4IG8A

Structural basis for cytosolic double-stranded rna surveillance by human oas1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
344
structure length
338
Chain Sequence
DLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords 2'-5'-oligoadenylate synthase 1
publication title Structural basis for cytosolic double-stranded RNA surveillance by human oligoadenylate synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 338
sequence length 344
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4ig8A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ig8A01
4X4OA 4TUPA 4MF8A 7ICFA 4QZGA 5DKWA 3JPSA 4PGQA 4GXIA 3WFPA 1MQ2A 5HC9A 1KNYA 4RWNA 1VJ7A 3JPQA 2BCVA 2DR9A 4M9GA 8ICUA 3K75D 5J2AA 4QZHA 2BCRA 1TFWA 9ICEA 2BE3A 8ICCA 4X4SA 9ICXA 5D4BA 3ISBA 3H3AA 4LT6A 7ICLA 1UETA 4I2HA 7ICVA 8ICKA 4I27A 5HRKA 2ZH2A 4DOBA 4LVSA 4WBZA 1HUOA 1KDHA 4RQ8A 3UQ0A 3AU2A 4WC1A 1BPEA 4RQ2A 4WC4A 4WC5A 4UBBA 5IINA 4FO6A 4M9NA 7ICSA 1MIWA 4GXJA 2PFNA 5IILA 4X4PA 4RQ1A 4PHAA 3H39A 1XSNA 1ZQUA 3JPRA 7ICKA 4I2BA 4UAYA 2BPCA 3C2KA 3WFQE 4RQ4A 1UEVA 1UEUA 1TFYA 3OGUA 4M04A 4I29A 1R89A 4KLGA 1ZQMA 5IIJA 4FHWA 5J2IA 4P2HA 4ATBB 4FHVA 2ZHAA 3HJ1A 4P4PA 4IG8A 4Z6CA 4X4TA 9ICJA 3JPPA 4K4IA 4MFFA 2ZH5A 4P4MA 4X5VA 1ZQWA 9ICSA 3UXOA 9ICUA 4FHPA 7ICNA 4KLEA 4JWMA 2DVIA 4AT7A 7ICPA 2M2VA 3ISCA 3C18A 4TUQA 4UAWA 3JPOA 2FMSA 5J0SA 5DB9A 4LZGA 5DBCA 5DB8A 4P4OA 4NY8A 4KLJA 2ZH6A 4NLKA 4WC3A 2BPGA 2I9GA 5D49A 4X4RA 3AU6A 2ZH7A 4RQ7A 2ZH1A 9ICQA 4UD4A 5J0WA 1R8CA 4I2EA 4RWPA 1JQRA 1BPDA 5DBAA 9ICFA 5J0UA 3B0YA 3WFOA 2ZHBA 1PX5A 9ICLA 4X4QA 3RJHA 5D46A 4KLQA 1ZQJA 9ICHA 4R66A 5F2VO 5DDMA 3UPQA 1ZQQA 4XRHA 3OVAA 1ZQLA 1V4AA 4QZFA 1ZQDA 4X0BA 2VANA 5CA7A 1NOMA 4I2DA 4KLFA 4JWNA 5DB7A 1RPLA 4XQ7A 3ISDA 1MQ3A 4PHEA 4R65A 5CHGA 4TURA 1ZJNA 3TFRA 4GXKA 2PXIA 4O5EA 1ZQAA 8ICGA 8ICZA 4QZEA 2PBEA 4PHDA 4LZDA 4KLMA 5CR0A 2DR8A 2M2WA 5BOLA 4WCWA 8ICIA 5HRGA 3V7JA 4K4GA 3RJJA 4M9JA 4YN4A 3C66A 1BPBA 4EBKA 2GWSA 7ICTA 4RPZA 2ISOA 8ICFA 3C5FA 8ICSA 5IIKA 3MGHA 1ZQTA 5HR9A 1ZQNA 3JPTA 4RQ6A 3RJFA 2ID1A 5CP2A 1WOTA 3JZ0A 4MF2A 5J2CA 8ICVA 5DDYA 4AT7B 3H38A 4M0AA 4Z6DA 1ZQPA 5J2EA 5CWRA 4DOAA 7ICOA 1ZQYA 4S3NA 7ICHA 1ZQVA 5HRBA 8ICYA 3C5GA 3OUYB 2O5AA 1NO5A 4I28A 4E7XA 1ZJMA 9ICNA 4XUSA 5DB6A 2IHMA 4QZBA 3UQ2A 3LK9A 4FHXA 4PPXA 4X4UA 4NM1A 1HUZA 4YMOA 2PFPA 4NLNA 8ICHA 4KLTA 1ZQSA 9ICTA 2BCQA 2P66A 4FH5A 4RQ3A 4UB2A 4E80A 3GDXA 1F5AA 2HHPA 8ICXA 1MIYA 3UPSA 4K4HA 3AQKA 4QZDA 4O5KA 4FHYA 3RJKA 5J2KA 5J0OA 4DO9A 4RT2A 1VFGA 3OUYA 4MFAA 4R63A 5J0XA 9ICCA 3UXPA 1YLQA 5J2FA 3B0XA 4AT8A 2ZH3A 8ICMA 4YMNA 3UXNA 4Z6EA 3MDAA 5BOMA 2BPFA 4F5RA 4YMMA 4KLLA 4FH3A 5HHHA 4KLUA 5HRFA 4O5CA 3NYBA 4UB4A 1JAJA 3AQMA 3RJGA 7ICJA 1BPZA 8ICEA 5HRHA 3MBYA 1ZQGA 3TFSA 3C2MA 4RQ0A 3RH5A 9ICAA 3RH4A 4WC7A 4NM2A 4M5DA 4I2FA 5IIOA 5TZVA 5J0YA 4KLIA 9ICPA 4DOCA 4X4VA 4Z6FA 2ISPA 3RJEA 2O1PA 8ICWA 1FA0A 4UB5A 4I2IA 2DRBA 8ICNA 2DR7A 3PMLA 5IIIA 5J29A 3AQNA 3MDCA 8ICTA 4UB3A 4KLSA 4AT9B 4WC6A 3L9DA 4IQWA 3HJ4A 4UD5A 5CB1A 5J2DA 3AQLA 2PFQA 8ICBA 9ICIA 5DECA 1ZQXA 3RH6A 1KEJA 4KLDA 3H37A 7ICQA 4I2CA 4PH5A 7ICUA 4QZIA 1JN3A 4X4NA 2ZH8A 5HREA 4RT3A 4QZ9A 1ZQFA 7ICRA 1ZQCA 9ICRA 5HRDA 4YD2A 4PGXA 3OVBA 4F5OA 3V7LA 4F5PA 7ICGA 2FMQA 4M2YA 5CJ7A 1ZQRA 1ZQOA 4RWOA 4QZAA 2RFFA 5EOZA 1Q79A 4AT9A 1ZQIA 4IQVA 4EBJA 3V72A 4UB1A 4UBCA 4I2AA 8ICQA 4YD1A 5J2BA 5HRLA 2ZH9A 9ICMA 3JPNA 4UAZA 4AT8B 9ICKA 5IIMA 8ICRA 2NRKA 4YCXA 1ZQEA 5J2JA 2DR5A 8ICOA 1MIVA 3LQCB 4NKTA 5J0PA 2BCUA 4RWQA 2DRAA 4WBYA 4F5NA 3HW8A 2Q66A 4XA5A 3HIYA 1JMSA 3V7KA 2ZH4A 4I2JA 4QZ8A 4KLOA 3PNCA 1ZQBA 9ICGA 1BPYA 5J2GA 3JYYA 2PFOA 4QZCA 3OVSA 9ICVA 8ICJA 4X0AA 4R64A 3AUOA 4M9LA 4NLZA 4M47A 5DEDA 1TV9A 4PHPA 3WFSC 4KLHA 1ZQKA 1Q78A 5J0TA 7ICMA 4PGYA 8ICLA 1TVAA 1BPXA 1OU5A 4IQUA 4RQ5A 4E8FA 4NXZA 5J0RA 3RJIA 5HHIA 3C2LA 9ICWA 1XSLA 4RPXA 4MFCA 1RZTA 4NKUA 4TUSA 7ICIA 8ICAA 1XSPA 4WC0A 4EP7A 2M2UA 8ICPA 2BCSA 2M2TA 4ATBA 1R8BA 5J0QA 4XQ8A 2W9MA 5J2HA 5DBBA 3WFRE 3HWTA 1R8AA 5BPCA 2FMPA 4IQTA 3PMNA 4I2GA 4RPYA 4WC2A 4M9HA 3MGIA 3HX0A 3OV7A 1ZQZA 7ICEA 1ZQHA 5HRIA 9ICOA 4F5QA 9ICBA 4O9MA
chains in the Genus database with same CATH superfamily
4X4OA 4TUPA 4JLXA 4MF8A 4OAFA 7ICFA 4QZGA 5DKWA 3JPSA 4PGQA 4GXIA 3WFPA 1MQ2A 5HC9A 1KNYA 4RWNA 1VJ7A 3JPQA 2DR9A 2BCVA 4M9GA 8ICUA 5CFUA 3K75D 5J2AA 4QZHA 2BCRA 1TFWA 4I0UA 9ICEA 4K99A 3NWIA 2BE3A 8ICCA 4X4SA 9ICXA 5D4BA 3ISBA 3H3AA 4NXUA 4LT6A 7ICLA 1UETA 4I2HA 7ICVA 8ICKA 4XJEA 4I27A 2ZH2A 5HRKA 4DOBA 4LVSA 4WBZA 1HUOA 1KDHA 4RQ8A 3UQ0A 3AU2A 5D63A 4WC1A 1BPEA 4RQ2A 4WC4A 4WC5A 4UBBA 5IINA 4FO6A 4M9NA 7ICSA 1MIWA 4GXJA 2PFNA 5IILA 4X4PA 4RQ1A 4PHAA 3H39A 4N7RA 1XSNA 4WOYA 1ZQUA 3JPRA 7ICKA 4I2BA 4UAYA 2BPCA 3C2KA 3WFQE 2GAFD 4RQ4A 1UEVA 1UEUA 1TFYA 3OGUA 4M04A 4I29A 1R89A 4KLGA 1ZQMA 5IIJA 4FHWA 5J2IA 4P2HA 4ATBB 4FHVA 2ZHAA 3HJ1A 4P4PA 3ER9B 4IG8A 4Z6CA 4X4TA 9ICJA 3JPPA 4K4IA 4MFFA 2ZH5A 4P4MA 4X5VA 1ZQWA 9ICSA 3UXOA 9ICUA 4FHPA 7ICNA 4KLEA 5B3PA 4JWMA 2DVIA 4AT7A 7ICPA 2M2VA 3ISCA 5D61A 3C18A 4TUQA 4UAWA 3JPOA 2FMSA 5J0SA 5DB9A 4LZGA 5DBCA 5DB8A 4P4OA 4NY8A 4KLJA 2ZH6A 4NLKA 4WC3A 2BPGA 2I9GA 5D49A 4X4RA 3AU6A 2ZH7A 4RQ7A 2ZH1A 9ICQA 4LEVA 4UD4A 5J0WA 1R8CA 4I2EA 4RWPA 1JQRA 1BPDA 5DBAA 9ICFA 5J0UA 3B0YA 3WFOA 2ZHBA 1PX5A 9ICLA 4X4QA 3RJHA 5D46A 4KLQA 1ZQJA 9ICHA 4R66A 5F2VO 5DDMA 3UPQA 4O69A 1ZQQA 4XRHA 3OVAA 1ZQLA 1V4AA 4QZFA 1ZQDA 4X0BA 2VANA 5CA7A 1NOMA 4NXVA 4I2DA 4KLFA 4JWNA 5DB7A 4LEWA 1RPLA 5CFSA 4XQ7A 3ISDA 1MQ3A 4PHEA 4R65A 5CHGA 4EGWA 4JLZA 4TURA 1ZJNA 3TFRA 4GXKA 2PXIA 4O5EA 1ZQAA 8ICGA 8ICZA 4QZEA 2PBEA 4PHDA 4LZDA 4KLMA 5CR0A 2DR8A 2M2WA 5BOLA 4WCWA 8ICIA 5HRGA 3V7JA 2EWRA 4K4GA 4EV6A 3RJJA 4M9JA 4YN4A 3ER8C 2BBHA 3C66A 3CK6A 1BPBA 4EBKA 5D62A 2GWSA 7ICTA 4RPZA 2ISOA 8ICFA 3C5FA 8ICSA 5IIKA 3MGHA 1ZQTA 5HR9A 1ZQNA 3JPTA 4RQ6A 3RJFA 2ID1A 5CP2A 1WOTA 3JZ0A 4MF2A 5J2CA 8ICVA 4AT7B 5DDYA 3H38A 4M0AA 4Z6DA 4K9AA 1ZQPA 5J2EA 5CWRA 4DOAA 7ICOA 1ZQYA 4S3NA 4OAGA 7ICHA 1ZQVA 5HRBA 8ICYA 3C5GA 3OUYB 2O5AA 2B4VA 3PHZA 1NO5A 4I28A 4E7XA 4KB6A 1ZJMA 9ICNA 4XUSA 5DB6A 2IHMA 4QZBA 3UQ2A 3LK9A 4FHXA 4PPXA 4X4UA 4NM1A 1HUZA 4YMOA 2PFPA 4NLNA 8ICHA 4LEYA 1ZQSA 4KLTA 9ICTA 2BCQA 2P66A 4FH5A 4RQ3A 4UB2A 4E80A 3GDXA 1F5AA 5CHEA 2HHPA 4MKPA 8ICXA 1MIYA 4FO1A 3UPSA 4K4HA 3AQKA 4QZDA 4O5KA 3MCRA 4FHYA 3RJKA 5B3QA 5J2KA 5J0OA 4DO9A 4RT2A 1VFGA 3OUYA 4MFAA 4R63A 5J0XA 9ICCA 4O68A 3UXPA 1YLQA 5J2FA 4AT8A 3B0XA 2ZH3A 4EEBA 4YMNA 8ICMA 3UXNA 4WQLA 4HX0A 4Z6EA 3MDAA 5BOMA 2BPFA 4F5RA 4YMMA 4KLLA 4FH3A 5HHHA 4KLUA 5HRFA 4O5CA 3NYBA 4UB4A 1JAJA 4LEZA 3AQMA 3RJGA 7ICJA 1BPZA 2HN2A 8ICEA 5HRHA 3MBYA 2IUBA 1ZQGA 3TFSA 3C2MA 4RQ0A 3RH5A 9ICAA 3RH4A 4WC7A 4NM2A 3JCFA 4M5DA 4I2FA 5IIOA 2B56A 5TZVA 5J0YA 4KLIA 4DOCA 9ICPA 4X4VA 4Z6FA 2ISPA 3RJEA 2O1PA 8ICWA 1FA0A 3EF2A 4WH5A 4UB5A 4I2IA 2DRBA 8ICNA 2DR7A 3PMLA 5IIIA 5J29A 3AQNA 4O6AA 3MDCA 8ICTA 4UB3A 4KLSA 4AT9B 4WC6A 3L9DA 4IQWA 3HJ4A 4UD5A 5CB1A 5J2DA 3AQLA 2PFQA 3ERCC 4K9BA 8ICBA 9ICIA 5DECA 4NXWA 1ZQXA 1KEJA 3RH6A 4KLDA 3H37A 7ICQA 4I2CA 4PH5A 7ICUA 4X4NA 1JN3A 4QZIA 2ZH8A 5HREA 2HN1A 4RT3A 4QZ9A 1ZQFA 7ICRA 1ZQCA 9ICRA 5HRDA 4O67A 4YD2A 4PGXA 3OVBA 4F5OA 3V7LA 4F5PA 7ICGA 2FMQA 4M2YA 5CJ7A 1ZQRA 3NVOA 1ZQOA 4RWOA 4QZAA 2RFFA 5EOZA 1Q79A 2BBJA 4KM5A 4AT9A 1ZQIA 4IQVA 4EBJA 3V72A 4UB1A 4UBCA 4I2AA 4K8VA 8ICQA 4YD1A 5J2BA 2ZH9A 5HRLA 9ICMA 3JPNA 2IHOA 4UAZA 4AT8B 9ICKA 5IIMA 8ICRA 2NRKA 4YCXA 1ZQEA 5J2JA 2DR5A 8ICOA 1MIVA 3LQCB 4NKTA 5J0PA 2BCUA 4RWQA 2DRAA 4WBYA 3K7DA 4F5NA 3HW8A 2Q66A 4XA5A 2B51A 3HIYA 1JMSA 3V7KA 2ZH4A 4I2JA 4QZ8A 4KLOA 3NKUA 3PNCA 1ZQBA 9ICGA 2FCLA 1BPYA 5J2GA 3JYYA 2PFOA 4WQKA 4QZCA 3OVSA 9ICVA 8ICJA 4X0AA 4R64A 3AUOA 5JTGA 4M9LA 4NLZA 4M47A 5DEDA 1TV9A 4PHPA 3WFSC 4KLHA 1ZQKA 1Q78A 5J0TA 7ICMA 4PGYA 4K98A 1TVAA 8ICLA 1BPXA 4NXTA 2GA9D 1OU5A 4IQUA 4RQ5A 4E8FA 4NXZA 5J0RA 3RJIA 5HHIA 3C2LA 9ICWA 1XSLA 4RPXA 4K96A 4MFCA 1RZTA 4NKUA 4TUSA 7ICIA 8ICAA 1XSPA 4OAHA 4EP7A 4WC0A 2M2UA 8ICPA 4EEDA 2BCSA 4ATBA 2M2TA 1R8BA 5J0QA 4XQ8A 2W9MA 5J2HA 5DBBA 3WFRE 3HWTA 1R8AA 5BPCA 2FMPA 4IQTA 4OAIZ 3PMNA 4I2GA 1GPJA 4RPYA 4WC2A 4M9HA 4NXXA 3MGIA 3HX0A 3OV7A 5CFTA 1ZQZA 7ICEA 1ZQHA 5HRIA 4K97A 3OWGA 9ICOA 4F5QA 9ICBA 4O9MA
chains in the Genus database with same CATH topology
4X4OA 4TUPA 4MF8A 7ICFA 4QZGA 5DKWA 3JPSA 4PGQA 4GXIA 3WFPA 1MQ2A 5HC9A 1KNYA 4RWNA 1VJ7A 3JPQA 2BCVA 2DR9A 4M9GA 8ICUA 3K75D 5J2AA 4QZHA 2BCRA 1TFWA 9ICEA 2BE3A 8ICCA 4X4SA 9ICXA 5D4BA 3ISBA 3H3AA 4LT6A 7ICLA 1UETA 4I2HA 7ICVA 8ICKA 4I27A 5HRKA 2ZH2A 4DOBA 4LVSA 4WBZA 1HUOA 1KDHA 4RQ8A 3UQ0A 3AU2A 4WC1A 1BPEA 4RQ2A 4WC4A 4WC5A 4UBBA 5IINA 4FO6A 4M9NA 7ICSA 1MIWA 4GXJA 2PFNA 5IILA 4X4PA 4RQ1A 4PHAA 3H39A 1XSNA 1ZQUA 3JPRA 7ICKA 4I2BA 4UAYA 2BPCA 3C2KA 3WFQE 4RQ4A 1UEVA 1UEUA 1TFYA 3OGUA 4M04A 4I29A 1R89A 4KLGA 1ZQMA 5IIJA 4FHWA 5J2IA 4P2HA 4ATBB 4FHVA 2ZHAA 3HJ1A 4P4PA 4IG8A 4Z6CA 4X4TA 9ICJA 3JPPA 4K4IA 4MFFA 2ZH5A 4P4MA 4X5VA 1ZQWA 9ICSA 3UXOA 9ICUA 4FHPA 7ICNA 4KLEA 4JWMA 2DVIA 4AT7A 7ICPA 2M2VA 3ISCA 3C18A 4TUQA 4UAWA 3JPOA 2FMSA 5J0SA 5DB9A 4LZGA 5DBCA 5DB8A 4P4OA 4NY8A 4KLJA 2ZH6A 4NLKA 4WC3A 2BPGA 2I9GA 5D49A 4X4RA 3AU6A 2ZH7A 4RQ7A 2ZH1A 9ICQA 4UD4A 5J0WA 1R8CA 4I2EA 4RWPA 1JQRA 1BPDA 5DBAA 9ICFA 5J0UA 3B0YA 3WFOA 2ZHBA 1PX5A 9ICLA 4X4QA 3RJHA 5D46A 4KLQA 1ZQJA 9ICHA 4R66A 5F2VO 5DDMA 3UPQA 1ZQQA 4XRHA 3OVAA 1ZQLA 1V4AA 4QZFA 1ZQDA 4X0BA 2VANA 5CA7A 1NOMA 4I2DA 4KLFA 4JWNA 5DB7A 1RPLA 4XQ7A 3ISDA 1MQ3A 4PHEA 4R65A 5CHGA 4TURA 1ZJNA 3TFRA 4GXKA 2PXIA 4O5EA 1ZQAA 8ICGA 8ICZA 4QZEA 2PBEA 4PHDA 4LZDA 4KLMA 5CR0A 2DR8A 2M2WA 5BOLA 4WCWA 8ICIA 5HRGA 3V7JA 4K4GA 3RJJA 4M9JA 4YN4A 3C66A 1BPBA 4EBKA 2GWSA 7ICTA 4RPZA 2ISOA 8ICFA 3C5FA 8ICSA 5IIKA 3MGHA 1ZQTA 5HR9A 1ZQNA 3JPTA 4RQ6A 3RJFA 2ID1A 5CP2A 1WOTA 3JZ0A 4MF2A 5J2CA 8ICVA 5DDYA 4AT7B 3H38A 4M0AA 4Z6DA 1ZQPA 5J2EA 5CWRA 4DOAA 7ICOA 1ZQYA 4S3NA 7ICHA 1ZQVA 5HRBA 8ICYA 3C5GA 3OUYB 2O5AA 1NO5A 4I28A 4E7XA 1ZJMA 9ICNA 4XUSA 5DB6A 2IHMA 4QZBA 3UQ2A 3LK9A 4FHXA 4PPXA 4X4UA 4NM1A 1HUZA 4YMOA 2PFPA 4NLNA 8ICHA 4KLTA 1ZQSA 9ICTA 2BCQA 2P66A 4FH5A 4RQ3A 4UB2A 4E80A 3GDXA 1F5AA 2HHPA 8ICXA 1MIYA 3UPSA 4K4HA 3AQKA 4QZDA 4O5KA 4FHYA 3RJKA 5J2KA 5J0OA 4DO9A 4RT2A 1VFGA 3OUYA 4MFAA 4R63A 5J0XA 9ICCA 3UXPA 1YLQA 5J2FA 3B0XA 4AT8A 2ZH3A 8ICMA 4YMNA 3UXNA 4Z6EA 3MDAA 5BOMA 2BPFA 4F5RA 4YMMA 4KLLA 4FH3A 5HHHA 4KLUA 5HRFA 4O5CA 3NYBA 4UB4A 1JAJA 3AQMA 3RJGA 7ICJA 1BPZA 8ICEA 5HRHA 3MBYA 1ZQGA 3TFSA 3C2MA 4RQ0A 3RH5A 9ICAA 3RH4A 4WC7A 4NM2A 4M5DA 4I2FA 5IIOA 5TZVA 5J0YA 4KLIA 9ICPA 4DOCA 4X4VA 4Z6FA 2ISPA 3RJEA 2O1PA 8ICWA 1FA0A 4UB5A 4I2IA 2DRBA 8ICNA 2DR7A 3PMLA 5IIIA 5J29A 3AQNA 3MDCA 8ICTA 4UB3A 4KLSA 4AT9B 4WC6A 3L9DA 4IQWA 3HJ4A 4UD5A 5CB1A 5J2DA 3AQLA 2PFQA 8ICBA 9ICIA 5DECA 1ZQXA 3RH6A 1KEJA 4KLDA 3H37A 7ICQA 4I2CA 4PH5A 7ICUA 4QZIA 1JN3A 4X4NA 2ZH8A 5HREA 4RT3A 4QZ9A 1ZQFA 7ICRA 1ZQCA 9ICRA 5HRDA 4YD2A 4PGXA 3OVBA 4F5OA 3V7LA 4F5PA 7ICGA 2FMQA 4M2YA 5CJ7A 1ZQRA 1ZQOA 4RWOA 4QZAA 2RFFA 5EOZA 1Q79A 4AT9A 1ZQIA 4IQVA 4EBJA 3V72A 4UB1A 4UBCA 4I2AA 8ICQA 4YD1A 5J2BA 5HRLA 2ZH9A 9ICMA 3JPNA 4UAZA 4AT8B 9ICKA 5IIMA 8ICRA 2NRKA 4YCXA 1ZQEA 5J2JA 2DR5A 8ICOA 1MIVA 3LQCB 4NKTA 5J0PA 2BCUA 4RWQA 2DRAA 4WBYA 4F5NA 3HW8A 2Q66A 4XA5A 3HIYA 1JMSA 3V7KA 2ZH4A 4I2JA 4QZ8A 4KLOA 3PNCA 1ZQBA 9ICGA 1BPYA 5J2GA 3JYYA 2PFOA 4QZCA 3OVSA 9ICVA 8ICJA 4X0AA 4R64A 3AUOA 4M9LA 4NLZA 4M47A 5DEDA 1TV9A 4PHPA 3WFSC 4KLHA 1ZQKA 1Q78A 5J0TA 7ICMA 4PGYA 8ICLA 1TVAA 1BPXA 1OU5A 4IQUA 4RQ5A 4E8FA 4NXZA 5J0RA 3RJIA 5HHIA 3C2LA 9ICWA 1XSLA 4RPXA 4MFCA 1RZTA 4NKUA 4TUSA 7ICIA 8ICAA 1XSPA 4WC0A 4EP7A 2M2UA 8ICPA 2BCSA 2M2TA 4ATBA 1R8BA 5J0QA 4XQ8A 2W9MA 5J2HA 5DBBA 3WFRE 3HWTA 1R8AA 5BPCA 2FMPA 4IQTA 3PMNA 4I2GA 4RPYA 4WC2A 4M9HA 3MGIA 3HX0A 3OV7A 1ZQZA 7ICEA 1ZQHA 5HRIA 9ICOA 4F5QA 9ICBA 4O9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4O A;  4TUP A;  4MF8 A;  7ICF A;  4QZG A;  5DKW A;  3JPS A;  4PGQ A;  4GXI A;  3WFP A;  1MQ2 A;  5HC9 A;  1KNY A;  4RWN A;  1VJ7 A;  3JPQ A;  2BCV A;  2DR9 A;  4M9G A;  8ICU A;  3K75 D;  5J2A A;  4QZH A;  2BCR A;  1TFW A;  9ICE A;  2BE3 A;  8ICC A;  4X4S A;  9ICX A;  5D4B A;  3ISB A;  3H3A A;  4LT6 A;  7ICL A;  1UET A;  4I2H A;  7ICV A;  8ICK A;  4I27 A;  5HRK A;  2ZH2 A;  4DOB A;  4LVS A;  4WBZ A;  1HUO A;  1KDH A;  4RQ8 A;  3UQ0 A;  3AU2 A;  4WC1 A;  1BPE A;  4RQ2 A;  4WC4 A;  4WC5 A;  4UBB A;  5IIN A;  4FO6 A;  4M9N A;  7ICS A;  1MIW A;  4GXJ A;  2PFN A;  5IIL A;  4X4P A;  4RQ1 A;  4PHA A;  3H39 A;  1XSN A;  1ZQU A;  3JPR A;  7ICK A;  4I2B A;  4UAY A;  2BPC A;  3C2K A;  3WFQ E;  4RQ4 A;  1UEV A;  1UEU A;  1TFY A;  3OGU A;  4M04 A;  4I29 A;  1R89 A;  4KLG A;  1ZQM A;  5IIJ A;  4FHW A;  5J2I A;  4P2H A;  4ATB B;  4FHV A;  2ZHA A;  3HJ1 A;  4P4P A;  4IG8 A;  4Z6C A;  4X4T A;  9ICJ A;  3JPP A;  4K4I A;  4MFF A;  2ZH5 A;  4P4M A;  4X5V A;  1ZQW A;  9ICS A;  3UXO A;  9ICU A;  4FHP A;  7ICN A;  4KLE A;  4JWM A;  2DVI A;  4AT7 A;  7ICP A;  2M2V A;  3ISC A;  3C18 A;  4TUQ A;  4UAW A;  3JPO A;  2FMS A;  5J0S A;  5DB9 A;  4LZG A;  5DBC A;  5DB8 A;  4P4O A;  4NY8 A;  4KLJ A;  2ZH6 A;  4NLK A;  4WC3 A;  2BPG A;  2I9G A;  5D49 A;  4X4R A;  3AU6 A;  2ZH7 A;  4RQ7 A;  2ZH1 A;  9ICQ A;  4UD4 A;  5J0W A;  1R8C A;  4I2E A;  4RWP A;  1JQR A;  1BPD A;  5DBA A;  9ICF A;  5J0U A;  3B0Y A;  3WFO A;  2ZHB A;  1PX5 A;  9ICL A;  4X4Q A;  3RJH A;  5D46 A;  4KLQ A;  1ZQJ A;  9ICH A;  4R66 A;  5F2V O;  5DDM A;  3UPQ A;  1ZQQ A;  4XRH A;  3OVA A;  1ZQL A;  1V4A A;  4QZF A;  1ZQD A;  4X0B A;  2VAN A;  5CA7 A;  1NOM A;  4I2D A;  4KLF A;  4JWN A;  5DB7 A;  1RPL A;  4XQ7 A;  3ISD A;  1MQ3 A;  4PHE A;  4R65 A;  5CHG A;  4TUR A;  1ZJN A;  3TFR A;  4GXK A;  2PXI A;  4O5E A;  1ZQA A;  8ICG A;  8ICZ A;  4QZE A;  2PBE A;  4PHD A;  4LZD A;  4KLM A;  5CR0 A;  2DR8 A;  2M2W A;  5BOL A;  4WCW A;  8ICI A;  5HRG A;  3V7J A;  4K4G A;  3RJJ A;  4M9J A;  4YN4 A;  3C66 A;  1BPB A;  4EBK A;  2GWS A;  7ICT A;  4RPZ A;  2ISO A;  8ICF A;  3C5F A;  8ICS A;  5IIK A;  3MGH A;  1ZQT A;  5HR9 A;  1ZQN A;  3JPT A;  4RQ6 A;  3RJF A;  2ID1 A;  5CP2 A;  1WOT A;  3JZ0 A;  4MF2 A;  5J2C A;  8ICV A;  5DDY A;  4AT7 B;  3H38 A;  4M0A A;  4Z6D A;  1ZQP A;  5J2E A;  5CWR A;  4DOA A;  7ICO A;  1ZQY A;  4S3N A;  7ICH A;  1ZQV A;  5HRB A;  8ICY A;  3C5G A;  3OUY B;  2O5A A;  1NO5 A;  4I28 A;  4E7X A;  1ZJM A;  9ICN A;  4XUS A;  5DB6 A;  2IHM A;  4QZB A;  3UQ2 A;  3LK9 A;  4FHX A;  4PPX A;  4X4U A;  4NM1 A;  1HUZ A;  4YMO A;  2PFP A;  4NLN A;  8ICH A;  4KLT A;  1ZQS A;  9ICT A;  2BCQ A;  2P66 A;  4FH5 A;  4RQ3 A;  4UB2 A;  4E80 A;  3GDX A;  1F5A A;  2HHP A;  8ICX A;  1MIY A;  3UPS A;  4K4H A;  3AQK A;  4QZD A;  4O5K A;  4FHY A;  3RJK A;  5J2K A;  5J0O A;  4DO9 A;  4RT2 A;  1VFG A;  3OUY A;  4MFA A;  4R63 A;  5J0X A;  9ICC A;  3UXP A;  1YLQ A;  5J2F A;  3B0X A;  4AT8 A;  2ZH3 A;  8ICM A;  4YMN A;  3UXN A;  4Z6E A;  3MDA A;  5BOM A;  2BPF A;  4F5R A;  4YMM A;  4KLL A;  4FH3 A;  5HHH A;  4KLU A;  5HRF A;  4O5C A;  3NYB A;  4UB4 A;  1JAJ A;  3AQM A;  3RJG A;  7ICJ A;  1BPZ A;  8ICE A;  5HRH A;  3MBY A;  1ZQG A;  3TFS A;  3C2M A;  4RQ0 A;  3RH5 A;  9ICA A;  3RH4 A;  4WC7 A;  4NM2 A;  4M5D A;  4I2F A;  5IIO A;  5TZV A;  5J0Y A;  4KLI A;  9ICP A;  4DOC A;  4X4V A;  4Z6F A;  2ISP A;  3RJE A;  2O1P A;  8ICW A;  1FA0 A;  4UB5 A;  4I2I A;  2DRB A;  8ICN A;  2DR7 A;  3PML A;  5III A;  5J29 A;  3AQN A;  3MDC A;  8ICT A;  4UB3 A;  4KLS A;  4AT9 B;  4WC6 A;  3L9D A;  4IQW A;  3HJ4 A;  4UD5 A;  5CB1 A;  5J2D A;  3AQL A;  2PFQ A;  8ICB A;  9ICI A;  5DEC A;  1ZQX A;  3RH6 A;  1KEJ A;  4KLD A;  3H37 A;  7ICQ A;  4I2C A;  4PH5 A;  7ICU A;  4QZI A;  1JN3 A;  4X4N A;  2ZH8 A;  5HRE A;  4RT3 A;  4QZ9 A;  1ZQF A;  7ICR A;  1ZQC A;  9ICR A;  5HRD A;  4YD2 A;  4PGX A;  3OVB A;  4F5O A;  3V7L A;  4F5P A;  7ICG A;  2FMQ A;  4M2Y A;  5CJ7 A;  1ZQR A;  1ZQO A;  4RWO A;  4QZA A;  2RFF A;  5EOZ A;  1Q79 A;  4AT9 A;  1ZQI A;  4IQV A;  4EBJ A;  3V72 A;  4UB1 A;  4UBC A;  4I2A A;  8ICQ A;  4YD1 A;  5J2B A;  5HRL A;  2ZH9 A;  9ICM A;  3JPN A;  4UAZ A;  4AT8 B;  9ICK A;  5IIM A;  8ICR A;  2NRK A;  4YCX A;  1ZQE A;  5J2J A;  2DR5 A;  8ICO A;  1MIV A;  3LQC B;  4NKT A;  5J0P A;  2BCU A;  4RWQ A;  2DRA A;  4WBY A;  4F5N A;  3HW8 A;  2Q66 A;  4XA5 A;  3HIY A;  1JMS A;  3V7K A;  2ZH4 A;  4I2J A;  4QZ8 A;  4KLO A;  3PNC A;  1ZQB A;  9ICG A;  1BPY A;  5J2G A;  3JYY A;  2PFO A;  4QZC A;  3OVS A;  9ICV A;  8ICJ A;  4X0A A;  4R64 A;  3AUO A;  4M9L A;  4NLZ A;  4M47 A;  5DED A;  1TV9 A;  4PHP A;  3WFS C;  4KLH A;  1ZQK A;  1Q78 A;  5J0T A;  7ICM A;  4PGY A;  8ICL A;  1TVA A;  1BPX A;  1OU5 A;  4IQU A;  4RQ5 A;  4E8F A;  4NXZ A;  5J0R A;  3RJI A;  5HHI A;  3C2L A;  9ICW A;  1XSL A;  4RPX A;  4MFC A;  1RZT A;  4NKU A;  4TUS A;  7ICI A;  8ICA A;  1XSP A;  4WC0 A;  4EP7 A;  2M2U A;  8ICP A;  2BCS A;  2M2T A;  4ATB A;  1R8B A;  5J0Q A;  4XQ8 A;  2W9M A;  5J2H A;  5DBB A;  3WFR E;  3HWT A;  1R8A A;  5BPC A;  2FMP A;  4IQT A;  3PMN A;  4I2G A;  4RPY A;  4WC2 A;  4M9H A;  3MGI A;  3HX0 A;  3OV7 A;  1ZQZ A;  7ICE A;  1ZQH A;  5HRI A;  9ICO A;  4F5Q A;  9ICB A;  4O9M A; 
#chains in the Genus database with same CATH topology
 4X4O A;  4TUP A;  4JLX A;  4MF8 A;  4OAF A;  7ICF A;  4QZG A;  5DKW A;  3JPS A;  4PGQ A;  4GXI A;  3WFP A;  1MQ2 A;  5HC9 A;  1KNY A;  4RWN A;  1VJ7 A;  3JPQ A;  2DR9 A;  2BCV A;  4M9G A;  8ICU A;  5CFU A;  3K75 D;  5J2A A;  4QZH A;  2BCR A;  1TFW A;  4I0U A;  9ICE A;  4K99 A;  3NWI A;  2BE3 A;  8ICC A;  4X4S A;  9ICX A;  5D4B A;  3ISB A;  3H3A A;  4NXU A;  4LT6 A;  7ICL A;  1UET A;  4I2H A;  7ICV A;  8ICK A;  4XJE A;  4I27 A;  2ZH2 A;  5HRK A;  4DOB A;  4LVS A;  4WBZ A;  1HUO A;  1KDH A;  4RQ8 A;  3UQ0 A;  3AU2 A;  5D63 A;  4WC1 A;  1BPE A;  4RQ2 A;  4WC4 A;  4WC5 A;  4UBB A;  5IIN A;  4FO6 A;  4M9N A;  7ICS A;  1MIW A;  4GXJ A;  2PFN A;  5IIL A;  4X4P A;  4RQ1 A;  4PHA A;  3H39 A;  4N7R A;  1XSN A;  4WOY A;  1ZQU A;  3JPR A;  7ICK A;  4I2B A;  4UAY A;  2BPC A;  3C2K A;  3WFQ E;  2GAF D;  4RQ4 A;  1UEV A;  1UEU A;  1TFY A;  3OGU A;  4M04 A;  4I29 A;  1R89 A;  4KLG A;  1ZQM A;  5IIJ A;  4FHW A;  5J2I A;  4P2H A;  4ATB B;  4FHV A;  2ZHA A;  3HJ1 A;  4P4P A;  3ER9 B;  4IG8 A;  4Z6C A;  4X4T A;  9ICJ A;  3JPP A;  4K4I A;  4MFF A;  2ZH5 A;  4P4M A;  4X5V A;  1ZQW A;  9ICS A;  3UXO A;  9ICU A;  4FHP A;  7ICN A;  4KLE A;  5B3P A;  4JWM A;  2DVI A;  4AT7 A;  7ICP A;  2M2V A;  3ISC A;  5D61 A;  3C18 A;  4TUQ A;  4UAW A;  3JPO A;  2FMS A;  5J0S A;  5DB9 A;  4LZG A;  5DBC A;  5DB8 A;  4P4O A;  4NY8 A;  4KLJ A;  2ZH6 A;  4NLK A;  4WC3 A;  2BPG A;  2I9G A;  5D49 A;  4X4R A;  3AU6 A;  2ZH7 A;  4RQ7 A;  2ZH1 A;  9ICQ A;  4LEV A;  4UD4 A;  5J0W A;  1R8C A;  4I2E A;  4RWP A;  1JQR A;  1BPD A;  5DBA A;  9ICF A;  5J0U A;  3B0Y A;  3WFO A;  2ZHB A;  1PX5 A;  9ICL A;  4X4Q A;  3RJH A;  5D46 A;  4KLQ A;  1ZQJ A;  9ICH A;  4R66 A;  5F2V O;  5DDM A;  3UPQ A;  4O69 A;  1ZQQ A;  4XRH A;  3OVA A;  1ZQL A;  1V4A A;  4QZF A;  1ZQD A;  4X0B A;  2VAN A;  5CA7 A;  1NOM A;  4NXV A;  4I2D A;  4KLF A;  4JWN A;  5DB7 A;  4LEW A;  1RPL A;  5CFS A;  4XQ7 A;  3ISD A;  1MQ3 A;  4PHE A;  4R65 A;  5CHG A;  4EGW A;  4JLZ A;  4TUR A;  1ZJN A;  3TFR A;  4GXK A;  2PXI A;  4O5E A;  1ZQA A;  8ICG A;  8ICZ A;  4QZE A;  2PBE A;  4PHD A;  4LZD A;  4KLM A;  5CR0 A;  2DR8 A;  2M2W A;  5BOL A;  4WCW A;  8ICI A;  5HRG A;  3V7J A;  2EWR A;  4K4G A;  4EV6 A;  3RJJ A;  4M9J A;  4YN4 A;  3ER8 C;  2BBH A;  3C66 A;  3CK6 A;  1BPB A;  4EBK A;  5D62 A;  2GWS A;  7ICT A;  4RPZ A;  2ISO A;  8ICF A;  3C5F A;  8ICS A;  5IIK A;  3MGH A;  1ZQT A;  5HR9 A;  1ZQN A;  3JPT A;  4RQ6 A;  3RJF A;  2ID1 A;  5CP2 A;  1WOT A;  3JZ0 A;  4MF2 A;  5J2C A;  8ICV A;  4AT7 B;  5DDY A;  3H38 A;  4M0A A;  4Z6D A;  4K9A A;  1ZQP A;  5J2E A;  5CWR A;  4DOA A;  7ICO A;  1ZQY A;  4S3N A;  4OAG A;  7ICH A;  1ZQV A;  5HRB A;  8ICY A;  3C5G A;  3OUY B;  2O5A A;  2B4V A;  3PHZ A;  1NO5 A;  4I28 A;  4E7X A;  4KB6 A;  1ZJM A;  9ICN A;  4XUS A;  5DB6 A;  2IHM A;  4QZB A;  3UQ2 A;  3LK9 A;  4FHX A;  4PPX A;  4X4U A;  4NM1 A;  1HUZ A;  4YMO A;  2PFP A;  4NLN A;  8ICH A;  4LEY A;  1ZQS A;  4KLT A;  9ICT A;  2BCQ A;  2P66 A;  4FH5 A;  4RQ3 A;  4UB2 A;  4E80 A;  3GDX A;  1F5A A;  5CHE A;  2HHP A;  4MKP A;  8ICX A;  1MIY A;  4FO1 A;  3UPS A;  4K4H A;  3AQK A;  4QZD A;  4O5K A;  3MCR A;  4FHY A;  3RJK A;  5B3Q A;  5J2K A;  5J0O A;  4DO9 A;  4RT2 A;  1VFG A;  3OUY A;  4MFA A;  4R63 A;  5J0X A;  9ICC A;  4O68 A;  3UXP A;  1YLQ A;  5J2F A;  4AT8 A;  3B0X A;  2ZH3 A;  4EEB A;  4YMN A;  8ICM A;  3UXN A;  4WQL A;  4HX0 A;  4Z6E A;  3MDA A;  5BOM A;  2BPF A;  4F5R A;  4YMM A;  4KLL A;  4FH3 A;  5HHH A;  4KLU A;  5HRF A;  4O5C A;  3NYB A;  4UB4 A;  1JAJ A;  4LEZ A;  3AQM A;  3RJG A;  7ICJ A;  1BPZ A;  2HN2 A;  8ICE A;  5HRH A;  3MBY A;  2IUB A;  1ZQG A;  3TFS A;  3C2M A;  4RQ0 A;  3RH5 A;  9ICA A;  3RH4 A;  4WC7 A;  4NM2 A;  3JCF A;  4M5D A;  4I2F A;  5IIO A;  2B56 A;  5TZV A;  5J0Y A;  4KLI A;  4DOC A;  9ICP A;  4X4V A;  4Z6F A;  2ISP A;  3RJE A;  2O1P A;  8ICW A;  1FA0 A;  3EF2 A;  4WH5 A;  4UB5 A;  4I2I A;  2DRB A;  8ICN A;  2DR7 A;  3PML A;  5III A;  5J29 A;  3AQN A;  4O6A A;  3MDC A;  8ICT A;  4UB3 A;  4KLS A;  4AT9 B;  4WC6 A;  3L9D A;  4IQW A;  3HJ4 A;  4UD5 A;  5CB1 A;  5J2D A;  3AQL A;  2PFQ A;  3ERC C;  4K9B A;  8ICB A;  9ICI A;  5DEC A;  4NXW A;  1ZQX A;  1KEJ A;  3RH6 A;  4KLD A;  3H37 A;  7ICQ A;  4I2C A;  4PH5 A;  7ICU A;  4X4N A;  1JN3 A;  4QZI A;  2ZH8 A;  5HRE A;  2HN1 A;  4RT3 A;  4QZ9 A;  1ZQF A;  7ICR A;  1ZQC A;  9ICR A;  5HRD A;  4O67 A;  4YD2 A;  4PGX A;  3OVB A;  4F5O A;  3V7L A;  4F5P A;  7ICG A;  2FMQ A;  4M2Y A;  5CJ7 A;  1ZQR A;  3NVO A;  1ZQO A;  4RWO A;  4QZA A;  2RFF A;  5EOZ A;  1Q79 A;  2BBJ A;  4KM5 A;  4AT9 A;  1ZQI A;  4IQV A;  4EBJ A;  3V72 A;  4UB1 A;  4UBC A;  4I2A A;  4K8V A;  8ICQ A;  4YD1 A;  5J2B A;  2ZH9 A;  5HRL A;  9ICM A;  3JPN A;  2IHO A;  4UAZ A;  4AT8 B;  9ICK A;  5IIM A;  8ICR A;  2NRK A;  4YCX A;  1ZQE A;  5J2J A;  2DR5 A;  8ICO A;  1MIV A;  3LQC B;  4NKT A;  5J0P A;  2BCU A;  4RWQ A;  2DRA A;  4WBY A;  3K7D A;  4F5N A;  3HW8 A;  2Q66 A;  4XA5 A;  2B51 A;  3HIY A;  1JMS A;  3V7K A;  2ZH4 A;  4I2J A;  4QZ8 A;  4KLO A;  3NKU A;  3PNC A;  1ZQB A;  9ICG A;  2FCL A;  1BPY A;  5J2G A;  3JYY A;  2PFO A;  4WQK A;  4QZC A;  3OVS A;  9ICV A;  8ICJ A;  4X0A A;  4R64 A;  3AUO A;  5JTG A;  4M9L A;  4NLZ A;  4M47 A;  5DED A;  1TV9 A;  4PHP A;  3WFS C;  4KLH A;  1ZQK A;  1Q78 A;  5J0T A;  7ICM A;  4PGY A;  4K98 A;  1TVA A;  8ICL A;  1BPX A;  4NXT A;  2GA9 D;  1OU5 A;  4IQU A;  4RQ5 A;  4E8F A;  4NXZ A;  5J0R A;  3RJI A;  5HHI A;  3C2L A;  9ICW A;  1XSL A;  4RPX A;  4K96 A;  4MFC A;  1RZT A;  4NKU A;  4TUS A;  7ICI A;  8ICA A;  1XSP A;  4OAH A;  4EP7 A;  4WC0 A;  2M2U A;  8ICP A;  4EED A;  2BCS A;  4ATB A;  2M2T A;  1R8B A;  5J0Q A;  4XQ8 A;  2W9M A;  5J2H A;  5DBB A;  3WFR E;  3HWT A;  1R8A A;  5BPC A;  2FMP A;  4IQT A;  4OAI Z;  3PMN A;  4I2G A;  1GPJ A;  4RPY A;  4WC2 A;  4M9H A;  4NXX A;  3MGI A;  3HX0 A;  3OV7 A;  5CFT A;  1ZQZ A;  7ICE A;  1ZQH A;  5HRI A;  4K97 A;  3OWG A;  9ICO A;  4F5Q A;  9ICB A;  4O9M A; 
#chains in the Genus database with same CATH homology
 4X4O A;  4TUP A;  4MF8 A;  7ICF A;  4QZG A;  5DKW A;  3JPS A;  4PGQ A;  4GXI A;  3WFP A;  1MQ2 A;  5HC9 A;  1KNY A;  4RWN A;  1VJ7 A;  3JPQ A;  2BCV A;  2DR9 A;  4M9G A;  8ICU A;  3K75 D;  5J2A A;  4QZH A;  2BCR A;  1TFW A;  9ICE A;  2BE3 A;  8ICC A;  4X4S A;  9ICX A;  5D4B A;  3ISB A;  3H3A A;  4LT6 A;  7ICL A;  1UET A;  4I2H A;  7ICV A;  8ICK A;  4I27 A;  5HRK A;  2ZH2 A;  4DOB A;  4LVS A;  4WBZ A;  1HUO A;  1KDH A;  4RQ8 A;  3UQ0 A;  3AU2 A;  4WC1 A;  1BPE A;  4RQ2 A;  4WC4 A;  4WC5 A;  4UBB A;  5IIN A;  4FO6 A;  4M9N A;  7ICS A;  1MIW A;  4GXJ A;  2PFN A;  5IIL A;  4X4P A;  4RQ1 A;  4PHA A;  3H39 A;  1XSN A;  1ZQU A;  3JPR A;  7ICK A;  4I2B A;  4UAY A;  2BPC A;  3C2K A;  3WFQ E;  4RQ4 A;  1UEV A;  1UEU A;  1TFY A;  3OGU A;  4M04 A;  4I29 A;  1R89 A;  4KLG A;  1ZQM A;  5IIJ A;  4FHW A;  5J2I A;  4P2H A;  4ATB B;  4FHV A;  2ZHA A;  3HJ1 A;  4P4P A;  4IG8 A;  4Z6C A;  4X4T A;  9ICJ A;  3JPP A;  4K4I A;  4MFF A;  2ZH5 A;  4P4M A;  4X5V A;  1ZQW A;  9ICS A;  3UXO A;  9ICU A;  4FHP A;  7ICN A;  4KLE A;  4JWM A;  2DVI A;  4AT7 A;  7ICP A;  2M2V A;  3ISC A;  3C18 A;  4TUQ A;  4UAW A;  3JPO A;  2FMS A;  5J0S A;  5DB9 A;  4LZG A;  5DBC A;  5DB8 A;  4P4O A;  4NY8 A;  4KLJ A;  2ZH6 A;  4NLK A;  4WC3 A;  2BPG A;  2I9G A;  5D49 A;  4X4R A;  3AU6 A;  2ZH7 A;  4RQ7 A;  2ZH1 A;  9ICQ A;  4UD4 A;  5J0W A;  1R8C A;  4I2E A;  4RWP A;  1JQR A;  1BPD A;  5DBA A;  9ICF A;  5J0U A;  3B0Y A;  3WFO A;  2ZHB A;  1PX5 A;  9ICL A;  4X4Q A;  3RJH A;  5D46 A;  4KLQ A;  1ZQJ A;  9ICH A;  4R66 A;  5F2V O;  5DDM A;  3UPQ A;  1ZQQ A;  4XRH A;  3OVA A;  1ZQL A;  1V4A A;  4QZF A;  1ZQD A;  4X0B A;  2VAN A;  5CA7 A;  1NOM A;  4I2D A;  4KLF A;  4JWN A;  5DB7 A;  1RPL A;  4XQ7 A;  3ISD A;  1MQ3 A;  4PHE A;  4R65 A;  5CHG A;  4TUR A;  1ZJN A;  3TFR A;  4GXK A;  2PXI A;  4O5E A;  1ZQA A;  8ICG A;  8ICZ A;  4QZE A;  2PBE A;  4PHD A;  4LZD A;  4KLM A;  5CR0 A;  2DR8 A;  2M2W A;  5BOL A;  4WCW A;  8ICI A;  5HRG A;  3V7J A;  4K4G A;  3RJJ A;  4M9J A;  4YN4 A;  3C66 A;  1BPB A;  4EBK A;  2GWS A;  7ICT A;  4RPZ A;  2ISO A;  8ICF A;  3C5F A;  8ICS A;  5IIK A;  3MGH A;  1ZQT A;  5HR9 A;  1ZQN A;  3JPT A;  4RQ6 A;  3RJF A;  2ID1 A;  5CP2 A;  1WOT A;  3JZ0 A;  4MF2 A;  5J2C A;  8ICV A;  5DDY A;  4AT7 B;  3H38 A;  4M0A A;  4Z6D A;  1ZQP A;  5J2E A;  5CWR A;  4DOA A;  7ICO A;  1ZQY A;  4S3N A;  7ICH A;  1ZQV A;  5HRB A;  8ICY A;  3C5G A;  3OUY B;  2O5A A;  1NO5 A;  4I28 A;  4E7X A;  1ZJM A;  9ICN A;  4XUS A;  5DB6 A;  2IHM A;  4QZB A;  3UQ2 A;  3LK9 A;  4FHX A;  4PPX A;  4X4U A;  4NM1 A;  1HUZ A;  4YMO A;  2PFP A;  4NLN A;  8ICH A;  4KLT A;  1ZQS A;  9ICT A;  2BCQ A;  2P66 A;  4FH5 A;  4RQ3 A;  4UB2 A;  4E80 A;  3GDX A;  1F5A A;  2HHP A;  8ICX A;  1MIY A;  3UPS A;  4K4H A;  3AQK A;  4QZD A;  4O5K A;  4FHY A;  3RJK A;  5J2K A;  5J0O A;  4DO9 A;  4RT2 A;  1VFG A;  3OUY A;  4MFA A;  4R63 A;  5J0X A;  9ICC A;  3UXP A;  1YLQ A;  5J2F A;  3B0X A;  4AT8 A;  2ZH3 A;  8ICM A;  4YMN A;  3UXN A;  4Z6E A;  3MDA A;  5BOM A;  2BPF A;  4F5R A;  4YMM A;  4KLL A;  4FH3 A;  5HHH A;  4KLU A;  5HRF A;  4O5C A;  3NYB A;  4UB4 A;  1JAJ A;  3AQM A;  3RJG A;  7ICJ A;  1BPZ A;  8ICE A;  5HRH A;  3MBY A;  1ZQG A;  3TFS A;  3C2M A;  4RQ0 A;  3RH5 A;  9ICA A;  3RH4 A;  4WC7 A;  4NM2 A;  4M5D A;  4I2F A;  5IIO A;  5TZV A;  5J0Y A;  4KLI A;  9ICP A;  4DOC A;  4X4V A;  4Z6F A;  2ISP A;  3RJE A;  2O1P A;  8ICW A;  1FA0 A;  4UB5 A;  4I2I A;  2DRB A;  8ICN A;  2DR7 A;  3PML A;  5III A;  5J29 A;  3AQN A;  3MDC A;  8ICT A;  4UB3 A;  4KLS A;  4AT9 B;  4WC6 A;  3L9D A;  4IQW A;  3HJ4 A;  4UD5 A;  5CB1 A;  5J2D A;  3AQL A;  2PFQ A;  8ICB A;  9ICI A;  5DEC A;  1ZQX A;  3RH6 A;  1KEJ A;  4KLD A;  3H37 A;  7ICQ A;  4I2C A;  4PH5 A;  7ICU A;  4QZI A;  1JN3 A;  4X4N A;  2ZH8 A;  5HRE A;  4RT3 A;  4QZ9 A;  1ZQF A;  7ICR A;  1ZQC A;  9ICR A;  5HRD A;  4YD2 A;  4PGX A;  3OVB A;  4F5O A;  3V7L A;  4F5P A;  7ICG A;  2FMQ A;  4M2Y A;  5CJ7 A;  1ZQR A;  1ZQO A;  4RWO A;  4QZA A;  2RFF A;  5EOZ A;  1Q79 A;  4AT9 A;  1ZQI A;  4IQV A;  4EBJ A;  3V72 A;  4UB1 A;  4UBC A;  4I2A A;  8ICQ A;  4YD1 A;  5J2B A;  5HRL A;  2ZH9 A;  9ICM A;  3JPN A;  4UAZ A;  4AT8 B;  9ICK A;  5IIM A;  8ICR A;  2NRK A;  4YCX A;  1ZQE A;  5J2J A;  2DR5 A;  8ICO A;  1MIV A;  3LQC B;  4NKT A;  5J0P A;  2BCU A;  4RWQ A;  2DRA A;  4WBY A;  4F5N A;  3HW8 A;  2Q66 A;  4XA5 A;  3HIY A;  1JMS A;  3V7K A;  2ZH4 A;  4I2J A;  4QZ8 A;  4KLO A;  3PNC A;  1ZQB A;  9ICG A;  1BPY A;  5J2G A;  3JYY A;  2PFO A;  4QZC A;  3OVS A;  9ICV A;  8ICJ A;  4X0A A;  4R64 A;  3AUO A;  4M9L A;  4NLZ A;  4M47 A;  5DED A;  1TV9 A;  4PHP A;  3WFS C;  4KLH A;  1ZQK A;  1Q78 A;  5J0T A;  7ICM A;  4PGY A;  8ICL A;  1TVA A;  1BPX A;  1OU5 A;  4IQU A;  4RQ5 A;  4E8F A;  4NXZ A;  5J0R A;  3RJI A;  5HHI A;  3C2L A;  9ICW A;  1XSL A;  4RPX A;  4MFC A;  1RZT A;  4NKU A;  4TUS A;  7ICI A;  8ICA A;  1XSP A;  4WC0 A;  4EP7 A;  2M2U A;  8ICP A;  2BCS A;  2M2T A;  4ATB A;  1R8B A;  5J0Q A;  4XQ8 A;  2W9M A;  5J2H A;  5DBB A;  3WFR E;  3HWT A;  1R8A A;  5BPC A;  2FMP A;  4IQT A;  3PMN A;  4I2G A;  4RPY A;  4WC2 A;  4M9H A;  3MGI A;  3HX0 A;  3OV7 A;  1ZQZ A;  7ICE A;  1ZQH A;  5HRI A;  9ICO A;  4F5Q A;  9ICB A;  4O9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...