3JYYA

Semet linb complexed with ppi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
265
Chain Sequence
MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
total genus 93
structure length 265
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jyyA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jyyA01
4X4PA 4WC4A 2ZH3A 4I28A 7ICLA 4YMOA 4IQUA 4I2GA 2VANA 4E8FA 1ZJNA 4WC2A 5J2AA 4X0BA 4I29A 7ICRA 4WC3A 4DOAA 2ZH7A 8ICTA 1ZQSA 4I2DA 2FMSA 4UBCA 1TFWA 3C8GA 5HREA 8ICCA 4UB2A 4I27A 4UAYA 4NLKA 4KLEA 3RH5A 4P4OA 4WBYA 4R64A 5HRIA 4X4OA 3MFNA 4X4QA 1Q79A 3OUYA 4UB5A 2DR9A 3HX0A 3RJGA 8ICGA 4TUQA 4AT9A 4RWQA 8ICIA 1KNYA 3B0YA 8ICKA 1RPLA 2BCVA 2IHMA 4I2HA 4FH3A 4WC0A 4Z6CA 4QZAA 1JN3A 1UFBA 1MQ2A 2BCUA 4TUSA 1XSNA 5CA7A 1ZQDA 2BCRA 4R65A 9ICHA 4WCWA 3AU2A 2BPCA 1ZQZA 4RQ3A 5DKWA 9ICIA 3S9OA 4O5EA 4RQ0A 4EBKA 1UEUA 1F5AA 9ICFA 1ZQRA 1WTYA 2ZH9A 4KLOA 3OGUA 5J2CA 4RWPA 3U3FA 4QZHA 2JX0A 5IIMA 4YN4A 4QZ9A 4UB4A 3C5FA 1RZTA 8ICHA 3JPQA 8ICRA 4XEFA 2YWAA 2O1PA 2DR7A 5IIKA 5HRHA 5CR0A 7ICSA 1ZQFA 4X5VA 3GM3A 4EP7A 3C2LA 3H3AA 4RPYA 3OVSA 9ICXA 1R8AA 2W9MA 1KTMA 9ICJA 4RQ1A 2ISOA 4RQ4A 2HSBA 3UXPA 1KDHA 3RJKA 2L6FA 4XRHA 3MDCA 4I2CA 4AT7A 3H38A 1PV3A 1JMSA 3V72A 5CJ7A 3WFSC 4PHPA 5HRFA 5CHGA 3BRJA 1YLQA 2BPFA 2ZH4A 4XA5A 2M2UA 1BPEA 1R8BA 9ICTA 3JYYA 2O5AA 1FA0A 1ZQNA 2DVIA 9ICBA 4RT2A 1TV9A 9ICUA 4FHWA 5F28E 1VJ7A 1XSPA 5HRBA 4YD2A 5DDYA 8ICJA 4Z6EA 4ATBB 3MGHA 2GWSA 4XQ7A 1HUZA 4M0AA 3WFOA 3WFQE 4RWOA 8ICMA 2ZH8A 1V4AA 3PMLA 4UB3A 1JOGA 4MFCA 5J2BA 2ZHAA 5D49A 7ICEA 3RJEA 3O10A 7ICUA 5J2KA 2Q66A 3C2MA 3AJMA 4NM2A 2PFQA 4GXKA 4IQWA 3B71A 1MIVA 4QZ8A 1TVAA 5J2JA 1XSLA 3RJFA 7ICFA 2BCQA 1BPDA 3AQKA 4M9NA 1ZQIA 7ICJA 1ZQJA 4LZDA 5CWRA 3LK9A 8ICPA 7ICVA 7ICPA 4XUSA 4DOBA 5D46A 4LT6A 4PHAA 4K4HA 4UAWA 1Q78A 3V7LA 4WC1A 5J0PA 8ICWA 5DB6A 4FO6A 4GXIA 9ICEA 3HW8A 7ICMA 7ICQA 8ICFA 8ICLA 1BPBA 5J2EA 4PHEA 4PGXA 5J0YA 3HJ4A 3RQFA 3L9DA 4KLFA 4TURA 2M2TA 4M9HA 4KLSA 1ZQWA 4PGQA 8ICUA 1PX5A 4YMMA 4RPXA 2NRKA 3UXOA 4KLDA 4X4NA 4LZGA 4AT7B 2ZH1A 5BOMA 5J0UA 4XQ8A 3WFPA 5J29A 5J0QA 5J0XA 4KLUA 3JPRA 1UETA 1OW8A 4NKTA 3JPOA 3ISBA 4M04A 5DB7A 1R89A 5HC9A 1BPZA 4NXZA 4F5NA 8ICBA 4WC5A 3GDXA 4NQFA 2DRBA 5BOLA 4FH5A 4WC7A 4I2EA 1ZQLA 4S3NA 3RH4A 2FMQA 3AQNA 4RQ8A 4PPXA 4RWNA 4FHPA 4M9LA 7ICGA 1ZZPA 3GM1A 1ZQGA 8ICXA 2ZH2A 4AT8A 5HRGA 8ICOA 4RQ7A 1ZQXA 3PNCA 3ISDA 1VFGA 3GM2A 4TUPA 5DBCA 3K75D 4JWMA 1OU5A 9ICNA 3C8GB 3C5GA 2BE3A 8ICYA 4X4TA 4NLZA 2FMPA 3TULA 1ZJMA 4X4RA 4KLIA 7ICTA 5HHIA 4I2BA 3OUYB 3L8IA 2M2WA 1NOMA 4UB1A 4P4MA 5D4BA 1ZQQA 3OVBA 7ICKA 5J2DA 4AT9B 2PFOA 1KEJA 4RQ2A 4O5CA 4KLGA 4Z6DA 3C66A 4M2YA 5J0WA 4F5OA 4F5PA 4PGYA 4M9GA 4X4VA 1MIYA 1K04A 2P66A 5IIJA 3MDAA 9ICWA 5HRDA 4DOCA 2I9GA 8ICEA 9ICLA 9ICKA 4Z6FA 3UPQA 4I2FA 5DBAA 2L6GA 4QZCA 2DR8A 4MF2A 4FHVA 3MGIA 2ISPA 9ICMA 4R63A 3RJJA 2HHPA 4E7XA 3AU6A 4I2IA 4M47A 2L6HA 4IQVA 5IINA 3H37A 1ZQVA 9ICCA 3V7JA 5DB9A 4KLQA 1O3UA 3C2KA 1JQRA 5DECA 1WOLA 4KLLA 4MFAA 4I2AA 4QZIA 4K4GA 4LVSA 2KK1A 9ICRA 3RQEA 4QZFA 3RJIA 4YD1A 4O9MA 4FHXA 8ICZA 5HHHA 5DB8A 3JPSA 3OVAA 8ICAA 4NY8A 3WFRE 1ZQUA 9ICPA 4NKUA 4MF8A 4F5RA 3U0CA 4R32A 1ZQCA 4KLMA 4KLJA 4NM1A 4NLNA 1OW6A 4P4PA 1WWPA 4AT8B 1ZQMA 3L8JA 2PFPA 8ICVA 4P2HA 4QZEA 5IILA 9ICQA 4ATBA 5J0SA 4M5DA 5EOZA 4YMNA 4GXJA 9ICOA 5J2FA 5HRLA 1HUOA 4UBBA 9ICGA 4FHYA 2ZHBA 3UQ0A 3AQLA 3B0XA 3NYBA 4RQ5A 1ZQBA 3OV7A 4PHDA 2M2VA 2ZH6A 2BCSA 3RQGA 3RJHA 1WOTA 3LQCB 1ZQTA 4X0AA 3TFSA 3HJ1A 5HRKA 5BPCA 1ZQOA 4WC6A 3AUOA 4O5KA 1ZQYA 4R66A 5DDMA 7ICIA 4I2JA 1ZQHA 4KLTA 3UQ2A 5HR9A 3TFRA 5DBBA 3JPNA 2BPGA 2DR5A 3RH6A 4IG8A 5J2IA 4F5QA 1ZQKA 2DRAA 1ZQPA 3JPPA 3PMNA 3V7KA 2PXIA 7ICNA 4X4SA 3JPTA 8ICNA 1ZQAA 1R8CA 3C18A 4QZDA 3HIYA 3HWTA 5F2VO 2JPUA 3MBYA 4MFFA 5IIIA 4JWNA 5CP2A 4XEVA 7ICOA 3UXNA 8ICSA 5J0TA 1K40A 4E80A 4RT3A 3JZ0A 2Q00A 1BPYA 5CB1A 4M9JA 4RQ6A 4EBJA 7ICHA 8ICQA 9ICSA 9ICVA 3H39A 4DO9A 4UAZA 5DEDA 4UD5A 1UEVA 3UPSA 1TFYA 5TZVA 4K4IA 2LK4A 1QVXA 4UD4A 4RPZA 4QZBA 1MQ3A 1JAJA 2PFNA 4QZGA 3K7DA 9ICAA 2RFFA 4KLHA 2ID1A 3C8GD 1OW7A 4WBZA 3AQMA 4X4UA 4XEKA 3ISCA 5J0RA 4PH5A 1K05A 4IQTA 1NO5A 2ZH5A 1MIWA 1BPXA 2PBEA 1ZQEA 5J2HA 4YCXA 5J2GA 5IIOA 5J0OA
chains in the Genus database with same CATH superfamily
2ZH3A 5AC4A 4YMOA 4I2GA 2AP3A 2BBHA 5CI8A 4E8FA 4OAIZ 4WC2A 5B1AC 2R7QA 3ZQYA 4DOAA 2GAQA 1TFWA 3C8GA 5BQIA 4I27A 4XLPF 3NVOA 1CGNA 3L0IA 3RH5A 5JUAA 5JT4A 4P4OA 4R64A 1PCXA 3L1MA 3RFYA 1T01A 2WVNA 1ZHWA 3RJGA 3EGXB 4MVUA 3B0YA 8ICKA 3NYJA 2VCBA 1D1CA 5E33A 1G5ZA 2BCVA 4I2HA 4PJLA 4Z6CA 1UFBA 2BCUA 4CJGA 2NG1A 4LERA 2CNWA 4Z9HA 4R65A 2CGEA 4WCWA 5JSLA 2BPCA 1U6HA 1ZQZA 4RQ3A 5DS5A 5DLJA 4O5EA 4N6HA 3HNIA 3X2QC 2B0HA 4OIQF 3S28A 2IXNA 4JZAA 1VK5A 1WTYA 3W8IA 2AVKA 3JT1A 3VYWA 4KC9A 3JTLO 4K1OA 4KLOA 3AGUA 3U3FA 4QZHA 3EGDA 4IRUA 2JX0A 4LDRA 3VRCA 5IIMA 4YN4A 5K0IA 5T3TA 5HV9A 3K6BA 3JRMO 4GQHA 2O1PA 3ZSUA 7ICSA 4WGYA 3H3AA 1VYKA 1SMYF 9ICXA 4JLZA 1KTMA 1MNEA 9ICJA 4RQ1A 1BR1A 1TWHA 2HSBA 1AUEA 3MDCA 4ONSA 4JJFA 2H7BA 2YKZA 3ZTMA 1VYIA 4RBNA 3BRJA 2A0UA 3U9MA 1R8BA 1DOWA 3JYYA 1ZQNA 3MYIA 1LE4A 1TV9A 1HY5A 4FHWA 5HRBA 1VLSA 5DDYA 5JTGA 4EEBA 4U5BE 2P0NA 3W2WA 4KI2A 4ATBB 3MGHA 3WFOA 2OOCA 1WASA 4KNVA 5F5HA 2ZH8A 2OEVA 5EHHA 1JOGA 4CDVA 5KYYA 3KYIA 5D49A 2KW3C 3RJEA 7ICUA 2EPKX 2XLWA 5B3SC 3E9VA 5COFA 2BE5F 4CBEA 4O6NA 2WL8A 4GXKA 2WB7A 3EH1A 2AWYA 4JCZA 4C7OB 1XSLA 4WJ0A 4UDVA 3ZWIA 4BJ5C 4M9NA 1FMWA 2FAPB 4XWJA 3KL4A 1GM5A 3LAYA 2PF4E 7ICVA 2YLGA 3NMIA 4LT6A 4PHAA 4P6IC 3LEVA 3B0UX 1D0XA 5DB6A 4FO6A 4ER9A 2FCLA 2W4BA 8ICLA 5J2EA 4U5HA 3GORA 3RQFA 3IEEA 1VOMA 4RPXA 4LEWA 2Q9CA 4IARA 1R4TA 3K33A 5CFUA 4AT7B 3M4BA 3G4XA 4P9TA 3J06A 5J0XA 1LS1A 2UUHA 4DVYP 1OW8A 3FAPB 4DRJB 4ULWA 4F5NA 3DJUB 3JSZA 5BOLA 4WC7A 3C63A 1LI5A 2FMQA 4RQ8A 4GEHA 1FMVA 2H7VC 4RWNA 5T3WA 2J8WA 8ICXA 2ZH2A 5HRGA 4YK5A 4RQ7A 4CSAA 1ZQXA 1JMWA 2WZFA 3GM2A 1XZPA 3NKDA 1OKKD 4JWMA 2W45A 9ICNA 3RYLA 4B6IA 4O67A 1EKYA 3C8GB 3C5GA 2BE3A 1KU2A 3SXYA 1ZJMA 4JTCB 4DBRA 1Y6DA 3UMIA 4P4MA 4IAQA 5D4BA 5J2DA 4N6CA 2PFOA 3F47A 3ERCC 4Z6DA 4M2YA 5L0FA 5J0WA 4X4VA 1RKEA 3T9OA 2EPOA 5IIJA 3MDAA 3G50A 1OKKA 4DOCA 2YL0A 3N24A 2I9GA 4QZCA 2DR8A 4K97A 3JCUQ 3ZTZA 2ISPA 3RJJA 2B4VA 1ZVZA 4WGZA 2NPUA 3UGPA 1ZQVA 3TK0A 5DB9A 4W8KA 1CPRA 3QMKA 3C2KA 1GPJA 4O6YA 2GDCA 5DECA 3DWWA 1WOLA 3EH2A 2A1DD 4KLLA 4DJ9A 4MFAA 4MS2A 3FOPA 4I2AA 4QZIA 2ZXWC 4Q5SF 4J7TA 3RJIA 4YD1A 2G62A 5HHHA 2ASRA 5L3QA 4CIHA 4G0HA 2IUBA 3Q6NA 4NY8A 4PJJA 3WFRE 1ZQUA 2BL2A 4JW1A 2DYRC 4KLMA 1O5HA 4WQLA 2QE9A 2NUTA 4Z9JA 2PNOA 3L8JA 3JRTA 9ICQA 5EOZA 5J2FA 1A7VA 1Z6AA 4FHYA 3HNLA 2EWRA 2ZHBA 3CZ6A 4RQ5A 1IZMA 4CS8C 1NZEA 1R5ID 3S27A 3HKKA 4BJ6A 4BJ1A 1QKRA 1LVKA 3W4YA 4J32B 3MX3A 3PMRA 1BZ4A 4OIRF 4RDAA 1LIHA 4NXTA 3AUOA 1ZQOA 4O5KA 2ETSA 4R66A 1MMNA 4I2JA 4KLTA 4PFOA 2A0BA 4AK9A 4EHPA 2LFDA 5KYYB 1NFNA 3JPNA 3RH6A 2HFIA 1ZQKA 3EGXA 1ZQPA 3N2ZB 5DS4A 3V7KA 1YVIA 1T9KA 8ICNA 1ZQAA 4CS7A 4ZLDA 3C18A 4EKWA 5F2VO 2AWCA 3U8VA 4JWNA 5CP2A 2GA0A 4CDYA 1TQGA 1ZYRF 5CI9A 8ICSA 1K40A 3GWLA 4FESA 4XQ1A 4LDKA 1HE9A 5L0GA 3RVZA 4UD5A 1APCA 3Q7LA 2YRFA 3UPSA 1M2OA 2VCAA 2ZXRA 1TFYA 3CSKA 3FDQA 1LPEA 1QVXA 4NXVA 4QZBA 2OJQA 2R7UA 4Z9IA 4U5CE 1A7EA 2LSEA 3ISCA 1QLEC 4IQTA 3DD7A 5D62A 3WODF 2PBEA 4X0RA 3NYMA 4O68A 5J2GA 5IIOA 5DVWA 4X4PA 4I28A 2VANA 5DS6A 4I0UA 1ZJNA 4I29A 3U5SA 8ICTA 2FMSA 3U8PA 8ICCA 1WN0A 4KLEA 4WBYA 5BUOA 4WQKA 1MMAA 3OUYA 4UB5A 2XLOA 4OD5A 3HX0A 4AT9A 1KNYA 2L81A 1E84A 3LNRA 2PX0A 2NSGA 3SZRA 4OAHA 3ASOC 3AG3C 2J9BA 1JN3A 1MQ2A 5COMA 1ZQDA 2CCYA 2BCRA 4MTOA 5DKWA 4C7OA 2C03A 4RQ0A 1NU9C 4EBKA 1UEUA 1F5AA 1ZQRA 3AQBA 2C04A 4C3EA 3OGUA 5J2CA 4RWPA 4EIYA 3W2VA 3LLIA 1E85A 2VCCA 4IB4A 3F46A 4Q7CA 3HLZA 8ICHA 2LP4A 3OA1A 3JPQA 8ICRA 1TWGA 3AQCA 2EPMX 3EZIA 2J9VA 2WZLA 3G4ZA 5CR0A 2B56A 4JTDB 3C2LA 4RPYA 5JRAA 4G78A 3U3BA 1M6TA 2ISOA 2ICWG 2EPNA 2L6FA 2L9JA 4JLXA 2D4UA 2YVKA 4AT7A 1Q0FA 4NCQA 3S84A 5CJ7A 5EGYA 5CHGA 5B1BC 5A6BD 2BPFA 2VC9A 2M2UA 3LNMB 2DVIA 1HMDA 1ZU4A 4N06A 5F28E 1VJ7A 4K8VA 1XSPA 5CFTA 2Q3TA 3AOUA 4XQ7A 1HUZA 4RWOA 2DGJA 3PDMP 8ICMA 4MQ9F 3PMLA 7ICEA 3FMSA 3DXJF 2HKVA 3M79A 5A6AA 1ZHZA 3U2LA 3O10A 4L6RA 3H2UA 5J2KA 2Q66A 3C2MA 4AL1A 3AJMA 4NM2A 5A6BA 3C8ZA 4QI2A 1O87A 4YWQA 4IQWA 3B71A 1MIVA 5D91A 5J2JA 1UG7A 2YHSA 4XTKA 3NWIA 4NC3A 1T6UA 3V7OA 3AQKA 1QSPA 1M57C 1ZQIA 3LLKA 1ZQJA 4AL0A 5COGA 3LK9A 3GEHA 3FVYA 5D46A 1WATA 3WAQA 4K4HA 1Q78A 2DYSC 2ZD9A 4MVRA 2OJED 2HZ8A 2QY9A 2IBFA 4GXIA 9ICEA 4PR9A 4WH5A 2R25A 1BPBA 4PGXA 3I5QA 1ZQWA 2Y3GA 8ICUA 1YA7O 3KPHA 4BG0A 4FWVA 5J0UA 4XQ8A 1GGQA 2UUIA 3K1HA 2VASA 5J0QA 3L34A 4KLUA 1UETA 3AG4C 5DB7A 3MBGA 2PX3A 3CK6A 4NXZA 3OWGA 5EK0A 4NQFA 2XM4A 2DRBA 1M2VA 4MTFA 4I2EA 4CS9A 2XL6A 3RH4A 2XLVA 1DOVA 3AQNA 4PPXA 4M9LA 1PD0A 1ZZPA 5TJ5E 3WHNA 2NSFA 3Q6MA 1VFGA 3ISDA 3T6GB 5DBCA 3LUTB 5KYUA 1XZQA 5D61A 2FMPA 3IHUA 7ICTA 4O7GA 3OUYB 2H7OA 1NOMA 4UB1A 1ORYA 2I15A 7ICKA 1NU7D 4AT9B 2IM8A 4PJMA 2LIGA 4KLGA 3C66A 4PGYA 2MHRA 1K04A 9ICWA 4HFFB 4A4AA 4I1MA 4YT5A 3UPQA 1LI7A 2A6HF 1H7IA 2L6GA 5DBAA 4I2FA 4MF2A 4FHVA 4PK4A 4DOZA 4OIOF 9ICMA 1Z63A 3DKAA 3IQ6A 4LEYA 2HS5A 2R7XA 4WABA 2L6HA 5IINA 4G7ZF 4IJJA 3LJBA 2P1AA 1ZW2A 4JJGA 4BEMJ 1ZHXA 1H9GA 1SYQA 4CJOA 2Y3HA 4QZFA 4O9MA 1SF8A 2W9YA 4E0HA 3DI5A 2Z15A 1HMOA 5DB8A 3JPSA 4J30B 2EINC 3ER9B 3MYFA 2IXPA 2EILC 2GA9D 1S05A 9ICPA 4NKUA 4F5RA 2HV7A 3U0CA 4R32A 1ZQCA 2IHOA 4AT8B 2GAFD 5KYXA 2Y39A 3EG9B 4P2HA 4PACA 2Q9AA 4QZEA 4DRHB 1A7DA 1HUOA 2J9WA 5GPGB 1H9TA 1RCPA 3B0XA 3NMJA 3RW0A 1ZQBA 1EI7A 4PHDA 2M2VA 2BCSA 3KH2A 1I4ZA 1WOTA 4X0AA 3TFSA 3UMKA 3HJ1A 5BPCA 1C17M 1ZQYA 2BC5A 3S29A 3UQ2A 5HR9A 1E83A 1ZHTA 4IGGA 2A68F 4XPXA 2J45A 2BPGA 2DR5A 4O79A 5J2IA 2VB6A 2QTVA 2YQYA 3JPPA 1T5OA 5L0DA 1SZIA 4JVSA 4A2NB 2PXIA 7ICNA 1GS9A 2R7TA 4OAFA 3HIYA 3HWTA 2YEVA 3GEIA 3I4UA 4YL3A 3SXMA 1OXKA 3UXNA 5J0TA 4M9JA 3POVA 3FHDA 1FTSA 7ICHA 3KKBA 4DO9A 3EFOA 4CIPA 1TWCA 1RMVA 2RD9A 4K4IA 2LK4A 1JR8A 2WZGA 3HNJA 4UD4A 1XWJA 3V5YA 1V54C 1Q0DA 9ICAA 4KLHA 2ID1A 4WBZA 4JURI 4XEKA 2HMZA 2KYHA 2J9UA 1K05A 3E70C 2ZH5A 1YARO 4E7ZA 5D92A 3K66A 5B3PA 1OQCA 2LFFA 5J0OA 3DE9A 7ICLA 2YL7A 2J7PD 1OCOC 7ICRA 3TOLA 2ZH7A 3LEOA 4K9AA 1ZQSA 4UBCA 1D1AA 3DM5A 5HREA 1M2VB 4UB2A 4UAYA 5HRIA 4X4QA 4BJ5A 3CQZA 2DR9A 3TD7A 8ICGA 5L3VA 4TUQA 8ICIA 4RWQA 1RPLA 2TMVP 2IHMA 4MVOA 4FH3A 4WC0A 1VLTA 5KYUB 5JS5A 4KM5A 3AU2A 3W8HA 2R7OA 3RF3A 9ICIA 2PP4A 3S9OA 4C3DA 3GANA 3T4RA 4HX0A 9ICFA 3FAJA 2R05A 3X1OA 1GQAA 2P7VA 4XPWA 2ZH9A 2KJGA 3SEOA 3R2PA 4LEZA 3DE8A 1YZAA 4QZ9A 3VAYA 4MNDA 2Q9BA 2YWAA 2DR7A 1YZCA 1FAPB 3ZG1A 4X5VA 3GM3A 4EP7A 3OVSA 2W9MA 3DJNB 3B29A 5BQHA 3A11A 2R7RA 3UXPA 1KDHA 3RJKA 4XRHA 1NBBA 2YLDA 5L0HA 1PV3A 4ZLCA 3H38A 2G3KA 5HSWA 4PHPA 5HRFA 1YLQA 1JPJA 4MVSA 1ORSC 2HSQA 2ZH4A 5JLIA 1BPEA 9ICTA 5F5FA 2O5AA 2RSEB 9ICBA 9ICUA 1A41A 5KYXB 1PD1A 4E0IA 3UGOA 4Z6EA 3EJNA 1Y4CA 4M0AA 2ZPAA 4E17A 3WFQE 1V4AA 5A6JA 4UB3A 2ZHAA 3EPVA 4JEAA 4FO1A 1SR2A 1YDIA 1MMGA 3SNHA 1TWAA 5L0JA 1I4YA 2PFQA 1QQ3A 2HUJA 4GYTA 2XXAB 4QZ8A 4LLCA 3TOMA 4G7OF 7ICFA 1BR2A 2BCQA 1BPDA 1ST6A 3KMIA 4QI0A 1L7CA 4U9EA 1Q0KA 3IQCA 5IY5C 8ICPA 7ICPA 4YT4A 4XUSA 4DOBA 3B0PA 3V7LA 2HJMA 2KSFA 1JRAA 3HW8A 4YL1A 8ICFA 3EZHA 1D0ZA 3K1IA 3L9DA 4KLFA 2A69F 5L0CA 5B3QA 2M2TA 4M9HA 4KLSA 1PX5A 1CGOA 2NRKA 1OCCC 3EFOB 1FNTc 3C7JA 3UXOA 4HEAJ 4LZGA 3WG7C 4KBLA 1C02A 4OD4A 2FGYA 3GEEA 5J29A 1G4WR 2IXOA 3JPOA 1NFOA 1BPZA 4ULVA 4LDQA 4CS8A 4C3BA 3MCRA 3RKOF 4NTBA 8ICBA 3GDXA 3ITFA 3SYNA 1QZXA 2KGOA 4K96A 1ZQLA 4S3NA 4E18A 3ASNC 4P9FA 2IXMA 2HN1A 5A69A 2XLDA 3GM1A 1ZQGA 4AT8A 3EG9A 4U5EE 4LLEA 3PNCA 2HJ3A 2X51A 4TUPA 4F4BA 1OU5A 3AG1C 4EWCA 3S0XA 8ICYA 4NLZA 3TULA 1G4US 3PHZA 5HHIA 1RJ9B 1ZQQA 3AGTA 1KEJA 4RQ2A 4NTAA 4M9GA 2XLEA 4JIOA 4XJEA 2P66A 1NG1A 2E87A 1YYXA 2J46A 9ICKA 4Z6FA 4MTGA 2H8AA 3MGIA 4O69A 2HHPA 4E7XA 5KYNA 5E2QA 4I2IA 4M47A 4IQVA 3NKEA 4CDAA 9ICCA 1E86A 3V7JA 4KLQA 2CDQA 2XRHA 4K7BA 1OCZC 3CAXA 1NSGB 1T6QA 3M15A 1TFOB 9ICRA 2HN2A 2Q4FA 3ABLC 1H6GA 2MWQA 4NXXA 2CNWD 3ZIBA 3OVAA 8ICAA 1AEPA 2ZXPA 1LKXA 3ER8C 3NKUA 5BQGA 256BA 4KLJA 4P4PA 1WWPA 2M4EA 4H4KC 8ICVA 2KC3A 3OWTA 5L0IA 2G3VA 1FFTC 1CPQA 1MMDA 1TFKB 5J0SA 2O9XA 4YMNA 4GXJA 2OQMA 1A0BA 5HRLA 2YLIA 1QPUA 4UBBA 4YT2A 3DMDA 9ICGA 3S90A 4D4XA 3UQ0A 2DB4A 4K0DA 3OV7A 2ZH6A 1L3PA 4E7SA 4PJNA 5KYWB 1HE1A 1ZQTA 1ZHYA 3NDBB 5HRKA 3ATPA 3ABKC 4I3MA 3UR3C 3SXZA 1C03A 5DDMA 3IQ5A 2F22A 4LEVA 2QLAA 4IAOA 3TFRA 5DBBA 2OKUA 3UNGC 4CSAC 1YLMA 4IG8A 4F5QA 5B3IA 1Z7Qc 2DRAA 5FCLA 3CEXA 3NMKA 1RXQA 4U5FE 4YN0B 4WOYA 3GODA 1R8CA 1J8MF 3LS0A 4QZDA 5D63A 2L7AA 2JPUA 4O6AA 1AVOB 3UMHA 4XEVA 2YZSA 4LACB 2R02A 4M63A 2Q00A 1BPYA 5CB1A 1NLXA 2IOQA 3H2VA 8ICQA 4U5DE 4UAZA 5DEDA 1UEVA 5TZVA 3B9QA 3M4CA 2XSEA 3DZAA 4MW3A 1JAJA 3QVZA 2PFNA 3HTKC 4NTFA 4QZGA 1EQ1A 4YJWA 3LS1A 2WVOA 1OW7A 4U9DA 3SP1A 4X4UA 5J0RA 4PH5A 2A6EF 2XLMA 3KYJA 1NO5A 1W2WA 1BPXA 1ZQEA 4YCXA 4ANJA 4WC4A 4IQUA 1Z23A 3U2MA 4NY3A 3DAFA 5J2AA 4X0BA 4WC3A 5E3CA 4I2DA 3IPMO 1Z5ZA 4DVZA 4NLKA 1M56C 2V3CC 1CGME 1E2XA 4X4OA 3MFNA 4EV6A 3PCVA 4AE4A 1Q79A 1JAFA 2EIJC 4JCHA 1OR2A 1N1CA 5CHEA 3SXKA 5DQZA 1MNDA 4QZAA 1ORJA 1D0YA 4TUSA 1XSNA 5CA7A 3I5PA 9ICHA 4BJ6C 3V5ZA 3HJCA 2XXAA 2IYLD 2AU5A 4D4NA 1FFHA 4K99A 4NXUA 1VMAA 3ECSA 5CIVA 5E3AA 2OG2A 4UB4A 4CX9A 2NUPA 3EHNA 1JPNA 1TR2A 1V74B 3C5FA 1RZTA 2LCHA 2GFHA 4XEFA 5IIKA 4MVQA 3DAGA 2EPLX 2KNHA 5HRHA 4HFKB 1ZQFA 1R8AA 4RQ4A 4JEBA 4EGWA 3A9CA 2HV6A 3H65A 4I2CA 1HW2A 1S7ZA 4NXWA 1OR3A 1JMSA 3V72A 3WFSC 3NG1A 2GWWA 3JYHA 5JVEA 4XA5A 2KQ9A 3EQLF 2OU6A 1FA0A 4RT2A 3QW1A 3IQTA 3QTHA 4YD2A 8ICJA 2EIKC 2GWSA 1YA9A 3HNKA 2WVQA 4MFCA 5J2BA 2MYSA 5JP7A 2LD6A 1YJGA 5DQTA 4K9BA 1LS4A 1Q0GA 2XM0A 3N0TA 4JRZA 4DXWA 1TVAA 3RJFA 4N4WA 4IWBA 4FAPB 4MKPA 2CW0F 2W4MA 2R7VA 4PFPA 2QNLA 4U5GA 3US6A 7ICJA 3VM6A 1D1BA 4BEJA 5AC5A 4LZDA 4YL0A 1T6IA 4EBBA 5CWRA 1RJ9A 3EGDB 2HMQA 4UAWA 4KB6A 4WC1A 5J0PA 8ICWA 1OCRC 2J7PA 4JC7A 3T6BA 7ICMA 3K1IC 2Q7RA 7ICQA 4RD9A 4W8PA 4JE9A 1HW1A 4PHEA 3PHF2 5J0YA 3HJ4A 3T6JA 4TURA 4PGQA 4YMMA 4Q4ZF 4FX5A 2X0CA 4KLDA 3R7CA 4X4NA 2ZH1A 5BOMA 1J8YF 3WFPA 4AX2A 4O6MA 2R03A 4J7YA 4OINF 2R7WA 3JPRA 3C62A 4NKTA 3ISBA 4M04A 2QUPA 1MQVA 1R89A 5HC9A 4DRIB 2I8BA 1U0BB 2LQGA 4WC5A 2FFHA 3NRHA 4FH5A 3EHMA 2CYDA 4KNWA 4XLNF 1F1MA 4FHPA 7ICGA 3LESA 4JKVA 8ICOA 2VH3A 3GWNA 3Q7GA 3FXHA 3K75D 4K98A 2R7SA 2BBJA 3AG2C 4X4TA 4G7HF 4X4RA 4KLIA 4AE4B 4I2BA 3L8IA 3B0VC 2M2WA 2D5RB 3OVBA 1Q0MA 3OEOA 4YT8A 5KYWA 4O5CA 4F5OA 5CFSA 4F5PA 1MIYA 3RH3A 4H54A 3V5XA 5HRDA 3VF0A 2XS8A 4I1OB 8ICEA 4HE8D 9ICLA 2V26A 1OXBA 1I5NA 3RVYA 4EUKB 4R63A 2XL8A 4MW8A 3AU6A 2M64A 3NYLA 3BEHA 2J0XA 3H37A 2ZXOA 3TJ6A 1YYJA 4BJTA 2XLHA 3ZDLA 1O3UA 4I44A 1JQRA 3MLGA 2XS1A 2XL4A 4K4GA 3TQOA 4LVSA 1LM3B 2KK1A 3RQEA 8ICZA 2NUPB 4FHXA 2YL1A 3JSEO 4EEDA 2J0WA 5AGFA 5A6KA 2P6VA 2EIMC 4MF8A 3EF2A 5FZTA 4NM1A 2B51A 1IW7F 1VB5A 1OW6A 2P61A 1V55C 2Y3DA 4NLNA 1ZQMA 4MVZA 2PFPA 1BR4A 5IILA 3O39A 2Y3BA 4ATBA 9ICOA 4M5DA 1BDJB 4OIPF 5T1DB 2DI3A 3AQLA 3NYBA 4QDLA 3JCFA 2OEXA 3QW0A 3ABMC 4N7RA 3FOOA 3RQGA 3RJHA 3ZVRA 3LQCB 1Z3IX 3TJ5A 1VTMP 4CS9C 4OAGA 4WC6A 7ICIA 1RKEB 1ZQHA 3U9JA 1U89A 3PMNA 2JD3A 4X4SA 3JPTA 1LE2A 4DBQA 3QVYA 1FR0A 1YAUO 4MFFA 3MBYA 5IIIA 7ICOA 1B68A 3O6XA 4E80A 4RT3A 1BBHA 1WGWA 3JZ0A 4RQ6A 3DM9B 4EBJA 9ICSA 3O55A 9ICVA 3H39A 4MVMA 3ZC4A 2YL3A 3M1CB 1TKNA 1G8XA 1ZU5A 2B0JA 4XPYA 1EA8A 2OCCC 1RKCA 2Y69C 4RPZA 2PFDA 1MQ3A 3K7DA 4BPMA 2NUTB 2RFFA 1ZW3A 3C8GD 3AQMA 3RIPA 3ZQVA 1MIWA 3QZCA 4JTAB 5J2HA 2R9RB
chains in the Genus database with same CATH topology
4X4PA 4WC4A 2ZH3A 4I28A 7ICLA 4YMOA 4IQUA 4I2GA 2VANA 4E8FA 1ZJNA 4WC2A 5J2AA 4X0BA 4I29A 7ICRA 4WC3A 4DOAA 2ZH7A 8ICTA 1ZQSA 4I2DA 2FMSA 4UBCA 1TFWA 3C8GA 5HREA 8ICCA 4UB2A 4I27A 4UAYA 4NLKA 4KLEA 3RH5A 4P4OA 4WBYA 4R64A 5HRIA 4X4OA 3MFNA 4X4QA 1Q79A 3OUYA 4UB5A 2DR9A 3HX0A 3RJGA 8ICGA 4TUQA 4AT9A 4RWQA 8ICIA 1KNYA 3B0YA 8ICKA 1RPLA 2BCVA 2IHMA 4I2HA 4FH3A 4WC0A 4Z6CA 4QZAA 1JN3A 1UFBA 1MQ2A 2BCUA 4TUSA 1XSNA 5CA7A 1ZQDA 2BCRA 4R65A 9ICHA 4WCWA 3AU2A 2BPCA 1ZQZA 4RQ3A 5DKWA 9ICIA 3S9OA 4O5EA 4RQ0A 4EBKA 1UEUA 1F5AA 9ICFA 1ZQRA 1WTYA 2ZH9A 4KLOA 3OGUA 5J2CA 4RWPA 3U3FA 4QZHA 2JX0A 5IIMA 4YN4A 4QZ9A 4UB4A 3C5FA 1RZTA 8ICHA 3JPQA 8ICRA 4XEFA 2YWAA 2O1PA 2DR7A 5IIKA 5HRHA 5CR0A 7ICSA 1ZQFA 4X5VA 3GM3A 4EP7A 3C2LA 3H3AA 4RPYA 3OVSA 9ICXA 1R8AA 2W9MA 1KTMA 9ICJA 4RQ1A 2ISOA 4RQ4A 2HSBA 3UXPA 1KDHA 3RJKA 2L6FA 4XRHA 3MDCA 4I2CA 4AT7A 3H38A 1PV3A 1JMSA 3V72A 5CJ7A 3WFSC 4PHPA 5HRFA 5CHGA 3BRJA 1YLQA 2BPFA 2ZH4A 4XA5A 2M2UA 1BPEA 1R8BA 9ICTA 3JYYA 2O5AA 1FA0A 1ZQNA 2DVIA 9ICBA 4RT2A 1TV9A 9ICUA 4FHWA 5F28E 1VJ7A 1XSPA 5HRBA 4YD2A 5DDYA 8ICJA 4Z6EA 4ATBB 3MGHA 2GWSA 4XQ7A 1HUZA 4M0AA 3WFOA 3WFQE 4RWOA 8ICMA 2ZH8A 1V4AA 3PMLA 4UB3A 1JOGA 4MFCA 5J2BA 2ZHAA 5D49A 7ICEA 3RJEA 3O10A 7ICUA 5J2KA 2Q66A 3C2MA 3AJMA 4NM2A 2PFQA 4GXKA 4IQWA 3B71A 1MIVA 4QZ8A 1TVAA 5J2JA 1XSLA 3RJFA 7ICFA 2BCQA 1BPDA 3AQKA 4M9NA 1ZQIA 7ICJA 1ZQJA 4LZDA 5CWRA 3LK9A 8ICPA 7ICVA 7ICPA 4XUSA 4DOBA 5D46A 4LT6A 4PHAA 4K4HA 4UAWA 1Q78A 3V7LA 4WC1A 5J0PA 8ICWA 5DB6A 4FO6A 4GXIA 9ICEA 3HW8A 7ICMA 7ICQA 8ICFA 8ICLA 1BPBA 5J2EA 4PHEA 4PGXA 5J0YA 3HJ4A 3RQFA 3L9DA 4KLFA 4TURA 2M2TA 4M9HA 4KLSA 1ZQWA 4PGQA 8ICUA 1PX5A 4YMMA 4RPXA 2NRKA 3UXOA 4KLDA 4X4NA 4LZGA 4AT7B 2ZH1A 5BOMA 5J0UA 4XQ8A 3WFPA 5J29A 5J0QA 5J0XA 4KLUA 3JPRA 1UETA 1OW8A 4NKTA 3JPOA 3ISBA 4M04A 5DB7A 1R89A 5HC9A 1BPZA 4NXZA 4F5NA 8ICBA 4WC5A 3GDXA 4NQFA 2DRBA 5BOLA 4FH5A 4WC7A 4I2EA 1ZQLA 4S3NA 3RH4A 2FMQA 3AQNA 4RQ8A 4PPXA 4RWNA 4FHPA 4M9LA 7ICGA 1ZZPA 3GM1A 1ZQGA 8ICXA 2ZH2A 4AT8A 5HRGA 8ICOA 4RQ7A 1ZQXA 3PNCA 3ISDA 1VFGA 3GM2A 4TUPA 5DBCA 3K75D 4JWMA 1OU5A 9ICNA 3C8GB 3C5GA 2BE3A 8ICYA 4X4TA 4NLZA 2FMPA 3TULA 1ZJMA 4X4RA 4KLIA 7ICTA 5HHIA 4I2BA 3OUYB 3L8IA 2M2WA 1NOMA 4UB1A 4P4MA 5D4BA 1ZQQA 3OVBA 7ICKA 5J2DA 4AT9B 2PFOA 1KEJA 4RQ2A 4O5CA 4KLGA 4Z6DA 3C66A 4M2YA 5J0WA 4F5OA 4F5PA 4PGYA 4M9GA 4X4VA 1MIYA 1K04A 2P66A 5IIJA 3MDAA 9ICWA 5HRDA 4DOCA 2I9GA 8ICEA 9ICLA 9ICKA 4Z6FA 3UPQA 4I2FA 5DBAA 2L6GA 4QZCA 2DR8A 4MF2A 4FHVA 3MGIA 2ISPA 9ICMA 4R63A 3RJJA 2HHPA 4E7XA 3AU6A 4I2IA 4M47A 2L6HA 4IQVA 5IINA 3H37A 1ZQVA 9ICCA 3V7JA 5DB9A 4KLQA 1O3UA 3C2KA 1JQRA 5DECA 1WOLA 4KLLA 4MFAA 4I2AA 4QZIA 4K4GA 4LVSA 2KK1A 9ICRA 3RQEA 4QZFA 3RJIA 4YD1A 4O9MA 4FHXA 8ICZA 5HHHA 5DB8A 3JPSA 3OVAA 8ICAA 4NY8A 3WFRE 1ZQUA 9ICPA 4NKUA 4MF8A 4F5RA 3U0CA 4R32A 1ZQCA 4KLMA 4KLJA 4NM1A 4NLNA 1OW6A 4P4PA 1WWPA 4AT8B 1ZQMA 3L8JA 2PFPA 8ICVA 4P2HA 4QZEA 5IILA 9ICQA 4ATBA 5J0SA 4M5DA 5EOZA 4YMNA 4GXJA 9ICOA 5J2FA 5HRLA 1HUOA 4UBBA 9ICGA 4FHYA 2ZHBA 3UQ0A 3AQLA 3B0XA 3NYBA 4RQ5A 1ZQBA 3OV7A 4PHDA 2M2VA 2ZH6A 2BCSA 3RQGA 3RJHA 1WOTA 3LQCB 1ZQTA 4X0AA 3TFSA 3HJ1A 5HRKA 5BPCA 1ZQOA 4WC6A 3AUOA 4O5KA 1ZQYA 4R66A 5DDMA 7ICIA 4I2JA 1ZQHA 4KLTA 3UQ2A 5HR9A 3TFRA 5DBBA 3JPNA 2BPGA 2DR5A 3RH6A 4IG8A 5J2IA 4F5QA 1ZQKA 2DRAA 1ZQPA 3JPPA 3PMNA 3V7KA 2PXIA 7ICNA 4X4SA 3JPTA 8ICNA 1ZQAA 1R8CA 3C18A 4QZDA 3HIYA 3HWTA 5F2VO 2JPUA 3MBYA 4MFFA 5IIIA 4JWNA 5CP2A 4XEVA 7ICOA 3UXNA 8ICSA 5J0TA 1K40A 4E80A 4RT3A 3JZ0A 2Q00A 1BPYA 5CB1A 4M9JA 4RQ6A 4EBJA 7ICHA 8ICQA 9ICSA 9ICVA 3H39A 4DO9A 4UAZA 5DEDA 4UD5A 1UEVA 3UPSA 1TFYA 5TZVA 4K4IA 2LK4A 1QVXA 4UD4A 4RPZA 4QZBA 1MQ3A 1JAJA 2PFNA 4QZGA 3K7DA 9ICAA 2RFFA 4KLHA 2ID1A 3C8GD 1OW7A 4WBZA 3AQMA 4X4UA 4XEKA 3ISCA 5J0RA 4PH5A 1K05A 4IQTA 1NO5A 2ZH5A 1MIWA 1BPXA 2PBEA 1ZQEA 5J2HA 4YCXA 5J2GA 5IIOA 5J0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4P A;  4WC4 A;  2ZH3 A;  4I28 A;  7ICL A;  4YMO A;  4IQU A;  4I2G A;  2VAN A;  4E8F A;  1ZJN A;  4WC2 A;  5J2A A;  4X0B A;  4I29 A;  7ICR A;  4WC3 A;  4DOA A;  2ZH7 A;  8ICT A;  1ZQS A;  4I2D A;  2FMS A;  4UBC A;  1TFW A;  3C8G A;  5HRE A;  8ICC A;  4UB2 A;  4I27 A;  4UAY A;  4NLK A;  4KLE A;  3RH5 A;  4P4O A;  4WBY A;  4R64 A;  5HRI A;  4X4O A;  3MFN A;  4X4Q A;  1Q79 A;  3OUY A;  4UB5 A;  2DR9 A;  3HX0 A;  3RJG A;  8ICG A;  4TUQ A;  4AT9 A;  4RWQ A;  8ICI A;  1KNY A;  3B0Y A;  8ICK A;  1RPL A;  2BCV A;  2IHM A;  4I2H A;  4FH3 A;  4WC0 A;  4Z6C A;  4QZA A;  1JN3 A;  1UFB A;  1MQ2 A;  2BCU A;  4TUS A;  1XSN A;  5CA7 A;  1ZQD A;  2BCR A;  4R65 A;  9ICH A;  4WCW A;  3AU2 A;  2BPC A;  1ZQZ A;  4RQ3 A;  5DKW A;  9ICI A;  3S9O A;  4O5E A;  4RQ0 A;  4EBK A;  1UEU A;  1F5A A;  9ICF A;  1ZQR A;  1WTY A;  2ZH9 A;  4KLO A;  3OGU A;  5J2C A;  4RWP A;  3U3F A;  4QZH A;  2JX0 A;  5IIM A;  4YN4 A;  4QZ9 A;  4UB4 A;  3C5F A;  1RZT A;  8ICH A;  3JPQ A;  8ICR A;  4XEF A;  2YWA A;  2O1P A;  2DR7 A;  5IIK A;  5HRH A;  5CR0 A;  7ICS A;  1ZQF A;  4X5V A;  3GM3 A;  4EP7 A;  3C2L A;  3H3A A;  4RPY A;  3OVS A;  9ICX A;  1R8A A;  2W9M A;  1KTM A;  9ICJ A;  4RQ1 A;  2ISO A;  4RQ4 A;  2HSB A;  3UXP A;  1KDH A;  3RJK A;  2L6F A;  4XRH A;  3MDC A;  4I2C A;  4AT7 A;  3H38 A;  1PV3 A;  1JMS A;  3V72 A;  5CJ7 A;  3WFS C;  4PHP A;  5HRF A;  5CHG A;  3BRJ A;  1YLQ A;  2BPF A;  2ZH4 A;  4XA5 A;  2M2U A;  1BPE A;  1R8B A;  9ICT A;  3JYY A;  2O5A A;  1FA0 A;  1ZQN A;  2DVI A;  9ICB A;  4RT2 A;  1TV9 A;  9ICU A;  4FHW A;  5F28 E;  1VJ7 A;  1XSP A;  5HRB A;  4YD2 A;  5DDY A;  8ICJ A;  4Z6E A;  4ATB B;  3MGH A;  2GWS A;  4XQ7 A;  1HUZ A;  4M0A A;  3WFO A;  3WFQ E;  4RWO A;  8ICM A;  2ZH8 A;  1V4A A;  3PML A;  4UB3 A;  1JOG A;  4MFC A;  5J2B A;  2ZHA A;  5D49 A;  7ICE A;  3RJE A;  3O10 A;  7ICU A;  5J2K A;  2Q66 A;  3C2M A;  3AJM A;  4NM2 A;  2PFQ A;  4GXK A;  4IQW A;  3B71 A;  1MIV A;  4QZ8 A;  1TVA A;  5J2J A;  1XSL A;  3RJF A;  7ICF A;  2BCQ A;  1BPD A;  3AQK A;  4M9N A;  1ZQI A;  7ICJ A;  1ZQJ A;  4LZD A;  5CWR A;  3LK9 A;  8ICP A;  7ICV A;  7ICP A;  4XUS A;  4DOB A;  5D46 A;  4LT6 A;  4PHA A;  4K4H A;  4UAW A;  1Q78 A;  3V7L A;  4WC1 A;  5J0P A;  8ICW A;  5DB6 A;  4FO6 A;  4GXI A;  9ICE A;  3HW8 A;  7ICM A;  7ICQ A;  8ICF A;  8ICL A;  1BPB A;  5J2E A;  4PHE A;  4PGX A;  5J0Y A;  3HJ4 A;  3RQF A;  3L9D A;  4KLF A;  4TUR A;  2M2T A;  4M9H A;  4KLS A;  1ZQW A;  4PGQ A;  8ICU A;  1PX5 A;  4YMM A;  4RPX A;  2NRK A;  3UXO A;  4KLD A;  4X4N A;  4LZG A;  4AT7 B;  2ZH1 A;  5BOM A;  5J0U A;  4XQ8 A;  3WFP A;  5J29 A;  5J0Q A;  5J0X A;  4KLU A;  3JPR A;  1UET A;  1OW8 A;  4NKT A;  3JPO A;  3ISB A;  4M04 A;  5DB7 A;  1R89 A;  5HC9 A;  1BPZ A;  4NXZ A;  4F5N A;  8ICB A;  4WC5 A;  3GDX A;  4NQF A;  2DRB A;  5BOL A;  4FH5 A;  4WC7 A;  4I2E A;  1ZQL A;  4S3N A;  3RH4 A;  2FMQ A;  3AQN A;  4RQ8 A;  4PPX A;  4RWN A;  4FHP A;  4M9L A;  7ICG A;  1ZZP A;  3GM1 A;  1ZQG A;  8ICX A;  2ZH2 A;  4AT8 A;  5HRG A;  8ICO A;  4RQ7 A;  1ZQX A;  3PNC A;  3ISD A;  1VFG A;  3GM2 A;  4TUP A;  5DBC A;  3K75 D;  4JWM A;  1OU5 A;  9ICN A;  3C8G B;  3C5G A;  2BE3 A;  8ICY A;  4X4T A;  4NLZ A;  2FMP A;  3TUL A;  1ZJM A;  4X4R A;  4KLI A;  7ICT A;  5HHI A;  4I2B A;  3OUY B;  3L8I A;  2M2W A;  1NOM A;  4UB1 A;  4P4M A;  5D4B A;  1ZQQ A;  3OVB A;  7ICK A;  5J2D A;  4AT9 B;  2PFO A;  1KEJ A;  4RQ2 A;  4O5C A;  4KLG A;  4Z6D A;  3C66 A;  4M2Y A;  5J0W A;  4F5O A;  4F5P A;  4PGY A;  4M9G A;  4X4V A;  1MIY A;  1K04 A;  2P66 A;  5IIJ A;  3MDA A;  9ICW A;  5HRD A;  4DOC A;  2I9G A;  8ICE A;  9ICL A;  9ICK A;  4Z6F A;  3UPQ A;  4I2F A;  5DBA A;  2L6G A;  4QZC A;  2DR8 A;  4MF2 A;  4FHV A;  3MGI A;  2ISP A;  9ICM A;  4R63 A;  3RJJ A;  2HHP A;  4E7X A;  3AU6 A;  4I2I A;  4M47 A;  2L6H A;  4IQV A;  5IIN A;  3H37 A;  1ZQV A;  9ICC A;  3V7J A;  5DB9 A;  4KLQ A;  1O3U A;  3C2K A;  1JQR A;  5DEC A;  1WOL A;  4KLL A;  4MFA A;  4I2A A;  4QZI A;  4K4G A;  4LVS A;  2KK1 A;  9ICR A;  3RQE A;  4QZF A;  3RJI A;  4YD1 A;  4O9M A;  4FHX A;  8ICZ A;  5HHH A;  5DB8 A;  3JPS A;  3OVA A;  8ICA A;  4NY8 A;  3WFR E;  1ZQU A;  9ICP A;  4NKU A;  4MF8 A;  4F5R A;  3U0C A;  4R32 A;  1ZQC A;  4KLM A;  4KLJ A;  4NM1 A;  4NLN A;  1OW6 A;  4P4P A;  1WWP A;  4AT8 B;  1ZQM A;  3L8J A;  2PFP A;  8ICV A;  4P2H A;  4QZE A;  5IIL A;  9ICQ A;  4ATB A;  5J0S A;  4M5D A;  5EOZ A;  4YMN A;  4GXJ A;  9ICO A;  5J2F A;  5HRL A;  1HUO A;  4UBB A;  9ICG A;  4FHY A;  2ZHB A;  3UQ0 A;  3AQL A;  3B0X A;  3NYB A;  4RQ5 A;  1ZQB A;  3OV7 A;  4PHD A;  2M2V A;  2ZH6 A;  2BCS A;  3RQG A;  3RJH A;  1WOT A;  3LQC B;  1ZQT A;  4X0A A;  3TFS A;  3HJ1 A;  5HRK A;  5BPC A;  1ZQO A;  4WC6 A;  3AUO A;  4O5K A;  1ZQY A;  4R66 A;  5DDM A;  7ICI A;  4I2J A;  1ZQH A;  4KLT A;  3UQ2 A;  5HR9 A;  3TFR A;  5DBB A;  3JPN A;  2BPG A;  2DR5 A;  3RH6 A;  4IG8 A;  5J2I A;  4F5Q A;  1ZQK A;  2DRA A;  1ZQP A;  3JPP A;  3PMN A;  3V7K A;  2PXI A;  7ICN A;  4X4S A;  3JPT A;  8ICN A;  1ZQA A;  1R8C A;  3C18 A;  4QZD A;  3HIY A;  3HWT A;  5F2V O;  2JPU A;  3MBY A;  4MFF A;  5III A;  4JWN A;  5CP2 A;  4XEV A;  7ICO A;  3UXN A;  8ICS A;  5J0T A;  1K40 A;  4E80 A;  4RT3 A;  3JZ0 A;  2Q00 A;  1BPY A;  5CB1 A;  4M9J A;  4RQ6 A;  4EBJ A;  7ICH A;  8ICQ A;  9ICS A;  9ICV A;  3H39 A;  4DO9 A;  4UAZ A;  5DED A;  4UD5 A;  1UEV A;  3UPS A;  1TFY A;  5TZV A;  4K4I A;  2LK4 A;  1QVX A;  4UD4 A;  4RPZ A;  4QZB A;  1MQ3 A;  1JAJ A;  2PFN A;  4QZG A;  3K7D A;  9ICA A;  2RFF A;  4KLH A;  2ID1 A;  3C8G D;  1OW7 A;  4WBZ A;  3AQM A;  4X4U A;  4XEK A;  3ISC A;  5J0R A;  4PH5 A;  1K05 A;  4IQT A;  1NO5 A;  2ZH5 A;  1MIW A;  1BPX A;  2PBE A;  1ZQE A;  5J2H A;  4YCX A;  5J2G A;  5IIO A;  5J0O A; 
#chains in the Genus database with same CATH topology
 2ZH3 A;  5AC4 A;  4YMO A;  4I2G A;  2AP3 A;  2BBH A;  5CI8 A;  4E8F A;  4OAI Z;  4WC2 A;  5B1A C;  2R7Q A;  3ZQY A;  4DOA A;  2GAQ A;  1TFW A;  3C8G A;  5BQI A;  4I27 A;  4XLP F;  3NVO A;  1CGN A;  3L0I A;  3RH5 A;  5JUA A;  5JT4 A;  4P4O A;  4R64 A;  1PCX A;  3L1M A;  3RFY A;  1T01 A;  2WVN A;  1ZHW A;  3RJG A;  3EGX B;  4MVU A;  3B0Y A;  8ICK A;  3NYJ A;  2VCB A;  1D1C A;  5E33 A;  1G5Z A;  2BCV A;  4I2H A;  4PJL A;  4Z6C A;  1UFB A;  2BCU A;  4CJG A;  2NG1 A;  4LER A;  2CNW A;  4Z9H A;  4R65 A;  2CGE A;  4WCW A;  5JSL A;  2BPC A;  1U6H A;  1ZQZ A;  4RQ3 A;  5DS5 A;  5DLJ A;  4O5E A;  4N6H A;  3HNI A;  3X2Q C;  2B0H A;  4OIQ F;  3S28 A;  2IXN A;  4JZA A;  1VK5 A;  1WTY A;  3W8I A;  2AVK A;  3JT1 A;  3VYW A;  4KC9 A;  3JTL O;  4K1O A;  4KLO A;  3AGU A;  3U3F A;  4QZH A;  3EGD A;  4IRU A;  2JX0 A;  4LDR A;  3VRC A;  5IIM A;  4YN4 A;  5K0I A;  5T3T A;  5HV9 A;  3K6B A;  3JRM O;  4GQH A;  2O1P A;  3ZSU A;  7ICS A;  4WGY A;  3H3A A;  1VYK A;  1SMY F;  9ICX A;  4JLZ A;  1KTM A;  1MNE A;  9ICJ A;  4RQ1 A;  1BR1 A;  1TWH A;  2HSB A;  1AUE A;  3MDC A;  4ONS A;  4JJF A;  2H7B A;  2YKZ A;  3ZTM A;  1VYI A;  4RBN A;  3BRJ A;  2A0U A;  3U9M A;  1R8B A;  1DOW A;  3JYY A;  1ZQN A;  3MYI A;  1LE4 A;  1TV9 A;  1HY5 A;  4FHW A;  5HRB A;  1VLS A;  5DDY A;  5JTG A;  4EEB A;  4U5B E;  2P0N A;  3W2W A;  4KI2 A;  4ATB B;  3MGH A;  3WFO A;  2OOC A;  1WAS A;  4KNV A;  5F5H A;  2ZH8 A;  2OEV A;  5EHH A;  1JOG A;  4CDV A;  5KYY A;  3KYI A;  5D49 A;  2KW3 C;  3RJE A;  7ICU A;  2EPK X;  2XLW A;  5B3S C;  3E9V A;  5COF A;  2BE5 F;  4CBE A;  4O6N A;  2WL8 A;  4GXK A;  2WB7 A;  3EH1 A;  2AWY A;  4JCZ A;  4C7O B;  1XSL A;  4WJ0 A;  4UDV A;  3ZWI A;  4BJ5 C;  4M9N A;  1FMW A;  2FAP B;  4XWJ A;  3KL4 A;  1GM5 A;  3LAY A;  2PF4 E;  7ICV A;  2YLG A;  3NMI A;  4LT6 A;  4PHA A;  4P6I C;  3LEV A;  3B0U X;  1D0X A;  5DB6 A;  4FO6 A;  4ER9 A;  2FCL A;  2W4B A;  8ICL A;  5J2E A;  4U5H A;  3GOR A;  3RQF A;  3IEE A;  1VOM A;  4RPX A;  4LEW A;  2Q9C A;  4IAR A;  1R4T A;  3K33 A;  5CFU A;  4AT7 B;  3M4B A;  3G4X A;  4P9T A;  3J06 A;  5J0X A;  1LS1 A;  2UUH A;  4DVY P;  1OW8 A;  3FAP B;  4DRJ B;  4ULW A;  4F5N A;  3DJU B;  3JSZ A;  5BOL A;  4WC7 A;  3C63 A;  1LI5 A;  2FMQ A;  4RQ8 A;  4GEH A;  1FMV A;  2H7V C;  4RWN A;  5T3W A;  2J8W A;  8ICX A;  2ZH2 A;  5HRG A;  4YK5 A;  4RQ7 A;  4CSA A;  1ZQX A;  1JMW A;  2WZF A;  3GM2 A;  1XZP A;  3NKD A;  1OKK D;  4JWM A;  2W45 A;  9ICN A;  3RYL A;  4B6I A;  4O67 A;  1EKY A;  3C8G B;  3C5G A;  2BE3 A;  1KU2 A;  3SXY A;  1ZJM A;  4JTC B;  4DBR A;  1Y6D A;  3UMI A;  4P4M A;  4IAQ A;  5D4B A;  5J2D A;  4N6C A;  2PFO A;  3F47 A;  3ERC C;  4Z6D A;  4M2Y A;  5L0F A;  5J0W A;  4X4V A;  1RKE A;  3T9O A;  2EPO A;  5IIJ A;  3MDA A;  3G50 A;  1OKK A;  4DOC A;  2YL0 A;  3N24 A;  2I9G A;  4QZC A;  2DR8 A;  4K97 A;  3JCU Q;  3ZTZ A;  2ISP A;  3RJJ A;  2B4V A;  1ZVZ A;  4WGZ A;  2NPU A;  3UGP A;  1ZQV A;  3TK0 A;  5DB9 A;  4W8K A;  1CPR A;  3QMK A;  3C2K A;  1GPJ A;  4O6Y A;  2GDC A;  5DEC A;  3DWW A;  1WOL A;  3EH2 A;  2A1D D;  4KLL A;  4DJ9 A;  4MFA A;  4MS2 A;  3FOP A;  4I2A A;  4QZI A;  2ZXW C;  4Q5S F;  4J7T A;  3RJI A;  4YD1 A;  2G62 A;  5HHH A;  2ASR A;  5L3Q A;  4CIH A;  4G0H A;  2IUB A;  3Q6N A;  4NY8 A;  4PJJ A;  3WFR E;  1ZQU A;  2BL2 A;  4JW1 A;  2DYR C;  4KLM A;  1O5H A;  4WQL A;  2QE9 A;  2NUT A;  4Z9J A;  2PNO A;  3L8J A;  3JRT A;  9ICQ A;  5EOZ A;  5J2F A;  1A7V A;  1Z6A A;  4FHY A;  3HNL A;  2EWR A;  2ZHB A;  3CZ6 A;  4RQ5 A;  1IZM A;  4CS8 C;  1NZE A;  1R5I D;  3S27 A;  3HKK A;  4BJ6 A;  4BJ1 A;  1QKR A;  1LVK A;  3W4Y A;  4J32 B;  3MX3 A;  3PMR A;  1BZ4 A;  4OIR F;  4RDA A;  1LIH A;  4NXT A;  3AUO A;  1ZQO A;  4O5K A;  2ETS A;  4R66 A;  1MMN A;  4I2J A;  4KLT A;  4PFO A;  2A0B A;  4AK9 A;  4EHP A;  2LFD A;  5KYY B;  1NFN A;  3JPN A;  3RH6 A;  2HFI A;  1ZQK A;  3EGX A;  1ZQP A;  3N2Z B;  5DS4 A;  3V7K A;  1YVI A;  1T9K A;  8ICN A;  1ZQA A;  4CS7 A;  4ZLD A;  3C18 A;  4EKW A;  5F2V O;  2AWC A;  3U8V A;  4JWN A;  5CP2 A;  2GA0 A;  4CDY A;  1TQG A;  1ZYR F;  5CI9 A;  8ICS A;  1K40 A;  3GWL A;  4FES A;  4XQ1 A;  4LDK A;  1HE9 A;  5L0G A;  3RVZ A;  4UD5 A;  1APC A;  3Q7L A;  2YRF A;  3UPS A;  1M2O A;  2VCA A;  2ZXR A;  1TFY A;  3CSK A;  3FDQ A;  1LPE A;  1QVX A;  4NXV A;  4QZB A;  2OJQ A;  2R7U A;  4Z9I A;  4U5C E;  1A7E A;  2LSE A;  3ISC A;  1QLE C;  4IQT A;  3DD7 A;  5D62 A;  3WOD F;  2PBE A;  4X0R A;  3NYM A;  4O68 A;  5J2G A;  5IIO A;  5DVW A;  4X4P A;  4I28 A;  2VAN A;  5DS6 A;  4I0U A;  1ZJN A;  4I29 A;  3U5S A;  8ICT A;  2FMS A;  3U8P A;  8ICC A;  1WN0 A;  4KLE A;  4WBY A;  5BUO A;  4WQK A;  1MMA A;  3OUY A;  4UB5 A;  2XLO A;  4OD5 A;  3HX0 A;  4AT9 A;  1KNY A;  2L81 A;  1E84 A;  3LNR A;  2PX0 A;  2NSG A;  3SZR A;  4OAH A;  3ASO C;  3AG3 C;  2J9B A;  1JN3 A;  1MQ2 A;  5COM A;  1ZQD A;  2CCY A;  2BCR A;  4MTO A;  5DKW A;  4C7O A;  2C03 A;  4RQ0 A;  1NU9 C;  4EBK A;  1UEU A;  1F5A A;  1ZQR A;  3AQB A;  2C04 A;  4C3E A;  3OGU A;  5J2C A;  4RWP A;  4EIY A;  3W2V A;  3LLI A;  1E85 A;  2VCC A;  4IB4 A;  3F46 A;  4Q7C A;  3HLZ A;  8ICH A;  2LP4 A;  3OA1 A;  3JPQ A;  8ICR A;  1TWG A;  3AQC A;  2EPM X;  3EZI A;  2J9V A;  2WZL A;  3G4Z A;  5CR0 A;  2B56 A;  4JTD B;  3C2L A;  4RPY A;  5JRA A;  4G78 A;  3U3B A;  1M6T A;  2ISO A;  2ICW G;  2EPN A;  2L6F A;  2L9J A;  4JLX A;  2D4U A;  2YVK A;  4AT7 A;  1Q0F A;  4NCQ A;  3S84 A;  5CJ7 A;  5EGY A;  5CHG A;  5B1B C;  5A6B D;  2BPF A;  2VC9 A;  2M2U A;  3LNM B;  2DVI A;  1HMD A;  1ZU4 A;  4N06 A;  5F28 E;  1VJ7 A;  4K8V A;  1XSP A;  5CFT A;  2Q3T A;  3AOU A;  4XQ7 A;  1HUZ A;  4RWO A;  2DGJ A;  3PDM P;  8ICM A;  4MQ9 F;  3PML A;  7ICE A;  3FMS A;  3DXJ F;  2HKV A;  3M79 A;  5A6A A;  1ZHZ A;  3U2L A;  3O10 A;  4L6R A;  3H2U A;  5J2K A;  2Q66 A;  3C2M A;  4AL1 A;  3AJM A;  4NM2 A;  5A6B A;  3C8Z A;  4QI2 A;  1O87 A;  4YWQ A;  4IQW A;  3B71 A;  1MIV A;  5D91 A;  5J2J A;  1UG7 A;  2YHS A;  4XTK A;  3NWI A;  4NC3 A;  1T6U A;  3V7O A;  3AQK A;  1QSP A;  1M57 C;  1ZQI A;  3LLK A;  1ZQJ A;  4AL0 A;  5COG A;  3LK9 A;  3GEH A;  3FVY A;  5D46 A;  1WAT A;  3WAQ A;  4K4H A;  1Q78 A;  2DYS C;  2ZD9 A;  4MVR A;  2OJE D;  2HZ8 A;  2QY9 A;  2IBF A;  4GXI A;  9ICE A;  4PR9 A;  4WH5 A;  2R25 A;  1BPB A;  4PGX A;  3I5Q A;  1ZQW A;  2Y3G A;  8ICU A;  1YA7 O;  3KPH A;  4BG0 A;  4FWV A;  5J0U A;  4XQ8 A;  1GGQ A;  2UUI A;  3K1H A;  2VAS A;  5J0Q A;  3L34 A;  4KLU A;  1UET A;  3AG4 C;  5DB7 A;  3MBG A;  2PX3 A;  3CK6 A;  4NXZ A;  3OWG A;  5EK0 A;  4NQF A;  2XM4 A;  2DRB A;  1M2V A;  4MTF A;  4I2E A;  4CS9 A;  2XL6 A;  3RH4 A;  2XLV A;  1DOV A;  3AQN A;  4PPX A;  4M9L A;  1PD0 A;  1ZZP A;  5TJ5 E;  3WHN A;  2NSF A;  3Q6M A;  1VFG A;  3ISD A;  3T6G B;  5DBC A;  3LUT B;  5KYU A;  1XZQ A;  5D61 A;  2FMP A;  3IHU A;  7ICT A;  4O7G A;  3OUY B;  2H7O A;  1NOM A;  4UB1 A;  1ORY A;  2I15 A;  7ICK A;  1NU7 D;  4AT9 B;  2IM8 A;  4PJM A;  2LIG A;  4KLG A;  3C66 A;  4PGY A;  2MHR A;  1K04 A;  9ICW A;  4HFF B;  4A4A A;  4I1M A;  4YT5 A;  3UPQ A;  1LI7 A;  2A6H F;  1H7I A;  2L6G A;  5DBA A;  4I2F A;  4MF2 A;  4FHV A;  4PK4 A;  4DOZ A;  4OIO F;  9ICM A;  1Z63 A;  3DKA A;  3IQ6 A;  4LEY A;  2HS5 A;  2R7X A;  4WAB A;  2L6H A;  5IIN A;  4G7Z F;  4IJJ A;  3LJB A;  2P1A A;  1ZW2 A;  4JJG A;  4BEM J;  1ZHX A;  1H9G A;  1SYQ A;  4CJO A;  2Y3H A;  4QZF A;  4O9M A;  1SF8 A;  2W9Y A;  4E0H A;  3DI5 A;  2Z15 A;  1HMO A;  5DB8 A;  3JPS A;  4J30 B;  2EIN C;  3ER9 B;  3MYF A;  2IXP A;  2EIL C;  2GA9 D;  1S05 A;  9ICP A;  4NKU A;  4F5R A;  2HV7 A;  3U0C A;  4R32 A;  1ZQC A;  2IHO A;  4AT8 B;  2GAF D;  5KYX A;  2Y39 A;  3EG9 B;  4P2H A;  4PAC A;  2Q9A A;  4QZE A;  4DRH B;  1A7D A;  1HUO A;  2J9W A;  5GPG B;  1H9T A;  1RCP A;  3B0X A;  3NMJ A;  3RW0 A;  1ZQB A;  1EI7 A;  4PHD A;  2M2V A;  2BCS A;  3KH2 A;  1I4Z A;  1WOT A;  4X0A A;  3TFS A;  3UMK A;  3HJ1 A;  5BPC A;  1C17 M;  1ZQY A;  2BC5 A;  3S29 A;  3UQ2 A;  5HR9 A;  1E83 A;  1ZHT A;  4IGG A;  2A68 F;  4XPX A;  2J45 A;  2BPG A;  2DR5 A;  4O79 A;  5J2I A;  2VB6 A;  2QTV A;  2YQY A;  3JPP A;  1T5O A;  5L0D A;  1SZI A;  4JVS A;  4A2N B;  2PXI A;  7ICN A;  1GS9 A;  2R7T A;  4OAF A;  3HIY A;  3HWT A;  2YEV A;  3GEI A;  3I4U A;  4YL3 A;  3SXM A;  1OXK A;  3UXN A;  5J0T A;  4M9J A;  3POV A;  3FHD A;  1FTS A;  7ICH A;  3KKB A;  4DO9 A;  3EFO A;  4CIP A;  1TWC A;  1RMV A;  2RD9 A;  4K4I A;  2LK4 A;  1JR8 A;  2WZG A;  3HNJ A;  4UD4 A;  1XWJ A;  3V5Y A;  1V54 C;  1Q0D A;  9ICA A;  4KLH A;  2ID1 A;  4WBZ A;  4JUR I;  4XEK A;  2HMZ A;  2KYH A;  2J9U A;  1K05 A;  3E70 C;  2ZH5 A;  1YAR O;  4E7Z A;  5D92 A;  3K66 A;  5B3P A;  1OQC A;  2LFF A;  5J0O A;  3DE9 A;  7ICL A;  2YL7 A;  2J7P D;  1OCO C;  7ICR A;  3TOL A;  2ZH7 A;  3LEO A;  4K9A A;  1ZQS A;  4UBC A;  1D1A A;  3DM5 A;  5HRE A;  1M2V B;  4UB2 A;  4UAY A;  5HRI A;  4X4Q A;  4BJ5 A;  3CQZ A;  2DR9 A;  3TD7 A;  8ICG A;  5L3V A;  4TUQ A;  8ICI A;  4RWQ A;  1RPL A;  2TMV P;  2IHM A;  4MVO A;  4FH3 A;  4WC0 A;  1VLT A;  5KYU B;  5JS5 A;  4KM5 A;  3AU2 A;  3W8H A;  2R7O A;  3RF3 A;  9ICI A;  2PP4 A;  3S9O A;  4C3D A;  3GAN A;  3T4R A;  4HX0 A;  9ICF A;  3FAJ A;  2R05 A;  3X1O A;  1GQA A;  2P7V A;  4XPW A;  2ZH9 A;  2KJG A;  3SEO A;  3R2P A;  4LEZ A;  3DE8 A;  1YZA A;  4QZ9 A;  3VAY A;  4MND A;  2Q9B A;  2YWA A;  2DR7 A;  1YZC A;  1FAP B;  3ZG1 A;  4X5V A;  3GM3 A;  4EP7 A;  3OVS A;  2W9M A;  3DJN B;  3B29 A;  5BQH A;  3A11 A;  2R7R A;  3UXP A;  1KDH A;  3RJK A;  4XRH A;  1NBB A;  2YLD A;  5L0H A;  1PV3 A;  4ZLC A;  3H38 A;  2G3K A;  5HSW A;  4PHP A;  5HRF A;  1YLQ A;  1JPJ A;  4MVS A;  1ORS C;  2HSQ A;  2ZH4 A;  5JLI A;  1BPE A;  9ICT A;  5F5F A;  2O5A A;  2RSE B;  9ICB A;  9ICU A;  1A41 A;  5KYX B;  1PD1 A;  4E0I A;  3UGO A;  4Z6E A;  3EJN A;  1Y4C A;  4M0A A;  2ZPA A;  4E17 A;  3WFQ E;  1V4A A;  5A6J A;  4UB3 A;  2ZHA A;  3EPV A;  4JEA A;  4FO1 A;  1SR2 A;  1YDI A;  1MMG A;  3SNH A;  1TWA A;  5L0J A;  1I4Y A;  2PFQ A;  1QQ3 A;  2HUJ A;  4GYT A;  2XXA B;  4QZ8 A;  4LLC A;  3TOM A;  4G7O F;  7ICF A;  1BR2 A;  2BCQ A;  1BPD A;  1ST6 A;  3KMI A;  4QI0 A;  1L7C A;  4U9E A;  1Q0K A;  3IQC A;  5IY5 C;  8ICP A;  7ICP A;  4YT4 A;  4XUS A;  4DOB A;  3B0P A;  3V7L A;  2HJM A;  2KSF A;  1JRA A;  3HW8 A;  4YL1 A;  8ICF A;  3EZH A;  1D0Z A;  3K1I A;  3L9D A;  4KLF A;  2A69 F;  5L0C A;  5B3Q A;  2M2T A;  4M9H A;  4KLS A;  1PX5 A;  1CGO A;  2NRK A;  1OCC C;  3EFO B;  1FNT c;  3C7J A;  3UXO A;  4HEA J;  4LZG A;  3WG7 C;  4KBL A;  1C02 A;  4OD4 A;  2FGY A;  3GEE A;  5J29 A;  1G4W R;  2IXO A;  3JPO A;  1NFO A;  1BPZ A;  4ULV A;  4LDQ A;  4CS8 A;  4C3B A;  3MCR A;  3RKO F;  4NTB A;  8ICB A;  3GDX A;  3ITF A;  3SYN A;  1QZX A;  2KGO A;  4K96 A;  1ZQL A;  4S3N A;  4E18 A;  3ASN C;  4P9F A;  2IXM A;  2HN1 A;  5A69 A;  2XLD A;  3GM1 A;  1ZQG A;  4AT8 A;  3EG9 A;  4U5E E;  4LLE A;  3PNC A;  2HJ3 A;  2X51 A;  4TUP A;  4F4B A;  1OU5 A;  3AG1 C;  4EWC A;  3S0X A;  8ICY A;  4NLZ A;  3TUL A;  1G4U S;  3PHZ A;  5HHI A;  1RJ9 B;  1ZQQ A;  3AGT A;  1KEJ A;  4RQ2 A;  4NTA A;  4M9G A;  2XLE A;  4JIO A;  4XJE A;  2P66 A;  1NG1 A;  2E87 A;  1YYX A;  2J46 A;  9ICK A;  4Z6F A;  4MTG A;  2H8A A;  3MGI A;  4O69 A;  2HHP A;  4E7X A;  5KYN A;  5E2Q A;  4I2I A;  4M47 A;  4IQV A;  3NKE A;  4CDA A;  9ICC A;  1E86 A;  3V7J A;  4KLQ A;  2CDQ A;  2XRH A;  4K7B A;  1OCZ C;  3CAX A;  1NSG B;  1T6Q A;  3M15 A;  1TFO B;  9ICR A;  2HN2 A;  2Q4F A;  3ABL C;  1H6G A;  2MWQ A;  4NXX A;  2CNW D;  3ZIB A;  3OVA A;  8ICA A;  1AEP A;  2ZXP A;  1LKX A;  3ER8 C;  3NKU A;  5BQG A;  256B A;  4KLJ A;  4P4P A;  1WWP A;  2M4E A;  4H4K C;  8ICV A;  2KC3 A;  3OWT A;  5L0I A;  2G3V A;  1FFT C;  1CPQ A;  1MMD A;  1TFK B;  5J0S A;  2O9X A;  4YMN A;  4GXJ A;  2OQM A;  1A0B A;  5HRL A;  2YLI A;  1QPU A;  4UBB A;  4YT2 A;  3DMD A;  9ICG A;  3S90 A;  4D4X A;  3UQ0 A;  2DB4 A;  4K0D A;  3OV7 A;  2ZH6 A;  1L3P A;  4E7S A;  4PJN A;  5KYW B;  1HE1 A;  1ZQT A;  1ZHY A;  3NDB B;  5HRK A;  3ATP A;  3ABK C;  4I3M A;  3UR3 C;  3SXZ A;  1C03 A;  5DDM A;  3IQ5 A;  2F22 A;  4LEV A;  2QLA A;  4IAO A;  3TFR A;  5DBB A;  2OKU A;  3UNG C;  4CSA C;  1YLM A;  4IG8 A;  4F5Q A;  5B3I A;  1Z7Q c;  2DRA A;  5FCL A;  3CEX A;  3NMK A;  1RXQ A;  4U5F E;  4YN0 B;  4WOY A;  3GOD A;  1R8C A;  1J8M F;  3LS0 A;  4QZD A;  5D63 A;  2L7A A;  2JPU A;  4O6A A;  1AVO B;  3UMH A;  4XEV A;  2YZS A;  4LAC B;  2R02 A;  4M63 A;  2Q00 A;  1BPY A;  5CB1 A;  1NLX A;  2IOQ A;  3H2V A;  8ICQ A;  4U5D E;  4UAZ A;  5DED A;  1UEV A;  5TZV A;  3B9Q A;  3M4C A;  2XSE A;  3DZA A;  4MW3 A;  1JAJ A;  3QVZ A;  2PFN A;  3HTK C;  4NTF A;  4QZG A;  1EQ1 A;  4YJW A;  3LS1 A;  2WVO A;  1OW7 A;  4U9D A;  3SP1 A;  4X4U A;  5J0R A;  4PH5 A;  2A6E F;  2XLM A;  3KYJ A;  1NO5 A;  1W2W A;  1BPX A;  1ZQE A;  4YCX A;  4ANJ A;  4WC4 A;  4IQU A;  1Z23 A;  3U2M A;  4NY3 A;  3DAF A;  5J2A A;  4X0B A;  4WC3 A;  5E3C A;  4I2D A;  3IPM O;  1Z5Z A;  4DVZ A;  4NLK A;  1M56 C;  2V3C C;  1CGM E;  1E2X A;  4X4O A;  3MFN A;  4EV6 A;  3PCV A;  4AE4 A;  1Q79 A;  1JAF A;  2EIJ C;  4JCH A;  1OR2 A;  1N1C A;  5CHE A;  3SXK A;  5DQZ A;  1MND A;  4QZA A;  1ORJ A;  1D0Y A;  4TUS A;  1XSN A;  5CA7 A;  3I5P A;  9ICH A;  4BJ6 C;  3V5Z A;  3HJC A;  2XXA A;  2IYL D;  2AU5 A;  4D4N A;  1FFH A;  4K99 A;  4NXU A;  1VMA A;  3ECS A;  5CIV A;  5E3A A;  2OG2 A;  4UB4 A;  4CX9 A;  2NUP A;  3EHN A;  1JPN A;  1TR2 A;  1V74 B;  3C5F A;  1RZT A;  2LCH A;  2GFH A;  4XEF A;  5IIK A;  4MVQ A;  3DAG A;  2EPL X;  2KNH A;  5HRH A;  4HFK B;  1ZQF A;  1R8A A;  4RQ4 A;  4JEB A;  4EGW A;  3A9C A;  2HV6 A;  3H65 A;  4I2C A;  1HW2 A;  1S7Z A;  4NXW A;  1OR3 A;  1JMS A;  3V72 A;  3WFS C;  3NG1 A;  2GWW A;  3JYH A;  5JVE A;  4XA5 A;  2KQ9 A;  3EQL F;  2OU6 A;  1FA0 A;  4RT2 A;  3QW1 A;  3IQT A;  3QTH A;  4YD2 A;  8ICJ A;  2EIK C;  2GWS A;  1YA9 A;  3HNK A;  2WVQ A;  4MFC A;  5J2B A;  2MYS A;  5JP7 A;  2LD6 A;  1YJG A;  5DQT A;  4K9B A;  1LS4 A;  1Q0G A;  2XM0 A;  3N0T A;  4JRZ A;  4DXW A;  1TVA A;  3RJF A;  4N4W A;  4IWB A;  4FAP B;  4MKP A;  2CW0 F;  2W4M A;  2R7V A;  4PFP A;  2QNL A;  4U5G A;  3US6 A;  7ICJ A;  3VM6 A;  1D1B A;  4BEJ A;  5AC5 A;  4LZD A;  4YL0 A;  1T6I A;  4EBB A;  5CWR A;  1RJ9 A;  3EGD B;  2HMQ A;  4UAW A;  4KB6 A;  4WC1 A;  5J0P A;  8ICW A;  1OCR C;  2J7P A;  4JC7 A;  3T6B A;  7ICM A;  3K1I C;  2Q7R A;  7ICQ A;  4RD9 A;  4W8P A;  4JE9 A;  1HW1 A;  4PHE A;  3PHF 2;  5J0Y A;  3HJ4 A;  3T6J A;  4TUR A;  4PGQ A;  4YMM A;  4Q4Z F;  4FX5 A;  2X0C A;  4KLD A;  3R7C A;  4X4N A;  2ZH1 A;  5BOM A;  1J8Y F;  3WFP A;  4AX2 A;  4O6M A;  2R03 A;  4J7Y A;  4OIN F;  2R7W A;  3JPR A;  3C62 A;  4NKT A;  3ISB A;  4M04 A;  2QUP A;  1MQV A;  1R89 A;  5HC9 A;  4DRI B;  2I8B A;  1U0B B;  2LQG A;  4WC5 A;  2FFH A;  3NRH A;  4FH5 A;  3EHM A;  2CYD A;  4KNW A;  4XLN F;  1F1M A;  4FHP A;  7ICG A;  3LES A;  4JKV A;  8ICO A;  2VH3 A;  3GWN A;  3Q7G A;  3FXH A;  3K75 D;  4K98 A;  2R7S A;  2BBJ A;  3AG2 C;  4X4T A;  4G7H F;  4X4R A;  4KLI A;  4AE4 B;  4I2B A;  3L8I A;  3B0V C;  2M2W A;  2D5R B;  3OVB A;  1Q0M A;  3OEO A;  4YT8 A;  5KYW A;  4O5C A;  4F5O A;  5CFS A;  4F5P A;  1MIY A;  3RH3 A;  4H54 A;  3V5X A;  5HRD A;  3VF0 A;  2XS8 A;  4I1O B;  8ICE A;  4HE8 D;  9ICL A;  2V26 A;  1OXB A;  1I5N A;  3RVY A;  4EUK B;  4R63 A;  2XL8 A;  4MW8 A;  3AU6 A;  2M64 A;  3NYL A;  3BEH A;  2J0X A;  3H37 A;  2ZXO A;  3TJ6 A;  1YYJ A;  4BJT A;  2XLH A;  3ZDL A;  1O3U A;  4I44 A;  1JQR A;  3MLG A;  2XS1 A;  2XL4 A;  4K4G A;  3TQO A;  4LVS A;  1LM3 B;  2KK1 A;  3RQE A;  8ICZ A;  2NUP B;  4FHX A;  2YL1 A;  3JSE O;  4EED A;  2J0W A;  5AGF A;  5A6K A;  2P6V A;  2EIM C;  4MF8 A;  3EF2 A;  5FZT A;  4NM1 A;  2B51 A;  1IW7 F;  1VB5 A;  1OW6 A;  2P61 A;  1V55 C;  2Y3D A;  4NLN A;  1ZQM A;  4MVZ A;  2PFP A;  1BR4 A;  5IIL A;  3O39 A;  2Y3B A;  4ATB A;  9ICO A;  4M5D A;  1BDJ B;  4OIP F;  5T1D B;  2DI3 A;  3AQL A;  3NYB A;  4QDL A;  3JCF A;  2OEX A;  3QW0 A;  3ABM C;  4N7R A;  3FOO A;  3RQG A;  3RJH A;  3ZVR A;  3LQC B;  1Z3I X;  3TJ5 A;  1VTM P;  4CS9 C;  4OAG A;  4WC6 A;  7ICI A;  1RKE B;  1ZQH A;  3U9J A;  1U89 A;  3PMN A;  2JD3 A;  4X4S A;  3JPT A;  1LE2 A;  4DBQ A;  3QVY A;  1FR0 A;  1YAU O;  4MFF A;  3MBY A;  5III A;  7ICO A;  1B68 A;  3O6X A;  4E80 A;  4RT3 A;  1BBH A;  1WGW A;  3JZ0 A;  4RQ6 A;  3DM9 B;  4EBJ A;  9ICS A;  3O55 A;  9ICV A;  3H39 A;  4MVM A;  3ZC4 A;  2YL3 A;  3M1C B;  1TKN A;  1G8X A;  1ZU5 A;  2B0J A;  4XPY A;  1EA8 A;  2OCC C;  1RKC A;  2Y69 C;  4RPZ A;  2PFD A;  1MQ3 A;  3K7D A;  4BPM A;  2NUT B;  2RFF A;  1ZW3 A;  3C8G D;  3AQM A;  3RIP A;  3ZQV A;  1MIW A;  3QZC A;  4JTA B;  5J2H A;  2R9R B; 
#chains in the Genus database with same CATH homology
 4X4P A;  4WC4 A;  2ZH3 A;  4I28 A;  7ICL A;  4YMO A;  4IQU A;  4I2G A;  2VAN A;  4E8F A;  1ZJN A;  4WC2 A;  5J2A A;  4X0B A;  4I29 A;  7ICR A;  4WC3 A;  4DOA A;  2ZH7 A;  8ICT A;  1ZQS A;  4I2D A;  2FMS A;  4UBC A;  1TFW A;  3C8G A;  5HRE A;  8ICC A;  4UB2 A;  4I27 A;  4UAY A;  4NLK A;  4KLE A;  3RH5 A;  4P4O A;  4WBY A;  4R64 A;  5HRI A;  4X4O A;  3MFN A;  4X4Q A;  1Q79 A;  3OUY A;  4UB5 A;  2DR9 A;  3HX0 A;  3RJG A;  8ICG A;  4TUQ A;  4AT9 A;  4RWQ A;  8ICI A;  1KNY A;  3B0Y A;  8ICK A;  1RPL A;  2BCV A;  2IHM A;  4I2H A;  4FH3 A;  4WC0 A;  4Z6C A;  4QZA A;  1JN3 A;  1UFB A;  1MQ2 A;  2BCU A;  4TUS A;  1XSN A;  5CA7 A;  1ZQD A;  2BCR A;  4R65 A;  9ICH A;  4WCW A;  3AU2 A;  2BPC A;  1ZQZ A;  4RQ3 A;  5DKW A;  9ICI A;  3S9O A;  4O5E A;  4RQ0 A;  4EBK A;  1UEU A;  1F5A A;  9ICF A;  1ZQR A;  1WTY A;  2ZH9 A;  4KLO A;  3OGU A;  5J2C A;  4RWP A;  3U3F A;  4QZH A;  2JX0 A;  5IIM A;  4YN4 A;  4QZ9 A;  4UB4 A;  3C5F A;  1RZT A;  8ICH A;  3JPQ A;  8ICR A;  4XEF A;  2YWA A;  2O1P A;  2DR7 A;  5IIK A;  5HRH A;  5CR0 A;  7ICS A;  1ZQF A;  4X5V A;  3GM3 A;  4EP7 A;  3C2L A;  3H3A A;  4RPY A;  3OVS A;  9ICX A;  1R8A A;  2W9M A;  1KTM A;  9ICJ A;  4RQ1 A;  2ISO A;  4RQ4 A;  2HSB A;  3UXP A;  1KDH A;  3RJK A;  2L6F A;  4XRH A;  3MDC A;  4I2C A;  4AT7 A;  3H38 A;  1PV3 A;  1JMS A;  3V72 A;  5CJ7 A;  3WFS C;  4PHP A;  5HRF A;  5CHG A;  3BRJ A;  1YLQ A;  2BPF A;  2ZH4 A;  4XA5 A;  2M2U A;  1BPE A;  1R8B A;  9ICT A;  3JYY A;  2O5A A;  1FA0 A;  1ZQN A;  2DVI A;  9ICB A;  4RT2 A;  1TV9 A;  9ICU A;  4FHW A;  5F28 E;  1VJ7 A;  1XSP A;  5HRB A;  4YD2 A;  5DDY A;  8ICJ A;  4Z6E A;  4ATB B;  3MGH A;  2GWS A;  4XQ7 A;  1HUZ A;  4M0A A;  3WFO A;  3WFQ E;  4RWO A;  8ICM A;  2ZH8 A;  1V4A A;  3PML A;  4UB3 A;  1JOG A;  4MFC A;  5J2B A;  2ZHA A;  5D49 A;  7ICE A;  3RJE A;  3O10 A;  7ICU A;  5J2K A;  2Q66 A;  3C2M A;  3AJM A;  4NM2 A;  2PFQ A;  4GXK A;  4IQW A;  3B71 A;  1MIV A;  4QZ8 A;  1TVA A;  5J2J A;  1XSL A;  3RJF A;  7ICF A;  2BCQ A;  1BPD A;  3AQK A;  4M9N A;  1ZQI A;  7ICJ A;  1ZQJ A;  4LZD A;  5CWR A;  3LK9 A;  8ICP A;  7ICV A;  7ICP A;  4XUS A;  4DOB A;  5D46 A;  4LT6 A;  4PHA A;  4K4H A;  4UAW A;  1Q78 A;  3V7L A;  4WC1 A;  5J0P A;  8ICW A;  5DB6 A;  4FO6 A;  4GXI A;  9ICE A;  3HW8 A;  7ICM A;  7ICQ A;  8ICF A;  8ICL A;  1BPB A;  5J2E A;  4PHE A;  4PGX A;  5J0Y A;  3HJ4 A;  3RQF A;  3L9D A;  4KLF A;  4TUR A;  2M2T A;  4M9H A;  4KLS A;  1ZQW A;  4PGQ A;  8ICU A;  1PX5 A;  4YMM A;  4RPX A;  2NRK A;  3UXO A;  4KLD A;  4X4N A;  4LZG A;  4AT7 B;  2ZH1 A;  5BOM A;  5J0U A;  4XQ8 A;  3WFP A;  5J29 A;  5J0Q A;  5J0X A;  4KLU A;  3JPR A;  1UET A;  1OW8 A;  4NKT A;  3JPO A;  3ISB A;  4M04 A;  5DB7 A;  1R89 A;  5HC9 A;  1BPZ A;  4NXZ A;  4F5N A;  8ICB A;  4WC5 A;  3GDX A;  4NQF A;  2DRB A;  5BOL A;  4FH5 A;  4WC7 A;  4I2E A;  1ZQL A;  4S3N A;  3RH4 A;  2FMQ A;  3AQN A;  4RQ8 A;  4PPX A;  4RWN A;  4FHP A;  4M9L A;  7ICG A;  1ZZP A;  3GM1 A;  1ZQG A;  8ICX A;  2ZH2 A;  4AT8 A;  5HRG A;  8ICO A;  4RQ7 A;  1ZQX A;  3PNC A;  3ISD A;  1VFG A;  3GM2 A;  4TUP A;  5DBC A;  3K75 D;  4JWM A;  1OU5 A;  9ICN A;  3C8G B;  3C5G A;  2BE3 A;  8ICY A;  4X4T A;  4NLZ A;  2FMP A;  3TUL A;  1ZJM A;  4X4R A;  4KLI A;  7ICT A;  5HHI A;  4I2B A;  3OUY B;  3L8I A;  2M2W A;  1NOM A;  4UB1 A;  4P4M A;  5D4B A;  1ZQQ A;  3OVB A;  7ICK A;  5J2D A;  4AT9 B;  2PFO A;  1KEJ A;  4RQ2 A;  4O5C A;  4KLG A;  4Z6D A;  3C66 A;  4M2Y A;  5J0W A;  4F5O A;  4F5P A;  4PGY A;  4M9G A;  4X4V A;  1MIY A;  1K04 A;  2P66 A;  5IIJ A;  3MDA A;  9ICW A;  5HRD A;  4DOC A;  2I9G A;  8ICE A;  9ICL A;  9ICK A;  4Z6F A;  3UPQ A;  4I2F A;  5DBA A;  2L6G A;  4QZC A;  2DR8 A;  4MF2 A;  4FHV A;  3MGI A;  2ISP A;  9ICM A;  4R63 A;  3RJJ A;  2HHP A;  4E7X A;  3AU6 A;  4I2I A;  4M47 A;  2L6H A;  4IQV A;  5IIN A;  3H37 A;  1ZQV A;  9ICC A;  3V7J A;  5DB9 A;  4KLQ A;  1O3U A;  3C2K A;  1JQR A;  5DEC A;  1WOL A;  4KLL A;  4MFA A;  4I2A A;  4QZI A;  4K4G A;  4LVS A;  2KK1 A;  9ICR A;  3RQE A;  4QZF A;  3RJI A;  4YD1 A;  4O9M A;  4FHX A;  8ICZ A;  5HHH A;  5DB8 A;  3JPS A;  3OVA A;  8ICA A;  4NY8 A;  3WFR E;  1ZQU A;  9ICP A;  4NKU A;  4MF8 A;  4F5R A;  3U0C A;  4R32 A;  1ZQC A;  4KLM A;  4KLJ A;  4NM1 A;  4NLN A;  1OW6 A;  4P4P A;  1WWP A;  4AT8 B;  1ZQM A;  3L8J A;  2PFP A;  8ICV A;  4P2H A;  4QZE A;  5IIL A;  9ICQ A;  4ATB A;  5J0S A;  4M5D A;  5EOZ A;  4YMN A;  4GXJ A;  9ICO A;  5J2F A;  5HRL A;  1HUO A;  4UBB A;  9ICG A;  4FHY A;  2ZHB A;  3UQ0 A;  3AQL A;  3B0X A;  3NYB A;  4RQ5 A;  1ZQB A;  3OV7 A;  4PHD A;  2M2V A;  2ZH6 A;  2BCS A;  3RQG A;  3RJH A;  1WOT A;  3LQC B;  1ZQT A;  4X0A A;  3TFS A;  3HJ1 A;  5HRK A;  5BPC A;  1ZQO A;  4WC6 A;  3AUO A;  4O5K A;  1ZQY A;  4R66 A;  5DDM A;  7ICI A;  4I2J A;  1ZQH A;  4KLT A;  3UQ2 A;  5HR9 A;  3TFR A;  5DBB A;  3JPN A;  2BPG A;  2DR5 A;  3RH6 A;  4IG8 A;  5J2I A;  4F5Q A;  1ZQK A;  2DRA A;  1ZQP A;  3JPP A;  3PMN A;  3V7K A;  2PXI A;  7ICN A;  4X4S A;  3JPT A;  8ICN A;  1ZQA A;  1R8C A;  3C18 A;  4QZD A;  3HIY A;  3HWT A;  5F2V O;  2JPU A;  3MBY A;  4MFF A;  5III A;  4JWN A;  5CP2 A;  4XEV A;  7ICO A;  3UXN A;  8ICS A;  5J0T A;  1K40 A;  4E80 A;  4RT3 A;  3JZ0 A;  2Q00 A;  1BPY A;  5CB1 A;  4M9J A;  4RQ6 A;  4EBJ A;  7ICH A;  8ICQ A;  9ICS A;  9ICV A;  3H39 A;  4DO9 A;  4UAZ A;  5DED A;  4UD5 A;  1UEV A;  3UPS A;  1TFY A;  5TZV A;  4K4I A;  2LK4 A;  1QVX A;  4UD4 A;  4RPZ A;  4QZB A;  1MQ3 A;  1JAJ A;  2PFN A;  4QZG A;  3K7D A;  9ICA A;  2RFF A;  4KLH A;  2ID1 A;  3C8G D;  1OW7 A;  4WBZ A;  3AQM A;  4X4U A;  4XEK A;  3ISC A;  5J0R A;  4PH5 A;  1K05 A;  4IQT A;  1NO5 A;  2ZH5 A;  1MIW A;  1BPX A;  2PBE A;  1ZQE A;  5J2H A;  4YCX A;  5J2G A;  5IIO A;  5J0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...