3JYYA

Semet linb complexed with ppi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
265
Chain Sequence
b'MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide nucleotidyltransferase
molecule tags Transferase
source organism Enterococcus faecium
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
total genus 93
structure length 265
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jyyA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jyyA01
3O10A 5IIOA 3RJKA 4KLSA 4WBYA 1NOMA 5HRLA 4GXIA 4P4MA 3C8GB 3L8IA 3MDCA 5F2VO 4YCXA 2L6FA 3JPOA 4UB4A 4YMOA 4RQ8A 2DR9A 4M04A 1ZQSA 1XSLA 9ICLA 5IIJA 4XQ8A 4F5NA 8ICWA 7ICKA 1ZQJA 2FMPA 4X0BA 2BCQA 2PFQA 7ICGA 4WC5A 4F5OA 5F28E 4M9HA 3AUOA 2PFPA 8ICYA 1MIVA 3JPTA 3GM2A 1ZQRA 1JN3A 3K75D 1R8BA 4NKTA 2M2WA 4FHWA 2ID1A 4XQ7A 4RWQA 1KNYA 3WFPA 3C2MA 5DDYA 3RJJA 4P2HA 7ICIA 3L8JA 2M2TA 4KLQA 4R64A 1WWPA 3RJEA 4PHEA 9ICBA 4MF2A 2ZH6A 3HJ1A 2JPUA 5J0YA 5J0OA 4UB5A 4DO9A 4EBJA 4RQ1A 3MGIA 3JPPA 2PBEA 3V72A 4AT7A 4M2YA 4X4PA 4UAWA 9ICXA 9ICOA 4F5RA 8ICPA 8ICCA 4KLFA 9ICKA 2L6HA 8ICGA 5HRKA 2ZH3A 4I2IA 4NM2A 1ZQEA 5HRDA 1OW6A 5DBAA 3TULA 3C8GD 5HRHA 4KLLA 9ICTA 3UPSA 4DOBA 4K4GA 4M9GA 9ICNA 2ZH2A 1OW7A 1ZQMA 4I2JA 3WFSC 1Q78A 4KLTA 3OGUA 5J2HA 3V7KA 3OUYA 7ICUA 2ZHBA 4TUPA 3OV7A 4UD4A 9ICPA 1TV9A 4K4IA 1TFYA 7ICOA 4WC3A 3AJMA 4F5QA 5HHHA 5J2GA 3H38A 4NLNA 1WOLA 4X4TA 4MFCA 4QZ8A 4UB3A 4RQ5A 1ZZPA 1BPDA 4EP7A 1JQRA 5CP2A 5HRBA 3OUYB 3JPSA 1KDHA 8ICBA 7ICNA 2DVIA 4R63A 4QZFA 4YMMA 9ICEA 1ZQQA 3U0CA 5DBCA 4FH5A 1R89A 4XEFA 3C2LA 4O5EA 4QZHA 9ICWA 3AU2A 9ICGA 3ISCA 1ZQNA 1ZQFA 4NKUA 4QZGA 2ISOA 9ICHA 1QVXA 7ICLA 4ATBA 1UEVA 3UQ0A 4AT9A 3UXNA 4I2EA 3V7JA 4I2FA 1XSPA 1UETA 5IIIA 7ICSA 5IINA 1BPXA 4RQ0A 4XRHA 3RJGA 4RQ4A 4TURA 1ZJMA 4KLOA 7ICFA 2BPFA 4XEVA 9ICIA 1R8AA 1UFBA 5J2BA 4LVSA 4RQ6A 5HHIA 3AQMA 5D46A 5IILA 4QZCA 3RQGA 4X5VA 4NY8A 1FA0A 4X4RA 8ICMA 3HW8A 4X4NA 3PMNA 1V4AA 3HJ4A 5DB8A 4X4OA 2DR8A 5DECA 2KK1A 4NM1A 4E7XA 4IQVA 2HHPA 3OVBA 9ICCA 2ZH5A 4PGYA 4X4SA 4M9NA 8ICNA 1RPLA 2O5AA 3JZ0A 8ICTA 4WC7A 3C5FA 4PPXA 3OVAA 3PMLA 8ICEA 5J0SA 9ICRA 1K04A 2BCVA 4JWNA 4X4QA 5DKWA 3RH6A 3RQFA 1RZTA 5TZVA 4MFAA 5J0WA 1ZQWA 5HR9A 4QZEA 8ICLA 3GM1A 2BE3A 4Z6EA 4O5CA 7ICRA 5J2DA 4KLIA 2ZH7A 2FMSA 1ZQDA 4RQ2A 2I9GA 1ZQGA 4KLEA 4IQUA 5BOMA 5J0QA 3AU6A 4UB2A 9ICVA 5EOZA 3RH5A 9ICJA 4YD1A 1BPEA 1MQ2A 2DRBA 2YWAA 1TVAA 3LQCB 8ICIA 4IQTA 4UD5A 2LK4A 8ICRA 4QZDA 4NLZA 5D49A 4R65A 9ICSA 4EBKA 4RWNA 4I27A 4I2GA 4FH3A 1KEJA 1ZQPA 1WTYA 1MIYA 3OVSA 4RT3A 4K4HA 5D4BA 4KLMA 4YD2A 2PFNA 2BPCA 4R32A 1ZQCA 3JYYA 8ICKA 4DOAA 1BPZA 9ICFA 5HRFA 3TFRA 4RT2A 4WCWA 8ICXA 4YMNA 2M2UA 4UBBA 4QZIA 4FHXA 1R8CA 4FHVA 5J0RA 4IG8A 3AQKA 3NYBA 3LK9A 4WBZA 4YN4A 5HC9A 4DOCA 4QZBA 1NO5A 4NXZA 8ICJA 5DB7A 1TFWA 4WC4A 5J0UA 1PX5A 4E80A 5HREA 3ISBA 1ZQZA 2ZH4A 1ZQIA 4AT8B 2Q66A 2GWSA 1PV3A 9ICMA 4I2HA 1O3UA 4IQWA 4X4UA 4X0AA 4RPXA 4I2BA 4XUSA 5J2AA 3V7LA 2M2VA 4UAYA 3HX0A 3C66A 3B71A 4Z6CA 4QZ9A 4R66A 3S9OA 7ICJA 3B0YA 2BCRA 5J2KA 3U3FA 3TFSA 1ZQOA 9ICQA 1MQ3A 4I2AA 1MIWA 5DB6A 2DR7A 3H39A 4RWOA 4RQ3A 8ICZA 4RWPA 4NQFA 3UXOA 1VFGA 2PFOA 4TUQA 5BPCA 4MFFA 4LT6A 2BPGA 4RPYA 3JPQA 4M5DA 4P4PA 2ZHAA 1VJ7A 4QZAA 4X4VA 1F5AA 4I2DA 1JMSA 1OU5A 5J0PA 1KTMA 1ZQAA 2DRAA 4KLUA 7ICMA 2O1PA 3MGHA 1ZQVA 4Z6FA 1HUOA 8ICAA 5IIKA 4LZGA 1ZQHA 3UQ2A 3B0XA 4UBCA 1ZJNA 3JPRA 3UPQA 5J2IA 5J0XA 3MBYA 7ICPA 4I2CA 4PHPA 1ZQXA 3C18A 8ICSA 2W9MA 1ZQUA 1ZQTA 4XA5A 2Q00A 4UAZA 3RJFA 4KLGA 5DEDA 5BOLA 3L9DA 4FHPA 1ZQKA 4NLKA 1XSNA 4UB1A 5DBBA 5CR0A 1WOTA 5DDMA 2ZH9A 1ZQLA 1K05A 7ICVA 1K40A 4TUSA 2PXIA 2IHMA 4FHYA 5CWRA 1BPYA 4LZDA 8ICHA 4WC1A 1HUZA 1UEUA 1ZQBA 4M47A 8ICOA 4WC6A 4MF8A 4P4OA 5J2CA 4GXKA 3WFQE 3AQNA 8ICUA 1JAJA 3BRJA 4ATBB 4WC2A 5HRIA 4AT7B 3UXPA 4FO6A 3K7DA 4O5KA 2NRKA 2FMQA 1BPBA 3GDXA 5CB1A 3GM3A 4I29A 3PNCA 5CA7A 2ZH8A 4KLDA 3MFNA 4E8FA 1ZQYA 2P66A 3RH4A 5CHGA 4WC0A 2ZH1A 5J0TA 7ICTA 3MDAA 4GXJA 3RQEA 7ICEA 4M9LA 4KLJA 2VANA 5J2EA 3RJHA 2L6GA 3HWTA 3ISDA 7ICHA 5J29A 4Z6DA 3C8GA 2BCUA 9ICAA 4S3NA 4I28A 3WFRE 5HRGA 3C2KA 5J2JA 9ICUA 4M9JA 4PHDA 3H3AA 4PH5A 2BCSA 4PHAA 3AQLA 5CJ7A 4RPZA 4AT9B 8ICQA 4PGXA 1Q79A 3RJIA 2DR5A 4O9MA 3H37A 3WFOA 8ICVA 4M0AA 3JPNA 3C5GA 2JX0A 4KLHA 4AT8A 2HSBA 5IIMA 4JWMA 3HIYA 2ISPA 1OW8A 4F5PA 5DB9A 1YLQA 1JOGA 2RFFA 4RQ7A 4PGQA 8ICFA 5J2FA 4XEKA 7ICQA
chains in the Genus database with same CATH superfamily
1MNEA 2R7VA 5F2VO 3JPOA 4CSAA 4UB4A 4C3BA 3C7JA 2C04A 4XQ8A 4F5NA 2KQ9A 7ICKA 2LP4A 2H8AA 7ICGA 1T9KA 3AUOA 5CFSA 3WAQA 1MIVA 3JPTA 1JN3A 3U9MA 4NKTA 4FHWA 2M2WA 2ID1A 3S0XA 4Z9HA 3FAPB 4MVMA 3RJJA 4P2HA 4XPYA 3RJEA 4MW8A 4PHEA 5FZTA 4GEHA 2ZH6A 2Z15A 1M56C 5J0YA 1R4TA 5L3QA 4JTDB 4E7ZA 2A1DD 3UMIA 3JPPA 1C03A 2Q4FA 1MMGA 4M2YA 9ICXA 1YZCA 1H9GA 2G62A 1BR4A 8ICPA 4DJ9A 1L7CA 1OCRC 2XL6A 2RD9A 5HRKA 5HRDA 4MTOA 3TULA 4E0IA 4O79A 4E18A 2GA0A 2XLEA 1ZQMA 4CBEA 1Q78A 3OGUA 1RKEA 3EGDA 2WB7A 3A9CA 3GWLA 4FX5A 4OIOF 4JE9A 3QZCA 9ICPA 1TV9A 4K4IA 1T6UA 5KYXA 1XZQA 2PNOA 3C62A 3JRMO 4X4TA 4QZ8A 4RQ5A 5E3CA 3TOMA 1M57C 2DI3A 4QI2A 1ZQQA 4JEBA 2CGEA 4BJTA 5A6BA 1J8YF 1NSGB 2QY9A 2P6VA 3DD7A 4FH5A 1AEPA 3JSEO 5JUAA 4OAIZ 3HNJA 4K96A 2R7RA 2GAQA 4JKVA 4C3DA 2ISOA 3K1HA 7ICLA 4ATBA 4WGZA 4AT9A 4I2EA 1LKXA 3TD7A 3TQOA 4XRHA 4MVZA 1L3PA 2BPFA 4H54A 4XEVA 1Y6DA 3T6BA 5KYXB 4J32B 4QZCA 3C8ZA 3W8IA 1APCA 3GEHA 1V4AA 4X4OA 2EWRA 3GANA 2R05A 4M9NA 2O5AA 4NXVA 5CI9A 3C5FA 5J0SA 4LDKA 3B29A 4JWNA 3EGXB 5DKWA 3RQFA 1RZTA 2ICWG 3LJBA 3GM1A 1QSPA 5J2DA 4MVSA 3UGOA 2BBHA 5DS4A 1ZQDA 4RQ2A 4IQUA 1O5HA 4D4NA 3IQTA 5BOMA 4MS2A 1F1MA 5EOZA 4KNVA 9ICJA 1BPEA 3VYWA 2DRBA 2YWAA 3K33A 3LQCB 8ICIA 3T6JA 2D4UA 4NLZA 1JPJA 3L1MA 4YL1A 5EK0A 4DVYP 2R7WA 4RDAA 1D0YA 5BQGA 2E87A 5DVWA 3SEOA 4JCHA 3OVSA 2XL8A 4K4HA 5F5HA 5D4BA 4KLMA 3E70C 2PFNA 4MVOA 4NCQA 4YL0A 4K9AA 1ZQCA 3JYYA 4N4WA 4JZAA 4AL1A 3U5SA 2HZ8A 3TFRA 3FOPA 1Q0DA 3QVZA 4UBBA 4QZIA 3JT1A 1R8CA 4FHVA 4O6YA 5J0RA 3AQKA 4IG8A 4BG0A 1YAUO 3LK9A 4YN4A 8ICJA 2GAFD 1TFWA 1PX5A 2NUTA 5HREA 4PJJA 4O6NA 5CIVA 9ICMA 1OKKA 4RPXA 5DS5A 4UAYA 2YZSA 7ICJA 3B0YA 2Q3TA 4K98A 4CX9A 2Y3HA 2L9JA 1OQCA 2EPOA 5IY5C 4RWOA 4YJWA 2IYLD 4G7HF 1VFGA 4TUQA 3K66A 3HLZA 2BPGA 4RPYA 4M5DA 4YK5A 2ZHAA 4AK9A 5HSWA 4I2DA 3RKOF 2R02A 4PJNA 2VC9A 2CYDA 4DBRA 2DRAA 2CCYA 7ICMA 3MGHA 2LFFA 8ICAA 2VCBA 2YQYA 3S29A 4UBCA 1ZJNA 3UPQA 1Z3IX 5J0XA 3RVZA 7ICPA 4I2CA 5E33A 4PHPA 3WODF 3B9QA 4MW3A 3SP1A 3Q6MA 4OIRF 4MTFA 1FNTc 4KLGA 3G4ZA 3OWGA 5DQZA 4UB1A 1YJGA 5CR0A 3ZDLA 5DDMA 2ZH9A 1K05A 2HKVA 1K40A 1C17M 2XLVA 2PXIA 3NVOA 4Q5SF 1UEUA 1ZQBA 4WC6A 2M64A 4P4OA 4MF8A 2EPLX 3NMJA 2J46A 4CS9C 1D0XA 1LIHA 3A11A 1Q0KA 4C7OA 5D63A 3CEXA 1TQGA 4O5KA 3EFOA 1BPBA 3PNCA 3AGUA 3DAGA 3ECSA 2ZH8A 4K8VA 1M2VB 3HNKA 4KLDA 3MFNA 2P66A 2ZH1A 5CFUA 4JLZA 4KLJA 5J2EA 3ZVRA 2BCUA 5L0DA 4I28A 1YA7O 4ONSA 2VASA 2BCSA 4IRUA 3DWWA 2DR5A 4O9MA 3SXZA 5B1AC 4M0AA 3JPNA 3C5GA 2NSGA 2IXPA 3FAJA 1Z7Qc 2BE5F 3EH1A 2QUPA 1QZXA 2J9BA 3HIYA 1OW8A 5DS6A 3G4XA 2RFFA 3TOLA 1I4ZA 2MYSA 2LIGA 5J2FA 2TMVP 3AG3C 4KLSA 5T3WA 4WBYA 1VLTA 1NOMA 2ZXRA 5HRLA 3GORA 4U9EA 4YT8A 3C8GB 4JLXA 3MDCA 4YCXA 4RQ8A 4M04A 1LM3B 3BEHA 3UMHA 5IIJA 1A7DA 4H4KC 2X51A 1ZQJA 4NTBA 3IPMO 3DE9A 1A7EA 2PFQA 2AWYA 5F28E 3TJ6A 4M9HA 4EIYA 1NU9C 5A69A 3K75D 3ZWIA 3DJNB 4RWQA 2D5RB 3WFPA 3L8JA 3ZC4A 2AU5A 2P1AA 3N2ZB 3G50A 4G7ZF 3HJ1A 3H2UA 4OAFA 2ASRA 5J0OA 4UB5A 3JCFA 1YARO 3MGIA 4CDYA 3V72A 3ABLC 1FR0A 4F5RA 2HJ3A 4KLFA 9ICKA 2OU6A 3PCVA 2O9XA 5HRHA 4KC9A 3LEOA 3UPSA 2DGJA 4M9GA 3K6BA 4W8PA 4XWJA 3LS1A 2W4MA 2XRHA 5L0GA 2MWQA 2IXNA 4C3EA 2ZHBA 4UD4A 1TFYA 3LEVA 5DLJA 3NKDA 4IAOA 4N6HA 3H38A 4MFCA 1BPDA 4Q7CA 2LCHA 8ICBA 2FGYA 4NTAA 3SXMA 4OIPF 3U0CA 2XXAB 1RJ9B 5AC5A 4XEFA 3C2LA 4O5EA 1GGQA 1DOVA 9ICGA 1ZQNA 1ZW3A 4NKUA 1UEVA 3UXNA 2XS8A 1OR3A 1OCOC 5JLIA 2LD6A 4QI0A 5IIIA 2KNHA 4MVQA 3C63A 3V7OA 1BPXA 4TURA 1ZJMA 4LLEA 9ICIA 1UFBA 5BQIA 2P7VA 1T5OA 3AQMA 2PF4E 3ER9B 1FA0A 4X4RA 8ICMA 3HW8A 4X4NA 5DB8A 4E7XA 4K1OA 2HHPA 4IQVA 2EIJC 2Q9AA 4PGYA 3NG1A 3HKKA 3UNGC 4WC7A 1XWJA 2GFHA 1Z23A 1FMVA 1G8XA 4JEAA 3T6GB 5L0IA 4BJ1A 1YYXA 1Q0MA 2R9RB 3EZHA 3PMRA 8ICLA 3OEOA 5JT4A 2BE3A 4LDRA 2UUHA 2ZH7A 1U89A 2FMSA 3RFYA 1BZ4A 2I9GA 4KLEA 2V3CC 4ER9A 3S27A 2XS1A 3ZG1A 3AU6A 2YL0A 2NUPB 9ICVA 2YKZA 3HNIA 2A0BA 4JRZA 4JJFA 3AG2C 2BL2A 2F22A 1WN0A 4R65A 4RWNA 4I27A 2EPMX 1KEJA 1ZQPA 1A0BA 1EKYA 4YD2A 1TFKB 1NZEA 2XM0A 2OOCA 2IM8A 2XM4A 2WVNA 3EJNA 2IUBA 4PK4A 4YL3A 4FO1A 1Y4CA 4JURI 4BJ5C 4PJMA 4FHXA 3PHF2 3Q7LA 4PACA 3W4YA 2PFDA 3N0TA 4B6IA 4NXZA 1E85A 4WC4A 5J0UA 4E80A 4I3MA 4RBNA 1ZQZA 3DI5A 4AT8B 1HMOA 4BEJA 1QKRA 3CAXA 5CHEA 4IQWA 1BBHA 4X4UA 3E9VA 4YT2A 1NFOA 4I2BA 4XUSA 2NPUA 3V7LA 4XQ1A 3C66A 3B71A 4K9BA 4XLNF 4QZ9A 2H7BA 4R66A 5J2KA 3V5YA 1MQ3A 4I2AA 2NG1A 1VK5A 1VYIA 4NXXA 4RQ3A 1CPRA 4NQFA 2R7UA 4P6IC 1ZHZA 4ANJA 3JPQA 1IW7F 4P4PA 3EH2A 1VJ7A 4QZAA 4O6MA 4X4VA 3O39A 2JD3A 1JMSA 3I5QA 1JPNA 3S84A 5J0PA 1ZVZA 5KYNA 2IBFA 4I1OB 5EHHA 1ORYA 1GQAA 2B56A 4Z6FA 1HUOA 5IIKA 4LZGA 4WH5A 4OD4A 2UUIA 2YL7A 4LDQA 5J2IA 3MBYA 4KB6A 1ST6A 3C18A 3O6XA 3NDBB 1ZQTA 4UDVA 2Y3BA 4KNWA 3RJFA 2J9UA 2Y39A 5DBBA 2WVQA 4PFPA 4DXWA 1LE4A 4D4XA 2ZXOA 1WOTA 2BC5A 3U9JA 2QLAA 4FHYA 1BPYA 3NKEA 4WC1A 1HUZA 4M47A 1RMVA 4NXWA 1JAJA 3DKAA 5J2CA 8ICUA 3AQNA 3S28A 1D1AA 4AT7B 3UXPA 4RD9A 3GDXA 5CB1A 2Y69C 2R7TA 4IWBA 3EF2A 5KYYB 3DJUB 4YT4A 1PD1A 3EHNA 3M79A 1M2OA 2KGOA 1NBBA 3RH4A 2OEVA 5FCLA 2WL8A 5J0TA 1I4YA 4M9LA 3EFOB 2L7AA 4NC3A 3C8GA 1NG1A 9ICUA 3MX3A 4N6CA 3LLKA 2BBJA 2J8WA 1EA8A 2B51A 5CJ7A 4AT9B 2YEVA 4PGXA 1Q79A 3RJIA 2W45A 4O6AA 5IIMA 3ZQYA 2I8BA 4JC7A 3NWIA 2Q7RA 1YLQA 1JOGA 3W2WA 4RQ7A 3FVYA 2VCAA 1TFOB 4N06A 2P0NA 2QTVA 8ICFA 4K7BA 3Q6NA 3RJKA 5T3TA 3ZQVA 3LS0A 2B0JA 1YA9A 1UG7A 3EPVA 2EINC 4BEMJ 2OQMA 3DXJF 4YMOA 5HV9A 2DR9A 1ZQSA 4AX2A 5EGYA 2YLGA 4G0HA 4X0BA 2BCQA 1G5ZA 3K1IC 4WC5A 4A4AA 2PFPA 8ICYA 1H7IA 3H65A 4KM5A 3B0PA 1R8BA 1RKCA 1D1CA 1QQ3A 1OXKA 1PCXA 1KNYA 1YDIA 2OEXA 5DDYA 3U2LA 3NYJA 2GDCA 4AL0A 4NY3A 4MF2A 1YLMA 2JPUA 1JMWA 4DO9A 1NU7D 2HMZA 4RQ1A 2PBEA 4AT7A 1S05A 4UAWA 1ZHTA 3SNHA 3ERCC 2XLMA 4MTGA 9ICOA 2R7QA 1FFTC 4LLCA 8ICCA 4MQ9F 3LLIA 8ICGA 2ZH3A 5D62A 1ZQEA 5DQTA 2CNWD 4MNDA 1ZYRF 4EWCA 3C8GD 3RF3A 2XLDA 9ICTA 4DOBA 1ZHXA 1RKEB 4GYTA 2YRFA 2ZH2A 4I2JA 2ZD9A 2L81A 4KLTA 3JYHA 3V7KA 3ASOC 3DM5A 3OUYA 2PX0A 4O68A 3VF0A 4TUPA 4IB4A 3OV7A 3EGDB 7ICOA 3EG9B 3PDMP 3AJMA 4OINF 5HHHA 5J2GA 4LACB 4NLNA 1Z63A 1MQVA 1WOLA 1OKKD 4UB3A 2Q9CA 1ZZPA 4EP7A 5HRBA 2WZGA 2DVIA 4R63A 9ICEA 4HE8D 4OIQF 3M15A 5DBCA 3QW0A 3GWNA 4QZHA 3AU2A 1HE9A 4IGGA 3VRCA 4QZGA 9ICHA 1QVXA 4C7OB 4K0DA 3RW0A 2XXAA 3M4CA 3FHDA 4I2FA 1XSPA 1UETA 1QLEC 5IINA 7ICSA 4RQ0A 4EGWA 4LEZA 2DYRC 3RJGA 3IEEA 1RXQA 3T4RA 2GWWA 5A6AA 3MBGA 1R8AA 4ZLDA 1RJ9A 1ZU4A 3JTLO 3ZSUA 4LVSA 2VB6A 3EG9A 1ZU5A 4G78A 3FOOA 2NUPA 3O55A 5BUOA 5D46A 3RQGA 4NY8A 1YVIA 3PMNA 2DR8A 2KK1A 5CFTA 4G7OF 4U5CE 2EPKX 3ZTZA 1XZPA 5L0FA 8ICNA 4JJGA 1RPLA 1MMAA 3JZ0A 8ICTA 3PMLA 8ICEA 9ICRA 4JW1A 1K04A 3X2QC 3ABKC 2W4BA 4X4QA 4Q4ZF 3RH6A 3V5XA 2Q9BA 1D1BA 1YYJA 5HR9A 1RCPA 3PHZA 4O5CA 7ICRA 2OJED 2WZLA 4AE4A 2A69F 1IZMA 1ZQGA 3VAYA 5J0QA 3RH5A 3B0UX 4IJJA 4YD1A 2HN1A 1U6HA 1MQ2A 256BA 4QDLA 1TVAA 4IQTA 1MMDA 4UD5A 4QZDA 5D49A 4EBKA 3NYMA 4IARA 4FH3A 1CPQA 1MIYA 4RT3A 3MCRA 3MLGA 5K0IA 1VTMP 4CS9A 1KU2A 5TJ5E 4DVZA 4EEDA 4R32A 3Q7GA 2LFDA 8ICKA 1V74B 4DOAA 9ICFA 3AG4C 5HRFA 4YMNA 2M2UA 2B0HA 1OR2A 1E2XA 3NYBA 4FWVA 4BJ6A 2NUTB 5HC9A 1E83A 4QZBA 1NO5A 2IXOA 2DYSC 4EEBA 3EHMA 3ISBA 5JVEA 1ZQIA 1E84A 2Q66A 3IQCA 3J06A 3AQCA 1O3UA 4OAGA 4I2HA 1OCCC 1BR2A 4OAHA 5J2AA 2PX3A 2M2VA 3HX0A 5L0CA 3RH3A 4DRIB 4Z6CA 3S9OA 2BCRA 3CSKA 3U3FA 1PD0A 5JRAA 3SXKA 9ICQA 1MIWA 2YL1A 5DB6A 2DR7A 5GPGB 4PJLA 3H39A 1TWCA 4CIHA 8ICZA 1WASA 5L3VA 3UXOA 1VOMA 4MFFA 4LT6A 3I5PA 2R03A 3GEEA 2A6HF 1LS1A 2Y3GA 1GS9A 4P9FA 4IAQA 1F5AA 3ITFA 4WQLA 1C02A 1B68A 2FCLA 4KLUA 3MYFA 4U5FE 3UR3C 1ZQVA 4CJOA 2B4VA 4I0UA 2KC3A 1ZW2A 2PP4A 3JPRA 5B3QA 2J0WA 1GPJA 3NMIA 1H9TA 4E0HA 1ORSC 1WGWA 1ZQXA 8ICSA 4DBQA 1HMDA 2Q00A 5B3IA 4UAZA 3FDQA 4CDAA 2XSEA 2J7PD 1TKNA 5BOLA 3L9DA 4FHPA 4JIOA 3KH2A 1LI5A 4KBLA 2C03A 3US6A 4DOZA 1ZQLA 7ICVA 2KW3C 4DRJB 5CWRA 8ICHA 4LZDA 2EPNA 8ICOA 3WFQE 3BRJA 5B1BC 3LNRA 1T01A 4ATBB 4WC2A 5HRIA 3K1IA 3HTKC 4FO6A 5L0JA 1LVKA 2FMQA 1TWGA 1H6GA 3KKBA 5CA7A 1W2WA 4K99A 1NFNA 2G3VA 3M4BA 4CS7A 4JCZA 1VB5A 4MVUA 4E8FA 3KYIA 3SXYA 1ZQYA 2ZPAA 4WC0A 1YZAA 3R7CA 2YVKA 3U8PA 2YHSA 3FXHA 1SYQA 1VYKA 3MDAA 7ICEA 2EIMC 4GQHA 2VANA 3I4UA 3KMIA 2XLHA 3X1OA 3AQBA 3HWTA 1R5ID 3ISDA 2R7OA 4Z6DA 2J9VA 3WFRE 5HRGA 3C2KA 2I15A 3H3AA 4PH5A 2HS5A 2ETSA 4NXTA 3N24A 2HV7A 2XLOA 3WFOA 8ICVA 2JX0A 3OA1A 4HFFB 3AG1C 4KLHA 2OKUA 4BJ5A 5KYUB 3UMKA 4CS8C 4JWMA 3EQLF 5JTGA 2WVOA 2ISPA 4F5PA 3TK0A 5DB9A 3ASNC 2AP3A 3U8VA 4E17A 1G4WR 2VCCA 3DMDA 4KI2A 2RSEB 3U3BA 4N7RA 2KYHA 4PGQA 4XEKA 3O10A 5IIOA 4O67A 1A7VA 4ULWA 2FFHA 4GXIA 4Z9IA 4P4MA 3L8IA 2L6FA 1WATA 3JRTA 3EZIA 1T6QA 1XSLA 9ICLA 2KSFA 8ICWA 1ZHYA 2HN2A 3QMKA 1HW2A 1S7ZA 2FMPA 2LQGA 3MYIA 2WZFA 4F5OA 3HJCA 3GEIA 4P9TA 4CDVA 2KJGA 2LSEA 4EKWA 1AUEA 3GM2A 1ZQRA 1JRAA 2HV6A 3R2PA 3POVA 4XQ7A 3RVYA 4CJGA 4NTFA 3C2MA 2GA9D 7ICIA 2M2TA 4KLQA 4R64A 1E86A 4ULVA 1WWPA 3ZIBA 9ICBA 4EV6A 4J30B 3F46A 2X0CA 3GODA 2AWCA 4BPMA 4EBJA 3M1CB 4XJEA 4X4PA 5AC4A 4EUKB 1AVOB 1LI7A 3RYLA 2H7OA 3AGTA 2L6HA 3FMSA 3LAYA 4I2IA 4NM2A 4JTCB 1OW6A 5DBAA 4KLLA 4J7TA 4K4GA 9ICNA 1LPEA 3CK6A 1EI7A 2OCCC 1OW7A 3WFSC 4PFOA 5J2HA 3IQ5A 5COFA 2EIKC 7ICUA 4BJ6C 2M4EA 2IXMA 4U5BE 4WC3A 4F5QA 3HNLA 3V5ZA 5B3PA 1Z6AA 1M6TA 4M63A 3LESA 5D92A 1JQRA 3NYLA 5CP2A 1LS4A 3OUYB 3JPSA 1KDHA 7ICNA 5JSLA 4QZFA 4YMMA 5KYUA 2P61A 1R89A 3LNMB 4U5DE 2HFIA 9ICWA 3S90A 4WQKA 3H2VA 1Z5ZA 3WG7C 3ISCA 1ZQFA 3KPHA 4HEAJ 4O69A 4HFKB 3UQ0A 2QNLA 3CQZA 2OJQA 5KYWA 3V7JA 2EILC 2A68F 1JAFA 4LERA 4RQ4A 2DB4A 4KLOA 2A6EF 7ICFA 5D91A 4AE4B 4NXUA 4MKPA 2R25A 3CZ6A 5J2BA 2HJMA 1SF8A 3TJ5A 4RQ6A 5HHIA 2ZXWC 5IILA 2A0UA 4X5VA 1TR2A 4YT5A 3ER8C 3KL4A 3HJ4A 3UGPA 3JCUQ 2CNWA 5DECA 2H7VC 4NM1A 1V54C 4F4BA 3OVBA 2V26A 9ICCA 2ZH5A 1FTSA 4X4SA 1TWHA 4U9DA 3RIPA 4I44A 4WGYA 1VMAA 2ZXPA 1HE1A 5A6KA 3OVAA 4PPXA 3QW1A 1I5NA 2BCVA 2XL4A 3VM6A 3U2MA 5TZVA 3ABMC 4MFAA 2XLWA 5J0WA 1ZQWA 1GM5A 4EBBA 2J9WA 4QZEA 5E2QA 4Z6EA 5KYWB 4KLIA 4U5GA 3DM9B 3NKUA 3NRHA 2AVKA 3KYJA 4PR9A 2MHRA 4Z9JA 4UB2A 3W2VA 2IHOA 4WJ0A 1J8MF 2LK4A 8ICRA 2IOQA 4HX0A 1CGME 9ICSA 3L34A 4L6RA 3WHNA 2FAPB 4JTAB 4I2GA 1OXBA 3ZTMA 1WTYA 3JSZA 1G4US 4K97A 1TWAA 2BPCA 5L0HA 1EQ1A 1Q0GA 5B3SC 1N1CA 1BPZA 2CDQA 4XTKA 4RT2A 4XLPF 4WCWA 8ICXA 5D61A 5A6JA 4J7YA 4OD5A 2G3KA 4CSAC 2OG2A 4I1MA 4WBZA 4MVRA 4DOCA 1D0ZA 1ZHWA 5DB7A 4U5EE 3W8HA 2ZH4A 2GWSA 1PV3A 1SR2A 3AOUA 2HMQA 4X0AA 3DAFA 1FAPB 4CS8A 1BR1A 4DRHB 5E3AA 4O7GA 4LEYA 1FFHA 5T1DB 3IHUA 3TFSA 3QTHA 5JP7A 1ZQOA 3DE8A 5F5FA 2YL3A 1CGOA 4RWPA 5COMA 3F47A 2PFOA 5BPCA 2J7PA 5AGFA 3IQ6A 3LUTB 1A41A 2YLIA 2Y3DA 4ZLCA 1OU5A 1KTMA 5KYYA 1ZQAA 1LE2A 2R7SA 2CW0F 4YN0B 4WOYA 2O1PA 1ZQHA 3UQ2A 3B0XA 1BDJB 1QPUA 4LEWA 1CGNA 3B0VC 2W9YA 1OCZC 2W9MA 1ZQUA 4XA5A 4A2NB 4X0RA 5DEDA 1ZQKA 4NLKA 1XSNA 3EGXA 1Q0FA 2HSQA 4TUSA 3T9OA 2IHMA 1NLXA 2HUJA 4YWQA 5CI8A 1V55C 1HY5A 4GXKA 2J45A 2J0XA 5A6BD 1T6IA 1ORJA 3K7DA 2NRKA 5JS5A 3GM3A 4XPXA 4I29A 1O87A 4FESA 1SMYF 4EHPA 1HW1A 4FAPB 4WABA 2VH3A 1VLSA 3DZAA 5CHGA 7ICTA 4GXJA 3RQEA 3RJHA 2L6GA 7ICHA 2YLDA 5J29A 9ICAA 1FMWA 1MMNA 3NMKA 4S3NA 3OWTA 4XPWA 5J2JA 4LEVA 4M9JA 4PHDA 4CIPA 4PHAA 3AQLA 4RPZA 8ICQA 1MNDA 3QVYA 1SZIA 3H37A 2R7XA 4E7SA 4U5HA 4AT8A 3SZRA 1DOWA 2HSBA 4JVSA 1JR8A 1M2VA 3L0IA 2NSFA 4W8KA 1U0BB 5BQHA 5COGA 2QE9A 3ATPA 3SYNA 7ICQA
chains in the Genus database with same CATH topology
3O10A 5IIOA 3RJKA 4KLSA 4WBYA 1NOMA 5HRLA 4GXIA 4P4MA 3C8GB 3L8IA 3MDCA 5F2VO 4YCXA 2L6FA 3JPOA 4UB4A 4YMOA 4RQ8A 2DR9A 4M04A 1ZQSA 1XSLA 9ICLA 5IIJA 4XQ8A 4F5NA 8ICWA 7ICKA 1ZQJA 2FMPA 4X0BA 2BCQA 2PFQA 7ICGA 4WC5A 4F5OA 5F28E 4M9HA 3AUOA 2PFPA 8ICYA 1MIVA 3JPTA 3GM2A 1ZQRA 1JN3A 3K75D 1R8BA 4NKTA 2M2WA 4FHWA 2ID1A 4XQ7A 4RWQA 1KNYA 3WFPA 3C2MA 5DDYA 3RJJA 4P2HA 7ICIA 3L8JA 2M2TA 4KLQA 4R64A 1WWPA 3RJEA 4PHEA 9ICBA 4MF2A 2ZH6A 3HJ1A 2JPUA 5J0YA 5J0OA 4UB5A 4DO9A 4EBJA 4RQ1A 3MGIA 3JPPA 2PBEA 3V72A 4AT7A 4M2YA 4X4PA 4UAWA 9ICXA 9ICOA 4F5RA 8ICPA 8ICCA 4KLFA 9ICKA 2L6HA 8ICGA 5HRKA 2ZH3A 4I2IA 4NM2A 1ZQEA 5HRDA 1OW6A 5DBAA 3TULA 3C8GD 5HRHA 4KLLA 9ICTA 3UPSA 4DOBA 4K4GA 4M9GA 9ICNA 2ZH2A 1OW7A 1ZQMA 4I2JA 3WFSC 1Q78A 4KLTA 3OGUA 5J2HA 3V7KA 3OUYA 7ICUA 2ZHBA 4TUPA 3OV7A 4UD4A 9ICPA 1TV9A 4K4IA 1TFYA 7ICOA 4WC3A 3AJMA 4F5QA 5HHHA 5J2GA 3H38A 4NLNA 1WOLA 4X4TA 4MFCA 4QZ8A 4UB3A 4RQ5A 1ZZPA 1BPDA 4EP7A 1JQRA 5CP2A 5HRBA 3OUYB 3JPSA 1KDHA 8ICBA 7ICNA 2DVIA 4R63A 4QZFA 4YMMA 9ICEA 1ZQQA 3U0CA 5DBCA 4FH5A 1R89A 4XEFA 3C2LA 4O5EA 4QZHA 9ICWA 3AU2A 9ICGA 3ISCA 1ZQNA 1ZQFA 4NKUA 4QZGA 2ISOA 9ICHA 1QVXA 7ICLA 4ATBA 1UEVA 3UQ0A 4AT9A 3UXNA 4I2EA 3V7JA 4I2FA 1XSPA 1UETA 5IIIA 7ICSA 5IINA 1BPXA 4RQ0A 4XRHA 3RJGA 4RQ4A 4TURA 1ZJMA 4KLOA 7ICFA 2BPFA 4XEVA 9ICIA 1R8AA 1UFBA 5J2BA 4LVSA 4RQ6A 5HHIA 3AQMA 5D46A 5IILA 4QZCA 3RQGA 4X5VA 4NY8A 1FA0A 4X4RA 8ICMA 3HW8A 4X4NA 3PMNA 1V4AA 3HJ4A 5DB8A 4X4OA 2DR8A 5DECA 2KK1A 4NM1A 4E7XA 4IQVA 2HHPA 3OVBA 9ICCA 2ZH5A 4PGYA 4X4SA 4M9NA 8ICNA 1RPLA 2O5AA 3JZ0A 8ICTA 4WC7A 3C5FA 4PPXA 3OVAA 3PMLA 8ICEA 5J0SA 9ICRA 1K04A 2BCVA 4JWNA 4X4QA 5DKWA 3RH6A 3RQFA 1RZTA 5TZVA 4MFAA 5J0WA 1ZQWA 5HR9A 4QZEA 8ICLA 3GM1A 2BE3A 4Z6EA 4O5CA 7ICRA 5J2DA 4KLIA 2ZH7A 2FMSA 1ZQDA 4RQ2A 2I9GA 1ZQGA 4KLEA 4IQUA 5BOMA 5J0QA 3AU6A 4UB2A 9ICVA 5EOZA 3RH5A 9ICJA 4YD1A 1BPEA 1MQ2A 2DRBA 2YWAA 1TVAA 3LQCB 8ICIA 4IQTA 4UD5A 2LK4A 8ICRA 4QZDA 4NLZA 5D49A 4R65A 9ICSA 4EBKA 4RWNA 4I27A 4I2GA 4FH3A 1KEJA 1ZQPA 1WTYA 1MIYA 3OVSA 4RT3A 4K4HA 5D4BA 4KLMA 4YD2A 2PFNA 2BPCA 4R32A 1ZQCA 3JYYA 8ICKA 4DOAA 1BPZA 9ICFA 5HRFA 3TFRA 4RT2A 4WCWA 8ICXA 4YMNA 2M2UA 4UBBA 4QZIA 4FHXA 1R8CA 4FHVA 5J0RA 4IG8A 3AQKA 3NYBA 3LK9A 4WBZA 4YN4A 5HC9A 4DOCA 4QZBA 1NO5A 4NXZA 8ICJA 5DB7A 1TFWA 4WC4A 5J0UA 1PX5A 4E80A 5HREA 3ISBA 1ZQZA 2ZH4A 1ZQIA 4AT8B 2Q66A 2GWSA 1PV3A 9ICMA 4I2HA 1O3UA 4IQWA 4X4UA 4X0AA 4RPXA 4I2BA 4XUSA 5J2AA 3V7LA 2M2VA 4UAYA 3HX0A 3C66A 3B71A 4Z6CA 4QZ9A 4R66A 3S9OA 7ICJA 3B0YA 2BCRA 5J2KA 3U3FA 3TFSA 1ZQOA 9ICQA 1MQ3A 4I2AA 1MIWA 5DB6A 2DR7A 3H39A 4RWOA 4RQ3A 8ICZA 4RWPA 4NQFA 3UXOA 1VFGA 2PFOA 4TUQA 5BPCA 4MFFA 4LT6A 2BPGA 4RPYA 3JPQA 4M5DA 4P4PA 2ZHAA 1VJ7A 4QZAA 4X4VA 1F5AA 4I2DA 1JMSA 1OU5A 5J0PA 1KTMA 1ZQAA 2DRAA 4KLUA 7ICMA 2O1PA 3MGHA 1ZQVA 4Z6FA 1HUOA 8ICAA 5IIKA 4LZGA 1ZQHA 3UQ2A 3B0XA 4UBCA 1ZJNA 3JPRA 3UPQA 5J2IA 5J0XA 3MBYA 7ICPA 4I2CA 4PHPA 1ZQXA 3C18A 8ICSA 2W9MA 1ZQUA 1ZQTA 4XA5A 2Q00A 4UAZA 3RJFA 4KLGA 5DEDA 5BOLA 3L9DA 4FHPA 1ZQKA 4NLKA 1XSNA 4UB1A 5DBBA 5CR0A 1WOTA 5DDMA 2ZH9A 1ZQLA 1K05A 7ICVA 1K40A 4TUSA 2PXIA 2IHMA 4FHYA 5CWRA 1BPYA 4LZDA 8ICHA 4WC1A 1HUZA 1UEUA 1ZQBA 4M47A 8ICOA 4WC6A 4MF8A 4P4OA 5J2CA 4GXKA 3WFQE 3AQNA 8ICUA 1JAJA 3BRJA 4ATBB 4WC2A 5HRIA 4AT7B 3UXPA 4FO6A 3K7DA 4O5KA 2NRKA 2FMQA 1BPBA 3GDXA 5CB1A 3GM3A 4I29A 3PNCA 5CA7A 2ZH8A 4KLDA 3MFNA 4E8FA 1ZQYA 2P66A 3RH4A 5CHGA 4WC0A 2ZH1A 5J0TA 7ICTA 3MDAA 4GXJA 3RQEA 7ICEA 4M9LA 4KLJA 2VANA 5J2EA 3RJHA 2L6GA 3HWTA 3ISDA 7ICHA 5J29A 4Z6DA 3C8GA 2BCUA 9ICAA 4S3NA 4I28A 3WFRE 5HRGA 3C2KA 5J2JA 9ICUA 4M9JA 4PHDA 3H3AA 4PH5A 2BCSA 4PHAA 3AQLA 5CJ7A 4RPZA 4AT9B 8ICQA 4PGXA 1Q79A 3RJIA 2DR5A 4O9MA 3H37A 3WFOA 8ICVA 4M0AA 3JPNA 3C5GA 2JX0A 4KLHA 4AT8A 2HSBA 5IIMA 4JWMA 3HIYA 2ISPA 1OW8A 4F5PA 5DB9A 1YLQA 1JOGA 2RFFA 4RQ7A 4PGQA 8ICFA 5J2FA 4XEKA 7ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O10 A;  5IIO A;  3RJK A;  4KLS A;  4WBY A;  1NOM A;  5HRL A;  4GXI A;  4P4M A;  3C8G B;  3L8I A;  3MDC A;  5F2V O;  4YCX A;  2L6F A;  3JPO A;  4UB4 A;  4YMO A;  4RQ8 A;  2DR9 A;  4M04 A;  1ZQS A;  1XSL A;  9ICL A;  5IIJ A;  4XQ8 A;  4F5N A;  8ICW A;  7ICK A;  1ZQJ A;  2FMP A;  4X0B A;  2BCQ A;  2PFQ A;  7ICG A;  4WC5 A;  4F5O A;  5F28 E;  4M9H A;  3AUO A;  2PFP A;  8ICY A;  1MIV A;  3JPT A;  3GM2 A;  1ZQR A;  1JN3 A;  3K75 D;  1R8B A;  4NKT A;  2M2W A;  4FHW A;  2ID1 A;  4XQ7 A;  4RWQ A;  1KNY A;  3WFP A;  3C2M A;  5DDY A;  3RJJ A;  4P2H A;  7ICI A;  3L8J A;  2M2T A;  4KLQ A;  4R64 A;  1WWP A;  3RJE A;  4PHE A;  9ICB A;  4MF2 A;  2ZH6 A;  3HJ1 A;  2JPU A;  5J0Y A;  5J0O A;  4UB5 A;  4DO9 A;  4EBJ A;  4RQ1 A;  3MGI A;  3JPP A;  2PBE A;  3V72 A;  4AT7 A;  4M2Y A;  4X4P A;  4UAW A;  9ICX A;  9ICO A;  4F5R A;  8ICP A;  8ICC A;  4KLF A;  9ICK A;  2L6H A;  8ICG A;  5HRK A;  2ZH3 A;  4I2I A;  4NM2 A;  1ZQE A;  5HRD A;  1OW6 A;  5DBA A;  3TUL A;  3C8G D;  5HRH A;  4KLL A;  9ICT A;  3UPS A;  4DOB A;  4K4G A;  4M9G A;  9ICN A;  2ZH2 A;  1OW7 A;  1ZQM A;  4I2J A;  3WFS C;  1Q78 A;  4KLT A;  3OGU A;  5J2H A;  3V7K A;  3OUY A;  7ICU A;  2ZHB A;  4TUP A;  3OV7 A;  4UD4 A;  9ICP A;  1TV9 A;  4K4I A;  1TFY A;  7ICO A;  4WC3 A;  3AJM A;  4F5Q A;  5HHH A;  5J2G A;  3H38 A;  4NLN A;  1WOL A;  4X4T A;  4MFC A;  4QZ8 A;  4UB3 A;  4RQ5 A;  1ZZP A;  1BPD A;  4EP7 A;  1JQR A;  5CP2 A;  5HRB A;  3OUY B;  3JPS A;  1KDH A;  8ICB A;  7ICN A;  2DVI A;  4R63 A;  4QZF A;  4YMM A;  9ICE A;  1ZQQ A;  3U0C A;  5DBC A;  4FH5 A;  1R89 A;  4XEF A;  3C2L A;  4O5E A;  4QZH A;  9ICW A;  3AU2 A;  9ICG A;  3ISC A;  1ZQN A;  1ZQF A;  4NKU A;  4QZG A;  2ISO A;  9ICH A;  1QVX A;  7ICL A;  4ATB A;  1UEV A;  3UQ0 A;  4AT9 A;  3UXN A;  4I2E A;  3V7J A;  4I2F A;  1XSP A;  1UET A;  5III A;  7ICS A;  5IIN A;  1BPX A;  4RQ0 A;  4XRH A;  3RJG A;  4RQ4 A;  4TUR A;  1ZJM A;  4KLO A;  7ICF A;  2BPF A;  4XEV A;  9ICI A;  1R8A A;  1UFB A;  5J2B A;  4LVS A;  4RQ6 A;  5HHI A;  3AQM A;  5D46 A;  5IIL A;  4QZC A;  3RQG A;  4X5V A;  4NY8 A;  1FA0 A;  4X4R A;  8ICM A;  3HW8 A;  4X4N A;  3PMN A;  1V4A A;  3HJ4 A;  5DB8 A;  4X4O A;  2DR8 A;  5DEC A;  2KK1 A;  4NM1 A;  4E7X A;  4IQV A;  2HHP A;  3OVB A;  9ICC A;  2ZH5 A;  4PGY A;  4X4S A;  4M9N A;  8ICN A;  1RPL A;  2O5A A;  3JZ0 A;  8ICT A;  4WC7 A;  3C5F A;  4PPX A;  3OVA A;  3PML A;  8ICE A;  5J0S A;  9ICR A;  1K04 A;  2BCV A;  4JWN A;  4X4Q A;  5DKW A;  3RH6 A;  3RQF A;  1RZT A;  5TZV A;  4MFA A;  5J0W A;  1ZQW A;  5HR9 A;  4QZE A;  8ICL A;  3GM1 A;  2BE3 A;  4Z6E A;  4O5C A;  7ICR A;  5J2D A;  4KLI A;  2ZH7 A;  2FMS A;  1ZQD A;  4RQ2 A;  2I9G A;  1ZQG A;  4KLE A;  4IQU A;  5BOM A;  5J0Q A;  3AU6 A;  4UB2 A;  9ICV A;  5EOZ A;  3RH5 A;  9ICJ A;  4YD1 A;  1BPE A;  1MQ2 A;  2DRB A;  2YWA A;  1TVA A;  3LQC B;  8ICI A;  4IQT A;  4UD5 A;  2LK4 A;  8ICR A;  4QZD A;  4NLZ A;  5D49 A;  4R65 A;  9ICS A;  4EBK A;  4RWN A;  4I27 A;  4I2G A;  4FH3 A;  1KEJ A;  1ZQP A;  1WTY A;  1MIY A;  3OVS A;  4RT3 A;  4K4H A;  5D4B A;  4KLM A;  4YD2 A;  2PFN A;  2BPC A;  4R32 A;  1ZQC A;  3JYY A;  8ICK A;  4DOA A;  1BPZ A;  9ICF A;  5HRF A;  3TFR A;  4RT2 A;  4WCW A;  8ICX A;  4YMN A;  2M2U A;  4UBB A;  4QZI A;  4FHX A;  1R8C A;  4FHV A;  5J0R A;  4IG8 A;  3AQK A;  3NYB A;  3LK9 A;  4WBZ A;  4YN4 A;  5HC9 A;  4DOC A;  4QZB A;  1NO5 A;  4NXZ A;  8ICJ A;  5DB7 A;  1TFW A;  4WC4 A;  5J0U A;  1PX5 A;  4E80 A;  5HRE A;  3ISB A;  1ZQZ A;  2ZH4 A;  1ZQI A;  4AT8 B;  2Q66 A;  2GWS A;  1PV3 A;  9ICM A;  4I2H A;  1O3U A;  4IQW A;  4X4U A;  4X0A A;  4RPX A;  4I2B A;  4XUS A;  5J2A A;  3V7L A;  2M2V A;  4UAY A;  3HX0 A;  3C66 A;  3B71 A;  4Z6C A;  4QZ9 A;  4R66 A;  3S9O A;  7ICJ A;  3B0Y A;  2BCR A;  5J2K A;  3U3F A;  3TFS A;  1ZQO A;  9ICQ A;  1MQ3 A;  4I2A A;  1MIW A;  5DB6 A;  2DR7 A;  3H39 A;  4RWO A;  4RQ3 A;  8ICZ A;  4RWP A;  4NQF A;  3UXO A;  1VFG A;  2PFO A;  4TUQ A;  5BPC A;  4MFF A;  4LT6 A;  2BPG A;  4RPY A;  3JPQ A;  4M5D A;  4P4P A;  2ZHA A;  1VJ7 A;  4QZA A;  4X4V A;  1F5A A;  4I2D A;  1JMS A;  1OU5 A;  5J0P A;  1KTM A;  1ZQA A;  2DRA A;  4KLU A;  7ICM A;  2O1P A;  3MGH A;  1ZQV A;  4Z6F A;  1HUO A;  8ICA A;  5IIK A;  4LZG A;  1ZQH A;  3UQ2 A;  3B0X A;  4UBC A;  1ZJN A;  3JPR A;  3UPQ A;  5J2I A;  5J0X A;  3MBY A;  7ICP A;  4I2C A;  4PHP A;  1ZQX A;  3C18 A;  8ICS A;  2W9M A;  1ZQU A;  1ZQT A;  4XA5 A;  2Q00 A;  4UAZ A;  3RJF A;  4KLG A;  5DED A;  5BOL A;  3L9D A;  4FHP A;  1ZQK A;  4NLK A;  1XSN A;  4UB1 A;  5DBB A;  5CR0 A;  1WOT A;  5DDM A;  2ZH9 A;  1ZQL A;  1K05 A;  7ICV A;  1K40 A;  4TUS A;  2PXI A;  2IHM A;  4FHY A;  5CWR A;  1BPY A;  4LZD A;  8ICH A;  4WC1 A;  1HUZ A;  1UEU A;  1ZQB A;  4M47 A;  8ICO A;  4WC6 A;  4MF8 A;  4P4O A;  5J2C A;  4GXK A;  3WFQ E;  3AQN A;  8ICU A;  1JAJ A;  3BRJ A;  4ATB B;  4WC2 A;  5HRI A;  4AT7 B;  3UXP A;  4FO6 A;  3K7D A;  4O5K A;  2NRK A;  2FMQ A;  1BPB A;  3GDX A;  5CB1 A;  3GM3 A;  4I29 A;  3PNC A;  5CA7 A;  2ZH8 A;  4KLD A;  3MFN A;  4E8F A;  1ZQY A;  2P66 A;  3RH4 A;  5CHG A;  4WC0 A;  2ZH1 A;  5J0T A;  7ICT A;  3MDA A;  4GXJ A;  3RQE A;  7ICE A;  4M9L A;  4KLJ A;  2VAN A;  5J2E A;  3RJH A;  2L6G A;  3HWT A;  3ISD A;  7ICH A;  5J29 A;  4Z6D A;  3C8G A;  2BCU A;  9ICA A;  4S3N A;  4I28 A;  3WFR E;  5HRG A;  3C2K A;  5J2J A;  9ICU A;  4M9J A;  4PHD A;  3H3A A;  4PH5 A;  2BCS A;  4PHA A;  3AQL A;  5CJ7 A;  4RPZ A;  4AT9 B;  8ICQ A;  4PGX A;  1Q79 A;  3RJI A;  2DR5 A;  4O9M A;  3H37 A;  3WFO A;  8ICV A;  4M0A A;  3JPN A;  3C5G A;  2JX0 A;  4KLH A;  4AT8 A;  2HSB A;  5IIM A;  4JWM A;  3HIY A;  2ISP A;  1OW8 A;  4F5P A;  5DB9 A;  1YLQ A;  1JOG A;  2RFF A;  4RQ7 A;  4PGQ A;  8ICF A;  5J2F A;  4XEK A;  7ICQ A; 
#chains in the Genus database with same CATH topology
 1MNE A;  2R7V A;  5F2V O;  3JPO A;  4CSA A;  4UB4 A;  4C3B A;  3C7J A;  2C04 A;  4XQ8 A;  4F5N A;  2KQ9 A;  7ICK A;  2LP4 A;  2H8A A;  7ICG A;  1T9K A;  3AUO A;  5CFS A;  3WAQ A;  1MIV A;  3JPT A;  1JN3 A;  3U9M A;  4NKT A;  4FHW A;  2M2W A;  2ID1 A;  3S0X A;  4Z9H A;  3FAP B;  4MVM A;  3RJJ A;  4P2H A;  4XPY A;  3RJE A;  4MW8 A;  4PHE A;  5FZT A;  4GEH A;  2ZH6 A;  2Z15 A;  1M56 C;  5J0Y A;  1R4T A;  5L3Q A;  4JTD B;  4E7Z A;  2A1D D;  3UMI A;  3JPP A;  1C03 A;  2Q4F A;  1MMG A;  4M2Y A;  9ICX A;  1YZC A;  1H9G A;  2G62 A;  1BR4 A;  8ICP A;  4DJ9 A;  1L7C A;  1OCR C;  2XL6 A;  2RD9 A;  5HRK A;  5HRD A;  4MTO A;  3TUL A;  4E0I A;  4O79 A;  4E18 A;  2GA0 A;  2XLE A;  1ZQM A;  4CBE A;  1Q78 A;  3OGU A;  1RKE A;  3EGD A;  2WB7 A;  3A9C A;  3GWL A;  4FX5 A;  4OIO F;  4JE9 A;  3QZC A;  9ICP A;  1TV9 A;  4K4I A;  1T6U A;  5KYX A;  1XZQ A;  2PNO A;  3C62 A;  3JRM O;  4X4T A;  4QZ8 A;  4RQ5 A;  5E3C A;  3TOM A;  1M57 C;  2DI3 A;  4QI2 A;  1ZQQ A;  4JEB A;  2CGE A;  4BJT A;  5A6B A;  1J8Y F;  1NSG B;  2QY9 A;  2P6V A;  3DD7 A;  4FH5 A;  1AEP A;  3JSE O;  5JUA A;  4OAI Z;  3HNJ A;  4K96 A;  2R7R A;  2GAQ A;  4JKV A;  4C3D A;  2ISO A;  3K1H A;  7ICL A;  4ATB A;  4WGZ A;  4AT9 A;  4I2E A;  1LKX A;  3TD7 A;  3TQO A;  4XRH A;  4MVZ A;  1L3P A;  2BPF A;  4H54 A;  4XEV A;  1Y6D A;  3T6B A;  5KYX B;  4J32 B;  4QZC A;  3C8Z A;  3W8I A;  1APC A;  3GEH A;  1V4A A;  4X4O A;  2EWR A;  3GAN A;  2R05 A;  4M9N A;  2O5A A;  4NXV A;  5CI9 A;  3C5F A;  5J0S A;  4LDK A;  3B29 A;  4JWN A;  3EGX B;  5DKW A;  3RQF A;  1RZT A;  2ICW G;  3LJB A;  3GM1 A;  1QSP A;  5J2D A;  4MVS A;  3UGO A;  2BBH A;  5DS4 A;  1ZQD A;  4RQ2 A;  4IQU A;  1O5H A;  4D4N A;  3IQT A;  5BOM A;  4MS2 A;  1F1M A;  5EOZ A;  4KNV A;  9ICJ A;  1BPE A;  3VYW A;  2DRB A;  2YWA A;  3K33 A;  3LQC B;  8ICI A;  3T6J A;  2D4U A;  4NLZ A;  1JPJ A;  3L1M A;  4YL1 A;  5EK0 A;  4DVY P;  2R7W A;  4RDA A;  1D0Y A;  5BQG A;  2E87 A;  5DVW A;  3SEO A;  4JCH A;  3OVS A;  2XL8 A;  4K4H A;  5F5H A;  5D4B A;  4KLM A;  3E70 C;  2PFN A;  4MVO A;  4NCQ A;  4YL0 A;  4K9A A;  1ZQC A;  3JYY A;  4N4W A;  4JZA A;  4AL1 A;  3U5S A;  2HZ8 A;  3TFR A;  3FOP A;  1Q0D A;  3QVZ A;  4UBB A;  4QZI A;  3JT1 A;  1R8C A;  4FHV A;  4O6Y A;  5J0R A;  3AQK A;  4IG8 A;  4BG0 A;  1YAU O;  3LK9 A;  4YN4 A;  8ICJ A;  2GAF D;  1TFW A;  1PX5 A;  2NUT A;  5HRE A;  4PJJ A;  4O6N A;  5CIV A;  9ICM A;  1OKK A;  4RPX A;  5DS5 A;  4UAY A;  2YZS A;  7ICJ A;  3B0Y A;  2Q3T A;  4K98 A;  4CX9 A;  2Y3H A;  2L9J A;  1OQC A;  2EPO A;  5IY5 C;  4RWO A;  4YJW A;  2IYL D;  4G7H F;  1VFG A;  4TUQ A;  3K66 A;  3HLZ A;  2BPG A;  4RPY A;  4M5D A;  4YK5 A;  2ZHA A;  4AK9 A;  5HSW A;  4I2D A;  3RKO F;  2R02 A;  4PJN A;  2VC9 A;  2CYD A;  4DBR A;  2DRA A;  2CCY A;  7ICM A;  3MGH A;  2LFF A;  8ICA A;  2VCB A;  2YQY A;  3S29 A;  4UBC A;  1ZJN A;  3UPQ A;  1Z3I X;  5J0X A;  3RVZ A;  7ICP A;  4I2C A;  5E33 A;  4PHP A;  3WOD F;  3B9Q A;  4MW3 A;  3SP1 A;  3Q6M A;  4OIR F;  4MTF A;  1FNT c;  4KLG A;  3G4Z A;  3OWG A;  5DQZ A;  4UB1 A;  1YJG A;  5CR0 A;  3ZDL A;  5DDM A;  2ZH9 A;  1K05 A;  2HKV A;  1K40 A;  1C17 M;  2XLV A;  2PXI A;  3NVO A;  4Q5S F;  1UEU A;  1ZQB A;  4WC6 A;  2M64 A;  4P4O A;  4MF8 A;  2EPL X;  3NMJ A;  2J46 A;  4CS9 C;  1D0X A;  1LIH A;  3A11 A;  1Q0K A;  4C7O A;  5D63 A;  3CEX A;  1TQG A;  4O5K A;  3EFO A;  1BPB A;  3PNC A;  3AGU A;  3DAG A;  3ECS A;  2ZH8 A;  4K8V A;  1M2V B;  3HNK A;  4KLD A;  3MFN A;  2P66 A;  2ZH1 A;  5CFU A;  4JLZ A;  4KLJ A;  5J2E A;  3ZVR A;  2BCU A;  5L0D A;  4I28 A;  1YA7 O;  4ONS A;  2VAS A;  2BCS A;  4IRU A;  3DWW A;  2DR5 A;  4O9M A;  3SXZ A;  5B1A C;  4M0A A;  3JPN A;  3C5G A;  2NSG A;  2IXP A;  3FAJ A;  1Z7Q c;  2BE5 F;  3EH1 A;  2QUP A;  1QZX A;  2J9B A;  3HIY A;  1OW8 A;  5DS6 A;  3G4X A;  2RFF A;  3TOL A;  1I4Z A;  2MYS A;  2LIG A;  5J2F A;  2TMV P;  3AG3 C;  4KLS A;  5T3W A;  4WBY A;  1VLT A;  1NOM A;  2ZXR A;  5HRL A;  3GOR A;  4U9E A;  4YT8 A;  3C8G B;  4JLX A;  3MDC A;  4YCX A;  4RQ8 A;  4M04 A;  1LM3 B;  3BEH A;  3UMH A;  5IIJ A;  1A7D A;  4H4K C;  2X51 A;  1ZQJ A;  4NTB A;  3IPM O;  3DE9 A;  1A7E A;  2PFQ A;  2AWY A;  5F28 E;  3TJ6 A;  4M9H A;  4EIY A;  1NU9 C;  5A69 A;  3K75 D;  3ZWI A;  3DJN B;  4RWQ A;  2D5R B;  3WFP A;  3L8J A;  3ZC4 A;  2AU5 A;  2P1A A;  3N2Z B;  3G50 A;  4G7Z F;  3HJ1 A;  3H2U A;  4OAF A;  2ASR A;  5J0O A;  4UB5 A;  3JCF A;  1YAR O;  3MGI A;  4CDY A;  3V72 A;  3ABL C;  1FR0 A;  4F5R A;  2HJ3 A;  4KLF A;  9ICK A;  2OU6 A;  3PCV A;  2O9X A;  5HRH A;  4KC9 A;  3LEO A;  3UPS A;  2DGJ A;  4M9G A;  3K6B A;  4W8P A;  4XWJ A;  3LS1 A;  2W4M A;  2XRH A;  5L0G A;  2MWQ A;  2IXN A;  4C3E A;  2ZHB A;  4UD4 A;  1TFY A;  3LEV A;  5DLJ A;  3NKD A;  4IAO A;  4N6H A;  3H38 A;  4MFC A;  1BPD A;  4Q7C A;  2LCH A;  8ICB A;  2FGY A;  4NTA A;  3SXM A;  4OIP F;  3U0C A;  2XXA B;  1RJ9 B;  5AC5 A;  4XEF A;  3C2L A;  4O5E A;  1GGQ A;  1DOV A;  9ICG A;  1ZQN A;  1ZW3 A;  4NKU A;  1UEV A;  3UXN A;  2XS8 A;  1OR3 A;  1OCO C;  5JLI A;  2LD6 A;  4QI0 A;  5III A;  2KNH A;  4MVQ A;  3C63 A;  3V7O A;  1BPX A;  4TUR A;  1ZJM A;  4LLE A;  9ICI A;  1UFB A;  5BQI A;  2P7V A;  1T5O A;  3AQM A;  2PF4 E;  3ER9 B;  1FA0 A;  4X4R A;  8ICM A;  3HW8 A;  4X4N A;  5DB8 A;  4E7X A;  4K1O A;  2HHP A;  4IQV A;  2EIJ C;  2Q9A A;  4PGY A;  3NG1 A;  3HKK A;  3UNG C;  4WC7 A;  1XWJ A;  2GFH A;  1Z23 A;  1FMV A;  1G8X A;  4JEA A;  3T6G B;  5L0I A;  4BJ1 A;  1YYX A;  1Q0M A;  2R9R B;  3EZH A;  3PMR A;  8ICL A;  3OEO A;  5JT4 A;  2BE3 A;  4LDR A;  2UUH A;  2ZH7 A;  1U89 A;  2FMS A;  3RFY A;  1BZ4 A;  2I9G A;  4KLE A;  2V3C C;  4ER9 A;  3S27 A;  2XS1 A;  3ZG1 A;  3AU6 A;  2YL0 A;  2NUP B;  9ICV A;  2YKZ A;  3HNI A;  2A0B A;  4JRZ A;  4JJF A;  3AG2 C;  2BL2 A;  2F22 A;  1WN0 A;  4R65 A;  4RWN A;  4I27 A;  2EPM X;  1KEJ A;  1ZQP A;  1A0B A;  1EKY A;  4YD2 A;  1TFK B;  1NZE A;  2XM0 A;  2OOC A;  2IM8 A;  2XM4 A;  2WVN A;  3EJN A;  2IUB A;  4PK4 A;  4YL3 A;  4FO1 A;  1Y4C A;  4JUR I;  4BJ5 C;  4PJM A;  4FHX A;  3PHF 2;  3Q7L A;  4PAC A;  3W4Y A;  2PFD A;  3N0T A;  4B6I A;  4NXZ A;  1E85 A;  4WC4 A;  5J0U A;  4E80 A;  4I3M A;  4RBN A;  1ZQZ A;  3DI5 A;  4AT8 B;  1HMO A;  4BEJ A;  1QKR A;  3CAX A;  5CHE A;  4IQW A;  1BBH A;  4X4U A;  3E9V A;  4YT2 A;  1NFO A;  4I2B A;  4XUS A;  2NPU A;  3V7L A;  4XQ1 A;  3C66 A;  3B71 A;  4K9B A;  4XLN F;  4QZ9 A;  2H7B A;  4R66 A;  5J2K A;  3V5Y A;  1MQ3 A;  4I2A A;  2NG1 A;  1VK5 A;  1VYI A;  4NXX A;  4RQ3 A;  1CPR A;  4NQF A;  2R7U A;  4P6I C;  1ZHZ A;  4ANJ A;  3JPQ A;  1IW7 F;  4P4P A;  3EH2 A;  1VJ7 A;  4QZA A;  4O6M A;  4X4V A;  3O39 A;  2JD3 A;  1JMS A;  3I5Q A;  1JPN A;  3S84 A;  5J0P A;  1ZVZ A;  5KYN A;  2IBF A;  4I1O B;  5EHH A;  1ORY A;  1GQA A;  2B56 A;  4Z6F A;  1HUO A;  5IIK A;  4LZG A;  4WH5 A;  4OD4 A;  2UUI A;  2YL7 A;  4LDQ A;  5J2I A;  3MBY A;  4KB6 A;  1ST6 A;  3C18 A;  3O6X A;  3NDB B;  1ZQT A;  4UDV A;  2Y3B A;  4KNW A;  3RJF A;  2J9U A;  2Y39 A;  5DBB A;  2WVQ A;  4PFP A;  4DXW A;  1LE4 A;  4D4X A;  2ZXO A;  1WOT A;  2BC5 A;  3U9J A;  2QLA A;  4FHY A;  1BPY A;  3NKE A;  4WC1 A;  1HUZ A;  4M47 A;  1RMV A;  4NXW A;  1JAJ A;  3DKA A;  5J2C A;  8ICU A;  3AQN A;  3S28 A;  1D1A A;  4AT7 B;  3UXP A;  4RD9 A;  3GDX A;  5CB1 A;  2Y69 C;  2R7T A;  4IWB A;  3EF2 A;  5KYY B;  3DJU B;  4YT4 A;  1PD1 A;  3EHN A;  3M79 A;  1M2O A;  2KGO A;  1NBB A;  3RH4 A;  2OEV A;  5FCL A;  2WL8 A;  5J0T A;  1I4Y A;  4M9L A;  3EFO B;  2L7A A;  4NC3 A;  3C8G A;  1NG1 A;  9ICU A;  3MX3 A;  4N6C A;  3LLK A;  2BBJ A;  2J8W A;  1EA8 A;  2B51 A;  5CJ7 A;  4AT9 B;  2YEV A;  4PGX A;  1Q79 A;  3RJI A;  2W45 A;  4O6A A;  5IIM A;  3ZQY A;  2I8B A;  4JC7 A;  3NWI A;  2Q7R A;  1YLQ A;  1JOG A;  3W2W A;  4RQ7 A;  3FVY A;  2VCA A;  1TFO B;  4N06 A;  2P0N A;  2QTV A;  8ICF A;  4K7B A;  3Q6N A;  3RJK A;  5T3T A;  3ZQV A;  3LS0 A;  2B0J A;  1YA9 A;  1UG7 A;  3EPV A;  2EIN C;  4BEM J;  2OQM A;  3DXJ F;  4YMO A;  5HV9 A;  2DR9 A;  1ZQS A;  4AX2 A;  5EGY A;  2YLG A;  4G0H A;  4X0B A;  2BCQ A;  1G5Z A;  3K1I C;  4WC5 A;  4A4A A;  2PFP A;  8ICY A;  1H7I A;  3H65 A;  4KM5 A;  3B0P A;  1R8B A;  1RKC A;  1D1C A;  1QQ3 A;  1OXK A;  1PCX A;  1KNY A;  1YDI A;  2OEX A;  5DDY A;  3U2L A;  3NYJ A;  2GDC A;  4AL0 A;  4NY3 A;  4MF2 A;  1YLM A;  2JPU A;  1JMW A;  4DO9 A;  1NU7 D;  2HMZ A;  4RQ1 A;  2PBE A;  4AT7 A;  1S05 A;  4UAW A;  1ZHT A;  3SNH A;  3ERC C;  2XLM A;  4MTG A;  9ICO A;  2R7Q A;  1FFT C;  4LLC A;  8ICC A;  4MQ9 F;  3LLI A;  8ICG A;  2ZH3 A;  5D62 A;  1ZQE A;  5DQT A;  2CNW D;  4MND A;  1ZYR F;  4EWC A;  3C8G D;  3RF3 A;  2XLD A;  9ICT A;  4DOB A;  1ZHX A;  1RKE B;  4GYT A;  2YRF A;  2ZH2 A;  4I2J A;  2ZD9 A;  2L81 A;  4KLT A;  3JYH A;  3V7K A;  3ASO C;  3DM5 A;  3OUY A;  2PX0 A;  4O68 A;  3VF0 A;  4TUP A;  4IB4 A;  3OV7 A;  3EGD B;  7ICO A;  3EG9 B;  3PDM P;  3AJM A;  4OIN F;  5HHH A;  5J2G A;  4LAC B;  4NLN A;  1Z63 A;  1MQV A;  1WOL A;  1OKK D;  4UB3 A;  2Q9C A;  1ZZP A;  4EP7 A;  5HRB A;  2WZG A;  2DVI A;  4R63 A;  9ICE A;  4HE8 D;  4OIQ F;  3M15 A;  5DBC A;  3QW0 A;  3GWN A;  4QZH A;  3AU2 A;  1HE9 A;  4IGG A;  3VRC A;  4QZG A;  9ICH A;  1QVX A;  4C7O B;  4K0D A;  3RW0 A;  2XXA A;  3M4C A;  3FHD A;  4I2F A;  1XSP A;  1UET A;  1QLE C;  5IIN A;  7ICS A;  4RQ0 A;  4EGW A;  4LEZ A;  2DYR C;  3RJG A;  3IEE A;  1RXQ A;  3T4R A;  2GWW A;  5A6A A;  3MBG A;  1R8A A;  4ZLD A;  1RJ9 A;  1ZU4 A;  3JTL O;  3ZSU A;  4LVS A;  2VB6 A;  3EG9 A;  1ZU5 A;  4G78 A;  3FOO A;  2NUP A;  3O55 A;  5BUO A;  5D46 A;  3RQG A;  4NY8 A;  1YVI A;  3PMN A;  2DR8 A;  2KK1 A;  5CFT A;  4G7O F;  4U5C E;  2EPK X;  3ZTZ A;  1XZP A;  5L0F A;  8ICN A;  4JJG A;  1RPL A;  1MMA A;  3JZ0 A;  8ICT A;  3PML A;  8ICE A;  9ICR A;  4JW1 A;  1K04 A;  3X2Q C;  3ABK C;  2W4B A;  4X4Q A;  4Q4Z F;  3RH6 A;  3V5X A;  2Q9B A;  1D1B A;  1YYJ A;  5HR9 A;  1RCP A;  3PHZ A;  4O5C A;  7ICR A;  2OJE D;  2WZL A;  4AE4 A;  2A69 F;  1IZM A;  1ZQG A;  3VAY A;  5J0Q A;  3RH5 A;  3B0U X;  4IJJ A;  4YD1 A;  2HN1 A;  1U6H A;  1MQ2 A;  256B A;  4QDL A;  1TVA A;  4IQT A;  1MMD A;  4UD5 A;  4QZD A;  5D49 A;  4EBK A;  3NYM A;  4IAR A;  4FH3 A;  1CPQ A;  1MIY A;  4RT3 A;  3MCR A;  3MLG A;  5K0I A;  1VTM P;  4CS9 A;  1KU2 A;  5TJ5 E;  4DVZ A;  4EED A;  4R32 A;  3Q7G A;  2LFD A;  8ICK A;  1V74 B;  4DOA A;  9ICF A;  3AG4 C;  5HRF A;  4YMN A;  2M2U A;  2B0H A;  1OR2 A;  1E2X A;  3NYB A;  4FWV A;  4BJ6 A;  2NUT B;  5HC9 A;  1E83 A;  4QZB A;  1NO5 A;  2IXO A;  2DYS C;  4EEB A;  3EHM A;  3ISB A;  5JVE A;  1ZQI A;  1E84 A;  2Q66 A;  3IQC A;  3J06 A;  3AQC A;  1O3U A;  4OAG A;  4I2H A;  1OCC C;  1BR2 A;  4OAH A;  5J2A A;  2PX3 A;  2M2V A;  3HX0 A;  5L0C A;  3RH3 A;  4DRI B;  4Z6C A;  3S9O A;  2BCR A;  3CSK A;  3U3F A;  1PD0 A;  5JRA A;  3SXK A;  9ICQ A;  1MIW A;  2YL1 A;  5DB6 A;  2DR7 A;  5GPG B;  4PJL A;  3H39 A;  1TWC A;  4CIH A;  8ICZ A;  1WAS A;  5L3V A;  3UXO A;  1VOM A;  4MFF A;  4LT6 A;  3I5P A;  2R03 A;  3GEE A;  2A6H F;  1LS1 A;  2Y3G A;  1GS9 A;  4P9F A;  4IAQ A;  1F5A A;  3ITF A;  4WQL A;  1C02 A;  1B68 A;  2FCL A;  4KLU A;  3MYF A;  4U5F E;  3UR3 C;  1ZQV A;  4CJO A;  2B4V A;  4I0U A;  2KC3 A;  1ZW2 A;  2PP4 A;  3JPR A;  5B3Q A;  2J0W A;  1GPJ A;  3NMI A;  1H9T A;  4E0H A;  1ORS C;  1WGW A;  1ZQX A;  8ICS A;  4DBQ A;  1HMD A;  2Q00 A;  5B3I A;  4UAZ A;  3FDQ A;  4CDA A;  2XSE A;  2J7P D;  1TKN A;  5BOL A;  3L9D A;  4FHP A;  4JIO A;  3KH2 A;  1LI5 A;  4KBL A;  2C03 A;  3US6 A;  4DOZ A;  1ZQL A;  7ICV A;  2KW3 C;  4DRJ B;  5CWR A;  8ICH A;  4LZD A;  2EPN A;  8ICO A;  3WFQ E;  3BRJ A;  5B1B C;  3LNR A;  1T01 A;  4ATB B;  4WC2 A;  5HRI A;  3K1I A;  3HTK C;  4FO6 A;  5L0J A;  1LVK A;  2FMQ A;  1TWG A;  1H6G A;  3KKB A;  5CA7 A;  1W2W A;  4K99 A;  1NFN A;  2G3V A;  3M4B A;  4CS7 A;  4JCZ A;  1VB5 A;  4MVU A;  4E8F A;  3KYI A;  3SXY A;  1ZQY A;  2ZPA A;  4WC0 A;  1YZA A;  3R7C A;  2YVK A;  3U8P A;  2YHS A;  3FXH A;  1SYQ A;  1VYK A;  3MDA A;  7ICE A;  2EIM C;  4GQH A;  2VAN A;  3I4U A;  3KMI A;  2XLH A;  3X1O A;  3AQB A;  3HWT A;  1R5I D;  3ISD A;  2R7O A;  4Z6D A;  2J9V A;  3WFR E;  5HRG A;  3C2K A;  2I15 A;  3H3A A;  4PH5 A;  2HS5 A;  2ETS A;  4NXT A;  3N24 A;  2HV7 A;  2XLO A;  3WFO A;  8ICV A;  2JX0 A;  3OA1 A;  4HFF B;  3AG1 C;  4KLH A;  2OKU A;  4BJ5 A;  5KYU B;  3UMK A;  4CS8 C;  4JWM A;  3EQL F;  5JTG A;  2WVO A;  2ISP A;  4F5P A;  3TK0 A;  5DB9 A;  3ASN C;  2AP3 A;  3U8V A;  4E17 A;  1G4W R;  2VCC A;  3DMD A;  4KI2 A;  2RSE B;  3U3B A;  4N7R A;  2KYH A;  4PGQ A;  4XEK A;  3O10 A;  5IIO A;  4O67 A;  1A7V A;  4ULW A;  2FFH A;  4GXI A;  4Z9I A;  4P4M A;  3L8I A;  2L6F A;  1WAT A;  3JRT A;  3EZI A;  1T6Q A;  1XSL A;  9ICL A;  2KSF A;  8ICW A;  1ZHY A;  2HN2 A;  3QMK A;  1HW2 A;  1S7Z A;  2FMP A;  2LQG A;  3MYI A;  2WZF A;  4F5O A;  3HJC A;  3GEI A;  4P9T A;  4CDV A;  2KJG A;  2LSE A;  4EKW A;  1AUE A;  3GM2 A;  1ZQR A;  1JRA A;  2HV6 A;  3R2P A;  3POV A;  4XQ7 A;  3RVY A;  4CJG A;  4NTF A;  3C2M A;  2GA9 D;  7ICI A;  2M2T A;  4KLQ A;  4R64 A;  1E86 A;  4ULV A;  1WWP A;  3ZIB A;  9ICB A;  4EV6 A;  4J30 B;  3F46 A;  2X0C A;  3GOD A;  2AWC A;  4BPM A;  4EBJ A;  3M1C B;  4XJE A;  4X4P A;  5AC4 A;  4EUK B;  1AVO B;  1LI7 A;  3RYL A;  2H7O A;  3AGT A;  2L6H A;  3FMS A;  3LAY A;  4I2I A;  4NM2 A;  4JTC B;  1OW6 A;  5DBA A;  4KLL A;  4J7T A;  4K4G A;  9ICN A;  1LPE A;  3CK6 A;  1EI7 A;  2OCC C;  1OW7 A;  3WFS C;  4PFO A;  5J2H A;  3IQ5 A;  5COF A;  2EIK C;  7ICU A;  4BJ6 C;  2M4E A;  2IXM A;  4U5B E;  4WC3 A;  4F5Q A;  3HNL A;  3V5Z A;  5B3P A;  1Z6A A;  1M6T A;  4M63 A;  3LES A;  5D92 A;  1JQR A;  3NYL A;  5CP2 A;  1LS4 A;  3OUY B;  3JPS A;  1KDH A;  7ICN A;  5JSL A;  4QZF A;  4YMM A;  5KYU A;  2P61 A;  1R89 A;  3LNM B;  4U5D E;  2HFI A;  9ICW A;  3S90 A;  4WQK A;  3H2V A;  1Z5Z A;  3WG7 C;  3ISC A;  1ZQF A;  3KPH A;  4HEA J;  4O69 A;  4HFK B;  3UQ0 A;  2QNL A;  3CQZ A;  2OJQ A;  5KYW A;  3V7J A;  2EIL C;  2A68 F;  1JAF A;  4LER A;  4RQ4 A;  2DB4 A;  4KLO A;  2A6E F;  7ICF A;  5D91 A;  4AE4 B;  4NXU A;  4MKP A;  2R25 A;  3CZ6 A;  5J2B A;  2HJM A;  1SF8 A;  3TJ5 A;  4RQ6 A;  5HHI A;  2ZXW C;  5IIL A;  2A0U A;  4X5V A;  1TR2 A;  4YT5 A;  3ER8 C;  3KL4 A;  3HJ4 A;  3UGP A;  3JCU Q;  2CNW A;  5DEC A;  2H7V C;  4NM1 A;  1V54 C;  4F4B A;  3OVB A;  2V26 A;  9ICC A;  2ZH5 A;  1FTS A;  4X4S A;  1TWH A;  4U9D A;  3RIP A;  4I44 A;  4WGY A;  1VMA A;  2ZXP A;  1HE1 A;  5A6K A;  3OVA A;  4PPX A;  3QW1 A;  1I5N A;  2BCV A;  2XL4 A;  3VM6 A;  3U2M A;  5TZV A;  3ABM C;  4MFA A;  2XLW A;  5J0W A;  1ZQW A;  1GM5 A;  4EBB A;  2J9W A;  4QZE A;  5E2Q A;  4Z6E A;  5KYW B;  4KLI A;  4U5G A;  3DM9 B;  3NKU A;  3NRH A;  2AVK A;  3KYJ A;  4PR9 A;  2MHR A;  4Z9J A;  4UB2 A;  3W2V A;  2IHO A;  4WJ0 A;  1J8M F;  2LK4 A;  8ICR A;  2IOQ A;  4HX0 A;  1CGM E;  9ICS A;  3L34 A;  4L6R A;  3WHN A;  2FAP B;  4JTA B;  4I2G A;  1OXB A;  3ZTM A;  1WTY A;  3JSZ A;  1G4U S;  4K97 A;  1TWA A;  2BPC A;  5L0H A;  1EQ1 A;  1Q0G A;  5B3S C;  1N1C A;  1BPZ A;  2CDQ A;  4XTK A;  4RT2 A;  4XLP F;  4WCW A;  8ICX A;  5D61 A;  5A6J A;  4J7Y A;  4OD5 A;  2G3K A;  4CSA C;  2OG2 A;  4I1M A;  4WBZ A;  4MVR A;  4DOC A;  1D0Z A;  1ZHW A;  5DB7 A;  4U5E E;  3W8H A;  2ZH4 A;  2GWS A;  1PV3 A;  1SR2 A;  3AOU A;  2HMQ A;  4X0A A;  3DAF A;  1FAP B;  4CS8 A;  1BR1 A;  4DRH B;  5E3A A;  4O7G A;  4LEY A;  1FFH A;  5T1D B;  3IHU A;  3TFS A;  3QTH A;  5JP7 A;  1ZQO A;  3DE8 A;  5F5F A;  2YL3 A;  1CGO A;  4RWP A;  5COM A;  3F47 A;  2PFO A;  5BPC A;  2J7P A;  5AGF A;  3IQ6 A;  3LUT B;  1A41 A;  2YLI A;  2Y3D A;  4ZLC A;  1OU5 A;  1KTM A;  5KYY A;  1ZQA A;  1LE2 A;  2R7S A;  2CW0 F;  4YN0 B;  4WOY A;  2O1P A;  1ZQH A;  3UQ2 A;  3B0X A;  1BDJ B;  1QPU A;  4LEW A;  1CGN A;  3B0V C;  2W9Y A;  1OCZ C;  2W9M A;  1ZQU A;  4XA5 A;  4A2N B;  4X0R A;  5DED A;  1ZQK A;  4NLK A;  1XSN A;  3EGX A;  1Q0F A;  2HSQ A;  4TUS A;  3T9O A;  2IHM A;  1NLX A;  2HUJ A;  4YWQ A;  5CI8 A;  1V55 C;  1HY5 A;  4GXK A;  2J45 A;  2J0X A;  5A6B D;  1T6I A;  1ORJ A;  3K7D A;  2NRK A;  5JS5 A;  3GM3 A;  4XPX A;  4I29 A;  1O87 A;  4FES A;  1SMY F;  4EHP A;  1HW1 A;  4FAP B;  4WAB A;  2VH3 A;  1VLS A;  3DZA A;  5CHG A;  7ICT A;  4GXJ A;  3RQE A;  3RJH A;  2L6G A;  7ICH A;  2YLD A;  5J29 A;  9ICA A;  1FMW A;  1MMN A;  3NMK A;  4S3N A;  3OWT A;  4XPW A;  5J2J A;  4LEV A;  4M9J A;  4PHD A;  4CIP A;  4PHA A;  3AQL A;  4RPZ A;  8ICQ A;  1MND A;  3QVY A;  1SZI A;  3H37 A;  2R7X A;  4E7S A;  4U5H A;  4AT8 A;  3SZR A;  1DOW A;  2HSB A;  4JVS A;  1JR8 A;  1M2V A;  3L0I A;  2NSF A;  4W8K A;  1U0B B;  5BQH A;  5COG A;  2QE9 A;  3ATP A;  3SYN A;  7ICQ A; 
#chains in the Genus database with same CATH homology
 3O10 A;  5IIO A;  3RJK A;  4KLS A;  4WBY A;  1NOM A;  5HRL A;  4GXI A;  4P4M A;  3C8G B;  3L8I A;  3MDC A;  5F2V O;  4YCX A;  2L6F A;  3JPO A;  4UB4 A;  4YMO A;  4RQ8 A;  2DR9 A;  4M04 A;  1ZQS A;  1XSL A;  9ICL A;  5IIJ A;  4XQ8 A;  4F5N A;  8ICW A;  7ICK A;  1ZQJ A;  2FMP A;  4X0B A;  2BCQ A;  2PFQ A;  7ICG A;  4WC5 A;  4F5O A;  5F28 E;  4M9H A;  3AUO A;  2PFP A;  8ICY A;  1MIV A;  3JPT A;  3GM2 A;  1ZQR A;  1JN3 A;  3K75 D;  1R8B A;  4NKT A;  2M2W A;  4FHW A;  2ID1 A;  4XQ7 A;  4RWQ A;  1KNY A;  3WFP A;  3C2M A;  5DDY A;  3RJJ A;  4P2H A;  7ICI A;  3L8J A;  2M2T A;  4KLQ A;  4R64 A;  1WWP A;  3RJE A;  4PHE A;  9ICB A;  4MF2 A;  2ZH6 A;  3HJ1 A;  2JPU A;  5J0Y A;  5J0O A;  4UB5 A;  4DO9 A;  4EBJ A;  4RQ1 A;  3MGI A;  3JPP A;  2PBE A;  3V72 A;  4AT7 A;  4M2Y A;  4X4P A;  4UAW A;  9ICX A;  9ICO A;  4F5R A;  8ICP A;  8ICC A;  4KLF A;  9ICK A;  2L6H A;  8ICG A;  5HRK A;  2ZH3 A;  4I2I A;  4NM2 A;  1ZQE A;  5HRD A;  1OW6 A;  5DBA A;  3TUL A;  3C8G D;  5HRH A;  4KLL A;  9ICT A;  3UPS A;  4DOB A;  4K4G A;  4M9G A;  9ICN A;  2ZH2 A;  1OW7 A;  1ZQM A;  4I2J A;  3WFS C;  1Q78 A;  4KLT A;  3OGU A;  5J2H A;  3V7K A;  3OUY A;  7ICU A;  2ZHB A;  4TUP A;  3OV7 A;  4UD4 A;  9ICP A;  1TV9 A;  4K4I A;  1TFY A;  7ICO A;  4WC3 A;  3AJM A;  4F5Q A;  5HHH A;  5J2G A;  3H38 A;  4NLN A;  1WOL A;  4X4T A;  4MFC A;  4QZ8 A;  4UB3 A;  4RQ5 A;  1ZZP A;  1BPD A;  4EP7 A;  1JQR A;  5CP2 A;  5HRB A;  3OUY B;  3JPS A;  1KDH A;  8ICB A;  7ICN A;  2DVI A;  4R63 A;  4QZF A;  4YMM A;  9ICE A;  1ZQQ A;  3U0C A;  5DBC A;  4FH5 A;  1R89 A;  4XEF A;  3C2L A;  4O5E A;  4QZH A;  9ICW A;  3AU2 A;  9ICG A;  3ISC A;  1ZQN A;  1ZQF A;  4NKU A;  4QZG A;  2ISO A;  9ICH A;  1QVX A;  7ICL A;  4ATB A;  1UEV A;  3UQ0 A;  4AT9 A;  3UXN A;  4I2E A;  3V7J A;  4I2F A;  1XSP A;  1UET A;  5III A;  7ICS A;  5IIN A;  1BPX A;  4RQ0 A;  4XRH A;  3RJG A;  4RQ4 A;  4TUR A;  1ZJM A;  4KLO A;  7ICF A;  2BPF A;  4XEV A;  9ICI A;  1R8A A;  1UFB A;  5J2B A;  4LVS A;  4RQ6 A;  5HHI A;  3AQM A;  5D46 A;  5IIL A;  4QZC A;  3RQG A;  4X5V A;  4NY8 A;  1FA0 A;  4X4R A;  8ICM A;  3HW8 A;  4X4N A;  3PMN A;  1V4A A;  3HJ4 A;  5DB8 A;  4X4O A;  2DR8 A;  5DEC A;  2KK1 A;  4NM1 A;  4E7X A;  4IQV A;  2HHP A;  3OVB A;  9ICC A;  2ZH5 A;  4PGY A;  4X4S A;  4M9N A;  8ICN A;  1RPL A;  2O5A A;  3JZ0 A;  8ICT A;  4WC7 A;  3C5F A;  4PPX A;  3OVA A;  3PML A;  8ICE A;  5J0S A;  9ICR A;  1K04 A;  2BCV A;  4JWN A;  4X4Q A;  5DKW A;  3RH6 A;  3RQF A;  1RZT A;  5TZV A;  4MFA A;  5J0W A;  1ZQW A;  5HR9 A;  4QZE A;  8ICL A;  3GM1 A;  2BE3 A;  4Z6E A;  4O5C A;  7ICR A;  5J2D A;  4KLI A;  2ZH7 A;  2FMS A;  1ZQD A;  4RQ2 A;  2I9G A;  1ZQG A;  4KLE A;  4IQU A;  5BOM A;  5J0Q A;  3AU6 A;  4UB2 A;  9ICV A;  5EOZ A;  3RH5 A;  9ICJ A;  4YD1 A;  1BPE A;  1MQ2 A;  2DRB A;  2YWA A;  1TVA A;  3LQC B;  8ICI A;  4IQT A;  4UD5 A;  2LK4 A;  8ICR A;  4QZD A;  4NLZ A;  5D49 A;  4R65 A;  9ICS A;  4EBK A;  4RWN A;  4I27 A;  4I2G A;  4FH3 A;  1KEJ A;  1ZQP A;  1WTY A;  1MIY A;  3OVS A;  4RT3 A;  4K4H A;  5D4B A;  4KLM A;  4YD2 A;  2PFN A;  2BPC A;  4R32 A;  1ZQC A;  3JYY A;  8ICK A;  4DOA A;  1BPZ A;  9ICF A;  5HRF A;  3TFR A;  4RT2 A;  4WCW A;  8ICX A;  4YMN A;  2M2U A;  4UBB A;  4QZI A;  4FHX A;  1R8C A;  4FHV A;  5J0R A;  4IG8 A;  3AQK A;  3NYB A;  3LK9 A;  4WBZ A;  4YN4 A;  5HC9 A;  4DOC A;  4QZB A;  1NO5 A;  4NXZ A;  8ICJ A;  5DB7 A;  1TFW A;  4WC4 A;  5J0U A;  1PX5 A;  4E80 A;  5HRE A;  3ISB A;  1ZQZ A;  2ZH4 A;  1ZQI A;  4AT8 B;  2Q66 A;  2GWS A;  1PV3 A;  9ICM A;  4I2H A;  1O3U A;  4IQW A;  4X4U A;  4X0A A;  4RPX A;  4I2B A;  4XUS A;  5J2A A;  3V7L A;  2M2V A;  4UAY A;  3HX0 A;  3C66 A;  3B71 A;  4Z6C A;  4QZ9 A;  4R66 A;  3S9O A;  7ICJ A;  3B0Y A;  2BCR A;  5J2K A;  3U3F A;  3TFS A;  1ZQO A;  9ICQ A;  1MQ3 A;  4I2A A;  1MIW A;  5DB6 A;  2DR7 A;  3H39 A;  4RWO A;  4RQ3 A;  8ICZ A;  4RWP A;  4NQF A;  3UXO A;  1VFG A;  2PFO A;  4TUQ A;  5BPC A;  4MFF A;  4LT6 A;  2BPG A;  4RPY A;  3JPQ A;  4M5D A;  4P4P A;  2ZHA A;  1VJ7 A;  4QZA A;  4X4V A;  1F5A A;  4I2D A;  1JMS A;  1OU5 A;  5J0P A;  1KTM A;  1ZQA A;  2DRA A;  4KLU A;  7ICM A;  2O1P A;  3MGH A;  1ZQV A;  4Z6F A;  1HUO A;  8ICA A;  5IIK A;  4LZG A;  1ZQH A;  3UQ2 A;  3B0X A;  4UBC A;  1ZJN A;  3JPR A;  3UPQ A;  5J2I A;  5J0X A;  3MBY A;  7ICP A;  4I2C A;  4PHP A;  1ZQX A;  3C18 A;  8ICS A;  2W9M A;  1ZQU A;  1ZQT A;  4XA5 A;  2Q00 A;  4UAZ A;  3RJF A;  4KLG A;  5DED A;  5BOL A;  3L9D A;  4FHP A;  1ZQK A;  4NLK A;  1XSN A;  4UB1 A;  5DBB A;  5CR0 A;  1WOT A;  5DDM A;  2ZH9 A;  1ZQL A;  1K05 A;  7ICV A;  1K40 A;  4TUS A;  2PXI A;  2IHM A;  4FHY A;  5CWR A;  1BPY A;  4LZD A;  8ICH A;  4WC1 A;  1HUZ A;  1UEU A;  1ZQB A;  4M47 A;  8ICO A;  4WC6 A;  4MF8 A;  4P4O A;  5J2C A;  4GXK A;  3WFQ E;  3AQN A;  8ICU A;  1JAJ A;  3BRJ A;  4ATB B;  4WC2 A;  5HRI A;  4AT7 B;  3UXP A;  4FO6 A;  3K7D A;  4O5K A;  2NRK A;  2FMQ A;  1BPB A;  3GDX A;  5CB1 A;  3GM3 A;  4I29 A;  3PNC A;  5CA7 A;  2ZH8 A;  4KLD A;  3MFN A;  4E8F A;  1ZQY A;  2P66 A;  3RH4 A;  5CHG A;  4WC0 A;  2ZH1 A;  5J0T A;  7ICT A;  3MDA A;  4GXJ A;  3RQE A;  7ICE A;  4M9L A;  4KLJ A;  2VAN A;  5J2E A;  3RJH A;  2L6G A;  3HWT A;  3ISD A;  7ICH A;  5J29 A;  4Z6D A;  3C8G A;  2BCU A;  9ICA A;  4S3N A;  4I28 A;  3WFR E;  5HRG A;  3C2K A;  5J2J A;  9ICU A;  4M9J A;  4PHD A;  3H3A A;  4PH5 A;  2BCS A;  4PHA A;  3AQL A;  5CJ7 A;  4RPZ A;  4AT9 B;  8ICQ A;  4PGX A;  1Q79 A;  3RJI A;  2DR5 A;  4O9M A;  3H37 A;  3WFO A;  8ICV A;  4M0A A;  3JPN A;  3C5G A;  2JX0 A;  4KLH A;  4AT8 A;  2HSB A;  5IIM A;  4JWM A;  3HIY A;  2ISP A;  1OW8 A;  4F5P A;  5DB9 A;  1YLQ A;  1JOG A;  2RFF A;  4RQ7 A;  4PGQ A;  8ICF A;  5J2F A;  4XEK A;  7ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...