5D62A

Moa-z-vad-fmk complex, inverted orientation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
b'SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d62A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d62A02
5B2HA 1MD6A 3OJVA 2FO1A 4ZOTA 5E24E 1S0EA 3IM6A 1IRAX 1V6XA 1DJSB 2AFGA 1D0HA 1S0DA 2D24A 4WBCA 1VCLA 4I37A 2FGFA 4J2YA 3OBTA 4LO7C 3RMYA 2DRYA 3WINC 1G9CA 3V0BA 2E4MA 4FGFA 1Q1UA 4IZEA 5BXPA 4ZLBB 1RMLA 1PUUB 1UPSA 4QD2C 1ONKB 1R8NA 3BAVA 4ZBVB 1HWMB 3HN1A 3MPPG 1GGPB 5BQUA 4KBBA 1BFFA 4I4UA 1BFCA 3JRRA 1FN0A 1M16A 3P53A 3WMVA 1NUNA 3WO3A 1SZ6B 3O4CA 1FV3A 2ZR1B 4G6MA 4XFUA 1WBAA 2UUSA 1BLDA 3POKA 1HCEA 3FJ9A 1BLAA 2D22A 8I1BA 3CU1B 3BAGA 2Z49A 4D0ZA 4QALA 3UD7A 1P63A 1HKNA 5FZZA 3VT1A 1RY7A 3BA4A 1FV2A 3O4BA 4CJMA 4J23B 1PC8B 3I2AA 5HPZA 1AFCA 1DLLA 1PUMB 4X39A 3PG0A 3CRGA 2ESUA 4HA2A 1V6VA 4PC4A 5I1BA 3E8LC 5F90A 3FJIA 4LO3C 2M49A 1JQZA 2LIEA 3FJ8A 3O5WB 5F8SA 3C9ZA 2D7RA 1II4A 2NZ9A 4IY8A 3FFZA 3NBNA 3FJJA 1DZDA 1TTUA 2VSEA 3QYDA 2KI6B 1EV2A 3ZX7A 4KEIA 3O4DA 4IYBA 3AKHA 1W3AA 5DSSB 4EFQA 3AJ5A 4GP0A 3AH4A 3P6IA 3S8JA 2D44A 3CA1A 4IQPA 1T4QA 1W3FA 3BAUA 1F31A 3HALA 2ZQNA 1ITBA 4I4OA 2VUAA 4ZA3B 4Q91A 2D23A 3UJ0A 5EC5A 4I8MA 1IRPA 1AVAC 3BA7A 5FNWA 2F8XC 2HW9A 4EFPA 2VSAA 4J2KA 4F34A 3A23A 4ISRA 1FGAA 31BIA 3BRFA 3RTJB 4A7KA 4X3AA 2BEAA 3BADA 4JAWA 1JLXA 3B9UA 4D8HA 5BP5A 41BIA 3AH1A 2HWMA 1HWPB 4II0A 3CA3A 4OW4A 4IHZA 3D7WB 2IHOA 3CRIA 1S0BA 3ZXDA 4QKRA 1IHKA 1EPWA 2KLLA 4QC4A 5DZUA 2AXMA 1EVTA 4ENDA 1IJTA 3ZC9A 1QQKA 2D1ZA 4OWJA 4OEEA 4I4XA 3VT2A 1FMMS 2GZBA 2X2SA 3T8SA 2Q9XA 2NP0A 1G9AA 3S8KA 4P6AA 4ZFUB 1TP0A 4I96A 3JUTA 3IIRA 3RTIB 1DFQA 1XHBA 2P39A 4I4QA 1SR4A 4IONA 1I1BA 3OBRA 4OWKA 3MALA 3OGFA 3AJ6A 3FJCA 1G82A 9ILBA 4DEPA 4AN7B 3V0AB 2QYIB 5D62A 5BVPI 1BA7A 2DRZA 3EF2A 3I2XA 3KMVA 1HWOB 3CA0A 4I7IA 1Z2VA 4GP3A 1Z4SA 2ET2A 1CE7B 3UJ4A 2X2TA 3FGMA 4XFTA 1S0FA 3FJHA 3LTQA 4I2SA 2BFHA 1AVWB 1IT0A 3NBDA 3O3QA 3HMYA 3FJAA 4A7YA 3CA6A 3WINA 1JLYA 2IWTB 3FJFA 3A07A 1J0SA 1RZOB 1IILA 4L4HA 3F1RA 3K1XA 4I3NA 5BXTA 4Q9PA 3WO4A 3VT0A 1TWEA 4Z9WB 4I6IA 3O44A 3FJEA 3N7LA 4LO2C 2KI4A 1FQ9A 1WD3A 3UD8A 1E0OA 2F2FC 3TC2A 3CAHA 4QO3A 3UD9A 4AN6A 4USPA 1BFGA 1NZKA 1G9DA 4H9WA 4QBCA 3BRGC 1S0LA 4EEEB 3FJDA 2HZ9A 4JP0A 2VXTI 1ISWA 2QN4A 3Q7XA 5FZYA 5JMCA 4EFRA 3R4UA 1V6UA 2LIQA 3HOMA 3IM7A 5JLVA 3CQAA 6I1BA 4OEGA 5GAQA 1S0GA 3VSFA 3OGGA 4I1EA 3R4SA 4DCKC 3QR5A 4LO3A 3AZWA 3RSJA 1QXMA 1WD4A 1FMZA 2KKIA 3BAHA 4I4PA 1YXWA 4P0LA 3V0AA 1AXMA 2WBCA 5G00A 3N0KA 2RG9B 2L5XA 1JTCA 1AVXB 2FFUA 4USOA 1Q03A 7I1BA 4G1RA 1K5VA 4LO1C 4G6JA 4A7ZA 4ZFYB 3BB2A 4QKSA 3I29B 2VLCA 1AF9A 4JRAA 5F8YA 5FNXA 3RMXA 4I4SA 1EYLA 1JT7A 4HR6C 1KNMA 5D61A 5EG6C 4GOVA 2XOAA 4IY9A 1HCDA 5FZUA 5BXRA 1YYNA 2R9KB 1YBIA 3HBWA 1OQLB 2NM1A 2MLLB 3PHZA 1DQGA 2DS0A 4HJJA 3WO2A 5EHAA 3AZVA 1ISVA 2E4MC 3H6RB 5BXSA 5DUYA 2WRYA 3F62B 3AKIA 4ZFWB 4Z8SB 4GAIA 4ISQA 5BQUC 2AQZA 2J3PA 4I4VA 4D0TA 2YUGA 3PMEA 4G9NA 2Q3NB 2Y9FA 4L4IA 3FJBA 3ZC8A 1L2HA 5BOWA 1W3GA 4XKIA 4R6UB 2NTDA 4TLPA 3IM5A 21BIA 3P6JA 2MIBA 4YOLA 3ILAA 1TIEA 4I4RA 4OEFA 1RG8A 2KH2A 3BTAA 2ERMA 2VU9A 1G9BA 3N7MA 4OUJA 1JT4A 4IZXA 2Y9WC 4G9MA 4GAFA 3V79C 3Q7WA 4LO8B 2NYYA 1JY0A 1I1EA 3OJ2A 4DENA 1HWNB 1FWUA 1PZZA 1JT5A 2VXRA 4LO0C 1DZCA 1DQOA 1YTOA 3H6SE 3WMUA 2Z48A 3PUBA 5D63A 2DREA 1QQLA 4X37A 1DIWA 4FVVA 4JKQA 2D43A 2Y9GA 3O49A 1PWAA 3OJMA 1BASA 1V6WA 3NJ5A 2AAIB 2RQ9A 1ISXA 3CA5A 4I1BA 3Q7YA 3NBEA 2D20A 3W9TA 3FUQA 3N7KA 1XZZA 2FDBM 3LLPA 1A8DA 4KC3A 4GOYA 4JQ0A 4LO0A 2ZQOA 3H6RA 1DFCA 4ZKTB 1N4KA 2Y9XE 3A22A 2MC2A 1TWMA 4LO2A 3AH2A 4X38A 3UDAA 1K5UA 3CRHA 3FUOA 3SNVA 3HSMA 2F2FA 2HWAA 3BAOA 2GO2A 4Q9GA 3BA5A 3BX1C 3V0BB 4H04A 3NBCA 1TFMB 2K4AB 2FFVA 1ISYA 4JPZA 2BEBA 3N7JA 1ISZA 4I0YA 3CA4A 1FWVA 4JKXB 2K43A 5BP5C 1S0CA 3IAGC 4QBVA 1M2TB 2P23A 4ZGRB 4J2SA 1IOBA 4OWLA 2NVHA 4P0KA 1R8OA 3VEQA 1BARA 1T9FA 4F83A 3BAQA 1ABRB 3AKGA 3A21A 3ZXGA 4KEKA 1ILR1 4EKXB 1TOOA 1WBCA 5DVHA 4J2XA 3O4AA 1BFBA 3H6QA 4LO7B 2I1BA 3BRDA 4EB2B 4QD2B 3AKFA 3VWCA 3VSZA 1AVUA 4KEJA 1HIBA 2K8RA 3WA1A 1Z0HA 1XYFA 3O4OA 4XFSA 5F8WA 4LO1A 4P0JA 3VUOA 3FJKA 2RSTA 1XG6A 1CVSA 1MC9A 1Q04A 2D7IA 1JT3A 1YF8B 4I4YA 1SR4C
chains in the Genus database with same CATH superfamily
5B2HA 4GXJA 3B0XA 5IINA 3IM6A 1DJSB 5HR9A 2AFGA 3RJGA 4AT8B 4YMMA 4YD1A 2D24A 4X4SA 4WBCA 2BCSA 2PFOA 9ICHA 4J2YA 1MIWA 8ICZA 2DRYA 3WINC 4ZLBB 1RMLA 1R8NA 4ZBVB 1BFFA 2RFFA 8ICQA 4GXIA 1NUNA 5IILA 1FV3A 1XSPA 3JPOA 4LZDA 1WBAA 4QZEA 9ICAA 3FJ9A 8I1BA 3CU1B 1HKNA 4I27A 4UB3A 4J23B 2ZH9A 3I2AA 5I1BA 4K9BA 4LO3C 1JQZA 4QZGA 2NZ9A 4IY8A 8ICXA 1ZQBA 3NBNA 4FO1A 3FJJA 5J2FA 1JAJA 1ZQHA 4AT8A 4PPXA 4KEIA 4IYBA 5DSSB 4WQKA 3AJ5A 3S8JA 4RQ1A 1KDHA 1F31A 3HALA 4WH5A 4I8MA 1AVAC 4P4MA 4Z6FA 4ISRA 4AT9A 1FGAA 4A7KA 2BEAA 4P4PA 4D8HA 5BP5A 3AH1A 2PFQA 1HWPB 3CA3A 4OW4A 1VFGA 4KLDA 3CRIA 4QKRA 4EBKA 4WC3A 4ENDA 1IJTA 3RH4A 4K4HA 4OWJA 4NXUA 4OEEA 1ZJNA 3WFOA 3VT2A 1FMMS 4GXKA 2X2SA 3K7DA 2Q9XA 4RQ3A 4ZFUB 4X0AA 3RTIB 3JPPA 4R65A 4O6AA 3MALA 3OGFA 3FJCA 5IIOA 5D62A 7ICOA 3I2XA 8ICWA 4GP3A 3UJ4A 3JYYA 2X2TA 3FGMA 4XFTA 1S0FA 2BFHA 4RWQA 3HMYA 1JLYA 1J0SA 1RZOB 1IILA 2M2VA 4L4HA 3F1RA 5BXTA 5J0RA 7ICIA 5DBAA 4Q9PA 3VT0A 1TWEA 4QZDA 5HREA 4Z9WB 4I6IA 3FJEA 1E0OA 1NZKA 4H9WA 4QBCA 3BRGC 4UBCA 4EEEB 3V7LA 5F2VO 3RJJA 4E7XA 4MZHA 3IM7A 5DKWA 9ICPA 6I1BA 1S0GA 1BPZA 3QR5A 3AZWA 3RSJA 4OAFA 7ICJA 2KKIA 3BAHA 4I4PA 5G00A 3N0KA 4MF8A 2L5XA 3RH6A 1AVXB 7I1BA 3MBYA 3AQLA 3I29B 4EP7A 4UBBA 4P4OA 2VLCA 8ICCA 4WC5A 8ICVA 5FNXA 7ICEA 1MIVA 3C18A 4QZ9A 4HR6C 4M9LA 4O9MA 8ICKA 2GWSA 4LEWA 5FZUA 4FHWA 1YYNA 1YBIA 2MLLB 5EHAA 2E4MC 3WFRE 3F62B 3AKIA 4ZFWB 1ZQWA 5CFUA 2AQZA 4NLZA 4K99A 2Q3NB 2Y9FA 3FJBA 5BOWA 1W3GA 3C5GA 4EEBA 2NS2A 3P6JA 4FHXA 4YOLA 3ILAA 1TIEA 3BTAA 2ERMA 4NXZA 1G9BA 3N7MA 3RJEA 4IZXA 2Y9WC 4G9MA 4GAFA 4X4UA 4I2IA 2NYYA 4O68A 1FWUA 4X4PA 1DZCA 7ICSA 3WMUA 3H38A 5J2KA 4KLLA 5D63A 1QQLA 4K98A 4JKQA 1ISXA 4I1BA 3NBEA 2D20A 3W9TA 4KC3A 5DECA 2ZQOA 1DFCA 1N4KA 2MC2A 4LO2A 2HWAA 1R89A 8ICMA 3BX1C 4F5RA 3V0BB 2K4AB 1ZQEA 7ICTA 3AQMA 2P23A 4ZGRB 4OWLA 3AUOA 1R8OA 4F83A 2BCVA 3H37A 4AT7B 3A21A 3ZXGA 4FHPA 4KEKA 1TOOA 4O69A 4MZFB 4UAWA 3AU2A 9ICLA 1BPXA 4M9NA 1HIBA 3K75D 4RWNA 4QZAA 3B0YA 4F5OA 8ICPA 1S0EA 4I2HA 4NXXA 2M2TA 3ER8C 4KLTA 1S0DA 1VCLA 4WC7A 2HN1A 8ICLA 5DB9A 2FGFA 3OBTA 4LO7C 3RMYA 3V0BA 4IZEA 1ZQDA 1PUUB 4WBYA 4QD2C 4M2YA 3H39A 1ZQNA 2ISPA 3C2KA 2PXIA 3MPPG 3RJIA 4MZGB 2ZH7A 3C2LA 1FN0A 4UD4A 5J0TA 7ICGA 4AT7A 1SZ6B 2ZR1B 1BPBA 4P2HA 3POKA 4WC6A 5CJ7A 4D0ZA 4DO9A 8ICGA 1P63A 1Q79A 2PBEA 5FZZA 1TV9A 4CJMA 1HUZA 3C2MA 5HRGA 1AFCA 5J0SA 3CK6A 4X39A 4QZBA 2ESUA 4HA2A 1V6VA 4PGQA 3E8LC 5F90A 4I2BA 3V7JA 1GPJA 3UPSA 2D7RA 1II4A 2NRKA 3FFZA 4TURA 1DZDA 4I29A 2VSEA 3QYDA 3O4DA 7ICPA 1ZQVA 3AKHA 1F5AA 1W3FA 9ICEA 4RQ5A 2VUAA 4ZA3B 4Q91A 3BA7A 5FNWA 2HW9A 4EFPA 2DR9A 31BIA 3RTJB 4X3AA 8ICBA 2PFPA 7ICLA 4WCWA 5HRLA 2ZHBA 1ZQKA 8ICNA 9ICSA 4II0A 3L9DA 3ZXDA 4N7RA 2ZH8A 2KLLA 4RT2A 1EVTA 4KM5A 4UD5A 9ICNA 2D1ZA 4Z6DA 4KLQA 4NM1A 3RJHA 1ZQOA 4QZHA 3T8SA 5HHIA 1G9AA 3S8KA 4P6AA 4I96A 2O1PA 2P39A 4IONA 1SR4A 1R8AA 5J2DA 4RQ2A 9ICGA 3AJ6A 4DEPA 4AN7B 2DRZA 3KMVA 4K96A 4I7IA 4WC1A 1CE7B 1ZQZA 5D49A 1V4AA 3PMNA 3O3QA 3A07A 4M9JA 4X4TA 4I3NA 2BCUA 3O44A 3N7LA 1FQ9A 3UD8A 3GDXA 2F2FC 4AN6A 4QO3A 3NVOA 3PNCA 5FZYA 5J0PA 1V6UA 3HOMA 3CQAA 5GAQA 1ZQFA 5DDYA 3VSFA 5EOZA 1JQRA 3HJ1A 4I1EA 4FHVA 1QXMA 1AXMA 2WBCA 4G1RA 4A7ZA 5J2BA 4M5DA 3BB2A 4QKSA 7ICRA 4RWOA 1MQ2A 3ISBA 4I4SA 4KLGA 4LEVA 4MFAA 1JT7A 5D61A 1HCDA 9ICMA 2R9KB 2BPGA 3AQKA 3UXPA 1DQGA 2DS0A 3WO2A 5BXSA 3HW8A 2WRYA 1ZQIA 5HRFA 5JTGA 4ISQA 4I4VA 1L2HA 2NTDA 4I4RA 1RG8A 2KH2A 2VU9A 2Q66A 1JT4A 3Q7WA 9ICTA 1JY0A 1HWNB 1JT5A 4LO0C 3OWGA 4KLMA 4OAIZ 2Z48A 4UB2A 4X37A 2D43A 2BE3A 3O49A 3OJMA 1BASA 4RQ0A 2AAIB 4QZCA 1R8BA 2O5AA 8ICIA 7ICQA 1A8DA 4UAZA 4LEYA 2BPCA 1ZQCA 2Y9XE 5DB8A 9ICKA 4I2JA 1K5UA 3SNVA 3HSMA 3BAOA 1ZQPA 4KB6A 4IQUA 3BA5A 4M04A 4H04A 1ISYA 5HRKA 3N7JA 4I0YA 4X4VA 1FWVA 5BP5C 2K43A 4RT3A 3LK9A 1S0CA 9ICJA 4QBVA 1M2TB 3AU6A 2NVHA 5J2JA 3VEQA 3BAQA 4UAYA 4UB4A 8ICYA 5J2CA 2ZH5A 1WBCA 5DVHA 4K97A 3O4AA 4UB1A 3H6QA 4LO7B 3BRDA 3JPQA 4O5EA 4QD2B 4WQLA 5CHEA 1JN3A 1AVUA 4KEJA 2K8RA 5IIJA 3ERCC 4LO1A 4P0JA 2ZH4A 3FJKA 2RSTA 1CVSA 1XSNA 1HUOA 3R4SA 3UXOA 1MD6A 3HJ4A 4ZOTA 9ICBA 1MQ3A 1IRAX 1V6XA 3PMLA 1D0HA 4I37A 2ZH1A 1JMSA 3OVSA 1G9CA 4FGFA 1Q1UA 5BXPA 1UPSA 3OVAA 9ICOA 1ONKB 3BAVA 3JPSA 5DDMA 5BOLA 3HN1A 1GGPB 4K4IA 5BQUA 4KBBA 3ISDA 5DBCA 4I4UA 1BFCA 4NXWA 1M16A 3C66A 4RPXA 3WO3A 3O4CA 1BPYA 1BLDA 5DBBA 1HCEA 3WFQE 1BLAA 4I2DA 2Z49A 4K4GA 2ZH3A 4YD2A 3VT1A 1RY7A 1FV2A 4NY8A 5HRIA 5HPZA 2B56A 4R64A 3PG0A 1ZQTA 3HX0A 3FJIA 4ATBB 2LIEA 2ID1A 3FJ8A 3C9ZA 4O67A 7ICFA 1TTUA 5J0QA 2KI6B 1EV2A 4OAHA 4EFQA 4GP0A 3P6IA 4F5NA 3BAUA 4X4NA 1ITBA 2W9MA 3UJ0A 2IHMA 3A23A 3BRFA 5J2GA 4KLUA 4IQVA 2DR5A 3OUYB 4JAWA 2PFNA 1JLXA 3B9UA 5J0OA 41BIA 3TFSA 2HWMA 4IHZA 3D7WB 3OGUA 1S0BA 1EPWA 4QC4A 4PHPA 2AXMA 4YMNA 4PGXA 1ZQJA 1QQKA 8ICHA 4ATBA 4I4XA 2GZBA 3H3AA 4UY4A 1TP0A 1ZQQA 9ICXA 1XHBA 4I4QA 3OBRA 4OWKA 4M47A 3AQNA 2EWRA 1G82A 3HWTA 1PX5A 3V0AB 5BVPI 5DEDA 1HWOB 4YN4A 1ZQMA 1Z2VA 2BBHA 5CFTA 3NBDA 4RPZA 3CA6A 3WINA 1RPLA 3K1XA 2P66A 3WO4A 4LO2C 8ICUA 9ICUA 3TC2A 3UD9A 4USPA 1G9DA 4JLXA 8ICFA 1S0LA 4EBJA 3FJDA 2HZ9A 4I2AA 4M0AA 1ISWA 4O5CA 3R4UA 2LIQA 5HC9A 5CP2A 4EGWA 2FCLA 3OGGA 4JWNA 4I2FA 4LO3A 1NOMA 1FMZA 2ISOA 1YXWA 5J0WA 4P0LA 3V0AA 1TFWA 4DOAA 2RG9B 1JTCA 4USOA 1Q03A 3ER9B 4G6JA 4ZFYB 1RZTA 5F8YA 3RMXA 3RJKA 1TVAA 4WBZA 9ICFA 1KNMA 3NWIA 4GOVA 2XOAA 3HBWA 1OQLB 4JLZA 3PHZA 1UEUA 4S3NA 2GAFD 3AZVA 4XJEA 3H6RB 4NKUA 1KNYA 9ICCA 5J29A 3UQ2A 4M9HA 2B51A 9ICWA 2J3PA 4D0TA 3PMEA 4L4IA 5HRHA 4DOBA 4R6UB 3IM5A 21BIA 3JZ0A 2ZH6A 7ICKA 5IIIA 4EV6A 4LO8B 5J0YA 4AT9B 3OJ2A 4I28A 1DQOA 3H6SE 2M2UA 3UXNA 3PUBA 2ZH2A 4RPYA 2DREA 4Z6EA 5CB1A 1DIWA 2Y9GA 1PWAA 2RQ9A 3CA5A 3Q7YA 5DB7A 2DVIA 5B3PA 3FUQA 1XZZA 2FDBM 2I9GA 4GOYA 4LO0A 3H6RA 1ZQRA 5IIMA 1TWMA 4X38A 3CRHA 4KLJA 4Q9GA 1OU5A 3NBCA 5CWRA 4UB5A 2BEBA 1YLQA 1BPEA 1ISZA 5HRDA 3IAGC 4J2SA 2ZHAA 3TFRA 2VANA 4P0KA 1BARA 1T9FA 4MKPA 1ABRB 3AKGA 1ILR1 4EKXB 4J2XA 1TFYA 3UQ0A 8ICJA 3RJFA 3UPQA 3AKFA 4R66A 4I2CA 3O4OA 4QZIA 4XFSA 4WC2A 3VUOA 1XG6A 2D7IA 4X4QA 4PH5A 1JT3A 1YF8B 4I4YA 1SR4C 3ISCA 1VJ7A 3OJVA 3JPRA 2FO1A 5E24E 4PHEA 1ZQXA 5J2EA 5J2AA 4F5QA 4KLSA 2E4MA 5BPCA 2HN2A 2B4VA 1HWMB 4RQ7A 5CHGA 4RWPA 4NLKA 3JRRA 4NXVA 3P53A 3WMVA 4LEZA 4Z6CA 4G6MA 4XFUA 2UUSA 4XRHA 4PGYA 2D22A 2IUBA 4MFFA 3BAGA 4QALA 3UD7A 3NYBA 4I2EA 3BA4A 3V72A 3O4BA 1PC8B 1DLLA 1PUMB 2FMQA 4RQ6A 3CRGA 5J2HA 4PC4A 4I0UA 2DRAA 4NXTA 2M49A 3O5WB 5F8SA 3ZX7A 4XQ8A 3OV7A 1W3AA 9ICQA 3AH4A 4IG8A 2D44A 3CA1A 4IQPA 1T4QA 1UETA 2ZQNA 4I4OA 2D23A 5EC5A 1IRPA 5J0UA 2F8XC 4X4RA 5TZVA 4QZFA 2VSAA 4J2KA 4F34A 4TUSA 1NO5A 1ZJMA 3BADA 1Q78A 4M9GA 7ICMA 1KEJA 7ICHA 2GA9D 2IHOA 1ZQYA 3WFSC 1IHKA 1XSLA 3HIYA 5DZUA 3ZC9A 2DRBA 4WOYA 4NLNA 2NP0A 1ZQAA 3JUTA 4LVSA 3IIRA 7ICVA 1DFQA 5J2IA 4JWMA 1I1BA 2BCQA 4H75A 2DR7A 9ILBA 8ICTA 2QYIB 1BA7A 3EF2A 5B3QA 3CA0A 1Z4SA 2ET2A 3FJHA 3LTQA 4I2SA 4WC0A 1AVWB 1IT0A 4A7YA 3FJAA 2IWTB 3FJFA 4PHAA 4MF2A 3MDAA 4R63A 4K8VA 2KI4A 1WD3A 4YCXA 2BBJA 5IIKA 3CAHA 3C5FA 1BFGA 4KLFA 4EEDA 2BCRA 3MGHA 4JP0A 2VXTI 9ICRA 2QN4A 3Q7XA 4IQWA 5JMCA 4EFRA 4XUSA 4X4OA 5JLVA 4OEGA 3JPTA 4NKTA 5BOMA 4DCKC 4F5PA 1WD4A 4WC4A 4FH3A 4DOCA 5CA7A 2FMSA 8ICSA 2FFUA 1MIYA 3WFPA 1K5VA 4LO1C 1AF9A 2FMPA 4JRAA 2HHPA 5CR0A 7ICUA 1EYLA 8ICAA 5EG6C 4IY9A 5BXRA 1ZQGA 2NM1A 4OAGA 4HJJA 2M2WA 1ISVA 5DUYA 4MFCA 4Z8SB 3MGIA 4GAIA 5BQUC 4O5KA 4YMOA 2YUGA 4G9NA 4E80A 3RH5A 3MCRA 3ZC8A 4XKIA 4KLIA 4TLPA 4TUPA 2MIBA 1ZQLA 4OEFA 4XQ7A 5CFSA 4OUJA 2DR8A 3V79C 3OUYA 9ICVA 1I1EA 1BPDA 4DENA 2VXRA 1PZZA 1WOTA 5J0XA 4QZ8A 1YTOA 4X5VA 3JCFA 4KLOA 3MDCA 5DB6A 4FVVA 5HRBA 5D46A 4KLEA 5HHHA 1V6WA 1ZQSA 3NJ5A 8ICOA 3JPNA 1ZQUA 3NKUA 3N7KA 4LZGA 4PHDA 4HX0A 4I2GA 8ICRA 3LLPA 4JQ0A 4ZKTB 3A22A 1R8CA 3AH2A 3UDAA 1FA0A 5D4BA 3FUOA 2F2FA 2GO2A 3LQCB 4FO6A 4XA5A 1TFMB 2FFVA 4JPZA 7ICNA 4RQ8A 3CA4A 4JKXB 1UEVA 4LT6A 1IOBA 3V7KA 4FH5A 4RQ4A 4X0BA 1BFBA 4KLHA 2I1BA 4EB2B 3VWCA 3VSZA 4NM2A 4K9AA 3WA1A 8ICEA 1Z0HA 1XYFA 4FHYA 2BPFA 5F8WA 4TUQA 3OVBA 1MC9A 1Q04A 4IQTA 9ICIA 4E8FA
chains in the Genus database with same CATH topology
5B2HA 1MD6A 3OJVA 2FO1A 4ZOTA 5E24E 1S0EA 3IM6A 1IRAX 4NXXA 1V6XA 1DJSB 2AFGA 3ER8C 1D0HA 1S0DA 2D24A 4WBCA 1VCLA 4I37A 2FGFA 4J2YA 3OBTA 4LO7C 3RMYA 2DRYA 3WINC 1G9CA 3V0BA 2E4MA 4FGFA 1Q1UA 4IZEA 5BXPA 4ZLBB 1RMLA 1PUUB 1UPSA 4QD2C 2B4VA 1ONKB 1R8NA 3BAVA 4ZBVB 1HWMB 3HN1A 3MPPG 1GGPB 5BQUA 4KBBA 1BFFA 4I4UA 4MZGB 1BFCA 3JRRA 1FN0A 4NXWA 1M16A 4NXVA 3P53A 3WMVA 1NUNA 3WO3A 1SZ6B 3O4CA 1FV3A 4LEZA 2ZR1B 4G6MA 4XFUA 1WBAA 2UUSA 1BLDA 3POKA 1HCEA 3FJ9A 1BLAA 2D22A 8I1BA 3CU1B 3BAGA 2Z49A 4D0ZA 4QALA 3UD7A 1P63A 1HKNA 5FZZA 3VT1A 1RY7A 3BA4A 1FV2A 3O4BA 4CJMA 4J23B 1PC8B 3I2AA 5HPZA 2B56A 1AFCA 1DLLA 1PUMB 4X39A 3PG0A 3CRGA 2ESUA 4HA2A 1V6VA 4PC4A 5I1BA 3E8LC 5F90A 3FJIA 4NXTA 4LO3C 2M49A 4K9BA 1JQZA 2LIEA 3FJ8A 3O5WB 5F8SA 3C9ZA 1GPJA 2D7RA 4O67A 1II4A 2NZ9A 4IY8A 3FFZA 3NBNA 4FO1A 3FJJA 1DZDA 1TTUA 2VSEA 3QYDA 2KI6B 1EV2A 3ZX7A 4KEIA 3O4DA 4IYBA 4OAHA 3AKHA 1W3AA 5DSSB 4WQKA 4EFQA 3AJ5A 4GP0A 3AH4A 3P6IA 3S8JA 2D44A 3CA1A 4IQPA 1T4QA 1W3FA 3BAUA 1F31A 3HALA 2ZQNA 1ITBA 4I4OA 2VUAA 4ZA3B 4Q91A 4WH5A 2D23A 3UJ0A 5EC5A 4I8MA 1IRPA 1AVAC 3BA7A 5FNWA 2F8XC 2HW9A 4EFPA 2VSAA 4J2KA 4F34A 3A23A 4ISRA 1FGAA 31BIA 3BRFA 3RTJB 4A7KA 4X3AA 2BEAA 3BADA 4JAWA 1JLXA 3B9UA 4D8HA 5BP5A 41BIA 3AH1A 2HWMA 1HWPB 4II0A 3CA3A 4OW4A 2GA9D 4IHZA 3D7WB 2IHOA 3CRIA 1S0BA 3ZXDA 4N7RA 4QKRA 1IHKA 1EPWA 2KLLA 4QC4A 5DZUA 2AXMA 1EVTA 4ENDA 4KM5A 1IJTA 3ZC9A 1QQKA 2D1ZA 4OWJA 4NXUA 4OEEA 4I4XA 3VT2A 1FMMS 4WOYA 2GZBA 2X2SA 3K7DA 4UY4A 3T8SA 2Q9XA 2NP0A 1G9AA 3S8KA 4P6AA 4ZFUB 1TP0A 4I96A 3JUTA 3IIRA 3RTIB 1DFQA 1XHBA 2P39A 4I4QA 1SR4A 4IONA 1I1BA 3OBRA 4OWKA 4O6AA 4H75A 3MALA 3OGFA 3AJ6A 3FJCA 1G82A 2EWRA 9ILBA 4DEPA 4AN7B 3V0AB 2QYIB 5D62A 5BVPI 1BA7A 2DRZA 3EF2A 3I2XA 3KMVA 4K96A 1HWOB 5B3QA 3CA0A 4I7IA 1Z2VA 4GP3A 1Z4SA 2ET2A 1CE7B 3UJ4A 2X2TA 3FGMA 4XFTA 1S0FA 3FJHA 3LTQA 4I2SA 2BFHA 1AVWB 1IT0A 3NBDA 3O3QA 3HMYA 3FJAA 4A7YA 3CA6A 3WINA 1JLYA 2IWTB 3FJFA 3A07A 1J0SA 1RZOB 1IILA 4L4HA 3F1RA 3K1XA 4I3NA 5BXTA 4Q9PA 3WO4A 4K8VA 3VT0A 1TWEA 4Z9WB 4I6IA 3O44A 3FJEA 3N7LA 4LO2C 2KI4A 1FQ9A 1WD3A 3UD8A 1E0OA 2F2FC 3TC2A 3CAHA 4QO3A 3UD9A 4AN6A 4USPA 1BFGA 1NZKA 1G9DA 4JLXA 4H9WA 4QBCA 3BRGC 1S0LA 4EEEB 3FJDA 2HZ9A 4JP0A 2VXTI 1ISWA 2QN4A 3Q7XA 5FZYA 5JMCA 4EFRA 4MZHA 3R4UA 1V6UA 2LIQA 3HOMA 3IM7A 5JLVA 3CQAA 6I1BA 4OEGA 5GAQA 2FCLA 1S0GA 3VSFA 3OGGA 4I1EA 3R4SA 4DCKC 3QR5A 4LO3A 3AZWA 3RSJA 4OAFA 1QXMA 1WD4A 1FMZA 2KKIA 3BAHA 4I4PA 1YXWA 4P0LA 3V0AA 1AXMA 2WBCA 5G00A 3N0KA 2RG9B 2L5XA 1JTCA 1AVXB 2FFUA 4USOA 1Q03A 3ER9B 7I1BA 4G1RA 1K5VA 4LO1C 4G6JA 4A7ZA 4ZFYB 3BB2A 4QKSA 3I29B 2VLCA 1AF9A 4JRAA 5F8YA 5FNXA 3RMXA 4I4SA 4LEVA 1EYLA 1JT7A 4HR6C 1KNMA 5D61A 5EG6C 4GOVA 2XOAA 4IY9A 4LEWA 1HCDA 5FZUA 5BXRA 1YYNA 2R9KB 1YBIA 3HBWA 1OQLB 2NM1A 4JLZA 2MLLB 4OAGA 3PHZA 1DQGA 2DS0A 4HJJA 3WO2A 5EHAA 2GAFD 3AZVA 1ISVA 2E4MC 4XJEA 3H6RB 5BXSA 5DUYA 2WRYA 3F62B 3AKIA 4ZFWB 5CFUA 4Z8SB 4GAIA 4ISQA 5BQUC 2AQZA 2B51A 4K99A 2J3PA 4I4VA 4D0TA 2YUGA 3PMEA 4G9NA 2Q3NB 2Y9FA 4L4IA 3FJBA 3MCRA 3ZC8A 1L2HA 5BOWA 1W3GA 4XKIA 4R6UB 2NTDA 4TLPA 3IM5A 21BIA 2NS2A 3P6JA 2MIBA 4YOLA 3ILAA 1TIEA 4I4RA 4OEFA 1RG8A 2KH2A 3BTAA 2ERMA 2VU9A 1G9BA 5CFSA 3N7MA 4OUJA 1JT4A 4IZXA 2Y9WC 4G9MA 4GAFA 3V79C 3Q7WA 4LO8B 2NYYA 1JY0A 1I1EA 3OJ2A 4DENA 1HWNB 4O68A 1FWUA 1PZZA 1JT5A 2VXRA 4LO0C 1DZCA 3OWGA 4OAIZ 1DQOA 1YTOA 3H6SE 3WMUA 2Z48A 3PUBA 5D63A 2DREA 1QQLA 4X37A 4K98A 1DIWA 4FVVA 4JKQA 2D43A 2Y9GA 3O49A 1PWAA 3OJMA 1BASA 1V6WA 3NJ5A 2AAIB 2RQ9A 1ISXA 3CA5A 4I1BA 3Q7YA 3NBEA 2D20A 3W9TA 3NKUA 5B3PA 3FUQA 3N7KA 1XZZA 2FDBM 4HX0A 3LLPA 1A8DA 4KC3A 4GOYA 4LEYA 4JQ0A 4LO0A 2ZQOA 3H6RA 1DFCA 4ZKTB 1N4KA 2Y9XE 3A22A 2MC2A 1TWMA 4LO2A 3AH2A 4X38A 3UDAA 1K5UA 3CRHA 3FUOA 3SNVA 3HSMA 2F2FA 2HWAA 3BAOA 2GO2A 4KB6A 4Q9GA 3BA5A 3BX1C 3V0BB 4H04A 3NBCA 1TFMB 2K4AB 2FFVA 1ISYA 4JPZA 2BEBA 3N7JA 1ISZA 4I0YA 3CA4A 1FWVA 4JKXB 2K43A 5BP5C 1S0CA 3IAGC 4QBVA 1M2TB 2P23A 4ZGRB 4J2SA 1IOBA 4OWLA 2NVHA 4P0KA 1R8OA 3VEQA 1BARA 1T9FA 4MKPA 4F83A 3BAQA 1ABRB 3AKGA 3A21A 3ZXGA 4KEKA 1ILR1 4EKXB 1TOOA 1WBCA 5DVHA 4O69A 4K97A 4J2XA 3O4AA 1BFBA 3H6QA 4LO7B 4MZFB 2I1BA 3BRDA 4EB2B 4QD2B 4WQLA 3AKFA 3VWCA 5CHEA 3VSZA 1AVUA 4KEJA 4K9AA 1HIBA 5CFTA 2K8RA 3WA1A 1Z0HA 1XYFA 3O4OA 3ERCC 4XFSA 5F8WA 4LO1A 4P0JA 3VUOA 3FJKA 2RSTA 1XG6A 1CVSA 1MC9A 1Q04A 2D7IA 1JT3A 1YF8B 4I4YA 1SR4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2H A;  1MD6 A;  3OJV A;  2FO1 A;  4ZOT A;  5E24 E;  1S0E A;  3IM6 A;  1IRA X;  1V6X A;  1DJS B;  2AFG A;  1D0H A;  1S0D A;  2D24 A;  4WBC A;  1VCL A;  4I37 A;  2FGF A;  4J2Y A;  3OBT A;  4LO7 C;  3RMY A;  2DRY A;  3WIN C;  1G9C A;  3V0B A;  2E4M A;  4FGF A;  1Q1U A;  4IZE A;  5BXP A;  4ZLB B;  1RML A;  1PUU B;  1UPS A;  4QD2 C;  1ONK B;  1R8N A;  3BAV A;  4ZBV B;  1HWM B;  3HN1 A;  3MPP G;  1GGP B;  5BQU A;  4KBB A;  1BFF A;  4I4U A;  1BFC A;  3JRR A;  1FN0 A;  1M16 A;  3P53 A;  3WMV A;  1NUN A;  3WO3 A;  1SZ6 B;  3O4C A;  1FV3 A;  2ZR1 B;  4G6M A;  4XFU A;  1WBA A;  2UUS A;  1BLD A;  3POK A;  1HCE A;  3FJ9 A;  1BLA A;  2D22 A;  8I1B A;  3CU1 B;  3BAG A;  2Z49 A;  4D0Z A;  4QAL A;  3UD7 A;  1P63 A;  1HKN A;  5FZZ A;  3VT1 A;  1RY7 A;  3BA4 A;  1FV2 A;  3O4B A;  4CJM A;  4J23 B;  1PC8 B;  3I2A A;  5HPZ A;  1AFC A;  1DLL A;  1PUM B;  4X39 A;  3PG0 A;  3CRG A;  2ESU A;  4HA2 A;  1V6V A;  4PC4 A;  5I1B A;  3E8L C;  5F90 A;  3FJI A;  4LO3 C;  2M49 A;  1JQZ A;  2LIE A;  3FJ8 A;  3O5W B;  5F8S A;  3C9Z A;  2D7R A;  1II4 A;  2NZ9 A;  4IY8 A;  3FFZ A;  3NBN A;  3FJJ A;  1DZD A;  1TTU A;  2VSE A;  3QYD A;  2KI6 B;  1EV2 A;  3ZX7 A;  4KEI A;  3O4D A;  4IYB A;  3AKH A;  1W3A A;  5DSS B;  4EFQ A;  3AJ5 A;  4GP0 A;  3AH4 A;  3P6I A;  3S8J A;  2D44 A;  3CA1 A;  4IQP A;  1T4Q A;  1W3F A;  3BAU A;  1F31 A;  3HAL A;  2ZQN A;  1ITB A;  4I4O A;  2VUA A;  4ZA3 B;  4Q91 A;  2D23 A;  3UJ0 A;  5EC5 A;  4I8M A;  1IRP A;  1AVA C;  3BA7 A;  5FNW A;  2F8X C;  2HW9 A;  4EFP A;  2VSA A;  4J2K A;  4F34 A;  3A23 A;  4ISR A;  1FGA A;  31BI A;  3BRF A;  3RTJ B;  4A7K A;  4X3A A;  2BEA A;  3BAD A;  4JAW A;  1JLX A;  3B9U A;  4D8H A;  5BP5 A;  41BI A;  3AH1 A;  2HWM A;  1HWP B;  4II0 A;  3CA3 A;  4OW4 A;  4IHZ A;  3D7W B;  2IHO A;  3CRI A;  1S0B A;  3ZXD A;  4QKR A;  1IHK A;  1EPW A;  2KLL A;  4QC4 A;  5DZU A;  2AXM A;  1EVT A;  4END A;  1IJT A;  3ZC9 A;  1QQK A;  2D1Z A;  4OWJ A;  4OEE A;  4I4X A;  3VT2 A;  1FMM S;  2GZB A;  2X2S A;  3T8S A;  2Q9X A;  2NP0 A;  1G9A A;  3S8K A;  4P6A A;  4ZFU B;  1TP0 A;  4I96 A;  3JUT A;  3IIR A;  3RTI B;  1DFQ A;  1XHB A;  2P39 A;  4I4Q A;  1SR4 A;  4ION A;  1I1B A;  3OBR A;  4OWK A;  3MAL A;  3OGF A;  3AJ6 A;  3FJC A;  1G82 A;  9ILB A;  4DEP A;  4AN7 B;  3V0A B;  2QYI B;  5D62 A;  5BVP I;  1BA7 A;  2DRZ A;  3EF2 A;  3I2X A;  3KMV A;  1HWO B;  3CA0 A;  4I7I A;  1Z2V A;  4GP3 A;  1Z4S A;  2ET2 A;  1CE7 B;  3UJ4 A;  2X2T A;  3FGM A;  4XFT A;  1S0F A;  3FJH A;  3LTQ A;  4I2S A;  2BFH A;  1AVW B;  1IT0 A;  3NBD A;  3O3Q A;  3HMY A;  3FJA A;  4A7Y A;  3CA6 A;  3WIN A;  1JLY A;  2IWT B;  3FJF A;  3A07 A;  1J0S A;  1RZO B;  1IIL A;  4L4H A;  3F1R A;  3K1X A;  4I3N A;  5BXT A;  4Q9P A;  3WO4 A;  3VT0 A;  1TWE A;  4Z9W B;  4I6I A;  3O44 A;  3FJE A;  3N7L A;  4LO2 C;  2KI4 A;  1FQ9 A;  1WD3 A;  3UD8 A;  1E0O A;  2F2F C;  3TC2 A;  3CAH A;  4QO3 A;  3UD9 A;  4AN6 A;  4USP A;  1BFG A;  1NZK A;  1G9D A;  4H9W A;  4QBC A;  3BRG C;  1S0L A;  4EEE B;  3FJD A;  2HZ9 A;  4JP0 A;  2VXT I;  1ISW A;  2QN4 A;  3Q7X A;  5FZY A;  5JMC A;  4EFR A;  3R4U A;  1V6U A;  2LIQ A;  3HOM A;  3IM7 A;  5JLV A;  3CQA A;  6I1B A;  4OEG A;  5GAQ A;  1S0G A;  3VSF A;  3OGG A;  4I1E A;  3R4S A;  4DCK C;  3QR5 A;  4LO3 A;  3AZW A;  3RSJ A;  1QXM A;  1WD4 A;  1FMZ A;  2KKI A;  3BAH A;  4I4P A;  1YXW A;  4P0L A;  3V0A A;  1AXM A;  2WBC A;  5G00 A;  3N0K A;  2RG9 B;  2L5X A;  1JTC A;  1AVX B;  2FFU A;  4USO A;  1Q03 A;  7I1B A;  4G1R A;  1K5V A;  4LO1 C;  4G6J A;  4A7Z A;  4ZFY B;  3BB2 A;  4QKS A;  3I29 B;  2VLC A;  1AF9 A;  4JRA A;  5F8Y A;  5FNX A;  3RMX A;  4I4S A;  1EYL A;  1JT7 A;  4HR6 C;  1KNM A;  5D61 A;  5EG6 C;  4GOV A;  2XOA A;  4IY9 A;  1HCD A;  5FZU A;  5BXR A;  1YYN A;  2R9K B;  1YBI A;  3HBW A;  1OQL B;  2NM1 A;  2MLL B;  3PHZ A;  1DQG A;  2DS0 A;  4HJJ A;  3WO2 A;  5EHA A;  3AZV A;  1ISV A;  2E4M C;  3H6R B;  5BXS A;  5DUY A;  2WRY A;  3F62 B;  3AKI A;  4ZFW B;  4Z8S B;  4GAI A;  4ISQ A;  5BQU C;  2AQZ A;  2J3P A;  4I4V A;  4D0T A;  2YUG A;  3PME A;  4G9N A;  2Q3N B;  2Y9F A;  4L4I A;  3FJB A;  3ZC8 A;  1L2H A;  5BOW A;  1W3G A;  4XKI A;  4R6U B;  2NTD A;  4TLP A;  3IM5 A;  21BI A;  3P6J A;  2MIB A;  4YOL A;  3ILA A;  1TIE A;  4I4R A;  4OEF A;  1RG8 A;  2KH2 A;  3BTA A;  2ERM A;  2VU9 A;  1G9B A;  3N7M A;  4OUJ A;  1JT4 A;  4IZX A;  2Y9W C;  4G9M A;  4GAF A;  3V79 C;  3Q7W A;  4LO8 B;  2NYY A;  1JY0 A;  1I1E A;  3OJ2 A;  4DEN A;  1HWN B;  1FWU A;  1PZZ A;  1JT5 A;  2VXR A;  4LO0 C;  1DZC A;  1DQO A;  1YTO A;  3H6S E;  3WMU A;  2Z48 A;  3PUB A;  5D63 A;  2DRE A;  1QQL A;  4X37 A;  1DIW A;  4FVV A;  4JKQ A;  2D43 A;  2Y9G A;  3O49 A;  1PWA A;  3OJM A;  1BAS A;  1V6W A;  3NJ5 A;  2AAI B;  2RQ9 A;  1ISX A;  3CA5 A;  4I1B A;  3Q7Y A;  3NBE A;  2D20 A;  3W9T A;  3FUQ A;  3N7K A;  1XZZ A;  2FDB M;  3LLP A;  1A8D A;  4KC3 A;  4GOY A;  4JQ0 A;  4LO0 A;  2ZQO A;  3H6R A;  1DFC A;  4ZKT B;  1N4K A;  2Y9X E;  3A22 A;  2MC2 A;  1TWM A;  4LO2 A;  3AH2 A;  4X38 A;  3UDA A;  1K5U A;  3CRH A;  3FUO A;  3SNV A;  3HSM A;  2F2F A;  2HWA A;  3BAO A;  2GO2 A;  4Q9G A;  3BA5 A;  3BX1 C;  3V0B B;  4H04 A;  3NBC A;  1TFM B;  2K4A B;  2FFV A;  1ISY A;  4JPZ A;  2BEB A;  3N7J A;  1ISZ A;  4I0Y A;  3CA4 A;  1FWV A;  4JKX B;  2K43 A;  5BP5 C;  1S0C A;  3IAG C;  4QBV A;  1M2T B;  2P23 A;  4ZGR B;  4J2S A;  1IOB A;  4OWL A;  2NVH A;  4P0K A;  1R8O A;  3VEQ A;  1BAR A;  1T9F A;  4F83 A;  3BAQ A;  1ABR B;  3AKG A;  3A21 A;  3ZXG A;  4KEK A;  1ILR 1;  4EKX B;  1TOO A;  1WBC A;  5DVH A;  4J2X A;  3O4A A;  1BFB A;  3H6Q A;  4LO7 B;  2I1B A;  3BRD A;  4EB2 B;  4QD2 B;  3AKF A;  3VWC A;  3VSZ A;  1AVU A;  4KEJ A;  1HIB A;  2K8R A;  3WA1 A;  1Z0H A;  1XYF A;  3O4O A;  4XFS A;  5F8W A;  4LO1 A;  4P0J A;  3VUO A;  3FJK A;  2RST A;  1XG6 A;  1CVS A;  1MC9 A;  1Q04 A;  2D7I A;  1JT3 A;  1YF8 B;  4I4Y A;  1SR4 C; 
#chains in the Genus database with same CATH topology
 5B2H A;  4GXJ A;  3B0X A;  5IIN A;  3IM6 A;  1DJS B;  5HR9 A;  2AFG A;  3RJG A;  4AT8 B;  4YMM A;  4YD1 A;  2D24 A;  4X4S A;  4WBC A;  2BCS A;  2PFO A;  9ICH A;  4J2Y A;  1MIW A;  8ICZ A;  2DRY A;  3WIN C;  4ZLB B;  1RML A;  1R8N A;  4ZBV B;  1BFF A;  2RFF A;  8ICQ A;  4GXI A;  1NUN A;  5IIL A;  1FV3 A;  1XSP A;  3JPO A;  4LZD A;  1WBA A;  4QZE A;  9ICA A;  3FJ9 A;  8I1B A;  3CU1 B;  1HKN A;  4I27 A;  4UB3 A;  4J23 B;  2ZH9 A;  3I2A A;  5I1B A;  4K9B A;  4LO3 C;  1JQZ A;  4QZG A;  2NZ9 A;  4IY8 A;  8ICX A;  1ZQB A;  3NBN A;  4FO1 A;  3FJJ A;  5J2F A;  1JAJ A;  1ZQH A;  4AT8 A;  4PPX A;  4KEI A;  4IYB A;  5DSS B;  4WQK A;  3AJ5 A;  3S8J A;  4RQ1 A;  1KDH A;  1F31 A;  3HAL A;  4WH5 A;  4I8M A;  1AVA C;  4P4M A;  4Z6F A;  4ISR A;  4AT9 A;  1FGA A;  4A7K A;  2BEA A;  4P4P A;  4D8H A;  5BP5 A;  3AH1 A;  2PFQ A;  1HWP B;  3CA3 A;  4OW4 A;  1VFG A;  4KLD A;  3CRI A;  4QKR A;  4EBK A;  4WC3 A;  4END A;  1IJT A;  3RH4 A;  4K4H A;  4OWJ A;  4NXU A;  4OEE A;  1ZJN A;  3WFO A;  3VT2 A;  1FMM S;  4GXK A;  2X2S A;  3K7D A;  2Q9X A;  4RQ3 A;  4ZFU B;  4X0A A;  3RTI B;  3JPP A;  4R65 A;  4O6A A;  3MAL A;  3OGF A;  3FJC A;  5IIO A;  5D62 A;  7ICO A;  3I2X A;  8ICW A;  4GP3 A;  3UJ4 A;  3JYY A;  2X2T A;  3FGM A;  4XFT A;  1S0F A;  2BFH A;  4RWQ A;  3HMY A;  1JLY A;  1J0S A;  1RZO B;  1IIL A;  2M2V A;  4L4H A;  3F1R A;  5BXT A;  5J0R A;  7ICI A;  5DBA A;  4Q9P A;  3VT0 A;  1TWE A;  4QZD A;  5HRE A;  4Z9W B;  4I6I A;  3FJE A;  1E0O A;  1NZK A;  4H9W A;  4QBC A;  3BRG C;  4UBC A;  4EEE B;  3V7L A;  5F2V O;  3RJJ A;  4E7X A;  4MZH A;  3IM7 A;  5DKW A;  9ICP A;  6I1B A;  1S0G A;  1BPZ A;  3QR5 A;  3AZW A;  3RSJ A;  4OAF A;  7ICJ A;  2KKI A;  3BAH A;  4I4P A;  5G00 A;  3N0K A;  4MF8 A;  2L5X A;  3RH6 A;  1AVX B;  7I1B A;  3MBY A;  3AQL A;  3I29 B;  4EP7 A;  4UBB A;  4P4O A;  2VLC A;  8ICC A;  4WC5 A;  8ICV A;  5FNX A;  7ICE A;  1MIV A;  3C18 A;  4QZ9 A;  4HR6 C;  4M9L A;  4O9M A;  8ICK A;  2GWS A;  4LEW A;  5FZU A;  4FHW A;  1YYN A;  1YBI A;  2MLL B;  5EHA A;  2E4M C;  3WFR E;  3F62 B;  3AKI A;  4ZFW B;  1ZQW A;  5CFU A;  2AQZ A;  4NLZ A;  4K99 A;  2Q3N B;  2Y9F A;  3FJB A;  5BOW A;  1W3G A;  3C5G A;  4EEB A;  2NS2 A;  3P6J A;  4FHX A;  4YOL A;  3ILA A;  1TIE A;  3BTA A;  2ERM A;  4NXZ A;  1G9B A;  3N7M A;  3RJE A;  4IZX A;  2Y9W C;  4G9M A;  4GAF A;  4X4U A;  4I2I A;  2NYY A;  4O68 A;  1FWU A;  4X4P A;  1DZC A;  7ICS A;  3WMU A;  3H38 A;  5J2K A;  4KLL A;  5D63 A;  1QQL A;  4K98 A;  4JKQ A;  1ISX A;  4I1B A;  3NBE A;  2D20 A;  3W9T A;  4KC3 A;  5DEC A;  2ZQO A;  1DFC A;  1N4K A;  2MC2 A;  4LO2 A;  2HWA A;  1R89 A;  8ICM A;  3BX1 C;  4F5R A;  3V0B B;  2K4A B;  1ZQE A;  7ICT A;  3AQM A;  2P23 A;  4ZGR B;  4OWL A;  3AUO A;  1R8O A;  4F83 A;  2BCV A;  3H37 A;  4AT7 B;  3A21 A;  3ZXG A;  4FHP A;  4KEK A;  1TOO A;  4O69 A;  4MZF B;  4UAW A;  3AU2 A;  9ICL A;  1BPX A;  4M9N A;  1HIB A;  3K75 D;  4RWN A;  4QZA A;  3B0Y A;  4F5O A;  8ICP A;  1S0E A;  4I2H A;  4NXX A;  2M2T A;  3ER8 C;  4KLT A;  1S0D A;  1VCL A;  4WC7 A;  2HN1 A;  8ICL A;  5DB9 A;  2FGF A;  3OBT A;  4LO7 C;  3RMY A;  3V0B A;  4IZE A;  1ZQD A;  1PUU B;  4WBY A;  4QD2 C;  4M2Y A;  3H39 A;  1ZQN A;  2ISP A;  3C2K A;  2PXI A;  3MPP G;  3RJI A;  4MZG B;  2ZH7 A;  3C2L A;  1FN0 A;  4UD4 A;  5J0T A;  7ICG A;  4AT7 A;  1SZ6 B;  2ZR1 B;  1BPB A;  4P2H A;  3POK A;  4WC6 A;  5CJ7 A;  4D0Z A;  4DO9 A;  8ICG A;  1P63 A;  1Q79 A;  2PBE A;  5FZZ A;  1TV9 A;  4CJM A;  1HUZ A;  3C2M A;  5HRG A;  1AFC A;  5J0S A;  3CK6 A;  4X39 A;  4QZB A;  2ESU A;  4HA2 A;  1V6V A;  4PGQ A;  3E8L C;  5F90 A;  4I2B A;  3V7J A;  1GPJ A;  3UPS A;  2D7R A;  1II4 A;  2NRK A;  3FFZ A;  4TUR A;  1DZD A;  4I29 A;  2VSE A;  3QYD A;  3O4D A;  7ICP A;  1ZQV A;  3AKH A;  1F5A A;  1W3F A;  9ICE A;  4RQ5 A;  2VUA A;  4ZA3 B;  4Q91 A;  3BA7 A;  5FNW A;  2HW9 A;  4EFP A;  2DR9 A;  31BI A;  3RTJ B;  4X3A A;  8ICB A;  2PFP A;  7ICL A;  4WCW A;  5HRL A;  2ZHB A;  1ZQK A;  8ICN A;  9ICS A;  4II0 A;  3L9D A;  3ZXD A;  4N7R A;  2ZH8 A;  2KLL A;  4RT2 A;  1EVT A;  4KM5 A;  4UD5 A;  9ICN A;  2D1Z A;  4Z6D A;  4KLQ A;  4NM1 A;  3RJH A;  1ZQO A;  4QZH A;  3T8S A;  5HHI A;  1G9A A;  3S8K A;  4P6A A;  4I96 A;  2O1P A;  2P39 A;  4ION A;  1SR4 A;  1R8A A;  5J2D A;  4RQ2 A;  9ICG A;  3AJ6 A;  4DEP A;  4AN7 B;  2DRZ A;  3KMV A;  4K96 A;  4I7I A;  4WC1 A;  1CE7 B;  1ZQZ A;  5D49 A;  1V4A A;  3PMN A;  3O3Q A;  3A07 A;  4M9J A;  4X4T A;  4I3N A;  2BCU A;  3O44 A;  3N7L A;  1FQ9 A;  3UD8 A;  3GDX A;  2F2F C;  4AN6 A;  4QO3 A;  3NVO A;  3PNC A;  5FZY A;  5J0P A;  1V6U A;  3HOM A;  3CQA A;  5GAQ A;  1ZQF A;  5DDY A;  3VSF A;  5EOZ A;  1JQR A;  3HJ1 A;  4I1E A;  4FHV A;  1QXM A;  1AXM A;  2WBC A;  4G1R A;  4A7Z A;  5J2B A;  4M5D A;  3BB2 A;  4QKS A;  7ICR A;  4RWO A;  1MQ2 A;  3ISB A;  4I4S A;  4KLG A;  4LEV A;  4MFA A;  1JT7 A;  5D61 A;  1HCD A;  9ICM A;  2R9K B;  2BPG A;  3AQK A;  3UXP A;  1DQG A;  2DS0 A;  3WO2 A;  5BXS A;  3HW8 A;  2WRY A;  1ZQI A;  5HRF A;  5JTG A;  4ISQ A;  4I4V A;  1L2H A;  2NTD A;  4I4R A;  1RG8 A;  2KH2 A;  2VU9 A;  2Q66 A;  1JT4 A;  3Q7W A;  9ICT A;  1JY0 A;  1HWN B;  1JT5 A;  4LO0 C;  3OWG A;  4KLM A;  4OAI Z;  2Z48 A;  4UB2 A;  4X37 A;  2D43 A;  2BE3 A;  3O49 A;  3OJM A;  1BAS A;  4RQ0 A;  2AAI B;  4QZC A;  1R8B A;  2O5A A;  8ICI A;  7ICQ A;  1A8D A;  4UAZ A;  4LEY A;  2BPC A;  1ZQC A;  2Y9X E;  5DB8 A;  9ICK A;  4I2J A;  1K5U A;  3SNV A;  3HSM A;  3BAO A;  1ZQP A;  4KB6 A;  4IQU A;  3BA5 A;  4M04 A;  4H04 A;  1ISY A;  5HRK A;  3N7J A;  4I0Y A;  4X4V A;  1FWV A;  5BP5 C;  2K43 A;  4RT3 A;  3LK9 A;  1S0C A;  9ICJ A;  4QBV A;  1M2T B;  3AU6 A;  2NVH A;  5J2J A;  3VEQ A;  3BAQ A;  4UAY A;  4UB4 A;  8ICY A;  5J2C A;  2ZH5 A;  1WBC A;  5DVH A;  4K97 A;  3O4A A;  4UB1 A;  3H6Q A;  4LO7 B;  3BRD A;  3JPQ A;  4O5E A;  4QD2 B;  4WQL A;  5CHE A;  1JN3 A;  1AVU A;  4KEJ A;  2K8R A;  5IIJ A;  3ERC C;  4LO1 A;  4P0J A;  2ZH4 A;  3FJK A;  2RST A;  1CVS A;  1XSN A;  1HUO A;  3R4S A;  3UXO A;  1MD6 A;  3HJ4 A;  4ZOT A;  9ICB A;  1MQ3 A;  1IRA X;  1V6X A;  3PML A;  1D0H A;  4I37 A;  2ZH1 A;  1JMS A;  3OVS A;  1G9C A;  4FGF A;  1Q1U A;  5BXP A;  1UPS A;  3OVA A;  9ICO A;  1ONK B;  3BAV A;  3JPS A;  5DDM A;  5BOL A;  3HN1 A;  1GGP B;  4K4I A;  5BQU A;  4KBB A;  3ISD A;  5DBC A;  4I4U A;  1BFC A;  4NXW A;  1M16 A;  3C66 A;  4RPX A;  3WO3 A;  3O4C A;  1BPY A;  1BLD A;  5DBB A;  1HCE A;  3WFQ E;  1BLA A;  4I2D A;  2Z49 A;  4K4G A;  2ZH3 A;  4YD2 A;  3VT1 A;  1RY7 A;  1FV2 A;  4NY8 A;  5HRI A;  5HPZ A;  2B56 A;  4R64 A;  3PG0 A;  1ZQT A;  3HX0 A;  3FJI A;  4ATB B;  2LIE A;  2ID1 A;  3FJ8 A;  3C9Z A;  4O67 A;  7ICF A;  1TTU A;  5J0Q A;  2KI6 B;  1EV2 A;  4OAH A;  4EFQ A;  4GP0 A;  3P6I A;  4F5N A;  3BAU A;  4X4N A;  1ITB A;  2W9M A;  3UJ0 A;  2IHM A;  3A23 A;  3BRF A;  5J2G A;  4KLU A;  4IQV A;  2DR5 A;  3OUY B;  4JAW A;  2PFN A;  1JLX A;  3B9U A;  5J0O A;  41BI A;  3TFS A;  2HWM A;  4IHZ A;  3D7W B;  3OGU A;  1S0B A;  1EPW A;  4QC4 A;  4PHP A;  2AXM A;  4YMN A;  4PGX A;  1ZQJ A;  1QQK A;  8ICH A;  4ATB A;  4I4X A;  2GZB A;  3H3A A;  4UY4 A;  1TP0 A;  1ZQQ A;  9ICX A;  1XHB A;  4I4Q A;  3OBR A;  4OWK A;  4M47 A;  3AQN A;  2EWR A;  1G82 A;  3HWT A;  1PX5 A;  3V0A B;  5BVP I;  5DED A;  1HWO B;  4YN4 A;  1ZQM A;  1Z2V A;  2BBH A;  5CFT A;  3NBD A;  4RPZ A;  3CA6 A;  3WIN A;  1RPL A;  3K1X A;  2P66 A;  3WO4 A;  4LO2 C;  8ICU A;  9ICU A;  3TC2 A;  3UD9 A;  4USP A;  1G9D A;  4JLX A;  8ICF A;  1S0L A;  4EBJ A;  3FJD A;  2HZ9 A;  4I2A A;  4M0A A;  1ISW A;  4O5C A;  3R4U A;  2LIQ A;  5HC9 A;  5CP2 A;  4EGW A;  2FCL A;  3OGG A;  4JWN A;  4I2F A;  4LO3 A;  1NOM A;  1FMZ A;  2ISO A;  1YXW A;  5J0W A;  4P0L A;  3V0A A;  1TFW A;  4DOA A;  2RG9 B;  1JTC A;  4USO A;  1Q03 A;  3ER9 B;  4G6J A;  4ZFY B;  1RZT A;  5F8Y A;  3RMX A;  3RJK A;  1TVA A;  4WBZ A;  9ICF A;  1KNM A;  3NWI A;  4GOV A;  2XOA A;  3HBW A;  1OQL B;  4JLZ A;  3PHZ A;  1UEU A;  4S3N A;  2GAF D;  3AZV A;  4XJE A;  3H6R B;  4NKU A;  1KNY A;  9ICC A;  5J29 A;  3UQ2 A;  4M9H A;  2B51 A;  9ICW A;  2J3P A;  4D0T A;  3PME A;  4L4I A;  5HRH A;  4DOB A;  4R6U B;  3IM5 A;  21BI A;  3JZ0 A;  2ZH6 A;  7ICK A;  5III A;  4EV6 A;  4LO8 B;  5J0Y A;  4AT9 B;  3OJ2 A;  4I28 A;  1DQO A;  3H6S E;  2M2U A;  3UXN A;  3PUB A;  2ZH2 A;  4RPY A;  2DRE A;  4Z6E A;  5CB1 A;  1DIW A;  2Y9G A;  1PWA A;  2RQ9 A;  3CA5 A;  3Q7Y A;  5DB7 A;  2DVI A;  5B3P A;  3FUQ A;  1XZZ A;  2FDB M;  2I9G A;  4GOY A;  4LO0 A;  3H6R A;  1ZQR A;  5IIM A;  1TWM A;  4X38 A;  3CRH A;  4KLJ A;  4Q9G A;  1OU5 A;  3NBC A;  5CWR A;  4UB5 A;  2BEB A;  1YLQ A;  1BPE A;  1ISZ A;  5HRD A;  3IAG C;  4J2S A;  2ZHA A;  3TFR A;  2VAN A;  4P0K A;  1BAR A;  1T9F A;  4MKP A;  1ABR B;  3AKG A;  1ILR 1;  4EKX B;  4J2X A;  1TFY A;  3UQ0 A;  8ICJ A;  3RJF A;  3UPQ A;  3AKF A;  4R66 A;  4I2C A;  3O4O A;  4QZI A;  4XFS A;  4WC2 A;  3VUO A;  1XG6 A;  2D7I A;  4X4Q A;  4PH5 A;  1JT3 A;  1YF8 B;  4I4Y A;  1SR4 C;  3ISC A;  1VJ7 A;  3OJV A;  3JPR A;  2FO1 A;  5E24 E;  4PHE A;  1ZQX A;  5J2E A;  5J2A A;  4F5Q A;  4KLS A;  2E4M A;  5BPC A;  2HN2 A;  2B4V A;  1HWM B;  4RQ7 A;  5CHG A;  4RWP A;  4NLK A;  3JRR A;  4NXV A;  3P53 A;  3WMV A;  4LEZ A;  4Z6C A;  4G6M A;  4XFU A;  2UUS A;  4XRH A;  4PGY A;  2D22 A;  2IUB A;  4MFF A;  3BAG A;  4QAL A;  3UD7 A;  3NYB A;  4I2E A;  3BA4 A;  3V72 A;  3O4B A;  1PC8 B;  1DLL A;  1PUM B;  2FMQ A;  4RQ6 A;  3CRG A;  5J2H A;  4PC4 A;  4I0U A;  2DRA A;  4NXT A;  2M49 A;  3O5W B;  5F8S A;  3ZX7 A;  4XQ8 A;  3OV7 A;  1W3A A;  9ICQ A;  3AH4 A;  4IG8 A;  2D44 A;  3CA1 A;  4IQP A;  1T4Q A;  1UET A;  2ZQN A;  4I4O A;  2D23 A;  5EC5 A;  1IRP A;  5J0U A;  2F8X C;  4X4R A;  5TZV A;  4QZF A;  2VSA A;  4J2K A;  4F34 A;  4TUS A;  1NO5 A;  1ZJM A;  3BAD A;  1Q78 A;  4M9G A;  7ICM A;  1KEJ A;  7ICH A;  2GA9 D;  2IHO A;  1ZQY A;  3WFS C;  1IHK A;  1XSL A;  3HIY A;  5DZU A;  3ZC9 A;  2DRB A;  4WOY A;  4NLN A;  2NP0 A;  1ZQA A;  3JUT A;  4LVS A;  3IIR A;  7ICV A;  1DFQ A;  5J2I A;  4JWM A;  1I1B A;  2BCQ A;  4H75 A;  2DR7 A;  9ILB A;  8ICT A;  2QYI B;  1BA7 A;  3EF2 A;  5B3Q A;  3CA0 A;  1Z4S A;  2ET2 A;  3FJH A;  3LTQ A;  4I2S A;  4WC0 A;  1AVW B;  1IT0 A;  4A7Y A;  3FJA A;  2IWT B;  3FJF A;  4PHA A;  4MF2 A;  3MDA A;  4R63 A;  4K8V A;  2KI4 A;  1WD3 A;  4YCX A;  2BBJ A;  5IIK A;  3CAH A;  3C5F A;  1BFG A;  4KLF A;  4EED A;  2BCR A;  3MGH A;  4JP0 A;  2VXT I;  9ICR A;  2QN4 A;  3Q7X A;  4IQW A;  5JMC A;  4EFR A;  4XUS A;  4X4O A;  5JLV A;  4OEG A;  3JPT A;  4NKT A;  5BOM A;  4DCK C;  4F5P A;  1WD4 A;  4WC4 A;  4FH3 A;  4DOC A;  5CA7 A;  2FMS A;  8ICS A;  2FFU A;  1MIY A;  3WFP A;  1K5V A;  4LO1 C;  1AF9 A;  2FMP A;  4JRA A;  2HHP A;  5CR0 A;  7ICU A;  1EYL A;  8ICA A;  5EG6 C;  4IY9 A;  5BXR A;  1ZQG A;  2NM1 A;  4OAG A;  4HJJ A;  2M2W A;  1ISV A;  5DUY A;  4MFC A;  4Z8S B;  3MGI A;  4GAI A;  5BQU C;  4O5K A;  4YMO A;  2YUG A;  4G9N A;  4E80 A;  3RH5 A;  3MCR A;  3ZC8 A;  4XKI A;  4KLI A;  4TLP A;  4TUP A;  2MIB A;  1ZQL A;  4OEF A;  4XQ7 A;  5CFS A;  4OUJ A;  2DR8 A;  3V79 C;  3OUY A;  9ICV A;  1I1E A;  1BPD A;  4DEN A;  2VXR A;  1PZZ A;  1WOT A;  5J0X A;  4QZ8 A;  1YTO A;  4X5V A;  3JCF A;  4KLO A;  3MDC A;  5DB6 A;  4FVV A;  5HRB A;  5D46 A;  4KLE A;  5HHH A;  1V6W A;  1ZQS A;  3NJ5 A;  8ICO A;  3JPN A;  1ZQU A;  3NKU A;  3N7K A;  4LZG A;  4PHD A;  4HX0 A;  4I2G A;  8ICR A;  3LLP A;  4JQ0 A;  4ZKT B;  3A22 A;  1R8C A;  3AH2 A;  3UDA A;  1FA0 A;  5D4B A;  3FUO A;  2F2F A;  2GO2 A;  3LQC B;  4FO6 A;  4XA5 A;  1TFM B;  2FFV A;  4JPZ A;  7ICN A;  4RQ8 A;  3CA4 A;  4JKX B;  1UEV A;  4LT6 A;  1IOB A;  3V7K A;  4FH5 A;  4RQ4 A;  4X0B A;  1BFB A;  4KLH A;  2I1B A;  4EB2 B;  3VWC A;  3VSZ A;  4NM2 A;  4K9A A;  3WA1 A;  8ICE A;  1Z0H A;  1XYF A;  4FHY A;  2BPF A;  5F8W A;  4TUQ A;  3OVB A;  1MC9 A;  1Q04 A;  4IQT A;  9ICI A;  4E8F A; 
#chains in the Genus database with same CATH homology
 5B2H A;  1MD6 A;  3OJV A;  2FO1 A;  4ZOT A;  5E24 E;  1S0E A;  3IM6 A;  1IRA X;  4NXX A;  1V6X A;  1DJS B;  2AFG A;  3ER8 C;  1D0H A;  1S0D A;  2D24 A;  4WBC A;  1VCL A;  4I37 A;  2FGF A;  4J2Y A;  3OBT A;  4LO7 C;  3RMY A;  2DRY A;  3WIN C;  1G9C A;  3V0B A;  2E4M A;  4FGF A;  1Q1U A;  4IZE A;  5BXP A;  4ZLB B;  1RML A;  1PUU B;  1UPS A;  4QD2 C;  2B4V A;  1ONK B;  1R8N A;  3BAV A;  4ZBV B;  1HWM B;  3HN1 A;  3MPP G;  1GGP B;  5BQU A;  4KBB A;  1BFF A;  4I4U A;  4MZG B;  1BFC A;  3JRR A;  1FN0 A;  4NXW A;  1M16 A;  4NXV A;  3P53 A;  3WMV A;  1NUN A;  3WO3 A;  1SZ6 B;  3O4C A;  1FV3 A;  4LEZ A;  2ZR1 B;  4G6M A;  4XFU A;  1WBA A;  2UUS A;  1BLD A;  3POK A;  1HCE A;  3FJ9 A;  1BLA A;  2D22 A;  8I1B A;  3CU1 B;  3BAG A;  2Z49 A;  4D0Z A;  4QAL A;  3UD7 A;  1P63 A;  1HKN A;  5FZZ A;  3VT1 A;  1RY7 A;  3BA4 A;  1FV2 A;  3O4B A;  4CJM A;  4J23 B;  1PC8 B;  3I2A A;  5HPZ A;  2B56 A;  1AFC A;  1DLL A;  1PUM B;  4X39 A;  3PG0 A;  3CRG A;  2ESU A;  4HA2 A;  1V6V A;  4PC4 A;  5I1B A;  3E8L C;  5F90 A;  3FJI A;  4NXT A;  4LO3 C;  2M49 A;  4K9B A;  1JQZ A;  2LIE A;  3FJ8 A;  3O5W B;  5F8S A;  3C9Z A;  1GPJ A;  2D7R A;  4O67 A;  1II4 A;  2NZ9 A;  4IY8 A;  3FFZ A;  3NBN A;  4FO1 A;  3FJJ A;  1DZD A;  1TTU A;  2VSE A;  3QYD A;  2KI6 B;  1EV2 A;  3ZX7 A;  4KEI A;  3O4D A;  4IYB A;  4OAH A;  3AKH A;  1W3A A;  5DSS B;  4WQK A;  4EFQ A;  3AJ5 A;  4GP0 A;  3AH4 A;  3P6I A;  3S8J A;  2D44 A;  3CA1 A;  4IQP A;  1T4Q A;  1W3F A;  3BAU A;  1F31 A;  3HAL A;  2ZQN A;  1ITB A;  4I4O A;  2VUA A;  4ZA3 B;  4Q91 A;  4WH5 A;  2D23 A;  3UJ0 A;  5EC5 A;  4I8M A;  1IRP A;  1AVA C;  3BA7 A;  5FNW A;  2F8X C;  2HW9 A;  4EFP A;  2VSA A;  4J2K A;  4F34 A;  3A23 A;  4ISR A;  1FGA A;  31BI A;  3BRF A;  3RTJ B;  4A7K A;  4X3A A;  2BEA A;  3BAD A;  4JAW A;  1JLX A;  3B9U A;  4D8H A;  5BP5 A;  41BI A;  3AH1 A;  2HWM A;  1HWP B;  4II0 A;  3CA3 A;  4OW4 A;  2GA9 D;  4IHZ A;  3D7W B;  2IHO A;  3CRI A;  1S0B A;  3ZXD A;  4N7R A;  4QKR A;  1IHK A;  1EPW A;  2KLL A;  4QC4 A;  5DZU A;  2AXM A;  1EVT A;  4END A;  4KM5 A;  1IJT A;  3ZC9 A;  1QQK A;  2D1Z A;  4OWJ A;  4NXU A;  4OEE A;  4I4X A;  3VT2 A;  1FMM S;  4WOY A;  2GZB A;  2X2S A;  3K7D A;  4UY4 A;  3T8S A;  2Q9X A;  2NP0 A;  1G9A A;  3S8K A;  4P6A A;  4ZFU B;  1TP0 A;  4I96 A;  3JUT A;  3IIR A;  3RTI B;  1DFQ A;  1XHB A;  2P39 A;  4I4Q A;  1SR4 A;  4ION A;  1I1B A;  3OBR A;  4OWK A;  4O6A A;  4H75 A;  3MAL A;  3OGF A;  3AJ6 A;  3FJC A;  1G82 A;  2EWR A;  9ILB A;  4DEP A;  4AN7 B;  3V0A B;  2QYI B;  5D62 A;  5BVP I;  1BA7 A;  2DRZ A;  3EF2 A;  3I2X A;  3KMV A;  4K96 A;  1HWO B;  5B3Q A;  3CA0 A;  4I7I A;  1Z2V A;  4GP3 A;  1Z4S A;  2ET2 A;  1CE7 B;  3UJ4 A;  2X2T A;  3FGM A;  4XFT A;  1S0F A;  3FJH A;  3LTQ A;  4I2S A;  2BFH A;  1AVW B;  1IT0 A;  3NBD A;  3O3Q A;  3HMY A;  3FJA A;  4A7Y A;  3CA6 A;  3WIN A;  1JLY A;  2IWT B;  3FJF A;  3A07 A;  1J0S A;  1RZO B;  1IIL A;  4L4H A;  3F1R A;  3K1X A;  4I3N A;  5BXT A;  4Q9P A;  3WO4 A;  4K8V A;  3VT0 A;  1TWE A;  4Z9W B;  4I6I A;  3O44 A;  3FJE A;  3N7L A;  4LO2 C;  2KI4 A;  1FQ9 A;  1WD3 A;  3UD8 A;  1E0O A;  2F2F C;  3TC2 A;  3CAH A;  4QO3 A;  3UD9 A;  4AN6 A;  4USP A;  1BFG A;  1NZK A;  1G9D A;  4JLX A;  4H9W A;  4QBC A;  3BRG C;  1S0L A;  4EEE B;  3FJD A;  2HZ9 A;  4JP0 A;  2VXT I;  1ISW A;  2QN4 A;  3Q7X A;  5FZY A;  5JMC A;  4EFR A;  4MZH A;  3R4U A;  1V6U A;  2LIQ A;  3HOM A;  3IM7 A;  5JLV A;  3CQA A;  6I1B A;  4OEG A;  5GAQ A;  2FCL A;  1S0G A;  3VSF A;  3OGG A;  4I1E A;  3R4S A;  4DCK C;  3QR5 A;  4LO3 A;  3AZW A;  3RSJ A;  4OAF A;  1QXM A;  1WD4 A;  1FMZ A;  2KKI A;  3BAH A;  4I4P A;  1YXW A;  4P0L A;  3V0A A;  1AXM A;  2WBC A;  5G00 A;  3N0K A;  2RG9 B;  2L5X A;  1JTC A;  1AVX B;  2FFU A;  4USO A;  1Q03 A;  3ER9 B;  7I1B A;  4G1R A;  1K5V A;  4LO1 C;  4G6J A;  4A7Z A;  4ZFY B;  3BB2 A;  4QKS A;  3I29 B;  2VLC A;  1AF9 A;  4JRA A;  5F8Y A;  5FNX A;  3RMX A;  4I4S A;  4LEV A;  1EYL A;  1JT7 A;  4HR6 C;  1KNM A;  5D61 A;  5EG6 C;  4GOV A;  2XOA A;  4IY9 A;  4LEW A;  1HCD A;  5FZU A;  5BXR A;  1YYN A;  2R9K B;  1YBI A;  3HBW A;  1OQL B;  2NM1 A;  4JLZ A;  2MLL B;  4OAG A;  3PHZ A;  1DQG A;  2DS0 A;  4HJJ A;  3WO2 A;  5EHA A;  2GAF D;  3AZV A;  1ISV A;  2E4M C;  4XJE A;  3H6R B;  5BXS A;  5DUY A;  2WRY A;  3F62 B;  3AKI A;  4ZFW B;  5CFU A;  4Z8S B;  4GAI A;  4ISQ A;  5BQU C;  2AQZ A;  2B51 A;  4K99 A;  2J3P A;  4I4V A;  4D0T A;  2YUG A;  3PME A;  4G9N A;  2Q3N B;  2Y9F A;  4L4I A;  3FJB A;  3MCR A;  3ZC8 A;  1L2H A;  5BOW A;  1W3G A;  4XKI A;  4R6U B;  2NTD A;  4TLP A;  3IM5 A;  21BI A;  2NS2 A;  3P6J A;  2MIB A;  4YOL A;  3ILA A;  1TIE A;  4I4R A;  4OEF A;  1RG8 A;  2KH2 A;  3BTA A;  2ERM A;  2VU9 A;  1G9B A;  5CFS A;  3N7M A;  4OUJ A;  1JT4 A;  4IZX A;  2Y9W C;  4G9M A;  4GAF A;  3V79 C;  3Q7W A;  4LO8 B;  2NYY A;  1JY0 A;  1I1E A;  3OJ2 A;  4DEN A;  1HWN B;  4O68 A;  1FWU A;  1PZZ A;  1JT5 A;  2VXR A;  4LO0 C;  1DZC A;  3OWG A;  4OAI Z;  1DQO A;  1YTO A;  3H6S E;  3WMU A;  2Z48 A;  3PUB A;  5D63 A;  2DRE A;  1QQL A;  4X37 A;  4K98 A;  1DIW A;  4FVV A;  4JKQ A;  2D43 A;  2Y9G A;  3O49 A;  1PWA A;  3OJM A;  1BAS A;  1V6W A;  3NJ5 A;  2AAI B;  2RQ9 A;  1ISX A;  3CA5 A;  4I1B A;  3Q7Y A;  3NBE A;  2D20 A;  3W9T A;  3NKU A;  5B3P A;  3FUQ A;  3N7K A;  1XZZ A;  2FDB M;  4HX0 A;  3LLP A;  1A8D A;  4KC3 A;  4GOY A;  4LEY A;  4JQ0 A;  4LO0 A;  2ZQO A;  3H6R A;  1DFC A;  4ZKT B;  1N4K A;  2Y9X E;  3A22 A;  2MC2 A;  1TWM A;  4LO2 A;  3AH2 A;  4X38 A;  3UDA A;  1K5U A;  3CRH A;  3FUO A;  3SNV A;  3HSM A;  2F2F A;  2HWA A;  3BAO A;  2GO2 A;  4KB6 A;  4Q9G A;  3BA5 A;  3BX1 C;  3V0B B;  4H04 A;  3NBC A;  1TFM B;  2K4A B;  2FFV A;  1ISY A;  4JPZ A;  2BEB A;  3N7J A;  1ISZ A;  4I0Y A;  3CA4 A;  1FWV A;  4JKX B;  2K43 A;  5BP5 C;  1S0C A;  3IAG C;  4QBV A;  1M2T B;  2P23 A;  4ZGR B;  4J2S A;  1IOB A;  4OWL A;  2NVH A;  4P0K A;  1R8O A;  3VEQ A;  1BAR A;  1T9F A;  4MKP A;  4F83 A;  3BAQ A;  1ABR B;  3AKG A;  3A21 A;  3ZXG A;  4KEK A;  1ILR 1;  4EKX B;  1TOO A;  1WBC A;  5DVH A;  4O69 A;  4K97 A;  4J2X A;  3O4A A;  1BFB A;  3H6Q A;  4LO7 B;  4MZF B;  2I1B A;  3BRD A;  4EB2 B;  4QD2 B;  4WQL A;  3AKF A;  3VWC A;  5CHE A;  3VSZ A;  1AVU A;  4KEJ A;  4K9A A;  1HIB A;  5CFT A;  2K8R A;  3WA1 A;  1Z0H A;  1XYF A;  3O4O A;  3ERC C;  4XFS A;  5F8W A;  4LO1 A;  4P0J A;  3VUO A;  3FJK A;  2RST A;  1XG6 A;  1CVS A;  1MC9 A;  1Q04 A;  2D7I A;  1JT3 A;  1YF8 B;  4I4Y A;  1SR4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...