5D62A

Moa-z-vad-fmk complex, inverted orientation
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d62A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d62A02
2Z49A 2AXMA 2KI6B 3FJJA 3CA1A 4ISQA 9ILBA 1IHKA 2KLLA 1BFBA 3PMEA 2ERMA 4KEKA 2BFHA 2HW9A 3BAQA 4KEJA 5FZUA 4D8HA 7I1BA 3EF2A 3HSMA 2D43A 3OGFA 1FGAA 1QQLA 3KMVA 2X2TA 5F8WA 3N7MA 1T9FA 2ESUA 2P23A 3WMVA 1IT0A 3NBNA 4ZLBB 1NZKA 3NBCA 4J23B 2BEAA 3JRRA 1S0DA 4I8MA 3VT0A 4A7ZA 3FJEA 1IILA 3UD9A 4GOVA 1XG6A 3O3QA 1ITBA 2ET2A 2ZQNA 3N7KA 3RTJB 1Z4SA 1S0EA 3V0BB 4Q9PA 2K8RA 3WMUA 5BP5A 4LO7B 3OJVA 1YXWA 3I2XA 1JT5A 4JKQA 4JKXB 3BRDA 1WBCA 1FQ9A 2HWAA 3H6RB 2R9KB 3ILAA 1EYLA 4JP0A 2E4MC 1TFMB 2BEBA 4XFUA 1XZZA 1AF9A 1DFCA 2D7RA 3A07A 1V6UA 3OBTA 5EG6C 3UDAA 3VUOA 2D23A 3H6RA 1ISZA 3OJMA 1BARA 1PUMB 1TOOA 3BB2A 3JUTA 1E0OA 3HN1A 2HWMA 3P53A 4LO2A 4QALA 4JPZA 3AKIA 1J0SA 1A8DA 2D1ZA 4IY9A 3ZC9A 3BAOA 1V6XA 4I1EA 1AVXB 1G9AA 3UJ0A 4OEFA 4QKSA 3RTIB 1SR4A 3O49A 1YF8B 3F62B 4DEPA 1TTUA 3D7WB 4PC4A 3FJFA 3AKHA 1ISVA 2DRZA 1DQGA 3SNVA 2LIEA 3P6JA 1IJTA 5FZZA 4GP0A 4GAFA 3VSFA 2FFVA 1YTOA 3OJ2A 5BP5C 4FGFA 1DZDA 1ONKB 1RG8A 41BIA 3V79C 4HJJA 3AH2A 3FJHA 4G1RA 3WINA 3BRGC 3HBWA 4LO7C 4EFPA 1IRPA 1G9BA 4LO0A 3NJ5A 3VT2A 3WO3A 4KC3A 3O44A 3FJAA 2NM1A 3BRFA 5G00A 5D61A 2K43A 5BXPA 1V6WA 4LO2C 4ZFWB 4EB2B 3VEQA 4FVVA 1HCEA 3NBDA 4HA2A 3VWCA 2VLCA 2F2FA 1AVUA 1DIWA 1JLXA 1SR4C 1YBIA 4WBCA 4I3NA 1JTCA 2ZQOA 2KKIA 3T8SA 31BIA 4ENDA 3FJ8A 2MC2A 1W3AA 3O4OA 4QBCA 4I1BA 5BXRA 1M2TB 3WO2A 4I7IA 1GGPB 2VSAA 4IQPA 4P6AA 4JRAA 4G9NA 1Q04A 1I1EA 3E8LC 3FJIA 1HIBA 2RG9B 3O4BA 2DS0A 3R4UA 1KNMA 4QD2B 5FZYA 2D24A 3BA5A 1XYFA 3RMXA 1BLDA 3AH1A 3AZWA 3CU1B 3WINC 1G9DA 3PG0A 2AQZA 2Q3NB 2HZ9A 4LO0C 1TWMA 21BIA 2AAIB 4Z9WB 3FJDA 4XKIA 1EV2A 4I4RA 3O4AA 3RMYA 2GZBA 1Q03A 3AKGA 2NZ9A 2K4AB 3MALA 1ILR1 1V6VA 4HR6C 4IZEA 3Q7YA 3A23A 2VU9A 4Q91A 1D0HA 2MIBA 3CA4A 1ISWA 4OW4A 1HKNA 2M49A 2F2FC 1FMZA 5F8SA 4EFQA 3O5WB 3ZXDA 2NTDA 1YYNA 4D0ZA 4I96A 2P39A 3BAVA 3N7LA 1TWEA 3WO4A 1RZOB 3BAGA 4LO3A 1G9CA 3BA7A 4EKXB 1P63A 2D20A 3V0AB 1PWAA 4I4VA 2X2SA 3BX1C 4P0KA 5DSSB 4CJMA 3I2AA 2F8XC 2WRYA 2Y9FA 3IAGC 2Y9WC 1JLYA 3FJKA 4YOLA 1W3FA 5F90A 4L4IA 3HMYA 5D62A 3C9ZA 1DZCA 3V0AA 2KI4A 2MLLB 1IRAX 1BFFA 2VUAA 3BA4A 3CRGA 3FJBA 3ZXGA 4QD2C 4J2KA 2Z48A 5F8YA 4USOA 4XFTA 4JAWA 1EVTA 5HPZA 1CE7B 1MD6A 3PHZA 4Q9GA 3FGMA 3VT1A 1AVWB 5DVHA 4L4HA 2VSEA 3P6IA 2RSTA 3CRIA 4OUJA 3MPPG 2D22A 4ZFUB 4ZGRB 2FO1A 3O4DA 1ABRB 3FFZA 2Y9GA 3F1RA 3H6SE 3N7JA 3QR5A 4F83A 4I4YA 4GOYA 4P0JA 4X3AA 3LTQA 2UUSA 1FV2A 5BOWA 4LO3C 1Q1UA 4H9WA 2NP0A 4I4UA 4OWLA 5BXTA 4GAIA 3CA0A 1UPSA 3BTAA 3RSJA 4KEIA 2VXRA 1RMLA 4EFRA 1S0GA 4X37A 6I1BA 4DCKC 3FJ9A 1BFGA 1G82A 1JT3A 5FNWA 1AXMA 4JQ0A 2DRYA 1M16A 5JMCA 4DENA 4QKRA 3AKFA 3CA3A 3HALA 4H04A 1HWOB 4P0LA 3CA6A 2FFUA 4GP3A 1JY0A 3BAUA 4ZOTA 4I4PA 3VSZA 3AJ5A 8I1BA 3W9TA 4A7YA 5EC5A 4OEEA 5GAQA 1SZ6B 1BASA 1S0LA 4OWKA 3K1XA 4I2SA 1DFQA 3IIRA 1K5UA 2XOAA 3LLPA 3IM5A 1K5VA 3Q7XA 1ISXA 5DZUA 4ZKTB 4ZFYB 1PUUB 2L5XA 1RY7A 1TIEA 3CRHA 2RQ9A 1AVAC 1PC8B 3Q7WA 1JT4A 2QYIB 4I4QA 1VCLA 4I4XA 4Z8SB 5BQUA 3O4CA 1JT7A 3FUOA 3QYDA 1S0FA 1DLLA 1FWUA 1I1BA 3AH4A 3OGGA 1CVSA 1HWPB 1S0CA 4LO1A 1FMMS 4USPA 3WA1A 4QBVA 2FGFA 4ZBVB 3CQAA 3CAHA 1MC9A 1DJSB 2LIQA 2ZR1B 3V0BA 5E24E 4IHZA 1R8NA 4ISRA 3HOMA 1R8OA 4IYBA 1HWNB 4D0TA 1HCDA 1FN0A 2D44A 4IY8A 1WBAA 4IZXA 3I29B 2QN4A 3ZC8A 3CA5A 2WBCA 1FV3A 2DREA 1QQKA 4IONA 4J2SA 5I1BA 3UJ4A 4KBBA 3UD8A 4G6JA 4I4SA 4OEGA 4LO8B 1BA7A 4QC4A 4I0YA 2I1BA 4G6MA 1AFCA 4J2YA 2Y9XE 4TLPA 1FWVA 3FUQA 3S8JA 4R6UB 4EEEB 3PUBA 1JQZA 4F34A 1II4A 4ZA3B 3A21A 2IWTB 4J2XA 1NUNA 3FJCA 1IOBA 2KH2A 1OQLB 3IM7A 4X39A 1PZZA 3NBEA 3R4SA 4I37A 1WD3A 3B9UA 5BQUC 1EPWA 5BXSA 2J3PA 1BFCA 5EHAA 2VXTI 4A7KA 4G9MA 1DQOA 2YUGA 5B2HA 1TP0A 1W3GA 3BAHA 2GO2A 4LO1C 1T4QA 3AJ6A 3ZX7A 1S0BA 3A22A 3BADA 5DUYA 3H6QA 2D7IA 5FNXA 3S8KA 4I6IA 4AN7B 1HWMB 5BVPI 1ISYA 2NYYA 4OWJA 1BLAA 4XFSA 1Z0HA 5JLVA 2IHOA 1L2HA 3UD7A 3AZVA 1WD4A 4X38A 4I4OA 2AFGA 2NVHA 4QO3A 3OBRA 3POKA 2E4MA 1Z2VA 5D63A 2Q9XA 1QXMA 1F31A 2FDBM 1N4KA 1XHBA 3IM6A 4II0A 3TC2A 3N0KA 4AN6A
chains in the Genus database with same CATH superfamily
4KM5A 3AU6A 3CA1A 4ISQA 1IHKA 4Z6FA 3BAQA 3JZ0A 3UPQA 4KEJA 7I1BA 2D43A 3OGFA 1ZQKA 1FGAA 3KMVA 2X2TA 3WMVA 1T9FA 3NBNA 1RZTA 1NZKA 3NBCA 4WC4A 4J23B 3TFSA 2ZH5A 1IILA 5HRBA 3O3QA 8ICKA 1S0EA 4WC1A 3V0BB 8ICRA 5D49A 2HN2A 4JWNA 3H6RB 1FQ9A 3ILAA 1ZQAA 2E4MC 4FO1A 4KLDA 4XFUA 4XUSA 5DBCA 4F5NA 3UDAA 2ZHAA 7ICVA 1J0SA 1AVXB 1G9AA 3CK6A 4RPYA 3ER8C 1TV9A 4NXVA 3FJFA 4JLZA 2BCVA 2LIEA 4WC3A 4K9AA 2FFVA 4MFAA 1DZDA 4RWPA 41BIA 4FH5A 4M9LA 1IRPA 1G9BA 4LO0A 1ZQPA 4KLEA 3VT2A 4X4NA 5J0XA 4F5PA 2NM1A 5D61A 4LEYA 3VEQA 4N7RA 1HCEA 3NBDA 4NM1A 4X4SA 1ZQCA 1YBIA 7ICRA 3O4OA 1HUOA 4QBCA 4MZGB 4X4VA 4LEWA 4XRHA 2VSAA 4IQPA 3FJIA 3NVOA 3R4UA 1KNMA 3HW8A 5FZYA 2D24A 3BA5A 4O5EA 3RMXA 1BLDA 4WBYA 4EV6A 8ICSA 1TVAA 3WINC 1ZQIA 4Z9WB 4E80A 2GZBA 4M9GA 2NZ9A 4NLZA 1ISWA 4OW4A 1HKNA 4F5RA 5F8SA 2NTDA 4I96A 2PXIA 1TWEA 4M47A 2D20A 4JLXA 2X2SA 4P0KA 4K8VA 2WRYA 4I0UA 2B51A 1RPLA 5J0PA 5F90A 5HRDA 3HMYA 5D62A 8ICIA 2MLLB 5J2IA 4YN4A 4KLJA 4USOA 2DR5A 1XSPA 4JAWA 4Q9GA 2PFNA 4L4HA 3P6IA 5J0SA 4ZGRB 2FO1A 1ABRB 3FFZA 5HRFA 3RH5A 3NKUA 4FO6A 3H6SE 3N7JA 3QR5A 4P4OA 4RT2A 4F83A 4P0JA 4GOYA 2UUSA 1FV2A 3RJFA 4MZFB 1ZJMA 4GXJA 4I4UA 9ICLA 5BXTA 4HX0A 1R8BA 5IIJA 4EFRA 4X37A 6I1BA 4DOAA 5J2KA 1BFGA 1JT3A 5FNWA 1AXMA 2DRYA 1M16A 5JMCA 4QKRA 2GAFD 4GP3A 1JY0A 4I4PA 7ICJA 8I1BA 3W9TA 4DOBA 3RJKA 7ICOA 5EC5A 4OEEA 5GAQA 4RQ1A 3IIRA 2XOAA 3Q7XA 2L5XA 1RY7A 1TIEA 4MKPA 1ZQSA 5HRGA 4I4QA 1I1BA 3OGGA 1S0CA 4QBVA 4WH5A 1ZQTA 4ZBVB 1V4AA 1ZQZA 1MC9A 3V0BA 5J2CA 4O5KA 3RJJA 4QZCA 4ISRA 3HOMA 1R8OA 4D0TA 1HWNB 4QZ8A 3I29B 3ZC8A 4K99A 4IONA 4KLUA 5J0UA 4G6JA 9ICAA 1BA7A 4QC4A 2NS2A 3AQNA 5F2VO 3PUBA 5B3PA 5CA7A 3RJEA 1NUNA 1OQLB 5EOZA 1PZZA 3NBEA 3R4SA 3OUYB 1EPWA 2FMQA 4A7KA 1DQOA 1BPDA 2B56A 1VJ7A 5B2HA 4P2HA 2GO2A 1ZJNA 3ISCA 1L2HA 3UD7A 5HRIA 4IQUA 1WD4A 4X38A 4I4OA 2AFGA 4LZGA 4QO3A 3POKA 2Q9XA 1F31A 4RT3A 4WC6A 8ICVA 2W9MA 1ZQFA 2P66A 5IIKA 4AN6A 2Z49A 3B0YA 3FJJA 1TFYA 2ERMA 4I2DA 4X0BA 3K7DA 3OVBA 5DB7A 2BEAA 4I8MA 4A7ZA 3FJEA 4XA5A 4I27A 1XG6A 1ITBA 4KLFA 2ZQNA 3N7KA 3JPOA 2K8RA 5BP5A 5DB8A 2ZH1A 3I2XA 4KLQA 1JT5A 4JKQA 3AQMA 2R9KB 1MIYA 1EYLA 4JP0A 1TFMB 2VANA 4EBKA 2BEBA 2NRKA 4PGQA 1XZZA 1AF9A 2PFOA 1V6UA 4PGXA 2D23A 2I9GA 3OJMA 1TOOA 3L9DA 9ICJA 3BB2A 3JUTA 3JPNA 4I2JA 3P53A 1KDHA 5J2HA 4LO2A 4YD2A 3AKIA 3JPSA 1A8DA 4IY9A 4I1EA 3UJ0A 4UB1A 8ICEA 2B4VA 1SR4A 3O49A 5HHHA 4AT7B 4DEPA 3D7WB 4I29A 4OAGA 1DQGA 4X0AA 9ICPA 2ZH6A 4GAFA 3WFPA 1ZQQA 4QZFA 4TUQA 1RG8A 3NYBA 4HJJA 3FJHA 1HUZA 5IIIA 3BRGC 4EFPA 8ICUA 4RWNA 4M04A 2ZH4A 3NJ5A 9ICFA 3RH6A 2K43A 1ZQGA 4EB2B 5DB6A 4KLMA 4ATBA 2VLCA 2F2FA 4WBCA 4I3NA 1JTCA 2ZQOA 3T8SA 31BIA 2MC2A 4K98A 5BXRA 1M2TB 3WO2A 4I7IA 3MBYA 4JRAA 4G9NA 8ICPA 5BOMA 8ICNA 3AH1A 3AZWA 3UXNA 2Q3NB 1BPBA 4Z6CA 5CFTA 4LO0C 2AAIB 4I2FA 3O4AA 3RMYA 7ICHA 3AKGA 3MALA 1ILR1 1JQRA 1V6VA 3OWGA 4IZEA 3Q7YA 3A23A 2VU9A 4Q91A 5HRLA 2M49A 1FMZA 2BE3A 3ZXDA 7ICMA 1YYNA 2P39A 3BAVA 1MQ2A 3JCFA 3BA7A 4RQ5A 3V0AB 4I4VA 4RQ4A 2O5AA 3ISBA 3ERCC 4CJMA 2Y9FA 4XQ7A 8ICFA 3FJKA 4L4IA 2KI4A 1IRAX 3OGUA 3FJBA 4QD2C 4J2KA 4XFTA 1ZQYA 1AVWB 4UBBA 2O1PA 3CRIA 4OUJA 4ZFUB 2ZH8A 3HWTA 3O4DA 1BPYA 2Y9GA 5DKWA 4NXXA 4I4YA 3C66A 9ICWA 5BOWA 4FHVA 8ICOA 1Q1UA 4TUPA 3HIYA 4NXWA 4YMMA 3CA0A 3RSJA 4P4PA 3WFQE 4I28A 2EWRA 4NKUA 3AKFA 4P0LA 4IQWA 3C2MA 4ZOTA 4PHPA 3C5FA 8ICJA 3AJ5A 3JPQA 1SZ6B 1BASA 4KLGA 1K5UA 3UPSA 1ZQWA 4PHAA 1ISXA 5DZUA 4ZKTB 3N0KA 3CRHA 1PC8B 5J0TA 3JPTA 1VCLA 4I4XA 4Z8SB 3NWIA 3O4CA 1JT7A 3QYDA 1ZQUA 1DLLA 1KEJA 1CVSA 4K4IA 3ISDA 2FGFA 7ICPA 3RJGA 5J0QA 1DJSB 9ICGA 3MGHA 3H39A 4S3NA 2DVIA 4IY8A 1WBAA 4IQTA 4X4RA 3CA5A 2WBCA 1YLQA 1QQKA 4WQKA 9ICHA 5I1BA 3UJ4A 3UD8A 2I1BA 1AFCA 4RWQA 2Y9XE 1FWVA 3FUQA 4R6UB 4EEEB 1II4A 4ZA3B 3WFRE 2IWTB 4J2XA 7ICLA 4MF8A 4AT9A 1IOBA 2KH2A 4IG8A 4I37A 1ZQDA 1WD3A 4AT7A 5BXSA 2GWSA 2J3PA 1BFCA 5EHAA 1TP0A 7ICIA 4R64A 2D7IA 5FNXA 1ZQEA 3S8KA 4PH5A 4P4MA 5B3QA 5JLVA 2IHOA 4X4OA 4OAHA 1MQ3A 2BPGA 9ICOA 4WQLA 1Z2VA 3MDCA 4K4GA 1TFWA 4II0A 4XJEA 3TC2A 2AXMA 2KI6B 4I2GA 8ICQA 2KLLA 1BFBA 3PMEA 4KEKA 2HW9A 5FZUA 4D8HA 3HSMA 4QZEA 1QQLA 2ESUA 2P23A 1IT0A 4ZLBB 5J29A 2ISPA 4TUSA 4KLHA 2IHMA 3JRRA 1S0DA 3VT0A 4X5VA 5DBBA 5J2JA 3RJHA 1Z4SA 1ZQVA 3WMUA 5HHIA 3OJVA 1YXWA 4GXKA 5DDMA 8ICYA 9ICBA 4JKXB 3BRDA 9ICVA 4O68A 9ICNA 5TZVA 1DFCA 3A07A 3H6RA 1ISZA 1VFGA 1BARA 1PUMB 1ZQNA 3HN1A 2HWMA 4RWOA 3BAOA 1V6XA 3MCRA 4QKSA 3H38A 4I2AA 3AKHA 2DRZA 3SNVA 3P6JA 1XSNA 5FZZA 4GP0A 5CHEA 3AU2A 5BP5C 7ICNA 4JWMA 4LT6A 3V79C 4FH3A 3AH2A 3H3AA 3RH4A 4LO7C 5D4BA 5DEDA 4UB5A 4H75A 2BBHA 2BPCA 4KC3A 3AQLA 3BRFA 5G00A 1OU5A 5BXPA 1V6WA 4LO2C 3OVSA 4ZFWB 5J2EA 5HRHA 4LVSA 3VWCA 4WC5A 1AVUA 1JLXA 4UB2A 1SR4C 2RFFA 4PHDA 3FJ8A 1NOMA 1W3AA 3LK9A 1GGPB 4P6AA 1JMSA 2GA9D 4WC0A 4YMNA 4O67A 9ICMA 4WC7A 4FHPA 1HIBA 8ICTA 2RG9B 4Z6EA 3O4BA 4RQ8A 2DS0A 4QD2B 2ZHBA 1BPXA 4I2IA 1R8CA 4UY4A 5CHGA 2PFQA 4EEBA 3PG0A 2HZ9A 21BIA 4XKIA 4PGYA 2M2UA 4E7XA 7ICQA 1Q03A 3PMNA 4PPXA 4FHXA 9ICIA 4R63A 3K75D 2PBEA 2MIBA 3CA4A 5J2AA 2F2FC 4EFQA 3O5WB 4KB6A 2DRAA 4D0ZA 4UD5A 8ICZA 3H37A 3WO4A 1RZOB 1PX5A 4LO3A 5IILA 4O5CA 1P63A 4QZHA 1PWAA 3BX1C 5DSSB 3I2AA 1JLYA 4KLLA 1W3FA 9ICRA 3C9ZA 5D46A 3BA4A 3CRGA 4F5OA 4EBJA 3ZXGA 4YCXA 2Z48A 1ZQHA 3VT1A 3HX0A 4M5DA 4E8FA 5DB9A 2RSTA 1ZQBA 4NLKA 7ICFA 4NXZA 3F1RA 5CP2A 2ZH3A 4NM2A 4LEVA 4MZHA 4X3AA 3UXPA 4H9WA 2NP0A 4X4PA 1UPSA 3BTAA 4QZBA 1RMLA 3V7JA 1S0GA 1XSLA 3AUOA 3C2KA 3FJ9A 4NKTA 3UQ0A 3UQ2A 1ZQJA 4JQ0A 3CA3A 1HWOB 4LZDA 5HRKA 4MFCA 4A7YA 2M2WA 4OWKA 3K1XA 4I2SA 3B0XA 1R8AA 3IM5A 3RJIA 4EEDA 1PUUB 4KLTA 4RQ6A 2RQ9A 2BCQA 1AVAC 3PNCA 1JT4A 1JN3A 8ICMA 5BQUA 4YD1A 2IUBA 4QZIA 4K96A 4WBZA 4LO1A 4USPA 3CAHA 4K97A 5E24E 8ICWA 4MF2A 4IYBA 1HCDA 2D44A 7ICEA 4O69A 4X4TA 4I2CA 4NXUA 5DDYA 4OEGA 8ICLA 4OAFA 4I0YA 5BOLA 2ZH9A 2BCSA 8ICBA 4RQ3A 3FJCA 4RQ0A 5DECA 2DR9A 2Q66A 2ZH2A 5HR9A 3B9UA 4WCWA 4G9MA 4NXTA 2YUGA 5J0RA 2ISOA 1ZQXA 1W3GA 4FHWA 3BAHA 1T4QA 1GPJA 5CFSA 3ZX7A 1S0BA 4UBCA 3A22A 3OUYA 8ICAA 3H6QA 9ICTA 9ICUA 4I6IA 4AN7B 7ICUA 1ISYA 2NYYA 4OWJA 1BLAA 4YMOA 5J0YA 3AZVA 3OBRA 2E4MA 4RQ7A 5HREA 1N4KA 1XHBA 3IM6A 3HJ4A 9ILBA 4EP7A 2BFHA 7ICSA 4NY8A 3EF2A 5F8WA 3N7MA 8ICHA 4KLIA 4UB4A 3UD9A 1ZQLA 4GOVA 4TURA 2ET2A 3RTJB 4Q9PA 1FA0A 4IQVA 4LO7B 1WBCA 2HWAA 3GDXA 4M9JA 2M2TA 2D7RA 4X4QA 3OBTA 5EG6C 3VUOA 4O6AA 5CR0A 4DOCA 1E0OA 5J2BA 4QALA 4JPZA 4AT8B 2D1ZA 3ZC9A 5HC9A 4OEFA 3RTIB 1F5AA 1YF8B 3F62B 1TTUA 4I2EA 4PC4A 1ISVA 4PHEA 1IJTA 1MIWA 3VSFA 5CB1A 1YTOA 4QZDA 3OJ2A 4FGFA 9ICCA 1ONKB 1ZQRA 1ZQOA 5CWRA 1BPEA 2FMSA 5IIMA 1WOTA 4G1RA 3WINA 3HBWA 3WO3A 3O44A 4ATBB 3OVAA 3FJAA 3C2LA 8ICGA 4K4HA 3OV7A 4WC2A 2HN1A 4FVVA 4HA2A 1DIWA 4RPXA 2PFPA 4XQ8A 2KKIA 4ENDA 4K9BA 4I1BA 4LEZA 1Q04A 1I1EA 3E8LC 4UB3A 1XYFA 4UAWA 3CU1B 9ICKA 4KLSA 4Z6DA 4R65A 1G9DA 1NO5A 4M0AA 2AQZA 1TWMA 4UD4A 2ID1A 1ZQMA 1Q78A 3FJDA 1EV2A 4I4RA 5BPCA 2K4AB 4M2YA 4MFFA 4HR6C 4I2BA 1D0HA 4FHYA 3LQCB 4RPZA 1KNYA 3N7LA 5J2GA 3BAGA 4EGWA 1G9CA 3JPRA 1UEVA 4EKXB 1BPZA 1R89A 7ICTA 3V7KA 2F8XC 3IAGC 4UAZA 2Y9WC 3C18A 4YOLA 3JPPA 1DZCA 3V0AA 1JAJA 1BFFA 2VUAA 3MDAA 8ICXA 5F8YA 1EVTA 5HPZA 1CE7B 1MD6A 3PHZA 7ICGA 3FGMA 5DVHA 2VSEA 4KLOA 5CJ7A 5J0WA 3MPPG 2D22A 2FCLA 3WFSC 9ICXA 5DBAA 3LTQA 4LO3C 4OWLA 4GAIA 4KEIA 2VXRA 4I2HA 4F5QA 8ICCA 4DCKC 1G82A 5J2FA 4X4UA 4QZGA 4DO9A 4DENA 3HALA 9ICQA 4H04A 2M2VA 3CA6A 2FFUA 3BAUA 5CFUA 2DRBA 3VSZA 4OAIZ 1S0LA 1DFQA 5IINA 3LLPA 4QZ9A 1K5VA 2ZH7A 4ZFYB 2BBJA 3Q7WA 2QYIB 2DR8A 3FUOA 4R66A 3UXOA 1S0FA 1FWUA 3AH4A 3V7LA 1HWPB 1FMMS 3WA1A 2BPFA 5J2DA 3CQAA 2LIQA 2ZR1B 1UETA 7ICKA 4IHZA 5JTGA 5J0OA 1R8NA 3WFOA 4QZAA 3V72A 1FN0A 4IZXA 3MGIA 2QN4A 3AQKA 1FV3A 2DREA 4J2SA 4KBBA 4I4SA 4LO8B 4AT9B 2BCRA 2FMPA 3JYYA 4G6MA 2HHPA 4J2YA 4TLPA 2BCUA 3S8JA 3TFRA 1JQZA 4F34A 3ER9B 3A21A 4AT8A 9ICEA 3IM7A 4X39A 4O9MA 3PMLA 3HJ1A 2DR7A 4GXIA 5BQUC 4WOYA 2VXTI 4RQ2A 1Q79A 4M9NA 4LO1C 3AJ6A 3BADA 9ICSA 5DUYA 4UAYA 1HWMB 5BVPI 4XFSA 1Z0HA 5IIOA 3C5GA 2NVHA 5D63A 1QXMA 4M9HA 2FDBM 4NLNA 1MIVA 1UEUA
chains in the Genus database with same CATH topology
4KM5A 2Z49A 2AXMA 2KI6B 3FJJA 3CA1A 4ISQA 9ILBA 1IHKA 2KLLA 1BFBA 3PMEA 2ERMA 4KEKA 2BFHA 2HW9A 3BAQA 4KEJA 5FZUA 4D8HA 7I1BA 3EF2A 3HSMA 2D43A 3OGFA 1FGAA 1QQLA 3KMVA 2X2TA 5F8WA 3N7MA 1T9FA 2ESUA 2P23A 3WMVA 1IT0A 3K7DA 3NBNA 4ZLBB 1NZKA 3NBCA 4J23B 2BEAA 3JRRA 1S0DA 4I8MA 3VT0A 4A7ZA 3FJEA 1IILA 3UD9A 4GOVA 1XG6A 3O3QA 1ITBA 2ET2A 2ZQNA 3N7KA 3RTJB 1Z4SA 1S0EA 3V0BB 4Q9PA 2K8RA 3WMUA 5BP5A 4LO7B 3OJVA 1YXWA 3I2XA 1JT5A 4JKQA 4JKXB 3BRDA 4O68A 1WBCA 1FQ9A 2HWAA 3H6RB 2R9KB 3ILAA 1EYLA 4JP0A 2E4MC 1TFMB 4FO1A 2BEBA 4XFUA 1XZZA 1AF9A 1DFCA 2D7RA 3A07A 1V6UA 3OBTA 5EG6C 3UDAA 3VUOA 2D23A 3H6RA 1ISZA 4O6AA 3OJMA 1BARA 1PUMB 1TOOA 3BB2A 3JUTA 1E0OA 3HN1A 2HWMA 3P53A 4LO2A 4QALA 4JPZA 3AKIA 1J0SA 1A8DA 2D1ZA 4IY9A 3ZC9A 3BAOA 1V6XA 4I1EA 1AVXB 1G9AA 3MCRA 3UJ0A 4OEFA 2B4VA 4QKSA 3ER8C 3RTIB 1SR4A 3O49A 1YF8B 3F62B 4NXVA 4DEPA 1TTUA 3D7WB 4PC4A 3FJFA 3AKHA 1ISVA 4JLZA 4OAGA 2DRZA 1DQGA 3SNVA 2LIEA 3P6JA 4K9AA 1IJTA 5FZZA 4GP0A 4GAFA 3VSFA 2FFVA 5CHEA 1YTOA 3OJ2A 5BP5C 4FGFA 1DZDA 1ONKB 1RG8A 41BIA 3V79C 4HJJA 3AH2A 3FJHA 4G1RA 3WINA 3BRGC 3HBWA 4LO7C 4EFPA 1IRPA 1G9BA 4LO0A 4H75A 3NJ5A 3VT2A 3WO3A 4KC3A 3O44A 3FJAA 2NM1A 3BRFA 5G00A 5D61A 2K43A 5BXPA 4LEYA 1V6WA 4LO2C 4ZFWB 4EB2B 3VEQA 4N7RA 4FVVA 1HCEA 3NBDA 4HA2A 3VWCA 2VLCA 2F2FA 1AVUA 1DIWA 1JLXA 1SR4C 1YBIA 4WBCA 4I3NA 1JTCA 2ZQOA 2KKIA 3T8SA 31BIA 4ENDA 3FJ8A 2MC2A 4K9BA 1W3AA 3O4OA 4QBCA 4MZGB 4I1BA 5BXRA 4LEWA 4K98A 1M2TB 3WO2A 4I7IA 1GGPB 2VSAA 4IQPA 4P6AA 2GA9D 4JRAA 4LEZA 4G9NA 4O67A 1Q04A 1I1EA 3E8LC 3FJIA 1HIBA 2RG9B 3O4BA 2DS0A 3R4UA 1KNMA 4QD2B 5FZYA 2D24A 4UY4A 3BA5A 1XYFA 3RMXA 1BLDA 3AH1A 3AZWA 3CU1B 3WINC 1G9DA 3PG0A 2AQZA 2Q3NB 2HZ9A 5CFTA 4LO0C 1TWMA 21BIA 2AAIB 4Z9WB 3FJDA 4XKIA 1EV2A 4I4RA 3O4AA 3RMYA 2GZBA 1Q03A 3AKGA 2NZ9A 2K4AB 3MALA 1ILR1 1V6VA 3OWGA 4HR6C 4IZEA 3Q7YA 3A23A 2VU9A 4Q91A 1D0HA 2MIBA 3CA4A 1ISWA 4OW4A 1HKNA 2M49A 2F2FC 1FMZA 5F8SA 4EFQA 3O5WB 3ZXDA 4KB6A 2NTDA 1YYNA 4D0ZA 4I96A 2P39A 3BAVA 3N7LA 1TWEA 3WO4A 1RZOB 3BAGA 4LO3A 1G9CA 3BA7A 4EKXB 1P63A 2D20A 3V0AB 1PWAA 4I4VA 4JLXA 2X2SA 3BX1C 4P0KA 3ERCC 5DSSB 4CJMA 3I2AA 2F8XC 4K8VA 2WRYA 2Y9FA 3IAGC 2Y9WC 1JLYA 2B51A 3FJKA 4YOLA 1W3FA 5F90A 4L4IA 3HMYA 5D62A 3C9ZA 1DZCA 3V0AA 2KI4A 2MLLB 1IRAX 1BFFA 2VUAA 3BA4A 3CRGA 3FJBA 3ZXGA 4QD2C 4J2KA 2Z48A 5F8YA 4USOA 4XFTA 4JAWA 1EVTA 5HPZA 1CE7B 1MD6A 3PHZA 4Q9GA 3FGMA 3VT1A 1AVWB 5DVHA 4L4HA 2VSEA 3P6IA 2RSTA 3CRIA 4OUJA 3MPPG 2D22A 4ZFUB 4ZGRB 2FO1A 3O4DA 1ABRB 3FFZA 2FCLA 2Y9GA 3F1RA 3NKUA 3H6SE 3N7JA 3QR5A 4F83A 4LEVA 4NXXA 4I4YA 4GOYA 4MZHA 4P0JA 4X3AA 3LTQA 2UUSA 1FV2A 5BOWA 4MZFB 4LO3C 1Q1UA 4H9WA 2NP0A 4I4UA 4OWLA 5BXTA 4GAIA 4NXWA 4HX0A 3CA0A 1UPSA 3BTAA 3RSJA 4KEIA 2VXRA 1RMLA 4EFRA 1S0GA 4X37A 6I1BA 4DCKC 3FJ9A 1BFGA 1G82A 1JT3A 2EWRA 5FNWA 1AXMA 4JQ0A 2DRYA 1M16A 5JMCA 4DENA 4QKRA 3AKFA 3CA3A 3HALA 4H04A 1HWOB 4P0LA 3CA6A 2GAFD 2FFUA 4GP3A 1JY0A 3BAUA 4ZOTA 5CFUA 4I4PA 3VSZA 3AJ5A 8I1BA 3W9TA 4A7YA 5EC5A 4OEEA 5GAQA 1SZ6B 1BASA 4OAIZ 1S0LA 4OWKA 3K1XA 4I2SA 1DFQA 3IIRA 1K5UA 2XOAA 3LLPA 3IM5A 1K5VA 3Q7XA 1ISXA 5DZUA 4ZKTB 4ZFYB 1PUUB 2L5XA 1RY7A 1TIEA 3CRHA 4MKPA 2RQ9A 1AVAC 1PC8B 3Q7WA 1JT4A 2QYIB 4I4QA 1VCLA 4I4XA 4Z8SB 5BQUA 3O4CA 1JT7A 3FUOA 3QYDA 1S0FA 4K96A 1DLLA 1FWUA 1I1BA 3AH4A 3OGGA 1CVSA 1HWPB 1S0CA 4LO1A 1FMMS 4USPA 3WA1A 4QBVA 4WH5A 2FGFA 4ZBVB 3CQAA 3CAHA 4K97A 1MC9A 1DJSB 2LIQA 2ZR1B 3V0BA 5E24E 4IHZA 1R8NA 4ISRA 3HOMA 1R8OA 4IYBA 1HWNB 4D0TA 1HCDA 1FN0A 2D44A 4IY8A 1WBAA 4IZXA 4O69A 3I29B 2QN4A 3ZC8A 4K99A 3CA5A 2WBCA 1FV3A 2DREA 1QQKA 4IONA 4J2SA 4WQKA 5I1BA 3UJ4A 4NXUA 4KBBA 3UD8A 4G6JA 4I4SA 4OEGA 4LO8B 4OAFA 1BA7A 4QC4A 4I0YA 2I1BA 4G6MA 1AFCA 2NS2A 4J2YA 2Y9XE 4TLPA 1FWVA 3FUQA 3S8JA 4R6UB 4EEEB 3PUBA 1JQZA 4F34A 5B3PA 1II4A 4ZA3B 3ER9B 3A21A 2IWTB 4J2XA 1NUNA 3FJCA 1IOBA 2KH2A 1OQLB 3IM7A 4X39A 1PZZA 3NBEA 3R4SA 4I37A 1WD3A 3B9UA 5BQUC 1EPWA 5BXSA 2J3PA 1BFCA 5EHAA 4WOYA 2VXTI 4A7KA 4G9MA 1DQOA 2YUGA 4NXTA 2B56A 5B2HA 1TP0A 1W3GA 3BAHA 2GO2A 4LO1C 1T4QA 3AJ6A 1GPJA 3ZX7A 5CFSA 1S0BA 3A22A 3BADA 5DUYA 3H6QA 2D7IA 5FNXA 3S8KA 4I6IA 4AN7B 1HWMB 5BVPI 1ISYA 2NYYA 4OWJA 1BLAA 4XFSA 5B3QA 1Z0HA 5JLVA 2IHOA 1L2HA 3UD7A 3AZVA 1WD4A 4X38A 4I4OA 2AFGA 2NVHA 4QO3A 3OBRA 3POKA 2E4MA 4OAHA 4WQLA 1Z2VA 5D63A 2Q9XA 1QXMA 1F31A 2FDBM 1N4KA 1XHBA 3IM6A 4II0A 4XJEA 3TC2A 3N0KA 4AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z49 A;  2AXM A;  2KI6 B;  3FJJ A;  3CA1 A;  4ISQ A;  9ILB A;  1IHK A;  2KLL A;  1BFB A;  3PME A;  2ERM A;  4KEK A;  2BFH A;  2HW9 A;  3BAQ A;  4KEJ A;  5FZU A;  4D8H A;  7I1B A;  3EF2 A;  3HSM A;  2D43 A;  3OGF A;  1FGA A;  1QQL A;  3KMV A;  2X2T A;  5F8W A;  3N7M A;  1T9F A;  2ESU A;  2P23 A;  3WMV A;  1IT0 A;  3NBN A;  4ZLB B;  1NZK A;  3NBC A;  4J23 B;  2BEA A;  3JRR A;  1S0D A;  4I8M A;  3VT0 A;  4A7Z A;  3FJE A;  1IIL A;  3UD9 A;  4GOV A;  1XG6 A;  3O3Q A;  1ITB A;  2ET2 A;  2ZQN A;  3N7K A;  3RTJ B;  1Z4S A;  1S0E A;  3V0B B;  4Q9P A;  2K8R A;  3WMU A;  5BP5 A;  4LO7 B;  3OJV A;  1YXW A;  3I2X A;  1JT5 A;  4JKQ A;  4JKX B;  3BRD A;  1WBC A;  1FQ9 A;  2HWA A;  3H6R B;  2R9K B;  3ILA A;  1EYL A;  4JP0 A;  2E4M C;  1TFM B;  2BEB A;  4XFU A;  1XZZ A;  1AF9 A;  1DFC A;  2D7R A;  3A07 A;  1V6U A;  3OBT A;  5EG6 C;  3UDA A;  3VUO A;  2D23 A;  3H6R A;  1ISZ A;  3OJM A;  1BAR A;  1PUM B;  1TOO A;  3BB2 A;  3JUT A;  1E0O A;  3HN1 A;  2HWM A;  3P53 A;  4LO2 A;  4QAL A;  4JPZ A;  3AKI A;  1J0S A;  1A8D A;  2D1Z A;  4IY9 A;  3ZC9 A;  3BAO A;  1V6X A;  4I1E A;  1AVX B;  1G9A A;  3UJ0 A;  4OEF A;  4QKS A;  3RTI B;  1SR4 A;  3O49 A;  1YF8 B;  3F62 B;  4DEP A;  1TTU A;  3D7W B;  4PC4 A;  3FJF A;  3AKH A;  1ISV A;  2DRZ A;  1DQG A;  3SNV A;  2LIE A;  3P6J A;  1IJT A;  5FZZ A;  4GP0 A;  4GAF A;  3VSF A;  2FFV A;  1YTO A;  3OJ2 A;  5BP5 C;  4FGF A;  1DZD A;  1ONK B;  1RG8 A;  41BI A;  3V79 C;  4HJJ A;  3AH2 A;  3FJH A;  4G1R A;  3WIN A;  3BRG C;  3HBW A;  4LO7 C;  4EFP A;  1IRP A;  1G9B A;  4LO0 A;  3NJ5 A;  3VT2 A;  3WO3 A;  4KC3 A;  3O44 A;  3FJA A;  2NM1 A;  3BRF A;  5G00 A;  5D61 A;  2K43 A;  5BXP A;  1V6W A;  4LO2 C;  4ZFW B;  4EB2 B;  3VEQ A;  4FVV A;  1HCE A;  3NBD A;  4HA2 A;  3VWC A;  2VLC A;  2F2F A;  1AVU A;  1DIW A;  1JLX A;  1SR4 C;  1YBI A;  4WBC A;  4I3N A;  1JTC A;  2ZQO A;  2KKI A;  3T8S A;  31BI A;  4END A;  3FJ8 A;  2MC2 A;  1W3A A;  3O4O A;  4QBC A;  4I1B A;  5BXR A;  1M2T B;  3WO2 A;  4I7I A;  1GGP B;  2VSA A;  4IQP A;  4P6A A;  4JRA A;  4G9N A;  1Q04 A;  1I1E A;  3E8L C;  3FJI A;  1HIB A;  2RG9 B;  3O4B A;  2DS0 A;  3R4U A;  1KNM A;  4QD2 B;  5FZY A;  2D24 A;  3BA5 A;  1XYF A;  3RMX A;  1BLD A;  3AH1 A;  3AZW A;  3CU1 B;  3WIN C;  1G9D A;  3PG0 A;  2AQZ A;  2Q3N B;  2HZ9 A;  4LO0 C;  1TWM A;  21BI A;  2AAI B;  4Z9W B;  3FJD A;  4XKI A;  1EV2 A;  4I4R A;  3O4A A;  3RMY A;  2GZB A;  1Q03 A;  3AKG A;  2NZ9 A;  2K4A B;  3MAL A;  1ILR 1;  1V6V A;  4HR6 C;  4IZE A;  3Q7Y A;  3A23 A;  2VU9 A;  4Q91 A;  1D0H A;  2MIB A;  3CA4 A;  1ISW A;  4OW4 A;  1HKN A;  2M49 A;  2F2F C;  1FMZ A;  5F8S A;  4EFQ A;  3O5W B;  3ZXD A;  2NTD A;  1YYN A;  4D0Z A;  4I96 A;  2P39 A;  3BAV A;  3N7L A;  1TWE A;  3WO4 A;  1RZO B;  3BAG A;  4LO3 A;  1G9C A;  3BA7 A;  4EKX B;  1P63 A;  2D20 A;  3V0A B;  1PWA A;  4I4V A;  2X2S A;  3BX1 C;  4P0K A;  5DSS B;  4CJM A;  3I2A A;  2F8X C;  2WRY A;  2Y9F A;  3IAG C;  2Y9W C;  1JLY A;  3FJK A;  4YOL A;  1W3F A;  5F90 A;  4L4I A;  3HMY A;  5D62 A;  3C9Z A;  1DZC A;  3V0A A;  2KI4 A;  2MLL B;  1IRA X;  1BFF A;  2VUA A;  3BA4 A;  3CRG A;  3FJB A;  3ZXG A;  4QD2 C;  4J2K A;  2Z48 A;  5F8Y A;  4USO A;  4XFT A;  4JAW A;  1EVT A;  5HPZ A;  1CE7 B;  1MD6 A;  3PHZ A;  4Q9G A;  3FGM A;  3VT1 A;  1AVW B;  5DVH A;  4L4H A;  2VSE A;  3P6I A;  2RST A;  3CRI A;  4OUJ A;  3MPP G;  2D22 A;  4ZFU B;  4ZGR B;  2FO1 A;  3O4D A;  1ABR B;  3FFZ A;  2Y9G A;  3F1R A;  3H6S E;  3N7J A;  3QR5 A;  4F83 A;  4I4Y A;  4GOY A;  4P0J A;  4X3A A;  3LTQ A;  2UUS A;  1FV2 A;  5BOW A;  4LO3 C;  1Q1U A;  4H9W A;  2NP0 A;  4I4U A;  4OWL A;  5BXT A;  4GAI A;  3CA0 A;  1UPS A;  3BTA A;  3RSJ A;  4KEI A;  2VXR A;  1RML A;  4EFR A;  1S0G A;  4X37 A;  6I1B A;  4DCK C;  3FJ9 A;  1BFG A;  1G82 A;  1JT3 A;  5FNW A;  1AXM A;  4JQ0 A;  2DRY A;  1M16 A;  5JMC A;  4DEN A;  4QKR A;  3AKF A;  3CA3 A;  3HAL A;  4H04 A;  1HWO B;  4P0L A;  3CA6 A;  2FFU A;  4GP3 A;  1JY0 A;  3BAU A;  4ZOT A;  4I4P A;  3VSZ A;  3AJ5 A;  8I1B A;  3W9T A;  4A7Y A;  5EC5 A;  4OEE A;  5GAQ A;  1SZ6 B;  1BAS A;  1S0L A;  4OWK A;  3K1X A;  4I2S A;  1DFQ A;  3IIR A;  1K5U A;  2XOA A;  3LLP A;  3IM5 A;  1K5V A;  3Q7X A;  1ISX A;  5DZU A;  4ZKT B;  4ZFY B;  1PUU B;  2L5X A;  1RY7 A;  1TIE A;  3CRH A;  2RQ9 A;  1AVA C;  1PC8 B;  3Q7W A;  1JT4 A;  2QYI B;  4I4Q A;  1VCL A;  4I4X A;  4Z8S B;  5BQU A;  3O4C A;  1JT7 A;  3FUO A;  3QYD A;  1S0F A;  1DLL A;  1FWU A;  1I1B A;  3AH4 A;  3OGG A;  1CVS A;  1HWP B;  1S0C A;  4LO1 A;  1FMM S;  4USP A;  3WA1 A;  4QBV A;  2FGF A;  4ZBV B;  3CQA A;  3CAH A;  1MC9 A;  1DJS B;  2LIQ A;  2ZR1 B;  3V0B A;  5E24 E;  4IHZ A;  1R8N A;  4ISR A;  3HOM A;  1R8O A;  4IYB A;  1HWN B;  4D0T A;  1HCD A;  1FN0 A;  2D44 A;  4IY8 A;  1WBA A;  4IZX A;  3I29 B;  2QN4 A;  3ZC8 A;  3CA5 A;  2WBC A;  1FV3 A;  2DRE A;  1QQK A;  4ION A;  4J2S A;  5I1B A;  3UJ4 A;  4KBB A;  3UD8 A;  4G6J A;  4I4S A;  4OEG A;  4LO8 B;  1BA7 A;  4QC4 A;  4I0Y A;  2I1B A;  4G6M A;  1AFC A;  4J2Y A;  2Y9X E;  4TLP A;  1FWV A;  3FUQ A;  3S8J A;  4R6U B;  4EEE B;  3PUB A;  1JQZ A;  4F34 A;  1II4 A;  4ZA3 B;  3A21 A;  2IWT B;  4J2X A;  1NUN A;  3FJC A;  1IOB A;  2KH2 A;  1OQL B;  3IM7 A;  4X39 A;  1PZZ A;  3NBE A;  3R4S A;  4I37 A;  1WD3 A;  3B9U A;  5BQU C;  1EPW A;  5BXS A;  2J3P A;  1BFC A;  5EHA A;  2VXT I;  4A7K A;  4G9M A;  1DQO A;  2YUG A;  5B2H A;  1TP0 A;  1W3G A;  3BAH A;  2GO2 A;  4LO1 C;  1T4Q A;  3AJ6 A;  3ZX7 A;  1S0B A;  3A22 A;  3BAD A;  5DUY A;  3H6Q A;  2D7I A;  5FNX A;  3S8K A;  4I6I A;  4AN7 B;  1HWM B;  5BVP I;  1ISY A;  2NYY A;  4OWJ A;  1BLA A;  4XFS A;  1Z0H A;  5JLV A;  2IHO A;  1L2H A;  3UD7 A;  3AZV A;  1WD4 A;  4X38 A;  4I4O A;  2AFG A;  2NVH A;  4QO3 A;  3OBR A;  3POK A;  2E4M A;  1Z2V A;  5D63 A;  2Q9X A;  1QXM A;  1F31 A;  2FDB M;  1N4K A;  1XHB A;  3IM6 A;  4II0 A;  3TC2 A;  3N0K A;  4AN6 A; 
#chains in the Genus database with same CATH topology
 4KM5 A;  3AU6 A;  3CA1 A;  4ISQ A;  1IHK A;  4Z6F A;  3BAQ A;  3JZ0 A;  3UPQ A;  4KEJ A;  7I1B A;  2D43 A;  3OGF A;  1ZQK A;  1FGA A;  3KMV A;  2X2T A;  3WMV A;  1T9F A;  3NBN A;  1RZT A;  1NZK A;  3NBC A;  4WC4 A;  4J23 B;  3TFS A;  2ZH5 A;  1IIL A;  5HRB A;  3O3Q A;  8ICK A;  1S0E A;  4WC1 A;  3V0B B;  8ICR A;  5D49 A;  2HN2 A;  4JWN A;  3H6R B;  1FQ9 A;  3ILA A;  1ZQA A;  2E4M C;  4FO1 A;  4KLD A;  4XFU A;  4XUS A;  5DBC A;  4F5N A;  3UDA A;  2ZHA A;  7ICV A;  1J0S A;  1AVX B;  1G9A A;  3CK6 A;  4RPY A;  3ER8 C;  1TV9 A;  4NXV A;  3FJF A;  4JLZ A;  2BCV A;  2LIE A;  4WC3 A;  4K9A A;  2FFV A;  4MFA A;  1DZD A;  4RWP A;  41BI A;  4FH5 A;  4M9L A;  1IRP A;  1G9B A;  4LO0 A;  1ZQP A;  4KLE A;  3VT2 A;  4X4N A;  5J0X A;  4F5P A;  2NM1 A;  5D61 A;  4LEY A;  3VEQ A;  4N7R A;  1HCE A;  3NBD A;  4NM1 A;  4X4S A;  1ZQC A;  1YBI A;  7ICR A;  3O4O A;  1HUO A;  4QBC A;  4MZG B;  4X4V A;  4LEW A;  4XRH A;  2VSA A;  4IQP A;  3FJI A;  3NVO A;  3R4U A;  1KNM A;  3HW8 A;  5FZY A;  2D24 A;  3BA5 A;  4O5E A;  3RMX A;  1BLD A;  4WBY A;  4EV6 A;  8ICS A;  1TVA A;  3WIN C;  1ZQI A;  4Z9W B;  4E80 A;  2GZB A;  4M9G A;  2NZ9 A;  4NLZ A;  1ISW A;  4OW4 A;  1HKN A;  4F5R A;  5F8S A;  2NTD A;  4I96 A;  2PXI A;  1TWE A;  4M47 A;  2D20 A;  4JLX A;  2X2S A;  4P0K A;  4K8V A;  2WRY A;  4I0U A;  2B51 A;  1RPL A;  5J0P A;  5F90 A;  5HRD A;  3HMY A;  5D62 A;  8ICI A;  2MLL B;  5J2I A;  4YN4 A;  4KLJ A;  4USO A;  2DR5 A;  1XSP A;  4JAW A;  4Q9G A;  2PFN A;  4L4H A;  3P6I A;  5J0S A;  4ZGR B;  2FO1 A;  1ABR B;  3FFZ A;  5HRF A;  3RH5 A;  3NKU A;  4FO6 A;  3H6S E;  3N7J A;  3QR5 A;  4P4O A;  4RT2 A;  4F83 A;  4P0J A;  4GOY A;  2UUS A;  1FV2 A;  3RJF A;  4MZF B;  1ZJM A;  4GXJ A;  4I4U A;  9ICL A;  5BXT A;  4HX0 A;  1R8B A;  5IIJ A;  4EFR A;  4X37 A;  6I1B A;  4DOA A;  5J2K A;  1BFG A;  1JT3 A;  5FNW A;  1AXM A;  2DRY A;  1M16 A;  5JMC A;  4QKR A;  2GAF D;  4GP3 A;  1JY0 A;  4I4P A;  7ICJ A;  8I1B A;  3W9T A;  4DOB A;  3RJK A;  7ICO A;  5EC5 A;  4OEE A;  5GAQ A;  4RQ1 A;  3IIR A;  2XOA A;  3Q7X A;  2L5X A;  1RY7 A;  1TIE A;  4MKP A;  1ZQS A;  5HRG A;  4I4Q A;  1I1B A;  3OGG A;  1S0C A;  4QBV A;  4WH5 A;  1ZQT A;  4ZBV B;  1V4A A;  1ZQZ A;  1MC9 A;  3V0B A;  5J2C A;  4O5K A;  3RJJ A;  4QZC A;  4ISR A;  3HOM A;  1R8O A;  4D0T A;  1HWN B;  4QZ8 A;  3I29 B;  3ZC8 A;  4K99 A;  4ION A;  4KLU A;  5J0U A;  4G6J A;  9ICA A;  1BA7 A;  4QC4 A;  2NS2 A;  3AQN A;  5F2V O;  3PUB A;  5B3P A;  5CA7 A;  3RJE A;  1NUN A;  1OQL B;  5EOZ A;  1PZZ A;  3NBE A;  3R4S A;  3OUY B;  1EPW A;  2FMQ A;  4A7K A;  1DQO A;  1BPD A;  2B56 A;  1VJ7 A;  5B2H A;  4P2H A;  2GO2 A;  1ZJN A;  3ISC A;  1L2H A;  3UD7 A;  5HRI A;  4IQU A;  1WD4 A;  4X38 A;  4I4O A;  2AFG A;  4LZG A;  4QO3 A;  3POK A;  2Q9X A;  1F31 A;  4RT3 A;  4WC6 A;  8ICV A;  2W9M A;  1ZQF A;  2P66 A;  5IIK A;  4AN6 A;  2Z49 A;  3B0Y A;  3FJJ A;  1TFY A;  2ERM A;  4I2D A;  4X0B A;  3K7D A;  3OVB A;  5DB7 A;  2BEA A;  4I8M A;  4A7Z A;  3FJE A;  4XA5 A;  4I27 A;  1XG6 A;  1ITB A;  4KLF A;  2ZQN A;  3N7K A;  3JPO A;  2K8R A;  5BP5 A;  5DB8 A;  2ZH1 A;  3I2X A;  4KLQ A;  1JT5 A;  4JKQ A;  3AQM A;  2R9K B;  1MIY A;  1EYL A;  4JP0 A;  1TFM B;  2VAN A;  4EBK A;  2BEB A;  2NRK A;  4PGQ A;  1XZZ A;  1AF9 A;  2PFO A;  1V6U A;  4PGX A;  2D23 A;  2I9G A;  3OJM A;  1TOO A;  3L9D A;  9ICJ A;  3BB2 A;  3JUT A;  3JPN A;  4I2J A;  3P53 A;  1KDH A;  5J2H A;  4LO2 A;  4YD2 A;  3AKI A;  3JPS A;  1A8D A;  4IY9 A;  4I1E A;  3UJ0 A;  4UB1 A;  8ICE A;  2B4V A;  1SR4 A;  3O49 A;  5HHH A;  4AT7 B;  4DEP A;  3D7W B;  4I29 A;  4OAG A;  1DQG A;  4X0A A;  9ICP A;  2ZH6 A;  4GAF A;  3WFP A;  1ZQQ A;  4QZF A;  4TUQ A;  1RG8 A;  3NYB A;  4HJJ A;  3FJH A;  1HUZ A;  5III A;  3BRG C;  4EFP A;  8ICU A;  4RWN A;  4M04 A;  2ZH4 A;  3NJ5 A;  9ICF A;  3RH6 A;  2K43 A;  1ZQG A;  4EB2 B;  5DB6 A;  4KLM A;  4ATB A;  2VLC A;  2F2F A;  4WBC A;  4I3N A;  1JTC A;  2ZQO A;  3T8S A;  31BI A;  2MC2 A;  4K98 A;  5BXR A;  1M2T B;  3WO2 A;  4I7I A;  3MBY A;  4JRA A;  4G9N A;  8ICP A;  5BOM A;  8ICN A;  3AH1 A;  3AZW A;  3UXN A;  2Q3N B;  1BPB A;  4Z6C A;  5CFT A;  4LO0 C;  2AAI B;  4I2F A;  3O4A A;  3RMY A;  7ICH A;  3AKG A;  3MAL A;  1ILR 1;  1JQR A;  1V6V A;  3OWG A;  4IZE A;  3Q7Y A;  3A23 A;  2VU9 A;  4Q91 A;  5HRL A;  2M49 A;  1FMZ A;  2BE3 A;  3ZXD A;  7ICM A;  1YYN A;  2P39 A;  3BAV A;  1MQ2 A;  3JCF A;  3BA7 A;  4RQ5 A;  3V0A B;  4I4V A;  4RQ4 A;  2O5A A;  3ISB A;  3ERC C;  4CJM A;  2Y9F A;  4XQ7 A;  8ICF A;  3FJK A;  4L4I A;  2KI4 A;  1IRA X;  3OGU A;  3FJB A;  4QD2 C;  4J2K A;  4XFT A;  1ZQY A;  1AVW B;  4UBB A;  2O1P A;  3CRI A;  4OUJ A;  4ZFU B;  2ZH8 A;  3HWT A;  3O4D A;  1BPY A;  2Y9G A;  5DKW A;  4NXX A;  4I4Y A;  3C66 A;  9ICW A;  5BOW A;  4FHV A;  8ICO A;  1Q1U A;  4TUP A;  3HIY A;  4NXW A;  4YMM A;  3CA0 A;  3RSJ A;  4P4P A;  3WFQ E;  4I28 A;  2EWR A;  4NKU A;  3AKF A;  4P0L A;  4IQW A;  3C2M A;  4ZOT A;  4PHP A;  3C5F A;  8ICJ A;  3AJ5 A;  3JPQ A;  1SZ6 B;  1BAS A;  4KLG A;  1K5U A;  3UPS A;  1ZQW A;  4PHA A;  1ISX A;  5DZU A;  4ZKT B;  3N0K A;  3CRH A;  1PC8 B;  5J0T A;  3JPT A;  1VCL A;  4I4X A;  4Z8S B;  3NWI A;  3O4C A;  1JT7 A;  3QYD A;  1ZQU A;  1DLL A;  1KEJ A;  1CVS A;  4K4I A;  3ISD A;  2FGF A;  7ICP A;  3RJG A;  5J0Q A;  1DJS B;  9ICG A;  3MGH A;  3H39 A;  4S3N A;  2DVI A;  4IY8 A;  1WBA A;  4IQT A;  4X4R A;  3CA5 A;  2WBC A;  1YLQ A;  1QQK A;  4WQK A;  9ICH A;  5I1B A;  3UJ4 A;  3UD8 A;  2I1B A;  1AFC A;  4RWQ A;  2Y9X E;  1FWV A;  3FUQ A;  4R6U B;  4EEE B;  1II4 A;  4ZA3 B;  3WFR E;  2IWT B;  4J2X A;  7ICL A;  4MF8 A;  4AT9 A;  1IOB A;  2KH2 A;  4IG8 A;  4I37 A;  1ZQD A;  1WD3 A;  4AT7 A;  5BXS A;  2GWS A;  2J3P A;  1BFC A;  5EHA A;  1TP0 A;  7ICI A;  4R64 A;  2D7I A;  5FNX A;  1ZQE A;  3S8K A;  4PH5 A;  4P4M A;  5B3Q A;  5JLV A;  2IHO A;  4X4O A;  4OAH A;  1MQ3 A;  2BPG A;  9ICO A;  4WQL A;  1Z2V A;  3MDC A;  4K4G A;  1TFW A;  4II0 A;  4XJE A;  3TC2 A;  2AXM A;  2KI6 B;  4I2G A;  8ICQ A;  2KLL A;  1BFB A;  3PME A;  4KEK A;  2HW9 A;  5FZU A;  4D8H A;  3HSM A;  4QZE A;  1QQL A;  2ESU A;  2P23 A;  1IT0 A;  4ZLB B;  5J29 A;  2ISP A;  4TUS A;  4KLH A;  2IHM A;  3JRR A;  1S0D A;  3VT0 A;  4X5V A;  5DBB A;  5J2J A;  3RJH A;  1Z4S A;  1ZQV A;  3WMU A;  5HHI A;  3OJV A;  1YXW A;  4GXK A;  5DDM A;  8ICY A;  9ICB A;  4JKX B;  3BRD A;  9ICV A;  4O68 A;  9ICN A;  5TZV A;  1DFC A;  3A07 A;  3H6R A;  1ISZ A;  1VFG A;  1BAR A;  1PUM B;  1ZQN A;  3HN1 A;  2HWM A;  4RWO A;  3BAO A;  1V6X A;  3MCR A;  4QKS A;  3H38 A;  4I2A A;  3AKH A;  2DRZ A;  3SNV A;  3P6J A;  1XSN A;  5FZZ A;  4GP0 A;  5CHE A;  3AU2 A;  5BP5 C;  7ICN A;  4JWM A;  4LT6 A;  3V79 C;  4FH3 A;  3AH2 A;  3H3A A;  3RH4 A;  4LO7 C;  5D4B A;  5DED A;  4UB5 A;  4H75 A;  2BBH A;  2BPC A;  4KC3 A;  3AQL A;  3BRF A;  5G00 A;  1OU5 A;  5BXP A;  1V6W A;  4LO2 C;  3OVS A;  4ZFW B;  5J2E A;  5HRH A;  4LVS A;  3VWC A;  4WC5 A;  1AVU A;  1JLX A;  4UB2 A;  1SR4 C;  2RFF A;  4PHD A;  3FJ8 A;  1NOM A;  1W3A A;  3LK9 A;  1GGP B;  4P6A A;  1JMS A;  2GA9 D;  4WC0 A;  4YMN A;  4O67 A;  9ICM A;  4WC7 A;  4FHP A;  1HIB A;  8ICT A;  2RG9 B;  4Z6E A;  3O4B A;  4RQ8 A;  2DS0 A;  4QD2 B;  2ZHB A;  1BPX A;  4I2I A;  1R8C A;  4UY4 A;  5CHG A;  2PFQ A;  4EEB A;  3PG0 A;  2HZ9 A;  21BI A;  4XKI A;  4PGY A;  2M2U A;  4E7X A;  7ICQ A;  1Q03 A;  3PMN A;  4PPX A;  4FHX A;  9ICI A;  4R63 A;  3K75 D;  2PBE A;  2MIB A;  3CA4 A;  5J2A A;  2F2F C;  4EFQ A;  3O5W B;  4KB6 A;  2DRA A;  4D0Z A;  4UD5 A;  8ICZ A;  3H37 A;  3WO4 A;  1RZO B;  1PX5 A;  4LO3 A;  5IIL A;  4O5C A;  1P63 A;  4QZH A;  1PWA A;  3BX1 C;  5DSS B;  3I2A A;  1JLY A;  4KLL A;  1W3F A;  9ICR A;  3C9Z A;  5D46 A;  3BA4 A;  3CRG A;  4F5O A;  4EBJ A;  3ZXG A;  4YCX A;  2Z48 A;  1ZQH A;  3VT1 A;  3HX0 A;  4M5D A;  4E8F A;  5DB9 A;  2RST A;  1ZQB A;  4NLK A;  7ICF A;  4NXZ A;  3F1R A;  5CP2 A;  2ZH3 A;  4NM2 A;  4LEV A;  4MZH A;  4X3A A;  3UXP A;  4H9W A;  2NP0 A;  4X4P A;  1UPS A;  3BTA A;  4QZB A;  1RML A;  3V7J A;  1S0G A;  1XSL A;  3AUO A;  3C2K A;  3FJ9 A;  4NKT A;  3UQ0 A;  3UQ2 A;  1ZQJ A;  4JQ0 A;  3CA3 A;  1HWO B;  4LZD A;  5HRK A;  4MFC A;  4A7Y A;  2M2W A;  4OWK A;  3K1X A;  4I2S A;  3B0X A;  1R8A A;  3IM5 A;  3RJI A;  4EED A;  1PUU B;  4KLT A;  4RQ6 A;  2RQ9 A;  2BCQ A;  1AVA C;  3PNC A;  1JT4 A;  1JN3 A;  8ICM A;  5BQU A;  4YD1 A;  2IUB A;  4QZI A;  4K96 A;  4WBZ A;  4LO1 A;  4USP A;  3CAH A;  4K97 A;  5E24 E;  8ICW A;  4MF2 A;  4IYB A;  1HCD A;  2D44 A;  7ICE A;  4O69 A;  4X4T A;  4I2C A;  4NXU A;  5DDY A;  4OEG A;  8ICL A;  4OAF A;  4I0Y A;  5BOL A;  2ZH9 A;  2BCS A;  8ICB A;  4RQ3 A;  3FJC A;  4RQ0 A;  5DEC A;  2DR9 A;  2Q66 A;  2ZH2 A;  5HR9 A;  3B9U A;  4WCW A;  4G9M A;  4NXT A;  2YUG A;  5J0R A;  2ISO A;  1ZQX A;  1W3G A;  4FHW A;  3BAH A;  1T4Q A;  1GPJ A;  5CFS A;  3ZX7 A;  1S0B A;  4UBC A;  3A22 A;  3OUY A;  8ICA A;  3H6Q A;  9ICT A;  9ICU A;  4I6I A;  4AN7 B;  7ICU A;  1ISY A;  2NYY A;  4OWJ A;  1BLA A;  4YMO A;  5J0Y A;  3AZV A;  3OBR A;  2E4M A;  4RQ7 A;  5HRE A;  1N4K A;  1XHB A;  3IM6 A;  3HJ4 A;  9ILB A;  4EP7 A;  2BFH A;  7ICS A;  4NY8 A;  3EF2 A;  5F8W A;  3N7M A;  8ICH A;  4KLI A;  4UB4 A;  3UD9 A;  1ZQL A;  4GOV A;  4TUR A;  2ET2 A;  3RTJ B;  4Q9P A;  1FA0 A;  4IQV A;  4LO7 B;  1WBC A;  2HWA A;  3GDX A;  4M9J A;  2M2T A;  2D7R A;  4X4Q A;  3OBT A;  5EG6 C;  3VUO A;  4O6A A;  5CR0 A;  4DOC A;  1E0O A;  5J2B A;  4QAL A;  4JPZ A;  4AT8 B;  2D1Z A;  3ZC9 A;  5HC9 A;  4OEF A;  3RTI B;  1F5A A;  1YF8 B;  3F62 B;  1TTU A;  4I2E A;  4PC4 A;  1ISV A;  4PHE A;  1IJT A;  1MIW A;  3VSF A;  5CB1 A;  1YTO A;  4QZD A;  3OJ2 A;  4FGF A;  9ICC A;  1ONK B;  1ZQR A;  1ZQO A;  5CWR A;  1BPE A;  2FMS A;  5IIM A;  1WOT A;  4G1R A;  3WIN A;  3HBW A;  3WO3 A;  3O44 A;  4ATB B;  3OVA A;  3FJA A;  3C2L A;  8ICG A;  4K4H A;  3OV7 A;  4WC2 A;  2HN1 A;  4FVV A;  4HA2 A;  1DIW A;  4RPX A;  2PFP A;  4XQ8 A;  2KKI A;  4END A;  4K9B A;  4I1B A;  4LEZ A;  1Q04 A;  1I1E A;  3E8L C;  4UB3 A;  1XYF A;  4UAW A;  3CU1 B;  9ICK A;  4KLS A;  4Z6D A;  4R65 A;  1G9D A;  1NO5 A;  4M0A A;  2AQZ A;  1TWM A;  4UD4 A;  2ID1 A;  1ZQM A;  1Q78 A;  3FJD A;  1EV2 A;  4I4R A;  5BPC A;  2K4A B;  4M2Y A;  4MFF A;  4HR6 C;  4I2B A;  1D0H A;  4FHY A;  3LQC B;  4RPZ A;  1KNY A;  3N7L A;  5J2G A;  3BAG A;  4EGW A;  1G9C A;  3JPR A;  1UEV A;  4EKX B;  1BPZ A;  1R89 A;  7ICT A;  3V7K A;  2F8X C;  3IAG C;  4UAZ A;  2Y9W C;  3C18 A;  4YOL A;  3JPP A;  1DZC A;  3V0A A;  1JAJ A;  1BFF A;  2VUA A;  3MDA A;  8ICX A;  5F8Y A;  1EVT A;  5HPZ A;  1CE7 B;  1MD6 A;  3PHZ A;  7ICG A;  3FGM A;  5DVH A;  2VSE A;  4KLO A;  5CJ7 A;  5J0W A;  3MPP G;  2D22 A;  2FCL A;  3WFS C;  9ICX A;  5DBA A;  3LTQ A;  4LO3 C;  4OWL A;  4GAI A;  4KEI A;  2VXR A;  4I2H A;  4F5Q A;  8ICC A;  4DCK C;  1G82 A;  5J2F A;  4X4U A;  4QZG A;  4DO9 A;  4DEN A;  3HAL A;  9ICQ A;  4H04 A;  2M2V A;  3CA6 A;  2FFU A;  3BAU A;  5CFU A;  2DRB A;  3VSZ A;  4OAI Z;  1S0L A;  1DFQ A;  5IIN A;  3LLP A;  4QZ9 A;  1K5V A;  2ZH7 A;  4ZFY B;  2BBJ A;  3Q7W A;  2QYI B;  2DR8 A;  3FUO A;  4R66 A;  3UXO A;  1S0F A;  1FWU A;  3AH4 A;  3V7L A;  1HWP B;  1FMM S;  3WA1 A;  2BPF A;  5J2D A;  3CQA A;  2LIQ A;  2ZR1 B;  1UET A;  7ICK A;  4IHZ A;  5JTG A;  5J0O A;  1R8N A;  3WFO A;  4QZA A;  3V72 A;  1FN0 A;  4IZX A;  3MGI A;  2QN4 A;  3AQK A;  1FV3 A;  2DRE A;  4J2S A;  4KBB A;  4I4S A;  4LO8 B;  4AT9 B;  2BCR A;  2FMP A;  3JYY A;  4G6M A;  2HHP A;  4J2Y A;  4TLP A;  2BCU A;  3S8J A;  3TFR A;  1JQZ A;  4F34 A;  3ER9 B;  3A21 A;  4AT8 A;  9ICE A;  3IM7 A;  4X39 A;  4O9M A;  3PML A;  3HJ1 A;  2DR7 A;  4GXI A;  5BQU C;  4WOY A;  2VXT I;  4RQ2 A;  1Q79 A;  4M9N A;  4LO1 C;  3AJ6 A;  3BAD A;  9ICS A;  5DUY A;  4UAY A;  1HWM B;  5BVP I;  4XFS A;  1Z0H A;  5IIO A;  3C5G A;  2NVH A;  5D63 A;  1QXM A;  4M9H A;  2FDB M;  4NLN A;  1MIV A;  1UEU A; 
#chains in the Genus database with same CATH homology
 4KM5 A;  2Z49 A;  2AXM A;  2KI6 B;  3FJJ A;  3CA1 A;  4ISQ A;  9ILB A;  1IHK A;  2KLL A;  1BFB A;  3PME A;  2ERM A;  4KEK A;  2BFH A;  2HW9 A;  3BAQ A;  4KEJ A;  5FZU A;  4D8H A;  7I1B A;  3EF2 A;  3HSM A;  2D43 A;  3OGF A;  1FGA A;  1QQL A;  3KMV A;  2X2T A;  5F8W A;  3N7M A;  1T9F A;  2ESU A;  2P23 A;  3WMV A;  1IT0 A;  3K7D A;  3NBN A;  4ZLB B;  1NZK A;  3NBC A;  4J23 B;  2BEA A;  3JRR A;  1S0D A;  4I8M A;  3VT0 A;  4A7Z A;  3FJE A;  1IIL A;  3UD9 A;  4GOV A;  1XG6 A;  3O3Q A;  1ITB A;  2ET2 A;  2ZQN A;  3N7K A;  3RTJ B;  1Z4S A;  1S0E A;  3V0B B;  4Q9P A;  2K8R A;  3WMU A;  5BP5 A;  4LO7 B;  3OJV A;  1YXW A;  3I2X A;  1JT5 A;  4JKQ A;  4JKX B;  3BRD A;  4O68 A;  1WBC A;  1FQ9 A;  2HWA A;  3H6R B;  2R9K B;  3ILA A;  1EYL A;  4JP0 A;  2E4M C;  1TFM B;  4FO1 A;  2BEB A;  4XFU A;  1XZZ A;  1AF9 A;  1DFC A;  2D7R A;  3A07 A;  1V6U A;  3OBT A;  5EG6 C;  3UDA A;  3VUO A;  2D23 A;  3H6R A;  1ISZ A;  4O6A A;  3OJM A;  1BAR A;  1PUM B;  1TOO A;  3BB2 A;  3JUT A;  1E0O A;  3HN1 A;  2HWM A;  3P53 A;  4LO2 A;  4QAL A;  4JPZ A;  3AKI A;  1J0S A;  1A8D A;  2D1Z A;  4IY9 A;  3ZC9 A;  3BAO A;  1V6X A;  4I1E A;  1AVX B;  1G9A A;  3MCR A;  3UJ0 A;  4OEF A;  2B4V A;  4QKS A;  3ER8 C;  3RTI B;  1SR4 A;  3O49 A;  1YF8 B;  3F62 B;  4NXV A;  4DEP A;  1TTU A;  3D7W B;  4PC4 A;  3FJF A;  3AKH A;  1ISV A;  4JLZ A;  4OAG A;  2DRZ A;  1DQG A;  3SNV A;  2LIE A;  3P6J A;  4K9A A;  1IJT A;  5FZZ A;  4GP0 A;  4GAF A;  3VSF A;  2FFV A;  5CHE A;  1YTO A;  3OJ2 A;  5BP5 C;  4FGF A;  1DZD A;  1ONK B;  1RG8 A;  41BI A;  3V79 C;  4HJJ A;  3AH2 A;  3FJH A;  4G1R A;  3WIN A;  3BRG C;  3HBW A;  4LO7 C;  4EFP A;  1IRP A;  1G9B A;  4LO0 A;  4H75 A;  3NJ5 A;  3VT2 A;  3WO3 A;  4KC3 A;  3O44 A;  3FJA A;  2NM1 A;  3BRF A;  5G00 A;  5D61 A;  2K43 A;  5BXP A;  4LEY A;  1V6W A;  4LO2 C;  4ZFW B;  4EB2 B;  3VEQ A;  4N7R A;  4FVV A;  1HCE A;  3NBD A;  4HA2 A;  3VWC A;  2VLC A;  2F2F A;  1AVU A;  1DIW A;  1JLX A;  1SR4 C;  1YBI A;  4WBC A;  4I3N A;  1JTC A;  2ZQO A;  2KKI A;  3T8S A;  31BI A;  4END A;  3FJ8 A;  2MC2 A;  4K9B A;  1W3A A;  3O4O A;  4QBC A;  4MZG B;  4I1B A;  5BXR A;  4LEW A;  4K98 A;  1M2T B;  3WO2 A;  4I7I A;  1GGP B;  2VSA A;  4IQP A;  4P6A A;  2GA9 D;  4JRA A;  4LEZ A;  4G9N A;  4O67 A;  1Q04 A;  1I1E A;  3E8L C;  3FJI A;  1HIB A;  2RG9 B;  3O4B A;  2DS0 A;  3R4U A;  1KNM A;  4QD2 B;  5FZY A;  2D24 A;  4UY4 A;  3BA5 A;  1XYF A;  3RMX A;  1BLD A;  3AH1 A;  3AZW A;  3CU1 B;  3WIN C;  1G9D A;  3PG0 A;  2AQZ A;  2Q3N B;  2HZ9 A;  5CFT A;  4LO0 C;  1TWM A;  21BI A;  2AAI B;  4Z9W B;  3FJD A;  4XKI A;  1EV2 A;  4I4R A;  3O4A A;  3RMY A;  2GZB A;  1Q03 A;  3AKG A;  2NZ9 A;  2K4A B;  3MAL A;  1ILR 1;  1V6V A;  3OWG A;  4HR6 C;  4IZE A;  3Q7Y A;  3A23 A;  2VU9 A;  4Q91 A;  1D0H A;  2MIB A;  3CA4 A;  1ISW A;  4OW4 A;  1HKN A;  2M49 A;  2F2F C;  1FMZ A;  5F8S A;  4EFQ A;  3O5W B;  3ZXD A;  4KB6 A;  2NTD A;  1YYN A;  4D0Z A;  4I96 A;  2P39 A;  3BAV A;  3N7L A;  1TWE A;  3WO4 A;  1RZO B;  3BAG A;  4LO3 A;  1G9C A;  3BA7 A;  4EKX B;  1P63 A;  2D20 A;  3V0A B;  1PWA A;  4I4V A;  4JLX A;  2X2S A;  3BX1 C;  4P0K A;  3ERC C;  5DSS B;  4CJM A;  3I2A A;  2F8X C;  4K8V A;  2WRY A;  2Y9F A;  3IAG C;  2Y9W C;  1JLY A;  2B51 A;  3FJK A;  4YOL A;  1W3F A;  5F90 A;  4L4I A;  3HMY A;  5D62 A;  3C9Z A;  1DZC A;  3V0A A;  2KI4 A;  2MLL B;  1IRA X;  1BFF A;  2VUA A;  3BA4 A;  3CRG A;  3FJB A;  3ZXG A;  4QD2 C;  4J2K A;  2Z48 A;  5F8Y A;  4USO A;  4XFT A;  4JAW A;  1EVT A;  5HPZ A;  1CE7 B;  1MD6 A;  3PHZ A;  4Q9G A;  3FGM A;  3VT1 A;  1AVW B;  5DVH A;  4L4H A;  2VSE A;  3P6I A;  2RST A;  3CRI A;  4OUJ A;  3MPP G;  2D22 A;  4ZFU B;  4ZGR B;  2FO1 A;  3O4D A;  1ABR B;  3FFZ A;  2FCL A;  2Y9G A;  3F1R A;  3NKU A;  3H6S E;  3N7J A;  3QR5 A;  4F83 A;  4LEV A;  4NXX A;  4I4Y A;  4GOY A;  4MZH A;  4P0J A;  4X3A A;  3LTQ A;  2UUS A;  1FV2 A;  5BOW A;  4MZF B;  4LO3 C;  1Q1U A;  4H9W A;  2NP0 A;  4I4U A;  4OWL A;  5BXT A;  4GAI A;  4NXW A;  4HX0 A;  3CA0 A;  1UPS A;  3BTA A;  3RSJ A;  4KEI A;  2VXR A;  1RML A;  4EFR A;  1S0G A;  4X37 A;  6I1B A;  4DCK C;  3FJ9 A;  1BFG A;  1G82 A;  1JT3 A;  2EWR A;  5FNW A;  1AXM A;  4JQ0 A;  2DRY A;  1M16 A;  5JMC A;  4DEN A;  4QKR A;  3AKF A;  3CA3 A;  3HAL A;  4H04 A;  1HWO B;  4P0L A;  3CA6 A;  2GAF D;  2FFU A;  4GP3 A;  1JY0 A;  3BAU A;  4ZOT A;  5CFU A;  4I4P A;  3VSZ A;  3AJ5 A;  8I1B A;  3W9T A;  4A7Y A;  5EC5 A;  4OEE A;  5GAQ A;  1SZ6 B;  1BAS A;  4OAI Z;  1S0L A;  4OWK A;  3K1X A;  4I2S A;  1DFQ A;  3IIR A;  1K5U A;  2XOA A;  3LLP A;  3IM5 A;  1K5V A;  3Q7X A;  1ISX A;  5DZU A;  4ZKT B;  4ZFY B;  1PUU B;  2L5X A;  1RY7 A;  1TIE A;  3CRH A;  4MKP A;  2RQ9 A;  1AVA C;  1PC8 B;  3Q7W A;  1JT4 A;  2QYI B;  4I4Q A;  1VCL A;  4I4X A;  4Z8S B;  5BQU A;  3O4C A;  1JT7 A;  3FUO A;  3QYD A;  1S0F A;  4K96 A;  1DLL A;  1FWU A;  1I1B A;  3AH4 A;  3OGG A;  1CVS A;  1HWP B;  1S0C A;  4LO1 A;  1FMM S;  4USP A;  3WA1 A;  4QBV A;  4WH5 A;  2FGF A;  4ZBV B;  3CQA A;  3CAH A;  4K97 A;  1MC9 A;  1DJS B;  2LIQ A;  2ZR1 B;  3V0B A;  5E24 E;  4IHZ A;  1R8N A;  4ISR A;  3HOM A;  1R8O A;  4IYB A;  1HWN B;  4D0T A;  1HCD A;  1FN0 A;  2D44 A;  4IY8 A;  1WBA A;  4IZX A;  4O69 A;  3I29 B;  2QN4 A;  3ZC8 A;  4K99 A;  3CA5 A;  2WBC A;  1FV3 A;  2DRE A;  1QQK A;  4ION A;  4J2S A;  4WQK A;  5I1B A;  3UJ4 A;  4NXU A;  4KBB A;  3UD8 A;  4G6J A;  4I4S A;  4OEG A;  4LO8 B;  4OAF A;  1BA7 A;  4QC4 A;  4I0Y A;  2I1B A;  4G6M A;  1AFC A;  2NS2 A;  4J2Y A;  2Y9X E;  4TLP A;  1FWV A;  3FUQ A;  3S8J A;  4R6U B;  4EEE B;  3PUB A;  1JQZ A;  4F34 A;  5B3P A;  1II4 A;  4ZA3 B;  3ER9 B;  3A21 A;  2IWT B;  4J2X A;  1NUN A;  3FJC A;  1IOB A;  2KH2 A;  1OQL B;  3IM7 A;  4X39 A;  1PZZ A;  3NBE A;  3R4S A;  4I37 A;  1WD3 A;  3B9U A;  5BQU C;  1EPW A;  5BXS A;  2J3P A;  1BFC A;  5EHA A;  4WOY A;  2VXT I;  4A7K A;  4G9M A;  1DQO A;  2YUG A;  4NXT A;  2B56 A;  5B2H A;  1TP0 A;  1W3G A;  3BAH A;  2GO2 A;  4LO1 C;  1T4Q A;  3AJ6 A;  1GPJ A;  3ZX7 A;  5CFS A;  1S0B A;  3A22 A;  3BAD A;  5DUY A;  3H6Q A;  2D7I A;  5FNX A;  3S8K A;  4I6I A;  4AN7 B;  1HWM B;  5BVP I;  1ISY A;  2NYY A;  4OWJ A;  1BLA A;  4XFS A;  5B3Q A;  1Z0H A;  5JLV A;  2IHO A;  1L2H A;  3UD7 A;  3AZV A;  1WD4 A;  4X38 A;  4I4O A;  2AFG A;  2NVH A;  4QO3 A;  3OBR A;  3POK A;  2E4M A;  4OAH A;  4WQL A;  1Z2V A;  5D63 A;  2Q9X A;  1QXM A;  1F31 A;  2FDB M;  1N4K A;  1XHB A;  3IM6 A;  4II0 A;  4XJE A;  3TC2 A;  3N0K A;  4AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...