4M9NA

Dna polymerase beta e295k soaked with datp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
326
structure length
300
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHTINKYTIRPLGEPLPVDSEKDIFDYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 91
structure length 300
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9nA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9nA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9nA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9nA03
4J9SA 1XSLA 1U9LA 3GFKB 8ICJA 4E0DA 7ICRA 3C1ZA 3TQ1A 5HMLA 1TVAA 4F4KA 5DBAA 2XO7A 4B9TA 3Q8KA 3QZ8A 5KG1A 3JPOA 3H40A 4J9LA 5L9XA 1JX4A 1AROP 2V4RA 4KLSA 3UQ0A 3SI8A 4WCWA 3WFSC 1B43A 7ICOA 5L1LA 3PY8A 1CEZA 3AQMA 2Q0ZX 4JK1A 4BXOB 3GDXA 5L1IA 4X4NA 4YXMA 4MF2A 4AT9A 4QZHA 5KFEA 3RAQA 2AQ4A 5EWGA 1T7PA 4DSIA 2ALZA 4F5NA 1BNOA 4Z6DA 2ZJAA 5KG5A 3V7KA 4EBDA 4K4GA 8ICAA 3SYZA 4UD5A 3JPTA 3G6YA 1ZQYA 4FHWA 5DGBA 4UB4A 4WC2A 1T8EA 1ZQDA 1XWLA 4PH5A 4ELUA 4EBJA 4DLGA 9ICVA 1DOQA 3M9MB 5IIMA 7ICKA 4M9NA 5J0TA 4ECSA 5J0SA 2MUTB 5DBCA 4QZDA 4RQ8A 1QSLA 5HRKA 3PX0A 4F5PA 3H38A 4IQUA 4DQRA 5KG0A 4XQ7A 1DK2A 1UEUA 4PGYA 2AGQA 4KLEA 4O3PA 3THVA 4QWAA 2HHWA 1R8AA 1HJPA 3HT3A 2ISPA 4M2YA 4F5QA 1NK7A 5DG7A 5J0UA 1KEJA 1Z3EB 7ICUA 2XCPA 4M47A 2UVRA 3KHGA 4M6WA 5HRHA 3MR2A 5JUMA 1DK3A 1PX5A 1V4AA 3Q8RB 4YCXA 3SZ2A 4B9NA 5IINA 2ASLA 1QLNA 5DECA 3RH6A 4KLLA 2ZH1A 4QZ8A 4O9MA 4EBEA 5KFVA 4UB5A 1ZQFA 1Y88A 7ICSA 1MIWA 2ZH7A 2Y1JA 2NRKA 3ETLA 5TZVA 4QW8A 4FBUA 3V6KA 8ICNA 1NKCA 5KG7A 3RBEA 4YMMA 1S9FA 1MIYA 4DF4A 2BR0A 1JXEA 1ZYQA 1N56A 3T5HA 4DOBA 4FO6A 1L3SA 1ZQJA 1BGXT 2KP7A 4C8NA 5IIOA 1X9WA 1ZQKA 3Q8SB 5KFXA 4O3QA 5HMMA 3ISCA 8ICWA 9ICKA 4I2FA 3HPOA 3T5LA 4QWDA 3M9NB 5IIIA 4DL4A 2Y1IA 3AQNA 1MIVA 2IHMA 3PO4A 4X4UA 4YD1A 2KZ3A 3JPPA 2PFNA 9ICBA 3EW9A 2BQRA 4FBTA 3Q8MA 5CR0A 3HW8A 5KFHA 2BCSA 4DSLA 4B9UA 5J2IA 5KFJA 2ZH9A 8ICYA 3TI0A 4J9PA 2PFPA 4IR1A 2MAXA 4M6WB 2HHQA 2ZH2A 3RRHA 5F2VO 5HNKA 1BNPA 4KMUA 1NKBA 1OU5A 4ED2A 1NZPA 3C18A 3M9OB 4KLDA 4JUZA 1TK5A 2PXIA 8ICEA 3RJIA 4WBZA 2O1PA 4NM1A 5DKWA 2RDJA 4X4VA 1Q79A 3KHRA 4TURA 4J9MA 1U47A 3MR6A 4GC6A 2AGPA 3GV7B 2LYHA 1LV5A 1ZQZA 4F50A 1KFTA 4MF8A 3AQLA 2VA3A 5KFWA 3H8SA 2PI5A 5J0OA 1TK8A 4F2RA 3RR8A 4UAWA 5HRLA 3ZDEA 4EZ6A 1NK4A 3OUYB 3B0XA 3RAXA 5CWRA 3IM1A 5KG2A 3MBYA 1RXWA 2ATLA 3JPRA 3K75D 4PHPA 5KFFA 2FMPA 2BQUA 4I2AA 1D8YA 5HRDA 4WC1A 4NLZA 2M2TA 4IQTA 1D8LA 4B9SA 4IR9A 3UQ2A 4I2BA 4DS5A 2FMQA 4ED3A 4KLTA 2BCQA 4E8FA 1L3UA 7ICFA 2A1JB 9ICEA 2JEIA 5BOLA 1BVSA 4RQ6A 4F4YA 2UVUA 1JMSA 1RZTA 9ICOA 1SL0A 4ECXA 3RJJA 1SKRA 5CP2A 5KFLA 4ED1A 4YXJA 3PNCA 5KFIA 4I29A 9ICMA 8ICHA 3RTVA 5KTQA 3C23A 1KLNA 8ICKA 1B22A 1KRPA 3PV8A 2KFNA 3KHLA 1SKSA 5KG4A 5L1JA 4I2GA 2ZTDA 4F4WA 4R65A 4P4PA 4DL2A 2UVWA 1K1SA 4RQ3A 5J0RA 2W8KA 4F2SA 7ICGA 4RNMA 4O3SA 2WTFA 4QZAA 2BKEA 4TUQA 7ICNA 3ZDBA 5J2HA 3Q8PB 4QZGA 4KLOA 3ORYA 4KN4A 4M9GA 3H3AA 5DBBA 4DL6A 5J0YA 4AT8A 4S3NA 3TARA 4QZFA 2XY7A 1TK0A 2ZUCA 5KFOA 4O5CA 4ECUA 4PGXA 2DPJA 1R8CA 5KG6A 4PHEA 3OVBA 1KSPA 3BJYA 4B9LA 4Z6CA 4BGDA 3GILA 1U48A 4RQ2A 1L3VA 1ZQEA 4E7XA 1XO1A 4JV1A 1Q78A 1WOTA 5J2AA 4RNNA 3GIJA 3RJKA 2P6UA 9ICSA 3ZD9A 4ECYA 4F8RA 5DDMA 8ICBA 4Q43A 1S0NA 4RNOA 4CCHA 2NRWA 3N4MB 4EBKA 2ZH6A 8ICIA 4F93B 2RFFA 3OSPA 3WFOA 4DL5A 8ICOA 3C5FA 4YFKA 1TKDA 2JZBB 3PO5A 9ICWA 4AT9B 4PHDA 2ZHBA 4I27A 5J2CA 1UT8A 4XA5A 2P6RA 2M9NA 3Q8QB 5DGAA 3JPNA 3QEBZ 3H7IA 4ELVA 1A77A 4MEXA 8ICCA 3WFQE 4QZBA 2BCUA 2RDIA 4DOCA 3RB0A 4JV2A 4TUPA 1NK8A 5KFCA 4C8KA 1NJYA 4QW9A 1NK9A 4O3NA 1T4GA 2FPKA 4ECRA 4DFJA 3KTQA 1JQRA 4MFCA 3C66A 4YVZA 2BPCA 5J2DA 1XSPA 4B9VA 2H5XA 5KFGA 3ISDA 1S77D 4GLXA 4B9MA 5HRGA 3OVSA 4Q45A 1XSNA 2AU0A 2HHSA 3AUOA 2DR5A 4AT8B 3H8JA 2C2RA 1T3NA 4EYHB 1RYSA 2PI4A 4C8LA 7ICEA 3TAQA 3C21A 2PBEA 2BPFA 1VJ7A 4Z6EA 1S0MA 4Z6FA 3OHAA 3BQ1A 3PVXA 3JPSA 4EP7A 2BPGA 1ZQVA 4PPXA 4DSKA 1UA0A 8ICUA 2ZH3A 1ZQMA 3PW5A 1S97A 2HHPA 4YN4A 1NOMA 4O3OA 3JZ0A 1V9PA 3PMLA 4DLEA 4QZ9A 3NGDA 4RWQA 4UB1A 3BQTA 4I2DA 4RT2A 3PR4A 2HVIA 3OUYA 7ICHA 3LK9A 5DB8A 4Q44A 4UB3A 4DFPA 5KFRA 2PFOA 3BDPA 5KT5A 4WC0A 1WCNA 3GV5B 8ICXA 5HP4A 3B0YA 4ECQA 1NO5A 2V9WA 3WFRE 4DL7A 2A1JA 1A76A 5DG8A 1X9MA 5DB7A 3OGUA 3C2MA 4M5DA 3ZDCA 5IIKA 1QSYA 4DWIA 4RWNA 9ICUA 4EBCA 1RYRA 8ICFA 4I2JA 1F5AA 2VANA 4UB2A 7ICVA 1X2IA 3WFPA 5J2FA 1ZQCA 4KTQA 4R64A 4RQ7A 1NJXA 1ZQIA 4QWCA 5DB6A 4RQ5A 1BPXA 2ISOA 4M9HA 5CA7A 1ZQGA 1ZQPA 2HW3A 3T5KA 5KT6A 4X4SA 2KFZA 3PW7A 8ICPA 4IQWA 1SL2A 4UBCA 3EYZA 4P4OA 2BGWA 4YR2A 2FMSA 4TQSA 2FLPA 5KFSA 4F92B 4RUCA 5HRFA 1EXNA 2HHXA 4YR3A 2AGOA 3OJSA 4FHXA 4JWMA 4DEZA 4UAYA 4E80A 5DG9A 2OWOA 3RBDA 1ZQQA 5HRBA 3V6JA 1IM4A 4J9KA 1ZQAA 3RR7A 3RB4A 4AT7B 9ICGA 1R89A 9ICRA 3RH5A 2BCVA 3IHQB 4YR0A 2V4QA 4WC4A 3HX0A 4C8MA 4ECVA 2R8IA 3C2LA 2BHNA 1JXLA 1KFSA 4O5KA 2ZTCA 2O5AA 5DB9A 3ISBA 4J9RA 3E2EA 2NRVA 5DLFA 3HP6A 1ZQOA 5CB1A 3PW2A 2ASDA 2NRTA 4K4IA 2W9MA 3MGHA 8ICSA 3AU6A 3LWLA 5KFZA 2ZJ5A 1ZQSA 4JWNA 3T5JA 4XRHA 4K4HA 2ID1A 4J9OA 3G6XA 4WC7A 2BCRA 2ZJ8A 5J2EA 3TFRA 1KTQA 2JZBA 3FDSA 3MGIA 3GIIA 4FHVA 4FHPA 3UXNA 4RPZA 4ECZA 2B21A 2NRZA 4UAZA 4NKTA 2DFLA 3RH4A 4RWPA 4J9QA 8ICQA 1H38A 2XGPA 4F4XA 2XC9A 1MQ2A 1ZQLA 4Q8EA 3LDAA 5DLGA 4O5EA 4JV0A 1UETA 4RPXA 4J9NA 4TUSA 4DOAA 4YMNA 1KNYA 4WBYA 1KDHA 2IA6A 5EWFA 3PX6A 4YG2A 7ICMA 3GIKA 2XY5A 1ZQWA 4DQSA 4RWOA 2DRBA 4ECWA 2KZMA 4IQVA 5KFPA 2ZH8A 4R63A 5F9LA 4DFMA 4DF8A 1ZQRA 4FS2A 3V72A 4MEYA 1XS9D 2KN7A 3BQ2A 4BWMA 4ZH4A 5C5JA 4I2IA 5KG3A 4ED6A 4HYKA 3PX4A 1ZETA 1ZQTA 4M9JA 3AQKA 2VA8A 9ICPA 1D9DA 9ICFA 2P66A 8ICGA 3LQCB 3UPQA 3M8RA 2FLLA 2F1IA 3H8WA 3H39A 4M0AA 1NKEA 1XU4A 5KFQA 1BPYA 5J29A 4NLNA 1S0OA 4EEYA 2DR7A 4X4PA 2VA2A 3AU2A 1NJZA 1BPEA 4ED0A 4XQ8A 3MDAA 1S76D 3K4GA 4ED8A 2KZZA 3EWAA 3KHHA 9ICAA 2FPMA 4X0AA 5J2BA 2F1JA 4LZDA 4ATBA 2JEJA 3JPQA 3H4BA 4NY8A 3RJGA 4UD4A 1NK6A 1IXRA 4R8UA 5HC9A 2HVHA 4DQQA 4NLGA 3JYYA 4KLGA 4KLFA 3Q8LA 3EPGA 5KFNA 2M2UA 1L5UA 5IIJA 2DVIA 5DQIA 1C7YA 5J0WA 7ICIA 2DR9A 5F9NA 5DDYA 1MSWD 3OVAA 2XY6A 1BPBA 4YD2A 4RZRA 2ZTEA 1YLQA 2XCAA 4YQWA 2ZHAA 8ICLA 1ZQHA 1SKWA 1U49A 4WC6A 5KT4A 4F5OA 2DR8A 4NXZA 3RRGA 5J2GA 1N48A 2HHVA 3MR3A 3TANA 4MFAA 3HJ1A 1CUKA 3L9DA 5BOMA 5D46A 1ZQNA 5L1KA 5J0PA 7ICPA 9ICLA 2KTQA 3OV7A 4RQ1A 3G6VA 1ZJNA 2C2EA 3PW4A 1TFRA 1Z00B 4GXJA 4ECTA 3MR5A 4DSFA 3TFSA 3QEAZ 2IHNA 5HHHA 5KFBA 5BPCA 4NM2A 1U45A 2ZUDA 2BDPA 1UT5A 2ASJA 4M04A 4BWJA 9ICIA 1NK5A 5EWEA 3H37A 2FLNA 3H4DA 4O3RA 4AT7A 3NTUA 5CHGA 2JEFA 2UVVA 4DQIA 3MFIA 3PW0A 3MDCA 2W8LA 1FA0A 7ICLA 2I1QA 4DSEA 7ICQA 4QWBA 4X4RA 1ZJMA 1TV9A 2IMWP 2M2VA 2ZH4A 4EYIB 3TAPA 4C8OA 5KFDA 1VFGA 4I2CA 4ATBB 5J0QA 1ZQBA 9ICNA 2W9BA 4LZGA 3RB3A 2J6TA 2R8KA 4G3IA 4X5VA 1UA1A 4IG8A 5J0XA 4PHAA 3C5GA 4R8UB 3C1YA 4GXKA 4QZCA 4F91B 4QWEA 3LWMA 1PZNA 2R8HA 2W9AA 4Q8FA 4FHYA 4M9LA 4FS1A 3MFHA 3V7JA 4I28A 3T3FA 8ICZA 2BE3A 4RU9A 5D49A 2M2WA 4DO9A 3ZDDA 2IBKA 4WC3A 4ED7A 2Q66A 2DPIA 4UQGA 5D4BA 5HRIA 2C2DA 4R66A 3GV8B 1JAJA 1BPDA 4F4ZA 4BDPA 3FYHA 5KFUA 3OHBA 1XC9A 1X9SA 1HUZA 3GQCA 4I2HA 9ICTA 3RJFA 5DQHA 5KFAA 4DL3A 2R8GA 4LT6A 1SZPA 4YP3A 4FH3A 1UEVA 4X4QA 3SV4A 5KT7A 4F5RA 1NJWA 2W9CA 1RXVA 4X4TA 2AJQA 5KFMA 1JN3A 3PR5B 4GC7A 8ICVA 1BPZA 1ZQXA 1TAUA 4KITB 3V6HA 3EPIA 4KLJA 3HJ4A 5DQGA 5HREA 4MFFA 4KLIA 2JEGA 5J2KA 3C2KA 9ICCA 1U4BA 4WC5A 3GIMA 4QZIA 1COOA 9ICXA 5J2JA 1LB2B 4DS4A 4X4OA 2HHTA 9ICQA 3ZD8A 1S10A 4DSJA 9ICJA 3QE9Y 4EZ9A 5CJ7A 3UPSA 3ZDAA 4RT3A 3SV3A 2BQ3A 3OJUA 3PMNA 2W9BB 2PFQA 7ICTA 5HR9A 5KFKA 4YMOA 4P4MA 8ICTA 5IILA 4RQ0A 3MABA 4XUSA 8ICRA 2HHUA 1QTMA 4F3OA 1ZQUA 2ZH5A 1K1QA 4LVSA 3BQ0A 3UXPA 1TFWA 4IRCA 4TQRA 3RJHA 2FPLA 2NRXA 5KFYA 3UXOA 1KFDA 2XGQA 1QSSA 4QZEA 3EZ5A 1S0VA 4DQPA 4BXOA 9ICHA 1RPLA 1TAQA 2I9GA 2J6SA 4NLKA 5DEDA 4DFKA 3V7LA 4KN7A 4ELTA 3NYBA 1L3TA 4X0BA 4FH5A 4UBBA 4P2HA 4RPYA 1D9FA 2J6UA 4IRKA 4KLMA 2C22A 5HHIA 1MC8A 2C28A 4RQ4A 5KT3A 2DRAA 3RB6A 1WCLA 5EOZA 2W9CB 4O0IA 3N97B 1NK0A 1R8BA 1TFYA 1JIHA 8ICMA 1HUOA 7ICJA 3HWTA 2MUTA 4GXIA 2AQ0A 3RJEA 2GWSA 1MQ3A 4NKUA 3QZ7A 3M8SA 1Z00A 4RUAA 4IRDA 2ZUBA 2F1HA 2R8JA 4I2EA 4KLUA 4KLQA 1DGSA 4PGQA 3OSNA 1SL1A 4KLHA 3HIYA 5KFTA 5KT2A
chains in the Genus database with same CATH superfamily
1ZD5A 2G5HB 1TVAA 5DBAA 4B9TA 3QZ8A 5KG1A 2WF8A 1IIPA 1X6IA 3SI8A 4WCWA 7ICOA 3PY8A 2Q0ZX 4BXOB 5L1IA 3AN1A 4YXMA 4MF2A 1Q3UA 5ALJA 5KFEA 5EWGA 4UB6U 1BNOA 1ZXIA 4K9BA 4K4GA 4UD5A 3SYZA 5AM0A 3JPTA 3G6YA 5DGBA 4UB4A 1PK3A 4ELUA 3IDWA 9ICVA 3M9MB 4M9NA 5J0SA 4RQ8A 2P35A 4F5PA 4K99A 3PSTA 3T79A 4PGYA 1R8AA 3THVA 3BS5A 1NK7A 2K8CB 5J0UA 1Z3EB 3CK6A 3KHGA 3MR2A 1DK3A 5AI8A 2QB0B 3SZ2A 2K8AA 5IINA 5ALRA 4C80A 4KLLA 1URJA 4UB5A 3F2CA 1Y88A 3FAHA 3ETLA 5TZVA 4FBUA 3V6KA 2EZYA 1QCKA 2JMGA 2YB4A 1SV0A 5HMMA 1K5OA 4QWDA 3M9NB 5IIIA 2DUYA 2OCEA 1MIVA 5ALZA 2KZ3A 4US9A 2PFNA 2BQRA 4FBTA 5HR6A 3KOOA 2BCSA 5J2IA 3TI0A 2ZH2A 2HHQA 3RRHA 5F2VO 5HNKA 5AM1A 4ED2A 3M9OB 4JUZA 1TK5A 2PXIA 4NM1A 5L1MA 4TURA 4J9MA 3MR6A 2MU2A 3ICXA 4MF8A 5KFWA 3H8SA 4F2RA 3ERCC 3D2QA 3OUYB 3NWIA 2KSOB 3F53A 1WWUA 3JPRA 3DDHA 5ALUA 4NLZA 3ONNA 1ZRMA 1SGGA 2HOIA 1L3UA 9ICEA 1X66A 3RJJA 5AKJA 9ICMA 8ICHA 4PL2A 3C23A 1B22A 1IG6A 3KHLA 4I2GA 2HOFA 4DL2A 2UVWA 1K1SA 5J0RA 3N7PD 2LPEA 2JH1A 3ZDBA 3Q8PB 2GOLA 4KLOA 4KN4A 5J0YA 4ICAA 4QZFA 3C29A 2ZUCA 3AMZA 2CPRA 5AICA 1LKYA 1ZQEA 4RQ2A 1O08A 2G06A 9ICSA 5DDMA 8ICBA 2BDUA 2DF4B 2NRWA 2ZH6A 8ICIA 3WKDA 4DL5A 1DXSA 3C5FA 2JZBB 3K1ZA 4I27A 1V85A 4LEWA 3Q8QB 3JPNA 1SZHA 4C7ZA 5AHXA 4NXWA 4MEXA 3WFQE 4K97A 2RDIA 3S6JA 1ZRNA 4EEBA 1NK8A 5KFCA 4O3NA 2FPKA 3KTQA 1JQRA 3KZIU 2BPCA 5J2DA 4OJLA 5CEHA 2Y0SC 4Q45A 1XSNA 2AU0A 2HHSA 3AUOA 3OPXA 3H8JA 5JTIA 2ZH3A 3TAQA 2BPFA 1VJ7A 2M0NA 1S0MA 4Z6FA 1O03A 4P0QA 1ZQMA 3PW5A 2HHPA 1L8OA 1NOMA 3JZ0A 4DLEA 2HBKA 4U7CA 4Q44A 2LKYA 2A3VA 4UB3A 5KT5A 3I28A 5HP4A 1KW4A 2KJ8A 1HIWA 1KN5A 2WF6A 2W04A 3C2MA 2KG5A 2W54A 1F5AA 2VANA 7ICVA 1YZ7A 1P7DA 5AKHA 1X2IA 3WFPA 1T3QA 4NL9A 1ZQCA 4R64A 4QWCA 4RQ5A 2ISOA 1ZQGA 5ALPA 5KT6A 4X4SA 1SL2A 4TQSA 4F92B 2HHXA 2AGOA 4JWMA 4DEZA 4E80A 4OAFA 2K60A 5ALOA 3RB4A 5AKXA 9ICGA 2NO5A 3RH5A 3IHQB 3GZFA 3HX0A 4ECVA 3C2LA 4O5KA 2ZTCA 2O5AA 5DB9A 5ALDA 5DLFA 3PW2A 8ICSA 5KFZA 2KOBA 2W03A 4AT9A 3QUQA 2NRZA 1Z19A 2DFLA 3NVOA 2XGPA 2ZG6A 1ZQLA 5DLGA 4JV0A 4EGWA 2IA6A 3GU3A 4DQSA 4OAGA 1ZD3A 4AYBF 2BBHA 2Y0SF 4MEYA 3I76A 4BWMA 1ZETA 4HYKA 4M9JA 3AQKA 2G09A 2VA8A 1JRPA 3D6JA 9ICPA 2P66A 5KL8B 1BPYA 2K4IA 4PZOA 5J29A 4EEYA 2DL0A 4X4PA 1NJZA 3K4GA 2KZZA 1ZD4A 2IOFA 4ATBA 4NY8A 4UD4A 5ALVA 5J8YC 4NLCA 5KFNA 1L5UA 5IIJA 2KIVA 1C7YA 4RQNA 1BPBA 4YD2A 3QU7A 5AKKA 2A19A 4OJOA 8ICLA 5JRTA 1U49A 4WC6A 4J03A 4F5OA 2BZFA 4NXZA 3RRGA 3WKBA 3UMGA 4MFAA 3L9DA 5BOMA 1ZQNA 7ICPA 4Y2VA 2OHFA 2GO7A 5KL1B 4MKPA 4DSFA 3TFSA 5HRLA 4OAIZ 3QNMA 3QXGA 1UT5A 1VDVA 2FLNA 5CHGA 2JEFA 3MFIA 3PW0A 3MDCA 2W8LA 7ICLA 4EELA 2M2VA 5KFDA 2F3NA 4C4TA 4I0UA 1ZQBA 2R8KA 1UCVA 4X5VA 5J0XA 3C5GA 4QWEA 1PZNA 4Q8FA 4FS1A 1X40A 5AI6A 4DO9A 3MGVA 3ZDDA 2IBKA 4PJ0U 1JAJA 1V97A 3FYHA 9ICTA 5DQHA 5KFAA 4YP3A 4FH3A 4USAA 5KT7A 1PVQA 2WHEA 8ICVA 3NRWA 3V6HA 3EPIA 3VC8A 3SQIA 4KLIA 1F0MA 4UB8U 3UM9A 5AK3A 3EUB2 4NXVA 1SIJA 2XICA 1S10A 1UPHA 3ZDAA 2PFQA 5HR9A 1XNSA 5GTHU 1OUQA 3MABA 2NV3A 2LI6A 1QTMA 3BQ0A 3CW2C 2FPLA 5KFYA 2HBLA 2YB1A 1QSSA 3QU4A 4BXOA 4NLKA 2RLTA 4RPYA 4KLMA 1MC8A 5AM4A 5KT3A 3HRDD 1OW5A 1TFYA 3OTQA 4KX3A 4O0IA 2D8CA 4OAHA 4UAVA 3RJEA 2EAMA 2KVSA 4NKUA 3N28A 2KJ9A 4PGQA 1SL1A 4KLHA 4C4SA 5KT2A 4J9SA 1U9LA 2XI9A 7ICRA 4DFDA 4F4KA 1S8OA 3M1YA 2XO7A 2QB0A 3JPOA 5L9XA 2KV2A 4KLSA 3RF9A 3UQ0A 3NS1A 1NNLA 1NI3A 4NXUA 1CEZA 5ALQA 3FM9A 1T7PA 4CF4A 2ALZA 4Z6DA 4EBDA 4PZNA 2W7PA 3D2NA 1T8EA 2HCFA 2CRXA 1ZQDA 4PH5A 5IIMA 7ICKA 4ECSA 5HRKA 5DBCA 3H38A 5AM2A 4KX5A 4Y2YA 4O3PA 1CRXA 3KFUF 2GLEA 5DG7A 1N63A 3TADC 2XCPA 5B3QA 5HRHA 5JUMA 4UARA 3Q8RB 4YCXA 2ASLA 3K7DA 2NRKA 2JR5A 1NKCA 1S9FA 2OXOA 1MIYA 4DF4A 2BR0A 1JXEA 4DOBA 1X9WA 2KSOA 1ZQKA 4I2FA 3HPOA 3T5LA 3IG8A 4DL4A 3ER9B 3SD7A 2MSNA 3HW8A 5KFHA 5AI4A 4B9UA 2IOHA 2PFPA 2QKQA 4M6WB 1OU5A 3HILA 8ICEA 2RDJA 3E58A 4X4VA 1U47A 4K9AA 2AGPA 2NO4A 2YN4A 5AKGA 4F50A 1KFTA 2VA3A 5J0OA 3N7SC 4EZ6A 1NK4A 1N2XA 2LHTA 3B0XA 3RAXA 3IM1A 4XJEA 5HRDA 4BJQA 4IQTA 2M2TA 4B9SA 3BZKA 2Y9TA 4DS5A 3SAFA 2BCQA 7ICFA 1SL0A 2DKZA 4ECXA 5KFLA 4ED1A 4I29A 3RTVA 5KTQA 1SXEA 1KRPA 2KFNA 2ZTDA 4F4WA 4R65A 4F2SA 2WTFA 2BKEA 5J2HA 2LYAA 3H3AA 1TAMA 5ALYA 5DBBA 2QARB 5CRXA 3TACB 1KBUA 1TK0A 2QLTA 4PGXA 1R8CA 5KG6A 3OVBA 5AKEA 4Z6CA 4BGDA 3GILA 4E7XA 4LEVA 1S0NA 4CCHA 3N4MB 1A6SA 3OSPA 3WFOA 3PO5A 2ZHBA 4PHDA 1UT8A 4XA5A 2P6RA 2M9NA 5DGAA 2PMZF 4OJ5A 2KJ5A 3H7IA 2BCUA 4DOCA 2W3RA 1NJYA 3CP8A 2KEYA 4YVZA 1XSPA 1J2NA 4B9VA 2H5XA 1L7PA 1S77D 5ALTA 3KZXA 1V38A 2DR5A 1SWVA 2EZZA 4EYHB 2PI4A 4C8LA 2PBEA 3C21A 2B51A 3BQ1A 3JPSA 4EP7A 4DSKA 4Y2SA 3PMLA 4U6PA 4I2DA 4RT2A 3PR4A 1KKXA 5DB8A 4UATA 4WC0A 1ED1A 8ICXA 4OJ6A 3IRUA 3WFRE 4DL7A 2A1JA 1X9MA 3ZDCA 1QSYA 3AQFA 4KMOB 2F8KA 8ICFA 3AL0B 2LMRA 5J2FA 4Y2RA 3U26A 1QH9A 1NJXA 4M9HA 8ICYA 2HW3A 1ZQPA 3T5KA 2KFZA 4IQWA 2FLPA 5KFSA 4RUCA 4WJ3B 4B6JA 4EX6A 1ZQQA 2HBMA 3V6JA 2ES6A 1ZQAA 5ALNA 9ICRA 1RDFA 2V4QA 5B66U 4A8EA 2KHQA 1JXLA 5ALXA 3ISBA 3E2EA 4O69A 5D63A 3HP6A 4K4IA 2JH7A 9ICXA 4K4HA 1ZQSA 3WFSC 3T5JA 2ID1A 3G6XA 4GFJA 5J2EA 1SV0C 5AKZA 3TFRA 1KTQA 2B56A 4FHVA 3NUQA 2CXYA 3RH4A 4J9QA 4Q8EA 3LDAA 4RPXA 2WAQC 4TUSA 4WBYA 1QQ5A 1KDHA 3PX6A 3WU2U 2GAFD 2XY5A 3I1YA 2KZMA 4IQVA 5F9LA 1ZQRA 4FS2A 3V72A 4FO1A 1TE2A 3WKEA 2KN7A 4ZH4A 2W55A 4Y2PA 1C20A 9ICFA 4NXXA 4FFDA 4BX9C 3UPQA 4CRXA 3M8RA 2IHOA 4JMUA 1XU4A 5AK5A 1IV8A 1PVRA 1BPEA 4ED0A 2FPMA 5J2BA 2F1JA 4LZDA 2JEJA 3HJEA 1IXRA 2DGZA 2HVHA 4DQQA 4NLGA 3QUBA 4KLFA 5AI5A 4KLGA 3EPGA 3F5EA 1MSWD 2KK0A 2XY6A 4RZRA 5CHEA 5ALFA 2KIWA 2XCAA 4YQWA 2HHVA 3HJ1A 1CUKA 4Y2UA 5D46A 5J0PA 4UAUA 4ECTA 2IHNA 5HHHA 1U45A 2ZUDA 4OCZA 2ASJA 9ICIA 1NK5A 2WF9A 2K89A 4O3RA 3QU5A 4AT7A 2HOQA 2W43A 4DQIA 3UMBA 1SWWA 3NKUA 1FA0A 2I1QA 1LVHA 4DSEA 4QWBA 2IMWP 4EYIB 3TAPA 2W3SA 1MA7A 1VFGA 9ICNA 4Y2XA 3RB3A 2J6TA 4PHAA 4R8UB 2RHFA 3C1YA 4F91B 2R8HA 3V7JA 8ICZA 2BE3A 2XVTA 5D49A 2RQ5A 4QJFB 4WC3A 4ED7A 2AHOB 2KVCA 2YMMA 4UQGA 2DPIA 4WQKA 2C2DA 4FZLA 5KFUA 2KNJA 1VJ5A 3RJFA 4DL3A 1L7OA 4X4QA 3N7RC 4NXTA 1NJWA 1RXVA 4X4TA 5KFMA 1JN3A 1TAUA 4KITB 3BS5B 3PSPA 5HREA 4MFFA 2FE9A 2JEGA 5F3XB 5J2KA 4WC5A 4OD0A 4DS4A 4X4OA 9ICJA 3UPSA 4CDGA 1QQ6A 3OJUA 2W9BB 5KFKA 1ECWA 4P4MA 3E0FA 8ICRA 4F3OA 1ZQUA 4LVSA 4IRCA 4JB3A 1JI7A 3RJHA 2NRXA 3UXOA 2XGQA 4QZEA 1TAQA 2I9GA 2J6SA 5DEDA 4DFKA 3V7LA 4ELTA 2J6UA 1D9FA 2C28A 3RB6A 2EH9A 5FP0A 2W9CB 4IL6U 3N97B 1NK0A 2CN1A 5B5EU 2AQ0A 2GWSA 3QZ7A 1Z00A 2H3IA 4IRDA 2ZUBA 2R8JA 3ZI4A 2QB1A 3VCBA 5KAIU 1XSLA 3TQ1A 5HMLA 1L7MA 1Z1VA 5AI9A 3MCRA 3Q8KA 2F2AB 4J9LA 2V4RA 5L1LA 3AQMA 3SEIA 4X4NA 3F2BA 4QZHA 3RAQA 4DSIA 4F5NA 2ZJAA 3V7KA 8ICAA 4O67A 4WC2A 1YT3A 4DLGA 2OH2A 5J0TA 2MUTB 4QZDA 1KQQA 3PX0A 3WKAA 4IQUA 4DQRA 1UEUA 2AGQA 2HHWA 1HJPA 3CYMA 3HT3A 4F5QA 2E8OA 1KEJA 3LYSA 4RQMA 3A0BU 1Z4NA 2EAPA 2UVRA 4CGZA 4M6WA 4B9NA 2ZXHA 5DECA 2ZIUB 3SAHA 2ZH1A 4O9MA 4EBEA 5KFVA 1ZQFA 7ICSA 1MIWA 1WG8A 1PK1B 4QW8A 3RBEA 4YMMA 1FEZA 2JRZA 2KP7A 1ZYQA 1L3SA 2KKPA 5IIOA 2OM6A 4WQLA 5AIAA 4O3QA 3ISCA 9ICKA 1PVPA 4P0PB 3AQNA 2IHMA 4FE3A 3JPPA 4WH5A 9ICBA 3WK7A 5CR0A 5KFJA 4J9PA 4IR1A 2MAXA 5JTGA 1UQVA 5ALGA 5ALKA 1NKBA 1NZPA 2FJ6A 3RJIA 4WBZA 5DKWA 1Q79A 1OXJA 2HSZA 5K4LA 4GC6A 1RQNA 2LYHA 4P0QB 2EDUA 1ZQZA 1RM6C 4GIBA 4UAWA 1QQ7A 3QYPA 5CWRA 1RXWA 2ATLA 3K75D 2FMPA 2BQUA 4I2AA 1CI4A 2KE7A 4IR9A 3UQ2A 2ZIWB 4QIWC 4ED3A 2A1AA 2JEIA 5BOLA 4RQ6A 2UVUA 1JMSA 9ICOA 2G5IB 1SKRA 1DRGA 2LM4A 3PSFA 3LVWA 5KFIA 8ICKA 2FI1A 3PHZA 3HKZC 2VJ5A 2DWQA 4P4PA 7ICGA 2W8KA 4RQ3A 1S5LU 4RNMA 4O3SA 4QZAA 2F76X 4KB6A 4M9GA 4DL6A 3TARA 1VLBA 2XY7A 5KFOA 5AKLA 3MC1A 1Z1BA 1L6NA 4B9LA 1U48A 3WK4A 4JV1A 1WOTA 5J2AA 2D3DA 3RJKA 2P6UA 3ZD9A 4ECYA 4F8RA 3NVWA 4EBKA 2MRLA 4F93B 2RFFA 8ICOA 2WB1C 4YFKA 4AT9B 5G5GA 2Q4TA 4ELVA 8ICCA 4QZBA 4JV2A 4C8KA 1T4GA 4ECRA 4MFCA 2K8BB 4NV0A 5KFGA 3ISDA 3OVSA 4AT8B 1RYSA 1RQLA 7ICEA 4Z6EA 3NASA 2K4PA 3PVXA 1WYGA 1ZQVA 8ICUA 1UA0A 4YN4A 4O3OA 3IN5A 1V9PA 1WWVA 4QZ9A 3NGDA 3BQTA 3OUYA 7ICHA 3LK9A 3KKAA 4DFPA 2PFOA 2EZXA 1X42A 1WCNA 3GV5B 3B0YA 1NO5A 4Y2TA 1GPJA 2KMDA 1A76A 5DG8A 5DB7A 3OGUA 4M5DA 5IIKA 4DWIA 4RWNA 3L3FX 9ICUA 4EBCA 3JCFA 4EX7A 4I2JA 2ZIXB 1N62A 1ZQIA 2B0CA 1BPXA 1X9XA 3PW7A 8ICPA 4UBCA 3EYZA 4P4OA 2BGWA 4YR2A 2FMSA 1JUDA 1EXNA 4CF3A 4UAYA 3RBDA 3H8MA 4LJXA 1ZQ1C 4YR0A 4WC4A 2R8IA 2BHNA 4J9RA 2NRVA 3AEVA 1A0PA 5CB1A 2W9MA 3MGHA 2ZJ5A 5AI0A 4WC7A 4J9OA 2BCRA 1RYUA 3GIIA 2JZBA 3F5AA 3FDSA 3MGIA 4FHPA 3UXNA 2DR9A 4ECZA 2B21A 2H3QA 2I6XA 1H38A 5HRFA 4F4XA 4AP9A 1MQ2A 3WKCA 1UETA 4J9NA 4DOAA 4YMNA 4Y2JA 5EWFA 2AXTU 3GIKA 4RWOA 4K98A 2DRBA 5KFPA 2ZH8A 4R63A 4DFMA 2WFAA 4DF8A 3H0LB 3BQ2A 3QU9A 3PX4A 4I2IA 4ED6A 2HDOA 8ICGA 2FLLA 3H39A 2F1IA 3H8WA 4M0AA 1NKEA 5KFQA 4NLNA 1S0OA 2VA2A 4XQ8A 1ZD2P 3MDAA 5G5HA 1S76D 4ED8A 3EWAA 4F72A 5EE9A 3KBBA 2FCLA 1FIQA 3H4BA 2KKVA 4R8UA 1N5WA 2L5YA 3Q8LA 2M2UA 3UMCA 2ZIVB 5J0WA 5DDYA 5AK6A 2KICA 1ZQHA 1ZOLA 2DR8A 5J2GA 1N48A 3J81j 3MR3A 3TANA 9ICLA 5L1KA 3OV7A 2G0AA 2KTQA 1SV4A 3G6VA 2OEHA 1ZJNA 2C2EA 3PW4A 4GXJA 1YZ6A 4X4UA 3MR5A 5BPCA 4M04A 2BDPA 4BWJA 5EE3A 3H37A 1N61A 3H4DA 3NTUA 3ER8C 3C28A 1JALA 1MN8A 4X4RA 1ZJMA 3DV9A 4C8OA 2YX8A 5JU5A 5J0QA 2W9BA 4G3IA 4IG8A 3LWMA 1L7NA 2LBOA 5T14A 4I28A 3F2DA 4O3MA 4LEZA 2Q66A 5HRIA 3ETRA 5EE1A 3AQEA 4R66A 2N1RA 1BPDA 2VIXA 4BDPA 1HUZA 3OHBA 3GQCA 5CFUA 2HBJA 5KNIA 3H0RB 1UEVA 3SV4A 4WOYA 3O0FA 2W9CA 3PSIA 2AJQA 4GC7A 1ZQXA 2F77X 4KLJA 2H3ZA 3C2KA 1Q46A 5AKYA 5J2JA 1LB2B 9ICQA 4DSJA 2W11A 3QE9Y 5CJ7A 4RT3A 3QX7A 2BQ3A 7ICTA 4YMOA 2HHUA 2ZH5A 4NLBA 3ALRA 1J97A 1TFWA 1S0VA 2VJ4A 9ICHA 2JV3A 1B4FA 5TISU 3NYBA 4X0BA 4FH5A 4UBBA 3WK9A 5AM3A 2C22A 5HHIA 1WCLA 4QNLA 1R8BA 1JIHA 2HI0A 2LM1A 1HUOA 7ICJA 3HWTA 2MUTA 4GXIA 1MQ3A 4I2EA 4KLUA 3WK6A 5D62A 4KLQA 1DGSA 3HIYA 1Q8KA 8ICJA 3GFKB 4E0DA 2NYVA 3C1ZA 4OJPA 3H0MB 3M7DA 4KM5A 5ALWA 3H40A 2EANA 5B3PA 1JX4A 1AROP 2ZIUA 5GTIU 1B43A 4FZNA 5A0LA 2YMLA 4JK1A 3GDXA 3L4PA 1PK1A 2HN2A 5H2FU 2AQ4A 3CRXA 3IP4B 2I5HA 4BUGA 5KG5A 2YMQA 4FHWA 1ZQYA 4EEKA 4EBJA 1XWLA 1DOQA 1QSLA 4P0PA 3SENA 1Z4OA 2BBJA 5KG0A 4XQ7A 1DK2A 5D61A 4KLEA 4QWAA 2ISPA 4M2YA 3KD3A 7ICUA 2AH5A 4M47A 3PZPA 4AYBC 4K96A 2O6KA 4N7RA 1PX5A 3SMVA 4ZOHC 1V4AA 4UW9A 4K8VA 3NVYA 1QLNA 2JHDA 3RH6A 4QZ8A 2ZH7A 3RFAA 2Y1JA 8ICNA 4HAIA 5KG7A 4PL1A 1N56A 3T5HA 4FO6A 1ZQJA 5HR7A 1BGXT 4C8NA 1SXDA 3Q8SB 5KFXA 8ICWA 1D8BA 2WAQF 2Y1IA 2ZIWA 5E79U 3PO4A 3CNHA 4YD1A 4EENA 3EW9A 2IOFK 3Q8MA 2E8NA 4IC9A 2ZH9A 4DSLA 2GH1A 3WK5A 1BNPA 4KMUA 4CNQA 3C18A 3D2SA 4KLDA 2O1PA 3AM9A 3KHRA 1FFUA 2JGAA 3GV7B 1LV5A 3AQLA 4LEYA 3L5KA 2PI5A 1TK8A 3RR8A 3ZDEA 2W7OA 5KG2A 3MBYA 4C7YA 4PHPA 5KFFA 4WC1A 1D8YA 1D8LA 4C4RA 4I2BA 2FMQA 4KLTA 4E8FA 4NL9C 5J8YA 2A1JB 1BVSA 4F4YA 1RZTA 3NRZA 2EWRA 5CP2A 1X6JA 4UASA 5ALHA 4YXJA 3PNCA 3QU2A 1T94A 1KLNA 3PV8A 1SKSA 5KG4A 2F8LA 5L1JA 2H3FA 1XO0A 1AQ6A 5AM5A 4TUQA 7ICNA 4QZGA 3ORYA 4HX0A 4JLXA 4AT8A 4S3NA 4O5CA 4ECUA 2HMXA 2DPJA 4PHEA 1KSPA 3BJYA 1WUDA 1L3VA 1XO1A 1Q78A 4RNNA 2Y9UA 3GIJA 4DCCA 2DQNB 3BZCA 4Q43A 2E3TA 2K4EA 3DEEA 4RNOA 3TKAA 1UHUA 1TKDA 9ICWA 5J2CA 4EEDA 2B6GA 3QEBZ 1A77A 2F44A 3RB0A 4TUPA 4MHVA 1NK9A 4QW9A 4DFJA 3C66A 1M6YA 2ZIXA 2IUBA 2EQYA 5HRGA 4GLXA 4B9MA 1N5XA 1SB3C 4O6AA 2C2RA 1T3NA 3OHAA 1LKYB 2E8PA 2BPGA 4PPXA 1S97A 3BS7A 2R18A 4RWQA 4UB1A 4FZMA 2HVIA 4JLZA 5KFRA 3BDPA 4ECQA 1F44A 2V9WA 5ALIA 4G9BA 2JXJA 2YMPA 5AK4A 3QUTA 1RYRA 4UB2A 1PUZA 4KTQA 4RQ7A 5DB6A 5CA7A 1COKA 2PKEA 4EV6A 4YR3A 3OJSA 4FHXA 2QARA 3NVZA 4NWIA 5DG9A 2OWOA 1FFVA 5HRBA 1IM4A 4J9KA 3RR7A 3R9KA 4AT7B 1R89A 2HN1A 2BCVA 3K1RB 4C8MA 1N60A 1KFSA 5CFTA 3BQ7A 1ZQOA 2ASDA 2NRTA 2YY6A 3AU6A 3LWLA 4JWNA 4XRHA 1FO4A 2G08A 2ZJ8A 4RPZA 4RWPA 3IV6A 4NKTA 4UAZA 1J2MA 2G07A 8ICQA 4C0ZA 2MA1A 2XC9A 1F5SA 4O5EA 2FDRA 1KNYA 2K4HA 2ZIVA 4YG2A 7ICMA 3M6ZA 1ZQWA 4ECWA 1DGJA 2KHVA 4CF5A 5ALEA 1RG6A 1XS9D 2ZXIA 5C5JA 1ZQTA 5KG3A 5AIBA 3TADA 1D9DA 5EE0A 3LQCB 1GO3F 5CFSA 2KD1A 3QUCA 3B9JA 2DR7A 3WK8A 3AU2A 4OO1J 3KHHA 9ICAA 4X0AA 3JPQA 3RJGA 1NK6A 5HC9A 3JYYA 2DVIA 5DQIA 7ICIA 5F9NA 3OVAA 2ZTEA 1YLQA 3LVVA 2ZHAA 1KL9A 2B4VA 1SKWA 4CE6A 5KT4A 4RQ1A 1L8LA 1TFRA 1Z00B 2Z7JA 3QEAZ 4O68A 2E8MA 5KFBA 4NM2A 3EF2A 2DBYA 4IS7A 5EWEA 5ALMA 4F71A 2UVVA 1HEKA 2OYYA 7ICQA 2ZH4A 2YTUA 1TV9A 2E1EA 4I2CA 4ATBB 4LZGA 3OWGA 1UA1A 2ODGA 4GXKA 4QZCA 3M6KA 4QIWF 2W9AA 3SR6A 4FHYA 4M9LA 3MFHA 3T3FA 3SAGA 4RU9A 2M2WA 2H3VA 5D4BA 3GV8B 2GA9D 4F4ZA 1X9SA 2E5SA 1XC9A 2PMZC 4I2HA 5AKIA 3NVVA 2XIDA 2R8GA 3HKZF 1SZPA 4LT6A 4NJ8A 4F5RA 4Y2QA 3PR5B 2DKXA 1BPZA 3HJ4A 5DQGA 5C0YA 9ICCA 1U4BA 2ESEA 3GIMA 4QZIA 1COOA 2HHTA 3ZD8A 4EZ9A 2WF7A 3SV3A 1JROA 3PMNA 2YQEA 3KKAC 5IILA 8ICTA 4RQ0A 4XUSA 2RP5A 1K1QA 5ALLA 3UXPA 2WB1F 2RRDA 4TQRA 1KFDA 3EZ5A 4DQPA 5ALSA 1RPLA 3A0HU 4KN7A 1L3TA 4P2HA 4IRKA 4RQ4A 2DRAA 3FC4A 2D6FC 4US8A 5KAFU 5EOZA 8ICMA 2EAOA 3IG5A 2LYBA 2VKQA 4ACOA 2WF5A 1NZBA 2E1FA 3M8SA 4RUAA 2F1HA 1B0XA 3ED5A 1Q3VA 3OSNA 5KFTA
chains in the Genus database with same CATH topology
4J9SA 1XSLA 1U9LA 3GFKB 8ICJA 4E0DA 7ICRA 3C1ZA 3TQ1A 5HMLA 1TVAA 4F4KA 5DBAA 2XO7A 4B9TA 3Q8KA 3QZ8A 5KG1A 3JPOA 3H40A 4J9LA 5L9XA 1JX4A 1AROP 2V4RA 4KLSA 3UQ0A 3SI8A 4WCWA 3WFSC 1B43A 7ICOA 5L1LA 3PY8A 1CEZA 3AQMA 2Q0ZX 4JK1A 4BXOB 3GDXA 5L1IA 4X4NA 4YXMA 4MF2A 4AT9A 4QZHA 5KFEA 3RAQA 2AQ4A 5EWGA 1T7PA 4DSIA 2ALZA 4F5NA 1BNOA 4Z6DA 2ZJAA 5KG5A 3V7KA 4EBDA 4K4GA 8ICAA 3SYZA 4UD5A 3JPTA 3G6YA 1ZQYA 4FHWA 5DGBA 4UB4A 4WC2A 1T8EA 1ZQDA 1XWLA 4PH5A 4ELUA 4EBJA 4DLGA 9ICVA 1DOQA 3M9MB 5IIMA 7ICKA 4M9NA 5J0TA 4ECSA 5J0SA 2MUTB 5DBCA 4QZDA 4RQ8A 1QSLA 5HRKA 3PX0A 4F5PA 3H38A 4IQUA 4DQRA 5KG0A 4XQ7A 1DK2A 1UEUA 4PGYA 2AGQA 4KLEA 4O3PA 3THVA 4QWAA 2HHWA 1R8AA 1HJPA 3HT3A 2ISPA 4M2YA 4F5QA 1NK7A 5DG7A 5J0UA 1KEJA 1Z3EB 7ICUA 2XCPA 4M47A 2UVRA 3KHGA 4M6WA 5HRHA 3MR2A 5JUMA 1DK3A 1PX5A 1V4AA 3Q8RB 4YCXA 3SZ2A 4B9NA 5IINA 2ASLA 1QLNA 5DECA 3RH6A 4KLLA 2ZH1A 4QZ8A 4O9MA 4EBEA 5KFVA 4UB5A 1ZQFA 1Y88A 7ICSA 1MIWA 2ZH7A 2Y1JA 2NRKA 3ETLA 5TZVA 4QW8A 4FBUA 3V6KA 8ICNA 1NKCA 5KG7A 3RBEA 4YMMA 1S9FA 1MIYA 4DF4A 2BR0A 1JXEA 1ZYQA 1N56A 3T5HA 4DOBA 4FO6A 1L3SA 1ZQJA 1BGXT 2KP7A 4C8NA 5IIOA 1X9WA 1ZQKA 3Q8SB 5KFXA 4O3QA 5HMMA 3ISCA 8ICWA 9ICKA 4I2FA 3HPOA 3T5LA 4QWDA 3M9NB 5IIIA 4DL4A 2Y1IA 3AQNA 1MIVA 2IHMA 3PO4A 4X4UA 4YD1A 2KZ3A 3JPPA 2PFNA 9ICBA 3EW9A 2BQRA 4FBTA 3Q8MA 5CR0A 3HW8A 5KFHA 2BCSA 4DSLA 4B9UA 5J2IA 5KFJA 2ZH9A 8ICYA 3TI0A 4J9PA 2PFPA 4IR1A 2MAXA 4M6WB 2HHQA 2ZH2A 3RRHA 5F2VO 5HNKA 1BNPA 4KMUA 1NKBA 1OU5A 4ED2A 1NZPA 3C18A 3M9OB 4KLDA 4JUZA 1TK5A 2PXIA 8ICEA 3RJIA 4WBZA 2O1PA 4NM1A 5DKWA 2RDJA 4X4VA 1Q79A 3KHRA 4TURA 4J9MA 1U47A 3MR6A 4GC6A 2AGPA 3GV7B 2LYHA 1LV5A 1ZQZA 4F50A 1KFTA 4MF8A 3AQLA 2VA3A 5KFWA 3H8SA 2PI5A 5J0OA 1TK8A 4F2RA 3RR8A 4UAWA 5HRLA 3ZDEA 4EZ6A 1NK4A 3OUYB 3B0XA 3RAXA 5CWRA 3IM1A 5KG2A 3MBYA 1RXWA 2ATLA 3JPRA 3K75D 4PHPA 5KFFA 2FMPA 2BQUA 4I2AA 1D8YA 5HRDA 4WC1A 4NLZA 2M2TA 4IQTA 1D8LA 4B9SA 4IR9A 3UQ2A 4I2BA 4DS5A 2FMQA 4ED3A 4KLTA 2BCQA 4E8FA 1L3UA 7ICFA 2A1JB 9ICEA 2JEIA 5BOLA 1BVSA 4RQ6A 4F4YA 2UVUA 1JMSA 1RZTA 9ICOA 1SL0A 4ECXA 3RJJA 1SKRA 5CP2A 5KFLA 4ED1A 4YXJA 3PNCA 5KFIA 4I29A 9ICMA 8ICHA 3RTVA 5KTQA 3C23A 1KLNA 8ICKA 1B22A 1KRPA 3PV8A 2KFNA 3KHLA 1SKSA 5KG4A 5L1JA 4I2GA 2ZTDA 4F4WA 4R65A 4P4PA 4DL2A 2UVWA 1K1SA 4RQ3A 5J0RA 2W8KA 4F2SA 7ICGA 4RNMA 4O3SA 2WTFA 4QZAA 2BKEA 4TUQA 7ICNA 3ZDBA 5J2HA 3Q8PB 4QZGA 4KLOA 3ORYA 4KN4A 4M9GA 3H3AA 5DBBA 4DL6A 5J0YA 4AT8A 4S3NA 3TARA 4QZFA 2XY7A 1TK0A 2ZUCA 5KFOA 4O5CA 4ECUA 4PGXA 2DPJA 1R8CA 5KG6A 4PHEA 3OVBA 1KSPA 3BJYA 4B9LA 4Z6CA 4BGDA 3GILA 1U48A 4RQ2A 1L3VA 1ZQEA 4E7XA 1XO1A 4JV1A 1Q78A 1WOTA 5J2AA 4RNNA 3GIJA 3RJKA 2P6UA 9ICSA 3ZD9A 4ECYA 4F8RA 5DDMA 8ICBA 4Q43A 1S0NA 4RNOA 4CCHA 2NRWA 3N4MB 4EBKA 2ZH6A 8ICIA 4F93B 2RFFA 3OSPA 3WFOA 4DL5A 8ICOA 3C5FA 4YFKA 1TKDA 2JZBB 3PO5A 9ICWA 4AT9B 4PHDA 2ZHBA 4I27A 5J2CA 1UT8A 4XA5A 2P6RA 2M9NA 3Q8QB 5DGAA 3JPNA 3QEBZ 3H7IA 4ELVA 1A77A 4MEXA 8ICCA 3WFQE 4QZBA 2BCUA 2RDIA 4DOCA 3RB0A 4JV2A 4TUPA 1NK8A 5KFCA 4C8KA 1NJYA 4QW9A 1NK9A 4O3NA 1T4GA 2FPKA 4ECRA 4DFJA 3KTQA 1JQRA 4MFCA 3C66A 4YVZA 2BPCA 5J2DA 1XSPA 4B9VA 2H5XA 5KFGA 3ISDA 1S77D 4GLXA 4B9MA 5HRGA 3OVSA 4Q45A 1XSNA 2AU0A 2HHSA 3AUOA 2DR5A 4AT8B 3H8JA 2C2RA 1T3NA 4EYHB 1RYSA 2PI4A 4C8LA 7ICEA 3TAQA 3C21A 2PBEA 2BPFA 1VJ7A 4Z6EA 1S0MA 4Z6FA 3OHAA 3BQ1A 3PVXA 3JPSA 4EP7A 2BPGA 1ZQVA 4PPXA 4DSKA 1UA0A 8ICUA 2ZH3A 1ZQMA 3PW5A 1S97A 2HHPA 4YN4A 1NOMA 4O3OA 3JZ0A 1V9PA 3PMLA 4DLEA 4QZ9A 3NGDA 4RWQA 4UB1A 3BQTA 4I2DA 4RT2A 3PR4A 2HVIA 3OUYA 7ICHA 3LK9A 5DB8A 4Q44A 4UB3A 4DFPA 5KFRA 2PFOA 3BDPA 5KT5A 4WC0A 1WCNA 3GV5B 8ICXA 5HP4A 3B0YA 4ECQA 1NO5A 2V9WA 3WFRE 4DL7A 2A1JA 1A76A 5DG8A 1X9MA 5DB7A 3OGUA 3C2MA 4M5DA 3ZDCA 5IIKA 1QSYA 4DWIA 4RWNA 9ICUA 4EBCA 1RYRA 8ICFA 4I2JA 1F5AA 2VANA 4UB2A 7ICVA 1X2IA 3WFPA 5J2FA 1ZQCA 4KTQA 4R64A 4RQ7A 1NJXA 1ZQIA 4QWCA 5DB6A 4RQ5A 1BPXA 2ISOA 4M9HA 5CA7A 1ZQGA 1ZQPA 2HW3A 3T5KA 5KT6A 4X4SA 2KFZA 3PW7A 8ICPA 4IQWA 1SL2A 4UBCA 3EYZA 4P4OA 2BGWA 4YR2A 2FMSA 4TQSA 2FLPA 5KFSA 4F92B 4RUCA 5HRFA 1EXNA 2HHXA 4YR3A 2AGOA 3OJSA 4FHXA 4JWMA 4DEZA 4UAYA 4E80A 5DG9A 2OWOA 3RBDA 1ZQQA 5HRBA 3V6JA 1IM4A 4J9KA 1ZQAA 3RR7A 3RB4A 4AT7B 9ICGA 1R89A 9ICRA 3RH5A 2BCVA 3IHQB 4YR0A 2V4QA 4WC4A 3HX0A 4C8MA 4ECVA 2R8IA 3C2LA 2BHNA 1JXLA 1KFSA 4O5KA 2ZTCA 2O5AA 5DB9A 3ISBA 4J9RA 3E2EA 2NRVA 5DLFA 3HP6A 1ZQOA 5CB1A 3PW2A 2ASDA 2NRTA 4K4IA 2W9MA 3MGHA 8ICSA 3AU6A 3LWLA 5KFZA 2ZJ5A 1ZQSA 4JWNA 3T5JA 4XRHA 4K4HA 2ID1A 4J9OA 3G6XA 4WC7A 2BCRA 2ZJ8A 5J2EA 3TFRA 1KTQA 2JZBA 3FDSA 3MGIA 3GIIA 4FHVA 4FHPA 3UXNA 4RPZA 4ECZA 2B21A 2NRZA 4UAZA 4NKTA 2DFLA 3RH4A 4RWPA 4J9QA 8ICQA 1H38A 2XGPA 4F4XA 2XC9A 1MQ2A 1ZQLA 4Q8EA 3LDAA 5DLGA 4O5EA 4JV0A 1UETA 4RPXA 4J9NA 4TUSA 4DOAA 4YMNA 1KNYA 4WBYA 1KDHA 2IA6A 5EWFA 3PX6A 4YG2A 7ICMA 3GIKA 2XY5A 1ZQWA 4DQSA 4RWOA 2DRBA 4ECWA 2KZMA 4IQVA 5KFPA 2ZH8A 4R63A 5F9LA 4DFMA 4DF8A 1ZQRA 4FS2A 3V72A 4MEYA 1XS9D 2KN7A 3BQ2A 4BWMA 4ZH4A 5C5JA 4I2IA 5KG3A 4ED6A 4HYKA 3PX4A 1ZETA 1ZQTA 4M9JA 3AQKA 2VA8A 9ICPA 1D9DA 9ICFA 2P66A 8ICGA 3LQCB 3UPQA 3M8RA 2FLLA 2F1IA 3H8WA 3H39A 4M0AA 1NKEA 1XU4A 5KFQA 1BPYA 5J29A 4NLNA 1S0OA 4EEYA 2DR7A 4X4PA 2VA2A 3AU2A 1NJZA 1BPEA 4ED0A 4XQ8A 3MDAA 1S76D 3K4GA 4ED8A 2KZZA 3EWAA 3KHHA 9ICAA 2FPMA 4X0AA 5J2BA 2F1JA 4LZDA 4ATBA 2JEJA 3JPQA 3H4BA 4NY8A 3RJGA 4UD4A 1NK6A 1IXRA 4R8UA 5HC9A 2HVHA 4DQQA 4NLGA 3JYYA 4KLGA 4KLFA 3Q8LA 3EPGA 5KFNA 2M2UA 1L5UA 5IIJA 2DVIA 5DQIA 1C7YA 5J0WA 7ICIA 2DR9A 5F9NA 5DDYA 1MSWD 3OVAA 2XY6A 1BPBA 4YD2A 4RZRA 2ZTEA 1YLQA 2XCAA 4YQWA 2ZHAA 8ICLA 1ZQHA 1SKWA 1U49A 4WC6A 5KT4A 4F5OA 2DR8A 4NXZA 3RRGA 5J2GA 1N48A 2HHVA 3MR3A 3TANA 4MFAA 3HJ1A 1CUKA 3L9DA 5BOMA 5D46A 1ZQNA 5L1KA 5J0PA 7ICPA 9ICLA 2KTQA 3OV7A 4RQ1A 3G6VA 1ZJNA 2C2EA 3PW4A 1TFRA 1Z00B 4GXJA 4ECTA 3MR5A 4DSFA 3TFSA 3QEAZ 2IHNA 5HHHA 5KFBA 5BPCA 4NM2A 1U45A 2ZUDA 2BDPA 1UT5A 2ASJA 4M04A 4BWJA 9ICIA 1NK5A 5EWEA 3H37A 2FLNA 3H4DA 4O3RA 4AT7A 3NTUA 5CHGA 2JEFA 2UVVA 4DQIA 3MFIA 3PW0A 3MDCA 2W8LA 1FA0A 7ICLA 2I1QA 4DSEA 7ICQA 4QWBA 4X4RA 1ZJMA 1TV9A 2IMWP 2M2VA 2ZH4A 4EYIB 3TAPA 4C8OA 5KFDA 1VFGA 4I2CA 4ATBB 5J0QA 1ZQBA 9ICNA 2W9BA 4LZGA 3RB3A 2J6TA 2R8KA 4G3IA 4X5VA 1UA1A 4IG8A 5J0XA 4PHAA 3C5GA 4R8UB 3C1YA 4GXKA 4QZCA 4F91B 4QWEA 3LWMA 1PZNA 2R8HA 2W9AA 4Q8FA 4FHYA 4M9LA 4FS1A 3MFHA 3V7JA 4I28A 3T3FA 8ICZA 2BE3A 4RU9A 5D49A 2M2WA 4DO9A 3ZDDA 2IBKA 4WC3A 4ED7A 2Q66A 2DPIA 4UQGA 5D4BA 5HRIA 2C2DA 4R66A 3GV8B 1JAJA 1BPDA 4F4ZA 4BDPA 3FYHA 5KFUA 3OHBA 1XC9A 1X9SA 1HUZA 3GQCA 4I2HA 9ICTA 3RJFA 5DQHA 5KFAA 4DL3A 2R8GA 4LT6A 1SZPA 4YP3A 4FH3A 1UEVA 4X4QA 3SV4A 5KT7A 4F5RA 1NJWA 2W9CA 1RXVA 4X4TA 2AJQA 5KFMA 1JN3A 3PR5B 4GC7A 8ICVA 1BPZA 1ZQXA 1TAUA 4KITB 3V6HA 3EPIA 4KLJA 3HJ4A 5DQGA 5HREA 4MFFA 4KLIA 2JEGA 5J2KA 3C2KA 9ICCA 1U4BA 4WC5A 3GIMA 4QZIA 1COOA 9ICXA 5J2JA 1LB2B 4DS4A 4X4OA 2HHTA 9ICQA 3ZD8A 1S10A 4DSJA 9ICJA 3QE9Y 4EZ9A 5CJ7A 3UPSA 3ZDAA 4RT3A 3SV3A 2BQ3A 3OJUA 3PMNA 2W9BB 2PFQA 7ICTA 5HR9A 5KFKA 4YMOA 4P4MA 8ICTA 5IILA 4RQ0A 3MABA 4XUSA 8ICRA 2HHUA 1QTMA 4F3OA 1ZQUA 2ZH5A 1K1QA 4LVSA 3BQ0A 3UXPA 1TFWA 4IRCA 4TQRA 3RJHA 2FPLA 2NRXA 5KFYA 3UXOA 1KFDA 2XGQA 1QSSA 4QZEA 3EZ5A 1S0VA 4DQPA 4BXOA 9ICHA 1RPLA 1TAQA 2I9GA 2J6SA 4NLKA 5DEDA 4DFKA 3V7LA 4KN7A 4ELTA 3NYBA 1L3TA 4X0BA 4FH5A 4UBBA 4P2HA 4RPYA 1D9FA 2J6UA 4IRKA 4KLMA 2C22A 5HHIA 1MC8A 2C28A 4RQ4A 5KT3A 2DRAA 3RB6A 1WCLA 5EOZA 2W9CB 4O0IA 3N97B 1NK0A 1R8BA 1TFYA 1JIHA 8ICMA 1HUOA 7ICJA 3HWTA 2MUTA 4GXIA 2AQ0A 3RJEA 2GWSA 1MQ3A 4NKUA 3QZ7A 3M8SA 1Z00A 4RUAA 4IRDA 2ZUBA 2F1HA 2R8JA 4I2EA 4KLUA 4KLQA 1DGSA 4PGQA 3OSNA 1SL1A 4KLHA 3HIYA 5KFTA 5KT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9S A;  1XSL A;  1U9L A;  3GFK B;  8ICJ A;  4E0D A;  7ICR A;  3C1Z A;  3TQ1 A;  5HML A;  1TVA A;  4F4K A;  5DBA A;  2XO7 A;  4B9T A;  3Q8K A;  3QZ8 A;  5KG1 A;  3JPO A;  3H40 A;  4J9L A;  5L9X A;  1JX4 A;  1ARO P;  2V4R A;  4KLS A;  3UQ0 A;  3SI8 A;  4WCW A;  3WFS C;  1B43 A;  7ICO A;  5L1L A;  3PY8 A;  1CEZ A;  3AQM A;  2Q0Z X;  4JK1 A;  4BXO B;  3GDX A;  5L1I A;  4X4N A;  4YXM A;  4MF2 A;  4AT9 A;  4QZH A;  5KFE A;  3RAQ A;  2AQ4 A;  5EWG A;  1T7P A;  4DSI A;  2ALZ A;  4F5N A;  1BNO A;  4Z6D A;  2ZJA A;  5KG5 A;  3V7K A;  4EBD A;  4K4G A;  8ICA A;  3SYZ A;  4UD5 A;  3JPT A;  3G6Y A;  1ZQY A;  4FHW A;  5DGB A;  4UB4 A;  4WC2 A;  1T8E A;  1ZQD A;  1XWL A;  4PH5 A;  4ELU A;  4EBJ A;  4DLG A;  9ICV A;  1DOQ A;  3M9M B;  5IIM A;  7ICK A;  4M9N A;  5J0T A;  4ECS A;  5J0S A;  2MUT B;  5DBC A;  4QZD A;  4RQ8 A;  1QSL A;  5HRK A;  3PX0 A;  4F5P A;  3H38 A;  4IQU A;  4DQR A;  5KG0 A;  4XQ7 A;  1DK2 A;  1UEU A;  4PGY A;  2AGQ A;  4KLE A;  4O3P A;  3THV A;  4QWA A;  2HHW A;  1R8A A;  1HJP A;  3HT3 A;  2ISP A;  4M2Y A;  4F5Q A;  1NK7 A;  5DG7 A;  5J0U A;  1KEJ A;  1Z3E B;  7ICU A;  2XCP A;  4M47 A;  2UVR A;  3KHG A;  4M6W A;  5HRH A;  3MR2 A;  5JUM A;  1DK3 A;  1PX5 A;  1V4A A;  3Q8R B;  4YCX A;  3SZ2 A;  4B9N A;  5IIN A;  2ASL A;  1QLN A;  5DEC A;  3RH6 A;  4KLL A;  2ZH1 A;  4QZ8 A;  4O9M A;  4EBE A;  5KFV A;  4UB5 A;  1ZQF A;  1Y88 A;  7ICS A;  1MIW A;  2ZH7 A;  2Y1J A;  2NRK A;  3ETL A;  5TZV A;  4QW8 A;  4FBU A;  3V6K A;  8ICN A;  1NKC A;  5KG7 A;  3RBE A;  4YMM A;  1S9F A;  1MIY A;  4DF4 A;  2BR0 A;  1JXE A;  1ZYQ A;  1N56 A;  3T5H A;  4DOB A;  4FO6 A;  1L3S A;  1ZQJ A;  1BGX T;  2KP7 A;  4C8N A;  5IIO A;  1X9W A;  1ZQK A;  3Q8S B;  5KFX A;  4O3Q A;  5HMM A;  3ISC A;  8ICW A;  9ICK A;  4I2F A;  3HPO A;  3T5L A;  4QWD A;  3M9N B;  5III A;  4DL4 A;  2Y1I A;  3AQN A;  1MIV A;  2IHM A;  3PO4 A;  4X4U A;  4YD1 A;  2KZ3 A;  3JPP A;  2PFN A;  9ICB A;  3EW9 A;  2BQR A;  4FBT A;  3Q8M A;  5CR0 A;  3HW8 A;  5KFH A;  2BCS A;  4DSL A;  4B9U A;  5J2I A;  5KFJ A;  2ZH9 A;  8ICY A;  3TI0 A;  4J9P A;  2PFP A;  4IR1 A;  2MAX A;  4M6W B;  2HHQ A;  2ZH2 A;  3RRH A;  5F2V O;  5HNK A;  1BNP A;  4KMU A;  1NKB A;  1OU5 A;  4ED2 A;  1NZP A;  3C18 A;  3M9O B;  4KLD A;  4JUZ A;  1TK5 A;  2PXI A;  8ICE A;  3RJI A;  4WBZ A;  2O1P A;  4NM1 A;  5DKW A;  2RDJ A;  4X4V A;  1Q79 A;  3KHR A;  4TUR A;  4J9M A;  1U47 A;  3MR6 A;  4GC6 A;  2AGP A;  3GV7 B;  2LYH A;  1LV5 A;  1ZQZ A;  4F50 A;  1KFT A;  4MF8 A;  3AQL A;  2VA3 A;  5KFW A;  3H8S A;  2PI5 A;  5J0O A;  1TK8 A;  4F2R A;  3RR8 A;  4UAW A;  5HRL A;  3ZDE A;  4EZ6 A;  1NK4 A;  3OUY B;  3B0X A;  3RAX A;  5CWR A;  3IM1 A;  5KG2 A;  3MBY A;  1RXW A;  2ATL A;  3JPR A;  3K75 D;  4PHP A;  5KFF A;  2FMP A;  2BQU A;  4I2A A;  1D8Y A;  5HRD A;  4WC1 A;  4NLZ A;  2M2T A;  4IQT A;  1D8L A;  4B9S A;  4IR9 A;  3UQ2 A;  4I2B A;  4DS5 A;  2FMQ A;  4ED3 A;  4KLT A;  2BCQ A;  4E8F A;  1L3U A;  7ICF A;  2A1J B;  9ICE A;  2JEI A;  5BOL A;  1BVS A;  4RQ6 A;  4F4Y A;  2UVU A;  1JMS A;  1RZT A;  9ICO A;  1SL0 A;  4ECX A;  3RJJ A;  1SKR A;  5CP2 A;  5KFL A;  4ED1 A;  4YXJ A;  3PNC A;  5KFI A;  4I29 A;  9ICM A;  8ICH A;  3RTV A;  5KTQ A;  3C23 A;  1KLN A;  8ICK A;  1B22 A;  1KRP A;  3PV8 A;  2KFN A;  3KHL A;  1SKS A;  5KG4 A;  5L1J A;  4I2G A;  2ZTD A;  4F4W A;  4R65 A;  4P4P A;  4DL2 A;  2UVW A;  1K1S A;  4RQ3 A;  5J0R A;  2W8K A;  4F2S A;  7ICG A;  4RNM A;  4O3S A;  2WTF A;  4QZA A;  2BKE A;  4TUQ A;  7ICN A;  3ZDB A;  5J2H A;  3Q8P B;  4QZG A;  4KLO A;  3ORY A;  4KN4 A;  4M9G A;  3H3A A;  5DBB A;  4DL6 A;  5J0Y A;  4AT8 A;  4S3N A;  3TAR A;  4QZF A;  2XY7 A;  1TK0 A;  2ZUC A;  5KFO A;  4O5C A;  4ECU A;  4PGX A;  2DPJ A;  1R8C A;  5KG6 A;  4PHE A;  3OVB A;  1KSP A;  3BJY A;  4B9L A;  4Z6C A;  4BGD A;  3GIL A;  1U48 A;  4RQ2 A;  1L3V A;  1ZQE A;  4E7X A;  1XO1 A;  4JV1 A;  1Q78 A;  1WOT A;  5J2A A;  4RNN A;  3GIJ A;  3RJK A;  2P6U A;  9ICS A;  3ZD9 A;  4ECY A;  4F8R A;  5DDM A;  8ICB A;  4Q43 A;  1S0N A;  4RNO A;  4CCH A;  2NRW A;  3N4M B;  4EBK A;  2ZH6 A;  8ICI A;  4F93 B;  2RFF A;  3OSP A;  3WFO A;  4DL5 A;  8ICO A;  3C5F A;  4YFK A;  1TKD A;  2JZB B;  3PO5 A;  9ICW A;  4AT9 B;  4PHD A;  2ZHB A;  4I27 A;  5J2C A;  1UT8 A;  4XA5 A;  2P6R A;  2M9N A;  3Q8Q B;  5DGA A;  3JPN A;  3QEB Z;  3H7I A;  4ELV A;  1A77 A;  4MEX A;  8ICC A;  3WFQ E;  4QZB A;  2BCU A;  2RDI A;  4DOC A;  3RB0 A;  4JV2 A;  4TUP A;  1NK8 A;  5KFC A;  4C8K A;  1NJY A;  4QW9 A;  1NK9 A;  4O3N A;  1T4G A;  2FPK A;  4ECR A;  4DFJ A;  3KTQ A;  1JQR A;  4MFC A;  3C66 A;  4YVZ A;  2BPC A;  5J2D A;  1XSP A;  4B9V A;  2H5X A;  5KFG A;  3ISD A;  1S77 D;  4GLX A;  4B9M A;  5HRG A;  3OVS A;  4Q45 A;  1XSN A;  2AU0 A;  2HHS A;  3AUO A;  2DR5 A;  4AT8 B;  3H8J A;  2C2R A;  1T3N A;  4EYH B;  1RYS A;  2PI4 A;  4C8L A;  7ICE A;  3TAQ A;  3C21 A;  2PBE A;  2BPF A;  1VJ7 A;  4Z6E A;  1S0M A;  4Z6F A;  3OHA A;  3BQ1 A;  3PVX A;  3JPS A;  4EP7 A;  2BPG A;  1ZQV A;  4PPX A;  4DSK A;  1UA0 A;  8ICU A;  2ZH3 A;  1ZQM A;  3PW5 A;  1S97 A;  2HHP A;  4YN4 A;  1NOM A;  4O3O A;  3JZ0 A;  1V9P A;  3PML A;  4DLE A;  4QZ9 A;  3NGD A;  4RWQ A;  4UB1 A;  3BQT A;  4I2D A;  4RT2 A;  3PR4 A;  2HVI A;  3OUY A;  7ICH A;  3LK9 A;  5DB8 A;  4Q44 A;  4UB3 A;  4DFP A;  5KFR A;  2PFO A;  3BDP A;  5KT5 A;  4WC0 A;  1WCN A;  3GV5 B;  8ICX A;  5HP4 A;  3B0Y A;  4ECQ A;  1NO5 A;  2V9W A;  3WFR E;  4DL7 A;  2A1J A;  1A76 A;  5DG8 A;  1X9M A;  5DB7 A;  3OGU A;  3C2M A;  4M5D A;  3ZDC A;  5IIK A;  1QSY A;  4DWI A;  4RWN A;  9ICU A;  4EBC A;  1RYR A;  8ICF A;  4I2J A;  1F5A A;  2VAN A;  4UB2 A;  7ICV A;  1X2I A;  3WFP A;  5J2F A;  1ZQC A;  4KTQ A;  4R64 A;  4RQ7 A;  1NJX A;  1ZQI A;  4QWC A;  5DB6 A;  4RQ5 A;  1BPX A;  2ISO A;  4M9H A;  5CA7 A;  1ZQG A;  1ZQP A;  2HW3 A;  3T5K A;  5KT6 A;  4X4S A;  2KFZ A;  3PW7 A;  8ICP A;  4IQW A;  1SL2 A;  4UBC A;  3EYZ A;  4P4O A;  2BGW A;  4YR2 A;  2FMS A;  4TQS A;  2FLP A;  5KFS A;  4F92 B;  4RUC A;  5HRF A;  1EXN A;  2HHX A;  4YR3 A;  2AGO A;  3OJS A;  4FHX A;  4JWM A;  4DEZ A;  4UAY A;  4E80 A;  5DG9 A;  2OWO A;  3RBD A;  1ZQQ A;  5HRB A;  3V6J A;  1IM4 A;  4J9K A;  1ZQA A;  3RR7 A;  3RB4 A;  4AT7 B;  9ICG A;  1R89 A;  9ICR A;  3RH5 A;  2BCV A;  3IHQ B;  4YR0 A;  2V4Q A;  4WC4 A;  3HX0 A;  4C8M A;  4ECV A;  2R8I A;  3C2L A;  2BHN A;  1JXL A;  1KFS A;  4O5K A;  2ZTC A;  2O5A A;  5DB9 A;  3ISB A;  4J9R A;  3E2E A;  2NRV A;  5DLF A;  3HP6 A;  1ZQO A;  5CB1 A;  3PW2 A;  2ASD A;  2NRT A;  4K4I A;  2W9M A;  3MGH A;  8ICS A;  3AU6 A;  3LWL A;  5KFZ A;  2ZJ5 A;  1ZQS A;  4JWN A;  3T5J A;  4XRH A;  4K4H A;  2ID1 A;  4J9O A;  3G6X A;  4WC7 A;  2BCR A;  2ZJ8 A;  5J2E A;  3TFR A;  1KTQ A;  2JZB A;  3FDS A;  3MGI A;  3GII A;  4FHV A;  4FHP A;  3UXN A;  4RPZ A;  4ECZ A;  2B21 A;  2NRZ A;  4UAZ A;  4NKT A;  2DFL A;  3RH4 A;  4RWP A;  4J9Q A;  8ICQ A;  1H38 A;  2XGP A;  4F4X A;  2XC9 A;  1MQ2 A;  1ZQL A;  4Q8E A;  3LDA A;  5DLG A;  4O5E A;  4JV0 A;  1UET A;  4RPX A;  4J9N A;  4TUS A;  4DOA A;  4YMN A;  1KNY A;  4WBY A;  1KDH A;  2IA6 A;  5EWF A;  3PX6 A;  4YG2 A;  7ICM A;  3GIK A;  2XY5 A;  1ZQW A;  4DQS A;  4RWO A;  2DRB A;  4ECW A;  2KZM A;  4IQV A;  5KFP A;  2ZH8 A;  4R63 A;  5F9L A;  4DFM A;  4DF8 A;  1ZQR A;  4FS2 A;  3V72 A;  4MEY A;  1XS9 D;  2KN7 A;  3BQ2 A;  4BWM A;  4ZH4 A;  5C5J A;  4I2I A;  5KG3 A;  4ED6 A;  4HYK A;  3PX4 A;  1ZET A;  1ZQT A;  4M9J A;  3AQK A;  2VA8 A;  9ICP A;  1D9D A;  9ICF A;  2P66 A;  8ICG A;  3LQC B;  3UPQ A;  3M8R A;  2FLL A;  2F1I A;  3H8W A;  3H39 A;  4M0A A;  1NKE A;  1XU4 A;  5KFQ A;  1BPY A;  5J29 A;  4NLN A;  1S0O A;  4EEY A;  2DR7 A;  4X4P A;  2VA2 A;  3AU2 A;  1NJZ A;  1BPE A;  4ED0 A;  4XQ8 A;  3MDA A;  1S76 D;  3K4G A;  4ED8 A;  2KZZ A;  3EWA A;  3KHH A;  9ICA A;  2FPM A;  4X0A A;  5J2B A;  2F1J A;  4LZD A;  4ATB A;  2JEJ A;  3JPQ A;  3H4B A;  4NY8 A;  3RJG A;  4UD4 A;  1NK6 A;  1IXR A;  4R8U A;  5HC9 A;  2HVH A;  4DQQ A;  4NLG A;  3JYY A;  4KLG A;  4KLF A;  3Q8L A;  3EPG A;  5KFN A;  2M2U A;  1L5U A;  5IIJ A;  2DVI A;  5DQI A;  1C7Y A;  5J0W A;  7ICI A;  2DR9 A;  5F9N A;  5DDY A;  1MSW D;  3OVA A;  2XY6 A;  1BPB A;  4YD2 A;  4RZR A;  2ZTE A;  1YLQ A;  2XCA A;  4YQW A;  2ZHA A;  8ICL A;  1ZQH A;  1SKW A;  1U49 A;  4WC6 A;  5KT4 A;  4F5O A;  2DR8 A;  4NXZ A;  3RRG A;  5J2G A;  1N48 A;  2HHV A;  3MR3 A;  3TAN A;  4MFA A;  3HJ1 A;  1CUK A;  3L9D A;  5BOM A;  5D46 A;  1ZQN A;  5L1K A;  5J0P A;  7ICP A;  9ICL A;  2KTQ A;  3OV7 A;  4RQ1 A;  3G6V A;  1ZJN A;  2C2E A;  3PW4 A;  1TFR A;  1Z00 B;  4GXJ A;  4ECT A;  3MR5 A;  4DSF A;  3TFS A;  3QEA Z;  2IHN A;  5HHH A;  5KFB A;  5BPC A;  4NM2 A;  1U45 A;  2ZUD A;  2BDP A;  1UT5 A;  2ASJ A;  4M04 A;  4BWJ A;  9ICI A;  1NK5 A;  5EWE A;  3H37 A;  2FLN A;  3H4D A;  4O3R A;  4AT7 A;  3NTU A;  5CHG A;  2JEF A;  2UVV A;  4DQI A;  3MFI A;  3PW0 A;  3MDC A;  2W8L A;  1FA0 A;  7ICL A;  2I1Q A;  4DSE A;  7ICQ A;  4QWB A;  4X4R A;  1ZJM A;  1TV9 A;  2IMW P;  2M2V A;  2ZH4 A;  4EYI B;  3TAP A;  4C8O A;  5KFD A;  1VFG A;  4I2C A;  4ATB B;  5J0Q A;  1ZQB A;  9ICN A;  2W9B A;  4LZG A;  3RB3 A;  2J6T A;  2R8K A;  4G3I A;  4X5V A;  1UA1 A;  4IG8 A;  5J0X A;  4PHA A;  3C5G A;  4R8U B;  3C1Y A;  4GXK A;  4QZC A;  4F91 B;  4QWE A;  3LWM A;  1PZN A;  2R8H A;  2W9A A;  4Q8F A;  4FHY A;  4M9L A;  4FS1 A;  3MFH A;  3V7J A;  4I28 A;  3T3F A;  8ICZ A;  2BE3 A;  4RU9 A;  5D49 A;  2M2W A;  4DO9 A;  3ZDD A;  2IBK A;  4WC3 A;  4ED7 A;  2Q66 A;  2DPI A;  4UQG A;  5D4B A;  5HRI A;  2C2D A;  4R66 A;  3GV8 B;  1JAJ A;  1BPD A;  4F4Z A;  4BDP A;  3FYH A;  5KFU A;  3OHB A;  1XC9 A;  1X9S A;  1HUZ A;  3GQC A;  4I2H A;  9ICT A;  3RJF A;  5DQH A;  5KFA A;  4DL3 A;  2R8G A;  4LT6 A;  1SZP A;  4YP3 A;  4FH3 A;  1UEV A;  4X4Q A;  3SV4 A;  5KT7 A;  4F5R A;  1NJW A;  2W9C A;  1RXV A;  4X4T A;  2AJQ A;  5KFM A;  1JN3 A;  3PR5 B;  4GC7 A;  8ICV A;  1BPZ A;  1ZQX A;  1TAU A;  4KIT B;  3V6H A;  3EPI A;  4KLJ A;  3HJ4 A;  5DQG A;  5HRE A;  4MFF A;  4KLI A;  2JEG A;  5J2K A;  3C2K A;  9ICC A;  1U4B A;  4WC5 A;  3GIM A;  4QZI A;  1COO A;  9ICX A;  5J2J A;  1LB2 B;  4DS4 A;  4X4O A;  2HHT A;  9ICQ A;  3ZD8 A;  1S10 A;  4DSJ A;  9ICJ A;  3QE9 Y;  4EZ9 A;  5CJ7 A;  3UPS A;  3ZDA A;  4RT3 A;  3SV3 A;  2BQ3 A;  3OJU A;  3PMN A;  2W9B B;  2PFQ A;  7ICT A;  5HR9 A;  5KFK A;  4YMO A;  4P4M A;  8ICT A;  5IIL A;  4RQ0 A;  3MAB A;  4XUS A;  8ICR A;  2HHU A;  1QTM A;  4F3O A;  1ZQU A;  2ZH5 A;  1K1Q A;  4LVS A;  3BQ0 A;  3UXP A;  1TFW A;  4IRC A;  4TQR A;  3RJH A;  2FPL A;  2NRX A;  5KFY A;  3UXO A;  1KFD A;  2XGQ A;  1QSS A;  4QZE A;  3EZ5 A;  1S0V A;  4DQP A;  4BXO A;  9ICH A;  1RPL A;  1TAQ A;  2I9G A;  2J6S A;  4NLK A;  5DED A;  4DFK A;  3V7L A;  4KN7 A;  4ELT A;  3NYB A;  1L3T A;  4X0B A;  4FH5 A;  4UBB A;  4P2H A;  4RPY A;  1D9F A;  2J6U A;  4IRK A;  4KLM A;  2C22 A;  5HHI A;  1MC8 A;  2C28 A;  4RQ4 A;  5KT3 A;  2DRA A;  3RB6 A;  1WCL A;  5EOZ A;  2W9C B;  4O0I A;  3N97 B;  1NK0 A;  1R8B A;  1TFY A;  1JIH A;  8ICM A;  1HUO A;  7ICJ A;  3HWT A;  2MUT A;  4GXI A;  2AQ0 A;  3RJE A;  2GWS A;  1MQ3 A;  4NKU A;  3QZ7 A;  3M8S A;  1Z00 A;  4RUA A;  4IRD A;  2ZUB A;  2F1H A;  2R8J A;  4I2E A;  4KLU A;  4KLQ A;  1DGS A;  4PGQ A;  3OSN A;  1SL1 A;  4KLH A;  3HIY A;  5KFT A;  5KT2 A; 
#chains in the Genus database with same CATH topology
 1ZD5 A;  2G5H B;  1TVA A;  5DBA A;  4B9T A;  3QZ8 A;  5KG1 A;  2WF8 A;  1IIP A;  1X6I A;  3SI8 A;  4WCW A;  7ICO A;  3PY8 A;  2Q0Z X;  4BXO B;  5L1I A;  3AN1 A;  4YXM A;  4MF2 A;  1Q3U A;  5ALJ A;  5KFE A;  5EWG A;  4UB6 U;  1BNO A;  1ZXI A;  4K9B A;  4K4G A;  4UD5 A;  3SYZ A;  5AM0 A;  3JPT A;  3G6Y A;  5DGB A;  4UB4 A;  1PK3 A;  4ELU A;  3IDW A;  9ICV A;  3M9M B;  4M9N A;  5J0S A;  4RQ8 A;  2P35 A;  4F5P A;  4K99 A;  3PST A;  3T79 A;  4PGY A;  1R8A A;  3THV A;  3BS5 A;  1NK7 A;  2K8C B;  5J0U A;  1Z3E B;  3CK6 A;  3KHG A;  3MR2 A;  1DK3 A;  5AI8 A;  2QB0 B;  3SZ2 A;  2K8A A;  5IIN A;  5ALR A;  4C80 A;  4KLL A;  1URJ A;  4UB5 A;  3F2C A;  1Y88 A;  3FAH A;  3ETL A;  5TZV A;  4FBU A;  3V6K A;  2EZY A;  1QCK A;  2JMG A;  2YB4 A;  1SV0 A;  5HMM A;  1K5O A;  4QWD A;  3M9N B;  5III A;  2DUY A;  2OCE A;  1MIV A;  5ALZ A;  2KZ3 A;  4US9 A;  2PFN A;  2BQR A;  4FBT A;  5HR6 A;  3KOO A;  2BCS A;  5J2I A;  3TI0 A;  2ZH2 A;  2HHQ A;  3RRH A;  5F2V O;  5HNK A;  5AM1 A;  4ED2 A;  3M9O B;  4JUZ A;  1TK5 A;  2PXI A;  4NM1 A;  5L1M A;  4TUR A;  4J9M A;  3MR6 A;  2MU2 A;  3ICX A;  4MF8 A;  5KFW A;  3H8S A;  4F2R A;  3ERC C;  3D2Q A;  3OUY B;  3NWI A;  2KSO B;  3F53 A;  1WWU A;  3JPR A;  3DDH A;  5ALU A;  4NLZ A;  3ONN A;  1ZRM A;  1SGG A;  2HOI A;  1L3U A;  9ICE A;  1X66 A;  3RJJ A;  5AKJ A;  9ICM A;  8ICH A;  4PL2 A;  3C23 A;  1B22 A;  1IG6 A;  3KHL A;  4I2G A;  2HOF A;  4DL2 A;  2UVW A;  1K1S A;  5J0R A;  3N7P D;  2LPE A;  2JH1 A;  3ZDB A;  3Q8P B;  2GOL A;  4KLO A;  4KN4 A;  5J0Y A;  4ICA A;  4QZF A;  3C29 A;  2ZUC A;  3AMZ A;  2CPR A;  5AIC A;  1LKY A;  1ZQE A;  4RQ2 A;  1O08 A;  2G06 A;  9ICS A;  5DDM A;  8ICB A;  2BDU A;  2DF4 B;  2NRW A;  2ZH6 A;  8ICI A;  3WKD A;  4DL5 A;  1DXS A;  3C5F A;  2JZB B;  3K1Z A;  4I27 A;  1V85 A;  4LEW A;  3Q8Q B;  3JPN A;  1SZH A;  4C7Z A;  5AHX A;  4NXW A;  4MEX A;  3WFQ E;  4K97 A;  2RDI A;  3S6J A;  1ZRN A;  4EEB A;  1NK8 A;  5KFC A;  4O3N A;  2FPK A;  3KTQ A;  1JQR A;  3KZI U;  2BPC A;  5J2D A;  4OJL A;  5CEH A;  2Y0S C;  4Q45 A;  1XSN A;  2AU0 A;  2HHS A;  3AUO A;  3OPX A;  3H8J A;  5JTI A;  2ZH3 A;  3TAQ A;  2BPF A;  1VJ7 A;  2M0N A;  1S0M A;  4Z6F A;  1O03 A;  4P0Q A;  1ZQM A;  3PW5 A;  2HHP A;  1L8O A;  1NOM A;  3JZ0 A;  4DLE A;  2HBK A;  4U7C A;  4Q44 A;  2LKY A;  2A3V A;  4UB3 A;  5KT5 A;  3I28 A;  5HP4 A;  1KW4 A;  2KJ8 A;  1HIW A;  1KN5 A;  2WF6 A;  2W04 A;  3C2M A;  2KG5 A;  2W54 A;  1F5A A;  2VAN A;  7ICV A;  1YZ7 A;  1P7D A;  5AKH A;  1X2I A;  3WFP A;  1T3Q A;  4NL9 A;  1ZQC A;  4R64 A;  4QWC A;  4RQ5 A;  2ISO A;  1ZQG A;  5ALP A;  5KT6 A;  4X4S A;  1SL2 A;  4TQS A;  4F92 B;  2HHX A;  2AGO A;  4JWM A;  4DEZ A;  4E80 A;  4OAF A;  2K60 A;  5ALO A;  3RB4 A;  5AKX A;  9ICG A;  2NO5 A;  3RH5 A;  3IHQ B;  3GZF A;  3HX0 A;  4ECV A;  3C2L A;  4O5K A;  2ZTC A;  2O5A A;  5DB9 A;  5ALD A;  5DLF A;  3PW2 A;  8ICS A;  5KFZ A;  2KOB A;  2W03 A;  4AT9 A;  3QUQ A;  2NRZ A;  1Z19 A;  2DFL A;  3NVO A;  2XGP A;  2ZG6 A;  1ZQL A;  5DLG A;  4JV0 A;  4EGW A;  2IA6 A;  3GU3 A;  4DQS A;  4OAG A;  1ZD3 A;  4AYB F;  2BBH A;  2Y0S F;  4MEY A;  3I76 A;  4BWM A;  1ZET A;  4HYK A;  4M9J A;  3AQK A;  2G09 A;  2VA8 A;  1JRP A;  3D6J A;  9ICP A;  2P66 A;  5KL8 B;  1BPY A;  2K4I A;  4PZO A;  5J29 A;  4EEY A;  2DL0 A;  4X4P A;  1NJZ A;  3K4G A;  2KZZ A;  1ZD4 A;  2IOF A;  4ATB A;  4NY8 A;  4UD4 A;  5ALV A;  5J8Y C;  4NLC A;  5KFN A;  1L5U A;  5IIJ A;  2KIV A;  1C7Y A;  4RQN A;  1BPB A;  4YD2 A;  3QU7 A;  5AKK A;  2A19 A;  4OJO A;  8ICL A;  5JRT A;  1U49 A;  4WC6 A;  4J03 A;  4F5O A;  2BZF A;  4NXZ A;  3RRG A;  3WKB A;  3UMG A;  4MFA A;  3L9D A;  5BOM A;  1ZQN A;  7ICP A;  4Y2V A;  2OHF A;  2GO7 A;  5KL1 B;  4MKP A;  4DSF A;  3TFS A;  5HRL A;  4OAI Z;  3QNM A;  3QXG A;  1UT5 A;  1VDV A;  2FLN A;  5CHG A;  2JEF A;  3MFI A;  3PW0 A;  3MDC A;  2W8L A;  7ICL A;  4EEL A;  2M2V A;  5KFD A;  2F3N A;  4C4T A;  4I0U A;  1ZQB A;  2R8K A;  1UCV A;  4X5V A;  5J0X A;  3C5G A;  4QWE A;  1PZN A;  4Q8F A;  4FS1 A;  1X40 A;  5AI6 A;  4DO9 A;  3MGV A;  3ZDD A;  2IBK A;  4PJ0 U;  1JAJ A;  1V97 A;  3FYH A;  9ICT A;  5DQH A;  5KFA A;  4YP3 A;  4FH3 A;  4USA A;  5KT7 A;  1PVQ A;  2WHE A;  8ICV A;  3NRW A;  3V6H A;  3EPI A;  3VC8 A;  3SQI A;  4KLI A;  1F0M A;  4UB8 U;  3UM9 A;  5AK3 A;  3EUB 2;  4NXV A;  1SIJ A;  2XIC A;  1S10 A;  1UPH A;  3ZDA A;  2PFQ A;  5HR9 A;  1XNS A;  5GTH U;  1OUQ A;  3MAB A;  2NV3 A;  2LI6 A;  1QTM A;  3BQ0 A;  3CW2 C;  2FPL A;  5KFY A;  2HBL A;  2YB1 A;  1QSS A;  3QU4 A;  4BXO A;  4NLK A;  2RLT A;  4RPY A;  4KLM A;  1MC8 A;  5AM4 A;  5KT3 A;  3HRD D;  1OW5 A;  1TFY A;  3OTQ A;  4KX3 A;  4O0I A;  2D8C A;  4OAH A;  4UAV A;  3RJE A;  2EAM A;  2KVS A;  4NKU A;  3N28 A;  2KJ9 A;  4PGQ A;  1SL1 A;  4KLH A;  4C4S A;  5KT2 A;  4J9S A;  1U9L A;  2XI9 A;  7ICR A;  4DFD A;  4F4K A;  1S8O A;  3M1Y A;  2XO7 A;  2QB0 A;  3JPO A;  5L9X A;  2KV2 A;  4KLS A;  3RF9 A;  3UQ0 A;  3NS1 A;  1NNL A;  1NI3 A;  4NXU A;  1CEZ A;  5ALQ A;  3FM9 A;  1T7P A;  4CF4 A;  2ALZ A;  4Z6D A;  4EBD A;  4PZN A;  2W7P A;  3D2N A;  1T8E A;  2HCF A;  2CRX A;  1ZQD A;  4PH5 A;  5IIM A;  7ICK A;  4ECS A;  5HRK A;  5DBC A;  3H38 A;  5AM2 A;  4KX5 A;  4Y2Y A;  4O3P A;  1CRX A;  3KFU F;  2GLE A;  5DG7 A;  1N63 A;  3TAD C;  2XCP A;  5B3Q A;  5HRH A;  5JUM A;  4UAR A;  3Q8R B;  4YCX A;  2ASL A;  3K7D A;  2NRK A;  2JR5 A;  1NKC A;  1S9F A;  2OXO A;  1MIY A;  4DF4 A;  2BR0 A;  1JXE A;  4DOB A;  1X9W A;  2KSO A;  1ZQK A;  4I2F A;  3HPO A;  3T5L A;  3IG8 A;  4DL4 A;  3ER9 B;  3SD7 A;  2MSN A;  3HW8 A;  5KFH A;  5AI4 A;  4B9U A;  2IOH A;  2PFP A;  2QKQ A;  4M6W B;  1OU5 A;  3HIL A;  8ICE A;  2RDJ A;  3E58 A;  4X4V A;  1U47 A;  4K9A A;  2AGP A;  2NO4 A;  2YN4 A;  5AKG A;  4F50 A;  1KFT A;  2VA3 A;  5J0O A;  3N7S C;  4EZ6 A;  1NK4 A;  1N2X A;  2LHT A;  3B0X A;  3RAX A;  3IM1 A;  4XJE A;  5HRD A;  4BJQ A;  4IQT A;  2M2T A;  4B9S A;  3BZK A;  2Y9T A;  4DS5 A;  3SAF A;  2BCQ A;  7ICF A;  1SL0 A;  2DKZ A;  4ECX A;  5KFL A;  4ED1 A;  4I29 A;  3RTV A;  5KTQ A;  1SXE A;  1KRP A;  2KFN A;  2ZTD A;  4F4W A;  4R65 A;  4F2S A;  2WTF A;  2BKE A;  5J2H A;  2LYA A;  3H3A A;  1TAM A;  5ALY A;  5DBB A;  2QAR B;  5CRX A;  3TAC B;  1KBU A;  1TK0 A;  2QLT A;  4PGX A;  1R8C A;  5KG6 A;  3OVB A;  5AKE A;  4Z6C A;  4BGD A;  3GIL A;  4E7X A;  4LEV A;  1S0N A;  4CCH A;  3N4M B;  1A6S A;  3OSP A;  3WFO A;  3PO5 A;  2ZHB A;  4PHD A;  1UT8 A;  4XA5 A;  2P6R A;  2M9N A;  5DGA A;  2PMZ F;  4OJ5 A;  2KJ5 A;  3H7I A;  2BCU A;  4DOC A;  2W3R A;  1NJY A;  3CP8 A;  2KEY A;  4YVZ A;  1XSP A;  1J2N A;  4B9V A;  2H5X A;  1L7P A;  1S77 D;  5ALT A;  3KZX A;  1V38 A;  2DR5 A;  1SWV A;  2EZZ A;  4EYH B;  2PI4 A;  4C8L A;  2PBE A;  3C21 A;  2B51 A;  3BQ1 A;  3JPS A;  4EP7 A;  4DSK A;  4Y2S A;  3PML A;  4U6P A;  4I2D A;  4RT2 A;  3PR4 A;  1KKX A;  5DB8 A;  4UAT A;  4WC0 A;  1ED1 A;  8ICX A;  4OJ6 A;  3IRU A;  3WFR E;  4DL7 A;  2A1J A;  1X9M A;  3ZDC A;  1QSY A;  3AQF A;  4KMO B;  2F8K A;  8ICF A;  3AL0 B;  2LMR A;  5J2F A;  4Y2R A;  3U26 A;  1QH9 A;  1NJX A;  4M9H A;  8ICY A;  2HW3 A;  1ZQP A;  3T5K A;  2KFZ A;  4IQW A;  2FLP A;  5KFS A;  4RUC A;  4WJ3 B;  4B6J A;  4EX6 A;  1ZQQ A;  2HBM A;  3V6J A;  2ES6 A;  1ZQA A;  5ALN A;  9ICR A;  1RDF A;  2V4Q A;  5B66 U;  4A8E A;  2KHQ A;  1JXL A;  5ALX A;  3ISB A;  3E2E A;  4O69 A;  5D63 A;  3HP6 A;  4K4I A;  2JH7 A;  9ICX A;  4K4H A;  1ZQS A;  3WFS C;  3T5J A;  2ID1 A;  3G6X A;  4GFJ A;  5J2E A;  1SV0 C;  5AKZ A;  3TFR A;  1KTQ A;  2B56 A;  4FHV A;  3NUQ A;  2CXY A;  3RH4 A;  4J9Q A;  4Q8E A;  3LDA A;  4RPX A;  2WAQ C;  4TUS A;  4WBY A;  1QQ5 A;  1KDH A;  3PX6 A;  3WU2 U;  2GAF D;  2XY5 A;  3I1Y A;  2KZM A;  4IQV A;  5F9L A;  1ZQR A;  4FS2 A;  3V72 A;  4FO1 A;  1TE2 A;  3WKE A;  2KN7 A;  4ZH4 A;  2W55 A;  4Y2P A;  1C20 A;  9ICF A;  4NXX A;  4FFD A;  4BX9 C;  3UPQ A;  4CRX A;  3M8R A;  2IHO A;  4JMU A;  1XU4 A;  5AK5 A;  1IV8 A;  1PVR A;  1BPE A;  4ED0 A;  2FPM A;  5J2B A;  2F1J A;  4LZD A;  2JEJ A;  3HJE A;  1IXR A;  2DGZ A;  2HVH A;  4DQQ A;  4NLG A;  3QUB A;  4KLF A;  5AI5 A;  4KLG A;  3EPG A;  3F5E A;  1MSW D;  2KK0 A;  2XY6 A;  4RZR A;  5CHE A;  5ALF A;  2KIW A;  2XCA A;  4YQW A;  2HHV A;  3HJ1 A;  1CUK A;  4Y2U A;  5D46 A;  5J0P A;  4UAU A;  4ECT A;  2IHN A;  5HHH A;  1U45 A;  2ZUD A;  4OCZ A;  2ASJ A;  9ICI A;  1NK5 A;  2WF9 A;  2K89 A;  4O3R A;  3QU5 A;  4AT7 A;  2HOQ A;  2W43 A;  4DQI A;  3UMB A;  1SWW A;  3NKU A;  1FA0 A;  2I1Q A;  1LVH A;  4DSE A;  4QWB A;  2IMW P;  4EYI B;  3TAP A;  2W3S A;  1MA7 A;  1VFG A;  9ICN A;  4Y2X A;  3RB3 A;  2J6T A;  4PHA A;  4R8U B;  2RHF A;  3C1Y A;  4F91 B;  2R8H A;  3V7J A;  8ICZ A;  2BE3 A;  2XVT A;  5D49 A;  2RQ5 A;  4QJF B;  4WC3 A;  4ED7 A;  2AHO B;  2KVC A;  2YMM A;  4UQG A;  2DPI A;  4WQK A;  2C2D A;  4FZL A;  5KFU A;  2KNJ A;  1VJ5 A;  3RJF A;  4DL3 A;  1L7O A;  4X4Q A;  3N7R C;  4NXT A;  1NJW A;  1RXV A;  4X4T A;  5KFM A;  1JN3 A;  1TAU A;  4KIT B;  3BS5 B;  3PSP A;  5HRE A;  4MFF A;  2FE9 A;  2JEG A;  5F3X B;  5J2K A;  4WC5 A;  4OD0 A;  4DS4 A;  4X4O A;  9ICJ A;  3UPS A;  4CDG A;  1QQ6 A;  3OJU A;  2W9B B;  5KFK A;  1ECW A;  4P4M A;  3E0F A;  8ICR A;  4F3O A;  1ZQU A;  4LVS A;  4IRC A;  4JB3 A;  1JI7 A;  3RJH A;  2NRX A;  3UXO A;  2XGQ A;  4QZE A;  1TAQ A;  2I9G A;  2J6S A;  5DED A;  4DFK A;  3V7L A;  4ELT A;  2J6U A;  1D9F A;  2C28 A;  3RB6 A;  2EH9 A;  5FP0 A;  2W9C B;  4IL6 U;  3N97 B;  1NK0 A;  2CN1 A;  5B5E U;  2AQ0 A;  2GWS A;  3QZ7 A;  1Z00 A;  2H3I A;  4IRD A;  2ZUB A;  2R8J A;  3ZI4 A;  2QB1 A;  3VCB A;  5KAI U;  1XSL A;  3TQ1 A;  5HML A;  1L7M A;  1Z1V A;  5AI9 A;  3MCR A;  3Q8K A;  2F2A B;  4J9L A;  2V4R A;  5L1L A;  3AQM A;  3SEI A;  4X4N A;  3F2B A;  4QZH A;  3RAQ A;  4DSI A;  4F5N A;  2ZJA A;  3V7K A;  8ICA A;  4O67 A;  4WC2 A;  1YT3 A;  4DLG A;  2OH2 A;  5J0T A;  2MUT B;  4QZD A;  1KQQ A;  3PX0 A;  3WKA A;  4IQU A;  4DQR A;  1UEU A;  2AGQ A;  2HHW A;  1HJP A;  3CYM A;  3HT3 A;  4F5Q A;  2E8O A;  1KEJ A;  3LYS A;  4RQM A;  3A0B U;  1Z4N A;  2EAP A;  2UVR A;  4CGZ A;  4M6W A;  4B9N A;  2ZXH A;  5DEC A;  2ZIU B;  3SAH A;  2ZH1 A;  4O9M A;  4EBE A;  5KFV A;  1ZQF A;  7ICS A;  1MIW A;  1WG8 A;  1PK1 B;  4QW8 A;  3RBE A;  4YMM A;  1FEZ A;  2JRZ A;  2KP7 A;  1ZYQ A;  1L3S A;  2KKP A;  5IIO A;  2OM6 A;  4WQL A;  5AIA A;  4O3Q A;  3ISC A;  9ICK A;  1PVP A;  4P0P B;  3AQN A;  2IHM A;  4FE3 A;  3JPP A;  4WH5 A;  9ICB A;  3WK7 A;  5CR0 A;  5KFJ A;  4J9P A;  4IR1 A;  2MAX A;  5JTG A;  1UQV A;  5ALG A;  5ALK A;  1NKB A;  1NZP A;  2FJ6 A;  3RJI A;  4WBZ A;  5DKW A;  1Q79 A;  1OXJ A;  2HSZ A;  5K4L A;  4GC6 A;  1RQN A;  2LYH A;  4P0Q B;  2EDU A;  1ZQZ A;  1RM6 C;  4GIB A;  4UAW A;  1QQ7 A;  3QYP A;  5CWR A;  1RXW A;  2ATL A;  3K75 D;  2FMP A;  2BQU A;  4I2A A;  1CI4 A;  2KE7 A;  4IR9 A;  3UQ2 A;  2ZIW B;  4QIW C;  4ED3 A;  2A1A A;  2JEI A;  5BOL A;  4RQ6 A;  2UVU A;  1JMS A;  9ICO A;  2G5I B;  1SKR A;  1DRG A;  2LM4 A;  3PSF A;  3LVW A;  5KFI A;  8ICK A;  2FI1 A;  3PHZ A;  3HKZ C;  2VJ5 A;  2DWQ A;  4P4P A;  7ICG A;  2W8K A;  4RQ3 A;  1S5L U;  4RNM A;  4O3S A;  4QZA A;  2F76 X;  4KB6 A;  4M9G A;  4DL6 A;  3TAR A;  1VLB A;  2XY7 A;  5KFO A;  5AKL A;  3MC1 A;  1Z1B A;  1L6N A;  4B9L A;  1U48 A;  3WK4 A;  4JV1 A;  1WOT A;  5J2A A;  2D3D A;  3RJK A;  2P6U A;  3ZD9 A;  4ECY A;  4F8R A;  3NVW A;  4EBK A;  2MRL A;  4F93 B;  2RFF A;  8ICO A;  2WB1 C;  4YFK A;  4AT9 B;  5G5G A;  2Q4T A;  4ELV A;  8ICC A;  4QZB A;  4JV2 A;  4C8K A;  1T4G A;  4ECR A;  4MFC A;  2K8B B;  4NV0 A;  5KFG A;  3ISD A;  3OVS A;  4AT8 B;  1RYS A;  1RQL A;  7ICE A;  4Z6E A;  3NAS A;  2K4P A;  3PVX A;  1WYG A;  1ZQV A;  8ICU A;  1UA0 A;  4YN4 A;  4O3O A;  3IN5 A;  1V9P A;  1WWV A;  4QZ9 A;  3NGD A;  3BQT A;  3OUY A;  7ICH A;  3LK9 A;  3KKA A;  4DFP A;  2PFO A;  2EZX A;  1X42 A;  1WCN A;  3GV5 B;  3B0Y A;  1NO5 A;  4Y2T A;  1GPJ A;  2KMD A;  1A76 A;  5DG8 A;  5DB7 A;  3OGU A;  4M5D A;  5IIK A;  4DWI A;  4RWN A;  3L3F X;  9ICU A;  4EBC A;  3JCF A;  4EX7 A;  4I2J A;  2ZIX B;  1N62 A;  1ZQI A;  2B0C A;  1BPX A;  1X9X A;  3PW7 A;  8ICP A;  4UBC A;  3EYZ A;  4P4O A;  2BGW A;  4YR2 A;  2FMS A;  1JUD A;  1EXN A;  4CF3 A;  4UAY A;  3RBD A;  3H8M A;  4LJX A;  1ZQ1 C;  4YR0 A;  4WC4 A;  2R8I A;  2BHN A;  4J9R A;  2NRV A;  3AEV A;  1A0P A;  5CB1 A;  2W9M A;  3MGH A;  2ZJ5 A;  5AI0 A;  4WC7 A;  4J9O A;  2BCR A;  1RYU A;  3GII A;  2JZB A;  3F5A A;  3FDS A;  3MGI A;  4FHP A;  3UXN A;  2DR9 A;  4ECZ A;  2B21 A;  2H3Q A;  2I6X A;  1H38 A;  5HRF A;  4F4X A;  4AP9 A;  1MQ2 A;  3WKC A;  1UET A;  4J9N A;  4DOA A;  4YMN A;  4Y2J A;  5EWF A;  2AXT U;  3GIK A;  4RWO A;  4K98 A;  2DRB A;  5KFP A;  2ZH8 A;  4R63 A;  4DFM A;  2WFA A;  4DF8 A;  3H0L B;  3BQ2 A;  3QU9 A;  3PX4 A;  4I2I A;  4ED6 A;  2HDO A;  8ICG A;  2FLL A;  3H39 A;  2F1I A;  3H8W A;  4M0A A;  1NKE A;  5KFQ A;  4NLN A;  1S0O A;  2VA2 A;  4XQ8 A;  1ZD2 P;  3MDA A;  5G5H A;  1S76 D;  4ED8 A;  3EWA A;  4F72 A;  5EE9 A;  3KBB A;  2FCL A;  1FIQ A;  3H4B A;  2KKV A;  4R8U A;  1N5W A;  2L5Y A;  3Q8L A;  2M2U A;  3UMC A;  2ZIV B;  5J0W A;  5DDY A;  5AK6 A;  2KIC A;  1ZQH A;  1ZOL A;  2DR8 A;  5J2G A;  1N48 A;  3J81 j;  3MR3 A;  3TAN A;  9ICL A;  5L1K A;  3OV7 A;  2G0A A;  2KTQ A;  1SV4 A;  3G6V A;  2OEH A;  1ZJN A;  2C2E A;  3PW4 A;  4GXJ A;  1YZ6 A;  4X4U A;  3MR5 A;  5BPC A;  4M04 A;  2BDP A;  4BWJ A;  5EE3 A;  3H37 A;  1N61 A;  3H4D A;  3NTU A;  3ER8 C;  3C28 A;  1JAL A;  1MN8 A;  4X4R A;  1ZJM A;  3DV9 A;  4C8O A;  2YX8 A;  5JU5 A;  5J0Q A;  2W9B A;  4G3I A;  4IG8 A;  3LWM A;  1L7N A;  2LBO A;  5T14 A;  4I28 A;  3F2D A;  4O3M A;  4LEZ A;  2Q66 A;  5HRI A;  3ETR A;  5EE1 A;  3AQE A;  4R66 A;  2N1R A;  1BPD A;  2VIX A;  4BDP A;  1HUZ A;  3OHB A;  3GQC A;  5CFU A;  2HBJ A;  5KNI A;  3H0R B;  1UEV A;  3SV4 A;  4WOY A;  3O0F A;  2W9C A;  3PSI A;  2AJQ A;  4GC7 A;  1ZQX A;  2F77 X;  4KLJ A;  2H3Z A;  3C2K A;  1Q46 A;  5AKY A;  5J2J A;  1LB2 B;  9ICQ A;  4DSJ A;  2W11 A;  3QE9 Y;  5CJ7 A;  4RT3 A;  3QX7 A;  2BQ3 A;  7ICT A;  4YMO A;  2HHU A;  2ZH5 A;  4NLB A;  3ALR A;  1J97 A;  1TFW A;  1S0V A;  2VJ4 A;  9ICH A;  2JV3 A;  1B4F A;  5TIS U;  3NYB A;  4X0B A;  4FH5 A;  4UBB A;  3WK9 A;  5AM3 A;  2C22 A;  5HHI A;  1WCL A;  4QNL A;  1R8B A;  1JIH A;  2HI0 A;  2LM1 A;  1HUO A;  7ICJ A;  3HWT A;  2MUT A;  4GXI A;  1MQ3 A;  4I2E A;  4KLU A;  3WK6 A;  5D62 A;  4KLQ A;  1DGS A;  3HIY A;  1Q8K A;  8ICJ A;  3GFK B;  4E0D A;  2NYV A;  3C1Z A;  4OJP A;  3H0M B;  3M7D A;  4KM5 A;  5ALW A;  3H40 A;  2EAN A;  5B3P A;  1JX4 A;  1ARO P;  2ZIU A;  5GTI U;  1B43 A;  4FZN A;  5A0L A;  2YML A;  4JK1 A;  3GDX A;  3L4P A;  1PK1 A;  2HN2 A;  5H2F U;  2AQ4 A;  3CRX A;  3IP4 B;  2I5H A;  4BUG A;  5KG5 A;  2YMQ A;  4FHW A;  1ZQY A;  4EEK A;  4EBJ A;  1XWL A;  1DOQ A;  1QSL A;  4P0P A;  3SEN A;  1Z4O A;  2BBJ A;  5KG0 A;  4XQ7 A;  1DK2 A;  5D61 A;  4KLE A;  4QWA A;  2ISP A;  4M2Y A;  3KD3 A;  7ICU A;  2AH5 A;  4M47 A;  3PZP A;  4AYB C;  4K96 A;  2O6K A;  4N7R A;  1PX5 A;  3SMV A;  4ZOH C;  1V4A A;  4UW9 A;  4K8V A;  3NVY A;  1QLN A;  2JHD A;  3RH6 A;  4QZ8 A;  2ZH7 A;  3RFA A;  2Y1J A;  8ICN A;  4HAI A;  5KG7 A;  4PL1 A;  1N56 A;  3T5H A;  4FO6 A;  1ZQJ A;  5HR7 A;  1BGX T;  4C8N A;  1SXD A;  3Q8S B;  5KFX A;  8ICW A;  1D8B A;  2WAQ F;  2Y1I A;  2ZIW A;  5E79 U;  3PO4 A;  3CNH A;  4YD1 A;  4EEN A;  3EW9 A;  2IOF K;  3Q8M A;  2E8N A;  4IC9 A;  2ZH9 A;  4DSL A;  2GH1 A;  3WK5 A;  1BNP A;  4KMU A;  4CNQ A;  3C18 A;  3D2S A;  4KLD A;  2O1P A;  3AM9 A;  3KHR A;  1FFU A;  2JGA A;  3GV7 B;  1LV5 A;  3AQL A;  4LEY A;  3L5K A;  2PI5 A;  1TK8 A;  3RR8 A;  3ZDE A;  2W7O A;  5KG2 A;  3MBY A;  4C7Y A;  4PHP A;  5KFF A;  4WC1 A;  1D8Y A;  1D8L A;  4C4R A;  4I2B A;  2FMQ A;  4KLT A;  4E8F A;  4NL9 C;  5J8Y A;  2A1J B;  1BVS A;  4F4Y A;  1RZT A;  3NRZ A;  2EWR A;  5CP2 A;  1X6J A;  4UAS A;  5ALH A;  4YXJ A;  3PNC A;  3QU2 A;  1T94 A;  1KLN A;  3PV8 A;  1SKS A;  5KG4 A;  2F8L A;  5L1J A;  2H3F A;  1XO0 A;  1AQ6 A;  5AM5 A;  4TUQ A;  7ICN A;  4QZG A;  3ORY A;  4HX0 A;  4JLX A;  4AT8 A;  4S3N A;  4O5C A;  4ECU A;  2HMX A;  2DPJ A;  4PHE A;  1KSP A;  3BJY A;  1WUD A;  1L3V A;  1XO1 A;  1Q78 A;  4RNN A;  2Y9U A;  3GIJ A;  4DCC A;  2DQN B;  3BZC A;  4Q43 A;  2E3T A;  2K4E A;  3DEE A;  4RNO A;  3TKA A;  1UHU A;  1TKD A;  9ICW A;  5J2C A;  4EED A;  2B6G A;  3QEB Z;  1A77 A;  2F44 A;  3RB0 A;  4TUP A;  4MHV A;  1NK9 A;  4QW9 A;  4DFJ A;  3C66 A;  1M6Y A;  2ZIX A;  2IUB A;  2EQY A;  5HRG A;  4GLX A;  4B9M A;  1N5X A;  1SB3 C;  4O6A A;  2C2R A;  1T3N A;  3OHA A;  1LKY B;  2E8P A;  2BPG A;  4PPX A;  1S97 A;  3BS7 A;  2R18 A;  4RWQ A;  4UB1 A;  4FZM A;  2HVI A;  4JLZ A;  5KFR A;  3BDP A;  4ECQ A;  1F44 A;  2V9W A;  5ALI A;  4G9B A;  2JXJ A;  2YMP A;  5AK4 A;  3QUT A;  1RYR A;  4UB2 A;  1PUZ A;  4KTQ A;  4RQ7 A;  5DB6 A;  5CA7 A;  1COK A;  2PKE A;  4EV6 A;  4YR3 A;  3OJS A;  4FHX A;  2QAR A;  3NVZ A;  4NWI A;  5DG9 A;  2OWO A;  1FFV A;  5HRB A;  1IM4 A;  4J9K A;  3RR7 A;  3R9K A;  4AT7 B;  1R89 A;  2HN1 A;  2BCV A;  3K1R B;  4C8M A;  1N60 A;  1KFS A;  5CFT A;  3BQ7 A;  1ZQO A;  2ASD A;  2NRT A;  2YY6 A;  3AU6 A;  3LWL A;  4JWN A;  4XRH A;  1FO4 A;  2G08 A;  2ZJ8 A;  4RPZ A;  4RWP A;  3IV6 A;  4NKT A;  4UAZ A;  1J2M A;  2G07 A;  8ICQ A;  4C0Z A;  2MA1 A;  2XC9 A;  1F5S A;  4O5E A;  2FDR A;  1KNY A;  2K4H A;  2ZIV A;  4YG2 A;  7ICM A;  3M6Z A;  1ZQW A;  4ECW A;  1DGJ A;  2KHV A;  4CF5 A;  5ALE A;  1RG6 A;  1XS9 D;  2ZXI A;  5C5J A;  1ZQT A;  5KG3 A;  5AIB A;  3TAD A;  1D9D A;  5EE0 A;  3LQC B;  1GO3 F;  5CFS A;  2KD1 A;  3QUC A;  3B9J A;  2DR7 A;  3WK8 A;  3AU2 A;  4OO1 J;  3KHH A;  9ICA A;  4X0A A;  3JPQ A;  3RJG A;  1NK6 A;  5HC9 A;  3JYY A;  2DVI A;  5DQI A;  7ICI A;  5F9N A;  3OVA A;  2ZTE A;  1YLQ A;  3LVV A;  2ZHA A;  1KL9 A;  2B4V A;  1SKW A;  4CE6 A;  5KT4 A;  4RQ1 A;  1L8L A;  1TFR A;  1Z00 B;  2Z7J A;  3QEA Z;  4O68 A;  2E8M A;  5KFB A;  4NM2 A;  3EF2 A;  2DBY A;  4IS7 A;  5EWE A;  5ALM A;  4F71 A;  2UVV A;  1HEK A;  2OYY A;  7ICQ A;  2ZH4 A;  2YTU A;  1TV9 A;  2E1E A;  4I2C A;  4ATB B;  4LZG A;  3OWG A;  1UA1 A;  2ODG A;  4GXK A;  4QZC A;  3M6K A;  4QIW F;  2W9A A;  3SR6 A;  4FHY A;  4M9L A;  3MFH A;  3T3F A;  3SAG A;  4RU9 A;  2M2W A;  2H3V A;  5D4B A;  3GV8 B;  2GA9 D;  4F4Z A;  1X9S A;  2E5S A;  1XC9 A;  2PMZ C;  4I2H A;  5AKI A;  3NVV A;  2XID A;  2R8G A;  3HKZ F;  1SZP A;  4LT6 A;  4NJ8 A;  4F5R A;  4Y2Q A;  3PR5 B;  2DKX A;  1BPZ A;  3HJ4 A;  5DQG A;  5C0Y A;  9ICC A;  1U4B A;  2ESE A;  3GIM A;  4QZI A;  1COO A;  2HHT A;  3ZD8 A;  4EZ9 A;  2WF7 A;  3SV3 A;  1JRO A;  3PMN A;  2YQE A;  3KKA C;  5IIL A;  8ICT A;  4RQ0 A;  4XUS A;  2RP5 A;  1K1Q A;  5ALL A;  3UXP A;  2WB1 F;  2RRD A;  4TQR A;  1KFD A;  3EZ5 A;  4DQP A;  5ALS A;  1RPL A;  3A0H U;  4KN7 A;  1L3T A;  4P2H A;  4IRK A;  4RQ4 A;  2DRA A;  3FC4 A;  2D6F C;  4US8 A;  5KAF U;  5EOZ A;  8ICM A;  2EAO A;  3IG5 A;  2LYB A;  2VKQ A;  4ACO A;  2WF5 A;  1NZB A;  2E1F A;  3M8S A;  4RUA A;  2F1H A;  1B0X A;  3ED5 A;  1Q3V A;  3OSN A;  5KFT A; 
#chains in the Genus database with same CATH homology
 4J9S A;  1XSL A;  1U9L A;  3GFK B;  8ICJ A;  4E0D A;  7ICR A;  3C1Z A;  3TQ1 A;  5HML A;  1TVA A;  4F4K A;  5DBA A;  2XO7 A;  4B9T A;  3Q8K A;  3QZ8 A;  5KG1 A;  3JPO A;  3H40 A;  4J9L A;  5L9X A;  1JX4 A;  1ARO P;  2V4R A;  4KLS A;  3UQ0 A;  3SI8 A;  4WCW A;  3WFS C;  1B43 A;  7ICO A;  5L1L A;  3PY8 A;  1CEZ A;  3AQM A;  2Q0Z X;  4JK1 A;  4BXO B;  3GDX A;  5L1I A;  4X4N A;  4YXM A;  4MF2 A;  4AT9 A;  4QZH A;  5KFE A;  3RAQ A;  2AQ4 A;  5EWG A;  1T7P A;  4DSI A;  2ALZ A;  4F5N A;  1BNO A;  4Z6D A;  2ZJA A;  5KG5 A;  3V7K A;  4EBD A;  4K4G A;  8ICA A;  3SYZ A;  4UD5 A;  3JPT A;  3G6Y A;  1ZQY A;  4FHW A;  5DGB A;  4UB4 A;  4WC2 A;  1T8E A;  1ZQD A;  1XWL A;  4PH5 A;  4ELU A;  4EBJ A;  4DLG A;  9ICV A;  1DOQ A;  3M9M B;  5IIM A;  7ICK A;  4M9N A;  5J0T A;  4ECS A;  5J0S A;  2MUT B;  5DBC A;  4QZD A;  4RQ8 A;  1QSL A;  5HRK A;  3PX0 A;  4F5P A;  3H38 A;  4IQU A;  4DQR A;  5KG0 A;  4XQ7 A;  1DK2 A;  1UEU A;  4PGY A;  2AGQ A;  4KLE A;  4O3P A;  3THV A;  4QWA A;  2HHW A;  1R8A A;  1HJP A;  3HT3 A;  2ISP A;  4M2Y A;  4F5Q A;  1NK7 A;  5DG7 A;  5J0U A;  1KEJ A;  1Z3E B;  7ICU A;  2XCP A;  4M47 A;  2UVR A;  3KHG A;  4M6W A;  5HRH A;  3MR2 A;  5JUM A;  1DK3 A;  1PX5 A;  1V4A A;  3Q8R B;  4YCX A;  3SZ2 A;  4B9N A;  5IIN A;  2ASL A;  1QLN A;  5DEC A;  3RH6 A;  4KLL A;  2ZH1 A;  4QZ8 A;  4O9M A;  4EBE A;  5KFV A;  4UB5 A;  1ZQF A;  1Y88 A;  7ICS A;  1MIW A;  2ZH7 A;  2Y1J A;  2NRK A;  3ETL A;  5TZV A;  4QW8 A;  4FBU A;  3V6K A;  8ICN A;  1NKC A;  5KG7 A;  3RBE A;  4YMM A;  1S9F A;  1MIY A;  4DF4 A;  2BR0 A;  1JXE A;  1ZYQ A;  1N56 A;  3T5H A;  4DOB A;  4FO6 A;  1L3S A;  1ZQJ A;  1BGX T;  2KP7 A;  4C8N A;  5IIO A;  1X9W A;  1ZQK A;  3Q8S B;  5KFX A;  4O3Q A;  5HMM A;  3ISC A;  8ICW A;  9ICK A;  4I2F A;  3HPO A;  3T5L A;  4QWD A;  3M9N B;  5III A;  4DL4 A;  2Y1I A;  3AQN A;  1MIV A;  2IHM A;  3PO4 A;  4X4U A;  4YD1 A;  2KZ3 A;  3JPP A;  2PFN A;  9ICB A;  3EW9 A;  2BQR A;  4FBT A;  3Q8M A;  5CR0 A;  3HW8 A;  5KFH A;  2BCS A;  4DSL A;  4B9U A;  5J2I A;  5KFJ A;  2ZH9 A;  8ICY A;  3TI0 A;  4J9P A;  2PFP A;  4IR1 A;  2MAX A;  4M6W B;  2HHQ A;  2ZH2 A;  3RRH A;  5F2V O;  5HNK A;  1BNP A;  4KMU A;  1NKB A;  1OU5 A;  4ED2 A;  1NZP A;  3C18 A;  3M9O B;  4KLD A;  4JUZ A;  1TK5 A;  2PXI A;  8ICE A;  3RJI A;  4WBZ A;  2O1P A;  4NM1 A;  5DKW A;  2RDJ A;  4X4V A;  1Q79 A;  3KHR A;  4TUR A;  4J9M A;  1U47 A;  3MR6 A;  4GC6 A;  2AGP A;  3GV7 B;  2LYH A;  1LV5 A;  1ZQZ A;  4F50 A;  1KFT A;  4MF8 A;  3AQL A;  2VA3 A;  5KFW A;  3H8S A;  2PI5 A;  5J0O A;  1TK8 A;  4F2R A;  3RR8 A;  4UAW A;  5HRL A;  3ZDE A;  4EZ6 A;  1NK4 A;  3OUY B;  3B0X A;  3RAX A;  5CWR A;  3IM1 A;  5KG2 A;  3MBY A;  1RXW A;  2ATL A;  3JPR A;  3K75 D;  4PHP A;  5KFF A;  2FMP A;  2BQU A;  4I2A A;  1D8Y A;  5HRD A;  4WC1 A;  4NLZ A;  2M2T A;  4IQT A;  1D8L A;  4B9S A;  4IR9 A;  3UQ2 A;  4I2B A;  4DS5 A;  2FMQ A;  4ED3 A;  4KLT A;  2BCQ A;  4E8F A;  1L3U A;  7ICF A;  2A1J B;  9ICE A;  2JEI A;  5BOL A;  1BVS A;  4RQ6 A;  4F4Y A;  2UVU A;  1JMS A;  1RZT A;  9ICO A;  1SL0 A;  4ECX A;  3RJJ A;  1SKR A;  5CP2 A;  5KFL A;  4ED1 A;  4YXJ A;  3PNC A;  5KFI A;  4I29 A;  9ICM A;  8ICH A;  3RTV A;  5KTQ A;  3C23 A;  1KLN A;  8ICK A;  1B22 A;  1KRP A;  3PV8 A;  2KFN A;  3KHL A;  1SKS A;  5KG4 A;  5L1J A;  4I2G A;  2ZTD A;  4F4W A;  4R65 A;  4P4P A;  4DL2 A;  2UVW A;  1K1S A;  4RQ3 A;  5J0R A;  2W8K A;  4F2S A;  7ICG A;  4RNM A;  4O3S A;  2WTF A;  4QZA A;  2BKE A;  4TUQ A;  7ICN A;  3ZDB A;  5J2H A;  3Q8P B;  4QZG A;  4KLO A;  3ORY A;  4KN4 A;  4M9G A;  3H3A A;  5DBB A;  4DL6 A;  5J0Y A;  4AT8 A;  4S3N A;  3TAR A;  4QZF A;  2XY7 A;  1TK0 A;  2ZUC A;  5KFO A;  4O5C A;  4ECU A;  4PGX A;  2DPJ A;  1R8C A;  5KG6 A;  4PHE A;  3OVB A;  1KSP A;  3BJY A;  4B9L A;  4Z6C A;  4BGD A;  3GIL A;  1U48 A;  4RQ2 A;  1L3V A;  1ZQE A;  4E7X A;  1XO1 A;  4JV1 A;  1Q78 A;  1WOT A;  5J2A A;  4RNN A;  3GIJ A;  3RJK A;  2P6U A;  9ICS A;  3ZD9 A;  4ECY A;  4F8R A;  5DDM A;  8ICB A;  4Q43 A;  1S0N A;  4RNO A;  4CCH A;  2NRW A;  3N4M B;  4EBK A;  2ZH6 A;  8ICI A;  4F93 B;  2RFF A;  3OSP A;  3WFO A;  4DL5 A;  8ICO A;  3C5F A;  4YFK A;  1TKD A;  2JZB B;  3PO5 A;  9ICW A;  4AT9 B;  4PHD A;  2ZHB A;  4I27 A;  5J2C A;  1UT8 A;  4XA5 A;  2P6R A;  2M9N A;  3Q8Q B;  5DGA A;  3JPN A;  3QEB Z;  3H7I A;  4ELV A;  1A77 A;  4MEX A;  8ICC A;  3WFQ E;  4QZB A;  2BCU A;  2RDI A;  4DOC A;  3RB0 A;  4JV2 A;  4TUP A;  1NK8 A;  5KFC A;  4C8K A;  1NJY A;  4QW9 A;  1NK9 A;  4O3N A;  1T4G A;  2FPK A;  4ECR A;  4DFJ A;  3KTQ A;  1JQR A;  4MFC A;  3C66 A;  4YVZ A;  2BPC A;  5J2D A;  1XSP A;  4B9V A;  2H5X A;  5KFG A;  3ISD A;  1S77 D;  4GLX A;  4B9M A;  5HRG A;  3OVS A;  4Q45 A;  1XSN A;  2AU0 A;  2HHS A;  3AUO A;  2DR5 A;  4AT8 B;  3H8J A;  2C2R A;  1T3N A;  4EYH B;  1RYS A;  2PI4 A;  4C8L A;  7ICE A;  3TAQ A;  3C21 A;  2PBE A;  2BPF A;  1VJ7 A;  4Z6E A;  1S0M A;  4Z6F A;  3OHA A;  3BQ1 A;  3PVX A;  3JPS A;  4EP7 A;  2BPG A;  1ZQV A;  4PPX A;  4DSK A;  1UA0 A;  8ICU A;  2ZH3 A;  1ZQM A;  3PW5 A;  1S97 A;  2HHP A;  4YN4 A;  1NOM A;  4O3O A;  3JZ0 A;  1V9P A;  3PML A;  4DLE A;  4QZ9 A;  3NGD A;  4RWQ A;  4UB1 A;  3BQT A;  4I2D A;  4RT2 A;  3PR4 A;  2HVI A;  3OUY A;  7ICH A;  3LK9 A;  5DB8 A;  4Q44 A;  4UB3 A;  4DFP A;  5KFR A;  2PFO A;  3BDP A;  5KT5 A;  4WC0 A;  1WCN A;  3GV5 B;  8ICX A;  5HP4 A;  3B0Y A;  4ECQ A;  1NO5 A;  2V9W A;  3WFR E;  4DL7 A;  2A1J A;  1A76 A;  5DG8 A;  1X9M A;  5DB7 A;  3OGU A;  3C2M A;  4M5D A;  3ZDC A;  5IIK A;  1QSY A;  4DWI A;  4RWN A;  9ICU A;  4EBC A;  1RYR A;  8ICF A;  4I2J A;  1F5A A;  2VAN A;  4UB2 A;  7ICV A;  1X2I A;  3WFP A;  5J2F A;  1ZQC A;  4KTQ A;  4R64 A;  4RQ7 A;  1NJX A;  1ZQI A;  4QWC A;  5DB6 A;  4RQ5 A;  1BPX A;  2ISO A;  4M9H A;  5CA7 A;  1ZQG A;  1ZQP A;  2HW3 A;  3T5K A;  5KT6 A;  4X4S A;  2KFZ A;  3PW7 A;  8ICP A;  4IQW A;  1SL2 A;  4UBC A;  3EYZ A;  4P4O A;  2BGW A;  4YR2 A;  2FMS A;  4TQS A;  2FLP A;  5KFS A;  4F92 B;  4RUC A;  5HRF A;  1EXN A;  2HHX A;  4YR3 A;  2AGO A;  3OJS A;  4FHX A;  4JWM A;  4DEZ A;  4UAY A;  4E80 A;  5DG9 A;  2OWO A;  3RBD A;  1ZQQ A;  5HRB A;  3V6J A;  1IM4 A;  4J9K A;  1ZQA A;  3RR7 A;  3RB4 A;  4AT7 B;  9ICG A;  1R89 A;  9ICR A;  3RH5 A;  2BCV A;  3IHQ B;  4YR0 A;  2V4Q A;  4WC4 A;  3HX0 A;  4C8M A;  4ECV A;  2R8I A;  3C2L A;  2BHN A;  1JXL A;  1KFS A;  4O5K A;  2ZTC A;  2O5A A;  5DB9 A;  3ISB A;  4J9R A;  3E2E A;  2NRV A;  5DLF A;  3HP6 A;  1ZQO A;  5CB1 A;  3PW2 A;  2ASD A;  2NRT A;  4K4I A;  2W9M A;  3MGH A;  8ICS A;  3AU6 A;  3LWL A;  5KFZ A;  2ZJ5 A;  1ZQS A;  4JWN A;  3T5J A;  4XRH A;  4K4H A;  2ID1 A;  4J9O A;  3G6X A;  4WC7 A;  2BCR A;  2ZJ8 A;  5J2E A;  3TFR A;  1KTQ A;  2JZB A;  3FDS A;  3MGI A;  3GII A;  4FHV A;  4FHP A;  3UXN A;  4RPZ A;  4ECZ A;  2B21 A;  2NRZ A;  4UAZ A;  4NKT A;  2DFL A;  3RH4 A;  4RWP A;  4J9Q A;  8ICQ A;  1H38 A;  2XGP A;  4F4X A;  2XC9 A;  1MQ2 A;  1ZQL A;  4Q8E A;  3LDA A;  5DLG A;  4O5E A;  4JV0 A;  1UET A;  4RPX A;  4J9N A;  4TUS A;  4DOA A;  4YMN A;  1KNY A;  4WBY A;  1KDH A;  2IA6 A;  5EWF A;  3PX6 A;  4YG2 A;  7ICM A;  3GIK A;  2XY5 A;  1ZQW A;  4DQS A;  4RWO A;  2DRB A;  4ECW A;  2KZM A;  4IQV A;  5KFP A;  2ZH8 A;  4R63 A;  5F9L A;  4DFM A;  4DF8 A;  1ZQR A;  4FS2 A;  3V72 A;  4MEY A;  1XS9 D;  2KN7 A;  3BQ2 A;  4BWM A;  4ZH4 A;  5C5J A;  4I2I A;  5KG3 A;  4ED6 A;  4HYK A;  3PX4 A;  1ZET A;  1ZQT A;  4M9J A;  3AQK A;  2VA8 A;  9ICP A;  1D9D A;  9ICF A;  2P66 A;  8ICG A;  3LQC B;  3UPQ A;  3M8R A;  2FLL A;  2F1I A;  3H8W A;  3H39 A;  4M0A A;  1NKE A;  1XU4 A;  5KFQ A;  1BPY A;  5J29 A;  4NLN A;  1S0O A;  4EEY A;  2DR7 A;  4X4P A;  2VA2 A;  3AU2 A;  1NJZ A;  1BPE A;  4ED0 A;  4XQ8 A;  3MDA A;  1S76 D;  3K4G A;  4ED8 A;  2KZZ A;  3EWA A;  3KHH A;  9ICA A;  2FPM A;  4X0A A;  5J2B A;  2F1J A;  4LZD A;  4ATB A;  2JEJ A;  3JPQ A;  3H4B A;  4NY8 A;  3RJG A;  4UD4 A;  1NK6 A;  1IXR A;  4R8U A;  5HC9 A;  2HVH A;  4DQQ A;  4NLG A;  3JYY A;  4KLG A;  4KLF A;  3Q8L A;  3EPG A;  5KFN A;  2M2U A;  1L5U A;  5IIJ A;  2DVI A;  5DQI A;  1C7Y A;  5J0W A;  7ICI A;  2DR9 A;  5F9N A;  5DDY A;  1MSW D;  3OVA A;  2XY6 A;  1BPB A;  4YD2 A;  4RZR A;  2ZTE A;  1YLQ A;  2XCA A;  4YQW A;  2ZHA A;  8ICL A;  1ZQH A;  1SKW A;  1U49 A;  4WC6 A;  5KT4 A;  4F5O A;  2DR8 A;  4NXZ A;  3RRG A;  5J2G A;  1N48 A;  2HHV A;  3MR3 A;  3TAN A;  4MFA A;  3HJ1 A;  1CUK A;  3L9D A;  5BOM A;  5D46 A;  1ZQN A;  5L1K A;  5J0P A;  7ICP A;  9ICL A;  2KTQ A;  3OV7 A;  4RQ1 A;  3G6V A;  1ZJN A;  2C2E A;  3PW4 A;  1TFR A;  1Z00 B;  4GXJ A;  4ECT A;  3MR5 A;  4DSF A;  3TFS A;  3QEA Z;  2IHN A;  5HHH A;  5KFB A;  5BPC A;  4NM2 A;  1U45 A;  2ZUD A;  2BDP A;  1UT5 A;  2ASJ A;  4M04 A;  4BWJ A;  9ICI A;  1NK5 A;  5EWE A;  3H37 A;  2FLN A;  3H4D A;  4O3R A;  4AT7 A;  3NTU A;  5CHG A;  2JEF A;  2UVV A;  4DQI A;  3MFI A;  3PW0 A;  3MDC A;  2W8L A;  1FA0 A;  7ICL A;  2I1Q A;  4DSE A;  7ICQ A;  4QWB A;  4X4R A;  1ZJM A;  1TV9 A;  2IMW P;  2M2V A;  2ZH4 A;  4EYI B;  3TAP A;  4C8O A;  5KFD A;  1VFG A;  4I2C A;  4ATB B;  5J0Q A;  1ZQB A;  9ICN A;  2W9B A;  4LZG A;  3RB3 A;  2J6T A;  2R8K A;  4G3I A;  4X5V A;  1UA1 A;  4IG8 A;  5J0X A;  4PHA A;  3C5G A;  4R8U B;  3C1Y A;  4GXK A;  4QZC A;  4F91 B;  4QWE A;  3LWM A;  1PZN A;  2R8H A;  2W9A A;  4Q8F A;  4FHY A;  4M9L A;  4FS1 A;  3MFH A;  3V7J A;  4I28 A;  3T3F A;  8ICZ A;  2BE3 A;  4RU9 A;  5D49 A;  2M2W A;  4DO9 A;  3ZDD A;  2IBK A;  4WC3 A;  4ED7 A;  2Q66 A;  2DPI A;  4UQG A;  5D4B A;  5HRI A;  2C2D A;  4R66 A;  3GV8 B;  1JAJ A;  1BPD A;  4F4Z A;  4BDP A;  3FYH A;  5KFU A;  3OHB A;  1XC9 A;  1X9S A;  1HUZ A;  3GQC A;  4I2H A;  9ICT A;  3RJF A;  5DQH A;  5KFA A;  4DL3 A;  2R8G A;  4LT6 A;  1SZP A;  4YP3 A;  4FH3 A;  1UEV A;  4X4Q A;  3SV4 A;  5KT7 A;  4F5R A;  1NJW A;  2W9C A;  1RXV A;  4X4T A;  2AJQ A;  5KFM A;  1JN3 A;  3PR5 B;  4GC7 A;  8ICV A;  1BPZ A;  1ZQX A;  1TAU A;  4KIT B;  3V6H A;  3EPI A;  4KLJ A;  3HJ4 A;  5DQG A;  5HRE A;  4MFF A;  4KLI A;  2JEG A;  5J2K A;  3C2K A;  9ICC A;  1U4B A;  4WC5 A;  3GIM A;  4QZI A;  1COO A;  9ICX A;  5J2J A;  1LB2 B;  4DS4 A;  4X4O A;  2HHT A;  9ICQ A;  3ZD8 A;  1S10 A;  4DSJ A;  9ICJ A;  3QE9 Y;  4EZ9 A;  5CJ7 A;  3UPS A;  3ZDA A;  4RT3 A;  3SV3 A;  2BQ3 A;  3OJU A;  3PMN A;  2W9B B;  2PFQ A;  7ICT A;  5HR9 A;  5KFK A;  4YMO A;  4P4M A;  8ICT A;  5IIL A;  4RQ0 A;  3MAB A;  4XUS A;  8ICR A;  2HHU A;  1QTM A;  4F3O A;  1ZQU A;  2ZH5 A;  1K1Q A;  4LVS A;  3BQ0 A;  3UXP A;  1TFW A;  4IRC A;  4TQR A;  3RJH A;  2FPL A;  2NRX A;  5KFY A;  3UXO A;  1KFD A;  2XGQ A;  1QSS A;  4QZE A;  3EZ5 A;  1S0V A;  4DQP A;  4BXO A;  9ICH A;  1RPL A;  1TAQ A;  2I9G A;  2J6S A;  4NLK A;  5DED A;  4DFK A;  3V7L A;  4KN7 A;  4ELT A;  3NYB A;  1L3T A;  4X0B A;  4FH5 A;  4UBB A;  4P2H A;  4RPY A;  1D9F A;  2J6U A;  4IRK A;  4KLM A;  2C22 A;  5HHI A;  1MC8 A;  2C28 A;  4RQ4 A;  5KT3 A;  2DRA A;  3RB6 A;  1WCL A;  5EOZ A;  2W9C B;  4O0I A;  3N97 B;  1NK0 A;  1R8B A;  1TFY A;  1JIH A;  8ICM A;  1HUO A;  7ICJ A;  3HWT A;  2MUT A;  4GXI A;  2AQ0 A;  3RJE A;  2GWS A;  1MQ3 A;  4NKU A;  3QZ7 A;  3M8S A;  1Z00 A;  4RUA A;  4IRD A;  2ZUB A;  2F1H A;  2R8J A;  4I2E A;  4KLU A;  4KLQ A;  1DGS A;  4PGQ A;  3OSN A;  1SL1 A;  4KLH A;  3HIY A;  5KFT A;  5KT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...