2EWRA

Crystal structure of a putative nucleotidyltransferase (tm1012) from thermotoga maritima at 1.60 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
IRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSKKVRFSSTEKICSHFGELIIDGIKVEIMGDIRKRLEDGTWEDPVDLNKYKRFVETHGMKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM1012
publication title Crystal structure of hypothetical protein (tm1012) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ewrA00
4WQLA 4HX0A 4XJEA 4FO1A 4WH5A 4WQKA 5CFTA 5CFUA 2FCLA 2EWRA 5CFSA
chains in the Genus database with same CATH superfamily
4M9JA 3AQKA 5HREA 1ZQSA 4NM2A 8ICSA 4RPXA 7ICTA 2DR7A 2BBJA 5J2IA 4M2YA 9ICHA 9ICOA 5J29A 5IIIA 1OU5A 1MIWA 4K4IA 3C5FA 1F5AA 4RQ3A 1ZQWA 1JQRA 3L9DA 5HR9A 4EGWA 4E80A 5DEDA 3OUYA 4EBKA 4NXZA 3RH5A 4RQ0A 8ICQA 1ZQIA 7ICSA 1KEJA 4RQ6A 4I2CA 9ICXA 4IG8A 2RFFA 4UAWA 4X4UA 8ICJA 4QZ9A 4UAZA 8ICZA 1R89A 2ZH9A 4UB5A 3JCFA 2M2TA 4QZBA 1MQ2A 2PXIA 8ICNA 4WC4A 4MF2A 3JYYA 2BCUA 4UB1A 4F5OA 3OVAA 3V7JA 4I2EA 8ICOA 4X0BA 4M9HA 4F5RA 2ZH4A 5CHEA 4NLNA 4MFCA 8ICYA 9ICGA 1ZQKA 2HHPA 3PNCA 1BPYA 1JN3A 4PH5A 1UEVA 4YN4A 1VFGA 4KLQA 4AT9A 4QZ8A 1HUOA 5J2AA 5DBCA 2BE3A 4YMNA 1FA0A 5D62A 4F5NA 4EBJA 3RJJA 5J2JA 4M9NA 2B51A 4ATBA 1NO5A 5HRDA 5J2GA 4RQ8A 9ICWA 4WC3A 4FHPA 2GA9D 4S3NA 2PBEA 4LVSA 4NXUA 4O6AA 8ICMA 4GXKA 3ISBA 4AT8A 4JLXA 5DB8A 4KLIA 5J0QA 5HHIA 2DRAA 3K75D 7ICIA 4K96A 3C2MA 9ICBA 4RQ5A 3H37A 2ZHAA 4GXJA 2ZH1A 1ZQCA 4NM1A 4XQ8A 2ZH7A 1NOMA 4UBBA 2BCRA 9ICNA 3OGUA 4P4PA 1ZQHA 4MFFA 2M2WA 4OAIZ 4P2HA 5J2KA 1HUZA 3GDXA 4UB3A 3C5GA 4FH5A 5CFTA 4DOCA 2NRKA 3HX0A 9ICRA 4O67A 7ICFA 5CB1A 4X4QA 4M9LA 5BOLA 3JZ0A 4YMOA 4LT6A 1ZQOA 4WC6A 9ICVA 4K8VA 5B3QA 5J0UA 5CFSA 1ZQNA 5DDYA 4KLTA 4X4NA 4WC5A 8ICAA 3H3AA 3ER9B 1TFWA 3RJGA 4JWMA 3K7DA 3NYBA 4R66A 4P4OA 4KLLA 4IQTA 3UPQA 2ISOA 9ICIA 3V7KA 1ZQMA 1ZQVA 3WFQE 4XJEA 4OAGA 4UD4A 7ICMA 2DR5A 5CA7A 1ZQDA 3EF2A 4EV6A 4M5DA 4WQLA 4K9AA 1XSNA 8ICLA 3C66A 3UPSA 1BPDA 4WC7A 2I9GA 4M0AA 4LZDA 3RJEA 3HJ1A 3JPOA 5DB9A 5TZVA 4Z6FA 5HHHA 3JPTA 2O1PA 3PMNA 3HW8A 2BPGA 2PFQA 4M04A 3C2KA 4O5EA 4YCXA 4RPZA 3UQ2A 5IIMA 5IINA 8ICHA 5B3PA 4I28A 1BPEA 4QZHA 3UXNA 4LEVA 5J2FA 5J2CA 9ICSA 4I2IA 4XA5A 4PPXA 3HJ4A 3JPPA 4X5VA 2VANA 4DOAA 4QZAA 4YD1A 5DB6A 3WFOA 3OUYB 5CHGA 2PFNA 4I2FA 3V7LA 8ICUA 1XSPA 4I2AA 5HRIA 7ICQA 4O5KA 5J0OA 9ICCA 4HX0A 2O5AA 3AQNA 4O9MA 4YD2A 2PFPA 2ZHBA 4K4HA 3H39A 3CK6A 1ZQRA 4F5PA 5DECA 7ICUA 4I2DA 3JPSA 3MDCA 4NXTA 4AT7A 1ZJMA 1ZQLA 4RQ1A 2IUBA 2GAFD 3OV7A 2ZH3A 9ICUA 5HRGA 3UXPA 1RZTA 2P66A 5HRKA 1JMSA 4QZIA 2ZH8A 4R64A 8ICCA 8ICWA 1ZQUA 4FO6A 4KLEA 4AT9B 1Q79A 3AQLA 5J0YA 4UB4A 4P4MA 1KDHA 2FMSA 2GWSA 5BPCA 3AU2A 4UB2A 3LK9A 2M2VA 5J0WA 3C2LA 4K9BA 3JPQA 5CFUA 4Z6DA 4E7XA 3RJHA 4WBYA 4I2JA 1ZQQA 1BPBA 4ATBB 3H38A 4NXXA 4I2GA 3RH6A 4EEBA 4IQVA 4O69A 2DVIA 3RJKA 4KLUA 5DKWA 7ICOA 2B56A 9ICEA 5CWRA 7ICLA 2HN2A 9ICLA 3RJIA 5CP2A 4KLHA 2IHOA 1MIYA 2FCLA 4WBZA 3TFRA 5CJ7A 4AT8B 7ICGA 8ICBA 1BPZA 4XQ7A 4UD5A 3JPNA 7ICJA 2EWRA 5BOMA 1BPXA 4X4PA 4QZCA 4UBCA 9ICKA 3RH4A 3OVSA 5J0PA 4QZFA 4NXVA 5CR0A 4X4RA 4WC2A 5J0SA 5D49A 4TUSA 4MF8A 3JPRA 9ICFA 2BBHA 1RPLA 4FHVA 3MDAA 3UQ0A 2IHMA 2BPCA 4NXWA 3UXOA 4FO1A 7ICVA 7ICKA 1ZQZA 5F2VO 3AUOA 2HN1A 5DBAA 1JAJA 4RWQA 4I27A 4RQ4A 3MGHA 4I2BA 4EEDA 4F5QA 1V4AA 8ICGA 1UEUA 4I29A 4PGXA 4QZEA 2BPFA 3C18A 4NKTA 4KLOA 3ISCA 5IIJA 5EOZA 3WFPA 5J2EA 1ZQJA 4KLMA 4XUSA 2FMQA 8ICPA 4X4TA 3V72A 4K98A 7ICHA 8ICRA 4TURA 1PX5A 1Q78A 4IQWA 4MKPA 4WH5A 4RT3A 3B0XA 5IIOA 5HRLA 4X4OA 4KB6A 7ICRA 4X0AA 4PGQA 4PHAA 8ICFA 4KLSA 4OAFA 4WQKA 4WOYA 4N7RA 4UAYA 3WFSC 5J2BA 1ZQYA 7ICEA 4M9GA 4PHDA 2PFOA 4O68A 4XRHA 9ICTA 5DBBA 4KLDA 4R65A 4PGYA 4K99A 3HWTA 4TUPA 4OAHA 7ICPA 2B4VA 4FHYA 4RPYA 4WC1A 2W9MA 1ZQXA 3HIYA 4FH3A 2FMPA 5IIKA 8ICXA 1TV9A 3NVOA 2DR8A 2ID1A 4NLKA 4KLJA 4RWNA 8ICIA 1R8BA 4QZDA 4I2HA 2M2UA 5DB7A 5J0RA 5HRBA 8ICTA 3LQCB 4DOBA 3ER8C 4RQ7A 5D46A 5D63A 1MIVA 4EP7A 4WC0A 2Q66A 2BCQA 1ZQBA 5J0TA 3MBYA 2ISPA 4O5CA 1VJ7A 3TFSA 4NY8A 3OVBA 4RWOA 1ZQTA 1ZQAA 4AT7B 4RQ2A 3ISDA 1YLQA 3ERCC 2ZH2A 4FHWA 2BCVA 4KLGA 4GXIA 1ZQEA 1TFYA 3MGIA 3OWGA 3MCRA 5D61A 3AQMA 5JTGA 4LZGA 1XSLA 4NLZA 3RJFA 3NKUA 3NWIA 1KNYA 1MQ3A 4RWPA 5HRHA 4I0UA 3B0YA 4KM5A 4K4GA 4E8FA 4RT2A 4KLFA 2DR9A 4PHEA 8ICVA 5J0XA 3WFRE 4QZGA 5J2DA 4JLZA 1UETA 9ICJA 9ICMA 4LEYA 4WCWA 5HRFA 4LEWA 1ZQFA 4PHPA 4DO9A 9ICPA 1ZQGA 2BCSA 4FHXA 5DDMA 4R63A 4M47A 4Z6EA 3AU6A 3PMLA 5J2HA 2ZH5A 4JWNA 1TVAA 5IILA 7ICNA 1ZJNA 8ICEA 4MFAA 1ZQPA 1GPJA 1WOTA 5D4BA 4LEZA 8ICKA 2ZH6A 4X4SA 4X4VA 4Z6CA 5HC9A 9ICAA 4NKUA 1R8AA 4YMMA 3PHZA 1R8CA 4IQUA 9ICQA 4K97A 2DRBA 4TUQA
chains in the Genus database with same CATH topology
3MCRA 3NKUA 4NXXA 4OAIZ 4O69A 2GA9D 5CFTA 4O67A 2B56A 4NXUA 4O68A 4HX0A 4K98A 4KM5A 4NXWA 4O6AA 4XJEA 4OAGA 4FO1A 4MKPA 4WH5A 5D61A 2IHOA 4JLXA 3ER8C 2FCLA 4KB6A 5B3PA 1GPJA 3EF2A 4LEZA 5D63A 4JLZA 4LEVA 4K99A 4K8VA 4K96A 4K97A 4OAHA 5B3QA 5D62A 2EWRA 5CFSA 4NXTA 4K9BA 2B4VA 4LEYA 4WQLA 4K9AA 4OAFA 3PHZA 3ERCC 4LEWA 4WQKA 5CHEA 2B51A 4WOYA 4N7RA 3K7DA 5CFUA 3ER9B 2GAFD 4NXVA 3OWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQL A;  4HX0 A;  4XJE A;  4FO1 A;  4WH5 A;  4WQK A;  5CFT A;  5CFU A;  2FCL A;  2EWR A;  5CFS A; 
#chains in the Genus database with same CATH topology
 4M9J A;  3AQK A;  5HRE A;  1ZQS A;  4NM2 A;  8ICS A;  4RPX A;  7ICT A;  2DR7 A;  2BBJ A;  5J2I A;  4M2Y A;  9ICH A;  9ICO A;  5J29 A;  5III A;  1OU5 A;  1MIW A;  4K4I A;  3C5F A;  1F5A A;  4RQ3 A;  1ZQW A;  1JQR A;  3L9D A;  5HR9 A;  4EGW A;  4E80 A;  5DED A;  3OUY A;  4EBK A;  4NXZ A;  3RH5 A;  4RQ0 A;  8ICQ A;  1ZQI A;  7ICS A;  1KEJ A;  4RQ6 A;  4I2C A;  9ICX A;  4IG8 A;  2RFF A;  4UAW A;  4X4U A;  8ICJ A;  4QZ9 A;  4UAZ A;  8ICZ A;  1R89 A;  2ZH9 A;  4UB5 A;  3JCF A;  2M2T A;  4QZB A;  1MQ2 A;  2PXI A;  8ICN A;  4WC4 A;  4MF2 A;  3JYY A;  2BCU A;  4UB1 A;  4F5O A;  3OVA A;  3V7J A;  4I2E A;  8ICO A;  4X0B A;  4M9H A;  4F5R A;  2ZH4 A;  5CHE A;  4NLN A;  4MFC A;  8ICY A;  9ICG A;  1ZQK A;  2HHP A;  3PNC A;  1BPY A;  1JN3 A;  4PH5 A;  1UEV A;  4YN4 A;  1VFG A;  4KLQ A;  4AT9 A;  4QZ8 A;  1HUO A;  5J2A A;  5DBC A;  2BE3 A;  4YMN A;  1FA0 A;  5D62 A;  4F5N A;  4EBJ A;  3RJJ A;  5J2J A;  4M9N A;  2B51 A;  4ATB A;  1NO5 A;  5HRD A;  5J2G A;  4RQ8 A;  9ICW A;  4WC3 A;  4FHP A;  2GA9 D;  4S3N A;  2PBE A;  4LVS A;  4NXU A;  4O6A A;  8ICM A;  4GXK A;  3ISB A;  4AT8 A;  4JLX A;  5DB8 A;  4KLI A;  5J0Q A;  5HHI A;  2DRA A;  3K75 D;  7ICI A;  4K96 A;  3C2M A;  9ICB A;  4RQ5 A;  3H37 A;  2ZHA A;  4GXJ A;  2ZH1 A;  1ZQC A;  4NM1 A;  4XQ8 A;  2ZH7 A;  1NOM A;  4UBB A;  2BCR A;  9ICN A;  3OGU A;  4P4P A;  1ZQH A;  4MFF A;  2M2W A;  4OAI Z;  4P2H A;  5J2K A;  1HUZ A;  3GDX A;  4UB3 A;  3C5G A;  4FH5 A;  5CFT A;  4DOC A;  2NRK A;  3HX0 A;  9ICR A;  4O67 A;  7ICF A;  5CB1 A;  4X4Q A;  4M9L A;  5BOL A;  3JZ0 A;  4YMO A;  4LT6 A;  1ZQO A;  4WC6 A;  9ICV A;  4K8V A;  5B3Q A;  5J0U A;  5CFS A;  1ZQN A;  5DDY A;  4KLT A;  4X4N A;  4WC5 A;  8ICA A;  3H3A A;  3ER9 B;  1TFW A;  3RJG A;  4JWM A;  3K7D A;  3NYB A;  4R66 A;  4P4O A;  4KLL A;  4IQT A;  3UPQ A;  2ISO A;  9ICI A;  3V7K A;  1ZQM A;  1ZQV A;  3WFQ E;  4XJE A;  4OAG A;  4UD4 A;  7ICM A;  2DR5 A;  5CA7 A;  1ZQD A;  3EF2 A;  4EV6 A;  4M5D A;  4WQL A;  4K9A A;  1XSN A;  8ICL A;  3C66 A;  3UPS A;  1BPD A;  4WC7 A;  2I9G A;  4M0A A;  4LZD A;  3RJE A;  3HJ1 A;  3JPO A;  5DB9 A;  5TZV A;  4Z6F A;  5HHH A;  3JPT A;  2O1P A;  3PMN A;  3HW8 A;  2BPG A;  2PFQ A;  4M04 A;  3C2K A;  4O5E A;  4YCX A;  4RPZ A;  3UQ2 A;  5IIM A;  5IIN A;  8ICH A;  5B3P A;  4I28 A;  1BPE A;  4QZH A;  3UXN A;  4LEV A;  5J2F A;  5J2C A;  9ICS A;  4I2I A;  4XA5 A;  4PPX A;  3HJ4 A;  3JPP A;  4X5V A;  2VAN A;  4DOA A;  4QZA A;  4YD1 A;  5DB6 A;  3WFO A;  3OUY B;  5CHG A;  2PFN A;  4I2F A;  3V7L A;  8ICU A;  1XSP A;  4I2A A;  5HRI A;  7ICQ A;  4O5K A;  5J0O A;  9ICC A;  4HX0 A;  2O5A A;  3AQN A;  4O9M A;  4YD2 A;  2PFP A;  2ZHB A;  4K4H A;  3H39 A;  3CK6 A;  1ZQR A;  4F5P A;  5DEC A;  7ICU A;  4I2D A;  3JPS A;  3MDC A;  4NXT A;  4AT7 A;  1ZJM A;  1ZQL A;  4RQ1 A;  2IUB A;  2GAF D;  3OV7 A;  2ZH3 A;  9ICU A;  5HRG A;  3UXP A;  1RZT A;  2P66 A;  5HRK A;  1JMS A;  4QZI A;  2ZH8 A;  4R64 A;  8ICC A;  8ICW A;  1ZQU A;  4FO6 A;  4KLE A;  4AT9 B;  1Q79 A;  3AQL A;  5J0Y A;  4UB4 A;  4P4M A;  1KDH A;  2FMS A;  2GWS A;  5BPC A;  3AU2 A;  4UB2 A;  3LK9 A;  2M2V A;  5J0W A;  3C2L A;  4K9B A;  3JPQ A;  5CFU A;  4Z6D A;  4E7X A;  3RJH A;  4WBY A;  4I2J A;  1ZQQ A;  1BPB A;  4ATB B;  3H38 A;  4NXX A;  4I2G A;  3RH6 A;  4EEB A;  4IQV A;  4O69 A;  2DVI A;  3RJK A;  4KLU A;  5DKW A;  7ICO A;  2B56 A;  9ICE A;  5CWR A;  7ICL A;  2HN2 A;  9ICL A;  3RJI A;  5CP2 A;  4KLH A;  2IHO A;  1MIY A;  2FCL A;  4WBZ A;  3TFR A;  5CJ7 A;  4AT8 B;  7ICG A;  8ICB A;  1BPZ A;  4XQ7 A;  4UD5 A;  3JPN A;  7ICJ A;  2EWR A;  5BOM A;  1BPX A;  4X4P A;  4QZC A;  4UBC A;  9ICK A;  3RH4 A;  3OVS A;  5J0P A;  4QZF A;  4NXV A;  5CR0 A;  4X4R A;  4WC2 A;  5J0S A;  5D49 A;  4TUS A;  4MF8 A;  3JPR A;  9ICF A;  2BBH A;  1RPL A;  4FHV A;  3MDA A;  3UQ0 A;  2IHM A;  2BPC A;  4NXW A;  3UXO A;  4FO1 A;  7ICV A;  7ICK A;  1ZQZ A;  5F2V O;  3AUO A;  2HN1 A;  5DBA A;  1JAJ A;  4RWQ A;  4I27 A;  4RQ4 A;  3MGH A;  4I2B A;  4EED A;  4F5Q A;  1V4A A;  8ICG A;  1UEU A;  4I29 A;  4PGX A;  4QZE A;  2BPF A;  3C18 A;  4NKT A;  4KLO A;  3ISC A;  5IIJ A;  5EOZ A;  3WFP A;  5J2E A;  1ZQJ A;  4KLM A;  4XUS A;  2FMQ A;  8ICP A;  4X4T A;  3V72 A;  4K98 A;  7ICH A;  8ICR A;  4TUR A;  1PX5 A;  1Q78 A;  4IQW A;  4MKP A;  4WH5 A;  4RT3 A;  3B0X A;  5IIO A;  5HRL A;  4X4O A;  4KB6 A;  7ICR A;  4X0A A;  4PGQ A;  4PHA A;  8ICF A;  4KLS A;  4OAF A;  4WQK A;  4WOY A;  4N7R A;  4UAY A;  3WFS C;  5J2B A;  1ZQY A;  7ICE A;  4M9G A;  4PHD A;  2PFO A;  4O68 A;  4XRH A;  9ICT A;  5DBB A;  4KLD A;  4R65 A;  4PGY A;  4K99 A;  3HWT A;  4TUP A;  4OAH A;  7ICP A;  2B4V A;  4FHY A;  4RPY A;  4WC1 A;  2W9M A;  1ZQX A;  3HIY A;  4FH3 A;  2FMP A;  5IIK A;  8ICX A;  1TV9 A;  3NVO A;  2DR8 A;  2ID1 A;  4NLK A;  4KLJ A;  4RWN A;  8ICI A;  1R8B A;  4QZD A;  4I2H A;  2M2U A;  5DB7 A;  5J0R A;  5HRB A;  8ICT A;  3LQC B;  4DOB A;  3ER8 C;  4RQ7 A;  5D46 A;  5D63 A;  1MIV A;  4EP7 A;  4WC0 A;  2Q66 A;  2BCQ A;  1ZQB A;  5J0T A;  3MBY A;  2ISP A;  4O5C A;  1VJ7 A;  3TFS A;  4NY8 A;  3OVB A;  4RWO A;  1ZQT A;  1ZQA A;  4AT7 B;  4RQ2 A;  3ISD A;  1YLQ A;  3ERC C;  2ZH2 A;  4FHW A;  2BCV A;  4KLG A;  4GXI A;  1ZQE A;  1TFY A;  3MGI A;  3OWG A;  3MCR A;  5D61 A;  3AQM A;  5JTG A;  4LZG A;  1XSL A;  4NLZ A;  3RJF A;  3NKU A;  3NWI A;  1KNY A;  1MQ3 A;  4RWP A;  5HRH A;  4I0U A;  3B0Y A;  4KM5 A;  4K4G A;  4E8F A;  4RT2 A;  4KLF A;  2DR9 A;  4PHE A;  8ICV A;  5J0X A;  3WFR E;  4QZG A;  5J2D A;  4JLZ A;  1UET A;  9ICJ A;  9ICM A;  4LEY A;  4WCW A;  5HRF A;  4LEW A;  1ZQF A;  4PHP A;  4DO9 A;  9ICP A;  1ZQG A;  2BCS A;  4FHX A;  5DDM A;  4R63 A;  4M47 A;  4Z6E A;  3AU6 A;  3PML A;  5J2H A;  2ZH5 A;  4JWN A;  1TVA A;  5IIL A;  7ICN A;  1ZJN A;  8ICE A;  4MFA A;  1ZQP A;  1GPJ A;  1WOT A;  5D4B A;  4LEZ A;  8ICK A;  2ZH6 A;  4X4S A;  4X4V A;  4Z6C A;  5HC9 A;  9ICA A;  4NKU A;  1R8A A;  4YMM A;  3PHZ A;  1R8C A;  4IQU A;  9ICQ A;  4K97 A;  2DRB A;  4TUQ A; 
#chains in the Genus database with same CATH homology
 3MCR A;  3NKU A;  4NXX A;  4OAI Z;  4O69 A;  2GA9 D;  5CFT A;  4O67 A;  2B56 A;  4NXU A;  4O68 A;  4HX0 A;  4K98 A;  4KM5 A;  4NXW A;  4O6A A;  4XJE A;  4OAG A;  4FO1 A;  4MKP A;  4WH5 A;  5D61 A;  2IHO A;  4JLX A;  3ER8 C;  2FCL A;  4KB6 A;  5B3P A;  1GPJ A;  3EF2 A;  4LEZ A;  5D63 A;  4JLZ A;  4LEV A;  4K99 A;  4K8V A;  4K96 A;  4K97 A;  4OAH A;  5B3Q A;  5D62 A;  2EWR A;  5CFS A;  4NXT A;  4K9B A;  2B4V A;  4LEY A;  4WQL A;  4K9A A;  4OAF A;  3PHZ A;  3ERC C;  4LEW A;  4WQK A;  5CHE A;  2B51 A;  4WOY A;  4N7R A;  3K7D A;  5CFU A;  3ER9 B;  2GAF D;  4NXV A;  3OWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...