5DB6A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dc
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 102
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db6A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db6A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db6A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db6A03
7ICOA 1WCNA 1NZPA 4J9KA 1QTMA 1ZQBA 1BVSA 5KFLA 3C2MA 3H40A 5CP2A 3UQ0A 4DL4A 4IR1A 1ZQRA 2ISOA 4O0IA 2HHTA 4WC1A 2F1IA 3ZDDA 1RXVA 1JXEA 3ISCA 1RXWA 5KG6A 3AQNA 4EZ6A 1MQ3A 4ECSA 3RAQA 4I2AA 1U49A 5HRIA 2ZHAA 1JN3A 1ZQMA 3TAPA 3SV4A 3G6XA 1L3SA 4RQ4A 1XSLA 3GV8B 4ECYA 3GV7B 3LWMA 2FMPA 4X4RA 3GILA 4Q43A 4BDPA 5DECA 1MIVA 2DR5A 3T5HA 4YXMA 2HVHA 2HHPA 3GIKA 4PHEA 3H8WA 3V7KA 4RUCA 3GIMA 4WC6A 1KEJA 9ICHA 4QZEA 3C1YA 3EWAA 5EOZA 5HRGA 3HP6A 1CEZA 4I2IA 4B9MA 2VA3A 4X0AA 1ZQIA 4FHXA 5KFHA 2C2RA 3BJYA 3MR2A 4RQ1A 3KHHA 5J2HA 2I9GA 4YQWA 3M8SA 4B9LA 4IRKA 7ICIA 2BCSA 1TV9A 4TQRA 7ICJA 4FHPA 5L1JA 4I2GA 1U48A 4X4NA 4DSFA 4M6WB 3PO4A 3PW0A 4LVSA 1WCLA 4PPXA 4F5PA 5BPCA 1R8AA 1NJZA 2J6TA 4KLUA 9ICXA 3V6HA 4DLEA 2R8KA 4AT7B 4MF2A 2DRAA 1AROP 4JV1A 4X5VA 2V4QA 3V6KA 2BCRA 3EPGA 4DSKA 1QSYA 2KTQA 3TARA 4PHAA 4KLHA 2Y1IA 2BQRA 2Q0ZX 2JEJA 5J0SA 1XU4A 4KLOA 3ZDBA 3T5KA 5KFRA 4GC6A 3WFQE 3MGHA 1NKCA 7ICFA 5J2BA 2FLLA 1MC8A 3FYHA 5J0PA 5HP4A 3OGUA 3V6JA 2O1PA 1S9FA 2PFQA 2M2TA 3TQ1A 5J0OA 3QEAZ 2FPKA 4I27A 4QZFA 2Y1JA 1QSSA 2ZUDA 4X4TA 4QZCA 3THVA 5HRHA 4AT8A 4J9RA 2PFPA 4IQWA 1S76D 4X0BA 4O9MA 2M2WA 4FHVA 1ZQVA 2XCAA 4MFFA 1ZQEA 2KN7A 4M9LA 2ZH6A 5IIIA 4WC0A 3OVBA 1KLNA 4DSLA 1KRPA 9ICUA 2BPFA 1N56A 2ASLA 2DR8A 4RT2A 3AQMA 4DSIA 5F2VO 1SKSA 5CHGA 4I2DA 4I2EA 7ICHA 4Z6EA 4XQ7A 4PHDA 4M47A 5DGBA 2MAXA 4MFAA 1NK6A 3L9DA 5L1KA 4EP7A 4B9UA 4DFKA 3UPSA 3M9MB 4RWNA 4IQVA 2P6RA 3JPPA 5KFJA 1JXLA 4O3SA 5DLGA 2DFLA 4UD4A 2JEFA 5KG2A 3MGIA 5KT2A 4R63A 3PR4A 1JAJA 1ZQGA 4X4PA 3PW7A 8ICWA 4E7XA 4F4ZA 3H4BA 2HHVA 3OSPA 1OU5A 4J9SA 4I28A 1FA0A 1ZQAA 3BQ1A 4P2HA 1LV5A 4HYKA 5J0RA 4XRHA 3BQ0A 2FMSA 5HRBA 1DGSA 1IM4A 5J2JA 4F5RA 4BWJA 1ZQXA 1JX4A 5J2EA 3RRHA 1DK2A 4QW8A 7ICMA 1CUKA 5HNKA 5KFBA 3PX6A 2JEIA 4UB2A 3T5JA 5IIOA 4J9PA 4DL5A 3M8RA 1NK9A 3RAXA 3RR7A 4ECUA 3PW5A 2UVWA 2A1JA 2BHNA 4RQ2A 5HRKA 4X4SA 5DGAA 7ICGA 3EW9A 2DPIA 4KLFA 4QZAA 3HPOA 4WBYA 4DWIA 2M9NA 4ED2A 2MUTB 4UB1A 2R8IA 4TUPA 2C2DA 9ICAA 4MEXA 3MABA 4X4OA 4O5CA 4FH5A 2ZH4A 4O3RA 2DRBA 1DOQA 2AGOA 5DKWA 3H39A 4AT8B 1X9SA 1RZTA 4KLSA 3RJGA 3Q8KA 1C7YA 4J9NA 4FBUA 5TZVA 4QWDA 9ICOA 3Q8RB 1KFDA 1ZQSA 1N48A 4EEYA 2F1JA 1Q79A 4Z6CA 1X9MA 2BPGA 1BGXT 4P4PA 4QZ8A 3QE9Y 5KT5A 4YD1A 9ICLA 1Q78A 1U45A 1BPYA 2ZTCA 4DL2A 4E80A 1XWLA 8ICTA 2P66A 8ICFA 4M6WA 5HR9A 5KFTA 1K1SA 4ATBB 2OWOA 4GXKA 8ICSA 1R89A 1RYSA 4I2CA 4RWPA 4QZDA 3RBEA 1L5UA 1TVAA 5KT6A 9ICGA 1ZQTA 4EZ9A 5EWGA 1B22A 2IA6A 2HHQA 4UBBA 4WC5A 3C18A 3ISBA 1HJPA 3N97B 1UA1A 9ICJA 4DOAA 4I2FA 4PGYA 5KG7A 4DOCA 3PMLA 4MEYA 1UA0A 4ECQA 4X4VA 8ICXA 5DBBA 5KFGA 5BOLA 5DB9A 5JUMA 4QZHA 2W8KA 1V4AA 4KLLA 4M5DA 3GV5B 4RQ0A 3NTUA 1NK5A 4O5KA 4YCXA 3JPSA 3HIYA 5J2KA 4JWMA 5KFUA 2M2UA 1V9PA 2NRWA 5J2IA 1RPLA 4DO9A 4DF8A 5CJ7A 1ZQHA 4F4KA 5HHIA 4DQIA 3WFSC 4E8FA 4IRDA 1ZQCA 3MR3A 4JK1A 4FHYA 2W9AA 1NK4A 3RJJA 3H8SA 3NGDA 4IQTA 8ICAA 5J0UA 4RQ7A 2W9CA 5IINA 4DF4A 1T8EA 1BPZA 4E0DA 2XY6A 3QEBZ 4QWAA 5IILA 2PI4A 3RB0A 5BOMA 8ICUA 7ICSA 1TFYA 2V9WA 2H5XA 3HW8A 2WTFA 5J2AA 4YD2A 5KG5A 5HMMA 4I29A 1S10A 1IXRA 3C5GA 4DQSA 5KFOA 3UXPA 9ICRA 4G3IA 4LT6A 1ZQYA 4FH3A 4M2YA 7ICTA 3WFOA 5J0XA 9ICVA 2PXIA 4DLGA 4YR3A 9ICNA 4QZIA 4RQ8A 2ZJ5A 3Q8QB 3OHAA 3ZDCA 3AUOA 5CWRA 4Q44A 1BNPA 3GDXA 1XSNA 2J6SA 4NLKA 8ICNA 3H7IA 4C8OA 2ISPA 3MDCA 4EBCA 4Q8EA 3ZDEA 3M9OB 4GXIA 5DB6A 5HRLA 5J0TA 4F4WA 4NLGA 4YXJA 4YP3A 3HJ4A 1S0MA 4AT9B 4BWMA 3LK9A 8ICLA 4R64A 1NK0A 4JUZA 1UEVA 4YMOA 5J0YA 1SL1A 1XS9D 2W9BA 3EYZA 4EYHB 5HMLA 4XQ8A 4C8LA 4KLQA 3WFPA 2RDJA 2FPLA 2I1QA 4EBDA 2HVIA 2PFNA 1TAUA 1ZQDA 9ICTA 4EBJA 4UB5A 2P6UA 3SYZA 4QZBA 4DQPA 3TFSA 4RNNA 4M9NA 3C21A 4EYIB 4DQQA 1PX5A 2ZUBA 5DG7A 2BCQA 2M2VA 5KFMA 5KFXA 4M9JA 2DR9A 2BE3A 3LDAA 4RT3A 4ECZA 4I2BA 9ICBA 1UT8A 3FDSA 3JPRA 1JIHA 4M9HA 1K1QA 1KSPA 1U9LA 5DLFA 4FBTA 3C1ZA 2ZJAA 2ASJA 5J2DA 4XA5A 4KN4A 1ZJNA 1NO5A 4YVZA 1UT5A 5DDMA 5DB8A 2KZZA 2BDPA 4RQ3A 4KLJA 1VJ7A 3UXNA 4F93B 3MFIA 3MR5A 5HHHA 4F4XA 5D4BA 4KLGA 3UPQA 3HT3A 4CCHA 1QLNA 4J9LA 1KFTA 4LZGA 4KTQA 4BXOB 2PBEA 5CA7A 3RB6A 3OJSA 5KT7A 1WOTA 1UETA 2B21A 4UQGA 1B43A 2BGWA 3OSNA 2NRXA 3RJKA 4KN7A 2ASDA 9ICIA 1R8CA 1HUOA 4KITB 4RWOA 1ZQJA 4IQUA 4RUAA 3MBYA 1TK0A 4YR2A 8ICPA 5J29A 8ICHA 2AGQA 4IRCA 1JQRA 1L3TA 1BPBA 7ICNA 1L3UA 8ICOA 4YMNA 4WC4A 4Z6DA 1H38A 3EPIA 2VA8A 5DQHA 4DOBA 4FO6A 2ZTEA 4ELVA 8ICRA 3B0YA 4YN4A 8ICVA 4EBEA 4DS5A 1X2IA 4DSJA 5L1LA 3G6VA 3JZ0A 3Q8SB 1LB2B 3C2LA 2AJQA 5HC9A 3T5LA 3N4MB 4DQRA 4LZDA 5KFSA 2KP7A 5DBCA 3H4DA 1TK8A 4ECXA 2R8HA 1ZQWA 3QZ8A 3RH6A 3Q8PB 2PFOA 2DVIA 4ZH4A 4GC7A 1BPDA 1L3VA 5KG4A 2IHMA 1PZNA 5KT3A 4RPZA 1KTQA 3OJUA 2XY7A 1XO1A 4F3OA 1S77D 1U47A 4Z6FA 5D49A 3MDAA 4GLXA 2BQ3A 9ICSA 3PW2A 1ZETA 1KDHA 3ZD9A 4K4HA 4TQSA 4NLZA 5KTQA 4PGXA 1F5AA 3V7JA 1ZYQA 3H3AA 4ED6A 5DQGA 5CR0A 4NY8A 3JPNA 8ICGA 4O3OA 3UXOA 4RU9A 2NRZA 3PMNA 8ICZA 4MF8A 1SKWA 1S0VA 4KLIA 4R66A 4DSEA 3V7LA 3C2KA 2HHSA 1MQ2A 1S0OA 5KFIA 4KMUA 3OUYA 5J0QA 4ED8A 4ELUA 5HRDA 4DFJA 3MFHA 4IR9A 1TKDA 4YMMA 2NRKA 1VFGA 1XSPA 4R8UB 1Y88A 3C5FA 3K75D 3KHGA 5DB7A 3RH4A 4JWNA 4M04A 3OVAA 4NM1A 4RWQA 3BQTA 4QWBA 1MIYA 5CB1A 4BGDA 2AGPA 4JV2A 8ICMA 1NK8A 2BCVA 3LQCB 4QZGA 2XGQA 1SL2A 2ID1A 4F92B 5KFPA 4O3PA 1ZQLA 2C2EA 3PVXA 7ICLA 2BKEA 4ECTA 4ED0A 1NKEA 4Q45A 2HHWA 8ICCA 8ICKA 4YFKA 5KG0A 5IIKA 3ZDAA 4F4YA 5IIMA 4B9VA 9ICEA 4GXJA 4ECWA 3RJIA 5KFWA 1U4BA 9ICFA 4F5QA 4B9SA 3JPTA 1NOMA 1S97A 3OV7A 4I2HA 2F1HA 3ETLA 4F91B 2ATLA 4ED7A 3GIJA 2FLNA 4C8KA 4F5OA 3RB3A 7ICVA 2KFNA 1ZQPA 3KHRA 1COOA 2BR0A 1ZQOA 2W8LA 3WFRE 5DG8A 8ICBA 1T3NA 3JPQA 5KFZA 2BCUA 4R65A 3ORYA 2W9CB 3RJFA 5L9XA 9ICMA 9ICWA 4F50A 1KNYA 4X4QA 1HUZA 3Q8MA 5DEDA 1XC9A 1S0NA 4ECVA 5J2FA 4WCWA 5HREA 4BXOA 4PGQA 4DEZA 3LWLA 2BPCA 5KFFA 4RQ5A 1BPXA 2J6UA 5KG1A 4FHWA 4PHPA 4RPYA 5KFNA 4KLTA 4RQ6A 3JPOA 4M0AA 4DFMA 4UB3A 1ZJMA 2IBKA 4MFCA 4K4IA 2UVRA 2HHXA 9ICQA 2C22A 4TUQA 2JEGA 4RZRA 2XGPA 4S3NA 1ZQQA 4M9GA 5KT4A 3GFKB 4J9OA 5L1IA 1NJXA 3OVSA 3KHLA 5KFQA 3JYYA 1TAQA 4UBCA 4QWEA 4P4MA 2ZHBA 2VANA 5J0WA 4TUSA 9ICPA 1SKRA 5J2GA 2IMWP 1KFSA 1JMSA 9ICKA 4J9QA 3H8JA 3RTVA 4PH5A 4NM2A 3MR6A 8ICQA 3M9NB 8ICIA 3AQLA 2RFFA 2DR7A 4KLDA 3H38A 4F8RA 2C28A 2ZH3A 4P4OA 1TFWA 2ZH7A 5DG9A 3G6YA 4ED3A 2UVVA 2UVUA 4B9TA 7ICUA 4C8MA 3PX4A 2JZBA 1MSWD 3RBDA 4DL3A 2HW3A 1X9WA 3SZ2A 2AU0A 3B0XA 1ZQZA 2ZH9A 2AQ0A 3V72A 2FMQA 5EWFA 4TURA 2DPJA 5F9NA 4ELTA 2FLPA 4AT9A 4IG8A 4DFPA 1BNOA 4AT7A 5KFCA 5D46A 5KFEA 4C8NA 1ZQNA 2JZBB 2ZJ8A 2ZH2A 4O5EA 2KZ3A 4O3NA 3AU2A 3TANA 1RYRA 3NYBA 2GWSA 3E2EA 5KFVA 4DL6A 3H37A 3GQCA 5KG3A 4DL7A 1Z00A 3KTQA 3TI0A 1EXNA 3K4GA 5KFDA 2PI5A 1YLQA 2A1JB 1D9DA 2KZMA 2NRVA 5KFKA 2ALZA 4WC7A 7ICPA 1A77A 4JV0A 4F5NA 3IM1A 4R8UA 3HWTA 3T3FA 7ICQA 4WC3A 2FPMA 2ZH5A 1BPEA 3HJ1A 2XC9A 3RH5A 4KLMA 4RNOA 8ICYA 2ZTDA 3PR5B 3AU6A 4WBZA 4I2JA 1NJYA 4FS1A 7ICEA 8ICEA 2RDIA 2BQUA 2V4RA 1D8YA 3RJEA 3TAQA 4QW9A 2IHNA 5DBAA 1A76A 5C5JA 4RNMA 5KFAA 4YR0A 4UAWA 3RRGA 4NKTA 3HX0A 4RPXA 1UEUA 4NXZA 3BDPA 3EZ5A 1T7PA 3TFRA 5EWEA 7ICKA 3PY8A 4YG2A 4KLEA 2Q66A 2KFZA 2O5AA 4ATBA 1Z3EB 5IIJA 3C23A 2W9MA 1SL0A 3OUYB 4ECRA 4F2RA 1ZQUA 4NLNA 3SI8A 3RB4A 2XY5A 3PO5A 3OHBA 4XUSA 2VA2A 3PNCA 2ZUCA 5DDYA 3PX0A 3QZ7A 1TFRA 4UAZA 3AQKA 4FS2A 4UB4A 3RR8A 5F9LA 3ISDA 3PV8A 1NKBA 2AQ4A 2R8JA 5DQIA 3GIIA 4EBKA 1SZPA 3SV3A 2LYHA 3C66A 2NRTA 2ZH8A 1T4GA 4B9NA 2XCPA 4UAYA 4F2SA 1QSLA 1MIWA 2W9BB 3RJHA 4DS4A 4X4UA 1R8BA 1NK7A 3IHQB 1ZQKA 3UQ2A 1NJWA 2MUTA 2XO7A 1D8LA 1Z00B 4K4GA 5KFYA 4QWCA 5J2CA 1TK5A 1D9FA 4WC2A 1DK3A 8ICJA 4Q8FA 4UD5A 4ED1A 4NKUA 3BQ2A 3PW4A 4QZ9A 1ZQFA 2ZH1A 7ICRA 2HHUA 3Q8LA 3ZD8A 4J9MA 2R8GA 4O3QA 9ICCA 5HRFA
chains in the Genus database with same CATH superfamily
7ICOA 2B51A 4CF5A 1NZPA 1QTMA 1BVSA 5KFLA 3UQ0A 3H40A 5CP2A 4IR1A 5HR9A 1S5LU 5HR7A 4O0IA 3ZDDA 4AP9A 1KQQA 2YMPA 2YMMA 1MQ3A 2KHVA 4ECSA 5HRIA 1F0MA 2ZHAA 4WQLA 3TAPA 3G6XA 1L3SA 1XSLA 2OEHA 2Q4TA 3H8WA 2RRDA 3GIMA 3C1YA 1CEZA 2OYYA 3LVVA 4X0AA 1ZQIA 2I6XA 3MR2A 5ALJA 4FHPA 7ICIA 2E1FA 4X4NA 3PO4A 4PPXA 4F5PA 2K4HA 2R8KA 2DRAA 3CNHA 2V4QA 3V6KA 1QSYA 3TARA 2HSZA 2MSNA 3ZDBA 3WFQE 1NKCA 5ALYA 1MC8A 2ZIWB 3FYHA 2W3SA 3NVYA 1FFVA 2O1PA 1S9FA 3QEAZ 5AHXA 2ZUDA 2FCLA 1YZ7A 2H3VA 4QZCA 5HRHA 4J9RA 5EE0A 4IQWA 2M2WA 4MFFA 2ZH6A 5ALMA 3L4PA 1KRPA 3H0LB 1N56A 2KOBA 1WYGA 7ICHA 2WAQC 5K4LA 3L9DA 1J2NA 4B9UA 2GOLA 3M9MB 2H3QA 1JXLA 4O3SA 5DLGA 1V97A 5KT2A 5AK4A 2GAFD 2B6GA 2QB0A 4E7XA 4F4ZA 1OU5A 4J9SA 4I28A 3BQ1A 2NO5A 1LV5A 1L7OA 5D63A 4XRHA 1DGSA 4F5RA 4EX6A 1AQ6A 4QW8A 2JEIA 2FJ6A 4UB2A 4DL5A 4J9PA 2UVWA 4RQ2A 2YMLA 3WK5A 4QZAA 3HPOA 1L8LA 4DWIA 2HI0A 4UB1A 4X4OA 1Q3UA 2AGOA 1J2MA 2WAQF 1X9SA 1SV0A 1C7YA 5D61A 1SGGA 5HR6A 3Q8RB 1ZQSA 1Q79A 3M1YA 1JROA 2KKVA 4QZ8A 3QE9Y 9ICLA 1BPYA 2ZTCA 4E80A 3NRZA 1K1SA 1R89A 3UMGA 1NNLA 5G5HA 4I2CA 2F8LA 2JV3A 1L5UA 3ER9B 1TVAA 5KT6A 4WC5A 4EZ9A 2EDUA 1UA1A 2BZFA 9ICJA 4DOCA 4ECQA 3IG5A 8ICXA 5DBBA 2W8KA 5ALWA 5JUMA 2KNJA 4RQ0A 2F3NA 5KFUA 2NRWA 1QQ6A 4DO9A 1ZQHA 5HHIA 1RYUA 4E8FA 1ZQCA 2W9AA 3RJJA 1HIWA 2HN1A 3F2CA 5AI9A 4DF4A 5IILA 3RB0A 5BOMA 8ICUA 3HW8A 4YD2A 5KG5A 4I29A 3LYSA 1XO0A 1ZQYA 3HJEA 2PXIA 9ICNA 1HEKA 3Q8QB 1FIQA 3HRDD 1MN8A 2NO4A 4CF4A 3GDXA 5KAIU 2GA9D 4P0QA 4F4WA 2GO7A 5J0TA 1O03A 1SXEA 4YXJA 4YP3A 1TE2A 4JUZA 1SL1A 3QU5A 2KG5A 3WFPA 1GO3F 5ALGA 4OJLA 4UB5A 2DL0A 2JR5A 5A0LA 4I2BA 5EE9A 1K1QA 1KSPA 1U9LA 3KOOA 3ER8C 5DLFA 4FBTA 2G5HB 2ASJA 4C7YA 1Q8KA 3MR5A 4F93B 3MFIA 1N5WA 4KLGA 3UPQA 4J9LA 4KTQA 4I0UA 3OJSA 2F2AB 4US9A 1B43A 9ICIA 3SAHA 3OSNA 2ASDA 4KITB 1ZQJA 4IQUA 1TK0A 8ICPA 3KZIU 3SENA 5JTGA 7ICNA 8ICOA 4YMNA 4UASA 2G0AA 3EPIA 2VA8A 4ELVA 2KSOB 3Q8SB 1LB2B 2AJQA 4DQRA 4LZDA 2KP7A 3H4DA 4ECXA 2PFOA 4ICAA 4ZH4A 4GC7A 1L3VA 2IHMA 5AK3A 5KT3A 1KTQA 3SAGA 3OJUA 5KL8B 4Z6FA 2OM6A 3C29A 3ZD9A 4TQSA 2KICA 2DGZA 5KTQA 1IV8A 3UXOA 1SKWA 1S0VA 1B0XA 4KLIA 3V7LA 3C2KA 3OUYA 1VFGA 1F44A 2M0NA 4NLBA 1Y88A 3RH4A 5AM1A 4NM1A 1PVPA 4QWBA 2AGPA 8ICMA 3B9JA 3WU2U 4QZGA 1RG6A 4ECTA 4ED0A 5ALTA 8ICCA 8ICKA 4YFKA 5IIKA 4KB6A 1SWVA 2MRLA 1U4BA 4F5QA 3JPTA 1NOMA 2KJ8A 2ATLA 4C8KA 3RB3A 1ZQPA 1ZQOA 3WFRE 2RQ5A 8ICBA 4RQMA 1T3NA 4R65A 4K98A 9ICMA 5L9XA 9ICWA 4F50A 1KKXA 1S0NA 4WCWA 4DEZA 4RQ5A 2J6UA 4RPYA 5KFNA 3JYYA 3JPOA 4K4IA 2C22A 3NVOA 3AQFA 4M9GA 3KFUF 2W03A 1N62A 5L1IA 5G5GA 1NJXA 1UQVA 4P4MA 2PMZF 2K4EA 2VANA 4TUSA 2IMWP 8ICIA 4NM2A 3M9NB 2C28A 2ZH3A 2ZH7A 3F5AA 3RBDA 4DL3A 2HW3A 1ZQ1C 1FFUA 2ZH9A 3V72A 4Y2VA 1BNOA 4DFPA 5KFEA 1ZQNA 2ZIWA 2H3ZA 4O3NA 5AIAA 3H37A 2G08A 3KTQA 3TI0A 1EXNA 3K4GA 5AI5A 2PI5A 2ALZA 7ICPA 4IL6U 3IM1A 2W11A 4HAIA 1BPEA 3RH5A 4EEKA 2ZTDA 4K9BA 7ICEA 3SMVA 2FI1A 3D2SA 2F77X 3TAQA 4QW9A 5DBAA 4EGWA 5C5JA 3RRGA 4NKTA 2HOQA 2F76X 3BDPA 2HMXA 5KL1B 5EWEA 2O5AA 2E8OA 5CHEA 1ZQUA 3PO5A 3OHBA 4XUSA 2VA2A 3PNCA 3AQKA 4FS2A 4B6JA 3RR8A 3MCRA 5FP0A 2NRTA 2ZH8A 1T4GA 1QSLA 3NRWA 3RJHA 2E8PA 3QUQA 5ALSA 1WUDA 1D9FA 4WC2A 8ICJA 5D62A 3WKBA 3ZD8A 2R8GA 9ICCA 3WK6A 4K99A 4J9KA 1ZQBA 4DL4A 2A1AA 3ISCA 1RXWA 3AQNA 3IV6A 3GV8B 3GV7B 3LWMA 4QIWC 2FDRA 1QQ7A 4BDPA 3T5HA 2HVHA 4K96A 3EF2A 3V7KA 4RUCA 3EWAA 1ZD4A 3HP6A 4B9MA 4WQKA 5AKGA 5KFHA 2ZIUA 1WCLA 1V38A 2WF9A 2J6TA 4KLUA 3V6HA 4MF2A 4Y2JA 5J8YC 4PHAA 2Y1IA 2Q0ZX 1XU4A 4NXXA 3MGHA 1CI4A 5GTIU 2KE7A 4P0PB 5HP4A 5AI0A 2PFQA 2M2TA 4I27A 1QSSA 4QIWF 1ZRMA 1S76D 4O9MA 4OAGA 1ZQEA 5IIIA 4DSLA 3TADC 1X42A 2DR8A 4RT2A 4DSIA 2N1RA 5CHGA 4Z6EA 2KJ5A 2Y0SF 4MFAA 4XJEA 5J8YA 4RWNA 4IQVA 2DFLA 3WK4A 4UD4A 5ALRA 4UB8U 3PW7A 2HHVA 3OSPA 3WKDA 1OUQA 5ALZA 2E8MA 4O3MA 1RQNA 5J0RA 2FMSA 4BWJA 2RLTA 3RRHA 1DK2A 1JI7A 1CUKA 1FEZA 5IIOA 3M8RA 4N7RA 1M6YA 2ZXHA 5DGAA 3UM9A 3EW9A 4WBYA 5ALDA 4TUPA 4LEWA 9ICAA 3MABA 3VCBA 2ZH4A 4AT8B 2EQYA 4J9NA 4G9BA 4YD1A 1ECWA 1U45A 3BQ7A 2WFAA 3BS5B 1XWLA 8ICTA 4M6WA 5KFTA 4ATBB 2OWOA 8ICSA 2YMQA 4RWPA 2QARB 3RBEA 1N63A 1ZQTA 5EWGA 2JXJA 1CRXA 3N97B 4PGYA 2ESEA 4MEYA 1UA0A 2H3IA 5DB9A 3NTUA 2KD1A 5J2KA 3KZXA 5AM3A 5J2IA 3WFSC 2K8BB 1UPHA 4EV6A 2YTUA 4IRDA 2AXTU 4JK1A 3NGDA 2YB4A 1FO4A 4IQTA 5J0UA 1VDVA 4RQ7A 5IINA 4E0DA 4QWAA 7ICSA 4BX9C 2B4VA 5J2AA 1IIPA 3N7RC 5HMMA 1IXRA 5JTIA 1S10A 3HKZF 4M2YA 5J0XA 9ICVA 3OHAA 1UCVA 4USAA 2J6SA 4BUGA 3MDCA 4Q8EA 1YZ6A 4GXIA 5DB6A 2YY6A 4NLGA 4FZMA 4AT9B 3LK9A 2B56A 3NVZA 3WKCA 1UEVA 4YMOA 5J0YA 1XS9D 3BZCA 2W9BA 3EYZA 3KBBA 4XQ8A 4KLQA 2FPLA 2HVIA 2PFNA 3ED5A 1X40A 4RNNA 4EYIB 4DQQA 1PX5A 1S8OA 1L8OA 2EZXA 2DR9A 3LDAA 4ECZA 2D8CA 2ZIXA 2JRZA 3FDSA 3JPRA 2W7PA 4M9HA 3K7DA 3C1ZA 2WHEA 2ZJAA 1UT5A 2KZZA 3RF9A 1KN5A 1T3QA 4KLJA 1VJ7A 3UXNA 5D4BA 5HHHA 1QLNA 4Y2SA 1KFTA 5ALVA 5CA7A 3RB6A 3QU9A 1UETA 4CDGA 2LM4A 3D2QA 3AN1A 2BGWA 4FFDA 4KN7A 2LKYA 4RWOA 4YR2A 1D8BA 2LPEA 1ZXIA 5AIBA 2AGQA 1L3TA 1BPBA 4FE3A 4IC9A 4WC4A 2QB1A 1H38A 5DQHA 2ZTEA 8ICVA 1QQ5A 3ETRA 1X2IA 5L1LA 3G6VA 3JZ0A 3C2LA 5HC9A 5KFSA 3I1YA 1T94A 5EE1A 1PZNA 4F3OA 1XO1A 3QU7A 2DWQA 4F71A 3MDAA 3PW2A 1ZETA 3WKEA 4OAFA 3H3AA 4ED6A 4O69A 1X6IA 3JPNA 8ICGA 4O3OA 2NRZA 3PMNA 2RP5A 2OHFA 4KMUA 2DR7A 4ELUA 3MFHA 2HN2A 2NRKA 5CEHA 1XSPA 4R8UB 3K75D 3KHGA 4F72A 4WH5A 1GPJA 2XVTA 2BCVA 4F92B 7ICLA 4LEYA 1NKEA 2HHWA 9ICEA 4MHVA 3ZDAA 4ECWA 5KFWA 2KIWA 5AK6A 5ALFA 1S97A 4F5OA 2BR0A 1COOA 5DG8A 3S6JA 3K1ZA 4ACOA 3RJFA 3F53A 4NXUA 2LYAA 2E8NA 3HILA 1KNYA 4X4QA 1XC9A 2KVCA 5J2FA 3LWLA 2BPCA 5KFFA 1BPXA 4FHWA 4PHPA 4RQ6A 4MFCA 1SB3C 3BZKA 4DFMA 1ZJMA 2OH2A 2XGPA 4S3NA 4LEVA 1ZQQA 3WK7A 5KT4A 3GFKB 2BBJA 3N7PD 5KFQA 4QWEA 3GU3A 2ZHBA 5J2GA 8ICQA 4PH5A 1JALA 4KLDA 1TFWA 4P4OA 3G6YA 4ED3A 7ICUA 3M7DA 2JZBA 1MSWD 3WK9A 1Z4NA 4QJFB 2XICA 3SZ2A 2VJ4A 1X9WA 3B0XA 1KL9A 1ZQZA 2AQ0A 4GFJA 2DPJA 4ELTA 1N2XA 2D3DA 4DCCA 4AT9A 2DKZA 5D46A 4C8NA 1VLBA 3NYBA 3AU2A 5AM5A 2ZIUB 3K1RB 3N7SC 5KG3A 4DL7A 1X6JA 2EAMA 5KFDA 2A1JB 4OJ5A 4WC7A 4F5NA 7ICQA 3HWTA 4UATA 3HJ1A 2XC9A 4PL2A 4RNOA 1NJYA 5ALPA 2V4RA 1KBUA 3QUTA 3F2DA 4KMOB 2IHNA 1A76A 2B0CA 4RNMA 4YR0A 3H0RB 1TAMA 4RPXA 3DV9A 3TADA 3TFRA 2Q66A 4YG2A 4KLEA 4ATBA 3C23A 2W9MA 1SL0A 2XY5A 2ZUCA 3PX0A 3QZ7A 4UAZA 4UB4A 5T14A 2DBYA 5F9LA 3ISDA 1NKBA 4EBKA 3D2NA 5AKHA 2HCFA 3ONNA 2I5HA 1NK7A 1ZQKA 4QWCA 5J2CA 1TK5A 1DK3A 5AKJA 4QZ9A 3D6JA 4NLKA 3EUB2 5EE3A 4IS7A 1WCNA 4OCZA 5AKKA 4AYBF 3C2MA 4WC1A 1ZQRA 5ALEA 2HHTA 4O67A 2F1IA 1RXVA 4U6PA 3QU4A 4EZ6A 2G07A 1LKYB 3RAQA 4I2AA 1JN3A 1ZQMA 4C4TA 4RQ4A 4ECYA 2FMPA 4KX3A 2DR5A 4YXMA 2HHPA 4QNLA 4WC6A 1KEJA 3F5EA 4I2IA 3MGVA 4PJ0U 2VA3A 4FHXA 2LI6A 4RQ1A 3KHHA 4IRKA 4B9LA 3FC4A 7ICJA 3NVVA 2BCSA 5L1JA 4I2GA 1U48A 4DSFA 4UAUA 2HOIA 4OAIZ 1R8AA 1NJZA 9ICXA 5B66U 4NXTA 4DLEA 4AT7B 1AROP 5AKXA 4X5VA 3EPGA 2JH7A 4KLHA 2BQRA 1X9XA 5J0SA 4KLOA 3T5KA 4DFDA 2PMZC 7ICFA 5J2BA 3RFAA 1RDFA 5J0PA 2ZG6A 3OGUA 2Y9TA 5CFSA 4K9AA 5J0OA 2FPKA 4QZFA 3F2BA 3THVA 4AT8A 2W54A 4FHVA 4P0PA 5KAFU 2XCAA 4M9LA 3OVBA 1KLNA 1IG6A 2EH9A 3AQMA 1SKSA 4I2DA 2K8AA 2L5YA 4M47A 5DGBA 2MAXA 2IHOA 5AI6A 5L1KA 4EP7A 3CW2C 2P6RA 3SEIA 2F8KA 4Y2QA 2JEFA 5KG2A 3MGIA 4R63A 4X4PA 1ZQGA 4CGZA 3UMCA 8ICWA 1Z19A 1ZQAA 4A8EA 4HYKA 3BQ0A 1IM4A 1ZQXA 1JX4A 3IP4B 5HNKA 3T5JA 1NK9A 1MA7A 3RR7A 4ECUA 3PW5A 3AL0B 2BHNA 4X4SA 5HRKA 2G06A 7ICGA 3QUBA 4KLFA 4HX0A 2MUTB 2WF5A 2R8IA 2C2DA 4O5CA 2DRBA 1DOQA 2R18A 1RZTA 4KLSA 3Q8KA 4FBUA 9ICOA 2F1JA 5GTHU 4Z6CA 1X9MA 2BPGA 1BGXT 3R9KA 5KT5A 4MKPA 4Y2RA 4Y2YA 3PZPA 2JMGA 2P66A 8ICFA 3IN5A 4OJOA 5ALXA 3SQIA 1RYSA 4QZDA 4K97A 1C20A 1B4FA 9ICGA 2HHQA 4UBBA 4FZLA 3ISBA 1HJPA 3C18A 4DOAA 5AKZA 4I2FA 3PMLA 1Z1BA 4KLLA 3GV5B 1DXSA 1ZRNA 1NK5A 4YCXA 4O5KA 1V9PA 3M6KA 1RPLA 5AKYA 5CJ7A 4F4KA 4DQIA 4BJQA 5AI4A 3MR3A 4FHYA 3H8SA 8ICAA 2W9CA 1T8EA 3QEBZ 2V9WA 2H5XA 2RFFA 3C5GA 9ICRA 4LT6A 5KFOA 4G3IA 7ICTA 2IOHA 4YR3A 2KMDA 4QZIA 2ZJ5A 4PZNA 2QARA 3AUOA 1BNPA 3AM9A 3PSPA 2Y9UA 3H7IA 5HRLA 1ZD2P 3HJ4A 1S0MA 4R64A 1NK0A 1QCKA 5HMLA 2K4PA 2KJ9A 4C7ZA 4LEZA 4CNQA 2HBJA 2P35A 1ZQDA 2EZYA 3SYZA 4DQPA 4M9NA 2ZUBA 5DG7A 2QKQA 4M9JA 4RT3A 2QLTA 5ALNA 1Z4OA 1L7MA 1JIHA 2OXOA 4EELA 4KX5A 1NO5A 5J2DA 4KN4A 1ZJNA 4F4XA 1L7NA 5TISU 4CCHA 4LZGA 2PBEA 5ALIA 5B5EU 1WOTA 4C0ZA 2B21A 2G5IB 3RJKA 1R8CA 1ED1A 1HUOA 3UMBA 3BS5A 4RUAA 5J29A 1L3UA 3SD7A 4Z6DA 4DOBA 4FO6A 8ICRA 3B0YA 4YN4A 2KIVA 3CYMA 3FAHA 4DSJA 5ALKA 3T5LA 5AM4A 3N4MB 3FM9A 5DBCA 1N60A 3RH6A 3QZ8A 3Q8PB 2DVIA 1BPDA 5KG4A 2XY7A 4RPZA 1S77D 1P7DA 4M5DA 1U47A 2BQ3A 1KDHA 4NLZA 3V7JA 1ZYQA 5DQGA 5F3XB 4MF8A 4DSEA 2HHSA 1MQ2A 1S0OA 5J0QA 4ED8A 5HRDA 4IR9A 4YMMA 4M04A 3OVAA 5AK5A 1MIYA 5CB1A 5AKIA 4BGDA 5JU5A 3J81j 4JV2A 1NK8A 2ID1A 1RM6C 4LJXA 5KFPA 2C2EA 2BKEA 4Q45A 2IOFK 5KG0A 4F4YA 1LVHA 3RJIA 1A6SA 4OJ6A 3ZI4A 4NXWA 2D6FC 4I2HA 2F1HA 3ETLA 3N28A 4F91B 4ED7A 2FLNA 2JH1A 7ICVA 4JMUA 3KKAA 2KFNA 3KHRA 2KHQA 2W8LA 3JPQA 2BCUA 3ORYA 2W9CB 5ALLA 1X66A 1HUZA 3Q8MA 5DEDA 4BXOA 4WJ3B 5KG1A 2IBKA 2EAPA 2UVRA 5KNIA 2JEGA 4NL9A 4GIBA 1Q46A 3KHLA 1TAQA 5J0WA 9ICPA 1SKRA 9ICKA 3H8JA 3MR6A 3I76A 1SV0C 3H38A 2VKQA 4F8RA 4P0QB 5DG9A 3L3FX 5H2FU 2UVVA 3DDHA 4B9TA 3PX4A 4UW9A 3LVWA 2AU0A 5JRTA 2FMQA 3A0HU 5EWFA 4TURA 5F9NA 2A3VA 5AICA 5KFCA 2JZBB 1L7PA 2ZH2A 4O5EA 2KZ3A 2KVSA 2LBOA 5L1MA 2WF8A 2DQNB 2VJ5A 3GQCA 4JLXA 1O08A 2NRVA 2AHOB 1A77A 4JV0A 5CRXA 2ZH5A 3L5KA 4US8A 4KLMA 8ICYA 3ALRA 8ICEA 2RDIA 1D8YA 2KEYA 5KFAA 4UAWA 3HX0A 2E5SA 4PZOA 3EZ5A 1T7PA 2LHTA 3OUYB 2YQEA 4F2RA 5DDYA 1TFRA 1Z1VA 2E1EA 2R8JA 2EZZA 2LYHA 3VC8A 4B9NA 4F2SA 1R8BA 3IHQB 2IUBA 2W55A 3PW4A 3Q8LA 4J9MA 4O3QA 5HRFA 1NZBA 3QUCA 2WF7A 2ISOA 3NVWA 1XNSA 1JXEA 5KG6A 3IDWA 1ZOLA 1U49A 1PK1B 2PKEA 2G09A 3SV4A 4X4RA 3GILA 4O6AA 4Q43A 5DECA 1MIVA 2VIXA 3CP8A 3GIKA 4PHEA 9ICHA 3TACB 4QZEA 5EOZA 5HRGA 2HBMA 3ICXA 2C2RA 3BJYA 2I9GA 5J2HA 2MU2A 3PSTA 4YQWA 3M8SA 1TV9A 4TQRA 2F44A 4NLCA 4M6WB 3PW0A 4LVSA 5BPCA 1COKA 4JV1A 2BCRA 4OJPA 3T79A 4C4RA 2HBLA 4DSKA 2KTQA 1PVQA 2JEJA 3QXGA 5KFRA 4GC6A 2WB1C 3NASA 1PUZA 2CN1A 1F5SA 2FLLA 2E3TA 4UAVA 4KM5A 3PSFA 3V6JA 3TQ1A 3QU2A 3OWGA 2Y1JA 4EENA 5CFUA 4X4TA 4X0BA 2PFPA 1A0PA 2K60A 1ZQVA 4X4VA 2KN7A 4WC0A 9ICUA 2BPFA 2ASLA 1SXDA 5F2VO 4I2EA 2NV3A 4XQ7A 4PHDA 1OXJA 1NK6A 2GLEA 2KK0A 4DFKA 3UPSA 3JPPA 5KFJA 1J97A 1JAJA 3QNMA 3PR4A 3H4BA 1UHUA 1JUDA 1FA0A 2WB1F 4P2HA 2BDUA 5HRBA 5J2JA 5J2EA 5B3QA 7ICMA 5KFBA 3PX6A 1RQLA 3AQEA 3RAXA 2A1JA 3DEEA 2DPIA 2JHDA 2M9NA 2W3RA 4ED2A 2Y0SC 4U7CA 4MEXA 2CXYA 4FH5A 1V85A 4NV0A 4O3RA 5DKWA 3H39A 2CRXA 3RJGA 1K5OA 5TZVA 4QWDA 1KFDA 1N48A 4EEYA 4Y2UA 4P4PA 1Q78A 1WWVA 4DL2A 5AI8A 4GXKA 2HBKA 3IRUA 1PK3A 3GZFA 1B22A 2IA6A 3H0MB 5KG7A 5E79U 4Y2PA 4QZHA 5KFGA 5BOLA 1V4AA 3JPSA 3HIYA 4JWMA 2H3FA 2M2UA 4DF8A 1SZHA 1NK4A 1BPZA 2XY6A 5ALOA 2PI4A 1TFYA 5B3PA 2WTFA 3E0FA 4CF3A 4DQSA 3UXPA 1DGJA 1SWWA 3NKUA 4FH3A 2A19A 3WFOA 4DLGA 4RQ8A 4CE6A 3ZDCA 4JB3A 5CWRA 4Q44A 1XSNA 4OO1J 8ICNA 4C8OA 2ISPA 4EBCA 3M9OB 3ZDEA 2RHFA 3AEVA 1JRPA 2EANA 4BWMA 2K89A 8ICLA 4NXVA 2OCEA 4EYHB 4Y2XA 4C8LA 2RDJA 3PHZA 2I1QA 3I28A 4EBDA 1TAUA 9ICTA 4EBJA 2P6UA 4QZBA 3TFSA 5CFTA 4WOYA 3SR6A 3C21A 3NWIA 3TKAA 2M2VA 2BCQA 5KFMA 5KFXA 2BE3A 3E58A 4NWIA 4FO1A 2ZIXB 9ICBA 1UT8A 2JGAA 3QX7A 4XA5A 4YVZA 2DF4B 4NL9C 5DDMA 5DB8A 2BDPA 4RQ3A 3NUQA 3HT3A 2DKXA 1WWUA 4BXOB 5KT7A 3MC1A 5AM0A 3BS7A 4UQGA 2Z7JA 1PK1A 2NRXA 3MBYA 8ICHA 4C80A 4IRCA 1JQRA 1KW4A 3KKAC 2K4IA 2W43A 1VJ5A 2WF6A 4EBEA 2QB0B 4DS5A 2EWRA 4EEDA 2ES6A 1TK8A 3OPXA 2R8HA 1ZQWA 3WKAA 1WG8A 2KV2A 5D49A 1ZD5A 3IG8A 2HOFA 4GLXA 9ICSA 2YX8A 4K4HA 4PGXA 1F5AA 4K8VA 2ODGA 5CR0A 4NY8A 4RU9A 8ICZA 2ZIVB 4R66A 5KFIA 4DFJA 1TKDA 4JLZA 5AM2A 3C5FA 3KD3A 5DB7A 4JWNA 4RWQA 3BQTA 4Y2TA 2EAOA 2ZIVA 3LQCB 2XGQA 2LM1A 1SL2A 1ZQLA 4O3PA 3PVXA 4J03A 2KKPA 5IIMA 4B9VA 3JCFA 4GXJA 2IOFA 9ICFA 4B9SA 1N5XA 3OV7A 3M6ZA 3GIJA 2NYVA 2CPRA 2K8CB 2HDOA 4RQNA 5KFZA 2DUYA 4UARA 4ECVA 5HREA 4PGQA 4KLTA 4M0AA 4UB3A 3CRXA 2HHXA 9ICQA 4TUQA 5C0YA 3QYPA 4RZRA 2W04A 2W7OA 4J9OA 3OVSA 5ALQA 4UBCA 4PL1A 5ALUA 1JMSA 1KFSA 4J9QA 3RTVA 3H8MA 3AQLA 3SAFA 4UB6U 3U26A 1QH9A 4OD0A 2FE9A 2LYBA 3HKZC 2O6KA 4CRXA 2UVUA 4C8MA 1SV4A 1NI3A 1DRGA 1PVRA 2AH5A 3C28A 2FLPA 4IG8A 4AT7A 4C4SA 2ZJ8A 2XI9A 3TANA 1SIJA 1RYRA 2GWSA 2KSOA 3E2EA 5KFVA 4DL6A 3NS1A 3A0BU 3CK6A 3O0FA 1Z00A 5AKLA 1Q3VA 2ZXIA 3OTQA 1YLQA 1D9DA 2KZMA 5KFKA 4EEBA 4R8UA 3T3FA 4WC3A 2GH1A 2FPMA 3PR5B 3AU6A 4WBZA 4I2JA 4FS1A 3AMZA 2BQUA 1OW5A 3RJEA 4OAHA 1UEUA 4NXZA 3ERCC 5AKEA 1URJA 1N61A 5ALHA 7ICKA 4AYBC 3PY8A 2KFZA 1Z3EB 2MA1A 5IIJA 1LKYA 4ECRA 2BBHA 4NLNA 3WK8A 1YT3A 3SI8A 3RB4A 4EX7A 1L6NA 2YN4A 3PV8A 2AQ4A 5DQIA 3GIIA 1SZPA 3SV3A 3C66A 2XIDA 2XCPA 4ZOHC 4UAYA 1MIWA 2W9BB 4DS4A 4X4UA 3UQ2A 1NJWA 2MUTA 2XO7A 1D8LA 1Z00B 4K4GA 4NJ8A 3PSIA 5KFYA 2YB1A 2LMRA 4FZNA 4O68A 4Q8FA 4UD5A 4ED1A 4NKUA 3BQ2A 1ZQFA 2ZH1A 7ICRA 2HHUA 1ZD3A
chains in the Genus database with same CATH topology
7ICOA 1WCNA 1NZPA 4J9KA 1QTMA 1ZQBA 1BVSA 5KFLA 3C2MA 3H40A 5CP2A 3UQ0A 4DL4A 4IR1A 1ZQRA 2ISOA 4O0IA 2HHTA 4WC1A 2F1IA 3ZDDA 1RXVA 1JXEA 3ISCA 1RXWA 5KG6A 3AQNA 4EZ6A 1MQ3A 4ECSA 3RAQA 4I2AA 1U49A 5HRIA 2ZHAA 1JN3A 1ZQMA 3TAPA 3SV4A 3G6XA 1L3SA 4RQ4A 1XSLA 3GV8B 4ECYA 3GV7B 3LWMA 2FMPA 4X4RA 3GILA 4Q43A 4BDPA 5DECA 1MIVA 2DR5A 3T5HA 4YXMA 2HVHA 2HHPA 3GIKA 4PHEA 3H8WA 3V7KA 4RUCA 3GIMA 4WC6A 1KEJA 9ICHA 4QZEA 3C1YA 3EWAA 5EOZA 5HRGA 3HP6A 1CEZA 4I2IA 4B9MA 2VA3A 4X0AA 1ZQIA 4FHXA 5KFHA 2C2RA 3BJYA 3MR2A 4RQ1A 3KHHA 5J2HA 2I9GA 4YQWA 3M8SA 4B9LA 4IRKA 7ICIA 2BCSA 1TV9A 4TQRA 7ICJA 4FHPA 5L1JA 4I2GA 1U48A 4X4NA 4DSFA 4M6WB 3PO4A 3PW0A 4LVSA 1WCLA 4PPXA 4F5PA 5BPCA 1R8AA 1NJZA 2J6TA 4KLUA 9ICXA 3V6HA 4DLEA 2R8KA 4AT7B 4MF2A 2DRAA 1AROP 4JV1A 4X5VA 2V4QA 3V6KA 2BCRA 3EPGA 4DSKA 1QSYA 2KTQA 3TARA 4PHAA 4KLHA 2Y1IA 2BQRA 2Q0ZX 2JEJA 5J0SA 1XU4A 4KLOA 3ZDBA 3T5KA 5KFRA 4GC6A 3WFQE 3MGHA 1NKCA 7ICFA 5J2BA 2FLLA 1MC8A 3FYHA 5J0PA 5HP4A 3OGUA 3V6JA 2O1PA 1S9FA 2PFQA 2M2TA 3TQ1A 5J0OA 3QEAZ 2FPKA 4I27A 4QZFA 2Y1JA 1QSSA 2ZUDA 4X4TA 4QZCA 3THVA 5HRHA 4AT8A 4J9RA 2PFPA 4IQWA 1S76D 4X0BA 4O9MA 2M2WA 4FHVA 1ZQVA 2XCAA 4MFFA 1ZQEA 2KN7A 4M9LA 2ZH6A 5IIIA 4WC0A 3OVBA 1KLNA 4DSLA 1KRPA 9ICUA 2BPFA 1N56A 2ASLA 2DR8A 4RT2A 3AQMA 4DSIA 5F2VO 1SKSA 5CHGA 4I2DA 4I2EA 7ICHA 4Z6EA 4XQ7A 4PHDA 4M47A 5DGBA 2MAXA 4MFAA 1NK6A 3L9DA 5L1KA 4EP7A 4B9UA 4DFKA 3UPSA 3M9MB 4RWNA 4IQVA 2P6RA 3JPPA 5KFJA 1JXLA 4O3SA 5DLGA 2DFLA 4UD4A 2JEFA 5KG2A 3MGIA 5KT2A 4R63A 3PR4A 1JAJA 1ZQGA 4X4PA 3PW7A 8ICWA 4E7XA 4F4ZA 3H4BA 2HHVA 3OSPA 1OU5A 4J9SA 4I28A 1FA0A 1ZQAA 3BQ1A 4P2HA 1LV5A 4HYKA 5J0RA 4XRHA 3BQ0A 2FMSA 5HRBA 1DGSA 1IM4A 5J2JA 4F5RA 4BWJA 1ZQXA 1JX4A 5J2EA 3RRHA 1DK2A 4QW8A 7ICMA 1CUKA 5HNKA 5KFBA 3PX6A 2JEIA 4UB2A 3T5JA 5IIOA 4J9PA 4DL5A 3M8RA 1NK9A 3RAXA 3RR7A 4ECUA 3PW5A 2UVWA 2A1JA 2BHNA 4RQ2A 5HRKA 4X4SA 5DGAA 7ICGA 3EW9A 2DPIA 4KLFA 4QZAA 3HPOA 4WBYA 4DWIA 2M9NA 4ED2A 2MUTB 4UB1A 2R8IA 4TUPA 2C2DA 9ICAA 4MEXA 3MABA 4X4OA 4O5CA 4FH5A 2ZH4A 4O3RA 2DRBA 1DOQA 2AGOA 5DKWA 3H39A 4AT8B 1X9SA 1RZTA 4KLSA 3RJGA 3Q8KA 1C7YA 4J9NA 4FBUA 5TZVA 4QWDA 9ICOA 3Q8RB 1KFDA 1ZQSA 1N48A 4EEYA 2F1JA 1Q79A 4Z6CA 1X9MA 2BPGA 1BGXT 4P4PA 4QZ8A 3QE9Y 5KT5A 4YD1A 9ICLA 1Q78A 1U45A 1BPYA 2ZTCA 4DL2A 4E80A 1XWLA 8ICTA 2P66A 8ICFA 4M6WA 5HR9A 5KFTA 1K1SA 4ATBB 2OWOA 4GXKA 8ICSA 1R89A 1RYSA 4I2CA 4RWPA 4QZDA 3RBEA 1L5UA 1TVAA 5KT6A 9ICGA 1ZQTA 4EZ9A 5EWGA 1B22A 2IA6A 2HHQA 4UBBA 4WC5A 3C18A 3ISBA 1HJPA 3N97B 1UA1A 9ICJA 4DOAA 4I2FA 4PGYA 5KG7A 4DOCA 3PMLA 4MEYA 1UA0A 4ECQA 4X4VA 8ICXA 5DBBA 5KFGA 5BOLA 5DB9A 5JUMA 4QZHA 2W8KA 1V4AA 4KLLA 4M5DA 3GV5B 4RQ0A 3NTUA 1NK5A 4O5KA 4YCXA 3JPSA 3HIYA 5J2KA 4JWMA 5KFUA 2M2UA 1V9PA 2NRWA 5J2IA 1RPLA 4DO9A 4DF8A 5CJ7A 1ZQHA 4F4KA 5HHIA 4DQIA 3WFSC 4E8FA 4IRDA 1ZQCA 3MR3A 4JK1A 4FHYA 2W9AA 1NK4A 3RJJA 3H8SA 3NGDA 4IQTA 8ICAA 5J0UA 4RQ7A 2W9CA 5IINA 4DF4A 1T8EA 1BPZA 4E0DA 2XY6A 3QEBZ 4QWAA 5IILA 2PI4A 3RB0A 5BOMA 8ICUA 7ICSA 1TFYA 2V9WA 2H5XA 3HW8A 2WTFA 5J2AA 4YD2A 5KG5A 5HMMA 4I29A 1S10A 1IXRA 3C5GA 4DQSA 5KFOA 3UXPA 9ICRA 4G3IA 4LT6A 1ZQYA 4FH3A 4M2YA 7ICTA 3WFOA 5J0XA 9ICVA 2PXIA 4DLGA 4YR3A 9ICNA 4QZIA 4RQ8A 2ZJ5A 3Q8QB 3OHAA 3ZDCA 3AUOA 5CWRA 4Q44A 1BNPA 3GDXA 1XSNA 2J6SA 4NLKA 8ICNA 3H7IA 4C8OA 2ISPA 3MDCA 4EBCA 4Q8EA 3ZDEA 3M9OB 4GXIA 5DB6A 5HRLA 5J0TA 4F4WA 4NLGA 4YXJA 4YP3A 3HJ4A 1S0MA 4AT9B 4BWMA 3LK9A 8ICLA 4R64A 1NK0A 4JUZA 1UEVA 4YMOA 5J0YA 1SL1A 1XS9D 2W9BA 3EYZA 4EYHB 5HMLA 4XQ8A 4C8LA 4KLQA 3WFPA 2RDJA 2FPLA 2I1QA 4EBDA 2HVIA 2PFNA 1TAUA 1ZQDA 9ICTA 4EBJA 4UB5A 2P6UA 3SYZA 4QZBA 4DQPA 3TFSA 4RNNA 4M9NA 3C21A 4EYIB 4DQQA 1PX5A 2ZUBA 5DG7A 2BCQA 2M2VA 5KFMA 5KFXA 4M9JA 2DR9A 2BE3A 3LDAA 4RT3A 4ECZA 4I2BA 9ICBA 1UT8A 3FDSA 3JPRA 1JIHA 4M9HA 1K1QA 1KSPA 1U9LA 5DLFA 4FBTA 3C1ZA 2ZJAA 2ASJA 5J2DA 4XA5A 4KN4A 1ZJNA 1NO5A 4YVZA 1UT5A 5DDMA 5DB8A 2KZZA 2BDPA 4RQ3A 4KLJA 1VJ7A 3UXNA 4F93B 3MFIA 3MR5A 5HHHA 4F4XA 5D4BA 4KLGA 3UPQA 3HT3A 4CCHA 1QLNA 4J9LA 1KFTA 4LZGA 4KTQA 4BXOB 2PBEA 5CA7A 3RB6A 3OJSA 5KT7A 1WOTA 1UETA 2B21A 4UQGA 1B43A 2BGWA 3OSNA 2NRXA 3RJKA 4KN7A 2ASDA 9ICIA 1R8CA 1HUOA 4KITB 4RWOA 1ZQJA 4IQUA 4RUAA 3MBYA 1TK0A 4YR2A 8ICPA 5J29A 8ICHA 2AGQA 4IRCA 1JQRA 1L3TA 1BPBA 7ICNA 1L3UA 8ICOA 4YMNA 4WC4A 4Z6DA 1H38A 3EPIA 2VA8A 5DQHA 4DOBA 4FO6A 2ZTEA 4ELVA 8ICRA 3B0YA 4YN4A 8ICVA 4EBEA 4DS5A 1X2IA 4DSJA 5L1LA 3G6VA 3JZ0A 3Q8SB 1LB2B 3C2LA 2AJQA 5HC9A 3T5LA 3N4MB 4DQRA 4LZDA 5KFSA 2KP7A 5DBCA 3H4DA 1TK8A 4ECXA 2R8HA 1ZQWA 3QZ8A 3RH6A 3Q8PB 2PFOA 2DVIA 4ZH4A 4GC7A 1BPDA 1L3VA 5KG4A 2IHMA 1PZNA 5KT3A 4RPZA 1KTQA 3OJUA 2XY7A 1XO1A 4F3OA 1S77D 1U47A 4Z6FA 5D49A 3MDAA 4GLXA 2BQ3A 9ICSA 3PW2A 1ZETA 1KDHA 3ZD9A 4K4HA 4TQSA 4NLZA 5KTQA 4PGXA 1F5AA 3V7JA 1ZYQA 3H3AA 4ED6A 5DQGA 5CR0A 4NY8A 3JPNA 8ICGA 4O3OA 3UXOA 4RU9A 2NRZA 3PMNA 8ICZA 4MF8A 1SKWA 1S0VA 4KLIA 4R66A 4DSEA 3V7LA 3C2KA 2HHSA 1MQ2A 1S0OA 5KFIA 4KMUA 3OUYA 5J0QA 4ED8A 4ELUA 5HRDA 4DFJA 3MFHA 4IR9A 1TKDA 4YMMA 2NRKA 1VFGA 1XSPA 4R8UB 1Y88A 3C5FA 3K75D 3KHGA 5DB7A 3RH4A 4JWNA 4M04A 3OVAA 4NM1A 4RWQA 3BQTA 4QWBA 1MIYA 5CB1A 4BGDA 2AGPA 4JV2A 8ICMA 1NK8A 2BCVA 3LQCB 4QZGA 2XGQA 1SL2A 2ID1A 4F92B 5KFPA 4O3PA 1ZQLA 2C2EA 3PVXA 7ICLA 2BKEA 4ECTA 4ED0A 1NKEA 4Q45A 2HHWA 8ICCA 8ICKA 4YFKA 5KG0A 5IIKA 3ZDAA 4F4YA 5IIMA 4B9VA 9ICEA 4GXJA 4ECWA 3RJIA 5KFWA 1U4BA 9ICFA 4F5QA 4B9SA 3JPTA 1NOMA 1S97A 3OV7A 4I2HA 2F1HA 3ETLA 4F91B 2ATLA 4ED7A 3GIJA 2FLNA 4C8KA 4F5OA 3RB3A 7ICVA 2KFNA 1ZQPA 3KHRA 1COOA 2BR0A 1ZQOA 2W8LA 3WFRE 5DG8A 8ICBA 1T3NA 3JPQA 5KFZA 2BCUA 4R65A 3ORYA 2W9CB 3RJFA 5L9XA 9ICMA 9ICWA 4F50A 1KNYA 4X4QA 1HUZA 3Q8MA 5DEDA 1XC9A 1S0NA 4ECVA 5J2FA 4WCWA 5HREA 4BXOA 4PGQA 4DEZA 3LWLA 2BPCA 5KFFA 4RQ5A 1BPXA 2J6UA 5KG1A 4FHWA 4PHPA 4RPYA 5KFNA 4KLTA 4RQ6A 3JPOA 4M0AA 4DFMA 4UB3A 1ZJMA 2IBKA 4MFCA 4K4IA 2UVRA 2HHXA 9ICQA 2C22A 4TUQA 2JEGA 4RZRA 2XGPA 4S3NA 1ZQQA 4M9GA 5KT4A 3GFKB 4J9OA 5L1IA 1NJXA 3OVSA 3KHLA 5KFQA 3JYYA 1TAQA 4UBCA 4QWEA 4P4MA 2ZHBA 2VANA 5J0WA 4TUSA 9ICPA 1SKRA 5J2GA 2IMWP 1KFSA 1JMSA 9ICKA 4J9QA 3H8JA 3RTVA 4PH5A 4NM2A 3MR6A 8ICQA 3M9NB 8ICIA 3AQLA 2RFFA 2DR7A 4KLDA 3H38A 4F8RA 2C28A 2ZH3A 4P4OA 1TFWA 2ZH7A 5DG9A 3G6YA 4ED3A 2UVVA 2UVUA 4B9TA 7ICUA 4C8MA 3PX4A 2JZBA 1MSWD 3RBDA 4DL3A 2HW3A 1X9WA 3SZ2A 2AU0A 3B0XA 1ZQZA 2ZH9A 2AQ0A 3V72A 2FMQA 5EWFA 4TURA 2DPJA 5F9NA 4ELTA 2FLPA 4AT9A 4IG8A 4DFPA 1BNOA 4AT7A 5KFCA 5D46A 5KFEA 4C8NA 1ZQNA 2JZBB 2ZJ8A 2ZH2A 4O5EA 2KZ3A 4O3NA 3AU2A 3TANA 1RYRA 3NYBA 2GWSA 3E2EA 5KFVA 4DL6A 3H37A 3GQCA 5KG3A 4DL7A 1Z00A 3KTQA 3TI0A 1EXNA 3K4GA 5KFDA 2PI5A 1YLQA 2A1JB 1D9DA 2KZMA 2NRVA 5KFKA 2ALZA 4WC7A 7ICPA 1A77A 4JV0A 4F5NA 3IM1A 4R8UA 3HWTA 3T3FA 7ICQA 4WC3A 2FPMA 2ZH5A 1BPEA 3HJ1A 2XC9A 3RH5A 4KLMA 4RNOA 8ICYA 2ZTDA 3PR5B 3AU6A 4WBZA 4I2JA 1NJYA 4FS1A 7ICEA 8ICEA 2RDIA 2BQUA 2V4RA 1D8YA 3RJEA 3TAQA 4QW9A 2IHNA 5DBAA 1A76A 5C5JA 4RNMA 5KFAA 4YR0A 4UAWA 3RRGA 4NKTA 3HX0A 4RPXA 1UEUA 4NXZA 3BDPA 3EZ5A 1T7PA 3TFRA 5EWEA 7ICKA 3PY8A 4YG2A 4KLEA 2Q66A 2KFZA 2O5AA 4ATBA 1Z3EB 5IIJA 3C23A 2W9MA 1SL0A 3OUYB 4ECRA 4F2RA 1ZQUA 4NLNA 3SI8A 3RB4A 2XY5A 3PO5A 3OHBA 4XUSA 2VA2A 3PNCA 2ZUCA 5DDYA 3PX0A 3QZ7A 1TFRA 4UAZA 3AQKA 4FS2A 4UB4A 3RR8A 5F9LA 3ISDA 3PV8A 1NKBA 2AQ4A 2R8JA 5DQIA 3GIIA 4EBKA 1SZPA 3SV3A 2LYHA 3C66A 2NRTA 2ZH8A 1T4GA 4B9NA 2XCPA 4UAYA 4F2SA 1QSLA 1MIWA 2W9BB 3RJHA 4DS4A 4X4UA 1R8BA 1NK7A 3IHQB 1ZQKA 3UQ2A 1NJWA 2MUTA 2XO7A 1D8LA 1Z00B 4K4GA 5KFYA 4QWCA 5J2CA 1TK5A 1D9FA 4WC2A 1DK3A 8ICJA 4Q8FA 4UD5A 4ED1A 4NKUA 3BQ2A 3PW4A 4QZ9A 1ZQFA 2ZH1A 7ICRA 2HHUA 3Q8LA 3ZD8A 4J9MA 2R8GA 4O3QA 9ICCA 5HRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICO A;  1WCN A;  1NZP A;  4J9K A;  1QTM A;  1ZQB A;  1BVS A;  5KFL A;  3C2M A;  3H40 A;  5CP2 A;  3UQ0 A;  4DL4 A;  4IR1 A;  1ZQR A;  2ISO A;  4O0I A;  2HHT A;  4WC1 A;  2F1I A;  3ZDD A;  1RXV A;  1JXE A;  3ISC A;  1RXW A;  5KG6 A;  3AQN A;  4EZ6 A;  1MQ3 A;  4ECS A;  3RAQ A;  4I2A A;  1U49 A;  5HRI A;  2ZHA A;  1JN3 A;  1ZQM A;  3TAP A;  3SV4 A;  3G6X A;  1L3S A;  4RQ4 A;  1XSL A;  3GV8 B;  4ECY A;  3GV7 B;  3LWM A;  2FMP A;  4X4R A;  3GIL A;  4Q43 A;  4BDP A;  5DEC A;  1MIV A;  2DR5 A;  3T5H A;  4YXM A;  2HVH A;  2HHP A;  3GIK A;  4PHE A;  3H8W A;  3V7K A;  4RUC A;  3GIM A;  4WC6 A;  1KEJ A;  9ICH A;  4QZE A;  3C1Y A;  3EWA A;  5EOZ A;  5HRG A;  3HP6 A;  1CEZ A;  4I2I A;  4B9M A;  2VA3 A;  4X0A A;  1ZQI A;  4FHX A;  5KFH A;  2C2R A;  3BJY A;  3MR2 A;  4RQ1 A;  3KHH A;  5J2H A;  2I9G A;  4YQW A;  3M8S A;  4B9L A;  4IRK A;  7ICI A;  2BCS A;  1TV9 A;  4TQR A;  7ICJ A;  4FHP A;  5L1J A;  4I2G A;  1U48 A;  4X4N A;  4DSF A;  4M6W B;  3PO4 A;  3PW0 A;  4LVS A;  1WCL A;  4PPX A;  4F5P A;  5BPC A;  1R8A A;  1NJZ A;  2J6T A;  4KLU A;  9ICX A;  3V6H A;  4DLE A;  2R8K A;  4AT7 B;  4MF2 A;  2DRA A;  1ARO P;  4JV1 A;  4X5V A;  2V4Q A;  3V6K A;  2BCR A;  3EPG A;  4DSK A;  1QSY A;  2KTQ A;  3TAR A;  4PHA A;  4KLH A;  2Y1I A;  2BQR A;  2Q0Z X;  2JEJ A;  5J0S A;  1XU4 A;  4KLO A;  3ZDB A;  3T5K A;  5KFR A;  4GC6 A;  3WFQ E;  3MGH A;  1NKC A;  7ICF A;  5J2B A;  2FLL A;  1MC8 A;  3FYH A;  5J0P A;  5HP4 A;  3OGU A;  3V6J A;  2O1P A;  1S9F A;  2PFQ A;  2M2T A;  3TQ1 A;  5J0O A;  3QEA Z;  2FPK A;  4I27 A;  4QZF A;  2Y1J A;  1QSS A;  2ZUD A;  4X4T A;  4QZC A;  3THV A;  5HRH A;  4AT8 A;  4J9R A;  2PFP A;  4IQW A;  1S76 D;  4X0B A;  4O9M A;  2M2W A;  4FHV A;  1ZQV A;  2XCA A;  4MFF A;  1ZQE A;  2KN7 A;  4M9L A;  2ZH6 A;  5III A;  4WC0 A;  3OVB A;  1KLN A;  4DSL A;  1KRP A;  9ICU A;  2BPF A;  1N56 A;  2ASL A;  2DR8 A;  4RT2 A;  3AQM A;  4DSI A;  5F2V O;  1SKS A;  5CHG A;  4I2D A;  4I2E A;  7ICH A;  4Z6E A;  4XQ7 A;  4PHD A;  4M47 A;  5DGB A;  2MAX A;  4MFA A;  1NK6 A;  3L9D A;  5L1K A;  4EP7 A;  4B9U A;  4DFK A;  3UPS A;  3M9M B;  4RWN A;  4IQV A;  2P6R A;  3JPP A;  5KFJ A;  1JXL A;  4O3S A;  5DLG A;  2DFL A;  4UD4 A;  2JEF A;  5KG2 A;  3MGI A;  5KT2 A;  4R63 A;  3PR4 A;  1JAJ A;  1ZQG A;  4X4P A;  3PW7 A;  8ICW A;  4E7X A;  4F4Z A;  3H4B A;  2HHV A;  3OSP A;  1OU5 A;  4J9S A;  4I28 A;  1FA0 A;  1ZQA A;  3BQ1 A;  4P2H A;  1LV5 A;  4HYK A;  5J0R A;  4XRH A;  3BQ0 A;  2FMS A;  5HRB A;  1DGS A;  1IM4 A;  5J2J A;  4F5R A;  4BWJ A;  1ZQX A;  1JX4 A;  5J2E A;  3RRH A;  1DK2 A;  4QW8 A;  7ICM A;  1CUK A;  5HNK A;  5KFB A;  3PX6 A;  2JEI A;  4UB2 A;  3T5J A;  5IIO A;  4J9P A;  4DL5 A;  3M8R A;  1NK9 A;  3RAX A;  3RR7 A;  4ECU A;  3PW5 A;  2UVW A;  2A1J A;  2BHN A;  4RQ2 A;  5HRK A;  4X4S A;  5DGA A;  7ICG A;  3EW9 A;  2DPI A;  4KLF A;  4QZA A;  3HPO A;  4WBY A;  4DWI A;  2M9N A;  4ED2 A;  2MUT B;  4UB1 A;  2R8I A;  4TUP A;  2C2D A;  9ICA A;  4MEX A;  3MAB A;  4X4O A;  4O5C A;  4FH5 A;  2ZH4 A;  4O3R A;  2DRB A;  1DOQ A;  2AGO A;  5DKW A;  3H39 A;  4AT8 B;  1X9S A;  1RZT A;  4KLS A;  3RJG A;  3Q8K A;  1C7Y A;  4J9N A;  4FBU A;  5TZV A;  4QWD A;  9ICO A;  3Q8R B;  1KFD A;  1ZQS A;  1N48 A;  4EEY A;  2F1J A;  1Q79 A;  4Z6C A;  1X9M A;  2BPG A;  1BGX T;  4P4P A;  4QZ8 A;  3QE9 Y;  5KT5 A;  4YD1 A;  9ICL A;  1Q78 A;  1U45 A;  1BPY A;  2ZTC A;  4DL2 A;  4E80 A;  1XWL A;  8ICT A;  2P66 A;  8ICF A;  4M6W A;  5HR9 A;  5KFT A;  1K1S A;  4ATB B;  2OWO A;  4GXK A;  8ICS A;  1R89 A;  1RYS A;  4I2C A;  4RWP A;  4QZD A;  3RBE A;  1L5U A;  1TVA A;  5KT6 A;  9ICG A;  1ZQT A;  4EZ9 A;  5EWG A;  1B22 A;  2IA6 A;  2HHQ A;  4UBB A;  4WC5 A;  3C18 A;  3ISB A;  1HJP A;  3N97 B;  1UA1 A;  9ICJ A;  4DOA A;  4I2F A;  4PGY A;  5KG7 A;  4DOC A;  3PML A;  4MEY A;  1UA0 A;  4ECQ A;  4X4V A;  8ICX A;  5DBB A;  5KFG A;  5BOL A;  5DB9 A;  5JUM A;  4QZH A;  2W8K A;  1V4A A;  4KLL A;  4M5D A;  3GV5 B;  4RQ0 A;  3NTU A;  1NK5 A;  4O5K A;  4YCX A;  3JPS A;  3HIY A;  5J2K A;  4JWM A;  5KFU A;  2M2U A;  1V9P A;  2NRW A;  5J2I A;  1RPL A;  4DO9 A;  4DF8 A;  5CJ7 A;  1ZQH A;  4F4K A;  5HHI A;  4DQI A;  3WFS C;  4E8F A;  4IRD A;  1ZQC A;  3MR3 A;  4JK1 A;  4FHY A;  2W9A A;  1NK4 A;  3RJJ A;  3H8S A;  3NGD A;  4IQT A;  8ICA A;  5J0U A;  4RQ7 A;  2W9C A;  5IIN A;  4DF4 A;  1T8E A;  1BPZ A;  4E0D A;  2XY6 A;  3QEB Z;  4QWA A;  5IIL A;  2PI4 A;  3RB0 A;  5BOM A;  8ICU A;  7ICS A;  1TFY A;  2V9W A;  2H5X A;  3HW8 A;  2WTF A;  5J2A A;  4YD2 A;  5KG5 A;  5HMM A;  4I29 A;  1S10 A;  1IXR A;  3C5G A;  4DQS A;  5KFO A;  3UXP A;  9ICR A;  4G3I A;  4LT6 A;  1ZQY A;  4FH3 A;  4M2Y A;  7ICT A;  3WFO A;  5J0X A;  9ICV A;  2PXI A;  4DLG A;  4YR3 A;  9ICN A;  4QZI A;  4RQ8 A;  2ZJ5 A;  3Q8Q B;  3OHA A;  3ZDC A;  3AUO A;  5CWR A;  4Q44 A;  1BNP A;  3GDX A;  1XSN A;  2J6S A;  4NLK A;  8ICN A;  3H7I A;  4C8O A;  2ISP A;  3MDC A;  4EBC A;  4Q8E A;  3ZDE A;  3M9O B;  4GXI A;  5DB6 A;  5HRL A;  5J0T A;  4F4W A;  4NLG A;  4YXJ A;  4YP3 A;  3HJ4 A;  1S0M A;  4AT9 B;  4BWM A;  3LK9 A;  8ICL A;  4R64 A;  1NK0 A;  4JUZ A;  1UEV A;  4YMO A;  5J0Y A;  1SL1 A;  1XS9 D;  2W9B A;  3EYZ A;  4EYH B;  5HML A;  4XQ8 A;  4C8L A;  4KLQ A;  3WFP A;  2RDJ A;  2FPL A;  2I1Q A;  4EBD A;  2HVI A;  2PFN A;  1TAU A;  1ZQD A;  9ICT A;  4EBJ A;  4UB5 A;  2P6U A;  3SYZ A;  4QZB A;  4DQP A;  3TFS A;  4RNN A;  4M9N A;  3C21 A;  4EYI B;  4DQQ A;  1PX5 A;  2ZUB A;  5DG7 A;  2BCQ A;  2M2V A;  5KFM A;  5KFX A;  4M9J A;  2DR9 A;  2BE3 A;  3LDA A;  4RT3 A;  4ECZ A;  4I2B A;  9ICB A;  1UT8 A;  3FDS A;  3JPR A;  1JIH A;  4M9H A;  1K1Q A;  1KSP A;  1U9L A;  5DLF A;  4FBT A;  3C1Z A;  2ZJA A;  2ASJ A;  5J2D A;  4XA5 A;  4KN4 A;  1ZJN A;  1NO5 A;  4YVZ A;  1UT5 A;  5DDM A;  5DB8 A;  2KZZ A;  2BDP A;  4RQ3 A;  4KLJ A;  1VJ7 A;  3UXN A;  4F93 B;  3MFI A;  3MR5 A;  5HHH A;  4F4X A;  5D4B A;  4KLG A;  3UPQ A;  3HT3 A;  4CCH A;  1QLN A;  4J9L A;  1KFT A;  4LZG A;  4KTQ A;  4BXO B;  2PBE A;  5CA7 A;  3RB6 A;  3OJS A;  5KT7 A;  1WOT A;  1UET A;  2B21 A;  4UQG A;  1B43 A;  2BGW A;  3OSN A;  2NRX A;  3RJK A;  4KN7 A;  2ASD A;  9ICI A;  1R8C A;  1HUO A;  4KIT B;  4RWO A;  1ZQJ A;  4IQU A;  4RUA A;  3MBY A;  1TK0 A;  4YR2 A;  8ICP A;  5J29 A;  8ICH A;  2AGQ A;  4IRC A;  1JQR A;  1L3T A;  1BPB A;  7ICN A;  1L3U A;  8ICO A;  4YMN A;  4WC4 A;  4Z6D A;  1H38 A;  3EPI A;  2VA8 A;  5DQH A;  4DOB A;  4FO6 A;  2ZTE A;  4ELV A;  8ICR A;  3B0Y A;  4YN4 A;  8ICV A;  4EBE A;  4DS5 A;  1X2I A;  4DSJ A;  5L1L A;  3G6V A;  3JZ0 A;  3Q8S B;  1LB2 B;  3C2L A;  2AJQ A;  5HC9 A;  3T5L A;  3N4M B;  4DQR A;  4LZD A;  5KFS A;  2KP7 A;  5DBC A;  3H4D A;  1TK8 A;  4ECX A;  2R8H A;  1ZQW A;  3QZ8 A;  3RH6 A;  3Q8P B;  2PFO A;  2DVI A;  4ZH4 A;  4GC7 A;  1BPD A;  1L3V A;  5KG4 A;  2IHM A;  1PZN A;  5KT3 A;  4RPZ A;  1KTQ A;  3OJU A;  2XY7 A;  1XO1 A;  4F3O A;  1S77 D;  1U47 A;  4Z6F A;  5D49 A;  3MDA A;  4GLX A;  2BQ3 A;  9ICS A;  3PW2 A;  1ZET A;  1KDH A;  3ZD9 A;  4K4H A;  4TQS A;  4NLZ A;  5KTQ A;  4PGX A;  1F5A A;  3V7J A;  1ZYQ A;  3H3A A;  4ED6 A;  5DQG A;  5CR0 A;  4NY8 A;  3JPN A;  8ICG A;  4O3O A;  3UXO A;  4RU9 A;  2NRZ A;  3PMN A;  8ICZ A;  4MF8 A;  1SKW A;  1S0V A;  4KLI A;  4R66 A;  4DSE A;  3V7L A;  3C2K A;  2HHS A;  1MQ2 A;  1S0O A;  5KFI A;  4KMU A;  3OUY A;  5J0Q A;  4ED8 A;  4ELU A;  5HRD A;  4DFJ A;  3MFH A;  4IR9 A;  1TKD A;  4YMM A;  2NRK A;  1VFG A;  1XSP A;  4R8U B;  1Y88 A;  3C5F A;  3K75 D;  3KHG A;  5DB7 A;  3RH4 A;  4JWN A;  4M04 A;  3OVA A;  4NM1 A;  4RWQ A;  3BQT A;  4QWB A;  1MIY A;  5CB1 A;  4BGD A;  2AGP A;  4JV2 A;  8ICM A;  1NK8 A;  2BCV A;  3LQC B;  4QZG A;  2XGQ A;  1SL2 A;  2ID1 A;  4F92 B;  5KFP A;  4O3P A;  1ZQL A;  2C2E A;  3PVX A;  7ICL A;  2BKE A;  4ECT A;  4ED0 A;  1NKE A;  4Q45 A;  2HHW A;  8ICC A;  8ICK A;  4YFK A;  5KG0 A;  5IIK A;  3ZDA A;  4F4Y A;  5IIM A;  4B9V A;  9ICE A;  4GXJ A;  4ECW A;  3RJI A;  5KFW A;  1U4B A;  9ICF A;  4F5Q A;  4B9S A;  3JPT A;  1NOM A;  1S97 A;  3OV7 A;  4I2H A;  2F1H A;  3ETL A;  4F91 B;  2ATL A;  4ED7 A;  3GIJ A;  2FLN A;  4C8K A;  4F5O A;  3RB3 A;  7ICV A;  2KFN A;  1ZQP A;  3KHR A;  1COO A;  2BR0 A;  1ZQO A;  2W8L A;  3WFR E;  5DG8 A;  8ICB A;  1T3N A;  3JPQ A;  5KFZ A;  2BCU A;  4R65 A;  3ORY A;  2W9C B;  3RJF A;  5L9X A;  9ICM A;  9ICW A;  4F50 A;  1KNY A;  4X4Q A;  1HUZ A;  3Q8M A;  5DED A;  1XC9 A;  1S0N A;  4ECV A;  5J2F A;  4WCW A;  5HRE A;  4BXO A;  4PGQ A;  4DEZ A;  3LWL A;  2BPC A;  5KFF A;  4RQ5 A;  1BPX A;  2J6U A;  5KG1 A;  4FHW A;  4PHP A;  4RPY A;  5KFN A;  4KLT A;  4RQ6 A;  3JPO A;  4M0A A;  4DFM A;  4UB3 A;  1ZJM A;  2IBK A;  4MFC A;  4K4I A;  2UVR A;  2HHX A;  9ICQ A;  2C22 A;  4TUQ A;  2JEG A;  4RZR A;  2XGP A;  4S3N A;  1ZQQ A;  4M9G A;  5KT4 A;  3GFK B;  4J9O A;  5L1I A;  1NJX A;  3OVS A;  3KHL A;  5KFQ A;  3JYY A;  1TAQ A;  4UBC A;  4QWE A;  4P4M A;  2ZHB A;  2VAN A;  5J0W A;  4TUS A;  9ICP A;  1SKR A;  5J2G A;  2IMW P;  1KFS A;  1JMS A;  9ICK A;  4J9Q A;  3H8J A;  3RTV A;  4PH5 A;  4NM2 A;  3MR6 A;  8ICQ A;  3M9N B;  8ICI A;  3AQL A;  2RFF A;  2DR7 A;  4KLD A;  3H38 A;  4F8R A;  2C28 A;  2ZH3 A;  4P4O A;  1TFW A;  2ZH7 A;  5DG9 A;  3G6Y A;  4ED3 A;  2UVV A;  2UVU A;  4B9T A;  7ICU A;  4C8M A;  3PX4 A;  2JZB A;  1MSW D;  3RBD A;  4DL3 A;  2HW3 A;  1X9W A;  3SZ2 A;  2AU0 A;  3B0X A;  1ZQZ A;  2ZH9 A;  2AQ0 A;  3V72 A;  2FMQ A;  5EWF A;  4TUR A;  2DPJ A;  5F9N A;  4ELT A;  2FLP A;  4AT9 A;  4IG8 A;  4DFP A;  1BNO A;  4AT7 A;  5KFC A;  5D46 A;  5KFE A;  4C8N A;  1ZQN A;  2JZB B;  2ZJ8 A;  2ZH2 A;  4O5E A;  2KZ3 A;  4O3N A;  3AU2 A;  3TAN A;  1RYR A;  3NYB A;  2GWS A;  3E2E A;  5KFV A;  4DL6 A;  3H37 A;  3GQC A;  5KG3 A;  4DL7 A;  1Z00 A;  3KTQ A;  3TI0 A;  1EXN A;  3K4G A;  5KFD A;  2PI5 A;  1YLQ A;  2A1J B;  1D9D A;  2KZM A;  2NRV A;  5KFK A;  2ALZ A;  4WC7 A;  7ICP A;  1A77 A;  4JV0 A;  4F5N A;  3IM1 A;  4R8U A;  3HWT A;  3T3F A;  7ICQ A;  4WC3 A;  2FPM A;  2ZH5 A;  1BPE A;  3HJ1 A;  2XC9 A;  3RH5 A;  4KLM A;  4RNO A;  8ICY A;  2ZTD A;  3PR5 B;  3AU6 A;  4WBZ A;  4I2J A;  1NJY A;  4FS1 A;  7ICE A;  8ICE A;  2RDI A;  2BQU A;  2V4R A;  1D8Y A;  3RJE A;  3TAQ A;  4QW9 A;  2IHN A;  5DBA A;  1A76 A;  5C5J A;  4RNM A;  5KFA A;  4YR0 A;  4UAW A;  3RRG A;  4NKT A;  3HX0 A;  4RPX A;  1UEU A;  4NXZ A;  3BDP A;  3EZ5 A;  1T7P A;  3TFR A;  5EWE A;  7ICK A;  3PY8 A;  4YG2 A;  4KLE A;  2Q66 A;  2KFZ A;  2O5A A;  4ATB A;  1Z3E B;  5IIJ A;  3C23 A;  2W9M A;  1SL0 A;  3OUY B;  4ECR A;  4F2R A;  1ZQU A;  4NLN A;  3SI8 A;  3RB4 A;  2XY5 A;  3PO5 A;  3OHB A;  4XUS A;  2VA2 A;  3PNC A;  2ZUC A;  5DDY A;  3PX0 A;  3QZ7 A;  1TFR A;  4UAZ A;  3AQK A;  4FS2 A;  4UB4 A;  3RR8 A;  5F9L A;  3ISD A;  3PV8 A;  1NKB A;  2AQ4 A;  2R8J A;  5DQI A;  3GII A;  4EBK A;  1SZP A;  3SV3 A;  2LYH A;  3C66 A;  2NRT A;  2ZH8 A;  1T4G A;  4B9N A;  2XCP A;  4UAY A;  4F2S A;  1QSL A;  1MIW A;  2W9B B;  3RJH A;  4DS4 A;  4X4U A;  1R8B A;  1NK7 A;  3IHQ B;  1ZQK A;  3UQ2 A;  1NJW A;  2MUT A;  2XO7 A;  1D8L A;  1Z00 B;  4K4G A;  5KFY A;  4QWC A;  5J2C A;  1TK5 A;  1D9F A;  4WC2 A;  1DK3 A;  8ICJ A;  4Q8F A;  4UD5 A;  4ED1 A;  4NKU A;  3BQ2 A;  3PW4 A;  4QZ9 A;  1ZQF A;  2ZH1 A;  7ICR A;  2HHU A;  3Q8L A;  3ZD8 A;  4J9M A;  2R8G A;  4O3Q A;  9ICC A;  5HRF A; 
#chains in the Genus database with same CATH topology
 7ICO A;  2B51 A;  4CF5 A;  1NZP A;  1QTM A;  1BVS A;  5KFL A;  3UQ0 A;  3H40 A;  5CP2 A;  4IR1 A;  5HR9 A;  1S5L U;  5HR7 A;  4O0I A;  3ZDD A;  4AP9 A;  1KQQ A;  2YMP A;  2YMM A;  1MQ3 A;  2KHV A;  4ECS A;  5HRI A;  1F0M A;  2ZHA A;  4WQL A;  3TAP A;  3G6X A;  1L3S A;  1XSL A;  2OEH A;  2Q4T A;  3H8W A;  2RRD A;  3GIM A;  3C1Y A;  1CEZ A;  2OYY A;  3LVV A;  4X0A A;  1ZQI A;  2I6X A;  3MR2 A;  5ALJ A;  4FHP A;  7ICI A;  2E1F A;  4X4N A;  3PO4 A;  4PPX A;  4F5P A;  2K4H A;  2R8K A;  2DRA A;  3CNH A;  2V4Q A;  3V6K A;  1QSY A;  3TAR A;  2HSZ A;  2MSN A;  3ZDB A;  3WFQ E;  1NKC A;  5ALY A;  1MC8 A;  2ZIW B;  3FYH A;  2W3S A;  3NVY A;  1FFV A;  2O1P A;  1S9F A;  3QEA Z;  5AHX A;  2ZUD A;  2FCL A;  1YZ7 A;  2H3V A;  4QZC A;  5HRH A;  4J9R A;  5EE0 A;  4IQW A;  2M2W A;  4MFF A;  2ZH6 A;  5ALM A;  3L4P A;  1KRP A;  3H0L B;  1N56 A;  2KOB A;  1WYG A;  7ICH A;  2WAQ C;  5K4L A;  3L9D A;  1J2N A;  4B9U A;  2GOL A;  3M9M B;  2H3Q A;  1JXL A;  4O3S A;  5DLG A;  1V97 A;  5KT2 A;  5AK4 A;  2GAF D;  2B6G A;  2QB0 A;  4E7X A;  4F4Z A;  1OU5 A;  4J9S A;  4I28 A;  3BQ1 A;  2NO5 A;  1LV5 A;  1L7O A;  5D63 A;  4XRH A;  1DGS A;  4F5R A;  4EX6 A;  1AQ6 A;  4QW8 A;  2JEI A;  2FJ6 A;  4UB2 A;  4DL5 A;  4J9P A;  2UVW A;  4RQ2 A;  2YML A;  3WK5 A;  4QZA A;  3HPO A;  1L8L A;  4DWI A;  2HI0 A;  4UB1 A;  4X4O A;  1Q3U A;  2AGO A;  1J2M A;  2WAQ F;  1X9S A;  1SV0 A;  1C7Y A;  5D61 A;  1SGG A;  5HR6 A;  3Q8R B;  1ZQS A;  1Q79 A;  3M1Y A;  1JRO A;  2KKV A;  4QZ8 A;  3QE9 Y;  9ICL A;  1BPY A;  2ZTC A;  4E80 A;  3NRZ A;  1K1S A;  1R89 A;  3UMG A;  1NNL A;  5G5H A;  4I2C A;  2F8L A;  2JV3 A;  1L5U A;  3ER9 B;  1TVA A;  5KT6 A;  4WC5 A;  4EZ9 A;  2EDU A;  1UA1 A;  2BZF A;  9ICJ A;  4DOC A;  4ECQ A;  3IG5 A;  8ICX A;  5DBB A;  2W8K A;  5ALW A;  5JUM A;  2KNJ A;  4RQ0 A;  2F3N A;  5KFU A;  2NRW A;  1QQ6 A;  4DO9 A;  1ZQH A;  5HHI A;  1RYU A;  4E8F A;  1ZQC A;  2W9A A;  3RJJ A;  1HIW A;  2HN1 A;  3F2C A;  5AI9 A;  4DF4 A;  5IIL A;  3RB0 A;  5BOM A;  8ICU A;  3HW8 A;  4YD2 A;  5KG5 A;  4I29 A;  3LYS A;  1XO0 A;  1ZQY A;  3HJE A;  2PXI A;  9ICN A;  1HEK A;  3Q8Q B;  1FIQ A;  3HRD D;  1MN8 A;  2NO4 A;  4CF4 A;  3GDX A;  5KAI U;  2GA9 D;  4P0Q A;  4F4W A;  2GO7 A;  5J0T A;  1O03 A;  1SXE A;  4YXJ A;  4YP3 A;  1TE2 A;  4JUZ A;  1SL1 A;  3QU5 A;  2KG5 A;  3WFP A;  1GO3 F;  5ALG A;  4OJL A;  4UB5 A;  2DL0 A;  2JR5 A;  5A0L A;  4I2B A;  5EE9 A;  1K1Q A;  1KSP A;  1U9L A;  3KOO A;  3ER8 C;  5DLF A;  4FBT A;  2G5H B;  2ASJ A;  4C7Y A;  1Q8K A;  3MR5 A;  4F93 B;  3MFI A;  1N5W A;  4KLG A;  3UPQ A;  4J9L A;  4KTQ A;  4I0U A;  3OJS A;  2F2A B;  4US9 A;  1B43 A;  9ICI A;  3SAH A;  3OSN A;  2ASD A;  4KIT B;  1ZQJ A;  4IQU A;  1TK0 A;  8ICP A;  3KZI U;  3SEN A;  5JTG A;  7ICN A;  8ICO A;  4YMN A;  4UAS A;  2G0A A;  3EPI A;  2VA8 A;  4ELV A;  2KSO B;  3Q8S B;  1LB2 B;  2AJQ A;  4DQR A;  4LZD A;  2KP7 A;  3H4D A;  4ECX A;  2PFO A;  4ICA A;  4ZH4 A;  4GC7 A;  1L3V A;  2IHM A;  5AK3 A;  5KT3 A;  1KTQ A;  3SAG A;  3OJU A;  5KL8 B;  4Z6F A;  2OM6 A;  3C29 A;  3ZD9 A;  4TQS A;  2KIC A;  2DGZ A;  5KTQ A;  1IV8 A;  3UXO A;  1SKW A;  1S0V A;  1B0X A;  4KLI A;  3V7L A;  3C2K A;  3OUY A;  1VFG A;  1F44 A;  2M0N A;  4NLB A;  1Y88 A;  3RH4 A;  5AM1 A;  4NM1 A;  1PVP A;  4QWB A;  2AGP A;  8ICM A;  3B9J A;  3WU2 U;  4QZG A;  1RG6 A;  4ECT A;  4ED0 A;  5ALT A;  8ICC A;  8ICK A;  4YFK A;  5IIK A;  4KB6 A;  1SWV A;  2MRL A;  1U4B A;  4F5Q A;  3JPT A;  1NOM A;  2KJ8 A;  2ATL A;  4C8K A;  3RB3 A;  1ZQP A;  1ZQO A;  3WFR E;  2RQ5 A;  8ICB A;  4RQM A;  1T3N A;  4R65 A;  4K98 A;  9ICM A;  5L9X A;  9ICW A;  4F50 A;  1KKX A;  1S0N A;  4WCW A;  4DEZ A;  4RQ5 A;  2J6U A;  4RPY A;  5KFN A;  3JYY A;  3JPO A;  4K4I A;  2C22 A;  3NVO A;  3AQF A;  4M9G A;  3KFU F;  2W03 A;  1N62 A;  5L1I A;  5G5G A;  1NJX A;  1UQV A;  4P4M A;  2PMZ F;  2K4E A;  2VAN A;  4TUS A;  2IMW P;  8ICI A;  4NM2 A;  3M9N B;  2C28 A;  2ZH3 A;  2ZH7 A;  3F5A A;  3RBD A;  4DL3 A;  2HW3 A;  1ZQ1 C;  1FFU A;  2ZH9 A;  3V72 A;  4Y2V A;  1BNO A;  4DFP A;  5KFE A;  1ZQN A;  2ZIW A;  2H3Z A;  4O3N A;  5AIA A;  3H37 A;  2G08 A;  3KTQ A;  3TI0 A;  1EXN A;  3K4G A;  5AI5 A;  2PI5 A;  2ALZ A;  7ICP A;  4IL6 U;  3IM1 A;  2W11 A;  4HAI A;  1BPE A;  3RH5 A;  4EEK A;  2ZTD A;  4K9B A;  7ICE A;  3SMV A;  2FI1 A;  3D2S A;  2F77 X;  3TAQ A;  4QW9 A;  5DBA A;  4EGW A;  5C5J A;  3RRG A;  4NKT A;  2HOQ A;  2F76 X;  3BDP A;  2HMX A;  5KL1 B;  5EWE A;  2O5A A;  2E8O A;  5CHE A;  1ZQU A;  3PO5 A;  3OHB A;  4XUS A;  2VA2 A;  3PNC A;  3AQK A;  4FS2 A;  4B6J A;  3RR8 A;  3MCR A;  5FP0 A;  2NRT A;  2ZH8 A;  1T4G A;  1QSL A;  3NRW A;  3RJH A;  2E8P A;  3QUQ A;  5ALS A;  1WUD A;  1D9F A;  4WC2 A;  8ICJ A;  5D62 A;  3WKB A;  3ZD8 A;  2R8G A;  9ICC A;  3WK6 A;  4K99 A;  4J9K A;  1ZQB A;  4DL4 A;  2A1A A;  3ISC A;  1RXW A;  3AQN A;  3IV6 A;  3GV8 B;  3GV7 B;  3LWM A;  4QIW C;  2FDR A;  1QQ7 A;  4BDP A;  3T5H A;  2HVH A;  4K96 A;  3EF2 A;  3V7K A;  4RUC A;  3EWA A;  1ZD4 A;  3HP6 A;  4B9M A;  4WQK A;  5AKG A;  5KFH A;  2ZIU A;  1WCL A;  1V38 A;  2WF9 A;  2J6T A;  4KLU A;  3V6H A;  4MF2 A;  4Y2J A;  5J8Y C;  4PHA A;  2Y1I A;  2Q0Z X;  1XU4 A;  4NXX A;  3MGH A;  1CI4 A;  5GTI U;  2KE7 A;  4P0P B;  5HP4 A;  5AI0 A;  2PFQ A;  2M2T A;  4I27 A;  1QSS A;  4QIW F;  1ZRM A;  1S76 D;  4O9M A;  4OAG A;  1ZQE A;  5III A;  4DSL A;  3TAD C;  1X42 A;  2DR8 A;  4RT2 A;  4DSI A;  2N1R A;  5CHG A;  4Z6E A;  2KJ5 A;  2Y0S F;  4MFA A;  4XJE A;  5J8Y A;  4RWN A;  4IQV A;  2DFL A;  3WK4 A;  4UD4 A;  5ALR A;  4UB8 U;  3PW7 A;  2HHV A;  3OSP A;  3WKD A;  1OUQ A;  5ALZ A;  2E8M A;  4O3M A;  1RQN A;  5J0R A;  2FMS A;  4BWJ A;  2RLT A;  3RRH A;  1DK2 A;  1JI7 A;  1CUK A;  1FEZ A;  5IIO A;  3M8R A;  4N7R A;  1M6Y A;  2ZXH A;  5DGA A;  3UM9 A;  3EW9 A;  4WBY A;  5ALD A;  4TUP A;  4LEW A;  9ICA A;  3MAB A;  3VCB A;  2ZH4 A;  4AT8 B;  2EQY A;  4J9N A;  4G9B A;  4YD1 A;  1ECW A;  1U45 A;  3BQ7 A;  2WFA A;  3BS5 B;  1XWL A;  8ICT A;  4M6W A;  5KFT A;  4ATB B;  2OWO A;  8ICS A;  2YMQ A;  4RWP A;  2QAR B;  3RBE A;  1N63 A;  1ZQT A;  5EWG A;  2JXJ A;  1CRX A;  3N97 B;  4PGY A;  2ESE A;  4MEY A;  1UA0 A;  2H3I A;  5DB9 A;  3NTU A;  2KD1 A;  5J2K A;  3KZX A;  5AM3 A;  5J2I A;  3WFS C;  2K8B B;  1UPH A;  4EV6 A;  2YTU A;  4IRD A;  2AXT U;  4JK1 A;  3NGD A;  2YB4 A;  1FO4 A;  4IQT A;  5J0U A;  1VDV A;  4RQ7 A;  5IIN A;  4E0D A;  4QWA A;  7ICS A;  4BX9 C;  2B4V A;  5J2A A;  1IIP A;  3N7R C;  5HMM A;  1IXR A;  5JTI A;  1S10 A;  3HKZ F;  4M2Y A;  5J0X A;  9ICV A;  3OHA A;  1UCV A;  4USA A;  2J6S A;  4BUG A;  3MDC A;  4Q8E A;  1YZ6 A;  4GXI A;  5DB6 A;  2YY6 A;  4NLG A;  4FZM A;  4AT9 B;  3LK9 A;  2B56 A;  3NVZ A;  3WKC A;  1UEV A;  4YMO A;  5J0Y A;  1XS9 D;  3BZC A;  2W9B A;  3EYZ A;  3KBB A;  4XQ8 A;  4KLQ A;  2FPL A;  2HVI A;  2PFN A;  3ED5 A;  1X40 A;  4RNN A;  4EYI B;  4DQQ A;  1PX5 A;  1S8O A;  1L8O A;  2EZX A;  2DR9 A;  3LDA A;  4ECZ A;  2D8C A;  2ZIX A;  2JRZ A;  3FDS A;  3JPR A;  2W7P A;  4M9H A;  3K7D A;  3C1Z A;  2WHE A;  2ZJA A;  1UT5 A;  2KZZ A;  3RF9 A;  1KN5 A;  1T3Q A;  4KLJ A;  1VJ7 A;  3UXN A;  5D4B A;  5HHH A;  1QLN A;  4Y2S A;  1KFT A;  5ALV A;  5CA7 A;  3RB6 A;  3QU9 A;  1UET A;  4CDG A;  2LM4 A;  3D2Q A;  3AN1 A;  2BGW A;  4FFD A;  4KN7 A;  2LKY A;  4RWO A;  4YR2 A;  1D8B A;  2LPE A;  1ZXI A;  5AIB A;  2AGQ A;  1L3T A;  1BPB A;  4FE3 A;  4IC9 A;  4WC4 A;  2QB1 A;  1H38 A;  5DQH A;  2ZTE A;  8ICV A;  1QQ5 A;  3ETR A;  1X2I A;  5L1L A;  3G6V A;  3JZ0 A;  3C2L A;  5HC9 A;  5KFS A;  3I1Y A;  1T94 A;  5EE1 A;  1PZN A;  4F3O A;  1XO1 A;  3QU7 A;  2DWQ A;  4F71 A;  3MDA A;  3PW2 A;  1ZET A;  3WKE A;  4OAF A;  3H3A A;  4ED6 A;  4O69 A;  1X6I A;  3JPN A;  8ICG A;  4O3O A;  2NRZ A;  3PMN A;  2RP5 A;  2OHF A;  4KMU A;  2DR7 A;  4ELU A;  3MFH A;  2HN2 A;  2NRK A;  5CEH A;  1XSP A;  4R8U B;  3K75 D;  3KHG A;  4F72 A;  4WH5 A;  1GPJ A;  2XVT A;  2BCV A;  4F92 B;  7ICL A;  4LEY A;  1NKE A;  2HHW A;  9ICE A;  4MHV A;  3ZDA A;  4ECW A;  5KFW A;  2KIW A;  5AK6 A;  5ALF A;  1S97 A;  4F5O A;  2BR0 A;  1COO A;  5DG8 A;  3S6J A;  3K1Z A;  4ACO A;  3RJF A;  3F53 A;  4NXU A;  2LYA A;  2E8N A;  3HIL A;  1KNY A;  4X4Q A;  1XC9 A;  2KVC A;  5J2F A;  3LWL A;  2BPC A;  5KFF A;  1BPX A;  4FHW A;  4PHP A;  4RQ6 A;  4MFC A;  1SB3 C;  3BZK A;  4DFM A;  1ZJM A;  2OH2 A;  2XGP A;  4S3N A;  4LEV A;  1ZQQ A;  3WK7 A;  5KT4 A;  3GFK B;  2BBJ A;  3N7P D;  5KFQ A;  4QWE A;  3GU3 A;  2ZHB A;  5J2G A;  8ICQ A;  4PH5 A;  1JAL A;  4KLD A;  1TFW A;  4P4O A;  3G6Y A;  4ED3 A;  7ICU A;  3M7D A;  2JZB A;  1MSW D;  3WK9 A;  1Z4N A;  4QJF B;  2XIC A;  3SZ2 A;  2VJ4 A;  1X9W A;  3B0X A;  1KL9 A;  1ZQZ A;  2AQ0 A;  4GFJ A;  2DPJ A;  4ELT A;  1N2X A;  2D3D A;  4DCC A;  4AT9 A;  2DKZ A;  5D46 A;  4C8N A;  1VLB A;  3NYB A;  3AU2 A;  5AM5 A;  2ZIU B;  3K1R B;  3N7S C;  5KG3 A;  4DL7 A;  1X6J A;  2EAM A;  5KFD A;  2A1J B;  4OJ5 A;  4WC7 A;  4F5N A;  7ICQ A;  3HWT A;  4UAT A;  3HJ1 A;  2XC9 A;  4PL2 A;  4RNO A;  1NJY A;  5ALP A;  2V4R A;  1KBU A;  3QUT A;  3F2D A;  4KMO B;  2IHN A;  1A76 A;  2B0C A;  4RNM A;  4YR0 A;  3H0R B;  1TAM A;  4RPX A;  3DV9 A;  3TAD A;  3TFR A;  2Q66 A;  4YG2 A;  4KLE A;  4ATB A;  3C23 A;  2W9M A;  1SL0 A;  2XY5 A;  2ZUC A;  3PX0 A;  3QZ7 A;  4UAZ A;  4UB4 A;  5T14 A;  2DBY A;  5F9L A;  3ISD A;  1NKB A;  4EBK A;  3D2N A;  5AKH A;  2HCF A;  3ONN A;  2I5H A;  1NK7 A;  1ZQK A;  4QWC A;  5J2C A;  1TK5 A;  1DK3 A;  5AKJ A;  4QZ9 A;  3D6J A;  4NLK A;  3EUB 2;  5EE3 A;  4IS7 A;  1WCN A;  4OCZ A;  5AKK A;  4AYB F;  3C2M A;  4WC1 A;  1ZQR A;  5ALE A;  2HHT A;  4O67 A;  2F1I A;  1RXV A;  4U6P A;  3QU4 A;  4EZ6 A;  2G07 A;  1LKY B;  3RAQ A;  4I2A A;  1JN3 A;  1ZQM A;  4C4T A;  4RQ4 A;  4ECY A;  2FMP A;  4KX3 A;  2DR5 A;  4YXM A;  2HHP A;  4QNL A;  4WC6 A;  1KEJ A;  3F5E A;  4I2I A;  3MGV A;  4PJ0 U;  2VA3 A;  4FHX A;  2LI6 A;  4RQ1 A;  3KHH A;  4IRK A;  4B9L A;  3FC4 A;  7ICJ A;  3NVV A;  2BCS A;  5L1J A;  4I2G A;  1U48 A;  4DSF A;  4UAU A;  2HOI A;  4OAI Z;  1R8A A;  1NJZ A;  9ICX A;  5B66 U;  4NXT A;  4DLE A;  4AT7 B;  1ARO P;  5AKX A;  4X5V A;  3EPG A;  2JH7 A;  4KLH A;  2BQR A;  1X9X A;  5J0S A;  4KLO A;  3T5K A;  4DFD A;  2PMZ C;  7ICF A;  5J2B A;  3RFA A;  1RDF A;  5J0P A;  2ZG6 A;  3OGU A;  2Y9T A;  5CFS A;  4K9A A;  5J0O A;  2FPK A;  4QZF A;  3F2B A;  3THV A;  4AT8 A;  2W54 A;  4FHV A;  4P0P A;  5KAF U;  2XCA A;  4M9L A;  3OVB A;  1KLN A;  1IG6 A;  2EH9 A;  3AQM A;  1SKS A;  4I2D A;  2K8A A;  2L5Y A;  4M47 A;  5DGB A;  2MAX A;  2IHO A;  5AI6 A;  5L1K A;  4EP7 A;  3CW2 C;  2P6R A;  3SEI A;  2F8K A;  4Y2Q A;  2JEF A;  5KG2 A;  3MGI A;  4R63 A;  4X4P A;  1ZQG A;  4CGZ A;  3UMC A;  8ICW A;  1Z19 A;  1ZQA A;  4A8E A;  4HYK A;  3BQ0 A;  1IM4 A;  1ZQX A;  1JX4 A;  3IP4 B;  5HNK A;  3T5J A;  1NK9 A;  1MA7 A;  3RR7 A;  4ECU A;  3PW5 A;  3AL0 B;  2BHN A;  4X4S A;  5HRK A;  2G06 A;  7ICG A;  3QUB A;  4KLF A;  4HX0 A;  2MUT B;  2WF5 A;  2R8I A;  2C2D A;  4O5C A;  2DRB A;  1DOQ A;  2R18 A;  1RZT A;  4KLS A;  3Q8K A;  4FBU A;  9ICO A;  2F1J A;  5GTH U;  4Z6C A;  1X9M A;  2BPG A;  1BGX T;  3R9K A;  5KT5 A;  4MKP A;  4Y2R A;  4Y2Y A;  3PZP A;  2JMG A;  2P66 A;  8ICF A;  3IN5 A;  4OJO A;  5ALX A;  3SQI A;  1RYS A;  4QZD A;  4K97 A;  1C20 A;  1B4F A;  9ICG A;  2HHQ A;  4UBB A;  4FZL A;  3ISB A;  1HJP A;  3C18 A;  4DOA A;  5AKZ A;  4I2F A;  3PML A;  1Z1B A;  4KLL A;  3GV5 B;  1DXS A;  1ZRN A;  1NK5 A;  4YCX A;  4O5K A;  1V9P A;  3M6K A;  1RPL A;  5AKY A;  5CJ7 A;  4F4K A;  4DQI A;  4BJQ A;  5AI4 A;  3MR3 A;  4FHY A;  3H8S A;  8ICA A;  2W9C A;  1T8E A;  3QEB Z;  2V9W A;  2H5X A;  2RFF A;  3C5G A;  9ICR A;  4LT6 A;  5KFO A;  4G3I A;  7ICT A;  2IOH A;  4YR3 A;  2KMD A;  4QZI A;  2ZJ5 A;  4PZN A;  2QAR A;  3AUO A;  1BNP A;  3AM9 A;  3PSP A;  2Y9U A;  3H7I A;  5HRL A;  1ZD2 P;  3HJ4 A;  1S0M A;  4R64 A;  1NK0 A;  1QCK A;  5HML A;  2K4P A;  2KJ9 A;  4C7Z A;  4LEZ A;  4CNQ A;  2HBJ A;  2P35 A;  1ZQD A;  2EZY A;  3SYZ A;  4DQP A;  4M9N A;  2ZUB A;  5DG7 A;  2QKQ A;  4M9J A;  4RT3 A;  2QLT A;  5ALN A;  1Z4O A;  1L7M A;  1JIH A;  2OXO A;  4EEL A;  4KX5 A;  1NO5 A;  5J2D A;  4KN4 A;  1ZJN A;  4F4X A;  1L7N A;  5TIS U;  4CCH A;  4LZG A;  2PBE A;  5ALI A;  5B5E U;  1WOT A;  4C0Z A;  2B21 A;  2G5I B;  3RJK A;  1R8C A;  1ED1 A;  1HUO A;  3UMB A;  3BS5 A;  4RUA A;  5J29 A;  1L3U A;  3SD7 A;  4Z6D A;  4DOB A;  4FO6 A;  8ICR A;  3B0Y A;  4YN4 A;  2KIV A;  3CYM A;  3FAH A;  4DSJ A;  5ALK A;  3T5L A;  5AM4 A;  3N4M B;  3FM9 A;  5DBC A;  1N60 A;  3RH6 A;  3QZ8 A;  3Q8P B;  2DVI A;  1BPD A;  5KG4 A;  2XY7 A;  4RPZ A;  1S77 D;  1P7D A;  4M5D A;  1U47 A;  2BQ3 A;  1KDH A;  4NLZ A;  3V7J A;  1ZYQ A;  5DQG A;  5F3X B;  4MF8 A;  4DSE A;  2HHS A;  1MQ2 A;  1S0O A;  5J0Q A;  4ED8 A;  5HRD A;  4IR9 A;  4YMM A;  4M04 A;  3OVA A;  5AK5 A;  1MIY A;  5CB1 A;  5AKI A;  4BGD A;  5JU5 A;  3J81 j;  4JV2 A;  1NK8 A;  2ID1 A;  1RM6 C;  4LJX A;  5KFP A;  2C2E A;  2BKE A;  4Q45 A;  2IOF K;  5KG0 A;  4F4Y A;  1LVH A;  3RJI A;  1A6S A;  4OJ6 A;  3ZI4 A;  4NXW A;  2D6F C;  4I2H A;  2F1H A;  3ETL A;  3N28 A;  4F91 B;  4ED7 A;  2FLN A;  2JH1 A;  7ICV A;  4JMU A;  3KKA A;  2KFN A;  3KHR A;  2KHQ A;  2W8L A;  3JPQ A;  2BCU A;  3ORY A;  2W9C B;  5ALL A;  1X66 A;  1HUZ A;  3Q8M A;  5DED A;  4BXO A;  4WJ3 B;  5KG1 A;  2IBK A;  2EAP A;  2UVR A;  5KNI A;  2JEG A;  4NL9 A;  4GIB A;  1Q46 A;  3KHL A;  1TAQ A;  5J0W A;  9ICP A;  1SKR A;  9ICK A;  3H8J A;  3MR6 A;  3I76 A;  1SV0 C;  3H38 A;  2VKQ A;  4F8R A;  4P0Q B;  5DG9 A;  3L3F X;  5H2F U;  2UVV A;  3DDH A;  4B9T A;  3PX4 A;  4UW9 A;  3LVW A;  2AU0 A;  5JRT A;  2FMQ A;  3A0H U;  5EWF A;  4TUR A;  5F9N A;  2A3V A;  5AIC A;  5KFC A;  2JZB B;  1L7P A;  2ZH2 A;  4O5E A;  2KZ3 A;  2KVS A;  2LBO A;  5L1M A;  2WF8 A;  2DQN B;  2VJ5 A;  3GQC A;  4JLX A;  1O08 A;  2NRV A;  2AHO B;  1A77 A;  4JV0 A;  5CRX A;  2ZH5 A;  3L5K A;  4US8 A;  4KLM A;  8ICY A;  3ALR A;  8ICE A;  2RDI A;  1D8Y A;  2KEY A;  5KFA A;  4UAW A;  3HX0 A;  2E5S A;  4PZO A;  3EZ5 A;  1T7P A;  2LHT A;  3OUY B;  2YQE A;  4F2R A;  5DDY A;  1TFR A;  1Z1V A;  2E1E A;  2R8J A;  2EZZ A;  2LYH A;  3VC8 A;  4B9N A;  4F2S A;  1R8B A;  3IHQ B;  2IUB A;  2W55 A;  3PW4 A;  3Q8L A;  4J9M A;  4O3Q A;  5HRF A;  1NZB A;  3QUC A;  2WF7 A;  2ISO A;  3NVW A;  1XNS A;  1JXE A;  5KG6 A;  3IDW A;  1ZOL A;  1U49 A;  1PK1 B;  2PKE A;  2G09 A;  3SV4 A;  4X4R A;  3GIL A;  4O6A A;  4Q43 A;  5DEC A;  1MIV A;  2VIX A;  3CP8 A;  3GIK A;  4PHE A;  9ICH A;  3TAC B;  4QZE A;  5EOZ A;  5HRG A;  2HBM A;  3ICX A;  2C2R A;  3BJY A;  2I9G A;  5J2H A;  2MU2 A;  3PST A;  4YQW A;  3M8S A;  1TV9 A;  4TQR A;  2F44 A;  4NLC A;  4M6W B;  3PW0 A;  4LVS A;  5BPC A;  1COK A;  4JV1 A;  2BCR A;  4OJP A;  3T79 A;  4C4R A;  2HBL A;  4DSK A;  2KTQ A;  1PVQ A;  2JEJ A;  3QXG A;  5KFR A;  4GC6 A;  2WB1 C;  3NAS A;  1PUZ A;  2CN1 A;  1F5S A;  2FLL A;  2E3T A;  4UAV A;  4KM5 A;  3PSF A;  3V6J A;  3TQ1 A;  3QU2 A;  3OWG A;  2Y1J A;  4EEN A;  5CFU A;  4X4T A;  4X0B A;  2PFP A;  1A0P A;  2K60 A;  1ZQV A;  4X4V A;  2KN7 A;  4WC0 A;  9ICU A;  2BPF A;  2ASL A;  1SXD A;  5F2V O;  4I2E A;  2NV3 A;  4XQ7 A;  4PHD A;  1OXJ A;  1NK6 A;  2GLE A;  2KK0 A;  4DFK A;  3UPS A;  3JPP A;  5KFJ A;  1J97 A;  1JAJ A;  3QNM A;  3PR4 A;  3H4B A;  1UHU A;  1JUD A;  1FA0 A;  2WB1 F;  4P2H A;  2BDU A;  5HRB A;  5J2J A;  5J2E A;  5B3Q A;  7ICM A;  5KFB A;  3PX6 A;  1RQL A;  3AQE A;  3RAX A;  2A1J A;  3DEE A;  2DPI A;  2JHD A;  2M9N A;  2W3R A;  4ED2 A;  2Y0S C;  4U7C A;  4MEX A;  2CXY A;  4FH5 A;  1V85 A;  4NV0 A;  4O3R A;  5DKW A;  3H39 A;  2CRX A;  3RJG A;  1K5O A;  5TZV A;  4QWD A;  1KFD A;  1N48 A;  4EEY A;  4Y2U A;  4P4P A;  1Q78 A;  1WWV A;  4DL2 A;  5AI8 A;  4GXK A;  2HBK A;  3IRU A;  1PK3 A;  3GZF A;  1B22 A;  2IA6 A;  3H0M B;  5KG7 A;  5E79 U;  4Y2P A;  4QZH A;  5KFG A;  5BOL A;  1V4A A;  3JPS A;  3HIY A;  4JWM A;  2H3F A;  2M2U A;  4DF8 A;  1SZH A;  1NK4 A;  1BPZ A;  2XY6 A;  5ALO A;  2PI4 A;  1TFY A;  5B3P A;  2WTF A;  3E0F A;  4CF3 A;  4DQS A;  3UXP A;  1DGJ A;  1SWW A;  3NKU A;  4FH3 A;  2A19 A;  3WFO A;  4DLG A;  4RQ8 A;  4CE6 A;  3ZDC A;  4JB3 A;  5CWR A;  4Q44 A;  1XSN A;  4OO1 J;  8ICN A;  4C8O A;  2ISP A;  4EBC A;  3M9O B;  3ZDE A;  2RHF A;  3AEV A;  1JRP A;  2EAN A;  4BWM A;  2K89 A;  8ICL A;  4NXV A;  2OCE A;  4EYH B;  4Y2X A;  4C8L A;  2RDJ A;  3PHZ A;  2I1Q A;  3I28 A;  4EBD A;  1TAU A;  9ICT A;  4EBJ A;  2P6U A;  4QZB A;  3TFS A;  5CFT A;  4WOY A;  3SR6 A;  3C21 A;  3NWI A;  3TKA A;  2M2V A;  2BCQ A;  5KFM A;  5KFX A;  2BE3 A;  3E58 A;  4NWI A;  4FO1 A;  2ZIX B;  9ICB A;  1UT8 A;  2JGA A;  3QX7 A;  4XA5 A;  4YVZ A;  2DF4 B;  4NL9 C;  5DDM A;  5DB8 A;  2BDP A;  4RQ3 A;  3NUQ A;  3HT3 A;  2DKX A;  1WWU A;  4BXO B;  5KT7 A;  3MC1 A;  5AM0 A;  3BS7 A;  4UQG A;  2Z7J A;  1PK1 A;  2NRX A;  3MBY A;  8ICH A;  4C80 A;  4IRC A;  1JQR A;  1KW4 A;  3KKA C;  2K4I A;  2W43 A;  1VJ5 A;  2WF6 A;  4EBE A;  2QB0 B;  4DS5 A;  2EWR A;  4EED A;  2ES6 A;  1TK8 A;  3OPX A;  2R8H A;  1ZQW A;  3WKA A;  1WG8 A;  2KV2 A;  5D49 A;  1ZD5 A;  3IG8 A;  2HOF A;  4GLX A;  9ICS A;  2YX8 A;  4K4H A;  4PGX A;  1F5A A;  4K8V A;  2ODG A;  5CR0 A;  4NY8 A;  4RU9 A;  8ICZ A;  2ZIV B;  4R66 A;  5KFI A;  4DFJ A;  1TKD A;  4JLZ A;  5AM2 A;  3C5F A;  3KD3 A;  5DB7 A;  4JWN A;  4RWQ A;  3BQT A;  4Y2T A;  2EAO A;  2ZIV A;  3LQC B;  2XGQ A;  2LM1 A;  1SL2 A;  1ZQL A;  4O3P A;  3PVX A;  4J03 A;  2KKP A;  5IIM A;  4B9V A;  3JCF A;  4GXJ A;  2IOF A;  9ICF A;  4B9S A;  1N5X A;  3OV7 A;  3M6Z A;  3GIJ A;  2NYV A;  2CPR A;  2K8C B;  2HDO A;  4RQN A;  5KFZ A;  2DUY A;  4UAR A;  4ECV A;  5HRE A;  4PGQ A;  4KLT A;  4M0A A;  4UB3 A;  3CRX A;  2HHX A;  9ICQ A;  4TUQ A;  5C0Y A;  3QYP A;  4RZR A;  2W04 A;  2W7O A;  4J9O A;  3OVS A;  5ALQ A;  4UBC A;  4PL1 A;  5ALU A;  1JMS A;  1KFS A;  4J9Q A;  3RTV A;  3H8M A;  3AQL A;  3SAF A;  4UB6 U;  3U26 A;  1QH9 A;  4OD0 A;  2FE9 A;  2LYB A;  3HKZ C;  2O6K A;  4CRX A;  2UVU A;  4C8M A;  1SV4 A;  1NI3 A;  1DRG A;  1PVR A;  2AH5 A;  3C28 A;  2FLP A;  4IG8 A;  4AT7 A;  4C4S A;  2ZJ8 A;  2XI9 A;  3TAN A;  1SIJ A;  1RYR A;  2GWS A;  2KSO A;  3E2E A;  5KFV A;  4DL6 A;  3NS1 A;  3A0B U;  3CK6 A;  3O0F A;  1Z00 A;  5AKL A;  1Q3V A;  2ZXI A;  3OTQ A;  1YLQ A;  1D9D A;  2KZM A;  5KFK A;  4EEB A;  4R8U A;  3T3F A;  4WC3 A;  2GH1 A;  2FPM A;  3PR5 B;  3AU6 A;  4WBZ A;  4I2J A;  4FS1 A;  3AMZ A;  2BQU A;  1OW5 A;  3RJE A;  4OAH A;  1UEU A;  4NXZ A;  3ERC C;  5AKE A;  1URJ A;  1N61 A;  5ALH A;  7ICK A;  4AYB C;  3PY8 A;  2KFZ A;  1Z3E B;  2MA1 A;  5IIJ A;  1LKY A;  4ECR A;  2BBH A;  4NLN A;  3WK8 A;  1YT3 A;  3SI8 A;  3RB4 A;  4EX7 A;  1L6N A;  2YN4 A;  3PV8 A;  2AQ4 A;  5DQI A;  3GII A;  1SZP A;  3SV3 A;  3C66 A;  2XID A;  2XCP A;  4ZOH C;  4UAY A;  1MIW A;  2W9B B;  4DS4 A;  4X4U A;  3UQ2 A;  1NJW A;  2MUT A;  2XO7 A;  1D8L A;  1Z00 B;  4K4G A;  4NJ8 A;  3PSI A;  5KFY A;  2YB1 A;  2LMR A;  4FZN A;  4O68 A;  4Q8F A;  4UD5 A;  4ED1 A;  4NKU A;  3BQ2 A;  1ZQF A;  2ZH1 A;  7ICR A;  2HHU A;  1ZD3 A; 
#chains in the Genus database with same CATH homology
 7ICO A;  1WCN A;  1NZP A;  4J9K A;  1QTM A;  1ZQB A;  1BVS A;  5KFL A;  3C2M A;  3H40 A;  5CP2 A;  3UQ0 A;  4DL4 A;  4IR1 A;  1ZQR A;  2ISO A;  4O0I A;  2HHT A;  4WC1 A;  2F1I A;  3ZDD A;  1RXV A;  1JXE A;  3ISC A;  1RXW A;  5KG6 A;  3AQN A;  4EZ6 A;  1MQ3 A;  4ECS A;  3RAQ A;  4I2A A;  1U49 A;  5HRI A;  2ZHA A;  1JN3 A;  1ZQM A;  3TAP A;  3SV4 A;  3G6X A;  1L3S A;  4RQ4 A;  1XSL A;  3GV8 B;  4ECY A;  3GV7 B;  3LWM A;  2FMP A;  4X4R A;  3GIL A;  4Q43 A;  4BDP A;  5DEC A;  1MIV A;  2DR5 A;  3T5H A;  4YXM A;  2HVH A;  2HHP A;  3GIK A;  4PHE A;  3H8W A;  3V7K A;  4RUC A;  3GIM A;  4WC6 A;  1KEJ A;  9ICH A;  4QZE A;  3C1Y A;  3EWA A;  5EOZ A;  5HRG A;  3HP6 A;  1CEZ A;  4I2I A;  4B9M A;  2VA3 A;  4X0A A;  1ZQI A;  4FHX A;  5KFH A;  2C2R A;  3BJY A;  3MR2 A;  4RQ1 A;  3KHH A;  5J2H A;  2I9G A;  4YQW A;  3M8S A;  4B9L A;  4IRK A;  7ICI A;  2BCS A;  1TV9 A;  4TQR A;  7ICJ A;  4FHP A;  5L1J A;  4I2G A;  1U48 A;  4X4N A;  4DSF A;  4M6W B;  3PO4 A;  3PW0 A;  4LVS A;  1WCL A;  4PPX A;  4F5P A;  5BPC A;  1R8A A;  1NJZ A;  2J6T A;  4KLU A;  9ICX A;  3V6H A;  4DLE A;  2R8K A;  4AT7 B;  4MF2 A;  2DRA A;  1ARO P;  4JV1 A;  4X5V A;  2V4Q A;  3V6K A;  2BCR A;  3EPG A;  4DSK A;  1QSY A;  2KTQ A;  3TAR A;  4PHA A;  4KLH A;  2Y1I A;  2BQR A;  2Q0Z X;  2JEJ A;  5J0S A;  1XU4 A;  4KLO A;  3ZDB A;  3T5K A;  5KFR A;  4GC6 A;  3WFQ E;  3MGH A;  1NKC A;  7ICF A;  5J2B A;  2FLL A;  1MC8 A;  3FYH A;  5J0P A;  5HP4 A;  3OGU A;  3V6J A;  2O1P A;  1S9F A;  2PFQ A;  2M2T A;  3TQ1 A;  5J0O A;  3QEA Z;  2FPK A;  4I27 A;  4QZF A;  2Y1J A;  1QSS A;  2ZUD A;  4X4T A;  4QZC A;  3THV A;  5HRH A;  4AT8 A;  4J9R A;  2PFP A;  4IQW A;  1S76 D;  4X0B A;  4O9M A;  2M2W A;  4FHV A;  1ZQV A;  2XCA A;  4MFF A;  1ZQE A;  2KN7 A;  4M9L A;  2ZH6 A;  5III A;  4WC0 A;  3OVB A;  1KLN A;  4DSL A;  1KRP A;  9ICU A;  2BPF A;  1N56 A;  2ASL A;  2DR8 A;  4RT2 A;  3AQM A;  4DSI A;  5F2V O;  1SKS A;  5CHG A;  4I2D A;  4I2E A;  7ICH A;  4Z6E A;  4XQ7 A;  4PHD A;  4M47 A;  5DGB A;  2MAX A;  4MFA A;  1NK6 A;  3L9D A;  5L1K A;  4EP7 A;  4B9U A;  4DFK A;  3UPS A;  3M9M B;  4RWN A;  4IQV A;  2P6R A;  3JPP A;  5KFJ A;  1JXL A;  4O3S A;  5DLG A;  2DFL A;  4UD4 A;  2JEF A;  5KG2 A;  3MGI A;  5KT2 A;  4R63 A;  3PR4 A;  1JAJ A;  1ZQG A;  4X4P A;  3PW7 A;  8ICW A;  4E7X A;  4F4Z A;  3H4B A;  2HHV A;  3OSP A;  1OU5 A;  4J9S A;  4I28 A;  1FA0 A;  1ZQA A;  3BQ1 A;  4P2H A;  1LV5 A;  4HYK A;  5J0R A;  4XRH A;  3BQ0 A;  2FMS A;  5HRB A;  1DGS A;  1IM4 A;  5J2J A;  4F5R A;  4BWJ A;  1ZQX A;  1JX4 A;  5J2E A;  3RRH A;  1DK2 A;  4QW8 A;  7ICM A;  1CUK A;  5HNK A;  5KFB A;  3PX6 A;  2JEI A;  4UB2 A;  3T5J A;  5IIO A;  4J9P A;  4DL5 A;  3M8R A;  1NK9 A;  3RAX A;  3RR7 A;  4ECU A;  3PW5 A;  2UVW A;  2A1J A;  2BHN A;  4RQ2 A;  5HRK A;  4X4S A;  5DGA A;  7ICG A;  3EW9 A;  2DPI A;  4KLF A;  4QZA A;  3HPO A;  4WBY A;  4DWI A;  2M9N A;  4ED2 A;  2MUT B;  4UB1 A;  2R8I A;  4TUP A;  2C2D A;  9ICA A;  4MEX A;  3MAB A;  4X4O A;  4O5C A;  4FH5 A;  2ZH4 A;  4O3R A;  2DRB A;  1DOQ A;  2AGO A;  5DKW A;  3H39 A;  4AT8 B;  1X9S A;  1RZT A;  4KLS A;  3RJG A;  3Q8K A;  1C7Y A;  4J9N A;  4FBU A;  5TZV A;  4QWD A;  9ICO A;  3Q8R B;  1KFD A;  1ZQS A;  1N48 A;  4EEY A;  2F1J A;  1Q79 A;  4Z6C A;  1X9M A;  2BPG A;  1BGX T;  4P4P A;  4QZ8 A;  3QE9 Y;  5KT5 A;  4YD1 A;  9ICL A;  1Q78 A;  1U45 A;  1BPY A;  2ZTC A;  4DL2 A;  4E80 A;  1XWL A;  8ICT A;  2P66 A;  8ICF A;  4M6W A;  5HR9 A;  5KFT A;  1K1S A;  4ATB B;  2OWO A;  4GXK A;  8ICS A;  1R89 A;  1RYS A;  4I2C A;  4RWP A;  4QZD A;  3RBE A;  1L5U A;  1TVA A;  5KT6 A;  9ICG A;  1ZQT A;  4EZ9 A;  5EWG A;  1B22 A;  2IA6 A;  2HHQ A;  4UBB A;  4WC5 A;  3C18 A;  3ISB A;  1HJP A;  3N97 B;  1UA1 A;  9ICJ A;  4DOA A;  4I2F A;  4PGY A;  5KG7 A;  4DOC A;  3PML A;  4MEY A;  1UA0 A;  4ECQ A;  4X4V A;  8ICX A;  5DBB A;  5KFG A;  5BOL A;  5DB9 A;  5JUM A;  4QZH A;  2W8K A;  1V4A A;  4KLL A;  4M5D A;  3GV5 B;  4RQ0 A;  3NTU A;  1NK5 A;  4O5K A;  4YCX A;  3JPS A;  3HIY A;  5J2K A;  4JWM A;  5KFU A;  2M2U A;  1V9P A;  2NRW A;  5J2I A;  1RPL A;  4DO9 A;  4DF8 A;  5CJ7 A;  1ZQH A;  4F4K A;  5HHI A;  4DQI A;  3WFS C;  4E8F A;  4IRD A;  1ZQC A;  3MR3 A;  4JK1 A;  4FHY A;  2W9A A;  1NK4 A;  3RJJ A;  3H8S A;  3NGD A;  4IQT A;  8ICA A;  5J0U A;  4RQ7 A;  2W9C A;  5IIN A;  4DF4 A;  1T8E A;  1BPZ A;  4E0D A;  2XY6 A;  3QEB Z;  4QWA A;  5IIL A;  2PI4 A;  3RB0 A;  5BOM A;  8ICU A;  7ICS A;  1TFY A;  2V9W A;  2H5X A;  3HW8 A;  2WTF A;  5J2A A;  4YD2 A;  5KG5 A;  5HMM A;  4I29 A;  1S10 A;  1IXR A;  3C5G A;  4DQS A;  5KFO A;  3UXP A;  9ICR A;  4G3I A;  4LT6 A;  1ZQY A;  4FH3 A;  4M2Y A;  7ICT A;  3WFO A;  5J0X A;  9ICV A;  2PXI A;  4DLG A;  4YR3 A;  9ICN A;  4QZI A;  4RQ8 A;  2ZJ5 A;  3Q8Q B;  3OHA A;  3ZDC A;  3AUO A;  5CWR A;  4Q44 A;  1BNP A;  3GDX A;  1XSN A;  2J6S A;  4NLK A;  8ICN A;  3H7I A;  4C8O A;  2ISP A;  3MDC A;  4EBC A;  4Q8E A;  3ZDE A;  3M9O B;  4GXI A;  5DB6 A;  5HRL A;  5J0T A;  4F4W A;  4NLG A;  4YXJ A;  4YP3 A;  3HJ4 A;  1S0M A;  4AT9 B;  4BWM A;  3LK9 A;  8ICL A;  4R64 A;  1NK0 A;  4JUZ A;  1UEV A;  4YMO A;  5J0Y A;  1SL1 A;  1XS9 D;  2W9B A;  3EYZ A;  4EYH B;  5HML A;  4XQ8 A;  4C8L A;  4KLQ A;  3WFP A;  2RDJ A;  2FPL A;  2I1Q A;  4EBD A;  2HVI A;  2PFN A;  1TAU A;  1ZQD A;  9ICT A;  4EBJ A;  4UB5 A;  2P6U A;  3SYZ A;  4QZB A;  4DQP A;  3TFS A;  4RNN A;  4M9N A;  3C21 A;  4EYI B;  4DQQ A;  1PX5 A;  2ZUB A;  5DG7 A;  2BCQ A;  2M2V A;  5KFM A;  5KFX A;  4M9J A;  2DR9 A;  2BE3 A;  3LDA A;  4RT3 A;  4ECZ A;  4I2B A;  9ICB A;  1UT8 A;  3FDS A;  3JPR A;  1JIH A;  4M9H A;  1K1Q A;  1KSP A;  1U9L A;  5DLF A;  4FBT A;  3C1Z A;  2ZJA A;  2ASJ A;  5J2D A;  4XA5 A;  4KN4 A;  1ZJN A;  1NO5 A;  4YVZ A;  1UT5 A;  5DDM A;  5DB8 A;  2KZZ A;  2BDP A;  4RQ3 A;  4KLJ A;  1VJ7 A;  3UXN A;  4F93 B;  3MFI A;  3MR5 A;  5HHH A;  4F4X A;  5D4B A;  4KLG A;  3UPQ A;  3HT3 A;  4CCH A;  1QLN A;  4J9L A;  1KFT A;  4LZG A;  4KTQ A;  4BXO B;  2PBE A;  5CA7 A;  3RB6 A;  3OJS A;  5KT7 A;  1WOT A;  1UET A;  2B21 A;  4UQG A;  1B43 A;  2BGW A;  3OSN A;  2NRX A;  3RJK A;  4KN7 A;  2ASD A;  9ICI A;  1R8C A;  1HUO A;  4KIT B;  4RWO A;  1ZQJ A;  4IQU A;  4RUA A;  3MBY A;  1TK0 A;  4YR2 A;  8ICP A;  5J29 A;  8ICH A;  2AGQ A;  4IRC A;  1JQR A;  1L3T A;  1BPB A;  7ICN A;  1L3U A;  8ICO A;  4YMN A;  4WC4 A;  4Z6D A;  1H38 A;  3EPI A;  2VA8 A;  5DQH A;  4DOB A;  4FO6 A;  2ZTE A;  4ELV A;  8ICR A;  3B0Y A;  4YN4 A;  8ICV A;  4EBE A;  4DS5 A;  1X2I A;  4DSJ A;  5L1L A;  3G6V A;  3JZ0 A;  3Q8S B;  1LB2 B;  3C2L A;  2AJQ A;  5HC9 A;  3T5L A;  3N4M B;  4DQR A;  4LZD A;  5KFS A;  2KP7 A;  5DBC A;  3H4D A;  1TK8 A;  4ECX A;  2R8H A;  1ZQW A;  3QZ8 A;  3RH6 A;  3Q8P B;  2PFO A;  2DVI A;  4ZH4 A;  4GC7 A;  1BPD A;  1L3V A;  5KG4 A;  2IHM A;  1PZN A;  5KT3 A;  4RPZ A;  1KTQ A;  3OJU A;  2XY7 A;  1XO1 A;  4F3O A;  1S77 D;  1U47 A;  4Z6F A;  5D49 A;  3MDA A;  4GLX A;  2BQ3 A;  9ICS A;  3PW2 A;  1ZET A;  1KDH A;  3ZD9 A;  4K4H A;  4TQS A;  4NLZ A;  5KTQ A;  4PGX A;  1F5A A;  3V7J A;  1ZYQ A;  3H3A A;  4ED6 A;  5DQG A;  5CR0 A;  4NY8 A;  3JPN A;  8ICG A;  4O3O A;  3UXO A;  4RU9 A;  2NRZ A;  3PMN A;  8ICZ A;  4MF8 A;  1SKW A;  1S0V A;  4KLI A;  4R66 A;  4DSE A;  3V7L A;  3C2K A;  2HHS A;  1MQ2 A;  1S0O A;  5KFI A;  4KMU A;  3OUY A;  5J0Q A;  4ED8 A;  4ELU A;  5HRD A;  4DFJ A;  3MFH A;  4IR9 A;  1TKD A;  4YMM A;  2NRK A;  1VFG A;  1XSP A;  4R8U B;  1Y88 A;  3C5F A;  3K75 D;  3KHG A;  5DB7 A;  3RH4 A;  4JWN A;  4M04 A;  3OVA A;  4NM1 A;  4RWQ A;  3BQT A;  4QWB A;  1MIY A;  5CB1 A;  4BGD A;  2AGP A;  4JV2 A;  8ICM A;  1NK8 A;  2BCV A;  3LQC B;  4QZG A;  2XGQ A;  1SL2 A;  2ID1 A;  4F92 B;  5KFP A;  4O3P A;  1ZQL A;  2C2E A;  3PVX A;  7ICL A;  2BKE A;  4ECT A;  4ED0 A;  1NKE A;  4Q45 A;  2HHW A;  8ICC A;  8ICK A;  4YFK A;  5KG0 A;  5IIK A;  3ZDA A;  4F4Y A;  5IIM A;  4B9V A;  9ICE A;  4GXJ A;  4ECW A;  3RJI A;  5KFW A;  1U4B A;  9ICF A;  4F5Q A;  4B9S A;  3JPT A;  1NOM A;  1S97 A;  3OV7 A;  4I2H A;  2F1H A;  3ETL A;  4F91 B;  2ATL A;  4ED7 A;  3GIJ A;  2FLN A;  4C8K A;  4F5O A;  3RB3 A;  7ICV A;  2KFN A;  1ZQP A;  3KHR A;  1COO A;  2BR0 A;  1ZQO A;  2W8L A;  3WFR E;  5DG8 A;  8ICB A;  1T3N A;  3JPQ A;  5KFZ A;  2BCU A;  4R65 A;  3ORY A;  2W9C B;  3RJF A;  5L9X A;  9ICM A;  9ICW A;  4F50 A;  1KNY A;  4X4Q A;  1HUZ A;  3Q8M A;  5DED A;  1XC9 A;  1S0N A;  4ECV A;  5J2F A;  4WCW A;  5HRE A;  4BXO A;  4PGQ A;  4DEZ A;  3LWL A;  2BPC A;  5KFF A;  4RQ5 A;  1BPX A;  2J6U A;  5KG1 A;  4FHW A;  4PHP A;  4RPY A;  5KFN A;  4KLT A;  4RQ6 A;  3JPO A;  4M0A A;  4DFM A;  4UB3 A;  1ZJM A;  2IBK A;  4MFC A;  4K4I A;  2UVR A;  2HHX A;  9ICQ A;  2C22 A;  4TUQ A;  2JEG A;  4RZR A;  2XGP A;  4S3N A;  1ZQQ A;  4M9G A;  5KT4 A;  3GFK B;  4J9O A;  5L1I A;  1NJX A;  3OVS A;  3KHL A;  5KFQ A;  3JYY A;  1TAQ A;  4UBC A;  4QWE A;  4P4M A;  2ZHB A;  2VAN A;  5J0W A;  4TUS A;  9ICP A;  1SKR A;  5J2G A;  2IMW P;  1KFS A;  1JMS A;  9ICK A;  4J9Q A;  3H8J A;  3RTV A;  4PH5 A;  4NM2 A;  3MR6 A;  8ICQ A;  3M9N B;  8ICI A;  3AQL A;  2RFF A;  2DR7 A;  4KLD A;  3H38 A;  4F8R A;  2C28 A;  2ZH3 A;  4P4O A;  1TFW A;  2ZH7 A;  5DG9 A;  3G6Y A;  4ED3 A;  2UVV A;  2UVU A;  4B9T A;  7ICU A;  4C8M A;  3PX4 A;  2JZB A;  1MSW D;  3RBD A;  4DL3 A;  2HW3 A;  1X9W A;  3SZ2 A;  2AU0 A;  3B0X A;  1ZQZ A;  2ZH9 A;  2AQ0 A;  3V72 A;  2FMQ A;  5EWF A;  4TUR A;  2DPJ A;  5F9N A;  4ELT A;  2FLP A;  4AT9 A;  4IG8 A;  4DFP A;  1BNO A;  4AT7 A;  5KFC A;  5D46 A;  5KFE A;  4C8N A;  1ZQN A;  2JZB B;  2ZJ8 A;  2ZH2 A;  4O5E A;  2KZ3 A;  4O3N A;  3AU2 A;  3TAN A;  1RYR A;  3NYB A;  2GWS A;  3E2E A;  5KFV A;  4DL6 A;  3H37 A;  3GQC A;  5KG3 A;  4DL7 A;  1Z00 A;  3KTQ A;  3TI0 A;  1EXN A;  3K4G A;  5KFD A;  2PI5 A;  1YLQ A;  2A1J B;  1D9D A;  2KZM A;  2NRV A;  5KFK A;  2ALZ A;  4WC7 A;  7ICP A;  1A77 A;  4JV0 A;  4F5N A;  3IM1 A;  4R8U A;  3HWT A;  3T3F A;  7ICQ A;  4WC3 A;  2FPM A;  2ZH5 A;  1BPE A;  3HJ1 A;  2XC9 A;  3RH5 A;  4KLM A;  4RNO A;  8ICY A;  2ZTD A;  3PR5 B;  3AU6 A;  4WBZ A;  4I2J A;  1NJY A;  4FS1 A;  7ICE A;  8ICE A;  2RDI A;  2BQU A;  2V4R A;  1D8Y A;  3RJE A;  3TAQ A;  4QW9 A;  2IHN A;  5DBA A;  1A76 A;  5C5J A;  4RNM A;  5KFA A;  4YR0 A;  4UAW A;  3RRG A;  4NKT A;  3HX0 A;  4RPX A;  1UEU A;  4NXZ A;  3BDP A;  3EZ5 A;  1T7P A;  3TFR A;  5EWE A;  7ICK A;  3PY8 A;  4YG2 A;  4KLE A;  2Q66 A;  2KFZ A;  2O5A A;  4ATB A;  1Z3E B;  5IIJ A;  3C23 A;  2W9M A;  1SL0 A;  3OUY B;  4ECR A;  4F2R A;  1ZQU A;  4NLN A;  3SI8 A;  3RB4 A;  2XY5 A;  3PO5 A;  3OHB A;  4XUS A;  2VA2 A;  3PNC A;  2ZUC A;  5DDY A;  3PX0 A;  3QZ7 A;  1TFR A;  4UAZ A;  3AQK A;  4FS2 A;  4UB4 A;  3RR8 A;  5F9L A;  3ISD A;  3PV8 A;  1NKB A;  2AQ4 A;  2R8J A;  5DQI A;  3GII A;  4EBK A;  1SZP A;  3SV3 A;  2LYH A;  3C66 A;  2NRT A;  2ZH8 A;  1T4G A;  4B9N A;  2XCP A;  4UAY A;  4F2S A;  1QSL A;  1MIW A;  2W9B B;  3RJH A;  4DS4 A;  4X4U A;  1R8B A;  1NK7 A;  3IHQ B;  1ZQK A;  3UQ2 A;  1NJW A;  2MUT A;  2XO7 A;  1D8L A;  1Z00 B;  4K4G A;  5KFY A;  4QWC A;  5J2C A;  1TK5 A;  1D9F A;  4WC2 A;  1DK3 A;  8ICJ A;  4Q8F A;  4UD5 A;  4ED1 A;  4NKU A;  3BQ2 A;  3PW4 A;  4QZ9 A;  1ZQF A;  2ZH1 A;  7ICR A;  2HHU A;  3Q8L A;  3ZD8 A;  4J9M A;  2R8G A;  4O3Q A;  9ICC A;  5HRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...