4WC2A

Crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 122
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc2A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc2A01
3OVSA 4FHXA 1ZJNA 5J0TA 5BOLA 5DB7A 3JPTA 4RQ5A 1BPEA 2BCVA 8ICQA 4P4OA 4FHVA 7ICTA 7ICPA 3H39A 5CR0A 5TZVA 7ICJA 3MBYA 1TFYA 4X4NA 3AQNA 4AT8B 4YN4A 8ICBA 2RFFA 4WC6A 2BPCA 4FO6A 1ZQPA 2M2VA 4NLKA 1ZQKA 2PFOA 5J29A 4X4PA 7ICIA 4K4IA 5J0OA 4QZBA 3MDAA 5DBCA 2DRBA 4RWOA 8ICVA 3JPQA 4M04A 4I27A 3AQKA 4R65A 5IIKA 4KLTA 4WCWA 4IG8A 1ZQWA 4I2DA 8ICTA 2PXIA 4RT3A 4YD1A 4YD2A 4YMNA 5CJ7A 4KLSA 4PH5A 3K75D 2ZH8A 1BPZA 2M2TA 8ICIA 2VANA 9ICRA 4UB3A 8ICJA 4KLDA 8ICKA 4X4RA 7ICNA 2BCRA 3RJEA 1ZQVA 9ICAA 4PGQA 9ICLA 4UBBA 2O5AA 4TUPA 1BPXA 1NO5A 2PFNA 3RH6A 3RJIA 5HRIA 1ZQZA 3H3AA 4R66A 1JMSA 3C66A 4PHPA 4M9HA 4Z6DA 4X0AA 9ICIA 4UAYA 2O1PA 4EP7A 7ICLA 5D4BA 4Z6FA 4XA5A 3UPQA 2ZH6A 1V4AA 4EBJA 4KLLA 5DBAA 8ICZA 4GXIA 1RPLA 4DOAA 2ISPA 3RJFA 4M9NA 4MFFA 5HHHA 3UPSA 4MF8A 4EBKA 5IINA 4IQWA 1ZQHA 3C2KA 4F5OA 4KLGA 4PHEA 5HRLA 2GWSA 5DB8A 5CA7A 5CWRA 1ZQXA 1UEUA 3AU6A 4MFAA 4QZ8A 1Q79A 4M9GA 4IQVA 3HWTA 7ICFA 9ICNA 4GXJA 2ZHBA 1R8BA 4LZGA 3MDCA 5F2VO 4WC7A 1ZQLA 3RJGA 8ICAA 1MIWA 1ZQGA 4QZAA 1ZQSA 5DBBA 5J2HA 4I28A 4NM1A 4UAWA 3MGHA 4WC2A 4RWPA 3JPOA 3V7KA 1NOMA 7ICUA 5EOZA 1KDHA 4TUSA 1MQ3A 8ICLA 5J0XA 5J0YA 4S3NA 1OU5A 1FA0A 4X4QA 5IIJA 4X0BA 4E8FA 5J0PA 3UXPA 4KLEA 3LQCB 5BOMA 1ZQRA 4RWQA 5J0UA 2ID1A 3UXNA 3C2LA 4F5QA 8ICWA 1ZQYA 2DR7A 4NLZA 3C18A 9ICFA 3AU2A 4DOCA 3C2MA 3PMLA 3UXOA 2BCQA 2PBEA 3RJKA 4TUQA 2NRKA 2BE3A 4R63A 4O5KA 4RPZA 3UQ2A 3V7LA 2HHPA 4X4OA 4O5CA 4Z6CA 4KLJA 1ZQEA 3H37A 5CP2A 1YLQA 1JAJA 1BPYA 5HRKA 4AT7B 3AUOA 7ICEA 7ICMA 4P4MA 3OVAA 5HC9A 1JQRA 3TFRA 4NKUA 4YMMA 4FHWA 5J0QA 4I29A 4PHAA 1MQ2A 4NY8A 3HJ4A 4M5DA 4PPXA 5J2GA 1TFWA 2FMPA 5CB1A 4I2GA 4UB1A 4RWNA 4AT7A 3V7JA 5DKWA 4QZEA 4KLMA 4WC4A 1XSPA 3HJ1A 1UEVA 3HIYA 4RQ3A 7ICQA 4WC3A 4K4GA 1UETA 5J0WA 5J2FA 8ICUA 1VJ7A 3WFRE 3ISBA 7ICOA 9ICXA 2PFQA 1R8AA 9ICJA 3JPPA 4RQ0A 4I2FA 1ZQAA 4XRHA 4LT6A 2M2UA 5HRGA 5DDMA 1KEJA 5HRBA 2IHMA 3PMNA 1HUZA 1TVAA 4I2EA 4E7XA 4WBYA 4QZCA 4FH3A 4MF2A 4M2YA 3TFSA 1BPBA 2ZH2A 4WC0A 4RPXA 4O9MA 4Z6EA 8ICHA 4WC5A 4I2AA 5J2KA 1BPDA 4DO9A 4FHYA 4X4VA 4RT2A 5J2AA 5DDYA 1JN3A 5IILA 8ICXA 2Q66A 4XQ8A 5D49A 3OV7A 4NKTA 3ISCA 4RQ1A 2DR8A 1ZQQA 9ICVA 9ICQA 2W9MA 4P4PA 3NYBA 4E80A 5DB6A 4F5NA 4WBZA 4K4HA 4YCXA 9ICUA 3RH4A 2DRAA 1ZQMA 4NM2A 5HHIA 4M9LA 4FH5A 1MIYA 2ISOA 8ICEA 4DOBA 4UB4A 4KLIA 3GDXA 8ICMA 1ZJMA 1TV9A 1ZQNA 4RQ2A 2PFPA 2BPGA 4I2BA 4X4SA 2ZH1A 3OVBA 7ICRA 1Q78A 3C5FA 3HX0A 1RZTA 4I2HA 3HW8A 3OGUA 1ZQCA 2M2WA 1ZQDA 4I2IA 3JZ0A 4IQTA 4PHDA 2BCUA 9ICSA 3RJHA 8ICYA 3H38A 1F5AA 2FMSA 4RQ4A 1XSLA 8ICRA 3RJJA 4AT9B 4KLHA 5HREA 5J0RA 5J2CA 4UAZA 5D46A 2DVIA 4QZIA 1ZQJA 2ZH5A 4UB5A 2ZH7A 1ZQOA 9ICMA 3JPSA 9ICTA 4RPYA 4RQ6A 7ICGA 5IIMA 4QZFA 3WFPA 1R89A 5HRHA 5HR9A 8ICPA 8ICSA 5CHGA 1PX5A 3WFOA 4AT8A 9ICEA 2FMQA 4NLNA 4KLUA 4UB2A 4AT9A 1XSNA 1ZQTA 3PNCA 2ZH9A 1ZQIA 4F5PA 9ICWA 3MGIA 3JPRA 3JPNA 5J2IA 1ZQFA 4F5RA 4ATBB 1MIVA 1KNYA 8ICOA 1ZQBA 4RQ7A 9ICCA 4FHPA 5DEDA 4RQ8A 4M0AA 2I9GA 5IIIA 4GXKA 4LZDA 4UD5A 3JYYA 9ICGA 4M9JA 9ICPA 3WFSC 3AQLA 2ZH4A 4I2CA 4QZ9A 4LVSA 3OUYB 2ZH3A 7ICVA 3B0XA 4I2JA 8ICCA 4R64A 2DR5A 4WC1A 1VFGA 4UD4A 5DECA 4ATBA 5J2BA 4JWNA 4QZDA 4KLOA 7ICSA 2BPFA 4KLFA 5BPCA 4NXZA 3L9DA 2P66A 8ICFA 3B0YA 5IIOA 3WFQE 4MFCA 4QZHA 3ISDA 5HRFA 4PGXA 4XQ7A 1HUOA 9ICKA 3V72A 4X4TA 4PGYA 9ICHA 2ZHAA 4X5VA 3OUYA 4M47A 5J2DA 1ZQUA 4IQUA 4QZGA 5HRDA 4X4UA 4UBCA 2BCSA 4O5EA 7ICKA 9ICBA 8ICNA 3RH5A 8ICGA 5J2JA 3AQMA 2DR9A 5J2EA 4P2HA 5J0SA 4KLQA 3C5GA 3UQ0A 4XUSA 7ICHA 3LK9A 4JWMA 9ICOA 5DB9A 4TURA 1WOTA 1R8CA 4YMOA
chains in the Genus database with same CATH superfamily
3OVSA 4FHXA 1ZJNA 5J0TA 5BOLA 5DB7A 3JPTA 4RQ5A 1BPEA 2BCVA 4NXVA 8ICQA 4P4OA 4FHVA 7ICTA 7ICPA 3H39A 5CR0A 5TZVA 7ICJA 4EV6A 3MBYA 1TFYA 4X4NA 3AQNA 4AT8B 4YN4A 8ICBA 2RFFA 2HN1A 4WC6A 2BPCA 4FO6A 1ZQPA 2M2VA 4NLKA 1ZQKA 2PFOA 5J29A 4X4PA 7ICIA 4K4IA 5J0OA 4QZBA 3MDAA 5DBCA 2DRBA 4RWOA 8ICVA 3JPQA 4M04A 4I27A 3AQKA 4R65A 5IIKA 3CK6A 4KLTA 4WCWA 4IG8A 1ZQWA 4I2DA 8ICTA 2PXIA 4RT3A 4YD1A 4YD2A 4YMNA 5CJ7A 4KLSA 4PH5A 3K75D 2HN2A 2ZH8A 1BPZA 2M2TA 3ER9B 8ICIA 2VANA 9ICRA 4UB3A 8ICJA 4KLDA 4K9BA 8ICKA 4X4RA 7ICNA 2BCRA 3RJEA 1ZQVA 9ICAA 4PGQA 9ICLA 4UBBA 2O5AA 4TUPA 1BPXA 1NO5A 2PFNA 3RH6A 3RJIA 5HRIA 1ZQZA 3H3AA 4R66A 1JMSA 3C66A 4PHPA 4M9HA 4Z6DA 4X0AA 4K99A 9ICIA 4O6AA 4UAYA 2O1PA 4EP7A 7ICLA 5D4BA 4Z6FA 4XJEA 4XA5A 3UPQA 5B3QA 2ZH6A 1V4AA 4EBJA 4KLLA 5DBAA 8ICZA 4GXIA 1RPLA 4DOAA 2GA9D 2ISPA 3RJFA 4M9NA 4MFFA 5HHHA 3UPSA 4MF8A 4EBKA 5IINA 4IQWA 1ZQHA 3C2KA 4F5OA 5CFUA 4KLGA 4PHEA 5HRLA 2GWSA 5DB8A 5CA7A 5CWRA 1ZQXA 4HX0A 1UEUA 3AU6A 4MFAA 4QZ8A 1Q79A 4OAHA 4M9GA 4IQVA 3HWTA 7ICFA 9ICNA 4GXJA 2ZHBA 1R8BA 5D61A 4LZGA 3MDCA 5F2VO 4WC7A 1ZQLA 3RJGA 8ICAA 1MIWA 1ZQGA 4QZAA 1ZQSA 2FCLA 5DBBA 5J2HA 4I28A 4NM1A 4UAWA 3MGHA 4WC2A 4RWPA 3JPOA 3V7KA 1NOMA 7ICUA 5EOZA 1KDHA 5CHEA 4K98A 4TUSA 1MQ3A 8ICLA 3OWGA 5J0XA 2IUBA 5J0YA 4S3NA 1OU5A 1FA0A 4X4QA 5IIJA 4X0BA 4E8FA 5J0PA 3UXPA 4KLEA 3LQCB 5BOMA 1ZQRA 4RWQA 5J0UA 2ID1A 3UXNA 4OAIZ 3C2LA 4F5QA 8ICWA 1ZQYA 2DR7A 4O67A 3MCRA 4NLZA 3C18A 9ICFA 3AU2A 4LEWA 4K97A 4DOCA 3C2MA 4MKPA 3PMLA 3UXOA 2BCQA 2PBEA 3RJKA 4TUQA 2NRKA 4JLZA 3NVOA 4JWNA 2BE3A 4R63A 3EF2A 4WQLA 4O5KA 4RPZA 3UQ2A 3V7LA 2HHPA 4X4OA 4O5CA 4Z6CA 4KLJA 1ZQEA 3H37A 5CP2A 1YLQA 1JAJA 1BPYA 5HRKA 4WQKA 4AT7B 3AUOA 7ICEA 7ICMA 4P4MA 3OVAA 5HC9A 2B51A 1JQRA 3TFRA 4NKUA 4YMMA 4K9AA 4FHWA 5J0QA 4I29A 4PHAA 4LEZA 1MQ2A 4N7RA 4JLXA 4NY8A 3HJ4A 4M5DA 2EWRA 4PPXA 5J2GA 1TFWA 2FMPA 5CB1A 4I2GA 4UB1A 4EEDA 4RWNA 4AT7A 3V7JA 5DKWA 4QZEA 4KLMA 4WC4A 1XSPA 4WH5A 3HJ1A 1UEVA 3HIYA 4RQ3A 7ICQA 4WC3A 4K4GA 1UETA 5J0WA 5J2FA 8ICUA 1VJ7A 3WFRE 3ISBA 4EGWA 7ICOA 9ICXA 2PFQA 1R8AA 9ICJA 3JPPA 4KB6A 4RQ0A 4I2FA 1ZQAA 4XRHA 4LT6A 2M2UA 5HRGA 5DDMA 1KEJA 5HRBA 2IHMA 3PMNA 1HUZA 1TVAA 4I2EA 4E7XA 2BBHA 4WBYA 4QZCA 4FH3A 4MF2A 5D62A 4M2YA 3TFSA 1BPBA 4FO1A 2ZH2A 4WC0A 4RPXA 4O9MA 4Z6EA 5B3PA 8ICHA 4WC5A 4I2AA 4LEYA 5J2KA 3ERCC 1BPDA 4DO9A 4NXXA 4FHYA 4X4VA 4RT2A 5J2AA 5DDYA 1JN3A 5IILA 8ICXA 5D63A 2Q66A 4XQ8A 5D49A 3OV7A 5CFSA 4NXUA 2IHOA 4NKTA 3ISCA 4RQ1A 2DR8A 1ZQQA 3NKUA 9ICVA 9ICQA 2W9MA 4P4PA 3NYBA 4E80A 5DB6A 4O69A 4F5NA 4WBZA 4K4HA 4YCXA 3NWIA 9ICUA 4O68A 3RH4A 2DRAA 1ZQMA 4NM2A 5HHIA 4M9LA 4FH5A 1MIYA 2ISOA 8ICEA 4DOBA 4UB4A 4KLIA 3GDXA 8ICMA 1ZJMA 1TV9A 1ZQNA 4RQ2A 2PFPA 2BPGA 4K96A 4I2BA 4X4SA 2ZH1A 3OVBA 7ICRA 1Q78A 3C5FA 4LEVA 3HX0A 1RZTA 4I2HA 3HW8A 3OGUA 1ZQCA 2M2WA 1ZQDA 4I2IA 3JZ0A 4IQTA 4PHDA 4WOYA 2BCUA 3RJHA 3K7DA 8ICYA 9ICSA 3H38A 1F5AA 2FMSA 4RQ4A 1XSLA 8ICRA 3RJJA 4AT9B 4KLHA 5HREA 5J0RA 5J2CA 4UAZA 5D46A 2DVIA 4QZIA 4OAGA 2B56A 1ZQJA 2ZH5A 4UB5A 2ZH7A 1ZQOA 9ICMA 3JPSA 9ICTA 4RPYA 4RQ6A 7ICGA 4I0UA 5IIMA 4QZFA 3JCFA 3WFPA 1R89A 5HRHA 5HR9A 8ICPA 8ICSA 5CHGA 1PX5A 3WFOA 4AT8A 9ICEA 2FMQA 4NLNA 4KLUA 4UB2A 4AT9A 1XSNA 1ZQTA 3PNCA 2ZH9A 1ZQIA 4F5PA 9ICWA 3MGIA 3JPRA 3JPNA 5J2IA 1ZQFA 4TURA 4F5RA 4ATBB 1MIVA 1KNYA 8ICOA 1ZQBA 4RQ7A 9ICCA 4FHPA 5DEDA 4RQ8A 4M0AA 2I9GA 5IIIA 4GXKA 4LZDA 4UD5A 3JYYA 9ICGA 4NXWA 4M9JA 4NXTA 9ICPA 3WFSC 3AQLA 2ZH4A 4I2CA 4QZ9A 4LVSA 3OUYB 2ZH3A 7ICVA 3B0XA 4I2JA 2BBJA 8ICCA 4R64A 4KM5A 4WC1A 1VFGA 4UD4A 5DECA 4ATBA 5J2BA 2DR5A 4QZDA 4K8VA 4KLOA 7ICSA 2BPFA 4KLFA 3PHZA 5BPCA 1GPJA 4NXZA 3L9DA 2P66A 8ICFA 3B0YA 5IIOA 3WFQE 4MFCA 4QZHA 3ISDA 5HRFA 4PGXA 4XQ7A 5JTGA 1HUOA 9ICKA 3V72A 4X4TA 4PGYA 9ICHA 2ZHAA 4X5VA 3OUYA 4M47A 5J2DA 3ER8C 1ZQUA 4IQUA 4QZGA 5HRDA 4X4UA 4UBCA 2BCSA 4O5EA 7ICKA 9ICBA 8ICNA 3RH5A 2GAFD 8ICGA 5CFTA 5J2JA 3AQMA 2B4VA 2DR9A 5J2EA 4P2HA 5J0SA 4KLQA 4EEBA 3C5GA 3UQ0A 4XUSA 7ICHA 3LK9A 4JWMA 9ICOA 5DB9A 4OAFA 1WOTA 1R8CA 4YMOA
chains in the Genus database with same CATH topology
3OVSA 4FHXA 1ZJNA 5J0TA 5BOLA 5DB7A 3JPTA 4RQ5A 1BPEA 2BCVA 8ICQA 4P4OA 4FHVA 7ICTA 7ICPA 3H39A 5CR0A 5TZVA 7ICJA 3MBYA 1TFYA 4X4NA 3AQNA 4AT8B 4YN4A 8ICBA 2RFFA 4WC6A 2BPCA 4FO6A 1ZQPA 2M2VA 4NLKA 1ZQKA 2PFOA 5J29A 4X4PA 7ICIA 4K4IA 5J0OA 4QZBA 3MDAA 5DBCA 2DRBA 4RWOA 8ICVA 3JPQA 4M04A 4I27A 3AQKA 4R65A 5IIKA 4KLTA 4WCWA 4IG8A 1ZQWA 4I2DA 8ICTA 2PXIA 4RT3A 4YD1A 4YD2A 4YMNA 5CJ7A 4KLSA 4PH5A 3K75D 2ZH8A 1BPZA 2M2TA 8ICIA 2VANA 9ICRA 4UB3A 8ICJA 4KLDA 8ICKA 4X4RA 7ICNA 2BCRA 3RJEA 1ZQVA 9ICAA 4PGQA 9ICLA 4UBBA 2O5AA 4TUPA 1BPXA 1NO5A 2PFNA 3RH6A 3RJIA 5HRIA 1ZQZA 3H3AA 4R66A 1JMSA 3C66A 4PHPA 4M9HA 4Z6DA 4X0AA 9ICIA 4UAYA 2O1PA 4EP7A 7ICLA 5D4BA 4Z6FA 4XA5A 3UPQA 2ZH6A 1V4AA 4EBJA 4KLLA 5DBAA 8ICZA 4GXIA 1RPLA 4DOAA 2ISPA 3RJFA 4M9NA 4MFFA 5HHHA 3UPSA 4MF8A 4EBKA 5IINA 4IQWA 1ZQHA 3C2KA 4F5OA 4KLGA 4PHEA 5HRLA 2GWSA 5DB8A 5CA7A 5CWRA 1ZQXA 1UEUA 3AU6A 4MFAA 4QZ8A 1Q79A 4M9GA 4IQVA 3HWTA 7ICFA 9ICNA 4GXJA 2ZHBA 1R8BA 4LZGA 3MDCA 5F2VO 4WC7A 1ZQLA 3RJGA 8ICAA 1MIWA 1ZQGA 4QZAA 1ZQSA 5DBBA 5J2HA 4I28A 4NM1A 4UAWA 3MGHA 4WC2A 4RWPA 3JPOA 3V7KA 1NOMA 7ICUA 5EOZA 1KDHA 4TUSA 1MQ3A 8ICLA 5J0XA 5J0YA 4S3NA 1OU5A 1FA0A 4X4QA 5IIJA 4X0BA 4E8FA 5J0PA 3UXPA 4KLEA 3LQCB 5BOMA 1ZQRA 4RWQA 5J0UA 2ID1A 3UXNA 3C2LA 4F5QA 8ICWA 1ZQYA 2DR7A 4NLZA 3C18A 9ICFA 3AU2A 4DOCA 3C2MA 3PMLA 3UXOA 2BCQA 2PBEA 3RJKA 4TUQA 2NRKA 2BE3A 4R63A 4O5KA 4RPZA 3UQ2A 3V7LA 2HHPA 4X4OA 4O5CA 4Z6CA 4KLJA 1ZQEA 3H37A 5CP2A 1YLQA 1JAJA 1BPYA 5HRKA 4AT7B 3AUOA 7ICEA 7ICMA 4P4MA 3OVAA 5HC9A 1JQRA 3TFRA 4NKUA 4YMMA 4FHWA 5J0QA 4I29A 4PHAA 1MQ2A 4NY8A 3HJ4A 4M5DA 4PPXA 5J2GA 1TFWA 2FMPA 5CB1A 4I2GA 4UB1A 4RWNA 4AT7A 3V7JA 5DKWA 4QZEA 4KLMA 4WC4A 1XSPA 3HJ1A 1UEVA 3HIYA 4RQ3A 7ICQA 4WC3A 4K4GA 1UETA 5J0WA 5J2FA 8ICUA 1VJ7A 3WFRE 3ISBA 7ICOA 9ICXA 2PFQA 1R8AA 9ICJA 3JPPA 4RQ0A 4I2FA 1ZQAA 4XRHA 4LT6A 2M2UA 5HRGA 5DDMA 1KEJA 5HRBA 2IHMA 3PMNA 1HUZA 1TVAA 4I2EA 4E7XA 4WBYA 4QZCA 4FH3A 4MF2A 4M2YA 3TFSA 1BPBA 2ZH2A 4WC0A 4RPXA 4O9MA 4Z6EA 8ICHA 4WC5A 4I2AA 5J2KA 1BPDA 4DO9A 4FHYA 4X4VA 4RT2A 5J2AA 5DDYA 1JN3A 5IILA 8ICXA 2Q66A 4XQ8A 5D49A 3OV7A 4NKTA 3ISCA 4RQ1A 2DR8A 1ZQQA 9ICVA 9ICQA 2W9MA 4P4PA 3NYBA 4E80A 5DB6A 4F5NA 4WBZA 4K4HA 4YCXA 9ICUA 3RH4A 2DRAA 1ZQMA 4NM2A 5HHIA 4M9LA 4FH5A 1MIYA 2ISOA 8ICEA 4DOBA 4UB4A 4KLIA 3GDXA 8ICMA 1ZJMA 1TV9A 1ZQNA 4RQ2A 2PFPA 2BPGA 4I2BA 4X4SA 2ZH1A 3OVBA 7ICRA 1Q78A 3C5FA 3HX0A 1RZTA 4I2HA 3HW8A 3OGUA 1ZQCA 2M2WA 1ZQDA 4I2IA 3JZ0A 4IQTA 4PHDA 2BCUA 9ICSA 3RJHA 8ICYA 3H38A 1F5AA 2FMSA 4RQ4A 1XSLA 8ICRA 3RJJA 4AT9B 4KLHA 5HREA 5J0RA 5J2CA 4UAZA 5D46A 2DVIA 4QZIA 1ZQJA 2ZH5A 4UB5A 2ZH7A 1ZQOA 9ICMA 3JPSA 9ICTA 4RPYA 4RQ6A 7ICGA 5IIMA 4QZFA 3WFPA 1R89A 5HRHA 5HR9A 8ICPA 8ICSA 5CHGA 1PX5A 3WFOA 4AT8A 9ICEA 2FMQA 4NLNA 4KLUA 4UB2A 4AT9A 1XSNA 1ZQTA 3PNCA 2ZH9A 1ZQIA 4F5PA 9ICWA 3MGIA 3JPRA 3JPNA 5J2IA 1ZQFA 4F5RA 4ATBB 1MIVA 1KNYA 8ICOA 1ZQBA 4RQ7A 9ICCA 4FHPA 5DEDA 4RQ8A 4M0AA 2I9GA 5IIIA 4GXKA 4LZDA 4UD5A 3JYYA 9ICGA 4M9JA 9ICPA 3WFSC 3AQLA 2ZH4A 4I2CA 4QZ9A 4LVSA 3OUYB 2ZH3A 7ICVA 3B0XA 4I2JA 8ICCA 4R64A 2DR5A 4WC1A 1VFGA 4UD4A 5DECA 4ATBA 5J2BA 4JWNA 4QZDA 4KLOA 7ICSA 2BPFA 4KLFA 5BPCA 4NXZA 3L9DA 2P66A 8ICFA 3B0YA 5IIOA 3WFQE 4MFCA 4QZHA 3ISDA 5HRFA 4PGXA 4XQ7A 1HUOA 9ICKA 3V72A 4X4TA 4PGYA 9ICHA 2ZHAA 4X5VA 3OUYA 4M47A 5J2DA 1ZQUA 4IQUA 4QZGA 5HRDA 4X4UA 4UBCA 2BCSA 4O5EA 7ICKA 9ICBA 8ICNA 3RH5A 8ICGA 5J2JA 3AQMA 2DR9A 5J2EA 4P2HA 5J0SA 4KLQA 3C5GA 3UQ0A 4XUSA 7ICHA 3LK9A 4JWMA 9ICOA 5DB9A 4TURA 1WOTA 1R8CA 4YMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVS A;  4FHX A;  1ZJN A;  5J0T A;  5BOL A;  5DB7 A;  3JPT A;  4RQ5 A;  1BPE A;  2BCV A;  8ICQ A;  4P4O A;  4FHV A;  7ICT A;  7ICP A;  3H39 A;  5CR0 A;  5TZV A;  7ICJ A;  3MBY A;  1TFY A;  4X4N A;  3AQN A;  4AT8 B;  4YN4 A;  8ICB A;  2RFF A;  4WC6 A;  2BPC A;  4FO6 A;  1ZQP A;  2M2V A;  4NLK A;  1ZQK A;  2PFO A;  5J29 A;  4X4P A;  7ICI A;  4K4I A;  5J0O A;  4QZB A;  3MDA A;  5DBC A;  2DRB A;  4RWO A;  8ICV A;  3JPQ A;  4M04 A;  4I27 A;  3AQK A;  4R65 A;  5IIK A;  4KLT A;  4WCW A;  4IG8 A;  1ZQW A;  4I2D A;  8ICT A;  2PXI A;  4RT3 A;  4YD1 A;  4YD2 A;  4YMN A;  5CJ7 A;  4KLS A;  4PH5 A;  3K75 D;  2ZH8 A;  1BPZ A;  2M2T A;  8ICI A;  2VAN A;  9ICR A;  4UB3 A;  8ICJ A;  4KLD A;  8ICK A;  4X4R A;  7ICN A;  2BCR A;  3RJE A;  1ZQV A;  9ICA A;  4PGQ A;  9ICL A;  4UBB A;  2O5A A;  4TUP A;  1BPX A;  1NO5 A;  2PFN A;  3RH6 A;  3RJI A;  5HRI A;  1ZQZ A;  3H3A A;  4R66 A;  1JMS A;  3C66 A;  4PHP A;  4M9H A;  4Z6D A;  4X0A A;  9ICI A;  4UAY A;  2O1P A;  4EP7 A;  7ICL A;  5D4B A;  4Z6F A;  4XA5 A;  3UPQ A;  2ZH6 A;  1V4A A;  4EBJ A;  4KLL A;  5DBA A;  8ICZ A;  4GXI A;  1RPL A;  4DOA A;  2ISP A;  3RJF A;  4M9N A;  4MFF A;  5HHH A;  3UPS A;  4MF8 A;  4EBK A;  5IIN A;  4IQW A;  1ZQH A;  3C2K A;  4F5O A;  4KLG A;  4PHE A;  5HRL A;  2GWS A;  5DB8 A;  5CA7 A;  5CWR A;  1ZQX A;  1UEU A;  3AU6 A;  4MFA A;  4QZ8 A;  1Q79 A;  4M9G A;  4IQV A;  3HWT A;  7ICF A;  9ICN A;  4GXJ A;  2ZHB A;  1R8B A;  4LZG A;  3MDC A;  5F2V O;  4WC7 A;  1ZQL A;  3RJG A;  8ICA A;  1MIW A;  1ZQG A;  4QZA A;  1ZQS A;  5DBB A;  5J2H A;  4I28 A;  4NM1 A;  4UAW A;  3MGH A;  4WC2 A;  4RWP A;  3JPO A;  3V7K A;  1NOM A;  7ICU A;  5EOZ A;  1KDH A;  4TUS A;  1MQ3 A;  8ICL A;  5J0X A;  5J0Y A;  4S3N A;  1OU5 A;  1FA0 A;  4X4Q A;  5IIJ A;  4X0B A;  4E8F A;  5J0P A;  3UXP A;  4KLE A;  3LQC B;  5BOM A;  1ZQR A;  4RWQ A;  5J0U A;  2ID1 A;  3UXN A;  3C2L A;  4F5Q A;  8ICW A;  1ZQY A;  2DR7 A;  4NLZ A;  3C18 A;  9ICF A;  3AU2 A;  4DOC A;  3C2M A;  3PML A;  3UXO A;  2BCQ A;  2PBE A;  3RJK A;  4TUQ A;  2NRK A;  2BE3 A;  4R63 A;  4O5K A;  4RPZ A;  3UQ2 A;  3V7L A;  2HHP A;  4X4O A;  4O5C A;  4Z6C A;  4KLJ A;  1ZQE A;  3H37 A;  5CP2 A;  1YLQ A;  1JAJ A;  1BPY A;  5HRK A;  4AT7 B;  3AUO A;  7ICE A;  7ICM A;  4P4M A;  3OVA A;  5HC9 A;  1JQR A;  3TFR A;  4NKU A;  4YMM A;  4FHW A;  5J0Q A;  4I29 A;  4PHA A;  1MQ2 A;  4NY8 A;  3HJ4 A;  4M5D A;  4PPX A;  5J2G A;  1TFW A;  2FMP A;  5CB1 A;  4I2G A;  4UB1 A;  4RWN A;  4AT7 A;  3V7J A;  5DKW A;  4QZE A;  4KLM A;  4WC4 A;  1XSP A;  3HJ1 A;  1UEV A;  3HIY A;  4RQ3 A;  7ICQ A;  4WC3 A;  4K4G A;  1UET A;  5J0W A;  5J2F A;  8ICU A;  1VJ7 A;  3WFR E;  3ISB A;  7ICO A;  9ICX A;  2PFQ A;  1R8A A;  9ICJ A;  3JPP A;  4RQ0 A;  4I2F A;  1ZQA A;  4XRH A;  4LT6 A;  2M2U A;  5HRG A;  5DDM A;  1KEJ A;  5HRB A;  2IHM A;  3PMN A;  1HUZ A;  1TVA A;  4I2E A;  4E7X A;  4WBY A;  4QZC A;  4FH3 A;  4MF2 A;  4M2Y A;  3TFS A;  1BPB A;  2ZH2 A;  4WC0 A;  4RPX A;  4O9M A;  4Z6E A;  8ICH A;  4WC5 A;  4I2A A;  5J2K A;  1BPD A;  4DO9 A;  4FHY A;  4X4V A;  4RT2 A;  5J2A A;  5DDY A;  1JN3 A;  5IIL A;  8ICX A;  2Q66 A;  4XQ8 A;  5D49 A;  3OV7 A;  4NKT A;  3ISC A;  4RQ1 A;  2DR8 A;  1ZQQ A;  9ICV A;  9ICQ A;  2W9M A;  4P4P A;  3NYB A;  4E80 A;  5DB6 A;  4F5N A;  4WBZ A;  4K4H A;  4YCX A;  9ICU A;  3RH4 A;  2DRA A;  1ZQM A;  4NM2 A;  5HHI A;  4M9L A;  4FH5 A;  1MIY A;  2ISO A;  8ICE A;  4DOB A;  4UB4 A;  4KLI A;  3GDX A;  8ICM A;  1ZJM A;  1TV9 A;  1ZQN A;  4RQ2 A;  2PFP A;  2BPG A;  4I2B A;  4X4S A;  2ZH1 A;  3OVB A;  7ICR A;  1Q78 A;  3C5F A;  3HX0 A;  1RZT A;  4I2H A;  3HW8 A;  3OGU A;  1ZQC A;  2M2W A;  1ZQD A;  4I2I A;  3JZ0 A;  4IQT A;  4PHD A;  2BCU A;  9ICS A;  3RJH A;  8ICY A;  3H38 A;  1F5A A;  2FMS A;  4RQ4 A;  1XSL A;  8ICR A;  3RJJ A;  4AT9 B;  4KLH A;  5HRE A;  5J0R A;  5J2C A;  4UAZ A;  5D46 A;  2DVI A;  4QZI A;  1ZQJ A;  2ZH5 A;  4UB5 A;  2ZH7 A;  1ZQO A;  9ICM A;  3JPS A;  9ICT A;  4RPY A;  4RQ6 A;  7ICG A;  5IIM A;  4QZF A;  3WFP A;  1R89 A;  5HRH A;  5HR9 A;  8ICP A;  8ICS A;  5CHG A;  1PX5 A;  3WFO A;  4AT8 A;  9ICE A;  2FMQ A;  4NLN A;  4KLU A;  4UB2 A;  4AT9 A;  1XSN A;  1ZQT A;  3PNC A;  2ZH9 A;  1ZQI A;  4F5P A;  9ICW A;  3MGI A;  3JPR A;  3JPN A;  5J2I A;  1ZQF A;  4F5R A;  4ATB B;  1MIV A;  1KNY A;  8ICO A;  1ZQB A;  4RQ7 A;  9ICC A;  4FHP A;  5DED A;  4RQ8 A;  4M0A A;  2I9G A;  5III A;  4GXK A;  4LZD A;  4UD5 A;  3JYY A;  9ICG A;  4M9J A;  9ICP A;  3WFS C;  3AQL A;  2ZH4 A;  4I2C A;  4QZ9 A;  4LVS A;  3OUY B;  2ZH3 A;  7ICV A;  3B0X A;  4I2J A;  8ICC A;  4R64 A;  2DR5 A;  4WC1 A;  1VFG A;  4UD4 A;  5DEC A;  4ATB A;  5J2B A;  4JWN A;  4QZD A;  4KLO A;  7ICS A;  2BPF A;  4KLF A;  5BPC A;  4NXZ A;  3L9D A;  2P66 A;  8ICF A;  3B0Y A;  5IIO A;  3WFQ E;  4MFC A;  4QZH A;  3ISD A;  5HRF A;  4PGX A;  4XQ7 A;  1HUO A;  9ICK A;  3V72 A;  4X4T A;  4PGY A;  9ICH A;  2ZHA A;  4X5V A;  3OUY A;  4M47 A;  5J2D A;  1ZQU A;  4IQU A;  4QZG A;  5HRD A;  4X4U A;  4UBC A;  2BCS A;  4O5E A;  7ICK A;  9ICB A;  8ICN A;  3RH5 A;  8ICG A;  5J2J A;  3AQM A;  2DR9 A;  5J2E A;  4P2H A;  5J0S A;  4KLQ A;  3C5G A;  3UQ0 A;  4XUS A;  7ICH A;  3LK9 A;  4JWM A;  9ICO A;  5DB9 A;  4TUR A;  1WOT A;  1R8C A;  4YMO A; 
#chains in the Genus database with same CATH topology
 3OVS A;  4FHX A;  1ZJN A;  5J0T A;  5BOL A;  5DB7 A;  3JPT A;  4RQ5 A;  1BPE A;  2BCV A;  4NXV A;  8ICQ A;  4P4O A;  4FHV A;  7ICT A;  7ICP A;  3H39 A;  5CR0 A;  5TZV A;  7ICJ A;  4EV6 A;  3MBY A;  1TFY A;  4X4N A;  3AQN A;  4AT8 B;  4YN4 A;  8ICB A;  2RFF A;  2HN1 A;  4WC6 A;  2BPC A;  4FO6 A;  1ZQP A;  2M2V A;  4NLK A;  1ZQK A;  2PFO A;  5J29 A;  4X4P A;  7ICI A;  4K4I A;  5J0O A;  4QZB A;  3MDA A;  5DBC A;  2DRB A;  4RWO A;  8ICV A;  3JPQ A;  4M04 A;  4I27 A;  3AQK A;  4R65 A;  5IIK A;  3CK6 A;  4KLT A;  4WCW A;  4IG8 A;  1ZQW A;  4I2D A;  8ICT A;  2PXI A;  4RT3 A;  4YD1 A;  4YD2 A;  4YMN A;  5CJ7 A;  4KLS A;  4PH5 A;  3K75 D;  2HN2 A;  2ZH8 A;  1BPZ A;  2M2T A;  3ER9 B;  8ICI A;  2VAN A;  9ICR A;  4UB3 A;  8ICJ A;  4KLD A;  4K9B A;  8ICK A;  4X4R A;  7ICN A;  2BCR A;  3RJE A;  1ZQV A;  9ICA A;  4PGQ A;  9ICL A;  4UBB A;  2O5A A;  4TUP A;  1BPX A;  1NO5 A;  2PFN A;  3RH6 A;  3RJI A;  5HRI A;  1ZQZ A;  3H3A A;  4R66 A;  1JMS A;  3C66 A;  4PHP A;  4M9H A;  4Z6D A;  4X0A A;  4K99 A;  9ICI A;  4O6A A;  4UAY A;  2O1P A;  4EP7 A;  7ICL A;  5D4B A;  4Z6F A;  4XJE A;  4XA5 A;  3UPQ A;  5B3Q A;  2ZH6 A;  1V4A A;  4EBJ A;  4KLL A;  5DBA A;  8ICZ A;  4GXI A;  1RPL A;  4DOA A;  2GA9 D;  2ISP A;  3RJF A;  4M9N A;  4MFF A;  5HHH A;  3UPS A;  4MF8 A;  4EBK A;  5IIN A;  4IQW A;  1ZQH A;  3C2K A;  4F5O A;  5CFU A;  4KLG A;  4PHE A;  5HRL A;  2GWS A;  5DB8 A;  5CA7 A;  5CWR A;  1ZQX A;  4HX0 A;  1UEU A;  3AU6 A;  4MFA A;  4QZ8 A;  1Q79 A;  4OAH A;  4M9G A;  4IQV A;  3HWT A;  7ICF A;  9ICN A;  4GXJ A;  2ZHB A;  1R8B A;  5D61 A;  4LZG A;  3MDC A;  5F2V O;  4WC7 A;  1ZQL A;  3RJG A;  8ICA A;  1MIW A;  1ZQG A;  4QZA A;  1ZQS A;  2FCL A;  5DBB A;  5J2H A;  4I28 A;  4NM1 A;  4UAW A;  3MGH A;  4WC2 A;  4RWP A;  3JPO A;  3V7K A;  1NOM A;  7ICU A;  5EOZ A;  1KDH A;  5CHE A;  4K98 A;  4TUS A;  1MQ3 A;  8ICL A;  3OWG A;  5J0X A;  2IUB A;  5J0Y A;  4S3N A;  1OU5 A;  1FA0 A;  4X4Q A;  5IIJ A;  4X0B A;  4E8F A;  5J0P A;  3UXP A;  4KLE A;  3LQC B;  5BOM A;  1ZQR A;  4RWQ A;  5J0U A;  2ID1 A;  3UXN A;  4OAI Z;  3C2L A;  4F5Q A;  8ICW A;  1ZQY A;  2DR7 A;  4O67 A;  3MCR A;  4NLZ A;  3C18 A;  9ICF A;  3AU2 A;  4LEW A;  4K97 A;  4DOC A;  3C2M A;  4MKP A;  3PML A;  3UXO A;  2BCQ A;  2PBE A;  3RJK A;  4TUQ A;  2NRK A;  4JLZ A;  3NVO A;  4JWN A;  2BE3 A;  4R63 A;  3EF2 A;  4WQL A;  4O5K A;  4RPZ A;  3UQ2 A;  3V7L A;  2HHP A;  4X4O A;  4O5C A;  4Z6C A;  4KLJ A;  1ZQE A;  3H37 A;  5CP2 A;  1YLQ A;  1JAJ A;  1BPY A;  5HRK A;  4WQK A;  4AT7 B;  3AUO A;  7ICE A;  7ICM A;  4P4M A;  3OVA A;  5HC9 A;  2B51 A;  1JQR A;  3TFR A;  4NKU A;  4YMM A;  4K9A A;  4FHW A;  5J0Q A;  4I29 A;  4PHA A;  4LEZ A;  1MQ2 A;  4N7R A;  4JLX A;  4NY8 A;  3HJ4 A;  4M5D A;  2EWR A;  4PPX A;  5J2G A;  1TFW A;  2FMP A;  5CB1 A;  4I2G A;  4UB1 A;  4EED A;  4RWN A;  4AT7 A;  3V7J A;  5DKW A;  4QZE A;  4KLM A;  4WC4 A;  1XSP A;  4WH5 A;  3HJ1 A;  1UEV A;  3HIY A;  4RQ3 A;  7ICQ A;  4WC3 A;  4K4G A;  1UET A;  5J0W A;  5J2F A;  8ICU A;  1VJ7 A;  3WFR E;  3ISB A;  4EGW A;  7ICO A;  9ICX A;  2PFQ A;  1R8A A;  9ICJ A;  3JPP A;  4KB6 A;  4RQ0 A;  4I2F A;  1ZQA A;  4XRH A;  4LT6 A;  2M2U A;  5HRG A;  5DDM A;  1KEJ A;  5HRB A;  2IHM A;  3PMN A;  1HUZ A;  1TVA A;  4I2E A;  4E7X A;  2BBH A;  4WBY A;  4QZC A;  4FH3 A;  4MF2 A;  5D62 A;  4M2Y A;  3TFS A;  1BPB A;  4FO1 A;  2ZH2 A;  4WC0 A;  4RPX A;  4O9M A;  4Z6E A;  5B3P A;  8ICH A;  4WC5 A;  4I2A A;  4LEY A;  5J2K A;  3ERC C;  1BPD A;  4DO9 A;  4NXX A;  4FHY A;  4X4V A;  4RT2 A;  5J2A A;  5DDY A;  1JN3 A;  5IIL A;  8ICX A;  5D63 A;  2Q66 A;  4XQ8 A;  5D49 A;  3OV7 A;  5CFS A;  4NXU A;  2IHO A;  4NKT A;  3ISC A;  4RQ1 A;  2DR8 A;  1ZQQ A;  3NKU A;  9ICV A;  9ICQ A;  2W9M A;  4P4P A;  3NYB A;  4E80 A;  5DB6 A;  4O69 A;  4F5N A;  4WBZ A;  4K4H A;  4YCX A;  3NWI A;  9ICU A;  4O68 A;  3RH4 A;  2DRA A;  1ZQM A;  4NM2 A;  5HHI A;  4M9L A;  4FH5 A;  1MIY A;  2ISO A;  8ICE A;  4DOB A;  4UB4 A;  4KLI A;  3GDX A;  8ICM A;  1ZJM A;  1TV9 A;  1ZQN A;  4RQ2 A;  2PFP A;  2BPG A;  4K96 A;  4I2B A;  4X4S A;  2ZH1 A;  3OVB A;  7ICR A;  1Q78 A;  3C5F A;  4LEV A;  3HX0 A;  1RZT A;  4I2H A;  3HW8 A;  3OGU A;  1ZQC A;  2M2W A;  1ZQD A;  4I2I A;  3JZ0 A;  4IQT A;  4PHD A;  4WOY A;  2BCU A;  3RJH A;  3K7D A;  8ICY A;  9ICS A;  3H38 A;  1F5A A;  2FMS A;  4RQ4 A;  1XSL A;  8ICR A;  3RJJ A;  4AT9 B;  4KLH A;  5HRE A;  5J0R A;  5J2C A;  4UAZ A;  5D46 A;  2DVI A;  4QZI A;  4OAG A;  2B56 A;  1ZQJ A;  2ZH5 A;  4UB5 A;  2ZH7 A;  1ZQO A;  9ICM A;  3JPS A;  9ICT A;  4RPY A;  4RQ6 A;  7ICG A;  4I0U A;  5IIM A;  4QZF A;  3JCF A;  3WFP A;  1R89 A;  5HRH A;  5HR9 A;  8ICP A;  8ICS A;  5CHG A;  1PX5 A;  3WFO A;  4AT8 A;  9ICE A;  2FMQ A;  4NLN A;  4KLU A;  4UB2 A;  4AT9 A;  1XSN A;  1ZQT A;  3PNC A;  2ZH9 A;  1ZQI A;  4F5P A;  9ICW A;  3MGI A;  3JPR A;  3JPN A;  5J2I A;  1ZQF A;  4TUR A;  4F5R A;  4ATB B;  1MIV A;  1KNY A;  8ICO A;  1ZQB A;  4RQ7 A;  9ICC A;  4FHP A;  5DED A;  4RQ8 A;  4M0A A;  2I9G A;  5III A;  4GXK A;  4LZD A;  4UD5 A;  3JYY A;  9ICG A;  4NXW A;  4M9J A;  4NXT A;  9ICP A;  3WFS C;  3AQL A;  2ZH4 A;  4I2C A;  4QZ9 A;  4LVS A;  3OUY B;  2ZH3 A;  7ICV A;  3B0X A;  4I2J A;  2BBJ A;  8ICC A;  4R64 A;  4KM5 A;  4WC1 A;  1VFG A;  4UD4 A;  5DEC A;  4ATB A;  5J2B A;  2DR5 A;  4QZD A;  4K8V A;  4KLO A;  7ICS A;  2BPF A;  4KLF A;  3PHZ A;  5BPC A;  1GPJ A;  4NXZ A;  3L9D A;  2P66 A;  8ICF A;  3B0Y A;  5IIO A;  3WFQ E;  4MFC A;  4QZH A;  3ISD A;  5HRF A;  4PGX A;  4XQ7 A;  5JTG A;  1HUO A;  9ICK A;  3V72 A;  4X4T A;  4PGY A;  9ICH A;  2ZHA A;  4X5V A;  3OUY A;  4M47 A;  5J2D A;  3ER8 C;  1ZQU A;  4IQU A;  4QZG A;  5HRD A;  4X4U A;  4UBC A;  2BCS A;  4O5E A;  7ICK A;  9ICB A;  8ICN A;  3RH5 A;  2GAF D;  8ICG A;  5CFT A;  5J2J A;  3AQM A;  2B4V A;  2DR9 A;  5J2E A;  4P2H A;  5J0S A;  4KLQ A;  4EEB A;  3C5G A;  3UQ0 A;  4XUS A;  7ICH A;  3LK9 A;  4JWM A;  9ICO A;  5DB9 A;  4OAF A;  1WOT A;  1R8C A;  4YMO A; 
#chains in the Genus database with same CATH homology
 3OVS A;  4FHX A;  1ZJN A;  5J0T A;  5BOL A;  5DB7 A;  3JPT A;  4RQ5 A;  1BPE A;  2BCV A;  8ICQ A;  4P4O A;  4FHV A;  7ICT A;  7ICP A;  3H39 A;  5CR0 A;  5TZV A;  7ICJ A;  3MBY A;  1TFY A;  4X4N A;  3AQN A;  4AT8 B;  4YN4 A;  8ICB A;  2RFF A;  4WC6 A;  2BPC A;  4FO6 A;  1ZQP A;  2M2V A;  4NLK A;  1ZQK A;  2PFO A;  5J29 A;  4X4P A;  7ICI A;  4K4I A;  5J0O A;  4QZB A;  3MDA A;  5DBC A;  2DRB A;  4RWO A;  8ICV A;  3JPQ A;  4M04 A;  4I27 A;  3AQK A;  4R65 A;  5IIK A;  4KLT A;  4WCW A;  4IG8 A;  1ZQW A;  4I2D A;  8ICT A;  2PXI A;  4RT3 A;  4YD1 A;  4YD2 A;  4YMN A;  5CJ7 A;  4KLS A;  4PH5 A;  3K75 D;  2ZH8 A;  1BPZ A;  2M2T A;  8ICI A;  2VAN A;  9ICR A;  4UB3 A;  8ICJ A;  4KLD A;  8ICK A;  4X4R A;  7ICN A;  2BCR A;  3RJE A;  1ZQV A;  9ICA A;  4PGQ A;  9ICL A;  4UBB A;  2O5A A;  4TUP A;  1BPX A;  1NO5 A;  2PFN A;  3RH6 A;  3RJI A;  5HRI A;  1ZQZ A;  3H3A A;  4R66 A;  1JMS A;  3C66 A;  4PHP A;  4M9H A;  4Z6D A;  4X0A A;  9ICI A;  4UAY A;  2O1P A;  4EP7 A;  7ICL A;  5D4B A;  4Z6F A;  4XA5 A;  3UPQ A;  2ZH6 A;  1V4A A;  4EBJ A;  4KLL A;  5DBA A;  8ICZ A;  4GXI A;  1RPL A;  4DOA A;  2ISP A;  3RJF A;  4M9N A;  4MFF A;  5HHH A;  3UPS A;  4MF8 A;  4EBK A;  5IIN A;  4IQW A;  1ZQH A;  3C2K A;  4F5O A;  4KLG A;  4PHE A;  5HRL A;  2GWS A;  5DB8 A;  5CA7 A;  5CWR A;  1ZQX A;  1UEU A;  3AU6 A;  4MFA A;  4QZ8 A;  1Q79 A;  4M9G A;  4IQV A;  3HWT A;  7ICF A;  9ICN A;  4GXJ A;  2ZHB A;  1R8B A;  4LZG A;  3MDC A;  5F2V O;  4WC7 A;  1ZQL A;  3RJG A;  8ICA A;  1MIW A;  1ZQG A;  4QZA A;  1ZQS A;  5DBB A;  5J2H A;  4I28 A;  4NM1 A;  4UAW A;  3MGH A;  4WC2 A;  4RWP A;  3JPO A;  3V7K A;  1NOM A;  7ICU A;  5EOZ A;  1KDH A;  4TUS A;  1MQ3 A;  8ICL A;  5J0X A;  5J0Y A;  4S3N A;  1OU5 A;  1FA0 A;  4X4Q A;  5IIJ A;  4X0B A;  4E8F A;  5J0P A;  3UXP A;  4KLE A;  3LQC B;  5BOM A;  1ZQR A;  4RWQ A;  5J0U A;  2ID1 A;  3UXN A;  3C2L A;  4F5Q A;  8ICW A;  1ZQY A;  2DR7 A;  4NLZ A;  3C18 A;  9ICF A;  3AU2 A;  4DOC A;  3C2M A;  3PML A;  3UXO A;  2BCQ A;  2PBE A;  3RJK A;  4TUQ A;  2NRK A;  2BE3 A;  4R63 A;  4O5K A;  4RPZ A;  3UQ2 A;  3V7L A;  2HHP A;  4X4O A;  4O5C A;  4Z6C A;  4KLJ A;  1ZQE A;  3H37 A;  5CP2 A;  1YLQ A;  1JAJ A;  1BPY A;  5HRK A;  4AT7 B;  3AUO A;  7ICE A;  7ICM A;  4P4M A;  3OVA A;  5HC9 A;  1JQR A;  3TFR A;  4NKU A;  4YMM A;  4FHW A;  5J0Q A;  4I29 A;  4PHA A;  1MQ2 A;  4NY8 A;  3HJ4 A;  4M5D A;  4PPX A;  5J2G A;  1TFW A;  2FMP A;  5CB1 A;  4I2G A;  4UB1 A;  4RWN A;  4AT7 A;  3V7J A;  5DKW A;  4QZE A;  4KLM A;  4WC4 A;  1XSP A;  3HJ1 A;  1UEV A;  3HIY A;  4RQ3 A;  7ICQ A;  4WC3 A;  4K4G A;  1UET A;  5J0W A;  5J2F A;  8ICU A;  1VJ7 A;  3WFR E;  3ISB A;  7ICO A;  9ICX A;  2PFQ A;  1R8A A;  9ICJ A;  3JPP A;  4RQ0 A;  4I2F A;  1ZQA A;  4XRH A;  4LT6 A;  2M2U A;  5HRG A;  5DDM A;  1KEJ A;  5HRB A;  2IHM A;  3PMN A;  1HUZ A;  1TVA A;  4I2E A;  4E7X A;  4WBY A;  4QZC A;  4FH3 A;  4MF2 A;  4M2Y A;  3TFS A;  1BPB A;  2ZH2 A;  4WC0 A;  4RPX A;  4O9M A;  4Z6E A;  8ICH A;  4WC5 A;  4I2A A;  5J2K A;  1BPD A;  4DO9 A;  4FHY A;  4X4V A;  4RT2 A;  5J2A A;  5DDY A;  1JN3 A;  5IIL A;  8ICX A;  2Q66 A;  4XQ8 A;  5D49 A;  3OV7 A;  4NKT A;  3ISC A;  4RQ1 A;  2DR8 A;  1ZQQ A;  9ICV A;  9ICQ A;  2W9M A;  4P4P A;  3NYB A;  4E80 A;  5DB6 A;  4F5N A;  4WBZ A;  4K4H A;  4YCX A;  9ICU A;  3RH4 A;  2DRA A;  1ZQM A;  4NM2 A;  5HHI A;  4M9L A;  4FH5 A;  1MIY A;  2ISO A;  8ICE A;  4DOB A;  4UB4 A;  4KLI A;  3GDX A;  8ICM A;  1ZJM A;  1TV9 A;  1ZQN A;  4RQ2 A;  2PFP A;  2BPG A;  4I2B A;  4X4S A;  2ZH1 A;  3OVB A;  7ICR A;  1Q78 A;  3C5F A;  3HX0 A;  1RZT A;  4I2H A;  3HW8 A;  3OGU A;  1ZQC A;  2M2W A;  1ZQD A;  4I2I A;  3JZ0 A;  4IQT A;  4PHD A;  2BCU A;  9ICS A;  3RJH A;  8ICY A;  3H38 A;  1F5A A;  2FMS A;  4RQ4 A;  1XSL A;  8ICR A;  3RJJ A;  4AT9 B;  4KLH A;  5HRE A;  5J0R A;  5J2C A;  4UAZ A;  5D46 A;  2DVI A;  4QZI A;  1ZQJ A;  2ZH5 A;  4UB5 A;  2ZH7 A;  1ZQO A;  9ICM A;  3JPS A;  9ICT A;  4RPY A;  4RQ6 A;  7ICG A;  5IIM A;  4QZF A;  3WFP A;  1R89 A;  5HRH A;  5HR9 A;  8ICP A;  8ICS A;  5CHG A;  1PX5 A;  3WFO A;  4AT8 A;  9ICE A;  2FMQ A;  4NLN A;  4KLU A;  4UB2 A;  4AT9 A;  1XSN A;  1ZQT A;  3PNC A;  2ZH9 A;  1ZQI A;  4F5P A;  9ICW A;  3MGI A;  3JPR A;  3JPN A;  5J2I A;  1ZQF A;  4F5R A;  4ATB B;  1MIV A;  1KNY A;  8ICO A;  1ZQB A;  4RQ7 A;  9ICC A;  4FHP A;  5DED A;  4RQ8 A;  4M0A A;  2I9G A;  5III A;  4GXK A;  4LZD A;  4UD5 A;  3JYY A;  9ICG A;  4M9J A;  9ICP A;  3WFS C;  3AQL A;  2ZH4 A;  4I2C A;  4QZ9 A;  4LVS A;  3OUY B;  2ZH3 A;  7ICV A;  3B0X A;  4I2J A;  8ICC A;  4R64 A;  2DR5 A;  4WC1 A;  1VFG A;  4UD4 A;  5DEC A;  4ATB A;  5J2B A;  4JWN A;  4QZD A;  4KLO A;  7ICS A;  2BPF A;  4KLF A;  5BPC A;  4NXZ A;  3L9D A;  2P66 A;  8ICF A;  3B0Y A;  5IIO A;  3WFQ E;  4MFC A;  4QZH A;  3ISD A;  5HRF A;  4PGX A;  4XQ7 A;  1HUO A;  9ICK A;  3V72 A;  4X4T A;  4PGY A;  9ICH A;  2ZHA A;  4X5V A;  3OUY A;  4M47 A;  5J2D A;  1ZQU A;  4IQU A;  4QZG A;  5HRD A;  4X4U A;  4UBC A;  2BCS A;  4O5E A;  7ICK A;  9ICB A;  8ICN A;  3RH5 A;  8ICG A;  5J2J A;  3AQM A;  2DR9 A;  5J2E A;  4P2H A;  5J0S A;  4KLQ A;  3C5G A;  3UQ0 A;  4XUS A;  7ICH A;  3LK9 A;  4JWM A;  9ICO A;  5DB9 A;  4TUR A;  1WOT A;  1R8C A;  4YMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...