2M2VA

African swine fever virus pol x in the ternary complex with mgdgtp and dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
molecule keywords Repair DNA polymerase X
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2vA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2vA01
5J2IA 2ZH7A 4O5EA 4M47A 2HHPA 4QZEA 2W9MA 1TV9A 1ZQUA 2ISOA 5J29A 1TVAA 4PGXA 3L9DA 3V7KA 4YMNA 4I2GA 1ZQKA 1XSLA 4F5QA 4RPYA 4KLTA 3H38A 4X4UA 4PHEA 1R8AA 9ICEA 4FH5A 1XSNA 9ICNA 3RJKA 4M0AA 1MIWA 4UBCA 1ZQGA 3UQ2A 1BPDA 3UXPA 8ICLA 3MBYA 1TFWA 5HRKA 4I2DA 9ICXA 3C18A 3MDAA 3AU2A 2DVIA 3WFPA 4WC2A 1ZQSA 4NXZA 3AQKA 5BOMA 3JPPA 4AT9A 2NRKA 4M9LA 4I29A 4UAZA 2PFNA 3H3AA 2PXIA 3WFRE 5BPCA 3JPRA 4XA5A 1R8BA 4QZFA 4YN4A 5DDYA 5IINA 8ICRA 5DBBA 8ICUA 3AU6A 4K4GA 4IG8A 4YMOA 4LZDA 5J2BA 8ICIA 3WFSC 4O9MA 3RH6A 2PFQA 5BOLA 5HC9A 4QZAA 3V7LA 3RJGA 1UEUA 5J2JA 5J0WA 4KLIA 1ZQQA 4F5NA 4FO6A 7ICJA 3OVSA 4TUQA 1F5AA 4X4OA 3RJHA 2DRBA 2DR9A 9ICGA 1JQRA 4Z6CA 8ICFA 4WC1A 1KNYA 1ZQMA 8ICNA 4FHXA 2ZH9A 4GXKA 4QZDA 4KLFA 1NO5A 2M2UA 4M04A 3C5GA 2PFPA 4NY8A 9ICVA 1ZQDA 1ZQVA 3H37A 1UETA 4I27A 1ZQJA 3JPQA 8ICGA 1Q78A 1ZQTA 3WFQE 4RWQA 5J0OA 4WCWA 3C5FA 2PFOA 1ZQNA 4UD5A 4QZCA 5HHHA 4F5PA 1ZQRA 1R89A 7ICVA 1BPZA 8ICHA 4X4QA 5J2FA 4RQ0A 2BCVA 4WC0A 4WC7A 3TFSA 2I9GA 2FMPA 9ICLA 4KLLA 3LK9A 4KLUA 3NYBA 4X4SA 5CJ7A 4S3NA 5HRFA 4IQVA 7ICTA 4DO9A 1ZQYA 4K4IA 8ICJA 1BPBA 4RQ4A 3OV7A 4EBKA 7ICNA 8ICPA 4LZGA 2DRAA 2ISPA 4K4HA 9ICTA 1YLQA 1BPXA 4I2CA 3MGHA 7ICGA 4RQ8A 4M9GA 1R8CA 3RJIA 4XQ8A 4KLQA 5CWRA 4X4PA 2ZHBA 4PHAA 8ICYA 2FMQA 3OUYB 4UAWA 1ZQAA 3PMNA 8ICOA 4QZBA 7ICRA 5J0TA 7ICSA 3V72A 3UPSA 5J2DA 4RQ3A 4NLKA 4I2JA 2RFFA 4TUPA 3OGUA 5D46A 9ICIA 8ICEA 9ICRA 3HIYA 5IIJA 1ZQEA 2BCQA 4QZGA 2FMSA 1ZJMA 2ZH4A 5DKWA 4KLHA 2DR7A 4NM1A 4UAYA 4R66A 3OUYA 5DB7A 1MQ2A 2DR8A 4RPXA 5HHIA 2BPGA 3PMLA 4AT7A 4DOCA 1XSPA 4X4VA 3RJJA 4I2EA 4UB2A 4YCXA 5J0RA 9ICSA 1HUOA 4M9JA 4PGQA 4IQTA 8ICCA 4RWPA 4X4RA 2BPCA 5TZVA 4QZIA 4F5RA 4X0BA 3RJFA 5J0PA 4I28A 5HRIA 3WFOA 4UB3A 7ICPA 5IIOA 9ICHA 7ICMA 5J0QA 3OVBA 2GWSA 3HJ4A 7ICHA 4RQ1A 3C2MA 1OU5A 4GXJA 5J0UA 4O5KA 4TURA 4MF2A 9ICWA 4DOAA 4M9NA 4PHPA 5J2GA 4WC5A 9ICKA 4AT7B 3ISBA 3JPSA 7ICQA 4WC3A 3H39A 4KLEA 4X0AA 2P66A 5HRDA 3UXNA 5CP2A 4JWNA 4FHPA 4RQ6A 8ICQA 4WBYA 1PX5A 3AQMA 4UBBA 5HRGA 4I2AA 4RQ7A 4O5CA 3HX0A 8ICAA 4NKUA 5CB1A 5J2EA 5EOZA 5DBCA 5HRBA 4M2YA 4X4TA 9ICPA 2BE3A 8ICTA 4RWOA 4R64A 2O5AA 4UB1A 3JPTA 8ICWA 1ZQWA 5F2VO 4I2BA 4LVSA 4F5OA 3MDCA 2BCUA 1ZJNA 4FH3A 1HUZA 4R63A 3JPNA 2BCSA 2IHMA 8ICKA 7ICLA 9ICUA 2Q66A 4KLDA 1TFYA 9ICAA 4IQUA 5HR9A 1NOMA 3RH5A 4LT6A 4MF8A 7ICUA 4FHVA 4MFFA 4PH5A 4TUSA 4PHDA 1VJ7A 2PBEA 5IIIA 2BPFA 4NLNA 9ICBA 4NKTA 4AT9B 2ZH1A 4WC6A 2ZH5A 1ZQOA 2M2TA 3C2KA 4NM2A 3AUOA 4UD4A 2ZH3A 5J0XA 1JAJA 4PPXA 7ICEA 2ZH2A 1BPYA 4DOBA 5DB9A 4GXIA 3LQCB 4EBJA 4RQ5A 4QZ9A 3C66A 4ATBB 4Z6DA 9ICQA 2ID1A 1KDHA 5CHGA 5J2KA 4P4PA 3K75D 4YD1A 4P2HA 4WC4A 5IILA 4M5DA 5DDMA 4IQWA 1BPEA 4NLZA 5DB8A 4KLOA 3C2LA 1ZQHA 4MFCA 7ICIA 1WOTA 1RPLA 4KLJA 4RPZA 7ICKA 8ICSA 4JWMA 4MFAA 3JPOA 2M2VA 9ICJA 4XQ7A 5DECA 4I2HA 9ICMA 5HREA 5J2CA 3AQLA 3RJEA 4I2IA 8ICXA 4Z6EA 5HRHA 2O1PA 5IIMA 8ICZA 4KLMA 5IIKA 4WBZA 2DR5A 4XUSA 4X5VA 9ICOA 4YD2A 4YMMA 3UPQA 4AT8A 4FHYA 4FHWA 3GDXA 1UEVA 5J0SA 1FA0A 1ZQPA 3V7JA 3B0XA 1RZTA 4QZ8A 3HWTA 4RWNA 4PGYA 4P4OA 4RQ2A 4RT3A 1ZQFA 2BCRA 5CA7A 4I2FA 4KLSA 1MIVA 4M9HA 2M2WA 1MQ3A 4EP7A 4P4MA 1ZQBA 5J2AA 2VANA 5DB6A 4E80A 1ZQLA 3JZ0A 5D4BA 5CR0A 4QZHA 3HJ1A 4AT8B 1ZQXA 2ZH8A 1JMSA 5HRLA 3ISDA 3UQ0A 1VFGA 3MGIA 1ZQIA 4KLGA 5DEDA 1KEJA 8ICMA 4UB5A 4ATBA 1V4AA 3HW8A 4UB4A 8ICBA 3OVAA 1JN3A 2ZH6A 3UXOA 3PNCA 3RH4A 2ZHAA 4E7XA 3JYYA 1Q79A 5J0YA 4X4NA 5J2HA 7ICFA 9ICCA 5D49A 1ZQZA 9ICFA 4E8FA 3ISCA 3B0YA 4Z6FA 4RT2A 4XRHA 4R65A 5DBAA 7ICOA 1MIYA 3TFRA 3AQNA 1ZQCA 8ICVA
chains in the Genus database with same CATH superfamily
5J2IA 2ZH7A 5D61A 4O5EA 4M47A 2HHPA 4QZEA 2W9MA 1TV9A 1ZQUA 2ISOA 5J29A 1TVAA 4PGXA 3L9DA 3V7KA 4YMNA 4I2GA 1ZQKA 1XSLA 4F5QA 4RPYA 4KLTA 5B3QA 3H38A 4X4UA 4PHEA 1R8AA 1GPJA 9ICEA 4FH5A 1XSNA 9ICNA 3RJKA 4M0AA 1MIWA 4UBCA 1ZQGA 2BBJA 3UQ2A 1BPDA 3UXPA 8ICLA 3MBYA 4K97A 1TFWA 5HRKA 4I2DA 4K96A 9ICXA 3MCRA 3C18A 3MDAA 3AU2A 2DVIA 3WFPA 4WC2A 5JTGA 1ZQSA 4NXZA 3AQKA 5BOMA 3JPPA 4FO1A 5CFTA 4XJEA 4AT9A 4EGWA 2NRKA 4M9LA 4I29A 4UAZA 2PFNA 3H3AA 2PXIA 4MKPA 3WFRE 5BPCA 3JPRA 4XA5A 1R8BA 4QZFA 4YN4A 5DDYA 5IINA 8ICRA 4K9AA 5DBBA 8ICUA 3AU6A 4K4GA 4OAFA 4IG8A 4YMOA 4LZDA 5J2BA 4OAIZ 8ICIA 3WFSC 4O9MA 3RH6A 3ER8C 2PFQA 4I0UA 5BOLA 5HC9A 4QZAA 3V7LA 3RJGA 1UEUA 5J2JA 5J0WA 4KLIA 1ZQQA 4F5NA 2B56A 4FO6A 7ICJA 3OVSA 4TUQA 1F5AA 4X4OA 3RJHA 2DRBA 2DR9A 2EWRA 9ICGA 1JQRA 4Z6CA 8ICFA 4WC1A 1KNYA 1ZQMA 8ICNA 4FHXA 2ZH9A 4GXKA 4QZDA 4KLFA 1NO5A 2M2UA 4M04A 3C5GA 2PFPA 4NY8A 9ICVA 1ZQDA 4JLZA 1ZQVA 3H37A 1UETA 4I27A 1ZQJA 3JPQA 8ICGA 1Q78A 3NVOA 1ZQTA 3WFQE 4RWQA 5J0OA 4WCWA 3C5FA 2PFOA 1ZQNA 4NXTA 4UD5A 4QZCA 5HHHA 4F5PA 1ZQRA 1R89A 7ICVA 1BPZA 8ICHA 4X4QA 5J2FA 4NXVA 4RQ0A 2BCVA 4WC0A 4WC7A 3TFSA 4NXXA 2I9GA 2FMPA 9ICLA 4KLLA 3LK9A 4KLUA 3NYBA 4X4SA 5CJ7A 4S3NA 5HRFA 4IQVA 7ICTA 4HX0A 4DO9A 1ZQYA 4K4IA 8ICJA 1BPBA 4RQ4A 2FCLA 3OV7A 4EBKA 2B4VA 7ICNA 8ICPA 4LZGA 2DRAA 2ISPA 4KB6A 4K4HA 9ICTA 1YLQA 1BPXA 4I2CA 3MGHA 7ICGA 4RQ8A 4M9GA 2IHOA 1R8CA 3RJIA 4XQ8A 4KLQA 5CWRA 4X4PA 2ZHBA 4PHAA 8ICYA 2FMQA 3OUYB 4UAWA 1ZQAA 3OWGA 3PMNA 8ICOA 4QZBA 7ICRA 5J0TA 7ICSA 3V72A 3UPSA 5J2DA 4RQ3A 4NLKA 4I2JA 2RFFA 4TUPA 4WOYA 3OGUA 5D46A 9ICIA 8ICEA 9ICRA 3HIYA 5IIJA 1ZQEA 2BCQA 4QZGA 2FMSA 1ZJMA 4EEBA 2ZH4A 5DKWA 4KLHA 2DR7A 4NM1A 4UAYA 4R66A 3OUYA 3ER9B 5DB7A 1MQ2A 2DR8A 4RPXA 5HHIA 2BPGA 3PMLA 4AT7A 4DOCA 1XSPA 4X4VA 3RJJA 4I2EA 4UB2A 4YCXA 5J0RA 9ICSA 1HUOA 4M9JA 4PGQA 4IQTA 8ICCA 4RWPA 4X4RA 2BPCA 5TZVA 4QZIA 4F5RA 4X0BA 3RJFA 5J0PA 4I28A 4K99A 4O69A 5HRIA 3WFOA 4UB3A 7ICPA 5IIOA 9ICHA 7ICMA 5J0QA 3OVBA 2GWSA 3HJ4A 7ICHA 4OAHA 4RQ1A 3C2MA 1OU5A 4GXJA 5J0UA 4O5KA 4N7RA 4TURA 4MF2A 9ICWA 4DOAA 4M9NA 4PHPA 5J2GA 4WC5A 9ICKA 4AT7B 3ISBA 3JPSA 7ICQA 3EF2A 4LEWA 3H39A 4WC3A 4WQLA 4KLEA 4X0AA 2P66A 5HRDA 3UXNA 5CP2A 4JWNA 4FHPA 2BBHA 4RQ6A 8ICQA 4WBYA 1PX5A 3AQMA 4UBBA 5HRGA 3NWIA 4I2AA 3NKUA 4RQ7A 4O5CA 4EV6A 3HX0A 8ICAA 4NKUA 5CB1A 5J2EA 5EOZA 2IUBA 5DBCA 5HRBA 4M2YA 4X4TA 9ICPA 2BE3A 8ICTA 4RWOA 4R64A 2O5AA 4UB1A 3JPTA 8ICWA 1ZQWA 5F2VO 4I2BA 2GAFD 3ERCC 4LVSA 4F5OA 3JCFA 5CHEA 3MDCA 2BCUA 1ZJNA 3K7DA 4FH3A 1HUZA 4R63A 3JPNA 2BCSA 2IHMA 8ICKA 7ICLA 9ICUA 2Q66A 4KLDA 1TFYA 9ICAA 4LEZA 4IQUA 5HR9A 1NOMA 3RH5A 4LT6A 4MF8A 7ICUA 4FHVA 5D62A 4MFFA 4PH5A 4TUSA 4PHDA 1VJ7A 2PBEA 4K98A 5IIIA 2BPFA 4NLNA 9ICBA 4NKTA 4AT9B 2ZH1A 4WC6A 2ZH5A 1ZQOA 2M2TA 3C2KA 4NM2A 3AUOA 4UD4A 2ZH3A 4LEYA 5J0XA 1JAJA 4PPXA 7ICEA 2ZH2A 1BPYA 4DOBA 5DB9A 4GXIA 3LQCB 3PHZA 4NXWA 4RQ5A 4EBJA 4QZ9A 3C66A 4ATBB 4Z6DA 9ICQA 2ID1A 1KDHA 5CHGA 4K8VA 5J2KA 4P4PA 3K75D 4YD1A 4P2HA 4WC4A 5IILA 4M5DA 5DDMA 4IQWA 1BPEA 4NLZA 5DB8A 4KLOA 3C2LA 1ZQHA 4MFCA 7ICIA 1WOTA 1RPLA 4KLJA 4RPZA 7ICKA 8ICSA 4O68A 4JWMA 4MFAA 3JPOA 2M2VA 9ICJA 4XQ7A 5DECA 4I2HA 9ICMA 5HREA 5J2CA 3AQLA 3RJEA 4JLXA 4I2IA 8ICXA 4Z6EA 5HRHA 4WH5A 2O1PA 5IIMA 8ICZA 4KLMA 4EEDA 5IIKA 4WBZA 2DR5A 4XUSA 4WQKA 2B51A 4X5VA 9ICOA 4YD2A 4YMMA 3UPQA 4AT8A 4NXUA 4FHYA 4FHWA 4K9BA 3GDXA 1UEVA 5J0SA 1FA0A 1ZQPA 3V7JA 2HN1A 3B0XA 1RZTA 4O6AA 4QZ8A 3HWTA 2GA9D 4RWNA 4PGYA 4P4OA 4RQ2A 4RT3A 5CFSA 1ZQFA 2BCRA 5CA7A 4I2FA 4KLSA 1MIVA 4M9HA 2M2WA 1MQ3A 4EP7A 4KM5A 4P4MA 1ZQBA 5J2AA 2VANA 5DB6A 4E80A 1ZQLA 3JZ0A 5D4BA 5CR0A 4QZHA 3HJ1A 4AT8B 1ZQXA 2ZH8A 1JMSA 5HRLA 3ISDA 3UQ0A 5D63A 1VFGA 3MGIA 1ZQIA 5B3PA 4LEVA 4KLGA 5DEDA 1KEJA 8ICMA 4UB5A 4ATBA 1V4AA 3HW8A 4UB4A 8ICBA 3OVAA 1JN3A 5CFUA 2ZH6A 3UXOA 3PNCA 3RH4A 4OAGA 2ZHAA 4E7XA 3JYYA 2HN2A 1Q79A 5J0YA 4X4NA 5J2HA 7ICFA 9ICCA 3CK6A 5D49A 1ZQZA 9ICFA 4E8FA 3ISCA 3B0YA 4Z6FA 4RT2A 4XRHA 4R65A 5DBAA 7ICOA 1MIYA 3TFRA 3AQNA 1ZQCA 4O67A 8ICVA
chains in the Genus database with same CATH topology
5J2IA 2ZH7A 4O5EA 4M47A 2HHPA 4QZEA 2W9MA 1TV9A 1ZQUA 2ISOA 5J29A 1TVAA 4PGXA 3L9DA 3V7KA 4YMNA 4I2GA 1ZQKA 1XSLA 4F5QA 4RPYA 4KLTA 3H38A 4X4UA 4PHEA 1R8AA 9ICEA 4FH5A 1XSNA 9ICNA 3RJKA 4M0AA 1MIWA 4UBCA 1ZQGA 3UQ2A 1BPDA 3UXPA 8ICLA 3MBYA 1TFWA 5HRKA 4I2DA 9ICXA 3C18A 3MDAA 3AU2A 2DVIA 3WFPA 4WC2A 1ZQSA 4NXZA 3AQKA 5BOMA 3JPPA 4AT9A 2NRKA 4M9LA 4I29A 4UAZA 2PFNA 3H3AA 2PXIA 3WFRE 5BPCA 3JPRA 4XA5A 1R8BA 4QZFA 4YN4A 5DDYA 5IINA 8ICRA 5DBBA 8ICUA 3AU6A 4K4GA 4IG8A 4YMOA 4LZDA 5J2BA 8ICIA 3WFSC 4O9MA 3RH6A 2PFQA 5BOLA 5HC9A 4QZAA 3V7LA 3RJGA 1UEUA 5J2JA 5J0WA 4KLIA 1ZQQA 4F5NA 4FO6A 7ICJA 3OVSA 4TUQA 1F5AA 4X4OA 3RJHA 2DRBA 2DR9A 9ICGA 1JQRA 4Z6CA 8ICFA 4WC1A 1KNYA 1ZQMA 8ICNA 4FHXA 2ZH9A 4GXKA 4QZDA 4KLFA 1NO5A 2M2UA 4M04A 3C5GA 2PFPA 4NY8A 9ICVA 1ZQDA 1ZQVA 3H37A 1UETA 4I27A 1ZQJA 3JPQA 8ICGA 1Q78A 1ZQTA 3WFQE 4RWQA 5J0OA 4WCWA 3C5FA 2PFOA 1ZQNA 4UD5A 4QZCA 5HHHA 4F5PA 1ZQRA 1R89A 7ICVA 1BPZA 8ICHA 4X4QA 5J2FA 4RQ0A 2BCVA 4WC0A 4WC7A 3TFSA 2I9GA 2FMPA 9ICLA 4KLLA 3LK9A 4KLUA 3NYBA 4X4SA 5CJ7A 4S3NA 5HRFA 4IQVA 7ICTA 4DO9A 1ZQYA 4K4IA 8ICJA 1BPBA 4RQ4A 3OV7A 4EBKA 7ICNA 8ICPA 4LZGA 2DRAA 2ISPA 4K4HA 9ICTA 1YLQA 1BPXA 4I2CA 3MGHA 7ICGA 4RQ8A 4M9GA 1R8CA 3RJIA 4XQ8A 4KLQA 5CWRA 4X4PA 2ZHBA 4PHAA 8ICYA 2FMQA 3OUYB 4UAWA 1ZQAA 3PMNA 8ICOA 4QZBA 7ICRA 5J0TA 7ICSA 3V72A 3UPSA 5J2DA 4RQ3A 4NLKA 4I2JA 2RFFA 4TUPA 3OGUA 5D46A 9ICIA 8ICEA 9ICRA 3HIYA 5IIJA 1ZQEA 2BCQA 4QZGA 2FMSA 1ZJMA 2ZH4A 5DKWA 4KLHA 2DR7A 4NM1A 4UAYA 4R66A 3OUYA 5DB7A 1MQ2A 2DR8A 4RPXA 5HHIA 2BPGA 3PMLA 4AT7A 4DOCA 1XSPA 4X4VA 3RJJA 4I2EA 4UB2A 4YCXA 5J0RA 9ICSA 1HUOA 4M9JA 4PGQA 4IQTA 8ICCA 4RWPA 4X4RA 2BPCA 5TZVA 4QZIA 4F5RA 4X0BA 3RJFA 5J0PA 4I28A 5HRIA 3WFOA 4UB3A 7ICPA 5IIOA 9ICHA 7ICMA 5J0QA 3OVBA 2GWSA 3HJ4A 7ICHA 4RQ1A 3C2MA 1OU5A 4GXJA 5J0UA 4O5KA 4TURA 4MF2A 9ICWA 4DOAA 4M9NA 4PHPA 5J2GA 4WC5A 9ICKA 4AT7B 3ISBA 3JPSA 7ICQA 4WC3A 3H39A 4KLEA 4X0AA 2P66A 5HRDA 3UXNA 5CP2A 4JWNA 4FHPA 4RQ6A 8ICQA 4WBYA 1PX5A 3AQMA 4UBBA 5HRGA 4I2AA 4RQ7A 4O5CA 3HX0A 8ICAA 4NKUA 5CB1A 5J2EA 5EOZA 5DBCA 5HRBA 4M2YA 4X4TA 9ICPA 2BE3A 8ICTA 4RWOA 4R64A 2O5AA 4UB1A 3JPTA 8ICWA 1ZQWA 5F2VO 4I2BA 4LVSA 4F5OA 3MDCA 2BCUA 1ZJNA 4FH3A 1HUZA 4R63A 3JPNA 2BCSA 2IHMA 8ICKA 7ICLA 9ICUA 2Q66A 4KLDA 1TFYA 9ICAA 4IQUA 5HR9A 1NOMA 3RH5A 4LT6A 4MF8A 7ICUA 4FHVA 4MFFA 4PH5A 4TUSA 4PHDA 1VJ7A 2PBEA 5IIIA 2BPFA 4NLNA 9ICBA 4NKTA 4AT9B 2ZH1A 4WC6A 2ZH5A 1ZQOA 2M2TA 3C2KA 4NM2A 3AUOA 4UD4A 2ZH3A 5J0XA 1JAJA 4PPXA 7ICEA 2ZH2A 1BPYA 4DOBA 5DB9A 4GXIA 3LQCB 4EBJA 4RQ5A 4QZ9A 3C66A 4ATBB 4Z6DA 9ICQA 2ID1A 1KDHA 5CHGA 5J2KA 4P4PA 3K75D 4YD1A 4P2HA 4WC4A 5IILA 4M5DA 5DDMA 4IQWA 1BPEA 4NLZA 5DB8A 4KLOA 3C2LA 1ZQHA 4MFCA 7ICIA 1WOTA 1RPLA 4KLJA 4RPZA 7ICKA 8ICSA 4JWMA 4MFAA 3JPOA 2M2VA 9ICJA 4XQ7A 5DECA 4I2HA 9ICMA 5HREA 5J2CA 3AQLA 3RJEA 4I2IA 8ICXA 4Z6EA 5HRHA 2O1PA 5IIMA 8ICZA 4KLMA 5IIKA 4WBZA 2DR5A 4XUSA 4X5VA 9ICOA 4YD2A 4YMMA 3UPQA 4AT8A 4FHYA 4FHWA 3GDXA 1UEVA 5J0SA 1FA0A 1ZQPA 3V7JA 3B0XA 1RZTA 4QZ8A 3HWTA 4RWNA 4PGYA 4P4OA 4RQ2A 4RT3A 1ZQFA 2BCRA 5CA7A 4I2FA 4KLSA 1MIVA 4M9HA 2M2WA 1MQ3A 4EP7A 4P4MA 1ZQBA 5J2AA 2VANA 5DB6A 4E80A 1ZQLA 3JZ0A 5D4BA 5CR0A 4QZHA 3HJ1A 4AT8B 1ZQXA 2ZH8A 1JMSA 5HRLA 3ISDA 3UQ0A 1VFGA 3MGIA 1ZQIA 4KLGA 5DEDA 1KEJA 8ICMA 4UB5A 4ATBA 1V4AA 3HW8A 4UB4A 8ICBA 3OVAA 1JN3A 2ZH6A 3UXOA 3PNCA 3RH4A 2ZHAA 4E7XA 3JYYA 1Q79A 5J0YA 4X4NA 5J2HA 7ICFA 9ICCA 5D49A 1ZQZA 9ICFA 4E8FA 3ISCA 3B0YA 4Z6FA 4RT2A 4XRHA 4R65A 5DBAA 7ICOA 1MIYA 3TFRA 3AQNA 1ZQCA 8ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2I A;  2ZH7 A;  4O5E A;  4M47 A;  2HHP A;  4QZE A;  2W9M A;  1TV9 A;  1ZQU A;  2ISO A;  5J29 A;  1TVA A;  4PGX A;  3L9D A;  3V7K A;  4YMN A;  4I2G A;  1ZQK A;  1XSL A;  4F5Q A;  4RPY A;  4KLT A;  3H38 A;  4X4U A;  4PHE A;  1R8A A;  9ICE A;  4FH5 A;  1XSN A;  9ICN A;  3RJK A;  4M0A A;  1MIW A;  4UBC A;  1ZQG A;  3UQ2 A;  1BPD A;  3UXP A;  8ICL A;  3MBY A;  1TFW A;  5HRK A;  4I2D A;  9ICX A;  3C18 A;  3MDA A;  3AU2 A;  2DVI A;  3WFP A;  4WC2 A;  1ZQS A;  4NXZ A;  3AQK A;  5BOM A;  3JPP A;  4AT9 A;  2NRK A;  4M9L A;  4I29 A;  4UAZ A;  2PFN A;  3H3A A;  2PXI A;  3WFR E;  5BPC A;  3JPR A;  4XA5 A;  1R8B A;  4QZF A;  4YN4 A;  5DDY A;  5IIN A;  8ICR A;  5DBB A;  8ICU A;  3AU6 A;  4K4G A;  4IG8 A;  4YMO A;  4LZD A;  5J2B A;  8ICI A;  3WFS C;  4O9M A;  3RH6 A;  2PFQ A;  5BOL A;  5HC9 A;  4QZA A;  3V7L A;  3RJG A;  1UEU A;  5J2J A;  5J0W A;  4KLI A;  1ZQQ A;  4F5N A;  4FO6 A;  7ICJ A;  3OVS A;  4TUQ A;  1F5A A;  4X4O A;  3RJH A;  2DRB A;  2DR9 A;  9ICG A;  1JQR A;  4Z6C A;  8ICF A;  4WC1 A;  1KNY A;  1ZQM A;  8ICN A;  4FHX A;  2ZH9 A;  4GXK A;  4QZD A;  4KLF A;  1NO5 A;  2M2U A;  4M04 A;  3C5G A;  2PFP A;  4NY8 A;  9ICV A;  1ZQD A;  1ZQV A;  3H37 A;  1UET A;  4I27 A;  1ZQJ A;  3JPQ A;  8ICG A;  1Q78 A;  1ZQT A;  3WFQ E;  4RWQ A;  5J0O A;  4WCW A;  3C5F A;  2PFO A;  1ZQN A;  4UD5 A;  4QZC A;  5HHH A;  4F5P A;  1ZQR A;  1R89 A;  7ICV A;  1BPZ A;  8ICH A;  4X4Q A;  5J2F A;  4RQ0 A;  2BCV A;  4WC0 A;  4WC7 A;  3TFS A;  2I9G A;  2FMP A;  9ICL A;  4KLL A;  3LK9 A;  4KLU A;  3NYB A;  4X4S A;  5CJ7 A;  4S3N A;  5HRF A;  4IQV A;  7ICT A;  4DO9 A;  1ZQY A;  4K4I A;  8ICJ A;  1BPB A;  4RQ4 A;  3OV7 A;  4EBK A;  7ICN A;  8ICP A;  4LZG A;  2DRA A;  2ISP A;  4K4H A;  9ICT A;  1YLQ A;  1BPX A;  4I2C A;  3MGH A;  7ICG A;  4RQ8 A;  4M9G A;  1R8C A;  3RJI A;  4XQ8 A;  4KLQ A;  5CWR A;  4X4P A;  2ZHB A;  4PHA A;  8ICY A;  2FMQ A;  3OUY B;  4UAW A;  1ZQA A;  3PMN A;  8ICO A;  4QZB A;  7ICR A;  5J0T A;  7ICS A;  3V72 A;  3UPS A;  5J2D A;  4RQ3 A;  4NLK A;  4I2J A;  2RFF A;  4TUP A;  3OGU A;  5D46 A;  9ICI A;  8ICE A;  9ICR A;  3HIY A;  5IIJ A;  1ZQE A;  2BCQ A;  4QZG A;  2FMS A;  1ZJM A;  2ZH4 A;  5DKW A;  4KLH A;  2DR7 A;  4NM1 A;  4UAY A;  4R66 A;  3OUY A;  5DB7 A;  1MQ2 A;  2DR8 A;  4RPX A;  5HHI A;  2BPG A;  3PML A;  4AT7 A;  4DOC A;  1XSP A;  4X4V A;  3RJJ A;  4I2E A;  4UB2 A;  4YCX A;  5J0R A;  9ICS A;  1HUO A;  4M9J A;  4PGQ A;  4IQT A;  8ICC A;  4RWP A;  4X4R A;  2BPC A;  5TZV A;  4QZI A;  4F5R A;  4X0B A;  3RJF A;  5J0P A;  4I28 A;  5HRI A;  3WFO A;  4UB3 A;  7ICP A;  5IIO A;  9ICH A;  7ICM A;  5J0Q A;  3OVB A;  2GWS A;  3HJ4 A;  7ICH A;  4RQ1 A;  3C2M A;  1OU5 A;  4GXJ A;  5J0U A;  4O5K A;  4TUR A;  4MF2 A;  9ICW A;  4DOA A;  4M9N A;  4PHP A;  5J2G A;  4WC5 A;  9ICK A;  4AT7 B;  3ISB A;  3JPS A;  7ICQ A;  4WC3 A;  3H39 A;  4KLE A;  4X0A A;  2P66 A;  5HRD A;  3UXN A;  5CP2 A;  4JWN A;  4FHP A;  4RQ6 A;  8ICQ A;  4WBY A;  1PX5 A;  3AQM A;  4UBB A;  5HRG A;  4I2A A;  4RQ7 A;  4O5C A;  3HX0 A;  8ICA A;  4NKU A;  5CB1 A;  5J2E A;  5EOZ A;  5DBC A;  5HRB A;  4M2Y A;  4X4T A;  9ICP A;  2BE3 A;  8ICT A;  4RWO A;  4R64 A;  2O5A A;  4UB1 A;  3JPT A;  8ICW A;  1ZQW A;  5F2V O;  4I2B A;  4LVS A;  4F5O A;  3MDC A;  2BCU A;  1ZJN A;  4FH3 A;  1HUZ A;  4R63 A;  3JPN A;  2BCS A;  2IHM A;  8ICK A;  7ICL A;  9ICU A;  2Q66 A;  4KLD A;  1TFY A;  9ICA A;  4IQU A;  5HR9 A;  1NOM A;  3RH5 A;  4LT6 A;  4MF8 A;  7ICU A;  4FHV A;  4MFF A;  4PH5 A;  4TUS A;  4PHD A;  1VJ7 A;  2PBE A;  5III A;  2BPF A;  4NLN A;  9ICB A;  4NKT A;  4AT9 B;  2ZH1 A;  4WC6 A;  2ZH5 A;  1ZQO A;  2M2T A;  3C2K A;  4NM2 A;  3AUO A;  4UD4 A;  2ZH3 A;  5J0X A;  1JAJ A;  4PPX A;  7ICE A;  2ZH2 A;  1BPY A;  4DOB A;  5DB9 A;  4GXI A;  3LQC B;  4EBJ A;  4RQ5 A;  4QZ9 A;  3C66 A;  4ATB B;  4Z6D A;  9ICQ A;  2ID1 A;  1KDH A;  5CHG A;  5J2K A;  4P4P A;  3K75 D;  4YD1 A;  4P2H A;  4WC4 A;  5IIL A;  4M5D A;  5DDM A;  4IQW A;  1BPE A;  4NLZ A;  5DB8 A;  4KLO A;  3C2L A;  1ZQH A;  4MFC A;  7ICI A;  1WOT A;  1RPL A;  4KLJ A;  4RPZ A;  7ICK A;  8ICS A;  4JWM A;  4MFA A;  3JPO A;  2M2V A;  9ICJ A;  4XQ7 A;  5DEC A;  4I2H A;  9ICM A;  5HRE A;  5J2C A;  3AQL A;  3RJE A;  4I2I A;  8ICX A;  4Z6E A;  5HRH A;  2O1P A;  5IIM A;  8ICZ A;  4KLM A;  5IIK A;  4WBZ A;  2DR5 A;  4XUS A;  4X5V A;  9ICO A;  4YD2 A;  4YMM A;  3UPQ A;  4AT8 A;  4FHY A;  4FHW A;  3GDX A;  1UEV A;  5J0S A;  1FA0 A;  1ZQP A;  3V7J A;  3B0X A;  1RZT A;  4QZ8 A;  3HWT A;  4RWN A;  4PGY A;  4P4O A;  4RQ2 A;  4RT3 A;  1ZQF A;  2BCR A;  5CA7 A;  4I2F A;  4KLS A;  1MIV A;  4M9H A;  2M2W A;  1MQ3 A;  4EP7 A;  4P4M A;  1ZQB A;  5J2A A;  2VAN A;  5DB6 A;  4E80 A;  1ZQL A;  3JZ0 A;  5D4B A;  5CR0 A;  4QZH A;  3HJ1 A;  4AT8 B;  1ZQX A;  2ZH8 A;  1JMS A;  5HRL A;  3ISD A;  3UQ0 A;  1VFG A;  3MGI A;  1ZQI A;  4KLG A;  5DED A;  1KEJ A;  8ICM A;  4UB5 A;  4ATB A;  1V4A A;  3HW8 A;  4UB4 A;  8ICB A;  3OVA A;  1JN3 A;  2ZH6 A;  3UXO A;  3PNC A;  3RH4 A;  2ZHA A;  4E7X A;  3JYY A;  1Q79 A;  5J0Y A;  4X4N A;  5J2H A;  7ICF A;  9ICC A;  5D49 A;  1ZQZ A;  9ICF A;  4E8F A;  3ISC A;  3B0Y A;  4Z6F A;  4RT2 A;  4XRH A;  4R65 A;  5DBA A;  7ICO A;  1MIY A;  3TFR A;  3AQN A;  1ZQC A;  8ICV A; 
#chains in the Genus database with same CATH topology
 5J2I A;  2ZH7 A;  5D61 A;  4O5E A;  4M47 A;  2HHP A;  4QZE A;  2W9M A;  1TV9 A;  1ZQU A;  2ISO A;  5J29 A;  1TVA A;  4PGX A;  3L9D A;  3V7K A;  4YMN A;  4I2G A;  1ZQK A;  1XSL A;  4F5Q A;  4RPY A;  4KLT A;  5B3Q A;  3H38 A;  4X4U A;  4PHE A;  1R8A A;  1GPJ A;  9ICE A;  4FH5 A;  1XSN A;  9ICN A;  3RJK A;  4M0A A;  1MIW A;  4UBC A;  1ZQG A;  2BBJ A;  3UQ2 A;  1BPD A;  3UXP A;  8ICL A;  3MBY A;  4K97 A;  1TFW A;  5HRK A;  4I2D A;  4K96 A;  9ICX A;  3MCR A;  3C18 A;  3MDA A;  3AU2 A;  2DVI A;  3WFP A;  4WC2 A;  5JTG A;  1ZQS A;  4NXZ A;  3AQK A;  5BOM A;  3JPP A;  4FO1 A;  5CFT A;  4XJE A;  4AT9 A;  4EGW A;  2NRK A;  4M9L A;  4I29 A;  4UAZ A;  2PFN A;  3H3A A;  2PXI A;  4MKP A;  3WFR E;  5BPC A;  3JPR A;  4XA5 A;  1R8B A;  4QZF A;  4YN4 A;  5DDY A;  5IIN A;  8ICR A;  4K9A A;  5DBB A;  8ICU A;  3AU6 A;  4K4G A;  4OAF A;  4IG8 A;  4YMO A;  4LZD A;  5J2B A;  4OAI Z;  8ICI A;  3WFS C;  4O9M A;  3RH6 A;  3ER8 C;  2PFQ A;  4I0U A;  5BOL A;  5HC9 A;  4QZA A;  3V7L A;  3RJG A;  1UEU A;  5J2J A;  5J0W A;  4KLI A;  1ZQQ A;  4F5N A;  2B56 A;  4FO6 A;  7ICJ A;  3OVS A;  4TUQ A;  1F5A A;  4X4O A;  3RJH A;  2DRB A;  2DR9 A;  2EWR A;  9ICG A;  1JQR A;  4Z6C A;  8ICF A;  4WC1 A;  1KNY A;  1ZQM A;  8ICN A;  4FHX A;  2ZH9 A;  4GXK A;  4QZD A;  4KLF A;  1NO5 A;  2M2U A;  4M04 A;  3C5G A;  2PFP A;  4NY8 A;  9ICV A;  1ZQD A;  4JLZ A;  1ZQV A;  3H37 A;  1UET A;  4I27 A;  1ZQJ A;  3JPQ A;  8ICG A;  1Q78 A;  3NVO A;  1ZQT A;  3WFQ E;  4RWQ A;  5J0O A;  4WCW A;  3C5F A;  2PFO A;  1ZQN A;  4NXT A;  4UD5 A;  4QZC A;  5HHH A;  4F5P A;  1ZQR A;  1R89 A;  7ICV A;  1BPZ A;  8ICH A;  4X4Q A;  5J2F A;  4NXV A;  4RQ0 A;  2BCV A;  4WC0 A;  4WC7 A;  3TFS A;  4NXX A;  2I9G A;  2FMP A;  9ICL A;  4KLL A;  3LK9 A;  4KLU A;  3NYB A;  4X4S A;  5CJ7 A;  4S3N A;  5HRF A;  4IQV A;  7ICT A;  4HX0 A;  4DO9 A;  1ZQY A;  4K4I A;  8ICJ A;  1BPB A;  4RQ4 A;  2FCL A;  3OV7 A;  4EBK A;  2B4V A;  7ICN A;  8ICP A;  4LZG A;  2DRA A;  2ISP A;  4KB6 A;  4K4H A;  9ICT A;  1YLQ A;  1BPX A;  4I2C A;  3MGH A;  7ICG A;  4RQ8 A;  4M9G A;  2IHO A;  1R8C A;  3RJI A;  4XQ8 A;  4KLQ A;  5CWR A;  4X4P A;  2ZHB A;  4PHA A;  8ICY A;  2FMQ A;  3OUY B;  4UAW A;  1ZQA A;  3OWG A;  3PMN A;  8ICO A;  4QZB A;  7ICR A;  5J0T A;  7ICS A;  3V72 A;  3UPS A;  5J2D A;  4RQ3 A;  4NLK A;  4I2J A;  2RFF A;  4TUP A;  4WOY A;  3OGU A;  5D46 A;  9ICI A;  8ICE A;  9ICR A;  3HIY A;  5IIJ A;  1ZQE A;  2BCQ A;  4QZG A;  2FMS A;  1ZJM A;  4EEB A;  2ZH4 A;  5DKW A;  4KLH A;  2DR7 A;  4NM1 A;  4UAY A;  4R66 A;  3OUY A;  3ER9 B;  5DB7 A;  1MQ2 A;  2DR8 A;  4RPX A;  5HHI A;  2BPG A;  3PML A;  4AT7 A;  4DOC A;  1XSP A;  4X4V A;  3RJJ A;  4I2E A;  4UB2 A;  4YCX A;  5J0R A;  9ICS A;  1HUO A;  4M9J A;  4PGQ A;  4IQT A;  8ICC A;  4RWP A;  4X4R A;  2BPC A;  5TZV A;  4QZI A;  4F5R A;  4X0B A;  3RJF A;  5J0P A;  4I28 A;  4K99 A;  4O69 A;  5HRI A;  3WFO A;  4UB3 A;  7ICP A;  5IIO A;  9ICH A;  7ICM A;  5J0Q A;  3OVB A;  2GWS A;  3HJ4 A;  7ICH A;  4OAH A;  4RQ1 A;  3C2M A;  1OU5 A;  4GXJ A;  5J0U A;  4O5K A;  4N7R A;  4TUR A;  4MF2 A;  9ICW A;  4DOA A;  4M9N A;  4PHP A;  5J2G A;  4WC5 A;  9ICK A;  4AT7 B;  3ISB A;  3JPS A;  7ICQ A;  3EF2 A;  4LEW A;  3H39 A;  4WC3 A;  4WQL A;  4KLE A;  4X0A A;  2P66 A;  5HRD A;  3UXN A;  5CP2 A;  4JWN A;  4FHP A;  2BBH A;  4RQ6 A;  8ICQ A;  4WBY A;  1PX5 A;  3AQM A;  4UBB A;  5HRG A;  3NWI A;  4I2A A;  3NKU A;  4RQ7 A;  4O5C A;  4EV6 A;  3HX0 A;  8ICA A;  4NKU A;  5CB1 A;  5J2E A;  5EOZ A;  2IUB A;  5DBC A;  5HRB A;  4M2Y A;  4X4T A;  9ICP A;  2BE3 A;  8ICT A;  4RWO A;  4R64 A;  2O5A A;  4UB1 A;  3JPT A;  8ICW A;  1ZQW A;  5F2V O;  4I2B A;  2GAF D;  3ERC C;  4LVS A;  4F5O A;  3JCF A;  5CHE A;  3MDC A;  2BCU A;  1ZJN A;  3K7D A;  4FH3 A;  1HUZ A;  4R63 A;  3JPN A;  2BCS A;  2IHM A;  8ICK A;  7ICL A;  9ICU A;  2Q66 A;  4KLD A;  1TFY A;  9ICA A;  4LEZ A;  4IQU A;  5HR9 A;  1NOM A;  3RH5 A;  4LT6 A;  4MF8 A;  7ICU A;  4FHV A;  5D62 A;  4MFF A;  4PH5 A;  4TUS A;  4PHD A;  1VJ7 A;  2PBE A;  4K98 A;  5III A;  2BPF A;  4NLN A;  9ICB A;  4NKT A;  4AT9 B;  2ZH1 A;  4WC6 A;  2ZH5 A;  1ZQO A;  2M2T A;  3C2K A;  4NM2 A;  3AUO A;  4UD4 A;  2ZH3 A;  4LEY A;  5J0X A;  1JAJ A;  4PPX A;  7ICE A;  2ZH2 A;  1BPY A;  4DOB A;  5DB9 A;  4GXI A;  3LQC B;  3PHZ A;  4NXW A;  4RQ5 A;  4EBJ A;  4QZ9 A;  3C66 A;  4ATB B;  4Z6D A;  9ICQ A;  2ID1 A;  1KDH A;  5CHG A;  4K8V A;  5J2K A;  4P4P A;  3K75 D;  4YD1 A;  4P2H A;  4WC4 A;  5IIL A;  4M5D A;  5DDM A;  4IQW A;  1BPE A;  4NLZ A;  5DB8 A;  4KLO A;  3C2L A;  1ZQH A;  4MFC A;  7ICI A;  1WOT A;  1RPL A;  4KLJ A;  4RPZ A;  7ICK A;  8ICS A;  4O68 A;  4JWM A;  4MFA A;  3JPO A;  2M2V A;  9ICJ A;  4XQ7 A;  5DEC A;  4I2H A;  9ICM A;  5HRE A;  5J2C A;  3AQL A;  3RJE A;  4JLX A;  4I2I A;  8ICX A;  4Z6E A;  5HRH A;  4WH5 A;  2O1P A;  5IIM A;  8ICZ A;  4KLM A;  4EED A;  5IIK A;  4WBZ A;  2DR5 A;  4XUS A;  4WQK A;  2B51 A;  4X5V A;  9ICO A;  4YD2 A;  4YMM A;  3UPQ A;  4AT8 A;  4NXU A;  4FHY A;  4FHW A;  4K9B A;  3GDX A;  1UEV A;  5J0S A;  1FA0 A;  1ZQP A;  3V7J A;  2HN1 A;  3B0X A;  1RZT A;  4O6A A;  4QZ8 A;  3HWT A;  2GA9 D;  4RWN A;  4PGY A;  4P4O A;  4RQ2 A;  4RT3 A;  5CFS A;  1ZQF A;  2BCR A;  5CA7 A;  4I2F A;  4KLS A;  1MIV A;  4M9H A;  2M2W A;  1MQ3 A;  4EP7 A;  4KM5 A;  4P4M A;  1ZQB A;  5J2A A;  2VAN A;  5DB6 A;  4E80 A;  1ZQL A;  3JZ0 A;  5D4B A;  5CR0 A;  4QZH A;  3HJ1 A;  4AT8 B;  1ZQX A;  2ZH8 A;  1JMS A;  5HRL A;  3ISD A;  3UQ0 A;  5D63 A;  1VFG A;  3MGI A;  1ZQI A;  5B3P A;  4LEV A;  4KLG A;  5DED A;  1KEJ A;  8ICM A;  4UB5 A;  4ATB A;  1V4A A;  3HW8 A;  4UB4 A;  8ICB A;  3OVA A;  1JN3 A;  5CFU A;  2ZH6 A;  3UXO A;  3PNC A;  3RH4 A;  4OAG A;  2ZHA A;  4E7X A;  3JYY A;  2HN2 A;  1Q79 A;  5J0Y A;  4X4N A;  5J2H A;  7ICF A;  9ICC A;  3CK6 A;  5D49 A;  1ZQZ A;  9ICF A;  4E8F A;  3ISC A;  3B0Y A;  4Z6F A;  4RT2 A;  4XRH A;  4R65 A;  5DBA A;  7ICO A;  1MIY A;  3TFR A;  3AQN A;  1ZQC A;  4O67 A;  8ICV A; 
#chains in the Genus database with same CATH homology
 5J2I A;  2ZH7 A;  4O5E A;  4M47 A;  2HHP A;  4QZE A;  2W9M A;  1TV9 A;  1ZQU A;  2ISO A;  5J29 A;  1TVA A;  4PGX A;  3L9D A;  3V7K A;  4YMN A;  4I2G A;  1ZQK A;  1XSL A;  4F5Q A;  4RPY A;  4KLT A;  3H38 A;  4X4U A;  4PHE A;  1R8A A;  9ICE A;  4FH5 A;  1XSN A;  9ICN A;  3RJK A;  4M0A A;  1MIW A;  4UBC A;  1ZQG A;  3UQ2 A;  1BPD A;  3UXP A;  8ICL A;  3MBY A;  1TFW A;  5HRK A;  4I2D A;  9ICX A;  3C18 A;  3MDA A;  3AU2 A;  2DVI A;  3WFP A;  4WC2 A;  1ZQS A;  4NXZ A;  3AQK A;  5BOM A;  3JPP A;  4AT9 A;  2NRK A;  4M9L A;  4I29 A;  4UAZ A;  2PFN A;  3H3A A;  2PXI A;  3WFR E;  5BPC A;  3JPR A;  4XA5 A;  1R8B A;  4QZF A;  4YN4 A;  5DDY A;  5IIN A;  8ICR A;  5DBB A;  8ICU A;  3AU6 A;  4K4G A;  4IG8 A;  4YMO A;  4LZD A;  5J2B A;  8ICI A;  3WFS C;  4O9M A;  3RH6 A;  2PFQ A;  5BOL A;  5HC9 A;  4QZA A;  3V7L A;  3RJG A;  1UEU A;  5J2J A;  5J0W A;  4KLI A;  1ZQQ A;  4F5N A;  4FO6 A;  7ICJ A;  3OVS A;  4TUQ A;  1F5A A;  4X4O A;  3RJH A;  2DRB A;  2DR9 A;  9ICG A;  1JQR A;  4Z6C A;  8ICF A;  4WC1 A;  1KNY A;  1ZQM A;  8ICN A;  4FHX A;  2ZH9 A;  4GXK A;  4QZD A;  4KLF A;  1NO5 A;  2M2U A;  4M04 A;  3C5G A;  2PFP A;  4NY8 A;  9ICV A;  1ZQD A;  1ZQV A;  3H37 A;  1UET A;  4I27 A;  1ZQJ A;  3JPQ A;  8ICG A;  1Q78 A;  1ZQT A;  3WFQ E;  4RWQ A;  5J0O A;  4WCW A;  3C5F A;  2PFO A;  1ZQN A;  4UD5 A;  4QZC A;  5HHH A;  4F5P A;  1ZQR A;  1R89 A;  7ICV A;  1BPZ A;  8ICH A;  4X4Q A;  5J2F A;  4RQ0 A;  2BCV A;  4WC0 A;  4WC7 A;  3TFS A;  2I9G A;  2FMP A;  9ICL A;  4KLL A;  3LK9 A;  4KLU A;  3NYB A;  4X4S A;  5CJ7 A;  4S3N A;  5HRF A;  4IQV A;  7ICT A;  4DO9 A;  1ZQY A;  4K4I A;  8ICJ A;  1BPB A;  4RQ4 A;  3OV7 A;  4EBK A;  7ICN A;  8ICP A;  4LZG A;  2DRA A;  2ISP A;  4K4H A;  9ICT A;  1YLQ A;  1BPX A;  4I2C A;  3MGH A;  7ICG A;  4RQ8 A;  4M9G A;  1R8C A;  3RJI A;  4XQ8 A;  4KLQ A;  5CWR A;  4X4P A;  2ZHB A;  4PHA A;  8ICY A;  2FMQ A;  3OUY B;  4UAW A;  1ZQA A;  3PMN A;  8ICO A;  4QZB A;  7ICR A;  5J0T A;  7ICS A;  3V72 A;  3UPS A;  5J2D A;  4RQ3 A;  4NLK A;  4I2J A;  2RFF A;  4TUP A;  3OGU A;  5D46 A;  9ICI A;  8ICE A;  9ICR A;  3HIY A;  5IIJ A;  1ZQE A;  2BCQ A;  4QZG A;  2FMS A;  1ZJM A;  2ZH4 A;  5DKW A;  4KLH A;  2DR7 A;  4NM1 A;  4UAY A;  4R66 A;  3OUY A;  5DB7 A;  1MQ2 A;  2DR8 A;  4RPX A;  5HHI A;  2BPG A;  3PML A;  4AT7 A;  4DOC A;  1XSP A;  4X4V A;  3RJJ A;  4I2E A;  4UB2 A;  4YCX A;  5J0R A;  9ICS A;  1HUO A;  4M9J A;  4PGQ A;  4IQT A;  8ICC A;  4RWP A;  4X4R A;  2BPC A;  5TZV A;  4QZI A;  4F5R A;  4X0B A;  3RJF A;  5J0P A;  4I28 A;  5HRI A;  3WFO A;  4UB3 A;  7ICP A;  5IIO A;  9ICH A;  7ICM A;  5J0Q A;  3OVB A;  2GWS A;  3HJ4 A;  7ICH A;  4RQ1 A;  3C2M A;  1OU5 A;  4GXJ A;  5J0U A;  4O5K A;  4TUR A;  4MF2 A;  9ICW A;  4DOA A;  4M9N A;  4PHP A;  5J2G A;  4WC5 A;  9ICK A;  4AT7 B;  3ISB A;  3JPS A;  7ICQ A;  4WC3 A;  3H39 A;  4KLE A;  4X0A A;  2P66 A;  5HRD A;  3UXN A;  5CP2 A;  4JWN A;  4FHP A;  4RQ6 A;  8ICQ A;  4WBY A;  1PX5 A;  3AQM A;  4UBB A;  5HRG A;  4I2A A;  4RQ7 A;  4O5C A;  3HX0 A;  8ICA A;  4NKU A;  5CB1 A;  5J2E A;  5EOZ A;  5DBC A;  5HRB A;  4M2Y A;  4X4T A;  9ICP A;  2BE3 A;  8ICT A;  4RWO A;  4R64 A;  2O5A A;  4UB1 A;  3JPT A;  8ICW A;  1ZQW A;  5F2V O;  4I2B A;  4LVS A;  4F5O A;  3MDC A;  2BCU A;  1ZJN A;  4FH3 A;  1HUZ A;  4R63 A;  3JPN A;  2BCS A;  2IHM A;  8ICK A;  7ICL A;  9ICU A;  2Q66 A;  4KLD A;  1TFY A;  9ICA A;  4IQU A;  5HR9 A;  1NOM A;  3RH5 A;  4LT6 A;  4MF8 A;  7ICU A;  4FHV A;  4MFF A;  4PH5 A;  4TUS A;  4PHD A;  1VJ7 A;  2PBE A;  5III A;  2BPF A;  4NLN A;  9ICB A;  4NKT A;  4AT9 B;  2ZH1 A;  4WC6 A;  2ZH5 A;  1ZQO A;  2M2T A;  3C2K A;  4NM2 A;  3AUO A;  4UD4 A;  2ZH3 A;  5J0X A;  1JAJ A;  4PPX A;  7ICE A;  2ZH2 A;  1BPY A;  4DOB A;  5DB9 A;  4GXI A;  3LQC B;  4EBJ A;  4RQ5 A;  4QZ9 A;  3C66 A;  4ATB B;  4Z6D A;  9ICQ A;  2ID1 A;  1KDH A;  5CHG A;  5J2K A;  4P4P A;  3K75 D;  4YD1 A;  4P2H A;  4WC4 A;  5IIL A;  4M5D A;  5DDM A;  4IQW A;  1BPE A;  4NLZ A;  5DB8 A;  4KLO A;  3C2L A;  1ZQH A;  4MFC A;  7ICI A;  1WOT A;  1RPL A;  4KLJ A;  4RPZ A;  7ICK A;  8ICS A;  4JWM A;  4MFA A;  3JPO A;  2M2V A;  9ICJ A;  4XQ7 A;  5DEC A;  4I2H A;  9ICM A;  5HRE A;  5J2C A;  3AQL A;  3RJE A;  4I2I A;  8ICX A;  4Z6E A;  5HRH A;  2O1P A;  5IIM A;  8ICZ A;  4KLM A;  5IIK A;  4WBZ A;  2DR5 A;  4XUS A;  4X5V A;  9ICO A;  4YD2 A;  4YMM A;  3UPQ A;  4AT8 A;  4FHY A;  4FHW A;  3GDX A;  1UEV A;  5J0S A;  1FA0 A;  1ZQP A;  3V7J A;  3B0X A;  1RZT A;  4QZ8 A;  3HWT A;  4RWN A;  4PGY A;  4P4O A;  4RQ2 A;  4RT3 A;  1ZQF A;  2BCR A;  5CA7 A;  4I2F A;  4KLS A;  1MIV A;  4M9H A;  2M2W A;  1MQ3 A;  4EP7 A;  4P4M A;  1ZQB A;  5J2A A;  2VAN A;  5DB6 A;  4E80 A;  1ZQL A;  3JZ0 A;  5D4B A;  5CR0 A;  4QZH A;  3HJ1 A;  4AT8 B;  1ZQX A;  2ZH8 A;  1JMS A;  5HRL A;  3ISD A;  3UQ0 A;  1VFG A;  3MGI A;  1ZQI A;  4KLG A;  5DED A;  1KEJ A;  8ICM A;  4UB5 A;  4ATB A;  1V4A A;  3HW8 A;  4UB4 A;  8ICB A;  3OVA A;  1JN3 A;  2ZH6 A;  3UXO A;  3PNC A;  3RH4 A;  2ZHA A;  4E7X A;  3JYY A;  1Q79 A;  5J0Y A;  4X4N A;  5J2H A;  7ICF A;  9ICC A;  5D49 A;  1ZQZ A;  9ICF A;  4E8F A;  3ISC A;  3B0Y A;  4Z6F A;  4RT2 A;  4XRH A;  4R65 A;  5DBA A;  7ICO A;  1MIY A;  3TFR A;  3AQN A;  1ZQC A;  8ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...