2EWRA

Crystal structure of a putative nucleotidyltransferase (tm1012) from thermotoga maritima at 1.60 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
IRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSKKVRFSSTEKICSHFGELIIDGIKVEIMGDIRKRLEDGTWEDPVDLNKYKRFVETHGMKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein TM1012
publication title Crystal structure of hypothetical protein (tm1012) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
total genus 50
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ewrA00
4WH5A 4XJEA 2EWRA 5CFTA 5CFSA 4FO1A 2FCLA 5CFUA 4WQKA 4HX0A 4WQLA
chains in the Genus database with same CATH superfamily
4I2FA 3H3AA 1ZJMA 8ICEA 3RH6A 1BPYA 4M04A 5CHEA 4RPZA 2DRAA 5J2HA 1R8BA 8ICVA 4F5RA 1ZQKA 4UB2A 1F5AA 3NWIA 3JPQA 1ZQWA 3UQ0A 4TURA 5CJ7A 3UXNA 4RQ6A 4FHWA 1OU5A 3MGHA 9ICAA 4JLXA 1Q78A 4P4PA 4RT3A 1TVAA 4EEDA 4XA5A 4RQ4A 2IHOA 4TUPA 5DBAA 2ZHBA 3C5FA 3HIYA 4O6AA 4DOBA 4RT2A 4MF2A 4X4QA 3RJGA 3LQCB 7ICEA 2P66A 4RPYA 5J2AA 9ICCA 4QZFA 4PHEA 4NXXA 7ICSA 2O5AA 4MFFA 4NXZA 1ZQQA 5HHIA 4AT9B 4EP7A 3WFSC 1ZQZA 5IIMA 4M0AA 5DDMA 4KLTA 2HHPA 4R66A 9ICKA 5BPCA 4E7XA 1ZQLA 5J0QA 4NXUA 4WC3A 3H38A 4KLDA 4UAZA 1ZQRA 4MFAA 3NVOA 4KLGA 2BE3A 4DOAA 1ZQPA 4X4TA 4K96A 5J2GA 3RJKA 4I29A 1ZQNA 1ZQVA 8ICLA 2ZH5A 3UXOA 4I27A 4LEYA 4K9BA 4K4IA 4GXIA 1ZQFA 3UPSA 3WFQE 2PFPA 4PHDA 2B51A 4I2AA 3MBYA 1UEVA 5DEDA 4UAWA 5DB6A 4FHPA 4KLLA 4EEBA 1R8AA 1MQ3A 4YMOA 1KDHA 5J0TA 8ICBA 1XSPA 4LEWA 4RPXA 5BOMA 4QZ8A 8ICJA 4X4UA 2DR9A 4FH3A 4FHVA 4UD5A 3MGIA 1ZQGA 4I2DA 3HX0A 4TUSA 3NKUA 3JPTA 2HN2A 4O9MA 2W9MA 4UB1A 2PXIA 3B0YA 4Z6FA 4X4PA 7ICQA 3LK9A 1TFWA 4K8VA 8ICMA 4I2CA 9ICEA 5J2IA 2O1PA 4X4SA 4UB4A 3HWTA 8ICAA 9ICQA 4XQ7A 2ZHAA 4NXWA 3RJEA 4X4RA 4F5QA 4QZCA 7ICTA 3AQMA 3B0XA 5J0XA 1ZQMA 4KLMA 3AU2A 4LEVA 4RQ5A 4KLIA 2FMPA 4NM1A 1VFGA 4WOYA 1BPEA 7ICRA 5J2KA 4MFCA 5D62A 2BCVA 4FHYA 8ICFA 1TV9A 1ZQAA 1ZQDA 5D61A 4IQWA 4K4HA 1UEUA 8ICSA 3CK6A 4FHXA 4LZGA 3AQNA 2IHMA 5D49A 4NLKA 4IG8A 4NM2A 4IQVA 8ICYA 1XSNA 4KLQA 1ZQYA 4GXJA 7ICIA 1TFYA 4RWQA 3NYBA 5B3PA 8ICQA 4EBKA 4F5OA 4K99A 4NLZA 7ICPA 4P2HA 3EF2A 1Q79A 4Z6DA 9ICNA 4PGXA 1MIYA 4KLOA 2BCSA 2PFOA 4M9NA 1NO5A 4WCWA 4KLSA 4KLUA 4UAYA 5CP2A 1WOTA 3H39A 2EWRA 5DDYA 1JMSA 1MIWA 4YN4A 3C2LA 4S3NA 7ICFA 5IIIA 2GWSA 3OGUA 2BCUA 4GXKA 4WQKA 4PH5A 3ER9B 2IUBA 2ZH6A 4XJEA 7ICOA 2PFQA 5HRIA 4XRHA 5J2DA 4DOCA 4P4OA 4PHAA 3TFSA 2ID1A 4PGYA 4R65A 5HR9A 7ICUA 5CFSA 4I2IA 1UETA 3JZ0A 4WC1A 4UB3A 1KEJA 1ZQXA 4RWOA 4I2HA 4WC6A 2DRBA 9ICBA 5CWRA 4WBYA 2M2UA 1XSLA 4PPXA 4JWNA 3C2MA 5IIJA 4FO6A 4FO1A 1HUZA 5DECA 4I28A 2HN1A 7ICMA 2FMSA 1GPJA 5D63A 1V4AA 7ICHA 1MIVA 1R8CA 5J0YA 4YMNA 3HJ1A 1ZQHA 8ICIA 2BCQA 1ZQOA 3RH5A 3C66A 4KLFA 4KLHA 3AU6A 5DBCA 5DB8A 3PNCA 9ICFA 4X0AA 4Z6EA 2DR7A 9ICGA 4KLEA 1RZTA 5JTGA 4XUSA 3OVAA 3WFPA 4QZIA 3H37A 5CFTA 3ISCA 4K97A 2FCLA 1BPDA 2GAFD 3HJ4A 4O67A 1HUOA 4O69A 4DO9A 3WFRE 9ICVA 4X4NA 5J0PA 1ZQUA 4Z6CA 5CFUA 4OAGA 4X5VA 1ZQEA 2ZH2A 5D4BA 2PFNA 5J0OA 3RJFA 3ERCC 4O5EA 4M9JA 4RWPA 4RQ1A 3OUYA 5CA7A 4AT8A 3V72A 4M47A 4E8FA 3L9DA 8ICHA 9ICIA 4HX0A 4YCXA 3WFOA 4E80A 1BPZA 4OAFA 5HRLA 4YD1A 8ICOA 7ICKA 7ICVA 2M2VA 2B56A 4QZEA 2M2WA 3TFRA 1PX5A 4I0UA 4X0BA 3V7JA 9ICXA 8ICTA 5HHHA 4JWMA 3OWGA 5J2CA 1ZQCA 2BPCA 4LEZA 1R89A 7ICJA 4FH5A 4I2EA 2VANA 8ICGA 9ICJA 3RJHA 4YMMA 4NKTA 5F2VO 4NKUA 4IQUA 4QZ9A 4PHPA 3K75D 4RQ8A 4WC2A 4O5KA 2ISOA 4I2GA 3JPSA 3PMLA 1BPXA 1KNYA 2I9GA 4P4MA 4WH5A 2DVIA 9ICTA 9ICWA 1YLQA 1VJ7A 4RQ2A 5DB7A 5CHGA 1ZJNA 7ICGA 4I2JA 2GA9D 3ER8C 4TUQA 3ISBA 2BPFA 1JQRA 5J2JA 5B3QA 4QZBA 3AUOA 3OUYB 3MDCA 5J0UA 4AT8B 4O5CA 1JAJA 4AT7A 4EGWA 4QZGA 4R64A 3RJIA 8ICZA 2BBHA 3UQ2A 8ICRA 4O68A 4UD4A 4NXTA 5HC9A 4ATBA 2ZH4A 8ICNA 4LZDA 2ZH3A 1ZQIA 4QZDA 4F5PA 1BPBA 5J2BA 1ZQSA 5J0RA 8ICUA 5J2FA 4M5DA 4PGQA 5J29A 5DBBA 8ICXA 5IIOA 8ICCA 4WBZA 3JCFA 4NXVA 3JPNA 2ZH1A 4IQTA 3GDXA 4QZAA 3MCRA 2BPGA 4F5NA 2ISPA 3JPRA 2BBJA 1ZQTA 3RH4A 3HW8A 4M9GA 9ICPA 5J0WA 4OAIZ 5HRHA 2ZH7A 4X4VA 3OV7A 4UB5A 8ICPA 4LT6A 4NLNA 5IIKA 4YD2A 4XQ8A 3C18A 2Q66A 3OVBA 9ICUA 5DKWA 5HRDA 4MKPA 4KM5A 4OAHA 9ICLA 5D46A 4WC5A 2B4VA 4K98A 2FMQA 3MDAA 3RJJA 4RQ0A 3JPPA 5HRKA 4UBCA 2PBEA 2DR8A 3C2KA 9ICRA 9ICSA 5HREA 5TZVA 4AT7B 4WC4A 3UPQA 2RFFA 5HRFA 5IINA 1MQ2A 4K4GA 8ICWA 4X4OA 4RQ7A 2DR5A 4UBBA 4WC0A 3JYYA 7ICNA 4ATBB 3OVSA 5IILA 9ICMA 3AQKA 5J2EA 2ZH8A 4K9AA 2ZH9A 4M9HA 4EV6A 1NOMA 3V7LA 4KB6A 3JPOA 5HRBA 3PMNA 5HRGA 7ICLA 4N7RA 4KLJA 3AQLA 4RWNA 4NY8A 5BOLA 4QZHA 1ZQBA 9ICHA 3ISDA 4R63A 4WC7A 3PHZA 2M2TA 5J0SA 4M9LA 1ZQJA 1RPLA 4LVSA 5CB1A 3C5GA 4MF8A 4M2YA 4RQ3A 4WQLA 4I2BA 9ICOA 4AT9A 4EBJA 4JLZA 3K7DA 3UXPA 2BCRA 3V7KA 5CR0A 5DB9A 1FA0A 1JN3A 5EOZA 2NRKA 8ICKA
chains in the Genus database with same CATH topology
2GA9D 3OWGA 3PHZA 4NXUA 3ER8C 4OAIZ 5CFSA 2IHOA 4LEZA 5CHEA 4O6AA 4K98A 5CFUA 4OAGA 4LEYA 3ERCC 4K96A 4NXWA 4K9AA 4MKPA 4KM5A 4FO1A 4LEWA 4OAHA 5B3QA 5B3PA 4WQKA 4NXVA 4LEVA 4HX0A 4WQLA 3ER9B 4KB6A 4K97A 4K9BA 4XJEA 4K99A 3MCRA 5CFTA 4NXXA 1GPJA 2B4VA 3EF2A 4OAFA 4JLZA 4WOYA 5D63A 2FCLA 3NKUA 4N7RA 5D62A 3K7DA 2B56A 4WH5A 4JLXA 2B51A 2GAFD 4O68A 5D61A 4NXTA 4O67A 4K8VA 4O69A 2EWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH5 A;  4XJE A;  2EWR A;  5CFT A;  5CFS A;  4FO1 A;  2FCL A;  5CFU A;  4WQK A;  4HX0 A;  4WQL A; 
#chains in the Genus database with same CATH topology
 4I2F A;  3H3A A;  1ZJM A;  8ICE A;  3RH6 A;  1BPY A;  4M04 A;  5CHE A;  4RPZ A;  2DRA A;  5J2H A;  1R8B A;  8ICV A;  4F5R A;  1ZQK A;  4UB2 A;  1F5A A;  3NWI A;  3JPQ A;  1ZQW A;  3UQ0 A;  4TUR A;  5CJ7 A;  3UXN A;  4RQ6 A;  4FHW A;  1OU5 A;  3MGH A;  9ICA A;  4JLX A;  1Q78 A;  4P4P A;  4RT3 A;  1TVA A;  4EED A;  4XA5 A;  4RQ4 A;  2IHO A;  4TUP A;  5DBA A;  2ZHB A;  3C5F A;  3HIY A;  4O6A A;  4DOB A;  4RT2 A;  4MF2 A;  4X4Q A;  3RJG A;  3LQC B;  7ICE A;  2P66 A;  4RPY A;  5J2A A;  9ICC A;  4QZF A;  4PHE A;  4NXX A;  7ICS A;  2O5A A;  4MFF A;  4NXZ A;  1ZQQ A;  5HHI A;  4AT9 B;  4EP7 A;  3WFS C;  1ZQZ A;  5IIM A;  4M0A A;  5DDM A;  4KLT A;  2HHP A;  4R66 A;  9ICK A;  5BPC A;  4E7X A;  1ZQL A;  5J0Q A;  4NXU A;  4WC3 A;  3H38 A;  4KLD A;  4UAZ A;  1ZQR A;  4MFA A;  3NVO A;  4KLG A;  2BE3 A;  4DOA A;  1ZQP A;  4X4T A;  4K96 A;  5J2G A;  3RJK A;  4I29 A;  1ZQN A;  1ZQV A;  8ICL A;  2ZH5 A;  3UXO A;  4I27 A;  4LEY A;  4K9B A;  4K4I A;  4GXI A;  1ZQF A;  3UPS A;  3WFQ E;  2PFP A;  4PHD A;  2B51 A;  4I2A A;  3MBY A;  1UEV A;  5DED A;  4UAW A;  5DB6 A;  4FHP A;  4KLL A;  4EEB A;  1R8A A;  1MQ3 A;  4YMO A;  1KDH A;  5J0T A;  8ICB A;  1XSP A;  4LEW A;  4RPX A;  5BOM A;  4QZ8 A;  8ICJ A;  4X4U A;  2DR9 A;  4FH3 A;  4FHV A;  4UD5 A;  3MGI A;  1ZQG A;  4I2D A;  3HX0 A;  4TUS A;  3NKU A;  3JPT A;  2HN2 A;  4O9M A;  2W9M A;  4UB1 A;  2PXI A;  3B0Y A;  4Z6F A;  4X4P A;  7ICQ A;  3LK9 A;  1TFW A;  4K8V A;  8ICM A;  4I2C A;  9ICE A;  5J2I A;  2O1P A;  4X4S A;  4UB4 A;  3HWT A;  8ICA A;  9ICQ A;  4XQ7 A;  2ZHA A;  4NXW A;  3RJE A;  4X4R A;  4F5Q A;  4QZC A;  7ICT A;  3AQM A;  3B0X A;  5J0X A;  1ZQM A;  4KLM A;  3AU2 A;  4LEV A;  4RQ5 A;  4KLI A;  2FMP A;  4NM1 A;  1VFG A;  4WOY A;  1BPE A;  7ICR A;  5J2K A;  4MFC A;  5D62 A;  2BCV A;  4FHY A;  8ICF A;  1TV9 A;  1ZQA A;  1ZQD A;  5D61 A;  4IQW A;  4K4H A;  1UEU A;  8ICS A;  3CK6 A;  4FHX A;  4LZG A;  3AQN A;  2IHM A;  5D49 A;  4NLK A;  4IG8 A;  4NM2 A;  4IQV A;  8ICY A;  1XSN A;  4KLQ A;  1ZQY A;  4GXJ A;  7ICI A;  1TFY A;  4RWQ A;  3NYB A;  5B3P A;  8ICQ A;  4EBK A;  4F5O A;  4K99 A;  4NLZ A;  7ICP A;  4P2H A;  3EF2 A;  1Q79 A;  4Z6D A;  9ICN A;  4PGX A;  1MIY A;  4KLO A;  2BCS A;  2PFO A;  4M9N A;  1NO5 A;  4WCW A;  4KLS A;  4KLU A;  4UAY A;  5CP2 A;  1WOT A;  3H39 A;  2EWR A;  5DDY A;  1JMS A;  1MIW A;  4YN4 A;  3C2L A;  4S3N A;  7ICF A;  5III A;  2GWS A;  3OGU A;  2BCU A;  4GXK A;  4WQK A;  4PH5 A;  3ER9 B;  2IUB A;  2ZH6 A;  4XJE A;  7ICO A;  2PFQ A;  5HRI A;  4XRH A;  5J2D A;  4DOC A;  4P4O A;  4PHA A;  3TFS A;  2ID1 A;  4PGY A;  4R65 A;  5HR9 A;  7ICU A;  5CFS A;  4I2I A;  1UET A;  3JZ0 A;  4WC1 A;  4UB3 A;  1KEJ A;  1ZQX A;  4RWO A;  4I2H A;  4WC6 A;  2DRB A;  9ICB A;  5CWR A;  4WBY A;  2M2U A;  1XSL A;  4PPX A;  4JWN A;  3C2M A;  5IIJ A;  4FO6 A;  4FO1 A;  1HUZ A;  5DEC A;  4I28 A;  2HN1 A;  7ICM A;  2FMS A;  1GPJ A;  5D63 A;  1V4A A;  7ICH A;  1MIV A;  1R8C A;  5J0Y A;  4YMN A;  3HJ1 A;  1ZQH A;  8ICI A;  2BCQ A;  1ZQO A;  3RH5 A;  3C66 A;  4KLF A;  4KLH A;  3AU6 A;  5DBC A;  5DB8 A;  3PNC A;  9ICF A;  4X0A A;  4Z6E A;  2DR7 A;  9ICG A;  4KLE A;  1RZT A;  5JTG A;  4XUS A;  3OVA A;  3WFP A;  4QZI A;  3H37 A;  5CFT A;  3ISC A;  4K97 A;  2FCL A;  1BPD A;  2GAF D;  3HJ4 A;  4O67 A;  1HUO A;  4O69 A;  4DO9 A;  3WFR E;  9ICV A;  4X4N A;  5J0P A;  1ZQU A;  4Z6C A;  5CFU A;  4OAG A;  4X5V A;  1ZQE A;  2ZH2 A;  5D4B A;  2PFN A;  5J0O A;  3RJF A;  3ERC C;  4O5E A;  4M9J A;  4RWP A;  4RQ1 A;  3OUY A;  5CA7 A;  4AT8 A;  3V72 A;  4M47 A;  4E8F A;  3L9D A;  8ICH A;  9ICI A;  4HX0 A;  4YCX A;  3WFO A;  4E80 A;  1BPZ A;  4OAF A;  5HRL A;  4YD1 A;  8ICO A;  7ICK A;  7ICV A;  2M2V A;  2B56 A;  4QZE A;  2M2W A;  3TFR A;  1PX5 A;  4I0U A;  4X0B A;  3V7J A;  9ICX A;  8ICT A;  5HHH A;  4JWM A;  3OWG A;  5J2C A;  1ZQC A;  2BPC A;  4LEZ A;  1R89 A;  7ICJ A;  4FH5 A;  4I2E A;  2VAN A;  8ICG A;  9ICJ A;  3RJH A;  4YMM A;  4NKT A;  5F2V O;  4NKU A;  4IQU A;  4QZ9 A;  4PHP A;  3K75 D;  4RQ8 A;  4WC2 A;  4O5K A;  2ISO A;  4I2G A;  3JPS A;  3PML A;  1BPX A;  1KNY A;  2I9G A;  4P4M A;  4WH5 A;  2DVI A;  9ICT A;  9ICW A;  1YLQ A;  1VJ7 A;  4RQ2 A;  5DB7 A;  5CHG A;  1ZJN A;  7ICG A;  4I2J A;  2GA9 D;  3ER8 C;  4TUQ A;  3ISB A;  2BPF A;  1JQR A;  5J2J A;  5B3Q A;  4QZB A;  3AUO A;  3OUY B;  3MDC A;  5J0U A;  4AT8 B;  4O5C A;  1JAJ A;  4AT7 A;  4EGW A;  4QZG A;  4R64 A;  3RJI A;  8ICZ A;  2BBH A;  3UQ2 A;  8ICR A;  4O68 A;  4UD4 A;  4NXT A;  5HC9 A;  4ATB A;  2ZH4 A;  8ICN A;  4LZD A;  2ZH3 A;  1ZQI A;  4QZD A;  4F5P A;  1BPB A;  5J2B A;  1ZQS A;  5J0R A;  8ICU A;  5J2F A;  4M5D A;  4PGQ A;  5J29 A;  5DBB A;  8ICX A;  5IIO A;  8ICC A;  4WBZ A;  3JCF A;  4NXV A;  3JPN A;  2ZH1 A;  4IQT A;  3GDX A;  4QZA A;  3MCR A;  2BPG A;  4F5N A;  2ISP A;  3JPR A;  2BBJ A;  1ZQT A;  3RH4 A;  3HW8 A;  4M9G A;  9ICP A;  5J0W A;  4OAI Z;  5HRH A;  2ZH7 A;  4X4V A;  3OV7 A;  4UB5 A;  8ICP A;  4LT6 A;  4NLN A;  5IIK A;  4YD2 A;  4XQ8 A;  3C18 A;  2Q66 A;  3OVB A;  9ICU A;  5DKW A;  5HRD A;  4MKP A;  4KM5 A;  4OAH A;  9ICL A;  5D46 A;  4WC5 A;  2B4V A;  4K98 A;  2FMQ A;  3MDA A;  3RJJ A;  4RQ0 A;  3JPP A;  5HRK A;  4UBC A;  2PBE A;  2DR8 A;  3C2K A;  9ICR A;  9ICS A;  5HRE A;  5TZV A;  4AT7 B;  4WC4 A;  3UPQ A;  2RFF A;  5HRF A;  5IIN A;  1MQ2 A;  4K4G A;  8ICW A;  4X4O A;  4RQ7 A;  2DR5 A;  4UBB A;  4WC0 A;  3JYY A;  7ICN A;  4ATB B;  3OVS A;  5IIL A;  9ICM A;  3AQK A;  5J2E A;  2ZH8 A;  4K9A A;  2ZH9 A;  4M9H A;  4EV6 A;  1NOM A;  3V7L A;  4KB6 A;  3JPO A;  5HRB A;  3PMN A;  5HRG A;  7ICL A;  4N7R A;  4KLJ A;  3AQL A;  4RWN A;  4NY8 A;  5BOL A;  4QZH A;  1ZQB A;  9ICH A;  3ISD A;  4R63 A;  4WC7 A;  3PHZ A;  2M2T A;  5J0S A;  4M9L A;  1ZQJ A;  1RPL A;  4LVS A;  5CB1 A;  3C5G A;  4MF8 A;  4M2Y A;  4RQ3 A;  4WQL A;  4I2B A;  9ICO A;  4AT9 A;  4EBJ A;  4JLZ A;  3K7D A;  3UXP A;  2BCR A;  3V7K A;  5CR0 A;  5DB9 A;  1FA0 A;  1JN3 A;  5EOZ A;  2NRK A;  8ICK A; 
#chains in the Genus database with same CATH homology
 2GA9 D;  3OWG A;  3PHZ A;  4NXU A;  3ER8 C;  4OAI Z;  5CFS A;  2IHO A;  4LEZ A;  5CHE A;  4O6A A;  4K98 A;  5CFU A;  4OAG A;  4LEY A;  3ERC C;  4K96 A;  4NXW A;  4K9A A;  4MKP A;  4KM5 A;  4FO1 A;  4LEW A;  4OAH A;  5B3Q A;  5B3P A;  4WQK A;  4NXV A;  4LEV A;  4HX0 A;  4WQL A;  3ER9 B;  4KB6 A;  4K97 A;  4K9B A;  4XJE A;  4K99 A;  3MCR A;  5CFT A;  4NXX A;  1GPJ A;  2B4V A;  3EF2 A;  4OAF A;  4JLZ A;  4WOY A;  5D63 A;  2FCL A;  3NKU A;  4N7R A;  5D62 A;  3K7D A;  2B56 A;  4WH5 A;  4JLX A;  2B51 A;  2GAF D;  4O68 A;  5D61 A;  4NXT A;  4O67 A;  4K8V A;  4O69 A;  2EWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...