4TURA

Human dna polymerase beta inserting dcmpnpp opposite the 5'g of cisplatin crosslinked gs (pt-gg2)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4turA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4turA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4turA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4turA03
3H4BA 1WCNA 1C7YA 3EPIA 9ICIA 2ZH8A 5HREA 2NRVA 3EYZA 4IR9A 4NY8A 4IR1A 5KT7A 3H40A 1TFWA 8ICZA 2O1PA 3GIIA 4M5DA 5DQGA 2W8LA 2M9NA 4DOAA 5HC9A 2DVIA 4O3QA 4RQ1A 2AGPA 2P6RA 4M2YA 4IRCA 4F2SA 4UB1A 2W9AA 4TUPA 2C22A 2J6TA 4K4IA 4YXMA 9ICBA 4PGQA 3AQKA 1BPDA 2BKEA 5KG3A 4TURA 7ICUA 4WC1A 4FO6A 2PI5A 4O3OA 2JEIA 1ZQFA 8ICFA 1OU5A 2ATLA 4QWAA 1DK3A 4ELUA 3C1ZA 4EBKA 1SKWA 3HWTA 3N4MB 3RJGA 2ZH2A 1ZQYA 1T4GA 2ZH3A 3BJYA 4F4XA 1JXLA 1BPZA 4EYHB 1D8YA 2MUTA 8ICQA 1IM4A 9ICVA 3HJ1A 2KZ3A 3PW7A 1BPEA 3RB3A 1A76A 1KLNA 4YMOA 3B0XA 9ICJA 2FMQA 3HW8A 2M2VA 8ICKA 5J0YA 3UQ0A 5J2BA 5KG2A 4ATBB 4DOCA 4GC6A 3OHAA 4WC4A 4ED2A 3ZD8A 4DLGA 7ICMA 3RB6A 5DQIA 5DG7A 5DG8A 5IIMA 4JK1A 4PH5A 3H37A 4YD2A 4R65A 3MFHA 4ECXA 2P66A 5KFXA 1ZQEA 3RJKA 4C8OA 3UPQA 2UVVA 5HP4A 5IIKA 3PVXA 2OWOA 4I2DA 9ICAA 2BPCA 4ED8A 1ZQBA 4O3SA 9ICPA 9ICTA 5JUMA 3RB0A 4F5OA 4F5PA 1MQ2A 1ZJMA 3HT3A 2W9CA 2Q0ZX 4RQ3A 4NLZA 4G3IA 3MR3A 2RFFA 1DOQA 4X4VA 2JEGA 4RWQA 1BPBA 5IIJA 2ZUBA 4JV0A 2ZJAA 2PXIA 4HYKA 3Q8LA 3G6YA 3RJEA 5KG4A 8ICEA 3KHHA 1KEJA 4DL3A 5L1JA 1KNYA 2H5XA 3MR5A 1DK2A 5KT4A 1ZQRA 2MAXA 3GDXA 5TZVA 4F92B 5J0RA 4QWCA 1RZTA 4TUSA 4DQSA 9ICRA 4QWEA 2HHXA 5KFKA 1DGSA 4M6WA 2UVUA 2IHNA 1KFTA 4PGXA 4ED0A 4M0AA 4KLHA 9ICGA 2ZH6A 3LWMA 1ZYQA 3T3FA 3ORYA 5L1IA 1ZQPA 1PZNA 2XGPA 3ZDBA 1T8EA 4DWIA 4I2FA 2BE3A 2Q66A 2VANA 1X9SA 5BPCA 9ICUA 1U4BA 3MGHA 2P6UA 2W9CB 3H8SA 1R8CA 4UBCA 5KFJA 4F5NA 4DS4A 3RJJA 3OVSA 4YQWA 8ICCA 1KFDA 1QSYA 4KLTA 4X4PA 2ZH1A 5IILA 5CWRA 3OUYB 3NYBA 3BQ0A 4XRHA 4DQQA 5L9XA 3C2KA 4DL4A 1WOTA 1TK5A 4FHPA 5D49A 2Y1IA 4JWNA 4DO9A 4KLEA 2HHQA 8ICWA 1SL1A 3B0YA 2BGWA 4MEXA 3M9NB 4F4ZA 9ICFA 2V9WA 3BDPA 4J9MA 4M6WB 4Q8EA 4RWOA 4X4OA 4F4KA 4MEYA 4RQ6A 2RDJA 8ICXA 1L3UA 3GV5B 4K4HA 2ZTEA 1L3TA 3PX0A 1NK5A 5L1LA 3M9MB 3V6HA 1ZQSA 5KFYA 4ELVA 3K75D 3ZDDA 3GILA 5DGAA 2FLLA 4X4TA 4KLJA 4J9PA 5IIIA 4AT9A 2JZBB 4RT2A 4EYIB 4DLEA 4KLMA 4TUQA 4RQ2A 4DOBA 5KFQA 2BQ3A 2R8GA 1JMSA 4NXZA 3KTQA 4BXOB 4X4SA 5KFNA 3JPQA 4NKUA 4FH5A 1CUKA 5EWFA 5CP2A 5J2IA 4UD4A 5HRGA 3HP6A 4JV2A 3H7IA 4ZH4A 5DQHA 4I28A 2W8KA 5HRFA 4P4OA 3TAQA 1XS9D 2FPLA 1FA0A 5HRBA 4ED3A 1TVAA 2ZH4A 2DR7A 2ZJ8A 1QTMA 4QZBA 1ZQWA 4YG2A 2BHNA 4J9QA 5IINA 2Y1JA 1NJWA 4MFFA 1MIYA 2HHWA 1UT8A 1ZQDA 4DFJA 4DSLA 1ZQQA 1T3NA 7ICQA 1KFSA 1NK8A 4KLUA 5J2GA 4YR2A 4ED6A 1A77A 4I2JA 3V7LA 4DSEA 3AU6A 4DSJA 4FBUA 4I2AA 4M04A 8ICHA 1UEVA 4YP3A 4S3NA 4RQ5A 3T5JA 4RT3A 1H38A 4NM1A 1TFYA 1RYRA 4RPZA 4TQSA 2GWSA 4I27A 3C1YA 4WC6A 3THVA 2C2EA 5F9LA 5J2AA 2JEFA 2ALZA 3H39A 1S10A 4AT9B 4LT6A 2DPJA 5DDMA 5EWGA 3L9DA 4MF8A 1KSPA 5KFFA 4ECRA 4MF2A 5KFOA 3GIKA 3C5FA 3BQ1A 4QZEA 2VA2A 5CR0A 9ICKA 1TKDA 4NM2A 4BDPA 5J2DA 3QE9Y 5J2JA 4Q8FA 4LZDA 8ICSA 8ICLA 1Z00A 3V7JA 3T5LA 4M47A 2HW3A 7ICFA 5KG7A 2BCQA 3WFQE 2C2DA 4DFMA 8ICYA 1MIVA 1D9DA 4KMUA 3MR6A 1K1SA 3OJSA 3GIMA 1NK0A 4UD5A 1BVSA 4GXJA 2ASDA 1ZQTA 1XSLA 9ICMA 2V4QA 3C23A 2W9BA 4M9NA 4J9NA 4DSKA 1S76D 5J0PA 1AROP 3PO4A 1ZQLA 3HIYA 1NK9A 4E8FA 2A1JA 4QWBA 1XU4A 9ICQA 3Q8PB 4C8LA 4QZ8A 3Q8RB 3TI0A 4I2BA 2UVRA 4C8KA 4QWDA 4YN4A 3JPTA 3ISBA 1T7PA 3RAXA 5J0SA 3SYZA 4I29A 4FBTA 3HX0A 4EBJA 5F2VO 4FHXA 4IG8A 3ZDCA 4UAYA 4F2RA 5J0UA 3Q8KA 3JZ0A 2ZHBA 4RZRA 5KFLA 2ZUDA 5C5JA 4PHAA 5CHGA 4Q43A 2ZUCA 4F4WA 5KT2A 3RH4A 2AGOA 1L3SA 4O5EA 5KFTA 9ICHA 1NO5A 4UB3A 3RBDA 2DR9A 3V6KA 1NK4A 3PY8A 1SKRA 5D46A 2XCPA 4EEYA 3FDSA 3RBEA 1QSSA 5J0WA 5HMMA 1ZQNA 5HRIA 1R89A 3OGUA 4FHVA 2MUTB 5KFWA 3RTVA 5KFGA 4UAWA 4DQRA 5J0QA 4AT8A 4F50A 4FH3A 3GFKB 2KFNA 1X2IA 3EPGA 5KFRA 4KLGA 4KLOA 4RPXA 2PFNA 3GIJA 1ZQKA 2W9BB 4DL6A 4RQ4A 1NJXA 1QSLA 5KFSA 4QW9A 2ID1A 3LDAA 2FLPA 3C5GA 4BWJA 3FYHA 1S77D 4UB4A 5J2FA 5KFZA 2VA8A 2ZH7A 4UQGA 2XO7A 2I1QA 4F93B 4J9SA 4C8MA 1B22A 4GC7A 3MGIA 3OV7A 4DQIA 5CA7A 3C66A 4M9HA 4WC2A 3PX4A 2PFPA 7ICHA 5J2EA 7ICOA 4PHDA 4ECSA 3TANA 9ICNA 3TFSA 4EBDA 4XQ8A 1SL2A 2IMWP 4DSIA 1SL0A 4X4UA 4I2IA 3C18A 1XSNA 1TV9A 1UETA 1NKBA 3Q8QB 3WFRE 1XO1A 1Y88A 3RR8A 3PR4A 2FPKA 4J9KA 4F5RA 3JYYA 1SZPA 5KFDA 4NKTA 5CB1A 4KLIA 5F9NA 1RPLA 5J2KA 3UPSA 4DEZA 4DF4A 4X5VA 1B43A 4BGDA 4FS2A 4O3PA 3EW9A 5KFBA 1ZQJA 4XQ7A 3TAPA 5HNKA 4RNOA 2HHTA 2NRKA 3EZ5A 4QZIA 2XCAA 4PHEA 2BCUA 5HRHA 1PX5A 1UT5A 1MC8A 5J2CA 1S0VA 3NGDA 1EXNA 3C21A 4NLNA 4EBCA 2F1HA 4CCHA 2FLNA 2BQRA 8ICTA 1TFRA 1MIWA 1MQ3A 3M8RA 1NOMA 5CJ7A 1JX4A 4QZCA 3M8SA 4F91B 4LVSA 3H4DA 1V4AA 8ICOA 2J6UA 1BGXT 4YMNA 2ISPA 2R8IA 4JWMA 2BCVA 7ICPA 2VA3A 1HUOA 4FHWA 3RH5A 4JV1A 4R8UA 3GQCA 2AJQA 1COOA 1K1QA 4O5CA 3MFIA 3KHLA 5J0XA 9ICLA 2ZTCA 3OVAA 4WBZA 1S0OA 1D8LA 4YFKA 5L1KA 3MBYA 4ED1A 5HRLA 1S0MA 5DECA 3QZ8A 5KTQA 5DLGA 2PFOA 1HJPA 3PW2A 2AU0A 3H8WA 4R66A 2IA6A 4IRKA 3QEBZ 1ZQOA 4YR0A 2HVIA 1NJYA 2LYHA 4B9VA 4IQTA 8ICAA 2M2WA 2WTFA 3KHRA 1XSPA 4ED7A 2JEJA 4O9MA 3WFSC 3V72A 4B9LA 3N97B 7ICVA 1KTQA 4YXJA 3GV7B 5KFUA 8ICNA 2HHPA 4QZGA 3JPSA 3RR7A 1UA1A 1RYSA 3RAQA 2ISOA 3OJUA 4QZAA 4YR3A 5KT3A 3AUOA 1ZQMA 3RJHA 3PMLA 2C28A 2AGQA 3EWAA 4F8RA 9ICEA 4WBYA 4ECVA 2XY7A 2ZH9A 3QEAZ 2B21A 2ZTDA 1ZJNA 4B9SA 2BCSA 1HUZA 1NKCA 1ZQCA 4R8UB 2KZMA 3SZ2A 3PMNA 7ICSA 1TK0A 4RNNA 4ECWA 4I2CA 9ICOA 1JQRA 5KG5A 4RQ7A 3MR2A 5J0TA 3KHGA 3JPNA 1LB2B 4KLQA 5HMLA 3JPPA 3LQCB 4WC3A 3G6VA 1KDHA 3OSPA 1X9WA 4NLKA 5BOLA 4E0DA 1S97A 2R8KA 5KG1A 4IQVA 4J9RA 4WCWA 4F4YA 1UA0A 8ICMA 5DLFA 5KG6A 1NJZA 3LK9A 4ATBA 4X0AA 5J0OA 3OVBA 2ZHAA 4KN7A 3PNCA 4WC0A 1ZETA 5HR9A 2DR8A 3MDAA 8ICUA 2BR0A 4YCXA 3OSNA 4O3NA 4E80A 1VJ7A 1S0NA 4DL7A 3HPOA 4QW8A 1U48A 1JAJA 1V9PA 5KFMA 5BOMA 3PO5A 2M2UA 4QZ9A 4F5QA 1JIHA 5EWEA 4FS1A 3H8JA 1TK8A 4UAZA 4M9JA 3WFOA 2KN7A 4WC5A 1UEUA 4RUAA 3GV8B 3ISDA 5DBBA 5J2HA 4RQ0A 4RPYA 2O5AA 1KRPA 3Q8SB 1N56A 1R8BA 4X4RA 4LZGA 8ICBA 2I9GA 2RDIA 1ZQGA 3PX6A 3IM1A 9ICXA 3ZDAA 2BPFA 2HVHA 4EZ6A 2ASJA 8ICGA 4QZFA 5DGBA 3RB4A 4X4QA 1YLQA 4DS5A 3PW5A 3RJFA 4DQPA 5KFHA 4DF8A 2KTQA 4GXIA 4DL5A 2FMPA 1Z00B 3AU2A 3PW0A 3K4GA 4YVZA 4XUSA 4IQWA 8ICJA 3H38A 3WFPA 3PR5B 4KLFA 2IBKA 1U49A 4ELTA 1NZPA 2NRWA 3C2LA 4MFCA 4KITB 4YMMA 2DRAA 4P2HA 3Q8MA 4DL2A 1WCLA 2DFLA 4B9TA 5HRKA 1TAUA 3MDCA 3AQLA 4ECYA 7ICGA 2A1JB 4P4PA 3BQ2A 1IXRA 4I2GA 4E7XA 2NRZA 2FMSA 2M2TA 4J9LA 3V7KA 4ECTA 4KN4A 3RJIA 2ASLA 1JN3A 1ZQZA 1ZQAA 3M9OB 4PPXA 1N48A 4I2HA 3E2EA 2AQ0A 5HHHA 9ICCA 4ECUA 4AT7A 1TAQA 5KFPA 1ZQVA 3UXOA 3OUYA 2F1JA 5KT5A 2HHSA 4Z6CA 5DBCA 1MSWD 1LV5A 4R63A 5DDYA 4RNMA 3ETLA 5DB7A 1ZQHA 3JPRA 2HHUA 4AT8B 2IHMA 4Z6FA 2XY6A 4B9NA 1RXWA 3ISCA 1NKEA 2DRBA 4RWNA 4EBEA 1BPXA 4X4NA 5DB8A 2R8JA 4C8NA 3SV4A 4KLSA 4KLLA 3AQMA 4UBBA 4B9MA 1S9FA 5EOZA 3UXNA 5KFAA 3BQTA 1Q78A 4X0BA 5IIOA 1L5UA 7ICEA 1BPYA 3T5KA 2ZH5A 1ZQUA 1VFGA 1R8AA 4RWPA 5KFCA 4I2EA 2NRTA 2DPIA 4M9LA 7ICKA 1ZQXA 4ECQA 2NRXA 2BQUA 3AQNA 2J6SA 4DSFA 7ICLA 2C2RA 4ECZA 2JZBA 7ICIA 1RXVA 1NK6A 4AT7B 1JXEA 4XA5A 3UQ2A 8ICRA 7ICRA 1Q79A 5DB9A 4BXOA 3JPOA 4MFAA 4Q44A 4QZHA 1Z3EB 4IQUA 4PGYA 4TQRA 2V4RA 3RRHA 2FPMA 1L3VA 2PFQA 2W9MA 4UB5A 4K4GA 3SI8A 4R64A 4M9GA 2KZZA 9ICWA 5DB6A 7ICJA 3LWLA 4FHYA 1F5AA 4UB2A 3TARA 2BPGA 2ZJ5A 4Q45A 1QLNA 7ICNA 1D9FA 2PI4A 2R8HA 4O3RA 2HHVA 2KP7A 1SKSA 2XGQA 3H3AA 1CEZA 2DR5A 4GXKA 5KFVA 4IRDA 4KTQA 3MABA 1NK7A 3G6XA 2XY5A 4PHPA 3SV3A 3HJ4A 5DG9A 3RH6A 2PBEA 4DFKA 3RRGA 4O0IA 9ICSA 3V6JA 4Z6EA 1U9LA 4P4MA 4JUZA 4EZ9A 3IHQB 5KG0A 2XC9A 3C2MA 2BDPA 8ICPA 4Z6DA 3NTUA 5KFEA 4RU9A 7ICTA 1ZQIA 4QZDA 4RQ8A 3QZ7A 4J9OA 3T5HA 1U47A 4KLDA 5HRDA 2KFZA 4NLGA 2F1IA 5DKWA 5HHIA 5KFIA 3OHBA 3ZDEA 4BWMA 4GLXA 2AQ4A 5DEDA 1U45A 4EP7A 4WC7A 4B9UA 3PW4A 2BCRA 1BNPA 3PV8A 3UXPA 1XWLA 3TQ1A 2UVWA 1BNOA 1XC9A 1X9MA 8ICVA 8ICIA 4YD1A 4DFPA 3TFRA 5KT6A 3ZD9A 5D4BA 4O5KA 5DBAA 5J29A 4F3OA 4RUCA
chains in the Genus database with same CATH superfamily
3H4BA 2ZH8A 4C80A 2E1FA 2JRZA 2YMPA 4IR9A 4IR1A 4FFDA 3GIIA 2ZIUB 4O3QA 2AGPA 1GO3F 5F3XB 2W9AA 4EGWA 3AQKA 9ICBA 4FE3A 3CK6A 5KG3A 7ICUA 4WC1A 1OU5A 2WAQF 3NASA 3N4MB 2ZH3A 3BJYA 2MUTA 3BZKA 1BPEA 1A76A 2HMXA 2M2VA 1VDVA 4GC6A 1KL9A 4JLXA 2JHDA 5ALIA 5DQIA 5IIMA 4JK1A 3UPSA 2P66A 4C8OA 1PVQA 4NXXA 5HP4A 1ZQBA 4F5OA 3HT3A 3MR3A 1DOQA 3UMBA 3GU3A 2ZUBA 2ZJAA 3HKZC 3Q8LA 3KHHA 4DL3A 4C4RA 2MAXA 2HDOA 5AI0A 4OO1J 1V97A 4QWEA 2HHXA 3K1RB 2K4PA 3I1YA 1KFTA 4NJ8A 4KLHA 9ICGA 3ORYA 5L1IA 5HR7A 3MGHA 3H8SA 4LEYA 3RJJA 1J97A 2HBLA 5IILA 5CWRA 1COKA 3BQ0A 4DQQA 2G09A 5B3PA 5D61A 4KLEA 2HHQA 2BGWA 2LM4A 1WYGA 1PK3A 4F4KA 5D63A 1UPHA 3M9MB 5KFYA 3ZDDA 2JMGA 5DGAA 1FIQA 4KLJA 2FDRA 4J9PA 5IIIA 3H0LB 4RT2A 4EYIB 2A3VA 4KLMA 4PZNA 3NKUA 4DOBA 5KFNA 5DQHA 1XS9D 1FA0A 1Z4OA 3OTQA 5ALEA 2ZH4A 1QTMA 4MFFA 4YG2A 2BHNA 4J9QA 1KFSA 2H3IA 1A77A 4I2JA 2K8AA 8ICHA 4YP3A 4S3NA 4RQ5A 3T5JA 2YMMA 1X40A 2NV3A 4UW9A 5CHEA 3THVA 4OJ5A 2ALZA 1S10A 4LT6A 2DPJA 5ALSA 1YZ6A 5KFFA 3BQ1A 5JRTA 4NM2A 1L6NA 3U26A 5J2JA 2W7PA 2HOQA 2HW3A 3T5LA 4M47A 4C7ZA 3MR6A 5AM0A 3OJSA 1B0XA 4GXJA 5HR6A 1XSLA 2GH1A 3C23A 4DSKA 4E8FA 1N60A 3PO4A 2W3SA 1XU4A 3Q8PB 3Q8RB 3TI0A 4QWDA 4YN4A 3D2NA 4EBJA 3SMVA 4IG8A 3O0FA 4Q43A 3RH4A 5KT2A 1NO5A 2E8PA 4UB3A 3RBDA 3PY8A 5D46A 5J0WA 2WF6A 1R89A 2YTUA 5KFGA 3SAFA 5J0QA 4FH3A 4GIBA 4RPXA 4I0UA 4RQ4A 4QW9A 5G5HA 3C5GA 4JMUA 1FO4A 2XO7A 1B22A 4GC7A 1J2MA 3HKZF 4NLCA 3AQFA 4M9HA 1FFVA 7ICHA 4PHDA 4EBDA 4O3MA 4X4UA 1KW4A 3EF2A 1UETA 3RR8A 1JRPA 3PR4A 3JYYA 1P7DA 2VIXA 5CB1A 4KLIA 3KZXA 4X5VA 2ZIXA 4FS2A 4O3PA 3EW9A 1ZQJA 3TAPA 3EZ5A 4QZIA 2XCAA 4PHEA 1PX5A 2YY6A 1T94A 4WQKA 5J2CA 4CGZA 3NGDA 3PSPA 3C21A 2F1HA 3TADC 5B66U 2BQRA 1TFRA 1MQ3A 3M8RA 1NOMA 5CJ7A 4F91B 4PZOA 1V4AA 1RYUA 2RP5A 2BCVA 2VA3A 4CF5A 2JV3A 2A19A 4O5CA 3MFIA 4C4SA 9ICLA 2G08A 2ZIXB 4YFKA 2LYBA 1S0MA 1RM6C 1HJPA 3H8WA 3QEBZ 1ZQOA 1NJYA 2LYHA 2WF9A 2G06A 4IQTA 8ICAA 2WTFA 2W43A 3KHRA 1XSPA 2JEJA 4O9MA 2MU2A 7ICVA 4B9LA 1KTQA 5KFUA 8ICNA 4QZGA 3RR7A 2K8CB 2BZFA 2QB0A 4F8RA 3RJHA 3PMLA 1PUZA 5ALWA 4WBYA 2XY7A 3NUQA 3QEAZ 2HOFA 3NVOA 1ZQCA 7ICSA 4MHVA 2H3ZA 1ZD4A 4RQNA 5ALMA 1S5LU 1LB2B 3IG5A 2YB4A 4E0DA 4J9RA 4IQVA 1UA0A 1NI3A 5DLFA 3LK9A 2ZHAA 4WC0A 1ZETA 2GOLA 8ICUA 2BR0A 4LJXA 2QB0B 4E80A 1VJ7A 4PL2A 1X42A 4Y2SA 5EWEA 3WFOA 1N2XA 1UEUA 3ISDA 4X4RA 2I9GA 4IS7A 3PX6A 3IM1A 5AK4A 9ICXA 2HVHA 3GZFA 8ICGA 4KMOB 4QZFA 2QKQA 3RB4A 2F2AB 3RJFA 5KFHA 2FMPA 2DBYA 1Z00B 8ICJA 3WFPA 4RQMA 3PR5B 4KLFA 3LVVA 4KITB 4YMMA 3Q8MA 1WCLA 2DFLA 2K4HA 2Z7JA 3BQ2A 4CNQA 4Y2PA 2FMSA 4ECTA 4Y2YA 1ZQZA 4I2HA 3KD3A 2QARA 2CRXA 4ECUA 1SIJA 1TAQA 4BJQA 3OUYA 2F1JA 2PMZC 5KT5A 1MSWD 4Z6CA 5DBCA 2G5HB 1LV5A 5DB7A 3JPRA 4AT8B 1T3QA 5ALJA 3L3FX 3BS7A 2B51A 3AQMA 4UBBA 4K96A 2W7OA 5IIOA 2ZH5A 3T5KA 1R8AA 4RWPA 4I2EA 4QJFB 2DPIA 3WU2U 1IG6A 1ZQXA 2NYVA 2NRXA 2J6SA 2QARB 7ICIA 2JZBA 1RXVA 1JXEA 1OXJA 4NXVA 3JPOA 4QZHA 4TQRA 4PGYA 2V4RA 2HOIA 2M2TA 2W9MA 7ICJA 7ICNA 3F5EA 3TARA 2MSNA 5AKYA 1WUDA 2R8HA 3MGVA 3WK8A 3NWIA 5ALGA 4IRDA 1NK7A 2XY5A 2PBEA 3RRGA 3TACB 3A0BU 4Z6EA 2KIWA 3SD7A 2BDPA 4WJ3B 4Z6DA 2Y0SF 1ZQIA 4KLDA 3T5HA 1U47A 4NLGA 4K98A 2AQ4A 1NNLA 3PW4A 3UXPA 1XWLA 3F53A 2OHFA 8ICVA 3TFRA 5KT6A 1SV0C 1DRGA 2ZIVA 3NRZA 2LYAA 3NVYA 1C7YA 2K60A 4NY8A 3H40A 8ICZA 4M5DA 5DQGA 2W8LA 2P6RA 4IRCA 2J6TA 3ED5A 2BKEA 8ICFA 2ATLA 1DK3A 4QWAA 3QYPA 4EBKA 2KNJA 1SKWA 2KVSA 4F4XA 8ICQA 3HJ1A 1VLBA 2KZ3A 2LMRA 1KLNA 2CXYA 4YMOA 9ICJA 3UQ0A 2YN4A 5AI5A 1TAMA 4ED2A 4EX6A 4DLGA 4G9BA 7ICMA 4BX9C 5DG8A 4PH5A 2KJ9A 1MIWA 3RJKA 2XICA 2OWOA 4O3SA 9ICTA 2N1RA 3MCRA 4UARA 4JLZA 1ZJMA 2IOFK 2W9CA 3UMGA 4RQ3A 4X4VA 2IOHA 1BPBA 5IIJA 2PXIA 3G6YA 3RJEA 8ICEA 3QUQA 1ZQRA 3GDXA 5J0RA 4QWCA 1RZTA 4LEZA 4OAHA 4M6WA 2P35A 4PGXA 4M0AA 3AM9A 3F5AA 2EANA 3T3FA 2Q66A 2YMLA 3ER8C 2BE3A 1PVRA 3J81j 1RQLA 5BPCA 9ICUA 1L7PA 2W9CB 1R8CA 3OVSA 8ICCA 4KLTA 4K97A 3NYBA 4NL9A 3ALRA 4QNLA 3C2KA 1A6SA 1M6YA 5EE0A 1TK5A 5D49A 2G5IB 1ZD5A 8ICWA 4MEXA 4F4ZA 5E79U 9ICFA 4J9MA 4M6WB 4Q8EA 3GV5B 4K4HA 5B3QA 4KB6A 3D2SA 4IC9A 3GILA 2FLLA 4X4TA 5AKZA 2DL0A 3QU2A 2KG5A 4Y2XA 2G0AA 4NXZA 4BXOB 4X4SA 3JPQA 5EWFA 5J2IA 1N63A 3DEEA 4C0ZA 4UD4A 1ED1A 5HRGA 4Y2VA 3HP6A 3WKDA 1KBUA 1ZRNA 1TVAA 4OAIZ 4QZBA 2HHWA 1ZQDA 4DFJA 4DSLA 1ZQQA 1T3NA 7ICQA 1NK8A 4YR2A 3AU6A 4FBUA 4DSEA 1F5AA 1WWVA 2L5YA 1UEVA 2IUBA 1TFYA 5ALVA 4RT3A 1H38A 2GWSA 4RPZA 5G5GA 3WKAA 4TQSA 4NXUA 3C1YA 5F9LA 5J2AA 3L9DA 4MF2A 4AP9A 2VA2A 1N61A 5AKKA 3QE9Y 4Q8FA 5KL8B 8ICSA 8ICLA 2O6KA 3QU5A 2BCQA 3R9KA 1Z4NA 4DFMA 2D6FC 3GIMA 1K1SA 4UD5A 1NK0A 1BVSA 1L7OA 5D62A 3WK5A 2V4QA 2W9BA 3HIYA 2RQ5A 1Q3VA 4JB3A 4C8KA 5AICA 5J0SA 3HRDD 4FHXA 2E8OA 4F2RA 3ERCC 1PK1A 5C5JA 4F4WA 2ZUCA 5EE9A 4XJEA 2DR9A 1NK4A 4US8A 3FDSA 5HMMA 2MUTB 5KFWA 4DQRA 4F50A 1VJ5A 3QNMA 1IIPA 4KLGA 4KLOA 2PFNA 1ZQKA 1PVPA 4OCZA 2W9BB 1JALA 2R18A 5KFSA 2FLPA 3QUCA 4BWJA 5H2FU 4HX0A 2VA8A 4USAA 4K8VA 1TE2A 2LM1A 3PX4A 2GLEA 3BQ7A 3TANA 3TFSA 4XQ8A 1SL2A 2KMDA 3C18A 1XSNA 1Z1BA 4NKTA 1SZPA 3SENA 1B43A 5AM3A 3EUB2 2BCUA 5HRHA 2WHEA 1Z1VA 1S0VA 1EXNA 3SEIA 2E1EA 2JR5A 3M8SA 1ZRMA 8ICOA 2J6UA 4NLBA 1BGXT 2WF5A 2R8IA 3H0RB 7ICPA 3K7DA 5CEHA 4JV1A 3GQCA 5GTIU 1COOA 3M6KA 4O6AA 3KHLA 2ZTCA 1D8LA 2W3RA 1QQ7A 4KX3A 2PFOA 3PW2A 3DDHA 4R66A 5JTIA 4IRKA 3WFSC 3HJEA 3N97B 4YXJA 3JPSA 1UA1A 4QZAA 5C0YA 2EAPA 1ZJNA 4HAIA 1Q3UA 4O69A 1NKCA 2KZMA 3SZ2A 3PMNA 4EENA 1TK0A 1WWUA 4OJOA 4ECWA 1JQRA 5KG5A 4RQ7A 3MR2A 5J0TA 3JPNA 3G6VA 1KDHA 3OSPA 1S97A 2FJ6A 2R8KA 5KG1A 3CRXA 4F4YA 8ICMA 5AM2A 2LPEA 5KG6A 4ATBA 4X0AA 2DR8A 4KN7A 3PNCA 3ONNA 1S0NA 4QW8A 1JAJA 1V9PA 2M2UA 3PO5A 4QZ9A 4F5QA 3PHZA 3QX7A 4M9JA 4WC5A 4RUAA 3QU4A 4RQ0A 5J2HA 4U7CA 3Q8SB 3C29A 3F2DA 4AYBC 3F2CA 4X4QA 1YLQA 4DS5A 2KTQA 3OPXA 1JROA 4DL5A 3AU2A 2LKYA 3WK6A 1U49A 1NZPA 2NRWA 5EE1A 4DL2A 4B9TA 5HRKA 3MDCA 3AQLA 1JI7A 2NRZA 3B9JA 5ALRA 2QB1A 4KN4A 5AKJA 1JN3A 1N48A 4FZNA 9ICCA 2DWQA 4EEBA 1SGGA 3WK4A 5DDYA 2BDUA 2IHMA 3KKAA 3K1ZA 4Z6FA 3SQIA 5AK5A 3QUBA 1RXWA 1NKEA 4RWNA 2GAFD 1BPXA 2E5SA 2XVTA 2R8JA 4C8NA 1RG6A 4B9MA 2B0CA 5EOZA 3UXNA 3BQTA 3FAHA 4X0BA 1L5UA 2B4VA 1VFGA 2K89A 1MA7A 2NRTA 4ECQA 5ALUA 2W54A 2CN1A 2C2RA 4ECZA 4XA5A 4OJPA 8ICRA 7ICRA 5DB9A 4MFAA 1L3VA 2PFQA 4M9GA 3SI8A 1SXDA 2KZZA 9ICWA 5DB6A 1IV8A 4Q45A 2HHPA 4O3RA 2KP7A 2HHVA 1SKSA 4GFJA 3H3AA 1CEZA 2Y0SC 2DR5A 2KKPA 5KFVA 3G6XA 3SV3A 4OD0A 3V6JA 1U9LA 4JUZA 2XC9A 2DGZA 3NTUA 5KFEA 2OM6A 4QZDA 2KFZA 2F1IA 4DCCA 5DKWA 5KFIA 3ZDEA 4BWMA 4GLXA 5DEDA 1BNPA 3PV8A 1X9XA 1X9MA 4DFPA 4U6PA 3ZD9A 1N5XA 2A1AA 4F3OA 1D8BA 1WCNA 3CYMA 3EPIA 3AN1A 5HREA 3EYZA 5KT7A 3IG8A 2B56A 2O1PA 2M9NA 2DVIA 4RQ1A 4M2YA 4F2SA 4UB1A 4WC7A 1BPDA 4TURA 4FO6A 1NZBA 4O3OA 2DQNB 4ELUA 3M1YA 3HWTA 2ZH2A 5KNIA 4K99A 1JXLA 1D8YA 1BPZA 2HBJA 1IM4A 9ICVA 1ZXIA 1DXSA 3SAGA 8ICKA 5CFSA 2EZXA 3IP4B 3DV9A 4J03A 5J2BA 5KG2A 4AYBF 3ZD8A 4KM5A 3RB6A 2IOFA 4F71A 3H37A 4R65A 3MFHA 1YT3A 2AJQA 1ZQEA 2XI9A 3UPQA 2UVVA 5IIKA 9ICPA 4ZOHC 1MQ2A 4F5PA 1KKXA 2Q0ZX 4G3IA 2JEGA 2OCEA 4JV0A 4HYKA 2QLTA 1KEJA 2KHVA 5L1JA 1KNYA 5TZVA 4F92B 3I28A 2IHNA 2AH5A 2EAOA 2ZH6A 3LWMA 3NS1A 1ZQPA 4I2FA 1PZNA 1L7NA 1CI4A 1O08A 1U4BA 2P6UA 2HN2A 5AK3A 4OAGA 3N7RC 4F5NA 4DS4A 2LHTA 1QSYA 4X4PA 2ZG6A 3OUYB 5JU5A 4ICAA 4XRHA 5L9XA 1XO0A 3WKEA 2EZZA 2Y1IA 4JWNA 4DO9A 2PKEA 3M9NB 3S6JA 3IDWA 4MEYA 1UQVA 4RQ6A 2RDJA 1N5WA 2F3NA 1L3TA 1NK5A 4WQLA 5L1LA 3CNHA 1ZQSA 4ELVA 3K75D 3A0HU 5ALFA 2I5HA 1N62A 2JZBB 4DLEA 2OH2A 4NV0A 4RQ2A 2M0NA 2WFAA 5ALZA 1ZQ1C 5KFQA 2R8GA 1JMSA 2KJ5A 3KTQA 4NKUA 2FI1A 4FH5A 1CUKA 5CP2A 4ZH4A 5T14A 1SWVA 4NL9C 5HRFA 3QUTA 4P4OA 3TAQA 5HRBA 4ED3A 2DR7A 1J2NA 2ZJ8A 5IINA 1ZQWA 2Y1JA 3M6ZA 5A0LA 1UT8A 4KLUA 4ED6A 4I2AA 4DSJA 2YX8A 3L4PA 2I6XA 4I27A 1V85A 1S8OA 3E0FA 5AKHA 5DDMA 5EWGA 4ECRA 2KIVA 2EZYA 4QZEA 2OXOA 5K4LA 1TKDA 2GO7A 3KFUF 1X6JA 5AKXA 4LZDA 3LYSA 3N7SC 2VKQA 2ZIVB 2C2DA 8ICYA 1V38A 2LI6A 4KMUA 5AI4A 2HBKA 2ASDA 1ZQTA 2Q4TA 4M9NA 1S76D 1AROP 1ZQLA 2A1JA 4QZ8A 4I2BA 2UVRA 3JPTA 1T7PA 2BBHA 3RAXA 3SYZA 4LEVA 3HX0A 4EX7A 1QQ6A 5F2VO 1LVHA 4UAYA 3Q8KA 2ZUDA 4O5EA 9ICHA 4IL6U 3UM9A 3V6KA 1SKRA 4EEYA 2XCPA 3RBEA 3N7PD 1ZQNA 4FHVA 4UB6U 3GFKB 2KFNA 1QCKA 4DL6A 1QSLA 3FYHA 4UB4A 5AM5A 3CP8A 5AM1A 4UQGA 2I1QA 4C8MA 3MC1A 3OV7A 3MGIA 5CA7A 3NVZA 3C66A 4WC2A 4NWIA 5J2EA 4ECSA 3M7DA 3QU9A 2EQYA 2F76X 1TV9A 3HILA 3Q8QB 3WFRE 1XO1A 2FPKA 5AI6A 4F5RA 3CW2C 5KFDA 3QXGA 5B5EU 5F9NA 5KFBA 5HNKA 2E8MA 3KZIU 1UT5A 3N28A 4EBCA 4CCHA 2FLNA 2GA9D 3TKAA 4MKPA 1F0MA 2DKZA 4LVSA 4NXTA 4YMNA 3NVVA 2KVCA 2JXJA 5ALTA 4EV6A 1HUOA 1HIWA 1K1QA 4CF4A 1L7MA 3OVAA 1S0OA 4ED1A 5HRLA 5DECA 3QZ8A 3OWGA 1A0PA 1L8LA 2AU0A 3AEVA 2IA6A 5JTGA 2HVIA 4B9VA 1OUQA 2OYYA 4ED7A 5L1MA 2W11A 3V72A 2JGAA 3GV7B 2KOBA 2ISOA 4YR3A 3AUOA 5AKIA 2C28A 3EWAA 4ECVA 3C28A 2B21A 2ZTDA 2BCSA 2DF4B 4A8EA 2KHQA 4I2CA 3KHGA 4WC3A 5EE3A 4KLQA 2H3FA 5HMLA 2ZXHA 1KN5A 2D3DA 5BOLA 2MRLA 3PZPA 1SXEA 4WCWA 1NJZA 2W04A 3OVBA 5J0OA 5HR9A 4YCXA 4O3NA 3HPOA 1U48A 2W55A 4K9AA 5KFMA 5BOMA 1TK8A 3H8JA 3GV8B 2F8LA 4RPYA 2O5AA 2K4EA 1N56A 4LZGA 1DGJA 1ZQGA 3IV6A 4UAUA 2BPFA 4EZ6A 4Y2RA 5DGBA 5AK6A 2RHFA 4DQPA 3PW5A 5CFTA 4GXIA 4YVZA 2HSZA 2IBKA 3C2LA 4MFCA 2F8KA 2G07A 1TAUA 4FO1A 5ALKA 2NO5A 1GPJA 4CF3A 3V7KA 2ASLA 3RJIA 1ZQAA 4PPXA 3M9OB 1PK1B 4AT7A 2EDUA 5KFPA 2ES6A 3VCBA 2HI0A 1HEKA 4R63A 4RNMA 1ZQHA 3BS5A 1JUDA 2XY6A 4B9NA 3ISCA 2KSOA 5J8YA 5DB8A 2E3TA 3SV4A 4KLLA 5KFAA 1ZQUA 3KBBA 5KFCA 1Q8KA 4M9LA 7ICKA 1FFUA 4CE6A 5AHXA 2BQUA 4DSFA 7ICLA 4AT7B 1NK6A 3UQ2A 1Q79A 3AMZA 4Q44A 1Z3EB 4IQUA 3RRHA 4K4GA 3BS5B 4US9A 4Y2JA 4R64A 4OJ6A 3LWLA 3IRUA 1QLNA 1D9FA 2KSOB 4GXKA 3MABA 3KKAC 5KL1B 2EH9A 3HJ4A 4DFKA 2XIDA 4C4TA 1Z19A 4P4MA 4FZLA 3IHQB 5KG0A 3C2MA 8ICPA 1F5SA 9ICKA 4EELA 3QZ7A 4Y2QA 5HHIA 1QQ5A 3H8MA 1U45A 2DKXA 4EP7A 2EWRA 5ALHA 2UVWA 3TQ1A 1BNOA 5KAFU 4O5KA 5DBAA 4F72A 9ICIA 2F44A 2NRVA 2ODGA 1TFWA 4DOAA 5HC9A 3I76A 2C22A 4K4IA 4TUPA 4YXMA 4PGQA 2PI5A 2JEIA 3D2QA 1ZQFA 1XNSA 2WB1C 3C1ZA 3RJGA 5AKLA 1ZQYA 1T4GA 4EYHB 4B6JA 3PW7A 3RB3A 3B0XA 2FMQA 3HW8A 2IHOA 5J0YA 3F2BA 4CDGA 4ATBB 4DOCA 3OHAA 1ZD3A 4WC4A 5DG7A 2H3QA 4YD2A 4ECXA 3AL0B 5KFXA 3IN5A 3PVXA 4I2DA 9ICAA 2BPCA 4ED8A 3WKBA 5JUMA 3RB0A 1URJA 4NLZA 4FZMA 2FE9A 4RWQA 5KG4A 2H5XA 3MR5A 1DK2A 5KT4A 3D6JA 1SV4A 5ALXA 4TUSA 4DQSA 9ICRA 1YZ7A 2K4IA 3L5KA 5KFKA 1C20A 1DGSA 2UVUA 1Q46A 2YQEA 4UASA 2AHOB 4ED0A 2W03A 1ZYQA 3ZDBA 4DWIA 2XGPA 1T8EA 4O67A 2VANA 3SR6A 1X9SA 5ALDA 4UBCA 5KFJA 4YQWA 3KOOA 3WK7A 1KFDA 2ZH1A 4DL4A 2JH1A 1WOTA 2NO4A 1SWWA 4FHPA 3LVWA 1LKYA 5ALLA 3ZI4A 1RDFA 1SL1A 3B0YA 3FC4A 2HCFA 2V9WA 3BDPA 4RWOA 4X4OA 2F77X 8ICXA 1L3UA 1SZHA 2ZTEA 3PX0A 3V6HA 3WK9A 4AT9A 3QU7A 4C7YA 4TUQA 2BQ3A 4UAVA 2OEHA 1ECWA 2HN1A 4JV2A 1LKYB 3H7IA 4I28A 2KV2A 2W8KA 4OAFA 2FPLA 4BUGA 3FM9A 1MIYA 1NJWA 2B6GA 5J2GA 4WOYA 3V7LA 4M04A 2FCLA 4P0QA 2MA1A 4NM1A 1RYRA 4WC6A 1AQ6A 2C2EA 2JEFA 3H39A 4AT9B 4Y2UA 4MF8A 1KSPA 2YB1A 1X6IA 5KFOA 3GIKA 3C5FA 5CR0A 1X66A 4BDPA 5J2DA 3NVWA 1Z00A 3V7JA 7ICFA 5KG7A 3WFQE 5AI9A 1MIVA 1D9DA 2DUYA 2WB1F 4P0QB 9ICMA 1L8OA 4J9NA 5J0PA 1NK9A 4QWBA 5KAIU 9ICQA 4C8LA 1K5OA 4I29A 3ISBA 4FBTA 4LEWA 3ZDCA 2KEYA 3JZ0A 2ZHBA 5J0UA 2RRDA 4RZRA 5KFLA 5GTHU 5CHGA 4PHAA 2AGOA 1L3SA 5AM4A 5KFTA 2KJ8A 1QSSA 5HRIA 3OGUA 4DFDA 3RTVA 4UAWA 4AT8A 4EEKA 1X2IA 3EPGA 5KFRA 4NXWA 3GIJA 3TADA 1NJXA 2ID1A 3PSTA 3LDAA 1S77D 5J2FA 5KFZA 2ZH7A 4QIWC 4F93B 4J9SA 1OW5A 4DQIA 2PFPA 7ICOA 9ICNA 5ALPA 4DSIA 2IMWP 1SL0A 4I2IA 2ZXIA 1NKBA 1Y88A 4J9KA 5ALYA 5J2KA 1RPLA 4DEZA 4DF4A 4BGDA 4XQ7A 4RNOA 2Y9TA 1ZOLA 2HHTA 2NRKA 1MC8A 1UHUA 2WF8A 4NLNA 1Q78A 8ICTA 4O68A 1JX4A 4QZCA 2E8NA 3H4DA 2ISPA 4JWMA 5CFUA 1F44A 4FHWA 3RH5A 4R8UA 2YMQA 5J0XA 4WBZA 5L1KA 3MBYA 4UB8U 5KTQA 5DLGA 5AIAA 2H3VA 2VJ5A 1ZD2P 4YR0A 2M2WA 4KX5A 1RYSA 3RAQA 3OJUA 1UCVA 5KT3A 1ZQMA 2AGQA 2EAMA 4B9SA 1HUZA 4R8UB 2D8CA 4RNNA 9ICOA 3LQCB 3JPPA 4NLKA 1X9WA 2CPRA 3RFAA 1MN8A 5AKGA 3JCFA 3ETRA 2WAQC 2ESEA 3MDAA 3OSNA 3T79A 4DL7A 2AXTU 2ZIWA 2JH7A 1JIHA 4FS1A 3PSIA 4UAZA 3SAHA 2KN7A 5DBBA 1KRPA 1R8BA 5CRXA 8ICBA 2Y9UA 1SB3C 2RDIA 3ZDAA 2ASJA 2BBJA 3ER9B 2KK0A 1WG8A 4DF8A 2VJ4A 4PJ0U 3PW0A 3K4GA 4Y2TA 4XUSA 4IQWA 3H38A 4ELTA 1RQNA 2DRAA 5AIBA 4P2HA 2ZIWB 3BZCA 4ECYA 7ICGA 2A1JB 4P4PA 1IXRA 4I2GA 4E7XA 2RLTA 4J9LA 2KKVA 4OJLA 2KICA 3E2EA 2AQ0A 5HHHA 3PSFA 1ZQVA 3UXOA 4PL1A 4QIWF 2HHSA 2KD1A 1O03A 3ETLA 2HHUA 3NRWA 3ICXA 1KQQA 2DRBA 4EBEA 4X4NA 4UATA 3RF9A 1B4FA 4KLSA 1S9FA 2PMZF 2KE7A 4P0PA 2LBOA 7ICEA 1BPYA 4CRXA 4EEDA 3AQNA 4WH5A 4BXOA 2RFFA 9ICEA 3WKCA 2FPMA 1SV0A 4UB5A 4FHYA 4UB2A 2BPGA 2ZJ5A 5TISU 5ALOA 2PI4A 2XGQA 3E58A 4KTQA 4PHPA 1FEZA 4P0PB 5DG9A 5J8YC 4N7RA 3RH6A 1CRXA 4O0IA 9ICSA 5ALNA 5AKEA 4EZ9A 2ZIUA 5FP0A 3H0MB 4RU9A 7ICTA 2ZH9A 4RQ8A 4J9OA 4ACOA 5HRDA 4K9BA 5ALQA 3AQEA 3OHBA 3VC8A 4B9UA 2BCRA 2WF7A 3UMCA 2K8BB 2HBMA 1XC9A 8ICIA 4YD1A 5D4BA 1QH9A 5J29A 5AI8A 4RUCA
chains in the Genus database with same CATH topology
3H4BA 1WCNA 1C7YA 3EPIA 9ICIA 2ZH8A 5HREA 2NRVA 3EYZA 4IR9A 4NY8A 4IR1A 5KT7A 3H40A 1TFWA 8ICZA 2O1PA 3GIIA 4M5DA 5DQGA 2W8LA 2M9NA 4DOAA 5HC9A 2DVIA 4O3QA 4RQ1A 2AGPA 2P6RA 4M2YA 4IRCA 4F2SA 4UB1A 2W9AA 4TUPA 2C22A 2J6TA 4K4IA 4YXMA 9ICBA 4PGQA 3AQKA 1BPDA 2BKEA 5KG3A 4TURA 7ICUA 4WC1A 4FO6A 2PI5A 4O3OA 2JEIA 1ZQFA 8ICFA 1OU5A 2ATLA 4QWAA 1DK3A 4ELUA 3C1ZA 4EBKA 1SKWA 3HWTA 3N4MB 3RJGA 2ZH2A 1ZQYA 1T4GA 2ZH3A 3BJYA 4F4XA 1JXLA 1BPZA 4EYHB 1D8YA 2MUTA 8ICQA 1IM4A 9ICVA 3HJ1A 2KZ3A 3PW7A 1BPEA 3RB3A 1A76A 1KLNA 4YMOA 3B0XA 9ICJA 2FMQA 3HW8A 2M2VA 8ICKA 5J0YA 3UQ0A 5J2BA 5KG2A 4ATBB 4DOCA 4GC6A 3OHAA 4WC4A 4ED2A 3ZD8A 4DLGA 7ICMA 3RB6A 5DQIA 5DG7A 5DG8A 5IIMA 4JK1A 4PH5A 3H37A 4YD2A 4R65A 3MFHA 4ECXA 2P66A 5KFXA 1ZQEA 3RJKA 4C8OA 3UPQA 2UVVA 5HP4A 5IIKA 3PVXA 2OWOA 4I2DA 9ICAA 2BPCA 4ED8A 1ZQBA 4O3SA 9ICPA 9ICTA 5JUMA 3RB0A 4F5OA 4F5PA 1MQ2A 1ZJMA 3HT3A 2W9CA 2Q0ZX 4RQ3A 4NLZA 4G3IA 3MR3A 2RFFA 1DOQA 4X4VA 2JEGA 4RWQA 1BPBA 5IIJA 2ZUBA 4JV0A 2ZJAA 2PXIA 4HYKA 3Q8LA 3G6YA 3RJEA 5KG4A 8ICEA 3KHHA 1KEJA 4DL3A 5L1JA 1KNYA 2H5XA 3MR5A 1DK2A 5KT4A 1ZQRA 2MAXA 3GDXA 5TZVA 4F92B 5J0RA 4QWCA 1RZTA 4TUSA 4DQSA 9ICRA 4QWEA 2HHXA 5KFKA 1DGSA 4M6WA 2UVUA 2IHNA 1KFTA 4PGXA 4ED0A 4M0AA 4KLHA 9ICGA 2ZH6A 3LWMA 1ZYQA 3T3FA 3ORYA 5L1IA 1ZQPA 1PZNA 2XGPA 3ZDBA 1T8EA 4DWIA 4I2FA 2BE3A 2Q66A 2VANA 1X9SA 5BPCA 9ICUA 1U4BA 3MGHA 2P6UA 2W9CB 3H8SA 1R8CA 4UBCA 5KFJA 4F5NA 4DS4A 3RJJA 3OVSA 4YQWA 8ICCA 1KFDA 1QSYA 4KLTA 4X4PA 2ZH1A 5IILA 5CWRA 3OUYB 3NYBA 3BQ0A 4XRHA 4DQQA 5L9XA 3C2KA 4DL4A 1WOTA 1TK5A 4FHPA 5D49A 2Y1IA 4JWNA 4DO9A 4KLEA 2HHQA 8ICWA 1SL1A 3B0YA 2BGWA 4MEXA 3M9NB 4F4ZA 9ICFA 2V9WA 3BDPA 4J9MA 4M6WB 4Q8EA 4RWOA 4X4OA 4F4KA 4MEYA 4RQ6A 2RDJA 8ICXA 1L3UA 3GV5B 4K4HA 2ZTEA 1L3TA 3PX0A 1NK5A 5L1LA 3M9MB 3V6HA 1ZQSA 5KFYA 4ELVA 3K75D 3ZDDA 3GILA 5DGAA 2FLLA 4X4TA 4KLJA 4J9PA 5IIIA 4AT9A 2JZBB 4RT2A 4EYIB 4DLEA 4KLMA 4TUQA 4RQ2A 4DOBA 5KFQA 2BQ3A 2R8GA 1JMSA 4NXZA 3KTQA 4BXOB 4X4SA 5KFNA 3JPQA 4NKUA 4FH5A 1CUKA 5EWFA 5CP2A 5J2IA 4UD4A 5HRGA 3HP6A 4JV2A 3H7IA 4ZH4A 5DQHA 4I28A 2W8KA 5HRFA 4P4OA 3TAQA 1XS9D 2FPLA 1FA0A 5HRBA 4ED3A 1TVAA 2ZH4A 2DR7A 2ZJ8A 1QTMA 4QZBA 1ZQWA 4YG2A 2BHNA 4J9QA 5IINA 2Y1JA 1NJWA 4MFFA 1MIYA 2HHWA 1UT8A 1ZQDA 4DFJA 4DSLA 1ZQQA 1T3NA 7ICQA 1KFSA 1NK8A 4KLUA 5J2GA 4YR2A 4ED6A 1A77A 4I2JA 3V7LA 4DSEA 3AU6A 4DSJA 4FBUA 4I2AA 4M04A 8ICHA 1UEVA 4YP3A 4S3NA 4RQ5A 3T5JA 4RT3A 1H38A 4NM1A 1TFYA 1RYRA 4RPZA 4TQSA 2GWSA 4I27A 3C1YA 4WC6A 3THVA 2C2EA 5F9LA 5J2AA 2JEFA 2ALZA 3H39A 1S10A 4AT9B 4LT6A 2DPJA 5DDMA 5EWGA 3L9DA 4MF8A 1KSPA 5KFFA 4ECRA 4MF2A 5KFOA 3GIKA 3C5FA 3BQ1A 4QZEA 2VA2A 5CR0A 9ICKA 1TKDA 4NM2A 4BDPA 5J2DA 3QE9Y 5J2JA 4Q8FA 4LZDA 8ICSA 8ICLA 1Z00A 3V7JA 3T5LA 4M47A 2HW3A 7ICFA 5KG7A 2BCQA 3WFQE 2C2DA 4DFMA 8ICYA 1MIVA 1D9DA 4KMUA 3MR6A 1K1SA 3OJSA 3GIMA 1NK0A 4UD5A 1BVSA 4GXJA 2ASDA 1ZQTA 1XSLA 9ICMA 2V4QA 3C23A 2W9BA 4M9NA 4J9NA 4DSKA 1S76D 5J0PA 1AROP 3PO4A 1ZQLA 3HIYA 1NK9A 4E8FA 2A1JA 4QWBA 1XU4A 9ICQA 3Q8PB 4C8LA 4QZ8A 3Q8RB 3TI0A 4I2BA 2UVRA 4C8KA 4QWDA 4YN4A 3JPTA 3ISBA 1T7PA 3RAXA 5J0SA 3SYZA 4I29A 4FBTA 3HX0A 4EBJA 5F2VO 4FHXA 4IG8A 3ZDCA 4UAYA 4F2RA 5J0UA 3Q8KA 3JZ0A 2ZHBA 4RZRA 5KFLA 2ZUDA 5C5JA 4PHAA 5CHGA 4Q43A 2ZUCA 4F4WA 5KT2A 3RH4A 2AGOA 1L3SA 4O5EA 5KFTA 9ICHA 1NO5A 4UB3A 3RBDA 2DR9A 3V6KA 1NK4A 3PY8A 1SKRA 5D46A 2XCPA 4EEYA 3FDSA 3RBEA 1QSSA 5J0WA 5HMMA 1ZQNA 5HRIA 1R89A 3OGUA 4FHVA 2MUTB 5KFWA 3RTVA 5KFGA 4UAWA 4DQRA 5J0QA 4AT8A 4F50A 4FH3A 3GFKB 2KFNA 1X2IA 3EPGA 5KFRA 4KLGA 4KLOA 4RPXA 2PFNA 3GIJA 1ZQKA 2W9BB 4DL6A 4RQ4A 1NJXA 1QSLA 5KFSA 4QW9A 2ID1A 3LDAA 2FLPA 3C5GA 4BWJA 3FYHA 1S77D 4UB4A 5J2FA 5KFZA 2VA8A 2ZH7A 4UQGA 2XO7A 2I1QA 4F93B 4J9SA 4C8MA 1B22A 4GC7A 3MGIA 3OV7A 4DQIA 5CA7A 3C66A 4M9HA 4WC2A 3PX4A 2PFPA 7ICHA 5J2EA 7ICOA 4PHDA 4ECSA 3TANA 9ICNA 3TFSA 4EBDA 4XQ8A 1SL2A 2IMWP 4DSIA 1SL0A 4X4UA 4I2IA 3C18A 1XSNA 1TV9A 1UETA 1NKBA 3Q8QB 3WFRE 1XO1A 1Y88A 3RR8A 3PR4A 2FPKA 4J9KA 4F5RA 3JYYA 1SZPA 5KFDA 4NKTA 5CB1A 4KLIA 5F9NA 1RPLA 5J2KA 3UPSA 4DEZA 4DF4A 4X5VA 1B43A 4BGDA 4FS2A 4O3PA 3EW9A 5KFBA 1ZQJA 4XQ7A 3TAPA 5HNKA 4RNOA 2HHTA 2NRKA 3EZ5A 4QZIA 2XCAA 4PHEA 2BCUA 5HRHA 1PX5A 1UT5A 1MC8A 5J2CA 1S0VA 3NGDA 1EXNA 3C21A 4NLNA 4EBCA 2F1HA 4CCHA 2FLNA 2BQRA 8ICTA 1TFRA 1MIWA 1MQ3A 3M8RA 1NOMA 5CJ7A 1JX4A 4QZCA 3M8SA 4F91B 4LVSA 3H4DA 1V4AA 8ICOA 2J6UA 1BGXT 4YMNA 2ISPA 2R8IA 4JWMA 2BCVA 7ICPA 2VA3A 1HUOA 4FHWA 3RH5A 4JV1A 4R8UA 3GQCA 2AJQA 1COOA 1K1QA 4O5CA 3MFIA 3KHLA 5J0XA 9ICLA 2ZTCA 3OVAA 4WBZA 1S0OA 1D8LA 4YFKA 5L1KA 3MBYA 4ED1A 5HRLA 1S0MA 5DECA 3QZ8A 5KTQA 5DLGA 2PFOA 1HJPA 3PW2A 2AU0A 3H8WA 4R66A 2IA6A 4IRKA 3QEBZ 1ZQOA 4YR0A 2HVIA 1NJYA 2LYHA 4B9VA 4IQTA 8ICAA 2M2WA 2WTFA 3KHRA 1XSPA 4ED7A 2JEJA 4O9MA 3WFSC 3V72A 4B9LA 3N97B 7ICVA 1KTQA 4YXJA 3GV7B 5KFUA 8ICNA 2HHPA 4QZGA 3JPSA 3RR7A 1UA1A 1RYSA 3RAQA 2ISOA 3OJUA 4QZAA 4YR3A 5KT3A 3AUOA 1ZQMA 3RJHA 3PMLA 2C28A 2AGQA 3EWAA 4F8RA 9ICEA 4WBYA 4ECVA 2XY7A 2ZH9A 3QEAZ 2B21A 2ZTDA 1ZJNA 4B9SA 2BCSA 1HUZA 1NKCA 1ZQCA 4R8UB 2KZMA 3SZ2A 3PMNA 7ICSA 1TK0A 4RNNA 4ECWA 4I2CA 9ICOA 1JQRA 5KG5A 4RQ7A 3MR2A 5J0TA 3KHGA 3JPNA 1LB2B 4KLQA 5HMLA 3JPPA 3LQCB 4WC3A 3G6VA 1KDHA 3OSPA 1X9WA 4NLKA 5BOLA 4E0DA 1S97A 2R8KA 5KG1A 4IQVA 4J9RA 4WCWA 4F4YA 1UA0A 8ICMA 5DLFA 5KG6A 1NJZA 3LK9A 4ATBA 4X0AA 5J0OA 3OVBA 2ZHAA 4KN7A 3PNCA 4WC0A 1ZETA 5HR9A 2DR8A 3MDAA 8ICUA 2BR0A 4YCXA 3OSNA 4O3NA 4E80A 1VJ7A 1S0NA 4DL7A 3HPOA 4QW8A 1U48A 1JAJA 1V9PA 5KFMA 5BOMA 3PO5A 2M2UA 4QZ9A 4F5QA 1JIHA 5EWEA 4FS1A 3H8JA 1TK8A 4UAZA 4M9JA 3WFOA 2KN7A 4WC5A 1UEUA 4RUAA 3GV8B 3ISDA 5DBBA 5J2HA 4RQ0A 4RPYA 2O5AA 1KRPA 3Q8SB 1N56A 1R8BA 4X4RA 4LZGA 8ICBA 2I9GA 2RDIA 1ZQGA 3PX6A 3IM1A 9ICXA 3ZDAA 2BPFA 2HVHA 4EZ6A 2ASJA 8ICGA 4QZFA 5DGBA 3RB4A 4X4QA 1YLQA 4DS5A 3PW5A 3RJFA 4DQPA 5KFHA 4DF8A 2KTQA 4GXIA 4DL5A 2FMPA 1Z00B 3AU2A 3PW0A 3K4GA 4YVZA 4XUSA 4IQWA 8ICJA 3H38A 3WFPA 3PR5B 4KLFA 2IBKA 1U49A 4ELTA 1NZPA 2NRWA 3C2LA 4MFCA 4KITB 4YMMA 2DRAA 4P2HA 3Q8MA 4DL2A 1WCLA 2DFLA 4B9TA 5HRKA 1TAUA 3MDCA 3AQLA 4ECYA 7ICGA 2A1JB 4P4PA 3BQ2A 1IXRA 4I2GA 4E7XA 2NRZA 2FMSA 2M2TA 4J9LA 3V7KA 4ECTA 4KN4A 3RJIA 2ASLA 1JN3A 1ZQZA 1ZQAA 3M9OB 4PPXA 1N48A 4I2HA 3E2EA 2AQ0A 5HHHA 9ICCA 4ECUA 4AT7A 1TAQA 5KFPA 1ZQVA 3UXOA 3OUYA 2F1JA 5KT5A 2HHSA 4Z6CA 5DBCA 1MSWD 1LV5A 4R63A 5DDYA 4RNMA 3ETLA 5DB7A 1ZQHA 3JPRA 2HHUA 4AT8B 2IHMA 4Z6FA 2XY6A 4B9NA 1RXWA 3ISCA 1NKEA 2DRBA 4RWNA 4EBEA 1BPXA 4X4NA 5DB8A 2R8JA 4C8NA 3SV4A 4KLSA 4KLLA 3AQMA 4UBBA 4B9MA 1S9FA 5EOZA 3UXNA 5KFAA 3BQTA 1Q78A 4X0BA 5IIOA 1L5UA 7ICEA 1BPYA 3T5KA 2ZH5A 1ZQUA 1VFGA 1R8AA 4RWPA 5KFCA 4I2EA 2NRTA 2DPIA 4M9LA 7ICKA 1ZQXA 4ECQA 2NRXA 2BQUA 3AQNA 2J6SA 4DSFA 7ICLA 2C2RA 4ECZA 2JZBA 7ICIA 1RXVA 1NK6A 4AT7B 1JXEA 4XA5A 3UQ2A 8ICRA 7ICRA 1Q79A 5DB9A 4BXOA 3JPOA 4MFAA 4Q44A 4QZHA 1Z3EB 4IQUA 4PGYA 4TQRA 2V4RA 3RRHA 2FPMA 1L3VA 2PFQA 2W9MA 4UB5A 4K4GA 3SI8A 4R64A 4M9GA 2KZZA 9ICWA 5DB6A 7ICJA 3LWLA 4FHYA 1F5AA 4UB2A 3TARA 2BPGA 2ZJ5A 4Q45A 1QLNA 7ICNA 1D9FA 2PI4A 2R8HA 4O3RA 2HHVA 2KP7A 1SKSA 2XGQA 3H3AA 1CEZA 2DR5A 4GXKA 5KFVA 4IRDA 4KTQA 3MABA 1NK7A 3G6XA 2XY5A 4PHPA 3SV3A 3HJ4A 5DG9A 3RH6A 2PBEA 4DFKA 3RRGA 4O0IA 9ICSA 3V6JA 4Z6EA 1U9LA 4P4MA 4JUZA 4EZ9A 3IHQB 5KG0A 2XC9A 3C2MA 2BDPA 8ICPA 4Z6DA 3NTUA 5KFEA 4RU9A 7ICTA 1ZQIA 4QZDA 4RQ8A 3QZ7A 4J9OA 3T5HA 1U47A 4KLDA 5HRDA 2KFZA 4NLGA 2F1IA 5DKWA 5HHIA 5KFIA 3OHBA 3ZDEA 4BWMA 4GLXA 2AQ4A 5DEDA 1U45A 4EP7A 4WC7A 4B9UA 3PW4A 2BCRA 1BNPA 3PV8A 3UXPA 1XWLA 3TQ1A 2UVWA 1BNOA 1XC9A 1X9MA 8ICVA 8ICIA 4YD1A 4DFPA 3TFRA 5KT6A 3ZD9A 5D4BA 4O5KA 5DBAA 5J29A 4F3OA 4RUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4B A;  1WCN A;  1C7Y A;  3EPI A;  9ICI A;  2ZH8 A;  5HRE A;  2NRV A;  3EYZ A;  4IR9 A;  4NY8 A;  4IR1 A;  5KT7 A;  3H40 A;  1TFW A;  8ICZ A;  2O1P A;  3GII A;  4M5D A;  5DQG A;  2W8L A;  2M9N A;  4DOA A;  5HC9 A;  2DVI A;  4O3Q A;  4RQ1 A;  2AGP A;  2P6R A;  4M2Y A;  4IRC A;  4F2S A;  4UB1 A;  2W9A A;  4TUP A;  2C22 A;  2J6T A;  4K4I A;  4YXM A;  9ICB A;  4PGQ A;  3AQK A;  1BPD A;  2BKE A;  5KG3 A;  4TUR A;  7ICU A;  4WC1 A;  4FO6 A;  2PI5 A;  4O3O A;  2JEI A;  1ZQF A;  8ICF A;  1OU5 A;  2ATL A;  4QWA A;  1DK3 A;  4ELU A;  3C1Z A;  4EBK A;  1SKW A;  3HWT A;  3N4M B;  3RJG A;  2ZH2 A;  1ZQY A;  1T4G A;  2ZH3 A;  3BJY A;  4F4X A;  1JXL A;  1BPZ A;  4EYH B;  1D8Y A;  2MUT A;  8ICQ A;  1IM4 A;  9ICV A;  3HJ1 A;  2KZ3 A;  3PW7 A;  1BPE A;  3RB3 A;  1A76 A;  1KLN A;  4YMO A;  3B0X A;  9ICJ A;  2FMQ A;  3HW8 A;  2M2V A;  8ICK A;  5J0Y A;  3UQ0 A;  5J2B A;  5KG2 A;  4ATB B;  4DOC A;  4GC6 A;  3OHA A;  4WC4 A;  4ED2 A;  3ZD8 A;  4DLG A;  7ICM A;  3RB6 A;  5DQI A;  5DG7 A;  5DG8 A;  5IIM A;  4JK1 A;  4PH5 A;  3H37 A;  4YD2 A;  4R65 A;  3MFH A;  4ECX A;  2P66 A;  5KFX A;  1ZQE A;  3RJK A;  4C8O A;  3UPQ A;  2UVV A;  5HP4 A;  5IIK A;  3PVX A;  2OWO A;  4I2D A;  9ICA A;  2BPC A;  4ED8 A;  1ZQB A;  4O3S A;  9ICP A;  9ICT A;  5JUM A;  3RB0 A;  4F5O A;  4F5P A;  1MQ2 A;  1ZJM A;  3HT3 A;  2W9C A;  2Q0Z X;  4RQ3 A;  4NLZ A;  4G3I A;  3MR3 A;  2RFF A;  1DOQ A;  4X4V A;  2JEG A;  4RWQ A;  1BPB A;  5IIJ A;  2ZUB A;  4JV0 A;  2ZJA A;  2PXI A;  4HYK A;  3Q8L A;  3G6Y A;  3RJE A;  5KG4 A;  8ICE A;  3KHH A;  1KEJ A;  4DL3 A;  5L1J A;  1KNY A;  2H5X A;  3MR5 A;  1DK2 A;  5KT4 A;  1ZQR A;  2MAX A;  3GDX A;  5TZV A;  4F92 B;  5J0R A;  4QWC A;  1RZT A;  4TUS A;  4DQS A;  9ICR A;  4QWE A;  2HHX A;  5KFK A;  1DGS A;  4M6W A;  2UVU A;  2IHN A;  1KFT A;  4PGX A;  4ED0 A;  4M0A A;  4KLH A;  9ICG A;  2ZH6 A;  3LWM A;  1ZYQ A;  3T3F A;  3ORY A;  5L1I A;  1ZQP A;  1PZN A;  2XGP A;  3ZDB A;  1T8E A;  4DWI A;  4I2F A;  2BE3 A;  2Q66 A;  2VAN A;  1X9S A;  5BPC A;  9ICU A;  1U4B A;  3MGH A;  2P6U A;  2W9C B;  3H8S A;  1R8C A;  4UBC A;  5KFJ A;  4F5N A;  4DS4 A;  3RJJ A;  3OVS A;  4YQW A;  8ICC A;  1KFD A;  1QSY A;  4KLT A;  4X4P A;  2ZH1 A;  5IIL A;  5CWR A;  3OUY B;  3NYB A;  3BQ0 A;  4XRH A;  4DQQ A;  5L9X A;  3C2K A;  4DL4 A;  1WOT A;  1TK5 A;  4FHP A;  5D49 A;  2Y1I A;  4JWN A;  4DO9 A;  4KLE A;  2HHQ A;  8ICW A;  1SL1 A;  3B0Y A;  2BGW A;  4MEX A;  3M9N B;  4F4Z A;  9ICF A;  2V9W A;  3BDP A;  4J9M A;  4M6W B;  4Q8E A;  4RWO A;  4X4O A;  4F4K A;  4MEY A;  4RQ6 A;  2RDJ A;  8ICX A;  1L3U A;  3GV5 B;  4K4H A;  2ZTE A;  1L3T A;  3PX0 A;  1NK5 A;  5L1L A;  3M9M B;  3V6H A;  1ZQS A;  5KFY A;  4ELV A;  3K75 D;  3ZDD A;  3GIL A;  5DGA A;  2FLL A;  4X4T A;  4KLJ A;  4J9P A;  5III A;  4AT9 A;  2JZB B;  4RT2 A;  4EYI B;  4DLE A;  4KLM A;  4TUQ A;  4RQ2 A;  4DOB A;  5KFQ A;  2BQ3 A;  2R8G A;  1JMS A;  4NXZ A;  3KTQ A;  4BXO B;  4X4S A;  5KFN A;  3JPQ A;  4NKU A;  4FH5 A;  1CUK A;  5EWF A;  5CP2 A;  5J2I A;  4UD4 A;  5HRG A;  3HP6 A;  4JV2 A;  3H7I A;  4ZH4 A;  5DQH A;  4I28 A;  2W8K A;  5HRF A;  4P4O A;  3TAQ A;  1XS9 D;  2FPL A;  1FA0 A;  5HRB A;  4ED3 A;  1TVA A;  2ZH4 A;  2DR7 A;  2ZJ8 A;  1QTM A;  4QZB A;  1ZQW A;  4YG2 A;  2BHN A;  4J9Q A;  5IIN A;  2Y1J A;  1NJW A;  4MFF A;  1MIY A;  2HHW A;  1UT8 A;  1ZQD A;  4DFJ A;  4DSL A;  1ZQQ A;  1T3N A;  7ICQ A;  1KFS A;  1NK8 A;  4KLU A;  5J2G A;  4YR2 A;  4ED6 A;  1A77 A;  4I2J A;  3V7L A;  4DSE A;  3AU6 A;  4DSJ A;  4FBU A;  4I2A A;  4M04 A;  8ICH A;  1UEV A;  4YP3 A;  4S3N A;  4RQ5 A;  3T5J A;  4RT3 A;  1H38 A;  4NM1 A;  1TFY A;  1RYR A;  4RPZ A;  4TQS A;  2GWS A;  4I27 A;  3C1Y A;  4WC6 A;  3THV A;  2C2E A;  5F9L A;  5J2A A;  2JEF A;  2ALZ A;  3H39 A;  1S10 A;  4AT9 B;  4LT6 A;  2DPJ A;  5DDM A;  5EWG A;  3L9D A;  4MF8 A;  1KSP A;  5KFF A;  4ECR A;  4MF2 A;  5KFO A;  3GIK A;  3C5F A;  3BQ1 A;  4QZE A;  2VA2 A;  5CR0 A;  9ICK A;  1TKD A;  4NM2 A;  4BDP A;  5J2D A;  3QE9 Y;  5J2J A;  4Q8F A;  4LZD A;  8ICS A;  8ICL A;  1Z00 A;  3V7J A;  3T5L A;  4M47 A;  2HW3 A;  7ICF A;  5KG7 A;  2BCQ A;  3WFQ E;  2C2D A;  4DFM A;  8ICY A;  1MIV A;  1D9D A;  4KMU A;  3MR6 A;  1K1S A;  3OJS A;  3GIM A;  1NK0 A;  4UD5 A;  1BVS A;  4GXJ A;  2ASD A;  1ZQT A;  1XSL A;  9ICM A;  2V4Q A;  3C23 A;  2W9B A;  4M9N A;  4J9N A;  4DSK A;  1S76 D;  5J0P A;  1ARO P;  3PO4 A;  1ZQL A;  3HIY A;  1NK9 A;  4E8F A;  2A1J A;  4QWB A;  1XU4 A;  9ICQ A;  3Q8P B;  4C8L A;  4QZ8 A;  3Q8R B;  3TI0 A;  4I2B A;  2UVR A;  4C8K A;  4QWD A;  4YN4 A;  3JPT A;  3ISB A;  1T7P A;  3RAX A;  5J0S A;  3SYZ A;  4I29 A;  4FBT A;  3HX0 A;  4EBJ A;  5F2V O;  4FHX A;  4IG8 A;  3ZDC A;  4UAY A;  4F2R A;  5J0U A;  3Q8K A;  3JZ0 A;  2ZHB A;  4RZR A;  5KFL A;  2ZUD A;  5C5J A;  4PHA A;  5CHG A;  4Q43 A;  2ZUC A;  4F4W A;  5KT2 A;  3RH4 A;  2AGO A;  1L3S A;  4O5E A;  5KFT A;  9ICH A;  1NO5 A;  4UB3 A;  3RBD A;  2DR9 A;  3V6K A;  1NK4 A;  3PY8 A;  1SKR A;  5D46 A;  2XCP A;  4EEY A;  3FDS A;  3RBE A;  1QSS A;  5J0W A;  5HMM A;  1ZQN A;  5HRI A;  1R89 A;  3OGU A;  4FHV A;  2MUT B;  5KFW A;  3RTV A;  5KFG A;  4UAW A;  4DQR A;  5J0Q A;  4AT8 A;  4F50 A;  4FH3 A;  3GFK B;  2KFN A;  1X2I A;  3EPG A;  5KFR A;  4KLG A;  4KLO A;  4RPX A;  2PFN A;  3GIJ A;  1ZQK A;  2W9B B;  4DL6 A;  4RQ4 A;  1NJX A;  1QSL A;  5KFS A;  4QW9 A;  2ID1 A;  3LDA A;  2FLP A;  3C5G A;  4BWJ A;  3FYH A;  1S77 D;  4UB4 A;  5J2F A;  5KFZ A;  2VA8 A;  2ZH7 A;  4UQG A;  2XO7 A;  2I1Q A;  4F93 B;  4J9S A;  4C8M A;  1B22 A;  4GC7 A;  3MGI A;  3OV7 A;  4DQI A;  5CA7 A;  3C66 A;  4M9H A;  4WC2 A;  3PX4 A;  2PFP A;  7ICH A;  5J2E A;  7ICO A;  4PHD A;  4ECS A;  3TAN A;  9ICN A;  3TFS A;  4EBD A;  4XQ8 A;  1SL2 A;  2IMW P;  4DSI A;  1SL0 A;  4X4U A;  4I2I A;  3C18 A;  1XSN A;  1TV9 A;  1UET A;  1NKB A;  3Q8Q B;  3WFR E;  1XO1 A;  1Y88 A;  3RR8 A;  3PR4 A;  2FPK A;  4J9K A;  4F5R A;  3JYY A;  1SZP A;  5KFD A;  4NKT A;  5CB1 A;  4KLI A;  5F9N A;  1RPL A;  5J2K A;  3UPS A;  4DEZ A;  4DF4 A;  4X5V A;  1B43 A;  4BGD A;  4FS2 A;  4O3P A;  3EW9 A;  5KFB A;  1ZQJ A;  4XQ7 A;  3TAP A;  5HNK A;  4RNO A;  2HHT A;  2NRK A;  3EZ5 A;  4QZI A;  2XCA A;  4PHE A;  2BCU A;  5HRH A;  1PX5 A;  1UT5 A;  1MC8 A;  5J2C A;  1S0V A;  3NGD A;  1EXN A;  3C21 A;  4NLN A;  4EBC A;  2F1H A;  4CCH A;  2FLN A;  2BQR A;  8ICT A;  1TFR A;  1MIW A;  1MQ3 A;  3M8R A;  1NOM A;  5CJ7 A;  1JX4 A;  4QZC A;  3M8S A;  4F91 B;  4LVS A;  3H4D A;  1V4A A;  8ICO A;  2J6U A;  1BGX T;  4YMN A;  2ISP A;  2R8I A;  4JWM A;  2BCV A;  7ICP A;  2VA3 A;  1HUO A;  4FHW A;  3RH5 A;  4JV1 A;  4R8U A;  3GQC A;  2AJQ A;  1COO A;  1K1Q A;  4O5C A;  3MFI A;  3KHL A;  5J0X A;  9ICL A;  2ZTC A;  3OVA A;  4WBZ A;  1S0O A;  1D8L A;  4YFK A;  5L1K A;  3MBY A;  4ED1 A;  5HRL A;  1S0M A;  5DEC A;  3QZ8 A;  5KTQ A;  5DLG A;  2PFO A;  1HJP A;  3PW2 A;  2AU0 A;  3H8W A;  4R66 A;  2IA6 A;  4IRK A;  3QEB Z;  1ZQO A;  4YR0 A;  2HVI A;  1NJY A;  2LYH A;  4B9V A;  4IQT A;  8ICA A;  2M2W A;  2WTF A;  3KHR A;  1XSP A;  4ED7 A;  2JEJ A;  4O9M A;  3WFS C;  3V72 A;  4B9L A;  3N97 B;  7ICV A;  1KTQ A;  4YXJ A;  3GV7 B;  5KFU A;  8ICN A;  2HHP A;  4QZG A;  3JPS A;  3RR7 A;  1UA1 A;  1RYS A;  3RAQ A;  2ISO A;  3OJU A;  4QZA A;  4YR3 A;  5KT3 A;  3AUO A;  1ZQM A;  3RJH A;  3PML A;  2C28 A;  2AGQ A;  3EWA A;  4F8R A;  9ICE A;  4WBY A;  4ECV A;  2XY7 A;  2ZH9 A;  3QEA Z;  2B21 A;  2ZTD A;  1ZJN A;  4B9S A;  2BCS A;  1HUZ A;  1NKC A;  1ZQC A;  4R8U B;  2KZM A;  3SZ2 A;  3PMN A;  7ICS A;  1TK0 A;  4RNN A;  4ECW A;  4I2C A;  9ICO A;  1JQR A;  5KG5 A;  4RQ7 A;  3MR2 A;  5J0T A;  3KHG A;  3JPN A;  1LB2 B;  4KLQ A;  5HML A;  3JPP A;  3LQC B;  4WC3 A;  3G6V A;  1KDH A;  3OSP A;  1X9W A;  4NLK A;  5BOL A;  4E0D A;  1S97 A;  2R8K A;  5KG1 A;  4IQV A;  4J9R A;  4WCW A;  4F4Y A;  1UA0 A;  8ICM A;  5DLF A;  5KG6 A;  1NJZ A;  3LK9 A;  4ATB A;  4X0A A;  5J0O A;  3OVB A;  2ZHA A;  4KN7 A;  3PNC A;  4WC0 A;  1ZET A;  5HR9 A;  2DR8 A;  3MDA A;  8ICU A;  2BR0 A;  4YCX A;  3OSN A;  4O3N A;  4E80 A;  1VJ7 A;  1S0N A;  4DL7 A;  3HPO A;  4QW8 A;  1U48 A;  1JAJ A;  1V9P A;  5KFM A;  5BOM A;  3PO5 A;  2M2U A;  4QZ9 A;  4F5Q A;  1JIH A;  5EWE A;  4FS1 A;  3H8J A;  1TK8 A;  4UAZ A;  4M9J A;  3WFO A;  2KN7 A;  4WC5 A;  1UEU A;  4RUA A;  3GV8 B;  3ISD A;  5DBB A;  5J2H A;  4RQ0 A;  4RPY A;  2O5A A;  1KRP A;  3Q8S B;  1N56 A;  1R8B A;  4X4R A;  4LZG A;  8ICB A;  2I9G A;  2RDI A;  1ZQG A;  3PX6 A;  3IM1 A;  9ICX A;  3ZDA A;  2BPF A;  2HVH A;  4EZ6 A;  2ASJ A;  8ICG A;  4QZF A;  5DGB A;  3RB4 A;  4X4Q A;  1YLQ A;  4DS5 A;  3PW5 A;  3RJF A;  4DQP A;  5KFH A;  4DF8 A;  2KTQ A;  4GXI A;  4DL5 A;  2FMP A;  1Z00 B;  3AU2 A;  3PW0 A;  3K4G A;  4YVZ A;  4XUS A;  4IQW A;  8ICJ A;  3H38 A;  3WFP A;  3PR5 B;  4KLF A;  2IBK A;  1U49 A;  4ELT A;  1NZP A;  2NRW A;  3C2L A;  4MFC A;  4KIT B;  4YMM A;  2DRA A;  4P2H A;  3Q8M A;  4DL2 A;  1WCL A;  2DFL A;  4B9T A;  5HRK A;  1TAU A;  3MDC A;  3AQL A;  4ECY A;  7ICG A;  2A1J B;  4P4P A;  3BQ2 A;  1IXR A;  4I2G A;  4E7X A;  2NRZ A;  2FMS A;  2M2T A;  4J9L A;  3V7K A;  4ECT A;  4KN4 A;  3RJI A;  2ASL A;  1JN3 A;  1ZQZ A;  1ZQA A;  3M9O B;  4PPX A;  1N48 A;  4I2H A;  3E2E A;  2AQ0 A;  5HHH A;  9ICC A;  4ECU A;  4AT7 A;  1TAQ A;  5KFP A;  1ZQV A;  3UXO A;  3OUY A;  2F1J A;  5KT5 A;  2HHS A;  4Z6C A;  5DBC A;  1MSW D;  1LV5 A;  4R63 A;  5DDY A;  4RNM A;  3ETL A;  5DB7 A;  1ZQH A;  3JPR A;  2HHU A;  4AT8 B;  2IHM A;  4Z6F A;  2XY6 A;  4B9N A;  1RXW A;  3ISC A;  1NKE A;  2DRB A;  4RWN A;  4EBE A;  1BPX A;  4X4N A;  5DB8 A;  2R8J A;  4C8N A;  3SV4 A;  4KLS A;  4KLL A;  3AQM A;  4UBB A;  4B9M A;  1S9F A;  5EOZ A;  3UXN A;  5KFA A;  3BQT A;  1Q78 A;  4X0B A;  5IIO A;  1L5U A;  7ICE A;  1BPY A;  3T5K A;  2ZH5 A;  1ZQU A;  1VFG A;  1R8A A;  4RWP A;  5KFC A;  4I2E A;  2NRT A;  2DPI A;  4M9L A;  7ICK A;  1ZQX A;  4ECQ A;  2NRX A;  2BQU A;  3AQN A;  2J6S A;  4DSF A;  7ICL A;  2C2R A;  4ECZ A;  2JZB A;  7ICI A;  1RXV A;  1NK6 A;  4AT7 B;  1JXE A;  4XA5 A;  3UQ2 A;  8ICR A;  7ICR A;  1Q79 A;  5DB9 A;  4BXO A;  3JPO A;  4MFA A;  4Q44 A;  4QZH A;  1Z3E B;  4IQU A;  4PGY A;  4TQR A;  2V4R A;  3RRH A;  2FPM A;  1L3V A;  2PFQ A;  2W9M A;  4UB5 A;  4K4G A;  3SI8 A;  4R64 A;  4M9G A;  2KZZ A;  9ICW A;  5DB6 A;  7ICJ A;  3LWL A;  4FHY A;  1F5A A;  4UB2 A;  3TAR A;  2BPG A;  2ZJ5 A;  4Q45 A;  1QLN A;  7ICN A;  1D9F A;  2PI4 A;  2R8H A;  4O3R A;  2HHV A;  2KP7 A;  1SKS A;  2XGQ A;  3H3A A;  1CEZ A;  2DR5 A;  4GXK A;  5KFV A;  4IRD A;  4KTQ A;  3MAB A;  1NK7 A;  3G6X A;  2XY5 A;  4PHP A;  3SV3 A;  3HJ4 A;  5DG9 A;  3RH6 A;  2PBE A;  4DFK A;  3RRG A;  4O0I A;  9ICS A;  3V6J A;  4Z6E A;  1U9L A;  4P4M A;  4JUZ A;  4EZ9 A;  3IHQ B;  5KG0 A;  2XC9 A;  3C2M A;  2BDP A;  8ICP A;  4Z6D A;  3NTU A;  5KFE A;  4RU9 A;  7ICT A;  1ZQI A;  4QZD A;  4RQ8 A;  3QZ7 A;  4J9O A;  3T5H A;  1U47 A;  4KLD A;  5HRD A;  2KFZ A;  4NLG A;  2F1I A;  5DKW A;  5HHI A;  5KFI A;  3OHB A;  3ZDE A;  4BWM A;  4GLX A;  2AQ4 A;  5DED A;  1U45 A;  4EP7 A;  4WC7 A;  4B9U A;  3PW4 A;  2BCR A;  1BNP A;  3PV8 A;  3UXP A;  1XWL A;  3TQ1 A;  2UVW A;  1BNO A;  1XC9 A;  1X9M A;  8ICV A;  8ICI A;  4YD1 A;  4DFP A;  3TFR A;  5KT6 A;  3ZD9 A;  5D4B A;  4O5K A;  5DBA A;  5J29 A;  4F3O A;  4RUC A; 
#chains in the Genus database with same CATH topology
 3H4B A;  2ZH8 A;  4C80 A;  2E1F A;  2JRZ A;  2YMP A;  4IR9 A;  4IR1 A;  4FFD A;  3GII A;  2ZIU B;  4O3Q A;  2AGP A;  1GO3 F;  5F3X B;  2W9A A;  4EGW A;  3AQK A;  9ICB A;  4FE3 A;  3CK6 A;  5KG3 A;  7ICU A;  4WC1 A;  1OU5 A;  2WAQ F;  3NAS A;  3N4M B;  2ZH3 A;  3BJY A;  2MUT A;  3BZK A;  1BPE A;  1A76 A;  2HMX A;  2M2V A;  1VDV A;  4GC6 A;  1KL9 A;  4JLX A;  2JHD A;  5ALI A;  5DQI A;  5IIM A;  4JK1 A;  3UPS A;  2P66 A;  4C8O A;  1PVQ A;  4NXX A;  5HP4 A;  1ZQB A;  4F5O A;  3HT3 A;  3MR3 A;  1DOQ A;  3UMB A;  3GU3 A;  2ZUB A;  2ZJA A;  3HKZ C;  3Q8L A;  3KHH A;  4DL3 A;  4C4R A;  2MAX A;  2HDO A;  5AI0 A;  4OO1 J;  1V97 A;  4QWE A;  2HHX A;  3K1R B;  2K4P A;  3I1Y A;  1KFT A;  4NJ8 A;  4KLH A;  9ICG A;  3ORY A;  5L1I A;  5HR7 A;  3MGH A;  3H8S A;  4LEY A;  3RJJ A;  1J97 A;  2HBL A;  5IIL A;  5CWR A;  1COK A;  3BQ0 A;  4DQQ A;  2G09 A;  5B3P A;  5D61 A;  4KLE A;  2HHQ A;  2BGW A;  2LM4 A;  1WYG A;  1PK3 A;  4F4K A;  5D63 A;  1UPH A;  3M9M B;  5KFY A;  3ZDD A;  2JMG A;  5DGA A;  1FIQ A;  4KLJ A;  2FDR A;  4J9P A;  5III A;  3H0L B;  4RT2 A;  4EYI B;  2A3V A;  4KLM A;  4PZN A;  3NKU A;  4DOB A;  5KFN A;  5DQH A;  1XS9 D;  1FA0 A;  1Z4O A;  3OTQ A;  5ALE A;  2ZH4 A;  1QTM A;  4MFF A;  4YG2 A;  2BHN A;  4J9Q A;  1KFS A;  2H3I A;  1A77 A;  4I2J A;  2K8A A;  8ICH A;  4YP3 A;  4S3N A;  4RQ5 A;  3T5J A;  2YMM A;  1X40 A;  2NV3 A;  4UW9 A;  5CHE A;  3THV A;  4OJ5 A;  2ALZ A;  1S10 A;  4LT6 A;  2DPJ A;  5ALS A;  1YZ6 A;  5KFF A;  3BQ1 A;  5JRT A;  4NM2 A;  1L6N A;  3U26 A;  5J2J A;  2W7P A;  2HOQ A;  2HW3 A;  3T5L A;  4M47 A;  4C7Z A;  3MR6 A;  5AM0 A;  3OJS A;  1B0X A;  4GXJ A;  5HR6 A;  1XSL A;  2GH1 A;  3C23 A;  4DSK A;  4E8F A;  1N60 A;  3PO4 A;  2W3S A;  1XU4 A;  3Q8P B;  3Q8R B;  3TI0 A;  4QWD A;  4YN4 A;  3D2N A;  4EBJ A;  3SMV A;  4IG8 A;  3O0F A;  4Q43 A;  3RH4 A;  5KT2 A;  1NO5 A;  2E8P A;  4UB3 A;  3RBD A;  3PY8 A;  5D46 A;  5J0W A;  2WF6 A;  1R89 A;  2YTU A;  5KFG A;  3SAF A;  5J0Q A;  4FH3 A;  4GIB A;  4RPX A;  4I0U A;  4RQ4 A;  4QW9 A;  5G5H A;  3C5G A;  4JMU A;  1FO4 A;  2XO7 A;  1B22 A;  4GC7 A;  1J2M A;  3HKZ F;  4NLC A;  3AQF A;  4M9H A;  1FFV A;  7ICH A;  4PHD A;  4EBD A;  4O3M A;  4X4U A;  1KW4 A;  3EF2 A;  1UET A;  3RR8 A;  1JRP A;  3PR4 A;  3JYY A;  1P7D A;  2VIX A;  5CB1 A;  4KLI A;  3KZX A;  4X5V A;  2ZIX A;  4FS2 A;  4O3P A;  3EW9 A;  1ZQJ A;  3TAP A;  3EZ5 A;  4QZI A;  2XCA A;  4PHE A;  1PX5 A;  2YY6 A;  1T94 A;  4WQK A;  5J2C A;  4CGZ A;  3NGD A;  3PSP A;  3C21 A;  2F1H A;  3TAD C;  5B66 U;  2BQR A;  1TFR A;  1MQ3 A;  3M8R A;  1NOM A;  5CJ7 A;  4F91 B;  4PZO A;  1V4A A;  1RYU A;  2RP5 A;  2BCV A;  2VA3 A;  4CF5 A;  2JV3 A;  2A19 A;  4O5C A;  3MFI A;  4C4S A;  9ICL A;  2G08 A;  2ZIX B;  4YFK A;  2LYB A;  1S0M A;  1RM6 C;  1HJP A;  3H8W A;  3QEB Z;  1ZQO A;  1NJY A;  2LYH A;  2WF9 A;  2G06 A;  4IQT A;  8ICA A;  2WTF A;  2W43 A;  3KHR A;  1XSP A;  2JEJ A;  4O9M A;  2MU2 A;  7ICV A;  4B9L A;  1KTQ A;  5KFU A;  8ICN A;  4QZG A;  3RR7 A;  2K8C B;  2BZF A;  2QB0 A;  4F8R A;  3RJH A;  3PML A;  1PUZ A;  5ALW A;  4WBY A;  2XY7 A;  3NUQ A;  3QEA Z;  2HOF A;  3NVO A;  1ZQC A;  7ICS A;  4MHV A;  2H3Z A;  1ZD4 A;  4RQN A;  5ALM A;  1S5L U;  1LB2 B;  3IG5 A;  2YB4 A;  4E0D A;  4J9R A;  4IQV A;  1UA0 A;  1NI3 A;  5DLF A;  3LK9 A;  2ZHA A;  4WC0 A;  1ZET A;  2GOL A;  8ICU A;  2BR0 A;  4LJX A;  2QB0 B;  4E80 A;  1VJ7 A;  4PL2 A;  1X42 A;  4Y2S A;  5EWE A;  3WFO A;  1N2X A;  1UEU A;  3ISD A;  4X4R A;  2I9G A;  4IS7 A;  3PX6 A;  3IM1 A;  5AK4 A;  9ICX A;  2HVH A;  3GZF A;  8ICG A;  4KMO B;  4QZF A;  2QKQ A;  3RB4 A;  2F2A B;  3RJF A;  5KFH A;  2FMP A;  2DBY A;  1Z00 B;  8ICJ A;  3WFP A;  4RQM A;  3PR5 B;  4KLF A;  3LVV A;  4KIT B;  4YMM A;  3Q8M A;  1WCL A;  2DFL A;  2K4H A;  2Z7J A;  3BQ2 A;  4CNQ A;  4Y2P A;  2FMS A;  4ECT A;  4Y2Y A;  1ZQZ A;  4I2H A;  3KD3 A;  2QAR A;  2CRX A;  4ECU A;  1SIJ A;  1TAQ A;  4BJQ A;  3OUY A;  2F1J A;  2PMZ C;  5KT5 A;  1MSW D;  4Z6C A;  5DBC A;  2G5H B;  1LV5 A;  5DB7 A;  3JPR A;  4AT8 B;  1T3Q A;  5ALJ A;  3L3F X;  3BS7 A;  2B51 A;  3AQM A;  4UBB A;  4K96 A;  2W7O A;  5IIO A;  2ZH5 A;  3T5K A;  1R8A A;  4RWP A;  4I2E A;  4QJF B;  2DPI A;  3WU2 U;  1IG6 A;  1ZQX A;  2NYV A;  2NRX A;  2J6S A;  2QAR B;  7ICI A;  2JZB A;  1RXV A;  1JXE A;  1OXJ A;  4NXV A;  3JPO A;  4QZH A;  4TQR A;  4PGY A;  2V4R A;  2HOI A;  2M2T A;  2W9M A;  7ICJ A;  7ICN A;  3F5E A;  3TAR A;  2MSN A;  5AKY A;  1WUD A;  2R8H A;  3MGV A;  3WK8 A;  3NWI A;  5ALG A;  4IRD A;  1NK7 A;  2XY5 A;  2PBE A;  3RRG A;  3TAC B;  3A0B U;  4Z6E A;  2KIW A;  3SD7 A;  2BDP A;  4WJ3 B;  4Z6D A;  2Y0S F;  1ZQI A;  4KLD A;  3T5H A;  1U47 A;  4NLG A;  4K98 A;  2AQ4 A;  1NNL A;  3PW4 A;  3UXP A;  1XWL A;  3F53 A;  2OHF A;  8ICV A;  3TFR A;  5KT6 A;  1SV0 C;  1DRG A;  2ZIV A;  3NRZ A;  2LYA A;  3NVY A;  1C7Y A;  2K60 A;  4NY8 A;  3H40 A;  8ICZ A;  4M5D A;  5DQG A;  2W8L A;  2P6R A;  4IRC A;  2J6T A;  3ED5 A;  2BKE A;  8ICF A;  2ATL A;  1DK3 A;  4QWA A;  3QYP A;  4EBK A;  2KNJ A;  1SKW A;  2KVS A;  4F4X A;  8ICQ A;  3HJ1 A;  1VLB A;  2KZ3 A;  2LMR A;  1KLN A;  2CXY A;  4YMO A;  9ICJ A;  3UQ0 A;  2YN4 A;  5AI5 A;  1TAM A;  4ED2 A;  4EX6 A;  4DLG A;  4G9B A;  7ICM A;  4BX9 C;  5DG8 A;  4PH5 A;  2KJ9 A;  1MIW A;  3RJK A;  2XIC A;  2OWO A;  4O3S A;  9ICT A;  2N1R A;  3MCR A;  4UAR A;  4JLZ A;  1ZJM A;  2IOF K;  2W9C A;  3UMG A;  4RQ3 A;  4X4V A;  2IOH A;  1BPB A;  5IIJ A;  2PXI A;  3G6Y A;  3RJE A;  8ICE A;  3QUQ A;  1ZQR A;  3GDX A;  5J0R A;  4QWC A;  1RZT A;  4LEZ A;  4OAH A;  4M6W A;  2P35 A;  4PGX A;  4M0A A;  3AM9 A;  3F5A A;  2EAN A;  3T3F A;  2Q66 A;  2YML A;  3ER8 C;  2BE3 A;  1PVR A;  3J81 j;  1RQL A;  5BPC A;  9ICU A;  1L7P A;  2W9C B;  1R8C A;  3OVS A;  8ICC A;  4KLT A;  4K97 A;  3NYB A;  4NL9 A;  3ALR A;  4QNL A;  3C2K A;  1A6S A;  1M6Y A;  5EE0 A;  1TK5 A;  5D49 A;  2G5I B;  1ZD5 A;  8ICW A;  4MEX A;  4F4Z A;  5E79 U;  9ICF A;  4J9M A;  4M6W B;  4Q8E A;  3GV5 B;  4K4H A;  5B3Q A;  4KB6 A;  3D2S A;  4IC9 A;  3GIL A;  2FLL A;  4X4T A;  5AKZ A;  2DL0 A;  3QU2 A;  2KG5 A;  4Y2X A;  2G0A A;  4NXZ A;  4BXO B;  4X4S A;  3JPQ A;  5EWF A;  5J2I A;  1N63 A;  3DEE A;  4C0Z A;  4UD4 A;  1ED1 A;  5HRG A;  4Y2V A;  3HP6 A;  3WKD A;  1KBU A;  1ZRN A;  1TVA A;  4OAI Z;  4QZB A;  2HHW A;  1ZQD A;  4DFJ A;  4DSL A;  1ZQQ A;  1T3N A;  7ICQ A;  1NK8 A;  4YR2 A;  3AU6 A;  4FBU A;  4DSE A;  1F5A A;  1WWV A;  2L5Y A;  1UEV A;  2IUB A;  1TFY A;  5ALV A;  4RT3 A;  1H38 A;  2GWS A;  4RPZ A;  5G5G A;  3WKA A;  4TQS A;  4NXU A;  3C1Y A;  5F9L A;  5J2A A;  3L9D A;  4MF2 A;  4AP9 A;  2VA2 A;  1N61 A;  5AKK A;  3QE9 Y;  4Q8F A;  5KL8 B;  8ICS A;  8ICL A;  2O6K A;  3QU5 A;  2BCQ A;  3R9K A;  1Z4N A;  4DFM A;  2D6F C;  3GIM A;  1K1S A;  4UD5 A;  1NK0 A;  1BVS A;  1L7O A;  5D62 A;  3WK5 A;  2V4Q A;  2W9B A;  3HIY A;  2RQ5 A;  1Q3V A;  4JB3 A;  4C8K A;  5AIC A;  5J0S A;  3HRD D;  4FHX A;  2E8O A;  4F2R A;  3ERC C;  1PK1 A;  5C5J A;  4F4W A;  2ZUC A;  5EE9 A;  4XJE A;  2DR9 A;  1NK4 A;  4US8 A;  3FDS A;  5HMM A;  2MUT B;  5KFW A;  4DQR A;  4F50 A;  1VJ5 A;  3QNM A;  1IIP A;  4KLG A;  4KLO A;  2PFN A;  1ZQK A;  1PVP A;  4OCZ A;  2W9B B;  1JAL A;  2R18 A;  5KFS A;  2FLP A;  3QUC A;  4BWJ A;  5H2F U;  4HX0 A;  2VA8 A;  4USA A;  4K8V A;  1TE2 A;  2LM1 A;  3PX4 A;  2GLE A;  3BQ7 A;  3TAN A;  3TFS A;  4XQ8 A;  1SL2 A;  2KMD A;  3C18 A;  1XSN A;  1Z1B A;  4NKT A;  1SZP A;  3SEN A;  1B43 A;  5AM3 A;  3EUB 2;  2BCU A;  5HRH A;  2WHE A;  1Z1V A;  1S0V A;  1EXN A;  3SEI A;  2E1E A;  2JR5 A;  3M8S A;  1ZRM A;  8ICO A;  2J6U A;  4NLB A;  1BGX T;  2WF5 A;  2R8I A;  3H0R B;  7ICP A;  3K7D A;  5CEH A;  4JV1 A;  3GQC A;  5GTI U;  1COO A;  3M6K A;  4O6A A;  3KHL A;  2ZTC A;  1D8L A;  2W3R A;  1QQ7 A;  4KX3 A;  2PFO A;  3PW2 A;  3DDH A;  4R66 A;  5JTI A;  4IRK A;  3WFS C;  3HJE A;  3N97 B;  4YXJ A;  3JPS A;  1UA1 A;  4QZA A;  5C0Y A;  2EAP A;  1ZJN A;  4HAI A;  1Q3U A;  4O69 A;  1NKC A;  2KZM A;  3SZ2 A;  3PMN A;  4EEN A;  1TK0 A;  1WWU A;  4OJO A;  4ECW A;  1JQR A;  5KG5 A;  4RQ7 A;  3MR2 A;  5J0T A;  3JPN A;  3G6V A;  1KDH A;  3OSP A;  1S97 A;  2FJ6 A;  2R8K A;  5KG1 A;  3CRX A;  4F4Y A;  8ICM A;  5AM2 A;  2LPE A;  5KG6 A;  4ATB A;  4X0A A;  2DR8 A;  4KN7 A;  3PNC A;  3ONN A;  1S0N A;  4QW8 A;  1JAJ A;  1V9P A;  2M2U A;  3PO5 A;  4QZ9 A;  4F5Q A;  3PHZ A;  3QX7 A;  4M9J A;  4WC5 A;  4RUA A;  3QU4 A;  4RQ0 A;  5J2H A;  4U7C A;  3Q8S B;  3C29 A;  3F2D A;  4AYB C;  3F2C A;  4X4Q A;  1YLQ A;  4DS5 A;  2KTQ A;  3OPX A;  1JRO A;  4DL5 A;  3AU2 A;  2LKY A;  3WK6 A;  1U49 A;  1NZP A;  2NRW A;  5EE1 A;  4DL2 A;  4B9T A;  5HRK A;  3MDC A;  3AQL A;  1JI7 A;  2NRZ A;  3B9J A;  5ALR A;  2QB1 A;  4KN4 A;  5AKJ A;  1JN3 A;  1N48 A;  4FZN A;  9ICC A;  2DWQ A;  4EEB A;  1SGG A;  3WK4 A;  5DDY A;  2BDU A;  2IHM A;  3KKA A;  3K1Z A;  4Z6F A;  3SQI A;  5AK5 A;  3QUB A;  1RXW A;  1NKE A;  4RWN A;  2GAF D;  1BPX A;  2E5S A;  2XVT A;  2R8J A;  4C8N A;  1RG6 A;  4B9M A;  2B0C A;  5EOZ A;  3UXN A;  3BQT A;  3FAH A;  4X0B A;  1L5U A;  2B4V A;  1VFG A;  2K89 A;  1MA7 A;  2NRT A;  4ECQ A;  5ALU A;  2W54 A;  2CN1 A;  2C2R A;  4ECZ A;  4XA5 A;  4OJP A;  8ICR A;  7ICR A;  5DB9 A;  4MFA A;  1L3V A;  2PFQ A;  4M9G A;  3SI8 A;  1SXD A;  2KZZ A;  9ICW A;  5DB6 A;  1IV8 A;  4Q45 A;  2HHP A;  4O3R A;  2KP7 A;  2HHV A;  1SKS A;  4GFJ A;  3H3A A;  1CEZ A;  2Y0S C;  2DR5 A;  2KKP A;  5KFV A;  3G6X A;  3SV3 A;  4OD0 A;  3V6J A;  1U9L A;  4JUZ A;  2XC9 A;  2DGZ A;  3NTU A;  5KFE A;  2OM6 A;  4QZD A;  2KFZ A;  2F1I A;  4DCC A;  5DKW A;  5KFI A;  3ZDE A;  4BWM A;  4GLX A;  5DED A;  1BNP A;  3PV8 A;  1X9X A;  1X9M A;  4DFP A;  4U6P A;  3ZD9 A;  1N5X A;  2A1A A;  4F3O A;  1D8B A;  1WCN A;  3CYM A;  3EPI A;  3AN1 A;  5HRE A;  3EYZ A;  5KT7 A;  3IG8 A;  2B56 A;  2O1P A;  2M9N A;  2DVI A;  4RQ1 A;  4M2Y A;  4F2S A;  4UB1 A;  4WC7 A;  1BPD A;  4TUR A;  4FO6 A;  1NZB A;  4O3O A;  2DQN B;  4ELU A;  3M1Y A;  3HWT A;  2ZH2 A;  5KNI A;  4K99 A;  1JXL A;  1D8Y A;  1BPZ A;  2HBJ A;  1IM4 A;  9ICV A;  1ZXI A;  1DXS A;  3SAG A;  8ICK A;  5CFS A;  2EZX A;  3IP4 B;  3DV9 A;  4J03 A;  5J2B A;  5KG2 A;  4AYB F;  3ZD8 A;  4KM5 A;  3RB6 A;  2IOF A;  4F71 A;  3H37 A;  4R65 A;  3MFH A;  1YT3 A;  2AJQ A;  1ZQE A;  2XI9 A;  3UPQ A;  2UVV A;  5IIK A;  9ICP A;  4ZOH C;  1MQ2 A;  4F5P A;  1KKX A;  2Q0Z X;  4G3I A;  2JEG A;  2OCE A;  4JV0 A;  4HYK A;  2QLT A;  1KEJ A;  2KHV A;  5L1J A;  1KNY A;  5TZV A;  4F92 B;  3I28 A;  2IHN A;  2AH5 A;  2EAO A;  2ZH6 A;  3LWM A;  3NS1 A;  1ZQP A;  4I2F A;  1PZN A;  1L7N A;  1CI4 A;  1O08 A;  1U4B A;  2P6U A;  2HN2 A;  5AK3 A;  4OAG A;  3N7R C;  4F5N A;  4DS4 A;  2LHT A;  1QSY A;  4X4P A;  2ZG6 A;  3OUY B;  5JU5 A;  4ICA A;  4XRH A;  5L9X A;  1XO0 A;  3WKE A;  2EZZ A;  2Y1I A;  4JWN A;  4DO9 A;  2PKE A;  3M9N B;  3S6J A;  3IDW A;  4MEY A;  1UQV A;  4RQ6 A;  2RDJ A;  1N5W A;  2F3N A;  1L3T A;  1NK5 A;  4WQL A;  5L1L A;  3CNH A;  1ZQS A;  4ELV A;  3K75 D;  3A0H U;  5ALF A;  2I5H A;  1N62 A;  2JZB B;  4DLE A;  2OH2 A;  4NV0 A;  4RQ2 A;  2M0N A;  2WFA A;  5ALZ A;  1ZQ1 C;  5KFQ A;  2R8G A;  1JMS A;  2KJ5 A;  3KTQ A;  4NKU A;  2FI1 A;  4FH5 A;  1CUK A;  5CP2 A;  4ZH4 A;  5T14 A;  1SWV A;  4NL9 C;  5HRF A;  3QUT A;  4P4O A;  3TAQ A;  5HRB A;  4ED3 A;  2DR7 A;  1J2N A;  2ZJ8 A;  5IIN A;  1ZQW A;  2Y1J A;  3M6Z A;  5A0L A;  1UT8 A;  4KLU A;  4ED6 A;  4I2A A;  4DSJ A;  2YX8 A;  3L4P A;  2I6X A;  4I27 A;  1V85 A;  1S8O A;  3E0F A;  5AKH A;  5DDM A;  5EWG A;  4ECR A;  2KIV A;  2EZY A;  4QZE A;  2OXO A;  5K4L A;  1TKD A;  2GO7 A;  3KFU F;  1X6J A;  5AKX A;  4LZD A;  3LYS A;  3N7S C;  2VKQ A;  2ZIV B;  2C2D A;  8ICY A;  1V38 A;  2LI6 A;  4KMU A;  5AI4 A;  2HBK A;  2ASD A;  1ZQT A;  2Q4T A;  4M9N A;  1S76 D;  1ARO P;  1ZQL A;  2A1J A;  4QZ8 A;  4I2B A;  2UVR A;  3JPT A;  1T7P A;  2BBH A;  3RAX A;  3SYZ A;  4LEV A;  3HX0 A;  4EX7 A;  1QQ6 A;  5F2V O;  1LVH A;  4UAY A;  3Q8K A;  2ZUD A;  4O5E A;  9ICH A;  4IL6 U;  3UM9 A;  3V6K A;  1SKR A;  4EEY A;  2XCP A;  3RBE A;  3N7P D;  1ZQN A;  4FHV A;  4UB6 U;  3GFK B;  2KFN A;  1QCK A;  4DL6 A;  1QSL A;  3FYH A;  4UB4 A;  5AM5 A;  3CP8 A;  5AM1 A;  4UQG A;  2I1Q A;  4C8M A;  3MC1 A;  3OV7 A;  3MGI A;  5CA7 A;  3NVZ A;  3C66 A;  4WC2 A;  4NWI A;  5J2E A;  4ECS A;  3M7D A;  3QU9 A;  2EQY A;  2F76 X;  1TV9 A;  3HIL A;  3Q8Q B;  3WFR E;  1XO1 A;  2FPK A;  5AI6 A;  4F5R A;  3CW2 C;  5KFD A;  3QXG A;  5B5E U;  5F9N A;  5KFB A;  5HNK A;  2E8M A;  3KZI U;  1UT5 A;  3N28 A;  4EBC A;  4CCH A;  2FLN A;  2GA9 D;  3TKA A;  4MKP A;  1F0M A;  2DKZ A;  4LVS A;  4NXT A;  4YMN A;  3NVV A;  2KVC A;  2JXJ A;  5ALT A;  4EV6 A;  1HUO A;  1HIW A;  1K1Q A;  4CF4 A;  1L7M A;  3OVA A;  1S0O A;  4ED1 A;  5HRL A;  5DEC A;  3QZ8 A;  3OWG A;  1A0P A;  1L8L A;  2AU0 A;  3AEV A;  2IA6 A;  5JTG A;  2HVI A;  4B9V A;  1OUQ A;  2OYY A;  4ED7 A;  5L1M A;  2W11 A;  3V72 A;  2JGA A;  3GV7 B;  2KOB A;  2ISO A;  4YR3 A;  3AUO A;  5AKI A;  2C28 A;  3EWA A;  4ECV A;  3C28 A;  2B21 A;  2ZTD A;  2BCS A;  2DF4 B;  4A8E A;  2KHQ A;  4I2C A;  3KHG A;  4WC3 A;  5EE3 A;  4KLQ A;  2H3F A;  5HML A;  2ZXH A;  1KN5 A;  2D3D A;  5BOL A;  2MRL A;  3PZP A;  1SXE A;  4WCW A;  1NJZ A;  2W04 A;  3OVB A;  5J0O A;  5HR9 A;  4YCX A;  4O3N A;  3HPO A;  1U48 A;  2W55 A;  4K9A A;  5KFM A;  5BOM A;  1TK8 A;  3H8J A;  3GV8 B;  2F8L A;  4RPY A;  2O5A A;  2K4E A;  1N56 A;  4LZG A;  1DGJ A;  1ZQG A;  3IV6 A;  4UAU A;  2BPF A;  4EZ6 A;  4Y2R A;  5DGB A;  5AK6 A;  2RHF A;  4DQP A;  3PW5 A;  5CFT A;  4GXI A;  4YVZ A;  2HSZ A;  2IBK A;  3C2L A;  4MFC A;  2F8K A;  2G07 A;  1TAU A;  4FO1 A;  5ALK A;  2NO5 A;  1GPJ A;  4CF3 A;  3V7K A;  2ASL A;  3RJI A;  1ZQA A;  4PPX A;  3M9O B;  1PK1 B;  4AT7 A;  2EDU A;  5KFP A;  2ES6 A;  3VCB A;  2HI0 A;  1HEK A;  4R63 A;  4RNM A;  1ZQH A;  3BS5 A;  1JUD A;  2XY6 A;  4B9N A;  3ISC A;  2KSO A;  5J8Y A;  5DB8 A;  2E3T A;  3SV4 A;  4KLL A;  5KFA A;  1ZQU A;  3KBB A;  5KFC A;  1Q8K A;  4M9L A;  7ICK A;  1FFU A;  4CE6 A;  5AHX A;  2BQU A;  4DSF A;  7ICL A;  4AT7 B;  1NK6 A;  3UQ2 A;  1Q79 A;  3AMZ A;  4Q44 A;  1Z3E B;  4IQU A;  3RRH A;  4K4G A;  3BS5 B;  4US9 A;  4Y2J A;  4R64 A;  4OJ6 A;  3LWL A;  3IRU A;  1QLN A;  1D9F A;  2KSO B;  4GXK A;  3MAB A;  3KKA C;  5KL1 B;  2EH9 A;  3HJ4 A;  4DFK A;  2XID A;  4C4T A;  1Z19 A;  4P4M A;  4FZL A;  3IHQ B;  5KG0 A;  3C2M A;  8ICP A;  1F5S A;  9ICK A;  4EEL A;  3QZ7 A;  4Y2Q A;  5HHI A;  1QQ5 A;  3H8M A;  1U45 A;  2DKX A;  4EP7 A;  2EWR A;  5ALH A;  2UVW A;  3TQ1 A;  1BNO A;  5KAF U;  4O5K A;  5DBA A;  4F72 A;  9ICI A;  2F44 A;  2NRV A;  2ODG A;  1TFW A;  4DOA A;  5HC9 A;  3I76 A;  2C22 A;  4K4I A;  4TUP A;  4YXM A;  4PGQ A;  2PI5 A;  2JEI A;  3D2Q A;  1ZQF A;  1XNS A;  2WB1 C;  3C1Z A;  3RJG A;  5AKL A;  1ZQY A;  1T4G A;  4EYH B;  4B6J A;  3PW7 A;  3RB3 A;  3B0X A;  2FMQ A;  3HW8 A;  2IHO A;  5J0Y A;  3F2B A;  4CDG A;  4ATB B;  4DOC A;  3OHA A;  1ZD3 A;  4WC4 A;  5DG7 A;  2H3Q A;  4YD2 A;  4ECX A;  3AL0 B;  5KFX A;  3IN5 A;  3PVX A;  4I2D A;  9ICA A;  2BPC A;  4ED8 A;  3WKB A;  5JUM A;  3RB0 A;  1URJ A;  4NLZ A;  4FZM A;  2FE9 A;  4RWQ A;  5KG4 A;  2H5X A;  3MR5 A;  1DK2 A;  5KT4 A;  3D6J A;  1SV4 A;  5ALX A;  4TUS A;  4DQS A;  9ICR A;  1YZ7 A;  2K4I A;  3L5K A;  5KFK A;  1C20 A;  1DGS A;  2UVU A;  1Q46 A;  2YQE A;  4UAS A;  2AHO B;  4ED0 A;  2W03 A;  1ZYQ A;  3ZDB A;  4DWI A;  2XGP A;  1T8E A;  4O67 A;  2VAN A;  3SR6 A;  1X9S A;  5ALD A;  4UBC A;  5KFJ A;  4YQW A;  3KOO A;  3WK7 A;  1KFD A;  2ZH1 A;  4DL4 A;  2JH1 A;  1WOT A;  2NO4 A;  1SWW A;  4FHP A;  3LVW A;  1LKY A;  5ALL A;  3ZI4 A;  1RDF A;  1SL1 A;  3B0Y A;  3FC4 A;  2HCF A;  2V9W A;  3BDP A;  4RWO A;  4X4O A;  2F77 X;  8ICX A;  1L3U A;  1SZH A;  2ZTE A;  3PX0 A;  3V6H A;  3WK9 A;  4AT9 A;  3QU7 A;  4C7Y A;  4TUQ A;  2BQ3 A;  4UAV A;  2OEH A;  1ECW A;  2HN1 A;  4JV2 A;  1LKY B;  3H7I A;  4I28 A;  2KV2 A;  2W8K A;  4OAF A;  2FPL A;  4BUG A;  3FM9 A;  1MIY A;  1NJW A;  2B6G A;  5J2G A;  4WOY A;  3V7L A;  4M04 A;  2FCL A;  4P0Q A;  2MA1 A;  4NM1 A;  1RYR A;  4WC6 A;  1AQ6 A;  2C2E A;  2JEF A;  3H39 A;  4AT9 B;  4Y2U A;  4MF8 A;  1KSP A;  2YB1 A;  1X6I A;  5KFO A;  3GIK A;  3C5F A;  5CR0 A;  1X66 A;  4BDP A;  5J2D A;  3NVW A;  1Z00 A;  3V7J A;  7ICF A;  5KG7 A;  3WFQ E;  5AI9 A;  1MIV A;  1D9D A;  2DUY A;  2WB1 F;  4P0Q B;  9ICM A;  1L8O A;  4J9N A;  5J0P A;  1NK9 A;  4QWB A;  5KAI U;  9ICQ A;  4C8L A;  1K5O A;  4I29 A;  3ISB A;  4FBT A;  4LEW A;  3ZDC A;  2KEY A;  3JZ0 A;  2ZHB A;  5J0U A;  2RRD A;  4RZR A;  5KFL A;  5GTH U;  5CHG A;  4PHA A;  2AGO A;  1L3S A;  5AM4 A;  5KFT A;  2KJ8 A;  1QSS A;  5HRI A;  3OGU A;  4DFD A;  3RTV A;  4UAW A;  4AT8 A;  4EEK A;  1X2I A;  3EPG A;  5KFR A;  4NXW A;  3GIJ A;  3TAD A;  1NJX A;  2ID1 A;  3PST A;  3LDA A;  1S77 D;  5J2F A;  5KFZ A;  2ZH7 A;  4QIW C;  4F93 B;  4J9S A;  1OW5 A;  4DQI A;  2PFP A;  7ICO A;  9ICN A;  5ALP A;  4DSI A;  2IMW P;  1SL0 A;  4I2I A;  2ZXI A;  1NKB A;  1Y88 A;  4J9K A;  5ALY A;  5J2K A;  1RPL A;  4DEZ A;  4DF4 A;  4BGD A;  4XQ7 A;  4RNO A;  2Y9T A;  1ZOL A;  2HHT A;  2NRK A;  1MC8 A;  1UHU A;  2WF8 A;  4NLN A;  1Q78 A;  8ICT A;  4O68 A;  1JX4 A;  4QZC A;  2E8N A;  3H4D A;  2ISP A;  4JWM A;  5CFU A;  1F44 A;  4FHW A;  3RH5 A;  4R8U A;  2YMQ A;  5J0X A;  4WBZ A;  5L1K A;  3MBY A;  4UB8 U;  5KTQ A;  5DLG A;  5AIA A;  2H3V A;  2VJ5 A;  1ZD2 P;  4YR0 A;  2M2W A;  4KX5 A;  1RYS A;  3RAQ A;  3OJU A;  1UCV A;  5KT3 A;  1ZQM A;  2AGQ A;  2EAM A;  4B9S A;  1HUZ A;  4R8U B;  2D8C A;  4RNN A;  9ICO A;  3LQC B;  3JPP A;  4NLK A;  1X9W A;  2CPR A;  3RFA A;  1MN8 A;  5AKG A;  3JCF A;  3ETR A;  2WAQ C;  2ESE A;  3MDA A;  3OSN A;  3T79 A;  4DL7 A;  2AXT U;  2ZIW A;  2JH7 A;  1JIH A;  4FS1 A;  3PSI A;  4UAZ A;  3SAH A;  2KN7 A;  5DBB A;  1KRP A;  1R8B A;  5CRX A;  8ICB A;  2Y9U A;  1SB3 C;  2RDI A;  3ZDA A;  2ASJ A;  2BBJ A;  3ER9 B;  2KK0 A;  1WG8 A;  4DF8 A;  2VJ4 A;  4PJ0 U;  3PW0 A;  3K4G A;  4Y2T A;  4XUS A;  4IQW A;  3H38 A;  4ELT A;  1RQN A;  2DRA A;  5AIB A;  4P2H A;  2ZIW B;  3BZC A;  4ECY A;  7ICG A;  2A1J B;  4P4P A;  1IXR A;  4I2G A;  4E7X A;  2RLT A;  4J9L A;  2KKV A;  4OJL A;  2KIC A;  3E2E A;  2AQ0 A;  5HHH A;  3PSF A;  1ZQV A;  3UXO A;  4PL1 A;  4QIW F;  2HHS A;  2KD1 A;  1O03 A;  3ETL A;  2HHU A;  3NRW A;  3ICX A;  1KQQ A;  2DRB A;  4EBE A;  4X4N A;  4UAT A;  3RF9 A;  1B4F A;  4KLS A;  1S9F A;  2PMZ F;  2KE7 A;  4P0P A;  2LBO A;  7ICE A;  1BPY A;  4CRX A;  4EED A;  3AQN A;  4WH5 A;  4BXO A;  2RFF A;  9ICE A;  3WKC A;  2FPM A;  1SV0 A;  4UB5 A;  4FHY A;  4UB2 A;  2BPG A;  2ZJ5 A;  5TIS U;  5ALO A;  2PI4 A;  2XGQ A;  3E58 A;  4KTQ A;  4PHP A;  1FEZ A;  4P0P B;  5DG9 A;  5J8Y C;  4N7R A;  3RH6 A;  1CRX A;  4O0I A;  9ICS A;  5ALN A;  5AKE A;  4EZ9 A;  2ZIU A;  5FP0 A;  3H0M B;  4RU9 A;  7ICT A;  2ZH9 A;  4RQ8 A;  4J9O A;  4ACO A;  5HRD A;  4K9B A;  5ALQ A;  3AQE A;  3OHB A;  3VC8 A;  4B9U A;  2BCR A;  2WF7 A;  3UMC A;  2K8B B;  2HBM A;  1XC9 A;  8ICI A;  4YD1 A;  5D4B A;  1QH9 A;  5J29 A;  5AI8 A;  4RUC A; 
#chains in the Genus database with same CATH homology
 3H4B A;  1WCN A;  1C7Y A;  3EPI A;  9ICI A;  2ZH8 A;  5HRE A;  2NRV A;  3EYZ A;  4IR9 A;  4NY8 A;  4IR1 A;  5KT7 A;  3H40 A;  1TFW A;  8ICZ A;  2O1P A;  3GII A;  4M5D A;  5DQG A;  2W8L A;  2M9N A;  4DOA A;  5HC9 A;  2DVI A;  4O3Q A;  4RQ1 A;  2AGP A;  2P6R A;  4M2Y A;  4IRC A;  4F2S A;  4UB1 A;  2W9A A;  4TUP A;  2C22 A;  2J6T A;  4K4I A;  4YXM A;  9ICB A;  4PGQ A;  3AQK A;  1BPD A;  2BKE A;  5KG3 A;  4TUR A;  7ICU A;  4WC1 A;  4FO6 A;  2PI5 A;  4O3O A;  2JEI A;  1ZQF A;  8ICF A;  1OU5 A;  2ATL A;  4QWA A;  1DK3 A;  4ELU A;  3C1Z A;  4EBK A;  1SKW A;  3HWT A;  3N4M B;  3RJG A;  2ZH2 A;  1ZQY A;  1T4G A;  2ZH3 A;  3BJY A;  4F4X A;  1JXL A;  1BPZ A;  4EYH B;  1D8Y A;  2MUT A;  8ICQ A;  1IM4 A;  9ICV A;  3HJ1 A;  2KZ3 A;  3PW7 A;  1BPE A;  3RB3 A;  1A76 A;  1KLN A;  4YMO A;  3B0X A;  9ICJ A;  2FMQ A;  3HW8 A;  2M2V A;  8ICK A;  5J0Y A;  3UQ0 A;  5J2B A;  5KG2 A;  4ATB B;  4DOC A;  4GC6 A;  3OHA A;  4WC4 A;  4ED2 A;  3ZD8 A;  4DLG A;  7ICM A;  3RB6 A;  5DQI A;  5DG7 A;  5DG8 A;  5IIM A;  4JK1 A;  4PH5 A;  3H37 A;  4YD2 A;  4R65 A;  3MFH A;  4ECX A;  2P66 A;  5KFX A;  1ZQE A;  3RJK A;  4C8O A;  3UPQ A;  2UVV A;  5HP4 A;  5IIK A;  3PVX A;  2OWO A;  4I2D A;  9ICA A;  2BPC A;  4ED8 A;  1ZQB A;  4O3S A;  9ICP A;  9ICT A;  5JUM A;  3RB0 A;  4F5O A;  4F5P A;  1MQ2 A;  1ZJM A;  3HT3 A;  2W9C A;  2Q0Z X;  4RQ3 A;  4NLZ A;  4G3I A;  3MR3 A;  2RFF A;  1DOQ A;  4X4V A;  2JEG A;  4RWQ A;  1BPB A;  5IIJ A;  2ZUB A;  4JV0 A;  2ZJA A;  2PXI A;  4HYK A;  3Q8L A;  3G6Y A;  3RJE A;  5KG4 A;  8ICE A;  3KHH A;  1KEJ A;  4DL3 A;  5L1J A;  1KNY A;  2H5X A;  3MR5 A;  1DK2 A;  5KT4 A;  1ZQR A;  2MAX A;  3GDX A;  5TZV A;  4F92 B;  5J0R A;  4QWC A;  1RZT A;  4TUS A;  4DQS A;  9ICR A;  4QWE A;  2HHX A;  5KFK A;  1DGS A;  4M6W A;  2UVU A;  2IHN A;  1KFT A;  4PGX A;  4ED0 A;  4M0A A;  4KLH A;  9ICG A;  2ZH6 A;  3LWM A;  1ZYQ A;  3T3F A;  3ORY A;  5L1I A;  1ZQP A;  1PZN A;  2XGP A;  3ZDB A;  1T8E A;  4DWI A;  4I2F A;  2BE3 A;  2Q66 A;  2VAN A;  1X9S A;  5BPC A;  9ICU A;  1U4B A;  3MGH A;  2P6U A;  2W9C B;  3H8S A;  1R8C A;  4UBC A;  5KFJ A;  4F5N A;  4DS4 A;  3RJJ A;  3OVS A;  4YQW A;  8ICC A;  1KFD A;  1QSY A;  4KLT A;  4X4P A;  2ZH1 A;  5IIL A;  5CWR A;  3OUY B;  3NYB A;  3BQ0 A;  4XRH A;  4DQQ A;  5L9X A;  3C2K A;  4DL4 A;  1WOT A;  1TK5 A;  4FHP A;  5D49 A;  2Y1I A;  4JWN A;  4DO9 A;  4KLE A;  2HHQ A;  8ICW A;  1SL1 A;  3B0Y A;  2BGW A;  4MEX A;  3M9N B;  4F4Z A;  9ICF A;  2V9W A;  3BDP A;  4J9M A;  4M6W B;  4Q8E A;  4RWO A;  4X4O A;  4F4K A;  4MEY A;  4RQ6 A;  2RDJ A;  8ICX A;  1L3U A;  3GV5 B;  4K4H A;  2ZTE A;  1L3T A;  3PX0 A;  1NK5 A;  5L1L A;  3M9M B;  3V6H A;  1ZQS A;  5KFY A;  4ELV A;  3K75 D;  3ZDD A;  3GIL A;  5DGA A;  2FLL A;  4X4T A;  4KLJ A;  4J9P A;  5III A;  4AT9 A;  2JZB B;  4RT2 A;  4EYI B;  4DLE A;  4KLM A;  4TUQ A;  4RQ2 A;  4DOB A;  5KFQ A;  2BQ3 A;  2R8G A;  1JMS A;  4NXZ A;  3KTQ A;  4BXO B;  4X4S A;  5KFN A;  3JPQ A;  4NKU A;  4FH5 A;  1CUK A;  5EWF A;  5CP2 A;  5J2I A;  4UD4 A;  5HRG A;  3HP6 A;  4JV2 A;  3H7I A;  4ZH4 A;  5DQH A;  4I28 A;  2W8K A;  5HRF A;  4P4O A;  3TAQ A;  1XS9 D;  2FPL A;  1FA0 A;  5HRB A;  4ED3 A;  1TVA A;  2ZH4 A;  2DR7 A;  2ZJ8 A;  1QTM A;  4QZB A;  1ZQW A;  4YG2 A;  2BHN A;  4J9Q A;  5IIN A;  2Y1J A;  1NJW A;  4MFF A;  1MIY A;  2HHW A;  1UT8 A;  1ZQD A;  4DFJ A;  4DSL A;  1ZQQ A;  1T3N A;  7ICQ A;  1KFS A;  1NK8 A;  4KLU A;  5J2G A;  4YR2 A;  4ED6 A;  1A77 A;  4I2J A;  3V7L A;  4DSE A;  3AU6 A;  4DSJ A;  4FBU A;  4I2A A;  4M04 A;  8ICH A;  1UEV A;  4YP3 A;  4S3N A;  4RQ5 A;  3T5J A;  4RT3 A;  1H38 A;  4NM1 A;  1TFY A;  1RYR A;  4RPZ A;  4TQS A;  2GWS A;  4I27 A;  3C1Y A;  4WC6 A;  3THV A;  2C2E A;  5F9L A;  5J2A A;  2JEF A;  2ALZ A;  3H39 A;  1S10 A;  4AT9 B;  4LT6 A;  2DPJ A;  5DDM A;  5EWG A;  3L9D A;  4MF8 A;  1KSP A;  5KFF A;  4ECR A;  4MF2 A;  5KFO A;  3GIK A;  3C5F A;  3BQ1 A;  4QZE A;  2VA2 A;  5CR0 A;  9ICK A;  1TKD A;  4NM2 A;  4BDP A;  5J2D A;  3QE9 Y;  5J2J A;  4Q8F A;  4LZD A;  8ICS A;  8ICL A;  1Z00 A;  3V7J A;  3T5L A;  4M47 A;  2HW3 A;  7ICF A;  5KG7 A;  2BCQ A;  3WFQ E;  2C2D A;  4DFM A;  8ICY A;  1MIV A;  1D9D A;  4KMU A;  3MR6 A;  1K1S A;  3OJS A;  3GIM A;  1NK0 A;  4UD5 A;  1BVS A;  4GXJ A;  2ASD A;  1ZQT A;  1XSL A;  9ICM A;  2V4Q A;  3C23 A;  2W9B A;  4M9N A;  4J9N A;  4DSK A;  1S76 D;  5J0P A;  1ARO P;  3PO4 A;  1ZQL A;  3HIY A;  1NK9 A;  4E8F A;  2A1J A;  4QWB A;  1XU4 A;  9ICQ A;  3Q8P B;  4C8L A;  4QZ8 A;  3Q8R B;  3TI0 A;  4I2B A;  2UVR A;  4C8K A;  4QWD A;  4YN4 A;  3JPT A;  3ISB A;  1T7P A;  3RAX A;  5J0S A;  3SYZ A;  4I29 A;  4FBT A;  3HX0 A;  4EBJ A;  5F2V O;  4FHX A;  4IG8 A;  3ZDC A;  4UAY A;  4F2R A;  5J0U A;  3Q8K A;  3JZ0 A;  2ZHB A;  4RZR A;  5KFL A;  2ZUD A;  5C5J A;  4PHA A;  5CHG A;  4Q43 A;  2ZUC A;  4F4W A;  5KT2 A;  3RH4 A;  2AGO A;  1L3S A;  4O5E A;  5KFT A;  9ICH A;  1NO5 A;  4UB3 A;  3RBD A;  2DR9 A;  3V6K A;  1NK4 A;  3PY8 A;  1SKR A;  5D46 A;  2XCP A;  4EEY A;  3FDS A;  3RBE A;  1QSS A;  5J0W A;  5HMM A;  1ZQN A;  5HRI A;  1R89 A;  3OGU A;  4FHV A;  2MUT B;  5KFW A;  3RTV A;  5KFG A;  4UAW A;  4DQR A;  5J0Q A;  4AT8 A;  4F50 A;  4FH3 A;  3GFK B;  2KFN A;  1X2I A;  3EPG A;  5KFR A;  4KLG A;  4KLO A;  4RPX A;  2PFN A;  3GIJ A;  1ZQK A;  2W9B B;  4DL6 A;  4RQ4 A;  1NJX A;  1QSL A;  5KFS A;  4QW9 A;  2ID1 A;  3LDA A;  2FLP A;  3C5G A;  4BWJ A;  3FYH A;  1S77 D;  4UB4 A;  5J2F A;  5KFZ A;  2VA8 A;  2ZH7 A;  4UQG A;  2XO7 A;  2I1Q A;  4F93 B;  4J9S A;  4C8M A;  1B22 A;  4GC7 A;  3MGI A;  3OV7 A;  4DQI A;  5CA7 A;  3C66 A;  4M9H A;  4WC2 A;  3PX4 A;  2PFP A;  7ICH A;  5J2E A;  7ICO A;  4PHD A;  4ECS A;  3TAN A;  9ICN A;  3TFS A;  4EBD A;  4XQ8 A;  1SL2 A;  2IMW P;  4DSI A;  1SL0 A;  4X4U A;  4I2I A;  3C18 A;  1XSN A;  1TV9 A;  1UET A;  1NKB A;  3Q8Q B;  3WFR E;  1XO1 A;  1Y88 A;  3RR8 A;  3PR4 A;  2FPK A;  4J9K A;  4F5R A;  3JYY A;  1SZP A;  5KFD A;  4NKT A;  5CB1 A;  4KLI A;  5F9N A;  1RPL A;  5J2K A;  3UPS A;  4DEZ A;  4DF4 A;  4X5V A;  1B43 A;  4BGD A;  4FS2 A;  4O3P A;  3EW9 A;  5KFB A;  1ZQJ A;  4XQ7 A;  3TAP A;  5HNK A;  4RNO A;  2HHT A;  2NRK A;  3EZ5 A;  4QZI A;  2XCA A;  4PHE A;  2BCU A;  5HRH A;  1PX5 A;  1UT5 A;  1MC8 A;  5J2C A;  1S0V A;  3NGD A;  1EXN A;  3C21 A;  4NLN A;  4EBC A;  2F1H A;  4CCH A;  2FLN A;  2BQR A;  8ICT A;  1TFR A;  1MIW A;  1MQ3 A;  3M8R A;  1NOM A;  5CJ7 A;  1JX4 A;  4QZC A;  3M8S A;  4F91 B;  4LVS A;  3H4D A;  1V4A A;  8ICO A;  2J6U A;  1BGX T;  4YMN A;  2ISP A;  2R8I A;  4JWM A;  2BCV A;  7ICP A;  2VA3 A;  1HUO A;  4FHW A;  3RH5 A;  4JV1 A;  4R8U A;  3GQC A;  2AJQ A;  1COO A;  1K1Q A;  4O5C A;  3MFI A;  3KHL A;  5J0X A;  9ICL A;  2ZTC A;  3OVA A;  4WBZ A;  1S0O A;  1D8L A;  4YFK A;  5L1K A;  3MBY A;  4ED1 A;  5HRL A;  1S0M A;  5DEC A;  3QZ8 A;  5KTQ A;  5DLG A;  2PFO A;  1HJP A;  3PW2 A;  2AU0 A;  3H8W A;  4R66 A;  2IA6 A;  4IRK A;  3QEB Z;  1ZQO A;  4YR0 A;  2HVI A;  1NJY A;  2LYH A;  4B9V A;  4IQT A;  8ICA A;  2M2W A;  2WTF A;  3KHR A;  1XSP A;  4ED7 A;  2JEJ A;  4O9M A;  3WFS C;  3V72 A;  4B9L A;  3N97 B;  7ICV A;  1KTQ A;  4YXJ A;  3GV7 B;  5KFU A;  8ICN A;  2HHP A;  4QZG A;  3JPS A;  3RR7 A;  1UA1 A;  1RYS A;  3RAQ A;  2ISO A;  3OJU A;  4QZA A;  4YR3 A;  5KT3 A;  3AUO A;  1ZQM A;  3RJH A;  3PML A;  2C28 A;  2AGQ A;  3EWA A;  4F8R A;  9ICE A;  4WBY A;  4ECV A;  2XY7 A;  2ZH9 A;  3QEA Z;  2B21 A;  2ZTD A;  1ZJN A;  4B9S A;  2BCS A;  1HUZ A;  1NKC A;  1ZQC A;  4R8U B;  2KZM A;  3SZ2 A;  3PMN A;  7ICS A;  1TK0 A;  4RNN A;  4ECW A;  4I2C A;  9ICO A;  1JQR A;  5KG5 A;  4RQ7 A;  3MR2 A;  5J0T A;  3KHG A;  3JPN A;  1LB2 B;  4KLQ A;  5HML A;  3JPP A;  3LQC B;  4WC3 A;  3G6V A;  1KDH A;  3OSP A;  1X9W A;  4NLK A;  5BOL A;  4E0D A;  1S97 A;  2R8K A;  5KG1 A;  4IQV A;  4J9R A;  4WCW A;  4F4Y A;  1UA0 A;  8ICM A;  5DLF A;  5KG6 A;  1NJZ A;  3LK9 A;  4ATB A;  4X0A A;  5J0O A;  3OVB A;  2ZHA A;  4KN7 A;  3PNC A;  4WC0 A;  1ZET A;  5HR9 A;  2DR8 A;  3MDA A;  8ICU A;  2BR0 A;  4YCX A;  3OSN A;  4O3N A;  4E80 A;  1VJ7 A;  1S0N A;  4DL7 A;  3HPO A;  4QW8 A;  1U48 A;  1JAJ A;  1V9P A;  5KFM A;  5BOM A;  3PO5 A;  2M2U A;  4QZ9 A;  4F5Q A;  1JIH A;  5EWE A;  4FS1 A;  3H8J A;  1TK8 A;  4UAZ A;  4M9J A;  3WFO A;  2KN7 A;  4WC5 A;  1UEU A;  4RUA A;  3GV8 B;  3ISD A;  5DBB A;  5J2H A;  4RQ0 A;  4RPY A;  2O5A A;  1KRP A;  3Q8S B;  1N56 A;  1R8B A;  4X4R A;  4LZG A;  8ICB A;  2I9G A;  2RDI A;  1ZQG A;  3PX6 A;  3IM1 A;  9ICX A;  3ZDA A;  2BPF A;  2HVH A;  4EZ6 A;  2ASJ A;  8ICG A;  4QZF A;  5DGB A;  3RB4 A;  4X4Q A;  1YLQ A;  4DS5 A;  3PW5 A;  3RJF A;  4DQP A;  5KFH A;  4DF8 A;  2KTQ A;  4GXI A;  4DL5 A;  2FMP A;  1Z00 B;  3AU2 A;  3PW0 A;  3K4G A;  4YVZ A;  4XUS A;  4IQW A;  8ICJ A;  3H38 A;  3WFP A;  3PR5 B;  4KLF A;  2IBK A;  1U49 A;  4ELT A;  1NZP A;  2NRW A;  3C2L A;  4MFC A;  4KIT B;  4YMM A;  2DRA A;  4P2H A;  3Q8M A;  4DL2 A;  1WCL A;  2DFL A;  4B9T A;  5HRK A;  1TAU A;  3MDC A;  3AQL A;  4ECY A;  7ICG A;  2A1J B;  4P4P A;  3BQ2 A;  1IXR A;  4I2G A;  4E7X A;  2NRZ A;  2FMS A;  2M2T A;  4J9L A;  3V7K A;  4ECT A;  4KN4 A;  3RJI A;  2ASL A;  1JN3 A;  1ZQZ A;  1ZQA A;  3M9O B;  4PPX A;  1N48 A;  4I2H A;  3E2E A;  2AQ0 A;  5HHH A;  9ICC A;  4ECU A;  4AT7 A;  1TAQ A;  5KFP A;  1ZQV A;  3UXO A;  3OUY A;  2F1J A;  5KT5 A;  2HHS A;  4Z6C A;  5DBC A;  1MSW D;  1LV5 A;  4R63 A;  5DDY A;  4RNM A;  3ETL A;  5DB7 A;  1ZQH A;  3JPR A;  2HHU A;  4AT8 B;  2IHM A;  4Z6F A;  2XY6 A;  4B9N A;  1RXW A;  3ISC A;  1NKE A;  2DRB A;  4RWN A;  4EBE A;  1BPX A;  4X4N A;  5DB8 A;  2R8J A;  4C8N A;  3SV4 A;  4KLS A;  4KLL A;  3AQM A;  4UBB A;  4B9M A;  1S9F A;  5EOZ A;  3UXN A;  5KFA A;  3BQT A;  1Q78 A;  4X0B A;  5IIO A;  1L5U A;  7ICE A;  1BPY A;  3T5K A;  2ZH5 A;  1ZQU A;  1VFG A;  1R8A A;  4RWP A;  5KFC A;  4I2E A;  2NRT A;  2DPI A;  4M9L A;  7ICK A;  1ZQX A;  4ECQ A;  2NRX A;  2BQU A;  3AQN A;  2J6S A;  4DSF A;  7ICL A;  2C2R A;  4ECZ A;  2JZB A;  7ICI A;  1RXV A;  1NK6 A;  4AT7 B;  1JXE A;  4XA5 A;  3UQ2 A;  8ICR A;  7ICR A;  1Q79 A;  5DB9 A;  4BXO A;  3JPO A;  4MFA A;  4Q44 A;  4QZH A;  1Z3E B;  4IQU A;  4PGY A;  4TQR A;  2V4R A;  3RRH A;  2FPM A;  1L3V A;  2PFQ A;  2W9M A;  4UB5 A;  4K4G A;  3SI8 A;  4R64 A;  4M9G A;  2KZZ A;  9ICW A;  5DB6 A;  7ICJ A;  3LWL A;  4FHY A;  1F5A A;  4UB2 A;  3TAR A;  2BPG A;  2ZJ5 A;  4Q45 A;  1QLN A;  7ICN A;  1D9F A;  2PI4 A;  2R8H A;  4O3R A;  2HHV A;  2KP7 A;  1SKS A;  2XGQ A;  3H3A A;  1CEZ A;  2DR5 A;  4GXK A;  5KFV A;  4IRD A;  4KTQ A;  3MAB A;  1NK7 A;  3G6X A;  2XY5 A;  4PHP A;  3SV3 A;  3HJ4 A;  5DG9 A;  3RH6 A;  2PBE A;  4DFK A;  3RRG A;  4O0I A;  9ICS A;  3V6J A;  4Z6E A;  1U9L A;  4P4M A;  4JUZ A;  4EZ9 A;  3IHQ B;  5KG0 A;  2XC9 A;  3C2M A;  2BDP A;  8ICP A;  4Z6D A;  3NTU A;  5KFE A;  4RU9 A;  7ICT A;  1ZQI A;  4QZD A;  4RQ8 A;  3QZ7 A;  4J9O A;  3T5H A;  1U47 A;  4KLD A;  5HRD A;  2KFZ A;  4NLG A;  2F1I A;  5DKW A;  5HHI A;  5KFI A;  3OHB A;  3ZDE A;  4BWM A;  4GLX A;  2AQ4 A;  5DED A;  1U45 A;  4EP7 A;  4WC7 A;  4B9U A;  3PW4 A;  2BCR A;  1BNP A;  3PV8 A;  3UXP A;  1XWL A;  3TQ1 A;  2UVW A;  1BNO A;  1XC9 A;  1X9M A;  8ICV A;  8ICI A;  4YD1 A;  4DFP A;  3TFR A;  5KT6 A;  3ZD9 A;  5D4B A;  4O5K A;  5DBA A;  5J29 A;  4F3O A;  4RUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...