4M9NA

Dna polymerase beta e295k soaked with datp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
326
structure length
300
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHTINKYTIRPLGEPLPVDSEKDIFDYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 300
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9nA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9nA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9nA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9nA03
3RH5A 2P66A 1SKRA 9ICHA 1KDHA 5D4BA 2HHXA 4C8NA 4PHAA 4BXOA 4O5KA 1S76D 4XUSA 3C5GA 1TK5A 2I1QA 5JUMA 4RU9A 4DQIA 3AQLA 4E80A 4DOAA 4X0BA 4UAWA 4YMNA 3PW5A 3Q8MA 2ASDA 3OVBA 1XWLA 4ECYA 2BQRA 1NK5A 1KRPA 4YR0A 8ICNA 4FHXA 3UXOA 4WC6A 2ZH6A 2DR5A 3V72A 4DF4A 4KLLA 4WC5A 4O3SA 1V4AA 4C8MA 4K4HA 3AQMA 1Y88A 1U49A 1ZQYA 4M9NA 7ICUA 3E2EA 7ICFA 5KT2A 7ICMA 1ZQLA 1TFYA 3JPOA 2BGWA 7ICRA 5KG5A 5J2KA 4DL7A 1NJZA 2IHMA 2JEIA 3C2MA 1WOTA 4PPXA 5J2GA 2KTQA 2R8JA 4DSFA 2Y1IA 1S97A 2IHNA 3B0XA 2C28A 5KFAA 5KT5A 2HHTA 5KFPA 4QZGA 4YMOA 2PI5A 4MEYA 5L1IA 9ICAA 5J2CA 5DDYA 3PX6A 1ZJNA 5KFNA 3RB0A 4FS2A 1LB2B 8ICOA 1S9FA 5TZVA 4LT6A 9ICVA 3C66A 1NK8A 1ZQEA 5J0UA 4I29A 4KMUA 4XA5A 3IM1A 8ICVA 1MIWA 4S3NA 4O9MA 4I28A 1S0MA 3MR6A 5F9NA 4I2EA 5KT4A 1NKCA 4IG8A 4XRHA 2V4QA 4X4RA 3GIMA 2M2VA 4O3OA 2NRZA 5CB1A 5J2FA 4RQ1A 3GIIA 4NM1A 8ICBA 5HRKA 3GV8B 3H4DA 5KFOA 5BOMA 4RNNA 3KHLA 3C23A 5C5JA 2R8KA 5J0OA 4YD1A 3EPIA 4ECXA 2IMWP 2W9CB 2NRKA 5J0QA 2PFNA 4UAZA 2JEJA 4DSLA 1XC9A 5DKWA 5J2EA 3TFRA 5KT6A 8ICEA 1TAUA 7ICVA 1KNYA 1JXEA 9ICWA 2AU0A 3MGHA 3G6YA 4O3RA 2W9CA 1UETA 1ZQSA 1KSPA 4AT7A 8ICPA 4KLUA 3ISBA 7ICKA 5KG7A 1T8EA 1OU5A 4MF8A 9ICLA 5KFQA 1ZQAA 5HP4A 4IQVA 9ICSA 1BPBA 1NKEA 2ZHAA 2OWOA 4I2HA 3Q8PB 3GILA 2ZH1A 4EBEA 3NGDA 4ECVA 1ZQFA 4I2JA 5J0YA 2H5XA 5DB6A 3C5FA 4J9PA 4DL4A 3FDSA 4PHDA 4B9VA 4QZ9A 4GLXA 2KFNA 3RB6A 2KZZA 4Q45A 5DQIA 4QZDA 3KHGA 4TQSA 2C2RA 4KLDA 1PX5A 3THVA 3QEBZ 4LZGA 1ZQQA 1PZNA 4EYIB 4ECQA 4M47A 5KG6A 4F8RA 4RQ7A 5L9XA 2FPMA 1RYRA 4ED6A 2DPJA 3PNCA 3UPSA 3SV4A 2AQ0A 2I9GA 2O1PA 3Q8QB 3H7IA 4DSEA 4FBUA 7ICNA 5KT3A 1VJ7A 3JPRA 2BR0A 4WC2A 3OSNA 4PGXA 4F4WA 4KLTA 5DLFA 1BPZA 2KZ3A 2PFQA 1T4GA 5KG0A 3ZDBA 1JN3A 2Q0ZX 3PR4A 4DFMA 4NLGA 4QZAA 4GXIA 4P4MA 1ZQBA 4FHPA 4ELUA 3PV8A 3RB4A 2BCQA 4X4VA 5HRLA 1JAJA 4DL2A 4FO6A 3JPSA 3ZD8A 3RRGA 3HJ4A 5CR0A 4DS5A 7ICGA 5CWRA 4Q44A 2R8HA 1WCNA 4PGQA 1TK0A 4X4SA 3KHHA 4ZH4A 4IR9A 2FPLA 4TUQA 2Q66A 4Z6CA 5EWEA 3PMLA 2DFLA 4JV0A 4J9QA 2BHNA 4QWDA 4YN4A 3M8RA 3H4BA 2ZJ5A 4J9SA 1TV9A 2P6RA 8ICHA 2ASJA 5DG9A 4NLNA 3PX4A 1ZQWA 4NKTA 4X4OA 2XY7A 3QZ8A 4DEZA 4F5RA 4DL5A 3OSPA 2ZH4A 1BVSA 8ICTA 4F4XA 2W9AA 1A76A 3PW2A 1ZJMA 5J0XA 2ISPA 2HHSA 7ICOA 2ZTCA 1UA0A 2RFFA 5DB8A 1Z00B 4KLGA 4UBBA 3RH4A 4DQQA 4F2RA 4KITB 2ATLA 4GC6A 1ZQOA 4J9KA 1U48A 4ED7A 3GFKB 3AU2A 5HHHA 7ICHA 4IR1A 4F4KA 1Z00A 2XCAA 4F5QA 1BGXT 4EP7A 2W8LA 2UVVA 4YG2A 3HT3A 1KTQA 4RPXA 5CHGA 2HW3A 3OGUA 4UBCA 1UT8A 4RQ5A 3BDPA 4M9HA 1JXLA 2C22A 8ICIA 9ICFA 3RJEA 8ICCA 3KTQA 4F5NA 2W9BA 9ICCA 3MR3A 1COOA 2ISOA 4WC0A 1NO5A 8ICSA 4FS1A 3OVAA 2DR8A 3JZ0A 2ZTEA 2ZHBA 1D9DA 1NK0A 4J9OA 5KG1A 5EOZA 1QTMA 3MBYA 3OUYA 1R8CA 2AJQA 3Q8KA 3MDCA 2HVHA 1NJYA 4QW8A 3PW4A 4I2CA 4J9RA 5J2JA 4ED1A 3AUOA 3AU6A 4FH3A 1RPLA 8ICFA 4RWQA 4ATBB 1ZQIA 4YP3A 1H38A 1NJWA 1SKWA 4I2BA 2RDJA 1UEVA 3EW9A 1ZQRA 7ICJA 2BPGA 4ATBA 3PMNA 5IIMA 2NRTA 4RWPA 1DK2A 4M04A 4TUPA 4FHWA 4B9SA 4O5CA 2PI4A 4MEXA 2PFOA 5DBAA 3H8SA 4YMMA 2ALZA 3RJHA 3SI8A 4M9LA 3MFIA 8ICRA 3HIYA 4KLHA 1JX4A 4G3IA 1F5AA 5KFRA 3LK9A 4DS4A 2WTFA 4K4GA 4DQRA 2BCUA 4DL6A 4YXJA 4DWIA 9ICXA 2B21A 2DPIA 4WC7A 4WBZA 8ICMA 5CA7A 4GXJA 4P4PA 3JPNA 1QSSA 4LVSA 2HHQA 2C2EA 1S10A 4UQGA 4ED8A 3LWLA 2XY6A 5HMLA 4O3QA 3N4MB 1N48A 3ZDCA 4YD2A 1NK7A 1ZQVA 3GIKA 1ZETA 1BNPA 1BPEA 5J2AA 3GV5B 5L1KA 2BCRA 4DSJA 4KN7A 4AT7B 3N97B 2A1JB 9ICKA 4XQ8A 1ZQHA 5J0WA 4MFCA 4RPZA 7ICTA 1JMSA 2NRWA 4IQTA 2ZTDA 1SZPA 4Z6EA 3T5HA 1DOQA 1EXNA 3G6VA 4F2SA 9ICNA 2A1JA 5F2VO 2ZJ8A 4P4OA 4PH5A 5DBCA 2W8KA 2JEGA 5EWGA 3OJUA 4IQWA 5DB7A 3AQNA 2ZH5A 4RT3A 3RJFA 3RJJA 3TI0A 4BDPA 4IQUA 5J29A 4GC7A 4QZBA 3RH6A 5KFHA 4RT2A 4YR2A 4QWAA 3TARA 1KLNA 4ED2A 2BDPA 3T3FA 4I2AA 4X5VA 5HNKA 1BPXA 1KFTA 4C8OA 4AT8B 4UB1A 3EYZA 1BNOA 4I27A 4EEYA 3TAPA 4RQ4A 5KFIA 5J0TA 4WC3A 9ICOA 1QSYA 2HVIA 2KZMA 4ECSA 4AT8A 5L1JA 2JZBA 4R8UB 5KFGA 1U47A 1ZQDA 3WFRE 1D8YA 5HRBA 2UVUA 5KFCA 3GDXA 2RDIA 3HP6A 2UVWA 2LYHA 4R8UA 1ZQPA 4MFAA 2KFZA 4UB4A 3PY8A 3RR7A 1NJXA 9ICBA 4ECUA 1KEJA 1ZQNA 3QE9Y 2BPCA 4RQ0A 2M2WA 2DR9A 4Z6FA 7ICSA 4EBJA 3PR5B 4WBYA 4AT9A 3T5JA 2DR7A 4UD4A 4KN4A 4JUZA 5L1LA 4KLEA 9ICJA 7ICPA 4X0AA 3OVSA 4TQRA 3LWMA 2VA3A 4RQ2A 3BQ2A 4O3NA 5HR9A 4IRDA 5J0SA 3RRHA 7ICIA 1MIVA 4P2HA 4FH5A 2AGOA 4R64A 4HYKA 1KFSA 4DF8A 4DSKA 5DECA 3EZ5A 5J0PA 4FHVA 1A77A 3M9OB 3EPGA 4TURA 3C2KA 1X9SA 1HUOA 3IHQB 4YR3A 1JQRA 2IBKA 1R8AA 2ZJAA 1JIHA 9ICPA 5KFTA 2FLNA 3RR8A 5KFWA 3UPQA 1RZTA 4FBTA 2F1JA 4BWJA 5J2BA 5HMMA 3C18A 4QW9A 5BPCA 1XU4A 1DK3A 5DGAA 4J9NA 3QEAZ 1SL0A 2UVRA 2FPKA 5IIIA 1ZQZA 2J6SA 5HREA 4WCWA 4ELVA 4Q8FA 4DL3A 4B9MA 1L3UA 4E7XA 3MR5A 4NY8A 3C1ZA 4EBKA 1BPDA 3V6HA 8ICUA 2DVIA 1K1SA 1QSLA 2O5AA 2ASLA 1TAQA 2DRBA 5KFVA 4CCHA 9ICGA 4DFPA 1RXVA 1MQ2A 1MIYA 3WFPA 3H8JA 1XSNA 9ICEA 4I2FA 8ICGA 4ECZA 4QWCA 4J9LA 2ID1A 2W9BB 1QLNA 4F5OA 4RUAA 2HHWA 2FLPA 4QWBA 1Z3EB 1IXRA 1X9WA 4Q8EA 4JV1A 1L5UA 2DRAA 3V7LA 1XS9D 3C21A 2AGPA 3PO4A 4QZHA 3M8SA 4ED3A 1SL1A 1U4BA 1UT5A 1RXWA 4DOCA 9ICRA 1L3SA 4FHYA 2BE3A 3OUYB 3MFHA 3GQCA 1Q78A 4O0IA 4DQPA 1R8BA 3PW7A 1X9MA 3LQCB 1S0VA 3H3AA 3HW8A 4NM2A 2P6UA 2J6UA 4YXMA 1XO1A 5DG8A 2HHUA 4X4PA 4X4UA 2XGPA 2XGQA 2BCSA 4EBCA 1XSLA 2BPFA 2KN7A 3G6XA 4DO9A 4JV2A 3UXPA 4J9MA 2MUTB 4O5EA 1SKSA 5IIKA 8ICXA 2ZH2A 2XC9A 4DFJA 2ZUCA 3RB3A 3V7JA 1NKBA 2MUTA 5DG7A 4UB2A 1ZQCA 4EBDA 4B9NA 5DQHA 4EZ9A 4NLZA 1S0OA 5J2IA 4MFFA 4BGDA 2ZH9A 5KFYA 1T3NA 2F1HA 1L3VA 5HC9A 2XO7A 9ICTA 4PGYA 4F3OA 1Q79A 1B43A 4DSIA 2AQ4A 1MC8A 3LDAA 9ICIA 4I2GA 4KLJA 3HX0A 3ZDDA 4UAYA 4NKUA 4QZ8A 5KFUA 3PW0A 1TFWA 1HUZA 3OV7A 1XSPA 3MABA 2Y1JA 1C7YA 4M5DA 1U45A 4I2IA 3TFSA 2R8GA 3C2LA 4BWMA 2NRXA 3ETLA 4BXOB 5KFMA 7ICQA 4M9GA 1TVAA 4QZFA 4UD5A 4RNOA 3UXNA 2FMSA 5DBBA 5DB9A 1L3TA 4QWEA 1NZPA 2XY5A 3C1YA 3JPQA 5KFSA 4YCXA 5J2HA 5KFFA 5DLGA 2MAXA 5KFEA 5F9LA 1ZQMA 3MR2A 4O3PA 5DGBA 4RNMA 3RJGA 2FMQA 3BQTA 4RZRA 3M9NB 3RTVA 4K4IA 2ZH8A 4M9JA 4Z6DA 3M9MB 5HRDA 5KG3A 4RUCA 1D9FA 8ICKA 3H37A 2BQUA 5HRGA 3BJYA 4QZEA 4RPYA 2BKEA 3B0YA 4F50A 3RAQA 4RQ6A 1ZYQA 4KTQA 7ICLA 3AQKA 1X2IA 4IRCA 4PHEA 5KFBA 3K75D 1HJPA 2ZUDA 4C8LA 3PVXA 2ZH7A 3UQ2A 2JZBB 2ZUBA 3EWAA 2VA8A 4EYHB 1V9PA 2FMPA 3WFQE 2M9NA 2R8IA 4ELTA 3NTUA 3WFSC 9ICUA 4UB3A 4LZDA 3OJSA 3RAXA 4KLSA 2C2DA 1ZQGA 4RWNA 4IRKA 3ZDEA 4XQ7A 4E0DA 4NXZA 2F1IA 2NRVA 1MSWD 4DLGA 1ZQXA 4GXKA 4R65A 1LV5A 8ICQA 4DLEA 3V7KA 3RBEA 4KLIA 3Q8LA 4X4TA 3ISDA 2VA2A 3HJ1A 2V4RA 3QZ7A 4QZCA 1TK8A 1U9LA 4WC4A 4R66A 4DOBA 3TAQA 4PHPA 1TKDA 3FYHA 4KLFA 8ICYA 9ICQA 4AT9B 4ECWA 1MQ3A 1ZQUA 5J2DA 3TQ1A 5BOLA 1NK6A 4B9TA 4KLMA 5HRHA 5CJ7A 3HPOA 1NOMA 3JYYA 1CUKA 4I2DA 3OHBA 3PX0A 4C8KA 4M6WB 4DQSA 7ICEA 2PBEA 3SYZA 4MF2A 4M0AA 2HHVA 4F91B 1T7PA 4KLOA 8ICWA 3V6JA 3BQ0A 3PO5A 4M6WA 3JPPA 5DQGA 1ZQTA 4M2YA 3T5LA 1CEZA 1UEUA 3T5KA 4E8FA 3WFOA 9ICMA 5D46A 3OHAA 8ICJA 4F93B 1NK4A 3RJIA 8ICZA 3BQ1A 2BCVA 4YFKA 3H40A 3TANA 4B9UA 1B22A 4UB5A 4Q43A 3ISCA 1S0NA 1S77D 2M2UA 1RYSA 1NK9A 5EWFA 5IINA 2KP7A 4JWMA 5DDMA 1K1QA 4QZIA 5IILA 4F4YA 2J6TA 2FLLA 4RWOA 3K4GA 4JK1A 1AROP 5KFDA 4ED0A 4NLKA 4RQ8A 2XCPA 3RJKA 4X4NA 4YQWA 3RBDA 1BPYA 5HRIA 1R89A 5CP2A 1ZQKA 5D49A 4R63A 2M2TA 8ICAA 8ICLA 4TUSA 5KFZA 3V6KA 4KLQA 5DEDA 2BQ3A 4F5PA 3SV3A 4ECTA 1FA0A 4ECRA 2IA6A 2PXIA 3MDAA 5KG2A 3JPTA 3H38A 4X4QA 1TFRA 2JEFA 4EZ6A 3H8WA 3ZD9A 5KFXA 5IIJA 5KTQA 3Q8RB 3Q8SB 3MGIA 5IIOA 2AGQA 4B9LA 5KFJA 1N56A 3GIJA 3ORYA 1SL2A 3HWTA 3SZ2A 4YVZA 3GV7B 3ZDAA 1DGSA 3KHRA 1D8LA 4DFKA 1UA1A 4JWNA 2W9MA 1VFGA 2PFPA 1ZQJA 5KFKA 2VANA 3UQ0A 3NYBA 3L9DA 5KG4A 4WC1A 2V9WA 4RQ3A 1KFDA 1YLQA 4F4ZA 2GWSA 2HHPA 5HHIA 3H39A 5KT7A 1WCLA 5J0RA 4F92B 5KFLA 1IM4A 5HRFA 2ZH3A
chains in the Genus database with same CATH superfamily
3RH5A 2QLTA 4PHAA 4O5KA 4NLCA 3C5GA 1TK5A 2ZH7A 3PW5A 2ASDA 4CE6A 2BQRA 3WK6A 1L7NA 4IL6U 1KRPA 4K8VA 3UXOA 2ZH6A 3V72A 2Q4TA 4O3SA 1V4AA 4C8MA 3QU4A 1U49A 1ED1A 7ICFA 5KT2A 3QYPA 1TFYA 7ICRA 5J2KA 1NJZA 2IHMA 2R8JA 2G5HB 4DSFA 1S97A 2HBMA 5KT5A 2YMLA 5EE3A 2HHTA 4YMOA 2PI5A 1ZQ1C 4OJ5A 1ZJNA 4KB6A 4CF4A 2R18A 2W11A 1ZQEA 5AKZA 1N61A 8ICVA 4I28A 2GAFD 4IG8A 2DGZA 4O3OA 2RP5A 5KFOA 4RNNA 4J03A 4ECXA 2NRKA 4WQKA 4DSLA 3TFRA 5KT6A 3WKBA 3MGHA 1P7DA 2B51A 1CI4A 4OAHA 8ICPA 3M6KA 7ICKA 5KG7A 4NXVA 2VIXA 5KFQA 1ZQAA 4AYBC 1NKEA 2EANA 2YY6A 4U7CA 1O03A 4EBEA 2YX8A 4J9PA 3FDSA 5B5EU 2KZZA 4Q45A 3B9JA 2LKYA 3KHGA 3THVA 4LZGA 1PZNA 4EYIB 4M47A 1X42A 4F8RA 4RQ7A 5L9XA 2O1PA 4DSEA 5ALTA 5KT3A 3M6ZA 3JPRA 2BR0A 2W3RA 4C4RA 5KAFU 1COKA 4PGXA 5DLFA 1BPZA 1T4GA 1YZ6A 4NLGA 4QZAA 1ECWA 1ZQBA 2BCQA 3RRGA 2EWRA 2VJ4A 3L4PA 2AH5A 4PGQA 4ZH4A 3AMZA 3K1ZA 4NXUA 4F4WA 1SL0A 2YQEA 5ALQA 5AKXA 2WB1F 1ZQWA 4DEZA 2ZH4A 1KN5A 4F4XA 2ISPA 1A76A 1UA0A 4QIWF 4KITB 2ATLA 3F2CA 4GC6A 3AU2A 1MN8A 2XCAA 4F5QA 3M1YA 2HW3A 4RQ5A 1S8OA 2W9BA 9ICCA 1COOA 4WC0A 1TE2A 4FS1A 2ZHBA 4EGWA 4CGZA 5KG1A 5EOZA 5GTIU 1ZD2P 2BBHA 3PW4A 4I2CA 5J2JA 3AUOA 4FH3A 2QARB 1ZQIA 2KHQA 2KMDA 7ICJA 2QARA 4M04A 4TUPA 3H8SA 3UMBA 3LYSA 1JX4A 3E0FA 3LK9A 1F44A 4UATA 3OWGA 4C7ZA 3ER9B 3PSPA 4GXJA 4PJ0U 4P4PA 4LVSA 2HHQA 1FFVA 4ED8A 1N48A 1BPEA 2BCRA 3TADC 2A1JB 4OJPA 4XQ8A 2KKPA 4MFCA 5AIBA 2ZTDA 1SZPA 2NO5A 1DOQA 2A1JA 5EE0A 4PH5A 4P4OA 5DBCA 4IQWA 5DB7A 3L3FX 1N63A 2HOQA 3RJJA 4BDPA 4GC7A 4QZBA 4JLXA 4YR2A 3TARA 1OW5A 1YZ7A 2VKQA 2E8MA 1M6YA 1FEZA 4UB1A 4EEYA 4RQ4A 5J0TA 2KZMA 5JTGA 2JH7A 5ALUA 5L1JA 4KX3A 5F3XB 5KFGA 1U47A 5D61A 3WFRE 1A6SA 2RDIA 3PY8A 4NJ8A 2G0AA 4ECUA 1RYUA 2BPCA 4RQ0A 3EUB2 2ZIWA 4WBYA 4X0AA 2VA3A 2LHTA 4FFDA 4O3NA 3BQ2A 4IRDA 4P2HA 2HN2A 4DF8A 4FHVA 1A77A 3M9OB 4P0PA 1HUOA 3IHQB 4YR3A 2IBKA 3WK9A 1R8AA 5KFTA 2K4IA 1RZTA 4QW9A 1DK3A 5DGAA 3QEAZ 5CEHA 2UVRA 3CK6A 5IIIA 4WCWA 4ELVA 4B9MA 3ETRA 2E8PA 3DDHA 2WAQC 2DVIA 3C28A 2JMGA 1TAQA 3PSFA 3PHZA 3AM9A 3WFPA 3H8JA 5AKKA 3MCRA 9ICEA 8ICGA 4RUAA 2DKZA 3D2NA 4JV1A 3SAGA 3M7DA 2AGPA 3TADA 1N2XA 1SL1A 4DOCA 2XVTA 3MFHA 3GQCA 2HCFA 1N5WA 4NM2A 5AK3A 1SZHA 2IOFA 5AKYA 4B6JA 4X4UA 4LJXA 3N7RC 1ZOLA 4J9MA 4O5EA 3A0BU 8ICXA 4DFJA 4OAGA 2BBJA 5DQHA 2LI6A 4RQNA 4EZ9A 2DL0A 2EZXA 1S0OA 2ZH9A 2WF5A 2XO7A 4CDGA 4F3OA 1Q79A 1B43A 1MC8A 3LDAA 4G9BA 3ZDDA 4NKUA 4AYBF 2K60A 1XSPA 4F72A 2R8GA 3C2LA 2IHOA 5ALJA 1RQNA 2NRXA 2ES6A 2G08A 2FMSA 3JPQA 5KFSA 3KZXA 5KFFA 5DLGA 3RFAA 3MR2A 2FMQA 4RZRA 2LBOA 2QKQA 4M9JA 2HDOA 4ICAA 5KG3A 8ICKA 3BJYA 1FFUA 4RPYA 5AM0A 3AQKA 4RQ6A 3IV6A 1X2IA 4C8LA 2ZUBA 1V85A 1V9PA 3NTUA 1MA7A 1WWUA 2ZIVB 1KKXA 4RWNA 3D6JA 4IRKA 2WF9A 4E0DA 4HX0A 2F1IA 1MSWD 1ZQXA 5AKHA 2ZIVA 8ICQA 3RBEA 3Q8LA 3F53A 2Z7JA 1J2NA 2VA2A 3HJ1A 1U9LA 1B4FA 3TAQA 3IN5A 4AT9B 1TKDA 9ICQA 4ECWA 2HI0A 5BOLA 5CJ7A 3HPOA 3PX0A 4C8KA 2PBEA 1Z19A 1T7PA 4KLOA 1CEZA 5DQGA 1LVHA 5AI4A 3OHAA 3CNHA 5AK6A 2DKXA 1B22A 3TANA 2EAMA 1PK3A 5EWFA 2KP7A 4JWMA 2FLLA 3K4GA 4JK1A 1AROP 4KMOB 4X4NA 3UMGA 1ZQKA 2MU2A 5DEDA 4F5PA 3SV3A 3SQIA 1FA0A 2KOBA 4ECRA 1D8BA 3QX7A 3MDAA 5KG2A 4K9AA 3JPTA 2DUYA 3I1YA 4US8A 2KV2A 3GIJA 1SL2A 3HWTA 3H0MB 4YVZA 3ZDAA 1LKYA 1D8LA 4DFKA 1UA1A 2ZIUB 4CNQA 2VANA 2YN4A 2NO4A 3L9DA 4EEKA 2V9WA 2HBKA 2HHPA 2ZIUA 3WK4A 3H39A 4JB3A 1WCLA 4F92B 3ZI4A 1IM4A 4BXOB 4NL9C 9ICHA 1KDHA 5D4BA 4BXOA 2I1QA 5JUMA 4DOAA 3F5AA 1NK5A 4ECYA 2EAPA 2DR5A 4WH5A 3ICXA 2CN1A 7ICUA 3E2EA 3QUCA 2B0CA 1ZQLA 3JPOA 2BGWA 5KG5A 1KQQA 4DL7A 2JEIA 2K4EA 3DEEA 3C2MA 1L7OA 1IV8A 2KTQA 5J2GA 5KFAA 5AI5A 3SMVA 4QZGA 4O68A 5L1IA 5J2CA 1RDFA 3PX6A 3QU7A 3QU5A 4FS2A 2WFAA 1LB2B 4GFJA 5TZVA 4LT6A 9ICVA 1NK8A 5ALFA 5J0UA 4I29A 4XA5A 1MIWA 2RQ5A 4O9MA 5F9NA 1NKCA 4EX7A 4XRHA 2V4QA 4X4RA 2YMMA 2P35A 4EV6A 2M2VA 3N28A 3GIIA 2A3VA 8ICBA 5GTHU 3KHLA 2R8KA 5C5JA 5J0OA 1UQVA 2HOIA 5DKWA 2OYYA 5J2EA 2AU0A 3G6YA 1KSPA 2Y0SC 3ISBA 1T8EA 9ICLA 2WF6A 3Q8PB 4N7RA 1PK1B 5J8YA 2G06A 4ECVA 1ZQFA 2F76X 2H5XA 2OHFA 2H3VA 3C5FA 4PHDA 3IRUA 2KFNA 3RB6A 3ERCC 4QZDA 2C2RA 4KLDA 1QQ5A 2EAOA 4ECQA 2FPMA 1RYRA 2DPJA 4EEBA 3PNCA 5ALLA 3O0FA 2AQ0A 4NL9A 2I9GA 3Q8QB 3H7IA 7ICNA 3OSNA 4KLTA 5KG0A 3AQEA 4DFMA 2KKVA 5ALMA 4GXIA 2JRZA 4P4MA 3RB4A 2OEHA 3ZD8A 4LEYA 2JHDA 4TUQA 4Z6CA 4JV0A 2BHNA 4QWDA 4WC5A 2P6RA 4OJOA 2ASJA 3T79A 4NKTA 3QZ8A 4F5RA 8ICTA 3PW2A 3KOOA 1ZJMA 4FO1A 2ZTCA 1DXSA 1Z00B 4F2RA 5KNIA 4J9KA 1ZQOA 4ED7A 7ICHA 4IR1A 4F4KA 1Z00A 4Y2QA 4EP7A 1BGXT 4YG2A 5AKEA 1KTQA 5A0LA 4RPXA 5HR6A 5AI8A 4UBCA 2KJ5A 4DFDA 1JXLA 3RJEA 2K8BB 3KBBA 2DR8A 2ZTEA 4J9OA 3NVYA 5EE1A 3OUYA 1R8CA 1NJYA 4QW8A 2F77X 8ICFA 2KSOB 1ZQRA 4RWPA 4FHWA 2KSOA 3QNMA 8ICRA 4U6PA 4YMMA 5DBAA 2ALZA 3SI8A 5KFRA 4K4GA 2O6KA 2WTFA 2BCUA 2K8AA 4YXJA 4DWIA 2DPIA 8ICMA 5CA7A 5AHXA 2RHFA 3JPNA 2C2EA 1O08A 4UQGA 3LWLA 3N4MB 1BNPA 4YD2A 1NK7A 1ZQVA 3GIKA 1ZETA 5J2AA 2KIWA 1L7PA 4DSJA 1UHUA 4KN7A 1JRPA 9ICKA 7ICTA 4Z6EA 5KAIU 9ICNA 4NLBA 5AM3A 5EWGA 2ZH5A 4RT3A 3RJFA 3C29A 3WK8A 5KFHA 2BDPA 1Z4NA 4I2AA 5HNKA 3RF9A 4I27A 4OAFA 3TAPA 5KFIA 4UAUA 1QSYA 4MHVA 2JZBA 2ZG6A 1ZQDA 5HRBA 5KFCA 3GDXA 3HP6A 2UVWA 2BDUA 3WK7A 2OXOA 4K96A 3QE9Y 4Z6FA 7ICSA 4EBJA 1N62A 4UD4A 7ICPA 4TQRA 3LWMA 3RRHA 7ICIA 1L7MA 2FDRA 5J0PA 3C2KA 1PVQA 1JIHA 9ICPA 2FLNA 3UPQA 2WF8A 2WF7A 4BWJA 5HMMA 1ZQZA 4PZNA 4DL3A 4E7XA 4C80A 3MR5A 3C1ZA 1BPDA 1OUQA 2O5AA 2ASLA 1J97A 5KFVA 4CCHA 3NRWA 1MQ2A 1MIYA 3QU9A 1XSNA 4Y2SA 2KVCA 2W9BB 3FAHA 4F5OA 2HSZA 2KEYA 1Z3EB 3TKAA 2MSNA 2YB1A 3V7LA 4OAIZ 4QZHA 3I28A 1RXWA 2B6GA 9ICRA 1L3SA 4NV0A 4HAIA 4DQPA 4K9BA 1SIJA 1R8BA 1S0VA 3H3AA 1JI7A 2P6UA 3F5EA 4NWIA 1XO1A 1B0XA 1SWWA 5DG8A 1SXEA 2BCSA 1ZD4A 3BS5B 3G6XA 3UXPA 2MUTB 4XJEA 1SKSA 5IIKA 3CP8A 3BS5A 4FE3A 1NKBA 2MUTA 5DG7A 1ZQCA 4B9NA 4BGDA 3H0RB 5KFYA 9ICTA 5D62A 1RM6C 3HKZC 9ICIA 4I2GA 1VJ5A 4UAYA 4FZLA 1VLBA 4QZ8A 4M5DA 1U45A 4I2IA 5JU5A 4K97A 4UD5A 4RNOA 5DB9A 3C1YA 5J2HA 5F9LA 1ZQMA 4O3PA 3RJGA 3RTVA 1Z1BA 3M9NB 1D9FA 4RUCA 3H37A 2BQUA 5HRGA 4F50A 7ICLA 1HJPA 4MKPA 2KHVA 4O3MA 3WFQE 2M9NA 2R8IA 1OXJA 9ICUA 2FI1A 4LZDA 3OJSA 5EE9A 2NRVA 3KFUF 2OCEA 3QUQA 2LMRA 1N5XA 4USAA 3H8MA 4WC4A 4R66A 2ZIWB 4PHPA 2LPEA 8ICYA 4LEZA 3AL0B 4JMUA 1NK6A 4B9TA 4DQSA 1RG6A 4M0AA 3A0HU 4P0PB 1QQ6A 3V6JA 2A19A 2HBJA 4UAVA 1ZQTA 1UEUA 9ICMA 5ALHA 1PUZA 4F93B 1NK4A 3RJIA 8ICZA 2BCVA 4UB5A 2H3QA 5E79U 3ISCA 1S0NA 2M2UA 3KD3A 4Y2RA 1X66A 4OJ6A 1WWVA 5KFDA 1R89A 1Q3UA 3S6JA 8ICAA 8ICLA 4TUSA 3BS7A 3V6KA 2BQ3A 4ECTA 2PXIA 4Y2TA 3K1RB 3NKUA 4EZ6A 3BZKA 5ALKA 3MGIA 3ZD9A 3Q8RB 5KTQA 4EBKA 1N56A 3NVZA 2FJ6A 3GV7B 3LVVA 1DGSA 5ALGA 1NZBA 2ESEA 1ZQJA 5KFKA 3UQ0A 3NYBA 2GWSA 5HHIA 4F4YA 5J0RA 5KFLA 2P66A 1SKRA 2HHXA 2DWQA 4EELA 1S76D 3AQLA 1IIPA 2ZH3A 4E80A 4X0BA 4YMNA 2E8NA 1HIWA 8ICNA 4FHXA 1Z4OA 2HBLA 4NXWA 3AQMA 4M9NA 3LVWA 3NVOA 2E1EA 1HEKA 4CF3A 4PPXA 2IHNA 4MEYA 1X6IA 3WKCA 5KFNA 1S9FA 4C0ZA 3C66A 5CFUA 5JTIA 1Q3VA 1RQLA 1S0MA 3MR6A 1DGJA 3BZCA 5KT4A 4I2EA 2KNJA 2JGAA 1T3QA 3GIMA 4RQ1A 2NRZA 5ALRA 5BOMA 3NWIA 2IMWP 4YD1A 1UPHA 4UAZA 1K5OA 1TAUA 1KNYA 9ICWA 3BQ7A 1X9XA 1ZQSA 1Q46A 4P0QA 4AT7A 4K99A 4KLUA 4AP9A 4MF8A 5HP4A 4IQVA 2OWOA 4I2HA 2AHOB 4DL4A 4B9VA 4BX9C 2NYVA 5DQIA 4C4SA 2M0NA 3F2BA 3QEBZ 1ZQQA 1XNSA 5KG6A 4KX5A 3PSTA 4ED6A 1Q8KA 2I6XA 2EDUA 2KICA 2ZIXB 2Y9UA 1KW4A 2LM4A 3WKAA 5D63A 4WC2A 2ZIXA 3QXGA 3ZDBA 4O6AA 1JN3A 2Q0ZX 1DRGA 4FHPA 4ELUA 3PV8A 4X4VA 5HRLA 3JPSA 1ZD3A 5CR0A 1FO4A 2DQNB 7ICGA 4Q44A 2R8HA 4X4SA 2Q66A 3KHHA 2FPLA 5EWEA 3PMLA 5J8YC 2DFLA 4J9QA 1TV9A 3M8RA 4YN4A 2ZJ5A 4J9SA 1LKYB 5DG9A 3PX4A 4X4OA 5AI9A 2XY7A 3OSPA 4IC9A 1BVSA 3K7DA 2FE9A 2W9AA 5J0XA 2RFFA 5DB8A 4KLGA 4UBBA 2W7OA 3RH4A 4GIBA 5KL8B 2W8LA 2UVVA 5CHGA 1UT8A 5B3PA 4M9HA 2C22A 8ICIA 9ICFA 3HKZF 1C20A 3KTQA 1UCVA 4F5NA 4KM5A 1F0MA 3JZ0A 1WUDA 1NK0A 5CFSA 1QTMA 3MBYA 3GZFA 4UB6U 2AJQA 3Q8KA 3MDCA 4J9RA 3SENA 4RWQA 4ATBB 2GA9D 4FZMA 1H38A 4I2BA 1SKWA 4EENA 2BPGA 4ATBA 2KG5A 1SV0C 4B9SA 4O5CA 3RJHA 4M9LA 3MFIA 2D6FC 4G3IA 4DQRA 2K89A 4DL6A 3J81j 4QNLA 9ICXA 2B21A 4WC7A 4K98A 1QSSA 2RLTA 2CXYA 5HMLA 1TAMA 2GLEA 3TACB 5AM4A 2I5HA 1L6NA 2F8LA 1ZQHA 5J0WA 3NS1A 4IQTA 3T5HA 1CRXA 1EXNA 3G6VA 5F2VO 2ZJ8A 2W8KA 2JEGA 5AM5A 5AM2A 2F8KA 3TI0A 2CPRA 1ZRNA 3E58A 1KLNA 3T3FA 4X5VA 1YT3A 1BPXA 4ACOA 4AT8B 3EYZA 2GH1A 4WC3A 2HVIA 4ECSA 2ODGA 4AT8A 3D2QA 4R8UB 2WAQF 2LYHA 4R8UA 4MFAA 2VJ5A 4UB4A 2KFZA 3L5KA 2DR9A 3VCBA 3PR5B 2EH9A 2JH1A 3WKDA 4KLEA 9ICJA 5K4LA 1QCKA 5HR9A 1MIVA 2AGOA 1KFSA 4DSKA 3EZ5A 4EEDA 3EPGA 1X9SA 3KZIU 2QB0B 3RR8A 3AQFA 1NI3A 5J2BA 3F2DA 3C18A 5BPCA 1XU4A 2QB0A 2FPKA 5HREA 2J6SA 1L3UA 3IG5A 1SV0A 4WQLA 1SXDA 1K1SA 1XO0A 1QSLA 2DRBA 9ICGA 1RXVA 4LEWA 1JALA 4ECZA 3CYMA 4QWCA 4J9LA 2ID1A 1J2MA 4OJLA 2G09A 2HHWA 2FLPA 1IXRA 4C4TA 1X9WA 1L5UA 2DRAA 4DCCA 2W7PA 1XS9D 3M8SA 4ED3A 1UT5A 3UMCA 4FHYA 3OUYB 2BE3A 2HOFA 4O0IA 4Y2UA 3PW7A 4PL1A 5ALZA 3HW8A 2XGPA 1XSLA 4JV2A 2B4VA 5C0YA 3RB3A 3V7JA 3UM9A 3ER8C 4NLZA 5J2IA 4MFFA 5G5HA 2OH2A 3ED5A 2W3SA 2AQ4A 3PW0A 4BUGA 3OV7A 2Y1JA 1C7YA 4UASA 3TFSA 2KD1A 3OPXA 5KFMA 7ICQA 4QZFA 1NZPA 4QWEA 2XY5A 1A0PA 5KFEA 2MAXA 4RNMA 3BQTA 4K4IA 2ZH8A 3ALRA 3M9MB 2YMPA 1AQ6A 2BKEA 4OCZA 4KTQA 1ZYQA 5ALVA 4IRCA 3D2SA 2ZUDA 2JZBB 3EWAA 2FMPA 2D3DA 4O67A 3WFSC 3N7SC 4OO1J 3IG8A 2C2DA 4XQ7A 2KIVA 1QQ7A 4DLGA 3MC1A 2H3IA 1LV5A 2V4RA 4UB8U 1TK8A 5CRXA 1ZQUA 5J2DA 4KLMA 2IOHA 3OHBA 4M6WB 7ICEA 4PZOA 4MF2A 2HHVA 4F91B 3BQ0A 3PO5A 4M6WA 3JPPA 4M2YA 3T5LA 5G5GA 3T5KA 4WJ3B 3WFOA 2CRXA 2MA1A 2Y9TA 4YFKA 3H40A 1PVPA 1NK9A 5IINA 5DDMA 1K1QA 4QZIA 5IILA 4Y2XA 2J6TA 2K4PA 2F3NA 4RWOA 4NLKA 4ED0A 4YQWA 1BPYA 4R63A 4KLQA 2IA6A 1SWVA 1QH9A 4X4QA 1TFRA 2AXTU 3FC4A 5CFTA 2YB4A 3Q8SB 3H8WA 5IIJA 2MRLA 4JWNA 3KHRA 4Y2VA 5AKGA 2W9MA 1VFGA 1PVRA 1KFDA 2LM1A 2LYBA 4RPZA 5HRFA 4WOYA 4C8NA 2E3TA 4XUSA 3AN1A 4RU9A 4DQIA 4UAWA 3Q8MA 3OVBA 1XWLA 3SEIA 4YR0A 2XICA 3I76A 4WC6A 5ALDA 1L8LA 4DF4A 4KLLA 4K4HA 3H0LB 1Y88A 1ZQYA 3ONNA 2XIDA 2Y0SF 1WOTA 1GPJA 2JR5A 2Y1IA 3B0XA 5AI6A 2C28A 2B56A 5KFPA 4NXXA 9ICAA 5DDYA 3R9KA 3RB0A 8ICOA 2IUBA 4KMUA 3IM1A 4S3NA 4UARA 5FP0A 3VC8A 5AKLA 2NV3A 5CB1A 5J2FA 3QUTA 5HRKA 4NM1A 3GV8B 3H4DA 2RRDA 3C23A 3EPIA 2W9CB 5J0QA 2PFNA 2JEJA 1TFWA 1XC9A 8ICEA 7ICVA 1JXEA 4O3RA 2W9CA 2EQYA 1UETA 3IDWA 4NXTA 3NVVA 4PL2A 1OU5A 4JLZA 9ICSA 1BPBA 2W54A 2ZHAA 3NRZA 3GILA 2ZH1A 3NGDA 4I2JA 5J0YA 5DB6A 3HJEA 4QZ9A 4GLXA 3MGVA 4TQSA 1PX5A 5B66U 4F71A 1V97A 3UPSA 5ALXA 3SV4A 2WHEA 5AK4A 4FBUA 1VJ7A 2KZ3A 2PFQA 3PR4A 5ALEA 5CHEA 2XI9A 3QU2A 3WKEA 1JAJA 5AK5A 4DL2A 4FO6A 3HJ4A 4DS5A 2ZXHA 5CWRA 1WCNA 1TK0A 4IR9A 2G07A 3H4BA 3U26A 8ICHA 4NLNA 3PZPA 4DL5A 1GO3F 2HHSA 2E1FA 7ICOA 4CF5A 4DQQA 1U48A 3GFKB 5HHHA 4CRXA 1T94A 3HT3A 5ALWA 3OGUA 3BDPA 8ICCA 3OTQA 2L5YA 3MR3A 2ISOA 1NO5A 8ICSA 2PKEA 2W03A 3OVAA 1D9DA 2HVHA 1IG6A 4ED1A 2PMZC 5TISU 3AU6A 1RPLA 2KJ9A 1JROA 3CW2C 4YP3A 4QJFB 1NJWA 2RDJA 1KBUA 1ZD5A 3EW9A 1S5LU 3PMNA 5L1MA 2NRTA 5IIMA 1DK2A 2PI4A 4MEXA 2KVSA 2PFOA 3HIYA 4KLHA 1F5AA 4DS4A 4WBZA 2G5IB 2ZXIA 1S10A 2XY6A 3ZDCA 4O3QA 1ZXIA 4O69A 3GV5B 3IP4B 5L1KA 4P0QB 4AT7B 3N97B 5KL1B 4OD0A 1JMSA 2NRWA 4F2SA 3AQNA 3OJUA 3CRXA 2W55A 3NUQA 5ALNA 5ALYA 4IQUA 5J29A 3RH6A 4QWAA 4RT2A 5ALSA 4ED2A 3WK5A 2F44A 3PSIA 2W04A 3HRDD 5ALOA 5AM1A 1KFTA 4C8OA 1BNOA 9ICOA 5AICA 2HN1A 1FIQA 1D8YA 3QUBA 2UVUA 1ZQPA 3RR7A 1NJXA 3SD7A 9ICBA 1KEJA 1ZQNA 2FCLA 1JUDA 2M2WA 4AT9A 2W43A 3T5JA 2DR7A 2DF4B 4KN4A 4JUZA 5L1LA 3OVSA 4RQ2A 5J0SA 2BZFA 4FH5A 4R64A 4HYKA 1NNLA 5JRTA 5DECA 1SGGA 4TURA 1JQRA 2ZJAA 2EZZA 5KFWA 4FBTA 2F1JA 3NASA 1V38A 3EF2A 4J9NA 2OM6A 4Q8FA 4NY8A 3V6HA 8ICUA 2F2AB 1SB3C 3FM9A 1URJA 2IOFK 4DFPA 4BJQA 4I2FA 2K4HA 4EX6A 1QLNA 2HMXA 4Q8EA 4QWBA 1X6JA 3C21A 2EZYA 2KK0A 3PO4A 3SR6A 1U4BA 5AKJA 4FZNA 3KKAC 3NVWA 2DBYA 1Q78A 1X9MA 3LQCB 2YTUA 1Z1VA 2QB1A 2WB1C 2J6UA 4YXMA 2HHUA 4X4PA 4UW9A 2XGQA 4EBCA 2BPFA 2KN7A 4DO9A 2KE7A 2E8OA 4QIWC 2ZH2A 2XC9A 5AIAA 2ZUCA 4UB2A 4EBDA 4I0UA 1SV4A 1T3NA 2F1HA 4ZOHC 1L3VA 5HC9A 4PGYA 4DSIA 4KLJA 3HX0A 2JXJA 5KFUA 1HUZA 4Y2PA 3MABA 5B3QA 4BWMA 2JV3A 3ETLA 2KJ8A 5AKIA 1TVAA 4M9GA 4RQMA 3UXNA 4Y2JA 5DBBA 1L3TA 1UEVA 4YCXA 5DGBA 5HRDA 4Z6DA 1ZRMA 2YMQA 3WU2U 4QZEA 3B0YA 3RAQA 5HR7A 1WYGA 4PHEA 5KFBA 3K75D 1KL9A 2H3FA 3PVXA 3HILA 3UQ2A 2VA8A 4EYHB 4ELTA 4A8EA 1L8OA 4UB3A 3RAXA 4KLSA 1ZQGA 5T14A 3ZDEA 4NXZA 5AI0A 4GXKA 4C7YA 4R65A 4DLEA 3V7KA 2K8CB 4KLIA 4X4TA 3ISDA 3QZ7A 4QZCA 4DOBA 4KLFA 3FYHA 1PK1A 1MQ3A 3TQ1A 2LYAA 2A1AA 4US9A 5HRHA 1NOMA 3JYYA 1CUKA 4I2DA 3SAHA 3KKAA 3SYZA 3N7PD 2N1RA 8ICWA 4E8FA 2GOLA 5D46A 5ALPA 8ICJA 3BQ1A 3JCFA 4B9UA 4Q43A 1S77D 5H2FU 1RYSA 3DV9A 1F5SA 2H3ZA 4RQ8A 2XCPA 3RJKA 3RBDA 5HRIA 5CP2A 5D49A 2M2TA 1X40A 5KFZA 2D8CA 5ALIA 3AEVA 3H38A 4LEVA 2JEFA 1WG8A 7ICMA 5KFXA 4B9LA 2AGQA 5IIOA 5KFJA 4IS7A 3ORYA 2PMZF 3SZ2A 3SAFA 3GU3A 2E5SA 2PFPA 1N60A 4WC1A 5KG4A 4Y2YA 4RQ3A 1VDVA 1YLQA 4F4ZA 5KT7A 2GO7A
chains in the Genus database with same CATH topology
3RH5A 2P66A 1SKRA 9ICHA 1KDHA 5D4BA 2HHXA 4C8NA 4PHAA 4BXOA 4O5KA 1S76D 4XUSA 3C5GA 1TK5A 2I1QA 5JUMA 4RU9A 4DQIA 3AQLA 4E80A 4DOAA 4X0BA 4UAWA 4YMNA 3PW5A 3Q8MA 2ASDA 3OVBA 1XWLA 4ECYA 2BQRA 1NK5A 1KRPA 4YR0A 8ICNA 4FHXA 3UXOA 4WC6A 2ZH6A 2DR5A 3V72A 4DF4A 4KLLA 4WC5A 4O3SA 1V4AA 4C8MA 4K4HA 3AQMA 1Y88A 1U49A 1ZQYA 4M9NA 7ICUA 3E2EA 7ICFA 5KT2A 7ICMA 1ZQLA 1TFYA 3JPOA 2BGWA 7ICRA 5KG5A 5J2KA 4DL7A 1NJZA 2IHMA 2JEIA 3C2MA 1WOTA 4PPXA 5J2GA 2KTQA 2R8JA 4DSFA 2Y1IA 1S97A 2IHNA 3B0XA 2C28A 5KFAA 5KT5A 2HHTA 5KFPA 4QZGA 4YMOA 2PI5A 4MEYA 5L1IA 9ICAA 5J2CA 5DDYA 3PX6A 1ZJNA 5KFNA 3RB0A 4FS2A 1LB2B 8ICOA 1S9FA 5TZVA 4LT6A 9ICVA 3C66A 1NK8A 1ZQEA 5J0UA 4I29A 4KMUA 4XA5A 3IM1A 8ICVA 1MIWA 4S3NA 4O9MA 4I28A 1S0MA 3MR6A 5F9NA 4I2EA 5KT4A 1NKCA 4IG8A 4XRHA 2V4QA 4X4RA 3GIMA 2M2VA 4O3OA 2NRZA 5CB1A 5J2FA 4RQ1A 3GIIA 4NM1A 8ICBA 5HRKA 3GV8B 3H4DA 5KFOA 5BOMA 4RNNA 3KHLA 3C23A 5C5JA 2R8KA 5J0OA 4YD1A 3EPIA 4ECXA 2IMWP 2W9CB 2NRKA 5J0QA 2PFNA 4UAZA 2JEJA 4DSLA 1XC9A 5DKWA 5J2EA 3TFRA 5KT6A 8ICEA 1TAUA 7ICVA 1KNYA 1JXEA 9ICWA 2AU0A 3MGHA 3G6YA 4O3RA 2W9CA 1UETA 1ZQSA 1KSPA 4AT7A 8ICPA 4KLUA 3ISBA 7ICKA 5KG7A 1T8EA 1OU5A 4MF8A 9ICLA 5KFQA 1ZQAA 5HP4A 4IQVA 9ICSA 1BPBA 1NKEA 2ZHAA 2OWOA 4I2HA 3Q8PB 3GILA 2ZH1A 4EBEA 3NGDA 4ECVA 1ZQFA 4I2JA 5J0YA 2H5XA 5DB6A 3C5FA 4J9PA 4DL4A 3FDSA 4PHDA 4B9VA 4QZ9A 4GLXA 2KFNA 3RB6A 2KZZA 4Q45A 5DQIA 4QZDA 3KHGA 4TQSA 2C2RA 4KLDA 1PX5A 3THVA 3QEBZ 4LZGA 1ZQQA 1PZNA 4EYIB 4ECQA 4M47A 5KG6A 4F8RA 4RQ7A 5L9XA 2FPMA 1RYRA 4ED6A 2DPJA 3PNCA 3UPSA 3SV4A 2AQ0A 2I9GA 2O1PA 3Q8QB 3H7IA 4DSEA 4FBUA 7ICNA 5KT3A 1VJ7A 3JPRA 2BR0A 4WC2A 3OSNA 4PGXA 4F4WA 4KLTA 5DLFA 1BPZA 2KZ3A 2PFQA 1T4GA 5KG0A 3ZDBA 1JN3A 2Q0ZX 3PR4A 4DFMA 4NLGA 4QZAA 4GXIA 4P4MA 1ZQBA 4FHPA 4ELUA 3PV8A 3RB4A 2BCQA 4X4VA 5HRLA 1JAJA 4DL2A 4FO6A 3JPSA 3ZD8A 3RRGA 3HJ4A 5CR0A 4DS5A 7ICGA 5CWRA 4Q44A 2R8HA 1WCNA 4PGQA 1TK0A 4X4SA 3KHHA 4ZH4A 4IR9A 2FPLA 4TUQA 2Q66A 4Z6CA 5EWEA 3PMLA 2DFLA 4JV0A 4J9QA 2BHNA 4QWDA 4YN4A 3M8RA 3H4BA 2ZJ5A 4J9SA 1TV9A 2P6RA 8ICHA 2ASJA 5DG9A 4NLNA 3PX4A 1ZQWA 4NKTA 4X4OA 2XY7A 3QZ8A 4DEZA 4F5RA 4DL5A 3OSPA 2ZH4A 1BVSA 8ICTA 4F4XA 2W9AA 1A76A 3PW2A 1ZJMA 5J0XA 2ISPA 2HHSA 7ICOA 2ZTCA 1UA0A 2RFFA 5DB8A 1Z00B 4KLGA 4UBBA 3RH4A 4DQQA 4F2RA 4KITB 2ATLA 4GC6A 1ZQOA 4J9KA 1U48A 4ED7A 3GFKB 3AU2A 5HHHA 7ICHA 4IR1A 4F4KA 1Z00A 2XCAA 4F5QA 1BGXT 4EP7A 2W8LA 2UVVA 4YG2A 3HT3A 1KTQA 4RPXA 5CHGA 2HW3A 3OGUA 4UBCA 1UT8A 4RQ5A 3BDPA 4M9HA 1JXLA 2C22A 8ICIA 9ICFA 3RJEA 8ICCA 3KTQA 4F5NA 2W9BA 9ICCA 3MR3A 1COOA 2ISOA 4WC0A 1NO5A 8ICSA 4FS1A 3OVAA 2DR8A 3JZ0A 2ZTEA 2ZHBA 1D9DA 1NK0A 4J9OA 5KG1A 5EOZA 1QTMA 3MBYA 3OUYA 1R8CA 2AJQA 3Q8KA 3MDCA 2HVHA 1NJYA 4QW8A 3PW4A 4I2CA 4J9RA 5J2JA 4ED1A 3AUOA 3AU6A 4FH3A 1RPLA 8ICFA 4RWQA 4ATBB 1ZQIA 4YP3A 1H38A 1NJWA 1SKWA 4I2BA 2RDJA 1UEVA 3EW9A 1ZQRA 7ICJA 2BPGA 4ATBA 3PMNA 5IIMA 2NRTA 4RWPA 1DK2A 4M04A 4TUPA 4FHWA 4B9SA 4O5CA 2PI4A 4MEXA 2PFOA 5DBAA 3H8SA 4YMMA 2ALZA 3RJHA 3SI8A 4M9LA 3MFIA 8ICRA 3HIYA 4KLHA 1JX4A 4G3IA 1F5AA 5KFRA 3LK9A 4DS4A 2WTFA 4K4GA 4DQRA 2BCUA 4DL6A 4YXJA 4DWIA 9ICXA 2B21A 2DPIA 4WC7A 4WBZA 8ICMA 5CA7A 4GXJA 4P4PA 3JPNA 1QSSA 4LVSA 2HHQA 2C2EA 1S10A 4UQGA 4ED8A 3LWLA 2XY6A 5HMLA 4O3QA 3N4MB 1N48A 3ZDCA 4YD2A 1NK7A 1ZQVA 3GIKA 1ZETA 1BNPA 1BPEA 5J2AA 3GV5B 5L1KA 2BCRA 4DSJA 4KN7A 4AT7B 3N97B 2A1JB 9ICKA 4XQ8A 1ZQHA 5J0WA 4MFCA 4RPZA 7ICTA 1JMSA 2NRWA 4IQTA 2ZTDA 1SZPA 4Z6EA 3T5HA 1DOQA 1EXNA 3G6VA 4F2SA 9ICNA 2A1JA 5F2VO 2ZJ8A 4P4OA 4PH5A 5DBCA 2W8KA 2JEGA 5EWGA 3OJUA 4IQWA 5DB7A 3AQNA 2ZH5A 4RT3A 3RJFA 3RJJA 3TI0A 4BDPA 4IQUA 5J29A 4GC7A 4QZBA 3RH6A 5KFHA 4RT2A 4YR2A 4QWAA 3TARA 1KLNA 4ED2A 2BDPA 3T3FA 4I2AA 4X5VA 5HNKA 1BPXA 1KFTA 4C8OA 4AT8B 4UB1A 3EYZA 1BNOA 4I27A 4EEYA 3TAPA 4RQ4A 5KFIA 5J0TA 4WC3A 9ICOA 1QSYA 2HVIA 2KZMA 4ECSA 4AT8A 5L1JA 2JZBA 4R8UB 5KFGA 1U47A 1ZQDA 3WFRE 1D8YA 5HRBA 2UVUA 5KFCA 3GDXA 2RDIA 3HP6A 2UVWA 2LYHA 4R8UA 1ZQPA 4MFAA 2KFZA 4UB4A 3PY8A 3RR7A 1NJXA 9ICBA 4ECUA 1KEJA 1ZQNA 3QE9Y 2BPCA 4RQ0A 2M2WA 2DR9A 4Z6FA 7ICSA 4EBJA 3PR5B 4WBYA 4AT9A 3T5JA 2DR7A 4UD4A 4KN4A 4JUZA 5L1LA 4KLEA 9ICJA 7ICPA 4X0AA 3OVSA 4TQRA 3LWMA 2VA3A 4RQ2A 3BQ2A 4O3NA 5HR9A 4IRDA 5J0SA 3RRHA 7ICIA 1MIVA 4P2HA 4FH5A 2AGOA 4R64A 4HYKA 1KFSA 4DF8A 4DSKA 5DECA 3EZ5A 5J0PA 4FHVA 1A77A 3M9OB 3EPGA 4TURA 3C2KA 1X9SA 1HUOA 3IHQB 4YR3A 1JQRA 2IBKA 1R8AA 2ZJAA 1JIHA 9ICPA 5KFTA 2FLNA 3RR8A 5KFWA 3UPQA 1RZTA 4FBTA 2F1JA 4BWJA 5J2BA 5HMMA 3C18A 4QW9A 5BPCA 1XU4A 1DK3A 5DGAA 4J9NA 3QEAZ 1SL0A 2UVRA 2FPKA 5IIIA 1ZQZA 2J6SA 5HREA 4WCWA 4ELVA 4Q8FA 4DL3A 4B9MA 1L3UA 4E7XA 3MR5A 4NY8A 3C1ZA 4EBKA 1BPDA 3V6HA 8ICUA 2DVIA 1K1SA 1QSLA 2O5AA 2ASLA 1TAQA 2DRBA 5KFVA 4CCHA 9ICGA 4DFPA 1RXVA 1MQ2A 1MIYA 3WFPA 3H8JA 1XSNA 9ICEA 4I2FA 8ICGA 4ECZA 4QWCA 4J9LA 2ID1A 2W9BB 1QLNA 4F5OA 4RUAA 2HHWA 2FLPA 4QWBA 1Z3EB 1IXRA 1X9WA 4Q8EA 4JV1A 1L5UA 2DRAA 3V7LA 1XS9D 3C21A 2AGPA 3PO4A 4QZHA 3M8SA 4ED3A 1SL1A 1U4BA 1UT5A 1RXWA 4DOCA 9ICRA 1L3SA 4FHYA 2BE3A 3OUYB 3MFHA 3GQCA 1Q78A 4O0IA 4DQPA 1R8BA 3PW7A 1X9MA 3LQCB 1S0VA 3H3AA 3HW8A 4NM2A 2P6UA 2J6UA 4YXMA 1XO1A 5DG8A 2HHUA 4X4PA 4X4UA 2XGPA 2XGQA 2BCSA 4EBCA 1XSLA 2BPFA 2KN7A 3G6XA 4DO9A 4JV2A 3UXPA 4J9MA 2MUTB 4O5EA 1SKSA 5IIKA 8ICXA 2ZH2A 2XC9A 4DFJA 2ZUCA 3RB3A 3V7JA 1NKBA 2MUTA 5DG7A 4UB2A 1ZQCA 4EBDA 4B9NA 5DQHA 4EZ9A 4NLZA 1S0OA 5J2IA 4MFFA 4BGDA 2ZH9A 5KFYA 1T3NA 2F1HA 1L3VA 5HC9A 2XO7A 9ICTA 4PGYA 4F3OA 1Q79A 1B43A 4DSIA 2AQ4A 1MC8A 3LDAA 9ICIA 4I2GA 4KLJA 3HX0A 3ZDDA 4UAYA 4NKUA 4QZ8A 5KFUA 3PW0A 1TFWA 1HUZA 3OV7A 1XSPA 3MABA 2Y1JA 1C7YA 4M5DA 1U45A 4I2IA 3TFSA 2R8GA 3C2LA 4BWMA 2NRXA 3ETLA 4BXOB 5KFMA 7ICQA 4M9GA 1TVAA 4QZFA 4UD5A 4RNOA 3UXNA 2FMSA 5DBBA 5DB9A 1L3TA 4QWEA 1NZPA 2XY5A 3C1YA 3JPQA 5KFSA 4YCXA 5J2HA 5KFFA 5DLGA 2MAXA 5KFEA 5F9LA 1ZQMA 3MR2A 4O3PA 5DGBA 4RNMA 3RJGA 2FMQA 3BQTA 4RZRA 3M9NB 3RTVA 4K4IA 2ZH8A 4M9JA 4Z6DA 3M9MB 5HRDA 5KG3A 4RUCA 1D9FA 8ICKA 3H37A 2BQUA 5HRGA 3BJYA 4QZEA 4RPYA 2BKEA 3B0YA 4F50A 3RAQA 4RQ6A 1ZYQA 4KTQA 7ICLA 3AQKA 1X2IA 4IRCA 4PHEA 5KFBA 3K75D 1HJPA 2ZUDA 4C8LA 3PVXA 2ZH7A 3UQ2A 2JZBB 2ZUBA 3EWAA 2VA8A 4EYHB 1V9PA 2FMPA 3WFQE 2M9NA 2R8IA 4ELTA 3NTUA 3WFSC 9ICUA 4UB3A 4LZDA 3OJSA 3RAXA 4KLSA 2C2DA 1ZQGA 4RWNA 4IRKA 3ZDEA 4XQ7A 4E0DA 4NXZA 2F1IA 2NRVA 1MSWD 4DLGA 1ZQXA 4GXKA 4R65A 1LV5A 8ICQA 4DLEA 3V7KA 3RBEA 4KLIA 3Q8LA 4X4TA 3ISDA 2VA2A 3HJ1A 2V4RA 3QZ7A 4QZCA 1TK8A 1U9LA 4WC4A 4R66A 4DOBA 3TAQA 4PHPA 1TKDA 3FYHA 4KLFA 8ICYA 9ICQA 4AT9B 4ECWA 1MQ3A 1ZQUA 5J2DA 3TQ1A 5BOLA 1NK6A 4B9TA 4KLMA 5HRHA 5CJ7A 3HPOA 1NOMA 3JYYA 1CUKA 4I2DA 3OHBA 3PX0A 4C8KA 4M6WB 4DQSA 7ICEA 2PBEA 3SYZA 4MF2A 4M0AA 2HHVA 4F91B 1T7PA 4KLOA 8ICWA 3V6JA 3BQ0A 3PO5A 4M6WA 3JPPA 5DQGA 1ZQTA 4M2YA 3T5LA 1CEZA 1UEUA 3T5KA 4E8FA 3WFOA 9ICMA 5D46A 3OHAA 8ICJA 4F93B 1NK4A 3RJIA 8ICZA 3BQ1A 2BCVA 4YFKA 3H40A 3TANA 4B9UA 1B22A 4UB5A 4Q43A 3ISCA 1S0NA 1S77D 2M2UA 1RYSA 1NK9A 5EWFA 5IINA 2KP7A 4JWMA 5DDMA 1K1QA 4QZIA 5IILA 4F4YA 2J6TA 2FLLA 4RWOA 3K4GA 4JK1A 1AROP 5KFDA 4ED0A 4NLKA 4RQ8A 2XCPA 3RJKA 4X4NA 4YQWA 3RBDA 1BPYA 5HRIA 1R89A 5CP2A 1ZQKA 5D49A 4R63A 2M2TA 8ICAA 8ICLA 4TUSA 5KFZA 3V6KA 4KLQA 5DEDA 2BQ3A 4F5PA 3SV3A 4ECTA 1FA0A 4ECRA 2IA6A 2PXIA 3MDAA 5KG2A 3JPTA 3H38A 4X4QA 1TFRA 2JEFA 4EZ6A 3H8WA 3ZD9A 5KFXA 5IIJA 5KTQA 3Q8RB 3Q8SB 3MGIA 5IIOA 2AGQA 4B9LA 5KFJA 1N56A 3GIJA 3ORYA 1SL2A 3HWTA 3SZ2A 4YVZA 3GV7B 3ZDAA 1DGSA 3KHRA 1D8LA 4DFKA 1UA1A 4JWNA 2W9MA 1VFGA 2PFPA 1ZQJA 5KFKA 2VANA 3UQ0A 3NYBA 3L9DA 5KG4A 4WC1A 2V9WA 4RQ3A 1KFDA 1YLQA 4F4ZA 2GWSA 2HHPA 5HHIA 3H39A 5KT7A 1WCLA 5J0RA 4F92B 5KFLA 1IM4A 5HRFA 2ZH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH5 A;  2P66 A;  1SKR A;  9ICH A;  1KDH A;  5D4B A;  2HHX A;  4C8N A;  4PHA A;  4BXO A;  4O5K A;  1S76 D;  4XUS A;  3C5G A;  1TK5 A;  2I1Q A;  5JUM A;  4RU9 A;  4DQI A;  3AQL A;  4E80 A;  4DOA A;  4X0B A;  4UAW A;  4YMN A;  3PW5 A;  3Q8M A;  2ASD A;  3OVB A;  1XWL A;  4ECY A;  2BQR A;  1NK5 A;  1KRP A;  4YR0 A;  8ICN A;  4FHX A;  3UXO A;  4WC6 A;  2ZH6 A;  2DR5 A;  3V72 A;  4DF4 A;  4KLL A;  4WC5 A;  4O3S A;  1V4A A;  4C8M A;  4K4H A;  3AQM A;  1Y88 A;  1U49 A;  1ZQY A;  4M9N A;  7ICU A;  3E2E A;  7ICF A;  5KT2 A;  7ICM A;  1ZQL A;  1TFY A;  3JPO A;  2BGW A;  7ICR A;  5KG5 A;  5J2K A;  4DL7 A;  1NJZ A;  2IHM A;  2JEI A;  3C2M A;  1WOT A;  4PPX A;  5J2G A;  2KTQ A;  2R8J A;  4DSF A;  2Y1I A;  1S97 A;  2IHN A;  3B0X A;  2C28 A;  5KFA A;  5KT5 A;  2HHT A;  5KFP A;  4QZG A;  4YMO A;  2PI5 A;  4MEY A;  5L1I A;  9ICA A;  5J2C A;  5DDY A;  3PX6 A;  1ZJN A;  5KFN A;  3RB0 A;  4FS2 A;  1LB2 B;  8ICO A;  1S9F A;  5TZV A;  4LT6 A;  9ICV A;  3C66 A;  1NK8 A;  1ZQE A;  5J0U A;  4I29 A;  4KMU A;  4XA5 A;  3IM1 A;  8ICV A;  1MIW A;  4S3N A;  4O9M A;  4I28 A;  1S0M A;  3MR6 A;  5F9N A;  4I2E A;  5KT4 A;  1NKC A;  4IG8 A;  4XRH A;  2V4Q A;  4X4R A;  3GIM A;  2M2V A;  4O3O A;  2NRZ A;  5CB1 A;  5J2F A;  4RQ1 A;  3GII A;  4NM1 A;  8ICB A;  5HRK A;  3GV8 B;  3H4D A;  5KFO A;  5BOM A;  4RNN A;  3KHL A;  3C23 A;  5C5J A;  2R8K A;  5J0O A;  4YD1 A;  3EPI A;  4ECX A;  2IMW P;  2W9C B;  2NRK A;  5J0Q A;  2PFN A;  4UAZ A;  2JEJ A;  4DSL A;  1XC9 A;  5DKW A;  5J2E A;  3TFR A;  5KT6 A;  8ICE A;  1TAU A;  7ICV A;  1KNY A;  1JXE A;  9ICW A;  2AU0 A;  3MGH A;  3G6Y A;  4O3R A;  2W9C A;  1UET A;  1ZQS A;  1KSP A;  4AT7 A;  8ICP A;  4KLU A;  3ISB A;  7ICK A;  5KG7 A;  1T8E A;  1OU5 A;  4MF8 A;  9ICL A;  5KFQ A;  1ZQA A;  5HP4 A;  4IQV A;  9ICS A;  1BPB A;  1NKE A;  2ZHA A;  2OWO A;  4I2H A;  3Q8P B;  3GIL A;  2ZH1 A;  4EBE A;  3NGD A;  4ECV A;  1ZQF A;  4I2J A;  5J0Y A;  2H5X A;  5DB6 A;  3C5F A;  4J9P A;  4DL4 A;  3FDS A;  4PHD A;  4B9V A;  4QZ9 A;  4GLX A;  2KFN A;  3RB6 A;  2KZZ A;  4Q45 A;  5DQI A;  4QZD A;  3KHG A;  4TQS A;  2C2R A;  4KLD A;  1PX5 A;  3THV A;  3QEB Z;  4LZG A;  1ZQQ A;  1PZN A;  4EYI B;  4ECQ A;  4M47 A;  5KG6 A;  4F8R A;  4RQ7 A;  5L9X A;  2FPM A;  1RYR A;  4ED6 A;  2DPJ A;  3PNC A;  3UPS A;  3SV4 A;  2AQ0 A;  2I9G A;  2O1P A;  3Q8Q B;  3H7I A;  4DSE A;  4FBU A;  7ICN A;  5KT3 A;  1VJ7 A;  3JPR A;  2BR0 A;  4WC2 A;  3OSN A;  4PGX A;  4F4W A;  4KLT A;  5DLF A;  1BPZ A;  2KZ3 A;  2PFQ A;  1T4G A;  5KG0 A;  3ZDB A;  1JN3 A;  2Q0Z X;  3PR4 A;  4DFM A;  4NLG A;  4QZA A;  4GXI A;  4P4M A;  1ZQB A;  4FHP A;  4ELU A;  3PV8 A;  3RB4 A;  2BCQ A;  4X4V A;  5HRL A;  1JAJ A;  4DL2 A;  4FO6 A;  3JPS A;  3ZD8 A;  3RRG A;  3HJ4 A;  5CR0 A;  4DS5 A;  7ICG A;  5CWR A;  4Q44 A;  2R8H A;  1WCN A;  4PGQ A;  1TK0 A;  4X4S A;  3KHH A;  4ZH4 A;  4IR9 A;  2FPL A;  4TUQ A;  2Q66 A;  4Z6C A;  5EWE A;  3PML A;  2DFL A;  4JV0 A;  4J9Q A;  2BHN A;  4QWD A;  4YN4 A;  3M8R A;  3H4B A;  2ZJ5 A;  4J9S A;  1TV9 A;  2P6R A;  8ICH A;  2ASJ A;  5DG9 A;  4NLN A;  3PX4 A;  1ZQW A;  4NKT A;  4X4O A;  2XY7 A;  3QZ8 A;  4DEZ A;  4F5R A;  4DL5 A;  3OSP A;  2ZH4 A;  1BVS A;  8ICT A;  4F4X A;  2W9A A;  1A76 A;  3PW2 A;  1ZJM A;  5J0X A;  2ISP A;  2HHS A;  7ICO A;  2ZTC A;  1UA0 A;  2RFF A;  5DB8 A;  1Z00 B;  4KLG A;  4UBB A;  3RH4 A;  4DQQ A;  4F2R A;  4KIT B;  2ATL A;  4GC6 A;  1ZQO A;  4J9K A;  1U48 A;  4ED7 A;  3GFK B;  3AU2 A;  5HHH A;  7ICH A;  4IR1 A;  4F4K A;  1Z00 A;  2XCA A;  4F5Q A;  1BGX T;  4EP7 A;  2W8L A;  2UVV A;  4YG2 A;  3HT3 A;  1KTQ A;  4RPX A;  5CHG A;  2HW3 A;  3OGU A;  4UBC A;  1UT8 A;  4RQ5 A;  3BDP A;  4M9H A;  1JXL A;  2C22 A;  8ICI A;  9ICF A;  3RJE A;  8ICC A;  3KTQ A;  4F5N A;  2W9B A;  9ICC A;  3MR3 A;  1COO A;  2ISO A;  4WC0 A;  1NO5 A;  8ICS A;  4FS1 A;  3OVA A;  2DR8 A;  3JZ0 A;  2ZTE A;  2ZHB A;  1D9D A;  1NK0 A;  4J9O A;  5KG1 A;  5EOZ A;  1QTM A;  3MBY A;  3OUY A;  1R8C A;  2AJQ A;  3Q8K A;  3MDC A;  2HVH A;  1NJY A;  4QW8 A;  3PW4 A;  4I2C A;  4J9R A;  5J2J A;  4ED1 A;  3AUO A;  3AU6 A;  4FH3 A;  1RPL A;  8ICF A;  4RWQ A;  4ATB B;  1ZQI A;  4YP3 A;  1H38 A;  1NJW A;  1SKW A;  4I2B A;  2RDJ A;  1UEV A;  3EW9 A;  1ZQR A;  7ICJ A;  2BPG A;  4ATB A;  3PMN A;  5IIM A;  2NRT A;  4RWP A;  1DK2 A;  4M04 A;  4TUP A;  4FHW A;  4B9S A;  4O5C A;  2PI4 A;  4MEX A;  2PFO A;  5DBA A;  3H8S A;  4YMM A;  2ALZ A;  3RJH A;  3SI8 A;  4M9L A;  3MFI A;  8ICR A;  3HIY A;  4KLH A;  1JX4 A;  4G3I A;  1F5A A;  5KFR A;  3LK9 A;  4DS4 A;  2WTF A;  4K4G A;  4DQR A;  2BCU A;  4DL6 A;  4YXJ A;  4DWI A;  9ICX A;  2B21 A;  2DPI A;  4WC7 A;  4WBZ A;  8ICM A;  5CA7 A;  4GXJ A;  4P4P A;  3JPN A;  1QSS A;  4LVS A;  2HHQ A;  2C2E A;  1S10 A;  4UQG A;  4ED8 A;  3LWL A;  2XY6 A;  5HML A;  4O3Q A;  3N4M B;  1N48 A;  3ZDC A;  4YD2 A;  1NK7 A;  1ZQV A;  3GIK A;  1ZET A;  1BNP A;  1BPE A;  5J2A A;  3GV5 B;  5L1K A;  2BCR A;  4DSJ A;  4KN7 A;  4AT7 B;  3N97 B;  2A1J B;  9ICK A;  4XQ8 A;  1ZQH A;  5J0W A;  4MFC A;  4RPZ A;  7ICT A;  1JMS A;  2NRW A;  4IQT A;  2ZTD A;  1SZP A;  4Z6E A;  3T5H A;  1DOQ A;  1EXN A;  3G6V A;  4F2S A;  9ICN A;  2A1J A;  5F2V O;  2ZJ8 A;  4P4O A;  4PH5 A;  5DBC A;  2W8K A;  2JEG A;  5EWG A;  3OJU A;  4IQW A;  5DB7 A;  3AQN A;  2ZH5 A;  4RT3 A;  3RJF A;  3RJJ A;  3TI0 A;  4BDP A;  4IQU A;  5J29 A;  4GC7 A;  4QZB A;  3RH6 A;  5KFH A;  4RT2 A;  4YR2 A;  4QWA A;  3TAR A;  1KLN A;  4ED2 A;  2BDP A;  3T3F A;  4I2A A;  4X5V A;  5HNK A;  1BPX A;  1KFT A;  4C8O A;  4AT8 B;  4UB1 A;  3EYZ A;  1BNO A;  4I27 A;  4EEY A;  3TAP A;  4RQ4 A;  5KFI A;  5J0T A;  4WC3 A;  9ICO A;  1QSY A;  2HVI A;  2KZM A;  4ECS A;  4AT8 A;  5L1J A;  2JZB A;  4R8U B;  5KFG A;  1U47 A;  1ZQD A;  3WFR E;  1D8Y A;  5HRB A;  2UVU A;  5KFC A;  3GDX A;  2RDI A;  3HP6 A;  2UVW A;  2LYH A;  4R8U A;  1ZQP A;  4MFA A;  2KFZ A;  4UB4 A;  3PY8 A;  3RR7 A;  1NJX A;  9ICB A;  4ECU A;  1KEJ A;  1ZQN A;  3QE9 Y;  2BPC A;  4RQ0 A;  2M2W A;  2DR9 A;  4Z6F A;  7ICS A;  4EBJ A;  3PR5 B;  4WBY A;  4AT9 A;  3T5J A;  2DR7 A;  4UD4 A;  4KN4 A;  4JUZ A;  5L1L A;  4KLE A;  9ICJ A;  7ICP A;  4X0A A;  3OVS A;  4TQR A;  3LWM A;  2VA3 A;  4RQ2 A;  3BQ2 A;  4O3N A;  5HR9 A;  4IRD A;  5J0S A;  3RRH A;  7ICI A;  1MIV A;  4P2H A;  4FH5 A;  2AGO A;  4R64 A;  4HYK A;  1KFS A;  4DF8 A;  4DSK A;  5DEC A;  3EZ5 A;  5J0P A;  4FHV A;  1A77 A;  3M9O B;  3EPG A;  4TUR A;  3C2K A;  1X9S A;  1HUO A;  3IHQ B;  4YR3 A;  1JQR A;  2IBK A;  1R8A A;  2ZJA A;  1JIH A;  9ICP A;  5KFT A;  2FLN A;  3RR8 A;  5KFW A;  3UPQ A;  1RZT A;  4FBT A;  2F1J A;  4BWJ A;  5J2B A;  5HMM A;  3C18 A;  4QW9 A;  5BPC A;  1XU4 A;  1DK3 A;  5DGA A;  4J9N A;  3QEA Z;  1SL0 A;  2UVR A;  2FPK A;  5III A;  1ZQZ A;  2J6S A;  5HRE A;  4WCW A;  4ELV A;  4Q8F A;  4DL3 A;  4B9M A;  1L3U A;  4E7X A;  3MR5 A;  4NY8 A;  3C1Z A;  4EBK A;  1BPD A;  3V6H A;  8ICU A;  2DVI A;  1K1S A;  1QSL A;  2O5A A;  2ASL A;  1TAQ A;  2DRB A;  5KFV A;  4CCH A;  9ICG A;  4DFP A;  1RXV A;  1MQ2 A;  1MIY A;  3WFP A;  3H8J A;  1XSN A;  9ICE A;  4I2F A;  8ICG A;  4ECZ A;  4QWC A;  4J9L A;  2ID1 A;  2W9B B;  1QLN A;  4F5O A;  4RUA A;  2HHW A;  2FLP A;  4QWB A;  1Z3E B;  1IXR A;  1X9W A;  4Q8E A;  4JV1 A;  1L5U A;  2DRA A;  3V7L A;  1XS9 D;  3C21 A;  2AGP A;  3PO4 A;  4QZH A;  3M8S A;  4ED3 A;  1SL1 A;  1U4B A;  1UT5 A;  1RXW A;  4DOC A;  9ICR A;  1L3S A;  4FHY A;  2BE3 A;  3OUY B;  3MFH A;  3GQC A;  1Q78 A;  4O0I A;  4DQP A;  1R8B A;  3PW7 A;  1X9M A;  3LQC B;  1S0V A;  3H3A A;  3HW8 A;  4NM2 A;  2P6U A;  2J6U A;  4YXM A;  1XO1 A;  5DG8 A;  2HHU A;  4X4P A;  4X4U A;  2XGP A;  2XGQ A;  2BCS A;  4EBC A;  1XSL A;  2BPF A;  2KN7 A;  3G6X A;  4DO9 A;  4JV2 A;  3UXP A;  4J9M A;  2MUT B;  4O5E A;  1SKS A;  5IIK A;  8ICX A;  2ZH2 A;  2XC9 A;  4DFJ A;  2ZUC A;  3RB3 A;  3V7J A;  1NKB A;  2MUT A;  5DG7 A;  4UB2 A;  1ZQC A;  4EBD A;  4B9N A;  5DQH A;  4EZ9 A;  4NLZ A;  1S0O A;  5J2I A;  4MFF A;  4BGD A;  2ZH9 A;  5KFY A;  1T3N A;  2F1H A;  1L3V A;  5HC9 A;  2XO7 A;  9ICT A;  4PGY A;  4F3O A;  1Q79 A;  1B43 A;  4DSI A;  2AQ4 A;  1MC8 A;  3LDA A;  9ICI A;  4I2G A;  4KLJ A;  3HX0 A;  3ZDD A;  4UAY A;  4NKU A;  4QZ8 A;  5KFU A;  3PW0 A;  1TFW A;  1HUZ A;  3OV7 A;  1XSP A;  3MAB A;  2Y1J A;  1C7Y A;  4M5D A;  1U45 A;  4I2I A;  3TFS A;  2R8G A;  3C2L A;  4BWM A;  2NRX A;  3ETL A;  4BXO B;  5KFM A;  7ICQ A;  4M9G A;  1TVA A;  4QZF A;  4UD5 A;  4RNO A;  3UXN A;  2FMS A;  5DBB A;  5DB9 A;  1L3T A;  4QWE A;  1NZP A;  2XY5 A;  3C1Y A;  3JPQ A;  5KFS A;  4YCX A;  5J2H A;  5KFF A;  5DLG A;  2MAX A;  5KFE A;  5F9L A;  1ZQM A;  3MR2 A;  4O3P A;  5DGB A;  4RNM A;  3RJG A;  2FMQ A;  3BQT A;  4RZR A;  3M9N B;  3RTV A;  4K4I A;  2ZH8 A;  4M9J A;  4Z6D A;  3M9M B;  5HRD A;  5KG3 A;  4RUC A;  1D9F A;  8ICK A;  3H37 A;  2BQU A;  5HRG A;  3BJY A;  4QZE A;  4RPY A;  2BKE A;  3B0Y A;  4F50 A;  3RAQ A;  4RQ6 A;  1ZYQ A;  4KTQ A;  7ICL A;  3AQK A;  1X2I A;  4IRC A;  4PHE A;  5KFB A;  3K75 D;  1HJP A;  2ZUD A;  4C8L A;  3PVX A;  2ZH7 A;  3UQ2 A;  2JZB B;  2ZUB A;  3EWA A;  2VA8 A;  4EYH B;  1V9P A;  2FMP A;  3WFQ E;  2M9N A;  2R8I A;  4ELT A;  3NTU A;  3WFS C;  9ICU A;  4UB3 A;  4LZD A;  3OJS A;  3RAX A;  4KLS A;  2C2D A;  1ZQG A;  4RWN A;  4IRK A;  3ZDE A;  4XQ7 A;  4E0D A;  4NXZ A;  2F1I A;  2NRV A;  1MSW D;  4DLG A;  1ZQX A;  4GXK A;  4R65 A;  1LV5 A;  8ICQ A;  4DLE A;  3V7K A;  3RBE A;  4KLI A;  3Q8L A;  4X4T A;  3ISD A;  2VA2 A;  3HJ1 A;  2V4R A;  3QZ7 A;  4QZC A;  1TK8 A;  1U9L A;  4WC4 A;  4R66 A;  4DOB A;  3TAQ A;  4PHP A;  1TKD A;  3FYH A;  4KLF A;  8ICY A;  9ICQ A;  4AT9 B;  4ECW A;  1MQ3 A;  1ZQU A;  5J2D A;  3TQ1 A;  5BOL A;  1NK6 A;  4B9T A;  4KLM A;  5HRH A;  5CJ7 A;  3HPO A;  1NOM A;  3JYY A;  1CUK A;  4I2D A;  3OHB A;  3PX0 A;  4C8K A;  4M6W B;  4DQS A;  7ICE A;  2PBE A;  3SYZ A;  4MF2 A;  4M0A A;  2HHV A;  4F91 B;  1T7P A;  4KLO A;  8ICW A;  3V6J A;  3BQ0 A;  3PO5 A;  4M6W A;  3JPP A;  5DQG A;  1ZQT A;  4M2Y A;  3T5L A;  1CEZ A;  1UEU A;  3T5K A;  4E8F A;  3WFO A;  9ICM A;  5D46 A;  3OHA A;  8ICJ A;  4F93 B;  1NK4 A;  3RJI A;  8ICZ A;  3BQ1 A;  2BCV A;  4YFK A;  3H40 A;  3TAN A;  4B9U A;  1B22 A;  4UB5 A;  4Q43 A;  3ISC A;  1S0N A;  1S77 D;  2M2U A;  1RYS A;  1NK9 A;  5EWF A;  5IIN A;  2KP7 A;  4JWM A;  5DDM A;  1K1Q A;  4QZI A;  5IIL A;  4F4Y A;  2J6T A;  2FLL A;  4RWO A;  3K4G A;  4JK1 A;  1ARO P;  5KFD A;  4ED0 A;  4NLK A;  4RQ8 A;  2XCP A;  3RJK A;  4X4N A;  4YQW A;  3RBD A;  1BPY A;  5HRI A;  1R89 A;  5CP2 A;  1ZQK A;  5D49 A;  4R63 A;  2M2T A;  8ICA A;  8ICL A;  4TUS A;  5KFZ A;  3V6K A;  4KLQ A;  5DED A;  2BQ3 A;  4F5P A;  3SV3 A;  4ECT A;  1FA0 A;  4ECR A;  2IA6 A;  2PXI A;  3MDA A;  5KG2 A;  3JPT A;  3H38 A;  4X4Q A;  1TFR A;  2JEF A;  4EZ6 A;  3H8W A;  3ZD9 A;  5KFX A;  5IIJ A;  5KTQ A;  3Q8R B;  3Q8S B;  3MGI A;  5IIO A;  2AGQ A;  4B9L A;  5KFJ A;  1N56 A;  3GIJ A;  3ORY A;  1SL2 A;  3HWT A;  3SZ2 A;  4YVZ A;  3GV7 B;  3ZDA A;  1DGS A;  3KHR A;  1D8L A;  4DFK A;  1UA1 A;  4JWN A;  2W9M A;  1VFG A;  2PFP A;  1ZQJ A;  5KFK A;  2VAN A;  3UQ0 A;  3NYB A;  3L9D A;  5KG4 A;  4WC1 A;  2V9W A;  4RQ3 A;  1KFD A;  1YLQ A;  4F4Z A;  2GWS A;  2HHP A;  5HHI A;  3H39 A;  5KT7 A;  1WCL A;  5J0R A;  4F92 B;  5KFL A;  1IM4 A;  5HRF A;  2ZH3 A; 
#chains in the Genus database with same CATH topology
 3RH5 A;  2QLT A;  4PHA A;  4O5K A;  4NLC A;  3C5G A;  1TK5 A;  2ZH7 A;  3PW5 A;  2ASD A;  4CE6 A;  2BQR A;  3WK6 A;  1L7N A;  4IL6 U;  1KRP A;  4K8V A;  3UXO A;  2ZH6 A;  3V72 A;  2Q4T A;  4O3S A;  1V4A A;  4C8M A;  3QU4 A;  1U49 A;  1ED1 A;  7ICF A;  5KT2 A;  3QYP A;  1TFY A;  7ICR A;  5J2K A;  1NJZ A;  2IHM A;  2R8J A;  2G5H B;  4DSF A;  1S97 A;  2HBM A;  5KT5 A;  2YML A;  5EE3 A;  2HHT A;  4YMO A;  2PI5 A;  1ZQ1 C;  4OJ5 A;  1ZJN A;  4KB6 A;  4CF4 A;  2R18 A;  2W11 A;  1ZQE A;  5AKZ A;  1N61 A;  8ICV A;  4I28 A;  2GAF D;  4IG8 A;  2DGZ A;  4O3O A;  2RP5 A;  5KFO A;  4RNN A;  4J03 A;  4ECX A;  2NRK A;  4WQK A;  4DSL A;  3TFR A;  5KT6 A;  3WKB A;  3MGH A;  1P7D A;  2B51 A;  1CI4 A;  4OAH A;  8ICP A;  3M6K A;  7ICK A;  5KG7 A;  4NXV A;  2VIX A;  5KFQ A;  1ZQA A;  4AYB C;  1NKE A;  2EAN A;  2YY6 A;  4U7C A;  1O03 A;  4EBE A;  2YX8 A;  4J9P A;  3FDS A;  5B5E U;  2KZZ A;  4Q45 A;  3B9J A;  2LKY A;  3KHG A;  3THV A;  4LZG A;  1PZN A;  4EYI B;  4M47 A;  1X42 A;  4F8R A;  4RQ7 A;  5L9X A;  2O1P A;  4DSE A;  5ALT A;  5KT3 A;  3M6Z A;  3JPR A;  2BR0 A;  2W3R A;  4C4R A;  5KAF U;  1COK A;  4PGX A;  5DLF A;  1BPZ A;  1T4G A;  1YZ6 A;  4NLG A;  4QZA A;  1ECW A;  1ZQB A;  2BCQ A;  3RRG A;  2EWR A;  2VJ4 A;  3L4P A;  2AH5 A;  4PGQ A;  4ZH4 A;  3AMZ A;  3K1Z A;  4NXU A;  4F4W A;  1SL0 A;  2YQE A;  5ALQ A;  5AKX A;  2WB1 F;  1ZQW A;  4DEZ A;  2ZH4 A;  1KN5 A;  4F4X A;  2ISP A;  1A76 A;  1UA0 A;  4QIW F;  4KIT B;  2ATL A;  3F2C A;  4GC6 A;  3AU2 A;  1MN8 A;  2XCA A;  4F5Q A;  3M1Y A;  2HW3 A;  4RQ5 A;  1S8O A;  2W9B A;  9ICC A;  1COO A;  4WC0 A;  1TE2 A;  4FS1 A;  2ZHB A;  4EGW A;  4CGZ A;  5KG1 A;  5EOZ A;  5GTI U;  1ZD2 P;  2BBH A;  3PW4 A;  4I2C A;  5J2J A;  3AUO A;  4FH3 A;  2QAR B;  1ZQI A;  2KHQ A;  2KMD A;  7ICJ A;  2QAR A;  4M04 A;  4TUP A;  3H8S A;  3UMB A;  3LYS A;  1JX4 A;  3E0F A;  3LK9 A;  1F44 A;  4UAT A;  3OWG A;  4C7Z A;  3ER9 B;  3PSP A;  4GXJ A;  4PJ0 U;  4P4P A;  4LVS A;  2HHQ A;  1FFV A;  4ED8 A;  1N48 A;  1BPE A;  2BCR A;  3TAD C;  2A1J B;  4OJP A;  4XQ8 A;  2KKP A;  4MFC A;  5AIB A;  2ZTD A;  1SZP A;  2NO5 A;  1DOQ A;  2A1J A;  5EE0 A;  4PH5 A;  4P4O A;  5DBC A;  4IQW A;  5DB7 A;  3L3F X;  1N63 A;  2HOQ A;  3RJJ A;  4BDP A;  4GC7 A;  4QZB A;  4JLX A;  4YR2 A;  3TAR A;  1OW5 A;  1YZ7 A;  2VKQ A;  2E8M A;  1M6Y A;  1FEZ A;  4UB1 A;  4EEY A;  4RQ4 A;  5J0T A;  2KZM A;  5JTG A;  2JH7 A;  5ALU A;  5L1J A;  4KX3 A;  5F3X B;  5KFG A;  1U47 A;  5D61 A;  3WFR E;  1A6S A;  2RDI A;  3PY8 A;  4NJ8 A;  2G0A A;  4ECU A;  1RYU A;  2BPC A;  4RQ0 A;  3EUB 2;  2ZIW A;  4WBY A;  4X0A A;  2VA3 A;  2LHT A;  4FFD A;  4O3N A;  3BQ2 A;  4IRD A;  4P2H A;  2HN2 A;  4DF8 A;  4FHV A;  1A77 A;  3M9O B;  4P0P A;  1HUO A;  3IHQ B;  4YR3 A;  2IBK A;  3WK9 A;  1R8A A;  5KFT A;  2K4I A;  1RZT A;  4QW9 A;  1DK3 A;  5DGA A;  3QEA Z;  5CEH A;  2UVR A;  3CK6 A;  5III A;  4WCW A;  4ELV A;  4B9M A;  3ETR A;  2E8P A;  3DDH A;  2WAQ C;  2DVI A;  3C28 A;  2JMG A;  1TAQ A;  3PSF A;  3PHZ A;  3AM9 A;  3WFP A;  3H8J A;  5AKK A;  3MCR A;  9ICE A;  8ICG A;  4RUA A;  2DKZ A;  3D2N A;  4JV1 A;  3SAG A;  3M7D A;  2AGP A;  3TAD A;  1N2X A;  1SL1 A;  4DOC A;  2XVT A;  3MFH A;  3GQC A;  2HCF A;  1N5W A;  4NM2 A;  5AK3 A;  1SZH A;  2IOF A;  5AKY A;  4B6J A;  4X4U A;  4LJX A;  3N7R C;  1ZOL A;  4J9M A;  4O5E A;  3A0B U;  8ICX A;  4DFJ A;  4OAG A;  2BBJ A;  5DQH A;  2LI6 A;  4RQN A;  4EZ9 A;  2DL0 A;  2EZX A;  1S0O A;  2ZH9 A;  2WF5 A;  2XO7 A;  4CDG A;  4F3O A;  1Q79 A;  1B43 A;  1MC8 A;  3LDA A;  4G9B A;  3ZDD A;  4NKU A;  4AYB F;  2K60 A;  1XSP A;  4F72 A;  2R8G A;  3C2L A;  2IHO A;  5ALJ A;  1RQN A;  2NRX A;  2ES6 A;  2G08 A;  2FMS A;  3JPQ A;  5KFS A;  3KZX A;  5KFF A;  5DLG A;  3RFA A;  3MR2 A;  2FMQ A;  4RZR A;  2LBO A;  2QKQ A;  4M9J A;  2HDO A;  4ICA A;  5KG3 A;  8ICK A;  3BJY A;  1FFU A;  4RPY A;  5AM0 A;  3AQK A;  4RQ6 A;  3IV6 A;  1X2I A;  4C8L A;  2ZUB A;  1V85 A;  1V9P A;  3NTU A;  1MA7 A;  1WWU A;  2ZIV B;  1KKX A;  4RWN A;  3D6J A;  4IRK A;  2WF9 A;  4E0D A;  4HX0 A;  2F1I A;  1MSW D;  1ZQX A;  5AKH A;  2ZIV A;  8ICQ A;  3RBE A;  3Q8L A;  3F53 A;  2Z7J A;  1J2N A;  2VA2 A;  3HJ1 A;  1U9L A;  1B4F A;  3TAQ A;  3IN5 A;  4AT9 B;  1TKD A;  9ICQ A;  4ECW A;  2HI0 A;  5BOL A;  5CJ7 A;  3HPO A;  3PX0 A;  4C8K A;  2PBE A;  1Z19 A;  1T7P A;  4KLO A;  1CEZ A;  5DQG A;  1LVH A;  5AI4 A;  3OHA A;  3CNH A;  5AK6 A;  2DKX A;  1B22 A;  3TAN A;  2EAM A;  1PK3 A;  5EWF A;  2KP7 A;  4JWM A;  2FLL A;  3K4G A;  4JK1 A;  1ARO P;  4KMO B;  4X4N A;  3UMG A;  1ZQK A;  2MU2 A;  5DED A;  4F5P A;  3SV3 A;  3SQI A;  1FA0 A;  2KOB A;  4ECR A;  1D8B A;  3QX7 A;  3MDA A;  5KG2 A;  4K9A A;  3JPT A;  2DUY A;  3I1Y A;  4US8 A;  2KV2 A;  3GIJ A;  1SL2 A;  3HWT A;  3H0M B;  4YVZ A;  3ZDA A;  1LKY A;  1D8L A;  4DFK A;  1UA1 A;  2ZIU B;  4CNQ A;  2VAN A;  2YN4 A;  2NO4 A;  3L9D A;  4EEK A;  2V9W A;  2HBK A;  2HHP A;  2ZIU A;  3WK4 A;  3H39 A;  4JB3 A;  1WCL A;  4F92 B;  3ZI4 A;  1IM4 A;  4BXO B;  4NL9 C;  9ICH A;  1KDH A;  5D4B A;  4BXO A;  2I1Q A;  5JUM A;  4DOA A;  3F5A A;  1NK5 A;  4ECY A;  2EAP A;  2DR5 A;  4WH5 A;  3ICX A;  2CN1 A;  7ICU A;  3E2E A;  3QUC A;  2B0C A;  1ZQL A;  3JPO A;  2BGW A;  5KG5 A;  1KQQ A;  4DL7 A;  2JEI A;  2K4E A;  3DEE A;  3C2M A;  1L7O A;  1IV8 A;  2KTQ A;  5J2G A;  5KFA A;  5AI5 A;  3SMV A;  4QZG A;  4O68 A;  5L1I A;  5J2C A;  1RDF A;  3PX6 A;  3QU7 A;  3QU5 A;  4FS2 A;  2WFA A;  1LB2 B;  4GFJ A;  5TZV A;  4LT6 A;  9ICV A;  1NK8 A;  5ALF A;  5J0U A;  4I29 A;  4XA5 A;  1MIW A;  2RQ5 A;  4O9M A;  5F9N A;  1NKC A;  4EX7 A;  4XRH A;  2V4Q A;  4X4R A;  2YMM A;  2P35 A;  4EV6 A;  2M2V A;  3N28 A;  3GII A;  2A3V A;  8ICB A;  5GTH U;  3KHL A;  2R8K A;  5C5J A;  5J0O A;  1UQV A;  2HOI A;  5DKW A;  2OYY A;  5J2E A;  2AU0 A;  3G6Y A;  1KSP A;  2Y0S C;  3ISB A;  1T8E A;  9ICL A;  2WF6 A;  3Q8P B;  4N7R A;  1PK1 B;  5J8Y A;  2G06 A;  4ECV A;  1ZQF A;  2F76 X;  2H5X A;  2OHF A;  2H3V A;  3C5F A;  4PHD A;  3IRU A;  2KFN A;  3RB6 A;  3ERC C;  4QZD A;  2C2R A;  4KLD A;  1QQ5 A;  2EAO A;  4ECQ A;  2FPM A;  1RYR A;  2DPJ A;  4EEB A;  3PNC A;  5ALL A;  3O0F A;  2AQ0 A;  4NL9 A;  2I9G A;  3Q8Q B;  3H7I A;  7ICN A;  3OSN A;  4KLT A;  5KG0 A;  3AQE A;  4DFM A;  2KKV A;  5ALM A;  4GXI A;  2JRZ A;  4P4M A;  3RB4 A;  2OEH A;  3ZD8 A;  4LEY A;  2JHD A;  4TUQ A;  4Z6C A;  4JV0 A;  2BHN A;  4QWD A;  4WC5 A;  2P6R A;  4OJO A;  2ASJ A;  3T79 A;  4NKT A;  3QZ8 A;  4F5R A;  8ICT A;  3PW2 A;  3KOO A;  1ZJM A;  4FO1 A;  2ZTC A;  1DXS A;  1Z00 B;  4F2R A;  5KNI A;  4J9K A;  1ZQO A;  4ED7 A;  7ICH A;  4IR1 A;  4F4K A;  1Z00 A;  4Y2Q A;  4EP7 A;  1BGX T;  4YG2 A;  5AKE A;  1KTQ A;  5A0L A;  4RPX A;  5HR6 A;  5AI8 A;  4UBC A;  2KJ5 A;  4DFD A;  1JXL A;  3RJE A;  2K8B B;  3KBB A;  2DR8 A;  2ZTE A;  4J9O A;  3NVY A;  5EE1 A;  3OUY A;  1R8C A;  1NJY A;  4QW8 A;  2F77 X;  8ICF A;  2KSO B;  1ZQR A;  4RWP A;  4FHW A;  2KSO A;  3QNM A;  8ICR A;  4U6P A;  4YMM A;  5DBA A;  2ALZ A;  3SI8 A;  5KFR A;  4K4G A;  2O6K A;  2WTF A;  2BCU A;  2K8A A;  4YXJ A;  4DWI A;  2DPI A;  8ICM A;  5CA7 A;  5AHX A;  2RHF A;  3JPN A;  2C2E A;  1O08 A;  4UQG A;  3LWL A;  3N4M B;  1BNP A;  4YD2 A;  1NK7 A;  1ZQV A;  3GIK A;  1ZET A;  5J2A A;  2KIW A;  1L7P A;  4DSJ A;  1UHU A;  4KN7 A;  1JRP A;  9ICK A;  7ICT A;  4Z6E A;  5KAI U;  9ICN A;  4NLB A;  5AM3 A;  5EWG A;  2ZH5 A;  4RT3 A;  3RJF A;  3C29 A;  3WK8 A;  5KFH A;  2BDP A;  1Z4N A;  4I2A A;  5HNK A;  3RF9 A;  4I27 A;  4OAF A;  3TAP A;  5KFI A;  4UAU A;  1QSY A;  4MHV A;  2JZB A;  2ZG6 A;  1ZQD A;  5HRB A;  5KFC A;  3GDX A;  3HP6 A;  2UVW A;  2BDU A;  3WK7 A;  2OXO A;  4K96 A;  3QE9 Y;  4Z6F A;  7ICS A;  4EBJ A;  1N62 A;  4UD4 A;  7ICP A;  4TQR A;  3LWM A;  3RRH A;  7ICI A;  1L7M A;  2FDR A;  5J0P A;  3C2K A;  1PVQ A;  1JIH A;  9ICP A;  2FLN A;  3UPQ A;  2WF8 A;  2WF7 A;  4BWJ A;  5HMM A;  1ZQZ A;  4PZN A;  4DL3 A;  4E7X A;  4C80 A;  3MR5 A;  3C1Z A;  1BPD A;  1OUQ A;  2O5A A;  2ASL A;  1J97 A;  5KFV A;  4CCH A;  3NRW A;  1MQ2 A;  1MIY A;  3QU9 A;  1XSN A;  4Y2S A;  2KVC A;  2W9B B;  3FAH A;  4F5O A;  2HSZ A;  2KEY A;  1Z3E B;  3TKA A;  2MSN A;  2YB1 A;  3V7L A;  4OAI Z;  4QZH A;  3I28 A;  1RXW A;  2B6G A;  9ICR A;  1L3S A;  4NV0 A;  4HAI A;  4DQP A;  4K9B A;  1SIJ A;  1R8B A;  1S0V A;  3H3A A;  1JI7 A;  2P6U A;  3F5E A;  4NWI A;  1XO1 A;  1B0X A;  1SWW A;  5DG8 A;  1SXE A;  2BCS A;  1ZD4 A;  3BS5 B;  3G6X A;  3UXP A;  2MUT B;  4XJE A;  1SKS A;  5IIK A;  3CP8 A;  3BS5 A;  4FE3 A;  1NKB A;  2MUT A;  5DG7 A;  1ZQC A;  4B9N A;  4BGD A;  3H0R B;  5KFY A;  9ICT A;  5D62 A;  1RM6 C;  3HKZ C;  9ICI A;  4I2G A;  1VJ5 A;  4UAY A;  4FZL A;  1VLB A;  4QZ8 A;  4M5D A;  1U45 A;  4I2I A;  5JU5 A;  4K97 A;  4UD5 A;  4RNO A;  5DB9 A;  3C1Y A;  5J2H A;  5F9L A;  1ZQM A;  4O3P A;  3RJG A;  3RTV A;  1Z1B A;  3M9N B;  1D9F A;  4RUC A;  3H37 A;  2BQU A;  5HRG A;  4F50 A;  7ICL A;  1HJP A;  4MKP A;  2KHV A;  4O3M A;  3WFQ E;  2M9N A;  2R8I A;  1OXJ A;  9ICU A;  2FI1 A;  4LZD A;  3OJS A;  5EE9 A;  2NRV A;  3KFU F;  2OCE A;  3QUQ A;  2LMR A;  1N5X A;  4USA A;  3H8M A;  4WC4 A;  4R66 A;  2ZIW B;  4PHP A;  2LPE A;  8ICY A;  4LEZ A;  3AL0 B;  4JMU A;  1NK6 A;  4B9T A;  4DQS A;  1RG6 A;  4M0A A;  3A0H U;  4P0P B;  1QQ6 A;  3V6J A;  2A19 A;  2HBJ A;  4UAV A;  1ZQT A;  1UEU A;  9ICM A;  5ALH A;  1PUZ A;  4F93 B;  1NK4 A;  3RJI A;  8ICZ A;  2BCV A;  4UB5 A;  2H3Q A;  5E79 U;  3ISC A;  1S0N A;  2M2U A;  3KD3 A;  4Y2R A;  1X66 A;  4OJ6 A;  1WWV A;  5KFD A;  1R89 A;  1Q3U A;  3S6J A;  8ICA A;  8ICL A;  4TUS A;  3BS7 A;  3V6K A;  2BQ3 A;  4ECT A;  2PXI A;  4Y2T A;  3K1R B;  3NKU A;  4EZ6 A;  3BZK A;  5ALK A;  3MGI A;  3ZD9 A;  3Q8R B;  5KTQ A;  4EBK A;  1N56 A;  3NVZ A;  2FJ6 A;  3GV7 B;  3LVV A;  1DGS A;  5ALG A;  1NZB A;  2ESE A;  1ZQJ A;  5KFK A;  3UQ0 A;  3NYB A;  2GWS A;  5HHI A;  4F4Y A;  5J0R A;  5KFL A;  2P66 A;  1SKR A;  2HHX A;  2DWQ A;  4EEL A;  1S76 D;  3AQL A;  1IIP A;  2ZH3 A;  4E80 A;  4X0B A;  4YMN A;  2E8N A;  1HIW A;  8ICN A;  4FHX A;  1Z4O A;  2HBL A;  4NXW A;  3AQM A;  4M9N A;  3LVW A;  3NVO A;  2E1E A;  1HEK A;  4CF3 A;  4PPX A;  2IHN A;  4MEY A;  1X6I A;  3WKC A;  5KFN A;  1S9F A;  4C0Z A;  3C66 A;  5CFU A;  5JTI A;  1Q3V A;  1RQL A;  1S0M A;  3MR6 A;  1DGJ A;  3BZC A;  5KT4 A;  4I2E A;  2KNJ A;  2JGA A;  1T3Q A;  3GIM A;  4RQ1 A;  2NRZ A;  5ALR A;  5BOM A;  3NWI A;  2IMW P;  4YD1 A;  1UPH A;  4UAZ A;  1K5O A;  1TAU A;  1KNY A;  9ICW A;  3BQ7 A;  1X9X A;  1ZQS A;  1Q46 A;  4P0Q A;  4AT7 A;  4K99 A;  4KLU A;  4AP9 A;  4MF8 A;  5HP4 A;  4IQV A;  2OWO A;  4I2H A;  2AHO B;  4DL4 A;  4B9V A;  4BX9 C;  2NYV A;  5DQI A;  4C4S A;  2M0N A;  3F2B A;  3QEB Z;  1ZQQ A;  1XNS A;  5KG6 A;  4KX5 A;  3PST A;  4ED6 A;  1Q8K A;  2I6X A;  2EDU A;  2KIC A;  2ZIX B;  2Y9U A;  1KW4 A;  2LM4 A;  3WKA A;  5D63 A;  4WC2 A;  2ZIX A;  3QXG A;  3ZDB A;  4O6A A;  1JN3 A;  2Q0Z X;  1DRG A;  4FHP A;  4ELU A;  3PV8 A;  4X4V A;  5HRL A;  3JPS A;  1ZD3 A;  5CR0 A;  1FO4 A;  2DQN B;  7ICG A;  4Q44 A;  2R8H A;  4X4S A;  2Q66 A;  3KHH A;  2FPL A;  5EWE A;  3PML A;  5J8Y C;  2DFL A;  4J9Q A;  1TV9 A;  3M8R A;  4YN4 A;  2ZJ5 A;  4J9S A;  1LKY B;  5DG9 A;  3PX4 A;  4X4O A;  5AI9 A;  2XY7 A;  3OSP A;  4IC9 A;  1BVS A;  3K7D A;  2FE9 A;  2W9A A;  5J0X A;  2RFF A;  5DB8 A;  4KLG A;  4UBB A;  2W7O A;  3RH4 A;  4GIB A;  5KL8 B;  2W8L A;  2UVV A;  5CHG A;  1UT8 A;  5B3P A;  4M9H A;  2C22 A;  8ICI A;  9ICF A;  3HKZ F;  1C20 A;  3KTQ A;  1UCV A;  4F5N A;  4KM5 A;  1F0M A;  3JZ0 A;  1WUD A;  1NK0 A;  5CFS A;  1QTM A;  3MBY A;  3GZF A;  4UB6 U;  2AJQ A;  3Q8K A;  3MDC A;  4J9R A;  3SEN A;  4RWQ A;  4ATB B;  2GA9 D;  4FZM A;  1H38 A;  4I2B A;  1SKW A;  4EEN A;  2BPG A;  4ATB A;  2KG5 A;  1SV0 C;  4B9S A;  4O5C A;  3RJH A;  4M9L A;  3MFI A;  2D6F C;  4G3I A;  4DQR A;  2K89 A;  4DL6 A;  3J81 j;  4QNL A;  9ICX A;  2B21 A;  4WC7 A;  4K98 A;  1QSS A;  2RLT A;  2CXY A;  5HML A;  1TAM A;  2GLE A;  3TAC B;  5AM4 A;  2I5H A;  1L6N A;  2F8L A;  1ZQH A;  5J0W A;  3NS1 A;  4IQT A;  3T5H A;  1CRX A;  1EXN A;  3G6V A;  5F2V O;  2ZJ8 A;  2W8K A;  2JEG A;  5AM5 A;  5AM2 A;  2F8K A;  3TI0 A;  2CPR A;  1ZRN A;  3E58 A;  1KLN A;  3T3F A;  4X5V A;  1YT3 A;  1BPX A;  4ACO A;  4AT8 B;  3EYZ A;  2GH1 A;  4WC3 A;  2HVI A;  4ECS A;  2ODG A;  4AT8 A;  3D2Q A;  4R8U B;  2WAQ F;  2LYH A;  4R8U A;  4MFA A;  2VJ5 A;  4UB4 A;  2KFZ A;  3L5K A;  2DR9 A;  3VCB A;  3PR5 B;  2EH9 A;  2JH1 A;  3WKD A;  4KLE A;  9ICJ A;  5K4L A;  1QCK A;  5HR9 A;  1MIV A;  2AGO A;  1KFS A;  4DSK A;  3EZ5 A;  4EED A;  3EPG A;  1X9S A;  3KZI U;  2QB0 B;  3RR8 A;  3AQF A;  1NI3 A;  5J2B A;  3F2D A;  3C18 A;  5BPC A;  1XU4 A;  2QB0 A;  2FPK A;  5HRE A;  2J6S A;  1L3U A;  3IG5 A;  1SV0 A;  4WQL A;  1SXD A;  1K1S A;  1XO0 A;  1QSL A;  2DRB A;  9ICG A;  1RXV A;  4LEW A;  1JAL A;  4ECZ A;  3CYM A;  4QWC A;  4J9L A;  2ID1 A;  1J2M A;  4OJL A;  2G09 A;  2HHW A;  2FLP A;  1IXR A;  4C4T A;  1X9W A;  1L5U A;  2DRA A;  4DCC A;  2W7P A;  1XS9 D;  3M8S A;  4ED3 A;  1UT5 A;  3UMC A;  4FHY A;  3OUY B;  2BE3 A;  2HOF A;  4O0I A;  4Y2U A;  3PW7 A;  4PL1 A;  5ALZ A;  3HW8 A;  2XGP A;  1XSL A;  4JV2 A;  2B4V A;  5C0Y A;  3RB3 A;  3V7J A;  3UM9 A;  3ER8 C;  4NLZ A;  5J2I A;  4MFF A;  5G5H A;  2OH2 A;  3ED5 A;  2W3S A;  2AQ4 A;  3PW0 A;  4BUG A;  3OV7 A;  2Y1J A;  1C7Y A;  4UAS A;  3TFS A;  2KD1 A;  3OPX A;  5KFM A;  7ICQ A;  4QZF A;  1NZP A;  4QWE A;  2XY5 A;  1A0P A;  5KFE A;  2MAX A;  4RNM A;  3BQT A;  4K4I A;  2ZH8 A;  3ALR A;  3M9M B;  2YMP A;  1AQ6 A;  2BKE A;  4OCZ A;  4KTQ A;  1ZYQ A;  5ALV A;  4IRC A;  3D2S A;  2ZUD A;  2JZB B;  3EWA A;  2FMP A;  2D3D A;  4O67 A;  3WFS C;  3N7S C;  4OO1 J;  3IG8 A;  2C2D A;  4XQ7 A;  2KIV A;  1QQ7 A;  4DLG A;  3MC1 A;  2H3I A;  1LV5 A;  2V4R A;  4UB8 U;  1TK8 A;  5CRX A;  1ZQU A;  5J2D A;  4KLM A;  2IOH A;  3OHB A;  4M6W B;  7ICE A;  4PZO A;  4MF2 A;  2HHV A;  4F91 B;  3BQ0 A;  3PO5 A;  4M6W A;  3JPP A;  4M2Y A;  3T5L A;  5G5G A;  3T5K A;  4WJ3 B;  3WFO A;  2CRX A;  2MA1 A;  2Y9T A;  4YFK A;  3H40 A;  1PVP A;  1NK9 A;  5IIN A;  5DDM A;  1K1Q A;  4QZI A;  5IIL A;  4Y2X A;  2J6T A;  2K4P A;  2F3N A;  4RWO A;  4NLK A;  4ED0 A;  4YQW A;  1BPY A;  4R63 A;  4KLQ A;  2IA6 A;  1SWV A;  1QH9 A;  4X4Q A;  1TFR A;  2AXT U;  3FC4 A;  5CFT A;  2YB4 A;  3Q8S B;  3H8W A;  5IIJ A;  2MRL A;  4JWN A;  3KHR A;  4Y2V A;  5AKG A;  2W9M A;  1VFG A;  1PVR A;  1KFD A;  2LM1 A;  2LYB A;  4RPZ A;  5HRF A;  4WOY A;  4C8N A;  2E3T A;  4XUS A;  3AN1 A;  4RU9 A;  4DQI A;  4UAW A;  3Q8M A;  3OVB A;  1XWL A;  3SEI A;  4YR0 A;  2XIC A;  3I76 A;  4WC6 A;  5ALD A;  1L8L A;  4DF4 A;  4KLL A;  4K4H A;  3H0L B;  1Y88 A;  1ZQY A;  3ONN A;  2XID A;  2Y0S F;  1WOT A;  1GPJ A;  2JR5 A;  2Y1I A;  3B0X A;  5AI6 A;  2C28 A;  2B56 A;  5KFP A;  4NXX A;  9ICA A;  5DDY A;  3R9K A;  3RB0 A;  8ICO A;  2IUB A;  4KMU A;  3IM1 A;  4S3N A;  4UAR A;  5FP0 A;  3VC8 A;  5AKL A;  2NV3 A;  5CB1 A;  5J2F A;  3QUT A;  5HRK A;  4NM1 A;  3GV8 B;  3H4D A;  2RRD A;  3C23 A;  3EPI A;  2W9C B;  5J0Q A;  2PFN A;  2JEJ A;  1TFW A;  1XC9 A;  8ICE A;  7ICV A;  1JXE A;  4O3R A;  2W9C A;  2EQY A;  1UET A;  3IDW A;  4NXT A;  3NVV A;  4PL2 A;  1OU5 A;  4JLZ A;  9ICS A;  1BPB A;  2W54 A;  2ZHA A;  3NRZ A;  3GIL A;  2ZH1 A;  3NGD A;  4I2J A;  5J0Y A;  5DB6 A;  3HJE A;  4QZ9 A;  4GLX A;  3MGV A;  4TQS A;  1PX5 A;  5B66 U;  4F71 A;  1V97 A;  3UPS A;  5ALX A;  3SV4 A;  2WHE A;  5AK4 A;  4FBU A;  1VJ7 A;  2KZ3 A;  2PFQ A;  3PR4 A;  5ALE A;  5CHE A;  2XI9 A;  3QU2 A;  3WKE A;  1JAJ A;  5AK5 A;  4DL2 A;  4FO6 A;  3HJ4 A;  4DS5 A;  2ZXH A;  5CWR A;  1WCN A;  1TK0 A;  4IR9 A;  2G07 A;  3H4B A;  3U26 A;  8ICH A;  4NLN A;  3PZP A;  4DL5 A;  1GO3 F;  2HHS A;  2E1F A;  7ICO A;  4CF5 A;  4DQQ A;  1U48 A;  3GFK B;  5HHH A;  4CRX A;  1T94 A;  3HT3 A;  5ALW A;  3OGU A;  3BDP A;  8ICC A;  3OTQ A;  2L5Y A;  3MR3 A;  2ISO A;  1NO5 A;  8ICS A;  2PKE A;  2W03 A;  3OVA A;  1D9D A;  2HVH A;  1IG6 A;  4ED1 A;  2PMZ C;  5TIS U;  3AU6 A;  1RPL A;  2KJ9 A;  1JRO A;  3CW2 C;  4YP3 A;  4QJF B;  1NJW A;  2RDJ A;  1KBU A;  1ZD5 A;  3EW9 A;  1S5L U;  3PMN A;  5L1M A;  2NRT A;  5IIM A;  1DK2 A;  2PI4 A;  4MEX A;  2KVS A;  2PFO A;  3HIY A;  4KLH A;  1F5A A;  4DS4 A;  4WBZ A;  2G5I B;  2ZXI A;  1S10 A;  2XY6 A;  3ZDC A;  4O3Q A;  1ZXI A;  4O69 A;  3GV5 B;  3IP4 B;  5L1K A;  4P0Q B;  4AT7 B;  3N97 B;  5KL1 B;  4OD0 A;  1JMS A;  2NRW A;  4F2S A;  3AQN A;  3OJU A;  3CRX A;  2W55 A;  3NUQ A;  5ALN A;  5ALY A;  4IQU A;  5J29 A;  3RH6 A;  4QWA A;  4RT2 A;  5ALS A;  4ED2 A;  3WK5 A;  2F44 A;  3PSI A;  2W04 A;  3HRD D;  5ALO A;  5AM1 A;  1KFT A;  4C8O A;  1BNO A;  9ICO A;  5AIC A;  2HN1 A;  1FIQ A;  1D8Y A;  3QUB A;  2UVU A;  1ZQP A;  3RR7 A;  1NJX A;  3SD7 A;  9ICB A;  1KEJ A;  1ZQN A;  2FCL A;  1JUD A;  2M2W A;  4AT9 A;  2W43 A;  3T5J A;  2DR7 A;  2DF4 B;  4KN4 A;  4JUZ A;  5L1L A;  3OVS A;  4RQ2 A;  5J0S A;  2BZF A;  4FH5 A;  4R64 A;  4HYK A;  1NNL A;  5JRT A;  5DEC A;  1SGG A;  4TUR A;  1JQR A;  2ZJA A;  2EZZ A;  5KFW A;  4FBT A;  2F1J A;  3NAS A;  1V38 A;  3EF2 A;  4J9N A;  2OM6 A;  4Q8F A;  4NY8 A;  3V6H A;  8ICU A;  2F2A B;  1SB3 C;  3FM9 A;  1URJ A;  2IOF K;  4DFP A;  4BJQ A;  4I2F A;  2K4H A;  4EX6 A;  1QLN A;  2HMX A;  4Q8E A;  4QWB A;  1X6J A;  3C21 A;  2EZY A;  2KK0 A;  3PO4 A;  3SR6 A;  1U4B A;  5AKJ A;  4FZN A;  3KKA C;  3NVW A;  2DBY A;  1Q78 A;  1X9M A;  3LQC B;  2YTU A;  1Z1V A;  2QB1 A;  2WB1 C;  2J6U A;  4YXM A;  2HHU A;  4X4P A;  4UW9 A;  2XGQ A;  4EBC A;  2BPF A;  2KN7 A;  4DO9 A;  2KE7 A;  2E8O A;  4QIW C;  2ZH2 A;  2XC9 A;  5AIA A;  2ZUC A;  4UB2 A;  4EBD A;  4I0U A;  1SV4 A;  1T3N A;  2F1H A;  4ZOH C;  1L3V A;  5HC9 A;  4PGY A;  4DSI A;  4KLJ A;  3HX0 A;  2JXJ A;  5KFU A;  1HUZ A;  4Y2P A;  3MAB A;  5B3Q A;  4BWM A;  2JV3 A;  3ETL A;  2KJ8 A;  5AKI A;  1TVA A;  4M9G A;  4RQM A;  3UXN A;  4Y2J A;  5DBB A;  1L3T A;  1UEV A;  4YCX A;  5DGB A;  5HRD A;  4Z6D A;  1ZRM A;  2YMQ A;  3WU2 U;  4QZE A;  3B0Y A;  3RAQ A;  5HR7 A;  1WYG A;  4PHE A;  5KFB A;  3K75 D;  1KL9 A;  2H3F A;  3PVX A;  3HIL A;  3UQ2 A;  2VA8 A;  4EYH B;  4ELT A;  4A8E A;  1L8O A;  4UB3 A;  3RAX A;  4KLS A;  1ZQG A;  5T14 A;  3ZDE A;  4NXZ A;  5AI0 A;  4GXK A;  4C7Y A;  4R65 A;  4DLE A;  3V7K A;  2K8C B;  4KLI A;  4X4T A;  3ISD A;  3QZ7 A;  4QZC A;  4DOB A;  4KLF A;  3FYH A;  1PK1 A;  1MQ3 A;  3TQ1 A;  2LYA A;  2A1A A;  4US9 A;  5HRH A;  1NOM A;  3JYY A;  1CUK A;  4I2D A;  3SAH A;  3KKA A;  3SYZ A;  3N7P D;  2N1R A;  8ICW A;  4E8F A;  2GOL A;  5D46 A;  5ALP A;  8ICJ A;  3BQ1 A;  3JCF A;  4B9U A;  4Q43 A;  1S77 D;  5H2F U;  1RYS A;  3DV9 A;  1F5S A;  2H3Z A;  4RQ8 A;  2XCP A;  3RJK A;  3RBD A;  5HRI A;  5CP2 A;  5D49 A;  2M2T A;  1X40 A;  5KFZ A;  2D8C A;  5ALI A;  3AEV A;  3H38 A;  4LEV A;  2JEF A;  1WG8 A;  7ICM A;  5KFX A;  4B9L A;  2AGQ A;  5IIO A;  5KFJ A;  4IS7 A;  3ORY A;  2PMZ F;  3SZ2 A;  3SAF A;  3GU3 A;  2E5S A;  2PFP A;  1N60 A;  4WC1 A;  5KG4 A;  4Y2Y A;  4RQ3 A;  1VDV A;  1YLQ A;  4F4Z A;  5KT7 A;  2GO7 A; 
#chains in the Genus database with same CATH homology
 3RH5 A;  2P66 A;  1SKR A;  9ICH A;  1KDH A;  5D4B A;  2HHX A;  4C8N A;  4PHA A;  4BXO A;  4O5K A;  1S76 D;  4XUS A;  3C5G A;  1TK5 A;  2I1Q A;  5JUM A;  4RU9 A;  4DQI A;  3AQL A;  4E80 A;  4DOA A;  4X0B A;  4UAW A;  4YMN A;  3PW5 A;  3Q8M A;  2ASD A;  3OVB A;  1XWL A;  4ECY A;  2BQR A;  1NK5 A;  1KRP A;  4YR0 A;  8ICN A;  4FHX A;  3UXO A;  4WC6 A;  2ZH6 A;  2DR5 A;  3V72 A;  4DF4 A;  4KLL A;  4WC5 A;  4O3S A;  1V4A A;  4C8M A;  4K4H A;  3AQM A;  1Y88 A;  1U49 A;  1ZQY A;  4M9N A;  7ICU A;  3E2E A;  7ICF A;  5KT2 A;  7ICM A;  1ZQL A;  1TFY A;  3JPO A;  2BGW A;  7ICR A;  5KG5 A;  5J2K A;  4DL7 A;  1NJZ A;  2IHM A;  2JEI A;  3C2M A;  1WOT A;  4PPX A;  5J2G A;  2KTQ A;  2R8J A;  4DSF A;  2Y1I A;  1S97 A;  2IHN A;  3B0X A;  2C28 A;  5KFA A;  5KT5 A;  2HHT A;  5KFP A;  4QZG A;  4YMO A;  2PI5 A;  4MEY A;  5L1I A;  9ICA A;  5J2C A;  5DDY A;  3PX6 A;  1ZJN A;  5KFN A;  3RB0 A;  4FS2 A;  1LB2 B;  8ICO A;  1S9F A;  5TZV A;  4LT6 A;  9ICV A;  3C66 A;  1NK8 A;  1ZQE A;  5J0U A;  4I29 A;  4KMU A;  4XA5 A;  3IM1 A;  8ICV A;  1MIW A;  4S3N A;  4O9M A;  4I28 A;  1S0M A;  3MR6 A;  5F9N A;  4I2E A;  5KT4 A;  1NKC A;  4IG8 A;  4XRH A;  2V4Q A;  4X4R A;  3GIM A;  2M2V A;  4O3O A;  2NRZ A;  5CB1 A;  5J2F A;  4RQ1 A;  3GII A;  4NM1 A;  8ICB A;  5HRK A;  3GV8 B;  3H4D A;  5KFO A;  5BOM A;  4RNN A;  3KHL A;  3C23 A;  5C5J A;  2R8K A;  5J0O A;  4YD1 A;  3EPI A;  4ECX A;  2IMW P;  2W9C B;  2NRK A;  5J0Q A;  2PFN A;  4UAZ A;  2JEJ A;  4DSL A;  1XC9 A;  5DKW A;  5J2E A;  3TFR A;  5KT6 A;  8ICE A;  1TAU A;  7ICV A;  1KNY A;  1JXE A;  9ICW A;  2AU0 A;  3MGH A;  3G6Y A;  4O3R A;  2W9C A;  1UET A;  1ZQS A;  1KSP A;  4AT7 A;  8ICP A;  4KLU A;  3ISB A;  7ICK A;  5KG7 A;  1T8E A;  1OU5 A;  4MF8 A;  9ICL A;  5KFQ A;  1ZQA A;  5HP4 A;  4IQV A;  9ICS A;  1BPB A;  1NKE A;  2ZHA A;  2OWO A;  4I2H A;  3Q8P B;  3GIL A;  2ZH1 A;  4EBE A;  3NGD A;  4ECV A;  1ZQF A;  4I2J A;  5J0Y A;  2H5X A;  5DB6 A;  3C5F A;  4J9P A;  4DL4 A;  3FDS A;  4PHD A;  4B9V A;  4QZ9 A;  4GLX A;  2KFN A;  3RB6 A;  2KZZ A;  4Q45 A;  5DQI A;  4QZD A;  3KHG A;  4TQS A;  2C2R A;  4KLD A;  1PX5 A;  3THV A;  3QEB Z;  4LZG A;  1ZQQ A;  1PZN A;  4EYI B;  4ECQ A;  4M47 A;  5KG6 A;  4F8R A;  4RQ7 A;  5L9X A;  2FPM A;  1RYR A;  4ED6 A;  2DPJ A;  3PNC A;  3UPS A;  3SV4 A;  2AQ0 A;  2I9G A;  2O1P A;  3Q8Q B;  3H7I A;  4DSE A;  4FBU A;  7ICN A;  5KT3 A;  1VJ7 A;  3JPR A;  2BR0 A;  4WC2 A;  3OSN A;  4PGX A;  4F4W A;  4KLT A;  5DLF A;  1BPZ A;  2KZ3 A;  2PFQ A;  1T4G A;  5KG0 A;  3ZDB A;  1JN3 A;  2Q0Z X;  3PR4 A;  4DFM A;  4NLG A;  4QZA A;  4GXI A;  4P4M A;  1ZQB A;  4FHP A;  4ELU A;  3PV8 A;  3RB4 A;  2BCQ A;  4X4V A;  5HRL A;  1JAJ A;  4DL2 A;  4FO6 A;  3JPS A;  3ZD8 A;  3RRG A;  3HJ4 A;  5CR0 A;  4DS5 A;  7ICG A;  5CWR A;  4Q44 A;  2R8H A;  1WCN A;  4PGQ A;  1TK0 A;  4X4S A;  3KHH A;  4ZH4 A;  4IR9 A;  2FPL A;  4TUQ A;  2Q66 A;  4Z6C A;  5EWE A;  3PML A;  2DFL A;  4JV0 A;  4J9Q A;  2BHN A;  4QWD A;  4YN4 A;  3M8R A;  3H4B A;  2ZJ5 A;  4J9S A;  1TV9 A;  2P6R A;  8ICH A;  2ASJ A;  5DG9 A;  4NLN A;  3PX4 A;  1ZQW A;  4NKT A;  4X4O A;  2XY7 A;  3QZ8 A;  4DEZ A;  4F5R A;  4DL5 A;  3OSP A;  2ZH4 A;  1BVS A;  8ICT A;  4F4X A;  2W9A A;  1A76 A;  3PW2 A;  1ZJM A;  5J0X A;  2ISP A;  2HHS A;  7ICO A;  2ZTC A;  1UA0 A;  2RFF A;  5DB8 A;  1Z00 B;  4KLG A;  4UBB A;  3RH4 A;  4DQQ A;  4F2R A;  4KIT B;  2ATL A;  4GC6 A;  1ZQO A;  4J9K A;  1U48 A;  4ED7 A;  3GFK B;  3AU2 A;  5HHH A;  7ICH A;  4IR1 A;  4F4K A;  1Z00 A;  2XCA A;  4F5Q A;  1BGX T;  4EP7 A;  2W8L A;  2UVV A;  4YG2 A;  3HT3 A;  1KTQ A;  4RPX A;  5CHG A;  2HW3 A;  3OGU A;  4UBC A;  1UT8 A;  4RQ5 A;  3BDP A;  4M9H A;  1JXL A;  2C22 A;  8ICI A;  9ICF A;  3RJE A;  8ICC A;  3KTQ A;  4F5N A;  2W9B A;  9ICC A;  3MR3 A;  1COO A;  2ISO A;  4WC0 A;  1NO5 A;  8ICS A;  4FS1 A;  3OVA A;  2DR8 A;  3JZ0 A;  2ZTE A;  2ZHB A;  1D9D A;  1NK0 A;  4J9O A;  5KG1 A;  5EOZ A;  1QTM A;  3MBY A;  3OUY A;  1R8C A;  2AJQ A;  3Q8K A;  3MDC A;  2HVH A;  1NJY A;  4QW8 A;  3PW4 A;  4I2C A;  4J9R A;  5J2J A;  4ED1 A;  3AUO A;  3AU6 A;  4FH3 A;  1RPL A;  8ICF A;  4RWQ A;  4ATB B;  1ZQI A;  4YP3 A;  1H38 A;  1NJW A;  1SKW A;  4I2B A;  2RDJ A;  1UEV A;  3EW9 A;  1ZQR A;  7ICJ A;  2BPG A;  4ATB A;  3PMN A;  5IIM A;  2NRT A;  4RWP A;  1DK2 A;  4M04 A;  4TUP A;  4FHW A;  4B9S A;  4O5C A;  2PI4 A;  4MEX A;  2PFO A;  5DBA A;  3H8S A;  4YMM A;  2ALZ A;  3RJH A;  3SI8 A;  4M9L A;  3MFI A;  8ICR A;  3HIY A;  4KLH A;  1JX4 A;  4G3I A;  1F5A A;  5KFR A;  3LK9 A;  4DS4 A;  2WTF A;  4K4G A;  4DQR A;  2BCU A;  4DL6 A;  4YXJ A;  4DWI A;  9ICX A;  2B21 A;  2DPI A;  4WC7 A;  4WBZ A;  8ICM A;  5CA7 A;  4GXJ A;  4P4P A;  3JPN A;  1QSS A;  4LVS A;  2HHQ A;  2C2E A;  1S10 A;  4UQG A;  4ED8 A;  3LWL A;  2XY6 A;  5HML A;  4O3Q A;  3N4M B;  1N48 A;  3ZDC A;  4YD2 A;  1NK7 A;  1ZQV A;  3GIK A;  1ZET A;  1BNP A;  1BPE A;  5J2A A;  3GV5 B;  5L1K A;  2BCR A;  4DSJ A;  4KN7 A;  4AT7 B;  3N97 B;  2A1J B;  9ICK A;  4XQ8 A;  1ZQH A;  5J0W A;  4MFC A;  4RPZ A;  7ICT A;  1JMS A;  2NRW A;  4IQT A;  2ZTD A;  1SZP A;  4Z6E A;  3T5H A;  1DOQ A;  1EXN A;  3G6V A;  4F2S A;  9ICN A;  2A1J A;  5F2V O;  2ZJ8 A;  4P4O A;  4PH5 A;  5DBC A;  2W8K A;  2JEG A;  5EWG A;  3OJU A;  4IQW A;  5DB7 A;  3AQN A;  2ZH5 A;  4RT3 A;  3RJF A;  3RJJ A;  3TI0 A;  4BDP A;  4IQU A;  5J29 A;  4GC7 A;  4QZB A;  3RH6 A;  5KFH A;  4RT2 A;  4YR2 A;  4QWA A;  3TAR A;  1KLN A;  4ED2 A;  2BDP A;  3T3F A;  4I2A A;  4X5V A;  5HNK A;  1BPX A;  1KFT A;  4C8O A;  4AT8 B;  4UB1 A;  3EYZ A;  1BNO A;  4I27 A;  4EEY A;  3TAP A;  4RQ4 A;  5KFI A;  5J0T A;  4WC3 A;  9ICO A;  1QSY A;  2HVI A;  2KZM A;  4ECS A;  4AT8 A;  5L1J A;  2JZB A;  4R8U B;  5KFG A;  1U47 A;  1ZQD A;  3WFR E;  1D8Y A;  5HRB A;  2UVU A;  5KFC A;  3GDX A;  2RDI A;  3HP6 A;  2UVW A;  2LYH A;  4R8U A;  1ZQP A;  4MFA A;  2KFZ A;  4UB4 A;  3PY8 A;  3RR7 A;  1NJX A;  9ICB A;  4ECU A;  1KEJ A;  1ZQN A;  3QE9 Y;  2BPC A;  4RQ0 A;  2M2W A;  2DR9 A;  4Z6F A;  7ICS A;  4EBJ A;  3PR5 B;  4WBY A;  4AT9 A;  3T5J A;  2DR7 A;  4UD4 A;  4KN4 A;  4JUZ A;  5L1L A;  4KLE A;  9ICJ A;  7ICP A;  4X0A A;  3OVS A;  4TQR A;  3LWM A;  2VA3 A;  4RQ2 A;  3BQ2 A;  4O3N A;  5HR9 A;  4IRD A;  5J0S A;  3RRH A;  7ICI A;  1MIV A;  4P2H A;  4FH5 A;  2AGO A;  4R64 A;  4HYK A;  1KFS A;  4DF8 A;  4DSK A;  5DEC A;  3EZ5 A;  5J0P A;  4FHV A;  1A77 A;  3M9O B;  3EPG A;  4TUR A;  3C2K A;  1X9S A;  1HUO A;  3IHQ B;  4YR3 A;  1JQR A;  2IBK A;  1R8A A;  2ZJA A;  1JIH A;  9ICP A;  5KFT A;  2FLN A;  3RR8 A;  5KFW A;  3UPQ A;  1RZT A;  4FBT A;  2F1J A;  4BWJ A;  5J2B A;  5HMM A;  3C18 A;  4QW9 A;  5BPC A;  1XU4 A;  1DK3 A;  5DGA A;  4J9N A;  3QEA Z;  1SL0 A;  2UVR A;  2FPK A;  5III A;  1ZQZ A;  2J6S A;  5HRE A;  4WCW A;  4ELV A;  4Q8F A;  4DL3 A;  4B9M A;  1L3U A;  4E7X A;  3MR5 A;  4NY8 A;  3C1Z A;  4EBK A;  1BPD A;  3V6H A;  8ICU A;  2DVI A;  1K1S A;  1QSL A;  2O5A A;  2ASL A;  1TAQ A;  2DRB A;  5KFV A;  4CCH A;  9ICG A;  4DFP A;  1RXV A;  1MQ2 A;  1MIY A;  3WFP A;  3H8J A;  1XSN A;  9ICE A;  4I2F A;  8ICG A;  4ECZ A;  4QWC A;  4J9L A;  2ID1 A;  2W9B B;  1QLN A;  4F5O A;  4RUA A;  2HHW A;  2FLP A;  4QWB A;  1Z3E B;  1IXR A;  1X9W A;  4Q8E A;  4JV1 A;  1L5U A;  2DRA A;  3V7L A;  1XS9 D;  3C21 A;  2AGP A;  3PO4 A;  4QZH A;  3M8S A;  4ED3 A;  1SL1 A;  1U4B A;  1UT5 A;  1RXW A;  4DOC A;  9ICR A;  1L3S A;  4FHY A;  2BE3 A;  3OUY B;  3MFH A;  3GQC A;  1Q78 A;  4O0I A;  4DQP A;  1R8B A;  3PW7 A;  1X9M A;  3LQC B;  1S0V A;  3H3A A;  3HW8 A;  4NM2 A;  2P6U A;  2J6U A;  4YXM A;  1XO1 A;  5DG8 A;  2HHU A;  4X4P A;  4X4U A;  2XGP A;  2XGQ A;  2BCS A;  4EBC A;  1XSL A;  2BPF A;  2KN7 A;  3G6X A;  4DO9 A;  4JV2 A;  3UXP A;  4J9M A;  2MUT B;  4O5E A;  1SKS A;  5IIK A;  8ICX A;  2ZH2 A;  2XC9 A;  4DFJ A;  2ZUC A;  3RB3 A;  3V7J A;  1NKB A;  2MUT A;  5DG7 A;  4UB2 A;  1ZQC A;  4EBD A;  4B9N A;  5DQH A;  4EZ9 A;  4NLZ A;  1S0O A;  5J2I A;  4MFF A;  4BGD A;  2ZH9 A;  5KFY A;  1T3N A;  2F1H A;  1L3V A;  5HC9 A;  2XO7 A;  9ICT A;  4PGY A;  4F3O A;  1Q79 A;  1B43 A;  4DSI A;  2AQ4 A;  1MC8 A;  3LDA A;  9ICI A;  4I2G A;  4KLJ A;  3HX0 A;  3ZDD A;  4UAY A;  4NKU A;  4QZ8 A;  5KFU A;  3PW0 A;  1TFW A;  1HUZ A;  3OV7 A;  1XSP A;  3MAB A;  2Y1J A;  1C7Y A;  4M5D A;  1U45 A;  4I2I A;  3TFS A;  2R8G A;  3C2L A;  4BWM A;  2NRX A;  3ETL A;  4BXO B;  5KFM A;  7ICQ A;  4M9G A;  1TVA A;  4QZF A;  4UD5 A;  4RNO A;  3UXN A;  2FMS A;  5DBB A;  5DB9 A;  1L3T A;  4QWE A;  1NZP A;  2XY5 A;  3C1Y A;  3JPQ A;  5KFS A;  4YCX A;  5J2H A;  5KFF A;  5DLG A;  2MAX A;  5KFE A;  5F9L A;  1ZQM A;  3MR2 A;  4O3P A;  5DGB A;  4RNM A;  3RJG A;  2FMQ A;  3BQT A;  4RZR A;  3M9N B;  3RTV A;  4K4I A;  2ZH8 A;  4M9J A;  4Z6D A;  3M9M B;  5HRD A;  5KG3 A;  4RUC A;  1D9F A;  8ICK A;  3H37 A;  2BQU A;  5HRG A;  3BJY A;  4QZE A;  4RPY A;  2BKE A;  3B0Y A;  4F50 A;  3RAQ A;  4RQ6 A;  1ZYQ A;  4KTQ A;  7ICL A;  3AQK A;  1X2I A;  4IRC A;  4PHE A;  5KFB A;  3K75 D;  1HJP A;  2ZUD A;  4C8L A;  3PVX A;  2ZH7 A;  3UQ2 A;  2JZB B;  2ZUB A;  3EWA A;  2VA8 A;  4EYH B;  1V9P A;  2FMP A;  3WFQ E;  2M9N A;  2R8I A;  4ELT A;  3NTU A;  3WFS C;  9ICU A;  4UB3 A;  4LZD A;  3OJS A;  3RAX A;  4KLS A;  2C2D A;  1ZQG A;  4RWN A;  4IRK A;  3ZDE A;  4XQ7 A;  4E0D A;  4NXZ A;  2F1I A;  2NRV A;  1MSW D;  4DLG A;  1ZQX A;  4GXK A;  4R65 A;  1LV5 A;  8ICQ A;  4DLE A;  3V7K A;  3RBE A;  4KLI A;  3Q8L A;  4X4T A;  3ISD A;  2VA2 A;  3HJ1 A;  2V4R A;  3QZ7 A;  4QZC A;  1TK8 A;  1U9L A;  4WC4 A;  4R66 A;  4DOB A;  3TAQ A;  4PHP A;  1TKD A;  3FYH A;  4KLF A;  8ICY A;  9ICQ A;  4AT9 B;  4ECW A;  1MQ3 A;  1ZQU A;  5J2D A;  3TQ1 A;  5BOL A;  1NK6 A;  4B9T A;  4KLM A;  5HRH A;  5CJ7 A;  3HPO A;  1NOM A;  3JYY A;  1CUK A;  4I2D A;  3OHB A;  3PX0 A;  4C8K A;  4M6W B;  4DQS A;  7ICE A;  2PBE A;  3SYZ A;  4MF2 A;  4M0A A;  2HHV A;  4F91 B;  1T7P A;  4KLO A;  8ICW A;  3V6J A;  3BQ0 A;  3PO5 A;  4M6W A;  3JPP A;  5DQG A;  1ZQT A;  4M2Y A;  3T5L A;  1CEZ A;  1UEU A;  3T5K A;  4E8F A;  3WFO A;  9ICM A;  5D46 A;  3OHA A;  8ICJ A;  4F93 B;  1NK4 A;  3RJI A;  8ICZ A;  3BQ1 A;  2BCV A;  4YFK A;  3H40 A;  3TAN A;  4B9U A;  1B22 A;  4UB5 A;  4Q43 A;  3ISC A;  1S0N A;  1S77 D;  2M2U A;  1RYS A;  1NK9 A;  5EWF A;  5IIN A;  2KP7 A;  4JWM A;  5DDM A;  1K1Q A;  4QZI A;  5IIL A;  4F4Y A;  2J6T A;  2FLL A;  4RWO A;  3K4G A;  4JK1 A;  1ARO P;  5KFD A;  4ED0 A;  4NLK A;  4RQ8 A;  2XCP A;  3RJK A;  4X4N A;  4YQW A;  3RBD A;  1BPY A;  5HRI A;  1R89 A;  5CP2 A;  1ZQK A;  5D49 A;  4R63 A;  2M2T A;  8ICA A;  8ICL A;  4TUS A;  5KFZ A;  3V6K A;  4KLQ A;  5DED A;  2BQ3 A;  4F5P A;  3SV3 A;  4ECT A;  1FA0 A;  4ECR A;  2IA6 A;  2PXI A;  3MDA A;  5KG2 A;  3JPT A;  3H38 A;  4X4Q A;  1TFR A;  2JEF A;  4EZ6 A;  3H8W A;  3ZD9 A;  5KFX A;  5IIJ A;  5KTQ A;  3Q8R B;  3Q8S B;  3MGI A;  5IIO A;  2AGQ A;  4B9L A;  5KFJ A;  1N56 A;  3GIJ A;  3ORY A;  1SL2 A;  3HWT A;  3SZ2 A;  4YVZ A;  3GV7 B;  3ZDA A;  1DGS A;  3KHR A;  1D8L A;  4DFK A;  1UA1 A;  4JWN A;  2W9M A;  1VFG A;  2PFP A;  1ZQJ A;  5KFK A;  2VAN A;  3UQ0 A;  3NYB A;  3L9D A;  5KG4 A;  4WC1 A;  2V9W A;  4RQ3 A;  1KFD A;  1YLQ A;  4F4Z A;  2GWS A;  2HHP A;  5HHI A;  3H39 A;  5KT7 A;  1WCL A;  5J0R A;  4F92 B;  5KFL A;  1IM4 A;  5HRF A;  2ZH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...