5DB6A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dc
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db6A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db6A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db6A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db6A03
9ICKA 1KSPA 4QZEA 4ED8A 4ED7A 1Z00A 3SYZA 4ECZA 5KFRA 4UAWA 3C5GA 5IIKA 2BCRA 4O9MA 5J0UA 3H8SA 5DB7A 1XS9D 4F91B 4ECXA 2JZBA 5KFSA 4UB4A 4K4HA 1WCNA 2ZJAA 3V6KA 4JV1A 1S77D 5IIOA 4PHEA 1UA1A 2PI4A 4KLOA 3H37A 2DR8A 4KLEA 3BQ2A 4P2HA 1TK0A 4HYKA 4K4GA 2M2TA 3RJKA 3HW8A 2FMQA 2FLPA 4QZHA 4DSFA 4YCXA 5KFBA 1BPEA 4UB3A 3MFIA 3GIJA 4KLLA 2FLLA 1ZQTA 4RUAA 5J2JA 4Q44A 4EYIB 2PFQA 2KTQA 4IRKA 4F5OA 4DFMA 3OVAA 5J2HA 4WCWA 4RQ7A 5HRGA 2AJQA 2ASLA 3ETLA 3T5JA 7ICHA 5D49A 3UPSA 2AGOA 1ZQLA 4R65A 2IHNA 2IHMA 3IM1A 4C8KA 4PHAA 2W8LA 4AT8B 4ECUA 2W8KA 5L1LA 4JWMA 1MSWD 9ICXA 4RU9A 4QZAA 3RAQA 4NLZA 2NRXA 5CWRA 5BPCA 3HIYA 4KLSA 8ICRA 3AQKA 4R8UA 5KT4A 4GXKA 3RR8A 1BNOA 4J9OA 4I2DA 1NK4A 4F4YA 4ED1A 2IBKA 8ICBA 4WC6A 2BR0A 2BCQA 2JEJA 4O3QA 3GV8B 3PW0A 4QZIA 3RJFA 5KFMA 4DS4A 1K1QA 3MFHA 1ZQOA 3ZD8A 4PHDA 5KFHA 3KHGA 5TZVA 1NK0A 4M9JA 2HHQA 1ZQAA 4Q45A 2P6UA 1TKDA 5J0QA 4DQPA 5HR9A 3M8RA 4O5CA 4X5VA 3Q8RB 1D9DA 5DBCA 2IA6A 4IQUA 4F2RA 8ICHA 2HHSA 5HP4A 5KG1A 5KG3A 9ICQA 3PO5A 1R8AA 4WC1A 1X9SA 1JQRA 2ZH7A 3PW7A 4B9NA 4YXMA 1MIYA 2FPMA 4DL3A 1MQ2A 4YG2A 2FMPA 4O3RA 7ICQA 4I2IA 4BWMA 4NLGA 2ZH5A 3OJSA 3C21A 4R64A 4ECWA 7ICRA 4AT9B 4WC7A 5J2FA 3MDAA 4RWPA 4F5NA 1KRPA 1RPLA 3C18A 5KT6A 4ED2A 1TK5A 1S76D 3T3FA 3RB6A 2PFOA 4M0AA 2ZJ5A 2JZBB 4YXJA 4E80A 1NKEA 1TV9A 4I27A 1N56A 3HPOA 9ICOA 4RZRA 3V6JA 8ICTA 5CB1A 1JMSA 4RPZA 4ECQA 2ZJ8A 3V6HA 3PR5B 4DF4A 1U45A 2ZTDA 5HRHA 2ZHAA 3GIIA 2HHWA 4RT3A 4RWNA 3RB3A 1SL1A 5DB6A 2DVIA 4WC5A 3RJHA 7ICGA 8ICYA 3MGIA 3WFQE 5BOMA 4FO6A 3JZ0A 3C1YA 1NKBA 4JK1A 4Q43A 4DF8A 3PX6A 4KLFA 1B22A 1S0OA 2KFZA 4B9UA 4F4ZA 1JN3A 4BWJA 3OHBA 4FBTA 4M9LA 4PHPA 5J0XA 4YR0A 1NK8A 2PFPA 3RJEA 3AU2A 3C23A 4EZ9A 5KFLA 3PW4A 4KLQA 4YN4A 3G6VA 2BKEA 3Q8QB 1RYSA 4Q8FA 4X4SA 9ICAA 3QZ8A 1FA0A 2AGPA 1KEJA 1TK8A 2DPJA 1Q79A 2VANA 4UBCA 2Q0ZX 1NK5A 2VA2A 4JV2A 1U4BA 1X9WA 1ZJNA 1NJWA 2F1JA 2C2DA 5KG5A 4F93B 3AUOA 8ICGA 4XUSA 4UQGA 3EPGA 3JPOA 3LQCB 1ZYQA 4KLTA 4QZGA 5KFGA 1QSSA 3M9NB 5KG2A 3RTVA 1SKWA 4F4KA 7ICMA 4KLDA 5D46A 4O5KA 3QEBZ 2C2RA 4TURA 2XY7A 2P66A 5F9LA 3JYYA 2ZUDA 4LZDA 1JXLA 3OSPA 3WFOA 4DO9A 4WC3A 1S10A 3PNCA 9ICSA 2FMSA 2W9CB 3IHQB 3TQ1A 4X4TA 5L1JA 3MGHA 1IM4A 1WCLA 3GFKB 3MDCA 5L1KA 4UAZA 8ICZA 4X0AA 4X4RA 4X4QA 3V72A 4EBEA 1NJYA 4MEYA 4YR3A 4P4PA 1L5UA 4WC0A 1SL0A 2ASJA 4M6WA 4DL5A 2KN7A 3RJJA 2BPGA 4F50A 2XY5A 4RQ3A 3TAPA 2ZTCA 1XSLA 1BPZA 1XU4A 1R8BA 4XRHA 1MC8A 4I2FA 5J2AA 1HUOA 4LT6A 3ORYA 3KHRA 7ICNA 3JPPA 4RQ8A 4TUQA 4RT2A 5DLFA 3QE9Y 2R8GA 1DK2A 4J9RA 3AQMA 4Z6FA 3ZDAA 4FS2A 4F4XA 4EBDA 3HP6A 4CCHA 4EEYA 9ICMA 4EP7A 1AROP 2DRAA 2ID1A 2ALZA 4RPXA 5EWGA 4GC6A 3HJ4A 3SI8A 8ICSA 2FLNA 4G3IA 2MAXA 3QZ7A 5KFCA 3RH5A 2FPLA 3UXOA 2BQRA 1ZQBA 3M8SA 4M9HA 4KMUA 1UETA 4GXIA 5D4BA 1ZQGA 7ICVA 2FPKA 3HWTA 3MR5A 3BQ0A 8ICWA 4ECSA 2BPCA 1JIHA 3ZDEA 2BCVA 2OWOA 4FH3A 4O3NA 3ZDCA 1Z3EB 3PW2A 1ZQZA 3PX0A 9ICTA 1TFRA 5J0OA 4UB5A 2XCAA 2RDIA 4O0IA 1YLQA 4FHYA 1L3VA 2LYHA 4DL7A 1VFGA 4YVZA 4NY8A 3LWLA 5KFJA 2M2WA 4I2JA 4RPYA 3LK9A 4XA5A 4J9SA 2XGQA 2HHVA 3OV7A 1NO5A 4I29A 4R66A 4WBYA 1RXVA 2J6UA 3C66A 5CJ7A 1SKSA 3H7IA 5DLGA 4UBBA 5DG8A 8ICAA 2RDJA 5KFAA 4UD5A 4NKUA 3MR3A 4NKTA 5J0TA 1A76A 5J0WA 5BOLA 1UA0A 5IIJA 1MQ3A 4C8OA 4I2BA 5J2KA 9ICGA 4DFKA 1KFDA 4C8NA 1U9LA 4AT7A 3ZD9A 2XCPA 4KLJA 4I2HA 4FHXA 1ZQUA 5KFKA 2W9BB 2W9CA 4DL6A 4M6WB 1BGXT 3ISBA 2UVVA 4Z6CA 4NLNA 5KG6A 5HMMA 1S97A 4PGQA 7ICOA 4RUCA 1NOMA 1LV5A 4KN4A 8ICIA 5DQHA 1COOA 4Z6EA 3ZDBA 1CEZA 3N97B 5F2VO 5KT7A 1S9FA 4IR1A 3OVSA 1UT8A 2XC9A 5CA7A 4ATBB 5HC9A 4X0BA 4X4NA 4ED3A 1QTMA 3OHAA 5KG4A 3AQNA 3TARA 1NJZA 4RQ2A 3RH4A 4BDPA 1X9MA 1L3UA 5KFZA 3V7JA 4RQ5A 4KTQA 3EYZA 5IINA 1TAQA 2PBEA 3H8WA 2DRBA 4MF8A 4F5PA 2C22A 4EBCA 2NRVA 4B9LA 3PX4A 2XY6A 5KT2A 5DDYA 4NM2A 4PPXA 2HW3A 8ICOA 8ICMA 4QWBA 4MFFA 4Z6DA 4FHWA 3MBYA 4QW8A 3NTUA 3C2LA 5HRDA 2HVIA 2BQUA 5DBBA 5J2BA 4DQRA 2V9WA 9ICLA 3OUYB 1A77A 3EWAA 5J0YA 1TFWA 3OVBA 5HMLA 4I2EA 3EPIA 5J0PA 1BPDA 1WOTA 1XSNA 4B9VA 3GV7B 3JPNA 1JX4A 3T5KA 4NXZA 2XGPA 1SZPA 4C8MA 1T3NA 4DQIA 4M47A 9ICRA 1KFTA 4DL4A 2BE3A 2ZH3A 1RXWA 3H40A 4F3OA 1HJPA 4MEXA 4E7XA 4DSEA 4ED6A 2HHPA 5EWEA 1N48A 4FHPA 3C2MA 1BNPA 7ICEA 5DGAA 5HRKA 4YMNA 3ZDDA 1UEVA 4IQWA 3EZ5A 4UD4A 3PMNA 2ASDA 4DSLA 2ZH1A 1BPYA 3TFRA 4P4OA 2JEFA 4TQSA 3HJ1A 5KFXA 1QLNA 4C8LA 1QSYA 9ICIA 5J2GA 4ELUA 4F92B 4O3SA 1QSLA 4R63A 2BPFA 8ICFA 3RJGA 3PV8A 1VJ7A 3TANA 7ICUA 4AT7B 4J9NA 5KFTA 3PR4A 4DWIA 2NRZA 9ICNA 1H38A 2J6SA 2KZ3A 8ICEA 4F4WA 2RFFA 3ISDA 4M2YA 1Y88A 4FS1A 3GQCA 1ZQNA 3GIMA 2Q66A 4IG8A 4JUZA 2W9BA 3LWMA 4QWDA 3GDXA 4Q8EA 4KN7A 3TI0A 5L1IA 2ATLA 3RRHA 4I2CA 3H8JA 3GILA 5HHIA 4YR2A 3BDPA 9ICPA 5HRLA 4O3PA 3AQLA 1C7YA 2Y1IA 4DSJA 2DR7A 5KFNA 2V4QA 4E8FA 5CHGA 2PXIA 4M04A 5DGBA 4X4UA 2F1IA 3TFSA 1V9PA 4UB1A 4ATBA 1KTQA 5KFUA 3MR6A 1S0MA 3ISCA 2ZUCA 4ECVA 3BQ1A 3SV4A 4F8RA 9ICEA 1ZQHA 2AQ0A 2DR5A 7ICTA 1NK7A 3Q8KA 3N4MB 4EBKA 2NRWA 4XQ7A 2ZH8A 4ECTA 2R8JA 4WBZA 5DQGA 4O3OA 3UPQA 4IQVA 2DFLA 5EWFA 1ZQDA 5L9XA 1ZQPA 3Q8MA 2PFNA 1BVSA 4MFAA 1ZETA 4I28A 1R8CA 4BXOA 3Q8PB 2O1PA 4BGDA 5JUMA 1ZQIA 1S0NA 2UVWA 4F5QA 4NM1A 3MR2A 2R8HA 3OUYA 2UVUA 4J9LA 2MUTA 4MFCA 4RQ0A 2XO7A 1TVAA 2ISOA 1U49A 9ICFA 2JEIA 5HREA 1EXNA 2M9NA 1ZQRA 4QZBA 1ZQQA 4YD1A 3PMLA 3C5FA 3LDAA 1LB2B 2HHTA 4KLHA 4RNOA 4S3NA 3GIKA 1RYRA 4DOAA 1BPXA 1L3TA 4UB2A 9ICHA 2J6TA 1B43A 2AU0A 1XWLA 4YMOA 4DFJA 4UAYA 3Q8LA 5KG0A 3WFPA 3RB4A 7ICIA 2VA8A 8ICUA 3G6YA 4IQTA 3PVXA 5F9NA 2A1JA 3THVA 5CP2A 1D8YA 4YD2A 5DG9A 2WTFA 1KDHA 2BDPA 9ICCA 3H3AA 1ZQWA 1ZQFA 4O5EA 2I1QA 1UT5A 5KFYA 3OSNA 3KHLA 3RAXA 1RZTA 1ZQSA 2VA3A 4EBJA 3QEAZ 2ZH2A 1NJXA 4ZH4A 9ICJA 3M9OB 4IRDA 3B0XA 4QZDA 3JPQA 3C2KA 4J9QA 4DLGA 3V7KA 2BGWA 1U48A 1ZQMA 4RNNA 2BCSA 2HVHA 5KFPA 4WC2A 4TQRA 1NK9A 5DB9A 5C5JA 5KFWA 4PGYA 3K4GA 4LVSA 1KFSA 7ICSA 4DOBA 3OJUA 4WC4A 5HNKA 3RB0A 3JPRA 4ELVA 5KT5A 4B9MA 4I2GA 4QW9A 4DQSA 1TFYA 3MABA 3JPTA 3TAQA 1ZJMA 5J2EA 3M9MB 4J9MA 5CR0A 2B21A 2BCUA 1PX5A 4YFKA 3RJIA 2DR9A 2R8KA 1BPBA 5DEDA 4X4PA 8ICKA 1XC9A 3T5HA 4IRCA 8ICCA 5HRBA 2NRTA 9ICBA 1T4GA 3T5LA 1XSPA 3H4DA 4YQWA 4B9TA 4QZCA 4RWOA 3BJYA 4DOCA 5IILA 5J2DA 5HHHA 9ICUA 5KTQA 4DSKA 3H38A 4BXOB 4PH5A 2F1HA 3K75D 3G6XA 1DGSA 4ELTA 1TAUA 3V7LA 4P4MA 1K1SA 4KITB 4J9PA 3RRGA 2KZMA 4QWEA 1U47A 4FHVA 5KFEA 2MUTB 2W9MA 3NGDA 3L9DA 5DB8A 1Z00B 4QZ9A 3C1ZA 4GLXA 7ICKA 7ICJA 4TUSA 4M9NA 1DK3A 4YP3A 1ZQJA 7ICFA 2BQ3A 2AGQA 1IXRA 3KTQA 2ZH6A 2BHNA 4QWCA 2ZUBA 3RH6A 2ISPA 3FYHA 1NKCA 2JEGA 4EZ6A 4K4IA 4IR9A 4PGXA 1ZQYA 8ICXA 5EOZA 5J29A 4M5DA 3PW5A 1PZNA 4KLMA 1ZQCA 1X2IA 4JV0A 3KHHA 2M2VA 5KFOA 4KLUA 1V4AA 3NYBA 3RBDA 1D9FA 4DSIA 2PI5A 2I9GA 5KT3A 2GWSA 1SKRA 3JPSA 4ED0A 2C2EA 4GC7A 4DL2A 3PY8A 2KP7A 1MIVA 2ZHBA 2A1JB 4YMMA 5J2CA 1SL2A 4FBUA 4J9KA 1T7PA 2HHXA 1D8LA 4E0DA 2IMWP 4QZFA 4MF2A 4TUPA 4DLEA 5KFDA 1NK6A 3HX0A 3H4BA 4KLIA 1KNYA 2C28A 3WFSC 5DDMA 5DBAA 5HRIA 3UXPA 1L3SA 4RQ1A 3RR7A 4R8UB 1ZQEA 1UEUA 4ECYA 4B9SA 4I2AA 3B0YA 2M2UA 7ICLA 4AT8A 3UQ0A 1JXEA 5J0RA 3GV5B 3SZ2A 2W9AA 8ICQA 1JAJA 5KFFA 5DECA 4X4OA 1CUKA 1XO1A 3RBEA 4DQQA 7ICPA 2ZH9A 4DEZA 3Q8SB 3SV3A 4RNMA 4GXJA 2AQ4A 3UXNA 4QZ8A 4QWAA 3UQ2A 5KFIA 1MIWA 1T8EA 5KFQA 1Q78A 5HRFA 1R89A 4RQ6A 4RWQA 3FDSA 1KLNA 4F2SA 2Y1JA 5J2IA 4F5RA 1F5AA 3WFRE 2KZZA 3H39A 4NLKA 4EYHB 2P6RA 8ICLA 5IIIA 2KFNA 2HHUA 3BQTA 1OU5A 4FH5A 2DPIA 4JWNA 4M9GA 9ICWA 9ICVA 2NRKA 4DS5A 8ICNA 5KFVA 1DOQA 1ZQKA 8ICVA 2O5AA 5KG7A 4RQ4A 2ZH4A 4LZGA 1S0VA 2V4RA 3PO4A 2H5XA 1ZQVA 5IIMA 4X4VA 3EW9A 5DQIA 1ZQXA 5J0SA 1HUZA 8ICJA 3HT3A 3AU6A 2R8IA 1NZPA 3E2EA 2UVRA 2ZTEA 4XQ8A 4ECRA 3OGUA 4DFPA 4AT9A 4KLGA 5DKWA 8ICPA 5DG7A
chains in the Genus database with same CATH superfamily
4QZEA 4AYBF 4ED8A 3C5GA 5IIKA 5J0UA 3H8SA 5DB7A 1XS9D 4K4HA 2JZBA 2ZJAA 2NYVA 4K8VA 3BQ2A 3ER8C 2FLPA 4QZHA 4DSFA 2JH1A 3VC8A 3MFIA 2HN2A 4RUAA 5J2JA 4Q44A 4IRKA 4F5OA 4DFMA 4LEZA 4RQ7A 2AJQA 3F2DA 2ASLA 3ETLA 3N7RC 4PL1A 2G06A 1X6IA 2LYAA 1ZQLA 2IHMA 4NWIA 2W8LA 1HIWA 1MN8A 2W8KA 4AT8B 2DUYA 3RAQA 2EQYA 2Y9UA 3RR8A 1BNOA 4ICAA 2IBKA 4F4YA 4ED1A 5EE1A 2JHDA 2BCQA 3GV8B 3PW0A 5KFMA 1ZQOA 3ZD8A 3KHGA 5TZVA 4M9JA 2W7OA 3KBBA 4UAVA 2P6UA 5J0QA 4X5VA 2IA6A 5DBCA 2HBKA 2Z7JA 1X6JA 4YXMA 5AIBA 2LKYA 2ODGA 4DL3A 5ALSA 4ECWA 4AT9B 2IUBA 4WC7A 2DWQA 1RPLA 4ED2A 3T3FA 1SWWA 4YXJA 3D6JA 1NKEA 4FFDA 5AM1A 1B0XA 2RRDA 3HPOA 4KX5A 3V6JA 5CB1A 1JMSA 4RPZA 3V6HA 2HHWA 2FI1A 1SL1A 2DVIA 4WC5A 8ICYA 3WFQE 4Q43A 3PX6A 1S0OA 3UMCA 4B9UA 1JN3A 4P0PA 4PHPA 3RJEA 3I1YA 4EZ9A 2FJ6A 2HOIA 3WKDA 1RYSA 2W03A 4X4SA 1UQVA 3QZ8A 3QUBA 2DPJA 2WF6A 5J8YC 4DCCA 2ZIXB 3NVYA 1U4BA 2DL0A 1LVHA 4F93B 3HKZF 1PK1B 5KFGA 1QSSA 2QKQA 1F5AA 4F4KA 7ICMA 4TURA 5F9LA 4U6PA 2ZUDA 3H8MA 2B51A 3WFOA 2ZXHA 4WC3A 9ICSA 2W9CB 3MGHA 1IM4A 1WCLA 3V72A 1JRPA 4YR3A 3RJJA 1X40A 3NS1A 3GU3A 2BPGA 2G5IB 2ZTCA 5ALXA 5ALNA 5J2AA 1HUOA 3ORYA 3PSFA 3JPPA 2L5YA 4RQ8A 4RT2A 5DLFA 4EBDA 4EP7A 5ALFA 3L3FX 5EWGA 1OW5A 2DQNB 2W04A 2FPLA 4KMUA 2MSNA 7ICVA 5AKGA 1F5SA 3BQ0A 8ICWA 1JIHA 5D61A 2OWOA 2W54A 2PMZC 3PW2A 1ZQZA 5HR7A 4ZOHC 1TFRA 5J0OA 4O0IA 4DL7A 1VFGA 4YVZA 4RPYA 4J9SA 2K60A 5HR6A 2Q4TA 5CJ7A 1SKSA 4UBBA 4NKUA 1COKA 1TE2A 5J0TA 1A76A 1MQ3A 1UA0A 4OJOA 2KNJA 5J2KA 3ZD9A 4FHXA 1ZQUA 2JGAA 5KFKA 4Z6CA 4PGQA 4KM5A 2E1EA 4KN4A 1F0MA 2HBLA 8ICIA 5DQHA 1ZD2P 2KVSA 5KT7A 1S9FA 1UT8A 4ATBB 4X0BA 1QTMA 5K4LA 5KG4A 2K4IA 1NJZA 4RQ2A 2I5HA 4MKPA 1X9MA 3IP4B 4KTQA 3H8WA 4XJEA 4F5PA 4EBCA 2KJ5A 4IS7A 5DDYA 8ICMA 2W7PA 3B9JA 3MBYA 4QW8A 4F72A 5DBBA 1F44A 3OUYB 1N2XA 5J0YA 3CRXA 2K4EA 5J0PA 5GTIU 2YMMA 4DQIA 3AQEA 1KFTA 5KAFU 1HJPA 4MEXA 2XVTA 4WJ3B 5CFSA 5EWEA 1KL9A 2ZIVB 1Q46A 4UAUA 1BNPA 5HRKA 5CFTA 3ZDDA 1DGJA 4IQWA 2KSOB 1QLNA 2VKQA 4F92B 4O3SA 1QSLA 1VJ7A 3PV8A 3TANA 4AT7B 4J9NA 1Q8KA 4C4RA 1VJ5A 1H38A 1SGGA 2EANA 4M2YA 1J97A 2K89A 3GQCA 1ZQNA 4NXWA 2Y9TA 2YMPA 4I2CA 3H8JA 2EAPA 3NUQA 3BDPA 3EUB2 4E8FA 5B5EU 4MHVA 3QNMA 2F1IA 4UB1A 3MR6A 2LBOA 4EEDA 1MA7A 3M1YA 3Q8KA 4K9AA 3N4MB 2F77X 1ZQDA 2P35A 5D62A 2JRZA 3Q8MA 4MFAA 2O1PA 3PHZA 2HDOA 2E3TA 1U49A 4OD0A 4YD1A 2KD1A 5ALEA 1BPXA 2J6TA 1B43A 2AU0A 4UAYA 3WFPA 4BX9C 2VA8A 8ICUA 2ZIWB 3G6YA 3PVXA 1D8YA 2E8OA 1ZQWA 2ZIUB 1UT5A 3KHLA 1WWVA 3OSNA 2VA3A 1RZTA 1NJXA 4ZH4A 3M9OB 3C2KA 2BGWA 4EGWA 4RNNA 3U26A 1LKYB 3OWGA 2EDUA 5HNKA 2HI0A 4LJXA 4QW9A 3ERCC 1N5XA 4Y2YA 5JRTA 5J2EA 3M9MB 5CR0A 4J9MA 4YFKA 3A0BU 2R8KA 4IRCA 1RDFA 2NRTA 4CE6A 1K5OA 3BJYA 5HHHA 5KTQA 4DSKA 1ZOLA 2F1HA 5ALHA 1DGSA 5AKLA 4QWEA 2MUTB 4IC9A 4GLXA 1DK3A 2GO7A 1ZQJA 2ZH6A 5ALTA 4EX6A 2D3DA 5EOZA 5CRXA 4M5DA 1ZQCA 3FC4A 1OXJA 4RQNA 2OHFA 3NYBA 3RBDA 1L7NA 5KT3A 3F5AA 3JPSA 4JB3A 5J2CA 4FBUA 4FO1A 4E0DA 2IMWP 2EZYA 4OAGA 1NK6A 2W43A 5KFDA 4KLIA 1KNYA 2C28A 3WFSC 4FE3A 3RR7A 1ZQEA 3BS5A 4ECYA 2AXTU 1X66A 3B0YA 2M2UA 3C29A 4NL9C 1JAJA 1PVRA 1XO1A 3RBEA 4DQQA 5CFUA 2ZH9A 3Q8SB 4GXJA 2AQ4A 4QZ8A 5KFIA 1T8EA 5KFQA 4RWQA 2ZXIA 5ALWA 4Y2QA 5J2IA 3WFRE 3H0RB 4NLKA 2F8LA 1VLBA 2HHUA 9ICWA 4DS5A 1DOQA 5KNIA 8ICVA 1ZQVA 2OXOA 1ZQXA 1FFUA 5L1MA 5T14A 1HUZA 3AU6A 2R8IA 4ECRA 3OGUA 2WF5A 5DKWA 1ZRNA 1KSPA 3QUQA 1Z00A 3SYZA 1FEZA 4ECXA 5KFSA 1WCNA 3E58A 4JV1A 1S77D 4PHEA 2DBYA 2DR8A 4P2HA 3RJKA 4KLLA 4KLMA 4P0PB 2QARB 3LYSA 4WCWA 4P0QB 1B4FA 3T5JA 1SZHA 2D8CA 5AI6A 3WK8A 5L1LA 2KG5A 3NRWA 3AL0B 4QZAA 4NLZA 2NRXA 5CWRA 8ICRA 5KT4A 4GXKA 1NK4A 4WC6A 1NZBA 2BR0A 4QZIA 5AI8A 2YTUA 2HHQA 1J2NA 4Q45A 4OJ6A 4DQPA 1X9XA 4ACOA 4F2RA 1Z4NA 3CP8A 5KG3A 3PO5A 2ZH7A 5C0YA 3PW7A 2EAMA 4B9NA 4NXXA 5ALLA 7ICQA 1MQ2A 4YG2A 3OJSA 3C21A 5J2FA 3MDAA 2EAOA 2DGZA 1KRPA 1M6YA 5KT6A 3RB6A 2PFOA 2QB0A 2Y0SF 2ZJ5A 1IV8A 2KOBA 4I27A 2RHFA 4EENA 8ICTA 5HRHA 2ZHAA 2H3VA 4C4SA 4FZNA 2WF9A 3RB3A 3KD3A 4FO6A 3C1YA 1NKBA 2HBJA 4EV6A 4GFJA 1AQ6A 1B22A 2KFZA 3OHBA 3BZCA 1NK8A 3AU2A 5KFLA 2YQEA 1UCVA 4CF4A 2VANA 4UBCA 1NK5A 4JV2A 1ZJNA 2F1JA 8ICGA 3QU5A 5AKHA 4UQGA 2KHQA 3JPOA 5CHEA 4Y2XA 4QZGA 3AN1A 5KG2A 2XY7A 4C0ZA 5JU5A 1JXLA 3OSPA 4DO9A 3L4PA 3CK6A 3PNCA 2LYBA 3IHQB 1PVQA 1PVPA 3GFKB 4X0AA 4UAZA 4MEYA 4P4PA 4WC0A 1Z4OA 3AQFA 2KN7A 5AI0A 5J8YA 4F50A 1BPZA 1XU4A 5ALIA 1R8BA 1MC8A 7ICNA 3DDHA 3NRZA 4LEVA 4Y2UA 4JLXA 4Z6FA 4FS2A 9ICMA 2DRAA 4NJ8A 2ID1A 2GLEA 2ALZA 3F5EA 3HJ4A 3RH5A 2YB4A 3UXOA 2PKEA 4M9HA 2W11A 3CW2C 5D4BA 1ZQGA 2DKZA 2BZFA 1SXEA 2XIDA 2BPCA 4O3NA 2FDRA 4OAHA 2RDIA 2A3VA 2G5HB 1L3VA 4NY8A 4I2JA 3LK9A 4XA5A 3R9KA 1NO5A 1ZXIA 4IL6U 5E79U 4OO1J 4WBYA 3C66A 5DLGA 5DG8A 8ICAA 4UD5A 5KFAA 3QXGA 4PZNA 4NKTA 2AHOB 2H3QA 2KKVA 5BOLA 4O68A 2HMXA 4C8OA 4I2BA 1KFDA 5B66U 5B3PA 2KJ8A 1NNLA 3LVVA 1BGXT 4M6WB 3KZXA 3NWIA 1S97A 1LV5A 1COOA 5F2VO 2XC9A 5CA7A 5HC9A 1P7DA 4ED3A 2NO4A 1L3UA 5D63A 3O0FA 5IINA 4B9LA 5KT2A 1XO0A 4PPXA 2HW3A 4QWBA 1PUZA 4FHWA 2G07A 4WH5A 2BQUA 3KOOA 4HX0A 9ICLA 1ED1A 3EWAA 1TFWA 3OVBA 3WK5A 1N60A 3EPIA 1XSNA 4B9VA 3ICXA 4NXZA 3ALRA 4DL4A 2ZH3A 1SXDA 1VDVA 5AI4A 4F3OA 5AI9A 5ALVA 4DSEA 3BS7A 5DGAA 4YMNA 1UEVA 4LEYA 3EZ5A 4UD4A 1BPYA 3HJ1A 4P4OA 5H2FU 4C8LA 4AP9A 5J2GA 2FCLA 2BPFA 5CEHA 2F3NA 2ZG6A 9ICNA 2J6SA 2RFFA 3GIMA 2B6GA 3K7DA 2Q66A 2HCFA 4KN7A 5L1IA 2KE7A 1JALA 9ICPA 1ZRMA 1C7YA 5CHGA 4M04A 3TFSA 1V9PA 5KFUA 2ZUCA 1ZQHA 7ICTA 3KKAC 5ALRA 4EBKA 4XQ7A 4ECTA 2R8JA 4IQVA 5EWFA 4I0UA 4NLBA 3H0LB 1BVSA 3IN5A 1ZETA 3I76A 2PFNA 4BXOA 2UVWA 4NM1A 3MR2A 2R8HA 1SV0C 2UVUA 3M6ZA 2XO7A 2ISOA 3MCRA 9ICFA 2JEIA 2G09A 2M9NA 2BBJA 2B56A 2JMGA 3LDAA 1LB2B 2HHTA 4KLHA 2G0AA 2IOFK 3Q8LA 5KG0A 1L8LA 3BQ7A 4DFDA 2WTFA 1KDHA 3H3AA 2BDPA 4O5EA 3BS5B 2BBHA 3B0XA 3JPQA 7ICKA 4DLGA 3V7KA 2HVHA 4TQRA 4C7YA 5C5JA 5KFWA 4PGYA 3K4GA 1KFSA 4DOBA 4WC4A 5KT5A 3WKEA 1TFYA 4DQSA 1RQNA 3TAQA 4WOYA 1ZJMA 1PX5A 1QCKA 3RJIA 5DEDA 8ICKA 5HRBA 5ALOA 3T5LA 4KX3A 4YQWA 4RWOA 2LMRA 9ICUA 3H38A 3K75D 4BUGA 3G6XA 4ELTA 3V7LA 2YMLA 3RRGA 2QB1A 1Z00B 4QZ9A 2PMZF 4YP3A 3F2BA 4PZOA 2BHNA 2JEGA 2ZUBA 4EEBA 1N63A 2NV3A 1PZNA 4JV0A 4KLUA 1V4AA 1A0PA 3SMVA 2GWSA 4ED0A 2ZHBA 2A1JB 3L5KA 4J9KA 1T7PA 1N62A 1D8LA 4O3MA 4QZFA 4TUPA 3UXPA 4B9SA 4EX7A 4AT8A 5TISU 3UQ0A 3SZ2A 3GV5B 8ICQA 1CUKA 3UXNA 4QWAA 2VIXA 5HRFA 4RQ6A 4CRXA 1KLNA 4F2SA 2HBMA 4F5RA 5F3XB 4EELA 3H39A 3WK9A 4BJQA 4EYHB 2P6RA 8ICLA 1OU5A 3PZPA 2O5AA 8ICNA 5KG7A 4RQ4A 4LZGA 1L6NA 3PO4A 5IIMA 4NL9A 5J0SA 1JQRA 1T3QA 2UVRA 4AT9A 4KLGA 1D8BA 1GPJA 5KFRA 4UAWA 4O9MA 5AM4A 3V6KA 1CRXA 5IIOA 4OCZA 3H37A 1TK0A 4HYKA 2FMQA 1QH9A 4UB3A 1BPEA 2PFQA 2CN1A 2KTQA 1UHUA 5J2HA 5D49A 2KJ9A 3UPSA 4R65A 3IM1A 4ECUA 1MSWD 4RU9A 4KLSA 3AQKA 4R8UA 2KIWA 2AH5A 2JH7A 4J9OA 1HEKA 8ICBA 2JEJA 2ZIXA 1K1QA 3MFHA 3IG5A 4PHDA 5KFHA 1NK0A 1ZQAA 1PK1A 1TKDA 5HR9A 3M8RA 1WUDA 1D9DA 2VJ5A 3Q8RB 8ICHA 5KG1A 9ICQA 4LEWA 2FPMA 4O3RA 2ZH5A 4BWMA 4NLGA 4R64A 2BDUA 4RWPA 1WWUA 3A0HU 1S76D 1KBUA 4M0AA 2JZBB 2QLTA 4E80A 1TV9A 9ICOA 2E8MA 4RZRA 4ECQA 2ZJ8A 4DF4A 3PR5B 1U45A 3GIIA 3NKUA 4RWNA 2MU2A 4NXVA 2K8BB 5DB6A 3RJHA 3MGIA 3SQIA 4JK1A 1RM6C 1Q3VA 2O6KA 4BWJA 4M9LA 4YR0A 5AM2A 2PFPA 3PW4A 4YN4A 3Q8QB 4Q8FA 9ICAA 1FA0A 2JXJA 2AGPA 1KEJA 1Q79A 2Q0ZX 1X9WA 2OYYA 5AM3A 2GAFD 3AUOA 2KHVA 3WK6A 1ZYQA 4OJLA 4A8EA 3M9NB 3RTVA 1MIYA 1SKWA 5D46A 4O5KA 2P66A 2CXYA 4PJ0U 5AK5A 2CPRA 5AKZA 4X4TA 8ICZA 3MDCA 5L1KA 4EBEA 1WG8A 2IOHA 4G9BA 3SENA 2MRLA 4XRHA 3QUCA 2WHEA 3KHRA 3QYPA 4TUQA 2R8GA 1DK2A 3FM9A 4EEYA 4UW9A 4GC6A 4Y2JA 3SI8A 8ICSA 4Y2PA 2FLNA 4U7CA 2MAXA 1ZQBA 2BQRA 3M8SA 1PK3A 1UETA 4GXIA 5KL8B 3IRUA 4ECSA 3ZDEA 2BCVA 3ZDCA 2LI6A 3PX0A 9ICTA 2XCAA 3NVWA 1YLQA 2LYHA 3LWLA 2M2WA 2HHVA 3OV7A 1L7PA 4R66A 1RXVA 4OAIZ 2J6UA 2RDJA 5ALQA 3UM9A 5AKKA 3MR3A 2FE9A 5IIJA 1QQ5A 4DFKA 4AT7A 2XCPA 4KLJA 4I2HA 4CF3A 1IG6A 3ISBA 4NLNA 5KG6A 5HMMA 7ICOA 2GA9D 4RUCA 1DRGA 4Z6EA 3WKBA 3N97B 4US8A 2EZZA 4X4NA 3NVOA 3OHAA 3TARA 3RH4A 4BDPA 5KFZA 4RQ5A 3EYZA 1TAQA 4MF8A 1T94A 3S6JA 3VCBA 3PX4A 4NM2A 2OCEA 1SIJA 4Z6DA 5HRDA 3NTUA 2KICA 2HVIA 2WAQC 5J2BA 2V9WA 1A77A 5HMLA 5AK4A 4I2EA 3KFUF 3JPNA 1JX4A 2XGPA 4C8MA 4AYBC 9ICRA 2BE3A 2RLTA 2HHPA 4C4TA 7ICEA 5ALPA 3PMNA 2ASDA 4DSLA 3QU9A 3TFRA 5KFXA 1QSYA 9ICIA 4ELUA 2ZIWA 4R63A 5JTGA 5AKYA 2A19A 4DWIA 3NASA 2NRZA 2ZIUA 3F2CA 8ICEA 2M0NA 3ED5A 2KEYA 4C80A 4FS1A 4JUZA 2W9BA 3WK7A 4QWDA 3GDXA 4Q8EA 3TI0A 1KW4A 1FO4A 2EH9A 3RRHA 1O08A 5HHIA 4YR2A 5AIAA 4O3PA 3AQLA 3N28A 2DR7A 4UB6U 2PXIA 1S0MA 2R18A 4F8RA 2DR5A 3BQ1A 2AQ0A 1V38A 1NK7A 2NRWA 2ZH8A 4WBZA 5DQGA 3UPQA 2DFLA 4WQLA 2WAQF 4I28A 1DXSA 1FFVA 4QJFB 4BGDA 5JUMA 1ZQIA 1S0NA 4F5QA 4J9LA 2MUTA 5AM5A 5HREA 3WKCA 2OM6A 5FP0A 1ZQQA 3KKAA 3TADC 1N5WA 4RNOA 2GH1A 3TACB 4S3NA 4DOAA 9ICHA 3HIYA 2ZH1A 2F76X 4YMOA 3RB4A 3WKAA 3QU7A 7ICIA 2K4PA 2LM4A 5F9NA 9ICCA 5DG9A 1SV0A 2RP5A 3QEAZ 4QZDA 1ZQMA 2KV2A 4J9QA 3I28A 5AKEA 5DB9A 4LVSA 1JUDA 7ICSA 3D2SA 3OJUA 3JPRA 4ELVA 2IHOA 3M6KA 3JPTA 2H3ZA 3HKZC 4K99A 2E5SA 2B21A 2BCUA 4Y2RA 8ICCA 2VJ4A 1XSPA 1Q3UA 3E0FA 4QZCA 5IILA 5J2DA 1KQQA 3SAFA 4WQKA 4PH5A 5ALMA 1K1SA 4KMOB 4KITB 4J9PA 1U47A 3L9DA 4TUSA 4M9NA 4Y2TA 5G5GA 2AGQA 1IXRA 3KTQA 3RH6A 4EZ6A 2ISPA 4K4IA 3K1ZA 4PGXA 1ZQYA 8ICXA 5J29A 1SB3C 3PW5A 5A0LA 1X2IA 2I9GA 3N7SC 1CI4A 3AM9A 2IOFA 3PY8A 2KP7A 4DL2A 1MIVA 4YMMA 1OUQA 1QQ6A 2QARA 4DLEA 3DEEA 4P0QA 5EE0A 3WU2U 5DDMA 4GIBA 3IDWA 5DBAA 1XNSA 4R8UB 1IIPA 1UEUA 4I2AA 2YMQA 7ICLA 5J0RA 2W3RA 5KFFA 7ICPA 2RQ5A 2K8AA 3SV3A 1KKXA 4UASA 4K97A 5ALKA 1YZ7A 1R89A 3FDSA 3CNHA 2KZZA 5ALGA 1YT3A 2KFNA 3BQTA 2DF4B 4JWNA 4M9GA 9ICVA 2NRKA 2ZH4A 1S0VA 4CDGA 4X4VA 2YN4A 2WF8A 3HT3A 3E2EA 4N7RA 4DFPA 2KK0A 2KKPA 2W55A 1RYUA 1SWVA 2ESEA 9ICKA 3ZI4A 4UARA 4ED7A 4ECZA 2BCRA 3D2NA 4F91B 3HJEA 3ETRA 4UB4A 1UA1A 4KLOA 2I6XA 2PI4A 4KLEA 2M2TA 4K4GA 3AEVA 3HW8A 5AI5A 4Y2SA 4YCXA 5KFBA 3GIJA 4X4PA 2FLLA 1ZQTA 4EYIB 3J81j 3OVAA 5ALDA 4OJ5A 3HRDD 5HRGA 5KAIU 5AM0A 7ICHA 4OAFA 3QUTA 2AGOA 2IHNA 4C8KA 4PHAA 1Z1VA 9ICXA 4JWMA 5BPCA 1A6SA 2YB1A 5AKXA 4I2DA 2F2AB 4O3QA 3RJFA 4DS4A 2H3FA 3ER9B 3OPXA 2LPEA 3QU2A 4O5CA 4IQUA 3MGVA 4NLCA 5HP4A 2HHSA 4WC1A 1R8AA 1X9SA 1S5LU 2FMPA 1JI7A 2E1FA 4I2IA 4OJPA 2ES6A 7ICRA 5ALJA 4HAIA 4F5NA 3C18A 5JTIA 4B6JA 3N7PD 1TK5A 4Y2VA 3FAHA 1N56A 2DKXA 4FHYA 4RQMA 5AKJA 2ZTDA 4RT3A 3MC1A 2D6FC 4CGZA 3WK4A 7ICGA 4FZLA 4CF5A 5BOMA 3JZ0A 2NO5A 4DF8A 4KLFA 4F4ZA 4FBTA 5J0XA 3C23A 2W3SA 1J2MA 4KLQA 3G6VA 3RFAA 2BKEA 1RG6A 3BZKA 1TK8A 2VA2A 1NJWA 2C2DA 5KG5A 4QNLA 4XUSA 5AK6A 3EPGA 3LQCB 4KLTA 4US9A 4KLDA 3QEBZ 2C2RA 3JYYA 4LZDA 1ZD5A 1S10A 2FMSA 3TQ1A 5L1JA 4X4RA 3NVVA 2OH2A 4X4QA 1NJYA 1L5UA 1SL0A 2ASJA 4M6WA 4DL5A 2HOFA 4PL2A 2XY5A 3QU4A 3IV6A 4RQ3A 3TAPA 1XSLA 4O69A 3F53A 1TAMA 4I2FA 1O03A 2EZXA 4LT6A 2QB0B 3QE9Y 4J9RA 3AQMA 3ZDAA 4CCHA 4F4XA 3HP6A 2F8KA 3IG8A 1AROP 1ZD4A 2E8NA 4RPXA 1NI3A 3SEIA 4G3IA 3QZ7A 5KFCA 2FPKA 3HWTA 3MR5A 4C7ZA 2CRXA 4FH3A 1Z3EB 2B4VA 5EE9A 4UB5A 2MA1A 1KN5A 2WF7A 5KFJA 2XGQA 4I29A 2LM1A 2H3IA 3H7IA 4UATA 1ZQ1C 3RF9A 5J0WA 9ICGA 4C8NA 1U9LA 2W9CA 2W9BB 5EE3A 4DL6A 2UVVA 1N61A 1V97A 4CNQA 1NOMA 1ZD3A 2B0CA 4USAA 3ZDBA 1CEZA 2G08A 4IR1A 3OVSA 3AQNA 3M7DA 2LHTA 3V7JA 2A1AA 2PBEA 2DRBA 5G5HA 2C22A 2NRVA 2XY6A 2KMDA 8ICOA 2GOLA 4MFFA 3DV9A 5AKIA 5ALYA 3PSIA 3C2LA 2EWRA 3SD7A 2XICA 4DQRA 1ECWA 4K96A 1BPDA 1WOTA 3GV7B 5B3QA 3T5KA 1T3NA 1SZPA 4M47A 1UPHA 1RXWA 3H40A 4E7XA 2YY6A 4ED6A 4F71A 1N48A 4FHPA 2HSZA 3C2MA 3T79A 1GO3F 2JEFA 4TQSA 4UB8U 1C20A 3SAGA 1JROA 8ICFA 3RJGA 3K1RB 7ICUA 3GZFA 5KFTA 3PR4A 1S8OA 2HOQA 2KZ3A 4F4WA 3ISDA 1Y88A 4IG8A 3LWMA 2JR5A 5GTHU 2ATLA 3GILA 5HRLA 2Y1IA 4DSJA 5KFNA 4NXUA 4NV0A 5ALUA 2V4QA 5DGBA 4X4UA 4ATBA 4K98A 1KTQA 3ISCA 4ECVA 9ICEA 3SV4A 4QIWC 1WYGA 2JV3A 2XI9A 3H0MB 4O3OA 5L9XA 4O6AA 1ZQPA 1R8CA 4J03A 3Q8PB 3SR6A 1Z1BA 3OUYA 4MFCA 4RQ0A 1TVAA 2Y0SC 1EXNA 1ZQRA 3UMBA 4QZBA 3PMLA 3C5FA 3EF2A 5KL1B 3PSPA 2YX8A 3GIKA 1RYRA 2ZIVA 1L3TA 4UB2A 1XWLA 4DFJA 2WB1C 1X42A 4IQTA 2KSOA 2A1JA 3THVA 5CP2A 4YD2A 3NVZA 1ZQFA 5AICA 2I1QA 5KFYA 3RAXA 1ZQSA 4EBJA 3UMGA 2ZH2A 9ICJA 4IRDA 2BCSA 4WC2A 1U48A 3ONNA 5KFPA 1NK9A 3QX7A 3RB0A 3TADA 4B9MA 4I2GA 3MABA 1V85A 1YZ6A 2DR9A 1BPBA 4QIWF 1XC9A 3T5HA 2K4HA 9ICBA 3HILA 1T4GA 5AK3A 3H4DA 4B9TA 4DOCA 3TKAA 4BXOB 2E8PA 5ALZA 2KVCA 1TAUA 3KZIU 4P4MA 2KZMA 4FHVA 5KFEA 3CYMA 2W9MA 3NGDA 5DB8A 4O67A 3C1ZA 4JLZA 7ICJA 7ICFA 3PSTA 2BQ3A 4QWCA 1L8OA 2N1RA 3FYHA 1NKCA 3D2QA 4IR9A 4FZMA 2F44A 3KHHA 2M2VA 5KFOA 1D9FA 4DSIA 1L7OA 2PI5A 1RQLA 1SKRA 2WB1F 2C2EA 4GC7A 1SL2A 2HHXA 3C28A 1URJA 4MF2A 3HX0A 3H4BA 1QQ7A 4JMUA 2WFAA 5HRIA 1L3SA 2OEHA 4RQ1A 3LVWA 4EEKA 2HN1A 5AHXA 4NXTA 3AMZA 3SAHA 1JXEA 5DECA 4X4OA 3OTQA 2W9AA 4DEZA 1FIQA 4RNMA 1L7MA 1LKYA 2KIVA 4KB6A 3UQ2A 1MIWA 2Y1JA 4K9BA 5IIIA 4FH5A 2DPIA 3JCFA 5KFVA 1ZQKA 2V4RA 2K8CB 2H5XA 3EW9A 5DQIA 1Z19A 1SV4A 1NZPA 8ICJA 1Q78A 2ZTEA 4XQ8A 8ICPA 5DG7A
chains in the Genus database with same CATH topology
9ICKA 1KSPA 4QZEA 4ED8A 4ED7A 1Z00A 3SYZA 4ECZA 5KFRA 4UAWA 3C5GA 5IIKA 2BCRA 4O9MA 5J0UA 3H8SA 5DB7A 1XS9D 4F91B 4ECXA 2JZBA 5KFSA 4UB4A 4K4HA 1WCNA 2ZJAA 3V6KA 4JV1A 1S77D 5IIOA 4PHEA 1UA1A 2PI4A 4KLOA 3H37A 2DR8A 4KLEA 3BQ2A 4P2HA 1TK0A 4HYKA 4K4GA 2M2TA 3RJKA 3HW8A 2FMQA 2FLPA 4QZHA 4DSFA 4YCXA 5KFBA 1BPEA 4UB3A 3MFIA 3GIJA 4KLLA 2FLLA 1ZQTA 4RUAA 5J2JA 4Q44A 4EYIB 2PFQA 2KTQA 4IRKA 4F5OA 4DFMA 3OVAA 5J2HA 4WCWA 4RQ7A 5HRGA 2AJQA 2ASLA 3ETLA 3T5JA 7ICHA 5D49A 3UPSA 2AGOA 1ZQLA 4R65A 2IHNA 2IHMA 3IM1A 4C8KA 4PHAA 2W8LA 4AT8B 4ECUA 2W8KA 5L1LA 4JWMA 1MSWD 9ICXA 4RU9A 4QZAA 3RAQA 4NLZA 2NRXA 5CWRA 5BPCA 3HIYA 4KLSA 8ICRA 3AQKA 4R8UA 5KT4A 4GXKA 3RR8A 1BNOA 4J9OA 4I2DA 1NK4A 4F4YA 4ED1A 2IBKA 8ICBA 4WC6A 2BR0A 2BCQA 2JEJA 4O3QA 3GV8B 3PW0A 4QZIA 3RJFA 5KFMA 4DS4A 1K1QA 3MFHA 1ZQOA 3ZD8A 4PHDA 5KFHA 3KHGA 5TZVA 1NK0A 4M9JA 2HHQA 1ZQAA 4Q45A 2P6UA 1TKDA 5J0QA 4DQPA 5HR9A 3M8RA 4O5CA 4X5VA 3Q8RB 1D9DA 5DBCA 2IA6A 4IQUA 4F2RA 8ICHA 2HHSA 5HP4A 5KG1A 5KG3A 9ICQA 3PO5A 1R8AA 4WC1A 1X9SA 1JQRA 2ZH7A 3PW7A 4B9NA 4YXMA 1MIYA 2FPMA 4DL3A 1MQ2A 4YG2A 2FMPA 4O3RA 7ICQA 4I2IA 4BWMA 4NLGA 2ZH5A 3OJSA 3C21A 4R64A 4ECWA 7ICRA 4AT9B 4WC7A 5J2FA 3MDAA 4RWPA 4F5NA 1KRPA 1RPLA 3C18A 5KT6A 4ED2A 1TK5A 1S76D 3T3FA 3RB6A 2PFOA 4M0AA 2ZJ5A 2JZBB 4YXJA 4E80A 1NKEA 1TV9A 4I27A 1N56A 3HPOA 9ICOA 4RZRA 3V6JA 8ICTA 5CB1A 1JMSA 4RPZA 4ECQA 2ZJ8A 3V6HA 3PR5B 4DF4A 1U45A 2ZTDA 5HRHA 2ZHAA 3GIIA 2HHWA 4RT3A 4RWNA 3RB3A 1SL1A 5DB6A 2DVIA 4WC5A 3RJHA 7ICGA 8ICYA 3MGIA 3WFQE 5BOMA 4FO6A 3JZ0A 3C1YA 1NKBA 4JK1A 4Q43A 4DF8A 3PX6A 4KLFA 1B22A 1S0OA 2KFZA 4B9UA 4F4ZA 1JN3A 4BWJA 3OHBA 4FBTA 4M9LA 4PHPA 5J0XA 4YR0A 1NK8A 2PFPA 3RJEA 3AU2A 3C23A 4EZ9A 5KFLA 3PW4A 4KLQA 4YN4A 3G6VA 2BKEA 3Q8QB 1RYSA 4Q8FA 4X4SA 9ICAA 3QZ8A 1FA0A 2AGPA 1KEJA 1TK8A 2DPJA 1Q79A 2VANA 4UBCA 2Q0ZX 1NK5A 2VA2A 4JV2A 1U4BA 1X9WA 1ZJNA 1NJWA 2F1JA 2C2DA 5KG5A 4F93B 3AUOA 8ICGA 4XUSA 4UQGA 3EPGA 3JPOA 3LQCB 1ZYQA 4KLTA 4QZGA 5KFGA 1QSSA 3M9NB 5KG2A 3RTVA 1SKWA 4F4KA 7ICMA 4KLDA 5D46A 4O5KA 3QEBZ 2C2RA 4TURA 2XY7A 2P66A 5F9LA 3JYYA 2ZUDA 4LZDA 1JXLA 3OSPA 3WFOA 4DO9A 4WC3A 1S10A 3PNCA 9ICSA 2FMSA 2W9CB 3IHQB 3TQ1A 4X4TA 5L1JA 3MGHA 1IM4A 1WCLA 3GFKB 3MDCA 5L1KA 4UAZA 8ICZA 4X0AA 4X4RA 4X4QA 3V72A 4EBEA 1NJYA 4MEYA 4YR3A 4P4PA 1L5UA 4WC0A 1SL0A 2ASJA 4M6WA 4DL5A 2KN7A 3RJJA 2BPGA 4F50A 2XY5A 4RQ3A 3TAPA 2ZTCA 1XSLA 1BPZA 1XU4A 1R8BA 4XRHA 1MC8A 4I2FA 5J2AA 1HUOA 4LT6A 3ORYA 3KHRA 7ICNA 3JPPA 4RQ8A 4TUQA 4RT2A 5DLFA 3QE9Y 2R8GA 1DK2A 4J9RA 3AQMA 4Z6FA 3ZDAA 4FS2A 4F4XA 4EBDA 3HP6A 4CCHA 4EEYA 9ICMA 4EP7A 1AROP 2DRAA 2ID1A 2ALZA 4RPXA 5EWGA 4GC6A 3HJ4A 3SI8A 8ICSA 2FLNA 4G3IA 2MAXA 3QZ7A 5KFCA 3RH5A 2FPLA 3UXOA 2BQRA 1ZQBA 3M8SA 4M9HA 4KMUA 1UETA 4GXIA 5D4BA 1ZQGA 7ICVA 2FPKA 3HWTA 3MR5A 3BQ0A 8ICWA 4ECSA 2BPCA 1JIHA 3ZDEA 2BCVA 2OWOA 4FH3A 4O3NA 3ZDCA 1Z3EB 3PW2A 1ZQZA 3PX0A 9ICTA 1TFRA 5J0OA 4UB5A 2XCAA 2RDIA 4O0IA 1YLQA 4FHYA 1L3VA 2LYHA 4DL7A 1VFGA 4YVZA 4NY8A 3LWLA 5KFJA 2M2WA 4I2JA 4RPYA 3LK9A 4XA5A 4J9SA 2XGQA 2HHVA 3OV7A 1NO5A 4I29A 4R66A 4WBYA 1RXVA 2J6UA 3C66A 5CJ7A 1SKSA 3H7IA 5DLGA 4UBBA 5DG8A 8ICAA 2RDJA 5KFAA 4UD5A 4NKUA 3MR3A 4NKTA 5J0TA 1A76A 5J0WA 5BOLA 1UA0A 5IIJA 1MQ3A 4C8OA 4I2BA 5J2KA 9ICGA 4DFKA 1KFDA 4C8NA 1U9LA 4AT7A 3ZD9A 2XCPA 4KLJA 4I2HA 4FHXA 1ZQUA 5KFKA 2W9BB 2W9CA 4DL6A 4M6WB 1BGXT 3ISBA 2UVVA 4Z6CA 4NLNA 5KG6A 5HMMA 1S97A 4PGQA 7ICOA 4RUCA 1NOMA 1LV5A 4KN4A 8ICIA 5DQHA 1COOA 4Z6EA 3ZDBA 1CEZA 3N97B 5F2VO 5KT7A 1S9FA 4IR1A 3OVSA 1UT8A 2XC9A 5CA7A 4ATBB 5HC9A 4X0BA 4X4NA 4ED3A 1QTMA 3OHAA 5KG4A 3AQNA 3TARA 1NJZA 4RQ2A 3RH4A 4BDPA 1X9MA 1L3UA 5KFZA 3V7JA 4RQ5A 4KTQA 3EYZA 5IINA 1TAQA 2PBEA 3H8WA 2DRBA 4MF8A 4F5PA 2C22A 4EBCA 2NRVA 4B9LA 3PX4A 2XY6A 5KT2A 5DDYA 4NM2A 4PPXA 2HW3A 8ICOA 8ICMA 4QWBA 4MFFA 4Z6DA 4FHWA 3MBYA 4QW8A 3NTUA 3C2LA 5HRDA 2HVIA 2BQUA 5DBBA 5J2BA 4DQRA 2V9WA 9ICLA 3OUYB 1A77A 3EWAA 5J0YA 1TFWA 3OVBA 5HMLA 4I2EA 3EPIA 5J0PA 1BPDA 1WOTA 1XSNA 4B9VA 3GV7B 3JPNA 1JX4A 3T5KA 4NXZA 2XGPA 1SZPA 4C8MA 1T3NA 4DQIA 4M47A 9ICRA 1KFTA 4DL4A 2BE3A 2ZH3A 1RXWA 3H40A 4F3OA 1HJPA 4MEXA 4E7XA 4DSEA 4ED6A 2HHPA 5EWEA 1N48A 4FHPA 3C2MA 1BNPA 7ICEA 5DGAA 5HRKA 4YMNA 3ZDDA 1UEVA 4IQWA 3EZ5A 4UD4A 3PMNA 2ASDA 4DSLA 2ZH1A 1BPYA 3TFRA 4P4OA 2JEFA 4TQSA 3HJ1A 5KFXA 1QLNA 4C8LA 1QSYA 9ICIA 5J2GA 4ELUA 4F92B 4O3SA 1QSLA 4R63A 2BPFA 8ICFA 3RJGA 3PV8A 1VJ7A 3TANA 7ICUA 4AT7B 4J9NA 5KFTA 3PR4A 4DWIA 2NRZA 9ICNA 1H38A 2J6SA 2KZ3A 8ICEA 4F4WA 2RFFA 3ISDA 4M2YA 1Y88A 4FS1A 3GQCA 1ZQNA 3GIMA 2Q66A 4IG8A 4JUZA 2W9BA 3LWMA 4QWDA 3GDXA 4Q8EA 4KN7A 3TI0A 5L1IA 2ATLA 3RRHA 4I2CA 3H8JA 3GILA 5HHIA 4YR2A 3BDPA 9ICPA 5HRLA 4O3PA 3AQLA 1C7YA 2Y1IA 4DSJA 2DR7A 5KFNA 2V4QA 4E8FA 5CHGA 2PXIA 4M04A 5DGBA 4X4UA 2F1IA 3TFSA 1V9PA 4UB1A 4ATBA 1KTQA 5KFUA 3MR6A 1S0MA 3ISCA 2ZUCA 4ECVA 3BQ1A 3SV4A 4F8RA 9ICEA 1ZQHA 2AQ0A 2DR5A 7ICTA 1NK7A 3Q8KA 3N4MB 4EBKA 2NRWA 4XQ7A 2ZH8A 4ECTA 2R8JA 4WBZA 5DQGA 4O3OA 3UPQA 4IQVA 2DFLA 5EWFA 1ZQDA 5L9XA 1ZQPA 3Q8MA 2PFNA 1BVSA 4MFAA 1ZETA 4I28A 1R8CA 4BXOA 3Q8PB 2O1PA 4BGDA 5JUMA 1ZQIA 1S0NA 2UVWA 4F5QA 4NM1A 3MR2A 2R8HA 3OUYA 2UVUA 4J9LA 2MUTA 4MFCA 4RQ0A 2XO7A 1TVAA 2ISOA 1U49A 9ICFA 2JEIA 5HREA 1EXNA 2M9NA 1ZQRA 4QZBA 1ZQQA 4YD1A 3PMLA 3C5FA 3LDAA 1LB2B 2HHTA 4KLHA 4RNOA 4S3NA 3GIKA 1RYRA 4DOAA 1BPXA 1L3TA 4UB2A 9ICHA 2J6TA 1B43A 2AU0A 1XWLA 4YMOA 4DFJA 4UAYA 3Q8LA 5KG0A 3WFPA 3RB4A 7ICIA 2VA8A 8ICUA 3G6YA 4IQTA 3PVXA 5F9NA 2A1JA 3THVA 5CP2A 1D8YA 4YD2A 5DG9A 2WTFA 1KDHA 2BDPA 9ICCA 3H3AA 1ZQWA 1ZQFA 4O5EA 2I1QA 1UT5A 5KFYA 3OSNA 3KHLA 3RAXA 1RZTA 1ZQSA 2VA3A 4EBJA 3QEAZ 2ZH2A 1NJXA 4ZH4A 9ICJA 3M9OB 4IRDA 3B0XA 4QZDA 3JPQA 3C2KA 4J9QA 4DLGA 3V7KA 2BGWA 1U48A 1ZQMA 4RNNA 2BCSA 2HVHA 5KFPA 4WC2A 4TQRA 1NK9A 5DB9A 5C5JA 5KFWA 4PGYA 3K4GA 4LVSA 1KFSA 7ICSA 4DOBA 3OJUA 4WC4A 5HNKA 3RB0A 3JPRA 4ELVA 5KT5A 4B9MA 4I2GA 4QW9A 4DQSA 1TFYA 3MABA 3JPTA 3TAQA 1ZJMA 5J2EA 3M9MB 4J9MA 5CR0A 2B21A 2BCUA 1PX5A 4YFKA 3RJIA 2DR9A 2R8KA 1BPBA 5DEDA 4X4PA 8ICKA 1XC9A 3T5HA 4IRCA 8ICCA 5HRBA 2NRTA 9ICBA 1T4GA 3T5LA 1XSPA 3H4DA 4YQWA 4B9TA 4QZCA 4RWOA 3BJYA 4DOCA 5IILA 5J2DA 5HHHA 9ICUA 5KTQA 4DSKA 3H38A 4BXOB 4PH5A 2F1HA 3K75D 3G6XA 1DGSA 4ELTA 1TAUA 3V7LA 4P4MA 1K1SA 4KITB 4J9PA 3RRGA 2KZMA 4QWEA 1U47A 4FHVA 5KFEA 2MUTB 2W9MA 3NGDA 3L9DA 5DB8A 1Z00B 4QZ9A 3C1ZA 4GLXA 7ICKA 7ICJA 4TUSA 4M9NA 1DK3A 4YP3A 1ZQJA 7ICFA 2BQ3A 2AGQA 1IXRA 3KTQA 2ZH6A 2BHNA 4QWCA 2ZUBA 3RH6A 2ISPA 3FYHA 1NKCA 2JEGA 4EZ6A 4K4IA 4IR9A 4PGXA 1ZQYA 8ICXA 5EOZA 5J29A 4M5DA 3PW5A 1PZNA 4KLMA 1ZQCA 1X2IA 4JV0A 3KHHA 2M2VA 5KFOA 4KLUA 1V4AA 3NYBA 3RBDA 1D9FA 4DSIA 2PI5A 2I9GA 5KT3A 2GWSA 1SKRA 3JPSA 4ED0A 2C2EA 4GC7A 4DL2A 3PY8A 2KP7A 1MIVA 2ZHBA 2A1JB 4YMMA 5J2CA 1SL2A 4FBUA 4J9KA 1T7PA 2HHXA 1D8LA 4E0DA 2IMWP 4QZFA 4MF2A 4TUPA 4DLEA 5KFDA 1NK6A 3HX0A 3H4BA 4KLIA 1KNYA 2C28A 3WFSC 5DDMA 5DBAA 5HRIA 3UXPA 1L3SA 4RQ1A 3RR7A 4R8UB 1ZQEA 1UEUA 4ECYA 4B9SA 4I2AA 3B0YA 2M2UA 7ICLA 4AT8A 3UQ0A 1JXEA 5J0RA 3GV5B 3SZ2A 2W9AA 8ICQA 1JAJA 5KFFA 5DECA 4X4OA 1CUKA 1XO1A 3RBEA 4DQQA 7ICPA 2ZH9A 4DEZA 3Q8SB 3SV3A 4RNMA 4GXJA 2AQ4A 3UXNA 4QZ8A 4QWAA 3UQ2A 5KFIA 1MIWA 1T8EA 5KFQA 1Q78A 5HRFA 1R89A 4RQ6A 4RWQA 3FDSA 1KLNA 4F2SA 2Y1JA 5J2IA 4F5RA 1F5AA 3WFRE 2KZZA 3H39A 4NLKA 4EYHB 2P6RA 8ICLA 5IIIA 2KFNA 2HHUA 3BQTA 1OU5A 4FH5A 2DPIA 4JWNA 4M9GA 9ICWA 9ICVA 2NRKA 4DS5A 8ICNA 5KFVA 1DOQA 1ZQKA 8ICVA 2O5AA 5KG7A 4RQ4A 2ZH4A 4LZGA 1S0VA 2V4RA 3PO4A 2H5XA 1ZQVA 5IIMA 4X4VA 3EW9A 5DQIA 1ZQXA 5J0SA 1HUZA 8ICJA 3HT3A 3AU6A 2R8IA 1NZPA 3E2EA 2UVRA 2ZTEA 4XQ8A 4ECRA 3OGUA 4DFPA 4AT9A 4KLGA 5DKWA 8ICPA 5DG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICK A;  1KSP A;  4QZE A;  4ED8 A;  4ED7 A;  1Z00 A;  3SYZ A;  4ECZ A;  5KFR A;  4UAW A;  3C5G A;  5IIK A;  2BCR A;  4O9M A;  5J0U A;  3H8S A;  5DB7 A;  1XS9 D;  4F91 B;  4ECX A;  2JZB A;  5KFS A;  4UB4 A;  4K4H A;  1WCN A;  2ZJA A;  3V6K A;  4JV1 A;  1S77 D;  5IIO A;  4PHE A;  1UA1 A;  2PI4 A;  4KLO A;  3H37 A;  2DR8 A;  4KLE A;  3BQ2 A;  4P2H A;  1TK0 A;  4HYK A;  4K4G A;  2M2T A;  3RJK A;  3HW8 A;  2FMQ A;  2FLP A;  4QZH A;  4DSF A;  4YCX A;  5KFB A;  1BPE A;  4UB3 A;  3MFI A;  3GIJ A;  4KLL A;  2FLL A;  1ZQT A;  4RUA A;  5J2J A;  4Q44 A;  4EYI B;  2PFQ A;  2KTQ A;  4IRK A;  4F5O A;  4DFM A;  3OVA A;  5J2H A;  4WCW A;  4RQ7 A;  5HRG A;  2AJQ A;  2ASL A;  3ETL A;  3T5J A;  7ICH A;  5D49 A;  3UPS A;  2AGO A;  1ZQL A;  4R65 A;  2IHN A;  2IHM A;  3IM1 A;  4C8K A;  4PHA A;  2W8L A;  4AT8 B;  4ECU A;  2W8K A;  5L1L A;  4JWM A;  1MSW D;  9ICX A;  4RU9 A;  4QZA A;  3RAQ A;  4NLZ A;  2NRX A;  5CWR A;  5BPC A;  3HIY A;  4KLS A;  8ICR A;  3AQK A;  4R8U A;  5KT4 A;  4GXK A;  3RR8 A;  1BNO A;  4J9O A;  4I2D A;  1NK4 A;  4F4Y A;  4ED1 A;  2IBK A;  8ICB A;  4WC6 A;  2BR0 A;  2BCQ A;  2JEJ A;  4O3Q A;  3GV8 B;  3PW0 A;  4QZI A;  3RJF A;  5KFM A;  4DS4 A;  1K1Q A;  3MFH A;  1ZQO A;  3ZD8 A;  4PHD A;  5KFH A;  3KHG A;  5TZV A;  1NK0 A;  4M9J A;  2HHQ A;  1ZQA A;  4Q45 A;  2P6U A;  1TKD A;  5J0Q A;  4DQP A;  5HR9 A;  3M8R A;  4O5C A;  4X5V A;  3Q8R B;  1D9D A;  5DBC A;  2IA6 A;  4IQU A;  4F2R A;  8ICH A;  2HHS A;  5HP4 A;  5KG1 A;  5KG3 A;  9ICQ A;  3PO5 A;  1R8A A;  4WC1 A;  1X9S A;  1JQR A;  2ZH7 A;  3PW7 A;  4B9N A;  4YXM A;  1MIY A;  2FPM A;  4DL3 A;  1MQ2 A;  4YG2 A;  2FMP A;  4O3R A;  7ICQ A;  4I2I A;  4BWM A;  4NLG A;  2ZH5 A;  3OJS A;  3C21 A;  4R64 A;  4ECW A;  7ICR A;  4AT9 B;  4WC7 A;  5J2F A;  3MDA A;  4RWP A;  4F5N A;  1KRP A;  1RPL A;  3C18 A;  5KT6 A;  4ED2 A;  1TK5 A;  1S76 D;  3T3F A;  3RB6 A;  2PFO A;  4M0A A;  2ZJ5 A;  2JZB B;  4YXJ A;  4E80 A;  1NKE A;  1TV9 A;  4I27 A;  1N56 A;  3HPO A;  9ICO A;  4RZR A;  3V6J A;  8ICT A;  5CB1 A;  1JMS A;  4RPZ A;  4ECQ A;  2ZJ8 A;  3V6H A;  3PR5 B;  4DF4 A;  1U45 A;  2ZTD A;  5HRH A;  2ZHA A;  3GII A;  2HHW A;  4RT3 A;  4RWN A;  3RB3 A;  1SL1 A;  5DB6 A;  2DVI A;  4WC5 A;  3RJH A;  7ICG A;  8ICY A;  3MGI A;  3WFQ E;  5BOM A;  4FO6 A;  3JZ0 A;  3C1Y A;  1NKB A;  4JK1 A;  4Q43 A;  4DF8 A;  3PX6 A;  4KLF A;  1B22 A;  1S0O A;  2KFZ A;  4B9U A;  4F4Z A;  1JN3 A;  4BWJ A;  3OHB A;  4FBT A;  4M9L A;  4PHP A;  5J0X A;  4YR0 A;  1NK8 A;  2PFP A;  3RJE A;  3AU2 A;  3C23 A;  4EZ9 A;  5KFL A;  3PW4 A;  4KLQ A;  4YN4 A;  3G6V A;  2BKE A;  3Q8Q B;  1RYS A;  4Q8F A;  4X4S A;  9ICA A;  3QZ8 A;  1FA0 A;  2AGP A;  1KEJ A;  1TK8 A;  2DPJ A;  1Q79 A;  2VAN A;  4UBC A;  2Q0Z X;  1NK5 A;  2VA2 A;  4JV2 A;  1U4B A;  1X9W A;  1ZJN A;  1NJW A;  2F1J A;  2C2D A;  5KG5 A;  4F93 B;  3AUO A;  8ICG A;  4XUS A;  4UQG A;  3EPG A;  3JPO A;  3LQC B;  1ZYQ A;  4KLT A;  4QZG A;  5KFG A;  1QSS A;  3M9N B;  5KG2 A;  3RTV A;  1SKW A;  4F4K A;  7ICM A;  4KLD A;  5D46 A;  4O5K A;  3QEB Z;  2C2R A;  4TUR A;  2XY7 A;  2P66 A;  5F9L A;  3JYY A;  2ZUD A;  4LZD A;  1JXL A;  3OSP A;  3WFO A;  4DO9 A;  4WC3 A;  1S10 A;  3PNC A;  9ICS A;  2FMS A;  2W9C B;  3IHQ B;  3TQ1 A;  4X4T A;  5L1J A;  3MGH A;  1IM4 A;  1WCL A;  3GFK B;  3MDC A;  5L1K A;  4UAZ A;  8ICZ A;  4X0A A;  4X4R A;  4X4Q A;  3V72 A;  4EBE A;  1NJY A;  4MEY A;  4YR3 A;  4P4P A;  1L5U A;  4WC0 A;  1SL0 A;  2ASJ A;  4M6W A;  4DL5 A;  2KN7 A;  3RJJ A;  2BPG A;  4F50 A;  2XY5 A;  4RQ3 A;  3TAP A;  2ZTC A;  1XSL A;  1BPZ A;  1XU4 A;  1R8B A;  4XRH A;  1MC8 A;  4I2F A;  5J2A A;  1HUO A;  4LT6 A;  3ORY A;  3KHR A;  7ICN A;  3JPP A;  4RQ8 A;  4TUQ A;  4RT2 A;  5DLF A;  3QE9 Y;  2R8G A;  1DK2 A;  4J9R A;  3AQM A;  4Z6F A;  3ZDA A;  4FS2 A;  4F4X A;  4EBD A;  3HP6 A;  4CCH A;  4EEY A;  9ICM A;  4EP7 A;  1ARO P;  2DRA A;  2ID1 A;  2ALZ A;  4RPX A;  5EWG A;  4GC6 A;  3HJ4 A;  3SI8 A;  8ICS A;  2FLN A;  4G3I A;  2MAX A;  3QZ7 A;  5KFC A;  3RH5 A;  2FPL A;  3UXO A;  2BQR A;  1ZQB A;  3M8S A;  4M9H A;  4KMU A;  1UET A;  4GXI A;  5D4B A;  1ZQG A;  7ICV A;  2FPK A;  3HWT A;  3MR5 A;  3BQ0 A;  8ICW A;  4ECS A;  2BPC A;  1JIH A;  3ZDE A;  2BCV A;  2OWO A;  4FH3 A;  4O3N A;  3ZDC A;  1Z3E B;  3PW2 A;  1ZQZ A;  3PX0 A;  9ICT A;  1TFR A;  5J0O A;  4UB5 A;  2XCA A;  2RDI A;  4O0I A;  1YLQ A;  4FHY A;  1L3V A;  2LYH A;  4DL7 A;  1VFG A;  4YVZ A;  4NY8 A;  3LWL A;  5KFJ A;  2M2W A;  4I2J A;  4RPY A;  3LK9 A;  4XA5 A;  4J9S A;  2XGQ A;  2HHV A;  3OV7 A;  1NO5 A;  4I29 A;  4R66 A;  4WBY A;  1RXV A;  2J6U A;  3C66 A;  5CJ7 A;  1SKS A;  3H7I A;  5DLG A;  4UBB A;  5DG8 A;  8ICA A;  2RDJ A;  5KFA A;  4UD5 A;  4NKU A;  3MR3 A;  4NKT A;  5J0T A;  1A76 A;  5J0W A;  5BOL A;  1UA0 A;  5IIJ A;  1MQ3 A;  4C8O A;  4I2B A;  5J2K A;  9ICG A;  4DFK A;  1KFD A;  4C8N A;  1U9L A;  4AT7 A;  3ZD9 A;  2XCP A;  4KLJ A;  4I2H A;  4FHX A;  1ZQU A;  5KFK A;  2W9B B;  2W9C A;  4DL6 A;  4M6W B;  1BGX T;  3ISB A;  2UVV A;  4Z6C A;  4NLN A;  5KG6 A;  5HMM A;  1S97 A;  4PGQ A;  7ICO A;  4RUC A;  1NOM A;  1LV5 A;  4KN4 A;  8ICI A;  5DQH A;  1COO A;  4Z6E A;  3ZDB A;  1CEZ A;  3N97 B;  5F2V O;  5KT7 A;  1S9F A;  4IR1 A;  3OVS A;  1UT8 A;  2XC9 A;  5CA7 A;  4ATB B;  5HC9 A;  4X0B A;  4X4N A;  4ED3 A;  1QTM A;  3OHA A;  5KG4 A;  3AQN A;  3TAR A;  1NJZ A;  4RQ2 A;  3RH4 A;  4BDP A;  1X9M A;  1L3U A;  5KFZ A;  3V7J A;  4RQ5 A;  4KTQ A;  3EYZ A;  5IIN A;  1TAQ A;  2PBE A;  3H8W A;  2DRB A;  4MF8 A;  4F5P A;  2C22 A;  4EBC A;  2NRV A;  4B9L A;  3PX4 A;  2XY6 A;  5KT2 A;  5DDY A;  4NM2 A;  4PPX A;  2HW3 A;  8ICO A;  8ICM A;  4QWB A;  4MFF A;  4Z6D A;  4FHW A;  3MBY A;  4QW8 A;  3NTU A;  3C2L A;  5HRD A;  2HVI A;  2BQU A;  5DBB A;  5J2B A;  4DQR A;  2V9W A;  9ICL A;  3OUY B;  1A77 A;  3EWA A;  5J0Y A;  1TFW A;  3OVB A;  5HML A;  4I2E A;  3EPI A;  5J0P A;  1BPD A;  1WOT A;  1XSN A;  4B9V A;  3GV7 B;  3JPN A;  1JX4 A;  3T5K A;  4NXZ A;  2XGP A;  1SZP A;  4C8M A;  1T3N A;  4DQI A;  4M47 A;  9ICR A;  1KFT A;  4DL4 A;  2BE3 A;  2ZH3 A;  1RXW A;  3H40 A;  4F3O A;  1HJP A;  4MEX A;  4E7X A;  4DSE A;  4ED6 A;  2HHP A;  5EWE A;  1N48 A;  4FHP A;  3C2M A;  1BNP A;  7ICE A;  5DGA A;  5HRK A;  4YMN A;  3ZDD A;  1UEV A;  4IQW A;  3EZ5 A;  4UD4 A;  3PMN A;  2ASD A;  4DSL A;  2ZH1 A;  1BPY A;  3TFR A;  4P4O A;  2JEF A;  4TQS A;  3HJ1 A;  5KFX A;  1QLN A;  4C8L A;  1QSY A;  9ICI A;  5J2G A;  4ELU A;  4F92 B;  4O3S A;  1QSL A;  4R63 A;  2BPF A;  8ICF A;  3RJG A;  3PV8 A;  1VJ7 A;  3TAN A;  7ICU A;  4AT7 B;  4J9N A;  5KFT A;  3PR4 A;  4DWI A;  2NRZ A;  9ICN A;  1H38 A;  2J6S A;  2KZ3 A;  8ICE A;  4F4W A;  2RFF A;  3ISD A;  4M2Y A;  1Y88 A;  4FS1 A;  3GQC A;  1ZQN A;  3GIM A;  2Q66 A;  4IG8 A;  4JUZ A;  2W9B A;  3LWM A;  4QWD A;  3GDX A;  4Q8E A;  4KN7 A;  3TI0 A;  5L1I A;  2ATL A;  3RRH A;  4I2C A;  3H8J A;  3GIL A;  5HHI A;  4YR2 A;  3BDP A;  9ICP A;  5HRL A;  4O3P A;  3AQL A;  1C7Y A;  2Y1I A;  4DSJ A;  2DR7 A;  5KFN A;  2V4Q A;  4E8F A;  5CHG A;  2PXI A;  4M04 A;  5DGB A;  4X4U A;  2F1I A;  3TFS A;  1V9P A;  4UB1 A;  4ATB A;  1KTQ A;  5KFU A;  3MR6 A;  1S0M A;  3ISC A;  2ZUC A;  4ECV A;  3BQ1 A;  3SV4 A;  4F8R A;  9ICE A;  1ZQH A;  2AQ0 A;  2DR5 A;  7ICT A;  1NK7 A;  3Q8K A;  3N4M B;  4EBK A;  2NRW A;  4XQ7 A;  2ZH8 A;  4ECT A;  2R8J A;  4WBZ A;  5DQG A;  4O3O A;  3UPQ A;  4IQV A;  2DFL A;  5EWF A;  1ZQD A;  5L9X A;  1ZQP A;  3Q8M A;  2PFN A;  1BVS A;  4MFA A;  1ZET A;  4I28 A;  1R8C A;  4BXO A;  3Q8P B;  2O1P A;  4BGD A;  5JUM A;  1ZQI A;  1S0N A;  2UVW A;  4F5Q A;  4NM1 A;  3MR2 A;  2R8H A;  3OUY A;  2UVU A;  4J9L A;  2MUT A;  4MFC A;  4RQ0 A;  2XO7 A;  1TVA A;  2ISO A;  1U49 A;  9ICF A;  2JEI A;  5HRE A;  1EXN A;  2M9N A;  1ZQR A;  4QZB A;  1ZQQ A;  4YD1 A;  3PML A;  3C5F A;  3LDA A;  1LB2 B;  2HHT A;  4KLH A;  4RNO A;  4S3N A;  3GIK A;  1RYR A;  4DOA A;  1BPX A;  1L3T A;  4UB2 A;  9ICH A;  2J6T A;  1B43 A;  2AU0 A;  1XWL A;  4YMO A;  4DFJ A;  4UAY A;  3Q8L A;  5KG0 A;  3WFP A;  3RB4 A;  7ICI A;  2VA8 A;  8ICU A;  3G6Y A;  4IQT A;  3PVX A;  5F9N A;  2A1J A;  3THV A;  5CP2 A;  1D8Y A;  4YD2 A;  5DG9 A;  2WTF A;  1KDH A;  2BDP A;  9ICC A;  3H3A A;  1ZQW A;  1ZQF A;  4O5E A;  2I1Q A;  1UT5 A;  5KFY A;  3OSN A;  3KHL A;  3RAX A;  1RZT A;  1ZQS A;  2VA3 A;  4EBJ A;  3QEA Z;  2ZH2 A;  1NJX A;  4ZH4 A;  9ICJ A;  3M9O B;  4IRD A;  3B0X A;  4QZD A;  3JPQ A;  3C2K A;  4J9Q A;  4DLG A;  3V7K A;  2BGW A;  1U48 A;  1ZQM A;  4RNN A;  2BCS A;  2HVH A;  5KFP A;  4WC2 A;  4TQR A;  1NK9 A;  5DB9 A;  5C5J A;  5KFW A;  4PGY A;  3K4G A;  4LVS A;  1KFS A;  7ICS A;  4DOB A;  3OJU A;  4WC4 A;  5HNK A;  3RB0 A;  3JPR A;  4ELV A;  5KT5 A;  4B9M A;  4I2G A;  4QW9 A;  4DQS A;  1TFY A;  3MAB A;  3JPT A;  3TAQ A;  1ZJM A;  5J2E A;  3M9M B;  4J9M A;  5CR0 A;  2B21 A;  2BCU A;  1PX5 A;  4YFK A;  3RJI A;  2DR9 A;  2R8K A;  1BPB A;  5DED A;  4X4P A;  8ICK A;  1XC9 A;  3T5H A;  4IRC A;  8ICC A;  5HRB A;  2NRT A;  9ICB A;  1T4G A;  3T5L A;  1XSP A;  3H4D A;  4YQW A;  4B9T A;  4QZC A;  4RWO A;  3BJY A;  4DOC A;  5IIL A;  5J2D A;  5HHH A;  9ICU A;  5KTQ A;  4DSK A;  3H38 A;  4BXO B;  4PH5 A;  2F1H A;  3K75 D;  3G6X A;  1DGS A;  4ELT A;  1TAU A;  3V7L A;  4P4M A;  1K1S A;  4KIT B;  4J9P A;  3RRG A;  2KZM A;  4QWE A;  1U47 A;  4FHV A;  5KFE A;  2MUT B;  2W9M A;  3NGD A;  3L9D A;  5DB8 A;  1Z00 B;  4QZ9 A;  3C1Z A;  4GLX A;  7ICK A;  7ICJ A;  4TUS A;  4M9N A;  1DK3 A;  4YP3 A;  1ZQJ A;  7ICF A;  2BQ3 A;  2AGQ A;  1IXR A;  3KTQ A;  2ZH6 A;  2BHN A;  4QWC A;  2ZUB A;  3RH6 A;  2ISP A;  3FYH A;  1NKC A;  2JEG A;  4EZ6 A;  4K4I A;  4IR9 A;  4PGX A;  1ZQY A;  8ICX A;  5EOZ A;  5J29 A;  4M5D A;  3PW5 A;  1PZN A;  4KLM A;  1ZQC A;  1X2I A;  4JV0 A;  3KHH A;  2M2V A;  5KFO A;  4KLU A;  1V4A A;  3NYB A;  3RBD A;  1D9F A;  4DSI A;  2PI5 A;  2I9G A;  5KT3 A;  2GWS A;  1SKR A;  3JPS A;  4ED0 A;  2C2E A;  4GC7 A;  4DL2 A;  3PY8 A;  2KP7 A;  1MIV A;  2ZHB A;  2A1J B;  4YMM A;  5J2C A;  1SL2 A;  4FBU A;  4J9K A;  1T7P A;  2HHX A;  1D8L A;  4E0D A;  2IMW P;  4QZF A;  4MF2 A;  4TUP A;  4DLE A;  5KFD A;  1NK6 A;  3HX0 A;  3H4B A;  4KLI A;  1KNY A;  2C28 A;  3WFS C;  5DDM A;  5DBA A;  5HRI A;  3UXP A;  1L3S A;  4RQ1 A;  3RR7 A;  4R8U B;  1ZQE A;  1UEU A;  4ECY A;  4B9S A;  4I2A A;  3B0Y A;  2M2U A;  7ICL A;  4AT8 A;  3UQ0 A;  1JXE A;  5J0R A;  3GV5 B;  3SZ2 A;  2W9A A;  8ICQ A;  1JAJ A;  5KFF A;  5DEC A;  4X4O A;  1CUK A;  1XO1 A;  3RBE A;  4DQQ A;  7ICP A;  2ZH9 A;  4DEZ A;  3Q8S B;  3SV3 A;  4RNM A;  4GXJ A;  2AQ4 A;  3UXN A;  4QZ8 A;  4QWA A;  3UQ2 A;  5KFI A;  1MIW A;  1T8E A;  5KFQ A;  1Q78 A;  5HRF A;  1R89 A;  4RQ6 A;  4RWQ A;  3FDS A;  1KLN A;  4F2S A;  2Y1J A;  5J2I A;  4F5R A;  1F5A A;  3WFR E;  2KZZ A;  3H39 A;  4NLK A;  4EYH B;  2P6R A;  8ICL A;  5III A;  2KFN A;  2HHU A;  3BQT A;  1OU5 A;  4FH5 A;  2DPI A;  4JWN A;  4M9G A;  9ICW A;  9ICV A;  2NRK A;  4DS5 A;  8ICN A;  5KFV A;  1DOQ A;  1ZQK A;  8ICV A;  2O5A A;  5KG7 A;  4RQ4 A;  2ZH4 A;  4LZG A;  1S0V A;  2V4R A;  3PO4 A;  2H5X A;  1ZQV A;  5IIM A;  4X4V A;  3EW9 A;  5DQI A;  1ZQX A;  5J0S A;  1HUZ A;  8ICJ A;  3HT3 A;  3AU6 A;  2R8I A;  1NZP A;  3E2E A;  2UVR A;  2ZTE A;  4XQ8 A;  4ECR A;  3OGU A;  4DFP A;  4AT9 A;  4KLG A;  5DKW A;  8ICP A;  5DG7 A; 
#chains in the Genus database with same CATH topology
 4QZE A;  4AYB F;  4ED8 A;  3C5G A;  5IIK A;  5J0U A;  3H8S A;  5DB7 A;  1XS9 D;  4K4H A;  2JZB A;  2ZJA A;  2NYV A;  4K8V A;  3BQ2 A;  3ER8 C;  2FLP A;  4QZH A;  4DSF A;  2JH1 A;  3VC8 A;  3MFI A;  2HN2 A;  4RUA A;  5J2J A;  4Q44 A;  4IRK A;  4F5O A;  4DFM A;  4LEZ A;  4RQ7 A;  2AJQ A;  3F2D A;  2ASL A;  3ETL A;  3N7R C;  4PL1 A;  2G06 A;  1X6I A;  2LYA A;  1ZQL A;  2IHM A;  4NWI A;  2W8L A;  1HIW A;  1MN8 A;  2W8K A;  4AT8 B;  2DUY A;  3RAQ A;  2EQY A;  2Y9U A;  3RR8 A;  1BNO A;  4ICA A;  2IBK A;  4F4Y A;  4ED1 A;  5EE1 A;  2JHD A;  2BCQ A;  3GV8 B;  3PW0 A;  5KFM A;  1ZQO A;  3ZD8 A;  3KHG A;  5TZV A;  4M9J A;  2W7O A;  3KBB A;  4UAV A;  2P6U A;  5J0Q A;  4X5V A;  2IA6 A;  5DBC A;  2HBK A;  2Z7J A;  1X6J A;  4YXM A;  5AIB A;  2LKY A;  2ODG A;  4DL3 A;  5ALS A;  4ECW A;  4AT9 B;  2IUB A;  4WC7 A;  2DWQ A;  1RPL A;  4ED2 A;  3T3F A;  1SWW A;  4YXJ A;  3D6J A;  1NKE A;  4FFD A;  5AM1 A;  1B0X A;  2RRD A;  3HPO A;  4KX5 A;  3V6J A;  5CB1 A;  1JMS A;  4RPZ A;  3V6H A;  2HHW A;  2FI1 A;  1SL1 A;  2DVI A;  4WC5 A;  8ICY A;  3WFQ E;  4Q43 A;  3PX6 A;  1S0O A;  3UMC A;  4B9U A;  1JN3 A;  4P0P A;  4PHP A;  3RJE A;  3I1Y A;  4EZ9 A;  2FJ6 A;  2HOI A;  3WKD A;  1RYS A;  2W03 A;  4X4S A;  1UQV A;  3QZ8 A;  3QUB A;  2DPJ A;  2WF6 A;  5J8Y C;  4DCC A;  2ZIX B;  3NVY A;  1U4B A;  2DL0 A;  1LVH A;  4F93 B;  3HKZ F;  1PK1 B;  5KFG A;  1QSS A;  2QKQ A;  1F5A A;  4F4K A;  7ICM A;  4TUR A;  5F9L A;  4U6P A;  2ZUD A;  3H8M A;  2B51 A;  3WFO A;  2ZXH A;  4WC3 A;  9ICS A;  2W9C B;  3MGH A;  1IM4 A;  1WCL A;  3V72 A;  1JRP A;  4YR3 A;  3RJJ A;  1X40 A;  3NS1 A;  3GU3 A;  2BPG A;  2G5I B;  2ZTC A;  5ALX A;  5ALN A;  5J2A A;  1HUO A;  3ORY A;  3PSF A;  3JPP A;  2L5Y A;  4RQ8 A;  4RT2 A;  5DLF A;  4EBD A;  4EP7 A;  5ALF A;  3L3F X;  5EWG A;  1OW5 A;  2DQN B;  2W04 A;  2FPL A;  4KMU A;  2MSN A;  7ICV A;  5AKG A;  1F5S A;  3BQ0 A;  8ICW A;  1JIH A;  5D61 A;  2OWO A;  2W54 A;  2PMZ C;  3PW2 A;  1ZQZ A;  5HR7 A;  4ZOH C;  1TFR A;  5J0O A;  4O0I A;  4DL7 A;  1VFG A;  4YVZ A;  4RPY A;  4J9S A;  2K60 A;  5HR6 A;  2Q4T A;  5CJ7 A;  1SKS A;  4UBB A;  4NKU A;  1COK A;  1TE2 A;  5J0T A;  1A76 A;  1MQ3 A;  1UA0 A;  4OJO A;  2KNJ A;  5J2K A;  3ZD9 A;  4FHX A;  1ZQU A;  2JGA A;  5KFK A;  4Z6C A;  4PGQ A;  4KM5 A;  2E1E A;  4KN4 A;  1F0M A;  2HBL A;  8ICI A;  5DQH A;  1ZD2 P;  2KVS A;  5KT7 A;  1S9F A;  1UT8 A;  4ATB B;  4X0B A;  1QTM A;  5K4L A;  5KG4 A;  2K4I A;  1NJZ A;  4RQ2 A;  2I5H A;  4MKP A;  1X9M A;  3IP4 B;  4KTQ A;  3H8W A;  4XJE A;  4F5P A;  4EBC A;  2KJ5 A;  4IS7 A;  5DDY A;  8ICM A;  2W7P A;  3B9J A;  3MBY A;  4QW8 A;  4F72 A;  5DBB A;  1F44 A;  3OUY B;  1N2X A;  5J0Y A;  3CRX A;  2K4E A;  5J0P A;  5GTI U;  2YMM A;  4DQI A;  3AQE A;  1KFT A;  5KAF U;  1HJP A;  4MEX A;  2XVT A;  4WJ3 B;  5CFS A;  5EWE A;  1KL9 A;  2ZIV B;  1Q46 A;  4UAU A;  1BNP A;  5HRK A;  5CFT A;  3ZDD A;  1DGJ A;  4IQW A;  2KSO B;  1QLN A;  2VKQ A;  4F92 B;  4O3S A;  1QSL A;  1VJ7 A;  3PV8 A;  3TAN A;  4AT7 B;  4J9N A;  1Q8K A;  4C4R A;  1VJ5 A;  1H38 A;  1SGG A;  2EAN A;  4M2Y A;  1J97 A;  2K89 A;  3GQC A;  1ZQN A;  4NXW A;  2Y9T A;  2YMP A;  4I2C A;  3H8J A;  2EAP A;  3NUQ A;  3BDP A;  3EUB 2;  4E8F A;  5B5E U;  4MHV A;  3QNM A;  2F1I A;  4UB1 A;  3MR6 A;  2LBO A;  4EED A;  1MA7 A;  3M1Y A;  3Q8K A;  4K9A A;  3N4M B;  2F77 X;  1ZQD A;  2P35 A;  5D62 A;  2JRZ A;  3Q8M A;  4MFA A;  2O1P A;  3PHZ A;  2HDO A;  2E3T A;  1U49 A;  4OD0 A;  4YD1 A;  2KD1 A;  5ALE A;  1BPX A;  2J6T A;  1B43 A;  2AU0 A;  4UAY A;  3WFP A;  4BX9 C;  2VA8 A;  8ICU A;  2ZIW B;  3G6Y A;  3PVX A;  1D8Y A;  2E8O A;  1ZQW A;  2ZIU B;  1UT5 A;  3KHL A;  1WWV A;  3OSN A;  2VA3 A;  1RZT A;  1NJX A;  4ZH4 A;  3M9O B;  3C2K A;  2BGW A;  4EGW A;  4RNN A;  3U26 A;  1LKY B;  3OWG A;  2EDU A;  5HNK A;  2HI0 A;  4LJX A;  4QW9 A;  3ERC C;  1N5X A;  4Y2Y A;  5JRT A;  5J2E A;  3M9M B;  5CR0 A;  4J9M A;  4YFK A;  3A0B U;  2R8K A;  4IRC A;  1RDF A;  2NRT A;  4CE6 A;  1K5O A;  3BJY A;  5HHH A;  5KTQ A;  4DSK A;  1ZOL A;  2F1H A;  5ALH A;  1DGS A;  5AKL A;  4QWE A;  2MUT B;  4IC9 A;  4GLX A;  1DK3 A;  2GO7 A;  1ZQJ A;  2ZH6 A;  5ALT A;  4EX6 A;  2D3D A;  5EOZ A;  5CRX A;  4M5D A;  1ZQC A;  3FC4 A;  1OXJ A;  4RQN A;  2OHF A;  3NYB A;  3RBD A;  1L7N A;  5KT3 A;  3F5A A;  3JPS A;  4JB3 A;  5J2C A;  4FBU A;  4FO1 A;  4E0D A;  2IMW P;  2EZY A;  4OAG A;  1NK6 A;  2W43 A;  5KFD A;  4KLI A;  1KNY A;  2C28 A;  3WFS C;  4FE3 A;  3RR7 A;  1ZQE A;  3BS5 A;  4ECY A;  2AXT U;  1X66 A;  3B0Y A;  2M2U A;  3C29 A;  4NL9 C;  1JAJ A;  1PVR A;  1XO1 A;  3RBE A;  4DQQ A;  5CFU A;  2ZH9 A;  3Q8S B;  4GXJ A;  2AQ4 A;  4QZ8 A;  5KFI A;  1T8E A;  5KFQ A;  4RWQ A;  2ZXI A;  5ALW A;  4Y2Q A;  5J2I A;  3WFR E;  3H0R B;  4NLK A;  2F8L A;  1VLB A;  2HHU A;  9ICW A;  4DS5 A;  1DOQ A;  5KNI A;  8ICV A;  1ZQV A;  2OXO A;  1ZQX A;  1FFU A;  5L1M A;  5T14 A;  1HUZ A;  3AU6 A;  2R8I A;  4ECR A;  3OGU A;  2WF5 A;  5DKW A;  1ZRN A;  1KSP A;  3QUQ A;  1Z00 A;  3SYZ A;  1FEZ A;  4ECX A;  5KFS A;  1WCN A;  3E58 A;  4JV1 A;  1S77 D;  4PHE A;  2DBY A;  2DR8 A;  4P2H A;  3RJK A;  4KLL A;  4KLM A;  4P0P B;  2QAR B;  3LYS A;  4WCW A;  4P0Q B;  1B4F A;  3T5J A;  1SZH A;  2D8C A;  5AI6 A;  3WK8 A;  5L1L A;  2KG5 A;  3NRW A;  3AL0 B;  4QZA A;  4NLZ A;  2NRX A;  5CWR A;  8ICR A;  5KT4 A;  4GXK A;  1NK4 A;  4WC6 A;  1NZB A;  2BR0 A;  4QZI A;  5AI8 A;  2YTU A;  2HHQ A;  1J2N A;  4Q45 A;  4OJ6 A;  4DQP A;  1X9X A;  4ACO A;  4F2R A;  1Z4N A;  3CP8 A;  5KG3 A;  3PO5 A;  2ZH7 A;  5C0Y A;  3PW7 A;  2EAM A;  4B9N A;  4NXX A;  5ALL A;  7ICQ A;  1MQ2 A;  4YG2 A;  3OJS A;  3C21 A;  5J2F A;  3MDA A;  2EAO A;  2DGZ A;  1KRP A;  1M6Y A;  5KT6 A;  3RB6 A;  2PFO A;  2QB0 A;  2Y0S F;  2ZJ5 A;  1IV8 A;  2KOB A;  4I27 A;  2RHF A;  4EEN A;  8ICT A;  5HRH A;  2ZHA A;  2H3V A;  4C4S A;  4FZN A;  2WF9 A;  3RB3 A;  3KD3 A;  4FO6 A;  3C1Y A;  1NKB A;  2HBJ A;  4EV6 A;  4GFJ A;  1AQ6 A;  1B22 A;  2KFZ A;  3OHB A;  3BZC A;  1NK8 A;  3AU2 A;  5KFL A;  2YQE A;  1UCV A;  4CF4 A;  2VAN A;  4UBC A;  1NK5 A;  4JV2 A;  1ZJN A;  2F1J A;  8ICG A;  3QU5 A;  5AKH A;  4UQG A;  2KHQ A;  3JPO A;  5CHE A;  4Y2X A;  4QZG A;  3AN1 A;  5KG2 A;  2XY7 A;  4C0Z A;  5JU5 A;  1JXL A;  3OSP A;  4DO9 A;  3L4P A;  3CK6 A;  3PNC A;  2LYB A;  3IHQ B;  1PVQ A;  1PVP A;  3GFK B;  4X0A A;  4UAZ A;  4MEY A;  4P4P A;  4WC0 A;  1Z4O A;  3AQF A;  2KN7 A;  5AI0 A;  5J8Y A;  4F50 A;  1BPZ A;  1XU4 A;  5ALI A;  1R8B A;  1MC8 A;  7ICN A;  3DDH A;  3NRZ A;  4LEV A;  4Y2U A;  4JLX A;  4Z6F A;  4FS2 A;  9ICM A;  2DRA A;  4NJ8 A;  2ID1 A;  2GLE A;  2ALZ A;  3F5E A;  3HJ4 A;  3RH5 A;  2YB4 A;  3UXO A;  2PKE A;  4M9H A;  2W11 A;  3CW2 C;  5D4B A;  1ZQG A;  2DKZ A;  2BZF A;  1SXE A;  2XID A;  2BPC A;  4O3N A;  2FDR A;  4OAH A;  2RDI A;  2A3V A;  2G5H B;  1L3V A;  4NY8 A;  4I2J A;  3LK9 A;  4XA5 A;  3R9K A;  1NO5 A;  1ZXI A;  4IL6 U;  5E79 U;  4OO1 J;  4WBY A;  3C66 A;  5DLG A;  5DG8 A;  8ICA A;  4UD5 A;  5KFA A;  3QXG A;  4PZN A;  4NKT A;  2AHO B;  2H3Q A;  2KKV A;  5BOL A;  4O68 A;  2HMX A;  4C8O A;  4I2B A;  1KFD A;  5B66 U;  5B3P A;  2KJ8 A;  1NNL A;  3LVV A;  1BGX T;  4M6W B;  3KZX A;  3NWI A;  1S97 A;  1LV5 A;  1COO A;  5F2V O;  2XC9 A;  5CA7 A;  5HC9 A;  1P7D A;  4ED3 A;  2NO4 A;  1L3U A;  5D63 A;  3O0F A;  5IIN A;  4B9L A;  5KT2 A;  1XO0 A;  4PPX A;  2HW3 A;  4QWB A;  1PUZ A;  4FHW A;  2G07 A;  4WH5 A;  2BQU A;  3KOO A;  4HX0 A;  9ICL A;  1ED1 A;  3EWA A;  1TFW A;  3OVB A;  3WK5 A;  1N60 A;  3EPI A;  1XSN A;  4B9V A;  3ICX A;  4NXZ A;  3ALR A;  4DL4 A;  2ZH3 A;  1SXD A;  1VDV A;  5AI4 A;  4F3O A;  5AI9 A;  5ALV A;  4DSE A;  3BS7 A;  5DGA A;  4YMN A;  1UEV A;  4LEY A;  3EZ5 A;  4UD4 A;  1BPY A;  3HJ1 A;  4P4O A;  5H2F U;  4C8L A;  4AP9 A;  5J2G A;  2FCL A;  2BPF A;  5CEH A;  2F3N A;  2ZG6 A;  9ICN A;  2J6S A;  2RFF A;  3GIM A;  2B6G A;  3K7D A;  2Q66 A;  2HCF A;  4KN7 A;  5L1I A;  2KE7 A;  1JAL A;  9ICP A;  1ZRM A;  1C7Y A;  5CHG A;  4M04 A;  3TFS A;  1V9P A;  5KFU A;  2ZUC A;  1ZQH A;  7ICT A;  3KKA C;  5ALR A;  4EBK A;  4XQ7 A;  4ECT A;  2R8J A;  4IQV A;  5EWF A;  4I0U A;  4NLB A;  3H0L B;  1BVS A;  3IN5 A;  1ZET A;  3I76 A;  2PFN A;  4BXO A;  2UVW A;  4NM1 A;  3MR2 A;  2R8H A;  1SV0 C;  2UVU A;  3M6Z A;  2XO7 A;  2ISO A;  3MCR A;  9ICF A;  2JEI A;  2G09 A;  2M9N A;  2BBJ A;  2B56 A;  2JMG A;  3LDA A;  1LB2 B;  2HHT A;  4KLH A;  2G0A A;  2IOF K;  3Q8L A;  5KG0 A;  1L8L A;  3BQ7 A;  4DFD A;  2WTF A;  1KDH A;  3H3A A;  2BDP A;  4O5E A;  3BS5 B;  2BBH A;  3B0X A;  3JPQ A;  7ICK A;  4DLG A;  3V7K A;  2HVH A;  4TQR A;  4C7Y A;  5C5J A;  5KFW A;  4PGY A;  3K4G A;  1KFS A;  4DOB A;  4WC4 A;  5KT5 A;  3WKE A;  1TFY A;  4DQS A;  1RQN A;  3TAQ A;  4WOY A;  1ZJM A;  1PX5 A;  1QCK A;  3RJI A;  5DED A;  8ICK A;  5HRB A;  5ALO A;  3T5L A;  4KX3 A;  4YQW A;  4RWO A;  2LMR A;  9ICU A;  3H38 A;  3K75 D;  4BUG A;  3G6X A;  4ELT A;  3V7L A;  2YML A;  3RRG A;  2QB1 A;  1Z00 B;  4QZ9 A;  2PMZ F;  4YP3 A;  3F2B A;  4PZO A;  2BHN A;  2JEG A;  2ZUB A;  4EEB A;  1N63 A;  2NV3 A;  1PZN A;  4JV0 A;  4KLU A;  1V4A A;  1A0P A;  3SMV A;  2GWS A;  4ED0 A;  2ZHB A;  2A1J B;  3L5K A;  4J9K A;  1T7P A;  1N62 A;  1D8L A;  4O3M A;  4QZF A;  4TUP A;  3UXP A;  4B9S A;  4EX7 A;  4AT8 A;  5TIS U;  3UQ0 A;  3SZ2 A;  3GV5 B;  8ICQ A;  1CUK A;  3UXN A;  4QWA A;  2VIX A;  5HRF A;  4RQ6 A;  4CRX A;  1KLN A;  4F2S A;  2HBM A;  4F5R A;  5F3X B;  4EEL A;  3H39 A;  3WK9 A;  4BJQ A;  4EYH B;  2P6R A;  8ICL A;  1OU5 A;  3PZP A;  2O5A A;  8ICN A;  5KG7 A;  4RQ4 A;  4LZG A;  1L6N A;  3PO4 A;  5IIM A;  4NL9 A;  5J0S A;  1JQR A;  1T3Q A;  2UVR A;  4AT9 A;  4KLG A;  1D8B A;  1GPJ A;  5KFR A;  4UAW A;  4O9M A;  5AM4 A;  3V6K A;  1CRX A;  5IIO A;  4OCZ A;  3H37 A;  1TK0 A;  4HYK A;  2FMQ A;  1QH9 A;  4UB3 A;  1BPE A;  2PFQ A;  2CN1 A;  2KTQ A;  1UHU A;  5J2H A;  5D49 A;  2KJ9 A;  3UPS A;  4R65 A;  3IM1 A;  4ECU A;  1MSW D;  4RU9 A;  4KLS A;  3AQK A;  4R8U A;  2KIW A;  2AH5 A;  2JH7 A;  4J9O A;  1HEK A;  8ICB A;  2JEJ A;  2ZIX A;  1K1Q A;  3MFH A;  3IG5 A;  4PHD A;  5KFH A;  1NK0 A;  1ZQA A;  1PK1 A;  1TKD A;  5HR9 A;  3M8R A;  1WUD A;  1D9D A;  2VJ5 A;  3Q8R B;  8ICH A;  5KG1 A;  9ICQ A;  4LEW A;  2FPM A;  4O3R A;  2ZH5 A;  4BWM A;  4NLG A;  4R64 A;  2BDU A;  4RWP A;  1WWU A;  3A0H U;  1S76 D;  1KBU A;  4M0A A;  2JZB B;  2QLT A;  4E80 A;  1TV9 A;  9ICO A;  2E8M A;  4RZR A;  4ECQ A;  2ZJ8 A;  4DF4 A;  3PR5 B;  1U45 A;  3GII A;  3NKU A;  4RWN A;  2MU2 A;  4NXV A;  2K8B B;  5DB6 A;  3RJH A;  3MGI A;  3SQI A;  4JK1 A;  1RM6 C;  1Q3V A;  2O6K A;  4BWJ A;  4M9L A;  4YR0 A;  5AM2 A;  2PFP A;  3PW4 A;  4YN4 A;  3Q8Q B;  4Q8F A;  9ICA A;  1FA0 A;  2JXJ A;  2AGP A;  1KEJ A;  1Q79 A;  2Q0Z X;  1X9W A;  2OYY A;  5AM3 A;  2GAF D;  3AUO A;  2KHV A;  3WK6 A;  1ZYQ A;  4OJL A;  4A8E A;  3M9N B;  3RTV A;  1MIY A;  1SKW A;  5D46 A;  4O5K A;  2P66 A;  2CXY A;  4PJ0 U;  5AK5 A;  2CPR A;  5AKZ A;  4X4T A;  8ICZ A;  3MDC A;  5L1K A;  4EBE A;  1WG8 A;  2IOH A;  4G9B A;  3SEN A;  2MRL A;  4XRH A;  3QUC A;  2WHE A;  3KHR A;  3QYP A;  4TUQ A;  2R8G A;  1DK2 A;  3FM9 A;  4EEY A;  4UW9 A;  4GC6 A;  4Y2J A;  3SI8 A;  8ICS A;  4Y2P A;  2FLN A;  4U7C A;  2MAX A;  1ZQB A;  2BQR A;  3M8S A;  1PK3 A;  1UET A;  4GXI A;  5KL8 B;  3IRU A;  4ECS A;  3ZDE A;  2BCV A;  3ZDC A;  2LI6 A;  3PX0 A;  9ICT A;  2XCA A;  3NVW A;  1YLQ A;  2LYH A;  3LWL A;  2M2W A;  2HHV A;  3OV7 A;  1L7P A;  4R66 A;  1RXV A;  4OAI Z;  2J6U A;  2RDJ A;  5ALQ A;  3UM9 A;  5AKK A;  3MR3 A;  2FE9 A;  5IIJ A;  1QQ5 A;  4DFK A;  4AT7 A;  2XCP A;  4KLJ A;  4I2H A;  4CF3 A;  1IG6 A;  3ISB A;  4NLN A;  5KG6 A;  5HMM A;  7ICO A;  2GA9 D;  4RUC A;  1DRG A;  4Z6E A;  3WKB A;  3N97 B;  4US8 A;  2EZZ A;  4X4N A;  3NVO A;  3OHA A;  3TAR A;  3RH4 A;  4BDP A;  5KFZ A;  4RQ5 A;  3EYZ A;  1TAQ A;  4MF8 A;  1T94 A;  3S6J A;  3VCB A;  3PX4 A;  4NM2 A;  2OCE A;  1SIJ A;  4Z6D A;  5HRD A;  3NTU A;  2KIC A;  2HVI A;  2WAQ C;  5J2B A;  2V9W A;  1A77 A;  5HML A;  5AK4 A;  4I2E A;  3KFU F;  3JPN A;  1JX4 A;  2XGP A;  4C8M A;  4AYB C;  9ICR A;  2BE3 A;  2RLT A;  2HHP A;  4C4T A;  7ICE A;  5ALP A;  3PMN A;  2ASD A;  4DSL A;  3QU9 A;  3TFR A;  5KFX A;  1QSY A;  9ICI A;  4ELU A;  2ZIW A;  4R63 A;  5JTG A;  5AKY A;  2A19 A;  4DWI A;  3NAS A;  2NRZ A;  2ZIU A;  3F2C A;  8ICE A;  2M0N A;  3ED5 A;  2KEY A;  4C80 A;  4FS1 A;  4JUZ A;  2W9B A;  3WK7 A;  4QWD A;  3GDX A;  4Q8E A;  3TI0 A;  1KW4 A;  1FO4 A;  2EH9 A;  3RRH A;  1O08 A;  5HHI A;  4YR2 A;  5AIA A;  4O3P A;  3AQL A;  3N28 A;  2DR7 A;  4UB6 U;  2PXI A;  1S0M A;  2R18 A;  4F8R A;  2DR5 A;  3BQ1 A;  2AQ0 A;  1V38 A;  1NK7 A;  2NRW A;  2ZH8 A;  4WBZ A;  5DQG A;  3UPQ A;  2DFL A;  4WQL A;  2WAQ F;  4I28 A;  1DXS A;  1FFV A;  4QJF B;  4BGD A;  5JUM A;  1ZQI A;  1S0N A;  4F5Q A;  4J9L A;  2MUT A;  5AM5 A;  5HRE A;  3WKC A;  2OM6 A;  5FP0 A;  1ZQQ A;  3KKA A;  3TAD C;  1N5W A;  4RNO A;  2GH1 A;  3TAC B;  4S3N A;  4DOA A;  9ICH A;  3HIY A;  2ZH1 A;  2F76 X;  4YMO A;  3RB4 A;  3WKA A;  3QU7 A;  7ICI A;  2K4P A;  2LM4 A;  5F9N A;  9ICC A;  5DG9 A;  1SV0 A;  2RP5 A;  3QEA Z;  4QZD A;  1ZQM A;  2KV2 A;  4J9Q A;  3I28 A;  5AKE A;  5DB9 A;  4LVS A;  1JUD A;  7ICS A;  3D2S A;  3OJU A;  3JPR A;  4ELV A;  2IHO A;  3M6K A;  3JPT A;  2H3Z A;  3HKZ C;  4K99 A;  2E5S A;  2B21 A;  2BCU A;  4Y2R A;  8ICC A;  2VJ4 A;  1XSP A;  1Q3U A;  3E0F A;  4QZC A;  5IIL A;  5J2D A;  1KQQ A;  3SAF A;  4WQK A;  4PH5 A;  5ALM A;  1K1S A;  4KMO B;  4KIT B;  4J9P A;  1U47 A;  3L9D A;  4TUS A;  4M9N A;  4Y2T A;  5G5G A;  2AGQ A;  1IXR A;  3KTQ A;  3RH6 A;  4EZ6 A;  2ISP A;  4K4I A;  3K1Z A;  4PGX A;  1ZQY A;  8ICX A;  5J29 A;  1SB3 C;  3PW5 A;  5A0L A;  1X2I A;  2I9G A;  3N7S C;  1CI4 A;  3AM9 A;  2IOF A;  3PY8 A;  2KP7 A;  4DL2 A;  1MIV A;  4YMM A;  1OUQ A;  1QQ6 A;  2QAR A;  4DLE A;  3DEE A;  4P0Q A;  5EE0 A;  3WU2 U;  5DDM A;  4GIB A;  3IDW A;  5DBA A;  1XNS A;  4R8U B;  1IIP A;  1UEU A;  4I2A A;  2YMQ A;  7ICL A;  5J0R A;  2W3R A;  5KFF A;  7ICP A;  2RQ5 A;  2K8A A;  3SV3 A;  1KKX A;  4UAS A;  4K97 A;  5ALK A;  1YZ7 A;  1R89 A;  3FDS A;  3CNH A;  2KZZ A;  5ALG A;  1YT3 A;  2KFN A;  3BQT A;  2DF4 B;  4JWN A;  4M9G A;  9ICV A;  2NRK A;  2ZH4 A;  1S0V A;  4CDG A;  4X4V A;  2YN4 A;  2WF8 A;  3HT3 A;  3E2E A;  4N7R A;  4DFP A;  2KK0 A;  2KKP A;  2W55 A;  1RYU A;  1SWV A;  2ESE A;  9ICK A;  3ZI4 A;  4UAR A;  4ED7 A;  4ECZ A;  2BCR A;  3D2N A;  4F91 B;  3HJE A;  3ETR A;  4UB4 A;  1UA1 A;  4KLO A;  2I6X A;  2PI4 A;  4KLE A;  2M2T A;  4K4G A;  3AEV A;  3HW8 A;  5AI5 A;  4Y2S A;  4YCX A;  5KFB A;  3GIJ A;  4X4P A;  2FLL A;  1ZQT A;  4EYI B;  3J81 j;  3OVA A;  5ALD A;  4OJ5 A;  3HRD D;  5HRG A;  5KAI U;  5AM0 A;  7ICH A;  4OAF A;  3QUT A;  2AGO A;  2IHN A;  4C8K A;  4PHA A;  1Z1V A;  9ICX A;  4JWM A;  5BPC A;  1A6S A;  2YB1 A;  5AKX A;  4I2D A;  2F2A B;  4O3Q A;  3RJF A;  4DS4 A;  2H3F A;  3ER9 B;  3OPX A;  2LPE A;  3QU2 A;  4O5C A;  4IQU A;  3MGV A;  4NLC A;  5HP4 A;  2HHS A;  4WC1 A;  1R8A A;  1X9S A;  1S5L U;  2FMP A;  1JI7 A;  2E1F A;  4I2I A;  4OJP A;  2ES6 A;  7ICR A;  5ALJ A;  4HAI A;  4F5N A;  3C18 A;  5JTI A;  4B6J A;  3N7P D;  1TK5 A;  4Y2V A;  3FAH A;  1N56 A;  2DKX A;  4FHY A;  4RQM A;  5AKJ A;  2ZTD A;  4RT3 A;  3MC1 A;  2D6F C;  4CGZ A;  3WK4 A;  7ICG A;  4FZL A;  4CF5 A;  5BOM A;  3JZ0 A;  2NO5 A;  4DF8 A;  4KLF A;  4F4Z A;  4FBT A;  5J0X A;  3C23 A;  2W3S A;  1J2M A;  4KLQ A;  3G6V A;  3RFA A;  2BKE A;  1RG6 A;  3BZK A;  1TK8 A;  2VA2 A;  1NJW A;  2C2D A;  5KG5 A;  4QNL A;  4XUS A;  5AK6 A;  3EPG A;  3LQC B;  4KLT A;  4US9 A;  4KLD A;  3QEB Z;  2C2R A;  3JYY A;  4LZD A;  1ZD5 A;  1S10 A;  2FMS A;  3TQ1 A;  5L1J A;  4X4R A;  3NVV A;  2OH2 A;  4X4Q A;  1NJY A;  1L5U A;  1SL0 A;  2ASJ A;  4M6W A;  4DL5 A;  2HOF A;  4PL2 A;  2XY5 A;  3QU4 A;  3IV6 A;  4RQ3 A;  3TAP A;  1XSL A;  4O69 A;  3F53 A;  1TAM A;  4I2F A;  1O03 A;  2EZX A;  4LT6 A;  2QB0 B;  3QE9 Y;  4J9R A;  3AQM A;  3ZDA A;  4CCH A;  4F4X A;  3HP6 A;  2F8K A;  3IG8 A;  1ARO P;  1ZD4 A;  2E8N A;  4RPX A;  1NI3 A;  3SEI A;  4G3I A;  3QZ7 A;  5KFC A;  2FPK A;  3HWT A;  3MR5 A;  4C7Z A;  2CRX A;  4FH3 A;  1Z3E B;  2B4V A;  5EE9 A;  4UB5 A;  2MA1 A;  1KN5 A;  2WF7 A;  5KFJ A;  2XGQ A;  4I29 A;  2LM1 A;  2H3I A;  3H7I A;  4UAT A;  1ZQ1 C;  3RF9 A;  5J0W A;  9ICG A;  4C8N A;  1U9L A;  2W9C A;  2W9B B;  5EE3 A;  4DL6 A;  2UVV A;  1N61 A;  1V97 A;  4CNQ A;  1NOM A;  1ZD3 A;  2B0C A;  4USA A;  3ZDB A;  1CEZ A;  2G08 A;  4IR1 A;  3OVS A;  3AQN A;  3M7D A;  2LHT A;  3V7J A;  2A1A A;  2PBE A;  2DRB A;  5G5H A;  2C22 A;  2NRV A;  2XY6 A;  2KMD A;  8ICO A;  2GOL A;  4MFF A;  3DV9 A;  5AKI A;  5ALY A;  3PSI A;  3C2L A;  2EWR A;  3SD7 A;  2XIC A;  4DQR A;  1ECW A;  4K96 A;  1BPD A;  1WOT A;  3GV7 B;  5B3Q A;  3T5K A;  1T3N A;  1SZP A;  4M47 A;  1UPH A;  1RXW A;  3H40 A;  4E7X A;  2YY6 A;  4ED6 A;  4F71 A;  1N48 A;  4FHP A;  2HSZ A;  3C2M A;  3T79 A;  1GO3 F;  2JEF A;  4TQS A;  4UB8 U;  1C20 A;  3SAG A;  1JRO A;  8ICF A;  3RJG A;  3K1R B;  7ICU A;  3GZF A;  5KFT A;  3PR4 A;  1S8O A;  2HOQ A;  2KZ3 A;  4F4W A;  3ISD A;  1Y88 A;  4IG8 A;  3LWM A;  2JR5 A;  5GTH U;  2ATL A;  3GIL A;  5HRL A;  2Y1I A;  4DSJ A;  5KFN A;  4NXU A;  4NV0 A;  5ALU A;  2V4Q A;  5DGB A;  4X4U A;  4ATB A;  4K98 A;  1KTQ A;  3ISC A;  4ECV A;  9ICE A;  3SV4 A;  4QIW C;  1WYG A;  2JV3 A;  2XI9 A;  3H0M B;  4O3O A;  5L9X A;  4O6A A;  1ZQP A;  1R8C A;  4J03 A;  3Q8P B;  3SR6 A;  1Z1B A;  3OUY A;  4MFC A;  4RQ0 A;  1TVA A;  2Y0S C;  1EXN A;  1ZQR A;  3UMB A;  4QZB A;  3PML A;  3C5F A;  3EF2 A;  5KL1 B;  3PSP A;  2YX8 A;  3GIK A;  1RYR A;  2ZIV A;  1L3T A;  4UB2 A;  1XWL A;  4DFJ A;  2WB1 C;  1X42 A;  4IQT A;  2KSO A;  2A1J A;  3THV A;  5CP2 A;  4YD2 A;  3NVZ A;  1ZQF A;  5AIC A;  2I1Q A;  5KFY A;  3RAX A;  1ZQS A;  4EBJ A;  3UMG A;  2ZH2 A;  9ICJ A;  4IRD A;  2BCS A;  4WC2 A;  1U48 A;  3ONN A;  5KFP A;  1NK9 A;  3QX7 A;  3RB0 A;  3TAD A;  4B9M A;  4I2G A;  3MAB A;  1V85 A;  1YZ6 A;  2DR9 A;  1BPB A;  4QIW F;  1XC9 A;  3T5H A;  2K4H A;  9ICB A;  3HIL A;  1T4G A;  5AK3 A;  3H4D A;  4B9T A;  4DOC A;  3TKA A;  4BXO B;  2E8P A;  5ALZ A;  2KVC A;  1TAU A;  3KZI U;  4P4M A;  2KZM A;  4FHV A;  5KFE A;  3CYM A;  2W9M A;  3NGD A;  5DB8 A;  4O67 A;  3C1Z A;  4JLZ A;  7ICJ A;  7ICF A;  3PST A;  2BQ3 A;  4QWC A;  1L8O A;  2N1R A;  3FYH A;  1NKC A;  3D2Q A;  4IR9 A;  4FZM A;  2F44 A;  3KHH A;  2M2V A;  5KFO A;  1D9F A;  4DSI A;  1L7O A;  2PI5 A;  1RQL A;  1SKR A;  2WB1 F;  2C2E A;  4GC7 A;  1SL2 A;  2HHX A;  3C28 A;  1URJ A;  4MF2 A;  3HX0 A;  3H4B A;  1QQ7 A;  4JMU A;  2WFA A;  5HRI A;  1L3S A;  2OEH A;  4RQ1 A;  3LVW A;  4EEK A;  2HN1 A;  5AHX A;  4NXT A;  3AMZ A;  3SAH A;  1JXE A;  5DEC A;  4X4O A;  3OTQ A;  2W9A A;  4DEZ A;  1FIQ A;  4RNM A;  1L7M A;  1LKY A;  2KIV A;  4KB6 A;  3UQ2 A;  1MIW A;  2Y1J A;  4K9B A;  5III A;  4FH5 A;  2DPI A;  3JCF A;  5KFV A;  1ZQK A;  2V4R A;  2K8C B;  2H5X A;  3EW9 A;  5DQI A;  1Z19 A;  1SV4 A;  1NZP A;  8ICJ A;  1Q78 A;  2ZTE A;  4XQ8 A;  8ICP A;  5DG7 A; 
#chains in the Genus database with same CATH homology
 9ICK A;  1KSP A;  4QZE A;  4ED8 A;  4ED7 A;  1Z00 A;  3SYZ A;  4ECZ A;  5KFR A;  4UAW A;  3C5G A;  5IIK A;  2BCR A;  4O9M A;  5J0U A;  3H8S A;  5DB7 A;  1XS9 D;  4F91 B;  4ECX A;  2JZB A;  5KFS A;  4UB4 A;  4K4H A;  1WCN A;  2ZJA A;  3V6K A;  4JV1 A;  1S77 D;  5IIO A;  4PHE A;  1UA1 A;  2PI4 A;  4KLO A;  3H37 A;  2DR8 A;  4KLE A;  3BQ2 A;  4P2H A;  1TK0 A;  4HYK A;  4K4G A;  2M2T A;  3RJK A;  3HW8 A;  2FMQ A;  2FLP A;  4QZH A;  4DSF A;  4YCX A;  5KFB A;  1BPE A;  4UB3 A;  3MFI A;  3GIJ A;  4KLL A;  2FLL A;  1ZQT A;  4RUA A;  5J2J A;  4Q44 A;  4EYI B;  2PFQ A;  2KTQ A;  4IRK A;  4F5O A;  4DFM A;  3OVA A;  5J2H A;  4WCW A;  4RQ7 A;  5HRG A;  2AJQ A;  2ASL A;  3ETL A;  3T5J A;  7ICH A;  5D49 A;  3UPS A;  2AGO A;  1ZQL A;  4R65 A;  2IHN A;  2IHM A;  3IM1 A;  4C8K A;  4PHA A;  2W8L A;  4AT8 B;  4ECU A;  2W8K A;  5L1L A;  4JWM A;  1MSW D;  9ICX A;  4RU9 A;  4QZA A;  3RAQ A;  4NLZ A;  2NRX A;  5CWR A;  5BPC A;  3HIY A;  4KLS A;  8ICR A;  3AQK A;  4R8U A;  5KT4 A;  4GXK A;  3RR8 A;  1BNO A;  4J9O A;  4I2D A;  1NK4 A;  4F4Y A;  4ED1 A;  2IBK A;  8ICB A;  4WC6 A;  2BR0 A;  2BCQ A;  2JEJ A;  4O3Q A;  3GV8 B;  3PW0 A;  4QZI A;  3RJF A;  5KFM A;  4DS4 A;  1K1Q A;  3MFH A;  1ZQO A;  3ZD8 A;  4PHD A;  5KFH A;  3KHG A;  5TZV A;  1NK0 A;  4M9J A;  2HHQ A;  1ZQA A;  4Q45 A;  2P6U A;  1TKD A;  5J0Q A;  4DQP A;  5HR9 A;  3M8R A;  4O5C A;  4X5V A;  3Q8R B;  1D9D A;  5DBC A;  2IA6 A;  4IQU A;  4F2R A;  8ICH A;  2HHS A;  5HP4 A;  5KG1 A;  5KG3 A;  9ICQ A;  3PO5 A;  1R8A A;  4WC1 A;  1X9S A;  1JQR A;  2ZH7 A;  3PW7 A;  4B9N A;  4YXM A;  1MIY A;  2FPM A;  4DL3 A;  1MQ2 A;  4YG2 A;  2FMP A;  4O3R A;  7ICQ A;  4I2I A;  4BWM A;  4NLG A;  2ZH5 A;  3OJS A;  3C21 A;  4R64 A;  4ECW A;  7ICR A;  4AT9 B;  4WC7 A;  5J2F A;  3MDA A;  4RWP A;  4F5N A;  1KRP A;  1RPL A;  3C18 A;  5KT6 A;  4ED2 A;  1TK5 A;  1S76 D;  3T3F A;  3RB6 A;  2PFO A;  4M0A A;  2ZJ5 A;  2JZB B;  4YXJ A;  4E80 A;  1NKE A;  1TV9 A;  4I27 A;  1N56 A;  3HPO A;  9ICO A;  4RZR A;  3V6J A;  8ICT A;  5CB1 A;  1JMS A;  4RPZ A;  4ECQ A;  2ZJ8 A;  3V6H A;  3PR5 B;  4DF4 A;  1U45 A;  2ZTD A;  5HRH A;  2ZHA A;  3GII A;  2HHW A;  4RT3 A;  4RWN A;  3RB3 A;  1SL1 A;  5DB6 A;  2DVI A;  4WC5 A;  3RJH A;  7ICG A;  8ICY A;  3MGI A;  3WFQ E;  5BOM A;  4FO6 A;  3JZ0 A;  3C1Y A;  1NKB A;  4JK1 A;  4Q43 A;  4DF8 A;  3PX6 A;  4KLF A;  1B22 A;  1S0O A;  2KFZ A;  4B9U A;  4F4Z A;  1JN3 A;  4BWJ A;  3OHB A;  4FBT A;  4M9L A;  4PHP A;  5J0X A;  4YR0 A;  1NK8 A;  2PFP A;  3RJE A;  3AU2 A;  3C23 A;  4EZ9 A;  5KFL A;  3PW4 A;  4KLQ A;  4YN4 A;  3G6V A;  2BKE A;  3Q8Q B;  1RYS A;  4Q8F A;  4X4S A;  9ICA A;  3QZ8 A;  1FA0 A;  2AGP A;  1KEJ A;  1TK8 A;  2DPJ A;  1Q79 A;  2VAN A;  4UBC A;  2Q0Z X;  1NK5 A;  2VA2 A;  4JV2 A;  1U4B A;  1X9W A;  1ZJN A;  1NJW A;  2F1J A;  2C2D A;  5KG5 A;  4F93 B;  3AUO A;  8ICG A;  4XUS A;  4UQG A;  3EPG A;  3JPO A;  3LQC B;  1ZYQ A;  4KLT A;  4QZG A;  5KFG A;  1QSS A;  3M9N B;  5KG2 A;  3RTV A;  1SKW A;  4F4K A;  7ICM A;  4KLD A;  5D46 A;  4O5K A;  3QEB Z;  2C2R A;  4TUR A;  2XY7 A;  2P66 A;  5F9L A;  3JYY A;  2ZUD A;  4LZD A;  1JXL A;  3OSP A;  3WFO A;  4DO9 A;  4WC3 A;  1S10 A;  3PNC A;  9ICS A;  2FMS A;  2W9C B;  3IHQ B;  3TQ1 A;  4X4T A;  5L1J A;  3MGH A;  1IM4 A;  1WCL A;  3GFK B;  3MDC A;  5L1K A;  4UAZ A;  8ICZ A;  4X0A A;  4X4R A;  4X4Q A;  3V72 A;  4EBE A;  1NJY A;  4MEY A;  4YR3 A;  4P4P A;  1L5U A;  4WC0 A;  1SL0 A;  2ASJ A;  4M6W A;  4DL5 A;  2KN7 A;  3RJJ A;  2BPG A;  4F50 A;  2XY5 A;  4RQ3 A;  3TAP A;  2ZTC A;  1XSL A;  1BPZ A;  1XU4 A;  1R8B A;  4XRH A;  1MC8 A;  4I2F A;  5J2A A;  1HUO A;  4LT6 A;  3ORY A;  3KHR A;  7ICN A;  3JPP A;  4RQ8 A;  4TUQ A;  4RT2 A;  5DLF A;  3QE9 Y;  2R8G A;  1DK2 A;  4J9R A;  3AQM A;  4Z6F A;  3ZDA A;  4FS2 A;  4F4X A;  4EBD A;  3HP6 A;  4CCH A;  4EEY A;  9ICM A;  4EP7 A;  1ARO P;  2DRA A;  2ID1 A;  2ALZ A;  4RPX A;  5EWG A;  4GC6 A;  3HJ4 A;  3SI8 A;  8ICS A;  2FLN A;  4G3I A;  2MAX A;  3QZ7 A;  5KFC A;  3RH5 A;  2FPL A;  3UXO A;  2BQR A;  1ZQB A;  3M8S A;  4M9H A;  4KMU A;  1UET A;  4GXI A;  5D4B A;  1ZQG A;  7ICV A;  2FPK A;  3HWT A;  3MR5 A;  3BQ0 A;  8ICW A;  4ECS A;  2BPC A;  1JIH A;  3ZDE A;  2BCV A;  2OWO A;  4FH3 A;  4O3N A;  3ZDC A;  1Z3E B;  3PW2 A;  1ZQZ A;  3PX0 A;  9ICT A;  1TFR A;  5J0O A;  4UB5 A;  2XCA A;  2RDI A;  4O0I A;  1YLQ A;  4FHY A;  1L3V A;  2LYH A;  4DL7 A;  1VFG A;  4YVZ A;  4NY8 A;  3LWL A;  5KFJ A;  2M2W A;  4I2J A;  4RPY A;  3LK9 A;  4XA5 A;  4J9S A;  2XGQ A;  2HHV A;  3OV7 A;  1NO5 A;  4I29 A;  4R66 A;  4WBY A;  1RXV A;  2J6U A;  3C66 A;  5CJ7 A;  1SKS A;  3H7I A;  5DLG A;  4UBB A;  5DG8 A;  8ICA A;  2RDJ A;  5KFA A;  4UD5 A;  4NKU A;  3MR3 A;  4NKT A;  5J0T A;  1A76 A;  5J0W A;  5BOL A;  1UA0 A;  5IIJ A;  1MQ3 A;  4C8O A;  4I2B A;  5J2K A;  9ICG A;  4DFK A;  1KFD A;  4C8N A;  1U9L A;  4AT7 A;  3ZD9 A;  2XCP A;  4KLJ A;  4I2H A;  4FHX A;  1ZQU A;  5KFK A;  2W9B B;  2W9C A;  4DL6 A;  4M6W B;  1BGX T;  3ISB A;  2UVV A;  4Z6C A;  4NLN A;  5KG6 A;  5HMM A;  1S97 A;  4PGQ A;  7ICO A;  4RUC A;  1NOM A;  1LV5 A;  4KN4 A;  8ICI A;  5DQH A;  1COO A;  4Z6E A;  3ZDB A;  1CEZ A;  3N97 B;  5F2V O;  5KT7 A;  1S9F A;  4IR1 A;  3OVS A;  1UT8 A;  2XC9 A;  5CA7 A;  4ATB B;  5HC9 A;  4X0B A;  4X4N A;  4ED3 A;  1QTM A;  3OHA A;  5KG4 A;  3AQN A;  3TAR A;  1NJZ A;  4RQ2 A;  3RH4 A;  4BDP A;  1X9M A;  1L3U A;  5KFZ A;  3V7J A;  4RQ5 A;  4KTQ A;  3EYZ A;  5IIN A;  1TAQ A;  2PBE A;  3H8W A;  2DRB A;  4MF8 A;  4F5P A;  2C22 A;  4EBC A;  2NRV A;  4B9L A;  3PX4 A;  2XY6 A;  5KT2 A;  5DDY A;  4NM2 A;  4PPX A;  2HW3 A;  8ICO A;  8ICM A;  4QWB A;  4MFF A;  4Z6D A;  4FHW A;  3MBY A;  4QW8 A;  3NTU A;  3C2L A;  5HRD A;  2HVI A;  2BQU A;  5DBB A;  5J2B A;  4DQR A;  2V9W A;  9ICL A;  3OUY B;  1A77 A;  3EWA A;  5J0Y A;  1TFW A;  3OVB A;  5HML A;  4I2E A;  3EPI A;  5J0P A;  1BPD A;  1WOT A;  1XSN A;  4B9V A;  3GV7 B;  3JPN A;  1JX4 A;  3T5K A;  4NXZ A;  2XGP A;  1SZP A;  4C8M A;  1T3N A;  4DQI A;  4M47 A;  9ICR A;  1KFT A;  4DL4 A;  2BE3 A;  2ZH3 A;  1RXW A;  3H40 A;  4F3O A;  1HJP A;  4MEX A;  4E7X A;  4DSE A;  4ED6 A;  2HHP A;  5EWE A;  1N48 A;  4FHP A;  3C2M A;  1BNP A;  7ICE A;  5DGA A;  5HRK A;  4YMN A;  3ZDD A;  1UEV A;  4IQW A;  3EZ5 A;  4UD4 A;  3PMN A;  2ASD A;  4DSL A;  2ZH1 A;  1BPY A;  3TFR A;  4P4O A;  2JEF A;  4TQS A;  3HJ1 A;  5KFX A;  1QLN A;  4C8L A;  1QSY A;  9ICI A;  5J2G A;  4ELU A;  4F92 B;  4O3S A;  1QSL A;  4R63 A;  2BPF A;  8ICF A;  3RJG A;  3PV8 A;  1VJ7 A;  3TAN A;  7ICU A;  4AT7 B;  4J9N A;  5KFT A;  3PR4 A;  4DWI A;  2NRZ A;  9ICN A;  1H38 A;  2J6S A;  2KZ3 A;  8ICE A;  4F4W A;  2RFF A;  3ISD A;  4M2Y A;  1Y88 A;  4FS1 A;  3GQC A;  1ZQN A;  3GIM A;  2Q66 A;  4IG8 A;  4JUZ A;  2W9B A;  3LWM A;  4QWD A;  3GDX A;  4Q8E A;  4KN7 A;  3TI0 A;  5L1I A;  2ATL A;  3RRH A;  4I2C A;  3H8J A;  3GIL A;  5HHI A;  4YR2 A;  3BDP A;  9ICP A;  5HRL A;  4O3P A;  3AQL A;  1C7Y A;  2Y1I A;  4DSJ A;  2DR7 A;  5KFN A;  2V4Q A;  4E8F A;  5CHG A;  2PXI A;  4M04 A;  5DGB A;  4X4U A;  2F1I A;  3TFS A;  1V9P A;  4UB1 A;  4ATB A;  1KTQ A;  5KFU A;  3MR6 A;  1S0M A;  3ISC A;  2ZUC A;  4ECV A;  3BQ1 A;  3SV4 A;  4F8R A;  9ICE A;  1ZQH A;  2AQ0 A;  2DR5 A;  7ICT A;  1NK7 A;  3Q8K A;  3N4M B;  4EBK A;  2NRW A;  4XQ7 A;  2ZH8 A;  4ECT A;  2R8J A;  4WBZ A;  5DQG A;  4O3O A;  3UPQ A;  4IQV A;  2DFL A;  5EWF A;  1ZQD A;  5L9X A;  1ZQP A;  3Q8M A;  2PFN A;  1BVS A;  4MFA A;  1ZET A;  4I28 A;  1R8C A;  4BXO A;  3Q8P B;  2O1P A;  4BGD A;  5JUM A;  1ZQI A;  1S0N A;  2UVW A;  4F5Q A;  4NM1 A;  3MR2 A;  2R8H A;  3OUY A;  2UVU A;  4J9L A;  2MUT A;  4MFC A;  4RQ0 A;  2XO7 A;  1TVA A;  2ISO A;  1U49 A;  9ICF A;  2JEI A;  5HRE A;  1EXN A;  2M9N A;  1ZQR A;  4QZB A;  1ZQQ A;  4YD1 A;  3PML A;  3C5F A;  3LDA A;  1LB2 B;  2HHT A;  4KLH A;  4RNO A;  4S3N A;  3GIK A;  1RYR A;  4DOA A;  1BPX A;  1L3T A;  4UB2 A;  9ICH A;  2J6T A;  1B43 A;  2AU0 A;  1XWL A;  4YMO A;  4DFJ A;  4UAY A;  3Q8L A;  5KG0 A;  3WFP A;  3RB4 A;  7ICI A;  2VA8 A;  8ICU A;  3G6Y A;  4IQT A;  3PVX A;  5F9N A;  2A1J A;  3THV A;  5CP2 A;  1D8Y A;  4YD2 A;  5DG9 A;  2WTF A;  1KDH A;  2BDP A;  9ICC A;  3H3A A;  1ZQW A;  1ZQF A;  4O5E A;  2I1Q A;  1UT5 A;  5KFY A;  3OSN A;  3KHL A;  3RAX A;  1RZT A;  1ZQS A;  2VA3 A;  4EBJ A;  3QEA Z;  2ZH2 A;  1NJX A;  4ZH4 A;  9ICJ A;  3M9O B;  4IRD A;  3B0X A;  4QZD A;  3JPQ A;  3C2K A;  4J9Q A;  4DLG A;  3V7K A;  2BGW A;  1U48 A;  1ZQM A;  4RNN A;  2BCS A;  2HVH A;  5KFP A;  4WC2 A;  4TQR A;  1NK9 A;  5DB9 A;  5C5J A;  5KFW A;  4PGY A;  3K4G A;  4LVS A;  1KFS A;  7ICS A;  4DOB A;  3OJU A;  4WC4 A;  5HNK A;  3RB0 A;  3JPR A;  4ELV A;  5KT5 A;  4B9M A;  4I2G A;  4QW9 A;  4DQS A;  1TFY A;  3MAB A;  3JPT A;  3TAQ A;  1ZJM A;  5J2E A;  3M9M B;  4J9M A;  5CR0 A;  2B21 A;  2BCU A;  1PX5 A;  4YFK A;  3RJI A;  2DR9 A;  2R8K A;  1BPB A;  5DED A;  4X4P A;  8ICK A;  1XC9 A;  3T5H A;  4IRC A;  8ICC A;  5HRB A;  2NRT A;  9ICB A;  1T4G A;  3T5L A;  1XSP A;  3H4D A;  4YQW A;  4B9T A;  4QZC A;  4RWO A;  3BJY A;  4DOC A;  5IIL A;  5J2D A;  5HHH A;  9ICU A;  5KTQ A;  4DSK A;  3H38 A;  4BXO B;  4PH5 A;  2F1H A;  3K75 D;  3G6X A;  1DGS A;  4ELT A;  1TAU A;  3V7L A;  4P4M A;  1K1S A;  4KIT B;  4J9P A;  3RRG A;  2KZM A;  4QWE A;  1U47 A;  4FHV A;  5KFE A;  2MUT B;  2W9M A;  3NGD A;  3L9D A;  5DB8 A;  1Z00 B;  4QZ9 A;  3C1Z A;  4GLX A;  7ICK A;  7ICJ A;  4TUS A;  4M9N A;  1DK3 A;  4YP3 A;  1ZQJ A;  7ICF A;  2BQ3 A;  2AGQ A;  1IXR A;  3KTQ A;  2ZH6 A;  2BHN A;  4QWC A;  2ZUB A;  3RH6 A;  2ISP A;  3FYH A;  1NKC A;  2JEG A;  4EZ6 A;  4K4I A;  4IR9 A;  4PGX A;  1ZQY A;  8ICX A;  5EOZ A;  5J29 A;  4M5D A;  3PW5 A;  1PZN A;  4KLM A;  1ZQC A;  1X2I A;  4JV0 A;  3KHH A;  2M2V A;  5KFO A;  4KLU A;  1V4A A;  3NYB A;  3RBD A;  1D9F A;  4DSI A;  2PI5 A;  2I9G A;  5KT3 A;  2GWS A;  1SKR A;  3JPS A;  4ED0 A;  2C2E A;  4GC7 A;  4DL2 A;  3PY8 A;  2KP7 A;  1MIV A;  2ZHB A;  2A1J B;  4YMM A;  5J2C A;  1SL2 A;  4FBU A;  4J9K A;  1T7P A;  2HHX A;  1D8L A;  4E0D A;  2IMW P;  4QZF A;  4MF2 A;  4TUP A;  4DLE A;  5KFD A;  1NK6 A;  3HX0 A;  3H4B A;  4KLI A;  1KNY A;  2C28 A;  3WFS C;  5DDM A;  5DBA A;  5HRI A;  3UXP A;  1L3S A;  4RQ1 A;  3RR7 A;  4R8U B;  1ZQE A;  1UEU A;  4ECY A;  4B9S A;  4I2A A;  3B0Y A;  2M2U A;  7ICL A;  4AT8 A;  3UQ0 A;  1JXE A;  5J0R A;  3GV5 B;  3SZ2 A;  2W9A A;  8ICQ A;  1JAJ A;  5KFF A;  5DEC A;  4X4O A;  1CUK A;  1XO1 A;  3RBE A;  4DQQ A;  7ICP A;  2ZH9 A;  4DEZ A;  3Q8S B;  3SV3 A;  4RNM A;  4GXJ A;  2AQ4 A;  3UXN A;  4QZ8 A;  4QWA A;  3UQ2 A;  5KFI A;  1MIW A;  1T8E A;  5KFQ A;  1Q78 A;  5HRF A;  1R89 A;  4RQ6 A;  4RWQ A;  3FDS A;  1KLN A;  4F2S A;  2Y1J A;  5J2I A;  4F5R A;  1F5A A;  3WFR E;  2KZZ A;  3H39 A;  4NLK A;  4EYH B;  2P6R A;  8ICL A;  5III A;  2KFN A;  2HHU A;  3BQT A;  1OU5 A;  4FH5 A;  2DPI A;  4JWN A;  4M9G A;  9ICW A;  9ICV A;  2NRK A;  4DS5 A;  8ICN A;  5KFV A;  1DOQ A;  1ZQK A;  8ICV A;  2O5A A;  5KG7 A;  4RQ4 A;  2ZH4 A;  4LZG A;  1S0V A;  2V4R A;  3PO4 A;  2H5X A;  1ZQV A;  5IIM A;  4X4V A;  3EW9 A;  5DQI A;  1ZQX A;  5J0S A;  1HUZ A;  8ICJ A;  3HT3 A;  3AU6 A;  2R8I A;  1NZP A;  3E2E A;  2UVR A;  2ZTE A;  4XQ8 A;  4ECR A;  3OGU A;  4DFP A;  4AT9 A;  4KLG A;  5DKW A;  8ICP A;  5DG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...