2M2UA

Binary complex of african swine fever virus pol x with mgdgtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
total genus 45
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2uA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2uA01
4YCXA 5IIMA 4QZ8A 4UAZA 3OVBA 3MDAA 9ICOA 1UEUA 4RQ0A 3H38A 5DDMA 4P2HA 4KLSA 3H37A 4X4SA 3OV7A 2PXIA 5J0YA 5J2HA 3OGUA 1ZQEA 4M9NA 5D4BA 5J0RA 4RQ4A 3WFPA 4M04A 4X4RA 3LK9A 2DR9A 1MIYA 4K4HA 5J2GA 4UD5A 3B0YA 4I2CA 4KLEA 1ZQLA 2P66A 3JPOA 1YLQA 1ZQZA 4AT8B 5J0QA 2BCUA 2W9MA 3V7LA 2O5AA 5HHHA 3UPQA 2BCSA 4RWOA 9ICKA 4MFFA 8ICMA 5HRIA 4I2GA 4UB2A 5D49A 5BOMA 1ZQCA 4O5KA 5J0XA 2FMQA 4I27A 1ZQRA 9ICLA 3C2KA 2M2WA 1JN3A 4WC3A 2ZHBA 4FHPA 1F5AA 8ICZA 4F5PA 1ZQXA 4IQTA 3C5FA 3UXNA 3V7JA 9ICAA 5J0WA 4UBBA 9ICGA 9ICHA 4M9JA 7ICUA 4FO6A 2VANA 3RJEA 4I29A 3V72A 8ICRA 3ISDA 3NYBA 3RH5A 4YMNA 4LZDA 8ICTA 4M0AA 4RWPA 2PFOA 3L9DA 2IHMA 4NKTA 3C18A 4Z6DA 4IG8A 2O1PA 4WC4A 4WBYA 3C66A 1R89A 4KLOA 4NKUA 3UXOA 2ZH5A 4RQ7A 7ICKA 5DB6A 4PGQA 4I2IA 3JPNA 4EP7A 4RT2A 4PGYA 9ICSA 1ZQOA 4KLLA 4NY8A 8ICAA 1ZQPA 4X4PA 1FA0A 4F5NA 3HJ4A 9ICEA 1ZJNA 4AT7A 5HRDA 4KLQA 5DECA 5CA7A 4I2BA 4M2YA 4Z6FA 4WCWA 4RPZA 4UB4A 2M2VA 4PHDA 4O5CA 4X4OA 5HC9A 8ICLA 9ICTA 4WC1A 8ICIA 5HREA 2M2UA 7ICHA 3MBYA 5IIKA 2ZH4A 4AT9A 3HWTA 5CWRA 2BE3A 2ZH7A 3AUOA 1MIWA 3RJIA 4QZBA 5HRLA 3WFSC 2FMSA 1BPDA 3OVAA 7ICNA 4X5VA 4I2FA 3C5GA 1ZQGA 4NLZA 4I2EA 4QZFA 3OUYA 4DOAA 4XUSA 4FHYA 2ZH2A 3OVSA 4P4MA 8ICYA 4X4NA 4S3NA 2DRBA 4XQ7A 4I2AA 1ZQHA 2DR8A 4RQ2A 4TUPA 3V7KA 7ICSA 4KLIA 9ICNA 5CP2A 4GXKA 4K4IA 9ICQA 2RFFA 5HR9A 5TZVA 4P4OA 1UEVA 1RZTA 5J2EA 8ICFA 2I9GA 3JPQA 1HUZA 3B0XA 4WC0A 3GDXA 4UAYA 4KLFA 4UD4A 4O9MA 3HJ1A 4I2DA 4RQ5A 3MGHA 4WC6A 2ZH8A 2PFNA 7ICMA 4PHAA 4X4VA 9ICUA 2ISPA 9ICWA 9ICPA 1XSLA 4E8FA 4M9HA 5HRHA 5F2VO 5J0UA 2Q66A 8ICCA 2PBEA 1WOTA 4R63A 4JWMA 8ICSA 5EOZA 5DDYA 5D46A 5BOLA 4AT7B 4I2JA 3ISCA 3WFQE 1NO5A 4Z6CA 5J2DA 4GXJA 5DB8A 1ZQMA 4MF8A 9ICJA 2ZH6A 5DBAA 9ICFA 5J0TA 9ICCA 4O5EA 4AT9B 3H3AA 4R66A 4QZCA 4M9GA 4UB3A 3UQ2A 1XSNA 2FMPA 2ZHAA 5J2BA 3RJKA 4KLUA 4GXIA 7ICRA 2BPGA 1JMSA 3AQMA 4X4TA 4MFAA 3AQKA 5J2FA 2BCQA 4NM2A 4QZEA 4YN4A 3JPTA 3UQ0A 1ZQJA 4KLMA 1ZQWA 1VFGA 8ICJA 1Q78A 3LQCB 3OUYB 5CHGA 4WC5A 4MFCA 5J0PA 4EBKA 5CB1A 1ZQKA 4XA5A 2DRAA 8ICBA 7ICOA 3C2MA 1MQ3A 4QZAA 1NOMA 4X0AA 5HRGA 4F5OA 1ZQYA 4YD1A 2ZH9A 1BPEA 3C2LA 3AQNA 4PHPA 2ZH1A 4LVSA 1BPZA 5J2CA 5DEDA 1ZQIA 4WBZA 1ZQBA 4FH3A 4I28A 3AU2A 1BPBA 4TURA 4RPYA 2BCVA 3AU6A 8ICVA 4LT6A 4IQWA 3MGIA 3RJHA 8ICPA 3RH4A 2ZH3A 9ICVA 3WFOA 8ICUA 5CJ7A 5DB9A 4NLKA 8ICWA 4KLHA 1XSPA 5HHIA 7ICPA 7ICIA 5DBCA 4RWQA 5HRKA 4E7XA 3JZ0A 4RWNA 3UPSA 1ZQSA 8ICKA 8ICHA 1OU5A 1RPLA 1KDHA 2M2TA 3AQLA 5HRFA 5J0SA 4UB1A 4YMOA 2DVIA 3HW8A 5J2IA 1KNYA 4F5RA 5IIIA 1R8AA 1KEJA 7ICVA 1ZQVA 4M9LA 1JAJA 5IIOA 3HX0A 4IQUA 2PFQA 4FH5A 1ZQAA 7ICJA 1ZQNA 4DO9A 4DOBA 4XQ8A 1TVAA 1R8BA 3HIYA 2DR7A 4JWNA 1ZQUA 4RQ3A 4PGXA 5IILA 4TUQA 3RH6A 2NRKA 4YD2A 9ICMA 3WFRE 1JQRA 3PNCA 4LZGA 2BPCA 4RPXA 4PHEA 2BCRA 2HHPA 1PX5A 1TFYA 3RJFA 4ATBA 2DR5A 7ICQA 8ICGA 8ICQA 4TUSA 5J0OA 4KLJA 3RJGA 1UETA 4QZ9A 4K4GA 7ICFA 4YMMA 3JPSA 4QZIA 4PPXA 1R8CA 1ZQDA 5J2KA 3PMLA 4EBJA 2ISOA 4E80A 7ICLA 3TFSA 4QZHA 7ICGA 1TFWA 3MDCA 4KLDA 4R65A 4R64A 4M47A 4X4UA 4NM1A 4RQ8A 5IIJA 4MF2A 1BPXA 8ICEA 4DOCA 4NXZA 4FHWA 1MQ2A 5DB7A 1ZJMA 8ICXA 4RT3A 4FHVA 4AT8A 4FHXA 4P4PA 4X0BA 1VJ7A 5DKWA 4F5QA 9ICIA 5J2AA 3RJJA 1ZQTA 1V4AA 4PH5A 4NLNA 1ZQQA 4QZGA 1TV9A 4I2HA 5CR0A 1MIVA 3JPPA 3ISBA 2ID1A 1BPYA 7ICTA 3K75D 3H39A 4M5DA 8ICNA 5J2JA 2GWSA 9ICRA 3JPRA 2BPFA 4UB5A 5J29A 1Q79A 4QZDA 1HUOA 2PFPA 4RQ1A 9ICBA 9ICXA 3UXPA 7ICEA 4RQ6A 4X4QA 4XRHA 3JYYA 8ICOA 4KLGA 4IQVA 4UBCA 4WC2A 5DBBA 4WC7A 3TFRA 5BPCA 4ATBB 4Z6EA 3PMNA 4KLTA 4UAWA 1ZQFA 5HRBA 5IINA
chains in the Genus database with same CATH superfamily
4YCXA 5IIMA 4QZ8A 4UAZA 3OVBA 3MDAA 9ICOA 1UEUA 4RQ0A 3H38A 5DDMA 4P2HA 4KLSA 3H37A 4OAGA 5JTGA 4X4SA 3OV7A 2PXIA 5J0YA 5J2HA 3OGUA 3ERCC 1ZQEA 4M9NA 5D4BA 5J0RA 4RQ4A 3WFPA 4M04A 4X4RA 3LK9A 2DR9A 2GA9D 1MIYA 4K4HA 5J2GA 4UD5A 5CFUA 3B0YA 4I2CA 4KLEA 1ZQLA 2P66A 3JPOA 1YLQA 1ZQZA 4AT8B 5J0QA 2BCUA 2W9MA 3V7LA 2O5AA 5HHHA 3UPQA 2BCSA 4RWOA 9ICKA 4MFFA 8ICMA 5HRIA 4I2GA 4UB2A 5D49A 5BOMA 4O6AA 3ER9B 1ZQCA 4O5KA 5J0XA 2FMQA 4I27A 1ZQRA 9ICLA 3C2KA 2M2WA 1JN3A 4WC3A 2ZHBA 4FHPA 1F5AA 8ICZA 4F5PA 4WOYA 1ZQXA 4IQTA 3C5FA 3UXNA 3V7JA 9ICAA 5J0WA 2B51A 4OAHA 4UBBA 9ICGA 9ICHA 4M9JA 7ICUA 4FO6A 2VANA 3RJEA 4I29A 3V72A 8ICRA 3ISDA 3NYBA 3JCFA 3RH5A 4YMNA 4LZDA 8ICTA 4M0AA 4OAFA 4RWPA 4KB6A 2PFOA 3L9DA 2IHMA 4JLXA 4NKTA 3C18A 4Z6DA 4IG8A 2O1PA 4WC4A 4KM5A 4WBYA 3C66A 1R89A 4KLOA 4NKUA 3UXOA 2ZH5A 4RQ7A 3NWIA 7ICKA 5DB6A 4PGQA 4I2IA 2BBJA 3JPNA 4EP7A 4RT2A 4PGYA 9ICSA 1ZQOA 4KLLA 4NY8A 8ICAA 3ER8C 1ZQPA 4X4PA 1FA0A 4F5NA 3HJ4A 9ICEA 1ZJNA 4AT7A 5HRDA 4KLQA 5DECA 5CA7A 4I2BA 4M2YA 4Z6FA 4WCWA 4RPZA 4UB4A 2M2VA 4PHDA 4O5CA 4X4OA 5HC9A 8ICLA 9ICTA 4WC1A 8ICIA 2B56A 5HREA 2M2UA 7ICHA 3MBYA 5IIKA 2ZH4A 4AT9A 4K99A 4FO1A 3HWTA 5CWRA 2BE3A 4LEYA 2ZH7A 3AUOA 1MIWA 3RJIA 4QZBA 5HRLA 3WFSC 2FMSA 1BPDA 3OVAA 7ICNA 4X5VA 4I2FA 3C5GA 1ZQGA 4NLZA 4I2EA 4QZFA 3OUYA 4DOAA 4XUSA 4FHYA 2ZH2A 4LEZA 3OVSA 4P4MA 8ICYA 4X4NA 4S3NA 2DRBA 4XQ7A 4I2AA 1ZQHA 2DR8A 5D63A 4RQ2A 4TUPA 3V7KA 5CFSA 7ICSA 4KLIA 9ICNA 5CP2A 4GXKA 4K4IA 9ICQA 2RFFA 5HR9A 5TZVA 4P4OA 1UEVA 1RZTA 5J2EA 8ICFA 4OAIZ 2I9GA 3JPQA 1HUZA 3B0XA 4WC0A 3GDXA 4UAYA 4KLFA 4UD4A 4O9MA 3HJ1A 4I2DA 4RQ5A 3MGHA 4WC6A 2ZH8A 2PFNA 7ICMA 4PHAA 4X4VA 9ICUA 2ISPA 9ICWA 4K9AA 2EWRA 9ICPA 4XJEA 4HX0A 1XSLA 4E8FA 5B3PA 4M9HA 5HRHA 5F2VO 5J0UA 2Q66A 8ICCA 2IUBA 1WOTA 4R63A 2PBEA 4NXVA 4JWMA 8ICSA 5EOZA 5DDYA 5D46A 5BOLA 4AT7B 4I2JA 3ISCA 4N7RA 3WFQE 1NO5A 4Z6CA 5J2DA 4GXJA 5DB8A 1ZQMA 4MF8A 9ICJA 2FCLA 2ZH6A 5DBAA 9ICFA 5J0TA 9ICCA 4O5EA 4AT9B 3H3AA 4R66A 4QZCA 4M9GA 4UB3A 3UQ2A 1XSNA 2FMPA 2ZHAA 5J2BA 3RJKA 4KLUA 4EEDA 4GXIA 7ICRA 2BPGA 1JMSA 3AQMA 4X4TA 4MFAA 3AQKA 5J2FA 2BCQA 4NM2A 4QZEA 4YN4A 3JPTA 3UQ0A 1ZQJA 4KLMA 1ZQWA 1VFGA 8ICJA 1Q78A 3LQCB 3OUYB 5CHGA 4WC5A 4MFCA 5J0PA 4EBKA 5CB1A 1ZQKA 4XA5A 2DRAA 8ICBA 7ICOA 3C2MA 1MQ3A 4QZAA 1NOMA 4X0AA 5HRGA 4F5OA 1ZQYA 4YD1A 2ZH9A 1BPEA 3C2LA 3AQNA 4I0UA 4K8VA 4PHPA 2ZH1A 4LVSA 1BPZA 5J2CA 5DEDA 1ZQIA 4WBZA 1ZQBA 4FH3A 4I28A 4O69A 3AU2A 1BPBA 4TURA 4RPYA 2BCVA 3AU6A 8ICVA 4LT6A 4IQWA 3MGIA 3RJHA 8ICPA 1GPJA 3RH4A 2ZH3A 9ICVA 3WFOA 8ICUA 5CJ7A 5DB9A 4NLKA 8ICWA 4KLHA 1XSPA 4NXTA 5HHIA 7ICPA 2HN2A 7ICIA 5DBCA 4RWQA 5HRKA 3K7DA 4NXXA 4EV6A 4E7XA 4MKPA 3JZ0A 4RWNA 3UPSA 1ZQSA 8ICKA 3PHZA 8ICHA 1OU5A 1RPLA 1KDHA 2M2TA 3AQLA 5HRFA 5J0SA 4UB1A 4LEVA 4YMOA 2DVIA 3HW8A 5J2IA 1KNYA 4F5RA 5IIIA 1R8AA 1KEJA 4K96A 7ICVA 4EGWA 4EEBA 4JLZA 1ZQVA 4M9LA 1JAJA 5IIOA 5B3QA 3HX0A 4IQUA 2PFQA 2HN1A 4FH5A 4K9BA 3MCRA 1ZQAA 7ICJA 4WQKA 1ZQNA 2IHOA 4DO9A 4DOBA 4XQ8A 1TVAA 1R8BA 3HIYA 2DR7A 4JWNA 1ZQUA 4RQ3A 4PGXA 4LEWA 5IILA 4TUQA 3RH6A 2NRKA 4YD2A 9ICMA 3WFRE 1JQRA 3PNCA 4LZGA 2BPCA 4RPXA 4PHEA 2BCRA 2HHPA 1PX5A 1TFYA 3RJFA 4ATBA 2DR5A 7ICQA 8ICGA 8ICQA 4TUSA 5J0OA 4KLJA 2BBHA 3RJGA 1UETA 4K98A 4QZ9A 4K4GA 4O67A 7ICFA 3NVOA 4YMMA 3JPSA 4QZIA 4PPXA 1R8CA 1ZQDA 5CFTA 5J2KA 3PMLA 4EBJA 2ISOA 4E80A 7ICLA 3TFSA 4QZHA 7ICGA 1TFWA 3MDCA 4KLDA 4R65A 4R64A 4K97A 4M47A 4X4UA 2B4VA 4NM1A 4RQ8A 5IIJA 4MF2A 1BPXA 8ICEA 4DOCA 4NXZA 4FHWA 4O68A 1MQ2A 5DB7A 1ZJMA 8ICXA 2GAFD 4RT3A 4FHVA 4AT8A 4FHXA 3CK6A 3OWGA 3EF2A 4P4PA 4X0BA 1VJ7A 5DKWA 4F5QA 9ICIA 5J2AA 3RJJA 1ZQTA 4WQLA 1V4AA 4PH5A 4NLNA 1ZQQA 4QZGA 1TV9A 4I2HA 5CR0A 1MIVA 3NKUA 3JPPA 3ISBA 5D62A 2ID1A 1BPYA 7ICTA 3K75D 3H39A 4M5DA 8ICNA 4NXWA 5J2JA 2GWSA 9ICRA 3JPRA 2BPFA 4UB5A 4WH5A 4NXUA 5J29A 1Q79A 4QZDA 1HUOA 2PFPA 4RQ1A 9ICBA 9ICXA 5CHEA 3UXPA 7ICEA 4RQ6A 4X4QA 4XRHA 3JYYA 8ICOA 4KLGA 4IQVA 4UBCA 4WC2A 5DBBA 5D61A 4WC7A 3TFRA 5BPCA 4ATBB 4Z6EA 3PMNA 4KLTA 4UAWA 1ZQFA 5HRBA 5IINA
chains in the Genus database with same CATH topology
4YCXA 5IIMA 4QZ8A 4UAZA 3OVBA 3MDAA 9ICOA 1UEUA 4RQ0A 3H38A 5DDMA 4P2HA 4KLSA 3H37A 4X4SA 3OV7A 2PXIA 5J0YA 5J2HA 3OGUA 1ZQEA 4M9NA 5D4BA 5J0RA 4RQ4A 3WFPA 4M04A 4X4RA 3LK9A 2DR9A 1MIYA 4K4HA 5J2GA 4UD5A 3B0YA 4I2CA 4KLEA 1ZQLA 2P66A 3JPOA 1YLQA 1ZQZA 4AT8B 5J0QA 2BCUA 2W9MA 3V7LA 2O5AA 5HHHA 3UPQA 2BCSA 4RWOA 9ICKA 4MFFA 8ICMA 5HRIA 4I2GA 4UB2A 5D49A 5BOMA 1ZQCA 4O5KA 5J0XA 2FMQA 4I27A 1ZQRA 9ICLA 3C2KA 2M2WA 1JN3A 4WC3A 2ZHBA 4FHPA 1F5AA 8ICZA 4F5PA 1ZQXA 4IQTA 3C5FA 3UXNA 3V7JA 9ICAA 5J0WA 4UBBA 9ICGA 9ICHA 4M9JA 7ICUA 4FO6A 2VANA 3RJEA 4I29A 3V72A 8ICRA 3ISDA 3NYBA 3RH5A 4YMNA 4LZDA 8ICTA 4M0AA 4RWPA 2PFOA 3L9DA 2IHMA 4NKTA 3C18A 4Z6DA 4IG8A 2O1PA 4WC4A 4WBYA 3C66A 1R89A 4KLOA 4NKUA 3UXOA 2ZH5A 4RQ7A 7ICKA 5DB6A 4PGQA 4I2IA 3JPNA 4EP7A 4RT2A 4PGYA 9ICSA 1ZQOA 4KLLA 4NY8A 8ICAA 1ZQPA 4X4PA 1FA0A 4F5NA 3HJ4A 9ICEA 1ZJNA 4AT7A 5HRDA 4KLQA 5DECA 5CA7A 4I2BA 4M2YA 4Z6FA 4WCWA 4RPZA 4UB4A 2M2VA 4PHDA 4O5CA 4X4OA 5HC9A 8ICLA 9ICTA 4WC1A 8ICIA 5HREA 2M2UA 7ICHA 3MBYA 5IIKA 2ZH4A 4AT9A 3HWTA 5CWRA 2BE3A 2ZH7A 3AUOA 1MIWA 3RJIA 4QZBA 5HRLA 3WFSC 2FMSA 1BPDA 3OVAA 7ICNA 4X5VA 4I2FA 3C5GA 1ZQGA 4NLZA 4I2EA 4QZFA 3OUYA 4DOAA 4XUSA 4FHYA 2ZH2A 3OVSA 4P4MA 8ICYA 4X4NA 4S3NA 2DRBA 4XQ7A 4I2AA 1ZQHA 2DR8A 4RQ2A 4TUPA 3V7KA 7ICSA 4KLIA 9ICNA 5CP2A 4GXKA 4K4IA 9ICQA 2RFFA 5HR9A 5TZVA 4P4OA 1UEVA 1RZTA 5J2EA 8ICFA 2I9GA 3JPQA 1HUZA 3B0XA 4WC0A 3GDXA 4UAYA 4KLFA 4UD4A 4O9MA 3HJ1A 4I2DA 4RQ5A 3MGHA 4WC6A 2ZH8A 2PFNA 7ICMA 4PHAA 4X4VA 9ICUA 2ISPA 9ICWA 9ICPA 1XSLA 4E8FA 4M9HA 5HRHA 5F2VO 5J0UA 2Q66A 8ICCA 2PBEA 1WOTA 4R63A 4JWMA 8ICSA 5EOZA 5DDYA 5D46A 5BOLA 4AT7B 4I2JA 3ISCA 3WFQE 1NO5A 4Z6CA 5J2DA 4GXJA 5DB8A 1ZQMA 4MF8A 9ICJA 2ZH6A 5DBAA 9ICFA 5J0TA 9ICCA 4O5EA 4AT9B 3H3AA 4R66A 4QZCA 4M9GA 4UB3A 3UQ2A 1XSNA 2FMPA 2ZHAA 5J2BA 3RJKA 4KLUA 4GXIA 7ICRA 2BPGA 1JMSA 3AQMA 4X4TA 4MFAA 3AQKA 5J2FA 2BCQA 4NM2A 4QZEA 4YN4A 3JPTA 3UQ0A 1ZQJA 4KLMA 1ZQWA 1VFGA 8ICJA 1Q78A 3LQCB 3OUYB 5CHGA 4WC5A 4MFCA 5J0PA 4EBKA 5CB1A 1ZQKA 4XA5A 2DRAA 8ICBA 7ICOA 3C2MA 1MQ3A 4QZAA 1NOMA 4X0AA 5HRGA 4F5OA 1ZQYA 4YD1A 2ZH9A 1BPEA 3C2LA 3AQNA 4PHPA 2ZH1A 4LVSA 1BPZA 5J2CA 5DEDA 1ZQIA 4WBZA 1ZQBA 4FH3A 4I28A 3AU2A 1BPBA 4TURA 4RPYA 2BCVA 3AU6A 8ICVA 4LT6A 4IQWA 3MGIA 3RJHA 8ICPA 3RH4A 2ZH3A 9ICVA 3WFOA 8ICUA 5CJ7A 5DB9A 4NLKA 8ICWA 4KLHA 1XSPA 5HHIA 7ICPA 7ICIA 5DBCA 4RWQA 5HRKA 4E7XA 3JZ0A 4RWNA 3UPSA 1ZQSA 8ICKA 8ICHA 1OU5A 1RPLA 1KDHA 2M2TA 3AQLA 5HRFA 5J0SA 4UB1A 4YMOA 2DVIA 3HW8A 5J2IA 1KNYA 4F5RA 5IIIA 1R8AA 1KEJA 7ICVA 1ZQVA 4M9LA 1JAJA 5IIOA 3HX0A 4IQUA 2PFQA 4FH5A 1ZQAA 7ICJA 1ZQNA 4DO9A 4DOBA 4XQ8A 1TVAA 1R8BA 3HIYA 2DR7A 4JWNA 1ZQUA 4RQ3A 4PGXA 5IILA 4TUQA 3RH6A 2NRKA 4YD2A 9ICMA 3WFRE 1JQRA 3PNCA 4LZGA 2BPCA 4RPXA 4PHEA 2BCRA 2HHPA 1PX5A 1TFYA 3RJFA 4ATBA 2DR5A 7ICQA 8ICGA 8ICQA 4TUSA 5J0OA 4KLJA 3RJGA 1UETA 4QZ9A 4K4GA 7ICFA 4YMMA 3JPSA 4QZIA 4PPXA 1R8CA 1ZQDA 5J2KA 3PMLA 4EBJA 2ISOA 4E80A 7ICLA 3TFSA 4QZHA 7ICGA 1TFWA 3MDCA 4KLDA 4R65A 4R64A 4M47A 4X4UA 4NM1A 4RQ8A 5IIJA 4MF2A 1BPXA 8ICEA 4DOCA 4NXZA 4FHWA 1MQ2A 5DB7A 1ZJMA 8ICXA 4RT3A 4FHVA 4AT8A 4FHXA 4P4PA 4X0BA 1VJ7A 5DKWA 4F5QA 9ICIA 5J2AA 3RJJA 1ZQTA 1V4AA 4PH5A 4NLNA 1ZQQA 4QZGA 1TV9A 4I2HA 5CR0A 1MIVA 3JPPA 3ISBA 2ID1A 1BPYA 7ICTA 3K75D 3H39A 4M5DA 8ICNA 5J2JA 2GWSA 9ICRA 3JPRA 2BPFA 4UB5A 5J29A 1Q79A 4QZDA 1HUOA 2PFPA 4RQ1A 9ICBA 9ICXA 3UXPA 7ICEA 4RQ6A 4X4QA 4XRHA 3JYYA 8ICOA 4KLGA 4IQVA 4UBCA 4WC2A 5DBBA 4WC7A 3TFRA 5BPCA 4ATBB 4Z6EA 3PMNA 4KLTA 4UAWA 1ZQFA 5HRBA 5IINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCX A;  5IIM A;  4QZ8 A;  4UAZ A;  3OVB A;  3MDA A;  9ICO A;  1UEU A;  4RQ0 A;  3H38 A;  5DDM A;  4P2H A;  4KLS A;  3H37 A;  4X4S A;  3OV7 A;  2PXI A;  5J0Y A;  5J2H A;  3OGU A;  1ZQE A;  4M9N A;  5D4B A;  5J0R A;  4RQ4 A;  3WFP A;  4M04 A;  4X4R A;  3LK9 A;  2DR9 A;  1MIY A;  4K4H A;  5J2G A;  4UD5 A;  3B0Y A;  4I2C A;  4KLE A;  1ZQL A;  2P66 A;  3JPO A;  1YLQ A;  1ZQZ A;  4AT8 B;  5J0Q A;  2BCU A;  2W9M A;  3V7L A;  2O5A A;  5HHH A;  3UPQ A;  2BCS A;  4RWO A;  9ICK A;  4MFF A;  8ICM A;  5HRI A;  4I2G A;  4UB2 A;  5D49 A;  5BOM A;  1ZQC A;  4O5K A;  5J0X A;  2FMQ A;  4I27 A;  1ZQR A;  9ICL A;  3C2K A;  2M2W A;  1JN3 A;  4WC3 A;  2ZHB A;  4FHP A;  1F5A A;  8ICZ A;  4F5P A;  1ZQX A;  4IQT A;  3C5F A;  3UXN A;  3V7J A;  9ICA A;  5J0W A;  4UBB A;  9ICG A;  9ICH A;  4M9J A;  7ICU A;  4FO6 A;  2VAN A;  3RJE A;  4I29 A;  3V72 A;  8ICR A;  3ISD A;  3NYB A;  3RH5 A;  4YMN A;  4LZD A;  8ICT A;  4M0A A;  4RWP A;  2PFO A;  3L9D A;  2IHM A;  4NKT A;  3C18 A;  4Z6D A;  4IG8 A;  2O1P A;  4WC4 A;  4WBY A;  3C66 A;  1R89 A;  4KLO A;  4NKU A;  3UXO A;  2ZH5 A;  4RQ7 A;  7ICK A;  5DB6 A;  4PGQ A;  4I2I A;  3JPN A;  4EP7 A;  4RT2 A;  4PGY A;  9ICS A;  1ZQO A;  4KLL A;  4NY8 A;  8ICA A;  1ZQP A;  4X4P A;  1FA0 A;  4F5N A;  3HJ4 A;  9ICE A;  1ZJN A;  4AT7 A;  5HRD A;  4KLQ A;  5DEC A;  5CA7 A;  4I2B A;  4M2Y A;  4Z6F A;  4WCW A;  4RPZ A;  4UB4 A;  2M2V A;  4PHD A;  4O5C A;  4X4O A;  5HC9 A;  8ICL A;  9ICT A;  4WC1 A;  8ICI A;  5HRE A;  2M2U A;  7ICH A;  3MBY A;  5IIK A;  2ZH4 A;  4AT9 A;  3HWT A;  5CWR A;  2BE3 A;  2ZH7 A;  3AUO A;  1MIW A;  3RJI A;  4QZB A;  5HRL A;  3WFS C;  2FMS A;  1BPD A;  3OVA A;  7ICN A;  4X5V A;  4I2F A;  3C5G A;  1ZQG A;  4NLZ A;  4I2E A;  4QZF A;  3OUY A;  4DOA A;  4XUS A;  4FHY A;  2ZH2 A;  3OVS A;  4P4M A;  8ICY A;  4X4N A;  4S3N A;  2DRB A;  4XQ7 A;  4I2A A;  1ZQH A;  2DR8 A;  4RQ2 A;  4TUP A;  3V7K A;  7ICS A;  4KLI A;  9ICN A;  5CP2 A;  4GXK A;  4K4I A;  9ICQ A;  2RFF A;  5HR9 A;  5TZV A;  4P4O A;  1UEV A;  1RZT A;  5J2E A;  8ICF A;  2I9G A;  3JPQ A;  1HUZ A;  3B0X A;  4WC0 A;  3GDX A;  4UAY A;  4KLF A;  4UD4 A;  4O9M A;  3HJ1 A;  4I2D A;  4RQ5 A;  3MGH A;  4WC6 A;  2ZH8 A;  2PFN A;  7ICM A;  4PHA A;  4X4V A;  9ICU A;  2ISP A;  9ICW A;  9ICP A;  1XSL A;  4E8F A;  4M9H A;  5HRH A;  5F2V O;  5J0U A;  2Q66 A;  8ICC A;  2PBE A;  1WOT A;  4R63 A;  4JWM A;  8ICS A;  5EOZ A;  5DDY A;  5D46 A;  5BOL A;  4AT7 B;  4I2J A;  3ISC A;  3WFQ E;  1NO5 A;  4Z6C A;  5J2D A;  4GXJ A;  5DB8 A;  1ZQM A;  4MF8 A;  9ICJ A;  2ZH6 A;  5DBA A;  9ICF A;  5J0T A;  9ICC A;  4O5E A;  4AT9 B;  3H3A A;  4R66 A;  4QZC A;  4M9G A;  4UB3 A;  3UQ2 A;  1XSN A;  2FMP A;  2ZHA A;  5J2B A;  3RJK A;  4KLU A;  4GXI A;  7ICR A;  2BPG A;  1JMS A;  3AQM A;  4X4T A;  4MFA A;  3AQK A;  5J2F A;  2BCQ A;  4NM2 A;  4QZE A;  4YN4 A;  3JPT A;  3UQ0 A;  1ZQJ A;  4KLM A;  1ZQW A;  1VFG A;  8ICJ A;  1Q78 A;  3LQC B;  3OUY B;  5CHG A;  4WC5 A;  4MFC A;  5J0P A;  4EBK A;  5CB1 A;  1ZQK A;  4XA5 A;  2DRA A;  8ICB A;  7ICO A;  3C2M A;  1MQ3 A;  4QZA A;  1NOM A;  4X0A A;  5HRG A;  4F5O A;  1ZQY A;  4YD1 A;  2ZH9 A;  1BPE A;  3C2L A;  3AQN A;  4PHP A;  2ZH1 A;  4LVS A;  1BPZ A;  5J2C A;  5DED A;  1ZQI A;  4WBZ A;  1ZQB A;  4FH3 A;  4I28 A;  3AU2 A;  1BPB A;  4TUR A;  4RPY A;  2BCV A;  3AU6 A;  8ICV A;  4LT6 A;  4IQW A;  3MGI A;  3RJH A;  8ICP A;  3RH4 A;  2ZH3 A;  9ICV A;  3WFO A;  8ICU A;  5CJ7 A;  5DB9 A;  4NLK A;  8ICW A;  4KLH A;  1XSP A;  5HHI A;  7ICP A;  7ICI A;  5DBC A;  4RWQ A;  5HRK A;  4E7X A;  3JZ0 A;  4RWN A;  3UPS A;  1ZQS A;  8ICK A;  8ICH A;  1OU5 A;  1RPL A;  1KDH A;  2M2T A;  3AQL A;  5HRF A;  5J0S A;  4UB1 A;  4YMO A;  2DVI A;  3HW8 A;  5J2I A;  1KNY A;  4F5R A;  5III A;  1R8A A;  1KEJ A;  7ICV A;  1ZQV A;  4M9L A;  1JAJ A;  5IIO A;  3HX0 A;  4IQU A;  2PFQ A;  4FH5 A;  1ZQA A;  7ICJ A;  1ZQN A;  4DO9 A;  4DOB A;  4XQ8 A;  1TVA A;  1R8B A;  3HIY A;  2DR7 A;  4JWN A;  1ZQU A;  4RQ3 A;  4PGX A;  5IIL A;  4TUQ A;  3RH6 A;  2NRK A;  4YD2 A;  9ICM A;  3WFR E;  1JQR A;  3PNC A;  4LZG A;  2BPC A;  4RPX A;  4PHE A;  2BCR A;  2HHP A;  1PX5 A;  1TFY A;  3RJF A;  4ATB A;  2DR5 A;  7ICQ A;  8ICG A;  8ICQ A;  4TUS A;  5J0O A;  4KLJ A;  3RJG A;  1UET A;  4QZ9 A;  4K4G A;  7ICF A;  4YMM A;  3JPS A;  4QZI A;  4PPX A;  1R8C A;  1ZQD A;  5J2K A;  3PML A;  4EBJ A;  2ISO A;  4E80 A;  7ICL A;  3TFS A;  4QZH A;  7ICG A;  1TFW A;  3MDC A;  4KLD A;  4R65 A;  4R64 A;  4M47 A;  4X4U A;  4NM1 A;  4RQ8 A;  5IIJ A;  4MF2 A;  1BPX A;  8ICE A;  4DOC A;  4NXZ A;  4FHW A;  1MQ2 A;  5DB7 A;  1ZJM A;  8ICX A;  4RT3 A;  4FHV A;  4AT8 A;  4FHX A;  4P4P A;  4X0B A;  1VJ7 A;  5DKW A;  4F5Q A;  9ICI A;  5J2A A;  3RJJ A;  1ZQT A;  1V4A A;  4PH5 A;  4NLN A;  1ZQQ A;  4QZG A;  1TV9 A;  4I2H A;  5CR0 A;  1MIV A;  3JPP A;  3ISB A;  2ID1 A;  1BPY A;  7ICT A;  3K75 D;  3H39 A;  4M5D A;  8ICN A;  5J2J A;  2GWS A;  9ICR A;  3JPR A;  2BPF A;  4UB5 A;  5J29 A;  1Q79 A;  4QZD A;  1HUO A;  2PFP A;  4RQ1 A;  9ICB A;  9ICX A;  3UXP A;  7ICE A;  4RQ6 A;  4X4Q A;  4XRH A;  3JYY A;  8ICO A;  4KLG A;  4IQV A;  4UBC A;  4WC2 A;  5DBB A;  4WC7 A;  3TFR A;  5BPC A;  4ATB B;  4Z6E A;  3PMN A;  4KLT A;  4UAW A;  1ZQF A;  5HRB A;  5IIN A; 
#chains in the Genus database with same CATH topology
 4YCX A;  5IIM A;  4QZ8 A;  4UAZ A;  3OVB A;  3MDA A;  9ICO A;  1UEU A;  4RQ0 A;  3H38 A;  5DDM A;  4P2H A;  4KLS A;  3H37 A;  4OAG A;  5JTG A;  4X4S A;  3OV7 A;  2PXI A;  5J0Y A;  5J2H A;  3OGU A;  3ERC C;  1ZQE A;  4M9N A;  5D4B A;  5J0R A;  4RQ4 A;  3WFP A;  4M04 A;  4X4R A;  3LK9 A;  2DR9 A;  2GA9 D;  1MIY A;  4K4H A;  5J2G A;  4UD5 A;  5CFU A;  3B0Y A;  4I2C A;  4KLE A;  1ZQL A;  2P66 A;  3JPO A;  1YLQ A;  1ZQZ A;  4AT8 B;  5J0Q A;  2BCU A;  2W9M A;  3V7L A;  2O5A A;  5HHH A;  3UPQ A;  2BCS A;  4RWO A;  9ICK A;  4MFF A;  8ICM A;  5HRI A;  4I2G A;  4UB2 A;  5D49 A;  5BOM A;  4O6A A;  3ER9 B;  1ZQC A;  4O5K A;  5J0X A;  2FMQ A;  4I27 A;  1ZQR A;  9ICL A;  3C2K A;  2M2W A;  1JN3 A;  4WC3 A;  2ZHB A;  4FHP A;  1F5A A;  8ICZ A;  4F5P A;  4WOY A;  1ZQX A;  4IQT A;  3C5F A;  3UXN A;  3V7J A;  9ICA A;  5J0W A;  2B51 A;  4OAH A;  4UBB A;  9ICG A;  9ICH A;  4M9J A;  7ICU A;  4FO6 A;  2VAN A;  3RJE A;  4I29 A;  3V72 A;  8ICR A;  3ISD A;  3NYB A;  3JCF A;  3RH5 A;  4YMN A;  4LZD A;  8ICT A;  4M0A A;  4OAF A;  4RWP A;  4KB6 A;  2PFO A;  3L9D A;  2IHM A;  4JLX A;  4NKT A;  3C18 A;  4Z6D A;  4IG8 A;  2O1P A;  4WC4 A;  4KM5 A;  4WBY A;  3C66 A;  1R89 A;  4KLO A;  4NKU A;  3UXO A;  2ZH5 A;  4RQ7 A;  3NWI A;  7ICK A;  5DB6 A;  4PGQ A;  4I2I A;  2BBJ A;  3JPN A;  4EP7 A;  4RT2 A;  4PGY A;  9ICS A;  1ZQO A;  4KLL A;  4NY8 A;  8ICA A;  3ER8 C;  1ZQP A;  4X4P A;  1FA0 A;  4F5N A;  3HJ4 A;  9ICE A;  1ZJN A;  4AT7 A;  5HRD A;  4KLQ A;  5DEC A;  5CA7 A;  4I2B A;  4M2Y A;  4Z6F A;  4WCW A;  4RPZ A;  4UB4 A;  2M2V A;  4PHD A;  4O5C A;  4X4O A;  5HC9 A;  8ICL A;  9ICT A;  4WC1 A;  8ICI A;  2B56 A;  5HRE A;  2M2U A;  7ICH A;  3MBY A;  5IIK A;  2ZH4 A;  4AT9 A;  4K99 A;  4FO1 A;  3HWT A;  5CWR A;  2BE3 A;  4LEY A;  2ZH7 A;  3AUO A;  1MIW A;  3RJI A;  4QZB A;  5HRL A;  3WFS C;  2FMS A;  1BPD A;  3OVA A;  7ICN A;  4X5V A;  4I2F A;  3C5G A;  1ZQG A;  4NLZ A;  4I2E A;  4QZF A;  3OUY A;  4DOA A;  4XUS A;  4FHY A;  2ZH2 A;  4LEZ A;  3OVS A;  4P4M A;  8ICY A;  4X4N A;  4S3N A;  2DRB A;  4XQ7 A;  4I2A A;  1ZQH A;  2DR8 A;  5D63 A;  4RQ2 A;  4TUP A;  3V7K A;  5CFS A;  7ICS A;  4KLI A;  9ICN A;  5CP2 A;  4GXK A;  4K4I A;  9ICQ A;  2RFF A;  5HR9 A;  5TZV A;  4P4O A;  1UEV A;  1RZT A;  5J2E A;  8ICF A;  4OAI Z;  2I9G A;  3JPQ A;  1HUZ A;  3B0X A;  4WC0 A;  3GDX A;  4UAY A;  4KLF A;  4UD4 A;  4O9M A;  3HJ1 A;  4I2D A;  4RQ5 A;  3MGH A;  4WC6 A;  2ZH8 A;  2PFN A;  7ICM A;  4PHA A;  4X4V A;  9ICU A;  2ISP A;  9ICW A;  4K9A A;  2EWR A;  9ICP A;  4XJE A;  4HX0 A;  1XSL A;  4E8F A;  5B3P A;  4M9H A;  5HRH A;  5F2V O;  5J0U A;  2Q66 A;  8ICC A;  2IUB A;  1WOT A;  4R63 A;  2PBE A;  4NXV A;  4JWM A;  8ICS A;  5EOZ A;  5DDY A;  5D46 A;  5BOL A;  4AT7 B;  4I2J A;  3ISC A;  4N7R A;  3WFQ E;  1NO5 A;  4Z6C A;  5J2D A;  4GXJ A;  5DB8 A;  1ZQM A;  4MF8 A;  9ICJ A;  2FCL A;  2ZH6 A;  5DBA A;  9ICF A;  5J0T A;  9ICC A;  4O5E A;  4AT9 B;  3H3A A;  4R66 A;  4QZC A;  4M9G A;  4UB3 A;  3UQ2 A;  1XSN A;  2FMP A;  2ZHA A;  5J2B A;  3RJK A;  4KLU A;  4EED A;  4GXI A;  7ICR A;  2BPG A;  1JMS A;  3AQM A;  4X4T A;  4MFA A;  3AQK A;  5J2F A;  2BCQ A;  4NM2 A;  4QZE A;  4YN4 A;  3JPT A;  3UQ0 A;  1ZQJ A;  4KLM A;  1ZQW A;  1VFG A;  8ICJ A;  1Q78 A;  3LQC B;  3OUY B;  5CHG A;  4WC5 A;  4MFC A;  5J0P A;  4EBK A;  5CB1 A;  1ZQK A;  4XA5 A;  2DRA A;  8ICB A;  7ICO A;  3C2M A;  1MQ3 A;  4QZA A;  1NOM A;  4X0A A;  5HRG A;  4F5O A;  1ZQY A;  4YD1 A;  2ZH9 A;  1BPE A;  3C2L A;  3AQN A;  4I0U A;  4K8V A;  4PHP A;  2ZH1 A;  4LVS A;  1BPZ A;  5J2C A;  5DED A;  1ZQI A;  4WBZ A;  1ZQB A;  4FH3 A;  4I28 A;  4O69 A;  3AU2 A;  1BPB A;  4TUR A;  4RPY A;  2BCV A;  3AU6 A;  8ICV A;  4LT6 A;  4IQW A;  3MGI A;  3RJH A;  8ICP A;  1GPJ A;  3RH4 A;  2ZH3 A;  9ICV A;  3WFO A;  8ICU A;  5CJ7 A;  5DB9 A;  4NLK A;  8ICW A;  4KLH A;  1XSP A;  4NXT A;  5HHI A;  7ICP A;  2HN2 A;  7ICI A;  5DBC A;  4RWQ A;  5HRK A;  3K7D A;  4NXX A;  4EV6 A;  4E7X A;  4MKP A;  3JZ0 A;  4RWN A;  3UPS A;  1ZQS A;  8ICK A;  3PHZ A;  8ICH A;  1OU5 A;  1RPL A;  1KDH A;  2M2T A;  3AQL A;  5HRF A;  5J0S A;  4UB1 A;  4LEV A;  4YMO A;  2DVI A;  3HW8 A;  5J2I A;  1KNY A;  4F5R A;  5III A;  1R8A A;  1KEJ A;  4K96 A;  7ICV A;  4EGW A;  4EEB A;  4JLZ A;  1ZQV A;  4M9L A;  1JAJ A;  5IIO A;  5B3Q A;  3HX0 A;  4IQU A;  2PFQ A;  2HN1 A;  4FH5 A;  4K9B A;  3MCR A;  1ZQA A;  7ICJ A;  4WQK A;  1ZQN A;  2IHO A;  4DO9 A;  4DOB A;  4XQ8 A;  1TVA A;  1R8B A;  3HIY A;  2DR7 A;  4JWN A;  1ZQU A;  4RQ3 A;  4PGX A;  4LEW A;  5IIL A;  4TUQ A;  3RH6 A;  2NRK A;  4YD2 A;  9ICM A;  3WFR E;  1JQR A;  3PNC A;  4LZG A;  2BPC A;  4RPX A;  4PHE A;  2BCR A;  2HHP A;  1PX5 A;  1TFY A;  3RJF A;  4ATB A;  2DR5 A;  7ICQ A;  8ICG A;  8ICQ A;  4TUS A;  5J0O A;  4KLJ A;  2BBH A;  3RJG A;  1UET A;  4K98 A;  4QZ9 A;  4K4G A;  4O67 A;  7ICF A;  3NVO A;  4YMM A;  3JPS A;  4QZI A;  4PPX A;  1R8C A;  1ZQD A;  5CFT A;  5J2K A;  3PML A;  4EBJ A;  2ISO A;  4E80 A;  7ICL A;  3TFS A;  4QZH A;  7ICG A;  1TFW A;  3MDC A;  4KLD A;  4R65 A;  4R64 A;  4K97 A;  4M47 A;  4X4U A;  2B4V A;  4NM1 A;  4RQ8 A;  5IIJ A;  4MF2 A;  1BPX A;  8ICE A;  4DOC A;  4NXZ A;  4FHW A;  4O68 A;  1MQ2 A;  5DB7 A;  1ZJM A;  8ICX A;  2GAF D;  4RT3 A;  4FHV A;  4AT8 A;  4FHX A;  3CK6 A;  3OWG A;  3EF2 A;  4P4P A;  4X0B A;  1VJ7 A;  5DKW A;  4F5Q A;  9ICI A;  5J2A A;  3RJJ A;  1ZQT A;  4WQL A;  1V4A A;  4PH5 A;  4NLN A;  1ZQQ A;  4QZG A;  1TV9 A;  4I2H A;  5CR0 A;  1MIV A;  3NKU A;  3JPP A;  3ISB A;  5D62 A;  2ID1 A;  1BPY A;  7ICT A;  3K75 D;  3H39 A;  4M5D A;  8ICN A;  4NXW A;  5J2J A;  2GWS A;  9ICR A;  3JPR A;  2BPF A;  4UB5 A;  4WH5 A;  4NXU A;  5J29 A;  1Q79 A;  4QZD A;  1HUO A;  2PFP A;  4RQ1 A;  9ICB A;  9ICX A;  5CHE A;  3UXP A;  7ICE A;  4RQ6 A;  4X4Q A;  4XRH A;  3JYY A;  8ICO A;  4KLG A;  4IQV A;  4UBC A;  4WC2 A;  5DBB A;  5D61 A;  4WC7 A;  3TFR A;  5BPC A;  4ATB B;  4Z6E A;  3PMN A;  4KLT A;  4UAW A;  1ZQF A;  5HRB A;  5IIN A; 
#chains in the Genus database with same CATH homology
 4YCX A;  5IIM A;  4QZ8 A;  4UAZ A;  3OVB A;  3MDA A;  9ICO A;  1UEU A;  4RQ0 A;  3H38 A;  5DDM A;  4P2H A;  4KLS A;  3H37 A;  4X4S A;  3OV7 A;  2PXI A;  5J0Y A;  5J2H A;  3OGU A;  1ZQE A;  4M9N A;  5D4B A;  5J0R A;  4RQ4 A;  3WFP A;  4M04 A;  4X4R A;  3LK9 A;  2DR9 A;  1MIY A;  4K4H A;  5J2G A;  4UD5 A;  3B0Y A;  4I2C A;  4KLE A;  1ZQL A;  2P66 A;  3JPO A;  1YLQ A;  1ZQZ A;  4AT8 B;  5J0Q A;  2BCU A;  2W9M A;  3V7L A;  2O5A A;  5HHH A;  3UPQ A;  2BCS A;  4RWO A;  9ICK A;  4MFF A;  8ICM A;  5HRI A;  4I2G A;  4UB2 A;  5D49 A;  5BOM A;  1ZQC A;  4O5K A;  5J0X A;  2FMQ A;  4I27 A;  1ZQR A;  9ICL A;  3C2K A;  2M2W A;  1JN3 A;  4WC3 A;  2ZHB A;  4FHP A;  1F5A A;  8ICZ A;  4F5P A;  1ZQX A;  4IQT A;  3C5F A;  3UXN A;  3V7J A;  9ICA A;  5J0W A;  4UBB A;  9ICG A;  9ICH A;  4M9J A;  7ICU A;  4FO6 A;  2VAN A;  3RJE A;  4I29 A;  3V72 A;  8ICR A;  3ISD A;  3NYB A;  3RH5 A;  4YMN A;  4LZD A;  8ICT A;  4M0A A;  4RWP A;  2PFO A;  3L9D A;  2IHM A;  4NKT A;  3C18 A;  4Z6D A;  4IG8 A;  2O1P A;  4WC4 A;  4WBY A;  3C66 A;  1R89 A;  4KLO A;  4NKU A;  3UXO A;  2ZH5 A;  4RQ7 A;  7ICK A;  5DB6 A;  4PGQ A;  4I2I A;  3JPN A;  4EP7 A;  4RT2 A;  4PGY A;  9ICS A;  1ZQO A;  4KLL A;  4NY8 A;  8ICA A;  1ZQP A;  4X4P A;  1FA0 A;  4F5N A;  3HJ4 A;  9ICE A;  1ZJN A;  4AT7 A;  5HRD A;  4KLQ A;  5DEC A;  5CA7 A;  4I2B A;  4M2Y A;  4Z6F A;  4WCW A;  4RPZ A;  4UB4 A;  2M2V A;  4PHD A;  4O5C A;  4X4O A;  5HC9 A;  8ICL A;  9ICT A;  4WC1 A;  8ICI A;  5HRE A;  2M2U A;  7ICH A;  3MBY A;  5IIK A;  2ZH4 A;  4AT9 A;  3HWT A;  5CWR A;  2BE3 A;  2ZH7 A;  3AUO A;  1MIW A;  3RJI A;  4QZB A;  5HRL A;  3WFS C;  2FMS A;  1BPD A;  3OVA A;  7ICN A;  4X5V A;  4I2F A;  3C5G A;  1ZQG A;  4NLZ A;  4I2E A;  4QZF A;  3OUY A;  4DOA A;  4XUS A;  4FHY A;  2ZH2 A;  3OVS A;  4P4M A;  8ICY A;  4X4N A;  4S3N A;  2DRB A;  4XQ7 A;  4I2A A;  1ZQH A;  2DR8 A;  4RQ2 A;  4TUP A;  3V7K A;  7ICS A;  4KLI A;  9ICN A;  5CP2 A;  4GXK A;  4K4I A;  9ICQ A;  2RFF A;  5HR9 A;  5TZV A;  4P4O A;  1UEV A;  1RZT A;  5J2E A;  8ICF A;  2I9G A;  3JPQ A;  1HUZ A;  3B0X A;  4WC0 A;  3GDX A;  4UAY A;  4KLF A;  4UD4 A;  4O9M A;  3HJ1 A;  4I2D A;  4RQ5 A;  3MGH A;  4WC6 A;  2ZH8 A;  2PFN A;  7ICM A;  4PHA A;  4X4V A;  9ICU A;  2ISP A;  9ICW A;  9ICP A;  1XSL A;  4E8F A;  4M9H A;  5HRH A;  5F2V O;  5J0U A;  2Q66 A;  8ICC A;  2PBE A;  1WOT A;  4R63 A;  4JWM A;  8ICS A;  5EOZ A;  5DDY A;  5D46 A;  5BOL A;  4AT7 B;  4I2J A;  3ISC A;  3WFQ E;  1NO5 A;  4Z6C A;  5J2D A;  4GXJ A;  5DB8 A;  1ZQM A;  4MF8 A;  9ICJ A;  2ZH6 A;  5DBA A;  9ICF A;  5J0T A;  9ICC A;  4O5E A;  4AT9 B;  3H3A A;  4R66 A;  4QZC A;  4M9G A;  4UB3 A;  3UQ2 A;  1XSN A;  2FMP A;  2ZHA A;  5J2B A;  3RJK A;  4KLU A;  4GXI A;  7ICR A;  2BPG A;  1JMS A;  3AQM A;  4X4T A;  4MFA A;  3AQK A;  5J2F A;  2BCQ A;  4NM2 A;  4QZE A;  4YN4 A;  3JPT A;  3UQ0 A;  1ZQJ A;  4KLM A;  1ZQW A;  1VFG A;  8ICJ A;  1Q78 A;  3LQC B;  3OUY B;  5CHG A;  4WC5 A;  4MFC A;  5J0P A;  4EBK A;  5CB1 A;  1ZQK A;  4XA5 A;  2DRA A;  8ICB A;  7ICO A;  3C2M A;  1MQ3 A;  4QZA A;  1NOM A;  4X0A A;  5HRG A;  4F5O A;  1ZQY A;  4YD1 A;  2ZH9 A;  1BPE A;  3C2L A;  3AQN A;  4PHP A;  2ZH1 A;  4LVS A;  1BPZ A;  5J2C A;  5DED A;  1ZQI A;  4WBZ A;  1ZQB A;  4FH3 A;  4I28 A;  3AU2 A;  1BPB A;  4TUR A;  4RPY A;  2BCV A;  3AU6 A;  8ICV A;  4LT6 A;  4IQW A;  3MGI A;  3RJH A;  8ICP A;  3RH4 A;  2ZH3 A;  9ICV A;  3WFO A;  8ICU A;  5CJ7 A;  5DB9 A;  4NLK A;  8ICW A;  4KLH A;  1XSP A;  5HHI A;  7ICP A;  7ICI A;  5DBC A;  4RWQ A;  5HRK A;  4E7X A;  3JZ0 A;  4RWN A;  3UPS A;  1ZQS A;  8ICK A;  8ICH A;  1OU5 A;  1RPL A;  1KDH A;  2M2T A;  3AQL A;  5HRF A;  5J0S A;  4UB1 A;  4YMO A;  2DVI A;  3HW8 A;  5J2I A;  1KNY A;  4F5R A;  5III A;  1R8A A;  1KEJ A;  7ICV A;  1ZQV A;  4M9L A;  1JAJ A;  5IIO A;  3HX0 A;  4IQU A;  2PFQ A;  4FH5 A;  1ZQA A;  7ICJ A;  1ZQN A;  4DO9 A;  4DOB A;  4XQ8 A;  1TVA A;  1R8B A;  3HIY A;  2DR7 A;  4JWN A;  1ZQU A;  4RQ3 A;  4PGX A;  5IIL A;  4TUQ A;  3RH6 A;  2NRK A;  4YD2 A;  9ICM A;  3WFR E;  1JQR A;  3PNC A;  4LZG A;  2BPC A;  4RPX A;  4PHE A;  2BCR A;  2HHP A;  1PX5 A;  1TFY A;  3RJF A;  4ATB A;  2DR5 A;  7ICQ A;  8ICG A;  8ICQ A;  4TUS A;  5J0O A;  4KLJ A;  3RJG A;  1UET A;  4QZ9 A;  4K4G A;  7ICF A;  4YMM A;  3JPS A;  4QZI A;  4PPX A;  1R8C A;  1ZQD A;  5J2K A;  3PML A;  4EBJ A;  2ISO A;  4E80 A;  7ICL A;  3TFS A;  4QZH A;  7ICG A;  1TFW A;  3MDC A;  4KLD A;  4R65 A;  4R64 A;  4M47 A;  4X4U A;  4NM1 A;  4RQ8 A;  5IIJ A;  4MF2 A;  1BPX A;  8ICE A;  4DOC A;  4NXZ A;  4FHW A;  1MQ2 A;  5DB7 A;  1ZJM A;  8ICX A;  4RT3 A;  4FHV A;  4AT8 A;  4FHX A;  4P4P A;  4X0B A;  1VJ7 A;  5DKW A;  4F5Q A;  9ICI A;  5J2A A;  3RJJ A;  1ZQT A;  1V4A A;  4PH5 A;  4NLN A;  1ZQQ A;  4QZG A;  1TV9 A;  4I2H A;  5CR0 A;  1MIV A;  3JPP A;  3ISB A;  2ID1 A;  1BPY A;  7ICT A;  3K75 D;  3H39 A;  4M5D A;  8ICN A;  5J2J A;  2GWS A;  9ICR A;  3JPR A;  2BPF A;  4UB5 A;  5J29 A;  1Q79 A;  4QZD A;  1HUO A;  2PFP A;  4RQ1 A;  9ICB A;  9ICX A;  3UXP A;  7ICE A;  4RQ6 A;  4X4Q A;  4XRH A;  3JYY A;  8ICO A;  4KLG A;  4IQV A;  4UBC A;  4WC2 A;  5DBB A;  4WC7 A;  3TFR A;  5BPC A;  4ATB B;  4Z6E A;  3PMN A;  4KLT A;  4UAW A;  1ZQF A;  5HRB A;  5IIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...