2M2UA

Binary complex of african swine fever virus pol x with mgdgtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
total genus 45
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2uA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2uA01
2ZH2A 4YMNA 4WC1A 8ICVA 5DECA 4UB1A 3MGIA 3WFRE 1ZQAA 8ICSA 4LVSA 4E80A 2BPGA 4RWQA 2ZH9A 5BPCA 4R66A 4KLDA 4UB4A 3RH6A 3RJFA 1JN3A 4RQ0A 9ICSA 5HHHA 3JPTA 7ICEA 3HJ4A 8ICHA 1TVAA 4RWPA 7ICTA 1JQRA 4IQWA 1UETA 3MGHA 4I2IA 2ISPA 3NYBA 4RWNA 4GXKA 4NY8A 5J2DA 1UEUA 8ICJA 4DOCA 3H39A 1BPEA 1V4AA 1YLQA 5DDYA 3WFQE 5CJ7A 1ZQEA 3RJJA 3MDCA 1ZQCA 3JPQA 4WBZA 3H3AA 4O5KA 8ICLA 4AT7A 2ZH1A 4KLUA 1ZQPA 9ICLA 4FHWA 2BCVA 4K4IA 3PMNA 1ZQHA 3JZ0A 1BPXA 4PPXA 3WFOA 4Z6CA 4P4PA 8ICPA 7ICQA 2FMQA 9ICQA 5J0YA 2ZH5A 4DOAA 4UD4A 3UPSA 1KDHA 4TUPA 4X4SA 3V7JA 7ICGA 3UQ2A 4F5QA 9ICOA 4K4HA 4X4NA 4RQ7A 5J0RA 2BCRA 5J0TA 2PFPA 4WC3A 9ICXA 1R8BA 5CWRA 5CR0A 5DEDA 7ICPA 1ZQBA 4ATBB 4RQ3A 9ICVA 4QZFA 2DRBA 3TFSA 4M9JA 3PNCA 1R8CA 4M2YA 5IILA 7ICLA 5CB1A 8ICCA 7ICSA 4Z6DA 4NKTA 1VJ7A 4WC4A 8ICIA 4M9GA 3OUYA 7ICIA 3OGUA 4I2FA 2BPCA 1R89A 1BPBA 4KLSA 1ZQZA 8ICUA 2W9MA 4R63A 4PHPA 4NLZA 3AQMA 4S3NA 5HRBA 5J2BA 4P2HA 3HJ1A 9ICEA 4MFFA 1XSPA 4I2DA 3ISDA 4O5EA 3OVBA 2PFQA 4KLTA 1WOTA 8ICZA 1KNYA 5HRLA 3MDAA 4LT6A 2BCQA 9ICHA 4AT8B 3LQCB 4O9MA 5J2IA 4F5OA 5F2VO 3RJKA 2M2TA 4FHPA 1FA0A 1TFYA 2O5AA 7ICRA 4QZGA 2DR8A 1ZQQA 5J0XA 4NKUA 4P4OA 9ICKA 2O1PA 4M5DA 5DB6A 4UB2A 3OVAA 7ICHA 5HRHA 3K75D 2NRKA 1ZQXA 4RWOA 4RQ6A 4KLMA 7ICMA 4NXZA 2PFOA 3JPNA 4RQ5A 1KEJA 4XA5A 8ICQA 3V72A 3C5GA 4UBBA 3HW8A 3HIYA 4FHYA 5J0SA 4WBYA 4QZBA 3UXOA 4F5RA 4I2JA 9ICAA 5DBCA 2P66A 5D49A 9ICNA 4NM2A 4K4GA 3C2MA 2Q66A 4X4OA 9ICIA 4KLFA 4FH3A 4PHDA 4KLQA 1NOMA 3JPSA 5D4BA 2DVIA 4WC5A 1Q79A 4I2BA 5D46A 1MIWA 4RQ4A 5J2CA 5HR9A 3ISBA 4QZCA 4TUQA 5IINA 8ICGA 5CHGA 4JWMA 5DB8A 4MFAA 1NO5A 3RJHA 9ICBA 8ICOA 4TUSA 4KLJA 5HHIA 3L9DA 4AT9B 1ZQJA 2RFFA 1ZQRA 8ICWA 5EOZA 2DRAA 4X4VA 4UB5A 4DOBA 8ICNA 3B0YA 3OV7A 1ZJMA 4FHXA 4X0BA 4GXIA 5J2KA 3RJIA 1ZQWA 1ZQTA 7ICUA 5J0WA 8ICTA 2ZH6A 4UB3A 4X4PA 3OUYB 1ZQGA 1ZQFA 5J0QA 5HRDA 1ZQVA 4YN4A 5DBBA 4IQTA 4I27A 3V7LA 4O5CA 9ICTA 4ATBA 5DB9A 1TFWA 4QZDA 9ICRA 4QZAA 5J2GA 3TFRA 3RJEA 4X4TA 4LZDA 1MIVA 5IIMA 4RPZA 3AQLA 4YD2A 2FMSA 9ICUA 3C66A 4JWNA 1XSLA 3JPRA 3WFPA 4YMMA 1ZJNA 4M9HA 1ZQMA 2M2WA 4GXJA 4WC2A 3JPOA 1PX5A 2BPFA 5DKWA 2ISOA 5BOLA 9ICWA 4MFCA 3H38A 5HRGA 4MF8A 1R8AA 4FHVA 7ICJA 4FH5A 4PHAA 8ICBA 4IG8A 4I29A 3AUOA 7ICOA 5DBAA 2BE3A 3AQNA 4KLOA 4XUSA 4QZIA 5DB7A 4KLEA 4EBKA 4UAWA 3MBYA 2BCSA 4AT8A 1BPZA 3RH4A 4I28A 2DR9A 1ZQLA 1JMSA 5J0UA 4YD1A 3UPQA 8ICKA 8ICYA 4NLNA 4X4RA 5BOMA 3B0XA 4I2EA 2PFNA 5DDMA 4KLIA 4I2HA 4MF2A 8ICXA 3PMLA 3ISCA 4Z6FA 3HX0A 5IIKA 3AQKA 5J2HA 1RPLA 1ZQIA 4PHEA 4X4UA 4RT2A 8ICMA 5HREA 4PGXA 2HHPA 2ZHBA 4NM1A 2ZHAA 9ICMA 4RQ2A 4KLHA 4YMOA 2BCUA 4R65A 4E8FA 2PXIA 8ICRA 9ICFA 2ID1A 4AT7B 4M04A 2ZH3A 4RT3A 1HUZA 4XQ8A 5J0OA 5J2AA 4IQVA 9ICPA 1ZQOA 4PGYA 4QZEA 3UXNA 4EP7A 2ZH4A 4FO6A 1ZQKA 4LZGA 4RQ8A 4TURA 3RJGA 5IIIA 4X0AA 1Q78A 4I2AA 4I2GA 2DR5A 3WFSC 7ICFA 2I9GA 4QZ8A 1ZQSA 4IQUA 9ICGA 4M47A 5HRIA 1ZQUA 7ICNA 4RPYA 4RQ1A 4DO9A 2ZH7A 4M0AA 4YCXA 2PBEA 5CP2A 3OVSA 4PH5A 1HUOA 9ICCA 8ICFA 1ZQYA 5J2EA 4PGQA 4M9LA 1OU5A 4R64A 3C18A 4QZHA 4AT9A 1RZTA 2ZH8A 5HC9A 4E7XA 3UQ0A 5IIJA 5CA7A 4UBCA 4P4MA 4X5VA 1BPYA 5IIOA 4EBJA 1BPDA 3RH5A 4RPXA 1MIYA 4XRHA 4XQ7A 1F5AA 3HWTA 5TZVA 3H37A 9ICJA 2M2VA 4F5NA 8ICEA 4UD5A 2GWSA 4F5PA 4X4QA 2VANA 1ZQDA 5J0PA 4Z6EA 5J2JA 1MQ2A 4KLGA 3V7KA 1ZQNA 4UAYA 2DR7A 1VFGA 4WCWA 3LK9A 1UEVA 7ICVA 1JAJA 3C2KA 4QZ9A 1TV9A 4WC0A 5J29A 4KLLA 2IHMA 2M2UA 3AU2A 7ICKA 3C5FA 4WC6A 2FMPA 1XSNA 3UXPA 3C2LA 3GDXA 4UAZA 1MQ3A 8ICAA 5J2FA 4NLKA 4WC7A 4M9NA 5HRFA 4I2CA 3JYYA 3JPPA 3AU6A 5HRKA
chains in the Genus database with same CATH superfamily
2ZH2A 4YMNA 4WC1A 8ICVA 5DECA 4UB1A 3MGIA 3WFRE 1ZQAA 2B4VA 8ICSA 4LVSA 4E80A 2BPGA 4RWQA 2ZH9A 3EF2A 5BPCA 4R66A 4KLDA 4UB4A 3RH6A 3RJFA 1JN3A 4RQ0A 5CFUA 9ICSA 5HHHA 3JPTA 7ICEA 3HJ4A 8ICHA 1TVAA 4RWPA 7ICTA 1JQRA 4IQWA 1UETA 3MGHA 4I2IA 2ISPA 3NYBA 4RWNA 4GXKA 4NY8A 5J2DA 1UEUA 8ICJA 4DOCA 3H39A 1BPEA 1V4AA 1YLQA 5DDYA 3WFQE 5CJ7A 1ZQEA 3RJJA 3MDCA 4JLZA 2BBJA 1ZQCA 3JPQA 5CFSA 4LEZA 4WBZA 3H3AA 4O5KA 8ICLA 4NXXA 4AT7A 2ZH1A 4KLUA 1ZQPA 9ICLA 4FHWA 2BCVA 4K4IA 3PMNA 1ZQHA 3JZ0A 1BPXA 4PPXA 3WFOA 4Z6CA 4P4PA 8ICPA 7ICQA 2FMQA 9ICQA 5J0YA 2ZH5A 4DOAA 4UD4A 3UPSA 1KDHA 3OWGA 4TUPA 4X4SA 3V7JA 7ICGA 3UQ2A 4F5QA 9ICOA 5JTGA 4K4HA 4X4NA 4RQ7A 5J0RA 2BCRA 5J0TA 2PFPA 4WC3A 9ICXA 4OAGA 1R8BA 5CWRA 5CR0A 5DEDA 7ICPA 1ZQBA 4ATBB 4RQ3A 9ICVA 4QZFA 2DRBA 3TFSA 4M9JA 3PNCA 1R8CA 4M2YA 5IILA 7ICLA 5CB1A 8ICCA 7ICSA 4Z6DA 4NKTA 1VJ7A 4WC4A 8ICIA 4K96A 4M9GA 3OUYA 4KM5A 7ICIA 3OGUA 4I2FA 2BPCA 1R89A 4K99A 1BPBA 4KLSA 1ZQZA 8ICUA 2W9MA 4R63A 3ER8C 4HX0A 4PHPA 4NXTA 4NLZA 4K97A 3AQMA 4O69A 3ERCC 4S3NA 5HRBA 5J2BA 4P2HA 3HJ1A 9ICEA 4MFFA 1XSPA 4I2DA 3ISDA 4O5EA 4K98A 3OVBA 2PFQA 4KLTA 1WOTA 4WQKA 8ICZA 1KNYA 5HRLA 3MDAA 4LT6A 2BCQA 9ICHA 4AT8B 3LQCB 4O9MA 5J2IA 4F5OA 5F2VO 3RJKA 3NKUA 2M2TA 4FHPA 1FA0A 1TFYA 2O5AA 7ICRA 3MCRA 3K7DA 4QZGA 2DR8A 1ZQQA 5J0XA 4NKUA 4P4OA 9ICKA 2O1PA 4WOYA 4KB6A 4M5DA 5DB6A 4UB2A 3OVAA 3CK6A 7ICHA 5HRHA 5D62A 3K75D 2NRKA 1ZQXA 4NXUA 4RQ6A 4KLMA 7ICMA 4RWOA 4NXZA 2PFOA 3JPNA 4RQ5A 2GAFD 3NVOA 1KEJA 4XA5A 8ICQA 3V72A 3C5GA 4UBBA 3HW8A 3HIYA 4FHYA 4LEYA 5J0SA 4WBYA 4QZBA 3UXOA 4K9BA 4F5RA 4I2JA 9ICAA 5DBCA 3ER9B 2P66A 5D49A 2B51A 3NWIA 9ICNA 4NM2A 4K4GA 3C2MA 4EEBA 2Q66A 4X4OA 2FCLA 9ICIA 4KLFA 4FH3A 4PHDA 4KLQA 1NOMA 3JPSA 5D4BA 2DVIA 2B56A 4WC5A 1Q79A 4I2BA 4XJEA 5D46A 1MIWA 2IHOA 4RQ4A 5J2CA 5HR9A 3ISBA 4QZCA 4TUQA 5IINA 8ICGA 5D63A 5CHGA 4JWMA 5DB8A 4MFAA 1NO5A 3RJHA 9ICBA 8ICOA 4TUSA 4KLJA 5HHIA 3L9DA 4AT9B 1ZQJA 2RFFA 1ZQRA 8ICWA 4O67A 5EOZA 2DRAA 4X4VA 4UB5A 4N7RA 4DOBA 4JLXA 8ICNA 3B0YA 3OV7A 1ZJMA 4OAFA 4LEWA 4FHXA 4X0BA 4NXWA 4GXIA 5J2KA 3RJIA 1ZQWA 1ZQTA 7ICUA 4O68A 5J0WA 8ICTA 2ZH6A 4UB3A 4X4PA 3OUYB 1ZQGA 4OAIZ 1ZQFA 5J0QA 5HRDA 4MKPA 1ZQVA 4YN4A 5DBBA 4EGWA 4IQTA 4I27A 3V7LA 4O5CA 9ICTA 4ATBA 5DB9A 1TFWA 4QZDA 9ICRA 1GPJA 4QZAA 5J2GA 3TFRA 3RJEA 3PHZA 4X4TA 4LZDA 1MIVA 5IIMA 4RPZA 3AQLA 4YD2A 2FMSA 9ICUA 3C66A 4O6AA 4JWNA 1XSLA 3JPRA 3WFPA 4YMMA 1ZJNA 4M9HA 1ZQMA 2M2WA 4GXJA 4WC2A 3JPOA 1PX5A 2HN2A 2BPFA 5DKWA 2ISOA 5BOLA 9ICWA 4MFCA 3H38A 5HRGA 4MF8A 1R8AA 4FHVA 7ICJA 5CHEA 4FH5A 4PHAA 5D61A 8ICBA 4IG8A 4I29A 3AUOA 7ICOA 5DBAA 2BE3A 3AQNA 4KLOA 4XUSA 4QZIA 5DB7A 4KLEA 4EBKA 4UAWA 3MBYA 2BCSA 4AT8A 4I0UA 1BPZA 3RH4A 4I28A 2DR9A 1ZQLA 2IUBA 1JMSA 5J0UA 4YD1A 3UPQA 8ICKA 8ICYA 4NLNA 4X4RA 5BOMA 3B0XA 4I2EA 2PFNA 5DDMA 4KLIA 4I2HA 4MF2A 8ICXA 3PMLA 3ISCA 4Z6FA 4NXVA 3HX0A 5IIKA 3AQKA 5J2HA 1RPLA 1ZQIA 4PHEA 4X4UA 4RT2A 8ICMA 5HREA 4PGXA 2HHPA 2ZHBA 4NM1A 2ZHAA 9ICMA 4RQ2A 4KLHA 4YMOA 2BCUA 4OAHA 4R65A 4E8FA 2PXIA 8ICRA 9ICFA 2GA9D 2ID1A 4AT7B 4M04A 2ZH3A 4RT3A 1HUZA 4XQ8A 5J0OA 5J2AA 4IQVA 9ICPA 2EWRA 1ZQOA 4PGYA 4QZEA 4FO1A 3UXNA 4EP7A 2ZH4A 4LEVA 4FO6A 1ZQKA 4LZGA 4RQ8A 4TURA 3RJGA 5IIIA 4X0AA 1Q78A 4I2AA 4I2GA 2DR5A 3WFSC 7ICFA 2I9GA 3JCFA 4QZ8A 1ZQSA 4IQUA 9ICGA 4M47A 2HN1A 5HRIA 1ZQUA 7ICNA 4RPYA 4RQ1A 4DO9A 2ZH7A 4M0AA 4YCXA 2PBEA 5CP2A 3OVSA 4PH5A 1HUOA 9ICCA 8ICFA 1ZQYA 5J2EA 4PGQA 4WQLA 4M9LA 1OU5A 4R64A 3C18A 4QZHA 4AT9A 1RZTA 2ZH8A 5HC9A 4E7XA 3UQ0A 5IIJA 5CFTA 5CA7A 4UBCA 4P4MA 4X5VA 1BPYA 2BBHA 5IIOA 4EBJA 1BPDA 3RH5A 4RPXA 1MIYA 4XRHA 4XQ7A 1F5AA 3HWTA 5TZVA 3H37A 9ICJA 2M2VA 4F5NA 8ICEA 4UD5A 2GWSA 4EEDA 5B3QA 4F5PA 4X4QA 4EV6A 2VANA 1ZQDA 5B3PA 5J0PA 4Z6EA 5J2JA 1MQ2A 4KLGA 3V7KA 1ZQNA 4UAYA 2DR7A 1VFGA 4K9AA 4WCWA 3LK9A 1UEVA 7ICVA 1JAJA 3C2KA 4QZ9A 1TV9A 4WC0A 5J29A 4KLLA 2IHMA 2M2UA 3AU2A 7ICKA 3C5FA 4WC6A 2FMPA 1XSNA 3UXPA 4WH5A 3C2LA 3GDXA 4UAZA 1MQ3A 8ICAA 5J2FA 4NLKA 4WC7A 4M9NA 5HRFA 4I2CA 3JYYA 3JPPA 3AU6A 5HRKA 4K8VA
chains in the Genus database with same CATH topology
2ZH2A 4YMNA 4WC1A 8ICVA 5DECA 4UB1A 3MGIA 3WFRE 1ZQAA 8ICSA 4LVSA 4E80A 2BPGA 4RWQA 2ZH9A 5BPCA 4R66A 4KLDA 4UB4A 3RH6A 3RJFA 1JN3A 4RQ0A 9ICSA 5HHHA 3JPTA 7ICEA 3HJ4A 8ICHA 1TVAA 4RWPA 7ICTA 1JQRA 4IQWA 1UETA 3MGHA 4I2IA 2ISPA 3NYBA 4RWNA 4GXKA 4NY8A 5J2DA 1UEUA 8ICJA 4DOCA 3H39A 1BPEA 1V4AA 1YLQA 5DDYA 3WFQE 5CJ7A 1ZQEA 3RJJA 3MDCA 1ZQCA 3JPQA 4WBZA 3H3AA 4O5KA 8ICLA 4AT7A 2ZH1A 4KLUA 1ZQPA 9ICLA 4FHWA 2BCVA 4K4IA 3PMNA 1ZQHA 3JZ0A 1BPXA 4PPXA 3WFOA 4Z6CA 4P4PA 8ICPA 7ICQA 2FMQA 9ICQA 5J0YA 2ZH5A 4DOAA 4UD4A 3UPSA 1KDHA 4TUPA 4X4SA 3V7JA 7ICGA 3UQ2A 4F5QA 9ICOA 4K4HA 4X4NA 4RQ7A 5J0RA 2BCRA 5J0TA 2PFPA 4WC3A 9ICXA 1R8BA 5CWRA 5CR0A 5DEDA 7ICPA 1ZQBA 4ATBB 4RQ3A 9ICVA 4QZFA 2DRBA 3TFSA 4M9JA 3PNCA 1R8CA 4M2YA 5IILA 7ICLA 5CB1A 8ICCA 7ICSA 4Z6DA 4NKTA 1VJ7A 4WC4A 8ICIA 4M9GA 3OUYA 7ICIA 3OGUA 4I2FA 2BPCA 1R89A 1BPBA 4KLSA 1ZQZA 8ICUA 2W9MA 4R63A 4PHPA 4NLZA 3AQMA 4S3NA 5HRBA 5J2BA 4P2HA 3HJ1A 9ICEA 4MFFA 1XSPA 4I2DA 3ISDA 4O5EA 3OVBA 2PFQA 4KLTA 1WOTA 8ICZA 1KNYA 5HRLA 3MDAA 4LT6A 2BCQA 9ICHA 4AT8B 3LQCB 4O9MA 5J2IA 4F5OA 5F2VO 3RJKA 2M2TA 4FHPA 1FA0A 1TFYA 2O5AA 7ICRA 4QZGA 2DR8A 1ZQQA 5J0XA 4NKUA 4P4OA 9ICKA 2O1PA 4M5DA 5DB6A 4UB2A 3OVAA 7ICHA 5HRHA 3K75D 2NRKA 1ZQXA 4RWOA 4RQ6A 4KLMA 7ICMA 4NXZA 2PFOA 3JPNA 4RQ5A 1KEJA 4XA5A 8ICQA 3V72A 3C5GA 4UBBA 3HW8A 3HIYA 4FHYA 5J0SA 4WBYA 4QZBA 3UXOA 4F5RA 4I2JA 9ICAA 5DBCA 2P66A 5D49A 9ICNA 4NM2A 4K4GA 3C2MA 2Q66A 4X4OA 9ICIA 4KLFA 4FH3A 4PHDA 4KLQA 1NOMA 3JPSA 5D4BA 2DVIA 4WC5A 1Q79A 4I2BA 5D46A 1MIWA 4RQ4A 5J2CA 5HR9A 3ISBA 4QZCA 4TUQA 5IINA 8ICGA 5CHGA 4JWMA 5DB8A 4MFAA 1NO5A 3RJHA 9ICBA 8ICOA 4TUSA 4KLJA 5HHIA 3L9DA 4AT9B 1ZQJA 2RFFA 1ZQRA 8ICWA 5EOZA 2DRAA 4X4VA 4UB5A 4DOBA 8ICNA 3B0YA 3OV7A 1ZJMA 4FHXA 4X0BA 4GXIA 5J2KA 3RJIA 1ZQWA 1ZQTA 7ICUA 5J0WA 8ICTA 2ZH6A 4UB3A 4X4PA 3OUYB 1ZQGA 1ZQFA 5J0QA 5HRDA 1ZQVA 4YN4A 5DBBA 4IQTA 4I27A 3V7LA 4O5CA 9ICTA 4ATBA 5DB9A 1TFWA 4QZDA 9ICRA 4QZAA 5J2GA 3TFRA 3RJEA 4X4TA 4LZDA 1MIVA 5IIMA 4RPZA 3AQLA 4YD2A 2FMSA 9ICUA 3C66A 4JWNA 1XSLA 3JPRA 3WFPA 4YMMA 1ZJNA 4M9HA 1ZQMA 2M2WA 4GXJA 4WC2A 3JPOA 1PX5A 2BPFA 5DKWA 2ISOA 5BOLA 9ICWA 4MFCA 3H38A 5HRGA 4MF8A 1R8AA 4FHVA 7ICJA 4FH5A 4PHAA 8ICBA 4IG8A 4I29A 3AUOA 7ICOA 5DBAA 2BE3A 3AQNA 4KLOA 4XUSA 4QZIA 5DB7A 4KLEA 4EBKA 4UAWA 3MBYA 2BCSA 4AT8A 1BPZA 3RH4A 4I28A 2DR9A 1ZQLA 1JMSA 5J0UA 4YD1A 3UPQA 8ICKA 8ICYA 4NLNA 4X4RA 5BOMA 3B0XA 4I2EA 2PFNA 5DDMA 4KLIA 4I2HA 4MF2A 8ICXA 3PMLA 3ISCA 4Z6FA 3HX0A 5IIKA 3AQKA 5J2HA 1RPLA 1ZQIA 4PHEA 4X4UA 4RT2A 8ICMA 5HREA 4PGXA 2HHPA 2ZHBA 4NM1A 2ZHAA 9ICMA 4RQ2A 4KLHA 4YMOA 2BCUA 4R65A 4E8FA 2PXIA 8ICRA 9ICFA 2ID1A 4AT7B 4M04A 2ZH3A 4RT3A 1HUZA 4XQ8A 5J0OA 5J2AA 4IQVA 9ICPA 1ZQOA 4PGYA 4QZEA 3UXNA 4EP7A 2ZH4A 4FO6A 1ZQKA 4LZGA 4RQ8A 4TURA 3RJGA 5IIIA 4X0AA 1Q78A 4I2AA 4I2GA 2DR5A 3WFSC 7ICFA 2I9GA 4QZ8A 1ZQSA 4IQUA 9ICGA 4M47A 5HRIA 1ZQUA 7ICNA 4RPYA 4RQ1A 4DO9A 2ZH7A 4M0AA 4YCXA 2PBEA 5CP2A 3OVSA 4PH5A 1HUOA 9ICCA 8ICFA 1ZQYA 5J2EA 4PGQA 4M9LA 1OU5A 4R64A 3C18A 4QZHA 4AT9A 1RZTA 2ZH8A 5HC9A 4E7XA 3UQ0A 5IIJA 5CA7A 4UBCA 4P4MA 4X5VA 1BPYA 5IIOA 4EBJA 1BPDA 3RH5A 4RPXA 1MIYA 4XRHA 4XQ7A 1F5AA 3HWTA 5TZVA 3H37A 9ICJA 2M2VA 4F5NA 8ICEA 4UD5A 2GWSA 4F5PA 4X4QA 2VANA 1ZQDA 5J0PA 4Z6EA 5J2JA 1MQ2A 4KLGA 3V7KA 1ZQNA 4UAYA 2DR7A 1VFGA 4WCWA 3LK9A 1UEVA 7ICVA 1JAJA 3C2KA 4QZ9A 1TV9A 4WC0A 5J29A 4KLLA 2IHMA 2M2UA 3AU2A 7ICKA 3C5FA 4WC6A 2FMPA 1XSNA 3UXPA 3C2LA 3GDXA 4UAZA 1MQ3A 8ICAA 5J2FA 4NLKA 4WC7A 4M9NA 5HRFA 4I2CA 3JYYA 3JPPA 3AU6A 5HRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZH2 A;  4YMN A;  4WC1 A;  8ICV A;  5DEC A;  4UB1 A;  3MGI A;  3WFR E;  1ZQA A;  8ICS A;  4LVS A;  4E80 A;  2BPG A;  4RWQ A;  2ZH9 A;  5BPC A;  4R66 A;  4KLD A;  4UB4 A;  3RH6 A;  3RJF A;  1JN3 A;  4RQ0 A;  9ICS A;  5HHH A;  3JPT A;  7ICE A;  3HJ4 A;  8ICH A;  1TVA A;  4RWP A;  7ICT A;  1JQR A;  4IQW A;  1UET A;  3MGH A;  4I2I A;  2ISP A;  3NYB A;  4RWN A;  4GXK A;  4NY8 A;  5J2D A;  1UEU A;  8ICJ A;  4DOC A;  3H39 A;  1BPE A;  1V4A A;  1YLQ A;  5DDY A;  3WFQ E;  5CJ7 A;  1ZQE A;  3RJJ A;  3MDC A;  1ZQC A;  3JPQ A;  4WBZ A;  3H3A A;  4O5K A;  8ICL A;  4AT7 A;  2ZH1 A;  4KLU A;  1ZQP A;  9ICL A;  4FHW A;  2BCV A;  4K4I A;  3PMN A;  1ZQH A;  3JZ0 A;  1BPX A;  4PPX A;  3WFO A;  4Z6C A;  4P4P A;  8ICP A;  7ICQ A;  2FMQ A;  9ICQ A;  5J0Y A;  2ZH5 A;  4DOA A;  4UD4 A;  3UPS A;  1KDH A;  4TUP A;  4X4S A;  3V7J A;  7ICG A;  3UQ2 A;  4F5Q A;  9ICO A;  4K4H A;  4X4N A;  4RQ7 A;  5J0R A;  2BCR A;  5J0T A;  2PFP A;  4WC3 A;  9ICX A;  1R8B A;  5CWR A;  5CR0 A;  5DED A;  7ICP A;  1ZQB A;  4ATB B;  4RQ3 A;  9ICV A;  4QZF A;  2DRB A;  3TFS A;  4M9J A;  3PNC A;  1R8C A;  4M2Y A;  5IIL A;  7ICL A;  5CB1 A;  8ICC A;  7ICS A;  4Z6D A;  4NKT A;  1VJ7 A;  4WC4 A;  8ICI A;  4M9G A;  3OUY A;  7ICI A;  3OGU A;  4I2F A;  2BPC A;  1R89 A;  1BPB A;  4KLS A;  1ZQZ A;  8ICU A;  2W9M A;  4R63 A;  4PHP A;  4NLZ A;  3AQM A;  4S3N A;  5HRB A;  5J2B A;  4P2H A;  3HJ1 A;  9ICE A;  4MFF A;  1XSP A;  4I2D A;  3ISD A;  4O5E A;  3OVB A;  2PFQ A;  4KLT A;  1WOT A;  8ICZ A;  1KNY A;  5HRL A;  3MDA A;  4LT6 A;  2BCQ A;  9ICH A;  4AT8 B;  3LQC B;  4O9M A;  5J2I A;  4F5O A;  5F2V O;  3RJK A;  2M2T A;  4FHP A;  1FA0 A;  1TFY A;  2O5A A;  7ICR A;  4QZG A;  2DR8 A;  1ZQQ A;  5J0X A;  4NKU A;  4P4O A;  9ICK A;  2O1P A;  4M5D A;  5DB6 A;  4UB2 A;  3OVA A;  7ICH A;  5HRH A;  3K75 D;  2NRK A;  1ZQX A;  4RWO A;  4RQ6 A;  4KLM A;  7ICM A;  4NXZ A;  2PFO A;  3JPN A;  4RQ5 A;  1KEJ A;  4XA5 A;  8ICQ A;  3V72 A;  3C5G A;  4UBB A;  3HW8 A;  3HIY A;  4FHY A;  5J0S A;  4WBY A;  4QZB A;  3UXO A;  4F5R A;  4I2J A;  9ICA A;  5DBC A;  2P66 A;  5D49 A;  9ICN A;  4NM2 A;  4K4G A;  3C2M A;  2Q66 A;  4X4O A;  9ICI A;  4KLF A;  4FH3 A;  4PHD A;  4KLQ A;  1NOM A;  3JPS A;  5D4B A;  2DVI A;  4WC5 A;  1Q79 A;  4I2B A;  5D46 A;  1MIW A;  4RQ4 A;  5J2C A;  5HR9 A;  3ISB A;  4QZC A;  4TUQ A;  5IIN A;  8ICG A;  5CHG A;  4JWM A;  5DB8 A;  4MFA A;  1NO5 A;  3RJH A;  9ICB A;  8ICO A;  4TUS A;  4KLJ A;  5HHI A;  3L9D A;  4AT9 B;  1ZQJ A;  2RFF A;  1ZQR A;  8ICW A;  5EOZ A;  2DRA A;  4X4V A;  4UB5 A;  4DOB A;  8ICN A;  3B0Y A;  3OV7 A;  1ZJM A;  4FHX A;  4X0B A;  4GXI A;  5J2K A;  3RJI A;  1ZQW A;  1ZQT A;  7ICU A;  5J0W A;  8ICT A;  2ZH6 A;  4UB3 A;  4X4P A;  3OUY B;  1ZQG A;  1ZQF A;  5J0Q A;  5HRD A;  1ZQV A;  4YN4 A;  5DBB A;  4IQT A;  4I27 A;  3V7L A;  4O5C A;  9ICT A;  4ATB A;  5DB9 A;  1TFW A;  4QZD A;  9ICR A;  4QZA A;  5J2G A;  3TFR A;  3RJE A;  4X4T A;  4LZD A;  1MIV A;  5IIM A;  4RPZ A;  3AQL A;  4YD2 A;  2FMS A;  9ICU A;  3C66 A;  4JWN A;  1XSL A;  3JPR A;  3WFP A;  4YMM A;  1ZJN A;  4M9H A;  1ZQM A;  2M2W A;  4GXJ A;  4WC2 A;  3JPO A;  1PX5 A;  2BPF A;  5DKW A;  2ISO A;  5BOL A;  9ICW A;  4MFC A;  3H38 A;  5HRG A;  4MF8 A;  1R8A A;  4FHV A;  7ICJ A;  4FH5 A;  4PHA A;  8ICB A;  4IG8 A;  4I29 A;  3AUO A;  7ICO A;  5DBA A;  2BE3 A;  3AQN A;  4KLO A;  4XUS A;  4QZI A;  5DB7 A;  4KLE A;  4EBK A;  4UAW A;  3MBY A;  2BCS A;  4AT8 A;  1BPZ A;  3RH4 A;  4I28 A;  2DR9 A;  1ZQL A;  1JMS A;  5J0U A;  4YD1 A;  3UPQ A;  8ICK A;  8ICY A;  4NLN A;  4X4R A;  5BOM A;  3B0X A;  4I2E A;  2PFN A;  5DDM A;  4KLI A;  4I2H A;  4MF2 A;  8ICX A;  3PML A;  3ISC A;  4Z6F A;  3HX0 A;  5IIK A;  3AQK A;  5J2H A;  1RPL A;  1ZQI A;  4PHE A;  4X4U A;  4RT2 A;  8ICM A;  5HRE A;  4PGX A;  2HHP A;  2ZHB A;  4NM1 A;  2ZHA A;  9ICM A;  4RQ2 A;  4KLH A;  4YMO A;  2BCU A;  4R65 A;  4E8F A;  2PXI A;  8ICR A;  9ICF A;  2ID1 A;  4AT7 B;  4M04 A;  2ZH3 A;  4RT3 A;  1HUZ A;  4XQ8 A;  5J0O A;  5J2A A;  4IQV A;  9ICP A;  1ZQO A;  4PGY A;  4QZE A;  3UXN A;  4EP7 A;  2ZH4 A;  4FO6 A;  1ZQK A;  4LZG A;  4RQ8 A;  4TUR A;  3RJG A;  5III A;  4X0A A;  1Q78 A;  4I2A A;  4I2G A;  2DR5 A;  3WFS C;  7ICF A;  2I9G A;  4QZ8 A;  1ZQS A;  4IQU A;  9ICG A;  4M47 A;  5HRI A;  1ZQU A;  7ICN A;  4RPY A;  4RQ1 A;  4DO9 A;  2ZH7 A;  4M0A A;  4YCX A;  2PBE A;  5CP2 A;  3OVS A;  4PH5 A;  1HUO A;  9ICC A;  8ICF A;  1ZQY A;  5J2E A;  4PGQ A;  4M9L A;  1OU5 A;  4R64 A;  3C18 A;  4QZH A;  4AT9 A;  1RZT A;  2ZH8 A;  5HC9 A;  4E7X A;  3UQ0 A;  5IIJ A;  5CA7 A;  4UBC A;  4P4M A;  4X5V A;  1BPY A;  5IIO A;  4EBJ A;  1BPD A;  3RH5 A;  4RPX A;  1MIY A;  4XRH A;  4XQ7 A;  1F5A A;  3HWT A;  5TZV A;  3H37 A;  9ICJ A;  2M2V A;  4F5N A;  8ICE A;  4UD5 A;  2GWS A;  4F5P A;  4X4Q A;  2VAN A;  1ZQD A;  5J0P A;  4Z6E A;  5J2J A;  1MQ2 A;  4KLG A;  3V7K A;  1ZQN A;  4UAY A;  2DR7 A;  1VFG A;  4WCW A;  3LK9 A;  1UEV A;  7ICV A;  1JAJ A;  3C2K A;  4QZ9 A;  1TV9 A;  4WC0 A;  5J29 A;  4KLL A;  2IHM A;  2M2U A;  3AU2 A;  7ICK A;  3C5F A;  4WC6 A;  2FMP A;  1XSN A;  3UXP A;  3C2L A;  3GDX A;  4UAZ A;  1MQ3 A;  8ICA A;  5J2F A;  4NLK A;  4WC7 A;  4M9N A;  5HRF A;  4I2C A;  3JYY A;  3JPP A;  3AU6 A;  5HRK A; 
#chains in the Genus database with same CATH topology
 2ZH2 A;  4YMN A;  4WC1 A;  8ICV A;  5DEC A;  4UB1 A;  3MGI A;  3WFR E;  1ZQA A;  2B4V A;  8ICS A;  4LVS A;  4E80 A;  2BPG A;  4RWQ A;  2ZH9 A;  3EF2 A;  5BPC A;  4R66 A;  4KLD A;  4UB4 A;  3RH6 A;  3RJF A;  1JN3 A;  4RQ0 A;  5CFU A;  9ICS A;  5HHH A;  3JPT A;  7ICE A;  3HJ4 A;  8ICH A;  1TVA A;  4RWP A;  7ICT A;  1JQR A;  4IQW A;  1UET A;  3MGH A;  4I2I A;  2ISP A;  3NYB A;  4RWN A;  4GXK A;  4NY8 A;  5J2D A;  1UEU A;  8ICJ A;  4DOC A;  3H39 A;  1BPE A;  1V4A A;  1YLQ A;  5DDY A;  3WFQ E;  5CJ7 A;  1ZQE A;  3RJJ A;  3MDC A;  4JLZ A;  2BBJ A;  1ZQC A;  3JPQ A;  5CFS A;  4LEZ A;  4WBZ A;  3H3A A;  4O5K A;  8ICL A;  4NXX A;  4AT7 A;  2ZH1 A;  4KLU A;  1ZQP A;  9ICL A;  4FHW A;  2BCV A;  4K4I A;  3PMN A;  1ZQH A;  3JZ0 A;  1BPX A;  4PPX A;  3WFO A;  4Z6C A;  4P4P A;  8ICP A;  7ICQ A;  2FMQ A;  9ICQ A;  5J0Y A;  2ZH5 A;  4DOA A;  4UD4 A;  3UPS A;  1KDH A;  3OWG A;  4TUP A;  4X4S A;  3V7J A;  7ICG A;  3UQ2 A;  4F5Q A;  9ICO A;  5JTG A;  4K4H A;  4X4N A;  4RQ7 A;  5J0R A;  2BCR A;  5J0T A;  2PFP A;  4WC3 A;  9ICX A;  4OAG A;  1R8B A;  5CWR A;  5CR0 A;  5DED A;  7ICP A;  1ZQB A;  4ATB B;  4RQ3 A;  9ICV A;  4QZF A;  2DRB A;  3TFS A;  4M9J A;  3PNC A;  1R8C A;  4M2Y A;  5IIL A;  7ICL A;  5CB1 A;  8ICC A;  7ICS A;  4Z6D A;  4NKT A;  1VJ7 A;  4WC4 A;  8ICI A;  4K96 A;  4M9G A;  3OUY A;  4KM5 A;  7ICI A;  3OGU A;  4I2F A;  2BPC A;  1R89 A;  4K99 A;  1BPB A;  4KLS A;  1ZQZ A;  8ICU A;  2W9M A;  4R63 A;  3ER8 C;  4HX0 A;  4PHP A;  4NXT A;  4NLZ A;  4K97 A;  3AQM A;  4O69 A;  3ERC C;  4S3N A;  5HRB A;  5J2B A;  4P2H A;  3HJ1 A;  9ICE A;  4MFF A;  1XSP A;  4I2D A;  3ISD A;  4O5E A;  4K98 A;  3OVB A;  2PFQ A;  4KLT A;  1WOT A;  4WQK A;  8ICZ A;  1KNY A;  5HRL A;  3MDA A;  4LT6 A;  2BCQ A;  9ICH A;  4AT8 B;  3LQC B;  4O9M A;  5J2I A;  4F5O A;  5F2V O;  3RJK A;  3NKU A;  2M2T A;  4FHP A;  1FA0 A;  1TFY A;  2O5A A;  7ICR A;  3MCR A;  3K7D A;  4QZG A;  2DR8 A;  1ZQQ A;  5J0X A;  4NKU A;  4P4O A;  9ICK A;  2O1P A;  4WOY A;  4KB6 A;  4M5D A;  5DB6 A;  4UB2 A;  3OVA A;  3CK6 A;  7ICH A;  5HRH A;  5D62 A;  3K75 D;  2NRK A;  1ZQX A;  4NXU A;  4RQ6 A;  4KLM A;  7ICM A;  4RWO A;  4NXZ A;  2PFO A;  3JPN A;  4RQ5 A;  2GAF D;  3NVO A;  1KEJ A;  4XA5 A;  8ICQ A;  3V72 A;  3C5G A;  4UBB A;  3HW8 A;  3HIY A;  4FHY A;  4LEY A;  5J0S A;  4WBY A;  4QZB A;  3UXO A;  4K9B A;  4F5R A;  4I2J A;  9ICA A;  5DBC A;  3ER9 B;  2P66 A;  5D49 A;  2B51 A;  3NWI A;  9ICN A;  4NM2 A;  4K4G A;  3C2M A;  4EEB A;  2Q66 A;  4X4O A;  2FCL A;  9ICI A;  4KLF A;  4FH3 A;  4PHD A;  4KLQ A;  1NOM A;  3JPS A;  5D4B A;  2DVI A;  2B56 A;  4WC5 A;  1Q79 A;  4I2B A;  4XJE A;  5D46 A;  1MIW A;  2IHO A;  4RQ4 A;  5J2C A;  5HR9 A;  3ISB A;  4QZC A;  4TUQ A;  5IIN A;  8ICG A;  5D63 A;  5CHG A;  4JWM A;  5DB8 A;  4MFA A;  1NO5 A;  3RJH A;  9ICB A;  8ICO A;  4TUS A;  4KLJ A;  5HHI A;  3L9D A;  4AT9 B;  1ZQJ A;  2RFF A;  1ZQR A;  8ICW A;  4O67 A;  5EOZ A;  2DRA A;  4X4V A;  4UB5 A;  4N7R A;  4DOB A;  4JLX A;  8ICN A;  3B0Y A;  3OV7 A;  1ZJM A;  4OAF A;  4LEW A;  4FHX A;  4X0B A;  4NXW A;  4GXI A;  5J2K A;  3RJI A;  1ZQW A;  1ZQT A;  7ICU A;  4O68 A;  5J0W A;  8ICT A;  2ZH6 A;  4UB3 A;  4X4P A;  3OUY B;  1ZQG A;  4OAI Z;  1ZQF A;  5J0Q A;  5HRD A;  4MKP A;  1ZQV A;  4YN4 A;  5DBB A;  4EGW A;  4IQT A;  4I27 A;  3V7L A;  4O5C A;  9ICT A;  4ATB A;  5DB9 A;  1TFW A;  4QZD A;  9ICR A;  1GPJ A;  4QZA A;  5J2G A;  3TFR A;  3RJE A;  3PHZ A;  4X4T A;  4LZD A;  1MIV A;  5IIM A;  4RPZ A;  3AQL A;  4YD2 A;  2FMS A;  9ICU A;  3C66 A;  4O6A A;  4JWN A;  1XSL A;  3JPR A;  3WFP A;  4YMM A;  1ZJN A;  4M9H A;  1ZQM A;  2M2W A;  4GXJ A;  4WC2 A;  3JPO A;  1PX5 A;  2HN2 A;  2BPF A;  5DKW A;  2ISO A;  5BOL A;  9ICW A;  4MFC A;  3H38 A;  5HRG A;  4MF8 A;  1R8A A;  4FHV A;  7ICJ A;  5CHE A;  4FH5 A;  4PHA A;  5D61 A;  8ICB A;  4IG8 A;  4I29 A;  3AUO A;  7ICO A;  5DBA A;  2BE3 A;  3AQN A;  4KLO A;  4XUS A;  4QZI A;  5DB7 A;  4KLE A;  4EBK A;  4UAW A;  3MBY A;  2BCS A;  4AT8 A;  4I0U A;  1BPZ A;  3RH4 A;  4I28 A;  2DR9 A;  1ZQL A;  2IUB A;  1JMS A;  5J0U A;  4YD1 A;  3UPQ A;  8ICK A;  8ICY A;  4NLN A;  4X4R A;  5BOM A;  3B0X A;  4I2E A;  2PFN A;  5DDM A;  4KLI A;  4I2H A;  4MF2 A;  8ICX A;  3PML A;  3ISC A;  4Z6F A;  4NXV A;  3HX0 A;  5IIK A;  3AQK A;  5J2H A;  1RPL A;  1ZQI A;  4PHE A;  4X4U A;  4RT2 A;  8ICM A;  5HRE A;  4PGX A;  2HHP A;  2ZHB A;  4NM1 A;  2ZHA A;  9ICM A;  4RQ2 A;  4KLH A;  4YMO A;  2BCU A;  4OAH A;  4R65 A;  4E8F A;  2PXI A;  8ICR A;  9ICF A;  2GA9 D;  2ID1 A;  4AT7 B;  4M04 A;  2ZH3 A;  4RT3 A;  1HUZ A;  4XQ8 A;  5J0O A;  5J2A A;  4IQV A;  9ICP A;  2EWR A;  1ZQO A;  4PGY A;  4QZE A;  4FO1 A;  3UXN A;  4EP7 A;  2ZH4 A;  4LEV A;  4FO6 A;  1ZQK A;  4LZG A;  4RQ8 A;  4TUR A;  3RJG A;  5III A;  4X0A A;  1Q78 A;  4I2A A;  4I2G A;  2DR5 A;  3WFS C;  7ICF A;  2I9G A;  3JCF A;  4QZ8 A;  1ZQS A;  4IQU A;  9ICG A;  4M47 A;  2HN1 A;  5HRI A;  1ZQU A;  7ICN A;  4RPY A;  4RQ1 A;  4DO9 A;  2ZH7 A;  4M0A A;  4YCX A;  2PBE A;  5CP2 A;  3OVS A;  4PH5 A;  1HUO A;  9ICC A;  8ICF A;  1ZQY A;  5J2E A;  4PGQ A;  4WQL A;  4M9L A;  1OU5 A;  4R64 A;  3C18 A;  4QZH A;  4AT9 A;  1RZT A;  2ZH8 A;  5HC9 A;  4E7X A;  3UQ0 A;  5IIJ A;  5CFT A;  5CA7 A;  4UBC A;  4P4M A;  4X5V A;  1BPY A;  2BBH A;  5IIO A;  4EBJ A;  1BPD A;  3RH5 A;  4RPX A;  1MIY A;  4XRH A;  4XQ7 A;  1F5A A;  3HWT A;  5TZV A;  3H37 A;  9ICJ A;  2M2V A;  4F5N A;  8ICE A;  4UD5 A;  2GWS A;  4EED A;  5B3Q A;  4F5P A;  4X4Q A;  4EV6 A;  2VAN A;  1ZQD A;  5B3P A;  5J0P A;  4Z6E A;  5J2J A;  1MQ2 A;  4KLG A;  3V7K A;  1ZQN A;  4UAY A;  2DR7 A;  1VFG A;  4K9A A;  4WCW A;  3LK9 A;  1UEV A;  7ICV A;  1JAJ A;  3C2K A;  4QZ9 A;  1TV9 A;  4WC0 A;  5J29 A;  4KLL A;  2IHM A;  2M2U A;  3AU2 A;  7ICK A;  3C5F A;  4WC6 A;  2FMP A;  1XSN A;  3UXP A;  4WH5 A;  3C2L A;  3GDX A;  4UAZ A;  1MQ3 A;  8ICA A;  5J2F A;  4NLK A;  4WC7 A;  4M9N A;  5HRF A;  4I2C A;  3JYY A;  3JPP A;  3AU6 A;  5HRK A;  4K8V A; 
#chains in the Genus database with same CATH homology
 2ZH2 A;  4YMN A;  4WC1 A;  8ICV A;  5DEC A;  4UB1 A;  3MGI A;  3WFR E;  1ZQA A;  8ICS A;  4LVS A;  4E80 A;  2BPG A;  4RWQ A;  2ZH9 A;  5BPC A;  4R66 A;  4KLD A;  4UB4 A;  3RH6 A;  3RJF A;  1JN3 A;  4RQ0 A;  9ICS A;  5HHH A;  3JPT A;  7ICE A;  3HJ4 A;  8ICH A;  1TVA A;  4RWP A;  7ICT A;  1JQR A;  4IQW A;  1UET A;  3MGH A;  4I2I A;  2ISP A;  3NYB A;  4RWN A;  4GXK A;  4NY8 A;  5J2D A;  1UEU A;  8ICJ A;  4DOC A;  3H39 A;  1BPE A;  1V4A A;  1YLQ A;  5DDY A;  3WFQ E;  5CJ7 A;  1ZQE A;  3RJJ A;  3MDC A;  1ZQC A;  3JPQ A;  4WBZ A;  3H3A A;  4O5K A;  8ICL A;  4AT7 A;  2ZH1 A;  4KLU A;  1ZQP A;  9ICL A;  4FHW A;  2BCV A;  4K4I A;  3PMN A;  1ZQH A;  3JZ0 A;  1BPX A;  4PPX A;  3WFO A;  4Z6C A;  4P4P A;  8ICP A;  7ICQ A;  2FMQ A;  9ICQ A;  5J0Y A;  2ZH5 A;  4DOA A;  4UD4 A;  3UPS A;  1KDH A;  4TUP A;  4X4S A;  3V7J A;  7ICG A;  3UQ2 A;  4F5Q A;  9ICO A;  4K4H A;  4X4N A;  4RQ7 A;  5J0R A;  2BCR A;  5J0T A;  2PFP A;  4WC3 A;  9ICX A;  1R8B A;  5CWR A;  5CR0 A;  5DED A;  7ICP A;  1ZQB A;  4ATB B;  4RQ3 A;  9ICV A;  4QZF A;  2DRB A;  3TFS A;  4M9J A;  3PNC A;  1R8C A;  4M2Y A;  5IIL A;  7ICL A;  5CB1 A;  8ICC A;  7ICS A;  4Z6D A;  4NKT A;  1VJ7 A;  4WC4 A;  8ICI A;  4M9G A;  3OUY A;  7ICI A;  3OGU A;  4I2F A;  2BPC A;  1R89 A;  1BPB A;  4KLS A;  1ZQZ A;  8ICU A;  2W9M A;  4R63 A;  4PHP A;  4NLZ A;  3AQM A;  4S3N A;  5HRB A;  5J2B A;  4P2H A;  3HJ1 A;  9ICE A;  4MFF A;  1XSP A;  4I2D A;  3ISD A;  4O5E A;  3OVB A;  2PFQ A;  4KLT A;  1WOT A;  8ICZ A;  1KNY A;  5HRL A;  3MDA A;  4LT6 A;  2BCQ A;  9ICH A;  4AT8 B;  3LQC B;  4O9M A;  5J2I A;  4F5O A;  5F2V O;  3RJK A;  2M2T A;  4FHP A;  1FA0 A;  1TFY A;  2O5A A;  7ICR A;  4QZG A;  2DR8 A;  1ZQQ A;  5J0X A;  4NKU A;  4P4O A;  9ICK A;  2O1P A;  4M5D A;  5DB6 A;  4UB2 A;  3OVA A;  7ICH A;  5HRH A;  3K75 D;  2NRK A;  1ZQX A;  4RWO A;  4RQ6 A;  4KLM A;  7ICM A;  4NXZ A;  2PFO A;  3JPN A;  4RQ5 A;  1KEJ A;  4XA5 A;  8ICQ A;  3V72 A;  3C5G A;  4UBB A;  3HW8 A;  3HIY A;  4FHY A;  5J0S A;  4WBY A;  4QZB A;  3UXO A;  4F5R A;  4I2J A;  9ICA A;  5DBC A;  2P66 A;  5D49 A;  9ICN A;  4NM2 A;  4K4G A;  3C2M A;  2Q66 A;  4X4O A;  9ICI A;  4KLF A;  4FH3 A;  4PHD A;  4KLQ A;  1NOM A;  3JPS A;  5D4B A;  2DVI A;  4WC5 A;  1Q79 A;  4I2B A;  5D46 A;  1MIW A;  4RQ4 A;  5J2C A;  5HR9 A;  3ISB A;  4QZC A;  4TUQ A;  5IIN A;  8ICG A;  5CHG A;  4JWM A;  5DB8 A;  4MFA A;  1NO5 A;  3RJH A;  9ICB A;  8ICO A;  4TUS A;  4KLJ A;  5HHI A;  3L9D A;  4AT9 B;  1ZQJ A;  2RFF A;  1ZQR A;  8ICW A;  5EOZ A;  2DRA A;  4X4V A;  4UB5 A;  4DOB A;  8ICN A;  3B0Y A;  3OV7 A;  1ZJM A;  4FHX A;  4X0B A;  4GXI A;  5J2K A;  3RJI A;  1ZQW A;  1ZQT A;  7ICU A;  5J0W A;  8ICT A;  2ZH6 A;  4UB3 A;  4X4P A;  3OUY B;  1ZQG A;  1ZQF A;  5J0Q A;  5HRD A;  1ZQV A;  4YN4 A;  5DBB A;  4IQT A;  4I27 A;  3V7L A;  4O5C A;  9ICT A;  4ATB A;  5DB9 A;  1TFW A;  4QZD A;  9ICR A;  4QZA A;  5J2G A;  3TFR A;  3RJE A;  4X4T A;  4LZD A;  1MIV A;  5IIM A;  4RPZ A;  3AQL A;  4YD2 A;  2FMS A;  9ICU A;  3C66 A;  4JWN A;  1XSL A;  3JPR A;  3WFP A;  4YMM A;  1ZJN A;  4M9H A;  1ZQM A;  2M2W A;  4GXJ A;  4WC2 A;  3JPO A;  1PX5 A;  2BPF A;  5DKW A;  2ISO A;  5BOL A;  9ICW A;  4MFC A;  3H38 A;  5HRG A;  4MF8 A;  1R8A A;  4FHV A;  7ICJ A;  4FH5 A;  4PHA A;  8ICB A;  4IG8 A;  4I29 A;  3AUO A;  7ICO A;  5DBA A;  2BE3 A;  3AQN A;  4KLO A;  4XUS A;  4QZI A;  5DB7 A;  4KLE A;  4EBK A;  4UAW A;  3MBY A;  2BCS A;  4AT8 A;  1BPZ A;  3RH4 A;  4I28 A;  2DR9 A;  1ZQL A;  1JMS A;  5J0U A;  4YD1 A;  3UPQ A;  8ICK A;  8ICY A;  4NLN A;  4X4R A;  5BOM A;  3B0X A;  4I2E A;  2PFN A;  5DDM A;  4KLI A;  4I2H A;  4MF2 A;  8ICX A;  3PML A;  3ISC A;  4Z6F A;  3HX0 A;  5IIK A;  3AQK A;  5J2H A;  1RPL A;  1ZQI A;  4PHE A;  4X4U A;  4RT2 A;  8ICM A;  5HRE A;  4PGX A;  2HHP A;  2ZHB A;  4NM1 A;  2ZHA A;  9ICM A;  4RQ2 A;  4KLH A;  4YMO A;  2BCU A;  4R65 A;  4E8F A;  2PXI A;  8ICR A;  9ICF A;  2ID1 A;  4AT7 B;  4M04 A;  2ZH3 A;  4RT3 A;  1HUZ A;  4XQ8 A;  5J0O A;  5J2A A;  4IQV A;  9ICP A;  1ZQO A;  4PGY A;  4QZE A;  3UXN A;  4EP7 A;  2ZH4 A;  4FO6 A;  1ZQK A;  4LZG A;  4RQ8 A;  4TUR A;  3RJG A;  5III A;  4X0A A;  1Q78 A;  4I2A A;  4I2G A;  2DR5 A;  3WFS C;  7ICF A;  2I9G A;  4QZ8 A;  1ZQS A;  4IQU A;  9ICG A;  4M47 A;  5HRI A;  1ZQU A;  7ICN A;  4RPY A;  4RQ1 A;  4DO9 A;  2ZH7 A;  4M0A A;  4YCX A;  2PBE A;  5CP2 A;  3OVS A;  4PH5 A;  1HUO A;  9ICC A;  8ICF A;  1ZQY A;  5J2E A;  4PGQ A;  4M9L A;  1OU5 A;  4R64 A;  3C18 A;  4QZH A;  4AT9 A;  1RZT A;  2ZH8 A;  5HC9 A;  4E7X A;  3UQ0 A;  5IIJ A;  5CA7 A;  4UBC A;  4P4M A;  4X5V A;  1BPY A;  5IIO A;  4EBJ A;  1BPD A;  3RH5 A;  4RPX A;  1MIY A;  4XRH A;  4XQ7 A;  1F5A A;  3HWT A;  5TZV A;  3H37 A;  9ICJ A;  2M2V A;  4F5N A;  8ICE A;  4UD5 A;  2GWS A;  4F5P A;  4X4Q A;  2VAN A;  1ZQD A;  5J0P A;  4Z6E A;  5J2J A;  1MQ2 A;  4KLG A;  3V7K A;  1ZQN A;  4UAY A;  2DR7 A;  1VFG A;  4WCW A;  3LK9 A;  1UEV A;  7ICV A;  1JAJ A;  3C2K A;  4QZ9 A;  1TV9 A;  4WC0 A;  5J29 A;  4KLL A;  2IHM A;  2M2U A;  3AU2 A;  7ICK A;  3C5F A;  4WC6 A;  2FMP A;  1XSN A;  3UXP A;  3C2L A;  3GDX A;  4UAZ A;  1MQ3 A;  8ICA A;  5J2F A;  4NLK A;  4WC7 A;  4M9N A;  5HRF A;  4I2C A;  3JYY A;  3JPP A;  3AU6 A;  5HRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...