4NLZA

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template 8brg and incoming gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
323
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 109
structure length 323
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlzA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlzA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlzA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlzA03
2DPIA 4M9JA 2IHNA 1DOQA 1NKCA 2RFFA 4LVSA 1BPXA 5DLFA 5BOMA 3NYBA 5HC9A 4UAYA 2ISOA 4KLQA 2JZBB 5KFZA 1ZQAA 5KFNA 4HYKA 3RR8A 3K4GA 5KFVA 1MQ3A 4E7XA 5KG4A 1V9PA 2XC9A 3V7LA 1ZQJA 1A77A 1XSPA 4DSJA 2P6UA 4QZBA 4KLJA 5KFHA 2DR7A 3JPPA 3Q8SB 3H40A 1JXLA 1KSPA 4X4TA 3EWAA 8ICAA 4QWAA 3OJSA 4YG2A 4UBCA 4DSFA 3RJGA 3OUYA 3RJEA 4ED8A 2BDPA 4I2AA 4KITB 1SL1A 2PFNA 4FHXA 1ZQKA 4DQSA 4DL3A 3ZDAA 2BR0A 3EPGA 2XGQA 4K4GA 4F5PA 1ZQFA 3PW5A 1NOMA 4EBCA 9ICKA 5J2JA 2M2UA 1S97A 1WCNA 5KFRA 3JPSA 1TFYA 4RWQA 3C2LA 2W9MA 3JPTA 4E0DA 3RBEA 2HHTA 9ICLA 4X0AA 1B22A 2W8LA 4BXOA 3GIJA 3PW0A 3WFSC 2C2EA 4O3NA 3M9OB 4I2DA 5DBAA 4LT6A 4RQ7A 2DRBA 4PHEA 4I2BA 2IBKA 4KLHA 4DQQA 8ICQA 3EZ5A 3BQ2A 4RUAA 4BDPA 2UVVA 3MFIA 4MF2A 1JAJA 4X4RA 1ZQWA 5L1IA 2ATLA 2VA2A 4X4NA 4E8FA 3HX0A 2MUTB 3AQLA 1XS9D 4IR1A 3IM1A 1TK8A 3LQCB 4DLEA 8ICRA 4EBKA 2ZTCA 2DFLA 3JPNA 2JEGA 3RJKA 4O3RA 5HREA 5D4BA 4DFMA 1NK6A 4QWEA 9ICGA 3EW9A 5CA7A 5HRKA 3ISCA 9ICQA 4NM2A 3OGUA 3GIMA 1ZQUA 2FLNA 2IMWP 3BJYA 8ICBA 2HHVA 5HRBA 3SV3A 5KT4A 4R65A 4JWNA 4I2CA 3BDPA 3RH5A 3PX0A 3HJ1A 4AT7B 5HRDA 4DOAA 1JMSA 4NY8A 3ZDBA 7ICNA 1JQRA 1BPDA 3OJUA 4GC6A 5DDYA 4RQ0A 4F4KA 5L9XA 1X2IA 3PW7A 4B9MA 4IR9A 4FHVA 1NK8A 4UD5A 5KFIA 3UQ2A 4QZIA 4RQ4A 1UT8A 3SI8A 5KFFA 3KTQA 3K75D 1RZTA 9ICNA 4F5RA 1KDHA 4JV2A 1KEJA 4I28A 4M47A 3V7JA 2R8GA 1MIYA 3ISDA 3GV7B 2ZH3A 4UQGA 5KFEA 5DBCA 1QSSA 4DL5A 1YLQA 1XSLA 4KLTA 8ICWA 3Q8PB 8ICNA 1F5AA 4S3NA 3ZDEA 3Q8RB 5EWEA 1ZQBA 5J0XA 5KFQA 4QWCA 4M6WB 4J9NA 3OV7A 5DB8A 4PHAA 3UQ0A 1QSLA 3ETLA 4X4QA 4YVZA 1TFWA 4YCXA 5KT7A 2XCPA 4KTQA 1U49A 4DQIA 4O9MA 8ICGA 1U47A 2HHQA 2VANA 1T4GA 4DOBA 2KFNA 5HP4A 2BKEA 3JPRA 1S0NA 4DQPA 4UAWA 2FMQA 4K4IA 5J2DA 4EBJA 5EWFA 3RAQA 4QZGA 4F3OA 4UBBA 5KFKA 2B21A 5J2AA 5J2GA 3LWLA 3KHHA 3Q8LA 1RXVA 4KLGA 3H8SA 5DBBA 3THVA 5KG6A 1T8EA 3GQCA 2GWSA 3QZ8A 4NKUA 4TQRA 5HRGA 4J9LA 3OVSA 2I1QA 2UVWA 8ICZA 2M9NA 3B0YA 4FO6A 4DFJA 3SV4A 4K4HA 4DL2A 2NRXA 4O5EA 8ICCA 4IQTA 1UEVA 3QEAZ 4ECVA 4I2JA 4DO9A 1ZQHA 2BPGA 3C1ZA 7ICUA 3PVXA 3MDAA 2F1JA 5J2IA 3TARA 4IRDA 4KLMA 4YR2A 3GDXA 3M9MB 2PXIA 4IQVA 4RQ2A 2R8JA 1ZQVA 2BCSA 4NLNA 5KFDA 4F50A 4ATBA 4ECQA 4UB1A 4XQ7A 5DEDA 2Q66A 5IILA 2HHWA 4IG8A 4I2FA 1B43A 1IXRA 5KFBA 2BQ3A 1ZQGA 3C2MA 5KFSA 5CJ7A 4DF8A 1JIHA 4DFKA 4R63A 4RQ8A 4I2HA 9ICRA 1NO5A 2BGWA 5HHHA 2ZH5A 5KT6A 3T5HA 1S77D 3BQTA 3HPOA 3MGHA 4PGQA 4R8UB 9ICBA 1MC8A 4DL6A 4E80A 3H4BA 4TUQA 2R8IA 4DLGA 5J2FA 2LYHA 4GLXA 2IA6A 3PMNA 3G6VA 4ECXA 3SYZA 4DSEA 2J6TA 5HR9A 5J0PA 3LWMA 3TAQA 3H38A 4NLKA 1SL2A 3UXNA 1NJYA 4QWBA 3PW2A 4XUSA 2ZH2A 5D49A 3UXPA 4EP7A 1BPYA 2RDJA 2AGQA 1OU5A 4AT9B 3C18A 2P6RA 1KLNA 1N56A 1VFGA 5KFLA 3OHAA 4TQSA 1SKRA 2DR8A 5J2KA 1NZPA 3M9NB 2AGPA 2M2VA 3RH6A 1SZPA 1BGXT 4NLGA 3OHBA 4YD2A 4XRHA 4KN4A 5KFUA 3C5GA 4O5CA 2ZH4A 3RRGA 1NK9A 4P4OA 4WC4A 1XU4A 3H4DA 2FMSA 8ICXA 7ICMA 4ECRA 1ZQXA 4DL7A 1T3NA 4PGXA 1ZYQA 3GV8B 4I2EA 4Z6FA 4O3PA 4TURA 3RJIA 5HRIA 4F4ZA 3WFQE 4XQ8A 8ICHA 1ZQZA 3L9DA 5J0TA 1IM4A 1UT5A 9ICPA 4R66A 5DGAA 4ELTA 4I29A 3ISBA 4KLFA 1S0MA 2ZHAA 5KT3A 2V4RA 5KFMA 9ICFA 2NRVA 4WBYA 2BPFA 5IIMA 3ZD8A 4ECTA 2W9BA 2Y1IA 2I9GA 2W9AA 2XY5A 3RB6A 4F8RA 4JV1A 1SKWA 4M9HA 2AQ0A 2O1PA 4X4PA 1Z00A 1U48A 3TFRA 1ZQPA 8ICUA 2DR5A 4IRKA 1NJWA 1H38A 3PY8A 4X4VA 2OWOA 4YR0A 2HHSA 5HMLA 1D8LA 3JPOA 3RTVA 4FS2A 1SL0A 3T5LA 3AQKA 4DQRA 3M8RA 5KG0A 4CCHA 3G6XA 5IIIA 4WC2A 3C5FA 3RRHA 2ZUDA 1N48A 2BE3A 3T3FA 1TAQA 1AROP 4Z6EA 3PW4A 4M6WA 4MEXA 4UB5A 3H37A 3MR6A 3TANA 1C7YA 2F1HA 4M5DA 1A76A 2ISPA 4TUSA 2ASJA 3N97B 4BXOB 3H8JA 4YXMA 4J9MA 5J2BA 4Q44A 1K1SA 1NJZA 1L3SA 4ELVA 4QZCA 4BGDA 5J2CA 1NK5A 4B9VA 3RAXA 2JEJA 4ECWA 4I2IA 7ICTA 3MR5A 4QZEA 5CWRA 4QWDA 2FLLA 1XC9A 4RQ1A 4YQWA 5CR0A 2ZUCA 5F9LA 3MBYA 3UPQA 3RB0A 4C8OA 3H3AA 4RWNA 1UETA 1ZETA 3JZ0A 1ZJMA 2BCUA 1LV5A 4RNNA 3OVBA 1DK2A 4KLUA 1ZQEA 1UEUA 4RWPA 9ICHA 4B9TA 5J29A 4YFKA 5DG7A 1L5UA 2A1JA 1ZQQA 2P66A 7ICJA 4J9QA 2VA8A 1HUOA 4RQ3A 1XO1A 3KHGA 4X5VA 4YD1A 3PX4A 2ZH7A 4YMNA 7ICRA 2C28A 2KP7A 9ICTA 2DR9A 5J0QA 4GXJA 5HMMA 2C22A 5DQHA 5DGBA 3MFHA 5J0RA 4PH5A 4J9SA 4F4XA 5IINA 1WCLA 7ICQA 3QEBZ 2PBEA 4FHWA 4X0BA 2ZH1A 1KFDA 4UB3A 2ZH9A 1MIVA 3NGDA 4GC7A 2V4QA 4M9NA 1MIWA 3UPSA 2ALZA 1TK0A 4DEZA 2PI5A 4BWJA 4EBEA 1X9WA 7ICPA 1BPEA 1EXNA 5KTQA 5L1LA 9ICEA 4QW8A 4PGYA 1RYSA 3RJHA 2W9CA 3Q8QB 4BWMA 4AT8A 4WCWA 7ICVA 4G3IA 3RBDA 2ZHBA 8ICIA 2PFOA 5IIKA 3RH4A 4DSIA 3HIYA 1TKDA 3PMLA 5J0WA 4DS4A 2FPKA 4QZAA 2JZBA 1NK0A 3MR3A 1ZQSA 5KG1A 5DB6A 1BVSA 2XCAA 3KHLA 3KHRA 4C8KA 4F92B 3GIIA 2AQ4A 5DKWA 4DFPA 4QZHA 3IHQB 5IIJA 3Q8KA 1ZQCA 4ECUA 4ELUA 4XA5A 4PPXA 2XO7A 9ICCA 1FA0A 5EOZA 2ZH6A 2KZZA 4MFAA 1UA1A 2R8HA 4DF4A 2PFPA 4ZH4A 3PV8A 9ICXA 5BOLA 4QZ9A 4FBTA 4IQWA 2ZUBA 4DOCA 1U4BA 4ED2A 8ICTA 4J9KA 2HHUA 3WFOA 5L1KA 1S9FA 2DPJA 1QLNA 1R8AA 3C66A 4DSLA 1S10A 3FYHA 7ICLA 3RJJA 4UB2A 5C5JA 5KT5A 5KFCA 3LK9A 3LDAA 1X9SA 9ICUA 3WFRE 4KMUA 2DRAA 2BQRA 3H39A 1CUKA 2KFZA 9ICOA 4RWOA 4X4SA 4NXZA 3HT3A 3PO5A 3B0XA 4QW9A 1DGSA 7ICIA 2R8KA 4WBZA 4DSKA 5DQGA 1JX4A 4FH3A 1D9DA 1VJ7A 1RPLA 2WTFA 3QE9Y 4F2SA 2HVHA 4RNMA 2PI4A 1TAUA 9ICJA 3C21A 4LZGA 8ICPA 5DLGA 1R89A 4EYIB 3RB3A 4J9RA 3AQNA 4M9LA 4UAZA 2MUTA 1L3UA 7ICOA 4B9UA 9ICWA 4UD4A 4ATBB 5DB9A 3PNCA 2ZTDA 5F9NA 1RXWA 4O5KA 9ICSA 2J6UA 1BNPA 2RDIA 1ZQLA 5KFTA 4JK1A 3AUOA 1LB2B 2V9WA 3PO4A 4FH5A 1COOA 4FHPA 1Y88A 4Q8FA 1KNYA 2DVIA 4YP3A 4RUCA 2BQUA 1KFTA 3ORYA 3TI0A 2UVRA 5J2EA 8ICOA 4F91B 1TVAA 7ICFA 4Z6CA 4FHYA 2NRZA 3V72A 1DK3A 4F2RA 3FDSA 1XWLA 2H5XA 2XGPA 4AT7A 1ZQDA 5L1JA 3PR4A 1T7PA 5KG7A 4Q8EA 3V6HA 2W8KA 4MFCA 2AJQA 4YXJA 1QTMA 4GXKA 2AU0A 5J0UA 2ASDA 8ICMA 4F93B 3SZ2A 1MSWD 7ICHA 8ICKA 1PX5A 4MFFA 5DB7A 2XY6A 2KZ3A 1TV9A 4MF8A 3OUYB 3GIKA 3PX6A 3MGIA 5KFYA 3V6KA 4WC0A 4X4OA 2FLPA 1MQ2A 4F5NA 4WC5A 5KFAA 2MAXA 5KG3A 3TAPA 1ZJNA 5DG8A 2HVIA 3HJ4A 3GFKB 5KT2A 5DDMA 1Z3EB 4RT3A 5D46A 3HW8A 3G6YA 4B9LA 3E2EA 5HRHA 4WC3A 4UB4A 2FPLA 4Q45A 4I27A 1ZQMA 4DWIA 1S76D 5CP2A 4NM1A 5IIOA 1ZQIA 4O3QA 3UXOA 2XY7A 4RQ6A 3T5JA 1TK5A 7ICGA 2JEIA 1NK7A 2C2RA 2FMPA 5DECA 3MR2A 5CHGA 2ZTEA 4TUPA 3AU6A 3QZ7A 4ED7A 1XSNA 2HHXA 2NRKA 1R8CA 4YMMA 1R8BA 4NKTA 5CB1A 4ECYA 2UVUA 4M04A 5HRLA 5KG2A 4JWMA 5BPCA 4P4MA 3PR5B 4KLDA 2BCRA 4KLIA 2HHPA 2ID1A 3H7IA 1SKSA 4YMOA 3HWTA 1K1QA 1D8YA 3OVAA 3MDCA 5F2VO 4RPZA 2ASLA 4KN7A 3RJFA 4O3OA 2W9BB 1ZQOA 2M2WA 4ED0A 1NJXA 2O5AA 2BCVA 5DG9A 3V6JA 1U9LA 4ECZA 4ED1A 9ICVA 4EEYA 4X4UA 1S0OA 1ZQRA 2KTQA 4B9SA 3V7KA 1ZQNA 1Z00B 1CEZA 1PZNA 4YN4A 2Q0ZX 4C8LA 5KFOA 2J6SA 3AQMA 1QSYA 2ZH8A 3BQ1A 5EWGA 5J2HA 4RU9A 4ECSA 4B9NA 1X9MA 4MEYA 2ZJ5A 8ICVA 1Q78A 9ICAA 4C8NA 4FS1A 1KRPA 4O3SA 2KZMA 1V4AA 3H8WA 5DQIA 1NK4A 2ZJ8A 1NKBA 1KTQA 4LZDA 5HHIA 5KG5A 2KN7A 4DL4A 3RB4A 1U45A 2BCQA 4I2GA 4Q43A 4C8MA 4RQ5A 3EYZA 3Q8MA 3BQ0A 3TFSA 1UA0A 4WC1A 3OSPA 4P4PA 1D9FA 3C2KA 8ICJA 2NRWA 2ZJAA 5JUMA 4EZ9A 4M0AA 4F4YA 4EBDA 2M2TA 4PHDA 4R8UA 4P2HA 1L3TA 4IRCA 4Z6DA 1S0VA 4ED6A 5J0YA 5KFPA 3JYYA 4RZRA 3M8SA 3JPQA 1HUZA 2AGOA 4KLLA 8ICSA 9ICIA 7ICEA 4F4WA 2FPMA 3C1YA 2BHNA 4DS5A 2PFQA 3MABA 4QZDA 1HJPA 2VA3A 4KLEA 3OSNA 2HW3A 3GILA 3TQ1A 4JUZA 1BPZA 3ZDDA 4EZ6A 9ICMA 4QZ8A 2NRTA 5HRFA 4NLZA 2A1JB 2F1IA 2Y1JA 5KFJA 1Q79A 3WFPA 2C2DA 8ICEA 4JV0A 4AT9A 1JXEA 5HNKA 4M9GA 5KFGA 1BPBA 4F5QA 1L3VA 4RT2A 4IQUA 4R64A 2BPCA 4F5OA 4WC6A 4J9PA 2IHMA 1WOTA 8ICYA 8ICFA 3ZDCA 3GV5B 4WC7A 5J0OA 8ICLA 1KFSA 1JN3A 1BNOA 3AU2A 4QZFA 4GXIA 4ED3A 4EYHB 5TZVA 4RPXA 3T5KA 3ZD9A 2JEFA 4M2YA 3NTUA 4PHPA 3N4MB 7ICKA 1ZQYA 1TFRA 3RR7A 4KLOA 4KLSA 5J0SA 4YR3A 5KFXA 3HP6A 3C23A 2W9CB 3EPIA 4J9OA 1RYRA 1NKEA 4FBUA 7ICSA 4RPYA 4AT8B 5KFWA 1ZQTA 4O0IA 4RNOA
chains in the Genus database with same CATH superfamily
4M9JA 5AHXA 1NKCA 4PL1A 3F2CA 5CFSA 5DLFA 2E8NA 5BOMA 3NYBA 3KD3A 2ISOA 5HC9A 3KKAA 2H3FA 4HYKA 5KFVA 2XC9A 1A77A 4C7ZA 2P6UA 4QZBA 4GIBA 3Q8SB 4EGWA 4X4TA 1N63A 8ICAA 4QWAA 3OJSA 4YG2A 4UBCA 3OUYA 3RJGA 2BDPA 4FHXA 1NZBA 1ZQKA 4PZOA 3SMVA 1NOMA 4EBCA 9ICKA 1YT3A 5KFRA 2C2EA 2KVSA 4I2DA 3AEVA 4I2BA 8ICQA 2YB4A 2OHFA 3MFIA 4KB6A 1JAJA 1ZQWA 5L1IA 2ATLA 2VA2A 4X4NA 4U7CA 3HX0A 2MUTB 2KICA 3IM1A 3LQCB 1X6IA 4DLEA 4EBKA 1ZD3A 2KHQA 2YMQA 2Y0SC 5HRKA 1ZQUA 2HHVA 4B6JA 3HJ1A 2P35A 4AT7B 5HRDA 4FZMA 1JMSA 7ICNA 4O67A 2LPEA 4F4KA 3PW7A 1X2IA 4IR9A 4FHVA 4QZIA 3KTQA 4JV2A 1MN8A 2D3DA 4KLTA 8ICNA 3Q8RB 5J0XA 1SWVA 1QQ7A 3KBBA 2QARB 3LYSA 4O6AA 4KTQA 4DQIA 8ICGA 2GAFD 2HHQA 2BKEA 2RLTA 1N5WA 1WYGA 4EBJA 2ES6A 3CRXA 4F3OA 2WF8A 1RXVA 4CF4A 3H8SA 5KG6A 4TQRA 3RFAA 2UVWA 1WOTA 3SV4A 8ICCA 1UEVA 4IQTA 4I2JA 4DO9A 7ICUA 3C1ZA 3D2NA 4BUGA 5J2IA 4KLMA 2AXTU 4OAGA 4Y2VA 5J8YC 4IQVA 4NLNA 5D61A 5KFDA 2HOFA 2DF4B 3DDHA 4C4RA 4IL6U 1B43A 2BQ3A 3HRDD 5AICA 3C29A 5CJ7A 4DFKA 4I2HA 2BGWA 4R8UB 9ICBA 3N7RC 4GLXA 4UARA 4UB8U 3LWMA 3TAQA 1SL2A 3WU2U 3UXNA 2B6GA 2ZH2A 3PSTA 5AI8A 3C18A 2P6RA 3OHAA 3AM9A 4Y2PA 1SKRA 2DR8A 4QJFB 2AGPA 5AKYA 1BGXT 2HBJA 1Q8KA 3OHBA 4XRHA 4KN4A 4K9AA 2ZH4A 4P4OA 4WC4A 5GTIU 7ICMA 4LEVA 1RQLA 4PGXA 3GV8B 4Z6FA 2HOIA 1L8OA 3UMBA 2KIWA 5C0YA 1NNLA 2W9BA 3RB6A 2CRXA 1SKWA 3LVVA 2O1PA 2DR5A 8ICUA 1ED1A 3BQ7A 1NJWA 5AI9A 3WK4A 4YR0A 2EAOA 1VDVA 1SL0A 2HMXA 4CCHA 2EZZA 3C5FA 3RRHA 4K97A 3PW4A 1AROP 4Z6EA 3H37A 1QQ6A 1P7DA 3ALRA 1NJZA 1K1SA 2KFNA 1L3SA 4K4IA 4EP7A 2JEJA 4ECWA 7ICTA 4Y2YA 3WKCA 3MBYA 4C8OA 4RWNA 1UETA 1ZETA 2KSOB 2OXOA 5AKLA 2KIVA 1ZQQA 2K4EA 2JR5A 1XO1A 2VKQA 4RQ3A 5AK3A 7ICRA 1HIWA 9ICTA 2DR9A 4GXJA 5AKJA 3MFHA 4J9SA 2ZH9A 2ZH1A 5AM5A 4GC7A 4M9NA 2QLTA 3FM9A 5AIBA 3KFUF 4PGYA 4G3IA 8ICIA 2PFOA 4IS7A 1TKDA 2N1RA 4QZAA 1F5SA 2JZBA 2HOQA 1RG6A 4OCZA 4OO1J 3KHRA 3KHLA 4F92B 4KMOB 4DFPA 4ECUA 2XO7A 4G9BA 2ZH6A 3OTQA 2HHUA 1S9FA 5HR7A 1S10A 3RJJA 5KT5A 1X9SA 4KMUA 9ICOA 3PO5A 3B0XA 2R8KA 1RPLA 3QE9Y 2AH5A 1TAUA 9ICJA 4LZGA 1R89A 4EYIB 4J9RA 4UAZA 4P0QA 3SR6A 3PNCA 4WQLA 2V9WA 3PO4A 4Q8FA 3N7PD 4RUCA 3ORYA 3TI0A 5L1MA 3HJEA 2Y9UA 3FDSA 2XGPA 3IDWA 1ZQDA 3V6HA 4MFCA 4NXXA 2A19A 4OAIZ 2AU0A 4F93B 1YZ7A 3SZ2A 4LEZA 1PX5A 5ALJA 5DB7A 2KZ3A 3PX6A 3QU5A 3V6KA 4X4OA 4WC5A 5KFAA 2MAXA 1ZJNA 3HJ4A 3IG8A 3NVZA 3WKDA 2VIXA 3BZCA 5HRHA 4DFDA 2GO7A 5K4LA 5CP2A 4NM1A 7ICGA 1DRGA 5DECA 3MR2A 1XSNA 3QZ7A 5CFUA 1R8BA 5CB1A 1SV0A 4JWMA 5BPCA 5ALNA 5ALYA 4OAHA 2HHPA 4YMOA 3HWTA 3AN1A 3MDCA 2WAQC 1GPJA 4KN7A 1ZRMA 4ICAA 4ECZA 9ICVA 4B9SA 5ALKA 3V7KA 1SV4A 1QSYA 4KX3A 2ZH8A 1Q78A 4RU9A 1X9MA 5AK5A 2JXJA 3EYZA 2K4HA 3Q8MA 3TFSA 1OW5A 5JUMA 4M0AA 2JRZA 4F4YA 5JTGA 5E79U 4ED6A 4RZRA 1HUZA 9ICIA 2HSZA 1V38A 2FPMA 2BHNA 2I6XA 1SB3C 2WF9A 2VA3A 4KLEA 3TQ1A 1BPZA 4JUZA 3M7DA 4NLZA 2IHOA 2ZXIA 1WWVA 1JXEA 2DUYA 5HNKA 3F5AA 1BPBA 2IHMA 4OJ5A 2A1AA 4CF5A 1BNOA 3AU2A 5AKGA 4RPXA 3ZD9A 4BX9C 4YR3A 4FBUA 3C23A 1NKEA 3QUBA 5AM0A 4O0IA 4OJ6A 2HI0A 4UAYA 1ZQAA 3RR8A 2MA1A 4E7XA 1ZQJA 1UQVA 1F0MA 4USAA 3V7LA 5KAIU 2JH7A 4DSFA 3NASA 4O68A 4KITB 1SL1A 2Q4TA 4DQSA 3PSPA 3ZDAA 2BR0A 4K4GA 4F5PA 5J2JA 1S97A 1WCNA 1TFYA 3C2LA 4E0DA 2HHTA 9ICLA 1B22A 5AM4A 4BXOA 3WFSC 4O3NA 4RQ7A 2IBKA 4KLHA 4RQNA 4X4RA 2I5HA 1XS9D 4IR1A 8ICRA 2E8PA 2E1EA 2ZIWB 2DFLA 3JPNA 2JEGA 5D4BA 1L8LA 4QWEA 3EW9A 4UAUA 4F72A 8ICBA 3GIMA 2FLNA 1Z1BA 4JWNA 4NJ8A 1BPDA 4FFDA 3OJUA 5DDYA 3SEIA 4GC6A 4MKPA 1WG8A 5L9XA 5FP0A 3ETRA 4NLCA 1UT8A 5KAFU 1KDHA 1KEJA 2B0CA 4J03A 2R8GA 2LYBA 4DL5A 1XSLA 3H0RB 3ZDEA 5EWEA 3DEEA 1ZQBA 4ZOHC 3OV7A 3UQ0A 3M6KA 1QSLA 2XCPA 1FIQA 2F76X 1T4GA 2F3NA 3NVWA 3BS5B 5EWFA 1QCKA 2B21A 4OAFA 3THVA 4A8EA 4KM5A 5HRGA 3OVSA 8ICZA 2M9NA 3B0YA 4O5EA 4M5DA 2NRXA 3QEAZ 4ECVA 3CYMA 2BPGA 1ZQHA 3CK6A 3TARA 3M9MB 1ZQVA 4F50A 4UB1A 2Q66A 1SZHA 4IG8A 1IXRA 3C2MA 4HAIA 5KFSA 4DF8A 9ICRA 4RQ8A 2K60A 2ZH5A 3BQTA 3MGHA 3AQFA 3E0FA 1MC8A 2ZIUA 4TUQA 2R8IA 4DLGA 5J2FA 4DSEA 2J6TA 2FJ6A 4NLKA 1L7NA 2F8LA 4NWIA 5D49A 4PZNA 2W11A 2AGQA 1N61A 1OU5A 4AT9B 3ED5A 2KVCA 3M9NB 5ALTA 2EAPA 2F8KA 5KFUA 4O5CA 8ICXA 3QU2A 4ECRA 3D2SA 4WOYA 4F4ZA 4XQ8A 4FO1A 1ZQZA 5J0TA 1IM4A 9ICPA 4R66A 5DGAA 4KLFA 4I29A 3SD7A 5KFMA 2V4RA 9ICFA 2NRVA 4I0UA 5IIMA 5AI0A 2I9GA 3AL0B 1FFUA 4F8RA 4CE6A 2DRAA 1Z00A 3FC4A 1U48A 4IRKA 2KJ8A 2RHFA 5HMLA 1D8LA 2KOBA 2Y9TA 2ZIXB 2JGAA 3T5LA 4DQRA 4US9A 3QNMA 5KG0A 2QB0B 3T3FA 1TAQA 3NUQA 2EANA 3TANA 1C7YA 1A76A 2ISPA 3N97B 4J9MA 4Q44A 4OJPA 1NK5A 3RAXA 2ZUCA 4K99A 2H3VA 2MSNA 5AK4A 1KQQA 2KKVA 2WF6A 1ZQEA 3QUCA 4KLUA 1UEUA 2DL0A 4B9TA 4RWPA 7ICJA 4J9QA 2YMMA 4N7RA 4P0PA 4X5VA 2ZH7A 5HMMA 2C22A 7ICQA 3NGDA 1MIWA 3UPSA 1TK0A 4DEZA 2PI5A 1X9WA 7ICPA 4QW8A 1RYSA 3RJHA 2KJ5A 4BWMA 4WCWA 7ICVA 2CN1A 3RBDA 2ZHBA 5IIKA 4DSIA 4DCCA 3HIYA 4EEBA 4DS4A 2FPKA 2KKPA 3MC1A 2YX8A 4NL9A 3WK7A 1NK0A 4XJEA 1ZQSA 5AKXA 1O03A 1BVSA 3ER9B 4GFJA 5DKWA 4ELUA 4PPXA 1FA0A 2PMZF 1UA1A 5ALIA 1ZD4A 2PFPA 4ZH4A 3PV8A 3B9JA 5ALUA 3SAFA 4IQWA 4MHVA 4ED2A 8ICTA 4J9KA 1QLNA 2DPJA 2KMDA 4DSLA 4JB3A 4CF3A 3FYHA 7ICLA 4PJ0U 3LDAA 4WH5A 4X4SA 2IOFA 4RWOA 4QW9A 2HBLA 4DSKA 5DQGA 1D9DA 1VJ7A 2K4IA 2XICA 2PI4A 3M6ZA 5ALPA 8ICPA 3AQNA 4M9LA 3NKUA 2EQYA 5CHEA 2MUTA 1L3UA 7ICOA 4ATBB 5DB9A 1RXWA 3H0MB 1BNPA 2RDIA 1ZQLA 1LB2B 4JK1A 3AUOA 1Y88A 2DVIA 2YY6A 4NXVA 4F91B 1TVAA 7ICFA 3V72A 1DK3A 4F2RA 1XWLA 2H5XA 4AT7A 1ZOLA 4C0ZA 1PVRA 1T7PA 5KG7A 4U6PA 2W8KA 1QTMA 2ASDA 3A0BU 8ICKA 3KOOA 4MF8A 2MRLA 3N7SC 3TAPA 2W7OA 3HW8A 5KT2A 5DDMA 1Z3EB 3SENA 3E58A 5ALVA 5D46A 3E2EA 2B51A 4WC3A 3PSFA 4C80A 2FPLA 4Y2JA 5ALRA 4Q45A 1ZQMA 2FDRA 2Z7JA 2QARA 4O3QA 3T5JA 1TK5A 1NK7A 3ONNA 2FMPA 4JMUA 2ZTEA 1R8CA 5F3XB 3I76A 5HRLA 4ECYA 1XO0A 2BDUA 4KLIA 1SIJA 3H7IA 5F2VO 5TISU 4O3OA 1ZQOA 2O5AA 2BCVA 5DG9A 1CI4A 2QB1A 3V6JA 3L4PA 5JU5A 2ZIVB 4ED1A 1JALA 3FAHA 4YN4A 3MGVA 2J6SA 2EH9A 5AKHA 1SWWA 3BQ1A 3IV6A 3LVWA 4MEYA 2ZJ5A 9ICAA 4Y2QA 4FS1A 4O3SA 3H8WA 2ZJ8A 3GZFA 2WF7A 4LZDA 5KG5A 3RB4A 1F44A 4I2GA 4Q43A 1D9FA 3AMZA 2NRWA 4EZ9A 2YMLA 4K8VA 4R8UA 4IRCA 3JYYA 3JPQA 3C1YA 2PFQA 2HW3A 9ICMA 3ZDDA 1N5XA 2A1JB 4JV0A 1SXEA 4IQUA 4F5OA 2BPCA 8ICYA 8ICLA 4ED3A 5TZVA 3T5KA 3NTUA 4PHPA 3RR7A 4NXTA 5KFXA 2W9CB 4AT8B 2PKEA 4RPYA 5KFWA 1GO3F 4RNOA 4I28A 2DPIA 2IHNA 1DOQA 2RFFA 3VC8A 4LVSA 4KLQA 5KFZA 1KW4A 2WB1F 4NXUA 4EEDA 2KE7A 3K4GA 1MQ3A 2DR7A 4DSJA 3H40A 1KSPA 1JXLA 3EWAA 3RJEA 2DKZA 4I2AA 1V85A 1UCVA 2XGQA 2D8CA 1ZQFA 5ALGA 3PW5A 3RF9A 5D63A 3JPSA 2W9MA 3JPTA 5DBAA 4LT6A 2DRBA 2H3QA 3WKAA 1IV8A 4DQQA 5KL1B 3BQ2A 2UVVA 4MF2A 1DGJA 1COKA 5AI5A 3AQLA 2KSOA 3RJKA 3HKZF 4O3RA 5HREA 4DFMA 1NK6A 4KX5A 5EE1A 4K9BA 4R65A 2RQ5A 4NY8A 2HBKA 2HBMA 4UASA 4C7YA 4RQ0A 4B9MA 5ALXA 5KFIA 3CP8A 4RQ4A 3SI8A 3K75D 5KL8B 3F2BA 4M47A 3ISDA 3GV7B 5KFEA 5DBCA 1YLQA 8ICWA 3Q8PB 4S3NA 2DQNB 5B3QA 5AM3A 5KFQA 5DB8A 4PHAA 3TADC 4YVZA 1K5OA 4O9MA 5KT7A 4UW9A 2IOHA 2VANA 3JPRA 4EENA 2K8CB 4UAWA 2FMQA 1KBUA 3RAQA 4QZGA 5AM2A 5J2AA 3KHHA 1A0PA 3Q8LA 1IG6A 2B4VA 2EDUA 2KD1A 1T8EA 3GQCA 1N2XA 4NKUA 3QU4A 3QUTA 5JRTA 2I1QA 2OH2A 4DFJA 4K4HA 2WB1C 4EX7A 3PVXA 3I28A 3MDAA 1FEZA 4IRDA 1L7OA 3GDXA 4LEYA 2PXIA 4RQ2A 2BCSA 1L7PA 1ZD2P 4ECQA 1B4FA 4XQ7A 5DEDA 1UHUA 2HHWA 5KFBA 1ZQGA 2A3VA 4R63A 1NO5A 5AKKA 5HHHA 1S77D 4WJ3B 3HPOA 1O08A 4PGQA 3H4BA 3PMNA 3SYZA 3H38A 5G5GA 4QWBA 4XUSA 3UXPA 2BBJA 1N56A 5KFLA 4TQSA 5J2KA 2LKYA 3RH6A 2F77X 1SZPA 2M0NA 3HKZC 4NLGA 2BZFA 4YD2A 3C5GA 2FMSA 1RQNA 1N62A 2G09A 4DL7A 1T3NA 2GH1A 4O3PA 5HRIA 3CW2C 1Z4OA 3WFQE 3IN5A 3F53A 8ICHA 1UT5A 4ELTA 1S0MA 5KT3A 4WBYA 2GA9D 5EE3A 4ECTA 5EE9A 5B66U 1L7MA 3TFRA 3KZXA 3SAGA 5AKIA 5ALHA 2HHSA 3JPOA 3RTVA 4FS2A 1PVPA 5ALEA 3WKBA 4WC2A 2BE3A 3MR6A 2LM1A 3IP4B 1MA7A 5J2BA 4ELVA 5J2CA 1D8BA 4I2IA 5CWRA 5D62A 2FLLA 1XC9A 4RQ1A 4YQWA 5CR0A 2LBOA 3UPQA 1JROA 2LYAA 2R18A 3JZ0A 3WK8A 1ZJMA 5ALQA 1LV5A 4RNNA 3OVBA 2OCEA 5J29A 4YFKA 5DG7A 1L5UA 2P66A 2G06A 2NYVA 2AHOB 2G08A 3KHGA 4YMNA 3D2QA 2C28A 1J2NA 3ERCC 5J0QA 5DGBA 5J0RA 3U26A 4PH5A 4F4XA 1WCLA 4FHWA 4X0BA 2Y0SF 1B0XA 5AKEA 4FZNA 4UAVA 3NRZA 2CXYA 4BWJA 1WUDA 3ER8C 5KTQA 1EXNA 5L1LA 9ICEA 2HN1A 3Q8QB 1A6SA 2W04A 5J0WA 2WFAA 3NVYA 3GIIA 3Q8KA 4QZHA 3IHQB 5IIJA 1ZQCA 3OWGA 4XA5A 1KKXA 3A0HU 4MFAA 2R8HA 4DF4A 5BOLA 2BBHA 4FBTA 1ECWA 3H0LB 1L6NA 3PHZA 1OUQA 5CEHA 1R8AA 2NO4A 4FZLA 5KFCA 3LK9A 5T14A 2BQRA 1CUKA 5AIAA 4NXZA 1ZD5A 1HEKA 1X6JA 7ICIA 5ALZA 2WTFA 1Z4NA 3JCFA 3C21A 2HN2A 5DLGA 1PUZA 3RB3A 3S6JA 1Q3VA 9ICWA 4Y2TA 5F9NA 3TKAA 2ZIWA 9ICSA 3HILA 4FHPA 4FH5A 2E1FA 2W54A 3QX7A 4QIWF 4UB6U 5L1JA 4Q8EA 4YXJA 4GXKA 1TE2A 1MSWD 2CPRA 2E3TA 5J8YA 3IG5A 2XY6A 2NO5A 3GIKA 4WC0A 5KFYA 1J2MA 2FLPA 4F5NA 2HVIA 5DG8A 1X9XA 3GFKB 4RT3A 2EWRA 4FE3A 3AQEA 4UB4A 1RDFA 3L3FX 2HDOA 4C4TA 1JRPA 3TACB 5IIOA 3UXOA 1SGGA 4RQ6A 4ACOA 2XY7A 2JEIA 2C2RA 2W3SA 4ED7A 2NRKA 4YMMA 4NKTA 1LVHA 4NV0A 3BS5A 5KG2A 4KLDA 2BCRA 2H3IA 1D8YA 1K1QA 4RPZA 5CRXA 2W9BB 3I1YA 4X4UA 2QKQA 1S0OA 1ZQNA 3KKAC 2GOLA 4C8LA 2KK0A 5EWGA 4ECSA 4C8NA 2DBYA 5DQIA 1NK4A 1NKBA 4DL4A 4K96A 2DKXA 3K7DA 4RQ5A 3BQ0A 4WC1A 8ICJA 4P4PA 2ZJAA 1KN5A 4AP9A 2GLEA 4NXWA 1OXJA 2W55A 4P2HA 5EE0A 3M8SA 4KLLA 2AGOA 2XVTA 4DS5A 2NV3A 4QZDA 3OSNA 4EZ6A 5ALSA 4QZ8A 2Y1JA 5KFJA 3WFPA 8ICEA 1FFVA 4AT9A 1IIPA 4M9GA 4F5QA 1L3VA 1V97A 8ICFA 3ZDCA 3GV5B 5H2FU 4WC7A 5J0OA 4CDGA 1JN3A 4QZFA 4GXIA 4EYHB 3H8MA 2JEFA 4M2YA 2FE9A 2G07A 4K98A 1ZQYA 1TFRA 1QH9A 1X40A 4HX0A 4IC9A 4QIWC 2ODGA 2KEYA 2OYYA 2F44A 1BPXA 1SXDA 3QYPA 2JZBB 3J81j 5KFNA 1ZRNA 5KG4A 1V9PA 4KLJA 2E8MA 1XSPA 5KFHA 3JPPA 2DWQA 4OD0A 1RYUA 2EAMA 4ED8A 2PFNA 1KL9A 2ZIXA 4DL3A 3EPGA 1X42A 3IRUA 2QB0A 4WQKA 2M2UA 2LHTA 4RWQA 4X0AA 1WWUA 3RBEA 3WK6A 2W8LA 3GIJA 3PW0A 3M9OB 1T3QA 4OJLA 4PHEA 2XIDA 3EZ5A 4RUAA 4BDPA 4RQMA 4LJXA 4E8FA 2ESEA 4P0QB 1TK8A 2H3ZA 5AK6A 2ZTCA 2K89A 2YN4A 9ICGA 5CA7A 4NL9C 2EZYA 3ISCA 9ICQA 4NM2A 1FO4A 3OGUA 2IMWP 1XNSA 2D6FC 3BJYA 1N60A 3SV3A 5KT4A 4I2CA 3BDPA 3RH5A 3PX0A 4DOAA 5ALWA 3ZDBA 3CNHA 1JQRA 2KJ9A 1NK8A 4UD5A 3UQ2A 3C28A 2FI1A 5KFFA 1RZTA 9ICNA 4F5RA 2E5SA 2LM4A 3V7JA 1MIYA 2ZH3A 4UQGA 1QSSA 3QXGA 2PMZC 1F5AA 4EEKA 4QWCA 4EX6A 4M6WB 4J9NA 2KG5A 1ZXIA 3ETLA 4X4QA 1TFWA 4YCXA 2MU2A 3BZKA 1U49A 1U47A 3OPXA 4DOBA 5HP4A 1S0NA 4DQPA 2VJ5A 5J2DA 4UBBA 4UATA 5KFKA 5J2GA 3LWLA 4KLGA 4O3MA 5DBBA 3DV9A 1PK3A 3QZ8A 2GWSA 4J9LA 2JHDA 2JMGA 5A0LA 4FO6A 2W03A 4DL2A 3ZI4A 3GU3A 1JI7A 2WAQF 2G0AA 3NVOA 3O0FA 2F1JA 4YR2A 1URJA 1ZQ1C 5KNIA 5HR6A 2R8JA 4ATBA 4JLXA 5IILA 1LKYB 3UMGA 4I2FA 3PZPA 4OJOA 1JIHA 1PVQA 5KT6A 3T5HA 3VCBA 5ALFA 4DL6A 4E80A 2IA6A 2LYHA 3G6VA 4ECXA 5HR9A 5J0PA 3QU9A 1NJYA 3PW2A 4Y2XA 1BPYA 2RDJA 2YQEA 1KLNA 3EF2A 1VFGA 3F2DA 3TADA 1C20A 4O69A 1NZPA 5ALDA 2G5IB 2M2VA 5B3PA 2WHEA 3WK9A 1S8OA 3RRGA 1NK9A 1XU4A 3H4DA 4QNLA 1ZQXA 2OM6A 1ZYQA 4I2EA 4Y2SA 4TURA 3RJIA 3L9DA 3ISBA 3M1YA 2ZHAA 2K8AA 1PK1B 3PSIA 2BPFA 3K1ZA 3ZD8A 2Y1IA 2W9AA 2XY5A 4JV1A 5AM1A 4M9HA 2ZIVA 4CGZA 2AQ0A 4F71A 1ZQPA 4X4VA 1H38A 3PY8A 2W3RA 2OWOA 5AI4A 2YB1A 5CFTA 3AQKA 3M8RA 3G6XA 5IIIA 3NVVA 1N48A 3WK5A 2ZUDA 4MEXA 4M6WA 3SQIA 4UB5A 5ALOA 4C4SA 2F1HA 4TUSA 2ASJA 4BXOB 3H8JA 4YXMA 4X4PA 4QZCA 2F2AB 3QU7A 4BGDA 4B9VA 3D6JA 3MR5A 4QZEA 4QWDA 3RB0A 5F9LA 3MCRA 1QQ5A 4EELA 3H3AA 5G5HA 4LEWA 2BCUA 1T94A 2RRDA 1DK2A 1CRXA 2L5YA 9ICHA 3N28A 2A1JA 3R9KA 2VA8A 1HUOA 4YD1A 3PX4A 2KP7A 2W43A 2ZG6A 5DQHA 2VJ4A 1S5LU 5IINA 4Y2RA 3QEBZ 2PBEA 1KFDA 4UB3A 1Q3UA 1UPHA 1MIVA 2V4QA 3SAHA 2ALZA 4CNQA 4EBEA 1LKYA 3NS1A 1BPEA 5JTIA 2W9CA 4AT8A 1VJ5A 4BJQA 2LMRA 2JV3A 1NI3A 4PL2A 2ZXHA 3RH4A 3PMLA 4Y2UA 3EUB2 5AKZA 3MR3A 2EZXA 5KG1A 5DB6A 2XCAA 4C8KA 2AQ4A 3QUQA 9ICCA 5EOZA 3L5KA 2KZZA 1M6YA 9ICXA 4QZ9A 4AYBF 2ZUBA 4DOCA 1U4BA 3WFOA 5L1KA 3C66A 3BS7A 4UB2A 5C5JA 9ICUA 3WFRE 1DXSA 3H39A 2K8BB 2KFZA 1SV0C 3HT3A 1DGSA 4WBZA 1JX4A 4FH3A 5ALMA 4F2SA 2HVHA 4RNMA 2O6KA 4NLBA 1PK1A 5ALLA 4B9UA 4UD4A 4O5KA 2ZTDA 2J6UA 5KFTA 5B5EU 1COOA 2OEHA 1KNYA 4YP3A 2BQUA 1KFTA 2UVRA 5J2EA 1X66A 8ICOA 4Z6CA 4FHYA 2NRZA 2ZIUB 1Z1VA 3NWIA 2JH1A 3PR4A 2G5HB 3WKEA 2AJQA 4JLZA 5J0UA 8ICMA 7ICHA 2XI9A 4MFFA 1TV9A 3OUYB 3MGIA 1MQ2A 5KG3A 3ICXA 3KZIU 1AQ6A 2YTUA 4B9LA 3G6YA 3T79A 2KHVA 4I27A 2YMPA 4DWIA 1S76D 1ZQIA 5CHGA 4TUPA 2E8OA 3AU6A 2HHXA 2UVUA 4M04A 4P4MA 3PR5B 2ID1A 1SKSA 3OVAA 2ASLA 3RJFA 2M2WA 4ED0A 1NJXA 2K4PA 1U9LA 3K1RB 4EEYA 1YZ6A 1ZQRA 2KTQA 1CEZA 1Z00B 1PZNA 2Q0ZX 5KFOA 3AQMA 5J2HA 4B9NA 8ICVA 2RP5A 2FCLA 1KRPA 2KZMA 1V4AA 2IUBA 2BCQA 1KTQA 5HHIA 1U45A 2KN7A 4AYBC 1J97A 4C8MA 1UA0A 3OSPA 3C2KA 4EBDA 2M2TA 4EV6A 4PHDA 2DGZA 1L3TA 4Z6DA 1S0VA 5GTHU 5J0YA 5KFPA 2B56A 8ICSA 1RM6C 7ICEA 4F4WA 5HRBA 1VLBA 2HCFA 1HJPA 3MABA 3GILA 5HRFA 2KNJA 2NRTA 2LI6A 2F1IA 3F5EA 1JUDA 4P0PB 1Q79A 2C2DA 1TAMA 3UM9A 5KFGA 4RT2A 3NRWA 4R64A 4WC6A 2KV2A 4US8A 4J9PA 4CRXA 1Z19A 5AI6A 1KFSA 2W7PA 3N4MB 7ICKA 3UMCA 4KLOA 4KLSA 3EPIA 5J0SA 3HP6A 4J9OA 7ICSA 1Q46A 2WF5A 1RYRA 1ZQTA 2IOFK
chains in the Genus database with same CATH topology
2DPIA 4M9JA 2IHNA 1DOQA 1NKCA 2RFFA 4LVSA 1BPXA 5DLFA 5BOMA 3NYBA 5HC9A 4UAYA 2ISOA 4KLQA 2JZBB 5KFZA 1ZQAA 5KFNA 4HYKA 3RR8A 3K4GA 5KFVA 1MQ3A 4E7XA 5KG4A 1V9PA 2XC9A 3V7LA 1ZQJA 1A77A 1XSPA 4DSJA 2P6UA 4QZBA 4KLJA 5KFHA 2DR7A 3JPPA 3Q8SB 3H40A 1JXLA 1KSPA 4X4TA 3EWAA 8ICAA 4QWAA 3OJSA 4YG2A 4UBCA 4DSFA 3RJGA 3OUYA 3RJEA 4ED8A 2BDPA 4I2AA 4KITB 1SL1A 2PFNA 4FHXA 1ZQKA 4DQSA 4DL3A 3ZDAA 2BR0A 3EPGA 2XGQA 4K4GA 4F5PA 1ZQFA 3PW5A 1NOMA 4EBCA 9ICKA 5J2JA 2M2UA 1S97A 1WCNA 5KFRA 3JPSA 1TFYA 4RWQA 3C2LA 2W9MA 3JPTA 4E0DA 3RBEA 2HHTA 9ICLA 4X0AA 1B22A 2W8LA 4BXOA 3GIJA 3PW0A 3WFSC 2C2EA 4O3NA 3M9OB 4I2DA 5DBAA 4LT6A 4RQ7A 2DRBA 4PHEA 4I2BA 2IBKA 4KLHA 4DQQA 8ICQA 3EZ5A 3BQ2A 4RUAA 4BDPA 2UVVA 3MFIA 4MF2A 1JAJA 4X4RA 1ZQWA 5L1IA 2ATLA 2VA2A 4X4NA 4E8FA 3HX0A 2MUTB 3AQLA 1XS9D 4IR1A 3IM1A 1TK8A 3LQCB 4DLEA 8ICRA 4EBKA 2ZTCA 2DFLA 3JPNA 2JEGA 3RJKA 4O3RA 5HREA 5D4BA 4DFMA 1NK6A 4QWEA 9ICGA 3EW9A 5CA7A 5HRKA 3ISCA 9ICQA 4NM2A 3OGUA 3GIMA 1ZQUA 2FLNA 2IMWP 3BJYA 8ICBA 2HHVA 5HRBA 3SV3A 5KT4A 4R65A 4JWNA 4I2CA 3BDPA 3RH5A 3PX0A 3HJ1A 4AT7B 5HRDA 4DOAA 1JMSA 4NY8A 3ZDBA 7ICNA 1JQRA 1BPDA 3OJUA 4GC6A 5DDYA 4RQ0A 4F4KA 5L9XA 1X2IA 3PW7A 4B9MA 4IR9A 4FHVA 1NK8A 4UD5A 5KFIA 3UQ2A 4QZIA 4RQ4A 1UT8A 3SI8A 5KFFA 3KTQA 3K75D 1RZTA 9ICNA 4F5RA 1KDHA 4JV2A 1KEJA 4I28A 4M47A 3V7JA 2R8GA 1MIYA 3ISDA 3GV7B 2ZH3A 4UQGA 5KFEA 5DBCA 1QSSA 4DL5A 1YLQA 1XSLA 4KLTA 8ICWA 3Q8PB 8ICNA 1F5AA 4S3NA 3ZDEA 3Q8RB 5EWEA 1ZQBA 5J0XA 5KFQA 4QWCA 4M6WB 4J9NA 3OV7A 5DB8A 4PHAA 3UQ0A 1QSLA 3ETLA 4X4QA 4YVZA 1TFWA 4YCXA 5KT7A 2XCPA 4KTQA 1U49A 4DQIA 4O9MA 8ICGA 1U47A 2HHQA 2VANA 1T4GA 4DOBA 2KFNA 5HP4A 2BKEA 3JPRA 1S0NA 4DQPA 4UAWA 2FMQA 4K4IA 5J2DA 4EBJA 5EWFA 3RAQA 4QZGA 4F3OA 4UBBA 5KFKA 2B21A 5J2AA 5J2GA 3LWLA 3KHHA 3Q8LA 1RXVA 4KLGA 3H8SA 5DBBA 3THVA 5KG6A 1T8EA 3GQCA 2GWSA 3QZ8A 4NKUA 4TQRA 5HRGA 4J9LA 3OVSA 2I1QA 2UVWA 8ICZA 2M9NA 3B0YA 4FO6A 4DFJA 3SV4A 4K4HA 4DL2A 2NRXA 4O5EA 8ICCA 4IQTA 1UEVA 3QEAZ 4ECVA 4I2JA 4DO9A 1ZQHA 2BPGA 3C1ZA 7ICUA 3PVXA 3MDAA 2F1JA 5J2IA 3TARA 4IRDA 4KLMA 4YR2A 3GDXA 3M9MB 2PXIA 4IQVA 4RQ2A 2R8JA 1ZQVA 2BCSA 4NLNA 5KFDA 4F50A 4ATBA 4ECQA 4UB1A 4XQ7A 5DEDA 2Q66A 5IILA 2HHWA 4IG8A 4I2FA 1B43A 1IXRA 5KFBA 2BQ3A 1ZQGA 3C2MA 5KFSA 5CJ7A 4DF8A 1JIHA 4DFKA 4R63A 4RQ8A 4I2HA 9ICRA 1NO5A 2BGWA 5HHHA 2ZH5A 5KT6A 3T5HA 1S77D 3BQTA 3HPOA 3MGHA 4PGQA 4R8UB 9ICBA 1MC8A 4DL6A 4E80A 3H4BA 4TUQA 2R8IA 4DLGA 5J2FA 2LYHA 4GLXA 2IA6A 3PMNA 3G6VA 4ECXA 3SYZA 4DSEA 2J6TA 5HR9A 5J0PA 3LWMA 3TAQA 3H38A 4NLKA 1SL2A 3UXNA 1NJYA 4QWBA 3PW2A 4XUSA 2ZH2A 5D49A 3UXPA 4EP7A 1BPYA 2RDJA 2AGQA 1OU5A 4AT9B 3C18A 2P6RA 1KLNA 1N56A 1VFGA 5KFLA 3OHAA 4TQSA 1SKRA 2DR8A 5J2KA 1NZPA 3M9NB 2AGPA 2M2VA 3RH6A 1SZPA 1BGXT 4NLGA 3OHBA 4YD2A 4XRHA 4KN4A 5KFUA 3C5GA 4O5CA 2ZH4A 3RRGA 1NK9A 4P4OA 4WC4A 1XU4A 3H4DA 2FMSA 8ICXA 7ICMA 4ECRA 1ZQXA 4DL7A 1T3NA 4PGXA 1ZYQA 3GV8B 4I2EA 4Z6FA 4O3PA 4TURA 3RJIA 5HRIA 4F4ZA 3WFQE 4XQ8A 8ICHA 1ZQZA 3L9DA 5J0TA 1IM4A 1UT5A 9ICPA 4R66A 5DGAA 4ELTA 4I29A 3ISBA 4KLFA 1S0MA 2ZHAA 5KT3A 2V4RA 5KFMA 9ICFA 2NRVA 4WBYA 2BPFA 5IIMA 3ZD8A 4ECTA 2W9BA 2Y1IA 2I9GA 2W9AA 2XY5A 3RB6A 4F8RA 4JV1A 1SKWA 4M9HA 2AQ0A 2O1PA 4X4PA 1Z00A 1U48A 3TFRA 1ZQPA 8ICUA 2DR5A 4IRKA 1NJWA 1H38A 3PY8A 4X4VA 2OWOA 4YR0A 2HHSA 5HMLA 1D8LA 3JPOA 3RTVA 4FS2A 1SL0A 3T5LA 3AQKA 4DQRA 3M8RA 5KG0A 4CCHA 3G6XA 5IIIA 4WC2A 3C5FA 3RRHA 2ZUDA 1N48A 2BE3A 3T3FA 1TAQA 1AROP 4Z6EA 3PW4A 4M6WA 4MEXA 4UB5A 3H37A 3MR6A 3TANA 1C7YA 2F1HA 4M5DA 1A76A 2ISPA 4TUSA 2ASJA 3N97B 4BXOB 3H8JA 4YXMA 4J9MA 5J2BA 4Q44A 1K1SA 1NJZA 1L3SA 4ELVA 4QZCA 4BGDA 5J2CA 1NK5A 4B9VA 3RAXA 2JEJA 4ECWA 4I2IA 7ICTA 3MR5A 4QZEA 5CWRA 4QWDA 2FLLA 1XC9A 4RQ1A 4YQWA 5CR0A 2ZUCA 5F9LA 3MBYA 3UPQA 3RB0A 4C8OA 3H3AA 4RWNA 1UETA 1ZETA 3JZ0A 1ZJMA 2BCUA 1LV5A 4RNNA 3OVBA 1DK2A 4KLUA 1ZQEA 1UEUA 4RWPA 9ICHA 4B9TA 5J29A 4YFKA 5DG7A 1L5UA 2A1JA 1ZQQA 2P66A 7ICJA 4J9QA 2VA8A 1HUOA 4RQ3A 1XO1A 3KHGA 4X5VA 4YD1A 3PX4A 2ZH7A 4YMNA 7ICRA 2C28A 2KP7A 9ICTA 2DR9A 5J0QA 4GXJA 5HMMA 2C22A 5DQHA 5DGBA 3MFHA 5J0RA 4PH5A 4J9SA 4F4XA 5IINA 1WCLA 7ICQA 3QEBZ 2PBEA 4FHWA 4X0BA 2ZH1A 1KFDA 4UB3A 2ZH9A 1MIVA 3NGDA 4GC7A 2V4QA 4M9NA 1MIWA 3UPSA 2ALZA 1TK0A 4DEZA 2PI5A 4BWJA 4EBEA 1X9WA 7ICPA 1BPEA 1EXNA 5KTQA 5L1LA 9ICEA 4QW8A 4PGYA 1RYSA 3RJHA 2W9CA 3Q8QB 4BWMA 4AT8A 4WCWA 7ICVA 4G3IA 3RBDA 2ZHBA 8ICIA 2PFOA 5IIKA 3RH4A 4DSIA 3HIYA 1TKDA 3PMLA 5J0WA 4DS4A 2FPKA 4QZAA 2JZBA 1NK0A 3MR3A 1ZQSA 5KG1A 5DB6A 1BVSA 2XCAA 3KHLA 3KHRA 4C8KA 4F92B 3GIIA 2AQ4A 5DKWA 4DFPA 4QZHA 3IHQB 5IIJA 3Q8KA 1ZQCA 4ECUA 4ELUA 4XA5A 4PPXA 2XO7A 9ICCA 1FA0A 5EOZA 2ZH6A 2KZZA 4MFAA 1UA1A 2R8HA 4DF4A 2PFPA 4ZH4A 3PV8A 9ICXA 5BOLA 4QZ9A 4FBTA 4IQWA 2ZUBA 4DOCA 1U4BA 4ED2A 8ICTA 4J9KA 2HHUA 3WFOA 5L1KA 1S9FA 2DPJA 1QLNA 1R8AA 3C66A 4DSLA 1S10A 3FYHA 7ICLA 3RJJA 4UB2A 5C5JA 5KT5A 5KFCA 3LK9A 3LDAA 1X9SA 9ICUA 3WFRE 4KMUA 2DRAA 2BQRA 3H39A 1CUKA 2KFZA 9ICOA 4RWOA 4X4SA 4NXZA 3HT3A 3PO5A 3B0XA 4QW9A 1DGSA 7ICIA 2R8KA 4WBZA 4DSKA 5DQGA 1JX4A 4FH3A 1D9DA 1VJ7A 1RPLA 2WTFA 3QE9Y 4F2SA 2HVHA 4RNMA 2PI4A 1TAUA 9ICJA 3C21A 4LZGA 8ICPA 5DLGA 1R89A 4EYIB 3RB3A 4J9RA 3AQNA 4M9LA 4UAZA 2MUTA 1L3UA 7ICOA 4B9UA 9ICWA 4UD4A 4ATBB 5DB9A 3PNCA 2ZTDA 5F9NA 1RXWA 4O5KA 9ICSA 2J6UA 1BNPA 2RDIA 1ZQLA 5KFTA 4JK1A 3AUOA 1LB2B 2V9WA 3PO4A 4FH5A 1COOA 4FHPA 1Y88A 4Q8FA 1KNYA 2DVIA 4YP3A 4RUCA 2BQUA 1KFTA 3ORYA 3TI0A 2UVRA 5J2EA 8ICOA 4F91B 1TVAA 7ICFA 4Z6CA 4FHYA 2NRZA 3V72A 1DK3A 4F2RA 3FDSA 1XWLA 2H5XA 2XGPA 4AT7A 1ZQDA 5L1JA 3PR4A 1T7PA 5KG7A 4Q8EA 3V6HA 2W8KA 4MFCA 2AJQA 4YXJA 1QTMA 4GXKA 2AU0A 5J0UA 2ASDA 8ICMA 4F93B 3SZ2A 1MSWD 7ICHA 8ICKA 1PX5A 4MFFA 5DB7A 2XY6A 2KZ3A 1TV9A 4MF8A 3OUYB 3GIKA 3PX6A 3MGIA 5KFYA 3V6KA 4WC0A 4X4OA 2FLPA 1MQ2A 4F5NA 4WC5A 5KFAA 2MAXA 5KG3A 3TAPA 1ZJNA 5DG8A 2HVIA 3HJ4A 3GFKB 5KT2A 5DDMA 1Z3EB 4RT3A 5D46A 3HW8A 3G6YA 4B9LA 3E2EA 5HRHA 4WC3A 4UB4A 2FPLA 4Q45A 4I27A 1ZQMA 4DWIA 1S76D 5CP2A 4NM1A 5IIOA 1ZQIA 4O3QA 3UXOA 2XY7A 4RQ6A 3T5JA 1TK5A 7ICGA 2JEIA 1NK7A 2C2RA 2FMPA 5DECA 3MR2A 5CHGA 2ZTEA 4TUPA 3AU6A 3QZ7A 4ED7A 1XSNA 2HHXA 2NRKA 1R8CA 4YMMA 1R8BA 4NKTA 5CB1A 4ECYA 2UVUA 4M04A 5HRLA 5KG2A 4JWMA 5BPCA 4P4MA 3PR5B 4KLDA 2BCRA 4KLIA 2HHPA 2ID1A 3H7IA 1SKSA 4YMOA 3HWTA 1K1QA 1D8YA 3OVAA 3MDCA 5F2VO 4RPZA 2ASLA 4KN7A 3RJFA 4O3OA 2W9BB 1ZQOA 2M2WA 4ED0A 1NJXA 2O5AA 2BCVA 5DG9A 3V6JA 1U9LA 4ECZA 4ED1A 9ICVA 4EEYA 4X4UA 1S0OA 1ZQRA 2KTQA 4B9SA 3V7KA 1ZQNA 1Z00B 1CEZA 1PZNA 4YN4A 2Q0ZX 4C8LA 5KFOA 2J6SA 3AQMA 1QSYA 2ZH8A 3BQ1A 5EWGA 5J2HA 4RU9A 4ECSA 4B9NA 1X9MA 4MEYA 2ZJ5A 8ICVA 1Q78A 9ICAA 4C8NA 4FS1A 1KRPA 4O3SA 2KZMA 1V4AA 3H8WA 5DQIA 1NK4A 2ZJ8A 1NKBA 1KTQA 4LZDA 5HHIA 5KG5A 2KN7A 4DL4A 3RB4A 1U45A 2BCQA 4I2GA 4Q43A 4C8MA 4RQ5A 3EYZA 3Q8MA 3BQ0A 3TFSA 1UA0A 4WC1A 3OSPA 4P4PA 1D9FA 3C2KA 8ICJA 2NRWA 2ZJAA 5JUMA 4EZ9A 4M0AA 4F4YA 4EBDA 2M2TA 4PHDA 4R8UA 4P2HA 1L3TA 4IRCA 4Z6DA 1S0VA 4ED6A 5J0YA 5KFPA 3JYYA 4RZRA 3M8SA 3JPQA 1HUZA 2AGOA 4KLLA 8ICSA 9ICIA 7ICEA 4F4WA 2FPMA 3C1YA 2BHNA 4DS5A 2PFQA 3MABA 4QZDA 1HJPA 2VA3A 4KLEA 3OSNA 2HW3A 3GILA 3TQ1A 4JUZA 1BPZA 3ZDDA 4EZ6A 9ICMA 4QZ8A 2NRTA 5HRFA 4NLZA 2A1JB 2F1IA 2Y1JA 5KFJA 1Q79A 3WFPA 2C2DA 8ICEA 4JV0A 4AT9A 1JXEA 5HNKA 4M9GA 5KFGA 1BPBA 4F5QA 1L3VA 4RT2A 4IQUA 4R64A 2BPCA 4F5OA 4WC6A 4J9PA 2IHMA 1WOTA 8ICYA 8ICFA 3ZDCA 3GV5B 4WC7A 5J0OA 8ICLA 1KFSA 1JN3A 1BNOA 3AU2A 4QZFA 4GXIA 4ED3A 4EYHB 5TZVA 4RPXA 3T5KA 3ZD9A 2JEFA 4M2YA 3NTUA 4PHPA 3N4MB 7ICKA 1ZQYA 1TFRA 3RR7A 4KLOA 4KLSA 5J0SA 4YR3A 5KFXA 3HP6A 3C23A 2W9CB 3EPIA 4J9OA 1RYRA 1NKEA 4FBUA 7ICSA 4RPYA 4AT8B 5KFWA 1ZQTA 4O0IA 4RNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPI A;  4M9J A;  2IHN A;  1DOQ A;  1NKC A;  2RFF A;  4LVS A;  1BPX A;  5DLF A;  5BOM A;  3NYB A;  5HC9 A;  4UAY A;  2ISO A;  4KLQ A;  2JZB B;  5KFZ A;  1ZQA A;  5KFN A;  4HYK A;  3RR8 A;  3K4G A;  5KFV A;  1MQ3 A;  4E7X A;  5KG4 A;  1V9P A;  2XC9 A;  3V7L A;  1ZQJ A;  1A77 A;  1XSP A;  4DSJ A;  2P6U A;  4QZB A;  4KLJ A;  5KFH A;  2DR7 A;  3JPP A;  3Q8S B;  3H40 A;  1JXL A;  1KSP A;  4X4T A;  3EWA A;  8ICA A;  4QWA A;  3OJS A;  4YG2 A;  4UBC A;  4DSF A;  3RJG A;  3OUY A;  3RJE A;  4ED8 A;  2BDP A;  4I2A A;  4KIT B;  1SL1 A;  2PFN A;  4FHX A;  1ZQK A;  4DQS A;  4DL3 A;  3ZDA A;  2BR0 A;  3EPG A;  2XGQ A;  4K4G A;  4F5P A;  1ZQF A;  3PW5 A;  1NOM A;  4EBC A;  9ICK A;  5J2J A;  2M2U A;  1S97 A;  1WCN A;  5KFR A;  3JPS A;  1TFY A;  4RWQ A;  3C2L A;  2W9M A;  3JPT A;  4E0D A;  3RBE A;  2HHT A;  9ICL A;  4X0A A;  1B22 A;  2W8L A;  4BXO A;  3GIJ A;  3PW0 A;  3WFS C;  2C2E A;  4O3N A;  3M9O B;  4I2D A;  5DBA A;  4LT6 A;  4RQ7 A;  2DRB A;  4PHE A;  4I2B A;  2IBK A;  4KLH A;  4DQQ A;  8ICQ A;  3EZ5 A;  3BQ2 A;  4RUA A;  4BDP A;  2UVV A;  3MFI A;  4MF2 A;  1JAJ A;  4X4R A;  1ZQW A;  5L1I A;  2ATL A;  2VA2 A;  4X4N A;  4E8F A;  3HX0 A;  2MUT B;  3AQL A;  1XS9 D;  4IR1 A;  3IM1 A;  1TK8 A;  3LQC B;  4DLE A;  8ICR A;  4EBK A;  2ZTC A;  2DFL A;  3JPN A;  2JEG A;  3RJK A;  4O3R A;  5HRE A;  5D4B A;  4DFM A;  1NK6 A;  4QWE A;  9ICG A;  3EW9 A;  5CA7 A;  5HRK A;  3ISC A;  9ICQ A;  4NM2 A;  3OGU A;  3GIM A;  1ZQU A;  2FLN A;  2IMW P;  3BJY A;  8ICB A;  2HHV A;  5HRB A;  3SV3 A;  5KT4 A;  4R65 A;  4JWN A;  4I2C A;  3BDP A;  3RH5 A;  3PX0 A;  3HJ1 A;  4AT7 B;  5HRD A;  4DOA A;  1JMS A;  4NY8 A;  3ZDB A;  7ICN A;  1JQR A;  1BPD A;  3OJU A;  4GC6 A;  5DDY A;  4RQ0 A;  4F4K A;  5L9X A;  1X2I A;  3PW7 A;  4B9M A;  4IR9 A;  4FHV A;  1NK8 A;  4UD5 A;  5KFI A;  3UQ2 A;  4QZI A;  4RQ4 A;  1UT8 A;  3SI8 A;  5KFF A;  3KTQ A;  3K75 D;  1RZT A;  9ICN A;  4F5R A;  1KDH A;  4JV2 A;  1KEJ A;  4I28 A;  4M47 A;  3V7J A;  2R8G A;  1MIY A;  3ISD A;  3GV7 B;  2ZH3 A;  4UQG A;  5KFE A;  5DBC A;  1QSS A;  4DL5 A;  1YLQ A;  1XSL A;  4KLT A;  8ICW A;  3Q8P B;  8ICN A;  1F5A A;  4S3N A;  3ZDE A;  3Q8R B;  5EWE A;  1ZQB A;  5J0X A;  5KFQ A;  4QWC A;  4M6W B;  4J9N A;  3OV7 A;  5DB8 A;  4PHA A;  3UQ0 A;  1QSL A;  3ETL A;  4X4Q A;  4YVZ A;  1TFW A;  4YCX A;  5KT7 A;  2XCP A;  4KTQ A;  1U49 A;  4DQI A;  4O9M A;  8ICG A;  1U47 A;  2HHQ A;  2VAN A;  1T4G A;  4DOB A;  2KFN A;  5HP4 A;  2BKE A;  3JPR A;  1S0N A;  4DQP A;  4UAW A;  2FMQ A;  4K4I A;  5J2D A;  4EBJ A;  5EWF A;  3RAQ A;  4QZG A;  4F3O A;  4UBB A;  5KFK A;  2B21 A;  5J2A A;  5J2G A;  3LWL A;  3KHH A;  3Q8L A;  1RXV A;  4KLG A;  3H8S A;  5DBB A;  3THV A;  5KG6 A;  1T8E A;  3GQC A;  2GWS A;  3QZ8 A;  4NKU A;  4TQR A;  5HRG A;  4J9L A;  3OVS A;  2I1Q A;  2UVW A;  8ICZ A;  2M9N A;  3B0Y A;  4FO6 A;  4DFJ A;  3SV4 A;  4K4H A;  4DL2 A;  2NRX A;  4O5E A;  8ICC A;  4IQT A;  1UEV A;  3QEA Z;  4ECV A;  4I2J A;  4DO9 A;  1ZQH A;  2BPG A;  3C1Z A;  7ICU A;  3PVX A;  3MDA A;  2F1J A;  5J2I A;  3TAR A;  4IRD A;  4KLM A;  4YR2 A;  3GDX A;  3M9M B;  2PXI A;  4IQV A;  4RQ2 A;  2R8J A;  1ZQV A;  2BCS A;  4NLN A;  5KFD A;  4F50 A;  4ATB A;  4ECQ A;  4UB1 A;  4XQ7 A;  5DED A;  2Q66 A;  5IIL A;  2HHW A;  4IG8 A;  4I2F A;  1B43 A;  1IXR A;  5KFB A;  2BQ3 A;  1ZQG A;  3C2M A;  5KFS A;  5CJ7 A;  4DF8 A;  1JIH A;  4DFK A;  4R63 A;  4RQ8 A;  4I2H A;  9ICR A;  1NO5 A;  2BGW A;  5HHH A;  2ZH5 A;  5KT6 A;  3T5H A;  1S77 D;  3BQT A;  3HPO A;  3MGH A;  4PGQ A;  4R8U B;  9ICB A;  1MC8 A;  4DL6 A;  4E80 A;  3H4B A;  4TUQ A;  2R8I A;  4DLG A;  5J2F A;  2LYH A;  4GLX A;  2IA6 A;  3PMN A;  3G6V A;  4ECX A;  3SYZ A;  4DSE A;  2J6T A;  5HR9 A;  5J0P A;  3LWM A;  3TAQ A;  3H38 A;  4NLK A;  1SL2 A;  3UXN A;  1NJY A;  4QWB A;  3PW2 A;  4XUS A;  2ZH2 A;  5D49 A;  3UXP A;  4EP7 A;  1BPY A;  2RDJ A;  2AGQ A;  1OU5 A;  4AT9 B;  3C18 A;  2P6R A;  1KLN A;  1N56 A;  1VFG A;  5KFL A;  3OHA A;  4TQS A;  1SKR A;  2DR8 A;  5J2K A;  1NZP A;  3M9N B;  2AGP A;  2M2V A;  3RH6 A;  1SZP A;  1BGX T;  4NLG A;  3OHB A;  4YD2 A;  4XRH A;  4KN4 A;  5KFU A;  3C5G A;  4O5C A;  2ZH4 A;  3RRG A;  1NK9 A;  4P4O A;  4WC4 A;  1XU4 A;  3H4D A;  2FMS A;  8ICX A;  7ICM A;  4ECR A;  1ZQX A;  4DL7 A;  1T3N A;  4PGX A;  1ZYQ A;  3GV8 B;  4I2E A;  4Z6F A;  4O3P A;  4TUR A;  3RJI A;  5HRI A;  4F4Z A;  3WFQ E;  4XQ8 A;  8ICH A;  1ZQZ A;  3L9D A;  5J0T A;  1IM4 A;  1UT5 A;  9ICP A;  4R66 A;  5DGA A;  4ELT A;  4I29 A;  3ISB A;  4KLF A;  1S0M A;  2ZHA A;  5KT3 A;  2V4R A;  5KFM A;  9ICF A;  2NRV A;  4WBY A;  2BPF A;  5IIM A;  3ZD8 A;  4ECT A;  2W9B A;  2Y1I A;  2I9G A;  2W9A A;  2XY5 A;  3RB6 A;  4F8R A;  4JV1 A;  1SKW A;  4M9H A;  2AQ0 A;  2O1P A;  4X4P A;  1Z00 A;  1U48 A;  3TFR A;  1ZQP A;  8ICU A;  2DR5 A;  4IRK A;  1NJW A;  1H38 A;  3PY8 A;  4X4V A;  2OWO A;  4YR0 A;  2HHS A;  5HML A;  1D8L A;  3JPO A;  3RTV A;  4FS2 A;  1SL0 A;  3T5L A;  3AQK A;  4DQR A;  3M8R A;  5KG0 A;  4CCH A;  3G6X A;  5III A;  4WC2 A;  3C5F A;  3RRH A;  2ZUD A;  1N48 A;  2BE3 A;  3T3F A;  1TAQ A;  1ARO P;  4Z6E A;  3PW4 A;  4M6W A;  4MEX A;  4UB5 A;  3H37 A;  3MR6 A;  3TAN A;  1C7Y A;  2F1H A;  4M5D A;  1A76 A;  2ISP A;  4TUS A;  2ASJ A;  3N97 B;  4BXO B;  3H8J A;  4YXM A;  4J9M A;  5J2B A;  4Q44 A;  1K1S A;  1NJZ A;  1L3S A;  4ELV A;  4QZC A;  4BGD A;  5J2C A;  1NK5 A;  4B9V A;  3RAX A;  2JEJ A;  4ECW A;  4I2I A;  7ICT A;  3MR5 A;  4QZE A;  5CWR A;  4QWD A;  2FLL A;  1XC9 A;  4RQ1 A;  4YQW A;  5CR0 A;  2ZUC A;  5F9L A;  3MBY A;  3UPQ A;  3RB0 A;  4C8O A;  3H3A A;  4RWN A;  1UET A;  1ZET A;  3JZ0 A;  1ZJM A;  2BCU A;  1LV5 A;  4RNN A;  3OVB A;  1DK2 A;  4KLU A;  1ZQE A;  1UEU A;  4RWP A;  9ICH A;  4B9T A;  5J29 A;  4YFK A;  5DG7 A;  1L5U A;  2A1J A;  1ZQQ A;  2P66 A;  7ICJ A;  4J9Q A;  2VA8 A;  1HUO A;  4RQ3 A;  1XO1 A;  3KHG A;  4X5V A;  4YD1 A;  3PX4 A;  2ZH7 A;  4YMN A;  7ICR A;  2C28 A;  2KP7 A;  9ICT A;  2DR9 A;  5J0Q A;  4GXJ A;  5HMM A;  2C22 A;  5DQH A;  5DGB A;  3MFH A;  5J0R A;  4PH5 A;  4J9S A;  4F4X A;  5IIN A;  1WCL A;  7ICQ A;  3QEB Z;  2PBE A;  4FHW A;  4X0B A;  2ZH1 A;  1KFD A;  4UB3 A;  2ZH9 A;  1MIV A;  3NGD A;  4GC7 A;  2V4Q A;  4M9N A;  1MIW A;  3UPS A;  2ALZ A;  1TK0 A;  4DEZ A;  2PI5 A;  4BWJ A;  4EBE A;  1X9W A;  7ICP A;  1BPE A;  1EXN A;  5KTQ A;  5L1L A;  9ICE A;  4QW8 A;  4PGY A;  1RYS A;  3RJH A;  2W9C A;  3Q8Q B;  4BWM A;  4AT8 A;  4WCW A;  7ICV A;  4G3I A;  3RBD A;  2ZHB A;  8ICI A;  2PFO A;  5IIK A;  3RH4 A;  4DSI A;  3HIY A;  1TKD A;  3PML A;  5J0W A;  4DS4 A;  2FPK A;  4QZA A;  2JZB A;  1NK0 A;  3MR3 A;  1ZQS A;  5KG1 A;  5DB6 A;  1BVS A;  2XCA A;  3KHL A;  3KHR A;  4C8K A;  4F92 B;  3GII A;  2AQ4 A;  5DKW A;  4DFP A;  4QZH A;  3IHQ B;  5IIJ A;  3Q8K A;  1ZQC A;  4ECU A;  4ELU A;  4XA5 A;  4PPX A;  2XO7 A;  9ICC A;  1FA0 A;  5EOZ A;  2ZH6 A;  2KZZ A;  4MFA A;  1UA1 A;  2R8H A;  4DF4 A;  2PFP A;  4ZH4 A;  3PV8 A;  9ICX A;  5BOL A;  4QZ9 A;  4FBT A;  4IQW A;  2ZUB A;  4DOC A;  1U4B A;  4ED2 A;  8ICT A;  4J9K A;  2HHU A;  3WFO A;  5L1K A;  1S9F A;  2DPJ A;  1QLN A;  1R8A A;  3C66 A;  4DSL A;  1S10 A;  3FYH A;  7ICL A;  3RJJ A;  4UB2 A;  5C5J A;  5KT5 A;  5KFC A;  3LK9 A;  3LDA A;  1X9S A;  9ICU A;  3WFR E;  4KMU A;  2DRA A;  2BQR A;  3H39 A;  1CUK A;  2KFZ A;  9ICO A;  4RWO A;  4X4S A;  4NXZ A;  3HT3 A;  3PO5 A;  3B0X A;  4QW9 A;  1DGS A;  7ICI A;  2R8K A;  4WBZ A;  4DSK A;  5DQG A;  1JX4 A;  4FH3 A;  1D9D A;  1VJ7 A;  1RPL A;  2WTF A;  3QE9 Y;  4F2S A;  2HVH A;  4RNM A;  2PI4 A;  1TAU A;  9ICJ A;  3C21 A;  4LZG A;  8ICP A;  5DLG A;  1R89 A;  4EYI B;  3RB3 A;  4J9R A;  3AQN A;  4M9L A;  4UAZ A;  2MUT A;  1L3U A;  7ICO A;  4B9U A;  9ICW A;  4UD4 A;  4ATB B;  5DB9 A;  3PNC A;  2ZTD A;  5F9N A;  1RXW A;  4O5K A;  9ICS A;  2J6U A;  1BNP A;  2RDI A;  1ZQL A;  5KFT A;  4JK1 A;  3AUO A;  1LB2 B;  2V9W A;  3PO4 A;  4FH5 A;  1COO A;  4FHP A;  1Y88 A;  4Q8F A;  1KNY A;  2DVI A;  4YP3 A;  4RUC A;  2BQU A;  1KFT A;  3ORY A;  3TI0 A;  2UVR A;  5J2E A;  8ICO A;  4F91 B;  1TVA A;  7ICF A;  4Z6C A;  4FHY A;  2NRZ A;  3V72 A;  1DK3 A;  4F2R A;  3FDS A;  1XWL A;  2H5X A;  2XGP A;  4AT7 A;  1ZQD A;  5L1J A;  3PR4 A;  1T7P A;  5KG7 A;  4Q8E A;  3V6H A;  2W8K A;  4MFC A;  2AJQ A;  4YXJ A;  1QTM A;  4GXK A;  2AU0 A;  5J0U A;  2ASD A;  8ICM A;  4F93 B;  3SZ2 A;  1MSW D;  7ICH A;  8ICK A;  1PX5 A;  4MFF A;  5DB7 A;  2XY6 A;  2KZ3 A;  1TV9 A;  4MF8 A;  3OUY B;  3GIK A;  3PX6 A;  3MGI A;  5KFY A;  3V6K A;  4WC0 A;  4X4O A;  2FLP A;  1MQ2 A;  4F5N A;  4WC5 A;  5KFA A;  2MAX A;  5KG3 A;  3TAP A;  1ZJN A;  5DG8 A;  2HVI A;  3HJ4 A;  3GFK B;  5KT2 A;  5DDM A;  1Z3E B;  4RT3 A;  5D46 A;  3HW8 A;  3G6Y A;  4B9L A;  3E2E A;  5HRH A;  4WC3 A;  4UB4 A;  2FPL A;  4Q45 A;  4I27 A;  1ZQM A;  4DWI A;  1S76 D;  5CP2 A;  4NM1 A;  5IIO A;  1ZQI A;  4O3Q A;  3UXO A;  2XY7 A;  4RQ6 A;  3T5J A;  1TK5 A;  7ICG A;  2JEI A;  1NK7 A;  2C2R A;  2FMP A;  5DEC A;  3MR2 A;  5CHG A;  2ZTE A;  4TUP A;  3AU6 A;  3QZ7 A;  4ED7 A;  1XSN A;  2HHX A;  2NRK A;  1R8C A;  4YMM A;  1R8B A;  4NKT A;  5CB1 A;  4ECY A;  2UVU A;  4M04 A;  5HRL A;  5KG2 A;  4JWM A;  5BPC A;  4P4M A;  3PR5 B;  4KLD A;  2BCR A;  4KLI A;  2HHP A;  2ID1 A;  3H7I A;  1SKS A;  4YMO A;  3HWT A;  1K1Q A;  1D8Y A;  3OVA A;  3MDC A;  5F2V O;  4RPZ A;  2ASL A;  4KN7 A;  3RJF A;  4O3O A;  2W9B B;  1ZQO A;  2M2W A;  4ED0 A;  1NJX A;  2O5A A;  2BCV A;  5DG9 A;  3V6J A;  1U9L A;  4ECZ A;  4ED1 A;  9ICV A;  4EEY A;  4X4U A;  1S0O A;  1ZQR A;  2KTQ A;  4B9S A;  3V7K A;  1ZQN A;  1Z00 B;  1CEZ A;  1PZN A;  4YN4 A;  2Q0Z X;  4C8L A;  5KFO A;  2J6S A;  3AQM A;  1QSY A;  2ZH8 A;  3BQ1 A;  5EWG A;  5J2H A;  4RU9 A;  4ECS A;  4B9N A;  1X9M A;  4MEY A;  2ZJ5 A;  8ICV A;  1Q78 A;  9ICA A;  4C8N A;  4FS1 A;  1KRP A;  4O3S A;  2KZM A;  1V4A A;  3H8W A;  5DQI A;  1NK4 A;  2ZJ8 A;  1NKB A;  1KTQ A;  4LZD A;  5HHI A;  5KG5 A;  2KN7 A;  4DL4 A;  3RB4 A;  1U45 A;  2BCQ A;  4I2G A;  4Q43 A;  4C8M A;  4RQ5 A;  3EYZ A;  3Q8M A;  3BQ0 A;  3TFS A;  1UA0 A;  4WC1 A;  3OSP A;  4P4P A;  1D9F A;  3C2K A;  8ICJ A;  2NRW A;  2ZJA A;  5JUM A;  4EZ9 A;  4M0A A;  4F4Y A;  4EBD A;  2M2T A;  4PHD A;  4R8U A;  4P2H A;  1L3T A;  4IRC A;  4Z6D A;  1S0V A;  4ED6 A;  5J0Y A;  5KFP A;  3JYY A;  4RZR A;  3M8S A;  3JPQ A;  1HUZ A;  2AGO A;  4KLL A;  8ICS A;  9ICI A;  7ICE A;  4F4W A;  2FPM A;  3C1Y A;  2BHN A;  4DS5 A;  2PFQ A;  3MAB A;  4QZD A;  1HJP A;  2VA3 A;  4KLE A;  3OSN A;  2HW3 A;  3GIL A;  3TQ1 A;  4JUZ A;  1BPZ A;  3ZDD A;  4EZ6 A;  9ICM A;  4QZ8 A;  2NRT A;  5HRF A;  4NLZ A;  2A1J B;  2F1I A;  2Y1J A;  5KFJ A;  1Q79 A;  3WFP A;  2C2D A;  8ICE A;  4JV0 A;  4AT9 A;  1JXE A;  5HNK A;  4M9G A;  5KFG A;  1BPB A;  4F5Q A;  1L3V A;  4RT2 A;  4IQU A;  4R64 A;  2BPC A;  4F5O A;  4WC6 A;  4J9P A;  2IHM A;  1WOT A;  8ICY A;  8ICF A;  3ZDC A;  3GV5 B;  4WC7 A;  5J0O A;  8ICL A;  1KFS A;  1JN3 A;  1BNO A;  3AU2 A;  4QZF A;  4GXI A;  4ED3 A;  4EYH B;  5TZV A;  4RPX A;  3T5K A;  3ZD9 A;  2JEF A;  4M2Y A;  3NTU A;  4PHP A;  3N4M B;  7ICK A;  1ZQY A;  1TFR A;  3RR7 A;  4KLO A;  4KLS A;  5J0S A;  4YR3 A;  5KFX A;  3HP6 A;  3C23 A;  2W9C B;  3EPI A;  4J9O A;  1RYR A;  1NKE A;  4FBU A;  7ICS A;  4RPY A;  4AT8 B;  5KFW A;  1ZQT A;  4O0I A;  4RNO A; 
#chains in the Genus database with same CATH topology
 4M9J A;  5AHX A;  1NKC A;  4PL1 A;  3F2C A;  5CFS A;  5DLF A;  2E8N A;  5BOM A;  3NYB A;  3KD3 A;  2ISO A;  5HC9 A;  3KKA A;  2H3F A;  4HYK A;  5KFV A;  2XC9 A;  1A77 A;  4C7Z A;  2P6U A;  4QZB A;  4GIB A;  3Q8S B;  4EGW A;  4X4T A;  1N63 A;  8ICA A;  4QWA A;  3OJS A;  4YG2 A;  4UBC A;  3OUY A;  3RJG A;  2BDP A;  4FHX A;  1NZB A;  1ZQK A;  4PZO A;  3SMV A;  1NOM A;  4EBC A;  9ICK A;  1YT3 A;  5KFR A;  2C2E A;  2KVS A;  4I2D A;  3AEV A;  4I2B A;  8ICQ A;  2YB4 A;  2OHF A;  3MFI A;  4KB6 A;  1JAJ A;  1ZQW A;  5L1I A;  2ATL A;  2VA2 A;  4X4N A;  4U7C A;  3HX0 A;  2MUT B;  2KIC A;  3IM1 A;  3LQC B;  1X6I A;  4DLE A;  4EBK A;  1ZD3 A;  2KHQ A;  2YMQ A;  2Y0S C;  5HRK A;  1ZQU A;  2HHV A;  4B6J A;  3HJ1 A;  2P35 A;  4AT7 B;  5HRD A;  4FZM A;  1JMS A;  7ICN A;  4O67 A;  2LPE A;  4F4K A;  3PW7 A;  1X2I A;  4IR9 A;  4FHV A;  4QZI A;  3KTQ A;  4JV2 A;  1MN8 A;  2D3D A;  4KLT A;  8ICN A;  3Q8R B;  5J0X A;  1SWV A;  1QQ7 A;  3KBB A;  2QAR B;  3LYS A;  4O6A A;  4KTQ A;  4DQI A;  8ICG A;  2GAF D;  2HHQ A;  2BKE A;  2RLT A;  1N5W A;  1WYG A;  4EBJ A;  2ES6 A;  3CRX A;  4F3O A;  2WF8 A;  1RXV A;  4CF4 A;  3H8S A;  5KG6 A;  4TQR A;  3RFA A;  2UVW A;  1WOT A;  3SV4 A;  8ICC A;  1UEV A;  4IQT A;  4I2J A;  4DO9 A;  7ICU A;  3C1Z A;  3D2N A;  4BUG A;  5J2I A;  4KLM A;  2AXT U;  4OAG A;  4Y2V A;  5J8Y C;  4IQV A;  4NLN A;  5D61 A;  5KFD A;  2HOF A;  2DF4 B;  3DDH A;  4C4R A;  4IL6 U;  1B43 A;  2BQ3 A;  3HRD D;  5AIC A;  3C29 A;  5CJ7 A;  4DFK A;  4I2H A;  2BGW A;  4R8U B;  9ICB A;  3N7R C;  4GLX A;  4UAR A;  4UB8 U;  3LWM A;  3TAQ A;  1SL2 A;  3WU2 U;  3UXN A;  2B6G A;  2ZH2 A;  3PST A;  5AI8 A;  3C18 A;  2P6R A;  3OHA A;  3AM9 A;  4Y2P A;  1SKR A;  2DR8 A;  4QJF B;  2AGP A;  5AKY A;  1BGX T;  2HBJ A;  1Q8K A;  3OHB A;  4XRH A;  4KN4 A;  4K9A A;  2ZH4 A;  4P4O A;  4WC4 A;  5GTI U;  7ICM A;  4LEV A;  1RQL A;  4PGX A;  3GV8 B;  4Z6F A;  2HOI A;  1L8O A;  3UMB A;  2KIW A;  5C0Y A;  1NNL A;  2W9B A;  3RB6 A;  2CRX A;  1SKW A;  3LVV A;  2O1P A;  2DR5 A;  8ICU A;  1ED1 A;  3BQ7 A;  1NJW A;  5AI9 A;  3WK4 A;  4YR0 A;  2EAO A;  1VDV A;  1SL0 A;  2HMX A;  4CCH A;  2EZZ A;  3C5F A;  3RRH A;  4K97 A;  3PW4 A;  1ARO P;  4Z6E A;  3H37 A;  1QQ6 A;  1P7D A;  3ALR A;  1NJZ A;  1K1S A;  2KFN A;  1L3S A;  4K4I A;  4EP7 A;  2JEJ A;  4ECW A;  7ICT A;  4Y2Y A;  3WKC A;  3MBY A;  4C8O A;  4RWN A;  1UET A;  1ZET A;  2KSO B;  2OXO A;  5AKL A;  2KIV A;  1ZQQ A;  2K4E A;  2JR5 A;  1XO1 A;  2VKQ A;  4RQ3 A;  5AK3 A;  7ICR A;  1HIW A;  9ICT A;  2DR9 A;  4GXJ A;  5AKJ A;  3MFH A;  4J9S A;  2ZH9 A;  2ZH1 A;  5AM5 A;  4GC7 A;  4M9N A;  2QLT A;  3FM9 A;  5AIB A;  3KFU F;  4PGY A;  4G3I A;  8ICI A;  2PFO A;  4IS7 A;  1TKD A;  2N1R A;  4QZA A;  1F5S A;  2JZB A;  2HOQ A;  1RG6 A;  4OCZ A;  4OO1 J;  3KHR A;  3KHL A;  4F92 B;  4KMO B;  4DFP A;  4ECU A;  2XO7 A;  4G9B A;  2ZH6 A;  3OTQ A;  2HHU A;  1S9F A;  5HR7 A;  1S10 A;  3RJJ A;  5KT5 A;  1X9S A;  4KMU A;  9ICO A;  3PO5 A;  3B0X A;  2R8K A;  1RPL A;  3QE9 Y;  2AH5 A;  1TAU A;  9ICJ A;  4LZG A;  1R89 A;  4EYI B;  4J9R A;  4UAZ A;  4P0Q A;  3SR6 A;  3PNC A;  4WQL A;  2V9W A;  3PO4 A;  4Q8F A;  3N7P D;  4RUC A;  3ORY A;  3TI0 A;  5L1M A;  3HJE A;  2Y9U A;  3FDS A;  2XGP A;  3IDW A;  1ZQD A;  3V6H A;  4MFC A;  4NXX A;  2A19 A;  4OAI Z;  2AU0 A;  4F93 B;  1YZ7 A;  3SZ2 A;  4LEZ A;  1PX5 A;  5ALJ A;  5DB7 A;  2KZ3 A;  3PX6 A;  3QU5 A;  3V6K A;  4X4O A;  4WC5 A;  5KFA A;  2MAX A;  1ZJN A;  3HJ4 A;  3IG8 A;  3NVZ A;  3WKD A;  2VIX A;  3BZC A;  5HRH A;  4DFD A;  2GO7 A;  5K4L A;  5CP2 A;  4NM1 A;  7ICG A;  1DRG A;  5DEC A;  3MR2 A;  1XSN A;  3QZ7 A;  5CFU A;  1R8B A;  5CB1 A;  1SV0 A;  4JWM A;  5BPC A;  5ALN A;  5ALY A;  4OAH A;  2HHP A;  4YMO A;  3HWT A;  3AN1 A;  3MDC A;  2WAQ C;  1GPJ A;  4KN7 A;  1ZRM A;  4ICA A;  4ECZ A;  9ICV A;  4B9S A;  5ALK A;  3V7K A;  1SV4 A;  1QSY A;  4KX3 A;  2ZH8 A;  1Q78 A;  4RU9 A;  1X9M A;  5AK5 A;  2JXJ A;  3EYZ A;  2K4H A;  3Q8M A;  3TFS A;  1OW5 A;  5JUM A;  4M0A A;  2JRZ A;  4F4Y A;  5JTG A;  5E79 U;  4ED6 A;  4RZR A;  1HUZ A;  9ICI A;  2HSZ A;  1V38 A;  2FPM A;  2BHN A;  2I6X A;  1SB3 C;  2WF9 A;  2VA3 A;  4KLE A;  3TQ1 A;  1BPZ A;  4JUZ A;  3M7D A;  4NLZ A;  2IHO A;  2ZXI A;  1WWV A;  1JXE A;  2DUY A;  5HNK A;  3F5A A;  1BPB A;  2IHM A;  4OJ5 A;  2A1A A;  4CF5 A;  1BNO A;  3AU2 A;  5AKG A;  4RPX A;  3ZD9 A;  4BX9 C;  4YR3 A;  4FBU A;  3C23 A;  1NKE A;  3QUB A;  5AM0 A;  4O0I A;  4OJ6 A;  2HI0 A;  4UAY A;  1ZQA A;  3RR8 A;  2MA1 A;  4E7X A;  1ZQJ A;  1UQV A;  1F0M A;  4USA A;  3V7L A;  5KAI U;  2JH7 A;  4DSF A;  3NAS A;  4O68 A;  4KIT B;  1SL1 A;  2Q4T A;  4DQS A;  3PSP A;  3ZDA A;  2BR0 A;  4K4G A;  4F5P A;  5J2J A;  1S97 A;  1WCN A;  1TFY A;  3C2L A;  4E0D A;  2HHT A;  9ICL A;  1B22 A;  5AM4 A;  4BXO A;  3WFS C;  4O3N A;  4RQ7 A;  2IBK A;  4KLH A;  4RQN A;  4X4R A;  2I5H A;  1XS9 D;  4IR1 A;  8ICR A;  2E8P A;  2E1E A;  2ZIW B;  2DFL A;  3JPN A;  2JEG A;  5D4B A;  1L8L A;  4QWE A;  3EW9 A;  4UAU A;  4F72 A;  8ICB A;  3GIM A;  2FLN A;  1Z1B A;  4JWN A;  4NJ8 A;  1BPD A;  4FFD A;  3OJU A;  5DDY A;  3SEI A;  4GC6 A;  4MKP A;  1WG8 A;  5L9X A;  5FP0 A;  3ETR A;  4NLC A;  1UT8 A;  5KAF U;  1KDH A;  1KEJ A;  2B0C A;  4J03 A;  2R8G A;  2LYB A;  4DL5 A;  1XSL A;  3H0R B;  3ZDE A;  5EWE A;  3DEE A;  1ZQB A;  4ZOH C;  3OV7 A;  3UQ0 A;  3M6K A;  1QSL A;  2XCP A;  1FIQ A;  2F76 X;  1T4G A;  2F3N A;  3NVW A;  3BS5 B;  5EWF A;  1QCK A;  2B21 A;  4OAF A;  3THV A;  4A8E A;  4KM5 A;  5HRG A;  3OVS A;  8ICZ A;  2M9N A;  3B0Y A;  4O5E A;  4M5D A;  2NRX A;  3QEA Z;  4ECV A;  3CYM A;  2BPG A;  1ZQH A;  3CK6 A;  3TAR A;  3M9M B;  1ZQV A;  4F50 A;  4UB1 A;  2Q66 A;  1SZH A;  4IG8 A;  1IXR A;  3C2M A;  4HAI A;  5KFS A;  4DF8 A;  9ICR A;  4RQ8 A;  2K60 A;  2ZH5 A;  3BQT A;  3MGH A;  3AQF A;  3E0F A;  1MC8 A;  2ZIU A;  4TUQ A;  2R8I A;  4DLG A;  5J2F A;  4DSE A;  2J6T A;  2FJ6 A;  4NLK A;  1L7N A;  2F8L A;  4NWI A;  5D49 A;  4PZN A;  2W11 A;  2AGQ A;  1N61 A;  1OU5 A;  4AT9 B;  3ED5 A;  2KVC A;  3M9N B;  5ALT A;  2EAP A;  2F8K A;  5KFU A;  4O5C A;  8ICX A;  3QU2 A;  4ECR A;  3D2S A;  4WOY A;  4F4Z A;  4XQ8 A;  4FO1 A;  1ZQZ A;  5J0T A;  1IM4 A;  9ICP A;  4R66 A;  5DGA A;  4KLF A;  4I29 A;  3SD7 A;  5KFM A;  2V4R A;  9ICF A;  2NRV A;  4I0U A;  5IIM A;  5AI0 A;  2I9G A;  3AL0 B;  1FFU A;  4F8R A;  4CE6 A;  2DRA A;  1Z00 A;  3FC4 A;  1U48 A;  4IRK A;  2KJ8 A;  2RHF A;  5HML A;  1D8L A;  2KOB A;  2Y9T A;  2ZIX B;  2JGA A;  3T5L A;  4DQR A;  4US9 A;  3QNM A;  5KG0 A;  2QB0 B;  3T3F A;  1TAQ A;  3NUQ A;  2EAN A;  3TAN A;  1C7Y A;  1A76 A;  2ISP A;  3N97 B;  4J9M A;  4Q44 A;  4OJP A;  1NK5 A;  3RAX A;  2ZUC A;  4K99 A;  2H3V A;  2MSN A;  5AK4 A;  1KQQ A;  2KKV A;  2WF6 A;  1ZQE A;  3QUC A;  4KLU A;  1UEU A;  2DL0 A;  4B9T A;  4RWP A;  7ICJ A;  4J9Q A;  2YMM A;  4N7R A;  4P0P A;  4X5V A;  2ZH7 A;  5HMM A;  2C22 A;  7ICQ A;  3NGD A;  1MIW A;  3UPS A;  1TK0 A;  4DEZ A;  2PI5 A;  1X9W A;  7ICP A;  4QW8 A;  1RYS A;  3RJH A;  2KJ5 A;  4BWM A;  4WCW A;  7ICV A;  2CN1 A;  3RBD A;  2ZHB A;  5IIK A;  4DSI A;  4DCC A;  3HIY A;  4EEB A;  4DS4 A;  2FPK A;  2KKP A;  3MC1 A;  2YX8 A;  4NL9 A;  3WK7 A;  1NK0 A;  4XJE A;  1ZQS A;  5AKX A;  1O03 A;  1BVS A;  3ER9 B;  4GFJ A;  5DKW A;  4ELU A;  4PPX A;  1FA0 A;  2PMZ F;  1UA1 A;  5ALI A;  1ZD4 A;  2PFP A;  4ZH4 A;  3PV8 A;  3B9J A;  5ALU A;  3SAF A;  4IQW A;  4MHV A;  4ED2 A;  8ICT A;  4J9K A;  1QLN A;  2DPJ A;  2KMD A;  4DSL A;  4JB3 A;  4CF3 A;  3FYH A;  7ICL A;  4PJ0 U;  3LDA A;  4WH5 A;  4X4S A;  2IOF A;  4RWO A;  4QW9 A;  2HBL A;  4DSK A;  5DQG A;  1D9D A;  1VJ7 A;  2K4I A;  2XIC A;  2PI4 A;  3M6Z A;  5ALP A;  8ICP A;  3AQN A;  4M9L A;  3NKU A;  2EQY A;  5CHE A;  2MUT A;  1L3U A;  7ICO A;  4ATB B;  5DB9 A;  1RXW A;  3H0M B;  1BNP A;  2RDI A;  1ZQL A;  1LB2 B;  4JK1 A;  3AUO A;  1Y88 A;  2DVI A;  2YY6 A;  4NXV A;  4F91 B;  1TVA A;  7ICF A;  3V72 A;  1DK3 A;  4F2R A;  1XWL A;  2H5X A;  4AT7 A;  1ZOL A;  4C0Z A;  1PVR A;  1T7P A;  5KG7 A;  4U6P A;  2W8K A;  1QTM A;  2ASD A;  3A0B U;  8ICK A;  3KOO A;  4MF8 A;  2MRL A;  3N7S C;  3TAP A;  2W7O A;  3HW8 A;  5KT2 A;  5DDM A;  1Z3E B;  3SEN A;  3E58 A;  5ALV A;  5D46 A;  3E2E A;  2B51 A;  4WC3 A;  3PSF A;  4C80 A;  2FPL A;  4Y2J A;  5ALR A;  4Q45 A;  1ZQM A;  2FDR A;  2Z7J A;  2QAR A;  4O3Q A;  3T5J A;  1TK5 A;  1NK7 A;  3ONN A;  2FMP A;  4JMU A;  2ZTE A;  1R8C A;  5F3X B;  3I76 A;  5HRL A;  4ECY A;  1XO0 A;  2BDU A;  4KLI A;  1SIJ A;  3H7I A;  5F2V O;  5TIS U;  4O3O A;  1ZQO A;  2O5A A;  2BCV A;  5DG9 A;  1CI4 A;  2QB1 A;  3V6J A;  3L4P A;  5JU5 A;  2ZIV B;  4ED1 A;  1JAL A;  3FAH A;  4YN4 A;  3MGV A;  2J6S A;  2EH9 A;  5AKH A;  1SWW A;  3BQ1 A;  3IV6 A;  3LVW A;  4MEY A;  2ZJ5 A;  9ICA A;  4Y2Q A;  4FS1 A;  4O3S A;  3H8W A;  2ZJ8 A;  3GZF A;  2WF7 A;  4LZD A;  5KG5 A;  3RB4 A;  1F44 A;  4I2G A;  4Q43 A;  1D9F A;  3AMZ A;  2NRW A;  4EZ9 A;  2YML A;  4K8V A;  4R8U A;  4IRC A;  3JYY A;  3JPQ A;  3C1Y A;  2PFQ A;  2HW3 A;  9ICM A;  3ZDD A;  1N5X A;  2A1J B;  4JV0 A;  1SXE A;  4IQU A;  4F5O A;  2BPC A;  8ICY A;  8ICL A;  4ED3 A;  5TZV A;  3T5K A;  3NTU A;  4PHP A;  3RR7 A;  4NXT A;  5KFX A;  2W9C B;  4AT8 B;  2PKE A;  4RPY A;  5KFW A;  1GO3 F;  4RNO A;  4I28 A;  2DPI A;  2IHN A;  1DOQ A;  2RFF A;  3VC8 A;  4LVS A;  4KLQ A;  5KFZ A;  1KW4 A;  2WB1 F;  4NXU A;  4EED A;  2KE7 A;  3K4G A;  1MQ3 A;  2DR7 A;  4DSJ A;  3H40 A;  1KSP A;  1JXL A;  3EWA A;  3RJE A;  2DKZ A;  4I2A A;  1V85 A;  1UCV A;  2XGQ A;  2D8C A;  1ZQF A;  5ALG A;  3PW5 A;  3RF9 A;  5D63 A;  3JPS A;  2W9M A;  3JPT A;  5DBA A;  4LT6 A;  2DRB A;  2H3Q A;  3WKA A;  1IV8 A;  4DQQ A;  5KL1 B;  3BQ2 A;  2UVV A;  4MF2 A;  1DGJ A;  1COK A;  5AI5 A;  3AQL A;  2KSO A;  3RJK A;  3HKZ F;  4O3R A;  5HRE A;  4DFM A;  1NK6 A;  4KX5 A;  5EE1 A;  4K9B A;  4R65 A;  2RQ5 A;  4NY8 A;  2HBK A;  2HBM A;  4UAS A;  4C7Y A;  4RQ0 A;  4B9M A;  5ALX A;  5KFI A;  3CP8 A;  4RQ4 A;  3SI8 A;  3K75 D;  5KL8 B;  3F2B A;  4M47 A;  3ISD A;  3GV7 B;  5KFE A;  5DBC A;  1YLQ A;  8ICW A;  3Q8P B;  4S3N A;  2DQN B;  5B3Q A;  5AM3 A;  5KFQ A;  5DB8 A;  4PHA A;  3TAD C;  4YVZ A;  1K5O A;  4O9M A;  5KT7 A;  4UW9 A;  2IOH A;  2VAN A;  3JPR A;  4EEN A;  2K8C B;  4UAW A;  2FMQ A;  1KBU A;  3RAQ A;  4QZG A;  5AM2 A;  5J2A A;  3KHH A;  1A0P A;  3Q8L A;  1IG6 A;  2B4V A;  2EDU A;  2KD1 A;  1T8E A;  3GQC A;  1N2X A;  4NKU A;  3QU4 A;  3QUT A;  5JRT A;  2I1Q A;  2OH2 A;  4DFJ A;  4K4H A;  2WB1 C;  4EX7 A;  3PVX A;  3I28 A;  3MDA A;  1FEZ A;  4IRD A;  1L7O A;  3GDX A;  4LEY A;  2PXI A;  4RQ2 A;  2BCS A;  1L7P A;  1ZD2 P;  4ECQ A;  1B4F A;  4XQ7 A;  5DED A;  1UHU A;  2HHW A;  5KFB A;  1ZQG A;  2A3V A;  4R63 A;  1NO5 A;  5AKK A;  5HHH A;  1S77 D;  4WJ3 B;  3HPO A;  1O08 A;  4PGQ A;  3H4B A;  3PMN A;  3SYZ A;  3H38 A;  5G5G A;  4QWB A;  4XUS A;  3UXP A;  2BBJ A;  1N56 A;  5KFL A;  4TQS A;  5J2K A;  2LKY A;  3RH6 A;  2F77 X;  1SZP A;  2M0N A;  3HKZ C;  4NLG A;  2BZF A;  4YD2 A;  3C5G A;  2FMS A;  1RQN A;  1N62 A;  2G09 A;  4DL7 A;  1T3N A;  2GH1 A;  4O3P A;  5HRI A;  3CW2 C;  1Z4O A;  3WFQ E;  3IN5 A;  3F53 A;  8ICH A;  1UT5 A;  4ELT A;  1S0M A;  5KT3 A;  4WBY A;  2GA9 D;  5EE3 A;  4ECT A;  5EE9 A;  5B66 U;  1L7M A;  3TFR A;  3KZX A;  3SAG A;  5AKI A;  5ALH A;  2HHS A;  3JPO A;  3RTV A;  4FS2 A;  1PVP A;  5ALE A;  3WKB A;  4WC2 A;  2BE3 A;  3MR6 A;  2LM1 A;  3IP4 B;  1MA7 A;  5J2B A;  4ELV A;  5J2C A;  1D8B A;  4I2I A;  5CWR A;  5D62 A;  2FLL A;  1XC9 A;  4RQ1 A;  4YQW A;  5CR0 A;  2LBO A;  3UPQ A;  1JRO A;  2LYA A;  2R18 A;  3JZ0 A;  3WK8 A;  1ZJM A;  5ALQ A;  1LV5 A;  4RNN A;  3OVB A;  2OCE A;  5J29 A;  4YFK A;  5DG7 A;  1L5U A;  2P66 A;  2G06 A;  2NYV A;  2AHO B;  2G08 A;  3KHG A;  4YMN A;  3D2Q A;  2C28 A;  1J2N A;  3ERC C;  5J0Q A;  5DGB A;  5J0R A;  3U26 A;  4PH5 A;  4F4X A;  1WCL A;  4FHW A;  4X0B A;  2Y0S F;  1B0X A;  5AKE A;  4FZN A;  4UAV A;  3NRZ A;  2CXY A;  4BWJ A;  1WUD A;  3ER8 C;  5KTQ A;  1EXN A;  5L1L A;  9ICE A;  2HN1 A;  3Q8Q B;  1A6S A;  2W04 A;  5J0W A;  2WFA A;  3NVY A;  3GII A;  3Q8K A;  4QZH A;  3IHQ B;  5IIJ A;  1ZQC A;  3OWG A;  4XA5 A;  1KKX A;  3A0H U;  4MFA A;  2R8H A;  4DF4 A;  5BOL A;  2BBH A;  4FBT A;  1ECW A;  3H0L B;  1L6N A;  3PHZ A;  1OUQ A;  5CEH A;  1R8A A;  2NO4 A;  4FZL A;  5KFC A;  3LK9 A;  5T14 A;  2BQR A;  1CUK A;  5AIA A;  4NXZ A;  1ZD5 A;  1HEK A;  1X6J A;  7ICI A;  5ALZ A;  2WTF A;  1Z4N A;  3JCF A;  3C21 A;  2HN2 A;  5DLG A;  1PUZ A;  3RB3 A;  3S6J A;  1Q3V A;  9ICW A;  4Y2T A;  5F9N A;  3TKA A;  2ZIW A;  9ICS A;  3HIL A;  4FHP A;  4FH5 A;  2E1F A;  2W54 A;  3QX7 A;  4QIW F;  4UB6 U;  5L1J A;  4Q8E A;  4YXJ A;  4GXK A;  1TE2 A;  1MSW D;  2CPR A;  2E3T A;  5J8Y A;  3IG5 A;  2XY6 A;  2NO5 A;  3GIK A;  4WC0 A;  5KFY A;  1J2M A;  2FLP A;  4F5N A;  2HVI A;  5DG8 A;  1X9X A;  3GFK B;  4RT3 A;  2EWR A;  4FE3 A;  3AQE A;  4UB4 A;  1RDF A;  3L3F X;  2HDO A;  4C4T A;  1JRP A;  3TAC B;  5IIO A;  3UXO A;  1SGG A;  4RQ6 A;  4ACO A;  2XY7 A;  2JEI A;  2C2R A;  2W3S A;  4ED7 A;  2NRK A;  4YMM A;  4NKT A;  1LVH A;  4NV0 A;  3BS5 A;  5KG2 A;  4KLD A;  2BCR A;  2H3I A;  1D8Y A;  1K1Q A;  4RPZ A;  5CRX A;  2W9B B;  3I1Y A;  4X4U A;  2QKQ A;  1S0O A;  1ZQN A;  3KKA C;  2GOL A;  4C8L A;  2KK0 A;  5EWG A;  4ECS A;  4C8N A;  2DBY A;  5DQI A;  1NK4 A;  1NKB A;  4DL4 A;  4K96 A;  2DKX A;  3K7D A;  4RQ5 A;  3BQ0 A;  4WC1 A;  8ICJ A;  4P4P A;  2ZJA A;  1KN5 A;  4AP9 A;  2GLE A;  4NXW A;  1OXJ A;  2W55 A;  4P2H A;  5EE0 A;  3M8S A;  4KLL A;  2AGO A;  2XVT A;  4DS5 A;  2NV3 A;  4QZD A;  3OSN A;  4EZ6 A;  5ALS A;  4QZ8 A;  2Y1J A;  5KFJ A;  3WFP A;  8ICE A;  1FFV A;  4AT9 A;  1IIP A;  4M9G A;  4F5Q A;  1L3V A;  1V97 A;  8ICF A;  3ZDC A;  3GV5 B;  5H2F U;  4WC7 A;  5J0O A;  4CDG A;  1JN3 A;  4QZF A;  4GXI A;  4EYH B;  3H8M A;  2JEF A;  4M2Y A;  2FE9 A;  2G07 A;  4K98 A;  1ZQY A;  1TFR A;  1QH9 A;  1X40 A;  4HX0 A;  4IC9 A;  4QIW C;  2ODG A;  2KEY A;  2OYY A;  2F44 A;  1BPX A;  1SXD A;  3QYP A;  2JZB B;  3J81 j;  5KFN A;  1ZRN A;  5KG4 A;  1V9P A;  4KLJ A;  2E8M A;  1XSP A;  5KFH A;  3JPP A;  2DWQ A;  4OD0 A;  1RYU A;  2EAM A;  4ED8 A;  2PFN A;  1KL9 A;  2ZIX A;  4DL3 A;  3EPG A;  1X42 A;  3IRU A;  2QB0 A;  4WQK A;  2M2U A;  2LHT A;  4RWQ A;  4X0A A;  1WWU A;  3RBE A;  3WK6 A;  2W8L A;  3GIJ A;  3PW0 A;  3M9O B;  1T3Q A;  4OJL A;  4PHE A;  2XID A;  3EZ5 A;  4RUA A;  4BDP A;  4RQM A;  4LJX A;  4E8F A;  2ESE A;  4P0Q B;  1TK8 A;  2H3Z A;  5AK6 A;  2ZTC A;  2K89 A;  2YN4 A;  9ICG A;  5CA7 A;  4NL9 C;  2EZY A;  3ISC A;  9ICQ A;  4NM2 A;  1FO4 A;  3OGU A;  2IMW P;  1XNS A;  2D6F C;  3BJY A;  1N60 A;  3SV3 A;  5KT4 A;  4I2C A;  3BDP A;  3RH5 A;  3PX0 A;  4DOA A;  5ALW A;  3ZDB A;  3CNH A;  1JQR A;  2KJ9 A;  1NK8 A;  4UD5 A;  3UQ2 A;  3C28 A;  2FI1 A;  5KFF A;  1RZT A;  9ICN A;  4F5R A;  2E5S A;  2LM4 A;  3V7J A;  1MIY A;  2ZH3 A;  4UQG A;  1QSS A;  3QXG A;  2PMZ C;  1F5A A;  4EEK A;  4QWC A;  4EX6 A;  4M6W B;  4J9N A;  2KG5 A;  1ZXI A;  3ETL A;  4X4Q A;  1TFW A;  4YCX A;  2MU2 A;  3BZK A;  1U49 A;  1U47 A;  3OPX A;  4DOB A;  5HP4 A;  1S0N A;  4DQP A;  2VJ5 A;  5J2D A;  4UBB A;  4UAT A;  5KFK A;  5J2G A;  3LWL A;  4KLG A;  4O3M A;  5DBB A;  3DV9 A;  1PK3 A;  3QZ8 A;  2GWS A;  4J9L A;  2JHD A;  2JMG A;  5A0L A;  4FO6 A;  2W03 A;  4DL2 A;  3ZI4 A;  3GU3 A;  1JI7 A;  2WAQ F;  2G0A A;  3NVO A;  3O0F A;  2F1J A;  4YR2 A;  1URJ A;  1ZQ1 C;  5KNI A;  5HR6 A;  2R8J A;  4ATB A;  4JLX A;  5IIL A;  1LKY B;  3UMG A;  4I2F A;  3PZP A;  4OJO A;  1JIH A;  1PVQ A;  5KT6 A;  3T5H A;  3VCB A;  5ALF A;  4DL6 A;  4E80 A;  2IA6 A;  2LYH A;  3G6V A;  4ECX A;  5HR9 A;  5J0P A;  3QU9 A;  1NJY A;  3PW2 A;  4Y2X A;  1BPY A;  2RDJ A;  2YQE A;  1KLN A;  3EF2 A;  1VFG A;  3F2D A;  3TAD A;  1C20 A;  4O69 A;  1NZP A;  5ALD A;  2G5I B;  2M2V A;  5B3P A;  2WHE A;  3WK9 A;  1S8O A;  3RRG A;  1NK9 A;  1XU4 A;  3H4D A;  4QNL A;  1ZQX A;  2OM6 A;  1ZYQ A;  4I2E A;  4Y2S A;  4TUR A;  3RJI A;  3L9D A;  3ISB A;  3M1Y A;  2ZHA A;  2K8A A;  1PK1 B;  3PSI A;  2BPF A;  3K1Z A;  3ZD8 A;  2Y1I A;  2W9A A;  2XY5 A;  4JV1 A;  5AM1 A;  4M9H A;  2ZIV A;  4CGZ A;  2AQ0 A;  4F71 A;  1ZQP A;  4X4V A;  1H38 A;  3PY8 A;  2W3R A;  2OWO A;  5AI4 A;  2YB1 A;  5CFT A;  3AQK A;  3M8R A;  3G6X A;  5III A;  3NVV A;  1N48 A;  3WK5 A;  2ZUD A;  4MEX A;  4M6W A;  3SQI A;  4UB5 A;  5ALO A;  4C4S A;  2F1H A;  4TUS A;  2ASJ A;  4BXO B;  3H8J A;  4YXM A;  4X4P A;  4QZC A;  2F2A B;  3QU7 A;  4BGD A;  4B9V A;  3D6J A;  3MR5 A;  4QZE A;  4QWD A;  3RB0 A;  5F9L A;  3MCR A;  1QQ5 A;  4EEL A;  3H3A A;  5G5H A;  4LEW A;  2BCU A;  1T94 A;  2RRD A;  1DK2 A;  1CRX A;  2L5Y A;  9ICH A;  3N28 A;  2A1J A;  3R9K A;  2VA8 A;  1HUO A;  4YD1 A;  3PX4 A;  2KP7 A;  2W43 A;  2ZG6 A;  5DQH A;  2VJ4 A;  1S5L U;  5IIN A;  4Y2R A;  3QEB Z;  2PBE A;  1KFD A;  4UB3 A;  1Q3U A;  1UPH A;  1MIV A;  2V4Q A;  3SAH A;  2ALZ A;  4CNQ A;  4EBE A;  1LKY A;  3NS1 A;  1BPE A;  5JTI A;  2W9C A;  4AT8 A;  1VJ5 A;  4BJQ A;  2LMR A;  2JV3 A;  1NI3 A;  4PL2 A;  2ZXH A;  3RH4 A;  3PML A;  4Y2U A;  3EUB 2;  5AKZ A;  3MR3 A;  2EZX A;  5KG1 A;  5DB6 A;  2XCA A;  4C8K A;  2AQ4 A;  3QUQ A;  9ICC A;  5EOZ A;  3L5K A;  2KZZ A;  1M6Y A;  9ICX A;  4QZ9 A;  4AYB F;  2ZUB A;  4DOC A;  1U4B A;  3WFO A;  5L1K A;  3C66 A;  3BS7 A;  4UB2 A;  5C5J A;  9ICU A;  3WFR E;  1DXS A;  3H39 A;  2K8B B;  2KFZ A;  1SV0 C;  3HT3 A;  1DGS A;  4WBZ A;  1JX4 A;  4FH3 A;  5ALM A;  4F2S A;  2HVH A;  4RNM A;  2O6K A;  4NLB A;  1PK1 A;  5ALL A;  4B9U A;  4UD4 A;  4O5K A;  2ZTD A;  2J6U A;  5KFT A;  5B5E U;  1COO A;  2OEH A;  1KNY A;  4YP3 A;  2BQU A;  1KFT A;  2UVR A;  5J2E A;  1X66 A;  8ICO A;  4Z6C A;  4FHY A;  2NRZ A;  2ZIU B;  1Z1V A;  3NWI A;  2JH1 A;  3PR4 A;  2G5H B;  3WKE A;  2AJQ A;  4JLZ A;  5J0U A;  8ICM A;  7ICH A;  2XI9 A;  4MFF A;  1TV9 A;  3OUY B;  3MGI A;  1MQ2 A;  5KG3 A;  3ICX A;  3KZI U;  1AQ6 A;  2YTU A;  4B9L A;  3G6Y A;  3T79 A;  2KHV A;  4I27 A;  2YMP A;  4DWI A;  1S76 D;  1ZQI A;  5CHG A;  4TUP A;  2E8O A;  3AU6 A;  2HHX A;  2UVU A;  4M04 A;  4P4M A;  3PR5 B;  2ID1 A;  1SKS A;  3OVA A;  2ASL A;  3RJF A;  2M2W A;  4ED0 A;  1NJX A;  2K4P A;  1U9L A;  3K1R B;  4EEY A;  1YZ6 A;  1ZQR A;  2KTQ A;  1CEZ A;  1Z00 B;  1PZN A;  2Q0Z X;  5KFO A;  3AQM A;  5J2H A;  4B9N A;  8ICV A;  2RP5 A;  2FCL A;  1KRP A;  2KZM A;  1V4A A;  2IUB A;  2BCQ A;  1KTQ A;  5HHI A;  1U45 A;  2KN7 A;  4AYB C;  1J97 A;  4C8M A;  1UA0 A;  3OSP A;  3C2K A;  4EBD A;  2M2T A;  4EV6 A;  4PHD A;  2DGZ A;  1L3T A;  4Z6D A;  1S0V A;  5GTH U;  5J0Y A;  5KFP A;  2B56 A;  8ICS A;  1RM6 C;  7ICE A;  4F4W A;  5HRB A;  1VLB A;  2HCF A;  1HJP A;  3MAB A;  3GIL A;  5HRF A;  2KNJ A;  2NRT A;  2LI6 A;  2F1I A;  3F5E A;  1JUD A;  4P0P B;  1Q79 A;  2C2D A;  1TAM A;  3UM9 A;  5KFG A;  4RT2 A;  3NRW A;  4R64 A;  4WC6 A;  2KV2 A;  4US8 A;  4J9P A;  4CRX A;  1Z19 A;  5AI6 A;  1KFS A;  2W7P A;  3N4M B;  7ICK A;  3UMC A;  4KLO A;  4KLS A;  3EPI A;  5J0S A;  3HP6 A;  4J9O A;  7ICS A;  1Q46 A;  2WF5 A;  1RYR A;  1ZQT A;  2IOF K; 
#chains in the Genus database with same CATH homology
 2DPI A;  4M9J A;  2IHN A;  1DOQ A;  1NKC A;  2RFF A;  4LVS A;  1BPX A;  5DLF A;  5BOM A;  3NYB A;  5HC9 A;  4UAY A;  2ISO A;  4KLQ A;  2JZB B;  5KFZ A;  1ZQA A;  5KFN A;  4HYK A;  3RR8 A;  3K4G A;  5KFV A;  1MQ3 A;  4E7X A;  5KG4 A;  1V9P A;  2XC9 A;  3V7L A;  1ZQJ A;  1A77 A;  1XSP A;  4DSJ A;  2P6U A;  4QZB A;  4KLJ A;  5KFH A;  2DR7 A;  3JPP A;  3Q8S B;  3H40 A;  1JXL A;  1KSP A;  4X4T A;  3EWA A;  8ICA A;  4QWA A;  3OJS A;  4YG2 A;  4UBC A;  4DSF A;  3RJG A;  3OUY A;  3RJE A;  4ED8 A;  2BDP A;  4I2A A;  4KIT B;  1SL1 A;  2PFN A;  4FHX A;  1ZQK A;  4DQS A;  4DL3 A;  3ZDA A;  2BR0 A;  3EPG A;  2XGQ A;  4K4G A;  4F5P A;  1ZQF A;  3PW5 A;  1NOM A;  4EBC A;  9ICK A;  5J2J A;  2M2U A;  1S97 A;  1WCN A;  5KFR A;  3JPS A;  1TFY A;  4RWQ A;  3C2L A;  2W9M A;  3JPT A;  4E0D A;  3RBE A;  2HHT A;  9ICL A;  4X0A A;  1B22 A;  2W8L A;  4BXO A;  3GIJ A;  3PW0 A;  3WFS C;  2C2E A;  4O3N A;  3M9O B;  4I2D A;  5DBA A;  4LT6 A;  4RQ7 A;  2DRB A;  4PHE A;  4I2B A;  2IBK A;  4KLH A;  4DQQ A;  8ICQ A;  3EZ5 A;  3BQ2 A;  4RUA A;  4BDP A;  2UVV A;  3MFI A;  4MF2 A;  1JAJ A;  4X4R A;  1ZQW A;  5L1I A;  2ATL A;  2VA2 A;  4X4N A;  4E8F A;  3HX0 A;  2MUT B;  3AQL A;  1XS9 D;  4IR1 A;  3IM1 A;  1TK8 A;  3LQC B;  4DLE A;  8ICR A;  4EBK A;  2ZTC A;  2DFL A;  3JPN A;  2JEG A;  3RJK A;  4O3R A;  5HRE A;  5D4B A;  4DFM A;  1NK6 A;  4QWE A;  9ICG A;  3EW9 A;  5CA7 A;  5HRK A;  3ISC A;  9ICQ A;  4NM2 A;  3OGU A;  3GIM A;  1ZQU A;  2FLN A;  2IMW P;  3BJY A;  8ICB A;  2HHV A;  5HRB A;  3SV3 A;  5KT4 A;  4R65 A;  4JWN A;  4I2C A;  3BDP A;  3RH5 A;  3PX0 A;  3HJ1 A;  4AT7 B;  5HRD A;  4DOA A;  1JMS A;  4NY8 A;  3ZDB A;  7ICN A;  1JQR A;  1BPD A;  3OJU A;  4GC6 A;  5DDY A;  4RQ0 A;  4F4K A;  5L9X A;  1X2I A;  3PW7 A;  4B9M A;  4IR9 A;  4FHV A;  1NK8 A;  4UD5 A;  5KFI A;  3UQ2 A;  4QZI A;  4RQ4 A;  1UT8 A;  3SI8 A;  5KFF A;  3KTQ A;  3K75 D;  1RZT A;  9ICN A;  4F5R A;  1KDH A;  4JV2 A;  1KEJ A;  4I28 A;  4M47 A;  3V7J A;  2R8G A;  1MIY A;  3ISD A;  3GV7 B;  2ZH3 A;  4UQG A;  5KFE A;  5DBC A;  1QSS A;  4DL5 A;  1YLQ A;  1XSL A;  4KLT A;  8ICW A;  3Q8P B;  8ICN A;  1F5A A;  4S3N A;  3ZDE A;  3Q8R B;  5EWE A;  1ZQB A;  5J0X A;  5KFQ A;  4QWC A;  4M6W B;  4J9N A;  3OV7 A;  5DB8 A;  4PHA A;  3UQ0 A;  1QSL A;  3ETL A;  4X4Q A;  4YVZ A;  1TFW A;  4YCX A;  5KT7 A;  2XCP A;  4KTQ A;  1U49 A;  4DQI A;  4O9M A;  8ICG A;  1U47 A;  2HHQ A;  2VAN A;  1T4G A;  4DOB A;  2KFN A;  5HP4 A;  2BKE A;  3JPR A;  1S0N A;  4DQP A;  4UAW A;  2FMQ A;  4K4I A;  5J2D A;  4EBJ A;  5EWF A;  3RAQ A;  4QZG A;  4F3O A;  4UBB A;  5KFK A;  2B21 A;  5J2A A;  5J2G A;  3LWL A;  3KHH A;  3Q8L A;  1RXV A;  4KLG A;  3H8S A;  5DBB A;  3THV A;  5KG6 A;  1T8E A;  3GQC A;  2GWS A;  3QZ8 A;  4NKU A;  4TQR A;  5HRG A;  4J9L A;  3OVS A;  2I1Q A;  2UVW A;  8ICZ A;  2M9N A;  3B0Y A;  4FO6 A;  4DFJ A;  3SV4 A;  4K4H A;  4DL2 A;  2NRX A;  4O5E A;  8ICC A;  4IQT A;  1UEV A;  3QEA Z;  4ECV A;  4I2J A;  4DO9 A;  1ZQH A;  2BPG A;  3C1Z A;  7ICU A;  3PVX A;  3MDA A;  2F1J A;  5J2I A;  3TAR A;  4IRD A;  4KLM A;  4YR2 A;  3GDX A;  3M9M B;  2PXI A;  4IQV A;  4RQ2 A;  2R8J A;  1ZQV A;  2BCS A;  4NLN A;  5KFD A;  4F50 A;  4ATB A;  4ECQ A;  4UB1 A;  4XQ7 A;  5DED A;  2Q66 A;  5IIL A;  2HHW A;  4IG8 A;  4I2F A;  1B43 A;  1IXR A;  5KFB A;  2BQ3 A;  1ZQG A;  3C2M A;  5KFS A;  5CJ7 A;  4DF8 A;  1JIH A;  4DFK A;  4R63 A;  4RQ8 A;  4I2H A;  9ICR A;  1NO5 A;  2BGW A;  5HHH A;  2ZH5 A;  5KT6 A;  3T5H A;  1S77 D;  3BQT A;  3HPO A;  3MGH A;  4PGQ A;  4R8U B;  9ICB A;  1MC8 A;  4DL6 A;  4E80 A;  3H4B A;  4TUQ A;  2R8I A;  4DLG A;  5J2F A;  2LYH A;  4GLX A;  2IA6 A;  3PMN A;  3G6V A;  4ECX A;  3SYZ A;  4DSE A;  2J6T A;  5HR9 A;  5J0P A;  3LWM A;  3TAQ A;  3H38 A;  4NLK A;  1SL2 A;  3UXN A;  1NJY A;  4QWB A;  3PW2 A;  4XUS A;  2ZH2 A;  5D49 A;  3UXP A;  4EP7 A;  1BPY A;  2RDJ A;  2AGQ A;  1OU5 A;  4AT9 B;  3C18 A;  2P6R A;  1KLN A;  1N56 A;  1VFG A;  5KFL A;  3OHA A;  4TQS A;  1SKR A;  2DR8 A;  5J2K A;  1NZP A;  3M9N B;  2AGP A;  2M2V A;  3RH6 A;  1SZP A;  1BGX T;  4NLG A;  3OHB A;  4YD2 A;  4XRH A;  4KN4 A;  5KFU A;  3C5G A;  4O5C A;  2ZH4 A;  3RRG A;  1NK9 A;  4P4O A;  4WC4 A;  1XU4 A;  3H4D A;  2FMS A;  8ICX A;  7ICM A;  4ECR A;  1ZQX A;  4DL7 A;  1T3N A;  4PGX A;  1ZYQ A;  3GV8 B;  4I2E A;  4Z6F A;  4O3P A;  4TUR A;  3RJI A;  5HRI A;  4F4Z A;  3WFQ E;  4XQ8 A;  8ICH A;  1ZQZ A;  3L9D A;  5J0T A;  1IM4 A;  1UT5 A;  9ICP A;  4R66 A;  5DGA A;  4ELT A;  4I29 A;  3ISB A;  4KLF A;  1S0M A;  2ZHA A;  5KT3 A;  2V4R A;  5KFM A;  9ICF A;  2NRV A;  4WBY A;  2BPF A;  5IIM A;  3ZD8 A;  4ECT A;  2W9B A;  2Y1I A;  2I9G A;  2W9A A;  2XY5 A;  3RB6 A;  4F8R A;  4JV1 A;  1SKW A;  4M9H A;  2AQ0 A;  2O1P A;  4X4P A;  1Z00 A;  1U48 A;  3TFR A;  1ZQP A;  8ICU A;  2DR5 A;  4IRK A;  1NJW A;  1H38 A;  3PY8 A;  4X4V A;  2OWO A;  4YR0 A;  2HHS A;  5HML A;  1D8L A;  3JPO A;  3RTV A;  4FS2 A;  1SL0 A;  3T5L A;  3AQK A;  4DQR A;  3M8R A;  5KG0 A;  4CCH A;  3G6X A;  5III A;  4WC2 A;  3C5F A;  3RRH A;  2ZUD A;  1N48 A;  2BE3 A;  3T3F A;  1TAQ A;  1ARO P;  4Z6E A;  3PW4 A;  4M6W A;  4MEX A;  4UB5 A;  3H37 A;  3MR6 A;  3TAN A;  1C7Y A;  2F1H A;  4M5D A;  1A76 A;  2ISP A;  4TUS A;  2ASJ A;  3N97 B;  4BXO B;  3H8J A;  4YXM A;  4J9M A;  5J2B A;  4Q44 A;  1K1S A;  1NJZ A;  1L3S A;  4ELV A;  4QZC A;  4BGD A;  5J2C A;  1NK5 A;  4B9V A;  3RAX A;  2JEJ A;  4ECW A;  4I2I A;  7ICT A;  3MR5 A;  4QZE A;  5CWR A;  4QWD A;  2FLL A;  1XC9 A;  4RQ1 A;  4YQW A;  5CR0 A;  2ZUC A;  5F9L A;  3MBY A;  3UPQ A;  3RB0 A;  4C8O A;  3H3A A;  4RWN A;  1UET A;  1ZET A;  3JZ0 A;  1ZJM A;  2BCU A;  1LV5 A;  4RNN A;  3OVB A;  1DK2 A;  4KLU A;  1ZQE A;  1UEU A;  4RWP A;  9ICH A;  4B9T A;  5J29 A;  4YFK A;  5DG7 A;  1L5U A;  2A1J A;  1ZQQ A;  2P66 A;  7ICJ A;  4J9Q A;  2VA8 A;  1HUO A;  4RQ3 A;  1XO1 A;  3KHG A;  4X5V A;  4YD1 A;  3PX4 A;  2ZH7 A;  4YMN A;  7ICR A;  2C28 A;  2KP7 A;  9ICT A;  2DR9 A;  5J0Q A;  4GXJ A;  5HMM A;  2C22 A;  5DQH A;  5DGB A;  3MFH A;  5J0R A;  4PH5 A;  4J9S A;  4F4X A;  5IIN A;  1WCL A;  7ICQ A;  3QEB Z;  2PBE A;  4FHW A;  4X0B A;  2ZH1 A;  1KFD A;  4UB3 A;  2ZH9 A;  1MIV A;  3NGD A;  4GC7 A;  2V4Q A;  4M9N A;  1MIW A;  3UPS A;  2ALZ A;  1TK0 A;  4DEZ A;  2PI5 A;  4BWJ A;  4EBE A;  1X9W A;  7ICP A;  1BPE A;  1EXN A;  5KTQ A;  5L1L A;  9ICE A;  4QW8 A;  4PGY A;  1RYS A;  3RJH A;  2W9C A;  3Q8Q B;  4BWM A;  4AT8 A;  4WCW A;  7ICV A;  4G3I A;  3RBD A;  2ZHB A;  8ICI A;  2PFO A;  5IIK A;  3RH4 A;  4DSI A;  3HIY A;  1TKD A;  3PML A;  5J0W A;  4DS4 A;  2FPK A;  4QZA A;  2JZB A;  1NK0 A;  3MR3 A;  1ZQS A;  5KG1 A;  5DB6 A;  1BVS A;  2XCA A;  3KHL A;  3KHR A;  4C8K A;  4F92 B;  3GII A;  2AQ4 A;  5DKW A;  4DFP A;  4QZH A;  3IHQ B;  5IIJ A;  3Q8K A;  1ZQC A;  4ECU A;  4ELU A;  4XA5 A;  4PPX A;  2XO7 A;  9ICC A;  1FA0 A;  5EOZ A;  2ZH6 A;  2KZZ A;  4MFA A;  1UA1 A;  2R8H A;  4DF4 A;  2PFP A;  4ZH4 A;  3PV8 A;  9ICX A;  5BOL A;  4QZ9 A;  4FBT A;  4IQW A;  2ZUB A;  4DOC A;  1U4B A;  4ED2 A;  8ICT A;  4J9K A;  2HHU A;  3WFO A;  5L1K A;  1S9F A;  2DPJ A;  1QLN A;  1R8A A;  3C66 A;  4DSL A;  1S10 A;  3FYH A;  7ICL A;  3RJJ A;  4UB2 A;  5C5J A;  5KT5 A;  5KFC A;  3LK9 A;  3LDA A;  1X9S A;  9ICU A;  3WFR E;  4KMU A;  2DRA A;  2BQR A;  3H39 A;  1CUK A;  2KFZ A;  9ICO A;  4RWO A;  4X4S A;  4NXZ A;  3HT3 A;  3PO5 A;  3B0X A;  4QW9 A;  1DGS A;  7ICI A;  2R8K A;  4WBZ A;  4DSK A;  5DQG A;  1JX4 A;  4FH3 A;  1D9D A;  1VJ7 A;  1RPL A;  2WTF A;  3QE9 Y;  4F2S A;  2HVH A;  4RNM A;  2PI4 A;  1TAU A;  9ICJ A;  3C21 A;  4LZG A;  8ICP A;  5DLG A;  1R89 A;  4EYI B;  3RB3 A;  4J9R A;  3AQN A;  4M9L A;  4UAZ A;  2MUT A;  1L3U A;  7ICO A;  4B9U A;  9ICW A;  4UD4 A;  4ATB B;  5DB9 A;  3PNC A;  2ZTD A;  5F9N A;  1RXW A;  4O5K A;  9ICS A;  2J6U A;  1BNP A;  2RDI A;  1ZQL A;  5KFT A;  4JK1 A;  3AUO A;  1LB2 B;  2V9W A;  3PO4 A;  4FH5 A;  1COO A;  4FHP A;  1Y88 A;  4Q8F A;  1KNY A;  2DVI A;  4YP3 A;  4RUC A;  2BQU A;  1KFT A;  3ORY A;  3TI0 A;  2UVR A;  5J2E A;  8ICO A;  4F91 B;  1TVA A;  7ICF A;  4Z6C A;  4FHY A;  2NRZ A;  3V72 A;  1DK3 A;  4F2R A;  3FDS A;  1XWL A;  2H5X A;  2XGP A;  4AT7 A;  1ZQD A;  5L1J A;  3PR4 A;  1T7P A;  5KG7 A;  4Q8E A;  3V6H A;  2W8K A;  4MFC A;  2AJQ A;  4YXJ A;  1QTM A;  4GXK A;  2AU0 A;  5J0U A;  2ASD A;  8ICM A;  4F93 B;  3SZ2 A;  1MSW D;  7ICH A;  8ICK A;  1PX5 A;  4MFF A;  5DB7 A;  2XY6 A;  2KZ3 A;  1TV9 A;  4MF8 A;  3OUY B;  3GIK A;  3PX6 A;  3MGI A;  5KFY A;  3V6K A;  4WC0 A;  4X4O A;  2FLP A;  1MQ2 A;  4F5N A;  4WC5 A;  5KFA A;  2MAX A;  5KG3 A;  3TAP A;  1ZJN A;  5DG8 A;  2HVI A;  3HJ4 A;  3GFK B;  5KT2 A;  5DDM A;  1Z3E B;  4RT3 A;  5D46 A;  3HW8 A;  3G6Y A;  4B9L A;  3E2E A;  5HRH A;  4WC3 A;  4UB4 A;  2FPL A;  4Q45 A;  4I27 A;  1ZQM A;  4DWI A;  1S76 D;  5CP2 A;  4NM1 A;  5IIO A;  1ZQI A;  4O3Q A;  3UXO A;  2XY7 A;  4RQ6 A;  3T5J A;  1TK5 A;  7ICG A;  2JEI A;  1NK7 A;  2C2R A;  2FMP A;  5DEC A;  3MR2 A;  5CHG A;  2ZTE A;  4TUP A;  3AU6 A;  3QZ7 A;  4ED7 A;  1XSN A;  2HHX A;  2NRK A;  1R8C A;  4YMM A;  1R8B A;  4NKT A;  5CB1 A;  4ECY A;  2UVU A;  4M04 A;  5HRL A;  5KG2 A;  4JWM A;  5BPC A;  4P4M A;  3PR5 B;  4KLD A;  2BCR A;  4KLI A;  2HHP A;  2ID1 A;  3H7I A;  1SKS A;  4YMO A;  3HWT A;  1K1Q A;  1D8Y A;  3OVA A;  3MDC A;  5F2V O;  4RPZ A;  2ASL A;  4KN7 A;  3RJF A;  4O3O A;  2W9B B;  1ZQO A;  2M2W A;  4ED0 A;  1NJX A;  2O5A A;  2BCV A;  5DG9 A;  3V6J A;  1U9L A;  4ECZ A;  4ED1 A;  9ICV A;  4EEY A;  4X4U A;  1S0O A;  1ZQR A;  2KTQ A;  4B9S A;  3V7K A;  1ZQN A;  1Z00 B;  1CEZ A;  1PZN A;  4YN4 A;  2Q0Z X;  4C8L A;  5KFO A;  2J6S A;  3AQM A;  1QSY A;  2ZH8 A;  3BQ1 A;  5EWG A;  5J2H A;  4RU9 A;  4ECS A;  4B9N A;  1X9M A;  4MEY A;  2ZJ5 A;  8ICV A;  1Q78 A;  9ICA A;  4C8N A;  4FS1 A;  1KRP A;  4O3S A;  2KZM A;  1V4A A;  3H8W A;  5DQI A;  1NK4 A;  2ZJ8 A;  1NKB A;  1KTQ A;  4LZD A;  5HHI A;  5KG5 A;  2KN7 A;  4DL4 A;  3RB4 A;  1U45 A;  2BCQ A;  4I2G A;  4Q43 A;  4C8M A;  4RQ5 A;  3EYZ A;  3Q8M A;  3BQ0 A;  3TFS A;  1UA0 A;  4WC1 A;  3OSP A;  4P4P A;  1D9F A;  3C2K A;  8ICJ A;  2NRW A;  2ZJA A;  5JUM A;  4EZ9 A;  4M0A A;  4F4Y A;  4EBD A;  2M2T A;  4PHD A;  4R8U A;  4P2H A;  1L3T A;  4IRC A;  4Z6D A;  1S0V A;  4ED6 A;  5J0Y A;  5KFP A;  3JYY A;  4RZR A;  3M8S A;  3JPQ A;  1HUZ A;  2AGO A;  4KLL A;  8ICS A;  9ICI A;  7ICE A;  4F4W A;  2FPM A;  3C1Y A;  2BHN A;  4DS5 A;  2PFQ A;  3MAB A;  4QZD A;  1HJP A;  2VA3 A;  4KLE A;  3OSN A;  2HW3 A;  3GIL A;  3TQ1 A;  4JUZ A;  1BPZ A;  3ZDD A;  4EZ6 A;  9ICM A;  4QZ8 A;  2NRT A;  5HRF A;  4NLZ A;  2A1J B;  2F1I A;  2Y1J A;  5KFJ A;  1Q79 A;  3WFP A;  2C2D A;  8ICE A;  4JV0 A;  4AT9 A;  1JXE A;  5HNK A;  4M9G A;  5KFG A;  1BPB A;  4F5Q A;  1L3V A;  4RT2 A;  4IQU A;  4R64 A;  2BPC A;  4F5O A;  4WC6 A;  4J9P A;  2IHM A;  1WOT A;  8ICY A;  8ICF A;  3ZDC A;  3GV5 B;  4WC7 A;  5J0O A;  8ICL A;  1KFS A;  1JN3 A;  1BNO A;  3AU2 A;  4QZF A;  4GXI A;  4ED3 A;  4EYH B;  5TZV A;  4RPX A;  3T5K A;  3ZD9 A;  2JEF A;  4M2Y A;  3NTU A;  4PHP A;  3N4M B;  7ICK A;  1ZQY A;  1TFR A;  3RR7 A;  4KLO A;  4KLS A;  5J0S A;  4YR3 A;  5KFX A;  3HP6 A;  3C23 A;  2W9C B;  3EPI A;  4J9O A;  1RYR A;  1NKE A;  4FBU A;  7ICS A;  4RPY A;  4AT8 B;  5KFW A;  1ZQT A;  4O0I A;  4RNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...