5DB6A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dc
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 102
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db6A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db6A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db6A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db6A03
2Y1JA 5KFUA 4Q45A 3OJUA 1ZQDA 4JWNA 9ICWA 9ICRA 4ATBA 3WFSC 4NLKA 1C7YA 3WFRE 5KG7A 4IR1A 3T3FA 1F5AA 1Z3EB 5KFSA 3SZ2A 1X9WA 5DB7A 1T7PA 4EYHB 3C5FA 4I2EA 2HHSA 3MDAA 4AT9B 1HUZA 4RWNA 1ZQPA 4K4IA 1ZQKA 7ICFA 2ZH8A 3TARA 2RFFA 4DEZA 2DPIA 4XUSA 1KDHA 3ISBA 4QWAA 7ICNA 3GILA 4JV1A 5KT5A 2V9WA 4I2DA 5DKWA 3GIKA 5HRHA 3AQNA 4RU9A 3PMNA 2P66A 5HNKA 4FBUA 1ZQOA 3OSPA 3B0XA 4FHYA 5DECA 1UA0A 2DVIA 2AGPA 5HRFA 5KFRA 4TURA 3M8RA 1NK5A 4QZCA 2BKEA 1S77D 2HHPA 3PNCA 1ZQFA 2XGQA 2DRAA 4YMMA 2M2WA 1JQRA 3TQ1A 1XO1A 4ECSA 4YR3A 4B9VA 5DB9A 4B9LA 3GQCA 4B9SA 8ICUA 4PGXA 7ICSA 3LWMA 1T4GA 3OUYB 4KLSA 2ISPA 4QW9A 4ECWA 4F4WA 2UVVA 1MC8A 3H7IA 8ICLA 2IHMA 3RJHA 4ECRA 1XSLA 4EP7A 1ZQXA 1U47A 3MR6A 4J9MA 4O5CA 5KT6A 3MR5A 4TUPA 4KLOA 4ZH4A 1ZETA 2HHTA 9ICLA 5HREA 5DLGA 4PHAA 1ZQSA 4QZAA 3OVBA 4F50A 2PFNA 4FBTA 2BPGA 4O3OA 3Q8PB 4M6WA 3B0YA 5J0TA 3JPTA 1BGXT 3PX4A 3PX0A 1MQ2A 4Q8EA 2KFZA 3H39A 1TV9A 1ZQQA 4P4MA 2RDJA 2HHVA 1X9SA 4MEXA 4ED8A 3GFKB 4IQTA 4PGYA 3T5JA 2AJQA 2ZH6A 2FPLA 5KFYA 3RJEA 4QW8A 5EWFA 2BCUA 1TFRA 1KFTA 4NKUA 2HHXA 2Q0ZX 1JN3A 1TAQA 3TFSA 1UEUA 3M8SA 9ICPA 4UB2A 4ECZA 3RR8A 1N56A 2ZTEA 5IILA 1KLNA 4JUZA 4ELUA 3LDAA 4ELVA 1T8EA 1LB2B 4Z6FA 3BJYA 5BPCA 1XWLA 1ZQJA 3BDPA 5KG4A 5J0PA 5BOLA 1XSPA 2C2EA 2J6TA 4QZGA 4F4KA 1MSWD 5DQIA 3TANA 4F93B 3PW0A 2ALZA 1SKWA 4I27A 3H4BA 4NKTA 2ZH9A 2FLPA 7ICMA 1BNPA 4UD4A 4X4RA 1X9MA 1CEZA 3GV8B 3RB0A 3JPOA 4DOBA 4RWPA 5KG5A 5L1IA 4KLTA 5KT3A 1ZQTA 2F1HA 2FLLA 3C2LA 4PPXA 1D8LA 5KFCA 1ZQWA 4RQ4A 3PR4A 4EYIB 1WCLA 4DOAA 1T3NA 7ICRA 2R8IA 2C2RA 1SKSA 4M5DA 1S0OA 1FA0A 2PFOA 1NKCA 1UETA 4F2SA 4J9RA 3ZDCA 4KLGA 2C2DA 2W9CA 3SV4A 3HT3A 2J6UA 2KZ3A 4M9HA 4QZFA 1KEJA 4J9PA 4DL6A 2NRTA 3PW2A 1D8YA 5CWRA 2BE3A 5KFWA 3ETLA 3Q8SB 4NLZA 3MGIA 4KLQA 4RQ6A 8ICNA 1VJ7A 2UVWA 1R8AA 1QTMA 2DR8A 4I2BA 2PI4A 2IBKA 2XY7A 2DFLA 1A77A 8ICIA 5CR0A 4Q44A 4QWDA 4FHVA 3ZD9A 2MAXA 3TAQA 8ICHA 2R8GA 4Z6DA 1NK9A 4E7XA 1PZNA 2BCQA 2ZUCA 4DSIA 2JEGA 9ICIA 5KFNA 1S0NA 2NRWA 1NJZA 4DSKA 3EZ5A 2ZJ5A 1KSPA 4R64A 4X4UA 2ZTDA 1U48A 3IHQB 4F5NA 3RRHA 3GIJA 1BPZA 4XQ7A 2A1JB 4UB5A 9ICNA 2B21A 2RDIA 1WOTA 4F5QA 4HYKA 1ZQLA 5J2JA 4RQ1A 4IR9A 4IG8A 4RQ2A 2DRBA 3C2KA 3PY8A 3HJ4A 7ICQA 3EPGA 3UXOA 5KFPA 4X4VA 1Z00A 4DFJA 8ICOA 1R8CA 4EZ9A 1ZQZA 4KLJA 8ICSA 1JXLA 2W9MA 4QZBA 3V6KA 4RQ8A 1IXRA 2BHNA 4XA5A 1BNOA 4E80A 2I9GA 4NLGA 1ZQNA 4P4OA 1NKEA 1RPLA 3V72A 9ICAA 4O5EA 4IRKA 4PHDA 3C1ZA 1ZQMA 4M2YA 4AT7A 1MIYA 3OHAA 5L1LA 4FHPA 5J0UA 1R89A 5KG1A 4TUQA 1JXEA 4X4TA 1VFGA 3OHBA 1XC9A 2UVRA 4RWQA 2W9BB 4O9MA 4EBJA 2ZH3A 3UXPA 2C28A 4BXOA 4C8MA 2BQUA 3ZD8A 4PGQA 7ICJA 5HRBA 4X4OA 1KTQA 2KZZA 4TUSA 1JIHA 2PBEA 4IQUA 3Q8MA 4UB4A 4YMOA 4WC6A 2HHQA 3MFIA 5KFJA 2ZUBA 4KLIA 5J0QA 3EYZA 2XCAA 4DQQA 4F91B 1CUKA 2O1PA 4M0AA 2VA2A 4ECYA 4ECUA 2ZHBA 2ISOA 4C8LA 1DK3A 1UEVA 4QZDA 3RJFA 4YR2A 3BQ2A 4RNMA 1TK0A 1UA1A 2BCRA 1NK0A 4Q8FA 1B22A 1BPDA 4J9OA 1XS9D 1ZQVA 1X2IA 5DBCA 2F1JA 3C21A 4RPYA 3RJIA 1TK5A 2PFQA 1TAUA 2W8KA 2XGPA 2M2UA 4KN7A 1NJXA 2LYHA 2PXIA 1QSLA 4DFPA 3PW7A 5KFOA 3RH6A 2R8JA 4G3IA 4QZHA 4UAWA 4ED2A 1S0MA 2HHWA 8ICJA 3MBYA 1RXVA 3MDCA 3JYYA 9ICUA 3RJKA 1AROP 4X4QA 3HX0A 4QZ8A 1TK8A 4O3SA 3Q8LA 1XSNA 1ZQYA 8ICBA 1TFWA 2ZTCA 1RYRA 4X0BA 1RXWA 3M9OB 4MFFA 4I28A 3PX6A 1SL0A 3G6VA 2JEJA 7ICHA 4X4NA 2IHNA 1SZPA 4M9NA 4KLEA 4RQ3A 1U45A 3BQTA 5KFKA 4TQSA 3EPIA 4DFKA 3RR7A 8ICMA 9ICFA 3Q8KA 4GC6A 9ICVA 5HRGA 4WC1A 1EXNA 2ASLA 2A1JA 5KFQA 4DQRA 8ICGA 2NRKA 4AT8A 5J0RA 4GC7A 3TI0A 2JZBA 4KN4A 4DLGA 1SKRA 4DF4A 3OVAA 3JZ0A 4J9LA 3LQCB 1L3VA 1L5UA 2DR5A 1UT8A 5DDYA 1D9DA 5KG2A 2FLNA 5J29A 1TKDA 2M2VA 3H38A 1DOQA 1MIWA 3H3AA 5DG8A 4QWBA 9ICTA 1BPBA 3PMLA 3NGDA 2XC9A 3V7JA 2MUTB 4C8OA 4WC7A 3PO4A 4QWEA 3E2EA 1ZQUA 4R8UB 5J0SA 3G6YA 2JEIA 3H37A 4ATBB 3RJGA 4J9NA 1N48A 2JEFA 2ZH4A 3OJSA 2Q66A 3AU2A 3UXNA 3JPPA 3H40A 3ZDAA 4AT9A 4I29A 1U49A 3PO5A 3L9DA 4LT6A 2M9NA 3UPQA 4RQ0A 3G6XA 4I2FA 1UT5A 1K1QA 5HP4A 3OSNA 4KITB 1NOMA 3SYZA 3C66A 4DO9A 4F3OA 1S76D 2XY6A 4FHWA 4X4PA 4ECQA 2ZHAA 4UAZA 5DLFA 3PVXA 3OV7A 1NK7A 1LV5A 1Y88A 5KTQA 4UB3A 4DQSA 4R66A 1NK4A 1QLNA 1JAJA 4RQ7A 1BPYA 5EWEA 2VANA 5IIIA 3WFQE 7ICIA 3JPSA 1Q79A 3PV8A 4BWJA 5D46A 3KTQA 2KFNA 2AU0A 2ZH1A 4R65A 2XY5A 5J2CA 4LZDA 3QZ7A 2V4RA 1IM4A 4O0IA 4RQ5A 4KLUA 8ICPA 3RBEA 4X4SA 4GLXA 4DOCA 2AQ4A 2P6UA 1U4BA 4K4GA 1OU5A 4XRHA 3OUYA 5EOZA 4BWMA 3C1YA 9ICKA 1KNYA 4UAYA 2BR0A 4DQIA 1NO5A 2XCPA 5KFGA 3RB3A 4PHPA 4EBCA 4MEYA 7ICOA 5IIJA 1S0VA 4KLFA 8ICVA 5HR9A 3H8JA 1RZTA 5HRKA 3EW9A 8ICEA 4I2IA 3JPNA 5DG7A 3KHLA 4Z6EA 2DR7A 4JV0A 5BOMA 4F5PA 4KTQA 1NJYA 3MFHA 5KFVA 4DSLA 5C5JA 1L3TA 4B9UA 5HRDA 2KZMA 4YQWA 2BQRA 5KT7A 4M6WB 4MFAA 5J2AA 4DL4A 5HHIA 2V4QA 5KFZA 5TZVA 7ICKA 4DLEA 2PFPA 1S10A 4EBDA 4I2CA 4F5RA 3HW8A 4YFKA 3SV3A 4YMNA 2FPKA 4Z6CA 4RUCA 4R63A 4M9GA 1DK2A 1NJWA 3V7KA 1NK8A 5DGBA 4I2AA 7ICUA 4O5KA 4RNNA 4DFMA 2O5AA 5CJ7A 4YXMA 3V6JA 7ICTA 5KFIA 9ICHA 4FHXA 1NZPA 3TFRA 2BPCA 4RPZA 9ICCA 2AGOA 4ED1A 4ED3A 9ICOA 3LWLA 5KFBA 1ZQGA 5KFTA 5KFLA 4I2GA 5DGAA 3HPOA 2HHUA 1MIVA 4RNOA 5J0OA 2NRZA 4O3NA 5KT4A 1A76A 4DS5A 3HWTA 4J9KA 3PW5A 2BQ3A 2GWSA 5DBAA 5IIMA 1ZQHA 4JV2A 4EZ6A 4KLHA 8ICCA 2HVIA 4WBZA 3GV7B 4QZIA 3AU6A 4R8UA 4S3NA 3H8SA 3V6HA 1H38A 8ICKA 1Q78A 4IQWA 1DGSA 3MR3A 8ICWA 5DG9A 2P6RA 3AQMA 4JK1A 3T5HA 7ICPA 4M47A 3AQKA 4E8FA 3JPQA 4NXZA 4K4HA 5HHHA 4M04A 8ICQA 4KLLA 1B43A 3FDSA 5L9XA 2Y1IA 4YN4A 1KRPA 4F8RA 4NM1A 2KN7A 2BCVA 2J6SA 4WC5A 4DL2A 4DSEA 1ZYQA 4DSJA 2W9CB 7ICEA 5F2VO 4ECVA 2C22A 4RWOA 1ZQEA 3GIIA 4ELTA 1COOA 4RT2A 4FO6A 4DWIA 7ICVA 1ZQCA 3Q8RB 1ZQRA 2BGWA 4UBCA 2IA6A 4BDPA 9ICGA 3C2MA 4WC4A 3GV5B 5CHGA 1SL2A 5KG0A 1QSSA 4DQPA 4LZGA 5F9NA 3RH4A 4EBKA 3T5KA 5EWGA 1S97A 3ZDEA 4YXJA 4IQVA 4QZ9A 4UQGA 1HUOA 4NM2A 3KHGA 2BCSA 2ID1A 1KFSA 4RZRA 1TVAA 4F2RA 3AQLA 9ICEA 3EWAA 1YLQA 5CB1A 1JX4A 3ZDBA 2HVHA 2DR9A 4UB1A 3HIYA 5IIKA 7ICLA 5KFHA 3ISDA 4X5VA 5J2EA 2FMPA 3WFOA 2NRXA 1U9LA 3QEBZ 2AGQA 2NRVA 1KFDA 4FH5A 4F92B 2FMSA 4ED6A 5HRIA 4EEYA 4TQRA 5DBBA 2F1IA 5KFMA 4M9JA 3RTVA 9ICJA 2R8KA 1BPEA 5KFFA 3GDXA 5KT2A 5KG3A 2VA3A 4E0DA 3WFPA 1D9FA 3C23A 1Z00B 2W8LA 5D4BA 4I2JA 1PX5A 5DQGA 2WTFA 3HJ1A 8ICZA 3RAXA 5J2HA 8ICRA 3Q8QB 2BDPA 4DS4A 4P2HA 5IINA 1R8BA 4YD1A 2VA8A 5J2KA 1ZQBA 3RB4A 3QE9Y 3QZ8A 4F5OA 1ZQIA 4GXKA 4I2HA 3FYHA 5J2DA 4RUAA 2BPFA 4YD2A 4NLNA 4WBYA 4AT7B 4ED0A 9ICBA 3NTUA 5HMMA 3IM1A 5CP2A 5JUMA 3JPRA 2W9BA 3RRGA 5J0WA 4WCWA 5KFXA 3UPSA 4F4YA 5DQHA 4X0AA 3V7LA 5DB6A 4DF8A 4BXOB 4IRDA 4NY8A 3N97B 5HMLA 3C5GA 2KTQA 4FH3A 1JMSA 2HW3A 5J2GA 4RT3A 4M9LA 4FS1A 5HC9A 4EBEA 3THVA 4JWMA 4F4ZA 9ICSA 3ORYA 4YCXA 4YR0A 3HP6A 2W9AA 9ICMA 3MR2A 8ICAA 3SI8A 2PI5A 4CCHA 5F9LA 2R8HA 2OWOA 3RJJA 2XO7A 5KFAA 4YVZA 8ICXA 4KMUA 3RAQA 1K1SA 5J2BA 8ICTA 4B9MA 4RPXA 3UQ2A 3GIMA 2ZH7A 5DDMA 3M9MB 2FPMA 4BGDA 2H5XA 4KLMA 1L3UA 1WCNA 5J2IA 3UQ0A 4C8NA 4MFCA 2ZUDA 2ATLA 5KFDA 4J9QA 4Q43A 4ECTA 1QSYA 4YP3A 2ASJA 1XU4A 2ASDA 4KLDA 8ICFA 5L1JA 3BQ0A 4ECXA 3MABA 3K75D 1HJPA 4DL5A 2FMQA 1V9PA 5IIOA 5J0YA 3PR5B 2M2TA 5HRLA 4O3PA 4GXIA 4WC3A 2ZJ8A 4QZEA 3PW4A 1BPXA 7ICGA 2ZJAA 4C8KA 5KFEA 9ICQA 4YG2A 3AUOA 1S9FA 4PH5A 3K4GA 3LK9A 4ED7A 3T5LA 3TAPA 1SL1A 9ICXA 4XQ8A 2AQ0A 3N4MB 3M9NB 1MQ3A 2ZH2A 2UVUA 3OVSA 4MF8A 2DPJA 4DL3A 2IMWP 4O3QA 5L1KA 1ZQAA 1BVSA 1V4AA 4DL7A 3H4DA 3RB6A 5DB8A 1L3SA 4FS2A 3KHRA 4MF2A 4AT8B 3QEAZ 3MGHA 3ISCA 2JZBB 4B9NA 5J2FA 5J0XA 5DEDA 2I1QA 3NYBA 4DSFA 4UBBA 4WC2A 3RBDA 4GXJA 2KP7A 8ICYA 4F4XA 3BQ1A 3KHHA 4IRCA 1RYSA 4WC0A 4B9TA 5KG6A 1NK6A 2ZH5A 3H8WA 3RH5A 4LVSA 4P4PA 2MUTA 4UD5A 3C18A 3ZDDA 4QWCA 5D49A 3OGUA 1ZJMA 1ZJNA 1TFYA 1NKBA 4O3RA 5CA7A 4PHEA 4J9SA
chains in the Genus database with same CATH superfamily
2Y1JA 3OJUA 1ZQDA 2N1RA 9ICRA 9ICWA 5AM0A 4NLKA 1C7YA 5F3XB 1F5AA 1Z3EB 2VIXA 4NWIA 5KFSA 3L3FX 2ZXHA 3C5FA 4I2EA 2ES6A 3MDAA 5AKXA 4RWNA 4DEZA 1O03A 2DPIA 1KDHA 3ISBA 1SV0C 4QWAA 2IOFA 2DWQA 4I2DA 5DKWA 3CNHA 2MRLA 4FBUA 3OSPA 5DECA 3M8RA 1NK5A 4QZCA 3TQ1A 3IP4B 4YR3A 4B9VA 2H3FA 4B9SA 2KHQA 3OUYB 4KLSA 4QW9A 2RQ5A 1PVPA 2E1FA 5KT6A 3MR5A 4TUPA 4KLOA 4ZH4A 1ZETA 2HHTA 1UHUA 9ICLA 1DXSA 2F8KA 4M6WA 1MQ2A 1BGXT 2KKVA 2KFZA 3H39A 3K7DA 1TV9A 1SWWA 4P4MA 2HHVA 2M0NA 2FPLA 3PSFA 1KFTA 2F44A 2HHXA 1JN3A 4AYBF 3RR8A 3PZPA 1XNSA 3LDAA 3DEEA 1T8EA 5BPCA 2ZIUA 1ZQJA 5BOLA 2DGZA 2C2EA 1MSWD 4PJ0U 3PW0A 1SKWA 1YZ6A 4I27A 4NKTA 4UD4A 7ICMA 5ALLA 2OEHA 5KG5A 4RWPA 4PZOA 1ZQTA 4NXUA 1WCLA 2R8IA 2C2RA 2A19A 2KV2A 1FA0A 1UETA 5AK6A 5AKZA 1TAMA 2W9CA 4DL6A 2BE3A 5KFWA 4KMOB 3MGIA 4RQ6A 1VJ7A 4CNQA 1R8AA 3AQFA 4I2BA 2IBKA 2XY7A 1IG6A 5CR0A 4Q44A 4QWDA 1NK9A 1PZNA 2BCQA 4DSIA 3IRUA 3QUTA 4NXTA 4R64A 3VCBA 1ZRMA 4F5NA 4XQ7A 2A1JB 5ALRA 1KN5A 4AP9A 2B21A 1WOTA 4HYKA 1ZQLA 1PK3A 5ALTA 4O6AA 3PY8A 1KQQA 3EPGA 3UXOA 5KFPA 1JXLA 4QZBA 4NLCA 4E80A 2I9GA 4NLGA 1RPLA 4CRXA 3EF2A 9ICAA 2QLTA 3WK7A 2LI6A 2LKYA 3UXPA 3QXGA 4C8MA 5HRBA 3ZD8A 1L8LA 1KTQA 2YMMA 2KHVA 4TUSA 4YMOA 4U6PA 3QU5A 5KFJA 4OJPA 4KLIA 5AKJA 4F91B 1CUKA 3S6JA 5AKYA 2VA2A 2ODGA 1FO4A 3K1RB 4ECUA 4C8LA 3RJFA 4B6JA 1TK0A 1UA1A 4RPYA 3RJIA 3N7SC 2PFQA 1JUDA 2QARA 2LYHA 4KN7A 2LYBA 4G3IA 2Z7JA 4QZHA 4ZOHC 3MDCA 3JYYA 3RJKA 5HR6A 3BZCA 1F5SA 1XSNA 1ZQYA 3E58A 5B3QA 3IDWA 1ZD2P 2EWRA 3M9OB 5ALKA 4KLEA 1RYUA 3BQTA 9ICVA 3EPIA 9ICFA 4GC6A 5HRGA 5JTGA 2EAMA 5FP0A 3WKEA 1SKRA 1WUDA 3JZ0A 4J9LA 3BQ7A 3K1ZA 4Y2TA 2DR5A 2JH7A 2HOIA 1HIWA 5KG2A 4QWBA 2LYAA 3PMLA 5ALZA 5AK5A 1ZQUA 5J0SA 4ATBB 3RJGA 2JEFA 3OJSA 2Q66A 4AT9A 3JPPA 3L9DA 2HOFA 4F71A 2ESEA 3G6XA 3OWGA 1K1QA 2E8PA 3SYZA 4KITB 4UB6U 5G5HA 2XY6A 5DLFA 3OV7A 1SXEA 3PVXA 1NK7A 1Y88A 1NK4A 1QLNA 1BPYA 1B4FA 5KL1B 3PV8A 2KFNA 2AU0A 1IM4A 4DOCA 3QU4A 5AI4A 4K4GA 1TE2A 4BWMA 3C1YA 4DQIA 4MEYA 7ICOA 5IIJA 1S0VA 2XVTA 2JXJA 1L8OA 1UPHA 5HRKA 2QB0B 4I2IA 5DG7A 4JV0A 2ZXIA 3MFHA 2KZMA 5HHIA 5KFZA 5TZVA 3H0LB 1S10A 2PFPA 3HW8A 4YFKA 1QQ5A 1DK2A 1VJ5A 4RNNA 4YXMA 1OUQA 1NZPA 3CYMA 4EEDA 3NWIA 2B6GA 4ED3A 9ICOA 1ZQGA 5KFBA 4I2GA 5D61A 3HPOA 3NVZA 2HHUA 2NV3A 5J0OA 5KT4A 2BQ3A 8ICCA 4OD0A 2LHTA 5IIMA 5EE9A 5E79U 2KIWA 2KNJA 1Q78A 3NKUA 3MR3A 5DG9A 4QIWC 7ICPA 4K4HA 4KLLA 1DGJA 2BDUA 1UCVA 2EZXA 4DL2A 1ZYQA 5F2VO 2C22A 5AKHA 2QKQA 4EGWA 5L1MA 1L7NA 3AMZA 4KM5A 1SL2A 2EANA 3RH4A 3T5KA 4NM2A 4RZRA 3EWAA 5ALIA 1YLQA 2NYVA 3ZDBA 2HVHA 5IIKA 7ICLA 5KFHA 3F2CA 3WFOA 2NRXA 2NRVA 4FH5A 2FMSA 5KAIU 1B0XA 5DBBA 2AXTU 3RTVA 1BPEA 5KFFA 3GDXA 5B5EU 2VA3A 4E0DA 1IV8A 2WTFA 8ICZA 3L5KA 3WK4A 4DS4A 1ZXIA 2G08A 2KICA 1PUZA 2KSOA 2BPFA 3QUBA 4AT7B 3FC4A 2Y0SC 5AK4A 1ZD3A 5J0WA 4WCWA 5KFXA 3V7LA 4DF8A 4BXOB 4IRDA 3N97B 3QX7A 9ICSA 4F4ZA 4CF3A 5AM1A 3SI8A 2EAPA 3AN1A 2P35A 5F9LA 2R8HA 4K9BA 5ALEA 1HEKA 8ICXA 4FFDA 3RAQA 3GU3A 8ICTA 3U26A 2YB4A 4RPXA 3UQ2A 3GIMA 3MCRA 5J2IA 3UQ0A 4C8NA 5AKLA 1FEZA 2ASDA 3D2QA 3BQ0A 4DL5A 2FMQA 5J0YA 5HRLA 5AM3A 2ZJ8A 3OPXA 1X40A 7ICGA 4C8KA 5ALGA 5KFEA 3AUOA 3TAPA 1SL1A 1N63A 4KX3A 1L7OA 4DL3A 2IMWP 4DL7A 1L3SA 2ZIXB 4FS2A 4MF2A 5AKEA 2W54A 2JZBB 5DEDA 2RP5A 5D62A 2LM4A 4IRCA 3SMVA 3WK9A 4LVSA 4P4PA 1SZHA 5D49A 1MN8A 4O5KA 3M8SA 3QEBZ 5AICA 1FFUA 3WFSC 5KG7A 3T3FA 5H2FU 1T7PA 1X9WA 5DB7A 3CRXA 2HHSA 2KOBA 2E3TA 3VC8A 5K4LA 7ICFA 1ZQKA 5B3PA 3TARA 1OXJA 3SENA 3LVWA 2WF9A 2FJ6A 3GILA 3BS5A 2V9WA 3GIKA 2P66A 1RQNA 4FHYA 1UA0A 4OJ5A 2LBOA 2AGPA 2YMLA 2DVIA 2IOFK 5KFRA 1JQRA 4ECSA 3WU2U 2G5HB 7ICSA 3LWMA 4MHVA 2UVVA 2IHMA 3RJHA 2PMZF 1XSLA 1J2MA 4J9MA 4O5CA 1X6IA 5DLGA 1ZQSA 5J8YC 2PFNA 4O3OA 3PX4A 2GLEA 1ZQQA 1X9SA 3F2DA 2ZIWB 2E8OA 4IQTA 4PGYA 3T5JA 4P0QB 5KFYA 3NVOA 3RJEA 4QW8A 2BCUA 4NKUA 2R18A 4ELUA 2WB1C 1N56A 1KLNA 1LB2B 4NXVA 3BJYA 3PHZA 1XWLA 4IL6U 1XSPA 4F4KA 3TANA 2ALZA 1ZOLA 4X4RA 5AIAA 2NO5A 3RB0A 2A3VA 1COKA 5L1IA 5CFTA 4KLTA 5KT3A 2F1HA 2GA9D 1D8LA 1ZQWA 4RQ4A 3PR4A 4DOAA 7ICRA 4M5DA 1SKSA 5ALYA 2PFOA 1Z19A 2KG5A 4J9RA 3ZDCA 4KLGA 3SV4A 3HT3A 2CN1A 3PW2A 1D8YA 1SIJA 2Y9TA 4Y2VA 5AI5A 4C4TA 3F2BA 5C0YA 3KKAA 1QTMA 4NXXA 2PI4A 1A77A 4OAFA 3FAHA 3ZD9A 2MAXA 2JEGA 4FZMA 1V85A 3IHQB 3GIJA 4IG8A 4RQ2A 2DRBA 3HJ4A 2K8CB 4DFJA 4EZ9A 1ZQZA 3KFUF 4XA5A 2BHNA 1RQLA 2WF7A 4P4OA 1NKEA 2W7PA 4O5EA 4PHDA 1ZQMA 4M2YA 1MIYA 3RFAA 5L1LA 4BJQA 4FHPA 1X9XA 5TISU 2H3VA 1JXEA 3OHBA 1XC9A 4Y2YA 1WYGA 7ICJA 4X4OA 1LKYA 4WC6A 3Q8MA 4UB4A 3MFIA 2W04A 5J0QA 4P0PB 2K8AA 1DK3A 2WFAA 3BQ2A 4RNMA 4Q8FA 5B66U 4J9OA 1XS9D 3C21A 1TAUA 3HILA 3J81j 1NJXA 2PXIA 4UAWA 8ICJA 2HHWA 3MBYA 2YQEA 2AH5A 1AROP 4X4QA 3HX0A 1TK8A 2ZIVA 5D63A 1PK1B 3SAGA 4X0BA 4MFFA 3PX6A 3M1YA 5KFKA 4DFKA 1QQ7A 1L7PA 2G06A 2A1JA 2NRKA 4AT8A 4GC7A 3TI0A 4KN4A 4DF4A 3LQCB 4ICAA 1L3VA 2VJ5A 2YY6A 1D9DA 2M2VA 1TKDA 1DOQA 3H3AA 3SAHA 2B0CA 1BPBA 3NGDA 1S5LU 2XC9A 3G6YA 4NJ8A 3UXNA 1U49A 3UPQA 4O67A 4N7RA 3H0MB 2KD1A 4X4PA 4ECQA 4UAZA 4UB3A 4DQSA 3LVVA 2W3SA 4GIBA 5EWEA 2G5IB 4O68A 1Q79A 5ALQA 5D46A 3QZ7A 3M7DA 1OU5A 4XRHA 5EOZA 4J03A 1GO3F 2BR0A 1NO5A 4EBCA 2CPRA 3H8JA 2WAQC 2HSZA 2DF4B 3JPNA 2WHEA 2B56A 5BOMA 2DR7A 1NJYA 3KZXA 2K4PA 4DSLA 3NVYA 4YQWA 4M6WB 5J2AA 4DL4A 3NVVA 2V4QA 2YB1A 2FPKA 2KK0A 4Z6CA 4RUCA 5DGBA 2KVSA 2O5AA 4OJ6A 9ICHA 2EZZA 4RPZA 2JRZA 9ICCA 4K99A 3DV9A 5KFLA 2ZIUB 3SAFA 2RFFA 4O3NA 2GWSA 1A76A 3BDPA 3HWTA 5DBAA 1ZQHA 4EZ6A 4WBZA 3GV7B 1QH9A 3AU6A 3V6HA 1H38A 1DGSA 2P6RA 3AQKA 3T5HA 2HOQA 3JPQA 2DL0A 2JV3A 1KRPA 4F8RA 3QU9A 4WC5A 2HCFA 2W9CB 4RWOA 4OJOA 4DWIA 1ZQCA 2DQNB 4UBCA 4WC4A 3A0HU 3MGVA 4DQPA 2KVCA 5F9NA 2HBMA 1S97A 4YXJA 4IQVA 1HUOA 2BCSA 3KHGA 2ID1A 1JX4A 1X42A 2QB0A 4X5VA 5AKGA 2FMPA 1U9LA 5T14A 4EEYA 1XO0A 3UMBA 4M9JA 2HBJA 2JGAA 2R8KA 5KT2A 5KG3A 1D9FA 4EEKA 4I2JA 5KL8B 5AKKA 3BZKA 5DQGA 2Y0SF 3D2SA 3Q8QB 4P2HA 5EE3A 5J2KA 4A8EA 2RRDA 3RB4A 2XI9A 5ALFA 3QE9Y 3QZ8A 3FYHA 5J2DA 4YD2A 4EEBA 2HBLA 2K60A 3JPRA 2W43A 2W9BA 1QCKA 1SB3C 1DRGA 3UPSA 4F4YA 5DQHA 4X0AA 2G09A 1O08A 5HMLA 1NKBA 1JMSA 4AYBC 5J2GA 4CF4A 3ZI4A 3THVA 1KW4A 8ICAA 2ZG6A 2PI5A 3TACB 2OWOA 3RJJA 1LVHA 2XO7A 1SV0A 2G07A 4KMUA 5J2BA 5DDMA 3I1YA 2YTUA 3M9MB 2QARB 4Y2RA 1Z1VA 4MFCA 5KFDA 4J9QA 1QSYA 8ICFA 1FFVA 3MABA 1T3QA 3K75D 4IS7A 3MC1A 2HBKA 3PR5B 5AM5A 4WC3A 3PW4A 4HAIA 1V38A 2ZJAA 3LK9A 4ED7A 3T5LA 9ICXA 1VDVA 4XQ8A 3WKAA 3M9NB 1KL9A 4MF8A 4O3QA 3NASA 1ZQAA 5HR7A 1V4AA 3H4DA 5DB8A 5CRXA 5AI8A 3ISCA 1MA7A 3HRDD 4DSFA 4UBBA 4GXJA 4F4XA 3BQ1A 3AQEA 1RYSA 2ZH5A 3H8WA 2BBHA 2MUTA 4UD5A 3C18A 3FM9A 3ZDDA 4WOYA 1ZJMA 1SWVA 4O3RA 4J9SA 1CI4A 2EDUA 4AT9B 2KEYA 4PL1A 4EYHB 2JMGA 1HUZA 1NZBA 1ZQPA 3C28A 4K4IA 2ZH8A 4XUSA 7ICNA 4JV1A 5KT5A 5HRHA 3AQNA 3JCFA 3RF9A 3PMNA 2IHOA 1ZQOA 3B0XA 3AEVA 4TURA 2HHPA 3PNCA 1ZQFA 5A0LA 5DB9A 3N7PD 4B9LA 3GQCA 1QQ6A 8ICUA 4PGXA 3M6ZA 5JRTA 3H7IA 4EP7A 1U47A 1FIQA 3IG8A 4PHAA 4QZAA 3OVBA 4FBTA 5ALSA 3Q8PB 5J0TA 1WWUA 3I76A 2RDJA 4MEXA 4ED8A 2AJQA 1D8BA 5EWFA 2DKXA 3HKZF 1TAQA 4C4RA 1UEUA 9ICPA 4UB2A 3NS1A 3UMGA 4ECZA 2EH9A 3WK8A 4ELVA 5KG4A 5J0PA 1F0MA 2J6TA 4QZGA 5DQIA 2ZH9A 3H4BA 4EELA 5ALJA 2FLLA 1J2NA 4PPXA 1T3NA 1S0OA 1NKCA 4LEWA 2J6UA 1KEJA 2W11A 4KLQA 2FI1A 8ICNA 2XICA 1GPJA 2DBYA 2KJ8A 8ICIA 3TAQA 3SR6A 2R8GA 2ZUCA 4Y2SA 2JR5A 4DSKA 3EZ5A 2ZJ5A 3KBBA 1YZ7A 3RRHA 9ICNA 4UB5A 2RDIA 2DKZA 5J2JA 1Q46A 4RQ1A 4IR9A 4KB6A 1SGGA 2WF5A 1Z00A 8ICOA 2W7OA 4KLJA 4RQ8A 2B4VA 1BNOA 4P0QA 3AL0B 2H3QA 1SXDA 1JROA 4O69A 4IRKA 3C1ZA 3QU2A 2KSOB 3OHAA 4LJXA 4FZLA 5AI6A 2ZH3A 2C28A 2BQUA 2KZZA 2HHQA 4DQQA 2XCAA 4UB8U 4M0AA 1Q8KA 2KE7A 2ZHBA 2ISOA 4I0UA 4QZDA 5AM2A 4YR2A 1BPDA 1ZQVA 1X2IA 2F77X 2F1JA 2M2UA 4WJ3B 2BBJA 2NO4A 2R8JA 4CE6A 1S0MA 1UQVA 3HJEA 4ED2A 1V97A 2WF8A 9ICUA 2KJ5A 3KOOA 3WKCA 3ERCC 8ICBA 4UW9A 4NLBA 1RYRA 1X66A 4I28A 1SL0A 2JEJA 2IHNA 4M9NA 1U45A 4TQSA 3RR7A 8ICMA 4WC1A 3OTQA 3Q8KA 1K5OA 5AI9A 2VKQA 2ASLA 4US9A 5KFQA 4DQRA 4US8A 4DLGA 2OM6A 3OVAA 1KKXA 2FE9A 1L5UA 1UT8A 5DDYA 2FLNA 4K9AA 1Q3UA 2LM1A 4WC7A 4LEZA 3ER9B 3PO4A 5AI0A 4R8UB 3H37A 2JEIA 3LYSA 1JI7A 1ECWA 3AU2A 3H40A 4I29A 1ZD4A 2HN2A 2YN4A 4LT6A 2M9NA 3R9KA 1UT5A 4DO9A 1N62A 4F3OA 1S76D 4GFJA 5KNIA 1ZQ1C 5KTQA 3BS5B 3I28A 5IIIA 2OXOA 3WFQE 7ICIA 4P0PA 3IV6A 2ZH1A 2XY5A 5J2CA 2V4RA 4O0IA 4RQ5A 3RBEA 4X4SA 2AQ4A 1U4BA 2P6UA 4FO1A 3OUYA 4PHPA 8ICVA 5HR9A 4U7CA 4NXWA 8ICEA 3KHLA 4C4SA 4F5PA 2CRXA 3F5EA 1L3TA 4B9UA 3D6JA 3NRZA 2BQRA 1PK1A 4MFAA 4UAVA 7ICKA 4CGZA 2K4IA 4DLEA 1PVQA 4I2CA 4EBDA 1WG8A 4F5RA 2OYYA 4YMNA 4M9GA 1C20A 1NJWA 3V7KA 1NK8A 4I2AA 4IC9A 4WH5A 3V6JA 5KFIA 3N28A 3ALRA 3ED5A 2B51A 3TFRA 2BPCA 4ED1A 5KFTA 5DGAA 1MIVA 5EE0A 1Q3VA 1TFWA 4DS5A 3T79A 2YMPA 3QUQA 5JTIA 4S3NA 8ICKA 2Q4TA 3GZFA 4IQWA 8ICWA 3AQMA 4E8FA 8ICQA 1B43A 2HN1A 4YN4A 4RQMA 4NM1A 2KN7A 2BCVA 2J6SA 4DSJA 2RHFA 4ECVA 4ELTA 1COOA 4FO6A 3ER8C 4QNLA 3Q8RB 1ZQRA 2WF6A 2BGWA 9ICGA 2IA6A 3C2MA 1CRXA 5KG0A 4LZGA 3F5AA 4EBKA 3ZDEA 1TVAA 4LEVA 5CB1A 2DR9A 1IIPA 4UB1A 4OAGA 2AGQA 4UASA 4K8VA 9ICJA 5ALUA 4G9BA 3PSIA 3WFPA 4JLZA 3C23A 4OO1J 2W8LA 2PMZC 1N5WA 3DDHA 3RAXA 5J2HA 2BDPA 2FDRA 2VA8A 1ZQBA 4F5OA 4GXKA 4I2HA 4RUAA 4NLNA 4WQKA 2F76X 9ICBA 3NTUA 5HMMA 3IM1A 5CP2A 5DB6A 4NY8A 3C5GA 3ONNA 3A0BU 5ALMA 3N7RC 4FH3A 1LKYB 4M9LA 4FS1A 4EBEA 4JWMA 2OHFA 3MR2A 4CCHA 1RG6A 5KFAA 1PVRA 1AQ6A 4YVZA 4B9MA 1L7MA 2FPMA 2H5XA 1L3UA 1WCNA 2ZUDA 2ATLA 3D2NA 4ECTA 4YP3A 5L1JA 2F3NA 1JALA 1V9PA 5IIOA 2M2TA 4BUGA 2ZIVB 3NVWA 9ICQA 1S9FA 4PH5A 5KAFU 2AQ0A 5ALXA 3N4MB 4EENA 3H0RB 2JHDA 1BVSA 4DFDA 2YX8A 5J8YA 3RB6A 3KHRA 2HDOA 4AT8B 3QEAZ 4B9NA 5J2FA 5J0XA 2I1QA 2KP7A 8ICYA 4QIWF 4WC0A 4B9TA 2KIVA 5KG6A 1A0PA 4HX0A 2RLTA 1TFYA 3OGUA 5CA7A 4PHEA 4ATBA 5KFUA 4Q45A 4JWNA 5ALVA 3WFRE 2BZFA 4IR1A 3SZ2A 4Y2JA 4UATA 3WKDA 2YMQA 1NNLA 5CFSA 4KX5A 4RU9A 5HNKA 5HRFA 3SEIA 1S77D 2BKEA 2K4EA 3PSTA 5AIBA 3CK6A 5CHEA 2XGQA 2DRAA 4YMMA 2M2WA 1XO1A 3NRWA 3TKAA 1T4GA 1WWVA 2ISPA 4ECWA 4F4WA 8ICLA 1MC8A 1X6JA 4FZNA 4ECRA 1ZQXA 3MR6A 4UAUA 5HREA 4F50A 2BPGA 3B0YA 3JPTA 3PX0A 4Q8EA 2MA1A 5GTHU 3GFKB 4WQLA 2ZH6A 1TFRA 4CDGA 2Q0ZX 4OAHA 3TFSA 2PKEA 2ZTEA 5IILA 2E5SA 4JUZA 5ALNA 4MKPA 4Z6FA 5ALWA 1KBUA 4F93B 5AM4A 2FLPA 1BNPA 1X9MA 1CEZA 3GV8B 2D8CA 3JPOA 4DOBA 2A1AA 4NL9C 2E1EA 1N5XA 3C2LA 5KFCA 2H3ZA 2K8BB 2F2AB 3WK5A 4EYIB 4XJEA 2EQYA 1Z1BA 4F2SA 3IG5A 2C2DA 2KZ3A 4M9HA 4QZFA 4J9PA 2NRTA 5CWRA 1ED1A 3ETLA 3QYPA 3Q8SB 4NLZA 4Y2XA 1SV4A 2UVWA 2DR8A 2W03A 1L6NA 4WBYA 2DFLA 4JLXA 4FHVA 8ICHA 4Z6DA 4E7XA 9ICIA 5KFNA 1S0NA 2NRWA 1NJZA 1KSPA 4X4UA 2ZTDA 1U48A 2IOHA 1BPZA 4F5QA 1YT3A 3C2KA 7ICQA 4X4VA 1R8CA 8ICSA 2W9MA 3V6KA 1IXRA 5GTIU 2GO7A 1ZQNA 3V72A 5JU5A 4QJFB 4AT7A 2I6XA 5J0UA 1R89A 5KG1A 2L5YA 4TUQA 1Z4NA 4X4TA 2LPEA 2UVRA 4RWQA 1VFGA 2W9BB 4O9MA 4EBJA 3TADC 4BXOA 2D6FC 4PGQA 1JIHA 2PBEA 4IQUA 2ZUBA 3EYZA 2O1PA 2K4HA 4ECYA 2W3RA 1UEVA 2BCRA 5HRIA 1B22A 1NK0A 2ZHAA 1JRPA 2QB1A 3KKAC 5ALPA 5DBCA 1TK5A 2W8KA 3KZIU 2XGPA 1QSLA 1ZD5A 4DFPA 3PW7A 3B9JA 5KFOA 3RH6A 4UARA 1RXVA 4EX6A 5AHXA 4JMUA 2EAOA 4QZ8A 2WB1F 4O3SA 3Q8LA 2ZTCA 4CF5A 3SQIA 4C7ZA 1RXWA 7ICHA 3G6VA 4BX9C 4X4NA 1SZPA 3KD3A 4RQ3A 2W55A 3QNMA 1EXNA 2ZIXA 8ICGA 5J0RA 2JZBA 2KKPA 2D3DA 3EUB2 3SD7A 3CW2C 5J29A 3H38A 1MIWA 5DG8A 1ZRNA 2O6KA 4PL2A 9ICTA 4C8OA 3V7JA 2MUTB 1N60A 4QWEA 3E2EA 3PSPA 5ALOA 4J9NA 3H8MA 1N48A 2ZH4A 3ZDAA 3PO5A 4RQ0A 4I2FA 5ALHA 5HP4A 3OSNA 1F44A 1NOMA 3C66A 2E8MA 4FHWA 1M6YA 1LV5A 4R66A 1JAJA 4RQ7A 3AM9A 2VANA 3JPSA 4BWJA 3KTQA 4R65A 4LZDA 4KLUA 3IN5A 8ICPA 2CXYA 4GLXA 1KNYA 9ICKA 4UAYA 3BS7A 5KFGA 1J97A 2XCPA 1VLBA 3RB3A 5AK3A 4Y2QA 4KLFA 1RZTA 3EW9A 2EZYA 4Z6EA 4KTQA 1P7DA 4K98A 5KFVA 5HRDA 2DUYA 5C5JA 2HMXA 5KT7A 4PZNA 4EV6A 2ZIWA 3SV3A 4R63A 7ICUA 4DFMA 5CJ7A 4OAIZ 7ICTA 4FHXA 2H3IA 4C7YA 4O3MA 2E8NA 2AGOA 1RM6C 3LWLA 3QU7A 5G5GA 4RNOA 2NRZA 3PW5A 4J9KA 7ICVA 4JV2A 4KLHA 2HVIA 5CFUA 4QZIA 4R8UA 2LMRA 3H8SA 3WK6A 4JK1A 4M47A 4NXZA 2JH1A 3UMCA 2HI0A 5HHHA 4M04A 2Y1IA 3FDSA 4OJLA 5L9XA 4Y2PA 2KJ9A 4K97A 4DSEA 7ICEA 1ZQEA 3GIIA 1T94A 2G0AA 2MU2A 4NL9A 2OCEA 4RT2A 4BDPA 2Y9UA 5CHGA 3GV5B 1N2XA 1QSSA 3CP8A 5EWGA 3ICXA 4USAA 4QZ9A 3WKBA 4UQGA 4ACOA 1KFSA 4F2RA 3AQLA 9ICEA 3O0FA 3HIYA 3E0FA 3ISDA 5J2EA 1OW5A 2IUBA 1KFDA 3ETRA 4F92B 2I5HA 4ED6A 4TQRA 2OH2A 2F1IA 5KFMA 1Z00B 1PX5A 5D4BA 1Z4OA 1RDFA 3HJ1A 8ICRA 2KMDA 1R8BA 5IINA 4YD1A 1ZQIA 3UM9A 1URJA 4ED0A 5JUMA 3F53A 3RRGA 2VJ4A 3HKZC 2KTQA 1A6SA 4F72A 2HW3A 4RT3A 4EX7A 4FE3A 4RQNA 2FCLA 4C0ZA 5HC9A 3ORYA 4YCXA 2W9AA 2AHOB 3QUCA 4YR0A 3HP6A 9ICMA 2GOLA 2MSNA 2F8LA 2WAQF 4Y2UA 5AKIA 5ALDA 5EE1A 3TADA 5CEHA 1K1SA 2K89A 2GAFD 2ZH7A 4BGDA 4KLMA 4DCCA 4KLDA 4Q43A 2ASJA 1XU4A 4ECXA 3L4PA 1HJPA 4O3PA 4GXIA 4QZEA 1BPXA 4YG2A 3K4GA 1MQ3A 2ZH2A 4OCZA 2UVUA 3M6KA 3OVSA 2DPJA 5L1KA 3C29A 2XIDA 1NI3A 3MGHA 1S8OA 4C80A 3NYBA 4WC2A 3RBDA 3KHHA 4LEYA 1NK6A 3RH5A 4K96A 1N61A 2GH1A 4JB3A 4QWCA 1ZJNA 3NUQA 4NV0A
chains in the Genus database with same CATH topology
2Y1JA 5KFUA 4Q45A 3OJUA 1ZQDA 4JWNA 9ICWA 9ICRA 4ATBA 3WFSC 4NLKA 1C7YA 3WFRE 5KG7A 4IR1A 3T3FA 1F5AA 1Z3EB 5KFSA 3SZ2A 1X9WA 5DB7A 1T7PA 4EYHB 3C5FA 4I2EA 2HHSA 3MDAA 4AT9B 1HUZA 4RWNA 1ZQPA 4K4IA 1ZQKA 7ICFA 2ZH8A 3TARA 2RFFA 4DEZA 2DPIA 4XUSA 1KDHA 3ISBA 4QWAA 7ICNA 3GILA 4JV1A 5KT5A 2V9WA 4I2DA 5DKWA 3GIKA 5HRHA 3AQNA 4RU9A 3PMNA 2P66A 5HNKA 4FBUA 1ZQOA 3OSPA 3B0XA 4FHYA 5DECA 1UA0A 2DVIA 2AGPA 5HRFA 5KFRA 4TURA 3M8RA 1NK5A 4QZCA 2BKEA 1S77D 2HHPA 3PNCA 1ZQFA 2XGQA 2DRAA 4YMMA 2M2WA 1JQRA 3TQ1A 1XO1A 4ECSA 4YR3A 4B9VA 5DB9A 4B9LA 3GQCA 4B9SA 8ICUA 4PGXA 7ICSA 3LWMA 1T4GA 3OUYB 4KLSA 2ISPA 4QW9A 4ECWA 4F4WA 2UVVA 1MC8A 3H7IA 8ICLA 2IHMA 3RJHA 4ECRA 1XSLA 4EP7A 1ZQXA 1U47A 3MR6A 4J9MA 4O5CA 5KT6A 3MR5A 4TUPA 4KLOA 4ZH4A 1ZETA 2HHTA 9ICLA 5HREA 5DLGA 4PHAA 1ZQSA 4QZAA 3OVBA 4F50A 2PFNA 4FBTA 2BPGA 4O3OA 3Q8PB 4M6WA 3B0YA 5J0TA 3JPTA 1BGXT 3PX4A 3PX0A 1MQ2A 4Q8EA 2KFZA 3H39A 1TV9A 1ZQQA 4P4MA 2RDJA 2HHVA 1X9SA 4MEXA 4ED8A 3GFKB 4IQTA 4PGYA 3T5JA 2AJQA 2ZH6A 2FPLA 5KFYA 3RJEA 4QW8A 5EWFA 2BCUA 1TFRA 1KFTA 4NKUA 2HHXA 2Q0ZX 1JN3A 1TAQA 3TFSA 1UEUA 3M8SA 9ICPA 4UB2A 4ECZA 3RR8A 1N56A 2ZTEA 5IILA 1KLNA 4JUZA 4ELUA 3LDAA 4ELVA 1T8EA 1LB2B 4Z6FA 3BJYA 5BPCA 1XWLA 1ZQJA 3BDPA 5KG4A 5J0PA 5BOLA 1XSPA 2C2EA 2J6TA 4QZGA 4F4KA 1MSWD 5DQIA 3TANA 4F93B 3PW0A 2ALZA 1SKWA 4I27A 3H4BA 4NKTA 2ZH9A 2FLPA 7ICMA 1BNPA 4UD4A 4X4RA 1X9MA 1CEZA 3GV8B 3RB0A 3JPOA 4DOBA 4RWPA 5KG5A 5L1IA 4KLTA 5KT3A 1ZQTA 2F1HA 2FLLA 3C2LA 4PPXA 1D8LA 5KFCA 1ZQWA 4RQ4A 3PR4A 4EYIB 1WCLA 4DOAA 1T3NA 7ICRA 2R8IA 2C2RA 1SKSA 4M5DA 1S0OA 1FA0A 2PFOA 1NKCA 1UETA 4F2SA 4J9RA 3ZDCA 4KLGA 2C2DA 2W9CA 3SV4A 3HT3A 2J6UA 2KZ3A 4M9HA 4QZFA 1KEJA 4J9PA 4DL6A 2NRTA 3PW2A 1D8YA 5CWRA 2BE3A 5KFWA 3ETLA 3Q8SB 4NLZA 3MGIA 4KLQA 4RQ6A 8ICNA 1VJ7A 2UVWA 1R8AA 1QTMA 2DR8A 4I2BA 2PI4A 2IBKA 2XY7A 2DFLA 1A77A 8ICIA 5CR0A 4Q44A 4QWDA 4FHVA 3ZD9A 2MAXA 3TAQA 8ICHA 2R8GA 4Z6DA 1NK9A 4E7XA 1PZNA 2BCQA 2ZUCA 4DSIA 2JEGA 9ICIA 5KFNA 1S0NA 2NRWA 1NJZA 4DSKA 3EZ5A 2ZJ5A 1KSPA 4R64A 4X4UA 2ZTDA 1U48A 3IHQB 4F5NA 3RRHA 3GIJA 1BPZA 4XQ7A 2A1JB 4UB5A 9ICNA 2B21A 2RDIA 1WOTA 4F5QA 4HYKA 1ZQLA 5J2JA 4RQ1A 4IR9A 4IG8A 4RQ2A 2DRBA 3C2KA 3PY8A 3HJ4A 7ICQA 3EPGA 3UXOA 5KFPA 4X4VA 1Z00A 4DFJA 8ICOA 1R8CA 4EZ9A 1ZQZA 4KLJA 8ICSA 1JXLA 2W9MA 4QZBA 3V6KA 4RQ8A 1IXRA 2BHNA 4XA5A 1BNOA 4E80A 2I9GA 4NLGA 1ZQNA 4P4OA 1NKEA 1RPLA 3V72A 9ICAA 4O5EA 4IRKA 4PHDA 3C1ZA 1ZQMA 4M2YA 4AT7A 1MIYA 3OHAA 5L1LA 4FHPA 5J0UA 1R89A 5KG1A 4TUQA 1JXEA 4X4TA 1VFGA 3OHBA 1XC9A 2UVRA 4RWQA 2W9BB 4O9MA 4EBJA 2ZH3A 3UXPA 2C28A 4BXOA 4C8MA 2BQUA 3ZD8A 4PGQA 7ICJA 5HRBA 4X4OA 1KTQA 2KZZA 4TUSA 1JIHA 2PBEA 4IQUA 3Q8MA 4UB4A 4YMOA 4WC6A 2HHQA 3MFIA 5KFJA 2ZUBA 4KLIA 5J0QA 3EYZA 2XCAA 4DQQA 4F91B 1CUKA 2O1PA 4M0AA 2VA2A 4ECYA 4ECUA 2ZHBA 2ISOA 4C8LA 1DK3A 1UEVA 4QZDA 3RJFA 4YR2A 3BQ2A 4RNMA 1TK0A 1UA1A 2BCRA 1NK0A 4Q8FA 1B22A 1BPDA 4J9OA 1XS9D 1ZQVA 1X2IA 5DBCA 2F1JA 3C21A 4RPYA 3RJIA 1TK5A 2PFQA 1TAUA 2W8KA 2XGPA 2M2UA 4KN7A 1NJXA 2LYHA 2PXIA 1QSLA 4DFPA 3PW7A 5KFOA 3RH6A 2R8JA 4G3IA 4QZHA 4UAWA 4ED2A 1S0MA 2HHWA 8ICJA 3MBYA 1RXVA 3MDCA 3JYYA 9ICUA 3RJKA 1AROP 4X4QA 3HX0A 4QZ8A 1TK8A 4O3SA 3Q8LA 1XSNA 1ZQYA 8ICBA 1TFWA 2ZTCA 1RYRA 4X0BA 1RXWA 3M9OB 4MFFA 4I28A 3PX6A 1SL0A 3G6VA 2JEJA 7ICHA 4X4NA 2IHNA 1SZPA 4M9NA 4KLEA 4RQ3A 1U45A 3BQTA 5KFKA 4TQSA 3EPIA 4DFKA 3RR7A 8ICMA 9ICFA 3Q8KA 4GC6A 9ICVA 5HRGA 4WC1A 1EXNA 2ASLA 2A1JA 5KFQA 4DQRA 8ICGA 2NRKA 4AT8A 5J0RA 4GC7A 3TI0A 2JZBA 4KN4A 4DLGA 1SKRA 4DF4A 3OVAA 3JZ0A 4J9LA 3LQCB 1L3VA 1L5UA 2DR5A 1UT8A 5DDYA 1D9DA 5KG2A 2FLNA 5J29A 1TKDA 2M2VA 3H38A 1DOQA 1MIWA 3H3AA 5DG8A 4QWBA 9ICTA 1BPBA 3PMLA 3NGDA 2XC9A 3V7JA 2MUTB 4C8OA 4WC7A 3PO4A 4QWEA 3E2EA 1ZQUA 4R8UB 5J0SA 3G6YA 2JEIA 3H37A 4ATBB 3RJGA 4J9NA 1N48A 2JEFA 2ZH4A 3OJSA 2Q66A 3AU2A 3UXNA 3JPPA 3H40A 3ZDAA 4AT9A 4I29A 1U49A 3PO5A 3L9DA 4LT6A 2M9NA 3UPQA 4RQ0A 3G6XA 4I2FA 1UT5A 1K1QA 5HP4A 3OSNA 4KITB 1NOMA 3SYZA 3C66A 4DO9A 4F3OA 1S76D 2XY6A 4FHWA 4X4PA 4ECQA 2ZHAA 4UAZA 5DLFA 3PVXA 3OV7A 1NK7A 1LV5A 1Y88A 5KTQA 4UB3A 4DQSA 4R66A 1NK4A 1QLNA 1JAJA 4RQ7A 1BPYA 5EWEA 2VANA 5IIIA 3WFQE 7ICIA 3JPSA 1Q79A 3PV8A 4BWJA 5D46A 3KTQA 2KFNA 2AU0A 2ZH1A 4R65A 2XY5A 5J2CA 4LZDA 3QZ7A 2V4RA 1IM4A 4O0IA 4RQ5A 4KLUA 8ICPA 3RBEA 4X4SA 4GLXA 4DOCA 2AQ4A 2P6UA 1U4BA 4K4GA 1OU5A 4XRHA 3OUYA 5EOZA 4BWMA 3C1YA 9ICKA 1KNYA 4UAYA 2BR0A 4DQIA 1NO5A 2XCPA 5KFGA 3RB3A 4PHPA 4EBCA 4MEYA 7ICOA 5IIJA 1S0VA 4KLFA 8ICVA 5HR9A 3H8JA 1RZTA 5HRKA 3EW9A 8ICEA 4I2IA 3JPNA 5DG7A 3KHLA 4Z6EA 2DR7A 4JV0A 5BOMA 4F5PA 4KTQA 1NJYA 3MFHA 5KFVA 4DSLA 5C5JA 1L3TA 4B9UA 5HRDA 2KZMA 4YQWA 2BQRA 5KT7A 4M6WB 4MFAA 5J2AA 4DL4A 5HHIA 2V4QA 5KFZA 5TZVA 7ICKA 4DLEA 2PFPA 1S10A 4EBDA 4I2CA 4F5RA 3HW8A 4YFKA 3SV3A 4YMNA 2FPKA 4Z6CA 4RUCA 4R63A 4M9GA 1DK2A 1NJWA 3V7KA 1NK8A 5DGBA 4I2AA 7ICUA 4O5KA 4RNNA 4DFMA 2O5AA 5CJ7A 4YXMA 3V6JA 7ICTA 5KFIA 9ICHA 4FHXA 1NZPA 3TFRA 2BPCA 4RPZA 9ICCA 2AGOA 4ED1A 4ED3A 9ICOA 3LWLA 5KFBA 1ZQGA 5KFTA 5KFLA 4I2GA 5DGAA 3HPOA 2HHUA 1MIVA 4RNOA 5J0OA 2NRZA 4O3NA 5KT4A 1A76A 4DS5A 3HWTA 4J9KA 3PW5A 2BQ3A 2GWSA 5DBAA 5IIMA 1ZQHA 4JV2A 4EZ6A 4KLHA 8ICCA 2HVIA 4WBZA 3GV7B 4QZIA 3AU6A 4R8UA 4S3NA 3H8SA 3V6HA 1H38A 8ICKA 1Q78A 4IQWA 1DGSA 3MR3A 8ICWA 5DG9A 2P6RA 3AQMA 4JK1A 3T5HA 7ICPA 4M47A 3AQKA 4E8FA 3JPQA 4NXZA 4K4HA 5HHHA 4M04A 8ICQA 4KLLA 1B43A 3FDSA 5L9XA 2Y1IA 4YN4A 1KRPA 4F8RA 4NM1A 2KN7A 2BCVA 2J6SA 4WC5A 4DL2A 4DSEA 1ZYQA 4DSJA 2W9CB 7ICEA 5F2VO 4ECVA 2C22A 4RWOA 1ZQEA 3GIIA 4ELTA 1COOA 4RT2A 4FO6A 4DWIA 7ICVA 1ZQCA 3Q8RB 1ZQRA 2BGWA 4UBCA 2IA6A 4BDPA 9ICGA 3C2MA 4WC4A 3GV5B 5CHGA 1SL2A 5KG0A 1QSSA 4DQPA 4LZGA 5F9NA 3RH4A 4EBKA 3T5KA 5EWGA 1S97A 3ZDEA 4YXJA 4IQVA 4QZ9A 4UQGA 1HUOA 4NM2A 3KHGA 2BCSA 2ID1A 1KFSA 4RZRA 1TVAA 4F2RA 3AQLA 9ICEA 3EWAA 1YLQA 5CB1A 1JX4A 3ZDBA 2HVHA 2DR9A 4UB1A 3HIYA 5IIKA 7ICLA 5KFHA 3ISDA 4X5VA 5J2EA 2FMPA 3WFOA 2NRXA 1U9LA 3QEBZ 2AGQA 2NRVA 1KFDA 4FH5A 4F92B 2FMSA 4ED6A 5HRIA 4EEYA 4TQRA 5DBBA 2F1IA 5KFMA 4M9JA 3RTVA 9ICJA 2R8KA 1BPEA 5KFFA 3GDXA 5KT2A 5KG3A 2VA3A 4E0DA 3WFPA 1D9FA 3C23A 1Z00B 2W8LA 5D4BA 4I2JA 1PX5A 5DQGA 2WTFA 3HJ1A 8ICZA 3RAXA 5J2HA 8ICRA 3Q8QB 2BDPA 4DS4A 4P2HA 5IINA 1R8BA 4YD1A 2VA8A 5J2KA 1ZQBA 3RB4A 3QE9Y 3QZ8A 4F5OA 1ZQIA 4GXKA 4I2HA 3FYHA 5J2DA 4RUAA 2BPFA 4YD2A 4NLNA 4WBYA 4AT7B 4ED0A 9ICBA 3NTUA 5HMMA 3IM1A 5CP2A 5JUMA 3JPRA 2W9BA 3RRGA 5J0WA 4WCWA 5KFXA 3UPSA 4F4YA 5DQHA 4X0AA 3V7LA 5DB6A 4DF8A 4BXOB 4IRDA 4NY8A 3N97B 5HMLA 3C5GA 2KTQA 4FH3A 1JMSA 2HW3A 5J2GA 4RT3A 4M9LA 4FS1A 5HC9A 4EBEA 3THVA 4JWMA 4F4ZA 9ICSA 3ORYA 4YCXA 4YR0A 3HP6A 2W9AA 9ICMA 3MR2A 8ICAA 3SI8A 2PI5A 4CCHA 5F9LA 2R8HA 2OWOA 3RJJA 2XO7A 5KFAA 4YVZA 8ICXA 4KMUA 3RAQA 1K1SA 5J2BA 8ICTA 4B9MA 4RPXA 3UQ2A 3GIMA 2ZH7A 5DDMA 3M9MB 2FPMA 4BGDA 2H5XA 4KLMA 1L3UA 1WCNA 5J2IA 3UQ0A 4C8NA 4MFCA 2ZUDA 2ATLA 5KFDA 4J9QA 4Q43A 4ECTA 1QSYA 4YP3A 2ASJA 1XU4A 2ASDA 4KLDA 8ICFA 5L1JA 3BQ0A 4ECXA 3MABA 3K75D 1HJPA 4DL5A 2FMQA 1V9PA 5IIOA 5J0YA 3PR5B 2M2TA 5HRLA 4O3PA 4GXIA 4WC3A 2ZJ8A 4QZEA 3PW4A 1BPXA 7ICGA 2ZJAA 4C8KA 5KFEA 9ICQA 4YG2A 3AUOA 1S9FA 4PH5A 3K4GA 3LK9A 4ED7A 3T5LA 3TAPA 1SL1A 9ICXA 4XQ8A 2AQ0A 3N4MB 3M9NB 1MQ3A 2ZH2A 2UVUA 3OVSA 4MF8A 2DPJA 4DL3A 2IMWP 4O3QA 5L1KA 1ZQAA 1BVSA 1V4AA 4DL7A 3H4DA 3RB6A 5DB8A 1L3SA 4FS2A 3KHRA 4MF2A 4AT8B 3QEAZ 3MGHA 3ISCA 2JZBB 4B9NA 5J2FA 5J0XA 5DEDA 2I1QA 3NYBA 4DSFA 4UBBA 4WC2A 3RBDA 4GXJA 2KP7A 8ICYA 4F4XA 3BQ1A 3KHHA 4IRCA 1RYSA 4WC0A 4B9TA 5KG6A 1NK6A 2ZH5A 3H8WA 3RH5A 4LVSA 4P4PA 2MUTA 4UD5A 3C18A 3ZDDA 4QWCA 5D49A 3OGUA 1ZJMA 1ZJNA 1TFYA 1NKBA 4O3RA 5CA7A 4PHEA 4J9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1J A;  5KFU A;  4Q45 A;  3OJU A;  1ZQD A;  4JWN A;  9ICW A;  9ICR A;  4ATB A;  3WFS C;  4NLK A;  1C7Y A;  3WFR E;  5KG7 A;  4IR1 A;  3T3F A;  1F5A A;  1Z3E B;  5KFS A;  3SZ2 A;  1X9W A;  5DB7 A;  1T7P A;  4EYH B;  3C5F A;  4I2E A;  2HHS A;  3MDA A;  4AT9 B;  1HUZ A;  4RWN A;  1ZQP A;  4K4I A;  1ZQK A;  7ICF A;  2ZH8 A;  3TAR A;  2RFF A;  4DEZ A;  2DPI A;  4XUS A;  1KDH A;  3ISB A;  4QWA A;  7ICN A;  3GIL A;  4JV1 A;  5KT5 A;  2V9W A;  4I2D A;  5DKW A;  3GIK A;  5HRH A;  3AQN A;  4RU9 A;  3PMN A;  2P66 A;  5HNK A;  4FBU A;  1ZQO A;  3OSP A;  3B0X A;  4FHY A;  5DEC A;  1UA0 A;  2DVI A;  2AGP A;  5HRF A;  5KFR A;  4TUR A;  3M8R A;  1NK5 A;  4QZC A;  2BKE A;  1S77 D;  2HHP A;  3PNC A;  1ZQF A;  2XGQ A;  2DRA A;  4YMM A;  2M2W A;  1JQR A;  3TQ1 A;  1XO1 A;  4ECS A;  4YR3 A;  4B9V A;  5DB9 A;  4B9L A;  3GQC A;  4B9S A;  8ICU A;  4PGX A;  7ICS A;  3LWM A;  1T4G A;  3OUY B;  4KLS A;  2ISP A;  4QW9 A;  4ECW A;  4F4W A;  2UVV A;  1MC8 A;  3H7I A;  8ICL A;  2IHM A;  3RJH A;  4ECR A;  1XSL A;  4EP7 A;  1ZQX A;  1U47 A;  3MR6 A;  4J9M A;  4O5C A;  5KT6 A;  3MR5 A;  4TUP A;  4KLO A;  4ZH4 A;  1ZET A;  2HHT A;  9ICL A;  5HRE A;  5DLG A;  4PHA A;  1ZQS A;  4QZA A;  3OVB A;  4F50 A;  2PFN A;  4FBT A;  2BPG A;  4O3O A;  3Q8P B;  4M6W A;  3B0Y A;  5J0T A;  3JPT A;  1BGX T;  3PX4 A;  3PX0 A;  1MQ2 A;  4Q8E A;  2KFZ A;  3H39 A;  1TV9 A;  1ZQQ A;  4P4M A;  2RDJ A;  2HHV A;  1X9S A;  4MEX A;  4ED8 A;  3GFK B;  4IQT A;  4PGY A;  3T5J A;  2AJQ A;  2ZH6 A;  2FPL A;  5KFY A;  3RJE A;  4QW8 A;  5EWF A;  2BCU A;  1TFR A;  1KFT A;  4NKU A;  2HHX A;  2Q0Z X;  1JN3 A;  1TAQ A;  3TFS A;  1UEU A;  3M8S A;  9ICP A;  4UB2 A;  4ECZ A;  3RR8 A;  1N56 A;  2ZTE A;  5IIL A;  1KLN A;  4JUZ A;  4ELU A;  3LDA A;  4ELV A;  1T8E A;  1LB2 B;  4Z6F A;  3BJY A;  5BPC A;  1XWL A;  1ZQJ A;  3BDP A;  5KG4 A;  5J0P A;  5BOL A;  1XSP A;  2C2E A;  2J6T A;  4QZG A;  4F4K A;  1MSW D;  5DQI A;  3TAN A;  4F93 B;  3PW0 A;  2ALZ A;  1SKW A;  4I27 A;  3H4B A;  4NKT A;  2ZH9 A;  2FLP A;  7ICM A;  1BNP A;  4UD4 A;  4X4R A;  1X9M A;  1CEZ A;  3GV8 B;  3RB0 A;  3JPO A;  4DOB A;  4RWP A;  5KG5 A;  5L1I A;  4KLT A;  5KT3 A;  1ZQT A;  2F1H A;  2FLL A;  3C2L A;  4PPX A;  1D8L A;  5KFC A;  1ZQW A;  4RQ4 A;  3PR4 A;  4EYI B;  1WCL A;  4DOA A;  1T3N A;  7ICR A;  2R8I A;  2C2R A;  1SKS A;  4M5D A;  1S0O A;  1FA0 A;  2PFO A;  1NKC A;  1UET A;  4F2S A;  4J9R A;  3ZDC A;  4KLG A;  2C2D A;  2W9C A;  3SV4 A;  3HT3 A;  2J6U A;  2KZ3 A;  4M9H A;  4QZF A;  1KEJ A;  4J9P A;  4DL6 A;  2NRT A;  3PW2 A;  1D8Y A;  5CWR A;  2BE3 A;  5KFW A;  3ETL A;  3Q8S B;  4NLZ A;  3MGI A;  4KLQ A;  4RQ6 A;  8ICN A;  1VJ7 A;  2UVW A;  1R8A A;  1QTM A;  2DR8 A;  4I2B A;  2PI4 A;  2IBK A;  2XY7 A;  2DFL A;  1A77 A;  8ICI A;  5CR0 A;  4Q44 A;  4QWD A;  4FHV A;  3ZD9 A;  2MAX A;  3TAQ A;  8ICH A;  2R8G A;  4Z6D A;  1NK9 A;  4E7X A;  1PZN A;  2BCQ A;  2ZUC A;  4DSI A;  2JEG A;  9ICI A;  5KFN A;  1S0N A;  2NRW A;  1NJZ A;  4DSK A;  3EZ5 A;  2ZJ5 A;  1KSP A;  4R64 A;  4X4U A;  2ZTD A;  1U48 A;  3IHQ B;  4F5N A;  3RRH A;  3GIJ A;  1BPZ A;  4XQ7 A;  2A1J B;  4UB5 A;  9ICN A;  2B21 A;  2RDI A;  1WOT A;  4F5Q A;  4HYK A;  1ZQL A;  5J2J A;  4RQ1 A;  4IR9 A;  4IG8 A;  4RQ2 A;  2DRB A;  3C2K A;  3PY8 A;  3HJ4 A;  7ICQ A;  3EPG A;  3UXO A;  5KFP A;  4X4V A;  1Z00 A;  4DFJ A;  8ICO A;  1R8C A;  4EZ9 A;  1ZQZ A;  4KLJ A;  8ICS A;  1JXL A;  2W9M A;  4QZB A;  3V6K A;  4RQ8 A;  1IXR A;  2BHN A;  4XA5 A;  1BNO A;  4E80 A;  2I9G A;  4NLG A;  1ZQN A;  4P4O A;  1NKE A;  1RPL A;  3V72 A;  9ICA A;  4O5E A;  4IRK A;  4PHD A;  3C1Z A;  1ZQM A;  4M2Y A;  4AT7 A;  1MIY A;  3OHA A;  5L1L A;  4FHP A;  5J0U A;  1R89 A;  5KG1 A;  4TUQ A;  1JXE A;  4X4T A;  1VFG A;  3OHB A;  1XC9 A;  2UVR A;  4RWQ A;  2W9B B;  4O9M A;  4EBJ A;  2ZH3 A;  3UXP A;  2C28 A;  4BXO A;  4C8M A;  2BQU A;  3ZD8 A;  4PGQ A;  7ICJ A;  5HRB A;  4X4O A;  1KTQ A;  2KZZ A;  4TUS A;  1JIH A;  2PBE A;  4IQU A;  3Q8M A;  4UB4 A;  4YMO A;  4WC6 A;  2HHQ A;  3MFI A;  5KFJ A;  2ZUB A;  4KLI A;  5J0Q A;  3EYZ A;  2XCA A;  4DQQ A;  4F91 B;  1CUK A;  2O1P A;  4M0A A;  2VA2 A;  4ECY A;  4ECU A;  2ZHB A;  2ISO A;  4C8L A;  1DK3 A;  1UEV A;  4QZD A;  3RJF A;  4YR2 A;  3BQ2 A;  4RNM A;  1TK0 A;  1UA1 A;  2BCR A;  1NK0 A;  4Q8F A;  1B22 A;  1BPD A;  4J9O A;  1XS9 D;  1ZQV A;  1X2I A;  5DBC A;  2F1J A;  3C21 A;  4RPY A;  3RJI A;  1TK5 A;  2PFQ A;  1TAU A;  2W8K A;  2XGP A;  2M2U A;  4KN7 A;  1NJX A;  2LYH A;  2PXI A;  1QSL A;  4DFP A;  3PW7 A;  5KFO A;  3RH6 A;  2R8J A;  4G3I A;  4QZH A;  4UAW A;  4ED2 A;  1S0M A;  2HHW A;  8ICJ A;  3MBY A;  1RXV A;  3MDC A;  3JYY A;  9ICU A;  3RJK A;  1ARO P;  4X4Q A;  3HX0 A;  4QZ8 A;  1TK8 A;  4O3S A;  3Q8L A;  1XSN A;  1ZQY A;  8ICB A;  1TFW A;  2ZTC A;  1RYR A;  4X0B A;  1RXW A;  3M9O B;  4MFF A;  4I28 A;  3PX6 A;  1SL0 A;  3G6V A;  2JEJ A;  7ICH A;  4X4N A;  2IHN A;  1SZP A;  4M9N A;  4KLE A;  4RQ3 A;  1U45 A;  3BQT A;  5KFK A;  4TQS A;  3EPI A;  4DFK A;  3RR7 A;  8ICM A;  9ICF A;  3Q8K A;  4GC6 A;  9ICV A;  5HRG A;  4WC1 A;  1EXN A;  2ASL A;  2A1J A;  5KFQ A;  4DQR A;  8ICG A;  2NRK A;  4AT8 A;  5J0R A;  4GC7 A;  3TI0 A;  2JZB A;  4KN4 A;  4DLG A;  1SKR A;  4DF4 A;  3OVA A;  3JZ0 A;  4J9L A;  3LQC B;  1L3V A;  1L5U A;  2DR5 A;  1UT8 A;  5DDY A;  1D9D A;  5KG2 A;  2FLN A;  5J29 A;  1TKD A;  2M2V A;  3H38 A;  1DOQ A;  1MIW A;  3H3A A;  5DG8 A;  4QWB A;  9ICT A;  1BPB A;  3PML A;  3NGD A;  2XC9 A;  3V7J A;  2MUT B;  4C8O A;  4WC7 A;  3PO4 A;  4QWE A;  3E2E A;  1ZQU A;  4R8U B;  5J0S A;  3G6Y A;  2JEI A;  3H37 A;  4ATB B;  3RJG A;  4J9N A;  1N48 A;  2JEF A;  2ZH4 A;  3OJS A;  2Q66 A;  3AU2 A;  3UXN A;  3JPP A;  3H40 A;  3ZDA A;  4AT9 A;  4I29 A;  1U49 A;  3PO5 A;  3L9D A;  4LT6 A;  2M9N A;  3UPQ A;  4RQ0 A;  3G6X A;  4I2F A;  1UT5 A;  1K1Q A;  5HP4 A;  3OSN A;  4KIT B;  1NOM A;  3SYZ A;  3C66 A;  4DO9 A;  4F3O A;  1S76 D;  2XY6 A;  4FHW A;  4X4P A;  4ECQ A;  2ZHA A;  4UAZ A;  5DLF A;  3PVX A;  3OV7 A;  1NK7 A;  1LV5 A;  1Y88 A;  5KTQ A;  4UB3 A;  4DQS A;  4R66 A;  1NK4 A;  1QLN A;  1JAJ A;  4RQ7 A;  1BPY A;  5EWE A;  2VAN A;  5III A;  3WFQ E;  7ICI A;  3JPS A;  1Q79 A;  3PV8 A;  4BWJ A;  5D46 A;  3KTQ A;  2KFN A;  2AU0 A;  2ZH1 A;  4R65 A;  2XY5 A;  5J2C A;  4LZD A;  3QZ7 A;  2V4R A;  1IM4 A;  4O0I A;  4RQ5 A;  4KLU A;  8ICP A;  3RBE A;  4X4S A;  4GLX A;  4DOC A;  2AQ4 A;  2P6U A;  1U4B A;  4K4G A;  1OU5 A;  4XRH A;  3OUY A;  5EOZ A;  4BWM A;  3C1Y A;  9ICK A;  1KNY A;  4UAY A;  2BR0 A;  4DQI A;  1NO5 A;  2XCP A;  5KFG A;  3RB3 A;  4PHP A;  4EBC A;  4MEY A;  7ICO A;  5IIJ A;  1S0V A;  4KLF A;  8ICV A;  5HR9 A;  3H8J A;  1RZT A;  5HRK A;  3EW9 A;  8ICE A;  4I2I A;  3JPN A;  5DG7 A;  3KHL A;  4Z6E A;  2DR7 A;  4JV0 A;  5BOM A;  4F5P A;  4KTQ A;  1NJY A;  3MFH A;  5KFV A;  4DSL A;  5C5J A;  1L3T A;  4B9U A;  5HRD A;  2KZM A;  4YQW A;  2BQR A;  5KT7 A;  4M6W B;  4MFA A;  5J2A A;  4DL4 A;  5HHI A;  2V4Q A;  5KFZ A;  5TZV A;  7ICK A;  4DLE A;  2PFP A;  1S10 A;  4EBD A;  4I2C A;  4F5R A;  3HW8 A;  4YFK A;  3SV3 A;  4YMN A;  2FPK A;  4Z6C A;  4RUC A;  4R63 A;  4M9G A;  1DK2 A;  1NJW A;  3V7K A;  1NK8 A;  5DGB A;  4I2A A;  7ICU A;  4O5K A;  4RNN A;  4DFM A;  2O5A A;  5CJ7 A;  4YXM A;  3V6J A;  7ICT A;  5KFI A;  9ICH A;  4FHX A;  1NZP A;  3TFR A;  2BPC A;  4RPZ A;  9ICC A;  2AGO A;  4ED1 A;  4ED3 A;  9ICO A;  3LWL A;  5KFB A;  1ZQG A;  5KFT A;  5KFL A;  4I2G A;  5DGA A;  3HPO A;  2HHU A;  1MIV A;  4RNO A;  5J0O A;  2NRZ A;  4O3N A;  5KT4 A;  1A76 A;  4DS5 A;  3HWT A;  4J9K A;  3PW5 A;  2BQ3 A;  2GWS A;  5DBA A;  5IIM A;  1ZQH A;  4JV2 A;  4EZ6 A;  4KLH A;  8ICC A;  2HVI A;  4WBZ A;  3GV7 B;  4QZI A;  3AU6 A;  4R8U A;  4S3N A;  3H8S A;  3V6H A;  1H38 A;  8ICK A;  1Q78 A;  4IQW A;  1DGS A;  3MR3 A;  8ICW A;  5DG9 A;  2P6R A;  3AQM A;  4JK1 A;  3T5H A;  7ICP A;  4M47 A;  3AQK A;  4E8F A;  3JPQ A;  4NXZ A;  4K4H A;  5HHH A;  4M04 A;  8ICQ A;  4KLL A;  1B43 A;  3FDS A;  5L9X A;  2Y1I A;  4YN4 A;  1KRP A;  4F8R A;  4NM1 A;  2KN7 A;  2BCV A;  2J6S A;  4WC5 A;  4DL2 A;  4DSE A;  1ZYQ A;  4DSJ A;  2W9C B;  7ICE A;  5F2V O;  4ECV A;  2C22 A;  4RWO A;  1ZQE A;  3GII A;  4ELT A;  1COO A;  4RT2 A;  4FO6 A;  4DWI A;  7ICV A;  1ZQC A;  3Q8R B;  1ZQR A;  2BGW A;  4UBC A;  2IA6 A;  4BDP A;  9ICG A;  3C2M A;  4WC4 A;  3GV5 B;  5CHG A;  1SL2 A;  5KG0 A;  1QSS A;  4DQP A;  4LZG A;  5F9N A;  3RH4 A;  4EBK A;  3T5K A;  5EWG A;  1S97 A;  3ZDE A;  4YXJ A;  4IQV A;  4QZ9 A;  4UQG A;  1HUO A;  4NM2 A;  3KHG A;  2BCS A;  2ID1 A;  1KFS A;  4RZR A;  1TVA A;  4F2R A;  3AQL A;  9ICE A;  3EWA A;  1YLQ A;  5CB1 A;  1JX4 A;  3ZDB A;  2HVH A;  2DR9 A;  4UB1 A;  3HIY A;  5IIK A;  7ICL A;  5KFH A;  3ISD A;  4X5V A;  5J2E A;  2FMP A;  3WFO A;  2NRX A;  1U9L A;  3QEB Z;  2AGQ A;  2NRV A;  1KFD A;  4FH5 A;  4F92 B;  2FMS A;  4ED6 A;  5HRI A;  4EEY A;  4TQR A;  5DBB A;  2F1I A;  5KFM A;  4M9J A;  3RTV A;  9ICJ A;  2R8K A;  1BPE A;  5KFF A;  3GDX A;  5KT2 A;  5KG3 A;  2VA3 A;  4E0D A;  3WFP A;  1D9F A;  3C23 A;  1Z00 B;  2W8L A;  5D4B A;  4I2J A;  1PX5 A;  5DQG A;  2WTF A;  3HJ1 A;  8ICZ A;  3RAX A;  5J2H A;  8ICR A;  3Q8Q B;  2BDP A;  4DS4 A;  4P2H A;  5IIN A;  1R8B A;  4YD1 A;  2VA8 A;  5J2K A;  1ZQB A;  3RB4 A;  3QE9 Y;  3QZ8 A;  4F5O A;  1ZQI A;  4GXK A;  4I2H A;  3FYH A;  5J2D A;  4RUA A;  2BPF A;  4YD2 A;  4NLN A;  4WBY A;  4AT7 B;  4ED0 A;  9ICB A;  3NTU A;  5HMM A;  3IM1 A;  5CP2 A;  5JUM A;  3JPR A;  2W9B A;  3RRG A;  5J0W A;  4WCW A;  5KFX A;  3UPS A;  4F4Y A;  5DQH A;  4X0A A;  3V7L A;  5DB6 A;  4DF8 A;  4BXO B;  4IRD A;  4NY8 A;  3N97 B;  5HML A;  3C5G A;  2KTQ A;  4FH3 A;  1JMS A;  2HW3 A;  5J2G A;  4RT3 A;  4M9L A;  4FS1 A;  5HC9 A;  4EBE A;  3THV A;  4JWM A;  4F4Z A;  9ICS A;  3ORY A;  4YCX A;  4YR0 A;  3HP6 A;  2W9A A;  9ICM A;  3MR2 A;  8ICA A;  3SI8 A;  2PI5 A;  4CCH A;  5F9L A;  2R8H A;  2OWO A;  3RJJ A;  2XO7 A;  5KFA A;  4YVZ A;  8ICX A;  4KMU A;  3RAQ A;  1K1S A;  5J2B A;  8ICT A;  4B9M A;  4RPX A;  3UQ2 A;  3GIM A;  2ZH7 A;  5DDM A;  3M9M B;  2FPM A;  4BGD A;  2H5X A;  4KLM A;  1L3U A;  1WCN A;  5J2I A;  3UQ0 A;  4C8N A;  4MFC A;  2ZUD A;  2ATL A;  5KFD A;  4J9Q A;  4Q43 A;  4ECT A;  1QSY A;  4YP3 A;  2ASJ A;  1XU4 A;  2ASD A;  4KLD A;  8ICF A;  5L1J A;  3BQ0 A;  4ECX A;  3MAB A;  3K75 D;  1HJP A;  4DL5 A;  2FMQ A;  1V9P A;  5IIO A;  5J0Y A;  3PR5 B;  2M2T A;  5HRL A;  4O3P A;  4GXI A;  4WC3 A;  2ZJ8 A;  4QZE A;  3PW4 A;  1BPX A;  7ICG A;  2ZJA A;  4C8K A;  5KFE A;  9ICQ A;  4YG2 A;  3AUO A;  1S9F A;  4PH5 A;  3K4G A;  3LK9 A;  4ED7 A;  3T5L A;  3TAP A;  1SL1 A;  9ICX A;  4XQ8 A;  2AQ0 A;  3N4M B;  3M9N B;  1MQ3 A;  2ZH2 A;  2UVU A;  3OVS A;  4MF8 A;  2DPJ A;  4DL3 A;  2IMW P;  4O3Q A;  5L1K A;  1ZQA A;  1BVS A;  1V4A A;  4DL7 A;  3H4D A;  3RB6 A;  5DB8 A;  1L3S A;  4FS2 A;  3KHR A;  4MF2 A;  4AT8 B;  3QEA Z;  3MGH A;  3ISC A;  2JZB B;  4B9N A;  5J2F A;  5J0X A;  5DED A;  2I1Q A;  3NYB A;  4DSF A;  4UBB A;  4WC2 A;  3RBD A;  4GXJ A;  2KP7 A;  8ICY A;  4F4X A;  3BQ1 A;  3KHH A;  4IRC A;  1RYS A;  4WC0 A;  4B9T A;  5KG6 A;  1NK6 A;  2ZH5 A;  3H8W A;  3RH5 A;  4LVS A;  4P4P A;  2MUT A;  4UD5 A;  3C18 A;  3ZDD A;  4QWC A;  5D49 A;  3OGU A;  1ZJM A;  1ZJN A;  1TFY A;  1NKB A;  4O3R A;  5CA7 A;  4PHE A;  4J9S A; 
#chains in the Genus database with same CATH topology
 2Y1J A;  3OJU A;  1ZQD A;  2N1R A;  9ICR A;  9ICW A;  5AM0 A;  4NLK A;  1C7Y A;  5F3X B;  1F5A A;  1Z3E B;  2VIX A;  4NWI A;  5KFS A;  3L3F X;  2ZXH A;  3C5F A;  4I2E A;  2ES6 A;  3MDA A;  5AKX A;  4RWN A;  4DEZ A;  1O03 A;  2DPI A;  1KDH A;  3ISB A;  1SV0 C;  4QWA A;  2IOF A;  2DWQ A;  4I2D A;  5DKW A;  3CNH A;  2MRL A;  4FBU A;  3OSP A;  5DEC A;  3M8R A;  1NK5 A;  4QZC A;  3TQ1 A;  3IP4 B;  4YR3 A;  4B9V A;  2H3F A;  4B9S A;  2KHQ A;  3OUY B;  4KLS A;  4QW9 A;  2RQ5 A;  1PVP A;  2E1F A;  5KT6 A;  3MR5 A;  4TUP A;  4KLO A;  4ZH4 A;  1ZET A;  2HHT A;  1UHU A;  9ICL A;  1DXS A;  2F8K A;  4M6W A;  1MQ2 A;  1BGX T;  2KKV A;  2KFZ A;  3H39 A;  3K7D A;  1TV9 A;  1SWW A;  4P4M A;  2HHV A;  2M0N A;  2FPL A;  3PSF A;  1KFT A;  2F44 A;  2HHX A;  1JN3 A;  4AYB F;  3RR8 A;  3PZP A;  1XNS A;  3LDA A;  3DEE A;  1T8E A;  5BPC A;  2ZIU A;  1ZQJ A;  5BOL A;  2DGZ A;  2C2E A;  1MSW D;  4PJ0 U;  3PW0 A;  1SKW A;  1YZ6 A;  4I27 A;  4NKT A;  4UD4 A;  7ICM A;  5ALL A;  2OEH A;  5KG5 A;  4RWP A;  4PZO A;  1ZQT A;  4NXU A;  1WCL A;  2R8I A;  2C2R A;  2A19 A;  2KV2 A;  1FA0 A;  1UET A;  5AK6 A;  5AKZ A;  1TAM A;  2W9C A;  4DL6 A;  2BE3 A;  5KFW A;  4KMO B;  3MGI A;  4RQ6 A;  1VJ7 A;  4CNQ A;  1R8A A;  3AQF A;  4I2B A;  2IBK A;  2XY7 A;  1IG6 A;  5CR0 A;  4Q44 A;  4QWD A;  1NK9 A;  1PZN A;  2BCQ A;  4DSI A;  3IRU A;  3QUT A;  4NXT A;  4R64 A;  3VCB A;  1ZRM A;  4F5N A;  4XQ7 A;  2A1J B;  5ALR A;  1KN5 A;  4AP9 A;  2B21 A;  1WOT A;  4HYK A;  1ZQL A;  1PK3 A;  5ALT A;  4O6A A;  3PY8 A;  1KQQ A;  3EPG A;  3UXO A;  5KFP A;  1JXL A;  4QZB A;  4NLC A;  4E80 A;  2I9G A;  4NLG A;  1RPL A;  4CRX A;  3EF2 A;  9ICA A;  2QLT A;  3WK7 A;  2LI6 A;  2LKY A;  3UXP A;  3QXG A;  4C8M A;  5HRB A;  3ZD8 A;  1L8L A;  1KTQ A;  2YMM A;  2KHV A;  4TUS A;  4YMO A;  4U6P A;  3QU5 A;  5KFJ A;  4OJP A;  4KLI A;  5AKJ A;  4F91 B;  1CUK A;  3S6J A;  5AKY A;  2VA2 A;  2ODG A;  1FO4 A;  3K1R B;  4ECU A;  4C8L A;  3RJF A;  4B6J A;  1TK0 A;  1UA1 A;  4RPY A;  3RJI A;  3N7S C;  2PFQ A;  1JUD A;  2QAR A;  2LYH A;  4KN7 A;  2LYB A;  4G3I A;  2Z7J A;  4QZH A;  4ZOH C;  3MDC A;  3JYY A;  3RJK A;  5HR6 A;  3BZC A;  1F5S A;  1XSN A;  1ZQY A;  3E58 A;  5B3Q A;  3IDW A;  1ZD2 P;  2EWR A;  3M9O B;  5ALK A;  4KLE A;  1RYU A;  3BQT A;  9ICV A;  3EPI A;  9ICF A;  4GC6 A;  5HRG A;  5JTG A;  2EAM A;  5FP0 A;  3WKE A;  1SKR A;  1WUD A;  3JZ0 A;  4J9L A;  3BQ7 A;  3K1Z A;  4Y2T A;  2DR5 A;  2JH7 A;  2HOI A;  1HIW A;  5KG2 A;  4QWB A;  2LYA A;  3PML A;  5ALZ A;  5AK5 A;  1ZQU A;  5J0S A;  4ATB B;  3RJG A;  2JEF A;  3OJS A;  2Q66 A;  4AT9 A;  3JPP A;  3L9D A;  2HOF A;  4F71 A;  2ESE A;  3G6X A;  3OWG A;  1K1Q A;  2E8P A;  3SYZ A;  4KIT B;  4UB6 U;  5G5H A;  2XY6 A;  5DLF A;  3OV7 A;  1SXE A;  3PVX A;  1NK7 A;  1Y88 A;  1NK4 A;  1QLN A;  1BPY A;  1B4F A;  5KL1 B;  3PV8 A;  2KFN A;  2AU0 A;  1IM4 A;  4DOC A;  3QU4 A;  5AI4 A;  4K4G A;  1TE2 A;  4BWM A;  3C1Y A;  4DQI A;  4MEY A;  7ICO A;  5IIJ A;  1S0V A;  2XVT A;  2JXJ A;  1L8O A;  1UPH A;  5HRK A;  2QB0 B;  4I2I A;  5DG7 A;  4JV0 A;  2ZXI A;  3MFH A;  2KZM A;  5HHI A;  5KFZ A;  5TZV A;  3H0L B;  1S10 A;  2PFP A;  3HW8 A;  4YFK A;  1QQ5 A;  1DK2 A;  1VJ5 A;  4RNN A;  4YXM A;  1OUQ A;  1NZP A;  3CYM A;  4EED A;  3NWI A;  2B6G A;  4ED3 A;  9ICO A;  1ZQG A;  5KFB A;  4I2G A;  5D61 A;  3HPO A;  3NVZ A;  2HHU A;  2NV3 A;  5J0O A;  5KT4 A;  2BQ3 A;  8ICC A;  4OD0 A;  2LHT A;  5IIM A;  5EE9 A;  5E79 U;  2KIW A;  2KNJ A;  1Q78 A;  3NKU A;  3MR3 A;  5DG9 A;  4QIW C;  7ICP A;  4K4H A;  4KLL A;  1DGJ A;  2BDU A;  1UCV A;  2EZX A;  4DL2 A;  1ZYQ A;  5F2V O;  2C22 A;  5AKH A;  2QKQ A;  4EGW A;  5L1M A;  1L7N A;  3AMZ A;  4KM5 A;  1SL2 A;  2EAN A;  3RH4 A;  3T5K A;  4NM2 A;  4RZR A;  3EWA A;  5ALI A;  1YLQ A;  2NYV A;  3ZDB A;  2HVH A;  5IIK A;  7ICL A;  5KFH A;  3F2C A;  3WFO A;  2NRX A;  2NRV A;  4FH5 A;  2FMS A;  5KAI U;  1B0X A;  5DBB A;  2AXT U;  3RTV A;  1BPE A;  5KFF A;  3GDX A;  5B5E U;  2VA3 A;  4E0D A;  1IV8 A;  2WTF A;  8ICZ A;  3L5K A;  3WK4 A;  4DS4 A;  1ZXI A;  2G08 A;  2KIC A;  1PUZ A;  2KSO A;  2BPF A;  3QUB A;  4AT7 B;  3FC4 A;  2Y0S C;  5AK4 A;  1ZD3 A;  5J0W A;  4WCW A;  5KFX A;  3V7L A;  4DF8 A;  4BXO B;  4IRD A;  3N97 B;  3QX7 A;  9ICS A;  4F4Z A;  4CF3 A;  5AM1 A;  3SI8 A;  2EAP A;  3AN1 A;  2P35 A;  5F9L A;  2R8H A;  4K9B A;  5ALE A;  1HEK A;  8ICX A;  4FFD A;  3RAQ A;  3GU3 A;  8ICT A;  3U26 A;  2YB4 A;  4RPX A;  3UQ2 A;  3GIM A;  3MCR A;  5J2I A;  3UQ0 A;  4C8N A;  5AKL A;  1FEZ A;  2ASD A;  3D2Q A;  3BQ0 A;  4DL5 A;  2FMQ A;  5J0Y A;  5HRL A;  5AM3 A;  2ZJ8 A;  3OPX A;  1X40 A;  7ICG A;  4C8K A;  5ALG A;  5KFE A;  3AUO A;  3TAP A;  1SL1 A;  1N63 A;  4KX3 A;  1L7O A;  4DL3 A;  2IMW P;  4DL7 A;  1L3S A;  2ZIX B;  4FS2 A;  4MF2 A;  5AKE A;  2W54 A;  2JZB B;  5DED A;  2RP5 A;  5D62 A;  2LM4 A;  4IRC A;  3SMV A;  3WK9 A;  4LVS A;  4P4P A;  1SZH A;  5D49 A;  1MN8 A;  4O5K A;  3M8S A;  3QEB Z;  5AIC A;  1FFU A;  3WFS C;  5KG7 A;  3T3F A;  5H2F U;  1T7P A;  1X9W A;  5DB7 A;  3CRX A;  2HHS A;  2KOB A;  2E3T A;  3VC8 A;  5K4L A;  7ICF A;  1ZQK A;  5B3P A;  3TAR A;  1OXJ A;  3SEN A;  3LVW A;  2WF9 A;  2FJ6 A;  3GIL A;  3BS5 A;  2V9W A;  3GIK A;  2P66 A;  1RQN A;  4FHY A;  1UA0 A;  4OJ5 A;  2LBO A;  2AGP A;  2YML A;  2DVI A;  2IOF K;  5KFR A;  1JQR A;  4ECS A;  3WU2 U;  2G5H B;  7ICS A;  3LWM A;  4MHV A;  2UVV A;  2IHM A;  3RJH A;  2PMZ F;  1XSL A;  1J2M A;  4J9M A;  4O5C A;  1X6I A;  5DLG A;  1ZQS A;  5J8Y C;  2PFN A;  4O3O A;  3PX4 A;  2GLE A;  1ZQQ A;  1X9S A;  3F2D A;  2ZIW B;  2E8O A;  4IQT A;  4PGY A;  3T5J A;  4P0Q B;  5KFY A;  3NVO A;  3RJE A;  4QW8 A;  2BCU A;  4NKU A;  2R18 A;  4ELU A;  2WB1 C;  1N56 A;  1KLN A;  1LB2 B;  4NXV A;  3BJY A;  3PHZ A;  1XWL A;  4IL6 U;  1XSP A;  4F4K A;  3TAN A;  2ALZ A;  1ZOL A;  4X4R A;  5AIA A;  2NO5 A;  3RB0 A;  2A3V A;  1COK A;  5L1I A;  5CFT A;  4KLT A;  5KT3 A;  2F1H A;  2GA9 D;  1D8L A;  1ZQW A;  4RQ4 A;  3PR4 A;  4DOA A;  7ICR A;  4M5D A;  1SKS A;  5ALY A;  2PFO A;  1Z19 A;  2KG5 A;  4J9R A;  3ZDC A;  4KLG A;  3SV4 A;  3HT3 A;  2CN1 A;  3PW2 A;  1D8Y A;  1SIJ A;  2Y9T A;  4Y2V A;  5AI5 A;  4C4T A;  3F2B A;  5C0Y A;  3KKA A;  1QTM A;  4NXX A;  2PI4 A;  1A77 A;  4OAF A;  3FAH A;  3ZD9 A;  2MAX A;  2JEG A;  4FZM A;  1V85 A;  3IHQ B;  3GIJ A;  4IG8 A;  4RQ2 A;  2DRB A;  3HJ4 A;  2K8C B;  4DFJ A;  4EZ9 A;  1ZQZ A;  3KFU F;  4XA5 A;  2BHN A;  1RQL A;  2WF7 A;  4P4O A;  1NKE A;  2W7P A;  4O5E A;  4PHD A;  1ZQM A;  4M2Y A;  1MIY A;  3RFA A;  5L1L A;  4BJQ A;  4FHP A;  1X9X A;  5TIS U;  2H3V A;  1JXE A;  3OHB A;  1XC9 A;  4Y2Y A;  1WYG A;  7ICJ A;  4X4O A;  1LKY A;  4WC6 A;  3Q8M A;  4UB4 A;  3MFI A;  2W04 A;  5J0Q A;  4P0P B;  2K8A A;  1DK3 A;  2WFA A;  3BQ2 A;  4RNM A;  4Q8F A;  5B66 U;  4J9O A;  1XS9 D;  3C21 A;  1TAU A;  3HIL A;  3J81 j;  1NJX A;  2PXI A;  4UAW A;  8ICJ A;  2HHW A;  3MBY A;  2YQE A;  2AH5 A;  1ARO P;  4X4Q A;  3HX0 A;  1TK8 A;  2ZIV A;  5D63 A;  1PK1 B;  3SAG A;  4X0B A;  4MFF A;  3PX6 A;  3M1Y A;  5KFK A;  4DFK A;  1QQ7 A;  1L7P A;  2G06 A;  2A1J A;  2NRK A;  4AT8 A;  4GC7 A;  3TI0 A;  4KN4 A;  4DF4 A;  3LQC B;  4ICA A;  1L3V A;  2VJ5 A;  2YY6 A;  1D9D A;  2M2V A;  1TKD A;  1DOQ A;  3H3A A;  3SAH A;  2B0C A;  1BPB A;  3NGD A;  1S5L U;  2XC9 A;  3G6Y A;  4NJ8 A;  3UXN A;  1U49 A;  3UPQ A;  4O67 A;  4N7R A;  3H0M B;  2KD1 A;  4X4P A;  4ECQ A;  4UAZ A;  4UB3 A;  4DQS A;  3LVV A;  2W3S A;  4GIB A;  5EWE A;  2G5I B;  4O68 A;  1Q79 A;  5ALQ A;  5D46 A;  3QZ7 A;  3M7D A;  1OU5 A;  4XRH A;  5EOZ A;  4J03 A;  1GO3 F;  2BR0 A;  1NO5 A;  4EBC A;  2CPR A;  3H8J A;  2WAQ C;  2HSZ A;  2DF4 B;  3JPN A;  2WHE A;  2B56 A;  5BOM A;  2DR7 A;  1NJY A;  3KZX A;  2K4P A;  4DSL A;  3NVY A;  4YQW A;  4M6W B;  5J2A A;  4DL4 A;  3NVV A;  2V4Q A;  2YB1 A;  2FPK A;  2KK0 A;  4Z6C A;  4RUC A;  5DGB A;  2KVS A;  2O5A A;  4OJ6 A;  9ICH A;  2EZZ A;  4RPZ A;  2JRZ A;  9ICC A;  4K99 A;  3DV9 A;  5KFL A;  2ZIU B;  3SAF A;  2RFF A;  4O3N A;  2GWS A;  1A76 A;  3BDP A;  3HWT A;  5DBA A;  1ZQH A;  4EZ6 A;  4WBZ A;  3GV7 B;  1QH9 A;  3AU6 A;  3V6H A;  1H38 A;  1DGS A;  2P6R A;  3AQK A;  3T5H A;  2HOQ A;  3JPQ A;  2DL0 A;  2JV3 A;  1KRP A;  4F8R A;  3QU9 A;  4WC5 A;  2HCF A;  2W9C B;  4RWO A;  4OJO A;  4DWI A;  1ZQC A;  2DQN B;  4UBC A;  4WC4 A;  3A0H U;  3MGV A;  4DQP A;  2KVC A;  5F9N A;  2HBM A;  1S97 A;  4YXJ A;  4IQV A;  1HUO A;  2BCS A;  3KHG A;  2ID1 A;  1JX4 A;  1X42 A;  2QB0 A;  4X5V A;  5AKG A;  2FMP A;  1U9L A;  5T14 A;  4EEY A;  1XO0 A;  3UMB A;  4M9J A;  2HBJ A;  2JGA A;  2R8K A;  5KT2 A;  5KG3 A;  1D9F A;  4EEK A;  4I2J A;  5KL8 B;  5AKK A;  3BZK A;  5DQG A;  2Y0S F;  3D2S A;  3Q8Q B;  4P2H A;  5EE3 A;  5J2K A;  4A8E A;  2RRD A;  3RB4 A;  2XI9 A;  5ALF A;  3QE9 Y;  3QZ8 A;  3FYH A;  5J2D A;  4YD2 A;  4EEB A;  2HBL A;  2K60 A;  3JPR A;  2W43 A;  2W9B A;  1QCK A;  1SB3 C;  1DRG A;  3UPS A;  4F4Y A;  5DQH A;  4X0A A;  2G09 A;  1O08 A;  5HML A;  1NKB A;  1JMS A;  4AYB C;  5J2G A;  4CF4 A;  3ZI4 A;  3THV A;  1KW4 A;  8ICA A;  2ZG6 A;  2PI5 A;  3TAC B;  2OWO A;  3RJJ A;  1LVH A;  2XO7 A;  1SV0 A;  2G07 A;  4KMU A;  5J2B A;  5DDM A;  3I1Y A;  2YTU A;  3M9M B;  2QAR B;  4Y2R A;  1Z1V A;  4MFC A;  5KFD A;  4J9Q A;  1QSY A;  8ICF A;  1FFV A;  3MAB A;  1T3Q A;  3K75 D;  4IS7 A;  3MC1 A;  2HBK A;  3PR5 B;  5AM5 A;  4WC3 A;  3PW4 A;  4HAI A;  1V38 A;  2ZJA A;  3LK9 A;  4ED7 A;  3T5L A;  9ICX A;  1VDV A;  4XQ8 A;  3WKA A;  3M9N B;  1KL9 A;  4MF8 A;  4O3Q A;  3NAS A;  1ZQA A;  5HR7 A;  1V4A A;  3H4D A;  5DB8 A;  5CRX A;  5AI8 A;  3ISC A;  1MA7 A;  3HRD D;  4DSF A;  4UBB A;  4GXJ A;  4F4X A;  3BQ1 A;  3AQE A;  1RYS A;  2ZH5 A;  3H8W A;  2BBH A;  2MUT A;  4UD5 A;  3C18 A;  3FM9 A;  3ZDD A;  4WOY A;  1ZJM A;  1SWV A;  4O3R A;  4J9S A;  1CI4 A;  2EDU A;  4AT9 B;  2KEY A;  4PL1 A;  4EYH B;  2JMG A;  1HUZ A;  1NZB A;  1ZQP A;  3C28 A;  4K4I A;  2ZH8 A;  4XUS A;  7ICN A;  4JV1 A;  5KT5 A;  5HRH A;  3AQN A;  3JCF A;  3RF9 A;  3PMN A;  2IHO A;  1ZQO A;  3B0X A;  3AEV A;  4TUR A;  2HHP A;  3PNC A;  1ZQF A;  5A0L A;  5DB9 A;  3N7P D;  4B9L A;  3GQC A;  1QQ6 A;  8ICU A;  4PGX A;  3M6Z A;  5JRT A;  3H7I A;  4EP7 A;  1U47 A;  1FIQ A;  3IG8 A;  4PHA A;  4QZA A;  3OVB A;  4FBT A;  5ALS A;  3Q8P B;  5J0T A;  1WWU A;  3I76 A;  2RDJ A;  4MEX A;  4ED8 A;  2AJQ A;  1D8B A;  5EWF A;  2DKX A;  3HKZ F;  1TAQ A;  4C4R A;  1UEU A;  9ICP A;  4UB2 A;  3NS1 A;  3UMG A;  4ECZ A;  2EH9 A;  3WK8 A;  4ELV A;  5KG4 A;  5J0P A;  1F0M A;  2J6T A;  4QZG A;  5DQI A;  2ZH9 A;  3H4B A;  4EEL A;  5ALJ A;  2FLL A;  1J2N A;  4PPX A;  1T3N A;  1S0O A;  1NKC A;  4LEW A;  2J6U A;  1KEJ A;  2W11 A;  4KLQ A;  2FI1 A;  8ICN A;  2XIC A;  1GPJ A;  2DBY A;  2KJ8 A;  8ICI A;  3TAQ A;  3SR6 A;  2R8G A;  2ZUC A;  4Y2S A;  2JR5 A;  4DSK A;  3EZ5 A;  2ZJ5 A;  3KBB A;  1YZ7 A;  3RRH A;  9ICN A;  4UB5 A;  2RDI A;  2DKZ A;  5J2J A;  1Q46 A;  4RQ1 A;  4IR9 A;  4KB6 A;  1SGG A;  2WF5 A;  1Z00 A;  8ICO A;  2W7O A;  4KLJ A;  4RQ8 A;  2B4V A;  1BNO A;  4P0Q A;  3AL0 B;  2H3Q A;  1SXD A;  1JRO A;  4O69 A;  4IRK A;  3C1Z A;  3QU2 A;  2KSO B;  3OHA A;  4LJX A;  4FZL A;  5AI6 A;  2ZH3 A;  2C28 A;  2BQU A;  2KZZ A;  2HHQ A;  4DQQ A;  2XCA A;  4UB8 U;  4M0A A;  1Q8K A;  2KE7 A;  2ZHB A;  2ISO A;  4I0U A;  4QZD A;  5AM2 A;  4YR2 A;  1BPD A;  1ZQV A;  1X2I A;  2F77 X;  2F1J A;  2M2U A;  4WJ3 B;  2BBJ A;  2NO4 A;  2R8J A;  4CE6 A;  1S0M A;  1UQV A;  3HJE A;  4ED2 A;  1V97 A;  2WF8 A;  9ICU A;  2KJ5 A;  3KOO A;  3WKC A;  3ERC C;  8ICB A;  4UW9 A;  4NLB A;  1RYR A;  1X66 A;  4I28 A;  1SL0 A;  2JEJ A;  2IHN A;  4M9N A;  1U45 A;  4TQS A;  3RR7 A;  8ICM A;  4WC1 A;  3OTQ A;  3Q8K A;  1K5O A;  5AI9 A;  2VKQ A;  2ASL A;  4US9 A;  5KFQ A;  4DQR A;  4US8 A;  4DLG A;  2OM6 A;  3OVA A;  1KKX A;  2FE9 A;  1L5U A;  1UT8 A;  5DDY A;  2FLN A;  4K9A A;  1Q3U A;  2LM1 A;  4WC7 A;  4LEZ A;  3ER9 B;  3PO4 A;  5AI0 A;  4R8U B;  3H37 A;  2JEI A;  3LYS A;  1JI7 A;  1ECW A;  3AU2 A;  3H40 A;  4I29 A;  1ZD4 A;  2HN2 A;  2YN4 A;  4LT6 A;  2M9N A;  3R9K A;  1UT5 A;  4DO9 A;  1N62 A;  4F3O A;  1S76 D;  4GFJ A;  5KNI A;  1ZQ1 C;  5KTQ A;  3BS5 B;  3I28 A;  5III A;  2OXO A;  3WFQ E;  7ICI A;  4P0P A;  3IV6 A;  2ZH1 A;  2XY5 A;  5J2C A;  2V4R A;  4O0I A;  4RQ5 A;  3RBE A;  4X4S A;  2AQ4 A;  1U4B A;  2P6U A;  4FO1 A;  3OUY A;  4PHP A;  8ICV A;  5HR9 A;  4U7C A;  4NXW A;  8ICE A;  3KHL A;  4C4S A;  4F5P A;  2CRX A;  3F5E A;  1L3T A;  4B9U A;  3D6J A;  3NRZ A;  2BQR A;  1PK1 A;  4MFA A;  4UAV A;  7ICK A;  4CGZ A;  2K4I A;  4DLE A;  1PVQ A;  4I2C A;  4EBD A;  1WG8 A;  4F5R A;  2OYY A;  4YMN A;  4M9G A;  1C20 A;  1NJW A;  3V7K A;  1NK8 A;  4I2A A;  4IC9 A;  4WH5 A;  3V6J A;  5KFI A;  3N28 A;  3ALR A;  3ED5 A;  2B51 A;  3TFR A;  2BPC A;  4ED1 A;  5KFT A;  5DGA A;  1MIV A;  5EE0 A;  1Q3V A;  1TFW A;  4DS5 A;  3T79 A;  2YMP A;  3QUQ A;  5JTI A;  4S3N A;  8ICK A;  2Q4T A;  3GZF A;  4IQW A;  8ICW A;  3AQM A;  4E8F A;  8ICQ A;  1B43 A;  2HN1 A;  4YN4 A;  4RQM A;  4NM1 A;  2KN7 A;  2BCV A;  2J6S A;  4DSJ A;  2RHF A;  4ECV A;  4ELT A;  1COO A;  4FO6 A;  3ER8 C;  4QNL A;  3Q8R B;  1ZQR A;  2WF6 A;  2BGW A;  9ICG A;  2IA6 A;  3C2M A;  1CRX A;  5KG0 A;  4LZG A;  3F5A A;  4EBK A;  3ZDE A;  1TVA A;  4LEV A;  5CB1 A;  2DR9 A;  1IIP A;  4UB1 A;  4OAG A;  2AGQ A;  4UAS A;  4K8V A;  9ICJ A;  5ALU A;  4G9B A;  3PSI A;  3WFP A;  4JLZ A;  3C23 A;  4OO1 J;  2W8L A;  2PMZ C;  1N5W A;  3DDH A;  3RAX A;  5J2H A;  2BDP A;  2FDR A;  2VA8 A;  1ZQB A;  4F5O A;  4GXK A;  4I2H A;  4RUA A;  4NLN A;  4WQK A;  2F76 X;  9ICB A;  3NTU A;  5HMM A;  3IM1 A;  5CP2 A;  5DB6 A;  4NY8 A;  3C5G A;  3ONN A;  3A0B U;  5ALM A;  3N7R C;  4FH3 A;  1LKY B;  4M9L A;  4FS1 A;  4EBE A;  4JWM A;  2OHF A;  3MR2 A;  4CCH A;  1RG6 A;  5KFA A;  1PVR A;  1AQ6 A;  4YVZ A;  4B9M A;  1L7M A;  2FPM A;  2H5X A;  1L3U A;  1WCN A;  2ZUD A;  2ATL A;  3D2N A;  4ECT A;  4YP3 A;  5L1J A;  2F3N A;  1JAL A;  1V9P A;  5IIO A;  2M2T A;  4BUG A;  2ZIV B;  3NVW A;  9ICQ A;  1S9F A;  4PH5 A;  5KAF U;  2AQ0 A;  5ALX A;  3N4M B;  4EEN A;  3H0R B;  2JHD A;  1BVS A;  4DFD A;  2YX8 A;  5J8Y A;  3RB6 A;  3KHR A;  2HDO A;  4AT8 B;  3QEA Z;  4B9N A;  5J2F A;  5J0X A;  2I1Q A;  2KP7 A;  8ICY A;  4QIW F;  4WC0 A;  4B9T A;  2KIV A;  5KG6 A;  1A0P A;  4HX0 A;  2RLT A;  1TFY A;  3OGU A;  5CA7 A;  4PHE A;  4ATB A;  5KFU A;  4Q45 A;  4JWN A;  5ALV A;  3WFR E;  2BZF A;  4IR1 A;  3SZ2 A;  4Y2J A;  4UAT A;  3WKD A;  2YMQ A;  1NNL A;  5CFS A;  4KX5 A;  4RU9 A;  5HNK A;  5HRF A;  3SEI A;  1S77 D;  2BKE A;  2K4E A;  3PST A;  5AIB A;  3CK6 A;  5CHE A;  2XGQ A;  2DRA A;  4YMM A;  2M2W A;  1XO1 A;  3NRW A;  3TKA A;  1T4G A;  1WWV A;  2ISP A;  4ECW A;  4F4W A;  8ICL A;  1MC8 A;  1X6J A;  4FZN A;  4ECR A;  1ZQX A;  3MR6 A;  4UAU A;  5HRE A;  4F50 A;  2BPG A;  3B0Y A;  3JPT A;  3PX0 A;  4Q8E A;  2MA1 A;  5GTH U;  3GFK B;  4WQL A;  2ZH6 A;  1TFR A;  4CDG A;  2Q0Z X;  4OAH A;  3TFS A;  2PKE A;  2ZTE A;  5IIL A;  2E5S A;  4JUZ A;  5ALN A;  4MKP A;  4Z6F A;  5ALW A;  1KBU A;  4F93 B;  5AM4 A;  2FLP A;  1BNP A;  1X9M A;  1CEZ A;  3GV8 B;  2D8C A;  3JPO A;  4DOB A;  2A1A A;  4NL9 C;  2E1E A;  1N5X A;  3C2L A;  5KFC A;  2H3Z A;  2K8B B;  2F2A B;  3WK5 A;  4EYI B;  4XJE A;  2EQY A;  1Z1B A;  4F2S A;  3IG5 A;  2C2D A;  2KZ3 A;  4M9H A;  4QZF A;  4J9P A;  2NRT A;  5CWR A;  1ED1 A;  3ETL A;  3QYP A;  3Q8S B;  4NLZ A;  4Y2X A;  1SV4 A;  2UVW A;  2DR8 A;  2W03 A;  1L6N A;  4WBY A;  2DFL A;  4JLX A;  4FHV A;  8ICH A;  4Z6D A;  4E7X A;  9ICI A;  5KFN A;  1S0N A;  2NRW A;  1NJZ A;  1KSP A;  4X4U A;  2ZTD A;  1U48 A;  2IOH A;  1BPZ A;  4F5Q A;  1YT3 A;  3C2K A;  7ICQ A;  4X4V A;  1R8C A;  8ICS A;  2W9M A;  3V6K A;  1IXR A;  5GTI U;  2GO7 A;  1ZQN A;  3V72 A;  5JU5 A;  4QJF B;  4AT7 A;  2I6X A;  5J0U A;  1R89 A;  5KG1 A;  2L5Y A;  4TUQ A;  1Z4N A;  4X4T A;  2LPE A;  2UVR A;  4RWQ A;  1VFG A;  2W9B B;  4O9M A;  4EBJ A;  3TAD C;  4BXO A;  2D6F C;  4PGQ A;  1JIH A;  2PBE A;  4IQU A;  2ZUB A;  3EYZ A;  2O1P A;  2K4H A;  4ECY A;  2W3R A;  1UEV A;  2BCR A;  5HRI A;  1B22 A;  1NK0 A;  2ZHA A;  1JRP A;  2QB1 A;  3KKA C;  5ALP A;  5DBC A;  1TK5 A;  2W8K A;  3KZI U;  2XGP A;  1QSL A;  1ZD5 A;  4DFP A;  3PW7 A;  3B9J A;  5KFO A;  3RH6 A;  4UAR A;  1RXV A;  4EX6 A;  5AHX A;  4JMU A;  2EAO A;  4QZ8 A;  2WB1 F;  4O3S A;  3Q8L A;  2ZTC A;  4CF5 A;  3SQI A;  4C7Z A;  1RXW A;  7ICH A;  3G6V A;  4BX9 C;  4X4N A;  1SZP A;  3KD3 A;  4RQ3 A;  2W55 A;  3QNM A;  1EXN A;  2ZIX A;  8ICG A;  5J0R A;  2JZB A;  2KKP A;  2D3D A;  3EUB 2;  3SD7 A;  3CW2 C;  5J29 A;  3H38 A;  1MIW A;  5DG8 A;  1ZRN A;  2O6K A;  4PL2 A;  9ICT A;  4C8O A;  3V7J A;  2MUT B;  1N60 A;  4QWE A;  3E2E A;  3PSP A;  5ALO A;  4J9N A;  3H8M A;  1N48 A;  2ZH4 A;  3ZDA A;  3PO5 A;  4RQ0 A;  4I2F A;  5ALH A;  5HP4 A;  3OSN A;  1F44 A;  1NOM A;  3C66 A;  2E8M A;  4FHW A;  1M6Y A;  1LV5 A;  4R66 A;  1JAJ A;  4RQ7 A;  3AM9 A;  2VAN A;  3JPS A;  4BWJ A;  3KTQ A;  4R65 A;  4LZD A;  4KLU A;  3IN5 A;  8ICP A;  2CXY A;  4GLX A;  1KNY A;  9ICK A;  4UAY A;  3BS7 A;  5KFG A;  1J97 A;  2XCP A;  1VLB A;  3RB3 A;  5AK3 A;  4Y2Q A;  4KLF A;  1RZT A;  3EW9 A;  2EZY A;  4Z6E A;  4KTQ A;  1P7D A;  4K98 A;  5KFV A;  5HRD A;  2DUY A;  5C5J A;  2HMX A;  5KT7 A;  4PZN A;  4EV6 A;  2ZIW A;  3SV3 A;  4R63 A;  7ICU A;  4DFM A;  5CJ7 A;  4OAI Z;  7ICT A;  4FHX A;  2H3I A;  4C7Y A;  4O3M A;  2E8N A;  2AGO A;  1RM6 C;  3LWL A;  3QU7 A;  5G5G A;  4RNO A;  2NRZ A;  3PW5 A;  4J9K A;  7ICV A;  4JV2 A;  4KLH A;  2HVI A;  5CFU A;  4QZI A;  4R8U A;  2LMR A;  3H8S A;  3WK6 A;  4JK1 A;  4M47 A;  4NXZ A;  2JH1 A;  3UMC A;  2HI0 A;  5HHH A;  4M04 A;  2Y1I A;  3FDS A;  4OJL A;  5L9X A;  4Y2P A;  2KJ9 A;  4K97 A;  4DSE A;  7ICE A;  1ZQE A;  3GII A;  1T94 A;  2G0A A;  2MU2 A;  4NL9 A;  2OCE A;  4RT2 A;  4BDP A;  2Y9U A;  5CHG A;  3GV5 B;  1N2X A;  1QSS A;  3CP8 A;  5EWG A;  3ICX A;  4USA A;  4QZ9 A;  3WKB A;  4UQG A;  4ACO A;  1KFS A;  4F2R A;  3AQL A;  9ICE A;  3O0F A;  3HIY A;  3E0F A;  3ISD A;  5J2E A;  1OW5 A;  2IUB A;  1KFD A;  3ETR A;  4F92 B;  2I5H A;  4ED6 A;  4TQR A;  2OH2 A;  2F1I A;  5KFM A;  1Z00 B;  1PX5 A;  5D4B A;  1Z4O A;  1RDF A;  3HJ1 A;  8ICR A;  2KMD A;  1R8B A;  5IIN A;  4YD1 A;  1ZQI A;  3UM9 A;  1URJ A;  4ED0 A;  5JUM A;  3F53 A;  3RRG A;  2VJ4 A;  3HKZ C;  2KTQ A;  1A6S A;  4F72 A;  2HW3 A;  4RT3 A;  4EX7 A;  4FE3 A;  4RQN A;  2FCL A;  4C0Z A;  5HC9 A;  3ORY A;  4YCX A;  2W9A A;  2AHO B;  3QUC A;  4YR0 A;  3HP6 A;  9ICM A;  2GOL A;  2MSN A;  2F8L A;  2WAQ F;  4Y2U A;  5AKI A;  5ALD A;  5EE1 A;  3TAD A;  5CEH A;  1K1S A;  2K89 A;  2GAF D;  2ZH7 A;  4BGD A;  4KLM A;  4DCC A;  4KLD A;  4Q43 A;  2ASJ A;  1XU4 A;  4ECX A;  3L4P A;  1HJP A;  4O3P A;  4GXI A;  4QZE A;  1BPX A;  4YG2 A;  3K4G A;  1MQ3 A;  2ZH2 A;  4OCZ A;  2UVU A;  3M6K A;  3OVS A;  2DPJ A;  5L1K A;  3C29 A;  2XID A;  1NI3 A;  3MGH A;  1S8O A;  4C80 A;  3NYB A;  4WC2 A;  3RBD A;  3KHH A;  4LEY A;  1NK6 A;  3RH5 A;  4K96 A;  1N61 A;  2GH1 A;  4JB3 A;  4QWC A;  1ZJN A;  3NUQ A;  4NV0 A; 
#chains in the Genus database with same CATH homology
 2Y1J A;  5KFU A;  4Q45 A;  3OJU A;  1ZQD A;  4JWN A;  9ICW A;  9ICR A;  4ATB A;  3WFS C;  4NLK A;  1C7Y A;  3WFR E;  5KG7 A;  4IR1 A;  3T3F A;  1F5A A;  1Z3E B;  5KFS A;  3SZ2 A;  1X9W A;  5DB7 A;  1T7P A;  4EYH B;  3C5F A;  4I2E A;  2HHS A;  3MDA A;  4AT9 B;  1HUZ A;  4RWN A;  1ZQP A;  4K4I A;  1ZQK A;  7ICF A;  2ZH8 A;  3TAR A;  2RFF A;  4DEZ A;  2DPI A;  4XUS A;  1KDH A;  3ISB A;  4QWA A;  7ICN A;  3GIL A;  4JV1 A;  5KT5 A;  2V9W A;  4I2D A;  5DKW A;  3GIK A;  5HRH A;  3AQN A;  4RU9 A;  3PMN A;  2P66 A;  5HNK A;  4FBU A;  1ZQO A;  3OSP A;  3B0X A;  4FHY A;  5DEC A;  1UA0 A;  2DVI A;  2AGP A;  5HRF A;  5KFR A;  4TUR A;  3M8R A;  1NK5 A;  4QZC A;  2BKE A;  1S77 D;  2HHP A;  3PNC A;  1ZQF A;  2XGQ A;  2DRA A;  4YMM A;  2M2W A;  1JQR A;  3TQ1 A;  1XO1 A;  4ECS A;  4YR3 A;  4B9V A;  5DB9 A;  4B9L A;  3GQC A;  4B9S A;  8ICU A;  4PGX A;  7ICS A;  3LWM A;  1T4G A;  3OUY B;  4KLS A;  2ISP A;  4QW9 A;  4ECW A;  4F4W A;  2UVV A;  1MC8 A;  3H7I A;  8ICL A;  2IHM A;  3RJH A;  4ECR A;  1XSL A;  4EP7 A;  1ZQX A;  1U47 A;  3MR6 A;  4J9M A;  4O5C A;  5KT6 A;  3MR5 A;  4TUP A;  4KLO A;  4ZH4 A;  1ZET A;  2HHT A;  9ICL A;  5HRE A;  5DLG A;  4PHA A;  1ZQS A;  4QZA A;  3OVB A;  4F50 A;  2PFN A;  4FBT A;  2BPG A;  4O3O A;  3Q8P B;  4M6W A;  3B0Y A;  5J0T A;  3JPT A;  1BGX T;  3PX4 A;  3PX0 A;  1MQ2 A;  4Q8E A;  2KFZ A;  3H39 A;  1TV9 A;  1ZQQ A;  4P4M A;  2RDJ A;  2HHV A;  1X9S A;  4MEX A;  4ED8 A;  3GFK B;  4IQT A;  4PGY A;  3T5J A;  2AJQ A;  2ZH6 A;  2FPL A;  5KFY A;  3RJE A;  4QW8 A;  5EWF A;  2BCU A;  1TFR A;  1KFT A;  4NKU A;  2HHX A;  2Q0Z X;  1JN3 A;  1TAQ A;  3TFS A;  1UEU A;  3M8S A;  9ICP A;  4UB2 A;  4ECZ A;  3RR8 A;  1N56 A;  2ZTE A;  5IIL A;  1KLN A;  4JUZ A;  4ELU A;  3LDA A;  4ELV A;  1T8E A;  1LB2 B;  4Z6F A;  3BJY A;  5BPC A;  1XWL A;  1ZQJ A;  3BDP A;  5KG4 A;  5J0P A;  5BOL A;  1XSP A;  2C2E A;  2J6T A;  4QZG A;  4F4K A;  1MSW D;  5DQI A;  3TAN A;  4F93 B;  3PW0 A;  2ALZ A;  1SKW A;  4I27 A;  3H4B A;  4NKT A;  2ZH9 A;  2FLP A;  7ICM A;  1BNP A;  4UD4 A;  4X4R A;  1X9M A;  1CEZ A;  3GV8 B;  3RB0 A;  3JPO A;  4DOB A;  4RWP A;  5KG5 A;  5L1I A;  4KLT A;  5KT3 A;  1ZQT A;  2F1H A;  2FLL A;  3C2L A;  4PPX A;  1D8L A;  5KFC A;  1ZQW A;  4RQ4 A;  3PR4 A;  4EYI B;  1WCL A;  4DOA A;  1T3N A;  7ICR A;  2R8I A;  2C2R A;  1SKS A;  4M5D A;  1S0O A;  1FA0 A;  2PFO A;  1NKC A;  1UET A;  4F2S A;  4J9R A;  3ZDC A;  4KLG A;  2C2D A;  2W9C A;  3SV4 A;  3HT3 A;  2J6U A;  2KZ3 A;  4M9H A;  4QZF A;  1KEJ A;  4J9P A;  4DL6 A;  2NRT A;  3PW2 A;  1D8Y A;  5CWR A;  2BE3 A;  5KFW A;  3ETL A;  3Q8S B;  4NLZ A;  3MGI A;  4KLQ A;  4RQ6 A;  8ICN A;  1VJ7 A;  2UVW A;  1R8A A;  1QTM A;  2DR8 A;  4I2B A;  2PI4 A;  2IBK A;  2XY7 A;  2DFL A;  1A77 A;  8ICI A;  5CR0 A;  4Q44 A;  4QWD A;  4FHV A;  3ZD9 A;  2MAX A;  3TAQ A;  8ICH A;  2R8G A;  4Z6D A;  1NK9 A;  4E7X A;  1PZN A;  2BCQ A;  2ZUC A;  4DSI A;  2JEG A;  9ICI A;  5KFN A;  1S0N A;  2NRW A;  1NJZ A;  4DSK A;  3EZ5 A;  2ZJ5 A;  1KSP A;  4R64 A;  4X4U A;  2ZTD A;  1U48 A;  3IHQ B;  4F5N A;  3RRH A;  3GIJ A;  1BPZ A;  4XQ7 A;  2A1J B;  4UB5 A;  9ICN A;  2B21 A;  2RDI A;  1WOT A;  4F5Q A;  4HYK A;  1ZQL A;  5J2J A;  4RQ1 A;  4IR9 A;  4IG8 A;  4RQ2 A;  2DRB A;  3C2K A;  3PY8 A;  3HJ4 A;  7ICQ A;  3EPG A;  3UXO A;  5KFP A;  4X4V A;  1Z00 A;  4DFJ A;  8ICO A;  1R8C A;  4EZ9 A;  1ZQZ A;  4KLJ A;  8ICS A;  1JXL A;  2W9M A;  4QZB A;  3V6K A;  4RQ8 A;  1IXR A;  2BHN A;  4XA5 A;  1BNO A;  4E80 A;  2I9G A;  4NLG A;  1ZQN A;  4P4O A;  1NKE A;  1RPL A;  3V72 A;  9ICA A;  4O5E A;  4IRK A;  4PHD A;  3C1Z A;  1ZQM A;  4M2Y A;  4AT7 A;  1MIY A;  3OHA A;  5L1L A;  4FHP A;  5J0U A;  1R89 A;  5KG1 A;  4TUQ A;  1JXE A;  4X4T A;  1VFG A;  3OHB A;  1XC9 A;  2UVR A;  4RWQ A;  2W9B B;  4O9M A;  4EBJ A;  2ZH3 A;  3UXP A;  2C28 A;  4BXO A;  4C8M A;  2BQU A;  3ZD8 A;  4PGQ A;  7ICJ A;  5HRB A;  4X4O A;  1KTQ A;  2KZZ A;  4TUS A;  1JIH A;  2PBE A;  4IQU A;  3Q8M A;  4UB4 A;  4YMO A;  4WC6 A;  2HHQ A;  3MFI A;  5KFJ A;  2ZUB A;  4KLI A;  5J0Q A;  3EYZ A;  2XCA A;  4DQQ A;  4F91 B;  1CUK A;  2O1P A;  4M0A A;  2VA2 A;  4ECY A;  4ECU A;  2ZHB A;  2ISO A;  4C8L A;  1DK3 A;  1UEV A;  4QZD A;  3RJF A;  4YR2 A;  3BQ2 A;  4RNM A;  1TK0 A;  1UA1 A;  2BCR A;  1NK0 A;  4Q8F A;  1B22 A;  1BPD A;  4J9O A;  1XS9 D;  1ZQV A;  1X2I A;  5DBC A;  2F1J A;  3C21 A;  4RPY A;  3RJI A;  1TK5 A;  2PFQ A;  1TAU A;  2W8K A;  2XGP A;  2M2U A;  4KN7 A;  1NJX A;  2LYH A;  2PXI A;  1QSL A;  4DFP A;  3PW7 A;  5KFO A;  3RH6 A;  2R8J A;  4G3I A;  4QZH A;  4UAW A;  4ED2 A;  1S0M A;  2HHW A;  8ICJ A;  3MBY A;  1RXV A;  3MDC A;  3JYY A;  9ICU A;  3RJK A;  1ARO P;  4X4Q A;  3HX0 A;  4QZ8 A;  1TK8 A;  4O3S A;  3Q8L A;  1XSN A;  1ZQY A;  8ICB A;  1TFW A;  2ZTC A;  1RYR A;  4X0B A;  1RXW A;  3M9O B;  4MFF A;  4I28 A;  3PX6 A;  1SL0 A;  3G6V A;  2JEJ A;  7ICH A;  4X4N A;  2IHN A;  1SZP A;  4M9N A;  4KLE A;  4RQ3 A;  1U45 A;  3BQT A;  5KFK A;  4TQS A;  3EPI A;  4DFK A;  3RR7 A;  8ICM A;  9ICF A;  3Q8K A;  4GC6 A;  9ICV A;  5HRG A;  4WC1 A;  1EXN A;  2ASL A;  2A1J A;  5KFQ A;  4DQR A;  8ICG A;  2NRK A;  4AT8 A;  5J0R A;  4GC7 A;  3TI0 A;  2JZB A;  4KN4 A;  4DLG A;  1SKR A;  4DF4 A;  3OVA A;  3JZ0 A;  4J9L A;  3LQC B;  1L3V A;  1L5U A;  2DR5 A;  1UT8 A;  5DDY A;  1D9D A;  5KG2 A;  2FLN A;  5J29 A;  1TKD A;  2M2V A;  3H38 A;  1DOQ A;  1MIW A;  3H3A A;  5DG8 A;  4QWB A;  9ICT A;  1BPB A;  3PML A;  3NGD A;  2XC9 A;  3V7J A;  2MUT B;  4C8O A;  4WC7 A;  3PO4 A;  4QWE A;  3E2E A;  1ZQU A;  4R8U B;  5J0S A;  3G6Y A;  2JEI A;  3H37 A;  4ATB B;  3RJG A;  4J9N A;  1N48 A;  2JEF A;  2ZH4 A;  3OJS A;  2Q66 A;  3AU2 A;  3UXN A;  3JPP A;  3H40 A;  3ZDA A;  4AT9 A;  4I29 A;  1U49 A;  3PO5 A;  3L9D A;  4LT6 A;  2M9N A;  3UPQ A;  4RQ0 A;  3G6X A;  4I2F A;  1UT5 A;  1K1Q A;  5HP4 A;  3OSN A;  4KIT B;  1NOM A;  3SYZ A;  3C66 A;  4DO9 A;  4F3O A;  1S76 D;  2XY6 A;  4FHW A;  4X4P A;  4ECQ A;  2ZHA A;  4UAZ A;  5DLF A;  3PVX A;  3OV7 A;  1NK7 A;  1LV5 A;  1Y88 A;  5KTQ A;  4UB3 A;  4DQS A;  4R66 A;  1NK4 A;  1QLN A;  1JAJ A;  4RQ7 A;  1BPY A;  5EWE A;  2VAN A;  5III A;  3WFQ E;  7ICI A;  3JPS A;  1Q79 A;  3PV8 A;  4BWJ A;  5D46 A;  3KTQ A;  2KFN A;  2AU0 A;  2ZH1 A;  4R65 A;  2XY5 A;  5J2C A;  4LZD A;  3QZ7 A;  2V4R A;  1IM4 A;  4O0I A;  4RQ5 A;  4KLU A;  8ICP A;  3RBE A;  4X4S A;  4GLX A;  4DOC A;  2AQ4 A;  2P6U A;  1U4B A;  4K4G A;  1OU5 A;  4XRH A;  3OUY A;  5EOZ A;  4BWM A;  3C1Y A;  9ICK A;  1KNY A;  4UAY A;  2BR0 A;  4DQI A;  1NO5 A;  2XCP A;  5KFG A;  3RB3 A;  4PHP A;  4EBC A;  4MEY A;  7ICO A;  5IIJ A;  1S0V A;  4KLF A;  8ICV A;  5HR9 A;  3H8J A;  1RZT A;  5HRK A;  3EW9 A;  8ICE A;  4I2I A;  3JPN A;  5DG7 A;  3KHL A;  4Z6E A;  2DR7 A;  4JV0 A;  5BOM A;  4F5P A;  4KTQ A;  1NJY A;  3MFH A;  5KFV A;  4DSL A;  5C5J A;  1L3T A;  4B9U A;  5HRD A;  2KZM A;  4YQW A;  2BQR A;  5KT7 A;  4M6W B;  4MFA A;  5J2A A;  4DL4 A;  5HHI A;  2V4Q A;  5KFZ A;  5TZV A;  7ICK A;  4DLE A;  2PFP A;  1S10 A;  4EBD A;  4I2C A;  4F5R A;  3HW8 A;  4YFK A;  3SV3 A;  4YMN A;  2FPK A;  4Z6C A;  4RUC A;  4R63 A;  4M9G A;  1DK2 A;  1NJW A;  3V7K A;  1NK8 A;  5DGB A;  4I2A A;  7ICU A;  4O5K A;  4RNN A;  4DFM A;  2O5A A;  5CJ7 A;  4YXM A;  3V6J A;  7ICT A;  5KFI A;  9ICH A;  4FHX A;  1NZP A;  3TFR A;  2BPC A;  4RPZ A;  9ICC A;  2AGO A;  4ED1 A;  4ED3 A;  9ICO A;  3LWL A;  5KFB A;  1ZQG A;  5KFT A;  5KFL A;  4I2G A;  5DGA A;  3HPO A;  2HHU A;  1MIV A;  4RNO A;  5J0O A;  2NRZ A;  4O3N A;  5KT4 A;  1A76 A;  4DS5 A;  3HWT A;  4J9K A;  3PW5 A;  2BQ3 A;  2GWS A;  5DBA A;  5IIM A;  1ZQH A;  4JV2 A;  4EZ6 A;  4KLH A;  8ICC A;  2HVI A;  4WBZ A;  3GV7 B;  4QZI A;  3AU6 A;  4R8U A;  4S3N A;  3H8S A;  3V6H A;  1H38 A;  8ICK A;  1Q78 A;  4IQW A;  1DGS A;  3MR3 A;  8ICW A;  5DG9 A;  2P6R A;  3AQM A;  4JK1 A;  3T5H A;  7ICP A;  4M47 A;  3AQK A;  4E8F A;  3JPQ A;  4NXZ A;  4K4H A;  5HHH A;  4M04 A;  8ICQ A;  4KLL A;  1B43 A;  3FDS A;  5L9X A;  2Y1I A;  4YN4 A;  1KRP A;  4F8R A;  4NM1 A;  2KN7 A;  2BCV A;  2J6S A;  4WC5 A;  4DL2 A;  4DSE A;  1ZYQ A;  4DSJ A;  2W9C B;  7ICE A;  5F2V O;  4ECV A;  2C22 A;  4RWO A;  1ZQE A;  3GII A;  4ELT A;  1COO A;  4RT2 A;  4FO6 A;  4DWI A;  7ICV A;  1ZQC A;  3Q8R B;  1ZQR A;  2BGW A;  4UBC A;  2IA6 A;  4BDP A;  9ICG A;  3C2M A;  4WC4 A;  3GV5 B;  5CHG A;  1SL2 A;  5KG0 A;  1QSS A;  4DQP A;  4LZG A;  5F9N A;  3RH4 A;  4EBK A;  3T5K A;  5EWG A;  1S97 A;  3ZDE A;  4YXJ A;  4IQV A;  4QZ9 A;  4UQG A;  1HUO A;  4NM2 A;  3KHG A;  2BCS A;  2ID1 A;  1KFS A;  4RZR A;  1TVA A;  4F2R A;  3AQL A;  9ICE A;  3EWA A;  1YLQ A;  5CB1 A;  1JX4 A;  3ZDB A;  2HVH A;  2DR9 A;  4UB1 A;  3HIY A;  5IIK A;  7ICL A;  5KFH A;  3ISD A;  4X5V A;  5J2E A;  2FMP A;  3WFO A;  2NRX A;  1U9L A;  3QEB Z;  2AGQ A;  2NRV A;  1KFD A;  4FH5 A;  4F92 B;  2FMS A;  4ED6 A;  5HRI A;  4EEY A;  4TQR A;  5DBB A;  2F1I A;  5KFM A;  4M9J A;  3RTV A;  9ICJ A;  2R8K A;  1BPE A;  5KFF A;  3GDX A;  5KT2 A;  5KG3 A;  2VA3 A;  4E0D A;  3WFP A;  1D9F A;  3C23 A;  1Z00 B;  2W8L A;  5D4B A;  4I2J A;  1PX5 A;  5DQG A;  2WTF A;  3HJ1 A;  8ICZ A;  3RAX A;  5J2H A;  8ICR A;  3Q8Q B;  2BDP A;  4DS4 A;  4P2H A;  5IIN A;  1R8B A;  4YD1 A;  2VA8 A;  5J2K A;  1ZQB A;  3RB4 A;  3QE9 Y;  3QZ8 A;  4F5O A;  1ZQI A;  4GXK A;  4I2H A;  3FYH A;  5J2D A;  4RUA A;  2BPF A;  4YD2 A;  4NLN A;  4WBY A;  4AT7 B;  4ED0 A;  9ICB A;  3NTU A;  5HMM A;  3IM1 A;  5CP2 A;  5JUM A;  3JPR A;  2W9B A;  3RRG A;  5J0W A;  4WCW A;  5KFX A;  3UPS A;  4F4Y A;  5DQH A;  4X0A A;  3V7L A;  5DB6 A;  4DF8 A;  4BXO B;  4IRD A;  4NY8 A;  3N97 B;  5HML A;  3C5G A;  2KTQ A;  4FH3 A;  1JMS A;  2HW3 A;  5J2G A;  4RT3 A;  4M9L A;  4FS1 A;  5HC9 A;  4EBE A;  3THV A;  4JWM A;  4F4Z A;  9ICS A;  3ORY A;  4YCX A;  4YR0 A;  3HP6 A;  2W9A A;  9ICM A;  3MR2 A;  8ICA A;  3SI8 A;  2PI5 A;  4CCH A;  5F9L A;  2R8H A;  2OWO A;  3RJJ A;  2XO7 A;  5KFA A;  4YVZ A;  8ICX A;  4KMU A;  3RAQ A;  1K1S A;  5J2B A;  8ICT A;  4B9M A;  4RPX A;  3UQ2 A;  3GIM A;  2ZH7 A;  5DDM A;  3M9M B;  2FPM A;  4BGD A;  2H5X A;  4KLM A;  1L3U A;  1WCN A;  5J2I A;  3UQ0 A;  4C8N A;  4MFC A;  2ZUD A;  2ATL A;  5KFD A;  4J9Q A;  4Q43 A;  4ECT A;  1QSY A;  4YP3 A;  2ASJ A;  1XU4 A;  2ASD A;  4KLD A;  8ICF A;  5L1J A;  3BQ0 A;  4ECX A;  3MAB A;  3K75 D;  1HJP A;  4DL5 A;  2FMQ A;  1V9P A;  5IIO A;  5J0Y A;  3PR5 B;  2M2T A;  5HRL A;  4O3P A;  4GXI A;  4WC3 A;  2ZJ8 A;  4QZE A;  3PW4 A;  1BPX A;  7ICG A;  2ZJA A;  4C8K A;  5KFE A;  9ICQ A;  4YG2 A;  3AUO A;  1S9F A;  4PH5 A;  3K4G A;  3LK9 A;  4ED7 A;  3T5L A;  3TAP A;  1SL1 A;  9ICX A;  4XQ8 A;  2AQ0 A;  3N4M B;  3M9N B;  1MQ3 A;  2ZH2 A;  2UVU A;  3OVS A;  4MF8 A;  2DPJ A;  4DL3 A;  2IMW P;  4O3Q A;  5L1K A;  1ZQA A;  1BVS A;  1V4A A;  4DL7 A;  3H4D A;  3RB6 A;  5DB8 A;  1L3S A;  4FS2 A;  3KHR A;  4MF2 A;  4AT8 B;  3QEA Z;  3MGH A;  3ISC A;  2JZB B;  4B9N A;  5J2F A;  5J0X A;  5DED A;  2I1Q A;  3NYB A;  4DSF A;  4UBB A;  4WC2 A;  3RBD A;  4GXJ A;  2KP7 A;  8ICY A;  4F4X A;  3BQ1 A;  3KHH A;  4IRC A;  1RYS A;  4WC0 A;  4B9T A;  5KG6 A;  1NK6 A;  2ZH5 A;  3H8W A;  3RH5 A;  4LVS A;  4P4P A;  2MUT A;  4UD5 A;  3C18 A;  3ZDD A;  4QWC A;  5D49 A;  3OGU A;  1ZJM A;  1ZJN A;  1TFY A;  1NKB A;  4O3R A;  5CA7 A;  4PHE A;  4J9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...