4WBZA

Trna-processing enzyme (apo form 2)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 106
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wbzA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wbzA01
9ICEA 4DO9A 4KLJA 3JZ0A 8ICHA 4RPXA 3JPRA 1ZQAA 1MIYA 3HWTA 4UBCA 8ICQA 3K75D 4XRHA 1ZQVA 4O5CA 5HHHA 9ICNA 3AU6A 4RQ3A 2DR8A 2BPGA 4WC1A 3V7LA 5J0TA 8ICEA 5HRGA 4NY8A 8ICUA 4KLUA 3JPTA 4M0AA 4M9GA 5CR0A 5J2EA 9ICRA 2ISPA 5TZVA 4P4PA 3PMLA 2ID1A 3AQMA 4R66A 2Q66A 3RJJA 9ICVA 7ICRA 2PFPA 4EBKA 2W9MA 3C2MA 4M5DA 4E7XA 8ICOA 4YMNA 1ZQRA 1ZQLA 1JN3A 2ISOA 4O5EA 4M9NA 1ZQYA 5J29A 5J2KA 2ZH8A 4XQ8A 8ICIA 4X4NA 5IIMA 1XSLA 4K4GA 5BOMA 9ICAA 2BCUA 9ICKA 5HRKA 4JWNA 2O5AA 1HUOA 5CWRA 3RJFA 5D4BA 2ZH1A 3JYYA 4QZAA 3RH4A 5J2BA 8ICWA 4UAYA 4RWNA 3UPQA 4F5PA 9ICWA 3AUOA 1ZJNA 7ICHA 2DRBA 4QZCA 1MQ2A 3TFRA 4UB4A 1XSNA 4I2BA 9ICJA 4PHPA 1YLQA 7ICQA 5DB6A 9ICSA 4E8FA 4R64A 4RQ6A 4MFAA 8ICGA 9ICMA 3RJEA 4TUSA 4FHPA 4P2HA 3WFQE 4Z6DA 5J2DA 1FA0A 4JWMA 4MFFA 1TV9A 4WCWA 9ICFA 4WBYA 3OV7A 4F5OA 2BE3A 4MFCA 1F5AA 3JPOA 4QZGA 3WFSC 4AT9A 4K4HA 4FHWA 4KLMA 4WBZA 5CA7A 1KEJA 4O5KA 2VANA 9ICIA 5DECA 4EP7A 5HRBA 4KLTA 7ICGA 5DBBA 4XQ7A 4RPZA 4GXIA 4X5VA 4X4SA 8ICCA 3UQ2A 3JPNA 4I2JA 2I9GA 4UB1A 4PGXA 5IILA 4FHYA 1UETA 7ICKA 2PFNA 2NRKA 4KLFA 1R8BA 5HRFA 3H37A 1Q79A 5J0RA 9ICCA 4IG8A 5CJ7A 4X4OA 3MGHA 4KLIA 3PMNA 1BPXA 1V4AA 3AQNA 5D46A 4UB3A 3C2KA 1ZQNA 4IQVA 4RQ5A 1TVAA 1ZQIA 4F5NA 4FO6A 3UXPA 3RJKA 4Z6EA 5HRHA 7ICTA 4X4RA 4YD1A 3OGUA 7ICLA 2DR5A 1ZQBA 4I28A 4WC5A 5DBCA 4UBBA 4F5QA 4GXKA 1ZQEA 5J2CA 1JAJA 4UB5A 2PFQA 8ICVA 4PHAA 3H3AA 4PPXA 2P66A 4QZIA 1WOTA 4X4TA 4M9HA 5J2JA 3TFSA 4M04A 1NO5A 4RQ1A 5J0QA 1ZQMA 1BPDA 1ZQUA 4RPYA 3JPPA 2ZH5A 2BCRA 4WC0A 3WFOA 4DOBA 3UQ0A 1BPBA 7ICUA 7ICVA 1R8CA 4Z6CA 3V72A 4X0AA 4AT9B 5J0YA 3MDAA 2M2WA 5HHIA 4LZGA 4PGYA 1ZQSA 1ZQPA 9ICTA 3UXNA 4NKTA 4LT6A 2PFOA 4UAZA 2PBEA 4PHDA 3MBYA 2DR7A 4WC2A 4MF2A 2ZHBA 4LZDA 7ICSA 2ZH3A 5IINA 1RPLA 4RQ7A 3RJIA 4QZ9A 3RH5A 4XUSA 3AU2A 2BCSA 2BPFA 4E80A 9ICHA 4YCXA 4KLLA 3C5GA 4P4OA 3H38A 4DOCA 4RWPA 4X4UA 4I27A 3C5FA 2RFFA 4RT3A 4AT8A 4KLGA 1RZTA 1TFYA 1UEUA 4NLKA 3HIYA 4I2HA 4AT7B 5F2VO 4UAWA 3MGIA 3RJHA 3C66A 3OVSA 4I2GA 4FHVA 3C2LA 2ZH9A 5J0XA 4QZBA 2ZH4A 5DB7A 8ICAA 5EOZA 2PXIA 5J2HA 4IQTA 9ICPA 7ICFA 3V7KA 9ICUA 4KLEA 3V7JA 5HREA 4KLSA 2M2UA 8ICZA 4ATBA 3ISDA 4NKUA 9ICLA 4KLHA 3B0YA 4NM2A 4P4MA 2ZH2A 1HUZA 1BPEA 3HX0A 1PX5A 2ZHAA 1BPYA 5CB1A 4NLNA 4RQ0A 5DBAA 8ICSA 4NXZA 5DB8A 4FHXA 5CHGA 4I2AA 8ICBA 8ICKA 5J0OA 3PNCA 8ICRA 1MIWA 2FMPA 7ICNA 5HR9A 1MIVA 5J2GA 4WC4A 3C18A 4AT7A 7ICJA 2DVIA 1ZQHA 4UD5A 4TUQA 4PHEA 8ICPA 1ZQDA 4R63A 3OUYA 1BPZA 5DKWA 4WC7A 4Z6FA 4M47A 3B0XA 4YN4A 3ISCA 3NYBA 7ICPA 2O1PA 5BPCA 8ICFA 1UEVA 2GWSA 4AT8B 3GDXA 4QZFA 3ISBA 5J0PA 1R89A 1R8AA 4TUPA 5J2IA 3UPSA 4DOAA 3H39A 8ICTA 3RH6A 4MF8A 8ICLA 4RQ4A 1ZJMA 4X4PA 2ZH6A 2BPCA 5HRLA 4X4QA 3LQCB 4QZDA 3JPSA 1ZQJA 2IHMA 4FH3A 1ZQXA 1VFGA 9ICQA 5HRDA 2DR9A 4O9MA 3OVBA 4ATBB 1ZQOA 2BCQA 1OU5A 2FMSA 5J0UA 4LVSA 5IIKA 4TURA 1ZQGA 1VJ7A 4I2EA 7ICOA 1Q78A 4FH5A 9ICBA 4PH5A 2DRAA 1MQ3A 4X0BA 2HHPA 3WFRE 4I2DA 8ICJA 1ZQQA 8ICNA 4I2CA 5J0SA 5J2AA 4WC3A 2M2TA 5DB9A 4YD2A 4QZ8A 4GXJA 3AQLA 4I2FA 4YMMA 4KLDA 4RQ8A 1ZQKA 1JQRA 5IIJA 5HC9A 4RT2A 2BCVA 4M9JA 4XA5A 1KDHA 3WFPA 7ICMA 3OVAA 4I29A 4QZEA 3MDCA 4RWQA 1ZQFA 7ICEA 1XSPA 2M2VA 4WC6A 4X4VA 4IQWA 3HW8A 5HRIA 5DDMA 8ICYA 3OUYB 5J2FA 3JPQA 4KLQA 1ZQWA 4I2IA 4UB2A 5DDYA 3AQKA 4UD4A 4R65A 8ICXA 4F5RA 5DEDA 5J0WA 3L9DA 9ICOA 4M9LA 2ZH7A 3HJ1A 3LK9A 4S3NA 4RWOA 4KLOA 9ICGA 1ZQTA 1ZQZA 1NOMA 9ICXA 4QZHA 3HJ4A 5D49A 3UXOA 4IQUA 5IIIA 5BOLA 4M2YA 8ICMA 4PGQA 1TFWA 4K4IA 7ICIA 4YMOA 5CP2A 1ZQCA 1KNYA 4RQ2A 5IIOA 4NLZA 2FMQA 4EBJA 3RJGA 4NM1A 1JMSA
chains in the Genus database with same CATH superfamily
9ICEA 3NKUA 4DO9A 4KLJA 3JZ0A 8ICHA 4RPXA 3JPRA 1ZQAA 1MIYA 3HWTA 4UBCA 8ICQA 4NXXA 3K75D 4XRHA 1ZQVA 4O5CA 5HHHA 9ICNA 4K98A 3AU6A 4RQ3A 2DR8A 2BPGA 1GPJA 4WC1A 3V7LA 5J0TA 8ICEA 5HRGA 4NY8A 8ICUA 4HX0A 4KLUA 3JPTA 4M0AA 4M9GA 5CR0A 5J2EA 9ICRA 2ISPA 5TZVA 4P4PA 3PMLA 2ID1A 3AQMA 4LEYA 4R66A 2Q66A 3RJJA 9ICVA 7ICRA 2PFPA 4EBKA 4K99A 2W9MA 3C2MA 4M5DA 4E7XA 2HN2A 8ICOA 4YMNA 1ZQRA 4K96A 4MKPA 1JN3A 1ZQLA 2ISOA 5B3QA 4M9NA 4O5EA 1ZQYA 2BBJA 3NWIA 5J29A 5J2KA 2ZH8A 4XQ8A 8ICIA 4X4NA 5IIMA 1XSLA 4K4GA 5BOMA 9ICAA 2BCUA 9ICKA 5HRKA 4JWNA 2GA9D 2O5AA 1HUOA 5CWRA 3RJFA 4I0UA 5D4BA 2ZH1A 3JYYA 4QZAA 3RH4A 5J2BA 8ICWA 4UAYA 4RWNA 3UPQA 4O68A 4F5PA 5B3PA 9ICWA 4FO1A 3AUOA 1ZJNA 7ICHA 2DRBA 4LEVA 4QZCA 1MQ2A 3TFRA 4UB4A 3MCRA 1XSNA 4I2BA 4PHPA 1YLQA 9ICJA 7ICQA 5DB6A 9ICSA 2IHOA 4E8FA 4R64A 4RQ6A 4MFAA 5CFUA 8ICGA 9ICMA 3RJEA 4TUSA 4FHPA 4P2HA 3WFQE 4Z6DA 4WOYA 1FA0A 5J2DA 3PHZA 3JCFA 4JWMA 4MFFA 1TV9A 4WCWA 9ICFA 4WBYA 2EWRA 3OV7A 4F5OA 2BE3A 4MFCA 1F5AA 3JPOA 4QZGA 3ER9B 3WFSC 4AT9A 4K4HA 4FHWA 4KLMA 4WBZA 5CA7A 1KEJA 4O5KA 2B51A 2VANA 9ICIA 5DECA 4EP7A 5HRBA 4KLTA 7ICGA 5DBBA 4XQ7A 4RPZA 4GXIA 4X5VA 2FCLA 4X4SA 8ICCA 3UQ2A 3JPNA 4I2JA 2I9GA 4UB1A 4K97A 4PGXA 5IILA 4FHYA 1UETA 7ICKA 2PFNA 2NRKA 4KLFA 1R8BA 5HRFA 3H37A 1Q79A 5J0RA 9ICCA 4IG8A 5CJ7A 4X4OA 3MGHA 4KLIA 3PMNA 1BPXA 1V4AA 3AQNA 5D46A 3EF2A 4UB3A 3C2KA 1ZQNA 4N7RA 4IQVA 4RQ5A 1TVAA 1ZQIA 4F5NA 4FO6A 3UXPA 3RJKA 4Z6EA 5HRHA 5JTGA 7ICTA 4X4RA 4YD1A 3OGUA 7ICLA 2DR5A 1ZQBA 4I28A 4WC5A 5DBCA 4UBBA 4F5QA 4GXKA 1ZQEA 5J2CA 1JAJA 4EGWA 4UB5A 2PFQA 8ICVA 4PHAA 3H3AA 4WH5A 4PPXA 5D63A 2P66A 4WQKA 4K9AA 4QZIA 1WOTA 4X4TA 4O6AA 4M9HA 5J2JA 3TFSA 4WQLA 4M04A 1NO5A 4RQ1A 5J0QA 5CFSA 1ZQMA 2IUBA 1BPDA 1ZQUA 4RPYA 3JPPA 3CK6A 2ZH5A 2BCRA 4WC0A 4EEDA 3WFOA 4DOBA 3UQ0A 1BPBA 7ICUA 7ICVA 1R8CA 4Z6CA 3V72A 4X0AA 4AT9B 5J0YA 3MDAA 2M2WA 5HHIA 4OAHA 4LZGA 4PGYA 1ZQSA 1ZQPA 9ICTA 3UXNA 4NKTA 4LT6A 5D62A 2PFOA 4UAZA 2PBEA 4PHDA 3MBYA 2DR7A 4WC2A 3ERCC 4MF2A 2ZHBA 4LZDA 7ICSA 2ZH3A 5IINA 1RPLA 4RQ7A 3RJIA 4XJEA 4QZ9A 3RH5A 4XUSA 3AU2A 2BCSA 2BPFA 4E80A 9ICHA 4YCXA 4KLLA 3C5GA 4P4OA 3H38A 4DOCA 4RWPA 4X4UA 4I27A 3C5FA 2RFFA 4RT3A 4AT8A 4KLGA 1RZTA 1TFYA 1UEUA 4NLKA 3HIYA 4I2HA 4AT7B 5F2VO 4UAWA 3MGIA 3RJHA 5D61A 3C66A 3OVSA 4I2GA 4FHVA 3C2LA 2ZH9A 5J0XA 4QZBA 2ZH4A 5DB7A 8ICAA 5EOZA 2PXIA 5J2HA 4IQTA 4K8VA 9ICPA 7ICFA 3V7KA 9ICUA 4KLEA 3V7JA 5HREA 4KLSA 2M2UA 4O69A 8ICZA 4ATBA 3NVOA 3ISDA 4NKUA 9ICLA 4KLHA 3B0YA 4NM2A 4P4MA 2ZH2A 1HUZA 1BPEA 3HX0A 1PX5A 2ZHAA 1BPYA 5CB1A 4NLNA 4RQ0A 5DBAA 8ICSA 4NXZA 5DB8A 4FHXA 5CHGA 4I2AA 8ICBA 8ICKA 5J0OA 3PNCA 8ICRA 1MIWA 2FMPA 7ICNA 5HR9A 4EV6A 1MIVA 5J2GA 4WC4A 2GAFD 4NXUA 3C18A 4AT7A 2HN1A 4KB6A 4NXVA 2DVIA 7ICJA 1ZQHA 4UD5A 4TUQA 4PHEA 8ICPA 1ZQDA 4R63A 3OUYA 1BPZA 5DKWA 4WC7A 4Z6FA 4M47A 3B0XA 4YN4A 3ISCA 2BBHA 3NYBA 7ICPA 4JLZA 3OWGA 2O1PA 5BPCA 8ICFA 4K9BA 1UEVA 2GWSA 4AT8B 3GDXA 4QZFA 3ISBA 5J0PA 1R89A 1R8AA 4TUPA 5J2IA 3UPSA 4DOAA 3H39A 8ICTA 3RH6A 4MF8A 8ICLA 4RQ4A 1ZJMA 4X4PA 2ZH6A 2BPCA 5HRLA 4X4QA 3LQCB 4QZDA 3JPSA 1ZQJA 2IHMA 4FH3A 1ZQXA 1VFGA 9ICQA 5HRDA 4KM5A 2DR9A 4O9MA 3OVBA 4ATBB 1ZQOA 2BCQA 1OU5A 4JLXA 2FMSA 5J0UA 4LVSA 5IIKA 4TURA 1ZQGA 1VJ7A 4I2EA 7ICOA 1Q78A 4FH5A 9ICBA 4O67A 4PH5A 2DRAA 1MQ3A 4X0BA 2HHPA 3WFRE 4I2DA 4OAGA 8ICJA 4OAFA 1ZQQA 8ICNA 4I2CA 5J0SA 5J2AA 4WC3A 2M2TA 5DB9A 4YD2A 4QZ8A 4GXJA 3AQLA 3ER8C 4I2FA 4NXWA 4YMMA 4KLDA 4RQ8A 4OAIZ 1ZQKA 1JQRA 5IIJA 5HC9A 4RT2A 2BCVA 4M9JA 4XA5A 3K7DA 1KDHA 3WFPA 7ICMA 3OVAA 4I29A 4QZEA 3MDCA 4RWQA 1ZQFA 7ICEA 1XSPA 2M2VA 4WC6A 2B56A 4X4VA 5CHEA 4IQWA 3HW8A 5HRIA 5DDMA 5CFTA 3OUYB 5J2FA 3JPQA 8ICYA 4KLQA 4LEWA 4EEBA 1ZQWA 4I2IA 4UB2A 5DDYA 3AQKA 4UD4A 4R65A 8ICXA 4F5RA 5DEDA 5J0WA 3L9DA 9ICOA 4M9LA 2ZH7A 3HJ1A 3LK9A 4S3NA 4RWOA 4KLOA 9ICGA 1ZQTA 1ZQZA 1NOMA 9ICXA 4QZHA 3HJ4A 5D49A 3UXOA 4IQUA 5IIIA 5BOLA 4M2YA 8ICMA 4PGQA 1TFWA 4NXTA 4K4IA 7ICIA 2B4VA 4YMOA 5CP2A 1ZQCA 1KNYA 4RQ2A 5IIOA 4NLZA 2FMQA 4EBJA 3RJGA 4NM1A 4LEZA 1JMSA
chains in the Genus database with same CATH topology
9ICEA 4DO9A 4KLJA 3JZ0A 8ICHA 4RPXA 3JPRA 1ZQAA 1MIYA 3HWTA 4UBCA 8ICQA 3K75D 4XRHA 1ZQVA 4O5CA 5HHHA 9ICNA 3AU6A 4RQ3A 2DR8A 2BPGA 4WC1A 3V7LA 5J0TA 8ICEA 5HRGA 4NY8A 8ICUA 4KLUA 3JPTA 4M0AA 4M9GA 5CR0A 5J2EA 9ICRA 2ISPA 5TZVA 4P4PA 3PMLA 2ID1A 3AQMA 4R66A 2Q66A 3RJJA 9ICVA 7ICRA 2PFPA 4EBKA 2W9MA 3C2MA 4M5DA 4E7XA 8ICOA 4YMNA 1ZQRA 1ZQLA 1JN3A 2ISOA 4O5EA 4M9NA 1ZQYA 5J29A 5J2KA 2ZH8A 4XQ8A 8ICIA 4X4NA 5IIMA 1XSLA 4K4GA 5BOMA 9ICAA 2BCUA 9ICKA 5HRKA 4JWNA 2O5AA 1HUOA 5CWRA 3RJFA 5D4BA 2ZH1A 3JYYA 4QZAA 3RH4A 5J2BA 8ICWA 4UAYA 4RWNA 3UPQA 4F5PA 9ICWA 3AUOA 1ZJNA 7ICHA 2DRBA 4QZCA 1MQ2A 3TFRA 4UB4A 1XSNA 4I2BA 9ICJA 4PHPA 1YLQA 7ICQA 5DB6A 9ICSA 4E8FA 4R64A 4RQ6A 4MFAA 8ICGA 9ICMA 3RJEA 4TUSA 4FHPA 4P2HA 3WFQE 4Z6DA 5J2DA 1FA0A 4JWMA 4MFFA 1TV9A 4WCWA 9ICFA 4WBYA 3OV7A 4F5OA 2BE3A 4MFCA 1F5AA 3JPOA 4QZGA 3WFSC 4AT9A 4K4HA 4FHWA 4KLMA 4WBZA 5CA7A 1KEJA 4O5KA 2VANA 9ICIA 5DECA 4EP7A 5HRBA 4KLTA 7ICGA 5DBBA 4XQ7A 4RPZA 4GXIA 4X5VA 4X4SA 8ICCA 3UQ2A 3JPNA 4I2JA 2I9GA 4UB1A 4PGXA 5IILA 4FHYA 1UETA 7ICKA 2PFNA 2NRKA 4KLFA 1R8BA 5HRFA 3H37A 1Q79A 5J0RA 9ICCA 4IG8A 5CJ7A 4X4OA 3MGHA 4KLIA 3PMNA 1BPXA 1V4AA 3AQNA 5D46A 4UB3A 3C2KA 1ZQNA 4IQVA 4RQ5A 1TVAA 1ZQIA 4F5NA 4FO6A 3UXPA 3RJKA 4Z6EA 5HRHA 7ICTA 4X4RA 4YD1A 3OGUA 7ICLA 2DR5A 1ZQBA 4I28A 4WC5A 5DBCA 4UBBA 4F5QA 4GXKA 1ZQEA 5J2CA 1JAJA 4UB5A 2PFQA 8ICVA 4PHAA 3H3AA 4PPXA 2P66A 4QZIA 1WOTA 4X4TA 4M9HA 5J2JA 3TFSA 4M04A 1NO5A 4RQ1A 5J0QA 1ZQMA 1BPDA 1ZQUA 4RPYA 3JPPA 2ZH5A 2BCRA 4WC0A 3WFOA 4DOBA 3UQ0A 1BPBA 7ICUA 7ICVA 1R8CA 4Z6CA 3V72A 4X0AA 4AT9B 5J0YA 3MDAA 2M2WA 5HHIA 4LZGA 4PGYA 1ZQSA 1ZQPA 9ICTA 3UXNA 4NKTA 4LT6A 2PFOA 4UAZA 2PBEA 4PHDA 3MBYA 2DR7A 4WC2A 4MF2A 2ZHBA 4LZDA 7ICSA 2ZH3A 5IINA 1RPLA 4RQ7A 3RJIA 4QZ9A 3RH5A 4XUSA 3AU2A 2BCSA 2BPFA 4E80A 9ICHA 4YCXA 4KLLA 3C5GA 4P4OA 3H38A 4DOCA 4RWPA 4X4UA 4I27A 3C5FA 2RFFA 4RT3A 4AT8A 4KLGA 1RZTA 1TFYA 1UEUA 4NLKA 3HIYA 4I2HA 4AT7B 5F2VO 4UAWA 3MGIA 3RJHA 3C66A 3OVSA 4I2GA 4FHVA 3C2LA 2ZH9A 5J0XA 4QZBA 2ZH4A 5DB7A 8ICAA 5EOZA 2PXIA 5J2HA 4IQTA 9ICPA 7ICFA 3V7KA 9ICUA 4KLEA 3V7JA 5HREA 4KLSA 2M2UA 8ICZA 4ATBA 3ISDA 4NKUA 9ICLA 4KLHA 3B0YA 4NM2A 4P4MA 2ZH2A 1HUZA 1BPEA 3HX0A 1PX5A 2ZHAA 1BPYA 5CB1A 4NLNA 4RQ0A 5DBAA 8ICSA 4NXZA 5DB8A 4FHXA 5CHGA 4I2AA 8ICBA 8ICKA 5J0OA 3PNCA 8ICRA 1MIWA 2FMPA 7ICNA 5HR9A 1MIVA 5J2GA 4WC4A 3C18A 4AT7A 7ICJA 2DVIA 1ZQHA 4UD5A 4TUQA 4PHEA 8ICPA 1ZQDA 4R63A 3OUYA 1BPZA 5DKWA 4WC7A 4Z6FA 4M47A 3B0XA 4YN4A 3ISCA 3NYBA 7ICPA 2O1PA 5BPCA 8ICFA 1UEVA 2GWSA 4AT8B 3GDXA 4QZFA 3ISBA 5J0PA 1R89A 1R8AA 4TUPA 5J2IA 3UPSA 4DOAA 3H39A 8ICTA 3RH6A 4MF8A 8ICLA 4RQ4A 1ZJMA 4X4PA 2ZH6A 2BPCA 5HRLA 4X4QA 3LQCB 4QZDA 3JPSA 1ZQJA 2IHMA 4FH3A 1ZQXA 1VFGA 9ICQA 5HRDA 2DR9A 4O9MA 3OVBA 4ATBB 1ZQOA 2BCQA 1OU5A 2FMSA 5J0UA 4LVSA 5IIKA 4TURA 1ZQGA 1VJ7A 4I2EA 7ICOA 1Q78A 4FH5A 9ICBA 4PH5A 2DRAA 1MQ3A 4X0BA 2HHPA 3WFRE 4I2DA 8ICJA 1ZQQA 8ICNA 4I2CA 5J0SA 5J2AA 4WC3A 2M2TA 5DB9A 4YD2A 4QZ8A 4GXJA 3AQLA 4I2FA 4YMMA 4KLDA 4RQ8A 1ZQKA 1JQRA 5IIJA 5HC9A 4RT2A 2BCVA 4M9JA 4XA5A 1KDHA 3WFPA 7ICMA 3OVAA 4I29A 4QZEA 3MDCA 4RWQA 1ZQFA 7ICEA 1XSPA 2M2VA 4WC6A 4X4VA 4IQWA 3HW8A 5HRIA 5DDMA 8ICYA 3OUYB 5J2FA 3JPQA 4KLQA 1ZQWA 4I2IA 4UB2A 5DDYA 3AQKA 4UD4A 4R65A 8ICXA 4F5RA 5DEDA 5J0WA 3L9DA 9ICOA 4M9LA 2ZH7A 3HJ1A 3LK9A 4S3NA 4RWOA 4KLOA 9ICGA 1ZQTA 1ZQZA 1NOMA 9ICXA 4QZHA 3HJ4A 5D49A 3UXOA 4IQUA 5IIIA 5BOLA 4M2YA 8ICMA 4PGQA 1TFWA 4K4IA 7ICIA 4YMOA 5CP2A 1ZQCA 1KNYA 4RQ2A 5IIOA 4NLZA 2FMQA 4EBJA 3RJGA 4NM1A 1JMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICE A;  4DO9 A;  4KLJ A;  3JZ0 A;  8ICH A;  4RPX A;  3JPR A;  1ZQA A;  1MIY A;  3HWT A;  4UBC A;  8ICQ A;  3K75 D;  4XRH A;  1ZQV A;  4O5C A;  5HHH A;  9ICN A;  3AU6 A;  4RQ3 A;  2DR8 A;  2BPG A;  4WC1 A;  3V7L A;  5J0T A;  8ICE A;  5HRG A;  4NY8 A;  8ICU A;  4KLU A;  3JPT A;  4M0A A;  4M9G A;  5CR0 A;  5J2E A;  9ICR A;  2ISP A;  5TZV A;  4P4P A;  3PML A;  2ID1 A;  3AQM A;  4R66 A;  2Q66 A;  3RJJ A;  9ICV A;  7ICR A;  2PFP A;  4EBK A;  2W9M A;  3C2M A;  4M5D A;  4E7X A;  8ICO A;  4YMN A;  1ZQR A;  1ZQL A;  1JN3 A;  2ISO A;  4O5E A;  4M9N A;  1ZQY A;  5J29 A;  5J2K A;  2ZH8 A;  4XQ8 A;  8ICI A;  4X4N A;  5IIM A;  1XSL A;  4K4G A;  5BOM A;  9ICA A;  2BCU A;  9ICK A;  5HRK A;  4JWN A;  2O5A A;  1HUO A;  5CWR A;  3RJF A;  5D4B A;  2ZH1 A;  3JYY A;  4QZA A;  3RH4 A;  5J2B A;  8ICW A;  4UAY A;  4RWN A;  3UPQ A;  4F5P A;  9ICW A;  3AUO A;  1ZJN A;  7ICH A;  2DRB A;  4QZC A;  1MQ2 A;  3TFR A;  4UB4 A;  1XSN A;  4I2B A;  9ICJ A;  4PHP A;  1YLQ A;  7ICQ A;  5DB6 A;  9ICS A;  4E8F A;  4R64 A;  4RQ6 A;  4MFA A;  8ICG A;  9ICM A;  3RJE A;  4TUS A;  4FHP A;  4P2H A;  3WFQ E;  4Z6D A;  5J2D A;  1FA0 A;  4JWM A;  4MFF A;  1TV9 A;  4WCW A;  9ICF A;  4WBY A;  3OV7 A;  4F5O A;  2BE3 A;  4MFC A;  1F5A A;  3JPO A;  4QZG A;  3WFS C;  4AT9 A;  4K4H A;  4FHW A;  4KLM A;  4WBZ A;  5CA7 A;  1KEJ A;  4O5K A;  2VAN A;  9ICI A;  5DEC A;  4EP7 A;  5HRB A;  4KLT A;  7ICG A;  5DBB A;  4XQ7 A;  4RPZ A;  4GXI A;  4X5V A;  4X4S A;  8ICC A;  3UQ2 A;  3JPN A;  4I2J A;  2I9G A;  4UB1 A;  4PGX A;  5IIL A;  4FHY A;  1UET A;  7ICK A;  2PFN A;  2NRK A;  4KLF A;  1R8B A;  5HRF A;  3H37 A;  1Q79 A;  5J0R A;  9ICC A;  4IG8 A;  5CJ7 A;  4X4O A;  3MGH A;  4KLI A;  3PMN A;  1BPX A;  1V4A A;  3AQN A;  5D46 A;  4UB3 A;  3C2K A;  1ZQN A;  4IQV A;  4RQ5 A;  1TVA A;  1ZQI A;  4F5N A;  4FO6 A;  3UXP A;  3RJK A;  4Z6E A;  5HRH A;  7ICT A;  4X4R A;  4YD1 A;  3OGU A;  7ICL A;  2DR5 A;  1ZQB A;  4I28 A;  4WC5 A;  5DBC A;  4UBB A;  4F5Q A;  4GXK A;  1ZQE A;  5J2C A;  1JAJ A;  4UB5 A;  2PFQ A;  8ICV A;  4PHA A;  3H3A A;  4PPX A;  2P66 A;  4QZI A;  1WOT A;  4X4T A;  4M9H A;  5J2J A;  3TFS A;  4M04 A;  1NO5 A;  4RQ1 A;  5J0Q A;  1ZQM A;  1BPD A;  1ZQU A;  4RPY A;  3JPP A;  2ZH5 A;  2BCR A;  4WC0 A;  3WFO A;  4DOB A;  3UQ0 A;  1BPB A;  7ICU A;  7ICV A;  1R8C A;  4Z6C A;  3V72 A;  4X0A A;  4AT9 B;  5J0Y A;  3MDA A;  2M2W A;  5HHI A;  4LZG A;  4PGY A;  1ZQS A;  1ZQP A;  9ICT A;  3UXN A;  4NKT A;  4LT6 A;  2PFO A;  4UAZ A;  2PBE A;  4PHD A;  3MBY A;  2DR7 A;  4WC2 A;  4MF2 A;  2ZHB A;  4LZD A;  7ICS A;  2ZH3 A;  5IIN A;  1RPL A;  4RQ7 A;  3RJI A;  4QZ9 A;  3RH5 A;  4XUS A;  3AU2 A;  2BCS A;  2BPF A;  4E80 A;  9ICH A;  4YCX A;  4KLL A;  3C5G A;  4P4O A;  3H38 A;  4DOC A;  4RWP A;  4X4U A;  4I27 A;  3C5F A;  2RFF A;  4RT3 A;  4AT8 A;  4KLG A;  1RZT A;  1TFY A;  1UEU A;  4NLK A;  3HIY A;  4I2H A;  4AT7 B;  5F2V O;  4UAW A;  3MGI A;  3RJH A;  3C66 A;  3OVS A;  4I2G A;  4FHV A;  3C2L A;  2ZH9 A;  5J0X A;  4QZB A;  2ZH4 A;  5DB7 A;  8ICA A;  5EOZ A;  2PXI A;  5J2H A;  4IQT A;  9ICP A;  7ICF A;  3V7K A;  9ICU A;  4KLE A;  3V7J A;  5HRE A;  4KLS A;  2M2U A;  8ICZ A;  4ATB A;  3ISD A;  4NKU A;  9ICL A;  4KLH A;  3B0Y A;  4NM2 A;  4P4M A;  2ZH2 A;  1HUZ A;  1BPE A;  3HX0 A;  1PX5 A;  2ZHA A;  1BPY A;  5CB1 A;  4NLN A;  4RQ0 A;  5DBA A;  8ICS A;  4NXZ A;  5DB8 A;  4FHX A;  5CHG A;  4I2A A;  8ICB A;  8ICK A;  5J0O A;  3PNC A;  8ICR A;  1MIW A;  2FMP A;  7ICN A;  5HR9 A;  1MIV A;  5J2G A;  4WC4 A;  3C18 A;  4AT7 A;  7ICJ A;  2DVI A;  1ZQH A;  4UD5 A;  4TUQ A;  4PHE A;  8ICP A;  1ZQD A;  4R63 A;  3OUY A;  1BPZ A;  5DKW A;  4WC7 A;  4Z6F A;  4M47 A;  3B0X A;  4YN4 A;  3ISC A;  3NYB A;  7ICP A;  2O1P A;  5BPC A;  8ICF A;  1UEV A;  2GWS A;  4AT8 B;  3GDX A;  4QZF A;  3ISB A;  5J0P A;  1R89 A;  1R8A A;  4TUP A;  5J2I A;  3UPS A;  4DOA A;  3H39 A;  8ICT A;  3RH6 A;  4MF8 A;  8ICL A;  4RQ4 A;  1ZJM A;  4X4P A;  2ZH6 A;  2BPC A;  5HRL A;  4X4Q A;  3LQC B;  4QZD A;  3JPS A;  1ZQJ A;  2IHM A;  4FH3 A;  1ZQX A;  1VFG A;  9ICQ A;  5HRD A;  2DR9 A;  4O9M A;  3OVB A;  4ATB B;  1ZQO A;  2BCQ A;  1OU5 A;  2FMS A;  5J0U A;  4LVS A;  5IIK A;  4TUR A;  1ZQG A;  1VJ7 A;  4I2E A;  7ICO A;  1Q78 A;  4FH5 A;  9ICB A;  4PH5 A;  2DRA A;  1MQ3 A;  4X0B A;  2HHP A;  3WFR E;  4I2D A;  8ICJ A;  1ZQQ A;  8ICN A;  4I2C A;  5J0S A;  5J2A A;  4WC3 A;  2M2T A;  5DB9 A;  4YD2 A;  4QZ8 A;  4GXJ A;  3AQL A;  4I2F A;  4YMM A;  4KLD A;  4RQ8 A;  1ZQK A;  1JQR A;  5IIJ A;  5HC9 A;  4RT2 A;  2BCV A;  4M9J A;  4XA5 A;  1KDH A;  3WFP A;  7ICM A;  3OVA A;  4I29 A;  4QZE A;  3MDC A;  4RWQ A;  1ZQF A;  7ICE A;  1XSP A;  2M2V A;  4WC6 A;  4X4V A;  4IQW A;  3HW8 A;  5HRI A;  5DDM A;  8ICY A;  3OUY B;  5J2F A;  3JPQ A;  4KLQ A;  1ZQW A;  4I2I A;  4UB2 A;  5DDY A;  3AQK A;  4UD4 A;  4R65 A;  8ICX A;  4F5R A;  5DED A;  5J0W A;  3L9D A;  9ICO A;  4M9L A;  2ZH7 A;  3HJ1 A;  3LK9 A;  4S3N A;  4RWO A;  4KLO A;  9ICG A;  1ZQT A;  1ZQZ A;  1NOM A;  9ICX A;  4QZH A;  3HJ4 A;  5D49 A;  3UXO A;  4IQU A;  5III A;  5BOL A;  4M2Y A;  8ICM A;  4PGQ A;  1TFW A;  4K4I A;  7ICI A;  4YMO A;  5CP2 A;  1ZQC A;  1KNY A;  4RQ2 A;  5IIO A;  4NLZ A;  2FMQ A;  4EBJ A;  3RJG A;  4NM1 A;  1JMS A; 
#chains in the Genus database with same CATH topology
 9ICE A;  3NKU A;  4DO9 A;  4KLJ A;  3JZ0 A;  8ICH A;  4RPX A;  3JPR A;  1ZQA A;  1MIY A;  3HWT A;  4UBC A;  8ICQ A;  4NXX A;  3K75 D;  4XRH A;  1ZQV A;  4O5C A;  5HHH A;  9ICN A;  4K98 A;  3AU6 A;  4RQ3 A;  2DR8 A;  2BPG A;  1GPJ A;  4WC1 A;  3V7L A;  5J0T A;  8ICE A;  5HRG A;  4NY8 A;  8ICU A;  4HX0 A;  4KLU A;  3JPT A;  4M0A A;  4M9G A;  5CR0 A;  5J2E A;  9ICR A;  2ISP A;  5TZV A;  4P4P A;  3PML A;  2ID1 A;  3AQM A;  4LEY A;  4R66 A;  2Q66 A;  3RJJ A;  9ICV A;  7ICR A;  2PFP A;  4EBK A;  4K99 A;  2W9M A;  3C2M A;  4M5D A;  4E7X A;  2HN2 A;  8ICO A;  4YMN A;  1ZQR A;  4K96 A;  4MKP A;  1JN3 A;  1ZQL A;  2ISO A;  5B3Q A;  4M9N A;  4O5E A;  1ZQY A;  2BBJ A;  3NWI A;  5J29 A;  5J2K A;  2ZH8 A;  4XQ8 A;  8ICI A;  4X4N A;  5IIM A;  1XSL A;  4K4G A;  5BOM A;  9ICA A;  2BCU A;  9ICK A;  5HRK A;  4JWN A;  2GA9 D;  2O5A A;  1HUO A;  5CWR A;  3RJF A;  4I0U A;  5D4B A;  2ZH1 A;  3JYY A;  4QZA A;  3RH4 A;  5J2B A;  8ICW A;  4UAY A;  4RWN A;  3UPQ A;  4O68 A;  4F5P A;  5B3P A;  9ICW A;  4FO1 A;  3AUO A;  1ZJN A;  7ICH A;  2DRB A;  4LEV A;  4QZC A;  1MQ2 A;  3TFR A;  4UB4 A;  3MCR A;  1XSN A;  4I2B A;  4PHP A;  1YLQ A;  9ICJ A;  7ICQ A;  5DB6 A;  9ICS A;  2IHO A;  4E8F A;  4R64 A;  4RQ6 A;  4MFA A;  5CFU A;  8ICG A;  9ICM A;  3RJE A;  4TUS A;  4FHP A;  4P2H A;  3WFQ E;  4Z6D A;  4WOY A;  1FA0 A;  5J2D A;  3PHZ A;  3JCF A;  4JWM A;  4MFF A;  1TV9 A;  4WCW A;  9ICF A;  4WBY A;  2EWR A;  3OV7 A;  4F5O A;  2BE3 A;  4MFC A;  1F5A A;  3JPO A;  4QZG A;  3ER9 B;  3WFS C;  4AT9 A;  4K4H A;  4FHW A;  4KLM A;  4WBZ A;  5CA7 A;  1KEJ A;  4O5K A;  2B51 A;  2VAN A;  9ICI A;  5DEC A;  4EP7 A;  5HRB A;  4KLT A;  7ICG A;  5DBB A;  4XQ7 A;  4RPZ A;  4GXI A;  4X5V A;  2FCL A;  4X4S A;  8ICC A;  3UQ2 A;  3JPN A;  4I2J A;  2I9G A;  4UB1 A;  4K97 A;  4PGX A;  5IIL A;  4FHY A;  1UET A;  7ICK A;  2PFN A;  2NRK A;  4KLF A;  1R8B A;  5HRF A;  3H37 A;  1Q79 A;  5J0R A;  9ICC A;  4IG8 A;  5CJ7 A;  4X4O A;  3MGH A;  4KLI A;  3PMN A;  1BPX A;  1V4A A;  3AQN A;  5D46 A;  3EF2 A;  4UB3 A;  3C2K A;  1ZQN A;  4N7R A;  4IQV A;  4RQ5 A;  1TVA A;  1ZQI A;  4F5N A;  4FO6 A;  3UXP A;  3RJK A;  4Z6E A;  5HRH A;  5JTG A;  7ICT A;  4X4R A;  4YD1 A;  3OGU A;  7ICL A;  2DR5 A;  1ZQB A;  4I28 A;  4WC5 A;  5DBC A;  4UBB A;  4F5Q A;  4GXK A;  1ZQE A;  5J2C A;  1JAJ A;  4EGW A;  4UB5 A;  2PFQ A;  8ICV A;  4PHA A;  3H3A A;  4WH5 A;  4PPX A;  5D63 A;  2P66 A;  4WQK A;  4K9A A;  4QZI A;  1WOT A;  4X4T A;  4O6A A;  4M9H A;  5J2J A;  3TFS A;  4WQL A;  4M04 A;  1NO5 A;  4RQ1 A;  5J0Q A;  5CFS A;  1ZQM A;  2IUB A;  1BPD A;  1ZQU A;  4RPY A;  3JPP A;  3CK6 A;  2ZH5 A;  2BCR A;  4WC0 A;  4EED A;  3WFO A;  4DOB A;  3UQ0 A;  1BPB A;  7ICU A;  7ICV A;  1R8C A;  4Z6C A;  3V72 A;  4X0A A;  4AT9 B;  5J0Y A;  3MDA A;  2M2W A;  5HHI A;  4OAH A;  4LZG A;  4PGY A;  1ZQS A;  1ZQP A;  9ICT A;  3UXN A;  4NKT A;  4LT6 A;  5D62 A;  2PFO A;  4UAZ A;  2PBE A;  4PHD A;  3MBY A;  2DR7 A;  4WC2 A;  3ERC C;  4MF2 A;  2ZHB A;  4LZD A;  7ICS A;  2ZH3 A;  5IIN A;  1RPL A;  4RQ7 A;  3RJI A;  4XJE A;  4QZ9 A;  3RH5 A;  4XUS A;  3AU2 A;  2BCS A;  2BPF A;  4E80 A;  9ICH A;  4YCX A;  4KLL A;  3C5G A;  4P4O A;  3H38 A;  4DOC A;  4RWP A;  4X4U A;  4I27 A;  3C5F A;  2RFF A;  4RT3 A;  4AT8 A;  4KLG A;  1RZT A;  1TFY A;  1UEU A;  4NLK A;  3HIY A;  4I2H A;  4AT7 B;  5F2V O;  4UAW A;  3MGI A;  3RJH A;  5D61 A;  3C66 A;  3OVS A;  4I2G A;  4FHV A;  3C2L A;  2ZH9 A;  5J0X A;  4QZB A;  2ZH4 A;  5DB7 A;  8ICA A;  5EOZ A;  2PXI A;  5J2H A;  4IQT A;  4K8V A;  9ICP A;  7ICF A;  3V7K A;  9ICU A;  4KLE A;  3V7J A;  5HRE A;  4KLS A;  2M2U A;  4O69 A;  8ICZ A;  4ATB A;  3NVO A;  3ISD A;  4NKU A;  9ICL A;  4KLH A;  3B0Y A;  4NM2 A;  4P4M A;  2ZH2 A;  1HUZ A;  1BPE A;  3HX0 A;  1PX5 A;  2ZHA A;  1BPY A;  5CB1 A;  4NLN A;  4RQ0 A;  5DBA A;  8ICS A;  4NXZ A;  5DB8 A;  4FHX A;  5CHG A;  4I2A A;  8ICB A;  8ICK A;  5J0O A;  3PNC A;  8ICR A;  1MIW A;  2FMP A;  7ICN A;  5HR9 A;  4EV6 A;  1MIV A;  5J2G A;  4WC4 A;  2GAF D;  4NXU A;  3C18 A;  4AT7 A;  2HN1 A;  4KB6 A;  4NXV A;  2DVI A;  7ICJ A;  1ZQH A;  4UD5 A;  4TUQ A;  4PHE A;  8ICP A;  1ZQD A;  4R63 A;  3OUY A;  1BPZ A;  5DKW A;  4WC7 A;  4Z6F A;  4M47 A;  3B0X A;  4YN4 A;  3ISC A;  2BBH A;  3NYB A;  7ICP A;  4JLZ A;  3OWG A;  2O1P A;  5BPC A;  8ICF A;  4K9B A;  1UEV A;  2GWS A;  4AT8 B;  3GDX A;  4QZF A;  3ISB A;  5J0P A;  1R89 A;  1R8A A;  4TUP A;  5J2I A;  3UPS A;  4DOA A;  3H39 A;  8ICT A;  3RH6 A;  4MF8 A;  8ICL A;  4RQ4 A;  1ZJM A;  4X4P A;  2ZH6 A;  2BPC A;  5HRL A;  4X4Q A;  3LQC B;  4QZD A;  3JPS A;  1ZQJ A;  2IHM A;  4FH3 A;  1ZQX A;  1VFG A;  9ICQ A;  5HRD A;  4KM5 A;  2DR9 A;  4O9M A;  3OVB A;  4ATB B;  1ZQO A;  2BCQ A;  1OU5 A;  4JLX A;  2FMS A;  5J0U A;  4LVS A;  5IIK A;  4TUR A;  1ZQG A;  1VJ7 A;  4I2E A;  7ICO A;  1Q78 A;  4FH5 A;  9ICB A;  4O67 A;  4PH5 A;  2DRA A;  1MQ3 A;  4X0B A;  2HHP A;  3WFR E;  4I2D A;  4OAG A;  8ICJ A;  4OAF A;  1ZQQ A;  8ICN A;  4I2C A;  5J0S A;  5J2A A;  4WC3 A;  2M2T A;  5DB9 A;  4YD2 A;  4QZ8 A;  4GXJ A;  3AQL A;  3ER8 C;  4I2F A;  4NXW A;  4YMM A;  4KLD A;  4RQ8 A;  4OAI Z;  1ZQK A;  1JQR A;  5IIJ A;  5HC9 A;  4RT2 A;  2BCV A;  4M9J A;  4XA5 A;  3K7D A;  1KDH A;  3WFP A;  7ICM A;  3OVA A;  4I29 A;  4QZE A;  3MDC A;  4RWQ A;  1ZQF A;  7ICE A;  1XSP A;  2M2V A;  4WC6 A;  2B56 A;  4X4V A;  5CHE A;  4IQW A;  3HW8 A;  5HRI A;  5DDM A;  5CFT A;  3OUY B;  5J2F A;  3JPQ A;  8ICY A;  4KLQ A;  4LEW A;  4EEB A;  1ZQW A;  4I2I A;  4UB2 A;  5DDY A;  3AQK A;  4UD4 A;  4R65 A;  8ICX A;  4F5R A;  5DED A;  5J0W A;  3L9D A;  9ICO A;  4M9L A;  2ZH7 A;  3HJ1 A;  3LK9 A;  4S3N A;  4RWO A;  4KLO A;  9ICG A;  1ZQT A;  1ZQZ A;  1NOM A;  9ICX A;  4QZH A;  3HJ4 A;  5D49 A;  3UXO A;  4IQU A;  5III A;  5BOL A;  4M2Y A;  8ICM A;  4PGQ A;  1TFW A;  4NXT A;  4K4I A;  7ICI A;  2B4V A;  4YMO A;  5CP2 A;  1ZQC A;  1KNY A;  4RQ2 A;  5IIO A;  4NLZ A;  2FMQ A;  4EBJ A;  3RJG A;  4NM1 A;  4LEZ A;  1JMS A; 
#chains in the Genus database with same CATH homology
 9ICE A;  4DO9 A;  4KLJ A;  3JZ0 A;  8ICH A;  4RPX A;  3JPR A;  1ZQA A;  1MIY A;  3HWT A;  4UBC A;  8ICQ A;  3K75 D;  4XRH A;  1ZQV A;  4O5C A;  5HHH A;  9ICN A;  3AU6 A;  4RQ3 A;  2DR8 A;  2BPG A;  4WC1 A;  3V7L A;  5J0T A;  8ICE A;  5HRG A;  4NY8 A;  8ICU A;  4KLU A;  3JPT A;  4M0A A;  4M9G A;  5CR0 A;  5J2E A;  9ICR A;  2ISP A;  5TZV A;  4P4P A;  3PML A;  2ID1 A;  3AQM A;  4R66 A;  2Q66 A;  3RJJ A;  9ICV A;  7ICR A;  2PFP A;  4EBK A;  2W9M A;  3C2M A;  4M5D A;  4E7X A;  8ICO A;  4YMN A;  1ZQR A;  1ZQL A;  1JN3 A;  2ISO A;  4O5E A;  4M9N A;  1ZQY A;  5J29 A;  5J2K A;  2ZH8 A;  4XQ8 A;  8ICI A;  4X4N A;  5IIM A;  1XSL A;  4K4G A;  5BOM A;  9ICA A;  2BCU A;  9ICK A;  5HRK A;  4JWN A;  2O5A A;  1HUO A;  5CWR A;  3RJF A;  5D4B A;  2ZH1 A;  3JYY A;  4QZA A;  3RH4 A;  5J2B A;  8ICW A;  4UAY A;  4RWN A;  3UPQ A;  4F5P A;  9ICW A;  3AUO A;  1ZJN A;  7ICH A;  2DRB A;  4QZC A;  1MQ2 A;  3TFR A;  4UB4 A;  1XSN A;  4I2B A;  9ICJ A;  4PHP A;  1YLQ A;  7ICQ A;  5DB6 A;  9ICS A;  4E8F A;  4R64 A;  4RQ6 A;  4MFA A;  8ICG A;  9ICM A;  3RJE A;  4TUS A;  4FHP A;  4P2H A;  3WFQ E;  4Z6D A;  5J2D A;  1FA0 A;  4JWM A;  4MFF A;  1TV9 A;  4WCW A;  9ICF A;  4WBY A;  3OV7 A;  4F5O A;  2BE3 A;  4MFC A;  1F5A A;  3JPO A;  4QZG A;  3WFS C;  4AT9 A;  4K4H A;  4FHW A;  4KLM A;  4WBZ A;  5CA7 A;  1KEJ A;  4O5K A;  2VAN A;  9ICI A;  5DEC A;  4EP7 A;  5HRB A;  4KLT A;  7ICG A;  5DBB A;  4XQ7 A;  4RPZ A;  4GXI A;  4X5V A;  4X4S A;  8ICC A;  3UQ2 A;  3JPN A;  4I2J A;  2I9G A;  4UB1 A;  4PGX A;  5IIL A;  4FHY A;  1UET A;  7ICK A;  2PFN A;  2NRK A;  4KLF A;  1R8B A;  5HRF A;  3H37 A;  1Q79 A;  5J0R A;  9ICC A;  4IG8 A;  5CJ7 A;  4X4O A;  3MGH A;  4KLI A;  3PMN A;  1BPX A;  1V4A A;  3AQN A;  5D46 A;  4UB3 A;  3C2K A;  1ZQN A;  4IQV A;  4RQ5 A;  1TVA A;  1ZQI A;  4F5N A;  4FO6 A;  3UXP A;  3RJK A;  4Z6E A;  5HRH A;  7ICT A;  4X4R A;  4YD1 A;  3OGU A;  7ICL A;  2DR5 A;  1ZQB A;  4I28 A;  4WC5 A;  5DBC A;  4UBB A;  4F5Q A;  4GXK A;  1ZQE A;  5J2C A;  1JAJ A;  4UB5 A;  2PFQ A;  8ICV A;  4PHA A;  3H3A A;  4PPX A;  2P66 A;  4QZI A;  1WOT A;  4X4T A;  4M9H A;  5J2J A;  3TFS A;  4M04 A;  1NO5 A;  4RQ1 A;  5J0Q A;  1ZQM A;  1BPD A;  1ZQU A;  4RPY A;  3JPP A;  2ZH5 A;  2BCR A;  4WC0 A;  3WFO A;  4DOB A;  3UQ0 A;  1BPB A;  7ICU A;  7ICV A;  1R8C A;  4Z6C A;  3V72 A;  4X0A A;  4AT9 B;  5J0Y A;  3MDA A;  2M2W A;  5HHI A;  4LZG A;  4PGY A;  1ZQS A;  1ZQP A;  9ICT A;  3UXN A;  4NKT A;  4LT6 A;  2PFO A;  4UAZ A;  2PBE A;  4PHD A;  3MBY A;  2DR7 A;  4WC2 A;  4MF2 A;  2ZHB A;  4LZD A;  7ICS A;  2ZH3 A;  5IIN A;  1RPL A;  4RQ7 A;  3RJI A;  4QZ9 A;  3RH5 A;  4XUS A;  3AU2 A;  2BCS A;  2BPF A;  4E80 A;  9ICH A;  4YCX A;  4KLL A;  3C5G A;  4P4O A;  3H38 A;  4DOC A;  4RWP A;  4X4U A;  4I27 A;  3C5F A;  2RFF A;  4RT3 A;  4AT8 A;  4KLG A;  1RZT A;  1TFY A;  1UEU A;  4NLK A;  3HIY A;  4I2H A;  4AT7 B;  5F2V O;  4UAW A;  3MGI A;  3RJH A;  3C66 A;  3OVS A;  4I2G A;  4FHV A;  3C2L A;  2ZH9 A;  5J0X A;  4QZB A;  2ZH4 A;  5DB7 A;  8ICA A;  5EOZ A;  2PXI A;  5J2H A;  4IQT A;  9ICP A;  7ICF A;  3V7K A;  9ICU A;  4KLE A;  3V7J A;  5HRE A;  4KLS A;  2M2U A;  8ICZ A;  4ATB A;  3ISD A;  4NKU A;  9ICL A;  4KLH A;  3B0Y A;  4NM2 A;  4P4M A;  2ZH2 A;  1HUZ A;  1BPE A;  3HX0 A;  1PX5 A;  2ZHA A;  1BPY A;  5CB1 A;  4NLN A;  4RQ0 A;  5DBA A;  8ICS A;  4NXZ A;  5DB8 A;  4FHX A;  5CHG A;  4I2A A;  8ICB A;  8ICK A;  5J0O A;  3PNC A;  8ICR A;  1MIW A;  2FMP A;  7ICN A;  5HR9 A;  1MIV A;  5J2G A;  4WC4 A;  3C18 A;  4AT7 A;  7ICJ A;  2DVI A;  1ZQH A;  4UD5 A;  4TUQ A;  4PHE A;  8ICP A;  1ZQD A;  4R63 A;  3OUY A;  1BPZ A;  5DKW A;  4WC7 A;  4Z6F A;  4M47 A;  3B0X A;  4YN4 A;  3ISC A;  3NYB A;  7ICP A;  2O1P A;  5BPC A;  8ICF A;  1UEV A;  2GWS A;  4AT8 B;  3GDX A;  4QZF A;  3ISB A;  5J0P A;  1R89 A;  1R8A A;  4TUP A;  5J2I A;  3UPS A;  4DOA A;  3H39 A;  8ICT A;  3RH6 A;  4MF8 A;  8ICL A;  4RQ4 A;  1ZJM A;  4X4P A;  2ZH6 A;  2BPC A;  5HRL A;  4X4Q A;  3LQC B;  4QZD A;  3JPS A;  1ZQJ A;  2IHM A;  4FH3 A;  1ZQX A;  1VFG A;  9ICQ A;  5HRD A;  2DR9 A;  4O9M A;  3OVB A;  4ATB B;  1ZQO A;  2BCQ A;  1OU5 A;  2FMS A;  5J0U A;  4LVS A;  5IIK A;  4TUR A;  1ZQG A;  1VJ7 A;  4I2E A;  7ICO A;  1Q78 A;  4FH5 A;  9ICB A;  4PH5 A;  2DRA A;  1MQ3 A;  4X0B A;  2HHP A;  3WFR E;  4I2D A;  8ICJ A;  1ZQQ A;  8ICN A;  4I2C A;  5J0S A;  5J2A A;  4WC3 A;  2M2T A;  5DB9 A;  4YD2 A;  4QZ8 A;  4GXJ A;  3AQL A;  4I2F A;  4YMM A;  4KLD A;  4RQ8 A;  1ZQK A;  1JQR A;  5IIJ A;  5HC9 A;  4RT2 A;  2BCV A;  4M9J A;  4XA5 A;  1KDH A;  3WFP A;  7ICM A;  3OVA A;  4I29 A;  4QZE A;  3MDC A;  4RWQ A;  1ZQF A;  7ICE A;  1XSP A;  2M2V A;  4WC6 A;  4X4V A;  4IQW A;  3HW8 A;  5HRI A;  5DDM A;  8ICY A;  3OUY B;  5J2F A;  3JPQ A;  4KLQ A;  1ZQW A;  4I2I A;  4UB2 A;  5DDY A;  3AQK A;  4UD4 A;  4R65 A;  8ICX A;  4F5R A;  5DED A;  5J0W A;  3L9D A;  9ICO A;  4M9L A;  2ZH7 A;  3HJ1 A;  3LK9 A;  4S3N A;  4RWO A;  4KLO A;  9ICG A;  1ZQT A;  1ZQZ A;  1NOM A;  9ICX A;  4QZH A;  3HJ4 A;  5D49 A;  3UXO A;  4IQU A;  5III A;  5BOL A;  4M2Y A;  8ICM A;  4PGQ A;  1TFW A;  4K4I A;  7ICI A;  4YMO A;  5CP2 A;  1ZQC A;  1KNY A;  4RQ2 A;  5IIO A;  4NLZ A;  2FMQ A;  4EBJ A;  3RJG A;  4NM1 A;  1JMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...