4TURA

Human dna polymerase beta inserting dcmpnpp opposite the 5'g of cisplatin crosslinked gs (pt-gg2)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4turA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4turA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4turA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4turA03
4P4PA 4WC0A 4I2DA 5DLGA 4LT6A 1T8EA 3GILA 5DG9A 4NLKA 4P2HA 2M2VA 5HRBA 4X0BA 1NZPA 8ICUA 1BPEA 1DOQA 2HHVA 1MIYA 4RNMA 3QE9Y 4DL7A 4JWMA 1T4GA 4LVSA 2HHTA 1ZQDA 2XY7A 1DGSA 4QZ9A 5KG1A 4ED6A 3T5LA 2Q0ZX 1JIHA 4EZ6A 1HJPA 5HMLA 8ICTA 1UA0A 5KFNA 1B43A 4F4KA 1R8BA 2DPIA 3RRHA 1U47A 4WC7A 4FO6A 4E80A 4EBJA 5IIKA 5HHHA 4B9VA 4AT8A 4YVZA 3RJEA 4TUSA 2XGPA 4J9NA 4DFMA 7ICTA 4RT2A 4ECWA 7ICPA 3V6HA 4KN7A 7ICKA 4C8NA 4AT7A 3Q8PB 5L1KA 1NK9A 4TURA 1JN3A 5CR0A 4ECXA 4KLTA 1MIVA 5BOLA 1D9FA 1ZQQA 4PHAA 2F1JA 4XQ8A 5DG8A 1L5UA 1NJXA 7ICIA 3E2EA 4KLOA 4X4NA 9ICFA 4IQUA 7ICGA 2RFFA 4Z6DA 5KFFA 4RNOA 3RBDA 5BOMA 3V6KA 1ZJMA 2ASJA 8ICPA 4DL3A 5J2BA 4RQ6A 3HP6A 3SZ2A 1BPXA 8ICWA 2XC9A 2ZUBA 5BPCA 5J0YA 2ZUCA 4DS4A 3UXPA 5IILA 2PFNA 4BXOB 2M2TA 3AQNA 2HVIA 4JV1A 1RPLA 1UT5A 1NJZA 2JZBB 3Q8KA 2BPGA 4B9UA 7ICOA 1IM4A 3LWLA 1ZQSA 1ZJNA 1BNOA 2NRXA 9ICHA 1V9PA 2W9AA 4GXKA 2XY6A 4C8OA 1RZTA 1QSLA 1KDHA 5C5JA 3H8SA 3ZD9A 3HPOA 3HX0A 9ICQA 3PX0A 5HREA 2IHNA 7ICEA 1TK8A 4EBCA 5D46A 4QZIA 2BDPA 4B9LA 1TFYA 5DDYA 4IRCA 2FPKA 4QW9A 1S0OA 4KLMA 4DSFA 1TKDA 1RYRA 5KT4A 3GV5B 2IBKA 2O1PA 2ZH6A 1R8CA 3JPPA 4YFKA 1KFTA 5KFJA 2ZH2A 3JPTA 4KLEA 9ICSA 9ICUA 4NM1A 2HHXA 4YD2A 2ID1A 3T5HA 1NKEA 1ZQYA 3EYZA 4DO9A 3HW8A 4KLJA 2ZJ5A 2KP7A 3MR2A 5KG7A 3MDCA 1K1SA 3IM1A 4ECVA 2DR7A 2P66A 2DVIA 4BGDA 3PR4A 1ZQGA 1JAJA 3JPNA 5IIMA 4QW8A 3QEBZ 1CUKA 1U49A 5J0TA 5KFVA 5KFXA 2O5AA 1ZQVA 5DKWA 4FHYA 3TAQA 5DEDA 3H7IA 3GV7B 2UVUA 4ECUA 2W9CA 4KLLA 4ELTA 1NJYA 4CCHA 5J2CA 1KTQA 3PMNA 4ED2A 3Q8MA 4ECTA 4DL2A 8ICRA 4XUSA 3MR5A 3OSPA 9ICBA 3OV7A 2BCRA 4Z6EA 3ISBA 8ICOA 1V4AA 3PW4A 4IRDA 4RWOA 1D8LA 4UB3A 5IIOA 4RQ1A 5HRLA 4WC6A 2I1QA 4DF4A 5DB6A 4ELUA 4IR9A 1F5AA 5KG5A 5L1IA 4M6WA 4P4OA 3M9MB 4ECZA 4UD5A 3M9OB 3C21A 2BCQA 1ZQWA 4KLDA 5F9LA 3WFSC 4RNNA 1ZQJA 1ZQRA 4MEYA 5L9XA 1SL2A 2R8KA 3IHQB 3C2LA 4ED0A 1TFWA 2F1IA 4RT3A 2ISOA 7ICMA 1U45A 4ED7A 1UETA 4MEXA 2DR9A 1NKBA 1D8YA 5JUMA 5KG4A 2ATLA 4AT9A 4DFPA 3C1ZA 3Q8LA 4O0IA 7ICNA 2F1HA 1NK0A 4WC2A 2BCUA 1N56A 3ZDCA 2BQ3A 9ICCA 5KFGA 1ZETA 3K4GA 9ICAA 2C22A 4J9LA 4IG8A 1MC8A 5CJ7A 1SL0A 4B9NA 5J2DA 4AT8B 7ICHA 5DB9A 3H3AA 2FMQA 4ED1A 3RAQA 5KT7A 2ZH7A 2XCPA 4GC6A 4F92B 3MR3A 4O3OA 3MFIA 4FHPA 4X4SA 3OVSA 5KFIA 5KFOA 4RQ8A 4M47A 2M2UA 4UB5A 1NK5A 3WFQE 1FA0A 1KSPA 4JWNA 3PMLA 4R63A 1BVSA 4Q43A 3OGUA 4O3NA 3Q8QB 4FHWA 4ECRA 5CHGA 5DB8A 3C2KA 4HYKA 4QZHA 5KFPA 4QZFA 1TVAA 1UT8A 5J0WA 1UEVA 7ICRA 4I2AA 3BQTA 7ICJA 3OUYB 4JV0A 5DQGA 3PY8A 9ICWA 2NRWA 3KHLA 4UBCA 1JXLA 4XA5A 9ICIA 5KFQA 1K1QA 4DWIA 4WC3A 4KLUA 5CP2A 3PO5A 3T5KA 2Y1IA 4F4XA 3OHAA 1SZPA 3GDXA 4I2IA 1SKWA 1AROP 4YN4A 8ICCA 3RB6A 3RR8A 4ED3A 2FLLA 4O3SA 1U9LA 3GV8B 4PHDA 4X4OA 1BGXT 1X2IA 4EYIB 4GC7A 3AQLA 3H38A 3PW7A 1LB2B 4RU9A 1XC9A 3WFRE 4IQTA 4TQSA 8ICGA 5CWRA 5HRKA 1ZQEA 3OVAA 3NGDA 7ICFA 1EXNA 3MGIA 2PXIA 4O3QA 2W9MA 3PR5B 1Z00A 5KFWA 3PNCA 2ZJ8A 3JPOA 4YCXA 5J2HA 1L3VA 4YR3A 1KEJA 1C7YA 2ZH9A 4I2FA 3RH6A 2KN7A 5J0OA 5DECA 2DRAA 2FPLA 4M9LA 3ISDA 2AU0A 5CA7A 2BKEA 2W8LA 4ECQA 8ICNA 4EP7A 3OJUA 5DBCA 3LWMA 4B9SA 4IRKA 4LZGA 2C28A 1R89A 4MFFA 1LV5A 4YR0A 2ZTCA 5KFZA 2ZJAA 4K4HA 4M0AA 4UB1A 1KFSA 1ZYQA 4YMOA 5KG3A 4R64A 4C8LA 4DSEA 9ICPA 4ATBB 4QWEA 4KTQA 4RWNA 4FHXA 4QZEA 3ZDEA 3Q8SB 2W9CB 2W9BB 2FLNA 4I2HA 3RTVA 2ZH3A 1ZQUA 4WC4A 4MF8A 1BPZA 1RXVA 1L3UA 2JEJA 2BHNA 1Z3EB 5EOZA 5KFTA 5KG2A 1XSPA 1X9WA 1S9FA 4BDPA 3KTQA 3TFRA 2H5XA 3GIMA 1X9SA 4MF2A 4M2YA 2ZHBA 4YMNA 4ELVA 5DBAA 5DB7A 1N48A 3UPQA 4EZ9A 4X4RA 1TAUA 4IQVA 1NK4A 3BQ2A 2XCAA 4M6WB 2A1JB 1SKSA 4FH5A 5KFDA 3T5JA 2JEFA 2ZTEA 1NKCA 1MIWA 2WTFA 4WBYA 1ZQHA 4DQIA 2HHPA 4QZAA 4EEYA 4DSKA 1QSSA 4KLFA 5KFSA 5KG6A 2BPFA 2ASDA 1ZQMA 1QLNA 2Q66A 3LDAA 3G6XA 4G3IA 8ICQA 4J9KA 7ICUA 8ICYA 2OWOA 3C1YA 2C2RA 1H38A 2BQUA 3V72A 1VJ7A 2DRBA 5DBBA 4ECSA 4PGYA 1UA1A 5KFEA 5DDMA 3FYHA 3UPSA 1TAQA 1WCNA 4RQ5A 1OU5A 9ICMA 4E0DA 3PW5A 4UAWA 4M9NA 4K4IA 4ECYA 3H40A 3RJGA 2PFOA 8ICXA 2AGQA 3JPQA 2V4RA 3RH5A 2DR5A 3RJJA 4M9GA 5J2EA 1CEZA 1R8AA 4KN4A 4Z6FA 3H4BA 3V7LA 4I2EA 1YLQA 2ZH1A 4QZDA 5HRGA 4UBBA 2P6RA 3QZ7A 4F4ZA 4F2SA 2JZBA 5J0RA 5J29A 2UVRA 5KFAA 2V9WA 8ICSA 3UQ0A 5DQHA 2AQ4A 3JZ0A 3KHGA 1PX5A 4NKUA 5KFCA 4RPZA 3AQKA 3GIKA 3TFSA 3BDPA 4GLXA 4RPXA 3JPRA 3THVA 3RAXA 2JEIA 7ICVA 4I2CA 1ZQZA 5DLFA 9ICEA 3MFHA 3GIIA 4PHEA 4DFJA 3MGHA 3PW2A 3GIJA 1SKRA 4QZCA 1MQ3A 2UVVA 4KLSA 1VFGA 4M9HA 4F5OA 4JK1A 4O5CA 3ETLA 5HHIA 4F3OA 1U48A 1TK0A 2PFPA 4O9MA 4UB4A 8ICJA 4PGXA 3NYBA 1WCLA 5KT3A 3SV3A 1U4BA 2M2WA 5F9NA 2AGPA 1RXWA 4O3RA 4YD1A 2FMSA 3G6YA 5DGAA 3H8JA 2BCSA 3MDAA 3N4MB 3RRGA 5J0XA 3OHBA 2IMWP 3ZDDA 3SI8A 5J0SA 4PH5A 1T3NA 1S0MA 4AT7B 2XY5A 1X9MA 1MSWD 8ICLA 4DL4A 3B0YA 8ICAA 1TK5A 1KNYA 4X4UA 3AU6A 1XU4A 2R8IA 3TANA 5KT2A 4QZ8A 1QSYA 2KZ3A 3FDSA 1SL1A 3RJHA 4Q44A 4WBZA 2NRVA 3EPGA 3SV4A 1S10A 3WFOA 2MUTA 4RWQA 2DR8A 4GXJA 1L3SA 1ZQFA 4X4TA 4WC1A 5HRFA 1L3TA 4NLZA 3ZD8A 3M8RA 7ICSA 5DGBA 4NLGA 4UAYA 3T3FA 2ASLA 2KFZA 5IINA 5D49A 2HVHA 3EZ5A 1QTMA 3OVBA 4JV2A 3B0XA 1T7PA 4EBKA 5J2FA 4F4YA 3AQMA 2NRZA 4F5NA 1Q78A 2JEGA 4O5EA 8ICHA 2IHMA 7ICLA 1BPBA 3RB3A 3TQ1A 5HRDA 4RWPA 2NRTA 2XGQA 3UQ2A 2IA6A 4DF8A 9ICVA 4F50A 1ZQXA 4F4WA 2VA8A 4J9SA 2FMPA 4NXZA 1ZQBA 3RBEA 2FLPA 2AQ0A 5KFMA 4R65A 1JXEA 3RH4A 2C2EA 2DPJA 1A77A 4I2JA 4KLQA 9ICXA 4RQ7A 4F5PA 1XSLA 4DSLA 1Q79A 4DOAA 4KMUA 3GQCA 2MAXA 4DLGA 4I2BA 2ISPA 2C2DA 4NKTA 1UEUA 3EW9A 4YG2A 4R66A 4DL6A 5EWGA 2BQRA 2R8GA 2HW3A 1XWLA 2ZTDA 3HT3A 1B22A 3H39A 4UD4A 3KHHA 4YP3A 4DOCA 1ZQNA 4DL5A 3C5FA 2KZZA 1NOMA 1TV9A 5HRHA 2J6UA 1ZQOA 4M5DA 4RUCA 4BWMA 4RZRA 4F5RA 2P6UA 1S0VA 4BWJA 3MR6A 3G6VA 4YXJA 4X0AA 5KFKA 3N97B 4FHVA 3AUOA 4RQ2A 4S3NA 1ZQPA 2PI4A 3BJYA 4R8UA 4C8KA 4QWAA 2AJQA 4UQGA 4KITB 5KFHA 3H37A 2HHWA 8ICBA 9ICTA 4TUPA 3RJIA 4DQSA 2ZUDA 5J2AA 3ORYA 5KFLA 3NTUA 3UXNA 5TZVA 3V7JA 4ED8A 1ZQLA 3TARA 3RJKA 3ZDBA 4I27A 4MFCA 4F5QA 5HP4A 3OUYA 3AU2A 1XS9D 4JUZA 4Q45A 2PBEA 2FPMA 4X4QA 4UAZA 4WCWA 1BPDA 3JYYA 4KLHA 3RJFA 4F2RA 3PO4A 2XO7A 1IXRA 4J9MA 2R8JA 3TAPA 2PI5A 1S97A 2ZHAA 5KT5A 4FS1A 1S77D 1XSNA 1KLNA 9ICNA 5HMMA 2VANA 5EWFA 4NY8A 1KRPA 5HR9A 3LQCB 5J0UA 4AT9B 4XRHA 4QZBA 3MBYA 1PZNA 2VA3A 2NRKA 4PGQA 2ALZA 1JMSA 4RUAA 3RB4A 2HHQA 3PX6A 2ZH5A 2M9NA 4RQ4A 4X4PA 2BPCA 4FBTA 3KHRA 3M8SA 4DOBA 1NK6A 3Q8RB 4NM2A 1HUOA 5KFRA 4YR2A 4E7XA 4J9QA 2HHSA 3GFKB 9ICLA 8ICMA 4QWCA 1Y88A 4RQ0A 3WFPA 2BE3A 3BQ0A 3QEAZ 2ZH4A 3JPSA 2KFNA 4O5KA 4K4GA 7ICQA 8ICKA 4MFAA 3PVXA 3C66A 2W8KA 4IR1A 5F2VO 8ICFA 3BQ1A 2PFQA 4IQWA 5KG0A 5L1JA 4BXOA 4DFKA 1MQ2A 4C8MA 3PW0A 3C23A 1D9DA 3ZDAA 5CB1A 3EPIA 2R8HA 8ICVA 4ATBA 4EBEA 2MUTB 1ZQCA 3K75D 4DSJA 1DK2A 5HC9A 2W9BA 1S76D 5KFYA 3ISCA 4DLEA 5HRIA 4PPXA 2RDJA 4F93B 3LK9A 5J2IA 4EYHB 5J2JA 4LZDA 5DG7A 2I9GA 9ICGA 4QWBA 5J2GA 4DQRA 2KTQA 9ICOA 4J9PA 4FH3A 4GXIA 2DFLA 4QZGA 5L1LA 1WOTA 4EBDA 4DEZA 3H8WA 1NK7A 4X4VA 4DQQA 3RB0A 2V4QA 2ZH8A 5KTQA 5D4BA 1HUZA 8ICZA 2A1JA 9ICKA 2BGWA 2J6TA 1JX4A 2KZMA 1A76A 8ICEA 3OSNA 5HNKA 3OJSA 3H4DA 1NJWA 2HHUA 1NO5A 3L9DA 1ZQTA 4B9TA 5IIJA 3C5GA 4I2GA 2AGOA 3MABA 4QWDA 3SYZA 4Q8FA 4Q8EA 5J0QA 4PHPA 3HWTA 1ZQKA 4I28A 4TQRA 2Y1JA 1RYSA 4XQ7A 5KFBA 4E8FA 1Z00B 4UB2A 2J6SA 4DSIA 4F91B 4J9RA 5KT6A 4M9JA 1BNPA 3PV8A 3HJ1A 3EWAA 2BR0A 4TUQA 3UXOA 5EWEA 4X5VA 4O3PA 3M9NB 5KFUA 4Z6CA 3PX4A 1ZQAA 3V7KA 4F8RA 4I29A 1DK3A 4KLIA 5DQIA 3C18A 2GWSA 1COOA 4P4MA 2RDIA 4RPYA 4YXMA 1NK8A 2UVWA 2BCVA 3V6JA 2VA2A 1JQRA 3HIYA 4WC5A 1TFRA 4J9OA 1BPYA 4FBUA 8ICIA 4NLNA 4RQ3A 3RR7A 3QZ8A 4M04A 3HJ4A 9ICRA 5IIIA 5J0PA 4B9MA 1ZQIA 1KFDA 4KLGA 5J2KA 2LYHA 9ICJA 3TI0A 1S0NA 4R8UB 4ZH4A 4YQWA 3C2MA 4DQPA 1XO1A 2B21A 4DS5A 4YMMA 4FS2A
chains in the Genus database with same CATH superfamily
4P4PA 4LT6A 1T8EA 4X0BA 2HHVA 3MGVA 1T4GA 4LVSA 2HHTA 5KG1A 4ED6A 4NXVA 1JI7A 4EZ6A 1HJPA 1QH9A 2NYVA 4WC7A 4E80A 4EBJA 5IIKA 5HHHA 4AT8A 3RJEA 4DFMA 5J8YC 2WF5A 1WWVA 2E8PA 1SB3C 4AT7A 1NK9A 3OTQA 1KBUA 1ZQQA 1IG6A 4X4NA 4LEVA 2GAFD 3C29A 7ICGA 1L6NA 2G09A 4RNOA 3O0FA 4RQ6A 2XC9A 2KHVA 4DS4A 4RQNA 3D2SA 5AKJA 1RPLA 3Q8KA 4K98A 1ZQSA 1ZJNA 2XIDA 1RZTA 5C5JA 3AL0B 1KQQA 3PX0A 2F3NA 1X42A 7ICEA 5D46A 4B9LA 4QW9A 4DSFA 1RYRA 5CFUA 2BZFA 3JPTA 9ICUA 2ZXIA 2HHXA 3QYPA 4OJPA 5KG7A 2QB0B 4ECVA 2DVIA 4BGDA 3PR4A 1ZQGA 3QEBZ 4NL9A 2O5AA 1ZQVA 2F77X 3KFUF 5DEDA 2WAQF 3HRDD 5ALMA 4UW9A 2HOQA 4XUSA 9ICBA 3ISBA 2EAOA 4P0PA 1D8LA 4DF4A 5DB6A 2W55A 2KVCA 4P4OA 2H3IA 3M9MB 4ECZA 2DBYA 1QQ6A 2R8KA 3BS7A 2LI6A 1TFWA 2M0NA 1U45A 4ED7A 4P0QA 1NKBA 5KG4A 4AT9A 1NK0A 2BCUA 2K4IA 9ICCA 3CYMA 5ALHA 9ICAA 3WKDA 5D62A 5J2DA 3H3AA 4B6JA 2MA1A 4F92B 5KFIA 1NK5A 3FC4A 3RF9A 5KNIA 3OGUA 1N60A 4O3NA 3C2KA 4HYKA 4QZFA 1UT8A 1UEVA 7ICJA 2GA9D 2NRWA 2QB1A 9ICIA 2E8OA 4KLUA 2ZIXB 3T5KA 2Y1IA 1SZPA 4I2IA 4YN4A 2KJ5A 1U9LA 3KZIU 5ALGA 1BGXT 5G5HA 4GC7A 3I28A 1LB2B 1XC9A 2Y0SC 4IQTA 2WF8A 5HRKA 3OVAA 2LYAA 5B66U 2EZXA 3PR5B 3SMVA 2ZJ8A 2YB1A 3ISDA 8ICNA 2BKEA 4ECQA 3LWMA 2WF7A 4ATBB 4R64A 4UB6U 4C8LA 4I2HA 1MN8A 1CRXA 2F8KA 1ZQUA 4WC4A 4MF8A 5CHEA 1S9FA 3KTQA 2ZHBA 4YMNA 4FO1A 2P35A 3QUBA 3TACB 4OO1J 4M6WB 2A1JB 2EWRA 2G08A 2K4HA 2WTFA 4KLFA 3AEVA 5KG6A 2WF6A 2BPFA 5AK4A 2Q66A 3LDAA 4J9KA 2DQNB 2OWOA 1KN5A 4ECSA 1UA1A 3UPSA 1DXSA 1OU5A 3PW5A 4UAWA 2HMXA 4M9NA 4ECYA 2PFOA 2AGQA 3RH5A 5J2EA 2I6XA 2IUBA 4KN4A 3E58A 4I2EA 1YLQA 5AI4A 4QNLA 3QZ7A 5J29A 5KFAA 4NKUA 2AQ4A 3RFAA 3AQKA 3TFSA 3JPRA 2HI0A 1J97A 3HKZC 3PW2A 1MQ3A 1NNLA 2D8CA 4F5OA 3SEIA 4F3OA 1U48A 2PFPA 3NYBA 1WCLA 4CDGA 5F9NA 2AGPA 1S5LU 4O3RA 3H8JA 4OCZA 4O67A 3ZDDA 2WHEA 1T3NA 4PH5A 5AI9A 8ICLA 3UMBA 3D2QA 4X4UA 1TK5A 2YQEA 5KT2A 4EENA 2B56A 2MUTA 4RWQA 5ALIA 4GXJA 4CGZA 1L3SA 1ZQFA 1L7OA 5HRFA 3ZD8A 4JV2A 4EBKA 5J2FA 4O5EA 4Y2UA 1BPBA 2G5HB 2NRTA 2XGQA 4F50A 3QUCA 4NXZA 4Y2QA 2AQ0A 5KFMA 3WU2U 1A77A 3AN1A 4DSLA 5KL1B 4DOAA 4DLGA 4C4TA 5AM2A 1UEUA 2HW3A 2JMGA 2VJ4A 1TV9A 5HRHA 4BWMA 4RZRA 4C4SA 3AUOA 4RQ2A 4S3NA 4OJOA 4R8UA 2YTUA 4KITB 9ICTA 4U7CA 3RJIA 2ZUDA 5J2AA 3ORYA 5KFLA 3NTUA 4K4GA 3V7JA 3ZDBA 4MFCA 3M7DA 4X4QA 2ZIXA 4KLHA 3RJFA 4J9MA 2R8JA 3TAPA 1F44A 5KT5A 4PJ0U 3L5KA 4AP9A 4QZBA 4I0UA 2ALZA 4RUAA 3RB4A 4DOBA 4Y2JA 3Q8RB 5KFRA 2HHSA 3GFKB 4Y2TA 1Y88A 2ZG6A 2ZH4A 3BQ0A 2JRZA 2KFNA 8ICKA 1ZXIA 3WK9A 8ICFA 5L1JA 4DFKA 4UAUA 4C8MA 2JV3A 3C23A 4OAGA 4UARA 4ATBA 4EBEA 2PKEA 3K75D 1DK2A 5HRIA 2NO4A 5J2IA 3LK9A 1FFUA 9ICGA 5J2GA 4DQRA 2KTQA 5AM0A 4QZGA 4DQQA 3A0BU 5D4BA 2A1JA 3NKUA 1ZOLA 2DUYA 4EGWA 4DFDA 2HBMA 3OSNA 3H4DA 3OJSA 3L9DA 2HHUA 2CRXA 5D61A 3C28A 2LM1A 4PHPA 3HWTA 1RYSA 5KFBA 3NVOA 4UB2A 1S8OA 1UCVA 4J9RA 3ONNA 2BR0A 3QUQA 3V7KA 1COOA 2RDIA 1JQRA 1NK8A 2OHFA 4RQ3A 1SV0C 1ED1A 4B9MA 3HJEA 2L5YA 5J2KA 9ICJA 1RG6A 4DQPA 3C2MA 1B0XA 5DLGA 5DG9A 5HRBA 3WK7A 5D63A 1MIYA 4RNMA 1FIQA 4DL7A 4JWMA 5EE0A 2Q0ZX 5HMLA 8ICTA 1UA0A 5KFNA 4F4KA 1R8BA 3RRHA 4FO6A 4YVZA 4TUSA 7ICPA 5AHXA 2WAQC 3DDHA 3F2BA 3Q8PB 1D9FA 3E2EA 4PHAA 3IN5A 4KLOA 4IQUA 1ZD4A 1ZJMA 1O08A 4K99A 1PUZA 3QU2A 2ASJA 4DL3A 5J2BA 2KJ9A 3HP6A 3WKEA 5BPCA 1SWVA 5IILA 4BXOB 2M2TA 1NJZA 2W04A 1Z1BA 1IM4A 1RQLA 2CXYA 1V9PA 2W9AA 2XY6A 3SAHA 1TFYA 2EZYA 3QU5A 4QZIA 4IRCA 2HOFA 2ZXHA 1TKDA 3GV5B 5H2FU 2ZH2A 4Y2XA 4NM1A 1NKEA 1ZQYA 4OJ6A 4DO9A 4KLJA 2ZJ5A 2XI9A 4EX7A 4A8EA 1JALA 4LEWA 3PZPA 1JAJA 3JPNA 3KKAC 2JGAA 5J0TA 4WH5A 5DKWA 3TAQA 3CRXA 3H7IA 2E5SA 2UVUA 2KHQA 2W9CA 4ECUA 4CCHA 4ED2A 4ECTA 4DL2A 8ICRA 3OV7A 5AKYA 2BCRA 4Z6EA 8ICOA 4RWOA 5HRLA 2I1QA 3IV6A 4ELUA 4UD5A 3M9OB 1ZQRA 4MEYA 3ICXA 1UETA 2F2AB 1D8YA 2ZIUB 5AK6A 3K1RB 3C1ZA 3Q8LA 7ICNA 1N56A 5KFGA 1Q46A 3K4GA 2H3FA 1SL0A 1L7PA 1N63A 2K8AA 7ICHA 2FMQA 4GC6A 3MFIA 3OVSA 3N7PD 4RQ8A 4UB5A 4PZNA 4JLZA 1SWWA 3PMLA 1BVSA 1QCKA 4FHWA 4ECRA 5CHGA 1ZQ1C 3LYSA 3OUYB 4JV0A 5DQGA 2F76X 3KHLA 4UBCA 1JXLA 3IG5A 1SGGA 3QU4A 1SKWA 8ICCA 4PL2A 4ED3A 2FLLA 4K97A 3WFRE 4TQSA 1ZQEA 3NGDA 5GTHU 3MGIA 2PMZF 5KFWA 3JPOA 5J2HA 4YR3A 1C7YA 2IOFK 4FFDA 2E8NA 2N1RA 5J0OA 3PHZA 3SAFA 4US9A 5CA7A 4IRKA 2YMMA 4M0AA 3QU7A 1ZYQA 4YMOA 4WJ3B 9ICPA 4QWEA 5ALTA 2CPRA 4FHXA 2DKZA 3ZDEA 5AKLA 4CF5A 1BPZA 2JEJA 2BHNA 5AM1A 5KG2A 4NLBA 2H5XA 2OM6A 5DBAA 4EZ9A 3CNHA 2B51A 1NK4A 2W3RA 5AKEA 5HR7A 5KFDA 3T5JA 2JEFA 1NKCA 2HHPA 1ZQMA 1QLNA 3G6XA 8ICYA 1H38A 2K4EA 4K96A 5KFEA 2ODGA 5DDMA 4RQ5A 2OCEA 2IOFA 4K4IA 3RJGA 4BJQA 1V85A 5J8YA 3EUB2 2W11A 3D6JA 2V4RA 2DR5A 3RJJA 2DGZA 4M9GA 4KX3A 3NASA 1J2NA 1JRPA 4QZDA 3NWIA 4UBBA 2P6RA 4F4ZA 3JCFA 2KE7A 5J0RA 2UVRA 2V9WA 3UQ0A 5DQHA 3JZ0A 3KHGA 1PX5A 2B0CA 2JEIA 2JH7A 1ZQZA 3GIIA 1SKRA 3MGHA 2UVVA 4KLSA 1VFGA 4QZCA 1LKYB 4K8VA 4PGXA 3U26A 5AK3A 4YD1A 2FMSA 3G6YA 3MDAA 5AM5A 3N4MB 1X9MA 3KZXA 3CK6A 4KX5A 1XU4A 3TANA 4QZ8A 1QSYA 2KVSA 3EPGA 1S10A 1X66A 2GH1A 5ALSA 1L3TA 4NLZA 3M8RA 4NLGA 3T3FA 2VKQA 3QUTA 2HVHA 2RQ5A 3F5AA 3DV9A 1QTMA 1XNSA 3B0XA 2YN4A 2JEGA 4OAIZ 2NO5A 1X9XA 4F71A 3IDWA 3UQ2A 4DF8A 2IA6A 3WKBA 1ZQXA 4R65A 3RH4A 4KLQA 2VJ5A 4I2JA 3IRUA 2ZIUA 2F8LA 1Q79A 2IOHA 3E0FA 3GQCA 2MAXA 2MSNA 4I2BA 3EW9A 2LHTA 3BQ7A 5EWGA 1B22A 2VIXA 3NS1A 4DOCA 4DL5A 4MKPA 3C5FA 3M6KA 1NOMA 1UHUA 1Z4OA 1ZQOA 4O68A 4YXJA 5KFKA 3N97B 2KSOB 1VJ5A 2K89A 1COKA 4C8KA 4QWAA 3H37A 1L7NA 4TUPA 4DQSA 2M2VA 3UXNA 5TZVA 1ZQLA 3RJKA 3TARA 3OUYA 5AIAA 1XS9D 2PBEA 4WCWA 4C80A 1BPDA 2KKPA 1TAMA 2KD1A 1IXRA 2OYYA 9ICNA 5HMMA 5EWFA 4NY8A 3LQCB 2RLTA 4XRHA 3MBYA 1NZBA 4PGQA 2D6FC 1JMSA 5AI5A 2DF4B 2HHQA 3PX6A 1TE2A 2M9NA 4RQ4A 2BPCA 3KHRA 3M8SA 1NK6A 2NV3A 4NM2A 3UM9A 4E7XA 1SIJA 9ICLA 5HR6A 3QEAZ 4O5KA 2GO7A 7ICQA 3C66A 3BQ1A 3NRZA 1OXJA 3PW0A 3L3FX 3ZDAA 5CB1A 4EELA 2R8HA 8ICVA 4WQLA 1ZQCA 1O03A 1S76D 5AKKA 4DLEA 2K8BB 2AHOB 4PPXA 2RDJA 5DG7A 5J2JA 3FM9A 4FH3A 3AQEA 3N28A 5L1LA 1WOTA 3H8WA 1NK7A 5AKXA 3RB0A 5KTQA 1HUZA 2KMDA 3NUQA 1JX4A 2HCFA 1SXDA 5IIJA 3C5GA 4Q8FA 4QWDA 1D8BA 4Q8EA 4I28A 3AM9A 2QB0A 5G5GA 4XQ7A 1Z00B 5KT6A 3HJ1A 3PV8A 3EWAA 4OAFA 3UXOA 1IIPA 3NVYA 3LVWA 4O3PA 3T79A 1DRGA 2KICA 4Z6CA 3PX4A 1ZQAA 2GWSA 3HIYA 4FBUA 1BPYA 8ICIA 4NLNA 3RR7A 4ACOA 2BBJA 2WF9A 3HILA 2H3QA 2LYHA 2FE9A 4FHPA 2B21A 4DS5A 4I2DA 3ER9B 1NZPA 3ER8C 8ICUA 1BPEA 1DOQA 2KEYA 3NVVA 2EANA 4FZLA 2XY7A 5AKZA 1LKYA 4Y2SA 2LKYA 3T5LA 1B43A 2DPIA 1U47A 4B9VA 3EF2A 5KL8B 3I76A 2XGPA 4J9NA 1MIVA 4KLTA 1JN3A 5CR0A 4ECXA 2IHOA 4QIWF 2F1JA 1L5UA 3WK5A 9ICFA 4BUGA 8ICWA 1HIWA 2PFNA 2ZH9A 3UXPA 3AQNA 1UT5A 2JZBB 7ICOA 3A0HU 4C8OA 3PSIA 4KMOB 1RQNA 2IHNA 1TK8A 4EBCA 5ALNA 2QARB 5ALYA 5DDYA 2OXOA 2FPKA 4KLMA 2I5HA 2O1PA 2ZH6A 1R8CA 4YFKA 4YD2A 3ERCC 3EYZA 1GPJA 3BS5B 3IM1A 1FEZA 4ICAA 4QW8A 3NVZA 1M6YA 1U49A 3GV7B 4KLLA 5J2CA 1KTQA 3PMNA 3Q8MA 3OSPA 4IRDA 1X40A 4UB3A 5IIOA 4RQ1A 4WC6A 5EE1A 4IR9A 1F5AA 5KG5A 3ALRA 4M6WA 3LVVA 2BCQA 3C21A 3WFSC 4RNNA 1ZQJA 2Q4TA 1SL2A 2G0AA 2MU2A 2F1IA 4USAA 2PMZC 1OW5A 5AIBA 4K9BA 4DFPA 2K60A 3S6JA 4O0IA 2F1HA 5A0LA 2W03A 4WC2A 3ZDCA 2BQ3A 1ZETA 2YX8A 2C22A 4J9LA 1PVPA 4IG8A 4B9NA 2JXJA 4AT8B 5KAFU 4EEDA 2ZH7A 4X4SA 5KFOA 2M2UA 1FA0A 1KSPA 1L7MA 5JRTA 4R63A 4Q43A 2DKXA 3KBBA 3Q8QB 5DB8A 4QZHA 4JMUA 1TVAA 3BQTA 4XA5A 5GTIU 5CP2A 3PO5A 3RB6A 2CN1A 4PHDA 1X2IA 3D2NA 4EYIB 3AQLA 8ICGA 5ALXA 4XJEA 7ICFA 1Z00A 3K7DA 4C7ZA 4I2FA 2ZIVB 5DECA 2FPLA 4M9LA 1SXEA 4CF4A 3OJUA 4LZGA 2C28A 1R89A 4MFFA 1LV5A 4YR0A 2ZTCA 4K4HA 4OJLA 3CW2C 4UB1A 1KFSA 4U6PA 4RWNA 3WKAA 2W9BB 2ZH3A 3RTVA 2K4PA 3ZI4A 4UB8U 1RXVA 1L3UA 3QXGA 1XSPA 1Z3EB 1X9WA 5CFTA 4P0PB 3GIMA 1X9SA 4G9BA 1Z1VA 1SV0A 4X4RA 3UPQA 1TAUA 2XCAA 2F44A 2W3SA 4OD0A 1ZQHA 5ALDA 4QZAA 1QSSA 5KFSA 5AKGA 3B9JA 1CI4A 2ASDA 4G3IA 8ICQA 4DCCA 7ICUA 3C1YA 2C2RA 1URJA 1VJ7A 2DRBA 1YT3A 4PGYA 3TADC 1TAQA 9ICMA 3KD3A 3NRWA 3H40A 2EH9A 5AI0A 8ICXA 3JPQA 1CEZA 4Z6FA 3V7LA 5HRGA 4F2SA 2JZBA 2YMPA 2JH1A 4BX9C 4RPXA 2XICA 7ICVA 2O6KA 1C20A 4O69A 4I2CA 5DLFA 3MFHA 2D3DA 4UASA 4PHEA 2KK0A 3UMCA 4JK1A 2QARA 3ETLA 5E79U 5HHIA 1TK0A 4CF3A 4UB4A 1WG8A 5KT3A 3SV3A 2M2WA 3KOOA 5DGAA 5J0XA 2IMWP 3SI8A 5J0SA 2XY5A 1MSWD 2G06A 2DWQA 4Y2RA 3BS5A 1ZD3A 2KZ3A 4Q44A 2NRVA 2MRLA 2DR8A 4X4TA 4WC1A 3WKCA 7ICSA 1Q8KA 5DGBA 2ASLA 2KFZA 4O3MA 5IINA 3EZ5A 4F4YA 1N5XA 2EZZA 1L8LA 4F5NA 1Q78A 2IHMA 4QJFB 5HRDA 4RWPA 2W54A 9ICVA 2VA8A 2FMPA 1ZQBA 2DPJA 2C2EA 1YZ6A 1KW4A 4RQ7A 1XSLA 4EV6A 1XO0A 2ISPA 4NL9C 4YG2A 4R66A 4LJXA 5AI8A 2R8GA 1XWLA 2ZTDA 2LPEA 5ALLA 1ZQNA 3BZCA 2J6UA 4M5DA 4F5RA 1X6IA 3MR6A 2W43A 4FHVA 2PI4A 1OUQA 2HHWA 1QQ7A 4JUZA 2KJ8A 2FPMA 4UAZA 4OAHA 3JYYA 1IV8A 2KNJA 4F2RA 1S97A 2ZHAA 4FS1A 1XSNA 2ES6A 2VANA 5KAIU 1KRPA 5HR9A 5J0UA 2VA3A 2NRKA 2QLTA 2FCLA 2H3ZA 3CP8A 3L4PA 1HUOA 4YR2A 5EE9A 2BE3A 4RQMA 3JPSA 2ZIVA 1VLBA 2EDUA 4IR1A 2BBHA 2PFQA 5TISU 4BXOA 3J81j 1ZRNA 2WB1F 3EPIA 3M6ZA 2MUTB 3PSPA 1QQ5A 4NV0A 4DSJA 5HC9A 2W9BA 1T94A 5KFYA 2YY6A 2G5IB 4US8A 1Q3UA 2I9GA 4LEZA 4LZDA 1L8OA 4AYBF 5AM4A 4GXIA 4EBDA 4DEZA 2V4QA 2ZH8A 4K9AA 9ICKA 2BGWA 2RP5A 1A76A 2HDOA 8ICEA 1NJWA 1NO5A 4QIWC 4B9TA 2OH2A 3MABA 4TQRA 2Y1JA 2EQYA 2YMQA 5ALJA 4DSIA 1BNPA 4X5VA 5KFUA 1Z19A 4CNQA 1DK3A 4KLIA 5DQIA 4EEKA 2R18A 2UVWA 2BCVA 4WC5A 1TFRA 5CFSA 3QZ8A 5AM3A 3HJ4A 1WWUA 2KIWA 1ZQIA 1JUDA 1P7DA 4KLGA 4MHVA 1S0NA 4R8UB 4ZH4A 4YQWA 2GLEA 5AKHA 1BPXA 2HBKA 4WC0A 3GILA 4NLKA 4P2HA 2E3TA 1V97A 3QE9Y 1YZ7A 3H8MA 1ZQDA 1DGSA 4QZ9A 1K5OA 1JIHA 1SZHA 1UPHA 2AH5A 2DL0A 4HAIA 4C7YA 4IL6U 4NJ8A 5L1MA 4RT2A 4ECWA 3V6HA 4KN7A 7ICKA 4C8NA 2FDRA 5L1KA 4TURA 5BOLA 4GFJA 5DG8A 4XQ8A 2HN2A 7ICIA 1NJXA 3NVWA 2RFFA 4Z6DA 5KFFA 3RBDA 8ICPA 5BOMA 3V6KA 2G07A 3SZ2A 7ICTA 2ZUBA 2DR7A 2Y9TA 2ZUCA 5J0YA 2HVIA 3ETRA 4JV1A 5C0YA 2BPGA 4B9UA 2B4VA 3LWLA 1BNOA 2LMRA 2NRXA 9ICHA 4GXKA 1QSLA 5JU5A 1KDHA 5K4LA 3H8SA 3ZD9A 3HPOA 3HX0A 9ICQA 5HREA 2BDPA 1A6SA 3I1YA 2HBLA 1S0OA 2E8MA 5KT4A 2IBKA 5JTGA 3JPPA 1F0MA 1KFTA 4NLCA 5KFJA 4KLEA 9ICSA 2ID1A 3T5HA 3MCRA 3PSFA 5AI6A 3HW8A 2KP7A 3MR2A 3MDCA 1K1SA 1HEKA 2P66A 5IIMA 1CUKA 5KFVA 5KFXA 1V38A 4FHYA 4ELTA 1NJYA 1AQ6A 4IS7A 3MR5A 1V4AA 3PW4A 1Q3VA 1X6JA 5L1IA 2GOLA 1ZQWA 3WK4A 1PK3A 5F9LA 4KLDA 5L9XA 4KB6A 3IHQB 3C2LA 4ED0A 2ISOA 4RT3A 7ICMA 1KL9A 1DGJA 2KV2A 4MEXA 2DR9A 1PK1B 5ALEA 5JUMA 2ATLA 3AMZA 3N7RC 1PVRA 2ZIWB 3M1YA 4NWIA 1MC8A 5CJ7A 5B3QA 5ALOA 2HBJA 3SENA 5DB9A 4ED1A 3RAQA 5KT7A 3N7SC 2XCPA 3MR3A 5ALFA 4O3OA 4J03A 4M47A 3WFQE 4Y2YA 4N7RA 4JWNA 2HN1A 2KOBA 3DEEA 5KFPA 1T3QA 2WFAA 5J0WA 7ICRA 4I2AA 4JB3A 3PY8A 9ICWA 5KFQA 1K1QA 3WK8A 4DWIA 2ESEA 2LYBA 5EE3A 4WC3A 2Y9UA 4CRXA 4F4XA 3OHAA 5FP0A 3GDXA 1AROP 4F72A 3QU9A 5ALWA 2KIVA 3RR8A 4O3SA 4GIBA 1FO4A 3GV8B 1A0PA 3F5EA 4X4OA 2KKVA 4ZOHC 4IC9A 3H38A 3PW7A 4WQKA 4RU9A 2A19A 2A1AA 2K8CB 5CWRA 1N62A 1EXNA 3QNMA 2PXIA 4O3QA 2W9MA 3PNCA 4YCXA 1L3VA 1KEJA 3RH6A 2KN7A 3BZKA 2DRAA 2OEHA 2AU0A 1GO3F 2W8LA 4EP7A 5T14A 4Y2PA 3ED5A 4PZOA 5DBCA 4B9SA 2FJ6A 5KFZA 2ZJAA 5ALQA 5KG3A 4DSEA 4KTQA 4QZEA 3H0MB 3Q8SB 2W9CB 2FLNA 1WYGA 5EOZA 5KFTA 4BDPA 3WFPA 3TFRA 4MF2A 2LBOA 4M2YA 2W7PA 4ELVA 5DB7A 1N48A 4IQVA 3BQ2A 1SKSA 4FH5A 5ALUA 4WOYA 2ZTEA 1MIWA 4WBYA 1ZD2P 2HSZA 4EEYA 3TKAA 4DSKA 3UMGA 3H0RB 2BQUA 3R9KA 3V72A 5DBBA 3FYHA 1WCNA 2KSOA 2Y0SF 4E0DA 5ALRA 4NXUA 1VDVA 3GZFA 1R8AA 4CE6A 3SQIA 3H4BA 4LEYA 4O6AA 2ZH1A 1B4FA 4UATA 3MC1A 5ALKA 8ICSA 5KFCA 4RPZA 5JTIA 3GIKA 3BDPA 4OJ5A 4GLXA 3THVA 3RAXA 1MA7A 1FFVA 4HX0A 4DQIA 4DFJA 3IG8A 3GIJA 4M9HA 4O5CA 1N2XA 4Y2VA 4O9MA 8ICJA 5AKIA 1U4BA 5AK5A 2LM4A 3WK6A 4JLXA 1RXWA 2KG5A 3K1ZA 2BCSA 3RRGA 3OHBA 2H3VA 1S0MA 4AT7B 4DL4A 3B0YA 8ICAA 1KNYA 3AU6A 2R8IA 4PL1A 3FDSA 1SL1A 3SAGA 3RJHA 1ZRMA 4WBZA 2YB4A 3SV4A 3WFOA 3F2CA 4C4RA 3AQFA 3F53A 3F2DA 4NXTA 4UAYA 1NI3A 5D49A 4NXXA 3OVBA 1T7PA 3AQMA 2NRZA 1RDFA 8ICHA 5F3XB 7ICLA 3RB3A 2Z7JA 3TQ1A 1LVHA 2AXTU 5CEHA 4F4WA 4EX6A 5B3PA 4J9SA 2YMLA 3RBEA 2FLPA 1PK1A 1JXEA 9ICXA 1ECWA 4F5PA 3SR6A 4KMUA 2JHDA 3HKZF 2C2DA 2ZIWA 4NKTA 3OWGA 4DL6A 2BQRA 4FZNA 3HT3A 3H39A 4UD4A 2WB1C 3KHHA 4YP3A 2KZZA 3FAHA 4RUCA 1S0VA 4X0AA 2P6UA 4BWJA 3G6VA 3VCBA 1ZQPA 3BJYA 4AYBC 5ALVA 2AJQA 4UQGA 5KFHA 8ICBA 2B6GA 9ICEA 4ED8A 3QX7A 4I27A 4F5QA 5HP4A 4NXWA 3AU2A 1N61A 4Q45A 1RM6C 3PO4A 2XO7A 2PI5A 4UAVA 2HOIA 1S77D 4P0QB 2A3VA 1KLNA 3SD7A 2RHFA 4AT9B 1PZNA 5ALZA 1PVQA 2ZH5A 1Z4NA 4X4PA 4FBTA 1UQVA 4J9QA 4FE3A 8ICMA 4QWCA 4RQ0A 1SV4A 3OPXA 4KM5A 5AICA 1ZD5A 4MFAA 3PVXA 5CRXA 2W8KA 5F2VO 4IQWA 5KG0A 1MQ2A 2XVTA 3VC8A 1D9DA 3PSTA 2EAMA 1KKXA 3H0LB 3ISCA 4C0ZA 4EYHB 4F93B 2JR5A 1RYUA 4QWBA 2W7OA 2FI1A 9ICOA 4J9PA 1JROA 2DFLA 4X4VA 8ICZA 2J6TA 1J2MA 5B5EU 2KZMA 5HNKA 1N5WA 1ZQTA 4I2GA 2AGOA 3SYZA 5J0QA 1ZQKA 3GU3A 2E1EA 4E8FA 2J6SA 4F91B 4FZMA 4M9JA 4TUQA 5EWEA 3M9NB 4EEBA 4F8RA 4I29A 3C18A 4P4MA 2E1FA 3IP4B 4RPYA 4YXMA 2VA2A 3V6JA 3KKAA 4J9OA 2BDUA 4M04A 3TADA 2QKQA 9ICRA 5IIIA 5J0PA 2RRDA 1KFDA 2EAPA 3TI0A 1F5SA 1XO1A 5ALPA 4YMMA 4FS2A 1WUDA
chains in the Genus database with same CATH topology
4P4PA 4WC0A 4I2DA 5DLGA 4LT6A 1T8EA 3GILA 5DG9A 4NLKA 4P2HA 2M2VA 5HRBA 4X0BA 1NZPA 8ICUA 1BPEA 1DOQA 2HHVA 1MIYA 4RNMA 3QE9Y 4DL7A 4JWMA 1T4GA 4LVSA 2HHTA 1ZQDA 2XY7A 1DGSA 4QZ9A 5KG1A 4ED6A 3T5LA 2Q0ZX 1JIHA 4EZ6A 1HJPA 5HMLA 8ICTA 1UA0A 5KFNA 1B43A 4F4KA 1R8BA 2DPIA 3RRHA 1U47A 4WC7A 4FO6A 4E80A 4EBJA 5IIKA 5HHHA 4B9VA 4AT8A 4YVZA 3RJEA 4TUSA 2XGPA 4J9NA 4DFMA 7ICTA 4RT2A 4ECWA 7ICPA 3V6HA 4KN7A 7ICKA 4C8NA 4AT7A 3Q8PB 5L1KA 1NK9A 4TURA 1JN3A 5CR0A 4ECXA 4KLTA 1MIVA 5BOLA 1D9FA 1ZQQA 4PHAA 2F1JA 4XQ8A 5DG8A 1L5UA 1NJXA 7ICIA 3E2EA 4KLOA 4X4NA 9ICFA 4IQUA 7ICGA 2RFFA 4Z6DA 5KFFA 4RNOA 3RBDA 5BOMA 3V6KA 1ZJMA 2ASJA 8ICPA 4DL3A 5J2BA 4RQ6A 3HP6A 3SZ2A 1BPXA 8ICWA 2XC9A 2ZUBA 5BPCA 5J0YA 2ZUCA 4DS4A 3UXPA 5IILA 2PFNA 4BXOB 2M2TA 3AQNA 2HVIA 4JV1A 1RPLA 1UT5A 1NJZA 2JZBB 3Q8KA 2BPGA 4B9UA 7ICOA 1IM4A 3LWLA 1ZQSA 1ZJNA 1BNOA 2NRXA 9ICHA 1V9PA 2W9AA 4GXKA 2XY6A 4C8OA 1RZTA 1QSLA 1KDHA 5C5JA 3H8SA 3ZD9A 3HPOA 3HX0A 9ICQA 3PX0A 5HREA 2IHNA 7ICEA 1TK8A 4EBCA 5D46A 4QZIA 2BDPA 4B9LA 1TFYA 5DDYA 4IRCA 2FPKA 4QW9A 1S0OA 4KLMA 4DSFA 1TKDA 1RYRA 5KT4A 3GV5B 2IBKA 2O1PA 2ZH6A 1R8CA 3JPPA 4YFKA 1KFTA 5KFJA 2ZH2A 3JPTA 4KLEA 9ICSA 9ICUA 4NM1A 2HHXA 4YD2A 2ID1A 3T5HA 1NKEA 1ZQYA 3EYZA 4DO9A 3HW8A 4KLJA 2ZJ5A 2KP7A 3MR2A 5KG7A 3MDCA 1K1SA 3IM1A 4ECVA 2DR7A 2P66A 2DVIA 4BGDA 3PR4A 1ZQGA 1JAJA 3JPNA 5IIMA 4QW8A 3QEBZ 1CUKA 1U49A 5J0TA 5KFVA 5KFXA 2O5AA 1ZQVA 5DKWA 4FHYA 3TAQA 5DEDA 3H7IA 3GV7B 2UVUA 4ECUA 2W9CA 4KLLA 4ELTA 1NJYA 4CCHA 5J2CA 1KTQA 3PMNA 4ED2A 3Q8MA 4ECTA 4DL2A 8ICRA 4XUSA 3MR5A 3OSPA 9ICBA 3OV7A 2BCRA 4Z6EA 3ISBA 8ICOA 1V4AA 3PW4A 4IRDA 4RWOA 1D8LA 4UB3A 5IIOA 4RQ1A 5HRLA 4WC6A 2I1QA 4DF4A 5DB6A 4ELUA 4IR9A 1F5AA 5KG5A 5L1IA 4M6WA 4P4OA 3M9MB 4ECZA 4UD5A 3M9OB 3C21A 2BCQA 1ZQWA 4KLDA 5F9LA 3WFSC 4RNNA 1ZQJA 1ZQRA 4MEYA 5L9XA 1SL2A 2R8KA 3IHQB 3C2LA 4ED0A 1TFWA 2F1IA 4RT3A 2ISOA 7ICMA 1U45A 4ED7A 1UETA 4MEXA 2DR9A 1NKBA 1D8YA 5JUMA 5KG4A 2ATLA 4AT9A 4DFPA 3C1ZA 3Q8LA 4O0IA 7ICNA 2F1HA 1NK0A 4WC2A 2BCUA 1N56A 3ZDCA 2BQ3A 9ICCA 5KFGA 1ZETA 3K4GA 9ICAA 2C22A 4J9LA 4IG8A 1MC8A 5CJ7A 1SL0A 4B9NA 5J2DA 4AT8B 7ICHA 5DB9A 3H3AA 2FMQA 4ED1A 3RAQA 5KT7A 2ZH7A 2XCPA 4GC6A 4F92B 3MR3A 4O3OA 3MFIA 4FHPA 4X4SA 3OVSA 5KFIA 5KFOA 4RQ8A 4M47A 2M2UA 4UB5A 1NK5A 3WFQE 1FA0A 1KSPA 4JWNA 3PMLA 4R63A 1BVSA 4Q43A 3OGUA 4O3NA 3Q8QB 4FHWA 4ECRA 5CHGA 5DB8A 3C2KA 4HYKA 4QZHA 5KFPA 4QZFA 1TVAA 1UT8A 5J0WA 1UEVA 7ICRA 4I2AA 3BQTA 7ICJA 3OUYB 4JV0A 5DQGA 3PY8A 9ICWA 2NRWA 3KHLA 4UBCA 1JXLA 4XA5A 9ICIA 5KFQA 1K1QA 4DWIA 4WC3A 4KLUA 5CP2A 3PO5A 3T5KA 2Y1IA 4F4XA 3OHAA 1SZPA 3GDXA 4I2IA 1SKWA 1AROP 4YN4A 8ICCA 3RB6A 3RR8A 4ED3A 2FLLA 4O3SA 1U9LA 3GV8B 4PHDA 4X4OA 1BGXT 1X2IA 4EYIB 4GC7A 3AQLA 3H38A 3PW7A 1LB2B 4RU9A 1XC9A 3WFRE 4IQTA 4TQSA 8ICGA 5CWRA 5HRKA 1ZQEA 3OVAA 3NGDA 7ICFA 1EXNA 3MGIA 2PXIA 4O3QA 2W9MA 3PR5B 1Z00A 5KFWA 3PNCA 2ZJ8A 3JPOA 4YCXA 5J2HA 1L3VA 4YR3A 1KEJA 1C7YA 2ZH9A 4I2FA 3RH6A 2KN7A 5J0OA 5DECA 2DRAA 2FPLA 4M9LA 3ISDA 2AU0A 5CA7A 2BKEA 2W8LA 4ECQA 8ICNA 4EP7A 3OJUA 5DBCA 3LWMA 4B9SA 4IRKA 4LZGA 2C28A 1R89A 4MFFA 1LV5A 4YR0A 2ZTCA 5KFZA 2ZJAA 4K4HA 4M0AA 4UB1A 1KFSA 1ZYQA 4YMOA 5KG3A 4R64A 4C8LA 4DSEA 9ICPA 4ATBB 4QWEA 4KTQA 4RWNA 4FHXA 4QZEA 3ZDEA 3Q8SB 2W9CB 2W9BB 2FLNA 4I2HA 3RTVA 2ZH3A 1ZQUA 4WC4A 4MF8A 1BPZA 1RXVA 1L3UA 2JEJA 2BHNA 1Z3EB 5EOZA 5KFTA 5KG2A 1XSPA 1X9WA 1S9FA 4BDPA 3KTQA 3TFRA 2H5XA 3GIMA 1X9SA 4MF2A 4M2YA 2ZHBA 4YMNA 4ELVA 5DBAA 5DB7A 1N48A 3UPQA 4EZ9A 4X4RA 1TAUA 4IQVA 1NK4A 3BQ2A 2XCAA 4M6WB 2A1JB 1SKSA 4FH5A 5KFDA 3T5JA 2JEFA 2ZTEA 1NKCA 1MIWA 2WTFA 4WBYA 1ZQHA 4DQIA 2HHPA 4QZAA 4EEYA 4DSKA 1QSSA 4KLFA 5KFSA 5KG6A 2BPFA 2ASDA 1ZQMA 1QLNA 2Q66A 3LDAA 3G6XA 4G3IA 8ICQA 4J9KA 7ICUA 8ICYA 2OWOA 3C1YA 2C2RA 1H38A 2BQUA 3V72A 1VJ7A 2DRBA 5DBBA 4ECSA 4PGYA 1UA1A 5KFEA 5DDMA 3FYHA 3UPSA 1TAQA 1WCNA 4RQ5A 1OU5A 9ICMA 4E0DA 3PW5A 4UAWA 4M9NA 4K4IA 4ECYA 3H40A 3RJGA 2PFOA 8ICXA 2AGQA 3JPQA 2V4RA 3RH5A 2DR5A 3RJJA 4M9GA 5J2EA 1CEZA 1R8AA 4KN4A 4Z6FA 3H4BA 3V7LA 4I2EA 1YLQA 2ZH1A 4QZDA 5HRGA 4UBBA 2P6RA 3QZ7A 4F4ZA 4F2SA 2JZBA 5J0RA 5J29A 2UVRA 5KFAA 2V9WA 8ICSA 3UQ0A 5DQHA 2AQ4A 3JZ0A 3KHGA 1PX5A 4NKUA 5KFCA 4RPZA 3AQKA 3GIKA 3TFSA 3BDPA 4GLXA 4RPXA 3JPRA 3THVA 3RAXA 2JEIA 7ICVA 4I2CA 1ZQZA 5DLFA 9ICEA 3MFHA 3GIIA 4PHEA 4DFJA 3MGHA 3PW2A 3GIJA 1SKRA 4QZCA 1MQ3A 2UVVA 4KLSA 1VFGA 4M9HA 4F5OA 4JK1A 4O5CA 3ETLA 5HHIA 4F3OA 1U48A 1TK0A 2PFPA 4O9MA 4UB4A 8ICJA 4PGXA 3NYBA 1WCLA 5KT3A 3SV3A 1U4BA 2M2WA 5F9NA 2AGPA 1RXWA 4O3RA 4YD1A 2FMSA 3G6YA 5DGAA 3H8JA 2BCSA 3MDAA 3N4MB 3RRGA 5J0XA 3OHBA 2IMWP 3ZDDA 3SI8A 5J0SA 4PH5A 1T3NA 1S0MA 4AT7B 2XY5A 1X9MA 1MSWD 8ICLA 4DL4A 3B0YA 8ICAA 1TK5A 1KNYA 4X4UA 3AU6A 1XU4A 2R8IA 3TANA 5KT2A 4QZ8A 1QSYA 2KZ3A 3FDSA 1SL1A 3RJHA 4Q44A 4WBZA 2NRVA 3EPGA 3SV4A 1S10A 3WFOA 2MUTA 4RWQA 2DR8A 4GXJA 1L3SA 1ZQFA 4X4TA 4WC1A 5HRFA 1L3TA 4NLZA 3ZD8A 3M8RA 7ICSA 5DGBA 4NLGA 4UAYA 3T3FA 2ASLA 2KFZA 5IINA 5D49A 2HVHA 3EZ5A 1QTMA 3OVBA 4JV2A 3B0XA 1T7PA 4EBKA 5J2FA 4F4YA 3AQMA 2NRZA 4F5NA 1Q78A 2JEGA 4O5EA 8ICHA 2IHMA 7ICLA 1BPBA 3RB3A 3TQ1A 5HRDA 4RWPA 2NRTA 2XGQA 3UQ2A 2IA6A 4DF8A 9ICVA 4F50A 1ZQXA 4F4WA 2VA8A 4J9SA 2FMPA 4NXZA 1ZQBA 3RBEA 2FLPA 2AQ0A 5KFMA 4R65A 1JXEA 3RH4A 2C2EA 2DPJA 1A77A 4I2JA 4KLQA 9ICXA 4RQ7A 4F5PA 1XSLA 4DSLA 1Q79A 4DOAA 4KMUA 3GQCA 2MAXA 4DLGA 4I2BA 2ISPA 2C2DA 4NKTA 1UEUA 3EW9A 4YG2A 4R66A 4DL6A 5EWGA 2BQRA 2R8GA 2HW3A 1XWLA 2ZTDA 3HT3A 1B22A 3H39A 4UD4A 3KHHA 4YP3A 4DOCA 1ZQNA 4DL5A 3C5FA 2KZZA 1NOMA 1TV9A 5HRHA 2J6UA 1ZQOA 4M5DA 4RUCA 4BWMA 4RZRA 4F5RA 2P6UA 1S0VA 4BWJA 3MR6A 3G6VA 4YXJA 4X0AA 5KFKA 3N97B 4FHVA 3AUOA 4RQ2A 4S3NA 1ZQPA 2PI4A 3BJYA 4R8UA 4C8KA 4QWAA 2AJQA 4UQGA 4KITB 5KFHA 3H37A 2HHWA 8ICBA 9ICTA 4TUPA 3RJIA 4DQSA 2ZUDA 5J2AA 3ORYA 5KFLA 3NTUA 3UXNA 5TZVA 3V7JA 4ED8A 1ZQLA 3TARA 3RJKA 3ZDBA 4I27A 4MFCA 4F5QA 5HP4A 3OUYA 3AU2A 1XS9D 4JUZA 4Q45A 2PBEA 2FPMA 4X4QA 4UAZA 4WCWA 1BPDA 3JYYA 4KLHA 3RJFA 4F2RA 3PO4A 2XO7A 1IXRA 4J9MA 2R8JA 3TAPA 2PI5A 1S97A 2ZHAA 5KT5A 4FS1A 1S77D 1XSNA 1KLNA 9ICNA 5HMMA 2VANA 5EWFA 4NY8A 1KRPA 5HR9A 3LQCB 5J0UA 4AT9B 4XRHA 4QZBA 3MBYA 1PZNA 2VA3A 2NRKA 4PGQA 2ALZA 1JMSA 4RUAA 3RB4A 2HHQA 3PX6A 2ZH5A 2M9NA 4RQ4A 4X4PA 2BPCA 4FBTA 3KHRA 3M8SA 4DOBA 1NK6A 3Q8RB 4NM2A 1HUOA 5KFRA 4YR2A 4E7XA 4J9QA 2HHSA 3GFKB 9ICLA 8ICMA 4QWCA 1Y88A 4RQ0A 3WFPA 2BE3A 3BQ0A 3QEAZ 2ZH4A 3JPSA 2KFNA 4O5KA 4K4GA 7ICQA 8ICKA 4MFAA 3PVXA 3C66A 2W8KA 4IR1A 5F2VO 8ICFA 3BQ1A 2PFQA 4IQWA 5KG0A 5L1JA 4BXOA 4DFKA 1MQ2A 4C8MA 3PW0A 3C23A 1D9DA 3ZDAA 5CB1A 3EPIA 2R8HA 8ICVA 4ATBA 4EBEA 2MUTB 1ZQCA 3K75D 4DSJA 1DK2A 5HC9A 2W9BA 1S76D 5KFYA 3ISCA 4DLEA 5HRIA 4PPXA 2RDJA 4F93B 3LK9A 5J2IA 4EYHB 5J2JA 4LZDA 5DG7A 2I9GA 9ICGA 4QWBA 5J2GA 4DQRA 2KTQA 9ICOA 4J9PA 4FH3A 4GXIA 2DFLA 4QZGA 5L1LA 1WOTA 4EBDA 4DEZA 3H8WA 1NK7A 4X4VA 4DQQA 3RB0A 2V4QA 2ZH8A 5KTQA 5D4BA 1HUZA 8ICZA 2A1JA 9ICKA 2BGWA 2J6TA 1JX4A 2KZMA 1A76A 8ICEA 3OSNA 5HNKA 3OJSA 3H4DA 1NJWA 2HHUA 1NO5A 3L9DA 1ZQTA 4B9TA 5IIJA 3C5GA 4I2GA 2AGOA 3MABA 4QWDA 3SYZA 4Q8FA 4Q8EA 5J0QA 4PHPA 3HWTA 1ZQKA 4I28A 4TQRA 2Y1JA 1RYSA 4XQ7A 5KFBA 4E8FA 1Z00B 4UB2A 2J6SA 4DSIA 4F91B 4J9RA 5KT6A 4M9JA 1BNPA 3PV8A 3HJ1A 3EWAA 2BR0A 4TUQA 3UXOA 5EWEA 4X5VA 4O3PA 3M9NB 5KFUA 4Z6CA 3PX4A 1ZQAA 3V7KA 4F8RA 4I29A 1DK3A 4KLIA 5DQIA 3C18A 2GWSA 1COOA 4P4MA 2RDIA 4RPYA 4YXMA 1NK8A 2UVWA 2BCVA 3V6JA 2VA2A 1JQRA 3HIYA 4WC5A 1TFRA 4J9OA 1BPYA 4FBUA 8ICIA 4NLNA 4RQ3A 3RR7A 3QZ8A 4M04A 3HJ4A 9ICRA 5IIIA 5J0PA 4B9MA 1ZQIA 1KFDA 4KLGA 5J2KA 2LYHA 9ICJA 3TI0A 1S0NA 4R8UB 4ZH4A 4YQWA 3C2MA 4DQPA 1XO1A 2B21A 4DS5A 4YMMA 4FS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4P A;  4WC0 A;  4I2D A;  5DLG A;  4LT6 A;  1T8E A;  3GIL A;  5DG9 A;  4NLK A;  4P2H A;  2M2V A;  5HRB A;  4X0B A;  1NZP A;  8ICU A;  1BPE A;  1DOQ A;  2HHV A;  1MIY A;  4RNM A;  3QE9 Y;  4DL7 A;  4JWM A;  1T4G A;  4LVS A;  2HHT A;  1ZQD A;  2XY7 A;  1DGS A;  4QZ9 A;  5KG1 A;  4ED6 A;  3T5L A;  2Q0Z X;  1JIH A;  4EZ6 A;  1HJP A;  5HML A;  8ICT A;  1UA0 A;  5KFN A;  1B43 A;  4F4K A;  1R8B A;  2DPI A;  3RRH A;  1U47 A;  4WC7 A;  4FO6 A;  4E80 A;  4EBJ A;  5IIK A;  5HHH A;  4B9V A;  4AT8 A;  4YVZ A;  3RJE A;  4TUS A;  2XGP A;  4J9N A;  4DFM A;  7ICT A;  4RT2 A;  4ECW A;  7ICP A;  3V6H A;  4KN7 A;  7ICK A;  4C8N A;  4AT7 A;  3Q8P B;  5L1K A;  1NK9 A;  4TUR A;  1JN3 A;  5CR0 A;  4ECX A;  4KLT A;  1MIV A;  5BOL A;  1D9F A;  1ZQQ A;  4PHA A;  2F1J A;  4XQ8 A;  5DG8 A;  1L5U A;  1NJX A;  7ICI A;  3E2E A;  4KLO A;  4X4N A;  9ICF A;  4IQU A;  7ICG A;  2RFF A;  4Z6D A;  5KFF A;  4RNO A;  3RBD A;  5BOM A;  3V6K A;  1ZJM A;  2ASJ A;  8ICP A;  4DL3 A;  5J2B A;  4RQ6 A;  3HP6 A;  3SZ2 A;  1BPX A;  8ICW A;  2XC9 A;  2ZUB A;  5BPC A;  5J0Y A;  2ZUC A;  4DS4 A;  3UXP A;  5IIL A;  2PFN A;  4BXO B;  2M2T A;  3AQN A;  2HVI A;  4JV1 A;  1RPL A;  1UT5 A;  1NJZ A;  2JZB B;  3Q8K A;  2BPG A;  4B9U A;  7ICO A;  1IM4 A;  3LWL A;  1ZQS A;  1ZJN A;  1BNO A;  2NRX A;  9ICH A;  1V9P A;  2W9A A;  4GXK A;  2XY6 A;  4C8O A;  1RZT A;  1QSL A;  1KDH A;  5C5J A;  3H8S A;  3ZD9 A;  3HPO A;  3HX0 A;  9ICQ A;  3PX0 A;  5HRE A;  2IHN A;  7ICE A;  1TK8 A;  4EBC A;  5D46 A;  4QZI A;  2BDP A;  4B9L A;  1TFY A;  5DDY A;  4IRC A;  2FPK A;  4QW9 A;  1S0O A;  4KLM A;  4DSF A;  1TKD A;  1RYR A;  5KT4 A;  3GV5 B;  2IBK A;  2O1P A;  2ZH6 A;  1R8C A;  3JPP A;  4YFK A;  1KFT A;  5KFJ A;  2ZH2 A;  3JPT A;  4KLE A;  9ICS A;  9ICU A;  4NM1 A;  2HHX A;  4YD2 A;  2ID1 A;  3T5H A;  1NKE A;  1ZQY A;  3EYZ A;  4DO9 A;  3HW8 A;  4KLJ A;  2ZJ5 A;  2KP7 A;  3MR2 A;  5KG7 A;  3MDC A;  1K1S A;  3IM1 A;  4ECV A;  2DR7 A;  2P66 A;  2DVI A;  4BGD A;  3PR4 A;  1ZQG A;  1JAJ A;  3JPN A;  5IIM A;  4QW8 A;  3QEB Z;  1CUK A;  1U49 A;  5J0T A;  5KFV A;  5KFX A;  2O5A A;  1ZQV A;  5DKW A;  4FHY A;  3TAQ A;  5DED A;  3H7I A;  3GV7 B;  2UVU A;  4ECU A;  2W9C A;  4KLL A;  4ELT A;  1NJY A;  4CCH A;  5J2C A;  1KTQ A;  3PMN A;  4ED2 A;  3Q8M A;  4ECT A;  4DL2 A;  8ICR A;  4XUS A;  3MR5 A;  3OSP A;  9ICB A;  3OV7 A;  2BCR A;  4Z6E A;  3ISB A;  8ICO A;  1V4A A;  3PW4 A;  4IRD A;  4RWO A;  1D8L A;  4UB3 A;  5IIO A;  4RQ1 A;  5HRL A;  4WC6 A;  2I1Q A;  4DF4 A;  5DB6 A;  4ELU A;  4IR9 A;  1F5A A;  5KG5 A;  5L1I A;  4M6W A;  4P4O A;  3M9M B;  4ECZ A;  4UD5 A;  3M9O B;  3C21 A;  2BCQ A;  1ZQW A;  4KLD A;  5F9L A;  3WFS C;  4RNN A;  1ZQJ A;  1ZQR A;  4MEY A;  5L9X A;  1SL2 A;  2R8K A;  3IHQ B;  3C2L A;  4ED0 A;  1TFW A;  2F1I A;  4RT3 A;  2ISO A;  7ICM A;  1U45 A;  4ED7 A;  1UET A;  4MEX A;  2DR9 A;  1NKB A;  1D8Y A;  5JUM A;  5KG4 A;  2ATL A;  4AT9 A;  4DFP A;  3C1Z A;  3Q8L A;  4O0I A;  7ICN A;  2F1H A;  1NK0 A;  4WC2 A;  2BCU A;  1N56 A;  3ZDC A;  2BQ3 A;  9ICC A;  5KFG A;  1ZET A;  3K4G A;  9ICA A;  2C22 A;  4J9L A;  4IG8 A;  1MC8 A;  5CJ7 A;  1SL0 A;  4B9N A;  5J2D A;  4AT8 B;  7ICH A;  5DB9 A;  3H3A A;  2FMQ A;  4ED1 A;  3RAQ A;  5KT7 A;  2ZH7 A;  2XCP A;  4GC6 A;  4F92 B;  3MR3 A;  4O3O A;  3MFI A;  4FHP A;  4X4S A;  3OVS A;  5KFI A;  5KFO A;  4RQ8 A;  4M47 A;  2M2U A;  4UB5 A;  1NK5 A;  3WFQ E;  1FA0 A;  1KSP A;  4JWN A;  3PML A;  4R63 A;  1BVS A;  4Q43 A;  3OGU A;  4O3N A;  3Q8Q B;  4FHW A;  4ECR A;  5CHG A;  5DB8 A;  3C2K A;  4HYK A;  4QZH A;  5KFP A;  4QZF A;  1TVA A;  1UT8 A;  5J0W A;  1UEV A;  7ICR A;  4I2A A;  3BQT A;  7ICJ A;  3OUY B;  4JV0 A;  5DQG A;  3PY8 A;  9ICW A;  2NRW A;  3KHL A;  4UBC A;  1JXL A;  4XA5 A;  9ICI A;  5KFQ A;  1K1Q A;  4DWI A;  4WC3 A;  4KLU A;  5CP2 A;  3PO5 A;  3T5K A;  2Y1I A;  4F4X A;  3OHA A;  1SZP A;  3GDX A;  4I2I A;  1SKW A;  1ARO P;  4YN4 A;  8ICC A;  3RB6 A;  3RR8 A;  4ED3 A;  2FLL A;  4O3S A;  1U9L A;  3GV8 B;  4PHD A;  4X4O A;  1BGX T;  1X2I A;  4EYI B;  4GC7 A;  3AQL A;  3H38 A;  3PW7 A;  1LB2 B;  4RU9 A;  1XC9 A;  3WFR E;  4IQT A;  4TQS A;  8ICG A;  5CWR A;  5HRK A;  1ZQE A;  3OVA A;  3NGD A;  7ICF A;  1EXN A;  3MGI A;  2PXI A;  4O3Q A;  2W9M A;  3PR5 B;  1Z00 A;  5KFW A;  3PNC A;  2ZJ8 A;  3JPO A;  4YCX A;  5J2H A;  1L3V A;  4YR3 A;  1KEJ A;  1C7Y A;  2ZH9 A;  4I2F A;  3RH6 A;  2KN7 A;  5J0O A;  5DEC A;  2DRA A;  2FPL A;  4M9L A;  3ISD A;  2AU0 A;  5CA7 A;  2BKE A;  2W8L A;  4ECQ A;  8ICN A;  4EP7 A;  3OJU A;  5DBC A;  3LWM A;  4B9S A;  4IRK A;  4LZG A;  2C28 A;  1R89 A;  4MFF A;  1LV5 A;  4YR0 A;  2ZTC A;  5KFZ A;  2ZJA A;  4K4H A;  4M0A A;  4UB1 A;  1KFS A;  1ZYQ A;  4YMO A;  5KG3 A;  4R64 A;  4C8L A;  4DSE A;  9ICP A;  4ATB B;  4QWE A;  4KTQ A;  4RWN A;  4FHX A;  4QZE A;  3ZDE A;  3Q8S B;  2W9C B;  2W9B B;  2FLN A;  4I2H A;  3RTV A;  2ZH3 A;  1ZQU A;  4WC4 A;  4MF8 A;  1BPZ A;  1RXV A;  1L3U A;  2JEJ A;  2BHN A;  1Z3E B;  5EOZ A;  5KFT A;  5KG2 A;  1XSP A;  1X9W A;  1S9F A;  4BDP A;  3KTQ A;  3TFR A;  2H5X A;  3GIM A;  1X9S A;  4MF2 A;  4M2Y A;  2ZHB A;  4YMN A;  4ELV A;  5DBA A;  5DB7 A;  1N48 A;  3UPQ A;  4EZ9 A;  4X4R A;  1TAU A;  4IQV A;  1NK4 A;  3BQ2 A;  2XCA A;  4M6W B;  2A1J B;  1SKS A;  4FH5 A;  5KFD A;  3T5J A;  2JEF A;  2ZTE A;  1NKC A;  1MIW A;  2WTF A;  4WBY A;  1ZQH A;  4DQI A;  2HHP A;  4QZA A;  4EEY A;  4DSK A;  1QSS A;  4KLF A;  5KFS A;  5KG6 A;  2BPF A;  2ASD A;  1ZQM A;  1QLN A;  2Q66 A;  3LDA A;  3G6X A;  4G3I A;  8ICQ A;  4J9K A;  7ICU A;  8ICY A;  2OWO A;  3C1Y A;  2C2R A;  1H38 A;  2BQU A;  3V72 A;  1VJ7 A;  2DRB A;  5DBB A;  4ECS A;  4PGY A;  1UA1 A;  5KFE A;  5DDM A;  3FYH A;  3UPS A;  1TAQ A;  1WCN A;  4RQ5 A;  1OU5 A;  9ICM A;  4E0D A;  3PW5 A;  4UAW A;  4M9N A;  4K4I A;  4ECY A;  3H40 A;  3RJG A;  2PFO A;  8ICX A;  2AGQ A;  3JPQ A;  2V4R A;  3RH5 A;  2DR5 A;  3RJJ A;  4M9G A;  5J2E A;  1CEZ A;  1R8A A;  4KN4 A;  4Z6F A;  3H4B A;  3V7L A;  4I2E A;  1YLQ A;  2ZH1 A;  4QZD A;  5HRG A;  4UBB A;  2P6R A;  3QZ7 A;  4F4Z A;  4F2S A;  2JZB A;  5J0R A;  5J29 A;  2UVR A;  5KFA A;  2V9W A;  8ICS A;  3UQ0 A;  5DQH A;  2AQ4 A;  3JZ0 A;  3KHG A;  1PX5 A;  4NKU A;  5KFC A;  4RPZ A;  3AQK A;  3GIK A;  3TFS A;  3BDP A;  4GLX A;  4RPX A;  3JPR A;  3THV A;  3RAX A;  2JEI A;  7ICV A;  4I2C A;  1ZQZ A;  5DLF A;  9ICE A;  3MFH A;  3GII A;  4PHE A;  4DFJ A;  3MGH A;  3PW2 A;  3GIJ A;  1SKR A;  4QZC A;  1MQ3 A;  2UVV A;  4KLS A;  1VFG A;  4M9H A;  4F5O A;  4JK1 A;  4O5C A;  3ETL A;  5HHI A;  4F3O A;  1U48 A;  1TK0 A;  2PFP A;  4O9M A;  4UB4 A;  8ICJ A;  4PGX A;  3NYB A;  1WCL A;  5KT3 A;  3SV3 A;  1U4B A;  2M2W A;  5F9N A;  2AGP A;  1RXW A;  4O3R A;  4YD1 A;  2FMS A;  3G6Y A;  5DGA A;  3H8J A;  2BCS A;  3MDA A;  3N4M B;  3RRG A;  5J0X A;  3OHB A;  2IMW P;  3ZDD A;  3SI8 A;  5J0S A;  4PH5 A;  1T3N A;  1S0M A;  4AT7 B;  2XY5 A;  1X9M A;  1MSW D;  8ICL A;  4DL4 A;  3B0Y A;  8ICA A;  1TK5 A;  1KNY A;  4X4U A;  3AU6 A;  1XU4 A;  2R8I A;  3TAN A;  5KT2 A;  4QZ8 A;  1QSY A;  2KZ3 A;  3FDS A;  1SL1 A;  3RJH A;  4Q44 A;  4WBZ A;  2NRV A;  3EPG A;  3SV4 A;  1S10 A;  3WFO A;  2MUT A;  4RWQ A;  2DR8 A;  4GXJ A;  1L3S A;  1ZQF A;  4X4T A;  4WC1 A;  5HRF A;  1L3T A;  4NLZ A;  3ZD8 A;  3M8R A;  7ICS A;  5DGB A;  4NLG A;  4UAY A;  3T3F A;  2ASL A;  2KFZ A;  5IIN A;  5D49 A;  2HVH A;  3EZ5 A;  1QTM A;  3OVB A;  4JV2 A;  3B0X A;  1T7P A;  4EBK A;  5J2F A;  4F4Y A;  3AQM A;  2NRZ A;  4F5N A;  1Q78 A;  2JEG A;  4O5E A;  8ICH A;  2IHM A;  7ICL A;  1BPB A;  3RB3 A;  3TQ1 A;  5HRD A;  4RWP A;  2NRT A;  2XGQ A;  3UQ2 A;  2IA6 A;  4DF8 A;  9ICV A;  4F50 A;  1ZQX A;  4F4W A;  2VA8 A;  4J9S A;  2FMP A;  4NXZ A;  1ZQB A;  3RBE A;  2FLP A;  2AQ0 A;  5KFM A;  4R65 A;  1JXE A;  3RH4 A;  2C2E A;  2DPJ A;  1A77 A;  4I2J A;  4KLQ A;  9ICX A;  4RQ7 A;  4F5P A;  1XSL A;  4DSL A;  1Q79 A;  4DOA A;  4KMU A;  3GQC A;  2MAX A;  4DLG A;  4I2B A;  2ISP A;  2C2D A;  4NKT A;  1UEU A;  3EW9 A;  4YG2 A;  4R66 A;  4DL6 A;  5EWG A;  2BQR A;  2R8G A;  2HW3 A;  1XWL A;  2ZTD A;  3HT3 A;  1B22 A;  3H39 A;  4UD4 A;  3KHH A;  4YP3 A;  4DOC A;  1ZQN A;  4DL5 A;  3C5F A;  2KZZ A;  1NOM A;  1TV9 A;  5HRH A;  2J6U A;  1ZQO A;  4M5D A;  4RUC A;  4BWM A;  4RZR A;  4F5R A;  2P6U A;  1S0V A;  4BWJ A;  3MR6 A;  3G6V A;  4YXJ A;  4X0A A;  5KFK A;  3N97 B;  4FHV A;  3AUO A;  4RQ2 A;  4S3N A;  1ZQP A;  2PI4 A;  3BJY A;  4R8U A;  4C8K A;  4QWA A;  2AJQ A;  4UQG A;  4KIT B;  5KFH A;  3H37 A;  2HHW A;  8ICB A;  9ICT A;  4TUP A;  3RJI A;  4DQS A;  2ZUD A;  5J2A A;  3ORY A;  5KFL A;  3NTU A;  3UXN A;  5TZV A;  3V7J A;  4ED8 A;  1ZQL A;  3TAR A;  3RJK A;  3ZDB A;  4I27 A;  4MFC A;  4F5Q A;  5HP4 A;  3OUY A;  3AU2 A;  1XS9 D;  4JUZ A;  4Q45 A;  2PBE A;  2FPM A;  4X4Q A;  4UAZ A;  4WCW A;  1BPD A;  3JYY A;  4KLH A;  3RJF A;  4F2R A;  3PO4 A;  2XO7 A;  1IXR A;  4J9M A;  2R8J A;  3TAP A;  2PI5 A;  1S97 A;  2ZHA A;  5KT5 A;  4FS1 A;  1S77 D;  1XSN A;  1KLN A;  9ICN A;  5HMM A;  2VAN A;  5EWF A;  4NY8 A;  1KRP A;  5HR9 A;  3LQC B;  5J0U A;  4AT9 B;  4XRH A;  4QZB A;  3MBY A;  1PZN A;  2VA3 A;  2NRK A;  4PGQ A;  2ALZ A;  1JMS A;  4RUA A;  3RB4 A;  2HHQ A;  3PX6 A;  2ZH5 A;  2M9N A;  4RQ4 A;  4X4P A;  2BPC A;  4FBT A;  3KHR A;  3M8S A;  4DOB A;  1NK6 A;  3Q8R B;  4NM2 A;  1HUO A;  5KFR A;  4YR2 A;  4E7X A;  4J9Q A;  2HHS A;  3GFK B;  9ICL A;  8ICM A;  4QWC A;  1Y88 A;  4RQ0 A;  3WFP A;  2BE3 A;  3BQ0 A;  3QEA Z;  2ZH4 A;  3JPS A;  2KFN A;  4O5K A;  4K4G A;  7ICQ A;  8ICK A;  4MFA A;  3PVX A;  3C66 A;  2W8K A;  4IR1 A;  5F2V O;  8ICF A;  3BQ1 A;  2PFQ A;  4IQW A;  5KG0 A;  5L1J A;  4BXO A;  4DFK A;  1MQ2 A;  4C8M A;  3PW0 A;  3C23 A;  1D9D A;  3ZDA A;  5CB1 A;  3EPI A;  2R8H A;  8ICV A;  4ATB A;  4EBE A;  2MUT B;  1ZQC A;  3K75 D;  4DSJ A;  1DK2 A;  5HC9 A;  2W9B A;  1S76 D;  5KFY A;  3ISC A;  4DLE A;  5HRI A;  4PPX A;  2RDJ A;  4F93 B;  3LK9 A;  5J2I A;  4EYH B;  5J2J A;  4LZD A;  5DG7 A;  2I9G A;  9ICG A;  4QWB A;  5J2G A;  4DQR A;  2KTQ A;  9ICO A;  4J9P A;  4FH3 A;  4GXI A;  2DFL A;  4QZG A;  5L1L A;  1WOT A;  4EBD A;  4DEZ A;  3H8W A;  1NK7 A;  4X4V A;  4DQQ A;  3RB0 A;  2V4Q A;  2ZH8 A;  5KTQ A;  5D4B A;  1HUZ A;  8ICZ A;  2A1J A;  9ICK A;  2BGW A;  2J6T A;  1JX4 A;  2KZM A;  1A76 A;  8ICE A;  3OSN A;  5HNK A;  3OJS A;  3H4D A;  1NJW A;  2HHU A;  1NO5 A;  3L9D A;  1ZQT A;  4B9T A;  5IIJ A;  3C5G A;  4I2G A;  2AGO A;  3MAB A;  4QWD A;  3SYZ A;  4Q8F A;  4Q8E A;  5J0Q A;  4PHP A;  3HWT A;  1ZQK A;  4I28 A;  4TQR A;  2Y1J A;  1RYS A;  4XQ7 A;  5KFB A;  4E8F A;  1Z00 B;  4UB2 A;  2J6S A;  4DSI A;  4F91 B;  4J9R A;  5KT6 A;  4M9J A;  1BNP A;  3PV8 A;  3HJ1 A;  3EWA A;  2BR0 A;  4TUQ A;  3UXO A;  5EWE A;  4X5V A;  4O3P A;  3M9N B;  5KFU A;  4Z6C A;  3PX4 A;  1ZQA A;  3V7K A;  4F8R A;  4I29 A;  1DK3 A;  4KLI A;  5DQI A;  3C18 A;  2GWS A;  1COO A;  4P4M A;  2RDI A;  4RPY A;  4YXM A;  1NK8 A;  2UVW A;  2BCV A;  3V6J A;  2VA2 A;  1JQR A;  3HIY A;  4WC5 A;  1TFR A;  4J9O A;  1BPY A;  4FBU A;  8ICI A;  4NLN A;  4RQ3 A;  3RR7 A;  3QZ8 A;  4M04 A;  3HJ4 A;  9ICR A;  5III A;  5J0P A;  4B9M A;  1ZQI A;  1KFD A;  4KLG A;  5J2K A;  2LYH A;  9ICJ A;  3TI0 A;  1S0N A;  4R8U B;  4ZH4 A;  4YQW A;  3C2M A;  4DQP A;  1XO1 A;  2B21 A;  4DS5 A;  4YMM A;  4FS2 A; 
#chains in the Genus database with same CATH topology
 4P4P A;  4LT6 A;  1T8E A;  4X0B A;  2HHV A;  3MGV A;  1T4G A;  4LVS A;  2HHT A;  5KG1 A;  4ED6 A;  4NXV A;  1JI7 A;  4EZ6 A;  1HJP A;  1QH9 A;  2NYV A;  4WC7 A;  4E80 A;  4EBJ A;  5IIK A;  5HHH A;  4AT8 A;  3RJE A;  4DFM A;  5J8Y C;  2WF5 A;  1WWV A;  2E8P A;  1SB3 C;  4AT7 A;  1NK9 A;  3OTQ A;  1KBU A;  1ZQQ A;  1IG6 A;  4X4N A;  4LEV A;  2GAF D;  3C29 A;  7ICG A;  1L6N A;  2G09 A;  4RNO A;  3O0F A;  4RQ6 A;  2XC9 A;  2KHV A;  4DS4 A;  4RQN A;  3D2S A;  5AKJ A;  1RPL A;  3Q8K A;  4K98 A;  1ZQS A;  1ZJN A;  2XID A;  1RZT A;  5C5J A;  3AL0 B;  1KQQ A;  3PX0 A;  2F3N A;  1X42 A;  7ICE A;  5D46 A;  4B9L A;  4QW9 A;  4DSF A;  1RYR A;  5CFU A;  2BZF A;  3JPT A;  9ICU A;  2ZXI A;  2HHX A;  3QYP A;  4OJP A;  5KG7 A;  2QB0 B;  4ECV A;  2DVI A;  4BGD A;  3PR4 A;  1ZQG A;  3QEB Z;  4NL9 A;  2O5A A;  1ZQV A;  2F77 X;  3KFU F;  5DED A;  2WAQ F;  3HRD D;  5ALM A;  4UW9 A;  2HOQ A;  4XUS A;  9ICB A;  3ISB A;  2EAO A;  4P0P A;  1D8L A;  4DF4 A;  5DB6 A;  2W55 A;  2KVC A;  4P4O A;  2H3I A;  3M9M B;  4ECZ A;  2DBY A;  1QQ6 A;  2R8K A;  3BS7 A;  2LI6 A;  1TFW A;  2M0N A;  1U45 A;  4ED7 A;  4P0Q A;  1NKB A;  5KG4 A;  4AT9 A;  1NK0 A;  2BCU A;  2K4I A;  9ICC A;  3CYM A;  5ALH A;  9ICA A;  3WKD A;  5D62 A;  5J2D A;  3H3A A;  4B6J A;  2MA1 A;  4F92 B;  5KFI A;  1NK5 A;  3FC4 A;  3RF9 A;  5KNI A;  3OGU A;  1N60 A;  4O3N A;  3C2K A;  4HYK A;  4QZF A;  1UT8 A;  1UEV A;  7ICJ A;  2GA9 D;  2NRW A;  2QB1 A;  9ICI A;  2E8O A;  4KLU A;  2ZIX B;  3T5K A;  2Y1I A;  1SZP A;  4I2I A;  4YN4 A;  2KJ5 A;  1U9L A;  3KZI U;  5ALG A;  1BGX T;  5G5H A;  4GC7 A;  3I28 A;  1LB2 B;  1XC9 A;  2Y0S C;  4IQT A;  2WF8 A;  5HRK A;  3OVA A;  2LYA A;  5B66 U;  2EZX A;  3PR5 B;  3SMV A;  2ZJ8 A;  2YB1 A;  3ISD A;  8ICN A;  2BKE A;  4ECQ A;  3LWM A;  2WF7 A;  4ATB B;  4R64 A;  4UB6 U;  4C8L A;  4I2H A;  1MN8 A;  1CRX A;  2F8K A;  1ZQU A;  4WC4 A;  4MF8 A;  5CHE A;  1S9F A;  3KTQ A;  2ZHB A;  4YMN A;  4FO1 A;  2P35 A;  3QUB A;  3TAC B;  4OO1 J;  4M6W B;  2A1J B;  2EWR A;  2G08 A;  2K4H A;  2WTF A;  4KLF A;  3AEV A;  5KG6 A;  2WF6 A;  2BPF A;  5AK4 A;  2Q66 A;  3LDA A;  4J9K A;  2DQN B;  2OWO A;  1KN5 A;  4ECS A;  1UA1 A;  3UPS A;  1DXS A;  1OU5 A;  3PW5 A;  4UAW A;  2HMX A;  4M9N A;  4ECY A;  2PFO A;  2AGQ A;  3RH5 A;  5J2E A;  2I6X A;  2IUB A;  4KN4 A;  3E58 A;  4I2E A;  1YLQ A;  5AI4 A;  4QNL A;  3QZ7 A;  5J29 A;  5KFA A;  4NKU A;  2AQ4 A;  3RFA A;  3AQK A;  3TFS A;  3JPR A;  2HI0 A;  1J97 A;  3HKZ C;  3PW2 A;  1MQ3 A;  1NNL A;  2D8C A;  4F5O A;  3SEI A;  4F3O A;  1U48 A;  2PFP A;  3NYB A;  1WCL A;  4CDG A;  5F9N A;  2AGP A;  1S5L U;  4O3R A;  3H8J A;  4OCZ A;  4O67 A;  3ZDD A;  2WHE A;  1T3N A;  4PH5 A;  5AI9 A;  8ICL A;  3UMB A;  3D2Q A;  4X4U A;  1TK5 A;  2YQE A;  5KT2 A;  4EEN A;  2B56 A;  2MUT A;  4RWQ A;  5ALI A;  4GXJ A;  4CGZ A;  1L3S A;  1ZQF A;  1L7O A;  5HRF A;  3ZD8 A;  4JV2 A;  4EBK A;  5J2F A;  4O5E A;  4Y2U A;  1BPB A;  2G5H B;  2NRT A;  2XGQ A;  4F50 A;  3QUC A;  4NXZ A;  4Y2Q A;  2AQ0 A;  5KFM A;  3WU2 U;  1A77 A;  3AN1 A;  4DSL A;  5KL1 B;  4DOA A;  4DLG A;  4C4T A;  5AM2 A;  1UEU A;  2HW3 A;  2JMG A;  2VJ4 A;  1TV9 A;  5HRH A;  4BWM A;  4RZR A;  4C4S A;  3AUO A;  4RQ2 A;  4S3N A;  4OJO A;  4R8U A;  2YTU A;  4KIT B;  9ICT A;  4U7C A;  3RJI A;  2ZUD A;  5J2A A;  3ORY A;  5KFL A;  3NTU A;  4K4G A;  3V7J A;  3ZDB A;  4MFC A;  3M7D A;  4X4Q A;  2ZIX A;  4KLH A;  3RJF A;  4J9M A;  2R8J A;  3TAP A;  1F44 A;  5KT5 A;  4PJ0 U;  3L5K A;  4AP9 A;  4QZB A;  4I0U A;  2ALZ A;  4RUA A;  3RB4 A;  4DOB A;  4Y2J A;  3Q8R B;  5KFR A;  2HHS A;  3GFK B;  4Y2T A;  1Y88 A;  2ZG6 A;  2ZH4 A;  3BQ0 A;  2JRZ A;  2KFN A;  8ICK A;  1ZXI A;  3WK9 A;  8ICF A;  5L1J A;  4DFK A;  4UAU A;  4C8M A;  2JV3 A;  3C23 A;  4OAG A;  4UAR A;  4ATB A;  4EBE A;  2PKE A;  3K75 D;  1DK2 A;  5HRI A;  2NO4 A;  5J2I A;  3LK9 A;  1FFU A;  9ICG A;  5J2G A;  4DQR A;  2KTQ A;  5AM0 A;  4QZG A;  4DQQ A;  3A0B U;  5D4B A;  2A1J A;  3NKU A;  1ZOL A;  2DUY A;  4EGW A;  4DFD A;  2HBM A;  3OSN A;  3H4D A;  3OJS A;  3L9D A;  2HHU A;  2CRX A;  5D61 A;  3C28 A;  2LM1 A;  4PHP A;  3HWT A;  1RYS A;  5KFB A;  3NVO A;  4UB2 A;  1S8O A;  1UCV A;  4J9R A;  3ONN A;  2BR0 A;  3QUQ A;  3V7K A;  1COO A;  2RDI A;  1JQR A;  1NK8 A;  2OHF A;  4RQ3 A;  1SV0 C;  1ED1 A;  4B9M A;  3HJE A;  2L5Y A;  5J2K A;  9ICJ A;  1RG6 A;  4DQP A;  3C2M A;  1B0X A;  5DLG A;  5DG9 A;  5HRB A;  3WK7 A;  5D63 A;  1MIY A;  4RNM A;  1FIQ A;  4DL7 A;  4JWM A;  5EE0 A;  2Q0Z X;  5HML A;  8ICT A;  1UA0 A;  5KFN A;  4F4K A;  1R8B A;  3RRH A;  4FO6 A;  4YVZ A;  4TUS A;  7ICP A;  5AHX A;  2WAQ C;  3DDH A;  3F2B A;  3Q8P B;  1D9F A;  3E2E A;  4PHA A;  3IN5 A;  4KLO A;  4IQU A;  1ZD4 A;  1ZJM A;  1O08 A;  4K99 A;  1PUZ A;  3QU2 A;  2ASJ A;  4DL3 A;  5J2B A;  2KJ9 A;  3HP6 A;  3WKE A;  5BPC A;  1SWV A;  5IIL A;  4BXO B;  2M2T A;  1NJZ A;  2W04 A;  1Z1B A;  1IM4 A;  1RQL A;  2CXY A;  1V9P A;  2W9A A;  2XY6 A;  3SAH A;  1TFY A;  2EZY A;  3QU5 A;  4QZI A;  4IRC A;  2HOF A;  2ZXH A;  1TKD A;  3GV5 B;  5H2F U;  2ZH2 A;  4Y2X A;  4NM1 A;  1NKE A;  1ZQY A;  4OJ6 A;  4DO9 A;  4KLJ A;  2ZJ5 A;  2XI9 A;  4EX7 A;  4A8E A;  1JAL A;  4LEW A;  3PZP A;  1JAJ A;  3JPN A;  3KKA C;  2JGA A;  5J0T A;  4WH5 A;  5DKW A;  3TAQ A;  3CRX A;  3H7I A;  2E5S A;  2UVU A;  2KHQ A;  2W9C A;  4ECU A;  4CCH A;  4ED2 A;  4ECT A;  4DL2 A;  8ICR A;  3OV7 A;  5AKY A;  2BCR A;  4Z6E A;  8ICO A;  4RWO A;  5HRL A;  2I1Q A;  3IV6 A;  4ELU A;  4UD5 A;  3M9O B;  1ZQR A;  4MEY A;  3ICX A;  1UET A;  2F2A B;  1D8Y A;  2ZIU B;  5AK6 A;  3K1R B;  3C1Z A;  3Q8L A;  7ICN A;  1N56 A;  5KFG A;  1Q46 A;  3K4G A;  2H3F A;  1SL0 A;  1L7P A;  1N63 A;  2K8A A;  7ICH A;  2FMQ A;  4GC6 A;  3MFI A;  3OVS A;  3N7P D;  4RQ8 A;  4UB5 A;  4PZN A;  4JLZ A;  1SWW A;  3PML A;  1BVS A;  1QCK A;  4FHW A;  4ECR A;  5CHG A;  1ZQ1 C;  3LYS A;  3OUY B;  4JV0 A;  5DQG A;  2F76 X;  3KHL A;  4UBC A;  1JXL A;  3IG5 A;  1SGG A;  3QU4 A;  1SKW A;  8ICC A;  4PL2 A;  4ED3 A;  2FLL A;  4K97 A;  3WFR E;  4TQS A;  1ZQE A;  3NGD A;  5GTH U;  3MGI A;  2PMZ F;  5KFW A;  3JPO A;  5J2H A;  4YR3 A;  1C7Y A;  2IOF K;  4FFD A;  2E8N A;  2N1R A;  5J0O A;  3PHZ A;  3SAF A;  4US9 A;  5CA7 A;  4IRK A;  2YMM A;  4M0A A;  3QU7 A;  1ZYQ A;  4YMO A;  4WJ3 B;  9ICP A;  4QWE A;  5ALT A;  2CPR A;  4FHX A;  2DKZ A;  3ZDE A;  5AKL A;  4CF5 A;  1BPZ A;  2JEJ A;  2BHN A;  5AM1 A;  5KG2 A;  4NLB A;  2H5X A;  2OM6 A;  5DBA A;  4EZ9 A;  3CNH A;  2B51 A;  1NK4 A;  2W3R A;  5AKE A;  5HR7 A;  5KFD A;  3T5J A;  2JEF A;  1NKC A;  2HHP A;  1ZQM A;  1QLN A;  3G6X A;  8ICY A;  1H38 A;  2K4E A;  4K96 A;  5KFE A;  2ODG A;  5DDM A;  4RQ5 A;  2OCE A;  2IOF A;  4K4I A;  3RJG A;  4BJQ A;  1V85 A;  5J8Y A;  3EUB 2;  2W11 A;  3D6J A;  2V4R A;  2DR5 A;  3RJJ A;  2DGZ A;  4M9G A;  4KX3 A;  3NAS A;  1J2N A;  1JRP A;  4QZD A;  3NWI A;  4UBB A;  2P6R A;  4F4Z A;  3JCF A;  2KE7 A;  5J0R A;  2UVR A;  2V9W A;  3UQ0 A;  5DQH A;  3JZ0 A;  3KHG A;  1PX5 A;  2B0C A;  2JEI A;  2JH7 A;  1ZQZ A;  3GII A;  1SKR A;  3MGH A;  2UVV A;  4KLS A;  1VFG A;  4QZC A;  1LKY B;  4K8V A;  4PGX A;  3U26 A;  5AK3 A;  4YD1 A;  2FMS A;  3G6Y A;  3MDA A;  5AM5 A;  3N4M B;  1X9M A;  3KZX A;  3CK6 A;  4KX5 A;  1XU4 A;  3TAN A;  4QZ8 A;  1QSY A;  2KVS A;  3EPG A;  1S10 A;  1X66 A;  2GH1 A;  5ALS A;  1L3T A;  4NLZ A;  3M8R A;  4NLG A;  3T3F A;  2VKQ A;  3QUT A;  2HVH A;  2RQ5 A;  3F5A A;  3DV9 A;  1QTM A;  1XNS A;  3B0X A;  2YN4 A;  2JEG A;  4OAI Z;  2NO5 A;  1X9X A;  4F71 A;  3IDW A;  3UQ2 A;  4DF8 A;  2IA6 A;  3WKB A;  1ZQX A;  4R65 A;  3RH4 A;  4KLQ A;  2VJ5 A;  4I2J A;  3IRU A;  2ZIU A;  2F8L A;  1Q79 A;  2IOH A;  3E0F A;  3GQC A;  2MAX A;  2MSN A;  4I2B A;  3EW9 A;  2LHT A;  3BQ7 A;  5EWG A;  1B22 A;  2VIX A;  3NS1 A;  4DOC A;  4DL5 A;  4MKP A;  3C5F A;  3M6K A;  1NOM A;  1UHU A;  1Z4O A;  1ZQO A;  4O68 A;  4YXJ A;  5KFK A;  3N97 B;  2KSO B;  1VJ5 A;  2K89 A;  1COK A;  4C8K A;  4QWA A;  3H37 A;  1L7N A;  4TUP A;  4DQS A;  2M2V A;  3UXN A;  5TZV A;  1ZQL A;  3RJK A;  3TAR A;  3OUY A;  5AIA A;  1XS9 D;  2PBE A;  4WCW A;  4C80 A;  1BPD A;  2KKP A;  1TAM A;  2KD1 A;  1IXR A;  2OYY A;  9ICN A;  5HMM A;  5EWF A;  4NY8 A;  3LQC B;  2RLT A;  4XRH A;  3MBY A;  1NZB A;  4PGQ A;  2D6F C;  1JMS A;  5AI5 A;  2DF4 B;  2HHQ A;  3PX6 A;  1TE2 A;  2M9N A;  4RQ4 A;  2BPC A;  3KHR A;  3M8S A;  1NK6 A;  2NV3 A;  4NM2 A;  3UM9 A;  4E7X A;  1SIJ A;  9ICL A;  5HR6 A;  3QEA Z;  4O5K A;  2GO7 A;  7ICQ A;  3C66 A;  3BQ1 A;  3NRZ A;  1OXJ A;  3PW0 A;  3L3F X;  3ZDA A;  5CB1 A;  4EEL A;  2R8H A;  8ICV A;  4WQL A;  1ZQC A;  1O03 A;  1S76 D;  5AKK A;  4DLE A;  2K8B B;  2AHO B;  4PPX A;  2RDJ A;  5DG7 A;  5J2J A;  3FM9 A;  4FH3 A;  3AQE A;  3N28 A;  5L1L A;  1WOT A;  3H8W A;  1NK7 A;  5AKX A;  3RB0 A;  5KTQ A;  1HUZ A;  2KMD A;  3NUQ A;  1JX4 A;  2HCF A;  1SXD A;  5IIJ A;  3C5G A;  4Q8F A;  4QWD A;  1D8B A;  4Q8E A;  4I28 A;  3AM9 A;  2QB0 A;  5G5G A;  4XQ7 A;  1Z00 B;  5KT6 A;  3HJ1 A;  3PV8 A;  3EWA A;  4OAF A;  3UXO A;  1IIP A;  3NVY A;  3LVW A;  4O3P A;  3T79 A;  1DRG A;  2KIC A;  4Z6C A;  3PX4 A;  1ZQA A;  2GWS A;  3HIY A;  4FBU A;  1BPY A;  8ICI A;  4NLN A;  3RR7 A;  4ACO A;  2BBJ A;  2WF9 A;  3HIL A;  2H3Q A;  2LYH A;  2FE9 A;  4FHP A;  2B21 A;  4DS5 A;  4I2D A;  3ER9 B;  1NZP A;  3ER8 C;  8ICU A;  1BPE A;  1DOQ A;  2KEY A;  3NVV A;  2EAN A;  4FZL A;  2XY7 A;  5AKZ A;  1LKY A;  4Y2S A;  2LKY A;  3T5L A;  1B43 A;  2DPI A;  1U47 A;  4B9V A;  3EF2 A;  5KL8 B;  3I76 A;  2XGP A;  4J9N A;  1MIV A;  4KLT A;  1JN3 A;  5CR0 A;  4ECX A;  2IHO A;  4QIW F;  2F1J A;  1L5U A;  3WK5 A;  9ICF A;  4BUG A;  8ICW A;  1HIW A;  2PFN A;  2ZH9 A;  3UXP A;  3AQN A;  1UT5 A;  2JZB B;  7ICO A;  3A0H U;  4C8O A;  3PSI A;  4KMO B;  1RQN A;  2IHN A;  1TK8 A;  4EBC A;  5ALN A;  2QAR B;  5ALY A;  5DDY A;  2OXO A;  2FPK A;  4KLM A;  2I5H A;  2O1P A;  2ZH6 A;  1R8C A;  4YFK A;  4YD2 A;  3ERC C;  3EYZ A;  1GPJ A;  3BS5 B;  3IM1 A;  1FEZ A;  4ICA A;  4QW8 A;  3NVZ A;  1M6Y A;  1U49 A;  3GV7 B;  4KLL A;  5J2C A;  1KTQ A;  3PMN A;  3Q8M A;  3OSP A;  4IRD A;  1X40 A;  4UB3 A;  5IIO A;  4RQ1 A;  4WC6 A;  5EE1 A;  4IR9 A;  1F5A A;  5KG5 A;  3ALR A;  4M6W A;  3LVV A;  2BCQ A;  3C21 A;  3WFS C;  4RNN A;  1ZQJ A;  2Q4T A;  1SL2 A;  2G0A A;  2MU2 A;  2F1I A;  4USA A;  2PMZ C;  1OW5 A;  5AIB A;  4K9B A;  4DFP A;  2K60 A;  3S6J A;  4O0I A;  2F1H A;  5A0L A;  2W03 A;  4WC2 A;  3ZDC A;  2BQ3 A;  1ZET A;  2YX8 A;  2C22 A;  4J9L A;  1PVP A;  4IG8 A;  4B9N A;  2JXJ A;  4AT8 B;  5KAF U;  4EED A;  2ZH7 A;  4X4S A;  5KFO A;  2M2U A;  1FA0 A;  1KSP A;  1L7M A;  5JRT A;  4R63 A;  4Q43 A;  2DKX A;  3KBB A;  3Q8Q B;  5DB8 A;  4QZH A;  4JMU A;  1TVA A;  3BQT A;  4XA5 A;  5GTI U;  5CP2 A;  3PO5 A;  3RB6 A;  2CN1 A;  4PHD A;  1X2I A;  3D2N A;  4EYI B;  3AQL A;  8ICG A;  5ALX A;  4XJE A;  7ICF A;  1Z00 A;  3K7D A;  4C7Z A;  4I2F A;  2ZIV B;  5DEC A;  2FPL A;  4M9L A;  1SXE A;  4CF4 A;  3OJU A;  4LZG A;  2C28 A;  1R89 A;  4MFF A;  1LV5 A;  4YR0 A;  2ZTC A;  4K4H A;  4OJL A;  3CW2 C;  4UB1 A;  1KFS A;  4U6P A;  4RWN A;  3WKA A;  2W9B B;  2ZH3 A;  3RTV A;  2K4P A;  3ZI4 A;  4UB8 U;  1RXV A;  1L3U A;  3QXG A;  1XSP A;  1Z3E B;  1X9W A;  5CFT A;  4P0P B;  3GIM A;  1X9S A;  4G9B A;  1Z1V A;  1SV0 A;  4X4R A;  3UPQ A;  1TAU A;  2XCA A;  2F44 A;  2W3S A;  4OD0 A;  1ZQH A;  5ALD A;  4QZA A;  1QSS A;  5KFS A;  5AKG A;  3B9J A;  1CI4 A;  2ASD A;  4G3I A;  8ICQ A;  4DCC A;  7ICU A;  3C1Y A;  2C2R A;  1URJ A;  1VJ7 A;  2DRB A;  1YT3 A;  4PGY A;  3TAD C;  1TAQ A;  9ICM A;  3KD3 A;  3NRW A;  3H40 A;  2EH9 A;  5AI0 A;  8ICX A;  3JPQ A;  1CEZ A;  4Z6F A;  3V7L A;  5HRG A;  4F2S A;  2JZB A;  2YMP A;  2JH1 A;  4BX9 C;  4RPX A;  2XIC A;  7ICV A;  2O6K A;  1C20 A;  4O69 A;  4I2C A;  5DLF A;  3MFH A;  2D3D A;  4UAS A;  4PHE A;  2KK0 A;  3UMC A;  4JK1 A;  2QAR A;  3ETL A;  5E79 U;  5HHI A;  1TK0 A;  4CF3 A;  4UB4 A;  1WG8 A;  5KT3 A;  3SV3 A;  2M2W A;  3KOO A;  5DGA A;  5J0X A;  2IMW P;  3SI8 A;  5J0S A;  2XY5 A;  1MSW D;  2G06 A;  2DWQ A;  4Y2R A;  3BS5 A;  1ZD3 A;  2KZ3 A;  4Q44 A;  2NRV A;  2MRL A;  2DR8 A;  4X4T A;  4WC1 A;  3WKC A;  7ICS A;  1Q8K A;  5DGB A;  2ASL A;  2KFZ A;  4O3M A;  5IIN A;  3EZ5 A;  4F4Y A;  1N5X A;  2EZZ A;  1L8L A;  4F5N A;  1Q78 A;  2IHM A;  4QJF B;  5HRD A;  4RWP A;  2W54 A;  9ICV A;  2VA8 A;  2FMP A;  1ZQB A;  2DPJ A;  2C2E A;  1YZ6 A;  1KW4 A;  4RQ7 A;  1XSL A;  4EV6 A;  1XO0 A;  2ISP A;  4NL9 C;  4YG2 A;  4R66 A;  4LJX A;  5AI8 A;  2R8G A;  1XWL A;  2ZTD A;  2LPE A;  5ALL A;  1ZQN A;  3BZC A;  2J6U A;  4M5D A;  4F5R A;  1X6I A;  3MR6 A;  2W43 A;  4FHV A;  2PI4 A;  1OUQ A;  2HHW A;  1QQ7 A;  4JUZ A;  2KJ8 A;  2FPM A;  4UAZ A;  4OAH A;  3JYY A;  1IV8 A;  2KNJ A;  4F2R A;  1S97 A;  2ZHA A;  4FS1 A;  1XSN A;  2ES6 A;  2VAN A;  5KAI U;  1KRP A;  5HR9 A;  5J0U A;  2VA3 A;  2NRK A;  2QLT A;  2FCL A;  2H3Z A;  3CP8 A;  3L4P A;  1HUO A;  4YR2 A;  5EE9 A;  2BE3 A;  4RQM A;  3JPS A;  2ZIV A;  1VLB A;  2EDU A;  4IR1 A;  2BBH A;  2PFQ A;  5TIS U;  4BXO A;  3J81 j;  1ZRN A;  2WB1 F;  3EPI A;  3M6Z A;  2MUT B;  3PSP A;  1QQ5 A;  4NV0 A;  4DSJ A;  5HC9 A;  2W9B A;  1T94 A;  5KFY A;  2YY6 A;  2G5I B;  4US8 A;  1Q3U A;  2I9G A;  4LEZ A;  4LZD A;  1L8O A;  4AYB F;  5AM4 A;  4GXI A;  4EBD A;  4DEZ A;  2V4Q A;  2ZH8 A;  4K9A A;  9ICK A;  2BGW A;  2RP5 A;  1A76 A;  2HDO A;  8ICE A;  1NJW A;  1NO5 A;  4QIW C;  4B9T A;  2OH2 A;  3MAB A;  4TQR A;  2Y1J A;  2EQY A;  2YMQ A;  5ALJ A;  4DSI A;  1BNP A;  4X5V A;  5KFU A;  1Z19 A;  4CNQ A;  1DK3 A;  4KLI A;  5DQI A;  4EEK A;  2R18 A;  2UVW A;  2BCV A;  4WC5 A;  1TFR A;  5CFS A;  3QZ8 A;  5AM3 A;  3HJ4 A;  1WWU A;  2KIW A;  1ZQI A;  1JUD A;  1P7D A;  4KLG A;  4MHV A;  1S0N A;  4R8U B;  4ZH4 A;  4YQW A;  2GLE A;  5AKH A;  1BPX A;  2HBK A;  4WC0 A;  3GIL A;  4NLK A;  4P2H A;  2E3T A;  1V97 A;  3QE9 Y;  1YZ7 A;  3H8M A;  1ZQD A;  1DGS A;  4QZ9 A;  1K5O A;  1JIH A;  1SZH A;  1UPH A;  2AH5 A;  2DL0 A;  4HAI A;  4C7Y A;  4IL6 U;  4NJ8 A;  5L1M A;  4RT2 A;  4ECW A;  3V6H A;  4KN7 A;  7ICK A;  4C8N A;  2FDR A;  5L1K A;  4TUR A;  5BOL A;  4GFJ A;  5DG8 A;  4XQ8 A;  2HN2 A;  7ICI A;  1NJX A;  3NVW A;  2RFF A;  4Z6D A;  5KFF A;  3RBD A;  8ICP A;  5BOM A;  3V6K A;  2G07 A;  3SZ2 A;  7ICT A;  2ZUB A;  2DR7 A;  2Y9T A;  2ZUC A;  5J0Y A;  2HVI A;  3ETR A;  4JV1 A;  5C0Y A;  2BPG A;  4B9U A;  2B4V A;  3LWL A;  1BNO A;  2LMR A;  2NRX A;  9ICH A;  4GXK A;  1QSL A;  5JU5 A;  1KDH A;  5K4L A;  3H8S A;  3ZD9 A;  3HPO A;  3HX0 A;  9ICQ A;  5HRE A;  2BDP A;  1A6S A;  3I1Y A;  2HBL A;  1S0O A;  2E8M A;  5KT4 A;  2IBK A;  5JTG A;  3JPP A;  1F0M A;  1KFT A;  4NLC A;  5KFJ A;  4KLE A;  9ICS A;  2ID1 A;  3T5H A;  3MCR A;  3PSF A;  5AI6 A;  3HW8 A;  2KP7 A;  3MR2 A;  3MDC A;  1K1S A;  1HEK A;  2P66 A;  5IIM A;  1CUK A;  5KFV A;  5KFX A;  1V38 A;  4FHY A;  4ELT A;  1NJY A;  1AQ6 A;  4IS7 A;  3MR5 A;  1V4A A;  3PW4 A;  1Q3V A;  1X6J A;  5L1I A;  2GOL A;  1ZQW A;  3WK4 A;  1PK3 A;  5F9L A;  4KLD A;  5L9X A;  4KB6 A;  3IHQ B;  3C2L A;  4ED0 A;  2ISO A;  4RT3 A;  7ICM A;  1KL9 A;  1DGJ A;  2KV2 A;  4MEX A;  2DR9 A;  1PK1 B;  5ALE A;  5JUM A;  2ATL A;  3AMZ A;  3N7R C;  1PVR A;  2ZIW B;  3M1Y A;  4NWI A;  1MC8 A;  5CJ7 A;  5B3Q A;  5ALO A;  2HBJ A;  3SEN A;  5DB9 A;  4ED1 A;  3RAQ A;  5KT7 A;  3N7S C;  2XCP A;  3MR3 A;  5ALF A;  4O3O A;  4J03 A;  4M47 A;  3WFQ E;  4Y2Y A;  4N7R A;  4JWN A;  2HN1 A;  2KOB A;  3DEE A;  5KFP A;  1T3Q A;  2WFA A;  5J0W A;  7ICR A;  4I2A A;  4JB3 A;  3PY8 A;  9ICW A;  5KFQ A;  1K1Q A;  3WK8 A;  4DWI A;  2ESE A;  2LYB A;  5EE3 A;  4WC3 A;  2Y9U A;  4CRX A;  4F4X A;  3OHA A;  5FP0 A;  3GDX A;  1ARO P;  4F72 A;  3QU9 A;  5ALW A;  2KIV A;  3RR8 A;  4O3S A;  4GIB A;  1FO4 A;  3GV8 B;  1A0P A;  3F5E A;  4X4O A;  2KKV A;  4ZOH C;  4IC9 A;  3H38 A;  3PW7 A;  4WQK A;  4RU9 A;  2A19 A;  2A1A A;  2K8C B;  5CWR A;  1N62 A;  1EXN A;  3QNM A;  2PXI A;  4O3Q A;  2W9M A;  3PNC A;  4YCX A;  1L3V A;  1KEJ A;  3RH6 A;  2KN7 A;  3BZK A;  2DRA A;  2OEH A;  2AU0 A;  1GO3 F;  2W8L A;  4EP7 A;  5T14 A;  4Y2P A;  3ED5 A;  4PZO A;  5DBC A;  4B9S A;  2FJ6 A;  5KFZ A;  2ZJA A;  5ALQ A;  5KG3 A;  4DSE A;  4KTQ A;  4QZE A;  3H0M B;  3Q8S B;  2W9C B;  2FLN A;  1WYG A;  5EOZ A;  5KFT A;  4BDP A;  3WFP A;  3TFR A;  4MF2 A;  2LBO A;  4M2Y A;  2W7P A;  4ELV A;  5DB7 A;  1N48 A;  4IQV A;  3BQ2 A;  1SKS A;  4FH5 A;  5ALU A;  4WOY A;  2ZTE A;  1MIW A;  4WBY A;  1ZD2 P;  2HSZ A;  4EEY A;  3TKA A;  4DSK A;  3UMG A;  3H0R B;  2BQU A;  3R9K A;  3V72 A;  5DBB A;  3FYH A;  1WCN A;  2KSO A;  2Y0S F;  4E0D A;  5ALR A;  4NXU A;  1VDV A;  3GZF A;  1R8A A;  4CE6 A;  3SQI A;  3H4B A;  4LEY A;  4O6A A;  2ZH1 A;  1B4F A;  4UAT A;  3MC1 A;  5ALK A;  8ICS A;  5KFC A;  4RPZ A;  5JTI A;  3GIK A;  3BDP A;  4OJ5 A;  4GLX A;  3THV A;  3RAX A;  1MA7 A;  1FFV A;  4HX0 A;  4DQI A;  4DFJ A;  3IG8 A;  3GIJ A;  4M9H A;  4O5C A;  1N2X A;  4Y2V A;  4O9M A;  8ICJ A;  5AKI A;  1U4B A;  5AK5 A;  2LM4 A;  3WK6 A;  4JLX A;  1RXW A;  2KG5 A;  3K1Z A;  2BCS A;  3RRG A;  3OHB A;  2H3V A;  1S0M A;  4AT7 B;  4DL4 A;  3B0Y A;  8ICA A;  1KNY A;  3AU6 A;  2R8I A;  4PL1 A;  3FDS A;  1SL1 A;  3SAG A;  3RJH A;  1ZRM A;  4WBZ A;  2YB4 A;  3SV4 A;  3WFO A;  3F2C A;  4C4R A;  3AQF A;  3F53 A;  3F2D A;  4NXT A;  4UAY A;  1NI3 A;  5D49 A;  4NXX A;  3OVB A;  1T7P A;  3AQM A;  2NRZ A;  1RDF A;  8ICH A;  5F3X B;  7ICL A;  3RB3 A;  2Z7J A;  3TQ1 A;  1LVH A;  2AXT U;  5CEH A;  4F4W A;  4EX6 A;  5B3P A;  4J9S A;  2YML A;  3RBE A;  2FLP A;  1PK1 A;  1JXE A;  9ICX A;  1ECW A;  4F5P A;  3SR6 A;  4KMU A;  2JHD A;  3HKZ F;  2C2D A;  2ZIW A;  4NKT A;  3OWG A;  4DL6 A;  2BQR A;  4FZN A;  3HT3 A;  3H39 A;  4UD4 A;  2WB1 C;  3KHH A;  4YP3 A;  2KZZ A;  3FAH A;  4RUC A;  1S0V A;  4X0A A;  2P6U A;  4BWJ A;  3G6V A;  3VCB A;  1ZQP A;  3BJY A;  4AYB C;  5ALV A;  2AJQ A;  4UQG A;  5KFH A;  8ICB A;  2B6G A;  9ICE A;  4ED8 A;  3QX7 A;  4I27 A;  4F5Q A;  5HP4 A;  4NXW A;  3AU2 A;  1N61 A;  4Q45 A;  1RM6 C;  3PO4 A;  2XO7 A;  2PI5 A;  4UAV A;  2HOI A;  1S77 D;  4P0Q B;  2A3V A;  1KLN A;  3SD7 A;  2RHF A;  4AT9 B;  1PZN A;  5ALZ A;  1PVQ A;  2ZH5 A;  1Z4N A;  4X4P A;  4FBT A;  1UQV A;  4J9Q A;  4FE3 A;  8ICM A;  4QWC A;  4RQ0 A;  1SV4 A;  3OPX A;  4KM5 A;  5AIC A;  1ZD5 A;  4MFA A;  3PVX A;  5CRX A;  2W8K A;  5F2V O;  4IQW A;  5KG0 A;  1MQ2 A;  2XVT A;  3VC8 A;  1D9D A;  3PST A;  2EAM A;  1KKX A;  3H0L B;  3ISC A;  4C0Z A;  4EYH B;  4F93 B;  2JR5 A;  1RYU A;  4QWB A;  2W7O A;  2FI1 A;  9ICO A;  4J9P A;  1JRO A;  2DFL A;  4X4V A;  8ICZ A;  2J6T A;  1J2M A;  5B5E U;  2KZM A;  5HNK A;  1N5W A;  1ZQT A;  4I2G A;  2AGO A;  3SYZ A;  5J0Q A;  1ZQK A;  3GU3 A;  2E1E A;  4E8F A;  2J6S A;  4F91 B;  4FZM A;  4M9J A;  4TUQ A;  5EWE A;  3M9N B;  4EEB A;  4F8R A;  4I29 A;  3C18 A;  4P4M A;  2E1F A;  3IP4 B;  4RPY A;  4YXM A;  2VA2 A;  3V6J A;  3KKA A;  4J9O A;  2BDU A;  4M04 A;  3TAD A;  2QKQ A;  9ICR A;  5III A;  5J0P A;  2RRD A;  1KFD A;  2EAP A;  3TI0 A;  1F5S A;  1XO1 A;  5ALP A;  4YMM A;  4FS2 A;  1WUD A; 
#chains in the Genus database with same CATH homology
 4P4P A;  4WC0 A;  4I2D A;  5DLG A;  4LT6 A;  1T8E A;  3GIL A;  5DG9 A;  4NLK A;  4P2H A;  2M2V A;  5HRB A;  4X0B A;  1NZP A;  8ICU A;  1BPE A;  1DOQ A;  2HHV A;  1MIY A;  4RNM A;  3QE9 Y;  4DL7 A;  4JWM A;  1T4G A;  4LVS A;  2HHT A;  1ZQD A;  2XY7 A;  1DGS A;  4QZ9 A;  5KG1 A;  4ED6 A;  3T5L A;  2Q0Z X;  1JIH A;  4EZ6 A;  1HJP A;  5HML A;  8ICT A;  1UA0 A;  5KFN A;  1B43 A;  4F4K A;  1R8B A;  2DPI A;  3RRH A;  1U47 A;  4WC7 A;  4FO6 A;  4E80 A;  4EBJ A;  5IIK A;  5HHH A;  4B9V A;  4AT8 A;  4YVZ A;  3RJE A;  4TUS A;  2XGP A;  4J9N A;  4DFM A;  7ICT A;  4RT2 A;  4ECW A;  7ICP A;  3V6H A;  4KN7 A;  7ICK A;  4C8N A;  4AT7 A;  3Q8P B;  5L1K A;  1NK9 A;  4TUR A;  1JN3 A;  5CR0 A;  4ECX A;  4KLT A;  1MIV A;  5BOL A;  1D9F A;  1ZQQ A;  4PHA A;  2F1J A;  4XQ8 A;  5DG8 A;  1L5U A;  1NJX A;  7ICI A;  3E2E A;  4KLO A;  4X4N A;  9ICF A;  4IQU A;  7ICG A;  2RFF A;  4Z6D A;  5KFF A;  4RNO A;  3RBD A;  5BOM A;  3V6K A;  1ZJM A;  2ASJ A;  8ICP A;  4DL3 A;  5J2B A;  4RQ6 A;  3HP6 A;  3SZ2 A;  1BPX A;  8ICW A;  2XC9 A;  2ZUB A;  5BPC A;  5J0Y A;  2ZUC A;  4DS4 A;  3UXP A;  5IIL A;  2PFN A;  4BXO B;  2M2T A;  3AQN A;  2HVI A;  4JV1 A;  1RPL A;  1UT5 A;  1NJZ A;  2JZB B;  3Q8K A;  2BPG A;  4B9U A;  7ICO A;  1IM4 A;  3LWL A;  1ZQS A;  1ZJN A;  1BNO A;  2NRX A;  9ICH A;  1V9P A;  2W9A A;  4GXK A;  2XY6 A;  4C8O A;  1RZT A;  1QSL A;  1KDH A;  5C5J A;  3H8S A;  3ZD9 A;  3HPO A;  3HX0 A;  9ICQ A;  3PX0 A;  5HRE A;  2IHN A;  7ICE A;  1TK8 A;  4EBC A;  5D46 A;  4QZI A;  2BDP A;  4B9L A;  1TFY A;  5DDY A;  4IRC A;  2FPK A;  4QW9 A;  1S0O A;  4KLM A;  4DSF A;  1TKD A;  1RYR A;  5KT4 A;  3GV5 B;  2IBK A;  2O1P A;  2ZH6 A;  1R8C A;  3JPP A;  4YFK A;  1KFT A;  5KFJ A;  2ZH2 A;  3JPT A;  4KLE A;  9ICS A;  9ICU A;  4NM1 A;  2HHX A;  4YD2 A;  2ID1 A;  3T5H A;  1NKE A;  1ZQY A;  3EYZ A;  4DO9 A;  3HW8 A;  4KLJ A;  2ZJ5 A;  2KP7 A;  3MR2 A;  5KG7 A;  3MDC A;  1K1S A;  3IM1 A;  4ECV A;  2DR7 A;  2P66 A;  2DVI A;  4BGD A;  3PR4 A;  1ZQG A;  1JAJ A;  3JPN A;  5IIM A;  4QW8 A;  3QEB Z;  1CUK A;  1U49 A;  5J0T A;  5KFV A;  5KFX A;  2O5A A;  1ZQV A;  5DKW A;  4FHY A;  3TAQ A;  5DED A;  3H7I A;  3GV7 B;  2UVU A;  4ECU A;  2W9C A;  4KLL A;  4ELT A;  1NJY A;  4CCH A;  5J2C A;  1KTQ A;  3PMN A;  4ED2 A;  3Q8M A;  4ECT A;  4DL2 A;  8ICR A;  4XUS A;  3MR5 A;  3OSP A;  9ICB A;  3OV7 A;  2BCR A;  4Z6E A;  3ISB A;  8ICO A;  1V4A A;  3PW4 A;  4IRD A;  4RWO A;  1D8L A;  4UB3 A;  5IIO A;  4RQ1 A;  5HRL A;  4WC6 A;  2I1Q A;  4DF4 A;  5DB6 A;  4ELU A;  4IR9 A;  1F5A A;  5KG5 A;  5L1I A;  4M6W A;  4P4O A;  3M9M B;  4ECZ A;  4UD5 A;  3M9O B;  3C21 A;  2BCQ A;  1ZQW A;  4KLD A;  5F9L A;  3WFS C;  4RNN A;  1ZQJ A;  1ZQR A;  4MEY A;  5L9X A;  1SL2 A;  2R8K A;  3IHQ B;  3C2L A;  4ED0 A;  1TFW A;  2F1I A;  4RT3 A;  2ISO A;  7ICM A;  1U45 A;  4ED7 A;  1UET A;  4MEX A;  2DR9 A;  1NKB A;  1D8Y A;  5JUM A;  5KG4 A;  2ATL A;  4AT9 A;  4DFP A;  3C1Z A;  3Q8L A;  4O0I A;  7ICN A;  2F1H A;  1NK0 A;  4WC2 A;  2BCU A;  1N56 A;  3ZDC A;  2BQ3 A;  9ICC A;  5KFG A;  1ZET A;  3K4G A;  9ICA A;  2C22 A;  4J9L A;  4IG8 A;  1MC8 A;  5CJ7 A;  1SL0 A;  4B9N A;  5J2D A;  4AT8 B;  7ICH A;  5DB9 A;  3H3A A;  2FMQ A;  4ED1 A;  3RAQ A;  5KT7 A;  2ZH7 A;  2XCP A;  4GC6 A;  4F92 B;  3MR3 A;  4O3O A;  3MFI A;  4FHP A;  4X4S A;  3OVS A;  5KFI A;  5KFO A;  4RQ8 A;  4M47 A;  2M2U A;  4UB5 A;  1NK5 A;  3WFQ E;  1FA0 A;  1KSP A;  4JWN A;  3PML A;  4R63 A;  1BVS A;  4Q43 A;  3OGU A;  4O3N A;  3Q8Q B;  4FHW A;  4ECR A;  5CHG A;  5DB8 A;  3C2K A;  4HYK A;  4QZH A;  5KFP A;  4QZF A;  1TVA A;  1UT8 A;  5J0W A;  1UEV A;  7ICR A;  4I2A A;  3BQT A;  7ICJ A;  3OUY B;  4JV0 A;  5DQG A;  3PY8 A;  9ICW A;  2NRW A;  3KHL A;  4UBC A;  1JXL A;  4XA5 A;  9ICI A;  5KFQ A;  1K1Q A;  4DWI A;  4WC3 A;  4KLU A;  5CP2 A;  3PO5 A;  3T5K A;  2Y1I A;  4F4X A;  3OHA A;  1SZP A;  3GDX A;  4I2I A;  1SKW A;  1ARO P;  4YN4 A;  8ICC A;  3RB6 A;  3RR8 A;  4ED3 A;  2FLL A;  4O3S A;  1U9L A;  3GV8 B;  4PHD A;  4X4O A;  1BGX T;  1X2I A;  4EYI B;  4GC7 A;  3AQL A;  3H38 A;  3PW7 A;  1LB2 B;  4RU9 A;  1XC9 A;  3WFR E;  4IQT A;  4TQS A;  8ICG A;  5CWR A;  5HRK A;  1ZQE A;  3OVA A;  3NGD A;  7ICF A;  1EXN A;  3MGI A;  2PXI A;  4O3Q A;  2W9M A;  3PR5 B;  1Z00 A;  5KFW A;  3PNC A;  2ZJ8 A;  3JPO A;  4YCX A;  5J2H A;  1L3V A;  4YR3 A;  1KEJ A;  1C7Y A;  2ZH9 A;  4I2F A;  3RH6 A;  2KN7 A;  5J0O A;  5DEC A;  2DRA A;  2FPL A;  4M9L A;  3ISD A;  2AU0 A;  5CA7 A;  2BKE A;  2W8L A;  4ECQ A;  8ICN A;  4EP7 A;  3OJU A;  5DBC A;  3LWM A;  4B9S A;  4IRK A;  4LZG A;  2C28 A;  1R89 A;  4MFF A;  1LV5 A;  4YR0 A;  2ZTC A;  5KFZ A;  2ZJA A;  4K4H A;  4M0A A;  4UB1 A;  1KFS A;  1ZYQ A;  4YMO A;  5KG3 A;  4R64 A;  4C8L A;  4DSE A;  9ICP A;  4ATB B;  4QWE A;  4KTQ A;  4RWN A;  4FHX A;  4QZE A;  3ZDE A;  3Q8S B;  2W9C B;  2W9B B;  2FLN A;  4I2H A;  3RTV A;  2ZH3 A;  1ZQU A;  4WC4 A;  4MF8 A;  1BPZ A;  1RXV A;  1L3U A;  2JEJ A;  2BHN A;  1Z3E B;  5EOZ A;  5KFT A;  5KG2 A;  1XSP A;  1X9W A;  1S9F A;  4BDP A;  3KTQ A;  3TFR A;  2H5X A;  3GIM A;  1X9S A;  4MF2 A;  4M2Y A;  2ZHB A;  4YMN A;  4ELV A;  5DBA A;  5DB7 A;  1N48 A;  3UPQ A;  4EZ9 A;  4X4R A;  1TAU A;  4IQV A;  1NK4 A;  3BQ2 A;  2XCA A;  4M6W B;  2A1J B;  1SKS A;  4FH5 A;  5KFD A;  3T5J A;  2JEF A;  2ZTE A;  1NKC A;  1MIW A;  2WTF A;  4WBY A;  1ZQH A;  4DQI A;  2HHP A;  4QZA A;  4EEY A;  4DSK A;  1QSS A;  4KLF A;  5KFS A;  5KG6 A;  2BPF A;  2ASD A;  1ZQM A;  1QLN A;  2Q66 A;  3LDA A;  3G6X A;  4G3I A;  8ICQ A;  4J9K A;  7ICU A;  8ICY A;  2OWO A;  3C1Y A;  2C2R A;  1H38 A;  2BQU A;  3V72 A;  1VJ7 A;  2DRB A;  5DBB A;  4ECS A;  4PGY A;  1UA1 A;  5KFE A;  5DDM A;  3FYH A;  3UPS A;  1TAQ A;  1WCN A;  4RQ5 A;  1OU5 A;  9ICM A;  4E0D A;  3PW5 A;  4UAW A;  4M9N A;  4K4I A;  4ECY A;  3H40 A;  3RJG A;  2PFO A;  8ICX A;  2AGQ A;  3JPQ A;  2V4R A;  3RH5 A;  2DR5 A;  3RJJ A;  4M9G A;  5J2E A;  1CEZ A;  1R8A A;  4KN4 A;  4Z6F A;  3H4B A;  3V7L A;  4I2E A;  1YLQ A;  2ZH1 A;  4QZD A;  5HRG A;  4UBB A;  2P6R A;  3QZ7 A;  4F4Z A;  4F2S A;  2JZB A;  5J0R A;  5J29 A;  2UVR A;  5KFA A;  2V9W A;  8ICS A;  3UQ0 A;  5DQH A;  2AQ4 A;  3JZ0 A;  3KHG A;  1PX5 A;  4NKU A;  5KFC A;  4RPZ A;  3AQK A;  3GIK A;  3TFS A;  3BDP A;  4GLX A;  4RPX A;  3JPR A;  3THV A;  3RAX A;  2JEI A;  7ICV A;  4I2C A;  1ZQZ A;  5DLF A;  9ICE A;  3MFH A;  3GII A;  4PHE A;  4DFJ A;  3MGH A;  3PW2 A;  3GIJ A;  1SKR A;  4QZC A;  1MQ3 A;  2UVV A;  4KLS A;  1VFG A;  4M9H A;  4F5O A;  4JK1 A;  4O5C A;  3ETL A;  5HHI A;  4F3O A;  1U48 A;  1TK0 A;  2PFP A;  4O9M A;  4UB4 A;  8ICJ A;  4PGX A;  3NYB A;  1WCL A;  5KT3 A;  3SV3 A;  1U4B A;  2M2W A;  5F9N A;  2AGP A;  1RXW A;  4O3R A;  4YD1 A;  2FMS A;  3G6Y A;  5DGA A;  3H8J A;  2BCS A;  3MDA A;  3N4M B;  3RRG A;  5J0X A;  3OHB A;  2IMW P;  3ZDD A;  3SI8 A;  5J0S A;  4PH5 A;  1T3N A;  1S0M A;  4AT7 B;  2XY5 A;  1X9M A;  1MSW D;  8ICL A;  4DL4 A;  3B0Y A;  8ICA A;  1TK5 A;  1KNY A;  4X4U A;  3AU6 A;  1XU4 A;  2R8I A;  3TAN A;  5KT2 A;  4QZ8 A;  1QSY A;  2KZ3 A;  3FDS A;  1SL1 A;  3RJH A;  4Q44 A;  4WBZ A;  2NRV A;  3EPG A;  3SV4 A;  1S10 A;  3WFO A;  2MUT A;  4RWQ A;  2DR8 A;  4GXJ A;  1L3S A;  1ZQF A;  4X4T A;  4WC1 A;  5HRF A;  1L3T A;  4NLZ A;  3ZD8 A;  3M8R A;  7ICS A;  5DGB A;  4NLG A;  4UAY A;  3T3F A;  2ASL A;  2KFZ A;  5IIN A;  5D49 A;  2HVH A;  3EZ5 A;  1QTM A;  3OVB A;  4JV2 A;  3B0X A;  1T7P A;  4EBK A;  5J2F A;  4F4Y A;  3AQM A;  2NRZ A;  4F5N A;  1Q78 A;  2JEG A;  4O5E A;  8ICH A;  2IHM A;  7ICL A;  1BPB A;  3RB3 A;  3TQ1 A;  5HRD A;  4RWP A;  2NRT A;  2XGQ A;  3UQ2 A;  2IA6 A;  4DF8 A;  9ICV A;  4F50 A;  1ZQX A;  4F4W A;  2VA8 A;  4J9S A;  2FMP A;  4NXZ A;  1ZQB A;  3RBE A;  2FLP A;  2AQ0 A;  5KFM A;  4R65 A;  1JXE A;  3RH4 A;  2C2E A;  2DPJ A;  1A77 A;  4I2J A;  4KLQ A;  9ICX A;  4RQ7 A;  4F5P A;  1XSL A;  4DSL A;  1Q79 A;  4DOA A;  4KMU A;  3GQC A;  2MAX A;  4DLG A;  4I2B A;  2ISP A;  2C2D A;  4NKT A;  1UEU A;  3EW9 A;  4YG2 A;  4R66 A;  4DL6 A;  5EWG A;  2BQR A;  2R8G A;  2HW3 A;  1XWL A;  2ZTD A;  3HT3 A;  1B22 A;  3H39 A;  4UD4 A;  3KHH A;  4YP3 A;  4DOC A;  1ZQN A;  4DL5 A;  3C5F A;  2KZZ A;  1NOM A;  1TV9 A;  5HRH A;  2J6U A;  1ZQO A;  4M5D A;  4RUC A;  4BWM A;  4RZR A;  4F5R A;  2P6U A;  1S0V A;  4BWJ A;  3MR6 A;  3G6V A;  4YXJ A;  4X0A A;  5KFK A;  3N97 B;  4FHV A;  3AUO A;  4RQ2 A;  4S3N A;  1ZQP A;  2PI4 A;  3BJY A;  4R8U A;  4C8K A;  4QWA A;  2AJQ A;  4UQG A;  4KIT B;  5KFH A;  3H37 A;  2HHW A;  8ICB A;  9ICT A;  4TUP A;  3RJI A;  4DQS A;  2ZUD A;  5J2A A;  3ORY A;  5KFL A;  3NTU A;  3UXN A;  5TZV A;  3V7J A;  4ED8 A;  1ZQL A;  3TAR A;  3RJK A;  3ZDB A;  4I27 A;  4MFC A;  4F5Q A;  5HP4 A;  3OUY A;  3AU2 A;  1XS9 D;  4JUZ A;  4Q45 A;  2PBE A;  2FPM A;  4X4Q A;  4UAZ A;  4WCW A;  1BPD A;  3JYY A;  4KLH A;  3RJF A;  4F2R A;  3PO4 A;  2XO7 A;  1IXR A;  4J9M A;  2R8J A;  3TAP A;  2PI5 A;  1S97 A;  2ZHA A;  5KT5 A;  4FS1 A;  1S77 D;  1XSN A;  1KLN A;  9ICN A;  5HMM A;  2VAN A;  5EWF A;  4NY8 A;  1KRP A;  5HR9 A;  3LQC B;  5J0U A;  4AT9 B;  4XRH A;  4QZB A;  3MBY A;  1PZN A;  2VA3 A;  2NRK A;  4PGQ A;  2ALZ A;  1JMS A;  4RUA A;  3RB4 A;  2HHQ A;  3PX6 A;  2ZH5 A;  2M9N A;  4RQ4 A;  4X4P A;  2BPC A;  4FBT A;  3KHR A;  3M8S A;  4DOB A;  1NK6 A;  3Q8R B;  4NM2 A;  1HUO A;  5KFR A;  4YR2 A;  4E7X A;  4J9Q A;  2HHS A;  3GFK B;  9ICL A;  8ICM A;  4QWC A;  1Y88 A;  4RQ0 A;  3WFP A;  2BE3 A;  3BQ0 A;  3QEA Z;  2ZH4 A;  3JPS A;  2KFN A;  4O5K A;  4K4G A;  7ICQ A;  8ICK A;  4MFA A;  3PVX A;  3C66 A;  2W8K A;  4IR1 A;  5F2V O;  8ICF A;  3BQ1 A;  2PFQ A;  4IQW A;  5KG0 A;  5L1J A;  4BXO A;  4DFK A;  1MQ2 A;  4C8M A;  3PW0 A;  3C23 A;  1D9D A;  3ZDA A;  5CB1 A;  3EPI A;  2R8H A;  8ICV A;  4ATB A;  4EBE A;  2MUT B;  1ZQC A;  3K75 D;  4DSJ A;  1DK2 A;  5HC9 A;  2W9B A;  1S76 D;  5KFY A;  3ISC A;  4DLE A;  5HRI A;  4PPX A;  2RDJ A;  4F93 B;  3LK9 A;  5J2I A;  4EYH B;  5J2J A;  4LZD A;  5DG7 A;  2I9G A;  9ICG A;  4QWB A;  5J2G A;  4DQR A;  2KTQ A;  9ICO A;  4J9P A;  4FH3 A;  4GXI A;  2DFL A;  4QZG A;  5L1L A;  1WOT A;  4EBD A;  4DEZ A;  3H8W A;  1NK7 A;  4X4V A;  4DQQ A;  3RB0 A;  2V4Q A;  2ZH8 A;  5KTQ A;  5D4B A;  1HUZ A;  8ICZ A;  2A1J A;  9ICK A;  2BGW A;  2J6T A;  1JX4 A;  2KZM A;  1A76 A;  8ICE A;  3OSN A;  5HNK A;  3OJS A;  3H4D A;  1NJW A;  2HHU A;  1NO5 A;  3L9D A;  1ZQT A;  4B9T A;  5IIJ A;  3C5G A;  4I2G A;  2AGO A;  3MAB A;  4QWD A;  3SYZ A;  4Q8F A;  4Q8E A;  5J0Q A;  4PHP A;  3HWT A;  1ZQK A;  4I28 A;  4TQR A;  2Y1J A;  1RYS A;  4XQ7 A;  5KFB A;  4E8F A;  1Z00 B;  4UB2 A;  2J6S A;  4DSI A;  4F91 B;  4J9R A;  5KT6 A;  4M9J A;  1BNP A;  3PV8 A;  3HJ1 A;  3EWA A;  2BR0 A;  4TUQ A;  3UXO A;  5EWE A;  4X5V A;  4O3P A;  3M9N B;  5KFU A;  4Z6C A;  3PX4 A;  1ZQA A;  3V7K A;  4F8R A;  4I29 A;  1DK3 A;  4KLI A;  5DQI A;  3C18 A;  2GWS A;  1COO A;  4P4M A;  2RDI A;  4RPY A;  4YXM A;  1NK8 A;  2UVW A;  2BCV A;  3V6J A;  2VA2 A;  1JQR A;  3HIY A;  4WC5 A;  1TFR A;  4J9O A;  1BPY A;  4FBU A;  8ICI A;  4NLN A;  4RQ3 A;  3RR7 A;  3QZ8 A;  4M04 A;  3HJ4 A;  9ICR A;  5III A;  5J0P A;  4B9M A;  1ZQI A;  1KFD A;  4KLG A;  5J2K A;  2LYH A;  9ICJ A;  3TI0 A;  1S0N A;  4R8U B;  4ZH4 A;  4YQW A;  3C2M A;  4DQP A;  1XO1 A;  2B21 A;  4DS5 A;  4YMM A;  4FS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...