5D62A

Moa-z-vad-fmk complex, inverted orientation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d62A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d62A02
1EPWA 3HMYA 3JUTA 1V6XA 2DREA 2KI6B 4KBBA 4JP0A 3W9TA 5JMCA 2ZQOA 1FQ9A 4GOYA 3AKGA 5DVHA 3CAHA 3Q7WA 4QO3A 3FJBA 3FJJA 3O4AA 5G00A 2DRYA 4D0ZA 3BAGA 2VSEA 1FWVA 1AVUA 4IYBA 1R8NA 3UJ4A 3UJ0A 2HZ9A 1IT0A 4JAWA 2ZR1B 3ILAA 3FJKA 5BQUC 5DZUA 41BIA 1PC8B 3OJVA 3WO2A 1TOOA 3O49A 5BXSA 2E4MA 1E0OA 4OEGA 4J2XA 3PUBA 2VSAA 3E8LC 1HCDA 4G9MA 4LO0C 3R4SA 3F1RA 2X2TA 4LO2C 4EFQA 1RY7A 1M16A 2UUSA 3VSZA 5FZYA 4I96A 1JT7A 4R6UB 3RTJB 2MC2A 2D22A 3FJ9A 3T8SA 1WBCA 1DZCA 5I1BA 1AVXB 4DCKC 4GAFA 4HR6C 3BA5A 3S8KA 4OW4A 3WO3A 2NVHA 1TTUA 4OWLA 4QKSA 4LO1A 3BA4A 1XYFA 3VEQA 4HJJA 1RG8A 1N4KA 3AJ6A 3IM5A 4L4HA 3ZXGA 4LO7B 1TWEA 1S0EA 2KLLA 3BA7A 4QD2B 4GOVA 3RMXA 4ISRA 2Q9XA 3O3QA 1DZDA 4JKXB 1AXMA 3CA1A 3FJIA 3BAHA 1T9FA 3IIRA 1R8OA 3H6QA 1WBAA 3JRRA 3P53A 1BFGA 1JT4A 1P63A 4I0YA 2RG9B 4LO8B 3A07A 2ZQNA 3HALA 3ZX7A 5B2HA 4ZA3B 5FZUA 3P6JA 5FZZA 3B9UA 4IHZA 3FJAA 4XFUA 4H9WA 3CRGA 4ZOTA 1BFBA 2NTDA 3OJMA 1CE7B 3I2AA 1DFCA 4JQ0A 4I4XA 1ISVA 1QQLA 5EG6C 1BA7A 4Z8SB 5DUYA 1AVWB 5EC5A 1YYNA 2KH2A 1S0CA 1DIWA 3V79C 4AN7B 4LO3A 1TFMB 4Q9GA 2YUGA 2XOAA 4IY8A 1T4QA 3WMUA 1QXMA 1S0GA 3KMVA 1FMZA 3UDAA 3WINC 2K8RA 3HN1A 1I1BA 4YOLA 4QBVA 3MPPG 1SR4A 3AKIA 2VXRA 3CRHA 4I37A 1JT3A 1G82A 3V0BA 5DSSB 4Q9PA 4LO7C 4I1BA 4ZGRB 1BFCA 4J2KA 1IILA 4I2SA 2F8XC 4KEKA 3TC2A 2D23A 2FGFA 4CJMA 4A7KA 4FGFA 5D63A 3VWCA 1XG6A 1XHBA 4DEPA 1Q1UA 1Z4SA 1DLLA 3RSJA 1JQZA 4ZKTB 3CA4A 4I4UA 4ZFYB 1IRPA 3CA6A 2MLLB 2VUAA 4D8HA 1I1EA 4G1RA 2KKIA 2GO2A 1S0DA 3OGFA 4DENA 3RTIB 2VLCA 3A23A 4GP0A 2ERMA 2J3PA 4P6AA 4I4VA 1EV2A 1G9CA 4TLPA 2Z49A 3A21A 1UPSA 2M49A 3O44A 3AH4A 2F2FA 3OJ2A 1IRAX 5BP5C 1IHKA 4HA2A 2BEAA 4P0JA 3O4OA 2RSTA 9ILBA 1BLAA 3N0KA 5HPZA 2D43A 3N7MA 4ZFUB 3SNVA 1IOBA 2Y9GA 4LO1C 7I1BA 3HSMA 1DQOA 3EF2A 1VCLA 4JKQA 1G9DA 4USOA 3FJDA 1M2TB 1J0SA 1PZZA 4JPZA 4J2YA 3UD9A 1G9AA 1ITBA 4P0KA 1OQLB 4G6MA 3F62B 1JLYA 3FJHA 3ZC9A 3C9ZA 5BOWA 3MALA 3O5WB 4QC4A 4ZLBB 2NYYA 5BXRA 1EYLA 4OWKA 3CA3A 3Q7XA 1L2HA 1F31A 5BVPI 2Y9FA 4LO2A 1DQGA 4KEIA 2BEBA 1ILR1 1IJTA 1TIEA 4Z9WB 4X3AA 2X2SA 4J23B 1JTCA 2D7RA 4I4YA 1HIBA 2L5XA 3N7KA 3O4DA 2RQ9A 4XFTA 4J2SA 3UD8A 2R9KB 2NM1A 4I3NA 4QBCA 4LO3C 1Z0HA 2NP0A 1BLDA 3O4BA 4I6IA 1JLXA 2LIQA 3CQAA 3IM7A 2IHOA 1ISXA 1SR4C 4F83A 3V0AA 2AAIB 3OGGA 3NBNA 3CA0A 1AFCA 4I8MA 4XFSA 3Q7YA 1RMLA 6I1BA 1FV3A 3BAUA 4ISQA 3OBRA 4QD2C 3NBEA 1PUUB 2AXMA 1NZKA 3AH2A 2P39A 1W3FA 3FFZA 3IM6A 5F8SA 3FJ8A 4AN6A 1WD4A 3BB2A 4GP3A 4X38A 3ZC8A 2AQZA 1YF8B 2AFGA 2Y9WC 2D20A 2HW9A 2VXTI 2DRZA 1II4A 2D7IA 5BXPA 1HWNB 1YXWA 1W3AA 1ISYA 3VT1A 3S8JA 1XZZA 2NZ9A 3WINA 2GZBA 3NBCA 2K4AB 3AZWA 5JLVA 3FUOA 3D7WB 2HWMA 4I4QA 2FDBM 2E4MC 3I29B 2DS0A 3BTAA 2WRYA 2QN4A 4ZBVB 3N7JA 3H6SE 1HKNA 4IQPA 4X39A 2BFHA 2Y9XE 3V0AB 1QQKA 1TWMA 3LLPA 3WMVA 4I4RA 1AVAC 3LTQA 1WD3A 1DJSB 1FGAA 1HCEA 21BIA 3POKA 3ZXDA 1TP0A 3V0BB 3K1XA 4I4OA 4G6JA 3FJCA 1NUNA 3NJ5A 5F8WA 2IWTB 2KI4A 3FUQA 1GGPB 1Q04A 4A7ZA 5D62A 4USPA 3FJFA 5BQUA 2FFVA 3A22A 3AJ5A 4II0A 4EB2B 4I7IA 3NBDA 3BRGC 3BAQA 3FJEA 4WBCA 2ET2A 5BP5A 3CA5A 1FV2A 3H6RA 2LIEA 1BARA 4LO0A 1ISZA 1G9BA 4KEJA 1HWMB 2D44A 1SZ6B 2D24A 2FO1A 1HWOB 5FNWA 1V6WA 3BRFA 4IZEA 1YTOA 4IZXA 1CVSA 4EFRA 8I1BA 3BADA 1S0BA 1DFQA 4IY9A 2Z48A 3PHZA 3FGMA 3AH1A 3N7LA 3AKHA 3AKFA 1JT5A 1FMMS 3UD7A 1ABRB 4EFPA 1FWUA 1BFFA 4XKIA 3CU1B 1BASA 4D0TA 2ESUA 4IONA 3R4UA 1JY0A 3HBWA 4H04A 4A7YA 1S0LA 4ZFWB 3VSFA 3BAVA 4I4PA 5BXTA 2MIBA 4X37A 1KNMA 1K5VA 4OUJA 3BRDA 1V6UA 3CRIA 2HWAA 4OWJA 1PWAA 5EHAA 1ISWA 1S0FA 3I2XA 4FVVA 4OEFA 3IAGC 3OBTA 3PG0A 1D0HA 4OEEA 4P0LA 3AZVA 5GAQA 1K5UA 3VUOA 1MD6A 5E24E 2VU9A 3WA1A 4EEEB 1A8DA 4PC4A 3H6RB 3O4CA 1RZOB 2I1BA 4GAIA 1FN0A 1PUMB 2QYIB 1MC9A 3BX1C 2WBCA 4L4IA 4I1EA 1V6VA 1HWPB 2K43A 3PMEA 3VT2A 2D1ZA 3HOMA 2P23A 3VT0A 5FNXA 2Q3NB 4KC3A 3QYDA 5D61A 1Q03A 2FFUA 4JRAA 1Z2VA 1W3GA 3P6IA 1ONKB 4EKXB 31BIA 4QKRA 4ENDA 4QALA 5F90A 1EVTA 4Q91A 3QR5A 3WO4A 4F34A 4G9NA 4I4SA 3RMYA 1AF9A 2F2FC 1YBIA 3BAOA 5F8YA
chains in the Genus database with same CATH superfamily
3W9TA 4XRHA 4NXZA 3FJBA 4D0ZA 1FWVA 4IYBA 2HZ9A 2ZR1B 4YD2A 5DZUA 1PC8B 4AT8B 9ICWA 2X2TA 4EFQA 1M16A 4QZFA 1DZCA 4NM2A 1AVXB 4QZAA 8ICYA 4FHPA 1XYFA 3UXOA 5B3QA 3AJ6A 4QD2B 3RMXA 3OVSA 8ICHA 3IIRA 3H6QA 2W9MA 4NLNA 1UETA 3P53A 5HR9A 1BFGA 5DKWA 5J0PA 2RG9B 5B2HA 2ZQNA 4NLKA 1ZQGA 4IHZA 8ICQA 3FJAA 5IIIA 4H9WA 4M9LA 4ZOTA 1JAJA 4XUSA 2NTDA 4X0AA 4JQ0A 1ISVA 4E80A 3OGUA 9ICHA 1ZQFA 4Z8SB 5D49A 4LEZA 4N7RA 1BPEA 4LO3A 1TFMB 4X4NA 1ZQCA 1QXMA 1S0GA 3KMVA 2GWSA 1I1BA 2Q66A 4NKUA 8ICWA 3CRHA 2VXRA 1G82A 4I1BA 1IILA 4XA5A 8ICEA 3V7KA 5J0TA 2D23A 5DB8A 5D63A 4PGQA 3CA4A 4I4UA 4ZFYB 5DB6A 2PFNA 4D8HA 3AU2A 2KKIA 4NXWA 3OGFA 5HRHA 5J0QA 2J3PA 1G9CA 3A21A 1UPSA 4HA2A 5DB7A 3ERCC 4FHYA 4OAGA 3O4OA 1FA0A 5DB9A 3N0KA 3RJKA 3JPTA 4LO1C 7I1BA 7ICJA 3HSMA 1ZQWA 2IHMA 1DQOA 3K75D 4F5RA 4USOA 4JPZA 4GXKA 3UXPA 1JLYA 3MALA 7ICLA 3Q7XA 4PHPA 1F31A 4MZHA 1DQGA 3OUYA 2X2SA 4OAHA 3C2MA 1HIBA 2L5XA 3N7KA 3O4DA 2ZH5A 5DBAA 4AT9A 4KLDA 1V4AA 4YD1A 3O4BA 4I6IA 3CQAA 4XQ7A 1ISXA 3V0AA 3AQNA 3CA0A 1ZQIA 1PX5A 4ISQA 3OBRA 2AXMA 1NZKA 2P39A 3FFZA 3IM6A 4AN6A 8ICLA 1WD4A 3BB2A 4GP3A 1YF8B 2BBHA 2DRZA 2D7IA 5BXPA 1BPYA 3VT1A 1W3AA 4UB3A 3D7WB 1NO5A 1VJ7A 2WRYA 4KLJA 2FMPA 3N7JA 4PGXA 4IQPA 2ID1A 8ICGA 3RH6A 1AVAC 4R66A 7ICQA 3C66A 3FJCA 3NJ5A 4QZBA 3JPNA 3A22A 3AJ5A 5D46A 4II0A 4EB2B 7ICGA 3HJ1A 4WBCA 9ICAA 1ZQNA 4QZ8A 3H6RA 2LIEA 1BARA 4LO0A 2ZH4A 2D44A 2GAFD 5FNWA 3K7DA 4IZEA 3H37A 4EFRA 3PHZA 3AH1A 3N7LA 3AKHA 1FMMS 4EFPA 1FWUA 4M9GA 7ICIA 1BASA 9ICJA 1TFYA 2RFFA 1JY0A 4A7YA 4ZFWB 5HRBA 2ZH6A 4F5QA 3BRDA 2HWAA 1PWAA 4FVVA 5J2DA 4MZGB 7ICOA 3VUOA 4JLZA 3WA1A 2PFOA 4UB5A 1A8DA 1RZOB 3ER8C 1FN0A 1PUMB 5CHEA 1V6VA 1HWPB 4KLLA 3PMNA 4KLGA 3PMEA 2D1ZA 4FH3A 3WFPA 3VT0A 5FNXA 1TV9A 5J2BA 4NM1A 3QYDA 7ICKA 5J0WA 1Z2VA 1W3GA 4KLTA 4MF2A 1BPDA 4EKXB 3C2KA 8ICZA 4Q91A 3JYYA 1ZQVA 4F34A 4I4SA 3BAOA 5J2KA 4RQ3A 5F8YA 3AQKA 3HMYA 2P66A 2DREA 4K98A 4JP0A 4RPXA 3CAHA 3Q7WA 4QO3A 3FJJA 3O4AA 5G00A 5DBBA 2VSEA 3L9DA 5J0UA 3NWIA 3UJ0A 3RJHA 1IT0A 3H39A 3FJKA 41BIA 8ICVA 4EEBA 4X5VA 3O49A 2VSAA 4DOCA 3MDAA 3R4SA 3F1RA 4LO2C 2BPGA 4X4QA 8ICSA 4E7XA 4I2EA 2MC2A 2DVIA 4DCKC 1MIVA 3RJJA 4IQTA 3S8KA 1MIWA 5J0SA 4OW4A 3WO3A 2NVHA 1BPBA 3IM5A 4L4HA 1TWEA 2KLLA 3BA7A 4GOVA 4R65A 4XJEA 7ICEA 2Q9XA 3O3QA 1DZDA 4KB6A 3FJIA 1T9FA 1R8OA 3UPSA 4AT7A 5HRFA 1JT4A 2M2TA 4LO8B 2BE3A 4P4OA 5HC9A 3CRGA 3C5GA 3ER9B 1CE7B 2ZH7A 4KLSA 5DEDA 1QQLA 4RWNA 1YYNA 2DR5A 4Q9GA 4I2IA 1KDHA 4IY8A 2I9GA 4MF8A 3WINC 4Z6DA 2K8RA 4QBVA 3MPPG 4X4OA 1SR4A 4Q9PA 4ZGRB 2F8XC 2NS2A 2FCLA 5HHHA 3ISDA 4A7KA 3HIYA 4FGFA 4DEPA 1Z4SA 3RSJA 4ZKTB 1JQZA 4TUSA 4TUQA 4LVSA 3RTIB 4GP0A 5DECA 2ERMA 4I4VA 4EEDA 4RQ0A 2Z49A 4PGYA 4YMMA 4NXUA 2BEAA 4P0JA 2PXIA 2Y9GA 4JLXA 4FHVA 4RQ8A 5J0RA 4JKQA 4M9HA 1ZJNA 4J2YA 4K4GA 4O68A 1OQLB 3H38A 4IQUA 3O5WB 4QC4A 8ICFA 1EYLA 3CA3A 4YMNA 1L2HA 4UB1A 4LO2A 5J2IA 3OVAA 2DR8A 7ICFA 1IJTA 4RWQA 4X3AA 4S3NA 2D7RA 5IILA 4I4YA 4XFTA 4J2SA 2R9KB 2NM1A 1MQ2A 1Z0HA 3RH4A 4JWMA 2DR7A 2LIQA 4I28A 4NXXA 3RJGA 2AAIB 8ICXA 1AFCA 1NOMA 5BOLA 3HW8A 1FV3A 3BAUA 4RQ1A 3RH5A 4QD2C 1BPXA 3ZC8A 2AQZA 5IIJA 2AFGA 2Y9WC 2NRKA 1JMSA 5HRLA 1YXWA 8ICAA 3WINA 3NBCA 3AZWA 1R8BA 1MIYA 4O67A 4RWPA 1ZQDA 4GXIA 3WFOA 2DS0A 2QN4A 3TFRA 1ZQHA 3H6SE 4X39A 2BFHA 4WC6A 3LLPA 4TURA 4I4RA 9ICIA 2B51A 2BCVA 1HCEA 3POKA 4LEYA 3ZXDA 3V0BB 3C5FA 4G6JA 8ICTA 3AUOA 8ICMA 2IWTB 4EP7A 3JPPA 1GGPB 4I29A 5D62A 4RQ6A 4I7IA 2ET2A 4WC4A 3C2LA 5TZVA 3CA5A 1FV2A 4QZ9A 8ICNA 5IIOA 4O5KA 1YTOA 1ZQRA 4I27A 4KLQA 8I1BA 1S0BA 3FGMA 4R63A 3JPQA 4K4IA 2M2UA 4XKIA 5JTGA 3LQCB 4UBBA 7ICPA 3V7JA 3BAVA 1UEVA 4I4PA 4X4VA 1KNMA 4OUJA 1V6UA 4QZHA 5EHAA 2ISOA 1S0FA 3I2XA 2ZH1A 7ICRA 4NXTA 4OEFA 4P0LA 5GAQA 1K5UA 5CB1A 2VU9A 3OVBA 4IQVA 1ZQZA 4UAWA 2B56A 4K97A 5J0YA 1MC9A 3UQ2A 4M2YA 2WBCA 4QZGA 4AT8A 4WQLA 5CA7A 4IG8A 4KC3A 5D61A 4JRAA 3MDCA 5CHGA 1ONKB 2DR9A 1EVTA 3JPOA 3WO4A 3RMYA 2F2FC 5CWRA 1EPWA 3JUTA 9ICSA 9ICRA 5IIKA 1FQ9A 4DOBA 4GXJA 3V72A 4FHWA 4FH5A 3UJ4A 4JAWA 5BQUC 3OJVA 3WO2A 1TOOA 4YMOA 5BXSA 5HHIA 1ZQOA 3E8LC 2UUSA 4I96A 1JT7A 3RTJB 3T8SA 3FJ9A 5I1BA 1KNYA 1BPZA 4OWLA 4QKSA 4LO1A 4HJJA 1RG8A 1N4KA 3ZXGA 3CK6A 4WOYA 4ISRA 4I2JA 2HN1A 3CA1A 1Q79A 4UBCA 4O5EA 1WBAA 3JRRA 3PMLA 3A07A 3ZX7A 4RPYA 4ZA3B 4I2BA 5FZUA 3B9UA 4X4RA 4XFUA 1BFBA 3OJMA 4K4HA 3RJIA 4I4XA 4JWNA 3MBYA 4MKPA 2ISPA 3JPSA 5EG6C 1AVWB 5EC5A 1HUZA 8ICIA 4EV6A 2KH2A 3V79C 4WC3A 3ISBA 2YUGA 3WMUA 4WC0A 4IQWA 3HN1A 4YOLA 3WFSC 9ICLA 1KEJA 8ICKA 3AKIA 3V0BA 1F5AA 4K96A 1BFCA 4H75A 2BPFA 3TC2A 2FGFA 2HN2A 4CJMA 4FO6A 1DLLA 4EBKA 5DDYA 1IRPA 5J2CA 2VUAA 2GO2A 3AU6A 4DENA 2ZH9A 4WBYA 4P6AA 1EV2A 4TLPA 3OWGA 3O44A 3AH4A 2F2FA 1ZQTA 2RSTA 1BLAA 8ICBA 4I0UA 2D43A 4ZFUB 3EF2A 4WC7A 3FJDA 1M2TB 1J0SA 5HRDA 1PZZA 1JN3A 1G9AA 3V7LA 4KLMA 4G6MA 3F62B 1ZQJA 1ZQUA 3ZC9A 3C9ZA 4KLEA 1MQ3A 9ICFA 5BXRA 4OWKA 3UPQA 4KEIA 2BEBA 4PHEA 8ICJA 4Z9WB 1YLQA 3MGHA 4J23B 1JTCA 3WFRE 2RQ9A 2O1PA 3ISCA 9ICOA 4LO3C 2DRAA 4O5CA 2NP0A 1JLXA 4O6AA 3IM7A 2IHOA 3NKUA 4WH5A 3OGGA 3B0XA 4UY4A 5J29A 4XFSA 6I1BA 4LT6A 1ZJMA 9ICEA 3NBEA 2O5AA 4WC5A 3HX0A 3FJ8A 1XSLA 4KM5A 4PHAA 4X38A 4M9NA 2D20A 2FMSA 2EWRA 1HWNB 4E8FA 4K9BA 1ISYA 3S8JA 1XZZA 2NZ9A 4UD5A 4LZDA 3FUOA 4I4QA 2FDBM 2E4MC 3NYBA 4AT9B 4ZBVB 4DO9A 3V0AB 4M0AA 1QQKA 3WMVA 1RPLA 3GDXA 2PFPA 3LTQA 1WD3A 5CFTA 1DJSB 1FGAA 21BIA 3UQ0A 4I4OA 8ICCA 4Z6CA 5F8WA 1NUNA 4RT2A 4RPZA 4QZCA 1Q04A 3LK9A 4F5PA 4USPA 3FJFA 4QZIA 1ZQLA 2ZH3A 1ISZA 4KEJA 1XSNA 1HWMB 5BPCA 4RQ2A 2FO1A 1V6WA 3BRFA 4KLOA 4IZXA 1OU5A 3BADA 1DFQA 2Z48A 9ICBA 4UAYA 1JT5A 1ZQBA 1ABRB 4LZGA 3CU1B 3R4UA 1ZQKA 2BCUA 3HBWA 4H04A 5IIMA 4K9AA 3H3AA 1S0LA 3VSFA 2PFQA 2MIBA 5HRGA 4X37A 1K5VA 4RQ5A 3CRIA 4M5DA 1ISWA 3B0YA 4KLFA 3IAGC 3PG0A 1D0HA 4FO1A 9ICGA 1MD6A 5E24E 4WC1A 2DRBA 3H6RB 3O4CA 2I1BA 3RJFA 3NVOA 4P4PA 2K43A 3AQLA 1XSPA 4I2CA 3HOMA 2P23A 2FFUA 4M04A 3P6IA 3C18A 31BIA 3MGIA 4QKRA 4ENDA 5F90A 4RT3A 1YBIA 4WCWA 1V6XA 2KI6B 9ICKA 4KBBA 9ICUA 5JMCA 2ZQOA 5DVHA 4GOYA 3AKGA 4LEWA 5EOZA 4TUPA 4WC2A 4HX0A 2DRYA 5IINA 3BAGA 1R8CA 1AVUA 5DDMA 1R8NA 3ILAA 4RQ7A 4X4SA 2HHPA 3TFSA 4MFCA 2E4MA 1E0OA 4OEGA 4J2XA 4F5OA 3PUBA 1HCDA 4G9MA 4LO0C 1R89A 3RJEA 7ICTA 1RY7A 3VSZA 5FZYA 4R6UB 2D22A 4PPXA 1WBCA 4GAFA 3BA5A 5D4BA 1TTUA 1WOTA 3BA4A 3VEQA 4KLUA 4PHDA 4LO7B 1S0EA 3JCFA 5CFSA 8ICRA 4JKXB 1AXMA 3BAHA 4YN4A 1P63A 4I0YA 1HUOA 3HALA 4Z6FA 3P6JA 4I2FA 5FZZA 5HRIA 3I2AA 2BBJA 1DFCA 3WFQE 4ATBB 3JZ0A 1BA7A 5DUYA 2BCQA 4MZFB 4NXVA 1S0CA 1DIWA 4MFFA 4AN7B 4I2GA 4O9MA 2XOAA 1T4QA 4QZDA 1FMZA 3UDAA 2ZH2A 4UB2A 1RZTA 2GA9D 4WBZA 4I37A 1JT3A 5DSSB 7ICVA 4LO7C 4J2KA 1R8AA 4I2SA 4YCXA 4AT7B 4MFAA 4KEKA 5CP2A 4P4MA 5CR0A 3VWCA 1XG6A 1XHBA 1Q1UA 5J2EA 4QZEA 3CA6A 2MLLB 4FHXA 1I1EA 4G1RA 1S0DA 2VLCA 3A23A 1ZQQA 5J2HA 4P2HA 2M49A 3OJ2A 1IRAX 5BP5C 4EGWA 1IHKA 8ICOA 9ICNA 2BPCA 9ILBA 5HPZA 3N7MA 3SNVA 1IOBA 1VCLA 4M9JA 1G9DA 2M2VA 5CFUA 3UD9A 1ITBA 7ICNA 4P0KA 8ICUA 5J2GA 3FJHA 9ICMA 5BOWA 5J2AA 4ZLBB 2NYYA 9ICXA 5BVPI 2Y9FA 7ICSA 1ZQMA 1ILR1 1TIEA 5B3PA 4NY8A 3UD8A 2ZH8A 9ICQA 4X0BA 4I3NA 4QBCA 4I2AA 4O69A 1BLDA 1JQRA 5DBCA 1ZQPA 1SR4C 4F83A 4RWOA 3NBNA 2IUBA 1TVAA 9ICVA 4UB4A 4I8MA 5J0OA 4K8VA 4DOAA 3Q7YA 1RMLA 5HRKA 1PUUB 3AH2A 1W3FA 5F8SA 2BCSA 2HW9A 2VXTI 3HJ4A 1II4A 4X4TA 4EBJA 2GZBA 1UEUA 2K4AB 5JLVA 1ZQAA 2HWMA 4X4UA 5J2FA 3I29B 3BTAA 1Q78A 3UXNA 1ZQEA 2ZHAA 1HKNA 3MCRA 2Y9XE 4WQKA 4UAZA 1TWMA 4PH5A 7ICHA 2VANA 5CJ7A 4M47A 4XQ8A 4Z6EA 2ZHBA 1TP0A 3K1XA 3PNCA 4I2DA 2KI4A 4OAIZ 3FUQA 4F5NA 4A7ZA 4RQ4A 5BQUA 4ATBA 2FFVA 5BOMA 3NBDA 3BRGC 3BAQA 3FJEA 2FMQA 1GPJA 5BP5A 1TFWA 4X4PA 5HREA 1G9BA 1SZ6B 2D24A 1HWOB 9ICTA 4UD4A 1CVSA 4IY9A 5J2JA 5J0XA 3AKFA 4R64A 3UD7A 1ZQSA 8ICPA 1BFFA 9ICPA 1ZQYA 3JPRA 4D0TA 2ESUA 4IONA 4LEVA 4NLZA 4I2HA 5BXTA 4OWJA 4KLHA 3OBTA 5F2VO 4OEEA 3AZVA 4EEEB 1ZQXA 4NKTA 2BCRA 4PC4A 7ICUA 4GAIA 2QYIB 3BX1C 4L4IA 4I1EA 3OUYB 1VFGA 9ICCA 2M2WA 3VT2A 4K99A 3OV7A 2Q3NB 1Q03A 7ICMA 4KLIA 4OAFA 3AQMA 4QALA 2PBEA 3QR5A 3HWTA 2B4VA 4G9NA 1AF9A 4HR6C
chains in the Genus database with same CATH topology
1EPWA 3HMYA 3JUTA 1V6XA 2DREA 2KI6B 4K98A 4KBBA 4JP0A 3W9TA 5JMCA 2ZQOA 1FQ9A 4GOYA 3AKGA 5DVHA 4LEWA 3CAHA 3Q7WA 4QO3A 3FJBA 3FJJA 3O4AA 4HX0A 5G00A 2DRYA 4D0ZA 3BAGA 2VSEA 1FWVA 1AVUA 4IYBA 1R8NA 3UJ4A 3UJ0A 2HZ9A 1IT0A 4JAWA 2ZR1B 3ILAA 3FJKA 5BQUC 5DZUA 41BIA 1PC8B 3OJVA 3WO2A 1TOOA 3O49A 5BXSA 2E4MA 1E0OA 4OEGA 4J2XA 3PUBA 2VSAA 3E8LC 1HCDA 4G9MA 4LO0C 3R4SA 3F1RA 2X2TA 4LO2C 4EFQA 1RY7A 1M16A 2UUSA 3VSZA 5FZYA 4I96A 1JT7A 4R6UB 3RTJB 2MC2A 2D22A 3FJ9A 3T8SA 1WBCA 1DZCA 5I1BA 1AVXB 4DCKC 4GAFA 4HR6C 3BA5A 3S8KA 4OW4A 3WO3A 2NVHA 1TTUA 4OWLA 4QKSA 4LO1A 3BA4A 1XYFA 3VEQA 4HJJA 5B3QA 1RG8A 1N4KA 3AJ6A 3IM5A 4L4HA 3ZXGA 4LO7B 1TWEA 1S0EA 2KLLA 4WOYA 3BA7A 5CFSA 4QD2B 4GOVA 3RMXA 4ISRA 4XJEA 2Q9XA 3O3QA 1DZDA 4KB6A 4JKXB 1AXMA 3CA1A 3FJIA 3BAHA 1T9FA 3IIRA 1R8OA 3H6QA 1WBAA 3JRRA 3P53A 1BFGA 1JT4A 1P63A 4I0YA 2RG9B 4LO8B 3A07A 2ZQNA 3HALA 3ZX7A 5B2HA 4ZA3B 5FZUA 3P6JA 5FZZA 3B9UA 4IHZA 3FJAA 4XFUA 4H9WA 3CRGA 4ZOTA 1BFBA 2NTDA 3OJMA 3ER9B 1CE7B 3I2AA 1DFCA 4JQ0A 4I4XA 1ISVA 4MKPA 1QQLA 5EG6C 1BA7A 4Z8SB 5DUYA 4MZFB 1AVWB 5EC5A 1YYNA 2KH2A 1S0CA 4NXVA 1DIWA 3V79C 4AN7B 4LEZA 4N7RA 4LO3A 1TFMB 4Q9GA 2YUGA 2XOAA 4IY8A 1T4QA 3WMUA 1QXMA 1S0GA 3KMVA 1FMZA 3UDAA 3WINC 2K8RA 3HN1A 1I1BA 4YOLA 2GA9D 4QBVA 3MPPG 1SR4A 3AKIA 2VXRA 3CRHA 4I37A 1JT3A 1G82A 3V0BA 5DSSB 4Q9PA 4LO7C 4I1BA 4ZGRB 4K96A 1BFCA 4J2KA 1IILA 4I2SA 2F8XC 4H75A 2NS2A 4KEKA 3TC2A 2FCLA 2D23A 2FGFA 4CJMA 4A7KA 4FGFA 5D63A 3VWCA 1XG6A 1XHBA 4DEPA 1Q1UA 1Z4SA 1DLLA 3RSJA 1JQZA 4ZKTB 3CA4A 4I4UA 4ZFYB 1IRPA 3CA6A 2MLLB 2VUAA 4D8HA 1I1EA 4G1RA 2KKIA 2GO2A 1S0DA 4NXWA 3OGFA 4DENA 3RTIB 2VLCA 3A23A 4GP0A 2ERMA 2J3PA 4P6AA 4I4VA 1EV2A 1G9CA 4TLPA 2Z49A 3A21A 1UPSA 3OWGA 2M49A 3O44A 3AH4A 2F2FA 3OJ2A 1IRAX 5BP5C 1IHKA 4HA2A 4NXUA 3ERCC 2BEAA 4P0JA 4OAGA 3O4OA 2RSTA 9ILBA 1BLAA 3N0KA 5HPZA 2D43A 3N7MA 4ZFUB 3SNVA 1IOBA 2Y9GA 4LO1C 7I1BA 3HSMA 4JLXA 1DQOA 3EF2A 1VCLA 4JKQA 1G9DA 4USOA 3FJDA 1M2TB 1J0SA 5CFUA 1PZZA 4JPZA 4J2YA 4O68A 3UD9A 1G9AA 1ITBA 4P0KA 1OQLB 4G6MA 3F62B 1JLYA 3FJHA 3ZC9A 3C9ZA 5BOWA 3MALA 3O5WB 4QC4A 4ZLBB 2NYYA 5BXRA 1EYLA 4OWKA 3CA3A 3Q7XA 1L2HA 1F31A 5BVPI 4MZHA 2Y9FA 4LO2A 1DQGA 4KEIA 2BEBA 1ILR1 1IJTA 1TIEA 4Z9WB 4X3AA 2X2SA 4J23B 1JTCA 2D7RA 4OAHA 4I4YA 5B3PA 1HIBA 2L5XA 3N7KA 3O4DA 2RQ9A 4XFTA 4J2SA 3UD8A 2R9KB 2NM1A 4I3NA 4QBCA 4LO3C 1Z0HA 4O69A 2NP0A 1BLDA 3O4BA 4I6IA 1JLXA 2LIQA 3CQAA 4O6AA 4NXXA 3IM7A 2IHOA 3NKUA 1ISXA 1SR4C 4F83A 3V0AA 4WH5A 2AAIB 3OGGA 4UY4A 3NBNA 3CA0A 1AFCA 4I8MA 4K8VA 4XFSA 3Q7YA 1RMLA 6I1BA 1FV3A 3BAUA 4ISQA 3OBRA 4QD2C 3NBEA 1PUUB 2AXMA 1NZKA 3AH2A 2P39A 1W3FA 3FFZA 3IM6A 5F8SA 3FJ8A 4AN6A 4KM5A 1WD4A 3BB2A 4GP3A 4X38A 3ZC8A 2AQZA 1YF8B 2AFGA 2Y9WC 2D20A 2HW9A 2VXTI 2DRZA 2EWRA 1II4A 2D7IA 5BXPA 1HWNB 1YXWA 1W3AA 1ISYA 3VT1A 3S8JA 1XZZA 4K9BA 2NZ9A 3WINA 2GZBA 3NBCA 2K4AB 3AZWA 5JLVA 3FUOA 4O67A 3D7WB 2HWMA 4I4QA 2FDBM 2E4MC 3I29B 2DS0A 3BTAA 2WRYA 2QN4A 4ZBVB 3N7JA 3H6SE 1HKNA 4IQPA 4X39A 3MCRA 2BFHA 2Y9XE 3V0AB 4WQKA 1QQKA 1TWMA 3LLPA 3WMVA 4I4RA 2B51A 1AVAC 3LTQA 1WD3A 5CFTA 1DJSB 1FGAA 1HCEA 21BIA 3POKA 4LEYA 3ZXDA 1TP0A 3V0BB 3K1XA 4I4OA 4G6JA 3FJCA 1NUNA 3NJ5A 5F8WA 2IWTB 2KI4A 3FUQA 4OAIZ 1GGPB 1Q04A 4A7ZA 5D62A 4USPA 3FJFA 5BQUA 2FFVA 3A22A 3AJ5A 4II0A 4EB2B 4I7IA 3NBDA 3BRGC 3BAQA 3FJEA 4WBCA 2ET2A 1GPJA 5BP5A 3CA5A 1FV2A 3H6RA 2LIEA 1BARA 4LO0A 1ISZA 1G9BA 4KEJA 1HWMB 2D44A 2GAFD 1SZ6B 2D24A 2FO1A 1HWOB 5FNWA 3K7DA 1V6WA 3BRFA 4IZEA 1YTOA 4IZXA 1CVSA 4EFRA 8I1BA 3BADA 1S0BA 1DFQA 4IY9A 2Z48A 3PHZA 3FGMA 3AH1A 3N7LA 3AKHA 3AKFA 1JT5A 1FMMS 3UD7A 1ABRB 4EFPA 1FWUA 1BFFA 4XKIA 3CU1B 1BASA 4D0TA 2ESUA 4IONA 4LEVA 3R4UA 1JY0A 3HBWA 4H04A 4A7YA 4K9AA 1S0LA 4ZFWB 3VSFA 3BAVA 4I4PA 5BXTA 2MIBA 4X37A 1KNMA 1K5VA 4OUJA 3BRDA 1V6UA 3CRIA 2HWAA 4OWJA 1PWAA 5EHAA 1ISWA 1S0FA 3I2XA 4FVVA 4NXTA 4OEFA 3IAGC 3OBTA 3PG0A 1D0HA 4MZGB 4OEEA 4P0LA 3AZVA 5GAQA 1K5UA 4FO1A 3VUOA 1MD6A 4JLZA 5E24E 2VU9A 3WA1A 4EEEB 1A8DA 4PC4A 3H6RB 2B56A 3O4CA 4K97A 1RZOB 2I1BA 4GAIA 3ER8C 1FN0A 1PUMB 2QYIB 1MC9A 3BX1C 2WBCA 4L4IA 4I1EA 1V6VA 1HWPB 5CHEA 2K43A 3PMEA 3VT2A 4K99A 2D1ZA 3HOMA 4WQLA 2P23A 3VT0A 5FNXA 2Q3NB 4KC3A 3QYDA 5D61A 1Q03A 2FFUA 4JRAA 1Z2VA 1W3GA 3P6IA 1ONKB 4OAFA 4EKXB 31BIA 4QKRA 4ENDA 4QALA 5F90A 1EVTA 4Q91A 3QR5A 3WO4A 2B4VA 4F34A 4G9NA 4I4SA 3RMYA 1AF9A 2F2FC 1YBIA 3BAOA 5F8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EPW A;  3HMY A;  3JUT A;  1V6X A;  2DRE A;  2KI6 B;  4KBB A;  4JP0 A;  3W9T A;  5JMC A;  2ZQO A;  1FQ9 A;  4GOY A;  3AKG A;  5DVH A;  3CAH A;  3Q7W A;  4QO3 A;  3FJB A;  3FJJ A;  3O4A A;  5G00 A;  2DRY A;  4D0Z A;  3BAG A;  2VSE A;  1FWV A;  1AVU A;  4IYB A;  1R8N A;  3UJ4 A;  3UJ0 A;  2HZ9 A;  1IT0 A;  4JAW A;  2ZR1 B;  3ILA A;  3FJK A;  5BQU C;  5DZU A;  41BI A;  1PC8 B;  3OJV A;  3WO2 A;  1TOO A;  3O49 A;  5BXS A;  2E4M A;  1E0O A;  4OEG A;  4J2X A;  3PUB A;  2VSA A;  3E8L C;  1HCD A;  4G9M A;  4LO0 C;  3R4S A;  3F1R A;  2X2T A;  4LO2 C;  4EFQ A;  1RY7 A;  1M16 A;  2UUS A;  3VSZ A;  5FZY A;  4I96 A;  1JT7 A;  4R6U B;  3RTJ B;  2MC2 A;  2D22 A;  3FJ9 A;  3T8S A;  1WBC A;  1DZC A;  5I1B A;  1AVX B;  4DCK C;  4GAF A;  4HR6 C;  3BA5 A;  3S8K A;  4OW4 A;  3WO3 A;  2NVH A;  1TTU A;  4OWL A;  4QKS A;  4LO1 A;  3BA4 A;  1XYF A;  3VEQ A;  4HJJ A;  1RG8 A;  1N4K A;  3AJ6 A;  3IM5 A;  4L4H A;  3ZXG A;  4LO7 B;  1TWE A;  1S0E A;  2KLL A;  3BA7 A;  4QD2 B;  4GOV A;  3RMX A;  4ISR A;  2Q9X A;  3O3Q A;  1DZD A;  4JKX B;  1AXM A;  3CA1 A;  3FJI A;  3BAH A;  1T9F A;  3IIR A;  1R8O A;  3H6Q A;  1WBA A;  3JRR A;  3P53 A;  1BFG A;  1JT4 A;  1P63 A;  4I0Y A;  2RG9 B;  4LO8 B;  3A07 A;  2ZQN A;  3HAL A;  3ZX7 A;  5B2H A;  4ZA3 B;  5FZU A;  3P6J A;  5FZZ A;  3B9U A;  4IHZ A;  3FJA A;  4XFU A;  4H9W A;  3CRG A;  4ZOT A;  1BFB A;  2NTD A;  3OJM A;  1CE7 B;  3I2A A;  1DFC A;  4JQ0 A;  4I4X A;  1ISV A;  1QQL A;  5EG6 C;  1BA7 A;  4Z8S B;  5DUY A;  1AVW B;  5EC5 A;  1YYN A;  2KH2 A;  1S0C A;  1DIW A;  3V79 C;  4AN7 B;  4LO3 A;  1TFM B;  4Q9G A;  2YUG A;  2XOA A;  4IY8 A;  1T4Q A;  3WMU A;  1QXM A;  1S0G A;  3KMV A;  1FMZ A;  3UDA A;  3WIN C;  2K8R A;  3HN1 A;  1I1B A;  4YOL A;  4QBV A;  3MPP G;  1SR4 A;  3AKI A;  2VXR A;  3CRH A;  4I37 A;  1JT3 A;  1G82 A;  3V0B A;  5DSS B;  4Q9P A;  4LO7 C;  4I1B A;  4ZGR B;  1BFC A;  4J2K A;  1IIL A;  4I2S A;  2F8X C;  4KEK A;  3TC2 A;  2D23 A;  2FGF A;  4CJM A;  4A7K A;  4FGF A;  5D63 A;  3VWC A;  1XG6 A;  1XHB A;  4DEP A;  1Q1U A;  1Z4S A;  1DLL A;  3RSJ A;  1JQZ A;  4ZKT B;  3CA4 A;  4I4U A;  4ZFY B;  1IRP A;  3CA6 A;  2MLL B;  2VUA A;  4D8H A;  1I1E A;  4G1R A;  2KKI A;  2GO2 A;  1S0D A;  3OGF A;  4DEN A;  3RTI B;  2VLC A;  3A23 A;  4GP0 A;  2ERM A;  2J3P A;  4P6A A;  4I4V A;  1EV2 A;  1G9C A;  4TLP A;  2Z49 A;  3A21 A;  1UPS A;  2M49 A;  3O44 A;  3AH4 A;  2F2F A;  3OJ2 A;  1IRA X;  5BP5 C;  1IHK A;  4HA2 A;  2BEA A;  4P0J A;  3O4O A;  2RST A;  9ILB A;  1BLA A;  3N0K A;  5HPZ A;  2D43 A;  3N7M A;  4ZFU B;  3SNV A;  1IOB A;  2Y9G A;  4LO1 C;  7I1B A;  3HSM A;  1DQO A;  3EF2 A;  1VCL A;  4JKQ A;  1G9D A;  4USO A;  3FJD A;  1M2T B;  1J0S A;  1PZZ A;  4JPZ A;  4J2Y A;  3UD9 A;  1G9A A;  1ITB A;  4P0K A;  1OQL B;  4G6M A;  3F62 B;  1JLY A;  3FJH A;  3ZC9 A;  3C9Z A;  5BOW A;  3MAL A;  3O5W B;  4QC4 A;  4ZLB B;  2NYY A;  5BXR A;  1EYL A;  4OWK A;  3CA3 A;  3Q7X A;  1L2H A;  1F31 A;  5BVP I;  2Y9F A;  4LO2 A;  1DQG A;  4KEI A;  2BEB A;  1ILR 1;  1IJT A;  1TIE A;  4Z9W B;  4X3A A;  2X2S A;  4J23 B;  1JTC A;  2D7R A;  4I4Y A;  1HIB A;  2L5X A;  3N7K A;  3O4D A;  2RQ9 A;  4XFT A;  4J2S A;  3UD8 A;  2R9K B;  2NM1 A;  4I3N A;  4QBC A;  4LO3 C;  1Z0H A;  2NP0 A;  1BLD A;  3O4B A;  4I6I A;  1JLX A;  2LIQ A;  3CQA A;  3IM7 A;  2IHO A;  1ISX A;  1SR4 C;  4F83 A;  3V0A A;  2AAI B;  3OGG A;  3NBN A;  3CA0 A;  1AFC A;  4I8M A;  4XFS A;  3Q7Y A;  1RML A;  6I1B A;  1FV3 A;  3BAU A;  4ISQ A;  3OBR A;  4QD2 C;  3NBE A;  1PUU B;  2AXM A;  1NZK A;  3AH2 A;  2P39 A;  1W3F A;  3FFZ A;  3IM6 A;  5F8S A;  3FJ8 A;  4AN6 A;  1WD4 A;  3BB2 A;  4GP3 A;  4X38 A;  3ZC8 A;  2AQZ A;  1YF8 B;  2AFG A;  2Y9W C;  2D20 A;  2HW9 A;  2VXT I;  2DRZ A;  1II4 A;  2D7I A;  5BXP A;  1HWN B;  1YXW A;  1W3A A;  1ISY A;  3VT1 A;  3S8J A;  1XZZ A;  2NZ9 A;  3WIN A;  2GZB A;  3NBC A;  2K4A B;  3AZW A;  5JLV A;  3FUO A;  3D7W B;  2HWM A;  4I4Q A;  2FDB M;  2E4M C;  3I29 B;  2DS0 A;  3BTA A;  2WRY A;  2QN4 A;  4ZBV B;  3N7J A;  3H6S E;  1HKN A;  4IQP A;  4X39 A;  2BFH A;  2Y9X E;  3V0A B;  1QQK A;  1TWM A;  3LLP A;  3WMV A;  4I4R A;  1AVA C;  3LTQ A;  1WD3 A;  1DJS B;  1FGA A;  1HCE A;  21BI A;  3POK A;  3ZXD A;  1TP0 A;  3V0B B;  3K1X A;  4I4O A;  4G6J A;  3FJC A;  1NUN A;  3NJ5 A;  5F8W A;  2IWT B;  2KI4 A;  3FUQ A;  1GGP B;  1Q04 A;  4A7Z A;  5D62 A;  4USP A;  3FJF A;  5BQU A;  2FFV A;  3A22 A;  3AJ5 A;  4II0 A;  4EB2 B;  4I7I A;  3NBD A;  3BRG C;  3BAQ A;  3FJE A;  4WBC A;  2ET2 A;  5BP5 A;  3CA5 A;  1FV2 A;  3H6R A;  2LIE A;  1BAR A;  4LO0 A;  1ISZ A;  1G9B A;  4KEJ A;  1HWM B;  2D44 A;  1SZ6 B;  2D24 A;  2FO1 A;  1HWO B;  5FNW A;  1V6W A;  3BRF A;  4IZE A;  1YTO A;  4IZX A;  1CVS A;  4EFR A;  8I1B A;  3BAD A;  1S0B A;  1DFQ A;  4IY9 A;  2Z48 A;  3PHZ A;  3FGM A;  3AH1 A;  3N7L A;  3AKH A;  3AKF A;  1JT5 A;  1FMM S;  3UD7 A;  1ABR B;  4EFP A;  1FWU A;  1BFF A;  4XKI A;  3CU1 B;  1BAS A;  4D0T A;  2ESU A;  4ION A;  3R4U A;  1JY0 A;  3HBW A;  4H04 A;  4A7Y A;  1S0L A;  4ZFW B;  3VSF A;  3BAV A;  4I4P A;  5BXT A;  2MIB A;  4X37 A;  1KNM A;  1K5V A;  4OUJ A;  3BRD A;  1V6U A;  3CRI A;  2HWA A;  4OWJ A;  1PWA A;  5EHA A;  1ISW A;  1S0F A;  3I2X A;  4FVV A;  4OEF A;  3IAG C;  3OBT A;  3PG0 A;  1D0H A;  4OEE A;  4P0L A;  3AZV A;  5GAQ A;  1K5U A;  3VUO A;  1MD6 A;  5E24 E;  2VU9 A;  3WA1 A;  4EEE B;  1A8D A;  4PC4 A;  3H6R B;  3O4C A;  1RZO B;  2I1B A;  4GAI A;  1FN0 A;  1PUM B;  2QYI B;  1MC9 A;  3BX1 C;  2WBC A;  4L4I A;  4I1E A;  1V6V A;  1HWP B;  2K43 A;  3PME A;  3VT2 A;  2D1Z A;  3HOM A;  2P23 A;  3VT0 A;  5FNX A;  2Q3N B;  4KC3 A;  3QYD A;  5D61 A;  1Q03 A;  2FFU A;  4JRA A;  1Z2V A;  1W3G A;  3P6I A;  1ONK B;  4EKX B;  31BI A;  4QKR A;  4END A;  4QAL A;  5F90 A;  1EVT A;  4Q91 A;  3QR5 A;  3WO4 A;  4F34 A;  4G9N A;  4I4S A;  3RMY A;  1AF9 A;  2F2F C;  1YBI A;  3BAO A;  5F8Y A; 
#chains in the Genus database with same CATH topology
 3W9T A;  4XRH A;  4NXZ A;  3FJB A;  4D0Z A;  1FWV A;  4IYB A;  2HZ9 A;  2ZR1 B;  4YD2 A;  5DZU A;  1PC8 B;  4AT8 B;  9ICW A;  2X2T A;  4EFQ A;  1M16 A;  4QZF A;  1DZC A;  4NM2 A;  1AVX B;  4QZA A;  8ICY A;  4FHP A;  1XYF A;  3UXO A;  5B3Q A;  3AJ6 A;  4QD2 B;  3RMX A;  3OVS A;  8ICH A;  3IIR A;  3H6Q A;  2W9M A;  4NLN A;  1UET A;  3P53 A;  5HR9 A;  1BFG A;  5DKW A;  5J0P A;  2RG9 B;  5B2H A;  2ZQN A;  4NLK A;  1ZQG A;  4IHZ A;  8ICQ A;  3FJA A;  5III A;  4H9W A;  4M9L A;  4ZOT A;  1JAJ A;  4XUS A;  2NTD A;  4X0A A;  4JQ0 A;  1ISV A;  4E80 A;  3OGU A;  9ICH A;  1ZQF A;  4Z8S B;  5D49 A;  4LEZ A;  4N7R A;  1BPE A;  4LO3 A;  1TFM B;  4X4N A;  1ZQC A;  1QXM A;  1S0G A;  3KMV A;  2GWS A;  1I1B A;  2Q66 A;  4NKU A;  8ICW A;  3CRH A;  2VXR A;  1G82 A;  4I1B A;  1IIL A;  4XA5 A;  8ICE A;  3V7K A;  5J0T A;  2D23 A;  5DB8 A;  5D63 A;  4PGQ A;  3CA4 A;  4I4U A;  4ZFY B;  5DB6 A;  2PFN A;  4D8H A;  3AU2 A;  2KKI A;  4NXW A;  3OGF A;  5HRH A;  5J0Q A;  2J3P A;  1G9C A;  3A21 A;  1UPS A;  4HA2 A;  5DB7 A;  3ERC C;  4FHY A;  4OAG A;  3O4O A;  1FA0 A;  5DB9 A;  3N0K A;  3RJK A;  3JPT A;  4LO1 C;  7I1B A;  7ICJ A;  3HSM A;  1ZQW A;  2IHM A;  1DQO A;  3K75 D;  4F5R A;  4USO A;  4JPZ A;  4GXK A;  3UXP A;  1JLY A;  3MAL A;  7ICL A;  3Q7X A;  4PHP A;  1F31 A;  4MZH A;  1DQG A;  3OUY A;  2X2S A;  4OAH A;  3C2M A;  1HIB A;  2L5X A;  3N7K A;  3O4D A;  2ZH5 A;  5DBA A;  4AT9 A;  4KLD A;  1V4A A;  4YD1 A;  3O4B A;  4I6I A;  3CQA A;  4XQ7 A;  1ISX A;  3V0A A;  3AQN A;  3CA0 A;  1ZQI A;  1PX5 A;  4ISQ A;  3OBR A;  2AXM A;  1NZK A;  2P39 A;  3FFZ A;  3IM6 A;  4AN6 A;  8ICL A;  1WD4 A;  3BB2 A;  4GP3 A;  1YF8 B;  2BBH A;  2DRZ A;  2D7I A;  5BXP A;  1BPY A;  3VT1 A;  1W3A A;  4UB3 A;  3D7W B;  1NO5 A;  1VJ7 A;  2WRY A;  4KLJ A;  2FMP A;  3N7J A;  4PGX A;  4IQP A;  2ID1 A;  8ICG A;  3RH6 A;  1AVA C;  4R66 A;  7ICQ A;  3C66 A;  3FJC A;  3NJ5 A;  4QZB A;  3JPN A;  3A22 A;  3AJ5 A;  5D46 A;  4II0 A;  4EB2 B;  7ICG A;  3HJ1 A;  4WBC A;  9ICA A;  1ZQN A;  4QZ8 A;  3H6R A;  2LIE A;  1BAR A;  4LO0 A;  2ZH4 A;  2D44 A;  2GAF D;  5FNW A;  3K7D A;  4IZE A;  3H37 A;  4EFR A;  3PHZ A;  3AH1 A;  3N7L A;  3AKH A;  1FMM S;  4EFP A;  1FWU A;  4M9G A;  7ICI A;  1BAS A;  9ICJ A;  1TFY A;  2RFF A;  1JY0 A;  4A7Y A;  4ZFW B;  5HRB A;  2ZH6 A;  4F5Q A;  3BRD A;  2HWA A;  1PWA A;  4FVV A;  5J2D A;  4MZG B;  7ICO A;  3VUO A;  4JLZ A;  3WA1 A;  2PFO A;  4UB5 A;  1A8D A;  1RZO B;  3ER8 C;  1FN0 A;  1PUM B;  5CHE A;  1V6V A;  1HWP B;  4KLL A;  3PMN A;  4KLG A;  3PME A;  2D1Z A;  4FH3 A;  3WFP A;  3VT0 A;  5FNX A;  1TV9 A;  5J2B A;  4NM1 A;  3QYD A;  7ICK A;  5J0W A;  1Z2V A;  1W3G A;  4KLT A;  4MF2 A;  1BPD A;  4EKX B;  3C2K A;  8ICZ A;  4Q91 A;  3JYY A;  1ZQV A;  4F34 A;  4I4S A;  3BAO A;  5J2K A;  4RQ3 A;  5F8Y A;  3AQK A;  3HMY A;  2P66 A;  2DRE A;  4K98 A;  4JP0 A;  4RPX A;  3CAH A;  3Q7W A;  4QO3 A;  3FJJ A;  3O4A A;  5G00 A;  5DBB A;  2VSE A;  3L9D A;  5J0U A;  3NWI A;  3UJ0 A;  3RJH A;  1IT0 A;  3H39 A;  3FJK A;  41BI A;  8ICV A;  4EEB A;  4X5V A;  3O49 A;  2VSA A;  4DOC A;  3MDA A;  3R4S A;  3F1R A;  4LO2 C;  2BPG A;  4X4Q A;  8ICS A;  4E7X A;  4I2E A;  2MC2 A;  2DVI A;  4DCK C;  1MIV A;  3RJJ A;  4IQT A;  3S8K A;  1MIW A;  5J0S A;  4OW4 A;  3WO3 A;  2NVH A;  1BPB A;  3IM5 A;  4L4H A;  1TWE A;  2KLL A;  3BA7 A;  4GOV A;  4R65 A;  4XJE A;  7ICE A;  2Q9X A;  3O3Q A;  1DZD A;  4KB6 A;  3FJI A;  1T9F A;  1R8O A;  3UPS A;  4AT7 A;  5HRF A;  1JT4 A;  2M2T A;  4LO8 B;  2BE3 A;  4P4O A;  5HC9 A;  3CRG A;  3C5G A;  3ER9 B;  1CE7 B;  2ZH7 A;  4KLS A;  5DED A;  1QQL A;  4RWN A;  1YYN A;  2DR5 A;  4Q9G A;  4I2I A;  1KDH A;  4IY8 A;  2I9G A;  4MF8 A;  3WIN C;  4Z6D A;  2K8R A;  4QBV A;  3MPP G;  4X4O A;  1SR4 A;  4Q9P A;  4ZGR B;  2F8X C;  2NS2 A;  2FCL A;  5HHH A;  3ISD A;  4A7K A;  3HIY A;  4FGF A;  4DEP A;  1Z4S A;  3RSJ A;  4ZKT B;  1JQZ A;  4TUS A;  4TUQ A;  4LVS A;  3RTI B;  4GP0 A;  5DEC A;  2ERM A;  4I4V A;  4EED A;  4RQ0 A;  2Z49 A;  4PGY A;  4YMM A;  4NXU A;  2BEA A;  4P0J A;  2PXI A;  2Y9G A;  4JLX A;  4FHV A;  4RQ8 A;  5J0R A;  4JKQ A;  4M9H A;  1ZJN A;  4J2Y A;  4K4G A;  4O68 A;  1OQL B;  3H38 A;  4IQU A;  3O5W B;  4QC4 A;  8ICF A;  1EYL A;  3CA3 A;  4YMN A;  1L2H A;  4UB1 A;  4LO2 A;  5J2I A;  3OVA A;  2DR8 A;  7ICF A;  1IJT A;  4RWQ A;  4X3A A;  4S3N A;  2D7R A;  5IIL A;  4I4Y A;  4XFT A;  4J2S A;  2R9K B;  2NM1 A;  1MQ2 A;  1Z0H A;  3RH4 A;  4JWM A;  2DR7 A;  2LIQ A;  4I28 A;  4NXX A;  3RJG A;  2AAI B;  8ICX A;  1AFC A;  1NOM A;  5BOL A;  3HW8 A;  1FV3 A;  3BAU A;  4RQ1 A;  3RH5 A;  4QD2 C;  1BPX A;  3ZC8 A;  2AQZ A;  5IIJ A;  2AFG A;  2Y9W C;  2NRK A;  1JMS A;  5HRL A;  1YXW A;  8ICA A;  3WIN A;  3NBC A;  3AZW A;  1R8B A;  1MIY A;  4O67 A;  4RWP A;  1ZQD A;  4GXI A;  3WFO A;  2DS0 A;  2QN4 A;  3TFR A;  1ZQH A;  3H6S E;  4X39 A;  2BFH A;  4WC6 A;  3LLP A;  4TUR A;  4I4R A;  9ICI A;  2B51 A;  2BCV A;  1HCE A;  3POK A;  4LEY A;  3ZXD A;  3V0B B;  3C5F A;  4G6J A;  8ICT A;  3AUO A;  8ICM A;  2IWT B;  4EP7 A;  3JPP A;  1GGP B;  4I29 A;  5D62 A;  4RQ6 A;  4I7I A;  2ET2 A;  4WC4 A;  3C2L A;  5TZV A;  3CA5 A;  1FV2 A;  4QZ9 A;  8ICN A;  5IIO A;  4O5K A;  1YTO A;  1ZQR A;  4I27 A;  4KLQ A;  8I1B A;  1S0B A;  3FGM A;  4R63 A;  3JPQ A;  4K4I A;  2M2U A;  4XKI A;  5JTG A;  3LQC B;  4UBB A;  7ICP A;  3V7J A;  3BAV A;  1UEV A;  4I4P A;  4X4V A;  1KNM A;  4OUJ A;  1V6U A;  4QZH A;  5EHA A;  2ISO A;  1S0F A;  3I2X A;  2ZH1 A;  7ICR A;  4NXT A;  4OEF A;  4P0L A;  5GAQ A;  1K5U A;  5CB1 A;  2VU9 A;  3OVB A;  4IQV A;  1ZQZ A;  4UAW A;  2B56 A;  4K97 A;  5J0Y A;  1MC9 A;  3UQ2 A;  4M2Y A;  2WBC A;  4QZG A;  4AT8 A;  4WQL A;  5CA7 A;  4IG8 A;  4KC3 A;  5D61 A;  4JRA A;  3MDC A;  5CHG A;  1ONK B;  2DR9 A;  1EVT A;  3JPO A;  3WO4 A;  3RMY A;  2F2F C;  5CWR A;  1EPW A;  3JUT A;  9ICS A;  9ICR A;  5IIK A;  1FQ9 A;  4DOB A;  4GXJ A;  3V72 A;  4FHW A;  4FH5 A;  3UJ4 A;  4JAW A;  5BQU C;  3OJV A;  3WO2 A;  1TOO A;  4YMO A;  5BXS A;  5HHI A;  1ZQO A;  3E8L C;  2UUS A;  4I96 A;  1JT7 A;  3RTJ B;  3T8S A;  3FJ9 A;  5I1B A;  1KNY A;  1BPZ A;  4OWL A;  4QKS A;  4LO1 A;  4HJJ A;  1RG8 A;  1N4K A;  3ZXG A;  3CK6 A;  4WOY A;  4ISR A;  4I2J A;  2HN1 A;  3CA1 A;  1Q79 A;  4UBC A;  4O5E A;  1WBA A;  3JRR A;  3PML A;  3A07 A;  3ZX7 A;  4RPY A;  4ZA3 B;  4I2B A;  5FZU A;  3B9U A;  4X4R A;  4XFU A;  1BFB A;  3OJM A;  4K4H A;  3RJI A;  4I4X A;  4JWN A;  3MBY A;  4MKP A;  2ISP A;  3JPS A;  5EG6 C;  1AVW B;  5EC5 A;  1HUZ A;  8ICI A;  4EV6 A;  2KH2 A;  3V79 C;  4WC3 A;  3ISB A;  2YUG A;  3WMU A;  4WC0 A;  4IQW A;  3HN1 A;  4YOL A;  3WFS C;  9ICL A;  1KEJ A;  8ICK A;  3AKI A;  3V0B A;  1F5A A;  4K96 A;  1BFC A;  4H75 A;  2BPF A;  3TC2 A;  2FGF A;  2HN2 A;  4CJM A;  4FO6 A;  1DLL A;  4EBK A;  5DDY A;  1IRP A;  5J2C A;  2VUA A;  2GO2 A;  3AU6 A;  4DEN A;  2ZH9 A;  4WBY A;  4P6A A;  1EV2 A;  4TLP A;  3OWG A;  3O44 A;  3AH4 A;  2F2F A;  1ZQT A;  2RST A;  1BLA A;  8ICB A;  4I0U A;  2D43 A;  4ZFU B;  3EF2 A;  4WC7 A;  3FJD A;  1M2T B;  1J0S A;  5HRD A;  1PZZ A;  1JN3 A;  1G9A A;  3V7L A;  4KLM A;  4G6M A;  3F62 B;  1ZQJ A;  1ZQU A;  3ZC9 A;  3C9Z A;  4KLE A;  1MQ3 A;  9ICF A;  5BXR A;  4OWK A;  3UPQ A;  4KEI A;  2BEB A;  4PHE A;  8ICJ A;  4Z9W B;  1YLQ A;  3MGH A;  4J23 B;  1JTC A;  3WFR E;  2RQ9 A;  2O1P A;  3ISC A;  9ICO A;  4LO3 C;  2DRA A;  4O5C A;  2NP0 A;  1JLX A;  4O6A A;  3IM7 A;  2IHO A;  3NKU A;  4WH5 A;  3OGG A;  3B0X A;  4UY4 A;  5J29 A;  4XFS A;  6I1B A;  4LT6 A;  1ZJM A;  9ICE A;  3NBE A;  2O5A A;  4WC5 A;  3HX0 A;  3FJ8 A;  1XSL A;  4KM5 A;  4PHA A;  4X38 A;  4M9N A;  2D20 A;  2FMS A;  2EWR A;  1HWN B;  4E8F A;  4K9B A;  1ISY A;  3S8J A;  1XZZ A;  2NZ9 A;  4UD5 A;  4LZD A;  3FUO A;  4I4Q A;  2FDB M;  2E4M C;  3NYB A;  4AT9 B;  4ZBV B;  4DO9 A;  3V0A B;  4M0A A;  1QQK A;  3WMV A;  1RPL A;  3GDX A;  2PFP A;  3LTQ A;  1WD3 A;  5CFT A;  1DJS B;  1FGA A;  21BI A;  3UQ0 A;  4I4O A;  8ICC A;  4Z6C A;  5F8W A;  1NUN A;  4RT2 A;  4RPZ A;  4QZC A;  1Q04 A;  3LK9 A;  4F5P A;  4USP A;  3FJF A;  4QZI A;  1ZQL A;  2ZH3 A;  1ISZ A;  4KEJ A;  1XSN A;  1HWM B;  5BPC A;  4RQ2 A;  2FO1 A;  1V6W A;  3BRF A;  4KLO A;  4IZX A;  1OU5 A;  3BAD A;  1DFQ A;  2Z48 A;  9ICB A;  4UAY A;  1JT5 A;  1ZQB A;  1ABR B;  4LZG A;  3CU1 B;  3R4U A;  1ZQK A;  2BCU A;  3HBW A;  4H04 A;  5IIM A;  4K9A A;  3H3A A;  1S0L A;  3VSF A;  2PFQ A;  2MIB A;  5HRG A;  4X37 A;  1K5V A;  4RQ5 A;  3CRI A;  4M5D A;  1ISW A;  3B0Y A;  4KLF A;  3IAG C;  3PG0 A;  1D0H A;  4FO1 A;  9ICG A;  1MD6 A;  5E24 E;  4WC1 A;  2DRB A;  3H6R B;  3O4C A;  2I1B A;  3RJF A;  3NVO A;  4P4P A;  2K43 A;  3AQL A;  1XSP A;  4I2C A;  3HOM A;  2P23 A;  2FFU A;  4M04 A;  3P6I A;  3C18 A;  31BI A;  3MGI A;  4QKR A;  4END A;  5F90 A;  4RT3 A;  1YBI A;  4WCW A;  1V6X A;  2KI6 B;  9ICK A;  4KBB A;  9ICU A;  5JMC A;  2ZQO A;  5DVH A;  4GOY A;  3AKG A;  4LEW A;  5EOZ A;  4TUP A;  4WC2 A;  4HX0 A;  2DRY A;  5IIN A;  3BAG A;  1R8C A;  1AVU A;  5DDM A;  1R8N A;  3ILA A;  4RQ7 A;  4X4S A;  2HHP A;  3TFS A;  4MFC A;  2E4M A;  1E0O A;  4OEG A;  4J2X A;  4F5O A;  3PUB A;  1HCD A;  4G9M A;  4LO0 C;  1R89 A;  3RJE A;  7ICT A;  1RY7 A;  3VSZ A;  5FZY A;  4R6U B;  2D22 A;  4PPX A;  1WBC A;  4GAF A;  3BA5 A;  5D4B A;  1TTU A;  1WOT A;  3BA4 A;  3VEQ A;  4KLU A;  4PHD A;  4LO7 B;  1S0E A;  3JCF A;  5CFS A;  8ICR A;  4JKX B;  1AXM A;  3BAH A;  4YN4 A;  1P63 A;  4I0Y A;  1HUO A;  3HAL A;  4Z6F A;  3P6J A;  4I2F A;  5FZZ A;  5HRI A;  3I2A A;  2BBJ A;  1DFC A;  3WFQ E;  4ATB B;  3JZ0 A;  1BA7 A;  5DUY A;  2BCQ A;  4MZF B;  4NXV A;  1S0C A;  1DIW A;  4MFF A;  4AN7 B;  4I2G A;  4O9M A;  2XOA A;  1T4Q A;  4QZD A;  1FMZ A;  3UDA A;  2ZH2 A;  4UB2 A;  1RZT A;  2GA9 D;  4WBZ A;  4I37 A;  1JT3 A;  5DSS B;  7ICV A;  4LO7 C;  4J2K A;  1R8A A;  4I2S A;  4YCX A;  4AT7 B;  4MFA A;  4KEK A;  5CP2 A;  4P4M A;  5CR0 A;  3VWC A;  1XG6 A;  1XHB A;  1Q1U A;  5J2E A;  4QZE A;  3CA6 A;  2MLL B;  4FHX A;  1I1E A;  4G1R A;  1S0D A;  2VLC A;  3A23 A;  1ZQQ A;  5J2H A;  4P2H A;  2M49 A;  3OJ2 A;  1IRA X;  5BP5 C;  4EGW A;  1IHK A;  8ICO A;  9ICN A;  2BPC A;  9ILB A;  5HPZ A;  3N7M A;  3SNV A;  1IOB A;  1VCL A;  4M9J A;  1G9D A;  2M2V A;  5CFU A;  3UD9 A;  1ITB A;  7ICN A;  4P0K A;  8ICU A;  5J2G A;  3FJH A;  9ICM A;  5BOW A;  5J2A A;  4ZLB B;  2NYY A;  9ICX A;  5BVP I;  2Y9F A;  7ICS A;  1ZQM A;  1ILR 1;  1TIE A;  5B3P A;  4NY8 A;  3UD8 A;  2ZH8 A;  9ICQ A;  4X0B A;  4I3N A;  4QBC A;  4I2A A;  4O69 A;  1BLD A;  1JQR A;  5DBC A;  1ZQP A;  1SR4 C;  4F83 A;  4RWO A;  3NBN A;  2IUB A;  1TVA A;  9ICV A;  4UB4 A;  4I8M A;  5J0O A;  4K8V A;  4DOA A;  3Q7Y A;  1RML A;  5HRK A;  1PUU B;  3AH2 A;  1W3F A;  5F8S A;  2BCS A;  2HW9 A;  2VXT I;  3HJ4 A;  1II4 A;  4X4T A;  4EBJ A;  2GZB A;  1UEU A;  2K4A B;  5JLV A;  1ZQA A;  2HWM A;  4X4U A;  5J2F A;  3I29 B;  3BTA A;  1Q78 A;  3UXN A;  1ZQE A;  2ZHA A;  1HKN A;  3MCR A;  2Y9X E;  4WQK A;  4UAZ A;  1TWM A;  4PH5 A;  7ICH A;  2VAN A;  5CJ7 A;  4M47 A;  4XQ8 A;  4Z6E A;  2ZHB A;  1TP0 A;  3K1X A;  3PNC A;  4I2D A;  2KI4 A;  4OAI Z;  3FUQ A;  4F5N A;  4A7Z A;  4RQ4 A;  5BQU A;  4ATB A;  2FFV A;  5BOM A;  3NBD A;  3BRG C;  3BAQ A;  3FJE A;  2FMQ A;  1GPJ A;  5BP5 A;  1TFW A;  4X4P A;  5HRE A;  1G9B A;  1SZ6 B;  2D24 A;  1HWO B;  9ICT A;  4UD4 A;  1CVS A;  4IY9 A;  5J2J A;  5J0X A;  3AKF A;  4R64 A;  3UD7 A;  1ZQS A;  8ICP A;  1BFF A;  9ICP A;  1ZQY A;  3JPR A;  4D0T A;  2ESU A;  4ION A;  4LEV A;  4NLZ A;  4I2H A;  5BXT A;  4OWJ A;  4KLH A;  3OBT A;  5F2V O;  4OEE A;  3AZV A;  4EEE B;  1ZQX A;  4NKT A;  2BCR A;  4PC4 A;  7ICU A;  4GAI A;  2QYI B;  3BX1 C;  4L4I A;  4I1E A;  3OUY B;  1VFG A;  9ICC A;  2M2W A;  3VT2 A;  4K99 A;  3OV7 A;  2Q3N B;  1Q03 A;  7ICM A;  4KLI A;  4OAF A;  3AQM A;  4QAL A;  2PBE A;  3QR5 A;  3HWT A;  2B4V A;  4G9N A;  1AF9 A;  4HR6 C; 
#chains in the Genus database with same CATH homology
 1EPW A;  3HMY A;  3JUT A;  1V6X A;  2DRE A;  2KI6 B;  4K98 A;  4KBB A;  4JP0 A;  3W9T A;  5JMC A;  2ZQO A;  1FQ9 A;  4GOY A;  3AKG A;  5DVH A;  4LEW A;  3CAH A;  3Q7W A;  4QO3 A;  3FJB A;  3FJJ A;  3O4A A;  4HX0 A;  5G00 A;  2DRY A;  4D0Z A;  3BAG A;  2VSE A;  1FWV A;  1AVU A;  4IYB A;  1R8N A;  3UJ4 A;  3UJ0 A;  2HZ9 A;  1IT0 A;  4JAW A;  2ZR1 B;  3ILA A;  3FJK A;  5BQU C;  5DZU A;  41BI A;  1PC8 B;  3OJV A;  3WO2 A;  1TOO A;  3O49 A;  5BXS A;  2E4M A;  1E0O A;  4OEG A;  4J2X A;  3PUB A;  2VSA A;  3E8L C;  1HCD A;  4G9M A;  4LO0 C;  3R4S A;  3F1R A;  2X2T A;  4LO2 C;  4EFQ A;  1RY7 A;  1M16 A;  2UUS A;  3VSZ A;  5FZY A;  4I96 A;  1JT7 A;  4R6U B;  3RTJ B;  2MC2 A;  2D22 A;  3FJ9 A;  3T8S A;  1WBC A;  1DZC A;  5I1B A;  1AVX B;  4DCK C;  4GAF A;  4HR6 C;  3BA5 A;  3S8K A;  4OW4 A;  3WO3 A;  2NVH A;  1TTU A;  4OWL A;  4QKS A;  4LO1 A;  3BA4 A;  1XYF A;  3VEQ A;  4HJJ A;  5B3Q A;  1RG8 A;  1N4K A;  3AJ6 A;  3IM5 A;  4L4H A;  3ZXG A;  4LO7 B;  1TWE A;  1S0E A;  2KLL A;  4WOY A;  3BA7 A;  5CFS A;  4QD2 B;  4GOV A;  3RMX A;  4ISR A;  4XJE A;  2Q9X A;  3O3Q A;  1DZD A;  4KB6 A;  4JKX B;  1AXM A;  3CA1 A;  3FJI A;  3BAH A;  1T9F A;  3IIR A;  1R8O A;  3H6Q A;  1WBA A;  3JRR A;  3P53 A;  1BFG A;  1JT4 A;  1P63 A;  4I0Y A;  2RG9 B;  4LO8 B;  3A07 A;  2ZQN A;  3HAL A;  3ZX7 A;  5B2H A;  4ZA3 B;  5FZU A;  3P6J A;  5FZZ A;  3B9U A;  4IHZ A;  3FJA A;  4XFU A;  4H9W A;  3CRG A;  4ZOT A;  1BFB A;  2NTD A;  3OJM A;  3ER9 B;  1CE7 B;  3I2A A;  1DFC A;  4JQ0 A;  4I4X A;  1ISV A;  4MKP A;  1QQL A;  5EG6 C;  1BA7 A;  4Z8S B;  5DUY A;  4MZF B;  1AVW B;  5EC5 A;  1YYN A;  2KH2 A;  1S0C A;  4NXV A;  1DIW A;  3V79 C;  4AN7 B;  4LEZ A;  4N7R A;  4LO3 A;  1TFM B;  4Q9G A;  2YUG A;  2XOA A;  4IY8 A;  1T4Q A;  3WMU A;  1QXM A;  1S0G A;  3KMV A;  1FMZ A;  3UDA A;  3WIN C;  2K8R A;  3HN1 A;  1I1B A;  4YOL A;  2GA9 D;  4QBV A;  3MPP G;  1SR4 A;  3AKI A;  2VXR A;  3CRH A;  4I37 A;  1JT3 A;  1G82 A;  3V0B A;  5DSS B;  4Q9P A;  4LO7 C;  4I1B A;  4ZGR B;  4K96 A;  1BFC A;  4J2K A;  1IIL A;  4I2S A;  2F8X C;  4H75 A;  2NS2 A;  4KEK A;  3TC2 A;  2FCL A;  2D23 A;  2FGF A;  4CJM A;  4A7K A;  4FGF A;  5D63 A;  3VWC A;  1XG6 A;  1XHB A;  4DEP A;  1Q1U A;  1Z4S A;  1DLL A;  3RSJ A;  1JQZ A;  4ZKT B;  3CA4 A;  4I4U A;  4ZFY B;  1IRP A;  3CA6 A;  2MLL B;  2VUA A;  4D8H A;  1I1E A;  4G1R A;  2KKI A;  2GO2 A;  1S0D A;  4NXW A;  3OGF A;  4DEN A;  3RTI B;  2VLC A;  3A23 A;  4GP0 A;  2ERM A;  2J3P A;  4P6A A;  4I4V A;  1EV2 A;  1G9C A;  4TLP A;  2Z49 A;  3A21 A;  1UPS A;  3OWG A;  2M49 A;  3O44 A;  3AH4 A;  2F2F A;  3OJ2 A;  1IRA X;  5BP5 C;  1IHK A;  4HA2 A;  4NXU A;  3ERC C;  2BEA A;  4P0J A;  4OAG A;  3O4O A;  2RST A;  9ILB A;  1BLA A;  3N0K A;  5HPZ A;  2D43 A;  3N7M A;  4ZFU B;  3SNV A;  1IOB A;  2Y9G A;  4LO1 C;  7I1B A;  3HSM A;  4JLX A;  1DQO A;  3EF2 A;  1VCL A;  4JKQ A;  1G9D A;  4USO A;  3FJD A;  1M2T B;  1J0S A;  5CFU A;  1PZZ A;  4JPZ A;  4J2Y A;  4O68 A;  3UD9 A;  1G9A A;  1ITB A;  4P0K A;  1OQL B;  4G6M A;  3F62 B;  1JLY A;  3FJH A;  3ZC9 A;  3C9Z A;  5BOW A;  3MAL A;  3O5W B;  4QC4 A;  4ZLB B;  2NYY A;  5BXR A;  1EYL A;  4OWK A;  3CA3 A;  3Q7X A;  1L2H A;  1F31 A;  5BVP I;  4MZH A;  2Y9F A;  4LO2 A;  1DQG A;  4KEI A;  2BEB A;  1ILR 1;  1IJT A;  1TIE A;  4Z9W B;  4X3A A;  2X2S A;  4J23 B;  1JTC A;  2D7R A;  4OAH A;  4I4Y A;  5B3P A;  1HIB A;  2L5X A;  3N7K A;  3O4D A;  2RQ9 A;  4XFT A;  4J2S A;  3UD8 A;  2R9K B;  2NM1 A;  4I3N A;  4QBC A;  4LO3 C;  1Z0H A;  4O69 A;  2NP0 A;  1BLD A;  3O4B A;  4I6I A;  1JLX A;  2LIQ A;  3CQA A;  4O6A A;  4NXX A;  3IM7 A;  2IHO A;  3NKU A;  1ISX A;  1SR4 C;  4F83 A;  3V0A A;  4WH5 A;  2AAI B;  3OGG A;  4UY4 A;  3NBN A;  3CA0 A;  1AFC A;  4I8M A;  4K8V A;  4XFS A;  3Q7Y A;  1RML A;  6I1B A;  1FV3 A;  3BAU A;  4ISQ A;  3OBR A;  4QD2 C;  3NBE A;  1PUU B;  2AXM A;  1NZK A;  3AH2 A;  2P39 A;  1W3F A;  3FFZ A;  3IM6 A;  5F8S A;  3FJ8 A;  4AN6 A;  4KM5 A;  1WD4 A;  3BB2 A;  4GP3 A;  4X38 A;  3ZC8 A;  2AQZ A;  1YF8 B;  2AFG A;  2Y9W C;  2D20 A;  2HW9 A;  2VXT I;  2DRZ A;  2EWR A;  1II4 A;  2D7I A;  5BXP A;  1HWN B;  1YXW A;  1W3A A;  1ISY A;  3VT1 A;  3S8J A;  1XZZ A;  4K9B A;  2NZ9 A;  3WIN A;  2GZB A;  3NBC A;  2K4A B;  3AZW A;  5JLV A;  3FUO A;  4O67 A;  3D7W B;  2HWM A;  4I4Q A;  2FDB M;  2E4M C;  3I29 B;  2DS0 A;  3BTA A;  2WRY A;  2QN4 A;  4ZBV B;  3N7J A;  3H6S E;  1HKN A;  4IQP A;  4X39 A;  3MCR A;  2BFH A;  2Y9X E;  3V0A B;  4WQK A;  1QQK A;  1TWM A;  3LLP A;  3WMV A;  4I4R A;  2B51 A;  1AVA C;  3LTQ A;  1WD3 A;  5CFT A;  1DJS B;  1FGA A;  1HCE A;  21BI A;  3POK A;  4LEY A;  3ZXD A;  1TP0 A;  3V0B B;  3K1X A;  4I4O A;  4G6J A;  3FJC A;  1NUN A;  3NJ5 A;  5F8W A;  2IWT B;  2KI4 A;  3FUQ A;  4OAI Z;  1GGP B;  1Q04 A;  4A7Z A;  5D62 A;  4USP A;  3FJF A;  5BQU A;  2FFV A;  3A22 A;  3AJ5 A;  4II0 A;  4EB2 B;  4I7I A;  3NBD A;  3BRG C;  3BAQ A;  3FJE A;  4WBC A;  2ET2 A;  1GPJ A;  5BP5 A;  3CA5 A;  1FV2 A;  3H6R A;  2LIE A;  1BAR A;  4LO0 A;  1ISZ A;  1G9B A;  4KEJ A;  1HWM B;  2D44 A;  2GAF D;  1SZ6 B;  2D24 A;  2FO1 A;  1HWO B;  5FNW A;  3K7D A;  1V6W A;  3BRF A;  4IZE A;  1YTO A;  4IZX A;  1CVS A;  4EFR A;  8I1B A;  3BAD A;  1S0B A;  1DFQ A;  4IY9 A;  2Z48 A;  3PHZ A;  3FGM A;  3AH1 A;  3N7L A;  3AKH A;  3AKF A;  1JT5 A;  1FMM S;  3UD7 A;  1ABR B;  4EFP A;  1FWU A;  1BFF A;  4XKI A;  3CU1 B;  1BAS A;  4D0T A;  2ESU A;  4ION A;  4LEV A;  3R4U A;  1JY0 A;  3HBW A;  4H04 A;  4A7Y A;  4K9A A;  1S0L A;  4ZFW B;  3VSF A;  3BAV A;  4I4P A;  5BXT A;  2MIB A;  4X37 A;  1KNM A;  1K5V A;  4OUJ A;  3BRD A;  1V6U A;  3CRI A;  2HWA A;  4OWJ A;  1PWA A;  5EHA A;  1ISW A;  1S0F A;  3I2X A;  4FVV A;  4NXT A;  4OEF A;  3IAG C;  3OBT A;  3PG0 A;  1D0H A;  4MZG B;  4OEE A;  4P0L A;  3AZV A;  5GAQ A;  1K5U A;  4FO1 A;  3VUO A;  1MD6 A;  4JLZ A;  5E24 E;  2VU9 A;  3WA1 A;  4EEE B;  1A8D A;  4PC4 A;  3H6R B;  2B56 A;  3O4C A;  4K97 A;  1RZO B;  2I1B A;  4GAI A;  3ER8 C;  1FN0 A;  1PUM B;  2QYI B;  1MC9 A;  3BX1 C;  2WBC A;  4L4I A;  4I1E A;  1V6V A;  1HWP B;  5CHE A;  2K43 A;  3PME A;  3VT2 A;  4K99 A;  2D1Z A;  3HOM A;  4WQL A;  2P23 A;  3VT0 A;  5FNX A;  2Q3N B;  4KC3 A;  3QYD A;  5D61 A;  1Q03 A;  2FFU A;  4JRA A;  1Z2V A;  1W3G A;  3P6I A;  1ONK B;  4OAF A;  4EKX B;  31BI A;  4QKR A;  4END A;  4QAL A;  5F90 A;  1EVT A;  4Q91 A;  3QR5 A;  3WO4 A;  2B4V A;  4F34 A;  4G9N A;  4I4S A;  3RMY A;  1AF9 A;  2F2F C;  1YBI A;  3BAO A;  5F8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...