3JYYA

Semet linb complexed with ppi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
265
Chain Sequence
b'MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 93
structure length 265
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jyyA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jyyA01
3V72A 8ICLA 4RT2A 3RQFA 4AT8A 1BPXA 2GWSA 5J2DA 3V7JA 8ICFA 5HR9A 4O5EA 4QZDA 9ICVA 5CWRA 3ISDA 1JAJA 4WCWA 2DR7A 5HREA 3RJHA 4RWQA 4UB3A 5HRHA 2HSBA 4LT6A 4MFCA 4NQFA 1NO5A 3O10A 2M2WA 4I28A 4KLHA 2PBEA 5J0QA 3C18A 4F5PA 4KLTA 5IILA 2ZH7A 1KNYA 1R8AA 2ZH3A 8ICVA 9ICTA 4NM2A 4I2BA 2DR8A 1XSNA 5BPCA 3V7LA 4ATBB 7ICJA 4WC6A 5HRIA 1Q78A 2FMPA 2ISPA 4R66A 3C5GA 4I2DA 4AT9B 1ZQWA 1UFBA 4LZDA 7ICHA 8ICBA 9ICPA 4M04A 4UBCA 5J2EA 2ISOA 2BPFA 2BPCA 4I2GA 7ICGA 1UETA 9ICUA 3B0XA 5J2AA 4QZFA 3RJEA 2BCUA 3ISBA 1RZTA 4X4QA 4M9NA 4UAYA 4I29A 4PGXA 4M9LA 4S3NA 2ZHBA 4UD5A 4YD2A 5J2JA 4X4PA 4RPZA 3RJKA 2ZH6A 4P4MA 4UB5A 3C66A 1ZQCA 9ICIA 4RQ3A 3HX0A 2JPUA 8ICCA 4FH3A 4MF2A 2ID1A 3MGIA 9ICRA 1K05A 3V7KA 1OW7A 1JMSA 1MQ3A 4DOAA 8ICWA 4X4SA 1ZQOA 1ZQSA 4IQWA 1XSPA 5IIKA 4FHVA 4MFFA 4RWNA 4XEFA 3WFPA 4M9GA 1ZQZA 5D46A 3JYYA 4TUPA 4Z6CA 4IQUA 1ZQNA 1WWPA 7ICKA 1MIYA 5J2IA 4PPXA 5HC9A 4UB4A 4RPYA 4NKUA 1WTYA 1ZQXA 3JPPA 1ZQKA 1KEJA 2ZH8A 5HHHA 1JN3A 3C2KA 1ZQEA 4UB2A 3OVAA 3HJ4A 3OVSA 1XSLA 1ZQJA 1MIVA 1ZQBA 5DDMA 5J0OA 3HIYA 3C8GB 2ZH4A 4X4UA 4UBBA 5DB8A 4F5OA 4WC2A 4K4IA 5DBCA 4X4TA 3S9OA 4QZGA 4E8FA 7ICUA 1ZZPA 8ICAA 3JPOA 4QZIA 5HRBA 2HHPA 1ZQFA 5CHGA 3HWTA 2P66A 4NXZA 4RWOA 4X4OA 4WC0A 4I27A 4DOCA 1ZQLA 2BPGA 8ICYA 8ICUA 4PHPA 4WC1A 4XQ8A 3UQ0A 3AU6A 4AT7B 1TFWA 4UD4A 3AU2A 4EP7A 4I2FA 4WC3A 3RH4A 4WC7A 4UB1A 4I2AA 2M2TA 5IIOA 4KLMA 4PGYA 4IQVA 1ZQTA 2DVIA 2FMSA 7ICPA 9ICFA 4NLKA 1ZJNA 5J2HA 5CJ7A 4P4PA 1NOMA 5J0XA 1OW8A 4FHPA 5HRFA 4WC4A 5TZVA 3C8GD 5DECA 2NRKA 5J2GA 2O1PA 5BOLA 5J2CA 9ICXA 3H3AA 5IIMA 4YMMA 1MIWA 3UPSA 2RFFA 4XEKA 1HUZA 3MGHA 5IINA 2YWAA 3HJ1A 2IHMA 3GM1A 4MFAA 1PX5A 4AT8B 4GXKA 7ICIA 2Q66A 4KLSA 1UEUA 2PFOA 3WFSC 4M47A 1K40A 3MFNA 4KLOA 1R8CA 1V4AA 2BCVA 4QZBA 3AQLA 2L6GA 4P2HA 4RQ2A 7ICOA 4YD1A 3JPTA 1ZQQA 4RQ1A 5J2BA 1VFGA 4WC5A 3B71A 3UXPA 2BCQA 5EOZA 8ICPA 5J0PA 4X0BA 9ICLA 1VJ7A 3WFQE 1ZJMA 1FA0A 4XA5A 1ZQRA 4XUSA 2ZHAA 4O5CA 3GM3A 4KLLA 3OUYA 4PGQA 4RQ7A 3TFRA 4I2JA 4KLUA 4M5DA 3LK9A 3RJIA 4KLDA 3PMNA 3JZ0A 3TFSA 1BPYA 5F28E 4YCXA 7ICLA 3PNCA 3HW8A 4RQ4A 5DB9A 4PHAA 8ICXA 3GDXA 4YMNA 2DR5A 4KLJA 4P4OA 1ZQIA 3GM2A 1K04A 1WOTA 3OVBA 4FHWA 1ZQVA 4M0AA 8ICIA 9ICMA 4GXIA 4RQ6A 1ZQAA 5IIJA 8ICKA 1PV3A 4F5RA 4O9MA 4I2IA 5J0RA 5CP2A 1BPZA 4RQ0A 4RWPA 4M2YA 1BPDA 3RH5A 3UXOA 4EBKA 2M2UA 4QZ8A 5J2KA 3PMLA 8ICNA 4RPXA 1ZQYA 4WBZA 1MQ2A 8ICEA 2KK1A 4QZCA 3MBYA 2PXIA 1HUOA 4YN4A 4FH5A 3UXNA 4X4NA 5DBAA 3AQNA 4X4RA 4TURA 2JX0A 2ZH5A 8ICGA 9ICSA 5HRLA 3RJFA 9ICBA 4DO9A 2I9GA 8ICSA 2Q00A 2ZH2A 7ICMA 5HRGA 3BRJA 4FHYA 7ICEA 9ICQA 4Z6FA 4M9HA 3L8JA 4KLEA 2ZH1A 4UAWA 4ATBA 4K4GA 8ICHA 4XEVA 2W9MA 3MDCA 4F5QA 1UEVA 4FO6A 4KLFA 4I2CA 8ICTA 3U0CA 4AT9A 9ICWA 1JQRA 3B0YA 3L9DA 9ICGA 2ZH9A 4WBYA 5CB1A 5J0WA 4IG8A 4LVSA 5J0YA 1TV9A 2O5AA 3LQCB 9ICEA 5DKWA 3OV7A 3JPQA 5DEDA 3C5FA 4F5NA 1WOLA 4RQ8A 4QZ9A 2BCSA 3ISCA 3RJGA 3H39A 3K7DA 3H37A 8ICOA 4IQTA 1F5AA 4XRHA 9ICOA 3MDAA 9ICHA 7ICQA 8ICRA 4Z6DA 2DRBA 4NY8A 1YLQA 4R64A 4Z6EA 3RH6A 3TULA 7ICRA 4X5VA 1OU5A 4QZAA 4EBJA 1ZQPA 1QVXA 4JWNA 4K4HA 4X0AA 5DBBA 8ICZA 1RPLA 8ICQA 3UQ2A 3AJMA 3H38A 9ICAA 4JWMA 4NLNA 3U3FA 1OW6A 3OGUA 4NLZA 4FHXA 1KTMA 2LK4A 2BE3A 1ZQDA 5J2FA 1ZQMA 4MF8A 5CR0A 3JPNA 5DB6A 3RJJA 7ICVA 1JOGA 5BOMA 4DOBA 5HHIA 1TFYA 2L6FA 3C2LA 8ICMA 4E80A 4KLIA 3RQGA 3C8GA 5D4BA 1KDHA 4UAZA 5HRKA 5CA7A 4PHDA 4GXJA 4I2HA 7ICNA 9ICKA 1ZQGA 5DB7A 4LZGA 3OUYB 4R32A 3RQEA 2VANA 5IIIA 3AUOA 5HRDA 7ICFA 3K75D 4E7XA 3L8IA 4I2EA 3WFRE 1R89A 3UPQA 4KLGA 4NM1A 2PFNA 4AT7A 4RQ5A 4TUSA 1Q79A 2M2VA 3AQMA 1BPBA 8ICJA 4NKTA 3C2MA 4PHEA 5J0TA 4TUQA 5F2VO 9ICJA 2BCRA 5D49A 7ICTA 3AQKA 9ICCA 9ICNA 4QZHA 1ZQUA 1BPEA 4QZEA 5J0SA 5J29A 5J0UA 4YMOA 4XQ7A 4PH5A 3NYBA 4O5KA 1R8BA 5DDYA 1TVAA 2FMQA 1O3UA 3JPSA 7ICSA 3WFOA 2PFQA 2DR9A 4M9JA 3JPRA 2L6HA 4X4VA 4RT3A 4R63A 4KLQA 2DRAA 1ZQHA 4R65A 2PFPA
chains in the Genus database with same CATH superfamily
3EHNA 3V5ZA 8ICLA 3GWNA 3V5YA 4CSAC 4AT8A 1BPXA 2GWSA 1AUEA 5J2DA 2O9XA 8ICFA 5HR9A 2NUTA 4QZDA 9ICVA 2J7PD 2UUIA 2R7SA 4FX5A 4FAPB 4DXWA 2R03A 4OIPF 4RDAA 3SNHA 2W4BA 4RWQA 2AWCA 4JE9A 4EV6A 3UMHA 2CYDA 4PFOA 2R7TA 2PBEA 2R05A 3KL4A 1QLEC 3DXJF 3C18A 2BL2A 1I4YA 4B6IA 5IILA 9ICTA 8ICVA 4NM2A 2NUPB 2DR8A 1XSNA 4CX9A 7ICJA 3L0IA 3SEOA 5HRIA 1Q78A 1ZHXA 2VB6A 2ISPA 4I2DA 1NSGB 2KNHA 1UFBA 1YA9A 8ICBA 4CS9A 2HZ8A 4I2GA 1T6QA 2LD6A 3B0XA 2BCUA 1RZTA 4M9NA 4I29A 4M9LA 3W4YA 5FZTA 2ZH6A 2IXOA 4UB5A 3VRCA 4Z9IA 1Z7Qc 3HX0A 4FH3A 2OJED 4MF2A 2ID1A 9ICRA 2J8WA 5DLJA 3JSEO 4YK5A 4QI2A 4DOAA 4FESA 4K98A 5GPGB 4LERA 1N1CA 4MVSA 2R7UA 4FHVA 5IIKA 4MFFA 3TJ5A 2QNLA 2XL8A 2X51A 1MIYA 4JCZA 3IQTA 4RPYA 4WOYA 1VTMP 4C3BA 3NMKA 5JT4A 1I5NA 3OVAA 3DJUB 3DD7A 4AE4B 2Q7RA 4M63A 1GPJA 3CSKA 4K4IA 3U9MA 4H4KC 3U8PA 4QZGA 7ICUA 1LVKA 1YYXA 4XWJA 2L9JA 2VASA 1Z23A 3TD7A 4RWOA 3QTHA 4JRZA 8ICUA 3OWGA 1G4US 3UNGC 1W2WA 4XQ8A 3ABLC 3X2QC 4EP7A 2OEXA 4CS9C 1QKRA 4JW1A 3V5XA 4I2AA 3T9OA 4IQVA 1SZIA 2ZXPA 1V55C 2DVIA 4DJ9A 7ICPA 1S7ZA 4J32B 1GM5A 1ZJNA 3K1IA 1OKKD 1HMOA 5CJ7A 5CI9A 2V3CC 1WATA 4C7OB 5HRFA 4WC4A 3JCFA 1MIWA 2RFFA 4DVYP 3ASOC 1PX5A 3VAYA 3FDQA 1YYJA 1K40A 2AWYA 2BC5A 1R8CA 2PX3A 4PFPA 1V4AA 7ICOA 4D4NA 1YZAA 2EPNA 3U9JA 1PD0A 4K97A 3UXPA 5JS5A 4MTFA 1GQAA 4X0BA 3JSZA 2QUPA 4LEYA 2KJGA 2YRFA 4MW3A 4XA5A 1ZQRA 2V26A 1ORSC 5EGYA 3ZC4A 3AG1C 1AVOB 2IXMA 4PGQA 4I1OB 5B1BC 4I2JA 3JRMO 4M5DA 3PMNA 3TFSA 1OXBA 7ICLA 3PNCA 3IQCA 2J45A 3L1MA 1QPUA 5JRAA 3IQ6A 3UGOA 4GQHA 2P7VA 3NDBB 4YMNA 2DR5A 4KLJA 2HMZA 1G5ZA 1YDIA 1ZQIA 4E17A 3GM2A 1K04A 2FFHA 3K1HA 1JR8A 1BR1A 2XS1A 4U5FE 3K1IC 1DOWA 2DGJA 3M79A 4GXIA 5CFUA 2W9YA 1ZQAA 1RMVA 3LS0A 2A69F 3PCVA 1BPDA 1NG1A 4JZAA 3UXOA 3F46A 4HFKB 3EH2A 8ICNA 3W8IA 5L0GA 4NXTA 3IEEA 1ZVZA 2EINC 5A6AA 2XLWA 3QZCA 1VK5A 1Z3IX 2W4MA 4NXWA 2NG1A 5DBAA 4X4RA 4TURA 1C03A 2XSEA 9ICSA 1SR2A 4LEWA 3RJFA 4DO9A 2Q00A 2I15A 3S0XA 1FFTC 4CIPA 1YA7O 3RKOF 2NUPA 4M9HA 3L8JA 5T1DB 3OWTA 8ICHA 2NSGA 4KC9A 4CS8A 4EHPA 4FO6A 1G8XA 3PMRA 3U0CA 1JQRA 3FOOA 5EK0A 4MS2A 2J9VA 1T6IA 4YL0A 5DEDA 4NY3A 4RQ8A 4EUKB 2BCSA 4I1MA 4BJ6A 1F5AA 4XRHA 9ICOA 9ICHA 7ICQA 2DRBA 2HKVA 1OCZC 3RH6A 4AL0A 1JMWA 5JVEA 1NFOA 1OU5A 4QZAA 1CGOA 1LI5A 3QMKA 4X0AA 5DBBA 8ICZA 3NKEA 2KQ9A 8ICQA 2E87A 2L7AA 2DB4A 2B51A 1OW6A 3TJ6A 4FHXA 1KTMA 2LK4A 3GWLA 5J2FA 2P0NA 2HN1A 3JPNA 4OD5A 4MTOA 2Q9AA 1JOGA 5HHIA 8ICMA 1SF8A 4AE4A 4KLIA 4MTGA 4UAZA 3SXMA 5A69A 3I5PA 1ZQGA 1A41A 1VYIA 2EPKX 2A6HF 2VANA 1TKNA 2OJQA 3VYWA 1OXKA 3L8IA 3WFRE 1FTSA 1LE2A 2ETSA 2PNOA 5DQZA 3UPQA 5BQHA 4KLGA 2J9UA 3AGTA 4K9AA 4RQ5A 1TFOB 4NKTA 2HSQA 4PJLA 5F2VO 4IRUA 3TQOA 7ICTA 3AQKA 3SXYA 1BPEA 5DQTA 2I8BA 3E70C 4BJ6C 4YMOA 4PH5A 2CNWA 4W8PA 5D91A 3K66A 2FMQA 4M9JA 3JPRA 4X4VA 4RT3A 4KLQA 1D1BA 1APCA 2DRAA 4IAQA 3GORA 3DI5A 3V72A 1TQGA 2VCAA 5B1AC 2CDQA 2GAQA 3CAXA 1VOMA 4O5EA 5CWRA 2Y39A 4L6RA 4BJ5A 2DR7A 5HREA 4JJGA 2HSBA 4LT6A 4NQFA 3O10A 4I28A 3KYIA 3ER8C 2Y3BA 3I4UA 4MVMA 1MNEA 4F5PA 4KLTA 3HNIA 4I2BA 4U9DA 2FMPA 3C5GA 3R7CA 2XLVA 4AT9B 4LZDA 2XM4A 1IZMA 9ICPA 4BJTA 4M04A 4UBCA 7ICGA 3G50A 9ICUA 3GEHA 3I5QA 5E33A 4X4QA 2GA0A 2WVNA 4UD5A 3EJNA 5CFTA 3ZTZA 5J2JA 1JPJA 3RJKA 5D63A 5A6KA 1T9KA 3L34A 2JPUA 3VM6A 1E84A 3ZTMA 1ZQOA 1TWCA 1T6UA 5BUOA 2J7PA 1J8YF 3JCUQ 4XEFA 3WFPA 5D46A 1D0YA 4TUPA 1XZQA 4IQUA 1ZQNA 3H2UA 2P1AA 4PPXA 4UB4A 5E3AA 2A68F 1WTYA 1ZQXA 1A7EA 4E7SA 1ZQKA 1JN3A 4NTBA 4UB2A 4BJ5C 3F47A 1FNTc 4LDRA 1MMDA 3OVSA 4LEZA 1XSLA 1ZQJA 1ZQBA 3HIYA 1WGWA 4Q5SF 4KB6A 1RCPA 2R7WA 4OAIZ 3C8GB 4XPXA 5DB8A 5F5HA 2G3KA 8ICAA 1MQVA 3FHDA 1LS1A 3AOUA 1ZQFA 4LACB 3HWTA 1ZHZA 4NXZA 2ZXWC 1BZ4A 4WC1A 3UMKA 4AT7B 2HFIA 3EPVA 4LLEA 4UD4A 4WJ0A 3AU2A 1TFWA 2EIKC 4WC7A 4KNVA 1U89A 5IIOA 2EIJC 4KLMA 5CI8A 2A6EF 2FMSA 2R7XA 1MMGA 4CDVA 9ICFA 4NLKA 3EQLF 1NOMA 2PFDA 2W45A 1YJGA 3VF0A 4P9TA 2O1PA 3H3AA 4WGYA 2UUHA 2BBHA 4XEKA 3MGHA 5IINA 4E18A 2IHMA 3NYLA 2EIMC 4MW8A 4KLSA 3AQBA 2EPMX 3EG9B 4M47A 2YLGA 5DS4A 3W8HA 4KLOA 3LLKA 5KYYB 5B3QA 4QZBA 4YL3A 1XZPA 3B9QA 4YD1A 2XRHA 2OOCA 4ZLDA 5J2BA 1VFGA 3S29A 3B0VC 2CCYA 1DOVA 2QY9A 1VJ7A 1ZJMA 2LFFA 2OQMA 3K6BA 5AC4A 3DMDA 2A1DD 3NWIA 4ZLCA 4KLLA 3A11A 2R7OA 1V54C 1TWGA 4X0RA 4KLUA 4KLDA 1BPYA 2KC3A 1T5OA 5F28E 5TJ5E 4O6AA 3EFOB 4YWQA 3DE9A 4RQ4A 4KBLA 8ICXA 3C63A 3U8VA 1OKKA 4O67A 3N2ZB 4P4OA 1WOTA 1H9TA 4K8VA 4CJOA 4DRHB 2ASRA 3CZ6A 2WB7A 4RQ6A 4JTDB 3DJNB 4I2IA 5J0RA 2J9BA 3DKAA 4JLXA 2YLIA 1TWAA 3ZVRA 2PF4E 2IM8A 2QTVA 4IAOA 5E3CA 3RH5A 5JUAA 4NXXA 3FAJA 4G7HF 1ZQYA 4WBZA 1MQ2A 8ICEA 3MBYA 4XJEA 4YN4A 4FH5A 4X4NA 2KYHA 1CGNA 2C03A 4BPMA 4GYTA 3K33A 1FR0A 2OG2A 2HN2A 9ICBA 3C8ZA 8ICSA 5HRGA 3BRJA 2XXAB 1LKXA 3MYIA 4I44A 3RIPA 5E2QA 2CGEA 2J0WA 4Z6FA 2ZD9A 2ZH1A 4UAWA 2W9MA 3ATPA 4KLFA 5KYWB 4N6CA 2HUJA 4I2CA 4AT9A 1D1CA 2ZXRA 5CB1A 5J0WA 4IG8A 1NU7D 5J0YA 2O5AA 3US6A 4KI2A 3LQCB 4OD4A 4FO1A 5DKWA 3LESA 4WGZA 3ZG1A 4E7ZA 2YL0A 1FFHA 4PK4A 1RJ9B 2YL1A 2ICWG 1C02A 8ICRA 1YZCA 1YLQA 4Z6EA 1SMYF 2B0JA 3AGUA 7ICRA 4RBNA 4O7GA 1B68A 4Z9JA 2GAFD 4K4HA 2LQGA 3B0UX 1LS4A 3UQ2A 3AJMA 9ICAA 3UR3C 4NLNA 1Q0FA 2L81A 2Y3HA 3OGUA 4H54A 2XLMA 4JKVA 2BE3A 1RKCA 3UGPA 2XLOA 1ZQMA 4MF8A 5CR0A 4CS7A 2NPUA 4E0HA 5F5FA 4DOZA 2L6FA 4E80A 3CK6A 2YQYA 4YJWA 3C8GA 4JCHA 5HRKA 4PHDA 3KKBA 7ICNA 3GEIA 4MQ9F 2YLDA 1Y4CA 2YVKA 3LEVA 4E7XA 4AK9A 3X1OA 1R89A 3EZHA 2PFNA 4AT7A 1H9GA 4TUSA 3AQMA 2PX0A 3ZDLA 4CIHA 1BPBA 2HJMA 4U5GA 3N0TA 2BCRA 3U3BA 5D49A 4AX2A 2OCCC 9ICNA 4LLCA 1ZQUA 4QZEA 5J0SA 5J29A 4XQ7A 2Z15A 3G4XA 1R8BA 5FCLA 3RYLA 4YL1A 3LEOA 2XM0A 7ICSA 3WFOA 1R4TA 1SYQA 1VB5A 2B56A 4C3DA 3T6JA 2WVQA 4R65A 2NSFA 3RQFA 4FWVA 2DI3A 3EG9A 4OIOF 5KYYA 1JAJA 1A7DA 3RVZA 2FAPB 4WCWA 3ZQVA 3RJHA 4UB3A 3LLIA 4MFCA 1E86A 1NO5A 1BDJB 2M2WA 4KLHA 5J0QA 2G62A 3DWWA 3B0PA 1RXQA 2RD9A 3V7LA 2A0BA 4JEAA 4YT2A 1D1AA 4NC3A 1ORJA 4OAGA 3SP1A 5D61A 1ZQWA 7ICHA 1D0XA 5L3VA 4ULWA 4CDYA 2ISOA 3EFOA 1UETA 2AP3A 2Y3DA 1C17M 5J2AA 1L7CA 4PR9A 3RH3A 4PGXA 4S3NA 4YD2A 2HJ3A 4RPZA 4X4PA 4P4MA 5D62A 3C66A 9ICIA 4JVSA 3BEHA 3M4CA 5DVWA 3MGIA 2R7QA 4ULVA 1ZU4A 3V7KA 1MQ3A 2VC9A 2AVKA 8ICWA 1ZQSA 4IQWA 2HMQA 1XSPA 3ZWIA 2VCCA 4M9GA 1ZQZA 3S90A 2EILC 7ICKA 4I3MA 5J2IA 1QSPA 2VH3A 3NYMA 4MVQA 4NKUA 4EEBA 3JPPA 3J06A 1KEJA 3ERCC 3Q6NA 5HHHA 3C2KA 3NMJA 3HJ4A 1MIVA 1CPRA 5DDMA 5A6BD 2BE5F 4DBRA 2YEVA 2ZH4A 4X4UA 4UBBA 4F5OA 1NLXA 3U2MA 4WC2A 3DAGA 4NTFA 4X4TA 2XXAA 2MWQA 5IY5C 5CHEA 3JPOA 1A0BA 3T4RA 3W2WA 2HHPA 2R02A 4BJ1A 4EEDA 4X4OA 4WC0A 4I27A 3HNLA 4DOCA 5KYWA 2XL4A 4PHPA 4I2FA 4WC3A 2YZSA 4AL1A 2H7OA 3W2VA 2M2TA 3A9CA 4PGYA 3SYNA 3IQ5A 2WL8A 1RJ9A 2PP4A 4P4PA 1OW8A 1J8MF 5TZVA 2KGOA 5DECA 3QVZA 5J2GA 1YARO 5BOLA 5J2CA 9ICXA 4PJNA 5IIMA 1HE1A 1M56C 3ER9B 5DS6A 4DBQA 4Q7CA 2Q9CA 1IW7F 4GXKA 4HE8D 1UEUA 2PFOA 3WFSC 3MFNA 3FXHA 4E0IA 1HE9A 2BCVA 2B4VA 2IBFA 2L6GA 4DVZA 3FAPB 4K0DA 3UMIA 2VCBA 4WC5A 4NXVA 5EOZA 8ICPA 3ZIBA 3S27A 2IXPA 3LNRA 9ICLA 3DM5A 3WFQE 1FA0A 1XWJA 2P6VA 2CNWD 4K1OA 2ZHAA 4O5CA 2JD3A 3GM3A 1LIHA 4XPYA 4RQ7A 3AG4C 3TFRA 5K0IA 2YL7A 3LK9A 3RJIA 1OR2A 5KYXB 4YCXA 4DRJB 1ZYRF 3QW0A 1GS9A 2IYLD 5KYNA 3AG3C 4G7ZF 1GGQA 1TR2A 5DB9A 2EPOA 3ECSA 3MCRA 1BR2A 5COFA 1O87A 2TMVP 3O6XA 3OVBA 4FHWA 1ZQVA 2YKZA 2D4UA 4IGGA 8ICIA 9ICMA 4OIQF 5IIJA 4F5RA 4O9MA 3OEOA 3S28A 2DYRC 4MVOA 2Y69C 4XPWA 2IXNA 1I4ZA 4QI0A 1VLSA 1Z6AA 3LAYA 4EBKA 5KYUB 2M2UA 2XLHA 4EIYA 3NVOA 4QZ8A 5J2KA 4I0UA 3O55A 2F22A 2KK1A 4QZCA 1H7IA 3M1CB 3TK0A 4Q4ZF 4G78A 3UXNA 1F1MA 2XLDA 3AQNA 3ABMC 2LCHA 2ZH5A 4IARA 1M57C 3M15A 3Q7GA 4JLZA 2I9GA 1VMAA 2WZGA 2ZH2A 4PJMA 2Q4FA 9ICQA 1VYKA 3MDCA 4F5QA 1UEVA 4MKPA 3JYHA 4QDLA 4LEVA 1Q0GA 3L9DA 3E9VA 9ICGA 1G4WR 4OINF 4WBYA 2HS5A 4LVSA 2EPLX 1U0BB 1Q0MA 9ICEA 2J9WA 1LI7A 3EGDB 3C5FA 4F5NA 1MMAA 2LP4A 4MVRA 3AG2C 4QZ9A 3PDMP 4U9EA 4F4BA 1JRAA 5T3WA 3H65A 3K7DA 4IQTA 5L0DA 3HTKC 1Q0KA 3HNJA 4X5VA 4N06A 4EKWA 2HV6A 1ZQPA 1QVXA 3WHNA 4JWNA 2OEVA 2QE9A 4U5HA 2J46A 5COMA 3H38A 4NXUA 3MYFA 3U3FA 3WAQA 1MNDA 1ZQDA 3S84A 2G3VA 4JTAB 4J30B 7ICVA 3ZQYA 4JTCB 5BOMA 3QVYA 4EBBA 5D4BA 4O6MA 3PHF2 3ITFA 4I2HA 2FCLA 5DB7A 3OUYB 4IJJA 3RQEA 3AUOA 5IIIA 4A2NB 5HRDA 4I2EA 4U5EE 1RKEB 2R7VA 2LFDA 3EZIA 2KW3C 4MVUA 5CFSA 1E83A 4K9BA 4NM1A 1ZHYA 3JTLO 4KNWA 8ICJA 3KH2A 4PHEA 1QQ3A 5L0CA 4TUQA 9ICJA 4JJFA 4U5DE 4CBEA 1LE4A 3RVYA 5HV9A 4QZHA 1PCXA 5J0UA 3T6BA 4O69A 4O5KA 5JLIA 3RFYA 5DDYA 1O3UA 5L0JA 2YHSA 2PFQA 3ZSUA 2L6HA 2AU5A 3OA1A 1MMNA 3U5SA 4HFFB 4W8KA 3ASNC 1ZQHA 4A4AA 2PFPA 4RT2A 2D5RB 1ST6A 3LNMB 3V7JA 5B3PA 4WABA 1TWHA 2GA9D 3ISDA 2MYSA 3RW0A 1EQ1A 3HKKA 3LS1A 3B29A 5HRHA 3AQCA 4N7RA 3GEEA 1BBHA 5BQIA 3C62A 1UG7A 3JRTA 3DZAA 4O68A 2ZH7A 1HMDA 1KNYA 2J0XA 1TFKB 4BEJA 1R8AA 2ZH3A 5BPCA 4ATBB 256BA 4WC6A 4PJJA 4BG0A 3EHMA 4R66A 3FOPA 1E2XA 5KYXA 3PHZA 5J2EA 2BPFA 5B3SC 3NMIA 2BPCA 2XLEA 4WQKA 4QZFA 2BBJA 3RJEA 3KMIA 3ISBA 3IPMO 4UAYA 4XLPF 1JPNA 1LPEA 1E85A 2ZHBA 1OQCA 1LM3B 1ZQCA 4RQ3A 3EH1A 4CDAA 8ICCA 1ZHTA 4Z9HA 5A6JA 1K05A 1OW7A 1JMSA 1L3PA 3FMSA 4X4SA 3POVA 4XLNF 1U6HA 3EF2A 3NKDA 4P6IC 2B0HA 4RWNA 3NKUA 3TOMA 3N24A 3JYYA 3H2VA 4Z6CA 1WWPA 5BQGA 5KYUA 5HC9A 4YT5A 2XS8A 3M4BA 5B3IA 2ZH8A 2YL3A 1EI7A 2ZPAA 3KPHA 1ZQEA 4OIRF 3ABKC 5J0OA 3WODF 1D0ZA 1CGME 5JSLA 5DBCA 5EHHA 1M2VB 1QZXA 3S9OA 4E8FA 1ZZPA 4QZIA 3DAFA 5HRBA 4K96A 5CHGA 1CPQA 2P66A 4WQLA 1ZQLA 4N4WA 2BPGA 8ICYA 2Y3GA 3MX3A 1WN0A 1YAUO 3UQ0A 3AU6A 3GODA 2CW0F 3RH4A 4UB1A 3EGDA 3LUTB 3RF3A 1ZQTA 2EWRA 4O79A 4RD9A 5J2HA 5JTGA 3JT1A 4JURI 5J0XA 4FHPA 3C8GD 2NRKA 4EGWA 4MVZA 3EGXB 4UDVA 4YMMA 3UPSA 5AC5A 1HUZA 4BEMJ 2YWAA 3HJ1A 3GM1A 4MFAA 3CQZA 4AT8B 7ICIA 2Q66A 3CEXA 4N6HA 1ZW3A 1HW1A 2NUTB 2P61A 1Z63A 2C04A 3HLZA 1OR3A 3AQLA 1WASA 4P2HA 4RQ2A 5A6BA 1Q0DA 3JPTA 1ZQQA 4RQ1A 3B71A 4U5BE 2BCQA 4U5CE 2Q3TA 5CIVA 3O39A 4YT8A 4ER9A 5J0PA 3T6GB 4ONSA 4XUSA 2Q9BA 5L0IA 3OUYA 3U2LA 3JZ0A 1RKEA 2WZFA 3HW8A 4PHAA 2LSEA 1Z5ZA 4YN0B 3GDXA 2WVOA 5JP7A 1JAFA 4ANJA 1HW2A 4IWBA 4O6YA 4WH5A 1YLMA 3V7OA 4DRIB 2H8AA 3GANA 4M0AA 3TOLA 8ICKA 1PV3A 3MBGA 1YVIA 1ZHWA 5CP2A 1BPZA 4RQ0A 4CS8C 1H6GA 4RWPA 4M2YA 1EA8A 2GDCA 4GEHA 3G4ZA 3PMLA 4RPXA 2ZXOA 2M4EA 2PXIA 3QW1A 1HUOA 2GWWA 3WG7C 1M6TA 4OAHA 2JX0A 3MLGA 4C7OA 8ICGA 4EWCA 4YT4A 1EKYA 4P9FA 5HRLA 5L0HA 3SXKA 1M2OA 2X0CA 1BR4A 7ICMA 2FGYA 1T01A 1V74B 3NYJA 4FHYA 4C3EA 7ICEA 4CJGA 2M64A 4KLEA 4ATBA 4K4GA 2R9RB 1NU9C 4XEVA 2RSEB 1KU2A 8ICTA 4J7TA 9ICWA 1VLTA 3B0YA 3HNKA 3SXZA 5AGFA 2ZH9A 1A7VA 1OCRC 4KM5A 1TV9A 2OKUA 4J7YA 3OV7A 3JPQA 4K7BA 1WOLA 4JEBA 4G7OF 3ISCA 1S05A 3LJBA 1OCOC 3RJGA 3Q7LA 3H39A 3H37A 8ICOA 4JIOA 2IOQA 4G0HA 5DS5A 3MDAA 4OAFA 4Z6DA 4NY8A 1PD1A 4R64A 5L0FA 1FAPB 3TULA 2MHRA 3IHUA 4LDQA 4D4XA 4EBJA 3HJCA 1NBBA 4CSAA 2QLAA 4JC7A 1RPLA 5COGA 4JWMA 4NLZA 5DB6A 3RJJA 2R7RA 4DOBA 1TFYA 3C2LA 2IUBA 1ORYA 3RQGA 1HY5A 3NG1A 5CA7A 4GXJA 2GFHA 3SZRA 1M2VA 9ICKA 4K99A 4LZGA 2HV7A 1FMWA 1ZW2A 1Y6DA 4R32A 4XTKA 3R2PA 7ICFA 3K75D 3Q6MA 2IHOA 4IB4A 1O5HA 1R5ID 4HX0A 4NTAA 1AEPA 4PACA 1OCCC 5HSWA 4HEAJ 1Q79A 2M2VA 2OU6A 3FVYA 3C2MA 5J0TA 2A0UA 2KSFA 2R25A 2LIGA 4XQ1A 4O6NA 4NCQA 4LDKA 9ICCA 1FMVA 3KYJA 5D92A 1NFNA 3DE8A 3C7JA 5L3QA 3NRHA 3NYBA 4MNDA 2H7BA 1ZU5A 1TVAA 3JPSA 5T3TA 3DM9B 3EGXA 2WZLA 4R63A 1NZEA 2XL6A 2DR9A 1KDHA 2H7VC 2DYSC
chains in the Genus database with same CATH topology
3V72A 8ICLA 4RT2A 3RQFA 4AT8A 1BPXA 2GWSA 5J2DA 3V7JA 8ICFA 5HR9A 4O5EA 4QZDA 9ICVA 5CWRA 3ISDA 1JAJA 4WCWA 2DR7A 5HREA 3RJHA 4RWQA 4UB3A 5HRHA 2HSBA 4LT6A 4MFCA 4NQFA 1NO5A 3O10A 2M2WA 4I28A 4KLHA 2PBEA 5J0QA 3C18A 4F5PA 4KLTA 5IILA 2ZH7A 1KNYA 1R8AA 2ZH3A 8ICVA 9ICTA 4NM2A 4I2BA 2DR8A 1XSNA 5BPCA 3V7LA 4ATBB 7ICJA 4WC6A 5HRIA 1Q78A 2FMPA 2ISPA 4R66A 3C5GA 4I2DA 4AT9B 1ZQWA 1UFBA 4LZDA 7ICHA 8ICBA 9ICPA 4M04A 4UBCA 5J2EA 2ISOA 2BPFA 2BPCA 4I2GA 7ICGA 1UETA 9ICUA 3B0XA 5J2AA 4QZFA 3RJEA 2BCUA 3ISBA 1RZTA 4X4QA 4M9NA 4UAYA 4I29A 4PGXA 4M9LA 4S3NA 2ZHBA 4UD5A 4YD2A 5J2JA 4X4PA 4RPZA 3RJKA 2ZH6A 4P4MA 4UB5A 3C66A 1ZQCA 9ICIA 4RQ3A 3HX0A 2JPUA 8ICCA 4FH3A 4MF2A 2ID1A 3MGIA 9ICRA 1K05A 3V7KA 1OW7A 1JMSA 1MQ3A 4DOAA 8ICWA 4X4SA 1ZQOA 1ZQSA 4IQWA 1XSPA 5IIKA 4FHVA 4MFFA 4RWNA 4XEFA 3WFPA 4M9GA 1ZQZA 5D46A 3JYYA 4TUPA 4Z6CA 4IQUA 1ZQNA 1WWPA 7ICKA 1MIYA 5J2IA 4PPXA 5HC9A 4UB4A 4RPYA 4NKUA 1WTYA 1ZQXA 3JPPA 1ZQKA 1KEJA 2ZH8A 5HHHA 1JN3A 3C2KA 1ZQEA 4UB2A 3OVAA 3HJ4A 3OVSA 1XSLA 1ZQJA 1MIVA 1ZQBA 5DDMA 5J0OA 3HIYA 3C8GB 2ZH4A 4X4UA 4UBBA 5DB8A 4F5OA 4WC2A 4K4IA 5DBCA 4X4TA 3S9OA 4QZGA 4E8FA 7ICUA 1ZZPA 8ICAA 3JPOA 4QZIA 5HRBA 2HHPA 1ZQFA 5CHGA 3HWTA 2P66A 4NXZA 4RWOA 4X4OA 4WC0A 4I27A 4DOCA 1ZQLA 2BPGA 8ICYA 8ICUA 4PHPA 4WC1A 4XQ8A 3UQ0A 3AU6A 4AT7B 1TFWA 4UD4A 3AU2A 4EP7A 4I2FA 4WC3A 3RH4A 4WC7A 4UB1A 4I2AA 2M2TA 5IIOA 4KLMA 4PGYA 4IQVA 1ZQTA 2DVIA 2FMSA 7ICPA 9ICFA 4NLKA 1ZJNA 5J2HA 5CJ7A 4P4PA 1NOMA 5J0XA 1OW8A 4FHPA 5HRFA 4WC4A 5TZVA 3C8GD 5DECA 2NRKA 5J2GA 2O1PA 5BOLA 5J2CA 9ICXA 3H3AA 5IIMA 4YMMA 1MIWA 3UPSA 2RFFA 4XEKA 1HUZA 3MGHA 5IINA 2YWAA 3HJ1A 2IHMA 3GM1A 4MFAA 1PX5A 4AT8B 4GXKA 7ICIA 2Q66A 4KLSA 1UEUA 2PFOA 3WFSC 4M47A 1K40A 3MFNA 4KLOA 1R8CA 1V4AA 2BCVA 4QZBA 3AQLA 2L6GA 4P2HA 4RQ2A 7ICOA 4YD1A 3JPTA 1ZQQA 4RQ1A 5J2BA 1VFGA 4WC5A 3B71A 3UXPA 2BCQA 5EOZA 8ICPA 5J0PA 4X0BA 9ICLA 1VJ7A 3WFQE 1ZJMA 1FA0A 4XA5A 1ZQRA 4XUSA 2ZHAA 4O5CA 3GM3A 4KLLA 3OUYA 4PGQA 4RQ7A 3TFRA 4I2JA 4KLUA 4M5DA 3LK9A 3RJIA 4KLDA 3PMNA 3JZ0A 3TFSA 1BPYA 5F28E 4YCXA 7ICLA 3PNCA 3HW8A 4RQ4A 5DB9A 4PHAA 8ICXA 3GDXA 4YMNA 2DR5A 4KLJA 4P4OA 1ZQIA 3GM2A 1K04A 1WOTA 3OVBA 4FHWA 1ZQVA 4M0AA 8ICIA 9ICMA 4GXIA 4RQ6A 1ZQAA 5IIJA 8ICKA 1PV3A 4F5RA 4O9MA 4I2IA 5J0RA 5CP2A 1BPZA 4RQ0A 4RWPA 4M2YA 1BPDA 3RH5A 3UXOA 4EBKA 2M2UA 4QZ8A 5J2KA 3PMLA 8ICNA 4RPXA 1ZQYA 4WBZA 1MQ2A 8ICEA 2KK1A 4QZCA 3MBYA 2PXIA 1HUOA 4YN4A 4FH5A 3UXNA 4X4NA 5DBAA 3AQNA 4X4RA 4TURA 2JX0A 2ZH5A 8ICGA 9ICSA 5HRLA 3RJFA 9ICBA 4DO9A 2I9GA 8ICSA 2Q00A 2ZH2A 7ICMA 5HRGA 3BRJA 4FHYA 7ICEA 9ICQA 4Z6FA 4M9HA 3L8JA 4KLEA 2ZH1A 4UAWA 4ATBA 4K4GA 8ICHA 4XEVA 2W9MA 3MDCA 4F5QA 1UEVA 4FO6A 4KLFA 4I2CA 8ICTA 3U0CA 4AT9A 9ICWA 1JQRA 3B0YA 3L9DA 9ICGA 2ZH9A 4WBYA 5CB1A 5J0WA 4IG8A 4LVSA 5J0YA 1TV9A 2O5AA 3LQCB 9ICEA 5DKWA 3OV7A 3JPQA 5DEDA 3C5FA 4F5NA 1WOLA 4RQ8A 4QZ9A 2BCSA 3ISCA 3RJGA 3H39A 3K7DA 3H37A 8ICOA 4IQTA 1F5AA 4XRHA 9ICOA 3MDAA 9ICHA 7ICQA 8ICRA 4Z6DA 2DRBA 4NY8A 1YLQA 4R64A 4Z6EA 3RH6A 3TULA 7ICRA 4X5VA 1OU5A 4QZAA 4EBJA 1ZQPA 1QVXA 4JWNA 4K4HA 4X0AA 5DBBA 8ICZA 1RPLA 8ICQA 3UQ2A 3AJMA 3H38A 9ICAA 4JWMA 4NLNA 3U3FA 1OW6A 3OGUA 4NLZA 4FHXA 1KTMA 2LK4A 2BE3A 1ZQDA 5J2FA 1ZQMA 4MF8A 5CR0A 3JPNA 5DB6A 3RJJA 7ICVA 1JOGA 5BOMA 4DOBA 5HHIA 1TFYA 2L6FA 3C2LA 8ICMA 4E80A 4KLIA 3RQGA 3C8GA 5D4BA 1KDHA 4UAZA 5HRKA 5CA7A 4PHDA 4GXJA 4I2HA 7ICNA 9ICKA 1ZQGA 5DB7A 4LZGA 3OUYB 4R32A 3RQEA 2VANA 5IIIA 3AUOA 5HRDA 7ICFA 3K75D 4E7XA 3L8IA 4I2EA 3WFRE 1R89A 3UPQA 4KLGA 4NM1A 2PFNA 4AT7A 4RQ5A 4TUSA 1Q79A 2M2VA 3AQMA 1BPBA 8ICJA 4NKTA 3C2MA 4PHEA 5J0TA 4TUQA 5F2VO 9ICJA 2BCRA 5D49A 7ICTA 3AQKA 9ICCA 9ICNA 4QZHA 1ZQUA 1BPEA 4QZEA 5J0SA 5J29A 5J0UA 4YMOA 4XQ7A 4PH5A 3NYBA 4O5KA 1R8BA 5DDYA 1TVAA 2FMQA 1O3UA 3JPSA 7ICSA 3WFOA 2PFQA 2DR9A 4M9JA 3JPRA 2L6HA 4X4VA 4RT3A 4R63A 4KLQA 2DRAA 1ZQHA 4R65A 2PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V72 A;  8ICL A;  4RT2 A;  3RQF A;  4AT8 A;  1BPX A;  2GWS A;  5J2D A;  3V7J A;  8ICF A;  5HR9 A;  4O5E A;  4QZD A;  9ICV A;  5CWR A;  3ISD A;  1JAJ A;  4WCW A;  2DR7 A;  5HRE A;  3RJH A;  4RWQ A;  4UB3 A;  5HRH A;  2HSB A;  4LT6 A;  4MFC A;  4NQF A;  1NO5 A;  3O10 A;  2M2W A;  4I28 A;  4KLH A;  2PBE A;  5J0Q A;  3C18 A;  4F5P A;  4KLT A;  5IIL A;  2ZH7 A;  1KNY A;  1R8A A;  2ZH3 A;  8ICV A;  9ICT A;  4NM2 A;  4I2B A;  2DR8 A;  1XSN A;  5BPC A;  3V7L A;  4ATB B;  7ICJ A;  4WC6 A;  5HRI A;  1Q78 A;  2FMP A;  2ISP A;  4R66 A;  3C5G A;  4I2D A;  4AT9 B;  1ZQW A;  1UFB A;  4LZD A;  7ICH A;  8ICB A;  9ICP A;  4M04 A;  4UBC A;  5J2E A;  2ISO A;  2BPF A;  2BPC A;  4I2G A;  7ICG A;  1UET A;  9ICU A;  3B0X A;  5J2A A;  4QZF A;  3RJE A;  2BCU A;  3ISB A;  1RZT A;  4X4Q A;  4M9N A;  4UAY A;  4I29 A;  4PGX A;  4M9L A;  4S3N A;  2ZHB A;  4UD5 A;  4YD2 A;  5J2J A;  4X4P A;  4RPZ A;  3RJK A;  2ZH6 A;  4P4M A;  4UB5 A;  3C66 A;  1ZQC A;  9ICI A;  4RQ3 A;  3HX0 A;  2JPU A;  8ICC A;  4FH3 A;  4MF2 A;  2ID1 A;  3MGI A;  9ICR A;  1K05 A;  3V7K A;  1OW7 A;  1JMS A;  1MQ3 A;  4DOA A;  8ICW A;  4X4S A;  1ZQO A;  1ZQS A;  4IQW A;  1XSP A;  5IIK A;  4FHV A;  4MFF A;  4RWN A;  4XEF A;  3WFP A;  4M9G A;  1ZQZ A;  5D46 A;  3JYY A;  4TUP A;  4Z6C A;  4IQU A;  1ZQN A;  1WWP A;  7ICK A;  1MIY A;  5J2I A;  4PPX A;  5HC9 A;  4UB4 A;  4RPY A;  4NKU A;  1WTY A;  1ZQX A;  3JPP A;  1ZQK A;  1KEJ A;  2ZH8 A;  5HHH A;  1JN3 A;  3C2K A;  1ZQE A;  4UB2 A;  3OVA A;  3HJ4 A;  3OVS A;  1XSL A;  1ZQJ A;  1MIV A;  1ZQB A;  5DDM A;  5J0O A;  3HIY A;  3C8G B;  2ZH4 A;  4X4U A;  4UBB A;  5DB8 A;  4F5O A;  4WC2 A;  4K4I A;  5DBC A;  4X4T A;  3S9O A;  4QZG A;  4E8F A;  7ICU A;  1ZZP A;  8ICA A;  3JPO A;  4QZI A;  5HRB A;  2HHP A;  1ZQF A;  5CHG A;  3HWT A;  2P66 A;  4NXZ A;  4RWO A;  4X4O A;  4WC0 A;  4I27 A;  4DOC A;  1ZQL A;  2BPG A;  8ICY A;  8ICU A;  4PHP A;  4WC1 A;  4XQ8 A;  3UQ0 A;  3AU6 A;  4AT7 B;  1TFW A;  4UD4 A;  3AU2 A;  4EP7 A;  4I2F A;  4WC3 A;  3RH4 A;  4WC7 A;  4UB1 A;  4I2A A;  2M2T A;  5IIO A;  4KLM A;  4PGY A;  4IQV A;  1ZQT A;  2DVI A;  2FMS A;  7ICP A;  9ICF A;  4NLK A;  1ZJN A;  5J2H A;  5CJ7 A;  4P4P A;  1NOM A;  5J0X A;  1OW8 A;  4FHP A;  5HRF A;  4WC4 A;  5TZV A;  3C8G D;  5DEC A;  2NRK A;  5J2G A;  2O1P A;  5BOL A;  5J2C A;  9ICX A;  3H3A A;  5IIM A;  4YMM A;  1MIW A;  3UPS A;  2RFF A;  4XEK A;  1HUZ A;  3MGH A;  5IIN A;  2YWA A;  3HJ1 A;  2IHM A;  3GM1 A;  4MFA A;  1PX5 A;  4AT8 B;  4GXK A;  7ICI A;  2Q66 A;  4KLS A;  1UEU A;  2PFO A;  3WFS C;  4M47 A;  1K40 A;  3MFN A;  4KLO A;  1R8C A;  1V4A A;  2BCV A;  4QZB A;  3AQL A;  2L6G A;  4P2H A;  4RQ2 A;  7ICO A;  4YD1 A;  3JPT A;  1ZQQ A;  4RQ1 A;  5J2B A;  1VFG A;  4WC5 A;  3B71 A;  3UXP A;  2BCQ A;  5EOZ A;  8ICP A;  5J0P A;  4X0B A;  9ICL A;  1VJ7 A;  3WFQ E;  1ZJM A;  1FA0 A;  4XA5 A;  1ZQR A;  4XUS A;  2ZHA A;  4O5C A;  3GM3 A;  4KLL A;  3OUY A;  4PGQ A;  4RQ7 A;  3TFR A;  4I2J A;  4KLU A;  4M5D A;  3LK9 A;  3RJI A;  4KLD A;  3PMN A;  3JZ0 A;  3TFS A;  1BPY A;  5F28 E;  4YCX A;  7ICL A;  3PNC A;  3HW8 A;  4RQ4 A;  5DB9 A;  4PHA A;  8ICX A;  3GDX A;  4YMN A;  2DR5 A;  4KLJ A;  4P4O A;  1ZQI A;  3GM2 A;  1K04 A;  1WOT A;  3OVB A;  4FHW A;  1ZQV A;  4M0A A;  8ICI A;  9ICM A;  4GXI A;  4RQ6 A;  1ZQA A;  5IIJ A;  8ICK A;  1PV3 A;  4F5R A;  4O9M A;  4I2I A;  5J0R A;  5CP2 A;  1BPZ A;  4RQ0 A;  4RWP A;  4M2Y A;  1BPD A;  3RH5 A;  3UXO A;  4EBK A;  2M2U A;  4QZ8 A;  5J2K A;  3PML A;  8ICN A;  4RPX A;  1ZQY A;  4WBZ A;  1MQ2 A;  8ICE A;  2KK1 A;  4QZC A;  3MBY A;  2PXI A;  1HUO A;  4YN4 A;  4FH5 A;  3UXN A;  4X4N A;  5DBA A;  3AQN A;  4X4R A;  4TUR A;  2JX0 A;  2ZH5 A;  8ICG A;  9ICS A;  5HRL A;  3RJF A;  9ICB A;  4DO9 A;  2I9G A;  8ICS A;  2Q00 A;  2ZH2 A;  7ICM A;  5HRG A;  3BRJ A;  4FHY A;  7ICE A;  9ICQ A;  4Z6F A;  4M9H A;  3L8J A;  4KLE A;  2ZH1 A;  4UAW A;  4ATB A;  4K4G A;  8ICH A;  4XEV A;  2W9M A;  3MDC A;  4F5Q A;  1UEV A;  4FO6 A;  4KLF A;  4I2C A;  8ICT A;  3U0C A;  4AT9 A;  9ICW A;  1JQR A;  3B0Y A;  3L9D A;  9ICG A;  2ZH9 A;  4WBY A;  5CB1 A;  5J0W A;  4IG8 A;  4LVS A;  5J0Y A;  1TV9 A;  2O5A A;  3LQC B;  9ICE A;  5DKW A;  3OV7 A;  3JPQ A;  5DED A;  3C5F A;  4F5N A;  1WOL A;  4RQ8 A;  4QZ9 A;  2BCS A;  3ISC A;  3RJG A;  3H39 A;  3K7D A;  3H37 A;  8ICO A;  4IQT A;  1F5A A;  4XRH A;  9ICO A;  3MDA A;  9ICH A;  7ICQ A;  8ICR A;  4Z6D A;  2DRB A;  4NY8 A;  1YLQ A;  4R64 A;  4Z6E A;  3RH6 A;  3TUL A;  7ICR A;  4X5V A;  1OU5 A;  4QZA A;  4EBJ A;  1ZQP A;  1QVX A;  4JWN A;  4K4H A;  4X0A A;  5DBB A;  8ICZ A;  1RPL A;  8ICQ A;  3UQ2 A;  3AJM A;  3H38 A;  9ICA A;  4JWM A;  4NLN A;  3U3F A;  1OW6 A;  3OGU A;  4NLZ A;  4FHX A;  1KTM A;  2LK4 A;  2BE3 A;  1ZQD A;  5J2F A;  1ZQM A;  4MF8 A;  5CR0 A;  3JPN A;  5DB6 A;  3RJJ A;  7ICV A;  1JOG A;  5BOM A;  4DOB A;  5HHI A;  1TFY A;  2L6F A;  3C2L A;  8ICM A;  4E80 A;  4KLI A;  3RQG A;  3C8G A;  5D4B A;  1KDH A;  4UAZ A;  5HRK A;  5CA7 A;  4PHD A;  4GXJ A;  4I2H A;  7ICN A;  9ICK A;  1ZQG A;  5DB7 A;  4LZG A;  3OUY B;  4R32 A;  3RQE A;  2VAN A;  5III A;  3AUO A;  5HRD A;  7ICF A;  3K75 D;  4E7X A;  3L8I A;  4I2E A;  3WFR E;  1R89 A;  3UPQ A;  4KLG A;  4NM1 A;  2PFN A;  4AT7 A;  4RQ5 A;  4TUS A;  1Q79 A;  2M2V A;  3AQM A;  1BPB A;  8ICJ A;  4NKT A;  3C2M A;  4PHE A;  5J0T A;  4TUQ A;  5F2V O;  9ICJ A;  2BCR A;  5D49 A;  7ICT A;  3AQK A;  9ICC A;  9ICN A;  4QZH A;  1ZQU A;  1BPE A;  4QZE A;  5J0S A;  5J29 A;  5J0U A;  4YMO A;  4XQ7 A;  4PH5 A;  3NYB A;  4O5K A;  1R8B A;  5DDY A;  1TVA A;  2FMQ A;  1O3U A;  3JPS A;  7ICS A;  3WFO A;  2PFQ A;  2DR9 A;  4M9J A;  3JPR A;  2L6H A;  4X4V A;  4RT3 A;  4R63 A;  4KLQ A;  2DRA A;  1ZQH A;  4R65 A;  2PFP A; 
#chains in the Genus database with same CATH topology
 3EHN A;  3V5Z A;  8ICL A;  3GWN A;  3V5Y A;  4CSA C;  4AT8 A;  1BPX A;  2GWS A;  1AUE A;  5J2D A;  2O9X A;  8ICF A;  5HR9 A;  2NUT A;  4QZD A;  9ICV A;  2J7P D;  2UUI A;  2R7S A;  4FX5 A;  4FAP B;  4DXW A;  2R03 A;  4OIP F;  4RDA A;  3SNH A;  2W4B A;  4RWQ A;  2AWC A;  4JE9 A;  4EV6 A;  3UMH A;  2CYD A;  4PFO A;  2R7T A;  2PBE A;  2R05 A;  3KL4 A;  1QLE C;  3DXJ F;  3C18 A;  2BL2 A;  1I4Y A;  4B6I A;  5IIL A;  9ICT A;  8ICV A;  4NM2 A;  2NUP B;  2DR8 A;  1XSN A;  4CX9 A;  7ICJ A;  3L0I A;  3SEO A;  5HRI A;  1Q78 A;  1ZHX A;  2VB6 A;  2ISP A;  4I2D A;  1NSG B;  2KNH A;  1UFB A;  1YA9 A;  8ICB A;  4CS9 A;  2HZ8 A;  4I2G A;  1T6Q A;  2LD6 A;  3B0X A;  2BCU A;  1RZT A;  4M9N A;  4I29 A;  4M9L A;  3W4Y A;  5FZT A;  2ZH6 A;  2IXO A;  4UB5 A;  3VRC A;  4Z9I A;  1Z7Q c;  3HX0 A;  4FH3 A;  2OJE D;  4MF2 A;  2ID1 A;  9ICR A;  2J8W A;  5DLJ A;  3JSE O;  4YK5 A;  4QI2 A;  4DOA A;  4FES A;  4K98 A;  5GPG B;  4LER A;  1N1C A;  4MVS A;  2R7U A;  4FHV A;  5IIK A;  4MFF A;  3TJ5 A;  2QNL A;  2XL8 A;  2X51 A;  1MIY A;  4JCZ A;  3IQT A;  4RPY A;  4WOY A;  1VTM P;  4C3B A;  3NMK A;  5JT4 A;  1I5N A;  3OVA A;  3DJU B;  3DD7 A;  4AE4 B;  2Q7R A;  4M63 A;  1GPJ A;  3CSK A;  4K4I A;  3U9M A;  4H4K C;  3U8P A;  4QZG A;  7ICU A;  1LVK A;  1YYX A;  4XWJ A;  2L9J A;  2VAS A;  1Z23 A;  3TD7 A;  4RWO A;  3QTH A;  4JRZ A;  8ICU A;  3OWG A;  1G4U S;  3UNG C;  1W2W A;  4XQ8 A;  3ABL C;  3X2Q C;  4EP7 A;  2OEX A;  4CS9 C;  1QKR A;  4JW1 A;  3V5X A;  4I2A A;  3T9O A;  4IQV A;  1SZI A;  2ZXP A;  1V55 C;  2DVI A;  4DJ9 A;  7ICP A;  1S7Z A;  4J32 B;  1GM5 A;  1ZJN A;  3K1I A;  1OKK D;  1HMO A;  5CJ7 A;  5CI9 A;  2V3C C;  1WAT A;  4C7O B;  5HRF A;  4WC4 A;  3JCF A;  1MIW A;  2RFF A;  4DVY P;  3ASO C;  1PX5 A;  3VAY A;  3FDQ A;  1YYJ A;  1K40 A;  2AWY A;  2BC5 A;  1R8C A;  2PX3 A;  4PFP A;  1V4A A;  7ICO A;  4D4N A;  1YZA A;  2EPN A;  3U9J A;  1PD0 A;  4K97 A;  3UXP A;  5JS5 A;  4MTF A;  1GQA A;  4X0B A;  3JSZ A;  2QUP A;  4LEY A;  2KJG A;  2YRF A;  4MW3 A;  4XA5 A;  1ZQR A;  2V26 A;  1ORS C;  5EGY A;  3ZC4 A;  3AG1 C;  1AVO B;  2IXM A;  4PGQ A;  4I1O B;  5B1B C;  4I2J A;  3JRM O;  4M5D A;  3PMN A;  3TFS A;  1OXB A;  7ICL A;  3PNC A;  3IQC A;  2J45 A;  3L1M A;  1QPU A;  5JRA A;  3IQ6 A;  3UGO A;  4GQH A;  2P7V A;  3NDB B;  4YMN A;  2DR5 A;  4KLJ A;  2HMZ A;  1G5Z A;  1YDI A;  1ZQI A;  4E17 A;  3GM2 A;  1K04 A;  2FFH A;  3K1H A;  1JR8 A;  1BR1 A;  2XS1 A;  4U5F E;  3K1I C;  1DOW A;  2DGJ A;  3M79 A;  4GXI A;  5CFU A;  2W9Y A;  1ZQA A;  1RMV A;  3LS0 A;  2A69 F;  3PCV A;  1BPD A;  1NG1 A;  4JZA A;  3UXO A;  3F46 A;  4HFK B;  3EH2 A;  8ICN A;  3W8I A;  5L0G A;  4NXT A;  3IEE A;  1ZVZ A;  2EIN C;  5A6A A;  2XLW A;  3QZC A;  1VK5 A;  1Z3I X;  2W4M A;  4NXW A;  2NG1 A;  5DBA A;  4X4R A;  4TUR A;  1C03 A;  2XSE A;  9ICS A;  1SR2 A;  4LEW A;  3RJF A;  4DO9 A;  2Q00 A;  2I15 A;  3S0X A;  1FFT C;  4CIP A;  1YA7 O;  3RKO F;  2NUP A;  4M9H A;  3L8J A;  5T1D B;  3OWT A;  8ICH A;  2NSG A;  4KC9 A;  4CS8 A;  4EHP A;  4FO6 A;  1G8X A;  3PMR A;  3U0C A;  1JQR A;  3FOO A;  5EK0 A;  4MS2 A;  2J9V A;  1T6I A;  4YL0 A;  5DED A;  4NY3 A;  4RQ8 A;  4EUK B;  2BCS A;  4I1M A;  4BJ6 A;  1F5A A;  4XRH A;  9ICO A;  9ICH A;  7ICQ A;  2DRB A;  2HKV A;  1OCZ C;  3RH6 A;  4AL0 A;  1JMW A;  5JVE A;  1NFO A;  1OU5 A;  4QZA A;  1CGO A;  1LI5 A;  3QMK A;  4X0A A;  5DBB A;  8ICZ A;  3NKE A;  2KQ9 A;  8ICQ A;  2E87 A;  2L7A A;  2DB4 A;  2B51 A;  1OW6 A;  3TJ6 A;  4FHX A;  1KTM A;  2LK4 A;  3GWL A;  5J2F A;  2P0N A;  2HN1 A;  3JPN A;  4OD5 A;  4MTO A;  2Q9A A;  1JOG A;  5HHI A;  8ICM A;  1SF8 A;  4AE4 A;  4KLI A;  4MTG A;  4UAZ A;  3SXM A;  5A69 A;  3I5P A;  1ZQG A;  1A41 A;  1VYI A;  2EPK X;  2A6H F;  2VAN A;  1TKN A;  2OJQ A;  3VYW A;  1OXK A;  3L8I A;  3WFR E;  1FTS A;  1LE2 A;  2ETS A;  2PNO A;  5DQZ A;  3UPQ A;  5BQH A;  4KLG A;  2J9U A;  3AGT A;  4K9A A;  4RQ5 A;  1TFO B;  4NKT A;  2HSQ A;  4PJL A;  5F2V O;  4IRU A;  3TQO A;  7ICT A;  3AQK A;  3SXY A;  1BPE A;  5DQT A;  2I8B A;  3E70 C;  4BJ6 C;  4YMO A;  4PH5 A;  2CNW A;  4W8P A;  5D91 A;  3K66 A;  2FMQ A;  4M9J A;  3JPR A;  4X4V A;  4RT3 A;  4KLQ A;  1D1B A;  1APC A;  2DRA A;  4IAQ A;  3GOR A;  3DI5 A;  3V72 A;  1TQG A;  2VCA A;  5B1A C;  2CDQ A;  2GAQ A;  3CAX A;  1VOM A;  4O5E A;  5CWR A;  2Y39 A;  4L6R A;  4BJ5 A;  2DR7 A;  5HRE A;  4JJG A;  2HSB A;  4LT6 A;  4NQF A;  3O10 A;  4I28 A;  3KYI A;  3ER8 C;  2Y3B A;  3I4U A;  4MVM A;  1MNE A;  4F5P A;  4KLT A;  3HNI A;  4I2B A;  4U9D A;  2FMP A;  3C5G A;  3R7C A;  2XLV A;  4AT9 B;  4LZD A;  2XM4 A;  1IZM A;  9ICP A;  4BJT A;  4M04 A;  4UBC A;  7ICG A;  3G50 A;  9ICU A;  3GEH A;  3I5Q A;  5E33 A;  4X4Q A;  2GA0 A;  2WVN A;  4UD5 A;  3EJN A;  5CFT A;  3ZTZ A;  5J2J A;  1JPJ A;  3RJK A;  5D63 A;  5A6K A;  1T9K A;  3L34 A;  2JPU A;  3VM6 A;  1E84 A;  3ZTM A;  1ZQO A;  1TWC A;  1T6U A;  5BUO A;  2J7P A;  1J8Y F;  3JCU Q;  4XEF A;  3WFP A;  5D46 A;  1D0Y A;  4TUP A;  1XZQ A;  4IQU A;  1ZQN A;  3H2U A;  2P1A A;  4PPX A;  4UB4 A;  5E3A A;  2A68 F;  1WTY A;  1ZQX A;  1A7E A;  4E7S A;  1ZQK A;  1JN3 A;  4NTB A;  4UB2 A;  4BJ5 C;  3F47 A;  1FNT c;  4LDR A;  1MMD A;  3OVS A;  4LEZ A;  1XSL A;  1ZQJ A;  1ZQB A;  3HIY A;  1WGW A;  4Q5S F;  4KB6 A;  1RCP A;  2R7W A;  4OAI Z;  3C8G B;  4XPX A;  5DB8 A;  5F5H A;  2G3K A;  8ICA A;  1MQV A;  3FHD A;  1LS1 A;  3AOU A;  1ZQF A;  4LAC B;  3HWT A;  1ZHZ A;  4NXZ A;  2ZXW C;  1BZ4 A;  4WC1 A;  3UMK A;  4AT7 B;  2HFI A;  3EPV A;  4LLE A;  4UD4 A;  4WJ0 A;  3AU2 A;  1TFW A;  2EIK C;  4WC7 A;  4KNV A;  1U89 A;  5IIO A;  2EIJ C;  4KLM A;  5CI8 A;  2A6E F;  2FMS A;  2R7X A;  1MMG A;  4CDV A;  9ICF A;  4NLK A;  3EQL F;  1NOM A;  2PFD A;  2W45 A;  1YJG A;  3VF0 A;  4P9T A;  2O1P A;  3H3A A;  4WGY A;  2UUH A;  2BBH A;  4XEK A;  3MGH A;  5IIN A;  4E18 A;  2IHM A;  3NYL A;  2EIM C;  4MW8 A;  4KLS A;  3AQB A;  2EPM X;  3EG9 B;  4M47 A;  2YLG A;  5DS4 A;  3W8H A;  4KLO A;  3LLK A;  5KYY B;  5B3Q A;  4QZB A;  4YL3 A;  1XZP A;  3B9Q A;  4YD1 A;  2XRH A;  2OOC A;  4ZLD A;  5J2B A;  1VFG A;  3S29 A;  3B0V C;  2CCY A;  1DOV A;  2QY9 A;  1VJ7 A;  1ZJM A;  2LFF A;  2OQM A;  3K6B A;  5AC4 A;  3DMD A;  2A1D D;  3NWI A;  4ZLC A;  4KLL A;  3A11 A;  2R7O A;  1V54 C;  1TWG A;  4X0R A;  4KLU A;  4KLD A;  1BPY A;  2KC3 A;  1T5O A;  5F28 E;  5TJ5 E;  4O6A A;  3EFO B;  4YWQ A;  3DE9 A;  4RQ4 A;  4KBL A;  8ICX A;  3C63 A;  3U8V A;  1OKK A;  4O67 A;  3N2Z B;  4P4O A;  1WOT A;  1H9T A;  4K8V A;  4CJO A;  4DRH B;  2ASR A;  3CZ6 A;  2WB7 A;  4RQ6 A;  4JTD B;  3DJN B;  4I2I A;  5J0R A;  2J9B A;  3DKA A;  4JLX A;  2YLI A;  1TWA A;  3ZVR A;  2PF4 E;  2IM8 A;  2QTV A;  4IAO A;  5E3C A;  3RH5 A;  5JUA A;  4NXX A;  3FAJ A;  4G7H F;  1ZQY A;  4WBZ A;  1MQ2 A;  8ICE A;  3MBY A;  4XJE A;  4YN4 A;  4FH5 A;  4X4N A;  2KYH A;  1CGN A;  2C03 A;  4BPM A;  4GYT A;  3K33 A;  1FR0 A;  2OG2 A;  2HN2 A;  9ICB A;  3C8Z A;  8ICS A;  5HRG A;  3BRJ A;  2XXA B;  1LKX A;  3MYI A;  4I44 A;  3RIP A;  5E2Q A;  2CGE A;  2J0W A;  4Z6F A;  2ZD9 A;  2ZH1 A;  4UAW A;  2W9M A;  3ATP A;  4KLF A;  5KYW B;  4N6C A;  2HUJ A;  4I2C A;  4AT9 A;  1D1C A;  2ZXR A;  5CB1 A;  5J0W A;  4IG8 A;  1NU7 D;  5J0Y A;  2O5A A;  3US6 A;  4KI2 A;  3LQC B;  4OD4 A;  4FO1 A;  5DKW A;  3LES A;  4WGZ A;  3ZG1 A;  4E7Z A;  2YL0 A;  1FFH A;  4PK4 A;  1RJ9 B;  2YL1 A;  2ICW G;  1C02 A;  8ICR A;  1YZC A;  1YLQ A;  4Z6E A;  1SMY F;  2B0J A;  3AGU A;  7ICR A;  4RBN A;  4O7G A;  1B68 A;  4Z9J A;  2GAF D;  4K4H A;  2LQG A;  3B0U X;  1LS4 A;  3UQ2 A;  3AJM A;  9ICA A;  3UR3 C;  4NLN A;  1Q0F A;  2L81 A;  2Y3H A;  3OGU A;  4H54 A;  2XLM A;  4JKV A;  2BE3 A;  1RKC A;  3UGP A;  2XLO A;  1ZQM A;  4MF8 A;  5CR0 A;  4CS7 A;  2NPU A;  4E0H A;  5F5F A;  4DOZ A;  2L6F A;  4E80 A;  3CK6 A;  2YQY A;  4YJW A;  3C8G A;  4JCH A;  5HRK A;  4PHD A;  3KKB A;  7ICN A;  3GEI A;  4MQ9 F;  2YLD A;  1Y4C A;  2YVK A;  3LEV A;  4E7X A;  4AK9 A;  3X1O A;  1R89 A;  3EZH A;  2PFN A;  4AT7 A;  1H9G A;  4TUS A;  3AQM A;  2PX0 A;  3ZDL A;  4CIH A;  1BPB A;  2HJM A;  4U5G A;  3N0T A;  2BCR A;  3U3B A;  5D49 A;  4AX2 A;  2OCC C;  9ICN A;  4LLC A;  1ZQU A;  4QZE A;  5J0S A;  5J29 A;  4XQ7 A;  2Z15 A;  3G4X A;  1R8B A;  5FCL A;  3RYL A;  4YL1 A;  3LEO A;  2XM0 A;  7ICS A;  3WFO A;  1R4T A;  1SYQ A;  1VB5 A;  2B56 A;  4C3D A;  3T6J A;  2WVQ A;  4R65 A;  2NSF A;  3RQF A;  4FWV A;  2DI3 A;  3EG9 A;  4OIO F;  5KYY A;  1JAJ A;  1A7D A;  3RVZ A;  2FAP B;  4WCW A;  3ZQV A;  3RJH A;  4UB3 A;  3LLI A;  4MFC A;  1E86 A;  1NO5 A;  1BDJ B;  2M2W A;  4KLH A;  5J0Q A;  2G62 A;  3DWW A;  3B0P A;  1RXQ A;  2RD9 A;  3V7L A;  2A0B A;  4JEA A;  4YT2 A;  1D1A A;  4NC3 A;  1ORJ A;  4OAG A;  3SP1 A;  5D61 A;  1ZQW A;  7ICH A;  1D0X A;  5L3V A;  4ULW A;  4CDY A;  2ISO A;  3EFO A;  1UET A;  2AP3 A;  2Y3D A;  1C17 M;  5J2A A;  1L7C A;  4PR9 A;  3RH3 A;  4PGX A;  4S3N A;  4YD2 A;  2HJ3 A;  4RPZ A;  4X4P A;  4P4M A;  5D62 A;  3C66 A;  9ICI A;  4JVS A;  3BEH A;  3M4C A;  5DVW A;  3MGI A;  2R7Q A;  4ULV A;  1ZU4 A;  3V7K A;  1MQ3 A;  2VC9 A;  2AVK A;  8ICW A;  1ZQS A;  4IQW A;  2HMQ A;  1XSP A;  3ZWI A;  2VCC A;  4M9G A;  1ZQZ A;  3S90 A;  2EIL C;  7ICK A;  4I3M A;  5J2I A;  1QSP A;  2VH3 A;  3NYM A;  4MVQ A;  4NKU A;  4EEB A;  3JPP A;  3J06 A;  1KEJ A;  3ERC C;  3Q6N A;  5HHH A;  3C2K A;  3NMJ A;  3HJ4 A;  1MIV A;  1CPR A;  5DDM A;  5A6B D;  2BE5 F;  4DBR A;  2YEV A;  2ZH4 A;  4X4U A;  4UBB A;  4F5O A;  1NLX A;  3U2M A;  4WC2 A;  3DAG A;  4NTF A;  4X4T A;  2XXA A;  2MWQ A;  5IY5 C;  5CHE A;  3JPO A;  1A0B A;  3T4R A;  3W2W A;  2HHP A;  2R02 A;  4BJ1 A;  4EED A;  4X4O A;  4WC0 A;  4I27 A;  3HNL A;  4DOC A;  5KYW A;  2XL4 A;  4PHP A;  4I2F A;  4WC3 A;  2YZS A;  4AL1 A;  2H7O A;  3W2V A;  2M2T A;  3A9C A;  4PGY A;  3SYN A;  3IQ5 A;  2WL8 A;  1RJ9 A;  2PP4 A;  4P4P A;  1OW8 A;  1J8M F;  5TZV A;  2KGO A;  5DEC A;  3QVZ A;  5J2G A;  1YAR O;  5BOL A;  5J2C A;  9ICX A;  4PJN A;  5IIM A;  1HE1 A;  1M56 C;  3ER9 B;  5DS6 A;  4DBQ A;  4Q7C A;  2Q9C A;  1IW7 F;  4GXK A;  4HE8 D;  1UEU A;  2PFO A;  3WFS C;  3MFN A;  3FXH A;  4E0I A;  1HE9 A;  2BCV A;  2B4V A;  2IBF A;  2L6G A;  4DVZ A;  3FAP B;  4K0D A;  3UMI A;  2VCB A;  4WC5 A;  4NXV A;  5EOZ A;  8ICP A;  3ZIB A;  3S27 A;  2IXP A;  3LNR A;  9ICL A;  3DM5 A;  3WFQ E;  1FA0 A;  1XWJ A;  2P6V A;  2CNW D;  4K1O A;  2ZHA A;  4O5C A;  2JD3 A;  3GM3 A;  1LIH A;  4XPY A;  4RQ7 A;  3AG4 C;  3TFR A;  5K0I A;  2YL7 A;  3LK9 A;  3RJI A;  1OR2 A;  5KYX B;  4YCX A;  4DRJ B;  1ZYR F;  3QW0 A;  1GS9 A;  2IYL D;  5KYN A;  3AG3 C;  4G7Z F;  1GGQ A;  1TR2 A;  5DB9 A;  2EPO A;  3ECS A;  3MCR A;  1BR2 A;  5COF A;  1O87 A;  2TMV P;  3O6X A;  3OVB A;  4FHW A;  1ZQV A;  2YKZ A;  2D4U A;  4IGG A;  8ICI A;  9ICM A;  4OIQ F;  5IIJ A;  4F5R A;  4O9M A;  3OEO A;  3S28 A;  2DYR C;  4MVO A;  2Y69 C;  4XPW A;  2IXN A;  1I4Z A;  4QI0 A;  1VLS A;  1Z6A A;  3LAY A;  4EBK A;  5KYU B;  2M2U A;  2XLH A;  4EIY A;  3NVO A;  4QZ8 A;  5J2K A;  4I0U A;  3O55 A;  2F22 A;  2KK1 A;  4QZC A;  1H7I A;  3M1C B;  3TK0 A;  4Q4Z F;  4G78 A;  3UXN A;  1F1M A;  2XLD A;  3AQN A;  3ABM C;  2LCH A;  2ZH5 A;  4IAR A;  1M57 C;  3M15 A;  3Q7G A;  4JLZ A;  2I9G A;  1VMA A;  2WZG A;  2ZH2 A;  4PJM A;  2Q4F A;  9ICQ A;  1VYK A;  3MDC A;  4F5Q A;  1UEV A;  4MKP A;  3JYH A;  4QDL A;  4LEV A;  1Q0G A;  3L9D A;  3E9V A;  9ICG A;  1G4W R;  4OIN F;  4WBY A;  2HS5 A;  4LVS A;  2EPL X;  1U0B B;  1Q0M A;  9ICE A;  2J9W A;  1LI7 A;  3EGD B;  3C5F A;  4F5N A;  1MMA A;  2LP4 A;  4MVR A;  3AG2 C;  4QZ9 A;  3PDM P;  4U9E A;  4F4B A;  1JRA A;  5T3W A;  3H65 A;  3K7D A;  4IQT A;  5L0D A;  3HTK C;  1Q0K A;  3HNJ A;  4X5V A;  4N06 A;  4EKW A;  2HV6 A;  1ZQP A;  1QVX A;  3WHN A;  4JWN A;  2OEV A;  2QE9 A;  4U5H A;  2J46 A;  5COM A;  3H38 A;  4NXU A;  3MYF A;  3U3F A;  3WAQ A;  1MND A;  1ZQD A;  3S84 A;  2G3V A;  4JTA B;  4J30 B;  7ICV A;  3ZQY A;  4JTC B;  5BOM A;  3QVY A;  4EBB A;  5D4B A;  4O6M A;  3PHF 2;  3ITF A;  4I2H A;  2FCL A;  5DB7 A;  3OUY B;  4IJJ A;  3RQE A;  3AUO A;  5III A;  4A2N B;  5HRD A;  4I2E A;  4U5E E;  1RKE B;  2R7V A;  2LFD A;  3EZI A;  2KW3 C;  4MVU A;  5CFS A;  1E83 A;  4K9B A;  4NM1 A;  1ZHY A;  3JTL O;  4KNW A;  8ICJ A;  3KH2 A;  4PHE A;  1QQ3 A;  5L0C A;  4TUQ A;  9ICJ A;  4JJF A;  4U5D E;  4CBE A;  1LE4 A;  3RVY A;  5HV9 A;  4QZH A;  1PCX A;  5J0U A;  3T6B A;  4O69 A;  4O5K A;  5JLI A;  3RFY A;  5DDY A;  1O3U A;  5L0J A;  2YHS A;  2PFQ A;  3ZSU A;  2L6H A;  2AU5 A;  3OA1 A;  1MMN A;  3U5S A;  4HFF B;  4W8K A;  3ASN C;  1ZQH A;  4A4A A;  2PFP A;  4RT2 A;  2D5R B;  1ST6 A;  3LNM B;  3V7J A;  5B3P A;  4WAB A;  1TWH A;  2GA9 D;  3ISD A;  2MYS A;  3RW0 A;  1EQ1 A;  3HKK A;  3LS1 A;  3B29 A;  5HRH A;  3AQC A;  4N7R A;  3GEE A;  1BBH A;  5BQI A;  3C62 A;  1UG7 A;  3JRT A;  3DZA A;  4O68 A;  2ZH7 A;  1HMD A;  1KNY A;  2J0X A;  1TFK B;  4BEJ A;  1R8A A;  2ZH3 A;  5BPC A;  4ATB B;  256B A;  4WC6 A;  4PJJ A;  4BG0 A;  3EHM A;  4R66 A;  3FOP A;  1E2X A;  5KYX A;  3PHZ A;  5J2E A;  2BPF A;  5B3S C;  3NMI A;  2BPC A;  2XLE A;  4WQK A;  4QZF A;  2BBJ A;  3RJE A;  3KMI A;  3ISB A;  3IPM O;  4UAY A;  4XLP F;  1JPN A;  1LPE A;  1E85 A;  2ZHB A;  1OQC A;  1LM3 B;  1ZQC A;  4RQ3 A;  3EH1 A;  4CDA A;  8ICC A;  1ZHT A;  4Z9H A;  5A6J A;  1K05 A;  1OW7 A;  1JMS A;  1L3P A;  3FMS A;  4X4S A;  3POV A;  4XLN F;  1U6H A;  3EF2 A;  3NKD A;  4P6I C;  2B0H A;  4RWN A;  3NKU A;  3TOM A;  3N24 A;  3JYY A;  3H2V A;  4Z6C A;  1WWP A;  5BQG A;  5KYU A;  5HC9 A;  4YT5 A;  2XS8 A;  3M4B A;  5B3I A;  2ZH8 A;  2YL3 A;  1EI7 A;  2ZPA A;  3KPH A;  1ZQE A;  4OIR F;  3ABK C;  5J0O A;  3WOD F;  1D0Z A;  1CGM E;  5JSL A;  5DBC A;  5EHH A;  1M2V B;  1QZX A;  3S9O A;  4E8F A;  1ZZP A;  4QZI A;  3DAF A;  5HRB A;  4K96 A;  5CHG A;  1CPQ A;  2P66 A;  4WQL A;  1ZQL A;  4N4W A;  2BPG A;  8ICY A;  2Y3G A;  3MX3 A;  1WN0 A;  1YAU O;  3UQ0 A;  3AU6 A;  3GOD A;  2CW0 F;  3RH4 A;  4UB1 A;  3EGD A;  3LUT B;  3RF3 A;  1ZQT A;  2EWR A;  4O79 A;  4RD9 A;  5J2H A;  5JTG A;  3JT1 A;  4JUR I;  5J0X A;  4FHP A;  3C8G D;  2NRK A;  4EGW A;  4MVZ A;  3EGX B;  4UDV A;  4YMM A;  3UPS A;  5AC5 A;  1HUZ A;  4BEM J;  2YWA A;  3HJ1 A;  3GM1 A;  4MFA A;  3CQZ A;  4AT8 B;  7ICI A;  2Q66 A;  3CEX A;  4N6H A;  1ZW3 A;  1HW1 A;  2NUT B;  2P61 A;  1Z63 A;  2C04 A;  3HLZ A;  1OR3 A;  3AQL A;  1WAS A;  4P2H A;  4RQ2 A;  5A6B A;  1Q0D A;  3JPT A;  1ZQQ A;  4RQ1 A;  3B71 A;  4U5B E;  2BCQ A;  4U5C E;  2Q3T A;  5CIV A;  3O39 A;  4YT8 A;  4ER9 A;  5J0P A;  3T6G B;  4ONS A;  4XUS A;  2Q9B A;  5L0I A;  3OUY A;  3U2L A;  3JZ0 A;  1RKE A;  2WZF A;  3HW8 A;  4PHA A;  2LSE A;  1Z5Z A;  4YN0 B;  3GDX A;  2WVO A;  5JP7 A;  1JAF A;  4ANJ A;  1HW2 A;  4IWB A;  4O6Y A;  4WH5 A;  1YLM A;  3V7O A;  4DRI B;  2H8A A;  3GAN A;  4M0A A;  3TOL A;  8ICK A;  1PV3 A;  3MBG A;  1YVI A;  1ZHW A;  5CP2 A;  1BPZ A;  4RQ0 A;  4CS8 C;  1H6G A;  4RWP A;  4M2Y A;  1EA8 A;  2GDC A;  4GEH A;  3G4Z A;  3PML A;  4RPX A;  2ZXO A;  2M4E A;  2PXI A;  3QW1 A;  1HUO A;  2GWW A;  3WG7 C;  1M6T A;  4OAH A;  2JX0 A;  3MLG A;  4C7O A;  8ICG A;  4EWC A;  4YT4 A;  1EKY A;  4P9F A;  5HRL A;  5L0H A;  3SXK A;  1M2O A;  2X0C A;  1BR4 A;  7ICM A;  2FGY A;  1T01 A;  1V74 B;  3NYJ A;  4FHY A;  4C3E A;  7ICE A;  4CJG A;  2M64 A;  4KLE A;  4ATB A;  4K4G A;  2R9R B;  1NU9 C;  4XEV A;  2RSE B;  1KU2 A;  8ICT A;  4J7T A;  9ICW A;  1VLT A;  3B0Y A;  3HNK A;  3SXZ A;  5AGF A;  2ZH9 A;  1A7V A;  1OCR C;  4KM5 A;  1TV9 A;  2OKU A;  4J7Y A;  3OV7 A;  3JPQ A;  4K7B A;  1WOL A;  4JEB A;  4G7O F;  3ISC A;  1S05 A;  3LJB A;  1OCO C;  3RJG A;  3Q7L A;  3H39 A;  3H37 A;  8ICO A;  4JIO A;  2IOQ A;  4G0H A;  5DS5 A;  3MDA A;  4OAF A;  4Z6D A;  4NY8 A;  1PD1 A;  4R64 A;  5L0F A;  1FAP B;  3TUL A;  2MHR A;  3IHU A;  4LDQ A;  4D4X A;  4EBJ A;  3HJC A;  1NBB A;  4CSA A;  2QLA A;  4JC7 A;  1RPL A;  5COG A;  4JWM A;  4NLZ A;  5DB6 A;  3RJJ A;  2R7R A;  4DOB A;  1TFY A;  3C2L A;  2IUB A;  1ORY A;  3RQG A;  1HY5 A;  3NG1 A;  5CA7 A;  4GXJ A;  2GFH A;  3SZR A;  1M2V A;  9ICK A;  4K99 A;  4LZG A;  2HV7 A;  1FMW A;  1ZW2 A;  1Y6D A;  4R32 A;  4XTK A;  3R2P A;  7ICF A;  3K75 D;  3Q6M A;  2IHO A;  4IB4 A;  1O5H A;  1R5I D;  4HX0 A;  4NTA A;  1AEP A;  4PAC A;  1OCC C;  5HSW A;  4HEA J;  1Q79 A;  2M2V A;  2OU6 A;  3FVY A;  3C2M A;  5J0T A;  2A0U A;  2KSF A;  2R25 A;  2LIG A;  4XQ1 A;  4O6N A;  4NCQ A;  4LDK A;  9ICC A;  1FMV A;  3KYJ A;  5D92 A;  1NFN A;  3DE8 A;  3C7J A;  5L3Q A;  3NRH A;  3NYB A;  4MND A;  2H7B A;  1ZU5 A;  1TVA A;  3JPS A;  5T3T A;  3DM9 B;  3EGX A;  2WZL A;  4R63 A;  1NZE A;  2XL6 A;  2DR9 A;  1KDH A;  2H7V C;  2DYS C; 
#chains in the Genus database with same CATH homology
 3V72 A;  8ICL A;  4RT2 A;  3RQF A;  4AT8 A;  1BPX A;  2GWS A;  5J2D A;  3V7J A;  8ICF A;  5HR9 A;  4O5E A;  4QZD A;  9ICV A;  5CWR A;  3ISD A;  1JAJ A;  4WCW A;  2DR7 A;  5HRE A;  3RJH A;  4RWQ A;  4UB3 A;  5HRH A;  2HSB A;  4LT6 A;  4MFC A;  4NQF A;  1NO5 A;  3O10 A;  2M2W A;  4I28 A;  4KLH A;  2PBE A;  5J0Q A;  3C18 A;  4F5P A;  4KLT A;  5IIL A;  2ZH7 A;  1KNY A;  1R8A A;  2ZH3 A;  8ICV A;  9ICT A;  4NM2 A;  4I2B A;  2DR8 A;  1XSN A;  5BPC A;  3V7L A;  4ATB B;  7ICJ A;  4WC6 A;  5HRI A;  1Q78 A;  2FMP A;  2ISP A;  4R66 A;  3C5G A;  4I2D A;  4AT9 B;  1ZQW A;  1UFB A;  4LZD A;  7ICH A;  8ICB A;  9ICP A;  4M04 A;  4UBC A;  5J2E A;  2ISO A;  2BPF A;  2BPC A;  4I2G A;  7ICG A;  1UET A;  9ICU A;  3B0X A;  5J2A A;  4QZF A;  3RJE A;  2BCU A;  3ISB A;  1RZT A;  4X4Q A;  4M9N A;  4UAY A;  4I29 A;  4PGX A;  4M9L A;  4S3N A;  2ZHB A;  4UD5 A;  4YD2 A;  5J2J A;  4X4P A;  4RPZ A;  3RJK A;  2ZH6 A;  4P4M A;  4UB5 A;  3C66 A;  1ZQC A;  9ICI A;  4RQ3 A;  3HX0 A;  2JPU A;  8ICC A;  4FH3 A;  4MF2 A;  2ID1 A;  3MGI A;  9ICR A;  1K05 A;  3V7K A;  1OW7 A;  1JMS A;  1MQ3 A;  4DOA A;  8ICW A;  4X4S A;  1ZQO A;  1ZQS A;  4IQW A;  1XSP A;  5IIK A;  4FHV A;  4MFF A;  4RWN A;  4XEF A;  3WFP A;  4M9G A;  1ZQZ A;  5D46 A;  3JYY A;  4TUP A;  4Z6C A;  4IQU A;  1ZQN A;  1WWP A;  7ICK A;  1MIY A;  5J2I A;  4PPX A;  5HC9 A;  4UB4 A;  4RPY A;  4NKU A;  1WTY A;  1ZQX A;  3JPP A;  1ZQK A;  1KEJ A;  2ZH8 A;  5HHH A;  1JN3 A;  3C2K A;  1ZQE A;  4UB2 A;  3OVA A;  3HJ4 A;  3OVS A;  1XSL A;  1ZQJ A;  1MIV A;  1ZQB A;  5DDM A;  5J0O A;  3HIY A;  3C8G B;  2ZH4 A;  4X4U A;  4UBB A;  5DB8 A;  4F5O A;  4WC2 A;  4K4I A;  5DBC A;  4X4T A;  3S9O A;  4QZG A;  4E8F A;  7ICU A;  1ZZP A;  8ICA A;  3JPO A;  4QZI A;  5HRB A;  2HHP A;  1ZQF A;  5CHG A;  3HWT A;  2P66 A;  4NXZ A;  4RWO A;  4X4O A;  4WC0 A;  4I27 A;  4DOC A;  1ZQL A;  2BPG A;  8ICY A;  8ICU A;  4PHP A;  4WC1 A;  4XQ8 A;  3UQ0 A;  3AU6 A;  4AT7 B;  1TFW A;  4UD4 A;  3AU2 A;  4EP7 A;  4I2F A;  4WC3 A;  3RH4 A;  4WC7 A;  4UB1 A;  4I2A A;  2M2T A;  5IIO A;  4KLM A;  4PGY A;  4IQV A;  1ZQT A;  2DVI A;  2FMS A;  7ICP A;  9ICF A;  4NLK A;  1ZJN A;  5J2H A;  5CJ7 A;  4P4P A;  1NOM A;  5J0X A;  1OW8 A;  4FHP A;  5HRF A;  4WC4 A;  5TZV A;  3C8G D;  5DEC A;  2NRK A;  5J2G A;  2O1P A;  5BOL A;  5J2C A;  9ICX A;  3H3A A;  5IIM A;  4YMM A;  1MIW A;  3UPS A;  2RFF A;  4XEK A;  1HUZ A;  3MGH A;  5IIN A;  2YWA A;  3HJ1 A;  2IHM A;  3GM1 A;  4MFA A;  1PX5 A;  4AT8 B;  4GXK A;  7ICI A;  2Q66 A;  4KLS A;  1UEU A;  2PFO A;  3WFS C;  4M47 A;  1K40 A;  3MFN A;  4KLO A;  1R8C A;  1V4A A;  2BCV A;  4QZB A;  3AQL A;  2L6G A;  4P2H A;  4RQ2 A;  7ICO A;  4YD1 A;  3JPT A;  1ZQQ A;  4RQ1 A;  5J2B A;  1VFG A;  4WC5 A;  3B71 A;  3UXP A;  2BCQ A;  5EOZ A;  8ICP A;  5J0P A;  4X0B A;  9ICL A;  1VJ7 A;  3WFQ E;  1ZJM A;  1FA0 A;  4XA5 A;  1ZQR A;  4XUS A;  2ZHA A;  4O5C A;  3GM3 A;  4KLL A;  3OUY A;  4PGQ A;  4RQ7 A;  3TFR A;  4I2J A;  4KLU A;  4M5D A;  3LK9 A;  3RJI A;  4KLD A;  3PMN A;  3JZ0 A;  3TFS A;  1BPY A;  5F28 E;  4YCX A;  7ICL A;  3PNC A;  3HW8 A;  4RQ4 A;  5DB9 A;  4PHA A;  8ICX A;  3GDX A;  4YMN A;  2DR5 A;  4KLJ A;  4P4O A;  1ZQI A;  3GM2 A;  1K04 A;  1WOT A;  3OVB A;  4FHW A;  1ZQV A;  4M0A A;  8ICI A;  9ICM A;  4GXI A;  4RQ6 A;  1ZQA A;  5IIJ A;  8ICK A;  1PV3 A;  4F5R A;  4O9M A;  4I2I A;  5J0R A;  5CP2 A;  1BPZ A;  4RQ0 A;  4RWP A;  4M2Y A;  1BPD A;  3RH5 A;  3UXO A;  4EBK A;  2M2U A;  4QZ8 A;  5J2K A;  3PML A;  8ICN A;  4RPX A;  1ZQY A;  4WBZ A;  1MQ2 A;  8ICE A;  2KK1 A;  4QZC A;  3MBY A;  2PXI A;  1HUO A;  4YN4 A;  4FH5 A;  3UXN A;  4X4N A;  5DBA A;  3AQN A;  4X4R A;  4TUR A;  2JX0 A;  2ZH5 A;  8ICG A;  9ICS A;  5HRL A;  3RJF A;  9ICB A;  4DO9 A;  2I9G A;  8ICS A;  2Q00 A;  2ZH2 A;  7ICM A;  5HRG A;  3BRJ A;  4FHY A;  7ICE A;  9ICQ A;  4Z6F A;  4M9H A;  3L8J A;  4KLE A;  2ZH1 A;  4UAW A;  4ATB A;  4K4G A;  8ICH A;  4XEV A;  2W9M A;  3MDC A;  4F5Q A;  1UEV A;  4FO6 A;  4KLF A;  4I2C A;  8ICT A;  3U0C A;  4AT9 A;  9ICW A;  1JQR A;  3B0Y A;  3L9D A;  9ICG A;  2ZH9 A;  4WBY A;  5CB1 A;  5J0W A;  4IG8 A;  4LVS A;  5J0Y A;  1TV9 A;  2O5A A;  3LQC B;  9ICE A;  5DKW A;  3OV7 A;  3JPQ A;  5DED A;  3C5F A;  4F5N A;  1WOL A;  4RQ8 A;  4QZ9 A;  2BCS A;  3ISC A;  3RJG A;  3H39 A;  3K7D A;  3H37 A;  8ICO A;  4IQT A;  1F5A A;  4XRH A;  9ICO A;  3MDA A;  9ICH A;  7ICQ A;  8ICR A;  4Z6D A;  2DRB A;  4NY8 A;  1YLQ A;  4R64 A;  4Z6E A;  3RH6 A;  3TUL A;  7ICR A;  4X5V A;  1OU5 A;  4QZA A;  4EBJ A;  1ZQP A;  1QVX A;  4JWN A;  4K4H A;  4X0A A;  5DBB A;  8ICZ A;  1RPL A;  8ICQ A;  3UQ2 A;  3AJM A;  3H38 A;  9ICA A;  4JWM A;  4NLN A;  3U3F A;  1OW6 A;  3OGU A;  4NLZ A;  4FHX A;  1KTM A;  2LK4 A;  2BE3 A;  1ZQD A;  5J2F A;  1ZQM A;  4MF8 A;  5CR0 A;  3JPN A;  5DB6 A;  3RJJ A;  7ICV A;  1JOG A;  5BOM A;  4DOB A;  5HHI A;  1TFY A;  2L6F A;  3C2L A;  8ICM A;  4E80 A;  4KLI A;  3RQG A;  3C8G A;  5D4B A;  1KDH A;  4UAZ A;  5HRK A;  5CA7 A;  4PHD A;  4GXJ A;  4I2H A;  7ICN A;  9ICK A;  1ZQG A;  5DB7 A;  4LZG A;  3OUY B;  4R32 A;  3RQE A;  2VAN A;  5III A;  3AUO A;  5HRD A;  7ICF A;  3K75 D;  4E7X A;  3L8I A;  4I2E A;  3WFR E;  1R89 A;  3UPQ A;  4KLG A;  4NM1 A;  2PFN A;  4AT7 A;  4RQ5 A;  4TUS A;  1Q79 A;  2M2V A;  3AQM A;  1BPB A;  8ICJ A;  4NKT A;  3C2M A;  4PHE A;  5J0T A;  4TUQ A;  5F2V O;  9ICJ A;  2BCR A;  5D49 A;  7ICT A;  3AQK A;  9ICC A;  9ICN A;  4QZH A;  1ZQU A;  1BPE A;  4QZE A;  5J0S A;  5J29 A;  5J0U A;  4YMO A;  4XQ7 A;  4PH5 A;  3NYB A;  4O5K A;  1R8B A;  5DDY A;  1TVA A;  2FMQ A;  1O3U A;  3JPS A;  7ICS A;  3WFO A;  2PFQ A;  2DR9 A;  4M9J A;  3JPR A;  2L6H A;  4X4V A;  4RT3 A;  4R63 A;  4KLQ A;  2DRA A;  1ZQH A;  4R65 A;  2PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...