4WC2A

Crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 122
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc2A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc2A01
4I2DA 5D46A 4UBCA 1XSPA 1ZQYA 4UB1A 4KLGA 8ICHA 5IILA 7ICTA 8ICAA 9ICMA 3WFPA 1ZQXA 4QZBA 4K4HA 4UAYA 5DEDA 4O9MA 4XUSA 4R64A 1RPLA 9ICTA 4NM1A 1BPBA 3AQKA 3OVBA 4TURA 3H3AA 1ZQPA 4NLZA 5J0OA 4X4NA 3WFQE 1OU5A 8ICGA 9ICPA 5J0UA 4PHDA 3MDAA 1TFWA 1JMSA 5DB7A 1BPEA 4FHXA 1ZQTA 2PFPA 4M04A 5J0SA 8ICYA 5CP2A 8ICIA 4PPXA 4LZDA 4Z6EA 4DOCA 2ZH9A 3HJ1A 2BPCA 3OGUA 1ZQDA 5J2CA 8ICWA 1UEVA 1ZQLA 5DBAA 2ZH1A 4M9HA 9ICXA 8ICZA 5BOMA 3UXOA 3RH4A 4QZEA 5DBCA 5DB9A 4YMMA 1ZQBA 2M2TA 5HHHA 1ZQSA 4NLKA 8ICBA 2ISOA 5J0RA 4UD5A 3AQLA 1MQ2A 8ICJA 7ICRA 3AU2A 7ICNA 4FO6A 3LQCB 9ICQA 4M2YA 4WCWA 1WOTA 5IIMA 1JAJA 5HRGA 1Q79A 2O1PA 7ICEA 4AT7A 1UETA 4I28A 4I2HA 1PX5A 4WBZA 1ZQUA 4RPYA 4MFFA 4Z6FA 4KLMA 4XA5A 5BPCA 1ZJNA 2ZH6A 8ICOA 2DVIA 4UB4A 3RH6A 1ZQFA 4EP7A 4TUSA 4JWNA 4X4SA 4WC2A 1RZTA 4XQ7A 5CHGA 4PH5A 4YMNA 1XSLA 4P4OA 9ICGA 1ZQWA 3ISBA 2DRBA 4ATBA 1MIVA 4AT9A 3JPRA 5J29A 4PHPA 8ICSA 4Z6CA 3HJ4A 4AT8A 3V7LA 1BPXA 5J2EA 4IQVA 4F5QA 4I2JA 8ICQA 4O5EA 4YD1A 5HRHA 5HRBA 1BPYA 3C2LA 5HHIA 5HRKA 9ICJA 1ZQIA 1BPDA 4M5DA 4RWNA 9ICEA 2DR8A 1KEJA 3ISDA 4I2EA 4LZGA 1R8BA 2VANA 5DB6A 5DB8A 4RT2A 4QZDA 2HHPA 1ZQVA 3WFRE 4X0BA 5CWRA 2ZH8A 3HX0A 5HR9A 9ICAA 1MIYA 4R66A 4MF2A 1YLQA 9ICBA 4I2GA 4RT3A 3WFOA 2FMQA 2Q66A 5CR0A 2ZH7A 3RJGA 1ZQJA 4WC4A 3C5FA 2ZH3A 4X4TA 3HW8A 4NXZA 1BPZA 1JN3A 4E80A 9ICOA 1ZQOA 3OVSA 4F5NA 5J2DA 9ICSA 4WC3A 7ICIA 5F2VO 4GXKA 4UB5A 4KLUA 4NY8A 2PXIA 4KLIA 5J0TA 4RQ8A 4RQ2A 5BOLA 2BPFA 9ICNA 1FA0A 4X4QA 3H39A 4QZIA 1ZQQA 5IIKA 4UBBA 4F5OA 2PBEA 4LT6A 3UPSA 4PHEA 4KLDA 8ICEA 4I29A 4X4PA 4KLHA 1ZQRA 4RPZA 2DR9A 3UXNA 4I2CA 2W9MA 3UXPA 4FH5A 5IINA 8ICLA 1ZQZA 1TV9A 3HWTA 5J0QA 3OVAA 2FMPA 3JPNA 4KLOA 4M9LA 1Q78A 3MDCA 4WC7A 4FHVA 4M9JA 2BCRA 4YMOA 5CJ7A 5J2FA 2ZH5A 3PMLA 1KDHA 1HUZA 2BCQA 1ZQAA 4QZ8A 4WC6A 2BCSA 4RQ1A 3JPPA 4R65A 2GWSA 4TUPA 5J2GA 9ICRA 4YN4A 4FHWA 4KLFA 4F5PA 4X4VA 4KLJA 4RQ3A 4P4PA 4TUQA 4RWOA 3LK9A 3H38A 3JZ0A 1ZQKA 5J2KA 7ICMA 4DOAA 5CA7A 2ZH4A 2RFFA 3OUYB 8ICTA 2M2VA 3JPOA 5EOZA 4DO9A 1TFYA 2BE3A 4O5KA 4RQ4A 9ICUA 4QZ9A 3WFSC 2DRAA 4UD4A 4X4RA 2PFOA 9ICHA 4AT9B 3RJHA 5TZVA 4X4UA 1ZQHA 4FHPA 8ICXA 4AT8B 4IQWA 5J2BA 3B0YA 3GDXA 1ZQGA 3TFRA 3V7JA 4GXIA 4QZAA 3V72A 1R89A 4Z6DA 4PGXA 3V7KA 2DR7A 1TVAA 3MGIA 1ZQCA 4DOBA 4I2BA 3H37A 5HRIA 8ICRA 5DECA 2NRKA 3C18A 7ICJA 1HUOA 7ICFA 5J0YA 3PMNA 1NOMA 3B0XA 4UB2A 3UQ2A 4NKUA 4QZFA 4RQ0A 5J2AA 4EBKA 3AQMA 4I2IA 3MBYA 7ICPA 4K4GA 4P2HA 3JPSA 3L9DA 3JPTA 8ICUA 7ICUA 4KLLA 1R8CA 9ICCA 2ID1A 4YCXA 2P66A 5J0WA 4NKTA 5DDMA 4UAZA 2BCUA 4K4IA 4WBYA 3JPQA 4MF8A 4LVSA 8ICMA 4XRHA 5HC9A 3RH5A 9ICVA 3RJFA 7ICLA 4WC0A 4PHAA 1R8AA 4IQTA 4IG8A 5HRFA 3ISCA 3UQ0A 4IQUA 5CB1A 8ICPA 5IIJA 4RWPA 3AU6A 4NM2A 2BCVA 5HRLA 4E8FA 3C66A 4YD2A 4KLSA 3C2MA 9ICWA 4X4OA 7ICVA 4M9GA 2M2UA 5J0XA 2O5AA 4RQ6A 2I9GA 2DR5A 7ICHA 4MFCA 5D49A 4RWQA 5DBBA 9ICLA 4P4MA 4M47A 3MGHA 1VJ7A 1NO5A 4KLQA 4E7XA 3C5GA 8ICCA 4QZCA 4QZGA 4UB3A 3UPQA 1ZQMA 3PNCA 4NLNA 1F5AA 4RQ5A 3RJIA 2PFQA 7ICGA 3JYYA 8ICFA 2PFNA 4AT7B 4EBJA 4FHYA 1V4AA 4WC5A 4UAWA 5D4BA 2BPGA 4JWMA 1UEUA 5DDYA 1ZQEA 2ZHBA 4F5RA 2FMSA 3RJEA 9ICIA 1XSNA 4R63A 4FH3A 7ICQA 3AUOA 3HIYA 2ZHAA 1VFGA 3NYBA 4KLEA 3C2KA 3OUYA 4X5VA 8ICKA 1MQ3A 5HREA 4I2AA 4PGQA 5J2JA 1MIWA 4PGYA 7ICKA 4I2FA 8ICVA 3AQNA 5J2HA 4GXJA 2IHMA 4M9NA 5J2IA 4M0AA 2ZH2A 4I27A 9ICFA 4ATBB 1KNYA 4MFAA 7ICSA 5IIOA 2M2WA 1ZQNA 4S3NA 4WC1A 3RJJA 3K75D 3RJKA 4RQ7A 1ZJMA 5DKWA 5IIIA 7ICOA 5HRDA 2ISPA 4X0AA 9ICKA 4O5CA 4QZHA 4KLTA 4XQ8A 3TFSA 4RPXA 8ICNA 3OV7A 5J0PA 1JQRA
chains in the Genus database with same CATH superfamily
4I2DA 5D46A 4UBCA 1XSPA 1ZQYA 4UB1A 4KLGA 8ICHA 5B3PA 3NVOA 5IILA 7ICTA 4K8VA 3ER8C 9ICMA 8ICAA 3WFPA 1ZQXA 4QZBA 4K4HA 4UAYA 3ER9B 5DEDA 4O6AA 4O9MA 4XUSA 4R64A 1RPLA 9ICTA 3NWIA 4NM1A 4EEBA 1BPBA 3AQKA 3OVBA 4TURA 3H3AA 1ZQPA 2IHOA 4NLZA 5J0OA 4X4NA 3WFQE 1OU5A 8ICGA 9ICPA 5J0UA 4PHDA 3MDAA 1TFWA 1JMSA 5DB7A 1BPEA 4FHXA 1ZQTA 2PFPA 4M04A 2FCLA 2IUBA 5J0SA 8ICYA 5CP2A 8ICIA 4O67A 4LZDA 4PPXA 4Z6EA 4EV6A 4DOCA 2ZH9A 3OWGA 3HJ1A 2BPCA 3OGUA 1ZQDA 5J2CA 8ICWA 1UEVA 1ZQLA 5DBAA 2ZH1A 4M9HA 9ICXA 8ICZA 5BOMA 3UXOA 3RH4A 4QZEA 5DBCA 5DB9A 4YMMA 1ZQBA 2M2TA 5HHHA 1ZQSA 4NLKA 8ICBA 2ISOA 4HX0A 4UD5A 3AQLA 5J0RA 1MQ2A 8ICJA 7ICRA 3AU2A 7ICNA 4KB6A 4FO6A 3LQCB 9ICQA 5CFUA 4M2YA 4WCWA 1WOTA 5IIMA 1JAJA 5HRGA 2O1PA 7ICEA 4AT7A 1UETA 4I28A 4I2HA 1PX5A 4WBZA 1ZQUA 4RPYA 4XJEA 4WOYA 5CHEA 4MFFA 4Z6FA 4KLMA 4XA5A 5BPCA 1ZJNA 2ZH6A 8ICOA 2DVIA 4UB4A 4K9AA 3RH6A 1ZQFA 4N7RA 2GAFD 4EP7A 4TUSA 4JWNA 4X4SA 4WC2A 4JLZA 1RZTA 2BBHA 4NXWA 4XQ7A 5CHGA 3OV7A 4PH5A 4YMNA 1XSLA 4P4OA 9ICGA 1ZQWA 3ISBA 2DRBA 4ATBA 1MIVA 4AT9A 3JPRA 5J29A 4PHPA 8ICSA 4Z6CA 3HJ4A 4AT8A 3V7LA 1BPXA 5J2EA 4IQVA 4F5QA 4I2JA 8ICQA 4O5EA 4YD1A 5HRHA 5HRBA 1BPYA 4EGWA 3C2LA 5HHIA 5HRKA 9ICJA 1ZQIA 1BPDA 4M5DA 4RWNA 4I0UA 9ICEA 2DR8A 1KEJA 3ISDA 4I2EA 4LZGA 1R8BA 2VANA 5DB6A 5DB8A 4RT2A 4QZDA 2HHPA 1ZQVA 3WFRE 4X0BA 5CWRA 2ZH8A 3HX0A 5HR9A 9ICAA 1MIYA 4R66A 4MF2A 1YLQA 4OAIZ 9ICBA 4I2GA 4RT3A 3WFOA 2FMQA 2Q66A 5CR0A 2ZH7A 3RJGA 1ZQJA 4WC4A 5D62A 4K98A 3C5FA 2ZH3A 2EWRA 4X4TA 3HW8A 4NXZA 1BPZA 1JN3A 4E80A 9ICOA 1ZQOA 3OVSA 4F5NA 5J2DA 9ICSA 4WC3A 7ICIA 4NXVA 5F2VO 4GXKA 4UB5A 4KLUA 4O68A 4NY8A 2PXIA 4KLIA 5J0TA 4RQ8A 4RQ2A 5BOLA 2BPFA 9ICNA 1FA0A 4X4QA 3H39A 4K96A 3EF2A 4QZIA 1ZQQA 5IIKA 4UBBA 4LEVA 4F5OA 2PBEA 4LT6A 3UPSA 4PHEA 4KLDA 2HN1A 8ICEA 4I29A 4X4PA 4KLHA 1ZQRA 4RPZA 2DR9A 3UXNA 4I2CA 2W9MA 3UXPA 4FH5A 5IINA 8ICLA 1ZQZA 1TV9A 3HWTA 5J0QA 3OVAA 2FMPA 3JPNA 4KLOA 4M9LA 1Q78A 3MDCA 4WC7A 4FHVA 4M9JA 2BCRA 4YMOA 5CJ7A 5J2FA 2ZH5A 3PMLA 1KDHA 1HUZA 2BCQA 1ZQAA 4QZ8A 4WC6A 2BCSA 4RQ1A 3JPPA 4R65A 2GWSA 2BBJA 5D61A 5J2GA 4TUPA 4WQLA 9ICRA 4YN4A 2B56A 4FHWA 4KLFA 4F5PA 4X4VA 4KLJA 4RQ3A 4P4PA 4OAHA 4RWOA 4TUQA 3LK9A 3H38A 3JZ0A 4KM5A 1ZQKA 5J2KA 7ICMA 4DOAA 5CA7A 2ZH4A 2RFFA 3OUYB 8ICTA 2M2VA 3JPOA 5EOZA 4WH5A 4DO9A 1TFYA 2BE3A 4O5KA 4RQ4A 9ICUA 4QZ9A 3WFSC 2DRAA 4UD4A 4X4RA 2PFOA 9ICHA 4AT9B 3RJHA 5TZVA 4X4UA 1ZQHA 4FHPA 8ICXA 4AT8B 4IQWA 5J2BA 3B0YA 3GDXA 1ZQGA 3TFRA 3V7JA 4GXIA 4QZAA 3V72A 1R89A 4Z6DA 4PGXA 3V7KA 2DR7A 1TVAA 3MGIA 4NXTA 1ZQCA 4DOBA 4I2BA 3H37A 5HRIA 8ICRA 5DECA 2NRKA 3C18A 7ICJA 1HUOA 7ICFA 5J0YA 3PMNA 1NOMA 3B0XA 4UB2A 3UQ2A 4NKUA 4QZFA 4RQ0A 5J2AA 4EBKA 3AQMA 4I2IA 3MBYA 7ICPA 4K4GA 4P2HA 3JPSA 3L9DA 3JPTA 8ICUA 7ICUA 4KLLA 1R8CA 4OAFA 3ERCC 9ICCA 2ID1A 2HN2A 3K7DA 4YCXA 2P66A 5J0WA 4JLXA 4NKTA 5DDMA 4UAZA 2BCUA 4K97A 4K4IA 4WBYA 3JPQA 4MF8A 4LVSA 8ICMA 4XRHA 5HC9A 3RH5A 9ICVA 4NXUA 3RJFA 7ICLA 4WC0A 4PHAA 1R8AA 2B51A 4IQTA 4IG8A 5JTGA 5HRFA 3ISCA 2GA9D 3UQ0A 4IQUA 5CB1A 8ICPA 5IIJA 4RWPA 3AU6A 4NM2A 2BCVA 5CFSA 5HRLA 4E8FA 3C66A 4YD2A 4KLSA 3C2MA 9ICWA 4X4OA 7ICVA 4M9GA 1GPJA 2M2UA 5J0XA 4K99A 2O5AA 4RQ6A 2I9GA 2DR5A 7ICHA 4MFCA 5D49A 4RWQA 5DBBA 9ICLA 4P4MA 4M47A 4EEDA 3MGHA 1VJ7A 1NO5A 4K9BA 4KLQA 4E7XA 3C5GA 8ICCA 4QZCA 4QZGA 4UB3A 3UPQA 5B3QA 1ZQMA 3PNCA 4NLNA 1F5AA 4RQ5A 3RJIA 2PFQA 4MKPA 7ICGA 3JYYA 8ICFA 2PFNA 3NKUA 4O69A 4AT7B 4EBJA 4FHYA 1V4AA 5CFTA 4WC5A 4UAWA 5D4BA 2BPGA 4JWMA 1UEUA 5DDYA 1ZQEA 2ZHBA 4LEZA 4F5RA 2FMSA 4OAGA 3RJEA 9ICIA 1XSNA 4R63A 4FH3A 7ICQA 3AUOA 3HIYA 2ZHAA 1VFGA 3NYBA 4LEYA 3C2KA 3OUYA 4KLEA 4X5VA 8ICKA 1MQ3A 5HREA 4I2AA 4PGQA 5J2JA 1MIWA 4PGYA 7ICKA 4I2FA 8ICVA 3AQNA 3CK6A 5J2HA 4GXJA 2IHMA 4M9NA 5J2IA 4M0AA 2ZH2A 4I27A 9ICFA 4ATBB 1KNYA 4MFAA 3JCFA 7ICSA 5IIOA 2M2WA 1ZQNA 4S3NA 4WC1A 3RJJA 3K75D 3MCRA 3RJKA 4RQ7A 1ZJMA 5DKWA 4LEWA 4WQKA 5IIIA 3PHZA 4NXXA 7ICOA 5HRDA 2B4VA 2ISPA 4X0AA 5D63A 9ICKA 4O5CA 4QZHA 4KLTA 4XQ8A 3TFSA 4RPXA 4FO1A 8ICNA 1Q79A 5J0PA 1JQRA
chains in the Genus database with same CATH topology
4I2DA 5D46A 4UBCA 1XSPA 1ZQYA 4UB1A 4KLGA 8ICHA 5IILA 7ICTA 8ICAA 9ICMA 3WFPA 1ZQXA 4QZBA 4K4HA 4UAYA 5DEDA 4O9MA 4XUSA 4R64A 1RPLA 9ICTA 4NM1A 1BPBA 3AQKA 3OVBA 4TURA 3H3AA 1ZQPA 4NLZA 5J0OA 4X4NA 3WFQE 1OU5A 8ICGA 9ICPA 5J0UA 4PHDA 3MDAA 1TFWA 1JMSA 5DB7A 1BPEA 4FHXA 1ZQTA 2PFPA 4M04A 5J0SA 8ICYA 5CP2A 8ICIA 4PPXA 4LZDA 4Z6EA 4DOCA 2ZH9A 3HJ1A 2BPCA 3OGUA 1ZQDA 5J2CA 8ICWA 1UEVA 1ZQLA 5DBAA 2ZH1A 4M9HA 9ICXA 8ICZA 5BOMA 3UXOA 3RH4A 4QZEA 5DBCA 5DB9A 4YMMA 1ZQBA 2M2TA 5HHHA 1ZQSA 4NLKA 8ICBA 2ISOA 5J0RA 4UD5A 3AQLA 1MQ2A 8ICJA 7ICRA 3AU2A 7ICNA 4FO6A 3LQCB 9ICQA 4M2YA 4WCWA 1WOTA 5IIMA 1JAJA 5HRGA 1Q79A 2O1PA 7ICEA 4AT7A 1UETA 4I28A 4I2HA 1PX5A 4WBZA 1ZQUA 4RPYA 4MFFA 4Z6FA 4KLMA 4XA5A 5BPCA 1ZJNA 2ZH6A 8ICOA 2DVIA 4UB4A 3RH6A 1ZQFA 4EP7A 4TUSA 4JWNA 4X4SA 4WC2A 1RZTA 4XQ7A 5CHGA 4PH5A 4YMNA 1XSLA 4P4OA 9ICGA 1ZQWA 3ISBA 2DRBA 4ATBA 1MIVA 4AT9A 3JPRA 5J29A 4PHPA 8ICSA 4Z6CA 3HJ4A 4AT8A 3V7LA 1BPXA 5J2EA 4IQVA 4F5QA 4I2JA 8ICQA 4O5EA 4YD1A 5HRHA 5HRBA 1BPYA 3C2LA 5HHIA 5HRKA 9ICJA 1ZQIA 1BPDA 4M5DA 4RWNA 9ICEA 2DR8A 1KEJA 3ISDA 4I2EA 4LZGA 1R8BA 2VANA 5DB6A 5DB8A 4RT2A 4QZDA 2HHPA 1ZQVA 3WFRE 4X0BA 5CWRA 2ZH8A 3HX0A 5HR9A 9ICAA 1MIYA 4R66A 4MF2A 1YLQA 9ICBA 4I2GA 4RT3A 3WFOA 2FMQA 2Q66A 5CR0A 2ZH7A 3RJGA 1ZQJA 4WC4A 3C5FA 2ZH3A 4X4TA 3HW8A 4NXZA 1BPZA 1JN3A 4E80A 9ICOA 1ZQOA 3OVSA 4F5NA 5J2DA 9ICSA 4WC3A 7ICIA 5F2VO 4GXKA 4UB5A 4KLUA 4NY8A 2PXIA 4KLIA 5J0TA 4RQ8A 4RQ2A 5BOLA 2BPFA 9ICNA 1FA0A 4X4QA 3H39A 4QZIA 1ZQQA 5IIKA 4UBBA 4F5OA 2PBEA 4LT6A 3UPSA 4PHEA 4KLDA 8ICEA 4I29A 4X4PA 4KLHA 1ZQRA 4RPZA 2DR9A 3UXNA 4I2CA 2W9MA 3UXPA 4FH5A 5IINA 8ICLA 1ZQZA 1TV9A 3HWTA 5J0QA 3OVAA 2FMPA 3JPNA 4KLOA 4M9LA 1Q78A 3MDCA 4WC7A 4FHVA 4M9JA 2BCRA 4YMOA 5CJ7A 5J2FA 2ZH5A 3PMLA 1KDHA 1HUZA 2BCQA 1ZQAA 4QZ8A 4WC6A 2BCSA 4RQ1A 3JPPA 4R65A 2GWSA 4TUPA 5J2GA 9ICRA 4YN4A 4FHWA 4KLFA 4F5PA 4X4VA 4KLJA 4RQ3A 4P4PA 4TUQA 4RWOA 3LK9A 3H38A 3JZ0A 1ZQKA 5J2KA 7ICMA 4DOAA 5CA7A 2ZH4A 2RFFA 3OUYB 8ICTA 2M2VA 3JPOA 5EOZA 4DO9A 1TFYA 2BE3A 4O5KA 4RQ4A 9ICUA 4QZ9A 3WFSC 2DRAA 4UD4A 4X4RA 2PFOA 9ICHA 4AT9B 3RJHA 5TZVA 4X4UA 1ZQHA 4FHPA 8ICXA 4AT8B 4IQWA 5J2BA 3B0YA 3GDXA 1ZQGA 3TFRA 3V7JA 4GXIA 4QZAA 3V72A 1R89A 4Z6DA 4PGXA 3V7KA 2DR7A 1TVAA 3MGIA 1ZQCA 4DOBA 4I2BA 3H37A 5HRIA 8ICRA 5DECA 2NRKA 3C18A 7ICJA 1HUOA 7ICFA 5J0YA 3PMNA 1NOMA 3B0XA 4UB2A 3UQ2A 4NKUA 4QZFA 4RQ0A 5J2AA 4EBKA 3AQMA 4I2IA 3MBYA 7ICPA 4K4GA 4P2HA 3JPSA 3L9DA 3JPTA 8ICUA 7ICUA 4KLLA 1R8CA 9ICCA 2ID1A 4YCXA 2P66A 5J0WA 4NKTA 5DDMA 4UAZA 2BCUA 4K4IA 4WBYA 3JPQA 4MF8A 4LVSA 8ICMA 4XRHA 5HC9A 3RH5A 9ICVA 3RJFA 7ICLA 4WC0A 4PHAA 1R8AA 4IQTA 4IG8A 5HRFA 3ISCA 3UQ0A 4IQUA 5CB1A 8ICPA 5IIJA 4RWPA 3AU6A 4NM2A 2BCVA 5HRLA 4E8FA 3C66A 4YD2A 4KLSA 3C2MA 9ICWA 4X4OA 7ICVA 4M9GA 2M2UA 5J0XA 2O5AA 4RQ6A 2I9GA 2DR5A 7ICHA 4MFCA 5D49A 4RWQA 5DBBA 9ICLA 4P4MA 4M47A 3MGHA 1VJ7A 1NO5A 4KLQA 4E7XA 3C5GA 8ICCA 4QZCA 4QZGA 4UB3A 3UPQA 1ZQMA 3PNCA 4NLNA 1F5AA 4RQ5A 3RJIA 2PFQA 7ICGA 3JYYA 8ICFA 2PFNA 4AT7B 4EBJA 4FHYA 1V4AA 4WC5A 4UAWA 5D4BA 2BPGA 4JWMA 1UEUA 5DDYA 1ZQEA 2ZHBA 4F5RA 2FMSA 3RJEA 9ICIA 1XSNA 4R63A 4FH3A 7ICQA 3AUOA 3HIYA 2ZHAA 1VFGA 3NYBA 4KLEA 3C2KA 3OUYA 4X5VA 8ICKA 1MQ3A 5HREA 4I2AA 4PGQA 5J2JA 1MIWA 4PGYA 7ICKA 4I2FA 8ICVA 3AQNA 5J2HA 4GXJA 2IHMA 4M9NA 5J2IA 4M0AA 2ZH2A 4I27A 9ICFA 4ATBB 1KNYA 4MFAA 7ICSA 5IIOA 2M2WA 1ZQNA 4S3NA 4WC1A 3RJJA 3K75D 3RJKA 4RQ7A 1ZJMA 5DKWA 5IIIA 7ICOA 5HRDA 2ISPA 4X0AA 9ICKA 4O5CA 4QZHA 4KLTA 4XQ8A 3TFSA 4RPXA 8ICNA 3OV7A 5J0PA 1JQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2D A;  5D46 A;  4UBC A;  1XSP A;  1ZQY A;  4UB1 A;  4KLG A;  8ICH A;  5IIL A;  7ICT A;  8ICA A;  9ICM A;  3WFP A;  1ZQX A;  4QZB A;  4K4H A;  4UAY A;  5DED A;  4O9M A;  4XUS A;  4R64 A;  1RPL A;  9ICT A;  4NM1 A;  1BPB A;  3AQK A;  3OVB A;  4TUR A;  3H3A A;  1ZQP A;  4NLZ A;  5J0O A;  4X4N A;  3WFQ E;  1OU5 A;  8ICG A;  9ICP A;  5J0U A;  4PHD A;  3MDA A;  1TFW A;  1JMS A;  5DB7 A;  1BPE A;  4FHX A;  1ZQT A;  2PFP A;  4M04 A;  5J0S A;  8ICY A;  5CP2 A;  8ICI A;  4PPX A;  4LZD A;  4Z6E A;  4DOC A;  2ZH9 A;  3HJ1 A;  2BPC A;  3OGU A;  1ZQD A;  5J2C A;  8ICW A;  1UEV A;  1ZQL A;  5DBA A;  2ZH1 A;  4M9H A;  9ICX A;  8ICZ A;  5BOM A;  3UXO A;  3RH4 A;  4QZE A;  5DBC A;  5DB9 A;  4YMM A;  1ZQB A;  2M2T A;  5HHH A;  1ZQS A;  4NLK A;  8ICB A;  2ISO A;  5J0R A;  4UD5 A;  3AQL A;  1MQ2 A;  8ICJ A;  7ICR A;  3AU2 A;  7ICN A;  4FO6 A;  3LQC B;  9ICQ A;  4M2Y A;  4WCW A;  1WOT A;  5IIM A;  1JAJ A;  5HRG A;  1Q79 A;  2O1P A;  7ICE A;  4AT7 A;  1UET A;  4I28 A;  4I2H A;  1PX5 A;  4WBZ A;  1ZQU A;  4RPY A;  4MFF A;  4Z6F A;  4KLM A;  4XA5 A;  5BPC A;  1ZJN A;  2ZH6 A;  8ICO A;  2DVI A;  4UB4 A;  3RH6 A;  1ZQF A;  4EP7 A;  4TUS A;  4JWN A;  4X4S A;  4WC2 A;  1RZT A;  4XQ7 A;  5CHG A;  4PH5 A;  4YMN A;  1XSL A;  4P4O A;  9ICG A;  1ZQW A;  3ISB A;  2DRB A;  4ATB A;  1MIV A;  4AT9 A;  3JPR A;  5J29 A;  4PHP A;  8ICS A;  4Z6C A;  3HJ4 A;  4AT8 A;  3V7L A;  1BPX A;  5J2E A;  4IQV A;  4F5Q A;  4I2J A;  8ICQ A;  4O5E A;  4YD1 A;  5HRH A;  5HRB A;  1BPY A;  3C2L A;  5HHI A;  5HRK A;  9ICJ A;  1ZQI A;  1BPD A;  4M5D A;  4RWN A;  9ICE A;  2DR8 A;  1KEJ A;  3ISD A;  4I2E A;  4LZG A;  1R8B A;  2VAN A;  5DB6 A;  5DB8 A;  4RT2 A;  4QZD A;  2HHP A;  1ZQV A;  3WFR E;  4X0B A;  5CWR A;  2ZH8 A;  3HX0 A;  5HR9 A;  9ICA A;  1MIY A;  4R66 A;  4MF2 A;  1YLQ A;  9ICB A;  4I2G A;  4RT3 A;  3WFO A;  2FMQ A;  2Q66 A;  5CR0 A;  2ZH7 A;  3RJG A;  1ZQJ A;  4WC4 A;  3C5F A;  2ZH3 A;  4X4T A;  3HW8 A;  4NXZ A;  1BPZ A;  1JN3 A;  4E80 A;  9ICO A;  1ZQO A;  3OVS A;  4F5N A;  5J2D A;  9ICS A;  4WC3 A;  7ICI A;  5F2V O;  4GXK A;  4UB5 A;  4KLU A;  4NY8 A;  2PXI A;  4KLI A;  5J0T A;  4RQ8 A;  4RQ2 A;  5BOL A;  2BPF A;  9ICN A;  1FA0 A;  4X4Q A;  3H39 A;  4QZI A;  1ZQQ A;  5IIK A;  4UBB A;  4F5O A;  2PBE A;  4LT6 A;  3UPS A;  4PHE A;  4KLD A;  8ICE A;  4I29 A;  4X4P A;  4KLH A;  1ZQR A;  4RPZ A;  2DR9 A;  3UXN A;  4I2C A;  2W9M A;  3UXP A;  4FH5 A;  5IIN A;  8ICL A;  1ZQZ A;  1TV9 A;  3HWT A;  5J0Q A;  3OVA A;  2FMP A;  3JPN A;  4KLO A;  4M9L A;  1Q78 A;  3MDC A;  4WC7 A;  4FHV A;  4M9J A;  2BCR A;  4YMO A;  5CJ7 A;  5J2F A;  2ZH5 A;  3PML A;  1KDH A;  1HUZ A;  2BCQ A;  1ZQA A;  4QZ8 A;  4WC6 A;  2BCS A;  4RQ1 A;  3JPP A;  4R65 A;  2GWS A;  4TUP A;  5J2G A;  9ICR A;  4YN4 A;  4FHW A;  4KLF A;  4F5P A;  4X4V A;  4KLJ A;  4RQ3 A;  4P4P A;  4TUQ A;  4RWO A;  3LK9 A;  3H38 A;  3JZ0 A;  1ZQK A;  5J2K A;  7ICM A;  4DOA A;  5CA7 A;  2ZH4 A;  2RFF A;  3OUY B;  8ICT A;  2M2V A;  3JPO A;  5EOZ A;  4DO9 A;  1TFY A;  2BE3 A;  4O5K A;  4RQ4 A;  9ICU A;  4QZ9 A;  3WFS C;  2DRA A;  4UD4 A;  4X4R A;  2PFO A;  9ICH A;  4AT9 B;  3RJH A;  5TZV A;  4X4U A;  1ZQH A;  4FHP A;  8ICX A;  4AT8 B;  4IQW A;  5J2B A;  3B0Y A;  3GDX A;  1ZQG A;  3TFR A;  3V7J A;  4GXI A;  4QZA A;  3V72 A;  1R89 A;  4Z6D A;  4PGX A;  3V7K A;  2DR7 A;  1TVA A;  3MGI A;  1ZQC A;  4DOB A;  4I2B A;  3H37 A;  5HRI A;  8ICR A;  5DEC A;  2NRK A;  3C18 A;  7ICJ A;  1HUO A;  7ICF A;  5J0Y A;  3PMN A;  1NOM A;  3B0X A;  4UB2 A;  3UQ2 A;  4NKU A;  4QZF A;  4RQ0 A;  5J2A A;  4EBK A;  3AQM A;  4I2I A;  3MBY A;  7ICP A;  4K4G A;  4P2H A;  3JPS A;  3L9D A;  3JPT A;  8ICU A;  7ICU A;  4KLL A;  1R8C A;  9ICC A;  2ID1 A;  4YCX A;  2P66 A;  5J0W A;  4NKT A;  5DDM A;  4UAZ A;  2BCU A;  4K4I A;  4WBY A;  3JPQ A;  4MF8 A;  4LVS A;  8ICM A;  4XRH A;  5HC9 A;  3RH5 A;  9ICV A;  3RJF A;  7ICL A;  4WC0 A;  4PHA A;  1R8A A;  4IQT A;  4IG8 A;  5HRF A;  3ISC A;  3UQ0 A;  4IQU A;  5CB1 A;  8ICP A;  5IIJ A;  4RWP A;  3AU6 A;  4NM2 A;  2BCV A;  5HRL A;  4E8F A;  3C66 A;  4YD2 A;  4KLS A;  3C2M A;  9ICW A;  4X4O A;  7ICV A;  4M9G A;  2M2U A;  5J0X A;  2O5A A;  4RQ6 A;  2I9G A;  2DR5 A;  7ICH A;  4MFC A;  5D49 A;  4RWQ A;  5DBB A;  9ICL A;  4P4M A;  4M47 A;  3MGH A;  1VJ7 A;  1NO5 A;  4KLQ A;  4E7X A;  3C5G A;  8ICC A;  4QZC A;  4QZG A;  4UB3 A;  3UPQ A;  1ZQM A;  3PNC A;  4NLN A;  1F5A A;  4RQ5 A;  3RJI A;  2PFQ A;  7ICG A;  3JYY A;  8ICF A;  2PFN A;  4AT7 B;  4EBJ A;  4FHY A;  1V4A A;  4WC5 A;  4UAW A;  5D4B A;  2BPG A;  4JWM A;  1UEU A;  5DDY A;  1ZQE A;  2ZHB A;  4F5R A;  2FMS A;  3RJE A;  9ICI A;  1XSN A;  4R63 A;  4FH3 A;  7ICQ A;  3AUO A;  3HIY A;  2ZHA A;  1VFG A;  3NYB A;  4KLE A;  3C2K A;  3OUY A;  4X5V A;  8ICK A;  1MQ3 A;  5HRE A;  4I2A A;  4PGQ A;  5J2J A;  1MIW A;  4PGY A;  7ICK A;  4I2F A;  8ICV A;  3AQN A;  5J2H A;  4GXJ A;  2IHM A;  4M9N A;  5J2I A;  4M0A A;  2ZH2 A;  4I27 A;  9ICF A;  4ATB B;  1KNY A;  4MFA A;  7ICS A;  5IIO A;  2M2W A;  1ZQN A;  4S3N A;  4WC1 A;  3RJJ A;  3K75 D;  3RJK A;  4RQ7 A;  1ZJM A;  5DKW A;  5III A;  7ICO A;  5HRD A;  2ISP A;  4X0A A;  9ICK A;  4O5C A;  4QZH A;  4KLT A;  4XQ8 A;  3TFS A;  4RPX A;  8ICN A;  3OV7 A;  5J0P A;  1JQR A; 
#chains in the Genus database with same CATH topology
 4I2D A;  5D46 A;  4UBC A;  1XSP A;  1ZQY A;  4UB1 A;  4KLG A;  8ICH A;  5B3P A;  3NVO A;  5IIL A;  7ICT A;  4K8V A;  3ER8 C;  9ICM A;  8ICA A;  3WFP A;  1ZQX A;  4QZB A;  4K4H A;  4UAY A;  3ER9 B;  5DED A;  4O6A A;  4O9M A;  4XUS A;  4R64 A;  1RPL A;  9ICT A;  3NWI A;  4NM1 A;  4EEB A;  1BPB A;  3AQK A;  3OVB A;  4TUR A;  3H3A A;  1ZQP A;  2IHO A;  4NLZ A;  5J0O A;  4X4N A;  3WFQ E;  1OU5 A;  8ICG A;  9ICP A;  5J0U A;  4PHD A;  3MDA A;  1TFW A;  1JMS A;  5DB7 A;  1BPE A;  4FHX A;  1ZQT A;  2PFP A;  4M04 A;  2FCL A;  2IUB A;  5J0S A;  8ICY A;  5CP2 A;  8ICI A;  4O67 A;  4LZD A;  4PPX A;  4Z6E A;  4EV6 A;  4DOC A;  2ZH9 A;  3OWG A;  3HJ1 A;  2BPC A;  3OGU A;  1ZQD A;  5J2C A;  8ICW A;  1UEV A;  1ZQL A;  5DBA A;  2ZH1 A;  4M9H A;  9ICX A;  8ICZ A;  5BOM A;  3UXO A;  3RH4 A;  4QZE A;  5DBC A;  5DB9 A;  4YMM A;  1ZQB A;  2M2T A;  5HHH A;  1ZQS A;  4NLK A;  8ICB A;  2ISO A;  4HX0 A;  4UD5 A;  3AQL A;  5J0R A;  1MQ2 A;  8ICJ A;  7ICR A;  3AU2 A;  7ICN A;  4KB6 A;  4FO6 A;  3LQC B;  9ICQ A;  5CFU A;  4M2Y A;  4WCW A;  1WOT A;  5IIM A;  1JAJ A;  5HRG A;  2O1P A;  7ICE A;  4AT7 A;  1UET A;  4I28 A;  4I2H A;  1PX5 A;  4WBZ A;  1ZQU A;  4RPY A;  4XJE A;  4WOY A;  5CHE A;  4MFF A;  4Z6F A;  4KLM A;  4XA5 A;  5BPC A;  1ZJN A;  2ZH6 A;  8ICO A;  2DVI A;  4UB4 A;  4K9A A;  3RH6 A;  1ZQF A;  4N7R A;  2GAF D;  4EP7 A;  4TUS A;  4JWN A;  4X4S A;  4WC2 A;  4JLZ A;  1RZT A;  2BBH A;  4NXW A;  4XQ7 A;  5CHG A;  3OV7 A;  4PH5 A;  4YMN A;  1XSL A;  4P4O A;  9ICG A;  1ZQW A;  3ISB A;  2DRB A;  4ATB A;  1MIV A;  4AT9 A;  3JPR A;  5J29 A;  4PHP A;  8ICS A;  4Z6C A;  3HJ4 A;  4AT8 A;  3V7L A;  1BPX A;  5J2E A;  4IQV A;  4F5Q A;  4I2J A;  8ICQ A;  4O5E A;  4YD1 A;  5HRH A;  5HRB A;  1BPY A;  4EGW A;  3C2L A;  5HHI A;  5HRK A;  9ICJ A;  1ZQI A;  1BPD A;  4M5D A;  4RWN A;  4I0U A;  9ICE A;  2DR8 A;  1KEJ A;  3ISD A;  4I2E A;  4LZG A;  1R8B A;  2VAN A;  5DB6 A;  5DB8 A;  4RT2 A;  4QZD A;  2HHP A;  1ZQV A;  3WFR E;  4X0B A;  5CWR A;  2ZH8 A;  3HX0 A;  5HR9 A;  9ICA A;  1MIY A;  4R66 A;  4MF2 A;  1YLQ A;  4OAI Z;  9ICB A;  4I2G A;  4RT3 A;  3WFO A;  2FMQ A;  2Q66 A;  5CR0 A;  2ZH7 A;  3RJG A;  1ZQJ A;  4WC4 A;  5D62 A;  4K98 A;  3C5F A;  2ZH3 A;  2EWR A;  4X4T A;  3HW8 A;  4NXZ A;  1BPZ A;  1JN3 A;  4E80 A;  9ICO A;  1ZQO A;  3OVS A;  4F5N A;  5J2D A;  9ICS A;  4WC3 A;  7ICI A;  4NXV A;  5F2V O;  4GXK A;  4UB5 A;  4KLU A;  4O68 A;  4NY8 A;  2PXI A;  4KLI A;  5J0T A;  4RQ8 A;  4RQ2 A;  5BOL A;  2BPF A;  9ICN A;  1FA0 A;  4X4Q A;  3H39 A;  4K96 A;  3EF2 A;  4QZI A;  1ZQQ A;  5IIK A;  4UBB A;  4LEV A;  4F5O A;  2PBE A;  4LT6 A;  3UPS A;  4PHE A;  4KLD A;  2HN1 A;  8ICE A;  4I29 A;  4X4P A;  4KLH A;  1ZQR A;  4RPZ A;  2DR9 A;  3UXN A;  4I2C A;  2W9M A;  3UXP A;  4FH5 A;  5IIN A;  8ICL A;  1ZQZ A;  1TV9 A;  3HWT A;  5J0Q A;  3OVA A;  2FMP A;  3JPN A;  4KLO A;  4M9L A;  1Q78 A;  3MDC A;  4WC7 A;  4FHV A;  4M9J A;  2BCR A;  4YMO A;  5CJ7 A;  5J2F A;  2ZH5 A;  3PML A;  1KDH A;  1HUZ A;  2BCQ A;  1ZQA A;  4QZ8 A;  4WC6 A;  2BCS A;  4RQ1 A;  3JPP A;  4R65 A;  2GWS A;  2BBJ A;  5D61 A;  5J2G A;  4TUP A;  4WQL A;  9ICR A;  4YN4 A;  2B56 A;  4FHW A;  4KLF A;  4F5P A;  4X4V A;  4KLJ A;  4RQ3 A;  4P4P A;  4OAH A;  4RWO A;  4TUQ A;  3LK9 A;  3H38 A;  3JZ0 A;  4KM5 A;  1ZQK A;  5J2K A;  7ICM A;  4DOA A;  5CA7 A;  2ZH4 A;  2RFF A;  3OUY B;  8ICT A;  2M2V A;  3JPO A;  5EOZ A;  4WH5 A;  4DO9 A;  1TFY A;  2BE3 A;  4O5K A;  4RQ4 A;  9ICU A;  4QZ9 A;  3WFS C;  2DRA A;  4UD4 A;  4X4R A;  2PFO A;  9ICH A;  4AT9 B;  3RJH A;  5TZV A;  4X4U A;  1ZQH A;  4FHP A;  8ICX A;  4AT8 B;  4IQW A;  5J2B A;  3B0Y A;  3GDX A;  1ZQG A;  3TFR A;  3V7J A;  4GXI A;  4QZA A;  3V72 A;  1R89 A;  4Z6D A;  4PGX A;  3V7K A;  2DR7 A;  1TVA A;  3MGI A;  4NXT A;  1ZQC A;  4DOB A;  4I2B A;  3H37 A;  5HRI A;  8ICR A;  5DEC A;  2NRK A;  3C18 A;  7ICJ A;  1HUO A;  7ICF A;  5J0Y A;  3PMN A;  1NOM A;  3B0X A;  4UB2 A;  3UQ2 A;  4NKU A;  4QZF A;  4RQ0 A;  5J2A A;  4EBK A;  3AQM A;  4I2I A;  3MBY A;  7ICP A;  4K4G A;  4P2H A;  3JPS A;  3L9D A;  3JPT A;  8ICU A;  7ICU A;  4KLL A;  1R8C A;  4OAF A;  3ERC C;  9ICC A;  2ID1 A;  2HN2 A;  3K7D A;  4YCX A;  2P66 A;  5J0W A;  4JLX A;  4NKT A;  5DDM A;  4UAZ A;  2BCU A;  4K97 A;  4K4I A;  4WBY A;  3JPQ A;  4MF8 A;  4LVS A;  8ICM A;  4XRH A;  5HC9 A;  3RH5 A;  9ICV A;  4NXU A;  3RJF A;  7ICL A;  4WC0 A;  4PHA A;  1R8A A;  2B51 A;  4IQT A;  4IG8 A;  5JTG A;  5HRF A;  3ISC A;  2GA9 D;  3UQ0 A;  4IQU A;  5CB1 A;  8ICP A;  5IIJ A;  4RWP A;  3AU6 A;  4NM2 A;  2BCV A;  5CFS A;  5HRL A;  4E8F A;  3C66 A;  4YD2 A;  4KLS A;  3C2M A;  9ICW A;  4X4O A;  7ICV A;  4M9G A;  1GPJ A;  2M2U A;  5J0X A;  4K99 A;  2O5A A;  4RQ6 A;  2I9G A;  2DR5 A;  7ICH A;  4MFC A;  5D49 A;  4RWQ A;  5DBB A;  9ICL A;  4P4M A;  4M47 A;  4EED A;  3MGH A;  1VJ7 A;  1NO5 A;  4K9B A;  4KLQ A;  4E7X A;  3C5G A;  8ICC A;  4QZC A;  4QZG A;  4UB3 A;  3UPQ A;  5B3Q A;  1ZQM A;  3PNC A;  4NLN A;  1F5A A;  4RQ5 A;  3RJI A;  2PFQ A;  4MKP A;  7ICG A;  3JYY A;  8ICF A;  2PFN A;  3NKU A;  4O69 A;  4AT7 B;  4EBJ A;  4FHY A;  1V4A A;  5CFT A;  4WC5 A;  4UAW A;  5D4B A;  2BPG A;  4JWM A;  1UEU A;  5DDY A;  1ZQE A;  2ZHB A;  4LEZ A;  4F5R A;  2FMS A;  4OAG A;  3RJE A;  9ICI A;  1XSN A;  4R63 A;  4FH3 A;  7ICQ A;  3AUO A;  3HIY A;  2ZHA A;  1VFG A;  3NYB A;  4LEY A;  3C2K A;  3OUY A;  4KLE A;  4X5V A;  8ICK A;  1MQ3 A;  5HRE A;  4I2A A;  4PGQ A;  5J2J A;  1MIW A;  4PGY A;  7ICK A;  4I2F A;  8ICV A;  3AQN A;  3CK6 A;  5J2H A;  4GXJ A;  2IHM A;  4M9N A;  5J2I A;  4M0A A;  2ZH2 A;  4I27 A;  9ICF A;  4ATB B;  1KNY A;  4MFA A;  3JCF A;  7ICS A;  5IIO A;  2M2W A;  1ZQN A;  4S3N A;  4WC1 A;  3RJJ A;  3K75 D;  3MCR A;  3RJK A;  4RQ7 A;  1ZJM A;  5DKW A;  4LEW A;  4WQK A;  5III A;  3PHZ A;  4NXX A;  7ICO A;  5HRD A;  2B4V A;  2ISP A;  4X0A A;  5D63 A;  9ICK A;  4O5C A;  4QZH A;  4KLT A;  4XQ8 A;  3TFS A;  4RPX A;  4FO1 A;  8ICN A;  1Q79 A;  5J0P A;  1JQR A; 
#chains in the Genus database with same CATH homology
 4I2D A;  5D46 A;  4UBC A;  1XSP A;  1ZQY A;  4UB1 A;  4KLG A;  8ICH A;  5IIL A;  7ICT A;  8ICA A;  9ICM A;  3WFP A;  1ZQX A;  4QZB A;  4K4H A;  4UAY A;  5DED A;  4O9M A;  4XUS A;  4R64 A;  1RPL A;  9ICT A;  4NM1 A;  1BPB A;  3AQK A;  3OVB A;  4TUR A;  3H3A A;  1ZQP A;  4NLZ A;  5J0O A;  4X4N A;  3WFQ E;  1OU5 A;  8ICG A;  9ICP A;  5J0U A;  4PHD A;  3MDA A;  1TFW A;  1JMS A;  5DB7 A;  1BPE A;  4FHX A;  1ZQT A;  2PFP A;  4M04 A;  5J0S A;  8ICY A;  5CP2 A;  8ICI A;  4PPX A;  4LZD A;  4Z6E A;  4DOC A;  2ZH9 A;  3HJ1 A;  2BPC A;  3OGU A;  1ZQD A;  5J2C A;  8ICW A;  1UEV A;  1ZQL A;  5DBA A;  2ZH1 A;  4M9H A;  9ICX A;  8ICZ A;  5BOM A;  3UXO A;  3RH4 A;  4QZE A;  5DBC A;  5DB9 A;  4YMM A;  1ZQB A;  2M2T A;  5HHH A;  1ZQS A;  4NLK A;  8ICB A;  2ISO A;  5J0R A;  4UD5 A;  3AQL A;  1MQ2 A;  8ICJ A;  7ICR A;  3AU2 A;  7ICN A;  4FO6 A;  3LQC B;  9ICQ A;  4M2Y A;  4WCW A;  1WOT A;  5IIM A;  1JAJ A;  5HRG A;  1Q79 A;  2O1P A;  7ICE A;  4AT7 A;  1UET A;  4I28 A;  4I2H A;  1PX5 A;  4WBZ A;  1ZQU A;  4RPY A;  4MFF A;  4Z6F A;  4KLM A;  4XA5 A;  5BPC A;  1ZJN A;  2ZH6 A;  8ICO A;  2DVI A;  4UB4 A;  3RH6 A;  1ZQF A;  4EP7 A;  4TUS A;  4JWN A;  4X4S A;  4WC2 A;  1RZT A;  4XQ7 A;  5CHG A;  4PH5 A;  4YMN A;  1XSL A;  4P4O A;  9ICG A;  1ZQW A;  3ISB A;  2DRB A;  4ATB A;  1MIV A;  4AT9 A;  3JPR A;  5J29 A;  4PHP A;  8ICS A;  4Z6C A;  3HJ4 A;  4AT8 A;  3V7L A;  1BPX A;  5J2E A;  4IQV A;  4F5Q A;  4I2J A;  8ICQ A;  4O5E A;  4YD1 A;  5HRH A;  5HRB A;  1BPY A;  3C2L A;  5HHI A;  5HRK A;  9ICJ A;  1ZQI A;  1BPD A;  4M5D A;  4RWN A;  9ICE A;  2DR8 A;  1KEJ A;  3ISD A;  4I2E A;  4LZG A;  1R8B A;  2VAN A;  5DB6 A;  5DB8 A;  4RT2 A;  4QZD A;  2HHP A;  1ZQV A;  3WFR E;  4X0B A;  5CWR A;  2ZH8 A;  3HX0 A;  5HR9 A;  9ICA A;  1MIY A;  4R66 A;  4MF2 A;  1YLQ A;  9ICB A;  4I2G A;  4RT3 A;  3WFO A;  2FMQ A;  2Q66 A;  5CR0 A;  2ZH7 A;  3RJG A;  1ZQJ A;  4WC4 A;  3C5F A;  2ZH3 A;  4X4T A;  3HW8 A;  4NXZ A;  1BPZ A;  1JN3 A;  4E80 A;  9ICO A;  1ZQO A;  3OVS A;  4F5N A;  5J2D A;  9ICS A;  4WC3 A;  7ICI A;  5F2V O;  4GXK A;  4UB5 A;  4KLU A;  4NY8 A;  2PXI A;  4KLI A;  5J0T A;  4RQ8 A;  4RQ2 A;  5BOL A;  2BPF A;  9ICN A;  1FA0 A;  4X4Q A;  3H39 A;  4QZI A;  1ZQQ A;  5IIK A;  4UBB A;  4F5O A;  2PBE A;  4LT6 A;  3UPS A;  4PHE A;  4KLD A;  8ICE A;  4I29 A;  4X4P A;  4KLH A;  1ZQR A;  4RPZ A;  2DR9 A;  3UXN A;  4I2C A;  2W9M A;  3UXP A;  4FH5 A;  5IIN A;  8ICL A;  1ZQZ A;  1TV9 A;  3HWT A;  5J0Q A;  3OVA A;  2FMP A;  3JPN A;  4KLO A;  4M9L A;  1Q78 A;  3MDC A;  4WC7 A;  4FHV A;  4M9J A;  2BCR A;  4YMO A;  5CJ7 A;  5J2F A;  2ZH5 A;  3PML A;  1KDH A;  1HUZ A;  2BCQ A;  1ZQA A;  4QZ8 A;  4WC6 A;  2BCS A;  4RQ1 A;  3JPP A;  4R65 A;  2GWS A;  4TUP A;  5J2G A;  9ICR A;  4YN4 A;  4FHW A;  4KLF A;  4F5P A;  4X4V A;  4KLJ A;  4RQ3 A;  4P4P A;  4TUQ A;  4RWO A;  3LK9 A;  3H38 A;  3JZ0 A;  1ZQK A;  5J2K A;  7ICM A;  4DOA A;  5CA7 A;  2ZH4 A;  2RFF A;  3OUY B;  8ICT A;  2M2V A;  3JPO A;  5EOZ A;  4DO9 A;  1TFY A;  2BE3 A;  4O5K A;  4RQ4 A;  9ICU A;  4QZ9 A;  3WFS C;  2DRA A;  4UD4 A;  4X4R A;  2PFO A;  9ICH A;  4AT9 B;  3RJH A;  5TZV A;  4X4U A;  1ZQH A;  4FHP A;  8ICX A;  4AT8 B;  4IQW A;  5J2B A;  3B0Y A;  3GDX A;  1ZQG A;  3TFR A;  3V7J A;  4GXI A;  4QZA A;  3V72 A;  1R89 A;  4Z6D A;  4PGX A;  3V7K A;  2DR7 A;  1TVA A;  3MGI A;  1ZQC A;  4DOB A;  4I2B A;  3H37 A;  5HRI A;  8ICR A;  5DEC A;  2NRK A;  3C18 A;  7ICJ A;  1HUO A;  7ICF A;  5J0Y A;  3PMN A;  1NOM A;  3B0X A;  4UB2 A;  3UQ2 A;  4NKU A;  4QZF A;  4RQ0 A;  5J2A A;  4EBK A;  3AQM A;  4I2I A;  3MBY A;  7ICP A;  4K4G A;  4P2H A;  3JPS A;  3L9D A;  3JPT A;  8ICU A;  7ICU A;  4KLL A;  1R8C A;  9ICC A;  2ID1 A;  4YCX A;  2P66 A;  5J0W A;  4NKT A;  5DDM A;  4UAZ A;  2BCU A;  4K4I A;  4WBY A;  3JPQ A;  4MF8 A;  4LVS A;  8ICM A;  4XRH A;  5HC9 A;  3RH5 A;  9ICV A;  3RJF A;  7ICL A;  4WC0 A;  4PHA A;  1R8A A;  4IQT A;  4IG8 A;  5HRF A;  3ISC A;  3UQ0 A;  4IQU A;  5CB1 A;  8ICP A;  5IIJ A;  4RWP A;  3AU6 A;  4NM2 A;  2BCV A;  5HRL A;  4E8F A;  3C66 A;  4YD2 A;  4KLS A;  3C2M A;  9ICW A;  4X4O A;  7ICV A;  4M9G A;  2M2U A;  5J0X A;  2O5A A;  4RQ6 A;  2I9G A;  2DR5 A;  7ICH A;  4MFC A;  5D49 A;  4RWQ A;  5DBB A;  9ICL A;  4P4M A;  4M47 A;  3MGH A;  1VJ7 A;  1NO5 A;  4KLQ A;  4E7X A;  3C5G A;  8ICC A;  4QZC A;  4QZG A;  4UB3 A;  3UPQ A;  1ZQM A;  3PNC A;  4NLN A;  1F5A A;  4RQ5 A;  3RJI A;  2PFQ A;  7ICG A;  3JYY A;  8ICF A;  2PFN A;  4AT7 B;  4EBJ A;  4FHY A;  1V4A A;  4WC5 A;  4UAW A;  5D4B A;  2BPG A;  4JWM A;  1UEU A;  5DDY A;  1ZQE A;  2ZHB A;  4F5R A;  2FMS A;  3RJE A;  9ICI A;  1XSN A;  4R63 A;  4FH3 A;  7ICQ A;  3AUO A;  3HIY A;  2ZHA A;  1VFG A;  3NYB A;  4KLE A;  3C2K A;  3OUY A;  4X5V A;  8ICK A;  1MQ3 A;  5HRE A;  4I2A A;  4PGQ A;  5J2J A;  1MIW A;  4PGY A;  7ICK A;  4I2F A;  8ICV A;  3AQN A;  5J2H A;  4GXJ A;  2IHM A;  4M9N A;  5J2I A;  4M0A A;  2ZH2 A;  4I27 A;  9ICF A;  4ATB B;  1KNY A;  4MFA A;  7ICS A;  5IIO A;  2M2W A;  1ZQN A;  4S3N A;  4WC1 A;  3RJJ A;  3K75 D;  3RJK A;  4RQ7 A;  1ZJM A;  5DKW A;  5III A;  7ICO A;  5HRD A;  2ISP A;  4X0A A;  9ICK A;  4O5C A;  4QZH A;  4KLT A;  4XQ8 A;  3TFS A;  4RPX A;  8ICN A;  3OV7 A;  5J0P A;  1JQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...