5J0RA

Binary complex crystal structure of dna polymerase beta with c:a mismatch at the primer terminus
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0rA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0rA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0rA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0rA03
4X5VA 1WCLA 5KG5A 8ICRA 3PR5B 4GC6A 3QEBZ 1XC9A 4EBDA 2ASDA 5KFIA 2ZH7A 2FLNA 2MAXA 4EBKA 2VANA 3G6VA 1TK5A 1ZQGA 4J9OA 2ZH5A 3H3AA 1ZQSA 2BCSA 3OJSA 5DQGA 4M9HA 5DG9A 3H37A 4R8UB 2F1IA 4NM1A 3C1YA 1XO1A 4R66A 1JXLA 1ZQAA 1Z00B 1D9FA 1VFGA 1JQRA 3RRGA 4DQQA 3HIYA 1ZQKA 1L3TA 2PFOA 3ZDDA 4BDPA 1U45A 2RDJA 4RWNA 1XSNA 5DLGA 3BQ1A 4UB1A 3PY8A 4ATBB 1ZQDA 1TFRA 1IM4A 5J0YA 1L3SA 5KFVA 4P4MA 7ICFA 2FMQA 3GIMA 3PX4A 3RH6A 4O3RA 8ICCA 9ICOA 1NK6A 4R64A 4KLTA 3PW0A 3TI0A 4RQ4A 3JYYA 3UPSA 5KFDA 3RBDA 4O5EA 4I2DA 4B9SA 2JZBA 8ICMA 4F5QA 4PGXA 3Q8SB 4B9UA 5IIOA 3OVBA 4RZRA 1ZQRA 4J9SA 2HVIA 2JEFA 4GC7A 4EZ9A 5CR0A 5HC9A 4ECVA 3RR8A 8ICTA 3TANA 8ICFA 4DWIA 4FBUA 1UT5A 5J0QA 3KHLA 2R8JA 2DPJA 1S76D 5KFTA 2JEIA 1QSYA 2ISPA 4ECSA 2PI5A 7ICKA 3MR2A 2XY5A 4X4PA 4WC6A 4ATBA 5J2EA 5HREA 3ZDBA 4RT2A 4F2SA 4M47A 1D9DA 1HJPA 1BGXT 4RPXA 4YQWA 3OGUA 3MFHA 4KLUA 3WFRE 4RNOA 9ICNA 4YR2A 4I2JA 5KFBA 2MUTB 2AQ4A 2R8IA 4EBCA 3MBYA 1WCNA 7ICVA 4FHYA 3BQTA 3MR5A 5IIMA 3Q8MA 2XC9A 4S3NA 4QZ8A 4IR9A 7ICIA 4O3NA 4WC2A 9ICCA 2ZH2A 1T3NA 3L9DA 4IQWA 5HMMA 4UB5A 1XU4A 2AGOA 5J0OA 4NLGA 3C18A 2FPLA 1MIVA 4FH3A 4C8OA 4RT3A 5HRKA 4M04A 5J2AA 3GV7B 8ICIA 4NLZA 4EP7A 3OVSA 3PW7A 4O0IA 5J2HA 3V6HA 4DSFA 1BPZA 8ICUA 1Y88A 2P66A 3SZ2A 5HRBA 1R8CA 5JUMA 3LQCB 1S0MA 3ZDCA 4DL2A 1MIWA 3TQ1A 1LB2B 4QW8A 2PFPA 4TURA 4X4UA 3TARA 5D4BA 2VA2A 5L9XA 3MABA 2W9CA 7ICTA 5DQIA 4YN4A 4Q8FA 1UEUA 2ZH3A 4TUSA 3RB4A 1B43A 3PW2A 1NKEA 2J6UA 4JWNA 8ICAA 4X4QA 4Q45A 4WBYA 3JPPA 2DR8A 3H38A 1NK8A 5IILA 1JMSA 2ZUDA 4F93B 1ZQTA 1R8BA 1NJXA 4MEXA 8ICJA 1KRPA 4QWBA 1FA0A 1A76A 1TAQA 2AQ0A 2HHXA 3UPQA 2M9NA 4PPXA 4M2YA 5J0UA 1JIHA 2ASJA 4ED3A 1MQ2A 1KLNA 9ICQA 1DK2A 4JV1A 5CJ7A 4YR3A 2J6TA 5HHIA 9ICFA 3IM1A 3PR4A 2UVWA 4LVSA 7ICJA 2BPCA 5KFZA 4DF8A 4UB4A 4X4VA 2UVRA 5DB7A 3OV7A 1BPEA 4F4KA 4X4SA 4DF4A 1ZQWA 5CWRA 3T5HA 2KZ3A 2R8KA 7ICQA 4DSJA 2UVVA 5CB1A 4RNMA 1N48A 4FH5A 4RWOA 5HRDA 4I27A 2C2RA 5IIJA 3C66A 5HRGA 2HHSA 3RH4A 3Q8PB 4B9MA 4C8KA 3RTVA 3OJUA 5KFEA 2IBKA 1NZPA 4I2EA 2DR9A 1JN3A 3C1ZA 4PHDA 2XO7A 3EPGA 4P2HA 2KZMA 1U4BA 4UB3A 5KG0A 4DOAA 1ZETA 4KLLA 2BE3A 1R89A 3RRHA 2I1QA 2XGPA 1L5UA 3AQMA 4QZCA 7ICMA 3GIIA 2ZH1A 1NJZA 2PFQA 3MGHA 3IHQB 5HRHA 1BPDA 3C5FA 4PGYA 3UQ2A 4FO6A 4E80A 2BHNA 4ELTA 3HJ4A 5DQHA 3KHGA 3QEAZ 2BCQA 4KLQA 1ZQOA 4DLEA 4EEYA 4KLSA 2WTFA 1ZQFA 3UXNA 2H5XA 5BOLA 4YD2A 4J9PA 3SV3A 5KT5A 2Y1IA 1L3VA 2FMPA 1S0VA 4AT8A 3LDAA 3G6YA 3V6JA 2JZBB 2BPFA 2M2UA 3AQLA 2A1JA 2NRZA 4Z6FA 4DFJA 1XSLA 3B0YA 4F92B 4RQ5A 4RQ6A 4ED8A 1L3UA 2IMWP 2M2TA 4Z6DA 4DQPA 4WBZA 4O3QA 4QWCA 3OHAA 5J2DA 2GWSA 4J9NA 3N4MB 1NK0A 1BVSA 1TAUA 3MR3A 5DEDA 4ED0A 5KFQA 2W9BA 5KT6A 5F9LA 3C2KA 3PVXA 3MGIA 4F5RA 1KFSA 1JXEA 4WCWA 4RQ8A 3H40A 4YMMA 4UB2A 4ECTA 4I2CA 5KFYA 3TAQA 4AT9A 3WFQE 3B0XA 5DGBA 4F5PA 2BPGA 3PO4A 4B9VA 4NM2A 4O3OA 8ICYA 3RB0A 1S97A 7ICUA 3JZ0A 2V9WA 2M2WA 4RNNA 4GXIA 3E2EA 3RJEA 4KLOA 8ICKA 2DRAA 1MC8A 4RQ0A 3HW8A 3RJIA 2ASLA 4JUZA 4I2AA 3ETLA 3T5KA 5BPCA 4BGDA 3WFSC 3PNCA 4DLGA 4FHPA 5DKWA 5D46A 1OU5A 5IIIA 5KT4A 2ZHAA 1KDHA 3OUYB 4JV2A 5KTQA 3BJYA 1LV5A 5KFRA 4DS4A 4KLDA 5J2BA 5KFFA 5L1JA 3ZD9A 2W9AA 1DOQA 4M9GA 1NO5A 4UD5A 4AT7A 2ZTDA 3C21A 4Q43A 1NJWA 4FHXA 5IIKA 1D8LA 3RAQA 1ZQCA 4KLJA 2HHUA 2C2DA 4LZDA 4ELVA 2AJQA 3PV8A 4QZDA 4I2IA 4IRDA 2W9CB 4QZHA 4I2HA 3PW5A 4RWQA 4R65A 4QWEA 4YD1A 3BQ2A 1HUZA 2OWOA 2NRXA 2AGQA 2IHMA 4E7XA 5C5JA 3T3FA 1IXRA 4Z6CA 3PMNA 4F50A 4DSLA 4C8LA 4RQ7A 3OSNA 1SL2A 1BPBA 5HRFA 2BKEA 8ICOA 4BXOB 3JPSA 3FYHA 4ECUA 3ISCA 3TAPA 3RJHA 4DSIA 5J2FA 3HT3A 4WC0A 3ORYA 4QZGA 2ZHBA 4F4WA 4KLMA 2HHPA 3OUYA 3V6KA 3NTUA 4DS5A 5KFAA 5KT3A 3Q8LA 1ZQLA 3JPNA 3V7KA 1K1QA 4GLXA 1SKRA 1ZQMA 5CP2A 1T7PA 4IQVA 4B9LA 2ZUBA 1XS9D 1ZQZA 4J9MA 4X4NA 4RWPA 4Q8EA 2ZH9A 5L1LA 1XWLA 4F5OA 1KTQA 4G3IA 4DFPA 4YP3A 1NK4A 4DL3A 4IQUA 4UAYA 5KFOA 4XUSA 3HWTA 4XA5A 3H4BA 2BCUA 1CEZA 5HRIA 5J0XA 4LT6A 2Q66A 4NLKA 1F5AA 5KFNA 4RUAA 4TQRA 3M9MB 4ECXA 8ICPA 1D8YA 2ZTEA 1U9LA 3GDXA 3V7JA 1RYRA 3H7IA 4FS1A 5DLFA 2XY6A 1TVAA 1ZQBA 8ICSA 1NK5A 1RXVA 1NJYA 4EYIB 5J2KA 4LZGA 4BXOA 4IRCA 4IG8A 2ID1A 9ICIA 5KFLA 2KFNA 2ZH6A 5HMLA 4ECQA 5HNKA 5DB6A 4KMUA 3RJFA 2HHWA 4TUQA 3RB6A 4KITB 2AGPA 4FHWA 4J9KA 3RBEA 1V9PA 4RPYA 1UA1A 1R8AA 1MQ3A 4M9LA 9ICAA 2W8LA 2PBEA 4AT8B 5HHHA 3LWLA 4ELUA 2W9MA 4WC3A 1NK7A 5EWEA 3QZ8A 1ZQYA 7ICNA 2A1JB 1PZNA 4BWMA 5KG3A 4UBCA 4ED6A 4DL7A 3JPTA 3JPRA 2KFZA 4WC5A 1NOMA 5DG7A 4O5CA 1SZPA 2BCVA 3TFRA 4XQ8A 1RXWA 4X4RA 5KG7A 3AUOA 1N56A 2W9BB 3ISBA 2KN7A 4JV0A 5KFSA 2R8HA 4F4ZA 2KTQA 4DEZA 1S10A 3C2LA 1JX4A 4AT9B 3H8WA 4ED7A 2BCRA 4E0DA 1BPYA 4FBTA 1KFTA 4IRKA 4QZEA 4DL4A 1SKWA 3K4GA 5CA7A 3N97B 4RQ2A 5J0SA 3PO5A 5KFKA 3ZD8A 2VA8A 1SL0A 4K4HA 4GXKA 1C7YA 1RPLA 4PHEA 1SL1A 1U49A 3ISDA 1RYSA 4UAZA 9ICXA 2O1PA 4IR1A 5IINA 3RH5A 9ICLA 4EBEA 4QW9A 2JEGA 4UD4A 4MFFA 3RB3A 2NRKA 4M9JA 1Z3EB 5KG6A 4P4PA 4B9NA 4C8NA 1ZJNA 3M8SA 2ALZA 3GQCA 9ICRA 1SKSA 4YR0A 4KLIA 1ZQPA 1WOTA 4WC1A 9ICMA 2Y1JA 3M9OB 4M6WB 1PX5A 4MF8A 4J9RA 1BNPA 4ECZA 5EOZA 4PH5A 5DBBA 3M8RA 4BWJA 3C5GA 1QSSA 5KFPA 4AT7B 2NRWA 4YVZA 4PHPA 2V4QA 4KTQA 4IQTA 1V4AA 4DFMA 4QZIA 1KFDA 7ICOA 1X9SA 1TK0A 3BDPA 4DL6A 5J0RA 1ZQJA 4X0BA 5DBCA 7ICLA 2DR5A 5BOMA 4JK1A 2HHQA 1JAJA 2NRTA 4YCXA 3UXPA 8ICWA 3QE9Y 5KG2A 3RJKA 5HRLA 4XRHA 5J0WA 3Q8RB 1KNYA 4EBJA 1X9MA 1DK3A 3T5LA 4KLGA 3AQNA 5KG4A 3MR6A 2LYHA 4EYHB 1T4GA 5DB9A 2XCAA 2F1HA 8ICXA 4KLEA 2KP7A 4X4OA 1KSPA 1TK8A 3T5JA 4UAWA 3OHBA 3RR7A 3PX6A 1QLNA 4NXZA 3LWMA 3AQKA 4KN4A 3WFPA 4M6WA 1S77D 5J2IA 2HHTA 2PXIA 5EWGA 2DVIA 5CHGA 4YXJA 4DL5A 2ZH4A 4I2FA 2ZH8A 4YMNA 5KFUA 7ICEA 8ICLA 2C22A 1TFYA 5DDYA 3RJJA 4RQ1A 9ICGA 1A77A 1DGSA 1EXNA 1S0NA 3FDSA 3HJ1A 9ICTA 3PX0A 2DR7A 2W8KA 4DO9A 3H8SA 4I2GA 4O9MA 2BR0A 3M9NB 5L1IA 4ED1A 3EPIA 2XY7A 4F5NA 2DPIA 4RUCA 2BQUA 5KFXA 4I2BA 9ICBA 3H8JA 5DG8A 1NKBA 1COOA 4TQSA 1BPXA 2C28A 4R8UA 3UXOA 2ISOA 1Z00A 3QZ7A 5J2GA 9ICEA 1TFWA 5KFWA 2DFLA 2ZJAA 5KFJA 9ICJA 4QZ9A 2M2VA 2HW3A 4PGQA 1KEJA 7ICHA 3EYZA 3H4DA 1HUOA 4DOCA 9ICSA 7ICPA 3THVA 9ICPA 4MF2A 8ICNA 3GFKB 4QWDA 3OSPA 4QWAA 4DSKA 4F2RA 4O3SA 7ICRA 4QZAA 1YLQA 3Q8KA 2FLPA 2Q0ZX 4X0AA 4ED2A 5L1KA 4KLHA 4UBBA 3MDAA 4ECWA 4O5KA 4YFKA 4K4GA 3SV4A 3TFSA 1ZJMA 2XCPA 2FMSA 5KG1A 8ICEA 1B22A 4QZFA 4Q44A 2PI4A 2HVHA 4J9QA 5KFGA 2RDIA 1H38A 2UVUA 3EWAA 1S9FA 2F1JA 2O5AA 1Q78A 4NY8A 3AU2A 5J0PA 3Q8QB 1X2IA 1U47A 1QTMA 3LK9A 2B21A 5J2CA 9ICHA 2FPMA 2J6SA 4MFAA 2KZZA 2RFFA 3V7LA 2ZTCA 4J9LA 4HYKA 8ICBA 2P6UA 2ZJ5A 3K75D 5J0TA 1K1SA 4Z6EA 5HP4A 1BNOA 1VJ7A 3OVAA 5J2JA 1AROP 1RZTA 5KFCA 4GXJA 4YMOA 3HP6A 3WFOA 4FS2A 4I29A 1Q79A 3ZDEA 4DFKA 2DRBA 2BGWA 1ZQIA 3PW4A 4RU9A 1ZQUA 5DECA 1MSWD 4DSEA 2BQ3A 4ECRA 5F9NA 3PMLA 1ZQHA 4NKUA 2MUTA 4O3PA 7ICGA 4WC7A 2IHNA 9ICWA 3RJGA 2AU0A 3BQ0A 4KLFA 1UEVA 1QSLA 3UQ0A 2ZJ8A 2P6RA 4DOBA 1U48A 1UETA 3GV5B 2BDPA 4MEYA 5D49A 4F3OA 4DQRA 8ICVA 8ICZA 1T8EA 4FHVA 3EW9A 4I28A 3HPOA 3GV8B 1NK9A 4NKTA 4F8RA 2I9GA 4X4TA 4M9NA 4F4XA 5KFMA 5DGAA 5DDMA 4RQ3A 1ZQXA 4XQ7A 1TV9A 2NRVA 4CCHA 1CUKA 4MFCA 4WC4A 9ICKA 5KFHA 4YXMA 5F2VO 4NLNA 1UT8A 1ZQVA 2ZUCA 3JPQA 3HX0A 3V72A 2C2EA 8ICQA 1X9WA 4ECYA 3H39A 4DQSA 5HR9A 5DB8A 2ATLA 3C23A 4P4OA 3NYBA 2FLLA 1XSPA 7ICSA 4F4YA 4C8MA 4R63A 2HHVA 3JPOA 3GILA 3KHRA 1UA0A 4F91B 2R8GA 3KTQA 1ZYQA 8ICGA 3SI8A 1ZQNA 2XGQA 2V4RA 1MIYA 9ICUA 2IA6A 5DBAA 3G6XA 4UQGA 1S0OA 3SYZA 4ZH4A 5KT2A 3GIJA 2VA3A 4M0AA 5TZVA 2BQRA 3MDCA 4QZBA 1ZQEA 9ICVA 3GIKA 1ZQQA 4M5DA 1NKCA 4TUPA 4RPZA 4EZ6A 4E8FA 4K4IA 4DQIA 5KT7A 4YG2A 4PHAA 3AU6A 2FPKA 4JWMA 4B9TA 2JEJA 8ICHA 4KN7A 3MFIA 5EWFA 3RAXA 3C2MA 3NGDA 3ZDAA 3EZ5A 5J29A 3KHHA 2PFNA 1TKDA
chains in the Genus database with same CATH superfamily
3CNHA 2E8NA 2ZH7A 3OPXA 5ALQA 2VANA 3WK8A 1TK5A 4J9OA 4BJQA 3H3AA 2W3SA 1V97A 5DQGA 4R8UB 2F1IA 5J8YA 3AL0B 3T79A 2DUYA 2PFOA 1L7PA 4BDPA 4EV6A 2RDJA 2A1AA 2G5HB 5DLGA 1IG6A 2ZIVA 2HBKA 5JTIA 4DCCA 5KFDA 2JZBA 8ICMA 5EE0A 4PGXA 3OVBA 5IIOA 2HVIA 4WJ3B 5AM1A 4EZ9A 1C20A 3RR8A 2HOFA 1S76D 2JEIA 4ATBA 5HREA 3WKEA 4M47A 1HJPA 3WFRE 4LJXA 4YR2A 4WC3A 4NXUA 4S3NA 2XC9A 4QZ8A 7ICIA 3TACB 5J0OA 2I6XA 4C8OA 3OTQA 4EP7A 2HBJA 3GV7B 3V6HA 4EX7A 8ICUA 2P66A 3LQCB 3ZDCA 2OXOA 2A19A 2NO4A 4MHVA 1J2MA 3PSFA 2W9CA 4Q8FA 2ZH3A 1B43A 3ETRA 5AI0A 2DR8A 1JMSA 4CE6A 2H3FA 1KRPA 1FA0A 4EEKA 3UPQA 4M2YA 3AQEA 1DK2A 4K96A 9ICQA 3IM1A 7ICJA 4LVSA 2WF5A 2UVRA 4NWIA 2UVVA 4FH5A 4RWOA 2QKQA 4I27A 2W03A 5G5HA 5HRGA 3RH4A 3Q8PB 4C8KA 3OJUA 4P2HA 2KZMA 4O67A 5KG0A 1R89A 2I1QA 2WF7A 1LKYB 3GIIA 2ZH1A 5HRHA 2BHNA 3KHGA 4C4RA 2K8BB 2GO7A 3SEIA 3LDAA 3V6JA 4FZNA 2NRZA 4Z6FA 2AXTU 1L3UA 4DQPA 5AK6A 4ED0A 4UATA 2W9BA 3N28A 4O6AA 3MGIA 1KFSA 1JXEA 4WCWA 3H40A 4WOYA 2HI0A 3TAQA 5D62A 1VJ5A 3O0FA 3RB0A 3JZ0A 4RNNA 3WK7A 2YB1A 3S6JA 4ACOA 3HW8A 3RJIA 2E5SA 2OHFA 3WFSC 2K60A 2ZHAA 3OUYB 3AM9A 3H0RB 3CP8A 3ZD9A 3WKBA 1D8LA 1ZQCA 1PVQA 2HHUA 2C2DA 2B56A 3LYSA 1SIJA 4QWEA 4YD1A 2DGZA 3C28A 2AGQA 2IHMA 2JV3A 1IXRA 3PMNA 4C8LA 1FEZA 8ICOA 4IL6U 3QUQA 3TAPA 3ZI4A 2ZHBA 4QZGA 4F71A 4GLXA 4B9LA 1SKRA 2K4PA 2LMRA 4RWPA 3AMZA 3H4BA 5HR7A 4NV0A 1D8YA 2ZTEA 3F2BA 3V7JA 1RYRA 3H7IA 2XY6A 1NK5A 3NRWA 2VJ5A 4IRCA 2ID1A 2KFNA 2ZH6A 2E8MA 1N5WA 1ZD4A 4TUQA 4KITB 4J9KA 1UA1A 5A0LA 1R8AA 2EZXA 5CFTA 3MGVA 1NI3A 3LWLA 1NK7A 3QZ8A 1ZQYA 7ICNA 5KG3A 3JPTA 1YT3A 1NOMA 4O5CA 2BCVA 4X4RA 5KG7A 3SAFA 4JV0A 3F53A 2KTQA 3C2LA 4AT9B 1BPYA 2GAFD 4DL4A 2EAOA 2GLEA 5AKXA 3K4GA 3WKAA 4RQ2A 3N97B 3ZD8A 2VA8A 3QNMA 2G06A 4AP9A 1SB3C 9ICXA 4OAGA 2EWRA 4UD4A 2JEGA 2ZIXB 4M9JA 3HJEA 5KG6A 4YR0A 1ZQPA 4WC1A 2Y1JA 1PX5A 1Z1BA 2RQ5A 3M8RA 5DBBA 4AT7B 4LEYA 3C5GA 2F76X 2NRWA 2V4QA 2GA9D 1V4AA 4DFMA 4HX0A 4QZIA 1KFDA 2FCLA 2G0AA 2G5IB 2IOHA 5DBCA 7ICLA 1JAJA 3UXPA 2JH7A 2P35A 5HRLA 4XRHA 3MCRA 3Q8RB 1KNYA 1DK3A 4KLGA 3AN1A 1Q8KA 1T4GA 3LVVA 8ICXA 3KOOA 2ODGA 4UAWA 3OHBA 2E1EA 4OAIZ 3AQKA 4M6WA 3IV6A 1S77D 2PXIA 5EWGA 5K4LA 4DL5A 2ZH8A 4YMNA 2ZXHA 4PL1A 5KNIA 2JR5A 4C7YA 1DGSA 3IP4B 1S0NA 3QU7A 4JLXA 3ONNA 2KD1A 2W8KA 4DO9A 4O9MA 5L1IA 4ED1A 2W3RA 3EPIA 4F5NA 2LBOA 5AI9A 1BPXA 1J97A 3UXOA 2ISOA 3QZ7A 2A3VA 2YMMA 3DV9A 2M2VA 5JU5A 3EYZA 2E1FA 4DOCA 7ICPA 2FE9A 9ICPA 8ICNA 2B6GA 4F2RA 4O3SA 3Q8KA 2Q0ZX 2Q4TA 5AKJA 5L1KA 4ED2A 4X0AA 4O5KA 3TFSA 3UMCA 1B22A 3QXGA 3ER9B 2CPRA 2PI4A 4J9QA 5ALPA 2LHTA 1H38A 2UVUA 3AU2A 1AQ6A 1F0MA 2N1RA 1U47A 5J2CA 2KZZA 3V7LA 2ZTCA 2KSOB 1BNOA 4Z6EA 5HP4A 1S5LU 4ICAA 2W7PA 5ALKA 1AROP 1RZTA 5AKZA 1NNLA 4YMOA 3WFOA 1Q79A 3ZDEA 4WQLA 4ECRA 5F9NA 2MUTA 1A0PA 2IHNA 9ICWA 3RJGA 2AU0A 4KLFA 1Z19A 1QSLA 1SV4A 4MKPA 8ICZA 2W7OA 1T8EA 4FHVA 4I28A 4M9NA 4F4XA 1TV9A 1CUKA 2JH1A 4NXTA 3TKAA 2JHDA 3HX0A 2ZUCA 3V72A 2C2EA 8ICQA 3H39A 2ATLA 3NYBA 4C8MA 4R63A 3JPOA 1UA0A 4P0PB 4F91B 1SWWA 4CF4A 2Y9TA 8ICGA 2EANA 5ALJA 2YMLA 3J81j 2XGQA 2V4RA 2IA6A 2VA3A 4M0AA 3MDCA 5CFUA 1ZQEA 4NXXA 3GIKA 5AK3A 1ZQQA 1NKCA 4RPZA 1MIYA 1D8BA 5J29A 3SD7A 4X5VA 3QEBZ 4EBDA 1KL9A 5KFIA 2FJ6A 1ZQGA 3A0HU 2D6FC 5AICA 1ZQSA 4QIWF 1XO1A 4R66A 1Z00B 1ZQKA 1A6SA 1XSNA 1RDFA 3BQ1A 3PY8A 5HR6A 4ATBB 1ZQDA 1L3SA 7ICFA 3PX4A 8ICCA 4KLTA 3PW0A 3TI0A 4RQ4A 3JYYA 1COKA 4O5EA 3UMBA 4I2DA 3ICXA 3Q8SB 1O08A 1ZQRA 5CR0A 5HC9A 8ICTA 3TANA 1F5SA 4DWIA 3KHLA 4EX6A 4EGWA 2PI5A 4X4PA 2DQNB 4USAA 3NVZA 3OGUA 4YQWA 1D9DA 5KL8B 4KLUA 2HBLA 9ICNA 2AQ4A 3HRDD 5KFBA 4DFDA 4FHYA 4IS7A 3MR5A 5IIMA 4C4TA 3Q8MA 4O3NA 4QNLA 2JRZA 1UQVA 4OJOA 2F2AB 4NLGA 2AH5A 1MIVA 2HOIA 3OVSA 3F2DA 2YB4A 5GTIU 2FDRA 2XICA 3QU2A 5JUMA 5ALDA 1MIWA 4DL2A 3TARA 5D4BA 1X6IA 7ICTA 4YN4A 3RB4A 4JWNA 4X4QA 3JPPA 3H38A 1Q3UA 3WKCA 8ICJA 1A76A 1TAQA 2HHXA 1KLNA 4YR3A 2J6TA 9ICFA 2EH9A 3PR4A 2BPCA 4CGZA 3I76A 4F4KA 1J2NA 1SGGA 1ZQWA 5CWRA 5CFSA 7ICQA 3IG5A 5CB1A 4FZLA 4RNMA 2AHOB 2C2RA 5IIJA 2HHSA 4KM5A 5J8YC 3GU3A 2DR9A 1JN3A 2XO7A 1JI7A 4UB3A 5AKGA 4DOAA 1ZETA 1FFUA 3BS5B 3RRHA 2PKEA 2EAPA 1NJZA 3UQ2A 4FO6A 2CRXA 3HJ4A 2VJ4A 4EEYA 5BOLA 2FMPA 4AT8A 4CRXA 3BS7A 2A1JA 1XSLA 4RQ6A 4F92B 4ED8A 4Z6DA 5AIAA 3OHAA 5J2DA 1NK0A 4NJ8A 5F9LA 3PVXA 3QU5A 1V85A 4RQ8A 1B0XA 4YMMA 2KICA 4ECTA 5KFYA 3L5KA 3WFQE 5DGBA 2DKZA 4OJ6A 4OD0A 4B9VA 4NM2A 3IG8A 7ICUA 2V9WA 4GXIA 1SZHA 2ASLA 4JUZA 4I2AA 3T5KA 2MA1A 4BGDA 2K4EA 3D6JA 3PNCA 4DLGA 5DKWA 5D46A 5ALTA 5KT4A 1KDHA 1ZD5A 5KTQA 3BJYA 4KLDA 3L3FX 2QB1A 5KFFA 5L1JA 2QB0B 2W9AA 1NO5A 4M9GA 3C21A 4FHXA 2BBJA 4ELVA 3NVOA 4IRDA 3HILA 4QZHA 3PW5A 3KFUF 3BQ2A 4E7XA 5C5JA 3T3FA 4F50A 4RQ7A 1SL2A 2W43A 4JMUA 4ECUA 3ISCA 4O69A 3RJHA 4DSIA 4WC0A 4KLMA 3D2QA 1ZQLA 5KFAA 4X4UA 3PSPA 1K1QA 1ZQMA 5CP2A 1L7OA 4IQVA 2ZG6A 2KOBA 2YTUA 4YP3A 4DL3A 5ALWA 1NK4A 5CHEA 5HRIA 4XUSA 4LT6A 1CEZA 3NVWA 5J0XA 4U7CA 1F5AA 5KFNA 4RUAA 4ECXA 1WG8A 1U9LA 1TVAA 8ICSA 3IN5A 4LZGA 4BXOA 4IG8A 3PHZA 4ECQA 5HNKA 5DB6A 3RJFA 1WUDA 3RF9A 4FHWA 1DRGA 1MQ3A 2W8LA 2PBEA 2W9MA 4C80A 1PK1A 4BWMA 4DL7A 4ED6A 3D2SA 2KFZA 4WC5A 1TAMA 2ZIUB 1N56A 4O3MA 2KN7A 1FIQA 1Z1VA 3C29A 1S10A 2KMDA 4IRKA 1P7DA 2OEHA 3SQIA 4CF5A 3PO5A 2YN4A 2M0NA 4GXKA 1C7YA 1RPLA 4PHEA 3ISDA 1RYSA 1OW5A 4IR1A 4QW9A 2NRKA 4BX9C 4FO1A 4P4PA 4C8NA 1ZJNA 3ER8C 2BDUA 2ALZA 3KKAA 2LYBA 3M9OB 4M6WB 1UCVA 3GZFA 4UAUA 4J9RA 1N62A 4ECZA 4EEDA 3KZIU 4PH5A 4BWJA 4PHPA 1N2XA 3WKDA 2KVCA 1TK0A 4DL6A 5J0RA 2DR5A 2HHQA 3BZCA 4EBJA 3KD3A 1X9MA 1CI4A 4P0QA 2EDUA 4EYHB 5AKEA 4X4OA 3EUB2 4NL9A 4EELA 3PX6A 3RR7A 4NXZA 3LWMA 3WFPA 5J2IA 5CHGA 2HSZA 2RP5A 2ZH4A 2DKXA 2W11A 1MN8A 2CN1A 9ICGA 3AQFA 1EXNA 1L7NA 3HJ1A 2ZXIA 4I2GA 3M9NB 3H8MA 1FO4A 5G5GA 2KIWA 1NKBA 1JROA 4Y2VA 4R8UA 4QIWC 3SAHA 2DWQA 1TFWA 5KFWA 5KFJA 4XJEA 4QZ9A 2PMZC 4PGQA 5F3XB 4JB3A 3GFKB 4QWDA 4UASA 3F5AA 4QWAA 4DSKA 3TADA 4LEWA 4KLHA 2JGAA 2KKVA 3MDAA 5H2FU 4YFKA 4K4GA 3SV4A 1M6YA 2FMSA 2RDIA 1S9FA 2F1JA 2WF6A 2KHQA 8ICBA 2ZJ5A 1K1SA 3MC1A 4FS2A 4I29A 2O6KA 2F44A 4DFKA 2BGWA 1ZQUA 5DECA 1MSWD 1T3QA 2BQ3A 4O3PA 4WC7A 3NS1A 3BQ0A 5AM0A 3WK5A 3UQ0A 1U48A 4MEYA 4Y2PA 4DQRA 3GV8B 2I9GA 3H0MB 1X6JA 5KFMA 3VCBA 2H3ZA 4RQ3A 4WC4A 2WAQF 4YXMA 3JPQA 2WF8A 3UM9A 5HR9A 5DB8A 3C23A 2FLLA 5T14A 4AYBF 1ZYQA 4FZMA 2IHOA 5DBAA 2G09A 1S0OA 3SYZA 2F8KA 5KT2A 2QARA 5AKYA 3GIJA 2BBHA 4QZBA 9ICVA 4EZ6A 4K4IA 4NXVA 5EWFA 3RAXA 1QCKA 3NGDA 3ZDAA 1TKDA 4I0UA 5KG5A 3PR5B 4GC6A 1XC9A 3AEVA 2ASDA 4LEVA 1URJA 3OJSA 3H37A 4NM1A 5ALOA 1JXLA 1JQRA 3RRGA 3HIYA 5JTGA 1L3TA 1LKYA 1U45A 4RWNA 2I5HA 4US9A 4UB1A 1IM4A 5KFVA 4P4MA 9ICOA 3GIMA 4O3RA 3UPSA 1ED1A 3RBDA 3VC8A 4B9SA 4F5QA 4A8EA 2W55A 4B9UA 4RZRA 2RLTA 4J9SA 2LKYA 3DDHA 3KZXA 4ECVA 1SXDA 1ZXIA 8ICFA 2KVSA 4FBUA 3M6KA 1UT5A 2R8JA 2DPJA 4PJ0U 3K7DA 7ICKA 3MR2A 2XY5A 4WC6A 5J2EA 1ZD2P 4RT2A 3K1RB 4RNOA 4I2JA 4KX3A 7ICVA 3A0BU 2R8IA 4EBCA 1WCNA 1QH9A 4K8VA 5KAIU 4IR9A 4WC2A 9ICCA 3CW2C 1T3NA 5ALNA 3L9DA 5HMMA 3WK6A 5AKLA 3C18A 4FH3A 5HRKA 4M04A 5J2AA 8ICIA 4O0IA 5J2HA 1BPZA 2F77X 1R8CA 2HOQA 1S0MA 3B9JA 3TQ1A 1LB2B 2PFPA 4TURA 2HN1A 4FE3A 2VA2A 5L9XA 3MABA 1UEUA 4TUSA 4U6PA 1ZD3A 5ALEA 5ALFA 1NK8A 1R8BA 2ZUDA 4F93B 4HAIA 1NJXA 2F3NA 2AQ0A 1L8LA 5J0UA 1MQ2A 4JV1A 5HHIA 2XVTA 2UVWA 4DF8A 4UB4A 4X4VA 2XI9A 3OV7A 1BPEA 4X4SA 4RQNA 5B5EU 2KZ3A 1N48A 3QUCA 3CRXA 5HRDA 3C66A 4B9MA 3FM9A 1UHUA 4I2EA 4PHDA 3EPGA 2WF9A 2BE3A 1L5UA 5KL1B 7ICMA 2LI6A 5AM4A 2PFQA 3C5FA 5DQHA 2BCQA 5AIBA 2ZIVB 1ZQOA 4DLEA 4KLSA 2WTFA 1ZQFA 4J9PA 5KT5A 1KKXA 3G6YA 2M2UA 2EZZA 2JZBB 3NVVA 3B0YA 4RQ5A 2M2TA 2Y0SF 3N7SC 4J9NA 5L1MA 3N4MB 2RRDA 1BVSA 2F8LA 1TAUA 3MR3A 5DEDA 2IOFK 5KT6A 1VDVA 4Y2XA 4AT9A 3QUTA 3B0XA 2BPGA 1B4FA 2DBYA 3E2EA 3RJEA 1KBUA 3RFAA 2JXJA 2OH2A 5AHXA 5AKKA 3ETLA 2ZIXA 4EENA 4K9BA 3KBBA 2K4HA 1OU5A 1LV5A 5KFRA 1Z4OA 5J2BA 1DXSA 5B3QA 1DOQA 4UD5A 4AT7A 4Q43A 1IIPA 4PZNA 1NJWA 5IIKA 4LZDA 2JMGA 2W9CB 4I2HA 4JLZA 4RWQA 4R65A 1HUZA 2OWOA 4OJ5A 2NRXA 5ALSA 4GFJA 4Z6CA 4DSLA 1QQ6A 1BPBA 2YMPA 1WWVA 1ZRNA 5HRFA 3QYPA 4BXOB 3FYHA 3HT3A 3ORYA 1ZRMA 4F4WA 3V6KA 3NTUA 5KT3A 3Q8LA 4Y2TA 3V7KA 4OJLA 2VKQA 1RYUA 4J9MA 4Q8EA 1XWLA 4G3IA 4UAYA 5KFOA 2BCUA 3SENA 4NLKA 2EQYA 2B4VA 4TQRA 2W04A 3GDXA 2OCEA 4FS1A 3UMGA 5J2KA 2E8PA 3PSTA 3IRUA 2MU2A 5HMLA 4CNQA 3RB6A 4UW9A 5AI6A 4M9LA 9ICAA 2KHVA 2HN2A 1PZNA 4UBCA 3JPRA 5DG7A 1SZPA 1RXWA 4XQ8A 3NWIA 3AUOA 2K8AA 2W9BB 1XNSA 4DEZA 3H8WA 2BCRA 1KFTA 4QZEA 3F5EA 1SKWA 1Q3VA 5CA7A 2KSOA 4K98A 5KFKA 1O03A 1U49A 3RH5A 9ICLA 4EBEA 4MFFA 3RB3A 2G07A 5AM5A 4B9NA 3BQ7A 5JRTA 3M8SA 9ICRA 4KLIA 2KV2A 4K97A 1BNPA 2HMXA 5EOZA 3I28A 4NLBA 4YVZA 4J03A 4IQTA 1L7MA 3IDWA 1ZQJA 5BOMA 2WAQC 4JK1A 3RJKA 1HEKA 5ALHA 5J0WA 2WHEA 1SXEA 3T5LA 3CK6A 4AYBC 4P0PA 2XCAA 2WFAA 4RQMA 3QUBA 1KW4A 3T5JA 4EEBA 3OWGA 1QLNA 3SR6A 4QJFB 2DVIA 4YXJA 4I2FA 8ICLA 2C22A 5DDYA 2LM1A 3RJJA 4RQ1A 1VLBA 2FI1A 4IC9A 1A77A 3FDSA 1ZQ1C 5KFXA 4I2BA 3H8JA 5DG8A 1Z00A 2EAMA 3THVA 4MF2A 4Y2JA 3OSPA 7ICRA 4C0ZA 1YLQA 1FFVA 3N7RC 2XCPA 1DGJA 2BZFA 4Q44A 2HVHA 3F2CA 5KFGA 1WWUA 5AKHA 3EWAA 2O5AA 4NY8A 4OO1J 5J0PA 3Q8QB 1QTMA 3LK9A 2ES6A 9ICHA 2RFFA 2J6SA 4MFAA 2P6UA 3K75D 1VJ7A 3OVAA 5J2JA 5KFCA 3HP6A 2GH1A 1ZQIA 4RU9A 4OAFA 3PMLA 1X42A 3KKAC 7ICGA 1UEVA 2K4IA 2ZJ8A 2QARB 4DOBA 1UETA 5D49A 5ALMA 5ALXA 4F8RA 2NV3A 3L4PA 3FAHA 4X4TA 5DGAA 4CDGA 5DDMA 4XQ7A 4CCHA 3EF2A 4MFCA 9ICKA 5KFHA 1UT8A 1ZQVA 4ECYA 2ZIWA 4DQSA 4P4OA 1XSPA 7ICSA 2HHVA 1JALA 3GILA 3KHRA 2R8GA 3KTQA 2WB1F 1ZQNA 4NL9C 9ICUA 3G6XA 3ERCC 3NRZA 4ZH4A 2IUBA 5TZVA 4OAHA 2LM4A 3NUQA 4TUPA 3NASA 3K1ZA 5ALVA 4YG2A 8ICHA 4JWMA 4KN7A 3MFIA 3NKUA 5ALIA 2PFNA 1WCLA 8ICRA 2FLNA 2MAXA 2OM6A 4EBKA 3G6VA 2ZH5A 2QLTA 2YX8A 5E79U 4PL2A 2BCSA 4M9HA 3SAGA 5DG9A 3C1YA 1ZQAA 1D9FA 4C7ZA 1VFGA 1F44A 4DQQA 3BS5A 3M7DA 2YY6A 5ALLA 3ZDDA 2GOLA 4Y2SA 1PVPA 5B66U 2Z7JA 3WK4A 2B51A 1OXJA 2Y9UA 1TFRA 3QU4A 3TADC 3WK9A 5J0YA 2FMQA 3RH6A 4ZOHC 1NK6A 4R64A 5CRXA 2LPEA 4Y2UA 4O68A 2Y0SC 2JEFA 4GC7A 4UB6U 1T94A 3WU2U 5J0QA 1QQ5A 5KFTA 1QSYA 2ISPA 5ALGA 4ECSA 4KB6A 3ZDBA 4F2SA 1SWVA 2YMQA 3MFHA 1BGXT 4RPXA 1RQNA 2MUTB 3MBYA 3BQTA 2ZH2A 4IQWA 4UB5A 1XU4A 2AGOA 2KG5A 4KMOB 2FPLA 2E3TA 2NYVA 3H0LB 4RT3A 4NLZA 3PW7A 5ALZA 4DSFA 2QB0A 1Y88A 3SZ2A 5HRBA 4QW8A 2ESEA 1ECWA 2IOFA 3HKZF 5DQIA 1N61A 4KX5A 3PW2A 1NKEA 2J6UA 8ICAA 3I1YA 4Q45A 4WBYA 3ED5A 5IILA 1ZQTA 4MEXA 3CYMA 4QWBA 3DEEA 2M9NA 4PPXA 1JIHA 2ASJA 4ED3A 4F72A 5CJ7A 1XO0A 5KFZA 3QX7A 5DB7A 4DF4A 3QU9A 3T5HA 2R8KA 2D8CA 4DSJA 2D3DA 1HIWA 5TISU 2KJ8A 3RTVA 5KFEA 1NZPA 2IBKA 3M1YA 3C1ZA 5AI8A 1L6NA 4C4SA 1U4BA 2RHFA 4KLLA 2L5YA 2XGPA 3AQMA 4QZCA 4UAVA 3MGHA 3IHQB 1BPDA 4PGYA 4E80A 4ELTA 3QEAZ 4KLQA 3UXNA 2H5XA 3SV3A 4YD2A 1L3VA 1S0VA 2Y1IA 3AQLA 2BPFA 4DFJA 2IMWP 4WBZA 2ZIUA 4O3QA 4QWCA 2GWSA 3JCFA 3E0FA 5KFQA 5ALYA 1S8OA 3C2KA 2KNJA 4F5RA 4UB2A 4I2CA 4N7RA 2NO5A 3PO4A 4F5PA 5AI4A 2H3VA 4O3OA 8ICYA 1S97A 1SV0C 2M2WA 4KLOA 2DRAA 8ICKA 1MC8A 5EE3A 2MSNA 5AM2A 4RQ0A 3PSIA 5BPCA 4FHPA 1L8OA 2DL0A 5IIIA 4JV2A 4DS4A 4WQKA 1NZBA 2ZTDA 3RAQA 4KLJA 2AJQA 3PV8A 4BUGA 4I2IA 4QZDA 1X66A 2KJ5A 2VIXA 1KN5A 5EE9A 4GIBA 2EZYA 1SV0A 1K5OA 5EE1A 1CRXA 3OSNA 3FC4A 2BKEA 2HDOA 3JPSA 5ALRA 2B0CA 5J2FA 2HHPA 1Z4NA 2YQEA 5FP0A 3OUYA 4DS5A 1MA7A 1T7PA 3JPNA 2KEYA 5AM3A 2ZUBA 1XS9D 4OCZA 1ZQZA 4X4NA 2ZH9A 2K8CB 3R9KA 5L1LA 1TE2A 4F5OA 1KTQA 2XIDA 4DFPA 4IQUA 2KIVA 3HWTA 4XA5A 2Q66A 3M9MB 8ICPA 5GTHU 5DLFA 1ZQBA 4FFDA 1N63A 1RXVA 1NJYA 4EYIB 3PZPA 1V38A 9ICIA 5KFLA 4KMUA 4US8A 2HHWA 2AGPA 3RBEA 3D2NA 1V9PA 4RPYA 4AT8B 5HHHA 4ELUA 5EWEA 5D63A 2A1JB 5CEHA 4B6JA 1N60A 2HBMA 3TFRA 1RQLA 1PUZA 4G9BA 1RG6A 3ISBA 2G08A 5KFSA 2R8HA 4F4ZA 1JX4A 4ED7A 4E0DA 4FBTA 1YZ6A 1IV8A 5ALUA 1LVHA 5J0SA 4OJPA 5KAFU 1X40A 1SL0A 4K4HA 3NVYA 4UARA 4NLCA 1SL1A 2O1PA 4UAZA 5IINA 2OYYA 2HCFA 1Z3EB 4NXWA 3GQCA 3BZKA 1SKSA 1KQQA 1WOTA 9ICMA 5D61A 4MF8A 1QSSA 5KFPA 4KTQA 7ICOA 1X9SA 3BDPA 4X0BA 2NRTA 4YCXA 8ICWA 3QE9Y 5KG2A 1WYGA 3AQNA 5KG4A 3MR6A 2LYHA 5DB9A 2KP7A 2F1HA 2WB1C 4KLEA 1KSPA 1TK8A 5C0YA 2PMZF 4KN4A 2DF4B 4CF3A 2H3IA 2HHTA 1X9XA 1GO3F 5KFUA 7ICEA 1TFYA 3N7PD 4K99A 9ICTA 3PX0A 2DR7A 5AKIA 3H8SA 2BR0A 2MRLA 2XY7A 2DPIA 4RUCA 2BQUA 9ICBA 2K89A 1COOA 4TQSA 2C28A 2KE7A 1Q46A 5J2GA 9ICEA 2DFLA 2ZJAA 9ICJA 5B3PA 2HW3A 1KEJA 2LYAA 7ICHA 3H4DA 1HUOA 9ICSA 1RM6C 5AK5A 4LEZA 3E58A 4Y2YA 4QZAA 2FLPA 1PK1B 4UBBA 4ECWA 1ZJMA 5KG1A 8ICEA 4QZFA 4WH5A 2KKPA 2KJ9A 3M6ZA 2H3QA 4PZOA 4Y2RA 1Q78A 1X2IA 1OUQA 2B21A 2FPMA 2E8OA 4J9LA 4HYKA 1PK3A 1QQ7A 5J0TA 2R18A 3ALRA 2ZIWB 4GXJA 2CXYA 2DRBA 5AI5A 3PW4A 4DSEA 1ZQHA 4NKUA 1ZOLA 1YZ7A 1GPJA 2P6RA 4UB8U 3GV5B 2BDPA 4F3OA 8ICVA 4Y2QA 3U26A 3EW9A 3HPOA 1NK9A 4NKTA 1ZQXA 2NRVA 2KK0A 5F2VO 4NLNA 1X9WA 3SMVA 1PVRA 3HKZC 4P0QB 4F4YA 3SI8A 5AK4A 1N5XA 4UQGA 1UPHA 2BQRA 4M5DA 4K9AA 2W54A 4E8FA 4DQIA 5KT7A 3AU6A 4PHAA 2FPKA 4B9TA 2JEJA 1JUDA 3C2MA 1JRPA 3EZ5A 3KHHA 3LVWA
chains in the Genus database with same CATH topology
4X5VA 1WCLA 5KG5A 8ICRA 3PR5B 4GC6A 3QEBZ 1XC9A 4EBDA 2ASDA 5KFIA 2ZH7A 2FLNA 2MAXA 4EBKA 2VANA 3G6VA 1TK5A 1ZQGA 4J9OA 2ZH5A 3H3AA 1ZQSA 2BCSA 3OJSA 5DQGA 4M9HA 5DG9A 3H37A 4R8UB 2F1IA 4NM1A 3C1YA 1XO1A 4R66A 1JXLA 1ZQAA 1Z00B 1D9FA 1VFGA 1JQRA 3RRGA 4DQQA 3HIYA 1ZQKA 1L3TA 2PFOA 3ZDDA 4BDPA 1U45A 2RDJA 4RWNA 1XSNA 5DLGA 3BQ1A 4UB1A 3PY8A 4ATBB 1ZQDA 1TFRA 1IM4A 5J0YA 1L3SA 5KFVA 4P4MA 7ICFA 2FMQA 3GIMA 3PX4A 3RH6A 4O3RA 8ICCA 9ICOA 1NK6A 4R64A 4KLTA 3PW0A 3TI0A 4RQ4A 3JYYA 3UPSA 5KFDA 3RBDA 4O5EA 4I2DA 4B9SA 2JZBA 8ICMA 4F5QA 4PGXA 3Q8SB 4B9UA 5IIOA 3OVBA 4RZRA 1ZQRA 4J9SA 2HVIA 2JEFA 4GC7A 4EZ9A 5CR0A 5HC9A 4ECVA 3RR8A 8ICTA 3TANA 8ICFA 4DWIA 4FBUA 1UT5A 5J0QA 3KHLA 2R8JA 2DPJA 1S76D 5KFTA 2JEIA 1QSYA 2ISPA 4ECSA 2PI5A 7ICKA 3MR2A 2XY5A 4X4PA 4WC6A 4ATBA 5J2EA 5HREA 3ZDBA 4RT2A 4F2SA 4M47A 1D9DA 1HJPA 1BGXT 4RPXA 4YQWA 3OGUA 3MFHA 4KLUA 3WFRE 4RNOA 9ICNA 4YR2A 4I2JA 5KFBA 2MUTB 2AQ4A 2R8IA 4EBCA 3MBYA 1WCNA 7ICVA 4FHYA 3BQTA 3MR5A 5IIMA 3Q8MA 2XC9A 4S3NA 4QZ8A 4IR9A 7ICIA 4O3NA 4WC2A 9ICCA 2ZH2A 1T3NA 3L9DA 4IQWA 5HMMA 4UB5A 1XU4A 2AGOA 5J0OA 4NLGA 3C18A 2FPLA 1MIVA 4FH3A 4C8OA 4RT3A 5HRKA 4M04A 5J2AA 3GV7B 8ICIA 4NLZA 4EP7A 3OVSA 3PW7A 4O0IA 5J2HA 3V6HA 4DSFA 1BPZA 8ICUA 1Y88A 2P66A 3SZ2A 5HRBA 1R8CA 5JUMA 3LQCB 1S0MA 3ZDCA 4DL2A 1MIWA 3TQ1A 1LB2B 4QW8A 2PFPA 4TURA 4X4UA 3TARA 5D4BA 2VA2A 5L9XA 3MABA 2W9CA 7ICTA 5DQIA 4YN4A 4Q8FA 1UEUA 2ZH3A 4TUSA 3RB4A 1B43A 3PW2A 1NKEA 2J6UA 4JWNA 8ICAA 4X4QA 4Q45A 4WBYA 3JPPA 2DR8A 3H38A 1NK8A 5IILA 1JMSA 2ZUDA 4F93B 1ZQTA 1R8BA 1NJXA 4MEXA 8ICJA 1KRPA 4QWBA 1FA0A 1A76A 1TAQA 2AQ0A 2HHXA 3UPQA 2M9NA 4PPXA 4M2YA 5J0UA 1JIHA 2ASJA 4ED3A 1MQ2A 1KLNA 9ICQA 1DK2A 4JV1A 5CJ7A 4YR3A 2J6TA 5HHIA 9ICFA 3IM1A 3PR4A 2UVWA 4LVSA 7ICJA 2BPCA 5KFZA 4DF8A 4UB4A 4X4VA 2UVRA 5DB7A 3OV7A 1BPEA 4F4KA 4X4SA 4DF4A 1ZQWA 5CWRA 3T5HA 2KZ3A 2R8KA 7ICQA 4DSJA 2UVVA 5CB1A 4RNMA 1N48A 4FH5A 4RWOA 5HRDA 4I27A 2C2RA 5IIJA 3C66A 5HRGA 2HHSA 3RH4A 3Q8PB 4B9MA 4C8KA 3RTVA 3OJUA 5KFEA 2IBKA 1NZPA 4I2EA 2DR9A 1JN3A 3C1ZA 4PHDA 2XO7A 3EPGA 4P2HA 2KZMA 1U4BA 4UB3A 5KG0A 4DOAA 1ZETA 4KLLA 2BE3A 1R89A 3RRHA 2I1QA 2XGPA 1L5UA 3AQMA 4QZCA 7ICMA 3GIIA 2ZH1A 1NJZA 2PFQA 3MGHA 3IHQB 5HRHA 1BPDA 3C5FA 4PGYA 3UQ2A 4FO6A 4E80A 2BHNA 4ELTA 3HJ4A 5DQHA 3KHGA 3QEAZ 2BCQA 4KLQA 1ZQOA 4DLEA 4EEYA 4KLSA 2WTFA 1ZQFA 3UXNA 2H5XA 5BOLA 4YD2A 4J9PA 3SV3A 5KT5A 2Y1IA 1L3VA 2FMPA 1S0VA 4AT8A 3LDAA 3G6YA 3V6JA 2JZBB 2BPFA 2M2UA 3AQLA 2A1JA 2NRZA 4Z6FA 4DFJA 1XSLA 3B0YA 4F92B 4RQ5A 4RQ6A 4ED8A 1L3UA 2IMWP 2M2TA 4Z6DA 4DQPA 4WBZA 4O3QA 4QWCA 3OHAA 5J2DA 2GWSA 4J9NA 3N4MB 1NK0A 1BVSA 1TAUA 3MR3A 5DEDA 4ED0A 5KFQA 2W9BA 5KT6A 5F9LA 3C2KA 3PVXA 3MGIA 4F5RA 1KFSA 1JXEA 4WCWA 4RQ8A 3H40A 4YMMA 4UB2A 4ECTA 4I2CA 5KFYA 3TAQA 4AT9A 3WFQE 3B0XA 5DGBA 4F5PA 2BPGA 3PO4A 4B9VA 4NM2A 4O3OA 8ICYA 3RB0A 1S97A 7ICUA 3JZ0A 2V9WA 2M2WA 4RNNA 4GXIA 3E2EA 3RJEA 4KLOA 8ICKA 2DRAA 1MC8A 4RQ0A 3HW8A 3RJIA 2ASLA 4JUZA 4I2AA 3ETLA 3T5KA 5BPCA 4BGDA 3WFSC 3PNCA 4DLGA 4FHPA 5DKWA 5D46A 1OU5A 5IIIA 5KT4A 2ZHAA 1KDHA 3OUYB 4JV2A 5KTQA 3BJYA 1LV5A 5KFRA 4DS4A 4KLDA 5J2BA 5KFFA 5L1JA 3ZD9A 2W9AA 1DOQA 4M9GA 1NO5A 4UD5A 4AT7A 2ZTDA 3C21A 4Q43A 1NJWA 4FHXA 5IIKA 1D8LA 3RAQA 1ZQCA 4KLJA 2HHUA 2C2DA 4LZDA 4ELVA 2AJQA 3PV8A 4QZDA 4I2IA 4IRDA 2W9CB 4QZHA 4I2HA 3PW5A 4RWQA 4R65A 4QWEA 4YD1A 3BQ2A 1HUZA 2OWOA 2NRXA 2AGQA 2IHMA 4E7XA 5C5JA 3T3FA 1IXRA 4Z6CA 3PMNA 4F50A 4DSLA 4C8LA 4RQ7A 3OSNA 1SL2A 1BPBA 5HRFA 2BKEA 8ICOA 4BXOB 3JPSA 3FYHA 4ECUA 3ISCA 3TAPA 3RJHA 4DSIA 5J2FA 3HT3A 4WC0A 3ORYA 4QZGA 2ZHBA 4F4WA 4KLMA 2HHPA 3OUYA 3V6KA 3NTUA 4DS5A 5KFAA 5KT3A 3Q8LA 1ZQLA 3JPNA 3V7KA 1K1QA 4GLXA 1SKRA 1ZQMA 5CP2A 1T7PA 4IQVA 4B9LA 2ZUBA 1XS9D 1ZQZA 4J9MA 4X4NA 4RWPA 4Q8EA 2ZH9A 5L1LA 1XWLA 4F5OA 1KTQA 4G3IA 4DFPA 4YP3A 1NK4A 4DL3A 4IQUA 4UAYA 5KFOA 4XUSA 3HWTA 4XA5A 3H4BA 2BCUA 1CEZA 5HRIA 5J0XA 4LT6A 2Q66A 4NLKA 1F5AA 5KFNA 4RUAA 4TQRA 3M9MB 4ECXA 8ICPA 1D8YA 2ZTEA 1U9LA 3GDXA 3V7JA 1RYRA 3H7IA 4FS1A 5DLFA 2XY6A 1TVAA 1ZQBA 8ICSA 1NK5A 1RXVA 1NJYA 4EYIB 5J2KA 4LZGA 4BXOA 4IRCA 4IG8A 2ID1A 9ICIA 5KFLA 2KFNA 2ZH6A 5HMLA 4ECQA 5HNKA 5DB6A 4KMUA 3RJFA 2HHWA 4TUQA 3RB6A 4KITB 2AGPA 4FHWA 4J9KA 3RBEA 1V9PA 4RPYA 1UA1A 1R8AA 1MQ3A 4M9LA 9ICAA 2W8LA 2PBEA 4AT8B 5HHHA 3LWLA 4ELUA 2W9MA 4WC3A 1NK7A 5EWEA 3QZ8A 1ZQYA 7ICNA 2A1JB 1PZNA 4BWMA 5KG3A 4UBCA 4ED6A 4DL7A 3JPTA 3JPRA 2KFZA 4WC5A 1NOMA 5DG7A 4O5CA 1SZPA 2BCVA 3TFRA 4XQ8A 1RXWA 4X4RA 5KG7A 3AUOA 1N56A 2W9BB 3ISBA 2KN7A 4JV0A 5KFSA 2R8HA 4F4ZA 2KTQA 4DEZA 1S10A 3C2LA 1JX4A 4AT9B 3H8WA 4ED7A 2BCRA 4E0DA 1BPYA 4FBTA 1KFTA 4IRKA 4QZEA 4DL4A 1SKWA 3K4GA 5CA7A 3N97B 4RQ2A 5J0SA 3PO5A 5KFKA 3ZD8A 2VA8A 1SL0A 4K4HA 4GXKA 1C7YA 1RPLA 4PHEA 1SL1A 1U49A 3ISDA 1RYSA 4UAZA 9ICXA 2O1PA 4IR1A 5IINA 3RH5A 9ICLA 4EBEA 4QW9A 2JEGA 4UD4A 4MFFA 3RB3A 2NRKA 4M9JA 1Z3EB 5KG6A 4P4PA 4B9NA 4C8NA 1ZJNA 3M8SA 2ALZA 3GQCA 9ICRA 1SKSA 4YR0A 4KLIA 1ZQPA 1WOTA 4WC1A 9ICMA 2Y1JA 3M9OB 4M6WB 1PX5A 4MF8A 4J9RA 1BNPA 4ECZA 5EOZA 4PH5A 5DBBA 3M8RA 4BWJA 3C5GA 1QSSA 5KFPA 4AT7B 2NRWA 4YVZA 4PHPA 2V4QA 4KTQA 4IQTA 1V4AA 4DFMA 4QZIA 1KFDA 7ICOA 1X9SA 1TK0A 3BDPA 4DL6A 5J0RA 1ZQJA 4X0BA 5DBCA 7ICLA 2DR5A 5BOMA 4JK1A 2HHQA 1JAJA 2NRTA 4YCXA 3UXPA 8ICWA 3QE9Y 5KG2A 3RJKA 5HRLA 4XRHA 5J0WA 3Q8RB 1KNYA 4EBJA 1X9MA 1DK3A 3T5LA 4KLGA 3AQNA 5KG4A 3MR6A 2LYHA 4EYHB 1T4GA 5DB9A 2XCAA 2F1HA 8ICXA 4KLEA 2KP7A 4X4OA 1KSPA 1TK8A 3T5JA 4UAWA 3OHBA 3RR7A 3PX6A 1QLNA 4NXZA 3LWMA 3AQKA 4KN4A 3WFPA 4M6WA 1S77D 5J2IA 2HHTA 2PXIA 5EWGA 2DVIA 5CHGA 4YXJA 4DL5A 2ZH4A 4I2FA 2ZH8A 4YMNA 5KFUA 7ICEA 8ICLA 2C22A 1TFYA 5DDYA 3RJJA 4RQ1A 9ICGA 1A77A 1DGSA 1EXNA 1S0NA 3FDSA 3HJ1A 9ICTA 3PX0A 2DR7A 2W8KA 4DO9A 3H8SA 4I2GA 4O9MA 2BR0A 3M9NB 5L1IA 4ED1A 3EPIA 2XY7A 4F5NA 2DPIA 4RUCA 2BQUA 5KFXA 4I2BA 9ICBA 3H8JA 5DG8A 1NKBA 1COOA 4TQSA 1BPXA 2C28A 4R8UA 3UXOA 2ISOA 1Z00A 3QZ7A 5J2GA 9ICEA 1TFWA 5KFWA 2DFLA 2ZJAA 5KFJA 9ICJA 4QZ9A 2M2VA 2HW3A 4PGQA 1KEJA 7ICHA 3EYZA 3H4DA 1HUOA 4DOCA 9ICSA 7ICPA 3THVA 9ICPA 4MF2A 8ICNA 3GFKB 4QWDA 3OSPA 4QWAA 4DSKA 4F2RA 4O3SA 7ICRA 4QZAA 1YLQA 3Q8KA 2FLPA 2Q0ZX 4X0AA 4ED2A 5L1KA 4KLHA 4UBBA 3MDAA 4ECWA 4O5KA 4YFKA 4K4GA 3SV4A 3TFSA 1ZJMA 2XCPA 2FMSA 5KG1A 8ICEA 1B22A 4QZFA 4Q44A 2PI4A 2HVHA 4J9QA 5KFGA 2RDIA 1H38A 2UVUA 3EWAA 1S9FA 2F1JA 2O5AA 1Q78A 4NY8A 3AU2A 5J0PA 3Q8QB 1X2IA 1U47A 1QTMA 3LK9A 2B21A 5J2CA 9ICHA 2FPMA 2J6SA 4MFAA 2KZZA 2RFFA 3V7LA 2ZTCA 4J9LA 4HYKA 8ICBA 2P6UA 2ZJ5A 3K75D 5J0TA 1K1SA 4Z6EA 5HP4A 1BNOA 1VJ7A 3OVAA 5J2JA 1AROP 1RZTA 5KFCA 4GXJA 4YMOA 3HP6A 3WFOA 4FS2A 4I29A 1Q79A 3ZDEA 4DFKA 2DRBA 2BGWA 1ZQIA 3PW4A 4RU9A 1ZQUA 5DECA 1MSWD 4DSEA 2BQ3A 4ECRA 5F9NA 3PMLA 1ZQHA 4NKUA 2MUTA 4O3PA 7ICGA 4WC7A 2IHNA 9ICWA 3RJGA 2AU0A 3BQ0A 4KLFA 1UEVA 1QSLA 3UQ0A 2ZJ8A 2P6RA 4DOBA 1U48A 1UETA 3GV5B 2BDPA 4MEYA 5D49A 4F3OA 4DQRA 8ICVA 8ICZA 1T8EA 4FHVA 3EW9A 4I28A 3HPOA 3GV8B 1NK9A 4NKTA 4F8RA 2I9GA 4X4TA 4M9NA 4F4XA 5KFMA 5DGAA 5DDMA 4RQ3A 1ZQXA 4XQ7A 1TV9A 2NRVA 4CCHA 1CUKA 4MFCA 4WC4A 9ICKA 5KFHA 4YXMA 5F2VO 4NLNA 1UT8A 1ZQVA 2ZUCA 3JPQA 3HX0A 3V72A 2C2EA 8ICQA 1X9WA 4ECYA 3H39A 4DQSA 5HR9A 5DB8A 2ATLA 3C23A 4P4OA 3NYBA 2FLLA 1XSPA 7ICSA 4F4YA 4C8MA 4R63A 2HHVA 3JPOA 3GILA 3KHRA 1UA0A 4F91B 2R8GA 3KTQA 1ZYQA 8ICGA 3SI8A 1ZQNA 2XGQA 2V4RA 1MIYA 9ICUA 2IA6A 5DBAA 3G6XA 4UQGA 1S0OA 3SYZA 4ZH4A 5KT2A 3GIJA 2VA3A 4M0AA 5TZVA 2BQRA 3MDCA 4QZBA 1ZQEA 9ICVA 3GIKA 1ZQQA 4M5DA 1NKCA 4TUPA 4RPZA 4EZ6A 4E8FA 4K4IA 4DQIA 5KT7A 4YG2A 4PHAA 3AU6A 2FPKA 4JWMA 4B9TA 2JEJA 8ICHA 4KN7A 3MFIA 5EWFA 3RAXA 3C2MA 3NGDA 3ZDAA 3EZ5A 5J29A 3KHHA 2PFNA 1TKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5V A;  1WCL A;  5KG5 A;  8ICR A;  3PR5 B;  4GC6 A;  3QEB Z;  1XC9 A;  4EBD A;  2ASD A;  5KFI A;  2ZH7 A;  2FLN A;  2MAX A;  4EBK A;  2VAN A;  3G6V A;  1TK5 A;  1ZQG A;  4J9O A;  2ZH5 A;  3H3A A;  1ZQS A;  2BCS A;  3OJS A;  5DQG A;  4M9H A;  5DG9 A;  3H37 A;  4R8U B;  2F1I A;  4NM1 A;  3C1Y A;  1XO1 A;  4R66 A;  1JXL A;  1ZQA A;  1Z00 B;  1D9F A;  1VFG A;  1JQR A;  3RRG A;  4DQQ A;  3HIY A;  1ZQK A;  1L3T A;  2PFO A;  3ZDD A;  4BDP A;  1U45 A;  2RDJ A;  4RWN A;  1XSN A;  5DLG A;  3BQ1 A;  4UB1 A;  3PY8 A;  4ATB B;  1ZQD A;  1TFR A;  1IM4 A;  5J0Y A;  1L3S A;  5KFV A;  4P4M A;  7ICF A;  2FMQ A;  3GIM A;  3PX4 A;  3RH6 A;  4O3R A;  8ICC A;  9ICO A;  1NK6 A;  4R64 A;  4KLT A;  3PW0 A;  3TI0 A;  4RQ4 A;  3JYY A;  3UPS A;  5KFD A;  3RBD A;  4O5E A;  4I2D A;  4B9S A;  2JZB A;  8ICM A;  4F5Q A;  4PGX A;  3Q8S B;  4B9U A;  5IIO A;  3OVB A;  4RZR A;  1ZQR A;  4J9S A;  2HVI A;  2JEF A;  4GC7 A;  4EZ9 A;  5CR0 A;  5HC9 A;  4ECV A;  3RR8 A;  8ICT A;  3TAN A;  8ICF A;  4DWI A;  4FBU A;  1UT5 A;  5J0Q A;  3KHL A;  2R8J A;  2DPJ A;  1S76 D;  5KFT A;  2JEI A;  1QSY A;  2ISP A;  4ECS A;  2PI5 A;  7ICK A;  3MR2 A;  2XY5 A;  4X4P A;  4WC6 A;  4ATB A;  5J2E A;  5HRE A;  3ZDB A;  4RT2 A;  4F2S A;  4M47 A;  1D9D A;  1HJP A;  1BGX T;  4RPX A;  4YQW A;  3OGU A;  3MFH A;  4KLU A;  3WFR E;  4RNO A;  9ICN A;  4YR2 A;  4I2J A;  5KFB A;  2MUT B;  2AQ4 A;  2R8I A;  4EBC A;  3MBY A;  1WCN A;  7ICV A;  4FHY A;  3BQT A;  3MR5 A;  5IIM A;  3Q8M A;  2XC9 A;  4S3N A;  4QZ8 A;  4IR9 A;  7ICI A;  4O3N A;  4WC2 A;  9ICC A;  2ZH2 A;  1T3N A;  3L9D A;  4IQW A;  5HMM A;  4UB5 A;  1XU4 A;  2AGO A;  5J0O A;  4NLG A;  3C18 A;  2FPL A;  1MIV A;  4FH3 A;  4C8O A;  4RT3 A;  5HRK A;  4M04 A;  5J2A A;  3GV7 B;  8ICI A;  4NLZ A;  4EP7 A;  3OVS A;  3PW7 A;  4O0I A;  5J2H A;  3V6H A;  4DSF A;  1BPZ A;  8ICU A;  1Y88 A;  2P66 A;  3SZ2 A;  5HRB A;  1R8C A;  5JUM A;  3LQC B;  1S0M A;  3ZDC A;  4DL2 A;  1MIW A;  3TQ1 A;  1LB2 B;  4QW8 A;  2PFP A;  4TUR A;  4X4U A;  3TAR A;  5D4B A;  2VA2 A;  5L9X A;  3MAB A;  2W9C A;  7ICT A;  5DQI A;  4YN4 A;  4Q8F A;  1UEU A;  2ZH3 A;  4TUS A;  3RB4 A;  1B43 A;  3PW2 A;  1NKE A;  2J6U A;  4JWN A;  8ICA A;  4X4Q A;  4Q45 A;  4WBY A;  3JPP A;  2DR8 A;  3H38 A;  1NK8 A;  5IIL A;  1JMS A;  2ZUD A;  4F93 B;  1ZQT A;  1R8B A;  1NJX A;  4MEX A;  8ICJ A;  1KRP A;  4QWB A;  1FA0 A;  1A76 A;  1TAQ A;  2AQ0 A;  2HHX A;  3UPQ A;  2M9N A;  4PPX A;  4M2Y A;  5J0U A;  1JIH A;  2ASJ A;  4ED3 A;  1MQ2 A;  1KLN A;  9ICQ A;  1DK2 A;  4JV1 A;  5CJ7 A;  4YR3 A;  2J6T A;  5HHI A;  9ICF A;  3IM1 A;  3PR4 A;  2UVW A;  4LVS A;  7ICJ A;  2BPC A;  5KFZ A;  4DF8 A;  4UB4 A;  4X4V A;  2UVR A;  5DB7 A;  3OV7 A;  1BPE A;  4F4K A;  4X4S A;  4DF4 A;  1ZQW A;  5CWR A;  3T5H A;  2KZ3 A;  2R8K A;  7ICQ A;  4DSJ A;  2UVV A;  5CB1 A;  4RNM A;  1N48 A;  4FH5 A;  4RWO A;  5HRD A;  4I27 A;  2C2R A;  5IIJ A;  3C66 A;  5HRG A;  2HHS A;  3RH4 A;  3Q8P B;  4B9M A;  4C8K A;  3RTV A;  3OJU A;  5KFE A;  2IBK A;  1NZP A;  4I2E A;  2DR9 A;  1JN3 A;  3C1Z A;  4PHD A;  2XO7 A;  3EPG A;  4P2H A;  2KZM A;  1U4B A;  4UB3 A;  5KG0 A;  4DOA A;  1ZET A;  4KLL A;  2BE3 A;  1R89 A;  3RRH A;  2I1Q A;  2XGP A;  1L5U A;  3AQM A;  4QZC A;  7ICM A;  3GII A;  2ZH1 A;  1NJZ A;  2PFQ A;  3MGH A;  3IHQ B;  5HRH A;  1BPD A;  3C5F A;  4PGY A;  3UQ2 A;  4FO6 A;  4E80 A;  2BHN A;  4ELT A;  3HJ4 A;  5DQH A;  3KHG A;  3QEA Z;  2BCQ A;  4KLQ A;  1ZQO A;  4DLE A;  4EEY A;  4KLS A;  2WTF A;  1ZQF A;  3UXN A;  2H5X A;  5BOL A;  4YD2 A;  4J9P A;  3SV3 A;  5KT5 A;  2Y1I A;  1L3V A;  2FMP A;  1S0V A;  4AT8 A;  3LDA A;  3G6Y A;  3V6J A;  2JZB B;  2BPF A;  2M2U A;  3AQL A;  2A1J A;  2NRZ A;  4Z6F A;  4DFJ A;  1XSL A;  3B0Y A;  4F92 B;  4RQ5 A;  4RQ6 A;  4ED8 A;  1L3U A;  2IMW P;  2M2T A;  4Z6D A;  4DQP A;  4WBZ A;  4O3Q A;  4QWC A;  3OHA A;  5J2D A;  2GWS A;  4J9N A;  3N4M B;  1NK0 A;  1BVS A;  1TAU A;  3MR3 A;  5DED A;  4ED0 A;  5KFQ A;  2W9B A;  5KT6 A;  5F9L A;  3C2K A;  3PVX A;  3MGI A;  4F5R A;  1KFS A;  1JXE A;  4WCW A;  4RQ8 A;  3H40 A;  4YMM A;  4UB2 A;  4ECT A;  4I2C A;  5KFY A;  3TAQ A;  4AT9 A;  3WFQ E;  3B0X A;  5DGB A;  4F5P A;  2BPG A;  3PO4 A;  4B9V A;  4NM2 A;  4O3O A;  8ICY A;  3RB0 A;  1S97 A;  7ICU A;  3JZ0 A;  2V9W A;  2M2W A;  4RNN A;  4GXI A;  3E2E A;  3RJE A;  4KLO A;  8ICK A;  2DRA A;  1MC8 A;  4RQ0 A;  3HW8 A;  3RJI A;  2ASL A;  4JUZ A;  4I2A A;  3ETL A;  3T5K A;  5BPC A;  4BGD A;  3WFS C;  3PNC A;  4DLG A;  4FHP A;  5DKW A;  5D46 A;  1OU5 A;  5III A;  5KT4 A;  2ZHA A;  1KDH A;  3OUY B;  4JV2 A;  5KTQ A;  3BJY A;  1LV5 A;  5KFR A;  4DS4 A;  4KLD A;  5J2B A;  5KFF A;  5L1J A;  3ZD9 A;  2W9A A;  1DOQ A;  4M9G A;  1NO5 A;  4UD5 A;  4AT7 A;  2ZTD A;  3C21 A;  4Q43 A;  1NJW A;  4FHX A;  5IIK A;  1D8L A;  3RAQ A;  1ZQC A;  4KLJ A;  2HHU A;  2C2D A;  4LZD A;  4ELV A;  2AJQ A;  3PV8 A;  4QZD A;  4I2I A;  4IRD A;  2W9C B;  4QZH A;  4I2H A;  3PW5 A;  4RWQ A;  4R65 A;  4QWE A;  4YD1 A;  3BQ2 A;  1HUZ A;  2OWO A;  2NRX A;  2AGQ A;  2IHM A;  4E7X A;  5C5J A;  3T3F A;  1IXR A;  4Z6C A;  3PMN A;  4F50 A;  4DSL A;  4C8L A;  4RQ7 A;  3OSN A;  1SL2 A;  1BPB A;  5HRF A;  2BKE A;  8ICO A;  4BXO B;  3JPS A;  3FYH A;  4ECU A;  3ISC A;  3TAP A;  3RJH A;  4DSI A;  5J2F A;  3HT3 A;  4WC0 A;  3ORY A;  4QZG A;  2ZHB A;  4F4W A;  4KLM A;  2HHP A;  3OUY A;  3V6K A;  3NTU A;  4DS5 A;  5KFA A;  5KT3 A;  3Q8L A;  1ZQL A;  3JPN A;  3V7K A;  1K1Q A;  4GLX A;  1SKR A;  1ZQM A;  5CP2 A;  1T7P A;  4IQV A;  4B9L A;  2ZUB A;  1XS9 D;  1ZQZ A;  4J9M A;  4X4N A;  4RWP A;  4Q8E A;  2ZH9 A;  5L1L A;  1XWL A;  4F5O A;  1KTQ A;  4G3I A;  4DFP A;  4YP3 A;  1NK4 A;  4DL3 A;  4IQU A;  4UAY A;  5KFO A;  4XUS A;  3HWT A;  4XA5 A;  3H4B A;  2BCU A;  1CEZ A;  5HRI A;  5J0X A;  4LT6 A;  2Q66 A;  4NLK A;  1F5A A;  5KFN A;  4RUA A;  4TQR A;  3M9M B;  4ECX A;  8ICP A;  1D8Y A;  2ZTE A;  1U9L A;  3GDX A;  3V7J A;  1RYR A;  3H7I A;  4FS1 A;  5DLF A;  2XY6 A;  1TVA A;  1ZQB A;  8ICS A;  1NK5 A;  1RXV A;  1NJY A;  4EYI B;  5J2K A;  4LZG A;  4BXO A;  4IRC A;  4IG8 A;  2ID1 A;  9ICI A;  5KFL A;  2KFN A;  2ZH6 A;  5HML A;  4ECQ A;  5HNK A;  5DB6 A;  4KMU A;  3RJF A;  2HHW A;  4TUQ A;  3RB6 A;  4KIT B;  2AGP A;  4FHW A;  4J9K A;  3RBE A;  1V9P A;  4RPY A;  1UA1 A;  1R8A A;  1MQ3 A;  4M9L A;  9ICA A;  2W8L A;  2PBE A;  4AT8 B;  5HHH A;  3LWL A;  4ELU A;  2W9M A;  4WC3 A;  1NK7 A;  5EWE A;  3QZ8 A;  1ZQY A;  7ICN A;  2A1J B;  1PZN A;  4BWM A;  5KG3 A;  4UBC A;  4ED6 A;  4DL7 A;  3JPT A;  3JPR A;  2KFZ A;  4WC5 A;  1NOM A;  5DG7 A;  4O5C A;  1SZP A;  2BCV A;  3TFR A;  4XQ8 A;  1RXW A;  4X4R A;  5KG7 A;  3AUO A;  1N56 A;  2W9B B;  3ISB A;  2KN7 A;  4JV0 A;  5KFS A;  2R8H A;  4F4Z A;  2KTQ A;  4DEZ A;  1S10 A;  3C2L A;  1JX4 A;  4AT9 B;  3H8W A;  4ED7 A;  2BCR A;  4E0D A;  1BPY A;  4FBT A;  1KFT A;  4IRK A;  4QZE A;  4DL4 A;  1SKW A;  3K4G A;  5CA7 A;  3N97 B;  4RQ2 A;  5J0S A;  3PO5 A;  5KFK A;  3ZD8 A;  2VA8 A;  1SL0 A;  4K4H A;  4GXK A;  1C7Y A;  1RPL A;  4PHE A;  1SL1 A;  1U49 A;  3ISD A;  1RYS A;  4UAZ A;  9ICX A;  2O1P A;  4IR1 A;  5IIN A;  3RH5 A;  9ICL A;  4EBE A;  4QW9 A;  2JEG A;  4UD4 A;  4MFF A;  3RB3 A;  2NRK A;  4M9J A;  1Z3E B;  5KG6 A;  4P4P A;  4B9N A;  4C8N A;  1ZJN A;  3M8S A;  2ALZ A;  3GQC A;  9ICR A;  1SKS A;  4YR0 A;  4KLI A;  1ZQP A;  1WOT A;  4WC1 A;  9ICM A;  2Y1J A;  3M9O B;  4M6W B;  1PX5 A;  4MF8 A;  4J9R A;  1BNP A;  4ECZ A;  5EOZ A;  4PH5 A;  5DBB A;  3M8R A;  4BWJ A;  3C5G A;  1QSS A;  5KFP A;  4AT7 B;  2NRW A;  4YVZ A;  4PHP A;  2V4Q A;  4KTQ A;  4IQT A;  1V4A A;  4DFM A;  4QZI A;  1KFD A;  7ICO A;  1X9S A;  1TK0 A;  3BDP A;  4DL6 A;  5J0R A;  1ZQJ A;  4X0B A;  5DBC A;  7ICL A;  2DR5 A;  5BOM A;  4JK1 A;  2HHQ A;  1JAJ A;  2NRT A;  4YCX A;  3UXP A;  8ICW A;  3QE9 Y;  5KG2 A;  3RJK A;  5HRL A;  4XRH A;  5J0W A;  3Q8R B;  1KNY A;  4EBJ A;  1X9M A;  1DK3 A;  3T5L A;  4KLG A;  3AQN A;  5KG4 A;  3MR6 A;  2LYH A;  4EYH B;  1T4G A;  5DB9 A;  2XCA A;  2F1H A;  8ICX A;  4KLE A;  2KP7 A;  4X4O A;  1KSP A;  1TK8 A;  3T5J A;  4UAW A;  3OHB A;  3RR7 A;  3PX6 A;  1QLN A;  4NXZ A;  3LWM A;  3AQK A;  4KN4 A;  3WFP A;  4M6W A;  1S77 D;  5J2I A;  2HHT A;  2PXI A;  5EWG A;  2DVI A;  5CHG A;  4YXJ A;  4DL5 A;  2ZH4 A;  4I2F A;  2ZH8 A;  4YMN A;  5KFU A;  7ICE A;  8ICL A;  2C22 A;  1TFY A;  5DDY A;  3RJJ A;  4RQ1 A;  9ICG A;  1A77 A;  1DGS A;  1EXN A;  1S0N A;  3FDS A;  3HJ1 A;  9ICT A;  3PX0 A;  2DR7 A;  2W8K A;  4DO9 A;  3H8S A;  4I2G A;  4O9M A;  2BR0 A;  3M9N B;  5L1I A;  4ED1 A;  3EPI A;  2XY7 A;  4F5N A;  2DPI A;  4RUC A;  2BQU A;  5KFX A;  4I2B A;  9ICB A;  3H8J A;  5DG8 A;  1NKB A;  1COO A;  4TQS A;  1BPX A;  2C28 A;  4R8U A;  3UXO A;  2ISO A;  1Z00 A;  3QZ7 A;  5J2G A;  9ICE A;  1TFW A;  5KFW A;  2DFL A;  2ZJA A;  5KFJ A;  9ICJ A;  4QZ9 A;  2M2V A;  2HW3 A;  4PGQ A;  1KEJ A;  7ICH A;  3EYZ A;  3H4D A;  1HUO A;  4DOC A;  9ICS A;  7ICP A;  3THV A;  9ICP A;  4MF2 A;  8ICN A;  3GFK B;  4QWD A;  3OSP A;  4QWA A;  4DSK A;  4F2R A;  4O3S A;  7ICR A;  4QZA A;  1YLQ A;  3Q8K A;  2FLP A;  2Q0Z X;  4X0A A;  4ED2 A;  5L1K A;  4KLH A;  4UBB A;  3MDA A;  4ECW A;  4O5K A;  4YFK A;  4K4G A;  3SV4 A;  3TFS A;  1ZJM A;  2XCP A;  2FMS A;  5KG1 A;  8ICE A;  1B22 A;  4QZF A;  4Q44 A;  2PI4 A;  2HVH A;  4J9Q A;  5KFG A;  2RDI A;  1H38 A;  2UVU A;  3EWA A;  1S9F A;  2F1J A;  2O5A A;  1Q78 A;  4NY8 A;  3AU2 A;  5J0P A;  3Q8Q B;  1X2I A;  1U47 A;  1QTM A;  3LK9 A;  2B21 A;  5J2C A;  9ICH A;  2FPM A;  2J6S A;  4MFA A;  2KZZ A;  2RFF A;  3V7L A;  2ZTC A;  4J9L A;  4HYK A;  8ICB A;  2P6U A;  2ZJ5 A;  3K75 D;  5J0T A;  1K1S A;  4Z6E A;  5HP4 A;  1BNO A;  1VJ7 A;  3OVA A;  5J2J A;  1ARO P;  1RZT A;  5KFC A;  4GXJ A;  4YMO A;  3HP6 A;  3WFO A;  4FS2 A;  4I29 A;  1Q79 A;  3ZDE A;  4DFK A;  2DRB A;  2BGW A;  1ZQI A;  3PW4 A;  4RU9 A;  1ZQU A;  5DEC A;  1MSW D;  4DSE A;  2BQ3 A;  4ECR A;  5F9N A;  3PML A;  1ZQH A;  4NKU A;  2MUT A;  4O3P A;  7ICG A;  4WC7 A;  2IHN A;  9ICW A;  3RJG A;  2AU0 A;  3BQ0 A;  4KLF A;  1UEV A;  1QSL A;  3UQ0 A;  2ZJ8 A;  2P6R A;  4DOB A;  1U48 A;  1UET A;  3GV5 B;  2BDP A;  4MEY A;  5D49 A;  4F3O A;  4DQR A;  8ICV A;  8ICZ A;  1T8E A;  4FHV A;  3EW9 A;  4I28 A;  3HPO A;  3GV8 B;  1NK9 A;  4NKT A;  4F8R A;  2I9G A;  4X4T A;  4M9N A;  4F4X A;  5KFM A;  5DGA A;  5DDM A;  4RQ3 A;  1ZQX A;  4XQ7 A;  1TV9 A;  2NRV A;  4CCH A;  1CUK A;  4MFC A;  4WC4 A;  9ICK A;  5KFH A;  4YXM A;  5F2V O;  4NLN A;  1UT8 A;  1ZQV A;  2ZUC A;  3JPQ A;  3HX0 A;  3V72 A;  2C2E A;  8ICQ A;  1X9W A;  4ECY A;  3H39 A;  4DQS A;  5HR9 A;  5DB8 A;  2ATL A;  3C23 A;  4P4O A;  3NYB A;  2FLL A;  1XSP A;  7ICS A;  4F4Y A;  4C8M A;  4R63 A;  2HHV A;  3JPO A;  3GIL A;  3KHR A;  1UA0 A;  4F91 B;  2R8G A;  3KTQ A;  1ZYQ A;  8ICG A;  3SI8 A;  1ZQN A;  2XGQ A;  2V4R A;  1MIY A;  9ICU A;  2IA6 A;  5DBA A;  3G6X A;  4UQG A;  1S0O A;  3SYZ A;  4ZH4 A;  5KT2 A;  3GIJ A;  2VA3 A;  4M0A A;  5TZV A;  2BQR A;  3MDC A;  4QZB A;  1ZQE A;  9ICV A;  3GIK A;  1ZQQ A;  4M5D A;  1NKC A;  4TUP A;  4RPZ A;  4EZ6 A;  4E8F A;  4K4I A;  4DQI A;  5KT7 A;  4YG2 A;  4PHA A;  3AU6 A;  2FPK A;  4JWM A;  4B9T A;  2JEJ A;  8ICH A;  4KN7 A;  3MFI A;  5EWF A;  3RAX A;  3C2M A;  3NGD A;  3ZDA A;  3EZ5 A;  5J29 A;  3KHH A;  2PFN A;  1TKD A; 
#chains in the Genus database with same CATH topology
 3CNH A;  2E8N A;  2ZH7 A;  3OPX A;  5ALQ A;  2VAN A;  3WK8 A;  1TK5 A;  4J9O A;  4BJQ A;  3H3A A;  2W3S A;  1V97 A;  5DQG A;  4R8U B;  2F1I A;  5J8Y A;  3AL0 B;  3T79 A;  2DUY A;  2PFO A;  1L7P A;  4BDP A;  4EV6 A;  2RDJ A;  2A1A A;  2G5H B;  5DLG A;  1IG6 A;  2ZIV A;  2HBK A;  5JTI A;  4DCC A;  5KFD A;  2JZB A;  8ICM A;  5EE0 A;  4PGX A;  3OVB A;  5IIO A;  2HVI A;  4WJ3 B;  5AM1 A;  4EZ9 A;  1C20 A;  3RR8 A;  2HOF A;  1S76 D;  2JEI A;  4ATB A;  5HRE A;  3WKE A;  4M47 A;  1HJP A;  3WFR E;  4LJX A;  4YR2 A;  4WC3 A;  4NXU A;  4S3N A;  2XC9 A;  4QZ8 A;  7ICI A;  3TAC B;  5J0O A;  2I6X A;  4C8O A;  3OTQ A;  4EP7 A;  2HBJ A;  3GV7 B;  3V6H A;  4EX7 A;  8ICU A;  2P66 A;  3LQC B;  3ZDC A;  2OXO A;  2A19 A;  2NO4 A;  4MHV A;  1J2M A;  3PSF A;  2W9C A;  4Q8F A;  2ZH3 A;  1B43 A;  3ETR A;  5AI0 A;  2DR8 A;  1JMS A;  4CE6 A;  2H3F A;  1KRP A;  1FA0 A;  4EEK A;  3UPQ A;  4M2Y A;  3AQE A;  1DK2 A;  4K96 A;  9ICQ A;  3IM1 A;  7ICJ A;  4LVS A;  2WF5 A;  2UVR A;  4NWI A;  2UVV A;  4FH5 A;  4RWO A;  2QKQ A;  4I27 A;  2W03 A;  5G5H A;  5HRG A;  3RH4 A;  3Q8P B;  4C8K A;  3OJU A;  4P2H A;  2KZM A;  4O67 A;  5KG0 A;  1R89 A;  2I1Q A;  2WF7 A;  1LKY B;  3GII A;  2ZH1 A;  5HRH A;  2BHN A;  3KHG A;  4C4R A;  2K8B B;  2GO7 A;  3SEI A;  3LDA A;  3V6J A;  4FZN A;  2NRZ A;  4Z6F A;  2AXT U;  1L3U A;  4DQP A;  5AK6 A;  4ED0 A;  4UAT A;  2W9B A;  3N28 A;  4O6A A;  3MGI A;  1KFS A;  1JXE A;  4WCW A;  3H40 A;  4WOY A;  2HI0 A;  3TAQ A;  5D62 A;  1VJ5 A;  3O0F A;  3RB0 A;  3JZ0 A;  4RNN A;  3WK7 A;  2YB1 A;  3S6J A;  4ACO A;  3HW8 A;  3RJI A;  2E5S A;  2OHF A;  3WFS C;  2K60 A;  2ZHA A;  3OUY B;  3AM9 A;  3H0R B;  3CP8 A;  3ZD9 A;  3WKB A;  1D8L A;  1ZQC A;  1PVQ A;  2HHU A;  2C2D A;  2B56 A;  3LYS A;  1SIJ A;  4QWE A;  4YD1 A;  2DGZ A;  3C28 A;  2AGQ A;  2IHM A;  2JV3 A;  1IXR A;  3PMN A;  4C8L A;  1FEZ A;  8ICO A;  4IL6 U;  3QUQ A;  3TAP A;  3ZI4 A;  2ZHB A;  4QZG A;  4F71 A;  4GLX A;  4B9L A;  1SKR A;  2K4P A;  2LMR A;  4RWP A;  3AMZ A;  3H4B A;  5HR7 A;  4NV0 A;  1D8Y A;  2ZTE A;  3F2B A;  3V7J A;  1RYR A;  3H7I A;  2XY6 A;  1NK5 A;  3NRW A;  2VJ5 A;  4IRC A;  2ID1 A;  2KFN A;  2ZH6 A;  2E8M A;  1N5W A;  1ZD4 A;  4TUQ A;  4KIT B;  4J9K A;  1UA1 A;  5A0L A;  1R8A A;  2EZX A;  5CFT A;  3MGV A;  1NI3 A;  3LWL A;  1NK7 A;  3QZ8 A;  1ZQY A;  7ICN A;  5KG3 A;  3JPT A;  1YT3 A;  1NOM A;  4O5C A;  2BCV A;  4X4R A;  5KG7 A;  3SAF A;  4JV0 A;  3F53 A;  2KTQ A;  3C2L A;  4AT9 B;  1BPY A;  2GAF D;  4DL4 A;  2EAO A;  2GLE A;  5AKX A;  3K4G A;  3WKA A;  4RQ2 A;  3N97 B;  3ZD8 A;  2VA8 A;  3QNM A;  2G06 A;  4AP9 A;  1SB3 C;  9ICX A;  4OAG A;  2EWR A;  4UD4 A;  2JEG A;  2ZIX B;  4M9J A;  3HJE A;  5KG6 A;  4YR0 A;  1ZQP A;  4WC1 A;  2Y1J A;  1PX5 A;  1Z1B A;  2RQ5 A;  3M8R A;  5DBB A;  4AT7 B;  4LEY A;  3C5G A;  2F76 X;  2NRW A;  2V4Q A;  2GA9 D;  1V4A A;  4DFM A;  4HX0 A;  4QZI A;  1KFD A;  2FCL A;  2G0A A;  2G5I B;  2IOH A;  5DBC A;  7ICL A;  1JAJ A;  3UXP A;  2JH7 A;  2P35 A;  5HRL A;  4XRH A;  3MCR A;  3Q8R B;  1KNY A;  1DK3 A;  4KLG A;  3AN1 A;  1Q8K A;  1T4G A;  3LVV A;  8ICX A;  3KOO A;  2ODG A;  4UAW A;  3OHB A;  2E1E A;  4OAI Z;  3AQK A;  4M6W A;  3IV6 A;  1S77 D;  2PXI A;  5EWG A;  5K4L A;  4DL5 A;  2ZH8 A;  4YMN A;  2ZXH A;  4PL1 A;  5KNI A;  2JR5 A;  4C7Y A;  1DGS A;  3IP4 B;  1S0N A;  3QU7 A;  4JLX A;  3ONN A;  2KD1 A;  2W8K A;  4DO9 A;  4O9M A;  5L1I A;  4ED1 A;  2W3R A;  3EPI A;  4F5N A;  2LBO A;  5AI9 A;  1BPX A;  1J97 A;  3UXO A;  2ISO A;  3QZ7 A;  2A3V A;  2YMM A;  3DV9 A;  2M2V A;  5JU5 A;  3EYZ A;  2E1F A;  4DOC A;  7ICP A;  2FE9 A;  9ICP A;  8ICN A;  2B6G A;  4F2R A;  4O3S A;  3Q8K A;  2Q0Z X;  2Q4T A;  5AKJ A;  5L1K A;  4ED2 A;  4X0A A;  4O5K A;  3TFS A;  3UMC A;  1B22 A;  3QXG A;  3ER9 B;  2CPR A;  2PI4 A;  4J9Q A;  5ALP A;  2LHT A;  1H38 A;  2UVU A;  3AU2 A;  1AQ6 A;  1F0M A;  2N1R A;  1U47 A;  5J2C A;  2KZZ A;  3V7L A;  2ZTC A;  2KSO B;  1BNO A;  4Z6E A;  5HP4 A;  1S5L U;  4ICA A;  2W7P A;  5ALK A;  1ARO P;  1RZT A;  5AKZ A;  1NNL A;  4YMO A;  3WFO A;  1Q79 A;  3ZDE A;  4WQL A;  4ECR A;  5F9N A;  2MUT A;  1A0P A;  2IHN A;  9ICW A;  3RJG A;  2AU0 A;  4KLF A;  1Z19 A;  1QSL A;  1SV4 A;  4MKP A;  8ICZ A;  2W7O A;  1T8E A;  4FHV A;  4I28 A;  4M9N A;  4F4X A;  1TV9 A;  1CUK A;  2JH1 A;  4NXT A;  3TKA A;  2JHD A;  3HX0 A;  2ZUC A;  3V72 A;  2C2E A;  8ICQ A;  3H39 A;  2ATL A;  3NYB A;  4C8M A;  4R63 A;  3JPO A;  1UA0 A;  4P0P B;  4F91 B;  1SWW A;  4CF4 A;  2Y9T A;  8ICG A;  2EAN A;  5ALJ A;  2YML A;  3J81 j;  2XGQ A;  2V4R A;  2IA6 A;  2VA3 A;  4M0A A;  3MDC A;  5CFU A;  1ZQE A;  4NXX A;  3GIK A;  5AK3 A;  1ZQQ A;  1NKC A;  4RPZ A;  1MIY A;  1D8B A;  5J29 A;  3SD7 A;  4X5V A;  3QEB Z;  4EBD A;  1KL9 A;  5KFI A;  2FJ6 A;  1ZQG A;  3A0H U;  2D6F C;  5AIC A;  1ZQS A;  4QIW F;  1XO1 A;  4R66 A;  1Z00 B;  1ZQK A;  1A6S A;  1XSN A;  1RDF A;  3BQ1 A;  3PY8 A;  5HR6 A;  4ATB B;  1ZQD A;  1L3S A;  7ICF A;  3PX4 A;  8ICC A;  4KLT A;  3PW0 A;  3TI0 A;  4RQ4 A;  3JYY A;  1COK A;  4O5E A;  3UMB A;  4I2D A;  3ICX A;  3Q8S B;  1O08 A;  1ZQR A;  5CR0 A;  5HC9 A;  8ICT A;  3TAN A;  1F5S A;  4DWI A;  3KHL A;  4EX6 A;  4EGW A;  2PI5 A;  4X4P A;  2DQN B;  4USA A;  3NVZ A;  3OGU A;  4YQW A;  1D9D A;  5KL8 B;  4KLU A;  2HBL A;  9ICN A;  2AQ4 A;  3HRD D;  5KFB A;  4DFD A;  4FHY A;  4IS7 A;  3MR5 A;  5IIM A;  4C4T A;  3Q8M A;  4O3N A;  4QNL A;  2JRZ A;  1UQV A;  4OJO A;  2F2A B;  4NLG A;  2AH5 A;  1MIV A;  2HOI A;  3OVS A;  3F2D A;  2YB4 A;  5GTI U;  2FDR A;  2XIC A;  3QU2 A;  5JUM A;  5ALD A;  1MIW A;  4DL2 A;  3TAR A;  5D4B A;  1X6I A;  7ICT A;  4YN4 A;  3RB4 A;  4JWN A;  4X4Q A;  3JPP A;  3H38 A;  1Q3U A;  3WKC A;  8ICJ A;  1A76 A;  1TAQ A;  2HHX A;  1KLN A;  4YR3 A;  2J6T A;  9ICF A;  2EH9 A;  3PR4 A;  2BPC A;  4CGZ A;  3I76 A;  4F4K A;  1J2N A;  1SGG A;  1ZQW A;  5CWR A;  5CFS A;  7ICQ A;  3IG5 A;  5CB1 A;  4FZL A;  4RNM A;  2AHO B;  2C2R A;  5IIJ A;  2HHS A;  4KM5 A;  5J8Y C;  3GU3 A;  2DR9 A;  1JN3 A;  2XO7 A;  1JI7 A;  4UB3 A;  5AKG A;  4DOA A;  1ZET A;  1FFU A;  3BS5 B;  3RRH A;  2PKE A;  2EAP A;  1NJZ A;  3UQ2 A;  4FO6 A;  2CRX A;  3HJ4 A;  2VJ4 A;  4EEY A;  5BOL A;  2FMP A;  4AT8 A;  4CRX A;  3BS7 A;  2A1J A;  1XSL A;  4RQ6 A;  4F92 B;  4ED8 A;  4Z6D A;  5AIA A;  3OHA A;  5J2D A;  1NK0 A;  4NJ8 A;  5F9L A;  3PVX A;  3QU5 A;  1V85 A;  4RQ8 A;  1B0X A;  4YMM A;  2KIC A;  4ECT A;  5KFY A;  3L5K A;  3WFQ E;  5DGB A;  2DKZ A;  4OJ6 A;  4OD0 A;  4B9V A;  4NM2 A;  3IG8 A;  7ICU A;  2V9W A;  4GXI A;  1SZH A;  2ASL A;  4JUZ A;  4I2A A;  3T5K A;  2MA1 A;  4BGD A;  2K4E A;  3D6J A;  3PNC A;  4DLG A;  5DKW A;  5D46 A;  5ALT A;  5KT4 A;  1KDH A;  1ZD5 A;  5KTQ A;  3BJY A;  4KLD A;  3L3F X;  2QB1 A;  5KFF A;  5L1J A;  2QB0 B;  2W9A A;  1NO5 A;  4M9G A;  3C21 A;  4FHX A;  2BBJ A;  4ELV A;  3NVO A;  4IRD A;  3HIL A;  4QZH A;  3PW5 A;  3KFU F;  3BQ2 A;  4E7X A;  5C5J A;  3T3F A;  4F50 A;  4RQ7 A;  1SL2 A;  2W43 A;  4JMU A;  4ECU A;  3ISC A;  4O69 A;  3RJH A;  4DSI A;  4WC0 A;  4KLM A;  3D2Q A;  1ZQL A;  5KFA A;  4X4U A;  3PSP A;  1K1Q A;  1ZQM A;  5CP2 A;  1L7O A;  4IQV A;  2ZG6 A;  2KOB A;  2YTU A;  4YP3 A;  4DL3 A;  5ALW A;  1NK4 A;  5CHE A;  5HRI A;  4XUS A;  4LT6 A;  1CEZ A;  3NVW A;  5J0X A;  4U7C A;  1F5A A;  5KFN A;  4RUA A;  4ECX A;  1WG8 A;  1U9L A;  1TVA A;  8ICS A;  3IN5 A;  4LZG A;  4BXO A;  4IG8 A;  3PHZ A;  4ECQ A;  5HNK A;  5DB6 A;  3RJF A;  1WUD A;  3RF9 A;  4FHW A;  1DRG A;  1MQ3 A;  2W8L A;  2PBE A;  2W9M A;  4C80 A;  1PK1 A;  4BWM A;  4DL7 A;  4ED6 A;  3D2S A;  2KFZ A;  4WC5 A;  1TAM A;  2ZIU B;  1N56 A;  4O3M A;  2KN7 A;  1FIQ A;  1Z1V A;  3C29 A;  1S10 A;  2KMD A;  4IRK A;  1P7D A;  2OEH A;  3SQI A;  4CF5 A;  3PO5 A;  2YN4 A;  2M0N A;  4GXK A;  1C7Y A;  1RPL A;  4PHE A;  3ISD A;  1RYS A;  1OW5 A;  4IR1 A;  4QW9 A;  2NRK A;  4BX9 C;  4FO1 A;  4P4P A;  4C8N A;  1ZJN A;  3ER8 C;  2BDU A;  2ALZ A;  3KKA A;  2LYB A;  3M9O B;  4M6W B;  1UCV A;  3GZF A;  4UAU A;  4J9R A;  1N62 A;  4ECZ A;  4EED A;  3KZI U;  4PH5 A;  4BWJ A;  4PHP A;  1N2X A;  3WKD A;  2KVC A;  1TK0 A;  4DL6 A;  5J0R A;  2DR5 A;  2HHQ A;  3BZC A;  4EBJ A;  3KD3 A;  1X9M A;  1CI4 A;  4P0Q A;  2EDU A;  4EYH B;  5AKE A;  4X4O A;  3EUB 2;  4NL9 A;  4EEL A;  3PX6 A;  3RR7 A;  4NXZ A;  3LWM A;  3WFP A;  5J2I A;  5CHG A;  2HSZ A;  2RP5 A;  2ZH4 A;  2DKX A;  2W11 A;  1MN8 A;  2CN1 A;  9ICG A;  3AQF A;  1EXN A;  1L7N A;  3HJ1 A;  2ZXI A;  4I2G A;  3M9N B;  3H8M A;  1FO4 A;  5G5G A;  2KIW A;  1NKB A;  1JRO A;  4Y2V A;  4R8U A;  4QIW C;  3SAH A;  2DWQ A;  1TFW A;  5KFW A;  5KFJ A;  4XJE A;  4QZ9 A;  2PMZ C;  4PGQ A;  5F3X B;  4JB3 A;  3GFK B;  4QWD A;  4UAS A;  3F5A A;  4QWA A;  4DSK A;  3TAD A;  4LEW A;  4KLH A;  2JGA A;  2KKV A;  3MDA A;  5H2F U;  4YFK A;  4K4G A;  3SV4 A;  1M6Y A;  2FMS A;  2RDI A;  1S9F A;  2F1J A;  2WF6 A;  2KHQ A;  8ICB A;  2ZJ5 A;  1K1S A;  3MC1 A;  4FS2 A;  4I29 A;  2O6K A;  2F44 A;  4DFK A;  2BGW A;  1ZQU A;  5DEC A;  1MSW D;  1T3Q A;  2BQ3 A;  4O3P A;  4WC7 A;  3NS1 A;  3BQ0 A;  5AM0 A;  3WK5 A;  3UQ0 A;  1U48 A;  4MEY A;  4Y2P A;  4DQR A;  3GV8 B;  2I9G A;  3H0M B;  1X6J A;  5KFM A;  3VCB A;  2H3Z A;  4RQ3 A;  4WC4 A;  2WAQ F;  4YXM A;  3JPQ A;  2WF8 A;  3UM9 A;  5HR9 A;  5DB8 A;  3C23 A;  2FLL A;  5T14 A;  4AYB F;  1ZYQ A;  4FZM A;  2IHO A;  5DBA A;  2G09 A;  1S0O A;  3SYZ A;  2F8K A;  5KT2 A;  2QAR A;  5AKY A;  3GIJ A;  2BBH A;  4QZB A;  9ICV A;  4EZ6 A;  4K4I A;  4NXV A;  5EWF A;  3RAX A;  1QCK A;  3NGD A;  3ZDA A;  1TKD A;  4I0U A;  5KG5 A;  3PR5 B;  4GC6 A;  1XC9 A;  3AEV A;  2ASD A;  4LEV A;  1URJ A;  3OJS A;  3H37 A;  4NM1 A;  5ALO A;  1JXL A;  1JQR A;  3RRG A;  3HIY A;  5JTG A;  1L3T A;  1LKY A;  1U45 A;  4RWN A;  2I5H A;  4US9 A;  4UB1 A;  1IM4 A;  5KFV A;  4P4M A;  9ICO A;  3GIM A;  4O3R A;  3UPS A;  1ED1 A;  3RBD A;  3VC8 A;  4B9S A;  4F5Q A;  4A8E A;  2W55 A;  4B9U A;  4RZR A;  2RLT A;  4J9S A;  2LKY A;  3DDH A;  3KZX A;  4ECV A;  1SXD A;  1ZXI A;  8ICF A;  2KVS A;  4FBU A;  3M6K A;  1UT5 A;  2R8J A;  2DPJ A;  4PJ0 U;  3K7D A;  7ICK A;  3MR2 A;  2XY5 A;  4WC6 A;  5J2E A;  1ZD2 P;  4RT2 A;  3K1R B;  4RNO A;  4I2J A;  4KX3 A;  7ICV A;  3A0B U;  2R8I A;  4EBC A;  1WCN A;  1QH9 A;  4K8V A;  5KAI U;  4IR9 A;  4WC2 A;  9ICC A;  3CW2 C;  1T3N A;  5ALN A;  3L9D A;  5HMM A;  3WK6 A;  5AKL A;  3C18 A;  4FH3 A;  5HRK A;  4M04 A;  5J2A A;  8ICI A;  4O0I A;  5J2H A;  1BPZ A;  2F77 X;  1R8C A;  2HOQ A;  1S0M A;  3B9J A;  3TQ1 A;  1LB2 B;  2PFP A;  4TUR A;  2HN1 A;  4FE3 A;  2VA2 A;  5L9X A;  3MAB A;  1UEU A;  4TUS A;  4U6P A;  1ZD3 A;  5ALE A;  5ALF A;  1NK8 A;  1R8B A;  2ZUD A;  4F93 B;  4HAI A;  1NJX A;  2F3N A;  2AQ0 A;  1L8L A;  5J0U A;  1MQ2 A;  4JV1 A;  5HHI A;  2XVT A;  2UVW A;  4DF8 A;  4UB4 A;  4X4V A;  2XI9 A;  3OV7 A;  1BPE A;  4X4S A;  4RQN A;  5B5E U;  2KZ3 A;  1N48 A;  3QUC A;  3CRX A;  5HRD A;  3C66 A;  4B9M A;  3FM9 A;  1UHU A;  4I2E A;  4PHD A;  3EPG A;  2WF9 A;  2BE3 A;  1L5U A;  5KL1 B;  7ICM A;  2LI6 A;  5AM4 A;  2PFQ A;  3C5F A;  5DQH A;  2BCQ A;  5AIB A;  2ZIV B;  1ZQO A;  4DLE A;  4KLS A;  2WTF A;  1ZQF A;  4J9P A;  5KT5 A;  1KKX A;  3G6Y A;  2M2U A;  2EZZ A;  2JZB B;  3NVV A;  3B0Y A;  4RQ5 A;  2M2T A;  2Y0S F;  3N7S C;  4J9N A;  5L1M A;  3N4M B;  2RRD A;  1BVS A;  2F8L A;  1TAU A;  3MR3 A;  5DED A;  2IOF K;  5KT6 A;  1VDV A;  4Y2X A;  4AT9 A;  3QUT A;  3B0X A;  2BPG A;  1B4F A;  2DBY A;  3E2E A;  3RJE A;  1KBU A;  3RFA A;  2JXJ A;  2OH2 A;  5AHX A;  5AKK A;  3ETL A;  2ZIX A;  4EEN A;  4K9B A;  3KBB A;  2K4H A;  1OU5 A;  1LV5 A;  5KFR A;  1Z4O A;  5J2B A;  1DXS A;  5B3Q A;  1DOQ A;  4UD5 A;  4AT7 A;  4Q43 A;  1IIP A;  4PZN A;  1NJW A;  5IIK A;  4LZD A;  2JMG A;  2W9C B;  4I2H A;  4JLZ A;  4RWQ A;  4R65 A;  1HUZ A;  2OWO A;  4OJ5 A;  2NRX A;  5ALS A;  4GFJ A;  4Z6C A;  4DSL A;  1QQ6 A;  1BPB A;  2YMP A;  1WWV A;  1ZRN A;  5HRF A;  3QYP A;  4BXO B;  3FYH A;  3HT3 A;  3ORY A;  1ZRM A;  4F4W A;  3V6K A;  3NTU A;  5KT3 A;  3Q8L A;  4Y2T A;  3V7K A;  4OJL A;  2VKQ A;  1RYU A;  4J9M A;  4Q8E A;  1XWL A;  4G3I A;  4UAY A;  5KFO A;  2BCU A;  3SEN A;  4NLK A;  2EQY A;  2B4V A;  4TQR A;  2W04 A;  3GDX A;  2OCE A;  4FS1 A;  3UMG A;  5J2K A;  2E8P A;  3PST A;  3IRU A;  2MU2 A;  5HML A;  4CNQ A;  3RB6 A;  4UW9 A;  5AI6 A;  4M9L A;  9ICA A;  2KHV A;  2HN2 A;  1PZN A;  4UBC A;  3JPR A;  5DG7 A;  1SZP A;  1RXW A;  4XQ8 A;  3NWI A;  3AUO A;  2K8A A;  2W9B B;  1XNS A;  4DEZ A;  3H8W A;  2BCR A;  1KFT A;  4QZE A;  3F5E A;  1SKW A;  1Q3V A;  5CA7 A;  2KSO A;  4K98 A;  5KFK A;  1O03 A;  1U49 A;  3RH5 A;  9ICL A;  4EBE A;  4MFF A;  3RB3 A;  2G07 A;  5AM5 A;  4B9N A;  3BQ7 A;  5JRT A;  3M8S A;  9ICR A;  4KLI A;  2KV2 A;  4K97 A;  1BNP A;  2HMX A;  5EOZ A;  3I28 A;  4NLB A;  4YVZ A;  4J03 A;  4IQT A;  1L7M A;  3IDW A;  1ZQJ A;  5BOM A;  2WAQ C;  4JK1 A;  3RJK A;  1HEK A;  5ALH A;  5J0W A;  2WHE A;  1SXE A;  3T5L A;  3CK6 A;  4AYB C;  4P0P A;  2XCA A;  2WFA A;  4RQM A;  3QUB A;  1KW4 A;  3T5J A;  4EEB A;  3OWG A;  1QLN A;  3SR6 A;  4QJF B;  2DVI A;  4YXJ A;  4I2F A;  8ICL A;  2C22 A;  5DDY A;  2LM1 A;  3RJJ A;  4RQ1 A;  1VLB A;  2FI1 A;  4IC9 A;  1A77 A;  3FDS A;  1ZQ1 C;  5KFX A;  4I2B A;  3H8J A;  5DG8 A;  1Z00 A;  2EAM A;  3THV A;  4MF2 A;  4Y2J A;  3OSP A;  7ICR A;  4C0Z A;  1YLQ A;  1FFV A;  3N7R C;  2XCP A;  1DGJ A;  2BZF A;  4Q44 A;  2HVH A;  3F2C A;  5KFG A;  1WWU A;  5AKH A;  3EWA A;  2O5A A;  4NY8 A;  4OO1 J;  5J0P A;  3Q8Q B;  1QTM A;  3LK9 A;  2ES6 A;  9ICH A;  2RFF A;  2J6S A;  4MFA A;  2P6U A;  3K75 D;  1VJ7 A;  3OVA A;  5J2J A;  5KFC A;  3HP6 A;  2GH1 A;  1ZQI A;  4RU9 A;  4OAF A;  3PML A;  1X42 A;  3KKA C;  7ICG A;  1UEV A;  2K4I A;  2ZJ8 A;  2QAR B;  4DOB A;  1UET A;  5D49 A;  5ALM A;  5ALX A;  4F8R A;  2NV3 A;  3L4P A;  3FAH A;  4X4T A;  5DGA A;  4CDG A;  5DDM A;  4XQ7 A;  4CCH A;  3EF2 A;  4MFC A;  9ICK A;  5KFH A;  1UT8 A;  1ZQV A;  4ECY A;  2ZIW A;  4DQS A;  4P4O A;  1XSP A;  7ICS A;  2HHV A;  1JAL A;  3GIL A;  3KHR A;  2R8G A;  3KTQ A;  2WB1 F;  1ZQN A;  4NL9 C;  9ICU A;  3G6X A;  3ERC C;  3NRZ A;  4ZH4 A;  2IUB A;  5TZV A;  4OAH A;  2LM4 A;  3NUQ A;  4TUP A;  3NAS A;  3K1Z A;  5ALV A;  4YG2 A;  8ICH A;  4JWM A;  4KN7 A;  3MFI A;  3NKU A;  5ALI A;  2PFN A;  1WCL A;  8ICR A;  2FLN A;  2MAX A;  2OM6 A;  4EBK A;  3G6V A;  2ZH5 A;  2QLT A;  2YX8 A;  5E79 U;  4PL2 A;  2BCS A;  4M9H A;  3SAG A;  5DG9 A;  3C1Y A;  1ZQA A;  1D9F A;  4C7Z A;  1VFG A;  1F44 A;  4DQQ A;  3BS5 A;  3M7D A;  2YY6 A;  5ALL A;  3ZDD A;  2GOL A;  4Y2S A;  1PVP A;  5B66 U;  2Z7J A;  3WK4 A;  2B51 A;  1OXJ A;  2Y9U A;  1TFR A;  3QU4 A;  3TAD C;  3WK9 A;  5J0Y A;  2FMQ A;  3RH6 A;  4ZOH C;  1NK6 A;  4R64 A;  5CRX A;  2LPE A;  4Y2U A;  4O68 A;  2Y0S C;  2JEF A;  4GC7 A;  4UB6 U;  1T94 A;  3WU2 U;  5J0Q A;  1QQ5 A;  5KFT A;  1QSY A;  2ISP A;  5ALG A;  4ECS A;  4KB6 A;  3ZDB A;  4F2S A;  1SWV A;  2YMQ A;  3MFH A;  1BGX T;  4RPX A;  1RQN A;  2MUT B;  3MBY A;  3BQT A;  2ZH2 A;  4IQW A;  4UB5 A;  1XU4 A;  2AGO A;  2KG5 A;  4KMO B;  2FPL A;  2E3T A;  2NYV A;  3H0L B;  4RT3 A;  4NLZ A;  3PW7 A;  5ALZ A;  4DSF A;  2QB0 A;  1Y88 A;  3SZ2 A;  5HRB A;  4QW8 A;  2ESE A;  1ECW A;  2IOF A;  3HKZ F;  5DQI A;  1N61 A;  4KX5 A;  3PW2 A;  1NKE A;  2J6U A;  8ICA A;  3I1Y A;  4Q45 A;  4WBY A;  3ED5 A;  5IIL A;  1ZQT A;  4MEX A;  3CYM A;  4QWB A;  3DEE A;  2M9N A;  4PPX A;  1JIH A;  2ASJ A;  4ED3 A;  4F72 A;  5CJ7 A;  1XO0 A;  5KFZ A;  3QX7 A;  5DB7 A;  4DF4 A;  3QU9 A;  3T5H A;  2R8K A;  2D8C A;  4DSJ A;  2D3D A;  1HIW A;  5TIS U;  2KJ8 A;  3RTV A;  5KFE A;  1NZP A;  2IBK A;  3M1Y A;  3C1Z A;  5AI8 A;  1L6N A;  4C4S A;  1U4B A;  2RHF A;  4KLL A;  2L5Y A;  2XGP A;  3AQM A;  4QZC A;  4UAV A;  3MGH A;  3IHQ B;  1BPD A;  4PGY A;  4E80 A;  4ELT A;  3QEA Z;  4KLQ A;  3UXN A;  2H5X A;  3SV3 A;  4YD2 A;  1L3V A;  1S0V A;  2Y1I A;  3AQL A;  2BPF A;  4DFJ A;  2IMW P;  4WBZ A;  2ZIU A;  4O3Q A;  4QWC A;  2GWS A;  3JCF A;  3E0F A;  5KFQ A;  5ALY A;  1S8O A;  3C2K A;  2KNJ A;  4F5R A;  4UB2 A;  4I2C A;  4N7R A;  2NO5 A;  3PO4 A;  4F5P A;  5AI4 A;  2H3V A;  4O3O A;  8ICY A;  1S97 A;  1SV0 C;  2M2W A;  4KLO A;  2DRA A;  8ICK A;  1MC8 A;  5EE3 A;  2MSN A;  5AM2 A;  4RQ0 A;  3PSI A;  5BPC A;  4FHP A;  1L8O A;  2DL0 A;  5III A;  4JV2 A;  4DS4 A;  4WQK A;  1NZB A;  2ZTD A;  3RAQ A;  4KLJ A;  2AJQ A;  3PV8 A;  4BUG A;  4I2I A;  4QZD A;  1X66 A;  2KJ5 A;  2VIX A;  1KN5 A;  5EE9 A;  4GIB A;  2EZY A;  1SV0 A;  1K5O A;  5EE1 A;  1CRX A;  3OSN A;  3FC4 A;  2BKE A;  2HDO A;  3JPS A;  5ALR A;  2B0C A;  5J2F A;  2HHP A;  1Z4N A;  2YQE A;  5FP0 A;  3OUY A;  4DS5 A;  1MA7 A;  1T7P A;  3JPN A;  2KEY A;  5AM3 A;  2ZUB A;  1XS9 D;  4OCZ A;  1ZQZ A;  4X4N A;  2ZH9 A;  2K8C B;  3R9K A;  5L1L A;  1TE2 A;  4F5O A;  1KTQ A;  2XID A;  4DFP A;  4IQU A;  2KIV A;  3HWT A;  4XA5 A;  2Q66 A;  3M9M B;  8ICP A;  5GTH U;  5DLF A;  1ZQB A;  4FFD A;  1N63 A;  1RXV A;  1NJY A;  4EYI B;  3PZP A;  1V38 A;  9ICI A;  5KFL A;  4KMU A;  4US8 A;  2HHW A;  2AGP A;  3RBE A;  3D2N A;  1V9P A;  4RPY A;  4AT8 B;  5HHH A;  4ELU A;  5EWE A;  5D63 A;  2A1J B;  5CEH A;  4B6J A;  1N60 A;  2HBM A;  3TFR A;  1RQL A;  1PUZ A;  4G9B A;  1RG6 A;  3ISB A;  2G08 A;  5KFS A;  2R8H A;  4F4Z A;  1JX4 A;  4ED7 A;  4E0D A;  4FBT A;  1YZ6 A;  1IV8 A;  5ALU A;  1LVH A;  5J0S A;  4OJP A;  5KAF U;  1X40 A;  1SL0 A;  4K4H A;  3NVY A;  4UAR A;  4NLC A;  1SL1 A;  2O1P A;  4UAZ A;  5IIN A;  2OYY A;  2HCF A;  1Z3E B;  4NXW A;  3GQC A;  3BZK A;  1SKS A;  1KQQ A;  1WOT A;  9ICM A;  5D61 A;  4MF8 A;  1QSS A;  5KFP A;  4KTQ A;  7ICO A;  1X9S A;  3BDP A;  4X0B A;  2NRT A;  4YCX A;  8ICW A;  3QE9 Y;  5KG2 A;  1WYG A;  3AQN A;  5KG4 A;  3MR6 A;  2LYH A;  5DB9 A;  2KP7 A;  2F1H A;  2WB1 C;  4KLE A;  1KSP A;  1TK8 A;  5C0Y A;  2PMZ F;  4KN4 A;  2DF4 B;  4CF3 A;  2H3I A;  2HHT A;  1X9X A;  1GO3 F;  5KFU A;  7ICE A;  1TFY A;  3N7P D;  4K99 A;  9ICT A;  3PX0 A;  2DR7 A;  5AKI A;  3H8S A;  2BR0 A;  2MRL A;  2XY7 A;  2DPI A;  4RUC A;  2BQU A;  9ICB A;  2K89 A;  1COO A;  4TQS A;  2C28 A;  2KE7 A;  1Q46 A;  5J2G A;  9ICE A;  2DFL A;  2ZJA A;  9ICJ A;  5B3P A;  2HW3 A;  1KEJ A;  2LYA A;  7ICH A;  3H4D A;  1HUO A;  9ICS A;  1RM6 C;  5AK5 A;  4LEZ A;  3E58 A;  4Y2Y A;  4QZA A;  2FLP A;  1PK1 B;  4UBB A;  4ECW A;  1ZJM A;  5KG1 A;  8ICE A;  4QZF A;  4WH5 A;  2KKP A;  2KJ9 A;  3M6Z A;  2H3Q A;  4PZO A;  4Y2R A;  1Q78 A;  1X2I A;  1OUQ A;  2B21 A;  2FPM A;  2E8O A;  4J9L A;  4HYK A;  1PK3 A;  1QQ7 A;  5J0T A;  2R18 A;  3ALR A;  2ZIW B;  4GXJ A;  2CXY A;  2DRB A;  5AI5 A;  3PW4 A;  4DSE A;  1ZQH A;  4NKU A;  1ZOL A;  1YZ7 A;  1GPJ A;  2P6R A;  4UB8 U;  3GV5 B;  2BDP A;  4F3O A;  8ICV A;  4Y2Q A;  3U26 A;  3EW9 A;  3HPO A;  1NK9 A;  4NKT A;  1ZQX A;  2NRV A;  2KK0 A;  5F2V O;  4NLN A;  1X9W A;  3SMV A;  1PVR A;  3HKZ C;  4P0Q B;  4F4Y A;  3SI8 A;  5AK4 A;  1N5X A;  4UQG A;  1UPH A;  2BQR A;  4M5D A;  4K9A A;  2W54 A;  4E8F A;  4DQI A;  5KT7 A;  3AU6 A;  4PHA A;  2FPK A;  4B9T A;  2JEJ A;  1JUD A;  3C2M A;  1JRP A;  3EZ5 A;  3KHH A;  3LVW A; 
#chains in the Genus database with same CATH homology
 4X5V A;  1WCL A;  5KG5 A;  8ICR A;  3PR5 B;  4GC6 A;  3QEB Z;  1XC9 A;  4EBD A;  2ASD A;  5KFI A;  2ZH7 A;  2FLN A;  2MAX A;  4EBK A;  2VAN A;  3G6V A;  1TK5 A;  1ZQG A;  4J9O A;  2ZH5 A;  3H3A A;  1ZQS A;  2BCS A;  3OJS A;  5DQG A;  4M9H A;  5DG9 A;  3H37 A;  4R8U B;  2F1I A;  4NM1 A;  3C1Y A;  1XO1 A;  4R66 A;  1JXL A;  1ZQA A;  1Z00 B;  1D9F A;  1VFG A;  1JQR A;  3RRG A;  4DQQ A;  3HIY A;  1ZQK A;  1L3T A;  2PFO A;  3ZDD A;  4BDP A;  1U45 A;  2RDJ A;  4RWN A;  1XSN A;  5DLG A;  3BQ1 A;  4UB1 A;  3PY8 A;  4ATB B;  1ZQD A;  1TFR A;  1IM4 A;  5J0Y A;  1L3S A;  5KFV A;  4P4M A;  7ICF A;  2FMQ A;  3GIM A;  3PX4 A;  3RH6 A;  4O3R A;  8ICC A;  9ICO A;  1NK6 A;  4R64 A;  4KLT A;  3PW0 A;  3TI0 A;  4RQ4 A;  3JYY A;  3UPS A;  5KFD A;  3RBD A;  4O5E A;  4I2D A;  4B9S A;  2JZB A;  8ICM A;  4F5Q A;  4PGX A;  3Q8S B;  4B9U A;  5IIO A;  3OVB A;  4RZR A;  1ZQR A;  4J9S A;  2HVI A;  2JEF A;  4GC7 A;  4EZ9 A;  5CR0 A;  5HC9 A;  4ECV A;  3RR8 A;  8ICT A;  3TAN A;  8ICF A;  4DWI A;  4FBU A;  1UT5 A;  5J0Q A;  3KHL A;  2R8J A;  2DPJ A;  1S76 D;  5KFT A;  2JEI A;  1QSY A;  2ISP A;  4ECS A;  2PI5 A;  7ICK A;  3MR2 A;  2XY5 A;  4X4P A;  4WC6 A;  4ATB A;  5J2E A;  5HRE A;  3ZDB A;  4RT2 A;  4F2S A;  4M47 A;  1D9D A;  1HJP A;  1BGX T;  4RPX A;  4YQW A;  3OGU A;  3MFH A;  4KLU A;  3WFR E;  4RNO A;  9ICN A;  4YR2 A;  4I2J A;  5KFB A;  2MUT B;  2AQ4 A;  2R8I A;  4EBC A;  3MBY A;  1WCN A;  7ICV A;  4FHY A;  3BQT A;  3MR5 A;  5IIM A;  3Q8M A;  2XC9 A;  4S3N A;  4QZ8 A;  4IR9 A;  7ICI A;  4O3N A;  4WC2 A;  9ICC A;  2ZH2 A;  1T3N A;  3L9D A;  4IQW A;  5HMM A;  4UB5 A;  1XU4 A;  2AGO A;  5J0O A;  4NLG A;  3C18 A;  2FPL A;  1MIV A;  4FH3 A;  4C8O A;  4RT3 A;  5HRK A;  4M04 A;  5J2A A;  3GV7 B;  8ICI A;  4NLZ A;  4EP7 A;  3OVS A;  3PW7 A;  4O0I A;  5J2H A;  3V6H A;  4DSF A;  1BPZ A;  8ICU A;  1Y88 A;  2P66 A;  3SZ2 A;  5HRB A;  1R8C A;  5JUM A;  3LQC B;  1S0M A;  3ZDC A;  4DL2 A;  1MIW A;  3TQ1 A;  1LB2 B;  4QW8 A;  2PFP A;  4TUR A;  4X4U A;  3TAR A;  5D4B A;  2VA2 A;  5L9X A;  3MAB A;  2W9C A;  7ICT A;  5DQI A;  4YN4 A;  4Q8F A;  1UEU A;  2ZH3 A;  4TUS A;  3RB4 A;  1B43 A;  3PW2 A;  1NKE A;  2J6U A;  4JWN A;  8ICA A;  4X4Q A;  4Q45 A;  4WBY A;  3JPP A;  2DR8 A;  3H38 A;  1NK8 A;  5IIL A;  1JMS A;  2ZUD A;  4F93 B;  1ZQT A;  1R8B A;  1NJX A;  4MEX A;  8ICJ A;  1KRP A;  4QWB A;  1FA0 A;  1A76 A;  1TAQ A;  2AQ0 A;  2HHX A;  3UPQ A;  2M9N A;  4PPX A;  4M2Y A;  5J0U A;  1JIH A;  2ASJ A;  4ED3 A;  1MQ2 A;  1KLN A;  9ICQ A;  1DK2 A;  4JV1 A;  5CJ7 A;  4YR3 A;  2J6T A;  5HHI A;  9ICF A;  3IM1 A;  3PR4 A;  2UVW A;  4LVS A;  7ICJ A;  2BPC A;  5KFZ A;  4DF8 A;  4UB4 A;  4X4V A;  2UVR A;  5DB7 A;  3OV7 A;  1BPE A;  4F4K A;  4X4S A;  4DF4 A;  1ZQW A;  5CWR A;  3T5H A;  2KZ3 A;  2R8K A;  7ICQ A;  4DSJ A;  2UVV A;  5CB1 A;  4RNM A;  1N48 A;  4FH5 A;  4RWO A;  5HRD A;  4I27 A;  2C2R A;  5IIJ A;  3C66 A;  5HRG A;  2HHS A;  3RH4 A;  3Q8P B;  4B9M A;  4C8K A;  3RTV A;  3OJU A;  5KFE A;  2IBK A;  1NZP A;  4I2E A;  2DR9 A;  1JN3 A;  3C1Z A;  4PHD A;  2XO7 A;  3EPG A;  4P2H A;  2KZM A;  1U4B A;  4UB3 A;  5KG0 A;  4DOA A;  1ZET A;  4KLL A;  2BE3 A;  1R89 A;  3RRH A;  2I1Q A;  2XGP A;  1L5U A;  3AQM A;  4QZC A;  7ICM A;  3GII A;  2ZH1 A;  1NJZ A;  2PFQ A;  3MGH A;  3IHQ B;  5HRH A;  1BPD A;  3C5F A;  4PGY A;  3UQ2 A;  4FO6 A;  4E80 A;  2BHN A;  4ELT A;  3HJ4 A;  5DQH A;  3KHG A;  3QEA Z;  2BCQ A;  4KLQ A;  1ZQO A;  4DLE A;  4EEY A;  4KLS A;  2WTF A;  1ZQF A;  3UXN A;  2H5X A;  5BOL A;  4YD2 A;  4J9P A;  3SV3 A;  5KT5 A;  2Y1I A;  1L3V A;  2FMP A;  1S0V A;  4AT8 A;  3LDA A;  3G6Y A;  3V6J A;  2JZB B;  2BPF A;  2M2U A;  3AQL A;  2A1J A;  2NRZ A;  4Z6F A;  4DFJ A;  1XSL A;  3B0Y A;  4F92 B;  4RQ5 A;  4RQ6 A;  4ED8 A;  1L3U A;  2IMW P;  2M2T A;  4Z6D A;  4DQP A;  4WBZ A;  4O3Q A;  4QWC A;  3OHA A;  5J2D A;  2GWS A;  4J9N A;  3N4M B;  1NK0 A;  1BVS A;  1TAU A;  3MR3 A;  5DED A;  4ED0 A;  5KFQ A;  2W9B A;  5KT6 A;  5F9L A;  3C2K A;  3PVX A;  3MGI A;  4F5R A;  1KFS A;  1JXE A;  4WCW A;  4RQ8 A;  3H40 A;  4YMM A;  4UB2 A;  4ECT A;  4I2C A;  5KFY A;  3TAQ A;  4AT9 A;  3WFQ E;  3B0X A;  5DGB A;  4F5P A;  2BPG A;  3PO4 A;  4B9V A;  4NM2 A;  4O3O A;  8ICY A;  3RB0 A;  1S97 A;  7ICU A;  3JZ0 A;  2V9W A;  2M2W A;  4RNN A;  4GXI A;  3E2E A;  3RJE A;  4KLO A;  8ICK A;  2DRA A;  1MC8 A;  4RQ0 A;  3HW8 A;  3RJI A;  2ASL A;  4JUZ A;  4I2A A;  3ETL A;  3T5K A;  5BPC A;  4BGD A;  3WFS C;  3PNC A;  4DLG A;  4FHP A;  5DKW A;  5D46 A;  1OU5 A;  5III A;  5KT4 A;  2ZHA A;  1KDH A;  3OUY B;  4JV2 A;  5KTQ A;  3BJY A;  1LV5 A;  5KFR A;  4DS4 A;  4KLD A;  5J2B A;  5KFF A;  5L1J A;  3ZD9 A;  2W9A A;  1DOQ A;  4M9G A;  1NO5 A;  4UD5 A;  4AT7 A;  2ZTD A;  3C21 A;  4Q43 A;  1NJW A;  4FHX A;  5IIK A;  1D8L A;  3RAQ A;  1ZQC A;  4KLJ A;  2HHU A;  2C2D A;  4LZD A;  4ELV A;  2AJQ A;  3PV8 A;  4QZD A;  4I2I A;  4IRD A;  2W9C B;  4QZH A;  4I2H A;  3PW5 A;  4RWQ A;  4R65 A;  4QWE A;  4YD1 A;  3BQ2 A;  1HUZ A;  2OWO A;  2NRX A;  2AGQ A;  2IHM A;  4E7X A;  5C5J A;  3T3F A;  1IXR A;  4Z6C A;  3PMN A;  4F50 A;  4DSL A;  4C8L A;  4RQ7 A;  3OSN A;  1SL2 A;  1BPB A;  5HRF A;  2BKE A;  8ICO A;  4BXO B;  3JPS A;  3FYH A;  4ECU A;  3ISC A;  3TAP A;  3RJH A;  4DSI A;  5J2F A;  3HT3 A;  4WC0 A;  3ORY A;  4QZG A;  2ZHB A;  4F4W A;  4KLM A;  2HHP A;  3OUY A;  3V6K A;  3NTU A;  4DS5 A;  5KFA A;  5KT3 A;  3Q8L A;  1ZQL A;  3JPN A;  3V7K A;  1K1Q A;  4GLX A;  1SKR A;  1ZQM A;  5CP2 A;  1T7P A;  4IQV A;  4B9L A;  2ZUB A;  1XS9 D;  1ZQZ A;  4J9M A;  4X4N A;  4RWP A;  4Q8E A;  2ZH9 A;  5L1L A;  1XWL A;  4F5O A;  1KTQ A;  4G3I A;  4DFP A;  4YP3 A;  1NK4 A;  4DL3 A;  4IQU A;  4UAY A;  5KFO A;  4XUS A;  3HWT A;  4XA5 A;  3H4B A;  2BCU A;  1CEZ A;  5HRI A;  5J0X A;  4LT6 A;  2Q66 A;  4NLK A;  1F5A A;  5KFN A;  4RUA A;  4TQR A;  3M9M B;  4ECX A;  8ICP A;  1D8Y A;  2ZTE A;  1U9L A;  3GDX A;  3V7J A;  1RYR A;  3H7I A;  4FS1 A;  5DLF A;  2XY6 A;  1TVA A;  1ZQB A;  8ICS A;  1NK5 A;  1RXV A;  1NJY A;  4EYI B;  5J2K A;  4LZG A;  4BXO A;  4IRC A;  4IG8 A;  2ID1 A;  9ICI A;  5KFL A;  2KFN A;  2ZH6 A;  5HML A;  4ECQ A;  5HNK A;  5DB6 A;  4KMU A;  3RJF A;  2HHW A;  4TUQ A;  3RB6 A;  4KIT B;  2AGP A;  4FHW A;  4J9K A;  3RBE A;  1V9P A;  4RPY A;  1UA1 A;  1R8A A;  1MQ3 A;  4M9L A;  9ICA A;  2W8L A;  2PBE A;  4AT8 B;  5HHH A;  3LWL A;  4ELU A;  2W9M A;  4WC3 A;  1NK7 A;  5EWE A;  3QZ8 A;  1ZQY A;  7ICN A;  2A1J B;  1PZN A;  4BWM A;  5KG3 A;  4UBC A;  4ED6 A;  4DL7 A;  3JPT A;  3JPR A;  2KFZ A;  4WC5 A;  1NOM A;  5DG7 A;  4O5C A;  1SZP A;  2BCV A;  3TFR A;  4XQ8 A;  1RXW A;  4X4R A;  5KG7 A;  3AUO A;  1N56 A;  2W9B B;  3ISB A;  2KN7 A;  4JV0 A;  5KFS A;  2R8H A;  4F4Z A;  2KTQ A;  4DEZ A;  1S10 A;  3C2L A;  1JX4 A;  4AT9 B;  3H8W A;  4ED7 A;  2BCR A;  4E0D A;  1BPY A;  4FBT A;  1KFT A;  4IRK A;  4QZE A;  4DL4 A;  1SKW A;  3K4G A;  5CA7 A;  3N97 B;  4RQ2 A;  5J0S A;  3PO5 A;  5KFK A;  3ZD8 A;  2VA8 A;  1SL0 A;  4K4H A;  4GXK A;  1C7Y A;  1RPL A;  4PHE A;  1SL1 A;  1U49 A;  3ISD A;  1RYS A;  4UAZ A;  9ICX A;  2O1P A;  4IR1 A;  5IIN A;  3RH5 A;  9ICL A;  4EBE A;  4QW9 A;  2JEG A;  4UD4 A;  4MFF A;  3RB3 A;  2NRK A;  4M9J A;  1Z3E B;  5KG6 A;  4P4P A;  4B9N A;  4C8N A;  1ZJN A;  3M8S A;  2ALZ A;  3GQC A;  9ICR A;  1SKS A;  4YR0 A;  4KLI A;  1ZQP A;  1WOT A;  4WC1 A;  9ICM A;  2Y1J A;  3M9O B;  4M6W B;  1PX5 A;  4MF8 A;  4J9R A;  1BNP A;  4ECZ A;  5EOZ A;  4PH5 A;  5DBB A;  3M8R A;  4BWJ A;  3C5G A;  1QSS A;  5KFP A;  4AT7 B;  2NRW A;  4YVZ A;  4PHP A;  2V4Q A;  4KTQ A;  4IQT A;  1V4A A;  4DFM A;  4QZI A;  1KFD A;  7ICO A;  1X9S A;  1TK0 A;  3BDP A;  4DL6 A;  5J0R A;  1ZQJ A;  4X0B A;  5DBC A;  7ICL A;  2DR5 A;  5BOM A;  4JK1 A;  2HHQ A;  1JAJ A;  2NRT A;  4YCX A;  3UXP A;  8ICW A;  3QE9 Y;  5KG2 A;  3RJK A;  5HRL A;  4XRH A;  5J0W A;  3Q8R B;  1KNY A;  4EBJ A;  1X9M A;  1DK3 A;  3T5L A;  4KLG A;  3AQN A;  5KG4 A;  3MR6 A;  2LYH A;  4EYH B;  1T4G A;  5DB9 A;  2XCA A;  2F1H A;  8ICX A;  4KLE A;  2KP7 A;  4X4O A;  1KSP A;  1TK8 A;  3T5J A;  4UAW A;  3OHB A;  3RR7 A;  3PX6 A;  1QLN A;  4NXZ A;  3LWM A;  3AQK A;  4KN4 A;  3WFP A;  4M6W A;  1S77 D;  5J2I A;  2HHT A;  2PXI A;  5EWG A;  2DVI A;  5CHG A;  4YXJ A;  4DL5 A;  2ZH4 A;  4I2F A;  2ZH8 A;  4YMN A;  5KFU A;  7ICE A;  8ICL A;  2C22 A;  1TFY A;  5DDY A;  3RJJ A;  4RQ1 A;  9ICG A;  1A77 A;  1DGS A;  1EXN A;  1S0N A;  3FDS A;  3HJ1 A;  9ICT A;  3PX0 A;  2DR7 A;  2W8K A;  4DO9 A;  3H8S A;  4I2G A;  4O9M A;  2BR0 A;  3M9N B;  5L1I A;  4ED1 A;  3EPI A;  2XY7 A;  4F5N A;  2DPI A;  4RUC A;  2BQU A;  5KFX A;  4I2B A;  9ICB A;  3H8J A;  5DG8 A;  1NKB A;  1COO A;  4TQS A;  1BPX A;  2C28 A;  4R8U A;  3UXO A;  2ISO A;  1Z00 A;  3QZ7 A;  5J2G A;  9ICE A;  1TFW A;  5KFW A;  2DFL A;  2ZJA A;  5KFJ A;  9ICJ A;  4QZ9 A;  2M2V A;  2HW3 A;  4PGQ A;  1KEJ A;  7ICH A;  3EYZ A;  3H4D A;  1HUO A;  4DOC A;  9ICS A;  7ICP A;  3THV A;  9ICP A;  4MF2 A;  8ICN A;  3GFK B;  4QWD A;  3OSP A;  4QWA A;  4DSK A;  4F2R A;  4O3S A;  7ICR A;  4QZA A;  1YLQ A;  3Q8K A;  2FLP A;  2Q0Z X;  4X0A A;  4ED2 A;  5L1K A;  4KLH A;  4UBB A;  3MDA A;  4ECW A;  4O5K A;  4YFK A;  4K4G A;  3SV4 A;  3TFS A;  1ZJM A;  2XCP A;  2FMS A;  5KG1 A;  8ICE A;  1B22 A;  4QZF A;  4Q44 A;  2PI4 A;  2HVH A;  4J9Q A;  5KFG A;  2RDI A;  1H38 A;  2UVU A;  3EWA A;  1S9F A;  2F1J A;  2O5A A;  1Q78 A;  4NY8 A;  3AU2 A;  5J0P A;  3Q8Q B;  1X2I A;  1U47 A;  1QTM A;  3LK9 A;  2B21 A;  5J2C A;  9ICH A;  2FPM A;  2J6S A;  4MFA A;  2KZZ A;  2RFF A;  3V7L A;  2ZTC A;  4J9L A;  4HYK A;  8ICB A;  2P6U A;  2ZJ5 A;  3K75 D;  5J0T A;  1K1S A;  4Z6E A;  5HP4 A;  1BNO A;  1VJ7 A;  3OVA A;  5J2J A;  1ARO P;  1RZT A;  5KFC A;  4GXJ A;  4YMO A;  3HP6 A;  3WFO A;  4FS2 A;  4I29 A;  1Q79 A;  3ZDE A;  4DFK A;  2DRB A;  2BGW A;  1ZQI A;  3PW4 A;  4RU9 A;  1ZQU A;  5DEC A;  1MSW D;  4DSE A;  2BQ3 A;  4ECR A;  5F9N A;  3PML A;  1ZQH A;  4NKU A;  2MUT A;  4O3P A;  7ICG A;  4WC7 A;  2IHN A;  9ICW A;  3RJG A;  2AU0 A;  3BQ0 A;  4KLF A;  1UEV A;  1QSL A;  3UQ0 A;  2ZJ8 A;  2P6R A;  4DOB A;  1U48 A;  1UET A;  3GV5 B;  2BDP A;  4MEY A;  5D49 A;  4F3O A;  4DQR A;  8ICV A;  8ICZ A;  1T8E A;  4FHV A;  3EW9 A;  4I28 A;  3HPO A;  3GV8 B;  1NK9 A;  4NKT A;  4F8R A;  2I9G A;  4X4T A;  4M9N A;  4F4X A;  5KFM A;  5DGA A;  5DDM A;  4RQ3 A;  1ZQX A;  4XQ7 A;  1TV9 A;  2NRV A;  4CCH A;  1CUK A;  4MFC A;  4WC4 A;  9ICK A;  5KFH A;  4YXM A;  5F2V O;  4NLN A;  1UT8 A;  1ZQV A;  2ZUC A;  3JPQ A;  3HX0 A;  3V72 A;  2C2E A;  8ICQ A;  1X9W A;  4ECY A;  3H39 A;  4DQS A;  5HR9 A;  5DB8 A;  2ATL A;  3C23 A;  4P4O A;  3NYB A;  2FLL A;  1XSP A;  7ICS A;  4F4Y A;  4C8M A;  4R63 A;  2HHV A;  3JPO A;  3GIL A;  3KHR A;  1UA0 A;  4F91 B;  2R8G A;  3KTQ A;  1ZYQ A;  8ICG A;  3SI8 A;  1ZQN A;  2XGQ A;  2V4R A;  1MIY A;  9ICU A;  2IA6 A;  5DBA A;  3G6X A;  4UQG A;  1S0O A;  3SYZ A;  4ZH4 A;  5KT2 A;  3GIJ A;  2VA3 A;  4M0A A;  5TZV A;  2BQR A;  3MDC A;  4QZB A;  1ZQE A;  9ICV A;  3GIK A;  1ZQQ A;  4M5D A;  1NKC A;  4TUP A;  4RPZ A;  4EZ6 A;  4E8F A;  4K4I A;  4DQI A;  5KT7 A;  4YG2 A;  4PHA A;  3AU6 A;  2FPK A;  4JWM A;  4B9T A;  2JEJ A;  8ICH A;  4KN7 A;  3MFI A;  5EWF A;  3RAX A;  3C2M A;  3NGD A;  3ZDA A;  3EZ5 A;  5J29 A;  3KHH A;  2PFN A;  1TKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...