4NLZA

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template 8brg and incoming gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
323
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 109
structure length 323
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlzA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlzA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlzA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlzA03
2MUTA 5DB6A 1UT8A 4Q43A 4QWAA 1NKBA 4M2YA 1ZQDA 4R63A 8ICQA 4C8OA 4ATBB 3ZDAA 3Q8LA 3PW0A 1IXRA 2ZH2A 5HHIA 5EWFA 2W9BA 1BPDA 2BE3A 4J9OA 3UXNA 4M9LA 5J2GA 4KLMA 2M9NA 4TUQA 2BCRA 5DQHA 1KRPA 2ID1A 4F5RA 4YD2A 3JPPA 4EZ9A 4GC6A 4DL4A 3H7IA 5IIOA 4RQ6A 1RXWA 5CR0A 3V6JA 4I2HA 4AT7A 2PBEA 2KFNA 4Z6EA 3SYZA 2ZUDA 5HRGA 2UVRA 4MFFA 4UBCA 8ICTA 3RJEA 2DVIA 5KFIA 4RWOA 1ZQYA 3OSPA 1L5UA 7ICVA 3EWAA 2KN7A 2C2RA 8ICWA 9ICTA 3RB6A 4RT3A 3PMNA 4NM1A 7ICUA 4JK1A 4KN7A 3C2MA 1SKWA 4P4OA 4X4UA 4KLJA 4JV1A 4X4NA 4Z6DA 5DBCA 1SL1A 5J2HA 3RTVA 4RNMA 4I2FA 3PW5A 3V7KA 1ZQLA 1S97A 3UXOA 1BVSA 4ED8A 4M9HA 4M6WA 2ZH7A 1U45A 1LB2B 2HHSA 3H38A 1ZQUA 4DFMA 8ICJA 9ICLA 9ICOA 8ICXA 2ZH6A 2KTQA 4ECWA 1SZPA 3BQTA 4FS2A 4G3IA 5HRBA 1KTQA 3MGIA 1Z00B 2JEJA 3RRGA 3JYYA 1ZQGA 4ECVA 2PFOA 4IRDA 4O5KA 2DRAA 1QLNA 1JIHA 2FLLA 3K4GA 2DR5A 5KFDA 2C2DA 4M9JA 7ICPA 4J9LA 4NM2A 2PI4A 2KZ3A 3GV8B 3RH6A 1LV5A 1S0NA 1X2IA 1R8AA 4F4YA 3K75D 5DKWA 3N97B 2BPFA 4E8FA 5HP4A 1L3UA 4O9MA 3OSNA 3EZ5A 2V4RA 2AGQA 4YR3A 4F5OA 4R65A 3HW8A 3GIIA 4ECUA 3T5HA 1NJYA 1S10A 4RQ2A 3MDAA 2VA8A 1XSLA 3WFRE 2XGPA 3AQKA 2JZBB 5KFZA 1HUZA 4B9SA 1ZYQA 3PW7A 2LYHA 5J2EA 7ICJA 3PX0A 4PPXA 4UBBA 3PO4A 4Z6FA 4YR2A 5KFFA 4X4SA 9ICRA 4WC7A 3HPOA 3T5KA 1HJPA 5DQGA 2IA6A 7ICOA 1UA0A 1JXEA 8ICGA 4TUSA 3PMLA 4QZDA 7ICIA 4QZFA 3H39A 3H8JA 1SKRA 4WC0A 4EBEA 1WCLA 5L1KA 3C23A 2OWOA 8ICAA 4K4IA 1U48A 1ZQAA 1RYSA 2MUTB 4ECZA 3L9DA 4DS4A 2I1QA 4DQQA 1XSPA 1ZQNA 3LK9A 4WC1A 5IIIA 3MFHA 3AQNA 2W9BB 4YFKA 3G6VA 1NJWA 2Q0ZX 3BQ1A 4C8LA 4O3PA 4ED3A 9ICVA 3UQ2A 3GIMA 2DR9A 1ZQTA 3WFQE 5D4BA 2PFNA 3E2EA 3MR5A 1ZQVA 1U4BA 1PZNA 4FHXA 2ISOA 4X4QA 4WBYA 4R8UA 8ICPA 4IQVA 4YP3A 1XS9D 3ZDDA 4LZGA 5HMMA 4BDPA 4GC7A 4TQRA 4B9LA 5BOMA 4ELTA 4KLFA 4R64A 3RB4A 5KT6A 5CHGA 5J0OA 4I2CA 4QWEA 9ICEA 2BQRA 1ZJNA 3KHGA 4ED7A 5J0XA 3RH5A 4F2SA 1NZPA 2DR7A 2ZH3A 1CEZA 7ICEA 5KFBA 5F9LA 5J0QA 4DQSA 2Y1IA 1S0MA 4RPYA 4EZ6A 1N56A 3NTUA 3RAQA 4M6WB 5L1IA 4RQ7A 4ELVA 1NOMA 8ICFA 3C1YA 2KP7A 4LVSA 2BKEA 4DF4A 3V7LA 1A76A 5J2BA 1Q79A 4B9NA 5J0RA 3JPRA 1A77A 7ICGA 7ICQA 1MIYA 2PFQA 1D9FA 5CWRA 5KG1A 2XGQA 3MDCA 8ICKA 1KEJA 5IINA 2IHNA 3RJIA 5KFAA 4IQUA 4YN4A 1QSYA 4NLGA 1SL2A 1ZQXA 3OHBA 5HRHA 1F5AA 2KFZA 4RU9A 1JX4A 3PO5A 1B22A 3OJUA 4O3OA 3EPGA 4BXOA 3FDSA 4EBDA 2ZJ8A 9ICCA 5HNKA 2J6TA 4RWQA 7ICNA 1R8BA 4ZH4A 2XY5A 2F1HA 1BPYA 2JEGA 3ORYA 4FBTA 1AROP 8ICOA 1KFSA 4B9VA 5DLFA 1KNYA 1NJXA 4KLUA 3JPQA 1U9LA 4O0IA 1DOQA 4Z6CA 3V6KA 1ZQRA 2UVVA 3M9MB 4DSLA 4DOCA 1S9FA 1D9DA 4NY8A 4DLEA 4QW8A 4EYHB 2RDIA 4UB1A 4F5PA 2NRTA 3H40A 2ZUCA 5D49A 2ATLA 4ECSA 5KFOA 2V4QA 5KFPA 5BPCA 4J9MA 1T3NA 4O3SA 2P6RA 2HVIA 4KN4A 4F2RA 2BQUA 4FO6A 4FBUA 1ZQSA 4IRCA 4K4GA 9ICQA 2Q66A 4KMUA 5HRFA 8ICVA 2FPLA 5DQIA 5KFQA 3RBDA 4UQGA 1UEUA 3C18A 5CB1A 4ECRA 2A1JA 2BDPA 3OVAA 3IHQB 4F50A 2XO7A 5KFVA 1QTMA 1NJZA 1XO1A 1R89A 3MR2A 4F8RA 4X4TA 3NGDA 1DK2A 2VA3A 4BWMA 2P66A 3Q8KA 9ICAA 3JZ0A 2C28A 4JV0A 5CA7A 3OHAA 3EPIA 2BPGA 2IHMA 9ICUA 2BQ3A 1ZQIA 4X4VA 1T7PA 3GIJA 2HHTA 3HP6A 4QZHA 3QZ7A 1Y88A 5HMLA 5KTQA 4FS1A 4CCHA 5KG5A 5DGAA 2HHVA 5HHHA 4XQ7A 2W9AA 5BOLA 3HX0A 2F1JA 4F4ZA 2M2UA 1TK0A 4RQ4A 3RJGA 3T3FA 3RJJA 4UD4A 4RZRA 3ZD9A 4ED6A 4F3OA 5KG3A 5J0UA 4IR9A 4NLNA 5DB9A 4DFKA 4KLOA 4DWIA 2WTFA 4F91B 3THVA 2GWSA 4E0DA 4Q8EA 4M9NA 2IBKA 3RBEA 2M2VA 4XA5A 4ECQA 3TAQA 4X0BA 3LWLA 4EYIB 4M04A 5DBAA 4X4PA 1DGSA 3TAPA 4RQ5A 3RB3A 1B43A 4TURA 2FLNA 4QZ8A 2DR8A 4PHPA 1H38A 5J0SA 4ECXA 4YMMA 1JQRA 2ZH5A 3UQ0A 4I2EA 3HIYA 3HJ1A 4P2HA 5J2KA 4C8NA 4GXKA 4KTQA 5IIMA 5IIJA 3RB0A 5KFUA 3RJKA 4BXOB 3AUOA 4YMOA 3GFKB 4GXIA 1NKCA 4NLZA 2ZJAA 2NRZA 4EEYA 4LT6A 1NK7A 9ICMA 3Q8SB 1ZETA 4KLHA 1L3SA 4QZ9A 4RQ8A 3H37A 2HVHA 3C1ZA 4GXJA 4YD1A 1NK0A 7ICMA 1Q78A 4PGYA 3M9OB 2BCVA 2J6UA 2KZZA 3AQMA 3GV7B 4X4OA 2ZH4A 2BCSA 3RRHA 4YVZA 1ZQQA 2XCAA 1RYRA 4I2DA 4E80A 5HR9A 2V9WA 2BHNA 5KT2A 4I2GA 3AU6A 4IQTA 1D8LA 4KITB 5F9NA 3HT3A 4NKTA 4AT7B 5KFLA 5KFEA 2NRXA 3TFSA 2XCPA 5F2VO 4WC2A 9ICKA 2BR0A 1NK9A 2NRWA 2M2TA 1ZQZA 5KT5A 7ICHA 1ZQJA 4MF8A 3PX6A 1TK8A 5KFKA 4DSIA 4JV2A 1MC8A 1TKDA 1UEVA 5KG6A 2A1JB 4YCXA 1XC9A 1BPBA 3UPSA 1RXVA 2F1IA 1VFGA 1CUKA 4HYKA 3ISDA 4F4KA 3ZDEA 4I29A 4DOAA 3PV8A 3N4MB 1D8YA 1TAUA 2VANA 5IIKA 3V7JA 2XC9A 1X9SA 4S3NA 5J0WA 4QZCA 2ZHAA 2UVUA 3PX4A 4O5CA 1TFWA 3KHRA 2R8HA 4NKUA 4DOBA 3NYBA 3PR4A 3GQCA 1TFRA 3JPNA 5DECA 1ZQBA 4RUCA 2NRVA 4YR0A 1ZQKA 2AGOA 3ZDBA 2HHWA 5EWEA 1ZQMA 5KFNA 5KG4A 4RNNA 3EYZA 1BPZA 3ZDCA 4FH5A 2ZUBA 3TFRA 7ICTA 1YLQA 9ICFA 1V4AA 4QZGA 3GV5B 3V72A 4RNOA 1BGXT 3H4DA 4QW9A 3BQ2A 5DB7A 2H5XA 3HWTA 3GILA 4J9KA 3QEBZ 3C66A 3RH4A 2C22A 3FYHA 3M8SA 2HHQA 4KLTA 4EP7A 5HC9A 5KFXA 2HW3A 4J9NA 9ICBA 4FH3A 8ICCA 2ZJ5A 4DQPA 2BCUA 4UAZA 1ZQCA 4PHAA 2JEIA 3UPQA 5J2CA 4WBZA 3B0YA 5KT4A 2ASJA 4DL3A 3Q8PB 3SI8A 3RR8A 3RJHA 3MBYA 3Q8RB 2JEFA 3C5GA 4DQRA 4YG2A 8ICIA 1COOA 3JPTA 2DPIA 3H8SA 8ICLA 8ICSA 4MEYA 9ICPA 5CJ7A 5DG9A 4FHYA 5DG8A 4UB4A 4RPZA 4DO9A 4DS5A 1ZQPA 5DGBA 2O1PA 1BPEA 5KFYA 4E7XA 3OV7A 3AQLA 2MAXA 4XQ8A 4ECYA 5KFJA 9ICGA 2R8KA 2AU0A 3PVXA 2AQ4A 4MFCA 4F5NA 1JXLA 7ICLA 4PGQA 4DFJA 1TV9A 5KFWA 1BPXA 1QSSA 4M5DA 1XWLA 4J9SA 4F4WA 1S0VA 4EBCA 3ETLA 4DSKA 2FLPA 3LQCB 4I2JA 3RAXA 3EW9A 2AQ0A 3H8WA 3G6YA 2RDJA 4R8UB 5KFRA 3OGUA 4ECTA 4M47A 2W9CA 4J9RA 3OUYA 1MIWA 3KTQA 1IM4A 5L1JA 4DFPA 2FMQA 4UD5A 4I2BA 4UAYA 4X0AA 2DFLA 4O3QA 2FPMA 3RR7A 4DQIA 2ZH1A 4PHDA 3BDPA 1TAQA 5DDYA 4YXJA 4AT9A 2DPJA 4IQWA 1L3VA 4TUPA 3PY8A 4NXZA 5KG2A 2ISPA 1NK6A 4O3NA 7ICFA 4M9GA 3SZ2A 1KFDA 5DDMA 8ICZA 5J0PA 1SL0A 2I9GA 4UB2A 5HRDA 3MABA 1ZQHA 9ICWA 8ICYA 4KLSA 4QZEA 5CP2A 4EBKA 4DL2A 5J29A 3PW4A 4C8MA 4PH5A 3M8RA 5J0TA 4Q45A 8ICBA 3WFSC 3LDAA 3GIKA 4QZBA 3H4BA 4F4XA 3LWMA 1FA0A 3OJSA 2R8JA 2VA2A 4RUAA 1U47A 9ICJA 4UAWA 1NK8A 7ICRA 4MF2A 1WCNA 4PHEA 5KFGA 5L9XA 3C2LA 2W8KA 4KLIA 5J2JA 4UB5A 3H3AA 3TARA 4AT8A 4I27A 1TVAA 9ICHA 1X9WA 3JPOA 4J9PA 4DEZA 1K1SA 3BJYA 2O5AA 3TQ1A 4MFAA 4X4RA 1RZTA 1HUOA 5J2AA 5DLGA 4WC6A 2FPKA 2IMWP 4RPXA 4RWNA 5KFTA 1KDHA 4X5VA 3QZ8A 1JMSA 4ED0A 4F92B 4C8KA 4LZDA 3T5LA 1VJ7A 1C7YA 4UB3A 2ZHBA 5KFHA 5TZVA 2HHUA 3M9NB 2FMSA 4DSEA 1ZQWA 5J2FA 4RQ1A 3SV4A 3PW2A 3T5JA 1EXNA 3MGHA 3BQ0A 8ICHA 2ASLA 1R8CA 4EBJA 1S0OA 1S76D 8ICEA 4DF8A 4ATBA 2R8IA 3C2KA 4I2AA 4WCWA 4YMNA 4FHWA 3GDXA 4WC3A 2HHXA 3ISCA 3KHHA 1MQ3A 4XUSA 3B0XA 1MQ2A 4B9TA 2NRKA 2FMPA 1L3TA 4ELUA 4P4PA 4PGXA 9ICXA 4WC5A 4JUZA 3C5FA 4KLEA 4QWBA 4ED2A 3MFIA 1V9PA 3IM1A 1ZQFA 8ICUA 3OVSA 4QZIA 4RT2A 1WOTA 1UA1A 1OU5A 4NLKA 1JN3A 1K1QA 2W9CB 8ICRA 4FHVA 1XSNA 1ZJMA 1KSPA 4ED1A 2W8LA 1T8EA 4O5EA 2ALZA 1S77D 9ICSA 5L1LA 3V6HA 4DL7A 1DK3A 2RFFA 4DLGA 4B9MA 4YXMA 4K4HA 7ICSA 2ZH9A 2PI5A 1QSLA 5KFCA 5IILA 1ZQOA 4Q44A 5HRIA 1T4GA 3MR6A 4KLLA 2R8GA 4AT9B 3C21A 4QWDA 4JWNA 4RQ0A 4GLXA 5KFSA 4P4MA 3Q8MA 3AU2A 3QEAZ 5EOZA 2Y1JA 3RJFA 3WFPA 4I2IA 1SKSA 5HREA 4RQ3A 4F93B 1U49A 4J9QA 5DEDA 9ICNA 4KLQA 4BWJA 2DRBA 2KZMA 7ICKA 4DL5A 3JPSA 2AJQA 1UETA 4F5QA 2W9MA 1Z3EB 3TANA 1NO5A 5D46A 3MR3A 3ISBA 3TI0A 4KLGA 5HRLA 1Z00A 1TFYA 4R66A 4JWMA 2J6SA 5EWGA 3WFOA 1KLNA 2PFPA 5DG7A 3G6XA 1JAJA 4I28A 2ZTCA 4QZAA 1N48A 2PXIA 4BGDA 3PNCA 4FHPA 1UT5A 3KHLA 2B21A 5KT3A 3OUYB 5J2IA 4WC4A 1XU4A 1NKEA 9ICIA 4TQSA 4Q8FA 1BNOA 4AT8B 4IG8A 2C2EA 4XRHA 2AGPA 1KFTA 2P6UA 4KLDA 4IR1A 5KG7A 4MEXA 1NK5A 1NK4A 5C5JA 2JZBA 4B9UA 4IRKA 5KT7A 3UXPA 1MSWD 5HRKA 4M0AA 3OVBA 2ASDA 2UVWA 4QWCA 5KG0A 3QE9Y 2ZTDA 1RPLA 4DL6A 4DSJA 2HHPA 2ZH8A 5KFMA 3SV3A 5DB8A 1TK5A 3ZD8A 2ZTEA 2BPCA 3Q8QB 2XY7A 1X9MA 3PR5B 1PX5A 3HJ4A 4RWPA 5JUMA 1BNPA 5J0YA 2BCQA 4YQWA 5J2DA 2BGWA 5DBBA 1ZQEA 8ICMA 2M2WA 1MIVA 8ICNA 2XY6A 4DSFA 4O3RA
chains in the Genus database with same CATH superfamily
5DB6A 5AK3A 1NKBA 2YN4A 3ZDAA 2ZH2A 1BPDA 5EE0A 2W3RA 4M9LA 4KLMA 2HMXA 5AKGA 3NWIA 4EZ9A 4Y2RA 4UAUA 4UB6U 5CR0A 2ZUDA 5A0LA 3QU2A 4UBCA 8ICTA 3WU2U 2LKYA 1DGJA 3RB6A 5D63A 2KJ8A 4NM1A 4CF5A 2ZIXA 2KG5A 4KLJA 5AM4A 4X4NA 4Z6DA 5DBCA 3N28A 5J2HA 4RNMA 3V7KA 4P0QB 4ED8A 4M9HA 3H38A 1LB2B 4DFMA 9ICOA 5ALQA 4FS2A 3MGIA 4ECVA 4U6PA 5KFDA 2IOHA 4E8FA 5DKWA 4C4TA 4YR3A 4R65A 3OPXA 3MDAA 3PW7A 1Q8KA 2WAQC 5KAIU 3PO4A 5KFFA 7ICOA 2IA6A 4TUSA 5HR7A 3PMLA 4QZDA 7ICIA 4FZLA 3H8JA 1WCLA 3C23A 2ZXIA 1RYSA 3TADA 4ECZA 1ZQNA 4DQQA 3QUTA 4WC1A 1RYUA 4C8LA 2G0AA 2DR9A 3WFQE 2QARA 1PZNA 3CP8A 4R8UA 4WH5A 4IQVA 3AQEA 5AM1A 5BOMA 4ELTA 2E8NA 4R64A 4NXXA 2K8BB 5KT6A 4I2CA 2PKEA 3IN5A 9ICEA 3KHGA 2ZIXB 5F9LA 2AHOB 4DQSA 2Y1IA 1N56A 2YTUA 2KP7A 4WJ3B 7ICQA 1Z1VA 1FO4A 5ALYA 3MDCA 8ICKA 5IINA 1QSYA 4NLGA 1SL2A 1ZQXA 1JROA 1SZHA 1COKA 1S5LU 1B22A 2WF6A 4BXOA 9ICCA 4RWQA 2F1HA 1BPYA 3KZXA 2XIDA 2D8CA 4O0IA 2UVVA 3M9MB 1S9FA 3ALRA 2RDIA 4ICAA 2ZUCA 5D49A 5KFOA 5BPCA 1T3NA 2L5YA 2BQUA 1ZQSA 4K4GA 5AKEA 3RBDA 1UEUA 3C18A 5CB1A 4ECRA 2QARB 3A0HU 4CE6A 3DV9A 5ALXA 4F8RA 1DK2A 2VA3A 4BWMA 1J2MA 3Q8KA 3SMVA 2C28A 4JV0A 3OHAA 2IHMA 1ZQIA 2HHTA 2F1JA 1HEKA 2CN1A 2F2AB 4RQ4A 3T3FA 1ZD5A 2R18A 1KKXA 4OJ5A 5AKHA 5DB9A 3UMGA 4O6AA 3TACB 1N2XA 2GWSA 4E0DA 2H3QA 4X4PA 1DGSA 3LVWA 3TAPA 4NL9A 2OEHA 5ALSA 4PHPA 1H38A 4WQKA 3HIYA 2DQNB 4P2HA 1O08A 4KTQA 5IIMA 5KFUA 1RM6C 4BXOB 3ERCC 1NKCA 4NLZA 1NK7A 3Q8SB 4QZ9A 1ZRMA 3C1ZA 4YD1A 7ICMA 2BCVA 3M9OB 2J6UA 2KZZA 2EWRA 4QNLA 2BCSA 3RRHA 4YVZA 1RYRA 3AU6A 2F3NA 2NYVA 5F9NA 5KFEA 2NRXA 1F0MA 2A3VA 9ICKA 3NKUA 2NRWA 1JUDA 2M2TA 1ZQZA 5L1MA 5KT5A 3QU7A 5CEHA 4J03A 1RXVA 1TAMA 2F1IA 4O67A 4DOAA 3N4MB 1D8YA 3V7JA 4FE3A 4QZCA 1TFWA 4O5CA 4OJ6A 2R8HA 4NKUA 1UHUA 4ACOA 1UQVA 5DECA 2HHWA 4RNNA 4FH5A 3EYZA 2ZUBA 2W11A 4QZGA 1YZ6A 3ONNA 5DB7A 2EAPA 1VJ5A 2IHOA 2JH1A 3M8SA 2HHQA 4EP7A 5HC9A 2ZJ5A 4DQPA 1ZQCA 2JEIA 4USAA 5KT4A 2G06A 3MBYA 3Q8RB 2GLEA 4YG2A 3JPTA 2DPIA 3H8SA 5H2FU 4JLZA 4OAGA 5DG9A 4UB4A 4RPZA 4NWIA 5B66U 4E7XA 3AQLA 4XQ8A 2K4PA 9ICGA 2AU0A 2AQ4A 5J8YA 4K98A 4PGQA 1TV9A 2H3VA 4J9SA 4F4WA 3ETLA 4DSKA 1ZXIA 3EW9A 5KFRA 4Y2VA 1IM4A 3VCBA 3T79A 4DFPA 2FMQA 2DFLA 2M0NA 1NNLA 4Y2SA 4IQWA 4NXZA 2ISPA 1NK6A 1CI4A 2LM1A 4EELA 4M9GA 3SZ2A 1SL0A 4UB2A 3WKEA 4BJQA 2W43A 5CP2A 2Z7JA 2MA1A 4PH5A 3M8RA 1PVQA 5KL1B 3GIKA 4QZBA 2NO4A 4F4XA 2VA2A 1NK8A 7ICRA 4MF2A 1PVPA 4PHEA 5KFGA 3SEIA 5J2JA 3TARA 4AT8A 4I27A 4U7CA 2WF9A 2O5AA 5ALFA 5J2AA 2DF4B 4RQNA 1UCVA 1QH9A 3QZ8A 1JMSA 3RFAA 3UMCA 4MHVA 3M9NB 1ZQWA 3T5JA 2ASLA 2CPRA 8ICEA 4WCWA 4FHWA 3GDXA 2HHXA 3ISCA 3KHHA 1MQ3A 3CYMA 4GFJA 2ES6A 2K8AA 4PGXA 1SWWA 3VC8A 2KHVA 3MFIA 8ICUA 4QZIA 1UA1A 1KSPA 2KK0A 2W8LA 3F2BA 1DK3A 3V6HA 2RFFA 4DLGA 2ZH9A 5HRIA 4Q44A 3MR6A 4RQ0A 1Z19A 3Q8MA 3AU2A 2Y1JA 1SKSA 4F93B 9ICNA 1ZOLA 1SV4A 2DRBA 4NXUA 4F5QA 1Z3EB 3TANA 5D46A 3MR3A 3ISBA 3TI0A 1TFYA 3C28A 2J6SA 3H0MB 3G6XA 1JAJA 2ZTCA 2PXIA 4BGDA 1PUZA 4CDGA 3KHLA 5J2IA 1NKEA 9ICIA 4AT8B 4XRHA 1KFTA 2QLTA 4AP9A 2WFAA 2YMLA 2ASDA 2KD1A 2KE7A 4DSJA 3AL0B 5DB8A 4OAIZ 2ZTEA 2E8MA 4AYBC 3FC4A 5JUMA 2BCQA 1ZQEA 1MIVA 5B5EU 2WAQF 1UT8A 5ALGA 4Q43A 1SWVA 2WF8A 4C8OA 1SGGA 4J9OA 3HKZC 1YZ7A 3K7DA 1KRPA 4EGWA 4F5RA 3I1YA 3JPPA 3H7IA 1RXWA 4I2HA 4K96A 2PBEA 2KFNA 4Z6EA 1T94A 2UVRA 2HBLA 2W55A 2G07A 4HAIA 3RJEA 5KFIA 5AIAA 8ICWA 9ICTA 3PMNA 7ICUA 4KN7A 3QUQA 4P4OA 2KOBA 1SL1A 4C7ZA 1S97A 3NASA 1U45A 1ZQUA 5CFUA 4KM5A 2KKPA 4G3IA 3RRGA 1OXJA 3JYYA 4IRDA 2DRAA 4O5KA 3K4GA 4FO1A 2KZ3A 3RH6A 1R8AA 1LV5A 2JH7A 3K75D 4O9MA 2AGQA 2KZMA 3HW8A 3T5HA 1NJYA 2CRXA 2XGPA 1HUZA 3GZFA 1Z4OA 4PPXA 4UBBA 4Z6FA 4LEWA 1O03A 3BZCA 3HPOA 1HJPA 3T5KA 3KBBA 1JXEA 1UA0A 8ICGA 1SKRA 1QQ7A 5L1KA 8ICAA 1U48A 2LMRA 4PL2A 4K8VA 4YFKA 2JHDA 3GIMA 5D4BA 3HRDD 4FHXA 3PZPA 4WBYA 1VLBA 4YP3A 4LZGA 4BDPA 4GC7A 5EE1A 4KLFA 2KV2A 3RB4A 5J0OA 4QWEA 4Y2PA 4ED7A 3RH5A 2XICA 1CEZA 7ICEA 5KFBA 4DCCA 5TISU 3NTUA 5L1IA 5EE3A 4RQ7A 5AI0A 1NOMA 2ZIVA 3C1YA 8ICFA 5J2BA 4QJFB 4B9NA 7ICGA 1JRPA 3EF2A 1URJA 2XGQA 2CXYA 5ALDA 5KFAA 4IQUA 4YN4A 1F5AA 4UB8U 2AH5A 3PO5A 4O3OA 3EPGA 2IOFA 2ZJ8A 2J6TA 5AKKA 5AK6A 2HSZA 2KVCA 3F2DA 4ZH4A 2FE9A 4FBTA 1S8OA 3ORYA 1AROP 8ICOA 1KFSA 2HN1A 2GOLA 3AEVA 5CFSA 4Z6CA 3V6KA 4DSLA 1F44A 4DLEA 4QW8A 2YY6A 4F5PA 1NI3A 2NRTA 2ATLA 2OXOA 2QB1A 4IRCA 4FO6A 2JV3A 3ER9B 3BS7A 3KKAA 4QIWC 2BDPA 3OVAA 3IHQB 2HOIA 2XO7A 1XO1A 4X4TA 2P66A 9ICAA 3EPIA 2BPGA 3KZIU 1T7PA 1Y88A 3NVVA 5AM0A 1ED1A 2YB4A 4Y2YA 5KTQA 5KG5A 4CCHA 2JMGA 4XQ7A 2W9AA 4NXTA 3HX0A 2LYBA 1TK0A 3RJJA 3KD3A 5AK5A 2YMMA 5J0UA 2WTFA 4G9BA 4F91B 2ZIVB 4M9NA 2M2VA 1OW5A 4X0BA 4O69A 3LWLA 4EYIB 3M6ZA 4QZ8A 2D6FC 1JQRA 4YMMA 3SQIA 2KIWA 2VJ5A 3WKAA 5IIJA 3WK8A 4OD0A 4YMOA 5C0YA 4LT6A 2NRZA 5B3QA 2EANA 1N60A 4GXJA 4RQMA 3UMBA 1Q78A 4PGYA 3GV7B 2F8LA 2ZH4A 2XCAA 3NRZA 5AM2A 2BHNA 4I2GA 4KITB 3HT3A 2ZG6A 2K89A 3TFSA 2BR0A 2JXJA 1ZQJA 4MF8A 2BBHA 5KFKA 1MC8A 1TKDA 1BPBA 3NVZA 1CUKA 4HYKA 4F4KA 2KKVA 2XC9A 3F2CA 2ZHAA 4FZMA 3KHRA 2IOFK 4OO1J 1KL9A 2JR5A 4DOBA 1ZQBA 2NRVA 4YR0A 2AGOA 2WF7A 5EWEA 2EQYA 4MKPA 5KG4A 3PSTA 3TFRA 7ICTA 1YLQA 9ICFA 4PZOA 3GV5B 1BGXT 3H4DA 5ALMA 3HWTA 3GILA 4J9KA 3QEBZ 3RH4A 4KLTA 5AICA 4J9NA 2FI1A 4PHAA 3RR8A 3Q8PB 3C5GA 4NLBA 4FHYA 4MEYA 5AKYA 1ZQPA 2O1PA 5KFYA 1ZD2P 3B9JA 2VIXA 3F5EA 4ECYA 2R8KA 2KSOA 1N62A 4F5NA 1JXLA 4OCZA 4DFJA 1QSSA 1FIQA 3NVOA 4M5DA 1XWLA 3NVYA 4EBCA 2FLPA 4I2JA 3RAXA 2AQ0A 1JALA 3L3FX 4R8UB 3OGUA 3G6YA 4J9RA 2G08A 3O0FA 2DUYA 4NLCA 2KJ9A 2K8CB 2G5HB 4ZOHC 4TUPA 4Y2QA 4O3NA 7ICFA 4PZNA 4C0ZA 2G5IB 5DDMA 2I9GA 3MABA 2HBJA 4KLSA 8ICYA 1L7MA 5AKXA 5J29A 3PW4A 5J0TA 1FA0A 4EX7A 3OJSA 1N5WA 1U47A 5AKZA 1Z4NA 5L9XA 2W8KA 4UB5A 3PSFA 1X9WA 3AMZA 3IG5A 3H0LB 3UM9A 1HUOA 3WK9A 5AKLA 3EUB2 1WWUA 4F92B 4C8KA 3T5LA 2FMSA 4Y2XA 5J2FA 1EXNA 1R8CA 4OJLA 4DF8A 3C2KA 4I2AA 4YMNA 2FDRA 4AYBF 3MC1A 2NRKA 2FMPA 4IC9A 1ZQFA 3IM1A 4RT2A 3GU3A 4K9AA 4NLKA 2LYAA 1JN3A 1XSNA 4O5EA 3HKZF 4ED1A 4C4SA 4YXMA 5IILA 4JWNA 5GTIU 4P4MA 5ALHA 5DEDA 4RQ3A 1U49A 2LBOA 4KLQA 5CRXA 4BWJA 2D3DA 4C7YA 2RRDA 4KLGA 3TADC 4R66A 1PVRA 3WFOA 5ALZA 4QZAA 3I28A 3PNCA 1UT5A 4Y2UA 2B21A 4IG8A 2W54A 2C2EA 4KLDA 2KVSA 4B9UA 1VDVA 4QWCA 4NV0A 4DL6A 2ZH8A 5KFMA 2OH2A 3SV3A 1PX5A 1TK5A 3ZD8A 3HJ4A 1X9MA 3Q8QB 4DFDA 1P7DA 2E8PA 2Q4TA 5CHEA 2E1EA 5J2DA 2YB1A 8ICMA 2M2WA 4DSFA 4DWIA 5AHXA 1KW4A 4QWAA 4M2YA 2WHEA 3PW0A 1IXRA 5HHIA 2W9BA 2BE3A 3SR6A 3UXNA 2M9NA 2ID1A 4YD2A 4GC6A 4RQ6A 5IIOA 4AT7A 3V6JA 4Y2JA 2KNJA 4IL6U 5HRGA 1B0XA 1FFUA 2DVIA 4RWOA 2KMDA 7ICVA 3EWAA 4JK1A 2RLTA 2W7OA 5AI5A 4JV1A 1ZD4A 4CF4A 1CRXA 3RF9A 3PW5A 1FEZA 1ZQLA 4M6WA 8ICXA 2KTQA 1UPHA 1SZPA 2JGAA 4US8A 5HRBA 2PFOA 2GA9D 1QLNA 1JIHA 2FLLA 3K1ZA 2DR5A 2C2DA 4J9LA 2PI4A 1DXSA 3GV8B 1S0NA 1X2IA 4F4YA 2BPFA 3N97B 5HP4A 1L3UA 3EZ5A 4F5OA 2HHUA 3GIIA 4ECUA 3WKBA 1S10A 1LVHA 1PK1A 3AQKA 5KFZA 1ZYQA 2LYHA 5J2EA 3PX0A 1F5SA 5G5HA 2FCLA 1GPJA 9ICRA 4WC7A 4JLXA 5DQGA 4QZFA 4WC0A 4EBEA 3D2NA 5KNIA 4K4IA 4P0PA 3LK9A 5IIIA 1A0PA 3MFHA 2W9BB 2Q0ZX 4O3PA 3UQ2A 1ZQTA 2HN2A 3QUBA 2PFNA 3E2EA 2LM4A 4NL9C 3MR5A 2ISOA 8ICPA 1XS9D 1X6JA 5HMMA 3J81j 4UAVA 4B9LA 1Q3VA 2RP5A 4QIWF 5CHGA 2BQRA 3MCRA 1NZPA 2ZH3A 4F71A 4EZ6A 3RAQA 2F8KA 4M6WB 4LJXA 4ELVA 4LVSA 3QX7A 1A76A 3SAHA 3JPRA 1A77A 2PMZC 4BUGA 1T3QA 1D9FA 2PFQA 4EV6A 1KEJA 2IHNA 3HILA 4CF3A 5HRHA 2KFZA 4RU9A 1PK1B 4EBDA 1KQQA 5HNKA 7ICNA 3ZI4A 1R8BA 2JEGA 3SAFA 5AM3A 4B9VA 5DLFA 4KLUA 4FFDA 3JPQA 1KBUA 1DOQA 1ZQRA 4NY8A 4DOCA 3ED5A 4UB1A 2DL0A 4ECSA 2V4QA 5KFPA 4P0PB 1IV8A 4KN4A 9ICQA 4KMUA 5HRFA 8ICVA 2FPLA 5DQIA 5KFQA 4F72A 3IDWA 1NJZA 1R89A 3C29A 3NGDA 2DKZA 3JZ0A 2W03A 4X4VA 4CGZA 3GIJA 3HP6A 2QKQA 5HMLA 2HHVA 5B3PA 5BOLA 2M2UA 4UD4A 4F3OA 2Y0SC 5KG3A 4IR9A 4NLNA 4DFKA 4KLOA 5J8YC 3THVA 4Q8EA 3RBEA 4XA5A 4ECQA 3TAQA 3QYPA 1SXDA 4TURA 2FLNA 2DR8A 5J0SA 4I2EA 3HJ1A 3M1YA 5AM5A 5AIBA 3RB0A 1WG8A 2E1FA 2ODGA 3RJKA 3AUOA 4N7RA 3GFKB 1RQLA 4EEYA 9ICMA 1ZETA 4KLHA 3H37A 4EENA 1NK0A 2YQEA 4X4OA 2B6GA 1ZQQA 4E80A 2ESEA 2V9WA 3JCFA 3E58A 5KFLA 2OCEA 5F2VO 1NK9A 7ICHA 1TK8A 3PX6A 4JV2A 1UEVA 1X42A 3UPSA 1QCKA 1VFGA 3ISDA 2F77X 4I29A 1TAUA 3PV8A 5IIKA 1X9SA 5AKIA 2UVUA 3PX4A 2BBJA 4EEBA 3NYBA 3PR4A 3GQCA 4RUCA 1C20A 3E0FA 3ZDBA 5KFNA 1BPZA 5ALTA 5JTIA 1V4AA 3OTQA 3V72A 4RNOA 3LYSA 4QW9A 2H5XA 3C66A 1MA7A 3FYHA 4O68A 2HW3A 3ETRA 8ICCA 3AQFA 4UAZA 5ALKA 3F53A 1XNSA 2ASJA 4DL3A 3SI8A 2ZIUA 2KICA 4KX3A 4CNQA 9ICPA 3U26A 5DG8A 4DO9A 4DS5A 5E79U 5DGBA 5AI6A 3OV7A 3IRUA 2MAXA 2RHFA 3PSIA 5KFJA 1ZQ1C 2ZIWA 1BPXA 5KFWA 1S0VA 5D62A 2YX8A 3H8WA 4ECTA 4M47A 3OUYA 2W9CA 1J2NA 2P35A 1WWVA 4O3QA 2FPMA 2WF5A 2HOQA 2YMPA 3RR7A 4PHDA 2ZH1A 1HIWA 3M7DA 4AT9A 2DPJA 2A1AA 1L3VA 4IS7A 3DEEA 3PY8A 5KG2A 1WUDA 1SV0C 1KFDA 5J0PA 3D2SA 1ZQHA 4BX9C 3KOOA 4QZEA 2Y9TA 3WK7A 2MRLA 1SXEA 5ALPA 3WKCA 3WFSC 4RUAA 2H3FA 9ICJA 4UAWA 3FM9A 3N7SC 2G09A 2EZZA 3H3AA 5JRTA 1TVAA 4J9PA 2ZXHA 1K1SA 3BJYA 5ALIA 4WOYA 2XVTA 4X4RA 5DLGA 4WC6A 2IMWP 4RWNA 5KFTA 4X5VA 4PL1A 3SD7A 2ZIUB 1C7YA 4UB3A 1N5XA 2LI6A 3SV4A 3PW2A 1L7OA 8ICHA 3MGHA 3BQ0A 4EBJA 1S0OA 1S76D 4ATBA 4XUSA 1MQ2A 4B9TA 2ZIWB 3A0BU 1L3TA 4ELUA 4C80A 9ICXA 4UATA 4JUZA 3C5FA 4KLEA 4ED2A 2E5SA 3OVSA 2B0CA 5ALWA 5AI9A 1WOTA 1OU5A 3OUYB 1WYGA 2W9CB 4FHVA 1ZJMA 2MSNA 2ALZA 1S77D 5L1LA 3FAHA 3IV6A 4OJPA 3L5KA 7ICSA 5AI4A 2W3SA 2PI5A 1QSLA 4EEKA 5KFCA 1ZQOA 4AT9B 2R8GA 3C21A 1RQNA 4GLXA 5KFSA 3WFPA 5HREA 5ALJA 7ICKA 5D61A 2AJQA 3JPSA 4OJOA 1UETA 2W9MA 3QXGA 1NO5A 4KX5A 1Z00A 1MN8A 5EWGA 5DG7A 3CW2C 4FHPA 4WC4A 5ALVA 4TQSA 5KG7A 4MEXA 1NK5A 1NK4A 3M6KA 2JZBA 4UASA 5KT7A 4M0AA 5KG0A 2H3IA 3QE9Y 2HHPA 1J97A 5J0YA 4YQWA 3QU4A 1XO0A 2XY6A 4O3RA 2MUTA 1ZQDA 4R63A 8ICQA 4ATBB 3Q8LA 1D8BA 5EWFA 3IG8A 5J2GA 2BCRA 4TUQA 5DQHA 4NJ8A 2HOFA 2I5HA 5ALUA 4DL4A 2K60A 3SYZA 4US9A 1RG6A 1AQ6A 4MFFA 2GAFD 1ZQYA 2GH1A 3OSPA 1L5UA 2KN7A 2C2RA 4RT3A 3C2MA 1SKWA 4X4UA 3N7RC 3RTVA 4I2FA 5T14A 3UXOA 1BVSA 2ZH7A 2HHSA 2ZH6A 2OYYA 8ICJA 9ICLA 4ECWA 2DWQA 2WB1C 3BQTA 1KTQA 2JEJA 1Z00B 1ZQGA 3PSPA 3I76A 2DKXA 3CK6A 4M9JA 7ICPA 1B4FA 3WK6A 4NM2A 2QB0A 1X9XA 2N1RA 3OSNA 2DBYA 2V4RA 2Y9UA 3KKAC 4RQ2A 2VA8A 1XSLA 3WFRE 2PMZF 4JMUA 2JZBB 4B9SA 1V97A 1X6IA 7ICJA 2XI9A 5ALLA 3WK5A 2EZYA 4YR2A 1RDFA 4X4SA 3OWGA 5JTGA 2KSOB 1ZRNA 3H39A 2OWOA 1ZQAA 2MUTB 3R9KA 3L9DA 2H3ZA 3HJEA 2HBKA 4DS4A 2I1QA 1XSPA 2RQ5A 3AQNA 3NS1A 3G6VA 1NJWA 1OUQA 2EDUA 3BQ1A 4ED3A 9ICVA 1IG6A 2W7PA 2E3TA 1ECWA 1ZQVA 1U4BA 5HR6A 4X4QA 3ZDDA 2LPEA 4TQRA 2KIVA 2BDUA 3S6JA 5G5GA 1ZJNA 4F2SA 5J0XA 2DR7A 4UARA 5J0QA 4EEDA 1S0MA 4RPYA 1SIJA 1PK3A 2B4VA 3DDHA 5GTHU 1NZBA 2BKEA 4DF4A 3V7LA 1Q79A 4K97A 4LEVA 5J0RA 1MIYA 4XJEA 1JI7A 2Y0SF 5CWRA 2AXTU 2K4HA 5KG1A 2YMQA 3N7PD 4OAHA 4KB6A 2QB0B 3RJIA 2KEYA 2DGZA 3OHBA 3NRWA 1JX4A 1GO3F 2HCFA 3ER8C 3OJUA 3FDSA 3QUCA 1M6YA 2KHQA 2XY5A 2BZFA 1KNYA 1NJXA 1U9LA 1LKYA 2EAMA 1D9DA 4EYHB 2OM6A 4NXVA 3H40A 2I6XA 3QU5A 4B6JA 4J9MA 4O3SA 2P6RA 2HVIA 4LEZA 1L8OA 4F2RA 4FBUA 2KJ5A 2Q66A 3KFUF 1TE2A 2EH9A 4UQGA 2A1JA 4F50A 1QTMA 5KFVA 3MR2A 3K1RB 5F3XB 1VJ7A 5CA7A 9ICUA 5K4LA 4OAFA 2BQ3A 2F44A 4QZHA 3QZ7A 4FS1A 5ALOA 5DGAA 2EAOA 3CNHA 5HHHA 4F4ZA 3RJGA 4RZRA 3ZD9A 4ED6A 2IBKA 2K4IA 3QNMA 4M04A 5DBAA 3MGVA 5EE9A 4RQ5A 3RB3A 1B43A 3BZKA 2ZH5A 4ECXA 3UQ0A 5J2KA 3TKAA 4C8NA 4GXKA 2NO5A 1FFVA 2W04A 4GXIA 2ZJAA 1L7PA 5AK4A 2VJ4A 5ALRA 1L3SA 4RQ8A 2HVHA 1QQ5A 1LKYB 3WK4A 3AQMA 2B56A 4KMOB 2B51A 2LHTA 4I2DA 5HR9A 1DRGA 1L8LA 5KT2A 4IQTA 1D8LA 4NKTA 3IP4B 4AT7B 2XCPA 4WC2A 5KL8B 4DSIA 5KG6A 2MU2A 2A1JB 2EZXA 4YCXA 1XC9A 2IUBA 3BQ7A 3SAGA 3D6JA 4JB3A 3ZDEA 3ICXA 4S3NA 2E8OA 2VANA 2HBMA 1V85A 5J0WA 4EX6A 5AI8A 1TFRA 3CRXA 4FZNA 3JPNA 1ZQKA 4A8EA 1Q46A 1ZQMA 3ZDCA 2F76X 3BQ2A 2HI0A 2C22A 1L7NA 5KFXA 4UW9A 9ICBA 4FH3A 2BCUA 3UPQA 5J2CA 4WBZA 3B0YA 4PJ0U 3RJHA 2JEFA 4DQRA 8ICIA 1COOA 8ICSA 8ICLA 5CJ7A 4WQLA 1BPEA 1SV0A 2FJ6A 3NVWA 3PVXA 4MFCA 5FP0A 7ICLA 4K99A 1SB3C 3PHZA 3LQCB 5ALEA 2RDJA 2VKQA 3KTQA 1MIWA 5L1JA 4UD5A 4I2BA 4UAYA 4X0AA 3AN1A 4DQIA 3H8MA 3BDPA 3WKDA 1TAQA 5DDYA 4YXJA 2NV3A 2OHFA 8ICZA 1A6SA 5HRDA 9ICWA 4EBKA 3BS5A 4DL2A 4C8MA 4Q45A 8ICBA 3LDAA 4C4RA 3H4BA 3LWMA 2R8JA 1IIPA 1WCNA 3C2LA 4KLIA 9ICHA 1QQ6A 3JPOA 3D2QA 3H0RB 4DEZA 1Q3UA 3TQ1A 4MFAA 4I0UA 1RZTA 2A19A 2FPKA 4RPXA 1KDHA 1K5OA 4ED0A 4LZDA 2ZHBA 5KFHA 5TZVA 3LVVA 2JRZA 2O6KA 5ALNA 4DSEA 4RQ1A 2R8IA 1N63A 4WC3A 3B0XA 4O3MA 4P4PA 4WC5A 1KN5A 4QWBA 1V9PA 8ICRA 1K1QA 1X40A 2HDOA 2GO7A 1T8EA 9ICSA 4DL7A 4B9MA 4K4HA 2K4EA 3SENA 1T4GA 4KLLA 4QWDA 3NUQA 3QEAZ 1V38A 5EOZA 3RJFA 4CRXA 4I2IA 4K9BA 1L6NA 1N61A 4J9QA 4P0QA 4GIBA 4DL5A 3F5AA 1YT3A 3BS5B 5HRLA 4JWMA 3L4PA 4NXWA 1KLNA 2PFPA 4I28A 1N48A 5KT3A 1XU4A 2WB1F 4Q8FA 1BNOA 2AGPA 2P6UA 4IR1A 5C5JA 4Y2TA 5JU5A 4IRKA 4LEYA 3UXPA 1MSWD 5HRKA 3OVBA 1Z1BA 4HX0A 3QU9A 2UVWA 2ZTDA 1RPLA 5KAFU 1ZD3A 2BPCA 2XY7A 4RWPA 3PR5B 1BNPA 1X66A 2BGWA 5DBBA 5CFTA 5AKJA 8ICNA 3AM9A
chains in the Genus database with same CATH topology
2MUTA 5DB6A 1UT8A 4Q43A 4QWAA 1NKBA 4M2YA 1ZQDA 4R63A 8ICQA 4C8OA 4ATBB 3ZDAA 3Q8LA 3PW0A 1IXRA 2ZH2A 5HHIA 5EWFA 2W9BA 1BPDA 2BE3A 4J9OA 3UXNA 4M9LA 5J2GA 4KLMA 2M9NA 4TUQA 2BCRA 5DQHA 1KRPA 2ID1A 4F5RA 4YD2A 3JPPA 4EZ9A 4GC6A 4DL4A 3H7IA 5IIOA 4RQ6A 1RXWA 5CR0A 3V6JA 4I2HA 4AT7A 2PBEA 2KFNA 4Z6EA 3SYZA 2ZUDA 5HRGA 2UVRA 4MFFA 4UBCA 8ICTA 3RJEA 2DVIA 5KFIA 4RWOA 1ZQYA 3OSPA 1L5UA 7ICVA 3EWAA 2KN7A 2C2RA 8ICWA 9ICTA 3RB6A 4RT3A 3PMNA 4NM1A 7ICUA 4JK1A 4KN7A 3C2MA 1SKWA 4P4OA 4X4UA 4KLJA 4JV1A 4X4NA 4Z6DA 5DBCA 1SL1A 5J2HA 3RTVA 4RNMA 4I2FA 3PW5A 3V7KA 1ZQLA 1S97A 3UXOA 1BVSA 4ED8A 4M9HA 4M6WA 2ZH7A 1U45A 1LB2B 2HHSA 3H38A 1ZQUA 4DFMA 8ICJA 9ICLA 9ICOA 8ICXA 2ZH6A 2KTQA 4ECWA 1SZPA 3BQTA 4FS2A 4G3IA 5HRBA 1KTQA 3MGIA 1Z00B 2JEJA 3RRGA 3JYYA 1ZQGA 4ECVA 2PFOA 4IRDA 4O5KA 2DRAA 1QLNA 1JIHA 2FLLA 3K4GA 2DR5A 5KFDA 2C2DA 4M9JA 7ICPA 4J9LA 4NM2A 2PI4A 2KZ3A 3GV8B 3RH6A 1LV5A 1S0NA 1X2IA 1R8AA 4F4YA 3K75D 5DKWA 3N97B 2BPFA 4E8FA 5HP4A 1L3UA 4O9MA 3OSNA 3EZ5A 2V4RA 2AGQA 4YR3A 4F5OA 4R65A 3HW8A 3GIIA 4ECUA 3T5HA 1NJYA 1S10A 4RQ2A 3MDAA 2VA8A 1XSLA 3WFRE 2XGPA 3AQKA 2JZBB 5KFZA 1HUZA 4B9SA 1ZYQA 3PW7A 2LYHA 5J2EA 7ICJA 3PX0A 4PPXA 4UBBA 3PO4A 4Z6FA 4YR2A 5KFFA 4X4SA 9ICRA 4WC7A 3HPOA 3T5KA 1HJPA 5DQGA 2IA6A 7ICOA 1UA0A 1JXEA 8ICGA 4TUSA 3PMLA 4QZDA 7ICIA 4QZFA 3H39A 3H8JA 1SKRA 4WC0A 4EBEA 1WCLA 5L1KA 3C23A 2OWOA 8ICAA 4K4IA 1U48A 1ZQAA 1RYSA 2MUTB 4ECZA 3L9DA 4DS4A 2I1QA 4DQQA 1XSPA 1ZQNA 3LK9A 4WC1A 5IIIA 3MFHA 3AQNA 2W9BB 4YFKA 3G6VA 1NJWA 2Q0ZX 3BQ1A 4C8LA 4O3PA 4ED3A 9ICVA 3UQ2A 3GIMA 2DR9A 1ZQTA 3WFQE 5D4BA 2PFNA 3E2EA 3MR5A 1ZQVA 1U4BA 1PZNA 4FHXA 2ISOA 4X4QA 4WBYA 4R8UA 8ICPA 4IQVA 4YP3A 1XS9D 3ZDDA 4LZGA 5HMMA 4BDPA 4GC7A 4TQRA 4B9LA 5BOMA 4ELTA 4KLFA 4R64A 3RB4A 5KT6A 5CHGA 5J0OA 4I2CA 4QWEA 9ICEA 2BQRA 1ZJNA 3KHGA 4ED7A 5J0XA 3RH5A 4F2SA 1NZPA 2DR7A 2ZH3A 1CEZA 7ICEA 5KFBA 5F9LA 5J0QA 4DQSA 2Y1IA 1S0MA 4RPYA 4EZ6A 1N56A 3NTUA 3RAQA 4M6WB 5L1IA 4RQ7A 4ELVA 1NOMA 8ICFA 3C1YA 2KP7A 4LVSA 2BKEA 4DF4A 3V7LA 1A76A 5J2BA 1Q79A 4B9NA 5J0RA 3JPRA 1A77A 7ICGA 7ICQA 1MIYA 2PFQA 1D9FA 5CWRA 5KG1A 2XGQA 3MDCA 8ICKA 1KEJA 5IINA 2IHNA 3RJIA 5KFAA 4IQUA 4YN4A 1QSYA 4NLGA 1SL2A 1ZQXA 3OHBA 5HRHA 1F5AA 2KFZA 4RU9A 1JX4A 3PO5A 1B22A 3OJUA 4O3OA 3EPGA 4BXOA 3FDSA 4EBDA 2ZJ8A 9ICCA 5HNKA 2J6TA 4RWQA 7ICNA 1R8BA 4ZH4A 2XY5A 2F1HA 1BPYA 2JEGA 3ORYA 4FBTA 1AROP 8ICOA 1KFSA 4B9VA 5DLFA 1KNYA 1NJXA 4KLUA 3JPQA 1U9LA 4O0IA 1DOQA 4Z6CA 3V6KA 1ZQRA 2UVVA 3M9MB 4DSLA 4DOCA 1S9FA 1D9DA 4NY8A 4DLEA 4QW8A 4EYHB 2RDIA 4UB1A 4F5PA 2NRTA 3H40A 2ZUCA 5D49A 2ATLA 4ECSA 5KFOA 2V4QA 5KFPA 5BPCA 4J9MA 1T3NA 4O3SA 2P6RA 2HVIA 4KN4A 4F2RA 2BQUA 4FO6A 4FBUA 1ZQSA 4IRCA 4K4GA 9ICQA 2Q66A 4KMUA 5HRFA 8ICVA 2FPLA 5DQIA 5KFQA 3RBDA 4UQGA 1UEUA 3C18A 5CB1A 4ECRA 2A1JA 2BDPA 3OVAA 3IHQB 4F50A 2XO7A 5KFVA 1QTMA 1NJZA 1XO1A 1R89A 3MR2A 4F8RA 4X4TA 3NGDA 1DK2A 2VA3A 4BWMA 2P66A 3Q8KA 9ICAA 3JZ0A 2C28A 4JV0A 5CA7A 3OHAA 3EPIA 2BPGA 2IHMA 9ICUA 2BQ3A 1ZQIA 4X4VA 1T7PA 3GIJA 2HHTA 3HP6A 4QZHA 3QZ7A 1Y88A 5HMLA 5KTQA 4FS1A 4CCHA 5KG5A 5DGAA 2HHVA 5HHHA 4XQ7A 2W9AA 5BOLA 3HX0A 2F1JA 4F4ZA 2M2UA 1TK0A 4RQ4A 3RJGA 3T3FA 3RJJA 4UD4A 4RZRA 3ZD9A 4ED6A 4F3OA 5KG3A 5J0UA 4IR9A 4NLNA 5DB9A 4DFKA 4KLOA 4DWIA 2WTFA 4F91B 3THVA 2GWSA 4E0DA 4Q8EA 4M9NA 2IBKA 3RBEA 2M2VA 4XA5A 4ECQA 3TAQA 4X0BA 3LWLA 4EYIB 4M04A 5DBAA 4X4PA 1DGSA 3TAPA 4RQ5A 3RB3A 1B43A 4TURA 2FLNA 4QZ8A 2DR8A 4PHPA 1H38A 5J0SA 4ECXA 4YMMA 1JQRA 2ZH5A 3UQ0A 4I2EA 3HIYA 3HJ1A 4P2HA 5J2KA 4C8NA 4GXKA 4KTQA 5IIMA 5IIJA 3RB0A 5KFUA 3RJKA 4BXOB 3AUOA 4YMOA 3GFKB 4GXIA 1NKCA 4NLZA 2ZJAA 2NRZA 4EEYA 4LT6A 1NK7A 9ICMA 3Q8SB 1ZETA 4KLHA 1L3SA 4QZ9A 4RQ8A 3H37A 2HVHA 3C1ZA 4GXJA 4YD1A 1NK0A 7ICMA 1Q78A 4PGYA 3M9OB 2BCVA 2J6UA 2KZZA 3AQMA 3GV7B 4X4OA 2ZH4A 2BCSA 3RRHA 4YVZA 1ZQQA 2XCAA 1RYRA 4I2DA 4E80A 5HR9A 2V9WA 2BHNA 5KT2A 4I2GA 3AU6A 4IQTA 1D8LA 4KITB 5F9NA 3HT3A 4NKTA 4AT7B 5KFLA 5KFEA 2NRXA 3TFSA 2XCPA 5F2VO 4WC2A 9ICKA 2BR0A 1NK9A 2NRWA 2M2TA 1ZQZA 5KT5A 7ICHA 1ZQJA 4MF8A 3PX6A 1TK8A 5KFKA 4DSIA 4JV2A 1MC8A 1TKDA 1UEVA 5KG6A 2A1JB 4YCXA 1XC9A 1BPBA 3UPSA 1RXVA 2F1IA 1VFGA 1CUKA 4HYKA 3ISDA 4F4KA 3ZDEA 4I29A 4DOAA 3PV8A 3N4MB 1D8YA 1TAUA 2VANA 5IIKA 3V7JA 2XC9A 1X9SA 4S3NA 5J0WA 4QZCA 2ZHAA 2UVUA 3PX4A 4O5CA 1TFWA 3KHRA 2R8HA 4NKUA 4DOBA 3NYBA 3PR4A 3GQCA 1TFRA 3JPNA 5DECA 1ZQBA 4RUCA 2NRVA 4YR0A 1ZQKA 2AGOA 3ZDBA 2HHWA 5EWEA 1ZQMA 5KFNA 5KG4A 4RNNA 3EYZA 1BPZA 3ZDCA 4FH5A 2ZUBA 3TFRA 7ICTA 1YLQA 9ICFA 1V4AA 4QZGA 3GV5B 3V72A 4RNOA 1BGXT 3H4DA 4QW9A 3BQ2A 5DB7A 2H5XA 3HWTA 3GILA 4J9KA 3QEBZ 3C66A 3RH4A 2C22A 3FYHA 3M8SA 2HHQA 4KLTA 4EP7A 5HC9A 5KFXA 2HW3A 4J9NA 9ICBA 4FH3A 8ICCA 2ZJ5A 4DQPA 2BCUA 4UAZA 1ZQCA 4PHAA 2JEIA 3UPQA 5J2CA 4WBZA 3B0YA 5KT4A 2ASJA 4DL3A 3Q8PB 3SI8A 3RR8A 3RJHA 3MBYA 3Q8RB 2JEFA 3C5GA 4DQRA 4YG2A 8ICIA 1COOA 3JPTA 2DPIA 3H8SA 8ICLA 8ICSA 4MEYA 9ICPA 5CJ7A 5DG9A 4FHYA 5DG8A 4UB4A 4RPZA 4DO9A 4DS5A 1ZQPA 5DGBA 2O1PA 1BPEA 5KFYA 4E7XA 3OV7A 3AQLA 2MAXA 4XQ8A 4ECYA 5KFJA 9ICGA 2R8KA 2AU0A 3PVXA 2AQ4A 4MFCA 4F5NA 1JXLA 7ICLA 4PGQA 4DFJA 1TV9A 5KFWA 1BPXA 1QSSA 4M5DA 1XWLA 4J9SA 4F4WA 1S0VA 4EBCA 3ETLA 4DSKA 2FLPA 3LQCB 4I2JA 3RAXA 3EW9A 2AQ0A 3H8WA 3G6YA 2RDJA 4R8UB 5KFRA 3OGUA 4ECTA 4M47A 2W9CA 4J9RA 3OUYA 1MIWA 3KTQA 1IM4A 5L1JA 4DFPA 2FMQA 4UD5A 4I2BA 4UAYA 4X0AA 2DFLA 4O3QA 2FPMA 3RR7A 4DQIA 2ZH1A 4PHDA 3BDPA 1TAQA 5DDYA 4YXJA 4AT9A 2DPJA 4IQWA 1L3VA 4TUPA 3PY8A 4NXZA 5KG2A 2ISPA 1NK6A 4O3NA 7ICFA 4M9GA 3SZ2A 1KFDA 5DDMA 8ICZA 5J0PA 1SL0A 2I9GA 4UB2A 5HRDA 3MABA 1ZQHA 9ICWA 8ICYA 4KLSA 4QZEA 5CP2A 4EBKA 4DL2A 5J29A 3PW4A 4C8MA 4PH5A 3M8RA 5J0TA 4Q45A 8ICBA 3WFSC 3LDAA 3GIKA 4QZBA 3H4BA 4F4XA 3LWMA 1FA0A 3OJSA 2R8JA 2VA2A 4RUAA 1U47A 9ICJA 4UAWA 1NK8A 7ICRA 4MF2A 1WCNA 4PHEA 5KFGA 5L9XA 3C2LA 2W8KA 4KLIA 5J2JA 4UB5A 3H3AA 3TARA 4AT8A 4I27A 1TVAA 9ICHA 1X9WA 3JPOA 4J9PA 4DEZA 1K1SA 3BJYA 2O5AA 3TQ1A 4MFAA 4X4RA 1RZTA 1HUOA 5J2AA 5DLGA 4WC6A 2FPKA 2IMWP 4RPXA 4RWNA 5KFTA 1KDHA 4X5VA 3QZ8A 1JMSA 4ED0A 4F92B 4C8KA 4LZDA 3T5LA 1VJ7A 1C7YA 4UB3A 2ZHBA 5KFHA 5TZVA 2HHUA 3M9NB 2FMSA 4DSEA 1ZQWA 5J2FA 4RQ1A 3SV4A 3PW2A 3T5JA 1EXNA 3MGHA 3BQ0A 8ICHA 2ASLA 1R8CA 4EBJA 1S0OA 1S76D 8ICEA 4DF8A 4ATBA 2R8IA 3C2KA 4I2AA 4WCWA 4YMNA 4FHWA 3GDXA 4WC3A 2HHXA 3ISCA 3KHHA 1MQ3A 4XUSA 3B0XA 1MQ2A 4B9TA 2NRKA 2FMPA 1L3TA 4ELUA 4P4PA 4PGXA 9ICXA 4WC5A 4JUZA 3C5FA 4KLEA 4QWBA 4ED2A 3MFIA 1V9PA 3IM1A 1ZQFA 8ICUA 3OVSA 4QZIA 4RT2A 1WOTA 1UA1A 1OU5A 4NLKA 1JN3A 1K1QA 2W9CB 8ICRA 4FHVA 1XSNA 1ZJMA 1KSPA 4ED1A 2W8LA 1T8EA 4O5EA 2ALZA 1S77D 9ICSA 5L1LA 3V6HA 4DL7A 1DK3A 2RFFA 4DLGA 4B9MA 4YXMA 4K4HA 7ICSA 2ZH9A 2PI5A 1QSLA 5KFCA 5IILA 1ZQOA 4Q44A 5HRIA 1T4GA 3MR6A 4KLLA 2R8GA 4AT9B 3C21A 4QWDA 4JWNA 4RQ0A 4GLXA 5KFSA 4P4MA 3Q8MA 3AU2A 3QEAZ 5EOZA 2Y1JA 3RJFA 3WFPA 4I2IA 1SKSA 5HREA 4RQ3A 4F93B 1U49A 4J9QA 5DEDA 9ICNA 4KLQA 4BWJA 2DRBA 2KZMA 7ICKA 4DL5A 3JPSA 2AJQA 1UETA 4F5QA 2W9MA 1Z3EB 3TANA 1NO5A 5D46A 3MR3A 3ISBA 3TI0A 4KLGA 5HRLA 1Z00A 1TFYA 4R66A 4JWMA 2J6SA 5EWGA 3WFOA 1KLNA 2PFPA 5DG7A 3G6XA 1JAJA 4I28A 2ZTCA 4QZAA 1N48A 2PXIA 4BGDA 3PNCA 4FHPA 1UT5A 3KHLA 2B21A 5KT3A 3OUYB 5J2IA 4WC4A 1XU4A 1NKEA 9ICIA 4TQSA 4Q8FA 1BNOA 4AT8B 4IG8A 2C2EA 4XRHA 2AGPA 1KFTA 2P6UA 4KLDA 4IR1A 5KG7A 4MEXA 1NK5A 1NK4A 5C5JA 2JZBA 4B9UA 4IRKA 5KT7A 3UXPA 1MSWD 5HRKA 4M0AA 3OVBA 2ASDA 2UVWA 4QWCA 5KG0A 3QE9Y 2ZTDA 1RPLA 4DL6A 4DSJA 2HHPA 2ZH8A 5KFMA 3SV3A 5DB8A 1TK5A 3ZD8A 2ZTEA 2BPCA 3Q8QB 2XY7A 1X9MA 3PR5B 1PX5A 3HJ4A 4RWPA 5JUMA 1BNPA 5J0YA 2BCQA 4YQWA 5J2DA 2BGWA 5DBBA 1ZQEA 8ICMA 2M2WA 1MIVA 8ICNA 2XY6A 4DSFA 4O3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUT A;  5DB6 A;  1UT8 A;  4Q43 A;  4QWA A;  1NKB A;  4M2Y A;  1ZQD A;  4R63 A;  8ICQ A;  4C8O A;  4ATB B;  3ZDA A;  3Q8L A;  3PW0 A;  1IXR A;  2ZH2 A;  5HHI A;  5EWF A;  2W9B A;  1BPD A;  2BE3 A;  4J9O A;  3UXN A;  4M9L A;  5J2G A;  4KLM A;  2M9N A;  4TUQ A;  2BCR A;  5DQH A;  1KRP A;  2ID1 A;  4F5R A;  4YD2 A;  3JPP A;  4EZ9 A;  4GC6 A;  4DL4 A;  3H7I A;  5IIO A;  4RQ6 A;  1RXW A;  5CR0 A;  3V6J A;  4I2H A;  4AT7 A;  2PBE A;  2KFN A;  4Z6E A;  3SYZ A;  2ZUD A;  5HRG A;  2UVR A;  4MFF A;  4UBC A;  8ICT A;  3RJE A;  2DVI A;  5KFI A;  4RWO A;  1ZQY A;  3OSP A;  1L5U A;  7ICV A;  3EWA A;  2KN7 A;  2C2R A;  8ICW A;  9ICT A;  3RB6 A;  4RT3 A;  3PMN A;  4NM1 A;  7ICU A;  4JK1 A;  4KN7 A;  3C2M A;  1SKW A;  4P4O A;  4X4U A;  4KLJ A;  4JV1 A;  4X4N A;  4Z6D A;  5DBC A;  1SL1 A;  5J2H A;  3RTV A;  4RNM A;  4I2F A;  3PW5 A;  3V7K A;  1ZQL A;  1S97 A;  3UXO A;  1BVS A;  4ED8 A;  4M9H A;  4M6W A;  2ZH7 A;  1U45 A;  1LB2 B;  2HHS A;  3H38 A;  1ZQU A;  4DFM A;  8ICJ A;  9ICL A;  9ICO A;  8ICX A;  2ZH6 A;  2KTQ A;  4ECW A;  1SZP A;  3BQT A;  4FS2 A;  4G3I A;  5HRB A;  1KTQ A;  3MGI A;  1Z00 B;  2JEJ A;  3RRG A;  3JYY A;  1ZQG A;  4ECV A;  2PFO A;  4IRD A;  4O5K A;  2DRA A;  1QLN A;  1JIH A;  2FLL A;  3K4G A;  2DR5 A;  5KFD A;  2C2D A;  4M9J A;  7ICP A;  4J9L A;  4NM2 A;  2PI4 A;  2KZ3 A;  3GV8 B;  3RH6 A;  1LV5 A;  1S0N A;  1X2I A;  1R8A A;  4F4Y A;  3K75 D;  5DKW A;  3N97 B;  2BPF A;  4E8F A;  5HP4 A;  1L3U A;  4O9M A;  3OSN A;  3EZ5 A;  2V4R A;  2AGQ A;  4YR3 A;  4F5O A;  4R65 A;  3HW8 A;  3GII A;  4ECU A;  3T5H A;  1NJY A;  1S10 A;  4RQ2 A;  3MDA A;  2VA8 A;  1XSL A;  3WFR E;  2XGP A;  3AQK A;  2JZB B;  5KFZ A;  1HUZ A;  4B9S A;  1ZYQ A;  3PW7 A;  2LYH A;  5J2E A;  7ICJ A;  3PX0 A;  4PPX A;  4UBB A;  3PO4 A;  4Z6F A;  4YR2 A;  5KFF A;  4X4S A;  9ICR A;  4WC7 A;  3HPO A;  3T5K A;  1HJP A;  5DQG A;  2IA6 A;  7ICO A;  1UA0 A;  1JXE A;  8ICG A;  4TUS A;  3PML A;  4QZD A;  7ICI A;  4QZF A;  3H39 A;  3H8J A;  1SKR A;  4WC0 A;  4EBE A;  1WCL A;  5L1K A;  3C23 A;  2OWO A;  8ICA A;  4K4I A;  1U48 A;  1ZQA A;  1RYS A;  2MUT B;  4ECZ A;  3L9D A;  4DS4 A;  2I1Q A;  4DQQ A;  1XSP A;  1ZQN A;  3LK9 A;  4WC1 A;  5III A;  3MFH A;  3AQN A;  2W9B B;  4YFK A;  3G6V A;  1NJW A;  2Q0Z X;  3BQ1 A;  4C8L A;  4O3P A;  4ED3 A;  9ICV A;  3UQ2 A;  3GIM A;  2DR9 A;  1ZQT A;  3WFQ E;  5D4B A;  2PFN A;  3E2E A;  3MR5 A;  1ZQV A;  1U4B A;  1PZN A;  4FHX A;  2ISO A;  4X4Q A;  4WBY A;  4R8U A;  8ICP A;  4IQV A;  4YP3 A;  1XS9 D;  3ZDD A;  4LZG A;  5HMM A;  4BDP A;  4GC7 A;  4TQR A;  4B9L A;  5BOM A;  4ELT A;  4KLF A;  4R64 A;  3RB4 A;  5KT6 A;  5CHG A;  5J0O A;  4I2C A;  4QWE A;  9ICE A;  2BQR A;  1ZJN A;  3KHG A;  4ED7 A;  5J0X A;  3RH5 A;  4F2S A;  1NZP A;  2DR7 A;  2ZH3 A;  1CEZ A;  7ICE A;  5KFB A;  5F9L A;  5J0Q A;  4DQS A;  2Y1I A;  1S0M A;  4RPY A;  4EZ6 A;  1N56 A;  3NTU A;  3RAQ A;  4M6W B;  5L1I A;  4RQ7 A;  4ELV A;  1NOM A;  8ICF A;  3C1Y A;  2KP7 A;  4LVS A;  2BKE A;  4DF4 A;  3V7L A;  1A76 A;  5J2B A;  1Q79 A;  4B9N A;  5J0R A;  3JPR A;  1A77 A;  7ICG A;  7ICQ A;  1MIY A;  2PFQ A;  1D9F A;  5CWR A;  5KG1 A;  2XGQ A;  3MDC A;  8ICK A;  1KEJ A;  5IIN A;  2IHN A;  3RJI A;  5KFA A;  4IQU A;  4YN4 A;  1QSY A;  4NLG A;  1SL2 A;  1ZQX A;  3OHB A;  5HRH A;  1F5A A;  2KFZ A;  4RU9 A;  1JX4 A;  3PO5 A;  1B22 A;  3OJU A;  4O3O A;  3EPG A;  4BXO A;  3FDS A;  4EBD A;  2ZJ8 A;  9ICC A;  5HNK A;  2J6T A;  4RWQ A;  7ICN A;  1R8B A;  4ZH4 A;  2XY5 A;  2F1H A;  1BPY A;  2JEG A;  3ORY A;  4FBT A;  1ARO P;  8ICO A;  1KFS A;  4B9V A;  5DLF A;  1KNY A;  1NJX A;  4KLU A;  3JPQ A;  1U9L A;  4O0I A;  1DOQ A;  4Z6C A;  3V6K A;  1ZQR A;  2UVV A;  3M9M B;  4DSL A;  4DOC A;  1S9F A;  1D9D A;  4NY8 A;  4DLE A;  4QW8 A;  4EYH B;  2RDI A;  4UB1 A;  4F5P A;  2NRT A;  3H40 A;  2ZUC A;  5D49 A;  2ATL A;  4ECS A;  5KFO A;  2V4Q A;  5KFP A;  5BPC A;  4J9M A;  1T3N A;  4O3S A;  2P6R A;  2HVI A;  4KN4 A;  4F2R A;  2BQU A;  4FO6 A;  4FBU A;  1ZQS A;  4IRC A;  4K4G A;  9ICQ A;  2Q66 A;  4KMU A;  5HRF A;  8ICV A;  2FPL A;  5DQI A;  5KFQ A;  3RBD A;  4UQG A;  1UEU A;  3C18 A;  5CB1 A;  4ECR A;  2A1J A;  2BDP A;  3OVA A;  3IHQ B;  4F50 A;  2XO7 A;  5KFV A;  1QTM A;  1NJZ A;  1XO1 A;  1R89 A;  3MR2 A;  4F8R A;  4X4T A;  3NGD A;  1DK2 A;  2VA3 A;  4BWM A;  2P66 A;  3Q8K A;  9ICA A;  3JZ0 A;  2C28 A;  4JV0 A;  5CA7 A;  3OHA A;  3EPI A;  2BPG A;  2IHM A;  9ICU A;  2BQ3 A;  1ZQI A;  4X4V A;  1T7P A;  3GIJ A;  2HHT A;  3HP6 A;  4QZH A;  3QZ7 A;  1Y88 A;  5HML A;  5KTQ A;  4FS1 A;  4CCH A;  5KG5 A;  5DGA A;  2HHV A;  5HHH A;  4XQ7 A;  2W9A A;  5BOL A;  3HX0 A;  2F1J A;  4F4Z A;  2M2U A;  1TK0 A;  4RQ4 A;  3RJG A;  3T3F A;  3RJJ A;  4UD4 A;  4RZR A;  3ZD9 A;  4ED6 A;  4F3O A;  5KG3 A;  5J0U A;  4IR9 A;  4NLN A;  5DB9 A;  4DFK A;  4KLO A;  4DWI A;  2WTF A;  4F91 B;  3THV A;  2GWS A;  4E0D A;  4Q8E A;  4M9N A;  2IBK A;  3RBE A;  2M2V A;  4XA5 A;  4ECQ A;  3TAQ A;  4X0B A;  3LWL A;  4EYI B;  4M04 A;  5DBA A;  4X4P A;  1DGS A;  3TAP A;  4RQ5 A;  3RB3 A;  1B43 A;  4TUR A;  2FLN A;  4QZ8 A;  2DR8 A;  4PHP A;  1H38 A;  5J0S A;  4ECX A;  4YMM A;  1JQR A;  2ZH5 A;  3UQ0 A;  4I2E A;  3HIY A;  3HJ1 A;  4P2H A;  5J2K A;  4C8N A;  4GXK A;  4KTQ A;  5IIM A;  5IIJ A;  3RB0 A;  5KFU A;  3RJK A;  4BXO B;  3AUO A;  4YMO A;  3GFK B;  4GXI A;  1NKC A;  4NLZ A;  2ZJA A;  2NRZ A;  4EEY A;  4LT6 A;  1NK7 A;  9ICM A;  3Q8S B;  1ZET A;  4KLH A;  1L3S A;  4QZ9 A;  4RQ8 A;  3H37 A;  2HVH A;  3C1Z A;  4GXJ A;  4YD1 A;  1NK0 A;  7ICM A;  1Q78 A;  4PGY A;  3M9O B;  2BCV A;  2J6U A;  2KZZ A;  3AQM A;  3GV7 B;  4X4O A;  2ZH4 A;  2BCS A;  3RRH A;  4YVZ A;  1ZQQ A;  2XCA A;  1RYR A;  4I2D A;  4E80 A;  5HR9 A;  2V9W A;  2BHN A;  5KT2 A;  4I2G A;  3AU6 A;  4IQT A;  1D8L A;  4KIT B;  5F9N A;  3HT3 A;  4NKT A;  4AT7 B;  5KFL A;  5KFE A;  2NRX A;  3TFS A;  2XCP A;  5F2V O;  4WC2 A;  9ICK A;  2BR0 A;  1NK9 A;  2NRW A;  2M2T A;  1ZQZ A;  5KT5 A;  7ICH A;  1ZQJ A;  4MF8 A;  3PX6 A;  1TK8 A;  5KFK A;  4DSI A;  4JV2 A;  1MC8 A;  1TKD A;  1UEV A;  5KG6 A;  2A1J B;  4YCX A;  1XC9 A;  1BPB A;  3UPS A;  1RXV A;  2F1I A;  1VFG A;  1CUK A;  4HYK A;  3ISD A;  4F4K A;  3ZDE A;  4I29 A;  4DOA A;  3PV8 A;  3N4M B;  1D8Y A;  1TAU A;  2VAN A;  5IIK A;  3V7J A;  2XC9 A;  1X9S A;  4S3N A;  5J0W A;  4QZC A;  2ZHA A;  2UVU A;  3PX4 A;  4O5C A;  1TFW A;  3KHR A;  2R8H A;  4NKU A;  4DOB A;  3NYB A;  3PR4 A;  3GQC A;  1TFR A;  3JPN A;  5DEC A;  1ZQB A;  4RUC A;  2NRV A;  4YR0 A;  1ZQK A;  2AGO A;  3ZDB A;  2HHW A;  5EWE A;  1ZQM A;  5KFN A;  5KG4 A;  4RNN A;  3EYZ A;  1BPZ A;  3ZDC A;  4FH5 A;  2ZUB A;  3TFR A;  7ICT A;  1YLQ A;  9ICF A;  1V4A A;  4QZG A;  3GV5 B;  3V72 A;  4RNO A;  1BGX T;  3H4D A;  4QW9 A;  3BQ2 A;  5DB7 A;  2H5X A;  3HWT A;  3GIL A;  4J9K A;  3QEB Z;  3C66 A;  3RH4 A;  2C22 A;  3FYH A;  3M8S A;  2HHQ A;  4KLT A;  4EP7 A;  5HC9 A;  5KFX A;  2HW3 A;  4J9N A;  9ICB A;  4FH3 A;  8ICC A;  2ZJ5 A;  4DQP A;  2BCU A;  4UAZ A;  1ZQC A;  4PHA A;  2JEI A;  3UPQ A;  5J2C A;  4WBZ A;  3B0Y A;  5KT4 A;  2ASJ A;  4DL3 A;  3Q8P B;  3SI8 A;  3RR8 A;  3RJH A;  3MBY A;  3Q8R B;  2JEF A;  3C5G A;  4DQR A;  4YG2 A;  8ICI A;  1COO A;  3JPT A;  2DPI A;  3H8S A;  8ICL A;  8ICS A;  4MEY A;  9ICP A;  5CJ7 A;  5DG9 A;  4FHY A;  5DG8 A;  4UB4 A;  4RPZ A;  4DO9 A;  4DS5 A;  1ZQP A;  5DGB A;  2O1P A;  1BPE A;  5KFY A;  4E7X A;  3OV7 A;  3AQL A;  2MAX A;  4XQ8 A;  4ECY A;  5KFJ A;  9ICG A;  2R8K A;  2AU0 A;  3PVX A;  2AQ4 A;  4MFC A;  4F5N A;  1JXL A;  7ICL A;  4PGQ A;  4DFJ A;  1TV9 A;  5KFW A;  1BPX A;  1QSS A;  4M5D A;  1XWL A;  4J9S A;  4F4W A;  1S0V A;  4EBC A;  3ETL A;  4DSK A;  2FLP A;  3LQC B;  4I2J A;  3RAX A;  3EW9 A;  2AQ0 A;  3H8W A;  3G6Y A;  2RDJ A;  4R8U B;  5KFR A;  3OGU A;  4ECT A;  4M47 A;  2W9C A;  4J9R A;  3OUY A;  1MIW A;  3KTQ A;  1IM4 A;  5L1J A;  4DFP A;  2FMQ A;  4UD5 A;  4I2B A;  4UAY A;  4X0A A;  2DFL A;  4O3Q A;  2FPM A;  3RR7 A;  4DQI A;  2ZH1 A;  4PHD A;  3BDP A;  1TAQ A;  5DDY A;  4YXJ A;  4AT9 A;  2DPJ A;  4IQW A;  1L3V A;  4TUP A;  3PY8 A;  4NXZ A;  5KG2 A;  2ISP A;  1NK6 A;  4O3N A;  7ICF A;  4M9G A;  3SZ2 A;  1KFD A;  5DDM A;  8ICZ A;  5J0P A;  1SL0 A;  2I9G A;  4UB2 A;  5HRD A;  3MAB A;  1ZQH A;  9ICW A;  8ICY A;  4KLS A;  4QZE A;  5CP2 A;  4EBK A;  4DL2 A;  5J29 A;  3PW4 A;  4C8M A;  4PH5 A;  3M8R A;  5J0T A;  4Q45 A;  8ICB A;  3WFS C;  3LDA A;  3GIK A;  4QZB A;  3H4B A;  4F4X A;  3LWM A;  1FA0 A;  3OJS A;  2R8J A;  2VA2 A;  4RUA A;  1U47 A;  9ICJ A;  4UAW A;  1NK8 A;  7ICR A;  4MF2 A;  1WCN A;  4PHE A;  5KFG A;  5L9X A;  3C2L A;  2W8K A;  4KLI A;  5J2J A;  4UB5 A;  3H3A A;  3TAR A;  4AT8 A;  4I27 A;  1TVA A;  9ICH A;  1X9W A;  3JPO A;  4J9P A;  4DEZ A;  1K1S A;  3BJY A;  2O5A A;  3TQ1 A;  4MFA A;  4X4R A;  1RZT A;  1HUO A;  5J2A A;  5DLG A;  4WC6 A;  2FPK A;  2IMW P;  4RPX A;  4RWN A;  5KFT A;  1KDH A;  4X5V A;  3QZ8 A;  1JMS A;  4ED0 A;  4F92 B;  4C8K A;  4LZD A;  3T5L A;  1VJ7 A;  1C7Y A;  4UB3 A;  2ZHB A;  5KFH A;  5TZV A;  2HHU A;  3M9N B;  2FMS A;  4DSE A;  1ZQW A;  5J2F A;  4RQ1 A;  3SV4 A;  3PW2 A;  3T5J A;  1EXN A;  3MGH A;  3BQ0 A;  8ICH A;  2ASL A;  1R8C A;  4EBJ A;  1S0O A;  1S76 D;  8ICE A;  4DF8 A;  4ATB A;  2R8I A;  3C2K A;  4I2A A;  4WCW A;  4YMN A;  4FHW A;  3GDX A;  4WC3 A;  2HHX A;  3ISC A;  3KHH A;  1MQ3 A;  4XUS A;  3B0X A;  1MQ2 A;  4B9T A;  2NRK A;  2FMP A;  1L3T A;  4ELU A;  4P4P A;  4PGX A;  9ICX A;  4WC5 A;  4JUZ A;  3C5F A;  4KLE A;  4QWB A;  4ED2 A;  3MFI A;  1V9P A;  3IM1 A;  1ZQF A;  8ICU A;  3OVS A;  4QZI A;  4RT2 A;  1WOT A;  1UA1 A;  1OU5 A;  4NLK A;  1JN3 A;  1K1Q A;  2W9C B;  8ICR A;  4FHV A;  1XSN A;  1ZJM A;  1KSP A;  4ED1 A;  2W8L A;  1T8E A;  4O5E A;  2ALZ A;  1S77 D;  9ICS A;  5L1L A;  3V6H A;  4DL7 A;  1DK3 A;  2RFF A;  4DLG A;  4B9M A;  4YXM A;  4K4H A;  7ICS A;  2ZH9 A;  2PI5 A;  1QSL A;  5KFC A;  5IIL A;  1ZQO A;  4Q44 A;  5HRI A;  1T4G A;  3MR6 A;  4KLL A;  2R8G A;  4AT9 B;  3C21 A;  4QWD A;  4JWN A;  4RQ0 A;  4GLX A;  5KFS A;  4P4M A;  3Q8M A;  3AU2 A;  3QEA Z;  5EOZ A;  2Y1J A;  3RJF A;  3WFP A;  4I2I A;  1SKS A;  5HRE A;  4RQ3 A;  4F93 B;  1U49 A;  4J9Q A;  5DED A;  9ICN A;  4KLQ A;  4BWJ A;  2DRB A;  2KZM A;  7ICK A;  4DL5 A;  3JPS A;  2AJQ A;  1UET A;  4F5Q A;  2W9M A;  1Z3E B;  3TAN A;  1NO5 A;  5D46 A;  3MR3 A;  3ISB A;  3TI0 A;  4KLG A;  5HRL A;  1Z00 A;  1TFY A;  4R66 A;  4JWM A;  2J6S A;  5EWG A;  3WFO A;  1KLN A;  2PFP A;  5DG7 A;  3G6X A;  1JAJ A;  4I28 A;  2ZTC A;  4QZA A;  1N48 A;  2PXI A;  4BGD A;  3PNC A;  4FHP A;  1UT5 A;  3KHL A;  2B21 A;  5KT3 A;  3OUY B;  5J2I A;  4WC4 A;  1XU4 A;  1NKE A;  9ICI A;  4TQS A;  4Q8F A;  1BNO A;  4AT8 B;  4IG8 A;  2C2E A;  4XRH A;  2AGP A;  1KFT A;  2P6U A;  4KLD A;  4IR1 A;  5KG7 A;  4MEX A;  1NK5 A;  1NK4 A;  5C5J A;  2JZB A;  4B9U A;  4IRK A;  5KT7 A;  3UXP A;  1MSW D;  5HRK A;  4M0A A;  3OVB A;  2ASD A;  2UVW A;  4QWC A;  5KG0 A;  3QE9 Y;  2ZTD A;  1RPL A;  4DL6 A;  4DSJ A;  2HHP A;  2ZH8 A;  5KFM A;  3SV3 A;  5DB8 A;  1TK5 A;  3ZD8 A;  2ZTE A;  2BPC A;  3Q8Q B;  2XY7 A;  1X9M A;  3PR5 B;  1PX5 A;  3HJ4 A;  4RWP A;  5JUM A;  1BNP A;  5J0Y A;  2BCQ A;  4YQW A;  5J2D A;  2BGW A;  5DBB A;  1ZQE A;  8ICM A;  2M2W A;  1MIV A;  8ICN A;  2XY6 A;  4DSF A;  4O3R A; 
#chains in the Genus database with same CATH topology
 5DB6 A;  5AK3 A;  1NKB A;  2YN4 A;  3ZDA A;  2ZH2 A;  1BPD A;  5EE0 A;  2W3R A;  4M9L A;  4KLM A;  2HMX A;  5AKG A;  3NWI A;  4EZ9 A;  4Y2R A;  4UAU A;  4UB6 U;  5CR0 A;  2ZUD A;  5A0L A;  3QU2 A;  4UBC A;  8ICT A;  3WU2 U;  2LKY A;  1DGJ A;  3RB6 A;  5D63 A;  2KJ8 A;  4NM1 A;  4CF5 A;  2ZIX A;  2KG5 A;  4KLJ A;  5AM4 A;  4X4N A;  4Z6D A;  5DBC A;  3N28 A;  5J2H A;  4RNM A;  3V7K A;  4P0Q B;  4ED8 A;  4M9H A;  3H38 A;  1LB2 B;  4DFM A;  9ICO A;  5ALQ A;  4FS2 A;  3MGI A;  4ECV A;  4U6P A;  5KFD A;  2IOH A;  4E8F A;  5DKW A;  4C4T A;  4YR3 A;  4R65 A;  3OPX A;  3MDA A;  3PW7 A;  1Q8K A;  2WAQ C;  5KAI U;  3PO4 A;  5KFF A;  7ICO A;  2IA6 A;  4TUS A;  5HR7 A;  3PML A;  4QZD A;  7ICI A;  4FZL A;  3H8J A;  1WCL A;  3C23 A;  2ZXI A;  1RYS A;  3TAD A;  4ECZ A;  1ZQN A;  4DQQ A;  3QUT A;  4WC1 A;  1RYU A;  4C8L A;  2G0A A;  2DR9 A;  3WFQ E;  2QAR A;  1PZN A;  3CP8 A;  4R8U A;  4WH5 A;  4IQV A;  3AQE A;  5AM1 A;  5BOM A;  4ELT A;  2E8N A;  4R64 A;  4NXX A;  2K8B B;  5KT6 A;  4I2C A;  2PKE A;  3IN5 A;  9ICE A;  3KHG A;  2ZIX B;  5F9L A;  2AHO B;  4DQS A;  2Y1I A;  1N56 A;  2YTU A;  2KP7 A;  4WJ3 B;  7ICQ A;  1Z1V A;  1FO4 A;  5ALY A;  3MDC A;  8ICK A;  5IIN A;  1QSY A;  4NLG A;  1SL2 A;  1ZQX A;  1JRO A;  1SZH A;  1COK A;  1S5L U;  1B22 A;  2WF6 A;  4BXO A;  9ICC A;  4RWQ A;  2F1H A;  1BPY A;  3KZX A;  2XID A;  2D8C A;  4O0I A;  2UVV A;  3M9M B;  1S9F A;  3ALR A;  2RDI A;  4ICA A;  2ZUC A;  5D49 A;  5KFO A;  5BPC A;  1T3N A;  2L5Y A;  2BQU A;  1ZQS A;  4K4G A;  5AKE A;  3RBD A;  1UEU A;  3C18 A;  5CB1 A;  4ECR A;  2QAR B;  3A0H U;  4CE6 A;  3DV9 A;  5ALX A;  4F8R A;  1DK2 A;  2VA3 A;  4BWM A;  1J2M A;  3Q8K A;  3SMV A;  2C28 A;  4JV0 A;  3OHA A;  2IHM A;  1ZQI A;  2HHT A;  2F1J A;  1HEK A;  2CN1 A;  2F2A B;  4RQ4 A;  3T3F A;  1ZD5 A;  2R18 A;  1KKX A;  4OJ5 A;  5AKH A;  5DB9 A;  3UMG A;  4O6A A;  3TAC B;  1N2X A;  2GWS A;  4E0D A;  2H3Q A;  4X4P A;  1DGS A;  3LVW A;  3TAP A;  4NL9 A;  2OEH A;  5ALS A;  4PHP A;  1H38 A;  4WQK A;  3HIY A;  2DQN B;  4P2H A;  1O08 A;  4KTQ A;  5IIM A;  5KFU A;  1RM6 C;  4BXO B;  3ERC C;  1NKC A;  4NLZ A;  1NK7 A;  3Q8S B;  4QZ9 A;  1ZRM A;  3C1Z A;  4YD1 A;  7ICM A;  2BCV A;  3M9O B;  2J6U A;  2KZZ A;  2EWR A;  4QNL A;  2BCS A;  3RRH A;  4YVZ A;  1RYR A;  3AU6 A;  2F3N A;  2NYV A;  5F9N A;  5KFE A;  2NRX A;  1F0M A;  2A3V A;  9ICK A;  3NKU A;  2NRW A;  1JUD A;  2M2T A;  1ZQZ A;  5L1M A;  5KT5 A;  3QU7 A;  5CEH A;  4J03 A;  1RXV A;  1TAM A;  2F1I A;  4O67 A;  4DOA A;  3N4M B;  1D8Y A;  3V7J A;  4FE3 A;  4QZC A;  1TFW A;  4O5C A;  4OJ6 A;  2R8H A;  4NKU A;  1UHU A;  4ACO A;  1UQV A;  5DEC A;  2HHW A;  4RNN A;  4FH5 A;  3EYZ A;  2ZUB A;  2W11 A;  4QZG A;  1YZ6 A;  3ONN A;  5DB7 A;  2EAP A;  1VJ5 A;  2IHO A;  2JH1 A;  3M8S A;  2HHQ A;  4EP7 A;  5HC9 A;  2ZJ5 A;  4DQP A;  1ZQC A;  2JEI A;  4USA A;  5KT4 A;  2G06 A;  3MBY A;  3Q8R B;  2GLE A;  4YG2 A;  3JPT A;  2DPI A;  3H8S A;  5H2F U;  4JLZ A;  4OAG A;  5DG9 A;  4UB4 A;  4RPZ A;  4NWI A;  5B66 U;  4E7X A;  3AQL A;  4XQ8 A;  2K4P A;  9ICG A;  2AU0 A;  2AQ4 A;  5J8Y A;  4K98 A;  4PGQ A;  1TV9 A;  2H3V A;  4J9S A;  4F4W A;  3ETL A;  4DSK A;  1ZXI A;  3EW9 A;  5KFR A;  4Y2V A;  1IM4 A;  3VCB A;  3T79 A;  4DFP A;  2FMQ A;  2DFL A;  2M0N A;  1NNL A;  4Y2S A;  4IQW A;  4NXZ A;  2ISP A;  1NK6 A;  1CI4 A;  2LM1 A;  4EEL A;  4M9G A;  3SZ2 A;  1SL0 A;  4UB2 A;  3WKE A;  4BJQ A;  2W43 A;  5CP2 A;  2Z7J A;  2MA1 A;  4PH5 A;  3M8R A;  1PVQ A;  5KL1 B;  3GIK A;  4QZB A;  2NO4 A;  4F4X A;  2VA2 A;  1NK8 A;  7ICR A;  4MF2 A;  1PVP A;  4PHE A;  5KFG A;  3SEI A;  5J2J A;  3TAR A;  4AT8 A;  4I27 A;  4U7C A;  2WF9 A;  2O5A A;  5ALF A;  5J2A A;  2DF4 B;  4RQN A;  1UCV A;  1QH9 A;  3QZ8 A;  1JMS A;  3RFA A;  3UMC A;  4MHV A;  3M9N B;  1ZQW A;  3T5J A;  2ASL A;  2CPR A;  8ICE A;  4WCW A;  4FHW A;  3GDX A;  2HHX A;  3ISC A;  3KHH A;  1MQ3 A;  3CYM A;  4GFJ A;  2ES6 A;  2K8A A;  4PGX A;  1SWW A;  3VC8 A;  2KHV A;  3MFI A;  8ICU A;  4QZI A;  1UA1 A;  1KSP A;  2KK0 A;  2W8L A;  3F2B A;  1DK3 A;  3V6H A;  2RFF A;  4DLG A;  2ZH9 A;  5HRI A;  4Q44 A;  3MR6 A;  4RQ0 A;  1Z19 A;  3Q8M A;  3AU2 A;  2Y1J A;  1SKS A;  4F93 B;  9ICN A;  1ZOL A;  1SV4 A;  2DRB A;  4NXU A;  4F5Q A;  1Z3E B;  3TAN A;  5D46 A;  3MR3 A;  3ISB A;  3TI0 A;  1TFY A;  3C28 A;  2J6S A;  3H0M B;  3G6X A;  1JAJ A;  2ZTC A;  2PXI A;  4BGD A;  1PUZ A;  4CDG A;  3KHL A;  5J2I A;  1NKE A;  9ICI A;  4AT8 B;  4XRH A;  1KFT A;  2QLT A;  4AP9 A;  2WFA A;  2YML A;  2ASD A;  2KD1 A;  2KE7 A;  4DSJ A;  3AL0 B;  5DB8 A;  4OAI Z;  2ZTE A;  2E8M A;  4AYB C;  3FC4 A;  5JUM A;  2BCQ A;  1ZQE A;  1MIV A;  5B5E U;  2WAQ F;  1UT8 A;  5ALG A;  4Q43 A;  1SWV A;  2WF8 A;  4C8O A;  1SGG A;  4J9O A;  3HKZ C;  1YZ7 A;  3K7D A;  1KRP A;  4EGW A;  4F5R A;  3I1Y A;  3JPP A;  3H7I A;  1RXW A;  4I2H A;  4K96 A;  2PBE A;  2KFN A;  4Z6E A;  1T94 A;  2UVR A;  2HBL A;  2W55 A;  2G07 A;  4HAI A;  3RJE A;  5KFI A;  5AIA A;  8ICW A;  9ICT A;  3PMN A;  7ICU A;  4KN7 A;  3QUQ A;  4P4O A;  2KOB A;  1SL1 A;  4C7Z A;  1S97 A;  3NAS A;  1U45 A;  1ZQU A;  5CFU A;  4KM5 A;  2KKP A;  4G3I A;  3RRG A;  1OXJ A;  3JYY A;  4IRD A;  2DRA A;  4O5K A;  3K4G A;  4FO1 A;  2KZ3 A;  3RH6 A;  1R8A A;  1LV5 A;  2JH7 A;  3K75 D;  4O9M A;  2AGQ A;  2KZM A;  3HW8 A;  3T5H A;  1NJY A;  2CRX A;  2XGP A;  1HUZ A;  3GZF A;  1Z4O A;  4PPX A;  4UBB A;  4Z6F A;  4LEW A;  1O03 A;  3BZC A;  3HPO A;  1HJP A;  3T5K A;  3KBB A;  1JXE A;  1UA0 A;  8ICG A;  1SKR A;  1QQ7 A;  5L1K A;  8ICA A;  1U48 A;  2LMR A;  4PL2 A;  4K8V A;  4YFK A;  2JHD A;  3GIM A;  5D4B A;  3HRD D;  4FHX A;  3PZP A;  4WBY A;  1VLB A;  4YP3 A;  4LZG A;  4BDP A;  4GC7 A;  5EE1 A;  4KLF A;  2KV2 A;  3RB4 A;  5J0O A;  4QWE A;  4Y2P A;  4ED7 A;  3RH5 A;  2XIC A;  1CEZ A;  7ICE A;  5KFB A;  4DCC A;  5TIS U;  3NTU A;  5L1I A;  5EE3 A;  4RQ7 A;  5AI0 A;  1NOM A;  2ZIV A;  3C1Y A;  8ICF A;  5J2B A;  4QJF B;  4B9N A;  7ICG A;  1JRP A;  3EF2 A;  1URJ A;  2XGQ A;  2CXY A;  5ALD A;  5KFA A;  4IQU A;  4YN4 A;  1F5A A;  4UB8 U;  2AH5 A;  3PO5 A;  4O3O A;  3EPG A;  2IOF A;  2ZJ8 A;  2J6T A;  5AKK A;  5AK6 A;  2HSZ A;  2KVC A;  3F2D A;  4ZH4 A;  2FE9 A;  4FBT A;  1S8O A;  3ORY A;  1ARO P;  8ICO A;  1KFS A;  2HN1 A;  2GOL A;  3AEV A;  5CFS A;  4Z6C A;  3V6K A;  4DSL A;  1F44 A;  4DLE A;  4QW8 A;  2YY6 A;  4F5P A;  1NI3 A;  2NRT A;  2ATL A;  2OXO A;  2QB1 A;  4IRC A;  4FO6 A;  2JV3 A;  3ER9 B;  3BS7 A;  3KKA A;  4QIW C;  2BDP A;  3OVA A;  3IHQ B;  2HOI A;  2XO7 A;  1XO1 A;  4X4T A;  2P66 A;  9ICA A;  3EPI A;  2BPG A;  3KZI U;  1T7P A;  1Y88 A;  3NVV A;  5AM0 A;  1ED1 A;  2YB4 A;  4Y2Y A;  5KTQ A;  5KG5 A;  4CCH A;  2JMG A;  4XQ7 A;  2W9A A;  4NXT A;  3HX0 A;  2LYB A;  1TK0 A;  3RJJ A;  3KD3 A;  5AK5 A;  2YMM A;  5J0U A;  2WTF A;  4G9B A;  4F91 B;  2ZIV B;  4M9N A;  2M2V A;  1OW5 A;  4X0B A;  4O69 A;  3LWL A;  4EYI B;  3M6Z A;  4QZ8 A;  2D6F C;  1JQR A;  4YMM A;  3SQI A;  2KIW A;  2VJ5 A;  3WKA A;  5IIJ A;  3WK8 A;  4OD0 A;  4YMO A;  5C0Y A;  4LT6 A;  2NRZ A;  5B3Q A;  2EAN A;  1N60 A;  4GXJ A;  4RQM A;  3UMB A;  1Q78 A;  4PGY A;  3GV7 B;  2F8L A;  2ZH4 A;  2XCA A;  3NRZ A;  5AM2 A;  2BHN A;  4I2G A;  4KIT B;  3HT3 A;  2ZG6 A;  2K89 A;  3TFS A;  2BR0 A;  2JXJ A;  1ZQJ A;  4MF8 A;  2BBH A;  5KFK A;  1MC8 A;  1TKD A;  1BPB A;  3NVZ A;  1CUK A;  4HYK A;  4F4K A;  2KKV A;  2XC9 A;  3F2C A;  2ZHA A;  4FZM A;  3KHR A;  2IOF K;  4OO1 J;  1KL9 A;  2JR5 A;  4DOB A;  1ZQB A;  2NRV A;  4YR0 A;  2AGO A;  2WF7 A;  5EWE A;  2EQY A;  4MKP A;  5KG4 A;  3PST A;  3TFR A;  7ICT A;  1YLQ A;  9ICF A;  4PZO A;  3GV5 B;  1BGX T;  3H4D A;  5ALM A;  3HWT A;  3GIL A;  4J9K A;  3QEB Z;  3RH4 A;  4KLT A;  5AIC A;  4J9N A;  2FI1 A;  4PHA A;  3RR8 A;  3Q8P B;  3C5G A;  4NLB A;  4FHY A;  4MEY A;  5AKY A;  1ZQP A;  2O1P A;  5KFY A;  1ZD2 P;  3B9J A;  2VIX A;  3F5E A;  4ECY A;  2R8K A;  2KSO A;  1N62 A;  4F5N A;  1JXL A;  4OCZ A;  4DFJ A;  1QSS A;  1FIQ A;  3NVO A;  4M5D A;  1XWL A;  3NVY A;  4EBC A;  2FLP A;  4I2J A;  3RAX A;  2AQ0 A;  1JAL A;  3L3F X;  4R8U B;  3OGU A;  3G6Y A;  4J9R A;  2G08 A;  3O0F A;  2DUY A;  4NLC A;  2KJ9 A;  2K8C B;  2G5H B;  4ZOH C;  4TUP A;  4Y2Q A;  4O3N A;  7ICF A;  4PZN A;  4C0Z A;  2G5I B;  5DDM A;  2I9G A;  3MAB A;  2HBJ A;  4KLS A;  8ICY A;  1L7M A;  5AKX A;  5J29 A;  3PW4 A;  5J0T A;  1FA0 A;  4EX7 A;  3OJS A;  1N5W A;  1U47 A;  5AKZ A;  1Z4N A;  5L9X A;  2W8K A;  4UB5 A;  3PSF A;  1X9W A;  3AMZ A;  3IG5 A;  3H0L B;  3UM9 A;  1HUO A;  3WK9 A;  5AKL A;  3EUB 2;  1WWU A;  4F92 B;  4C8K A;  3T5L A;  2FMS A;  4Y2X A;  5J2F A;  1EXN A;  1R8C A;  4OJL A;  4DF8 A;  3C2K A;  4I2A A;  4YMN A;  2FDR A;  4AYB F;  3MC1 A;  2NRK A;  2FMP A;  4IC9 A;  1ZQF A;  3IM1 A;  4RT2 A;  3GU3 A;  4K9A A;  4NLK A;  2LYA A;  1JN3 A;  1XSN A;  4O5E A;  3HKZ F;  4ED1 A;  4C4S A;  4YXM A;  5IIL A;  4JWN A;  5GTI U;  4P4M A;  5ALH A;  5DED A;  4RQ3 A;  1U49 A;  2LBO A;  4KLQ A;  5CRX A;  4BWJ A;  2D3D A;  4C7Y A;  2RRD A;  4KLG A;  3TAD C;  4R66 A;  1PVR A;  3WFO A;  5ALZ A;  4QZA A;  3I28 A;  3PNC A;  1UT5 A;  4Y2U A;  2B21 A;  4IG8 A;  2W54 A;  2C2E A;  4KLD A;  2KVS A;  4B9U A;  1VDV A;  4QWC A;  4NV0 A;  4DL6 A;  2ZH8 A;  5KFM A;  2OH2 A;  3SV3 A;  1PX5 A;  1TK5 A;  3ZD8 A;  3HJ4 A;  1X9M A;  3Q8Q B;  4DFD A;  1P7D A;  2E8P A;  2Q4T A;  5CHE A;  2E1E A;  5J2D A;  2YB1 A;  8ICM A;  2M2W A;  4DSF A;  4DWI A;  5AHX A;  1KW4 A;  4QWA A;  4M2Y A;  2WHE A;  3PW0 A;  1IXR A;  5HHI A;  2W9B A;  2BE3 A;  3SR6 A;  3UXN A;  2M9N A;  2ID1 A;  4YD2 A;  4GC6 A;  4RQ6 A;  5IIO A;  4AT7 A;  3V6J A;  4Y2J A;  2KNJ A;  4IL6 U;  5HRG A;  1B0X A;  1FFU A;  2DVI A;  4RWO A;  2KMD A;  7ICV A;  3EWA A;  4JK1 A;  2RLT A;  2W7O A;  5AI5 A;  4JV1 A;  1ZD4 A;  4CF4 A;  1CRX A;  3RF9 A;  3PW5 A;  1FEZ A;  1ZQL A;  4M6W A;  8ICX A;  2KTQ A;  1UPH A;  1SZP A;  2JGA A;  4US8 A;  5HRB A;  2PFO A;  2GA9 D;  1QLN A;  1JIH A;  2FLL A;  3K1Z A;  2DR5 A;  2C2D A;  4J9L A;  2PI4 A;  1DXS A;  3GV8 B;  1S0N A;  1X2I A;  4F4Y A;  2BPF A;  3N97 B;  5HP4 A;  1L3U A;  3EZ5 A;  4F5O A;  2HHU A;  3GII A;  4ECU A;  3WKB A;  1S10 A;  1LVH A;  1PK1 A;  3AQK A;  5KFZ A;  1ZYQ A;  2LYH A;  5J2E A;  3PX0 A;  1F5S A;  5G5H A;  2FCL A;  1GPJ A;  9ICR A;  4WC7 A;  4JLX A;  5DQG A;  4QZF A;  4WC0 A;  4EBE A;  3D2N A;  5KNI A;  4K4I A;  4P0P A;  3LK9 A;  5III A;  1A0P A;  3MFH A;  2W9B B;  2Q0Z X;  4O3P A;  3UQ2 A;  1ZQT A;  2HN2 A;  3QUB A;  2PFN A;  3E2E A;  2LM4 A;  4NL9 C;  3MR5 A;  2ISO A;  8ICP A;  1XS9 D;  1X6J A;  5HMM A;  3J81 j;  4UAV A;  4B9L A;  1Q3V A;  2RP5 A;  4QIW F;  5CHG A;  2BQR A;  3MCR A;  1NZP A;  2ZH3 A;  4F71 A;  4EZ6 A;  3RAQ A;  2F8K A;  4M6W B;  4LJX A;  4ELV A;  4LVS A;  3QX7 A;  1A76 A;  3SAH A;  3JPR A;  1A77 A;  2PMZ C;  4BUG A;  1T3Q A;  1D9F A;  2PFQ A;  4EV6 A;  1KEJ A;  2IHN A;  3HIL A;  4CF3 A;  5HRH A;  2KFZ A;  4RU9 A;  1PK1 B;  4EBD A;  1KQQ A;  5HNK A;  7ICN A;  3ZI4 A;  1R8B A;  2JEG A;  3SAF A;  5AM3 A;  4B9V A;  5DLF A;  4KLU A;  4FFD A;  3JPQ A;  1KBU A;  1DOQ A;  1ZQR A;  4NY8 A;  4DOC A;  3ED5 A;  4UB1 A;  2DL0 A;  4ECS A;  2V4Q A;  5KFP A;  4P0P B;  1IV8 A;  4KN4 A;  9ICQ A;  4KMU A;  5HRF A;  8ICV A;  2FPL A;  5DQI A;  5KFQ A;  4F72 A;  3IDW A;  1NJZ A;  1R89 A;  3C29 A;  3NGD A;  2DKZ A;  3JZ0 A;  2W03 A;  4X4V A;  4CGZ A;  3GIJ A;  3HP6 A;  2QKQ A;  5HML A;  2HHV A;  5B3P A;  5BOL A;  2M2U A;  4UD4 A;  4F3O A;  2Y0S C;  5KG3 A;  4IR9 A;  4NLN A;  4DFK A;  4KLO A;  5J8Y C;  3THV A;  4Q8E A;  3RBE A;  4XA5 A;  4ECQ A;  3TAQ A;  3QYP A;  1SXD A;  4TUR A;  2FLN A;  2DR8 A;  5J0S A;  4I2E A;  3HJ1 A;  3M1Y A;  5AM5 A;  5AIB A;  3RB0 A;  1WG8 A;  2E1F A;  2ODG A;  3RJK A;  3AUO A;  4N7R A;  3GFK B;  1RQL A;  4EEY A;  9ICM A;  1ZET A;  4KLH A;  3H37 A;  4EEN A;  1NK0 A;  2YQE A;  4X4O A;  2B6G A;  1ZQQ A;  4E80 A;  2ESE A;  2V9W A;  3JCF A;  3E58 A;  5KFL A;  2OCE A;  5F2V O;  1NK9 A;  7ICH A;  1TK8 A;  3PX6 A;  4JV2 A;  1UEV A;  1X42 A;  3UPS A;  1QCK A;  1VFG A;  3ISD A;  2F77 X;  4I29 A;  1TAU A;  3PV8 A;  5IIK A;  1X9S A;  5AKI A;  2UVU A;  3PX4 A;  2BBJ A;  4EEB A;  3NYB A;  3PR4 A;  3GQC A;  4RUC A;  1C20 A;  3E0F A;  3ZDB A;  5KFN A;  1BPZ A;  5ALT A;  5JTI A;  1V4A A;  3OTQ A;  3V72 A;  4RNO A;  3LYS A;  4QW9 A;  2H5X A;  3C66 A;  1MA7 A;  3FYH A;  4O68 A;  2HW3 A;  3ETR A;  8ICC A;  3AQF A;  4UAZ A;  5ALK A;  3F53 A;  1XNS A;  2ASJ A;  4DL3 A;  3SI8 A;  2ZIU A;  2KIC A;  4KX3 A;  4CNQ A;  9ICP A;  3U26 A;  5DG8 A;  4DO9 A;  4DS5 A;  5E79 U;  5DGB A;  5AI6 A;  3OV7 A;  3IRU A;  2MAX A;  2RHF A;  3PSI A;  5KFJ A;  1ZQ1 C;  2ZIW A;  1BPX A;  5KFW A;  1S0V A;  5D62 A;  2YX8 A;  3H8W A;  4ECT A;  4M47 A;  3OUY A;  2W9C A;  1J2N A;  2P35 A;  1WWV A;  4O3Q A;  2FPM A;  2WF5 A;  2HOQ A;  2YMP A;  3RR7 A;  4PHD A;  2ZH1 A;  1HIW A;  3M7D A;  4AT9 A;  2DPJ A;  2A1A A;  1L3V A;  4IS7 A;  3DEE A;  3PY8 A;  5KG2 A;  1WUD A;  1SV0 C;  1KFD A;  5J0P A;  3D2S A;  1ZQH A;  4BX9 C;  3KOO A;  4QZE A;  2Y9T A;  3WK7 A;  2MRL A;  1SXE A;  5ALP A;  3WKC A;  3WFS C;  4RUA A;  2H3F A;  9ICJ A;  4UAW A;  3FM9 A;  3N7S C;  2G09 A;  2EZZ A;  3H3A A;  5JRT A;  1TVA A;  4J9P A;  2ZXH A;  1K1S A;  3BJY A;  5ALI A;  4WOY A;  2XVT A;  4X4R A;  5DLG A;  4WC6 A;  2IMW P;  4RWN A;  5KFT A;  4X5V A;  4PL1 A;  3SD7 A;  2ZIU B;  1C7Y A;  4UB3 A;  1N5X A;  2LI6 A;  3SV4 A;  3PW2 A;  1L7O A;  8ICH A;  3MGH A;  3BQ0 A;  4EBJ A;  1S0O A;  1S76 D;  4ATB A;  4XUS A;  1MQ2 A;  4B9T A;  2ZIW B;  3A0B U;  1L3T A;  4ELU A;  4C80 A;  9ICX A;  4UAT A;  4JUZ A;  3C5F A;  4KLE A;  4ED2 A;  2E5S A;  3OVS A;  2B0C A;  5ALW A;  5AI9 A;  1WOT A;  1OU5 A;  3OUY B;  1WYG A;  2W9C B;  4FHV A;  1ZJM A;  2MSN A;  2ALZ A;  1S77 D;  5L1L A;  3FAH A;  3IV6 A;  4OJP A;  3L5K A;  7ICS A;  5AI4 A;  2W3S A;  2PI5 A;  1QSL A;  4EEK A;  5KFC A;  1ZQO A;  4AT9 B;  2R8G A;  3C21 A;  1RQN A;  4GLX A;  5KFS A;  3WFP A;  5HRE A;  5ALJ A;  7ICK A;  5D61 A;  2AJQ A;  3JPS A;  4OJO A;  1UET A;  2W9M A;  3QXG A;  1NO5 A;  4KX5 A;  1Z00 A;  1MN8 A;  5EWG A;  5DG7 A;  3CW2 C;  4FHP A;  4WC4 A;  5ALV A;  4TQS A;  5KG7 A;  4MEX A;  1NK5 A;  1NK4 A;  3M6K A;  2JZB A;  4UAS A;  5KT7 A;  4M0A A;  5KG0 A;  2H3I A;  3QE9 Y;  2HHP A;  1J97 A;  5J0Y A;  4YQW A;  3QU4 A;  1XO0 A;  2XY6 A;  4O3R A;  2MUT A;  1ZQD A;  4R63 A;  8ICQ A;  4ATB B;  3Q8L A;  1D8B A;  5EWF A;  3IG8 A;  5J2G A;  2BCR A;  4TUQ A;  5DQH A;  4NJ8 A;  2HOF A;  2I5H A;  5ALU A;  4DL4 A;  2K60 A;  3SYZ A;  4US9 A;  1RG6 A;  1AQ6 A;  4MFF A;  2GAF D;  1ZQY A;  2GH1 A;  3OSP A;  1L5U A;  2KN7 A;  2C2R A;  4RT3 A;  3C2M A;  1SKW A;  4X4U A;  3N7R C;  3RTV A;  4I2F A;  5T14 A;  3UXO A;  1BVS A;  2ZH7 A;  2HHS A;  2ZH6 A;  2OYY A;  8ICJ A;  9ICL A;  4ECW A;  2DWQ A;  2WB1 C;  3BQT A;  1KTQ A;  2JEJ A;  1Z00 B;  1ZQG A;  3PSP A;  3I76 A;  2DKX A;  3CK6 A;  4M9J A;  7ICP A;  1B4F A;  3WK6 A;  4NM2 A;  2QB0 A;  1X9X A;  2N1R A;  3OSN A;  2DBY A;  2V4R A;  2Y9U A;  3KKA C;  4RQ2 A;  2VA8 A;  1XSL A;  3WFR E;  2PMZ F;  4JMU A;  2JZB B;  4B9S A;  1V97 A;  1X6I A;  7ICJ A;  2XI9 A;  5ALL A;  3WK5 A;  2EZY A;  4YR2 A;  1RDF A;  4X4S A;  3OWG A;  5JTG A;  2KSO B;  1ZRN A;  3H39 A;  2OWO A;  1ZQA A;  2MUT B;  3R9K A;  3L9D A;  2H3Z A;  3HJE A;  2HBK A;  4DS4 A;  2I1Q A;  1XSP A;  2RQ5 A;  3AQN A;  3NS1 A;  3G6V A;  1NJW A;  1OUQ A;  2EDU A;  3BQ1 A;  4ED3 A;  9ICV A;  1IG6 A;  2W7P A;  2E3T A;  1ECW A;  1ZQV A;  1U4B A;  5HR6 A;  4X4Q A;  3ZDD A;  2LPE A;  4TQR A;  2KIV A;  2BDU A;  3S6J A;  5G5G A;  1ZJN A;  4F2S A;  5J0X A;  2DR7 A;  4UAR A;  5J0Q A;  4EED A;  1S0M A;  4RPY A;  1SIJ A;  1PK3 A;  2B4V A;  3DDH A;  5GTH U;  1NZB A;  2BKE A;  4DF4 A;  3V7L A;  1Q79 A;  4K97 A;  4LEV A;  5J0R A;  1MIY A;  4XJE A;  1JI7 A;  2Y0S F;  5CWR A;  2AXT U;  2K4H A;  5KG1 A;  2YMQ A;  3N7P D;  4OAH A;  4KB6 A;  2QB0 B;  3RJI A;  2KEY A;  2DGZ A;  3OHB A;  3NRW A;  1JX4 A;  1GO3 F;  2HCF A;  3ER8 C;  3OJU A;  3FDS A;  3QUC A;  1M6Y A;  2KHQ A;  2XY5 A;  2BZF A;  1KNY A;  1NJX A;  1U9L A;  1LKY A;  2EAM A;  1D9D A;  4EYH B;  2OM6 A;  4NXV A;  3H40 A;  2I6X A;  3QU5 A;  4B6J A;  4J9M A;  4O3S A;  2P6R A;  2HVI A;  4LEZ A;  1L8O A;  4F2R A;  4FBU A;  2KJ5 A;  2Q66 A;  3KFU F;  1TE2 A;  2EH9 A;  4UQG A;  2A1J A;  4F50 A;  1QTM A;  5KFV A;  3MR2 A;  3K1R B;  5F3X B;  1VJ7 A;  5CA7 A;  9ICU A;  5K4L A;  4OAF A;  2BQ3 A;  2F44 A;  4QZH A;  3QZ7 A;  4FS1 A;  5ALO A;  5DGA A;  2EAO A;  3CNH A;  5HHH A;  4F4Z A;  3RJG A;  4RZR A;  3ZD9 A;  4ED6 A;  2IBK A;  2K4I A;  3QNM A;  4M04 A;  5DBA A;  3MGV A;  5EE9 A;  4RQ5 A;  3RB3 A;  1B43 A;  3BZK A;  2ZH5 A;  4ECX A;  3UQ0 A;  5J2K A;  3TKA A;  4C8N A;  4GXK A;  2NO5 A;  1FFV A;  2W04 A;  4GXI A;  2ZJA A;  1L7P A;  5AK4 A;  2VJ4 A;  5ALR A;  1L3S A;  4RQ8 A;  2HVH A;  1QQ5 A;  1LKY B;  3WK4 A;  3AQM A;  2B56 A;  4KMO B;  2B51 A;  2LHT A;  4I2D A;  5HR9 A;  1DRG A;  1L8L A;  5KT2 A;  4IQT A;  1D8L A;  4NKT A;  3IP4 B;  4AT7 B;  2XCP A;  4WC2 A;  5KL8 B;  4DSI A;  5KG6 A;  2MU2 A;  2A1J B;  2EZX A;  4YCX A;  1XC9 A;  2IUB A;  3BQ7 A;  3SAG A;  3D6J A;  4JB3 A;  3ZDE A;  3ICX A;  4S3N A;  2E8O A;  2VAN A;  2HBM A;  1V85 A;  5J0W A;  4EX6 A;  5AI8 A;  1TFR A;  3CRX A;  4FZN A;  3JPN A;  1ZQK A;  4A8E A;  1Q46 A;  1ZQM A;  3ZDC A;  2F76 X;  3BQ2 A;  2HI0 A;  2C22 A;  1L7N A;  5KFX A;  4UW9 A;  9ICB A;  4FH3 A;  2BCU A;  3UPQ A;  5J2C A;  4WBZ A;  3B0Y A;  4PJ0 U;  3RJH A;  2JEF A;  4DQR A;  8ICI A;  1COO A;  8ICS A;  8ICL A;  5CJ7 A;  4WQL A;  1BPE A;  1SV0 A;  2FJ6 A;  3NVW A;  3PVX A;  4MFC A;  5FP0 A;  7ICL A;  4K99 A;  1SB3 C;  3PHZ A;  3LQC B;  5ALE A;  2RDJ A;  2VKQ A;  3KTQ A;  1MIW A;  5L1J A;  4UD5 A;  4I2B A;  4UAY A;  4X0A A;  3AN1 A;  4DQI A;  3H8M A;  3BDP A;  3WKD A;  1TAQ A;  5DDY A;  4YXJ A;  2NV3 A;  2OHF A;  8ICZ A;  1A6S A;  5HRD A;  9ICW A;  4EBK A;  3BS5 A;  4DL2 A;  4C8M A;  4Q45 A;  8ICB A;  3LDA A;  4C4R A;  3H4B A;  3LWM A;  2R8J A;  1IIP A;  1WCN A;  3C2L A;  4KLI A;  9ICH A;  1QQ6 A;  3JPO A;  3D2Q A;  3H0R B;  4DEZ A;  1Q3U A;  3TQ1 A;  4MFA A;  4I0U A;  1RZT A;  2A19 A;  2FPK A;  4RPX A;  1KDH A;  1K5O A;  4ED0 A;  4LZD A;  2ZHB A;  5KFH A;  5TZV A;  3LVV A;  2JRZ A;  2O6K A;  5ALN A;  4DSE A;  4RQ1 A;  2R8I A;  1N63 A;  4WC3 A;  3B0X A;  4O3M A;  4P4P A;  4WC5 A;  1KN5 A;  4QWB A;  1V9P A;  8ICR A;  1K1Q A;  1X40 A;  2HDO A;  2GO7 A;  1T8E A;  9ICS A;  4DL7 A;  4B9M A;  4K4H A;  2K4E A;  3SEN A;  1T4G A;  4KLL A;  4QWD A;  3NUQ A;  3QEA Z;  1V38 A;  5EOZ A;  3RJF A;  4CRX A;  4I2I A;  4K9B A;  1L6N A;  1N61 A;  4J9Q A;  4P0Q A;  4GIB A;  4DL5 A;  3F5A A;  1YT3 A;  3BS5 B;  5HRL A;  4JWM A;  3L4P A;  4NXW A;  1KLN A;  2PFP A;  4I28 A;  1N48 A;  5KT3 A;  1XU4 A;  2WB1 F;  4Q8F A;  1BNO A;  2AGP A;  2P6U A;  4IR1 A;  5C5J A;  4Y2T A;  5JU5 A;  4IRK A;  4LEY A;  3UXP A;  1MSW D;  5HRK A;  3OVB A;  1Z1B A;  4HX0 A;  3QU9 A;  2UVW A;  2ZTD A;  1RPL A;  5KAF U;  1ZD3 A;  2BPC A;  2XY7 A;  4RWP A;  3PR5 B;  1BNP A;  1X66 A;  2BGW A;  5DBB A;  5CFT A;  5AKJ A;  8ICN A;  3AM9 A; 
#chains in the Genus database with same CATH homology
 2MUT A;  5DB6 A;  1UT8 A;  4Q43 A;  4QWA A;  1NKB A;  4M2Y A;  1ZQD A;  4R63 A;  8ICQ A;  4C8O A;  4ATB B;  3ZDA A;  3Q8L A;  3PW0 A;  1IXR A;  2ZH2 A;  5HHI A;  5EWF A;  2W9B A;  1BPD A;  2BE3 A;  4J9O A;  3UXN A;  4M9L A;  5J2G A;  4KLM A;  2M9N A;  4TUQ A;  2BCR A;  5DQH A;  1KRP A;  2ID1 A;  4F5R A;  4YD2 A;  3JPP A;  4EZ9 A;  4GC6 A;  4DL4 A;  3H7I A;  5IIO A;  4RQ6 A;  1RXW A;  5CR0 A;  3V6J A;  4I2H A;  4AT7 A;  2PBE A;  2KFN A;  4Z6E A;  3SYZ A;  2ZUD A;  5HRG A;  2UVR A;  4MFF A;  4UBC A;  8ICT A;  3RJE A;  2DVI A;  5KFI A;  4RWO A;  1ZQY A;  3OSP A;  1L5U A;  7ICV A;  3EWA A;  2KN7 A;  2C2R A;  8ICW A;  9ICT A;  3RB6 A;  4RT3 A;  3PMN A;  4NM1 A;  7ICU A;  4JK1 A;  4KN7 A;  3C2M A;  1SKW A;  4P4O A;  4X4U A;  4KLJ A;  4JV1 A;  4X4N A;  4Z6D A;  5DBC A;  1SL1 A;  5J2H A;  3RTV A;  4RNM A;  4I2F A;  3PW5 A;  3V7K A;  1ZQL A;  1S97 A;  3UXO A;  1BVS A;  4ED8 A;  4M9H A;  4M6W A;  2ZH7 A;  1U45 A;  1LB2 B;  2HHS A;  3H38 A;  1ZQU A;  4DFM A;  8ICJ A;  9ICL A;  9ICO A;  8ICX A;  2ZH6 A;  2KTQ A;  4ECW A;  1SZP A;  3BQT A;  4FS2 A;  4G3I A;  5HRB A;  1KTQ A;  3MGI A;  1Z00 B;  2JEJ A;  3RRG A;  3JYY A;  1ZQG A;  4ECV A;  2PFO A;  4IRD A;  4O5K A;  2DRA A;  1QLN A;  1JIH A;  2FLL A;  3K4G A;  2DR5 A;  5KFD A;  2C2D A;  4M9J A;  7ICP A;  4J9L A;  4NM2 A;  2PI4 A;  2KZ3 A;  3GV8 B;  3RH6 A;  1LV5 A;  1S0N A;  1X2I A;  1R8A A;  4F4Y A;  3K75 D;  5DKW A;  3N97 B;  2BPF A;  4E8F A;  5HP4 A;  1L3U A;  4O9M A;  3OSN A;  3EZ5 A;  2V4R A;  2AGQ A;  4YR3 A;  4F5O A;  4R65 A;  3HW8 A;  3GII A;  4ECU A;  3T5H A;  1NJY A;  1S10 A;  4RQ2 A;  3MDA A;  2VA8 A;  1XSL A;  3WFR E;  2XGP A;  3AQK A;  2JZB B;  5KFZ A;  1HUZ A;  4B9S A;  1ZYQ A;  3PW7 A;  2LYH A;  5J2E A;  7ICJ A;  3PX0 A;  4PPX A;  4UBB A;  3PO4 A;  4Z6F A;  4YR2 A;  5KFF A;  4X4S A;  9ICR A;  4WC7 A;  3HPO A;  3T5K A;  1HJP A;  5DQG A;  2IA6 A;  7ICO A;  1UA0 A;  1JXE A;  8ICG A;  4TUS A;  3PML A;  4QZD A;  7ICI A;  4QZF A;  3H39 A;  3H8J A;  1SKR A;  4WC0 A;  4EBE A;  1WCL A;  5L1K A;  3C23 A;  2OWO A;  8ICA A;  4K4I A;  1U48 A;  1ZQA A;  1RYS A;  2MUT B;  4ECZ A;  3L9D A;  4DS4 A;  2I1Q A;  4DQQ A;  1XSP A;  1ZQN A;  3LK9 A;  4WC1 A;  5III A;  3MFH A;  3AQN A;  2W9B B;  4YFK A;  3G6V A;  1NJW A;  2Q0Z X;  3BQ1 A;  4C8L A;  4O3P A;  4ED3 A;  9ICV A;  3UQ2 A;  3GIM A;  2DR9 A;  1ZQT A;  3WFQ E;  5D4B A;  2PFN A;  3E2E A;  3MR5 A;  1ZQV A;  1U4B A;  1PZN A;  4FHX A;  2ISO A;  4X4Q A;  4WBY A;  4R8U A;  8ICP A;  4IQV A;  4YP3 A;  1XS9 D;  3ZDD A;  4LZG A;  5HMM A;  4BDP A;  4GC7 A;  4TQR A;  4B9L A;  5BOM A;  4ELT A;  4KLF A;  4R64 A;  3RB4 A;  5KT6 A;  5CHG A;  5J0O A;  4I2C A;  4QWE A;  9ICE A;  2BQR A;  1ZJN A;  3KHG A;  4ED7 A;  5J0X A;  3RH5 A;  4F2S A;  1NZP A;  2DR7 A;  2ZH3 A;  1CEZ A;  7ICE A;  5KFB A;  5F9L A;  5J0Q A;  4DQS A;  2Y1I A;  1S0M A;  4RPY A;  4EZ6 A;  1N56 A;  3NTU A;  3RAQ A;  4M6W B;  5L1I A;  4RQ7 A;  4ELV A;  1NOM A;  8ICF A;  3C1Y A;  2KP7 A;  4LVS A;  2BKE A;  4DF4 A;  3V7L A;  1A76 A;  5J2B A;  1Q79 A;  4B9N A;  5J0R A;  3JPR A;  1A77 A;  7ICG A;  7ICQ A;  1MIY A;  2PFQ A;  1D9F A;  5CWR A;  5KG1 A;  2XGQ A;  3MDC A;  8ICK A;  1KEJ A;  5IIN A;  2IHN A;  3RJI A;  5KFA A;  4IQU A;  4YN4 A;  1QSY A;  4NLG A;  1SL2 A;  1ZQX A;  3OHB A;  5HRH A;  1F5A A;  2KFZ A;  4RU9 A;  1JX4 A;  3PO5 A;  1B22 A;  3OJU A;  4O3O A;  3EPG A;  4BXO A;  3FDS A;  4EBD A;  2ZJ8 A;  9ICC A;  5HNK A;  2J6T A;  4RWQ A;  7ICN A;  1R8B A;  4ZH4 A;  2XY5 A;  2F1H A;  1BPY A;  2JEG A;  3ORY A;  4FBT A;  1ARO P;  8ICO A;  1KFS A;  4B9V A;  5DLF A;  1KNY A;  1NJX A;  4KLU A;  3JPQ A;  1U9L A;  4O0I A;  1DOQ A;  4Z6C A;  3V6K A;  1ZQR A;  2UVV A;  3M9M B;  4DSL A;  4DOC A;  1S9F A;  1D9D A;  4NY8 A;  4DLE A;  4QW8 A;  4EYH B;  2RDI A;  4UB1 A;  4F5P A;  2NRT A;  3H40 A;  2ZUC A;  5D49 A;  2ATL A;  4ECS A;  5KFO A;  2V4Q A;  5KFP A;  5BPC A;  4J9M A;  1T3N A;  4O3S A;  2P6R A;  2HVI A;  4KN4 A;  4F2R A;  2BQU A;  4FO6 A;  4FBU A;  1ZQS A;  4IRC A;  4K4G A;  9ICQ A;  2Q66 A;  4KMU A;  5HRF A;  8ICV A;  2FPL A;  5DQI A;  5KFQ A;  3RBD A;  4UQG A;  1UEU A;  3C18 A;  5CB1 A;  4ECR A;  2A1J A;  2BDP A;  3OVA A;  3IHQ B;  4F50 A;  2XO7 A;  5KFV A;  1QTM A;  1NJZ A;  1XO1 A;  1R89 A;  3MR2 A;  4F8R A;  4X4T A;  3NGD A;  1DK2 A;  2VA3 A;  4BWM A;  2P66 A;  3Q8K A;  9ICA A;  3JZ0 A;  2C28 A;  4JV0 A;  5CA7 A;  3OHA A;  3EPI A;  2BPG A;  2IHM A;  9ICU A;  2BQ3 A;  1ZQI A;  4X4V A;  1T7P A;  3GIJ A;  2HHT A;  3HP6 A;  4QZH A;  3QZ7 A;  1Y88 A;  5HML A;  5KTQ A;  4FS1 A;  4CCH A;  5KG5 A;  5DGA A;  2HHV A;  5HHH A;  4XQ7 A;  2W9A A;  5BOL A;  3HX0 A;  2F1J A;  4F4Z A;  2M2U A;  1TK0 A;  4RQ4 A;  3RJG A;  3T3F A;  3RJJ A;  4UD4 A;  4RZR A;  3ZD9 A;  4ED6 A;  4F3O A;  5KG3 A;  5J0U A;  4IR9 A;  4NLN A;  5DB9 A;  4DFK A;  4KLO A;  4DWI A;  2WTF A;  4F91 B;  3THV A;  2GWS A;  4E0D A;  4Q8E A;  4M9N A;  2IBK A;  3RBE A;  2M2V A;  4XA5 A;  4ECQ A;  3TAQ A;  4X0B A;  3LWL A;  4EYI B;  4M04 A;  5DBA A;  4X4P A;  1DGS A;  3TAP A;  4RQ5 A;  3RB3 A;  1B43 A;  4TUR A;  2FLN A;  4QZ8 A;  2DR8 A;  4PHP A;  1H38 A;  5J0S A;  4ECX A;  4YMM A;  1JQR A;  2ZH5 A;  3UQ0 A;  4I2E A;  3HIY A;  3HJ1 A;  4P2H A;  5J2K A;  4C8N A;  4GXK A;  4KTQ A;  5IIM A;  5IIJ A;  3RB0 A;  5KFU A;  3RJK A;  4BXO B;  3AUO A;  4YMO A;  3GFK B;  4GXI A;  1NKC A;  4NLZ A;  2ZJA A;  2NRZ A;  4EEY A;  4LT6 A;  1NK7 A;  9ICM A;  3Q8S B;  1ZET A;  4KLH A;  1L3S A;  4QZ9 A;  4RQ8 A;  3H37 A;  2HVH A;  3C1Z A;  4GXJ A;  4YD1 A;  1NK0 A;  7ICM A;  1Q78 A;  4PGY A;  3M9O B;  2BCV A;  2J6U A;  2KZZ A;  3AQM A;  3GV7 B;  4X4O A;  2ZH4 A;  2BCS A;  3RRH A;  4YVZ A;  1ZQQ A;  2XCA A;  1RYR A;  4I2D A;  4E80 A;  5HR9 A;  2V9W A;  2BHN A;  5KT2 A;  4I2G A;  3AU6 A;  4IQT A;  1D8L A;  4KIT B;  5F9N A;  3HT3 A;  4NKT A;  4AT7 B;  5KFL A;  5KFE A;  2NRX A;  3TFS A;  2XCP A;  5F2V O;  4WC2 A;  9ICK A;  2BR0 A;  1NK9 A;  2NRW A;  2M2T A;  1ZQZ A;  5KT5 A;  7ICH A;  1ZQJ A;  4MF8 A;  3PX6 A;  1TK8 A;  5KFK A;  4DSI A;  4JV2 A;  1MC8 A;  1TKD A;  1UEV A;  5KG6 A;  2A1J B;  4YCX A;  1XC9 A;  1BPB A;  3UPS A;  1RXV A;  2F1I A;  1VFG A;  1CUK A;  4HYK A;  3ISD A;  4F4K A;  3ZDE A;  4I29 A;  4DOA A;  3PV8 A;  3N4M B;  1D8Y A;  1TAU A;  2VAN A;  5IIK A;  3V7J A;  2XC9 A;  1X9S A;  4S3N A;  5J0W A;  4QZC A;  2ZHA A;  2UVU A;  3PX4 A;  4O5C A;  1TFW A;  3KHR A;  2R8H A;  4NKU A;  4DOB A;  3NYB A;  3PR4 A;  3GQC A;  1TFR A;  3JPN A;  5DEC A;  1ZQB A;  4RUC A;  2NRV A;  4YR0 A;  1ZQK A;  2AGO A;  3ZDB A;  2HHW A;  5EWE A;  1ZQM A;  5KFN A;  5KG4 A;  4RNN A;  3EYZ A;  1BPZ A;  3ZDC A;  4FH5 A;  2ZUB A;  3TFR A;  7ICT A;  1YLQ A;  9ICF A;  1V4A A;  4QZG A;  3GV5 B;  3V72 A;  4RNO A;  1BGX T;  3H4D A;  4QW9 A;  3BQ2 A;  5DB7 A;  2H5X A;  3HWT A;  3GIL A;  4J9K A;  3QEB Z;  3C66 A;  3RH4 A;  2C22 A;  3FYH A;  3M8S A;  2HHQ A;  4KLT A;  4EP7 A;  5HC9 A;  5KFX A;  2HW3 A;  4J9N A;  9ICB A;  4FH3 A;  8ICC A;  2ZJ5 A;  4DQP A;  2BCU A;  4UAZ A;  1ZQC A;  4PHA A;  2JEI A;  3UPQ A;  5J2C A;  4WBZ A;  3B0Y A;  5KT4 A;  2ASJ A;  4DL3 A;  3Q8P B;  3SI8 A;  3RR8 A;  3RJH A;  3MBY A;  3Q8R B;  2JEF A;  3C5G A;  4DQR A;  4YG2 A;  8ICI A;  1COO A;  3JPT A;  2DPI A;  3H8S A;  8ICL A;  8ICS A;  4MEY A;  9ICP A;  5CJ7 A;  5DG9 A;  4FHY A;  5DG8 A;  4UB4 A;  4RPZ A;  4DO9 A;  4DS5 A;  1ZQP A;  5DGB A;  2O1P A;  1BPE A;  5KFY A;  4E7X A;  3OV7 A;  3AQL A;  2MAX A;  4XQ8 A;  4ECY A;  5KFJ A;  9ICG A;  2R8K A;  2AU0 A;  3PVX A;  2AQ4 A;  4MFC A;  4F5N A;  1JXL A;  7ICL A;  4PGQ A;  4DFJ A;  1TV9 A;  5KFW A;  1BPX A;  1QSS A;  4M5D A;  1XWL A;  4J9S A;  4F4W A;  1S0V A;  4EBC A;  3ETL A;  4DSK A;  2FLP A;  3LQC B;  4I2J A;  3RAX A;  3EW9 A;  2AQ0 A;  3H8W A;  3G6Y A;  2RDJ A;  4R8U B;  5KFR A;  3OGU A;  4ECT A;  4M47 A;  2W9C A;  4J9R A;  3OUY A;  1MIW A;  3KTQ A;  1IM4 A;  5L1J A;  4DFP A;  2FMQ A;  4UD5 A;  4I2B A;  4UAY A;  4X0A A;  2DFL A;  4O3Q A;  2FPM A;  3RR7 A;  4DQI A;  2ZH1 A;  4PHD A;  3BDP A;  1TAQ A;  5DDY A;  4YXJ A;  4AT9 A;  2DPJ A;  4IQW A;  1L3V A;  4TUP A;  3PY8 A;  4NXZ A;  5KG2 A;  2ISP A;  1NK6 A;  4O3N A;  7ICF A;  4M9G A;  3SZ2 A;  1KFD A;  5DDM A;  8ICZ A;  5J0P A;  1SL0 A;  2I9G A;  4UB2 A;  5HRD A;  3MAB A;  1ZQH A;  9ICW A;  8ICY A;  4KLS A;  4QZE A;  5CP2 A;  4EBK A;  4DL2 A;  5J29 A;  3PW4 A;  4C8M A;  4PH5 A;  3M8R A;  5J0T A;  4Q45 A;  8ICB A;  3WFS C;  3LDA A;  3GIK A;  4QZB A;  3H4B A;  4F4X A;  3LWM A;  1FA0 A;  3OJS A;  2R8J A;  2VA2 A;  4RUA A;  1U47 A;  9ICJ A;  4UAW A;  1NK8 A;  7ICR A;  4MF2 A;  1WCN A;  4PHE A;  5KFG A;  5L9X A;  3C2L A;  2W8K A;  4KLI A;  5J2J A;  4UB5 A;  3H3A A;  3TAR A;  4AT8 A;  4I27 A;  1TVA A;  9ICH A;  1X9W A;  3JPO A;  4J9P A;  4DEZ A;  1K1S A;  3BJY A;  2O5A A;  3TQ1 A;  4MFA A;  4X4R A;  1RZT A;  1HUO A;  5J2A A;  5DLG A;  4WC6 A;  2FPK A;  2IMW P;  4RPX A;  4RWN A;  5KFT A;  1KDH A;  4X5V A;  3QZ8 A;  1JMS A;  4ED0 A;  4F92 B;  4C8K A;  4LZD A;  3T5L A;  1VJ7 A;  1C7Y A;  4UB3 A;  2ZHB A;  5KFH A;  5TZV A;  2HHU A;  3M9N B;  2FMS A;  4DSE A;  1ZQW A;  5J2F A;  4RQ1 A;  3SV4 A;  3PW2 A;  3T5J A;  1EXN A;  3MGH A;  3BQ0 A;  8ICH A;  2ASL A;  1R8C A;  4EBJ A;  1S0O A;  1S76 D;  8ICE A;  4DF8 A;  4ATB A;  2R8I A;  3C2K A;  4I2A A;  4WCW A;  4YMN A;  4FHW A;  3GDX A;  4WC3 A;  2HHX A;  3ISC A;  3KHH A;  1MQ3 A;  4XUS A;  3B0X A;  1MQ2 A;  4B9T A;  2NRK A;  2FMP A;  1L3T A;  4ELU A;  4P4P A;  4PGX A;  9ICX A;  4WC5 A;  4JUZ A;  3C5F A;  4KLE A;  4QWB A;  4ED2 A;  3MFI A;  1V9P A;  3IM1 A;  1ZQF A;  8ICU A;  3OVS A;  4QZI A;  4RT2 A;  1WOT A;  1UA1 A;  1OU5 A;  4NLK A;  1JN3 A;  1K1Q A;  2W9C B;  8ICR A;  4FHV A;  1XSN A;  1ZJM A;  1KSP A;  4ED1 A;  2W8L A;  1T8E A;  4O5E A;  2ALZ A;  1S77 D;  9ICS A;  5L1L A;  3V6H A;  4DL7 A;  1DK3 A;  2RFF A;  4DLG A;  4B9M A;  4YXM A;  4K4H A;  7ICS A;  2ZH9 A;  2PI5 A;  1QSL A;  5KFC A;  5IIL A;  1ZQO A;  4Q44 A;  5HRI A;  1T4G A;  3MR6 A;  4KLL A;  2R8G A;  4AT9 B;  3C21 A;  4QWD A;  4JWN A;  4RQ0 A;  4GLX A;  5KFS A;  4P4M A;  3Q8M A;  3AU2 A;  3QEA Z;  5EOZ A;  2Y1J A;  3RJF A;  3WFP A;  4I2I A;  1SKS A;  5HRE A;  4RQ3 A;  4F93 B;  1U49 A;  4J9Q A;  5DED A;  9ICN A;  4KLQ A;  4BWJ A;  2DRB A;  2KZM A;  7ICK A;  4DL5 A;  3JPS A;  2AJQ A;  1UET A;  4F5Q A;  2W9M A;  1Z3E B;  3TAN A;  1NO5 A;  5D46 A;  3MR3 A;  3ISB A;  3TI0 A;  4KLG A;  5HRL A;  1Z00 A;  1TFY A;  4R66 A;  4JWM A;  2J6S A;  5EWG A;  3WFO A;  1KLN A;  2PFP A;  5DG7 A;  3G6X A;  1JAJ A;  4I28 A;  2ZTC A;  4QZA A;  1N48 A;  2PXI A;  4BGD A;  3PNC A;  4FHP A;  1UT5 A;  3KHL A;  2B21 A;  5KT3 A;  3OUY B;  5J2I A;  4WC4 A;  1XU4 A;  1NKE A;  9ICI A;  4TQS A;  4Q8F A;  1BNO A;  4AT8 B;  4IG8 A;  2C2E A;  4XRH A;  2AGP A;  1KFT A;  2P6U A;  4KLD A;  4IR1 A;  5KG7 A;  4MEX A;  1NK5 A;  1NK4 A;  5C5J A;  2JZB A;  4B9U A;  4IRK A;  5KT7 A;  3UXP A;  1MSW D;  5HRK A;  4M0A A;  3OVB A;  2ASD A;  2UVW A;  4QWC A;  5KG0 A;  3QE9 Y;  2ZTD A;  1RPL A;  4DL6 A;  4DSJ A;  2HHP A;  2ZH8 A;  5KFM A;  3SV3 A;  5DB8 A;  1TK5 A;  3ZD8 A;  2ZTE A;  2BPC A;  3Q8Q B;  2XY7 A;  1X9M A;  3PR5 B;  1PX5 A;  3HJ4 A;  4RWP A;  5JUM A;  1BNP A;  5J0Y A;  2BCQ A;  4YQW A;  5J2D A;  2BGW A;  5DBB A;  1ZQE A;  8ICM A;  2M2W A;  1MIV A;  8ICN A;  2XY6 A;  4DSF A;  4O3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...