4WBZA

Trna-processing enzyme (apo form 2)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 106
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wbzA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wbzA01
5DEDA 5HRKA 9ICRA 4IQUA 8ICIA 1WOTA 1YLQA 3MGIA 4FO6A 4GXKA 2BPCA 3C2LA 4IG8A 3RJFA 8ICRA 4RQ5A 8ICHA 2PFNA 4AT7A 2DR9A 5J29A 3JPTA 4I2GA 5BPCA 7ICLA 5CR0A 4X0AA 4YMNA 3AUOA 9ICAA 4RQ2A 1ZQDA 4M9JA 7ICOA 2O5AA 4M9LA 4NXZA 4Z6FA 5IIMA 4KLDA 4K4GA 5DECA 1ZQLA 8ICSA 4FHVA 2BCUA 2DRAA 3V7LA 4WC3A 8ICCA 4UB1A 4YD1A 1ZJMA 4LZDA 1ZQWA 3UPQA 4QZ8A 4O9MA 3C5FA 4DOCA 4XA5A 4WC0A 3TFSA 5HC9A 5HRBA 8ICKA 4YCXA 3H38A 5DBAA 2PBEA 4UAWA 4R64A 9ICTA 3UXNA 1F5AA 4KLMA 4NKTA 5DB9A 3LK9A 4RWNA 4M9GA 8ICOA 4I2FA 4I2HA 5HRIA 3C18A 4S3NA 3OVBA 3H3AA 4E80A 1BPBA 7ICQA 2NRKA 4WC5A 5DB8A 4O5EA 4I2EA 4WC1A 7ICGA 1V4AA 8ICUA 1KNYA 5J2JA 4QZAA 2ZH1A 9ICIA 4RT2A 4UB2A 4XQ8A 1KEJA 3RH5A 3RJGA 4PHDA 5IIKA 7ICRA 1BPZA 4RQ0A 4KLTA 1BPEA 4EBJA 3UQ0A 4QZEA 3OGUA 3C2MA 5IIOA 2BCVA 2W9MA 2ZH7A 8ICGA 5D4BA 7ICNA 1ZQIA 4ATBB 4MFFA 4TUPA 8ICLA 5J2FA 3OVAA 5J2GA 1FA0A 5J2EA 4X4RA 1BPDA 5HREA 5DKWA 3RJJA 4I27A 5J0XA 1JAJA 3H39A 5J2DA 3JPSA 3OVSA 8ICQA 4PPXA 3HWTA 4YN4A 4GXIA 7ICKA 1NO5A 4JWNA 4YMMA 3HW8A 3ISBA 4K4HA 4RPXA 5DB6A 3RH6A 5CP2A 4AT8B 3HX0A 4RPZA 8ICZA 2M2UA 4KLUA 5IINA 1TVAA 5TZVA 4TUQA 2ZH2A 4ATBA 3AQLA 4QZFA 4X4QA 1R8CA 7ICSA 4TURA 5J2HA 4P4PA 3MGHA 4F5PA 1ZQMA 4KLOA 1HUZA 1ZQUA 1XSLA 1TFWA 2VANA 1ZJNA 9ICSA 4NLKA 5DBBA 2ZH8A 5J0SA 4WC2A 9ICOA 7ICVA 4EP7A 3UQ2A 4FHWA 3TFRA 4KLIA 5HRDA 4M9HA 4FHYA 3C2KA 5CJ7A 4Z6EA 5J2IA 3HJ1A 1MQ2A 3JZ0A 1ZQVA 4PGYA 4AT8A 4KLSA 5DB7A 5J0YA 4Z6DA 1Q78A 4WC4A 4MFAA 2DRBA 4X0BA 5J0QA 4QZ9A 5CB1A 1ZQPA 1JMSA 7ICHA 1ZQEA 4UB3A 1ZQNA 4I2JA 4UB5A 2DVIA 4RPYA 3V7JA 4P2HA 4GXJA 1ZQAA 4I2CA 4UB4A 1ZQFA 2DR7A 7ICJA 4X4OA 3AU6A 1XSNA 2RFFA 9ICMA 3WFPA 2Q66A 3HIYA 4WC7A 4QZBA 4XUSA 4RQ4A 4F5NA 5IILA 2BCSA 3LQCB 4NY8A 7ICPA 4QZGA 2PFOA 4M47A 4I29A 4KLQA 4QZHA 2BPGA 3UXPA 9ICHA 5J0OA 3L9DA 3H37A 3AQKA 7ICMA 8ICAA 4M0AA 1ZQBA 1ZQJA 4UBBA 4K4IA 1MIYA 4M9NA 4M04A 4X4UA 4IQVA 4X4SA 8ICWA 1OU5A 4QZDA 2ISOA 4UBCA 2PXIA 3ISDA 2HHPA 4MF8A 1ZQXA 1ZQTA 1MQ3A 4O5KA 1R8AA 1VFGA 5BOMA 8ICPA 4UD4A 5HR9A 4AT9B 3OUYB 3B0XA 4X5VA 8ICVA 2GWSA 1ZQQA 5HHIA 5J0UA 4X4TA 4RWQA 4RQ6A 2ZH6A 5J2KA 1ZQRA 4E7XA 8ICFA 3C5GA 9ICJA 2ISPA 1ZQCA 1PX5A 4RT3A 3PMLA 1BPYA 1ZQZA 4RWOA 2DR8A 9ICKA 4UAZA 3GDXA 5IIJA 4RQ8A 3MDCA 1XSPA 5CHGA 1UEVA 4P4MA 5HRHA 3PNCA 5CWRA 3JPQA 4X4NA 2M2TA 3AQMA 4FHPA 3K75D 1JN3A 3WFOA 2BCRA 9ICQA 5CA7A 4AT9A 1R8BA 1BPXA 2FMPA 3JYYA 4RWPA 3OUYA 3NYBA 5IIIA 1MIWA 4IQTA 4PHEA 4RQ3A 4NLZA 2BPFA 4QZIA 9ICNA 4WBZA 4NM2A 9ICPA 2ID1A 7ICTA 3MBYA 4PH5A 1UEUA 4R63A 3RJKA 4TUSA 1HUOA 4WCWA 2IHMA 3MDAA 1ZQGA 2BCQA 1UETA 5J2BA 2DR5A 4NM1A 5J0RA 4DOAA 5J0WA 4F5OA 4M5DA 9ICXA 1JQRA 4FHXA 1TFYA 1RPLA 4XRHA 5EOZA 4R65A 4I2AA 3RJIA 4IQWA 5J2AA 9ICLA 2FMQA 3AQNA 1NOMA 3JPRA 9ICBA 4X4VA 4KLGA 3WFRE 2BE3A 2ZH5A 9ICVA 4X4PA 3UPSA 4F5QA 4PHPA 2PFQA 5D46A 3JPPA 2O1PA 4KLEA 1TV9A 4P4OA 4I2BA 3WFSC 1KDHA 3HJ4A 3WFQE 2PFPA 3V7KA 4NKUA 2FMSA 8ICNA 4XQ7A 4LZGA 1ZQSA 1ZQYA 4WC6A 4M2YA 4R66A 4I2DA 2M2VA 4JWMA 4KLHA 7ICUA 8ICMA 4PHAA 9ICWA 4WBYA 2P66A 5DBCA 2I9GA 4RQ1A 1RZTA 1R89A 4FH3A 9ICEA 3RH4A 3AU2A 5J0PA 2ZHBA 8ICTA 7ICIA 4LT6A 2ZH9A 7ICEA 4FH5A 5HRGA 4UAYA 5F2VO 9ICGA 4I28A 5J0TA 2ZH4A 3JPNA 3RJEA 2ZHAA 4QZCA 4LVSA 1ZQKA 3UXOA 2ZH3A 4DOBA 4DO9A 5BOLA 4O5CA 4KLJA 3B0YA 4E8FA 5HRFA 1ZQHA 4Z6CA 4MF2A 3C66A 3V72A 1Q79A 5DDYA 3RJHA 4KLLA 8ICXA 4AT7B 4UD5A 4RQ7A 4MFCA 5HHHA 4PGQA 8ICJA 5HRLA 4EBKA 4I2IA 1ZQOA 5J2CA 3PMNA 3JPOA 3ISCA 4F5RA 5D49A 1MIVA 4PGXA 5DDMA 8ICBA 3OV7A 4YD2A 9ICCA 1VJ7A 4KLFA 7ICFA 4YMOA 8ICEA 9ICFA 8ICYA 2M2WA 9ICUA 4NLNA
chains in the Genus database with same CATH superfamily
5DEDA 5HRKA 9ICRA 4IQUA 8ICIA 1WOTA 1YLQA 3MGIA 4FO6A 4GXKA 2BPCA 4OAHA 3C2LA 4IG8A 3RJFA 8ICRA 4RQ5A 8ICHA 2PFNA 4AT7A 2DR9A 5J29A 3JPTA 4I2GA 5BPCA 1GPJA 7ICLA 5CR0A 2B4VA 4X0AA 4YMNA 3AUOA 9ICAA 4RQ2A 1ZQDA 4M9JA 7ICOA 2O5AA 4M9LA 4NXZA 4Z6FA 5IIMA 4OAIZ 4KLDA 4K4GA 5DECA 1ZQLA 8ICSA 4FHVA 4WOYA 2BCUA 2DRAA 3V7LA 4WC3A 8ICCA 4UB1A 4YD1A 1ZJMA 4LZDA 1ZQWA 3UPQA 4QZ8A 4O9MA 3C5FA 4DOCA 4XA5A 4WC0A 3TFSA 3OWGA 5HC9A 5HRBA 8ICKA 4YCXA 3H38A 5DBAA 2PBEA 4UAWA 4R64A 9ICTA 4NXXA 3UXNA 1F5AA 4KLMA 4NKTA 5DB9A 4OAGA 3LK9A 4RWNA 4M9GA 8ICOA 4I2FA 4WQLA 4I2HA 5HRIA 3C18A 4S3NA 3OVBA 3H3AA 4E80A 1BPBA 7ICQA 2NRKA 4WC5A 5DB8A 4O5EA 4K8VA 4I2EA 4LEWA 4WC1A 7ICGA 1V4AA 8ICUA 4NXUA 1KNYA 5J2JA 4QZAA 2ZH1A 9ICIA 4RT2A 2IUBA 4UB2A 4XQ8A 1KEJA 3RH5A 3RJGA 4PHDA 5IIKA 7ICRA 1BPZA 4RQ0A 4I0UA 4KLTA 1BPEA 4O69A 4EBJA 3UQ0A 4QZEA 3OGUA 3C2MA 5IIOA 2BCVA 2W9MA 2ZH7A 8ICGA 5D4BA 7ICNA 1ZQIA 4ATBB 4MFFA 2B51A 4TUPA 8ICLA 5J2FA 3OVAA 5J2GA 1FA0A 5J2EA 4X4RA 1BPDA 5HREA 5DKWA 3RJJA 4I27A 5J0XA 1JAJA 3H39A 5J2DA 3JPSA 3OVSA 8ICQA 4PPXA 3HWTA 4YN4A 4GXIA 7ICKA 1NO5A 4JWNA 4YMMA 2EWRA 3HW8A 3ISBA 4K4HA 4RPXA 5DB6A 3K7DA 3RH6A 5CP2A 4AT8B 3HX0A 3ER8C 4RPZA 8ICZA 2M2UA 4KLUA 5IINA 1TVAA 5TZVA 4TUQA 2ZH2A 4ATBA 3AQLA 4QZFA 2B56A 2HN1A 4X4QA 1R8CA 7ICSA 4TURA 5J2HA 4P4PA 3MGHA 4F5PA 1ZQMA 4KLOA 1HUZA 1ZQUA 1XSLA 1TFWA 2VANA 1ZJNA 9ICSA 4NLKA 2GAFD 4EGWA 5DBBA 2ZH8A 5J0SA 4WC2A 4K97A 4O67A 9ICOA 7ICVA 4LEZA 4NXWA 4EP7A 3UQ2A 4FHWA 3TFRA 4KLIA 5HRDA 4NXVA 4M9HA 4FHYA 3C2KA 5CJ7A 4Z6EA 5J2IA 3HJ1A 1MQ2A 3JZ0A 1ZQVA 4PGYA 4AT8A 4KLSA 5DB7A 5J0YA 4Z6DA 1Q78A 4WC4A 5D61A 4MFAA 2DRBA 4X0BA 5J0QA 4QZ9A 5CB1A 1ZQPA 5B3PA 1JMSA 7ICHA 1ZQEA 4UB3A 1ZQNA 4I2JA 4UB5A 2DVIA 4RPYA 3V7JA 4P2HA 4GXJA 1ZQAA 4K9BA 4I2CA 4JLZA 4UB4A 1ZQFA 2DR7A 3ERCC 4X4OA 7ICJA 3AU6A 1XSNA 4K99A 2RFFA 9ICMA 3WFPA 2Q66A 3HIYA 4WC7A 4QZBA 4XUSA 4RQ4A 4F5NA 5IILA 2BCSA 3LQCB 4NY8A 7ICPA 4JLXA 4QZGA 3EF2A 2PFOA 4M47A 4WH5A 4I29A 4K96A 4KLQA 4O68A 3NKUA 4QZHA 2BPGA 3UXPA 9ICHA 5J0OA 3L9DA 3H37A 3AQKA 7ICMA 8ICAA 4M0AA 1ZQBA 1ZQJA 4UBBA 4K4IA 1MIYA 4M9NA 4M04A 4X4UA 5CFTA 4IQVA 4X4SA 3ER9B 8ICWA 1OU5A 4QZDA 2ISOA 4UBCA 2PXIA 3ISDA 2HHPA 4MF8A 1ZQXA 1ZQTA 1MQ3A 4EEBA 4O5KA 1R8AA 1VFGA 3CK6A 3NVOA 5BOMA 8ICPA 4UD4A 5HR9A 4AT9B 4EV6A 3OUYB 3B0XA 4X5VA 8ICVA 2GWSA 1ZQQA 5HHIA 5J0UA 4X4TA 4RWQA 4RQ6A 2ZH6A 5J2KA 1ZQRA 4E7XA 4KM5A 8ICFA 3C5GA 9ICJA 2ISPA 1ZQCA 1PX5A 4RT3A 3PMLA 1BPYA 1ZQZA 4OAFA 4RWOA 2DR8A 9ICKA 4UAZA 3GDXA 5IIJA 4RQ8A 4N7RA 3MDCA 1XSPA 5CHGA 1UEVA 4P4MA 5HRHA 3PNCA 5CWRA 3JPQA 4X4NA 2M2TA 3AQMA 4FHPA 3K75D 1JN3A 3WFOA 2BCRA 9ICQA 5CA7A 4AT9A 1R8BA 1BPXA 2FMPA 3JYYA 5D63A 4RWPA 3OUYA 3NYBA 5IIIA 4EEDA 1MIWA 4IQTA 4PHEA 4RQ3A 4NLZA 4HX0A 2BPFA 4QZIA 9ICNA 4WBZA 4NM2A 9ICPA 2ID1A 5CHEA 3MBYA 7ICTA 4PH5A 1UEUA 4LEYA 2BBHA 4NXTA 4R63A 3RJKA 4TUSA 1HUOA 4WCWA 2IHMA 3MDAA 1ZQGA 2BCQA 1UETA 5J2BA 2DR5A 4MKPA 4NM1A 5J0RA 4DOAA 5J0WA 4F5OA 4M5DA 2BBJA 9ICXA 1JQRA 4FHXA 1TFYA 1RPLA 4XRHA 5EOZA 4R65A 4I2AA 3RJIA 4IQWA 4XJEA 5J2AA 3NWIA 9ICLA 2FMQA 3AQNA 1NOMA 3JPRA 5CFUA 9ICBA 4X4VA 4KLGA 3WFRE 2BE3A 2ZH5A 9ICVA 4X4PA 3UPSA 4F5QA 4PHPA 2PFQA 5D46A 3JPPA 2O1PA 4KLEA 1TV9A 4P4OA 3JCFA 2IHOA 4I2BA 3WFSC 1KDHA 3HJ4A 3WFQE 5CFSA 2PFPA 3V7KA 4NKUA 2FMSA 8ICNA 4XQ7A 4LZGA 5D62A 1ZQSA 1ZQYA 4WC6A 4M2YA 5B3QA 4R66A 4I2DA 2M2VA 4JWMA 4KLHA 7ICUA 8ICMA 4PHAA 9ICWA 4WBYA 2P66A 4WQKA 5DBCA 2I9GA 4RQ1A 1RZTA 1R89A 4FH3A 9ICEA 3RH4A 3AU2A 5J0PA 2ZHBA 8ICTA 4O6AA 4LT6A 2ZH9A 7ICIA 7ICEA 4FH5A 2HN2A 5HRGA 4UAYA 5F2VO 9ICGA 4I28A 5J0TA 2ZH4A 3JPNA 2FCLA 4K9AA 3RJEA 2ZHAA 4QZCA 4LVSA 1ZQKA 3UXOA 2ZH3A 4DOBA 3PHZA 4DO9A 2GA9D 5BOLA 4O5CA 4KLJA 3B0YA 4E8FA 5HRFA 1ZQHA 4Z6CA 4K98A 3C66A 3V72A 1Q79A 5DDYA 3RJHA 4MF2A 4KLLA 8ICXA 4AT7B 4UD5A 4RQ7A 4MFCA 5HHHA 4PGQA 8ICJA 5HRLA 4EBKA 4I2IA 1ZQOA 5J2CA 3PMNA 3JPOA 3ISCA 4F5RA 5D49A 1MIVA 4PGXA 5DDMA 8ICBA 3OV7A 4KB6A 4YD2A 9ICCA 1VJ7A 4KLFA 3MCRA 5JTGA 7ICFA 4YMOA 4LEVA 4FO1A 8ICEA 9ICFA 8ICYA 2M2WA 9ICUA 4NLNA
chains in the Genus database with same CATH topology
5DEDA 5HRKA 9ICRA 4IQUA 8ICIA 1WOTA 1YLQA 3MGIA 4FO6A 4GXKA 2BPCA 3C2LA 4IG8A 3RJFA 8ICRA 4RQ5A 8ICHA 2PFNA 4AT7A 2DR9A 5J29A 3JPTA 4I2GA 5BPCA 7ICLA 5CR0A 4X0AA 4YMNA 3AUOA 9ICAA 4RQ2A 1ZQDA 4M9JA 7ICOA 2O5AA 4M9LA 4NXZA 4Z6FA 5IIMA 4KLDA 4K4GA 5DECA 1ZQLA 8ICSA 4FHVA 2BCUA 2DRAA 3V7LA 4WC3A 8ICCA 4UB1A 4YD1A 1ZJMA 4LZDA 1ZQWA 3UPQA 4QZ8A 4O9MA 3C5FA 4DOCA 4XA5A 4WC0A 3TFSA 5HC9A 5HRBA 8ICKA 4YCXA 3H38A 5DBAA 2PBEA 4UAWA 4R64A 9ICTA 3UXNA 1F5AA 4KLMA 4NKTA 5DB9A 3LK9A 4RWNA 4M9GA 8ICOA 4I2FA 4I2HA 5HRIA 3C18A 4S3NA 3OVBA 3H3AA 4E80A 1BPBA 7ICQA 2NRKA 4WC5A 5DB8A 4O5EA 4I2EA 4WC1A 7ICGA 1V4AA 8ICUA 1KNYA 5J2JA 4QZAA 2ZH1A 9ICIA 4RT2A 4UB2A 4XQ8A 1KEJA 3RH5A 3RJGA 4PHDA 5IIKA 7ICRA 1BPZA 4RQ0A 4KLTA 1BPEA 4EBJA 3UQ0A 4QZEA 3OGUA 3C2MA 5IIOA 2BCVA 2W9MA 2ZH7A 8ICGA 5D4BA 7ICNA 1ZQIA 4ATBB 4MFFA 4TUPA 8ICLA 5J2FA 3OVAA 5J2GA 1FA0A 5J2EA 4X4RA 1BPDA 5HREA 5DKWA 3RJJA 4I27A 5J0XA 1JAJA 3H39A 5J2DA 3JPSA 3OVSA 8ICQA 4PPXA 3HWTA 4YN4A 4GXIA 7ICKA 1NO5A 4JWNA 4YMMA 3HW8A 3ISBA 4K4HA 4RPXA 5DB6A 3RH6A 5CP2A 4AT8B 3HX0A 4RPZA 8ICZA 2M2UA 4KLUA 5IINA 1TVAA 5TZVA 4TUQA 2ZH2A 4ATBA 3AQLA 4QZFA 4X4QA 1R8CA 7ICSA 4TURA 5J2HA 4P4PA 3MGHA 4F5PA 1ZQMA 4KLOA 1HUZA 1ZQUA 1XSLA 1TFWA 2VANA 1ZJNA 9ICSA 4NLKA 5DBBA 2ZH8A 5J0SA 4WC2A 9ICOA 7ICVA 4EP7A 3UQ2A 4FHWA 3TFRA 4KLIA 5HRDA 4M9HA 4FHYA 3C2KA 5CJ7A 4Z6EA 5J2IA 3HJ1A 1MQ2A 3JZ0A 1ZQVA 4PGYA 4AT8A 4KLSA 5DB7A 5J0YA 4Z6DA 1Q78A 4WC4A 4MFAA 2DRBA 4X0BA 5J0QA 4QZ9A 5CB1A 1ZQPA 1JMSA 7ICHA 1ZQEA 4UB3A 1ZQNA 4I2JA 4UB5A 2DVIA 4RPYA 3V7JA 4P2HA 4GXJA 1ZQAA 4I2CA 4UB4A 1ZQFA 2DR7A 7ICJA 4X4OA 3AU6A 1XSNA 2RFFA 9ICMA 3WFPA 2Q66A 3HIYA 4WC7A 4QZBA 4XUSA 4RQ4A 4F5NA 5IILA 2BCSA 3LQCB 4NY8A 7ICPA 4QZGA 2PFOA 4M47A 4I29A 4KLQA 4QZHA 2BPGA 3UXPA 9ICHA 5J0OA 3L9DA 3H37A 3AQKA 7ICMA 8ICAA 4M0AA 1ZQBA 1ZQJA 4UBBA 4K4IA 1MIYA 4M9NA 4M04A 4X4UA 4IQVA 4X4SA 8ICWA 1OU5A 4QZDA 2ISOA 4UBCA 2PXIA 3ISDA 2HHPA 4MF8A 1ZQXA 1ZQTA 1MQ3A 4O5KA 1R8AA 1VFGA 5BOMA 8ICPA 4UD4A 5HR9A 4AT9B 3OUYB 3B0XA 4X5VA 8ICVA 2GWSA 1ZQQA 5HHIA 5J0UA 4X4TA 4RWQA 4RQ6A 2ZH6A 5J2KA 1ZQRA 4E7XA 8ICFA 3C5GA 9ICJA 2ISPA 1ZQCA 1PX5A 4RT3A 3PMLA 1BPYA 1ZQZA 4RWOA 2DR8A 9ICKA 4UAZA 3GDXA 5IIJA 4RQ8A 3MDCA 1XSPA 5CHGA 1UEVA 4P4MA 5HRHA 3PNCA 5CWRA 3JPQA 4X4NA 2M2TA 3AQMA 4FHPA 3K75D 1JN3A 3WFOA 2BCRA 9ICQA 5CA7A 4AT9A 1R8BA 1BPXA 2FMPA 3JYYA 4RWPA 3OUYA 3NYBA 5IIIA 1MIWA 4IQTA 4PHEA 4RQ3A 4NLZA 2BPFA 4QZIA 9ICNA 4WBZA 4NM2A 9ICPA 2ID1A 7ICTA 3MBYA 4PH5A 1UEUA 4R63A 3RJKA 4TUSA 1HUOA 4WCWA 2IHMA 3MDAA 1ZQGA 2BCQA 1UETA 5J2BA 2DR5A 4NM1A 5J0RA 4DOAA 5J0WA 4F5OA 4M5DA 9ICXA 1JQRA 4FHXA 1TFYA 1RPLA 4XRHA 5EOZA 4R65A 4I2AA 3RJIA 4IQWA 5J2AA 9ICLA 2FMQA 3AQNA 1NOMA 3JPRA 9ICBA 4X4VA 4KLGA 3WFRE 2BE3A 2ZH5A 9ICVA 4X4PA 3UPSA 4F5QA 4PHPA 2PFQA 5D46A 3JPPA 2O1PA 4KLEA 1TV9A 4P4OA 4I2BA 3WFSC 1KDHA 3HJ4A 3WFQE 2PFPA 3V7KA 4NKUA 2FMSA 8ICNA 4XQ7A 4LZGA 1ZQSA 1ZQYA 4WC6A 4M2YA 4R66A 4I2DA 2M2VA 4JWMA 4KLHA 7ICUA 8ICMA 4PHAA 9ICWA 4WBYA 2P66A 5DBCA 2I9GA 4RQ1A 1RZTA 1R89A 4FH3A 9ICEA 3RH4A 3AU2A 5J0PA 2ZHBA 8ICTA 7ICIA 4LT6A 2ZH9A 7ICEA 4FH5A 5HRGA 4UAYA 5F2VO 9ICGA 4I28A 5J0TA 2ZH4A 3JPNA 3RJEA 2ZHAA 4QZCA 4LVSA 1ZQKA 3UXOA 2ZH3A 4DOBA 4DO9A 5BOLA 4O5CA 4KLJA 3B0YA 4E8FA 5HRFA 1ZQHA 4Z6CA 4MF2A 3C66A 3V72A 1Q79A 5DDYA 3RJHA 4KLLA 8ICXA 4AT7B 4UD5A 4RQ7A 4MFCA 5HHHA 4PGQA 8ICJA 5HRLA 4EBKA 4I2IA 1ZQOA 5J2CA 3PMNA 3JPOA 3ISCA 4F5RA 5D49A 1MIVA 4PGXA 5DDMA 8ICBA 3OV7A 4YD2A 9ICCA 1VJ7A 4KLFA 7ICFA 4YMOA 8ICEA 9ICFA 8ICYA 2M2WA 9ICUA 4NLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DED A;  5HRK A;  9ICR A;  4IQU A;  8ICI A;  1WOT A;  1YLQ A;  3MGI A;  4FO6 A;  4GXK A;  2BPC A;  3C2L A;  4IG8 A;  3RJF A;  8ICR A;  4RQ5 A;  8ICH A;  2PFN A;  4AT7 A;  2DR9 A;  5J29 A;  3JPT A;  4I2G A;  5BPC A;  7ICL A;  5CR0 A;  4X0A A;  4YMN A;  3AUO A;  9ICA A;  4RQ2 A;  1ZQD A;  4M9J A;  7ICO A;  2O5A A;  4M9L A;  4NXZ A;  4Z6F A;  5IIM A;  4KLD A;  4K4G A;  5DEC A;  1ZQL A;  8ICS A;  4FHV A;  2BCU A;  2DRA A;  3V7L A;  4WC3 A;  8ICC A;  4UB1 A;  4YD1 A;  1ZJM A;  4LZD A;  1ZQW A;  3UPQ A;  4QZ8 A;  4O9M A;  3C5F A;  4DOC A;  4XA5 A;  4WC0 A;  3TFS A;  5HC9 A;  5HRB A;  8ICK A;  4YCX A;  3H38 A;  5DBA A;  2PBE A;  4UAW A;  4R64 A;  9ICT A;  3UXN A;  1F5A A;  4KLM A;  4NKT A;  5DB9 A;  3LK9 A;  4RWN A;  4M9G A;  8ICO A;  4I2F A;  4I2H A;  5HRI A;  3C18 A;  4S3N A;  3OVB A;  3H3A A;  4E80 A;  1BPB A;  7ICQ A;  2NRK A;  4WC5 A;  5DB8 A;  4O5E A;  4I2E A;  4WC1 A;  7ICG A;  1V4A A;  8ICU A;  1KNY A;  5J2J A;  4QZA A;  2ZH1 A;  9ICI A;  4RT2 A;  4UB2 A;  4XQ8 A;  1KEJ A;  3RH5 A;  3RJG A;  4PHD A;  5IIK A;  7ICR A;  1BPZ A;  4RQ0 A;  4KLT A;  1BPE A;  4EBJ A;  3UQ0 A;  4QZE A;  3OGU A;  3C2M A;  5IIO A;  2BCV A;  2W9M A;  2ZH7 A;  8ICG A;  5D4B A;  7ICN A;  1ZQI A;  4ATB B;  4MFF A;  4TUP A;  8ICL A;  5J2F A;  3OVA A;  5J2G A;  1FA0 A;  5J2E A;  4X4R A;  1BPD A;  5HRE A;  5DKW A;  3RJJ A;  4I27 A;  5J0X A;  1JAJ A;  3H39 A;  5J2D A;  3JPS A;  3OVS A;  8ICQ A;  4PPX A;  3HWT A;  4YN4 A;  4GXI A;  7ICK A;  1NO5 A;  4JWN A;  4YMM A;  3HW8 A;  3ISB A;  4K4H A;  4RPX A;  5DB6 A;  3RH6 A;  5CP2 A;  4AT8 B;  3HX0 A;  4RPZ A;  8ICZ A;  2M2U A;  4KLU A;  5IIN A;  1TVA A;  5TZV A;  4TUQ A;  2ZH2 A;  4ATB A;  3AQL A;  4QZF A;  4X4Q A;  1R8C A;  7ICS A;  4TUR A;  5J2H A;  4P4P A;  3MGH A;  4F5P A;  1ZQM A;  4KLO A;  1HUZ A;  1ZQU A;  1XSL A;  1TFW A;  2VAN A;  1ZJN A;  9ICS A;  4NLK A;  5DBB A;  2ZH8 A;  5J0S A;  4WC2 A;  9ICO A;  7ICV A;  4EP7 A;  3UQ2 A;  4FHW A;  3TFR A;  4KLI A;  5HRD A;  4M9H A;  4FHY A;  3C2K A;  5CJ7 A;  4Z6E A;  5J2I A;  3HJ1 A;  1MQ2 A;  3JZ0 A;  1ZQV A;  4PGY A;  4AT8 A;  4KLS A;  5DB7 A;  5J0Y A;  4Z6D A;  1Q78 A;  4WC4 A;  4MFA A;  2DRB A;  4X0B A;  5J0Q A;  4QZ9 A;  5CB1 A;  1ZQP A;  1JMS A;  7ICH A;  1ZQE A;  4UB3 A;  1ZQN A;  4I2J A;  4UB5 A;  2DVI A;  4RPY A;  3V7J A;  4P2H A;  4GXJ A;  1ZQA A;  4I2C A;  4UB4 A;  1ZQF A;  2DR7 A;  7ICJ A;  4X4O A;  3AU6 A;  1XSN A;  2RFF A;  9ICM A;  3WFP A;  2Q66 A;  3HIY A;  4WC7 A;  4QZB A;  4XUS A;  4RQ4 A;  4F5N A;  5IIL A;  2BCS A;  3LQC B;  4NY8 A;  7ICP A;  4QZG A;  2PFO A;  4M47 A;  4I29 A;  4KLQ A;  4QZH A;  2BPG A;  3UXP A;  9ICH A;  5J0O A;  3L9D A;  3H37 A;  3AQK A;  7ICM A;  8ICA A;  4M0A A;  1ZQB A;  1ZQJ A;  4UBB A;  4K4I A;  1MIY A;  4M9N A;  4M04 A;  4X4U A;  4IQV A;  4X4S A;  8ICW A;  1OU5 A;  4QZD A;  2ISO A;  4UBC A;  2PXI A;  3ISD A;  2HHP A;  4MF8 A;  1ZQX A;  1ZQT A;  1MQ3 A;  4O5K A;  1R8A A;  1VFG A;  5BOM A;  8ICP A;  4UD4 A;  5HR9 A;  4AT9 B;  3OUY B;  3B0X A;  4X5V A;  8ICV A;  2GWS A;  1ZQQ A;  5HHI A;  5J0U A;  4X4T A;  4RWQ A;  4RQ6 A;  2ZH6 A;  5J2K A;  1ZQR A;  4E7X A;  8ICF A;  3C5G A;  9ICJ A;  2ISP A;  1ZQC A;  1PX5 A;  4RT3 A;  3PML A;  1BPY A;  1ZQZ A;  4RWO A;  2DR8 A;  9ICK A;  4UAZ A;  3GDX A;  5IIJ A;  4RQ8 A;  3MDC A;  1XSP A;  5CHG A;  1UEV A;  4P4M A;  5HRH A;  3PNC A;  5CWR A;  3JPQ A;  4X4N A;  2M2T A;  3AQM A;  4FHP A;  3K75 D;  1JN3 A;  3WFO A;  2BCR A;  9ICQ A;  5CA7 A;  4AT9 A;  1R8B A;  1BPX A;  2FMP A;  3JYY A;  4RWP A;  3OUY A;  3NYB A;  5III A;  1MIW A;  4IQT A;  4PHE A;  4RQ3 A;  4NLZ A;  2BPF A;  4QZI A;  9ICN A;  4WBZ A;  4NM2 A;  9ICP A;  2ID1 A;  7ICT A;  3MBY A;  4PH5 A;  1UEU A;  4R63 A;  3RJK A;  4TUS A;  1HUO A;  4WCW A;  2IHM A;  3MDA A;  1ZQG A;  2BCQ A;  1UET A;  5J2B A;  2DR5 A;  4NM1 A;  5J0R A;  4DOA A;  5J0W A;  4F5O A;  4M5D A;  9ICX A;  1JQR A;  4FHX A;  1TFY A;  1RPL A;  4XRH A;  5EOZ A;  4R65 A;  4I2A A;  3RJI A;  4IQW A;  5J2A A;  9ICL A;  2FMQ A;  3AQN A;  1NOM A;  3JPR A;  9ICB A;  4X4V A;  4KLG A;  3WFR E;  2BE3 A;  2ZH5 A;  9ICV A;  4X4P A;  3UPS A;  4F5Q A;  4PHP A;  2PFQ A;  5D46 A;  3JPP A;  2O1P A;  4KLE A;  1TV9 A;  4P4O A;  4I2B A;  3WFS C;  1KDH A;  3HJ4 A;  3WFQ E;  2PFP A;  3V7K A;  4NKU A;  2FMS A;  8ICN A;  4XQ7 A;  4LZG A;  1ZQS A;  1ZQY A;  4WC6 A;  4M2Y A;  4R66 A;  4I2D A;  2M2V A;  4JWM A;  4KLH A;  7ICU A;  8ICM A;  4PHA A;  9ICW A;  4WBY A;  2P66 A;  5DBC A;  2I9G A;  4RQ1 A;  1RZT A;  1R89 A;  4FH3 A;  9ICE A;  3RH4 A;  3AU2 A;  5J0P A;  2ZHB A;  8ICT A;  7ICI A;  4LT6 A;  2ZH9 A;  7ICE A;  4FH5 A;  5HRG A;  4UAY A;  5F2V O;  9ICG A;  4I28 A;  5J0T A;  2ZH4 A;  3JPN A;  3RJE A;  2ZHA A;  4QZC A;  4LVS A;  1ZQK A;  3UXO A;  2ZH3 A;  4DOB A;  4DO9 A;  5BOL A;  4O5C A;  4KLJ A;  3B0Y A;  4E8F A;  5HRF A;  1ZQH A;  4Z6C A;  4MF2 A;  3C66 A;  3V72 A;  1Q79 A;  5DDY A;  3RJH A;  4KLL A;  8ICX A;  4AT7 B;  4UD5 A;  4RQ7 A;  4MFC A;  5HHH A;  4PGQ A;  8ICJ A;  5HRL A;  4EBK A;  4I2I A;  1ZQO A;  5J2C A;  3PMN A;  3JPO A;  3ISC A;  4F5R A;  5D49 A;  1MIV A;  4PGX A;  5DDM A;  8ICB A;  3OV7 A;  4YD2 A;  9ICC A;  1VJ7 A;  4KLF A;  7ICF A;  4YMO A;  8ICE A;  9ICF A;  8ICY A;  2M2W A;  9ICU A;  4NLN A; 
#chains in the Genus database with same CATH topology
 5DED A;  5HRK A;  9ICR A;  4IQU A;  8ICI A;  1WOT A;  1YLQ A;  3MGI A;  4FO6 A;  4GXK A;  2BPC A;  4OAH A;  3C2L A;  4IG8 A;  3RJF A;  8ICR A;  4RQ5 A;  8ICH A;  2PFN A;  4AT7 A;  2DR9 A;  5J29 A;  3JPT A;  4I2G A;  5BPC A;  1GPJ A;  7ICL A;  5CR0 A;  2B4V A;  4X0A A;  4YMN A;  3AUO A;  9ICA A;  4RQ2 A;  1ZQD A;  4M9J A;  7ICO A;  2O5A A;  4M9L A;  4NXZ A;  4Z6F A;  5IIM A;  4OAI Z;  4KLD A;  4K4G A;  5DEC A;  1ZQL A;  8ICS A;  4FHV A;  4WOY A;  2BCU A;  2DRA A;  3V7L A;  4WC3 A;  8ICC A;  4UB1 A;  4YD1 A;  1ZJM A;  4LZD A;  1ZQW A;  3UPQ A;  4QZ8 A;  4O9M A;  3C5F A;  4DOC A;  4XA5 A;  4WC0 A;  3TFS A;  3OWG A;  5HC9 A;  5HRB A;  8ICK A;  4YCX A;  3H38 A;  5DBA A;  2PBE A;  4UAW A;  4R64 A;  9ICT A;  4NXX A;  3UXN A;  1F5A A;  4KLM A;  4NKT A;  5DB9 A;  4OAG A;  3LK9 A;  4RWN A;  4M9G A;  8ICO A;  4I2F A;  4WQL A;  4I2H A;  5HRI A;  3C18 A;  4S3N A;  3OVB A;  3H3A A;  4E80 A;  1BPB A;  7ICQ A;  2NRK A;  4WC5 A;  5DB8 A;  4O5E A;  4K8V A;  4I2E A;  4LEW A;  4WC1 A;  7ICG A;  1V4A A;  8ICU A;  4NXU A;  1KNY A;  5J2J A;  4QZA A;  2ZH1 A;  9ICI A;  4RT2 A;  2IUB A;  4UB2 A;  4XQ8 A;  1KEJ A;  3RH5 A;  3RJG A;  4PHD A;  5IIK A;  7ICR A;  1BPZ A;  4RQ0 A;  4I0U A;  4KLT A;  1BPE A;  4O69 A;  4EBJ A;  3UQ0 A;  4QZE A;  3OGU A;  3C2M A;  5IIO A;  2BCV A;  2W9M A;  2ZH7 A;  8ICG A;  5D4B A;  7ICN A;  1ZQI A;  4ATB B;  4MFF A;  2B51 A;  4TUP A;  8ICL A;  5J2F A;  3OVA A;  5J2G A;  1FA0 A;  5J2E A;  4X4R A;  1BPD A;  5HRE A;  5DKW A;  3RJJ A;  4I27 A;  5J0X A;  1JAJ A;  3H39 A;  5J2D A;  3JPS A;  3OVS A;  8ICQ A;  4PPX A;  3HWT A;  4YN4 A;  4GXI A;  7ICK A;  1NO5 A;  4JWN A;  4YMM A;  2EWR A;  3HW8 A;  3ISB A;  4K4H A;  4RPX A;  5DB6 A;  3K7D A;  3RH6 A;  5CP2 A;  4AT8 B;  3HX0 A;  3ER8 C;  4RPZ A;  8ICZ A;  2M2U A;  4KLU A;  5IIN A;  1TVA A;  5TZV A;  4TUQ A;  2ZH2 A;  4ATB A;  3AQL A;  4QZF A;  2B56 A;  2HN1 A;  4X4Q A;  1R8C A;  7ICS A;  4TUR A;  5J2H A;  4P4P A;  3MGH A;  4F5P A;  1ZQM A;  4KLO A;  1HUZ A;  1ZQU A;  1XSL A;  1TFW A;  2VAN A;  1ZJN A;  9ICS A;  4NLK A;  2GAF D;  4EGW A;  5DBB A;  2ZH8 A;  5J0S A;  4WC2 A;  4K97 A;  4O67 A;  9ICO A;  7ICV A;  4LEZ A;  4NXW A;  4EP7 A;  3UQ2 A;  4FHW A;  3TFR A;  4KLI A;  5HRD A;  4NXV A;  4M9H A;  4FHY A;  3C2K A;  5CJ7 A;  4Z6E A;  5J2I A;  3HJ1 A;  1MQ2 A;  3JZ0 A;  1ZQV A;  4PGY A;  4AT8 A;  4KLS A;  5DB7 A;  5J0Y A;  4Z6D A;  1Q78 A;  4WC4 A;  5D61 A;  4MFA A;  2DRB A;  4X0B A;  5J0Q A;  4QZ9 A;  5CB1 A;  1ZQP A;  5B3P A;  1JMS A;  7ICH A;  1ZQE A;  4UB3 A;  1ZQN A;  4I2J A;  4UB5 A;  2DVI A;  4RPY A;  3V7J A;  4P2H A;  4GXJ A;  1ZQA A;  4K9B A;  4I2C A;  4JLZ A;  4UB4 A;  1ZQF A;  2DR7 A;  3ERC C;  4X4O A;  7ICJ A;  3AU6 A;  1XSN A;  4K99 A;  2RFF A;  9ICM A;  3WFP A;  2Q66 A;  3HIY A;  4WC7 A;  4QZB A;  4XUS A;  4RQ4 A;  4F5N A;  5IIL A;  2BCS A;  3LQC B;  4NY8 A;  7ICP A;  4JLX A;  4QZG A;  3EF2 A;  2PFO A;  4M47 A;  4WH5 A;  4I29 A;  4K96 A;  4KLQ A;  4O68 A;  3NKU A;  4QZH A;  2BPG A;  3UXP A;  9ICH A;  5J0O A;  3L9D A;  3H37 A;  3AQK A;  7ICM A;  8ICA A;  4M0A A;  1ZQB A;  1ZQJ A;  4UBB A;  4K4I A;  1MIY A;  4M9N A;  4M04 A;  4X4U A;  5CFT A;  4IQV A;  4X4S A;  3ER9 B;  8ICW A;  1OU5 A;  4QZD A;  2ISO A;  4UBC A;  2PXI A;  3ISD A;  2HHP A;  4MF8 A;  1ZQX A;  1ZQT A;  1MQ3 A;  4EEB A;  4O5K A;  1R8A A;  1VFG A;  3CK6 A;  3NVO A;  5BOM A;  8ICP A;  4UD4 A;  5HR9 A;  4AT9 B;  4EV6 A;  3OUY B;  3B0X A;  4X5V A;  8ICV A;  2GWS A;  1ZQQ A;  5HHI A;  5J0U A;  4X4T A;  4RWQ A;  4RQ6 A;  2ZH6 A;  5J2K A;  1ZQR A;  4E7X A;  4KM5 A;  8ICF A;  3C5G A;  9ICJ A;  2ISP A;  1ZQC A;  1PX5 A;  4RT3 A;  3PML A;  1BPY A;  1ZQZ A;  4OAF A;  4RWO A;  2DR8 A;  9ICK A;  4UAZ A;  3GDX A;  5IIJ A;  4RQ8 A;  4N7R A;  3MDC A;  1XSP A;  5CHG A;  1UEV A;  4P4M A;  5HRH A;  3PNC A;  5CWR A;  3JPQ A;  4X4N A;  2M2T A;  3AQM A;  4FHP A;  3K75 D;  1JN3 A;  3WFO A;  2BCR A;  9ICQ A;  5CA7 A;  4AT9 A;  1R8B A;  1BPX A;  2FMP A;  3JYY A;  5D63 A;  4RWP A;  3OUY A;  3NYB A;  5III A;  4EED A;  1MIW A;  4IQT A;  4PHE A;  4RQ3 A;  4NLZ A;  4HX0 A;  2BPF A;  4QZI A;  9ICN A;  4WBZ A;  4NM2 A;  9ICP A;  2ID1 A;  5CHE A;  3MBY A;  7ICT A;  4PH5 A;  1UEU A;  4LEY A;  2BBH A;  4NXT A;  4R63 A;  3RJK A;  4TUS A;  1HUO A;  4WCW A;  2IHM A;  3MDA A;  1ZQG A;  2BCQ A;  1UET A;  5J2B A;  2DR5 A;  4MKP A;  4NM1 A;  5J0R A;  4DOA A;  5J0W A;  4F5O A;  4M5D A;  2BBJ A;  9ICX A;  1JQR A;  4FHX A;  1TFY A;  1RPL A;  4XRH A;  5EOZ A;  4R65 A;  4I2A A;  3RJI A;  4IQW A;  4XJE A;  5J2A A;  3NWI A;  9ICL A;  2FMQ A;  3AQN A;  1NOM A;  3JPR A;  5CFU A;  9ICB A;  4X4V A;  4KLG A;  3WFR E;  2BE3 A;  2ZH5 A;  9ICV A;  4X4P A;  3UPS A;  4F5Q A;  4PHP A;  2PFQ A;  5D46 A;  3JPP A;  2O1P A;  4KLE A;  1TV9 A;  4P4O A;  3JCF A;  2IHO A;  4I2B A;  3WFS C;  1KDH A;  3HJ4 A;  3WFQ E;  5CFS A;  2PFP A;  3V7K A;  4NKU A;  2FMS A;  8ICN A;  4XQ7 A;  4LZG A;  5D62 A;  1ZQS A;  1ZQY A;  4WC6 A;  4M2Y A;  5B3Q A;  4R66 A;  4I2D A;  2M2V A;  4JWM A;  4KLH A;  7ICU A;  8ICM A;  4PHA A;  9ICW A;  4WBY A;  2P66 A;  4WQK A;  5DBC A;  2I9G A;  4RQ1 A;  1RZT A;  1R89 A;  4FH3 A;  9ICE A;  3RH4 A;  3AU2 A;  5J0P A;  2ZHB A;  8ICT A;  4O6A A;  4LT6 A;  2ZH9 A;  7ICI A;  7ICE A;  4FH5 A;  2HN2 A;  5HRG A;  4UAY A;  5F2V O;  9ICG A;  4I28 A;  5J0T A;  2ZH4 A;  3JPN A;  2FCL A;  4K9A A;  3RJE A;  2ZHA A;  4QZC A;  4LVS A;  1ZQK A;  3UXO A;  2ZH3 A;  4DOB A;  3PHZ A;  4DO9 A;  2GA9 D;  5BOL A;  4O5C A;  4KLJ A;  3B0Y A;  4E8F A;  5HRF A;  1ZQH A;  4Z6C A;  4K98 A;  3C66 A;  3V72 A;  1Q79 A;  5DDY A;  3RJH A;  4MF2 A;  4KLL A;  8ICX A;  4AT7 B;  4UD5 A;  4RQ7 A;  4MFC A;  5HHH A;  4PGQ A;  8ICJ A;  5HRL A;  4EBK A;  4I2I A;  1ZQO A;  5J2C A;  3PMN A;  3JPO A;  3ISC A;  4F5R A;  5D49 A;  1MIV A;  4PGX A;  5DDM A;  8ICB A;  3OV7 A;  4KB6 A;  4YD2 A;  9ICC A;  1VJ7 A;  4KLF A;  3MCR A;  5JTG A;  7ICF A;  4YMO A;  4LEV A;  4FO1 A;  8ICE A;  9ICF A;  8ICY A;  2M2W A;  9ICU A;  4NLN A; 
#chains in the Genus database with same CATH homology
 5DED A;  5HRK A;  9ICR A;  4IQU A;  8ICI A;  1WOT A;  1YLQ A;  3MGI A;  4FO6 A;  4GXK A;  2BPC A;  3C2L A;  4IG8 A;  3RJF A;  8ICR A;  4RQ5 A;  8ICH A;  2PFN A;  4AT7 A;  2DR9 A;  5J29 A;  3JPT A;  4I2G A;  5BPC A;  7ICL A;  5CR0 A;  4X0A A;  4YMN A;  3AUO A;  9ICA A;  4RQ2 A;  1ZQD A;  4M9J A;  7ICO A;  2O5A A;  4M9L A;  4NXZ A;  4Z6F A;  5IIM A;  4KLD A;  4K4G A;  5DEC A;  1ZQL A;  8ICS A;  4FHV A;  2BCU A;  2DRA A;  3V7L A;  4WC3 A;  8ICC A;  4UB1 A;  4YD1 A;  1ZJM A;  4LZD A;  1ZQW A;  3UPQ A;  4QZ8 A;  4O9M A;  3C5F A;  4DOC A;  4XA5 A;  4WC0 A;  3TFS A;  5HC9 A;  5HRB A;  8ICK A;  4YCX A;  3H38 A;  5DBA A;  2PBE A;  4UAW A;  4R64 A;  9ICT A;  3UXN A;  1F5A A;  4KLM A;  4NKT A;  5DB9 A;  3LK9 A;  4RWN A;  4M9G A;  8ICO A;  4I2F A;  4I2H A;  5HRI A;  3C18 A;  4S3N A;  3OVB A;  3H3A A;  4E80 A;  1BPB A;  7ICQ A;  2NRK A;  4WC5 A;  5DB8 A;  4O5E A;  4I2E A;  4WC1 A;  7ICG A;  1V4A A;  8ICU A;  1KNY A;  5J2J A;  4QZA A;  2ZH1 A;  9ICI A;  4RT2 A;  4UB2 A;  4XQ8 A;  1KEJ A;  3RH5 A;  3RJG A;  4PHD A;  5IIK A;  7ICR A;  1BPZ A;  4RQ0 A;  4KLT A;  1BPE A;  4EBJ A;  3UQ0 A;  4QZE A;  3OGU A;  3C2M A;  5IIO A;  2BCV A;  2W9M A;  2ZH7 A;  8ICG A;  5D4B A;  7ICN A;  1ZQI A;  4ATB B;  4MFF A;  4TUP A;  8ICL A;  5J2F A;  3OVA A;  5J2G A;  1FA0 A;  5J2E A;  4X4R A;  1BPD A;  5HRE A;  5DKW A;  3RJJ A;  4I27 A;  5J0X A;  1JAJ A;  3H39 A;  5J2D A;  3JPS A;  3OVS A;  8ICQ A;  4PPX A;  3HWT A;  4YN4 A;  4GXI A;  7ICK A;  1NO5 A;  4JWN A;  4YMM A;  3HW8 A;  3ISB A;  4K4H A;  4RPX A;  5DB6 A;  3RH6 A;  5CP2 A;  4AT8 B;  3HX0 A;  4RPZ A;  8ICZ A;  2M2U A;  4KLU A;  5IIN A;  1TVA A;  5TZV A;  4TUQ A;  2ZH2 A;  4ATB A;  3AQL A;  4QZF A;  4X4Q A;  1R8C A;  7ICS A;  4TUR A;  5J2H A;  4P4P A;  3MGH A;  4F5P A;  1ZQM A;  4KLO A;  1HUZ A;  1ZQU A;  1XSL A;  1TFW A;  2VAN A;  1ZJN A;  9ICS A;  4NLK A;  5DBB A;  2ZH8 A;  5J0S A;  4WC2 A;  9ICO A;  7ICV A;  4EP7 A;  3UQ2 A;  4FHW A;  3TFR A;  4KLI A;  5HRD A;  4M9H A;  4FHY A;  3C2K A;  5CJ7 A;  4Z6E A;  5J2I A;  3HJ1 A;  1MQ2 A;  3JZ0 A;  1ZQV A;  4PGY A;  4AT8 A;  4KLS A;  5DB7 A;  5J0Y A;  4Z6D A;  1Q78 A;  4WC4 A;  4MFA A;  2DRB A;  4X0B A;  5J0Q A;  4QZ9 A;  5CB1 A;  1ZQP A;  1JMS A;  7ICH A;  1ZQE A;  4UB3 A;  1ZQN A;  4I2J A;  4UB5 A;  2DVI A;  4RPY A;  3V7J A;  4P2H A;  4GXJ A;  1ZQA A;  4I2C A;  4UB4 A;  1ZQF A;  2DR7 A;  7ICJ A;  4X4O A;  3AU6 A;  1XSN A;  2RFF A;  9ICM A;  3WFP A;  2Q66 A;  3HIY A;  4WC7 A;  4QZB A;  4XUS A;  4RQ4 A;  4F5N A;  5IIL A;  2BCS A;  3LQC B;  4NY8 A;  7ICP A;  4QZG A;  2PFO A;  4M47 A;  4I29 A;  4KLQ A;  4QZH A;  2BPG A;  3UXP A;  9ICH A;  5J0O A;  3L9D A;  3H37 A;  3AQK A;  7ICM A;  8ICA A;  4M0A A;  1ZQB A;  1ZQJ A;  4UBB A;  4K4I A;  1MIY A;  4M9N A;  4M04 A;  4X4U A;  4IQV A;  4X4S A;  8ICW A;  1OU5 A;  4QZD A;  2ISO A;  4UBC A;  2PXI A;  3ISD A;  2HHP A;  4MF8 A;  1ZQX A;  1ZQT A;  1MQ3 A;  4O5K A;  1R8A A;  1VFG A;  5BOM A;  8ICP A;  4UD4 A;  5HR9 A;  4AT9 B;  3OUY B;  3B0X A;  4X5V A;  8ICV A;  2GWS A;  1ZQQ A;  5HHI A;  5J0U A;  4X4T A;  4RWQ A;  4RQ6 A;  2ZH6 A;  5J2K A;  1ZQR A;  4E7X A;  8ICF A;  3C5G A;  9ICJ A;  2ISP A;  1ZQC A;  1PX5 A;  4RT3 A;  3PML A;  1BPY A;  1ZQZ A;  4RWO A;  2DR8 A;  9ICK A;  4UAZ A;  3GDX A;  5IIJ A;  4RQ8 A;  3MDC A;  1XSP A;  5CHG A;  1UEV A;  4P4M A;  5HRH A;  3PNC A;  5CWR A;  3JPQ A;  4X4N A;  2M2T A;  3AQM A;  4FHP A;  3K75 D;  1JN3 A;  3WFO A;  2BCR A;  9ICQ A;  5CA7 A;  4AT9 A;  1R8B A;  1BPX A;  2FMP A;  3JYY A;  4RWP A;  3OUY A;  3NYB A;  5III A;  1MIW A;  4IQT A;  4PHE A;  4RQ3 A;  4NLZ A;  2BPF A;  4QZI A;  9ICN A;  4WBZ A;  4NM2 A;  9ICP A;  2ID1 A;  7ICT A;  3MBY A;  4PH5 A;  1UEU A;  4R63 A;  3RJK A;  4TUS A;  1HUO A;  4WCW A;  2IHM A;  3MDA A;  1ZQG A;  2BCQ A;  1UET A;  5J2B A;  2DR5 A;  4NM1 A;  5J0R A;  4DOA A;  5J0W A;  4F5O A;  4M5D A;  9ICX A;  1JQR A;  4FHX A;  1TFY A;  1RPL A;  4XRH A;  5EOZ A;  4R65 A;  4I2A A;  3RJI A;  4IQW A;  5J2A A;  9ICL A;  2FMQ A;  3AQN A;  1NOM A;  3JPR A;  9ICB A;  4X4V A;  4KLG A;  3WFR E;  2BE3 A;  2ZH5 A;  9ICV A;  4X4P A;  3UPS A;  4F5Q A;  4PHP A;  2PFQ A;  5D46 A;  3JPP A;  2O1P A;  4KLE A;  1TV9 A;  4P4O A;  4I2B A;  3WFS C;  1KDH A;  3HJ4 A;  3WFQ E;  2PFP A;  3V7K A;  4NKU A;  2FMS A;  8ICN A;  4XQ7 A;  4LZG A;  1ZQS A;  1ZQY A;  4WC6 A;  4M2Y A;  4R66 A;  4I2D A;  2M2V A;  4JWM A;  4KLH A;  7ICU A;  8ICM A;  4PHA A;  9ICW A;  4WBY A;  2P66 A;  5DBC A;  2I9G A;  4RQ1 A;  1RZT A;  1R89 A;  4FH3 A;  9ICE A;  3RH4 A;  3AU2 A;  5J0P A;  2ZHB A;  8ICT A;  7ICI A;  4LT6 A;  2ZH9 A;  7ICE A;  4FH5 A;  5HRG A;  4UAY A;  5F2V O;  9ICG A;  4I28 A;  5J0T A;  2ZH4 A;  3JPN A;  3RJE A;  2ZHA A;  4QZC A;  4LVS A;  1ZQK A;  3UXO A;  2ZH3 A;  4DOB A;  4DO9 A;  5BOL A;  4O5C A;  4KLJ A;  3B0Y A;  4E8F A;  5HRF A;  1ZQH A;  4Z6C A;  4MF2 A;  3C66 A;  3V72 A;  1Q79 A;  5DDY A;  3RJH A;  4KLL A;  8ICX A;  4AT7 B;  4UD5 A;  4RQ7 A;  4MFC A;  5HHH A;  4PGQ A;  8ICJ A;  5HRL A;  4EBK A;  4I2I A;  1ZQO A;  5J2C A;  3PMN A;  3JPO A;  3ISC A;  4F5R A;  5D49 A;  1MIV A;  4PGX A;  5DDM A;  8ICB A;  3OV7 A;  4YD2 A;  9ICC A;  1VJ7 A;  4KLF A;  7ICF A;  4YMO A;  8ICE A;  9ICF A;  8ICY A;  2M2W A;  9ICU A;  4NLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...