4TURA

Human dna polymerase beta inserting dcmpnpp opposite the 5'g of cisplatin crosslinked gs (pt-gg2)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4turA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4turA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4turA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4turA03
5CHGA 9ICVA 4O3NA 1YLQA 3OUYB 1VFGA 4WBYA 3HWTA 4WCWA 3RAQA 5DDMA 4QZ9A 5BOLA 4DL2A 1U45A 5F9NA 2BCSA 3UXNA 1D9DA 1ZQUA 4EYIB 3V6KA 4B9SA 4WBZA 3C5FA 4YVZA 3PY8A 3AQLA 4FHPA 5HC9A 8ICWA 4RWOA 1OU5A 2AQ0A 3H4DA 3PNCA 5KT4A 1UEUA 4GXJA 8ICVA 8ICNA 1NKBA 5KT3A 4C8LA 1ZQKA 1V4AA 4Z6DA 3PO5A 4IRCA 5DB6A 4P4PA 2ZTDA 4DFPA 3PX6A 3ISDA 1KFSA 2NRVA 4J9QA 4WC1A 3GQCA 4M04A 5L9XA 3ZDEA 2NRZA 4J9LA 3H37A 1S0NA 2ZUCA 3C5GA 2UVWA 2ZH1A 3TQ1A 2XO7A 9ICAA 4MEYA 2R8KA 3LWMA 2VA2A 3C18A 2FPLA 3MGHA 2O1PA 5KFHA 3M9NB 4ED3A 4R66A 1NOMA 1SL2A 3WFRE 4ECWA 2O5AA 1XO1A 3RJHA 4YQWA 2W9MA 3ZD9A 4YMOA 4QWCA 3SI8A 1Q78A 3HP6A 3FDSA 3AQMA 4IRKA 3LK9A 5L1JA 4KLTA 4E80A 1ZQCA 3Q8SB 2ATLA 3T5JA 2MUTB 4NY8A 2HW3A 3OVBA 4DF8A 4P4MA 4J9SA 1ZETA 5KFIA 2FPKA 3RH4A 1TK0A 3E2EA 2ZHAA 1ZJNA 8ICJA 4MFCA 2KP7A 5HREA 7ICIA 5KFMA 4UB5A 8ICSA 5HRBA 4ECZA 4UB1A 2ISPA 3M8SA 1UA0A 1CEZA 3OVSA 4GC7A 1NK9A 4YR0A 5DECA 4M0AA 2HVIA 3GDXA 1MQ3A 3GIKA 4TURA 2AJQA 9ICKA 4Z6CA 2A1JA 3GV8B 1QLNA 2GWSA 2BCQA 5TZVA 2KN7A 4DSFA 4F4YA 4M2YA 1NK5A 1HUZA 2IHMA 2JEFA 1A76A 5DBAA 3TANA 5KG0A 1AROP 1ZQJA 3PX0A 1SKWA 1S0MA 4F4KA 3ORYA 4RQ5A 5L1KA 3SV3A 2Y1IA 3UQ0A 5IIIA 1TFYA 2FLNA 1NJYA 2FLPA 2PFNA 4UD4A 2KFNA 3RJKA 1ZQBA 4HYKA 4B9NA 1F5AA 1Z3EB 4QZAA 8ICUA 4PHEA 2I1QA 4GXIA 4NM1A 2ZUBA 3TFSA 3WFPA 9ICMA 3RJIA 2PXIA 9ICUA 4WC6A 4FHXA 4ED0A 2BR0A 2R8JA 3TFRA 3NYBA 2ZH2A 4AT9B 1ZQFA 4X4OA 1ZQQA 4FBUA 1ZQRA 3C66A 4RWNA 7ICGA 3NTUA 3RB4A 4NKTA 2PFOA 1R8AA 5DDYA 3G6XA 4JUZA 1IXRA 4RZRA 3G6YA 2BQUA 2M2VA 3PMLA 2JZBA 1T3NA 2ZH9A 5HNKA 2FMPA 4KITB 4RQ7A 9ICQA 4QWEA 2XGPA 2J6SA 5EWEA 3GV5B 4J9PA 4DOAA 1S77D 1NJXA 4MFFA 1QTMA 2ZJ5A 9ICPA 5KG6A 2HHQA 3M8RA 1UETA 4QZ8A 4ECSA 4UB4A 4JV1A 1K1SA 2ZTCA 3KHRA 4EYHB 3QE9Y 2BCVA 1MIWA 4DFKA 3H39A 2ZH7A 1Y88A 1UT5A 4DWIA 1Q79A 2ZH6A 3G6VA 8ICKA 1U47A 5KFGA 2ISOA 5IIJA 4YR3A 5DG7A 7ICSA 2ZUDA 4YXJA 3Q8MA 3RB3A 3ZDAA 4X0AA 7ICNA 1BNPA 4F4ZA 2PFPA 4QZBA 3JPPA 2ZTEA 3OUYA 1S10A 4B9TA 4PPXA 1BPXA 5HRHA 5DQIA 2XC9A 1ZQYA 2IA6A 4ECXA 1JXLA 5DQHA 3RR8A 2FMQA 3SYZA 2JEIA 5HRDA 4ECUA 4DL7A 4XA5A 5F9LA 2WTFA 5KFAA 4UBCA 4IR9A 4F4WA 3KHGA 7ICJA 1NK4A 4KN7A 4F5NA 1NKCA 5HRLA 9ICFA 2DR7A 7ICEA 4KLUA 1JAJA 3H8SA 4DSKA 5KFSA 3K4GA 3HT3A 3BQTA 5KFFA 4O3RA 4TUPA 2MAXA 4GC6A 4ECRA 4X4RA 5DG8A 9ICOA 5BOMA 3H40A 1C7YA 1T4GA 1ZQGA 8ICLA 2M2WA 9ICTA 4PGQA 4O9MA 4RWQA 3MR5A 4PH5A 3OV7A 5J2KA 5KTQA 3C1YA 5DB9A 5J2FA 4DL4A 3EZ5A 2BCRA 9ICBA 3MDCA 2KFZA 1NO5A 4FHVA 1ZQEA 5KFCA 4XQ7A 4I2HA 9ICIA 2JEGA 8ICMA 1XU4A 5CP2A 2Q66A 1XSLA 1EXNA 4ELTA 8ICZA 5HMLA 3PMNA 4J9MA 3AU6A 4I2CA 1Z00B 4DO9A 2V4RA 3QZ7A 3RBDA 1TVAA 5KG5A 5J0XA 4M9GA 2HHVA 4WC0A 4AT7A 3HW8A 4RQ3A 2JEJA 4M47A 4TQRA 2F1IA 2PI5A 3JPRA 5F2VO 4UBBA 5KG1A 5J2DA 5HRIA 1T7PA 5CWRA 1NK6A 2ALZA 4F4XA 2P66A 5KFYA 1CUKA 1ZQAA 4O5CA 1ZQOA 9ICWA 5J2JA 1TFRA 4ECVA 2XCPA 4DLEA 1NK7A 3RH5A 4M9JA 5KFUA 4LVSA 5DBBA 3ZDCA 4F8RA 7ICVA 5KFWA 3LQCB 4QZEA 5KFEA 4JWNA 5CJ7A 3RJGA 4DQSA 1BPYA 5J0WA 4O3SA 1COOA 2ZH3A 4QZDA 1X9SA 4O3QA 1KDHA 4KLLA 3UXOA 4FH5A 2ZHBA 4DFJA 4YMMA 1RXVA 7ICHA 2BE3A 4KLFA 3OHAA 2HHPA 4RQ8A 9ICJA 4KLQA 4FBTA 5EWGA 4X4UA 3MR2A 5KG4A 4JK1A 2ZH8A 5IINA 4J9KA 4M9LA 4ED2A 1DOQA 2BPCA 3M9OB 1ZJMA 4O5KA 2KTQA 2RFFA 4B9UA 3PO4A 3RRGA 4QZIA 5D4BA 9ICXA 1JQRA 3OJSA 5KT5A 3GILA 1U9LA 4KTQA 5KG7A 5DKWA 4KLSA 3JPOA 3H3AA 1X2IA 1QSLA 5J0RA 4WC5A 5J2BA 2DFLA 1D8LA 4QWDA 2I9GA 4YR2A 5J0UA 4KN4A 4TUQA 4RT3A 3IM1A 2LYHA 4CCHA 1NKEA 4I29A 4KLDA 4I2FA 3IHQB 4KLGA 5DG9A 3THVA 3HIYA 2HHWA 3V7KA 2ZJ8A 5HRFA 4PGYA 4RQ6A 4E8FA 4UQGA 4ECTA 1BPEA 3PR5B 2JZBB 2P6UA 3HJ1A 3LWLA 4DQRA 2BCUA 1LV5A 2M9NA 2W9BB 4YN4A 2RDIA 2XY7A 4QZHA 2A1JB 4NM2A 2ASDA 7ICOA 4R8UA 4AT9A 3GV7B 1RYRA 4YD2A 4EZ9A 4RWPA 3PW5A 2ZH4A 1KFTA 4F2RA 5DGBA 4DSEA 4X4SA 4XUSA 3RB6A 2BQ3A 4R8UB 4BXOA 3T5KA 3K75D 3WFQE 1N48A 5DLFA 4J9RA 4PHPA 4IQTA 3MDAA 7ICKA 2W9BA 1A77A 2AGQA 2W9CB 1Z00A 1L3VA 4Q8EA 9ICEA 2V4QA 2ASJA 2Y1JA 4AT7B 3RH6A 1S0OA 5JUMA 2B21A 5DB7A 8ICFA 4GLXA 2H5XA 4DOBA 3BJYA 1BPBA 1KSPA 1PX5A 4KLMA 4UAWA 1JX4A 5KFXA 5HHHA 1UT8A 1R8CA 4DSJA 3H7IA 4FH3A 1KEJA 2NRTA 5J2AA 1KTQA 4RNNA 2IHNA 4BXOB 4M9HA 1B22A 5J0TA 4PHDA 3Q8RB 1ZQHA 4JV2A 1DK3A 4LZGA 3ISBA 1NK0A 2C2RA 4RQ2A 4ATBA 4F5QA 4O5EA 3QEAZ 2FLLA 3Q8QB 4YFKA 5J2HA 8ICAA 4X4TA 4ECQA 1L5UA 4X4VA 3JPNA 4F92B 4RPZA 4IQWA 3AQNA 5IILA 3V7JA 4B9MA 1ZQIA 1MIVA 3EWAA 3MGIA 3GIMA 4KLHA 1V9PA 2DVIA 4K4IA 5KT7A 4I2AA 4UB3A 3ISCA 3RRHA 1N56A 4NLZA 2MUTA 1MC8A 4RU9A 3TAQA 3PR4A 4DL3A 2PBEA 5KFRA 4QW8A 3RTVA 3C21A 4RUCA 2J6UA 3T3FA 1ZQPA 2IBKA 5IIOA 3LDAA 3TI0A 1IM4A 3B0XA 4I2IA 4DEZA 3V6JA 1XS9D 2NRWA 2BHNA 4BGDA 4UAYA 5KFJA 1QSYA 4XRHA 4F2SA 2VANA 3HPOA 3EPGA 5CR0A 5DGAA 4FS2A 3RB0A 1XC9A 4DQPA 9ICLA 1DK2A 1ZQVA 3GFKB 4F91B 2W9AA 8ICCA 4R65A 4J9OA 4RQ1A 4M9NA 4DL5A 4S3NA 5KFBA 3MFHA 5HHIA 2XGQA 3EW9A 3OGUA 3NGDA 4DS5A 2AGPA 3RJJA 3BDPA 4I2BA 3JZ0A 4NKUA 4IQVA 4I2EA 4EBDA 1BGXT 4DLGA 4O0IA 1X9MA 9ICCA 1QSSA 3H38A 5J0OA 3C2MA 1ZQXA 5KFDA 3ZDBA 2C28A 4KLJA 3GIJA 1H38A 2ZH5A 1TKDA 3JPSA 4ECYA 4Q43A 2DRBA 4IG8A 4UAZA 3MFIA 4NXZA 4F93B 2P6RA 4I28A 3EPIA 5L1IA 3T5HA 1ZYQA 4WC4A 4C8OA 7ICQA 4KMUA 5HRGA 4QW9A 3UPSA 2M2TA 1S97A 4EEYA 4MF8A 2XY6A 1JIHA 1TK8A 1ZQDA 1WCLA 1ZQLA 9ICGA 4C8KA 1KRPA 4QZFA 4FHWA 4MEXA 4WC3A 4YP3A 4P4OA 4J9NA 3BQ1A 2BPFA 4G3IA 5HRKA 3AQKA 3PW2A 4AT8B 1NJZA 4TUSA 5IIMA 8ICBA 4BWMA 4EBCA 4FS1A 4F50A 5DB8A 4Q44A 1L3UA 9ICSA 4LT6A 1NZPA 4AT8A 5KG3A 4ELVA 4B9VA 7ICPA 3B0YA 1ZQNA 4M6WA 5KFQA 1DGSA 3H4BA 2V9WA 3OSNA 3UXPA 4IRDA 4YG2A 3V6HA 1RYSA 2IMWP 5J0QA 1TV9A 2UVRA 1UEVA 2BPGA 1JXEA 1SL1A 1TK5A 3BQ0A 1NK8A 4M6WB 1S9FA 8ICPA 2DR5A 1D9FA 1SKRA 8ICHA 4NLNA 4UD5A 3WFOA 2DR8A 3UPQA 4EBKA 4F5PA 4I2DA 3C2KA 2R8IA 1NJWA 3HX0A 1SZPA 5KT2A 5D49A 5KFVA 3MBYA 5KFZA 8ICTA 1XSPA 2VA3A 2BGWA 4DS4A 4C8NA 5CA7A 5DBCA 4R63A 2AQ4A 2OWOA 4DSLA 8ICYA 4E0DA 2HHXA 1XSNA 1MIYA 5J2GA 4FO6A 4Z6EA 1X9WA 7ICFA 1RZTA 7ICLA 5J29A 1UA1A 4R64A 4IQUA 3ZD8A 1ZQSA 3JPTA 4RNMA 8ICQA 5L1LA 4ED6A 2W9CA 1FA0A 2NRXA 4M5DA 3L9DA 2W8KA 1XWLA 4RQ0A 3T5LA 3V7LA 3C1ZA 9ICHA 2DPIA 4I2JA 1MSWD 2RDJA 3H8JA 4KLIA 4Q8FA 9ICNA 4DFMA 5HR9A 4X4NA 3N4MB 2W8LA 4O3PA 3C23A 5C5JA 1BNOA 3OVAA 1LB2B 1BPZA 4RPYA 3PW4A 5J0YA 3HJ4A 2KZZA 4YMNA 8ICGA 1RXWA 1KNYA 4NLGA 3KHLA 4IR1A 3V72A 1L3SA 4WC2A 4QZGA 2J6TA 7ICMA 1MQ2A 2UVVA 3RJFA 5CB1A 3PW0A 4RQ4A 3KTQA 2ID1A 3RAXA 1L3TA 4EBJA 2R8HA 2HHSA 3SZ2A 1S0VA 1VJ7A 5DQGA 4LZDA 4ELUA 4MF2A 3M9MB 8ICIA 1PZNA 5KFOA 3ZDDA 1ZQTA 4KLOA 1SKSA 2FPMA 3N97B 2HHTA 4RNOA 4PGXA 3EYZA 3TARA 1U48A 3BQ2A 4Q45A 5KFNA 2ASLA 2R8GA 5KT6A 1KFDA 1BVSA 5KFKA 2BDPA 3QEBZ 4B9LA 1T8EA 4EBEA 4I27A 2XY5A 1TAUA 1TAQA 3MABA 4NLKA 8ICEA 4GXKA 4QZCA 2BKEA 4ZH4A 2UVUA 2HHUA 4ATBB 4MFAA 5KFLA 1B43A 4X0BA 3SV4A 1BPDA 4BWJA 3H8WA 3OJUA 7ICTA 1R89A 2DR9A 2XCAA 1JN3A 1S76D 2FMSA 4I2GA 1JMSA 4ED1A 4FHYA 5BPCA 4P2HA 2HVHA 3Q8LA 1ZQZA 3OSPA 4TQSA 4DQIA 1HJPA 4RUAA 4RT2A 3UQ2A 3QZ8A 3Q8PB 4ED8A 1ZQMA 1RPLA 4PHAA 2PFQA 4ED7A 3RR7A 2C2EA 5J0PA 5IIKA 5J2CA 4EZ6A 2M2UA 9ICRA 4QWAA 1WCNA 3WFSC 7ICUA 4X4QA 4K4GA 3GIIA 5J0SA 1WOTA 2F1HA 4DSIA 5KFPA 3TAPA 4X4PA 2DPJA 5EOZA 4F5OA 8ICOA 1U49A 2ZJAA 8ICRA 4DOCA 4QWBA 5J2EA 4DF4A 1D8YA 2PI4A 4KLEA 2DRAA 4XQ8A 5D46A 2C2DA 7ICRA 4JV0A 5KG2A 3RBEA 1SL0A 5HMMA 3PW7A 3RJEA 3MR6A 1R8BA 5DEDA 4DL6A 4Z6FA 2KZ3A 3JYYA 4F3OA 4F5RA 5HP4A 2KZMA 4JWMA 4O3OA 4RPXA 3PV8A 4YCXA 5DLGA 3OHBA 3JPQA 1U4BA 2Q0ZX 3FYHA 2AGOA 3PVXA 1KLNA 3C2LA 1TFWA 4BDPA 4UB2A 2C22A 5J2IA 3PX4A 2NRKA 2F1JA 4EP7A 3Q8KA 4YXMA 1ZQWA 3KHHA 4YD1A 3AU2A 4K4HA 2BQRA 2AU0A 4WC7A 4C8MA 1HUOA 3ETLA 5KFTA 5EWFA 1K1QA 3MR3A 4DQQA 4E7XA 2VA8A 3AUOA 8ICXA 4X5VA
chains in the Genus database with same CATH superfamily
5ALKA 5ALHA 1ZD2P 3CK6A 4QZ9A 5BOLA 3WK9A 2EZZA 2DUYA 3PY8A 5B5EU 8ICWA 3OTQA 3PNCA 5KT4A 1UEUA 4Z6DA 1UPHA 5DB6A 1KFSA 4M04A 3M6ZA 5L9XA 2DL0A 4C80A 1O08A 9ICAA 4MEYA 2FPLA 5KFHA 4P0QA 4EELA 3RJHA 4YQWA 3ZD9A 2ZHBA 4QJFB 5ALQA 2ATLA 3T5JA 2MUTB 3KKAA 3F5EA 5JTIA 1TK0A 2EAMA 5AKKA 1WWUA 7ICIA 4UB5A 1UA0A 4ZOHC 1N61A 2YX8A 1MQ3A 4TURA 2AHOB 2EAPA 2VJ5A 4Z6CA 1YZ6A 3GV8B 4PL2A 5AI9A 4F72A 4UB8U 5ALXA 1NK5A 2HOFA 2BDUA 1SKWA 4F4KA 1F44A 3SD7A 5ALEA 1NJYA 2FLPA 4UD4A 4HYKA 2JH1A 2PMZF 4QZAA 4PHEA 4CF4A 3SR6A 3WFPA 2M0NA 4O3MA 2KVSA 3TFRA 2ZH2A 4NXTA 4AT9B 4X4OA 4FBUA 5AIBA 1R8AA 4I0UA 5AKYA 1FO4A 1SXEA 3PMLA 2ZH9A 5EE0A 2XGPA 5EWEA 3IG5A 1ZQ1C 5AKIA 3T79A 4QZ8A 4ECSA 3KHRA 3QE9Y 3M6KA 1HIWA 3H39A 1Y88A 2ZH6A 3G6VA 8ICKA 2ZIWB 1U47A 4YR3A 5DG7A 2ZUDA 3L4PA 3RB3A 2W7PA 3IP4B 3JPPA 1JXLA 5DQHA 3SYZA 3SQIA 2JEIA 4JB3A 4UBCA 4IR9A 1ED1A 1Z4NA 4F4WA 1VLBA 1NK4A 5ALFA 2G09A 7ICEA 1JAJA 2QARB 2F8KA 4DSKA 3HT3A 4JLXA 4NXVA 3VCBA 3BQTA 4O3RA 2D6FC 9ICOA 5BOMA 1C7YA 1ZQGA 1T4GA 2M2WA 1B4FA 3MR5A 4PH5A 5J2KA 5J2FA 2BCRA 3SMVA 5ALVA 4ACOA 1MN8A 5CP2A 3ALRA 1T94A 1Z00B 4DO9A 3FAHA 2H3ZA 2KK0A 4AT7A 4RQ3A 4UBBA 2KMDA 5J2DA 2ALZA 2P66A 1PVPA 2LM4A 4DLEA 3L5KA 4M9JA 2H3IA 5CRXA 1N2XA 4QZEA 4O3SA 3ICXA 2ZH3A 2XIDA 1X9SA 4O3QA 1KDHA 4KLLA 2RLTA 1RQNA 4YMMA 5JRTA 2ODGA 4KM5A 3OHAA 3HRDD 1AQ6A 3CRXA 3QUTA 1RDFA 4FBTA 2YN4A 4ED2A 1X6IA 1KKXA 2F76X 4B9UA 4KTQA 1Q3UA 3H3AA 3JPOA 1QSLA 1D8LA 1YZ7A 2YB4A 4KN4A 3IM1A 3U26A 4KLGA 4I2FA 4NXUA 4USAA 2YQEA 3NKUA 4E8FA 3HJ1A 3H8MA 2JZBB 3QU4A 2W9BB 4UAUA 2XY7A 4QZHA 4HX0A 3GV7B 1RYRA 4K9BA 3RB6A 4R8UB 5ALOA 3WFQE 4PHPA 1A77A 5ALYA 1X66A 3NVOA 2VJ4A 4WQLA 4US8A 2K4EA 2ZG6A 2ASJA 2LPEA 2Y1JA 3RH6A 4AT7B 4GLXA 4OAFA 4KLMA 1R8CA 1UT8A 3BQ7A 4C7YA 2I5HA 4AT8A 3OVBA 2KSOA 4PHDA 3WK4A 2FLLA 4ECQA 4IQWA 1DRGA 2G07A 5ALJA 3CNHA 2GLEA 3V7JA 2KV2A 5AHXA 3MGIA 4K4IA 5KT7A 3ISCA 4NLZA 5FP0A 4RU9A 3TAQA 1MC8A 4OJ6A 4DL3A 3C21A 3JCFA 3B0XA 1QCKA 2NRWA 5HR7A 5AKHA 3AMZA 5KFJA 1QSYA 3OWGA 3CYMA 3EPGA 1XC9A 3RB0A 1DK2A 1LKYB 3GFKB 2W9AA 3RFAA 1SZHA 4J9OA 4M9NA 5HHIA 2ZIWA 4DS5A 2AGPA 3BDPA 5KAFU 2KNJA 3H38A 2ZH5A 1TKDA 2OCEA 1JUDA 3QUBA 4KMUA 4QW9A 3F5AA 5D61A 1URJA 1QQ7A 1ZQDA 4MF8A 2IOFK 1RQLA 1KRPA 4FHWA 5HRKA 3BQ1A 4AT8B 8ICBA 4TUSA 3C28A 4FFDA 4K97A 4LT6A 9ICSA 5KG3A 1JRPA 4ELVA 2ES6A 3B0YA 3IRUA 1ZQNA 4A8EA 2V9WA 3H4BA 4IRDA 1FFUA 2UVRA 1SL1A 1TK5A 1CRXA 4M6WB 1D9FA 1Q8KA 2R8IA 1SZPA 2NYVA 5KT2A 3M1YA 3PHZA 2BGWA 1Z1VA 2AQ4A 3UM9A 5J2GA 4FO6A 4R64A 4KMOB 2NRXA 3WKEA 2W8KA 1XWLA 1PVRA 4RQ0A 3NVVA 3T5LA 3SEIA 4CE6A 3N7SC 3N4MB 4FE3A 3HJ4A 2KZZA 1KNYA 4IR1A 4WC2A 1ZRNA 2F44A 2ID1A 3AEVA 2W03A 1S0VA 1N5WA 5DQGA 4O69A 1X6JA 4CNQA 2XICA 2K4PA 3N97B 2HHTA 4RNOA 2H3VA 3PSTA 5J8YA 5AI4A 5KFNA 1D8BA 4I27A 1TAUA 4EBEA 5KL1B 2XY5A 3MABA 2BKEA 4ZH4A 5EE9A 5KFLA 1B43A 3OJUA 2D8CA 1R89A 1JN3A 1JMSA 4NL9C 5BPCA 4OJPA 4P2HA 2YTUA 1ZQMA 1ZRMA 3RR7A 1OUQA 3HKZC 2C2EA 5J0PA 5J2CA 9ICRA 4IS7A 4DSIA 4X4PA 2DPJA 2OEHA 8ICRA 2ZIXA 4QWBA 4DOCA 4DF4A 2PI4A 2HBLA 5D46A 2C2DA 4JV0A 3RJEA 1SL0A 4Z6FA 2KZ3A 5HP4A 2JGAA 5CHEA 3PVXA 3C2LA 2WF5A 4RQMA 4YXMA 1ZQWA 3AU2A 4WC7A 4C8MA 2KKPA 4E7XA 4F2RA 3TADC 5CHGA 9ICVA 2Z7JA 4O3NA 1VFGA 2FCLA 1QH9A 2NV3A 4NXWA 4P0PB 2H3FA 2BCSA 3K7DA 1ZQUA 3C5FA 3AQLA 4FHPA 5AKLA 2ZIVA 1PUZA 5EE3A 1JALA 4JLZA 3H4DA 5TISU 8ICVA 8ICNA 5KT3A 1V4AA 3PO5A 3PX6A 4NLCA 3ISDA 2E3TA 3GQCA 5AI0A 2FI1A 3A0BU 2UVWA 2ZH1A 2F77X 2XO7A 4EEDA 3MGHA 3M9NB 4ECWA 3KZIU 4QWCA 2W9MA 4YMOA 3HP6A 3FDSA 3AQMA 5J8YC 1NZBA 5L1JA 4IRKA 3Q8SB 4DF8A 4J9SA 5KFIA 1J2MA 2WF9A 2FPKA 3E2EA 3KKAC 1ZJNA 4MFCA 5HREA 5HRBA 8ICSA 4ECZA 2ISPA 2O6KA 4GC7A 4YR0A 2ESEA 1NK9A 3N28A 4Y2TA 3GIKA 5ALMA 2WF7A 4Y2YA 2AJQA 4XJEA 2A1JA 1QLNA 1N60A 2BCQA 5TZVA 2GWSA 2KN7A 4F4YA 2IHMA 2JEFA 4MHVA 5KG0A 1AROP 1S0MA 3ORYA 2Y1IA 1TFYA 3BZCA 2DWQA 2PFNA 2KFNA 1ZQBA 3M7DA 3D2QA 2W54A 4WC6A 5AI5A 3NYBA 3C66A 1ZQRA 3K1RB 7ICGA 3RB4A 4NKTA 2PFOA 5DDYA 3G6XA 5HNKA 2FMPA 4KITB 2J6SA 3MGVA 3GV5B 4J9PA 4DOAA 1S77D 2YMQA 1NJXA 2WF6A 2B0CA 2HHQA 4CGZA 4UB4A 1UT5A 4FO1A 4UB6U 2KIWA 5G5GA 5CFSA 3Q8MA 4C4SA 2PFPA 4UARA 4FZMA 1S10A 1BPXA 5HRHA 2MRLA 4K98A 2QB0B 2HBJA 4DL7A 5F9LA 1NKCA 3J81j 9ICFA 2HSZA 2DR7A 4KLUA 3K4GA 5KFFA 3H40A 9ICTA 5AICA 4RWQA 2MSNA 3C1YA 4DL4A 4XQ7A 9ICIA 2Q4TA 1GPJA 2Q66A 1EXNA 8ICZA 3PMNA 2V4RA 3QZ7A 2HHVA 3D2NA 2F1IA 2KE7A 3E0FA 3BS7A 4F4XA 4PZNA 1LVHA 1ZQOA 5J2JA 4ECVA 5KFUA 5KFEA 4JWNA 4BJQA 3I1YA 1COOA 5AK6A 2LM1A 4GIBA 4DFJA 3QUQA 1RXVA 1ZXIA 1TE2A 4KLFA 4X4UA 5KG4A 3SAGA 2ZH8A 1J97A 4QIWC 2BPCA 1ZJMA 4OJ5A 4O5KA 2KTQA 3RRGA 2KJ9A 4QZIA 2W3SA 5KT5A 3GILA 1U9LA 5KG7A 1X2IA 4WC5A 5J0RA 5J2BA 2UVVA 4TUQA 1TAMA 4CCHA 5AM4A 4KLDA 1N63A 3V7KA 2JXJA 1J2NA 3D2SA 2P6UA 3LWLA 2BCUA 3B9JA 1LV5A 3HILA 2ASDA 2A1JB 7ICOA 1F5SA 4R8UA 4EZ9A 4RWPA 1KFTA 5K4LA 4XUSA 1V97A 2L5YA 2KEYA 3BS5B 4J9RA 4IQTA 3MDAA 5B66U 2W9BA 2W9CB 1Z00A 4Q8EA 9ICEA 3UMBA 5DB7A 4AP9A 3MCRA 2H5XA 4DOBA 3F53A 1KSPA 2JMGA 1PX5A 4UAWA 4BUGA 5ALTA 1RM6C 3Q8RB 1ZQHA 4RQ2A 1SB3C 3Q8QB 1N5XA 4YFKA 1L5UA 4F92B 1SXDA 5IILA 4LEVA 1WWVA 3GIMA 3FC4A 1L6NA 1V85A 1WUDA 4I2AA 4UB3A 1PK3A 2K4HA 4QW8A 4RUCA 1PK1B 2VIXA 1IM4A 1CI4A 2BHNA 4BGDA 3HPOA 2BBJA 5L1MA 4FS2A 4F91B 1XNSA 3MFHA 2KOBA 2XGQA 3EW9A 3QU9A 3OGUA 4I2BA 4NKUA 4IQVA 2HOQA 2RQ5A 2RRDA 4O0IA 1QSSA 3NS1A 1ZQXA 2C28A 3D6JA 3JPSA 4Q43A 2DRBA 4IG8A 2WB1C 3MFIA 2A1AA 2W43A 3EPIA 3T5HA 4WC4A 3UPSA 1S97A 4EEYA 1TK8A 3WK6A 1WCLA 3N7PD 1ZQLA 4C8KA 4MEXA 4YP3A 2AH5A 4G3IA 4LEWA 4CF5A 1IG6A 4BWMA 5F2VO 4F50A 7ICPA 3WKDA 1DGSA 1O03A 3OSNA 1TV9A 1FEZA 1KN5A 3BQ0A 1NK8A 2EZXA 3WFOA 2GAFD 3UPQA 3NVWA 3F2BA 1L8LA 2IOHA 1RZTA 1S8OA 4CDGA 7ICLA 5ALGA 3AQEA 3ZD8A 8ICQA 2W9CA 1FA0A 4UW9A 1ECWA 5AKZA 3V7LA 2DPIA 4EGWA 3H8JA 2EWRA 4O3PA 3C23A 5C5JA 3OVAA 4RPYA 3PW4A 1A0PA 2Y9UA 1RXWA 5D62A 5ALWA 1MQ2A 2E8NA 3RJFA 1IV8A 1L7MA 2G5IB 3F2DA 2E1FA 4ELUA 4MF2A 3M9MB 3NASA 2G08A 5GTHU 3ZDDA 4KLOA 1SKSA 2ZXHA 2ASLA 4Q45A 5KT6A 3QU2A 3QEBZ 1C20A 3I28A 4X0BA 2DR9A 3H8WA 4OCZA 2XCAA 2FMSA 4N7RA 2HVHA 4DQIA 4TQSA 1HJPA 3UQ2A 8ICXA 3QZ8A 3Q8PB 2JHDA 8ICEA 4WBYA 4WH5A 3WK7A 2M2UA 2F8LA 5CFUA 5ALLA 2OYYA 4Y2RA 1WCNA 3WFSC 4K4GA 3ERCC 1DXSA 1WOTA 2F1HA 5EOZA 4F5OA 4Y2SA 1U49A 2DRAA 5J2EA 1KW4A 4DL6A 4F5RA 2KZMA 5ALUA 4RPXA 3JPQA 2AGOA 1TFWA 3EF2A 4PL1A 2C22A 5J2IA 5HR6A 4EP7A 3Q8KA 4YD1A 2AU0A 3KZXA 3ETLA 2W04A 5KFTA 5EWFA 2KHVA 3KBBA 4DQQA 1LKYA 3AUOA 3ER9B 4X5VA 1SWVA 1UQVA 1YLQA 3OUYB 3QYPA 4WCWA 5DDMA 1D9DA 1U45A 5F9NA 3UXNA 4WBZA 4AYBC 4YVZA 2JV3A 1NKBA 4C8LA 1ZQKA 3K1ZA 2ZTDA 4DFPA 4O6AA 5A0LA 3SAHA 2ZUCA 2R8KA 3C18A 2VA2A 2O1PA 4P0PA 4ED3A 1RYUA 3WFRE 1NOMA 2KVCA 2O5AA 1XO1A 3SI8A 1M6YA 4E80A 4KLTA 1ZQCA 1ZETA 4P4MA 5AKGA 3TKAA 3RH4A 1COKA 1T3QA 2GOLA 2JR5A 4WJ3B 5CEHA 4M0AA 2HVIA 2HMXA 4U7CA 2LYBA 4DSFA 2XVTA 2PMZC 4M2YA 2K8CB 1HUZA 2NO5A 1UHUA 2LBOA 1A76A 3TANA 3PX0A 4OAHA 5L1KA 3UQ0A 3QX7A 2FLNA 4Y2PA 3RJKA 4B9NA 1F5AA 1Z3EB 3NVYA 4NM1A 2QB0A 2PXIA 4FHXA 1UCVA 2B51A 1B0XA 3NTUA 4JUZA 2BQUA 3WKCA 3G6YA 2FDRA 2ZXIA 2M2VA 2BZFA 4MFFA 5KG6A 4KB6A 2CN1A 4OJOA 3M8RA 1UETA 4JV1A 1MIWA 2ZTCA 4EYHB 4K9AA 3WKAA 2ZH7A 1Q79A 3NVZA 2EANA 2ISOA 5IIJA 4Y2XA 7ICSA 2H3QA 2JH7A 4YXJA 3F2CA 5AM5A 1BNPA 4F4ZA 4QZBA 2ZTEA 1ZD5A 4B9TA 5DQIA 1ZQYA 4ECXA 2FMQA 5HRDA 1GO3F 4ECUA 2WTFA 7ICJA 4KN7A 3IV6A 2WAQF 2YMLA 4TUPA 2MAXA 2OHFA 4GC6A 8ICLA 4O9MA 2F3NA 2LKYA 5KTQA 4KX3A 3EZ5A 9ICBA 2KFZA 2WAQC 1ZQEA 3CW2C 5AKEA 2QARA 3QU7A 1XU4A 1XSLA 5HMLA 1Z19A 2YMMA 4LJXA 4NV0A 3RBDA 4M9GA 1TVAA 5KG5A 3HW8A 2YY6A 5AM3A 4M47A 4TQRA 2PI5A 5HRIA 2W55A 5KFYA 1CUKA 4O5CA 9ICWA 1TFRA 3RH5A 3ZDCA 4F8RA 4EEBA 5KFWA 2E5SA 4DQSA 5J0WA 4QZDA 2PKEA 1PVQA 4RQ8A 5F3XB 2MU2A 5JTGA 4KLQA 3MR2A 4JK1A 1DOQA 3M9OB 3PO4A 5D4BA 4UATA 1JQRA 3OJSA 1L7PA 5DKWA 2DR5A 2I9GA 4LEZA 2KHQA 4I29A 5J0UA 3IHQB 3HIYA 5DG9A 2A19A 2HHWA 5HRFA 4PGYA 4RQ6A 4UQGA 4ECTA 5ALPA 4DQRA 2ZIUB 2E8MA 1ZD3A 2QLTA 2RDIA 1VDVA 4NM2A 3WKBA 1V38A 2AXTU 3WK8A 3PW5A 5E79U 4DSEA 3AL0B 2OXOA 3ER8C 5DLFA 7ICKA 2AGQA 1P7DA 2CRXA 5AI6A 1L3VA 1S0OA 2B21A 8ICFA 4UAVA 3BJYA 4B6JA 5KFXA 4KX5A 3H7IA 4FH3A 2NRTA 2IHNA 4M9HA 4MKPA 2LHTA 4OD0A 3QUCA 4JV2A 3ISBA 4F5QA 2QKQA 3O0FA 8ICAA 4X4TA 4X4VA 1Z4OA 3JPNA 3AQNA 3DEEA 2P35A 2YB1A 3GZFA 1MIVA 1V9PA 3OPXA 3RRHA 1N56A 4BX9C 4ICAA 1SIJA 3T3FA 3LDAA 2HN1A 3TI0A 3V6JA 4DEZA 4C4RA 2VANA 2HBMA 5DGAA 2QB1A 4DQPA 4P0QB 9ICLA 3IDWA 1ZQVA 4R65A 4S3NA 4RQ1A 5KFBA 3RJJA 4OO1J 2KD1A 4I2EA 1BGXT 1L7OA 3PSFA 2ZIVB 2FE9A 4ECYA 5AK3A 4UAZA 4NXZA 4F93B 2P6RA 4I28A 4C8OA 2M2TA 2E8PA 4JMUA 1JIHA 3AQKA 3PW2A 4GFJA 3BZKA 4FS1A 5DB8A 2GH1A 4B9VA 2IUBA 4M6WA 5KFQA 3V6HA 1UEVA 5J0QA 2BPGA 5B3PA 3NRWA 1S9FA 8ICPA 1SV4A 4NLNA 4UD5A 2DR8A 3RF9A 4I2DA 3C2KA 3HX0A 4DCCA 1Q46A 5KFZA 3MBYA 1XSPA 2VA3A 2KJ5A 4DS4A 4C8NA 5CA7A 8ICYA 4DSLA 1XSNA 3QNMA 3GU3A 5J29A 4RNMA 5L1LA 4Y2UA 3C1ZA 9ICNA 4KLIA 4CRXA 4Q8FA 4DFMA 2W8LA 2B4VA 2DKZA 4QNLA 2KKVA 1BPZA 2VKQA 5AK5A 4NLGA 3KHLA 1L3SA 4QZGA 2J6TA 2R18A 1MA7A 2HN2A 3KTQA 3RAXA 4PZOA 1L3TA 2K60A 4EBJA 2R8HA 8ICIA 1PZNA 5KFOA 4Y2QA 1ZQTA 2FPMA 3TARA 1WG8A 2HI0A 1U48A 3BQ2A 1SWWA 2R8GA 5KFKA 1T8EA 4UASA 2BBHA 2HBKA 2HHUA 4QZCA 4MFAA 3SV4A 4BWJA 1S76D 3CP8A 1S5LU 5B3QA 4FHYA 3ETRA 4C4TA 1ZQZA 4RUAA 3SAFA 4RT2A 2K8AA 2PFQA 4ED8A 4ED7A 4EZ6A 5IIKA 3HJEA 4QWAA 2KG5A 3AM9A 2Y0SC 3TAPA 8ICOA 2DF4B 2ZJAA 2EDUA 3L3FX 4EX7A 7ICRA 3C29A 3RBEA 4IC9A 5HMMA 3PW7A 5DEDA 4F3OA 3PV8A 3FYHA 5EE1A 5T14A 4BDPA 3PX4A 2F1JA 3KHHA 4K4HA 2XI9A 3FM9A 4WOYA 2HOIA 1ZD4A 3HWTA 1N62A 3RAQA 4DL2A 4F71A 2GO7A 4EYIB 3V6KA 5ALSA 4B9SA 2B56A 4OAIZ 2Y9TA 5HC9A 4RWOA 1OU5A 2AQ0A 3PSPA 2KICA 5CFTA 4GXJA 1KQQA 4IRCA 4P4PA 2WF8A 4PJ0U 4IL6U 2EZYA 2NRVA 2DBYA 4J9QA 4WC1A 4OAGA 3ZDEA 1SGGA 1FIQA 2NRZA 4J9LA 1S0NA 3H37A 3LVVA 3C5GA 1A6SA 3TQ1A 5AM0A 3LVWA 2DKXA 3LWMA 4R66A 4NLBA 1SL2A 1Q78A 3LK9A 4LEYA 4NY8A 2HW3A 2ZHAA 8ICJA 2YMPA 5KFMA 1CEZA 4UB1A 3M8SA 3OVSA 5DECA 2RHFA 3GDXA 2ZIXB 5JU5A 9ICKA 1NI3A 3PSIA 5GTIU 3QXGA 2B6GA 2I6XA 5DBAA 1ZQJA 4RQ5A 2CXYA 3SV3A 5IIIA 4DFDA 2E8OA 8ICUA 2I1QA 4GXIA 4NJ8A 2ZUBA 3TFSA 3PZPA 1NNLA 9ICMA 3RJIA 4K96A 9ICUA 4ED0A 5AK4A 2BR0A 2R8JA 5KNIA 1ZQFA 1ZQQA 4RWNA 2LI6A 1IXRA 4EENA 4C7ZA 4RZRA 4FZNA 3LYSA 3WK5A 2OH2A 2JZBA 1T3NA 1VJ5A 4RQ7A 9ICQA 4QWEA 5AM1A 1SV0A 4EEKA 2ZJ5A 1IIPA 1QTMA 9ICPA 4U6PA 1HEKA 2KIVA 1K1SA 2BCVA 4DFKA 4DWIA 5KFGA 3ZDAA 4X0AA 7ICNA 1WYGA 3MC1A 3OUYA 4PPXA 4G9BA 2DGZA 2XC9A 3KOOA 2IA6A 3RR8A 1PK1A 3AQFA 4K99A 4XA5A 5KFAA 3KHGA 4F5NA 5HRLA 2F2AB 1F0MA 4US9A 3H8SA 5KFSA 2D3DA 4ECRA 4EX6A 5DG8A 4PGQA 3OV7A 4Y2JA 5DB9A 4FHVA 1NO5A 3MDCA 4NWIA 3N7RC 5KFCA 4I2HA 2E1EA 2JEGA 8ICMA 4ELTA 3H0MB 2IOFA 5KAIU 4J9MA 3AU6A 4I2CA 4K8VA 4WC0A 5J0XA 1OXJA 2JEJA 3JPRA 5KG1A 1T7PA 5CWRA 1NK6A 1FFVA 1ZQAA 3BS5A 2XCPA 1NK7A 2G0AA 4LVSA 4HAIA 5DBBA 7ICVA 3LQCB 5CJ7A 3RJGA 1BPYA 4CF3A 3UXOA 4FH5A 7ICHA 2BE3A 3DV9A 3KFUF 2HHPA 9ICJA 2KJ8A 2A3VA 5EWGA 2G5HB 5IINA 4J9KA 4M9LA 2RFFA 5ALRA 3ZI4A 2MA1A 9ICXA 4KLSA 1KBUA 4QWDA 2DFLA 3SENA 4YR2A 4RT3A 2LYHA 1NKEA 4QIWF 3THVA 1X40A 2ZJ8A 3WU2U 1RG6A 3TACB 1BPEA 3PR5B 2G06A 1K5OA 2M9NA 4YN4A 3NUQA 4AT9A 2ZH4A 3QU5A 4YD2A 5DGBA 2WHEA 2RP5A 4X4SA 2BQ3A 1ZOLA 3T5KA 3K75D 4BXOA 2CPRA 1N48A 2ZIUA 5D63A 2V4QA 5ALNA 5JUMA 3IN5A 2FJ6A 1BPBA 1JX4A 4O68A 5HHHA 4DSJA 4C0ZA 1KEJA 2LMRA 4RQNA 5J2AA 1KTQA 1L7NA 4RNNA 4BXOB 1B22A 5J0TA 1DK3A 4LZGA 1NK0A 2C2RA 4ATBA 4OJLA 4O5EA 3QEAZ 1X42A 3IG8A 2K89A 5J2HA 4RPZA 3S6JA 5AKJA 3R9KA 4B9MA 1ZQIA 3EWAA 4KLHA 2DVIA 2PBEA 2MUTA 5ALZA 3PR4A 2LYAA 5KFRA 3RTVA 2J6UA 1ZQPA 2IBKA 5IIOA 3TADA 4I2IA 1XS9D 4UAYA 5G5HA 4F2SA 4XRHA 5CR0A 1Z1BA 8ICCA 4DL5A 1KL9A 2WFAA 5AM2A 2GA9D 3NGDA 3JZ0A 2W7OA 2EH9A 4EBDA 4DLGA 1X9MA 9ICCA 5J0OA 3C2MA 5KFDA 3ZDBA 4KLJA 2W3RA 4FZLA 2NO4A 3GIJA 3EUB2 1H38A 3E58A 2W11A 3NRZA 5H2FU 5L1IA 1ZYQA 7ICQA 4J03A 2DQNB 5HRGA 2XY6A 4WQKA 1QQ5A 9ICGA 4QZFA 4WC3A 4P4OA 4J9NA 2WB1F 2BPFA 1NJZA 5IIMA 1XO0A 4EBCA 1L3UA 4Q44A 1Q3VA 1NZPA 2KP7A 2HCFA 3UXPA 1L8OA 4YG2A 1RYSA 2IMWP 3AN1A 1JXEA 3DDHA 1DGJA 2OM6A 1SKRA 8ICHA 4EBKA 4F5PA 3KD3A 3H0RB 1NJWA 5D49A 5KFVA 3A0HU 8ICTA 5KL8B 4R63A 5DBCA 2OWOA 2K4IA 4X4RA 1OW5A 4E0DA 2HHXA 1MIYA 1X9WA 7ICFA 4Z6EA 3VC8A 3H0LB 1JROA 1X9XA 1UA1A 4IQUA 1YT3A 1ZQSA 3JPTA 4ED6A 4M5DA 5AIAA 3L9DA 3HKZF 2JRZA 2K8BB 1QQ6A 9ICHA 4I2JA 1MSWD 2RDJA 2Y0SF 5HR9A 4X4NA 1BNOA 3ONNA 1LB2B 3UMGA 5J0YA 4EV6A 4YMNA 8ICGA 3V72A 7ICMA 5CB1A 3PW0A 4RQ4A 2EQYA 2HHSA 3SZ2A 5AI8A 3NWIA 1VJ7A 2EAOA 4LZDA 4NXXA 4PGXA 3EYZA 1KFDA 1BVSA 2BDPA 2KSOB 4B9LA 4O67A 1TAQA 4NLKA 4ATBB 4GXKA 3ED5A 4X4QA 2UVUA 1BPDA 7ICTA 5AKXA 4I2GA 4ED1A 5ALIA 3Q8LA 3OSPA 1RPLA 4PHAA 2IHOA 7ICUA 3GIIA 5J0SA 4Y2VA 5KFPA 4NL9A 3I76A 4KLEA 1D8YA 4XQ8A 3UMCA 5KG2A 3MR6A 1R8BA 3JYYA 1JI7A 4JWMA 4O3OA 4YCXA 5DLGA 3OHBA 1U4BA 2Q0ZX 1SV0C 2N1RA 1KLNA 4UB2A 2NRKA 2BQRA 1HUOA 2HDOA 1K1QA 3MR3A 4AYBF 5ALDA 2VA8A 5C0YA
chains in the Genus database with same CATH topology
5CHGA 9ICVA 4O3NA 1YLQA 3OUYB 1VFGA 4WBYA 3HWTA 4WCWA 3RAQA 5DDMA 4QZ9A 5BOLA 4DL2A 1U45A 5F9NA 2BCSA 3UXNA 1D9DA 1ZQUA 4EYIB 3V6KA 4B9SA 4WBZA 3C5FA 4YVZA 3PY8A 3AQLA 4FHPA 5HC9A 8ICWA 4RWOA 1OU5A 2AQ0A 3H4DA 3PNCA 5KT4A 1UEUA 4GXJA 8ICVA 8ICNA 1NKBA 5KT3A 4C8LA 1ZQKA 1V4AA 4Z6DA 3PO5A 4IRCA 5DB6A 4P4PA 2ZTDA 4DFPA 3PX6A 3ISDA 1KFSA 2NRVA 4J9QA 4WC1A 3GQCA 4M04A 5L9XA 3ZDEA 2NRZA 4J9LA 3H37A 1S0NA 2ZUCA 3C5GA 2UVWA 2ZH1A 3TQ1A 2XO7A 9ICAA 4MEYA 2R8KA 3LWMA 2VA2A 3C18A 2FPLA 3MGHA 2O1PA 5KFHA 3M9NB 4ED3A 4R66A 1NOMA 1SL2A 3WFRE 4ECWA 2O5AA 1XO1A 3RJHA 4YQWA 2W9MA 3ZD9A 4YMOA 4QWCA 3SI8A 1Q78A 3HP6A 3FDSA 3AQMA 4IRKA 3LK9A 5L1JA 4KLTA 4E80A 1ZQCA 3Q8SB 2ATLA 3T5JA 2MUTB 4NY8A 2HW3A 3OVBA 4DF8A 4P4MA 4J9SA 1ZETA 5KFIA 2FPKA 3RH4A 1TK0A 3E2EA 2ZHAA 1ZJNA 8ICJA 4MFCA 2KP7A 5HREA 7ICIA 5KFMA 4UB5A 8ICSA 5HRBA 4ECZA 4UB1A 2ISPA 3M8SA 1UA0A 1CEZA 3OVSA 4GC7A 1NK9A 4YR0A 5DECA 4M0AA 2HVIA 3GDXA 1MQ3A 3GIKA 4TURA 2AJQA 9ICKA 4Z6CA 2A1JA 3GV8B 1QLNA 2GWSA 2BCQA 5TZVA 2KN7A 4DSFA 4F4YA 4M2YA 1NK5A 1HUZA 2IHMA 2JEFA 1A76A 5DBAA 3TANA 5KG0A 1AROP 1ZQJA 3PX0A 1SKWA 1S0MA 4F4KA 3ORYA 4RQ5A 5L1KA 3SV3A 2Y1IA 3UQ0A 5IIIA 1TFYA 2FLNA 1NJYA 2FLPA 2PFNA 4UD4A 2KFNA 3RJKA 1ZQBA 4HYKA 4B9NA 1F5AA 1Z3EB 4QZAA 8ICUA 4PHEA 2I1QA 4GXIA 4NM1A 2ZUBA 3TFSA 3WFPA 9ICMA 3RJIA 2PXIA 9ICUA 4WC6A 4FHXA 4ED0A 2BR0A 2R8JA 3TFRA 3NYBA 2ZH2A 4AT9B 1ZQFA 4X4OA 1ZQQA 4FBUA 1ZQRA 3C66A 4RWNA 7ICGA 3NTUA 3RB4A 4NKTA 2PFOA 1R8AA 5DDYA 3G6XA 4JUZA 1IXRA 4RZRA 3G6YA 2BQUA 2M2VA 3PMLA 2JZBA 1T3NA 2ZH9A 5HNKA 2FMPA 4KITB 4RQ7A 9ICQA 4QWEA 2XGPA 2J6SA 5EWEA 3GV5B 4J9PA 4DOAA 1S77D 1NJXA 4MFFA 1QTMA 2ZJ5A 9ICPA 5KG6A 2HHQA 3M8RA 1UETA 4QZ8A 4ECSA 4UB4A 4JV1A 1K1SA 2ZTCA 3KHRA 4EYHB 3QE9Y 2BCVA 1MIWA 4DFKA 3H39A 2ZH7A 1Y88A 1UT5A 4DWIA 1Q79A 2ZH6A 3G6VA 8ICKA 1U47A 5KFGA 2ISOA 5IIJA 4YR3A 5DG7A 7ICSA 2ZUDA 4YXJA 3Q8MA 3RB3A 3ZDAA 4X0AA 7ICNA 1BNPA 4F4ZA 2PFPA 4QZBA 3JPPA 2ZTEA 3OUYA 1S10A 4B9TA 4PPXA 1BPXA 5HRHA 5DQIA 2XC9A 1ZQYA 2IA6A 4ECXA 1JXLA 5DQHA 3RR8A 2FMQA 3SYZA 2JEIA 5HRDA 4ECUA 4DL7A 4XA5A 5F9LA 2WTFA 5KFAA 4UBCA 4IR9A 4F4WA 3KHGA 7ICJA 1NK4A 4KN7A 4F5NA 1NKCA 5HRLA 9ICFA 2DR7A 7ICEA 4KLUA 1JAJA 3H8SA 4DSKA 5KFSA 3K4GA 3HT3A 3BQTA 5KFFA 4O3RA 4TUPA 2MAXA 4GC6A 4ECRA 4X4RA 5DG8A 9ICOA 5BOMA 3H40A 1C7YA 1T4GA 1ZQGA 8ICLA 2M2WA 9ICTA 4PGQA 4O9MA 4RWQA 3MR5A 4PH5A 3OV7A 5J2KA 5KTQA 3C1YA 5DB9A 5J2FA 4DL4A 3EZ5A 2BCRA 9ICBA 3MDCA 2KFZA 1NO5A 4FHVA 1ZQEA 5KFCA 4XQ7A 4I2HA 9ICIA 2JEGA 8ICMA 1XU4A 5CP2A 2Q66A 1XSLA 1EXNA 4ELTA 8ICZA 5HMLA 3PMNA 4J9MA 3AU6A 4I2CA 1Z00B 4DO9A 2V4RA 3QZ7A 3RBDA 1TVAA 5KG5A 5J0XA 4M9GA 2HHVA 4WC0A 4AT7A 3HW8A 4RQ3A 2JEJA 4M47A 4TQRA 2F1IA 2PI5A 3JPRA 5F2VO 4UBBA 5KG1A 5J2DA 5HRIA 1T7PA 5CWRA 1NK6A 2ALZA 4F4XA 2P66A 5KFYA 1CUKA 1ZQAA 4O5CA 1ZQOA 9ICWA 5J2JA 1TFRA 4ECVA 2XCPA 4DLEA 1NK7A 3RH5A 4M9JA 5KFUA 4LVSA 5DBBA 3ZDCA 4F8RA 7ICVA 5KFWA 3LQCB 4QZEA 5KFEA 4JWNA 5CJ7A 3RJGA 4DQSA 1BPYA 5J0WA 4O3SA 1COOA 2ZH3A 4QZDA 1X9SA 4O3QA 1KDHA 4KLLA 3UXOA 4FH5A 2ZHBA 4DFJA 4YMMA 1RXVA 7ICHA 2BE3A 4KLFA 3OHAA 2HHPA 4RQ8A 9ICJA 4KLQA 4FBTA 5EWGA 4X4UA 3MR2A 5KG4A 4JK1A 2ZH8A 5IINA 4J9KA 4M9LA 4ED2A 1DOQA 2BPCA 3M9OB 1ZJMA 4O5KA 2KTQA 2RFFA 4B9UA 3PO4A 3RRGA 4QZIA 5D4BA 9ICXA 1JQRA 3OJSA 5KT5A 3GILA 1U9LA 4KTQA 5KG7A 5DKWA 4KLSA 3JPOA 3H3AA 1X2IA 1QSLA 5J0RA 4WC5A 5J2BA 2DFLA 1D8LA 4QWDA 2I9GA 4YR2A 5J0UA 4KN4A 4TUQA 4RT3A 3IM1A 2LYHA 4CCHA 1NKEA 4I29A 4KLDA 4I2FA 3IHQB 4KLGA 5DG9A 3THVA 3HIYA 2HHWA 3V7KA 2ZJ8A 5HRFA 4PGYA 4RQ6A 4E8FA 4UQGA 4ECTA 1BPEA 3PR5B 2JZBB 2P6UA 3HJ1A 3LWLA 4DQRA 2BCUA 1LV5A 2M9NA 2W9BB 4YN4A 2RDIA 2XY7A 4QZHA 2A1JB 4NM2A 2ASDA 7ICOA 4R8UA 4AT9A 3GV7B 1RYRA 4YD2A 4EZ9A 4RWPA 3PW5A 2ZH4A 1KFTA 4F2RA 5DGBA 4DSEA 4X4SA 4XUSA 3RB6A 2BQ3A 4R8UB 4BXOA 3T5KA 3K75D 3WFQE 1N48A 5DLFA 4J9RA 4PHPA 4IQTA 3MDAA 7ICKA 2W9BA 1A77A 2AGQA 2W9CB 1Z00A 1L3VA 4Q8EA 9ICEA 2V4QA 2ASJA 2Y1JA 4AT7B 3RH6A 1S0OA 5JUMA 2B21A 5DB7A 8ICFA 4GLXA 2H5XA 4DOBA 3BJYA 1BPBA 1KSPA 1PX5A 4KLMA 4UAWA 1JX4A 5KFXA 5HHHA 1UT8A 1R8CA 4DSJA 3H7IA 4FH3A 1KEJA 2NRTA 5J2AA 1KTQA 4RNNA 2IHNA 4BXOB 4M9HA 1B22A 5J0TA 4PHDA 3Q8RB 1ZQHA 4JV2A 1DK3A 4LZGA 3ISBA 1NK0A 2C2RA 4RQ2A 4ATBA 4F5QA 4O5EA 3QEAZ 2FLLA 3Q8QB 4YFKA 5J2HA 8ICAA 4X4TA 4ECQA 1L5UA 4X4VA 3JPNA 4F92B 4RPZA 4IQWA 3AQNA 5IILA 3V7JA 4B9MA 1ZQIA 1MIVA 3EWAA 3MGIA 3GIMA 4KLHA 1V9PA 2DVIA 4K4IA 5KT7A 4I2AA 4UB3A 3ISCA 3RRHA 1N56A 4NLZA 2MUTA 1MC8A 4RU9A 3TAQA 3PR4A 4DL3A 2PBEA 5KFRA 4QW8A 3RTVA 3C21A 4RUCA 2J6UA 3T3FA 1ZQPA 2IBKA 5IIOA 3LDAA 3TI0A 1IM4A 3B0XA 4I2IA 4DEZA 3V6JA 1XS9D 2NRWA 2BHNA 4BGDA 4UAYA 5KFJA 1QSYA 4XRHA 4F2SA 2VANA 3HPOA 3EPGA 5CR0A 5DGAA 4FS2A 3RB0A 1XC9A 4DQPA 9ICLA 1DK2A 1ZQVA 3GFKB 4F91B 2W9AA 8ICCA 4R65A 4J9OA 4RQ1A 4M9NA 4DL5A 4S3NA 5KFBA 3MFHA 5HHIA 2XGQA 3EW9A 3OGUA 3NGDA 4DS5A 2AGPA 3RJJA 3BDPA 4I2BA 3JZ0A 4NKUA 4IQVA 4I2EA 4EBDA 1BGXT 4DLGA 4O0IA 1X9MA 9ICCA 1QSSA 3H38A 5J0OA 3C2MA 1ZQXA 5KFDA 3ZDBA 2C28A 4KLJA 3GIJA 1H38A 2ZH5A 1TKDA 3JPSA 4ECYA 4Q43A 2DRBA 4IG8A 4UAZA 3MFIA 4NXZA 4F93B 2P6RA 4I28A 3EPIA 5L1IA 3T5HA 1ZYQA 4WC4A 4C8OA 7ICQA 4KMUA 5HRGA 4QW9A 3UPSA 2M2TA 1S97A 4EEYA 4MF8A 2XY6A 1JIHA 1TK8A 1ZQDA 1WCLA 1ZQLA 9ICGA 4C8KA 1KRPA 4QZFA 4FHWA 4MEXA 4WC3A 4YP3A 4P4OA 4J9NA 3BQ1A 2BPFA 4G3IA 5HRKA 3AQKA 3PW2A 4AT8B 1NJZA 4TUSA 5IIMA 8ICBA 4BWMA 4EBCA 4FS1A 4F50A 5DB8A 4Q44A 1L3UA 9ICSA 4LT6A 1NZPA 4AT8A 5KG3A 4ELVA 4B9VA 7ICPA 3B0YA 1ZQNA 4M6WA 5KFQA 1DGSA 3H4BA 2V9WA 3OSNA 3UXPA 4IRDA 4YG2A 3V6HA 1RYSA 2IMWP 5J0QA 1TV9A 2UVRA 1UEVA 2BPGA 1JXEA 1SL1A 1TK5A 3BQ0A 1NK8A 4M6WB 1S9FA 8ICPA 2DR5A 1D9FA 1SKRA 8ICHA 4NLNA 4UD5A 3WFOA 2DR8A 3UPQA 4EBKA 4F5PA 4I2DA 3C2KA 2R8IA 1NJWA 3HX0A 1SZPA 5KT2A 5D49A 5KFVA 3MBYA 5KFZA 8ICTA 1XSPA 2VA3A 2BGWA 4DS4A 4C8NA 5CA7A 5DBCA 4R63A 2AQ4A 2OWOA 4DSLA 8ICYA 4E0DA 2HHXA 1XSNA 1MIYA 5J2GA 4FO6A 4Z6EA 1X9WA 7ICFA 1RZTA 7ICLA 5J29A 1UA1A 4R64A 4IQUA 3ZD8A 1ZQSA 3JPTA 4RNMA 8ICQA 5L1LA 4ED6A 2W9CA 1FA0A 2NRXA 4M5DA 3L9DA 2W8KA 1XWLA 4RQ0A 3T5LA 3V7LA 3C1ZA 9ICHA 2DPIA 4I2JA 1MSWD 2RDJA 3H8JA 4KLIA 4Q8FA 9ICNA 4DFMA 5HR9A 4X4NA 3N4MB 2W8LA 4O3PA 3C23A 5C5JA 1BNOA 3OVAA 1LB2B 1BPZA 4RPYA 3PW4A 5J0YA 3HJ4A 2KZZA 4YMNA 8ICGA 1RXWA 1KNYA 4NLGA 3KHLA 4IR1A 3V72A 1L3SA 4WC2A 4QZGA 2J6TA 7ICMA 1MQ2A 2UVVA 3RJFA 5CB1A 3PW0A 4RQ4A 3KTQA 2ID1A 3RAXA 1L3TA 4EBJA 2R8HA 2HHSA 3SZ2A 1S0VA 1VJ7A 5DQGA 4LZDA 4ELUA 4MF2A 3M9MB 8ICIA 1PZNA 5KFOA 3ZDDA 1ZQTA 4KLOA 1SKSA 2FPMA 3N97B 2HHTA 4RNOA 4PGXA 3EYZA 3TARA 1U48A 3BQ2A 4Q45A 5KFNA 2ASLA 2R8GA 5KT6A 1KFDA 1BVSA 5KFKA 2BDPA 3QEBZ 4B9LA 1T8EA 4EBEA 4I27A 2XY5A 1TAUA 1TAQA 3MABA 4NLKA 8ICEA 4GXKA 4QZCA 2BKEA 4ZH4A 2UVUA 2HHUA 4ATBB 4MFAA 5KFLA 1B43A 4X0BA 3SV4A 1BPDA 4BWJA 3H8WA 3OJUA 7ICTA 1R89A 2DR9A 2XCAA 1JN3A 1S76D 2FMSA 4I2GA 1JMSA 4ED1A 4FHYA 5BPCA 4P2HA 2HVHA 3Q8LA 1ZQZA 3OSPA 4TQSA 4DQIA 1HJPA 4RUAA 4RT2A 3UQ2A 3QZ8A 3Q8PB 4ED8A 1ZQMA 1RPLA 4PHAA 2PFQA 4ED7A 3RR7A 2C2EA 5J0PA 5IIKA 5J2CA 4EZ6A 2M2UA 9ICRA 4QWAA 1WCNA 3WFSC 7ICUA 4X4QA 4K4GA 3GIIA 5J0SA 1WOTA 2F1HA 4DSIA 5KFPA 3TAPA 4X4PA 2DPJA 5EOZA 4F5OA 8ICOA 1U49A 2ZJAA 8ICRA 4DOCA 4QWBA 5J2EA 4DF4A 1D8YA 2PI4A 4KLEA 2DRAA 4XQ8A 5D46A 2C2DA 7ICRA 4JV0A 5KG2A 3RBEA 1SL0A 5HMMA 3PW7A 3RJEA 3MR6A 1R8BA 5DEDA 4DL6A 4Z6FA 2KZ3A 3JYYA 4F3OA 4F5RA 5HP4A 2KZMA 4JWMA 4O3OA 4RPXA 3PV8A 4YCXA 5DLGA 3OHBA 3JPQA 1U4BA 2Q0ZX 3FYHA 2AGOA 3PVXA 1KLNA 3C2LA 1TFWA 4BDPA 4UB2A 2C22A 5J2IA 3PX4A 2NRKA 2F1JA 4EP7A 3Q8KA 4YXMA 1ZQWA 3KHHA 4YD1A 3AU2A 4K4HA 2BQRA 2AU0A 4WC7A 4C8MA 1HUOA 3ETLA 5KFTA 5EWFA 1K1QA 3MR3A 4DQQA 4E7XA 2VA8A 3AUOA 8ICXA 4X5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHG A;  9ICV A;  4O3N A;  1YLQ A;  3OUY B;  1VFG A;  4WBY A;  3HWT A;  4WCW A;  3RAQ A;  5DDM A;  4QZ9 A;  5BOL A;  4DL2 A;  1U45 A;  5F9N A;  2BCS A;  3UXN A;  1D9D A;  1ZQU A;  4EYI B;  3V6K A;  4B9S A;  4WBZ A;  3C5F A;  4YVZ A;  3PY8 A;  3AQL A;  4FHP A;  5HC9 A;  8ICW A;  4RWO A;  1OU5 A;  2AQ0 A;  3H4D A;  3PNC A;  5KT4 A;  1UEU A;  4GXJ A;  8ICV A;  8ICN A;  1NKB A;  5KT3 A;  4C8L A;  1ZQK A;  1V4A A;  4Z6D A;  3PO5 A;  4IRC A;  5DB6 A;  4P4P A;  2ZTD A;  4DFP A;  3PX6 A;  3ISD A;  1KFS A;  2NRV A;  4J9Q A;  4WC1 A;  3GQC A;  4M04 A;  5L9X A;  3ZDE A;  2NRZ A;  4J9L A;  3H37 A;  1S0N A;  2ZUC A;  3C5G A;  2UVW A;  2ZH1 A;  3TQ1 A;  2XO7 A;  9ICA A;  4MEY A;  2R8K A;  3LWM A;  2VA2 A;  3C18 A;  2FPL A;  3MGH A;  2O1P A;  5KFH A;  3M9N B;  4ED3 A;  4R66 A;  1NOM A;  1SL2 A;  3WFR E;  4ECW A;  2O5A A;  1XO1 A;  3RJH A;  4YQW A;  2W9M A;  3ZD9 A;  4YMO A;  4QWC A;  3SI8 A;  1Q78 A;  3HP6 A;  3FDS A;  3AQM A;  4IRK A;  3LK9 A;  5L1J A;  4KLT A;  4E80 A;  1ZQC A;  3Q8S B;  2ATL A;  3T5J A;  2MUT B;  4NY8 A;  2HW3 A;  3OVB A;  4DF8 A;  4P4M A;  4J9S A;  1ZET A;  5KFI A;  2FPK A;  3RH4 A;  1TK0 A;  3E2E A;  2ZHA A;  1ZJN A;  8ICJ A;  4MFC A;  2KP7 A;  5HRE A;  7ICI A;  5KFM A;  4UB5 A;  8ICS A;  5HRB A;  4ECZ A;  4UB1 A;  2ISP A;  3M8S A;  1UA0 A;  1CEZ A;  3OVS A;  4GC7 A;  1NK9 A;  4YR0 A;  5DEC A;  4M0A A;  2HVI A;  3GDX A;  1MQ3 A;  3GIK A;  4TUR A;  2AJQ A;  9ICK A;  4Z6C A;  2A1J A;  3GV8 B;  1QLN A;  2GWS A;  2BCQ A;  5TZV A;  2KN7 A;  4DSF A;  4F4Y A;  4M2Y A;  1NK5 A;  1HUZ A;  2IHM A;  2JEF A;  1A76 A;  5DBA A;  3TAN A;  5KG0 A;  1ARO P;  1ZQJ A;  3PX0 A;  1SKW A;  1S0M A;  4F4K A;  3ORY A;  4RQ5 A;  5L1K A;  3SV3 A;  2Y1I A;  3UQ0 A;  5III A;  1TFY A;  2FLN A;  1NJY A;  2FLP A;  2PFN A;  4UD4 A;  2KFN A;  3RJK A;  1ZQB A;  4HYK A;  4B9N A;  1F5A A;  1Z3E B;  4QZA A;  8ICU A;  4PHE A;  2I1Q A;  4GXI A;  4NM1 A;  2ZUB A;  3TFS A;  3WFP A;  9ICM A;  3RJI A;  2PXI A;  9ICU A;  4WC6 A;  4FHX A;  4ED0 A;  2BR0 A;  2R8J A;  3TFR A;  3NYB A;  2ZH2 A;  4AT9 B;  1ZQF A;  4X4O A;  1ZQQ A;  4FBU A;  1ZQR A;  3C66 A;  4RWN A;  7ICG A;  3NTU A;  3RB4 A;  4NKT A;  2PFO A;  1R8A A;  5DDY A;  3G6X A;  4JUZ A;  1IXR A;  4RZR A;  3G6Y A;  2BQU A;  2M2V A;  3PML A;  2JZB A;  1T3N A;  2ZH9 A;  5HNK A;  2FMP A;  4KIT B;  4RQ7 A;  9ICQ A;  4QWE A;  2XGP A;  2J6S A;  5EWE A;  3GV5 B;  4J9P A;  4DOA A;  1S77 D;  1NJX A;  4MFF A;  1QTM A;  2ZJ5 A;  9ICP A;  5KG6 A;  2HHQ A;  3M8R A;  1UET A;  4QZ8 A;  4ECS A;  4UB4 A;  4JV1 A;  1K1S A;  2ZTC A;  3KHR A;  4EYH B;  3QE9 Y;  2BCV A;  1MIW A;  4DFK A;  3H39 A;  2ZH7 A;  1Y88 A;  1UT5 A;  4DWI A;  1Q79 A;  2ZH6 A;  3G6V A;  8ICK A;  1U47 A;  5KFG A;  2ISO A;  5IIJ A;  4YR3 A;  5DG7 A;  7ICS A;  2ZUD A;  4YXJ A;  3Q8M A;  3RB3 A;  3ZDA A;  4X0A A;  7ICN A;  1BNP A;  4F4Z A;  2PFP A;  4QZB A;  3JPP A;  2ZTE A;  3OUY A;  1S10 A;  4B9T A;  4PPX A;  1BPX A;  5HRH A;  5DQI A;  2XC9 A;  1ZQY A;  2IA6 A;  4ECX A;  1JXL A;  5DQH A;  3RR8 A;  2FMQ A;  3SYZ A;  2JEI A;  5HRD A;  4ECU A;  4DL7 A;  4XA5 A;  5F9L A;  2WTF A;  5KFA A;  4UBC A;  4IR9 A;  4F4W A;  3KHG A;  7ICJ A;  1NK4 A;  4KN7 A;  4F5N A;  1NKC A;  5HRL A;  9ICF A;  2DR7 A;  7ICE A;  4KLU A;  1JAJ A;  3H8S A;  4DSK A;  5KFS A;  3K4G A;  3HT3 A;  3BQT A;  5KFF A;  4O3R A;  4TUP A;  2MAX A;  4GC6 A;  4ECR A;  4X4R A;  5DG8 A;  9ICO A;  5BOM A;  3H40 A;  1C7Y A;  1T4G A;  1ZQG A;  8ICL A;  2M2W A;  9ICT A;  4PGQ A;  4O9M A;  4RWQ A;  3MR5 A;  4PH5 A;  3OV7 A;  5J2K A;  5KTQ A;  3C1Y A;  5DB9 A;  5J2F A;  4DL4 A;  3EZ5 A;  2BCR A;  9ICB A;  3MDC A;  2KFZ A;  1NO5 A;  4FHV A;  1ZQE A;  5KFC A;  4XQ7 A;  4I2H A;  9ICI A;  2JEG A;  8ICM A;  1XU4 A;  5CP2 A;  2Q66 A;  1XSL A;  1EXN A;  4ELT A;  8ICZ A;  5HML A;  3PMN A;  4J9M A;  3AU6 A;  4I2C A;  1Z00 B;  4DO9 A;  2V4R A;  3QZ7 A;  3RBD A;  1TVA A;  5KG5 A;  5J0X A;  4M9G A;  2HHV A;  4WC0 A;  4AT7 A;  3HW8 A;  4RQ3 A;  2JEJ A;  4M47 A;  4TQR A;  2F1I A;  2PI5 A;  3JPR A;  5F2V O;  4UBB A;  5KG1 A;  5J2D A;  5HRI A;  1T7P A;  5CWR A;  1NK6 A;  2ALZ A;  4F4X A;  2P66 A;  5KFY A;  1CUK A;  1ZQA A;  4O5C A;  1ZQO A;  9ICW A;  5J2J A;  1TFR A;  4ECV A;  2XCP A;  4DLE A;  1NK7 A;  3RH5 A;  4M9J A;  5KFU A;  4LVS A;  5DBB A;  3ZDC A;  4F8R A;  7ICV A;  5KFW A;  3LQC B;  4QZE A;  5KFE A;  4JWN A;  5CJ7 A;  3RJG A;  4DQS A;  1BPY A;  5J0W A;  4O3S A;  1COO A;  2ZH3 A;  4QZD A;  1X9S A;  4O3Q A;  1KDH A;  4KLL A;  3UXO A;  4FH5 A;  2ZHB A;  4DFJ A;  4YMM A;  1RXV A;  7ICH A;  2BE3 A;  4KLF A;  3OHA A;  2HHP A;  4RQ8 A;  9ICJ A;  4KLQ A;  4FBT A;  5EWG A;  4X4U A;  3MR2 A;  5KG4 A;  4JK1 A;  2ZH8 A;  5IIN A;  4J9K A;  4M9L A;  4ED2 A;  1DOQ A;  2BPC A;  3M9O B;  1ZJM A;  4O5K A;  2KTQ A;  2RFF A;  4B9U A;  3PO4 A;  3RRG A;  4QZI A;  5D4B A;  9ICX A;  1JQR A;  3OJS A;  5KT5 A;  3GIL A;  1U9L A;  4KTQ A;  5KG7 A;  5DKW A;  4KLS A;  3JPO A;  3H3A A;  1X2I A;  1QSL A;  5J0R A;  4WC5 A;  5J2B A;  2DFL A;  1D8L A;  4QWD A;  2I9G A;  4YR2 A;  5J0U A;  4KN4 A;  4TUQ A;  4RT3 A;  3IM1 A;  2LYH A;  4CCH A;  1NKE A;  4I29 A;  4KLD A;  4I2F A;  3IHQ B;  4KLG A;  5DG9 A;  3THV A;  3HIY A;  2HHW A;  3V7K A;  2ZJ8 A;  5HRF A;  4PGY A;  4RQ6 A;  4E8F A;  4UQG A;  4ECT A;  1BPE A;  3PR5 B;  2JZB B;  2P6U A;  3HJ1 A;  3LWL A;  4DQR A;  2BCU A;  1LV5 A;  2M9N A;  2W9B B;  4YN4 A;  2RDI A;  2XY7 A;  4QZH A;  2A1J B;  4NM2 A;  2ASD A;  7ICO A;  4R8U A;  4AT9 A;  3GV7 B;  1RYR A;  4YD2 A;  4EZ9 A;  4RWP A;  3PW5 A;  2ZH4 A;  1KFT A;  4F2R A;  5DGB A;  4DSE A;  4X4S A;  4XUS A;  3RB6 A;  2BQ3 A;  4R8U B;  4BXO A;  3T5K A;  3K75 D;  3WFQ E;  1N48 A;  5DLF A;  4J9R A;  4PHP A;  4IQT A;  3MDA A;  7ICK A;  2W9B A;  1A77 A;  2AGQ A;  2W9C B;  1Z00 A;  1L3V A;  4Q8E A;  9ICE A;  2V4Q A;  2ASJ A;  2Y1J A;  4AT7 B;  3RH6 A;  1S0O A;  5JUM A;  2B21 A;  5DB7 A;  8ICF A;  4GLX A;  2H5X A;  4DOB A;  3BJY A;  1BPB A;  1KSP A;  1PX5 A;  4KLM A;  4UAW A;  1JX4 A;  5KFX A;  5HHH A;  1UT8 A;  1R8C A;  4DSJ A;  3H7I A;  4FH3 A;  1KEJ A;  2NRT A;  5J2A A;  1KTQ A;  4RNN A;  2IHN A;  4BXO B;  4M9H A;  1B22 A;  5J0T A;  4PHD A;  3Q8R B;  1ZQH A;  4JV2 A;  1DK3 A;  4LZG A;  3ISB A;  1NK0 A;  2C2R A;  4RQ2 A;  4ATB A;  4F5Q A;  4O5E A;  3QEA Z;  2FLL A;  3Q8Q B;  4YFK A;  5J2H A;  8ICA A;  4X4T A;  4ECQ A;  1L5U A;  4X4V A;  3JPN A;  4F92 B;  4RPZ A;  4IQW A;  3AQN A;  5IIL A;  3V7J A;  4B9M A;  1ZQI A;  1MIV A;  3EWA A;  3MGI A;  3GIM A;  4KLH A;  1V9P A;  2DVI A;  4K4I A;  5KT7 A;  4I2A A;  4UB3 A;  3ISC A;  3RRH A;  1N56 A;  4NLZ A;  2MUT A;  1MC8 A;  4RU9 A;  3TAQ A;  3PR4 A;  4DL3 A;  2PBE A;  5KFR A;  4QW8 A;  3RTV A;  3C21 A;  4RUC A;  2J6U A;  3T3F A;  1ZQP A;  2IBK A;  5IIO A;  3LDA A;  3TI0 A;  1IM4 A;  3B0X A;  4I2I A;  4DEZ A;  3V6J A;  1XS9 D;  2NRW A;  2BHN A;  4BGD A;  4UAY A;  5KFJ A;  1QSY A;  4XRH A;  4F2S A;  2VAN A;  3HPO A;  3EPG A;  5CR0 A;  5DGA A;  4FS2 A;  3RB0 A;  1XC9 A;  4DQP A;  9ICL A;  1DK2 A;  1ZQV A;  3GFK B;  4F91 B;  2W9A A;  8ICC A;  4R65 A;  4J9O A;  4RQ1 A;  4M9N A;  4DL5 A;  4S3N A;  5KFB A;  3MFH A;  5HHI A;  2XGQ A;  3EW9 A;  3OGU A;  3NGD A;  4DS5 A;  2AGP A;  3RJJ A;  3BDP A;  4I2B A;  3JZ0 A;  4NKU A;  4IQV A;  4I2E A;  4EBD A;  1BGX T;  4DLG A;  4O0I A;  1X9M A;  9ICC A;  1QSS A;  3H38 A;  5J0O A;  3C2M A;  1ZQX A;  5KFD A;  3ZDB A;  2C28 A;  4KLJ A;  3GIJ A;  1H38 A;  2ZH5 A;  1TKD A;  3JPS A;  4ECY A;  4Q43 A;  2DRB A;  4IG8 A;  4UAZ A;  3MFI A;  4NXZ A;  4F93 B;  2P6R A;  4I28 A;  3EPI A;  5L1I A;  3T5H A;  1ZYQ A;  4WC4 A;  4C8O A;  7ICQ A;  4KMU A;  5HRG A;  4QW9 A;  3UPS A;  2M2T A;  1S97 A;  4EEY A;  4MF8 A;  2XY6 A;  1JIH A;  1TK8 A;  1ZQD A;  1WCL A;  1ZQL A;  9ICG A;  4C8K A;  1KRP A;  4QZF A;  4FHW A;  4MEX A;  4WC3 A;  4YP3 A;  4P4O A;  4J9N A;  3BQ1 A;  2BPF A;  4G3I A;  5HRK A;  3AQK A;  3PW2 A;  4AT8 B;  1NJZ A;  4TUS A;  5IIM A;  8ICB A;  4BWM A;  4EBC A;  4FS1 A;  4F50 A;  5DB8 A;  4Q44 A;  1L3U A;  9ICS A;  4LT6 A;  1NZP A;  4AT8 A;  5KG3 A;  4ELV A;  4B9V A;  7ICP A;  3B0Y A;  1ZQN A;  4M6W A;  5KFQ A;  1DGS A;  3H4B A;  2V9W A;  3OSN A;  3UXP A;  4IRD A;  4YG2 A;  3V6H A;  1RYS A;  2IMW P;  5J0Q A;  1TV9 A;  2UVR A;  1UEV A;  2BPG A;  1JXE A;  1SL1 A;  1TK5 A;  3BQ0 A;  1NK8 A;  4M6W B;  1S9F A;  8ICP A;  2DR5 A;  1D9F A;  1SKR A;  8ICH A;  4NLN A;  4UD5 A;  3WFO A;  2DR8 A;  3UPQ A;  4EBK A;  4F5P A;  4I2D A;  3C2K A;  2R8I A;  1NJW A;  3HX0 A;  1SZP A;  5KT2 A;  5D49 A;  5KFV A;  3MBY A;  5KFZ A;  8ICT A;  1XSP A;  2VA3 A;  2BGW A;  4DS4 A;  4C8N A;  5CA7 A;  5DBC A;  4R63 A;  2AQ4 A;  2OWO A;  4DSL A;  8ICY A;  4E0D A;  2HHX A;  1XSN A;  1MIY A;  5J2G A;  4FO6 A;  4Z6E A;  1X9W A;  7ICF A;  1RZT A;  7ICL A;  5J29 A;  1UA1 A;  4R64 A;  4IQU A;  3ZD8 A;  1ZQS A;  3JPT A;  4RNM A;  8ICQ A;  5L1L A;  4ED6 A;  2W9C A;  1FA0 A;  2NRX A;  4M5D A;  3L9D A;  2W8K A;  1XWL A;  4RQ0 A;  3T5L A;  3V7L A;  3C1Z A;  9ICH A;  2DPI A;  4I2J A;  1MSW D;  2RDJ A;  3H8J A;  4KLI A;  4Q8F A;  9ICN A;  4DFM A;  5HR9 A;  4X4N A;  3N4M B;  2W8L A;  4O3P A;  3C23 A;  5C5J A;  1BNO A;  3OVA A;  1LB2 B;  1BPZ A;  4RPY A;  3PW4 A;  5J0Y A;  3HJ4 A;  2KZZ A;  4YMN A;  8ICG A;  1RXW A;  1KNY A;  4NLG A;  3KHL A;  4IR1 A;  3V72 A;  1L3S A;  4WC2 A;  4QZG A;  2J6T A;  7ICM A;  1MQ2 A;  2UVV A;  3RJF A;  5CB1 A;  3PW0 A;  4RQ4 A;  3KTQ A;  2ID1 A;  3RAX A;  1L3T A;  4EBJ A;  2R8H A;  2HHS A;  3SZ2 A;  1S0V A;  1VJ7 A;  5DQG A;  4LZD A;  4ELU A;  4MF2 A;  3M9M B;  8ICI A;  1PZN A;  5KFO A;  3ZDD A;  1ZQT A;  4KLO A;  1SKS A;  2FPM A;  3N97 B;  2HHT A;  4RNO A;  4PGX A;  3EYZ A;  3TAR A;  1U48 A;  3BQ2 A;  4Q45 A;  5KFN A;  2ASL A;  2R8G A;  5KT6 A;  1KFD A;  1BVS A;  5KFK A;  2BDP A;  3QEB Z;  4B9L A;  1T8E A;  4EBE A;  4I27 A;  2XY5 A;  1TAU A;  1TAQ A;  3MAB A;  4NLK A;  8ICE A;  4GXK A;  4QZC A;  2BKE A;  4ZH4 A;  2UVU A;  2HHU A;  4ATB B;  4MFA A;  5KFL A;  1B43 A;  4X0B A;  3SV4 A;  1BPD A;  4BWJ A;  3H8W A;  3OJU A;  7ICT A;  1R89 A;  2DR9 A;  2XCA A;  1JN3 A;  1S76 D;  2FMS A;  4I2G A;  1JMS A;  4ED1 A;  4FHY A;  5BPC A;  4P2H A;  2HVH A;  3Q8L A;  1ZQZ A;  3OSP A;  4TQS A;  4DQI A;  1HJP A;  4RUA A;  4RT2 A;  3UQ2 A;  3QZ8 A;  3Q8P B;  4ED8 A;  1ZQM A;  1RPL A;  4PHA A;  2PFQ A;  4ED7 A;  3RR7 A;  2C2E A;  5J0P A;  5IIK A;  5J2C A;  4EZ6 A;  2M2U A;  9ICR A;  4QWA A;  1WCN A;  3WFS C;  7ICU A;  4X4Q A;  4K4G A;  3GII A;  5J0S A;  1WOT A;  2F1H A;  4DSI A;  5KFP A;  3TAP A;  4X4P A;  2DPJ A;  5EOZ A;  4F5O A;  8ICO A;  1U49 A;  2ZJA A;  8ICR A;  4DOC A;  4QWB A;  5J2E A;  4DF4 A;  1D8Y A;  2PI4 A;  4KLE A;  2DRA A;  4XQ8 A;  5D46 A;  2C2D A;  7ICR A;  4JV0 A;  5KG2 A;  3RBE A;  1SL0 A;  5HMM A;  3PW7 A;  3RJE A;  3MR6 A;  1R8B A;  5DED A;  4DL6 A;  4Z6F A;  2KZ3 A;  3JYY A;  4F3O A;  4F5R A;  5HP4 A;  2KZM A;  4JWM A;  4O3O A;  4RPX A;  3PV8 A;  4YCX A;  5DLG A;  3OHB A;  3JPQ A;  1U4B A;  2Q0Z X;  3FYH A;  2AGO A;  3PVX A;  1KLN A;  3C2L A;  1TFW A;  4BDP A;  4UB2 A;  2C22 A;  5J2I A;  3PX4 A;  2NRK A;  2F1J A;  4EP7 A;  3Q8K A;  4YXM A;  1ZQW A;  3KHH A;  4YD1 A;  3AU2 A;  4K4H A;  2BQR A;  2AU0 A;  4WC7 A;  4C8M A;  1HUO A;  3ETL A;  5KFT A;  5EWF A;  1K1Q A;  3MR3 A;  4DQQ A;  4E7X A;  2VA8 A;  3AUO A;  8ICX A;  4X5V A; 
#chains in the Genus database with same CATH topology
 5ALK A;  5ALH A;  1ZD2 P;  3CK6 A;  4QZ9 A;  5BOL A;  3WK9 A;  2EZZ A;  2DUY A;  3PY8 A;  5B5E U;  8ICW A;  3OTQ A;  3PNC A;  5KT4 A;  1UEU A;  4Z6D A;  1UPH A;  5DB6 A;  1KFS A;  4M04 A;  3M6Z A;  5L9X A;  2DL0 A;  4C80 A;  1O08 A;  9ICA A;  4MEY A;  2FPL A;  5KFH A;  4P0Q A;  4EEL A;  3RJH A;  4YQW A;  3ZD9 A;  2ZHB A;  4QJF B;  5ALQ A;  2ATL A;  3T5J A;  2MUT B;  3KKA A;  3F5E A;  5JTI A;  1TK0 A;  2EAM A;  5AKK A;  1WWU A;  7ICI A;  4UB5 A;  1UA0 A;  4ZOH C;  1N61 A;  2YX8 A;  1MQ3 A;  4TUR A;  2AHO B;  2EAP A;  2VJ5 A;  4Z6C A;  1YZ6 A;  3GV8 B;  4PL2 A;  5AI9 A;  4F72 A;  4UB8 U;  5ALX A;  1NK5 A;  2HOF A;  2BDU A;  1SKW A;  4F4K A;  1F44 A;  3SD7 A;  5ALE A;  1NJY A;  2FLP A;  4UD4 A;  4HYK A;  2JH1 A;  2PMZ F;  4QZA A;  4PHE A;  4CF4 A;  3SR6 A;  3WFP A;  2M0N A;  4O3M A;  2KVS A;  3TFR A;  2ZH2 A;  4NXT A;  4AT9 B;  4X4O A;  4FBU A;  5AIB A;  1R8A A;  4I0U A;  5AKY A;  1FO4 A;  1SXE A;  3PML A;  2ZH9 A;  5EE0 A;  2XGP A;  5EWE A;  3IG5 A;  1ZQ1 C;  5AKI A;  3T79 A;  4QZ8 A;  4ECS A;  3KHR A;  3QE9 Y;  3M6K A;  1HIW A;  3H39 A;  1Y88 A;  2ZH6 A;  3G6V A;  8ICK A;  2ZIW B;  1U47 A;  4YR3 A;  5DG7 A;  2ZUD A;  3L4P A;  3RB3 A;  2W7P A;  3IP4 B;  3JPP A;  1JXL A;  5DQH A;  3SYZ A;  3SQI A;  2JEI A;  4JB3 A;  4UBC A;  4IR9 A;  1ED1 A;  1Z4N A;  4F4W A;  1VLB A;  1NK4 A;  5ALF A;  2G09 A;  7ICE A;  1JAJ A;  2QAR B;  2F8K A;  4DSK A;  3HT3 A;  4JLX A;  4NXV A;  3VCB A;  3BQT A;  4O3R A;  2D6F C;  9ICO A;  5BOM A;  1C7Y A;  1ZQG A;  1T4G A;  2M2W A;  1B4F A;  3MR5 A;  4PH5 A;  5J2K A;  5J2F A;  2BCR A;  3SMV A;  5ALV A;  4ACO A;  1MN8 A;  5CP2 A;  3ALR A;  1T94 A;  1Z00 B;  4DO9 A;  3FAH A;  2H3Z A;  2KK0 A;  4AT7 A;  4RQ3 A;  4UBB A;  2KMD A;  5J2D A;  2ALZ A;  2P66 A;  1PVP A;  2LM4 A;  4DLE A;  3L5K A;  4M9J A;  2H3I A;  5CRX A;  1N2X A;  4QZE A;  4O3S A;  3ICX A;  2ZH3 A;  2XID A;  1X9S A;  4O3Q A;  1KDH A;  4KLL A;  2RLT A;  1RQN A;  4YMM A;  5JRT A;  2ODG A;  4KM5 A;  3OHA A;  3HRD D;  1AQ6 A;  3CRX A;  3QUT A;  1RDF A;  4FBT A;  2YN4 A;  4ED2 A;  1X6I A;  1KKX A;  2F76 X;  4B9U A;  4KTQ A;  1Q3U A;  3H3A A;  3JPO A;  1QSL A;  1D8L A;  1YZ7 A;  2YB4 A;  4KN4 A;  3IM1 A;  3U26 A;  4KLG A;  4I2F A;  4NXU A;  4USA A;  2YQE A;  3NKU A;  4E8F A;  3HJ1 A;  3H8M A;  2JZB B;  3QU4 A;  2W9B B;  4UAU A;  2XY7 A;  4QZH A;  4HX0 A;  3GV7 B;  1RYR A;  4K9B A;  3RB6 A;  4R8U B;  5ALO A;  3WFQ E;  4PHP A;  1A77 A;  5ALY A;  1X66 A;  3NVO A;  2VJ4 A;  4WQL A;  4US8 A;  2K4E A;  2ZG6 A;  2ASJ A;  2LPE A;  2Y1J A;  3RH6 A;  4AT7 B;  4GLX A;  4OAF A;  4KLM A;  1R8C A;  1UT8 A;  3BQ7 A;  4C7Y A;  2I5H A;  4AT8 A;  3OVB A;  2KSO A;  4PHD A;  3WK4 A;  2FLL A;  4ECQ A;  4IQW A;  1DRG A;  2G07 A;  5ALJ A;  3CNH A;  2GLE A;  3V7J A;  2KV2 A;  5AHX A;  3MGI A;  4K4I A;  5KT7 A;  3ISC A;  4NLZ A;  5FP0 A;  4RU9 A;  3TAQ A;  1MC8 A;  4OJ6 A;  4DL3 A;  3C21 A;  3JCF A;  3B0X A;  1QCK A;  2NRW A;  5HR7 A;  5AKH A;  3AMZ A;  5KFJ A;  1QSY A;  3OWG A;  3CYM A;  3EPG A;  1XC9 A;  3RB0 A;  1DK2 A;  1LKY B;  3GFK B;  2W9A A;  3RFA A;  1SZH A;  4J9O A;  4M9N A;  5HHI A;  2ZIW A;  4DS5 A;  2AGP A;  3BDP A;  5KAF U;  2KNJ A;  3H38 A;  2ZH5 A;  1TKD A;  2OCE A;  1JUD A;  3QUB A;  4KMU A;  4QW9 A;  3F5A A;  5D61 A;  1URJ A;  1QQ7 A;  1ZQD A;  4MF8 A;  2IOF K;  1RQL A;  1KRP A;  4FHW A;  5HRK A;  3BQ1 A;  4AT8 B;  8ICB A;  4TUS A;  3C28 A;  4FFD A;  4K97 A;  4LT6 A;  9ICS A;  5KG3 A;  1JRP A;  4ELV A;  2ES6 A;  3B0Y A;  3IRU A;  1ZQN A;  4A8E A;  2V9W A;  3H4B A;  4IRD A;  1FFU A;  2UVR A;  1SL1 A;  1TK5 A;  1CRX A;  4M6W B;  1D9F A;  1Q8K A;  2R8I A;  1SZP A;  2NYV A;  5KT2 A;  3M1Y A;  3PHZ A;  2BGW A;  1Z1V A;  2AQ4 A;  3UM9 A;  5J2G A;  4FO6 A;  4R64 A;  4KMO B;  2NRX A;  3WKE A;  2W8K A;  1XWL A;  1PVR A;  4RQ0 A;  3NVV A;  3T5L A;  3SEI A;  4CE6 A;  3N7S C;  3N4M B;  4FE3 A;  3HJ4 A;  2KZZ A;  1KNY A;  4IR1 A;  4WC2 A;  1ZRN A;  2F44 A;  2ID1 A;  3AEV A;  2W03 A;  1S0V A;  1N5W A;  5DQG A;  4O69 A;  1X6J A;  4CNQ A;  2XIC A;  2K4P A;  3N97 B;  2HHT A;  4RNO A;  2H3V A;  3PST A;  5J8Y A;  5AI4 A;  5KFN A;  1D8B A;  4I27 A;  1TAU A;  4EBE A;  5KL1 B;  2XY5 A;  3MAB A;  2BKE A;  4ZH4 A;  5EE9 A;  5KFL A;  1B43 A;  3OJU A;  2D8C A;  1R89 A;  1JN3 A;  1JMS A;  4NL9 C;  5BPC A;  4OJP A;  4P2H A;  2YTU A;  1ZQM A;  1ZRM A;  3RR7 A;  1OUQ A;  3HKZ C;  2C2E A;  5J0P A;  5J2C A;  9ICR A;  4IS7 A;  4DSI A;  4X4P A;  2DPJ A;  2OEH A;  8ICR A;  2ZIX A;  4QWB A;  4DOC A;  4DF4 A;  2PI4 A;  2HBL A;  5D46 A;  2C2D A;  4JV0 A;  3RJE A;  1SL0 A;  4Z6F A;  2KZ3 A;  5HP4 A;  2JGA A;  5CHE A;  3PVX A;  3C2L A;  2WF5 A;  4RQM A;  4YXM A;  1ZQW A;  3AU2 A;  4WC7 A;  4C8M A;  2KKP A;  4E7X A;  4F2R A;  3TAD C;  5CHG A;  9ICV A;  2Z7J A;  4O3N A;  1VFG A;  2FCL A;  1QH9 A;  2NV3 A;  4NXW A;  4P0P B;  2H3F A;  2BCS A;  3K7D A;  1ZQU A;  3C5F A;  3AQL A;  4FHP A;  5AKL A;  2ZIV A;  1PUZ A;  5EE3 A;  1JAL A;  4JLZ A;  3H4D A;  5TIS U;  8ICV A;  8ICN A;  5KT3 A;  1V4A A;  3PO5 A;  3PX6 A;  4NLC A;  3ISD A;  2E3T A;  3GQC A;  5AI0 A;  2FI1 A;  3A0B U;  2UVW A;  2ZH1 A;  2F77 X;  2XO7 A;  4EED A;  3MGH A;  3M9N B;  4ECW A;  3KZI U;  4QWC A;  2W9M A;  4YMO A;  3HP6 A;  3FDS A;  3AQM A;  5J8Y C;  1NZB A;  5L1J A;  4IRK A;  3Q8S B;  4DF8 A;  4J9S A;  5KFI A;  1J2M A;  2WF9 A;  2FPK A;  3E2E A;  3KKA C;  1ZJN A;  4MFC A;  5HRE A;  5HRB A;  8ICS A;  4ECZ A;  2ISP A;  2O6K A;  4GC7 A;  4YR0 A;  2ESE A;  1NK9 A;  3N28 A;  4Y2T A;  3GIK A;  5ALM A;  2WF7 A;  4Y2Y A;  2AJQ A;  4XJE A;  2A1J A;  1QLN A;  1N60 A;  2BCQ A;  5TZV A;  2GWS A;  2KN7 A;  4F4Y A;  2IHM A;  2JEF A;  4MHV A;  5KG0 A;  1ARO P;  1S0M A;  3ORY A;  2Y1I A;  1TFY A;  3BZC A;  2DWQ A;  2PFN A;  2KFN A;  1ZQB A;  3M7D A;  3D2Q A;  2W54 A;  4WC6 A;  5AI5 A;  3NYB A;  3C66 A;  1ZQR A;  3K1R B;  7ICG A;  3RB4 A;  4NKT A;  2PFO A;  5DDY A;  3G6X A;  5HNK A;  2FMP A;  4KIT B;  2J6S A;  3MGV A;  3GV5 B;  4J9P A;  4DOA A;  1S77 D;  2YMQ A;  1NJX A;  2WF6 A;  2B0C A;  2HHQ A;  4CGZ A;  4UB4 A;  1UT5 A;  4FO1 A;  4UB6 U;  2KIW A;  5G5G A;  5CFS A;  3Q8M A;  4C4S A;  2PFP A;  4UAR A;  4FZM A;  1S10 A;  1BPX A;  5HRH A;  2MRL A;  4K98 A;  2QB0 B;  2HBJ A;  4DL7 A;  5F9L A;  1NKC A;  3J81 j;  9ICF A;  2HSZ A;  2DR7 A;  4KLU A;  3K4G A;  5KFF A;  3H40 A;  9ICT A;  5AIC A;  4RWQ A;  2MSN A;  3C1Y A;  4DL4 A;  4XQ7 A;  9ICI A;  2Q4T A;  1GPJ A;  2Q66 A;  1EXN A;  8ICZ A;  3PMN A;  2V4R A;  3QZ7 A;  2HHV A;  3D2N A;  2F1I A;  2KE7 A;  3E0F A;  3BS7 A;  4F4X A;  4PZN A;  1LVH A;  1ZQO A;  5J2J A;  4ECV A;  5KFU A;  5KFE A;  4JWN A;  4BJQ A;  3I1Y A;  1COO A;  5AK6 A;  2LM1 A;  4GIB A;  4DFJ A;  3QUQ A;  1RXV A;  1ZXI A;  1TE2 A;  4KLF A;  4X4U A;  5KG4 A;  3SAG A;  2ZH8 A;  1J97 A;  4QIW C;  2BPC A;  1ZJM A;  4OJ5 A;  4O5K A;  2KTQ A;  3RRG A;  2KJ9 A;  4QZI A;  2W3S A;  5KT5 A;  3GIL A;  1U9L A;  5KG7 A;  1X2I A;  4WC5 A;  5J0R A;  5J2B A;  2UVV A;  4TUQ A;  1TAM A;  4CCH A;  5AM4 A;  4KLD A;  1N63 A;  3V7K A;  2JXJ A;  1J2N A;  3D2S A;  2P6U A;  3LWL A;  2BCU A;  3B9J A;  1LV5 A;  3HIL A;  2ASD A;  2A1J B;  7ICO A;  1F5S A;  4R8U A;  4EZ9 A;  4RWP A;  1KFT A;  5K4L A;  4XUS A;  1V97 A;  2L5Y A;  2KEY A;  3BS5 B;  4J9R A;  4IQT A;  3MDA A;  5B66 U;  2W9B A;  2W9C B;  1Z00 A;  4Q8E A;  9ICE A;  3UMB A;  5DB7 A;  4AP9 A;  3MCR A;  2H5X A;  4DOB A;  3F53 A;  1KSP A;  2JMG A;  1PX5 A;  4UAW A;  4BUG A;  5ALT A;  1RM6 C;  3Q8R B;  1ZQH A;  4RQ2 A;  1SB3 C;  3Q8Q B;  1N5X A;  4YFK A;  1L5U A;  4F92 B;  1SXD A;  5IIL A;  4LEV A;  1WWV A;  3GIM A;  3FC4 A;  1L6N A;  1V85 A;  1WUD A;  4I2A A;  4UB3 A;  1PK3 A;  2K4H A;  4QW8 A;  4RUC A;  1PK1 B;  2VIX A;  1IM4 A;  1CI4 A;  2BHN A;  4BGD A;  3HPO A;  2BBJ A;  5L1M A;  4FS2 A;  4F91 B;  1XNS A;  3MFH A;  2KOB A;  2XGQ A;  3EW9 A;  3QU9 A;  3OGU A;  4I2B A;  4NKU A;  4IQV A;  2HOQ A;  2RQ5 A;  2RRD A;  4O0I A;  1QSS A;  3NS1 A;  1ZQX A;  2C28 A;  3D6J A;  3JPS A;  4Q43 A;  2DRB A;  4IG8 A;  2WB1 C;  3MFI A;  2A1A A;  2W43 A;  3EPI A;  3T5H A;  4WC4 A;  3UPS A;  1S97 A;  4EEY A;  1TK8 A;  3WK6 A;  1WCL A;  3N7P D;  1ZQL A;  4C8K A;  4MEX A;  4YP3 A;  2AH5 A;  4G3I A;  4LEW A;  4CF5 A;  1IG6 A;  4BWM A;  5F2V O;  4F50 A;  7ICP A;  3WKD A;  1DGS A;  1O03 A;  3OSN A;  1TV9 A;  1FEZ A;  1KN5 A;  3BQ0 A;  1NK8 A;  2EZX A;  3WFO A;  2GAF D;  3UPQ A;  3NVW A;  3F2B A;  1L8L A;  2IOH A;  1RZT A;  1S8O A;  4CDG A;  7ICL A;  5ALG A;  3AQE A;  3ZD8 A;  8ICQ A;  2W9C A;  1FA0 A;  4UW9 A;  1ECW A;  5AKZ A;  3V7L A;  2DPI A;  4EGW A;  3H8J A;  2EWR A;  4O3P A;  3C23 A;  5C5J A;  3OVA A;  4RPY A;  3PW4 A;  1A0P A;  2Y9U A;  1RXW A;  5D62 A;  5ALW A;  1MQ2 A;  2E8N A;  3RJF A;  1IV8 A;  1L7M A;  2G5I B;  3F2D A;  2E1F A;  4ELU A;  4MF2 A;  3M9M B;  3NAS A;  2G08 A;  5GTH U;  3ZDD A;  4KLO A;  1SKS A;  2ZXH A;  2ASL A;  4Q45 A;  5KT6 A;  3QU2 A;  3QEB Z;  1C20 A;  3I28 A;  4X0B A;  2DR9 A;  3H8W A;  4OCZ A;  2XCA A;  2FMS A;  4N7R A;  2HVH A;  4DQI A;  4TQS A;  1HJP A;  3UQ2 A;  8ICX A;  3QZ8 A;  3Q8P B;  2JHD A;  8ICE A;  4WBY A;  4WH5 A;  3WK7 A;  2M2U A;  2F8L A;  5CFU A;  5ALL A;  2OYY A;  4Y2R A;  1WCN A;  3WFS C;  4K4G A;  3ERC C;  1DXS A;  1WOT A;  2F1H A;  5EOZ A;  4F5O A;  4Y2S A;  1U49 A;  2DRA A;  5J2E A;  1KW4 A;  4DL6 A;  4F5R A;  2KZM A;  5ALU A;  4RPX A;  3JPQ A;  2AGO A;  1TFW A;  3EF2 A;  4PL1 A;  2C22 A;  5J2I A;  5HR6 A;  4EP7 A;  3Q8K A;  4YD1 A;  2AU0 A;  3KZX A;  3ETL A;  2W04 A;  5KFT A;  5EWF A;  2KHV A;  3KBB A;  4DQQ A;  1LKY A;  3AUO A;  3ER9 B;  4X5V A;  1SWV A;  1UQV A;  1YLQ A;  3OUY B;  3QYP A;  4WCW A;  5DDM A;  1D9D A;  1U45 A;  5F9N A;  3UXN A;  4WBZ A;  4AYB C;  4YVZ A;  2JV3 A;  1NKB A;  4C8L A;  1ZQK A;  3K1Z A;  2ZTD A;  4DFP A;  4O6A A;  5A0L A;  3SAH A;  2ZUC A;  2R8K A;  3C18 A;  2VA2 A;  2O1P A;  4P0P A;  4ED3 A;  1RYU A;  3WFR E;  1NOM A;  2KVC A;  2O5A A;  1XO1 A;  3SI8 A;  1M6Y A;  4E80 A;  4KLT A;  1ZQC A;  1ZET A;  4P4M A;  5AKG A;  3TKA A;  3RH4 A;  1COK A;  1T3Q A;  2GOL A;  2JR5 A;  4WJ3 B;  5CEH A;  4M0A A;  2HVI A;  2HMX A;  4U7C A;  2LYB A;  4DSF A;  2XVT A;  2PMZ C;  4M2Y A;  2K8C B;  1HUZ A;  2NO5 A;  1UHU A;  2LBO A;  1A76 A;  3TAN A;  3PX0 A;  4OAH A;  5L1K A;  3UQ0 A;  3QX7 A;  2FLN A;  4Y2P A;  3RJK A;  4B9N A;  1F5A A;  1Z3E B;  3NVY A;  4NM1 A;  2QB0 A;  2PXI A;  4FHX A;  1UCV A;  2B51 A;  1B0X A;  3NTU A;  4JUZ A;  2BQU A;  3WKC A;  3G6Y A;  2FDR A;  2ZXI A;  2M2V A;  2BZF A;  4MFF A;  5KG6 A;  4KB6 A;  2CN1 A;  4OJO A;  3M8R A;  1UET A;  4JV1 A;  1MIW A;  2ZTC A;  4EYH B;  4K9A A;  3WKA A;  2ZH7 A;  1Q79 A;  3NVZ A;  2EAN A;  2ISO A;  5IIJ A;  4Y2X A;  7ICS A;  2H3Q A;  2JH7 A;  4YXJ A;  3F2C A;  5AM5 A;  1BNP A;  4F4Z A;  4QZB A;  2ZTE A;  1ZD5 A;  4B9T A;  5DQI A;  1ZQY A;  4ECX A;  2FMQ A;  5HRD A;  1GO3 F;  4ECU A;  2WTF A;  7ICJ A;  4KN7 A;  3IV6 A;  2WAQ F;  2YML A;  4TUP A;  2MAX A;  2OHF A;  4GC6 A;  8ICL A;  4O9M A;  2F3N A;  2LKY A;  5KTQ A;  4KX3 A;  3EZ5 A;  9ICB A;  2KFZ A;  2WAQ C;  1ZQE A;  3CW2 C;  5AKE A;  2QAR A;  3QU7 A;  1XU4 A;  1XSL A;  5HML A;  1Z19 A;  2YMM A;  4LJX A;  4NV0 A;  3RBD A;  4M9G A;  1TVA A;  5KG5 A;  3HW8 A;  2YY6 A;  5AM3 A;  4M47 A;  4TQR A;  2PI5 A;  5HRI A;  2W55 A;  5KFY A;  1CUK A;  4O5C A;  9ICW A;  1TFR A;  3RH5 A;  3ZDC A;  4F8R A;  4EEB A;  5KFW A;  2E5S A;  4DQS A;  5J0W A;  4QZD A;  2PKE A;  1PVQ A;  4RQ8 A;  5F3X B;  2MU2 A;  5JTG A;  4KLQ A;  3MR2 A;  4JK1 A;  1DOQ A;  3M9O B;  3PO4 A;  5D4B A;  4UAT A;  1JQR A;  3OJS A;  1L7P A;  5DKW A;  2DR5 A;  2I9G A;  4LEZ A;  2KHQ A;  4I29 A;  5J0U A;  3IHQ B;  3HIY A;  5DG9 A;  2A19 A;  2HHW A;  5HRF A;  4PGY A;  4RQ6 A;  4UQG A;  4ECT A;  5ALP A;  4DQR A;  2ZIU B;  2E8M A;  1ZD3 A;  2QLT A;  2RDI A;  1VDV A;  4NM2 A;  3WKB A;  1V38 A;  2AXT U;  3WK8 A;  3PW5 A;  5E79 U;  4DSE A;  3AL0 B;  2OXO A;  3ER8 C;  5DLF A;  7ICK A;  2AGQ A;  1P7D A;  2CRX A;  5AI6 A;  1L3V A;  1S0O A;  2B21 A;  8ICF A;  4UAV A;  3BJY A;  4B6J A;  5KFX A;  4KX5 A;  3H7I A;  4FH3 A;  2NRT A;  2IHN A;  4M9H A;  4MKP A;  2LHT A;  4OD0 A;  3QUC A;  4JV2 A;  3ISB A;  4F5Q A;  2QKQ A;  3O0F A;  8ICA A;  4X4T A;  4X4V A;  1Z4O A;  3JPN A;  3AQN A;  3DEE A;  2P35 A;  2YB1 A;  3GZF A;  1MIV A;  1V9P A;  3OPX A;  3RRH A;  1N56 A;  4BX9 C;  4ICA A;  1SIJ A;  3T3F A;  3LDA A;  2HN1 A;  3TI0 A;  3V6J A;  4DEZ A;  4C4R A;  2VAN A;  2HBM A;  5DGA A;  2QB1 A;  4DQP A;  4P0Q B;  9ICL A;  3IDW A;  1ZQV A;  4R65 A;  4S3N A;  4RQ1 A;  5KFB A;  3RJJ A;  4OO1 J;  2KD1 A;  4I2E A;  1BGX T;  1L7O A;  3PSF A;  2ZIV B;  2FE9 A;  4ECY A;  5AK3 A;  4UAZ A;  4NXZ A;  4F93 B;  2P6R A;  4I28 A;  4C8O A;  2M2T A;  2E8P A;  4JMU A;  1JIH A;  3AQK A;  3PW2 A;  4GFJ A;  3BZK A;  4FS1 A;  5DB8 A;  2GH1 A;  4B9V A;  2IUB A;  4M6W A;  5KFQ A;  3V6H A;  1UEV A;  5J0Q A;  2BPG A;  5B3P A;  3NRW A;  1S9F A;  8ICP A;  1SV4 A;  4NLN A;  4UD5 A;  2DR8 A;  3RF9 A;  4I2D A;  3C2K A;  3HX0 A;  4DCC A;  1Q46 A;  5KFZ A;  3MBY A;  1XSP A;  2VA3 A;  2KJ5 A;  4DS4 A;  4C8N A;  5CA7 A;  8ICY A;  4DSL A;  1XSN A;  3QNM A;  3GU3 A;  5J29 A;  4RNM A;  5L1L A;  4Y2U A;  3C1Z A;  9ICN A;  4KLI A;  4CRX A;  4Q8F A;  4DFM A;  2W8L A;  2B4V A;  2DKZ A;  4QNL A;  2KKV A;  1BPZ A;  2VKQ A;  5AK5 A;  4NLG A;  3KHL A;  1L3S A;  4QZG A;  2J6T A;  2R18 A;  1MA7 A;  2HN2 A;  3KTQ A;  3RAX A;  4PZO A;  1L3T A;  2K60 A;  4EBJ A;  2R8H A;  8ICI A;  1PZN A;  5KFO A;  4Y2Q A;  1ZQT A;  2FPM A;  3TAR A;  1WG8 A;  2HI0 A;  1U48 A;  3BQ2 A;  1SWW A;  2R8G A;  5KFK A;  1T8E A;  4UAS A;  2BBH A;  2HBK A;  2HHU A;  4QZC A;  4MFA A;  3SV4 A;  4BWJ A;  1S76 D;  3CP8 A;  1S5L U;  5B3Q A;  4FHY A;  3ETR A;  4C4T A;  1ZQZ A;  4RUA A;  3SAF A;  4RT2 A;  2K8A A;  2PFQ A;  4ED8 A;  4ED7 A;  4EZ6 A;  5IIK A;  3HJE A;  4QWA A;  2KG5 A;  3AM9 A;  2Y0S C;  3TAP A;  8ICO A;  2DF4 B;  2ZJA A;  2EDU A;  3L3F X;  4EX7 A;  7ICR A;  3C29 A;  3RBE A;  4IC9 A;  5HMM A;  3PW7 A;  5DED A;  4F3O A;  3PV8 A;  3FYH A;  5EE1 A;  5T14 A;  4BDP A;  3PX4 A;  2F1J A;  3KHH A;  4K4H A;  2XI9 A;  3FM9 A;  4WOY A;  2HOI A;  1ZD4 A;  3HWT A;  1N62 A;  3RAQ A;  4DL2 A;  4F71 A;  2GO7 A;  4EYI B;  3V6K A;  5ALS A;  4B9S A;  2B56 A;  4OAI Z;  2Y9T A;  5HC9 A;  4RWO A;  1OU5 A;  2AQ0 A;  3PSP A;  2KIC A;  5CFT A;  4GXJ A;  1KQQ A;  4IRC A;  4P4P A;  2WF8 A;  4PJ0 U;  4IL6 U;  2EZY A;  2NRV A;  2DBY A;  4J9Q A;  4WC1 A;  4OAG A;  3ZDE A;  1SGG A;  1FIQ A;  2NRZ A;  4J9L A;  1S0N A;  3H37 A;  3LVV A;  3C5G A;  1A6S A;  3TQ1 A;  5AM0 A;  3LVW A;  2DKX A;  3LWM A;  4R66 A;  4NLB A;  1SL2 A;  1Q78 A;  3LK9 A;  4LEY A;  4NY8 A;  2HW3 A;  2ZHA A;  8ICJ A;  2YMP A;  5KFM A;  1CEZ A;  4UB1 A;  3M8S A;  3OVS A;  5DEC A;  2RHF A;  3GDX A;  2ZIX B;  5JU5 A;  9ICK A;  1NI3 A;  3PSI A;  5GTI U;  3QXG A;  2B6G A;  2I6X A;  5DBA A;  1ZQJ A;  4RQ5 A;  2CXY A;  3SV3 A;  5III A;  4DFD A;  2E8O A;  8ICU A;  2I1Q A;  4GXI A;  4NJ8 A;  2ZUB A;  3TFS A;  3PZP A;  1NNL A;  9ICM A;  3RJI A;  4K96 A;  9ICU A;  4ED0 A;  5AK4 A;  2BR0 A;  2R8J A;  5KNI A;  1ZQF A;  1ZQQ A;  4RWN A;  2LI6 A;  1IXR A;  4EEN A;  4C7Z A;  4RZR A;  4FZN A;  3LYS A;  3WK5 A;  2OH2 A;  2JZB A;  1T3N A;  1VJ5 A;  4RQ7 A;  9ICQ A;  4QWE A;  5AM1 A;  1SV0 A;  4EEK A;  2ZJ5 A;  1IIP A;  1QTM A;  9ICP A;  4U6P A;  1HEK A;  2KIV A;  1K1S A;  2BCV A;  4DFK A;  4DWI A;  5KFG A;  3ZDA A;  4X0A A;  7ICN A;  1WYG A;  3MC1 A;  3OUY A;  4PPX A;  4G9B A;  2DGZ A;  2XC9 A;  3KOO A;  2IA6 A;  3RR8 A;  1PK1 A;  3AQF A;  4K99 A;  4XA5 A;  5KFA A;  3KHG A;  4F5N A;  5HRL A;  2F2A B;  1F0M A;  4US9 A;  3H8S A;  5KFS A;  2D3D A;  4ECR A;  4EX6 A;  5DG8 A;  4PGQ A;  3OV7 A;  4Y2J A;  5DB9 A;  4FHV A;  1NO5 A;  3MDC A;  4NWI A;  3N7R C;  5KFC A;  4I2H A;  2E1E A;  2JEG A;  8ICM A;  4ELT A;  3H0M B;  2IOF A;  5KAI U;  4J9M A;  3AU6 A;  4I2C A;  4K8V A;  4WC0 A;  5J0X A;  1OXJ A;  2JEJ A;  3JPR A;  5KG1 A;  1T7P A;  5CWR A;  1NK6 A;  1FFV A;  1ZQA A;  3BS5 A;  2XCP A;  1NK7 A;  2G0A A;  4LVS A;  4HAI A;  5DBB A;  7ICV A;  3LQC B;  5CJ7 A;  3RJG A;  1BPY A;  4CF3 A;  3UXO A;  4FH5 A;  7ICH A;  2BE3 A;  3DV9 A;  3KFU F;  2HHP A;  9ICJ A;  2KJ8 A;  2A3V A;  5EWG A;  2G5H B;  5IIN A;  4J9K A;  4M9L A;  2RFF A;  5ALR A;  3ZI4 A;  2MA1 A;  9ICX A;  4KLS A;  1KBU A;  4QWD A;  2DFL A;  3SEN A;  4YR2 A;  4RT3 A;  2LYH A;  1NKE A;  4QIW F;  3THV A;  1X40 A;  2ZJ8 A;  3WU2 U;  1RG6 A;  3TAC B;  1BPE A;  3PR5 B;  2G06 A;  1K5O A;  2M9N A;  4YN4 A;  3NUQ A;  4AT9 A;  2ZH4 A;  3QU5 A;  4YD2 A;  5DGB A;  2WHE A;  2RP5 A;  4X4S A;  2BQ3 A;  1ZOL A;  3T5K A;  3K75 D;  4BXO A;  2CPR A;  1N48 A;  2ZIU A;  5D63 A;  2V4Q A;  5ALN A;  5JUM A;  3IN5 A;  2FJ6 A;  1BPB A;  1JX4 A;  4O68 A;  5HHH A;  4DSJ A;  4C0Z A;  1KEJ A;  2LMR A;  4RQN A;  5J2A A;  1KTQ A;  1L7N A;  4RNN A;  4BXO B;  1B22 A;  5J0T A;  1DK3 A;  4LZG A;  1NK0 A;  2C2R A;  4ATB A;  4OJL A;  4O5E A;  3QEA Z;  1X42 A;  3IG8 A;  2K89 A;  5J2H A;  4RPZ A;  3S6J A;  5AKJ A;  3R9K A;  4B9M A;  1ZQI A;  3EWA A;  4KLH A;  2DVI A;  2PBE A;  2MUT A;  5ALZ A;  3PR4 A;  2LYA A;  5KFR A;  3RTV A;  2J6U A;  1ZQP A;  2IBK A;  5IIO A;  3TAD A;  4I2I A;  1XS9 D;  4UAY A;  5G5H A;  4F2S A;  4XRH A;  5CR0 A;  1Z1B A;  8ICC A;  4DL5 A;  1KL9 A;  2WFA A;  5AM2 A;  2GA9 D;  3NGD A;  3JZ0 A;  2W7O A;  2EH9 A;  4EBD A;  4DLG A;  1X9M A;  9ICC A;  5J0O A;  3C2M A;  5KFD A;  3ZDB A;  4KLJ A;  2W3R A;  4FZL A;  2NO4 A;  3GIJ A;  3EUB 2;  1H38 A;  3E58 A;  2W11 A;  3NRZ A;  5H2F U;  5L1I A;  1ZYQ A;  7ICQ A;  4J03 A;  2DQN B;  5HRG A;  2XY6 A;  4WQK A;  1QQ5 A;  9ICG A;  4QZF A;  4WC3 A;  4P4O A;  4J9N A;  2WB1 F;  2BPF A;  1NJZ A;  5IIM A;  1XO0 A;  4EBC A;  1L3U A;  4Q44 A;  1Q3V A;  1NZP A;  2KP7 A;  2HCF A;  3UXP A;  1L8O A;  4YG2 A;  1RYS A;  2IMW P;  3AN1 A;  1JXE A;  3DDH A;  1DGJ A;  2OM6 A;  1SKR A;  8ICH A;  4EBK A;  4F5P A;  3KD3 A;  3H0R B;  1NJW A;  5D49 A;  5KFV A;  3A0H U;  8ICT A;  5KL8 B;  4R63 A;  5DBC A;  2OWO A;  2K4I A;  4X4R A;  1OW5 A;  4E0D A;  2HHX A;  1MIY A;  1X9W A;  7ICF A;  4Z6E A;  3VC8 A;  3H0L B;  1JRO A;  1X9X A;  1UA1 A;  4IQU A;  1YT3 A;  1ZQS A;  3JPT A;  4ED6 A;  4M5D A;  5AIA A;  3L9D A;  3HKZ F;  2JRZ A;  2K8B B;  1QQ6 A;  9ICH A;  4I2J A;  1MSW D;  2RDJ A;  2Y0S F;  5HR9 A;  4X4N A;  1BNO A;  3ONN A;  1LB2 B;  3UMG A;  5J0Y A;  4EV6 A;  4YMN A;  8ICG A;  3V72 A;  7ICM A;  5CB1 A;  3PW0 A;  4RQ4 A;  2EQY A;  2HHS A;  3SZ2 A;  5AI8 A;  3NWI A;  1VJ7 A;  2EAO A;  4LZD A;  4NXX A;  4PGX A;  3EYZ A;  1KFD A;  1BVS A;  2BDP A;  2KSO B;  4B9L A;  4O67 A;  1TAQ A;  4NLK A;  4ATB B;  4GXK A;  3ED5 A;  4X4Q A;  2UVU A;  1BPD A;  7ICT A;  5AKX A;  4I2G A;  4ED1 A;  5ALI A;  3Q8L A;  3OSP A;  1RPL A;  4PHA A;  2IHO A;  7ICU A;  3GII A;  5J0S A;  4Y2V A;  5KFP A;  4NL9 A;  3I76 A;  4KLE A;  1D8Y A;  4XQ8 A;  3UMC A;  5KG2 A;  3MR6 A;  1R8B A;  3JYY A;  1JI7 A;  4JWM A;  4O3O A;  4YCX A;  5DLG A;  3OHB A;  1U4B A;  2Q0Z X;  1SV0 C;  2N1R A;  1KLN A;  4UB2 A;  2NRK A;  2BQR A;  1HUO A;  2HDO A;  1K1Q A;  3MR3 A;  4AYB F;  5ALD A;  2VA8 A;  5C0Y A; 
#chains in the Genus database with same CATH homology
 5CHG A;  9ICV A;  4O3N A;  1YLQ A;  3OUY B;  1VFG A;  4WBY A;  3HWT A;  4WCW A;  3RAQ A;  5DDM A;  4QZ9 A;  5BOL A;  4DL2 A;  1U45 A;  5F9N A;  2BCS A;  3UXN A;  1D9D A;  1ZQU A;  4EYI B;  3V6K A;  4B9S A;  4WBZ A;  3C5F A;  4YVZ A;  3PY8 A;  3AQL A;  4FHP A;  5HC9 A;  8ICW A;  4RWO A;  1OU5 A;  2AQ0 A;  3H4D A;  3PNC A;  5KT4 A;  1UEU A;  4GXJ A;  8ICV A;  8ICN A;  1NKB A;  5KT3 A;  4C8L A;  1ZQK A;  1V4A A;  4Z6D A;  3PO5 A;  4IRC A;  5DB6 A;  4P4P A;  2ZTD A;  4DFP A;  3PX6 A;  3ISD A;  1KFS A;  2NRV A;  4J9Q A;  4WC1 A;  3GQC A;  4M04 A;  5L9X A;  3ZDE A;  2NRZ A;  4J9L A;  3H37 A;  1S0N A;  2ZUC A;  3C5G A;  2UVW A;  2ZH1 A;  3TQ1 A;  2XO7 A;  9ICA A;  4MEY A;  2R8K A;  3LWM A;  2VA2 A;  3C18 A;  2FPL A;  3MGH A;  2O1P A;  5KFH A;  3M9N B;  4ED3 A;  4R66 A;  1NOM A;  1SL2 A;  3WFR E;  4ECW A;  2O5A A;  1XO1 A;  3RJH A;  4YQW A;  2W9M A;  3ZD9 A;  4YMO A;  4QWC A;  3SI8 A;  1Q78 A;  3HP6 A;  3FDS A;  3AQM A;  4IRK A;  3LK9 A;  5L1J A;  4KLT A;  4E80 A;  1ZQC A;  3Q8S B;  2ATL A;  3T5J A;  2MUT B;  4NY8 A;  2HW3 A;  3OVB A;  4DF8 A;  4P4M A;  4J9S A;  1ZET A;  5KFI A;  2FPK A;  3RH4 A;  1TK0 A;  3E2E A;  2ZHA A;  1ZJN A;  8ICJ A;  4MFC A;  2KP7 A;  5HRE A;  7ICI A;  5KFM A;  4UB5 A;  8ICS A;  5HRB A;  4ECZ A;  4UB1 A;  2ISP A;  3M8S A;  1UA0 A;  1CEZ A;  3OVS A;  4GC7 A;  1NK9 A;  4YR0 A;  5DEC A;  4M0A A;  2HVI A;  3GDX A;  1MQ3 A;  3GIK A;  4TUR A;  2AJQ A;  9ICK A;  4Z6C A;  2A1J A;  3GV8 B;  1QLN A;  2GWS A;  2BCQ A;  5TZV A;  2KN7 A;  4DSF A;  4F4Y A;  4M2Y A;  1NK5 A;  1HUZ A;  2IHM A;  2JEF A;  1A76 A;  5DBA A;  3TAN A;  5KG0 A;  1ARO P;  1ZQJ A;  3PX0 A;  1SKW A;  1S0M A;  4F4K A;  3ORY A;  4RQ5 A;  5L1K A;  3SV3 A;  2Y1I A;  3UQ0 A;  5III A;  1TFY A;  2FLN A;  1NJY A;  2FLP A;  2PFN A;  4UD4 A;  2KFN A;  3RJK A;  1ZQB A;  4HYK A;  4B9N A;  1F5A A;  1Z3E B;  4QZA A;  8ICU A;  4PHE A;  2I1Q A;  4GXI A;  4NM1 A;  2ZUB A;  3TFS A;  3WFP A;  9ICM A;  3RJI A;  2PXI A;  9ICU A;  4WC6 A;  4FHX A;  4ED0 A;  2BR0 A;  2R8J A;  3TFR A;  3NYB A;  2ZH2 A;  4AT9 B;  1ZQF A;  4X4O A;  1ZQQ A;  4FBU A;  1ZQR A;  3C66 A;  4RWN A;  7ICG A;  3NTU A;  3RB4 A;  4NKT A;  2PFO A;  1R8A A;  5DDY A;  3G6X A;  4JUZ A;  1IXR A;  4RZR A;  3G6Y A;  2BQU A;  2M2V A;  3PML A;  2JZB A;  1T3N A;  2ZH9 A;  5HNK A;  2FMP A;  4KIT B;  4RQ7 A;  9ICQ A;  4QWE A;  2XGP A;  2J6S A;  5EWE A;  3GV5 B;  4J9P A;  4DOA A;  1S77 D;  1NJX A;  4MFF A;  1QTM A;  2ZJ5 A;  9ICP A;  5KG6 A;  2HHQ A;  3M8R A;  1UET A;  4QZ8 A;  4ECS A;  4UB4 A;  4JV1 A;  1K1S A;  2ZTC A;  3KHR A;  4EYH B;  3QE9 Y;  2BCV A;  1MIW A;  4DFK A;  3H39 A;  2ZH7 A;  1Y88 A;  1UT5 A;  4DWI A;  1Q79 A;  2ZH6 A;  3G6V A;  8ICK A;  1U47 A;  5KFG A;  2ISO A;  5IIJ A;  4YR3 A;  5DG7 A;  7ICS A;  2ZUD A;  4YXJ A;  3Q8M A;  3RB3 A;  3ZDA A;  4X0A A;  7ICN A;  1BNP A;  4F4Z A;  2PFP A;  4QZB A;  3JPP A;  2ZTE A;  3OUY A;  1S10 A;  4B9T A;  4PPX A;  1BPX A;  5HRH A;  5DQI A;  2XC9 A;  1ZQY A;  2IA6 A;  4ECX A;  1JXL A;  5DQH A;  3RR8 A;  2FMQ A;  3SYZ A;  2JEI A;  5HRD A;  4ECU A;  4DL7 A;  4XA5 A;  5F9L A;  2WTF A;  5KFA A;  4UBC A;  4IR9 A;  4F4W A;  3KHG A;  7ICJ A;  1NK4 A;  4KN7 A;  4F5N A;  1NKC A;  5HRL A;  9ICF A;  2DR7 A;  7ICE A;  4KLU A;  1JAJ A;  3H8S A;  4DSK A;  5KFS A;  3K4G A;  3HT3 A;  3BQT A;  5KFF A;  4O3R A;  4TUP A;  2MAX A;  4GC6 A;  4ECR A;  4X4R A;  5DG8 A;  9ICO A;  5BOM A;  3H40 A;  1C7Y A;  1T4G A;  1ZQG A;  8ICL A;  2M2W A;  9ICT A;  4PGQ A;  4O9M A;  4RWQ A;  3MR5 A;  4PH5 A;  3OV7 A;  5J2K A;  5KTQ A;  3C1Y A;  5DB9 A;  5J2F A;  4DL4 A;  3EZ5 A;  2BCR A;  9ICB A;  3MDC A;  2KFZ A;  1NO5 A;  4FHV A;  1ZQE A;  5KFC A;  4XQ7 A;  4I2H A;  9ICI A;  2JEG A;  8ICM A;  1XU4 A;  5CP2 A;  2Q66 A;  1XSL A;  1EXN A;  4ELT A;  8ICZ A;  5HML A;  3PMN A;  4J9M A;  3AU6 A;  4I2C A;  1Z00 B;  4DO9 A;  2V4R A;  3QZ7 A;  3RBD A;  1TVA A;  5KG5 A;  5J0X A;  4M9G A;  2HHV A;  4WC0 A;  4AT7 A;  3HW8 A;  4RQ3 A;  2JEJ A;  4M47 A;  4TQR A;  2F1I A;  2PI5 A;  3JPR A;  5F2V O;  4UBB A;  5KG1 A;  5J2D A;  5HRI A;  1T7P A;  5CWR A;  1NK6 A;  2ALZ A;  4F4X A;  2P66 A;  5KFY A;  1CUK A;  1ZQA A;  4O5C A;  1ZQO A;  9ICW A;  5J2J A;  1TFR A;  4ECV A;  2XCP A;  4DLE A;  1NK7 A;  3RH5 A;  4M9J A;  5KFU A;  4LVS A;  5DBB A;  3ZDC A;  4F8R A;  7ICV A;  5KFW A;  3LQC B;  4QZE A;  5KFE A;  4JWN A;  5CJ7 A;  3RJG A;  4DQS A;  1BPY A;  5J0W A;  4O3S A;  1COO A;  2ZH3 A;  4QZD A;  1X9S A;  4O3Q A;  1KDH A;  4KLL A;  3UXO A;  4FH5 A;  2ZHB A;  4DFJ A;  4YMM A;  1RXV A;  7ICH A;  2BE3 A;  4KLF A;  3OHA A;  2HHP A;  4RQ8 A;  9ICJ A;  4KLQ A;  4FBT A;  5EWG A;  4X4U A;  3MR2 A;  5KG4 A;  4JK1 A;  2ZH8 A;  5IIN A;  4J9K A;  4M9L A;  4ED2 A;  1DOQ A;  2BPC A;  3M9O B;  1ZJM A;  4O5K A;  2KTQ A;  2RFF A;  4B9U A;  3PO4 A;  3RRG A;  4QZI A;  5D4B A;  9ICX A;  1JQR A;  3OJS A;  5KT5 A;  3GIL A;  1U9L A;  4KTQ A;  5KG7 A;  5DKW A;  4KLS A;  3JPO A;  3H3A A;  1X2I A;  1QSL A;  5J0R A;  4WC5 A;  5J2B A;  2DFL A;  1D8L A;  4QWD A;  2I9G A;  4YR2 A;  5J0U A;  4KN4 A;  4TUQ A;  4RT3 A;  3IM1 A;  2LYH A;  4CCH A;  1NKE A;  4I29 A;  4KLD A;  4I2F A;  3IHQ B;  4KLG A;  5DG9 A;  3THV A;  3HIY A;  2HHW A;  3V7K A;  2ZJ8 A;  5HRF A;  4PGY A;  4RQ6 A;  4E8F A;  4UQG A;  4ECT A;  1BPE A;  3PR5 B;  2JZB B;  2P6U A;  3HJ1 A;  3LWL A;  4DQR A;  2BCU A;  1LV5 A;  2M9N A;  2W9B B;  4YN4 A;  2RDI A;  2XY7 A;  4QZH A;  2A1J B;  4NM2 A;  2ASD A;  7ICO A;  4R8U A;  4AT9 A;  3GV7 B;  1RYR A;  4YD2 A;  4EZ9 A;  4RWP A;  3PW5 A;  2ZH4 A;  1KFT A;  4F2R A;  5DGB A;  4DSE A;  4X4S A;  4XUS A;  3RB6 A;  2BQ3 A;  4R8U B;  4BXO A;  3T5K A;  3K75 D;  3WFQ E;  1N48 A;  5DLF A;  4J9R A;  4PHP A;  4IQT A;  3MDA A;  7ICK A;  2W9B A;  1A77 A;  2AGQ A;  2W9C B;  1Z00 A;  1L3V A;  4Q8E A;  9ICE A;  2V4Q A;  2ASJ A;  2Y1J A;  4AT7 B;  3RH6 A;  1S0O A;  5JUM A;  2B21 A;  5DB7 A;  8ICF A;  4GLX A;  2H5X A;  4DOB A;  3BJY A;  1BPB A;  1KSP A;  1PX5 A;  4KLM A;  4UAW A;  1JX4 A;  5KFX A;  5HHH A;  1UT8 A;  1R8C A;  4DSJ A;  3H7I A;  4FH3 A;  1KEJ A;  2NRT A;  5J2A A;  1KTQ A;  4RNN A;  2IHN A;  4BXO B;  4M9H A;  1B22 A;  5J0T A;  4PHD A;  3Q8R B;  1ZQH A;  4JV2 A;  1DK3 A;  4LZG A;  3ISB A;  1NK0 A;  2C2R A;  4RQ2 A;  4ATB A;  4F5Q A;  4O5E A;  3QEA Z;  2FLL A;  3Q8Q B;  4YFK A;  5J2H A;  8ICA A;  4X4T A;  4ECQ A;  1L5U A;  4X4V A;  3JPN A;  4F92 B;  4RPZ A;  4IQW A;  3AQN A;  5IIL A;  3V7J A;  4B9M A;  1ZQI A;  1MIV A;  3EWA A;  3MGI A;  3GIM A;  4KLH A;  1V9P A;  2DVI A;  4K4I A;  5KT7 A;  4I2A A;  4UB3 A;  3ISC A;  3RRH A;  1N56 A;  4NLZ A;  2MUT A;  1MC8 A;  4RU9 A;  3TAQ A;  3PR4 A;  4DL3 A;  2PBE A;  5KFR A;  4QW8 A;  3RTV A;  3C21 A;  4RUC A;  2J6U A;  3T3F A;  1ZQP A;  2IBK A;  5IIO A;  3LDA A;  3TI0 A;  1IM4 A;  3B0X A;  4I2I A;  4DEZ A;  3V6J A;  1XS9 D;  2NRW A;  2BHN A;  4BGD A;  4UAY A;  5KFJ A;  1QSY A;  4XRH A;  4F2S A;  2VAN A;  3HPO A;  3EPG A;  5CR0 A;  5DGA A;  4FS2 A;  3RB0 A;  1XC9 A;  4DQP A;  9ICL A;  1DK2 A;  1ZQV A;  3GFK B;  4F91 B;  2W9A A;  8ICC A;  4R65 A;  4J9O A;  4RQ1 A;  4M9N A;  4DL5 A;  4S3N A;  5KFB A;  3MFH A;  5HHI A;  2XGQ A;  3EW9 A;  3OGU A;  3NGD A;  4DS5 A;  2AGP A;  3RJJ A;  3BDP A;  4I2B A;  3JZ0 A;  4NKU A;  4IQV A;  4I2E A;  4EBD A;  1BGX T;  4DLG A;  4O0I A;  1X9M A;  9ICC A;  1QSS A;  3H38 A;  5J0O A;  3C2M A;  1ZQX A;  5KFD A;  3ZDB A;  2C28 A;  4KLJ A;  3GIJ A;  1H38 A;  2ZH5 A;  1TKD A;  3JPS A;  4ECY A;  4Q43 A;  2DRB A;  4IG8 A;  4UAZ A;  3MFI A;  4NXZ A;  4F93 B;  2P6R A;  4I28 A;  3EPI A;  5L1I A;  3T5H A;  1ZYQ A;  4WC4 A;  4C8O A;  7ICQ A;  4KMU A;  5HRG A;  4QW9 A;  3UPS A;  2M2T A;  1S97 A;  4EEY A;  4MF8 A;  2XY6 A;  1JIH A;  1TK8 A;  1ZQD A;  1WCL A;  1ZQL A;  9ICG A;  4C8K A;  1KRP A;  4QZF A;  4FHW A;  4MEX A;  4WC3 A;  4YP3 A;  4P4O A;  4J9N A;  3BQ1 A;  2BPF A;  4G3I A;  5HRK A;  3AQK A;  3PW2 A;  4AT8 B;  1NJZ A;  4TUS A;  5IIM A;  8ICB A;  4BWM A;  4EBC A;  4FS1 A;  4F50 A;  5DB8 A;  4Q44 A;  1L3U A;  9ICS A;  4LT6 A;  1NZP A;  4AT8 A;  5KG3 A;  4ELV A;  4B9V A;  7ICP A;  3B0Y A;  1ZQN A;  4M6W A;  5KFQ A;  1DGS A;  3H4B A;  2V9W A;  3OSN A;  3UXP A;  4IRD A;  4YG2 A;  3V6H A;  1RYS A;  2IMW P;  5J0Q A;  1TV9 A;  2UVR A;  1UEV A;  2BPG A;  1JXE A;  1SL1 A;  1TK5 A;  3BQ0 A;  1NK8 A;  4M6W B;  1S9F A;  8ICP A;  2DR5 A;  1D9F A;  1SKR A;  8ICH A;  4NLN A;  4UD5 A;  3WFO A;  2DR8 A;  3UPQ A;  4EBK A;  4F5P A;  4I2D A;  3C2K A;  2R8I A;  1NJW A;  3HX0 A;  1SZP A;  5KT2 A;  5D49 A;  5KFV A;  3MBY A;  5KFZ A;  8ICT A;  1XSP A;  2VA3 A;  2BGW A;  4DS4 A;  4C8N A;  5CA7 A;  5DBC A;  4R63 A;  2AQ4 A;  2OWO A;  4DSL A;  8ICY A;  4E0D A;  2HHX A;  1XSN A;  1MIY A;  5J2G A;  4FO6 A;  4Z6E A;  1X9W A;  7ICF A;  1RZT A;  7ICL A;  5J29 A;  1UA1 A;  4R64 A;  4IQU A;  3ZD8 A;  1ZQS A;  3JPT A;  4RNM A;  8ICQ A;  5L1L A;  4ED6 A;  2W9C A;  1FA0 A;  2NRX A;  4M5D A;  3L9D A;  2W8K A;  1XWL A;  4RQ0 A;  3T5L A;  3V7L A;  3C1Z A;  9ICH A;  2DPI A;  4I2J A;  1MSW D;  2RDJ A;  3H8J A;  4KLI A;  4Q8F A;  9ICN A;  4DFM A;  5HR9 A;  4X4N A;  3N4M B;  2W8L A;  4O3P A;  3C23 A;  5C5J A;  1BNO A;  3OVA A;  1LB2 B;  1BPZ A;  4RPY A;  3PW4 A;  5J0Y A;  3HJ4 A;  2KZZ A;  4YMN A;  8ICG A;  1RXW A;  1KNY A;  4NLG A;  3KHL A;  4IR1 A;  3V72 A;  1L3S A;  4WC2 A;  4QZG A;  2J6T A;  7ICM A;  1MQ2 A;  2UVV A;  3RJF A;  5CB1 A;  3PW0 A;  4RQ4 A;  3KTQ A;  2ID1 A;  3RAX A;  1L3T A;  4EBJ A;  2R8H A;  2HHS A;  3SZ2 A;  1S0V A;  1VJ7 A;  5DQG A;  4LZD A;  4ELU A;  4MF2 A;  3M9M B;  8ICI A;  1PZN A;  5KFO A;  3ZDD A;  1ZQT A;  4KLO A;  1SKS A;  2FPM A;  3N97 B;  2HHT A;  4RNO A;  4PGX A;  3EYZ A;  3TAR A;  1U48 A;  3BQ2 A;  4Q45 A;  5KFN A;  2ASL A;  2R8G A;  5KT6 A;  1KFD A;  1BVS A;  5KFK A;  2BDP A;  3QEB Z;  4B9L A;  1T8E A;  4EBE A;  4I27 A;  2XY5 A;  1TAU A;  1TAQ A;  3MAB A;  4NLK A;  8ICE A;  4GXK A;  4QZC A;  2BKE A;  4ZH4 A;  2UVU A;  2HHU A;  4ATB B;  4MFA A;  5KFL A;  1B43 A;  4X0B A;  3SV4 A;  1BPD A;  4BWJ A;  3H8W A;  3OJU A;  7ICT A;  1R89 A;  2DR9 A;  2XCA A;  1JN3 A;  1S76 D;  2FMS A;  4I2G A;  1JMS A;  4ED1 A;  4FHY A;  5BPC A;  4P2H A;  2HVH A;  3Q8L A;  1ZQZ A;  3OSP A;  4TQS A;  4DQI A;  1HJP A;  4RUA A;  4RT2 A;  3UQ2 A;  3QZ8 A;  3Q8P B;  4ED8 A;  1ZQM A;  1RPL A;  4PHA A;  2PFQ A;  4ED7 A;  3RR7 A;  2C2E A;  5J0P A;  5IIK A;  5J2C A;  4EZ6 A;  2M2U A;  9ICR A;  4QWA A;  1WCN A;  3WFS C;  7ICU A;  4X4Q A;  4K4G A;  3GII A;  5J0S A;  1WOT A;  2F1H A;  4DSI A;  5KFP A;  3TAP A;  4X4P A;  2DPJ A;  5EOZ A;  4F5O A;  8ICO A;  1U49 A;  2ZJA A;  8ICR A;  4DOC A;  4QWB A;  5J2E A;  4DF4 A;  1D8Y A;  2PI4 A;  4KLE A;  2DRA A;  4XQ8 A;  5D46 A;  2C2D A;  7ICR A;  4JV0 A;  5KG2 A;  3RBE A;  1SL0 A;  5HMM A;  3PW7 A;  3RJE A;  3MR6 A;  1R8B A;  5DED A;  4DL6 A;  4Z6F A;  2KZ3 A;  3JYY A;  4F3O A;  4F5R A;  5HP4 A;  2KZM A;  4JWM A;  4O3O A;  4RPX A;  3PV8 A;  4YCX A;  5DLG A;  3OHB A;  3JPQ A;  1U4B A;  2Q0Z X;  3FYH A;  2AGO A;  3PVX A;  1KLN A;  3C2L A;  1TFW A;  4BDP A;  4UB2 A;  2C22 A;  5J2I A;  3PX4 A;  2NRK A;  2F1J A;  4EP7 A;  3Q8K A;  4YXM A;  1ZQW A;  3KHH A;  4YD1 A;  3AU2 A;  4K4H A;  2BQR A;  2AU0 A;  4WC7 A;  4C8M A;  1HUO A;  3ETL A;  5KFT A;  5EWF A;  1K1Q A;  3MR3 A;  4DQQ A;  4E7X A;  2VA8 A;  3AUO A;  8ICX A;  4X5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...