2M2VA

African swine fever virus pol x in the ternary complex with mgdgtp and dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2vA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2vA01
4DOBA 4GXJA 1NOMA 1TVAA 9ICMA 8ICBA 4WC3A 4UBBA 4E7XA 4TUSA 4R63A 1NO5A 4WBZA 4E8FA 2DRAA 4I29A 4NKUA 7ICEA 7ICTA 1ZQNA 8ICAA 3HJ4A 4RWOA 4KLDA 4KLUA 5IINA 3RJIA 4UAZA 9ICPA 4RWNA 1BPXA 4X4QA 4QZBA 3JPPA 3ISBA 4KLGA 2ZH4A 2BE3A 4WC2A 5IILA 4UAYA 2M2WA 4NXZA 8ICGA 4Z6CA 4M0AA 1RPLA 8ICYA 5J0OA 1XSNA 1R89A 4I2DA 5BPCA 7ICUA 3WFOA 3JYYA 5CJ7A 4TUQA 7ICJA 8ICRA 5HRHA 4UB4A 4KLOA 8ICWA 4PGYA 4QZ8A 5D4BA 1ZQJA 3MBYA 2BCVA 1OU5A 7ICQA 1ZQPA 3H38A 5DBBA 5CR0A 4O5CA 3HIYA 5DB6A 5D46A 3PMLA 4PHEA 5DBAA 4PGXA 3OV7A 4AT7B 1KNYA 5DDMA 1BPBA 4X0AA 1F5AA 1MQ3A 4RPZA 3OGUA 3JPQA 4AT7A 3H37A 1XSPA 4XA5A 5J2FA 5J0TA 2DR9A 4KLEA 1ZQGA 1V4AA 5HRBA 4I2FA 3RH6A 4S3NA 4YN4A 5D49A 5CHGA 4O5EA 4TURA 7ICNA 3AQMA 1ZQWA 4PHDA 5HHIA 3AQLA 4QZIA 4R65A 4R64A 4EP7A 3C2KA 4KLHA 4MF8A 5J2DA 3PMNA 2P66A 3C5FA 4EBJA 2M2UA 4DOCA 1MIWA 3RJHA 2PFOA 1ZQFA 3JPSA 1UEVA 4XQ7A 5BOMA 4QZEA 5IIMA 4IQUA 4ATBB 1ZQVA 4WC4A 3UXNA 4PGQA 3V7JA 4YMNA 5CA7A 2ZH2A 4M47A 3K75D 4QZFA 2IHMA 4ATBA 5J2HA 2HHPA 2DR5A 1TFYA 1BPEA 1Q79A 4KLJA 4YD2A 9ICAA 4RT2A 4M5DA 4X5VA 3PNCA 4QZCA 4M2YA 9ICRA 8ICJA 5J0RA 4M9GA 9ICOA 4KLSA 8ICZA 8ICTA 2BPGA 2DR8A 4FH5A 4O5KA 2FMPA 4RT3A 8ICHA 5HRIA 4F5PA 4UD5A 4JWMA 4M9HA 4RPYA 4UB1A 4LT6A 8ICUA 4F5OA 4FHVA 4FHWA 5J0PA 4WC1A 1XSLA 8ICIA 4RQ6A 4WC5A 5J0SA 9ICJA 4YD1A 9ICVA 5J0UA 9ICNA 8ICOA 4M9JA 7ICHA 2I9GA 3C5GA 4MFAA 1ZQCA 4PH5A 3AU2A 2PBEA 4QZHA 2BCUA 7ICOA 9ICIA 1JQRA 5J2CA 4UBCA 4E80A 2ZH8A 8ICPA 4X4TA 3UXOA 5HR9A 1ZQOA 5J2KA 8ICMA 3JPOA 4NLKA 4X4SA 4KLTA 4RQ5A 3JPNA 3OUYB 2W9MA 4IQTA 4X4NA 4RQ3A 2BPFA 3MDCA 1KDHA 4NLNA 5IIOA 5J2EA 1HUOA 4FH3A 4I28A 4KLIA 4X4VA 4UD4A 5J0YA 3OUYA 4KLLA 2PFNA 5BOLA 3MGHA 2ISOA 4I2BA 3TFSA 9ICSA 3RJKA 5DECA 4PPXA 4R66A 3AU6A 3V72A 5CP2A 2M2TA 4RQ2A 4K4IA 3WFRE 4FHYA 2DRBA 5DDYA 3H39A 4XUSA 3RH4A 4EBKA 2ISPA 1Q78A 8ICEA 1TV9A 1TFWA 4YCXA 1ZQIA 1BPDA 1RZTA 4F5RA 4JWNA 4UB3A 4I2HA 3HW8A 7ICLA 2ZHAA 1VFGA 4IG8A 1PX5A 8ICFA 4NM2A 3HWTA 7ICFA 8ICXA 3L9DA 3JZ0A 3GDXA 3C2LA 3RJGA 7ICSA 3H3AA 2PFQA 4MF2A 3B0YA 9ICLA 1ZQAA 5J2BA 4LZGA 1VJ7A 2FMQA 5DBCA 5IIJA 1UETA 8ICLA 1YLQA 3LQCB 3AUOA 1HUZA 5DKWA 4MFCA 4K4HA 4DO9A 1JAJA 3MDAA 1JN3A 5J0QA 4I2EA 4P4OA 3V7LA 3C66A 4QZDA 4QZAA 4UAWA 1R8BA 3NYBA 5HRGA 1ZQLA 4M9LA 5HRKA 2PFPA 4F5QA 4FHPA 2ZH1A 5HRDA 4WC7A 4X0BA 2ZH7A 4X4OA 5DEDA 5IIKA 4LVSA 4FHXA 2M2VA 5DB9A 9ICFA 4X4UA 4FO6A 1ZQKA 5TZVA 3C18A 3AQNA 1ZQMA 1ZQBA 4I2CA 4RQ0A 2GWSA 4UB2A 3RH5A 4RWQA 4I2GA 7ICIA 5HRFA 4AT9B 4QZ9A 1JMSA 4KLMA 9ICWA 4RQ7A 3WFQE 4M04A 5HRLA 4P2HA 3LK9A 4PHAA 4Z6EA 4UB5A 3JPTA 7ICGA 4AT9A 3UPQA 5CB1A 4X4PA 1ZQEA 4I2JA 5HC9A 2NRKA 1ZQUA 3B0XA 7ICRA 2ZH5A 3UQ2A 1ZQHA 1KEJA 1R8AA 5IIIA 4IQWA 3UXPA 2ZH6A 4I2AA 2ID1A 3UPSA 8ICKA 1WOTA 3OVBA 3ISDA 2DR7A 4PHPA 1BPYA 4MFFA 9ICGA 4RQ1A 4KLFA 1ZQTA 5F2VO 9ICEA 4IQVA 9ICQA 2RFFA 4QZGA 4M9NA 1UEUA 2ZH3A 4WC0A 1FA0A 2DVIA 4NM1A 7ICPA 4Z6DA 1ZQYA 2O5AA 2O1PA 7ICVA 4NKTA 4KLQA 5J2JA 4K4GA 7ICMA 4NLZA 1ZQDA 7ICKA 4RPXA 4TUPA 3V7KA 5HHHA 3OVSA 3RJFA 5J0XA 4WCWA 4X4RA 3RJEA 3C2MA 4XRHA 8ICCA 3OVAA 4Z6FA 2ZH9A 1R8CA 4P4PA 1ZJMA 8ICSA 4RQ8A 5J29A 4WC6A 3AQKA 2FMSA 9ICUA 8ICNA 1MIVA 4O9MA 9ICKA 3UQ0A 9ICHA 1MIYA 1ZQRA 3WFPA 4I2IA 1ZQXA 4YMMA 3ISCA 4RWPA 1ZQQA 2BCRA 4P4MA 4GXIA 4WBYA 4XQ8A 1ZQSA 8ICVA 3WFSC 5DB8A 1MQ2A 2BCQA 4NY8A 5J2IA 5J2GA 5J0WA 9ICCA 4DOAA 5HREA 4LZDA 3RJJA 4GXKA 4F5NA 5J2AA 9ICTA 3JPRA 1ZJNA 4AT8B 2BCSA 1ZQZA 5DB7A 4YMOA 1BPZA 2ZHBA 3MGIA 4RQ4A 9ICBA 4I27A 2BPCA 3HJ1A 2PXIA 5EOZA 3HX0A 3TFRA 5CWRA 2Q66A 2VANA 9ICXA 4AT8A 8ICQA
chains in the Genus database with same CATH superfamily
4DOBA 4GXJA 1NOMA 1TVAA 9ICMA 8ICBA 4WC3A 4UBBA 4E7XA 4TUSA 4R63A 1NO5A 4WBZA 4E8FA 4EEDA 4I29A 2DRAA 5D62A 4NKUA 5CHEA 7ICEA 4K98A 7ICTA 1ZQNA 8ICAA 3HJ4A 4RWOA 3NKUA 4KLDA 4KLUA 5IINA 3RJIA 4UAZA 9ICPA 4RWNA 1BPXA 4X4QA 4QZBA 3JPPA 3ISBA 4KLGA 2ZH4A 2BE3A 4WC2A 5B3PA 5IILA 4UAYA 2M2WA 4NXZA 8ICGA 4Z6CA 4M0AA 3NVOA 1RPLA 8ICYA 5J0OA 1XSNA 1R89A 4I2DA 5BPCA 7ICUA 3WFOA 5JTGA 3JYYA 4EEBA 5CJ7A 4TUQA 7ICJA 8ICRA 5HRHA 4UB4A 4KLOA 8ICWA 4PGYA 4QZ8A 5D4BA 1ZQJA 3MBYA 2BCVA 1OU5A 7ICQA 1ZQPA 3H38A 4JLXA 5DBBA 5CR0A 4O5CA 3HIYA 5DB6A 5D46A 3PMLA 4PHEA 5DBAA 4PGXA 3OV7A 4AT7B 1KNYA 5B3QA 5DDMA 1BPBA 4X0AA 4K9AA 1F5AA 4LEVA 1MQ3A 4RPZA 3OGUA 3JPQA 4AT7A 3H37A 1XSPA 4XA5A 4NXWA 5J2FA 5J0TA 2DR9A 4KLEA 4EV6A 1ZQGA 1V4AA 5HRBA 4I2FA 4I0UA 3RH6A 4S3NA 4YN4A 5D49A 5CHGA 4O5EA 4TURA 4EGWA 7ICNA 3AQMA 1ZQWA 4PHDA 5HHIA 3AQLA 4QZIA 4R65A 4K8VA 4R64A 4EP7A 3C2KA 4KLHA 4MF8A 5J2DA 3PMNA 4WQLA 2P66A 3C5FA 4EBJA 2M2UA 4DOCA 1MIWA 3RJHA 2PFOA 1ZQFA 5D63A 3JPSA 4LEYA 1UEVA 4XQ7A 5BOMA 4QZEA 5IIMA 4IQUA 4ATBB 1ZQVA 4WC4A 3UXNA 4PGQA 3V7JA 4YMNA 4K9BA 5CA7A 3EF2A 2ZH2A 4M47A 3K75D 4QZFA 2IHMA 4ATBA 5J2HA 2HHPA 2DR5A 1TFYA 4XJEA 1BPEA 1Q79A 4KLJA 4YD2A 9ICAA 4RT2A 4M5DA 4X5VA 3PNCA 4QZCA 4M2YA 9ICRA 8ICJA 5J0RA 4M9GA 9ICOA 2HN1A 4KLSA 8ICZA 8ICTA 4NXVA 2BPGA 2DR8A 4FH5A 4O5KA 2FMPA 4RT3A 8ICHA 5HRIA 4F5PA 4UD5A 4JWMA 4M9HA 4RPYA 4UB1A 4LT6A 8ICUA 4F5OA 4FHVA 4FHWA 5J0PA 4WC1A 1XSLA 8ICIA 4RQ6A 4WC5A 5J0SA 9ICJA 4YD1A 4WOYA 9ICVA 5J0UA 9ICNA 3ER8C 4O68A 8ICOA 4M9JA 7ICHA 2I9GA 3C5GA 5D61A 4MFAA 1ZQCA 4PH5A 3AU2A 2PBEA 4QZHA 2EWRA 2BCUA 7ICOA 9ICIA 1JQRA 5J2CA 4UBCA 4E80A 2ZH8A 8ICPA 3NWIA 4X4TA 3UXOA 5HR9A 1ZQOA 4WH5A 5J2KA 8ICMA 3JPOA 4NLKA 4X4SA 4KLTA 4RQ5A 3JPNA 3OUYB 2W9MA 4IQTA 4X4NA 4RQ3A 2BPFA 4NXXA 3MDCA 1KDHA 4NLNA 5IIOA 5J2EA 1HUOA 4FH3A 4I28A 4KLIA 4X4VA 4UD4A 5J0YA 3OUYA 4KLLA 2PFNA 5BOLA 3MGHA 2ISOA 4I2BA 4OAIZ 3TFSA 9ICSA 3RJKA 5DECA 4PPXA 4R66A 2FCLA 3AU6A 3V72A 5CP2A 2M2TA 4RQ2A 4K4IA 3WFRE 4FHYA 2DRBA 5DDYA 3H39A 4XUSA 3RH4A 3JCFA 4EBKA 2ISPA 1Q78A 8ICEA 1GPJA 1TV9A 1TFWA 4YCXA 1ZQIA 1BPDA 1RZTA 4F5RA 4JWNA 4UB3A 4I2HA 3HW8A 7ICLA 2ZHAA 4KB6A 1VFGA 4IG8A 1PX5A 3MCRA 8ICFA 4NM2A 3OWGA 3HWTA 7ICFA 8ICXA 3L9DA 3JZ0A 3GDXA 3C2LA 3RJGA 7ICSA 3H3AA 2PFQA 4MF2A 3B0YA 9ICLA 2B56A 1ZQAA 5J2BA 4LZGA 1VJ7A 2FMQA 4O69A 5DBCA 2B51A 4OAFA 5IIJA 1UETA 8ICLA 1YLQA 3LQCB 3AUOA 4O6AA 1HUZA 4O67A 5DKWA 4MFCA 4K4HA 4DO9A 1JAJA 4NXTA 3MDAA 1JN3A 5J0QA 2GAFD 4I2EA 4P4OA 3V7LA 3C66A 4N7RA 4QZDA 5CFTA 4QZAA 4UAWA 1R8BA 3NYBA 4K97A 5HRGA 1ZQLA 4M9LA 2B4VA 5HRKA 2PFPA 4F5QA 4FHPA 2ZH1A 5HRDA 4WC7A 4NXUA 4X0BA 2ZH7A 4X4OA 5DEDA 3ERCC 5IIKA 4LVSA 4FHXA 2M2VA 5DB9A 9ICFA 4X4UA 4WQKA 4FO6A 1ZQKA 4FO1A 5TZVA 3C18A 3AQNA 1ZQMA 1ZQBA 4I2CA 4RQ0A 2GWSA 4UB2A 3RH5A 4RWQA 4I2GA 7ICIA 5HRFA 4AT9B 5CFSA 4QZ9A 1JMSA 4KLMA 9ICWA 4RQ7A 3WFQE 4M04A 5HRLA 4P2HA 3LK9A 2HN2A 4PHAA 4Z6EA 4UB5A 3JPTA 7ICGA 4AT9A 3UPQA 5CB1A 4X4PA 4K99A 1ZQEA 4I2JA 5HC9A 2NRKA 1ZQUA 4OAGA 3B0XA 7ICRA 2ZH5A 3UQ2A 1ZQHA 1KEJA 4JLZA 1R8AA 5IIIA 4IQWA 3UXPA 2ZH6A 4LEZA 4I2AA 2ID1A 3UPSA 8ICKA 1WOTA 3OVBA 3ISDA 2DR7A 4MKPA 4PHPA 1BPYA 4MFFA 9ICGA 4RQ1A 4KLFA 1ZQTA 5F2VO 4HX0A 4LEWA 9ICEA 4IQVA 3PHZA 9ICQA 2RFFA 4QZGA 4M9NA 1UEUA 2ZH3A 4WC0A 1FA0A 2DVIA 4NM1A 7ICPA 4Z6DA 1ZQYA 2O5AA 2O1PA 7ICVA 4NKTA 2IUBA 4KLQA 5J2JA 4K4GA 7ICMA 4NLZA 1ZQDA 7ICKA 4RPXA 4TUPA 3ER9B 3CK6A 3V7KA 5HHHA 3OVSA 3RJFA 5J0XA 2GA9D 4WCWA 4K96A 4X4RA 3RJEA 2IHOA 3C2MA 4XRHA 8ICCA 4KM5A 3OVAA 4Z6FA 5CFUA 2ZH9A 1R8CA 4P4PA 1ZJMA 8ICSA 4RQ8A 5J29A 4WC6A 3AQKA 2FMSA 9ICUA 8ICNA 1MIVA 4O9MA 9ICKA 3UQ0A 9ICHA 1MIYA 1ZQRA 3WFPA 4I2IA 1ZQXA 4YMMA 3ISCA 4RWPA 1ZQQA 2BCRA 4P4MA 4OAHA 4GXIA 4WBYA 4XQ8A 1ZQSA 8ICVA 3WFSC 5DB8A 1MQ2A 2BCQA 4NY8A 5J2IA 2BBJA 5J2GA 5J0WA 9ICCA 4DOAA 3K7DA 5HREA 4LZDA 3RJJA 4GXKA 2BBHA 4F5NA 5J2AA 9ICTA 3JPRA 1ZJNA 4AT8B 2BCSA 1ZQZA 5DB7A 4YMOA 1BPZA 2ZHBA 3MGIA 4RQ4A 9ICBA 4I27A 2BPCA 3HJ1A 2PXIA 5EOZA 3HX0A 3TFRA 5CWRA 2Q66A 2VANA 9ICXA 4AT8A 8ICQA
chains in the Genus database with same CATH topology
4DOBA 4GXJA 1NOMA 1TVAA 9ICMA 8ICBA 4WC3A 4UBBA 4E7XA 4TUSA 4R63A 1NO5A 4WBZA 4E8FA 2DRAA 4I29A 4NKUA 7ICEA 7ICTA 1ZQNA 8ICAA 3HJ4A 4RWOA 4KLDA 4KLUA 5IINA 3RJIA 4UAZA 9ICPA 4RWNA 1BPXA 4X4QA 4QZBA 3JPPA 3ISBA 4KLGA 2ZH4A 2BE3A 4WC2A 5IILA 4UAYA 2M2WA 4NXZA 8ICGA 4Z6CA 4M0AA 1RPLA 8ICYA 5J0OA 1XSNA 1R89A 4I2DA 5BPCA 7ICUA 3WFOA 3JYYA 5CJ7A 4TUQA 7ICJA 8ICRA 5HRHA 4UB4A 4KLOA 8ICWA 4PGYA 4QZ8A 5D4BA 1ZQJA 3MBYA 2BCVA 1OU5A 7ICQA 1ZQPA 3H38A 5DBBA 5CR0A 4O5CA 3HIYA 5DB6A 5D46A 3PMLA 4PHEA 5DBAA 4PGXA 3OV7A 4AT7B 1KNYA 5DDMA 1BPBA 4X0AA 1F5AA 1MQ3A 4RPZA 3OGUA 3JPQA 4AT7A 3H37A 1XSPA 4XA5A 5J2FA 5J0TA 2DR9A 4KLEA 1ZQGA 1V4AA 5HRBA 4I2FA 3RH6A 4S3NA 4YN4A 5D49A 5CHGA 4O5EA 4TURA 7ICNA 3AQMA 1ZQWA 4PHDA 5HHIA 3AQLA 4QZIA 4R65A 4R64A 4EP7A 3C2KA 4KLHA 4MF8A 5J2DA 3PMNA 2P66A 3C5FA 4EBJA 2M2UA 4DOCA 1MIWA 3RJHA 2PFOA 1ZQFA 3JPSA 1UEVA 4XQ7A 5BOMA 4QZEA 5IIMA 4IQUA 4ATBB 1ZQVA 4WC4A 3UXNA 4PGQA 3V7JA 4YMNA 5CA7A 2ZH2A 4M47A 3K75D 4QZFA 2IHMA 4ATBA 5J2HA 2HHPA 2DR5A 1TFYA 1BPEA 1Q79A 4KLJA 4YD2A 9ICAA 4RT2A 4M5DA 4X5VA 3PNCA 4QZCA 4M2YA 9ICRA 8ICJA 5J0RA 4M9GA 9ICOA 4KLSA 8ICZA 8ICTA 2BPGA 2DR8A 4FH5A 4O5KA 2FMPA 4RT3A 8ICHA 5HRIA 4F5PA 4UD5A 4JWMA 4M9HA 4RPYA 4UB1A 4LT6A 8ICUA 4F5OA 4FHVA 4FHWA 5J0PA 4WC1A 1XSLA 8ICIA 4RQ6A 4WC5A 5J0SA 9ICJA 4YD1A 9ICVA 5J0UA 9ICNA 8ICOA 4M9JA 7ICHA 2I9GA 3C5GA 4MFAA 1ZQCA 4PH5A 3AU2A 2PBEA 4QZHA 2BCUA 7ICOA 9ICIA 1JQRA 5J2CA 4UBCA 4E80A 2ZH8A 8ICPA 4X4TA 3UXOA 5HR9A 1ZQOA 5J2KA 8ICMA 3JPOA 4NLKA 4X4SA 4KLTA 4RQ5A 3JPNA 3OUYB 2W9MA 4IQTA 4X4NA 4RQ3A 2BPFA 3MDCA 1KDHA 4NLNA 5IIOA 5J2EA 1HUOA 4FH3A 4I28A 4KLIA 4X4VA 4UD4A 5J0YA 3OUYA 4KLLA 2PFNA 5BOLA 3MGHA 2ISOA 4I2BA 3TFSA 9ICSA 3RJKA 5DECA 4PPXA 4R66A 3AU6A 3V72A 5CP2A 2M2TA 4RQ2A 4K4IA 3WFRE 4FHYA 2DRBA 5DDYA 3H39A 4XUSA 3RH4A 4EBKA 2ISPA 1Q78A 8ICEA 1TV9A 1TFWA 4YCXA 1ZQIA 1BPDA 1RZTA 4F5RA 4JWNA 4UB3A 4I2HA 3HW8A 7ICLA 2ZHAA 1VFGA 4IG8A 1PX5A 8ICFA 4NM2A 3HWTA 7ICFA 8ICXA 3L9DA 3JZ0A 3GDXA 3C2LA 3RJGA 7ICSA 3H3AA 2PFQA 4MF2A 3B0YA 9ICLA 1ZQAA 5J2BA 4LZGA 1VJ7A 2FMQA 5DBCA 5IIJA 1UETA 8ICLA 1YLQA 3LQCB 3AUOA 1HUZA 5DKWA 4MFCA 4K4HA 4DO9A 1JAJA 3MDAA 1JN3A 5J0QA 4I2EA 4P4OA 3V7LA 3C66A 4QZDA 4QZAA 4UAWA 1R8BA 3NYBA 5HRGA 1ZQLA 4M9LA 5HRKA 2PFPA 4F5QA 4FHPA 2ZH1A 5HRDA 4WC7A 4X0BA 2ZH7A 4X4OA 5DEDA 5IIKA 4LVSA 4FHXA 2M2VA 5DB9A 9ICFA 4X4UA 4FO6A 1ZQKA 5TZVA 3C18A 3AQNA 1ZQMA 1ZQBA 4I2CA 4RQ0A 2GWSA 4UB2A 3RH5A 4RWQA 4I2GA 7ICIA 5HRFA 4AT9B 4QZ9A 1JMSA 4KLMA 9ICWA 4RQ7A 3WFQE 4M04A 5HRLA 4P2HA 3LK9A 4PHAA 4Z6EA 4UB5A 3JPTA 7ICGA 4AT9A 3UPQA 5CB1A 4X4PA 1ZQEA 4I2JA 5HC9A 2NRKA 1ZQUA 3B0XA 7ICRA 2ZH5A 3UQ2A 1ZQHA 1KEJA 1R8AA 5IIIA 4IQWA 3UXPA 2ZH6A 4I2AA 2ID1A 3UPSA 8ICKA 1WOTA 3OVBA 3ISDA 2DR7A 4PHPA 1BPYA 4MFFA 9ICGA 4RQ1A 4KLFA 1ZQTA 5F2VO 9ICEA 4IQVA 9ICQA 2RFFA 4QZGA 4M9NA 1UEUA 2ZH3A 4WC0A 1FA0A 2DVIA 4NM1A 7ICPA 4Z6DA 1ZQYA 2O5AA 2O1PA 7ICVA 4NKTA 4KLQA 5J2JA 4K4GA 7ICMA 4NLZA 1ZQDA 7ICKA 4RPXA 4TUPA 3V7KA 5HHHA 3OVSA 3RJFA 5J0XA 4WCWA 4X4RA 3RJEA 3C2MA 4XRHA 8ICCA 3OVAA 4Z6FA 2ZH9A 1R8CA 4P4PA 1ZJMA 8ICSA 4RQ8A 5J29A 4WC6A 3AQKA 2FMSA 9ICUA 8ICNA 1MIVA 4O9MA 9ICKA 3UQ0A 9ICHA 1MIYA 1ZQRA 3WFPA 4I2IA 1ZQXA 4YMMA 3ISCA 4RWPA 1ZQQA 2BCRA 4P4MA 4GXIA 4WBYA 4XQ8A 1ZQSA 8ICVA 3WFSC 5DB8A 1MQ2A 2BCQA 4NY8A 5J2IA 5J2GA 5J0WA 9ICCA 4DOAA 5HREA 4LZDA 3RJJA 4GXKA 4F5NA 5J2AA 9ICTA 3JPRA 1ZJNA 4AT8B 2BCSA 1ZQZA 5DB7A 4YMOA 1BPZA 2ZHBA 3MGIA 4RQ4A 9ICBA 4I27A 2BPCA 3HJ1A 2PXIA 5EOZA 3HX0A 3TFRA 5CWRA 2Q66A 2VANA 9ICXA 4AT8A 8ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOB A;  4GXJ A;  1NOM A;  1TVA A;  9ICM A;  8ICB A;  4WC3 A;  4UBB A;  4E7X A;  4TUS A;  4R63 A;  1NO5 A;  4WBZ A;  4E8F A;  2DRA A;  4I29 A;  4NKU A;  7ICE A;  7ICT A;  1ZQN A;  8ICA A;  3HJ4 A;  4RWO A;  4KLD A;  4KLU A;  5IIN A;  3RJI A;  4UAZ A;  9ICP A;  4RWN A;  1BPX A;  4X4Q A;  4QZB A;  3JPP A;  3ISB A;  4KLG A;  2ZH4 A;  2BE3 A;  4WC2 A;  5IIL A;  4UAY A;  2M2W A;  4NXZ A;  8ICG A;  4Z6C A;  4M0A A;  1RPL A;  8ICY A;  5J0O A;  1XSN A;  1R89 A;  4I2D A;  5BPC A;  7ICU A;  3WFO A;  3JYY A;  5CJ7 A;  4TUQ A;  7ICJ A;  8ICR A;  5HRH A;  4UB4 A;  4KLO A;  8ICW A;  4PGY A;  4QZ8 A;  5D4B A;  1ZQJ A;  3MBY A;  2BCV A;  1OU5 A;  7ICQ A;  1ZQP A;  3H38 A;  5DBB A;  5CR0 A;  4O5C A;  3HIY A;  5DB6 A;  5D46 A;  3PML A;  4PHE A;  5DBA A;  4PGX A;  3OV7 A;  4AT7 B;  1KNY A;  5DDM A;  1BPB A;  4X0A A;  1F5A A;  1MQ3 A;  4RPZ A;  3OGU A;  3JPQ A;  4AT7 A;  3H37 A;  1XSP A;  4XA5 A;  5J2F A;  5J0T A;  2DR9 A;  4KLE A;  1ZQG A;  1V4A A;  5HRB A;  4I2F A;  3RH6 A;  4S3N A;  4YN4 A;  5D49 A;  5CHG A;  4O5E A;  4TUR A;  7ICN A;  3AQM A;  1ZQW A;  4PHD A;  5HHI A;  3AQL A;  4QZI A;  4R65 A;  4R64 A;  4EP7 A;  3C2K A;  4KLH A;  4MF8 A;  5J2D A;  3PMN A;  2P66 A;  3C5F A;  4EBJ A;  2M2U A;  4DOC A;  1MIW A;  3RJH A;  2PFO A;  1ZQF A;  3JPS A;  1UEV A;  4XQ7 A;  5BOM A;  4QZE A;  5IIM A;  4IQU A;  4ATB B;  1ZQV A;  4WC4 A;  3UXN A;  4PGQ A;  3V7J A;  4YMN A;  5CA7 A;  2ZH2 A;  4M47 A;  3K75 D;  4QZF A;  2IHM A;  4ATB A;  5J2H A;  2HHP A;  2DR5 A;  1TFY A;  1BPE A;  1Q79 A;  4KLJ A;  4YD2 A;  9ICA A;  4RT2 A;  4M5D A;  4X5V A;  3PNC A;  4QZC A;  4M2Y A;  9ICR A;  8ICJ A;  5J0R A;  4M9G A;  9ICO A;  4KLS A;  8ICZ A;  8ICT A;  2BPG A;  2DR8 A;  4FH5 A;  4O5K A;  2FMP A;  4RT3 A;  8ICH A;  5HRI A;  4F5P A;  4UD5 A;  4JWM A;  4M9H A;  4RPY A;  4UB1 A;  4LT6 A;  8ICU A;  4F5O A;  4FHV A;  4FHW A;  5J0P A;  4WC1 A;  1XSL A;  8ICI A;  4RQ6 A;  4WC5 A;  5J0S A;  9ICJ A;  4YD1 A;  9ICV A;  5J0U A;  9ICN A;  8ICO A;  4M9J A;  7ICH A;  2I9G A;  3C5G A;  4MFA A;  1ZQC A;  4PH5 A;  3AU2 A;  2PBE A;  4QZH A;  2BCU A;  7ICO A;  9ICI A;  1JQR A;  5J2C A;  4UBC A;  4E80 A;  2ZH8 A;  8ICP A;  4X4T A;  3UXO A;  5HR9 A;  1ZQO A;  5J2K A;  8ICM A;  3JPO A;  4NLK A;  4X4S A;  4KLT A;  4RQ5 A;  3JPN A;  3OUY B;  2W9M A;  4IQT A;  4X4N A;  4RQ3 A;  2BPF A;  3MDC A;  1KDH A;  4NLN A;  5IIO A;  5J2E A;  1HUO A;  4FH3 A;  4I28 A;  4KLI A;  4X4V A;  4UD4 A;  5J0Y A;  3OUY A;  4KLL A;  2PFN A;  5BOL A;  3MGH A;  2ISO A;  4I2B A;  3TFS A;  9ICS A;  3RJK A;  5DEC A;  4PPX A;  4R66 A;  3AU6 A;  3V72 A;  5CP2 A;  2M2T A;  4RQ2 A;  4K4I A;  3WFR E;  4FHY A;  2DRB A;  5DDY A;  3H39 A;  4XUS A;  3RH4 A;  4EBK A;  2ISP A;  1Q78 A;  8ICE A;  1TV9 A;  1TFW A;  4YCX A;  1ZQI A;  1BPD A;  1RZT A;  4F5R A;  4JWN A;  4UB3 A;  4I2H A;  3HW8 A;  7ICL A;  2ZHA A;  1VFG A;  4IG8 A;  1PX5 A;  8ICF A;  4NM2 A;  3HWT A;  7ICF A;  8ICX A;  3L9D A;  3JZ0 A;  3GDX A;  3C2L A;  3RJG A;  7ICS A;  3H3A A;  2PFQ A;  4MF2 A;  3B0Y A;  9ICL A;  1ZQA A;  5J2B A;  4LZG A;  1VJ7 A;  2FMQ A;  5DBC A;  5IIJ A;  1UET A;  8ICL A;  1YLQ A;  3LQC B;  3AUO A;  1HUZ A;  5DKW A;  4MFC A;  4K4H A;  4DO9 A;  1JAJ A;  3MDA A;  1JN3 A;  5J0Q A;  4I2E A;  4P4O A;  3V7L A;  3C66 A;  4QZD A;  4QZA A;  4UAW A;  1R8B A;  3NYB A;  5HRG A;  1ZQL A;  4M9L A;  5HRK A;  2PFP A;  4F5Q A;  4FHP A;  2ZH1 A;  5HRD A;  4WC7 A;  4X0B A;  2ZH7 A;  4X4O A;  5DED A;  5IIK A;  4LVS A;  4FHX A;  2M2V A;  5DB9 A;  9ICF A;  4X4U A;  4FO6 A;  1ZQK A;  5TZV A;  3C18 A;  3AQN A;  1ZQM A;  1ZQB A;  4I2C A;  4RQ0 A;  2GWS A;  4UB2 A;  3RH5 A;  4RWQ A;  4I2G A;  7ICI A;  5HRF A;  4AT9 B;  4QZ9 A;  1JMS A;  4KLM A;  9ICW A;  4RQ7 A;  3WFQ E;  4M04 A;  5HRL A;  4P2H A;  3LK9 A;  4PHA A;  4Z6E A;  4UB5 A;  3JPT A;  7ICG A;  4AT9 A;  3UPQ A;  5CB1 A;  4X4P A;  1ZQE A;  4I2J A;  5HC9 A;  2NRK A;  1ZQU A;  3B0X A;  7ICR A;  2ZH5 A;  3UQ2 A;  1ZQH A;  1KEJ A;  1R8A A;  5III A;  4IQW A;  3UXP A;  2ZH6 A;  4I2A A;  2ID1 A;  3UPS A;  8ICK A;  1WOT A;  3OVB A;  3ISD A;  2DR7 A;  4PHP A;  1BPY A;  4MFF A;  9ICG A;  4RQ1 A;  4KLF A;  1ZQT A;  5F2V O;  9ICE A;  4IQV A;  9ICQ A;  2RFF A;  4QZG A;  4M9N A;  1UEU A;  2ZH3 A;  4WC0 A;  1FA0 A;  2DVI A;  4NM1 A;  7ICP A;  4Z6D A;  1ZQY A;  2O5A A;  2O1P A;  7ICV A;  4NKT A;  4KLQ A;  5J2J A;  4K4G A;  7ICM A;  4NLZ A;  1ZQD A;  7ICK A;  4RPX A;  4TUP A;  3V7K A;  5HHH A;  3OVS A;  3RJF A;  5J0X A;  4WCW A;  4X4R A;  3RJE A;  3C2M A;  4XRH A;  8ICC A;  3OVA A;  4Z6F A;  2ZH9 A;  1R8C A;  4P4P A;  1ZJM A;  8ICS A;  4RQ8 A;  5J29 A;  4WC6 A;  3AQK A;  2FMS A;  9ICU A;  8ICN A;  1MIV A;  4O9M A;  9ICK A;  3UQ0 A;  9ICH A;  1MIY A;  1ZQR A;  3WFP A;  4I2I A;  1ZQX A;  4YMM A;  3ISC A;  4RWP A;  1ZQQ A;  2BCR A;  4P4M A;  4GXI A;  4WBY A;  4XQ8 A;  1ZQS A;  8ICV A;  3WFS C;  5DB8 A;  1MQ2 A;  2BCQ A;  4NY8 A;  5J2I A;  5J2G A;  5J0W A;  9ICC A;  4DOA A;  5HRE A;  4LZD A;  3RJJ A;  4GXK A;  4F5N A;  5J2A A;  9ICT A;  3JPR A;  1ZJN A;  4AT8 B;  2BCS A;  1ZQZ A;  5DB7 A;  4YMO A;  1BPZ A;  2ZHB A;  3MGI A;  4RQ4 A;  9ICB A;  4I27 A;  2BPC A;  3HJ1 A;  2PXI A;  5EOZ A;  3HX0 A;  3TFR A;  5CWR A;  2Q66 A;  2VAN A;  9ICX A;  4AT8 A;  8ICQ A; 
#chains in the Genus database with same CATH topology
 4DOB A;  4GXJ A;  1NOM A;  1TVA A;  9ICM A;  8ICB A;  4WC3 A;  4UBB A;  4E7X A;  4TUS A;  4R63 A;  1NO5 A;  4WBZ A;  4E8F A;  4EED A;  4I29 A;  2DRA A;  5D62 A;  4NKU A;  5CHE A;  7ICE A;  4K98 A;  7ICT A;  1ZQN A;  8ICA A;  3HJ4 A;  4RWO A;  3NKU A;  4KLD A;  4KLU A;  5IIN A;  3RJI A;  4UAZ A;  9ICP A;  4RWN A;  1BPX A;  4X4Q A;  4QZB A;  3JPP A;  3ISB A;  4KLG A;  2ZH4 A;  2BE3 A;  4WC2 A;  5B3P A;  5IIL A;  4UAY A;  2M2W A;  4NXZ A;  8ICG A;  4Z6C A;  4M0A A;  3NVO A;  1RPL A;  8ICY A;  5J0O A;  1XSN A;  1R89 A;  4I2D A;  5BPC A;  7ICU A;  3WFO A;  5JTG A;  3JYY A;  4EEB A;  5CJ7 A;  4TUQ A;  7ICJ A;  8ICR A;  5HRH A;  4UB4 A;  4KLO A;  8ICW A;  4PGY A;  4QZ8 A;  5D4B A;  1ZQJ A;  3MBY A;  2BCV A;  1OU5 A;  7ICQ A;  1ZQP A;  3H38 A;  4JLX A;  5DBB A;  5CR0 A;  4O5C A;  3HIY A;  5DB6 A;  5D46 A;  3PML A;  4PHE A;  5DBA A;  4PGX A;  3OV7 A;  4AT7 B;  1KNY A;  5B3Q A;  5DDM A;  1BPB A;  4X0A A;  4K9A A;  1F5A A;  4LEV A;  1MQ3 A;  4RPZ A;  3OGU A;  3JPQ A;  4AT7 A;  3H37 A;  1XSP A;  4XA5 A;  4NXW A;  5J2F A;  5J0T A;  2DR9 A;  4KLE A;  4EV6 A;  1ZQG A;  1V4A A;  5HRB A;  4I2F A;  4I0U A;  3RH6 A;  4S3N A;  4YN4 A;  5D49 A;  5CHG A;  4O5E A;  4TUR A;  4EGW A;  7ICN A;  3AQM A;  1ZQW A;  4PHD A;  5HHI A;  3AQL A;  4QZI A;  4R65 A;  4K8V A;  4R64 A;  4EP7 A;  3C2K A;  4KLH A;  4MF8 A;  5J2D A;  3PMN A;  4WQL A;  2P66 A;  3C5F A;  4EBJ A;  2M2U A;  4DOC A;  1MIW A;  3RJH A;  2PFO A;  1ZQF A;  5D63 A;  3JPS A;  4LEY A;  1UEV A;  4XQ7 A;  5BOM A;  4QZE A;  5IIM A;  4IQU A;  4ATB B;  1ZQV A;  4WC4 A;  3UXN A;  4PGQ A;  3V7J A;  4YMN A;  4K9B A;  5CA7 A;  3EF2 A;  2ZH2 A;  4M47 A;  3K75 D;  4QZF A;  2IHM A;  4ATB A;  5J2H A;  2HHP A;  2DR5 A;  1TFY A;  4XJE A;  1BPE A;  1Q79 A;  4KLJ A;  4YD2 A;  9ICA A;  4RT2 A;  4M5D A;  4X5V A;  3PNC A;  4QZC A;  4M2Y A;  9ICR A;  8ICJ A;  5J0R A;  4M9G A;  9ICO A;  2HN1 A;  4KLS A;  8ICZ A;  8ICT A;  4NXV A;  2BPG A;  2DR8 A;  4FH5 A;  4O5K A;  2FMP A;  4RT3 A;  8ICH A;  5HRI A;  4F5P A;  4UD5 A;  4JWM A;  4M9H A;  4RPY A;  4UB1 A;  4LT6 A;  8ICU A;  4F5O A;  4FHV A;  4FHW A;  5J0P A;  4WC1 A;  1XSL A;  8ICI A;  4RQ6 A;  4WC5 A;  5J0S A;  9ICJ A;  4YD1 A;  4WOY A;  9ICV A;  5J0U A;  9ICN A;  3ER8 C;  4O68 A;  8ICO A;  4M9J A;  7ICH A;  2I9G A;  3C5G A;  5D61 A;  4MFA A;  1ZQC A;  4PH5 A;  3AU2 A;  2PBE A;  4QZH A;  2EWR A;  2BCU A;  7ICO A;  9ICI A;  1JQR A;  5J2C A;  4UBC A;  4E80 A;  2ZH8 A;  8ICP A;  3NWI A;  4X4T A;  3UXO A;  5HR9 A;  1ZQO A;  4WH5 A;  5J2K A;  8ICM A;  3JPO A;  4NLK A;  4X4S A;  4KLT A;  4RQ5 A;  3JPN A;  3OUY B;  2W9M A;  4IQT A;  4X4N A;  4RQ3 A;  2BPF A;  4NXX A;  3MDC A;  1KDH A;  4NLN A;  5IIO A;  5J2E A;  1HUO A;  4FH3 A;  4I28 A;  4KLI A;  4X4V A;  4UD4 A;  5J0Y A;  3OUY A;  4KLL A;  2PFN A;  5BOL A;  3MGH A;  2ISO A;  4I2B A;  4OAI Z;  3TFS A;  9ICS A;  3RJK A;  5DEC A;  4PPX A;  4R66 A;  2FCL A;  3AU6 A;  3V72 A;  5CP2 A;  2M2T A;  4RQ2 A;  4K4I A;  3WFR E;  4FHY A;  2DRB A;  5DDY A;  3H39 A;  4XUS A;  3RH4 A;  3JCF A;  4EBK A;  2ISP A;  1Q78 A;  8ICE A;  1GPJ A;  1TV9 A;  1TFW A;  4YCX A;  1ZQI A;  1BPD A;  1RZT A;  4F5R A;  4JWN A;  4UB3 A;  4I2H A;  3HW8 A;  7ICL A;  2ZHA A;  4KB6 A;  1VFG A;  4IG8 A;  1PX5 A;  3MCR A;  8ICF A;  4NM2 A;  3OWG A;  3HWT A;  7ICF A;  8ICX A;  3L9D A;  3JZ0 A;  3GDX A;  3C2L A;  3RJG A;  7ICS A;  3H3A A;  2PFQ A;  4MF2 A;  3B0Y A;  9ICL A;  2B56 A;  1ZQA A;  5J2B A;  4LZG A;  1VJ7 A;  2FMQ A;  4O69 A;  5DBC A;  2B51 A;  4OAF A;  5IIJ A;  1UET A;  8ICL A;  1YLQ A;  3LQC B;  3AUO A;  4O6A A;  1HUZ A;  4O67 A;  5DKW A;  4MFC A;  4K4H A;  4DO9 A;  1JAJ A;  4NXT A;  3MDA A;  1JN3 A;  5J0Q A;  2GAF D;  4I2E A;  4P4O A;  3V7L A;  3C66 A;  4N7R A;  4QZD A;  5CFT A;  4QZA A;  4UAW A;  1R8B A;  3NYB A;  4K97 A;  5HRG A;  1ZQL A;  4M9L A;  2B4V A;  5HRK A;  2PFP A;  4F5Q A;  4FHP A;  2ZH1 A;  5HRD A;  4WC7 A;  4NXU A;  4X0B A;  2ZH7 A;  4X4O A;  5DED A;  3ERC C;  5IIK A;  4LVS A;  4FHX A;  2M2V A;  5DB9 A;  9ICF A;  4X4U A;  4WQK A;  4FO6 A;  1ZQK A;  4FO1 A;  5TZV A;  3C18 A;  3AQN A;  1ZQM A;  1ZQB A;  4I2C A;  4RQ0 A;  2GWS A;  4UB2 A;  3RH5 A;  4RWQ A;  4I2G A;  7ICI A;  5HRF A;  4AT9 B;  5CFS A;  4QZ9 A;  1JMS A;  4KLM A;  9ICW A;  4RQ7 A;  3WFQ E;  4M04 A;  5HRL A;  4P2H A;  3LK9 A;  2HN2 A;  4PHA A;  4Z6E A;  4UB5 A;  3JPT A;  7ICG A;  4AT9 A;  3UPQ A;  5CB1 A;  4X4P A;  4K99 A;  1ZQE A;  4I2J A;  5HC9 A;  2NRK A;  1ZQU A;  4OAG A;  3B0X A;  7ICR A;  2ZH5 A;  3UQ2 A;  1ZQH A;  1KEJ A;  4JLZ A;  1R8A A;  5III A;  4IQW A;  3UXP A;  2ZH6 A;  4LEZ A;  4I2A A;  2ID1 A;  3UPS A;  8ICK A;  1WOT A;  3OVB A;  3ISD A;  2DR7 A;  4MKP A;  4PHP A;  1BPY A;  4MFF A;  9ICG A;  4RQ1 A;  4KLF A;  1ZQT A;  5F2V O;  4HX0 A;  4LEW A;  9ICE A;  4IQV A;  3PHZ A;  9ICQ A;  2RFF A;  4QZG A;  4M9N A;  1UEU A;  2ZH3 A;  4WC0 A;  1FA0 A;  2DVI A;  4NM1 A;  7ICP A;  4Z6D A;  1ZQY A;  2O5A A;  2O1P A;  7ICV A;  4NKT A;  2IUB A;  4KLQ A;  5J2J A;  4K4G A;  7ICM A;  4NLZ A;  1ZQD A;  7ICK A;  4RPX A;  4TUP A;  3ER9 B;  3CK6 A;  3V7K A;  5HHH A;  3OVS A;  3RJF A;  5J0X A;  2GA9 D;  4WCW A;  4K96 A;  4X4R A;  3RJE A;  2IHO A;  3C2M A;  4XRH A;  8ICC A;  4KM5 A;  3OVA A;  4Z6F A;  5CFU A;  2ZH9 A;  1R8C A;  4P4P A;  1ZJM A;  8ICS A;  4RQ8 A;  5J29 A;  4WC6 A;  3AQK A;  2FMS A;  9ICU A;  8ICN A;  1MIV A;  4O9M A;  9ICK A;  3UQ0 A;  9ICH A;  1MIY A;  1ZQR A;  3WFP A;  4I2I A;  1ZQX A;  4YMM A;  3ISC A;  4RWP A;  1ZQQ A;  2BCR A;  4P4M A;  4OAH A;  4GXI A;  4WBY A;  4XQ8 A;  1ZQS A;  8ICV A;  3WFS C;  5DB8 A;  1MQ2 A;  2BCQ A;  4NY8 A;  5J2I A;  2BBJ A;  5J2G A;  5J0W A;  9ICC A;  4DOA A;  3K7D A;  5HRE A;  4LZD A;  3RJJ A;  4GXK A;  2BBH A;  4F5N A;  5J2A A;  9ICT A;  3JPR A;  1ZJN A;  4AT8 B;  2BCS A;  1ZQZ A;  5DB7 A;  4YMO A;  1BPZ A;  2ZHB A;  3MGI A;  4RQ4 A;  9ICB A;  4I27 A;  2BPC A;  3HJ1 A;  2PXI A;  5EOZ A;  3HX0 A;  3TFR A;  5CWR A;  2Q66 A;  2VAN A;  9ICX A;  4AT8 A;  8ICQ A; 
#chains in the Genus database with same CATH homology
 4DOB A;  4GXJ A;  1NOM A;  1TVA A;  9ICM A;  8ICB A;  4WC3 A;  4UBB A;  4E7X A;  4TUS A;  4R63 A;  1NO5 A;  4WBZ A;  4E8F A;  2DRA A;  4I29 A;  4NKU A;  7ICE A;  7ICT A;  1ZQN A;  8ICA A;  3HJ4 A;  4RWO A;  4KLD A;  4KLU A;  5IIN A;  3RJI A;  4UAZ A;  9ICP A;  4RWN A;  1BPX A;  4X4Q A;  4QZB A;  3JPP A;  3ISB A;  4KLG A;  2ZH4 A;  2BE3 A;  4WC2 A;  5IIL A;  4UAY A;  2M2W A;  4NXZ A;  8ICG A;  4Z6C A;  4M0A A;  1RPL A;  8ICY A;  5J0O A;  1XSN A;  1R89 A;  4I2D A;  5BPC A;  7ICU A;  3WFO A;  3JYY A;  5CJ7 A;  4TUQ A;  7ICJ A;  8ICR A;  5HRH A;  4UB4 A;  4KLO A;  8ICW A;  4PGY A;  4QZ8 A;  5D4B A;  1ZQJ A;  3MBY A;  2BCV A;  1OU5 A;  7ICQ A;  1ZQP A;  3H38 A;  5DBB A;  5CR0 A;  4O5C A;  3HIY A;  5DB6 A;  5D46 A;  3PML A;  4PHE A;  5DBA A;  4PGX A;  3OV7 A;  4AT7 B;  1KNY A;  5DDM A;  1BPB A;  4X0A A;  1F5A A;  1MQ3 A;  4RPZ A;  3OGU A;  3JPQ A;  4AT7 A;  3H37 A;  1XSP A;  4XA5 A;  5J2F A;  5J0T A;  2DR9 A;  4KLE A;  1ZQG A;  1V4A A;  5HRB A;  4I2F A;  3RH6 A;  4S3N A;  4YN4 A;  5D49 A;  5CHG A;  4O5E A;  4TUR A;  7ICN A;  3AQM A;  1ZQW A;  4PHD A;  5HHI A;  3AQL A;  4QZI A;  4R65 A;  4R64 A;  4EP7 A;  3C2K A;  4KLH A;  4MF8 A;  5J2D A;  3PMN A;  2P66 A;  3C5F A;  4EBJ A;  2M2U A;  4DOC A;  1MIW A;  3RJH A;  2PFO A;  1ZQF A;  3JPS A;  1UEV A;  4XQ7 A;  5BOM A;  4QZE A;  5IIM A;  4IQU A;  4ATB B;  1ZQV A;  4WC4 A;  3UXN A;  4PGQ A;  3V7J A;  4YMN A;  5CA7 A;  2ZH2 A;  4M47 A;  3K75 D;  4QZF A;  2IHM A;  4ATB A;  5J2H A;  2HHP A;  2DR5 A;  1TFY A;  1BPE A;  1Q79 A;  4KLJ A;  4YD2 A;  9ICA A;  4RT2 A;  4M5D A;  4X5V A;  3PNC A;  4QZC A;  4M2Y A;  9ICR A;  8ICJ A;  5J0R A;  4M9G A;  9ICO A;  4KLS A;  8ICZ A;  8ICT A;  2BPG A;  2DR8 A;  4FH5 A;  4O5K A;  2FMP A;  4RT3 A;  8ICH A;  5HRI A;  4F5P A;  4UD5 A;  4JWM A;  4M9H A;  4RPY A;  4UB1 A;  4LT6 A;  8ICU A;  4F5O A;  4FHV A;  4FHW A;  5J0P A;  4WC1 A;  1XSL A;  8ICI A;  4RQ6 A;  4WC5 A;  5J0S A;  9ICJ A;  4YD1 A;  9ICV A;  5J0U A;  9ICN A;  8ICO A;  4M9J A;  7ICH A;  2I9G A;  3C5G A;  4MFA A;  1ZQC A;  4PH5 A;  3AU2 A;  2PBE A;  4QZH A;  2BCU A;  7ICO A;  9ICI A;  1JQR A;  5J2C A;  4UBC A;  4E80 A;  2ZH8 A;  8ICP A;  4X4T A;  3UXO A;  5HR9 A;  1ZQO A;  5J2K A;  8ICM A;  3JPO A;  4NLK A;  4X4S A;  4KLT A;  4RQ5 A;  3JPN A;  3OUY B;  2W9M A;  4IQT A;  4X4N A;  4RQ3 A;  2BPF A;  3MDC A;  1KDH A;  4NLN A;  5IIO A;  5J2E A;  1HUO A;  4FH3 A;  4I28 A;  4KLI A;  4X4V A;  4UD4 A;  5J0Y A;  3OUY A;  4KLL A;  2PFN A;  5BOL A;  3MGH A;  2ISO A;  4I2B A;  3TFS A;  9ICS A;  3RJK A;  5DEC A;  4PPX A;  4R66 A;  3AU6 A;  3V72 A;  5CP2 A;  2M2T A;  4RQ2 A;  4K4I A;  3WFR E;  4FHY A;  2DRB A;  5DDY A;  3H39 A;  4XUS A;  3RH4 A;  4EBK A;  2ISP A;  1Q78 A;  8ICE A;  1TV9 A;  1TFW A;  4YCX A;  1ZQI A;  1BPD A;  1RZT A;  4F5R A;  4JWN A;  4UB3 A;  4I2H A;  3HW8 A;  7ICL A;  2ZHA A;  1VFG A;  4IG8 A;  1PX5 A;  8ICF A;  4NM2 A;  3HWT A;  7ICF A;  8ICX A;  3L9D A;  3JZ0 A;  3GDX A;  3C2L A;  3RJG A;  7ICS A;  3H3A A;  2PFQ A;  4MF2 A;  3B0Y A;  9ICL A;  1ZQA A;  5J2B A;  4LZG A;  1VJ7 A;  2FMQ A;  5DBC A;  5IIJ A;  1UET A;  8ICL A;  1YLQ A;  3LQC B;  3AUO A;  1HUZ A;  5DKW A;  4MFC A;  4K4H A;  4DO9 A;  1JAJ A;  3MDA A;  1JN3 A;  5J0Q A;  4I2E A;  4P4O A;  3V7L A;  3C66 A;  4QZD A;  4QZA A;  4UAW A;  1R8B A;  3NYB A;  5HRG A;  1ZQL A;  4M9L A;  5HRK A;  2PFP A;  4F5Q A;  4FHP A;  2ZH1 A;  5HRD A;  4WC7 A;  4X0B A;  2ZH7 A;  4X4O A;  5DED A;  5IIK A;  4LVS A;  4FHX A;  2M2V A;  5DB9 A;  9ICF A;  4X4U A;  4FO6 A;  1ZQK A;  5TZV A;  3C18 A;  3AQN A;  1ZQM A;  1ZQB A;  4I2C A;  4RQ0 A;  2GWS A;  4UB2 A;  3RH5 A;  4RWQ A;  4I2G A;  7ICI A;  5HRF A;  4AT9 B;  4QZ9 A;  1JMS A;  4KLM A;  9ICW A;  4RQ7 A;  3WFQ E;  4M04 A;  5HRL A;  4P2H A;  3LK9 A;  4PHA A;  4Z6E A;  4UB5 A;  3JPT A;  7ICG A;  4AT9 A;  3UPQ A;  5CB1 A;  4X4P A;  1ZQE A;  4I2J A;  5HC9 A;  2NRK A;  1ZQU A;  3B0X A;  7ICR A;  2ZH5 A;  3UQ2 A;  1ZQH A;  1KEJ A;  1R8A A;  5III A;  4IQW A;  3UXP A;  2ZH6 A;  4I2A A;  2ID1 A;  3UPS A;  8ICK A;  1WOT A;  3OVB A;  3ISD A;  2DR7 A;  4PHP A;  1BPY A;  4MFF A;  9ICG A;  4RQ1 A;  4KLF A;  1ZQT A;  5F2V O;  9ICE A;  4IQV A;  9ICQ A;  2RFF A;  4QZG A;  4M9N A;  1UEU A;  2ZH3 A;  4WC0 A;  1FA0 A;  2DVI A;  4NM1 A;  7ICP A;  4Z6D A;  1ZQY A;  2O5A A;  2O1P A;  7ICV A;  4NKT A;  4KLQ A;  5J2J A;  4K4G A;  7ICM A;  4NLZ A;  1ZQD A;  7ICK A;  4RPX A;  4TUP A;  3V7K A;  5HHH A;  3OVS A;  3RJF A;  5J0X A;  4WCW A;  4X4R A;  3RJE A;  3C2M A;  4XRH A;  8ICC A;  3OVA A;  4Z6F A;  2ZH9 A;  1R8C A;  4P4P A;  1ZJM A;  8ICS A;  4RQ8 A;  5J29 A;  4WC6 A;  3AQK A;  2FMS A;  9ICU A;  8ICN A;  1MIV A;  4O9M A;  9ICK A;  3UQ0 A;  9ICH A;  1MIY A;  1ZQR A;  3WFP A;  4I2I A;  1ZQX A;  4YMM A;  3ISC A;  4RWP A;  1ZQQ A;  2BCR A;  4P4M A;  4GXI A;  4WBY A;  4XQ8 A;  1ZQS A;  8ICV A;  3WFS C;  5DB8 A;  1MQ2 A;  2BCQ A;  4NY8 A;  5J2I A;  5J2G A;  5J0W A;  9ICC A;  4DOA A;  5HRE A;  4LZD A;  3RJJ A;  4GXK A;  4F5N A;  5J2A A;  9ICT A;  3JPR A;  1ZJN A;  4AT8 B;  2BCS A;  1ZQZ A;  5DB7 A;  4YMO A;  1BPZ A;  2ZHB A;  3MGI A;  4RQ4 A;  9ICB A;  4I27 A;  2BPC A;  3HJ1 A;  2PXI A;  5EOZ A;  3HX0 A;  3TFR A;  5CWR A;  2Q66 A;  2VAN A;  9ICX A;  4AT8 A;  8ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...