5D62A

Moa-z-vad-fmk complex, inverted orientation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
molecule keywords Agglutinin
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d62A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d62A02
3FJBA 4I4PA 3NJ5A 3N7JA 1AF9A 1AVXB 4LO7B 1II4A 2Y9FA 2VU9A 4I2SA 5D61A 3TC2A 3Q7WA 2D44A 4J2XA 3WA1A 3LTQA 1BLAA 4JP0A 1NUNA 4KEKA 4XKIA 4QC4A 3CA6A 1BFGA 4I6IA 2IHOA 1ILR1 1DZDA 3BB2A 2KI4A 3ZXGA 3MPPG 1FWVA 1Q1UA 4HR6C 4X39A 4AN7B 2E4MC 1BA7A 9ILBA 2BFHA 3BA4A 5F8WA 5BXTA 4Q91A 4GP0A 1TIEA 1A8DA 5BXRA 4I4OA 3CQAA 4D8HA 4OEEA 4LO0A 5DZUA 2LIQA 1TOOA 1V6VA 3PG0A 1IRAX 4OUJA 4L4IA 4X37A 1HCEA 5D62A 2IWTB 3N0KA 2FDBM 7I1BA 4II0A 4IY9A 1M2TB 3O4AA 2NP0A 2VSAA 1PZZA 4I96A 3AZVA 4TLPA 1DQOA 3VSFA 4ISRA 4KBBA 5GAQA 5BXSA 3V0AA 3H6QA 3FJHA 3C9ZA 3WO2A 1DZCA 2D43A 3E8LC 1AFCA 1V6XA 3I2AA 3AKIA 2BEAA 3ZXDA 3CRGA 4P0LA 3QR5A 1IILA 3NBCA 3RSJA 3BA7A 2P23A 2Z49A 4ENDA 2KKIA 1HCDA 4ZA3B 1Z4SA 4OEGA 1IT0A 2ZQOA 1PUUB 1XG6A 4F34A 5DUYA 1N4KA 2HZ9A 3V79C 4ZKTB 3BTAA 3O44A 4XFTA 1JT7A 1Q03A 3F1RA 4HA2A 2K43A 1BLDA 4GOVA 4QKRA 4D0TA 3N7KA 1RMLA 2VXRA 4HJJA 1KNMA 4J23B 4Q9GA 4YOLA 4J2YA 3RTJB 4DENA 2KLLA 3Q7YA 3UJ0A 5FZYA 3UJ4A 1BFFA 4IY8A 4ZOTA 4L4HA 4FGFA 4QD2B 3UDAA 2D7IA 2FFUA 3JRRA 3R4SA 5BP5A 3O5WB 1G9BA 3OJMA 4KC3A 3CAHA 1G9DA 3AZWA 2VUAA 2DS0A 1RZOB 1W3GA 1EYLA 2UUSA 4J2SA 4IQPA 2AXMA 6I1BA 4GAIA 5FZUA 5HPZA 3OBRA 3N7LA 2Y9XE 3LLPA 4WBCA 3CU1B 3PUBA 3S8KA 3P6JA 3RTIB 2R9KB 3V0BA 2F2FC 1ABRB 4XFSA 1ITBA 2NM1A 2I1BA 3B9UA 3FJIA 1HWMB 2VLCA 2MIBA 3BX1C 4JRAA 1WBCA 1DLLA 1BASA 1ISZA 2D7RA 3HBWA 3WINC 2D24A 1WD4A 4D0ZA 1JLYA 4DCKC 3EF2A 1V6UA 1MD6A 1JTCA 2RQ9A 4I7IA 4G9MA 4LO8B 1HWOB 1IHKA 1YTOA 2NTDA 3FUQA 2VXTI 3POKA 4G6MA 3KMVA 5DVHA 3AKHA 2X2SA 1TP0A 1D0HA 1R8NA 3BAVA 1FV2A 3PMEA 2RSTA 5JMCA 3RMYA 1AVWB 4G1RA 2K4AB 4ISQA 3WMVA 2X2TA 3A22A 4EEEB 3MALA 3BAHA 3BAGA 2NZ9A 1FN0A 4QO3A 4USOA 3HMYA 3NBDA 1YF8B 1IOBA 2HW9A 2QYIB 4AN6A 3FJEA 4KEJA 1FQ9A 2FFVA 3A07A 3O4DA 3F62B 5D63A 3OJ2A 4ZFUB 5F90A 2DRYA 1XYFA 5F8YA 3O49A 4GOYA 1OQLB 4LO1C 1PC8B 2AQZA 4H04A 2ZQNA 1AVAC 1DJSB 1K5UA 3FJJA 4QBVA 4Q9PA 3CA1A 4USPA 4I37A 2F2FA 1AVUA 3UD8A 3AKGA 4P0JA 5I1BA 3IM6A 2XOAA 3BRFA 2D23A 4FVVA 1I1BA 1BFCA 1MC9A 4R6UB 2RG9B 3BAUA 2HWAA 3O4OA 4I3NA 4X38A 4QKSA 5BP5C 1FGAA 4J2KA 4OEFA 4I1EA 3CA5A 3H6SE 1YXWA 2F8XC 3SNVA 3CRHA 1FMZA 2M49A 3BAQA 3JUTA 3N7MA 1RY7A 2WRYA 3QYDA 4P0KA 4OWJA 1SR4A 4QD2C 3WO4A 3BRDA 3VT2A 5BQUC 1TFMB 4Z9WB 4KEIA 4QALA 3K1XA 1JY0A 1XHBA 3NBEA 1IJTA 4GAFA 2HWMA 5BVPI 2L5XA 4G9NA 3ILAA 4OW4A 3OGGA 3ZX7A 1T9FA 1JT3A 4I4XA 3OGFA 4LO3C 1V6WA 2NVHA 2GZBA 3AH2A 3W9TA 4ZGRB 1L2HA 3D7WB 3WMUA 2Q9XA 2Y9WC 3OBTA 3ZC8A 3AH4A 3Q7XA 5E24E 3H6RA 1S0CA 1VCLA 4LO7C 4ZFWB 3FJDA 1YYNA 3A23A 1GGPB 3IM5A 3BAOA 4OWKA 1ISVA 1S0FA 3CA0A 2J3PA 5EC5A 21BIA 3S8JA 3V0BB 2MLLB 1QXMA 1S0DA 1WBAA 4F83A 4A7KA 3HALA 1W3AA 3AJ5A 3BADA 2VSEA 1T4QA 41BIA 2P39A 1CE7B 3A21A 4IZEA 1HKNA 2DREA 2LIEA 3ZC9A 3PHZA 4EB2B 1PWAA 4QBCA 1S0LA 3FGMA 4I4VA 2MC2A 1FWUA 2D22A 1WD3A 2Q3NB 4G6JA 3T8SA 2BEBA 4DEPA 1R8OA 5FZZA 1DQGA 3FJ8A 3FJCA 5BXPA 3VEQA 3I2XA 3P53A 4I1BA 3FJAA 3FUOA 1S0BA 3H6RB 1UPSA 1Z0HA 4JPZA 4IYBA 1ONKB 3O4CA 4ZBVB 1EV2A 2NYYA 1DFQA 2YUGA 3WO3A 1XZZA 2ESUA 4I4YA 1K5VA 3BRGC 3IAGC 1YBIA 5FNWA 1ISYA 4ZFYB 5BOWA 1G9AA 5DSSB 1QQLA 3UD9A 1S0GA 3AKFA 4OWLA 2KI6B 1JT5A 2AFGA 4LO3A 3VWCA 3HN1A 3O3QA 1FV3A 8I1BA 1ISXA 4I4RA 4ZLBB 1JLXA 1RG8A 1JQZA 3P6IA 2ERMA 4I8MA 4JAWA 5B2HA 1W3FA 5F8SA 4JQ0A 4EFQA 4A7ZA 4IONA 3FJKA 4CJMA 5EHAA 3NBNA 1I1EA 4I4UA 3BA5A 1G9CA 1TTUA 1NZKA 1AXMA 2D1ZA 3V0AB 1BARA 2E4MA 4LO0C 1E0OA 3AJ6A 1PUMB 3FJ9A 2D20A 2DRZA 2ET2A 1TWEA 4I4SA 1Z2VA 4H9WA 3R4UA 4A7YA 5FNXA 4XFUA 1CVSA 3VSZA 3VT0A 3CA3A 4EFPA 2AAIB 2K8RA 4EFRA 2WBCA 3WINA 1ISWA 1EVTA 2ZR1B 1G82A 2QN4A 3FFZA 5BQUA 4LO2A 4Z8SB 3CA4A 3FJFA 3HOMA 4X3AA 1SR4C 4IHZA 3UD7A 3HSMA 4P6AA 5JLVA 4IZXA 4PC4A 5G00A 5EG6C 3RMXA 1DFCA 1HIBA 1P63A 1M16A 3VUOA 1TWMA 4LO2C 3I29B 4EKXB 4JKXB 1EPWA 4LO1A 2Z48A 1BFBA 1HWNB 31BIA 3O4BA 2KH2A 2Y9GA 3AH1A 3IM7A 1SZ6B 1FMMS 3VT1A 2FO1A 3IIRA 1QQKA 4I4QA 1IRPA 1Q04A 1F31A 2GO2A 2FGFA 1S0EA 1DIWA 1HWPB 1J0SA 4JKQA 3CRIA 4I0YA 3OJVA 1JT4A 4GP3A
chains in the Genus database with same CATH superfamily
3FJBA 4I4PA 3NJ5A 3N7JA 1AF9A 1AVXB 4LO7B 1II4A 2Y9FA 2VU9A 4I2SA 5D61A 3TC2A 3Q7WA 2D44A 4J2XA 3WA1A 3LTQA 2PBEA 1BLAA 4JLZA 4JP0A 1ZQKA 2PFPA 9ICIA 1NUNA 4K99A 4KEKA 4XKIA 4QC4A 1VJ7A 3CA6A 5J0WA 1BFGA 4I6IA 5J2AA 4RPYA 2IHOA 1ILR1 1DZDA 1R8CA 2HHPA 4FO1A 2DR9A 5DB9A 4KLOA 4X4NA 3BB2A 2KI4A 9ICUA 3ZXGA 3WFPA 1VFGA 3MPPG 1FWVA 5J2FA 5J0YA 4QZHA 1Q1UA 4HR6C 1BPEA 5DBCA 3C2MA 4X39A 2M2VA 4LEVA 3UPSA 7ICOA 4AN7B 2E4MC 1BA7A 9ILBA 3H3AA 5J2IA 2BFHA 4WC3A 3BA4A 3ISCA 4RQ3A 5F8WA 5DB7A 2Q66A 8ICAA 5BXTA 7ICHA 4Q91A 4GP0A 5DB8A 3WFOA 1TIEA 1A8DA 4FHWA 4AT8B 5BXRA 8ICRA 4I4OA 3CQAA 4D8HA 4OEEA 4I2IA 3JPPA 4O5EA 4LO0A 5DZUA 1ZQXA 5EOZA 2LIQA 4QZ9A 4X4TA 5HC9A 1TOOA 1V6VA 3PG0A 4M0AA 5IIOA 1IRAX 4QZDA 4OUJA 4TUSA 4F5QA 4L4IA 4X37A 1HCEA 5D62A 5J0PA 2IWTB 3N0KA 4RQ2A 2FDBM 3ISDA 7I1BA 5IINA 4II0A 4R66A 4O69A 4IY9A 4Z6FA 3JZ0A 1M2TB 3O4AA 2NP0A 2VSAA 4IQUA 4XA5A 1MQ2A 1PZZA 2BPGA 4FHXA 1ZQFA 4OAGA 3RJKA 4I96A 3AZVA 2BCSA 4TLPA 4O5CA 1R8AA 2ZH4A 1DQOA 3VSFA 5DKWA 4ISRA 4KBBA 8ICZA 5GAQA 5BXSA 3V0AA 3NKUA 4UB3A 9ICGA 3H6QA 1JN3A 3H39A 5HREA 4F5OA 3FJHA 3C9ZA 3WO2A 3HJ4A 4FHYA 8ICIA 1DZCA 2D43A 4I2GA 3RH4A 4M2YA 3E8LC 8ICSA 3RJEA 4PHPA 4WC6A 1AFCA 1HUZA 4MFCA 2ZH3A 4F5PA 3V7KA 1ZQMA 5J0TA 1ZQGA 1V6XA 3I2AA 3AKIA 4PGXA 4KLTA 2BEAA 2BCQA 3ZXDA 4OAFA 4EP7A 1ZQCA 3CRGA 4P0LA 3AQMA 3JPSA 2EWRA 3QR5A 1IILA 3NBCA 5IIIA 4QZEA 5CFSA 4LZGA 3RSJA 5D46A 3BA7A 2P23A 4PGQA 3OVAA 2Z49A 4ENDA 3C66A 2KKIA 1HCDA 4ZA3B 1Z4SA 4OEGA 7ICSA 4NLZA 1GPJA 4P4OA 8ICCA 1IT0A 2BCUA 2ZQOA 9ICJA 1PUUB 1XG6A 4F34A 4M5DA 5DUYA 1N4KA 5CFUA 4RT3A 3JPQA 1ZQDA 4N7RA 2HZ9A 2O5AA 4KLIA 3V79C 5HRLA 4ZKTB 3BTAA 3O44A 5DBAA 5J2GA 4XFTA 7ICKA 2GA9D 1JT7A 1Q03A 4I29A 3F1RA 1ZQUA 4HA2A 2BBHA 5BOLA 4PHDA 2DR7A 9ICRA 2K43A 1BPDA 1BLDA 4GOVA 5D49A 4QKRA 4XQ8A 4UAYA 4D0TA 4MFFA 3N7KA 1RMLA 2VXRA 4HJJA 3OVBA 3UXOA 2BCRA 1KNMA 3ISBA 4J23B 4Q9GA 4YOLA 4J2YA 3RTJB 1KNYA 4Z6CA 3WFQE 4RQ7A 5HHIA 7ICMA 8ICUA 4DENA 2KLLA 1ZQVA 3Q7YA 3UJ0A 5FZYA 3UJ4A 4XRHA 1BFFA 3MDAA 4IY8A 4K4GA 4ZOTA 1ZQWA 5IIJA 3H38A 1JMSA 4L4HA 2DR8A 2DRAA 7ICQA 4FGFA 4QD2B 3UDAA 1BPYA 2FMSA 2D7IA 4NXVA 4X4OA 2ZH1A 2DVIA 4EEDA 4YCXA 4EBJA 4OAHA 5B3PA 3JPOA 2PXIA 4K4IA 2FFUA 3JRRA 3R4SA 5BP5A 3O5WB 1G9BA 3OJMA 4KC3A 3C2KA 3CAHA 9ICKA 1G9DA 3AZWA 9ICBA 2VUAA 3AQKA 2DS0A 4KLSA 4NY8A 1RZOB 1W3GA 4QZBA 4I27A 1EYLA 2UUSA 4J2SA 3LQCB 4IQPA 4AT9B 3HWTA 4I2BA 2AXMA 4M9HA 6I1BA 4GAIA 4IG8A 5FZUA 5HPZA 3OBRA 3N7LA 2Y9XE 4EV6A 3LLPA 5HRHA 2BCVA 4WBCA 3CU1B 3PUBA 3S8KA 3P6JA 3RTIB 2R9KB 4RWPA 3V0BA 5IIMA 2F2FC 1ABRB 4XFSA 4WC2A 7ICLA 7ICJA 1ITBA 1V4AA 4KLUA 2NM1A 9ICHA 2I1BA 3B9UA 3FJIA 1HWMB 4K97A 1UEVA 2VLCA 2MIBA 3BX1C 4JRAA 3B0YA 4FHPA 4NXZA 4YN4A 4YMOA 3K75D 1WBCA 1BPXA 1DLLA 1BASA 1ISZA 2D7RA 3HBWA 3WINC 2D24A 1WD4A 4D0ZA 1Q79A 1JLYA 4PH5A 4RPZA 4RQ4A 4R63A 4M47A 8ICNA 4DCKC 3AQNA 1JQRA 4RPXA 3ER8C 3EF2A 1V6UA 1MD6A 1JTCA 2RQ9A 4I7IA 4Z6EA 4G9MA 4LO8B 4WC5A 3C5FA 4JWNA 1HWOB 1IHKA 1YTOA 2NTDA 3FUQA 2VXTI 3POKA 4G6MA 5DDMA 4NLKA 3KMVA 4RQ8A 5DVHA 3AKHA 1ZQPA 2PFOA 2X2SA 2RFFA 4KB6A 2ZHBA 2HN1A 1TP0A 2NRKA 1D0HA 4WC1A 1R8NA 4WQKA 4ATBB 4AT8A 3BAVA 3NVOA 4QZAA 1R8BA 5J29A 5J2BA 4RQ1A 4RWQA 4TUPA 3RJJA 4KLJA 1FV2A 3PMEA 1MIWA 5CHGA 2RSTA 4RWOA 5JMCA 4WQLA 4I2DA 3RMYA 1AVWB 4P4PA 2BE3A 4G1RA 1HUOA 2K4AB 8ICGA 4ISQA 3WMVA 2X2TA 3A22A 4EEEB 1OU5A 8ICXA 9ICTA 5CJ7A 8ICJA 3MALA 3BAHA 3BAGA 8ICOA 4WOYA 4YMMA 3UQ0A 2NZ9A 1ZQSA 2I9GA 3AUOA 4O6AA 1FN0A 4QO3A 4USOA 4RT2A 3HJ1A 3HMYA 3PMLA 2M2UA 4UY4A 3NBDA 1YF8B 2FCLA 1IOBA 1ZQTA 4PPXA 9ICCA 2HW9A 4H75A 8ICEA 4UB4A 2QYIB 1RZTA 4QZIA 4AN6A 4P4MA 3FJEA 5HRFA 2VANA 4KEJA 1FQ9A 2FFVA 3A07A 3O4DA 1XSLA 1ZQLA 1ZQBA 5F2VO 4UB2A 3F62B 4PHAA 5D63A 4QZ8A 3WFSC 3OJ2A 4ZFUB 9ICEA 5F90A 2DRYA 1XYFA 5F8YA 3O49A 4GOYA 1OQLB 4LO1C 4O5KA 1PC8B 2AQZA 4H04A 9ICPA 2ZQNA 7ICFA 1AVAC 1Q78A 1DJSB 1K5UA 4WC0A 3FJJA 4QBVA 7ICNA 4Q9PA 3CA1A 4USPA 4I37A 3HX0A 3NWIA 2F2FA 3RJFA 1AVUA 3UD8A 3AKGA 5BOMA 5J0SA 4P0JA 4X0AA 2BPFA 1KEJA 5I1BA 4YMNA 3IM6A 1FA0A 2XOAA 4RQ6A 2P66A 4NKTA 3ER9B 3BRFA 4NXWA 2D23A 4FVVA 7ICUA 1I1BA 3RH5A 1BFCA 4OAIZ 1MC9A 4R6UB 3OWGA 3C5GA 2RG9B 3BAUA 2HWAA 4F5RA 3O4OA 4I3NA 4XJEA 4RQ5A 4X4RA 4R64A 1ZQOA 4NLNA 4X38A 3JYYA 3RH6A 4QKSA 4P2HA 4UD4A 7ICIA 3MCRA 5BP5C 2ZH6A 3GDXA 1FGAA 4J2KA 4OEFA 3HW8A 2BBJA 4I1EA 5J0XA 3NYBA 4HX0A 3CA5A 4MZHA 2ZH7A 1XSPA 2ZH2A 4KLDA 3H6SE 1YXWA 4M9LA 2F8XC 1TFWA 3SNVA 3CRHA 5J2JA 1FMZA 4KLLA 2M49A 4WBYA 3BAQA 3JUTA 4PHEA 3V72A 3N7MA 4E7XA 8ICPA 9ICWA 1RY7A 2WRYA 3QYDA 2HN2A 7ICTA 4P0KA 4OWJA 1WOTA 4GXIA 1SR4A 4X4QA 3UQ2A 4QD2C 3WO4A 5CR0A 3BRDA 3RJIA 3VT2A 4KLQA 5BQUC 1TFMB 4UB1A 1MIYA 4I2AA 1TV9A 4Z9WB 3C18A 2B56A 4EEBA 4KEIA 4QALA 3K1XA 5IILA 4NXUA 1JY0A 1ZJMA 1XHBA 4DO9A 3NBEA 1IJTA 4YD2A 3UXPA 8ICHA 9ICAA 2ISOA 4GAFA 2HWMA 5BVPI 8ICLA 4TUQA 2L5XA 4DOAA 4G9NA 2DR5A 3ILAA 3JPNA 5DECA 4I2FA 4OW4A 4E8FA 4I2HA 2W9MA 3OGGA 2PFNA 5TZVA 4KLFA 5CWRA 3ZX7A 1T9FA 1JT3A 4I4XA 4AT7B 3OGFA 1TVAA 4LO3C 4WCWA 1V6WA 2NVHA 2GZBA 3AH2A 4X4VA 5J0UA 3ERCC 3W9TA 4AT9A 2B4VA 4ZGRB 9ICSA 9ICVA 8ICBA 1L2HA 3D7WB 3WMUA 2Q9XA 2Y9WC 3OBTA 3ZC8A 1PX5A 5D4BA 2GWSA 4Z6DA 5J2DA 3OGUA 3AH4A 1ZQYA 4O9MA 4QZFA 4NM2A 3Q7XA 4LVSA 5E24E 4X0BA 4GXJA 3H6RA 2ISPA 3TFSA 2IUBA 1S0CA 3MGIA 1VCLA 4LO7C 4ZFWB 1NOMA 2ID1A 3FJDA 3UPQA 4X5VA 1YYNA 3A23A 9ICNA 1GGPB 2ZH9A 2ZH5A 3IM5A 4I2EA 3BAOA 4OWKA 3HIYA 1ISVA 1S0FA 3CA0A 4UBCA 3RJHA 2J3PA 8ICKA 5EC5A 1RPLA 4ATBA 21BIA 3S8JA 2O1PA 3V0BB 7ICGA 4KLHA 4I2JA 3LK9A 3PMNA 2MLLB 1QXMA 1S0DA 1WBAA 4F83A 3MGHA 4A7KA 3K7DA 3HALA 1W3AA 3AJ5A 4K9BA 2M2WA 1ZQJA 3BADA 4X4UA 2VSEA 1T4QA 4FO6A 4M9NA 7ICPA 41BIA 2DRBA 2P39A 1ZQNA 5DBBA 4I28A 1CE7B 9ICLA 3A21A 4IZEA 2ZHAA 1HKNA 2DREA 2LIEA 3ZC9A 5J0RA 2IHMA 3L9DA 1UEUA 3PHZA 4EB2B 1PWAA 5HR9A 5BPCA 4QBCA 1S0LA 3FGMA 4I4VA 2MC2A 1FWUA 2D22A 1WD3A 4WH5A 2Q3NB 4G6JA 3T8SA 4X4PA 2BEBA 4DEPA 9ICMA 1R8OA 1JAJA 3MDCA 5J0OA 5FZZA 1DQGA 3FJ8A 4KLEA 4M9GA 3FJCA 5BXPA 3VEQA 4E80A 1ZQEA 3I2XA 3P53A 4I1BA 3CK6A 3FJAA 3FUOA 4YD1A 1S0BA 3H6RB 1UPSA 1Z0HA 4JPZA 4IYBA 4WC4A 5DB6A 8ICVA 4LEWA 1ONKB 4O68A 4NXTA 5CA7A 4I0UA 3O4CA 4ZBVB 1EV2A 4FHVA 4QZGA 2NYYA 4K96A 1DFQA 4LEYA 3OUYB 4WC7A 2YUGA 1R89A 3WO3A 1KDHA 1XZZA 2ESUA 4O67A 3C2LA 4MF2A 3PNCA 8ICQA 4EGWA 4I4YA 1K5VA 3BRGC 4EBKA 5CFTA 2B51A 3AU6A 3IAGC 4UAWA 1YBIA 5FNWA 1ISYA 4ZFYB 5BOWA 3AU2A 1ZQHA 1G9AA 5DSSB 1QQLA 4AT7A 4R65A 9ICQA 3JPRA 3JCFA 5JTGA 3UD9A 3WFRE 1S0GA 3AKFA 4OWLA 1MIVA 2FMQA 2KI6B 4IQTA 1JT5A 2NS2A 2AFGA 4LO3A 3VWCA 3HN1A 4XQ7A 3O3QA 3UXNA 1FV3A 2BPCA 8I1BA 5J0QA 1ISXA 4I4RA 4ZLBB 3OVSA 1JLXA 1RG8A 5HRDA 1JQZA 5HRBA 4XUSA 3P6IA 2ERMA 4I8MA 3OV7A 1ZJNA 1BPZA 7ICEA 4JAWA 4MKPA 8ICWA 5B2HA 1NO5A 1W3FA 1UETA 4DOBA 4M04A 4MZGB 8ICFA 5F8SA 4JWMA 4JQ0A 4EFQA 5CB1A 4A7ZA 4IONA 3FJKA 4CJMA 2PFQA 5EHAA 4LZDA 1ZQZA 4KLGA 3NBNA 1I1EA 4I4UA 3BA5A 1G9CA 1TTUA 3V7JA 1F5AA 4UAZA 1NZKA 1AXMA 2D1ZA 3V0AB 5CHEA 7ICRA 5J2CA 5HRIA 1BARA 4UD5A 4RWNA 2E4MA 4KM5A 4LO0C 1TFYA 1E0OA 3AJ6A 1PUMB 4MZFB 4IQWA 5DEDA 3FJ9A 4PGYA 2D20A 4IQVA 3OUYA 2DRZA 5J2HA 2ET2A 4M9JA 7ICVA 1TWEA 4I4SA 4QZCA 3TFRA 5J2EA 4K4HA 1Z2VA 3JPTA 4H9WA 3R4UA 4A7YA 5FNXA 4NM1A 4XFUA 4TURA 4GXKA 2ZH8A 1CVSA 4I2CA 3VSZA 3VT0A 3CA3A 3MBYA 4EFPA 1YLQA 4RQ0A 2AAIB 2FMPA 2K8RA 4EFRA 2WBCA 3WINA 1ISWA 1EVTA 2ZR1B 3H37A 1G82A 4NKUA 2QN4A 3FFZA 5BQUA 4LO2A 4Z8SB 4LT6A 4X4SA 9ICOA 3CA4A 3FJFA 3HOMA 1BPBA 4K8VA 4X3AA 1SR4C 5B3QA 9ICXA 4IHZA 4FH3A 3UD7A 4LEZA 3HSMA 3RJGA 4P6AA 5JLVA 4IZXA 4PC4A 5G00A 5EG6C 5HRGA 4UBBA 1MQ3A 3RMXA 1DFCA 1HIBA 1P63A 2M2TA 1M16A 3VUOA 1TWMA 2GAFD 4NXXA 4WBZA 5HRKA 4LO2C 3I29B 4EKXB 4JKXB 5IIKA 1EPWA 8ICTA 4LO1A 2Z48A 4F5NA 3B0XA 1BFBA 1HWNB 31BIA 4MF8A 3O4BA 1ZQIA 2KH2A 1XSNA 2Y9GA 3AH1A 3IM7A 9ICFA 1SZ6B 4KLMA 4DOCA 1FMMS 3VT1A 1ZQRA 2FO1A 3AQLA 3IIRA 3V7LA 1QQKA 1ZQAA 4I4QA 5CP2A 5J2KA 4MFAA 5DDYA 4FH5A 1IRPA 1Q04A 1F31A 2GO2A 8ICYA 4JLXA 1ZQQA 2FGFA 1S0EA 1DIWA 1HWPB 1J0SA 4K98A 4JKQA 3CRIA 4K9AA 4I0YA 3OJVA 1JT4A 4S3NA 4UB5A 4GP3A 5HHHA 8ICMA
chains in the Genus database with same CATH topology
3FJBA 4I4PA 3NJ5A 3N7JA 1AF9A 1AVXB 4LO7B 1II4A 2Y9FA 2VU9A 4I2SA 5D61A 3TC2A 3Q7WA 2D44A 4J2XA 3WA1A 3LTQA 4JLZA 1BLAA 4JP0A 1NUNA 4K99A 4KEKA 4XKIA 4QC4A 3CA6A 1BFGA 4I6IA 2IHOA 1ILR1 1DZDA 4FO1A 3BB2A 2KI4A 3ZXGA 3MPPG 1FWVA 1Q1UA 4HR6C 4X39A 4LEVA 4AN7B 2E4MC 1BA7A 9ILBA 2BFHA 3BA4A 5F8WA 5BXTA 4Q91A 4GP0A 1TIEA 1A8DA 5BXRA 4I4OA 3CQAA 4D8HA 4OEEA 4LO0A 5DZUA 2LIQA 1TOOA 1V6VA 3PG0A 1IRAX 4OUJA 4L4IA 4X37A 1HCEA 5D62A 2IWTB 3N0KA 2FDBM 7I1BA 4II0A 4O69A 4IY9A 1M2TB 3O4AA 2NP0A 2VSAA 1PZZA 4OAGA 4I96A 3AZVA 4TLPA 1DQOA 3VSFA 4ISRA 4KBBA 5GAQA 5BXSA 3V0AA 3NKUA 3H6QA 3FJHA 3C9ZA 3WO2A 1DZCA 2D43A 3E8LC 1AFCA 1V6XA 3I2AA 3AKIA 2BEAA 3ZXDA 4OAFA 3CRGA 4P0LA 2EWRA 3QR5A 1IILA 3NBCA 5CFSA 3RSJA 3BA7A 2P23A 2Z49A 4ENDA 2KKIA 1HCDA 4ZA3B 1Z4SA 4OEGA 1GPJA 1IT0A 2ZQOA 1PUUB 1XG6A 4F34A 5DUYA 1N4KA 5CFUA 4N7RA 2HZ9A 3V79C 4ZKTB 3BTAA 3O44A 4XFTA 2GA9D 1JT7A 1Q03A 3F1RA 4HA2A 2K43A 1BLDA 4GOVA 4QKRA 4D0TA 3N7KA 1RMLA 2VXRA 4HJJA 1KNMA 4J23B 4Q9GA 4YOLA 4J2YA 3RTJB 4DENA 2KLLA 3Q7YA 3UJ0A 5FZYA 3UJ4A 1BFFA 4IY8A 4ZOTA 4L4HA 4FGFA 4QD2B 3UDAA 2D7IA 4NXVA 4OAHA 5B3PA 2FFUA 3JRRA 3R4SA 5BP5A 3O5WB 1G9BA 3OJMA 4KC3A 3CAHA 1G9DA 3AZWA 2VUAA 2DS0A 1RZOB 1W3GA 1EYLA 2UUSA 4J2SA 4IQPA 2AXMA 6I1BA 4GAIA 5FZUA 5HPZA 3OBRA 3N7LA 2Y9XE 3LLPA 4WBCA 3CU1B 3PUBA 3S8KA 3P6JA 3RTIB 2R9KB 3V0BA 2F2FC 1ABRB 4XFSA 1ITBA 2NM1A 2I1BA 3B9UA 3FJIA 1HWMB 4K97A 2VLCA 2MIBA 3BX1C 4JRAA 1WBCA 1DLLA 1BASA 1ISZA 2D7RA 3HBWA 3WINC 2D24A 1WD4A 4D0ZA 1JLYA 4DCKC 3ER8C 3EF2A 1V6UA 1MD6A 1JTCA 2RQ9A 4I7IA 4G9MA 4LO8B 1HWOB 1IHKA 1YTOA 2NTDA 3FUQA 2VXTI 3POKA 4G6MA 3KMVA 5DVHA 3AKHA 2X2SA 4KB6A 1TP0A 1D0HA 1R8NA 4WQKA 3BAVA 1FV2A 3PMEA 2RSTA 5JMCA 4WQLA 3RMYA 1AVWB 4G1RA 2K4AB 4ISQA 3WMVA 2X2TA 3A22A 4EEEB 3MALA 3BAHA 3BAGA 4WOYA 2NZ9A 4O6AA 1FN0A 4QO3A 4USOA 3HMYA 4UY4A 3NBDA 1YF8B 2FCLA 1IOBA 2HW9A 4H75A 2QYIB 4AN6A 3FJEA 4KEJA 1FQ9A 2FFVA 3A07A 3O4DA 3F62B 5D63A 3OJ2A 4ZFUB 5F90A 2DRYA 1XYFA 5F8YA 3O49A 4GOYA 1OQLB 4LO1C 1PC8B 2AQZA 4H04A 2ZQNA 1AVAC 1DJSB 1K5UA 3FJJA 4QBVA 4Q9PA 3CA1A 4USPA 4I37A 2F2FA 1AVUA 3UD8A 3AKGA 4P0JA 5I1BA 3IM6A 2XOAA 3ER9B 3BRFA 4NXWA 2D23A 4FVVA 1I1BA 1BFCA 4OAIZ 1MC9A 4R6UB 3OWGA 2RG9B 3BAUA 2HWAA 3O4OA 4I3NA 4XJEA 4X38A 4QKSA 3MCRA 5BP5C 1FGAA 4J2KA 4OEFA 4I1EA 4HX0A 3CA5A 4MZHA 3H6SE 1YXWA 2F8XC 3SNVA 3CRHA 1FMZA 2M49A 3BAQA 3JUTA 3N7MA 1RY7A 2WRYA 3QYDA 4P0KA 4OWJA 1SR4A 4QD2C 3WO4A 3BRDA 3VT2A 5BQUC 1TFMB 4Z9WB 2B56A 4KEIA 4QALA 3K1XA 4NXUA 1JY0A 1XHBA 3NBEA 1IJTA 4GAFA 2HWMA 5BVPI 2L5XA 4G9NA 3ILAA 4OW4A 3OGGA 3ZX7A 1T9FA 1JT3A 4I4XA 3OGFA 4LO3C 1V6WA 2NVHA 2GZBA 3AH2A 3ERCC 3W9TA 2B4VA 4ZGRB 1L2HA 3D7WB 3WMUA 2Q9XA 2Y9WC 3OBTA 3ZC8A 3AH4A 3Q7XA 5E24E 3H6RA 1S0CA 1VCLA 4LO7C 4ZFWB 3FJDA 1YYNA 3A23A 1GGPB 3IM5A 3BAOA 4OWKA 1ISVA 1S0FA 3CA0A 2J3PA 5EC5A 21BIA 3S8JA 3V0BB 2MLLB 1QXMA 1S0DA 1WBAA 4F83A 4K9BA 4A7KA 3K7DA 3HALA 1W3AA 3AJ5A 3BADA 2VSEA 1T4QA 41BIA 2P39A 1CE7B 3A21A 4IZEA 1HKNA 2DREA 2LIEA 3ZC9A 3PHZA 4EB2B 1PWAA 4QBCA 1S0LA 3FGMA 4I4VA 2MC2A 1FWUA 2D22A 1WD3A 4WH5A 2Q3NB 4G6JA 3T8SA 2BEBA 4DEPA 1R8OA 5FZZA 1DQGA 3FJ8A 3FJCA 5BXPA 3VEQA 3I2XA 3P53A 4I1BA 3FJAA 3FUOA 1S0BA 3H6RB 1UPSA 1Z0HA 4JPZA 4IYBA 4LEWA 1ONKB 4O68A 4NXTA 3O4CA 4ZBVB 1EV2A 2NYYA 4K96A 1DFQA 4LEYA 2YUGA 3WO3A 1XZZA 2ESUA 4O67A 4I4YA 1K5VA 3BRGC 5CFTA 2B51A 3IAGC 1YBIA 5FNWA 1ISYA 4ZFYB 5BOWA 1G9AA 5DSSB 1QQLA 3UD9A 1S0GA 3AKFA 4OWLA 2KI6B 1JT5A 2NS2A 2AFGA 4LO3A 3VWCA 3HN1A 3O3QA 1FV3A 8I1BA 1ISXA 4I4RA 4ZLBB 1JLXA 1RG8A 1JQZA 3P6IA 2ERMA 4I8MA 4JAWA 4MKPA 5B2HA 1W3FA 4MZGB 5F8SA 4JQ0A 4EFQA 4A7ZA 4IONA 3FJKA 4CJMA 5EHAA 3NBNA 1I1EA 4I4UA 3BA5A 1G9CA 1TTUA 1NZKA 1AXMA 2D1ZA 3V0AB 5CHEA 1BARA 2E4MA 4KM5A 4LO0C 1E0OA 3AJ6A 1PUMB 4MZFB 3FJ9A 2D20A 2DRZA 2ET2A 1TWEA 4I4SA 1Z2VA 4H9WA 3R4UA 4A7YA 5FNXA 4XFUA 1CVSA 3VSZA 3VT0A 3CA3A 4EFPA 2AAIB 2K8RA 4EFRA 2WBCA 3WINA 1ISWA 1EVTA 2ZR1B 1G82A 2QN4A 3FFZA 5BQUA 4LO2A 4Z8SB 3CA4A 3FJFA 3HOMA 4K8VA 5B3QA 4X3AA 1SR4C 4IHZA 3UD7A 4LEZA 3HSMA 4P6AA 5JLVA 4IZXA 4PC4A 5G00A 5EG6C 3RMXA 1DFCA 1HIBA 1P63A 1M16A 3VUOA 1TWMA 2GAFD 4NXXA 4LO2C 3I29B 4EKXB 4JKXB 1EPWA 4LO1A 2Z48A 1BFBA 1HWNB 31BIA 3O4BA 2KH2A 2Y9GA 3AH1A 3IM7A 1SZ6B 1FMMS 3VT1A 2FO1A 3IIRA 1QQKA 4I4QA 1IRPA 1Q04A 1F31A 2GO2A 4JLXA 2FGFA 1S0EA 1DIWA 1HWPB 1J0SA 4K98A 4JKQA 3CRIA 4K9AA 4I0YA 3OJVA 1JT4A 4GP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJB A;  4I4P A;  3NJ5 A;  3N7J A;  1AF9 A;  1AVX B;  4LO7 B;  1II4 A;  2Y9F A;  2VU9 A;  4I2S A;  5D61 A;  3TC2 A;  3Q7W A;  2D44 A;  4J2X A;  3WA1 A;  3LTQ A;  1BLA A;  4JP0 A;  1NUN A;  4KEK A;  4XKI A;  4QC4 A;  3CA6 A;  1BFG A;  4I6I A;  2IHO A;  1ILR 1;  1DZD A;  3BB2 A;  2KI4 A;  3ZXG A;  3MPP G;  1FWV A;  1Q1U A;  4HR6 C;  4X39 A;  4AN7 B;  2E4M C;  1BA7 A;  9ILB A;  2BFH A;  3BA4 A;  5F8W A;  5BXT A;  4Q91 A;  4GP0 A;  1TIE A;  1A8D A;  5BXR A;  4I4O A;  3CQA A;  4D8H A;  4OEE A;  4LO0 A;  5DZU A;  2LIQ A;  1TOO A;  1V6V A;  3PG0 A;  1IRA X;  4OUJ A;  4L4I A;  4X37 A;  1HCE A;  5D62 A;  2IWT B;  3N0K A;  2FDB M;  7I1B A;  4II0 A;  4IY9 A;  1M2T B;  3O4A A;  2NP0 A;  2VSA A;  1PZZ A;  4I96 A;  3AZV A;  4TLP A;  1DQO A;  3VSF A;  4ISR A;  4KBB A;  5GAQ A;  5BXS A;  3V0A A;  3H6Q A;  3FJH A;  3C9Z A;  3WO2 A;  1DZC A;  2D43 A;  3E8L C;  1AFC A;  1V6X A;  3I2A A;  3AKI A;  2BEA A;  3ZXD A;  3CRG A;  4P0L A;  3QR5 A;  1IIL A;  3NBC A;  3RSJ A;  3BA7 A;  2P23 A;  2Z49 A;  4END A;  2KKI A;  1HCD A;  4ZA3 B;  1Z4S A;  4OEG A;  1IT0 A;  2ZQO A;  1PUU B;  1XG6 A;  4F34 A;  5DUY A;  1N4K A;  2HZ9 A;  3V79 C;  4ZKT B;  3BTA A;  3O44 A;  4XFT A;  1JT7 A;  1Q03 A;  3F1R A;  4HA2 A;  2K43 A;  1BLD A;  4GOV A;  4QKR A;  4D0T A;  3N7K A;  1RML A;  2VXR A;  4HJJ A;  1KNM A;  4J23 B;  4Q9G A;  4YOL A;  4J2Y A;  3RTJ B;  4DEN A;  2KLL A;  3Q7Y A;  3UJ0 A;  5FZY A;  3UJ4 A;  1BFF A;  4IY8 A;  4ZOT A;  4L4H A;  4FGF A;  4QD2 B;  3UDA A;  2D7I A;  2FFU A;  3JRR A;  3R4S A;  5BP5 A;  3O5W B;  1G9B A;  3OJM A;  4KC3 A;  3CAH A;  1G9D A;  3AZW A;  2VUA A;  2DS0 A;  1RZO B;  1W3G A;  1EYL A;  2UUS A;  4J2S A;  4IQP A;  2AXM A;  6I1B A;  4GAI A;  5FZU A;  5HPZ A;  3OBR A;  3N7L A;  2Y9X E;  3LLP A;  4WBC A;  3CU1 B;  3PUB A;  3S8K A;  3P6J A;  3RTI B;  2R9K B;  3V0B A;  2F2F C;  1ABR B;  4XFS A;  1ITB A;  2NM1 A;  2I1B A;  3B9U A;  3FJI A;  1HWM B;  2VLC A;  2MIB A;  3BX1 C;  4JRA A;  1WBC A;  1DLL A;  1BAS A;  1ISZ A;  2D7R A;  3HBW A;  3WIN C;  2D24 A;  1WD4 A;  4D0Z A;  1JLY A;  4DCK C;  3EF2 A;  1V6U A;  1MD6 A;  1JTC A;  2RQ9 A;  4I7I A;  4G9M A;  4LO8 B;  1HWO B;  1IHK A;  1YTO A;  2NTD A;  3FUQ A;  2VXT I;  3POK A;  4G6M A;  3KMV A;  5DVH A;  3AKH A;  2X2S A;  1TP0 A;  1D0H A;  1R8N A;  3BAV A;  1FV2 A;  3PME A;  2RST A;  5JMC A;  3RMY A;  1AVW B;  4G1R A;  2K4A B;  4ISQ A;  3WMV A;  2X2T A;  3A22 A;  4EEE B;  3MAL A;  3BAH A;  3BAG A;  2NZ9 A;  1FN0 A;  4QO3 A;  4USO A;  3HMY A;  3NBD A;  1YF8 B;  1IOB A;  2HW9 A;  2QYI B;  4AN6 A;  3FJE A;  4KEJ A;  1FQ9 A;  2FFV A;  3A07 A;  3O4D A;  3F62 B;  5D63 A;  3OJ2 A;  4ZFU B;  5F90 A;  2DRY A;  1XYF A;  5F8Y A;  3O49 A;  4GOY A;  1OQL B;  4LO1 C;  1PC8 B;  2AQZ A;  4H04 A;  2ZQN A;  1AVA C;  1DJS B;  1K5U A;  3FJJ A;  4QBV A;  4Q9P A;  3CA1 A;  4USP A;  4I37 A;  2F2F A;  1AVU A;  3UD8 A;  3AKG A;  4P0J A;  5I1B A;  3IM6 A;  2XOA A;  3BRF A;  2D23 A;  4FVV A;  1I1B A;  1BFC A;  1MC9 A;  4R6U B;  2RG9 B;  3BAU A;  2HWA A;  3O4O A;  4I3N A;  4X38 A;  4QKS A;  5BP5 C;  1FGA A;  4J2K A;  4OEF A;  4I1E A;  3CA5 A;  3H6S E;  1YXW A;  2F8X C;  3SNV A;  3CRH A;  1FMZ A;  2M49 A;  3BAQ A;  3JUT A;  3N7M A;  1RY7 A;  2WRY A;  3QYD A;  4P0K A;  4OWJ A;  1SR4 A;  4QD2 C;  3WO4 A;  3BRD A;  3VT2 A;  5BQU C;  1TFM B;  4Z9W B;  4KEI A;  4QAL A;  3K1X A;  1JY0 A;  1XHB A;  3NBE A;  1IJT A;  4GAF A;  2HWM A;  5BVP I;  2L5X A;  4G9N A;  3ILA A;  4OW4 A;  3OGG A;  3ZX7 A;  1T9F A;  1JT3 A;  4I4X A;  3OGF A;  4LO3 C;  1V6W A;  2NVH A;  2GZB A;  3AH2 A;  3W9T A;  4ZGR B;  1L2H A;  3D7W B;  3WMU A;  2Q9X A;  2Y9W C;  3OBT A;  3ZC8 A;  3AH4 A;  3Q7X A;  5E24 E;  3H6R A;  1S0C A;  1VCL A;  4LO7 C;  4ZFW B;  3FJD A;  1YYN A;  3A23 A;  1GGP B;  3IM5 A;  3BAO A;  4OWK A;  1ISV A;  1S0F A;  3CA0 A;  2J3P A;  5EC5 A;  21BI A;  3S8J A;  3V0B B;  2MLL B;  1QXM A;  1S0D A;  1WBA A;  4F83 A;  4A7K A;  3HAL A;  1W3A A;  3AJ5 A;  3BAD A;  2VSE A;  1T4Q A;  41BI A;  2P39 A;  1CE7 B;  3A21 A;  4IZE A;  1HKN A;  2DRE A;  2LIE A;  3ZC9 A;  3PHZ A;  4EB2 B;  1PWA A;  4QBC A;  1S0L A;  3FGM A;  4I4V A;  2MC2 A;  1FWU A;  2D22 A;  1WD3 A;  2Q3N B;  4G6J A;  3T8S A;  2BEB A;  4DEP A;  1R8O A;  5FZZ A;  1DQG A;  3FJ8 A;  3FJC A;  5BXP A;  3VEQ A;  3I2X A;  3P53 A;  4I1B A;  3FJA A;  3FUO A;  1S0B A;  3H6R B;  1UPS A;  1Z0H A;  4JPZ A;  4IYB A;  1ONK B;  3O4C A;  4ZBV B;  1EV2 A;  2NYY A;  1DFQ A;  2YUG A;  3WO3 A;  1XZZ A;  2ESU A;  4I4Y A;  1K5V A;  3BRG C;  3IAG C;  1YBI A;  5FNW A;  1ISY A;  4ZFY B;  5BOW A;  1G9A A;  5DSS B;  1QQL A;  3UD9 A;  1S0G A;  3AKF A;  4OWL A;  2KI6 B;  1JT5 A;  2AFG A;  4LO3 A;  3VWC A;  3HN1 A;  3O3Q A;  1FV3 A;  8I1B A;  1ISX A;  4I4R A;  4ZLB B;  1JLX A;  1RG8 A;  1JQZ A;  3P6I A;  2ERM A;  4I8M A;  4JAW A;  5B2H A;  1W3F A;  5F8S A;  4JQ0 A;  4EFQ A;  4A7Z A;  4ION A;  3FJK A;  4CJM A;  5EHA A;  3NBN A;  1I1E A;  4I4U A;  3BA5 A;  1G9C A;  1TTU A;  1NZK A;  1AXM A;  2D1Z A;  3V0A B;  1BAR A;  2E4M A;  4LO0 C;  1E0O A;  3AJ6 A;  1PUM B;  3FJ9 A;  2D20 A;  2DRZ A;  2ET2 A;  1TWE A;  4I4S A;  1Z2V A;  4H9W A;  3R4U A;  4A7Y A;  5FNX A;  4XFU A;  1CVS A;  3VSZ A;  3VT0 A;  3CA3 A;  4EFP A;  2AAI B;  2K8R A;  4EFR A;  2WBC A;  3WIN A;  1ISW A;  1EVT A;  2ZR1 B;  1G82 A;  2QN4 A;  3FFZ A;  5BQU A;  4LO2 A;  4Z8S B;  3CA4 A;  3FJF A;  3HOM A;  4X3A A;  1SR4 C;  4IHZ A;  3UD7 A;  3HSM A;  4P6A A;  5JLV A;  4IZX A;  4PC4 A;  5G00 A;  5EG6 C;  3RMX A;  1DFC A;  1HIB A;  1P63 A;  1M16 A;  3VUO A;  1TWM A;  4LO2 C;  3I29 B;  4EKX B;  4JKX B;  1EPW A;  4LO1 A;  2Z48 A;  1BFB A;  1HWN B;  31BI A;  3O4B A;  2KH2 A;  2Y9G A;  3AH1 A;  3IM7 A;  1SZ6 B;  1FMM S;  3VT1 A;  2FO1 A;  3IIR A;  1QQK A;  4I4Q A;  1IRP A;  1Q04 A;  1F31 A;  2GO2 A;  2FGF A;  1S0E A;  1DIW A;  1HWP B;  1J0S A;  4JKQ A;  3CRI A;  4I0Y A;  3OJV A;  1JT4 A;  4GP3 A; 
#chains in the Genus database with same CATH topology
 3FJB A;  4I4P A;  3NJ5 A;  3N7J A;  1AF9 A;  1AVX B;  4LO7 B;  1II4 A;  2Y9F A;  2VU9 A;  4I2S A;  5D61 A;  3TC2 A;  3Q7W A;  2D44 A;  4J2X A;  3WA1 A;  3LTQ A;  2PBE A;  1BLA A;  4JLZ A;  4JP0 A;  1ZQK A;  2PFP A;  9ICI A;  1NUN A;  4K99 A;  4KEK A;  4XKI A;  4QC4 A;  1VJ7 A;  3CA6 A;  5J0W A;  1BFG A;  4I6I A;  5J2A A;  4RPY A;  2IHO A;  1ILR 1;  1DZD A;  1R8C A;  2HHP A;  4FO1 A;  2DR9 A;  5DB9 A;  4KLO A;  4X4N A;  3BB2 A;  2KI4 A;  9ICU A;  3ZXG A;  3WFP A;  1VFG A;  3MPP G;  1FWV A;  5J2F A;  5J0Y A;  4QZH A;  1Q1U A;  4HR6 C;  1BPE A;  5DBC A;  3C2M A;  4X39 A;  2M2V A;  4LEV A;  3UPS A;  7ICO A;  4AN7 B;  2E4M C;  1BA7 A;  9ILB A;  3H3A A;  5J2I A;  2BFH A;  4WC3 A;  3BA4 A;  3ISC A;  4RQ3 A;  5F8W A;  5DB7 A;  2Q66 A;  8ICA A;  5BXT A;  7ICH A;  4Q91 A;  4GP0 A;  5DB8 A;  3WFO A;  1TIE A;  1A8D A;  4FHW A;  4AT8 B;  5BXR A;  8ICR A;  4I4O A;  3CQA A;  4D8H A;  4OEE A;  4I2I A;  3JPP A;  4O5E A;  4LO0 A;  5DZU A;  1ZQX A;  5EOZ A;  2LIQ A;  4QZ9 A;  4X4T A;  5HC9 A;  1TOO A;  1V6V A;  3PG0 A;  4M0A A;  5IIO A;  1IRA X;  4QZD A;  4OUJ A;  4TUS A;  4F5Q A;  4L4I A;  4X37 A;  1HCE A;  5D62 A;  5J0P A;  2IWT B;  3N0K A;  4RQ2 A;  2FDB M;  3ISD A;  7I1B A;  5IIN A;  4II0 A;  4R66 A;  4O69 A;  4IY9 A;  4Z6F A;  3JZ0 A;  1M2T B;  3O4A A;  2NP0 A;  2VSA A;  4IQU A;  4XA5 A;  1MQ2 A;  1PZZ A;  2BPG A;  4FHX A;  1ZQF A;  4OAG A;  3RJK A;  4I96 A;  3AZV A;  2BCS A;  4TLP A;  4O5C A;  1R8A A;  2ZH4 A;  1DQO A;  3VSF A;  5DKW A;  4ISR A;  4KBB A;  8ICZ A;  5GAQ A;  5BXS A;  3V0A A;  3NKU A;  4UB3 A;  9ICG A;  3H6Q A;  1JN3 A;  3H39 A;  5HRE A;  4F5O A;  3FJH A;  3C9Z A;  3WO2 A;  3HJ4 A;  4FHY A;  8ICI A;  1DZC A;  2D43 A;  4I2G A;  3RH4 A;  4M2Y A;  3E8L C;  8ICS A;  3RJE A;  4PHP A;  4WC6 A;  1AFC A;  1HUZ A;  4MFC A;  2ZH3 A;  4F5P A;  3V7K A;  1ZQM A;  5J0T A;  1ZQG A;  1V6X A;  3I2A A;  3AKI A;  4PGX A;  4KLT A;  2BEA A;  2BCQ A;  3ZXD A;  4OAF A;  4EP7 A;  1ZQC A;  3CRG A;  4P0L A;  3AQM A;  3JPS A;  2EWR A;  3QR5 A;  1IIL A;  3NBC A;  5III A;  4QZE A;  5CFS A;  4LZG A;  3RSJ A;  5D46 A;  3BA7 A;  2P23 A;  4PGQ A;  3OVA A;  2Z49 A;  4END A;  3C66 A;  2KKI A;  1HCD A;  4ZA3 B;  1Z4S A;  4OEG A;  7ICS A;  4NLZ A;  1GPJ A;  4P4O A;  8ICC A;  1IT0 A;  2BCU A;  2ZQO A;  9ICJ A;  1PUU B;  1XG6 A;  4F34 A;  4M5D A;  5DUY A;  1N4K A;  5CFU A;  4RT3 A;  3JPQ A;  1ZQD A;  4N7R A;  2HZ9 A;  2O5A A;  4KLI A;  3V79 C;  5HRL A;  4ZKT B;  3BTA A;  3O44 A;  5DBA A;  5J2G A;  4XFT A;  7ICK A;  2GA9 D;  1JT7 A;  1Q03 A;  4I29 A;  3F1R A;  1ZQU A;  4HA2 A;  2BBH A;  5BOL A;  4PHD A;  2DR7 A;  9ICR A;  2K43 A;  1BPD A;  1BLD A;  4GOV A;  5D49 A;  4QKR A;  4XQ8 A;  4UAY A;  4D0T A;  4MFF A;  3N7K A;  1RML A;  2VXR A;  4HJJ A;  3OVB A;  3UXO A;  2BCR A;  1KNM A;  3ISB A;  4J23 B;  4Q9G A;  4YOL A;  4J2Y A;  3RTJ B;  1KNY A;  4Z6C A;  3WFQ E;  4RQ7 A;  5HHI A;  7ICM A;  8ICU A;  4DEN A;  2KLL A;  1ZQV A;  3Q7Y A;  3UJ0 A;  5FZY A;  3UJ4 A;  4XRH A;  1BFF A;  3MDA A;  4IY8 A;  4K4G A;  4ZOT A;  1ZQW A;  5IIJ A;  3H38 A;  1JMS A;  4L4H A;  2DR8 A;  2DRA A;  7ICQ A;  4FGF A;  4QD2 B;  3UDA A;  1BPY A;  2FMS A;  2D7I A;  4NXV A;  4X4O A;  2ZH1 A;  2DVI A;  4EED A;  4YCX A;  4EBJ A;  4OAH A;  5B3P A;  3JPO A;  2PXI A;  4K4I A;  2FFU A;  3JRR A;  3R4S A;  5BP5 A;  3O5W B;  1G9B A;  3OJM A;  4KC3 A;  3C2K A;  3CAH A;  9ICK A;  1G9D A;  3AZW A;  9ICB A;  2VUA A;  3AQK A;  2DS0 A;  4KLS A;  4NY8 A;  1RZO B;  1W3G A;  4QZB A;  4I27 A;  1EYL A;  2UUS A;  4J2S A;  3LQC B;  4IQP A;  4AT9 B;  3HWT A;  4I2B A;  2AXM A;  4M9H A;  6I1B A;  4GAI A;  4IG8 A;  5FZU A;  5HPZ A;  3OBR A;  3N7L A;  2Y9X E;  4EV6 A;  3LLP A;  5HRH A;  2BCV A;  4WBC A;  3CU1 B;  3PUB A;  3S8K A;  3P6J A;  3RTI B;  2R9K B;  4RWP A;  3V0B A;  5IIM A;  2F2F C;  1ABR B;  4XFS A;  4WC2 A;  7ICL A;  7ICJ A;  1ITB A;  1V4A A;  4KLU A;  2NM1 A;  9ICH A;  2I1B A;  3B9U A;  3FJI A;  1HWM B;  4K97 A;  1UEV A;  2VLC A;  2MIB A;  3BX1 C;  4JRA A;  3B0Y A;  4FHP A;  4NXZ A;  4YN4 A;  4YMO A;  3K75 D;  1WBC A;  1BPX A;  1DLL A;  1BAS A;  1ISZ A;  2D7R A;  3HBW A;  3WIN C;  2D24 A;  1WD4 A;  4D0Z A;  1Q79 A;  1JLY A;  4PH5 A;  4RPZ A;  4RQ4 A;  4R63 A;  4M47 A;  8ICN A;  4DCK C;  3AQN A;  1JQR A;  4RPX A;  3ER8 C;  3EF2 A;  1V6U A;  1MD6 A;  1JTC A;  2RQ9 A;  4I7I A;  4Z6E A;  4G9M A;  4LO8 B;  4WC5 A;  3C5F A;  4JWN A;  1HWO B;  1IHK A;  1YTO A;  2NTD A;  3FUQ A;  2VXT I;  3POK A;  4G6M A;  5DDM A;  4NLK A;  3KMV A;  4RQ8 A;  5DVH A;  3AKH A;  1ZQP A;  2PFO A;  2X2S A;  2RFF A;  4KB6 A;  2ZHB A;  2HN1 A;  1TP0 A;  2NRK A;  1D0H A;  4WC1 A;  1R8N A;  4WQK A;  4ATB B;  4AT8 A;  3BAV A;  3NVO A;  4QZA A;  1R8B A;  5J29 A;  5J2B A;  4RQ1 A;  4RWQ A;  4TUP A;  3RJJ A;  4KLJ A;  1FV2 A;  3PME A;  1MIW A;  5CHG A;  2RST A;  4RWO A;  5JMC A;  4WQL A;  4I2D A;  3RMY A;  1AVW B;  4P4P A;  2BE3 A;  4G1R A;  1HUO A;  2K4A B;  8ICG A;  4ISQ A;  3WMV A;  2X2T A;  3A22 A;  4EEE B;  1OU5 A;  8ICX A;  9ICT A;  5CJ7 A;  8ICJ A;  3MAL A;  3BAH A;  3BAG A;  8ICO A;  4WOY A;  4YMM A;  3UQ0 A;  2NZ9 A;  1ZQS A;  2I9G A;  3AUO A;  4O6A A;  1FN0 A;  4QO3 A;  4USO A;  4RT2 A;  3HJ1 A;  3HMY A;  3PML A;  2M2U A;  4UY4 A;  3NBD A;  1YF8 B;  2FCL A;  1IOB A;  1ZQT A;  4PPX A;  9ICC A;  2HW9 A;  4H75 A;  8ICE A;  4UB4 A;  2QYI B;  1RZT A;  4QZI A;  4AN6 A;  4P4M A;  3FJE A;  5HRF A;  2VAN A;  4KEJ A;  1FQ9 A;  2FFV A;  3A07 A;  3O4D A;  1XSL A;  1ZQL A;  1ZQB A;  5F2V O;  4UB2 A;  3F62 B;  4PHA A;  5D63 A;  4QZ8 A;  3WFS C;  3OJ2 A;  4ZFU B;  9ICE A;  5F90 A;  2DRY A;  1XYF A;  5F8Y A;  3O49 A;  4GOY A;  1OQL B;  4LO1 C;  4O5K A;  1PC8 B;  2AQZ A;  4H04 A;  9ICP A;  2ZQN A;  7ICF A;  1AVA C;  1Q78 A;  1DJS B;  1K5U A;  4WC0 A;  3FJJ A;  4QBV A;  7ICN A;  4Q9P A;  3CA1 A;  4USP A;  4I37 A;  3HX0 A;  3NWI A;  2F2F A;  3RJF A;  1AVU A;  3UD8 A;  3AKG A;  5BOM A;  5J0S A;  4P0J A;  4X0A A;  2BPF A;  1KEJ A;  5I1B A;  4YMN A;  3IM6 A;  1FA0 A;  2XOA A;  4RQ6 A;  2P66 A;  4NKT A;  3ER9 B;  3BRF A;  4NXW A;  2D23 A;  4FVV A;  7ICU A;  1I1B A;  3RH5 A;  1BFC A;  4OAI Z;  1MC9 A;  4R6U B;  3OWG A;  3C5G A;  2RG9 B;  3BAU A;  2HWA A;  4F5R A;  3O4O A;  4I3N A;  4XJE A;  4RQ5 A;  4X4R A;  4R64 A;  1ZQO A;  4NLN A;  4X38 A;  3JYY A;  3RH6 A;  4QKS A;  4P2H A;  4UD4 A;  7ICI A;  3MCR A;  5BP5 C;  2ZH6 A;  3GDX A;  1FGA A;  4J2K A;  4OEF A;  3HW8 A;  2BBJ A;  4I1E A;  5J0X A;  3NYB A;  4HX0 A;  3CA5 A;  4MZH A;  2ZH7 A;  1XSP A;  2ZH2 A;  4KLD A;  3H6S E;  1YXW A;  4M9L A;  2F8X C;  1TFW A;  3SNV A;  3CRH A;  5J2J A;  1FMZ A;  4KLL A;  2M49 A;  4WBY A;  3BAQ A;  3JUT A;  4PHE A;  3V72 A;  3N7M A;  4E7X A;  8ICP A;  9ICW A;  1RY7 A;  2WRY A;  3QYD A;  2HN2 A;  7ICT A;  4P0K A;  4OWJ A;  1WOT A;  4GXI A;  1SR4 A;  4X4Q A;  3UQ2 A;  4QD2 C;  3WO4 A;  5CR0 A;  3BRD A;  3RJI A;  3VT2 A;  4KLQ A;  5BQU C;  1TFM B;  4UB1 A;  1MIY A;  4I2A A;  1TV9 A;  4Z9W B;  3C18 A;  2B56 A;  4EEB A;  4KEI A;  4QAL A;  3K1X A;  5IIL A;  4NXU A;  1JY0 A;  1ZJM A;  1XHB A;  4DO9 A;  3NBE A;  1IJT A;  4YD2 A;  3UXP A;  8ICH A;  9ICA A;  2ISO A;  4GAF A;  2HWM A;  5BVP I;  8ICL A;  4TUQ A;  2L5X A;  4DOA A;  4G9N A;  2DR5 A;  3ILA A;  3JPN A;  5DEC A;  4I2F A;  4OW4 A;  4E8F A;  4I2H A;  2W9M A;  3OGG A;  2PFN A;  5TZV A;  4KLF A;  5CWR A;  3ZX7 A;  1T9F A;  1JT3 A;  4I4X A;  4AT7 B;  3OGF A;  1TVA A;  4LO3 C;  4WCW A;  1V6W A;  2NVH A;  2GZB A;  3AH2 A;  4X4V A;  5J0U A;  3ERC C;  3W9T A;  4AT9 A;  2B4V A;  4ZGR B;  9ICS A;  9ICV A;  8ICB A;  1L2H A;  3D7W B;  3WMU A;  2Q9X A;  2Y9W C;  3OBT A;  3ZC8 A;  1PX5 A;  5D4B A;  2GWS A;  4Z6D A;  5J2D A;  3OGU A;  3AH4 A;  1ZQY A;  4O9M A;  4QZF A;  4NM2 A;  3Q7X A;  4LVS A;  5E24 E;  4X0B A;  4GXJ A;  3H6R A;  2ISP A;  3TFS A;  2IUB A;  1S0C A;  3MGI A;  1VCL A;  4LO7 C;  4ZFW B;  1NOM A;  2ID1 A;  3FJD A;  3UPQ A;  4X5V A;  1YYN A;  3A23 A;  9ICN A;  1GGP B;  2ZH9 A;  2ZH5 A;  3IM5 A;  4I2E A;  3BAO A;  4OWK A;  3HIY A;  1ISV A;  1S0F A;  3CA0 A;  4UBC A;  3RJH A;  2J3P A;  8ICK A;  5EC5 A;  1RPL A;  4ATB A;  21BI A;  3S8J A;  2O1P A;  3V0B B;  7ICG A;  4KLH A;  4I2J A;  3LK9 A;  3PMN A;  2MLL B;  1QXM A;  1S0D A;  1WBA A;  4F83 A;  3MGH A;  4A7K A;  3K7D A;  3HAL A;  1W3A A;  3AJ5 A;  4K9B A;  2M2W A;  1ZQJ A;  3BAD A;  4X4U A;  2VSE A;  1T4Q A;  4FO6 A;  4M9N A;  7ICP A;  41BI A;  2DRB A;  2P39 A;  1ZQN A;  5DBB A;  4I28 A;  1CE7 B;  9ICL A;  3A21 A;  4IZE A;  2ZHA A;  1HKN A;  2DRE A;  2LIE A;  3ZC9 A;  5J0R A;  2IHM A;  3L9D A;  1UEU A;  3PHZ A;  4EB2 B;  1PWA A;  5HR9 A;  5BPC A;  4QBC A;  1S0L A;  3FGM A;  4I4V A;  2MC2 A;  1FWU A;  2D22 A;  1WD3 A;  4WH5 A;  2Q3N B;  4G6J A;  3T8S A;  4X4P A;  2BEB A;  4DEP A;  9ICM A;  1R8O A;  1JAJ A;  3MDC A;  5J0O A;  5FZZ A;  1DQG A;  3FJ8 A;  4KLE A;  4M9G A;  3FJC A;  5BXP A;  3VEQ A;  4E80 A;  1ZQE A;  3I2X A;  3P53 A;  4I1B A;  3CK6 A;  3FJA A;  3FUO A;  4YD1 A;  1S0B A;  3H6R B;  1UPS A;  1Z0H A;  4JPZ A;  4IYB A;  4WC4 A;  5DB6 A;  8ICV A;  4LEW A;  1ONK B;  4O68 A;  4NXT A;  5CA7 A;  4I0U A;  3O4C A;  4ZBV B;  1EV2 A;  4FHV A;  4QZG A;  2NYY A;  4K96 A;  1DFQ A;  4LEY A;  3OUY B;  4WC7 A;  2YUG A;  1R89 A;  3WO3 A;  1KDH A;  1XZZ A;  2ESU A;  4O67 A;  3C2L A;  4MF2 A;  3PNC A;  8ICQ A;  4EGW A;  4I4Y A;  1K5V A;  3BRG C;  4EBK A;  5CFT A;  2B51 A;  3AU6 A;  3IAG C;  4UAW A;  1YBI A;  5FNW A;  1ISY A;  4ZFY B;  5BOW A;  3AU2 A;  1ZQH A;  1G9A A;  5DSS B;  1QQL A;  4AT7 A;  4R65 A;  9ICQ A;  3JPR A;  3JCF A;  5JTG A;  3UD9 A;  3WFR E;  1S0G A;  3AKF A;  4OWL A;  1MIV A;  2FMQ A;  2KI6 B;  4IQT A;  1JT5 A;  2NS2 A;  2AFG A;  4LO3 A;  3VWC A;  3HN1 A;  4XQ7 A;  3O3Q A;  3UXN A;  1FV3 A;  2BPC A;  8I1B A;  5J0Q A;  1ISX A;  4I4R A;  4ZLB B;  3OVS A;  1JLX A;  1RG8 A;  5HRD A;  1JQZ A;  5HRB A;  4XUS A;  3P6I A;  2ERM A;  4I8M A;  3OV7 A;  1ZJN A;  1BPZ A;  7ICE A;  4JAW A;  4MKP A;  8ICW A;  5B2H A;  1NO5 A;  1W3F A;  1UET A;  4DOB A;  4M04 A;  4MZG B;  8ICF A;  5F8S A;  4JWM A;  4JQ0 A;  4EFQ A;  5CB1 A;  4A7Z A;  4ION A;  3FJK A;  4CJM A;  2PFQ A;  5EHA A;  4LZD A;  1ZQZ A;  4KLG A;  3NBN A;  1I1E A;  4I4U A;  3BA5 A;  1G9C A;  1TTU A;  3V7J A;  1F5A A;  4UAZ A;  1NZK A;  1AXM A;  2D1Z A;  3V0A B;  5CHE A;  7ICR A;  5J2C A;  5HRI A;  1BAR A;  4UD5 A;  4RWN A;  2E4M A;  4KM5 A;  4LO0 C;  1TFY A;  1E0O A;  3AJ6 A;  1PUM B;  4MZF B;  4IQW A;  5DED A;  3FJ9 A;  4PGY A;  2D20 A;  4IQV A;  3OUY A;  2DRZ A;  5J2H A;  2ET2 A;  4M9J A;  7ICV A;  1TWE A;  4I4S A;  4QZC A;  3TFR A;  5J2E A;  4K4H A;  1Z2V A;  3JPT A;  4H9W A;  3R4U A;  4A7Y A;  5FNX A;  4NM1 A;  4XFU A;  4TUR A;  4GXK A;  2ZH8 A;  1CVS A;  4I2C A;  3VSZ A;  3VT0 A;  3CA3 A;  3MBY A;  4EFP A;  1YLQ A;  4RQ0 A;  2AAI B;  2FMP A;  2K8R A;  4EFR A;  2WBC A;  3WIN A;  1ISW A;  1EVT A;  2ZR1 B;  3H37 A;  1G82 A;  4NKU A;  2QN4 A;  3FFZ A;  5BQU A;  4LO2 A;  4Z8S B;  4LT6 A;  4X4S A;  9ICO A;  3CA4 A;  3FJF A;  3HOM A;  1BPB A;  4K8V A;  4X3A A;  1SR4 C;  5B3Q A;  9ICX A;  4IHZ A;  4FH3 A;  3UD7 A;  4LEZ A;  3HSM A;  3RJG A;  4P6A A;  5JLV A;  4IZX A;  4PC4 A;  5G00 A;  5EG6 C;  5HRG A;  4UBB A;  1MQ3 A;  3RMX A;  1DFC A;  1HIB A;  1P63 A;  2M2T A;  1M16 A;  3VUO A;  1TWM A;  2GAF D;  4NXX A;  4WBZ A;  5HRK A;  4LO2 C;  3I29 B;  4EKX B;  4JKX B;  5IIK A;  1EPW A;  8ICT A;  4LO1 A;  2Z48 A;  4F5N A;  3B0X A;  1BFB A;  1HWN B;  31BI A;  4MF8 A;  3O4B A;  1ZQI A;  2KH2 A;  1XSN A;  2Y9G A;  3AH1 A;  3IM7 A;  9ICF A;  1SZ6 B;  4KLM A;  4DOC A;  1FMM S;  3VT1 A;  1ZQR A;  2FO1 A;  3AQL A;  3IIR A;  3V7L A;  1QQK A;  1ZQA A;  4I4Q A;  5CP2 A;  5J2K A;  4MFA A;  5DDY A;  4FH5 A;  1IRP A;  1Q04 A;  1F31 A;  2GO2 A;  8ICY A;  4JLX A;  1ZQQ A;  2FGF A;  1S0E A;  1DIW A;  1HWP B;  1J0S A;  4K98 A;  4JKQ A;  3CRI A;  4K9A A;  4I0Y A;  3OJV A;  1JT4 A;  4S3N A;  4UB5 A;  4GP3 A;  5HHH A;  8ICM A; 
#chains in the Genus database with same CATH homology
 3FJB A;  4I4P A;  3NJ5 A;  3N7J A;  1AF9 A;  1AVX B;  4LO7 B;  1II4 A;  2Y9F A;  2VU9 A;  4I2S A;  5D61 A;  3TC2 A;  3Q7W A;  2D44 A;  4J2X A;  3WA1 A;  3LTQ A;  4JLZ A;  1BLA A;  4JP0 A;  1NUN A;  4K99 A;  4KEK A;  4XKI A;  4QC4 A;  3CA6 A;  1BFG A;  4I6I A;  2IHO A;  1ILR 1;  1DZD A;  4FO1 A;  3BB2 A;  2KI4 A;  3ZXG A;  3MPP G;  1FWV A;  1Q1U A;  4HR6 C;  4X39 A;  4LEV A;  4AN7 B;  2E4M C;  1BA7 A;  9ILB A;  2BFH A;  3BA4 A;  5F8W A;  5BXT A;  4Q91 A;  4GP0 A;  1TIE A;  1A8D A;  5BXR A;  4I4O A;  3CQA A;  4D8H A;  4OEE A;  4LO0 A;  5DZU A;  2LIQ A;  1TOO A;  1V6V A;  3PG0 A;  1IRA X;  4OUJ A;  4L4I A;  4X37 A;  1HCE A;  5D62 A;  2IWT B;  3N0K A;  2FDB M;  7I1B A;  4II0 A;  4O69 A;  4IY9 A;  1M2T B;  3O4A A;  2NP0 A;  2VSA A;  1PZZ A;  4OAG A;  4I96 A;  3AZV A;  4TLP A;  1DQO A;  3VSF A;  4ISR A;  4KBB A;  5GAQ A;  5BXS A;  3V0A A;  3NKU A;  3H6Q A;  3FJH A;  3C9Z A;  3WO2 A;  1DZC A;  2D43 A;  3E8L C;  1AFC A;  1V6X A;  3I2A A;  3AKI A;  2BEA A;  3ZXD A;  4OAF A;  3CRG A;  4P0L A;  2EWR A;  3QR5 A;  1IIL A;  3NBC A;  5CFS A;  3RSJ A;  3BA7 A;  2P23 A;  2Z49 A;  4END A;  2KKI A;  1HCD A;  4ZA3 B;  1Z4S A;  4OEG A;  1GPJ A;  1IT0 A;  2ZQO A;  1PUU B;  1XG6 A;  4F34 A;  5DUY A;  1N4K A;  5CFU A;  4N7R A;  2HZ9 A;  3V79 C;  4ZKT B;  3BTA A;  3O44 A;  4XFT A;  2GA9 D;  1JT7 A;  1Q03 A;  3F1R A;  4HA2 A;  2K43 A;  1BLD A;  4GOV A;  4QKR A;  4D0T A;  3N7K A;  1RML A;  2VXR A;  4HJJ A;  1KNM A;  4J23 B;  4Q9G A;  4YOL A;  4J2Y A;  3RTJ B;  4DEN A;  2KLL A;  3Q7Y A;  3UJ0 A;  5FZY A;  3UJ4 A;  1BFF A;  4IY8 A;  4ZOT A;  4L4H A;  4FGF A;  4QD2 B;  3UDA A;  2D7I A;  4NXV A;  4OAH A;  5B3P A;  2FFU A;  3JRR A;  3R4S A;  5BP5 A;  3O5W B;  1G9B A;  3OJM A;  4KC3 A;  3CAH A;  1G9D A;  3AZW A;  2VUA A;  2DS0 A;  1RZO B;  1W3G A;  1EYL A;  2UUS A;  4J2S A;  4IQP A;  2AXM A;  6I1B A;  4GAI A;  5FZU A;  5HPZ A;  3OBR A;  3N7L A;  2Y9X E;  3LLP A;  4WBC A;  3CU1 B;  3PUB A;  3S8K A;  3P6J A;  3RTI B;  2R9K B;  3V0B A;  2F2F C;  1ABR B;  4XFS A;  1ITB A;  2NM1 A;  2I1B A;  3B9U A;  3FJI A;  1HWM B;  4K97 A;  2VLC A;  2MIB A;  3BX1 C;  4JRA A;  1WBC A;  1DLL A;  1BAS A;  1ISZ A;  2D7R A;  3HBW A;  3WIN C;  2D24 A;  1WD4 A;  4D0Z A;  1JLY A;  4DCK C;  3ER8 C;  3EF2 A;  1V6U A;  1MD6 A;  1JTC A;  2RQ9 A;  4I7I A;  4G9M A;  4LO8 B;  1HWO B;  1IHK A;  1YTO A;  2NTD A;  3FUQ A;  2VXT I;  3POK A;  4G6M A;  3KMV A;  5DVH A;  3AKH A;  2X2S A;  4KB6 A;  1TP0 A;  1D0H A;  1R8N A;  4WQK A;  3BAV A;  1FV2 A;  3PME A;  2RST A;  5JMC A;  4WQL A;  3RMY A;  1AVW B;  4G1R A;  2K4A B;  4ISQ A;  3WMV A;  2X2T A;  3A22 A;  4EEE B;  3MAL A;  3BAH A;  3BAG A;  4WOY A;  2NZ9 A;  4O6A A;  1FN0 A;  4QO3 A;  4USO A;  3HMY A;  4UY4 A;  3NBD A;  1YF8 B;  2FCL A;  1IOB A;  2HW9 A;  4H75 A;  2QYI B;  4AN6 A;  3FJE A;  4KEJ A;  1FQ9 A;  2FFV A;  3A07 A;  3O4D A;  3F62 B;  5D63 A;  3OJ2 A;  4ZFU B;  5F90 A;  2DRY A;  1XYF A;  5F8Y A;  3O49 A;  4GOY A;  1OQL B;  4LO1 C;  1PC8 B;  2AQZ A;  4H04 A;  2ZQN A;  1AVA C;  1DJS B;  1K5U A;  3FJJ A;  4QBV A;  4Q9P A;  3CA1 A;  4USP A;  4I37 A;  2F2F A;  1AVU A;  3UD8 A;  3AKG A;  4P0J A;  5I1B A;  3IM6 A;  2XOA A;  3ER9 B;  3BRF A;  4NXW A;  2D23 A;  4FVV A;  1I1B A;  1BFC A;  4OAI Z;  1MC9 A;  4R6U B;  3OWG A;  2RG9 B;  3BAU A;  2HWA A;  3O4O A;  4I3N A;  4XJE A;  4X38 A;  4QKS A;  3MCR A;  5BP5 C;  1FGA A;  4J2K A;  4OEF A;  4I1E A;  4HX0 A;  3CA5 A;  4MZH A;  3H6S E;  1YXW A;  2F8X C;  3SNV A;  3CRH A;  1FMZ A;  2M49 A;  3BAQ A;  3JUT A;  3N7M A;  1RY7 A;  2WRY A;  3QYD A;  4P0K A;  4OWJ A;  1SR4 A;  4QD2 C;  3WO4 A;  3BRD A;  3VT2 A;  5BQU C;  1TFM B;  4Z9W B;  2B56 A;  4KEI A;  4QAL A;  3K1X A;  4NXU A;  1JY0 A;  1XHB A;  3NBE A;  1IJT A;  4GAF A;  2HWM A;  5BVP I;  2L5X A;  4G9N A;  3ILA A;  4OW4 A;  3OGG A;  3ZX7 A;  1T9F A;  1JT3 A;  4I4X A;  3OGF A;  4LO3 C;  1V6W A;  2NVH A;  2GZB A;  3AH2 A;  3ERC C;  3W9T A;  2B4V A;  4ZGR B;  1L2H A;  3D7W B;  3WMU A;  2Q9X A;  2Y9W C;  3OBT A;  3ZC8 A;  3AH4 A;  3Q7X A;  5E24 E;  3H6R A;  1S0C A;  1VCL A;  4LO7 C;  4ZFW B;  3FJD A;  1YYN A;  3A23 A;  1GGP B;  3IM5 A;  3BAO A;  4OWK A;  1ISV A;  1S0F A;  3CA0 A;  2J3P A;  5EC5 A;  21BI A;  3S8J A;  3V0B B;  2MLL B;  1QXM A;  1S0D A;  1WBA A;  4F83 A;  4K9B A;  4A7K A;  3K7D A;  3HAL A;  1W3A A;  3AJ5 A;  3BAD A;  2VSE A;  1T4Q A;  41BI A;  2P39 A;  1CE7 B;  3A21 A;  4IZE A;  1HKN A;  2DRE A;  2LIE A;  3ZC9 A;  3PHZ A;  4EB2 B;  1PWA A;  4QBC A;  1S0L A;  3FGM A;  4I4V A;  2MC2 A;  1FWU A;  2D22 A;  1WD3 A;  4WH5 A;  2Q3N B;  4G6J A;  3T8S A;  2BEB A;  4DEP A;  1R8O A;  5FZZ A;  1DQG A;  3FJ8 A;  3FJC A;  5BXP A;  3VEQ A;  3I2X A;  3P53 A;  4I1B A;  3FJA A;  3FUO A;  1S0B A;  3H6R B;  1UPS A;  1Z0H A;  4JPZ A;  4IYB A;  4LEW A;  1ONK B;  4O68 A;  4NXT A;  3O4C A;  4ZBV B;  1EV2 A;  2NYY A;  4K96 A;  1DFQ A;  4LEY A;  2YUG A;  3WO3 A;  1XZZ A;  2ESU A;  4O67 A;  4I4Y A;  1K5V A;  3BRG C;  5CFT A;  2B51 A;  3IAG C;  1YBI A;  5FNW A;  1ISY A;  4ZFY B;  5BOW A;  1G9A A;  5DSS B;  1QQL A;  3UD9 A;  1S0G A;  3AKF A;  4OWL A;  2KI6 B;  1JT5 A;  2NS2 A;  2AFG A;  4LO3 A;  3VWC A;  3HN1 A;  3O3Q A;  1FV3 A;  8I1B A;  1ISX A;  4I4R A;  4ZLB B;  1JLX A;  1RG8 A;  1JQZ A;  3P6I A;  2ERM A;  4I8M A;  4JAW A;  4MKP A;  5B2H A;  1W3F A;  4MZG B;  5F8S A;  4JQ0 A;  4EFQ A;  4A7Z A;  4ION A;  3FJK A;  4CJM A;  5EHA A;  3NBN A;  1I1E A;  4I4U A;  3BA5 A;  1G9C A;  1TTU A;  1NZK A;  1AXM A;  2D1Z A;  3V0A B;  5CHE A;  1BAR A;  2E4M A;  4KM5 A;  4LO0 C;  1E0O A;  3AJ6 A;  1PUM B;  4MZF B;  3FJ9 A;  2D20 A;  2DRZ A;  2ET2 A;  1TWE A;  4I4S A;  1Z2V A;  4H9W A;  3R4U A;  4A7Y A;  5FNX A;  4XFU A;  1CVS A;  3VSZ A;  3VT0 A;  3CA3 A;  4EFP A;  2AAI B;  2K8R A;  4EFR A;  2WBC A;  3WIN A;  1ISW A;  1EVT A;  2ZR1 B;  1G82 A;  2QN4 A;  3FFZ A;  5BQU A;  4LO2 A;  4Z8S B;  3CA4 A;  3FJF A;  3HOM A;  4K8V A;  5B3Q A;  4X3A A;  1SR4 C;  4IHZ A;  3UD7 A;  4LEZ A;  3HSM A;  4P6A A;  5JLV A;  4IZX A;  4PC4 A;  5G00 A;  5EG6 C;  3RMX A;  1DFC A;  1HIB A;  1P63 A;  1M16 A;  3VUO A;  1TWM A;  2GAF D;  4NXX A;  4LO2 C;  3I29 B;  4EKX B;  4JKX B;  1EPW A;  4LO1 A;  2Z48 A;  1BFB A;  1HWN B;  31BI A;  3O4B A;  2KH2 A;  2Y9G A;  3AH1 A;  3IM7 A;  1SZ6 B;  1FMM S;  3VT1 A;  2FO1 A;  3IIR A;  1QQK A;  4I4Q A;  1IRP A;  1Q04 A;  1F31 A;  2GO2 A;  4JLX A;  2FGF A;  1S0E A;  1DIW A;  1HWP B;  1J0S A;  4K98 A;  4JKQ A;  3CRI A;  4K9A A;  4I0Y A;  3OJV A;  1JT4 A;  4GP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...