2M2VA

African swine fever virus pol x in the ternary complex with mgdgtp and dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
b'MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2vA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2vA01
5HRGA 4Z6DA 4KLOA 4YMNA 5IIJA 3HW8A 4NM2A 9ICHA 4RQ0A 1ZQHA 3C18A 4S3NA 8ICBA 4K4IA 1MQ3A 1ZQLA 3V72A 1XSPA 5CR0A 9ICJA 2DRAA 7ICNA 1ZJMA 4EP7A 3AQMA 4QZGA 3LK9A 1ZQPA 2DR7A 4AT9A 4QZDA 4FHWA 8ICHA 4PHAA 2IHMA 1KDHA 2ZH4A 4X5VA 1ZQQA 4XA5A 3H39A 3UQ2A 1BPZA 4FHVA 1NOMA 1ZQGA 4MFCA 4FH3A 1XSNA 5HRIA 5J2IA 4EBKA 1TVAA 1ZQEA 7ICMA 3RJFA 2PXIA 5DB9A 3H3AA 7ICKA 3K75D 4ATBA 3B0XA 4TUPA 4GXJA 8ICPA 4RT2A 4QZFA 4R64A 4RT3A 4I2GA 5IIMA 2ZHAA 4K4GA 1MIVA 3HJ1A 1R8BA 9ICVA 4PHDA 4IQVA 1MQ2A 3JZ0A 2ZH5A 3TFRA 5HHIA 4TUSA 1ZQOA 5CA7A 1BPEA 5J2FA 2I9GA 5DB6A 2DRBA 4MF8A 5IIIA 4UB5A 4NM1A 4M9NA 9ICIA 5HHHA 4FHPA 4UAWA 3UXNA 3AU2A 2BPGA 2DR9A 5J0RA 1WOTA 4UBBA 1ZQMA 8ICUA 2HHPA 3PNCA 9ICRA 4RPYA 3C5GA 4KLDA 2ZH9A 4UD4A 1UEVA 4RQ4A 4KLGA 1ZQWA 4UB2A 3NYBA 4M9JA 4X4QA 4I2HA 4R66A 9ICTA 4IG8A 4RPZA 3PMLA 3HJ4A 3PMNA 1V4AA 3RJIA 4DOCA 3AU6A 4PGXA 3RJEA 2ZH7A 4RPXA 4AT7B 1ZQAA 2PFQA 9ICFA 5J2GA 8ICZA 7ICQA 1ZQRA 5DBBA 4WC3A 2NRKA 2ZH2A 4PHEA 1PX5A 4X4VA 4UAZA 4DO9A 3H37A 5J0WA 3JPSA 5CB1A 5J29A 2FMSA 3C2MA 4X0AA 4QZEA 2O5AA 5F2VO 5HRKA 4E7XA 4YN4A 5D49A 5TZVA 7ICPA 1ZQVA 8ICEA 4I29A 8ICYA 4MFFA 4M2YA 5HRBA 1NO5A 3MGHA 3WFOA 4RWPA 2PFOA 1ZQXA 1RPLA 4F5PA 9ICCA 7ICFA 3L9DA 8ICKA 1BPDA 1F5AA 1XSLA 4YMMA 5DB7A 1JN3A 4LZGA 4WC6A 3JPNA 4QZBA 4RWQA 4X4OA 8ICNA 5DDMA 3MDCA 2M2TA 5D4BA 3AUOA 5J0OA 2W9MA 3C5FA 1OU5A 4LT6A 3UPQA 3RJKA 4M9GA 1RZTA 4WC2A 9ICNA 1JAJA 1ZQSA 4KLLA 2M2UA 4WC1A 4UB1A 4JWMA 7ICSA 4DOBA 2ISOA 4I2FA 8ICMA 5J0XA 2FMPA 4WC7A 9ICWA 3V7KA 9ICKA 2VANA 1ZQTA 4I2JA 3JPTA 1R8CA 1ZQUA 2BCRA 4AT9B 4FH5A 7ICRA 3ISBA 9ICLA 4NY8A 4I2IA 4M47A 4WC0A 5J2CA 4R63A 5J0PA 4FHXA 3JPOA 8ICJA 4RQ3A 4TUQA 4UB4A 4YMOA 4LVSA 2BPCA 4X4PA 2PBEA 4WBYA 3B0YA 4EBJA 2ISPA 4F5OA 9ICPA 4Z6FA 3HX0A 7ICTA 3RJGA 3RH4A 5DDYA 1ZQBA 5IILA 5HRDA 8ICGA 5CWRA 5J2BA 4UBCA 3GDXA 1HUOA 4I2BA 5CJ7A 8ICLA 4X4NA 4Z6CA 4P4OA 5HRLA 4KLTA 1VJ7A 2M2WA 4FHYA 3RH5A 4X4UA 8ICSA 7ICLA 5J2HA 4I2CA 4IQUA 3MDAA 4QZ8A 7ICGA 3WFQE 5EOZA 3C2KA 4RQ8A 2RFFA 5DKWA 4AT7A 3OUYB 3HIYA 4WBZA 5HR9A 3JPQA 4AT8B 4X4RA 1TV9A 1KNYA 3OVBA 3JPRA 4KLFA 2BCUA 4F5QA 8ICTA 4I28A 2FMQA 1MIYA 4I2AA 9ICMA 8ICCA 9ICXA 3C66A 3UQ0A 4UAYA 2Q66A 4O5CA 1ZQNA 2ZH6A 4LZDA 5HRHA 1YLQA 2BPFA 4RWOA 3JYYA 4WC4A 8ICVA 1JMSA 4M9LA 4E80A 3JPPA 4TURA 4O5EA 4NLKA 4KLUA 7ICHA 4KLIA 4KLHA 2ZH8A 2DR8A 3C2LA 4YD1A 4NXZA 5D46A 4QZHA 1TFYA 4KLMA 5BOLA 5J2DA 4K4HA 3LQCB 4IQTA 4IQWA 4R65A 3TFSA 5CP2A 4X4SA 5HC9A 4KLEA 4XQ7A 3UXPA 4F5RA 3OVSA 5IINA 7ICOA 3ISDA 9ICGA 4XUSA 4X0BA 1ZQZA 3V7JA 5J2KA 8ICOA 4WC5A 7ICJA 1FA0A 3HWTA 4O9MA 1UETA 5DB8A 5HRFA 3WFPA 4M04A 4NKTA 4NLZA 4MF2A 4I2DA 9ICAA 3AQNA 4I27A 3MGIA 2GWSA 4KLQA 5DBCA 4NLNA 1ZQFA 3RJHA 2ZH1A 5DBAA 4M5DA 3H38A 3AQLA 1BPYA 4PPXA 4RWNA 9ICUA 9ICBA 2ZHBA 4QZ9A 2BE3A 4QZIA 1ZJNA 1ZQDA 1UEUA 2BCSA 8ICWA 2ID1A 1MIWA 3OVAA 8ICAA 4P4MA 1R8AA 9ICQA 4YCXA 4M9HA 3WFSC 4DOAA 4GXKA 4PH5A 3ISCA 1BPXA 4XRHA 4WCWA 3UPSA 4Z6EA 4NKUA 1ZQIA 5J0UA 4ATBB 2DVIA 3OUYA 4AT8A 2PFPA 3V7LA 5J2EA 2ZH3A 8ICRA 4I2EA 1BPBA 2O1PA 4KLSA 5J0TA 5J2JA 4M0AA 1R89A 9ICSA 1ZQCA 8ICXA 4F5NA 2BCQA 8ICFA 7ICIA 4RQ2A 4X4TA 1HUZA 4XQ8A 4P2HA 1Q79A 4QZCA 4UD5A 7ICVA 5BPCA 2BCVA 4O5KA 4JWNA 7ICEA 5BOMA 4RQ6A 4GXIA 4MFAA 8ICQA 5J2AA 5J0QA 4P4PA 4QZAA 3RJJA 5HREA 3RH6A 4PGQA 1ZQKA 4PHPA 4KLJA 5IIKA 1Q78A 4RQ1A 5IIOA 7ICUA 4FO6A 1KEJA 1ZQYA 5J0SA 5DECA 2P66A 3OV7A 1VFGA 9ICOA 3WFRE 3UXOA 4PGYA 1TFWA 8ICIA 5J0YA 3OGUA 4RQ5A 1JQRA 4E8FA 1ZQJA 9ICEA 4UB3A 2M2VA 2DR5A 5DEDA 4RQ7A 3AQKA 4YD2A 5CHGA 3MBYA 2PFNA
chains in the Genus database with same CATH superfamily
5HRGA 5CFSA 4Z6DA 4KLOA 4YMNA 5IIJA 3HW8A 4NM2A 9ICHA 4RQ0A 1ZQHA 3C18A 4S3NA 8ICBA 4K4IA 1MQ3A 1ZQLA 3V72A 1XSPA 5CR0A 9ICJA 2DRAA 7ICNA 1ZJMA 4EP7A 3AQMA 4QZGA 3LK9A 1ZQPA 2DR7A 4AT9A 4QZDA 3NKUA 2B56A 4FHWA 4N7RA 5D61A 8ICHA 4PHAA 3ERCC 2IHMA 1KDHA 2ZH4A 4X5VA 1ZQQA 4XA5A 4LEWA 3H39A 3UQ2A 1BPZA 4FHVA 1NOMA 4KM5A 1ZQGA 4MFCA 4FH3A 1XSNA 5HRIA 5J2IA 4EBKA 1TVAA 1ZQEA 7ICMA 3RJFA 2PXIA 5DB9A 3H3AA 7ICKA 4WOYA 3K75D 4ATBA 3B0XA 4TUPA 4GXJA 8ICPA 4RT2A 4QZFA 4MKPA 4R64A 4RT3A 4I2GA 5IIMA 2HN1A 2ZHAA 4K4GA 1MIVA 3HJ1A 1R8BA 4OAGA 4HX0A 9ICVA 4PHDA 4IQVA 2B51A 1MQ2A 3JZ0A 3EF2A 2ZH5A 3TFRA 5HHIA 4TUSA 1ZQOA 4OAIZ 4EV6A 5CA7A 1BPEA 5J2FA 2I9GA 5DB6A 2DRBA 4O67A 4MF8A 2BBJA 4EEBA 5IIIA 4UB5A 4NM1A 4M9NA 9ICIA 5HHHA 4I0UA 4FHPA 4UAWA 3UXNA 3AU2A 2BPGA 2DR9A 5J0RA 1WOTA 4UBBA 1ZQMA 8ICUA 2HHPA 3PNCA 9ICRA 4KB6A 4RPYA 3C5GA 4KLDA 2ZH9A 4UD4A 1UEVA 4RQ4A 4KLGA 1ZQWA 4UB2A 3NYBA 4M9JA 4X4QA 4I2HA 4R66A 9ICTA 4IG8A 4RPZA 3PMLA 3HJ4A 4O69A 3PMNA 1V4AA 4OAHA 3RJIA 4DOCA 3AU6A 4PGXA 3RJEA 2ZH7A 4RPXA 2HN2A 1ZQAA 4AT7B 2GA9D 2PFQA 9ICFA 5J2GA 8ICZA 7ICQA 1ZQRA 5DBBA 4WC3A 2NRKA 4O68A 2ZH2A 4PHEA 1PX5A 3NWIA 4X4VA 3JCFA 4UAZA 4DO9A 3H37A 5CHEA 4FO1A 5J0WA 3JPSA 5CB1A 5J29A 2FMSA 3C2MA 4X0AA 2BBHA 3CK6A 4QZEA 2O5AA 5F2VO 5HRKA 4E7XA 4YN4A 5D49A 5TZVA 7ICPA 1ZQVA 8ICEA 4I29A 4K98A 8ICYA 4MFFA 4M2YA 5HRBA 2IHOA 1NO5A 3MGHA 3OWGA 3WFOA 4RWPA 2PFOA 1ZQXA 1RPLA 4F5PA 9ICCA 7ICFA 3L9DA 8ICKA 1BPDA 1F5AA 1XSLA 4YMMA 5DB7A 1JN3A 4LZGA 4WC6A 3JPNA 3K7DA 4QZBA 4RWQA 4X4OA 8ICNA 5DDMA 3MDCA 2M2TA 5D4BA 3AUOA 5J0OA 2W9MA 3C5FA 1OU5A 4LT6A 3UPQA 3RJKA 4M9GA 1RZTA 5B3PA 9ICNA 4XJEA 4WC2A 1JAJA 1ZQSA 4KLLA 2M2UA 4WC1A 4UB1A 4JWMA 7ICSA 4DOBA 2ISOA 4I2FA 8ICMA 5J0XA 2FMPA 4WC7A 9ICWA 3V7KA 9ICKA 2VANA 5CFUA 1ZQTA 4I2JA 2B4VA 4LEYA 3JPTA 1R8CA 1ZQUA 2BCRA 4AT9B 4FH5A 7ICRA 3ISBA 9ICLA 4NY8A 4I2IA 4M47A 4WC0A 5J2CA 4R63A 5J0PA 4FHXA 3JPOA 8ICJA 4RQ3A 4NXXA 4TUQA 4UB4A 4YMOA 4LVSA 2BPCA 4X4PA 2PBEA 4WBYA 3B0YA 4EBJA 2ISPA 4F5OA 9ICPA 4Z6FA 3HX0A 7ICTA 3RJGA 3RH4A 5DDYA 5CFTA 1ZQBA 5IILA 5HRDA 8ICGA 5CWRA 5J2BA 4UBCA 3GDXA 1HUOA 4I2BA 5CJ7A 4LEVA 8ICLA 4X4NA 4Z6CA 4P4OA 5HRLA 4KLTA 1VJ7A 2M2WA 4FHYA 3RH5A 4X4UA 8ICSA 7ICLA 5J2HA 4I2CA 4IQUA 2EWRA 3MDAA 4QZ8A 7ICGA 4JLZA 3WFQE 5EOZA 3C2KA 4RQ8A 2RFFA 5DKWA 4K97A 4AT7A 3OUYB 3HIYA 4K9BA 4WBZA 5D62A 5HR9A 3JPQA 4AT8B 4X4RA 1TV9A 1KNYA 3OVBA 3JPRA 4KLFA 2BCUA 4F5QA 8ICTA 4I28A 2FMQA 1MIYA 4I2AA 9ICMA 8ICCA 9ICXA 3C66A 3UQ0A 4UAYA 2Q66A 4O5CA 1ZQNA 2ZH6A 4WQKA 4LZDA 5HRHA 1YLQA 4NXVA 2BPFA 4RWOA 3JYYA 4WC4A 8ICVA 1JMSA 4M9LA 4E80A 4LEZA 3JPPA 4TURA 4O5EA 4NXUA 4NLKA 4KLUA 7ICHA 4KLIA 4KLHA 2ZH8A 2DR8A 3C2LA 4YD1A 4NXZA 5D46A 4QZHA 1TFYA 4KLMA 5BOLA 5J2DA 4K4HA 3LQCB 4IQTA 4IQWA 4R65A 3TFSA 5CP2A 5JTGA 4X4SA 5HC9A 4KLEA 4XQ7A 3UXPA 4F5RA 3OVSA 5IINA 3ER8C 7ICOA 4JLXA 3ISDA 1GPJA 9ICGA 4K99A 4XUSA 4X0BA 1ZQZA 3V7JA 5J2KA 4WH5A 8ICOA 4WC5A 7ICJA 1FA0A 3HWTA 4O9MA 1UETA 5DB8A 5HRFA 3WFPA 4M04A 4NKTA 4NLZA 4MF2A 4I2DA 9ICAA 3AQNA 4I27A 3MGIA 2GWSA 4KLQA 5DBCA 4NLNA 1ZQFA 3RJHA 2ZH1A 4O6AA 5DBAA 4M5DA 3H38A 3AQLA 1BPYA 4PPXA 2FCLA 4RWNA 4WQLA 9ICUA 9ICBA 2ZHBA 4QZ9A 2BE3A 4QZIA 1ZJNA 1ZQDA 1UEUA 4NXWA 2BCSA 8ICWA 2ID1A 1MIWA 3OVAA 8ICAA 4P4MA 1R8AA 9ICQA 4YCXA 4M9HA 3WFSC 4DOAA 4GXKA 4PH5A 3ISCA 4OAFA 1BPXA 4XRHA 4WCWA 3UPSA 4Z6EA 4NKUA 1ZQIA 5J0UA 4ATBB 2DVIA 2GAFD 3OUYA 4AT8A 2PFPA 4K9AA 3V7LA 5J2EA 2ZH3A 8ICRA 4I2EA 1BPBA 2O1PA 4KLSA 5J0TA 5J2JA 4M0AA 1R89A 9ICSA 1ZQCA 8ICXA 3PHZA 4K8VA 4K96A 4F5NA 2BCQA 8ICFA 7ICIA 4RQ2A 4X4TA 5D63A 1HUZA 4NXTA 4XQ8A 4P2HA 1Q79A 4QZCA 4UD5A 7ICVA 5BPCA 2BCVA 4O5KA 4JWNA 7ICEA 5BOMA 5B3QA 4RQ6A 4GXIA 4MFAA 8ICQA 5J2AA 5J0QA 4P4PA 4QZAA 3RJJA 5HREA 3RH6A 4PGQA 1ZQKA 4PHPA 4KLJA 2IUBA 5IIKA 1Q78A 4RQ1A 5IIOA 7ICUA 4FO6A 1KEJA 1ZQYA 5J0SA 5DECA 2P66A 3OV7A 1VFGA 9ICOA 3WFRE 3UXOA 4PGYA 1TFWA 8ICIA 5J0YA 3OGUA 4EGWA 4RQ5A 1JQRA 3MCRA 3NVOA 3ER9B 4E8FA 1ZQJA 9ICEA 4UB3A 4EEDA 2M2VA 2DR5A 5DEDA 4RQ7A 3AQKA 4YD2A 5CHGA 3MBYA 2PFNA
chains in the Genus database with same CATH topology
5HRGA 4Z6DA 4KLOA 4YMNA 5IIJA 3HW8A 4NM2A 9ICHA 4RQ0A 1ZQHA 3C18A 4S3NA 8ICBA 4K4IA 1MQ3A 1ZQLA 3V72A 1XSPA 5CR0A 9ICJA 2DRAA 7ICNA 1ZJMA 4EP7A 3AQMA 4QZGA 3LK9A 1ZQPA 2DR7A 4AT9A 4QZDA 4FHWA 8ICHA 4PHAA 2IHMA 1KDHA 2ZH4A 4X5VA 1ZQQA 4XA5A 3H39A 3UQ2A 1BPZA 4FHVA 1NOMA 1ZQGA 4MFCA 4FH3A 1XSNA 5HRIA 5J2IA 4EBKA 1TVAA 1ZQEA 7ICMA 3RJFA 2PXIA 5DB9A 3H3AA 7ICKA 3K75D 4ATBA 3B0XA 4TUPA 4GXJA 8ICPA 4RT2A 4QZFA 4R64A 4RT3A 4I2GA 5IIMA 2ZHAA 4K4GA 1MIVA 3HJ1A 1R8BA 9ICVA 4PHDA 4IQVA 1MQ2A 3JZ0A 2ZH5A 3TFRA 5HHIA 4TUSA 1ZQOA 5CA7A 1BPEA 5J2FA 2I9GA 5DB6A 2DRBA 4MF8A 5IIIA 4UB5A 4NM1A 4M9NA 9ICIA 5HHHA 4FHPA 4UAWA 3UXNA 3AU2A 2BPGA 2DR9A 5J0RA 1WOTA 4UBBA 1ZQMA 8ICUA 2HHPA 3PNCA 9ICRA 4RPYA 3C5GA 4KLDA 2ZH9A 4UD4A 1UEVA 4RQ4A 4KLGA 1ZQWA 4UB2A 3NYBA 4M9JA 4X4QA 4I2HA 4R66A 9ICTA 4IG8A 4RPZA 3PMLA 3HJ4A 3PMNA 1V4AA 3RJIA 4DOCA 3AU6A 4PGXA 3RJEA 2ZH7A 4RPXA 4AT7B 1ZQAA 2PFQA 9ICFA 5J2GA 8ICZA 7ICQA 1ZQRA 5DBBA 4WC3A 2NRKA 2ZH2A 4PHEA 1PX5A 4X4VA 4UAZA 4DO9A 3H37A 5J0WA 3JPSA 5CB1A 5J29A 2FMSA 3C2MA 4X0AA 4QZEA 2O5AA 5F2VO 5HRKA 4E7XA 4YN4A 5D49A 5TZVA 7ICPA 1ZQVA 8ICEA 4I29A 8ICYA 4MFFA 4M2YA 5HRBA 1NO5A 3MGHA 3WFOA 4RWPA 2PFOA 1ZQXA 1RPLA 4F5PA 9ICCA 7ICFA 3L9DA 8ICKA 1BPDA 1F5AA 1XSLA 4YMMA 5DB7A 1JN3A 4LZGA 4WC6A 3JPNA 4QZBA 4RWQA 4X4OA 8ICNA 5DDMA 3MDCA 2M2TA 5D4BA 3AUOA 5J0OA 2W9MA 3C5FA 1OU5A 4LT6A 3UPQA 3RJKA 4M9GA 1RZTA 4WC2A 9ICNA 1JAJA 1ZQSA 4KLLA 2M2UA 4WC1A 4UB1A 4JWMA 7ICSA 4DOBA 2ISOA 4I2FA 8ICMA 5J0XA 2FMPA 4WC7A 9ICWA 3V7KA 9ICKA 2VANA 1ZQTA 4I2JA 3JPTA 1R8CA 1ZQUA 2BCRA 4AT9B 4FH5A 7ICRA 3ISBA 9ICLA 4NY8A 4I2IA 4M47A 4WC0A 5J2CA 4R63A 5J0PA 4FHXA 3JPOA 8ICJA 4RQ3A 4TUQA 4UB4A 4YMOA 4LVSA 2BPCA 4X4PA 2PBEA 4WBYA 3B0YA 4EBJA 2ISPA 4F5OA 9ICPA 4Z6FA 3HX0A 7ICTA 3RJGA 3RH4A 5DDYA 1ZQBA 5IILA 5HRDA 8ICGA 5CWRA 5J2BA 4UBCA 3GDXA 1HUOA 4I2BA 5CJ7A 8ICLA 4X4NA 4Z6CA 4P4OA 5HRLA 4KLTA 1VJ7A 2M2WA 4FHYA 3RH5A 4X4UA 8ICSA 7ICLA 5J2HA 4I2CA 4IQUA 3MDAA 4QZ8A 7ICGA 3WFQE 5EOZA 3C2KA 4RQ8A 2RFFA 5DKWA 4AT7A 3OUYB 3HIYA 4WBZA 5HR9A 3JPQA 4AT8B 4X4RA 1TV9A 1KNYA 3OVBA 3JPRA 4KLFA 2BCUA 4F5QA 8ICTA 4I28A 2FMQA 1MIYA 4I2AA 9ICMA 8ICCA 9ICXA 3C66A 3UQ0A 4UAYA 2Q66A 4O5CA 1ZQNA 2ZH6A 4LZDA 5HRHA 1YLQA 2BPFA 4RWOA 3JYYA 4WC4A 8ICVA 1JMSA 4M9LA 4E80A 3JPPA 4TURA 4O5EA 4NLKA 4KLUA 7ICHA 4KLIA 4KLHA 2ZH8A 2DR8A 3C2LA 4YD1A 4NXZA 5D46A 4QZHA 1TFYA 4KLMA 5BOLA 5J2DA 4K4HA 3LQCB 4IQTA 4IQWA 4R65A 3TFSA 5CP2A 4X4SA 5HC9A 4KLEA 4XQ7A 3UXPA 4F5RA 3OVSA 5IINA 7ICOA 3ISDA 9ICGA 4XUSA 4X0BA 1ZQZA 3V7JA 5J2KA 8ICOA 4WC5A 7ICJA 1FA0A 3HWTA 4O9MA 1UETA 5DB8A 5HRFA 3WFPA 4M04A 4NKTA 4NLZA 4MF2A 4I2DA 9ICAA 3AQNA 4I27A 3MGIA 2GWSA 4KLQA 5DBCA 4NLNA 1ZQFA 3RJHA 2ZH1A 5DBAA 4M5DA 3H38A 3AQLA 1BPYA 4PPXA 4RWNA 9ICUA 9ICBA 2ZHBA 4QZ9A 2BE3A 4QZIA 1ZJNA 1ZQDA 1UEUA 2BCSA 8ICWA 2ID1A 1MIWA 3OVAA 8ICAA 4P4MA 1R8AA 9ICQA 4YCXA 4M9HA 3WFSC 4DOAA 4GXKA 4PH5A 3ISCA 1BPXA 4XRHA 4WCWA 3UPSA 4Z6EA 4NKUA 1ZQIA 5J0UA 4ATBB 2DVIA 3OUYA 4AT8A 2PFPA 3V7LA 5J2EA 2ZH3A 8ICRA 4I2EA 1BPBA 2O1PA 4KLSA 5J0TA 5J2JA 4M0AA 1R89A 9ICSA 1ZQCA 8ICXA 4F5NA 2BCQA 8ICFA 7ICIA 4RQ2A 4X4TA 1HUZA 4XQ8A 4P2HA 1Q79A 4QZCA 4UD5A 7ICVA 5BPCA 2BCVA 4O5KA 4JWNA 7ICEA 5BOMA 4RQ6A 4GXIA 4MFAA 8ICQA 5J2AA 5J0QA 4P4PA 4QZAA 3RJJA 5HREA 3RH6A 4PGQA 1ZQKA 4PHPA 4KLJA 5IIKA 1Q78A 4RQ1A 5IIOA 7ICUA 4FO6A 1KEJA 1ZQYA 5J0SA 5DECA 2P66A 3OV7A 1VFGA 9ICOA 3WFRE 3UXOA 4PGYA 1TFWA 8ICIA 5J0YA 3OGUA 4RQ5A 1JQRA 4E8FA 1ZQJA 9ICEA 4UB3A 2M2VA 2DR5A 5DEDA 4RQ7A 3AQKA 4YD2A 5CHGA 3MBYA 2PFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRG A;  4Z6D A;  4KLO A;  4YMN A;  5IIJ A;  3HW8 A;  4NM2 A;  9ICH A;  4RQ0 A;  1ZQH A;  3C18 A;  4S3N A;  8ICB A;  4K4I A;  1MQ3 A;  1ZQL A;  3V72 A;  1XSP A;  5CR0 A;  9ICJ A;  2DRA A;  7ICN A;  1ZJM A;  4EP7 A;  3AQM A;  4QZG A;  3LK9 A;  1ZQP A;  2DR7 A;  4AT9 A;  4QZD A;  4FHW A;  8ICH A;  4PHA A;  2IHM A;  1KDH A;  2ZH4 A;  4X5V A;  1ZQQ A;  4XA5 A;  3H39 A;  3UQ2 A;  1BPZ A;  4FHV A;  1NOM A;  1ZQG A;  4MFC A;  4FH3 A;  1XSN A;  5HRI A;  5J2I A;  4EBK A;  1TVA A;  1ZQE A;  7ICM A;  3RJF A;  2PXI A;  5DB9 A;  3H3A A;  7ICK A;  3K75 D;  4ATB A;  3B0X A;  4TUP A;  4GXJ A;  8ICP A;  4RT2 A;  4QZF A;  4R64 A;  4RT3 A;  4I2G A;  5IIM A;  2ZHA A;  4K4G A;  1MIV A;  3HJ1 A;  1R8B A;  9ICV A;  4PHD A;  4IQV A;  1MQ2 A;  3JZ0 A;  2ZH5 A;  3TFR A;  5HHI A;  4TUS A;  1ZQO A;  5CA7 A;  1BPE A;  5J2F A;  2I9G A;  5DB6 A;  2DRB A;  4MF8 A;  5III A;  4UB5 A;  4NM1 A;  4M9N A;  9ICI A;  5HHH A;  4FHP A;  4UAW A;  3UXN A;  3AU2 A;  2BPG A;  2DR9 A;  5J0R A;  1WOT A;  4UBB A;  1ZQM A;  8ICU A;  2HHP A;  3PNC A;  9ICR A;  4RPY A;  3C5G A;  4KLD A;  2ZH9 A;  4UD4 A;  1UEV A;  4RQ4 A;  4KLG A;  1ZQW A;  4UB2 A;  3NYB A;  4M9J A;  4X4Q A;  4I2H A;  4R66 A;  9ICT A;  4IG8 A;  4RPZ A;  3PML A;  3HJ4 A;  3PMN A;  1V4A A;  3RJI A;  4DOC A;  3AU6 A;  4PGX A;  3RJE A;  2ZH7 A;  4RPX A;  4AT7 B;  1ZQA A;  2PFQ A;  9ICF A;  5J2G A;  8ICZ A;  7ICQ A;  1ZQR A;  5DBB A;  4WC3 A;  2NRK A;  2ZH2 A;  4PHE A;  1PX5 A;  4X4V A;  4UAZ A;  4DO9 A;  3H37 A;  5J0W A;  3JPS A;  5CB1 A;  5J29 A;  2FMS A;  3C2M A;  4X0A A;  4QZE A;  2O5A A;  5F2V O;  5HRK A;  4E7X A;  4YN4 A;  5D49 A;  5TZV A;  7ICP A;  1ZQV A;  8ICE A;  4I29 A;  8ICY A;  4MFF A;  4M2Y A;  5HRB A;  1NO5 A;  3MGH A;  3WFO A;  4RWP A;  2PFO A;  1ZQX A;  1RPL A;  4F5P A;  9ICC A;  7ICF A;  3L9D A;  8ICK A;  1BPD A;  1F5A A;  1XSL A;  4YMM A;  5DB7 A;  1JN3 A;  4LZG A;  4WC6 A;  3JPN A;  4QZB A;  4RWQ A;  4X4O A;  8ICN A;  5DDM A;  3MDC A;  2M2T A;  5D4B A;  3AUO A;  5J0O A;  2W9M A;  3C5F A;  1OU5 A;  4LT6 A;  3UPQ A;  3RJK A;  4M9G A;  1RZT A;  4WC2 A;  9ICN A;  1JAJ A;  1ZQS A;  4KLL A;  2M2U A;  4WC1 A;  4UB1 A;  4JWM A;  7ICS A;  4DOB A;  2ISO A;  4I2F A;  8ICM A;  5J0X A;  2FMP A;  4WC7 A;  9ICW A;  3V7K A;  9ICK A;  2VAN A;  1ZQT A;  4I2J A;  3JPT A;  1R8C A;  1ZQU A;  2BCR A;  4AT9 B;  4FH5 A;  7ICR A;  3ISB A;  9ICL A;  4NY8 A;  4I2I A;  4M47 A;  4WC0 A;  5J2C A;  4R63 A;  5J0P A;  4FHX A;  3JPO A;  8ICJ A;  4RQ3 A;  4TUQ A;  4UB4 A;  4YMO A;  4LVS A;  2BPC A;  4X4P A;  2PBE A;  4WBY A;  3B0Y A;  4EBJ A;  2ISP A;  4F5O A;  9ICP A;  4Z6F A;  3HX0 A;  7ICT A;  3RJG A;  3RH4 A;  5DDY A;  1ZQB A;  5IIL A;  5HRD A;  8ICG A;  5CWR A;  5J2B A;  4UBC A;  3GDX A;  1HUO A;  4I2B A;  5CJ7 A;  8ICL A;  4X4N A;  4Z6C A;  4P4O A;  5HRL A;  4KLT A;  1VJ7 A;  2M2W A;  4FHY A;  3RH5 A;  4X4U A;  8ICS A;  7ICL A;  5J2H A;  4I2C A;  4IQU A;  3MDA A;  4QZ8 A;  7ICG A;  3WFQ E;  5EOZ A;  3C2K A;  4RQ8 A;  2RFF A;  5DKW A;  4AT7 A;  3OUY B;  3HIY A;  4WBZ A;  5HR9 A;  3JPQ A;  4AT8 B;  4X4R A;  1TV9 A;  1KNY A;  3OVB A;  3JPR A;  4KLF A;  2BCU A;  4F5Q A;  8ICT A;  4I28 A;  2FMQ A;  1MIY A;  4I2A A;  9ICM A;  8ICC A;  9ICX A;  3C66 A;  3UQ0 A;  4UAY A;  2Q66 A;  4O5C A;  1ZQN A;  2ZH6 A;  4LZD A;  5HRH A;  1YLQ A;  2BPF A;  4RWO A;  3JYY A;  4WC4 A;  8ICV A;  1JMS A;  4M9L A;  4E80 A;  3JPP A;  4TUR A;  4O5E A;  4NLK A;  4KLU A;  7ICH A;  4KLI A;  4KLH A;  2ZH8 A;  2DR8 A;  3C2L A;  4YD1 A;  4NXZ A;  5D46 A;  4QZH A;  1TFY A;  4KLM A;  5BOL A;  5J2D A;  4K4H A;  3LQC B;  4IQT A;  4IQW A;  4R65 A;  3TFS A;  5CP2 A;  4X4S A;  5HC9 A;  4KLE A;  4XQ7 A;  3UXP A;  4F5R A;  3OVS A;  5IIN A;  7ICO A;  3ISD A;  9ICG A;  4XUS A;  4X0B A;  1ZQZ A;  3V7J A;  5J2K A;  8ICO A;  4WC5 A;  7ICJ A;  1FA0 A;  3HWT A;  4O9M A;  1UET A;  5DB8 A;  5HRF A;  3WFP A;  4M04 A;  4NKT A;  4NLZ A;  4MF2 A;  4I2D A;  9ICA A;  3AQN A;  4I27 A;  3MGI A;  2GWS A;  4KLQ A;  5DBC A;  4NLN A;  1ZQF A;  3RJH A;  2ZH1 A;  5DBA A;  4M5D A;  3H38 A;  3AQL A;  1BPY A;  4PPX A;  4RWN A;  9ICU A;  9ICB A;  2ZHB A;  4QZ9 A;  2BE3 A;  4QZI A;  1ZJN A;  1ZQD A;  1UEU A;  2BCS A;  8ICW A;  2ID1 A;  1MIW A;  3OVA A;  8ICA A;  4P4M A;  1R8A A;  9ICQ A;  4YCX A;  4M9H A;  3WFS C;  4DOA A;  4GXK A;  4PH5 A;  3ISC A;  1BPX A;  4XRH A;  4WCW A;  3UPS A;  4Z6E A;  4NKU A;  1ZQI A;  5J0U A;  4ATB B;  2DVI A;  3OUY A;  4AT8 A;  2PFP A;  3V7L A;  5J2E A;  2ZH3 A;  8ICR A;  4I2E A;  1BPB A;  2O1P A;  4KLS A;  5J0T A;  5J2J A;  4M0A A;  1R89 A;  9ICS A;  1ZQC A;  8ICX A;  4F5N A;  2BCQ A;  8ICF A;  7ICI A;  4RQ2 A;  4X4T A;  1HUZ A;  4XQ8 A;  4P2H A;  1Q79 A;  4QZC A;  4UD5 A;  7ICV A;  5BPC A;  2BCV A;  4O5K A;  4JWN A;  7ICE A;  5BOM A;  4RQ6 A;  4GXI A;  4MFA A;  8ICQ A;  5J2A A;  5J0Q A;  4P4P A;  4QZA A;  3RJJ A;  5HRE A;  3RH6 A;  4PGQ A;  1ZQK A;  4PHP A;  4KLJ A;  5IIK A;  1Q78 A;  4RQ1 A;  5IIO A;  7ICU A;  4FO6 A;  1KEJ A;  1ZQY A;  5J0S A;  5DEC A;  2P66 A;  3OV7 A;  1VFG A;  9ICO A;  3WFR E;  3UXO A;  4PGY A;  1TFW A;  8ICI A;  5J0Y A;  3OGU A;  4RQ5 A;  1JQR A;  4E8F A;  1ZQJ A;  9ICE A;  4UB3 A;  2M2V A;  2DR5 A;  5DED A;  4RQ7 A;  3AQK A;  4YD2 A;  5CHG A;  3MBY A;  2PFN A; 
#chains in the Genus database with same CATH topology
 5HRG A;  5CFS A;  4Z6D A;  4KLO A;  4YMN A;  5IIJ A;  3HW8 A;  4NM2 A;  9ICH A;  4RQ0 A;  1ZQH A;  3C18 A;  4S3N A;  8ICB A;  4K4I A;  1MQ3 A;  1ZQL A;  3V72 A;  1XSP A;  5CR0 A;  9ICJ A;  2DRA A;  7ICN A;  1ZJM A;  4EP7 A;  3AQM A;  4QZG A;  3LK9 A;  1ZQP A;  2DR7 A;  4AT9 A;  4QZD A;  3NKU A;  2B56 A;  4FHW A;  4N7R A;  5D61 A;  8ICH A;  4PHA A;  3ERC C;  2IHM A;  1KDH A;  2ZH4 A;  4X5V A;  1ZQQ A;  4XA5 A;  4LEW A;  3H39 A;  3UQ2 A;  1BPZ A;  4FHV A;  1NOM A;  4KM5 A;  1ZQG A;  4MFC A;  4FH3 A;  1XSN A;  5HRI A;  5J2I A;  4EBK A;  1TVA A;  1ZQE A;  7ICM A;  3RJF A;  2PXI A;  5DB9 A;  3H3A A;  7ICK A;  4WOY A;  3K75 D;  4ATB A;  3B0X A;  4TUP A;  4GXJ A;  8ICP A;  4RT2 A;  4QZF A;  4MKP A;  4R64 A;  4RT3 A;  4I2G A;  5IIM A;  2HN1 A;  2ZHA A;  4K4G A;  1MIV A;  3HJ1 A;  1R8B A;  4OAG A;  4HX0 A;  9ICV A;  4PHD A;  4IQV A;  2B51 A;  1MQ2 A;  3JZ0 A;  3EF2 A;  2ZH5 A;  3TFR A;  5HHI A;  4TUS A;  1ZQO A;  4OAI Z;  4EV6 A;  5CA7 A;  1BPE A;  5J2F A;  2I9G A;  5DB6 A;  2DRB A;  4O67 A;  4MF8 A;  2BBJ A;  4EEB A;  5III A;  4UB5 A;  4NM1 A;  4M9N A;  9ICI A;  5HHH A;  4I0U A;  4FHP A;  4UAW A;  3UXN A;  3AU2 A;  2BPG A;  2DR9 A;  5J0R A;  1WOT A;  4UBB A;  1ZQM A;  8ICU A;  2HHP A;  3PNC A;  9ICR A;  4KB6 A;  4RPY A;  3C5G A;  4KLD A;  2ZH9 A;  4UD4 A;  1UEV A;  4RQ4 A;  4KLG A;  1ZQW A;  4UB2 A;  3NYB A;  4M9J A;  4X4Q A;  4I2H A;  4R66 A;  9ICT A;  4IG8 A;  4RPZ A;  3PML A;  3HJ4 A;  4O69 A;  3PMN A;  1V4A A;  4OAH A;  3RJI A;  4DOC A;  3AU6 A;  4PGX A;  3RJE A;  2ZH7 A;  4RPX A;  2HN2 A;  1ZQA A;  4AT7 B;  2GA9 D;  2PFQ A;  9ICF A;  5J2G A;  8ICZ A;  7ICQ A;  1ZQR A;  5DBB A;  4WC3 A;  2NRK A;  4O68 A;  2ZH2 A;  4PHE A;  1PX5 A;  3NWI A;  4X4V A;  3JCF A;  4UAZ A;  4DO9 A;  3H37 A;  5CHE A;  4FO1 A;  5J0W A;  3JPS A;  5CB1 A;  5J29 A;  2FMS A;  3C2M A;  4X0A A;  2BBH A;  3CK6 A;  4QZE A;  2O5A A;  5F2V O;  5HRK A;  4E7X A;  4YN4 A;  5D49 A;  5TZV A;  7ICP A;  1ZQV A;  8ICE A;  4I29 A;  4K98 A;  8ICY A;  4MFF A;  4M2Y A;  5HRB A;  2IHO A;  1NO5 A;  3MGH A;  3OWG A;  3WFO A;  4RWP A;  2PFO A;  1ZQX A;  1RPL A;  4F5P A;  9ICC A;  7ICF A;  3L9D A;  8ICK A;  1BPD A;  1F5A A;  1XSL A;  4YMM A;  5DB7 A;  1JN3 A;  4LZG A;  4WC6 A;  3JPN A;  3K7D A;  4QZB A;  4RWQ A;  4X4O A;  8ICN A;  5DDM A;  3MDC A;  2M2T A;  5D4B A;  3AUO A;  5J0O A;  2W9M A;  3C5F A;  1OU5 A;  4LT6 A;  3UPQ A;  3RJK A;  4M9G A;  1RZT A;  5B3P A;  9ICN A;  4XJE A;  4WC2 A;  1JAJ A;  1ZQS A;  4KLL A;  2M2U A;  4WC1 A;  4UB1 A;  4JWM A;  7ICS A;  4DOB A;  2ISO A;  4I2F A;  8ICM A;  5J0X A;  2FMP A;  4WC7 A;  9ICW A;  3V7K A;  9ICK A;  2VAN A;  5CFU A;  1ZQT A;  4I2J A;  2B4V A;  4LEY A;  3JPT A;  1R8C A;  1ZQU A;  2BCR A;  4AT9 B;  4FH5 A;  7ICR A;  3ISB A;  9ICL A;  4NY8 A;  4I2I A;  4M47 A;  4WC0 A;  5J2C A;  4R63 A;  5J0P A;  4FHX A;  3JPO A;  8ICJ A;  4RQ3 A;  4NXX A;  4TUQ A;  4UB4 A;  4YMO A;  4LVS A;  2BPC A;  4X4P A;  2PBE A;  4WBY A;  3B0Y A;  4EBJ A;  2ISP A;  4F5O A;  9ICP A;  4Z6F A;  3HX0 A;  7ICT A;  3RJG A;  3RH4 A;  5DDY A;  5CFT A;  1ZQB A;  5IIL A;  5HRD A;  8ICG A;  5CWR A;  5J2B A;  4UBC A;  3GDX A;  1HUO A;  4I2B A;  5CJ7 A;  4LEV A;  8ICL A;  4X4N A;  4Z6C A;  4P4O A;  5HRL A;  4KLT A;  1VJ7 A;  2M2W A;  4FHY A;  3RH5 A;  4X4U A;  8ICS A;  7ICL A;  5J2H A;  4I2C A;  4IQU A;  2EWR A;  3MDA A;  4QZ8 A;  7ICG A;  4JLZ A;  3WFQ E;  5EOZ A;  3C2K A;  4RQ8 A;  2RFF A;  5DKW A;  4K97 A;  4AT7 A;  3OUY B;  3HIY A;  4K9B A;  4WBZ A;  5D62 A;  5HR9 A;  3JPQ A;  4AT8 B;  4X4R A;  1TV9 A;  1KNY A;  3OVB A;  3JPR A;  4KLF A;  2BCU A;  4F5Q A;  8ICT A;  4I28 A;  2FMQ A;  1MIY A;  4I2A A;  9ICM A;  8ICC A;  9ICX A;  3C66 A;  3UQ0 A;  4UAY A;  2Q66 A;  4O5C A;  1ZQN A;  2ZH6 A;  4WQK A;  4LZD A;  5HRH A;  1YLQ A;  4NXV A;  2BPF A;  4RWO A;  3JYY A;  4WC4 A;  8ICV A;  1JMS A;  4M9L A;  4E80 A;  4LEZ A;  3JPP A;  4TUR A;  4O5E A;  4NXU A;  4NLK A;  4KLU A;  7ICH A;  4KLI A;  4KLH A;  2ZH8 A;  2DR8 A;  3C2L A;  4YD1 A;  4NXZ A;  5D46 A;  4QZH A;  1TFY A;  4KLM A;  5BOL A;  5J2D A;  4K4H A;  3LQC B;  4IQT A;  4IQW A;  4R65 A;  3TFS A;  5CP2 A;  5JTG A;  4X4S A;  5HC9 A;  4KLE A;  4XQ7 A;  3UXP A;  4F5R A;  3OVS A;  5IIN A;  3ER8 C;  7ICO A;  4JLX A;  3ISD A;  1GPJ A;  9ICG A;  4K99 A;  4XUS A;  4X0B A;  1ZQZ A;  3V7J A;  5J2K A;  4WH5 A;  8ICO A;  4WC5 A;  7ICJ A;  1FA0 A;  3HWT A;  4O9M A;  1UET A;  5DB8 A;  5HRF A;  3WFP A;  4M04 A;  4NKT A;  4NLZ A;  4MF2 A;  4I2D A;  9ICA A;  3AQN A;  4I27 A;  3MGI A;  2GWS A;  4KLQ A;  5DBC A;  4NLN A;  1ZQF A;  3RJH A;  2ZH1 A;  4O6A A;  5DBA A;  4M5D A;  3H38 A;  3AQL A;  1BPY A;  4PPX A;  2FCL A;  4RWN A;  4WQL A;  9ICU A;  9ICB A;  2ZHB A;  4QZ9 A;  2BE3 A;  4QZI A;  1ZJN A;  1ZQD A;  1UEU A;  4NXW A;  2BCS A;  8ICW A;  2ID1 A;  1MIW A;  3OVA A;  8ICA A;  4P4M A;  1R8A A;  9ICQ A;  4YCX A;  4M9H A;  3WFS C;  4DOA A;  4GXK A;  4PH5 A;  3ISC A;  4OAF A;  1BPX A;  4XRH A;  4WCW A;  3UPS A;  4Z6E A;  4NKU A;  1ZQI A;  5J0U A;  4ATB B;  2DVI A;  2GAF D;  3OUY A;  4AT8 A;  2PFP A;  4K9A A;  3V7L A;  5J2E A;  2ZH3 A;  8ICR A;  4I2E A;  1BPB A;  2O1P A;  4KLS A;  5J0T A;  5J2J A;  4M0A A;  1R89 A;  9ICS A;  1ZQC A;  8ICX A;  3PHZ A;  4K8V A;  4K96 A;  4F5N A;  2BCQ A;  8ICF A;  7ICI A;  4RQ2 A;  4X4T A;  5D63 A;  1HUZ A;  4NXT A;  4XQ8 A;  4P2H A;  1Q79 A;  4QZC A;  4UD5 A;  7ICV A;  5BPC A;  2BCV A;  4O5K A;  4JWN A;  7ICE A;  5BOM A;  5B3Q A;  4RQ6 A;  4GXI A;  4MFA A;  8ICQ A;  5J2A A;  5J0Q A;  4P4P A;  4QZA A;  3RJJ A;  5HRE A;  3RH6 A;  4PGQ A;  1ZQK A;  4PHP A;  4KLJ A;  2IUB A;  5IIK A;  1Q78 A;  4RQ1 A;  5IIO A;  7ICU A;  4FO6 A;  1KEJ A;  1ZQY A;  5J0S A;  5DEC A;  2P66 A;  3OV7 A;  1VFG A;  9ICO A;  3WFR E;  3UXO A;  4PGY A;  1TFW A;  8ICI A;  5J0Y A;  3OGU A;  4EGW A;  4RQ5 A;  1JQR A;  3MCR A;  3NVO A;  3ER9 B;  4E8F A;  1ZQJ A;  9ICE A;  4UB3 A;  4EED A;  2M2V A;  2DR5 A;  5DED A;  4RQ7 A;  3AQK A;  4YD2 A;  5CHG A;  3MBY A;  2PFN A; 
#chains in the Genus database with same CATH homology
 5HRG A;  4Z6D A;  4KLO A;  4YMN A;  5IIJ A;  3HW8 A;  4NM2 A;  9ICH A;  4RQ0 A;  1ZQH A;  3C18 A;  4S3N A;  8ICB A;  4K4I A;  1MQ3 A;  1ZQL A;  3V72 A;  1XSP A;  5CR0 A;  9ICJ A;  2DRA A;  7ICN A;  1ZJM A;  4EP7 A;  3AQM A;  4QZG A;  3LK9 A;  1ZQP A;  2DR7 A;  4AT9 A;  4QZD A;  4FHW A;  8ICH A;  4PHA A;  2IHM A;  1KDH A;  2ZH4 A;  4X5V A;  1ZQQ A;  4XA5 A;  3H39 A;  3UQ2 A;  1BPZ A;  4FHV A;  1NOM A;  1ZQG A;  4MFC A;  4FH3 A;  1XSN A;  5HRI A;  5J2I A;  4EBK A;  1TVA A;  1ZQE A;  7ICM A;  3RJF A;  2PXI A;  5DB9 A;  3H3A A;  7ICK A;  3K75 D;  4ATB A;  3B0X A;  4TUP A;  4GXJ A;  8ICP A;  4RT2 A;  4QZF A;  4R64 A;  4RT3 A;  4I2G A;  5IIM A;  2ZHA A;  4K4G A;  1MIV A;  3HJ1 A;  1R8B A;  9ICV A;  4PHD A;  4IQV A;  1MQ2 A;  3JZ0 A;  2ZH5 A;  3TFR A;  5HHI A;  4TUS A;  1ZQO A;  5CA7 A;  1BPE A;  5J2F A;  2I9G A;  5DB6 A;  2DRB A;  4MF8 A;  5III A;  4UB5 A;  4NM1 A;  4M9N A;  9ICI A;  5HHH A;  4FHP A;  4UAW A;  3UXN A;  3AU2 A;  2BPG A;  2DR9 A;  5J0R A;  1WOT A;  4UBB A;  1ZQM A;  8ICU A;  2HHP A;  3PNC A;  9ICR A;  4RPY A;  3C5G A;  4KLD A;  2ZH9 A;  4UD4 A;  1UEV A;  4RQ4 A;  4KLG A;  1ZQW A;  4UB2 A;  3NYB A;  4M9J A;  4X4Q A;  4I2H A;  4R66 A;  9ICT A;  4IG8 A;  4RPZ A;  3PML A;  3HJ4 A;  3PMN A;  1V4A A;  3RJI A;  4DOC A;  3AU6 A;  4PGX A;  3RJE A;  2ZH7 A;  4RPX A;  4AT7 B;  1ZQA A;  2PFQ A;  9ICF A;  5J2G A;  8ICZ A;  7ICQ A;  1ZQR A;  5DBB A;  4WC3 A;  2NRK A;  2ZH2 A;  4PHE A;  1PX5 A;  4X4V A;  4UAZ A;  4DO9 A;  3H37 A;  5J0W A;  3JPS A;  5CB1 A;  5J29 A;  2FMS A;  3C2M A;  4X0A A;  4QZE A;  2O5A A;  5F2V O;  5HRK A;  4E7X A;  4YN4 A;  5D49 A;  5TZV A;  7ICP A;  1ZQV A;  8ICE A;  4I29 A;  8ICY A;  4MFF A;  4M2Y A;  5HRB A;  1NO5 A;  3MGH A;  3WFO A;  4RWP A;  2PFO A;  1ZQX A;  1RPL A;  4F5P A;  9ICC A;  7ICF A;  3L9D A;  8ICK A;  1BPD A;  1F5A A;  1XSL A;  4YMM A;  5DB7 A;  1JN3 A;  4LZG A;  4WC6 A;  3JPN A;  4QZB A;  4RWQ A;  4X4O A;  8ICN A;  5DDM A;  3MDC A;  2M2T A;  5D4B A;  3AUO A;  5J0O A;  2W9M A;  3C5F A;  1OU5 A;  4LT6 A;  3UPQ A;  3RJK A;  4M9G A;  1RZT A;  4WC2 A;  9ICN A;  1JAJ A;  1ZQS A;  4KLL A;  2M2U A;  4WC1 A;  4UB1 A;  4JWM A;  7ICS A;  4DOB A;  2ISO A;  4I2F A;  8ICM A;  5J0X A;  2FMP A;  4WC7 A;  9ICW A;  3V7K A;  9ICK A;  2VAN A;  1ZQT A;  4I2J A;  3JPT A;  1R8C A;  1ZQU A;  2BCR A;  4AT9 B;  4FH5 A;  7ICR A;  3ISB A;  9ICL A;  4NY8 A;  4I2I A;  4M47 A;  4WC0 A;  5J2C A;  4R63 A;  5J0P A;  4FHX A;  3JPO A;  8ICJ A;  4RQ3 A;  4TUQ A;  4UB4 A;  4YMO A;  4LVS A;  2BPC A;  4X4P A;  2PBE A;  4WBY A;  3B0Y A;  4EBJ A;  2ISP A;  4F5O A;  9ICP A;  4Z6F A;  3HX0 A;  7ICT A;  3RJG A;  3RH4 A;  5DDY A;  1ZQB A;  5IIL A;  5HRD A;  8ICG A;  5CWR A;  5J2B A;  4UBC A;  3GDX A;  1HUO A;  4I2B A;  5CJ7 A;  8ICL A;  4X4N A;  4Z6C A;  4P4O A;  5HRL A;  4KLT A;  1VJ7 A;  2M2W A;  4FHY A;  3RH5 A;  4X4U A;  8ICS A;  7ICL A;  5J2H A;  4I2C A;  4IQU A;  3MDA A;  4QZ8 A;  7ICG A;  3WFQ E;  5EOZ A;  3C2K A;  4RQ8 A;  2RFF A;  5DKW A;  4AT7 A;  3OUY B;  3HIY A;  4WBZ A;  5HR9 A;  3JPQ A;  4AT8 B;  4X4R A;  1TV9 A;  1KNY A;  3OVB A;  3JPR A;  4KLF A;  2BCU A;  4F5Q A;  8ICT A;  4I28 A;  2FMQ A;  1MIY A;  4I2A A;  9ICM A;  8ICC A;  9ICX A;  3C66 A;  3UQ0 A;  4UAY A;  2Q66 A;  4O5C A;  1ZQN A;  2ZH6 A;  4LZD A;  5HRH A;  1YLQ A;  2BPF A;  4RWO A;  3JYY A;  4WC4 A;  8ICV A;  1JMS A;  4M9L A;  4E80 A;  3JPP A;  4TUR A;  4O5E A;  4NLK A;  4KLU A;  7ICH A;  4KLI A;  4KLH A;  2ZH8 A;  2DR8 A;  3C2L A;  4YD1 A;  4NXZ A;  5D46 A;  4QZH A;  1TFY A;  4KLM A;  5BOL A;  5J2D A;  4K4H A;  3LQC B;  4IQT A;  4IQW A;  4R65 A;  3TFS A;  5CP2 A;  4X4S A;  5HC9 A;  4KLE A;  4XQ7 A;  3UXP A;  4F5R A;  3OVS A;  5IIN A;  7ICO A;  3ISD A;  9ICG A;  4XUS A;  4X0B A;  1ZQZ A;  3V7J A;  5J2K A;  8ICO A;  4WC5 A;  7ICJ A;  1FA0 A;  3HWT A;  4O9M A;  1UET A;  5DB8 A;  5HRF A;  3WFP A;  4M04 A;  4NKT A;  4NLZ A;  4MF2 A;  4I2D A;  9ICA A;  3AQN A;  4I27 A;  3MGI A;  2GWS A;  4KLQ A;  5DBC A;  4NLN A;  1ZQF A;  3RJH A;  2ZH1 A;  5DBA A;  4M5D A;  3H38 A;  3AQL A;  1BPY A;  4PPX A;  4RWN A;  9ICU A;  9ICB A;  2ZHB A;  4QZ9 A;  2BE3 A;  4QZI A;  1ZJN A;  1ZQD A;  1UEU A;  2BCS A;  8ICW A;  2ID1 A;  1MIW A;  3OVA A;  8ICA A;  4P4M A;  1R8A A;  9ICQ A;  4YCX A;  4M9H A;  3WFS C;  4DOA A;  4GXK A;  4PH5 A;  3ISC A;  1BPX A;  4XRH A;  4WCW A;  3UPS A;  4Z6E A;  4NKU A;  1ZQI A;  5J0U A;  4ATB B;  2DVI A;  3OUY A;  4AT8 A;  2PFP A;  3V7L A;  5J2E A;  2ZH3 A;  8ICR A;  4I2E A;  1BPB A;  2O1P A;  4KLS A;  5J0T A;  5J2J A;  4M0A A;  1R89 A;  9ICS A;  1ZQC A;  8ICX A;  4F5N A;  2BCQ A;  8ICF A;  7ICI A;  4RQ2 A;  4X4T A;  1HUZ A;  4XQ8 A;  4P2H A;  1Q79 A;  4QZC A;  4UD5 A;  7ICV A;  5BPC A;  2BCV A;  4O5K A;  4JWN A;  7ICE A;  5BOM A;  4RQ6 A;  4GXI A;  4MFA A;  8ICQ A;  5J2A A;  5J0Q A;  4P4P A;  4QZA A;  3RJJ A;  5HRE A;  3RH6 A;  4PGQ A;  1ZQK A;  4PHP A;  4KLJ A;  5IIK A;  1Q78 A;  4RQ1 A;  5IIO A;  7ICU A;  4FO6 A;  1KEJ A;  1ZQY A;  5J0S A;  5DEC A;  2P66 A;  3OV7 A;  1VFG A;  9ICO A;  3WFR E;  3UXO A;  4PGY A;  1TFW A;  8ICI A;  5J0Y A;  3OGU A;  4RQ5 A;  1JQR A;  4E8F A;  1ZQJ A;  9ICE A;  4UB3 A;  2M2V A;  2DR5 A;  5DED A;  4RQ7 A;  3AQK A;  4YD2 A;  5CHG A;  3MBY A;  2PFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...