4IG8A

Structural basis for cytosolic double-stranded rna surveillance by human oas1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
344
structure length
338
Chain Sequence
DLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-5'-oligoadenylate synthase 1
publication title Structural basis for cytosolic double-stranded RNA surveillance by human oligoadenylate synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 107
structure length 338
sequence length 344
ec nomenclature ec 2.7.7.84: 2'-5' oligoadenylate synthase.
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.20 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain 2'-5'-oligoadenylate synthetase 1, domain 2 4ig8A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ig8A01
4Z6DA 4RPXA 2HHPA 5HRLA 4Z6FA 1XSPA 9ICJA 8ICZA 3V7LA 3TFSA 4RWQA 3C66A 1MIYA 5DDYA 4QZ9A 1ZQSA 3RJEA 4X4PA 1BPZA 8ICMA 3MBYA 1TFWA 7ICPA 1BPEA 9ICXA 9ICFA 1ZQYA 4UD5A 4X4QA 4RWNA 1ZQUA 3RH4A 4PHDA 7ICLA 8ICSA 3C2KA 9ICGA 4JWNA 4TUQA 4FHPA 1HUZA 5J2KA 5IIMA 4AT9A 3C18A 4M9NA 4O5KA 4E80A 2FMSA 3OVSA 5J2CA 8ICFA 4I2DA 4UBCA 4WC4A 2PXIA 3V7KA 4KLOA 4ATBA 4I2HA 2BPFA 3LK9A 2IHMA 1VFGA 4PHEA 4MFAA 4EBJA 1R8AA 2ZH2A 3HJ4A 4XQ8A 1ZQKA 4RPYA 8ICYA 4KLLA 8ICJA 4PH5A 2ZH3A 4RQ0A 4Z6EA 3JPRA 4QZ8A 4RQ7A 2FMPA 4IQWA 3C5GA 4P4MA 4P4OA 1JMSA 3JYYA 4R66A 4PPXA 2PFOA 5DB8A 4IQVA 2NRKA 5HR9A 4AT8B 4KLUA 2ZH6A 1JN3A 7ICQA 4P2HA 5BOMA 4M47A 4R63A 4M9JA 9ICSA 4AT7B 4LZDA 4FHVA 5J0TA 5IIIA 1UEUA 5HRGA 4WC3A 4X4UA 4X4RA 1NO5A 3JPOA 1NOMA 9ICMA 3JPSA 5J2AA 9ICVA 5DKWA 5DB9A 1ZQNA 1YLQA 4IG8A 4M5DA 5IINA 3RJKA 3ISDA 5J2DA 4RQ1A 2DR5A 3NYBA 1HUOA 4DOAA 2VANA 5EOZA 3JPQA 1ZJNA 4PHPA 4UB3A 4QZAA 4RWPA 8ICNA 4K4HA 4UAZA 1Q78A 2BE3A 4I2FA 4I2GA 4AT9B 4UB1A 1ZQTA 4M04A 4M9LA 7ICKA 5J2GA 7ICEA 3OGUA 3HWTA 9ICHA 8ICLA 5J0SA 5CA7A 2BPCA 4K4GA 5CR0A 8ICQA 4NKTA 4ATBB 4M9GA 4MFFA 1TFYA 5D49A 3HIYA 4QZHA 5HC9A 1ZQXA 1XSLA 4F5PA 2DR8A 3AQNA 4RT3A 1JQRA 3C2MA 4F5NA 3JPTA 4M2YA 8ICUA 2BCQA 4GXJA 5HRBA 2P66A 4KLGA 4I2EA 4WC2A 9ICWA 3JPPA 1ZQWA 4RPZA 3MGHA 4DOBA 3AQLA 8ICOA 4TURA 4O9MA 5J0WA 7ICIA 1ZQPA 4QZGA 3K75D 3PMNA 1BPYA 5HHIA 1ZQQA 7ICMA 4UB2A 4UB4A 2BCUA 4I2IA 4I27A 4X4VA 2PFNA 3AU2A 1RZTA 9ICNA 4F5QA 1V4AA 5D46A 4FH3A 1ZJMA 1OU5A 8ICCA 5TZVA 5J0RA 3V7JA 2GWSA 2Q66A 4XQ7A 3AQMA 1ZQVA 4P4PA 3WFOA 1UETA 3MDAA 2ISPA 3PMLA 3H38A 8ICTA 4RQ2A 4UB5A 5CP2A 3H3AA 5D4BA 1Q79A 2ID1A 5J2EA 3HJ1A 3JPNA 4EBKA 7ICHA 5J2FA 2BPGA 4KLTA 3AQKA 4GXIA 5HRHA 1ZQCA 3UPSA 3GDXA 7ICSA 2DRAA 1F5AA 5DBCA 5J0OA 2PFQA 1RPLA 4NM2A 8ICRA 4UBBA 2O1PA 4QZBA 3UXNA 8ICIA 2ZHAA 4X4OA 4UAYA 1MQ3A 4YMMA 4NM1A 3B0XA 1BPBA 4QZCA 4WC6A 4EP7A 4YN4A 4RQ8A 4R64A 1MQ2A 3LQCB 3RJJA 9ICBA 9ICPA 7ICVA 1ZQBA 5HRKA 2DRBA 8ICXA 2M2UA 1ZQLA 2DR9A 3UQ0A 2I9GA 1ZQEA 4YMOA 5IILA 4RQ6A 2M2WA 4KLHA 3JZ0A 7ICFA 4RQ5A 3PNCA 4Z6CA 4X5VA 5J29A 2PBEA 5DB6A 4QZIA 3MGIA 2ZH9A 4KLEA 3WFSC 8ICHA 9ICLA 5HRFA 4I2AA 4I28A 9ICCA 5DBAA 5J0PA 4KLSA 4FHYA 5DB7A 3L9DA 5F2VO 3WFQE 1JAJA 5CHGA 3OVBA 1UEVA 4WC1A 4KLIA 4WC0A 4WBYA 4NXZA 3HX0A 4FH5A 2BCRA 4NLNA 1ZQRA 5DEDA 2M2VA 4WC7A 8ICKA 5J0YA 8ICWA 4KLDA 5BOLA 3ISBA 4XA5A 4PHAA 4I29A 4FHWA 5J0UA 8ICGA 4RT2A 3OV7A 2O5AA 9ICKA 1KNYA 4DOCA 4RWOA 4TUPA 3UQ2A 4JWMA 9ICTA 4IQTA 2ZH5A 5HHHA 4KLQA 4KLJA 9ICQA 4E7XA 3V72A 4UD4A 4KLMA 4TUSA 3RJFA 4WCWA 4X4SA 4X0BA 3TFRA 7ICRA 5HRIA 4PGXA 1TVAA 2PFPA 4O5EA 4XRHA 4E8FA 1MIVA 1PX5A 1ZQDA 4I2CA 8ICBA 1VJ7A 5J2JA 4FHXA 8ICVA 5IIKA 4KLFA 7ICUA 3ISCA 7ICOA 4LT6A 4QZEA 3C5FA 3OUYA 5IIOA 4NY8A 1FA0A 2ZH4A 1ZQGA 8ICPA 7ICTA 7ICGA 1ZQAA 5CWRA 2DVIA 5HREA 1ZQHA 9ICAA 2BCVA 3UXOA 3WFPA 2FMQA 4QZDA 3AU6A 1ZQMA 1XSNA 4YMNA 4PGYA 3WFRE 4X4TA 4F5OA 3UXPA 1R8BA 2ZH7A 5DBBA 4RQ3A 3RJHA 1BPDA 5CB1A 3H39A 4GXKA 3RJIA 4LVSA 1TV9A 1WOTA 2RFFA 3UPQA 9ICOA 4YCXA 9ICIA 1R8CA 1BPXA 4R65A 4O5CA 4FO6A 2ISOA 4X4NA 3B0YA 4WBZA 4NLKA 4NKUA 2ZH1A 5J0QA 1ZQIA 4S3NA 9ICRA 2M2TA 9ICEA 4F5RA 3H37A 3RH6A 8ICEA 4RQ4A 4X0AA 4DO9A 8ICAA 1MIWA 4M0AA 3RJGA 4M9HA 4LZGA 1ZQZA 5BPCA 4MF2A 4NLZA 4K4IA 9ICUA 4PGQA 5IIJA 4UAWA 5HRDA 5J2IA 3AUOA 4MF8A 4IQUA 7ICJA 2ZH8A 1ZQFA 3C2LA 3RH5A 3HW8A 4YD2A 3MDCA 2BCSA 3OUYB 2ZHBA 5DDMA 4YD1A 5J2HA 7ICNA 5J0XA 4I2JA 1ZQJA 2DR7A 5J2BA 5CJ7A 5DECA 4AT8A 4MFCA 1KDHA 3OVAA 2W9MA 4QZFA 4XUSA 1KEJA 4AT7A 1ZQOA 4WC5A 1R89A 4I2BA
chains in the Genus database with same CATH superfamily
4Z6DA 4RPXA 2HHPA 5HRLA 4Z6FA 1XSPA 2GAFD 9ICJA 8ICZA 3V7LA 3TFSA 3C66A 4RWQA 1MIYA 5DDYA 4QZ9A 1ZQSA 3RJEA 4X4PA 1BPZA 8ICMA 1TFWA 3MBYA 7ICPA 1BPEA 4OAHA 9ICXA 9ICFA 4UD5A 1ZQYA 4X4QA 4RWNA 2B56A 1ZQUA 3RH4A 4PHDA 7ICLA 2GA9D 8ICSA 5D61A 3C2KA 9ICGA 4JWNA 4TUQA 4FHPA 1HUZA 5J2KA 5IIMA 4AT9A 3C18A 4M9NA 4O5KA 4E80A 2FMSA 3OVSA 5J2CA 8ICFA 4NXWA 4LEWA 4I2DA 4UBCA 2FCLA 4WC4A 2PXIA 3V7KA 4KLOA 4ATBA 4I2HA 2BPFA 3LK9A 2IHMA 1VFGA 4PHEA 4MFAA 4EBJA 1R8AA 2ZH2A 3HJ4A 4XQ8A 1ZQKA 4RPYA 8ICYA 4KLLA 8ICJA 4PH5A 2ZH3A 4RQ0A 4Z6EA 4K9BA 4QZ8A 4RQ7A 3JPRA 2FMPA 4IQWA 3C5GA 4P4MA 4P4OA 1JMSA 3JYYA 4R66A 4PPXA 2PFOA 5DB8A 4IQVA 4NXTA 2NRKA 5HR9A 4AT8B 4KLUA 2ZH6A 1JN3A 4I0UA 7ICQA 3ER8C 4P2HA 5BOMA 4M47A 4R63A 4K8VA 4M9JA 9ICSA 4AT7B 4LZDA 4FHVA 5J0TA 5IIIA 1UEUA 4X4UA 5HRGA 4WC3A 4X4RA 1NO5A 3JPOA 1NOMA 9ICMA 4LEZA 3JPSA 5J2AA 9ICVA 5DKWA 5DB9A 1ZQNA 4M5DA 4IG8A 1YLQA 5IINA 3RJKA 3ISDA 5D63A 5J2DA 4RQ1A 2DR5A 3NYBA 1HUOA 4DOAA 2VANA 5EOZA 3JPQA 1ZJNA 4PHPA 4UB3A 4O6AA 3PHZA 4RWPA 4QZAA 8ICNA 4K4HA 2B51A 4UAZA 1Q78A 2BE3A 4I2FA 4I2GA 4AT9B 4UB1A 1ZQTA 4M04A 4M9LA 7ICKA 5J2GA 7ICEA 3OGUA 3HWTA 5JTGA 9ICHA 2B4VA 8ICLA 5J0SA 5CA7A 3K7DA 2BPCA 4K4GA 5CR0A 8ICQA 5CFSA 4NKTA 4ATBB 1TFYA 4M9GA 4MFFA 5D49A 3HIYA 4QZHA 5HC9A 4O68A 1ZQXA 1XSLA 4F5PA 2DR8A 3AQNA 4RT3A 1JQRA 3C2MA 4HX0A 4F5NA 3JPTA 4M2YA 8ICUA 2BCQA 4GXJA 5HRBA 3JCFA 4XJEA 2P66A 4MKPA 4KLGA 4I2EA 4WC2A 9ICWA 3JPPA 1ZQWA 4RPZA 3MGHA 4DOBA 3AQLA 8ICOA 4TURA 4O9MA 5J0WA 7ICIA 1ZQPA 4QZGA 3K75D 3PMNA 1BPYA 5HHIA 1ZQQA 7ICMA 4UB2A 4UB4A 2BCUA 4I2IA 3OWGA 4I27A 4X4VA 2PFNA 3AU2A 1RZTA 9ICNA 4F5QA 1V4AA 5D46A 4FH3A 1ZJMA 1OU5A 8ICCA 5TZVA 5J0RA 2Q66A 2IHOA 3V7JA 2GWSA 4XQ7A 3AQMA 1ZQVA 4P4PA 3WFOA 1UETA 4EGWA 3MDAA 2ISPA 3PMLA 3H38A 8ICTA 4RQ2A 4UB5A 5CP2A 3H3AA 5D4BA 1Q79A 2ID1A 5J2EA 3HJ1A 3JPNA 4EBKA 7ICHA 5J2FA 3ER9B 2BPGA 4KLTA 4NXUA 3AQKA 4GXIA 5HRHA 1ZQCA 3UPSA 3GDXA 7ICSA 2DRAA 4O69A 1F5AA 4K96A 5DBCA 5J0OA 1RPLA 2PFQA 4NM2A 8ICRA 4UBBA 2O1PA 4QZBA 1GPJA 3UXNA 8ICIA 2ZHAA 4X4OA 4UAYA 1MQ3A 4YMMA 4NM1A 3B0XA 1BPBA 4QZCA 4WC6A 4EP7A 4EEBA 4YN4A 4RQ8A 4EV6A 4R64A 1MQ2A 4K99A 3LQCB 3RJJA 3NVOA 9ICBA 9ICPA 2IUBA 7ICVA 1ZQBA 5HRKA 2DRBA 8ICXA 2M2UA 2DR9A 1ZQLA 3UQ0A 2I9GA 1ZQEA 4YMOA 5IILA 4RQ6A 2M2WA 4KLHA 3NKUA 3JZ0A 7ICFA 4RQ5A 3PNCA 4Z6CA 4FO1A 4X5VA 5J29A 2PBEA 3MCRA 5DB6A 4QZIA 2ZH9A 3MGIA 4KLEA 3WFSC 8ICHA 5HRFA 4I2AA 9ICLA 4I28A 9ICCA 5DBAA 5J0PA 4KLSA 4FHYA 5DB7A 3L9DA 5F2VO 3WFQE 4KB6A 1JAJA 5CHGA 3OVBA 1UEVA 4WC1A 4KLIA 4WC0A 4WBYA 4NXZA 3HX0A 4FH5A 2BCRA 4NLNA 1ZQRA 5DEDA 2M2VA 4WC7A 8ICKA 5J0YA 8ICWA 4KLDA 5BOLA 3ISBA 4XA5A 3CK6A 4PHAA 4I29A 2EWRA 4FHWA 5J0UA 8ICGA 3OV7A 4RT2A 2O5AA 9ICKA 1KNYA 4DOCA 4RWOA 4TUPA 3UQ2A 4OAFA 4JWMA 9ICTA 4IQTA 2ZH5A 5HHHA 4NXXA 4KLQA 5B3PA 4KLJA 9ICQA 4E7XA 4OAIZ 3V72A 4NXVA 4UD4A 4KLMA 4TUSA 3RJFA 4X4SA 4WCWA 4X0BA 3TFRA 7ICRA 4O67A 5HRIA 4PGXA 1TVAA 2PFPA 4O5EA 4XRHA 4WQLA 4E8FA 1MIVA 1PX5A 1ZQDA 4I2CA 8ICBA 1VJ7A 5CHEA 5J2JA 4FHXA 2HN2A 8ICVA 5IIKA 4KLFA 7ICUA 4WQKA 3ISCA 7ICOA 4LT6A 4QZEA 3C5FA 3OUYA 5IIOA 5CFTA 4NY8A 1FA0A 2ZH4A 1ZQGA 8ICPA 7ICTA 7ICGA 1ZQAA 5CWRA 2DVIA 5HREA 1ZQHA 9ICAA 2BCVA 3UXOA 3WFPA 2FMQA 4QZDA 3AU6A 1ZQMA 1XSNA 4YMNA 4PGYA 3WFRE 4N7RA 4X4TA 4F5OA 2HN1A 3UXPA 5B3QA 1R8BA 2ZH7A 5DBBA 3NWIA 4RQ3A 3RJHA 2BBHA 1BPDA 5CB1A 3H39A 5D62A 4GXKA 3RJIA 4LVSA 1TV9A 1WOTA 2RFFA 3UPQA 9ICOA 4YCXA 9ICIA 4WH5A 1R8CA 1BPXA 4R65A 4O5CA 4FO6A 4X4NA 2ISOA 3B0YA 4WBZA 4NLKA 4NKUA 2ZH1A 5J0QA 1ZQIA 4S3NA 2BBJA 2M2TA 3EF2A 9ICRA 9ICEA 4F5RA 4K9AA 3H37A 3RH6A 8ICEA 4RQ4A 4X0AA 4DO9A 8ICAA 1MIWA 4M0AA 3ERCC 3RJGA 4M9HA 4KM5A 4LZGA 1ZQZA 5BPCA 4MF2A 4NLZA 4EEDA 4K4IA 9ICUA 4PGQA 5IIJA 4UAWA 5HRDA 5J2IA 3AUOA 4MF8A 4IQUA 7ICJA 2ZH8A 1ZQFA 3C2LA 4JLZA 4WOYA 3HW8A 3RH5A 4YD2A 3MDCA 2BCSA 3OUYB 4OAGA 2ZHBA 5DDMA 4YD1A 5J2HA 7ICNA 5J0XA 4I2JA 1ZQJA 2DR7A 5J2BA 5CJ7A 5DECA 4AT8A 4MFCA 4LEYA 1KDHA 3OVAA 2W9MA 4QZFA 4XUSA 4K98A 5CFUA 1KEJA 4JLXA 4AT7A 4K97A 1ZQOA 4LEVA 4WC5A 1R89A 4I2BA
chains in the Genus database with same CATH topology
4Z6DA 4RPXA 2HHPA 5HRLA 4Z6FA 1XSPA 9ICJA 8ICZA 3V7LA 3TFSA 4RWQA 3C66A 1MIYA 5DDYA 4QZ9A 1ZQSA 3RJEA 4X4PA 1BPZA 8ICMA 3MBYA 1TFWA 7ICPA 1BPEA 9ICXA 9ICFA 1ZQYA 4UD5A 4X4QA 4RWNA 1ZQUA 3RH4A 4PHDA 7ICLA 8ICSA 3C2KA 9ICGA 4JWNA 4TUQA 4FHPA 1HUZA 5J2KA 5IIMA 4AT9A 3C18A 4M9NA 4O5KA 4E80A 2FMSA 3OVSA 5J2CA 8ICFA 4I2DA 4UBCA 4WC4A 2PXIA 3V7KA 4KLOA 4ATBA 4I2HA 2BPFA 3LK9A 2IHMA 1VFGA 4PHEA 4MFAA 4EBJA 1R8AA 2ZH2A 3HJ4A 4XQ8A 1ZQKA 4RPYA 8ICYA 4KLLA 8ICJA 4PH5A 2ZH3A 4RQ0A 4Z6EA 3JPRA 4QZ8A 4RQ7A 2FMPA 4IQWA 3C5GA 4P4MA 4P4OA 1JMSA 3JYYA 4R66A 4PPXA 2PFOA 5DB8A 4IQVA 2NRKA 5HR9A 4AT8B 4KLUA 2ZH6A 1JN3A 7ICQA 4P2HA 5BOMA 4M47A 4R63A 4M9JA 9ICSA 4AT7B 4LZDA 4FHVA 5J0TA 5IIIA 1UEUA 5HRGA 4WC3A 4X4UA 4X4RA 1NO5A 3JPOA 1NOMA 9ICMA 3JPSA 5J2AA 9ICVA 5DKWA 5DB9A 1ZQNA 1YLQA 4IG8A 4M5DA 5IINA 3RJKA 3ISDA 5J2DA 4RQ1A 2DR5A 3NYBA 1HUOA 4DOAA 2VANA 5EOZA 3JPQA 1ZJNA 4PHPA 4UB3A 4QZAA 4RWPA 8ICNA 4K4HA 4UAZA 1Q78A 2BE3A 4I2FA 4I2GA 4AT9B 4UB1A 1ZQTA 4M04A 4M9LA 7ICKA 5J2GA 7ICEA 3OGUA 3HWTA 9ICHA 8ICLA 5J0SA 5CA7A 2BPCA 4K4GA 5CR0A 8ICQA 4NKTA 4ATBB 4M9GA 4MFFA 1TFYA 5D49A 3HIYA 4QZHA 5HC9A 1ZQXA 1XSLA 4F5PA 2DR8A 3AQNA 4RT3A 1JQRA 3C2MA 4F5NA 3JPTA 4M2YA 8ICUA 2BCQA 4GXJA 5HRBA 2P66A 4KLGA 4I2EA 4WC2A 9ICWA 3JPPA 1ZQWA 4RPZA 3MGHA 4DOBA 3AQLA 8ICOA 4TURA 4O9MA 5J0WA 7ICIA 1ZQPA 4QZGA 3K75D 3PMNA 1BPYA 5HHIA 1ZQQA 7ICMA 4UB2A 4UB4A 2BCUA 4I2IA 4I27A 4X4VA 2PFNA 3AU2A 1RZTA 9ICNA 4F5QA 1V4AA 5D46A 4FH3A 1ZJMA 1OU5A 8ICCA 5TZVA 5J0RA 3V7JA 2GWSA 2Q66A 4XQ7A 3AQMA 1ZQVA 4P4PA 3WFOA 1UETA 3MDAA 2ISPA 3PMLA 3H38A 8ICTA 4RQ2A 4UB5A 5CP2A 3H3AA 5D4BA 1Q79A 2ID1A 5J2EA 3HJ1A 3JPNA 4EBKA 7ICHA 5J2FA 2BPGA 4KLTA 3AQKA 4GXIA 5HRHA 1ZQCA 3UPSA 3GDXA 7ICSA 2DRAA 1F5AA 5DBCA 5J0OA 2PFQA 1RPLA 4NM2A 8ICRA 4UBBA 2O1PA 4QZBA 3UXNA 8ICIA 2ZHAA 4X4OA 4UAYA 1MQ3A 4YMMA 4NM1A 3B0XA 1BPBA 4QZCA 4WC6A 4EP7A 4YN4A 4RQ8A 4R64A 1MQ2A 3LQCB 3RJJA 9ICBA 9ICPA 7ICVA 1ZQBA 5HRKA 2DRBA 8ICXA 2M2UA 1ZQLA 2DR9A 3UQ0A 2I9GA 1ZQEA 4YMOA 5IILA 4RQ6A 2M2WA 4KLHA 3JZ0A 7ICFA 4RQ5A 3PNCA 4Z6CA 4X5VA 5J29A 2PBEA 5DB6A 4QZIA 3MGIA 2ZH9A 4KLEA 3WFSC 8ICHA 9ICLA 5HRFA 4I2AA 4I28A 9ICCA 5DBAA 5J0PA 4KLSA 4FHYA 5DB7A 3L9DA 5F2VO 3WFQE 1JAJA 5CHGA 3OVBA 1UEVA 4WC1A 4KLIA 4WC0A 4WBYA 4NXZA 3HX0A 4FH5A 2BCRA 4NLNA 1ZQRA 5DEDA 2M2VA 4WC7A 8ICKA 5J0YA 8ICWA 4KLDA 5BOLA 3ISBA 4XA5A 4PHAA 4I29A 4FHWA 5J0UA 8ICGA 4RT2A 3OV7A 2O5AA 9ICKA 1KNYA 4DOCA 4RWOA 4TUPA 3UQ2A 4JWMA 9ICTA 4IQTA 2ZH5A 5HHHA 4KLQA 4KLJA 9ICQA 4E7XA 3V72A 4UD4A 4KLMA 4TUSA 3RJFA 4WCWA 4X4SA 4X0BA 3TFRA 7ICRA 5HRIA 4PGXA 1TVAA 2PFPA 4O5EA 4XRHA 4E8FA 1MIVA 1PX5A 1ZQDA 4I2CA 8ICBA 1VJ7A 5J2JA 4FHXA 8ICVA 5IIKA 4KLFA 7ICUA 3ISCA 7ICOA 4LT6A 4QZEA 3C5FA 3OUYA 5IIOA 4NY8A 1FA0A 2ZH4A 1ZQGA 8ICPA 7ICTA 7ICGA 1ZQAA 5CWRA 2DVIA 5HREA 1ZQHA 9ICAA 2BCVA 3UXOA 3WFPA 2FMQA 4QZDA 3AU6A 1ZQMA 1XSNA 4YMNA 4PGYA 3WFRE 4X4TA 4F5OA 3UXPA 1R8BA 2ZH7A 5DBBA 4RQ3A 3RJHA 1BPDA 5CB1A 3H39A 4GXKA 3RJIA 4LVSA 1TV9A 1WOTA 2RFFA 3UPQA 9ICOA 4YCXA 9ICIA 1R8CA 1BPXA 4R65A 4O5CA 4FO6A 2ISOA 4X4NA 3B0YA 4WBZA 4NLKA 4NKUA 2ZH1A 5J0QA 1ZQIA 4S3NA 9ICRA 2M2TA 9ICEA 4F5RA 3H37A 3RH6A 8ICEA 4RQ4A 4X0AA 4DO9A 8ICAA 1MIWA 4M0AA 3RJGA 4M9HA 4LZGA 1ZQZA 5BPCA 4MF2A 4NLZA 4K4IA 9ICUA 4PGQA 5IIJA 4UAWA 5HRDA 5J2IA 3AUOA 4MF8A 4IQUA 7ICJA 2ZH8A 1ZQFA 3C2LA 3RH5A 3HW8A 4YD2A 3MDCA 2BCSA 3OUYB 2ZHBA 5DDMA 4YD1A 5J2HA 7ICNA 5J0XA 4I2JA 1ZQJA 2DR7A 5J2BA 5CJ7A 5DECA 4AT8A 4MFCA 1KDHA 3OVAA 2W9MA 4QZFA 4XUSA 1KEJA 4AT7A 1ZQOA 4WC5A 1R89A 4I2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6D A;  4RPX A;  2HHP A;  5HRL A;  4Z6F A;  1XSP A;  9ICJ A;  8ICZ A;  3V7L A;  3TFS A;  4RWQ A;  3C66 A;  1MIY A;  5DDY A;  4QZ9 A;  1ZQS A;  3RJE A;  4X4P A;  1BPZ A;  8ICM A;  3MBY A;  1TFW A;  7ICP A;  1BPE A;  9ICX A;  9ICF A;  1ZQY A;  4UD5 A;  4X4Q A;  4RWN A;  1ZQU A;  3RH4 A;  4PHD A;  7ICL A;  8ICS A;  3C2K A;  9ICG A;  4JWN A;  4TUQ A;  4FHP A;  1HUZ A;  5J2K A;  5IIM A;  4AT9 A;  3C18 A;  4M9N A;  4O5K A;  4E80 A;  2FMS A;  3OVS A;  5J2C A;  8ICF A;  4I2D A;  4UBC A;  4WC4 A;  2PXI A;  3V7K A;  4KLO A;  4ATB A;  4I2H A;  2BPF A;  3LK9 A;  2IHM A;  1VFG A;  4PHE A;  4MFA A;  4EBJ A;  1R8A A;  2ZH2 A;  3HJ4 A;  4XQ8 A;  1ZQK A;  4RPY A;  8ICY A;  4KLL A;  8ICJ A;  4PH5 A;  2ZH3 A;  4RQ0 A;  4Z6E A;  3JPR A;  4QZ8 A;  4RQ7 A;  2FMP A;  4IQW A;  3C5G A;  4P4M A;  4P4O A;  1JMS A;  3JYY A;  4R66 A;  4PPX A;  2PFO A;  5DB8 A;  4IQV A;  2NRK A;  5HR9 A;  4AT8 B;  4KLU A;  2ZH6 A;  1JN3 A;  7ICQ A;  4P2H A;  5BOM A;  4M47 A;  4R63 A;  4M9J A;  9ICS A;  4AT7 B;  4LZD A;  4FHV A;  5J0T A;  5III A;  1UEU A;  5HRG A;  4WC3 A;  4X4U A;  4X4R A;  1NO5 A;  3JPO A;  1NOM A;  9ICM A;  3JPS A;  5J2A A;  9ICV A;  5DKW A;  5DB9 A;  1ZQN A;  1YLQ A;  4IG8 A;  4M5D A;  5IIN A;  3RJK A;  3ISD A;  5J2D A;  4RQ1 A;  2DR5 A;  3NYB A;  1HUO A;  4DOA A;  2VAN A;  5EOZ A;  3JPQ A;  1ZJN A;  4PHP A;  4UB3 A;  4QZA A;  4RWP A;  8ICN A;  4K4H A;  4UAZ A;  1Q78 A;  2BE3 A;  4I2F A;  4I2G A;  4AT9 B;  4UB1 A;  1ZQT A;  4M04 A;  4M9L A;  7ICK A;  5J2G A;  7ICE A;  3OGU A;  3HWT A;  9ICH A;  8ICL A;  5J0S A;  5CA7 A;  2BPC A;  4K4G A;  5CR0 A;  8ICQ A;  4NKT A;  4ATB B;  4M9G A;  4MFF A;  1TFY A;  5D49 A;  3HIY A;  4QZH A;  5HC9 A;  1ZQX A;  1XSL A;  4F5P A;  2DR8 A;  3AQN A;  4RT3 A;  1JQR A;  3C2M A;  4F5N A;  3JPT A;  4M2Y A;  8ICU A;  2BCQ A;  4GXJ A;  5HRB A;  2P66 A;  4KLG A;  4I2E A;  4WC2 A;  9ICW A;  3JPP A;  1ZQW A;  4RPZ A;  3MGH A;  4DOB A;  3AQL A;  8ICO A;  4TUR A;  4O9M A;  5J0W A;  7ICI A;  1ZQP A;  4QZG A;  3K75 D;  3PMN A;  1BPY A;  5HHI A;  1ZQQ A;  7ICM A;  4UB2 A;  4UB4 A;  2BCU A;  4I2I A;  4I27 A;  4X4V A;  2PFN A;  3AU2 A;  1RZT A;  9ICN A;  4F5Q A;  1V4A A;  5D46 A;  4FH3 A;  1ZJM A;  1OU5 A;  8ICC A;  5TZV A;  5J0R A;  3V7J A;  2GWS A;  2Q66 A;  4XQ7 A;  3AQM A;  1ZQV A;  4P4P A;  3WFO A;  1UET A;  3MDA A;  2ISP A;  3PML A;  3H38 A;  8ICT A;  4RQ2 A;  4UB5 A;  5CP2 A;  3H3A A;  5D4B A;  1Q79 A;  2ID1 A;  5J2E A;  3HJ1 A;  3JPN A;  4EBK A;  7ICH A;  5J2F A;  2BPG A;  4KLT A;  3AQK A;  4GXI A;  5HRH A;  1ZQC A;  3UPS A;  3GDX A;  7ICS A;  2DRA A;  1F5A A;  5DBC A;  5J0O A;  2PFQ A;  1RPL A;  4NM2 A;  8ICR A;  4UBB A;  2O1P A;  4QZB A;  3UXN A;  8ICI A;  2ZHA A;  4X4O A;  4UAY A;  1MQ3 A;  4YMM A;  4NM1 A;  3B0X A;  1BPB A;  4QZC A;  4WC6 A;  4EP7 A;  4YN4 A;  4RQ8 A;  4R64 A;  1MQ2 A;  3LQC B;  3RJJ A;  9ICB A;  9ICP A;  7ICV A;  1ZQB A;  5HRK A;  2DRB A;  8ICX A;  2M2U A;  1ZQL A;  2DR9 A;  3UQ0 A;  2I9G A;  1ZQE A;  4YMO A;  5IIL A;  4RQ6 A;  2M2W A;  4KLH A;  3JZ0 A;  7ICF A;  4RQ5 A;  3PNC A;  4Z6C A;  4X5V A;  5J29 A;  2PBE A;  5DB6 A;  4QZI A;  3MGI A;  2ZH9 A;  4KLE A;  3WFS C;  8ICH A;  9ICL A;  5HRF A;  4I2A A;  4I28 A;  9ICC A;  5DBA A;  5J0P A;  4KLS A;  4FHY A;  5DB7 A;  3L9D A;  5F2V O;  3WFQ E;  1JAJ A;  5CHG A;  3OVB A;  1UEV A;  4WC1 A;  4KLI A;  4WC0 A;  4WBY A;  4NXZ A;  3HX0 A;  4FH5 A;  2BCR A;  4NLN A;  1ZQR A;  5DED A;  2M2V A;  4WC7 A;  8ICK A;  5J0Y A;  8ICW A;  4KLD A;  5BOL A;  3ISB A;  4XA5 A;  4PHA A;  4I29 A;  4FHW A;  5J0U A;  8ICG A;  4RT2 A;  3OV7 A;  2O5A A;  9ICK A;  1KNY A;  4DOC A;  4RWO A;  4TUP A;  3UQ2 A;  4JWM A;  9ICT A;  4IQT A;  2ZH5 A;  5HHH A;  4KLQ A;  4KLJ A;  9ICQ A;  4E7X A;  3V72 A;  4UD4 A;  4KLM A;  4TUS A;  3RJF A;  4WCW A;  4X4S A;  4X0B A;  3TFR A;  7ICR A;  5HRI A;  4PGX A;  1TVA A;  2PFP A;  4O5E A;  4XRH A;  4E8F A;  1MIV A;  1PX5 A;  1ZQD A;  4I2C A;  8ICB A;  1VJ7 A;  5J2J A;  4FHX A;  8ICV A;  5IIK A;  4KLF A;  7ICU A;  3ISC A;  7ICO A;  4LT6 A;  4QZE A;  3C5F A;  3OUY A;  5IIO A;  4NY8 A;  1FA0 A;  2ZH4 A;  1ZQG A;  8ICP A;  7ICT A;  7ICG A;  1ZQA A;  5CWR A;  2DVI A;  5HRE A;  1ZQH A;  9ICA A;  2BCV A;  3UXO A;  3WFP A;  2FMQ A;  4QZD A;  3AU6 A;  1ZQM A;  1XSN A;  4YMN A;  4PGY A;  3WFR E;  4X4T A;  4F5O A;  3UXP A;  1R8B A;  2ZH7 A;  5DBB A;  4RQ3 A;  3RJH A;  1BPD A;  5CB1 A;  3H39 A;  4GXK A;  3RJI A;  4LVS A;  1TV9 A;  1WOT A;  2RFF A;  3UPQ A;  9ICO A;  4YCX A;  9ICI A;  1R8C A;  1BPX A;  4R65 A;  4O5C A;  4FO6 A;  2ISO A;  4X4N A;  3B0Y A;  4WBZ A;  4NLK A;  4NKU A;  2ZH1 A;  5J0Q A;  1ZQI A;  4S3N A;  9ICR A;  2M2T A;  9ICE A;  4F5R A;  3H37 A;  3RH6 A;  8ICE A;  4RQ4 A;  4X0A A;  4DO9 A;  8ICA A;  1MIW A;  4M0A A;  3RJG A;  4M9H A;  4LZG A;  1ZQZ A;  5BPC A;  4MF2 A;  4NLZ A;  4K4I A;  9ICU A;  4PGQ A;  5IIJ A;  4UAW A;  5HRD A;  5J2I A;  3AUO A;  4MF8 A;  4IQU A;  7ICJ A;  2ZH8 A;  1ZQF A;  3C2L A;  3RH5 A;  3HW8 A;  4YD2 A;  3MDC A;  2BCS A;  3OUY B;  2ZHB A;  5DDM A;  4YD1 A;  5J2H A;  7ICN A;  5J0X A;  4I2J A;  1ZQJ A;  2DR7 A;  5J2B A;  5CJ7 A;  5DEC A;  4AT8 A;  4MFC A;  1KDH A;  3OVA A;  2W9M A;  4QZF A;  4XUS A;  1KEJ A;  4AT7 A;  1ZQO A;  4WC5 A;  1R89 A;  4I2B A; 
#chains in the Genus database with same CATH topology
 4Z6D A;  4RPX A;  2HHP A;  5HRL A;  4Z6F A;  1XSP A;  2GAF D;  9ICJ A;  8ICZ A;  3V7L A;  3TFS A;  3C66 A;  4RWQ A;  1MIY A;  5DDY A;  4QZ9 A;  1ZQS A;  3RJE A;  4X4P A;  1BPZ A;  8ICM A;  1TFW A;  3MBY A;  7ICP A;  1BPE A;  4OAH A;  9ICX A;  9ICF A;  4UD5 A;  1ZQY A;  4X4Q A;  4RWN A;  2B56 A;  1ZQU A;  3RH4 A;  4PHD A;  7ICL A;  2GA9 D;  8ICS A;  5D61 A;  3C2K A;  9ICG A;  4JWN A;  4TUQ A;  4FHP A;  1HUZ A;  5J2K A;  5IIM A;  4AT9 A;  3C18 A;  4M9N A;  4O5K A;  4E80 A;  2FMS A;  3OVS A;  5J2C A;  8ICF A;  4NXW A;  4LEW A;  4I2D A;  4UBC A;  2FCL A;  4WC4 A;  2PXI A;  3V7K A;  4KLO A;  4ATB A;  4I2H A;  2BPF A;  3LK9 A;  2IHM A;  1VFG A;  4PHE A;  4MFA A;  4EBJ A;  1R8A A;  2ZH2 A;  3HJ4 A;  4XQ8 A;  1ZQK A;  4RPY A;  8ICY A;  4KLL A;  8ICJ A;  4PH5 A;  2ZH3 A;  4RQ0 A;  4Z6E A;  4K9B A;  4QZ8 A;  4RQ7 A;  3JPR A;  2FMP A;  4IQW A;  3C5G A;  4P4M A;  4P4O A;  1JMS A;  3JYY A;  4R66 A;  4PPX A;  2PFO A;  5DB8 A;  4IQV A;  4NXT A;  2NRK A;  5HR9 A;  4AT8 B;  4KLU A;  2ZH6 A;  1JN3 A;  4I0U A;  7ICQ A;  3ER8 C;  4P2H A;  5BOM A;  4M47 A;  4R63 A;  4K8V A;  4M9J A;  9ICS A;  4AT7 B;  4LZD A;  4FHV A;  5J0T A;  5III A;  1UEU A;  4X4U A;  5HRG A;  4WC3 A;  4X4R A;  1NO5 A;  3JPO A;  1NOM A;  9ICM A;  4LEZ A;  3JPS A;  5J2A A;  9ICV A;  5DKW A;  5DB9 A;  1ZQN A;  4M5D A;  4IG8 A;  1YLQ A;  5IIN A;  3RJK A;  3ISD A;  5D63 A;  5J2D A;  4RQ1 A;  2DR5 A;  3NYB A;  1HUO A;  4DOA A;  2VAN A;  5EOZ A;  3JPQ A;  1ZJN A;  4PHP A;  4UB3 A;  4O6A A;  3PHZ A;  4RWP A;  4QZA A;  8ICN A;  4K4H A;  2B51 A;  4UAZ A;  1Q78 A;  2BE3 A;  4I2F A;  4I2G A;  4AT9 B;  4UB1 A;  1ZQT A;  4M04 A;  4M9L A;  7ICK A;  5J2G A;  7ICE A;  3OGU A;  3HWT A;  5JTG A;  9ICH A;  2B4V A;  8ICL A;  5J0S A;  5CA7 A;  3K7D A;  2BPC A;  4K4G A;  5CR0 A;  8ICQ A;  5CFS A;  4NKT A;  4ATB B;  1TFY A;  4M9G A;  4MFF A;  5D49 A;  3HIY A;  4QZH A;  5HC9 A;  4O68 A;  1ZQX A;  1XSL A;  4F5P A;  2DR8 A;  3AQN A;  4RT3 A;  1JQR A;  3C2M A;  4HX0 A;  4F5N A;  3JPT A;  4M2Y A;  8ICU A;  2BCQ A;  4GXJ A;  5HRB A;  3JCF A;  4XJE A;  2P66 A;  4MKP A;  4KLG A;  4I2E A;  4WC2 A;  9ICW A;  3JPP A;  1ZQW A;  4RPZ A;  3MGH A;  4DOB A;  3AQL A;  8ICO A;  4TUR A;  4O9M A;  5J0W A;  7ICI A;  1ZQP A;  4QZG A;  3K75 D;  3PMN A;  1BPY A;  5HHI A;  1ZQQ A;  7ICM A;  4UB2 A;  4UB4 A;  2BCU A;  4I2I A;  3OWG A;  4I27 A;  4X4V A;  2PFN A;  3AU2 A;  1RZT A;  9ICN A;  4F5Q A;  1V4A A;  5D46 A;  4FH3 A;  1ZJM A;  1OU5 A;  8ICC A;  5TZV A;  5J0R A;  2Q66 A;  2IHO A;  3V7J A;  2GWS A;  4XQ7 A;  3AQM A;  1ZQV A;  4P4P A;  3WFO A;  1UET A;  4EGW A;  3MDA A;  2ISP A;  3PML A;  3H38 A;  8ICT A;  4RQ2 A;  4UB5 A;  5CP2 A;  3H3A A;  5D4B A;  1Q79 A;  2ID1 A;  5J2E A;  3HJ1 A;  3JPN A;  4EBK A;  7ICH A;  5J2F A;  3ER9 B;  2BPG A;  4KLT A;  4NXU A;  3AQK A;  4GXI A;  5HRH A;  1ZQC A;  3UPS A;  3GDX A;  7ICS A;  2DRA A;  4O69 A;  1F5A A;  4K96 A;  5DBC A;  5J0O A;  1RPL A;  2PFQ A;  4NM2 A;  8ICR A;  4UBB A;  2O1P A;  4QZB A;  1GPJ A;  3UXN A;  8ICI A;  2ZHA A;  4X4O A;  4UAY A;  1MQ3 A;  4YMM A;  4NM1 A;  3B0X A;  1BPB A;  4QZC A;  4WC6 A;  4EP7 A;  4EEB A;  4YN4 A;  4RQ8 A;  4EV6 A;  4R64 A;  1MQ2 A;  4K99 A;  3LQC B;  3RJJ A;  3NVO A;  9ICB A;  9ICP A;  2IUB A;  7ICV A;  1ZQB A;  5HRK A;  2DRB A;  8ICX A;  2M2U A;  2DR9 A;  1ZQL A;  3UQ0 A;  2I9G A;  1ZQE A;  4YMO A;  5IIL A;  4RQ6 A;  2M2W A;  4KLH A;  3NKU A;  3JZ0 A;  7ICF A;  4RQ5 A;  3PNC A;  4Z6C A;  4FO1 A;  4X5V A;  5J29 A;  2PBE A;  3MCR A;  5DB6 A;  4QZI A;  2ZH9 A;  3MGI A;  4KLE A;  3WFS C;  8ICH A;  5HRF A;  4I2A A;  9ICL A;  4I28 A;  9ICC A;  5DBA A;  5J0P A;  4KLS A;  4FHY A;  5DB7 A;  3L9D A;  5F2V O;  3WFQ E;  4KB6 A;  1JAJ A;  5CHG A;  3OVB A;  1UEV A;  4WC1 A;  4KLI A;  4WC0 A;  4WBY A;  4NXZ A;  3HX0 A;  4FH5 A;  2BCR A;  4NLN A;  1ZQR A;  5DED A;  2M2V A;  4WC7 A;  8ICK A;  5J0Y A;  8ICW A;  4KLD A;  5BOL A;  3ISB A;  4XA5 A;  3CK6 A;  4PHA A;  4I29 A;  2EWR A;  4FHW A;  5J0U A;  8ICG A;  3OV7 A;  4RT2 A;  2O5A A;  9ICK A;  1KNY A;  4DOC A;  4RWO A;  4TUP A;  3UQ2 A;  4OAF A;  4JWM A;  9ICT A;  4IQT A;  2ZH5 A;  5HHH A;  4NXX A;  4KLQ A;  5B3P A;  4KLJ A;  9ICQ A;  4E7X A;  4OAI Z;  3V72 A;  4NXV A;  4UD4 A;  4KLM A;  4TUS A;  3RJF A;  4X4S A;  4WCW A;  4X0B A;  3TFR A;  7ICR A;  4O67 A;  5HRI A;  4PGX A;  1TVA A;  2PFP A;  4O5E A;  4XRH A;  4WQL A;  4E8F A;  1MIV A;  1PX5 A;  1ZQD A;  4I2C A;  8ICB A;  1VJ7 A;  5CHE A;  5J2J A;  4FHX A;  2HN2 A;  8ICV A;  5IIK A;  4KLF A;  7ICU A;  4WQK A;  3ISC A;  7ICO A;  4LT6 A;  4QZE A;  3C5F A;  3OUY A;  5IIO A;  5CFT A;  4NY8 A;  1FA0 A;  2ZH4 A;  1ZQG A;  8ICP A;  7ICT A;  7ICG A;  1ZQA A;  5CWR A;  2DVI A;  5HRE A;  1ZQH A;  9ICA A;  2BCV A;  3UXO A;  3WFP A;  2FMQ A;  4QZD A;  3AU6 A;  1ZQM A;  1XSN A;  4YMN A;  4PGY A;  3WFR E;  4N7R A;  4X4T A;  4F5O A;  2HN1 A;  3UXP A;  5B3Q A;  1R8B A;  2ZH7 A;  5DBB A;  3NWI A;  4RQ3 A;  3RJH A;  2BBH A;  1BPD A;  5CB1 A;  3H39 A;  5D62 A;  4GXK A;  3RJI A;  4LVS A;  1TV9 A;  1WOT A;  2RFF A;  3UPQ A;  9ICO A;  4YCX A;  9ICI A;  4WH5 A;  1R8C A;  1BPX A;  4R65 A;  4O5C A;  4FO6 A;  4X4N A;  2ISO A;  3B0Y A;  4WBZ A;  4NLK A;  4NKU A;  2ZH1 A;  5J0Q A;  1ZQI A;  4S3N A;  2BBJ A;  2M2T A;  3EF2 A;  9ICR A;  9ICE A;  4F5R A;  4K9A A;  3H37 A;  3RH6 A;  8ICE A;  4RQ4 A;  4X0A A;  4DO9 A;  8ICA A;  1MIW A;  4M0A A;  3ERC C;  3RJG A;  4M9H A;  4KM5 A;  4LZG A;  1ZQZ A;  5BPC A;  4MF2 A;  4NLZ A;  4EED A;  4K4I A;  9ICU A;  4PGQ A;  5IIJ A;  4UAW A;  5HRD A;  5J2I A;  3AUO A;  4MF8 A;  4IQU A;  7ICJ A;  2ZH8 A;  1ZQF A;  3C2L A;  4JLZ A;  4WOY A;  3HW8 A;  3RH5 A;  4YD2 A;  3MDC A;  2BCS A;  3OUY B;  4OAG A;  2ZHB A;  5DDM A;  4YD1 A;  5J2H A;  7ICN A;  5J0X A;  4I2J A;  1ZQJ A;  2DR7 A;  5J2B A;  5CJ7 A;  5DEC A;  4AT8 A;  4MFC A;  4LEY A;  1KDH A;  3OVA A;  2W9M A;  4QZF A;  4XUS A;  4K98 A;  5CFU A;  1KEJ A;  4JLX A;  4AT7 A;  4K97 A;  1ZQO A;  4LEV A;  4WC5 A;  1R89 A;  4I2B A; 
#chains in the Genus database with same CATH homology
 4Z6D A;  4RPX A;  2HHP A;  5HRL A;  4Z6F A;  1XSP A;  9ICJ A;  8ICZ A;  3V7L A;  3TFS A;  4RWQ A;  3C66 A;  1MIY A;  5DDY A;  4QZ9 A;  1ZQS A;  3RJE A;  4X4P A;  1BPZ A;  8ICM A;  3MBY A;  1TFW A;  7ICP A;  1BPE A;  9ICX A;  9ICF A;  1ZQY A;  4UD5 A;  4X4Q A;  4RWN A;  1ZQU A;  3RH4 A;  4PHD A;  7ICL A;  8ICS A;  3C2K A;  9ICG A;  4JWN A;  4TUQ A;  4FHP A;  1HUZ A;  5J2K A;  5IIM A;  4AT9 A;  3C18 A;  4M9N A;  4O5K A;  4E80 A;  2FMS A;  3OVS A;  5J2C A;  8ICF A;  4I2D A;  4UBC A;  4WC4 A;  2PXI A;  3V7K A;  4KLO A;  4ATB A;  4I2H A;  2BPF A;  3LK9 A;  2IHM A;  1VFG A;  4PHE A;  4MFA A;  4EBJ A;  1R8A A;  2ZH2 A;  3HJ4 A;  4XQ8 A;  1ZQK A;  4RPY A;  8ICY A;  4KLL A;  8ICJ A;  4PH5 A;  2ZH3 A;  4RQ0 A;  4Z6E A;  3JPR A;  4QZ8 A;  4RQ7 A;  2FMP A;  4IQW A;  3C5G A;  4P4M A;  4P4O A;  1JMS A;  3JYY A;  4R66 A;  4PPX A;  2PFO A;  5DB8 A;  4IQV A;  2NRK A;  5HR9 A;  4AT8 B;  4KLU A;  2ZH6 A;  1JN3 A;  7ICQ A;  4P2H A;  5BOM A;  4M47 A;  4R63 A;  4M9J A;  9ICS A;  4AT7 B;  4LZD A;  4FHV A;  5J0T A;  5III A;  1UEU A;  5HRG A;  4WC3 A;  4X4U A;  4X4R A;  1NO5 A;  3JPO A;  1NOM A;  9ICM A;  3JPS A;  5J2A A;  9ICV A;  5DKW A;  5DB9 A;  1ZQN A;  1YLQ A;  4IG8 A;  4M5D A;  5IIN A;  3RJK A;  3ISD A;  5J2D A;  4RQ1 A;  2DR5 A;  3NYB A;  1HUO A;  4DOA A;  2VAN A;  5EOZ A;  3JPQ A;  1ZJN A;  4PHP A;  4UB3 A;  4QZA A;  4RWP A;  8ICN A;  4K4H A;  4UAZ A;  1Q78 A;  2BE3 A;  4I2F A;  4I2G A;  4AT9 B;  4UB1 A;  1ZQT A;  4M04 A;  4M9L A;  7ICK A;  5J2G A;  7ICE A;  3OGU A;  3HWT A;  9ICH A;  8ICL A;  5J0S A;  5CA7 A;  2BPC A;  4K4G A;  5CR0 A;  8ICQ A;  4NKT A;  4ATB B;  4M9G A;  4MFF A;  1TFY A;  5D49 A;  3HIY A;  4QZH A;  5HC9 A;  1ZQX A;  1XSL A;  4F5P A;  2DR8 A;  3AQN A;  4RT3 A;  1JQR A;  3C2M A;  4F5N A;  3JPT A;  4M2Y A;  8ICU A;  2BCQ A;  4GXJ A;  5HRB A;  2P66 A;  4KLG A;  4I2E A;  4WC2 A;  9ICW A;  3JPP A;  1ZQW A;  4RPZ A;  3MGH A;  4DOB A;  3AQL A;  8ICO A;  4TUR A;  4O9M A;  5J0W A;  7ICI A;  1ZQP A;  4QZG A;  3K75 D;  3PMN A;  1BPY A;  5HHI A;  1ZQQ A;  7ICM A;  4UB2 A;  4UB4 A;  2BCU A;  4I2I A;  4I27 A;  4X4V A;  2PFN A;  3AU2 A;  1RZT A;  9ICN A;  4F5Q A;  1V4A A;  5D46 A;  4FH3 A;  1ZJM A;  1OU5 A;  8ICC A;  5TZV A;  5J0R A;  3V7J A;  2GWS A;  2Q66 A;  4XQ7 A;  3AQM A;  1ZQV A;  4P4P A;  3WFO A;  1UET A;  3MDA A;  2ISP A;  3PML A;  3H38 A;  8ICT A;  4RQ2 A;  4UB5 A;  5CP2 A;  3H3A A;  5D4B A;  1Q79 A;  2ID1 A;  5J2E A;  3HJ1 A;  3JPN A;  4EBK A;  7ICH A;  5J2F A;  2BPG A;  4KLT A;  3AQK A;  4GXI A;  5HRH A;  1ZQC A;  3UPS A;  3GDX A;  7ICS A;  2DRA A;  1F5A A;  5DBC A;  5J0O A;  2PFQ A;  1RPL A;  4NM2 A;  8ICR A;  4UBB A;  2O1P A;  4QZB A;  3UXN A;  8ICI A;  2ZHA A;  4X4O A;  4UAY A;  1MQ3 A;  4YMM A;  4NM1 A;  3B0X A;  1BPB A;  4QZC A;  4WC6 A;  4EP7 A;  4YN4 A;  4RQ8 A;  4R64 A;  1MQ2 A;  3LQC B;  3RJJ A;  9ICB A;  9ICP A;  7ICV A;  1ZQB A;  5HRK A;  2DRB A;  8ICX A;  2M2U A;  1ZQL A;  2DR9 A;  3UQ0 A;  2I9G A;  1ZQE A;  4YMO A;  5IIL A;  4RQ6 A;  2M2W A;  4KLH A;  3JZ0 A;  7ICF A;  4RQ5 A;  3PNC A;  4Z6C A;  4X5V A;  5J29 A;  2PBE A;  5DB6 A;  4QZI A;  3MGI A;  2ZH9 A;  4KLE A;  3WFS C;  8ICH A;  9ICL A;  5HRF A;  4I2A A;  4I28 A;  9ICC A;  5DBA A;  5J0P A;  4KLS A;  4FHY A;  5DB7 A;  3L9D A;  5F2V O;  3WFQ E;  1JAJ A;  5CHG A;  3OVB A;  1UEV A;  4WC1 A;  4KLI A;  4WC0 A;  4WBY A;  4NXZ A;  3HX0 A;  4FH5 A;  2BCR A;  4NLN A;  1ZQR A;  5DED A;  2M2V A;  4WC7 A;  8ICK A;  5J0Y A;  8ICW A;  4KLD A;  5BOL A;  3ISB A;  4XA5 A;  4PHA A;  4I29 A;  4FHW A;  5J0U A;  8ICG A;  4RT2 A;  3OV7 A;  2O5A A;  9ICK A;  1KNY A;  4DOC A;  4RWO A;  4TUP A;  3UQ2 A;  4JWM A;  9ICT A;  4IQT A;  2ZH5 A;  5HHH A;  4KLQ A;  4KLJ A;  9ICQ A;  4E7X A;  3V72 A;  4UD4 A;  4KLM A;  4TUS A;  3RJF A;  4WCW A;  4X4S A;  4X0B A;  3TFR A;  7ICR A;  5HRI A;  4PGX A;  1TVA A;  2PFP A;  4O5E A;  4XRH A;  4E8F A;  1MIV A;  1PX5 A;  1ZQD A;  4I2C A;  8ICB A;  1VJ7 A;  5J2J A;  4FHX A;  8ICV A;  5IIK A;  4KLF A;  7ICU A;  3ISC A;  7ICO A;  4LT6 A;  4QZE A;  3C5F A;  3OUY A;  5IIO A;  4NY8 A;  1FA0 A;  2ZH4 A;  1ZQG A;  8ICP A;  7ICT A;  7ICG A;  1ZQA A;  5CWR A;  2DVI A;  5HRE A;  1ZQH A;  9ICA A;  2BCV A;  3UXO A;  3WFP A;  2FMQ A;  4QZD A;  3AU6 A;  1ZQM A;  1XSN A;  4YMN A;  4PGY A;  3WFR E;  4X4T A;  4F5O A;  3UXP A;  1R8B A;  2ZH7 A;  5DBB A;  4RQ3 A;  3RJH A;  1BPD A;  5CB1 A;  3H39 A;  4GXK A;  3RJI A;  4LVS A;  1TV9 A;  1WOT A;  2RFF A;  3UPQ A;  9ICO A;  4YCX A;  9ICI A;  1R8C A;  1BPX A;  4R65 A;  4O5C A;  4FO6 A;  2ISO A;  4X4N A;  3B0Y A;  4WBZ A;  4NLK A;  4NKU A;  2ZH1 A;  5J0Q A;  1ZQI A;  4S3N A;  9ICR A;  2M2T A;  9ICE A;  4F5R A;  3H37 A;  3RH6 A;  8ICE A;  4RQ4 A;  4X0A A;  4DO9 A;  8ICA A;  1MIW A;  4M0A A;  3RJG A;  4M9H A;  4LZG A;  1ZQZ A;  5BPC A;  4MF2 A;  4NLZ A;  4K4I A;  9ICU A;  4PGQ A;  5IIJ A;  4UAW A;  5HRD A;  5J2I A;  3AUO A;  4MF8 A;  4IQU A;  7ICJ A;  2ZH8 A;  1ZQF A;  3C2L A;  3RH5 A;  3HW8 A;  4YD2 A;  3MDC A;  2BCS A;  3OUY B;  2ZHB A;  5DDM A;  4YD1 A;  5J2H A;  7ICN A;  5J0X A;  4I2J A;  1ZQJ A;  2DR7 A;  5J2B A;  5CJ7 A;  5DEC A;  4AT8 A;  4MFC A;  1KDH A;  3OVA A;  2W9M A;  4QZF A;  4XUS A;  1KEJ A;  4AT7 A;  1ZQO A;  4WC5 A;  1R89 A;  4I2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...