4WC2A

Crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 122
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc2A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc2A01
4E8FA 4K4GA 4F5QA 4QZ8A 2M2VA 1MIYA 8ICXA 5DEDA 7ICQA 2NRKA 1UETA 4ATBA 2ISOA 4R63A 3MDAA 4UB1A 8ICKA 2BCRA 2RFFA 4KLUA 9ICWA 5CR0A 4RPYA 4E80A 5HC9A 1YLQA 4M9LA 3C5GA 5DECA 5J0SA 3GDXA 5D4BA 1BPZA 1R8AA 3C66A 4XQ7A 4UAWA 4X4UA 1KEJA 5J2HA 3OUYA 4RQ7A 4RQ1A 5CP2A 4I2GA 3JPRA 4X4VA 8ICLA 7ICTA 5J0PA 2HHPA 1ZQNA 4NLZA 4QZFA 4QZEA 4UBCA 2M2TA 4PGXA 8ICYA 2ZH6A 4TUSA 7ICLA 2ZH5A 9ICMA 4WCWA 4RWOA 4KLMA 1ZQHA 4YCXA 4I27A 9ICUA 1FA0A 1V4AA 3MDCA 9ICGA 5F2VO 5HRFA 1ZQIA 2Q66A 4K4HA 4I28A 1ZQTA 1ZQWA 4XA5A 1ZJNA 4X4TA 3RJFA 4Z6DA 4X4QA 2PFNA 4R64A 2ID1A 9ICVA 3MGIA 4UD5A 3C2MA 1XSNA 1ZQRA 4PHEA 4NLKA 1ZQQA 1JMSA 3NYBA 3C18A 1BPXA 3LQCB 3ISBA 2DR9A 5IIOA 3TFSA 3AQLA 4UAYA 4RWNA 4XQ8A 3MGHA 4K4IA 4WBZA 1ZQGA 3RH5A 5IIJA 4TURA 1F5AA 2FMPA 5J2EA 8ICGA 4XRHA 4I2EA 5J0QA 8ICSA 2BCQA 4P4MA 4YD1A 9ICHA 2BCVA 1JQRA 2ZH7A 4M04A 3AU2A 9ICJA 1R89A 7ICFA 3PMNA 5HRBA 4LT6A 4PGYA 1ZQMA 4DOCA 4FHWA 3RJGA 4ATBB 4KLSA 4MFAA 4NM1A 4IQVA 5DB7A 8ICRA 2FMSA 2ZH3A 4AT8A 4M47A 4WC5A 3V7LA 2ZH9A 4X4NA 1ZQKA 4JWMA 5DDMA 3UXNA 1TV9A 1NOMA 4RWQA 1ZQJA 3V7JA 3OUYB 4FHPA 8ICPA 4RPXA 7ICSA 4EP7A 4P2HA 4XUSA 4QZHA 2DR8A 4YD2A 3WFRE 5DB9A 1ZQPA 7ICHA 1ZQVA 4IQUA 9ICPA 4KLHA 8ICHA 1VJ7A 4YMMA 3JYYA 4RWPA 1Q79A 4DO9A 3RH6A 4Z6FA 4I2DA 2PBEA 5EOZA 1UEVA 4DOAA 3UQ0A 5CA7A 2BPFA 4O5EA 4M0AA 1UEUA 4LZGA 3WFQE 4O5KA 3RJIA 2ISPA 4QZGA 5BOLA 5J2JA 4M5DA 2ZH2A 1ZQDA 1BPEA 3HX0A 1VFGA 3JPTA 4WC4A 4RQ3A 3RH4A 4X4SA 4DOBA 4I2CA 1HUZA 5IIMA 4E7XA 4PHPA 8ICAA 3AQKA 4MF2A 4KLOA 3V72A 4WC3A 4M9GA 9ICBA 3OV7A 5HRKA 5HRGA 4M9NA 3UPSA 3C2LA 4UB4A 4AT7B 3PMLA 5DBCA 4LVSA 1ZQZA 4FH5A 4KLLA 1R8BA 4KLFA 4KLTA 9ICFA 5J0WA 5IIKA 4UB5A 4NKUA 9ICTA 4KLEA 9ICCA 9ICIA 7ICIA 1ZQCA 4UAZA 4AT7A 2DR7A 9ICNA 4F5OA 3HWTA 4P4OA 3WFOA 4F5PA 5DDYA 1R8CA 4RQ8A 2BCSA 9ICSA 7ICVA 4P4PA 3B0XA 9ICXA 1NO5A 5DB8A 3V7KA 4AT9B 1ZQSA 4FHVA 4F5NA 3UXPA 3AQNA 3JPOA 7ICNA 5HRLA 2DVIA 8ICVA 3OGUA 1KNYA 5DBAA 4O5CA 5J0TA 4X4RA 5J2IA 5J0UA 2ZHAA 8ICZA 4QZDA 4WBYA 7ICPA 5D46A 4NXZA 3HJ1A 4AT9A 1RPLA 7ICUA 5J2CA 1KDHA 9ICAA 7ICMA 2PFPA 5IIIA 2ZH8A 4R65A 2GWSA 9ICLA 5IINA 3C5FA 4F5RA 2PFOA 5J2AA 4AT8B 1XSPA 7ICEA 4WC1A 1BPBA 3JPSA 3TFRA 4I2HA 1HUOA 4KLDA 5J0RA 5J2FA 4YN4A 5J0YA 8ICUA 4RQ4A 4UD4A 8ICJA 3JPQA 2ZH4A 4NKTA 1OU5A 5IILA 4KLGA 4EBJA 4M2YA 3AUOA 3B0YA 1MQ2A 4MFCA 1JN3A 2BE3A 4RPZA 4YMNA 2DR5A 2IHMA 3H37A 3UXOA 2DRBA 4RQ2A 1MQ3A 1JAJA 4FO6A 2W9MA 4QZBA 4S3NA 4FHXA 3RJKA 2VANA 3JZ0A 4FH3A 1ZQBA 3ISCA 5BOMA 4X0BA 4TUQA 8ICBA 3RJEA 4UB3A 5HR9A 3K75D 5J0XA 8ICQA 3ISDA 5J2KA 5CWRA 4QZAA 4R66A 4MFFA 3L9DA 9ICRA 3WFPA 3HW8A 4M9JA 4RQ0A 9ICKA 9ICOA 4RT3A 2ZH1A 1ZQLA 5J2GA 5HRDA 8ICEA 4PHDA 3UPQA 5HHIA 2BPGA 3H3AA 1MIVA 4UB2A 5DKWA 1ZQXA 4UBBA 8ICFA 4I2BA 4PGQA 5DB6A 4KLJA 2DRAA 4I2JA 2M2WA 4IQTA 4GXJA 8ICCA 3UQ2A 1XSLA 3H38A 8ICIA 2O1PA 4WC7A 5J2DA 3RJHA 4NLNA 1TFYA 4X4OA 1MIWA 3OVBA 1ZQOA 4M9HA 4WC2A 4Z6CA 3MBYA 4RQ5A 4EBKA 4QZ9A 4RQ6A 2FMQA 3JPPA 8ICNA 4IG8A 7ICRA 5CB1A 1BPDA 4YMOA 3C2KA 4WC6A 4KLQA 5HREA 4I2FA 5D49A 4QZIA 3PNCA 8ICTA 1WOTA 4Z6EA 5J2BA 4KLIA 2ZHBA 4I2IA 3RJJA 9ICEA 8ICOA 4FHYA 4JWNA 3LK9A 3HJ4A 3OVSA 8ICMA 4MF8A 4LZDA 4WC0A 1PX5A 5CJ7A 3AQMA 1ZJMA 1RZTA 7ICGA 5HRHA 3OVAA 4PPXA 4NM2A 1BPYA 2M2UA 2O5AA 5HRIA 5J29A 5BPCA 4IQWA 4I2AA 5CHGA 9ICQA 5HHHA 3AU6A 4GXIA 4TUPA 4NY8A 3WFSC 5TZVA 3HIYA 2BPCA 4GXKA 8ICWA 4X0AA 1ZQEA 2BCUA 4I29A 2I9GA 4QZCA 4PHAA 7ICJA 1ZQFA 1ZQYA 4X5VA 3H39A 2PXIA 2PFQA 1TVAA 7ICOA 5J0OA 5DBBA 3JPNA 1ZQAA 4RT2A 2P66A 4X4PA 7ICKA 1Q78A 4PH5A 1ZQUA 1TFWA 4O9MA
chains in the Genus database with same CATH superfamily
4E8FA 4O67A 4F5QA 4K4GA 3NKUA 4QZ8A 2M2VA 1MIYA 4EEDA 4O69A 8ICXA 4WOYA 5DEDA 7ICQA 2HN1A 2NRKA 1UETA 4ATBA 2ISOA 4R63A 3MDAA 4UB1A 8ICKA 3EF2A 2BCRA 2RFFA 4KLUA 9ICWA 5CR0A 4RPYA 4E80A 5HC9A 1YLQA 4M9LA 3C5GA 5DECA 3ER9B 5J0SA 3GDXA 5D4BA 1BPZA 1R8AA 3C66A 4XQ7A 4UAWA 4X4UA 1KEJA 5J2HA 3OUYA 4RQ7A 5JTGA 4K8VA 4RQ1A 5CP2A 4I2GA 3JPRA 4X4VA 8ICLA 7ICTA 5J0PA 2HHPA 1ZQNA 4NXWA 4NLZA 4QZFA 4QZEA 2IUBA 4UBCA 4LEZA 3NWIA 2M2TA 4PGXA 8ICYA 2ZH6A 4TUSA 7ICLA 2ZH5A 9ICMA 4WCWA 4RWOA 4KLMA 1ZQHA 4YCXA 4I27A 9ICUA 1FA0A 1V4AA 3MDCA 9ICGA 5F2VO 5HRFA 4EGWA 1ZQIA 2Q66A 4K4HA 4I28A 5D63A 1ZQTA 4K98A 1ZQWA 4K9BA 4XA5A 1ZJNA 4K9AA 4X4TA 3RJFA 4Z6DA 4X4QA 2PFNA 4R64A 2ID1A 9ICVA 3MGIA 4UD5A 3C2MA 1XSNA 1ZQRA 4PHEA 4NLKA 1ZQQA 1JMSA 3NYBA 3C18A 1BPXA 3LQCB 3ISBA 2DR9A 4MKPA 5IIOA 3TFSA 3AQLA 4UAYA 4RWNA 2GAFD 4XQ8A 3MGHA 4K4IA 4WBZA 1ZQGA 3RH5A 5IIJA 4KB6A 4TURA 1F5AA 2FMPA 5J2EA 4K96A 2B4VA 8ICGA 4XRHA 4I2EA 5J0QA 8ICSA 2BCQA 4P4MA 4YD1A 9ICHA 2BCVA 3NVOA 1JQRA 2ZH7A 4M04A 3AU2A 9ICJA 1R89A 7ICFA 3PMNA 5B3QA 5HRBA 4LT6A 4PGYA 1ZQMA 4DOCA 4FHWA 3RJGA 4ATBB 4KLSA 4MFAA 4NM1A 4IQVA 5DB7A 4FO1A 8ICRA 2FMSA 2ZH3A 4AT8A 4M47A 4WC5A 3V7LA 2ZH9A 4X4NA 1ZQKA 4JWMA 5DDMA 3UXNA 1TV9A 1NOMA 4RWQA 1ZQJA 3V7JA 3OUYB 4FHPA 8ICPA 4RPXA 7ICSA 4EP7A 4P2HA 4XUSA 4QZHA 2DR8A 4YD2A 3WFRE 5DB9A 1ZQPA 7ICHA 1ZQVA 4IQUA 9ICPA 4KLHA 8ICHA 1VJ7A 4K99A 4YMMA 3JYYA 4RWPA 1Q79A 4DO9A 4KM5A 2B51A 3RH6A 4Z6FA 4I2DA 2PBEA 5EOZA 1UEVA 4O9MA 4LEWA 4DOAA 4XJEA 3OWGA 5CHEA 3UQ0A 5CA7A 4OAHA 2BPFA 4O5EA 4M0AA 1UEUA 4LZGA 3WFQE 4O5KA 4HX0A 3RJIA 2ISPA 1GPJA 4QZGA 5BOLA 5J2JA 4M5DA 2ZH2A 1ZQDA 1BPEA 3HX0A 1VFGA 3JPTA 4WC4A 4RQ3A 3RH4A 4X4SA 4DOBA 4I2CA 1HUZA 2BBJA 5IIMA 4E7XA 4PHPA 8ICAA 3AQKA 4MF2A 4KLOA 3V72A 4WC3A 4M9GA 4NXXA 9ICBA 3OV7A 5HRKA 5HRGA 4M9NA 3UPSA 3C2LA 4UB4A 4AT7B 3PMLA 5DBCA 4LVSA 1ZQZA 4FH5A 4KLLA 1R8BA 4KLFA 4KLTA 9ICFA 5J0WA 5IIKA 4UB5A 4NKUA 9ICTA 4KLEA 9ICCA 9ICIA 7ICIA 5CFUA 1ZQCA 4UAZA 4AT7A 2DR7A 3ERCC 9ICNA 2IHOA 4F5OA 3HWTA 4P4OA 3WFOA 4F5PA 5DDYA 3MCRA 4O6AA 1R8CA 4RQ8A 2BCSA 9ICSA 7ICVA 4P4PA 3B0XA 9ICXA 1NO5A 5DB8A 3V7KA 4AT9B 1ZQSA 4FHVA 4F5NA 3UXPA 3AQNA 3JPOA 7ICNA 4WQLA 5HRLA 2DVIA 8ICVA 3OGUA 1KNYA 5DBAA 4OAFA 4O5CA 5J0TA 4X4RA 3JCFA 5J2IA 5J0UA 2ZHAA 8ICZA 4QZDA 4WBYA 7ICPA 5D46A 4NXZA 3HJ1A 4WH5A 4AT9A 1RPLA 7ICUA 5J2CA 1KDHA 9ICAA 7ICMA 2PFPA 5IIIA 2ZH8A 4R65A 2GWSA 9ICLA 5IINA 3C5FA 4F5RA 2PFOA 5B3PA 5J2AA 4AT8B 4NXVA 1XSPA 2FCLA 4WC1A 1BPBA 7ICEA 3JPSA 3TFRA 4I2HA 1HUOA 4KLDA 5J0RA 5J2FA 4YN4A 5D61A 5J0YA 8ICUA 4RQ4A 4UD4A 8ICJA 3JPQA 2ZH4A 4NKTA 1OU5A 5IILA 4KLGA 4EBJA 4M2YA 3ER8C 3AUOA 3B0YA 1MQ2A 4MFCA 4LEVA 1JN3A 2BE3A 4RPZA 4YMNA 2DR5A 4EV6A 2IHMA 3H37A 3UXOA 3CK6A 2DRBA 4RQ2A 1MQ3A 1JAJA 4FO6A 2W9MA 4QZBA 4S3NA 4FHXA 3RJKA 2VANA 3JZ0A 4FH3A 1ZQBA 3ISCA 5BOMA 4X0BA 4N7RA 4TUQA 8ICBA 3RJEA 4I0UA 4UB3A 5HR9A 3K75D 5J0XA 8ICQA 3ISDA 5J2KA 5CWRA 4QZAA 4R66A 2BBHA 4MFFA 3L9DA 9ICRA 3WFPA 3HW8A 4M9JA 4RQ0A 4LEYA 9ICKA 9ICOA 5D62A 4RT3A 2ZH1A 1ZQLA 5J2GA 5HRDA 8ICEA 4PHDA 3UPQA 5HHIA 2BPGA 3H3AA 1MIVA 4UB2A 5DKWA 1ZQXA 4UBBA 8ICFA 4I2BA 5CFTA 4EEBA 4PGQA 5DB6A 4KLJA 2DRAA 4NXUA 4I2JA 2HN2A 2M2WA 4IQTA 4GXJA 8ICCA 3UQ2A 1XSLA 3H38A 8ICIA 2O1PA 4WC7A 5J2DA 3RJHA 4NLNA 1TFYA 4X4OA 1MIWA 3OVBA 4OAIZ 4JLZA 1ZQOA 4M9HA 4O68A 4WC2A 4Z6CA 3MBYA 4RQ5A 4EBKA 2GA9D 4QZ9A 4RQ6A 2FMQA 3JPPA 8ICNA 4IG8A 7ICRA 5CB1A 1BPDA 4YMOA 3C2KA 4WC6A 4KLQA 5HREA 4I2FA 5D49A 3PHZA 4QZIA 3PNCA 8ICTA 1WOTA 4Z6EA 5J2BA 4KLIA 2ZHBA 4I2IA 3RJJA 9ICEA 8ICOA 4FHYA 4JWNA 3LK9A 3HJ4A 3OVSA 8ICMA 4MF8A 4LZDA 4WC0A 1PX5A 5CJ7A 3AQMA 1ZJMA 1RZTA 7ICGA 5HRHA 3OVAA 4PPXA 4NM2A 1BPYA 4K97A 2M2UA 2O5AA 5HRIA 5J29A 5BPCA 4IQWA 4I2AA 5CHGA 9ICQA 5CFSA 5HHHA 3AU6A 4GXIA 4TUPA 4NY8A 3WFSC 4NXTA 5TZVA 3HIYA 2BPCA 4GXKA 8ICWA 4X0AA 1ZQEA 2BCUA 4I29A 4WQKA 2I9GA 4QZCA 4PHAA 4JLXA 7ICJA 2EWRA 1ZQFA 1ZQYA 4X5VA 3H39A 2PXIA 2PFQA 1TVAA 7ICOA 3K7DA 5J0OA 5DBBA 3JPNA 1ZQAA 4RT2A 2P66A 4X4PA 7ICKA 1Q78A 4PH5A 4OAGA 1ZQUA 1TFWA 2B56A
chains in the Genus database with same CATH topology
4E8FA 4K4GA 4F5QA 4QZ8A 2M2VA 1MIYA 8ICXA 5DEDA 7ICQA 2NRKA 1UETA 4ATBA 2ISOA 4R63A 3MDAA 4UB1A 8ICKA 2BCRA 2RFFA 4KLUA 9ICWA 5CR0A 4RPYA 4E80A 5HC9A 1YLQA 4M9LA 3C5GA 5DECA 5J0SA 3GDXA 5D4BA 1BPZA 1R8AA 3C66A 4XQ7A 4UAWA 4X4UA 1KEJA 5J2HA 3OUYA 4RQ7A 4RQ1A 5CP2A 4I2GA 3JPRA 4X4VA 8ICLA 7ICTA 5J0PA 2HHPA 1ZQNA 4NLZA 4QZFA 4QZEA 4UBCA 2M2TA 4PGXA 8ICYA 2ZH6A 4TUSA 7ICLA 2ZH5A 9ICMA 4WCWA 4RWOA 4KLMA 1ZQHA 4YCXA 4I27A 9ICUA 1FA0A 1V4AA 3MDCA 9ICGA 5F2VO 5HRFA 1ZQIA 2Q66A 4K4HA 4I28A 1ZQTA 1ZQWA 4XA5A 1ZJNA 4X4TA 3RJFA 4Z6DA 4X4QA 2PFNA 4R64A 2ID1A 9ICVA 3MGIA 4UD5A 3C2MA 1XSNA 1ZQRA 4PHEA 4NLKA 1ZQQA 1JMSA 3NYBA 3C18A 1BPXA 3LQCB 3ISBA 2DR9A 5IIOA 3TFSA 3AQLA 4UAYA 4RWNA 4XQ8A 3MGHA 4K4IA 4WBZA 1ZQGA 3RH5A 5IIJA 4TURA 1F5AA 2FMPA 5J2EA 8ICGA 4XRHA 4I2EA 5J0QA 8ICSA 2BCQA 4P4MA 4YD1A 9ICHA 2BCVA 1JQRA 2ZH7A 4M04A 3AU2A 9ICJA 1R89A 7ICFA 3PMNA 5HRBA 4LT6A 4PGYA 1ZQMA 4DOCA 4FHWA 3RJGA 4ATBB 4KLSA 4MFAA 4NM1A 4IQVA 5DB7A 8ICRA 2FMSA 2ZH3A 4AT8A 4M47A 4WC5A 3V7LA 2ZH9A 4X4NA 1ZQKA 4JWMA 5DDMA 3UXNA 1TV9A 1NOMA 4RWQA 1ZQJA 3V7JA 3OUYB 4FHPA 8ICPA 4RPXA 7ICSA 4EP7A 4P2HA 4XUSA 4QZHA 2DR8A 4YD2A 3WFRE 5DB9A 1ZQPA 7ICHA 1ZQVA 4IQUA 9ICPA 4KLHA 8ICHA 1VJ7A 4YMMA 3JYYA 4RWPA 1Q79A 4DO9A 3RH6A 4Z6FA 4I2DA 2PBEA 5EOZA 1UEVA 4DOAA 3UQ0A 5CA7A 2BPFA 4O5EA 4M0AA 1UEUA 4LZGA 3WFQE 4O5KA 3RJIA 2ISPA 4QZGA 5BOLA 5J2JA 4M5DA 2ZH2A 1ZQDA 1BPEA 3HX0A 1VFGA 3JPTA 4WC4A 4RQ3A 3RH4A 4X4SA 4DOBA 4I2CA 1HUZA 5IIMA 4E7XA 4PHPA 8ICAA 3AQKA 4MF2A 4KLOA 3V72A 4WC3A 4M9GA 9ICBA 3OV7A 5HRKA 5HRGA 4M9NA 3UPSA 3C2LA 4UB4A 4AT7B 3PMLA 5DBCA 4LVSA 1ZQZA 4FH5A 4KLLA 1R8BA 4KLFA 4KLTA 9ICFA 5J0WA 5IIKA 4UB5A 4NKUA 9ICTA 4KLEA 9ICCA 9ICIA 7ICIA 1ZQCA 4UAZA 4AT7A 2DR7A 9ICNA 4F5OA 3HWTA 4P4OA 3WFOA 4F5PA 5DDYA 1R8CA 4RQ8A 2BCSA 9ICSA 7ICVA 4P4PA 3B0XA 9ICXA 1NO5A 5DB8A 3V7KA 4AT9B 1ZQSA 4FHVA 4F5NA 3UXPA 3AQNA 3JPOA 7ICNA 5HRLA 2DVIA 8ICVA 3OGUA 1KNYA 5DBAA 4O5CA 5J0TA 4X4RA 5J2IA 5J0UA 2ZHAA 8ICZA 4QZDA 4WBYA 7ICPA 5D46A 4NXZA 3HJ1A 4AT9A 1RPLA 7ICUA 5J2CA 1KDHA 9ICAA 7ICMA 2PFPA 5IIIA 2ZH8A 4R65A 2GWSA 9ICLA 5IINA 3C5FA 4F5RA 2PFOA 5J2AA 4AT8B 1XSPA 7ICEA 4WC1A 1BPBA 3JPSA 3TFRA 4I2HA 1HUOA 4KLDA 5J0RA 5J2FA 4YN4A 5J0YA 8ICUA 4RQ4A 4UD4A 8ICJA 3JPQA 2ZH4A 4NKTA 1OU5A 5IILA 4KLGA 4EBJA 4M2YA 3AUOA 3B0YA 1MQ2A 4MFCA 1JN3A 2BE3A 4RPZA 4YMNA 2DR5A 2IHMA 3H37A 3UXOA 2DRBA 4RQ2A 1MQ3A 1JAJA 4FO6A 2W9MA 4QZBA 4S3NA 4FHXA 3RJKA 2VANA 3JZ0A 4FH3A 1ZQBA 3ISCA 5BOMA 4X0BA 4TUQA 8ICBA 3RJEA 4UB3A 5HR9A 3K75D 5J0XA 8ICQA 3ISDA 5J2KA 5CWRA 4QZAA 4R66A 4MFFA 3L9DA 9ICRA 3WFPA 3HW8A 4M9JA 4RQ0A 9ICKA 9ICOA 4RT3A 2ZH1A 1ZQLA 5J2GA 5HRDA 8ICEA 4PHDA 3UPQA 5HHIA 2BPGA 3H3AA 1MIVA 4UB2A 5DKWA 1ZQXA 4UBBA 8ICFA 4I2BA 4PGQA 5DB6A 4KLJA 2DRAA 4I2JA 2M2WA 4IQTA 4GXJA 8ICCA 3UQ2A 1XSLA 3H38A 8ICIA 2O1PA 4WC7A 5J2DA 3RJHA 4NLNA 1TFYA 4X4OA 1MIWA 3OVBA 1ZQOA 4M9HA 4WC2A 4Z6CA 3MBYA 4RQ5A 4EBKA 4QZ9A 4RQ6A 2FMQA 3JPPA 8ICNA 4IG8A 7ICRA 5CB1A 1BPDA 4YMOA 3C2KA 4WC6A 4KLQA 5HREA 4I2FA 5D49A 4QZIA 3PNCA 8ICTA 1WOTA 4Z6EA 5J2BA 4KLIA 2ZHBA 4I2IA 3RJJA 9ICEA 8ICOA 4FHYA 4JWNA 3LK9A 3HJ4A 3OVSA 8ICMA 4MF8A 4LZDA 4WC0A 1PX5A 5CJ7A 3AQMA 1ZJMA 1RZTA 7ICGA 5HRHA 3OVAA 4PPXA 4NM2A 1BPYA 2M2UA 2O5AA 5HRIA 5J29A 5BPCA 4IQWA 4I2AA 5CHGA 9ICQA 5HHHA 3AU6A 4GXIA 4TUPA 4NY8A 3WFSC 5TZVA 3HIYA 2BPCA 4GXKA 8ICWA 4X0AA 1ZQEA 2BCUA 4I29A 2I9GA 4QZCA 4PHAA 7ICJA 1ZQFA 1ZQYA 4X5VA 3H39A 2PXIA 2PFQA 1TVAA 7ICOA 5J0OA 5DBBA 3JPNA 1ZQAA 4RT2A 2P66A 4X4PA 7ICKA 1Q78A 4PH5A 1ZQUA 1TFWA 4O9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E8F A;  4K4G A;  4F5Q A;  4QZ8 A;  2M2V A;  1MIY A;  8ICX A;  5DED A;  7ICQ A;  2NRK A;  1UET A;  4ATB A;  2ISO A;  4R63 A;  3MDA A;  4UB1 A;  8ICK A;  2BCR A;  2RFF A;  4KLU A;  9ICW A;  5CR0 A;  4RPY A;  4E80 A;  5HC9 A;  1YLQ A;  4M9L A;  3C5G A;  5DEC A;  5J0S A;  3GDX A;  5D4B A;  1BPZ A;  1R8A A;  3C66 A;  4XQ7 A;  4UAW A;  4X4U A;  1KEJ A;  5J2H A;  3OUY A;  4RQ7 A;  4RQ1 A;  5CP2 A;  4I2G A;  3JPR A;  4X4V A;  8ICL A;  7ICT A;  5J0P A;  2HHP A;  1ZQN A;  4NLZ A;  4QZF A;  4QZE A;  4UBC A;  2M2T A;  4PGX A;  8ICY A;  2ZH6 A;  4TUS A;  7ICL A;  2ZH5 A;  9ICM A;  4WCW A;  4RWO A;  4KLM A;  1ZQH A;  4YCX A;  4I27 A;  9ICU A;  1FA0 A;  1V4A A;  3MDC A;  9ICG A;  5F2V O;  5HRF A;  1ZQI A;  2Q66 A;  4K4H A;  4I28 A;  1ZQT A;  1ZQW A;  4XA5 A;  1ZJN A;  4X4T A;  3RJF A;  4Z6D A;  4X4Q A;  2PFN A;  4R64 A;  2ID1 A;  9ICV A;  3MGI A;  4UD5 A;  3C2M A;  1XSN A;  1ZQR A;  4PHE A;  4NLK A;  1ZQQ A;  1JMS A;  3NYB A;  3C18 A;  1BPX A;  3LQC B;  3ISB A;  2DR9 A;  5IIO A;  3TFS A;  3AQL A;  4UAY A;  4RWN A;  4XQ8 A;  3MGH A;  4K4I A;  4WBZ A;  1ZQG A;  3RH5 A;  5IIJ A;  4TUR A;  1F5A A;  2FMP A;  5J2E A;  8ICG A;  4XRH A;  4I2E A;  5J0Q A;  8ICS A;  2BCQ A;  4P4M A;  4YD1 A;  9ICH A;  2BCV A;  1JQR A;  2ZH7 A;  4M04 A;  3AU2 A;  9ICJ A;  1R89 A;  7ICF A;  3PMN A;  5HRB A;  4LT6 A;  4PGY A;  1ZQM A;  4DOC A;  4FHW A;  3RJG A;  4ATB B;  4KLS A;  4MFA A;  4NM1 A;  4IQV A;  5DB7 A;  8ICR A;  2FMS A;  2ZH3 A;  4AT8 A;  4M47 A;  4WC5 A;  3V7L A;  2ZH9 A;  4X4N A;  1ZQK A;  4JWM A;  5DDM A;  3UXN A;  1TV9 A;  1NOM A;  4RWQ A;  1ZQJ A;  3V7J A;  3OUY B;  4FHP A;  8ICP A;  4RPX A;  7ICS A;  4EP7 A;  4P2H A;  4XUS A;  4QZH A;  2DR8 A;  4YD2 A;  3WFR E;  5DB9 A;  1ZQP A;  7ICH A;  1ZQV A;  4IQU A;  9ICP A;  4KLH A;  8ICH A;  1VJ7 A;  4YMM A;  3JYY A;  4RWP A;  1Q79 A;  4DO9 A;  3RH6 A;  4Z6F A;  4I2D A;  2PBE A;  5EOZ A;  1UEV A;  4DOA A;  3UQ0 A;  5CA7 A;  2BPF A;  4O5E A;  4M0A A;  1UEU A;  4LZG A;  3WFQ E;  4O5K A;  3RJI A;  2ISP A;  4QZG A;  5BOL A;  5J2J A;  4M5D A;  2ZH2 A;  1ZQD A;  1BPE A;  3HX0 A;  1VFG A;  3JPT A;  4WC4 A;  4RQ3 A;  3RH4 A;  4X4S A;  4DOB A;  4I2C A;  1HUZ A;  5IIM A;  4E7X A;  4PHP A;  8ICA A;  3AQK A;  4MF2 A;  4KLO A;  3V72 A;  4WC3 A;  4M9G A;  9ICB A;  3OV7 A;  5HRK A;  5HRG A;  4M9N A;  3UPS A;  3C2L A;  4UB4 A;  4AT7 B;  3PML A;  5DBC A;  4LVS A;  1ZQZ A;  4FH5 A;  4KLL A;  1R8B A;  4KLF A;  4KLT A;  9ICF A;  5J0W A;  5IIK A;  4UB5 A;  4NKU A;  9ICT A;  4KLE A;  9ICC A;  9ICI A;  7ICI A;  1ZQC A;  4UAZ A;  4AT7 A;  2DR7 A;  9ICN A;  4F5O A;  3HWT A;  4P4O A;  3WFO A;  4F5P A;  5DDY A;  1R8C A;  4RQ8 A;  2BCS A;  9ICS A;  7ICV A;  4P4P A;  3B0X A;  9ICX A;  1NO5 A;  5DB8 A;  3V7K A;  4AT9 B;  1ZQS A;  4FHV A;  4F5N A;  3UXP A;  3AQN A;  3JPO A;  7ICN A;  5HRL A;  2DVI A;  8ICV A;  3OGU A;  1KNY A;  5DBA A;  4O5C A;  5J0T A;  4X4R A;  5J2I A;  5J0U A;  2ZHA A;  8ICZ A;  4QZD A;  4WBY A;  7ICP A;  5D46 A;  4NXZ A;  3HJ1 A;  4AT9 A;  1RPL A;  7ICU A;  5J2C A;  1KDH A;  9ICA A;  7ICM A;  2PFP A;  5III A;  2ZH8 A;  4R65 A;  2GWS A;  9ICL A;  5IIN A;  3C5F A;  4F5R A;  2PFO A;  5J2A A;  4AT8 B;  1XSP A;  7ICE A;  4WC1 A;  1BPB A;  3JPS A;  3TFR A;  4I2H A;  1HUO A;  4KLD A;  5J0R A;  5J2F A;  4YN4 A;  5J0Y A;  8ICU A;  4RQ4 A;  4UD4 A;  8ICJ A;  3JPQ A;  2ZH4 A;  4NKT A;  1OU5 A;  5IIL A;  4KLG A;  4EBJ A;  4M2Y A;  3AUO A;  3B0Y A;  1MQ2 A;  4MFC A;  1JN3 A;  2BE3 A;  4RPZ A;  4YMN A;  2DR5 A;  2IHM A;  3H37 A;  3UXO A;  2DRB A;  4RQ2 A;  1MQ3 A;  1JAJ A;  4FO6 A;  2W9M A;  4QZB A;  4S3N A;  4FHX A;  3RJK A;  2VAN A;  3JZ0 A;  4FH3 A;  1ZQB A;  3ISC A;  5BOM A;  4X0B A;  4TUQ A;  8ICB A;  3RJE A;  4UB3 A;  5HR9 A;  3K75 D;  5J0X A;  8ICQ A;  3ISD A;  5J2K A;  5CWR A;  4QZA A;  4R66 A;  4MFF A;  3L9D A;  9ICR A;  3WFP A;  3HW8 A;  4M9J A;  4RQ0 A;  9ICK A;  9ICO A;  4RT3 A;  2ZH1 A;  1ZQL A;  5J2G A;  5HRD A;  8ICE A;  4PHD A;  3UPQ A;  5HHI A;  2BPG A;  3H3A A;  1MIV A;  4UB2 A;  5DKW A;  1ZQX A;  4UBB A;  8ICF A;  4I2B A;  4PGQ A;  5DB6 A;  4KLJ A;  2DRA A;  4I2J A;  2M2W A;  4IQT A;  4GXJ A;  8ICC A;  3UQ2 A;  1XSL A;  3H38 A;  8ICI A;  2O1P A;  4WC7 A;  5J2D A;  3RJH A;  4NLN A;  1TFY A;  4X4O A;  1MIW A;  3OVB A;  1ZQO A;  4M9H A;  4WC2 A;  4Z6C A;  3MBY A;  4RQ5 A;  4EBK A;  4QZ9 A;  4RQ6 A;  2FMQ A;  3JPP A;  8ICN A;  4IG8 A;  7ICR A;  5CB1 A;  1BPD A;  4YMO A;  3C2K A;  4WC6 A;  4KLQ A;  5HRE A;  4I2F A;  5D49 A;  4QZI A;  3PNC A;  8ICT A;  1WOT A;  4Z6E A;  5J2B A;  4KLI A;  2ZHB A;  4I2I A;  3RJJ A;  9ICE A;  8ICO A;  4FHY A;  4JWN A;  3LK9 A;  3HJ4 A;  3OVS A;  8ICM A;  4MF8 A;  4LZD A;  4WC0 A;  1PX5 A;  5CJ7 A;  3AQM A;  1ZJM A;  1RZT A;  7ICG A;  5HRH A;  3OVA A;  4PPX A;  4NM2 A;  1BPY A;  2M2U A;  2O5A A;  5HRI A;  5J29 A;  5BPC A;  4IQW A;  4I2A A;  5CHG A;  9ICQ A;  5HHH A;  3AU6 A;  4GXI A;  4TUP A;  4NY8 A;  3WFS C;  5TZV A;  3HIY A;  2BPC A;  4GXK A;  8ICW A;  4X0A A;  1ZQE A;  2BCU A;  4I29 A;  2I9G A;  4QZC A;  4PHA A;  7ICJ A;  1ZQF A;  1ZQY A;  4X5V A;  3H39 A;  2PXI A;  2PFQ A;  1TVA A;  7ICO A;  5J0O A;  5DBB A;  3JPN A;  1ZQA A;  4RT2 A;  2P66 A;  4X4P A;  7ICK A;  1Q78 A;  4PH5 A;  1ZQU A;  1TFW A;  4O9M A; 
#chains in the Genus database with same CATH topology
 4E8F A;  4O67 A;  4F5Q A;  4K4G A;  3NKU A;  4QZ8 A;  2M2V A;  1MIY A;  4EED A;  4O69 A;  8ICX A;  4WOY A;  5DED A;  7ICQ A;  2HN1 A;  2NRK A;  1UET A;  4ATB A;  2ISO A;  4R63 A;  3MDA A;  4UB1 A;  8ICK A;  3EF2 A;  2BCR A;  2RFF A;  4KLU A;  9ICW A;  5CR0 A;  4RPY A;  4E80 A;  5HC9 A;  1YLQ A;  4M9L A;  3C5G A;  5DEC A;  3ER9 B;  5J0S A;  3GDX A;  5D4B A;  1BPZ A;  1R8A A;  3C66 A;  4XQ7 A;  4UAW A;  4X4U A;  1KEJ A;  5J2H A;  3OUY A;  4RQ7 A;  5JTG A;  4K8V A;  4RQ1 A;  5CP2 A;  4I2G A;  3JPR A;  4X4V A;  8ICL A;  7ICT A;  5J0P A;  2HHP A;  1ZQN A;  4NXW A;  4NLZ A;  4QZF A;  4QZE A;  2IUB A;  4UBC A;  4LEZ A;  3NWI A;  2M2T A;  4PGX A;  8ICY A;  2ZH6 A;  4TUS A;  7ICL A;  2ZH5 A;  9ICM A;  4WCW A;  4RWO A;  4KLM A;  1ZQH A;  4YCX A;  4I27 A;  9ICU A;  1FA0 A;  1V4A A;  3MDC A;  9ICG A;  5F2V O;  5HRF A;  4EGW A;  1ZQI A;  2Q66 A;  4K4H A;  4I28 A;  5D63 A;  1ZQT A;  4K98 A;  1ZQW A;  4K9B A;  4XA5 A;  1ZJN A;  4K9A A;  4X4T A;  3RJF A;  4Z6D A;  4X4Q A;  2PFN A;  4R64 A;  2ID1 A;  9ICV A;  3MGI A;  4UD5 A;  3C2M A;  1XSN A;  1ZQR A;  4PHE A;  4NLK A;  1ZQQ A;  1JMS A;  3NYB A;  3C18 A;  1BPX A;  3LQC B;  3ISB A;  2DR9 A;  4MKP A;  5IIO A;  3TFS A;  3AQL A;  4UAY A;  4RWN A;  2GAF D;  4XQ8 A;  3MGH A;  4K4I A;  4WBZ A;  1ZQG A;  3RH5 A;  5IIJ A;  4KB6 A;  4TUR A;  1F5A A;  2FMP A;  5J2E A;  4K96 A;  2B4V A;  8ICG A;  4XRH A;  4I2E A;  5J0Q A;  8ICS A;  2BCQ A;  4P4M A;  4YD1 A;  9ICH A;  2BCV A;  3NVO A;  1JQR A;  2ZH7 A;  4M04 A;  3AU2 A;  9ICJ A;  1R89 A;  7ICF A;  3PMN A;  5B3Q A;  5HRB A;  4LT6 A;  4PGY A;  1ZQM A;  4DOC A;  4FHW A;  3RJG A;  4ATB B;  4KLS A;  4MFA A;  4NM1 A;  4IQV A;  5DB7 A;  4FO1 A;  8ICR A;  2FMS A;  2ZH3 A;  4AT8 A;  4M47 A;  4WC5 A;  3V7L A;  2ZH9 A;  4X4N A;  1ZQK A;  4JWM A;  5DDM A;  3UXN A;  1TV9 A;  1NOM A;  4RWQ A;  1ZQJ A;  3V7J A;  3OUY B;  4FHP A;  8ICP A;  4RPX A;  7ICS A;  4EP7 A;  4P2H A;  4XUS A;  4QZH A;  2DR8 A;  4YD2 A;  3WFR E;  5DB9 A;  1ZQP A;  7ICH A;  1ZQV A;  4IQU A;  9ICP A;  4KLH A;  8ICH A;  1VJ7 A;  4K99 A;  4YMM A;  3JYY A;  4RWP A;  1Q79 A;  4DO9 A;  4KM5 A;  2B51 A;  3RH6 A;  4Z6F A;  4I2D A;  2PBE A;  5EOZ A;  1UEV A;  4O9M A;  4LEW A;  4DOA A;  4XJE A;  3OWG A;  5CHE A;  3UQ0 A;  5CA7 A;  4OAH A;  2BPF A;  4O5E A;  4M0A A;  1UEU A;  4LZG A;  3WFQ E;  4O5K A;  4HX0 A;  3RJI A;  2ISP A;  1GPJ A;  4QZG A;  5BOL A;  5J2J A;  4M5D A;  2ZH2 A;  1ZQD A;  1BPE A;  3HX0 A;  1VFG A;  3JPT A;  4WC4 A;  4RQ3 A;  3RH4 A;  4X4S A;  4DOB A;  4I2C A;  1HUZ A;  2BBJ A;  5IIM A;  4E7X A;  4PHP A;  8ICA A;  3AQK A;  4MF2 A;  4KLO A;  3V72 A;  4WC3 A;  4M9G A;  4NXX A;  9ICB A;  3OV7 A;  5HRK A;  5HRG A;  4M9N A;  3UPS A;  3C2L A;  4UB4 A;  4AT7 B;  3PML A;  5DBC A;  4LVS A;  1ZQZ A;  4FH5 A;  4KLL A;  1R8B A;  4KLF A;  4KLT A;  9ICF A;  5J0W A;  5IIK A;  4UB5 A;  4NKU A;  9ICT A;  4KLE A;  9ICC A;  9ICI A;  7ICI A;  5CFU A;  1ZQC A;  4UAZ A;  4AT7 A;  2DR7 A;  3ERC C;  9ICN A;  2IHO A;  4F5O A;  3HWT A;  4P4O A;  3WFO A;  4F5P A;  5DDY A;  3MCR A;  4O6A A;  1R8C A;  4RQ8 A;  2BCS A;  9ICS A;  7ICV A;  4P4P A;  3B0X A;  9ICX A;  1NO5 A;  5DB8 A;  3V7K A;  4AT9 B;  1ZQS A;  4FHV A;  4F5N A;  3UXP A;  3AQN A;  3JPO A;  7ICN A;  4WQL A;  5HRL A;  2DVI A;  8ICV A;  3OGU A;  1KNY A;  5DBA A;  4OAF A;  4O5C A;  5J0T A;  4X4R A;  3JCF A;  5J2I A;  5J0U A;  2ZHA A;  8ICZ A;  4QZD A;  4WBY A;  7ICP A;  5D46 A;  4NXZ A;  3HJ1 A;  4WH5 A;  4AT9 A;  1RPL A;  7ICU A;  5J2C A;  1KDH A;  9ICA A;  7ICM A;  2PFP A;  5III A;  2ZH8 A;  4R65 A;  2GWS A;  9ICL A;  5IIN A;  3C5F A;  4F5R A;  2PFO A;  5B3P A;  5J2A A;  4AT8 B;  4NXV A;  1XSP A;  2FCL A;  4WC1 A;  1BPB A;  7ICE A;  3JPS A;  3TFR A;  4I2H A;  1HUO A;  4KLD A;  5J0R A;  5J2F A;  4YN4 A;  5D61 A;  5J0Y A;  8ICU A;  4RQ4 A;  4UD4 A;  8ICJ A;  3JPQ A;  2ZH4 A;  4NKT A;  1OU5 A;  5IIL A;  4KLG A;  4EBJ A;  4M2Y A;  3ER8 C;  3AUO A;  3B0Y A;  1MQ2 A;  4MFC A;  4LEV A;  1JN3 A;  2BE3 A;  4RPZ A;  4YMN A;  2DR5 A;  4EV6 A;  2IHM A;  3H37 A;  3UXO A;  3CK6 A;  2DRB A;  4RQ2 A;  1MQ3 A;  1JAJ A;  4FO6 A;  2W9M A;  4QZB A;  4S3N A;  4FHX A;  3RJK A;  2VAN A;  3JZ0 A;  4FH3 A;  1ZQB A;  3ISC A;  5BOM A;  4X0B A;  4N7R A;  4TUQ A;  8ICB A;  3RJE A;  4I0U A;  4UB3 A;  5HR9 A;  3K75 D;  5J0X A;  8ICQ A;  3ISD A;  5J2K A;  5CWR A;  4QZA A;  4R66 A;  2BBH A;  4MFF A;  3L9D A;  9ICR A;  3WFP A;  3HW8 A;  4M9J A;  4RQ0 A;  4LEY A;  9ICK A;  9ICO A;  5D62 A;  4RT3 A;  2ZH1 A;  1ZQL A;  5J2G A;  5HRD A;  8ICE A;  4PHD A;  3UPQ A;  5HHI A;  2BPG A;  3H3A A;  1MIV A;  4UB2 A;  5DKW A;  1ZQX A;  4UBB A;  8ICF A;  4I2B A;  5CFT A;  4EEB A;  4PGQ A;  5DB6 A;  4KLJ A;  2DRA A;  4NXU A;  4I2J A;  2HN2 A;  2M2W A;  4IQT A;  4GXJ A;  8ICC A;  3UQ2 A;  1XSL A;  3H38 A;  8ICI A;  2O1P A;  4WC7 A;  5J2D A;  3RJH A;  4NLN A;  1TFY A;  4X4O A;  1MIW A;  3OVB A;  4OAI Z;  4JLZ A;  1ZQO A;  4M9H A;  4O68 A;  4WC2 A;  4Z6C A;  3MBY A;  4RQ5 A;  4EBK A;  2GA9 D;  4QZ9 A;  4RQ6 A;  2FMQ A;  3JPP A;  8ICN A;  4IG8 A;  7ICR A;  5CB1 A;  1BPD A;  4YMO A;  3C2K A;  4WC6 A;  4KLQ A;  5HRE A;  4I2F A;  5D49 A;  3PHZ A;  4QZI A;  3PNC A;  8ICT A;  1WOT A;  4Z6E A;  5J2B A;  4KLI A;  2ZHB A;  4I2I A;  3RJJ A;  9ICE A;  8ICO A;  4FHY A;  4JWN A;  3LK9 A;  3HJ4 A;  3OVS A;  8ICM A;  4MF8 A;  4LZD A;  4WC0 A;  1PX5 A;  5CJ7 A;  3AQM A;  1ZJM A;  1RZT A;  7ICG A;  5HRH A;  3OVA A;  4PPX A;  4NM2 A;  1BPY A;  4K97 A;  2M2U A;  2O5A A;  5HRI A;  5J29 A;  5BPC A;  4IQW A;  4I2A A;  5CHG A;  9ICQ A;  5CFS A;  5HHH A;  3AU6 A;  4GXI A;  4TUP A;  4NY8 A;  3WFS C;  4NXT A;  5TZV A;  3HIY A;  2BPC A;  4GXK A;  8ICW A;  4X0A A;  1ZQE A;  2BCU A;  4I29 A;  4WQK A;  2I9G A;  4QZC A;  4PHA A;  4JLX A;  7ICJ A;  2EWR A;  1ZQF A;  1ZQY A;  4X5V A;  3H39 A;  2PXI A;  2PFQ A;  1TVA A;  7ICO A;  3K7D A;  5J0O A;  5DBB A;  3JPN A;  1ZQA A;  4RT2 A;  2P66 A;  4X4P A;  7ICK A;  1Q78 A;  4PH5 A;  4OAG A;  1ZQU A;  1TFW A;  2B56 A; 
#chains in the Genus database with same CATH homology
 4E8F A;  4K4G A;  4F5Q A;  4QZ8 A;  2M2V A;  1MIY A;  8ICX A;  5DED A;  7ICQ A;  2NRK A;  1UET A;  4ATB A;  2ISO A;  4R63 A;  3MDA A;  4UB1 A;  8ICK A;  2BCR A;  2RFF A;  4KLU A;  9ICW A;  5CR0 A;  4RPY A;  4E80 A;  5HC9 A;  1YLQ A;  4M9L A;  3C5G A;  5DEC A;  5J0S A;  3GDX A;  5D4B A;  1BPZ A;  1R8A A;  3C66 A;  4XQ7 A;  4UAW A;  4X4U A;  1KEJ A;  5J2H A;  3OUY A;  4RQ7 A;  4RQ1 A;  5CP2 A;  4I2G A;  3JPR A;  4X4V A;  8ICL A;  7ICT A;  5J0P A;  2HHP A;  1ZQN A;  4NLZ A;  4QZF A;  4QZE A;  4UBC A;  2M2T A;  4PGX A;  8ICY A;  2ZH6 A;  4TUS A;  7ICL A;  2ZH5 A;  9ICM A;  4WCW A;  4RWO A;  4KLM A;  1ZQH A;  4YCX A;  4I27 A;  9ICU A;  1FA0 A;  1V4A A;  3MDC A;  9ICG A;  5F2V O;  5HRF A;  1ZQI A;  2Q66 A;  4K4H A;  4I28 A;  1ZQT A;  1ZQW A;  4XA5 A;  1ZJN A;  4X4T A;  3RJF A;  4Z6D A;  4X4Q A;  2PFN A;  4R64 A;  2ID1 A;  9ICV A;  3MGI A;  4UD5 A;  3C2M A;  1XSN A;  1ZQR A;  4PHE A;  4NLK A;  1ZQQ A;  1JMS A;  3NYB A;  3C18 A;  1BPX A;  3LQC B;  3ISB A;  2DR9 A;  5IIO A;  3TFS A;  3AQL A;  4UAY A;  4RWN A;  4XQ8 A;  3MGH A;  4K4I A;  4WBZ A;  1ZQG A;  3RH5 A;  5IIJ A;  4TUR A;  1F5A A;  2FMP A;  5J2E A;  8ICG A;  4XRH A;  4I2E A;  5J0Q A;  8ICS A;  2BCQ A;  4P4M A;  4YD1 A;  9ICH A;  2BCV A;  1JQR A;  2ZH7 A;  4M04 A;  3AU2 A;  9ICJ A;  1R89 A;  7ICF A;  3PMN A;  5HRB A;  4LT6 A;  4PGY A;  1ZQM A;  4DOC A;  4FHW A;  3RJG A;  4ATB B;  4KLS A;  4MFA A;  4NM1 A;  4IQV A;  5DB7 A;  8ICR A;  2FMS A;  2ZH3 A;  4AT8 A;  4M47 A;  4WC5 A;  3V7L A;  2ZH9 A;  4X4N A;  1ZQK A;  4JWM A;  5DDM A;  3UXN A;  1TV9 A;  1NOM A;  4RWQ A;  1ZQJ A;  3V7J A;  3OUY B;  4FHP A;  8ICP A;  4RPX A;  7ICS A;  4EP7 A;  4P2H A;  4XUS A;  4QZH A;  2DR8 A;  4YD2 A;  3WFR E;  5DB9 A;  1ZQP A;  7ICH A;  1ZQV A;  4IQU A;  9ICP A;  4KLH A;  8ICH A;  1VJ7 A;  4YMM A;  3JYY A;  4RWP A;  1Q79 A;  4DO9 A;  3RH6 A;  4Z6F A;  4I2D A;  2PBE A;  5EOZ A;  1UEV A;  4DOA A;  3UQ0 A;  5CA7 A;  2BPF A;  4O5E A;  4M0A A;  1UEU A;  4LZG A;  3WFQ E;  4O5K A;  3RJI A;  2ISP A;  4QZG A;  5BOL A;  5J2J A;  4M5D A;  2ZH2 A;  1ZQD A;  1BPE A;  3HX0 A;  1VFG A;  3JPT A;  4WC4 A;  4RQ3 A;  3RH4 A;  4X4S A;  4DOB A;  4I2C A;  1HUZ A;  5IIM A;  4E7X A;  4PHP A;  8ICA A;  3AQK A;  4MF2 A;  4KLO A;  3V72 A;  4WC3 A;  4M9G A;  9ICB A;  3OV7 A;  5HRK A;  5HRG A;  4M9N A;  3UPS A;  3C2L A;  4UB4 A;  4AT7 B;  3PML A;  5DBC A;  4LVS A;  1ZQZ A;  4FH5 A;  4KLL A;  1R8B A;  4KLF A;  4KLT A;  9ICF A;  5J0W A;  5IIK A;  4UB5 A;  4NKU A;  9ICT A;  4KLE A;  9ICC A;  9ICI A;  7ICI A;  1ZQC A;  4UAZ A;  4AT7 A;  2DR7 A;  9ICN A;  4F5O A;  3HWT A;  4P4O A;  3WFO A;  4F5P A;  5DDY A;  1R8C A;  4RQ8 A;  2BCS A;  9ICS A;  7ICV A;  4P4P A;  3B0X A;  9ICX A;  1NO5 A;  5DB8 A;  3V7K A;  4AT9 B;  1ZQS A;  4FHV A;  4F5N A;  3UXP A;  3AQN A;  3JPO A;  7ICN A;  5HRL A;  2DVI A;  8ICV A;  3OGU A;  1KNY A;  5DBA A;  4O5C A;  5J0T A;  4X4R A;  5J2I A;  5J0U A;  2ZHA A;  8ICZ A;  4QZD A;  4WBY A;  7ICP A;  5D46 A;  4NXZ A;  3HJ1 A;  4AT9 A;  1RPL A;  7ICU A;  5J2C A;  1KDH A;  9ICA A;  7ICM A;  2PFP A;  5III A;  2ZH8 A;  4R65 A;  2GWS A;  9ICL A;  5IIN A;  3C5F A;  4F5R A;  2PFO A;  5J2A A;  4AT8 B;  1XSP A;  7ICE A;  4WC1 A;  1BPB A;  3JPS A;  3TFR A;  4I2H A;  1HUO A;  4KLD A;  5J0R A;  5J2F A;  4YN4 A;  5J0Y A;  8ICU A;  4RQ4 A;  4UD4 A;  8ICJ A;  3JPQ A;  2ZH4 A;  4NKT A;  1OU5 A;  5IIL A;  4KLG A;  4EBJ A;  4M2Y A;  3AUO A;  3B0Y A;  1MQ2 A;  4MFC A;  1JN3 A;  2BE3 A;  4RPZ A;  4YMN A;  2DR5 A;  2IHM A;  3H37 A;  3UXO A;  2DRB A;  4RQ2 A;  1MQ3 A;  1JAJ A;  4FO6 A;  2W9M A;  4QZB A;  4S3N A;  4FHX A;  3RJK A;  2VAN A;  3JZ0 A;  4FH3 A;  1ZQB A;  3ISC A;  5BOM A;  4X0B A;  4TUQ A;  8ICB A;  3RJE A;  4UB3 A;  5HR9 A;  3K75 D;  5J0X A;  8ICQ A;  3ISD A;  5J2K A;  5CWR A;  4QZA A;  4R66 A;  4MFF A;  3L9D A;  9ICR A;  3WFP A;  3HW8 A;  4M9J A;  4RQ0 A;  9ICK A;  9ICO A;  4RT3 A;  2ZH1 A;  1ZQL A;  5J2G A;  5HRD A;  8ICE A;  4PHD A;  3UPQ A;  5HHI A;  2BPG A;  3H3A A;  1MIV A;  4UB2 A;  5DKW A;  1ZQX A;  4UBB A;  8ICF A;  4I2B A;  4PGQ A;  5DB6 A;  4KLJ A;  2DRA A;  4I2J A;  2M2W A;  4IQT A;  4GXJ A;  8ICC A;  3UQ2 A;  1XSL A;  3H38 A;  8ICI A;  2O1P A;  4WC7 A;  5J2D A;  3RJH A;  4NLN A;  1TFY A;  4X4O A;  1MIW A;  3OVB A;  1ZQO A;  4M9H A;  4WC2 A;  4Z6C A;  3MBY A;  4RQ5 A;  4EBK A;  4QZ9 A;  4RQ6 A;  2FMQ A;  3JPP A;  8ICN A;  4IG8 A;  7ICR A;  5CB1 A;  1BPD A;  4YMO A;  3C2K A;  4WC6 A;  4KLQ A;  5HRE A;  4I2F A;  5D49 A;  4QZI A;  3PNC A;  8ICT A;  1WOT A;  4Z6E A;  5J2B A;  4KLI A;  2ZHB A;  4I2I A;  3RJJ A;  9ICE A;  8ICO A;  4FHY A;  4JWN A;  3LK9 A;  3HJ4 A;  3OVS A;  8ICM A;  4MF8 A;  4LZD A;  4WC0 A;  1PX5 A;  5CJ7 A;  3AQM A;  1ZJM A;  1RZT A;  7ICG A;  5HRH A;  3OVA A;  4PPX A;  4NM2 A;  1BPY A;  2M2U A;  2O5A A;  5HRI A;  5J29 A;  5BPC A;  4IQW A;  4I2A A;  5CHG A;  9ICQ A;  5HHH A;  3AU6 A;  4GXI A;  4TUP A;  4NY8 A;  3WFS C;  5TZV A;  3HIY A;  2BPC A;  4GXK A;  8ICW A;  4X0A A;  1ZQE A;  2BCU A;  4I29 A;  2I9G A;  4QZC A;  4PHA A;  7ICJ A;  1ZQF A;  1ZQY A;  4X5V A;  3H39 A;  2PXI A;  2PFQ A;  1TVA A;  7ICO A;  5J0O A;  5DBB A;  3JPN A;  1ZQA A;  4RT2 A;  2P66 A;  4X4P A;  7ICK A;  1Q78 A;  4PH5 A;  1ZQU A;  1TFW A;  4O9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...