3JYYA

Semet linb complexed with ppi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
265
Chain Sequence
MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 93
structure length 265
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jyyA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jyyA01
5J2HA 3MGIA 3B71A 1XSLA 5DDMA 2NRKA 4F5QA 1ZQFA 8ICAA 3AQLA 8ICLA 3UQ2A 4UD5A 4AT8B 4IQWA 2DVIA 4KLOA 1TFWA 2DRBA 4RWNA 2W9MA 5CA7A 4P4OA 3C66A 5J2BA 4MF8A 1ZQKA 4RQ7A 2BCSA 3JPSA 3WFQE 4M5DA 2KK1A 4NM1A 3B0YA 9ICOA 4RQ2A 4I2CA 4FHVA 4WC6A 1K04A 2YWAA 3HJ4A 4WBZA 5D4BA 9ICNA 4MFCA 2BCRA 2ISOA 4F5NA 3RH5A 9ICXA 5J0SA 1ZQEA 9ICJA 3OUYA 3MFNA 8ICWA 4X0BA 4PH5A 7ICLA 3RJKA 4JWMA 5DDYA 4QZEA 4KLMA 1JOGA 4I2AA 5IIIA 4XQ7A 2DR7A 3WFPA 5IILA 5HHHA 4NY8A 3OVBA 8ICUA 4M47A 4RQ1A 3PMNA 1JQRA 1PV3A 4I28A 3RJEA 1UEUA 1F5AA 8ICGA 1ZQBA 5HRIA 4LZGA 8ICMA 5BOLA 2L6GA 4WCWA 3RJJA 4QZIA 1NO5A 7ICTA 1MIWA 3JPNA 4JWNA 8ICKA 4EBKA 1XSPA 3MGHA 2ZH7A 4WC4A 4RQ5A 5DBAA 3HWTA 1JN3A 4MFFA 4P2HA 4WC1A 2LK4A 5D46A 2RFFA 3H3AA 3AUOA 4UB1A 4KLSA 5CJ7A 3V7JA 1ZQSA 4R63A 3OVAA 4M9NA 3RJIA 5HRBA 4KLQA 5CWRA 3H38A 4IQVA 3HIYA 3GM3A 3L8IA 1MIYA 4F5RA 4M9HA 4UB2A 4UB3A 3HX0A 2O1PA 4QZDA 4TUPA 9ICMA 4O9MA 3JPPA 4XUSA 4X0AA 4X4TA 7ICKA 5J0XA 2L6FA 3ISBA 8ICFA 2BE3A 1OW7A 3UXOA 1K05A 1R8AA 3AQMA 7ICOA 5HRHA 3C5FA 2M2VA 1WTYA 3K75D 4LVSA 3UPQA 1KNYA 4RWOA 4YMMA 3V7LA 2PXIA 4EBJA 4KLTA 7ICFA 4K4IA 4I2FA 4RPYA 2PBEA 4Z6FA 3RH6A 4WBYA 2Q00A 5J2DA 1MIVA 1ZQVA 5J0WA 5HRGA 4KLGA 4M9JA 3O10A 2BCVA 4KLEA 4KLFA 8ICNA 3PMLA 3OGUA 3C5GA 4WC7A 1ZQAA 4DO9A 1ZQLA 8ICVA 1UETA 4RQ4A 1ZQIA 4WC3A 4RT3A 4I2EA 3UQ0A 1PX5A 4E7XA 4Z6CA 4EP7A 3RQFA 3C2LA 1ZQXA 8ICJA 3RH4A 2ZH3A 4FHXA 4K4GA 2IHMA 4UBBA 3C8GB 4AT9B 4GXKA 4R66A 1Q79A 4TUQA 3TFRA 2O5AA 3LK9A 2I9GA 1UEVA 3LQCB 2ISPA 4I2BA 4KLIA 4M9LA 4FO6A 3BRJA 1ZQMA 4PGYA 5J2FA 5DECA 4KLUA 8ICBA 2PFNA 5HRKA 4YN4A 4PHAA 1YLQA 4X4NA 1R8BA 3OV7A 7ICNA 4I2DA 9ICVA 2PFQA 8ICHA 3PNCA 8ICRA 3V72A 4RWQA 4LZDA 1BPDA 5J2KA 3UXNA 4AT8A 3ISDA 3C2MA 4F5OA 3JYYA 1ZQTA 5CHGA 4YD2A 2HHPA 1WOLA 3OVSA 2ID1A 1QVXA 5CB1A 1FA0A 5EOZA 5J0PA 1BPYA 1ZQQA 1RZTA 3H37A 3RQGA 4UBCA 1OW6A 3JPQA 2PFPA 4YMNA 9ICGA 4R32A 4Z6EA 4M0AA 5J0YA 4I2IA 3GM2A 4AT9A 5DBBA 2FMPA 4IQTA 3JPOA 2ZH8A 1TVAA 5HC9A 4PGXA 1ZQJA 7ICGA 3UXPA 3RJHA 4UAZA 5DB8A 4I2GA 7ICPA 4DOAA 3TFSA 4NQFA 4WC5A 2ZH2A 3WFSC 1KTMA 5F28E 1Q78A 5J0OA 2ZH1A 8ICZA 3WFRE 2PFOA 4R64A 4RQ6A 4ATBB 2DR5A 1ZQHA 2HSBA 4E8FA 2DRAA 1RPLA 4RQ8A 7ICHA 2ZHBA 2Q66A 4FHWA 2P66A 4E80A 4QZBA 4UB4A 4QZAA 8ICYA 4YD1A 2ZH6A 5HRLA 1ZQWA 3HW8A 1ZQRA 1ZZPA 1BPBA 4FH3A 4RPXA 5J2CA 5CR0A 1V4AA 1UFBA 5IIJA 9ICCA 5HR9A 4NLNA 4GXIA 4F5PA 9ICPA 1R8CA 5DB6A 5DB7A 2L6HA 3RJGA 8ICSA 4PHDA 9ICBA 4LT6A 4NLZA 4NXZA 4UAYA 4P4PA 9ICAA 1HUOA 1WOTA 9ICIA 4X4UA 7ICVA 3H39A 4PHEA 3RQEA 1KDHA 4XRHA 5IIMA 3OUYB 1XSNA 1ZQNA 1TV9A 1JMSA 4S3NA 4UD4A 5HREA 9ICEA 9ICRA 5J2JA 1K40A 3MBYA 4RWPA 4QZCA 4FHPA 5DKWA 2BPCA 4XEFA 4MFAA 1OU5A 5J0UA 3MDAA 1O3UA 4X4OA 4O5KA 3UPSA 2BCUA 3K7DA 2JX0A 4RQ0A 1TFYA 9ICTA 5J0TA 8ICQA 4WC0A 4KLHA 3AQNA 2M2TA 1ZQCA 1ZQZA 4RT2A 4PGQA 3AQKA 4NM2A 2ZHAA 4YCXA 4KLLA 4QZGA 1OW8A 4KLDA 5BPCA 3GDXA 3MDCA 3GM1A 3C8GD 5F2VO 1WWPA 4AT7B 4R65A 2FMQA 4RQ3A 4GXJA 1BPEA 1BPXA 5TZVA 5IINA 3S9OA 1R89A 2JPUA 7ICSA 9ICSA 1VFGA 4O5EA 5J2GA 3WFOA 4P4MA 5HHIA 9ICUA 1ZQGA 3C18A 3C8GA 4QZ8A 4PHPA 3JPRA 5J0RA 1KEJA 1MQ3A 8ICOA 7ICUA 7ICEA 5J2EA 5BOMA 2FMSA 4I29A 1ZQYA 4XEVA 4UB5A 4X5VA 4X4SA 5CP2A 3C2KA 3TULA 3JPTA 2ZH4A 9ICWA 1HUZA 2M2UA 3L8JA 4UAWA 4X4VA 9ICFA 1JAJA 4DOCA 1ZQOA 4AT7A 9ICKA 2GWSA 3AU2A 4QZFA 1MQ2A 3U3FA 5DBCA 4Z6DA 4IQUA 8ICTA 4FHYA 4TUSA 4IG8A 3JZ0A 3U0CA 3L9DA 4NKTA 5HRDA 1ZQPA 2DR8A 3RJFA 1NOMA 4QZ9A 4I2JA 2ZH9A 5J29A 7ICIA 4NKUA 1ZJNA 8ICCA 4XQ8A 1ZJMA 2DR9A 5D49A 4M2YA 4M9GA 2M2WA 4X4RA 4KLJA 8ICPA 1ZQUA 4RPZA 4I2HA 4PPXA 4MF2A 4YMOA 3V7KA 7ICQA 2BPFA 5HRFA 9ICHA 3ISCA 4WC2A 2BCQA 1VJ7A 3AJMA 4XEKA 5DEDA 5J0QA 5IIOA 5J2AA 3B0XA 3NYBA 5J2IA 4X4QA 3HJ1A 7ICJA 7ICMA 4ATBA 9ICLA 2VANA 2BPGA 9ICQA 4QZHA 4M04A 3AU6A 4X4PA 8ICXA 8ICIA 8ICEA 4NLKA 4FH5A 4K4HA 4TURA 1BPZA 5IIKA 4DOBA 4I27A 7ICRA 1ZQDA 4O5CA 5DB9A 2ZH5A 4XA5A
chains in the Genus database with same CATH superfamily
5DDMA 2GFHA 3EHNA 1ZQFA 5E3CA 3MX3A 4YT4A 4YWQA 2W9MA 2XLMA 1ZQKA 3DE9A 1HW1A 1A0BA 2J0XA 4XTKA 3RFYA 3CQZA 3S27A 1FFTC 4B6IA 4LDKA 2XM4A 4FHVA 1LPEA 4WQKA 4WBZA 3HJ4A 2CW0F 4PK4A 4MFCA 5B3SC 4F5NA 4CDVA 3M15A 1ZQEA 3OUYA 4PH5A 3C8ZA 3L1MA 2HS5A 3TD7A 5DDYA 4QZEA 1FR0A 1SF8A 1MMDA 4KNWA 4JIOA 5HHHA 2B0HA 4MTGA 1V54C 3S29A 5CI9A 4OAFA 2R7SA 2ETSA 3NWIA 2H7BA 1ZQBA 4NTFA 3LAYA 4LZGA 5DS5A 3B0UX 4E0IA 2KJGA 2L6GA 5DQZA 4QZIA 1MIWA 2QNLA 4FESA 1M6TA 1XSPA 4O79A 1XWJA 4MVUA 2P1AA 4ANJA 1JN3A 3H3AA 3TJ5A 5CHEA 2J9UA 2KC3A 1ORJA 5CJ7A 1H9GA 4M9NA 2CYDA 1Z3IX 3RJIA 1XZPA 5T1DB 3HIYA 3OWTA 4K7BA 3NYLA 2TMVP 4KM5A 3HX0A 3ABKC 2O1PA 4QZDA 4HE8D 4TUPA 2YKZA 3JPPA 2XL8A 4XUSA 4UDVA 2HV7A 4C3BA 2NUPB 1T6UA 3T4RA 7ICKA 2YEVA 3RH3A 3K66A 1OW7A 2A69F 3FAJA 1R8AA 3O39A 3AQMA 1WTYA 4PR9A 3IQ5A 1KNYA 1WASA 1QQ3A 1D1BA 1CGNA 2WVOA 2PBEA 3RH6A 4E18A 4WBYA 1I5NA 5KYUB 1FAPB 2IBFA 5JTGA 1FTSA 1ZQVA 4KLGA 4ZLDA 4M9JA 1JMWA 4XPYA 3IQTA 3OGUA 3C5GA 3G4ZA 3JCUQ 2XLOA 1UETA 4EWCA 4LLEA 4DJ9A 4EP7A 1D1AA 1T5OA 4FHXA 4K4GA 2IHMA 2DGJA 3C8GB 4AT9B 4OIPF 4D4NA 2O5AA 3OWGA 1UEVA 3LQCB 2R03A 1KU2A 5CIVA 4M9LA 5A6BA 3ER8C 1ZQMA 8ICBA 5HRKA 4CSAA 3EH2A 1R8BA 1RJ9A 3DAFA 8ICHA 1QKRA 3C63A 8ICRA 3E9VA 2ZD9A 3UXNA 4AT8A 1D0XA 3NYJA 5CHGA 3PHF2 5EOZA 5J0PA 2XL6A 3I5PA 3RQGA 4E7SA 5KYYA 4NXXA 2R7WA 1GM5A 4Z6EA 4OIRF 1I4ZA 3GM2A 2OKUA 4OINF 3JPOA 4CS8A 5KYXA 4I2GA 2ZXRA 1RKEA 3RYLA 2ZH2A 4IB4A 3WFSC 4CDAA 3MCRA 4QI2A 1OCRC 2NG1A 2ZH1A 3DXJF 2QY9A 3V5YA 3SYNA 4ATBB 3VF0A 4U9EA 2NPUA 1JRAA 2GA0A 1ZYRF 3W2VA 1Z6AA 1RPLA 1C03A 3GEHA 2W4MA 4NXUA 4K96A 3PCVA 4P6IC 3GEIA 4BEMJ 1ZQWA 3HW8A 4RPXA 5J2CA 4D4XA 1GQAA 1UFBA 4NXWA 4NLNA 4JLZA 5JP7A 1QZXA 5DB7A 3FAPB 1HE1A 2YLDA 2UUIA 4NLZA 4NXZA 4UAYA 3B0VC 9ICAA 1HUOA 4JURI 1VK5A 2Y3DA 4M63A 9ICIA 4Q7CA 1RXQA 4Q4ZF 4BJ1A 2EILC 4PHEA 4BEJA 2L7AA 3OUYB 1XSNA 3VYWA 4KB6A 5HREA 9ICEA 5COGA 1E86A 5J2JA 2RSEB 4DRJB 1Q0DA 4Z9HA 4G0HA 4ZLCA 1H6GA 4JCHA 2X0CA 3MDAA 4C7OA 1O3UA 3K7DA 2P61A 2WVQA 4PJLA 4KLHA 5L0DA 1NSGB 1ZQZA 2CNWD 1PCXA 4NM2A 4QZGA 4IAQA 1MMNA 4AT7B 4KC9A 4GXJA 2J7PD 2L81A 3RVYA 5TZVA 5IINA 1R5ID 1IW7F 2DYSC 3DM9B 4K9BA 1S7ZA 4YJWA 3ZTMA 5L0CA 1LI7A 1MNDA 4I3MA 9ICSA 5DLJA 2QLAA 3U9MA 5J2GA 3C7JA 3SXMA 1ZVZA 3R7CA 5J0RA 1KEJA 5BOMA 2NUTA 2FMSA 4I29A 1JAFA 3GEEA 4UB5A 256BA 1A7EA 3JPTA 9ICWA 1BDJB 4BJ6A 4EEBA 4UAWA 4X4VA 9ICFA 1JAJA 2YVKA 4DOCA 9ICKA 3UGOA 4QZFA 3U3FA 3HNKA 2CCYA 2Q9AA 1Z7Qc 5DBCA 1FNTc 8ICTA 5EK0A 4IG8A 3I5QA 4NCQA 1ZQPA 4MS2A 5E33A 3TJ6A 1YYXA 4I2JA 5J29A 4CS9A 8ICCA 4XQ8A 1M56C 1T6QA 1OQCA 3RIPA 4KLJA 2Z15A 4IGGA 1ZQUA 4I2HA 4XJEA 2QUPA 2YLGA 3V7KA 7ICQA 3DM5A 1ZHWA 5DEDA 4O7GA 5J0QA 4H54A 5J2AA 3LS0A 3NYBA 5J2IA 3EG9B 2A1DD 7ICMA 9ICLA 2VANA 2BPGA 3CAXA 3QVZA 4NLKA 3POVA 2R7XA 4TURA 4JRZA 2XLVA 5EGYA 2LD6A 2ZH5A 1RJ9B 3T6JA 3MGIA 2A0BA 4CX9A 1CGME 2NRKA 8ICAA 5A6JA 3HTKC 3NKEA 2XXAA 4OAIZ 3UQ2A 4AT8B 4KLOA 2DVIA 2DYRC 1NG1A 3S84A 2BBHA 5CA7A 2OEVA 1PD1A 1LIHA 2BCSA 3WFQE 1UG7A 2KK1A 5AGFA 4NM1A 3B0YA 5T3TA 9ICOA 5KYYB 4I2CA 4WC6A 1EQ1A 4N6HA 5D4BA 3JYHA 2BCRA 4DRHB 5TJ5E 2ISOA 1ZHYA 2WZLA 2NSFA 1BZ4A 5KYXB 3AOUA 3F46A 4ONSA 3PMRA 4WGYA 1RKEB 8ICWA 5L0HA 4DXWA 4I2AA 3V5XA 3FHDA 4XQ7A 4JEBA 4DBQA 1NU7D 5IILA 2AP3A 1GS9A 3E70C 3W8HA 4M47A 1OXBA 4RQ1A 2A68F 1VB5A 2Q9BA 4EKWA 2J9BA 3L0IA 4JE9A 3ZDLA 1OXKA 4O6YA 4WJ0A 8ICGA 3CEXA 3DMDA 8ICMA 2R05A 3KH2A 5BOLA 3VM6A 4WCWA 3T9OA 4G78A 3JPNA 3MBGA 3SZRA 3MGHA 3U8VA 4DBRA 5DBAA 1YAUO 3QVYA 2LK4A 5D46A 3AUOA 1ZHXA 4KLSA 2J45A 4JTAB 3OVAA 3ATPA 2MWQA 3O55A 2I8BA 5HRBA 3W4YA 4IQVA 3ZWIA 4M9HA 1MIYA 4QDLA 4MVMA 2HJMA 3KKBA 4O9MA 2OCCC 2L6FA 8ICFA 4MTFA 4I1MA 4J7TA 1HE9A 1K05A 1YA7O 2W4BA 2UUHA 4HFFB 5IY5C 4C7OB 3C5FA 3LLKA 4LVSA 5JSLA 3UPQA 1LE2A 3FXHA 4YMMA 3V7LA 1WATA 3DD7A 2PXIA 4EBJA 2R7OA 1OR2A 4K4IA 4K8VA 4RPYA 4Z6FA 5JT4A 2Y3BA 3QW1A 4RBNA 5J0WA 2W45A 2G62A 1O5HA 1AVOB 4JC7A 4WH5A 4AE4A 3EGDA 1VYIA 8ICVA 3QW0A 1MMAA 1PX5A 2AU5A 2PX3A 4H4KC 3RH4A 4DRIB 1SYQA 4F4BA 3MYFA 3B29A 1Q79A 3TFRA 3S90A 2PFDA 3Q6NA 4YK5A 2ISPA 1NU9C 2GWWA 4JEAA 5KYWA 4FO6A 3BRJA 4K0DA 4N6CA 4YN4A 2R7TA 4X4NA 7ICNA 9ICVA 2PFQA 5DQTA 5B1BC 4XLNF 4RWQA 3NDBB 4OD4A 3C2MA 4YD2A 1WOLA 2ID1A 2YL0A 3ABMC 4U5FE 3WG7C 5E2QA 3S0XA 5T3WA 2MHRA 2FAPB 4AL1A 9ICGA 4R32A 4LERA 4M0AA 2J46A 4X0RA 4YN0B 5B3QA 2FMPA 4IQTA 1TVAA 1BR1A 4CIPA 3K6BA 1ZQJA 7ICGA 3UXPA 3RJHA 1AUEA 4UAZA 7ICPA 4WC5A 2WZGA 3JRTA 8ICZA 5HV9A 1VTMP 2DR5A 1TFOB 3K1IC 4E8FA 2DRAA 4RQ8A 7ICHA 2ZHBA 2P66A 1Q0GA 1G8XA 2LP4A 3M4BA 5HRLA 3HJCA 2ICWG 4Q5SF 5KYNA 1C02A 5IIJA 9ICCA 5HR9A 3JCFA 4GXIA 3F47A 4YT2A 1FFHA 5BUOA 4CSAC 8ICSA 3EFOA 3U9JA 4IWBA 2JD3A 1ST6A 4P4PA 3GWLA 2BBJA 3GWNA 3DWWA 3WHNA 2HN2A 3N24A 1FMVA 3TK0A 7ICVA 3RQEA 1KDHA 4XRHA 2MYSA 3K1IA 4CS7A 1JMSA 2VCAA 4JTDB 4S3NA 4XPWA 3O6XA 1GGQA 4FHPA 2GAQA 2BPCA 2EPMX 4NY3A 3SXKA 4XEFA 4CS8C 1H7IA 4X4OA 4O5KA 3M1CB 1NBBA 4RQ0A 9ICTA 4EHPA 8ICQA 4WC0A 3Q7LA 3AQNA 3ABLC 1HY5A 2FCLA 2XLDA 5BPCA 2YHSA 2BE5F 3B0PA 4CJGA 3IHUA 5F2VO 4XQ1A 1TWGA 3I4UA 3TOLA 2KYHA 1BPXA 3H2VA 1R89A 3VRCA 3GORA 5L3QA 1G4WR 4K97A 4I1OB 2KQ9A 4O5EA 2CNWA 3RKOF 3WFOA 3EZIA 3EGXA 4IJJA 5D62A 5B1AC 2B51A 5HHIA 2EWRA 3C18A 1LVKA 4I44A 3T6BA 2J7PA 1RKCA 4XEVA 5DS4A 4X4SA 1M2VA 5CP2A 3TULA 2ZH4A 4FWVA 2IYLD 1RMVA 1ZQOA 4HX0A 1A41A 1BBHA 4Z6DA 4HEAJ 4TUSA 4NKTA 2DR8A 4NKUA 5F5FA 2DR9A 2M2WA 1Z5ZA 4LACB 4RDAA 1R4TA 4AE4B 3JTLO 4RPZA 3EGDB 2HSQA 2IXMA 1EI7A 3ISCA 5COFA 1VJ7A 3AG3C 3AJMA 2B56A 1HW2A 3JSEO 1SZIA 4X4QA 3ITFA 3HJ1A 7ICJA 2HFIA 3TQOA 4QZHA 4M04A 3AU6A 3LEOA 8ICEA 1NFOA 5KYWB 1LM3B 3ZSUA 1E2XA 4K4HA 7ICRA 3DAGA 2KGOA 4XA5A 4GYTA 1YZCA 3AG2C 1XSLA 4F5QA 8ICLA 3FOPA 2A6HF 4IQWA 1TFWA 2DRBA 4RWNA 4P4OA 3C66A 4AX2A 2L9JA 4BJ6C 4M5DA 1EA8A 4NTAA 3MLGA 4RQ2A 4MNDA 2OEXA 1Q0KA 9ICNA 3X2QC 3KYJA 4EIYA 2Q9CA 3RH5A 9ICXA 4YL1A 1GPJA 9ICJA 5CFUA 4CS9C 3HNLA 1ZW2A 3RJKA 4JWMA 1D0ZA 3M79A 3DE8A 5IIIA 4EUKB 4DVYP 4KBLA 3K33A 4FO1A 3OVBA 2HV6A 8ICUA 2IHOA 3PMNA 2PF4E 1JQRA 2D4UA 3RJEA 3FVYA 1UEUA 5DS6A 5AC5A 5HRIA 2EINC 5B3PA 5B3IA 5L3VA 3T6GB 2ASRA 7ICTA 1BR2A 1HMOA 2IUBA 1ZHZA 1ORYA 4JWNA 8ICKA 2KSFA 2ZH7A 3SP1A 2XRHA 3U5SA 4WC4A 2YLIA 4WC1A 3CSKA 4LDQA 1YVIA 4A2NB 4J32B 2AWCA 3LNMB 2R7VA 1T9KA 5CWRA 4F5RA 3L8IA 3UMHA 1OKKD 1MQVA 2CGEA 4UB3A 1F1MA 2OJED 1A7DA 2G3VA 4X0AA 2DB4A 4PFOA 4PJMA 3KYIA 4EV6A 3UXOA 2VB6A 4BG0A 4CDYA 5HRHA 1WN0A 4K99A 2VC9A 4PFPA 4RWOA 4OIQF 4JW1A 7ICFA 5L0FA 3KMIA 4LEYA 1YARO 3W8IA 3ASNC 3ZQYA 1MIVA 5BQIA 4KLEA 1L3PA 3IEEA 4PJNA 4MW3A 3PMLA 2BL2A 2M4EA 4WC7A 4N4WA 3NMKA 4YL3A 4DO9A 5DVWA 4WC3A 4ULWA 3UQ0A 4E7XA 2FGYA 3C2LA 4EBBA 1ZQXA 8ICJA 3EGXB 1MNEA 4UBBA 4GXKA 4MVOA 1Y6DA 1YA9A 4DOZA 4WGZA 4KLIA 3MYIA 4KLUA 5DECA 4IRUA 3NVOA 2KW3C 4PHAA 5L0GA 1YJGA 3FMSA 1M2VB 4I2DA 4P9TA 3AGTA 1SMYF 1BPDA 3RF3A 5J2KA 4O6AA 3WODF 4F5OA 3JYYA 1ZQTA 3DJUB 4OIOF 2HHPA 1QVXA 5CB1A 2ZXPA 1BPYA 3W2WA 2Y69C 4UBCA 1OW6A 4O6NA 3JPQA 2ZPAA 1CPQA 4AT9A 5DBBA 1E85A 3M4CA 4XPXA 4PGXA 4N7RA 1H9TA 2IOQA 2H7VC 2Q3TA 5JVEA 3NKUA 4WABA 3KL4A 4DOAA 2V26A 3ZG1A 4OAHA 4MVQA 3PDMP 1Q78A 4GEHA 4BPMA 2PFOA 4R64A 4RQ6A 4FX5A 4JKVA 4U5BE 4MVSA 2FFHA 1ZQHA 2WL8A 5CFSA 2Q66A 1DOVA 4FHWA 2YQYA 4QZAA 1LI5A 4YD1A 8ICYA 4JTCB 2R02A 2IXPA 5JRAA 1ZQRA 1BPBA 4FH3A 2YL7A 4BJ5A 4NTBA 3EHMA 5HSWA 5JLIA 3WAQA 5L0JA 3HLZA 1AEPA 4PHDA 4LT6A 3C62A 5A6AA 1WOTA 2VASA 4CJOA 4L6RA 3H65A 3NMJA 4EGWA 1TV9A 3JT1A 4AK9A 2QE9A 2G3KA 9ICRA 1K40A 2O9XA 3EPVA 3MBYA 5EHHA 4QZCA 3EF2A 1OU5A 5J0UA 3N2ZB 2JX0A 4LEWA 3QMKA 1EKYA 1TWHA 5J0TA 1G5ZA 2NUTB 3PHZA 1T6IA 4P9FA 3G50A 2M2TA 3SEOA 4RT2A 2ZHAA 1Z63A 4YCXA 3NG1A 1I4YA 3MDCA 2VH3A 1D1CA 3GM1A 3C8GD 2RD9A 4FAPB 2XL4A 2HMQA 4R65A 2BC5A 3UNGC 3N0TA 5CFTA 3G4XA 2QTVA 3S9OA 7ICSA 4E7ZA 3NKDA 1ZW3A 3ASOC 3V7OA 2PX0A 5D61A 4P4MA 3QTHA 1ZU5A 4C3EA 2IM8A 1ZQGA 9ICUA 4W8KA 4QZ8A 3AG1C 2OU6A 3JPRA 1MQ3A 8ICOA 7ICUA 7ICEA 4RD9A 1M57C 1O87A 1ZQYA 4OAGA 3Q7GA 4X5VA 3KPHA 3C2KA 4YT5A 2AWYA 4O69A 1YYJA 3UMKA 4AT7A 2W9YA 3QZCA 2GA9D 2GWSA 1MQ2A 2H7OA 1L7CA 4K9AA 4MW8A 4IQUA 4PACA 3JZ0A 3U0CA 3L9DA 1G4US 1NOMA 4QZ9A 1LS1A 2M64A 2R7QA 1ZJNA 1ZJMA 1HMDA 4U5EE 5D49A 2VCCA 2XXAB 4M2YA 4M9GA 8ICPA 2LCHA 4O6MA 4PPXA 2WZFA 4YT8A 2BPFA 9ICHA 2OQMA 4WC2A 1ZHTA 1W2WA 2LFDA 3LESA 4JCZA 4XEKA 1TWAA 3X1OA 3DKAA 4J30B 4HFKB 2AVKA 3FDQA 4X4PA 8ICIA 4LEZA 1TQGA 4JJFA 4FH5A 4E0HA 4E17A 1BPZA 5IIKA 4DOBA 1LE4A 5DB9A 1VLTA 5J2HA 3B71A 2EPKX 3AQLA 1WGWA 4UD5A 1BR4A 2R25A 2J9VA 5J2BA 4MF8A 1E83A 4RQ7A 3JPSA 3EH1A 3Q6MA 1K04A 2YWAA 3EG9A 3U8PA 3JSZA 1CGOA 5L0IA 1VOMA 3IQCA 1OCOC 3ER9B 3DZAA 5D63A 3ERCC 2Y3HA 5J0SA 4WOYA 3MFNA 4ULVA 5E3AA 2IXNA 4X0BA 7ICLA 3GODA 4MVZA 2XSEA 3UGPA 4KLMA 1JOGA 1TFKB 3H2UA 4IAOA 4CBEA 2DR7A 3WFPA 3RVZA 4NY8A 1DOWA 2HZ8A 3AQBA 5A69A 3NMIA 1ORSC 1PV3A 4I28A 3TOMA 2LSEA 3LUTB 4Z9IA 4O68A 2ZXOA 1F5AA 4W8PA 1RCPA 2A0UA 3EJNA 3RJJA 1A7VA 1NO5A 3U2MA 1IZMA 2XM0A 4G7ZF 4EBKA 2B0JA 2HKVA 4RQ5A 2P7VA 3HWTA 4P2HA 4MFFA 1TKNA 2RFFA 3V5ZA 4UB1A 3V7JA 1ZQSA 4R63A 2C03A 3K1HA 5A6KA 5COMA 4KLQA 3H38A 3UMIA 3GM3A 4UB2A 4K98A 3DJNB 1MMGA 3SXZA 2A6EF 3OEOA 9ICMA 2OOCA 2XS8A 3A11A 2LIGA 4K1OA 4X4TA 3ZC4A 5J0XA 3ISBA 3VAYA 2BE3A 1YDIA 1Q0MA 2LQGA 2HMZA 7ICOA 2WVNA 4MKPA 2M2VA 1VMAA 3K75D 4XWJA 1T01A 2Y39A 3EQLF 1S05A 4KLTA 1OKKA 4I2FA 2I15A 2XLEA 2E87A 4JZAA 5JS5A 2Q00A 5J2DA 2HJ3A 4C3DA 1Z23A 3B9QA 5HRGA 4KI2A 1TR2A 2R9RB 3O10A 4NXTA 5FZTA 1JPNA 2BCVA 3ECSA 4KLFA 8ICNA 5A6BD 1ZQAA 1U6HA 1ZQLA 2R7UA 4RQ4A 3A9CA 1ZQIA 4RT3A 4I2EA 1JPJA 3ZQVA 4Z6CA 2VCBA 3RW0A 3RQFA 4U5DE 2HUJA 2ZH3A 1D0YA 4J7YA 4R66A 1J8MF 4TUQA 3LK9A 3HKKA 2I9GA 4I2BA 4EEDA 2XLWA 3DI5A 4PGYA 5J2FA 2PFNA 2C04A 3SXYA 1YLQA 3LJBA 3OV7A 2P0NA 3CK6A 4DVZA 5BQHA 3HNIA 2PNOA 3PNCA 3NRHA 3V72A 4OD5A 4LZDA 4YL0A 2GDCA 2PP4A 3ISDA 4GQHA 1YLMA 1LKXA 3OVSA 4QI0A 1FA0A 1ZQQA 1RZTA 3AG4C 3H37A 2Q7RA 1M2OA 2Q4FA 2PFPA 4YMNA 2GAFD 1U89A 5J0YA 1B68A 4I2IA 1TWCA 5AC4A 2ZXWC 2J0WA 3ZIBA 2ZH8A 3IQ6A 5HC9A 4ER9A 5DB8A 2DI3A 3EFOB 3TFSA 4NQFA 1KTMA 5F28E 5J0OA 4U9DA 3WFRE 2Y3GA 3U2LA 4LLCA 4O67A 3U3BA 1QPUA 3FOOA 4N06A 2YL3A 4WQLA 2HSBA 3SNHA 4PJJA 3S28A 4E80A 2XLHA 4QZBA 4UB4A 2ZH6A 1NFNA 1JR8A 4XLPF 1ZZPA 5CR0A 3GANA 1V4AA 4IARA 4F5PA 9ICPA 1R8CA 2J8WA 5DB6A 2HN1A 2L6HA 3RJGA 4NC3A 2P6VA 9ICBA 1Y4CA 1NZEA 3AGUA 5BQGA 4G7OF 4G7HF 4MVRA 3NYMA 2IXOA 1QSPA 2EIKC 2J9WA 4X4UA 1XZQA 3HNJA 4LDRA 3UR3C 3J06A 2NSGA 3H39A 3BEHA 4MQ9F 5IIMA 1VYKA 3LS1A 1ZQNA 4UD4A 2NUPA 2EPLX 3LLIA 4RWPA 4BJTA 5DKWA 3L34A 3LNRA 4AL0A 1U0BB 4MFAA 2H8AA 1N1CA 3AQCA 3UPSA 2BCUA 2LFFA 1TFYA 3EZHA 2XS1A 1CPRA 1ZQCA 2KNHA 5CI8A 4PGQA 3AQKA 2WB7A 4KLLA 1OW8A 4KLDA 5KYUA 1SR2A 3GDXA 2EIMC 1NLXA 1YZAA 1WWPA 1APCA 1LS4A 4JJGA 2FMQA 4RQ3A 1BPEA 3CZ6A 1V55C 2OG2A 2JPUA 1VLSA 2X51A 4BJ5C 5K0IA 2EPNA 1VFGA 2D5RB 2EPOA 5FCLA 1OCZC 3C8GA 2R7RA 4PHPA 5JUAA 5D91A 2V3CC 5J2EA 4KNVA 2F22A 3US6A 1C17M 1J8YF 3LEVA 1HUZA 2M2UA 3L8JA 2B4VA 4A4AA 3AU2A 4MTOA 4U5HA 4I0UA 4NXVA 1V74B 1Q0FA 3ZVRA 1ZU4A 4FHYA 1OR3A 2OJQA 5HRDA 4CIHA 3RJFA 2ZH9A 4JLXA 7ICIA 3ZTZA 4JVSA 4Z9JA 3JRMO 2EIJC 4X4RA 4U5GA 2YRFA 4U5CE 4MF2A 4YMOA 4LEVA 5HRFA 1FMWA 2BCQA 3IPMO 3OA1A 5IIOA 3B0XA 2CDQA 2YL1A 2YZSA 4ATBA 9ICQA 1E84A 5GPGB 1QLEC 8ICXA 3R2PA 4I27A 1OCCC 5F5HA 1PD0A 1ZQDA 4O5CA 5D92A
chains in the Genus database with same CATH topology
5J2HA 3MGIA 3B71A 1XSLA 5DDMA 2NRKA 4F5QA 1ZQFA 8ICAA 3AQLA 8ICLA 3UQ2A 4UD5A 4AT8B 4IQWA 2DVIA 4KLOA 1TFWA 2DRBA 4RWNA 2W9MA 5CA7A 4P4OA 3C66A 5J2BA 4MF8A 1ZQKA 4RQ7A 2BCSA 3JPSA 3WFQE 4M5DA 2KK1A 4NM1A 3B0YA 9ICOA 4RQ2A 4I2CA 4FHVA 4WC6A 1K04A 2YWAA 3HJ4A 4WBZA 5D4BA 9ICNA 4MFCA 2BCRA 2ISOA 4F5NA 3RH5A 9ICXA 5J0SA 1ZQEA 9ICJA 3OUYA 3MFNA 8ICWA 4X0BA 4PH5A 7ICLA 3RJKA 4JWMA 5DDYA 4QZEA 4KLMA 1JOGA 4I2AA 5IIIA 4XQ7A 2DR7A 3WFPA 5IILA 5HHHA 4NY8A 3OVBA 8ICUA 4M47A 4RQ1A 3PMNA 1JQRA 1PV3A 4I28A 3RJEA 1UEUA 1F5AA 8ICGA 1ZQBA 5HRIA 4LZGA 8ICMA 5BOLA 2L6GA 4WCWA 3RJJA 4QZIA 1NO5A 7ICTA 1MIWA 3JPNA 4JWNA 8ICKA 4EBKA 1XSPA 3MGHA 2ZH7A 4WC4A 4RQ5A 5DBAA 3HWTA 1JN3A 4MFFA 4P2HA 4WC1A 2LK4A 5D46A 2RFFA 3H3AA 3AUOA 4UB1A 4KLSA 5CJ7A 3V7JA 1ZQSA 4R63A 3OVAA 4M9NA 3RJIA 5HRBA 4KLQA 5CWRA 3H38A 4IQVA 3HIYA 3GM3A 3L8IA 1MIYA 4F5RA 4M9HA 4UB2A 4UB3A 3HX0A 2O1PA 4QZDA 4TUPA 9ICMA 4O9MA 3JPPA 4XUSA 4X0AA 4X4TA 7ICKA 5J0XA 2L6FA 3ISBA 8ICFA 2BE3A 1OW7A 3UXOA 1K05A 1R8AA 3AQMA 7ICOA 5HRHA 3C5FA 2M2VA 1WTYA 3K75D 4LVSA 3UPQA 1KNYA 4RWOA 4YMMA 3V7LA 2PXIA 4EBJA 4KLTA 7ICFA 4K4IA 4I2FA 4RPYA 2PBEA 4Z6FA 3RH6A 4WBYA 2Q00A 5J2DA 1MIVA 1ZQVA 5J0WA 5HRGA 4KLGA 4M9JA 3O10A 2BCVA 4KLEA 4KLFA 8ICNA 3PMLA 3OGUA 3C5GA 4WC7A 1ZQAA 4DO9A 1ZQLA 8ICVA 1UETA 4RQ4A 1ZQIA 4WC3A 4RT3A 4I2EA 3UQ0A 1PX5A 4E7XA 4Z6CA 4EP7A 3RQFA 3C2LA 1ZQXA 8ICJA 3RH4A 2ZH3A 4FHXA 4K4GA 2IHMA 4UBBA 3C8GB 4AT9B 4GXKA 4R66A 1Q79A 4TUQA 3TFRA 2O5AA 3LK9A 2I9GA 1UEVA 3LQCB 2ISPA 4I2BA 4KLIA 4M9LA 4FO6A 3BRJA 1ZQMA 4PGYA 5J2FA 5DECA 4KLUA 8ICBA 2PFNA 5HRKA 4YN4A 4PHAA 1YLQA 4X4NA 1R8BA 3OV7A 7ICNA 4I2DA 9ICVA 2PFQA 8ICHA 3PNCA 8ICRA 3V72A 4RWQA 4LZDA 1BPDA 5J2KA 3UXNA 4AT8A 3ISDA 3C2MA 4F5OA 3JYYA 1ZQTA 5CHGA 4YD2A 2HHPA 1WOLA 3OVSA 2ID1A 1QVXA 5CB1A 1FA0A 5EOZA 5J0PA 1BPYA 1ZQQA 1RZTA 3H37A 3RQGA 4UBCA 1OW6A 3JPQA 2PFPA 4YMNA 9ICGA 4R32A 4Z6EA 4M0AA 5J0YA 4I2IA 3GM2A 4AT9A 5DBBA 2FMPA 4IQTA 3JPOA 2ZH8A 1TVAA 5HC9A 4PGXA 1ZQJA 7ICGA 3UXPA 3RJHA 4UAZA 5DB8A 4I2GA 7ICPA 4DOAA 3TFSA 4NQFA 4WC5A 2ZH2A 3WFSC 1KTMA 5F28E 1Q78A 5J0OA 2ZH1A 8ICZA 3WFRE 2PFOA 4R64A 4RQ6A 4ATBB 2DR5A 1ZQHA 2HSBA 4E8FA 2DRAA 1RPLA 4RQ8A 7ICHA 2ZHBA 2Q66A 4FHWA 2P66A 4E80A 4QZBA 4UB4A 4QZAA 8ICYA 4YD1A 2ZH6A 5HRLA 1ZQWA 3HW8A 1ZQRA 1ZZPA 1BPBA 4FH3A 4RPXA 5J2CA 5CR0A 1V4AA 1UFBA 5IIJA 9ICCA 5HR9A 4NLNA 4GXIA 4F5PA 9ICPA 1R8CA 5DB6A 5DB7A 2L6HA 3RJGA 8ICSA 4PHDA 9ICBA 4LT6A 4NLZA 4NXZA 4UAYA 4P4PA 9ICAA 1HUOA 1WOTA 9ICIA 4X4UA 7ICVA 3H39A 4PHEA 3RQEA 1KDHA 4XRHA 5IIMA 3OUYB 1XSNA 1ZQNA 1TV9A 1JMSA 4S3NA 4UD4A 5HREA 9ICEA 9ICRA 5J2JA 1K40A 3MBYA 4RWPA 4QZCA 4FHPA 5DKWA 2BPCA 4XEFA 4MFAA 1OU5A 5J0UA 3MDAA 1O3UA 4X4OA 4O5KA 3UPSA 2BCUA 3K7DA 2JX0A 4RQ0A 1TFYA 9ICTA 5J0TA 8ICQA 4WC0A 4KLHA 3AQNA 2M2TA 1ZQCA 1ZQZA 4RT2A 4PGQA 3AQKA 4NM2A 2ZHAA 4YCXA 4KLLA 4QZGA 1OW8A 4KLDA 5BPCA 3GDXA 3MDCA 3GM1A 3C8GD 5F2VO 1WWPA 4AT7B 4R65A 2FMQA 4RQ3A 4GXJA 1BPEA 1BPXA 5TZVA 5IINA 3S9OA 1R89A 2JPUA 7ICSA 9ICSA 1VFGA 4O5EA 5J2GA 3WFOA 4P4MA 5HHIA 9ICUA 1ZQGA 3C18A 3C8GA 4QZ8A 4PHPA 3JPRA 5J0RA 1KEJA 1MQ3A 8ICOA 7ICUA 7ICEA 5J2EA 5BOMA 2FMSA 4I29A 1ZQYA 4XEVA 4UB5A 4X5VA 4X4SA 5CP2A 3C2KA 3TULA 3JPTA 2ZH4A 9ICWA 1HUZA 2M2UA 3L8JA 4UAWA 4X4VA 9ICFA 1JAJA 4DOCA 1ZQOA 4AT7A 9ICKA 2GWSA 3AU2A 4QZFA 1MQ2A 3U3FA 5DBCA 4Z6DA 4IQUA 8ICTA 4FHYA 4TUSA 4IG8A 3JZ0A 3U0CA 3L9DA 4NKTA 5HRDA 1ZQPA 2DR8A 3RJFA 1NOMA 4QZ9A 4I2JA 2ZH9A 5J29A 7ICIA 4NKUA 1ZJNA 8ICCA 4XQ8A 1ZJMA 2DR9A 5D49A 4M2YA 4M9GA 2M2WA 4X4RA 4KLJA 8ICPA 1ZQUA 4RPZA 4I2HA 4PPXA 4MF2A 4YMOA 3V7KA 7ICQA 2BPFA 5HRFA 9ICHA 3ISCA 4WC2A 2BCQA 1VJ7A 3AJMA 4XEKA 5DEDA 5J0QA 5IIOA 5J2AA 3B0XA 3NYBA 5J2IA 4X4QA 3HJ1A 7ICJA 7ICMA 4ATBA 9ICLA 2VANA 2BPGA 9ICQA 4QZHA 4M04A 3AU6A 4X4PA 8ICXA 8ICIA 8ICEA 4NLKA 4FH5A 4K4HA 4TURA 1BPZA 5IIKA 4DOBA 4I27A 7ICRA 1ZQDA 4O5CA 5DB9A 2ZH5A 4XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2H A;  3MGI A;  3B71 A;  1XSL A;  5DDM A;  2NRK A;  4F5Q A;  1ZQF A;  8ICA A;  3AQL A;  8ICL A;  3UQ2 A;  4UD5 A;  4AT8 B;  4IQW A;  2DVI A;  4KLO A;  1TFW A;  2DRB A;  4RWN A;  2W9M A;  5CA7 A;  4P4O A;  3C66 A;  5J2B A;  4MF8 A;  1ZQK A;  4RQ7 A;  2BCS A;  3JPS A;  3WFQ E;  4M5D A;  2KK1 A;  4NM1 A;  3B0Y A;  9ICO A;  4RQ2 A;  4I2C A;  4FHV A;  4WC6 A;  1K04 A;  2YWA A;  3HJ4 A;  4WBZ A;  5D4B A;  9ICN A;  4MFC A;  2BCR A;  2ISO A;  4F5N A;  3RH5 A;  9ICX A;  5J0S A;  1ZQE A;  9ICJ A;  3OUY A;  3MFN A;  8ICW A;  4X0B A;  4PH5 A;  7ICL A;  3RJK A;  4JWM A;  5DDY A;  4QZE A;  4KLM A;  1JOG A;  4I2A A;  5III A;  4XQ7 A;  2DR7 A;  3WFP A;  5IIL A;  5HHH A;  4NY8 A;  3OVB A;  8ICU A;  4M47 A;  4RQ1 A;  3PMN A;  1JQR A;  1PV3 A;  4I28 A;  3RJE A;  1UEU A;  1F5A A;  8ICG A;  1ZQB A;  5HRI A;  4LZG A;  8ICM A;  5BOL A;  2L6G A;  4WCW A;  3RJJ A;  4QZI A;  1NO5 A;  7ICT A;  1MIW A;  3JPN A;  4JWN A;  8ICK A;  4EBK A;  1XSP A;  3MGH A;  2ZH7 A;  4WC4 A;  4RQ5 A;  5DBA A;  3HWT A;  1JN3 A;  4MFF A;  4P2H A;  4WC1 A;  2LK4 A;  5D46 A;  2RFF A;  3H3A A;  3AUO A;  4UB1 A;  4KLS A;  5CJ7 A;  3V7J A;  1ZQS A;  4R63 A;  3OVA A;  4M9N A;  3RJI A;  5HRB A;  4KLQ A;  5CWR A;  3H38 A;  4IQV A;  3HIY A;  3GM3 A;  3L8I A;  1MIY A;  4F5R A;  4M9H A;  4UB2 A;  4UB3 A;  3HX0 A;  2O1P A;  4QZD A;  4TUP A;  9ICM A;  4O9M A;  3JPP A;  4XUS A;  4X0A A;  4X4T A;  7ICK A;  5J0X A;  2L6F A;  3ISB A;  8ICF A;  2BE3 A;  1OW7 A;  3UXO A;  1K05 A;  1R8A A;  3AQM A;  7ICO A;  5HRH A;  3C5F A;  2M2V A;  1WTY A;  3K75 D;  4LVS A;  3UPQ A;  1KNY A;  4RWO A;  4YMM A;  3V7L A;  2PXI A;  4EBJ A;  4KLT A;  7ICF A;  4K4I A;  4I2F A;  4RPY A;  2PBE A;  4Z6F A;  3RH6 A;  4WBY A;  2Q00 A;  5J2D A;  1MIV A;  1ZQV A;  5J0W A;  5HRG A;  4KLG A;  4M9J A;  3O10 A;  2BCV A;  4KLE A;  4KLF A;  8ICN A;  3PML A;  3OGU A;  3C5G A;  4WC7 A;  1ZQA A;  4DO9 A;  1ZQL A;  8ICV A;  1UET A;  4RQ4 A;  1ZQI A;  4WC3 A;  4RT3 A;  4I2E A;  3UQ0 A;  1PX5 A;  4E7X A;  4Z6C A;  4EP7 A;  3RQF A;  3C2L A;  1ZQX A;  8ICJ A;  3RH4 A;  2ZH3 A;  4FHX A;  4K4G A;  2IHM A;  4UBB A;  3C8G B;  4AT9 B;  4GXK A;  4R66 A;  1Q79 A;  4TUQ A;  3TFR A;  2O5A A;  3LK9 A;  2I9G A;  1UEV A;  3LQC B;  2ISP A;  4I2B A;  4KLI A;  4M9L A;  4FO6 A;  3BRJ A;  1ZQM A;  4PGY A;  5J2F A;  5DEC A;  4KLU A;  8ICB A;  2PFN A;  5HRK A;  4YN4 A;  4PHA A;  1YLQ A;  4X4N A;  1R8B A;  3OV7 A;  7ICN A;  4I2D A;  9ICV A;  2PFQ A;  8ICH A;  3PNC A;  8ICR A;  3V72 A;  4RWQ A;  4LZD A;  1BPD A;  5J2K A;  3UXN A;  4AT8 A;  3ISD A;  3C2M A;  4F5O A;  3JYY A;  1ZQT A;  5CHG A;  4YD2 A;  2HHP A;  1WOL A;  3OVS A;  2ID1 A;  1QVX A;  5CB1 A;  1FA0 A;  5EOZ A;  5J0P A;  1BPY A;  1ZQQ A;  1RZT A;  3H37 A;  3RQG A;  4UBC A;  1OW6 A;  3JPQ A;  2PFP A;  4YMN A;  9ICG A;  4R32 A;  4Z6E A;  4M0A A;  5J0Y A;  4I2I A;  3GM2 A;  4AT9 A;  5DBB A;  2FMP A;  4IQT A;  3JPO A;  2ZH8 A;  1TVA A;  5HC9 A;  4PGX A;  1ZQJ A;  7ICG A;  3UXP A;  3RJH A;  4UAZ A;  5DB8 A;  4I2G A;  7ICP A;  4DOA A;  3TFS A;  4NQF A;  4WC5 A;  2ZH2 A;  3WFS C;  1KTM A;  5F28 E;  1Q78 A;  5J0O A;  2ZH1 A;  8ICZ A;  3WFR E;  2PFO A;  4R64 A;  4RQ6 A;  4ATB B;  2DR5 A;  1ZQH A;  2HSB A;  4E8F A;  2DRA A;  1RPL A;  4RQ8 A;  7ICH A;  2ZHB A;  2Q66 A;  4FHW A;  2P66 A;  4E80 A;  4QZB A;  4UB4 A;  4QZA A;  8ICY A;  4YD1 A;  2ZH6 A;  5HRL A;  1ZQW A;  3HW8 A;  1ZQR A;  1ZZP A;  1BPB A;  4FH3 A;  4RPX A;  5J2C A;  5CR0 A;  1V4A A;  1UFB A;  5IIJ A;  9ICC A;  5HR9 A;  4NLN A;  4GXI A;  4F5P A;  9ICP A;  1R8C A;  5DB6 A;  5DB7 A;  2L6H A;  3RJG A;  8ICS A;  4PHD A;  9ICB A;  4LT6 A;  4NLZ A;  4NXZ A;  4UAY A;  4P4P A;  9ICA A;  1HUO A;  1WOT A;  9ICI A;  4X4U A;  7ICV A;  3H39 A;  4PHE A;  3RQE A;  1KDH A;  4XRH A;  5IIM A;  3OUY B;  1XSN A;  1ZQN A;  1TV9 A;  1JMS A;  4S3N A;  4UD4 A;  5HRE A;  9ICE A;  9ICR A;  5J2J A;  1K40 A;  3MBY A;  4RWP A;  4QZC A;  4FHP A;  5DKW A;  2BPC A;  4XEF A;  4MFA A;  1OU5 A;  5J0U A;  3MDA A;  1O3U A;  4X4O A;  4O5K A;  3UPS A;  2BCU A;  3K7D A;  2JX0 A;  4RQ0 A;  1TFY A;  9ICT A;  5J0T A;  8ICQ A;  4WC0 A;  4KLH A;  3AQN A;  2M2T A;  1ZQC A;  1ZQZ A;  4RT2 A;  4PGQ A;  3AQK A;  4NM2 A;  2ZHA A;  4YCX A;  4KLL A;  4QZG A;  1OW8 A;  4KLD A;  5BPC A;  3GDX A;  3MDC A;  3GM1 A;  3C8G D;  5F2V O;  1WWP A;  4AT7 B;  4R65 A;  2FMQ A;  4RQ3 A;  4GXJ A;  1BPE A;  1BPX A;  5TZV A;  5IIN A;  3S9O A;  1R89 A;  2JPU A;  7ICS A;  9ICS A;  1VFG A;  4O5E A;  5J2G A;  3WFO A;  4P4M A;  5HHI A;  9ICU A;  1ZQG A;  3C18 A;  3C8G A;  4QZ8 A;  4PHP A;  3JPR A;  5J0R A;  1KEJ A;  1MQ3 A;  8ICO A;  7ICU A;  7ICE A;  5J2E A;  5BOM A;  2FMS A;  4I29 A;  1ZQY A;  4XEV A;  4UB5 A;  4X5V A;  4X4S A;  5CP2 A;  3C2K A;  3TUL A;  3JPT A;  2ZH4 A;  9ICW A;  1HUZ A;  2M2U A;  3L8J A;  4UAW A;  4X4V A;  9ICF A;  1JAJ A;  4DOC A;  1ZQO A;  4AT7 A;  9ICK A;  2GWS A;  3AU2 A;  4QZF A;  1MQ2 A;  3U3F A;  5DBC A;  4Z6D A;  4IQU A;  8ICT A;  4FHY A;  4TUS A;  4IG8 A;  3JZ0 A;  3U0C A;  3L9D A;  4NKT A;  5HRD A;  1ZQP A;  2DR8 A;  3RJF A;  1NOM A;  4QZ9 A;  4I2J A;  2ZH9 A;  5J29 A;  7ICI A;  4NKU A;  1ZJN A;  8ICC A;  4XQ8 A;  1ZJM A;  2DR9 A;  5D49 A;  4M2Y A;  4M9G A;  2M2W A;  4X4R A;  4KLJ A;  8ICP A;  1ZQU A;  4RPZ A;  4I2H A;  4PPX A;  4MF2 A;  4YMO A;  3V7K A;  7ICQ A;  2BPF A;  5HRF A;  9ICH A;  3ISC A;  4WC2 A;  2BCQ A;  1VJ7 A;  3AJM A;  4XEK A;  5DED A;  5J0Q A;  5IIO A;  5J2A A;  3B0X A;  3NYB A;  5J2I A;  4X4Q A;  3HJ1 A;  7ICJ A;  7ICM A;  4ATB A;  9ICL A;  2VAN A;  2BPG A;  9ICQ A;  4QZH A;  4M04 A;  3AU6 A;  4X4P A;  8ICX A;  8ICI A;  8ICE A;  4NLK A;  4FH5 A;  4K4H A;  4TUR A;  1BPZ A;  5IIK A;  4DOB A;  4I27 A;  7ICR A;  1ZQD A;  4O5C A;  5DB9 A;  2ZH5 A;  4XA5 A; 
#chains in the Genus database with same CATH topology
 5DDM A;  2GFH A;  3EHN A;  1ZQF A;  5E3C A;  3MX3 A;  4YT4 A;  4YWQ A;  2W9M A;  2XLM A;  1ZQK A;  3DE9 A;  1HW1 A;  1A0B A;  2J0X A;  4XTK A;  3RFY A;  3CQZ A;  3S27 A;  1FFT C;  4B6I A;  4LDK A;  2XM4 A;  4FHV A;  1LPE A;  4WQK A;  4WBZ A;  3HJ4 A;  2CW0 F;  4PK4 A;  4MFC A;  5B3S C;  4F5N A;  4CDV A;  3M15 A;  1ZQE A;  3OUY A;  4PH5 A;  3C8Z A;  3L1M A;  2HS5 A;  3TD7 A;  5DDY A;  4QZE A;  1FR0 A;  1SF8 A;  1MMD A;  4KNW A;  4JIO A;  5HHH A;  2B0H A;  4MTG A;  1V54 C;  3S29 A;  5CI9 A;  4OAF A;  2R7S A;  2ETS A;  3NWI A;  2H7B A;  1ZQB A;  4NTF A;  3LAY A;  4LZG A;  5DS5 A;  3B0U X;  4E0I A;  2KJG A;  2L6G A;  5DQZ A;  4QZI A;  1MIW A;  2QNL A;  4FES A;  1M6T A;  1XSP A;  4O79 A;  1XWJ A;  4MVU A;  2P1A A;  4ANJ A;  1JN3 A;  3H3A A;  3TJ5 A;  5CHE A;  2J9U A;  2KC3 A;  1ORJ A;  5CJ7 A;  1H9G A;  4M9N A;  2CYD A;  1Z3I X;  3RJI A;  1XZP A;  5T1D B;  3HIY A;  3OWT A;  4K7B A;  3NYL A;  2TMV P;  4KM5 A;  3HX0 A;  3ABK C;  2O1P A;  4QZD A;  4HE8 D;  4TUP A;  2YKZ A;  3JPP A;  2XL8 A;  4XUS A;  4UDV A;  2HV7 A;  4C3B A;  2NUP B;  1T6U A;  3T4R A;  7ICK A;  2YEV A;  3RH3 A;  3K66 A;  1OW7 A;  2A69 F;  3FAJ A;  1R8A A;  3O39 A;  3AQM A;  1WTY A;  4PR9 A;  3IQ5 A;  1KNY A;  1WAS A;  1QQ3 A;  1D1B A;  1CGN A;  2WVO A;  2PBE A;  3RH6 A;  4E18 A;  4WBY A;  1I5N A;  5KYU B;  1FAP B;  2IBF A;  5JTG A;  1FTS A;  1ZQV A;  4KLG A;  4ZLD A;  4M9J A;  1JMW A;  4XPY A;  3IQT A;  3OGU A;  3C5G A;  3G4Z A;  3JCU Q;  2XLO A;  1UET A;  4EWC A;  4LLE A;  4DJ9 A;  4EP7 A;  1D1A A;  1T5O A;  4FHX A;  4K4G A;  2IHM A;  2DGJ A;  3C8G B;  4AT9 B;  4OIP F;  4D4N A;  2O5A A;  3OWG A;  1UEV A;  3LQC B;  2R03 A;  1KU2 A;  5CIV A;  4M9L A;  5A6B A;  3ER8 C;  1ZQM A;  8ICB A;  5HRK A;  4CSA A;  3EH2 A;  1R8B A;  1RJ9 A;  3DAF A;  8ICH A;  1QKR A;  3C63 A;  8ICR A;  3E9V A;  2ZD9 A;  3UXN A;  4AT8 A;  1D0X A;  3NYJ A;  5CHG A;  3PHF 2;  5EOZ A;  5J0P A;  2XL6 A;  3I5P A;  3RQG A;  4E7S A;  5KYY A;  4NXX A;  2R7W A;  1GM5 A;  4Z6E A;  4OIR F;  1I4Z A;  3GM2 A;  2OKU A;  4OIN F;  3JPO A;  4CS8 A;  5KYX A;  4I2G A;  2ZXR A;  1RKE A;  3RYL A;  2ZH2 A;  4IB4 A;  3WFS C;  4CDA A;  3MCR A;  4QI2 A;  1OCR C;  2NG1 A;  2ZH1 A;  3DXJ F;  2QY9 A;  3V5Y A;  3SYN A;  4ATB B;  3VF0 A;  4U9E A;  2NPU A;  1JRA A;  2GA0 A;  1ZYR F;  3W2V A;  1Z6A A;  1RPL A;  1C03 A;  3GEH A;  2W4M A;  4NXU A;  4K96 A;  3PCV A;  4P6I C;  3GEI A;  4BEM J;  1ZQW A;  3HW8 A;  4RPX A;  5J2C A;  4D4X A;  1GQA A;  1UFB A;  4NXW A;  4NLN A;  4JLZ A;  5JP7 A;  1QZX A;  5DB7 A;  3FAP B;  1HE1 A;  2YLD A;  2UUI A;  4NLZ A;  4NXZ A;  4UAY A;  3B0V C;  9ICA A;  1HUO A;  4JUR I;  1VK5 A;  2Y3D A;  4M63 A;  9ICI A;  4Q7C A;  1RXQ A;  4Q4Z F;  4BJ1 A;  2EIL C;  4PHE A;  4BEJ A;  2L7A A;  3OUY B;  1XSN A;  3VYW A;  4KB6 A;  5HRE A;  9ICE A;  5COG A;  1E86 A;  5J2J A;  2RSE B;  4DRJ B;  1Q0D A;  4Z9H A;  4G0H A;  4ZLC A;  1H6G A;  4JCH A;  2X0C A;  3MDA A;  4C7O A;  1O3U A;  3K7D A;  2P61 A;  2WVQ A;  4PJL A;  4KLH A;  5L0D A;  1NSG B;  1ZQZ A;  2CNW D;  1PCX A;  4NM2 A;  4QZG A;  4IAQ A;  1MMN A;  4AT7 B;  4KC9 A;  4GXJ A;  2J7P D;  2L81 A;  3RVY A;  5TZV A;  5IIN A;  1R5I D;  1IW7 F;  2DYS C;  3DM9 B;  4K9B A;  1S7Z A;  4YJW A;  3ZTM A;  5L0C A;  1LI7 A;  1MND A;  4I3M A;  9ICS A;  5DLJ A;  2QLA A;  3U9M A;  5J2G A;  3C7J A;  3SXM A;  1ZVZ A;  3R7C A;  5J0R A;  1KEJ A;  5BOM A;  2NUT A;  2FMS A;  4I29 A;  1JAF A;  3GEE A;  4UB5 A;  256B A;  1A7E A;  3JPT A;  9ICW A;  1BDJ B;  4BJ6 A;  4EEB A;  4UAW A;  4X4V A;  9ICF A;  1JAJ A;  2YVK A;  4DOC A;  9ICK A;  3UGO A;  4QZF A;  3U3F A;  3HNK A;  2CCY A;  2Q9A A;  1Z7Q c;  5DBC A;  1FNT c;  8ICT A;  5EK0 A;  4IG8 A;  3I5Q A;  4NCQ A;  1ZQP A;  4MS2 A;  5E33 A;  3TJ6 A;  1YYX A;  4I2J A;  5J29 A;  4CS9 A;  8ICC A;  4XQ8 A;  1M56 C;  1T6Q A;  1OQC A;  3RIP A;  4KLJ A;  2Z15 A;  4IGG A;  1ZQU A;  4I2H A;  4XJE A;  2QUP A;  2YLG A;  3V7K A;  7ICQ A;  3DM5 A;  1ZHW A;  5DED A;  4O7G A;  5J0Q A;  4H54 A;  5J2A A;  3LS0 A;  3NYB A;  5J2I A;  3EG9 B;  2A1D D;  7ICM A;  9ICL A;  2VAN A;  2BPG A;  3CAX A;  3QVZ A;  4NLK A;  3POV A;  2R7X A;  4TUR A;  4JRZ A;  2XLV A;  5EGY A;  2LD6 A;  2ZH5 A;  1RJ9 B;  3T6J A;  3MGI A;  2A0B A;  4CX9 A;  1CGM E;  2NRK A;  8ICA A;  5A6J A;  3HTK C;  3NKE A;  2XXA A;  4OAI Z;  3UQ2 A;  4AT8 B;  4KLO A;  2DVI A;  2DYR C;  1NG1 A;  3S84 A;  2BBH A;  5CA7 A;  2OEV A;  1PD1 A;  1LIH A;  2BCS A;  3WFQ E;  1UG7 A;  2KK1 A;  5AGF A;  4NM1 A;  3B0Y A;  5T3T A;  9ICO A;  5KYY B;  4I2C A;  4WC6 A;  1EQ1 A;  4N6H A;  5D4B A;  3JYH A;  2BCR A;  4DRH B;  5TJ5 E;  2ISO A;  1ZHY A;  2WZL A;  2NSF A;  1BZ4 A;  5KYX B;  3AOU A;  3F46 A;  4ONS A;  3PMR A;  4WGY A;  1RKE B;  8ICW A;  5L0H A;  4DXW A;  4I2A A;  3V5X A;  3FHD A;  4XQ7 A;  4JEB A;  4DBQ A;  1NU7 D;  5IIL A;  2AP3 A;  1GS9 A;  3E70 C;  3W8H A;  4M47 A;  1OXB A;  4RQ1 A;  2A68 F;  1VB5 A;  2Q9B A;  4EKW A;  2J9B A;  3L0I A;  4JE9 A;  3ZDL A;  1OXK A;  4O6Y A;  4WJ0 A;  8ICG A;  3CEX A;  3DMD A;  8ICM A;  2R05 A;  3KH2 A;  5BOL A;  3VM6 A;  4WCW A;  3T9O A;  4G78 A;  3JPN A;  3MBG A;  3SZR A;  3MGH A;  3U8V A;  4DBR A;  5DBA A;  1YAU O;  3QVY A;  2LK4 A;  5D46 A;  3AUO A;  1ZHX A;  4KLS A;  2J45 A;  4JTA B;  3OVA A;  3ATP A;  2MWQ A;  3O55 A;  2I8B A;  5HRB A;  3W4Y A;  4IQV A;  3ZWI A;  4M9H A;  1MIY A;  4QDL A;  4MVM A;  2HJM A;  3KKB A;  4O9M A;  2OCC C;  2L6F A;  8ICF A;  4MTF A;  4I1M A;  4J7T A;  1HE9 A;  1K05 A;  1YA7 O;  2W4B A;  2UUH A;  4HFF B;  5IY5 C;  4C7O B;  3C5F A;  3LLK A;  4LVS A;  5JSL A;  3UPQ A;  1LE2 A;  3FXH A;  4YMM A;  3V7L A;  1WAT A;  3DD7 A;  2PXI A;  4EBJ A;  2R7O A;  1OR2 A;  4K4I A;  4K8V A;  4RPY A;  4Z6F A;  5JT4 A;  2Y3B A;  3QW1 A;  4RBN A;  5J0W A;  2W45 A;  2G62 A;  1O5H A;  1AVO B;  4JC7 A;  4WH5 A;  4AE4 A;  3EGD A;  1VYI A;  8ICV A;  3QW0 A;  1MMA A;  1PX5 A;  2AU5 A;  2PX3 A;  4H4K C;  3RH4 A;  4DRI B;  1SYQ A;  4F4B A;  3MYF A;  3B29 A;  1Q79 A;  3TFR A;  3S90 A;  2PFD A;  3Q6N A;  4YK5 A;  2ISP A;  1NU9 C;  2GWW A;  4JEA A;  5KYW A;  4FO6 A;  3BRJ A;  4K0D A;  4N6C A;  4YN4 A;  2R7T A;  4X4N A;  7ICN A;  9ICV A;  2PFQ A;  5DQT A;  5B1B C;  4XLN F;  4RWQ A;  3NDB B;  4OD4 A;  3C2M A;  4YD2 A;  1WOL A;  2ID1 A;  2YL0 A;  3ABM C;  4U5F E;  3WG7 C;  5E2Q A;  3S0X A;  5T3W A;  2MHR A;  2FAP B;  4AL1 A;  9ICG A;  4R32 A;  4LER A;  4M0A A;  2J46 A;  4X0R A;  4YN0 B;  5B3Q A;  2FMP A;  4IQT A;  1TVA A;  1BR1 A;  4CIP A;  3K6B A;  1ZQJ A;  7ICG A;  3UXP A;  3RJH A;  1AUE A;  4UAZ A;  7ICP A;  4WC5 A;  2WZG A;  3JRT A;  8ICZ A;  5HV9 A;  1VTM P;  2DR5 A;  1TFO B;  3K1I C;  4E8F A;  2DRA A;  4RQ8 A;  7ICH A;  2ZHB A;  2P66 A;  1Q0G A;  1G8X A;  2LP4 A;  3M4B A;  5HRL A;  3HJC A;  2ICW G;  4Q5S F;  5KYN A;  1C02 A;  5IIJ A;  9ICC A;  5HR9 A;  3JCF A;  4GXI A;  3F47 A;  4YT2 A;  1FFH A;  5BUO A;  4CSA C;  8ICS A;  3EFO A;  3U9J A;  4IWB A;  2JD3 A;  1ST6 A;  4P4P A;  3GWL A;  2BBJ A;  3GWN A;  3DWW A;  3WHN A;  2HN2 A;  3N24 A;  1FMV A;  3TK0 A;  7ICV A;  3RQE A;  1KDH A;  4XRH A;  2MYS A;  3K1I A;  4CS7 A;  1JMS A;  2VCA A;  4JTD B;  4S3N A;  4XPW A;  3O6X A;  1GGQ A;  4FHP A;  2GAQ A;  2BPC A;  2EPM X;  4NY3 A;  3SXK A;  4XEF A;  4CS8 C;  1H7I A;  4X4O A;  4O5K A;  3M1C B;  1NBB A;  4RQ0 A;  9ICT A;  4EHP A;  8ICQ A;  4WC0 A;  3Q7L A;  3AQN A;  3ABL C;  1HY5 A;  2FCL A;  2XLD A;  5BPC A;  2YHS A;  2BE5 F;  3B0P A;  4CJG A;  3IHU A;  5F2V O;  4XQ1 A;  1TWG A;  3I4U A;  3TOL A;  2KYH A;  1BPX A;  3H2V A;  1R89 A;  3VRC A;  3GOR A;  5L3Q A;  1G4W R;  4K97 A;  4I1O B;  2KQ9 A;  4O5E A;  2CNW A;  3RKO F;  3WFO A;  3EZI A;  3EGX A;  4IJJ A;  5D62 A;  5B1A C;  2B51 A;  5HHI A;  2EWR A;  3C18 A;  1LVK A;  4I44 A;  3T6B A;  2J7P A;  1RKC A;  4XEV A;  5DS4 A;  4X4S A;  1M2V A;  5CP2 A;  3TUL A;  2ZH4 A;  4FWV A;  2IYL D;  1RMV A;  1ZQO A;  4HX0 A;  1A41 A;  1BBH A;  4Z6D A;  4HEA J;  4TUS A;  4NKT A;  2DR8 A;  4NKU A;  5F5F A;  2DR9 A;  2M2W A;  1Z5Z A;  4LAC B;  4RDA A;  1R4T A;  4AE4 B;  3JTL O;  4RPZ A;  3EGD B;  2HSQ A;  2IXM A;  1EI7 A;  3ISC A;  5COF A;  1VJ7 A;  3AG3 C;  3AJM A;  2B56 A;  1HW2 A;  3JSE O;  1SZI A;  4X4Q A;  3ITF A;  3HJ1 A;  7ICJ A;  2HFI A;  3TQO A;  4QZH A;  4M04 A;  3AU6 A;  3LEO A;  8ICE A;  1NFO A;  5KYW B;  1LM3 B;  3ZSU A;  1E2X A;  4K4H A;  7ICR A;  3DAG A;  2KGO A;  4XA5 A;  4GYT A;  1YZC A;  3AG2 C;  1XSL A;  4F5Q A;  8ICL A;  3FOP A;  2A6H F;  4IQW A;  1TFW A;  2DRB A;  4RWN A;  4P4O A;  3C66 A;  4AX2 A;  2L9J A;  4BJ6 C;  4M5D A;  1EA8 A;  4NTA A;  3MLG A;  4RQ2 A;  4MND A;  2OEX A;  1Q0K A;  9ICN A;  3X2Q C;  3KYJ A;  4EIY A;  2Q9C A;  3RH5 A;  9ICX A;  4YL1 A;  1GPJ A;  9ICJ A;  5CFU A;  4CS9 C;  3HNL A;  1ZW2 A;  3RJK A;  4JWM A;  1D0Z A;  3M79 A;  3DE8 A;  5III A;  4EUK B;  4DVY P;  4KBL A;  3K33 A;  4FO1 A;  3OVB A;  2HV6 A;  8ICU A;  2IHO A;  3PMN A;  2PF4 E;  1JQR A;  2D4U A;  3RJE A;  3FVY A;  1UEU A;  5DS6 A;  5AC5 A;  5HRI A;  2EIN C;  5B3P A;  5B3I A;  5L3V A;  3T6G B;  2ASR A;  7ICT A;  1BR2 A;  1HMO A;  2IUB A;  1ZHZ A;  1ORY A;  4JWN A;  8ICK A;  2KSF A;  2ZH7 A;  3SP1 A;  2XRH A;  3U5S A;  4WC4 A;  2YLI A;  4WC1 A;  3CSK A;  4LDQ A;  1YVI A;  4A2N B;  4J32 B;  2AWC A;  3LNM B;  2R7V A;  1T9K A;  5CWR A;  4F5R A;  3L8I A;  3UMH A;  1OKK D;  1MQV A;  2CGE A;  4UB3 A;  1F1M A;  2OJE D;  1A7D A;  2G3V A;  4X0A A;  2DB4 A;  4PFO A;  4PJM A;  3KYI A;  4EV6 A;  3UXO A;  2VB6 A;  4BG0 A;  4CDY A;  5HRH A;  1WN0 A;  4K99 A;  2VC9 A;  4PFP A;  4RWO A;  4OIQ F;  4JW1 A;  7ICF A;  5L0F A;  3KMI A;  4LEY A;  1YAR O;  3W8I A;  3ASN C;  3ZQY A;  1MIV A;  5BQI A;  4KLE A;  1L3P A;  3IEE A;  4PJN A;  4MW3 A;  3PML A;  2BL2 A;  2M4E A;  4WC7 A;  4N4W A;  3NMK A;  4YL3 A;  4DO9 A;  5DVW A;  4WC3 A;  4ULW A;  3UQ0 A;  4E7X A;  2FGY A;  3C2L A;  4EBB A;  1ZQX A;  8ICJ A;  3EGX B;  1MNE A;  4UBB A;  4GXK A;  4MVO A;  1Y6D A;  1YA9 A;  4DOZ A;  4WGZ A;  4KLI A;  3MYI A;  4KLU A;  5DEC A;  4IRU A;  3NVO A;  2KW3 C;  4PHA A;  5L0G A;  1YJG A;  3FMS A;  1M2V B;  4I2D A;  4P9T A;  3AGT A;  1SMY F;  1BPD A;  3RF3 A;  5J2K A;  4O6A A;  3WOD F;  4F5O A;  3JYY A;  1ZQT A;  3DJU B;  4OIO F;  2HHP A;  1QVX A;  5CB1 A;  2ZXP A;  1BPY A;  3W2W A;  2Y69 C;  4UBC A;  1OW6 A;  4O6N A;  3JPQ A;  2ZPA A;  1CPQ A;  4AT9 A;  5DBB A;  1E85 A;  3M4C A;  4XPX A;  4PGX A;  4N7R A;  1H9T A;  2IOQ A;  2H7V C;  2Q3T A;  5JVE A;  3NKU A;  4WAB A;  3KL4 A;  4DOA A;  2V26 A;  3ZG1 A;  4OAH A;  4MVQ A;  3PDM P;  1Q78 A;  4GEH A;  4BPM A;  2PFO A;  4R64 A;  4RQ6 A;  4FX5 A;  4JKV A;  4U5B E;  4MVS A;  2FFH A;  1ZQH A;  2WL8 A;  5CFS A;  2Q66 A;  1DOV A;  4FHW A;  2YQY A;  4QZA A;  1LI5 A;  4YD1 A;  8ICY A;  4JTC B;  2R02 A;  2IXP A;  5JRA A;  1ZQR A;  1BPB A;  4FH3 A;  2YL7 A;  4BJ5 A;  4NTB A;  3EHM A;  5HSW A;  5JLI A;  3WAQ A;  5L0J A;  3HLZ A;  1AEP A;  4PHD A;  4LT6 A;  3C62 A;  5A6A A;  1WOT A;  2VAS A;  4CJO A;  4L6R A;  3H65 A;  3NMJ A;  4EGW A;  1TV9 A;  3JT1 A;  4AK9 A;  2QE9 A;  2G3K A;  9ICR A;  1K40 A;  2O9X A;  3EPV A;  3MBY A;  5EHH A;  4QZC A;  3EF2 A;  1OU5 A;  5J0U A;  3N2Z B;  2JX0 A;  4LEW A;  3QMK A;  1EKY A;  1TWH A;  5J0T A;  1G5Z A;  2NUT B;  3PHZ A;  1T6I A;  4P9F A;  3G50 A;  2M2T A;  3SEO A;  4RT2 A;  2ZHA A;  1Z63 A;  4YCX A;  3NG1 A;  1I4Y A;  3MDC A;  2VH3 A;  1D1C A;  3GM1 A;  3C8G D;  2RD9 A;  4FAP B;  2XL4 A;  2HMQ A;  4R65 A;  2BC5 A;  3UNG C;  3N0T A;  5CFT A;  3G4X A;  2QTV A;  3S9O A;  7ICS A;  4E7Z A;  3NKD A;  1ZW3 A;  3ASO C;  3V7O A;  2PX0 A;  5D61 A;  4P4M A;  3QTH A;  1ZU5 A;  4C3E A;  2IM8 A;  1ZQG A;  9ICU A;  4W8K A;  4QZ8 A;  3AG1 C;  2OU6 A;  3JPR A;  1MQ3 A;  8ICO A;  7ICU A;  7ICE A;  4RD9 A;  1M57 C;  1O87 A;  1ZQY A;  4OAG A;  3Q7G A;  4X5V A;  3KPH A;  3C2K A;  4YT5 A;  2AWY A;  4O69 A;  1YYJ A;  3UMK A;  4AT7 A;  2W9Y A;  3QZC A;  2GA9 D;  2GWS A;  1MQ2 A;  2H7O A;  1L7C A;  4K9A A;  4MW8 A;  4IQU A;  4PAC A;  3JZ0 A;  3U0C A;  3L9D A;  1G4U S;  1NOM A;  4QZ9 A;  1LS1 A;  2M64 A;  2R7Q A;  1ZJN A;  1ZJM A;  1HMD A;  4U5E E;  5D49 A;  2VCC A;  2XXA B;  4M2Y A;  4M9G A;  8ICP A;  2LCH A;  4O6M A;  4PPX A;  2WZF A;  4YT8 A;  2BPF A;  9ICH A;  2OQM A;  4WC2 A;  1ZHT A;  1W2W A;  2LFD A;  3LES A;  4JCZ A;  4XEK A;  1TWA A;  3X1O A;  3DKA A;  4J30 B;  4HFK B;  2AVK A;  3FDQ A;  4X4P A;  8ICI A;  4LEZ A;  1TQG A;  4JJF A;  4FH5 A;  4E0H A;  4E17 A;  1BPZ A;  5IIK A;  4DOB A;  1LE4 A;  5DB9 A;  1VLT A;  5J2H A;  3B71 A;  2EPK X;  3AQL A;  1WGW A;  4UD5 A;  1BR4 A;  2R25 A;  2J9V A;  5J2B A;  4MF8 A;  1E83 A;  4RQ7 A;  3JPS A;  3EH1 A;  3Q6M A;  1K04 A;  2YWA A;  3EG9 A;  3U8P A;  3JSZ A;  1CGO A;  5L0I A;  1VOM A;  3IQC A;  1OCO C;  3ER9 B;  3DZA A;  5D63 A;  3ERC C;  2Y3H A;  5J0S A;  4WOY A;  3MFN A;  4ULV A;  5E3A A;  2IXN A;  4X0B A;  7ICL A;  3GOD A;  4MVZ A;  2XSE A;  3UGP A;  4KLM A;  1JOG A;  1TFK B;  3H2U A;  4IAO A;  4CBE A;  2DR7 A;  3WFP A;  3RVZ A;  4NY8 A;  1DOW A;  2HZ8 A;  3AQB A;  5A69 A;  3NMI A;  1ORS C;  1PV3 A;  4I28 A;  3TOM A;  2LSE A;  3LUT B;  4Z9I A;  4O68 A;  2ZXO A;  1F5A A;  4W8P A;  1RCP A;  2A0U A;  3EJN A;  3RJJ A;  1A7V A;  1NO5 A;  3U2M A;  1IZM A;  2XM0 A;  4G7Z F;  4EBK A;  2B0J A;  2HKV A;  4RQ5 A;  2P7V A;  3HWT A;  4P2H A;  4MFF A;  1TKN A;  2RFF A;  3V5Z A;  4UB1 A;  3V7J A;  1ZQS A;  4R63 A;  2C03 A;  3K1H A;  5A6K A;  5COM A;  4KLQ A;  3H38 A;  3UMI A;  3GM3 A;  4UB2 A;  4K98 A;  3DJN B;  1MMG A;  3SXZ A;  2A6E F;  3OEO A;  9ICM A;  2OOC A;  2XS8 A;  3A11 A;  2LIG A;  4K1O A;  4X4T A;  3ZC4 A;  5J0X A;  3ISB A;  3VAY A;  2BE3 A;  1YDI A;  1Q0M A;  2LQG A;  2HMZ A;  7ICO A;  2WVN A;  4MKP A;  2M2V A;  1VMA A;  3K75 D;  4XWJ A;  1T01 A;  2Y39 A;  3EQL F;  1S05 A;  4KLT A;  1OKK A;  4I2F A;  2I15 A;  2XLE A;  2E87 A;  4JZA A;  5JS5 A;  2Q00 A;  5J2D A;  2HJ3 A;  4C3D A;  1Z23 A;  3B9Q A;  5HRG A;  4KI2 A;  1TR2 A;  2R9R B;  3O10 A;  4NXT A;  5FZT A;  1JPN A;  2BCV A;  3ECS A;  4KLF A;  8ICN A;  5A6B D;  1ZQA A;  1U6H A;  1ZQL A;  2R7U A;  4RQ4 A;  3A9C A;  1ZQI A;  4RT3 A;  4I2E A;  1JPJ A;  3ZQV A;  4Z6C A;  2VCB A;  3RW0 A;  3RQF A;  4U5D E;  2HUJ A;  2ZH3 A;  1D0Y A;  4J7Y A;  4R66 A;  1J8M F;  4TUQ A;  3LK9 A;  3HKK A;  2I9G A;  4I2B A;  4EED A;  2XLW A;  3DI5 A;  4PGY A;  5J2F A;  2PFN A;  2C04 A;  3SXY A;  1YLQ A;  3LJB A;  3OV7 A;  2P0N A;  3CK6 A;  4DVZ A;  5BQH A;  3HNI A;  2PNO A;  3PNC A;  3NRH A;  3V72 A;  4OD5 A;  4LZD A;  4YL0 A;  2GDC A;  2PP4 A;  3ISD A;  4GQH A;  1YLM A;  1LKX A;  3OVS A;  4QI0 A;  1FA0 A;  1ZQQ A;  1RZT A;  3AG4 C;  3H37 A;  2Q7R A;  1M2O A;  2Q4F A;  2PFP A;  4YMN A;  2GAF D;  1U89 A;  5J0Y A;  1B68 A;  4I2I A;  1TWC A;  5AC4 A;  2ZXW C;  2J0W A;  3ZIB A;  2ZH8 A;  3IQ6 A;  5HC9 A;  4ER9 A;  5DB8 A;  2DI3 A;  3EFO B;  3TFS A;  4NQF A;  1KTM A;  5F28 E;  5J0O A;  4U9D A;  3WFR E;  2Y3G A;  3U2L A;  4LLC A;  4O67 A;  3U3B A;  1QPU A;  3FOO A;  4N06 A;  2YL3 A;  4WQL A;  2HSB A;  3SNH A;  4PJJ A;  3S28 A;  4E80 A;  2XLH A;  4QZB A;  4UB4 A;  2ZH6 A;  1NFN A;  1JR8 A;  4XLP F;  1ZZP A;  5CR0 A;  3GAN A;  1V4A A;  4IAR A;  4F5P A;  9ICP A;  1R8C A;  2J8W A;  5DB6 A;  2HN1 A;  2L6H A;  3RJG A;  4NC3 A;  2P6V A;  9ICB A;  1Y4C A;  1NZE A;  3AGU A;  5BQG A;  4G7O F;  4G7H F;  4MVR A;  3NYM A;  2IXO A;  1QSP A;  2EIK C;  2J9W A;  4X4U A;  1XZQ A;  3HNJ A;  4LDR A;  3UR3 C;  3J06 A;  2NSG A;  3H39 A;  3BEH A;  4MQ9 F;  5IIM A;  1VYK A;  3LS1 A;  1ZQN A;  4UD4 A;  2NUP A;  2EPL X;  3LLI A;  4RWP A;  4BJT A;  5DKW A;  3L34 A;  3LNR A;  4AL0 A;  1U0B B;  4MFA A;  2H8A A;  1N1C A;  3AQC A;  3UPS A;  2BCU A;  2LFF A;  1TFY A;  3EZH A;  2XS1 A;  1CPR A;  1ZQC A;  2KNH A;  5CI8 A;  4PGQ A;  3AQK A;  2WB7 A;  4KLL A;  1OW8 A;  4KLD A;  5KYU A;  1SR2 A;  3GDX A;  2EIM C;  1NLX A;  1YZA A;  1WWP A;  1APC A;  1LS4 A;  4JJG A;  2FMQ A;  4RQ3 A;  1BPE A;  3CZ6 A;  1V55 C;  2OG2 A;  2JPU A;  1VLS A;  2X51 A;  4BJ5 C;  5K0I A;  2EPN A;  1VFG A;  2D5R B;  2EPO A;  5FCL A;  1OCZ C;  3C8G A;  2R7R A;  4PHP A;  5JUA A;  5D91 A;  2V3C C;  5J2E A;  4KNV A;  2F22 A;  3US6 A;  1C17 M;  1J8Y F;  3LEV A;  1HUZ A;  2M2U A;  3L8J A;  2B4V A;  4A4A A;  3AU2 A;  4MTO A;  4U5H A;  4I0U A;  4NXV A;  1V74 B;  1Q0F A;  3ZVR A;  1ZU4 A;  4FHY A;  1OR3 A;  2OJQ A;  5HRD A;  4CIH A;  3RJF A;  2ZH9 A;  4JLX A;  7ICI A;  3ZTZ A;  4JVS A;  4Z9J A;  3JRM O;  2EIJ C;  4X4R A;  4U5G A;  2YRF A;  4U5C E;  4MF2 A;  4YMO A;  4LEV A;  5HRF A;  1FMW A;  2BCQ A;  3IPM O;  3OA1 A;  5IIO A;  3B0X A;  2CDQ A;  2YL1 A;  2YZS A;  4ATB A;  9ICQ A;  1E84 A;  5GPG B;  1QLE C;  8ICX A;  3R2P A;  4I27 A;  1OCC C;  5F5H A;  1PD0 A;  1ZQD A;  4O5C A;  5D92 A; 
#chains in the Genus database with same CATH homology
 5J2H A;  3MGI A;  3B71 A;  1XSL A;  5DDM A;  2NRK A;  4F5Q A;  1ZQF A;  8ICA A;  3AQL A;  8ICL A;  3UQ2 A;  4UD5 A;  4AT8 B;  4IQW A;  2DVI A;  4KLO A;  1TFW A;  2DRB A;  4RWN A;  2W9M A;  5CA7 A;  4P4O A;  3C66 A;  5J2B A;  4MF8 A;  1ZQK A;  4RQ7 A;  2BCS A;  3JPS A;  3WFQ E;  4M5D A;  2KK1 A;  4NM1 A;  3B0Y A;  9ICO A;  4RQ2 A;  4I2C A;  4FHV A;  4WC6 A;  1K04 A;  2YWA A;  3HJ4 A;  4WBZ A;  5D4B A;  9ICN A;  4MFC A;  2BCR A;  2ISO A;  4F5N A;  3RH5 A;  9ICX A;  5J0S A;  1ZQE A;  9ICJ A;  3OUY A;  3MFN A;  8ICW A;  4X0B A;  4PH5 A;  7ICL A;  3RJK A;  4JWM A;  5DDY A;  4QZE A;  4KLM A;  1JOG A;  4I2A A;  5III A;  4XQ7 A;  2DR7 A;  3WFP A;  5IIL A;  5HHH A;  4NY8 A;  3OVB A;  8ICU A;  4M47 A;  4RQ1 A;  3PMN A;  1JQR A;  1PV3 A;  4I28 A;  3RJE A;  1UEU A;  1F5A A;  8ICG A;  1ZQB A;  5HRI A;  4LZG A;  8ICM A;  5BOL A;  2L6G A;  4WCW A;  3RJJ A;  4QZI A;  1NO5 A;  7ICT A;  1MIW A;  3JPN A;  4JWN A;  8ICK A;  4EBK A;  1XSP A;  3MGH A;  2ZH7 A;  4WC4 A;  4RQ5 A;  5DBA A;  3HWT A;  1JN3 A;  4MFF A;  4P2H A;  4WC1 A;  2LK4 A;  5D46 A;  2RFF A;  3H3A A;  3AUO A;  4UB1 A;  4KLS A;  5CJ7 A;  3V7J A;  1ZQS A;  4R63 A;  3OVA A;  4M9N A;  3RJI A;  5HRB A;  4KLQ A;  5CWR A;  3H38 A;  4IQV A;  3HIY A;  3GM3 A;  3L8I A;  1MIY A;  4F5R A;  4M9H A;  4UB2 A;  4UB3 A;  3HX0 A;  2O1P A;  4QZD A;  4TUP A;  9ICM A;  4O9M A;  3JPP A;  4XUS A;  4X0A A;  4X4T A;  7ICK A;  5J0X A;  2L6F A;  3ISB A;  8ICF A;  2BE3 A;  1OW7 A;  3UXO A;  1K05 A;  1R8A A;  3AQM A;  7ICO A;  5HRH A;  3C5F A;  2M2V A;  1WTY A;  3K75 D;  4LVS A;  3UPQ A;  1KNY A;  4RWO A;  4YMM A;  3V7L A;  2PXI A;  4EBJ A;  4KLT A;  7ICF A;  4K4I A;  4I2F A;  4RPY A;  2PBE A;  4Z6F A;  3RH6 A;  4WBY A;  2Q00 A;  5J2D A;  1MIV A;  1ZQV A;  5J0W A;  5HRG A;  4KLG A;  4M9J A;  3O10 A;  2BCV A;  4KLE A;  4KLF A;  8ICN A;  3PML A;  3OGU A;  3C5G A;  4WC7 A;  1ZQA A;  4DO9 A;  1ZQL A;  8ICV A;  1UET A;  4RQ4 A;  1ZQI A;  4WC3 A;  4RT3 A;  4I2E A;  3UQ0 A;  1PX5 A;  4E7X A;  4Z6C A;  4EP7 A;  3RQF A;  3C2L A;  1ZQX A;  8ICJ A;  3RH4 A;  2ZH3 A;  4FHX A;  4K4G A;  2IHM A;  4UBB A;  3C8G B;  4AT9 B;  4GXK A;  4R66 A;  1Q79 A;  4TUQ A;  3TFR A;  2O5A A;  3LK9 A;  2I9G A;  1UEV A;  3LQC B;  2ISP A;  4I2B A;  4KLI A;  4M9L A;  4FO6 A;  3BRJ A;  1ZQM A;  4PGY A;  5J2F A;  5DEC A;  4KLU A;  8ICB A;  2PFN A;  5HRK A;  4YN4 A;  4PHA A;  1YLQ A;  4X4N A;  1R8B A;  3OV7 A;  7ICN A;  4I2D A;  9ICV A;  2PFQ A;  8ICH A;  3PNC A;  8ICR A;  3V72 A;  4RWQ A;  4LZD A;  1BPD A;  5J2K A;  3UXN A;  4AT8 A;  3ISD A;  3C2M A;  4F5O A;  3JYY A;  1ZQT A;  5CHG A;  4YD2 A;  2HHP A;  1WOL A;  3OVS A;  2ID1 A;  1QVX A;  5CB1 A;  1FA0 A;  5EOZ A;  5J0P A;  1BPY A;  1ZQQ A;  1RZT A;  3H37 A;  3RQG A;  4UBC A;  1OW6 A;  3JPQ A;  2PFP A;  4YMN A;  9ICG A;  4R32 A;  4Z6E A;  4M0A A;  5J0Y A;  4I2I A;  3GM2 A;  4AT9 A;  5DBB A;  2FMP A;  4IQT A;  3JPO A;  2ZH8 A;  1TVA A;  5HC9 A;  4PGX A;  1ZQJ A;  7ICG A;  3UXP A;  3RJH A;  4UAZ A;  5DB8 A;  4I2G A;  7ICP A;  4DOA A;  3TFS A;  4NQF A;  4WC5 A;  2ZH2 A;  3WFS C;  1KTM A;  5F28 E;  1Q78 A;  5J0O A;  2ZH1 A;  8ICZ A;  3WFR E;  2PFO A;  4R64 A;  4RQ6 A;  4ATB B;  2DR5 A;  1ZQH A;  2HSB A;  4E8F A;  2DRA A;  1RPL A;  4RQ8 A;  7ICH A;  2ZHB A;  2Q66 A;  4FHW A;  2P66 A;  4E80 A;  4QZB A;  4UB4 A;  4QZA A;  8ICY A;  4YD1 A;  2ZH6 A;  5HRL A;  1ZQW A;  3HW8 A;  1ZQR A;  1ZZP A;  1BPB A;  4FH3 A;  4RPX A;  5J2C A;  5CR0 A;  1V4A A;  1UFB A;  5IIJ A;  9ICC A;  5HR9 A;  4NLN A;  4GXI A;  4F5P A;  9ICP A;  1R8C A;  5DB6 A;  5DB7 A;  2L6H A;  3RJG A;  8ICS A;  4PHD A;  9ICB A;  4LT6 A;  4NLZ A;  4NXZ A;  4UAY A;  4P4P A;  9ICA A;  1HUO A;  1WOT A;  9ICI A;  4X4U A;  7ICV A;  3H39 A;  4PHE A;  3RQE A;  1KDH A;  4XRH A;  5IIM A;  3OUY B;  1XSN A;  1ZQN A;  1TV9 A;  1JMS A;  4S3N A;  4UD4 A;  5HRE A;  9ICE A;  9ICR A;  5J2J A;  1K40 A;  3MBY A;  4RWP A;  4QZC A;  4FHP A;  5DKW A;  2BPC A;  4XEF A;  4MFA A;  1OU5 A;  5J0U A;  3MDA A;  1O3U A;  4X4O A;  4O5K A;  3UPS A;  2BCU A;  3K7D A;  2JX0 A;  4RQ0 A;  1TFY A;  9ICT A;  5J0T A;  8ICQ A;  4WC0 A;  4KLH A;  3AQN A;  2M2T A;  1ZQC A;  1ZQZ A;  4RT2 A;  4PGQ A;  3AQK A;  4NM2 A;  2ZHA A;  4YCX A;  4KLL A;  4QZG A;  1OW8 A;  4KLD A;  5BPC A;  3GDX A;  3MDC A;  3GM1 A;  3C8G D;  5F2V O;  1WWP A;  4AT7 B;  4R65 A;  2FMQ A;  4RQ3 A;  4GXJ A;  1BPE A;  1BPX A;  5TZV A;  5IIN A;  3S9O A;  1R89 A;  2JPU A;  7ICS A;  9ICS A;  1VFG A;  4O5E A;  5J2G A;  3WFO A;  4P4M A;  5HHI A;  9ICU A;  1ZQG A;  3C18 A;  3C8G A;  4QZ8 A;  4PHP A;  3JPR A;  5J0R A;  1KEJ A;  1MQ3 A;  8ICO A;  7ICU A;  7ICE A;  5J2E A;  5BOM A;  2FMS A;  4I29 A;  1ZQY A;  4XEV A;  4UB5 A;  4X5V A;  4X4S A;  5CP2 A;  3C2K A;  3TUL A;  3JPT A;  2ZH4 A;  9ICW A;  1HUZ A;  2M2U A;  3L8J A;  4UAW A;  4X4V A;  9ICF A;  1JAJ A;  4DOC A;  1ZQO A;  4AT7 A;  9ICK A;  2GWS A;  3AU2 A;  4QZF A;  1MQ2 A;  3U3F A;  5DBC A;  4Z6D A;  4IQU A;  8ICT A;  4FHY A;  4TUS A;  4IG8 A;  3JZ0 A;  3U0C A;  3L9D A;  4NKT A;  5HRD A;  1ZQP A;  2DR8 A;  3RJF A;  1NOM A;  4QZ9 A;  4I2J A;  2ZH9 A;  5J29 A;  7ICI A;  4NKU A;  1ZJN A;  8ICC A;  4XQ8 A;  1ZJM A;  2DR9 A;  5D49 A;  4M2Y A;  4M9G A;  2M2W A;  4X4R A;  4KLJ A;  8ICP A;  1ZQU A;  4RPZ A;  4I2H A;  4PPX A;  4MF2 A;  4YMO A;  3V7K A;  7ICQ A;  2BPF A;  5HRF A;  9ICH A;  3ISC A;  4WC2 A;  2BCQ A;  1VJ7 A;  3AJM A;  4XEK A;  5DED A;  5J0Q A;  5IIO A;  5J2A A;  3B0X A;  3NYB A;  5J2I A;  4X4Q A;  3HJ1 A;  7ICJ A;  7ICM A;  4ATB A;  9ICL A;  2VAN A;  2BPG A;  9ICQ A;  4QZH A;  4M04 A;  3AU6 A;  4X4P A;  8ICX A;  8ICI A;  8ICE A;  4NLK A;  4FH5 A;  4K4H A;  4TUR A;  1BPZ A;  5IIK A;  4DOB A;  4I27 A;  7ICR A;  1ZQD A;  4O5C A;  5DB9 A;  2ZH5 A;  4XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...