4IG8A

Structural basis for cytosolic double-stranded rna surveillance by human oas1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
344
structure length
338
Chain Sequence
DLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-5'-oligoadenylate synthase 1
publication title Structural basis for cytosolic double-stranded RNA surveillance by human oligoadenylate synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 107
structure length 338
sequence length 344
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4ig8A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ig8A01
4EBJA 3GDXA 5HRBA 4WCWA 3UXNA 4UB5A 1ZQUA 8ICXA 9ICNA 2BPCA 4UB1A 2ZH8A 4WC5A 4NLKA 4AT7B 1ZJNA 4FHWA 3B0YA 1ZQLA 9ICVA 2BCQA 5CJ7A 4FHVA 3JPOA 1ZQDA 4M9NA 1KDHA 3MDAA 4KLLA 1BPBA 5J29A 8ICNA 9ICAA 1VJ7A 5J2FA 4R63A 3PNCA 9ICQA 4I2CA 3C5GA 4XUSA 4IQVA 9ICUA 2ZH6A 1TV9A 4P4PA 5IIIA 3H39A 4UB4A 4UAZA 3OVAA 7ICEA 4TURA 1ZJMA 5HRKA 4QZ8A 8ICIA 4MF8A 4PGQA 3MGIA 4I2HA 4PPXA 4LT6A 1HUOA 5IIJA 7ICHA 1XSPA 4I2DA 4UBBA 4EP7A 4F5NA 5J2DA 7ICPA 2BE3A 4F5PA 4DOBA 4RWNA 2FMPA 4YMMA 4QZAA 3MBYA 2FMQA 4KLUA 4TUPA 2M2TA 5J0WA 2BCSA 7ICNA 3PMNA 5IIMA 2BCUA 7ICQA 1TVAA 3UXOA 4LZDA 4QZ9A 4DOAA 1ZQFA 5BOMA 4QZHA 4O5EA 8ICHA 7ICSA 1TFWA 2DRAA 5DBAA 4WC3A 9ICTA 1ZQTA 7ICLA 2I9GA 4KLDA 8ICOA 5DB9A 5IINA 2ID1A 2DR5A 4IQTA 1ZQNA 4UD5A 8ICUA 3OGUA 3JPTA 9ICHA 5HHHA 1ZQCA 4M47A 1PX5A 3OVBA 2PBEA 4PHEA 3ISCA 5HC9A 4PHAA 4QZFA 5IIOA 3OUYB 4F5RA 1ZQPA 5J0UA 5HRFA 4I2IA 1VFGA 4QZDA 5DECA 4RWQA 5CHGA 1MIWA 3JZ0A 1MQ3A 4XRHA 5BPCA 4RQ5A 2RFFA 4RQ6A 8ICEA 2P66A 3WFSC 4M0AA 9ICEA 1KEJA 9ICJA 4Z6DA 7ICJA 2ZH9A 2ZH5A 3AQMA 4K4IA 4KLFA 1KNYA 3PMLA 3C2LA 4YN4A 3AU6A 8ICZA 3UQ0A 5HRLA 3RJHA 4KLQA 8ICYA 3RJJA 1UEVA 4I2AA 3RJIA 3TFRA 1JMSA 1OU5A 3RJFA 4I29A 1R8AA 1JN3A 4RT3A 2PFPA 3MGHA 5DDYA 5EOZA 1R8BA 1XSNA 9ICFA 4NXZA 4P4OA 4RWPA 5HREA 4RT2A 4MFFA 2M2VA 4R65A 1ZQHA 4FO6A 4M9HA 2DR9A 4KLMA 5BOLA 2M2UA 4TUQA 8ICMA 2PFNA 4NM1A 2ZH2A 1BPDA 4R64A 8ICRA 2BCRA 4F5OA 5J2HA 4AT8B 2BPGA 8ICSA 4WBZA 1NOMA 3ISBA 4E7XA 3WFQE 4MFCA 9ICSA 3AQNA 5D46A 2ZH4A 4UD4A 2PFQA 2DR7A 4RQ4A 2W9MA 4K4GA 2VANA 4RQ1A 7ICMA 4UAYA 8ICWA 3C2KA 5DB7A 1ZQMA 9ICLA 4FHYA 4NY8A 3LK9A 5DBBA 4I2FA 4FH3A 5F2VO 4UBCA 4M9JA 4DO9A 8ICFA 4WC4A 3ISDA 3B0XA 1RPLA 1YLQA 1BPEA 1ZQVA 9ICBA 5CA7A 3UQ2A 8ICTA 5HRGA 4UB3A 5J0SA 4IQWA 3WFRE 4UAWA 2DRBA 1ZQEA 3H38A 4GXIA 2ZH7A 1Q78A 4WC7A 5J2CA 5IIKA 4M04A 4X0AA 9ICGA 1ZQSA 5DB8A 4NLNA 3TFSA 4RQ0A 4GXKA 3MDCA 1FA0A 4R66A 5HHIA 2M2WA 4X4TA 4YMOA 3UXPA 8ICBA 5CB1A 2O1PA 4WBYA 1MIYA 1R8CA 2NRKA 2O5AA 4IG8A 3JPSA 4RWOA 4JWMA 4X4RA 4AT9A 3WFPA 3V7JA 4XQ7A 4NKUA 4X4SA 9ICKA 4M2YA 4RQ3A 3JPRA 4KLGA 5CR0A 4RQ8A 4M9GA 7ICUA 4X4UA 5J2BA 4RPXA 4O9MA 2IHMA 4KLHA 9ICCA 1ZQQA 4QZGA 4X5VA 7ICVA 5HRHA 3JPNA 3RH4A 1ZQJA 2HHPA 9ICWA 4YMNA 3C66A 4I2GA 4LVSA 4PHPA 4WC2A 2BCVA 3L9DA 3JYYA 1F5AA 1JAJA 5DB6A 5J0TA 5CP2A 4KLOA 1ZQKA 2ISPA 4KLTA 4X4NA 8ICPA 1RZTA 1UEUA 4DOCA 4ATBA 1ZQIA 5D49A 4QZEA 3OVSA 4TUSA 3NYBA 4NM2A 2ZHAA 4I27A 5CWRA 4O5KA 5HRDA 4X4PA 1XSLA 4PGXA 1R89A 4Z6EA 4MFAA 4O5CA 1ZQBA 3UPQA 4AT7A 1BPYA 1ZQWA 3AU2A 3RH6A 1BPXA 4I28A 3RH5A 4YCXA 1JQRA 4E80A 2ZHBA 2BPFA 4KLSA 4RPYA 2DR8A 4I2JA 4KLEA 4EBKA 7ICRA 4FH5A 5HR9A 7ICIA 4XQ8A 4FHPA 3HJ4A 5J0QA 4AT8A 3C18A 5J2KA 1ZQAA 3JPQA 7ICOA 1ZQXA 7ICFA 3RJEA 4WC6A 5J2AA 2DVIA 1BPZA 2FMSA 2ZH1A 8ICLA 1TFYA 2GWSA 4MF2A 7ICGA 5DDMA 4X0BA 4LZGA 5J2JA 5J0XA 3WFOA 1MIVA 4RQ7A 5D4BA 4PH5A 4QZIA 8ICJA 3AQKA 3HIYA 3HWTA 1ZQRA 3LQCB 5J0RA 3C2MA 1WOTA 5DKWA 5J2EA 1Q79A 8ICCA 4Z6FA 4PHDA 3H3AA 4S3NA 3HX0A 5HRIA 3V7LA 4Z6CA 3HJ1A 2Q66A 1MQ2A 4KLJA 2PXIA 9ICIA 5J0PA 5J2IA 7ICKA 1HUZA 4YD1A 1ZQYA 4YD2A 1ZQOA 1UETA 9ICXA 1V4AA 4JWNA 5IILA 4I2BA 4RQ2A 4X4OA 2ZH3A 5DBCA 4K4HA 5J0YA 4X4VA 4WC0A 4KLIA 2ISOA 1NO5A 5J0OA 8ICKA 8ICGA 4AT9B 3H37A 9ICOA 7ICTA 5J2GA 4F5QA 3AQLA 3RJGA 3OUYA 4QZBA 3K75D 3AUOA 4GXJA 4NKTA 3V7KA 9ICPA 4I2EA 4M5DA 3RJKA 4QZCA 2PFOA 9ICRA 5DEDA 9ICMA 4UB2A 8ICQA 3HW8A 8ICAA 3JPPA 8ICVA 4IQUA 1ZQZA 3C5FA 5TZVA 4P4MA 4ATBB 4FHXA 4P2HA 4M9LA 3OV7A 4XA5A 4RPZA 4WC1A 3UPSA 4E8FA 3V72A 4X4QA 1ZQGA 4PGYA 4NLZA
chains in the Genus database with same CATH superfamily
4EBJA 3GDXA 5HRBA 4WCWA 3UXNA 4UB5A 1ZQUA 8ICXA 9ICNA 1GPJA 2BPCA 4UB1A 2ZH8A 4WC5A 4NLKA 4AT7B 2IHOA 1ZJNA 4FHWA 3B0YA 1ZQLA 9ICVA 2BCQA 5CJ7A 5B3PA 4FHVA 3JPOA 1ZQDA 4M9NA 1KDHA 3MDAA 4KLLA 1BPBA 5J29A 8ICNA 4K96A 9ICAA 1VJ7A 5J2FA 4R63A 3PNCA 9ICQA 4I2CA 3C5GA 4XUSA 3CK6A 4IQVA 9ICUA 3K7DA 5D63A 2ZH6A 1TV9A 4P4PA 5IIIA 3H39A 4UB4A 2BBHA 4UAZA 3OVAA 7ICEA 4TURA 1ZJMA 5HRKA 4OAGA 4QZ8A 8ICIA 4JLXA 4MF8A 4PGQA 3MGIA 4I2HA 4PPXA 4LT6A 1HUOA 5IIJA 7ICHA 1XSPA 4I2DA 4UBBA 4EP7A 4F5NA 5J2DA 7ICPA 2BE3A 4F5PA 4DOBA 4RWNA 2FMPA 4YMMA 4QZAA 2B51A 3MBYA 2FMQA 4LEWA 4KLUA 4TUPA 2M2TA 5J0WA 2BCSA 7ICNA 3PMNA 5IIMA 2BCUA 7ICQA 1TVAA 3UXOA 4LZDA 4QZ9A 4DOAA 1ZQFA 5BOMA 4QZHA 4O5EA 8ICHA 7ICSA 1TFWA 2DRAA 5DBAA 4WC3A 9ICTA 1ZQTA 7ICLA 2I9GA 4KLDA 8ICOA 5DB9A 5IINA 2ID1A 4OAFA 2DR5A 4IQTA 1ZQNA 4HX0A 4UD5A 8ICUA 3OGUA 4O69A 3JPTA 9ICHA 5HHHA 3OVBA 4LEVA 1PX5A 1ZQCA 4M47A 4NLZA 2PBEA 4PHEA 3ISCA 5HC9A 4K9BA 4PHAA 4QZFA 3OUYB 4OAHA 5IIOA 4F5RA 1ZQPA 5D62A 5J0UA 5HRFA 4I2IA 1VFGA 4QZDA 5DECA 4RWQA 5CHGA 1MIWA 3JZ0A 1MQ3A 4XRHA 5BPCA 4RQ5A 2RFFA 4RQ6A 8ICEA 2P66A 3WFSC 4M0AA 9ICEA 1KEJA 3ERCC 9ICJA 4Z6DA 7ICJA 2ZH9A 2ZH5A 3AQMA 4K4IA 2HN1A 4KLFA 1KNYA 4WQLA 3PMLA 3C2LA 4YN4A 3AU6A 8ICZA 3UQ0A 5HRLA 3RJHA 4KLQA 8ICYA 3RJJA 1UEVA 4I2AA 3RJIA 3TFRA 2FCLA 1JMSA 5CFTA 1OU5A 4EEDA 3RJFA 4I29A 1R8AA 1JN3A 4RT3A 2PFPA 3MGHA 5DDYA 5EOZA 1R8BA 3PHZA 1XSNA 9ICFA 4NXZA 4P4OA 4RWPA 5HREA 4RT2A 4MFFA 2M2VA 4R65A 4K8VA 1ZQHA 4FO6A 4M9HA 2DR9A 4KLMA 5BOLA 2M2UA 4TUQA 8ICMA 2PFNA 4NM1A 2ZH2A 5D61A 1BPDA 4R64A 8ICRA 2BCRA 4F5OA 5J2HA 4AT8B 2BPGA 8ICSA 4WBZA 4O6AA 1NOMA 3ISBA 4E7XA 3WFQE 4MFCA 9ICSA 4LEYA 3AQNA 5D46A 2ZH4A 4UD4A 2PFQA 2DR7A 4RQ4A 2W9MA 4K4GA 2VANA 4RQ1A 7ICMA 4UAYA 2B56A 8ICWA 3C2KA 5DB7A 1ZQMA 9ICLA 4FHYA 4NY8A 3LK9A 5DBBA 4I2FA 4FH3A 3JCFA 5F2VO 4UBCA 4M9JA 4DO9A 8ICFA 4WC4A 3ISDA 3B0XA 1RPLA 1YLQA 1BPEA 1ZQVA 9ICBA 4NXTA 5CA7A 3UQ2A 8ICTA 5HRGA 4UB3A 4OAIZ 5J0SA 4IQWA 3WFRE 4UAWA 2DRBA 1ZQEA 4MKPA 3H38A 4GXIA 3NKUA 5B3QA 2ZH7A 1Q78A 4NXUA 2BBJA 4WC7A 5J2CA 4EV6A 5IIKA 4M04A 4X0AA 9ICGA 1ZQSA 5DB8A 4NLNA 3TFSA 4RQ0A 4EGWA 4GXKA 3MDCA 1FA0A 4R66A 5HHIA 4X4TA 2M2WA 4YMOA 3NWIA 3UXPA 8ICBA 5CB1A 2O1PA 4WBYA 1MIYA 1R8CA 2NRKA 2O5AA 4IG8A 3JPSA 4RWOA 5CHEA 4JWMA 4X4RA 4KB6A 4JLZA 4AT9A 3WFPA 3V7JA 4XQ7A 4NKUA 4X4SA 9ICKA 4M2YA 4RQ3A 3JPRA 3ER8C 4KM5A 5CR0A 4KLGA 4RQ8A 4M9GA 7ICUA 4X4UA 2GAFD 5J2BA 4RPXA 4O9MA 2IHMA 4KLHA 9ICCA 1ZQQA 4QZGA 4X5VA 7ICVA 2EWRA 5HRHA 3JPNA 3RH4A 1ZQJA 2HHPA 9ICWA 4YMNA 3C66A 4I2GA 4LVSA 4PHPA 4WC2A 2BCVA 3L9DA 3JYYA 1F5AA 1JAJA 5DB6A 4K98A 5J0TA 5CP2A 4X4NA 1ZQKA 2ISPA 4KLOA 4EEBA 4KLTA 8ICPA 2B4VA 1RZTA 3ER9B 1UEUA 4DOCA 4ATBA 1ZQIA 5D49A 4QZEA 3OVSA 5CFSA 4TUSA 3EF2A 4O67A 3NYBA 4NM2A 2ZHAA 4I27A 5CWRA 3NVOA 4O5KA 5HRDA 4X4PA 1XSLA 4PGXA 1R89A 4LEZA 4Z6EA 4MFAA 4NXXA 4O5CA 4K97A 3MCRA 1ZQBA 3UPQA 4AT7A 1BPYA 1ZQWA 3AU2A 3RH6A 1BPXA 4I28A 3RH5A 4YCXA 1JQRA 4E80A 2ZHBA 2BPFA 4KLSA 4RPYA 2DR8A 4I2JA 4KLEA 4EBKA 7ICRA 4FH5A 5HR9A 7ICIA 4XQ8A 4FHPA 3HJ4A 5J0QA 4AT8A 3C18A 5J2KA 1ZQAA 3JPQA 7ICOA 1ZQXA 4XJEA 3RJEA 7ICFA 4WC6A 5J2AA 2DVIA 1BPZA 2FMSA 2ZH1A 8ICLA 1TFYA 2GWSA 4MF2A 7ICGA 5DDMA 4X0BA 4LZGA 5J2JA 5J0XA 3WFOA 1MIVA 4RQ7A 5D4BA 4PH5A 4QZIA 8ICJA 3AQKA 4I0UA 3HIYA 3HWTA 1ZQRA 3LQCB 5J0RA 3C2MA 1WOTA 5DKWA 5J2EA 1Q79A 8ICCA 4Z6FA 4PHDA 3H3AA 4S3NA 3HX0A 5HRIA 3V7LA 4Z6CA 4WQKA 3HJ1A 2Q66A 1MQ2A 4KLJA 2PXIA 9ICIA 5J0PA 5J2IA 7ICKA 1HUZA 4YD1A 4K99A 1ZQYA 4YD2A 1ZQOA 1UETA 9ICXA 1V4AA 4JWNA 2HN2A 5IILA 4I2BA 4X4OA 4RQ2A 2ZH3A 5DBCA 4K4HA 5J0YA 4X4VA 4WC0A 4KLIA 2ISOA 1NO5A 5J0OA 4NXWA 8ICKA 8ICGA 4AT9B 3H37A 9ICOA 7ICTA 5J2GA 4F5QA 3AQLA 4WOYA 3RJGA 3OUYA 4QZBA 3K75D 3AUOA 4GXJA 4NKTA 3V7KA 2GA9D 9ICPA 4I2EA 4M5DA 4O68A 3OWGA 3RJKA 4QZCA 2PFOA 9ICRA 5DEDA 4N7RA 4UB2A 9ICMA 4NXVA 8ICQA 3HW8A 4WH5A 8ICAA 3JPPA 8ICVA 4IQUA 1ZQZA 3C5FA 2IUBA 5TZVA 4P4MA 4K9AA 4ATBB 4FHXA 4P2HA 4M9LA 3OV7A 4XA5A 4RPZA 4WC1A 5CFUA 3UPSA 4E8FA 3V72A 4X4QA 1ZQGA 5JTGA 4PGYA 4FO1A
chains in the Genus database with same CATH topology
4EBJA 3GDXA 5HRBA 4WCWA 3UXNA 4UB5A 1ZQUA 8ICXA 9ICNA 2BPCA 4UB1A 2ZH8A 4WC5A 4NLKA 4AT7B 1ZJNA 4FHWA 3B0YA 1ZQLA 9ICVA 2BCQA 5CJ7A 4FHVA 3JPOA 1ZQDA 4M9NA 1KDHA 3MDAA 4KLLA 1BPBA 5J29A 8ICNA 9ICAA 1VJ7A 5J2FA 4R63A 3PNCA 9ICQA 4I2CA 3C5GA 4XUSA 4IQVA 9ICUA 2ZH6A 1TV9A 4P4PA 5IIIA 3H39A 4UB4A 4UAZA 3OVAA 7ICEA 4TURA 1ZJMA 5HRKA 4QZ8A 8ICIA 4MF8A 4PGQA 3MGIA 4I2HA 4PPXA 4LT6A 1HUOA 5IIJA 7ICHA 1XSPA 4I2DA 4UBBA 4EP7A 4F5NA 5J2DA 7ICPA 2BE3A 4F5PA 4DOBA 4RWNA 2FMPA 4YMMA 4QZAA 3MBYA 2FMQA 4KLUA 4TUPA 2M2TA 5J0WA 2BCSA 7ICNA 3PMNA 5IIMA 2BCUA 7ICQA 1TVAA 3UXOA 4LZDA 4QZ9A 4DOAA 1ZQFA 5BOMA 4QZHA 4O5EA 8ICHA 7ICSA 1TFWA 2DRAA 5DBAA 4WC3A 9ICTA 1ZQTA 7ICLA 2I9GA 4KLDA 8ICOA 5DB9A 5IINA 2ID1A 2DR5A 4IQTA 1ZQNA 4UD5A 8ICUA 3OGUA 3JPTA 9ICHA 5HHHA 1ZQCA 4M47A 1PX5A 3OVBA 2PBEA 4PHEA 3ISCA 5HC9A 4PHAA 4QZFA 5IIOA 3OUYB 4F5RA 1ZQPA 5J0UA 5HRFA 4I2IA 1VFGA 4QZDA 5DECA 4RWQA 5CHGA 1MIWA 3JZ0A 1MQ3A 4XRHA 5BPCA 4RQ5A 2RFFA 4RQ6A 8ICEA 2P66A 3WFSC 4M0AA 9ICEA 1KEJA 9ICJA 4Z6DA 7ICJA 2ZH9A 2ZH5A 3AQMA 4K4IA 4KLFA 1KNYA 3PMLA 3C2LA 4YN4A 3AU6A 8ICZA 3UQ0A 5HRLA 3RJHA 4KLQA 8ICYA 3RJJA 1UEVA 4I2AA 3RJIA 3TFRA 1JMSA 1OU5A 3RJFA 4I29A 1R8AA 1JN3A 4RT3A 2PFPA 3MGHA 5DDYA 5EOZA 1R8BA 1XSNA 9ICFA 4NXZA 4P4OA 4RWPA 5HREA 4RT2A 4MFFA 2M2VA 4R65A 1ZQHA 4FO6A 4M9HA 2DR9A 4KLMA 5BOLA 2M2UA 4TUQA 8ICMA 2PFNA 4NM1A 2ZH2A 1BPDA 4R64A 8ICRA 2BCRA 4F5OA 5J2HA 4AT8B 2BPGA 8ICSA 4WBZA 1NOMA 3ISBA 4E7XA 3WFQE 4MFCA 9ICSA 3AQNA 5D46A 2ZH4A 4UD4A 2PFQA 2DR7A 4RQ4A 2W9MA 4K4GA 2VANA 4RQ1A 7ICMA 4UAYA 8ICWA 3C2KA 5DB7A 1ZQMA 9ICLA 4FHYA 4NY8A 3LK9A 5DBBA 4I2FA 4FH3A 5F2VO 4UBCA 4M9JA 4DO9A 8ICFA 4WC4A 3ISDA 3B0XA 1RPLA 1YLQA 1BPEA 1ZQVA 9ICBA 5CA7A 3UQ2A 8ICTA 5HRGA 4UB3A 5J0SA 4IQWA 3WFRE 4UAWA 2DRBA 1ZQEA 3H38A 4GXIA 2ZH7A 1Q78A 4WC7A 5J2CA 5IIKA 4M04A 4X0AA 9ICGA 1ZQSA 5DB8A 4NLNA 3TFSA 4RQ0A 4GXKA 3MDCA 1FA0A 4R66A 5HHIA 2M2WA 4X4TA 4YMOA 3UXPA 8ICBA 5CB1A 2O1PA 4WBYA 1MIYA 1R8CA 2NRKA 2O5AA 4IG8A 3JPSA 4RWOA 4JWMA 4X4RA 4AT9A 3WFPA 3V7JA 4XQ7A 4NKUA 4X4SA 9ICKA 4M2YA 4RQ3A 3JPRA 4KLGA 5CR0A 4RQ8A 4M9GA 7ICUA 4X4UA 5J2BA 4RPXA 4O9MA 2IHMA 4KLHA 9ICCA 1ZQQA 4QZGA 4X5VA 7ICVA 5HRHA 3JPNA 3RH4A 1ZQJA 2HHPA 9ICWA 4YMNA 3C66A 4I2GA 4LVSA 4PHPA 4WC2A 2BCVA 3L9DA 3JYYA 1F5AA 1JAJA 5DB6A 5J0TA 5CP2A 4KLOA 1ZQKA 2ISPA 4KLTA 4X4NA 8ICPA 1RZTA 1UEUA 4DOCA 4ATBA 1ZQIA 5D49A 4QZEA 3OVSA 4TUSA 3NYBA 4NM2A 2ZHAA 4I27A 5CWRA 4O5KA 5HRDA 4X4PA 1XSLA 4PGXA 1R89A 4Z6EA 4MFAA 4O5CA 1ZQBA 3UPQA 4AT7A 1BPYA 1ZQWA 3AU2A 3RH6A 1BPXA 4I28A 3RH5A 4YCXA 1JQRA 4E80A 2ZHBA 2BPFA 4KLSA 4RPYA 2DR8A 4I2JA 4KLEA 4EBKA 7ICRA 4FH5A 5HR9A 7ICIA 4XQ8A 4FHPA 3HJ4A 5J0QA 4AT8A 3C18A 5J2KA 1ZQAA 3JPQA 7ICOA 1ZQXA 7ICFA 3RJEA 4WC6A 5J2AA 2DVIA 1BPZA 2FMSA 2ZH1A 8ICLA 1TFYA 2GWSA 4MF2A 7ICGA 5DDMA 4X0BA 4LZGA 5J2JA 5J0XA 3WFOA 1MIVA 4RQ7A 5D4BA 4PH5A 4QZIA 8ICJA 3AQKA 3HIYA 3HWTA 1ZQRA 3LQCB 5J0RA 3C2MA 1WOTA 5DKWA 5J2EA 1Q79A 8ICCA 4Z6FA 4PHDA 3H3AA 4S3NA 3HX0A 5HRIA 3V7LA 4Z6CA 3HJ1A 2Q66A 1MQ2A 4KLJA 2PXIA 9ICIA 5J0PA 5J2IA 7ICKA 1HUZA 4YD1A 1ZQYA 4YD2A 1ZQOA 1UETA 9ICXA 1V4AA 4JWNA 5IILA 4I2BA 4RQ2A 4X4OA 2ZH3A 5DBCA 4K4HA 5J0YA 4X4VA 4WC0A 4KLIA 2ISOA 1NO5A 5J0OA 8ICKA 8ICGA 4AT9B 3H37A 9ICOA 7ICTA 5J2GA 4F5QA 3AQLA 3RJGA 3OUYA 4QZBA 3K75D 3AUOA 4GXJA 4NKTA 3V7KA 9ICPA 4I2EA 4M5DA 3RJKA 4QZCA 2PFOA 9ICRA 5DEDA 9ICMA 4UB2A 8ICQA 3HW8A 8ICAA 3JPPA 8ICVA 4IQUA 1ZQZA 3C5FA 5TZVA 4P4MA 4ATBB 4FHXA 4P2HA 4M9LA 3OV7A 4XA5A 4RPZA 4WC1A 3UPSA 4E8FA 3V72A 4X4QA 1ZQGA 4PGYA 4NLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBJ A;  3GDX A;  5HRB A;  4WCW A;  3UXN A;  4UB5 A;  1ZQU A;  8ICX A;  9ICN A;  2BPC A;  4UB1 A;  2ZH8 A;  4WC5 A;  4NLK A;  4AT7 B;  1ZJN A;  4FHW A;  3B0Y A;  1ZQL A;  9ICV A;  2BCQ A;  5CJ7 A;  4FHV A;  3JPO A;  1ZQD A;  4M9N A;  1KDH A;  3MDA A;  4KLL A;  1BPB A;  5J29 A;  8ICN A;  9ICA A;  1VJ7 A;  5J2F A;  4R63 A;  3PNC A;  9ICQ A;  4I2C A;  3C5G A;  4XUS A;  4IQV A;  9ICU A;  2ZH6 A;  1TV9 A;  4P4P A;  5III A;  3H39 A;  4UB4 A;  4UAZ A;  3OVA A;  7ICE A;  4TUR A;  1ZJM A;  5HRK A;  4QZ8 A;  8ICI A;  4MF8 A;  4PGQ A;  3MGI A;  4I2H A;  4PPX A;  4LT6 A;  1HUO A;  5IIJ A;  7ICH A;  1XSP A;  4I2D A;  4UBB A;  4EP7 A;  4F5N A;  5J2D A;  7ICP A;  2BE3 A;  4F5P A;  4DOB A;  4RWN A;  2FMP A;  4YMM A;  4QZA A;  3MBY A;  2FMQ A;  4KLU A;  4TUP A;  2M2T A;  5J0W A;  2BCS A;  7ICN A;  3PMN A;  5IIM A;  2BCU A;  7ICQ A;  1TVA A;  3UXO A;  4LZD A;  4QZ9 A;  4DOA A;  1ZQF A;  5BOM A;  4QZH A;  4O5E A;  8ICH A;  7ICS A;  1TFW A;  2DRA A;  5DBA A;  4WC3 A;  9ICT A;  1ZQT A;  7ICL A;  2I9G A;  4KLD A;  8ICO A;  5DB9 A;  5IIN A;  2ID1 A;  2DR5 A;  4IQT A;  1ZQN A;  4UD5 A;  8ICU A;  3OGU A;  3JPT A;  9ICH A;  5HHH A;  1ZQC A;  4M47 A;  1PX5 A;  3OVB A;  2PBE A;  4PHE A;  3ISC A;  5HC9 A;  4PHA A;  4QZF A;  5IIO A;  3OUY B;  4F5R A;  1ZQP A;  5J0U A;  5HRF A;  4I2I A;  1VFG A;  4QZD A;  5DEC A;  4RWQ A;  5CHG A;  1MIW A;  3JZ0 A;  1MQ3 A;  4XRH A;  5BPC A;  4RQ5 A;  2RFF A;  4RQ6 A;  8ICE A;  2P66 A;  3WFS C;  4M0A A;  9ICE A;  1KEJ A;  9ICJ A;  4Z6D A;  7ICJ A;  2ZH9 A;  2ZH5 A;  3AQM A;  4K4I A;  4KLF A;  1KNY A;  3PML A;  3C2L A;  4YN4 A;  3AU6 A;  8ICZ A;  3UQ0 A;  5HRL A;  3RJH A;  4KLQ A;  8ICY A;  3RJJ A;  1UEV A;  4I2A A;  3RJI A;  3TFR A;  1JMS A;  1OU5 A;  3RJF A;  4I29 A;  1R8A A;  1JN3 A;  4RT3 A;  2PFP A;  3MGH A;  5DDY A;  5EOZ A;  1R8B A;  1XSN A;  9ICF A;  4NXZ A;  4P4O A;  4RWP A;  5HRE A;  4RT2 A;  4MFF A;  2M2V A;  4R65 A;  1ZQH A;  4FO6 A;  4M9H A;  2DR9 A;  4KLM A;  5BOL A;  2M2U A;  4TUQ A;  8ICM A;  2PFN A;  4NM1 A;  2ZH2 A;  1BPD A;  4R64 A;  8ICR A;  2BCR A;  4F5O A;  5J2H A;  4AT8 B;  2BPG A;  8ICS A;  4WBZ A;  1NOM A;  3ISB A;  4E7X A;  3WFQ E;  4MFC A;  9ICS A;  3AQN A;  5D46 A;  2ZH4 A;  4UD4 A;  2PFQ A;  2DR7 A;  4RQ4 A;  2W9M A;  4K4G A;  2VAN A;  4RQ1 A;  7ICM A;  4UAY A;  8ICW A;  3C2K A;  5DB7 A;  1ZQM A;  9ICL A;  4FHY A;  4NY8 A;  3LK9 A;  5DBB A;  4I2F A;  4FH3 A;  5F2V O;  4UBC A;  4M9J A;  4DO9 A;  8ICF A;  4WC4 A;  3ISD A;  3B0X A;  1RPL A;  1YLQ A;  1BPE A;  1ZQV A;  9ICB A;  5CA7 A;  3UQ2 A;  8ICT A;  5HRG A;  4UB3 A;  5J0S A;  4IQW A;  3WFR E;  4UAW A;  2DRB A;  1ZQE A;  3H38 A;  4GXI A;  2ZH7 A;  1Q78 A;  4WC7 A;  5J2C A;  5IIK A;  4M04 A;  4X0A A;  9ICG A;  1ZQS A;  5DB8 A;  4NLN A;  3TFS A;  4RQ0 A;  4GXK A;  3MDC A;  1FA0 A;  4R66 A;  5HHI A;  2M2W A;  4X4T A;  4YMO A;  3UXP A;  8ICB A;  5CB1 A;  2O1P A;  4WBY A;  1MIY A;  1R8C A;  2NRK A;  2O5A A;  4IG8 A;  3JPS A;  4RWO A;  4JWM A;  4X4R A;  4AT9 A;  3WFP A;  3V7J A;  4XQ7 A;  4NKU A;  4X4S A;  9ICK A;  4M2Y A;  4RQ3 A;  3JPR A;  4KLG A;  5CR0 A;  4RQ8 A;  4M9G A;  7ICU A;  4X4U A;  5J2B A;  4RPX A;  4O9M A;  2IHM A;  4KLH A;  9ICC A;  1ZQQ A;  4QZG A;  4X5V A;  7ICV A;  5HRH A;  3JPN A;  3RH4 A;  1ZQJ A;  2HHP A;  9ICW A;  4YMN A;  3C66 A;  4I2G A;  4LVS A;  4PHP A;  4WC2 A;  2BCV A;  3L9D A;  3JYY A;  1F5A A;  1JAJ A;  5DB6 A;  5J0T A;  5CP2 A;  4KLO A;  1ZQK A;  2ISP A;  4KLT A;  4X4N A;  8ICP A;  1RZT A;  1UEU A;  4DOC A;  4ATB A;  1ZQI A;  5D49 A;  4QZE A;  3OVS A;  4TUS A;  3NYB A;  4NM2 A;  2ZHA A;  4I27 A;  5CWR A;  4O5K A;  5HRD A;  4X4P A;  1XSL A;  4PGX A;  1R89 A;  4Z6E A;  4MFA A;  4O5C A;  1ZQB A;  3UPQ A;  4AT7 A;  1BPY A;  1ZQW A;  3AU2 A;  3RH6 A;  1BPX A;  4I28 A;  3RH5 A;  4YCX A;  1JQR A;  4E80 A;  2ZHB A;  2BPF A;  4KLS A;  4RPY A;  2DR8 A;  4I2J A;  4KLE A;  4EBK A;  7ICR A;  4FH5 A;  5HR9 A;  7ICI A;  4XQ8 A;  4FHP A;  3HJ4 A;  5J0Q A;  4AT8 A;  3C18 A;  5J2K A;  1ZQA A;  3JPQ A;  7ICO A;  1ZQX A;  7ICF A;  3RJE A;  4WC6 A;  5J2A A;  2DVI A;  1BPZ A;  2FMS A;  2ZH1 A;  8ICL A;  1TFY A;  2GWS A;  4MF2 A;  7ICG A;  5DDM A;  4X0B A;  4LZG A;  5J2J A;  5J0X A;  3WFO A;  1MIV A;  4RQ7 A;  5D4B A;  4PH5 A;  4QZI A;  8ICJ A;  3AQK A;  3HIY A;  3HWT A;  1ZQR A;  3LQC B;  5J0R A;  3C2M A;  1WOT A;  5DKW A;  5J2E A;  1Q79 A;  8ICC A;  4Z6F A;  4PHD A;  3H3A A;  4S3N A;  3HX0 A;  5HRI A;  3V7L A;  4Z6C A;  3HJ1 A;  2Q66 A;  1MQ2 A;  4KLJ A;  2PXI A;  9ICI A;  5J0P A;  5J2I A;  7ICK A;  1HUZ A;  4YD1 A;  1ZQY A;  4YD2 A;  1ZQO A;  1UET A;  9ICX A;  1V4A A;  4JWN A;  5IIL A;  4I2B A;  4RQ2 A;  4X4O A;  2ZH3 A;  5DBC A;  4K4H A;  5J0Y A;  4X4V A;  4WC0 A;  4KLI A;  2ISO A;  1NO5 A;  5J0O A;  8ICK A;  8ICG A;  4AT9 B;  3H37 A;  9ICO A;  7ICT A;  5J2G A;  4F5Q A;  3AQL A;  3RJG A;  3OUY A;  4QZB A;  3K75 D;  3AUO A;  4GXJ A;  4NKT A;  3V7K A;  9ICP A;  4I2E A;  4M5D A;  3RJK A;  4QZC A;  2PFO A;  9ICR A;  5DED A;  9ICM A;  4UB2 A;  8ICQ A;  3HW8 A;  8ICA A;  3JPP A;  8ICV A;  4IQU A;  1ZQZ A;  3C5F A;  5TZV A;  4P4M A;  4ATB B;  4FHX A;  4P2H A;  4M9L A;  3OV7 A;  4XA5 A;  4RPZ A;  4WC1 A;  3UPS A;  4E8F A;  3V72 A;  4X4Q A;  1ZQG A;  4PGY A;  4NLZ A; 
#chains in the Genus database with same CATH topology
 4EBJ A;  3GDX A;  5HRB A;  4WCW A;  3UXN A;  4UB5 A;  1ZQU A;  8ICX A;  9ICN A;  1GPJ A;  2BPC A;  4UB1 A;  2ZH8 A;  4WC5 A;  4NLK A;  4AT7 B;  2IHO A;  1ZJN A;  4FHW A;  3B0Y A;  1ZQL A;  9ICV A;  2BCQ A;  5CJ7 A;  5B3P A;  4FHV A;  3JPO A;  1ZQD A;  4M9N A;  1KDH A;  3MDA A;  4KLL A;  1BPB A;  5J29 A;  8ICN A;  4K96 A;  9ICA A;  1VJ7 A;  5J2F A;  4R63 A;  3PNC A;  9ICQ A;  4I2C A;  3C5G A;  4XUS A;  3CK6 A;  4IQV A;  9ICU A;  3K7D A;  5D63 A;  2ZH6 A;  1TV9 A;  4P4P A;  5III A;  3H39 A;  4UB4 A;  2BBH A;  4UAZ A;  3OVA A;  7ICE A;  4TUR A;  1ZJM A;  5HRK A;  4OAG A;  4QZ8 A;  8ICI A;  4JLX A;  4MF8 A;  4PGQ A;  3MGI A;  4I2H A;  4PPX A;  4LT6 A;  1HUO A;  5IIJ A;  7ICH A;  1XSP A;  4I2D A;  4UBB A;  4EP7 A;  4F5N A;  5J2D A;  7ICP A;  2BE3 A;  4F5P A;  4DOB A;  4RWN A;  2FMP A;  4YMM A;  4QZA A;  2B51 A;  3MBY A;  2FMQ A;  4LEW A;  4KLU A;  4TUP A;  2M2T A;  5J0W A;  2BCS A;  7ICN A;  3PMN A;  5IIM A;  2BCU A;  7ICQ A;  1TVA A;  3UXO A;  4LZD A;  4QZ9 A;  4DOA A;  1ZQF A;  5BOM A;  4QZH A;  4O5E A;  8ICH A;  7ICS A;  1TFW A;  2DRA A;  5DBA A;  4WC3 A;  9ICT A;  1ZQT A;  7ICL A;  2I9G A;  4KLD A;  8ICO A;  5DB9 A;  5IIN A;  2ID1 A;  4OAF A;  2DR5 A;  4IQT A;  1ZQN A;  4HX0 A;  4UD5 A;  8ICU A;  3OGU A;  4O69 A;  3JPT A;  9ICH A;  5HHH A;  3OVB A;  4LEV A;  1PX5 A;  1ZQC A;  4M47 A;  4NLZ A;  2PBE A;  4PHE A;  3ISC A;  5HC9 A;  4K9B A;  4PHA A;  4QZF A;  3OUY B;  4OAH A;  5IIO A;  4F5R A;  1ZQP A;  5D62 A;  5J0U A;  5HRF A;  4I2I A;  1VFG A;  4QZD A;  5DEC A;  4RWQ A;  5CHG A;  1MIW A;  3JZ0 A;  1MQ3 A;  4XRH A;  5BPC A;  4RQ5 A;  2RFF A;  4RQ6 A;  8ICE A;  2P66 A;  3WFS C;  4M0A A;  9ICE A;  1KEJ A;  3ERC C;  9ICJ A;  4Z6D A;  7ICJ A;  2ZH9 A;  2ZH5 A;  3AQM A;  4K4I A;  2HN1 A;  4KLF A;  1KNY A;  4WQL A;  3PML A;  3C2L A;  4YN4 A;  3AU6 A;  8ICZ A;  3UQ0 A;  5HRL A;  3RJH A;  4KLQ A;  8ICY A;  3RJJ A;  1UEV A;  4I2A A;  3RJI A;  3TFR A;  2FCL A;  1JMS A;  5CFT A;  1OU5 A;  4EED A;  3RJF A;  4I29 A;  1R8A A;  1JN3 A;  4RT3 A;  2PFP A;  3MGH A;  5DDY A;  5EOZ A;  1R8B A;  3PHZ A;  1XSN A;  9ICF A;  4NXZ A;  4P4O A;  4RWP A;  5HRE A;  4RT2 A;  4MFF A;  2M2V A;  4R65 A;  4K8V A;  1ZQH A;  4FO6 A;  4M9H A;  2DR9 A;  4KLM A;  5BOL A;  2M2U A;  4TUQ A;  8ICM A;  2PFN A;  4NM1 A;  2ZH2 A;  5D61 A;  1BPD A;  4R64 A;  8ICR A;  2BCR A;  4F5O A;  5J2H A;  4AT8 B;  2BPG A;  8ICS A;  4WBZ A;  4O6A A;  1NOM A;  3ISB A;  4E7X A;  3WFQ E;  4MFC A;  9ICS A;  4LEY A;  3AQN A;  5D46 A;  2ZH4 A;  4UD4 A;  2PFQ A;  2DR7 A;  4RQ4 A;  2W9M A;  4K4G A;  2VAN A;  4RQ1 A;  7ICM A;  4UAY A;  2B56 A;  8ICW A;  3C2K A;  5DB7 A;  1ZQM A;  9ICL A;  4FHY A;  4NY8 A;  3LK9 A;  5DBB A;  4I2F A;  4FH3 A;  3JCF A;  5F2V O;  4UBC A;  4M9J A;  4DO9 A;  8ICF A;  4WC4 A;  3ISD A;  3B0X A;  1RPL A;  1YLQ A;  1BPE A;  1ZQV A;  9ICB A;  4NXT A;  5CA7 A;  3UQ2 A;  8ICT A;  5HRG A;  4UB3 A;  4OAI Z;  5J0S A;  4IQW A;  3WFR E;  4UAW A;  2DRB A;  1ZQE A;  4MKP A;  3H38 A;  4GXI A;  3NKU A;  5B3Q A;  2ZH7 A;  1Q78 A;  4NXU A;  2BBJ A;  4WC7 A;  5J2C A;  4EV6 A;  5IIK A;  4M04 A;  4X0A A;  9ICG A;  1ZQS A;  5DB8 A;  4NLN A;  3TFS A;  4RQ0 A;  4EGW A;  4GXK A;  3MDC A;  1FA0 A;  4R66 A;  5HHI A;  4X4T A;  2M2W A;  4YMO A;  3NWI A;  3UXP A;  8ICB A;  5CB1 A;  2O1P A;  4WBY A;  1MIY A;  1R8C A;  2NRK A;  2O5A A;  4IG8 A;  3JPS A;  4RWO A;  5CHE A;  4JWM A;  4X4R A;  4KB6 A;  4JLZ A;  4AT9 A;  3WFP A;  3V7J A;  4XQ7 A;  4NKU A;  4X4S A;  9ICK A;  4M2Y A;  4RQ3 A;  3JPR A;  3ER8 C;  4KM5 A;  5CR0 A;  4KLG A;  4RQ8 A;  4M9G A;  7ICU A;  4X4U A;  2GAF D;  5J2B A;  4RPX A;  4O9M A;  2IHM A;  4KLH A;  9ICC A;  1ZQQ A;  4QZG A;  4X5V A;  7ICV A;  2EWR A;  5HRH A;  3JPN A;  3RH4 A;  1ZQJ A;  2HHP A;  9ICW A;  4YMN A;  3C66 A;  4I2G A;  4LVS A;  4PHP A;  4WC2 A;  2BCV A;  3L9D A;  3JYY A;  1F5A A;  1JAJ A;  5DB6 A;  4K98 A;  5J0T A;  5CP2 A;  4X4N A;  1ZQK A;  2ISP A;  4KLO A;  4EEB A;  4KLT A;  8ICP A;  2B4V A;  1RZT A;  3ER9 B;  1UEU A;  4DOC A;  4ATB A;  1ZQI A;  5D49 A;  4QZE A;  3OVS A;  5CFS A;  4TUS A;  3EF2 A;  4O67 A;  3NYB A;  4NM2 A;  2ZHA A;  4I27 A;  5CWR A;  3NVO A;  4O5K A;  5HRD A;  4X4P A;  1XSL A;  4PGX A;  1R89 A;  4LEZ A;  4Z6E A;  4MFA A;  4NXX A;  4O5C A;  4K97 A;  3MCR A;  1ZQB A;  3UPQ A;  4AT7 A;  1BPY A;  1ZQW A;  3AU2 A;  3RH6 A;  1BPX A;  4I28 A;  3RH5 A;  4YCX A;  1JQR A;  4E80 A;  2ZHB A;  2BPF A;  4KLS A;  4RPY A;  2DR8 A;  4I2J A;  4KLE A;  4EBK A;  7ICR A;  4FH5 A;  5HR9 A;  7ICI A;  4XQ8 A;  4FHP A;  3HJ4 A;  5J0Q A;  4AT8 A;  3C18 A;  5J2K A;  1ZQA A;  3JPQ A;  7ICO A;  1ZQX A;  4XJE A;  3RJE A;  7ICF A;  4WC6 A;  5J2A A;  2DVI A;  1BPZ A;  2FMS A;  2ZH1 A;  8ICL A;  1TFY A;  2GWS A;  4MF2 A;  7ICG A;  5DDM A;  4X0B A;  4LZG A;  5J2J A;  5J0X A;  3WFO A;  1MIV A;  4RQ7 A;  5D4B A;  4PH5 A;  4QZI A;  8ICJ A;  3AQK A;  4I0U A;  3HIY A;  3HWT A;  1ZQR A;  3LQC B;  5J0R A;  3C2M A;  1WOT A;  5DKW A;  5J2E A;  1Q79 A;  8ICC A;  4Z6F A;  4PHD A;  3H3A A;  4S3N A;  3HX0 A;  5HRI A;  3V7L A;  4Z6C A;  4WQK A;  3HJ1 A;  2Q66 A;  1MQ2 A;  4KLJ A;  2PXI A;  9ICI A;  5J0P A;  5J2I A;  7ICK A;  1HUZ A;  4YD1 A;  4K99 A;  1ZQY A;  4YD2 A;  1ZQO A;  1UET A;  9ICX A;  1V4A A;  4JWN A;  2HN2 A;  5IIL A;  4I2B A;  4X4O A;  4RQ2 A;  2ZH3 A;  5DBC A;  4K4H A;  5J0Y A;  4X4V A;  4WC0 A;  4KLI A;  2ISO A;  1NO5 A;  5J0O A;  4NXW A;  8ICK A;  8ICG A;  4AT9 B;  3H37 A;  9ICO A;  7ICT A;  5J2G A;  4F5Q A;  3AQL A;  4WOY A;  3RJG A;  3OUY A;  4QZB A;  3K75 D;  3AUO A;  4GXJ A;  4NKT A;  3V7K A;  2GA9 D;  9ICP A;  4I2E A;  4M5D A;  4O68 A;  3OWG A;  3RJK A;  4QZC A;  2PFO A;  9ICR A;  5DED A;  4N7R A;  4UB2 A;  9ICM A;  4NXV A;  8ICQ A;  3HW8 A;  4WH5 A;  8ICA A;  3JPP A;  8ICV A;  4IQU A;  1ZQZ A;  3C5F A;  2IUB A;  5TZV A;  4P4M A;  4K9A A;  4ATB B;  4FHX A;  4P2H A;  4M9L A;  3OV7 A;  4XA5 A;  4RPZ A;  4WC1 A;  5CFU A;  3UPS A;  4E8F A;  3V72 A;  4X4Q A;  1ZQG A;  5JTG A;  4PGY A;  4FO1 A; 
#chains in the Genus database with same CATH homology
 4EBJ A;  3GDX A;  5HRB A;  4WCW A;  3UXN A;  4UB5 A;  1ZQU A;  8ICX A;  9ICN A;  2BPC A;  4UB1 A;  2ZH8 A;  4WC5 A;  4NLK A;  4AT7 B;  1ZJN A;  4FHW A;  3B0Y A;  1ZQL A;  9ICV A;  2BCQ A;  5CJ7 A;  4FHV A;  3JPO A;  1ZQD A;  4M9N A;  1KDH A;  3MDA A;  4KLL A;  1BPB A;  5J29 A;  8ICN A;  9ICA A;  1VJ7 A;  5J2F A;  4R63 A;  3PNC A;  9ICQ A;  4I2C A;  3C5G A;  4XUS A;  4IQV A;  9ICU A;  2ZH6 A;  1TV9 A;  4P4P A;  5III A;  3H39 A;  4UB4 A;  4UAZ A;  3OVA A;  7ICE A;  4TUR A;  1ZJM A;  5HRK A;  4QZ8 A;  8ICI A;  4MF8 A;  4PGQ A;  3MGI A;  4I2H A;  4PPX A;  4LT6 A;  1HUO A;  5IIJ A;  7ICH A;  1XSP A;  4I2D A;  4UBB A;  4EP7 A;  4F5N A;  5J2D A;  7ICP A;  2BE3 A;  4F5P A;  4DOB A;  4RWN A;  2FMP A;  4YMM A;  4QZA A;  3MBY A;  2FMQ A;  4KLU A;  4TUP A;  2M2T A;  5J0W A;  2BCS A;  7ICN A;  3PMN A;  5IIM A;  2BCU A;  7ICQ A;  1TVA A;  3UXO A;  4LZD A;  4QZ9 A;  4DOA A;  1ZQF A;  5BOM A;  4QZH A;  4O5E A;  8ICH A;  7ICS A;  1TFW A;  2DRA A;  5DBA A;  4WC3 A;  9ICT A;  1ZQT A;  7ICL A;  2I9G A;  4KLD A;  8ICO A;  5DB9 A;  5IIN A;  2ID1 A;  2DR5 A;  4IQT A;  1ZQN A;  4UD5 A;  8ICU A;  3OGU A;  3JPT A;  9ICH A;  5HHH A;  1ZQC A;  4M47 A;  1PX5 A;  3OVB A;  2PBE A;  4PHE A;  3ISC A;  5HC9 A;  4PHA A;  4QZF A;  5IIO A;  3OUY B;  4F5R A;  1ZQP A;  5J0U A;  5HRF A;  4I2I A;  1VFG A;  4QZD A;  5DEC A;  4RWQ A;  5CHG A;  1MIW A;  3JZ0 A;  1MQ3 A;  4XRH A;  5BPC A;  4RQ5 A;  2RFF A;  4RQ6 A;  8ICE A;  2P66 A;  3WFS C;  4M0A A;  9ICE A;  1KEJ A;  9ICJ A;  4Z6D A;  7ICJ A;  2ZH9 A;  2ZH5 A;  3AQM A;  4K4I A;  4KLF A;  1KNY A;  3PML A;  3C2L A;  4YN4 A;  3AU6 A;  8ICZ A;  3UQ0 A;  5HRL A;  3RJH A;  4KLQ A;  8ICY A;  3RJJ A;  1UEV A;  4I2A A;  3RJI A;  3TFR A;  1JMS A;  1OU5 A;  3RJF A;  4I29 A;  1R8A A;  1JN3 A;  4RT3 A;  2PFP A;  3MGH A;  5DDY A;  5EOZ A;  1R8B A;  1XSN A;  9ICF A;  4NXZ A;  4P4O A;  4RWP A;  5HRE A;  4RT2 A;  4MFF A;  2M2V A;  4R65 A;  1ZQH A;  4FO6 A;  4M9H A;  2DR9 A;  4KLM A;  5BOL A;  2M2U A;  4TUQ A;  8ICM A;  2PFN A;  4NM1 A;  2ZH2 A;  1BPD A;  4R64 A;  8ICR A;  2BCR A;  4F5O A;  5J2H A;  4AT8 B;  2BPG A;  8ICS A;  4WBZ A;  1NOM A;  3ISB A;  4E7X A;  3WFQ E;  4MFC A;  9ICS A;  3AQN A;  5D46 A;  2ZH4 A;  4UD4 A;  2PFQ A;  2DR7 A;  4RQ4 A;  2W9M A;  4K4G A;  2VAN A;  4RQ1 A;  7ICM A;  4UAY A;  8ICW A;  3C2K A;  5DB7 A;  1ZQM A;  9ICL A;  4FHY A;  4NY8 A;  3LK9 A;  5DBB A;  4I2F A;  4FH3 A;  5F2V O;  4UBC A;  4M9J A;  4DO9 A;  8ICF A;  4WC4 A;  3ISD A;  3B0X A;  1RPL A;  1YLQ A;  1BPE A;  1ZQV A;  9ICB A;  5CA7 A;  3UQ2 A;  8ICT A;  5HRG A;  4UB3 A;  5J0S A;  4IQW A;  3WFR E;  4UAW A;  2DRB A;  1ZQE A;  3H38 A;  4GXI A;  2ZH7 A;  1Q78 A;  4WC7 A;  5J2C A;  5IIK A;  4M04 A;  4X0A A;  9ICG A;  1ZQS A;  5DB8 A;  4NLN A;  3TFS A;  4RQ0 A;  4GXK A;  3MDC A;  1FA0 A;  4R66 A;  5HHI A;  2M2W A;  4X4T A;  4YMO A;  3UXP A;  8ICB A;  5CB1 A;  2O1P A;  4WBY A;  1MIY A;  1R8C A;  2NRK A;  2O5A A;  4IG8 A;  3JPS A;  4RWO A;  4JWM A;  4X4R A;  4AT9 A;  3WFP A;  3V7J A;  4XQ7 A;  4NKU A;  4X4S A;  9ICK A;  4M2Y A;  4RQ3 A;  3JPR A;  4KLG A;  5CR0 A;  4RQ8 A;  4M9G A;  7ICU A;  4X4U A;  5J2B A;  4RPX A;  4O9M A;  2IHM A;  4KLH A;  9ICC A;  1ZQQ A;  4QZG A;  4X5V A;  7ICV A;  5HRH A;  3JPN A;  3RH4 A;  1ZQJ A;  2HHP A;  9ICW A;  4YMN A;  3C66 A;  4I2G A;  4LVS A;  4PHP A;  4WC2 A;  2BCV A;  3L9D A;  3JYY A;  1F5A A;  1JAJ A;  5DB6 A;  5J0T A;  5CP2 A;  4KLO A;  1ZQK A;  2ISP A;  4KLT A;  4X4N A;  8ICP A;  1RZT A;  1UEU A;  4DOC A;  4ATB A;  1ZQI A;  5D49 A;  4QZE A;  3OVS A;  4TUS A;  3NYB A;  4NM2 A;  2ZHA A;  4I27 A;  5CWR A;  4O5K A;  5HRD A;  4X4P A;  1XSL A;  4PGX A;  1R89 A;  4Z6E A;  4MFA A;  4O5C A;  1ZQB A;  3UPQ A;  4AT7 A;  1BPY A;  1ZQW A;  3AU2 A;  3RH6 A;  1BPX A;  4I28 A;  3RH5 A;  4YCX A;  1JQR A;  4E80 A;  2ZHB A;  2BPF A;  4KLS A;  4RPY A;  2DR8 A;  4I2J A;  4KLE A;  4EBK A;  7ICR A;  4FH5 A;  5HR9 A;  7ICI A;  4XQ8 A;  4FHP A;  3HJ4 A;  5J0Q A;  4AT8 A;  3C18 A;  5J2K A;  1ZQA A;  3JPQ A;  7ICO A;  1ZQX A;  7ICF A;  3RJE A;  4WC6 A;  5J2A A;  2DVI A;  1BPZ A;  2FMS A;  2ZH1 A;  8ICL A;  1TFY A;  2GWS A;  4MF2 A;  7ICG A;  5DDM A;  4X0B A;  4LZG A;  5J2J A;  5J0X A;  3WFO A;  1MIV A;  4RQ7 A;  5D4B A;  4PH5 A;  4QZI A;  8ICJ A;  3AQK A;  3HIY A;  3HWT A;  1ZQR A;  3LQC B;  5J0R A;  3C2M A;  1WOT A;  5DKW A;  5J2E A;  1Q79 A;  8ICC A;  4Z6F A;  4PHD A;  3H3A A;  4S3N A;  3HX0 A;  5HRI A;  3V7L A;  4Z6C A;  3HJ1 A;  2Q66 A;  1MQ2 A;  4KLJ A;  2PXI A;  9ICI A;  5J0P A;  5J2I A;  7ICK A;  1HUZ A;  4YD1 A;  1ZQY A;  4YD2 A;  1ZQO A;  1UET A;  9ICX A;  1V4A A;  4JWN A;  5IIL A;  4I2B A;  4RQ2 A;  4X4O A;  2ZH3 A;  5DBC A;  4K4H A;  5J0Y A;  4X4V A;  4WC0 A;  4KLI A;  2ISO A;  1NO5 A;  5J0O A;  8ICK A;  8ICG A;  4AT9 B;  3H37 A;  9ICO A;  7ICT A;  5J2G A;  4F5Q A;  3AQL A;  3RJG A;  3OUY A;  4QZB A;  3K75 D;  3AUO A;  4GXJ A;  4NKT A;  3V7K A;  9ICP A;  4I2E A;  4M5D A;  3RJK A;  4QZC A;  2PFO A;  9ICR A;  5DED A;  9ICM A;  4UB2 A;  8ICQ A;  3HW8 A;  8ICA A;  3JPP A;  8ICV A;  4IQU A;  1ZQZ A;  3C5F A;  5TZV A;  4P4M A;  4ATB B;  4FHX A;  4P2H A;  4M9L A;  3OV7 A;  4XA5 A;  4RPZ A;  4WC1 A;  3UPS A;  4E8F A;  3V72 A;  4X4Q A;  1ZQG A;  4PGY A;  4NLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...