2M2UA

Binary complex of african swine fever virus pol x with mgdgtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
b'MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
total genus 45
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2uA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2uA01
4KLGA 3RJHA 4I2JA 4I2EA 3NYBA 3C18A 2M2TA 4X4VA 4E8FA 3MDAA 1ZQKA 4I2CA 4M9NA 4NLZA 3RJGA 3B0YA 3AUOA 7ICGA 2O1PA 4GXKA 5J0PA 1ZQMA 4UB1A 9ICVA 5J2HA 5CR0A 5D4BA 4UAZA 4R66A 8ICMA 5J0WA 3H3AA 1ZQCA 4FHWA 5BOMA 3C2LA 2IHMA 4X4NA 2M2WA 3OVBA 4QZAA 4I2AA 7ICLA 5DEDA 4NXZA 5CHGA 5IINA 9ICUA 5J2FA 4WC6A 2ISPA 5J0QA 4X4SA 8ICAA 5HRLA 4WBZA 7ICKA 2DRBA 4F5RA 3OUYA 4QZHA 4DOCA 5J2EA 3AU2A 2BPGA 3LK9A 5IIOA 1ZQAA 1ZQWA 3MGIA 4QZ9A 4GXJA 5F2VO 1MIYA 4NKUA 4RT2A 4F5PA 3PMNA 4KLOA 8ICWA 4MFFA 4FO6A 5J2BA 4R64A 1BPEA 1NOMA 5HR9A 9ICEA 1R8BA 3JZ0A 5CP2A 4NLNA 4E80A 9ICGA 4IQUA 1ZQTA 4RWQA 8ICUA 7ICQA 4WC7A 4RQ3A 5DKWA 3H38A 9ICCA 4AT9B 5HRDA 3V7JA 4M9GA 4EP7A 1NO5A 3AQNA 8ICHA 5HRFA 9ICXA 4F5NA 4I2IA 8ICCA 4YD1A 2NRKA 5J2DA 4MF8A 4FHXA 4RPXA 4AT8A 4O5KA 9ICNA 4QZFA 5D46A 4NM1A 2ZH5A 4UB2A 3AU6A 5HC9A 4X4UA 5IIKA 9ICJA 4AT7B 4RWPA 5J2IA 8ICQA 3HWTA 4ATBB 4RQ8A 3MGHA 4X0AA 4KLTA 5IILA 2PFQA 3WFQE 8ICOA 7ICIA 2ZHAA 4PHPA 2BCRA 3C2KA 1TV9A 7ICSA 5EOZA 3RJIA 1XSNA 5DBBA 1ZQUA 1ZJNA 1ZQQA 4KLFA 2DR8A 5HRIA 3UXOA 2BPCA 4Z6EA 1MIVA 4PHAA 2PFOA 4YD2A 5DECA 4UBCA 3RH5A 2M2VA 4UAYA 7ICNA 1Q78A 1TVAA 4RQ6A 3PNCA 5HRHA 5DB9A 3HJ4A 1ZQXA 3UPSA 2ZH8A 3JYYA 4RQ1A 3JPSA 1ZQPA 4RQ4A 4O5EA 3UQ2A 7ICVA 3LQCB 4KLUA 1TFYA 8ICTA 3C5FA 4EBKA 3RJEA 4LZDA 5DDMA 9ICBA 4X4QA 8ICEA 5DDYA 1ZQBA 4QZ8A 8ICSA 1ZQOA 5J2GA 5IIIA 2PFNA 1JN3A 2BCSA 4NLKA 2DVIA 4FHVA 5D49A 4FHYA 1VJ7A 1BPYA 5HHHA 5CJ7A 4FH3A 1KEJA 4F5QA 5J2AA 2BCUA 8ICBA 3JPPA 4X4TA 4M9JA 2DRAA 4DOAA 4E7XA 9ICSA 4I2HA 3ISDA 1Q79A 1UEUA 4YMNA 4O9MA 3K75D 4JWNA 3B0XA 4M2YA 4MFCA 7ICOA 3OGUA 9ICFA 9ICMA 2ZH9A 8ICVA 3C2MA 7ICMA 8ICXA 2BE3A 3RJJA 2BCQA 4P4PA 4RPZA 5J0SA 3C66A 5DBCA 3AQKA 4FH5A 9ICPA 4I2GA 2HHPA 2VANA 4RQ5A 2FMPA 3V72A 9ICAA 4IQVA 4KLIA 4FHPA 1BPBA 4RT3A 8ICFA 1KDHA 1FA0A 7ICRA 2ID1A 4WC1A 2ZH1A 5IIJA 1JAJA 1MQ2A 1ZQEA 1XSPA 3RJKA 9ICIA 7ICFA 3OVAA 7ICEA 4I2DA 1JMSA 4RQ2A 3OV7A 2ZH6A 9ICOA 4AT7A 4WC0A 1ZQIA 4UB3A 1MQ3A 4P2HA 1ZJMA 5HRKA 4ATBA 8ICGA 1BPXA 3RH4A 4PH5A 5HREA 2ZH3A 4XUSA 4I27A 3JPOA 4M47A 4M0AA 3WFPA 2W9MA 4YCXA 5BPCA 1R89A 4I29A 5J0TA 1ZQSA 2ISOA 1RZTA 8ICRA 1V4AA 9ICTA 3V7KA 1KNYA 7ICPA 2BPFA 4UD4A 3HIYA 3V7LA 2ZH4A 4UAWA 3MDCA 4RQ7A 8ICIA 3UXNA 4KLLA 4PGXA 4KLMA 4QZGA 3MBYA 4X5VA 4Z6DA 4K4IA 5DB8A 8ICZA 3L9DA 3OVSA 4XA5A 4PHDA 2PFPA 2DR5A 3ISCA 3H37A 1ZQGA 1ZQFA 4MFAA 3C5GA 5DB6A 4S3NA 1VFGA 3JPNA 2M2UA 4UBBA 4KLDA 3UPQA 1WOTA 8ICLA 4I2FA 4O5CA 1ZQNA 3UQ0A 4P4MA 2FMSA 4TURA 4KLEA 3RH6A 4I2BA 4F5OA 4QZEA 4TUQA 9ICHA 4M9HA 4QZIA 4NM2A 5J0UA 4WCWA 1MIWA 4WC2A 5TZVA 4K4GA 5DBAA 4RWOA 5J0YA 1ZQYA 1XSLA 4M04A 5DB7A 4GXIA 4Z6FA 7ICUA 5CA7A 1UETA 1HUZA 4JWMA 4DO9A 1BPZA 2I9GA 3JPRA 4IQTA 4UB5A 4TUSA 4YN4A 3H39A 5J2KA 4LZGA 1JQRA 1ZQVA 1R8CA 5HHIA 4YMOA 3WFRE 3UXPA 4IG8A 4Z6CA 4NKTA 4KLHA 2ZH7A 4PGQA 4XQ7A 5CB1A 5CWRA 2P66A 4QZDA 4EBJA 7ICTA 5J0XA 4M9LA 3HX0A 1ZQJA 4PPXA 3OUYB 4RQ0A 9ICWA 4X4PA 3GDXA 5BOLA 4AT9A 1OU5A 4X0BA 1R8AA 9ICLA 8ICJA 4QZBA 1PX5A 1ZQRA 4WC5A 4P4OA 5HRBA 4RPYA 5J2JA 9ICRA 4WBYA 4M5DA 3PMLA 2BCVA 2DR7A 4X4OA 1ZQLA 1F5AA 4LT6A 3JPQA 5J2CA 2PXIA 4LVSA 4PHEA 3TFSA 2DR9A 4DOBA 4UB4A 1ZQZA 1ZQDA 3HJ1A 1UEVA 2O5AA 4R65A 3RJFA 3WFOA 5J29A 4RWNA 2GWSA 8ICNA 7ICHA 2FMQA 2ZH2A 1HUOA 2RFFA 4WC3A 3ISBA 5HRGA 1ZQHA 2ZHBA 2PBEA 5IIMA 4KLQA 4X4RA 4AT8B 1TFWA 8ICPA 4XRHA 4TUPA 4I28A 5J0RA 9ICKA 3AQLA 3TFRA 4UD5A 4KLJA 1RPLA 4WC4A 4YMMA 8ICYA 4IQWA 3HW8A 4XQ8A 4NY8A 4KLSA 4QZCA 3JPTA 4MF2A 4K4HA 1YLQA 4R63A 3AQMA 7ICJA 8ICKA 2Q66A 9ICQA 5J0OA 3WFSC 4PGYA 1BPDA
chains in the Genus database with same CATH superfamily
4KLGA 3RJHA 4I2JA 4I2EA 3NYBA 5CFSA 3C18A 2M2TA 3ER8C 4X4VA 4E8FA 3MDAA 1ZQKA 4I2CA 4M9NA 3CK6A 4NLZA 3RJGA 3PHZA 3B0YA 3AUOA 7ICGA 2O1PA 4GXKA 5J0PA 2BBHA 1ZQMA 4UB1A 9ICVA 5J2HA 5CR0A 5D4BA 4UAZA 4R66A 8ICMA 5J0WA 3H3AA 1ZQCA 4FHWA 3OWGA 5BOMA 3C2LA 2IHMA 4X4NA 2M2WA 3OVBA 4QZAA 4I2AA 7ICLA 5DEDA 4NXZA 5CHEA 5CHGA 5D63A 1GPJA 5IINA 3K7DA 9ICUA 5J2FA 4WC6A 2ISPA 5J0QA 4X4SA 8ICAA 5HRLA 4WBZA 7ICKA 2DRBA 4F5RA 3OUYA 4QZHA 4DOCA 5J2EA 3AU2A 2BPGA 3LK9A 5IIOA 2B56A 1ZQAA 4OAFA 1ZQWA 3MGIA 4QZ9A 4GXJA 5F2VO 1MIYA 4WOYA 4NKUA 4RT2A 4F5PA 3PMNA 4KLOA 8ICWA 4MFFA 4NXUA 2FCLA 4O67A 4FO6A 5J2BA 4R64A 1BPEA 5D62A 1NOMA 5HR9A 9ICEA 1R8BA 3JZ0A 5CP2A 4NLNA 4E80A 9ICGA 4IQUA 1ZQTA 4RWQA 4LEZA 8ICUA 7ICQA 4WC7A 4RQ3A 5DKWA 3H38A 9ICCA 4AT9B 5HRDA 3V7JA 4M9GA 4EP7A 1NO5A 3AQNA 8ICHA 5HRFA 9ICXA 5B3PA 4F5NA 4I2IA 8ICCA 4YD1A 2NRKA 5J2DA 4MF8A 4FHXA 4RPXA 4AT8A 4O5KA 9ICNA 4QZFA 5D46A 4NM1A 2ZH5A 4UB2A 3AU6A 5HC9A 4X4UA 5IIKA 9ICJA 4AT7B 4RWPA 5J2IA 8ICQA 3HWTA 4ATBB 4RQ8A 3MGHA 4OAHA 4X0AA 4KLTA 5IILA 2PFQA 3WFQE 8ICOA 7ICIA 2ZHAA 4WQKA 4PHPA 2BCRA 4HX0A 3C2KA 1TV9A 7ICSA 5EOZA 3RJIA 1XSNA 5DBBA 1ZQUA 1ZJNA 1ZQQA 4KLFA 2DR8A 4NXTA 5HRIA 3UXOA 2BPCA 4WH5A 4Z6EA 1MIVA 4PHAA 2PFOA 5CFUA 4YD2A 5DECA 4UBCA 3RH5A 2M2VA 4UAYA 7ICNA 1Q78A 1TVAA 4RQ6A 3PNCA 5HRHA 5DB9A 3HJ4A 4LEWA 1ZQXA 3UPSA 2ZH8A 3JYYA 4RQ1A 3JPSA 1ZQPA 4RQ4A 4O5EA 3UQ2A 4O69A 7ICVA 3LQCB 4KLUA 1TFYA 8ICTA 3C5FA 4EBKA 3RJEA 4LZDA 5DDMA 9ICBA 4X4QA 8ICEA 5DDYA 1ZQBA 4QZ8A 8ICSA 1ZQOA 5J2GA 5IIIA 2PFNA 1JN3A 2BCSA 4NLKA 4NXWA 2DVIA 4FHVA 4K98A 5D49A 4FHYA 2B51A 1VJ7A 1BPYA 5HHHA 5CJ7A 4FH3A 1KEJA 4F5QA 5J2AA 2BCUA 8ICBA 3JPPA 4NXVA 4X4TA 4M9JA 2DRAA 4DOAA 4E7XA 9ICSA 4I2HA 3ISDA 1Q79A 1UEUA 4YMNA 4O9MA 3K75D 4JWNA 3B0XA 4M2YA 4MFCA 4O68A 7ICOA 4WQLA 3OGUA 9ICFA 9ICMA 2ZH9A 8ICVA 3C2MA 7ICMA 8ICXA 2BE3A 3RJJA 2BCQA 4P4PA 4OAIZ 4RPZA 5J0SA 3C66A 5DBCA 4OAGA 3AQKA 4FH5A 2B4VA 2EWRA 9ICPA 4I2GA 2HHPA 2VANA 4RQ5A 2FMPA 3V72A 9ICAA 4IQVA 4KLIA 4FHPA 1BPBA 4RT3A 8ICFA 1KDHA 1FA0A 7ICRA 2ID1A 4WC1A 2ZH1A 5IIJA 1JAJA 1MQ2A 1ZQEA 1XSPA 3RJKA 9ICIA 7ICFA 3OVAA 7ICEA 4I2DA 1JMSA 4RQ2A 3OV7A 2ZH6A 9ICOA 4AT7A 4WC0A 4EV6A 1ZQIA 2GA9D 4UB3A 1MQ3A 4P2HA 1ZJMA 5HRKA 4XJEA 4ATBA 8ICGA 1BPXA 2IUBA 3RH4A 4PH5A 5HREA 2ZH3A 4XUSA 4I27A 3JPOA 4M47A 4M0AA 3WFPA 2W9MA 5CFTA 4YCXA 4FO1A 4MKPA 5BPCA 1R89A 4I29A 5J0TA 1ZQSA 2ISOA 1RZTA 4N7RA 8ICRA 1V4AA 9ICTA 3V7KA 3NVOA 1KNYA 7ICPA 2BPFA 4UD4A 3HIYA 3V7LA 2ZH4A 4UAWA 3MDCA 4RQ7A 8ICIA 3UXNA 4KLLA 2HN1A 4PGXA 4EEBA 4KLMA 4QZGA 3MBYA 4X5VA 4Z6DA 4K4IA 3EF2A 5DB8A 2GAFD 8ICZA 3L9DA 3OVSA 4XA5A 4K9AA 4PHDA 2PFPA 2DR5A 3ISCA 3H37A 4KB6A 1ZQGA 1ZQFA 4MFAA 3C5GA 5DB6A 4S3NA 1VFGA 3JPNA 4K9BA 2M2UA 2BBJA 4UBBA 4KLDA 3UPQA 1WOTA 8ICLA 4LEYA 4I2FA 4O5CA 1ZQNA 3UQ0A 4P4MA 2FMSA 4TURA 4KLEA 3RH6A 4EEDA 3ERCC 4I2BA 4O6AA 4F5OA 4QZEA 4TUQA 9ICHA 4M9HA 4QZIA 4NM2A 5J0UA 4WCWA 1MIWA 4WC2A 3JCFA 5TZVA 4K4GA 5DBAA 4RWOA 5J0YA 1ZQYA 1XSLA 4M04A 5DB7A 4GXIA 4Z6FA 7ICUA 5CA7A 4NXXA 1UETA 1HUZA 4JWMA 4DO9A 1BPZA 2I9GA 3JPRA 4IQTA 4UB5A 4TUSA 4YN4A 3H39A 5J2KA 4LZGA 1JQRA 1ZQVA 1R8CA 4KM5A 5HHIA 4YMOA 3ER9B 3WFRE 3UXPA 4IG8A 4Z6CA 4NKTA 4KLHA 2ZH7A 4PGQA 4XQ7A 5CB1A 5CWRA 2P66A 4QZDA 4EBJA 4JLZA 7ICTA 5J0XA 4M9LA 4I0UA 3HX0A 1ZQJA 4PPXA 4EGWA 3OUYB 4RQ0A 3NKUA 9ICWA 4X4PA 3GDXA 5BOLA 4AT9A 1OU5A 4X0BA 1R8AA 9ICLA 8ICJA 4K97A 4QZBA 1PX5A 1ZQRA 4WC5A 4P4OA 5HRBA 2IHOA 4RPYA 5J2JA 5JTGA 4K99A 9ICRA 4WBYA 4K96A 4M5DA 3PMLA 2BCVA 2DR7A 4X4OA 1ZQLA 1F5AA 4LT6A 3JPQA 5J2CA 2PXIA 4LVSA 4PHEA 3TFSA 2DR9A 5B3QA 4K8VA 4DOBA 4UB4A 1ZQZA 1ZQDA 3HJ1A 1UEVA 3MCRA 2HN2A 2O5AA 4R65A 5D61A 3RJFA 3WFOA 5J29A 4RWNA 2GWSA 8ICNA 7ICHA 2FMQA 2ZH2A 1HUOA 2RFFA 4WC3A 3ISBA 5HRGA 1ZQHA 2ZHBA 2PBEA 5IIMA 4KLQA 4X4RA 4AT8B 1TFWA 8ICPA 4XRHA 4TUPA 4I28A 5J0RA 9ICKA 3AQLA 3TFRA 4UD5A 4KLJA 1RPLA 4WC4A 4LEVA 4YMMA 8ICYA 4IQWA 3HW8A 4XQ8A 3NWIA 4NY8A 4KLSA 4QZCA 3JPTA 4MF2A 4K4HA 1YLQA 4R63A 3AQMA 7ICJA 8ICKA 2Q66A 4JLXA 9ICQA 5J0OA 3WFSC 4PGYA 1BPDA
chains in the Genus database with same CATH topology
4KLGA 3RJHA 4I2JA 4I2EA 3NYBA 3C18A 2M2TA 4X4VA 4E8FA 3MDAA 1ZQKA 4I2CA 4M9NA 4NLZA 3RJGA 3B0YA 3AUOA 7ICGA 2O1PA 4GXKA 5J0PA 1ZQMA 4UB1A 9ICVA 5J2HA 5CR0A 5D4BA 4UAZA 4R66A 8ICMA 5J0WA 3H3AA 1ZQCA 4FHWA 5BOMA 3C2LA 2IHMA 4X4NA 2M2WA 3OVBA 4QZAA 4I2AA 7ICLA 5DEDA 4NXZA 5CHGA 5IINA 9ICUA 5J2FA 4WC6A 2ISPA 5J0QA 4X4SA 8ICAA 5HRLA 4WBZA 7ICKA 2DRBA 4F5RA 3OUYA 4QZHA 4DOCA 5J2EA 3AU2A 2BPGA 3LK9A 5IIOA 1ZQAA 1ZQWA 3MGIA 4QZ9A 4GXJA 5F2VO 1MIYA 4NKUA 4RT2A 4F5PA 3PMNA 4KLOA 8ICWA 4MFFA 4FO6A 5J2BA 4R64A 1BPEA 1NOMA 5HR9A 9ICEA 1R8BA 3JZ0A 5CP2A 4NLNA 4E80A 9ICGA 4IQUA 1ZQTA 4RWQA 8ICUA 7ICQA 4WC7A 4RQ3A 5DKWA 3H38A 9ICCA 4AT9B 5HRDA 3V7JA 4M9GA 4EP7A 1NO5A 3AQNA 8ICHA 5HRFA 9ICXA 4F5NA 4I2IA 8ICCA 4YD1A 2NRKA 5J2DA 4MF8A 4FHXA 4RPXA 4AT8A 4O5KA 9ICNA 4QZFA 5D46A 4NM1A 2ZH5A 4UB2A 3AU6A 5HC9A 4X4UA 5IIKA 9ICJA 4AT7B 4RWPA 5J2IA 8ICQA 3HWTA 4ATBB 4RQ8A 3MGHA 4X0AA 4KLTA 5IILA 2PFQA 3WFQE 8ICOA 7ICIA 2ZHAA 4PHPA 2BCRA 3C2KA 1TV9A 7ICSA 5EOZA 3RJIA 1XSNA 5DBBA 1ZQUA 1ZJNA 1ZQQA 4KLFA 2DR8A 5HRIA 3UXOA 2BPCA 4Z6EA 1MIVA 4PHAA 2PFOA 4YD2A 5DECA 4UBCA 3RH5A 2M2VA 4UAYA 7ICNA 1Q78A 1TVAA 4RQ6A 3PNCA 5HRHA 5DB9A 3HJ4A 1ZQXA 3UPSA 2ZH8A 3JYYA 4RQ1A 3JPSA 1ZQPA 4RQ4A 4O5EA 3UQ2A 7ICVA 3LQCB 4KLUA 1TFYA 8ICTA 3C5FA 4EBKA 3RJEA 4LZDA 5DDMA 9ICBA 4X4QA 8ICEA 5DDYA 1ZQBA 4QZ8A 8ICSA 1ZQOA 5J2GA 5IIIA 2PFNA 1JN3A 2BCSA 4NLKA 2DVIA 4FHVA 5D49A 4FHYA 1VJ7A 1BPYA 5HHHA 5CJ7A 4FH3A 1KEJA 4F5QA 5J2AA 2BCUA 8ICBA 3JPPA 4X4TA 4M9JA 2DRAA 4DOAA 4E7XA 9ICSA 4I2HA 3ISDA 1Q79A 1UEUA 4YMNA 4O9MA 3K75D 4JWNA 3B0XA 4M2YA 4MFCA 7ICOA 3OGUA 9ICFA 9ICMA 2ZH9A 8ICVA 3C2MA 7ICMA 8ICXA 2BE3A 3RJJA 2BCQA 4P4PA 4RPZA 5J0SA 3C66A 5DBCA 3AQKA 4FH5A 9ICPA 4I2GA 2HHPA 2VANA 4RQ5A 2FMPA 3V72A 9ICAA 4IQVA 4KLIA 4FHPA 1BPBA 4RT3A 8ICFA 1KDHA 1FA0A 7ICRA 2ID1A 4WC1A 2ZH1A 5IIJA 1JAJA 1MQ2A 1ZQEA 1XSPA 3RJKA 9ICIA 7ICFA 3OVAA 7ICEA 4I2DA 1JMSA 4RQ2A 3OV7A 2ZH6A 9ICOA 4AT7A 4WC0A 1ZQIA 4UB3A 1MQ3A 4P2HA 1ZJMA 5HRKA 4ATBA 8ICGA 1BPXA 3RH4A 4PH5A 5HREA 2ZH3A 4XUSA 4I27A 3JPOA 4M47A 4M0AA 3WFPA 2W9MA 4YCXA 5BPCA 1R89A 4I29A 5J0TA 1ZQSA 2ISOA 1RZTA 8ICRA 1V4AA 9ICTA 3V7KA 1KNYA 7ICPA 2BPFA 4UD4A 3HIYA 3V7LA 2ZH4A 4UAWA 3MDCA 4RQ7A 8ICIA 3UXNA 4KLLA 4PGXA 4KLMA 4QZGA 3MBYA 4X5VA 4Z6DA 4K4IA 5DB8A 8ICZA 3L9DA 3OVSA 4XA5A 4PHDA 2PFPA 2DR5A 3ISCA 3H37A 1ZQGA 1ZQFA 4MFAA 3C5GA 5DB6A 4S3NA 1VFGA 3JPNA 2M2UA 4UBBA 4KLDA 3UPQA 1WOTA 8ICLA 4I2FA 4O5CA 1ZQNA 3UQ0A 4P4MA 2FMSA 4TURA 4KLEA 3RH6A 4I2BA 4F5OA 4QZEA 4TUQA 9ICHA 4M9HA 4QZIA 4NM2A 5J0UA 4WCWA 1MIWA 4WC2A 5TZVA 4K4GA 5DBAA 4RWOA 5J0YA 1ZQYA 1XSLA 4M04A 5DB7A 4GXIA 4Z6FA 7ICUA 5CA7A 1UETA 1HUZA 4JWMA 4DO9A 1BPZA 2I9GA 3JPRA 4IQTA 4UB5A 4TUSA 4YN4A 3H39A 5J2KA 4LZGA 1JQRA 1ZQVA 1R8CA 5HHIA 4YMOA 3WFRE 3UXPA 4IG8A 4Z6CA 4NKTA 4KLHA 2ZH7A 4PGQA 4XQ7A 5CB1A 5CWRA 2P66A 4QZDA 4EBJA 7ICTA 5J0XA 4M9LA 3HX0A 1ZQJA 4PPXA 3OUYB 4RQ0A 9ICWA 4X4PA 3GDXA 5BOLA 4AT9A 1OU5A 4X0BA 1R8AA 9ICLA 8ICJA 4QZBA 1PX5A 1ZQRA 4WC5A 4P4OA 5HRBA 4RPYA 5J2JA 9ICRA 4WBYA 4M5DA 3PMLA 2BCVA 2DR7A 4X4OA 1ZQLA 1F5AA 4LT6A 3JPQA 5J2CA 2PXIA 4LVSA 4PHEA 3TFSA 2DR9A 4DOBA 4UB4A 1ZQZA 1ZQDA 3HJ1A 1UEVA 2O5AA 4R65A 3RJFA 3WFOA 5J29A 4RWNA 2GWSA 8ICNA 7ICHA 2FMQA 2ZH2A 1HUOA 2RFFA 4WC3A 3ISBA 5HRGA 1ZQHA 2ZHBA 2PBEA 5IIMA 4KLQA 4X4RA 4AT8B 1TFWA 8ICPA 4XRHA 4TUPA 4I28A 5J0RA 9ICKA 3AQLA 3TFRA 4UD5A 4KLJA 1RPLA 4WC4A 4YMMA 8ICYA 4IQWA 3HW8A 4XQ8A 4NY8A 4KLSA 4QZCA 3JPTA 4MF2A 4K4HA 1YLQA 4R63A 3AQMA 7ICJA 8ICKA 2Q66A 9ICQA 5J0OA 3WFSC 4PGYA 1BPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLG A;  3RJH A;  4I2J A;  4I2E A;  3NYB A;  3C18 A;  2M2T A;  4X4V A;  4E8F A;  3MDA A;  1ZQK A;  4I2C A;  4M9N A;  4NLZ A;  3RJG A;  3B0Y A;  3AUO A;  7ICG A;  2O1P A;  4GXK A;  5J0P A;  1ZQM A;  4UB1 A;  9ICV A;  5J2H A;  5CR0 A;  5D4B A;  4UAZ A;  4R66 A;  8ICM A;  5J0W A;  3H3A A;  1ZQC A;  4FHW A;  5BOM A;  3C2L A;  2IHM A;  4X4N A;  2M2W A;  3OVB A;  4QZA A;  4I2A A;  7ICL A;  5DED A;  4NXZ A;  5CHG A;  5IIN A;  9ICU A;  5J2F A;  4WC6 A;  2ISP A;  5J0Q A;  4X4S A;  8ICA A;  5HRL A;  4WBZ A;  7ICK A;  2DRB A;  4F5R A;  3OUY A;  4QZH A;  4DOC A;  5J2E A;  3AU2 A;  2BPG A;  3LK9 A;  5IIO A;  1ZQA A;  1ZQW A;  3MGI A;  4QZ9 A;  4GXJ A;  5F2V O;  1MIY A;  4NKU A;  4RT2 A;  4F5P A;  3PMN A;  4KLO A;  8ICW A;  4MFF A;  4FO6 A;  5J2B A;  4R64 A;  1BPE A;  1NOM A;  5HR9 A;  9ICE A;  1R8B A;  3JZ0 A;  5CP2 A;  4NLN A;  4E80 A;  9ICG A;  4IQU A;  1ZQT A;  4RWQ A;  8ICU A;  7ICQ A;  4WC7 A;  4RQ3 A;  5DKW A;  3H38 A;  9ICC A;  4AT9 B;  5HRD A;  3V7J A;  4M9G A;  4EP7 A;  1NO5 A;  3AQN A;  8ICH A;  5HRF A;  9ICX A;  4F5N A;  4I2I A;  8ICC A;  4YD1 A;  2NRK A;  5J2D A;  4MF8 A;  4FHX A;  4RPX A;  4AT8 A;  4O5K A;  9ICN A;  4QZF A;  5D46 A;  4NM1 A;  2ZH5 A;  4UB2 A;  3AU6 A;  5HC9 A;  4X4U A;  5IIK A;  9ICJ A;  4AT7 B;  4RWP A;  5J2I A;  8ICQ A;  3HWT A;  4ATB B;  4RQ8 A;  3MGH A;  4X0A A;  4KLT A;  5IIL A;  2PFQ A;  3WFQ E;  8ICO A;  7ICI A;  2ZHA A;  4PHP A;  2BCR A;  3C2K A;  1TV9 A;  7ICS A;  5EOZ A;  3RJI A;  1XSN A;  5DBB A;  1ZQU A;  1ZJN A;  1ZQQ A;  4KLF A;  2DR8 A;  5HRI A;  3UXO A;  2BPC A;  4Z6E A;  1MIV A;  4PHA A;  2PFO A;  4YD2 A;  5DEC A;  4UBC A;  3RH5 A;  2M2V A;  4UAY A;  7ICN A;  1Q78 A;  1TVA A;  4RQ6 A;  3PNC A;  5HRH A;  5DB9 A;  3HJ4 A;  1ZQX A;  3UPS A;  2ZH8 A;  3JYY A;  4RQ1 A;  3JPS A;  1ZQP A;  4RQ4 A;  4O5E A;  3UQ2 A;  7ICV A;  3LQC B;  4KLU A;  1TFY A;  8ICT A;  3C5F A;  4EBK A;  3RJE A;  4LZD A;  5DDM A;  9ICB A;  4X4Q A;  8ICE A;  5DDY A;  1ZQB A;  4QZ8 A;  8ICS A;  1ZQO A;  5J2G A;  5III A;  2PFN A;  1JN3 A;  2BCS A;  4NLK A;  2DVI A;  4FHV A;  5D49 A;  4FHY A;  1VJ7 A;  1BPY A;  5HHH A;  5CJ7 A;  4FH3 A;  1KEJ A;  4F5Q A;  5J2A A;  2BCU A;  8ICB A;  3JPP A;  4X4T A;  4M9J A;  2DRA A;  4DOA A;  4E7X A;  9ICS A;  4I2H A;  3ISD A;  1Q79 A;  1UEU A;  4YMN A;  4O9M A;  3K75 D;  4JWN A;  3B0X A;  4M2Y A;  4MFC A;  7ICO A;  3OGU A;  9ICF A;  9ICM A;  2ZH9 A;  8ICV A;  3C2M A;  7ICM A;  8ICX A;  2BE3 A;  3RJJ A;  2BCQ A;  4P4P A;  4RPZ A;  5J0S A;  3C66 A;  5DBC A;  3AQK A;  4FH5 A;  9ICP A;  4I2G A;  2HHP A;  2VAN A;  4RQ5 A;  2FMP A;  3V72 A;  9ICA A;  4IQV A;  4KLI A;  4FHP A;  1BPB A;  4RT3 A;  8ICF A;  1KDH A;  1FA0 A;  7ICR A;  2ID1 A;  4WC1 A;  2ZH1 A;  5IIJ A;  1JAJ A;  1MQ2 A;  1ZQE A;  1XSP A;  3RJK A;  9ICI A;  7ICF A;  3OVA A;  7ICE A;  4I2D A;  1JMS A;  4RQ2 A;  3OV7 A;  2ZH6 A;  9ICO A;  4AT7 A;  4WC0 A;  1ZQI A;  4UB3 A;  1MQ3 A;  4P2H A;  1ZJM A;  5HRK A;  4ATB A;  8ICG A;  1BPX A;  3RH4 A;  4PH5 A;  5HRE A;  2ZH3 A;  4XUS A;  4I27 A;  3JPO A;  4M47 A;  4M0A A;  3WFP A;  2W9M A;  4YCX A;  5BPC A;  1R89 A;  4I29 A;  5J0T A;  1ZQS A;  2ISO A;  1RZT A;  8ICR A;  1V4A A;  9ICT A;  3V7K A;  1KNY A;  7ICP A;  2BPF A;  4UD4 A;  3HIY A;  3V7L A;  2ZH4 A;  4UAW A;  3MDC A;  4RQ7 A;  8ICI A;  3UXN A;  4KLL A;  4PGX A;  4KLM A;  4QZG A;  3MBY A;  4X5V A;  4Z6D A;  4K4I A;  5DB8 A;  8ICZ A;  3L9D A;  3OVS A;  4XA5 A;  4PHD A;  2PFP A;  2DR5 A;  3ISC A;  3H37 A;  1ZQG A;  1ZQF A;  4MFA A;  3C5G A;  5DB6 A;  4S3N A;  1VFG A;  3JPN A;  2M2U A;  4UBB A;  4KLD A;  3UPQ A;  1WOT A;  8ICL A;  4I2F A;  4O5C A;  1ZQN A;  3UQ0 A;  4P4M A;  2FMS A;  4TUR A;  4KLE A;  3RH6 A;  4I2B A;  4F5O A;  4QZE A;  4TUQ A;  9ICH A;  4M9H A;  4QZI A;  4NM2 A;  5J0U A;  4WCW A;  1MIW A;  4WC2 A;  5TZV A;  4K4G A;  5DBA A;  4RWO A;  5J0Y A;  1ZQY A;  1XSL A;  4M04 A;  5DB7 A;  4GXI A;  4Z6F A;  7ICU A;  5CA7 A;  1UET A;  1HUZ A;  4JWM A;  4DO9 A;  1BPZ A;  2I9G A;  3JPR A;  4IQT A;  4UB5 A;  4TUS A;  4YN4 A;  3H39 A;  5J2K A;  4LZG A;  1JQR A;  1ZQV A;  1R8C A;  5HHI A;  4YMO A;  3WFR E;  3UXP A;  4IG8 A;  4Z6C A;  4NKT A;  4KLH A;  2ZH7 A;  4PGQ A;  4XQ7 A;  5CB1 A;  5CWR A;  2P66 A;  4QZD A;  4EBJ A;  7ICT A;  5J0X A;  4M9L A;  3HX0 A;  1ZQJ A;  4PPX A;  3OUY B;  4RQ0 A;  9ICW A;  4X4P A;  3GDX A;  5BOL A;  4AT9 A;  1OU5 A;  4X0B A;  1R8A A;  9ICL A;  8ICJ A;  4QZB A;  1PX5 A;  1ZQR A;  4WC5 A;  4P4O A;  5HRB A;  4RPY A;  5J2J A;  9ICR A;  4WBY A;  4M5D A;  3PML A;  2BCV A;  2DR7 A;  4X4O A;  1ZQL A;  1F5A A;  4LT6 A;  3JPQ A;  5J2C A;  2PXI A;  4LVS A;  4PHE A;  3TFS A;  2DR9 A;  4DOB A;  4UB4 A;  1ZQZ A;  1ZQD A;  3HJ1 A;  1UEV A;  2O5A A;  4R65 A;  3RJF A;  3WFO A;  5J29 A;  4RWN A;  2GWS A;  8ICN A;  7ICH A;  2FMQ A;  2ZH2 A;  1HUO A;  2RFF A;  4WC3 A;  3ISB A;  5HRG A;  1ZQH A;  2ZHB A;  2PBE A;  5IIM A;  4KLQ A;  4X4R A;  4AT8 B;  1TFW A;  8ICP A;  4XRH A;  4TUP A;  4I28 A;  5J0R A;  9ICK A;  3AQL A;  3TFR A;  4UD5 A;  4KLJ A;  1RPL A;  4WC4 A;  4YMM A;  8ICY A;  4IQW A;  3HW8 A;  4XQ8 A;  4NY8 A;  4KLS A;  4QZC A;  3JPT A;  4MF2 A;  4K4H A;  1YLQ A;  4R63 A;  3AQM A;  7ICJ A;  8ICK A;  2Q66 A;  9ICQ A;  5J0O A;  3WFS C;  4PGY A;  1BPD A; 
#chains in the Genus database with same CATH topology
 4KLG A;  3RJH A;  4I2J A;  4I2E A;  3NYB A;  5CFS A;  3C18 A;  2M2T A;  3ER8 C;  4X4V A;  4E8F A;  3MDA A;  1ZQK A;  4I2C A;  4M9N A;  3CK6 A;  4NLZ A;  3RJG A;  3PHZ A;  3B0Y A;  3AUO A;  7ICG A;  2O1P A;  4GXK A;  5J0P A;  2BBH A;  1ZQM A;  4UB1 A;  9ICV A;  5J2H A;  5CR0 A;  5D4B A;  4UAZ A;  4R66 A;  8ICM A;  5J0W A;  3H3A A;  1ZQC A;  4FHW A;  3OWG A;  5BOM A;  3C2L A;  2IHM A;  4X4N A;  2M2W A;  3OVB A;  4QZA A;  4I2A A;  7ICL A;  5DED A;  4NXZ A;  5CHE A;  5CHG A;  5D63 A;  1GPJ A;  5IIN A;  3K7D A;  9ICU A;  5J2F A;  4WC6 A;  2ISP A;  5J0Q A;  4X4S A;  8ICA A;  5HRL A;  4WBZ A;  7ICK A;  2DRB A;  4F5R A;  3OUY A;  4QZH A;  4DOC A;  5J2E A;  3AU2 A;  2BPG A;  3LK9 A;  5IIO A;  2B56 A;  1ZQA A;  4OAF A;  1ZQW A;  3MGI A;  4QZ9 A;  4GXJ A;  5F2V O;  1MIY A;  4WOY A;  4NKU A;  4RT2 A;  4F5P A;  3PMN A;  4KLO A;  8ICW A;  4MFF A;  4NXU A;  2FCL A;  4O67 A;  4FO6 A;  5J2B A;  4R64 A;  1BPE A;  5D62 A;  1NOM A;  5HR9 A;  9ICE A;  1R8B A;  3JZ0 A;  5CP2 A;  4NLN A;  4E80 A;  9ICG A;  4IQU A;  1ZQT A;  4RWQ A;  4LEZ A;  8ICU A;  7ICQ A;  4WC7 A;  4RQ3 A;  5DKW A;  3H38 A;  9ICC A;  4AT9 B;  5HRD A;  3V7J A;  4M9G A;  4EP7 A;  1NO5 A;  3AQN A;  8ICH A;  5HRF A;  9ICX A;  5B3P A;  4F5N A;  4I2I A;  8ICC A;  4YD1 A;  2NRK A;  5J2D A;  4MF8 A;  4FHX A;  4RPX A;  4AT8 A;  4O5K A;  9ICN A;  4QZF A;  5D46 A;  4NM1 A;  2ZH5 A;  4UB2 A;  3AU6 A;  5HC9 A;  4X4U A;  5IIK A;  9ICJ A;  4AT7 B;  4RWP A;  5J2I A;  8ICQ A;  3HWT A;  4ATB B;  4RQ8 A;  3MGH A;  4OAH A;  4X0A A;  4KLT A;  5IIL A;  2PFQ A;  3WFQ E;  8ICO A;  7ICI A;  2ZHA A;  4WQK A;  4PHP A;  2BCR A;  4HX0 A;  3C2K A;  1TV9 A;  7ICS A;  5EOZ A;  3RJI A;  1XSN A;  5DBB A;  1ZQU A;  1ZJN A;  1ZQQ A;  4KLF A;  2DR8 A;  4NXT A;  5HRI A;  3UXO A;  2BPC A;  4WH5 A;  4Z6E A;  1MIV A;  4PHA A;  2PFO A;  5CFU A;  4YD2 A;  5DEC A;  4UBC A;  3RH5 A;  2M2V A;  4UAY A;  7ICN A;  1Q78 A;  1TVA A;  4RQ6 A;  3PNC A;  5HRH A;  5DB9 A;  3HJ4 A;  4LEW A;  1ZQX A;  3UPS A;  2ZH8 A;  3JYY A;  4RQ1 A;  3JPS A;  1ZQP A;  4RQ4 A;  4O5E A;  3UQ2 A;  4O69 A;  7ICV A;  3LQC B;  4KLU A;  1TFY A;  8ICT A;  3C5F A;  4EBK A;  3RJE A;  4LZD A;  5DDM A;  9ICB A;  4X4Q A;  8ICE A;  5DDY A;  1ZQB A;  4QZ8 A;  8ICS A;  1ZQO A;  5J2G A;  5III A;  2PFN A;  1JN3 A;  2BCS A;  4NLK A;  4NXW A;  2DVI A;  4FHV A;  4K98 A;  5D49 A;  4FHY A;  2B51 A;  1VJ7 A;  1BPY A;  5HHH A;  5CJ7 A;  4FH3 A;  1KEJ A;  4F5Q A;  5J2A A;  2BCU A;  8ICB A;  3JPP A;  4NXV A;  4X4T A;  4M9J A;  2DRA A;  4DOA A;  4E7X A;  9ICS A;  4I2H A;  3ISD A;  1Q79 A;  1UEU A;  4YMN A;  4O9M A;  3K75 D;  4JWN A;  3B0X A;  4M2Y A;  4MFC A;  4O68 A;  7ICO A;  4WQL A;  3OGU A;  9ICF A;  9ICM A;  2ZH9 A;  8ICV A;  3C2M A;  7ICM A;  8ICX A;  2BE3 A;  3RJJ A;  2BCQ A;  4P4P A;  4OAI Z;  4RPZ A;  5J0S A;  3C66 A;  5DBC A;  4OAG A;  3AQK A;  4FH5 A;  2B4V A;  2EWR A;  9ICP A;  4I2G A;  2HHP A;  2VAN A;  4RQ5 A;  2FMP A;  3V72 A;  9ICA A;  4IQV A;  4KLI A;  4FHP A;  1BPB A;  4RT3 A;  8ICF A;  1KDH A;  1FA0 A;  7ICR A;  2ID1 A;  4WC1 A;  2ZH1 A;  5IIJ A;  1JAJ A;  1MQ2 A;  1ZQE A;  1XSP A;  3RJK A;  9ICI A;  7ICF A;  3OVA A;  7ICE A;  4I2D A;  1JMS A;  4RQ2 A;  3OV7 A;  2ZH6 A;  9ICO A;  4AT7 A;  4WC0 A;  4EV6 A;  1ZQI A;  2GA9 D;  4UB3 A;  1MQ3 A;  4P2H A;  1ZJM A;  5HRK A;  4XJE A;  4ATB A;  8ICG A;  1BPX A;  2IUB A;  3RH4 A;  4PH5 A;  5HRE A;  2ZH3 A;  4XUS A;  4I27 A;  3JPO A;  4M47 A;  4M0A A;  3WFP A;  2W9M A;  5CFT A;  4YCX A;  4FO1 A;  4MKP A;  5BPC A;  1R89 A;  4I29 A;  5J0T A;  1ZQS A;  2ISO A;  1RZT A;  4N7R A;  8ICR A;  1V4A A;  9ICT A;  3V7K A;  3NVO A;  1KNY A;  7ICP A;  2BPF A;  4UD4 A;  3HIY A;  3V7L A;  2ZH4 A;  4UAW A;  3MDC A;  4RQ7 A;  8ICI A;  3UXN A;  4KLL A;  2HN1 A;  4PGX A;  4EEB A;  4KLM A;  4QZG A;  3MBY A;  4X5V A;  4Z6D A;  4K4I A;  3EF2 A;  5DB8 A;  2GAF D;  8ICZ A;  3L9D A;  3OVS A;  4XA5 A;  4K9A A;  4PHD A;  2PFP A;  2DR5 A;  3ISC A;  3H37 A;  4KB6 A;  1ZQG A;  1ZQF A;  4MFA A;  3C5G A;  5DB6 A;  4S3N A;  1VFG A;  3JPN A;  4K9B A;  2M2U A;  2BBJ A;  4UBB A;  4KLD A;  3UPQ A;  1WOT A;  8ICL A;  4LEY A;  4I2F A;  4O5C A;  1ZQN A;  3UQ0 A;  4P4M A;  2FMS A;  4TUR A;  4KLE A;  3RH6 A;  4EED A;  3ERC C;  4I2B A;  4O6A A;  4F5O A;  4QZE A;  4TUQ A;  9ICH A;  4M9H A;  4QZI A;  4NM2 A;  5J0U A;  4WCW A;  1MIW A;  4WC2 A;  3JCF A;  5TZV A;  4K4G A;  5DBA A;  4RWO A;  5J0Y A;  1ZQY A;  1XSL A;  4M04 A;  5DB7 A;  4GXI A;  4Z6F A;  7ICU A;  5CA7 A;  4NXX A;  1UET A;  1HUZ A;  4JWM A;  4DO9 A;  1BPZ A;  2I9G A;  3JPR A;  4IQT A;  4UB5 A;  4TUS A;  4YN4 A;  3H39 A;  5J2K A;  4LZG A;  1JQR A;  1ZQV A;  1R8C A;  4KM5 A;  5HHI A;  4YMO A;  3ER9 B;  3WFR E;  3UXP A;  4IG8 A;  4Z6C A;  4NKT A;  4KLH A;  2ZH7 A;  4PGQ A;  4XQ7 A;  5CB1 A;  5CWR A;  2P66 A;  4QZD A;  4EBJ A;  4JLZ A;  7ICT A;  5J0X A;  4M9L A;  4I0U A;  3HX0 A;  1ZQJ A;  4PPX A;  4EGW A;  3OUY B;  4RQ0 A;  3NKU A;  9ICW A;  4X4P A;  3GDX A;  5BOL A;  4AT9 A;  1OU5 A;  4X0B A;  1R8A A;  9ICL A;  8ICJ A;  4K97 A;  4QZB A;  1PX5 A;  1ZQR A;  4WC5 A;  4P4O A;  5HRB A;  2IHO A;  4RPY A;  5J2J A;  5JTG A;  4K99 A;  9ICR A;  4WBY A;  4K96 A;  4M5D A;  3PML A;  2BCV A;  2DR7 A;  4X4O A;  1ZQL A;  1F5A A;  4LT6 A;  3JPQ A;  5J2C A;  2PXI A;  4LVS A;  4PHE A;  3TFS A;  2DR9 A;  5B3Q A;  4K8V A;  4DOB A;  4UB4 A;  1ZQZ A;  1ZQD A;  3HJ1 A;  1UEV A;  3MCR A;  2HN2 A;  2O5A A;  4R65 A;  5D61 A;  3RJF A;  3WFO A;  5J29 A;  4RWN A;  2GWS A;  8ICN A;  7ICH A;  2FMQ A;  2ZH2 A;  1HUO A;  2RFF A;  4WC3 A;  3ISB A;  5HRG A;  1ZQH A;  2ZHB A;  2PBE A;  5IIM A;  4KLQ A;  4X4R A;  4AT8 B;  1TFW A;  8ICP A;  4XRH A;  4TUP A;  4I28 A;  5J0R A;  9ICK A;  3AQL A;  3TFR A;  4UD5 A;  4KLJ A;  1RPL A;  4WC4 A;  4LEV A;  4YMM A;  8ICY A;  4IQW A;  3HW8 A;  4XQ8 A;  3NWI A;  4NY8 A;  4KLS A;  4QZC A;  3JPT A;  4MF2 A;  4K4H A;  1YLQ A;  4R63 A;  3AQM A;  7ICJ A;  8ICK A;  2Q66 A;  4JLX A;  9ICQ A;  5J0O A;  3WFS C;  4PGY A;  1BPD A; 
#chains in the Genus database with same CATH homology
 4KLG A;  3RJH A;  4I2J A;  4I2E A;  3NYB A;  3C18 A;  2M2T A;  4X4V A;  4E8F A;  3MDA A;  1ZQK A;  4I2C A;  4M9N A;  4NLZ A;  3RJG A;  3B0Y A;  3AUO A;  7ICG A;  2O1P A;  4GXK A;  5J0P A;  1ZQM A;  4UB1 A;  9ICV A;  5J2H A;  5CR0 A;  5D4B A;  4UAZ A;  4R66 A;  8ICM A;  5J0W A;  3H3A A;  1ZQC A;  4FHW A;  5BOM A;  3C2L A;  2IHM A;  4X4N A;  2M2W A;  3OVB A;  4QZA A;  4I2A A;  7ICL A;  5DED A;  4NXZ A;  5CHG A;  5IIN A;  9ICU A;  5J2F A;  4WC6 A;  2ISP A;  5J0Q A;  4X4S A;  8ICA A;  5HRL A;  4WBZ A;  7ICK A;  2DRB A;  4F5R A;  3OUY A;  4QZH A;  4DOC A;  5J2E A;  3AU2 A;  2BPG A;  3LK9 A;  5IIO A;  1ZQA A;  1ZQW A;  3MGI A;  4QZ9 A;  4GXJ A;  5F2V O;  1MIY A;  4NKU A;  4RT2 A;  4F5P A;  3PMN A;  4KLO A;  8ICW A;  4MFF A;  4FO6 A;  5J2B A;  4R64 A;  1BPE A;  1NOM A;  5HR9 A;  9ICE A;  1R8B A;  3JZ0 A;  5CP2 A;  4NLN A;  4E80 A;  9ICG A;  4IQU A;  1ZQT A;  4RWQ A;  8ICU A;  7ICQ A;  4WC7 A;  4RQ3 A;  5DKW A;  3H38 A;  9ICC A;  4AT9 B;  5HRD A;  3V7J A;  4M9G A;  4EP7 A;  1NO5 A;  3AQN A;  8ICH A;  5HRF A;  9ICX A;  4F5N A;  4I2I A;  8ICC A;  4YD1 A;  2NRK A;  5J2D A;  4MF8 A;  4FHX A;  4RPX A;  4AT8 A;  4O5K A;  9ICN A;  4QZF A;  5D46 A;  4NM1 A;  2ZH5 A;  4UB2 A;  3AU6 A;  5HC9 A;  4X4U A;  5IIK A;  9ICJ A;  4AT7 B;  4RWP A;  5J2I A;  8ICQ A;  3HWT A;  4ATB B;  4RQ8 A;  3MGH A;  4X0A A;  4KLT A;  5IIL A;  2PFQ A;  3WFQ E;  8ICO A;  7ICI A;  2ZHA A;  4PHP A;  2BCR A;  3C2K A;  1TV9 A;  7ICS A;  5EOZ A;  3RJI A;  1XSN A;  5DBB A;  1ZQU A;  1ZJN A;  1ZQQ A;  4KLF A;  2DR8 A;  5HRI A;  3UXO A;  2BPC A;  4Z6E A;  1MIV A;  4PHA A;  2PFO A;  4YD2 A;  5DEC A;  4UBC A;  3RH5 A;  2M2V A;  4UAY A;  7ICN A;  1Q78 A;  1TVA A;  4RQ6 A;  3PNC A;  5HRH A;  5DB9 A;  3HJ4 A;  1ZQX A;  3UPS A;  2ZH8 A;  3JYY A;  4RQ1 A;  3JPS A;  1ZQP A;  4RQ4 A;  4O5E A;  3UQ2 A;  7ICV A;  3LQC B;  4KLU A;  1TFY A;  8ICT A;  3C5F A;  4EBK A;  3RJE A;  4LZD A;  5DDM A;  9ICB A;  4X4Q A;  8ICE A;  5DDY A;  1ZQB A;  4QZ8 A;  8ICS A;  1ZQO A;  5J2G A;  5III A;  2PFN A;  1JN3 A;  2BCS A;  4NLK A;  2DVI A;  4FHV A;  5D49 A;  4FHY A;  1VJ7 A;  1BPY A;  5HHH A;  5CJ7 A;  4FH3 A;  1KEJ A;  4F5Q A;  5J2A A;  2BCU A;  8ICB A;  3JPP A;  4X4T A;  4M9J A;  2DRA A;  4DOA A;  4E7X A;  9ICS A;  4I2H A;  3ISD A;  1Q79 A;  1UEU A;  4YMN A;  4O9M A;  3K75 D;  4JWN A;  3B0X A;  4M2Y A;  4MFC A;  7ICO A;  3OGU A;  9ICF A;  9ICM A;  2ZH9 A;  8ICV A;  3C2M A;  7ICM A;  8ICX A;  2BE3 A;  3RJJ A;  2BCQ A;  4P4P A;  4RPZ A;  5J0S A;  3C66 A;  5DBC A;  3AQK A;  4FH5 A;  9ICP A;  4I2G A;  2HHP A;  2VAN A;  4RQ5 A;  2FMP A;  3V72 A;  9ICA A;  4IQV A;  4KLI A;  4FHP A;  1BPB A;  4RT3 A;  8ICF A;  1KDH A;  1FA0 A;  7ICR A;  2ID1 A;  4WC1 A;  2ZH1 A;  5IIJ A;  1JAJ A;  1MQ2 A;  1ZQE A;  1XSP A;  3RJK A;  9ICI A;  7ICF A;  3OVA A;  7ICE A;  4I2D A;  1JMS A;  4RQ2 A;  3OV7 A;  2ZH6 A;  9ICO A;  4AT7 A;  4WC0 A;  1ZQI A;  4UB3 A;  1MQ3 A;  4P2H A;  1ZJM A;  5HRK A;  4ATB A;  8ICG A;  1BPX A;  3RH4 A;  4PH5 A;  5HRE A;  2ZH3 A;  4XUS A;  4I27 A;  3JPO A;  4M47 A;  4M0A A;  3WFP A;  2W9M A;  4YCX A;  5BPC A;  1R89 A;  4I29 A;  5J0T A;  1ZQS A;  2ISO A;  1RZT A;  8ICR A;  1V4A A;  9ICT A;  3V7K A;  1KNY A;  7ICP A;  2BPF A;  4UD4 A;  3HIY A;  3V7L A;  2ZH4 A;  4UAW A;  3MDC A;  4RQ7 A;  8ICI A;  3UXN A;  4KLL A;  4PGX A;  4KLM A;  4QZG A;  3MBY A;  4X5V A;  4Z6D A;  4K4I A;  5DB8 A;  8ICZ A;  3L9D A;  3OVS A;  4XA5 A;  4PHD A;  2PFP A;  2DR5 A;  3ISC A;  3H37 A;  1ZQG A;  1ZQF A;  4MFA A;  3C5G A;  5DB6 A;  4S3N A;  1VFG A;  3JPN A;  2M2U A;  4UBB A;  4KLD A;  3UPQ A;  1WOT A;  8ICL A;  4I2F A;  4O5C A;  1ZQN A;  3UQ0 A;  4P4M A;  2FMS A;  4TUR A;  4KLE A;  3RH6 A;  4I2B A;  4F5O A;  4QZE A;  4TUQ A;  9ICH A;  4M9H A;  4QZI A;  4NM2 A;  5J0U A;  4WCW A;  1MIW A;  4WC2 A;  5TZV A;  4K4G A;  5DBA A;  4RWO A;  5J0Y A;  1ZQY A;  1XSL A;  4M04 A;  5DB7 A;  4GXI A;  4Z6F A;  7ICU A;  5CA7 A;  1UET A;  1HUZ A;  4JWM A;  4DO9 A;  1BPZ A;  2I9G A;  3JPR A;  4IQT A;  4UB5 A;  4TUS A;  4YN4 A;  3H39 A;  5J2K A;  4LZG A;  1JQR A;  1ZQV A;  1R8C A;  5HHI A;  4YMO A;  3WFR E;  3UXP A;  4IG8 A;  4Z6C A;  4NKT A;  4KLH A;  2ZH7 A;  4PGQ A;  4XQ7 A;  5CB1 A;  5CWR A;  2P66 A;  4QZD A;  4EBJ A;  7ICT A;  5J0X A;  4M9L A;  3HX0 A;  1ZQJ A;  4PPX A;  3OUY B;  4RQ0 A;  9ICW A;  4X4P A;  3GDX A;  5BOL A;  4AT9 A;  1OU5 A;  4X0B A;  1R8A A;  9ICL A;  8ICJ A;  4QZB A;  1PX5 A;  1ZQR A;  4WC5 A;  4P4O A;  5HRB A;  4RPY A;  5J2J A;  9ICR A;  4WBY A;  4M5D A;  3PML A;  2BCV A;  2DR7 A;  4X4O A;  1ZQL A;  1F5A A;  4LT6 A;  3JPQ A;  5J2C A;  2PXI A;  4LVS A;  4PHE A;  3TFS A;  2DR9 A;  4DOB A;  4UB4 A;  1ZQZ A;  1ZQD A;  3HJ1 A;  1UEV A;  2O5A A;  4R65 A;  3RJF A;  3WFO A;  5J29 A;  4RWN A;  2GWS A;  8ICN A;  7ICH A;  2FMQ A;  2ZH2 A;  1HUO A;  2RFF A;  4WC3 A;  3ISB A;  5HRG A;  1ZQH A;  2ZHB A;  2PBE A;  5IIM A;  4KLQ A;  4X4R A;  4AT8 B;  1TFW A;  8ICP A;  4XRH A;  4TUP A;  4I28 A;  5J0R A;  9ICK A;  3AQL A;  3TFR A;  4UD5 A;  4KLJ A;  1RPL A;  4WC4 A;  4YMM A;  8ICY A;  4IQW A;  3HW8 A;  4XQ8 A;  4NY8 A;  4KLS A;  4QZC A;  3JPT A;  4MF2 A;  4K4H A;  1YLQ A;  4R63 A;  3AQM A;  7ICJ A;  8ICK A;  2Q66 A;  9ICQ A;  5J0O A;  3WFS C;  4PGY A;  1BPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...