3JYYA

Semet linb complexed with ppi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
265
Chain Sequence
MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
molecule keywords Lincosamide nucleotidyltransferase
total genus 93
structure length 265
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jyyA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jyyA01
4YMOA 3PMLA 4LT6A 5DB8A 4IQTA 3C18A 3C5FA 2ZH3A 5HRBA 9ICAA 3OUYB 1MIYA 9ICEA 4NY8A 2O1PA 7ICPA 1ZJMA 5J0XA 1TV9A 4PGYA 4UD4A 3B0YA 4KLDA 8ICBA 5HRLA 5DDYA 4RPXA 3GM3A 2BCUA 3PMNA 4UD5A 4RQ6A 4R66A 4PH5A 4RWNA 3BRJA 4KLTA 4NQFA 2O5AA 2BCRA 4QZIA 4RT2A 4O5KA 2L6GA 4UAZA 2M2VA 4MFAA 2M2UA 5DECA 3HJ4A 4LZDA 1ZQNA 3H39A 7ICOA 8ICQA 9ICCA 1ZQUA 4TURA 1ZQYA 4I2AA 3HWTA 4QZFA 2DR8A 4I2FA 4LVSA 4EP7A 3RJIA 2RFFA 5BPCA 3GM2A 4AT8B 4M9JA 4I2CA 3RH4A 4P4OA 4PHDA 1ZQWA 2ZH4A 8ICCA 5DBAA 4RQ0A 3RH6A 1UEUA 4QZDA 4I2DA 4Z6CA 5DB6A 1OW8A 4UBCA 2ZHAA 4YMNA 8ICIA 2ZHBA 4P2HA 3OVBA 4KLGA 3NYBA 4XRHA 3JZ0A 5CP2A 1NO5A 4KLQA 4M9GA 4RWQA 7ICGA 4AT9B 4M5DA 9ICPA 3MDCA 1BPBA 2BCSA 1XSPA 2ZH6A 5J0WA 2DRBA 4O5CA 8ICEA 4FHVA 4X4RA 1WOLA 8ICVA 4ATBA 4MFFA 8ICYA 1KNYA 4M2YA 4PHAA 3MDAA 4I2BA 4RPZA 2P66A 4MFCA 5HHHA 1R8CA 2L6HA 3S9OA 2IHMA 4RQ8A 3ISDA 9ICXA 3U3FA 1ZQHA 3V72A 4F5RA 3AQLA 3B0XA 4X4OA 1KDHA 4AT8A 2DR7A 2FMQA 8ICXA 2PBEA 5IIJA 4QZEA 3JPNA 3U0CA 2DR9A 5BOMA 3RH5A 4I27A 1ZQPA 2ZH9A 1JQRA 5TZVA 2HSBA 4I2EA 4YN4A 8ICLA 4UB3A 5J29A 3UQ2A 1K04A 9ICQA 1V4AA 5CWRA 5J0PA 1ZQDA 9ICWA 4UAYA 4RQ5A 3JPTA 5IILA 4WCWA 3RJEA 4I2IA 5J0YA 1ZQMA 8ICGA 4X5VA 2ZH1A 8ICKA 1ZQVA 4WC3A 4WBYA 4XUSA 4QZGA 4WC1A 2BCVA 9ICNA 2YWAA 1R8AA 4NLZA 5CR0A 4NM1A 4F5PA 3OV7A 2BPGA 4I29A 4IQWA 3WFRE 3H3AA 2M2TA 3C8GA 3LK9A 5J2JA 1ZQXA 3H37A 3H38A 4NM2A 4X0AA 7ICTA 4GXIA 4NKTA 4PHEA 4I28A 4RT3A 5DKWA 1OU5A 3HW8A 1HUOA 2ISPA 4KLSA 9ICIA 1Q79A 9ICJA 2L6FA 3C8GD 5HRHA 4TUPA 5F28E 3AQMA 4YD2A 4P4MA 1R89A 4PGQA 3OGUA 4Z6DA 4F5NA 5DBCA 5D4BA 3RQGA 1TVAA 3AU2A 4E80A 3O10A 2BPFA 3RJKA 1UFBA 4K4HA 7ICUA 1ZQBA 4RWOA 8ICJA 5DEDA 4R64A 1FA0A 1JOGA 4TUSA 5CA7A 9ICMA 4Z6EA 4F5QA 7ICRA 1PV3A 4R63A 4FHPA 3JPOA 4AT7B 4KLFA 4X0BA 1ZQJA 3C8GB 5CHGA 2DR5A 4WBZA 3WFOA 1NOMA 3UPSA 1F5AA 4YMMA 3HIYA 3HJ1A 4PPXA 1O3UA 4X4PA 2NRKA 4R32A 1K40A 3V7JA 8ICPA 1BPYA 8ICTA 2JPUA 2ZH2A 3UQ0A 4E7XA 4WC2A 3UXPA 4QZ8A 5BOLA 3GM1A 1RZTA 4UB5A 1KEJA 2LK4A 4QZHA 2M2WA 3JPRA 2BE3A 4UAWA 3K75D 4EBKA 5DB7A 4I2JA 3C2MA 4QZ9A 2HHPA 4NLNA 1ZQFA 4RQ4A 5EOZA 4M0AA 3UXOA 1ZQZA 4IG8A 4WC4A 5J2HA 1XSLA 4M9HA 8ICNA 8ICOA 5HRKA 1ZQQA 4KLOA 1VJ7A 4K4GA 5HR9A 3JPQA 3TFRA 4FHXA 8ICWA 1JN3A 1UETA 4RPYA 2ISOA 4KLJA 4NKUA 2Q66A 4R65A 4X4UA 7ICJA 5J2IA 5J2DA 4ATBB 4FH3A 1VFGA 3AU6A 7ICHA 4GXJA 8ICUA 5J0OA 5J2KA 2JX0A 5DDMA 3RQEA 4XQ8A 3L8JA 4RQ3A 4FH5A 5J2FA 4P4PA 4DOCA 3TFSA 1ZQKA 2Q00A 4RWPA 2I9GA 1HUZA 8ICHA 1BPXA 1XSNA 3AJMA 4PGXA 7ICLA 4AT9A 1OW6A 5J2EA 4UBBA 5IIIA 3UXNA 7ICVA 5IIKA 5J0RA 4O5EA 4JWMA 4IQVA 9ICLA 5DB9A 4I2GA 1OW7A 4XEFA 4AT7A 5HREA 4QZBA 5IIMA 4XA5A 4M04A 1ZZPA 4X4QA 1MIVA 4KLMA 2ZH5A 2DVIA 3AQKA 3WFQE 2PXIA 2BCQA 3TULA 3K7DA 3GDXA 2VANA 5HRGA 1BPEA 3JPSA 5DBBA 4NLKA 4F5OA 4MF2A 1ZJNA 1ZQOA 2PFPA 1WTYA 4M9LA 4KLUA 1RPLA 4KLHA 4MF8A 2GWSA 5F2VO 4K4IA 4XQ7A 5J0UA 8ICFA 4EBJA 8ICAA 4TUQA 3RJJA 4Z6FA 1Q78A 8ICMA 1ZQIA 1QVXA 5J0SA 4QZAA 2FMPA 1TFWA 1ZQEA 5J0QA 3C66A 5J2GA 9ICKA 4WC0A 5J0TA 4QZCA 3OVAA 4YD1A 5CJ7A 1ZQLA 3MFNA 4WC6A 9ICRA 3ISBA 2PFQA 1JMSA 1BPDA 3V7KA 9ICHA 2ID1A 3MGIA 5J2CA 5HRIA 1PX5A 4O9MA 3L8IA 4KLIA 3UPQA 8ICSA 1JAJA 5J2BA 4DO9A 9ICOA 7ICEA 3C5GA 7ICIA 1ZQSA 3HX0A 1ZQTA 1ZQGA 4YCXA 1MQ2A 1R8BA 5J2AA 9ICBA 4XEKA 3JPPA 1ZQAA 7ICSA 7ICMA 3AUOA 4M9NA 4X4TA 4UB1A 2BPCA 1WOTA 4FHWA 4UB2A 2PFOA 4DOAA 4JWNA 4IQUA 5D46A 4RQ2A 1UEVA 4LZGA 3WFPA 4S3NA 1YLQA 9ICSA 4RQ7A 1KTMA 3L9DA 3OUYA 2ZH7A 5IIOA 9ICFA 1MQ3A 3MGHA 4UB4A 3RJGA 4E8FA 4M47A 4NXZA 7ICKA 1BPZA 4FO6A 9ICTA 2W9MA 4X4VA 4WC5A 1MIWA 3AQNA 8ICZA 3LQCB 7ICQA 4XEVA 2PFNA 3JYYA 2DRAA 4PHPA 5CB1A 2ZH8A 3MBYA 5HRFA 3V7LA 3RJFA 4X4SA 3C2LA 3ISCA 5HHIA 7ICFA 9ICGA 4KLEA 8ICRA 4WC7A 9ICUA 3OVSA 2FMSA 3C2KA 4GXKA 3RQFA 3RJHA 2KK1A 1TFYA 5D49A 1WWPA 3PNCA 4RQ1A 4FHYA 4KLLA 1ZQCA 9ICVA 4X4NA 5HRDA 4I2HA 5IINA 3WFSC 4DOBA 1K05A 1ZQRA 3B71A 7ICNA 5HC9A
chains in the Genus database with same CATH superfamily
2H7VC 5DB8A 2Z15A 3C18A 2ZH3A 9ICAA 1OR3A 1MIYA 3ATPA 2GAFD 4O6AA 2HMZA 3PHF2 5DDYA 3RKOF 4UD5A 4RQ6A 4R66A 3DJNB 2LQGA 3LLKA 4NQFA 2ZXPA 2L6GA 4UAZA 2OJQA 2G3VA 5DQZA 2M2VA 2M2UA 3JTLO 4NTAA 3ASNC 1ZQNA 4YT5A 4TURA 2A6EF 4I2FA 4QZFA 4K98A 1A7VA 2ZH4A 4P9TA 3DAFA 3WHNA 4PACA 5EHHA 3RH6A 3S84A 1QQ3A 1NLXA 5DB6A 4UBCA 4P2HA 1QZXA 4A2NB 2PNOA 4CJGA 2YLDA 1T6UA 3NYMA 4CDAA 4IAOA 2W4MA 1NO5A 2R02A 256BA 4H54A 4K9AA 4W8KA 2CCYA 3M4BA 3G4XA 2ZH6A 5J0WA 2DRBA 3U2LA 2XLEA 4X4RA 1TR2A 4NXVA 2I15A 3QTHA 3GEHA 4P9FA 3QW0A 4N6CA 5A6BA 1JRAA 3MDAA 1MQVA 2XLHA 4FO1A 4RPZA 4MFCA 3UGOA 3L34A 3LAYA 4LLCA 1BR2A 3S9OA 1OCOC 4ULVA 3U3FA 3PMRA 3C8ZA 1M2VB 4X4OA 5DS4A 3PDMP 4FX5A 2LD6A 2KYHA 2ZH9A 1IW7F 2HSBA 4YN4A 8ICLA 2OEXA 3K33A 5J29A 1K04A 1A7DA 3PCVA 4LEVA 9ICQA 5CWRA 2CDQA 1FNTc 9ICWA 4UAYA 4RQ5A 4H4KC 5DS5A 1L3PA 3ZG1A 3Q6NA 5FZTA 4X5VA 4B6IA 4ZLCA 1ZQVA 4WC3A 3SXZA 3W4YA 2Q4FA 4NLZA 5E2QA 3U9JA 4F5PA 4MVQA 3OV7A 1SF8A 4FWVA 2G3KA 2M2TA 3C8GA 2AWCA 1TFKB 4ULWA 5L3VA 5T3TA 2E87A 5AC5A 1IZMA 1OU5A 3HW8A 3B29A 4KLSA 2XLOA 1Q0KA 5F28E 4P4MA 4RDAA 2NUTA 5D63A 4K99A 1HMOA 2NUPB 3EG9B 1OKKD 1MNEA 1ZQBA 1O5HA 4OIPF 5DEDA 5BQHA 4JEBA 1JOGA 3ER8C 3IQTA 3FAPB 3MX3A 2GA9D 9ICMA 1RMVA 1PV3A 2J9BA 3UMKA 2XLWA 4QI2A 1N1CA 5DQTA 1F1MA 4WBZA 3EZHA 2Y3GA 5E3AA 1F5AA 3HIYA 4JJGA 1RJ9A 5CI9A 3B0VC 4X4PA 4R32A 3ZWIA 4K96A 3IQ5A 2ZH2A 4QZ8A 4AK9A 1LI7A 4N4WA 3ZQVA 2BE3A 1RXQA 4EBKA 4YL1A 3B0UX 3FXHA 1GGQA 4YT8A 5EOZA 3UXOA 5J2HA 2HV7A 5JS5A 2EPOA 8ICOA 1ZQQA 4KLOA 1VJ7A 3N2ZB 4EKWA 2FGYA 4UDVA 8ICWA 1FFHA 1Q0DA 4RPYA 2VCCA 3W8IA 5J2IA 5J2DA 4XPYA 2XL8A 7ICHA 4JE9A 2JX0A 2PX0A 3JSEO 3RQEA 2EWRA 2MHRA 2ZXOA 4XQ8A 3T9OA 3POVA 4DOCA 1FAPB 1ZQKA 1HUZA 1ORYA 4DOZA 3EGDB 7ICLA 2YKZA 2RSEB 3G4ZA 4AT9A 5J2EA 1BBHA 4UBBA 5IIKA 3CAXA 2J9VA 2WZFA 4O5EA 1E85A 4IQVA 2AVKA 1EA8A 4N7RA 3JCFA 4M04A 2P1AA 4RBNA 4CDYA 1ZZPA 2OJED 5CIVA 5B3QA 4NC3A 1I4ZA 4MKPA 1BPEA 1OR2A 3JPSA 1ZHWA 4NLKA 3GORA 2IHOA 4BJ1A 4F5OA 1ZJNA 3IEEA 2PFPA 4U5DE 4K97A 2GWSA 3HTKC 4CJOA 3IHUA 5KYUB 4O6MA 3V5ZA 1Q78A 5A6AA 1ZQIA 2VASA 4PR9A 2IXPA 4QZAA 1LE2A 1TFWA 3DKAA 3MYIA 3M79A 2AP3A 5J2GA 9ICKA 1A41A 3N24A 4JJFA 3F47A 2IYLD 4MVZA 9ICHA 2C03A 3V7KA 1PD0A 2Q9BA 4BJ6A 4IJJA 1D0XA 4HEAJ 3L8IA 4KLIA 3KMIA 3CEXA 1T6IA 4U5GA 5J2AA 4XEKA 1Z23A 3JPPA 1MMDA 7ICSA 7ICMA 1LS4A 4X4TA 2Q3TA 4J7YA 1WOTA 3IPMO 1CPQA 3EGXA 3B0PA 3FMSA 3U5SA 3L0IA 2PFOA 4DOAA 2DB4A 2B51A 3KH2A 2GA0A 4LZGA 4EGWA 1YLQA 4G7OF 5IIOA 9ICFA 1MQ3A 3RJGA 4JW1A 4NXZA 2DGJA 1KU2A 2H7BA 1TWHA 3DWWA 3SXYA 2YZSA 7ICQA 2PFNA 1E83A 4PHPA 3C63A 2CGEA 2BL2A 3RJFA 2YHSA 1HW1A 4FAPB 2KW3C 2FMSA 5KYNA 3NWIA 2XS8A 2R7UA 1WWPA 3EPVA 4MW3A 4FHYA 2EINC 9ICVA 2EPNA 2ETSA 3K1IC 2MWQA 4NTBA 1ZHTA 4JTDB 1RKEB 4BJ5A 1T9KA 2EIJC 1JR8A 1G4WR 2NUTB 4YMOA 3PMLA 3CQZA 3S90A 4E18A 4G78A 1UG7A 2O1PA 7ICPA 3EJNA 1FTSA 2JD3A 4BEMJ 4UD4A 8ICBA 5HRLA 5L0IA 1RKCA 1Q0FA 2KQ9A 2DI3A 1T01A 4MTOA 3CZ6A 3BRJA 4I3MA 2BCRA 1M57C 1NSGB 5DVWA 2EILC 5DECA 4P6IC 3HJ4A 4LZDA 7ICOA 8ICQA 1ZQUA 1ZQYA 4BEJA 4I2AA 4OAGA 2QUPA 1D0YA 4I2CA 4P4OA 3X2QC 1ZQWA 4F4BA 4PHDA 5DBAA 1ZU5A 4I44A 1VMAA 1D1CA 5KYXA 1U0BB 4QZDA 4I2DA 2BE5F 2IXNA 3VM6A 1J8MF 4YK5A 3ZIBA 4J7TA 2XLMA 4KLGA 4CIPA 3JZ0A 5CP2A 4AT9B 4M5DA 1BPBA 1XSPA 3RH3A 2IXOA 4OINF 4FHVA 3HKKA 1WOLA 2NSFA 1M2VA 1WN0A 3QZCA 8ICVA 4MFFA 4O79A 3ITFA 4PHAA 4I2BA 2P66A 1R8CA 2L6HA 3LLIA 2IHMA 5D62A 4MVRA 1MMGA 3EH2A 1KDHA 2DR7A 8ICXA 2PBEA 3JPNA 3U0CA 4U5FE 1SR2A 4LERA 3RH5A 2NUPA 3JCUQ 1ZQPA 1XWJA 3DM9B 5TZVA 4I2EA 5COMA 3M4CA 1C03A 1TFOB 4PJNA 2J9WA 4XJEA 5J0PA 3SEOA 1E2XA 1NBBA 4BG0A 4ER9A 4OIOF 1Z5ZA 3RJEA 4YL0A 4GYTA 1ZQMA 2PFDA 3EH1A 1ORSC 1RJ9B 4C3DA 4JTCB 3K1IA 1DOWA 1APCA 1R8AA 4OAFA 4I29A 3WFRE 3H3AA 1HE9A 1HMDA 2HFIA 7ICTA 4PHEA 2OCCC 1CPRA 1HUOA 4KNWA 4TUPA 3AQMA 1R89A 4PGQA 4F5NA 1MNDA 4U5BE 1TVAA 1AUEA 4MW8A 3AU2A 3AG4C 2L81A 3ZQYA 1UFBA 4CS7A 5B1BC 7ICUA 2YEVA 3X1OA 4R64A 2Y3BA 3A11A 4TUSA 5CA7A 4JRZA 3TOLA 2XLVA 4Z9IA 5AC4A 7ICRA 3AG1C 3ERCC 3JPOA 4AT7B 4KLFA 1ZQJA 4A4AA 4K0DA 1NOMA 4M63A 2HZ8A 3V7JA 1K40A 4Q4ZF 8ICTA 3EGXB 4U5HA 4MNDA 4MQ9F 2PP4A 5BOLA 4UB5A 1ZHZA 1KEJA 3B9QA 2HJMA 2D4UA 3K75D 5A6BD 2VCAA 4C3BA 5DB7A 3MBGA 4NXTA 1V74B 3C2MA 4QZ9A 2HHPA 1ZQFA 1OCZC 3U8VA 4M0AA 3C7JA 4IAQA 2J0WA 4K7BA 3EQLF 2ICWG 1XSLA 4M9HA 2MYSA 8ICNA 5HRKA 3NKDA 2W9YA 4K4GA 4XLPF 3JPQA 2OU6A 4XTKA 1UETA 2ISOA 5D91A 4NKUA 3M15A 1ZHYA 4X4UA 3T6BA 3U2MA 1GQAA 2J0XA 3VF0A 1NZEA 3OWTA 4GXJA 1H9GA 3RVYA 5J2KA 1LI5A 3I5QA 3L8JA 1T6QA 2YVKA 5A6JA 4P4PA 2HN1A 1Y4CA 4WJ0A 2WL8A 2I8BA 3KKBA 4PGXA 1OW6A 5IIIA 2UUHA 3UXNA 4G7ZF 2A0BA 3ER9B 1OW7A 1BR4A 3OA1A 4QZBA 4XPXA 3QMKA 1ZW3A 4JLZA 2DVIA 3KL4A 4BJ6C 1SZIA 3S29A 3K7DA 3AG2C 1HW2A 3NYLA 2CW0F 3DI5A 4WQLA 5JUAA 5CI8A 3TK0A 4MVMA 2IOQA 1WTYA 4M9LA 2QE9A 3H2VA 3O6XA 4KLUA 2WZLA 4EIYA 5F2VO 4E0HA 4G7HF 4LACB 4EEDA 4EBJA 2VCBA 2XLDA 1H7IA 3Q7GA 3DZAA 1ZYRF 4DBQA 5J0SA 1ZQEA 2XM4A 4JURI 3C66A 1YJGA 3OVAA 1Z63A 3US6A 3MFNA 3U9MA 3ISBA 2ID1A 3E9VA 5HRIA 9ICOA 1FR0A 7ICEA 1ZQTA 3HX0A 1ZQGA 2VH3A 5EK0A 1ZQAA 2P6VA 3TQOA 1T5OA 1LVKA 2YL7A 4OD4A 4IQUA 2J8WA 2J46A 3K66A 3LEOA 2H7OA 2YL3A 4RQ2A 3WFPA 3NDBB 1ORJA 1I5NA 4RQ7A 3ZTZA 1KTMA 3L9DA 3LESA 3PHZA 2ZH7A 3MGHA 3SXMA 3FAJA 4M47A 1YARO 4X0RA 3E70C 4IWBA 2B0HA 1JMWA 2A69F 4K8VA 3G50A 3JYYA 4IGGA 5CB1A 1XZQA 2XM0A 4CBEA 1BZ4A 3V7LA 1FMWA 5HHIA 7ICFA 9ICGA 3RIPA 4KLEA 3ZC4A 3OVSA 3C2KA 5KYYA 3RQFA 3RJHA 2J45A 1NFNA 4RQ1A 4KLLA 2QNLA 4QI0A 2OEVA 5IINA 1WASA 2CNWA 3TJ6A 5HC9A 4JC7A 2BC5A 4E7ZA 3NMIA 3S27A 4LT6A 2F22A 4IQTA 4Q7CA 3ABLC 3DM5A 3C5FA 2LFDA 3K1HA 5HRBA 3OUYB 1C17M 1FMVA 3DXJF 3B0YA 4LEYA 3ZVRA 4AE4B 5IY5C 3GM3A 3Q6MA 2BCUA 2R7VA 4PH5A 1PD1A 3WAQA 4KLTA 2H8AA 4QZIA 4O5KA 2P0NA 4AX2A 3SYNA 4LLEA 2J7PA 4W8PA 4CDVA 3H39A 3HWTA 4LVSA 3EHNA 4EP7A 1Z7Qc 2RFFA 3GM2A 4AT8B 1NU7D 2DYRC 1GM5A 8ICCA 4RQ0A 4HX0A 1NFOA 1H6GA 4CS8C 1YZCA 3KPHA 3GEIA 3JYHA 4YMNA 1VTMP 2ZHBA 1Q0GA 3OVBA 3DE9A 4YL3A 3NYBA 4XRHA 4KLQA 4M9GA 4RWQA 1SMYF 9ICPA 3MDCA 2BCSA 1L7CA 1LS1A 5KYWA 4XQ1A 5E3CA 4ATBA 2VB6A 1KNYA 3VRCA 1YDIA 3ZSUA 2ZPAA 5HHHA 9ICXA 4RQ8A 1OQCA 1ZQHA 2LFFA 4CS9A 1I4YA 4F5RA 3N0TA 3MLGA 2FMQA 2HN2A 4I0UA 3I4UA 2DR9A 5BOMA 4DBRA 3SP1A 1JQRA 3EG9A 4UB3A 4JTAB 4OIQF 3RFYA 3UQ2A 3W2WA 1M2OA 3JT1A 1DOVA 1HY5A 4U9DA 2C04A 2KNHA 3DD7A 5IILA 4OAIZ 1XZPA 8ICGA 3HNKA 3SXKA 5F5HA 2ZH1A 4QDLA 4ANJA 3FDQA 2BCVA 1SYQA 9ICNA 2YWAA 2NSGA 5CR0A 2BPGA 3ECSA 5BQGA 5J2JA 4JCZA 4X0AA 4NKTA 4I28A 2DYSC 5DKWA 2ISPA 9ICIA 2L6FA 3NMKA 4YD2A 4E0IA 4Z9HA 2B56A 1VLSA 3JRTA 3LNRA 5DBCA 5D4BA 2J7PD 3O10A 2LIGA 3EHMA 2BPFA 3RJKA 3T6GB 1HE1A 2XS1A 1JPJA 1PCXA 4JEAA 2OQMA 8ICJA 2R7QA 3HNIA 3RVZA 4DRHB 4Z6EA 1YYJA 1V55C 5GPGB 3W8HA 4R63A 4FHPA 1GPJA 5B3IA 4PFPA 2CYDA 2LCHA 4X0BA 3C8GB 2DR5A 3WFOA 3UPSA 3HJ1A 1TWGA 2HV6A 4LDRA 1O3UA 2NRKA 4MVSA 2GWWA 2L9JA 2Q7RA 4MVUA 5L0HA 2UUIA 2CNWD 4E7XA 1Q0MA 3J06A 3GM1A 2B4VA 3TOMA 1NU9C 4EWCA 2YRFA 3S0XA 4IB4A 4CX9A 4QZHA 4UAWA 2QLAA 1YVIA 4YN0B 1YLMA 4C7OB 4DRJB 2OG2A 4RQ4A 1ZQZA 4IG8A 4WC4A 3TJ5A 3DE8A 4DVZA 2YLIA 3TFRA 4FHXA 1JN3A 1YZAA 3VYWA 2Q66A 3UNGC 4R65A 4ATBB 4FH3A 1VYIA 4AE4A 3AU6A 3GEEA 4K9BA 5DDMA 5FCLA 5CFSA 4RQ3A 3MYFA 3DAGA 1QPUA 3TFSA 2Q00A 2I9GA 3U3BA 8ICHA 3BEHA 1BPXA 3AJMA 4LDQA 3FHDA 4WQKA 1WATA 3W2VA 4JZAA 7ICVA 4AL1A 9ICLA 5DB9A 2A6HF 4XEFA 5IIMA 1OCRC 3RYLA 4PK4A 4KI2A 1MIVA 4KLMA 3AQKA 2ZXRA 2P7VA 4MS2A 2J9UA 3TULA 5AGFA 3IQCA 4E17A 3GDXA 5HRGA 1B68A 4MF2A 3FOPA 2AU5A 1VOMA 4I1OB 2YL1A 2XXAA 3LS0A 4ONSA 1RPLA 4KLHA 4IARA 2LSEA 3TD7A 4K4IA 5T3WA 1H9TA 5J0UA 8ICAA 3M1CB 3SZRA 3RJJA 1U6HA 1QVXA 2PF4E 2Q9CA 3K6BA 3EGDA 1LM3B 5J0QA 2D5RB 5D92A 4PJLA 4JVSA 4U5EE 4OD5A 5J0TA 1YA9A 3AQCA 4J32B 4BPMA 9ICRA 2PFQA 1JMSA 3MGIA 5J2CA 1PX5A 2R7TA 8ICSA 3HLZA 3C5GA 7ICIA 4YCXA 1MQ2A 1QLEC 4DXWA 5JRAA 1E86A 2NPUA 3AUOA 1CGME 3KYIA 2BPCA 4FHWA 5KYWB 3AGTA 1Y6DA 5D46A 2FAPB 2Y69C 3AGUA 1UEVA 2KGOA 5DS6A 4S3NA 1RKEA 3OUYA 2HMQA 1E84A 4E8FA 1G4US 7ICKA 2WVNA 1BPZA 1M56C 4FO6A 9ICTA 1S05A 2W9MA 3L1MA 4O6YA 2R7OA 4X4VA 3AQNA 2G62A 4XEVA 4U9EA 2DRAA 4CSAA 4WOYA 2L7AA 4LDKA 3MBYA 2BBJA 5KYUA 1LE4A 4KC9A 4X4SA 3C2LA 2ASRA 5CFUA 3CK6A 4EHPA 1NG1A 9ICUA 4O67A 4ZLDA 1RCPA 4GXKA 4BJTA 2WZGA 2KK1A 3I5PA 4YT4A 1TFYA 5D49A 4C3EA 3PNCA 2W45A 1OXBA 3O39A 4KNVA 3S28A 4O6NA 5HRDA 4WH5A 2A0UA 1ZVZA 3AG3C 3WFSC 4EV6A 3B71A 2R25A 5CHEA 4DRIB 1G8XA 2XXAB 3JSZA 4OAHA 1LKXA 2HS5A 1U89A 9ICEA 1VK5A 4NY8A 3JRMO 3LEVA 1ZJMA 5J0XA 1TV9A 1CGOA 5L0DA 3V7OA 4PGYA 4KLDA 2IXMA 2YLGA 4RPXA 3PMNA 3MCRA 4RWNA 2O5AA 4RT2A 3VAYA 2ZD9A 1A0BA 2R05A 4MFAA 4GQHA 9ICCA 3LNMB 3R2PA 2DR8A 2GAQA 3RJIA 5BPCA 4XPWA 4M9JA 4DJ9A 3RH4A 3QVZA 4YWQA 2OKUA 2V26A 5HSWA 4KBLA 5L0GA 4GEHA 1UEUA 5JSLA 1ZW2A 3IQ6A 5HV9A 3H65A 4Z6CA 1OW8A 2ZHAA 8ICIA 1LIHA 1CGNA 5COGA 2KC3A 7ICGA 2QTVA 4CS8A 4NCQA 3GANA 3AOUA 4O5CA 8ICEA 2Y3HA 4EUKB 1R5ID 8ICYA 3C62A 3DJUB 4D4NA 4M2YA 3CSKA 2R7XA 4L6RA 3ISDA 1AVOB 3V72A 3ASOC 3AQLA 1QKRA 3B0XA 2QY9A 4AT8A 2XL6A 5IIJA 4QZEA 4O7GA 4FESA 1OKKA 2EPKX 4RD9A 4PFOA 4I27A 3WG7C 3UR3C 5BQIA 3H2UA 4NXUA 3NVOA 5D61A 1V4AA 4WGYA 1ZQDA 3JPTA 3NKEA 4WCWA 3T4RA 2Y3DA 1Z3IX 4I2IA 5J0YA 4D4XA 4CS9C 2HSQA 4MTFA 8ICKA 4KB6A 2GFHA 2OOCA 4WBYA 4XUSA 4QZGA 4YJWA 5B1AC 2TMVP 4WC1A 1R4TA 1BR1A 4OIRF 4NM1A 4IQWA 1OCCC 3LK9A 3GWNA 3UMIA 2B0JA 1ZQXA 3H37A 4O68A 3H38A 4NM2A 5E33A 4GXIA 4IRUA 3NG1A 4RT3A 3EFOB 5BUOA 4HFKB 1Q79A 9ICJA 4DVYP 3C8GD 5HRHA 1OXKA 3OEOA 3OGUA 4Q5SF 3V5XA 2IUBA 1EQ1A 4Z6DA 2GDCA 3RQGA 4EEBA 4WABA 2A68F 4E7SA 4YT2A 4E80A 2ZXWC 2FCLA 3GODA 2KSFA 3Q7LA 4K4HA 4RWOA 4HE8D 1ST6A 1EI7A 1FA0A 3R7CA 4MTGA 5L0JA 5JP7A 4F5QA 3UMHA 5A69A 4LEWA 5T1DB 1BDJB 3KYJA 5CHGA 4YMMA 5KYYB 4PPXA 5K0IA 2AWYA 8ICPA 1BPYA 3NMJA 2JPUA 3UQ0A 4JLXA 4WC2A 3UXPA 4G0HA 1LPEA 1RZTA 2YL0A 2LK4A 2M2WA 3JPRA 3NYJA 3O55A 2EIMC 5L3QA 4I2JA 4NLNA 5B3SC 4XLNF 2P61A 5EGYA 2R9RB 1G5ZA 2HUJA 5L0CA 5HR9A 1MMNA 2R7WA 4KLJA 1C02A 1TWAA 4NXWA 3HJCA 2XRHA 2R7SA 5JTGA 4O69A 7ICJA 1V54C 1WGWA 2NG1A 3NKUA 1VFGA 2A1DD 8ICUA 2WVQA 5J0OA 1TWCA 4FH5A 5B3PA 5J2FA 5A6KA 4LEZA 2V3CC 1YYXA 3WODF 4RWPA 5TJ5E 1XSNA 3HNLA 4HFFB 3EZIA 1VLTA 3A9CA 3ABKC 5J0RA 2VC9A 4JWMA 4C7OA 5COFA 4I2GA 4AT7A 3F46A 5HREA 2XSEA 3GWLA 4XA5A 1J8YF 1YA7O 2EPMX 4X4QA 2ZH5A 3WFQE 2PXIA 3UGPA 2BCQA 3EFOA 1Z6AA 1JPNA 2VANA 2X51A 5DBBA 1JAFA 4BJ5C 1M6TA 1ZQOA 3QW1A 2YQYA 2WVOA 1FFTC 2PX3A 4PJJA 3EF2A 2O9XA 4MF8A 4XQ7A 2HJ3A 8ICFA 3AQBA 4TUQA 2IM8A 4Z6FA 8ICMA 4N6HA 1AEPA 3QVYA 2FMPA 2HKVA 4NXXA 4U5CE 4WC0A 4KM5A 4JCHA 4QZCA 4YD1A 1D1AA 5CJ7A 5L0FA 4J30B 1ZQLA 1GS9A 2R7RA 4NTFA 4WC6A 1BPDA 3V5YA 2WB7A 4I1MA 4JKVA 1QSPA 1MMAA 5DLJA 4O9MA 3UPQA 1JAJA 5J2BA 4DO9A 4XWJA 1VYKA 2W4BA 1ZQSA 1TQGA 2EPLX 1EKYA 3DMDA 4N06A 1R8BA 9ICBA 4JIOA 1TKNA 4M9NA 4EBBA 1ZHXA 4NY3A 3FVYA 4UB1A 3ABMC 1ZU4A 3ZDLA 4CIHA 2Y39A 4UB2A 5JLIA 4JWNA 2X0CA 3FOOA 1D0ZA 2XL4A 9ICSA 1W2WA 4UB4A 5JT4A 3LUTB 5CFTA 1VB5A 4WGZA 3SNHA 1A7EA 4WC5A 3RW0A 1MIWA 8ICZA 3LQCB 2EIKC 5F5FA 3T6JA 3HNJA 1O87A 2ZH8A 5HRFA 3ISCA 2M4EA 5KYXB 2R03A 4PJMA 8ICRA 4WC7A 5JVEA 2KJGA 3NRHA 1S7ZA 3U8PA 3LJBA 4K1OA 4AL0A 3LS1A 4MVOA 2IBFA 3OWGA 1ZQCA 4X4NA 1D1BA 2LP4A 2M64A 4Z9JA 2Q9AA 2RD9A 4I2HA 2FFHA 4CSAC 4DOBA 2BBHA 1K05A 1ZQRA 3ZTMA 7ICNA 1YAUO 3RF3A
chains in the Genus database with same CATH topology
4YMOA 3PMLA 4LT6A 5DB8A 4IQTA 3C18A 3C5FA 2ZH3A 5HRBA 9ICAA 3OUYB 1MIYA 9ICEA 4NY8A 2O1PA 7ICPA 1ZJMA 5J0XA 1TV9A 4PGYA 4UD4A 3B0YA 4KLDA 8ICBA 5HRLA 5DDYA 4RPXA 3GM3A 2BCUA 3PMNA 4UD5A 4RQ6A 4R66A 4PH5A 4RWNA 3BRJA 4KLTA 4NQFA 2O5AA 2BCRA 4QZIA 4RT2A 4O5KA 2L6GA 4UAZA 2M2VA 4MFAA 2M2UA 5DECA 3HJ4A 4LZDA 1ZQNA 3H39A 7ICOA 8ICQA 9ICCA 1ZQUA 4TURA 1ZQYA 4I2AA 3HWTA 4QZFA 2DR8A 4I2FA 4LVSA 4EP7A 3RJIA 2RFFA 5BPCA 3GM2A 4AT8B 4M9JA 4I2CA 3RH4A 4P4OA 4PHDA 1ZQWA 2ZH4A 8ICCA 5DBAA 4RQ0A 3RH6A 1UEUA 4QZDA 4I2DA 4Z6CA 5DB6A 1OW8A 4UBCA 2ZHAA 4YMNA 8ICIA 2ZHBA 4P2HA 3OVBA 4KLGA 3NYBA 4XRHA 3JZ0A 5CP2A 1NO5A 4KLQA 4M9GA 4RWQA 7ICGA 4AT9B 4M5DA 9ICPA 3MDCA 1BPBA 2BCSA 1XSPA 2ZH6A 5J0WA 2DRBA 4O5CA 8ICEA 4FHVA 4X4RA 1WOLA 8ICVA 4ATBA 4MFFA 8ICYA 1KNYA 4M2YA 4PHAA 3MDAA 4I2BA 4RPZA 2P66A 4MFCA 5HHHA 1R8CA 2L6HA 3S9OA 2IHMA 4RQ8A 3ISDA 9ICXA 3U3FA 1ZQHA 3V72A 4F5RA 3AQLA 3B0XA 4X4OA 1KDHA 4AT8A 2DR7A 2FMQA 8ICXA 2PBEA 5IIJA 4QZEA 3JPNA 3U0CA 2DR9A 5BOMA 3RH5A 4I27A 1ZQPA 2ZH9A 1JQRA 5TZVA 2HSBA 4I2EA 4YN4A 8ICLA 4UB3A 5J29A 3UQ2A 1K04A 9ICQA 1V4AA 5CWRA 5J0PA 1ZQDA 9ICWA 4UAYA 4RQ5A 3JPTA 5IILA 4WCWA 3RJEA 4I2IA 5J0YA 1ZQMA 8ICGA 4X5VA 2ZH1A 8ICKA 1ZQVA 4WC3A 4WBYA 4XUSA 4QZGA 4WC1A 2BCVA 9ICNA 2YWAA 1R8AA 4NLZA 5CR0A 4NM1A 4F5PA 3OV7A 2BPGA 4I29A 4IQWA 3WFRE 3H3AA 2M2TA 3C8GA 3LK9A 5J2JA 1ZQXA 3H37A 3H38A 4NM2A 4X0AA 7ICTA 4GXIA 4NKTA 4PHEA 4I28A 4RT3A 5DKWA 1OU5A 3HW8A 1HUOA 2ISPA 4KLSA 9ICIA 1Q79A 9ICJA 2L6FA 3C8GD 5HRHA 4TUPA 5F28E 3AQMA 4YD2A 4P4MA 1R89A 4PGQA 3OGUA 4Z6DA 4F5NA 5DBCA 5D4BA 3RQGA 1TVAA 3AU2A 4E80A 3O10A 2BPFA 3RJKA 1UFBA 4K4HA 7ICUA 1ZQBA 4RWOA 8ICJA 5DEDA 4R64A 1FA0A 1JOGA 4TUSA 5CA7A 9ICMA 4Z6EA 4F5QA 7ICRA 1PV3A 4R63A 4FHPA 3JPOA 4AT7B 4KLFA 4X0BA 1ZQJA 3C8GB 5CHGA 2DR5A 4WBZA 3WFOA 1NOMA 3UPSA 1F5AA 4YMMA 3HIYA 3HJ1A 4PPXA 1O3UA 4X4PA 2NRKA 4R32A 1K40A 3V7JA 8ICPA 1BPYA 8ICTA 2JPUA 2ZH2A 3UQ0A 4E7XA 4WC2A 3UXPA 4QZ8A 5BOLA 3GM1A 1RZTA 4UB5A 1KEJA 2LK4A 4QZHA 2M2WA 3JPRA 2BE3A 4UAWA 3K75D 4EBKA 5DB7A 4I2JA 3C2MA 4QZ9A 2HHPA 4NLNA 1ZQFA 4RQ4A 5EOZA 4M0AA 3UXOA 1ZQZA 4IG8A 4WC4A 5J2HA 1XSLA 4M9HA 8ICNA 8ICOA 5HRKA 1ZQQA 4KLOA 1VJ7A 4K4GA 5HR9A 3JPQA 3TFRA 4FHXA 8ICWA 1JN3A 1UETA 4RPYA 2ISOA 4KLJA 4NKUA 2Q66A 4R65A 4X4UA 7ICJA 5J2IA 5J2DA 4ATBB 4FH3A 1VFGA 3AU6A 7ICHA 4GXJA 8ICUA 5J0OA 5J2KA 2JX0A 5DDMA 3RQEA 4XQ8A 3L8JA 4RQ3A 4FH5A 5J2FA 4P4PA 4DOCA 3TFSA 1ZQKA 2Q00A 4RWPA 2I9GA 1HUZA 8ICHA 1BPXA 1XSNA 3AJMA 4PGXA 7ICLA 4AT9A 1OW6A 5J2EA 4UBBA 5IIIA 3UXNA 7ICVA 5IIKA 5J0RA 4O5EA 4JWMA 4IQVA 9ICLA 5DB9A 4I2GA 1OW7A 4XEFA 4AT7A 5HREA 4QZBA 5IIMA 4XA5A 4M04A 1ZZPA 4X4QA 1MIVA 4KLMA 2ZH5A 2DVIA 3AQKA 3WFQE 2PXIA 2BCQA 3TULA 3K7DA 3GDXA 2VANA 5HRGA 1BPEA 3JPSA 5DBBA 4NLKA 4F5OA 4MF2A 1ZJNA 1ZQOA 2PFPA 1WTYA 4M9LA 4KLUA 1RPLA 4KLHA 4MF8A 2GWSA 5F2VO 4K4IA 4XQ7A 5J0UA 8ICFA 4EBJA 8ICAA 4TUQA 3RJJA 4Z6FA 1Q78A 8ICMA 1ZQIA 1QVXA 5J0SA 4QZAA 2FMPA 1TFWA 1ZQEA 5J0QA 3C66A 5J2GA 9ICKA 4WC0A 5J0TA 4QZCA 3OVAA 4YD1A 5CJ7A 1ZQLA 3MFNA 4WC6A 9ICRA 3ISBA 2PFQA 1JMSA 1BPDA 3V7KA 9ICHA 2ID1A 3MGIA 5J2CA 5HRIA 1PX5A 4O9MA 3L8IA 4KLIA 3UPQA 8ICSA 1JAJA 5J2BA 4DO9A 9ICOA 7ICEA 3C5GA 7ICIA 1ZQSA 3HX0A 1ZQTA 1ZQGA 4YCXA 1MQ2A 1R8BA 5J2AA 9ICBA 4XEKA 3JPPA 1ZQAA 7ICSA 7ICMA 3AUOA 4M9NA 4X4TA 4UB1A 2BPCA 1WOTA 4FHWA 4UB2A 2PFOA 4DOAA 4JWNA 4IQUA 5D46A 4RQ2A 1UEVA 4LZGA 3WFPA 4S3NA 1YLQA 9ICSA 4RQ7A 1KTMA 3L9DA 3OUYA 2ZH7A 5IIOA 9ICFA 1MQ3A 3MGHA 4UB4A 3RJGA 4E8FA 4M47A 4NXZA 7ICKA 1BPZA 4FO6A 9ICTA 2W9MA 4X4VA 4WC5A 1MIWA 3AQNA 8ICZA 3LQCB 7ICQA 4XEVA 2PFNA 3JYYA 2DRAA 4PHPA 5CB1A 2ZH8A 3MBYA 5HRFA 3V7LA 3RJFA 4X4SA 3C2LA 3ISCA 5HHIA 7ICFA 9ICGA 4KLEA 8ICRA 4WC7A 9ICUA 3OVSA 2FMSA 3C2KA 4GXKA 3RQFA 3RJHA 2KK1A 1TFYA 5D49A 1WWPA 3PNCA 4RQ1A 4FHYA 4KLLA 1ZQCA 9ICVA 4X4NA 5HRDA 4I2HA 5IINA 3WFSC 4DOBA 1K05A 1ZQRA 3B71A 7ICNA 5HC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMO A;  3PML A;  4LT6 A;  5DB8 A;  4IQT A;  3C18 A;  3C5F A;  2ZH3 A;  5HRB A;  9ICA A;  3OUY B;  1MIY A;  9ICE A;  4NY8 A;  2O1P A;  7ICP A;  1ZJM A;  5J0X A;  1TV9 A;  4PGY A;  4UD4 A;  3B0Y A;  4KLD A;  8ICB A;  5HRL A;  5DDY A;  4RPX A;  3GM3 A;  2BCU A;  3PMN A;  4UD5 A;  4RQ6 A;  4R66 A;  4PH5 A;  4RWN A;  3BRJ A;  4KLT A;  4NQF A;  2O5A A;  2BCR A;  4QZI A;  4RT2 A;  4O5K A;  2L6G A;  4UAZ A;  2M2V A;  4MFA A;  2M2U A;  5DEC A;  3HJ4 A;  4LZD A;  1ZQN A;  3H39 A;  7ICO A;  8ICQ A;  9ICC A;  1ZQU A;  4TUR A;  1ZQY A;  4I2A A;  3HWT A;  4QZF A;  2DR8 A;  4I2F A;  4LVS A;  4EP7 A;  3RJI A;  2RFF A;  5BPC A;  3GM2 A;  4AT8 B;  4M9J A;  4I2C A;  3RH4 A;  4P4O A;  4PHD A;  1ZQW A;  2ZH4 A;  8ICC A;  5DBA A;  4RQ0 A;  3RH6 A;  1UEU A;  4QZD A;  4I2D A;  4Z6C A;  5DB6 A;  1OW8 A;  4UBC A;  2ZHA A;  4YMN A;  8ICI A;  2ZHB A;  4P2H A;  3OVB A;  4KLG A;  3NYB A;  4XRH A;  3JZ0 A;  5CP2 A;  1NO5 A;  4KLQ A;  4M9G A;  4RWQ A;  7ICG A;  4AT9 B;  4M5D A;  9ICP A;  3MDC A;  1BPB A;  2BCS A;  1XSP A;  2ZH6 A;  5J0W A;  2DRB A;  4O5C A;  8ICE A;  4FHV A;  4X4R A;  1WOL A;  8ICV A;  4ATB A;  4MFF A;  8ICY A;  1KNY A;  4M2Y A;  4PHA A;  3MDA A;  4I2B A;  4RPZ A;  2P66 A;  4MFC A;  5HHH A;  1R8C A;  2L6H A;  3S9O A;  2IHM A;  4RQ8 A;  3ISD A;  9ICX A;  3U3F A;  1ZQH A;  3V72 A;  4F5R A;  3AQL A;  3B0X A;  4X4O A;  1KDH A;  4AT8 A;  2DR7 A;  2FMQ A;  8ICX A;  2PBE A;  5IIJ A;  4QZE A;  3JPN A;  3U0C A;  2DR9 A;  5BOM A;  3RH5 A;  4I27 A;  1ZQP A;  2ZH9 A;  1JQR A;  5TZV A;  2HSB A;  4I2E A;  4YN4 A;  8ICL A;  4UB3 A;  5J29 A;  3UQ2 A;  1K04 A;  9ICQ A;  1V4A A;  5CWR A;  5J0P A;  1ZQD A;  9ICW A;  4UAY A;  4RQ5 A;  3JPT A;  5IIL A;  4WCW A;  3RJE A;  4I2I A;  5J0Y A;  1ZQM A;  8ICG A;  4X5V A;  2ZH1 A;  8ICK A;  1ZQV A;  4WC3 A;  4WBY A;  4XUS A;  4QZG A;  4WC1 A;  2BCV A;  9ICN A;  2YWA A;  1R8A A;  4NLZ A;  5CR0 A;  4NM1 A;  4F5P A;  3OV7 A;  2BPG A;  4I29 A;  4IQW A;  3WFR E;  3H3A A;  2M2T A;  3C8G A;  3LK9 A;  5J2J A;  1ZQX A;  3H37 A;  3H38 A;  4NM2 A;  4X0A A;  7ICT A;  4GXI A;  4NKT A;  4PHE A;  4I28 A;  4RT3 A;  5DKW A;  1OU5 A;  3HW8 A;  1HUO A;  2ISP A;  4KLS A;  9ICI A;  1Q79 A;  9ICJ A;  2L6F A;  3C8G D;  5HRH A;  4TUP A;  5F28 E;  3AQM A;  4YD2 A;  4P4M A;  1R89 A;  4PGQ A;  3OGU A;  4Z6D A;  4F5N A;  5DBC A;  5D4B A;  3RQG A;  1TVA A;  3AU2 A;  4E80 A;  3O10 A;  2BPF A;  3RJK A;  1UFB A;  4K4H A;  7ICU A;  1ZQB A;  4RWO A;  8ICJ A;  5DED A;  4R64 A;  1FA0 A;  1JOG A;  4TUS A;  5CA7 A;  9ICM A;  4Z6E A;  4F5Q A;  7ICR A;  1PV3 A;  4R63 A;  4FHP A;  3JPO A;  4AT7 B;  4KLF A;  4X0B A;  1ZQJ A;  3C8G B;  5CHG A;  2DR5 A;  4WBZ A;  3WFO A;  1NOM A;  3UPS A;  1F5A A;  4YMM A;  3HIY A;  3HJ1 A;  4PPX A;  1O3U A;  4X4P A;  2NRK A;  4R32 A;  1K40 A;  3V7J A;  8ICP A;  1BPY A;  8ICT A;  2JPU A;  2ZH2 A;  3UQ0 A;  4E7X A;  4WC2 A;  3UXP A;  4QZ8 A;  5BOL A;  3GM1 A;  1RZT A;  4UB5 A;  1KEJ A;  2LK4 A;  4QZH A;  2M2W A;  3JPR A;  2BE3 A;  4UAW A;  3K75 D;  4EBK A;  5DB7 A;  4I2J A;  3C2M A;  4QZ9 A;  2HHP A;  4NLN A;  1ZQF A;  4RQ4 A;  5EOZ A;  4M0A A;  3UXO A;  1ZQZ A;  4IG8 A;  4WC4 A;  5J2H A;  1XSL A;  4M9H A;  8ICN A;  8ICO A;  5HRK A;  1ZQQ A;  4KLO A;  1VJ7 A;  4K4G A;  5HR9 A;  3JPQ A;  3TFR A;  4FHX A;  8ICW A;  1JN3 A;  1UET A;  4RPY A;  2ISO A;  4KLJ A;  4NKU A;  2Q66 A;  4R65 A;  4X4U A;  7ICJ A;  5J2I A;  5J2D A;  4ATB B;  4FH3 A;  1VFG A;  3AU6 A;  7ICH A;  4GXJ A;  8ICU A;  5J0O A;  5J2K A;  2JX0 A;  5DDM A;  3RQE A;  4XQ8 A;  3L8J A;  4RQ3 A;  4FH5 A;  5J2F A;  4P4P A;  4DOC A;  3TFS A;  1ZQK A;  2Q00 A;  4RWP A;  2I9G A;  1HUZ A;  8ICH A;  1BPX A;  1XSN A;  3AJM A;  4PGX A;  7ICL A;  4AT9 A;  1OW6 A;  5J2E A;  4UBB A;  5III A;  3UXN A;  7ICV A;  5IIK A;  5J0R A;  4O5E A;  4JWM A;  4IQV A;  9ICL A;  5DB9 A;  4I2G A;  1OW7 A;  4XEF A;  4AT7 A;  5HRE A;  4QZB A;  5IIM A;  4XA5 A;  4M04 A;  1ZZP A;  4X4Q A;  1MIV A;  4KLM A;  2ZH5 A;  2DVI A;  3AQK A;  3WFQ E;  2PXI A;  2BCQ A;  3TUL A;  3K7D A;  3GDX A;  2VAN A;  5HRG A;  1BPE A;  3JPS A;  5DBB A;  4NLK A;  4F5O A;  4MF2 A;  1ZJN A;  1ZQO A;  2PFP A;  1WTY A;  4M9L A;  4KLU A;  1RPL A;  4KLH A;  4MF8 A;  2GWS A;  5F2V O;  4K4I A;  4XQ7 A;  5J0U A;  8ICF A;  4EBJ A;  8ICA A;  4TUQ A;  3RJJ A;  4Z6F A;  1Q78 A;  8ICM A;  1ZQI A;  1QVX A;  5J0S A;  4QZA A;  2FMP A;  1TFW A;  1ZQE A;  5J0Q A;  3C66 A;  5J2G A;  9ICK A;  4WC0 A;  5J0T A;  4QZC A;  3OVA A;  4YD1 A;  5CJ7 A;  1ZQL A;  3MFN A;  4WC6 A;  9ICR A;  3ISB A;  2PFQ A;  1JMS A;  1BPD A;  3V7K A;  9ICH A;  2ID1 A;  3MGI A;  5J2C A;  5HRI A;  1PX5 A;  4O9M A;  3L8I A;  4KLI A;  3UPQ A;  8ICS A;  1JAJ A;  5J2B A;  4DO9 A;  9ICO A;  7ICE A;  3C5G A;  7ICI A;  1ZQS A;  3HX0 A;  1ZQT A;  1ZQG A;  4YCX A;  1MQ2 A;  1R8B A;  5J2A A;  9ICB A;  4XEK A;  3JPP A;  1ZQA A;  7ICS A;  7ICM A;  3AUO A;  4M9N A;  4X4T A;  4UB1 A;  2BPC A;  1WOT A;  4FHW A;  4UB2 A;  2PFO A;  4DOA A;  4JWN A;  4IQU A;  5D46 A;  4RQ2 A;  1UEV A;  4LZG A;  3WFP A;  4S3N A;  1YLQ A;  9ICS A;  4RQ7 A;  1KTM A;  3L9D A;  3OUY A;  2ZH7 A;  5IIO A;  9ICF A;  1MQ3 A;  3MGH A;  4UB4 A;  3RJG A;  4E8F A;  4M47 A;  4NXZ A;  7ICK A;  1BPZ A;  4FO6 A;  9ICT A;  2W9M A;  4X4V A;  4WC5 A;  1MIW A;  3AQN A;  8ICZ A;  3LQC B;  7ICQ A;  4XEV A;  2PFN A;  3JYY A;  2DRA A;  4PHP A;  5CB1 A;  2ZH8 A;  3MBY A;  5HRF A;  3V7L A;  3RJF A;  4X4S A;  3C2L A;  3ISC A;  5HHI A;  7ICF A;  9ICG A;  4KLE A;  8ICR A;  4WC7 A;  9ICU A;  3OVS A;  2FMS A;  3C2K A;  4GXK A;  3RQF A;  3RJH A;  2KK1 A;  1TFY A;  5D49 A;  1WWP A;  3PNC A;  4RQ1 A;  4FHY A;  4KLL A;  1ZQC A;  9ICV A;  4X4N A;  5HRD A;  4I2H A;  5IIN A;  3WFS C;  4DOB A;  1K05 A;  1ZQR A;  3B71 A;  7ICN A;  5HC9 A; 
#chains in the Genus database with same CATH topology
 2H7V C;  5DB8 A;  2Z15 A;  3C18 A;  2ZH3 A;  9ICA A;  1OR3 A;  1MIY A;  3ATP A;  2GAF D;  4O6A A;  2HMZ A;  3PHF 2;  5DDY A;  3RKO F;  4UD5 A;  4RQ6 A;  4R66 A;  3DJN B;  2LQG A;  3LLK A;  4NQF A;  2ZXP A;  2L6G A;  4UAZ A;  2OJQ A;  2G3V A;  5DQZ A;  2M2V A;  2M2U A;  3JTL O;  4NTA A;  3ASN C;  1ZQN A;  4YT5 A;  4TUR A;  2A6E F;  4I2F A;  4QZF A;  4K98 A;  1A7V A;  2ZH4 A;  4P9T A;  3DAF A;  3WHN A;  4PAC A;  5EHH A;  3RH6 A;  3S84 A;  1QQ3 A;  1NLX A;  5DB6 A;  4UBC A;  4P2H A;  1QZX A;  4A2N B;  2PNO A;  4CJG A;  2YLD A;  1T6U A;  3NYM A;  4CDA A;  4IAO A;  2W4M A;  1NO5 A;  2R02 A;  256B A;  4H54 A;  4K9A A;  4W8K A;  2CCY A;  3M4B A;  3G4X A;  2ZH6 A;  5J0W A;  2DRB A;  3U2L A;  2XLE A;  4X4R A;  1TR2 A;  4NXV A;  2I15 A;  3QTH A;  3GEH A;  4P9F A;  3QW0 A;  4N6C A;  5A6B A;  1JRA A;  3MDA A;  1MQV A;  2XLH A;  4FO1 A;  4RPZ A;  4MFC A;  3UGO A;  3L34 A;  3LAY A;  4LLC A;  1BR2 A;  3S9O A;  1OCO C;  4ULV A;  3U3F A;  3PMR A;  3C8Z A;  1M2V B;  4X4O A;  5DS4 A;  3PDM P;  4FX5 A;  2LD6 A;  2KYH A;  2ZH9 A;  1IW7 F;  2HSB A;  4YN4 A;  8ICL A;  2OEX A;  3K33 A;  5J29 A;  1K04 A;  1A7D A;  3PCV A;  4LEV A;  9ICQ A;  5CWR A;  2CDQ A;  1FNT c;  9ICW A;  4UAY A;  4RQ5 A;  4H4K C;  5DS5 A;  1L3P A;  3ZG1 A;  3Q6N A;  5FZT A;  4X5V A;  4B6I A;  4ZLC A;  1ZQV A;  4WC3 A;  3SXZ A;  3W4Y A;  2Q4F A;  4NLZ A;  5E2Q A;  3U9J A;  4F5P A;  4MVQ A;  3OV7 A;  1SF8 A;  4FWV A;  2G3K A;  2M2T A;  3C8G A;  2AWC A;  1TFK B;  4ULW A;  5L3V A;  5T3T A;  2E87 A;  5AC5 A;  1IZM A;  1OU5 A;  3HW8 A;  3B29 A;  4KLS A;  2XLO A;  1Q0K A;  5F28 E;  4P4M A;  4RDA A;  2NUT A;  5D63 A;  4K99 A;  1HMO A;  2NUP B;  3EG9 B;  1OKK D;  1MNE A;  1ZQB A;  1O5H A;  4OIP F;  5DED A;  5BQH A;  4JEB A;  1JOG A;  3ER8 C;  3IQT A;  3FAP B;  3MX3 A;  2GA9 D;  9ICM A;  1RMV A;  1PV3 A;  2J9B A;  3UMK A;  2XLW A;  4QI2 A;  1N1C A;  5DQT A;  1F1M A;  4WBZ A;  3EZH A;  2Y3G A;  5E3A A;  1F5A A;  3HIY A;  4JJG A;  1RJ9 A;  5CI9 A;  3B0V C;  4X4P A;  4R32 A;  3ZWI A;  4K96 A;  3IQ5 A;  2ZH2 A;  4QZ8 A;  4AK9 A;  1LI7 A;  4N4W A;  3ZQV A;  2BE3 A;  1RXQ A;  4EBK A;  4YL1 A;  3B0U X;  3FXH A;  1GGQ A;  4YT8 A;  5EOZ A;  3UXO A;  5J2H A;  2HV7 A;  5JS5 A;  2EPO A;  8ICO A;  1ZQQ A;  4KLO A;  1VJ7 A;  3N2Z B;  4EKW A;  2FGY A;  4UDV A;  8ICW A;  1FFH A;  1Q0D A;  4RPY A;  2VCC A;  3W8I A;  5J2I A;  5J2D A;  4XPY A;  2XL8 A;  7ICH A;  4JE9 A;  2JX0 A;  2PX0 A;  3JSE O;  3RQE A;  2EWR A;  2MHR A;  2ZXO A;  4XQ8 A;  3T9O A;  3POV A;  4DOC A;  1FAP B;  1ZQK A;  1HUZ A;  1ORY A;  4DOZ A;  3EGD B;  7ICL A;  2YKZ A;  2RSE B;  3G4Z A;  4AT9 A;  5J2E A;  1BBH A;  4UBB A;  5IIK A;  3CAX A;  2J9V A;  2WZF A;  4O5E A;  1E85 A;  4IQV A;  2AVK A;  1EA8 A;  4N7R A;  3JCF A;  4M04 A;  2P1A A;  4RBN A;  4CDY A;  1ZZP A;  2OJE D;  5CIV A;  5B3Q A;  4NC3 A;  1I4Z A;  4MKP A;  1BPE A;  1OR2 A;  3JPS A;  1ZHW A;  4NLK A;  3GOR A;  2IHO A;  4BJ1 A;  4F5O A;  1ZJN A;  3IEE A;  2PFP A;  4U5D E;  4K97 A;  2GWS A;  3HTK C;  4CJO A;  3IHU A;  5KYU B;  4O6M A;  3V5Z A;  1Q78 A;  5A6A A;  1ZQI A;  2VAS A;  4PR9 A;  2IXP A;  4QZA A;  1LE2 A;  1TFW A;  3DKA A;  3MYI A;  3M79 A;  2AP3 A;  5J2G A;  9ICK A;  1A41 A;  3N24 A;  4JJF A;  3F47 A;  2IYL D;  4MVZ A;  9ICH A;  2C03 A;  3V7K A;  1PD0 A;  2Q9B A;  4BJ6 A;  4IJJ A;  1D0X A;  4HEA J;  3L8I A;  4KLI A;  3KMI A;  3CEX A;  1T6I A;  4U5G A;  5J2A A;  4XEK A;  1Z23 A;  3JPP A;  1MMD A;  7ICS A;  7ICM A;  1LS4 A;  4X4T A;  2Q3T A;  4J7Y A;  1WOT A;  3IPM O;  1CPQ A;  3EGX A;  3B0P A;  3FMS A;  3U5S A;  3L0I A;  2PFO A;  4DOA A;  2DB4 A;  2B51 A;  3KH2 A;  2GA0 A;  4LZG A;  4EGW A;  1YLQ A;  4G7O F;  5IIO A;  9ICF A;  1MQ3 A;  3RJG A;  4JW1 A;  4NXZ A;  2DGJ A;  1KU2 A;  2H7B A;  1TWH A;  3DWW A;  3SXY A;  2YZS A;  7ICQ A;  2PFN A;  1E83 A;  4PHP A;  3C63 A;  2CGE A;  2BL2 A;  3RJF A;  2YHS A;  1HW1 A;  4FAP B;  2KW3 C;  2FMS A;  5KYN A;  3NWI A;  2XS8 A;  2R7U A;  1WWP A;  3EPV A;  4MW3 A;  4FHY A;  2EIN C;  9ICV A;  2EPN A;  2ETS A;  3K1I C;  2MWQ A;  4NTB A;  1ZHT A;  4JTD B;  1RKE B;  4BJ5 A;  1T9K A;  2EIJ C;  1JR8 A;  1G4W R;  2NUT B;  4YMO A;  3PML A;  3CQZ A;  3S90 A;  4E18 A;  4G78 A;  1UG7 A;  2O1P A;  7ICP A;  3EJN A;  1FTS A;  2JD3 A;  4BEM J;  4UD4 A;  8ICB A;  5HRL A;  5L0I A;  1RKC A;  1Q0F A;  2KQ9 A;  2DI3 A;  1T01 A;  4MTO A;  3CZ6 A;  3BRJ A;  4I3M A;  2BCR A;  1M57 C;  1NSG B;  5DVW A;  2EIL C;  5DEC A;  4P6I C;  3HJ4 A;  4LZD A;  7ICO A;  8ICQ A;  1ZQU A;  1ZQY A;  4BEJ A;  4I2A A;  4OAG A;  2QUP A;  1D0Y A;  4I2C A;  4P4O A;  3X2Q C;  1ZQW A;  4F4B A;  4PHD A;  5DBA A;  1ZU5 A;  4I44 A;  1VMA A;  1D1C A;  5KYX A;  1U0B B;  4QZD A;  4I2D A;  2BE5 F;  2IXN A;  3VM6 A;  1J8M F;  4YK5 A;  3ZIB A;  4J7T A;  2XLM A;  4KLG A;  4CIP A;  3JZ0 A;  5CP2 A;  4AT9 B;  4M5D A;  1BPB A;  1XSP A;  3RH3 A;  2IXO A;  4OIN F;  4FHV A;  3HKK A;  1WOL A;  2NSF A;  1M2V A;  1WN0 A;  3QZC A;  8ICV A;  4MFF A;  4O79 A;  3ITF A;  4PHA A;  4I2B A;  2P66 A;  1R8C A;  2L6H A;  3LLI A;  2IHM A;  5D62 A;  4MVR A;  1MMG A;  3EH2 A;  1KDH A;  2DR7 A;  8ICX A;  2PBE A;  3JPN A;  3U0C A;  4U5F E;  1SR2 A;  4LER A;  3RH5 A;  2NUP A;  3JCU Q;  1ZQP A;  1XWJ A;  3DM9 B;  5TZV A;  4I2E A;  5COM A;  3M4C A;  1C03 A;  1TFO B;  4PJN A;  2J9W A;  4XJE A;  5J0P A;  3SEO A;  1E2X A;  1NBB A;  4BG0 A;  4ER9 A;  4OIO F;  1Z5Z A;  3RJE A;  4YL0 A;  4GYT A;  1ZQM A;  2PFD A;  3EH1 A;  1ORS C;  1RJ9 B;  4C3D A;  4JTC B;  3K1I A;  1DOW A;  1APC A;  1R8A A;  4OAF A;  4I29 A;  3WFR E;  3H3A A;  1HE9 A;  1HMD A;  2HFI A;  7ICT A;  4PHE A;  2OCC C;  1CPR A;  1HUO A;  4KNW A;  4TUP A;  3AQM A;  1R89 A;  4PGQ A;  4F5N A;  1MND A;  4U5B E;  1TVA A;  1AUE A;  4MW8 A;  3AU2 A;  3AG4 C;  2L81 A;  3ZQY A;  1UFB A;  4CS7 A;  5B1B C;  7ICU A;  2YEV A;  3X1O A;  4R64 A;  2Y3B A;  3A11 A;  4TUS A;  5CA7 A;  4JRZ A;  3TOL A;  2XLV A;  4Z9I A;  5AC4 A;  7ICR A;  3AG1 C;  3ERC C;  3JPO A;  4AT7 B;  4KLF A;  1ZQJ A;  4A4A A;  4K0D A;  1NOM A;  4M63 A;  2HZ8 A;  3V7J A;  1K40 A;  4Q4Z F;  8ICT A;  3EGX B;  4U5H A;  4MND A;  4MQ9 F;  2PP4 A;  5BOL A;  4UB5 A;  1ZHZ A;  1KEJ A;  3B9Q A;  2HJM A;  2D4U A;  3K75 D;  5A6B D;  2VCA A;  4C3B A;  5DB7 A;  3MBG A;  4NXT A;  1V74 B;  3C2M A;  4QZ9 A;  2HHP A;  1ZQF A;  1OCZ C;  3U8V A;  4M0A A;  3C7J A;  4IAQ A;  2J0W A;  4K7B A;  3EQL F;  2ICW G;  1XSL A;  4M9H A;  2MYS A;  8ICN A;  5HRK A;  3NKD A;  2W9Y A;  4K4G A;  4XLP F;  3JPQ A;  2OU6 A;  4XTK A;  1UET A;  2ISO A;  5D91 A;  4NKU A;  3M15 A;  1ZHY A;  4X4U A;  3T6B A;  3U2M A;  1GQA A;  2J0X A;  3VF0 A;  1NZE A;  3OWT A;  4GXJ A;  1H9G A;  3RVY A;  5J2K A;  1LI5 A;  3I5Q A;  3L8J A;  1T6Q A;  2YVK A;  5A6J A;  4P4P A;  2HN1 A;  1Y4C A;  4WJ0 A;  2WL8 A;  2I8B A;  3KKB A;  4PGX A;  1OW6 A;  5III A;  2UUH A;  3UXN A;  4G7Z F;  2A0B A;  3ER9 B;  1OW7 A;  1BR4 A;  3OA1 A;  4QZB A;  4XPX A;  3QMK A;  1ZW3 A;  4JLZ A;  2DVI A;  3KL4 A;  4BJ6 C;  1SZI A;  3S29 A;  3K7D A;  3AG2 C;  1HW2 A;  3NYL A;  2CW0 F;  3DI5 A;  4WQL A;  5JUA A;  5CI8 A;  3TK0 A;  4MVM A;  2IOQ A;  1WTY A;  4M9L A;  2QE9 A;  3H2V A;  3O6X A;  4KLU A;  2WZL A;  4EIY A;  5F2V O;  4E0H A;  4G7H F;  4LAC B;  4EED A;  4EBJ A;  2VCB A;  2XLD A;  1H7I A;  3Q7G A;  3DZA A;  1ZYR F;  4DBQ A;  5J0S A;  1ZQE A;  2XM4 A;  4JUR I;  3C66 A;  1YJG A;  3OVA A;  1Z63 A;  3US6 A;  3MFN A;  3U9M A;  3ISB A;  2ID1 A;  3E9V A;  5HRI A;  9ICO A;  1FR0 A;  7ICE A;  1ZQT A;  3HX0 A;  1ZQG A;  2VH3 A;  5EK0 A;  1ZQA A;  2P6V A;  3TQO A;  1T5O A;  1LVK A;  2YL7 A;  4OD4 A;  4IQU A;  2J8W A;  2J46 A;  3K66 A;  3LEO A;  2H7O A;  2YL3 A;  4RQ2 A;  3WFP A;  3NDB B;  1ORJ A;  1I5N A;  4RQ7 A;  3ZTZ A;  1KTM A;  3L9D A;  3LES A;  3PHZ A;  2ZH7 A;  3MGH A;  3SXM A;  3FAJ A;  4M47 A;  1YAR O;  4X0R A;  3E70 C;  4IWB A;  2B0H A;  1JMW A;  2A69 F;  4K8V A;  3G50 A;  3JYY A;  4IGG A;  5CB1 A;  1XZQ A;  2XM0 A;  4CBE A;  1BZ4 A;  3V7L A;  1FMW A;  5HHI A;  7ICF A;  9ICG A;  3RIP A;  4KLE A;  3ZC4 A;  3OVS A;  3C2K A;  5KYY A;  3RQF A;  3RJH A;  2J45 A;  1NFN A;  4RQ1 A;  4KLL A;  2QNL A;  4QI0 A;  2OEV A;  5IIN A;  1WAS A;  2CNW A;  3TJ6 A;  5HC9 A;  4JC7 A;  2BC5 A;  4E7Z A;  3NMI A;  3S27 A;  4LT6 A;  2F22 A;  4IQT A;  4Q7C A;  3ABL C;  3DM5 A;  3C5F A;  2LFD A;  3K1H A;  5HRB A;  3OUY B;  1C17 M;  1FMV A;  3DXJ F;  3B0Y A;  4LEY A;  3ZVR A;  4AE4 B;  5IY5 C;  3GM3 A;  3Q6M A;  2BCU A;  2R7V A;  4PH5 A;  1PD1 A;  3WAQ A;  4KLT A;  2H8A A;  4QZI A;  4O5K A;  2P0N A;  4AX2 A;  3SYN A;  4LLE A;  2J7P A;  4W8P A;  4CDV A;  3H39 A;  3HWT A;  4LVS A;  3EHN A;  4EP7 A;  1Z7Q c;  2RFF A;  3GM2 A;  4AT8 B;  1NU7 D;  2DYR C;  1GM5 A;  8ICC A;  4RQ0 A;  4HX0 A;  1NFO A;  1H6G A;  4CS8 C;  1YZC A;  3KPH A;  3GEI A;  3JYH A;  4YMN A;  1VTM P;  2ZHB A;  1Q0G A;  3OVB A;  3DE9 A;  4YL3 A;  3NYB A;  4XRH A;  4KLQ A;  4M9G A;  4RWQ A;  1SMY F;  9ICP A;  3MDC A;  2BCS A;  1L7C A;  1LS1 A;  5KYW A;  4XQ1 A;  5E3C A;  4ATB A;  2VB6 A;  1KNY A;  3VRC A;  1YDI A;  3ZSU A;  2ZPA A;  5HHH A;  9ICX A;  4RQ8 A;  1OQC A;  1ZQH A;  2LFF A;  4CS9 A;  1I4Y A;  4F5R A;  3N0T A;  3MLG A;  2FMQ A;  2HN2 A;  4I0U A;  3I4U A;  2DR9 A;  5BOM A;  4DBR A;  3SP1 A;  1JQR A;  3EG9 A;  4UB3 A;  4JTA B;  4OIQ F;  3RFY A;  3UQ2 A;  3W2W A;  1M2O A;  3JT1 A;  1DOV A;  1HY5 A;  4U9D A;  2C04 A;  2KNH A;  3DD7 A;  5IIL A;  4OAI Z;  1XZP A;  8ICG A;  3HNK A;  3SXK A;  5F5H A;  2ZH1 A;  4QDL A;  4ANJ A;  3FDQ A;  2BCV A;  1SYQ A;  9ICN A;  2YWA A;  2NSG A;  5CR0 A;  2BPG A;  3ECS A;  5BQG A;  5J2J A;  4JCZ A;  4X0A A;  4NKT A;  4I28 A;  2DYS C;  5DKW A;  2ISP A;  9ICI A;  2L6F A;  3NMK A;  4YD2 A;  4E0I A;  4Z9H A;  2B56 A;  1VLS A;  3JRT A;  3LNR A;  5DBC A;  5D4B A;  2J7P D;  3O10 A;  2LIG A;  3EHM A;  2BPF A;  3RJK A;  3T6G B;  1HE1 A;  2XS1 A;  1JPJ A;  1PCX A;  4JEA A;  2OQM A;  8ICJ A;  2R7Q A;  3HNI A;  3RVZ A;  4DRH B;  4Z6E A;  1YYJ A;  1V55 C;  5GPG B;  3W8H A;  4R63 A;  4FHP A;  1GPJ A;  5B3I A;  4PFP A;  2CYD A;  2LCH A;  4X0B A;  3C8G B;  2DR5 A;  3WFO A;  3UPS A;  3HJ1 A;  1TWG A;  2HV6 A;  4LDR A;  1O3U A;  2NRK A;  4MVS A;  2GWW A;  2L9J A;  2Q7R A;  4MVU A;  5L0H A;  2UUI A;  2CNW D;  4E7X A;  1Q0M A;  3J06 A;  3GM1 A;  2B4V A;  3TOM A;  1NU9 C;  4EWC A;  2YRF A;  3S0X A;  4IB4 A;  4CX9 A;  4QZH A;  4UAW A;  2QLA A;  1YVI A;  4YN0 B;  1YLM A;  4C7O B;  4DRJ B;  2OG2 A;  4RQ4 A;  1ZQZ A;  4IG8 A;  4WC4 A;  3TJ5 A;  3DE8 A;  4DVZ A;  2YLI A;  3TFR A;  4FHX A;  1JN3 A;  1YZA A;  3VYW A;  2Q66 A;  3UNG C;  4R65 A;  4ATB B;  4FH3 A;  1VYI A;  4AE4 A;  3AU6 A;  3GEE A;  4K9B A;  5DDM A;  5FCL A;  5CFS A;  4RQ3 A;  3MYF A;  3DAG A;  1QPU A;  3TFS A;  2Q00 A;  2I9G A;  3U3B A;  8ICH A;  3BEH A;  1BPX A;  3AJM A;  4LDQ A;  3FHD A;  4WQK A;  1WAT A;  3W2V A;  4JZA A;  7ICV A;  4AL1 A;  9ICL A;  5DB9 A;  2A6H F;  4XEF A;  5IIM A;  1OCR C;  3RYL A;  4PK4 A;  4KI2 A;  1MIV A;  4KLM A;  3AQK A;  2ZXR A;  2P7V A;  4MS2 A;  2J9U A;  3TUL A;  5AGF A;  3IQC A;  4E17 A;  3GDX A;  5HRG A;  1B68 A;  4MF2 A;  3FOP A;  2AU5 A;  1VOM A;  4I1O B;  2YL1 A;  2XXA A;  3LS0 A;  4ONS A;  1RPL A;  4KLH A;  4IAR A;  2LSE A;  3TD7 A;  4K4I A;  5T3W A;  1H9T A;  5J0U A;  8ICA A;  3M1C B;  3SZR A;  3RJJ A;  1U6H A;  1QVX A;  2PF4 E;  2Q9C A;  3K6B A;  3EGD A;  1LM3 B;  5J0Q A;  2D5R B;  5D92 A;  4PJL A;  4JVS A;  4U5E E;  4OD5 A;  5J0T A;  1YA9 A;  3AQC A;  4J32 B;  4BPM A;  9ICR A;  2PFQ A;  1JMS A;  3MGI A;  5J2C A;  1PX5 A;  2R7T A;  8ICS A;  3HLZ A;  3C5G A;  7ICI A;  4YCX A;  1MQ2 A;  1QLE C;  4DXW A;  5JRA A;  1E86 A;  2NPU A;  3AUO A;  1CGM E;  3KYI A;  2BPC A;  4FHW A;  5KYW B;  3AGT A;  1Y6D A;  5D46 A;  2FAP B;  2Y69 C;  3AGU A;  1UEV A;  2KGO A;  5DS6 A;  4S3N A;  1RKE A;  3OUY A;  2HMQ A;  1E84 A;  4E8F A;  1G4U S;  7ICK A;  2WVN A;  1BPZ A;  1M56 C;  4FO6 A;  9ICT A;  1S05 A;  2W9M A;  3L1M A;  4O6Y A;  2R7O A;  4X4V A;  3AQN A;  2G62 A;  4XEV A;  4U9E A;  2DRA A;  4CSA A;  4WOY A;  2L7A A;  4LDK A;  3MBY A;  2BBJ A;  5KYU A;  1LE4 A;  4KC9 A;  4X4S A;  3C2L A;  2ASR A;  5CFU A;  3CK6 A;  4EHP A;  1NG1 A;  9ICU A;  4O67 A;  4ZLD A;  1RCP A;  4GXK A;  4BJT A;  2WZG A;  2KK1 A;  3I5P A;  4YT4 A;  1TFY A;  5D49 A;  4C3E A;  3PNC A;  2W45 A;  1OXB A;  3O39 A;  4KNV A;  3S28 A;  4O6N A;  5HRD A;  4WH5 A;  2A0U A;  1ZVZ A;  3AG3 C;  3WFS C;  4EV6 A;  3B71 A;  2R25 A;  5CHE A;  4DRI B;  1G8X A;  2XXA B;  3JSZ A;  4OAH A;  1LKX A;  2HS5 A;  1U89 A;  9ICE A;  1VK5 A;  4NY8 A;  3JRM O;  3LEV A;  1ZJM A;  5J0X A;  1TV9 A;  1CGO A;  5L0D A;  3V7O A;  4PGY A;  4KLD A;  2IXM A;  2YLG A;  4RPX A;  3PMN A;  3MCR A;  4RWN A;  2O5A A;  4RT2 A;  3VAY A;  2ZD9 A;  1A0B A;  2R05 A;  4MFA A;  4GQH A;  9ICC A;  3LNM B;  3R2P A;  2DR8 A;  2GAQ A;  3RJI A;  5BPC A;  4XPW A;  4M9J A;  4DJ9 A;  3RH4 A;  3QVZ A;  4YWQ A;  2OKU A;  2V26 A;  5HSW A;  4KBL A;  5L0G A;  4GEH A;  1UEU A;  5JSL A;  1ZW2 A;  3IQ6 A;  5HV9 A;  3H65 A;  4Z6C A;  1OW8 A;  2ZHA A;  8ICI A;  1LIH A;  1CGN A;  5COG A;  2KC3 A;  7ICG A;  2QTV A;  4CS8 A;  4NCQ A;  3GAN A;  3AOU A;  4O5C A;  8ICE A;  2Y3H A;  4EUK B;  1R5I D;  8ICY A;  3C62 A;  3DJU B;  4D4N A;  4M2Y A;  3CSK A;  2R7X A;  4L6R A;  3ISD A;  1AVO B;  3V72 A;  3ASO C;  3AQL A;  1QKR A;  3B0X A;  2QY9 A;  4AT8 A;  2XL6 A;  5IIJ A;  4QZE A;  4O7G A;  4FES A;  1OKK A;  2EPK X;  4RD9 A;  4PFO A;  4I27 A;  3WG7 C;  3UR3 C;  5BQI A;  3H2U A;  4NXU A;  3NVO A;  5D61 A;  1V4A A;  4WGY A;  1ZQD A;  3JPT A;  3NKE A;  4WCW A;  3T4R A;  2Y3D A;  1Z3I X;  4I2I A;  5J0Y A;  4D4X A;  4CS9 C;  2HSQ A;  4MTF A;  8ICK A;  4KB6 A;  2GFH A;  2OOC A;  4WBY A;  4XUS A;  4QZG A;  4YJW A;  5B1A C;  2TMV P;  4WC1 A;  1R4T A;  1BR1 A;  4OIR F;  4NM1 A;  4IQW A;  1OCC C;  3LK9 A;  3GWN A;  3UMI A;  2B0J A;  1ZQX A;  3H37 A;  4O68 A;  3H38 A;  4NM2 A;  5E33 A;  4GXI A;  4IRU A;  3NG1 A;  4RT3 A;  3EFO B;  5BUO A;  4HFK B;  1Q79 A;  9ICJ A;  4DVY P;  3C8G D;  5HRH A;  1OXK A;  3OEO A;  3OGU A;  4Q5S F;  3V5X A;  2IUB A;  1EQ1 A;  4Z6D A;  2GDC A;  3RQG A;  4EEB A;  4WAB A;  2A68 F;  4E7S A;  4YT2 A;  4E80 A;  2ZXW C;  2FCL A;  3GOD A;  2KSF A;  3Q7L A;  4K4H A;  4RWO A;  4HE8 D;  1ST6 A;  1EI7 A;  1FA0 A;  3R7C A;  4MTG A;  5L0J A;  5JP7 A;  4F5Q A;  3UMH A;  5A69 A;  4LEW A;  5T1D B;  1BDJ B;  3KYJ A;  5CHG A;  4YMM A;  5KYY B;  4PPX A;  5K0I A;  2AWY A;  8ICP A;  1BPY A;  3NMJ A;  2JPU A;  3UQ0 A;  4JLX A;  4WC2 A;  3UXP A;  4G0H A;  1LPE A;  1RZT A;  2YL0 A;  2LK4 A;  2M2W A;  3JPR A;  3NYJ A;  3O55 A;  2EIM C;  5L3Q A;  4I2J A;  4NLN A;  5B3S C;  4XLN F;  2P61 A;  5EGY A;  2R9R B;  1G5Z A;  2HUJ A;  5L0C A;  5HR9 A;  1MMN A;  2R7W A;  4KLJ A;  1C02 A;  1TWA A;  4NXW A;  3HJC A;  2XRH A;  2R7S A;  5JTG A;  4O69 A;  7ICJ A;  1V54 C;  1WGW A;  2NG1 A;  3NKU A;  1VFG A;  2A1D D;  8ICU A;  2WVQ A;  5J0O A;  1TWC A;  4FH5 A;  5B3P A;  5J2F A;  5A6K A;  4LEZ A;  2V3C C;  1YYX A;  3WOD F;  4RWP A;  5TJ5 E;  1XSN A;  3HNL A;  4HFF B;  3EZI A;  1VLT A;  3A9C A;  3ABK C;  5J0R A;  2VC9 A;  4JWM A;  4C7O A;  5COF A;  4I2G A;  4AT7 A;  3F46 A;  5HRE A;  2XSE A;  3GWL A;  4XA5 A;  1J8Y F;  1YA7 O;  2EPM X;  4X4Q A;  2ZH5 A;  3WFQ E;  2PXI A;  3UGP A;  2BCQ A;  3EFO A;  1Z6A A;  1JPN A;  2VAN A;  2X51 A;  5DBB A;  1JAF A;  4BJ5 C;  1M6T A;  1ZQO A;  3QW1 A;  2YQY A;  2WVO A;  1FFT C;  2PX3 A;  4PJJ A;  3EF2 A;  2O9X A;  4MF8 A;  4XQ7 A;  2HJ3 A;  8ICF A;  3AQB A;  4TUQ A;  2IM8 A;  4Z6F A;  8ICM A;  4N6H A;  1AEP A;  3QVY A;  2FMP A;  2HKV A;  4NXX A;  4U5C E;  4WC0 A;  4KM5 A;  4JCH A;  4QZC A;  4YD1 A;  1D1A A;  5CJ7 A;  5L0F A;  4J30 B;  1ZQL A;  1GS9 A;  2R7R A;  4NTF A;  4WC6 A;  1BPD A;  3V5Y A;  2WB7 A;  4I1M A;  4JKV A;  1QSP A;  1MMA A;  5DLJ A;  4O9M A;  3UPQ A;  1JAJ A;  5J2B A;  4DO9 A;  4XWJ A;  1VYK A;  2W4B A;  1ZQS A;  1TQG A;  2EPL X;  1EKY A;  3DMD A;  4N06 A;  1R8B A;  9ICB A;  4JIO A;  1TKN A;  4M9N A;  4EBB A;  1ZHX A;  4NY3 A;  3FVY A;  4UB1 A;  3ABM C;  1ZU4 A;  3ZDL A;  4CIH A;  2Y39 A;  4UB2 A;  5JLI A;  4JWN A;  2X0C A;  3FOO A;  1D0Z A;  2XL4 A;  9ICS A;  1W2W A;  4UB4 A;  5JT4 A;  3LUT B;  5CFT A;  1VB5 A;  4WGZ A;  3SNH A;  1A7E A;  4WC5 A;  3RW0 A;  1MIW A;  8ICZ A;  3LQC B;  2EIK C;  5F5F A;  3T6J A;  3HNJ A;  1O87 A;  2ZH8 A;  5HRF A;  3ISC A;  2M4E A;  5KYX B;  2R03 A;  4PJM A;  8ICR A;  4WC7 A;  5JVE A;  2KJG A;  3NRH A;  1S7Z A;  3U8P A;  3LJB A;  4K1O A;  4AL0 A;  3LS1 A;  4MVO A;  2IBF A;  3OWG A;  1ZQC A;  4X4N A;  1D1B A;  2LP4 A;  2M64 A;  4Z9J A;  2Q9A A;  2RD9 A;  4I2H A;  2FFH A;  4CSA C;  4DOB A;  2BBH A;  1K05 A;  1ZQR A;  3ZTM A;  7ICN A;  1YAU O;  3RF3 A; 
#chains in the Genus database with same CATH homology
 4YMO A;  3PML A;  4LT6 A;  5DB8 A;  4IQT A;  3C18 A;  3C5F A;  2ZH3 A;  5HRB A;  9ICA A;  3OUY B;  1MIY A;  9ICE A;  4NY8 A;  2O1P A;  7ICP A;  1ZJM A;  5J0X A;  1TV9 A;  4PGY A;  4UD4 A;  3B0Y A;  4KLD A;  8ICB A;  5HRL A;  5DDY A;  4RPX A;  3GM3 A;  2BCU A;  3PMN A;  4UD5 A;  4RQ6 A;  4R66 A;  4PH5 A;  4RWN A;  3BRJ A;  4KLT A;  4NQF A;  2O5A A;  2BCR A;  4QZI A;  4RT2 A;  4O5K A;  2L6G A;  4UAZ A;  2M2V A;  4MFA A;  2M2U A;  5DEC A;  3HJ4 A;  4LZD A;  1ZQN A;  3H39 A;  7ICO A;  8ICQ A;  9ICC A;  1ZQU A;  4TUR A;  1ZQY A;  4I2A A;  3HWT A;  4QZF A;  2DR8 A;  4I2F A;  4LVS A;  4EP7 A;  3RJI A;  2RFF A;  5BPC A;  3GM2 A;  4AT8 B;  4M9J A;  4I2C A;  3RH4 A;  4P4O A;  4PHD A;  1ZQW A;  2ZH4 A;  8ICC A;  5DBA A;  4RQ0 A;  3RH6 A;  1UEU A;  4QZD A;  4I2D A;  4Z6C A;  5DB6 A;  1OW8 A;  4UBC A;  2ZHA A;  4YMN A;  8ICI A;  2ZHB A;  4P2H A;  3OVB A;  4KLG A;  3NYB A;  4XRH A;  3JZ0 A;  5CP2 A;  1NO5 A;  4KLQ A;  4M9G A;  4RWQ A;  7ICG A;  4AT9 B;  4M5D A;  9ICP A;  3MDC A;  1BPB A;  2BCS A;  1XSP A;  2ZH6 A;  5J0W A;  2DRB A;  4O5C A;  8ICE A;  4FHV A;  4X4R A;  1WOL A;  8ICV A;  4ATB A;  4MFF A;  8ICY A;  1KNY A;  4M2Y A;  4PHA A;  3MDA A;  4I2B A;  4RPZ A;  2P66 A;  4MFC A;  5HHH A;  1R8C A;  2L6H A;  3S9O A;  2IHM A;  4RQ8 A;  3ISD A;  9ICX A;  3U3F A;  1ZQH A;  3V72 A;  4F5R A;  3AQL A;  3B0X A;  4X4O A;  1KDH A;  4AT8 A;  2DR7 A;  2FMQ A;  8ICX A;  2PBE A;  5IIJ A;  4QZE A;  3JPN A;  3U0C A;  2DR9 A;  5BOM A;  3RH5 A;  4I27 A;  1ZQP A;  2ZH9 A;  1JQR A;  5TZV A;  2HSB A;  4I2E A;  4YN4 A;  8ICL A;  4UB3 A;  5J29 A;  3UQ2 A;  1K04 A;  9ICQ A;  1V4A A;  5CWR A;  5J0P A;  1ZQD A;  9ICW A;  4UAY A;  4RQ5 A;  3JPT A;  5IIL A;  4WCW A;  3RJE A;  4I2I A;  5J0Y A;  1ZQM A;  8ICG A;  4X5V A;  2ZH1 A;  8ICK A;  1ZQV A;  4WC3 A;  4WBY A;  4XUS A;  4QZG A;  4WC1 A;  2BCV A;  9ICN A;  2YWA A;  1R8A A;  4NLZ A;  5CR0 A;  4NM1 A;  4F5P A;  3OV7 A;  2BPG A;  4I29 A;  4IQW A;  3WFR E;  3H3A A;  2M2T A;  3C8G A;  3LK9 A;  5J2J A;  1ZQX A;  3H37 A;  3H38 A;  4NM2 A;  4X0A A;  7ICT A;  4GXI A;  4NKT A;  4PHE A;  4I28 A;  4RT3 A;  5DKW A;  1OU5 A;  3HW8 A;  1HUO A;  2ISP A;  4KLS A;  9ICI A;  1Q79 A;  9ICJ A;  2L6F A;  3C8G D;  5HRH A;  4TUP A;  5F28 E;  3AQM A;  4YD2 A;  4P4M A;  1R89 A;  4PGQ A;  3OGU A;  4Z6D A;  4F5N A;  5DBC A;  5D4B A;  3RQG A;  1TVA A;  3AU2 A;  4E80 A;  3O10 A;  2BPF A;  3RJK A;  1UFB A;  4K4H A;  7ICU A;  1ZQB A;  4RWO A;  8ICJ A;  5DED A;  4R64 A;  1FA0 A;  1JOG A;  4TUS A;  5CA7 A;  9ICM A;  4Z6E A;  4F5Q A;  7ICR A;  1PV3 A;  4R63 A;  4FHP A;  3JPO A;  4AT7 B;  4KLF A;  4X0B A;  1ZQJ A;  3C8G B;  5CHG A;  2DR5 A;  4WBZ A;  3WFO A;  1NOM A;  3UPS A;  1F5A A;  4YMM A;  3HIY A;  3HJ1 A;  4PPX A;  1O3U A;  4X4P A;  2NRK A;  4R32 A;  1K40 A;  3V7J A;  8ICP A;  1BPY A;  8ICT A;  2JPU A;  2ZH2 A;  3UQ0 A;  4E7X A;  4WC2 A;  3UXP A;  4QZ8 A;  5BOL A;  3GM1 A;  1RZT A;  4UB5 A;  1KEJ A;  2LK4 A;  4QZH A;  2M2W A;  3JPR A;  2BE3 A;  4UAW A;  3K75 D;  4EBK A;  5DB7 A;  4I2J A;  3C2M A;  4QZ9 A;  2HHP A;  4NLN A;  1ZQF A;  4RQ4 A;  5EOZ A;  4M0A A;  3UXO A;  1ZQZ A;  4IG8 A;  4WC4 A;  5J2H A;  1XSL A;  4M9H A;  8ICN A;  8ICO A;  5HRK A;  1ZQQ A;  4KLO A;  1VJ7 A;  4K4G A;  5HR9 A;  3JPQ A;  3TFR A;  4FHX A;  8ICW A;  1JN3 A;  1UET A;  4RPY A;  2ISO A;  4KLJ A;  4NKU A;  2Q66 A;  4R65 A;  4X4U A;  7ICJ A;  5J2I A;  5J2D A;  4ATB B;  4FH3 A;  1VFG A;  3AU6 A;  7ICH A;  4GXJ A;  8ICU A;  5J0O A;  5J2K A;  2JX0 A;  5DDM A;  3RQE A;  4XQ8 A;  3L8J A;  4RQ3 A;  4FH5 A;  5J2F A;  4P4P A;  4DOC A;  3TFS A;  1ZQK A;  2Q00 A;  4RWP A;  2I9G A;  1HUZ A;  8ICH A;  1BPX A;  1XSN A;  3AJM A;  4PGX A;  7ICL A;  4AT9 A;  1OW6 A;  5J2E A;  4UBB A;  5III A;  3UXN A;  7ICV A;  5IIK A;  5J0R A;  4O5E A;  4JWM A;  4IQV A;  9ICL A;  5DB9 A;  4I2G A;  1OW7 A;  4XEF A;  4AT7 A;  5HRE A;  4QZB A;  5IIM A;  4XA5 A;  4M04 A;  1ZZP A;  4X4Q A;  1MIV A;  4KLM A;  2ZH5 A;  2DVI A;  3AQK A;  3WFQ E;  2PXI A;  2BCQ A;  3TUL A;  3K7D A;  3GDX A;  2VAN A;  5HRG A;  1BPE A;  3JPS A;  5DBB A;  4NLK A;  4F5O A;  4MF2 A;  1ZJN A;  1ZQO A;  2PFP A;  1WTY A;  4M9L A;  4KLU A;  1RPL A;  4KLH A;  4MF8 A;  2GWS A;  5F2V O;  4K4I A;  4XQ7 A;  5J0U A;  8ICF A;  4EBJ A;  8ICA A;  4TUQ A;  3RJJ A;  4Z6F A;  1Q78 A;  8ICM A;  1ZQI A;  1QVX A;  5J0S A;  4QZA A;  2FMP A;  1TFW A;  1ZQE A;  5J0Q A;  3C66 A;  5J2G A;  9ICK A;  4WC0 A;  5J0T A;  4QZC A;  3OVA A;  4YD1 A;  5CJ7 A;  1ZQL A;  3MFN A;  4WC6 A;  9ICR A;  3ISB A;  2PFQ A;  1JMS A;  1BPD A;  3V7K A;  9ICH A;  2ID1 A;  3MGI A;  5J2C A;  5HRI A;  1PX5 A;  4O9M A;  3L8I A;  4KLI A;  3UPQ A;  8ICS A;  1JAJ A;  5J2B A;  4DO9 A;  9ICO A;  7ICE A;  3C5G A;  7ICI A;  1ZQS A;  3HX0 A;  1ZQT A;  1ZQG A;  4YCX A;  1MQ2 A;  1R8B A;  5J2A A;  9ICB A;  4XEK A;  3JPP A;  1ZQA A;  7ICS A;  7ICM A;  3AUO A;  4M9N A;  4X4T A;  4UB1 A;  2BPC A;  1WOT A;  4FHW A;  4UB2 A;  2PFO A;  4DOA A;  4JWN A;  4IQU A;  5D46 A;  4RQ2 A;  1UEV A;  4LZG A;  3WFP A;  4S3N A;  1YLQ A;  9ICS A;  4RQ7 A;  1KTM A;  3L9D A;  3OUY A;  2ZH7 A;  5IIO A;  9ICF A;  1MQ3 A;  3MGH A;  4UB4 A;  3RJG A;  4E8F A;  4M47 A;  4NXZ A;  7ICK A;  1BPZ A;  4FO6 A;  9ICT A;  2W9M A;  4X4V A;  4WC5 A;  1MIW A;  3AQN A;  8ICZ A;  3LQC B;  7ICQ A;  4XEV A;  2PFN A;  3JYY A;  2DRA A;  4PHP A;  5CB1 A;  2ZH8 A;  3MBY A;  5HRF A;  3V7L A;  3RJF A;  4X4S A;  3C2L A;  3ISC A;  5HHI A;  7ICF A;  9ICG A;  4KLE A;  8ICR A;  4WC7 A;  9ICU A;  3OVS A;  2FMS A;  3C2K A;  4GXK A;  3RQF A;  3RJH A;  2KK1 A;  1TFY A;  5D49 A;  1WWP A;  3PNC A;  4RQ1 A;  4FHY A;  4KLL A;  1ZQC A;  9ICV A;  4X4N A;  5HRD A;  4I2H A;  5IIN A;  3WFS C;  4DOB A;  1K05 A;  1ZQR A;  3B71 A;  7ICN A;  5HC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...