5DB6A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dc
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase/dna
source organism Homo sapiens
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
total genus 102
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db6A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db6A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db6A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db6A03
4QWCA 4F5NA 3FDSA 2VA3A 3PW2A 5HP4A 3E2EA 4ATBA 1NK4A 1L5UA 3M8SA 4YR3A 3THVA 2XY6A 4F2SA 7ICNA 9ICJA 4DSJA 4DOAA 1ZQXA 5HRGA 4AT9A 2ZH7A 5HRFA 4DL3A 3B0YA 3H38A 1ZQEA 3GFKB 2FPLA 3EWAA 4NKTA 1D9FA 3LWMA 9ICTA 4RZRA 3RAQA 3RB4A 1ZQHA 4M04A 3MDAA 3ISDA 7ICEA 3ZD9A 9ICFA 3OUYB 3OVSA 5CA7A 1RXWA 3KHRA 3PO5A 4WBZA 2M9NA 5J2AA 4K4GA 1TVAA 2HHQA 1OU5A 1K1SA 4QWAA 4DFMA 2C28A 3JPPA 3V72A 5HHIA 4C8MA 4PHEA 3C66A 4DL5A 3UPQA 4NM2A 3C2KA 4M6WB 2VA8A 3JPRA 3JYYA 2ZUCA 4QZHA 2BPGA 4QZFA 3M9OB 2OWOA 4LZDA 4IG8A 3IM1A 3PVXA 4RPZA 2BQUA 4ECTA 2DRAA 1V9PA 1T4GA 3OSNA 3WFOA 2IA6A 2HHXA 2F1IA 2MUTB 3RTVA 4KLTA 4QZIA 2R8JA 4RWNA 2XC9A 4DQIA 4WC1A 4EZ9A 5DEDA 5EWGA 2DR8A 1ZQVA 4E80A 4RPXA 4DLGA 3Q8RB 4FHPA 4KLQA 3UPSA 4DF4A 5KG3A 2XGQA 4O3SA 1B43A 3RR8A 2KFNA 2NRKA 1DK2A 3JPNA 1DK3A 3JPOA 4ZH4A 3T3FA 4O3RA 4Q8EA 4FHWA 1U48A 8ICUA 1NKCA 3PX0A 4F5PA 5HRLA 1JIHA 5EOZA 2C22A 3WFSC 4K4HA 5J0PA 4DS4A 2A1JB 4DSKA 4MFCA 5KG6A 4RQ0A 2XCPA 3OHAA 4RNNA 5KFBA 4DSEA 1JX4A 2P66A 3HPOA 5IINA 1RPLA 3Q8KA 1UA1A 4J9QA 5KFAA 3TFSA 4EBJA 3V6HA 4ECSA 3IHQB 4FS2A 4X4TA 4YXJA 4MEXA 4UB5A 3H40A 4IQWA 4QWEA 1NK5A 4M6WA 4Q45A 5DB7A 3H4DA 1UT8A 1LV5A 1HUOA 4GXKA 3RJHA 4MFAA 1ZQJA 5KFZA 2O1PA 9ICHA 4PHAA 4KLUA 3ISCA 1ZQLA 8ICEA 4X0AA 2ISOA 2PFNA 4ELVA 4Q8FA 3GV8B 9ICQA 2Q66A 5J2CA 4B9MA 8ICNA 1B22A 1KTQA 5DQHA 1R89A 2ASLA 3GIKA 4X4VA 4JV0A 2DR9A 3M9MB 2ZUBA 2FLNA 4CCHA 2XY7A 4PHPA 5DG7A 1ZQDA 2UVRA 5DLGA 4I2GA 3ZD8A 2DPIA 4RPYA 5KG7A 1TKDA 5KFTA 1XSLA 4IQTA 4JV1A 4RT3A 4F93B 7ICKA 3TANA 4Q43A 1XSNA 5HHHA 3MR3A 4J9RA 5J0YA 4JK1A 3PNCA 3ZDDA 4ATBB 3JZ0A 2GWSA 4FS1A 8ICZA 4GLXA 1ZQMA 2HHUA 2AJQA 2W9BB 5EWEA 4I2DA 3RJEA 5DB8A 4YMNA 5J0UA 2PI5A 4KLLA 1NZPA 1UEVA 4GXJA 4ED1A 4R65A 4DOBA 5KT5A 3AU2A 3RB3A 5J2DA 4I27A 7ICMA 4WCWA 2H5XA 4Z6EA 5HMLA 2AGQA 3AQNA 5F9LA 5KFFA 1BPBA 4RQ6A 3OJUA 4ECYA 4I29A 2P6RA 5KG0A 2B21A 3BJYA 4C8LA 2DR7A 2ASJA 1JQRA 3K4GA 1JXEA 1KFSA 4LT6A 5CHGA 9ICSA 4MF2A 1SL2A 3LK9A 5D4BA 1S76D 9ICMA 1RXVA 4F5OA 1S0NA 2I1QA 4FBTA 4JWMA 1XU4A 3MR2A 4FH5A 1ZQAA 2XCAA 2W9CB 1PZNA 3V6JA 4DSFA 3AU6A 4TUSA 1NJYA 1WOTA 5J0SA 5J2KA 3C21A 4C8KA 2ZH8A 4O3PA 3RH4A 4J9NA 3ZDAA 8ICIA 5HR9A 2DPJA 4J9KA 4O0IA 4I2HA 5KT6A 4I2JA 5D49A 1JXLA 2IBKA 4MEYA 5KFLA 3Q8PB 4RQ5A 2JZBB 4J9PA 2ZHAA 1BPDA 4MFFA 1U49A 3FYHA 5KFQA 4PGXA 1KFTA 1ZETA 4DEZA 2AGOA 3RBDA 1X2IA 4ED0A 1X9WA 8ICYA 4WC7A 2BQ3A 1COOA 3PMNA 9ICKA 4MF8A 4JV2A 4RUAA 1KFDA 1A77A 4RQ7A 2R8IA 4XUSA 2C2RA 5CR0A 1SL0A 4R64A 2W8LA 4I2CA 4PHDA 1KLNA 5L1LA 4I28A 5KFEA 2LYHA 3C23A 4RUCA 3Q8QB 4ECZA 3UQ0A 2NRVA 3OJSA 5J0TA 4B9TA 4M9NA 1TAUA 4RNOA 2W9CA 8ICFA 1R8BA 3MDCA 4FBUA 3BQ0A 4I2BA 5IIMA 1BPZA 4TQRA 5DGBA 3Q8SB 5L1IA 5IIJA 1S77D 4TUPA 5HRIA 4ED6A 1XSPA 1ZQRA 4FH3A 4B9LA 5CJ7A 3UXPA 1TFYA 4S3NA 8ICAA 3BQTA 4O3QA 5KFCA 5J0XA 4KLMA 5KFOA 4FO6A 3AQLA 3PX4A 4DL6A 1H38A 1BGXT 5DBAA 2FLLA 1BPEA 8ICGA 8ICHA 1FA0A 3ZDCA 9ICRA 4ED3A 4I2FA 8ICJA 4QZCA 3G6YA 4M47A 8ICBA 2WTFA 3TARA 2C2DA 2JEGA 4O3OA 2O5AA 8ICCA 2PFPA 2M2TA 4WC0A 4QZGA 1Q78A 4IQUA 9ICEA 5HRKA 4X0BA 5J2HA 2BCVA 4EZ6A 1ZJNA 1WCLA 3GDXA 4YCXA 1QLNA 1UA0A 2IMWP 2NRXA 3HP6A 3V7KA 3QE9Y 4DLEA 1S10A 2DVIA 1T8EA 4AT7B 4QW8A 3PW0A 5J2EA 8ICWA 2ISPA 1NJWA 1S0OA 2BPCA 1ZQBA 3RR7A 3C18A 4G3IA 2UVVA 1U45A 1NK7A 2RDJA 1QSSA 4R8UA 5KFHA 4DO9A 5C5JA 4M9JA 2FLPA 4NY8A 4JUZA 1MIWA 4QWBA 9ICLA 5KFIA 8ICKA 4EYHB 4NLZA 2JZBA 1CEZA 4EP7A 4XA5A 2XO7A 2BE3A 3OHBA 4QZ9A 4B9NA 4BXOB 4P4OA 3UXNA 3NYBA 2PXIA 5DECA 1TK5A 1NOMA 4X4UA 3RAXA 4RWQA 7ICGA 4TURA 5KT2A 2ZTCA 7ICJA 4DOCA 2A1JA 4KN7A 1D8LA 4YD1A 5KG5A 3G6VA 1ZQPA 4QW9A 2ALZA 4UB1A 4ELTA 4UB4A 3PR5B 4R66A 4P2HA 3SI8A 5KG4A 1ZQQA 4F2RA 4RU9A 3H8JA 2XGPA 1S0MA 1Z00A 4DQPA 4EYIB 4XQ8A 4EBEA 4YR0A 1Z3EB 2HW3A 3GIMA 7ICTA 9ICWA 3AQKA 3HW8A 3PX6A 4PGYA 1MSWD 4NLKA 2ZH5A 3MFIA 3RJGA 2ZUDA 3EZ5A 3AUOA 1V4AA 5KFWA 4X4RA 3WFRE 2ZH4A 2JEIA 5J0RA 2KFZA 1R8CA 3TI0A 2HHWA 3GQCA 3ETLA 4F4XA 2RFFA 1TK0A 4F3OA 1HJPA 3C2MA 2FMSA 8ICSA 1ZQZA 5IIIA 4ED2A 7ICIA 5DB6A 3V7JA 2KZ3A 5DGAA 3PO4A 4M9GA 2UVWA 2PBEA 2AQ4A 2ZH3A 2BQRA 3RJKA 4F5QA 1K1QA 1UT5A 4Z6DA 2Y1JA 1QSYA 2IHNA 8ICOA 3HJ1A 3PW5A 4RWOA 3HX0A 2DFLA 1ZJMA 2JEJA 4YN4A 4KTQA 5KT4A 2FPMA 1XO1A 1ZQYA 5F9NA 3OUYA 2V4QA 2R8KA 5KFMA 1U47A 1XC9A 3T5LA 2MAXA 3TQ1A 1L3SA 2ZH9A 2VA2A 1U4BA 4DQSA 4UBCA 3TAPA 4O3NA 4Z6CA 9ICVA 4DFPA 5KFXA 4DS5A 5IILA 2ZH6A 2ZTEA 5J0OA 4KLEA 5KFNA 4YP3A 3RJIA 4QZDA 8ICPA 4F5RA 1NK9A 3HJ4A 7ICLA 4RQ2A 3OV7A 1VFGA 2BDPA 2F1HA 3PMLA 4ECUA 1TV9A 3EPGA 1NK8A 4ED7A 3ZDBA 2IHMA 4PPXA 5TZVA 3H37A 4EBKA 1TAQA 4E0DA 4M5DA 4KMUA 1C7YA 3T5HA 4KLFA 4KLIA 2KZZA 2Q0ZX 5DG9A 7ICFA 4I2IA 4J9MA 1KSPA 3LWLA 5D46A 4RQ1A 3TAQA 4E7XA 3LDAA 3H39A 3BQ1A 1TK8A 3GIIA 3C5FA 3RB0A 1ZYQA 2BCSA 4IRDA 5J0QA 3JPSA 4DQQA 3BDPA 4F92B 3B0XA 1ZQGA 3L9DA 5DBBA 1ZQKA 3C2LA 5HRDA 1EXNA 4JWNA 7ICQA 1YLQA 4YMOA 3PV8A 4FHXA 4ECXA 4YR2A 1Y88A 1IXRA 3C1ZA 3GV7B 1MIYA 4X4NA 4M9LA 4C8NA 7ICHA 2R8GA 4J9LA 3RJFA 5HREA 1T7PA 4UD4A 2FPKA 2BGWA 4O5EA 1PX5A 4IQVA 3PW7A 1XS9D 3Q8LA 2ATLA 3GIJA 1NK0A 5DQIA 8ICTA 3MBYA 2NRTA 4TQSA 2AQ0A 4YG2A 2HVIA 9ICNA 8ICXA 2BR0A 4QZ8A 4R63A 4B9VA 1HUZA 4UB2A 3MR6A 3SV3A 5L1JA 1KRPA 2J6UA 2PI4A 4IR9A 4Z6FA 5HMMA 5IIOA 5KT7A 5J2GA 3JPQA 2BKEA 1SKSA 4IRKA 9ICBA 4J9SA 1L3UA 5DDMA 3HWTA 5KTQA 2W9AA 3OSPA 4FHYA 1SKRA 2VANA 4KITB 1ZQIA 4EBCA 4RNMA 1Z00B 3C1YA 1D9DA 1KNYA 1Q79A 2V4RA 9ICOA 5KFVA 4RQ4A 4WC5A 5JUMA 1IM4A 1BPXA 1F5AA 2F1JA 3H4BA 2P6UA 5KFJA 4P4PA 5DBCA 1S0VA 3K75D 1U9LA 2HHTA 4WBYA 2DRBA 2AGPA 1DOQA 2ZJ8A 1X9MA 1ZQNA 2ZHBA 3MFHA 3RJJA 4X4OA 2ZH1A 3PW4A 5HNKA 3KHLA 3UQ2A 3TFRA 3RH5A 1SL1A 3MGHA 2KZMA 7ICUA 4XRHA 2BCRA 4UB3A 4WC6A 3ORYA 4M2YA 3RRHA 4F91B 2DR5A 3T5JA 4K4IA 2M2VA 2NRZA 1TFRA 1S97A 2BCQA 2JEFA 2HHVA 1QTMA 4DL2A 4KLJA 4WC2A 5KFSA 2I9GA 5KG1A 1JN3A 4YQWA 8ICQA 3LQCB 5J2IA 4AT8B 4UQGA 2R8HA 3M9NB 1ZQTA 5CWRA 4NLNA 4F4YA 8ICVA 1RYSA 9ICAA 4R8UB 3OGUA 3Q8MA 1ZQFA 1NO5A 5HC9A 4O5KA 1DGSA 3V7LA 1RYRA 5KFKA 9ICGA 4B9UA 5BOLA 4QWDA 3QEAZ 5J2JA 2ZH2A 4YD2A 3RB6A 2ZJ5A 4ECVA 1KDHA 4FHVA 2RDIA 5EWFA 4RT2A 4Q44A 5DKWA 1CUKA 5DB9A 4LZGA 1A76A 1TFWA 5KFPA 1R8AA 4GXIA 4ELUA 1NJXA 3MABA 4DSLA 2HHPA 4X4PA 1L3TA 3RH6A 3SYZA 4PH5A 1ZQWA 4M9HA 1SZPA 4O5CA 3EPIA 3WFPA 3C5GA 5J29A 4KN4A 2ID1A 4AT8A 3JPTA 5CB1A 3OVBA 3RBEA 2KN7A 4QZBA 1L3VA 2V9WA 7ICRA 2C2EA 1MIVA 3KHHA 1MQ3A 4M0AA 3H7IA 2KP7A 4DWIA 3PR4A 2W8KA 1D8YA 2XY5A 4RQ8A 1WCNA 3G6XA 1QSLA 4NXZA 5L9XA 4DL7A 1UETA 4DL4A 3HIYA 1X9SA 1UEUA 1NKBA 3OVAA 5KFYA 3MGIA 4KLSA 7ICPA 5HRHA 4NKUA 4YFKA 3H8SA 4BGDA 2HVHA 2M2WA 8ICRA 1S9FA 1BNPA 4B9SA 9ICUA 3EW9A 1N48A 2ZJAA 5BPCA 4ECQA 3QZ7A 4J9OA 4X4QA 3BQ2A 2MUTA 4F4WA 2BHNA 4F4ZA 4F4KA 3NGDA 2NRWA 4BDPA 3AQMA 3WFQE 4NLGA 4RQ3A 1ZQSA 3PY8A 9ICIA 4QZEA 2M2UA 3SZ2A 4GC7A 2BPFA 4UAWA 4DFJA 4KLHA 5HRBA 3NTUA 4WC4A 3M8RA 4GC6A 7ICSA 1RZTA 4I2AA 5CP2A 5DG8A 5IIKA 2W9BA 1KEJA 5KFRA 1NK6A 4IR1A 4KLGA 4ED8A 4KLOA 4X4SA 4TUQA 2PFOA 4BXOA 4DSIA 4HYKA 5DLFA 4YMMA 5KFGA 5KFUA 3T5KA 4EBDA 3ISBA 4KLDA 1AROP 4DFKA 3H3AA 3SV4A 3RRGA 5KG2A 1ZQOA 2PFQA 9ICPA 4ECWA 3V6KA 4AT7A 4P4MA 2FMQA 4BWJA 1SKWA 1NJZA 2AU0A 1MQ2A 4IRCA 4I2EA 4E8FA 8ICMA 5KT3A 4QZAA 3EYZA 1ZQUA 1LB2B 7ICOA 5KFDA 3QEBZ 4EEYA 3GILA 7ICVA 4LVSA 3ZDEA 4O9MA 3MR5A 3GV5B 1BPYA 4F8RA 5F2VO 5J0WA 5L1KA 4WC3A 3HT3A 2ZTDA 3QZ8A 3KTQA 9ICCA 3KHGA 1JMSA 4UBBA 4BWMA 2Y1IA 1N56A 1JAJA 4YVZA 1T3NA 4YXMA 2J6SA 4AT9B 4C8OA 1ZQCA 2W9MA 3N97B 2J6TA 4DQRA 4XQ7A 4F50A 1MC8A 5J2FA 4UAYA 4RWPA 5BOMA 3N4MB 1BVSA 4X5VA 1NKEA 2HHSA 8ICLA 5DQGA 5J2BA 9ICXA 2ASDA 2KTQA 4UD5A 2UVUA 5DDYA 3UXOA 2BCUA 4UAZA 2FMPA 1BNOA 4NM1A 4ECRA 3H8WA 4DF8A 4PGQA 1XWLA 1VJ7A
chains in the Genus database with same CATH superfamily
1RQLA 5CFTA 3LVVA 5HP4A 2B4VA 4ATBA 3AL0B 3SENA 4YR3A 4DSJA 4OJPA 5HRFA 2EAPA 4NKTA 3R9KA 9ICTA 1ZQHA 2JRZA 3ISDA 3OVSA 5CA7A 3KHRA 2M9NA 3M7DA 1B0XA 4C8MA 5AI0A 4OJ5A 4NM2A 2EZXA 4QZFA 4IG8A 1ZD2P 3PVXA 1L7PA 4KMOB 5AKKA 3OSNA 3WFOA 3RTVA 2R8JA 5AM3A 5EWGA 4E80A 3WU2U 4EEDA 4KLQA 3B9JA 5KG3A 1RYUA 4O3RA 8ICUA 5HRLA 3AM9A 1JIHA 3WFSC 4DS4A 4O3MA 2KJ8A 1JX4A 2P66A 3Q8KA 4EBJA 3TFSA 5KFAA 1N5XA 4ECSA 4X4TA 5ALPA 3H40A 5EE0A 9ICRA 3QU7A 4Q45A 1HUOA 1UT8A 2ZIUA 9ICHA 4PHAA 1LVHA 3LYSA 4X0AA 2ISOA 2Q66A 5AI5A 4CF3A 4B9MA 1R89A 3SQIA 1NNLA 2DR9A 3M9MB 4PHPA 2DPIA 3K7DA 7ICKA 3TANA 4CDGA 4Y2QA 5JTGA 2KE7A 3PNCA 4FZMA 2AJQA 2W9BB 1N63A 4C7YA 4LJXA 5KT5A 2H5XA 4Z6EA 5CRXA 3AQNA 5F9LA 1BPBA 4Y2YA 3OJUA 2B21A 4C8LA 2ASJA 1JQRA 1TE2A 3QU2A 1S76D 5D4BA 3ICXA 1XU4A 1N2XA 1ZQAA 3AU6A 1PZNA 1WOTA 3C21A 2ZH8A 4O3PA 4J9NA 8ICIA 5HR9A 4Y2TA 1V38A 4J9PA 1BPDA 2GOLA 3EUB2 4MFFA 3VC8A 4PGXA 5KFQA 2F44A 3RBDA 5GTHU 4JV2A 3E0FA 1KFDA 2WF5A 2XVTA 2W8LA 4PHDA 2MA1A 2LYHA 4ECZA 2NRVA 3OJSA 3BQ7A 8ICFA 2NO5A 3NRWA 3QU9A 5IIMA 4TQRA 5DGBA 4BJQA 5IIJA 1S77D 2OH2A 3EF2A 4AYBC 4ED6A 5AM1A 1TFYA 3AQLA 5EE1A 1COKA 1ZRNA 2QARA 5DBAA 2KG5A 1WWVA 2D8CA 1NZBA 5KAFU 3ZDCA 1OW5A 4CNQA 8ICJA 4LEYA 3PHZA 2B51A 2FDRA 2YX8A 3G6YA 8ICBA 2XIDA 4WC0A 8ICCA 2W04A 2KJ5A 4NV0A 4EV6A 2W54A 4YCXA 2ZG6A 4KX5A 2NRXA 3V7KA 3QE9Y 3I28A 3I1YA 4DLEA 2DVIA 2EAOA 4QW8A 3PW0A 2ISPA 1ZQBA 1QSSA 3K1ZA 4R8UA 5C5JA 2FLPA 4QWBA 9ICLA 2MRLA 2HOFA 1CEZA 2KK0A 5J8YA 4B9NA 4QZ9A 4P4OA 1A6SA 4PZOA 3CYMA 1TK5A 3F5EA 4RWQA 5KT2A 1SV0A 7ICJA 1UPHA 4K9BA 1D8LA 4YD1A 2R18A 4PL1A 4R66A 4NWIA 5J8YC 3SEIA 4XQ8A 3GIMA 9ICWA 3HW8A 4OO1J 4PGYA 4NLKA 1V4AA 4X4RA 2ZH4A 3ETRA 1N62A 1ZOLA 3L4PA 3GQCA 1TK0A 4F3OA 5IIIA 4LEZA 2JR5A 1JI7A 2ZH3A 2H3ZA 8ICOA 3HJ1A 1GO3F 3HX0A 1ZJMA 4YN4A 1Q46A 2V4QA 4MHVA 1L3SA 1HIWA 1U4BA 4DQSA 3TAPA 4UW9A 4DFPA 5KFXA 5G5HA 3PZPA 4DFDA 5KFNA 2E5SA 1NK9A 3L5KA 1VFGA 3PMLA 4ECUA 4PPXA 5TZVA 4CF4A 4KMUA 2KZZA 2QARB 4KLIA 2Q0ZX 2KV2A 5TISU 4LEWA 2W03A 2F2AB 2NO4A 3H39A 3BQ1A 3C5FA 4DQQA 1EXNA 4JWNA 1YLQA 4UAVA 3PV8A 2KIVA 3F2CA 1LKYA 3GV7B 2W3SA 4EELA 4J9LA 1T7PA 2FPKA 1PX5A 5D62A 2EQYA 1UQVA 3Q8LA 3GIJA 5DQIA 8ICTA 2HVIA 4TQSA 9ICNA 2AQ0A 3QNMA 4R63A 1HUZA 5L1JA 4IR9A 1SXEA 4Z6FA 5AIBA 3HKZF 1SKSA 2ZIWB 3OSPA 4EBCA 4RNMA 1Q79A 3C1YA 4RQ4A 1IM4A 1BPXA 4Y2RA 3H4BA 3NVZA 5KFJA 1Q8KA 5DBCA 1U9LA 1SWVA 1X9MA 2KEYA 3MFHA 2Y9UA 4X4OA 5HNKA 3KHLA 1SL1A 3A0BU 5ALVA 2OCEA 3NASA 4WC6A 4M2YA 2WAQF 2DR5A 4P0QA 4K4IA 2NRZA 2JEFA 4WC2A 5KFSA 2I9GA 4YQWA 5J2IA 3M9NB 1ZQTA 8ICVA 1RYSA 2IOHA 3SAHA 9ICAA 4O5KA 1RYRA 2E8OA 1ZD3A 5BOLA 4CF5A 2XICA 2ZJ5A 3RB6A 2YB1A 4FHVA 2RDIA 2HMXA 2CRXA 1A76A 3KZIU 5KFPA 2DQNB 4ELUA 2CPRA 2EZYA 2YMMA 1Z19A 1L3TA 4OJ6A 1S8OA 4PH5A 3EPIA 4KN4A 3JPTA 1L3VA 2V9WA 1X6JA 2W8KA 3G6XA 5L9XA 4DL4A 3OVAA 4IS7A 7ICPA 2RLTA 3RF9A 4KM5A 2M2WA 1JUDA 2ZJAA 4X4QA 3WFQE 4NLGA 4RQ3A 1ZQSA 5G5GA 3BS5B 2M2UA 2FCLA 5HRBA 2G07A 4WC4A 2M0NA 7ICSA 1RZTA 2KMDA 5DG8A 2O6KA 5IIKA 2W9BA 2G5IB 4ED8A 2Y0SF 5DLFA 2KIWA 5ALSA 4EBDA 1SWWA 1AROP 3HKZC 2K4HA 1ZQOA 2PFQA 3ER9B 2WFAA 2KICA 4BWJA 1NJZA 4IRCA 3EYZA 1L8OA 5JU5A 1LB2B 4EEYA 3ZDEA 3MR5A 4F8RA 1BPYA 2LM1A 5L1KA 4WC3A 3HT3A 3KTQA 3QZ8A 3T79A 1N56A 4YVZA 2J6SA 2K8CB 4C8OA 1ZQCA 2W9MA 2DBYA 2LYAA 2W7OA 4UAYA 2HHSA 9ICXA 4UD5A 2BCUA 4NM1A 3QUBA 1XWLA 4QWCA 2VA3A 5AKGA 9ICJA 4C7ZA 2EH9A 3TKAA 3F2DA 3H38A 1ZQEA 1D9FA 4RZRA 3RB4A 4FZNA 3MDAA 1RXWA 4WBZA 5J2AA 1B4FA 1K1SA 4QWAA 2C28A 3V72A 4NXWA 5T14A 2F3NA 4PHEA 1WG8A 5HR7A 4M6WB 3JPRA 3JYYA 2OWOA 1KBUA 4ECTA 2DRAA 1V9PA 2IA6A 4J03A 3WK5A 2XC9A 4DQIA 4WC1A 5DEDA 1FFVA 3Q8RB 2HN1A 4DF4A 4O3SA 3JPNA 4JB3A 1ZQ1C 1DK3A 4FHWA 4ICAA 4F5PA 5EOZA 4EX6A 3WK7A 1X40A 5KG6A 2XCPA 4BUGA 4RNNA 3JCFA 4C4SA 5IINA 1UA1A 4J9QA 2HSZA 3V6HA 3IHQB 4FS2A 4YXJA 4MEXA 4UB5A 1NK5A 4M6WA 3RJHA 5DB7A 1F0MA 4GXKA 4MFAA 1ZQJA 2O1PA 8ICEA 4ELVA 4Q8FA 9ICQA 1QQ6A 2ASLA 4X4VA 4JV0A 4PL2A 3UMBA 4U6PA 4I2GA 3ZD8A 4RPYA 5KG7A 1XSLA 2A1AA 4IQTA 1XSNA 3MR3A 3OPXA 3ZDDA 2PMZC 8ICZA 3JZ0A 4GLXA 4I2DA 5DB8A 4YMNA 2PI5A 4ED1A 4DOBA 1SGGA 4I29A 4OAFA 3K4GA 4LT6A 9ICSA 5AI8A 4C80A 2W55A 2WAQC 9ICMA 1RXVA 4EGWA 4F5OA 1S0NA 2I1QA 4FBTA 1XO0A 2WF9A 3NS1A 2KSOA 2K60A 1IIPA 2F76X 3ZDAA 2L5YA 4NJ8A 5KL1B 4O0IA 4I2HA 5KT6A 1X9XA 5D49A 2IBKA 5KFLA 4RQ5A 3PSIA 2OXOA 3FYHA 1U49A 2RP5A 1X9WA 8ICYA 3IG8A 3QYPA 4RUAA 1A77A 3DDHA 1SV0C 5CEHA 4WJ3B 9ICFA 1YZ7A 1KKXA 2E3TA 2E8MA 5J0TA 1TAUA 4RNOA 2HBJA 1R8BA 3BQ0A 3VCBA 1BPZA 3Q8SB 3S6JA 1J97A 1F5SA 1XSPA 4FH3A 5B3QA 5CJ7A 3UXPA 5KFCA 2WB1F 2B56A 1XNSA 3AMZA 8ICGA 2HBKA 2QB0B 1L7OA 2ESEA 3SAGA 2KVCA 4ED3A 5AK3A 4C0ZA 1Q3VA 4M47A 3TARA 4FO1A 9ICEA 4K97A 4EZ6A 1ZJNA 3GDXA 5ALNA 3HP6A 1RM6C 3QUCA 5A0LA 5C0YA 3C18A 4G3IA 1T94A 2RDJA 2JGAA 4M9JA 1N5WA 4JUZA 1X42A 4EP7A 1CRXA 4XA5A 2XO7A 4RQNA 2BE3A 3UXNA 3NYBA 5AM0A 5GTIU 2PXIA 4X4UA 3NUQA 7ICGA 1JRPA 4TURA 4DOCA 2A1JA 2K8AA 3G6VA 3WK4A 5KG4A 1ZQQA 4RU9A 1S5LU 2XGPA 2HBMA 3ERCC 1Z00A 3UMGA 4DQPA 1GPJA 3AQKA 1Z3EB 7ICTA 3MFIA 3AUOA 5KFWA 3PSFA 5ALLA 2KKVA 2JEIA 4OAHA 1R8CA 3TI0A 3ETLA 1OXJA 1HJPA 2FMSA 1ZQZA 7ICIA 2KZ3A 2UVWA 4UB6U 1J2MA 2BQRA 4F5QA 1K1QA 2IHNA 4Z6DA 1QSYA 2KKPA 4RWOA 3ALRA 2DFLA 5ALGA 1XO1A 1ZQYA 5F9NA 2MAXA 2ZH9A 2PMZF 3CNHA 2ZIUB 4DS5A 2WB1C 5ALXA 4KLEA 4WOYA 4QZDA 4LEVA 4F5RA 4RQ2A 1TV9A 1NK8A 4EBKA 3EPGA 4KLFA 7ICFA 2Y9TA 5AKIA 2BDUA 4J9MA 3LWLA 4ZOHC 5D46A 3LDAA 4IL6U 5AKEA 3GIIA 1ZYQA 2YN4A 4UARA 3BDPA 5ALOA 3C2LA 7ICQA 5ALQA 4YMOA 3LVWA 4ECXA 4FHXA 4YR2A 3C1ZA 1IXRA 1VJ5A 5AHXA 2FJ6A 5JRTA 7ICHA 5HREA 1URJA 1FFUA 2NV3A 4IQVA 1XS9D 3AN1A 3MBYA 2NRTA 5AKLA 8ICXA 3HJ4A 2KVSA 2BR0A 5KT7A 9ICBA 4Y2UA 1NO5A 2BKEA 5DDMA 3HWTA 5KTQA 4FHYA 2E1FA 4OJOA 2YY6A 5KFVA 5EE3A 3MC1A 5JUMA 4K96A 2ODGA 4P4PA 3HRDD 3WK6A 2DRBA 1AQ6A 3MGVA 3IG5A 2K4IA 2GA9D 3C29A 7ICUA 2E1EA 4CGZA 3ORYA 3RRHA 2BCQA 1QTMA 4UQGA 3SMVA 5CFUA 2ZIXB 4PJ0U 5CWRA 4NLNA 4F4YA 3OGUA 5HC9A 4O68A 4B9UA 4QWDA 5J2JA 2ZH2A 4CE6A 5AK4A 1KDHA 3KKAC 4Q44A 1CUKA 4LZGA 2A3VA 4Y2XA 1FEZA 1NJXA 1DRGA 4O5CA 3WFPA 4AT8A 3M1YA 7ICRA 4QZBA 1MIVA 2C2EA 4M0AA 2KP7A 2LM4A 4RQ8A 4NXZA 1UEUA 1NKBA 5KFYA 2F8LA 3MGIA 5HRHA 3H8SA 3KKAA 2HVHA 1DXSA 3EW9A 1N48A 3NGDA 3AQMA 4UB8U 4QJFB 4QZEA 1UHUA 4GC7A 4WQLA 2BPFA 4UAWA 3NTUA 2E8NA 4FE3A 3PSTA 4I2AA 1TAMA 5CP2A 1KEJA 3PSPA 5KFRA 1CI4A 4IR1A 4KLGA 4KLOA 1V97A 4HYKA 1PVQA 4MKPA 1SIJA 4OJLA 3RRGA 9ICPA 3CW2C 4AT7A 4P4MA 1M6YA 1SKWA 4B6JA 4I2EA 1ZQUA 7ICOA 3QEBZ 4KB6A 4K98A 5HR6A 3GV5B 9ICCA 4K99A 1JMSA 4BWMA 2GLEA 1JAJA 4AT9B 2F77X 4DQRA 4F50A 4OCZA 3D2SA 2H3FA 5J2FA 3N4MB 4X5VA 4O67A 5DQGA 5J2BA 1D8BA 2ASDA 2KTQA 3UXOA 2FMPA 4ECRA 1L8LA 3FDSA 2EANA 3SD7A 2WF6A 3FM9A 1NK4A 2AH5A 1HEKA 1L5UA 3THVA 5HRGA 4C4RA 2ZH7A 2EAMA 3GFKB 2FPLA 3EWAA 3LWMA 3KFUF 5KL8B 3ZD9A 4K4GA 1TVAA 4DFMA 3JPPA 5HHIA 3C66A 2ES6A 4DL5A 3UPQA 4QZHA 3M9OB 4LZDA 3D2NA 3IM1A 4RPZA 2YB4A 2F1IA 2MUTB 4KLTA 4QZIA 4RWNA 2LYBA 3UPSA 1B43A 3BZCA 3RR8A 2H3QA 2KFNA 4NXUA 3JPOA 4ZH4A 2C22A 4JLXA 2A1JB 1KN5A 2DKXA 4RQ0A 3IN5A 2H3IA 1SV4A 4QWEA 2ZXIA 4NLZA 1LV5A 5KFZA 2MU2A 4KLUA 1ZQLA 2YQEA 3BS7A 5AI4A 5CHEA 1A0PA 5J2CA 1KTQA 3GIKA 2FLNA 2ZUBA 2XY7A 5DG7A 5DLGA 2HI0A 1TKDA 5KFTA 3E58A 4JV1A 4RT3A 4F93B 4Q43A 2RQ5A 5HHHA 4J9RA 4WH5A 1QQ7A 4ATBB 5F3XB 2GWSA 4FS1A 1ZQMA 3RJEA 5J0UA 4O69A 4KLLA 3RB3A 4R65A 4WCWA 2AGQA 5HMLA 2K89A 3BS5A 5KG0A 3BJYA 1KFSA 4MF2A 5AKHA 3LK9A 2VKQA 4JWMA 2IHOA 2JV3A 4FH5A 2XCAA 3V6JA 1NJYA 4DSFA 5J0SA 5J2KA 4C8KA 1KQQA 3KZXA 3RH4A 1SXDA 4JMUA 3HJEA 5AK5A 4MEYA 3Q8PB 3L3FX 4NL9A 1KFTA 1ZETA 2AGOA 1X2IA 4ED0A 3QUTA 4WC7A 5D61A 5H2FU 3NWIA 5CR0A 1SL0A 4R64A 1KLNA 4NXXA 3C23A 4M9NA 3UQ0A 1FO4A 2W9CA 3MDCA 4FBUA 4I2BA 2YMLA 3CRXA 4B9LA 4S3NA 5AKXA 4O3QA 3GZFA 4AP9A 4DL6A 1BGXT 4K8VA 1BPEA 1FA0A 5ALWA 2NYVA 2G0AA 1Z4OA 2WTFA 2C2DA 2M2TA 2PFPA 4QZGA 1Q78A 3WKDA 5HRKA 4X0BA 2BCVA 3UMCA 4JLZA 2I6XA 2IMWP 3NVOA 3AQFA 3OTQA 1S10A 1T8EA 4AT7B 2ZIVB 2KJ9A 1NJWA 1S0OA 3MCRA 3NKUA 2CN1A 1O03A 2JMGA 1VDVA 5KFHA 4DO9A 4NY8A 2FI1A 1MIWA 4EYHB 2G5HB 2JZBA 2XI9A 5ALFA 1NOMA 3RAXA 2JH7A 5ALEA 4PZNA 2ZTCA 4KN7A 1ZQPA 4QW9A 2ALZA 4XJEA 5ALZA 4UB4A 4GFJA 4P2HA 4P0PB 3SI8A 4F2RA 3H8JA 5KNIA 4NLBA 4OAGA 2E8PA 4EBEA 4YR0A 2HW3A 2ZH5A 3PX6A 2ZUDA 2Z7JA 1IV8A 4F4XA 2RFFA 4DCCA 3UM9A 8ICSA 2KNJA 4ED2A 3H0RB 4M9GA 2PBEA 4HAIA 1UT5A 5AI9A 2Y0SC 2JEJA 4KTQA 3OUYA 2FPMA 2R8KA 5KFMA 1U47A 2YMQA 3T5LA 2ZIXA 4O3NA 4Z6CA 3ED5A 5IILA 2LKYA 2ZTEA 5J0OA 3DV9A 2LI6A 3RJIA 8ICPA 1K5OA 7ICLA 4US8A 3ZDBA 1NI3A 4ED7A 2IHMA 2GAFD 3J81j 4M5DA 1C7YA 4UATA 2LPEA 5DG9A 4I2IA 5AK6A 1KSPA 5B66U 2BBHA 4NXVA 2BZFA 2BCSA 4IRDA 1FIQA 5J0QA 5JTIA 2G09A 4F92B 1ZQGA 3L9DA 1JALA 5AI6A 5HRDA 3QX7A 4C8NA 2R8GA 4UD4A 2BGWA 4UASA 2ATLA 1NK0A 3WKCA 4UB2A 1KRPA 2J6UA 1RDFA 5HMMA 5IIOA 3JPQA 2W7PA 2DF4B 1OUQA 4KITB 1Z00B 1KNYA 9ICOA 3N7PD 2P6UA 3ZI4A 4WBYA 1DOQA 1ZQNA 2BBJA 1WUDA 2ZH1A 3TFRA 3UQ2A 3MGHA 2KZMA 4XRHA 2BCRA 4UB3A 1Z1VA 3T5JA 2M2VA 4USAA 1MA7A 4DL2A 5KG1A 8ICQA 5ALKA 3N7SC 1F44A 1RG6A 2WF8A 2JH1A 1DGSA 9ICGA 2VIXA 4YD2A 4ECVA 2QLTA 5EWFA 3H8MA 1TFWA 1ZXIA 3MABA 4NLCA 2HHPA 4X4PA 3RH6A 2IUBA 4M9HA 2EWRA 1SZPA 3C5GA 5J29A 2OYYA 2ID1A 2KOBA 2KHVA 2YTUA 4DWIA 3PR4A 1ZD5A 1SZHA 2XY5A 1D8YA 3OWGA 1WCNA 1UETA 4KLSA 3WK8A 4BGDA 1YZ6A 8ICRA 1S9FA 1BNPA 4B9SA 9ICUA 3KBBA 5BPCA 1KL9A 4J9OA 3BQ2A 2MUTA 4F4ZA 2BHNA 2NRWA 4BDPA 5D63A 2DGZA 2ZIWA 3M8RA 1DGJA 4GC6A 3KD3A 1NK6A 4GIBA 4X4SA 2HOQA 4KX3A 4TUQA 4BXOA 4DSIA 4YMMA 5KFGA 5KFUA 3T5KA 3IP4B 5KG2A 4ECWA 2FMQA 4QZAA 2KD1A 3FC4A 4EEKA 3GU3A 3AEVA 4IC9A 5ALMA 4LVSA 7ICVA 4O9MA 5F2VO 3ONNA 1SB3C 2ZTDA 1QH9A 4UBBA 2Y1IA 1T3NA 2LBOA 2QB0A 1BVSA 1Z4NA 3FAHA 4UAZA 4GXIA 4DF8A 3H8WA 4DSLA 1VJ7A 4F5NA 3PW2A 5ALRA 4EEBA 3E2EA 3TACB 3M8SA 7ICNA 2XY6A 4F2SA 4AT9A 4DOAA 1ZQXA 2JXJA 2W11A 4DL3A 3B0YA 3K1RB 3IDWA 3D2QA 3RAQA 4M04A 7ICEA 5AIAA 3OUYB 2YMPA 2RHFA 3PO5A 2HHQA 1OU5A 4QIWC 5ALYA 5ALUA 4F72A 4Y2VA 2Q4TA 3C2KA 2VA8A 2ZUCA 4OD0A 2BPGA 3AQEA 5FP0A 1YT3A 1LKYB 5B3PA 2BQUA 1T4GA 2PKEA 2HHXA 4EZ9A 1PUZA 1P7DA 1ZQVA 3TADA 4RPXA 4DLGA 2XGQA 2NRKA 2HDOA 1DK2A 2GH1A 4WQKA 3T3FA 2OHFA 4Q8EA 1U48A 1NKCA 3PX0A 4G9BA 2LMRA 3U26A 3IRUA 3WKBA 4K4HA 1N61A 5J0PA 4DSKA 4MFCA 3D6JA 3OHAA 5KFBA 4DSEA 3HPOA 4X4NA 1RPLA 4IQWA 5ALTA 3TADC 4FHPA 3H4DA 2DWQA 1N60A 3KOOA 3ISCA 2QKQA 2PFNA 3GV8B 1B22A 8ICNA 5DQHA 3F53A 3NRZA 2D6FC 4CCHA 2UVRA 1ZQDA 2W43A 5AM2A 1WYGA 5J0YA 2JHDA 4JK1A 2WHEA 4AYBF 2HHUA 5EWEA 2DKZA 1NZPA 1UEVA 4GXJA 7ICMA 4UAUA 3AU2A 4I27A 5J2DA 3N7RC 5KFFA 4RQ6A 4ECYA 1JROA 3CP8A 2P6RA 2DR7A 5ALJA 1JXEA 5CHGA 3CK6A 1SL2A 2A19A 2EZZA 3MR2A 3QXGA 2W9CB 4TUSA 1C20A 3IV6A 5CFSA 2DPJA 4J9KA 4I2JA 1JXLA 2JZBB 2B6GA 2ZHAA 1O08A 2G08A 4US9A 1L6NA 4DEZA 2BQ3A 2HBLA 1COOA 3PMNA 9ICKA 4MF8A 5ALDA 4CRXA 4RQ7A 1MN8A 2R8IA 4XUSA 2C2RA 4I2CA 1S0VA 5L1LA 4I28A 5KFEA 4B9TA 4RUCA 3Q8QB 3M6KA 1KW4A 5L1IA 3QUQA 3WKEA 4TUPA 1VLBA 1ZQRA 8ICAA 3BQTA 5J0XA 4KLMA 2VJ4A 2DL0A 5KFOA 4FO6A 3PX4A 4FFDA 1H38A 3WKAA 2FLLA 8ICHA 2K8BB 4I2FA 5ALIA 4C4TA 1X6IA 4QZCA 1PK1B 2F8KA 2O5AA 2JEGA 4O3OA 1L7NA 1J2NA 3O0FA 4IQUA 5J2HA 3SR6A 1WCLA 1QLNA 1UA0A 2OEHA 3N28A 5J2EA 3M6ZA 8ICWA 3RR7A 2BPCA 4F71A 2UVVA 1U45A 2W3RA 1NK7A 5K4LA 5AM4A 3H0LB 5KFIA 8ICKA 3NVVA 3OHBA 4BXOB 2HCFA 5DECA 1QQ5A 4A8EA 3ER8C 5KG5A 4UB1A 2P35A 4ELTA 2MSNA 3PR5B 1S0MA 1Q3UA 3RFAA 4HX0A 4EYIB 2K4PA 2N1RA 1MSWD 3RJGA 3EZ5A 3WFRE 5J0RA 2KFZA 2HHWA 5AM5A 1ECWA 3C2MA 5DB6A 3V7JA 5DGAA 3PO4A 1WWUA 2AQ4A 3RJKA 2Y1JA 2G06A 3PW5A 1ZD4A 5KT4A 3WK9A 1XC9A 3TQ1A 2EDUA 2VA2A 4UBCA 3QU4A 4Y2JA 9ICVA 3SAFA 2ZH6A 4YP3A 3F2BA 4P0QB 1PVPA 3OV7A 2BDPA 2F1HA 1PK3A 3H37A 1TAQA 4Y2SA 4E0DA 3T5HA 1IG6A 4NL9C 4RQ1A 3TAQA 4E7XA 5KAIU 1TK8A 3RB0A 3JPSA 3B0XA 5DBBA 1ZQKA 1Y88A 1MIYA 4M9LA 3RJFA 3A0HU 3I76A 4O5EA 3PW7A 2FE9A 1PVRA 4U7CA 2AHOB 4ACOA 4YG2A 4QZ8A 4B9VA 3H0MB 3MR6A 3SV3A 2PI4A 2DR8A 2KSOB 5J2GA 4IRKA 4J9SA 1L3UA 2AXTU 2KHQA 2W9AA 1SKRA 2GO7A 2VANA 2OM6A 1ZQIA 1D9DA 2V4RA 4WC5A 2DUYA 4NXTA 4RQMA 1F5AA 2F1JA 2HHTA 3K75D 4QIWF 2AGPA 2ZJ8A 2ZHBA 3RJJA 1PK1A 3PW4A 3RH5A 2IOFA 2RRDA 5ALHA 1QCKA 4F91B 3C28A 4BX9C 3NVYA 1TFRA 2B0CA 1S97A 2HHVA 2I5HA 4KLJA 1JN3A 3LQCB 4AT8B 3F5AA 2R8HA 3QU5A 1RQNA 4R8UB 3Q8MA 1ZQFA 2CXYA 3V7LA 5KFKA 2K4EA 1V85A 4EX7A 3QEAZ 5AKJA 2D3DA 4RT2A 5DKWA 1T3QA 5DB9A 1R8AA 4O6AA 1Z1BA 3SYZA 1ZQWA 1X66A 3DEEA 5CB1A 3OVBA 3RBEA 2KN7A 3KHHA 1MQ3A 5HRIA 3H7IA 2HN2A 1UCVA 2QB1A 1QSLA 4DL7A 3HIYA 1X9SA 2LHTA 2H3VA 4NKUA 1ED1A 4YFKA 1L7MA 2WF7A 2IOFK 4ECQA 3QZ7A 4F4WA 4F4KA 4P0PA 3PY8A 9ICIA 4Y2PA 4I0UA 4QNLA 3SZ2A 3HILA 4DFJA 4KLHA 2VJ5A 5AKYA 5AKZA 2PFOA 4EENA 3NVWA 3ISBA 4KLDA 4DFKA 3H3AA 3SV4A 4N7RA 3V6KA 4FZLA 5L1MA 5AICA 2AU0A 1MQ2A 4E8FA 5E79U 5KT3A 8ICMA 5KFDA 3GILA 2ZIVA 1ZRMA 5J0WA 3KHGA 4OAIZ 4YXMA 3N97B 5EE9A 2J6TA 4XQ7A 4K9AA 1MC8A 4RWPA 3BZKA 5BOMA 1NKEA 8ICLA 5B5EU 2UVUA 5DDYA 1BNOA 2HOIA 2ZXHA 4PGQA
chains in the Genus database with same CATH topology
4QWCA 4F5NA 3FDSA 2VA3A 3PW2A 5HP4A 3E2EA 4ATBA 1NK4A 1L5UA 3M8SA 4YR3A 3THVA 2XY6A 4F2SA 7ICNA 9ICJA 4DSJA 4DOAA 1ZQXA 5HRGA 4AT9A 2ZH7A 5HRFA 4DL3A 3B0YA 3H38A 1ZQEA 3GFKB 2FPLA 3EWAA 4NKTA 1D9FA 3LWMA 9ICTA 4RZRA 3RAQA 3RB4A 1ZQHA 4M04A 3MDAA 3ISDA 7ICEA 3ZD9A 9ICFA 3OUYB 3OVSA 5CA7A 1RXWA 3KHRA 3PO5A 4WBZA 2M9NA 5J2AA 4K4GA 1TVAA 2HHQA 1OU5A 1K1SA 4QWAA 4DFMA 2C28A 3JPPA 3V72A 5HHIA 4C8MA 4PHEA 3C66A 4DL5A 3UPQA 4NM2A 3C2KA 4M6WB 2VA8A 3JPRA 3JYYA 2ZUCA 4QZHA 2BPGA 4QZFA 3M9OB 2OWOA 4LZDA 4IG8A 3IM1A 3PVXA 4RPZA 2BQUA 4ECTA 2DRAA 1V9PA 1T4GA 3OSNA 3WFOA 2IA6A 2HHXA 2F1IA 2MUTB 3RTVA 4KLTA 4QZIA 2R8JA 4RWNA 2XC9A 4DQIA 4WC1A 4EZ9A 5DEDA 5EWGA 2DR8A 1ZQVA 4E80A 4RPXA 4DLGA 3Q8RB 4FHPA 4KLQA 3UPSA 4DF4A 5KG3A 2XGQA 4O3SA 1B43A 3RR8A 2KFNA 2NRKA 1DK2A 3JPNA 1DK3A 3JPOA 4ZH4A 3T3FA 4O3RA 4Q8EA 4FHWA 1U48A 8ICUA 1NKCA 3PX0A 4F5PA 5HRLA 1JIHA 5EOZA 2C22A 3WFSC 4K4HA 5J0PA 4DS4A 2A1JB 4DSKA 4MFCA 5KG6A 4RQ0A 2XCPA 3OHAA 4RNNA 5KFBA 4DSEA 1JX4A 2P66A 3HPOA 5IINA 1RPLA 3Q8KA 1UA1A 4J9QA 5KFAA 3TFSA 4EBJA 3V6HA 4ECSA 3IHQB 4FS2A 4X4TA 4YXJA 4MEXA 4UB5A 3H40A 4IQWA 4QWEA 1NK5A 4M6WA 4Q45A 5DB7A 3H4DA 1UT8A 1LV5A 1HUOA 4GXKA 3RJHA 4MFAA 1ZQJA 5KFZA 2O1PA 9ICHA 4PHAA 4KLUA 3ISCA 1ZQLA 8ICEA 4X0AA 2ISOA 2PFNA 4ELVA 4Q8FA 3GV8B 9ICQA 2Q66A 5J2CA 4B9MA 8ICNA 1B22A 1KTQA 5DQHA 1R89A 2ASLA 3GIKA 4X4VA 4JV0A 2DR9A 3M9MB 2ZUBA 2FLNA 4CCHA 2XY7A 4PHPA 5DG7A 1ZQDA 2UVRA 5DLGA 4I2GA 3ZD8A 2DPIA 4RPYA 5KG7A 1TKDA 5KFTA 1XSLA 4IQTA 4JV1A 4RT3A 4F93B 7ICKA 3TANA 4Q43A 1XSNA 5HHHA 3MR3A 4J9RA 5J0YA 4JK1A 3PNCA 3ZDDA 4ATBB 3JZ0A 2GWSA 4FS1A 8ICZA 4GLXA 1ZQMA 2HHUA 2AJQA 2W9BB 5EWEA 4I2DA 3RJEA 5DB8A 4YMNA 5J0UA 2PI5A 4KLLA 1NZPA 1UEVA 4GXJA 4ED1A 4R65A 4DOBA 5KT5A 3AU2A 3RB3A 5J2DA 4I27A 7ICMA 4WCWA 2H5XA 4Z6EA 5HMLA 2AGQA 3AQNA 5F9LA 5KFFA 1BPBA 4RQ6A 3OJUA 4ECYA 4I29A 2P6RA 5KG0A 2B21A 3BJYA 4C8LA 2DR7A 2ASJA 1JQRA 3K4GA 1JXEA 1KFSA 4LT6A 5CHGA 9ICSA 4MF2A 1SL2A 3LK9A 5D4BA 1S76D 9ICMA 1RXVA 4F5OA 1S0NA 2I1QA 4FBTA 4JWMA 1XU4A 3MR2A 4FH5A 1ZQAA 2XCAA 2W9CB 1PZNA 3V6JA 4DSFA 3AU6A 4TUSA 1NJYA 1WOTA 5J0SA 5J2KA 3C21A 4C8KA 2ZH8A 4O3PA 3RH4A 4J9NA 3ZDAA 8ICIA 5HR9A 2DPJA 4J9KA 4O0IA 4I2HA 5KT6A 4I2JA 5D49A 1JXLA 2IBKA 4MEYA 5KFLA 3Q8PB 4RQ5A 2JZBB 4J9PA 2ZHAA 1BPDA 4MFFA 1U49A 3FYHA 5KFQA 4PGXA 1KFTA 1ZETA 4DEZA 2AGOA 3RBDA 1X2IA 4ED0A 1X9WA 8ICYA 4WC7A 2BQ3A 1COOA 3PMNA 9ICKA 4MF8A 4JV2A 4RUAA 1KFDA 1A77A 4RQ7A 2R8IA 4XUSA 2C2RA 5CR0A 1SL0A 4R64A 2W8LA 4I2CA 4PHDA 1KLNA 5L1LA 4I28A 5KFEA 2LYHA 3C23A 4RUCA 3Q8QB 4ECZA 3UQ0A 2NRVA 3OJSA 5J0TA 4B9TA 4M9NA 1TAUA 4RNOA 2W9CA 8ICFA 1R8BA 3MDCA 4FBUA 3BQ0A 4I2BA 5IIMA 1BPZA 4TQRA 5DGBA 3Q8SB 5L1IA 5IIJA 1S77D 4TUPA 5HRIA 4ED6A 1XSPA 1ZQRA 4FH3A 4B9LA 5CJ7A 3UXPA 1TFYA 4S3NA 8ICAA 3BQTA 4O3QA 5KFCA 5J0XA 4KLMA 5KFOA 4FO6A 3AQLA 3PX4A 4DL6A 1H38A 1BGXT 5DBAA 2FLLA 1BPEA 8ICGA 8ICHA 1FA0A 3ZDCA 9ICRA 4ED3A 4I2FA 8ICJA 4QZCA 3G6YA 4M47A 8ICBA 2WTFA 3TARA 2C2DA 2JEGA 4O3OA 2O5AA 8ICCA 2PFPA 2M2TA 4WC0A 4QZGA 1Q78A 4IQUA 9ICEA 5HRKA 4X0BA 5J2HA 2BCVA 4EZ6A 1ZJNA 1WCLA 3GDXA 4YCXA 1QLNA 1UA0A 2IMWP 2NRXA 3HP6A 3V7KA 3QE9Y 4DLEA 1S10A 2DVIA 1T8EA 4AT7B 4QW8A 3PW0A 5J2EA 8ICWA 2ISPA 1NJWA 1S0OA 2BPCA 1ZQBA 3RR7A 3C18A 4G3IA 2UVVA 1U45A 1NK7A 2RDJA 1QSSA 4R8UA 5KFHA 4DO9A 5C5JA 4M9JA 2FLPA 4NY8A 4JUZA 1MIWA 4QWBA 9ICLA 5KFIA 8ICKA 4EYHB 4NLZA 2JZBA 1CEZA 4EP7A 4XA5A 2XO7A 2BE3A 3OHBA 4QZ9A 4B9NA 4BXOB 4P4OA 3UXNA 3NYBA 2PXIA 5DECA 1TK5A 1NOMA 4X4UA 3RAXA 4RWQA 7ICGA 4TURA 5KT2A 2ZTCA 7ICJA 4DOCA 2A1JA 4KN7A 1D8LA 4YD1A 5KG5A 3G6VA 1ZQPA 4QW9A 2ALZA 4UB1A 4ELTA 4UB4A 3PR5B 4R66A 4P2HA 3SI8A 5KG4A 1ZQQA 4F2RA 4RU9A 3H8JA 2XGPA 1S0MA 1Z00A 4DQPA 4EYIB 4XQ8A 4EBEA 4YR0A 1Z3EB 2HW3A 3GIMA 7ICTA 9ICWA 3AQKA 3HW8A 3PX6A 4PGYA 1MSWD 4NLKA 2ZH5A 3MFIA 3RJGA 2ZUDA 3EZ5A 3AUOA 1V4AA 5KFWA 4X4RA 3WFRE 2ZH4A 2JEIA 5J0RA 2KFZA 1R8CA 3TI0A 2HHWA 3GQCA 3ETLA 4F4XA 2RFFA 1TK0A 4F3OA 1HJPA 3C2MA 2FMSA 8ICSA 1ZQZA 5IIIA 4ED2A 7ICIA 5DB6A 3V7JA 2KZ3A 5DGAA 3PO4A 4M9GA 2UVWA 2PBEA 2AQ4A 2ZH3A 2BQRA 3RJKA 4F5QA 1K1QA 1UT5A 4Z6DA 2Y1JA 1QSYA 2IHNA 8ICOA 3HJ1A 3PW5A 4RWOA 3HX0A 2DFLA 1ZJMA 2JEJA 4YN4A 4KTQA 5KT4A 2FPMA 1XO1A 1ZQYA 5F9NA 3OUYA 2V4QA 2R8KA 5KFMA 1U47A 1XC9A 3T5LA 2MAXA 3TQ1A 1L3SA 2ZH9A 2VA2A 1U4BA 4DQSA 4UBCA 3TAPA 4O3NA 4Z6CA 9ICVA 4DFPA 5KFXA 4DS5A 5IILA 2ZH6A 2ZTEA 5J0OA 4KLEA 5KFNA 4YP3A 3RJIA 4QZDA 8ICPA 4F5RA 1NK9A 3HJ4A 7ICLA 4RQ2A 3OV7A 1VFGA 2BDPA 2F1HA 3PMLA 4ECUA 1TV9A 3EPGA 1NK8A 4ED7A 3ZDBA 2IHMA 4PPXA 5TZVA 3H37A 4EBKA 1TAQA 4E0DA 4M5DA 4KMUA 1C7YA 3T5HA 4KLFA 4KLIA 2KZZA 2Q0ZX 5DG9A 7ICFA 4I2IA 4J9MA 1KSPA 3LWLA 5D46A 4RQ1A 3TAQA 4E7XA 3LDAA 3H39A 3BQ1A 1TK8A 3GIIA 3C5FA 3RB0A 1ZYQA 2BCSA 4IRDA 5J0QA 3JPSA 4DQQA 3BDPA 4F92B 3B0XA 1ZQGA 3L9DA 5DBBA 1ZQKA 3C2LA 5HRDA 1EXNA 4JWNA 7ICQA 1YLQA 4YMOA 3PV8A 4FHXA 4ECXA 4YR2A 1Y88A 1IXRA 3C1ZA 3GV7B 1MIYA 4X4NA 4M9LA 4C8NA 7ICHA 2R8GA 4J9LA 3RJFA 5HREA 1T7PA 4UD4A 2FPKA 2BGWA 4O5EA 1PX5A 4IQVA 3PW7A 1XS9D 3Q8LA 2ATLA 3GIJA 1NK0A 5DQIA 8ICTA 3MBYA 2NRTA 4TQSA 2AQ0A 4YG2A 2HVIA 9ICNA 8ICXA 2BR0A 4QZ8A 4R63A 4B9VA 1HUZA 4UB2A 3MR6A 3SV3A 5L1JA 1KRPA 2J6UA 2PI4A 4IR9A 4Z6FA 5HMMA 5IIOA 5KT7A 5J2GA 3JPQA 2BKEA 1SKSA 4IRKA 9ICBA 4J9SA 1L3UA 5DDMA 3HWTA 5KTQA 2W9AA 3OSPA 4FHYA 1SKRA 2VANA 4KITB 1ZQIA 4EBCA 4RNMA 1Z00B 3C1YA 1D9DA 1KNYA 1Q79A 2V4RA 9ICOA 5KFVA 4RQ4A 4WC5A 5JUMA 1IM4A 1BPXA 1F5AA 2F1JA 3H4BA 2P6UA 5KFJA 4P4PA 5DBCA 1S0VA 3K75D 1U9LA 2HHTA 4WBYA 2DRBA 2AGPA 1DOQA 2ZJ8A 1X9MA 1ZQNA 2ZHBA 3MFHA 3RJJA 4X4OA 2ZH1A 3PW4A 5HNKA 3KHLA 3UQ2A 3TFRA 3RH5A 1SL1A 3MGHA 2KZMA 7ICUA 4XRHA 2BCRA 4UB3A 4WC6A 3ORYA 4M2YA 3RRHA 4F91B 2DR5A 3T5JA 4K4IA 2M2VA 2NRZA 1TFRA 1S97A 2BCQA 2JEFA 2HHVA 1QTMA 4DL2A 4KLJA 4WC2A 5KFSA 2I9GA 5KG1A 1JN3A 4YQWA 8ICQA 3LQCB 5J2IA 4AT8B 4UQGA 2R8HA 3M9NB 1ZQTA 5CWRA 4NLNA 4F4YA 8ICVA 1RYSA 9ICAA 4R8UB 3OGUA 3Q8MA 1ZQFA 1NO5A 5HC9A 4O5KA 1DGSA 3V7LA 1RYRA 5KFKA 9ICGA 4B9UA 5BOLA 4QWDA 3QEAZ 5J2JA 2ZH2A 4YD2A 3RB6A 2ZJ5A 4ECVA 1KDHA 4FHVA 2RDIA 5EWFA 4RT2A 4Q44A 5DKWA 1CUKA 5DB9A 4LZGA 1A76A 1TFWA 5KFPA 1R8AA 4GXIA 4ELUA 1NJXA 3MABA 4DSLA 2HHPA 4X4PA 1L3TA 3RH6A 3SYZA 4PH5A 1ZQWA 4M9HA 1SZPA 4O5CA 3EPIA 3WFPA 3C5GA 5J29A 4KN4A 2ID1A 4AT8A 3JPTA 5CB1A 3OVBA 3RBEA 2KN7A 4QZBA 1L3VA 2V9WA 7ICRA 2C2EA 1MIVA 3KHHA 1MQ3A 4M0AA 3H7IA 2KP7A 4DWIA 3PR4A 2W8KA 1D8YA 2XY5A 4RQ8A 1WCNA 3G6XA 1QSLA 4NXZA 5L9XA 4DL7A 1UETA 4DL4A 3HIYA 1X9SA 1UEUA 1NKBA 3OVAA 5KFYA 3MGIA 4KLSA 7ICPA 5HRHA 4NKUA 4YFKA 3H8SA 4BGDA 2HVHA 2M2WA 8ICRA 1S9FA 1BNPA 4B9SA 9ICUA 3EW9A 1N48A 2ZJAA 5BPCA 4ECQA 3QZ7A 4J9OA 4X4QA 3BQ2A 2MUTA 4F4WA 2BHNA 4F4ZA 4F4KA 3NGDA 2NRWA 4BDPA 3AQMA 3WFQE 4NLGA 4RQ3A 1ZQSA 3PY8A 9ICIA 4QZEA 2M2UA 3SZ2A 4GC7A 2BPFA 4UAWA 4DFJA 4KLHA 5HRBA 3NTUA 4WC4A 3M8RA 4GC6A 7ICSA 1RZTA 4I2AA 5CP2A 5DG8A 5IIKA 2W9BA 1KEJA 5KFRA 1NK6A 4IR1A 4KLGA 4ED8A 4KLOA 4X4SA 4TUQA 2PFOA 4BXOA 4DSIA 4HYKA 5DLFA 4YMMA 5KFGA 5KFUA 3T5KA 4EBDA 3ISBA 4KLDA 1AROP 4DFKA 3H3AA 3SV4A 3RRGA 5KG2A 1ZQOA 2PFQA 9ICPA 4ECWA 3V6KA 4AT7A 4P4MA 2FMQA 4BWJA 1SKWA 1NJZA 2AU0A 1MQ2A 4IRCA 4I2EA 4E8FA 8ICMA 5KT3A 4QZAA 3EYZA 1ZQUA 1LB2B 7ICOA 5KFDA 3QEBZ 4EEYA 3GILA 7ICVA 4LVSA 3ZDEA 4O9MA 3MR5A 3GV5B 1BPYA 4F8RA 5F2VO 5J0WA 5L1KA 4WC3A 3HT3A 2ZTDA 3QZ8A 3KTQA 9ICCA 3KHGA 1JMSA 4UBBA 4BWMA 2Y1IA 1N56A 1JAJA 4YVZA 1T3NA 4YXMA 2J6SA 4AT9B 4C8OA 1ZQCA 2W9MA 3N97B 2J6TA 4DQRA 4XQ7A 4F50A 1MC8A 5J2FA 4UAYA 4RWPA 5BOMA 3N4MB 1BVSA 4X5VA 1NKEA 2HHSA 8ICLA 5DQGA 5J2BA 9ICXA 2ASDA 2KTQA 4UD5A 2UVUA 5DDYA 3UXOA 2BCUA 4UAZA 2FMPA 1BNOA 4NM1A 4ECRA 3H8WA 4DF8A 4PGQA 1XWLA 1VJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWC A;  4F5N A;  3FDS A;  2VA3 A;  3PW2 A;  5HP4 A;  3E2E A;  4ATB A;  1NK4 A;  1L5U A;  3M8S A;  4YR3 A;  3THV A;  2XY6 A;  4F2S A;  7ICN A;  9ICJ A;  4DSJ A;  4DOA A;  1ZQX A;  5HRG A;  4AT9 A;  2ZH7 A;  5HRF A;  4DL3 A;  3B0Y A;  3H38 A;  1ZQE A;  3GFK B;  2FPL A;  3EWA A;  4NKT A;  1D9F A;  3LWM A;  9ICT A;  4RZR A;  3RAQ A;  3RB4 A;  1ZQH A;  4M04 A;  3MDA A;  3ISD A;  7ICE A;  3ZD9 A;  9ICF A;  3OUY B;  3OVS A;  5CA7 A;  1RXW A;  3KHR A;  3PO5 A;  4WBZ A;  2M9N A;  5J2A A;  4K4G A;  1TVA A;  2HHQ A;  1OU5 A;  1K1S A;  4QWA A;  4DFM A;  2C28 A;  3JPP A;  3V72 A;  5HHI A;  4C8M A;  4PHE A;  3C66 A;  4DL5 A;  3UPQ A;  4NM2 A;  3C2K A;  4M6W B;  2VA8 A;  3JPR A;  3JYY A;  2ZUC A;  4QZH A;  2BPG A;  4QZF A;  3M9O B;  2OWO A;  4LZD A;  4IG8 A;  3IM1 A;  3PVX A;  4RPZ A;  2BQU A;  4ECT A;  2DRA A;  1V9P A;  1T4G A;  3OSN A;  3WFO A;  2IA6 A;  2HHX A;  2F1I A;  2MUT B;  3RTV A;  4KLT A;  4QZI A;  2R8J A;  4RWN A;  2XC9 A;  4DQI A;  4WC1 A;  4EZ9 A;  5DED A;  5EWG A;  2DR8 A;  1ZQV A;  4E80 A;  4RPX A;  4DLG A;  3Q8R B;  4FHP A;  4KLQ A;  3UPS A;  4DF4 A;  5KG3 A;  2XGQ A;  4O3S A;  1B43 A;  3RR8 A;  2KFN A;  2NRK A;  1DK2 A;  3JPN A;  1DK3 A;  3JPO A;  4ZH4 A;  3T3F A;  4O3R A;  4Q8E A;  4FHW A;  1U48 A;  8ICU A;  1NKC A;  3PX0 A;  4F5P A;  5HRL A;  1JIH A;  5EOZ A;  2C22 A;  3WFS C;  4K4H A;  5J0P A;  4DS4 A;  2A1J B;  4DSK A;  4MFC A;  5KG6 A;  4RQ0 A;  2XCP A;  3OHA A;  4RNN A;  5KFB A;  4DSE A;  1JX4 A;  2P66 A;  3HPO A;  5IIN A;  1RPL A;  3Q8K A;  1UA1 A;  4J9Q A;  5KFA A;  3TFS A;  4EBJ A;  3V6H A;  4ECS A;  3IHQ B;  4FS2 A;  4X4T A;  4YXJ A;  4MEX A;  4UB5 A;  3H40 A;  4IQW A;  4QWE A;  1NK5 A;  4M6W A;  4Q45 A;  5DB7 A;  3H4D A;  1UT8 A;  1LV5 A;  1HUO A;  4GXK A;  3RJH A;  4MFA A;  1ZQJ A;  5KFZ A;  2O1P A;  9ICH A;  4PHA A;  4KLU A;  3ISC A;  1ZQL A;  8ICE A;  4X0A A;  2ISO A;  2PFN A;  4ELV A;  4Q8F A;  3GV8 B;  9ICQ A;  2Q66 A;  5J2C A;  4B9M A;  8ICN A;  1B22 A;  1KTQ A;  5DQH A;  1R89 A;  2ASL A;  3GIK A;  4X4V A;  4JV0 A;  2DR9 A;  3M9M B;  2ZUB A;  2FLN A;  4CCH A;  2XY7 A;  4PHP A;  5DG7 A;  1ZQD A;  2UVR A;  5DLG A;  4I2G A;  3ZD8 A;  2DPI A;  4RPY A;  5KG7 A;  1TKD A;  5KFT A;  1XSL A;  4IQT A;  4JV1 A;  4RT3 A;  4F93 B;  7ICK A;  3TAN A;  4Q43 A;  1XSN A;  5HHH A;  3MR3 A;  4J9R A;  5J0Y A;  4JK1 A;  3PNC A;  3ZDD A;  4ATB B;  3JZ0 A;  2GWS A;  4FS1 A;  8ICZ A;  4GLX A;  1ZQM A;  2HHU A;  2AJQ A;  2W9B B;  5EWE A;  4I2D A;  3RJE A;  5DB8 A;  4YMN A;  5J0U A;  2PI5 A;  4KLL A;  1NZP A;  1UEV A;  4GXJ A;  4ED1 A;  4R65 A;  4DOB A;  5KT5 A;  3AU2 A;  3RB3 A;  5J2D A;  4I27 A;  7ICM A;  4WCW A;  2H5X A;  4Z6E A;  5HML A;  2AGQ A;  3AQN A;  5F9L A;  5KFF A;  1BPB A;  4RQ6 A;  3OJU A;  4ECY A;  4I29 A;  2P6R A;  5KG0 A;  2B21 A;  3BJY A;  4C8L A;  2DR7 A;  2ASJ A;  1JQR A;  3K4G A;  1JXE A;  1KFS A;  4LT6 A;  5CHG A;  9ICS A;  4MF2 A;  1SL2 A;  3LK9 A;  5D4B A;  1S76 D;  9ICM A;  1RXV A;  4F5O A;  1S0N A;  2I1Q A;  4FBT A;  4JWM A;  1XU4 A;  3MR2 A;  4FH5 A;  1ZQA A;  2XCA A;  2W9C B;  1PZN A;  3V6J A;  4DSF A;  3AU6 A;  4TUS A;  1NJY A;  1WOT A;  5J0S A;  5J2K A;  3C21 A;  4C8K A;  2ZH8 A;  4O3P A;  3RH4 A;  4J9N A;  3ZDA A;  8ICI A;  5HR9 A;  2DPJ A;  4J9K A;  4O0I A;  4I2H A;  5KT6 A;  4I2J A;  5D49 A;  1JXL A;  2IBK A;  4MEY A;  5KFL A;  3Q8P B;  4RQ5 A;  2JZB B;  4J9P A;  2ZHA A;  1BPD A;  4MFF A;  1U49 A;  3FYH A;  5KFQ A;  4PGX A;  1KFT A;  1ZET A;  4DEZ A;  2AGO A;  3RBD A;  1X2I A;  4ED0 A;  1X9W A;  8ICY A;  4WC7 A;  2BQ3 A;  1COO A;  3PMN A;  9ICK A;  4MF8 A;  4JV2 A;  4RUA A;  1KFD A;  1A77 A;  4RQ7 A;  2R8I A;  4XUS A;  2C2R A;  5CR0 A;  1SL0 A;  4R64 A;  2W8L A;  4I2C A;  4PHD A;  1KLN A;  5L1L A;  4I28 A;  5KFE A;  2LYH A;  3C23 A;  4RUC A;  3Q8Q B;  4ECZ A;  3UQ0 A;  2NRV A;  3OJS A;  5J0T A;  4B9T A;  4M9N A;  1TAU A;  4RNO A;  2W9C A;  8ICF A;  1R8B A;  3MDC A;  4FBU A;  3BQ0 A;  4I2B A;  5IIM A;  1BPZ A;  4TQR A;  5DGB A;  3Q8S B;  5L1I A;  5IIJ A;  1S77 D;  4TUP A;  5HRI A;  4ED6 A;  1XSP A;  1ZQR A;  4FH3 A;  4B9L A;  5CJ7 A;  3UXP A;  1TFY A;  4S3N A;  8ICA A;  3BQT A;  4O3Q A;  5KFC A;  5J0X A;  4KLM A;  5KFO A;  4FO6 A;  3AQL A;  3PX4 A;  4DL6 A;  1H38 A;  1BGX T;  5DBA A;  2FLL A;  1BPE A;  8ICG A;  8ICH A;  1FA0 A;  3ZDC A;  9ICR A;  4ED3 A;  4I2F A;  8ICJ A;  4QZC A;  3G6Y A;  4M47 A;  8ICB A;  2WTF A;  3TAR A;  2C2D A;  2JEG A;  4O3O A;  2O5A A;  8ICC A;  2PFP A;  2M2T A;  4WC0 A;  4QZG A;  1Q78 A;  4IQU A;  9ICE A;  5HRK A;  4X0B A;  5J2H A;  2BCV A;  4EZ6 A;  1ZJN A;  1WCL A;  3GDX A;  4YCX A;  1QLN A;  1UA0 A;  2IMW P;  2NRX A;  3HP6 A;  3V7K A;  3QE9 Y;  4DLE A;  1S10 A;  2DVI A;  1T8E A;  4AT7 B;  4QW8 A;  3PW0 A;  5J2E A;  8ICW A;  2ISP A;  1NJW A;  1S0O A;  2BPC A;  1ZQB A;  3RR7 A;  3C18 A;  4G3I A;  2UVV A;  1U45 A;  1NK7 A;  2RDJ A;  1QSS A;  4R8U A;  5KFH A;  4DO9 A;  5C5J A;  4M9J A;  2FLP A;  4NY8 A;  4JUZ A;  1MIW A;  4QWB A;  9ICL A;  5KFI A;  8ICK A;  4EYH B;  4NLZ A;  2JZB A;  1CEZ A;  4EP7 A;  4XA5 A;  2XO7 A;  2BE3 A;  3OHB A;  4QZ9 A;  4B9N A;  4BXO B;  4P4O A;  3UXN A;  3NYB A;  2PXI A;  5DEC A;  1TK5 A;  1NOM A;  4X4U A;  3RAX A;  4RWQ A;  7ICG A;  4TUR A;  5KT2 A;  2ZTC A;  7ICJ A;  4DOC A;  2A1J A;  4KN7 A;  1D8L A;  4YD1 A;  5KG5 A;  3G6V A;  1ZQP A;  4QW9 A;  2ALZ A;  4UB1 A;  4ELT A;  4UB4 A;  3PR5 B;  4R66 A;  4P2H A;  3SI8 A;  5KG4 A;  1ZQQ A;  4F2R A;  4RU9 A;  3H8J A;  2XGP A;  1S0M A;  1Z00 A;  4DQP A;  4EYI B;  4XQ8 A;  4EBE A;  4YR0 A;  1Z3E B;  2HW3 A;  3GIM A;  7ICT A;  9ICW A;  3AQK A;  3HW8 A;  3PX6 A;  4PGY A;  1MSW D;  4NLK A;  2ZH5 A;  3MFI A;  3RJG A;  2ZUD A;  3EZ5 A;  3AUO A;  1V4A A;  5KFW A;  4X4R A;  3WFR E;  2ZH4 A;  2JEI A;  5J0R A;  2KFZ A;  1R8C A;  3TI0 A;  2HHW A;  3GQC A;  3ETL A;  4F4X A;  2RFF A;  1TK0 A;  4F3O A;  1HJP A;  3C2M A;  2FMS A;  8ICS A;  1ZQZ A;  5III A;  4ED2 A;  7ICI A;  5DB6 A;  3V7J A;  2KZ3 A;  5DGA A;  3PO4 A;  4M9G A;  2UVW A;  2PBE A;  2AQ4 A;  2ZH3 A;  2BQR A;  3RJK A;  4F5Q A;  1K1Q A;  1UT5 A;  4Z6D A;  2Y1J A;  1QSY A;  2IHN A;  8ICO A;  3HJ1 A;  3PW5 A;  4RWO A;  3HX0 A;  2DFL A;  1ZJM A;  2JEJ A;  4YN4 A;  4KTQ A;  5KT4 A;  2FPM A;  1XO1 A;  1ZQY A;  5F9N A;  3OUY A;  2V4Q A;  2R8K A;  5KFM A;  1U47 A;  1XC9 A;  3T5L A;  2MAX A;  3TQ1 A;  1L3S A;  2ZH9 A;  2VA2 A;  1U4B A;  4DQS A;  4UBC A;  3TAP A;  4O3N A;  4Z6C A;  9ICV A;  4DFP A;  5KFX A;  4DS5 A;  5IIL A;  2ZH6 A;  2ZTE A;  5J0O A;  4KLE A;  5KFN A;  4YP3 A;  3RJI A;  4QZD A;  8ICP A;  4F5R A;  1NK9 A;  3HJ4 A;  7ICL A;  4RQ2 A;  3OV7 A;  1VFG A;  2BDP A;  2F1H A;  3PML A;  4ECU A;  1TV9 A;  3EPG A;  1NK8 A;  4ED7 A;  3ZDB A;  2IHM A;  4PPX A;  5TZV A;  3H37 A;  4EBK A;  1TAQ A;  4E0D A;  4M5D A;  4KMU A;  1C7Y A;  3T5H A;  4KLF A;  4KLI A;  2KZZ A;  2Q0Z X;  5DG9 A;  7ICF A;  4I2I A;  4J9M A;  1KSP A;  3LWL A;  5D46 A;  4RQ1 A;  3TAQ A;  4E7X A;  3LDA A;  3H39 A;  3BQ1 A;  1TK8 A;  3GII A;  3C5F A;  3RB0 A;  1ZYQ A;  2BCS A;  4IRD A;  5J0Q A;  3JPS A;  4DQQ A;  3BDP A;  4F92 B;  3B0X A;  1ZQG A;  3L9D A;  5DBB A;  1ZQK A;  3C2L A;  5HRD A;  1EXN A;  4JWN A;  7ICQ A;  1YLQ A;  4YMO A;  3PV8 A;  4FHX A;  4ECX A;  4YR2 A;  1Y88 A;  1IXR A;  3C1Z A;  3GV7 B;  1MIY A;  4X4N A;  4M9L A;  4C8N A;  7ICH A;  2R8G A;  4J9L A;  3RJF A;  5HRE A;  1T7P A;  4UD4 A;  2FPK A;  2BGW A;  4O5E A;  1PX5 A;  4IQV A;  3PW7 A;  1XS9 D;  3Q8L A;  2ATL A;  3GIJ A;  1NK0 A;  5DQI A;  8ICT A;  3MBY A;  2NRT A;  4TQS A;  2AQ0 A;  4YG2 A;  2HVI A;  9ICN A;  8ICX A;  2BR0 A;  4QZ8 A;  4R63 A;  4B9V A;  1HUZ A;  4UB2 A;  3MR6 A;  3SV3 A;  5L1J A;  1KRP A;  2J6U A;  2PI4 A;  4IR9 A;  4Z6F A;  5HMM A;  5IIO A;  5KT7 A;  5J2G A;  3JPQ A;  2BKE A;  1SKS A;  4IRK A;  9ICB A;  4J9S A;  1L3U A;  5DDM A;  3HWT A;  5KTQ A;  2W9A A;  3OSP A;  4FHY A;  1SKR A;  2VAN A;  4KIT B;  1ZQI A;  4EBC A;  4RNM A;  1Z00 B;  3C1Y A;  1D9D A;  1KNY A;  1Q79 A;  2V4R A;  9ICO A;  5KFV A;  4RQ4 A;  4WC5 A;  5JUM A;  1IM4 A;  1BPX A;  1F5A A;  2F1J A;  3H4B A;  2P6U A;  5KFJ A;  4P4P A;  5DBC A;  1S0V A;  3K75 D;  1U9L A;  2HHT A;  4WBY A;  2DRB A;  2AGP A;  1DOQ A;  2ZJ8 A;  1X9M A;  1ZQN A;  2ZHB A;  3MFH A;  3RJJ A;  4X4O A;  2ZH1 A;  3PW4 A;  5HNK A;  3KHL A;  3UQ2 A;  3TFR A;  3RH5 A;  1SL1 A;  3MGH A;  2KZM A;  7ICU A;  4XRH A;  2BCR A;  4UB3 A;  4WC6 A;  3ORY A;  4M2Y A;  3RRH A;  4F91 B;  2DR5 A;  3T5J A;  4K4I A;  2M2V A;  2NRZ A;  1TFR A;  1S97 A;  2BCQ A;  2JEF A;  2HHV A;  1QTM A;  4DL2 A;  4KLJ A;  4WC2 A;  5KFS A;  2I9G A;  5KG1 A;  1JN3 A;  4YQW A;  8ICQ A;  3LQC B;  5J2I A;  4AT8 B;  4UQG A;  2R8H A;  3M9N B;  1ZQT A;  5CWR A;  4NLN A;  4F4Y A;  8ICV A;  1RYS A;  9ICA A;  4R8U B;  3OGU A;  3Q8M A;  1ZQF A;  1NO5 A;  5HC9 A;  4O5K A;  1DGS A;  3V7L A;  1RYR A;  5KFK A;  9ICG A;  4B9U A;  5BOL A;  4QWD A;  3QEA Z;  5J2J A;  2ZH2 A;  4YD2 A;  3RB6 A;  2ZJ5 A;  4ECV A;  1KDH A;  4FHV A;  2RDI A;  5EWF A;  4RT2 A;  4Q44 A;  5DKW A;  1CUK A;  5DB9 A;  4LZG A;  1A76 A;  1TFW A;  5KFP A;  1R8A A;  4GXI A;  4ELU A;  1NJX A;  3MAB A;  4DSL A;  2HHP A;  4X4P A;  1L3T A;  3RH6 A;  3SYZ A;  4PH5 A;  1ZQW A;  4M9H A;  1SZP A;  4O5C A;  3EPI A;  3WFP A;  3C5G A;  5J29 A;  4KN4 A;  2ID1 A;  4AT8 A;  3JPT A;  5CB1 A;  3OVB A;  3RBE A;  2KN7 A;  4QZB A;  1L3V A;  2V9W A;  7ICR A;  2C2E A;  1MIV A;  3KHH A;  1MQ3 A;  4M0A A;  3H7I A;  2KP7 A;  4DWI A;  3PR4 A;  2W8K A;  1D8Y A;  2XY5 A;  4RQ8 A;  1WCN A;  3G6X A;  1QSL A;  4NXZ A;  5L9X A;  4DL7 A;  1UET A;  4DL4 A;  3HIY A;  1X9S A;  1UEU A;  1NKB A;  3OVA A;  5KFY A;  3MGI A;  4KLS A;  7ICP A;  5HRH A;  4NKU A;  4YFK A;  3H8S A;  4BGD A;  2HVH A;  2M2W A;  8ICR A;  1S9F A;  1BNP A;  4B9S A;  9ICU A;  3EW9 A;  1N48 A;  2ZJA A;  5BPC A;  4ECQ A;  3QZ7 A;  4J9O A;  4X4Q A;  3BQ2 A;  2MUT A;  4F4W A;  2BHN A;  4F4Z A;  4F4K A;  3NGD A;  2NRW A;  4BDP A;  3AQM A;  3WFQ E;  4NLG A;  4RQ3 A;  1ZQS A;  3PY8 A;  9ICI A;  4QZE A;  2M2U A;  3SZ2 A;  4GC7 A;  2BPF A;  4UAW A;  4DFJ A;  4KLH A;  5HRB A;  3NTU A;  4WC4 A;  3M8R A;  4GC6 A;  7ICS A;  1RZT A;  4I2A A;  5CP2 A;  5DG8 A;  5IIK A;  2W9B A;  1KEJ A;  5KFR A;  1NK6 A;  4IR1 A;  4KLG A;  4ED8 A;  4KLO A;  4X4S A;  4TUQ A;  2PFO A;  4BXO A;  4DSI A;  4HYK A;  5DLF A;  4YMM A;  5KFG A;  5KFU A;  3T5K A;  4EBD A;  3ISB A;  4KLD A;  1ARO P;  4DFK A;  3H3A A;  3SV4 A;  3RRG A;  5KG2 A;  1ZQO A;  2PFQ A;  9ICP A;  4ECW A;  3V6K A;  4AT7 A;  4P4M A;  2FMQ A;  4BWJ A;  1SKW A;  1NJZ A;  2AU0 A;  1MQ2 A;  4IRC A;  4I2E A;  4E8F A;  8ICM A;  5KT3 A;  4QZA A;  3EYZ A;  1ZQU A;  1LB2 B;  7ICO A;  5KFD A;  3QEB Z;  4EEY A;  3GIL A;  7ICV A;  4LVS A;  3ZDE A;  4O9M A;  3MR5 A;  3GV5 B;  1BPY A;  4F8R A;  5F2V O;  5J0W A;  5L1K A;  4WC3 A;  3HT3 A;  2ZTD A;  3QZ8 A;  3KTQ A;  9ICC A;  3KHG A;  1JMS A;  4UBB A;  4BWM A;  2Y1I A;  1N56 A;  1JAJ A;  4YVZ A;  1T3N A;  4YXM A;  2J6S A;  4AT9 B;  4C8O A;  1ZQC A;  2W9M A;  3N97 B;  2J6T A;  4DQR A;  4XQ7 A;  4F50 A;  1MC8 A;  5J2F A;  4UAY A;  4RWP A;  5BOM A;  3N4M B;  1BVS A;  4X5V A;  1NKE A;  2HHS A;  8ICL A;  5DQG A;  5J2B A;  9ICX A;  2ASD A;  2KTQ A;  4UD5 A;  2UVU A;  5DDY A;  3UXO A;  2BCU A;  4UAZ A;  2FMP A;  1BNO A;  4NM1 A;  4ECR A;  3H8W A;  4DF8 A;  4PGQ A;  1XWL A;  1VJ7 A; 
#chains in the Genus database with same CATH topology
 1RQL A;  5CFT A;  3LVV A;  5HP4 A;  2B4V A;  4ATB A;  3AL0 B;  3SEN A;  4YR3 A;  4DSJ A;  4OJP A;  5HRF A;  2EAP A;  4NKT A;  3R9K A;  9ICT A;  1ZQH A;  2JRZ A;  3ISD A;  3OVS A;  5CA7 A;  3KHR A;  2M9N A;  3M7D A;  1B0X A;  4C8M A;  5AI0 A;  4OJ5 A;  4NM2 A;  2EZX A;  4QZF A;  4IG8 A;  1ZD2 P;  3PVX A;  1L7P A;  4KMO B;  5AKK A;  3OSN A;  3WFO A;  3RTV A;  2R8J A;  5AM3 A;  5EWG A;  4E80 A;  3WU2 U;  4EED A;  4KLQ A;  3B9J A;  5KG3 A;  1RYU A;  4O3R A;  8ICU A;  5HRL A;  3AM9 A;  1JIH A;  3WFS C;  4DS4 A;  4O3M A;  2KJ8 A;  1JX4 A;  2P66 A;  3Q8K A;  4EBJ A;  3TFS A;  5KFA A;  1N5X A;  4ECS A;  4X4T A;  5ALP A;  3H40 A;  5EE0 A;  9ICR A;  3QU7 A;  4Q45 A;  1HUO A;  1UT8 A;  2ZIU A;  9ICH A;  4PHA A;  1LVH A;  3LYS A;  4X0A A;  2ISO A;  2Q66 A;  5AI5 A;  4CF3 A;  4B9M A;  1R89 A;  3SQI A;  1NNL A;  2DR9 A;  3M9M B;  4PHP A;  2DPI A;  3K7D A;  7ICK A;  3TAN A;  4CDG A;  4Y2Q A;  5JTG A;  2KE7 A;  3PNC A;  4FZM A;  2AJQ A;  2W9B B;  1N63 A;  4C7Y A;  4LJX A;  5KT5 A;  2H5X A;  4Z6E A;  5CRX A;  3AQN A;  5F9L A;  1BPB A;  4Y2Y A;  3OJU A;  2B21 A;  4C8L A;  2ASJ A;  1JQR A;  1TE2 A;  3QU2 A;  1S76 D;  5D4B A;  3ICX A;  1XU4 A;  1N2X A;  1ZQA A;  3AU6 A;  1PZN A;  1WOT A;  3C21 A;  2ZH8 A;  4O3P A;  4J9N A;  8ICI A;  5HR9 A;  4Y2T A;  1V38 A;  4J9P A;  1BPD A;  2GOL A;  3EUB 2;  4MFF A;  3VC8 A;  4PGX A;  5KFQ A;  2F44 A;  3RBD A;  5GTH U;  4JV2 A;  3E0F A;  1KFD A;  2WF5 A;  2XVT A;  2W8L A;  4PHD A;  2MA1 A;  2LYH A;  4ECZ A;  2NRV A;  3OJS A;  3BQ7 A;  8ICF A;  2NO5 A;  3NRW A;  3QU9 A;  5IIM A;  4TQR A;  5DGB A;  4BJQ A;  5IIJ A;  1S77 D;  2OH2 A;  3EF2 A;  4AYB C;  4ED6 A;  5AM1 A;  1TFY A;  3AQL A;  5EE1 A;  1COK A;  1ZRN A;  2QAR A;  5DBA A;  2KG5 A;  1WWV A;  2D8C A;  1NZB A;  5KAF U;  3ZDC A;  1OW5 A;  4CNQ A;  8ICJ A;  4LEY A;  3PHZ A;  2B51 A;  2FDR A;  2YX8 A;  3G6Y A;  8ICB A;  2XID A;  4WC0 A;  8ICC A;  2W04 A;  2KJ5 A;  4NV0 A;  4EV6 A;  2W54 A;  4YCX A;  2ZG6 A;  4KX5 A;  2NRX A;  3V7K A;  3QE9 Y;  3I28 A;  3I1Y A;  4DLE A;  2DVI A;  2EAO A;  4QW8 A;  3PW0 A;  2ISP A;  1ZQB A;  1QSS A;  3K1Z A;  4R8U A;  5C5J A;  2FLP A;  4QWB A;  9ICL A;  2MRL A;  2HOF A;  1CEZ A;  2KK0 A;  5J8Y A;  4B9N A;  4QZ9 A;  4P4O A;  1A6S A;  4PZO A;  3CYM A;  1TK5 A;  3F5E A;  4RWQ A;  5KT2 A;  1SV0 A;  7ICJ A;  1UPH A;  4K9B A;  1D8L A;  4YD1 A;  2R18 A;  4PL1 A;  4R66 A;  4NWI A;  5J8Y C;  3SEI A;  4XQ8 A;  3GIM A;  9ICW A;  3HW8 A;  4OO1 J;  4PGY A;  4NLK A;  1V4A A;  4X4R A;  2ZH4 A;  3ETR A;  1N62 A;  1ZOL A;  3L4P A;  3GQC A;  1TK0 A;  4F3O A;  5III A;  4LEZ A;  2JR5 A;  1JI7 A;  2ZH3 A;  2H3Z A;  8ICO A;  3HJ1 A;  1GO3 F;  3HX0 A;  1ZJM A;  4YN4 A;  1Q46 A;  2V4Q A;  4MHV A;  1L3S A;  1HIW A;  1U4B A;  4DQS A;  3TAP A;  4UW9 A;  4DFP A;  5KFX A;  5G5H A;  3PZP A;  4DFD A;  5KFN A;  2E5S A;  1NK9 A;  3L5K A;  1VFG A;  3PML A;  4ECU A;  4PPX A;  5TZV A;  4CF4 A;  4KMU A;  2KZZ A;  2QAR B;  4KLI A;  2Q0Z X;  2KV2 A;  5TIS U;  4LEW A;  2W03 A;  2F2A B;  2NO4 A;  3H39 A;  3BQ1 A;  3C5F A;  4DQQ A;  1EXN A;  4JWN A;  1YLQ A;  4UAV A;  3PV8 A;  2KIV A;  3F2C A;  1LKY A;  3GV7 B;  2W3S A;  4EEL A;  4J9L A;  1T7P A;  2FPK A;  1PX5 A;  5D62 A;  2EQY A;  1UQV A;  3Q8L A;  3GIJ A;  5DQI A;  8ICT A;  2HVI A;  4TQS A;  9ICN A;  2AQ0 A;  3QNM A;  4R63 A;  1HUZ A;  5L1J A;  4IR9 A;  1SXE A;  4Z6F A;  5AIB A;  3HKZ F;  1SKS A;  2ZIW B;  3OSP A;  4EBC A;  4RNM A;  1Q79 A;  3C1Y A;  4RQ4 A;  1IM4 A;  1BPX A;  4Y2R A;  3H4B A;  3NVZ A;  5KFJ A;  1Q8K A;  5DBC A;  1U9L A;  1SWV A;  1X9M A;  2KEY A;  3MFH A;  2Y9U A;  4X4O A;  5HNK A;  3KHL A;  1SL1 A;  3A0B U;  5ALV A;  2OCE A;  3NAS A;  4WC6 A;  4M2Y A;  2WAQ F;  2DR5 A;  4P0Q A;  4K4I A;  2NRZ A;  2JEF A;  4WC2 A;  5KFS A;  2I9G A;  4YQW A;  5J2I A;  3M9N B;  1ZQT A;  8ICV A;  1RYS A;  2IOH A;  3SAH A;  9ICA A;  4O5K A;  1RYR A;  2E8O A;  1ZD3 A;  5BOL A;  4CF5 A;  2XIC A;  2ZJ5 A;  3RB6 A;  2YB1 A;  4FHV A;  2RDI A;  2HMX A;  2CRX A;  1A76 A;  3KZI U;  5KFP A;  2DQN B;  4ELU A;  2CPR A;  2EZY A;  2YMM A;  1Z19 A;  1L3T A;  4OJ6 A;  1S8O A;  4PH5 A;  3EPI A;  4KN4 A;  3JPT A;  1L3V A;  2V9W A;  1X6J A;  2W8K A;  3G6X A;  5L9X A;  4DL4 A;  3OVA A;  4IS7 A;  7ICP A;  2RLT A;  3RF9 A;  4KM5 A;  2M2W A;  1JUD A;  2ZJA A;  4X4Q A;  3WFQ E;  4NLG A;  4RQ3 A;  1ZQS A;  5G5G A;  3BS5 B;  2M2U A;  2FCL A;  5HRB A;  2G07 A;  4WC4 A;  2M0N A;  7ICS A;  1RZT A;  2KMD A;  5DG8 A;  2O6K A;  5IIK A;  2W9B A;  2G5I B;  4ED8 A;  2Y0S F;  5DLF A;  2KIW A;  5ALS A;  4EBD A;  1SWW A;  1ARO P;  3HKZ C;  2K4H A;  1ZQO A;  2PFQ A;  3ER9 B;  2WFA A;  2KIC A;  4BWJ A;  1NJZ A;  4IRC A;  3EYZ A;  1L8O A;  5JU5 A;  1LB2 B;  4EEY A;  3ZDE A;  3MR5 A;  4F8R A;  1BPY A;  2LM1 A;  5L1K A;  4WC3 A;  3HT3 A;  3KTQ A;  3QZ8 A;  3T79 A;  1N56 A;  4YVZ A;  2J6S A;  2K8C B;  4C8O A;  1ZQC A;  2W9M A;  2DBY A;  2LYA A;  2W7O A;  4UAY A;  2HHS A;  9ICX A;  4UD5 A;  2BCU A;  4NM1 A;  3QUB A;  1XWL A;  4QWC A;  2VA3 A;  5AKG A;  9ICJ A;  4C7Z A;  2EH9 A;  3TKA A;  3F2D A;  3H38 A;  1ZQE A;  1D9F A;  4RZR A;  3RB4 A;  4FZN A;  3MDA A;  1RXW A;  4WBZ A;  5J2A A;  1B4F A;  1K1S A;  4QWA A;  2C28 A;  3V72 A;  4NXW A;  5T14 A;  2F3N A;  4PHE A;  1WG8 A;  5HR7 A;  4M6W B;  3JPR A;  3JYY A;  2OWO A;  1KBU A;  4ECT A;  2DRA A;  1V9P A;  2IA6 A;  4J03 A;  3WK5 A;  2XC9 A;  4DQI A;  4WC1 A;  5DED A;  1FFV A;  3Q8R B;  2HN1 A;  4DF4 A;  4O3S A;  3JPN A;  4JB3 A;  1ZQ1 C;  1DK3 A;  4FHW A;  4ICA A;  4F5P A;  5EOZ A;  4EX6 A;  3WK7 A;  1X40 A;  5KG6 A;  2XCP A;  4BUG A;  4RNN A;  3JCF A;  4C4S A;  5IIN A;  1UA1 A;  4J9Q A;  2HSZ A;  3V6H A;  3IHQ B;  4FS2 A;  4YXJ A;  4MEX A;  4UB5 A;  1NK5 A;  4M6W A;  3RJH A;  5DB7 A;  1F0M A;  4GXK A;  4MFA A;  1ZQJ A;  2O1P A;  8ICE A;  4ELV A;  4Q8F A;  9ICQ A;  1QQ6 A;  2ASL A;  4X4V A;  4JV0 A;  4PL2 A;  3UMB A;  4U6P A;  4I2G A;  3ZD8 A;  4RPY A;  5KG7 A;  1XSL A;  2A1A A;  4IQT A;  1XSN A;  3MR3 A;  3OPX A;  3ZDD A;  2PMZ C;  8ICZ A;  3JZ0 A;  4GLX A;  4I2D A;  5DB8 A;  4YMN A;  2PI5 A;  4ED1 A;  4DOB A;  1SGG A;  4I29 A;  4OAF A;  3K4G A;  4LT6 A;  9ICS A;  5AI8 A;  4C80 A;  2W55 A;  2WAQ C;  9ICM A;  1RXV A;  4EGW A;  4F5O A;  1S0N A;  2I1Q A;  4FBT A;  1XO0 A;  2WF9 A;  3NS1 A;  2KSO A;  2K60 A;  1IIP A;  2F76 X;  3ZDA A;  2L5Y A;  4NJ8 A;  5KL1 B;  4O0I A;  4I2H A;  5KT6 A;  1X9X A;  5D49 A;  2IBK A;  5KFL A;  4RQ5 A;  3PSI A;  2OXO A;  3FYH A;  1U49 A;  2RP5 A;  1X9W A;  8ICY A;  3IG8 A;  3QYP A;  4RUA A;  1A77 A;  3DDH A;  1SV0 C;  5CEH A;  4WJ3 B;  9ICF A;  1YZ7 A;  1KKX A;  2E3T A;  2E8M A;  5J0T A;  1TAU A;  4RNO A;  2HBJ A;  1R8B A;  3BQ0 A;  3VCB A;  1BPZ A;  3Q8S B;  3S6J A;  1J97 A;  1F5S A;  1XSP A;  4FH3 A;  5B3Q A;  5CJ7 A;  3UXP A;  5KFC A;  2WB1 F;  2B56 A;  1XNS A;  3AMZ A;  8ICG A;  2HBK A;  2QB0 B;  1L7O A;  2ESE A;  3SAG A;  2KVC A;  4ED3 A;  5AK3 A;  4C0Z A;  1Q3V A;  4M47 A;  3TAR A;  4FO1 A;  9ICE A;  4K97 A;  4EZ6 A;  1ZJN A;  3GDX A;  5ALN A;  3HP6 A;  1RM6 C;  3QUC A;  5A0L A;  5C0Y A;  3C18 A;  4G3I A;  1T94 A;  2RDJ A;  2JGA A;  4M9J A;  1N5W A;  4JUZ A;  1X42 A;  4EP7 A;  1CRX A;  4XA5 A;  2XO7 A;  4RQN A;  2BE3 A;  3UXN A;  3NYB A;  5AM0 A;  5GTI U;  2PXI A;  4X4U A;  3NUQ A;  7ICG A;  1JRP A;  4TUR A;  4DOC A;  2A1J A;  2K8A A;  3G6V A;  3WK4 A;  5KG4 A;  1ZQQ A;  4RU9 A;  1S5L U;  2XGP A;  2HBM A;  3ERC C;  1Z00 A;  3UMG A;  4DQP A;  1GPJ A;  3AQK A;  1Z3E B;  7ICT A;  3MFI A;  3AUO A;  5KFW A;  3PSF A;  5ALL A;  2KKV A;  2JEI A;  4OAH A;  1R8C A;  3TI0 A;  3ETL A;  1OXJ A;  1HJP A;  2FMS A;  1ZQZ A;  7ICI A;  2KZ3 A;  2UVW A;  4UB6 U;  1J2M A;  2BQR A;  4F5Q A;  1K1Q A;  2IHN A;  4Z6D A;  1QSY A;  2KKP A;  4RWO A;  3ALR A;  2DFL A;  5ALG A;  1XO1 A;  1ZQY A;  5F9N A;  2MAX A;  2ZH9 A;  2PMZ F;  3CNH A;  2ZIU B;  4DS5 A;  2WB1 C;  5ALX A;  4KLE A;  4WOY A;  4QZD A;  4LEV A;  4F5R A;  4RQ2 A;  1TV9 A;  1NK8 A;  4EBK A;  3EPG A;  4KLF A;  7ICF A;  2Y9T A;  5AKI A;  2BDU A;  4J9M A;  3LWL A;  4ZOH C;  5D46 A;  3LDA A;  4IL6 U;  5AKE A;  3GII A;  1ZYQ A;  2YN4 A;  4UAR A;  3BDP A;  5ALO A;  3C2L A;  7ICQ A;  5ALQ A;  4YMO A;  3LVW A;  4ECX A;  4FHX A;  4YR2 A;  3C1Z A;  1IXR A;  1VJ5 A;  5AHX A;  2FJ6 A;  5JRT A;  7ICH A;  5HRE A;  1URJ A;  1FFU A;  2NV3 A;  4IQV A;  1XS9 D;  3AN1 A;  3MBY A;  2NRT A;  5AKL A;  8ICX A;  3HJ4 A;  2KVS A;  2BR0 A;  5KT7 A;  9ICB A;  4Y2U A;  1NO5 A;  2BKE A;  5DDM A;  3HWT A;  5KTQ A;  4FHY A;  2E1F A;  4OJO A;  2YY6 A;  5KFV A;  5EE3 A;  3MC1 A;  5JUM A;  4K96 A;  2ODG A;  4P4P A;  3HRD D;  3WK6 A;  2DRB A;  1AQ6 A;  3MGV A;  3IG5 A;  2K4I A;  2GA9 D;  3C29 A;  7ICU A;  2E1E A;  4CGZ A;  3ORY A;  3RRH A;  2BCQ A;  1QTM A;  4UQG A;  3SMV A;  5CFU A;  2ZIX B;  4PJ0 U;  5CWR A;  4NLN A;  4F4Y A;  3OGU A;  5HC9 A;  4O68 A;  4B9U A;  4QWD A;  5J2J A;  2ZH2 A;  4CE6 A;  5AK4 A;  1KDH A;  3KKA C;  4Q44 A;  1CUK A;  4LZG A;  2A3V A;  4Y2X A;  1FEZ A;  1NJX A;  1DRG A;  4O5C A;  3WFP A;  4AT8 A;  3M1Y A;  7ICR A;  4QZB A;  1MIV A;  2C2E A;  4M0A A;  2KP7 A;  2LM4 A;  4RQ8 A;  4NXZ A;  1UEU A;  1NKB A;  5KFY A;  2F8L A;  3MGI A;  5HRH A;  3H8S A;  3KKA A;  2HVH A;  1DXS A;  3EW9 A;  1N48 A;  3NGD A;  3AQM A;  4UB8 U;  4QJF B;  4QZE A;  1UHU A;  4GC7 A;  4WQL A;  2BPF A;  4UAW A;  3NTU A;  2E8N A;  4FE3 A;  3PST A;  4I2A A;  1TAM A;  5CP2 A;  1KEJ A;  3PSP A;  5KFR A;  1CI4 A;  4IR1 A;  4KLG A;  4KLO A;  1V97 A;  4HYK A;  1PVQ A;  4MKP A;  1SIJ A;  4OJL A;  3RRG A;  9ICP A;  3CW2 C;  4AT7 A;  4P4M A;  1M6Y A;  1SKW A;  4B6J A;  4I2E A;  1ZQU A;  7ICO A;  3QEB Z;  4KB6 A;  4K98 A;  5HR6 A;  3GV5 B;  9ICC A;  4K99 A;  1JMS A;  4BWM A;  2GLE A;  1JAJ A;  4AT9 B;  2F77 X;  4DQR A;  4F50 A;  4OCZ A;  3D2S A;  2H3F A;  5J2F A;  3N4M B;  4X5V A;  4O67 A;  5DQG A;  5J2B A;  1D8B A;  2ASD A;  2KTQ A;  3UXO A;  2FMP A;  4ECR A;  1L8L A;  3FDS A;  2EAN A;  3SD7 A;  2WF6 A;  3FM9 A;  1NK4 A;  2AH5 A;  1HEK A;  1L5U A;  3THV A;  5HRG A;  4C4R A;  2ZH7 A;  2EAM A;  3GFK B;  2FPL A;  3EWA A;  3LWM A;  3KFU F;  5KL8 B;  3ZD9 A;  4K4G A;  1TVA A;  4DFM A;  3JPP A;  5HHI A;  3C66 A;  2ES6 A;  4DL5 A;  3UPQ A;  4QZH A;  3M9O B;  4LZD A;  3D2N A;  3IM1 A;  4RPZ A;  2YB4 A;  2F1I A;  2MUT B;  4KLT A;  4QZI A;  4RWN A;  2LYB A;  3UPS A;  1B43 A;  3BZC A;  3RR8 A;  2H3Q A;  2KFN A;  4NXU A;  3JPO A;  4ZH4 A;  2C22 A;  4JLX A;  2A1J B;  1KN5 A;  2DKX A;  4RQ0 A;  3IN5 A;  2H3I A;  1SV4 A;  4QWE A;  2ZXI A;  4NLZ A;  1LV5 A;  5KFZ A;  2MU2 A;  4KLU A;  1ZQL A;  2YQE A;  3BS7 A;  5AI4 A;  5CHE A;  1A0P A;  5J2C A;  1KTQ A;  3GIK A;  2FLN A;  2ZUB A;  2XY7 A;  5DG7 A;  5DLG A;  2HI0 A;  1TKD A;  5KFT A;  3E58 A;  4JV1 A;  4RT3 A;  4F93 B;  4Q43 A;  2RQ5 A;  5HHH A;  4J9R A;  4WH5 A;  1QQ7 A;  4ATB B;  5F3X B;  2GWS A;  4FS1 A;  1ZQM A;  3RJE A;  5J0U A;  4O69 A;  4KLL A;  3RB3 A;  4R65 A;  4WCW A;  2AGQ A;  5HML A;  2K89 A;  3BS5 A;  5KG0 A;  3BJY A;  1KFS A;  4MF2 A;  5AKH A;  3LK9 A;  2VKQ A;  4JWM A;  2IHO A;  2JV3 A;  4FH5 A;  2XCA A;  3V6J A;  1NJY A;  4DSF A;  5J0S A;  5J2K A;  4C8K A;  1KQQ A;  3KZX A;  3RH4 A;  1SXD A;  4JMU A;  3HJE A;  5AK5 A;  4MEY A;  3Q8P B;  3L3F X;  4NL9 A;  1KFT A;  1ZET A;  2AGO A;  1X2I A;  4ED0 A;  3QUT A;  4WC7 A;  5D61 A;  5H2F U;  3NWI A;  5CR0 A;  1SL0 A;  4R64 A;  1KLN A;  4NXX A;  3C23 A;  4M9N A;  3UQ0 A;  1FO4 A;  2W9C A;  3MDC A;  4FBU A;  4I2B A;  2YML A;  3CRX A;  4B9L A;  4S3N A;  5AKX A;  4O3Q A;  3GZF A;  4AP9 A;  4DL6 A;  1BGX T;  4K8V A;  1BPE A;  1FA0 A;  5ALW A;  2NYV A;  2G0A A;  1Z4O A;  2WTF A;  2C2D A;  2M2T A;  2PFP A;  4QZG A;  1Q78 A;  3WKD A;  5HRK A;  4X0B A;  2BCV A;  3UMC A;  4JLZ A;  2I6X A;  2IMW P;  3NVO A;  3AQF A;  3OTQ A;  1S10 A;  1T8E A;  4AT7 B;  2ZIV B;  2KJ9 A;  1NJW A;  1S0O A;  3MCR A;  3NKU A;  2CN1 A;  1O03 A;  2JMG A;  1VDV A;  5KFH A;  4DO9 A;  4NY8 A;  2FI1 A;  1MIW A;  4EYH B;  2G5H B;  2JZB A;  2XI9 A;  5ALF A;  1NOM A;  3RAX A;  2JH7 A;  5ALE A;  4PZN A;  2ZTC A;  4KN7 A;  1ZQP A;  4QW9 A;  2ALZ A;  4XJE A;  5ALZ A;  4UB4 A;  4GFJ A;  4P2H A;  4P0P B;  3SI8 A;  4F2R A;  3H8J A;  5KNI A;  4NLB A;  4OAG A;  2E8P A;  4EBE A;  4YR0 A;  2HW3 A;  2ZH5 A;  3PX6 A;  2ZUD A;  2Z7J A;  1IV8 A;  4F4X A;  2RFF A;  4DCC A;  3UM9 A;  8ICS A;  2KNJ A;  4ED2 A;  3H0R B;  4M9G A;  2PBE A;  4HAI A;  1UT5 A;  5AI9 A;  2Y0S C;  2JEJ A;  4KTQ A;  3OUY A;  2FPM A;  2R8K A;  5KFM A;  1U47 A;  2YMQ A;  3T5L A;  2ZIX A;  4O3N A;  4Z6C A;  3ED5 A;  5IIL A;  2LKY A;  2ZTE A;  5J0O A;  3DV9 A;  2LI6 A;  3RJI A;  8ICP A;  1K5O A;  7ICL A;  4US8 A;  3ZDB A;  1NI3 A;  4ED7 A;  2IHM A;  2GAF D;  3J81 j;  4M5D A;  1C7Y A;  4UAT A;  2LPE A;  5DG9 A;  4I2I A;  5AK6 A;  1KSP A;  5B66 U;  2BBH A;  4NXV A;  2BZF A;  2BCS A;  4IRD A;  1FIQ A;  5J0Q A;  5JTI A;  2G09 A;  4F92 B;  1ZQG A;  3L9D A;  1JAL A;  5AI6 A;  5HRD A;  3QX7 A;  4C8N A;  2R8G A;  4UD4 A;  2BGW A;  4UAS A;  2ATL A;  1NK0 A;  3WKC A;  4UB2 A;  1KRP A;  2J6U A;  1RDF A;  5HMM A;  5IIO A;  3JPQ A;  2W7P A;  2DF4 B;  1OUQ A;  4KIT B;  1Z00 B;  1KNY A;  9ICO A;  3N7P D;  2P6U A;  3ZI4 A;  4WBY A;  1DOQ A;  1ZQN A;  2BBJ A;  1WUD A;  2ZH1 A;  3TFR A;  3UQ2 A;  3MGH A;  2KZM A;  4XRH A;  2BCR A;  4UB3 A;  1Z1V A;  3T5J A;  2M2V A;  4USA A;  1MA7 A;  4DL2 A;  5KG1 A;  8ICQ A;  5ALK A;  3N7S C;  1F44 A;  1RG6 A;  2WF8 A;  2JH1 A;  1DGS A;  9ICG A;  2VIX A;  4YD2 A;  4ECV A;  2QLT A;  5EWF A;  3H8M A;  1TFW A;  1ZXI A;  3MAB A;  4NLC A;  2HHP A;  4X4P A;  3RH6 A;  2IUB A;  4M9H A;  2EWR A;  1SZP A;  3C5G A;  5J29 A;  2OYY A;  2ID1 A;  2KOB A;  2KHV A;  2YTU A;  4DWI A;  3PR4 A;  1ZD5 A;  1SZH A;  2XY5 A;  1D8Y A;  3OWG A;  1WCN A;  1UET A;  4KLS A;  3WK8 A;  4BGD A;  1YZ6 A;  8ICR A;  1S9F A;  1BNP A;  4B9S A;  9ICU A;  3KBB A;  5BPC A;  1KL9 A;  4J9O A;  3BQ2 A;  2MUT A;  4F4Z A;  2BHN A;  2NRW A;  4BDP A;  5D63 A;  2DGZ A;  2ZIW A;  3M8R A;  1DGJ A;  4GC6 A;  3KD3 A;  1NK6 A;  4GIB A;  4X4S A;  2HOQ A;  4KX3 A;  4TUQ A;  4BXO A;  4DSI A;  4YMM A;  5KFG A;  5KFU A;  3T5K A;  3IP4 B;  5KG2 A;  4ECW A;  2FMQ A;  4QZA A;  2KD1 A;  3FC4 A;  4EEK A;  3GU3 A;  3AEV A;  4IC9 A;  5ALM A;  4LVS A;  7ICV A;  4O9M A;  5F2V O;  3ONN A;  1SB3 C;  2ZTD A;  1QH9 A;  4UBB A;  2Y1I A;  1T3N A;  2LBO A;  2QB0 A;  1BVS A;  1Z4N A;  3FAH A;  4UAZ A;  4GXI A;  4DF8 A;  3H8W A;  4DSL A;  1VJ7 A;  4F5N A;  3PW2 A;  5ALR A;  4EEB A;  3E2E A;  3TAC B;  3M8S A;  7ICN A;  2XY6 A;  4F2S A;  4AT9 A;  4DOA A;  1ZQX A;  2JXJ A;  2W11 A;  4DL3 A;  3B0Y A;  3K1R B;  3IDW A;  3D2Q A;  3RAQ A;  4M04 A;  7ICE A;  5AIA A;  3OUY B;  2YMP A;  2RHF A;  3PO5 A;  2HHQ A;  1OU5 A;  4QIW C;  5ALY A;  5ALU A;  4F72 A;  4Y2V A;  2Q4T A;  3C2K A;  2VA8 A;  2ZUC A;  4OD0 A;  2BPG A;  3AQE A;  5FP0 A;  1YT3 A;  1LKY B;  5B3P A;  2BQU A;  1T4G A;  2PKE A;  2HHX A;  4EZ9 A;  1PUZ A;  1P7D A;  1ZQV A;  3TAD A;  4RPX A;  4DLG A;  2XGQ A;  2NRK A;  2HDO A;  1DK2 A;  2GH1 A;  4WQK A;  3T3F A;  2OHF A;  4Q8E A;  1U48 A;  1NKC A;  3PX0 A;  4G9B A;  2LMR A;  3U26 A;  3IRU A;  3WKB A;  4K4H A;  1N61 A;  5J0P A;  4DSK A;  4MFC A;  3D6J A;  3OHA A;  5KFB A;  4DSE A;  3HPO A;  4X4N A;  1RPL A;  4IQW A;  5ALT A;  3TAD C;  4FHP A;  3H4D A;  2DWQ A;  1N60 A;  3KOO A;  3ISC A;  2QKQ A;  2PFN A;  3GV8 B;  1B22 A;  8ICN A;  5DQH A;  3F53 A;  3NRZ A;  2D6F C;  4CCH A;  2UVR A;  1ZQD A;  2W43 A;  5AM2 A;  1WYG A;  5J0Y A;  2JHD A;  4JK1 A;  2WHE A;  4AYB F;  2HHU A;  5EWE A;  2DKZ A;  1NZP A;  1UEV A;  4GXJ A;  7ICM A;  4UAU A;  3AU2 A;  4I27 A;  5J2D A;  3N7R C;  5KFF A;  4RQ6 A;  4ECY A;  1JRO A;  3CP8 A;  2P6R A;  2DR7 A;  5ALJ A;  1JXE A;  5CHG A;  3CK6 A;  1SL2 A;  2A19 A;  2EZZ A;  3MR2 A;  3QXG A;  2W9C B;  4TUS A;  1C20 A;  3IV6 A;  5CFS A;  2DPJ A;  4J9K A;  4I2J A;  1JXL A;  2JZB B;  2B6G A;  2ZHA A;  1O08 A;  2G08 A;  4US9 A;  1L6N A;  4DEZ A;  2BQ3 A;  2HBL A;  1COO A;  3PMN A;  9ICK A;  4MF8 A;  5ALD A;  4CRX A;  4RQ7 A;  1MN8 A;  2R8I A;  4XUS A;  2C2R A;  4I2C A;  1S0V A;  5L1L A;  4I28 A;  5KFE A;  4B9T A;  4RUC A;  3Q8Q B;  3M6K A;  1KW4 A;  5L1I A;  3QUQ A;  3WKE A;  4TUP A;  1VLB A;  1ZQR A;  8ICA A;  3BQT A;  5J0X A;  4KLM A;  2VJ4 A;  2DL0 A;  5KFO A;  4FO6 A;  3PX4 A;  4FFD A;  1H38 A;  3WKA A;  2FLL A;  8ICH A;  2K8B B;  4I2F A;  5ALI A;  4C4T A;  1X6I A;  4QZC A;  1PK1 B;  2F8K A;  2O5A A;  2JEG A;  4O3O A;  1L7N A;  1J2N A;  3O0F A;  4IQU A;  5J2H A;  3SR6 A;  1WCL A;  1QLN A;  1UA0 A;  2OEH A;  3N28 A;  5J2E A;  3M6Z A;  8ICW A;  3RR7 A;  2BPC A;  4F71 A;  2UVV A;  1U45 A;  2W3R A;  1NK7 A;  5K4L A;  5AM4 A;  3H0L B;  5KFI A;  8ICK A;  3NVV A;  3OHB A;  4BXO B;  2HCF A;  5DEC A;  1QQ5 A;  4A8E A;  3ER8 C;  5KG5 A;  4UB1 A;  2P35 A;  4ELT A;  2MSN A;  3PR5 B;  1S0M A;  1Q3U A;  3RFA A;  4HX0 A;  4EYI B;  2K4P A;  2N1R A;  1MSW D;  3RJG A;  3EZ5 A;  3WFR E;  5J0R A;  2KFZ A;  2HHW A;  5AM5 A;  1ECW A;  3C2M A;  5DB6 A;  3V7J A;  5DGA A;  3PO4 A;  1WWU A;  2AQ4 A;  3RJK A;  2Y1J A;  2G06 A;  3PW5 A;  1ZD4 A;  5KT4 A;  3WK9 A;  1XC9 A;  3TQ1 A;  2EDU A;  2VA2 A;  4UBC A;  3QU4 A;  4Y2J A;  9ICV A;  3SAF A;  2ZH6 A;  4YP3 A;  3F2B A;  4P0Q B;  1PVP A;  3OV7 A;  2BDP A;  2F1H A;  1PK3 A;  3H37 A;  1TAQ A;  4Y2S A;  4E0D A;  3T5H A;  1IG6 A;  4NL9 C;  4RQ1 A;  3TAQ A;  4E7X A;  5KAI U;  1TK8 A;  3RB0 A;  3JPS A;  3B0X A;  5DBB A;  1ZQK A;  1Y88 A;  1MIY A;  4M9L A;  3RJF A;  3A0H U;  3I76 A;  4O5E A;  3PW7 A;  2FE9 A;  1PVR A;  4U7C A;  2AHO B;  4ACO A;  4YG2 A;  4QZ8 A;  4B9V A;  3H0M B;  3MR6 A;  3SV3 A;  2PI4 A;  2DR8 A;  2KSO B;  5J2G A;  4IRK A;  4J9S A;  1L3U A;  2AXT U;  2KHQ A;  2W9A A;  1SKR A;  2GO7 A;  2VAN A;  2OM6 A;  1ZQI A;  1D9D A;  2V4R A;  4WC5 A;  2DUY A;  4NXT A;  4RQM A;  1F5A A;  2F1J A;  2HHT A;  3K75 D;  4QIW F;  2AGP A;  2ZJ8 A;  2ZHB A;  3RJJ A;  1PK1 A;  3PW4 A;  3RH5 A;  2IOF A;  2RRD A;  5ALH A;  1QCK A;  4F91 B;  3C28 A;  4BX9 C;  3NVY A;  1TFR A;  2B0C A;  1S97 A;  2HHV A;  2I5H A;  4KLJ A;  1JN3 A;  3LQC B;  4AT8 B;  3F5A A;  2R8H A;  3QU5 A;  1RQN A;  4R8U B;  3Q8M A;  1ZQF A;  2CXY A;  3V7L A;  5KFK A;  2K4E A;  1V85 A;  4EX7 A;  3QEA Z;  5AKJ A;  2D3D A;  4RT2 A;  5DKW A;  1T3Q A;  5DB9 A;  1R8A A;  4O6A A;  1Z1B A;  3SYZ A;  1ZQW A;  1X66 A;  3DEE A;  5CB1 A;  3OVB A;  3RBE A;  2KN7 A;  3KHH A;  1MQ3 A;  5HRI A;  3H7I A;  2HN2 A;  1UCV A;  2QB1 A;  1QSL A;  4DL7 A;  3HIY A;  1X9S A;  2LHT A;  2H3V A;  4NKU A;  1ED1 A;  4YFK A;  1L7M A;  2WF7 A;  2IOF K;  4ECQ A;  3QZ7 A;  4F4W A;  4F4K A;  4P0P A;  3PY8 A;  9ICI A;  4Y2P A;  4I0U A;  4QNL A;  3SZ2 A;  3HIL A;  4DFJ A;  4KLH A;  2VJ5 A;  5AKY A;  5AKZ A;  2PFO A;  4EEN A;  3NVW A;  3ISB A;  4KLD A;  4DFK A;  3H3A A;  3SV4 A;  4N7R A;  3V6K A;  4FZL A;  5L1M A;  5AIC A;  2AU0 A;  1MQ2 A;  4E8F A;  5E79 U;  5KT3 A;  8ICM A;  5KFD A;  3GIL A;  2ZIV A;  1ZRM A;  5J0W A;  3KHG A;  4OAI Z;  4YXM A;  3N97 B;  5EE9 A;  2J6T A;  4XQ7 A;  4K9A A;  1MC8 A;  4RWP A;  3BZK A;  5BOM A;  1NKE A;  8ICL A;  5B5E U;  2UVU A;  5DDY A;  1BNO A;  2HOI A;  2ZXH A;  4PGQ A; 
#chains in the Genus database with same CATH homology
 4QWC A;  4F5N A;  3FDS A;  2VA3 A;  3PW2 A;  5HP4 A;  3E2E A;  4ATB A;  1NK4 A;  1L5U A;  3M8S A;  4YR3 A;  3THV A;  2XY6 A;  4F2S A;  7ICN A;  9ICJ A;  4DSJ A;  4DOA A;  1ZQX A;  5HRG A;  4AT9 A;  2ZH7 A;  5HRF A;  4DL3 A;  3B0Y A;  3H38 A;  1ZQE A;  3GFK B;  2FPL A;  3EWA A;  4NKT A;  1D9F A;  3LWM A;  9ICT A;  4RZR A;  3RAQ A;  3RB4 A;  1ZQH A;  4M04 A;  3MDA A;  3ISD A;  7ICE A;  3ZD9 A;  9ICF A;  3OUY B;  3OVS A;  5CA7 A;  1RXW A;  3KHR A;  3PO5 A;  4WBZ A;  2M9N A;  5J2A A;  4K4G A;  1TVA A;  2HHQ A;  1OU5 A;  1K1S A;  4QWA A;  4DFM A;  2C28 A;  3JPP A;  3V72 A;  5HHI A;  4C8M A;  4PHE A;  3C66 A;  4DL5 A;  3UPQ A;  4NM2 A;  3C2K A;  4M6W B;  2VA8 A;  3JPR A;  3JYY A;  2ZUC A;  4QZH A;  2BPG A;  4QZF A;  3M9O B;  2OWO A;  4LZD A;  4IG8 A;  3IM1 A;  3PVX A;  4RPZ A;  2BQU A;  4ECT A;  2DRA A;  1V9P A;  1T4G A;  3OSN A;  3WFO A;  2IA6 A;  2HHX A;  2F1I A;  2MUT B;  3RTV A;  4KLT A;  4QZI A;  2R8J A;  4RWN A;  2XC9 A;  4DQI A;  4WC1 A;  4EZ9 A;  5DED A;  5EWG A;  2DR8 A;  1ZQV A;  4E80 A;  4RPX A;  4DLG A;  3Q8R B;  4FHP A;  4KLQ A;  3UPS A;  4DF4 A;  5KG3 A;  2XGQ A;  4O3S A;  1B43 A;  3RR8 A;  2KFN A;  2NRK A;  1DK2 A;  3JPN A;  1DK3 A;  3JPO A;  4ZH4 A;  3T3F A;  4O3R A;  4Q8E A;  4FHW A;  1U48 A;  8ICU A;  1NKC A;  3PX0 A;  4F5P A;  5HRL A;  1JIH A;  5EOZ A;  2C22 A;  3WFS C;  4K4H A;  5J0P A;  4DS4 A;  2A1J B;  4DSK A;  4MFC A;  5KG6 A;  4RQ0 A;  2XCP A;  3OHA A;  4RNN A;  5KFB A;  4DSE A;  1JX4 A;  2P66 A;  3HPO A;  5IIN A;  1RPL A;  3Q8K A;  1UA1 A;  4J9Q A;  5KFA A;  3TFS A;  4EBJ A;  3V6H A;  4ECS A;  3IHQ B;  4FS2 A;  4X4T A;  4YXJ A;  4MEX A;  4UB5 A;  3H40 A;  4IQW A;  4QWE A;  1NK5 A;  4M6W A;  4Q45 A;  5DB7 A;  3H4D A;  1UT8 A;  1LV5 A;  1HUO A;  4GXK A;  3RJH A;  4MFA A;  1ZQJ A;  5KFZ A;  2O1P A;  9ICH A;  4PHA A;  4KLU A;  3ISC A;  1ZQL A;  8ICE A;  4X0A A;  2ISO A;  2PFN A;  4ELV A;  4Q8F A;  3GV8 B;  9ICQ A;  2Q66 A;  5J2C A;  4B9M A;  8ICN A;  1B22 A;  1KTQ A;  5DQH A;  1R89 A;  2ASL A;  3GIK A;  4X4V A;  4JV0 A;  2DR9 A;  3M9M B;  2ZUB A;  2FLN A;  4CCH A;  2XY7 A;  4PHP A;  5DG7 A;  1ZQD A;  2UVR A;  5DLG A;  4I2G A;  3ZD8 A;  2DPI A;  4RPY A;  5KG7 A;  1TKD A;  5KFT A;  1XSL A;  4IQT A;  4JV1 A;  4RT3 A;  4F93 B;  7ICK A;  3TAN A;  4Q43 A;  1XSN A;  5HHH A;  3MR3 A;  4J9R A;  5J0Y A;  4JK1 A;  3PNC A;  3ZDD A;  4ATB B;  3JZ0 A;  2GWS A;  4FS1 A;  8ICZ A;  4GLX A;  1ZQM A;  2HHU A;  2AJQ A;  2W9B B;  5EWE A;  4I2D A;  3RJE A;  5DB8 A;  4YMN A;  5J0U A;  2PI5 A;  4KLL A;  1NZP A;  1UEV A;  4GXJ A;  4ED1 A;  4R65 A;  4DOB A;  5KT5 A;  3AU2 A;  3RB3 A;  5J2D A;  4I27 A;  7ICM A;  4WCW A;  2H5X A;  4Z6E A;  5HML A;  2AGQ A;  3AQN A;  5F9L A;  5KFF A;  1BPB A;  4RQ6 A;  3OJU A;  4ECY A;  4I29 A;  2P6R A;  5KG0 A;  2B21 A;  3BJY A;  4C8L A;  2DR7 A;  2ASJ A;  1JQR A;  3K4G A;  1JXE A;  1KFS A;  4LT6 A;  5CHG A;  9ICS A;  4MF2 A;  1SL2 A;  3LK9 A;  5D4B A;  1S76 D;  9ICM A;  1RXV A;  4F5O A;  1S0N A;  2I1Q A;  4FBT A;  4JWM A;  1XU4 A;  3MR2 A;  4FH5 A;  1ZQA A;  2XCA A;  2W9C B;  1PZN A;  3V6J A;  4DSF A;  3AU6 A;  4TUS A;  1NJY A;  1WOT A;  5J0S A;  5J2K A;  3C21 A;  4C8K A;  2ZH8 A;  4O3P A;  3RH4 A;  4J9N A;  3ZDA A;  8ICI A;  5HR9 A;  2DPJ A;  4J9K A;  4O0I A;  4I2H A;  5KT6 A;  4I2J A;  5D49 A;  1JXL A;  2IBK A;  4MEY A;  5KFL A;  3Q8P B;  4RQ5 A;  2JZB B;  4J9P A;  2ZHA A;  1BPD A;  4MFF A;  1U49 A;  3FYH A;  5KFQ A;  4PGX A;  1KFT A;  1ZET A;  4DEZ A;  2AGO A;  3RBD A;  1X2I A;  4ED0 A;  1X9W A;  8ICY A;  4WC7 A;  2BQ3 A;  1COO A;  3PMN A;  9ICK A;  4MF8 A;  4JV2 A;  4RUA A;  1KFD A;  1A77 A;  4RQ7 A;  2R8I A;  4XUS A;  2C2R A;  5CR0 A;  1SL0 A;  4R64 A;  2W8L A;  4I2C A;  4PHD A;  1KLN A;  5L1L A;  4I28 A;  5KFE A;  2LYH A;  3C23 A;  4RUC A;  3Q8Q B;  4ECZ A;  3UQ0 A;  2NRV A;  3OJS A;  5J0T A;  4B9T A;  4M9N A;  1TAU A;  4RNO A;  2W9C A;  8ICF A;  1R8B A;  3MDC A;  4FBU A;  3BQ0 A;  4I2B A;  5IIM A;  1BPZ A;  4TQR A;  5DGB A;  3Q8S B;  5L1I A;  5IIJ A;  1S77 D;  4TUP A;  5HRI A;  4ED6 A;  1XSP A;  1ZQR A;  4FH3 A;  4B9L A;  5CJ7 A;  3UXP A;  1TFY A;  4S3N A;  8ICA A;  3BQT A;  4O3Q A;  5KFC A;  5J0X A;  4KLM A;  5KFO A;  4FO6 A;  3AQL A;  3PX4 A;  4DL6 A;  1H38 A;  1BGX T;  5DBA A;  2FLL A;  1BPE A;  8ICG A;  8ICH A;  1FA0 A;  3ZDC A;  9ICR A;  4ED3 A;  4I2F A;  8ICJ A;  4QZC A;  3G6Y A;  4M47 A;  8ICB A;  2WTF A;  3TAR A;  2C2D A;  2JEG A;  4O3O A;  2O5A A;  8ICC A;  2PFP A;  2M2T A;  4WC0 A;  4QZG A;  1Q78 A;  4IQU A;  9ICE A;  5HRK A;  4X0B A;  5J2H A;  2BCV A;  4EZ6 A;  1ZJN A;  1WCL A;  3GDX A;  4YCX A;  1QLN A;  1UA0 A;  2IMW P;  2NRX A;  3HP6 A;  3V7K A;  3QE9 Y;  4DLE A;  1S10 A;  2DVI A;  1T8E A;  4AT7 B;  4QW8 A;  3PW0 A;  5J2E A;  8ICW A;  2ISP A;  1NJW A;  1S0O A;  2BPC A;  1ZQB A;  3RR7 A;  3C18 A;  4G3I A;  2UVV A;  1U45 A;  1NK7 A;  2RDJ A;  1QSS A;  4R8U A;  5KFH A;  4DO9 A;  5C5J A;  4M9J A;  2FLP A;  4NY8 A;  4JUZ A;  1MIW A;  4QWB A;  9ICL A;  5KFI A;  8ICK A;  4EYH B;  4NLZ A;  2JZB A;  1CEZ A;  4EP7 A;  4XA5 A;  2XO7 A;  2BE3 A;  3OHB A;  4QZ9 A;  4B9N A;  4BXO B;  4P4O A;  3UXN A;  3NYB A;  2PXI A;  5DEC A;  1TK5 A;  1NOM A;  4X4U A;  3RAX A;  4RWQ A;  7ICG A;  4TUR A;  5KT2 A;  2ZTC A;  7ICJ A;  4DOC A;  2A1J A;  4KN7 A;  1D8L A;  4YD1 A;  5KG5 A;  3G6V A;  1ZQP A;  4QW9 A;  2ALZ A;  4UB1 A;  4ELT A;  4UB4 A;  3PR5 B;  4R66 A;  4P2H A;  3SI8 A;  5KG4 A;  1ZQQ A;  4F2R A;  4RU9 A;  3H8J A;  2XGP A;  1S0M A;  1Z00 A;  4DQP A;  4EYI B;  4XQ8 A;  4EBE A;  4YR0 A;  1Z3E B;  2HW3 A;  3GIM A;  7ICT A;  9ICW A;  3AQK A;  3HW8 A;  3PX6 A;  4PGY A;  1MSW D;  4NLK A;  2ZH5 A;  3MFI A;  3RJG A;  2ZUD A;  3EZ5 A;  3AUO A;  1V4A A;  5KFW A;  4X4R A;  3WFR E;  2ZH4 A;  2JEI A;  5J0R A;  2KFZ A;  1R8C A;  3TI0 A;  2HHW A;  3GQC A;  3ETL A;  4F4X A;  2RFF A;  1TK0 A;  4F3O A;  1HJP A;  3C2M A;  2FMS A;  8ICS A;  1ZQZ A;  5III A;  4ED2 A;  7ICI A;  5DB6 A;  3V7J A;  2KZ3 A;  5DGA A;  3PO4 A;  4M9G A;  2UVW A;  2PBE A;  2AQ4 A;  2ZH3 A;  2BQR A;  3RJK A;  4F5Q A;  1K1Q A;  1UT5 A;  4Z6D A;  2Y1J A;  1QSY A;  2IHN A;  8ICO A;  3HJ1 A;  3PW5 A;  4RWO A;  3HX0 A;  2DFL A;  1ZJM A;  2JEJ A;  4YN4 A;  4KTQ A;  5KT4 A;  2FPM A;  1XO1 A;  1ZQY A;  5F9N A;  3OUY A;  2V4Q A;  2R8K A;  5KFM A;  1U47 A;  1XC9 A;  3T5L A;  2MAX A;  3TQ1 A;  1L3S A;  2ZH9 A;  2VA2 A;  1U4B A;  4DQS A;  4UBC A;  3TAP A;  4O3N A;  4Z6C A;  9ICV A;  4DFP A;  5KFX A;  4DS5 A;  5IIL A;  2ZH6 A;  2ZTE A;  5J0O A;  4KLE A;  5KFN A;  4YP3 A;  3RJI A;  4QZD A;  8ICP A;  4F5R A;  1NK9 A;  3HJ4 A;  7ICL A;  4RQ2 A;  3OV7 A;  1VFG A;  2BDP A;  2F1H A;  3PML A;  4ECU A;  1TV9 A;  3EPG A;  1NK8 A;  4ED7 A;  3ZDB A;  2IHM A;  4PPX A;  5TZV A;  3H37 A;  4EBK A;  1TAQ A;  4E0D A;  4M5D A;  4KMU A;  1C7Y A;  3T5H A;  4KLF A;  4KLI A;  2KZZ A;  2Q0Z X;  5DG9 A;  7ICF A;  4I2I A;  4J9M A;  1KSP A;  3LWL A;  5D46 A;  4RQ1 A;  3TAQ A;  4E7X A;  3LDA A;  3H39 A;  3BQ1 A;  1TK8 A;  3GII A;  3C5F A;  3RB0 A;  1ZYQ A;  2BCS A;  4IRD A;  5J0Q A;  3JPS A;  4DQQ A;  3BDP A;  4F92 B;  3B0X A;  1ZQG A;  3L9D A;  5DBB A;  1ZQK A;  3C2L A;  5HRD A;  1EXN A;  4JWN A;  7ICQ A;  1YLQ A;  4YMO A;  3PV8 A;  4FHX A;  4ECX A;  4YR2 A;  1Y88 A;  1IXR A;  3C1Z A;  3GV7 B;  1MIY A;  4X4N A;  4M9L A;  4C8N A;  7ICH A;  2R8G A;  4J9L A;  3RJF A;  5HRE A;  1T7P A;  4UD4 A;  2FPK A;  2BGW A;  4O5E A;  1PX5 A;  4IQV A;  3PW7 A;  1XS9 D;  3Q8L A;  2ATL A;  3GIJ A;  1NK0 A;  5DQI A;  8ICT A;  3MBY A;  2NRT A;  4TQS A;  2AQ0 A;  4YG2 A;  2HVI A;  9ICN A;  8ICX A;  2BR0 A;  4QZ8 A;  4R63 A;  4B9V A;  1HUZ A;  4UB2 A;  3MR6 A;  3SV3 A;  5L1J A;  1KRP A;  2J6U A;  2PI4 A;  4IR9 A;  4Z6F A;  5HMM A;  5IIO A;  5KT7 A;  5J2G A;  3JPQ A;  2BKE A;  1SKS A;  4IRK A;  9ICB A;  4J9S A;  1L3U A;  5DDM A;  3HWT A;  5KTQ A;  2W9A A;  3OSP A;  4FHY A;  1SKR A;  2VAN A;  4KIT B;  1ZQI A;  4EBC A;  4RNM A;  1Z00 B;  3C1Y A;  1D9D A;  1KNY A;  1Q79 A;  2V4R A;  9ICO A;  5KFV A;  4RQ4 A;  4WC5 A;  5JUM A;  1IM4 A;  1BPX A;  1F5A A;  2F1J A;  3H4B A;  2P6U A;  5KFJ A;  4P4P A;  5DBC A;  1S0V A;  3K75 D;  1U9L A;  2HHT A;  4WBY A;  2DRB A;  2AGP A;  1DOQ A;  2ZJ8 A;  1X9M A;  1ZQN A;  2ZHB A;  3MFH A;  3RJJ A;  4X4O A;  2ZH1 A;  3PW4 A;  5HNK A;  3KHL A;  3UQ2 A;  3TFR A;  3RH5 A;  1SL1 A;  3MGH A;  2KZM A;  7ICU A;  4XRH A;  2BCR A;  4UB3 A;  4WC6 A;  3ORY A;  4M2Y A;  3RRH A;  4F91 B;  2DR5 A;  3T5J A;  4K4I A;  2M2V A;  2NRZ A;  1TFR A;  1S97 A;  2BCQ A;  2JEF A;  2HHV A;  1QTM A;  4DL2 A;  4KLJ A;  4WC2 A;  5KFS A;  2I9G A;  5KG1 A;  1JN3 A;  4YQW A;  8ICQ A;  3LQC B;  5J2I A;  4AT8 B;  4UQG A;  2R8H A;  3M9N B;  1ZQT A;  5CWR A;  4NLN A;  4F4Y A;  8ICV A;  1RYS A;  9ICA A;  4R8U B;  3OGU A;  3Q8M A;  1ZQF A;  1NO5 A;  5HC9 A;  4O5K A;  1DGS A;  3V7L A;  1RYR A;  5KFK A;  9ICG A;  4B9U A;  5BOL A;  4QWD A;  3QEA Z;  5J2J A;  2ZH2 A;  4YD2 A;  3RB6 A;  2ZJ5 A;  4ECV A;  1KDH A;  4FHV A;  2RDI A;  5EWF A;  4RT2 A;  4Q44 A;  5DKW A;  1CUK A;  5DB9 A;  4LZG A;  1A76 A;  1TFW A;  5KFP A;  1R8A A;  4GXI A;  4ELU A;  1NJX A;  3MAB A;  4DSL A;  2HHP A;  4X4P A;  1L3T A;  3RH6 A;  3SYZ A;  4PH5 A;  1ZQW A;  4M9H A;  1SZP A;  4O5C A;  3EPI A;  3WFP A;  3C5G A;  5J29 A;  4KN4 A;  2ID1 A;  4AT8 A;  3JPT A;  5CB1 A;  3OVB A;  3RBE A;  2KN7 A;  4QZB A;  1L3V A;  2V9W A;  7ICR A;  2C2E A;  1MIV A;  3KHH A;  1MQ3 A;  4M0A A;  3H7I A;  2KP7 A;  4DWI A;  3PR4 A;  2W8K A;  1D8Y A;  2XY5 A;  4RQ8 A;  1WCN A;  3G6X A;  1QSL A;  4NXZ A;  5L9X A;  4DL7 A;  1UET A;  4DL4 A;  3HIY A;  1X9S A;  1UEU A;  1NKB A;  3OVA A;  5KFY A;  3MGI A;  4KLS A;  7ICP A;  5HRH A;  4NKU A;  4YFK A;  3H8S A;  4BGD A;  2HVH A;  2M2W A;  8ICR A;  1S9F A;  1BNP A;  4B9S A;  9ICU A;  3EW9 A;  1N48 A;  2ZJA A;  5BPC A;  4ECQ A;  3QZ7 A;  4J9O A;  4X4Q A;  3BQ2 A;  2MUT A;  4F4W A;  2BHN A;  4F4Z A;  4F4K A;  3NGD A;  2NRW A;  4BDP A;  3AQM A;  3WFQ E;  4NLG A;  4RQ3 A;  1ZQS A;  3PY8 A;  9ICI A;  4QZE A;  2M2U A;  3SZ2 A;  4GC7 A;  2BPF A;  4UAW A;  4DFJ A;  4KLH A;  5HRB A;  3NTU A;  4WC4 A;  3M8R A;  4GC6 A;  7ICS A;  1RZT A;  4I2A A;  5CP2 A;  5DG8 A;  5IIK A;  2W9B A;  1KEJ A;  5KFR A;  1NK6 A;  4IR1 A;  4KLG A;  4ED8 A;  4KLO A;  4X4S A;  4TUQ A;  2PFO A;  4BXO A;  4DSI A;  4HYK A;  5DLF A;  4YMM A;  5KFG A;  5KFU A;  3T5K A;  4EBD A;  3ISB A;  4KLD A;  1ARO P;  4DFK A;  3H3A A;  3SV4 A;  3RRG A;  5KG2 A;  1ZQO A;  2PFQ A;  9ICP A;  4ECW A;  3V6K A;  4AT7 A;  4P4M A;  2FMQ A;  4BWJ A;  1SKW A;  1NJZ A;  2AU0 A;  1MQ2 A;  4IRC A;  4I2E A;  4E8F A;  8ICM A;  5KT3 A;  4QZA A;  3EYZ A;  1ZQU A;  1LB2 B;  7ICO A;  5KFD A;  3QEB Z;  4EEY A;  3GIL A;  7ICV A;  4LVS A;  3ZDE A;  4O9M A;  3MR5 A;  3GV5 B;  1BPY A;  4F8R A;  5F2V O;  5J0W A;  5L1K A;  4WC3 A;  3HT3 A;  2ZTD A;  3QZ8 A;  3KTQ A;  9ICC A;  3KHG A;  1JMS A;  4UBB A;  4BWM A;  2Y1I A;  1N56 A;  1JAJ A;  4YVZ A;  1T3N A;  4YXM A;  2J6S A;  4AT9 B;  4C8O A;  1ZQC A;  2W9M A;  3N97 B;  2J6T A;  4DQR A;  4XQ7 A;  4F50 A;  1MC8 A;  5J2F A;  4UAY A;  4RWP A;  5BOM A;  3N4M B;  1BVS A;  4X5V A;  1NKE A;  2HHS A;  8ICL A;  5DQG A;  5J2B A;  9ICX A;  2ASD A;  2KTQ A;  4UD5 A;  2UVU A;  5DDY A;  3UXO A;  2BCU A;  4UAZ A;  2FMP A;  1BNO A;  4NM1 A;  4ECR A;  3H8W A;  4DF8 A;  4PGQ A;  1XWL A;  1VJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...