5J0RA

Binary complex crystal structure of dna polymerase beta with c:a mismatch at the primer terminus
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0rA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0rA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0rA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0rA03
5F9LA 3BQ2A 2Q66A 4IQVA 4RQ4A 1NKEA 3GQCA 3HT3A 1ZQSA 2R8IA 4UB3A 1ZQNA 1ZQRA 9ICHA 1JQRA 4K4GA 4F2SA 2FLPA 2BDPA 1ZQTA 3UPSA 2V9WA 2H5XA 4RWQA 1R8BA 3JPNA 1Q78A 3QEBZ 4E80A 4B9TA 4WC2A 4DOAA 3C2KA 3GV7B 4ED7A 1L3UA 9ICMA 4UD5A 4XQ7A 5F9NA 4BDPA 4Z6DA 2I9GA 3RRHA 1S0MA 4X4NA 3JPRA 4FHWA 2ZTEA 9ICTA 4AT9B 4XRHA 3SZ2A 4I2GA 4UB5A 1KFSA 4UB1A 5KFMA 4EYIB 4ED1A 1IXRA 1ZQAA 4DSIA 8ICNA 1KNYA 5KG0A 3M9OB 2ZH7A 4F4XA 2PFOA 4IRCA 5HMLA 4LVSA 2DR8A 5KFLA 4RWNA 5L1LA 3PO5A 2AQ4A 1MQ2A 3Q8PB 3GV8B 2FPMA 3THVA 5KFVA 4KLFA 4NM2A 4MF8A 3RJFA 2A1JA 7ICNA 3T3FA 9ICRA 4Q8FA 4RQ3A 4QWCA 1KRPA 1BNOA 1VJ7A 4YD2A 3K75D 4WBZA 4AT9A 9ICJA 1L3SA 5CJ7A 2ASJA 1AROP 1HJPA 3K4GA 2BGWA 4GXIA 2IHMA 3GILA 2JEGA 4PGXA 3AQMA 4JV2A 1IM4A 5KG6A 1KFTA 1BPBA 2ATLA 4F4WA 2ISPA 3LDAA 2BE3A 9ICEA 2KTQA 4BWJA 3GFKB 4F2RA 3RB4A 8ICEA 3C23A 1TAUA 1T3NA 9ICBA 1V4AA 3JPSA 1ZJMA 3T5JA 1RYRA 3JYYA 1OU5A 5KFBA 4RPXA 2ZJ5A 1SKRA 3M8SA 1MSWD 4FHYA 5EOZA 4EBDA 4NLGA 3GIMA 2Y1JA 4DSKA 4YMOA 3OHAA 3QEAZ 4KLLA 8ICWA 5DB6A 4PHDA 4NLKA 2HHWA 3V7JA 5L1IA 4Q43A 8ICVA 4BWMA 3QZ7A 2PBEA 4RQ1A 3ZDAA 1U45A 9ICCA 4R65A 2KZ3A 3LWMA 5HRBA 5J2BA 4KLIA 5HRGA 2B21A 2DR7A 2HW3A 4BXOB 2ZH1A 4KLDA 4QZAA 4ECRA 2V4RA 5KT2A 5CA7A 4DSEA 4DLEA 1NZPA 3LQCB 5J0OA 4QZIA 2C2RA 4ED3A 4JV1A 1LV5A 3WFRE 1XU4A 3MR2A 3UQ0A 1SKWA 1ZQCA 2PFQA 5HP4A 3RJEA 5J2DA 3T5LA 1ZQQA 5J0WA 4RT3A 1WCNA 5CR0A 3MGIA 4GLXA 7ICKA 7ICVA 1S77D 4JK1A 2ALZA 2R8GA 3C5GA 1ZQOA 4K4IA 2DRAA 4NKUA 2MUTA 3MDCA 3SYZA 4I2AA 5KG1A 3PO4A 2NRVA 5DB7A 2PXIA 4BXOA 4C8LA 1B22A 1EXNA 4ECYA 1S0NA 8ICMA 1TK8A 1SL0A 7ICPA 4ELUA 4ED0A 2BQRA 5KT5A 3HWTA 1QSSA 2GWSA 9ICAA 4DSFA 8ICTA 2XO7A 2M2TA 5KG4A 4FHVA 1DOQA 4YR0A 1MIVA 1R89A 5HHIA 2I1QA 4QZBA 1NK5A 1ZQJA 7ICOA 4M04A 2M2UA 2VA2A 3KTQA 2BPFA 4RUAA 4F8RA 1JXLA 1JIHA 1TFYA 1TK0A 1RYSA 4ECUA 2IBKA 7ICGA 4IR1A 4F5QA 5DG8A 3GIKA 4RU9A 1KDHA 3M8RA 4F50A 3RJGA 5C5JA 4MFCA 1ZQZA 5DLFA 2AGPA 3ISDA 1XC9A 7ICSA 9ICGA 5KFKA 3TFRA 4KLQA 4YD1A 4DL2A 1NK9A 2XCPA 4FS2A 9ICOA 5F2VO 2P66A 5KG2A 4MEXA 4KTQA 1F5AA 4YVZA 4XQ8A 4PPXA 3RH5A 2M9NA 4GC6A 4B9SA 4MFFA 1UT5A 5KFOA 3V72A 3AU2A 4WC1A 3H8JA 1ZYQA 4YCXA 4QZ8A 1NK7A 3KHHA 5KFDA 2J6TA 4B9UA 4ELTA 1ZQPA 3JPOA 3ZDBA 3NYBA 4AT7B 4J9KA 3RB6A 4KLTA 4QWBA 1NJYA 3IM1A 2F1HA 5J2CA 7ICEA 3SV3A 3MGHA 1X9SA 1L3VA 1ZJNA 2BCUA 5IIKA 8ICHA 4S3NA 4F4YA 2UVUA 1BPYA 5KFRA 4RNOA 3H37A 2DVIA 4I2JA 1ZQXA 2XGPA 8ICYA 4FHXA 8ICFA 4F91B 2XY7A 5KFJA 4GXKA 2IMWP 1Y88A 1ZQGA 4RWOA 4J9QA 4NXZA 1NK8A 2RFFA 3WFQE 3HPOA 3H40A 2ZH2A 1ZQYA 9ICFA 4EBCA 3RBDA 7ICIA 5KFHA 4M9JA 5DQHA 3HW8A 2DR5A 4AT7A 1U47A 1TV9A 1BPZA 5TZVA 1KTQA 2PI5A 5J29A 2ZJ8A 4RQ5A 4KMUA 1UA1A 5J0YA 4TUQA 4ECVA 2C2EA 2JEFA 4M9GA 5KFXA 4M9HA 3PX4A 1Q79A 1ZQIA 4Z6FA 5KFTA 2HHXA 1K1SA 8ICJA 3MDAA 1NJXA 3RJKA 4ZH4A 1NK0A 3L9DA 3TANA 2P6RA 4X4SA 1VFGA 4RT2A 3SI8A 4WC0A 5IIJA 4EYHB 2FPKA 2JEJA 3Q8RB 5J2EA 3PY8A 1NJWA 2ZJAA 1H38A 5IIMA 1PX5A 5KFZA 2DR9A 4PHAA 4M9NA 9ICQA 3RR8A 5HMMA 4YXJA 5KTQA 4PGQA 2BQ3A 3RH4A 3ZDCA 2NRXA 4QWEA 8ICBA 2BHNA 5J0UA 3C2MA 2W8LA 3T5KA 4TUSA 3PX6A 2J6UA 3H38A 4X4QA 9ICPA 2W9AA 5HRIA 3HIYA 4B9LA 3V6JA 2NRKA 5DKWA 5KFYA 1BGXT 4EP7A 2R8KA 1JMSA 3PR5B 4F5NA 1WOTA 4KN7A 5IIOA 4ELVA 4YG2A 3RJHA 5KG7A 2ZUCA 1NOMA 4O3OA 2KN7A 3MR6A 4X0BA 3AQNA 1U49A 4YXMA 4EBJA 4I2DA 3IHQB 4FHPA 4F5OA 3FDSA 8ICRA 3WFSC 1JX4A 5DBBA 4ECXA 4WC4A 2Q0ZX 4YFKA 3Q8MA 1KLNA 4DQPA 5J0RA 4DEZA 4GXJA 2Y1IA 2M2VA 4DL3A 4FH5A 5KT7A 4MF2A 3GIIA 3V6KA 4JWMA 3JPQA 4J9OA 4IQTA 4IRDA 1MIWA 4ED2A 1UA0A 4I2BA 8ICIA 3H8WA 5HREA 5DDYA 9ICIA 4O9MA 3OUYB 3PMLA 1KEJA 5KFPA 5HRKA 3M9NB 1TAQA 1QSYA 3C2LA 1YLQA 4LZDA 1RZTA 8ICKA 3UXPA 3PV8A 2BPCA 4DWIA 4PHPA 5D46A 1ZETA 4XUSA 2O1PA 4F3OA 2PI4A 1NK4A 4TQRA 5J2IA 2F1IA 4LZGA 2IHNA 1R8AA 4J9NA 4Z6EA 2BR0A 3N4MB 3ZDEA 1NKBA 4DSJA 5CWRA 1Z00B 4I28A 2BPGA 3OJUA 1QLNA 9ICUA 4YQWA 3GIJA 4J9SA 3BJYA 4DFJA 5KFSA 5IILA 1X9MA 2BCSA 3OUYA 9ICSA 4R8UB 3C1YA 5J2JA 2KFZA 2LYHA 4IQUA 5IIIA 3H4BA 9ICLA 3G6XA 4DL5A 1S97A 4EZ6A 4J9LA 5EWFA 2UVVA 4G3IA 4DF8A 3PVXA 1ZQDA 1PZNA 3PNCA 5KT4A 5HNKA 7ICJA 3AQLA 3HJ1A 4I29A 9ICKA 3C5FA 1LB2B 4I2IA 4FBUA 5KFQA 3G6YA 1L5UA 2AJQA 2RDIA 5J2FA 2UVRA 4M2YA 2KZMA 1RPLA 1JN3A 3RB3A 8ICPA 1Z00A 2DRBA 7ICQA 1NKCA 5J0TA 4B9VA 2ASLA 4K4HA 7ICLA 3ISBA 1N56A 2VANA 4KLMA 8ICSA 3UPQA 4DFMA 5KFFA 4R8UA 3RJIA 2ASDA 5DB8A 1UEUA 3T5HA 1ZQKA 2FMPA 2FLLA 2HHSA 4O3SA 2UVWA 3AQKA 3V7KA 3PW7A 2NRZA 3UXOA 4EBEA 3C1ZA 5DG7A 2PFPA 4O3RA 1UT8A 4RQ2A 5KFUA 4NLZA 4O3QA 3MBYA 8ICUA 1MC8A 3LWLA 1BVSA 3EWAA 4RQ8A 3EPGA 1S9FA 4O0IA 5D49A 2W8KA 3H4DA 4DL4A 3TAPA 1QSLA 4IQWA 4X4VA 5KG3A 2AU0A 2HHQA 4FH3A 1T8EA 1NO5A 4DO9A 3V7LA 2PFNA 4WC7A 2C22A 5HR9A 4UD4A 4X4OA 3WFPA 4RQ0A 5DQGA 4M47A 1B43A 5DDMA 4DSLA 5KFCA 3RH6A 1ZQFA 7ICTA 2NRTA 8ICXA 3PR4A 5HRHA 2KP7A 5CHGA 2HVIA 1A77A 5DQIA 4QZHA 4ATBB 2NRWA 4RQ7A 5L1KA 3MABA 5D4BA 4I2FA 3RR7A 2XY5A 3PX0A 4AT8B 4QZCA 4UBBA 1COOA 3BQ0A 4FBTA 4DS4A 1S76D 4O3NA 3OJSA 2R8HA 5DBAA 3C21A 3OGUA 4KLHA 9ICXA 2BKEA 4P4MA 4DS5A 3TFSA 4EEYA 1RXVA 4E0DA 5J0PA 1BPEA 1KSPA 2AQ0A 4QZDA 3RRGA 1A76A 1NJZA 4WC6A 8ICLA 2BCVA 2DFLA 4TQSA 5KFIA 4P2HA 1BNPA 4MEYA 2VA8A 1DK3A 4NLNA 4DFPA 4BGDA 4KLEA 1X9WA 3HX0A 1JAJA 4DQSA 4IR9A 4I2HA 3C66A 4F5PA 2C2DA 1JXEA 4Q44A 4KLGA 1R8CA 2JEIA 3GDXA 4YR3A 5CP2A 5J2KA 2WTFA 3M9MB 4CCHA 2ID1A 3RAXA 4RZRA 1KFDA 4QW9A 4F93B 4DQRA 5HRDA 3OVBA 1XSNA 4DF4A 4M6WB 4O5EA 3WFOA 4X4UA 4B9MA 9ICVA 4PH5A 1Z3EB 5DG9A 5KT6A 1XSLA 1ZQHA 2BCRA 4X4TA 4QZGA 4DL7A 4ECTA 2FPLA 1S10A 5L9XA 4JWNA 4DLGA 1WCLA 4LT6A 2IA6A 2A1JB 3ISCA 3RB0A 2ZTCA 4C8NA 3EYZA 2BQUA 3MR5A 2FLNA 8ICQA 4NM1A 2ZH3A 3JZ0A 4J9RA 2ZH6A 2ZH4A 2P6UA 4YMMA 1U48A 4NKTA 4KN4A 1DK2A 4M6WA 4UBCA 1UETA 3OVAA 1ZQWA 4F4ZA 4QZFA 1ZQLA 5KFNA 3H3AA 3EW9A 1V9PA 4UAWA 3Q8LA 1XO1A 1ZQBA 5HRFA 4NY8A 4RPYA 3HP6A 2W9BB 4M0AA 3JPPA 3PW0A 2ZH5A 4I27A 2ZH9A 4QZEA 4QWDA 1MQ3A 8ICZA 3PW2A 3GV5B 3RTVA 4PHEA 3H8SA 4RNNA 4ECZA 1XSPA 5KG5A 4QW8A 3BQTA 1TKDA 4O5CA 2AGQA 2C28A 2R8JA 4KLUA 9ICNA 1FA0A 4P4OA 5J2HA 4UB4A 3OSNA 3KHRA 2W9BA 4TURA 2J6SA 3QZ8A 5BOLA 4DOCA 3Q8SB 1TK5A 2OWOA 2W9MA 3H7IA 1ZQVA 4JV0A 5DB9A 4KLJA 3OVSA 3ETLA 4F5RA 7ICHA 3NGDA 4O3PA 3MR3A 4E7XA 3C18A 3MFIA 5DGAA 1S0VA 4WCWA 4E8FA 2F1JA 3EPIA 2V4QA 2HVHA 5HC9A 1ZQUA 2KFNA 7ICFA 4QZ9A 2ZH8A 7ICRA 1X2IA 2RDJA 3UQ2A 2FMQA 2HHVA 4R64A 4MFAA 1NK6A 3BQ1A 4YMNA 4C8MA 1MIYA 3TAQA 4RNMA 2MUTB 3BDPA 1D9DA 1QTMA 2O5AA 4RWPA 4I2EA 4JUZA 4J9PA 1D8YA 2ISOA 5J2GA 3G6VA 4ED6A 4ED8A 5JUMA 4F92B 5BOMA 4J9MA 4ECQA 1N48A 7ICMA 4R66A 2XGQA 4ECSA 3TI0A 1C7YA 4UAZA 1XS9D 1CUKA 1U4BA 2DPJA 4M5DA 4YP3A 1T7PA 1XWLA 4O5KA 3B0XA 3E2EA 5DECA 2ZHAA 3PMNA 1SKSA 1SL2A 2ZTDA 3AUOA 3PW4A 4FO6A 4RQ6A 5HHHA 4DQQA 2VA3A 3RAQA 2JZBB 5J2AA 3NTUA 4FS1A 1TFWA 1SZPA 4Z6CA 4EZ9A 4RPZA 2ZUBA 2XC9A 2XY6A 5IINA 1L3TA 4KLSA 5KFWA 3OSPA 1S0OA 2MAXA 2DPIA 4GC7A 8ICGA 4P4PA 3ZD9A 5L1JA 3Q8KA 1TVAA 5KFGA 2ZHBA 1BPXA 4UAYA 3JPTA 8ICCA 4X0AA 5J0QA 3KHGA 4UB2A 4UQGA 4DOBA 1HUOA 9ICWA 2M2WA 1BPDA 4TUPA 2KZZA 4QWAA 1ZQEA 5KFAA 3OHBA 4KITB 4DL6A 1RXWA 3ZD8A 3ZDDA 2W9CB 3H39A 3MFHA 4IG8A 3EZ5A 4PGYA 2JZBA 1K1QA 5KT3A 5BPCA 4YN4A 2HHPA 4I2CA 1CEZA 4DQIA 3N97B 4DFKA 1HUZA 4WC3A 4F4KA 4IRKA 2HHUA 2BCQA 1UEVA 4YR2A 4R63A 3V6HA 8ICAA 4ECWA 2HHTA 3ORYA 2XCAA 3RBEA 5EWEA 3B0YA 8ICOA 5DEDA 1D8LA 4Q45A 3KHLA 1T4GA 1D9FA 4C8OA 3HJ4A 1ZQMA 4HYKA 3QE9Y 3AU6A 2W9CA 5HRLA 5KFEA 4X4RA 2AGOA 4RUCA 7ICUA 4C8KA 5EWGA 1TFRA 4X4PA 4M9LA 1SL1A 4ATBA 3PW5A 4B9NA 4WBYA 5DGBA 2FMSA 4KLOA 5DBCA 4X5VA 4EBKA 1U9LA 3RJJA 4AT8A 3OV7A 3TARA 3UXNA 3TQ1A 3Q8QB 3FYHA 5J0XA 3SV4A 4WC5A 4Q8EA 1DGSA 3LK9A 5CB1A 5DLGA 5J0SA 2ZUDA 4XA5A
chains in the Genus database with same CATH superfamily
5F9LA 4RQ4A 1ZQSA 1ZQNA 9ICHA 1ZQTA 3UPSA 5AKLA 1L8OA 3QEBZ 4DOAA 2I9GA 1S0MA 2ZIUA 4EYIB 5KFMA 4ED1A 8ICNA 5KG0A 2P35A 4LVSA 2F77X 3PO5A 1JUDA 2ZG6A 2AQ4A 1MQ2A 4K99A 2FPMA 3UMCA 5KFVA 4KLFA 3E58A 2A1JA 4LEZA 4YD2A 4CF3A 9ICJA 2WF7A 5CJ7A 5AKKA 2H3VA 3K4GA 5D62A 4GXIA 2IHMA 3F2DA 1BPBA 2ISPA 4F4WA 2Q4TA 4UATA 2KTQA 4BWJA 3GFKB 2YQEA 1T3NA 9ICBA 1V4AA 3JPSA 1OU5A 3M8SA 1MSWD 2Y1JA 2W3RA 5CHEA 2F3NA 8ICVA 3QZ7A 3ZDAA 5J2BA 5HRGA 4ECRA 2YMQA 5KT2A 4WQLA 1NZPA 5J0OA 3SAFA 3WFRE 3MR2A 3UQ0A 2PFQA 1KKXA 2GAFD 4RT3A 4GLXA 1S77D 2XIDA 4Y2TA 3NRZA 5DB7A 4C8LA 1S8OA 1M6YA 3KD3A 1EXNA 8ICMA 5AK6A 1ZOLA 4CNQA 1SL0A 2OEHA 2EAPA 4K8VA 4DCCA 1UHUA 5ALVA 1R89A 3U26A 5ALSA 2BPFA 1TK0A 5DG8A 3C29A 1KDHA 4FZMA 4MFCA 2D6FC 9ICGA 5KFKA 4KLQA 2XVTA 1NK9A 2XCPA 3UMBA 4KTQA 3NVOA 4GC6A 4B9SA 3AU2A 2KK0A 1ZYQA 4B9UA 1NK7A 3KHHA 3NYBA 4AT7B 4LJXA 4KLTA 7ICEA 2KHQA 4K98A 4S3NA 5KFRA 2DVIA 1JROA 3F5EA 1Y88A 2RFFA 3H40A 9ICFA 2DR5A 1BPZA 3QU5A 5J29A 5ALNA 4Y2JA 2G08A 3QU9A 4ECVA 2DGZA 1RQNA 2C2EA 2JEFA 1F0MA 2MU2A 2Y9TA 3PX4A 2KKPA 1ZQIA 1K1SA 5AM2A 3SQIA 4FFDA 1NK0A 3TANA 4RT2A 2NYVA 4WC0A 5J2EA 2EQYA 2DR9A 4FZLA 5AM3A 9ICQA 3RF9A 5HMMA 2Y0SC 3CNHA 4QWEA 2W3SA 2J6UA 2DL0A 2B56A 1IG6A 3I28A 4B9LA 2NRKA 5DKWA 5KFYA 4EP7A 4F5NA 2OH2A 4KN7A 5IIOA 1ZD3A 5KG7A 2KN7A 3WK9A 5KNIA 4I2DA 5DBBA 4DQPA 5J0RA 4DEZA 2Y1IA 3L5KA 4CF5A 2Y0SF 3V6KA 4JWMA 4IRDA 4ED2A 2HSZA 3H8WA 5HREA 3OUYB 2ZIVA 1SXDA 5AI8A 3M9NB 1TAQA 4LZDA 4CE6A 4F3OA 1UCVA 4J9NA 2BR0A 4I28A 2BPGA 3OJUA 4J9SA 5KFSA 5IILA 4BUGA 3OTQA 9ICSA 2KFZA 4IQUA 5IIIA 4DL5A 2VKQA 5EWFA 8ICTA 4QIWC 1ZQDA 2K4EA 3M6ZA 5HNKA 3HRDD 4I29A 5J2FA 4IC9A 1RPLA 2GO7A 3SD7A 5J0TA 2KD1A 3ISBA 2VANA 4DFMA 3RJIA 4OO1J 2D8CA 3T5HA 2HOFA 2FMPA 4IL6U 3AQKA 3V7KA 3PW7A 2NRZA 5DG7A 4O3RA 5KFUA 8ICUA 4K9AA 1BVSA 4QIWF 1S9FA 4O0IA 3H4DA 1Z4NA 1QSLA 5KG3A 4FH3A 3V7LA 3O0FA 3IN5A 4X4OA 4F72A 3BS5A 2HDOA 1IIPA 1B43A 1ZQFA 1A77A 5DQIA 5AM4A 2NRWA 4RQ7A 1Z1BA 3MABA 5AM5A 3SENA 4AT8B 3GZFA 1COOA 3BQ0A 1S76D 2QARB 3NVYA 2G07A 2BKEA 4P4MA 4NM1A 5J0PA 4QZDA 5T14A 8ICLA 4TQSA 4MEYA 5G5GA 3HX0A 1JAJA 4IR9A 4I2HA 4Y2PA 3MGVA 2C2DA 3M9MB 2ID1A 3OVBA 4RZRA 1KFDA 1XSNA 4M6WB 1XO0A 2K4PA 1MA7A 1ZQHA 4NXVA 1S10A 4BX9C 4JWNA 4LT6A 3RB0A 5AKIA 5A0LA 2JH1A 3MR5A 8ICQA 1DK2A 3UMGA 1UETA 3OWGA 1TE2A 4UAWA 2E1FA 5JU5A 4M0AA 3PW0A 2ZH5A 2ZH9A 4QZEA 4QWDA 3GV5B 3RTVA 4ECZA 1XSPA 2RLTA 2YMPA 3LVWA 3BQTA 4O5CA 3KBBA 2C28A 4KLUA 5CFTA 2KIWA 3FM9A 4UB4A 3OSNA 2W9BA 4EV6A 4TURA 4KLJA 2W9MA 3ETLA 2DF4B 4O3PA 5DGAA 4WCWA 2HVHA 2G09A 7ICFA 1X2IA 4R64A 1MIYA 4CF4A 4CRXA 4JUZA 1FO4A 4NLCA 2FDRA 4ED8A 5JUMA 4J9MA 4ECQA 1C7YA 4UAZA 1FFUA 2WHEA 4O5KA 2ZTDA 5HHHA 2B0CA 2JZBB 1X6IA 1X9XA 1V97A 2ZUBA 3OSPA 1S0OA 1BPXA 1WG8A 1X6JA 2W55A 4X0AA 4DOBA 2LHTA 2A3VA 1PK3A 4QWAA 4KITB 3H0RB 3ZD8A 2YX8A 1N62A 1K1QA 4GIBA 2HHPA 3SAHA 3KKAC 4J03A 3TADC 1LKYB 4F4KA 2DBYA 2G5HB 3RBEA 2BZFA 3KHLA 4OJ5A 4Q45A 2KV2A 2DQNB 1ZQMA 3QE9Y 1CI4A 2W9CA 3AU6A 2MSNA 4C8KA 3FAHA 1TFRA 3VC8A 4EENA 4M9LA 4Y2XA 4ATBA 3PW5A 4WBYA 1YZ7A 4KLOA 5DBCA 4X5VA 4EBKA 1U9LA 1SV4A 3Q8QB 1DGSA 5CB1A 1S5LU 5ALHA 2AQ0A 1NKEA 2F2AB 3GQCA 3HT3A 2R8IA 2G06A 3SAGA 2FLPA 4E80A 2A19A 1KQQA 1R8BA 3JPNA 1N63A 2H3ZA 2ODGA 3GV7B 3BZKA 9ICMA 4UD5A 3PZPA 4XQ7A 4BDPA 3RRHA 4FHWA 4AT9B 4XRHA 5AI5A 4UB1A 4DSIA 2HN1A 4O69A 3M9OB 3ONNA 2PFOA 4IRCA 5KFLA 4CDGA 3Q8PB 2KG5A 5ALLA 2PMZC 1BNOA 5AICA 1VJ7A 1KBUA 2HCFA 3AQMA 5K4LA 1KFTA 4A8EA 2JR5A 3K7DA 3KZXA 3WK5A 8ICEA 1L7NA 5AHXA 2KEYA 1ZJMA 2LM4A 2ZJ5A 5CEHA 2LYBA 4EBDA 4NLGA 4YMOA 5ALEA 2PMZF 5CRXA 8ICWA 4NLKA 2PBEA 4Q43A 2CXYA 5ALJA 4BWMA 4R65A 3N7SC 2DR7A 4KLDA 5AI6A 5CA7A 4DSEA 3DDHA 4DLEA 3LQCB 4QZIA 1LV5A 1P7DA 1ZQCA 5HP4A 5J2DA 1WCNA 7ICKA 4JK1A 5EE1A 2ALZA 3SMVA 4K4IA 2DRAA 4I2AA 4NJ8A 5KG1A 1RM6C 4XJEA 2NRVA 3K1RB 3N7PD 1KL9A 2WAQC 4ELUA 1ZD4A 4ZOHC 3WU2U 9ICAA 4DSFA 5KG4A 4FHVA 1MIVA 2KICA 4QZBA 2M2UA 4M04A 2VA2A 4RUAA 1TFYA 1QQ7A 1O08A 4ECUA 4F5QA 4F50A 5C5JA 1XC9A 7ICSA 1T94A 4K97A 4DL2A 2WAQF 4RQNA 1F5AA 3RH5A 4MFFA 1UT5A 3V72A 4YCXA 3NS1A 1PVQA 3RB6A 3N28A 4P0PA 3MGHA 2BCUA 1OXJA 4F4YA 3C28A 4I2JA 2XGPA 4C4RA 8ICFA 2KVSA 2XY7A 4GXKA 1Q3UA 4J9QA 1NK8A 3WFQE 4OAHA 1SWWA 1ZQYA 4EBCA 3RBDA 7ICIA 4M9JA 3HW8A 4AT7A 1U47A 1TV9A 2WF9A 4KM5A 4GFJA 2PI5A 2ZJ8A 4KMUA 2HBJA 4EEDA 1V38A 2NV3A 4X4SA 2FPKA 4Y2UA 3PY8A 2YMLA 2ZJAA 1H38A 1PX5A 3M7DA 1HIWA 4PGQA 4B6JA 8ICBA 5J0UA 5GTHU 3PX6A 9ICPA 3HIYA 3AQFA 1BGXT 1JMSA 4X0BA 3MR6A 4YXMA 3LVVA 3IHQB 4F5OA 3FDSA 8ICRA 1JX4A 1T3QA 4WC4A 4YFKA 1KLNA 4GXJA 1Z1VA 4DL3A 4BJQA 1MIWA 2D3DA 3D2SA 1PK1B 4I2BA 8ICIA 5DDYA 5HRKA 1YLQA 3C2LA 1ZRMA 2L5YA 3UXPA 3I1YA 3PV8A 1ZETA 4TQRA 5GTIU 3ZDEA 1Z00B 2FJ6A 9ICUA 4YQWA 2CN1A 3OUYA 4R8UB 3C1YA 5J2JA 5EE9A 2W11A 3H4BA 5ALUA 9ICLA 1S97A 2UVVA 2ZXHA 2IOHA 3HJ1A 2Y9UA 7ICJA 1X40A 4OD0A 9ICKA 3C5FA 5KFQA 2AJQA 2KSOB 4EEBA 3NWIA 2DRBA 1JN3A 3RB3A 7ICQA 4K4HA 7ICLA 1WYGA 4KLMA 3WK6A 3EF2A 3EUB2 1SIJA 2FLLA 2UVWA 2B6GA 4EBEA 1L7OA 4RQ2A 5CFSA 4KB6A 1IV8A 3EPGA 3EWAA 3ER9B 4Y2VA 2W8KA 4IQWA 4P0QB 5AKJA 2AU0A 4O68A 1NO5A 2C22A 5HR7A 1F44A 2VJ4A 8ICXA 2NRTA 3PR4A 2KP7A 2JHDA 2XY5A 2I5HA 4UBBA 4DS4A 2R8HA 5DBAA 9ICXA 1RDFA 1ZRNA 1A76A 4US8A 1DK3A 2VA8A 4DFPA 4EX6A 4EX7A 4JLXA 5B3QA 1JXEA 1L7MA 5KL8B 2JEIA 4YR3A 1WUDA 4OCZA 5CP2A 4CCHA 2YN4A 1SB3C 4DQRA 4DF4A 3WFOA 4X4UA 5AK4A 5ALRA 1Z3EB 5KT6A 1SV0A 4DLGA 5CFUA 1A0PA 2A1JB 2ZTCA 2K4IA 2LM1A 3EYZA 2BQUA 5ALGA 3JZ0A 2P6UA 3SR6A 4KN4A 4M6WA 3OVAA 1ZQWA 1VDVA 2KJ9A 4F4ZA 4QZFA 3Q8LA 1XO1A 1ZQBA 5HRFA 1C20A 5AM0A 4NL9C 4RPYA 2IHOA 2E8PA 2LKYA 3WKDA 2KJ8A 5HR6A 3HILA 2NO4A 2AH5A 2R8JA 4P4OA 3KHRA 3AN1A 3QZ8A 3H7IA 4JV0A 3AMZA 3H0MB 4F5RA 3MR3A 1QH9A 2F1JA 1J97A 5EE0A 5HC9A 2RDJA 1NK6A 3BQ1A 1AQ6A 3TAQA 5EE3A 2ZXIA 3BDPA 4C4SA 1QTMA 2O5AA 3GU3A 4J9PA 1D8YA 5J2GA 3G6VA 4F92B 1V85A 2OYYA 2XGQA 3WK7A 1CUKA 1U4BA 2DPJA 2Z7JA 3B0XA 5DECA 1SL2A 2YB1A 3AUOA 2VA3A 2H3QA 1TFWA 1SZPA 4Z6CA 3DEEA 4LEWA 8ICGA 3ZD9A 3DV9A 1TVAA 4UAYA 3KHGA 3NRWA 9ICWA 5KFAA 1RXWA 3KZIU 5BPCA 2JZBA 4DQIA 3N97B 2RP5A 4WC3A 4ACOA 4IRKA 2HHUA 1D8BA 3V6HA 3CP8A 3ORYA 5DEDA 1D8LA 1D9FA 3N7RC 1T4GA 4C8OA 1PVRA 4HYKA 3M6KA 1RQLA 2GLEA 2HN2A 3QU2A 5DGBA 2FMSA 4O6AA 2F44A 3TARA 2HMXA 3AL0B 3LK9A 3KFUF 2K8AA 3ETRA 1SZHA 1Z4OA 5AI9A 4B9MA 9ICVA 2Q66A 1JQRA 4K4GA 1FIQA 1Q78A 4WC2A 4B9TA 2W43A 1L3UA 3D2NA 2KVCA 5F9NA 2M0NA 3JPRA 2QKQA 4Y2YA 2JGAA 3SZ2A 4I2GA 4UB5A 1ZQAA 1IXRA 1KNYA 3BS7A 1F5SA 1MN8A 4F4XA 2DR8A 2HBLA 2CPRA 5L1LA 2F76X 3GV8B 4NM2A 4MF8A 3RJFA 2EAOA 5ALPA 7ICNA 3T3FA 1TAMA 5AKYA 4Q8FA 4RQ3A 1KRPA 4NL9A 3R9KA 3K75D 4WBZA 4AT9A 2ASJA 2BGWA 1VLBA 2JEGA 2ATLA 3LDAA 2BE3A 3RB4A 3C23A 4KMOB 1RYRA 3QUQA 1JI7A 1SKRA 4FHYA 4DFDA 3OHAA 3QEAZ 2MRLA 5DB6A 2HOIA 4PHDA 2HHWA 5ALKA 4UAVA 5AKZA 9ICCA 3LWMA 4C7YA 2B21A 2HW3A 4BXOB 3WK8A 1N5XA 2C2RA 4JV1A 1SKWA 3RJEA 3T5LA 1ZQQA 5CR0A 5AM1A 4C4TA 4EELA 2R8GA 1KW4A 1VJ5A 3PSTA 1ZQOA 2MUTA 3SYZA 3PO4A 3CYMA 2LYAA 1NZBA 1S0NA 1TK8A 2W7PA 7ICPA 5J8YC 2BQRA 5KT5A 5H2FU 3HWTA 1QSSA 2GWSA 2YMMA 3KOOA 3A0BU 3MC1A 4US9A 1DOQA 4YR0A 5HHIA 2BDUA 3ER8C 2I1QA 3WKEA 4ICAA 4F8RA 5ALZA 1JIHA 7ICGA 2IBKA 3GIKA 3RJGA 4K9BA 5DLFA 3ISDA 2WF6A 3TFRA 4YD1A 9ICOA 3AEVA 5TISU 1KN5A 4WQKA 4YVZA 4XQ8A 4PPXA 5F3XB 2M9NA 2OHFA 4O3MA 4LEVA 2KJ5A 3H8JA 4FE3A 1QQ5A 4QZ8A 2J6TA 1XNSA 3ZDBA 4QWBA 1NJYA 3IM1A 2F1HA 1ZJNA 2O6KA 4C80A 1PUZA 4KX5A 1ZQXA 2ZIXB 5KFJA 1ZQGA 3CRXA 4RWOA 4NXZA 1JALA 3HPOA 3K1ZA 5KFHA 4NV0A 4OJ6A 5TZVA 4TUQA 4JLZA 2W04A 2DKXA 3LYSA 4M9GA 2EH9A 2KKVA 4Z6FA 5KFTA 2KNJA 3MDAA 1NJXA 4ZH4A 3L9DA 2P6RA 3SI8A 5IIJA 3AQEA 3Q8RB 1NJWA 5IIMA 4PHAA 2QB0B 3D6JA 5KTQA 3QU4A 2XICA 2E8OA 5AKHA 3ZI4A 4UARA 2W8LA 4FZNA 4TUSA 5HRIA 5KAFU 3PR5B 4YG2A 3RJHA 3PSPA 2ZUCA 1NOMA 3AQNA 1N5WA 2DWQA 2H3FA 4ECXA 2Q0ZX 3Q8MA 3JCFA 2PKEA 5KT7A 4MF2A 3GIIA 2R18A 1J2MA 3JPQA 4J9OA 5KAIU 2RHFA 5ALFA 3S6JA 1UA0A 2LPEA 9ICIA 4O9MA 3PMLA 2K60A 1RZTA 4HX0A 1COKA 2KIVA 3TKAA 5D46A 2O1PA 1NK4A 1SXEA 2F1IA 2IHNA 4LZGA 1R8AA 1N2XA 2B51A 5CWRA 1QLNA 4DFJA 3GIJA 1PK1A 1X9MA 2BCSA 4JMUA 3G6XA 3PVXA 3A0HU 3AQLA 3PNCA 3NVVA 1LB2B 4I2IA 2RDIA 2KZMA 2EANA 8ICPA 4N7RA 1Z00A 5J8YA 1SGGA 3UPQA 5KFFA 2JRZA 2NO5A 4R8UA 2OXOA 5DB8A 1UEUA 1ZQKA 2HHSA 4O3SA 4PL1A 3UXOA 3C1ZA 4U7CA 2K8BB 2OM6A 3MBYA 4O3QA 3LWLA 1MC8A 3TAPA 4DL4A 4X4VA 4OJOA 4DO9A 2IOFK 2LMRA 4PZOA 4UD4A 3WFPA 5DQGA 2LI6A 4DSLA 7ICTA 5L1MA 3QX7A 2HVIA 4ATBB 4QZHA 5G5HA 4P0QA 2JH7A 4O3NA 5JTIA 3OJSA 1LVHA 3C21A 3OGUA 5ALWA 4EEYA 1OUQA 1RXVA 4E0DA 1JRPA 1KSPA 1NJZA 2BCVA 4P2HA 1BNPA 1UPHA 4NLNA 3FC4A 4PZNA 4DQSA 4F5PA 4KLGA 1R8CA 3GDXA 5AI4A 3RAXA 1SV0C 4QW9A 5HRDA 4F93B 4IS7A 4O5EA 4CGZA 5DG9A 1XSLA 2BCRA 2K8CB 4X4TA 5B3PA 5L9XA 2EZXA 1N60A 1WCLA 2EZYA 2JV3A 4C8NA 2FLNA 4U6PA 3NVWA 1NNLA 4J9RA 2ZH6A 4YMMA 2ZH4A 4NKTA 4PJ0U 2ZIWB 3IP4B 1ZQLA 5KFNA 3H3AA 2CRXA 4NY8A 2GA9D 3HP6A 5AI0A 4I27A 2ES6A 3PW2A 3H8SA 2F8LA 4Y2QA 4RNNA 5KG5A 1TKDA 2AGQA 2VJ5A 1FA0A 9ICNA 3H0LB 1ECWA 1Q46A 4UAUA 1DGJA 2WF8A 1TK5A 2KMDA 2OWOA 5DB9A 7ICHA 3C18A 1S0VA 4E8FA 3EPIA 2A1AA 3UQ2A 7ICRA 2FMQA 2HHVA 1ZD5A 3NKUA 4YMNA 4MHVA 5ALXA 1D9DA 4RWPA 4I2EA 5ALIA 1N48A 4ECSA 5ALOA 3QXGA 4M5DA 2YY6A 1T7PA 1XWLA 3E2EA 2ZHAA 2G5IB 1SKSA 4RQ6A 4DQQA 3L4PA 3RAQA 2EWRA 5J2AA 3NTUA 4EZ9A 2XC9A 4C7ZA 4AYBC 1L3TA 4KLSA 4NLBA 2MAXA 2DPIA 4GC7A 1OW5A 3QUTA 3Q8KA 5KFGA 2ZHBA 5J0QA 1YZ6A 2M2WA 1BPDA 4TUPA 2KZZA 1ZQEA 3H39A 3MFHA 5ALQA 3EZ5A 4PGYA 2MA1A 2RQ5A 5KT3A 4IG8A 3TACB 1ZQ1C 5D63A 1CEZA 1UQVA 1HUZA 4P0PB 4ECWA 2AHOB 4LEYA 2XCAA 4AYBF 1O03A 4X4RA 5HRLA 2AGOA 7ICUA 3QU7A 3IRUA 2KOBA 2W7OA 3HKZC 3OV7A 2K89A 4AT8A 3RJJA 3FYHA 3SV4A 5KL1B 4WC5A 2QARA 5DLGA 2E8MA 2ZIUB 2ZUDA 4XA5A 2FI1A 3BQ2A 4IQVA 5AK3A 1Q3VA 4UB3A 1ZQRA 4F2SA 2BDPA 2V9WA 2H5XA 4RWQA 2AXTU 2JMGA 3C2KA 3HJEA 1WWVA 4ED7A 4Z6DA 4X4NA 2ZTEA 2GH1A 9ICTA 3NASA 3HKZF 5AIAA 1KFSA 4FHPA 4F71A 2ZH7A 2H3IA 4RWNA 5HMLA 2E3TA 1PVPA 3THVA 4AP9A 1RG6A 1RYUA 3IDWA 9ICRA 4QWCA 2LBOA 1L3SA 1AROP 1HJPA 3GILA 4PGXA 4JV2A 1IM4A 5KG6A 2HBMA 3H8MA 9ICEA 1TAUA 4F2RA 2E5SA 2HOQA 4Y2SA 3T5JA 3JYYA 5KFBA 4RPXA 3F5AA 5EOZA 1HEKA 3GIMA 4DSKA 4KLLA 3V7JA 5L1IA 2KE7A 2YTUA 3M1YA 4RQ1A 3CK6A 1U45A 2KZ3A 5HRBA 4KLIA 2ZH1A 4QZAA 2V4RA 1Z19A 4ED3A 5AKGA 1XU4A 2N1RA 2I6XA 3QUBA 1K5OA 4EGWA 5J0WA 3MGIA 2B4VA 4OAGA 7ICVA 2QB1A 3C5GA 3MDCA 2PXIA 4BXOA 1B22A 4ECYA 2OCEA 3T79A 4UB8U 4ED0A 2M2TA 2XO7A 5FP0A 5JTGA 1ZQJA 7ICOA 1NK5A 2WF5A 3KTQA 2FE9A 3L3FX 1JXLA 3PSFA 1RYSA 4IR1A 3B9JA 4RU9A 3M8RA 1L8LA 1ZQZA 2AGPA 3ALRA 5B5EU 4FS2A 5F2VO 2P66A 5KG2A 4MEXA 3BZCA 2WFAA 3UM9A 5KFOA 4WC1A 3I76A 5KFDA 4ELTA 1ZQPA 3JPOA 4J9KA 1LKYA 5J2CA 3SV3A 1X9SA 4OAFA 1L3VA 5IIKA 8ICHA 2UVUA 1BPYA 4RNOA 3H37A 4K96A 8ICYA 5ALYA 4FHXA 4F91B 2IMWP 4HAIA 3WKAA 2ZH2A 5DQHA 2W54A 1KTQA 4RQ5A 5D61A 1QCKA 3J81j 1UA1A 5J0YA 3MCRA 5KFXA 4M9HA 1Q79A 2ZIXA 2ESEA 2HHXA 8ICJA 1J2NA 3RJKA 1VFGA 4USAA 4EYHB 2JEJA 1ZXIA 5KFZA 4M9NA 3RR8A 4YXJA 2BQ3A 3RH4A 3ZDCA 2NRXA 2BHNA 3C2MA 3T5KA 3H38A 2RRDA 3PHZA 4X4QA 2W9AA 3V6JA 4OAIZ 2K4HA 3CW2C 1URJA 4PL2A 2R8KA 1WOTA 3QUCA 4ELVA 2ZIVB 4O3OA 2QLTA 1U49A 4EBJA 2QB0A 3WFSC 1SWVA 1NI3A 3D2QA 2M2VA 4FH5A 2EAMA 3ERCC 2W03A 4IQTA 4FO1A 4OJPA 4MKPA 4I0UA 1KEJA 5KFPA 1B4FA 1QSYA 4RQMA 3ED5A 8ICKA 5AKEA 2BPCA 4DWIA 4PHPA 4XUSA 3ICXA 2PI4A 5J2IA 4C0ZA 4Z6EA 3N4MB 1WWUA 1NKBA 4DSJA 2DKZA 3BJYA 4QJFB 2LYHA 4EZ6A 4J9LA 4G3IA 4NKUA 4DF8A 1PZNA 5KT4A 3QNMA 4NWIA 4FBUA 3IG5A 3G6YA 1L5UA 4UW9A 4M2YA 2UVRA 3SEIA 1NKCA 4B9VA 2ASLA 1N56A 8ICSA 3F2BA 4NXTA 3OPXA 2ASDA 1FFVA 3BS5B 3IG8A 3F53A 4NXXA 2PFPA 1UT8A 4NLZA 2DUYA 3PSIA 4RQ8A 4WH5A 5D49A 4Y2RA 2HHQA 1T8EA 1DRGA 2PFNA 4WC7A 3VCBA 5HR9A 4RQ0A 4M47A 5DDMA 3WKBA 5KFCA 3RH6A 3AM9A 5HRHA 5CHGA 1ED1A 5ALMA 5L1KA 5D4BA 4I2FA 3RR7A 3PX0A 4QZCA 2GOLA 4FBTA 5JRTA 2YB4A 4KLHA 3IV6A 4DS5A 3TFSA 2E8NA 1BPEA 3RRGA 4JB3A 4WC6A 3RFAA 3F2CA 2DFLA 5KFIA 4KLEA 1N61A 4BGDA 4QNLA 1X9WA 3C66A 4Q44A 1Q8KA 5AIBA 1FEZA 2WTFA 5J2KA 4PH5A 3NVZA 4KX3A 4QZGA 4DL7A 4ECTA 2FPLA 2FCLA 2IA6A 3ISCA 2WB1C 1YT3A 2E1EA 2EZZA 2ZH3A 4UB6U 1U48A 4UBCA 4NXWA 3EW9A 1V9PA 2BBJA 2W9BB 3JPPA 4WJ3B 1MQ3A 8ICZA 5C0YA 1DXSA 2EDUA 2XI9A 2IOFA 4UASA 4PHEA 1GO3F 4G9BA 2BBHA 4QW8A 4EEKA 2WB1F 2ZIWA 5ALDA 3QYPA 3NUQA 5J2HA 2J6SA 5BOLA 4DOCA 3Q8SB 4WOYA 1ZQVA 3OVSA 4OJLA 1B0XA 3NGDA 4E7XA 1QQ6A 3MFIA 2V4QA 1L6NA 1ZQUA 2KFNA 2ZH8A 4QZ9A 4MFAA 5B66U 4C8MA 4RNMA 2MUTB 3BQ7A 3WKCA 2ISOA 2VIXA 4ED6A 5AKXA 5BOMA 7ICMA 4R66A 3TI0A 1XS9D 2IUBA 1GPJA 4YP3A 1CRXA 2HBKA 3PMNA 3PW4A 4FO6A 4FS1A 4RPZA 1A6SA 2XY6A 5IINA 5KFWA 1L7PA 2KSOA 4P4PA 5L1JA 8ICCA 3JPTA 1ZD2P 4UB2A 4UQGA 1HUOA 3WK4A 2JXJA 3OHBA 5AK5A 4DL6A 3ZDDA 2W9CB 4YN4A 4I2CA 4DFKA 1UEVA 2BCQA 4YR2A 4R63A 8ICAA 1X42A 2HHTA 5EWEA 3B0YA 3KKAA 8ICOA 3TADA 5ALTA 3HJ4A 2HI0A 5KFEA 4RUCA 4NXUA 5E79U 5EWGA 4X4PA 3E0FA 1SL1A 4B9NA 3UXNA 2G0AA 2KHVA 3TQ1A 2F8KA 5J0XA 1X66A 4Q8EA 5J0SA 4O67A
chains in the Genus database with same CATH topology
5F9LA 3BQ2A 2Q66A 4IQVA 4RQ4A 1NKEA 3GQCA 3HT3A 1ZQSA 2R8IA 4UB3A 1ZQNA 1ZQRA 9ICHA 1JQRA 4K4GA 4F2SA 2FLPA 2BDPA 1ZQTA 3UPSA 2V9WA 2H5XA 4RWQA 1R8BA 3JPNA 1Q78A 3QEBZ 4E80A 4B9TA 4WC2A 4DOAA 3C2KA 3GV7B 4ED7A 1L3UA 9ICMA 4UD5A 4XQ7A 5F9NA 4BDPA 4Z6DA 2I9GA 3RRHA 1S0MA 4X4NA 3JPRA 4FHWA 2ZTEA 9ICTA 4AT9B 4XRHA 3SZ2A 4I2GA 4UB5A 1KFSA 4UB1A 5KFMA 4EYIB 4ED1A 1IXRA 1ZQAA 4DSIA 8ICNA 1KNYA 5KG0A 3M9OB 2ZH7A 4F4XA 2PFOA 4IRCA 5HMLA 4LVSA 2DR8A 5KFLA 4RWNA 5L1LA 3PO5A 2AQ4A 1MQ2A 3Q8PB 3GV8B 2FPMA 3THVA 5KFVA 4KLFA 4NM2A 4MF8A 3RJFA 2A1JA 7ICNA 3T3FA 9ICRA 4Q8FA 4RQ3A 4QWCA 1KRPA 1BNOA 1VJ7A 4YD2A 3K75D 4WBZA 4AT9A 9ICJA 1L3SA 5CJ7A 2ASJA 1AROP 1HJPA 3K4GA 2BGWA 4GXIA 2IHMA 3GILA 2JEGA 4PGXA 3AQMA 4JV2A 1IM4A 5KG6A 1KFTA 1BPBA 2ATLA 4F4WA 2ISPA 3LDAA 2BE3A 9ICEA 2KTQA 4BWJA 3GFKB 4F2RA 3RB4A 8ICEA 3C23A 1TAUA 1T3NA 9ICBA 1V4AA 3JPSA 1ZJMA 3T5JA 1RYRA 3JYYA 1OU5A 5KFBA 4RPXA 2ZJ5A 1SKRA 3M8SA 1MSWD 4FHYA 5EOZA 4EBDA 4NLGA 3GIMA 2Y1JA 4DSKA 4YMOA 3OHAA 3QEAZ 4KLLA 8ICWA 5DB6A 4PHDA 4NLKA 2HHWA 3V7JA 5L1IA 4Q43A 8ICVA 4BWMA 3QZ7A 2PBEA 4RQ1A 3ZDAA 1U45A 9ICCA 4R65A 2KZ3A 3LWMA 5HRBA 5J2BA 4KLIA 5HRGA 2B21A 2DR7A 2HW3A 4BXOB 2ZH1A 4KLDA 4QZAA 4ECRA 2V4RA 5KT2A 5CA7A 4DSEA 4DLEA 1NZPA 3LQCB 5J0OA 4QZIA 2C2RA 4ED3A 4JV1A 1LV5A 3WFRE 1XU4A 3MR2A 3UQ0A 1SKWA 1ZQCA 2PFQA 5HP4A 3RJEA 5J2DA 3T5LA 1ZQQA 5J0WA 4RT3A 1WCNA 5CR0A 3MGIA 4GLXA 7ICKA 7ICVA 1S77D 4JK1A 2ALZA 2R8GA 3C5GA 1ZQOA 4K4IA 2DRAA 4NKUA 2MUTA 3MDCA 3SYZA 4I2AA 5KG1A 3PO4A 2NRVA 5DB7A 2PXIA 4BXOA 4C8LA 1B22A 1EXNA 4ECYA 1S0NA 8ICMA 1TK8A 1SL0A 7ICPA 4ELUA 4ED0A 2BQRA 5KT5A 3HWTA 1QSSA 2GWSA 9ICAA 4DSFA 8ICTA 2XO7A 2M2TA 5KG4A 4FHVA 1DOQA 4YR0A 1MIVA 1R89A 5HHIA 2I1QA 4QZBA 1NK5A 1ZQJA 7ICOA 4M04A 2M2UA 2VA2A 3KTQA 2BPFA 4RUAA 4F8RA 1JXLA 1JIHA 1TFYA 1TK0A 1RYSA 4ECUA 2IBKA 7ICGA 4IR1A 4F5QA 5DG8A 3GIKA 4RU9A 1KDHA 3M8RA 4F50A 3RJGA 5C5JA 4MFCA 1ZQZA 5DLFA 2AGPA 3ISDA 1XC9A 7ICSA 9ICGA 5KFKA 3TFRA 4KLQA 4YD1A 4DL2A 1NK9A 2XCPA 4FS2A 9ICOA 5F2VO 2P66A 5KG2A 4MEXA 4KTQA 1F5AA 4YVZA 4XQ8A 4PPXA 3RH5A 2M9NA 4GC6A 4B9SA 4MFFA 1UT5A 5KFOA 3V72A 3AU2A 4WC1A 3H8JA 1ZYQA 4YCXA 4QZ8A 1NK7A 3KHHA 5KFDA 2J6TA 4B9UA 4ELTA 1ZQPA 3JPOA 3ZDBA 3NYBA 4AT7B 4J9KA 3RB6A 4KLTA 4QWBA 1NJYA 3IM1A 2F1HA 5J2CA 7ICEA 3SV3A 3MGHA 1X9SA 1L3VA 1ZJNA 2BCUA 5IIKA 8ICHA 4S3NA 4F4YA 2UVUA 1BPYA 5KFRA 4RNOA 3H37A 2DVIA 4I2JA 1ZQXA 2XGPA 8ICYA 4FHXA 8ICFA 4F91B 2XY7A 5KFJA 4GXKA 2IMWP 1Y88A 1ZQGA 4RWOA 4J9QA 4NXZA 1NK8A 2RFFA 3WFQE 3HPOA 3H40A 2ZH2A 1ZQYA 9ICFA 4EBCA 3RBDA 7ICIA 5KFHA 4M9JA 5DQHA 3HW8A 2DR5A 4AT7A 1U47A 1TV9A 1BPZA 5TZVA 1KTQA 2PI5A 5J29A 2ZJ8A 4RQ5A 4KMUA 1UA1A 5J0YA 4TUQA 4ECVA 2C2EA 2JEFA 4M9GA 5KFXA 4M9HA 3PX4A 1Q79A 1ZQIA 4Z6FA 5KFTA 2HHXA 1K1SA 8ICJA 3MDAA 1NJXA 3RJKA 4ZH4A 1NK0A 3L9DA 3TANA 2P6RA 4X4SA 1VFGA 4RT2A 3SI8A 4WC0A 5IIJA 4EYHB 2FPKA 2JEJA 3Q8RB 5J2EA 3PY8A 1NJWA 2ZJAA 1H38A 5IIMA 1PX5A 5KFZA 2DR9A 4PHAA 4M9NA 9ICQA 3RR8A 5HMMA 4YXJA 5KTQA 4PGQA 2BQ3A 3RH4A 3ZDCA 2NRXA 4QWEA 8ICBA 2BHNA 5J0UA 3C2MA 2W8LA 3T5KA 4TUSA 3PX6A 2J6UA 3H38A 4X4QA 9ICPA 2W9AA 5HRIA 3HIYA 4B9LA 3V6JA 2NRKA 5DKWA 5KFYA 1BGXT 4EP7A 2R8KA 1JMSA 3PR5B 4F5NA 1WOTA 4KN7A 5IIOA 4ELVA 4YG2A 3RJHA 5KG7A 2ZUCA 1NOMA 4O3OA 2KN7A 3MR6A 4X0BA 3AQNA 1U49A 4YXMA 4EBJA 4I2DA 3IHQB 4FHPA 4F5OA 3FDSA 8ICRA 3WFSC 1JX4A 5DBBA 4ECXA 4WC4A 2Q0ZX 4YFKA 3Q8MA 1KLNA 4DQPA 5J0RA 4DEZA 4GXJA 2Y1IA 2M2VA 4DL3A 4FH5A 5KT7A 4MF2A 3GIIA 3V6KA 4JWMA 3JPQA 4J9OA 4IQTA 4IRDA 1MIWA 4ED2A 1UA0A 4I2BA 8ICIA 3H8WA 5HREA 5DDYA 9ICIA 4O9MA 3OUYB 3PMLA 1KEJA 5KFPA 5HRKA 3M9NB 1TAQA 1QSYA 3C2LA 1YLQA 4LZDA 1RZTA 8ICKA 3UXPA 3PV8A 2BPCA 4DWIA 4PHPA 5D46A 1ZETA 4XUSA 2O1PA 4F3OA 2PI4A 1NK4A 4TQRA 5J2IA 2F1IA 4LZGA 2IHNA 1R8AA 4J9NA 4Z6EA 2BR0A 3N4MB 3ZDEA 1NKBA 4DSJA 5CWRA 1Z00B 4I28A 2BPGA 3OJUA 1QLNA 9ICUA 4YQWA 3GIJA 4J9SA 3BJYA 4DFJA 5KFSA 5IILA 1X9MA 2BCSA 3OUYA 9ICSA 4R8UB 3C1YA 5J2JA 2KFZA 2LYHA 4IQUA 5IIIA 3H4BA 9ICLA 3G6XA 4DL5A 1S97A 4EZ6A 4J9LA 5EWFA 2UVVA 4G3IA 4DF8A 3PVXA 1ZQDA 1PZNA 3PNCA 5KT4A 5HNKA 7ICJA 3AQLA 3HJ1A 4I29A 9ICKA 3C5FA 1LB2B 4I2IA 4FBUA 5KFQA 3G6YA 1L5UA 2AJQA 2RDIA 5J2FA 2UVRA 4M2YA 2KZMA 1RPLA 1JN3A 3RB3A 8ICPA 1Z00A 2DRBA 7ICQA 1NKCA 5J0TA 4B9VA 2ASLA 4K4HA 7ICLA 3ISBA 1N56A 2VANA 4KLMA 8ICSA 3UPQA 4DFMA 5KFFA 4R8UA 3RJIA 2ASDA 5DB8A 1UEUA 3T5HA 1ZQKA 2FMPA 2FLLA 2HHSA 4O3SA 2UVWA 3AQKA 3V7KA 3PW7A 2NRZA 3UXOA 4EBEA 3C1ZA 5DG7A 2PFPA 4O3RA 1UT8A 4RQ2A 5KFUA 4NLZA 4O3QA 3MBYA 8ICUA 1MC8A 3LWLA 1BVSA 3EWAA 4RQ8A 3EPGA 1S9FA 4O0IA 5D49A 2W8KA 3H4DA 4DL4A 3TAPA 1QSLA 4IQWA 4X4VA 5KG3A 2AU0A 2HHQA 4FH3A 1T8EA 1NO5A 4DO9A 3V7LA 2PFNA 4WC7A 2C22A 5HR9A 4UD4A 4X4OA 3WFPA 4RQ0A 5DQGA 4M47A 1B43A 5DDMA 4DSLA 5KFCA 3RH6A 1ZQFA 7ICTA 2NRTA 8ICXA 3PR4A 5HRHA 2KP7A 5CHGA 2HVIA 1A77A 5DQIA 4QZHA 4ATBB 2NRWA 4RQ7A 5L1KA 3MABA 5D4BA 4I2FA 3RR7A 2XY5A 3PX0A 4AT8B 4QZCA 4UBBA 1COOA 3BQ0A 4FBTA 4DS4A 1S76D 4O3NA 3OJSA 2R8HA 5DBAA 3C21A 3OGUA 4KLHA 9ICXA 2BKEA 4P4MA 4DS5A 3TFSA 4EEYA 1RXVA 4E0DA 5J0PA 1BPEA 1KSPA 2AQ0A 4QZDA 3RRGA 1A76A 1NJZA 4WC6A 8ICLA 2BCVA 2DFLA 4TQSA 5KFIA 4P2HA 1BNPA 4MEYA 2VA8A 1DK3A 4NLNA 4DFPA 4BGDA 4KLEA 1X9WA 3HX0A 1JAJA 4DQSA 4IR9A 4I2HA 3C66A 4F5PA 2C2DA 1JXEA 4Q44A 4KLGA 1R8CA 2JEIA 3GDXA 4YR3A 5CP2A 5J2KA 2WTFA 3M9MB 4CCHA 2ID1A 3RAXA 4RZRA 1KFDA 4QW9A 4F93B 4DQRA 5HRDA 3OVBA 1XSNA 4DF4A 4M6WB 4O5EA 3WFOA 4X4UA 4B9MA 9ICVA 4PH5A 1Z3EB 5DG9A 5KT6A 1XSLA 1ZQHA 2BCRA 4X4TA 4QZGA 4DL7A 4ECTA 2FPLA 1S10A 5L9XA 4JWNA 4DLGA 1WCLA 4LT6A 2IA6A 2A1JB 3ISCA 3RB0A 2ZTCA 4C8NA 3EYZA 2BQUA 3MR5A 2FLNA 8ICQA 4NM1A 2ZH3A 3JZ0A 4J9RA 2ZH6A 2ZH4A 2P6UA 4YMMA 1U48A 4NKTA 4KN4A 1DK2A 4M6WA 4UBCA 1UETA 3OVAA 1ZQWA 4F4ZA 4QZFA 1ZQLA 5KFNA 3H3AA 3EW9A 1V9PA 4UAWA 3Q8LA 1XO1A 1ZQBA 5HRFA 4NY8A 4RPYA 3HP6A 2W9BB 4M0AA 3JPPA 3PW0A 2ZH5A 4I27A 2ZH9A 4QZEA 4QWDA 1MQ3A 8ICZA 3PW2A 3GV5B 3RTVA 4PHEA 3H8SA 4RNNA 4ECZA 1XSPA 5KG5A 4QW8A 3BQTA 1TKDA 4O5CA 2AGQA 2C28A 2R8JA 4KLUA 9ICNA 1FA0A 4P4OA 5J2HA 4UB4A 3OSNA 3KHRA 2W9BA 4TURA 2J6SA 3QZ8A 5BOLA 4DOCA 3Q8SB 1TK5A 2OWOA 2W9MA 3H7IA 1ZQVA 4JV0A 5DB9A 4KLJA 3OVSA 3ETLA 4F5RA 7ICHA 3NGDA 4O3PA 3MR3A 4E7XA 3C18A 3MFIA 5DGAA 1S0VA 4WCWA 4E8FA 2F1JA 3EPIA 2V4QA 2HVHA 5HC9A 1ZQUA 2KFNA 7ICFA 4QZ9A 2ZH8A 7ICRA 1X2IA 2RDJA 3UQ2A 2FMQA 2HHVA 4R64A 4MFAA 1NK6A 3BQ1A 4YMNA 4C8MA 1MIYA 3TAQA 4RNMA 2MUTB 3BDPA 1D9DA 1QTMA 2O5AA 4RWPA 4I2EA 4JUZA 4J9PA 1D8YA 2ISOA 5J2GA 3G6VA 4ED6A 4ED8A 5JUMA 4F92B 5BOMA 4J9MA 4ECQA 1N48A 7ICMA 4R66A 2XGQA 4ECSA 3TI0A 1C7YA 4UAZA 1XS9D 1CUKA 1U4BA 2DPJA 4M5DA 4YP3A 1T7PA 1XWLA 4O5KA 3B0XA 3E2EA 5DECA 2ZHAA 3PMNA 1SKSA 1SL2A 2ZTDA 3AUOA 3PW4A 4FO6A 4RQ6A 5HHHA 4DQQA 2VA3A 3RAQA 2JZBB 5J2AA 3NTUA 4FS1A 1TFWA 1SZPA 4Z6CA 4EZ9A 4RPZA 2ZUBA 2XC9A 2XY6A 5IINA 1L3TA 4KLSA 5KFWA 3OSPA 1S0OA 2MAXA 2DPIA 4GC7A 8ICGA 4P4PA 3ZD9A 5L1JA 3Q8KA 1TVAA 5KFGA 2ZHBA 1BPXA 4UAYA 3JPTA 8ICCA 4X0AA 5J0QA 3KHGA 4UB2A 4UQGA 4DOBA 1HUOA 9ICWA 2M2WA 1BPDA 4TUPA 2KZZA 4QWAA 1ZQEA 5KFAA 3OHBA 4KITB 4DL6A 1RXWA 3ZD8A 3ZDDA 2W9CB 3H39A 3MFHA 4IG8A 3EZ5A 4PGYA 2JZBA 1K1QA 5KT3A 5BPCA 4YN4A 2HHPA 4I2CA 1CEZA 4DQIA 3N97B 4DFKA 1HUZA 4WC3A 4F4KA 4IRKA 2HHUA 2BCQA 1UEVA 4YR2A 4R63A 3V6HA 8ICAA 4ECWA 2HHTA 3ORYA 2XCAA 3RBEA 5EWEA 3B0YA 8ICOA 5DEDA 1D8LA 4Q45A 3KHLA 1T4GA 1D9FA 4C8OA 3HJ4A 1ZQMA 4HYKA 3QE9Y 3AU6A 2W9CA 5HRLA 5KFEA 4X4RA 2AGOA 4RUCA 7ICUA 4C8KA 5EWGA 1TFRA 4X4PA 4M9LA 1SL1A 4ATBA 3PW5A 4B9NA 4WBYA 5DGBA 2FMSA 4KLOA 5DBCA 4X5VA 4EBKA 1U9LA 3RJJA 4AT8A 3OV7A 3TARA 3UXNA 3TQ1A 3Q8QB 3FYHA 5J0XA 3SV4A 4WC5A 4Q8EA 1DGSA 3LK9A 5CB1A 5DLGA 5J0SA 2ZUDA 4XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F9L A;  3BQ2 A;  2Q66 A;  4IQV A;  4RQ4 A;  1NKE A;  3GQC A;  3HT3 A;  1ZQS A;  2R8I A;  4UB3 A;  1ZQN A;  1ZQR A;  9ICH A;  1JQR A;  4K4G A;  4F2S A;  2FLP A;  2BDP A;  1ZQT A;  3UPS A;  2V9W A;  2H5X A;  4RWQ A;  1R8B A;  3JPN A;  1Q78 A;  3QEB Z;  4E80 A;  4B9T A;  4WC2 A;  4DOA A;  3C2K A;  3GV7 B;  4ED7 A;  1L3U A;  9ICM A;  4UD5 A;  4XQ7 A;  5F9N A;  4BDP A;  4Z6D A;  2I9G A;  3RRH A;  1S0M A;  4X4N A;  3JPR A;  4FHW A;  2ZTE A;  9ICT A;  4AT9 B;  4XRH A;  3SZ2 A;  4I2G A;  4UB5 A;  1KFS A;  4UB1 A;  5KFM A;  4EYI B;  4ED1 A;  1IXR A;  1ZQA A;  4DSI A;  8ICN A;  1KNY A;  5KG0 A;  3M9O B;  2ZH7 A;  4F4X A;  2PFO A;  4IRC A;  5HML A;  4LVS A;  2DR8 A;  5KFL A;  4RWN A;  5L1L A;  3PO5 A;  2AQ4 A;  1MQ2 A;  3Q8P B;  3GV8 B;  2FPM A;  3THV A;  5KFV A;  4KLF A;  4NM2 A;  4MF8 A;  3RJF A;  2A1J A;  7ICN A;  3T3F A;  9ICR A;  4Q8F A;  4RQ3 A;  4QWC A;  1KRP A;  1BNO A;  1VJ7 A;  4YD2 A;  3K75 D;  4WBZ A;  4AT9 A;  9ICJ A;  1L3S A;  5CJ7 A;  2ASJ A;  1ARO P;  1HJP A;  3K4G A;  2BGW A;  4GXI A;  2IHM A;  3GIL A;  2JEG A;  4PGX A;  3AQM A;  4JV2 A;  1IM4 A;  5KG6 A;  1KFT A;  1BPB A;  2ATL A;  4F4W A;  2ISP A;  3LDA A;  2BE3 A;  9ICE A;  2KTQ A;  4BWJ A;  3GFK B;  4F2R A;  3RB4 A;  8ICE A;  3C23 A;  1TAU A;  1T3N A;  9ICB A;  1V4A A;  3JPS A;  1ZJM A;  3T5J A;  1RYR A;  3JYY A;  1OU5 A;  5KFB A;  4RPX A;  2ZJ5 A;  1SKR A;  3M8S A;  1MSW D;  4FHY A;  5EOZ A;  4EBD A;  4NLG A;  3GIM A;  2Y1J A;  4DSK A;  4YMO A;  3OHA A;  3QEA Z;  4KLL A;  8ICW A;  5DB6 A;  4PHD A;  4NLK A;  2HHW A;  3V7J A;  5L1I A;  4Q43 A;  8ICV A;  4BWM A;  3QZ7 A;  2PBE A;  4RQ1 A;  3ZDA A;  1U45 A;  9ICC A;  4R65 A;  2KZ3 A;  3LWM A;  5HRB A;  5J2B A;  4KLI A;  5HRG A;  2B21 A;  2DR7 A;  2HW3 A;  4BXO B;  2ZH1 A;  4KLD A;  4QZA A;  4ECR A;  2V4R A;  5KT2 A;  5CA7 A;  4DSE A;  4DLE A;  1NZP A;  3LQC B;  5J0O A;  4QZI A;  2C2R A;  4ED3 A;  4JV1 A;  1LV5 A;  3WFR E;  1XU4 A;  3MR2 A;  3UQ0 A;  1SKW A;  1ZQC A;  2PFQ A;  5HP4 A;  3RJE A;  5J2D A;  3T5L A;  1ZQQ A;  5J0W A;  4RT3 A;  1WCN A;  5CR0 A;  3MGI A;  4GLX A;  7ICK A;  7ICV A;  1S77 D;  4JK1 A;  2ALZ A;  2R8G A;  3C5G A;  1ZQO A;  4K4I A;  2DRA A;  4NKU A;  2MUT A;  3MDC A;  3SYZ A;  4I2A A;  5KG1 A;  3PO4 A;  2NRV A;  5DB7 A;  2PXI A;  4BXO A;  4C8L A;  1B22 A;  1EXN A;  4ECY A;  1S0N A;  8ICM A;  1TK8 A;  1SL0 A;  7ICP A;  4ELU A;  4ED0 A;  2BQR A;  5KT5 A;  3HWT A;  1QSS A;  2GWS A;  9ICA A;  4DSF A;  8ICT A;  2XO7 A;  2M2T A;  5KG4 A;  4FHV A;  1DOQ A;  4YR0 A;  1MIV A;  1R89 A;  5HHI A;  2I1Q A;  4QZB A;  1NK5 A;  1ZQJ A;  7ICO A;  4M04 A;  2M2U A;  2VA2 A;  3KTQ A;  2BPF A;  4RUA A;  4F8R A;  1JXL A;  1JIH A;  1TFY A;  1TK0 A;  1RYS A;  4ECU A;  2IBK A;  7ICG A;  4IR1 A;  4F5Q A;  5DG8 A;  3GIK A;  4RU9 A;  1KDH A;  3M8R A;  4F50 A;  3RJG A;  5C5J A;  4MFC A;  1ZQZ A;  5DLF A;  2AGP A;  3ISD A;  1XC9 A;  7ICS A;  9ICG A;  5KFK A;  3TFR A;  4KLQ A;  4YD1 A;  4DL2 A;  1NK9 A;  2XCP A;  4FS2 A;  9ICO A;  5F2V O;  2P66 A;  5KG2 A;  4MEX A;  4KTQ A;  1F5A A;  4YVZ A;  4XQ8 A;  4PPX A;  3RH5 A;  2M9N A;  4GC6 A;  4B9S A;  4MFF A;  1UT5 A;  5KFO A;  3V72 A;  3AU2 A;  4WC1 A;  3H8J A;  1ZYQ A;  4YCX A;  4QZ8 A;  1NK7 A;  3KHH A;  5KFD A;  2J6T A;  4B9U A;  4ELT A;  1ZQP A;  3JPO A;  3ZDB A;  3NYB A;  4AT7 B;  4J9K A;  3RB6 A;  4KLT A;  4QWB A;  1NJY A;  3IM1 A;  2F1H A;  5J2C A;  7ICE A;  3SV3 A;  3MGH A;  1X9S A;  1L3V A;  1ZJN A;  2BCU A;  5IIK A;  8ICH A;  4S3N A;  4F4Y A;  2UVU A;  1BPY A;  5KFR A;  4RNO A;  3H37 A;  2DVI A;  4I2J A;  1ZQX A;  2XGP A;  8ICY A;  4FHX A;  8ICF A;  4F91 B;  2XY7 A;  5KFJ A;  4GXK A;  2IMW P;  1Y88 A;  1ZQG A;  4RWO A;  4J9Q A;  4NXZ A;  1NK8 A;  2RFF A;  3WFQ E;  3HPO A;  3H40 A;  2ZH2 A;  1ZQY A;  9ICF A;  4EBC A;  3RBD A;  7ICI A;  5KFH A;  4M9J A;  5DQH A;  3HW8 A;  2DR5 A;  4AT7 A;  1U47 A;  1TV9 A;  1BPZ A;  5TZV A;  1KTQ A;  2PI5 A;  5J29 A;  2ZJ8 A;  4RQ5 A;  4KMU A;  1UA1 A;  5J0Y A;  4TUQ A;  4ECV A;  2C2E A;  2JEF A;  4M9G A;  5KFX A;  4M9H A;  3PX4 A;  1Q79 A;  1ZQI A;  4Z6F A;  5KFT A;  2HHX A;  1K1S A;  8ICJ A;  3MDA A;  1NJX A;  3RJK A;  4ZH4 A;  1NK0 A;  3L9D A;  3TAN A;  2P6R A;  4X4S A;  1VFG A;  4RT2 A;  3SI8 A;  4WC0 A;  5IIJ A;  4EYH B;  2FPK A;  2JEJ A;  3Q8R B;  5J2E A;  3PY8 A;  1NJW A;  2ZJA A;  1H38 A;  5IIM A;  1PX5 A;  5KFZ A;  2DR9 A;  4PHA A;  4M9N A;  9ICQ A;  3RR8 A;  5HMM A;  4YXJ A;  5KTQ A;  4PGQ A;  2BQ3 A;  3RH4 A;  3ZDC A;  2NRX A;  4QWE A;  8ICB A;  2BHN A;  5J0U A;  3C2M A;  2W8L A;  3T5K A;  4TUS A;  3PX6 A;  2J6U A;  3H38 A;  4X4Q A;  9ICP A;  2W9A A;  5HRI A;  3HIY A;  4B9L A;  3V6J A;  2NRK A;  5DKW A;  5KFY A;  1BGX T;  4EP7 A;  2R8K A;  1JMS A;  3PR5 B;  4F5N A;  1WOT A;  4KN7 A;  5IIO A;  4ELV A;  4YG2 A;  3RJH A;  5KG7 A;  2ZUC A;  1NOM A;  4O3O A;  2KN7 A;  3MR6 A;  4X0B A;  3AQN A;  1U49 A;  4YXM A;  4EBJ A;  4I2D A;  3IHQ B;  4FHP A;  4F5O A;  3FDS A;  8ICR A;  3WFS C;  1JX4 A;  5DBB A;  4ECX A;  4WC4 A;  2Q0Z X;  4YFK A;  3Q8M A;  1KLN A;  4DQP A;  5J0R A;  4DEZ A;  4GXJ A;  2Y1I A;  2M2V A;  4DL3 A;  4FH5 A;  5KT7 A;  4MF2 A;  3GII A;  3V6K A;  4JWM A;  3JPQ A;  4J9O A;  4IQT A;  4IRD A;  1MIW A;  4ED2 A;  1UA0 A;  4I2B A;  8ICI A;  3H8W A;  5HRE A;  5DDY A;  9ICI A;  4O9M A;  3OUY B;  3PML A;  1KEJ A;  5KFP A;  5HRK A;  3M9N B;  1TAQ A;  1QSY A;  3C2L A;  1YLQ A;  4LZD A;  1RZT A;  8ICK A;  3UXP A;  3PV8 A;  2BPC A;  4DWI A;  4PHP A;  5D46 A;  1ZET A;  4XUS A;  2O1P A;  4F3O A;  2PI4 A;  1NK4 A;  4TQR A;  5J2I A;  2F1I A;  4LZG A;  2IHN A;  1R8A A;  4J9N A;  4Z6E A;  2BR0 A;  3N4M B;  3ZDE A;  1NKB A;  4DSJ A;  5CWR A;  1Z00 B;  4I28 A;  2BPG A;  3OJU A;  1QLN A;  9ICU A;  4YQW A;  3GIJ A;  4J9S A;  3BJY A;  4DFJ A;  5KFS A;  5IIL A;  1X9M A;  2BCS A;  3OUY A;  9ICS A;  4R8U B;  3C1Y A;  5J2J A;  2KFZ A;  2LYH A;  4IQU A;  5III A;  3H4B A;  9ICL A;  3G6X A;  4DL5 A;  1S97 A;  4EZ6 A;  4J9L A;  5EWF A;  2UVV A;  4G3I A;  4DF8 A;  3PVX A;  1ZQD A;  1PZN A;  3PNC A;  5KT4 A;  5HNK A;  7ICJ A;  3AQL A;  3HJ1 A;  4I29 A;  9ICK A;  3C5F A;  1LB2 B;  4I2I A;  4FBU A;  5KFQ A;  3G6Y A;  1L5U A;  2AJQ A;  2RDI A;  5J2F A;  2UVR A;  4M2Y A;  2KZM A;  1RPL A;  1JN3 A;  3RB3 A;  8ICP A;  1Z00 A;  2DRB A;  7ICQ A;  1NKC A;  5J0T A;  4B9V A;  2ASL A;  4K4H A;  7ICL A;  3ISB A;  1N56 A;  2VAN A;  4KLM A;  8ICS A;  3UPQ A;  4DFM A;  5KFF A;  4R8U A;  3RJI A;  2ASD A;  5DB8 A;  1UEU A;  3T5H A;  1ZQK A;  2FMP A;  2FLL A;  2HHS A;  4O3S A;  2UVW A;  3AQK A;  3V7K A;  3PW7 A;  2NRZ A;  3UXO A;  4EBE A;  3C1Z A;  5DG7 A;  2PFP A;  4O3R A;  1UT8 A;  4RQ2 A;  5KFU A;  4NLZ A;  4O3Q A;  3MBY A;  8ICU A;  1MC8 A;  3LWL A;  1BVS A;  3EWA A;  4RQ8 A;  3EPG A;  1S9F A;  4O0I A;  5D49 A;  2W8K A;  3H4D A;  4DL4 A;  3TAP A;  1QSL A;  4IQW A;  4X4V A;  5KG3 A;  2AU0 A;  2HHQ A;  4FH3 A;  1T8E A;  1NO5 A;  4DO9 A;  3V7L A;  2PFN A;  4WC7 A;  2C22 A;  5HR9 A;  4UD4 A;  4X4O A;  3WFP A;  4RQ0 A;  5DQG A;  4M47 A;  1B43 A;  5DDM A;  4DSL A;  5KFC A;  3RH6 A;  1ZQF A;  7ICT A;  2NRT A;  8ICX A;  3PR4 A;  5HRH A;  2KP7 A;  5CHG A;  2HVI A;  1A77 A;  5DQI A;  4QZH A;  4ATB B;  2NRW A;  4RQ7 A;  5L1K A;  3MAB A;  5D4B A;  4I2F A;  3RR7 A;  2XY5 A;  3PX0 A;  4AT8 B;  4QZC A;  4UBB A;  1COO A;  3BQ0 A;  4FBT A;  4DS4 A;  1S76 D;  4O3N A;  3OJS A;  2R8H A;  5DBA A;  3C21 A;  3OGU A;  4KLH A;  9ICX A;  2BKE A;  4P4M A;  4DS5 A;  3TFS A;  4EEY A;  1RXV A;  4E0D A;  5J0P A;  1BPE A;  1KSP A;  2AQ0 A;  4QZD A;  3RRG A;  1A76 A;  1NJZ A;  4WC6 A;  8ICL A;  2BCV A;  2DFL A;  4TQS A;  5KFI A;  4P2H A;  1BNP A;  4MEY A;  2VA8 A;  1DK3 A;  4NLN A;  4DFP A;  4BGD A;  4KLE A;  1X9W A;  3HX0 A;  1JAJ A;  4DQS A;  4IR9 A;  4I2H A;  3C66 A;  4F5P A;  2C2D A;  1JXE A;  4Q44 A;  4KLG A;  1R8C A;  2JEI A;  3GDX A;  4YR3 A;  5CP2 A;  5J2K A;  2WTF A;  3M9M B;  4CCH A;  2ID1 A;  3RAX A;  4RZR A;  1KFD A;  4QW9 A;  4F93 B;  4DQR A;  5HRD A;  3OVB A;  1XSN A;  4DF4 A;  4M6W B;  4O5E A;  3WFO A;  4X4U A;  4B9M A;  9ICV A;  4PH5 A;  1Z3E B;  5DG9 A;  5KT6 A;  1XSL A;  1ZQH A;  2BCR A;  4X4T A;  4QZG A;  4DL7 A;  4ECT A;  2FPL A;  1S10 A;  5L9X A;  4JWN A;  4DLG A;  1WCL A;  4LT6 A;  2IA6 A;  2A1J B;  3ISC A;  3RB0 A;  2ZTC A;  4C8N A;  3EYZ A;  2BQU A;  3MR5 A;  2FLN A;  8ICQ A;  4NM1 A;  2ZH3 A;  3JZ0 A;  4J9R A;  2ZH6 A;  2ZH4 A;  2P6U A;  4YMM A;  1U48 A;  4NKT A;  4KN4 A;  1DK2 A;  4M6W A;  4UBC A;  1UET A;  3OVA A;  1ZQW A;  4F4Z A;  4QZF A;  1ZQL A;  5KFN A;  3H3A A;  3EW9 A;  1V9P A;  4UAW A;  3Q8L A;  1XO1 A;  1ZQB A;  5HRF A;  4NY8 A;  4RPY A;  3HP6 A;  2W9B B;  4M0A A;  3JPP A;  3PW0 A;  2ZH5 A;  4I27 A;  2ZH9 A;  4QZE A;  4QWD A;  1MQ3 A;  8ICZ A;  3PW2 A;  3GV5 B;  3RTV A;  4PHE A;  3H8S A;  4RNN A;  4ECZ A;  1XSP A;  5KG5 A;  4QW8 A;  3BQT A;  1TKD A;  4O5C A;  2AGQ A;  2C28 A;  2R8J A;  4KLU A;  9ICN A;  1FA0 A;  4P4O A;  5J2H A;  4UB4 A;  3OSN A;  3KHR A;  2W9B A;  4TUR A;  2J6S A;  3QZ8 A;  5BOL A;  4DOC A;  3Q8S B;  1TK5 A;  2OWO A;  2W9M A;  3H7I A;  1ZQV A;  4JV0 A;  5DB9 A;  4KLJ A;  3OVS A;  3ETL A;  4F5R A;  7ICH A;  3NGD A;  4O3P A;  3MR3 A;  4E7X A;  3C18 A;  3MFI A;  5DGA A;  1S0V A;  4WCW A;  4E8F A;  2F1J A;  3EPI A;  2V4Q A;  2HVH A;  5HC9 A;  1ZQU A;  2KFN A;  7ICF A;  4QZ9 A;  2ZH8 A;  7ICR A;  1X2I A;  2RDJ A;  3UQ2 A;  2FMQ A;  2HHV A;  4R64 A;  4MFA A;  1NK6 A;  3BQ1 A;  4YMN A;  4C8M A;  1MIY A;  3TAQ A;  4RNM A;  2MUT B;  3BDP A;  1D9D A;  1QTM A;  2O5A A;  4RWP A;  4I2E A;  4JUZ A;  4J9P A;  1D8Y A;  2ISO A;  5J2G A;  3G6V A;  4ED6 A;  4ED8 A;  5JUM A;  4F92 B;  5BOM A;  4J9M A;  4ECQ A;  1N48 A;  7ICM A;  4R66 A;  2XGQ A;  4ECS A;  3TI0 A;  1C7Y A;  4UAZ A;  1XS9 D;  1CUK A;  1U4B A;  2DPJ A;  4M5D A;  4YP3 A;  1T7P A;  1XWL A;  4O5K A;  3B0X A;  3E2E A;  5DEC A;  2ZHA A;  3PMN A;  1SKS A;  1SL2 A;  2ZTD A;  3AUO A;  3PW4 A;  4FO6 A;  4RQ6 A;  5HHH A;  4DQQ A;  2VA3 A;  3RAQ A;  2JZB B;  5J2A A;  3NTU A;  4FS1 A;  1TFW A;  1SZP A;  4Z6C A;  4EZ9 A;  4RPZ A;  2ZUB A;  2XC9 A;  2XY6 A;  5IIN A;  1L3T A;  4KLS A;  5KFW A;  3OSP A;  1S0O A;  2MAX A;  2DPI A;  4GC7 A;  8ICG A;  4P4P A;  3ZD9 A;  5L1J A;  3Q8K A;  1TVA A;  5KFG A;  2ZHB A;  1BPX A;  4UAY A;  3JPT A;  8ICC A;  4X0A A;  5J0Q A;  3KHG A;  4UB2 A;  4UQG A;  4DOB A;  1HUO A;  9ICW A;  2M2W A;  1BPD A;  4TUP A;  2KZZ A;  4QWA A;  1ZQE A;  5KFA A;  3OHB A;  4KIT B;  4DL6 A;  1RXW A;  3ZD8 A;  3ZDD A;  2W9C B;  3H39 A;  3MFH A;  4IG8 A;  3EZ5 A;  4PGY A;  2JZB A;  1K1Q A;  5KT3 A;  5BPC A;  4YN4 A;  2HHP A;  4I2C A;  1CEZ A;  4DQI A;  3N97 B;  4DFK A;  1HUZ A;  4WC3 A;  4F4K A;  4IRK A;  2HHU A;  2BCQ A;  1UEV A;  4YR2 A;  4R63 A;  3V6H A;  8ICA A;  4ECW A;  2HHT A;  3ORY A;  2XCA A;  3RBE A;  5EWE A;  3B0Y A;  8ICO A;  5DED A;  1D8L A;  4Q45 A;  3KHL A;  1T4G A;  1D9F A;  4C8O A;  3HJ4 A;  1ZQM A;  4HYK A;  3QE9 Y;  3AU6 A;  2W9C A;  5HRL A;  5KFE A;  4X4R A;  2AGO A;  4RUC A;  7ICU A;  4C8K A;  5EWG A;  1TFR A;  4X4P A;  4M9L A;  1SL1 A;  4ATB A;  3PW5 A;  4B9N A;  4WBY A;  5DGB A;  2FMS A;  4KLO A;  5DBC A;  4X5V A;  4EBK A;  1U9L A;  3RJJ A;  4AT8 A;  3OV7 A;  3TAR A;  3UXN A;  3TQ1 A;  3Q8Q B;  3FYH A;  5J0X A;  3SV4 A;  4WC5 A;  4Q8E A;  1DGS A;  3LK9 A;  5CB1 A;  5DLG A;  5J0S A;  2ZUD A;  4XA5 A; 
#chains in the Genus database with same CATH topology
 5F9L A;  4RQ4 A;  1ZQS A;  1ZQN A;  9ICH A;  1ZQT A;  3UPS A;  5AKL A;  1L8O A;  3QEB Z;  4DOA A;  2I9G A;  1S0M A;  2ZIU A;  4EYI B;  5KFM A;  4ED1 A;  8ICN A;  5KG0 A;  2P35 A;  4LVS A;  2F77 X;  3PO5 A;  1JUD A;  2ZG6 A;  2AQ4 A;  1MQ2 A;  4K99 A;  2FPM A;  3UMC A;  5KFV A;  4KLF A;  3E58 A;  2A1J A;  4LEZ A;  4YD2 A;  4CF3 A;  9ICJ A;  2WF7 A;  5CJ7 A;  5AKK A;  2H3V A;  3K4G A;  5D62 A;  4GXI A;  2IHM A;  3F2D A;  1BPB A;  2ISP A;  4F4W A;  2Q4T A;  4UAT A;  2KTQ A;  4BWJ A;  3GFK B;  2YQE A;  1T3N A;  9ICB A;  1V4A A;  3JPS A;  1OU5 A;  3M8S A;  1MSW D;  2Y1J A;  2W3R A;  5CHE A;  2F3N A;  8ICV A;  3QZ7 A;  3ZDA A;  5J2B A;  5HRG A;  4ECR A;  2YMQ A;  5KT2 A;  4WQL A;  1NZP A;  5J0O A;  3SAF A;  3WFR E;  3MR2 A;  3UQ0 A;  2PFQ A;  1KKX A;  2GAF D;  4RT3 A;  4GLX A;  1S77 D;  2XID A;  4Y2T A;  3NRZ A;  5DB7 A;  4C8L A;  1S8O A;  1M6Y A;  3KD3 A;  1EXN A;  8ICM A;  5AK6 A;  1ZOL A;  4CNQ A;  1SL0 A;  2OEH A;  2EAP A;  4K8V A;  4DCC A;  1UHU A;  5ALV A;  1R89 A;  3U26 A;  5ALS A;  2BPF A;  1TK0 A;  5DG8 A;  3C29 A;  1KDH A;  4FZM A;  4MFC A;  2D6F C;  9ICG A;  5KFK A;  4KLQ A;  2XVT A;  1NK9 A;  2XCP A;  3UMB A;  4KTQ A;  3NVO A;  4GC6 A;  4B9S A;  3AU2 A;  2KK0 A;  1ZYQ A;  4B9U A;  1NK7 A;  3KHH A;  3NYB A;  4AT7 B;  4LJX A;  4KLT A;  7ICE A;  2KHQ A;  4K98 A;  4S3N A;  5KFR A;  2DVI A;  1JRO A;  3F5E A;  1Y88 A;  2RFF A;  3H40 A;  9ICF A;  2DR5 A;  1BPZ A;  3QU5 A;  5J29 A;  5ALN A;  4Y2J A;  2G08 A;  3QU9 A;  4ECV A;  2DGZ A;  1RQN A;  2C2E A;  2JEF A;  1F0M A;  2MU2 A;  2Y9T A;  3PX4 A;  2KKP A;  1ZQI A;  1K1S A;  5AM2 A;  3SQI A;  4FFD A;  1NK0 A;  3TAN A;  4RT2 A;  2NYV A;  4WC0 A;  5J2E A;  2EQY A;  2DR9 A;  4FZL A;  5AM3 A;  9ICQ A;  3RF9 A;  5HMM A;  2Y0S C;  3CNH A;  4QWE A;  2W3S A;  2J6U A;  2DL0 A;  2B56 A;  1IG6 A;  3I28 A;  4B9L A;  2NRK A;  5DKW A;  5KFY A;  4EP7 A;  4F5N A;  2OH2 A;  4KN7 A;  5IIO A;  1ZD3 A;  5KG7 A;  2KN7 A;  3WK9 A;  5KNI A;  4I2D A;  5DBB A;  4DQP A;  5J0R A;  4DEZ A;  2Y1I A;  3L5K A;  4CF5 A;  2Y0S F;  3V6K A;  4JWM A;  4IRD A;  4ED2 A;  2HSZ A;  3H8W A;  5HRE A;  3OUY B;  2ZIV A;  1SXD A;  5AI8 A;  3M9N B;  1TAQ A;  4LZD A;  4CE6 A;  4F3O A;  1UCV A;  4J9N A;  2BR0 A;  4I28 A;  2BPG A;  3OJU A;  4J9S A;  5KFS A;  5IIL A;  4BUG A;  3OTQ A;  9ICS A;  2KFZ A;  4IQU A;  5III A;  4DL5 A;  2VKQ A;  5EWF A;  8ICT A;  4QIW C;  1ZQD A;  2K4E A;  3M6Z A;  5HNK A;  3HRD D;  4I29 A;  5J2F A;  4IC9 A;  1RPL A;  2GO7 A;  3SD7 A;  5J0T A;  2KD1 A;  3ISB A;  2VAN A;  4DFM A;  3RJI A;  4OO1 J;  2D8C A;  3T5H A;  2HOF A;  2FMP A;  4IL6 U;  3AQK A;  3V7K A;  3PW7 A;  2NRZ A;  5DG7 A;  4O3R A;  5KFU A;  8ICU A;  4K9A A;  1BVS A;  4QIW F;  1S9F A;  4O0I A;  3H4D A;  1Z4N A;  1QSL A;  5KG3 A;  4FH3 A;  3V7L A;  3O0F A;  3IN5 A;  4X4O A;  4F72 A;  3BS5 A;  2HDO A;  1IIP A;  1B43 A;  1ZQF A;  1A77 A;  5DQI A;  5AM4 A;  2NRW A;  4RQ7 A;  1Z1B A;  3MAB A;  5AM5 A;  3SEN A;  4AT8 B;  3GZF A;  1COO A;  3BQ0 A;  1S76 D;  2QAR B;  3NVY A;  2G07 A;  2BKE A;  4P4M A;  4NM1 A;  5J0P A;  4QZD A;  5T14 A;  8ICL A;  4TQS A;  4MEY A;  5G5G A;  3HX0 A;  1JAJ A;  4IR9 A;  4I2H A;  4Y2P A;  3MGV A;  2C2D A;  3M9M B;  2ID1 A;  3OVB A;  4RZR A;  1KFD A;  1XSN A;  4M6W B;  1XO0 A;  2K4P A;  1MA7 A;  1ZQH A;  4NXV A;  1S10 A;  4BX9 C;  4JWN A;  4LT6 A;  3RB0 A;  5AKI A;  5A0L A;  2JH1 A;  3MR5 A;  8ICQ A;  1DK2 A;  3UMG A;  1UET A;  3OWG A;  1TE2 A;  4UAW A;  2E1F A;  5JU5 A;  4M0A A;  3PW0 A;  2ZH5 A;  2ZH9 A;  4QZE A;  4QWD A;  3GV5 B;  3RTV A;  4ECZ A;  1XSP A;  2RLT A;  2YMP A;  3LVW A;  3BQT A;  4O5C A;  3KBB A;  2C28 A;  4KLU A;  5CFT A;  2KIW A;  3FM9 A;  4UB4 A;  3OSN A;  2W9B A;  4EV6 A;  4TUR A;  4KLJ A;  2W9M A;  3ETL A;  2DF4 B;  4O3P A;  5DGA A;  4WCW A;  2HVH A;  2G09 A;  7ICF A;  1X2I A;  4R64 A;  1MIY A;  4CF4 A;  4CRX A;  4JUZ A;  1FO4 A;  4NLC A;  2FDR A;  4ED8 A;  5JUM A;  4J9M A;  4ECQ A;  1C7Y A;  4UAZ A;  1FFU A;  2WHE A;  4O5K A;  2ZTD A;  5HHH A;  2B0C A;  2JZB B;  1X6I A;  1X9X A;  1V97 A;  2ZUB A;  3OSP A;  1S0O A;  1BPX A;  1WG8 A;  1X6J A;  2W55 A;  4X0A A;  4DOB A;  2LHT A;  2A3V A;  1PK3 A;  4QWA A;  4KIT B;  3H0R B;  3ZD8 A;  2YX8 A;  1N62 A;  1K1Q A;  4GIB A;  2HHP A;  3SAH A;  3KKA C;  4J03 A;  3TAD C;  1LKY B;  4F4K A;  2DBY A;  2G5H B;  3RBE A;  2BZF A;  3KHL A;  4OJ5 A;  4Q45 A;  2KV2 A;  2DQN B;  1ZQM A;  3QE9 Y;  1CI4 A;  2W9C A;  3AU6 A;  2MSN A;  4C8K A;  3FAH A;  1TFR A;  3VC8 A;  4EEN A;  4M9L A;  4Y2X A;  4ATB A;  3PW5 A;  4WBY A;  1YZ7 A;  4KLO A;  5DBC A;  4X5V A;  4EBK A;  1U9L A;  1SV4 A;  3Q8Q B;  1DGS A;  5CB1 A;  1S5L U;  5ALH A;  2AQ0 A;  1NKE A;  2F2A B;  3GQC A;  3HT3 A;  2R8I A;  2G06 A;  3SAG A;  2FLP A;  4E80 A;  2A19 A;  1KQQ A;  1R8B A;  3JPN A;  1N63 A;  2H3Z A;  2ODG A;  3GV7 B;  3BZK A;  9ICM A;  4UD5 A;  3PZP A;  4XQ7 A;  4BDP A;  3RRH A;  4FHW A;  4AT9 B;  4XRH A;  5AI5 A;  4UB1 A;  4DSI A;  2HN1 A;  4O69 A;  3M9O B;  3ONN A;  2PFO A;  4IRC A;  5KFL A;  4CDG A;  3Q8P B;  2KG5 A;  5ALL A;  2PMZ C;  1BNO A;  5AIC A;  1VJ7 A;  1KBU A;  2HCF A;  3AQM A;  5K4L A;  1KFT A;  4A8E A;  2JR5 A;  3K7D A;  3KZX A;  3WK5 A;  8ICE A;  1L7N A;  5AHX A;  2KEY A;  1ZJM A;  2LM4 A;  2ZJ5 A;  5CEH A;  2LYB A;  4EBD A;  4NLG A;  4YMO A;  5ALE A;  2PMZ F;  5CRX A;  8ICW A;  4NLK A;  2PBE A;  4Q43 A;  2CXY A;  5ALJ A;  4BWM A;  4R65 A;  3N7S C;  2DR7 A;  4KLD A;  5AI6 A;  5CA7 A;  4DSE A;  3DDH A;  4DLE A;  3LQC B;  4QZI A;  1LV5 A;  1P7D A;  1ZQC A;  5HP4 A;  5J2D A;  1WCN A;  7ICK A;  4JK1 A;  5EE1 A;  2ALZ A;  3SMV A;  4K4I A;  2DRA A;  4I2A A;  4NJ8 A;  5KG1 A;  1RM6 C;  4XJE A;  2NRV A;  3K1R B;  3N7P D;  1KL9 A;  2WAQ C;  4ELU A;  1ZD4 A;  4ZOH C;  3WU2 U;  9ICA A;  4DSF A;  5KG4 A;  4FHV A;  1MIV A;  2KIC A;  4QZB A;  2M2U A;  4M04 A;  2VA2 A;  4RUA A;  1TFY A;  1QQ7 A;  1O08 A;  4ECU A;  4F5Q A;  4F50 A;  5C5J A;  1XC9 A;  7ICS A;  1T94 A;  4K97 A;  4DL2 A;  2WAQ F;  4RQN A;  1F5A A;  3RH5 A;  4MFF A;  1UT5 A;  3V72 A;  4YCX A;  3NS1 A;  1PVQ A;  3RB6 A;  3N28 A;  4P0P A;  3MGH A;  2BCU A;  1OXJ A;  4F4Y A;  3C28 A;  4I2J A;  2XGP A;  4C4R A;  8ICF A;  2KVS A;  2XY7 A;  4GXK A;  1Q3U A;  4J9Q A;  1NK8 A;  3WFQ E;  4OAH A;  1SWW A;  1ZQY A;  4EBC A;  3RBD A;  7ICI A;  4M9J A;  3HW8 A;  4AT7 A;  1U47 A;  1TV9 A;  2WF9 A;  4KM5 A;  4GFJ A;  2PI5 A;  2ZJ8 A;  4KMU A;  2HBJ A;  4EED A;  1V38 A;  2NV3 A;  4X4S A;  2FPK A;  4Y2U A;  3PY8 A;  2YML A;  2ZJA A;  1H38 A;  1PX5 A;  3M7D A;  1HIW A;  4PGQ A;  4B6J A;  8ICB A;  5J0U A;  5GTH U;  3PX6 A;  9ICP A;  3HIY A;  3AQF A;  1BGX T;  1JMS A;  4X0B A;  3MR6 A;  4YXM A;  3LVV A;  3IHQ B;  4F5O A;  3FDS A;  8ICR A;  1JX4 A;  1T3Q A;  4WC4 A;  4YFK A;  1KLN A;  4GXJ A;  1Z1V A;  4DL3 A;  4BJQ A;  1MIW A;  2D3D A;  3D2S A;  1PK1 B;  4I2B A;  8ICI A;  5DDY A;  5HRK A;  1YLQ A;  3C2L A;  1ZRM A;  2L5Y A;  3UXP A;  3I1Y A;  3PV8 A;  1ZET A;  4TQR A;  5GTI U;  3ZDE A;  1Z00 B;  2FJ6 A;  9ICU A;  4YQW A;  2CN1 A;  3OUY A;  4R8U B;  3C1Y A;  5J2J A;  5EE9 A;  2W11 A;  3H4B A;  5ALU A;  9ICL A;  1S97 A;  2UVV A;  2ZXH A;  2IOH A;  3HJ1 A;  2Y9U A;  7ICJ A;  1X40 A;  4OD0 A;  9ICK A;  3C5F A;  5KFQ A;  2AJQ A;  2KSO B;  4EEB A;  3NWI A;  2DRB A;  1JN3 A;  3RB3 A;  7ICQ A;  4K4H A;  7ICL A;  1WYG A;  4KLM A;  3WK6 A;  3EF2 A;  3EUB 2;  1SIJ A;  2FLL A;  2UVW A;  2B6G A;  4EBE A;  1L7O A;  4RQ2 A;  5CFS A;  4KB6 A;  1IV8 A;  3EPG A;  3EWA A;  3ER9 B;  4Y2V A;  2W8K A;  4IQW A;  4P0Q B;  5AKJ A;  2AU0 A;  4O68 A;  1NO5 A;  2C22 A;  5HR7 A;  1F44 A;  2VJ4 A;  8ICX A;  2NRT A;  3PR4 A;  2KP7 A;  2JHD A;  2XY5 A;  2I5H A;  4UBB A;  4DS4 A;  2R8H A;  5DBA A;  9ICX A;  1RDF A;  1ZRN A;  1A76 A;  4US8 A;  1DK3 A;  2VA8 A;  4DFP A;  4EX6 A;  4EX7 A;  4JLX A;  5B3Q A;  1JXE A;  1L7M A;  5KL8 B;  2JEI A;  4YR3 A;  1WUD A;  4OCZ A;  5CP2 A;  4CCH A;  2YN4 A;  1SB3 C;  4DQR A;  4DF4 A;  3WFO A;  4X4U A;  5AK4 A;  5ALR A;  1Z3E B;  5KT6 A;  1SV0 A;  4DLG A;  5CFU A;  1A0P A;  2A1J B;  2ZTC A;  2K4I A;  2LM1 A;  3EYZ A;  2BQU A;  5ALG A;  3JZ0 A;  2P6U A;  3SR6 A;  4KN4 A;  4M6W A;  3OVA A;  1ZQW A;  1VDV A;  2KJ9 A;  4F4Z A;  4QZF A;  3Q8L A;  1XO1 A;  1ZQB A;  5HRF A;  1C20 A;  5AM0 A;  4NL9 C;  4RPY A;  2IHO A;  2E8P A;  2LKY A;  3WKD A;  2KJ8 A;  5HR6 A;  3HIL A;  2NO4 A;  2AH5 A;  2R8J A;  4P4O A;  3KHR A;  3AN1 A;  3QZ8 A;  3H7I A;  4JV0 A;  3AMZ A;  3H0M B;  4F5R A;  3MR3 A;  1QH9 A;  2F1J A;  1J97 A;  5EE0 A;  5HC9 A;  2RDJ A;  1NK6 A;  3BQ1 A;  1AQ6 A;  3TAQ A;  5EE3 A;  2ZXI A;  3BDP A;  4C4S A;  1QTM A;  2O5A A;  3GU3 A;  4J9P A;  1D8Y A;  5J2G A;  3G6V A;  4F92 B;  1V85 A;  2OYY A;  2XGQ A;  3WK7 A;  1CUK A;  1U4B A;  2DPJ A;  2Z7J A;  3B0X A;  5DEC A;  1SL2 A;  2YB1 A;  3AUO A;  2VA3 A;  2H3Q A;  1TFW A;  1SZP A;  4Z6C A;  3DEE A;  4LEW A;  8ICG A;  3ZD9 A;  3DV9 A;  1TVA A;  4UAY A;  3KHG A;  3NRW A;  9ICW A;  5KFA A;  1RXW A;  3KZI U;  5BPC A;  2JZB A;  4DQI A;  3N97 B;  2RP5 A;  4WC3 A;  4ACO A;  4IRK A;  2HHU A;  1D8B A;  3V6H A;  3CP8 A;  3ORY A;  5DED A;  1D8L A;  1D9F A;  3N7R C;  1T4G A;  4C8O A;  1PVR A;  4HYK A;  3M6K A;  1RQL A;  2GLE A;  2HN2 A;  3QU2 A;  5DGB A;  2FMS A;  4O6A A;  2F44 A;  3TAR A;  2HMX A;  3AL0 B;  3LK9 A;  3KFU F;  2K8A A;  3ETR A;  1SZH A;  1Z4O A;  5AI9 A;  4B9M A;  9ICV A;  2Q66 A;  1JQR A;  4K4G A;  1FIQ A;  1Q78 A;  4WC2 A;  4B9T A;  2W43 A;  1L3U A;  3D2N A;  2KVC A;  5F9N A;  2M0N A;  3JPR A;  2QKQ A;  4Y2Y A;  2JGA A;  3SZ2 A;  4I2G A;  4UB5 A;  1ZQA A;  1IXR A;  1KNY A;  3BS7 A;  1F5S A;  1MN8 A;  4F4X A;  2DR8 A;  2HBL A;  2CPR A;  5L1L A;  2F76 X;  3GV8 B;  4NM2 A;  4MF8 A;  3RJF A;  2EAO A;  5ALP A;  7ICN A;  3T3F A;  1TAM A;  5AKY A;  4Q8F A;  4RQ3 A;  1KRP A;  4NL9 A;  3R9K A;  3K75 D;  4WBZ A;  4AT9 A;  2ASJ A;  2BGW A;  1VLB A;  2JEG A;  2ATL A;  3LDA A;  2BE3 A;  3RB4 A;  3C23 A;  4KMO B;  1RYR A;  3QUQ A;  1JI7 A;  1SKR A;  4FHY A;  4DFD A;  3OHA A;  3QEA Z;  2MRL A;  5DB6 A;  2HOI A;  4PHD A;  2HHW A;  5ALK A;  4UAV A;  5AKZ A;  9ICC A;  3LWM A;  4C7Y A;  2B21 A;  2HW3 A;  4BXO B;  3WK8 A;  1N5X A;  2C2R A;  4JV1 A;  1SKW A;  3RJE A;  3T5L A;  1ZQQ A;  5CR0 A;  5AM1 A;  4C4T A;  4EEL A;  2R8G A;  1KW4 A;  1VJ5 A;  3PST A;  1ZQO A;  2MUT A;  3SYZ A;  3PO4 A;  3CYM A;  2LYA A;  1NZB A;  1S0N A;  1TK8 A;  2W7P A;  7ICP A;  5J8Y C;  2BQR A;  5KT5 A;  5H2F U;  3HWT A;  1QSS A;  2GWS A;  2YMM A;  3KOO A;  3A0B U;  3MC1 A;  4US9 A;  1DOQ A;  4YR0 A;  5HHI A;  2BDU A;  3ER8 C;  2I1Q A;  3WKE A;  4ICA A;  4F8R A;  5ALZ A;  1JIH A;  7ICG A;  2IBK A;  3GIK A;  3RJG A;  4K9B A;  5DLF A;  3ISD A;  2WF6 A;  3TFR A;  4YD1 A;  9ICO A;  3AEV A;  5TIS U;  1KN5 A;  4WQK A;  4YVZ A;  4XQ8 A;  4PPX A;  5F3X B;  2M9N A;  2OHF A;  4O3M A;  4LEV A;  2KJ5 A;  3H8J A;  4FE3 A;  1QQ5 A;  4QZ8 A;  2J6T A;  1XNS A;  3ZDB A;  4QWB A;  1NJY A;  3IM1 A;  2F1H A;  1ZJN A;  2O6K A;  4C80 A;  1PUZ A;  4KX5 A;  1ZQX A;  2ZIX B;  5KFJ A;  1ZQG A;  3CRX A;  4RWO A;  4NXZ A;  1JAL A;  3HPO A;  3K1Z A;  5KFH A;  4NV0 A;  4OJ6 A;  5TZV A;  4TUQ A;  4JLZ A;  2W04 A;  2DKX A;  3LYS A;  4M9G A;  2EH9 A;  2KKV A;  4Z6F A;  5KFT A;  2KNJ A;  3MDA A;  1NJX A;  4ZH4 A;  3L9D A;  2P6R A;  3SI8 A;  5IIJ A;  3AQE A;  3Q8R B;  1NJW A;  5IIM A;  4PHA A;  2QB0 B;  3D6J A;  5KTQ A;  3QU4 A;  2XIC A;  2E8O A;  5AKH A;  3ZI4 A;  4UAR A;  2W8L A;  4FZN A;  4TUS A;  5HRI A;  5KAF U;  3PR5 B;  4YG2 A;  3RJH A;  3PSP A;  2ZUC A;  1NOM A;  3AQN A;  1N5W A;  2DWQ A;  2H3F A;  4ECX A;  2Q0Z X;  3Q8M A;  3JCF A;  2PKE A;  5KT7 A;  4MF2 A;  3GII A;  2R18 A;  1J2M A;  3JPQ A;  4J9O A;  5KAI U;  2RHF A;  5ALF A;  3S6J A;  1UA0 A;  2LPE A;  9ICI A;  4O9M A;  3PML A;  2K60 A;  1RZT A;  4HX0 A;  1COK A;  2KIV A;  3TKA A;  5D46 A;  2O1P A;  1NK4 A;  1SXE A;  2F1I A;  2IHN A;  4LZG A;  1R8A A;  1N2X A;  2B51 A;  5CWR A;  1QLN A;  4DFJ A;  3GIJ A;  1PK1 A;  1X9M A;  2BCS A;  4JMU A;  3G6X A;  3PVX A;  3A0H U;  3AQL A;  3PNC A;  3NVV A;  1LB2 B;  4I2I A;  2RDI A;  2KZM A;  2EAN A;  8ICP A;  4N7R A;  1Z00 A;  5J8Y A;  1SGG A;  3UPQ A;  5KFF A;  2JRZ A;  2NO5 A;  4R8U A;  2OXO A;  5DB8 A;  1UEU A;  1ZQK A;  2HHS A;  4O3S A;  4PL1 A;  3UXO A;  3C1Z A;  4U7C A;  2K8B B;  2OM6 A;  3MBY A;  4O3Q A;  3LWL A;  1MC8 A;  3TAP A;  4DL4 A;  4X4V A;  4OJO A;  4DO9 A;  2IOF K;  2LMR A;  4PZO A;  4UD4 A;  3WFP A;  5DQG A;  2LI6 A;  4DSL A;  7ICT A;  5L1M A;  3QX7 A;  2HVI A;  4ATB B;  4QZH A;  5G5H A;  4P0Q A;  2JH7 A;  4O3N A;  5JTI A;  3OJS A;  1LVH A;  3C21 A;  3OGU A;  5ALW A;  4EEY A;  1OUQ A;  1RXV A;  4E0D A;  1JRP A;  1KSP A;  1NJZ A;  2BCV A;  4P2H A;  1BNP A;  1UPH A;  4NLN A;  3FC4 A;  4PZN A;  4DQS A;  4F5P A;  4KLG A;  1R8C A;  3GDX A;  5AI4 A;  3RAX A;  1SV0 C;  4QW9 A;  5HRD A;  4F93 B;  4IS7 A;  4O5E A;  4CGZ A;  5DG9 A;  1XSL A;  2BCR A;  2K8C B;  4X4T A;  5B3P A;  5L9X A;  2EZX A;  1N60 A;  1WCL A;  2EZY A;  2JV3 A;  4C8N A;  2FLN A;  4U6P A;  3NVW A;  1NNL A;  4J9R A;  2ZH6 A;  4YMM A;  2ZH4 A;  4NKT A;  4PJ0 U;  2ZIW B;  3IP4 B;  1ZQL A;  5KFN A;  3H3A A;  2CRX A;  4NY8 A;  2GA9 D;  3HP6 A;  5AI0 A;  4I27 A;  2ES6 A;  3PW2 A;  3H8S A;  2F8L A;  4Y2Q A;  4RNN A;  5KG5 A;  1TKD A;  2AGQ A;  2VJ5 A;  1FA0 A;  9ICN A;  3H0L B;  1ECW A;  1Q46 A;  4UAU A;  1DGJ A;  2WF8 A;  1TK5 A;  2KMD A;  2OWO A;  5DB9 A;  7ICH A;  3C18 A;  1S0V A;  4E8F A;  3EPI A;  2A1A A;  3UQ2 A;  7ICR A;  2FMQ A;  2HHV A;  1ZD5 A;  3NKU A;  4YMN A;  4MHV A;  5ALX A;  1D9D A;  4RWP A;  4I2E A;  5ALI A;  1N48 A;  4ECS A;  5ALO A;  3QXG A;  4M5D A;  2YY6 A;  1T7P A;  1XWL A;  3E2E A;  2ZHA A;  2G5I B;  1SKS A;  4RQ6 A;  4DQQ A;  3L4P A;  3RAQ A;  2EWR A;  5J2A A;  3NTU A;  4EZ9 A;  2XC9 A;  4C7Z A;  4AYB C;  1L3T A;  4KLS A;  4NLB A;  2MAX A;  2DPI A;  4GC7 A;  1OW5 A;  3QUT A;  3Q8K A;  5KFG A;  2ZHB A;  5J0Q A;  1YZ6 A;  2M2W A;  1BPD A;  4TUP A;  2KZZ A;  1ZQE A;  3H39 A;  3MFH A;  5ALQ A;  3EZ5 A;  4PGY A;  2MA1 A;  2RQ5 A;  5KT3 A;  4IG8 A;  3TAC B;  1ZQ1 C;  5D63 A;  1CEZ A;  1UQV A;  1HUZ A;  4P0P B;  4ECW A;  2AHO B;  4LEY A;  2XCA A;  4AYB F;  1O03 A;  4X4R A;  5HRL A;  2AGO A;  7ICU A;  3QU7 A;  3IRU A;  2KOB A;  2W7O A;  3HKZ C;  3OV7 A;  2K89 A;  4AT8 A;  3RJJ A;  3FYH A;  3SV4 A;  5KL1 B;  4WC5 A;  2QAR A;  5DLG A;  2E8M A;  2ZIU B;  2ZUD A;  4XA5 A;  2FI1 A;  3BQ2 A;  4IQV A;  5AK3 A;  1Q3V A;  4UB3 A;  1ZQR A;  4F2S A;  2BDP A;  2V9W A;  2H5X A;  4RWQ A;  2AXT U;  2JMG A;  3C2K A;  3HJE A;  1WWV A;  4ED7 A;  4Z6D A;  4X4N A;  2ZTE A;  2GH1 A;  9ICT A;  3NAS A;  3HKZ F;  5AIA A;  1KFS A;  4FHP A;  4F71 A;  2ZH7 A;  2H3I A;  4RWN A;  5HML A;  2E3T A;  1PVP A;  3THV A;  4AP9 A;  1RG6 A;  1RYU A;  3IDW A;  9ICR A;  4QWC A;  2LBO A;  1L3S A;  1ARO P;  1HJP A;  3GIL A;  4PGX A;  4JV2 A;  1IM4 A;  5KG6 A;  2HBM A;  3H8M A;  9ICE A;  1TAU A;  4F2R A;  2E5S A;  2HOQ A;  4Y2S A;  3T5J A;  3JYY A;  5KFB A;  4RPX A;  3F5A A;  5EOZ A;  1HEK A;  3GIM A;  4DSK A;  4KLL A;  3V7J A;  5L1I A;  2KE7 A;  2YTU A;  3M1Y A;  4RQ1 A;  3CK6 A;  1U45 A;  2KZ3 A;  5HRB A;  4KLI A;  2ZH1 A;  4QZA A;  2V4R A;  1Z19 A;  4ED3 A;  5AKG A;  1XU4 A;  2N1R A;  2I6X A;  3QUB A;  1K5O A;  4EGW A;  5J0W A;  3MGI A;  2B4V A;  4OAG A;  7ICV A;  2QB1 A;  3C5G A;  3MDC A;  2PXI A;  4BXO A;  1B22 A;  4ECY A;  2OCE A;  3T79 A;  4UB8 U;  4ED0 A;  2M2T A;  2XO7 A;  5FP0 A;  5JTG A;  1ZQJ A;  7ICO A;  1NK5 A;  2WF5 A;  3KTQ A;  2FE9 A;  3L3F X;  1JXL A;  3PSF A;  1RYS A;  4IR1 A;  3B9J A;  4RU9 A;  3M8R A;  1L8L A;  1ZQZ A;  2AGP A;  3ALR A;  5B5E U;  4FS2 A;  5F2V O;  2P66 A;  5KG2 A;  4MEX A;  3BZC A;  2WFA A;  3UM9 A;  5KFO A;  4WC1 A;  3I76 A;  5KFD A;  4ELT A;  1ZQP A;  3JPO A;  4J9K A;  1LKY A;  5J2C A;  3SV3 A;  1X9S A;  4OAF A;  1L3V A;  5IIK A;  8ICH A;  2UVU A;  1BPY A;  4RNO A;  3H37 A;  4K96 A;  8ICY A;  5ALY A;  4FHX A;  4F91 B;  2IMW P;  4HAI A;  3WKA A;  2ZH2 A;  5DQH A;  2W54 A;  1KTQ A;  4RQ5 A;  5D61 A;  1QCK A;  3J81 j;  1UA1 A;  5J0Y A;  3MCR A;  5KFX A;  4M9H A;  1Q79 A;  2ZIX A;  2ESE A;  2HHX A;  8ICJ A;  1J2N A;  3RJK A;  1VFG A;  4USA A;  4EYH B;  2JEJ A;  1ZXI A;  5KFZ A;  4M9N A;  3RR8 A;  4YXJ A;  2BQ3 A;  3RH4 A;  3ZDC A;  2NRX A;  2BHN A;  3C2M A;  3T5K A;  3H38 A;  2RRD A;  3PHZ A;  4X4Q A;  2W9A A;  3V6J A;  4OAI Z;  2K4H A;  3CW2 C;  1URJ A;  4PL2 A;  2R8K A;  1WOT A;  3QUC A;  4ELV A;  2ZIV B;  4O3O A;  2QLT A;  1U49 A;  4EBJ A;  2QB0 A;  3WFS C;  1SWV A;  1NI3 A;  3D2Q A;  2M2V A;  4FH5 A;  2EAM A;  3ERC C;  2W03 A;  4IQT A;  4FO1 A;  4OJP A;  4MKP A;  4I0U A;  1KEJ A;  5KFP A;  1B4F A;  1QSY A;  4RQM A;  3ED5 A;  8ICK A;  5AKE A;  2BPC A;  4DWI A;  4PHP A;  4XUS A;  3ICX A;  2PI4 A;  5J2I A;  4C0Z A;  4Z6E A;  3N4M B;  1WWU A;  1NKB A;  4DSJ A;  2DKZ A;  3BJY A;  4QJF B;  2LYH A;  4EZ6 A;  4J9L A;  4G3I A;  4NKU A;  4DF8 A;  1PZN A;  5KT4 A;  3QNM A;  4NWI A;  4FBU A;  3IG5 A;  3G6Y A;  1L5U A;  4UW9 A;  4M2Y A;  2UVR A;  3SEI A;  1NKC A;  4B9V A;  2ASL A;  1N56 A;  8ICS A;  3F2B A;  4NXT A;  3OPX A;  2ASD A;  1FFV A;  3BS5 B;  3IG8 A;  3F53 A;  4NXX A;  2PFP A;  1UT8 A;  4NLZ A;  2DUY A;  3PSI A;  4RQ8 A;  4WH5 A;  5D49 A;  4Y2R A;  2HHQ A;  1T8E A;  1DRG A;  2PFN A;  4WC7 A;  3VCB A;  5HR9 A;  4RQ0 A;  4M47 A;  5DDM A;  3WKB A;  5KFC A;  3RH6 A;  3AM9 A;  5HRH A;  5CHG A;  1ED1 A;  5ALM A;  5L1K A;  5D4B A;  4I2F A;  3RR7 A;  3PX0 A;  4QZC A;  2GOL A;  4FBT A;  5JRT A;  2YB4 A;  4KLH A;  3IV6 A;  4DS5 A;  3TFS A;  2E8N A;  1BPE A;  3RRG A;  4JB3 A;  4WC6 A;  3RFA A;  3F2C A;  2DFL A;  5KFI A;  4KLE A;  1N61 A;  4BGD A;  4QNL A;  1X9W A;  3C66 A;  4Q44 A;  1Q8K A;  5AIB A;  1FEZ A;  2WTF A;  5J2K A;  4PH5 A;  3NVZ A;  4KX3 A;  4QZG A;  4DL7 A;  4ECT A;  2FPL A;  2FCL A;  2IA6 A;  3ISC A;  2WB1 C;  1YT3 A;  2E1E A;  2EZZ A;  2ZH3 A;  4UB6 U;  1U48 A;  4UBC A;  4NXW A;  3EW9 A;  1V9P A;  2BBJ A;  2W9B B;  3JPP A;  4WJ3 B;  1MQ3 A;  8ICZ A;  5C0Y A;  1DXS A;  2EDU A;  2XI9 A;  2IOF A;  4UAS A;  4PHE A;  1GO3 F;  4G9B A;  2BBH A;  4QW8 A;  4EEK A;  2WB1 F;  2ZIW A;  5ALD A;  3QYP A;  3NUQ A;  5J2H A;  2J6S A;  5BOL A;  4DOC A;  3Q8S B;  4WOY A;  1ZQV A;  3OVS A;  4OJL A;  1B0X A;  3NGD A;  4E7X A;  1QQ6 A;  3MFI A;  2V4Q A;  1L6N A;  1ZQU A;  2KFN A;  2ZH8 A;  4QZ9 A;  4MFA A;  5B66 U;  4C8M A;  4RNM A;  2MUT B;  3BQ7 A;  3WKC A;  2ISO A;  2VIX A;  4ED6 A;  5AKX A;  5BOM A;  7ICM A;  4R66 A;  3TI0 A;  1XS9 D;  2IUB A;  1GPJ A;  4YP3 A;  1CRX A;  2HBK A;  3PMN A;  3PW4 A;  4FO6 A;  4FS1 A;  4RPZ A;  1A6S A;  2XY6 A;  5IIN A;  5KFW A;  1L7P A;  2KSO A;  4P4P A;  5L1J A;  8ICC A;  3JPT A;  1ZD2 P;  4UB2 A;  4UQG A;  1HUO A;  3WK4 A;  2JXJ A;  3OHB A;  5AK5 A;  4DL6 A;  3ZDD A;  2W9C B;  4YN4 A;  4I2C A;  4DFK A;  1UEV A;  2BCQ A;  4YR2 A;  4R63 A;  8ICA A;  1X42 A;  2HHT A;  5EWE A;  3B0Y A;  3KKA A;  8ICO A;  3TAD A;  5ALT A;  3HJ4 A;  2HI0 A;  5KFE A;  4RUC A;  4NXU A;  5E79 U;  5EWG A;  4X4P A;  3E0F A;  1SL1 A;  4B9N A;  3UXN A;  2G0A A;  2KHV A;  3TQ1 A;  2F8K A;  5J0X A;  1X66 A;  4Q8E A;  5J0S A;  4O67 A; 
#chains in the Genus database with same CATH homology
 5F9L A;  3BQ2 A;  2Q66 A;  4IQV A;  4RQ4 A;  1NKE A;  3GQC A;  3HT3 A;  1ZQS A;  2R8I A;  4UB3 A;  1ZQN A;  1ZQR A;  9ICH A;  1JQR A;  4K4G A;  4F2S A;  2FLP A;  2BDP A;  1ZQT A;  3UPS A;  2V9W A;  2H5X A;  4RWQ A;  1R8B A;  3JPN A;  1Q78 A;  3QEB Z;  4E80 A;  4B9T A;  4WC2 A;  4DOA A;  3C2K A;  3GV7 B;  4ED7 A;  1L3U A;  9ICM A;  4UD5 A;  4XQ7 A;  5F9N A;  4BDP A;  4Z6D A;  2I9G A;  3RRH A;  1S0M A;  4X4N A;  3JPR A;  4FHW A;  2ZTE A;  9ICT A;  4AT9 B;  4XRH A;  3SZ2 A;  4I2G A;  4UB5 A;  1KFS A;  4UB1 A;  5KFM A;  4EYI B;  4ED1 A;  1IXR A;  1ZQA A;  4DSI A;  8ICN A;  1KNY A;  5KG0 A;  3M9O B;  2ZH7 A;  4F4X A;  2PFO A;  4IRC A;  5HML A;  4LVS A;  2DR8 A;  5KFL A;  4RWN A;  5L1L A;  3PO5 A;  2AQ4 A;  1MQ2 A;  3Q8P B;  3GV8 B;  2FPM A;  3THV A;  5KFV A;  4KLF A;  4NM2 A;  4MF8 A;  3RJF A;  2A1J A;  7ICN A;  3T3F A;  9ICR A;  4Q8F A;  4RQ3 A;  4QWC A;  1KRP A;  1BNO A;  1VJ7 A;  4YD2 A;  3K75 D;  4WBZ A;  4AT9 A;  9ICJ A;  1L3S A;  5CJ7 A;  2ASJ A;  1ARO P;  1HJP A;  3K4G A;  2BGW A;  4GXI A;  2IHM A;  3GIL A;  2JEG A;  4PGX A;  3AQM A;  4JV2 A;  1IM4 A;  5KG6 A;  1KFT A;  1BPB A;  2ATL A;  4F4W A;  2ISP A;  3LDA A;  2BE3 A;  9ICE A;  2KTQ A;  4BWJ A;  3GFK B;  4F2R A;  3RB4 A;  8ICE A;  3C23 A;  1TAU A;  1T3N A;  9ICB A;  1V4A A;  3JPS A;  1ZJM A;  3T5J A;  1RYR A;  3JYY A;  1OU5 A;  5KFB A;  4RPX A;  2ZJ5 A;  1SKR A;  3M8S A;  1MSW D;  4FHY A;  5EOZ A;  4EBD A;  4NLG A;  3GIM A;  2Y1J A;  4DSK A;  4YMO A;  3OHA A;  3QEA Z;  4KLL A;  8ICW A;  5DB6 A;  4PHD A;  4NLK A;  2HHW A;  3V7J A;  5L1I A;  4Q43 A;  8ICV A;  4BWM A;  3QZ7 A;  2PBE A;  4RQ1 A;  3ZDA A;  1U45 A;  9ICC A;  4R65 A;  2KZ3 A;  3LWM A;  5HRB A;  5J2B A;  4KLI A;  5HRG A;  2B21 A;  2DR7 A;  2HW3 A;  4BXO B;  2ZH1 A;  4KLD A;  4QZA A;  4ECR A;  2V4R A;  5KT2 A;  5CA7 A;  4DSE A;  4DLE A;  1NZP A;  3LQC B;  5J0O A;  4QZI A;  2C2R A;  4ED3 A;  4JV1 A;  1LV5 A;  3WFR E;  1XU4 A;  3MR2 A;  3UQ0 A;  1SKW A;  1ZQC A;  2PFQ A;  5HP4 A;  3RJE A;  5J2D A;  3T5L A;  1ZQQ A;  5J0W A;  4RT3 A;  1WCN A;  5CR0 A;  3MGI A;  4GLX A;  7ICK A;  7ICV A;  1S77 D;  4JK1 A;  2ALZ A;  2R8G A;  3C5G A;  1ZQO A;  4K4I A;  2DRA A;  4NKU A;  2MUT A;  3MDC A;  3SYZ A;  4I2A A;  5KG1 A;  3PO4 A;  2NRV A;  5DB7 A;  2PXI A;  4BXO A;  4C8L A;  1B22 A;  1EXN A;  4ECY A;  1S0N A;  8ICM A;  1TK8 A;  1SL0 A;  7ICP A;  4ELU A;  4ED0 A;  2BQR A;  5KT5 A;  3HWT A;  1QSS A;  2GWS A;  9ICA A;  4DSF A;  8ICT A;  2XO7 A;  2M2T A;  5KG4 A;  4FHV A;  1DOQ A;  4YR0 A;  1MIV A;  1R89 A;  5HHI A;  2I1Q A;  4QZB A;  1NK5 A;  1ZQJ A;  7ICO A;  4M04 A;  2M2U A;  2VA2 A;  3KTQ A;  2BPF A;  4RUA A;  4F8R A;  1JXL A;  1JIH A;  1TFY A;  1TK0 A;  1RYS A;  4ECU A;  2IBK A;  7ICG A;  4IR1 A;  4F5Q A;  5DG8 A;  3GIK A;  4RU9 A;  1KDH A;  3M8R A;  4F50 A;  3RJG A;  5C5J A;  4MFC A;  1ZQZ A;  5DLF A;  2AGP A;  3ISD A;  1XC9 A;  7ICS A;  9ICG A;  5KFK A;  3TFR A;  4KLQ A;  4YD1 A;  4DL2 A;  1NK9 A;  2XCP A;  4FS2 A;  9ICO A;  5F2V O;  2P66 A;  5KG2 A;  4MEX A;  4KTQ A;  1F5A A;  4YVZ A;  4XQ8 A;  4PPX A;  3RH5 A;  2M9N A;  4GC6 A;  4B9S A;  4MFF A;  1UT5 A;  5KFO A;  3V72 A;  3AU2 A;  4WC1 A;  3H8J A;  1ZYQ A;  4YCX A;  4QZ8 A;  1NK7 A;  3KHH A;  5KFD A;  2J6T A;  4B9U A;  4ELT A;  1ZQP A;  3JPO A;  3ZDB A;  3NYB A;  4AT7 B;  4J9K A;  3RB6 A;  4KLT A;  4QWB A;  1NJY A;  3IM1 A;  2F1H A;  5J2C A;  7ICE A;  3SV3 A;  3MGH A;  1X9S A;  1L3V A;  1ZJN A;  2BCU A;  5IIK A;  8ICH A;  4S3N A;  4F4Y A;  2UVU A;  1BPY A;  5KFR A;  4RNO A;  3H37 A;  2DVI A;  4I2J A;  1ZQX A;  2XGP A;  8ICY A;  4FHX A;  8ICF A;  4F91 B;  2XY7 A;  5KFJ A;  4GXK A;  2IMW P;  1Y88 A;  1ZQG A;  4RWO A;  4J9Q A;  4NXZ A;  1NK8 A;  2RFF A;  3WFQ E;  3HPO A;  3H40 A;  2ZH2 A;  1ZQY A;  9ICF A;  4EBC A;  3RBD A;  7ICI A;  5KFH A;  4M9J A;  5DQH A;  3HW8 A;  2DR5 A;  4AT7 A;  1U47 A;  1TV9 A;  1BPZ A;  5TZV A;  1KTQ A;  2PI5 A;  5J29 A;  2ZJ8 A;  4RQ5 A;  4KMU A;  1UA1 A;  5J0Y A;  4TUQ A;  4ECV A;  2C2E A;  2JEF A;  4M9G A;  5KFX A;  4M9H A;  3PX4 A;  1Q79 A;  1ZQI A;  4Z6F A;  5KFT A;  2HHX A;  1K1S A;  8ICJ A;  3MDA A;  1NJX A;  3RJK A;  4ZH4 A;  1NK0 A;  3L9D A;  3TAN A;  2P6R A;  4X4S A;  1VFG A;  4RT2 A;  3SI8 A;  4WC0 A;  5IIJ A;  4EYH B;  2FPK A;  2JEJ A;  3Q8R B;  5J2E A;  3PY8 A;  1NJW A;  2ZJA A;  1H38 A;  5IIM A;  1PX5 A;  5KFZ A;  2DR9 A;  4PHA A;  4M9N A;  9ICQ A;  3RR8 A;  5HMM A;  4YXJ A;  5KTQ A;  4PGQ A;  2BQ3 A;  3RH4 A;  3ZDC A;  2NRX A;  4QWE A;  8ICB A;  2BHN A;  5J0U A;  3C2M A;  2W8L A;  3T5K A;  4TUS A;  3PX6 A;  2J6U A;  3H38 A;  4X4Q A;  9ICP A;  2W9A A;  5HRI A;  3HIY A;  4B9L A;  3V6J A;  2NRK A;  5DKW A;  5KFY A;  1BGX T;  4EP7 A;  2R8K A;  1JMS A;  3PR5 B;  4F5N A;  1WOT A;  4KN7 A;  5IIO A;  4ELV A;  4YG2 A;  3RJH A;  5KG7 A;  2ZUC A;  1NOM A;  4O3O A;  2KN7 A;  3MR6 A;  4X0B A;  3AQN A;  1U49 A;  4YXM A;  4EBJ A;  4I2D A;  3IHQ B;  4FHP A;  4F5O A;  3FDS A;  8ICR A;  3WFS C;  1JX4 A;  5DBB A;  4ECX A;  4WC4 A;  2Q0Z X;  4YFK A;  3Q8M A;  1KLN A;  4DQP A;  5J0R A;  4DEZ A;  4GXJ A;  2Y1I A;  2M2V A;  4DL3 A;  4FH5 A;  5KT7 A;  4MF2 A;  3GII A;  3V6K A;  4JWM A;  3JPQ A;  4J9O A;  4IQT A;  4IRD A;  1MIW A;  4ED2 A;  1UA0 A;  4I2B A;  8ICI A;  3H8W A;  5HRE A;  5DDY A;  9ICI A;  4O9M A;  3OUY B;  3PML A;  1KEJ A;  5KFP A;  5HRK A;  3M9N B;  1TAQ A;  1QSY A;  3C2L A;  1YLQ A;  4LZD A;  1RZT A;  8ICK A;  3UXP A;  3PV8 A;  2BPC A;  4DWI A;  4PHP A;  5D46 A;  1ZET A;  4XUS A;  2O1P A;  4F3O A;  2PI4 A;  1NK4 A;  4TQR A;  5J2I A;  2F1I A;  4LZG A;  2IHN A;  1R8A A;  4J9N A;  4Z6E A;  2BR0 A;  3N4M B;  3ZDE A;  1NKB A;  4DSJ A;  5CWR A;  1Z00 B;  4I28 A;  2BPG A;  3OJU A;  1QLN A;  9ICU A;  4YQW A;  3GIJ A;  4J9S A;  3BJY A;  4DFJ A;  5KFS A;  5IIL A;  1X9M A;  2BCS A;  3OUY A;  9ICS A;  4R8U B;  3C1Y A;  5J2J A;  2KFZ A;  2LYH A;  4IQU A;  5III A;  3H4B A;  9ICL A;  3G6X A;  4DL5 A;  1S97 A;  4EZ6 A;  4J9L A;  5EWF A;  2UVV A;  4G3I A;  4DF8 A;  3PVX A;  1ZQD A;  1PZN A;  3PNC A;  5KT4 A;  5HNK A;  7ICJ A;  3AQL A;  3HJ1 A;  4I29 A;  9ICK A;  3C5F A;  1LB2 B;  4I2I A;  4FBU A;  5KFQ A;  3G6Y A;  1L5U A;  2AJQ A;  2RDI A;  5J2F A;  2UVR A;  4M2Y A;  2KZM A;  1RPL A;  1JN3 A;  3RB3 A;  8ICP A;  1Z00 A;  2DRB A;  7ICQ A;  1NKC A;  5J0T A;  4B9V A;  2ASL A;  4K4H A;  7ICL A;  3ISB A;  1N56 A;  2VAN A;  4KLM A;  8ICS A;  3UPQ A;  4DFM A;  5KFF A;  4R8U A;  3RJI A;  2ASD A;  5DB8 A;  1UEU A;  3T5H A;  1ZQK A;  2FMP A;  2FLL A;  2HHS A;  4O3S A;  2UVW A;  3AQK A;  3V7K A;  3PW7 A;  2NRZ A;  3UXO A;  4EBE A;  3C1Z A;  5DG7 A;  2PFP A;  4O3R A;  1UT8 A;  4RQ2 A;  5KFU A;  4NLZ A;  4O3Q A;  3MBY A;  8ICU A;  1MC8 A;  3LWL A;  1BVS A;  3EWA A;  4RQ8 A;  3EPG A;  1S9F A;  4O0I A;  5D49 A;  2W8K A;  3H4D A;  4DL4 A;  3TAP A;  1QSL A;  4IQW A;  4X4V A;  5KG3 A;  2AU0 A;  2HHQ A;  4FH3 A;  1T8E A;  1NO5 A;  4DO9 A;  3V7L A;  2PFN A;  4WC7 A;  2C22 A;  5HR9 A;  4UD4 A;  4X4O A;  3WFP A;  4RQ0 A;  5DQG A;  4M47 A;  1B43 A;  5DDM A;  4DSL A;  5KFC A;  3RH6 A;  1ZQF A;  7ICT A;  2NRT A;  8ICX A;  3PR4 A;  5HRH A;  2KP7 A;  5CHG A;  2HVI A;  1A77 A;  5DQI A;  4QZH A;  4ATB B;  2NRW A;  4RQ7 A;  5L1K A;  3MAB A;  5D4B A;  4I2F A;  3RR7 A;  2XY5 A;  3PX0 A;  4AT8 B;  4QZC A;  4UBB A;  1COO A;  3BQ0 A;  4FBT A;  4DS4 A;  1S76 D;  4O3N A;  3OJS A;  2R8H A;  5DBA A;  3C21 A;  3OGU A;  4KLH A;  9ICX A;  2BKE A;  4P4M A;  4DS5 A;  3TFS A;  4EEY A;  1RXV A;  4E0D A;  5J0P A;  1BPE A;  1KSP A;  2AQ0 A;  4QZD A;  3RRG A;  1A76 A;  1NJZ A;  4WC6 A;  8ICL A;  2BCV A;  2DFL A;  4TQS A;  5KFI A;  4P2H A;  1BNP A;  4MEY A;  2VA8 A;  1DK3 A;  4NLN A;  4DFP A;  4BGD A;  4KLE A;  1X9W A;  3HX0 A;  1JAJ A;  4DQS A;  4IR9 A;  4I2H A;  3C66 A;  4F5P A;  2C2D A;  1JXE A;  4Q44 A;  4KLG A;  1R8C A;  2JEI A;  3GDX A;  4YR3 A;  5CP2 A;  5J2K A;  2WTF A;  3M9M B;  4CCH A;  2ID1 A;  3RAX A;  4RZR A;  1KFD A;  4QW9 A;  4F93 B;  4DQR A;  5HRD A;  3OVB A;  1XSN A;  4DF4 A;  4M6W B;  4O5E A;  3WFO A;  4X4U A;  4B9M A;  9ICV A;  4PH5 A;  1Z3E B;  5DG9 A;  5KT6 A;  1XSL A;  1ZQH A;  2BCR A;  4X4T A;  4QZG A;  4DL7 A;  4ECT A;  2FPL A;  1S10 A;  5L9X A;  4JWN A;  4DLG A;  1WCL A;  4LT6 A;  2IA6 A;  2A1J B;  3ISC A;  3RB0 A;  2ZTC A;  4C8N A;  3EYZ A;  2BQU A;  3MR5 A;  2FLN A;  8ICQ A;  4NM1 A;  2ZH3 A;  3JZ0 A;  4J9R A;  2ZH6 A;  2ZH4 A;  2P6U A;  4YMM A;  1U48 A;  4NKT A;  4KN4 A;  1DK2 A;  4M6W A;  4UBC A;  1UET A;  3OVA A;  1ZQW A;  4F4Z A;  4QZF A;  1ZQL A;  5KFN A;  3H3A A;  3EW9 A;  1V9P A;  4UAW A;  3Q8L A;  1XO1 A;  1ZQB A;  5HRF A;  4NY8 A;  4RPY A;  3HP6 A;  2W9B B;  4M0A A;  3JPP A;  3PW0 A;  2ZH5 A;  4I27 A;  2ZH9 A;  4QZE A;  4QWD A;  1MQ3 A;  8ICZ A;  3PW2 A;  3GV5 B;  3RTV A;  4PHE A;  3H8S A;  4RNN A;  4ECZ A;  1XSP A;  5KG5 A;  4QW8 A;  3BQT A;  1TKD A;  4O5C A;  2AGQ A;  2C28 A;  2R8J A;  4KLU A;  9ICN A;  1FA0 A;  4P4O A;  5J2H A;  4UB4 A;  3OSN A;  3KHR A;  2W9B A;  4TUR A;  2J6S A;  3QZ8 A;  5BOL A;  4DOC A;  3Q8S B;  1TK5 A;  2OWO A;  2W9M A;  3H7I A;  1ZQV A;  4JV0 A;  5DB9 A;  4KLJ A;  3OVS A;  3ETL A;  4F5R A;  7ICH A;  3NGD A;  4O3P A;  3MR3 A;  4E7X A;  3C18 A;  3MFI A;  5DGA A;  1S0V A;  4WCW A;  4E8F A;  2F1J A;  3EPI A;  2V4Q A;  2HVH A;  5HC9 A;  1ZQU A;  2KFN A;  7ICF A;  4QZ9 A;  2ZH8 A;  7ICR A;  1X2I A;  2RDJ A;  3UQ2 A;  2FMQ A;  2HHV A;  4R64 A;  4MFA A;  1NK6 A;  3BQ1 A;  4YMN A;  4C8M A;  1MIY A;  3TAQ A;  4RNM A;  2MUT B;  3BDP A;  1D9D A;  1QTM A;  2O5A A;  4RWP A;  4I2E A;  4JUZ A;  4J9P A;  1D8Y A;  2ISO A;  5J2G A;  3G6V A;  4ED6 A;  4ED8 A;  5JUM A;  4F92 B;  5BOM A;  4J9M A;  4ECQ A;  1N48 A;  7ICM A;  4R66 A;  2XGQ A;  4ECS A;  3TI0 A;  1C7Y A;  4UAZ A;  1XS9 D;  1CUK A;  1U4B A;  2DPJ A;  4M5D A;  4YP3 A;  1T7P A;  1XWL A;  4O5K A;  3B0X A;  3E2E A;  5DEC A;  2ZHA A;  3PMN A;  1SKS A;  1SL2 A;  2ZTD A;  3AUO A;  3PW4 A;  4FO6 A;  4RQ6 A;  5HHH A;  4DQQ A;  2VA3 A;  3RAQ A;  2JZB B;  5J2A A;  3NTU A;  4FS1 A;  1TFW A;  1SZP A;  4Z6C A;  4EZ9 A;  4RPZ A;  2ZUB A;  2XC9 A;  2XY6 A;  5IIN A;  1L3T A;  4KLS A;  5KFW A;  3OSP A;  1S0O A;  2MAX A;  2DPI A;  4GC7 A;  8ICG A;  4P4P A;  3ZD9 A;  5L1J A;  3Q8K A;  1TVA A;  5KFG A;  2ZHB A;  1BPX A;  4UAY A;  3JPT A;  8ICC A;  4X0A A;  5J0Q A;  3KHG A;  4UB2 A;  4UQG A;  4DOB A;  1HUO A;  9ICW A;  2M2W A;  1BPD A;  4TUP A;  2KZZ A;  4QWA A;  1ZQE A;  5KFA A;  3OHB A;  4KIT B;  4DL6 A;  1RXW A;  3ZD8 A;  3ZDD A;  2W9C B;  3H39 A;  3MFH A;  4IG8 A;  3EZ5 A;  4PGY A;  2JZB A;  1K1Q A;  5KT3 A;  5BPC A;  4YN4 A;  2HHP A;  4I2C A;  1CEZ A;  4DQI A;  3N97 B;  4DFK A;  1HUZ A;  4WC3 A;  4F4K A;  4IRK A;  2HHU A;  2BCQ A;  1UEV A;  4YR2 A;  4R63 A;  3V6H A;  8ICA A;  4ECW A;  2HHT A;  3ORY A;  2XCA A;  3RBE A;  5EWE A;  3B0Y A;  8ICO A;  5DED A;  1D8L A;  4Q45 A;  3KHL A;  1T4G A;  1D9F A;  4C8O A;  3HJ4 A;  1ZQM A;  4HYK A;  3QE9 Y;  3AU6 A;  2W9C A;  5HRL A;  5KFE A;  4X4R A;  2AGO A;  4RUC A;  7ICU A;  4C8K A;  5EWG A;  1TFR A;  4X4P A;  4M9L A;  1SL1 A;  4ATB A;  3PW5 A;  4B9N A;  4WBY A;  5DGB A;  2FMS A;  4KLO A;  5DBC A;  4X5V A;  4EBK A;  1U9L A;  3RJJ A;  4AT8 A;  3OV7 A;  3TAR A;  3UXN A;  3TQ1 A;  3Q8Q B;  3FYH A;  5J0X A;  3SV4 A;  4WC5 A;  4Q8E A;  1DGS A;  3LK9 A;  5CB1 A;  5DLG A;  5J0S A;  2ZUD A;  4XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...