4WBZA

Trna-processing enzyme (apo form 2)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 106
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wbzA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wbzA01
3OUYA 7ICTA 2NRKA 4TURA 1ZQDA 4RQ0A 3OVAA 2O5AA 4IG8A 4R65A 2ZH5A 4MF8A 3C66A 3MGIA 4EBJA 4MFFA 1JN3A 3HW8A 4RPXA 4X4UA 1R8BA 4Z6FA 5HRBA 4DOAA 1MQ3A 3RJGA 9ICLA 7ICQA 4JWNA 4P2HA 3UXOA 3L9DA 1ZQQA 4QZHA 4WC7A 4M9JA 3TFSA 5IILA 1XSLA 8ICJA 2ZH9A 4ATBB 4QZIA 4KLUA 5J2GA 4NM2A 4TUSA 4R63A 3UQ0A 7ICHA 4M2YA 3UPQA 3GDXA 4IQWA 1ZQXA 2FMSA 4YN4A 3JZ0A 4LVSA 4F5OA 3ISDA 4PPXA 1ZQPA 4I2HA 5F2VO 5BOMA 1ZQAA 4WC4A 4YD1A 2BCUA 4FHYA 4QZBA 3V7JA 1TFWA 3AQNA 1BPBA 8ICFA 3MDAA 3WFRE 9ICEA 4P4PA 4E7XA 3JPOA 4FH3A 1BPDA 4DO9A 3MBYA 1ZQLA 4O5CA 4YCXA 3C5GA 2ISOA 4RQ6A 4X4VA 4XQ8A 5IIIA 4O5EA 5J0QA 4WBYA 9ICIA 1F5AA 1PX5A 4RWOA 1MQ2A 4KLJA 7ICRA 5HRIA 5CWRA 1ZQUA 4KLHA 1JMSA 7ICUA 2BCRA 5CB1A 8ICGA 8ICXA 1Q78A 4QZCA 3PMLA 9ICWA 4I2FA 4MF2A 8ICWA 5HRGA 8ICLA 4AT7A 3HX0A 4X4PA 1ZQSA 4RQ1A 3C18A 4PGXA 4XQ7A 1ZJMA 2PFNA 4XA5A 2IHMA 2RFFA 4RQ3A 4AT8A 4NY8A 3C2LA 5J2JA 5BPCA 1ZQGA 2ISPA 5CA7A 5J0TA 1TFYA 1XSPA 2VANA 4YMMA 4KLLA 4QZGA 4KLGA 8ICMA 4XRHA 4IQVA 5EOZA 4KLEA 9ICQA 4I2EA 2DRAA 3OVBA 9ICVA 3RJFA 9ICNA 3B0XA 5DECA 4WC3A 9ICPA 4Z6CA 5HHIA 4WC2A 3WFOA 4X4SA 5J29A 4QZFA 5CP2A 3UXNA 4RWPA 4X4RA 4YD2A 9ICOA 2ZHBA 4QZDA 1TV9A 1VJ7A 2PXIA 1ZQBA 4R64A 8ICAA 4I29A 2PFPA 3C2KA 4FH5A 1ZQMA 4NKTA 5IIOA 5D46A 3B0YA 5J2IA 3AQMA 1ZQZA 1WOTA 9ICGA 8ICBA 2BCQA 7ICSA 4UD5A 3TFRA 4F5NA 4KLDA 4X0BA 7ICFA 4M9GA 4DOCA 4KLIA 1RPLA 2ZH8A 4GXJA 1NOMA 1MIWA 4AT7B 5DB6A 4FO6A 1BPEA 1ZQNA 4M0AA 4WBZA 3JPRA 4AT9B 3RH4A 8ICHA 1V4AA 4YMOA 5J2BA 5J2HA 4YMNA 3AU2A 4X0AA 3HIYA 4LZDA 8ICTA 3AUOA 3NYBA 4X4NA 3MGHA 2BCSA 2M2VA 1R8AA 4UBBA 4NXZA 5BOLA 2ZHAA 4KLFA 1YLQA 8ICQA 1ZQYA 1OU5A 4M47A 9ICUA 4PHDA 4X5VA 4MFCA 1NO5A 4QZ8A 3RJKA 2ZH7A 4TUQA 3RH6A 4NKUA 7ICOA 5DBCA 3V7LA 7ICJA 2M2UA 3LQCB 4RT3A 8ICNA 8ICSA 8ICYA 3OUYB 5DDYA 3UQ2A 2O1PA 1ZQIA 4X4OA 4M04A 4I2BA 3JYYA 3WFSC 4O9MA 1HUOA 2GWSA 3WFPA 2DR7A 8ICIA 4RQ7A 4UAWA 4M9LA 4KLQA 5J2CA 4WC6A 4Z6EA 4UAYA 9ICMA 5DDMA 3PNCA 7ICVA 4UD4A 8ICRA 5DKWA 4QZAA 3AQLA 5HR9A 3RJJA 1ZQCA 3C2MA 4F5PA 4I2AA 4RPZA 7ICKA 4O5KA 3JPTA 1HUZA 3OVSA 5J0UA 4F5RA 2BPFA 4GXKA 2ZH3A 4X4TA 8ICVA 1RZTA 2ZH6A 4K4GA 5CR0A 4QZEA 4RPYA 5CHGA 4KLSA 1MIYA 7ICIA 5HRDA 5DBBA 4ATBA 4I2IA 3HWTA 4RT2A 4NLNA 5IIJA 2DR5A 3JPNA 4FHWA 5IIMA 1XSNA 2I9GA 4WC0A 2DR8A 9ICAA 3LK9A 3JPSA 3H39A 3OGUA 4M9NA 8ICEA 9ICRA 7ICGA 5J2EA 4IQTA 4UB3A 7ICNA 4WC1A 1VFGA 1MIVA 4PHEA 2P66A 4DOBA 5DEDA 4F5QA 1UEVA 5DB9A 4FHPA 5HC9A 7ICLA 4EP7A 4M9HA 7ICPA 4R66A 1ZQEA 2M2TA 5J0OA 4KLTA 4WCWA 4RQ5A 3V7KA 9ICKA 5D4BA 5J2FA 1TVAA 8ICUA 5J0RA 9ICFA 1BPXA 2PFQA 4FHVA 2HHPA 1ZQFA 5HREA 4XUSA 5IIKA 1KNYA 1UEUA 2ZH2A 5HRKA 3JPQA 3V72A 4NM1A 8ICZA 2M2WA 8ICKA 4TUPA 3RJIA 4UB5A 2DRBA 4P4OA 1ZQWA 1ZQTA 3K75D 1R8CA 5J2KA 1ZQHA 5J0SA 5J2AA 3RJHA 9ICBA 4P4MA 4K4IA 4MFAA 9ICSA 4AT8B 5DB7A 3PMNA 1Q79A 3H37A 1ZJNA 4GXIA 4K4HA 2PFOA 4I27A 4UB2A 4M5DA 1UETA 4UB4A 3AQKA 7ICEA 5TZVA 4PHPA 5HRFA 2ZH4A 1R89A 4PGQA 4UB1A 3WFQE 1BPYA 5HRLA 2BE3A 8ICCA 1BPZA 5DB8A 4EBKA 5HHHA 2BPGA 2BPCA 2FMQA 4JWMA 7ICMA 2DR9A 4KLMA 2Q66A 3RH5A 5J0XA 5J0WA 4UBCA 4RQ8A 3H3AA 2ZH1A 1KDHA 3H38A 2ID1A 9ICTA 4RWQA 2BCVA 3JPPA 4UAZA 3C5FA 1ZQVA 3HJ1A 5HRHA 3HJ4A 2DVIA 1ZQOA 4I2GA 1ZQKA 4PH5A 3UPSA 4LZGA 1ZQRA 4E8FA 1JAJA 4PGYA 9ICJA 9ICXA 4Z6DA 4RQ2A 9ICHA 3RJEA 5CJ7A 5IINA 4I28A 4IQUA 5J0PA 8ICOA 3MDCA 8ICPA 1ZQJA 4X4QA 4E80A 4I2JA 1KEJA 9ICCA 1JQRA 4AT9A 4WC5A 4I2CA 4QZ9A 3OV7A 4NLKA 2W9MA 4RQ4A 5D49A 4LT6A 2PBEA 4KLOA 3AU6A 4I2DA 2FMPA 3UXPA 4FHXA 5DBAA 1FA0A 4NLZA 5J2DA 4PHAA 4S3NA 4RWNA 3ISCA 3ISBA 5J0YA
chains in the Genus database with same CATH superfamily
3OUYA 7ICTA 2NRKA 4TURA 5D62A 1ZQDA 4RQ0A 2O5AA 3OVAA 4IG8A 4R65A 2ZH5A 4MF8A 3C66A 3MGIA 4EBJA 4MFFA 1JN3A 3HW8A 4RPXA 4X4UA 1R8BA 4Z6FA 5HRBA 4DOAA 3NKUA 1MQ3A 3RJGA 9ICLA 7ICQA 4JWNA 4P2HA 2HN1A 3PHZA 3UXOA 3L9DA 1ZQQA 4QZHA 4LEYA 4WC7A 4M9JA 3TFSA 5IILA 1XSLA 8ICJA 2HN2A 2ZH9A 4ATBB 4QZIA 4KLUA 5J2GA 5CFSA 4NM2A 4TUSA 4R63A 3UQ0A 7ICHA 5CHEA 4M2YA 3UPQA 3GDXA 3ER8C 4IQWA 1ZQXA 4MKPA 2FMSA 4YN4A 3JZ0A 4LVSA 4F5OA 3ISDA 4PPXA 1ZQPA 4I2HA 5F2VO 5BOMA 1ZQAA 4WC4A 4YD1A 2BCUA 4FHYA 4QZBA 4O6AA 3V7JA 1TFWA 3AQNA 1BPBA 8ICFA 4XJEA 3MDAA 3WFRE 9ICEA 4P4PA 4E7XA 3K7DA 3JPOA 4FH3A 1BPDA 4WH5A 3MBYA 4DO9A 1ZQLA 4O5CA 4YCXA 3C5GA 2ISOA 4RQ6A 4X4VA 4XQ8A 5IIIA 4O5EA 5J0QA 4WBYA 9ICIA 1F5AA 1PX5A 4RWOA 1MQ2A 4KLJA 7ICRA 5HRIA 5CWRA 2BBJA 1ZQUA 4KLHA 1JMSA 4JLXA 7ICUA 4OAGA 2BCRA 5CB1A 8ICGA 8ICXA 1Q78A 4QZCA 3PMLA 9ICWA 4NXVA 4K96A 4I2FA 4MF2A 8ICWA 5HRGA 3MCRA 8ICLA 4AT7A 3HX0A 4X4PA 1ZQSA 3JCFA 4RQ1A 3C18A 4PGXA 4XQ7A 1ZJMA 2PFNA 4XA5A 2IHMA 2RFFA 4RQ3A 4AT8A 4NY8A 3C2LA 5J2JA 2EWRA 5BPCA 1ZQGA 2ISPA 5CA7A 5J0TA 1TFYA 1XSPA 2VANA 4YMMA 4KLLA 4QZGA 4KLGA 8ICMA 4XRHA 4IQVA 5EOZA 4KLEA 9ICQA 4I2EA 2DRAA 3OVBA 4K98A 9ICVA 3RJFA 9ICNA 3B0XA 5DECA 4HX0A 4WC3A 9ICPA 4Z6CA 5HHIA 4WC2A 3WFOA 4X4SA 5J29A 4O67A 4QZFA 4LEZA 5CP2A 3UXNA 4RWPA 4X4RA 4YD2A 9ICOA 4KB6A 2ZHBA 4QZDA 4LEVA 1TV9A 1VJ7A 2PXIA 1ZQBA 4R64A 8ICAA 4I29A 2PFPA 3C2KA 4FH5A 1ZQMA 4NKTA 5IIOA 5D46A 3B0YA 5J2IA 3AQMA 1ZQZA 1WOTA 9ICGA 8ICBA 2BCQA 7ICSA 4UD5A 3TFRA 4F5NA 4KLDA 4X0BA 7ICFA 4M9GA 4DOCA 4O69A 4KLIA 1RPLA 2ZH8A 4GXJA 1NOMA 1MIWA 4AT7B 5DB6A 4FO6A 1BPEA 2IHOA 1ZQNA 4M0AA 4WBZA 3NWIA 3JPRA 4AT9B 3RH4A 8ICHA 2FCLA 1V4AA 4YMOA 5J2BA 5J2HA 4YMNA 3AU2A 4FO1A 4X0AA 3HIYA 4LZDA 8ICTA 3AUOA 3NYBA 4X4NA 3MGHA 2GA9D 2BCSA 2M2VA 1R8AA 4UBBA 4NXZA 5BOLA 2ZHAA 4KLFA 1YLQA 8ICQA 1ZQYA 1OU5A 4M47A 9ICUA 4PHDA 4X5VA 4MFCA 1NO5A 4QZ8A 3RJKA 2ZH7A 4TUQA 3RH6A 4NKUA 7ICOA 5DBCA 3V7LA 7ICJA 2M2UA 2IUBA 3LQCB 4RT3A 8ICNA 8ICSA 8ICYA 4EGWA 3OUYB 5DDYA 3UQ2A 2O1PA 1ZQIA 4X4OA 4M04A 4LEWA 4I2BA 3JYYA 3WFSC 4O9MA 1HUOA 2GWSA 3WFPA 2DR7A 8ICIA 4OAHA 4RQ7A 4UAWA 3ER9B 4M9LA 4K9AA 5J2CA 4KLQA 4WC6A 2B51A 4Z6EA 4UAYA 9ICMA 5DDMA 3PNCA 7ICVA 4UD4A 4WQLA 8ICRA 5DKWA 4QZAA 3AQLA 5HR9A 3RJJA 1ZQCA 3C2MA 4F5PA 4I2AA 4RPZA 7ICKA 4O5KA 3JPTA 1HUZA 3OVSA 5J0UA 4F5RA 4OAFA 2BPFA 4NXXA 4GXKA 2ZH3A 4X4TA 8ICVA 1RZTA 2ZH6A 4K4GA 5CR0A 4QZEA 4RPYA 5CHGA 4KLSA 4JLZA 1MIYA 7ICIA 5HRDA 5DBBA 4ATBA 4I2IA 3HWTA 4RT2A 4NLNA 5IIJA 2DR5A 3JPNA 4FHWA 5IIMA 3EF2A 1XSNA 2I9GA 2BBHA 4WC0A 2DR8A 9ICAA 3LK9A 3JPSA 5CFUA 3H39A 3OGUA 4M9NA 8ICEA 9ICRA 7ICGA 5J2EA 4IQTA 4UB3A 7ICNA 4WC1A 1VFGA 1MIVA 4PHEA 2P66A 4DOBA 5DEDA 4F5QA 1UEVA 5DB9A 3OWGA 4FHPA 5HC9A 7ICLA 5D63A 4EP7A 4M9HA 7ICPA 4R66A 4O68A 2M2TA 1ZQEA 5J0OA 2B56A 4KLTA 4WCWA 4RQ5A 3V7KA 9ICKA 5D4BA 5J2FA 1TVAA 8ICUA 4K8VA 5J0RA 9ICFA 1BPXA 2PFQA 4FHVA 2HHPA 1ZQFA 5HREA 4XUSA 5IIKA 1KNYA 1UEUA 2ZH2A 5HRKA 3JPQA 4EV6A 3V72A 4NM1A 8ICZA 2M2WA 5B3PA 8ICKA 4TUPA 3RJIA 4UB5A 2DRBA 4P4OA 1ZQWA 4NXUA 1ZQTA 3K75D 1R8CA 4NXTA 4EEDA 5J2KA 1ZQHA 5J0SA 5J2AA 3RJHA 9ICBA 4P4MA 4K4IA 5CFTA 4MFAA 9ICSA 4AT8B 5DB7A 1Q79A 3PMNA 3H37A 1ZJNA 4GXIA 4K4HA 2PFOA 4I27A 4I0UA 4UB2A 4M5DA 2GAFD 1UETA 4UB4A 4NXWA 3AQKA 7ICEA 5TZVA 1GPJA 4PHPA 5HRFA 2ZH4A 1R89A 4PGQA 4UB1A 3WFQE 1BPYA 5HRLA 2BE3A 8ICCA 1BPZA 5DB8A 3NVOA 4EBKA 5HHHA 2BPGA 2BPCA 2FMQA 4JWMA 7ICMA 2DR9A 4KLMA 2Q66A 3RH5A 5J0XA 5J0WA 4UBCA 4RQ8A 3H3AA 2ZH1A 5D61A 1KDHA 3H38A 2ID1A 9ICTA 4RWQA 5B3QA 2BCVA 3JPPA 4UAZA 3C5FA 1ZQVA 4N7RA 3HJ1A 4WOYA 5HRHA 3HJ4A 4KM5A 2DVIA 1ZQOA 4I2GA 1ZQKA 4PH5A 3UPSA 4LZGA 1ZQRA 4E8FA 1JAJA 4PGYA 9ICJA 9ICXA 4Z6DA 4RQ2A 9ICHA 3RJEA 5CJ7A 5IINA 4I28A 4IQUA 5J0PA 8ICOA 3MDCA 8ICPA 1ZQJA 4EEBA 4X4QA 4E80A 4I2JA 1KEJA 9ICCA 1JQRA 4AT9A 4WC5A 4I2CA 4K9BA 4QZ9A 5JTGA 3OV7A 4NLKA 2W9MA 4RQ4A 5D49A 3ERCC 4K99A 4LT6A 2PBEA 4KLOA 3AU6A 4I2DA 2FMPA 3CK6A 3UXPA 2B4VA 4FHXA 5DBAA 1FA0A 4WQKA 4NLZA 5J2DA 4PHAA 4S3NA 4RWNA 3ISCA 4K97A 3ISBA 4OAIZ 5J0YA
chains in the Genus database with same CATH topology
3OUYA 7ICTA 2NRKA 4TURA 1ZQDA 4RQ0A 3OVAA 2O5AA 4IG8A 4R65A 2ZH5A 4MF8A 3C66A 3MGIA 4EBJA 4MFFA 1JN3A 3HW8A 4RPXA 4X4UA 1R8BA 4Z6FA 5HRBA 4DOAA 1MQ3A 3RJGA 9ICLA 7ICQA 4JWNA 4P2HA 3UXOA 3L9DA 1ZQQA 4QZHA 4WC7A 4M9JA 3TFSA 5IILA 1XSLA 8ICJA 2ZH9A 4ATBB 4QZIA 4KLUA 5J2GA 4NM2A 4TUSA 4R63A 3UQ0A 7ICHA 4M2YA 3UPQA 3GDXA 4IQWA 1ZQXA 2FMSA 4YN4A 3JZ0A 4LVSA 4F5OA 3ISDA 4PPXA 1ZQPA 4I2HA 5F2VO 5BOMA 1ZQAA 4WC4A 4YD1A 2BCUA 4FHYA 4QZBA 3V7JA 1TFWA 3AQNA 1BPBA 8ICFA 3MDAA 3WFRE 9ICEA 4P4PA 4E7XA 3JPOA 4FH3A 1BPDA 4DO9A 3MBYA 1ZQLA 4O5CA 4YCXA 3C5GA 2ISOA 4RQ6A 4X4VA 4XQ8A 5IIIA 4O5EA 5J0QA 4WBYA 9ICIA 1F5AA 1PX5A 4RWOA 1MQ2A 4KLJA 7ICRA 5HRIA 5CWRA 1ZQUA 4KLHA 1JMSA 7ICUA 2BCRA 5CB1A 8ICGA 8ICXA 1Q78A 4QZCA 3PMLA 9ICWA 4I2FA 4MF2A 8ICWA 5HRGA 8ICLA 4AT7A 3HX0A 4X4PA 1ZQSA 4RQ1A 3C18A 4PGXA 4XQ7A 1ZJMA 2PFNA 4XA5A 2IHMA 2RFFA 4RQ3A 4AT8A 4NY8A 3C2LA 5J2JA 5BPCA 1ZQGA 2ISPA 5CA7A 5J0TA 1TFYA 1XSPA 2VANA 4YMMA 4KLLA 4QZGA 4KLGA 8ICMA 4XRHA 4IQVA 5EOZA 4KLEA 9ICQA 4I2EA 2DRAA 3OVBA 9ICVA 3RJFA 9ICNA 3B0XA 5DECA 4WC3A 9ICPA 4Z6CA 5HHIA 4WC2A 3WFOA 4X4SA 5J29A 4QZFA 5CP2A 3UXNA 4RWPA 4X4RA 4YD2A 9ICOA 2ZHBA 4QZDA 1TV9A 1VJ7A 2PXIA 1ZQBA 4R64A 8ICAA 4I29A 2PFPA 3C2KA 4FH5A 1ZQMA 4NKTA 5IIOA 5D46A 3B0YA 5J2IA 3AQMA 1ZQZA 1WOTA 9ICGA 8ICBA 2BCQA 7ICSA 4UD5A 3TFRA 4F5NA 4KLDA 4X0BA 7ICFA 4M9GA 4DOCA 4KLIA 1RPLA 2ZH8A 4GXJA 1NOMA 1MIWA 4AT7B 5DB6A 4FO6A 1BPEA 1ZQNA 4M0AA 4WBZA 3JPRA 4AT9B 3RH4A 8ICHA 1V4AA 4YMOA 5J2BA 5J2HA 4YMNA 3AU2A 4X0AA 3HIYA 4LZDA 8ICTA 3AUOA 3NYBA 4X4NA 3MGHA 2BCSA 2M2VA 1R8AA 4UBBA 4NXZA 5BOLA 2ZHAA 4KLFA 1YLQA 8ICQA 1ZQYA 1OU5A 4M47A 9ICUA 4PHDA 4X5VA 4MFCA 1NO5A 4QZ8A 3RJKA 2ZH7A 4TUQA 3RH6A 4NKUA 7ICOA 5DBCA 3V7LA 7ICJA 2M2UA 3LQCB 4RT3A 8ICNA 8ICSA 8ICYA 3OUYB 5DDYA 3UQ2A 2O1PA 1ZQIA 4X4OA 4M04A 4I2BA 3JYYA 3WFSC 4O9MA 1HUOA 2GWSA 3WFPA 2DR7A 8ICIA 4RQ7A 4UAWA 4M9LA 4KLQA 5J2CA 4WC6A 4Z6EA 4UAYA 9ICMA 5DDMA 3PNCA 7ICVA 4UD4A 8ICRA 5DKWA 4QZAA 3AQLA 5HR9A 3RJJA 1ZQCA 3C2MA 4F5PA 4I2AA 4RPZA 7ICKA 4O5KA 3JPTA 1HUZA 3OVSA 5J0UA 4F5RA 2BPFA 4GXKA 2ZH3A 4X4TA 8ICVA 1RZTA 2ZH6A 4K4GA 5CR0A 4QZEA 4RPYA 5CHGA 4KLSA 1MIYA 7ICIA 5HRDA 5DBBA 4ATBA 4I2IA 3HWTA 4RT2A 4NLNA 5IIJA 2DR5A 3JPNA 4FHWA 5IIMA 1XSNA 2I9GA 4WC0A 2DR8A 9ICAA 3LK9A 3JPSA 3H39A 3OGUA 4M9NA 8ICEA 9ICRA 7ICGA 5J2EA 4IQTA 4UB3A 7ICNA 4WC1A 1VFGA 1MIVA 4PHEA 2P66A 4DOBA 5DEDA 4F5QA 1UEVA 5DB9A 4FHPA 5HC9A 7ICLA 4EP7A 4M9HA 7ICPA 4R66A 1ZQEA 2M2TA 5J0OA 4KLTA 4WCWA 4RQ5A 3V7KA 9ICKA 5D4BA 5J2FA 1TVAA 8ICUA 5J0RA 9ICFA 1BPXA 2PFQA 4FHVA 2HHPA 1ZQFA 5HREA 4XUSA 5IIKA 1KNYA 1UEUA 2ZH2A 5HRKA 3JPQA 3V72A 4NM1A 8ICZA 2M2WA 8ICKA 4TUPA 3RJIA 4UB5A 2DRBA 4P4OA 1ZQWA 1ZQTA 3K75D 1R8CA 5J2KA 1ZQHA 5J0SA 5J2AA 3RJHA 9ICBA 4P4MA 4K4IA 4MFAA 9ICSA 4AT8B 5DB7A 3PMNA 1Q79A 3H37A 1ZJNA 4GXIA 4K4HA 2PFOA 4I27A 4UB2A 4M5DA 1UETA 4UB4A 3AQKA 7ICEA 5TZVA 4PHPA 5HRFA 2ZH4A 1R89A 4PGQA 4UB1A 3WFQE 1BPYA 5HRLA 2BE3A 8ICCA 1BPZA 5DB8A 4EBKA 5HHHA 2BPGA 2BPCA 2FMQA 4JWMA 7ICMA 2DR9A 4KLMA 2Q66A 3RH5A 5J0XA 5J0WA 4UBCA 4RQ8A 3H3AA 2ZH1A 1KDHA 3H38A 2ID1A 9ICTA 4RWQA 2BCVA 3JPPA 4UAZA 3C5FA 1ZQVA 3HJ1A 5HRHA 3HJ4A 2DVIA 1ZQOA 4I2GA 1ZQKA 4PH5A 3UPSA 4LZGA 1ZQRA 4E8FA 1JAJA 4PGYA 9ICJA 9ICXA 4Z6DA 4RQ2A 9ICHA 3RJEA 5CJ7A 5IINA 4I28A 4IQUA 5J0PA 8ICOA 3MDCA 8ICPA 1ZQJA 4X4QA 4E80A 4I2JA 1KEJA 9ICCA 1JQRA 4AT9A 4WC5A 4I2CA 4QZ9A 3OV7A 4NLKA 2W9MA 4RQ4A 5D49A 4LT6A 2PBEA 4KLOA 3AU6A 4I2DA 2FMPA 3UXPA 4FHXA 5DBAA 1FA0A 4NLZA 5J2DA 4PHAA 4S3NA 4RWNA 3ISCA 3ISBA 5J0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUY A;  7ICT A;  2NRK A;  4TUR A;  1ZQD A;  4RQ0 A;  3OVA A;  2O5A A;  4IG8 A;  4R65 A;  2ZH5 A;  4MF8 A;  3C66 A;  3MGI A;  4EBJ A;  4MFF A;  1JN3 A;  3HW8 A;  4RPX A;  4X4U A;  1R8B A;  4Z6F A;  5HRB A;  4DOA A;  1MQ3 A;  3RJG A;  9ICL A;  7ICQ A;  4JWN A;  4P2H A;  3UXO A;  3L9D A;  1ZQQ A;  4QZH A;  4WC7 A;  4M9J A;  3TFS A;  5IIL A;  1XSL A;  8ICJ A;  2ZH9 A;  4ATB B;  4QZI A;  4KLU A;  5J2G A;  4NM2 A;  4TUS A;  4R63 A;  3UQ0 A;  7ICH A;  4M2Y A;  3UPQ A;  3GDX A;  4IQW A;  1ZQX A;  2FMS A;  4YN4 A;  3JZ0 A;  4LVS A;  4F5O A;  3ISD A;  4PPX A;  1ZQP A;  4I2H A;  5F2V O;  5BOM A;  1ZQA A;  4WC4 A;  4YD1 A;  2BCU A;  4FHY A;  4QZB A;  3V7J A;  1TFW A;  3AQN A;  1BPB A;  8ICF A;  3MDA A;  3WFR E;  9ICE A;  4P4P A;  4E7X A;  3JPO A;  4FH3 A;  1BPD A;  4DO9 A;  3MBY A;  1ZQL A;  4O5C A;  4YCX A;  3C5G A;  2ISO A;  4RQ6 A;  4X4V A;  4XQ8 A;  5III A;  4O5E A;  5J0Q A;  4WBY A;  9ICI A;  1F5A A;  1PX5 A;  4RWO A;  1MQ2 A;  4KLJ A;  7ICR A;  5HRI A;  5CWR A;  1ZQU A;  4KLH A;  1JMS A;  7ICU A;  2BCR A;  5CB1 A;  8ICG A;  8ICX A;  1Q78 A;  4QZC A;  3PML A;  9ICW A;  4I2F A;  4MF2 A;  8ICW A;  5HRG A;  8ICL A;  4AT7 A;  3HX0 A;  4X4P A;  1ZQS A;  4RQ1 A;  3C18 A;  4PGX A;  4XQ7 A;  1ZJM A;  2PFN A;  4XA5 A;  2IHM A;  2RFF A;  4RQ3 A;  4AT8 A;  4NY8 A;  3C2L A;  5J2J A;  5BPC A;  1ZQG A;  2ISP A;  5CA7 A;  5J0T A;  1TFY A;  1XSP A;  2VAN A;  4YMM A;  4KLL A;  4QZG A;  4KLG A;  8ICM A;  4XRH A;  4IQV A;  5EOZ A;  4KLE A;  9ICQ A;  4I2E A;  2DRA A;  3OVB A;  9ICV A;  3RJF A;  9ICN A;  3B0X A;  5DEC A;  4WC3 A;  9ICP A;  4Z6C A;  5HHI A;  4WC2 A;  3WFO A;  4X4S A;  5J29 A;  4QZF A;  5CP2 A;  3UXN A;  4RWP A;  4X4R A;  4YD2 A;  9ICO A;  2ZHB A;  4QZD A;  1TV9 A;  1VJ7 A;  2PXI A;  1ZQB A;  4R64 A;  8ICA A;  4I29 A;  2PFP A;  3C2K A;  4FH5 A;  1ZQM A;  4NKT A;  5IIO A;  5D46 A;  3B0Y A;  5J2I A;  3AQM A;  1ZQZ A;  1WOT A;  9ICG A;  8ICB A;  2BCQ A;  7ICS A;  4UD5 A;  3TFR A;  4F5N A;  4KLD A;  4X0B A;  7ICF A;  4M9G A;  4DOC A;  4KLI A;  1RPL A;  2ZH8 A;  4GXJ A;  1NOM A;  1MIW A;  4AT7 B;  5DB6 A;  4FO6 A;  1BPE A;  1ZQN A;  4M0A A;  4WBZ A;  3JPR A;  4AT9 B;  3RH4 A;  8ICH A;  1V4A A;  4YMO A;  5J2B A;  5J2H A;  4YMN A;  3AU2 A;  4X0A A;  3HIY A;  4LZD A;  8ICT A;  3AUO A;  3NYB A;  4X4N A;  3MGH A;  2BCS A;  2M2V A;  1R8A A;  4UBB A;  4NXZ A;  5BOL A;  2ZHA A;  4KLF A;  1YLQ A;  8ICQ A;  1ZQY A;  1OU5 A;  4M47 A;  9ICU A;  4PHD A;  4X5V A;  4MFC A;  1NO5 A;  4QZ8 A;  3RJK A;  2ZH7 A;  4TUQ A;  3RH6 A;  4NKU A;  7ICO A;  5DBC A;  3V7L A;  7ICJ A;  2M2U A;  3LQC B;  4RT3 A;  8ICN A;  8ICS A;  8ICY A;  3OUY B;  5DDY A;  3UQ2 A;  2O1P A;  1ZQI A;  4X4O A;  4M04 A;  4I2B A;  3JYY A;  3WFS C;  4O9M A;  1HUO A;  2GWS A;  3WFP A;  2DR7 A;  8ICI A;  4RQ7 A;  4UAW A;  4M9L A;  4KLQ A;  5J2C A;  4WC6 A;  4Z6E A;  4UAY A;  9ICM A;  5DDM A;  3PNC A;  7ICV A;  4UD4 A;  8ICR A;  5DKW A;  4QZA A;  3AQL A;  5HR9 A;  3RJJ A;  1ZQC A;  3C2M A;  4F5P A;  4I2A A;  4RPZ A;  7ICK A;  4O5K A;  3JPT A;  1HUZ A;  3OVS A;  5J0U A;  4F5R A;  2BPF A;  4GXK A;  2ZH3 A;  4X4T A;  8ICV A;  1RZT A;  2ZH6 A;  4K4G A;  5CR0 A;  4QZE A;  4RPY A;  5CHG A;  4KLS A;  1MIY A;  7ICI A;  5HRD A;  5DBB A;  4ATB A;  4I2I A;  3HWT A;  4RT2 A;  4NLN A;  5IIJ A;  2DR5 A;  3JPN A;  4FHW A;  5IIM A;  1XSN A;  2I9G A;  4WC0 A;  2DR8 A;  9ICA A;  3LK9 A;  3JPS A;  3H39 A;  3OGU A;  4M9N A;  8ICE A;  9ICR A;  7ICG A;  5J2E A;  4IQT A;  4UB3 A;  7ICN A;  4WC1 A;  1VFG A;  1MIV A;  4PHE A;  2P66 A;  4DOB A;  5DED A;  4F5Q A;  1UEV A;  5DB9 A;  4FHP A;  5HC9 A;  7ICL A;  4EP7 A;  4M9H A;  7ICP A;  4R66 A;  1ZQE A;  2M2T A;  5J0O A;  4KLT A;  4WCW A;  4RQ5 A;  3V7K A;  9ICK A;  5D4B A;  5J2F A;  1TVA A;  8ICU A;  5J0R A;  9ICF A;  1BPX A;  2PFQ A;  4FHV A;  2HHP A;  1ZQF A;  5HRE A;  4XUS A;  5IIK A;  1KNY A;  1UEU A;  2ZH2 A;  5HRK A;  3JPQ A;  3V72 A;  4NM1 A;  8ICZ A;  2M2W A;  8ICK A;  4TUP A;  3RJI A;  4UB5 A;  2DRB A;  4P4O A;  1ZQW A;  1ZQT A;  3K75 D;  1R8C A;  5J2K A;  1ZQH A;  5J0S A;  5J2A A;  3RJH A;  9ICB A;  4P4M A;  4K4I A;  4MFA A;  9ICS A;  4AT8 B;  5DB7 A;  3PMN A;  1Q79 A;  3H37 A;  1ZJN A;  4GXI A;  4K4H A;  2PFO A;  4I27 A;  4UB2 A;  4M5D A;  1UET A;  4UB4 A;  3AQK A;  7ICE A;  5TZV A;  4PHP A;  5HRF A;  2ZH4 A;  1R89 A;  4PGQ A;  4UB1 A;  3WFQ E;  1BPY A;  5HRL A;  2BE3 A;  8ICC A;  1BPZ A;  5DB8 A;  4EBK A;  5HHH A;  2BPG A;  2BPC A;  2FMQ A;  4JWM A;  7ICM A;  2DR9 A;  4KLM A;  2Q66 A;  3RH5 A;  5J0X A;  5J0W A;  4UBC A;  4RQ8 A;  3H3A A;  2ZH1 A;  1KDH A;  3H38 A;  2ID1 A;  9ICT A;  4RWQ A;  2BCV A;  3JPP A;  4UAZ A;  3C5F A;  1ZQV A;  3HJ1 A;  5HRH A;  3HJ4 A;  2DVI A;  1ZQO A;  4I2G A;  1ZQK A;  4PH5 A;  3UPS A;  4LZG A;  1ZQR A;  4E8F A;  1JAJ A;  4PGY A;  9ICJ A;  9ICX A;  4Z6D A;  4RQ2 A;  9ICH A;  3RJE A;  5CJ7 A;  5IIN A;  4I28 A;  4IQU A;  5J0P A;  8ICO A;  3MDC A;  8ICP A;  1ZQJ A;  4X4Q A;  4E80 A;  4I2J A;  1KEJ A;  9ICC A;  1JQR A;  4AT9 A;  4WC5 A;  4I2C A;  4QZ9 A;  3OV7 A;  4NLK A;  2W9M A;  4RQ4 A;  5D49 A;  4LT6 A;  2PBE A;  4KLO A;  3AU6 A;  4I2D A;  2FMP A;  3UXP A;  4FHX A;  5DBA A;  1FA0 A;  4NLZ A;  5J2D A;  4PHA A;  4S3N A;  4RWN A;  3ISC A;  3ISB A;  5J0Y A; 
#chains in the Genus database with same CATH topology
 3OUY A;  7ICT A;  2NRK A;  4TUR A;  5D62 A;  1ZQD A;  4RQ0 A;  2O5A A;  3OVA A;  4IG8 A;  4R65 A;  2ZH5 A;  4MF8 A;  3C66 A;  3MGI A;  4EBJ A;  4MFF A;  1JN3 A;  3HW8 A;  4RPX A;  4X4U A;  1R8B A;  4Z6F A;  5HRB A;  4DOA A;  3NKU A;  1MQ3 A;  3RJG A;  9ICL A;  7ICQ A;  4JWN A;  4P2H A;  2HN1 A;  3PHZ A;  3UXO A;  3L9D A;  1ZQQ A;  4QZH A;  4LEY A;  4WC7 A;  4M9J A;  3TFS A;  5IIL A;  1XSL A;  8ICJ A;  2HN2 A;  2ZH9 A;  4ATB B;  4QZI A;  4KLU A;  5J2G A;  5CFS A;  4NM2 A;  4TUS A;  4R63 A;  3UQ0 A;  7ICH A;  5CHE A;  4M2Y A;  3UPQ A;  3GDX A;  3ER8 C;  4IQW A;  1ZQX A;  4MKP A;  2FMS A;  4YN4 A;  3JZ0 A;  4LVS A;  4F5O A;  3ISD A;  4PPX A;  1ZQP A;  4I2H A;  5F2V O;  5BOM A;  1ZQA A;  4WC4 A;  4YD1 A;  2BCU A;  4FHY A;  4QZB A;  4O6A A;  3V7J A;  1TFW A;  3AQN A;  1BPB A;  8ICF A;  4XJE A;  3MDA A;  3WFR E;  9ICE A;  4P4P A;  4E7X A;  3K7D A;  3JPO A;  4FH3 A;  1BPD A;  4WH5 A;  3MBY A;  4DO9 A;  1ZQL A;  4O5C A;  4YCX A;  3C5G A;  2ISO A;  4RQ6 A;  4X4V A;  4XQ8 A;  5III A;  4O5E A;  5J0Q A;  4WBY A;  9ICI A;  1F5A A;  1PX5 A;  4RWO A;  1MQ2 A;  4KLJ A;  7ICR A;  5HRI A;  5CWR A;  2BBJ A;  1ZQU A;  4KLH A;  1JMS A;  4JLX A;  7ICU A;  4OAG A;  2BCR A;  5CB1 A;  8ICG A;  8ICX A;  1Q78 A;  4QZC A;  3PML A;  9ICW A;  4NXV A;  4K96 A;  4I2F A;  4MF2 A;  8ICW A;  5HRG A;  3MCR A;  8ICL A;  4AT7 A;  3HX0 A;  4X4P A;  1ZQS A;  3JCF A;  4RQ1 A;  3C18 A;  4PGX A;  4XQ7 A;  1ZJM A;  2PFN A;  4XA5 A;  2IHM A;  2RFF A;  4RQ3 A;  4AT8 A;  4NY8 A;  3C2L A;  5J2J A;  2EWR A;  5BPC A;  1ZQG A;  2ISP A;  5CA7 A;  5J0T A;  1TFY A;  1XSP A;  2VAN A;  4YMM A;  4KLL A;  4QZG A;  4KLG A;  8ICM A;  4XRH A;  4IQV A;  5EOZ A;  4KLE A;  9ICQ A;  4I2E A;  2DRA A;  3OVB A;  4K98 A;  9ICV A;  3RJF A;  9ICN A;  3B0X A;  5DEC A;  4HX0 A;  4WC3 A;  9ICP A;  4Z6C A;  5HHI A;  4WC2 A;  3WFO A;  4X4S A;  5J29 A;  4O67 A;  4QZF A;  4LEZ A;  5CP2 A;  3UXN A;  4RWP A;  4X4R A;  4YD2 A;  9ICO A;  4KB6 A;  2ZHB A;  4QZD A;  4LEV A;  1TV9 A;  1VJ7 A;  2PXI A;  1ZQB A;  4R64 A;  8ICA A;  4I29 A;  2PFP A;  3C2K A;  4FH5 A;  1ZQM A;  4NKT A;  5IIO A;  5D46 A;  3B0Y A;  5J2I A;  3AQM A;  1ZQZ A;  1WOT A;  9ICG A;  8ICB A;  2BCQ A;  7ICS A;  4UD5 A;  3TFR A;  4F5N A;  4KLD A;  4X0B A;  7ICF A;  4M9G A;  4DOC A;  4O69 A;  4KLI A;  1RPL A;  2ZH8 A;  4GXJ A;  1NOM A;  1MIW A;  4AT7 B;  5DB6 A;  4FO6 A;  1BPE A;  2IHO A;  1ZQN A;  4M0A A;  4WBZ A;  3NWI A;  3JPR A;  4AT9 B;  3RH4 A;  8ICH A;  2FCL A;  1V4A A;  4YMO A;  5J2B A;  5J2H A;  4YMN A;  3AU2 A;  4FO1 A;  4X0A A;  3HIY A;  4LZD A;  8ICT A;  3AUO A;  3NYB A;  4X4N A;  3MGH A;  2GA9 D;  2BCS A;  2M2V A;  1R8A A;  4UBB A;  4NXZ A;  5BOL A;  2ZHA A;  4KLF A;  1YLQ A;  8ICQ A;  1ZQY A;  1OU5 A;  4M47 A;  9ICU A;  4PHD A;  4X5V A;  4MFC A;  1NO5 A;  4QZ8 A;  3RJK A;  2ZH7 A;  4TUQ A;  3RH6 A;  4NKU A;  7ICO A;  5DBC A;  3V7L A;  7ICJ A;  2M2U A;  2IUB A;  3LQC B;  4RT3 A;  8ICN A;  8ICS A;  8ICY A;  4EGW A;  3OUY B;  5DDY A;  3UQ2 A;  2O1P A;  1ZQI A;  4X4O A;  4M04 A;  4LEW A;  4I2B A;  3JYY A;  3WFS C;  4O9M A;  1HUO A;  2GWS A;  3WFP A;  2DR7 A;  8ICI A;  4OAH A;  4RQ7 A;  4UAW A;  3ER9 B;  4M9L A;  4K9A A;  5J2C A;  4KLQ A;  4WC6 A;  2B51 A;  4Z6E A;  4UAY A;  9ICM A;  5DDM A;  3PNC A;  7ICV A;  4UD4 A;  4WQL A;  8ICR A;  5DKW A;  4QZA A;  3AQL A;  5HR9 A;  3RJJ A;  1ZQC A;  3C2M A;  4F5P A;  4I2A A;  4RPZ A;  7ICK A;  4O5K A;  3JPT A;  1HUZ A;  3OVS A;  5J0U A;  4F5R A;  4OAF A;  2BPF A;  4NXX A;  4GXK A;  2ZH3 A;  4X4T A;  8ICV A;  1RZT A;  2ZH6 A;  4K4G A;  5CR0 A;  4QZE A;  4RPY A;  5CHG A;  4KLS A;  4JLZ A;  1MIY A;  7ICI A;  5HRD A;  5DBB A;  4ATB A;  4I2I A;  3HWT A;  4RT2 A;  4NLN A;  5IIJ A;  2DR5 A;  3JPN A;  4FHW A;  5IIM A;  3EF2 A;  1XSN A;  2I9G A;  2BBH A;  4WC0 A;  2DR8 A;  9ICA A;  3LK9 A;  3JPS A;  5CFU A;  3H39 A;  3OGU A;  4M9N A;  8ICE A;  9ICR A;  7ICG A;  5J2E A;  4IQT A;  4UB3 A;  7ICN A;  4WC1 A;  1VFG A;  1MIV A;  4PHE A;  2P66 A;  4DOB A;  5DED A;  4F5Q A;  1UEV A;  5DB9 A;  3OWG A;  4FHP A;  5HC9 A;  7ICL A;  5D63 A;  4EP7 A;  4M9H A;  7ICP A;  4R66 A;  4O68 A;  2M2T A;  1ZQE A;  5J0O A;  2B56 A;  4KLT A;  4WCW A;  4RQ5 A;  3V7K A;  9ICK A;  5D4B A;  5J2F A;  1TVA A;  8ICU A;  4K8V A;  5J0R A;  9ICF A;  1BPX A;  2PFQ A;  4FHV A;  2HHP A;  1ZQF A;  5HRE A;  4XUS A;  5IIK A;  1KNY A;  1UEU A;  2ZH2 A;  5HRK A;  3JPQ A;  4EV6 A;  3V72 A;  4NM1 A;  8ICZ A;  2M2W A;  5B3P A;  8ICK A;  4TUP A;  3RJI A;  4UB5 A;  2DRB A;  4P4O A;  1ZQW A;  4NXU A;  1ZQT A;  3K75 D;  1R8C A;  4NXT A;  4EED A;  5J2K A;  1ZQH A;  5J0S A;  5J2A A;  3RJH A;  9ICB A;  4P4M A;  4K4I A;  5CFT A;  4MFA A;  9ICS A;  4AT8 B;  5DB7 A;  1Q79 A;  3PMN A;  3H37 A;  1ZJN A;  4GXI A;  4K4H A;  2PFO A;  4I27 A;  4I0U A;  4UB2 A;  4M5D A;  2GAF D;  1UET A;  4UB4 A;  4NXW A;  3AQK A;  7ICE A;  5TZV A;  1GPJ A;  4PHP A;  5HRF A;  2ZH4 A;  1R89 A;  4PGQ A;  4UB1 A;  3WFQ E;  1BPY A;  5HRL A;  2BE3 A;  8ICC A;  1BPZ A;  5DB8 A;  3NVO A;  4EBK A;  5HHH A;  2BPG A;  2BPC A;  2FMQ A;  4JWM A;  7ICM A;  2DR9 A;  4KLM A;  2Q66 A;  3RH5 A;  5J0X A;  5J0W A;  4UBC A;  4RQ8 A;  3H3A A;  2ZH1 A;  5D61 A;  1KDH A;  3H38 A;  2ID1 A;  9ICT A;  4RWQ A;  5B3Q A;  2BCV A;  3JPP A;  4UAZ A;  3C5F A;  1ZQV A;  4N7R A;  3HJ1 A;  4WOY A;  5HRH A;  3HJ4 A;  4KM5 A;  2DVI A;  1ZQO A;  4I2G A;  1ZQK A;  4PH5 A;  3UPS A;  4LZG A;  1ZQR A;  4E8F A;  1JAJ A;  4PGY A;  9ICJ A;  9ICX A;  4Z6D A;  4RQ2 A;  9ICH A;  3RJE A;  5CJ7 A;  5IIN A;  4I28 A;  4IQU A;  5J0P A;  8ICO A;  3MDC A;  8ICP A;  1ZQJ A;  4EEB A;  4X4Q A;  4E80 A;  4I2J A;  1KEJ A;  9ICC A;  1JQR A;  4AT9 A;  4WC5 A;  4I2C A;  4K9B A;  4QZ9 A;  5JTG A;  3OV7 A;  4NLK A;  2W9M A;  4RQ4 A;  5D49 A;  3ERC C;  4K99 A;  4LT6 A;  2PBE A;  4KLO A;  3AU6 A;  4I2D A;  2FMP A;  3CK6 A;  3UXP A;  2B4V A;  4FHX A;  5DBA A;  1FA0 A;  4WQK A;  4NLZ A;  5J2D A;  4PHA A;  4S3N A;  4RWN A;  3ISC A;  4K97 A;  3ISB A;  4OAI Z;  5J0Y A; 
#chains in the Genus database with same CATH homology
 3OUY A;  7ICT A;  2NRK A;  4TUR A;  1ZQD A;  4RQ0 A;  3OVA A;  2O5A A;  4IG8 A;  4R65 A;  2ZH5 A;  4MF8 A;  3C66 A;  3MGI A;  4EBJ A;  4MFF A;  1JN3 A;  3HW8 A;  4RPX A;  4X4U A;  1R8B A;  4Z6F A;  5HRB A;  4DOA A;  1MQ3 A;  3RJG A;  9ICL A;  7ICQ A;  4JWN A;  4P2H A;  3UXO A;  3L9D A;  1ZQQ A;  4QZH A;  4WC7 A;  4M9J A;  3TFS A;  5IIL A;  1XSL A;  8ICJ A;  2ZH9 A;  4ATB B;  4QZI A;  4KLU A;  5J2G A;  4NM2 A;  4TUS A;  4R63 A;  3UQ0 A;  7ICH A;  4M2Y A;  3UPQ A;  3GDX A;  4IQW A;  1ZQX A;  2FMS A;  4YN4 A;  3JZ0 A;  4LVS A;  4F5O A;  3ISD A;  4PPX A;  1ZQP A;  4I2H A;  5F2V O;  5BOM A;  1ZQA A;  4WC4 A;  4YD1 A;  2BCU A;  4FHY A;  4QZB A;  3V7J A;  1TFW A;  3AQN A;  1BPB A;  8ICF A;  3MDA A;  3WFR E;  9ICE A;  4P4P A;  4E7X A;  3JPO A;  4FH3 A;  1BPD A;  4DO9 A;  3MBY A;  1ZQL A;  4O5C A;  4YCX A;  3C5G A;  2ISO A;  4RQ6 A;  4X4V A;  4XQ8 A;  5III A;  4O5E A;  5J0Q A;  4WBY A;  9ICI A;  1F5A A;  1PX5 A;  4RWO A;  1MQ2 A;  4KLJ A;  7ICR A;  5HRI A;  5CWR A;  1ZQU A;  4KLH A;  1JMS A;  7ICU A;  2BCR A;  5CB1 A;  8ICG A;  8ICX A;  1Q78 A;  4QZC A;  3PML A;  9ICW A;  4I2F A;  4MF2 A;  8ICW A;  5HRG A;  8ICL A;  4AT7 A;  3HX0 A;  4X4P A;  1ZQS A;  4RQ1 A;  3C18 A;  4PGX A;  4XQ7 A;  1ZJM A;  2PFN A;  4XA5 A;  2IHM A;  2RFF A;  4RQ3 A;  4AT8 A;  4NY8 A;  3C2L A;  5J2J A;  5BPC A;  1ZQG A;  2ISP A;  5CA7 A;  5J0T A;  1TFY A;  1XSP A;  2VAN A;  4YMM A;  4KLL A;  4QZG A;  4KLG A;  8ICM A;  4XRH A;  4IQV A;  5EOZ A;  4KLE A;  9ICQ A;  4I2E A;  2DRA A;  3OVB A;  9ICV A;  3RJF A;  9ICN A;  3B0X A;  5DEC A;  4WC3 A;  9ICP A;  4Z6C A;  5HHI A;  4WC2 A;  3WFO A;  4X4S A;  5J29 A;  4QZF A;  5CP2 A;  3UXN A;  4RWP A;  4X4R A;  4YD2 A;  9ICO A;  2ZHB A;  4QZD A;  1TV9 A;  1VJ7 A;  2PXI A;  1ZQB A;  4R64 A;  8ICA A;  4I29 A;  2PFP A;  3C2K A;  4FH5 A;  1ZQM A;  4NKT A;  5IIO A;  5D46 A;  3B0Y A;  5J2I A;  3AQM A;  1ZQZ A;  1WOT A;  9ICG A;  8ICB A;  2BCQ A;  7ICS A;  4UD5 A;  3TFR A;  4F5N A;  4KLD A;  4X0B A;  7ICF A;  4M9G A;  4DOC A;  4KLI A;  1RPL A;  2ZH8 A;  4GXJ A;  1NOM A;  1MIW A;  4AT7 B;  5DB6 A;  4FO6 A;  1BPE A;  1ZQN A;  4M0A A;  4WBZ A;  3JPR A;  4AT9 B;  3RH4 A;  8ICH A;  1V4A A;  4YMO A;  5J2B A;  5J2H A;  4YMN A;  3AU2 A;  4X0A A;  3HIY A;  4LZD A;  8ICT A;  3AUO A;  3NYB A;  4X4N A;  3MGH A;  2BCS A;  2M2V A;  1R8A A;  4UBB A;  4NXZ A;  5BOL A;  2ZHA A;  4KLF A;  1YLQ A;  8ICQ A;  1ZQY A;  1OU5 A;  4M47 A;  9ICU A;  4PHD A;  4X5V A;  4MFC A;  1NO5 A;  4QZ8 A;  3RJK A;  2ZH7 A;  4TUQ A;  3RH6 A;  4NKU A;  7ICO A;  5DBC A;  3V7L A;  7ICJ A;  2M2U A;  3LQC B;  4RT3 A;  8ICN A;  8ICS A;  8ICY A;  3OUY B;  5DDY A;  3UQ2 A;  2O1P A;  1ZQI A;  4X4O A;  4M04 A;  4I2B A;  3JYY A;  3WFS C;  4O9M A;  1HUO A;  2GWS A;  3WFP A;  2DR7 A;  8ICI A;  4RQ7 A;  4UAW A;  4M9L A;  4KLQ A;  5J2C A;  4WC6 A;  4Z6E A;  4UAY A;  9ICM A;  5DDM A;  3PNC A;  7ICV A;  4UD4 A;  8ICR A;  5DKW A;  4QZA A;  3AQL A;  5HR9 A;  3RJJ A;  1ZQC A;  3C2M A;  4F5P A;  4I2A A;  4RPZ A;  7ICK A;  4O5K A;  3JPT A;  1HUZ A;  3OVS A;  5J0U A;  4F5R A;  2BPF A;  4GXK A;  2ZH3 A;  4X4T A;  8ICV A;  1RZT A;  2ZH6 A;  4K4G A;  5CR0 A;  4QZE A;  4RPY A;  5CHG A;  4KLS A;  1MIY A;  7ICI A;  5HRD A;  5DBB A;  4ATB A;  4I2I A;  3HWT A;  4RT2 A;  4NLN A;  5IIJ A;  2DR5 A;  3JPN A;  4FHW A;  5IIM A;  1XSN A;  2I9G A;  4WC0 A;  2DR8 A;  9ICA A;  3LK9 A;  3JPS A;  3H39 A;  3OGU A;  4M9N A;  8ICE A;  9ICR A;  7ICG A;  5J2E A;  4IQT A;  4UB3 A;  7ICN A;  4WC1 A;  1VFG A;  1MIV A;  4PHE A;  2P66 A;  4DOB A;  5DED A;  4F5Q A;  1UEV A;  5DB9 A;  4FHP A;  5HC9 A;  7ICL A;  4EP7 A;  4M9H A;  7ICP A;  4R66 A;  1ZQE A;  2M2T A;  5J0O A;  4KLT A;  4WCW A;  4RQ5 A;  3V7K A;  9ICK A;  5D4B A;  5J2F A;  1TVA A;  8ICU A;  5J0R A;  9ICF A;  1BPX A;  2PFQ A;  4FHV A;  2HHP A;  1ZQF A;  5HRE A;  4XUS A;  5IIK A;  1KNY A;  1UEU A;  2ZH2 A;  5HRK A;  3JPQ A;  3V72 A;  4NM1 A;  8ICZ A;  2M2W A;  8ICK A;  4TUP A;  3RJI A;  4UB5 A;  2DRB A;  4P4O A;  1ZQW A;  1ZQT A;  3K75 D;  1R8C A;  5J2K A;  1ZQH A;  5J0S A;  5J2A A;  3RJH A;  9ICB A;  4P4M A;  4K4I A;  4MFA A;  9ICS A;  4AT8 B;  5DB7 A;  3PMN A;  1Q79 A;  3H37 A;  1ZJN A;  4GXI A;  4K4H A;  2PFO A;  4I27 A;  4UB2 A;  4M5D A;  1UET A;  4UB4 A;  3AQK A;  7ICE A;  5TZV A;  4PHP A;  5HRF A;  2ZH4 A;  1R89 A;  4PGQ A;  4UB1 A;  3WFQ E;  1BPY A;  5HRL A;  2BE3 A;  8ICC A;  1BPZ A;  5DB8 A;  4EBK A;  5HHH A;  2BPG A;  2BPC A;  2FMQ A;  4JWM A;  7ICM A;  2DR9 A;  4KLM A;  2Q66 A;  3RH5 A;  5J0X A;  5J0W A;  4UBC A;  4RQ8 A;  3H3A A;  2ZH1 A;  1KDH A;  3H38 A;  2ID1 A;  9ICT A;  4RWQ A;  2BCV A;  3JPP A;  4UAZ A;  3C5F A;  1ZQV A;  3HJ1 A;  5HRH A;  3HJ4 A;  2DVI A;  1ZQO A;  4I2G A;  1ZQK A;  4PH5 A;  3UPS A;  4LZG A;  1ZQR A;  4E8F A;  1JAJ A;  4PGY A;  9ICJ A;  9ICX A;  4Z6D A;  4RQ2 A;  9ICH A;  3RJE A;  5CJ7 A;  5IIN A;  4I28 A;  4IQU A;  5J0P A;  8ICO A;  3MDC A;  8ICP A;  1ZQJ A;  4X4Q A;  4E80 A;  4I2J A;  1KEJ A;  9ICC A;  1JQR A;  4AT9 A;  4WC5 A;  4I2C A;  4QZ9 A;  3OV7 A;  4NLK A;  2W9M A;  4RQ4 A;  5D49 A;  4LT6 A;  2PBE A;  4KLO A;  3AU6 A;  4I2D A;  2FMP A;  3UXP A;  4FHX A;  5DBA A;  1FA0 A;  4NLZ A;  5J2D A;  4PHA A;  4S3N A;  4RWN A;  3ISC A;  3ISB A;  5J0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...