3JYYA

Semet linb complexed with ppi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
265
Chain Sequence
MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
molecule keywords Lincosamide nucleotidyltransferase
total genus 93
structure length 265
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jyyA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jyyA01
4LT6A 4GXIA 4E8FA 7ICJA 7ICMA 1UEVA 2JX0A 4M9HA 5F2VO 4MFAA 4IG8A 2DR5A 4JWMA 2O1PA 4F5PA 5CA7A 3ISCA 3V7LA 1TFWA 4MFFA 3RH4A 5DBAA 1RPLA 5TZVA 3S9OA 5CHGA 2FMPA 1ZQVA 5IIJA 3RJGA 4M9LA 4XUSA 1KDHA 1ZQTA 8ICJA 4PGXA 3OUYB 9ICNA 4R32A 4M9NA 1ZQXA 2HSBA 5J0OA 3LK9A 9ICBA 3C8GB 3HW8A 4X4QA 4NM2A 4RQ1A 4XEKA 2BE3A 1ZQFA 5BOLA 4EBJA 4QZGA 1FA0A 1ZQNA 4FH5A 4R63A 7ICNA 5J2BA 4KLEA 3L9DA 1ZZPA 7ICGA 2DRAA 7ICRA 3B0XA 4DOCA 4X0AA 4YMNA 5J0QA 1KTMA 5J2GA 8ICUA 4LZDA 2PFQA 4MF8A 4KLOA 9ICRA 4AT9A 4RPZA 2HHPA 3HJ4A 5J2FA 3RH6A 4WC4A 1K05A 4WC5A 4RWOA 1F5AA 4KLJA 2L6GA 5HHIA 4M0AA 4KLTA 3U3FA 8ICOA 1ZQPA 4UB2A 4NLKA 3UXOA 5DBBA 4K4GA 5CB1A 3MDCA 4O5KA 4UB1A 3O10A 7ICKA 3RJEA 4KLIA 3AU6A 4QZFA 3JPQA 3MBYA 4P2HA 4P4MA 4XA5A 8ICWA 3TFRA 4AT7B 4NY8A 3AU2A 1JMSA 5J0PA 3HWTA 2ISOA 1BPBA 1OW6A 1ZQGA 9ICIA 4KLFA 1JQRA 4M9JA 5J0TA 4I2GA 5DB6A 8ICNA 4RPYA 5IILA 4RWQA 2YWAA 4WC1A 4E7XA 1NOMA 4GXKA 7ICPA 4RWPA 1BPXA 4QZCA 9ICLA 2DR9A 4X4SA 5J2KA 4I27A 4RT3A 4M2YA 4I2CA 3L8IA 1XSLA 4NKUA 2W9MA 2ZH2A 4IQUA 3OVSA 5J2JA 4R64A 5HRDA 9ICKA 5HRGA 4WC7A 3H37A 4FHYA 2ZHAA 4QZAA 3ISDA 3UXPA 1ZJMA 2M2VA 8ICQA 3RJHA 3AQLA 3UPQA 5EOZA 3JPSA 4QZHA 4UD5A 1ZQRA 5DB9A 5HRBA 4LZGA 3PNCA 4KLSA 1QVXA 1NO5A 2RFFA 1ZQUA 9ICGA 1KEJA 7ICHA 2BPFA 3C5GA 5HHHA 2DR7A 1MIYA 2BCVA 4PH5A 3GM1A 4M5DA 4IQWA 2M2TA 1ZQKA 4FHPA 3L8JA 2DVIA 9ICSA 4AT9B 8ICMA 4FH3A 1RZTA 9ICUA 4WBYA 3OGUA 1ZQLA 4NLZA 2Q00A 4XEFA 5CWRA 2DR8A 3MFNA 3UPSA 4O5CA 2ZH3A 3JZ0A 3MDAA 1MIWA 4YD1A 4P4PA 4UB3A 3H39A 2ISPA 1ZQBA 1JN3A 4I2FA 8ICVA 5BPCA 4FO6A 4Z6EA 2PXIA 2ZH7A 1VJ7A 5J0SA 3C2MA 4PHEA 4TUPA 4P4OA 1ZQEA 2M2WA 4F5OA 4FHWA 4I28A 1XSNA 3H38A 2ZHBA 5J0UA 8ICKA 3V7KA 4WC6A 9ICFA 3UXNA 1K40A 4UBBA 3PMLA 4R66A 2P66A 9ICPA 9ICWA 1HUZA 3AQMA 4K4HA 3V72A 4I2AA 4X4UA 5HRFA 4TUSA 3LQCB 3BRJA 4QZEA 5DDMA 5HREA 2O5AA 1WOLA 4QZ8A 5DB7A 3JPTA 1ZQMA 3WFSC 4UD4A 1OW8A 1BPYA 4Z6CA 4NKTA 1R89A 7ICOA 1ZQDA 3NYBA 3RH5A 3JYYA 4DOBA 4KLHA 4TURA 2PFOA 5CR0A 2L6FA 4EP7A 4F5QA 8ICIA 1ZQQA 1BPEA 5DDYA 4M04A 4WCWA 8ICCA 4Z6DA 5DBCA 2FMSA 4UB5A 1R8CA 4RQ4A 3RJJA 4X4PA 4M47A 4UB4A 4PPXA 4RQ8A 4I29A 5HR9A 4KLUA 3RQGA 9ICOA 4JWNA 2Q66A 3WFOA 4KLMA 1BPZA 5DKWA 4I2HA 5IIMA 8ICLA 4YMOA 4RQ0A 4ATBA 4RQ2A 4PGQA 4PGYA 4ATBB 4PHDA 1OW7A 4YCXA 3JPNA 2ZH6A 1UFBA 4NXZA 5D46A 1YLQA 5J2CA 5IINA 7ICSA 2ZH8A 8ICGA 2IHMA 4MFCA 4E80A 5HRKA 4X4NA 2NRKA 2ID1A 4X5VA 5F28E 3TULA 1MIVA 5IIIA 4PHAA 4PHPA 2L6HA 1ZQCA 3K75D 2ZH4A 7ICFA 5IIOA 4RQ6A 4KLLA 4UBCA 3C5FA 4LVSA 5J2IA 4RT2A 9ICTA 5HRLA 5DECA 5DEDA 3GM3A 5J2DA 4I2EA 4RWNA 4IQTA 4I2IA 5D49A 2BPGA 4F5NA 1KNYA 3MGIA 3V7JA 1MQ3A 4KLGA 4KLQA 4X4TA 3TFSA 2I9GA 1WTYA 9ICCA 5D4BA 3ISBA 3B71A 5J0RA 8ICAA 3WFRE 5J0WA 1XSPA 4NLNA 4I2BA 8ICRA 5J2EA 2PBEA 2ZH9A 4UAWA 1TVAA 1ZQAA 8ICFA 9ICAA 9ICXA 3C2LA 8ICPA 2DRBA 4K4IA 3RQFA 8ICZA 3JPOA 3RJKA 2BCRA 5J0YA 4RQ3A 4UAYA 5BOMA 2M2UA 4FHVA 4AT8B 4X4RA 5HC9A 7ICIA 4XRHA 4F5RA 4S3NA 4YD2A 7ICUA 4O9MA 1ZQIA 4GXJA 1R8AA 3AQNA 4YMMA 2ZH5A 1TV9A 4TUQA 4KLDA 1WOTA 5IIKA 7ICVA 1PX5A 4IQVA 2GWSA 4XEVA 5CJ7A 2BPCA 7ICEA 5CP2A 3WFPA 4R65A 1ZQOA 1TFYA 4O5EA 3RQEA 3RJIA 2BCUA 8ICTA 4WC3A 5DB8A 3UQ2A 3AUOA 2FMQA 4NQFA 4X4OA 4DOAA 1ZQWA 9ICEA 4Z6FA 3C8GD 1ZQSA 4XQ7A 4MF2A 1HUOA 3HX0A 1K04A 4QZDA 4QZIA 4WC0A 3OV7A 1JOGA 8ICYA 2PFPA 3OVAA 1BPDA 9ICQA 3U0CA 4RPXA 3JPRA 1ZJNA 4AT7A 3AQKA 3K7DA 8ICBA 4X4VA 5HRIA 1MQ2A 4FHXA 1ZQZA 4RQ7A 1ZQJA 9ICVA 4WC2A 8ICSA 3C2KA 1R8BA 5HRHA 3PMNA 1Q79A 1UEUA 4I2DA 3OUYA 3H3AA 8ICEA 4DO9A 7ICQA 2VANA 4EBKA 2PFNA 5J0XA 5J29A 1VFGA 5J2AA 4QZBA 3WFQE 8ICHA 1ZQYA 4QZ9A 9ICMA 3HIYA 4UAZA 3C18A 1UETA 9ICJA 1OU5A 1PV3A 3MGHA 3GM2A 2LK4A 3HJ1A 1O3UA 9ICHA 2KK1A 2JPUA 4XQ8A 4NM1A 4RQ5A 4WBZA 7ICLA 8ICXA 4M9GA 3GDXA 4X0BA 3UQ0A 1ZQHA 3RJFA 1JAJA 2BCSA 3AJMA 1V4AA 3C66A 1WWPA 2ZH1A 3C8GA 7ICTA 4I2JA 3JPPA 3OVBA 4YN4A 3B0YA 2BCQA 4AT8A 5J2HA 1Q78A
chains in the Genus database with same CATH superfamily
1UEVA 4M9HA 2Q9AA 1T6IA 5CA7A 3ISCA 2KGOA 4MFFA 3RH4A 2YLIA 4PJJA 5DBAA 1VLTA 3RFYA 1M6TA 2P6VA 5CHGA 1ZQVA 3RJGA 3EFOB 1KDHA 8ICJA 2NG1A 4Z9JA 4JE9A 2HSBA 5COFA 3LK9A 3C8GB 4X4QA 3TK0A 3T6GB 3RW0A 4JLZA 2BE3A 5BOLA 4EBJA 2OKUA 3GEHA 1OKKA 2IBFA 5FZTA 5JLIA 7ICGA 2DRAA 4Q4ZF 7ICRA 3FDQA 2DYSC 4X0AA 1EA8A 1LM3B 1KTMA 5J2GA 4I1MA 4LZDA 2PFQA 1M2OA 4AT9A 2A68F 4DBQA 2HHPA 3HJ4A 3RH6A 4LDRA 4NXXA 2R7UA 2L6GA 3AGTA 3NYLA 3UXOA 4OD5A 3MDCA 4UB1A 3CQZA 3O10A 4BG0A 7ICKA 4GQHA 4JURI 3IHUA 3VF0A 1T5OA 1T6QA 2WZLA 3DD7A 5D63A 1I4ZA 3O6XA 3TFRA 5AC4A 1MNDA 4XLPF 3AU2A 4K99A 3M79A 1ZQGA 2IYLD 4DVYP 1JPNA 2NPUA 5J0TA 4I2GA 2R7QA 1M2VA 4U5EE 4RWQA 1B68A 2F22A 7ICPA 3UNGC 1E83A 3EJNA 2RSEB 4LLCA 2XLVA 4WJ0A 5KYWB 1LS1A 3NG1A 2WVQA 4NTBA 2UUHA 1ZU5A 1XSLA 1A7VA 4NKUA 2ZH2A 4IQUA 3OVSA 2YLDA 1LE4A 4C3BA 3EZHA 3K6BA 1ZJMA 3KMIA 2B4VA 2M2VA 4C7OB 2R25A 1RKEB 4CS8C 3UPQA 4J7TA 1TFOB 4QZHA 3QW0A 1Q0FA 4O7GA 4EGWA 5HRBA 4YT4A 1NU7D 1NO5A 3RIPA 2YL7A 9ICGA 4WH5A 3GEEA 2J0WA 2BPFA 3C5GA 3CAXA 5HHHA 1H9GA 4FX5A 2BCVA 4PH5A 1ZHZA 3W8IA 2O9XA 3ABKC 4IQWA 5B3SC 2B51A 2M2TA 1ZQKA 1EQ1A 2HKVA 4O6NA 8ICMA 4K96A 1ZQLA 4CS7A 4YT5A 4F4BA 2ISPA 1J8YF 4Z6EA 4MTOA 2ZH7A 3GWNA 5J0SA 1APCA 4P4OA 1Q0GA 5DVWA 1RKCA 1NLXA 4FHWA 3T9OA 1XSNA 2EPOA 4WQLA 5J0UA 1M2VB 3N0TA 2P7VA 4WC6A 4IAOA 2R7OA 1Z63A 3ZQYA 1MNEA 3PMLA 4R66A 5JUAA 2PX0A 5JVEA 3K33A 3K1HA 4IB4A 1V74B 2LIGA 4X4UA 4U5HA 1HE1A 1SMYF 1QKRA 3O39A 4K8VA 4UD4A 1OW8A 4ONSA 1SYQA 4HX0A 7ICOA 3C8ZA 1ZQDA 1ORSC 3NYBA 3JYYA 4MNDA 2W9YA 4KLHA 5CR0A 1IW7F 3LJBA 2XXAB 1TWAA 5KYYB 1T9KA 3E70C 1YJGA 1ZQQA 2AWYA 4JTCB 4J32B 2NUPB 1NBBA 2P0NA 2VB6A 3W2VA 1R8CA 4J7YA 4OD4A 4X4PA 4P9FA 4M47A 1ORYA 4RQ8A 2R7XA 4I29A 1D1AA 3RQGA 4PJLA 5A69A 5IY5C 4ZLDA 2PNOA 4I2HA 4RQ0A 3JTLO 4RQ2A 2EIJC 3NWIA 4PHDA 4EUKB 3TJ5A 1UFBA 2H7OA 5CFSA 4NXZA 1YLQA 1QPUA 4IRUA 1HW2A 3W2WA 2FGYA 4X4NA 4X5VA 5T3WA 4K9BA 1QLEC 1MIVA 1ZQCA 2QNLA 4Z9HA 7ICFA 5IIOA 2Q3TA 3HNIA 4UBCA 4RT2A 4RWNA 4KLQA 2W4MA 4X4TA 1WTYA 4OAHA 1FMVA 4YWQA 5J0WA 3T6JA 4NLNA 3TD7A 8ICRA 1TVAA 3V5ZA 1Z23A 3ZIBA 3RQFA 4E17A 3HNJA 3JPOA 2OEXA 3DE9A 4UAYA 4YJWA 4X4RA 4Q5SF 4AT8B 4XRHA 3GORA 3IQCA 4YD2A 3VM6A 3ATPA 256BA 4D4NA 5KYYA 5L3VA 3S90A 2L9JA 4Z9IA 3H2UA 1WOTA 3KYIA 2HSQA 4KNVA 3O55A 3G50A 3LS0A 2GWSA 1NFOA 3WFPA 2GDCA 3ZSUA 4O5EA 3RQEA 1JAFA 2W45A 4BJTA 4K1OA 3AUOA 4H4KC 4RDAA 1M56C 2A69F 1KU2A 1WGWA 4Z6FA 2HUJA 1FFTC 3ABMC 4P6IC 1EI7A 1K04A 1J8MF 4KB6A 4JW1A 2IOQA 4BEJA 4I0UA 4RPXA 4X4VA 9ICVA 3C2KA 4E18A 1VYIA 2J8WA 2ETSA 3PMNA 4I2DA 3JSZA 4MQ9F 8ICEA 4PJNA 4RD9A 2PFNA 1W2WA 5J0XA 1VFGA 1TFKB 5JP7A 3ZC4A 4QZ9A 3I5PA 4PFPA 9ICJA 3MGHA 4N6CA 3ZDLA 3N2ZB 1O3UA 9ICHA 3DAGA 4AL0A 2WL8A 5BQIA 4WBZA 7ICLA 3POVA 4WQKA 1ZQHA 3RJFA 1JAJA 3WHNA 2BCSA 1V4AA 1WWPA 2P61A 4I2JA 2XXAA 3B0YA 5FCLA 3AG2C 4AE4B 4LT6A 3SEOA 4P9TA 4E8FA 7ICMA 4PJMA 2JX0A 2B0HA 2NUPA 2KNHA 3L1MA 5F2VO 2DR5A 4XWJA 4JWMA 3ERCC 3K1IA 2HN2A 2O1PA 4LLEA 5EK0A 3ECSA 2FMPA 3QMKA 4AL1A 4MVQA 3AG1C 3H65A 1Q0KA 5B3QA 3OUYB 4R32A 1FTSA 4M9NA 5J0OA 2UUIA 9ICBA 3DXJF 3G4ZA 4XEKA 1ZQFA 1WATA 3EGDB 4FH5A 4R63A 5J2BA 2VCCA 4G78A 3L9DA 1QZXA 1HY5A 3B0XA 1RXQA 2X51A 5A6AA 3I5QA 8ICUA 4MF8A 9ICRA 2EPNA 1O5HA 5J2FA 4K0DA 5F5FA 4KLTA 2BL2A 2EPLX 3DZAA 3U3BA 5HHIA 2IXOA 3JT1A 5DS6A 4BEMJ 3V5YA 4MW3A 4NLKA 1L7CA 2QTVA 2R7RA 4KLIA 2OJED 5L0GA 3MBYA 3FVYA 8ICWA 2EPKX 1GGQA 3TOLA 4OINF 2R7WA 1JMSA 1EKYA 1TWGA 4DXWA 3LLIA 3SNHA 4MS2A 2R7TA 1O87A 2ISOA 1BPBA 1OW6A 9ICIA 4U9DA 3U8PA 4YT8A 4OIRF 5DB6A 2YWAA 4GXKA 1NOMA 1MMGA 9ICLA 1R5ID 2DR9A 4X4SA 3ABLC 3DJUB 1YARO 5J2KA 4I27A 1WN0A 4M2YA 4QDLA 3M4BA 4CBEA 3DM5A 1LPEA 5A6BA 4R64A 2J9WA 4X0RA 2J7PD 5B1BC 4C7OA 3ISDA 4C3DA 4MW8A 4DRIB 3RJHA 1T6UA 1H7IA 4CS8A 3KPHA 2CNWD 2YZSA 5EOZA 3JPSA 1M57C 1LI5A 4UD5A 1ZQRA 1HMDA 3PNCA 5A6KA 4ULWA 5CI9A 3EPVA 3IPMO 1A0BA 2IUBA 7ICHA 2DR7A 4QI0A 2R03A 3EH2A 4A4AA 1PD1A 3LNMB 3RYLA 1YA9A 1VOMA 4U5FE 9ICSA 2YKZA 3V5XA 2G3VA 4FH3A 2VASA 4WBYA 3OGUA 4NLZA 2Q00A 4XEFA 3MFNA 4J30B 2Q9CA 4O5CA 2DYRC 3JZ0A 3B9QA 3MDAA 4CX9A 3US6A 3J06A 1ZQBA 4MVZA 4N4WA 4ER9A 4FO6A 4NXWA 4FWVA 5DQZA 2PF4E 1YDIA 2ZHBA 3SYNA 1TWCA 3LEOA 8ICKA 2Y39A 5L0IA 3RVZA 1S7ZA 2LCHA 9ICPA 3A11A 3Q6NA 5KYXA 5EGYA 3V72A 1VMAA 3BRJA 4I3MA 1AUEA 2O5AA 3JPTA 2L81A 3WFSC 2HFIA 2DGJA 3U9MA 1R89A 1OCRC 1E2XA 2Y3BA 4EHPA 4DOBA 2PFOA 2XL8A 2E87A 2L6FA 3HJCA 1BR2A 1BPEA 5GPGB 1MMAA 4YL0A 4WGZA 1AEPA 4RQ4A 2A6HF 2Z15A 2NUTA 5BQGA 4UB4A 1BZ4A 2CYDA 4KLUA 4IGGA 1U89A 1F1MA 2Q66A 2R02A 3WFOA 4KLMA 1BPZA 5DKWA 3DKAA 5IIMA 1RJ9B 3VYWA 4YL1A 4PGQA 3U2LA 4BJ1A 1OW7A 1H9TA 4YCXA 2CW0F 4JJGA 3JRTA 5D46A 3CEXA 1I5NA 4OAIZ 1C02A 1TR2A 1T01A 4E0IA 3FOOA 4MFCA 4E80A 5HRKA 3I4UA 5B1AC 3TULA 1NFNA 2AP3A 4U5BE 4HEAJ 5D92A 3MCRA 5D62A 2PX3A 5DECA 2I15A 4I2EA 4IQTA 4JTAB 1V54C 2VCBA 2ZD9A 4KLGA 2OJQA 5L3QA 1E86A 4AK9A 5J0RA 2XM0A 2EINC 3R7CA 3EG9A 4EEDA 4BJ5C 5J2EA 2PBEA 4UAWA 9ICAA 3C2LA 4JCHA 4K4IA 5JS5A 2CGEA 3RJKA 1GPJA 4RQ3A 1LIHA 5HC9A 4FHVA 4W8PA 4CS9C 4F5RA 7ICUA 3ZTMA 1ZQIA 5JT4A 1A7EA 4JVSA 1TV9A 1R4TA 4KLDA 4XEVA 1TFYA 1NSGB 4YT2A 2ASRA 2ZXPA 8ICTA 3K66A 2FMQA 1XZQA 2LSEA 3EH1A 3SP1A 1ZQWA 3RF3A 1NG1A 3C8GD 2ZXRA 1ZQSA 4MTGA 4XQ7A 1RJ9A 4MF2A 1HUOA 3HX0A 2J9BA 1D0YA 5EHHA 2PFPA 1FFHA 1ZJNA 4AT7A 3FHDA 3AQKA 8ICBA 1CGOA 2VC9A 1MQ2A 1ZQJA 3DE8A 3GWLA 1Z3IX 3QVYA 4BJ6A 2OU6A 1Q79A 3H3AA 2DB4A 4LEYA 1GS9A 3F46A 4CIPA 4WOYA 5J2AA 4QZBA 3CK6A 5KYUA 3A9CA 1ZQYA 9ICMA 3HIYA 4O67A 4UAZA 3PHZA 3C18A 3LESA 2ZPAA 4ZLCA 3JCFA 2XLMA 3AOUA 4IWBA 3LUTB 2JPUA 4XQ8A 5E3AA 5HV9A 2EILC 3UR3C 4NM1A 4RQ5A 4M63A 4M9GA 4X0BA 3DM9B 4U5GA 3VAYA 2ZH1A 7ICTA 1LI7A 3OVBA 2BCQA 2QLAA 4GXIA 7ICJA 2I8BA 5KYXB 4CS9A 4MFAA 5DS4A 4IG8A 1BBHA 1PD0A 2Q4FA 3U9JA 2IXPA 4XLNF 1RPLA 5CFUA 3RKOF 5TZVA 3S9OA 1OQCA 2MYSA 3QTHA 9ICNA 4MVMA 3GODA 2JD3A 1OR3A 3PDMP 4LEVA 2Q9BA 4C3EA 4RQ1A 3DWWA 1FAPB 4QZGA 5DQTA 1QSPA 1FA0A 3T4RA 2IHOA 7ICNA 3CSKA 4YMNA 3SXMA 3ZTZA 2J0XA 5HSWA 3ER8C 4WC5A 4YL3A 5A6JA 1ZW3A 1F5AA 4KLJA 8ICOA 2BE5F 1ZQPA 4UB2A 2Y3GA 5DBBA 2HV7A 5CB1A 1YA7O 3NMKA 4O5KA 5KYUB 5JSLA 4MKPA 3AU6A 3JPQA 1FNTc 4P2HA 1Y6DA 4XA5A 2J9UA 4AT7B 3DJNB 5J0PA 4OAGA 3HWTA 1JQRA 1A7DA 4PR9A 1G4US 8ICNA 4RPYA 4AE4A 4DJ9A 4N6HA 4WC1A 1V55C 2Y3DA 4RWPA 1BPXA 1VK5A 4QZCA 4DOZA 3JSEO 3RH3A 3OWTA 3W4YA 2GAQA 4JZAA 2A1DD 2LQGA 4CDYA 3IEEA 3H37A 2ZHAA 2G62A 3SXYA 2H7VC 2AU5A 1G5ZA 3AQBA 1VTMP 2G3KA 5BUOA 4LEWA 2B56A 1UG7A 5DB9A 4LZGA 3AGUA 1JRAA 3L34A 1ZQUA 4YN0B 1KEJA 1ZW2A 2V26A 2HMZA 3GM1A 4QI2A 1SZIA 4HFKB 3FAPB 4FHPA 3L8JA 2DVIA 2EPMX 4ANJA 3X2QC 3ZWIA 1TWHA 4CDVA 1RZTA 2CNWA 4N06A 5CWRA 2DR8A 3UPSA 1XZPA 2ZH3A 1MIWA 3AQCA 3WAQA 4YD1A 4OIPF 1L3PA 4UB3A 2C04A 5T3TA 1YYJA 3S28A 1JN3A 4I2FA 1BR4A 3DMDA 4BJ5A 3C2MA 2M2WA 4F5OA 1FMWA 5AC5A 3H38A 4CSAA 1HE9A 3M15A 3UMKA 3V7KA 9ICFA 4JEBA 4JTDB 3NVOA 3UXNA 1K40A 1NZEA 1JR8A 2M64A 9ICWA 4KM5A 2LFDA 3AQMA 1OCZC 4K4HA 3NRHA 4PK4A 5HRFA 4TUSA 5DDMA 4CIHA 3H2VA 2C03A 3TJ6A 4Z6CA 4KI2A 2X0CA 1RKEA 3UMIA 5L0FA 3RH5A 4U5CE 4TURA 4K9AA 1IZMA 4EP7A 2QY9A 4F5QA 1DOWA 2XS1A 4M04A 4EBBA 5L0JA 4EIYA 4Z6DA 1YVIA 2FMSA 4UB5A 3RJJA 3HTKC 3ITFA 4NXUA 1Z6AA 4G7HF 4KC9A 5HR9A 4O69A 2BBJA 9ICOA 4JWNA 2P1AA 3AG4C 1ST6A 1C03A 1HW1A 8ICLA 4U9EA 4YMOA 4FESA 4ATBA 2QUPA 4PGYA 2OG2A 2J9VA 2WB7A 3MBGA 2ZH6A 2VH3A 3EGDA 4O6AA 5IINA 2PFDA 2V3CC 4FO1A 2IHMA 3LAYA 4JRZA 4WGYA 3PMRA 2NRKA 2ID1A 4PHAA 4PHPA 2FCLA 1QQ3A 3EG9B 1H6GA 3B0PA 4RQ6A 4KLLA 4B6IA 3C5FA 4MVUA 5HRLA 5J2DA 5DEDA 3GM3A 1G4WR 3VRCA 4F5NA 1KNYA 3V7JA 1MQ3A 4N7RA 3F47A 2I9GA 1RMVA 5D4BA 1AVOB 3ISBA 4GYTA 3JCUQ 8ICAA 2GAFD 1XSPA 1YYXA 1GM5A 2YVKA 9ICXA 4D4XA 2YQYA 4PFOA 4IAQA 5E2QA 3MLGA 2BCRA 1SF8A 2LFFA 1BR1A 7ICIA 1OCOC 3IQ6A 3U8VA 2MWQA 2YL3A 3C63A 3RVYA 4JLXA 1JPJA 5CI8A 2CDQA 7ICVA 5IIKA 2HS5A 4Q7CA 1D1CA 4IQVA 5CJ7A 2J7PA 4MTFA 2BPCA 7ICEA 4R65A 2A6EF 4XQ1A 3RJIA 2ZXOA 2BCUA 4WC3A 5DB8A 1N1CA 4MVRA 2AVKA 3NKDA 3BEHA 4X4OA 1ZHXA 1YZCA 3ER9B 9ICEA 4NC3A 4IJJA 1E85A 2D4UA 4QZDA 4QZIA 4WC0A 3OV7A 1JOGA 8ICYA 3OVAA 1BPDA 9ICQA 3MYFA 3U0CA 3JPRA 2ZXWC 3FXHA 3FOPA 3K7DA 1OXBA 5HRIA 4FHXA 1ZQZA 4RQ7A 2YHSA 4OIQF 4JC7A 3OWGA 5HRHA 2HN1A 2H7BA 2MHRA 4DO9A 2VANA 5L0HA 1NU9C 5J29A 1OR2A 1BDJB 3ZQVA 3NMIA 8ICHA 1JMWA 3B0UX 2AWCA 3M4CA 4E7ZA 3ASNC 1OU5A 2J46A 4CDAA 2B0JA 2HMQA 3EQLF 8ICXA 1DOVA 3JYHA 4RBNA 2RD9A 1CPQA 3C8GA 5CFTA 3LEVA 3X1OA 4YN4A 4AT8A 4BJ6C 2GA9D 4JJFA 2IXNA 2IM8A 1VYKA 1MMNA 5AGFA 2BC5A 3R2PA 4CSAC 5D61A 4F5PA 1TFWA 3V7LA 3EZIA 2WZGA 4G7ZF 3EF2A 5IIJA 3TOMA 4M9LA 4XUSA 2HZ8A 1ZQTA 3HNKA 4PGXA 3EFOA 2Y69C 1ZQXA 4EWCA 1A41A 4G0HA 3HW8A 2XLOA 4NM2A 3UGOA 4LDKA 3G4XA 2W4BA 4I44A 3DI5A 2NUTB 1ZQNA 3HLZA 4KLEA 1ZZPA 2XLHA 3E9VA 4DOCA 4NY3A 5T1DB 3ASOC 5J0QA 4KNWA 4KLOA 5DLJA 4RPZA 4WC4A 4NTAA 1K05A 1D0ZA 2L7AA 4O68A 4RWOA 2XS8A 4M0AA 2QE9A 2GA0A 3U3FA 1SR2A 4OIOF 5CHEA 4K4GA 4KBLA 1TQGA 2A0UA 2XLDA 4GEHA 4MVSA 3RJEA 4UDVA 4QZFA 4P4MA 5DS5A 1GQAA 4NY8A 4MVOA 1YLMA 2ICWG 3LLKA 2CCYA 3FAJA 5E3CA 4KLFA 4M9JA 2BBHA 4A2NB 4E0HA 5COMA 5IILA 4E7XA 2OOCA 3ZVRA 1TKNA 2OCCC 3Q7LA 5KYWA 1Y4CA 2OEVA 1CGNA 4RT3A 1LVKA 3NYMA 4I2CA 3L8IA 5K0IA 5B3PA 2KYHA 2W9MA 3IQTA 4H54A 4IARA 5J2JA 3W8HA 5HRDA 9ICKA 1U6HA 2KSFA 4WABA 5HRGA 4WC7A 4FHYA 4QZAA 3UXPA 4XTKA 2OQMA 3EHMA 8ICQA 3AQLA 3QZCA 4E7SA 4JIOA 4CJGA 4ULVA 2XL6A 4KLSA 2EIKC 1QVXA 3FMSA 2RFFA 1D0XA 3QW1A 1Q0MA 1MIYA 3PHF2 3NDBB 4M5DA 4AT9B 4OAFA 4K98A 2EWRA 9ICUA 2HJ3A 3GANA 4NXTA 2Y3HA 3WG7C 4K7BA 4P4PA 3H39A 2XLEA 2H8AA 8ICVA 5BPCA 5COGA 2PXIA 2NSFA 1VJ7A 4PHEA 5A6BD 4TUPA 2XL4A 1ZQEA 1E84A 1OXKA 4I28A 3MX3A 2LD6A 2XRHA 4LDQA 1CPRA 3LS1A 4UBBA 4JEAA 2P66A 4YK5A 3NKEA 1HUZA 2FFHA 1I4YA 3DAFA 2GFHA 4I2AA 2WVNA 1ORJA 1YZAA 3LQCB 4QZEA 3S0XA 5HREA 1WOLA 4QZ8A 1LE2A 5DB7A 3SZRA 1ZQMA 1BPYA 3S29A 4NKTA 1PCXA 4DRJB 2R7VA 3EHNA 3EGXB 2IXMA 2KC3A 1OCCC 1ZHYA 5CIVA 3Q7GA 2R7SA 8ICIA 3JRMO 4NTFA 3U2MA 5DDYA 4JKVA 4WCWA 8ICCA 5JRAA 3HKKA 5DBCA 3U5SA 4LACB 2WZFA 1LS4A 5L0DA 4PPXA 1LKXA 4NCQA 3V7OA 4EEBA 2LP4A 3OA1A 4FAPB 3EGXA 3CZ6A 1MMDA 4ATBB 2M4EA 3C7JA 2XSEA 3JPNA 2GWWA 5F5HA 1Z5ZA 4O6MA 5J2CA 4DVZA 2YEVA 4XPWA 7ICSA 2HV6A 1D1BA 2ZH8A 4U5DE 8ICGA 4EV6A 4K97A 5F28E 2A0BA 5IIIA 5JTGA 2L6HA 3K75D 2ZH4A 4O6YA 1XWJA 3UMHA 2KW3C 4LVSA 5J2IA 3HNLA 9ICTA 3C62A 4EKWA 4W8KA 4PACA 4I2IA 5D49A 2BPGA 3MGIA 3TFSA 1CGME 1HMOA 9ICCA 4O79A 3UGPA 1YAUO 3B71A 4LERA 3WFRE 4I2BA 3KH2A 3T6BA 1ZQAA 3S84A 2ZH9A 8ICFA 4HE8D 2VCAA 3IQ5A 2KQ9A 8ICPA 2DRBA 8ICZA 5J0YA 5BOMA 4DBRA 2M2UA 3QVZA 1WASA 4S3NA 4O9MA 1ZHWA 4GXJA 1R8AA 3AQNA 4YMMA 2ZH5A 3OEOA 4TUQA 1ZHTA 5KYNA 5BQHA 4BPMA 2WVOA 4CJOA 1PX5A 3AG3C 5CP2A 1ZQOA 1ZU4A 1Z7Qc 3SXZA 1G8XA 3NKUA 3UQ2A 3Q6MA 3B0VC 4NQFA 4DRHB 4NXVA 2YRFA 4DOAA 3SXKA 2R05A 1C17M 3ZG1A 3S27A 1U0BB 1ZVZA 1S05A 4AX2A 3K1IC 3M1CB 2YLGA 4XPXA 5D91A 2Q7RA 2XLWA 2YL1A 2TMVP 4WC2A 8ICSA 3PCVA 3KYJA 3TQOA 1R8BA 2PP4A 1UEUA 3OUYA 3NYJA 7ICQA 1VB5A 4L6RA 4EBKA 3GEIA 3KL4A 3WFQE 2YL0A 1VLSA 2R9RB 4LEZA 5B3IA 3L0IA 5E33A 2FAPB 1UETA 1MQVA 3WODF 1PV3A 3GM2A 2EIMC 2LK4A 3HJ1A 2KK1A 2NSGA 3B29A 4XJEA 5TJ5E 2D5RB 3MYIA 3LNRA 2J45A 3N24A 4I1OB 3GDXA 1RCPA 2HJMA 4JCZA 3UQ0A 2XM4A 3NMJA 4HFFB 1OKKD 5L0CA 3AJMA 1Q0DA 3C66A 3KKBA 1ZYRF 3JPPA 4XPYA 1FR0A 5J2HA 1Q78A 4G7OF 2KJGA 2DI3A
chains in the Genus database with same CATH topology
4LT6A 4GXIA 4E8FA 7ICJA 7ICMA 1UEVA 2JX0A 4M9HA 5F2VO 4MFAA 4IG8A 2DR5A 4JWMA 2O1PA 4F5PA 5CA7A 3ISCA 3V7LA 1TFWA 4MFFA 3RH4A 5DBAA 1RPLA 5TZVA 3S9OA 5CHGA 2FMPA 1ZQVA 5IIJA 3RJGA 4M9LA 4XUSA 1KDHA 1ZQTA 8ICJA 4PGXA 3OUYB 9ICNA 4R32A 4M9NA 1ZQXA 2HSBA 5J0OA 3LK9A 9ICBA 3C8GB 3HW8A 4X4QA 4NM2A 4RQ1A 4XEKA 2BE3A 1ZQFA 5BOLA 4EBJA 4QZGA 1FA0A 1ZQNA 4FH5A 4R63A 7ICNA 5J2BA 4KLEA 3L9DA 1ZZPA 7ICGA 2DRAA 7ICRA 3B0XA 4DOCA 4X0AA 4YMNA 5J0QA 1KTMA 5J2GA 8ICUA 4LZDA 2PFQA 4MF8A 4KLOA 9ICRA 4AT9A 4RPZA 2HHPA 3HJ4A 5J2FA 3RH6A 4WC4A 1K05A 4WC5A 4RWOA 1F5AA 4KLJA 2L6GA 5HHIA 4M0AA 4KLTA 3U3FA 8ICOA 1ZQPA 4UB2A 4NLKA 3UXOA 5DBBA 4K4GA 5CB1A 3MDCA 4O5KA 4UB1A 3O10A 7ICKA 3RJEA 4KLIA 3AU6A 4QZFA 3JPQA 3MBYA 4P2HA 4P4MA 4XA5A 8ICWA 3TFRA 4AT7B 4NY8A 3AU2A 1JMSA 5J0PA 3HWTA 2ISOA 1BPBA 1OW6A 1ZQGA 9ICIA 4KLFA 1JQRA 4M9JA 5J0TA 4I2GA 5DB6A 8ICNA 4RPYA 5IILA 4RWQA 2YWAA 4WC1A 4E7XA 1NOMA 4GXKA 7ICPA 4RWPA 1BPXA 4QZCA 9ICLA 2DR9A 4X4SA 5J2KA 4I27A 4RT3A 4M2YA 4I2CA 3L8IA 1XSLA 4NKUA 2W9MA 2ZH2A 4IQUA 3OVSA 5J2JA 4R64A 5HRDA 9ICKA 5HRGA 4WC7A 3H37A 4FHYA 2ZHAA 4QZAA 3ISDA 3UXPA 1ZJMA 2M2VA 8ICQA 3RJHA 3AQLA 3UPQA 5EOZA 3JPSA 4QZHA 4UD5A 1ZQRA 5DB9A 5HRBA 4LZGA 3PNCA 4KLSA 1QVXA 1NO5A 2RFFA 1ZQUA 9ICGA 1KEJA 7ICHA 2BPFA 3C5GA 5HHHA 2DR7A 1MIYA 2BCVA 4PH5A 3GM1A 4M5DA 4IQWA 2M2TA 1ZQKA 4FHPA 3L8JA 2DVIA 9ICSA 4AT9B 8ICMA 4FH3A 1RZTA 9ICUA 4WBYA 3OGUA 1ZQLA 4NLZA 2Q00A 4XEFA 5CWRA 2DR8A 3MFNA 3UPSA 4O5CA 2ZH3A 3JZ0A 3MDAA 1MIWA 4YD1A 4P4PA 4UB3A 3H39A 2ISPA 1ZQBA 1JN3A 4I2FA 8ICVA 5BPCA 4FO6A 4Z6EA 2PXIA 2ZH7A 1VJ7A 5J0SA 3C2MA 4PHEA 4TUPA 4P4OA 1ZQEA 2M2WA 4F5OA 4FHWA 4I28A 1XSNA 3H38A 2ZHBA 5J0UA 8ICKA 3V7KA 4WC6A 9ICFA 3UXNA 1K40A 4UBBA 3PMLA 4R66A 2P66A 9ICPA 9ICWA 1HUZA 3AQMA 4K4HA 3V72A 4I2AA 4X4UA 5HRFA 4TUSA 3LQCB 3BRJA 4QZEA 5DDMA 5HREA 2O5AA 1WOLA 4QZ8A 5DB7A 3JPTA 1ZQMA 3WFSC 4UD4A 1OW8A 1BPYA 4Z6CA 4NKTA 1R89A 7ICOA 1ZQDA 3NYBA 3RH5A 3JYYA 4DOBA 4KLHA 4TURA 2PFOA 5CR0A 2L6FA 4EP7A 4F5QA 8ICIA 1ZQQA 1BPEA 5DDYA 4M04A 4WCWA 8ICCA 4Z6DA 5DBCA 2FMSA 4UB5A 1R8CA 4RQ4A 3RJJA 4X4PA 4M47A 4UB4A 4PPXA 4RQ8A 4I29A 5HR9A 4KLUA 3RQGA 9ICOA 4JWNA 2Q66A 3WFOA 4KLMA 1BPZA 5DKWA 4I2HA 5IIMA 8ICLA 4YMOA 4RQ0A 4ATBA 4RQ2A 4PGQA 4PGYA 4ATBB 4PHDA 1OW7A 4YCXA 3JPNA 2ZH6A 1UFBA 4NXZA 5D46A 1YLQA 5J2CA 5IINA 7ICSA 2ZH8A 8ICGA 2IHMA 4MFCA 4E80A 5HRKA 4X4NA 2NRKA 2ID1A 4X5VA 5F28E 3TULA 1MIVA 5IIIA 4PHAA 4PHPA 2L6HA 1ZQCA 3K75D 2ZH4A 7ICFA 5IIOA 4RQ6A 4KLLA 4UBCA 3C5FA 4LVSA 5J2IA 4RT2A 9ICTA 5HRLA 5DECA 5DEDA 3GM3A 5J2DA 4I2EA 4RWNA 4IQTA 4I2IA 5D49A 2BPGA 4F5NA 1KNYA 3MGIA 3V7JA 1MQ3A 4KLGA 4KLQA 4X4TA 3TFSA 2I9GA 1WTYA 9ICCA 5D4BA 3ISBA 3B71A 5J0RA 8ICAA 3WFRE 5J0WA 1XSPA 4NLNA 4I2BA 8ICRA 5J2EA 2PBEA 2ZH9A 4UAWA 1TVAA 1ZQAA 8ICFA 9ICAA 9ICXA 3C2LA 8ICPA 2DRBA 4K4IA 3RQFA 8ICZA 3JPOA 3RJKA 2BCRA 5J0YA 4RQ3A 4UAYA 5BOMA 2M2UA 4FHVA 4AT8B 4X4RA 5HC9A 7ICIA 4XRHA 4F5RA 4S3NA 4YD2A 7ICUA 4O9MA 1ZQIA 4GXJA 1R8AA 3AQNA 4YMMA 2ZH5A 1TV9A 4TUQA 4KLDA 1WOTA 5IIKA 7ICVA 1PX5A 4IQVA 2GWSA 4XEVA 5CJ7A 2BPCA 7ICEA 5CP2A 3WFPA 4R65A 1ZQOA 1TFYA 4O5EA 3RQEA 3RJIA 2BCUA 8ICTA 4WC3A 5DB8A 3UQ2A 3AUOA 2FMQA 4NQFA 4X4OA 4DOAA 1ZQWA 9ICEA 4Z6FA 3C8GD 1ZQSA 4XQ7A 4MF2A 1HUOA 3HX0A 1K04A 4QZDA 4QZIA 4WC0A 3OV7A 1JOGA 8ICYA 2PFPA 3OVAA 1BPDA 9ICQA 3U0CA 4RPXA 3JPRA 1ZJNA 4AT7A 3AQKA 3K7DA 8ICBA 4X4VA 5HRIA 1MQ2A 4FHXA 1ZQZA 4RQ7A 1ZQJA 9ICVA 4WC2A 8ICSA 3C2KA 1R8BA 5HRHA 3PMNA 1Q79A 1UEUA 4I2DA 3OUYA 3H3AA 8ICEA 4DO9A 7ICQA 2VANA 4EBKA 2PFNA 5J0XA 5J29A 1VFGA 5J2AA 4QZBA 3WFQE 8ICHA 1ZQYA 4QZ9A 9ICMA 3HIYA 4UAZA 3C18A 1UETA 9ICJA 1OU5A 1PV3A 3MGHA 3GM2A 2LK4A 3HJ1A 1O3UA 9ICHA 2KK1A 2JPUA 4XQ8A 4NM1A 4RQ5A 4WBZA 7ICLA 8ICXA 4M9GA 3GDXA 4X0BA 3UQ0A 1ZQHA 3RJFA 1JAJA 2BCSA 3AJMA 1V4AA 3C66A 1WWPA 2ZH1A 3C8GA 7ICTA 4I2JA 3JPPA 3OVBA 4YN4A 3B0YA 2BCQA 4AT8A 5J2HA 1Q78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LT6 A;  4GXI A;  4E8F A;  7ICJ A;  7ICM A;  1UEV A;  2JX0 A;  4M9H A;  5F2V O;  4MFA A;  4IG8 A;  2DR5 A;  4JWM A;  2O1P A;  4F5P A;  5CA7 A;  3ISC A;  3V7L A;  1TFW A;  4MFF A;  3RH4 A;  5DBA A;  1RPL A;  5TZV A;  3S9O A;  5CHG A;  2FMP A;  1ZQV A;  5IIJ A;  3RJG A;  4M9L A;  4XUS A;  1KDH A;  1ZQT A;  8ICJ A;  4PGX A;  3OUY B;  9ICN A;  4R32 A;  4M9N A;  1ZQX A;  2HSB A;  5J0O A;  3LK9 A;  9ICB A;  3C8G B;  3HW8 A;  4X4Q A;  4NM2 A;  4RQ1 A;  4XEK A;  2BE3 A;  1ZQF A;  5BOL A;  4EBJ A;  4QZG A;  1FA0 A;  1ZQN A;  4FH5 A;  4R63 A;  7ICN A;  5J2B A;  4KLE A;  3L9D A;  1ZZP A;  7ICG A;  2DRA A;  7ICR A;  3B0X A;  4DOC A;  4X0A A;  4YMN A;  5J0Q A;  1KTM A;  5J2G A;  8ICU A;  4LZD A;  2PFQ A;  4MF8 A;  4KLO A;  9ICR A;  4AT9 A;  4RPZ A;  2HHP A;  3HJ4 A;  5J2F A;  3RH6 A;  4WC4 A;  1K05 A;  4WC5 A;  4RWO A;  1F5A A;  4KLJ A;  2L6G A;  5HHI A;  4M0A A;  4KLT A;  3U3F A;  8ICO A;  1ZQP A;  4UB2 A;  4NLK A;  3UXO A;  5DBB A;  4K4G A;  5CB1 A;  3MDC A;  4O5K A;  4UB1 A;  3O10 A;  7ICK A;  3RJE A;  4KLI A;  3AU6 A;  4QZF A;  3JPQ A;  3MBY A;  4P2H A;  4P4M A;  4XA5 A;  8ICW A;  3TFR A;  4AT7 B;  4NY8 A;  3AU2 A;  1JMS A;  5J0P A;  3HWT A;  2ISO A;  1BPB A;  1OW6 A;  1ZQG A;  9ICI A;  4KLF A;  1JQR A;  4M9J A;  5J0T A;  4I2G A;  5DB6 A;  8ICN A;  4RPY A;  5IIL A;  4RWQ A;  2YWA A;  4WC1 A;  4E7X A;  1NOM A;  4GXK A;  7ICP A;  4RWP A;  1BPX A;  4QZC A;  9ICL A;  2DR9 A;  4X4S A;  5J2K A;  4I27 A;  4RT3 A;  4M2Y A;  4I2C A;  3L8I A;  1XSL A;  4NKU A;  2W9M A;  2ZH2 A;  4IQU A;  3OVS A;  5J2J A;  4R64 A;  5HRD A;  9ICK A;  5HRG A;  4WC7 A;  3H37 A;  4FHY A;  2ZHA A;  4QZA A;  3ISD A;  3UXP A;  1ZJM A;  2M2V A;  8ICQ A;  3RJH A;  3AQL A;  3UPQ A;  5EOZ A;  3JPS A;  4QZH A;  4UD5 A;  1ZQR A;  5DB9 A;  5HRB A;  4LZG A;  3PNC A;  4KLS A;  1QVX A;  1NO5 A;  2RFF A;  1ZQU A;  9ICG A;  1KEJ A;  7ICH A;  2BPF A;  3C5G A;  5HHH A;  2DR7 A;  1MIY A;  2BCV A;  4PH5 A;  3GM1 A;  4M5D A;  4IQW A;  2M2T A;  1ZQK A;  4FHP A;  3L8J A;  2DVI A;  9ICS A;  4AT9 B;  8ICM A;  4FH3 A;  1RZT A;  9ICU A;  4WBY A;  3OGU A;  1ZQL A;  4NLZ A;  2Q00 A;  4XEF A;  5CWR A;  2DR8 A;  3MFN A;  3UPS A;  4O5C A;  2ZH3 A;  3JZ0 A;  3MDA A;  1MIW A;  4YD1 A;  4P4P A;  4UB3 A;  3H39 A;  2ISP A;  1ZQB A;  1JN3 A;  4I2F A;  8ICV A;  5BPC A;  4FO6 A;  4Z6E A;  2PXI A;  2ZH7 A;  1VJ7 A;  5J0S A;  3C2M A;  4PHE A;  4TUP A;  4P4O A;  1ZQE A;  2M2W A;  4F5O A;  4FHW A;  4I28 A;  1XSN A;  3H38 A;  2ZHB A;  5J0U A;  8ICK A;  3V7K A;  4WC6 A;  9ICF A;  3UXN A;  1K40 A;  4UBB A;  3PML A;  4R66 A;  2P66 A;  9ICP A;  9ICW A;  1HUZ A;  3AQM A;  4K4H A;  3V72 A;  4I2A A;  4X4U A;  5HRF A;  4TUS A;  3LQC B;  3BRJ A;  4QZE A;  5DDM A;  5HRE A;  2O5A A;  1WOL A;  4QZ8 A;  5DB7 A;  3JPT A;  1ZQM A;  3WFS C;  4UD4 A;  1OW8 A;  1BPY A;  4Z6C A;  4NKT A;  1R89 A;  7ICO A;  1ZQD A;  3NYB A;  3RH5 A;  3JYY A;  4DOB A;  4KLH A;  4TUR A;  2PFO A;  5CR0 A;  2L6F A;  4EP7 A;  4F5Q A;  8ICI A;  1ZQQ A;  1BPE A;  5DDY A;  4M04 A;  4WCW A;  8ICC A;  4Z6D A;  5DBC A;  2FMS A;  4UB5 A;  1R8C A;  4RQ4 A;  3RJJ A;  4X4P A;  4M47 A;  4UB4 A;  4PPX A;  4RQ8 A;  4I29 A;  5HR9 A;  4KLU A;  3RQG A;  9ICO A;  4JWN A;  2Q66 A;  3WFO A;  4KLM A;  1BPZ A;  5DKW A;  4I2H A;  5IIM A;  8ICL A;  4YMO A;  4RQ0 A;  4ATB A;  4RQ2 A;  4PGQ A;  4PGY A;  4ATB B;  4PHD A;  1OW7 A;  4YCX A;  3JPN A;  2ZH6 A;  1UFB A;  4NXZ A;  5D46 A;  1YLQ A;  5J2C A;  5IIN A;  7ICS A;  2ZH8 A;  8ICG A;  2IHM A;  4MFC A;  4E80 A;  5HRK A;  4X4N A;  2NRK A;  2ID1 A;  4X5V A;  5F28 E;  3TUL A;  1MIV A;  5III A;  4PHA A;  4PHP A;  2L6H A;  1ZQC A;  3K75 D;  2ZH4 A;  7ICF A;  5IIO A;  4RQ6 A;  4KLL A;  4UBC A;  3C5F A;  4LVS A;  5J2I A;  4RT2 A;  9ICT A;  5HRL A;  5DEC A;  5DED A;  3GM3 A;  5J2D A;  4I2E A;  4RWN A;  4IQT A;  4I2I A;  5D49 A;  2BPG A;  4F5N A;  1KNY A;  3MGI A;  3V7J A;  1MQ3 A;  4KLG A;  4KLQ A;  4X4T A;  3TFS A;  2I9G A;  1WTY A;  9ICC A;  5D4B A;  3ISB A;  3B71 A;  5J0R A;  8ICA A;  3WFR E;  5J0W A;  1XSP A;  4NLN A;  4I2B A;  8ICR A;  5J2E A;  2PBE A;  2ZH9 A;  4UAW A;  1TVA A;  1ZQA A;  8ICF A;  9ICA A;  9ICX A;  3C2L A;  8ICP A;  2DRB A;  4K4I A;  3RQF A;  8ICZ A;  3JPO A;  3RJK A;  2BCR A;  5J0Y A;  4RQ3 A;  4UAY A;  5BOM A;  2M2U A;  4FHV A;  4AT8 B;  4X4R A;  5HC9 A;  7ICI A;  4XRH A;  4F5R A;  4S3N A;  4YD2 A;  7ICU A;  4O9M A;  1ZQI A;  4GXJ A;  1R8A A;  3AQN A;  4YMM A;  2ZH5 A;  1TV9 A;  4TUQ A;  4KLD A;  1WOT A;  5IIK A;  7ICV A;  1PX5 A;  4IQV A;  2GWS A;  4XEV A;  5CJ7 A;  2BPC A;  7ICE A;  5CP2 A;  3WFP A;  4R65 A;  1ZQO A;  1TFY A;  4O5E A;  3RQE A;  3RJI A;  2BCU A;  8ICT A;  4WC3 A;  5DB8 A;  3UQ2 A;  3AUO A;  2FMQ A;  4NQF A;  4X4O A;  4DOA A;  1ZQW A;  9ICE A;  4Z6F A;  3C8G D;  1ZQS A;  4XQ7 A;  4MF2 A;  1HUO A;  3HX0 A;  1K04 A;  4QZD A;  4QZI A;  4WC0 A;  3OV7 A;  1JOG A;  8ICY A;  2PFP A;  3OVA A;  1BPD A;  9ICQ A;  3U0C A;  4RPX A;  3JPR A;  1ZJN A;  4AT7 A;  3AQK A;  3K7D A;  8ICB A;  4X4V A;  5HRI A;  1MQ2 A;  4FHX A;  1ZQZ A;  4RQ7 A;  1ZQJ A;  9ICV A;  4WC2 A;  8ICS A;  3C2K A;  1R8B A;  5HRH A;  3PMN A;  1Q79 A;  1UEU A;  4I2D A;  3OUY A;  3H3A A;  8ICE A;  4DO9 A;  7ICQ A;  2VAN A;  4EBK A;  2PFN A;  5J0X A;  5J29 A;  1VFG A;  5J2A A;  4QZB A;  3WFQ E;  8ICH A;  1ZQY A;  4QZ9 A;  9ICM A;  3HIY A;  4UAZ A;  3C18 A;  1UET A;  9ICJ A;  1OU5 A;  1PV3 A;  3MGH A;  3GM2 A;  2LK4 A;  3HJ1 A;  1O3U A;  9ICH A;  2KK1 A;  2JPU A;  4XQ8 A;  4NM1 A;  4RQ5 A;  4WBZ A;  7ICL A;  8ICX A;  4M9G A;  3GDX A;  4X0B A;  3UQ0 A;  1ZQH A;  3RJF A;  1JAJ A;  2BCS A;  3AJM A;  1V4A A;  3C66 A;  1WWP A;  2ZH1 A;  3C8G A;  7ICT A;  4I2J A;  3JPP A;  3OVB A;  4YN4 A;  3B0Y A;  2BCQ A;  4AT8 A;  5J2H A;  1Q78 A; 
#chains in the Genus database with same CATH topology
 1UEV A;  4M9H A;  2Q9A A;  1T6I A;  5CA7 A;  3ISC A;  2KGO A;  4MFF A;  3RH4 A;  2YLI A;  4PJJ A;  5DBA A;  1VLT A;  3RFY A;  1M6T A;  2P6V A;  5CHG A;  1ZQV A;  3RJG A;  3EFO B;  1KDH A;  8ICJ A;  2NG1 A;  4Z9J A;  4JE9 A;  2HSB A;  5COF A;  3LK9 A;  3C8G B;  4X4Q A;  3TK0 A;  3T6G B;  3RW0 A;  4JLZ A;  2BE3 A;  5BOL A;  4EBJ A;  2OKU A;  3GEH A;  1OKK A;  2IBF A;  5FZT A;  5JLI A;  7ICG A;  2DRA A;  4Q4Z F;  7ICR A;  3FDQ A;  2DYS C;  4X0A A;  1EA8 A;  1LM3 B;  1KTM A;  5J2G A;  4I1M A;  4LZD A;  2PFQ A;  1M2O A;  4AT9 A;  2A68 F;  4DBQ A;  2HHP A;  3HJ4 A;  3RH6 A;  4LDR A;  4NXX A;  2R7U A;  2L6G A;  3AGT A;  3NYL A;  3UXO A;  4OD5 A;  3MDC A;  4UB1 A;  3CQZ A;  3O10 A;  4BG0 A;  7ICK A;  4GQH A;  4JUR I;  3IHU A;  3VF0 A;  1T5O A;  1T6Q A;  2WZL A;  3DD7 A;  5D63 A;  1I4Z A;  3O6X A;  3TFR A;  5AC4 A;  1MND A;  4XLP F;  3AU2 A;  4K99 A;  3M79 A;  1ZQG A;  2IYL D;  4DVY P;  1JPN A;  2NPU A;  5J0T A;  4I2G A;  2R7Q A;  1M2V A;  4U5E E;  4RWQ A;  1B68 A;  2F22 A;  7ICP A;  3UNG C;  1E83 A;  3EJN A;  2RSE B;  4LLC A;  2XLV A;  4WJ0 A;  5KYW B;  1LS1 A;  3NG1 A;  2WVQ A;  4NTB A;  2UUH A;  1ZU5 A;  1XSL A;  1A7V A;  4NKU A;  2ZH2 A;  4IQU A;  3OVS A;  2YLD A;  1LE4 A;  4C3B A;  3EZH A;  3K6B A;  1ZJM A;  3KMI A;  2B4V A;  2M2V A;  4C7O B;  2R25 A;  1RKE B;  4CS8 C;  3UPQ A;  4J7T A;  1TFO B;  4QZH A;  3QW0 A;  1Q0F A;  4O7G A;  4EGW A;  5HRB A;  4YT4 A;  1NU7 D;  1NO5 A;  3RIP A;  2YL7 A;  9ICG A;  4WH5 A;  3GEE A;  2J0W A;  2BPF A;  3C5G A;  3CAX A;  5HHH A;  1H9G A;  4FX5 A;  2BCV A;  4PH5 A;  1ZHZ A;  3W8I A;  2O9X A;  3ABK C;  4IQW A;  5B3S C;  2B51 A;  2M2T A;  1ZQK A;  1EQ1 A;  2HKV A;  4O6N A;  8ICM A;  4K96 A;  1ZQL A;  4CS7 A;  4YT5 A;  4F4B A;  2ISP A;  1J8Y F;  4Z6E A;  4MTO A;  2ZH7 A;  3GWN A;  5J0S A;  1APC A;  4P4O A;  1Q0G A;  5DVW A;  1RKC A;  1NLX A;  4FHW A;  3T9O A;  1XSN A;  2EPO A;  4WQL A;  5J0U A;  1M2V B;  3N0T A;  2P7V A;  4WC6 A;  4IAO A;  2R7O A;  1Z63 A;  3ZQY A;  1MNE A;  3PML A;  4R66 A;  5JUA A;  2PX0 A;  5JVE A;  3K33 A;  3K1H A;  4IB4 A;  1V74 B;  2LIG A;  4X4U A;  4U5H A;  1HE1 A;  1SMY F;  1QKR A;  3O39 A;  4K8V A;  4UD4 A;  1OW8 A;  4ONS A;  1SYQ A;  4HX0 A;  7ICO A;  3C8Z A;  1ZQD A;  1ORS C;  3NYB A;  3JYY A;  4MND A;  2W9Y A;  4KLH A;  5CR0 A;  1IW7 F;  3LJB A;  2XXA B;  1TWA A;  5KYY B;  1T9K A;  3E70 C;  1YJG A;  1ZQQ A;  2AWY A;  4JTC B;  4J32 B;  2NUP B;  1NBB A;  2P0N A;  2VB6 A;  3W2V A;  1R8C A;  4J7Y A;  4OD4 A;  4X4P A;  4P9F A;  4M47 A;  1ORY A;  4RQ8 A;  2R7X A;  4I29 A;  1D1A A;  3RQG A;  4PJL A;  5A69 A;  5IY5 C;  4ZLD A;  2PNO A;  4I2H A;  4RQ0 A;  3JTL O;  4RQ2 A;  2EIJ C;  3NWI A;  4PHD A;  4EUK B;  3TJ5 A;  1UFB A;  2H7O A;  5CFS A;  4NXZ A;  1YLQ A;  1QPU A;  4IRU A;  1HW2 A;  3W2W A;  2FGY A;  4X4N A;  4X5V A;  5T3W A;  4K9B A;  1QLE C;  1MIV A;  1ZQC A;  2QNL A;  4Z9H A;  7ICF A;  5IIO A;  2Q3T A;  3HNI A;  4UBC A;  4RT2 A;  4RWN A;  4KLQ A;  2W4M A;  4X4T A;  1WTY A;  4OAH A;  1FMV A;  4YWQ A;  5J0W A;  3T6J A;  4NLN A;  3TD7 A;  8ICR A;  1TVA A;  3V5Z A;  1Z23 A;  3ZIB A;  3RQF A;  4E17 A;  3HNJ A;  3JPO A;  2OEX A;  3DE9 A;  4UAY A;  4YJW A;  4X4R A;  4Q5S F;  4AT8 B;  4XRH A;  3GOR A;  3IQC A;  4YD2 A;  3VM6 A;  3ATP A;  256B A;  4D4N A;  5KYY A;  5L3V A;  3S90 A;  2L9J A;  4Z9I A;  3H2U A;  1WOT A;  3KYI A;  2HSQ A;  4KNV A;  3O55 A;  3G50 A;  3LS0 A;  2GWS A;  1NFO A;  3WFP A;  2GDC A;  3ZSU A;  4O5E A;  3RQE A;  1JAF A;  2W45 A;  4BJT A;  4K1O A;  3AUO A;  4H4K C;  4RDA A;  1M56 C;  2A69 F;  1KU2 A;  1WGW A;  4Z6F A;  2HUJ A;  1FFT C;  3ABM C;  4P6I C;  1EI7 A;  1K04 A;  1J8M F;  4KB6 A;  4JW1 A;  2IOQ A;  4BEJ A;  4I0U A;  4RPX A;  4X4V A;  9ICV A;  3C2K A;  4E18 A;  1VYI A;  2J8W A;  2ETS A;  3PMN A;  4I2D A;  3JSZ A;  4MQ9 F;  8ICE A;  4PJN A;  4RD9 A;  2PFN A;  1W2W A;  5J0X A;  1VFG A;  1TFK B;  5JP7 A;  3ZC4 A;  4QZ9 A;  3I5P A;  4PFP A;  9ICJ A;  3MGH A;  4N6C A;  3ZDL A;  3N2Z B;  1O3U A;  9ICH A;  3DAG A;  4AL0 A;  2WL8 A;  5BQI A;  4WBZ A;  7ICL A;  3POV A;  4WQK A;  1ZQH A;  3RJF A;  1JAJ A;  3WHN A;  2BCS A;  1V4A A;  1WWP A;  2P61 A;  4I2J A;  2XXA A;  3B0Y A;  5FCL A;  3AG2 C;  4AE4 B;  4LT6 A;  3SEO A;  4P9T A;  4E8F A;  7ICM A;  4PJM A;  2JX0 A;  2B0H A;  2NUP A;  2KNH A;  3L1M A;  5F2V O;  2DR5 A;  4XWJ A;  4JWM A;  3ERC C;  3K1I A;  2HN2 A;  2O1P A;  4LLE A;  5EK0 A;  3ECS A;  2FMP A;  3QMK A;  4AL1 A;  4MVQ A;  3AG1 C;  3H65 A;  1Q0K A;  5B3Q A;  3OUY B;  4R32 A;  1FTS A;  4M9N A;  5J0O A;  2UUI A;  9ICB A;  3DXJ F;  3G4Z A;  4XEK A;  1ZQF A;  1WAT A;  3EGD B;  4FH5 A;  4R63 A;  5J2B A;  2VCC A;  4G78 A;  3L9D A;  1QZX A;  1HY5 A;  3B0X A;  1RXQ A;  2X51 A;  5A6A A;  3I5Q A;  8ICU A;  4MF8 A;  9ICR A;  2EPN A;  1O5H A;  5J2F A;  4K0D A;  5F5F A;  4KLT A;  2BL2 A;  2EPL X;  3DZA A;  3U3B A;  5HHI A;  2IXO A;  3JT1 A;  5DS6 A;  4BEM J;  3V5Y A;  4MW3 A;  4NLK A;  1L7C A;  2QTV A;  2R7R A;  4KLI A;  2OJE D;  5L0G A;  3MBY A;  3FVY A;  8ICW A;  2EPK X;  1GGQ A;  3TOL A;  4OIN F;  2R7W A;  1JMS A;  1EKY A;  1TWG A;  4DXW A;  3LLI A;  3SNH A;  4MS2 A;  2R7T A;  1O87 A;  2ISO A;  1BPB A;  1OW6 A;  9ICI A;  4U9D A;  3U8P A;  4YT8 A;  4OIR F;  5DB6 A;  2YWA A;  4GXK A;  1NOM A;  1MMG A;  9ICL A;  1R5I D;  2DR9 A;  4X4S A;  3ABL C;  3DJU B;  1YAR O;  5J2K A;  4I27 A;  1WN0 A;  4M2Y A;  4QDL A;  3M4B A;  4CBE A;  3DM5 A;  1LPE A;  5A6B A;  4R64 A;  2J9W A;  4X0R A;  2J7P D;  5B1B C;  4C7O A;  3ISD A;  4C3D A;  4MW8 A;  4DRI B;  3RJH A;  1T6U A;  1H7I A;  4CS8 A;  3KPH A;  2CNW D;  2YZS A;  5EOZ A;  3JPS A;  1M57 C;  1LI5 A;  4UD5 A;  1ZQR A;  1HMD A;  3PNC A;  5A6K A;  4ULW A;  5CI9 A;  3EPV A;  3IPM O;  1A0B A;  2IUB A;  7ICH A;  2DR7 A;  4QI0 A;  2R03 A;  3EH2 A;  4A4A A;  1PD1 A;  3LNM B;  3RYL A;  1YA9 A;  1VOM A;  4U5F E;  9ICS A;  2YKZ A;  3V5X A;  2G3V A;  4FH3 A;  2VAS A;  4WBY A;  3OGU A;  4NLZ A;  2Q00 A;  4XEF A;  3MFN A;  4J30 B;  2Q9C A;  4O5C A;  2DYR C;  3JZ0 A;  3B9Q A;  3MDA A;  4CX9 A;  3US6 A;  3J06 A;  1ZQB A;  4MVZ A;  4N4W A;  4ER9 A;  4FO6 A;  4NXW A;  4FWV A;  5DQZ A;  2PF4 E;  1YDI A;  2ZHB A;  3SYN A;  1TWC A;  3LEO A;  8ICK A;  2Y39 A;  5L0I A;  3RVZ A;  1S7Z A;  2LCH A;  9ICP A;  3A11 A;  3Q6N A;  5KYX A;  5EGY A;  3V72 A;  1VMA A;  3BRJ A;  4I3M A;  1AUE A;  2O5A A;  3JPT A;  2L81 A;  3WFS C;  2HFI A;  2DGJ A;  3U9M A;  1R89 A;  1OCR C;  1E2X A;  2Y3B A;  4EHP A;  4DOB A;  2PFO A;  2XL8 A;  2E87 A;  2L6F A;  3HJC A;  1BR2 A;  1BPE A;  5GPG B;  1MMA A;  4YL0 A;  4WGZ A;  1AEP A;  4RQ4 A;  2A6H F;  2Z15 A;  2NUT A;  5BQG A;  4UB4 A;  1BZ4 A;  2CYD A;  4KLU A;  4IGG A;  1U89 A;  1F1M A;  2Q66 A;  2R02 A;  3WFO A;  4KLM A;  1BPZ A;  5DKW A;  3DKA A;  5IIM A;  1RJ9 B;  3VYW A;  4YL1 A;  4PGQ A;  3U2L A;  4BJ1 A;  1OW7 A;  1H9T A;  4YCX A;  2CW0 F;  4JJG A;  3JRT A;  5D46 A;  3CEX A;  1I5N A;  4OAI Z;  1C02 A;  1TR2 A;  1T01 A;  4E0I A;  3FOO A;  4MFC A;  4E80 A;  5HRK A;  3I4U A;  5B1A C;  3TUL A;  1NFN A;  2AP3 A;  4U5B E;  4HEA J;  5D92 A;  3MCR A;  5D62 A;  2PX3 A;  5DEC A;  2I15 A;  4I2E A;  4IQT A;  4JTA B;  1V54 C;  2VCB A;  2ZD9 A;  4KLG A;  2OJQ A;  5L3Q A;  1E86 A;  4AK9 A;  5J0R A;  2XM0 A;  2EIN C;  3R7C A;  3EG9 A;  4EED A;  4BJ5 C;  5J2E A;  2PBE A;  4UAW A;  9ICA A;  3C2L A;  4JCH A;  4K4I A;  5JS5 A;  2CGE A;  3RJK A;  1GPJ A;  4RQ3 A;  1LIH A;  5HC9 A;  4FHV A;  4W8P A;  4CS9 C;  4F5R A;  7ICU A;  3ZTM A;  1ZQI A;  5JT4 A;  1A7E A;  4JVS A;  1TV9 A;  1R4T A;  4KLD A;  4XEV A;  1TFY A;  1NSG B;  4YT2 A;  2ASR A;  2ZXP A;  8ICT A;  3K66 A;  2FMQ A;  1XZQ A;  2LSE A;  3EH1 A;  3SP1 A;  1ZQW A;  3RF3 A;  1NG1 A;  3C8G D;  2ZXR A;  1ZQS A;  4MTG A;  4XQ7 A;  1RJ9 A;  4MF2 A;  1HUO A;  3HX0 A;  2J9B A;  1D0Y A;  5EHH A;  2PFP A;  1FFH A;  1ZJN A;  4AT7 A;  3FHD A;  3AQK A;  8ICB A;  1CGO A;  2VC9 A;  1MQ2 A;  1ZQJ A;  3DE8 A;  3GWL A;  1Z3I X;  3QVY A;  4BJ6 A;  2OU6 A;  1Q79 A;  3H3A A;  2DB4 A;  4LEY A;  1GS9 A;  3F46 A;  4CIP A;  4WOY A;  5J2A A;  4QZB A;  3CK6 A;  5KYU A;  3A9C A;  1ZQY A;  9ICM A;  3HIY A;  4O67 A;  4UAZ A;  3PHZ A;  3C18 A;  3LES A;  2ZPA A;  4ZLC A;  3JCF A;  2XLM A;  3AOU A;  4IWB A;  3LUT B;  2JPU A;  4XQ8 A;  5E3A A;  5HV9 A;  2EIL C;  3UR3 C;  4NM1 A;  4RQ5 A;  4M63 A;  4M9G A;  4X0B A;  3DM9 B;  4U5G A;  3VAY A;  2ZH1 A;  7ICT A;  1LI7 A;  3OVB A;  2BCQ A;  2QLA A;  4GXI A;  7ICJ A;  2I8B A;  5KYX B;  4CS9 A;  4MFA A;  5DS4 A;  4IG8 A;  1BBH A;  1PD0 A;  2Q4F A;  3U9J A;  2IXP A;  4XLN F;  1RPL A;  5CFU A;  3RKO F;  5TZV A;  3S9O A;  1OQC A;  2MYS A;  3QTH A;  9ICN A;  4MVM A;  3GOD A;  2JD3 A;  1OR3 A;  3PDM P;  4LEV A;  2Q9B A;  4C3E A;  4RQ1 A;  3DWW A;  1FAP B;  4QZG A;  5DQT A;  1QSP A;  1FA0 A;  3T4R A;  2IHO A;  7ICN A;  3CSK A;  4YMN A;  3SXM A;  3ZTZ A;  2J0X A;  5HSW A;  3ER8 C;  4WC5 A;  4YL3 A;  5A6J A;  1ZW3 A;  1F5A A;  4KLJ A;  8ICO A;  2BE5 F;  1ZQP A;  4UB2 A;  2Y3G A;  5DBB A;  2HV7 A;  5CB1 A;  1YA7 O;  3NMK A;  4O5K A;  5KYU B;  5JSL A;  4MKP A;  3AU6 A;  3JPQ A;  1FNT c;  4P2H A;  1Y6D A;  4XA5 A;  2J9U A;  4AT7 B;  3DJN B;  5J0P A;  4OAG A;  3HWT A;  1JQR A;  1A7D A;  4PR9 A;  1G4U S;  8ICN A;  4RPY A;  4AE4 A;  4DJ9 A;  4N6H A;  4WC1 A;  1V55 C;  2Y3D A;  4RWP A;  1BPX A;  1VK5 A;  4QZC A;  4DOZ A;  3JSE O;  3RH3 A;  3OWT A;  3W4Y A;  2GAQ A;  4JZA A;  2A1D D;  2LQG A;  4CDY A;  3IEE A;  3H37 A;  2ZHA A;  2G62 A;  3SXY A;  2H7V C;  2AU5 A;  1G5Z A;  3AQB A;  1VTM P;  2G3K A;  5BUO A;  4LEW A;  2B56 A;  1UG7 A;  5DB9 A;  4LZG A;  3AGU A;  1JRA A;  3L34 A;  1ZQU A;  4YN0 B;  1KEJ A;  1ZW2 A;  2V26 A;  2HMZ A;  3GM1 A;  4QI2 A;  1SZI A;  4HFK B;  3FAP B;  4FHP A;  3L8J A;  2DVI A;  2EPM X;  4ANJ A;  3X2Q C;  3ZWI A;  1TWH A;  4CDV A;  1RZT A;  2CNW A;  4N06 A;  5CWR A;  2DR8 A;  3UPS A;  1XZP A;  2ZH3 A;  1MIW A;  3AQC A;  3WAQ A;  4YD1 A;  4OIP F;  1L3P A;  4UB3 A;  2C04 A;  5T3T A;  1YYJ A;  3S28 A;  1JN3 A;  4I2F A;  1BR4 A;  3DMD A;  4BJ5 A;  3C2M A;  2M2W A;  4F5O A;  1FMW A;  5AC5 A;  3H38 A;  4CSA A;  1HE9 A;  3M15 A;  3UMK A;  3V7K A;  9ICF A;  4JEB A;  4JTD B;  3NVO A;  3UXN A;  1K40 A;  1NZE A;  1JR8 A;  2M64 A;  9ICW A;  4KM5 A;  2LFD A;  3AQM A;  1OCZ C;  4K4H A;  3NRH A;  4PK4 A;  5HRF A;  4TUS A;  5DDM A;  4CIH A;  3H2V A;  2C03 A;  3TJ6 A;  4Z6C A;  4KI2 A;  2X0C A;  1RKE A;  3UMI A;  5L0F A;  3RH5 A;  4U5C E;  4TUR A;  4K9A A;  1IZM A;  4EP7 A;  2QY9 A;  4F5Q A;  1DOW A;  2XS1 A;  4M04 A;  4EBB A;  5L0J A;  4EIY A;  4Z6D A;  1YVI A;  2FMS A;  4UB5 A;  3RJJ A;  3HTK C;  3ITF A;  4NXU A;  1Z6A A;  4G7H F;  4KC9 A;  5HR9 A;  4O69 A;  2BBJ A;  9ICO A;  4JWN A;  2P1A A;  3AG4 C;  1ST6 A;  1C03 A;  1HW1 A;  8ICL A;  4U9E A;  4YMO A;  4FES A;  4ATB A;  2QUP A;  4PGY A;  2OG2 A;  2J9V A;  2WB7 A;  3MBG A;  2ZH6 A;  2VH3 A;  3EGD A;  4O6A A;  5IIN A;  2PFD A;  2V3C C;  4FO1 A;  2IHM A;  3LAY A;  4JRZ A;  4WGY A;  3PMR A;  2NRK A;  2ID1 A;  4PHA A;  4PHP A;  2FCL A;  1QQ3 A;  3EG9 B;  1H6G A;  3B0P A;  4RQ6 A;  4KLL A;  4B6I A;  3C5F A;  4MVU A;  5HRL A;  5J2D A;  5DED A;  3GM3 A;  1G4W R;  3VRC A;  4F5N A;  1KNY A;  3V7J A;  1MQ3 A;  4N7R A;  3F47 A;  2I9G A;  1RMV A;  5D4B A;  1AVO B;  3ISB A;  4GYT A;  3JCU Q;  8ICA A;  2GAF D;  1XSP A;  1YYX A;  1GM5 A;  2YVK A;  9ICX A;  4D4X A;  2YQY A;  4PFO A;  4IAQ A;  5E2Q A;  3MLG A;  2BCR A;  1SF8 A;  2LFF A;  1BR1 A;  7ICI A;  1OCO C;  3IQ6 A;  3U8V A;  2MWQ A;  2YL3 A;  3C63 A;  3RVY A;  4JLX A;  1JPJ A;  5CI8 A;  2CDQ A;  7ICV A;  5IIK A;  2HS5 A;  4Q7C A;  1D1C A;  4IQV A;  5CJ7 A;  2J7P A;  4MTF A;  2BPC A;  7ICE A;  4R65 A;  2A6E F;  4XQ1 A;  3RJI A;  2ZXO A;  2BCU A;  4WC3 A;  5DB8 A;  1N1C A;  4MVR A;  2AVK A;  3NKD A;  3BEH A;  4X4O A;  1ZHX A;  1YZC A;  3ER9 B;  9ICE A;  4NC3 A;  4IJJ A;  1E85 A;  2D4U A;  4QZD A;  4QZI A;  4WC0 A;  3OV7 A;  1JOG A;  8ICY A;  3OVA A;  1BPD A;  9ICQ A;  3MYF A;  3U0C A;  3JPR A;  2ZXW C;  3FXH A;  3FOP A;  3K7D A;  1OXB A;  5HRI A;  4FHX A;  1ZQZ A;  4RQ7 A;  2YHS A;  4OIQ F;  4JC7 A;  3OWG A;  5HRH A;  2HN1 A;  2H7B A;  2MHR A;  4DO9 A;  2VAN A;  5L0H A;  1NU9 C;  5J29 A;  1OR2 A;  1BDJ B;  3ZQV A;  3NMI A;  8ICH A;  1JMW A;  3B0U X;  2AWC A;  3M4C A;  4E7Z A;  3ASN C;  1OU5 A;  2J46 A;  4CDA A;  2B0J A;  2HMQ A;  3EQL F;  8ICX A;  1DOV A;  3JYH A;  4RBN A;  2RD9 A;  1CPQ A;  3C8G A;  5CFT A;  3LEV A;  3X1O A;  4YN4 A;  4AT8 A;  4BJ6 C;  2GA9 D;  4JJF A;  2IXN A;  2IM8 A;  1VYK A;  1MMN A;  5AGF A;  2BC5 A;  3R2P A;  4CSA C;  5D61 A;  4F5P A;  1TFW A;  3V7L A;  3EZI A;  2WZG A;  4G7Z F;  3EF2 A;  5IIJ A;  3TOM A;  4M9L A;  4XUS A;  2HZ8 A;  1ZQT A;  3HNK A;  4PGX A;  3EFO A;  2Y69 C;  1ZQX A;  4EWC A;  1A41 A;  4G0H A;  3HW8 A;  2XLO A;  4NM2 A;  3UGO A;  4LDK A;  3G4X A;  2W4B A;  4I44 A;  3DI5 A;  2NUT B;  1ZQN A;  3HLZ A;  4KLE A;  1ZZP A;  2XLH A;  3E9V A;  4DOC A;  4NY3 A;  5T1D B;  3ASO C;  5J0Q A;  4KNW A;  4KLO A;  5DLJ A;  4RPZ A;  4WC4 A;  4NTA A;  1K05 A;  1D0Z A;  2L7A A;  4O68 A;  4RWO A;  2XS8 A;  4M0A A;  2QE9 A;  2GA0 A;  3U3F A;  1SR2 A;  4OIO F;  5CHE A;  4K4G A;  4KBL A;  1TQG A;  2A0U A;  2XLD A;  4GEH A;  4MVS A;  3RJE A;  4UDV A;  4QZF A;  4P4M A;  5DS5 A;  1GQA A;  4NY8 A;  4MVO A;  1YLM A;  2ICW G;  3LLK A;  2CCY A;  3FAJ A;  5E3C A;  4KLF A;  4M9J A;  2BBH A;  4A2N B;  4E0H A;  5COM A;  5IIL A;  4E7X A;  2OOC A;  3ZVR A;  1TKN A;  2OCC C;  3Q7L A;  5KYW A;  1Y4C A;  2OEV A;  1CGN A;  4RT3 A;  1LVK A;  3NYM A;  4I2C A;  3L8I A;  5K0I A;  5B3P A;  2KYH A;  2W9M A;  3IQT A;  4H54 A;  4IAR A;  5J2J A;  3W8H A;  5HRD A;  9ICK A;  1U6H A;  2KSF A;  4WAB A;  5HRG A;  4WC7 A;  4FHY A;  4QZA A;  3UXP A;  4XTK A;  2OQM A;  3EHM A;  8ICQ A;  3AQL A;  3QZC A;  4E7S A;  4JIO A;  4CJG A;  4ULV A;  2XL6 A;  4KLS A;  2EIK C;  1QVX A;  3FMS A;  2RFF A;  1D0X A;  3QW1 A;  1Q0M A;  1MIY A;  3PHF 2;  3NDB B;  4M5D A;  4AT9 B;  4OAF A;  4K98 A;  2EWR A;  9ICU A;  2HJ3 A;  3GAN A;  4NXT A;  2Y3H A;  3WG7 C;  4K7B A;  4P4P A;  3H39 A;  2XLE A;  2H8A A;  8ICV A;  5BPC A;  5COG A;  2PXI A;  2NSF A;  1VJ7 A;  4PHE A;  5A6B D;  4TUP A;  2XL4 A;  1ZQE A;  1E84 A;  1OXK A;  4I28 A;  3MX3 A;  2LD6 A;  2XRH A;  4LDQ A;  1CPR A;  3LS1 A;  4UBB A;  4JEA A;  2P66 A;  4YK5 A;  3NKE A;  1HUZ A;  2FFH A;  1I4Y A;  3DAF A;  2GFH A;  4I2A A;  2WVN A;  1ORJ A;  1YZA A;  3LQC B;  4QZE A;  3S0X A;  5HRE A;  1WOL A;  4QZ8 A;  1LE2 A;  5DB7 A;  3SZR A;  1ZQM A;  1BPY A;  3S29 A;  4NKT A;  1PCX A;  4DRJ B;  2R7V A;  3EHN A;  3EGX B;  2IXM A;  2KC3 A;  1OCC C;  1ZHY A;  5CIV A;  3Q7G A;  2R7S A;  8ICI A;  3JRM O;  4NTF A;  3U2M A;  5DDY A;  4JKV A;  4WCW A;  8ICC A;  5JRA A;  3HKK A;  5DBC A;  3U5S A;  4LAC B;  2WZF A;  1LS4 A;  5L0D A;  4PPX A;  1LKX A;  4NCQ A;  3V7O A;  4EEB A;  2LP4 A;  3OA1 A;  4FAP B;  3EGX A;  3CZ6 A;  1MMD A;  4ATB B;  2M4E A;  3C7J A;  2XSE A;  3JPN A;  2GWW A;  5F5H A;  1Z5Z A;  4O6M A;  5J2C A;  4DVZ A;  2YEV A;  4XPW A;  7ICS A;  2HV6 A;  1D1B A;  2ZH8 A;  4U5D E;  8ICG A;  4EV6 A;  4K97 A;  5F28 E;  2A0B A;  5III A;  5JTG A;  2L6H A;  3K75 D;  2ZH4 A;  4O6Y A;  1XWJ A;  3UMH A;  2KW3 C;  4LVS A;  5J2I A;  3HNL A;  9ICT A;  3C62 A;  4EKW A;  4W8K A;  4PAC A;  4I2I A;  5D49 A;  2BPG A;  3MGI A;  3TFS A;  1CGM E;  1HMO A;  9ICC A;  4O79 A;  3UGP A;  1YAU O;  3B71 A;  4LER A;  3WFR E;  4I2B A;  3KH2 A;  3T6B A;  1ZQA A;  3S84 A;  2ZH9 A;  8ICF A;  4HE8 D;  2VCA A;  3IQ5 A;  2KQ9 A;  8ICP A;  2DRB A;  8ICZ A;  5J0Y A;  5BOM A;  4DBR A;  2M2U A;  3QVZ A;  1WAS A;  4S3N A;  4O9M A;  1ZHW A;  4GXJ A;  1R8A A;  3AQN A;  4YMM A;  2ZH5 A;  3OEO A;  4TUQ A;  1ZHT A;  5KYN A;  5BQH A;  4BPM A;  2WVO A;  4CJO A;  1PX5 A;  3AG3 C;  5CP2 A;  1ZQO A;  1ZU4 A;  1Z7Q c;  3SXZ A;  1G8X A;  3NKU A;  3UQ2 A;  3Q6M A;  3B0V C;  4NQF A;  4DRH B;  4NXV A;  2YRF A;  4DOA A;  3SXK A;  2R05 A;  1C17 M;  3ZG1 A;  3S27 A;  1U0B B;  1ZVZ A;  1S05 A;  4AX2 A;  3K1I C;  3M1C B;  2YLG A;  4XPX A;  5D91 A;  2Q7R A;  2XLW A;  2YL1 A;  2TMV P;  4WC2 A;  8ICS A;  3PCV A;  3KYJ A;  3TQO A;  1R8B A;  2PP4 A;  1UEU A;  3OUY A;  3NYJ A;  7ICQ A;  1VB5 A;  4L6R A;  4EBK A;  3GEI A;  3KL4 A;  3WFQ E;  2YL0 A;  1VLS A;  2R9R B;  4LEZ A;  5B3I A;  3L0I A;  5E33 A;  2FAP B;  1UET A;  1MQV A;  3WOD F;  1PV3 A;  3GM2 A;  2EIM C;  2LK4 A;  3HJ1 A;  2KK1 A;  2NSG A;  3B29 A;  4XJE A;  5TJ5 E;  2D5R B;  3MYI A;  3LNR A;  2J45 A;  3N24 A;  4I1O B;  3GDX A;  1RCP A;  2HJM A;  4JCZ A;  3UQ0 A;  2XM4 A;  3NMJ A;  4HFF B;  1OKK D;  5L0C A;  3AJM A;  1Q0D A;  3C66 A;  3KKB A;  1ZYR F;  3JPP A;  4XPY A;  1FR0 A;  5J2H A;  1Q78 A;  4G7O F;  2KJG A;  2DI3 A; 
#chains in the Genus database with same CATH homology
 4LT6 A;  4GXI A;  4E8F A;  7ICJ A;  7ICM A;  1UEV A;  2JX0 A;  4M9H A;  5F2V O;  4MFA A;  4IG8 A;  2DR5 A;  4JWM A;  2O1P A;  4F5P A;  5CA7 A;  3ISC A;  3V7L A;  1TFW A;  4MFF A;  3RH4 A;  5DBA A;  1RPL A;  5TZV A;  3S9O A;  5CHG A;  2FMP A;  1ZQV A;  5IIJ A;  3RJG A;  4M9L A;  4XUS A;  1KDH A;  1ZQT A;  8ICJ A;  4PGX A;  3OUY B;  9ICN A;  4R32 A;  4M9N A;  1ZQX A;  2HSB A;  5J0O A;  3LK9 A;  9ICB A;  3C8G B;  3HW8 A;  4X4Q A;  4NM2 A;  4RQ1 A;  4XEK A;  2BE3 A;  1ZQF A;  5BOL A;  4EBJ A;  4QZG A;  1FA0 A;  1ZQN A;  4FH5 A;  4R63 A;  7ICN A;  5J2B A;  4KLE A;  3L9D A;  1ZZP A;  7ICG A;  2DRA A;  7ICR A;  3B0X A;  4DOC A;  4X0A A;  4YMN A;  5J0Q A;  1KTM A;  5J2G A;  8ICU A;  4LZD A;  2PFQ A;  4MF8 A;  4KLO A;  9ICR A;  4AT9 A;  4RPZ A;  2HHP A;  3HJ4 A;  5J2F A;  3RH6 A;  4WC4 A;  1K05 A;  4WC5 A;  4RWO A;  1F5A A;  4KLJ A;  2L6G A;  5HHI A;  4M0A A;  4KLT A;  3U3F A;  8ICO A;  1ZQP A;  4UB2 A;  4NLK A;  3UXO A;  5DBB A;  4K4G A;  5CB1 A;  3MDC A;  4O5K A;  4UB1 A;  3O10 A;  7ICK A;  3RJE A;  4KLI A;  3AU6 A;  4QZF A;  3JPQ A;  3MBY A;  4P2H A;  4P4M A;  4XA5 A;  8ICW A;  3TFR A;  4AT7 B;  4NY8 A;  3AU2 A;  1JMS A;  5J0P A;  3HWT A;  2ISO A;  1BPB A;  1OW6 A;  1ZQG A;  9ICI A;  4KLF A;  1JQR A;  4M9J A;  5J0T A;  4I2G A;  5DB6 A;  8ICN A;  4RPY A;  5IIL A;  4RWQ A;  2YWA A;  4WC1 A;  4E7X A;  1NOM A;  4GXK A;  7ICP A;  4RWP A;  1BPX A;  4QZC A;  9ICL A;  2DR9 A;  4X4S A;  5J2K A;  4I27 A;  4RT3 A;  4M2Y A;  4I2C A;  3L8I A;  1XSL A;  4NKU A;  2W9M A;  2ZH2 A;  4IQU A;  3OVS A;  5J2J A;  4R64 A;  5HRD A;  9ICK A;  5HRG A;  4WC7 A;  3H37 A;  4FHY A;  2ZHA A;  4QZA A;  3ISD A;  3UXP A;  1ZJM A;  2M2V A;  8ICQ A;  3RJH A;  3AQL A;  3UPQ A;  5EOZ A;  3JPS A;  4QZH A;  4UD5 A;  1ZQR A;  5DB9 A;  5HRB A;  4LZG A;  3PNC A;  4KLS A;  1QVX A;  1NO5 A;  2RFF A;  1ZQU A;  9ICG A;  1KEJ A;  7ICH A;  2BPF A;  3C5G A;  5HHH A;  2DR7 A;  1MIY A;  2BCV A;  4PH5 A;  3GM1 A;  4M5D A;  4IQW A;  2M2T A;  1ZQK A;  4FHP A;  3L8J A;  2DVI A;  9ICS A;  4AT9 B;  8ICM A;  4FH3 A;  1RZT A;  9ICU A;  4WBY A;  3OGU A;  1ZQL A;  4NLZ A;  2Q00 A;  4XEF A;  5CWR A;  2DR8 A;  3MFN A;  3UPS A;  4O5C A;  2ZH3 A;  3JZ0 A;  3MDA A;  1MIW A;  4YD1 A;  4P4P A;  4UB3 A;  3H39 A;  2ISP A;  1ZQB A;  1JN3 A;  4I2F A;  8ICV A;  5BPC A;  4FO6 A;  4Z6E A;  2PXI A;  2ZH7 A;  1VJ7 A;  5J0S A;  3C2M A;  4PHE A;  4TUP A;  4P4O A;  1ZQE A;  2M2W A;  4F5O A;  4FHW A;  4I28 A;  1XSN A;  3H38 A;  2ZHB A;  5J0U A;  8ICK A;  3V7K A;  4WC6 A;  9ICF A;  3UXN A;  1K40 A;  4UBB A;  3PML A;  4R66 A;  2P66 A;  9ICP A;  9ICW A;  1HUZ A;  3AQM A;  4K4H A;  3V72 A;  4I2A A;  4X4U A;  5HRF A;  4TUS A;  3LQC B;  3BRJ A;  4QZE A;  5DDM A;  5HRE A;  2O5A A;  1WOL A;  4QZ8 A;  5DB7 A;  3JPT A;  1ZQM A;  3WFS C;  4UD4 A;  1OW8 A;  1BPY A;  4Z6C A;  4NKT A;  1R89 A;  7ICO A;  1ZQD A;  3NYB A;  3RH5 A;  3JYY A;  4DOB A;  4KLH A;  4TUR A;  2PFO A;  5CR0 A;  2L6F A;  4EP7 A;  4F5Q A;  8ICI A;  1ZQQ A;  1BPE A;  5DDY A;  4M04 A;  4WCW A;  8ICC A;  4Z6D A;  5DBC A;  2FMS A;  4UB5 A;  1R8C A;  4RQ4 A;  3RJJ A;  4X4P A;  4M47 A;  4UB4 A;  4PPX A;  4RQ8 A;  4I29 A;  5HR9 A;  4KLU A;  3RQG A;  9ICO A;  4JWN A;  2Q66 A;  3WFO A;  4KLM A;  1BPZ A;  5DKW A;  4I2H A;  5IIM A;  8ICL A;  4YMO A;  4RQ0 A;  4ATB A;  4RQ2 A;  4PGQ A;  4PGY A;  4ATB B;  4PHD A;  1OW7 A;  4YCX A;  3JPN A;  2ZH6 A;  1UFB A;  4NXZ A;  5D46 A;  1YLQ A;  5J2C A;  5IIN A;  7ICS A;  2ZH8 A;  8ICG A;  2IHM A;  4MFC A;  4E80 A;  5HRK A;  4X4N A;  2NRK A;  2ID1 A;  4X5V A;  5F28 E;  3TUL A;  1MIV A;  5III A;  4PHA A;  4PHP A;  2L6H A;  1ZQC A;  3K75 D;  2ZH4 A;  7ICF A;  5IIO A;  4RQ6 A;  4KLL A;  4UBC A;  3C5F A;  4LVS A;  5J2I A;  4RT2 A;  9ICT A;  5HRL A;  5DEC A;  5DED A;  3GM3 A;  5J2D A;  4I2E A;  4RWN A;  4IQT A;  4I2I A;  5D49 A;  2BPG A;  4F5N A;  1KNY A;  3MGI A;  3V7J A;  1MQ3 A;  4KLG A;  4KLQ A;  4X4T A;  3TFS A;  2I9G A;  1WTY A;  9ICC A;  5D4B A;  3ISB A;  3B71 A;  5J0R A;  8ICA A;  3WFR E;  5J0W A;  1XSP A;  4NLN A;  4I2B A;  8ICR A;  5J2E A;  2PBE A;  2ZH9 A;  4UAW A;  1TVA A;  1ZQA A;  8ICF A;  9ICA A;  9ICX A;  3C2L A;  8ICP A;  2DRB A;  4K4I A;  3RQF A;  8ICZ A;  3JPO A;  3RJK A;  2BCR A;  5J0Y A;  4RQ3 A;  4UAY A;  5BOM A;  2M2U A;  4FHV A;  4AT8 B;  4X4R A;  5HC9 A;  7ICI A;  4XRH A;  4F5R A;  4S3N A;  4YD2 A;  7ICU A;  4O9M A;  1ZQI A;  4GXJ A;  1R8A A;  3AQN A;  4YMM A;  2ZH5 A;  1TV9 A;  4TUQ A;  4KLD A;  1WOT A;  5IIK A;  7ICV A;  1PX5 A;  4IQV A;  2GWS A;  4XEV A;  5CJ7 A;  2BPC A;  7ICE A;  5CP2 A;  3WFP A;  4R65 A;  1ZQO A;  1TFY A;  4O5E A;  3RQE A;  3RJI A;  2BCU A;  8ICT A;  4WC3 A;  5DB8 A;  3UQ2 A;  3AUO A;  2FMQ A;  4NQF A;  4X4O A;  4DOA A;  1ZQW A;  9ICE A;  4Z6F A;  3C8G D;  1ZQS A;  4XQ7 A;  4MF2 A;  1HUO A;  3HX0 A;  1K04 A;  4QZD A;  4QZI A;  4WC0 A;  3OV7 A;  1JOG A;  8ICY A;  2PFP A;  3OVA A;  1BPD A;  9ICQ A;  3U0C A;  4RPX A;  3JPR A;  1ZJN A;  4AT7 A;  3AQK A;  3K7D A;  8ICB A;  4X4V A;  5HRI A;  1MQ2 A;  4FHX A;  1ZQZ A;  4RQ7 A;  1ZQJ A;  9ICV A;  4WC2 A;  8ICS A;  3C2K A;  1R8B A;  5HRH A;  3PMN A;  1Q79 A;  1UEU A;  4I2D A;  3OUY A;  3H3A A;  8ICE A;  4DO9 A;  7ICQ A;  2VAN A;  4EBK A;  2PFN A;  5J0X A;  5J29 A;  1VFG A;  5J2A A;  4QZB A;  3WFQ E;  8ICH A;  1ZQY A;  4QZ9 A;  9ICM A;  3HIY A;  4UAZ A;  3C18 A;  1UET A;  9ICJ A;  1OU5 A;  1PV3 A;  3MGH A;  3GM2 A;  2LK4 A;  3HJ1 A;  1O3U A;  9ICH A;  2KK1 A;  2JPU A;  4XQ8 A;  4NM1 A;  4RQ5 A;  4WBZ A;  7ICL A;  8ICX A;  4M9G A;  3GDX A;  4X0B A;  3UQ0 A;  1ZQH A;  3RJF A;  1JAJ A;  2BCS A;  3AJM A;  1V4A A;  3C66 A;  1WWP A;  2ZH1 A;  3C8G A;  7ICT A;  4I2J A;  3JPP A;  3OVB A;  4YN4 A;  3B0Y A;  2BCQ A;  4AT8 A;  5J2H A;  1Q78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...