4NLZA

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template 8brg and incoming gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
323
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 323
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlzA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlzA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlzA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlzA03
1XO1A 1D8YA 4LVSA 1ZJMA 7ICLA 3AQNA 3GFKB 3JPQA 9ICHA 4JV1A 5HRFA 3RR8A 4BWMA 4ED3A 5IILA 2NRWA 2WTFA 2ZTDA 1JN3A 4QZ9A 3TI0A 1TVAA 4M47A 4FHWA 4I2JA 4FH5A 4TUSA 4BWJA 4DLGA 2VA2A 5KT2A 3RJKA 7ICPA 1BNOA 1NK0A 2FMPA 2BCQA 4M9NA 3K75D 5KFLA 4R64A 1L3VA 2JEIA 5KFZA 4YD1A 4IRCA 1RYSA 4GC7A 4EBCA 2UVWA 3AQLA 5KFNA 1X2IA 4UBBA 4F4WA 4DO9A 7ICFA 1QLNA 2W9CA 4WC6A 3ZDBA 2Y1JA 4RQ5A 3PW2A 2P6UA 3Q8QB 1XWLA 9ICLA 5KFOA 1CEZA 3PO4A 5KFMA 4EBKA 4P4PA 2NRKA 4QW8A 7ICIA 1Q79A 1IXRA 5J0QA 5HREA 1F5AA 8ICGA 3RAXA 3H8SA 4J9LA 4EYIB 9ICNA 4RUAA 4WCWA 5KT7A 4C8OA 4DWIA 5HRKA 2PBEA 4XQ7A 4NKUA 1S0OA 4F8RA 3EZ5A 2ZH7A 4I2AA 1MIWA 4UD5A 1UETA 5DECA 3OHAA 5F2VO 1NK7A 3M9NB 1DK2A 5KFAA 4JV0A 4R66A 9ICBA 4BGDA 5D46A 7ICNA 4B9MA 1NJZA 1ZQBA 1D9FA 1S77D 4KLIA 5J2EA 3GV7B 7ICHA 2O1PA 3MR2A 5KT5A 5EWFA 2NRTA 4QWAA 5KFEA 1HUZA 2PFPA 5TZVA 2HVHA 1KFTA 4RWQA 5J0TA 3RRGA 3C21A 1VFGA 2DRBA 3ISCA 5KFIA 1Z00B 2IBKA 4DQPA 4MEYA 4F4YA 5IINA 2BPFA 1R8BA 5CWRA 4O3OA 5DQHA 1U49A 5DQGA 4PHPA 4KLTA 5J0RA 8ICEA 2C22A 4Z6EA 4KLGA 3B0YA 1SKWA 4ECUA 1ZQJA 8ICCA 5HHHA 5KFXA 4DSIA 3UPSA 4KLLA 3PY8A 2R8IA 3Q8LA 5D49A 2DFLA 3OHBA 4ECZA 1T8EA 1ZQQA 4B9TA 4WC5A 3GDXA 2ZH4A 4MF8A 2J6UA 2DR7A 4QZBA 4F4KA 8ICHA 5IIMA 5HR9A 4PHEA 3HIYA 1LB2B 4E8FA 3ZD8A 2PI5A 4XRHA 5J0XA 1D8LA 3PR4A 3UXOA 3LWMA 1ZQGA 3JPNA 2M2UA 4S3NA 4YP3A 4QZGA 2A1JB 4PH5A 1R8CA 4C8NA 1IM4A 1KEJA 3PW4A 1ZQXA 4F93B 3MR3A 3MDAA 2OWOA 3RJEA 3RJFA 4C8LA 2XGPA 2VA3A 3PW5A 4NM1A 3AQKA 1QSLA 4O0IA 3Q8SB 1HJPA 1JXLA 3RJIA 3JPPA 4QZIA 7ICOA 4QZAA 3PMNA 1S0VA 3LDAA 3Q8KA 4M9HA 1S76D 1SZPA 3RTVA 3THVA 4GXJA 4WBZA 5IIOA 1ZQHA 1TAUA 5KFKA 4RQ3A 1NJYA 4YMNA 2ZUCA 3H4DA 1ZYQA 2FLNA 5EWEA 1ZJNA 2IMWP 4Q8FA 4AT8B 3C1YA 1BVSA 3HWTA 3IM1A 3T5LA 3QEAZ 1UA0A 2R8JA 3KHLA 5L1LA 5F9NA 3WFSC 4I27A 4O3RA 4X4RA 2JEJA 5KFGA 5L1JA 4ED6A 3PX6A 5KFCA 1JX4A 2R8GA 2W9BB 3OVBA 4QZFA 2Y1IA 4RQ4A 3RH6A 1XSPA 4KLFA 3EWAA 5HRHA 4I2BA 3WFRE 1ZETA 3MGHA 3UPQA 5KG0A 4QW9A 4M2YA 2KFZA 1TK5A 2BPCA 4QZ8A 4RQ7A 4YR3A 4K4GA 5HRIA 4TURA 1X9MA 5DDMA 4MEXA 8ICOA 7ICEA 4M6WB 4KLSA 4RPZA 2BE3A 8ICFA 4UAYA 4C8KA 1UEUA 4IRDA 4I2IA 5KG3A 4X4TA 3MDCA 9ICVA 1LV5A 4WC2A 4B9VA 5EOZA 2MUTA 3SYZA 1KFSA 4XUSA 1X9SA 3G6VA 3IHQB 1JXEA 8ICIA 3MFHA 3H7IA 4PGXA 4J9MA 1WCNA 2RDJA 1KSPA 3G6XA 4KLDA 1AROP 2PXIA 9ICAA 2NRVA 4ATBA 4WC7A 4PHDA 4O3QA 1BPBA 1NJWA 4NLNA 1UA1A 1KNYA 4PPXA 3HPOA 3V7JA 1NKCA 4JV2A 4EZ9A 1TKDA 2ZHBA 1HUOA 4B9LA 1PZNA 4X4SA 1A76A 4KITB 4ED7A 1NKBA 4DQSA 4KLHA 4I2HA 2VANA 3EW9A 2BQRA 8ICSA 3H37A 1RXWA 4M5DA 4RQ8A 4YXMA 3GQCA 2IHNA 1ZQWA 4DL7A 3KHGA 2BQUA 3AU2A 4QZDA 1TAQA 5CP2A 4F5QA 2IA6A 5J2FA 5KFJA 4RPYA 4R65A 1JIHA 4AT9A 8ICPA 2ATLA 2BCRA 4RWPA 1V9PA 4YR0A 5KFPA 4LZGA 5JUMA 5KG2A 4WC1A 3ZD9A 2KP7A 4AT7A 3C2MA 5KG5A 4J9QA 2UVVA 8ICAA 3PW0A 4DEZA 4M9GA 2ASDA 4P2HA 2BCSA 3OSPA 5HRDA 5J0PA 4DSFA 3GIMA 5HC9A 1ZQTA 1JAJA 4XA5A 3T5JA 5KFSA 3V7LA 4F5NA 4DFJA 1BPXA 8ICKA 3C5FA 2JZBB 2FLLA 4FBTA 2KZZA 4IRKA 3V6KA 4DL3A 4KLOA 2FPMA 4IG8A 4IQUA 4F5OA 3TFSA 4X5VA 5HRGA 2GWSA 4FHYA 1ZQPA 2ASJA 4M04A 5J2CA 9ICQA 5DKWA 4J9SA 3BQTA 4ECRA 4ED1A 3BQ1A 4B9UA 5J2JA 4LT6A 4X4OA 3AQMA 3NTUA 5KFUA 4UB4A 2XC9A 2ALZA 5KFTA 2AQ4A 2PFQA 3WFQE 4QWEA 2BHNA 3K4GA 4RQ2A 5KT6A 1Q78A 4O3NA 9ICSA 2FMQA 4YFKA 5J0WA 4RT3A 3H3AA 2DR5A 1ZQNA 2FLPA 3ZDAA 1UT8A 5IIKA 2PFOA 4JWMA 2ZH6A 2Q66A 2FPLA 9ICUA 5DG7A 7ICKA 1WOTA 4QZHA 3HJ4A 4J9RA 3MFIA 2I9GA 4KLJA 1T7PA 5DGBA 3T3FA 1MQ2A 4MFFA 2DR8A 1V4AA 5DB6A 4IQTA 3KHHA 4IR9A 4B9NA 1ZQLA 4NLGA 5J2DA 3M9MB 4NLKA 3ZDEA 1K1QA 4YR2A 3M8SA 4DQIA 4NM2A 4KN4A 4Q43A 1XSNA 1S0NA 4RPXA 3TAQA 9ICCA 1NJXA 2V4RA 4UB2A 3RB0A 3MGIA 3OJSA 4FS2A 3OJUA 9ICRA 3TFRA 4RQ6A 2ZTCA 3QZ7A 2A1JA 5DG9A 4F50A 4Q44A 3EPGA 4FO6A 4DSEA 2XY7A 1U47A 3RBEA 3GV8B 9ICIA 5L9XA 4FHVA 3RB4A 3RJHA 2F1JA 3QEBZ 3C18A 1DGSA 2HW3A 9ICOA 3BDPA 7ICUA 2KZ3A 3KHRA 1ZQEA 4WBYA 1ZQUA 5IIIA 5DB7A 5DBBA 4K4IA 7ICJA 3H38A 4UB3A 3PW7A 8ICVA 2M2VA 4WC0A 3LK9A 3WFOA 1BGXT 4MFAA 3SI8A 5KFDA 2XY6A 1SKRA 4DSJA 4PHAA 2W9MA 1ZQFA 2IHMA 3UXPA 4ECYA 4MFCA 5J0YA 2ZH2A 3LQCB 1NO5A 1BNPA 3HP6A 9ICPA 1Y88A 2I1QA 3QZ8A 1ZQAA 8ICMA 1KLNA 4M9LA 4X4PA 4Z6FA 8ICYA 5KFHA 1BPDA 4TQSA 4KLQA 2W9BA 5IIJA 5CJ7A 4I2DA 4KN7A 3M9OB 3ISDA 3T5KA 3V6JA 1B43A 5HHIA 4DFKA 3AU6A 3QE9Y 4F2SA 9ICGA 3OUYA 1XS9D 5DB8A 4RWOA 4BXOA 1MIYA 3BJYA 5HRBA 4R8UB 5J2HA 4UAZA 4UB1A 5J0OA 4E7XA 1MSWD 1NZPA 4YN4A 1JQRA 8ICXA 3ZDCA 3MBYA 4HYKA 4P4MA 3ZDDA 2W8KA 3RB3A 3C1ZA 3KTQA 2ZTEA 1ZQOA 1EXNA 2C2EA 4NKTA 4PGQA 1VJ7A 5KFFA 4XQ8A 4EP7A 1U9LA 1ZQRA 5J2BA 4ED2A 4GLXA 3BQ0A 1UT5A 1U45A 4DF4A 3PX4A 1S0MA 4GXKA 3M8RA 5L1KA 3JPRA 1L3TA 1QSSA 3MABA 4X4NA 8ICZA 3ETLA 2P66A 2ZHAA 2HHSA 9ICKA 4ECQA 3RJGA 2Q0ZX 3H39A 4RZRA 2ZH3A 1KFDA 2HHQA 3V72A 4WC4A 2BGWA 4RNMA 3V7KA 4DOBA 2UVRA 4NLZA 2XY5A 3G6YA 5CB1A 4C8MA 2ZJ5A 4O3PA 3LWLA 4ED0A 4I2GA 1B22A 3C5GA 5BOMA 3OSNA 3C66A 2HHUA 2DVIA 4JUZA 2DPJA 2UVUA 1TFRA 1SL0A 7ICSA 3WFPA 2RFFA 1NK9A 4KLEA 4F91B 2ID1A 5DEDA 2HHXA 4E0DA 2ZH8A 5KG4A 5BPCA 4RNNA 4GC6A 2PI4A 1NK4A 1CUKA 4DSKA 1ZQVA 1A77A 4UQGA 4ELTA 3SZ2A 1RYRA 1L3UA 3PO5A 4EZ6A 4F4XA 4EBJA 3PX0A 4IQVA 2P6RA 4K4HA 5KG7A 2AU0A 1QSYA 4YQWA 3HX0A 5DLFA 4DF8A 2AQ0A 2C28A 4O9MA 8ICJA 4FHXA 1KRPA 5L1IA 4FBUA 4DL5A 3TAPA 1R8AA 8ICNA 4R63A 1ZQZA 2JZBA 2DPIA 1KTQA 4NY8A 2AJQA 1R89A 4RQ0A 4QWBA 4FHPA 3PR5B 4DLEA 1ZQMA 4X4QA 2ZH9A 2LYHA 5J2AA 5J0SA 1NKEA 3N97B 1BPYA 2HHVA 4O5KA 2HHTA 3GV5B 2ISPA 2R8KA 4ECTA 4F92B 2C2DA 4G3IA 1RPLA 2AGPA 1N48A 4AT9B 2MAXA 5J29A 2W8LA 2W9AA 3JPOA 4KTQA 2KN7A 4O3SA 3PNCA 1ZQDA 5DLGA 2XCPA 4UB5A 1ZQIA 3UQ2A 2R8HA 9ICFA 2NRZA 4YD2A 1TK8A 1MIVA 3RH4A 4P4OA 4AT7B 1K1SA 8ICRA 1Z00A 3OV7A 2BQ3A 1NK6A 4Z6DA 4UAWA 3H8WA 5CHGA 2W9CB 1ZQKA 4Q8EA 3TQ1A 1COOA 2PFNA 4YXJA 5KFYA 3C2KA 3SV4A 4KMUA 4DFMA 4I2EA 3OVSA 4DOAA 3MR6A 8ICUA 5KFVA 2BCUA 7ICTA 5KFWA 8ICBA 4DOCA 4F2RA 5CR0A 4F3OA 4O5CA 1NK8A 4YVZA 2DRAA 3C2LA 5EWGA 2F1HA 3N4MB 1H38A 1D9DA 2KFNA 9ICEA 4QZCA 3OGUA 2AGOA 2AGQA 1S97A 1L3SA 4DFPA 4NXZA 5J2IA 1T3NA 2V9WA 4B9SA 4Q45A 1SL1A 3RAQA 7ICMA 3H8JA 9ICWA 5DBCA 4UBCA 4F5PA 4TUQA 3RRHA 2V4QA 5DQIA 4IR1A 4X0BA 3GILA 3HT3A 3RBDA 5KG6A 4YMOA 4RU9A 1ZQCA 1UEVA 3AUOA 4KLMA 4QWCA 1BPEA 5HP4A 1WCLA 4F5RA 7ICQA 1S10A 2BR0A 3RJJA 5C5JA 5BOLA 1QTMA 1XC9A 2HHPA 9ICMA 3TARA 4YG2A 2XO7A 8ICWA 5DBAA 3BQ2A 3UQ0A 8ICLA 3JYYA 1Z3EB 1DOQA 3Q8PB 3B0XA 4ECXA 5HNKA 1KDHA 5HMMA 3RH5A 3L9DA 2B21A 4DS4A 4TUPA 2F1IA 4YMMA 3SV3A 1TK0A 2HHWA 3MR5A 4ELUA 2XCAA 1PX5A 2RDIA 5DDYA 3HW8A 2ISOA 4CCHA 4ECWA 4DSLA 4AT8A 4MF2A 4RUCA 5J0UA 3GIJA 1SL2A 1ZQYA 2ZUDA 7ICVA 3UXNA 5HMLA 4DS5A 1X9WA 2J6TA 1TV9A 1DK3A 1TFYA 5DG8A 2BPGA 3GIIA 2M2WA 4ECVA 9ICTA 2ZH1A 4RWNA 1TFWA 4RT2A 4EBDA 3EPIA 2M9NA 4R8UA 5KT4A 3H4BA 2H5XA 2JEGA 1FA0A 3PMLA 8ICQA 4J9KA 2VA8A 2ZJAA 4M9JA 3V6HA 4M6WA 1N56A 5J2GA 4M0AA 3E2EA 4X4UA 4PGYA 5DGAA 2XGQA 4DL6A 3RB6A 2ZUBA 5HRLA 3EYZA 3OVAA 4JWNA 4RQ1A 3PV8A 4DL4A 4JK1A 5CA7A 1XU4A 3NGDA 3T5HA 4KLUA 5KFQA 2BKEA 4Z6CA 1U48A 2J6SA 4RNOA 2NRXA 3Q8MA 8ICTA 4FS1A 4DQRA 4TQRA 1OU5A 1YLQA 2FPKA 3C23A 2M2TA 2ZH5A 5KFRA 4J9NA 4ELVA 4I2FA 4LZDA 4J9PA 4X4VA 9ICXA 2ASLA 4QZEA 1NK5A 2JEFA 4I29A 4EYHB 4WC3A 3GIKA 3HJ1A 4ECSA 3OUYB 5KFBA 5D4BA 3TANA 3PVXA 1XSLA 7ICGA 3JPTA 4ED8A 1NOMA 2KZMA 4ZH4A 1SKSA 4BXOB 1MQ3A 2FMSA 4QWDA 4I28A 4O5EA 4E80A 2O5AA 3NYBA 4UD4A 3FDSA 5KT3A 3JPSA 3RR7A 4EEYA 4BDPA 4X0AA 3FYHA 2DR9A 5J2KA 3H40A 1T4GA 4YCXA 5KG1A 1JMSA 2ZJ8A 4F4ZA 1BPZA 7ICRA 3Q8RB 2C2RA 4DL2A 1RXVA 4J9OA 3ISBA 1C7YA 2MUTB 2HVIA 1L5UA 2KTQA 1S9FA 1RZTA 9ICJA 4IQWA 3ORYA 5KTQA 4EBEA 1MC8A 1U4BA 2BDPA 4FH3A 3JZ0A 4DQQA 5DB9A 2BCVA 4GXIA 4ATBB 5F9LA 1ZQSA 4I2CA
chains in the Genus database with same CATH superfamily
3VC8A 1XO1A 5KL1B 1ZJMA 4IL6U 2YMQA 4OD0A 2WTFA 4I0UA 3AN1A 4KB6A 4I2JA 4FH5A 4BWJA 5KT2A 2G07A 2OYYA 1NK0A 3WKCA 3K75D 5KFZA 4US8A 4EBCA 1PK1A 4UBBA 4F4WA 1QLNA 3ZDBA 2FI1A 4EBKA 5KFMA 2DL0A 3PSFA 4P4PA 7ICIA 3KKAC 1F5AA 3RAXA 1J2NA 4J9LA 2XVTA 4NKUA 4RUAA 5KT7A 4C8OA 4XQ7A 2E5SA 5AKHA 5F2VO 1NK7A 3BZKA 2W3RA 1XO0A 1P7DA 4R66A 4BGDA 3ED5A 1ZQBA 2JXJA 7ICHA 5J2EA 1PVRA 2DUYA 4QWAA 2H3QA 1HUZA 4FO1A 1KFTA 5TZVA 4DQPA 2G09A 1F44A 4Y2JA 4KLTA 2C22A 4KLGA 1SKWA 3AL0B 3PY8A 2R8IA 3OHBA 1SZHA 4MF8A 4F4KA 1COKA 8ICHA 3HIYA 3H0MB 3VCBA 4UARA 1RG6A 1ZQGA 1D8LA 2M2UA 4PH5A 1IM4A 2OM6A 3PW4A 4PZNA 4F93B 3MDAA 3RJFA 5KNIA 3NVVA 3PW5A 3AQKA 2ESEA 4QZIA 2QLTA 1S0VA 1L7PA 3Q8KA 3GZFA 4WBZA 5IIOA 2ZUCA 3H4DA 2FLNA 4AT8B 2R8JA 5F9NA 4OO1J 5ALVA 2JEJA 1JX4A 2Y0SF 3CW2C 5HR7A 3OVBA 3K1ZA 1XSPA 4KLFA 3EWAA 1B0XA 3UPQA 5KG0A 4M2YA 2WAQF 2BPCA 2AH5A 1ZOLA 4MEXA 5AI8A 4M6WB 2BE3A 2JV3A 1WWUA 4C8KA 1UEUA 1RDFA 4I2IA 4UAVA 2G5HB 9ICVA 3J81j 1Q8KA 5EOZA 3SYZA 2VJ4A 3KD3A 4J9MA 4ACOA 2K4IA 5GTHU 4PHDA 4O3QA 5ALHA 4NLNA 4FZLA 3HPOA 4EZ9A 2PMZC 8ICSA 1RXWA 4NL9A 4YXMA 3NRZA 2IHNA 3ER8C 4RPYA 4R65A 2F44A 4RQNA 3QU4A 2ATLA 2K8BB 5JUMA 2LM4A 2KP7A 4P2HA 2KNJA 4UASA 1VDVA 3KFUF 2HBJA 3T5JA 3V7LA 4J03A 1ZD2P 8ICKA 2JZBB 2FLLA 4IRKA 4DL3A 4F5OA 3TFSA 4X5VA 2H3ZA 5AKGA 1N63A 2I5HA 3BQ1A 5J2JA 4U6PA 2ALZA 5KFTA 2BHNA 2FMQA 2DR5A 1ZQNA 1WOTA 2P35A 1T7PA 5AM3A 3KHHA 1ZQLA 4NLGA 5J2DA 2YMPA 4DQIA 1XSNA 1OXJA 3TAQA 2RHFA 2KV2A 4UB2A 2GOLA 4US9A 1RYUA 4F50A 1SWVA 4OJ5A 3MGVA 1NKCA 4Q44A 3EPGA 1U47A 4FHVA 2HW3A 2Q4TA 4QJFB 5K4LA 5DB7A 4K4IA 7ICJA 2E8PA 4UB3A 8ICVA 3WFOA 3WKBA 3LK9A 2FE9A 2KKVA 1SKRA 3WK9A 3LQCB 3HP6A 4K8VA 1ZQAA 5ALGA 4M9LA 4AYBF 2B4VA 5CHEA 1BPDA 5CJ7A 4I2DA 4KN7A 4DFKA 3OUYA 1B43A 3CK6A 5DB8A 4BXOA 1MIYA 2WB1C 1SXDA 4R8UB 2QKQA 1B4FA 5AKXA 3MBYA 4P0QB 4P4MA 2CN1A 3ZDDA 4EX6A 3C1ZA 3KTQA 1EXNA 1VJ7A 5KFFA 3T79A 4EP7A 2GH1A 4JLXA 1ZQRA 2N1RA 3BQ0A 1UT5A 3SENA 9ICEA 3M8RA 4GIBA 8ICZA 3ETLA 5AIAA 2HHSA 3RJGA 3SAHA 2Q0ZX 2ZH3A 5ALNA 4RNMA 2YX8A 3V7KA 4O3MA 1B22A 4C8MA 3LWLA 3CRXA 2BDUA 2RFFA 4KLEA 2DGZA 1NK4A 4EENA 3H8MA 1RYRA 3PO5A 4F4XA 3PX0A 5KG7A 3HX0A 4DF8A 3KKAA 2C28A 2JMGA 2JZBA 4NY8A 4CNQA 4DLEA 5J0SA 2R8KA 1Z19A 4C4RA 1N48A 2W8LA 2WF6A 4O3SA 4Y2VA 2NRZA 4YD2A 1TK8A 4AT7B 5AKZA 4Z6DA 2W9CB 4YXJA 1LKYB 4DFMA 3OVSA 1T94A 5CR0A 4F3OA 4O69A 4O5CA 5AKYA 2DRAA 3C2LA 2G0AA 3D2QA 1X6IA 3OGUA 2AGOA 2AGQA 1L3SA 1T3NA 4NXZA 3RAQA 3FAHA 4UBCA 2K89A 3GILA 3HT3A 4YMOA 4KLMA 1S10A 5BOLA 2HHPA 1XC9A 2XO7A 3BQ2A 3UQ0A 3IN5A 4ZOHC 5AKIA 1DOQA 2G06A 4ECXA 3KBBA 1JALA 1J97A 4DS4A 2CRXA 2F1IA 3RF9A 4YMMA 4NXUA 1TK0A 2HHWA 2NO4A 4EGWA 1PX5A 4CCHA 3NVOA 5AI6A 3SAFA 4RUCA 7ICVA 1SL2A 3UXNA 5HMLA 4DS5A 2EANA 2M2WA 4ECVA 1TFWA 4EBDA 2M9NA 4R8UA 5KT4A 1FA0A 1FO4A 4EEDA 5CFSA 4M0AA 2ZIXB 2KG5A 3RB6A 2EZYA 2ZUBA 3EYZA 1IV8A 5AI5A 4DL4A 1XU4A 3T5HA 5KFQA 4FS1A 2FPKA 5D63A 2KOBA 2IOHA 4ELVA 4LZDA 2HI0A 4J9PA 9ICXA 4QZEA 4I29A 4EYHB 2E8OA 5D4BA 4PJ0U 1NOMA 4ZH4A 3MCRA 4K98A 3PSIA 4QWDA 4I28A 5AKJA 4UD4A 5KT3A 3RR7A 4X0AA 3FYHA 3N28A 4YCXA 2ZH7A 4NKTA 1F0MA 2KHVA 3UM9A 7ICRA 3Q8RB 4J9OA 1C7YA 2JH7A 1IIPA 3ORYA 4UB6U 4FH3A 5JTIA 2WAQC 3JZ0A 5DB9A 2EDUA 1KN5A 1ZQSA 3GU3A 1D8BA 2YQEA 3EUB2 4QIWF 9ICHA 4JV1A 4ED3A 3TKAA 4TUSA 3RJKA 1ZRMA 1QQ6A 2BCQA 2FMPA 5ALWA 5C0YA 2DF4B 4K96A 1FFUA 5ALRA 3AQLA 5CFUA 4DO9A 2W9CA 5TISU 3PW2A 9ICLA 1XWLA 5KFOA 1CEZA 1LKYA 4UB8U 4OAHA 2KJ5A 5E79U 5HREA 3H8SA 2G5IB 2PBEA 5AI0A 4DWIA 2Y9TA 4NXXA 1S0OA 4EEBA 1MIWA 3OHAA 3M9NB 1DK2A 3QU5A 5D46A 1NJZA 1D9FA 1S77D 3GV7B 5EWFA 2PFPA 5J0TA 3C21A 3I28A 5KFIA 2IBKA 4F4YA 3WK4A 1R8BA 5CWRA 5DQHA 5DQGA 2K4EA 4ECUA 3UPSA 4KLLA 3Q8LA 2DFLA 3IV6A 1T8EA 4WC5A 3GDXA 4A8EA 3ZD8A 4XRHA 2E8MA 3LWMA 4YP3A 3WK7A 4QZGA 1R8CA 1KEJA 2KJ8A 2GAFD 3RJEA 3MR3A 4CRXA 4C8LA 4O68A 2VA3A 2ZIXA 3Q8SB 1HJPA 2D3DA 3RJIA 3JPPA 2KIWA 4QZAA 1SZPA 3DV9A 3THVA 5ALDA 3NVYA 4YMNA 1NJYA 2KSOB 5EWEA 2IMWP 1BVSA 1JUDA 3IRUA 3KHLA 5L1JA 3QNMA 3PX6A 4OAIZ 2R8GA 2OH2A 4QZFA 2Y1IA 1PK3A 4I2BA 1TK5A 5DDMA 8ICOA 7ICEA 4KLSA 4RPZA 3L5KA 2YN4A 1QH9A 4HX0A 1KFSA 1N2XA 3G6VA 3IHQB 5FP0A 5AI9A 3WK6A 3MFHA 2RDJA 4KLDA 2NRVA 1UA1A 1KNYA 4PPXA 3AEVA 2D6FC 1HUOA 4B9LA 4JLZA 1A76A 5JTGA 2WFAA 3QUCA 4I2HA 4AP9A 3NVZA 4UAUA 4RQ8A 2YMLA 1O08A 3GQCA 1ZQWA 2O6KA 4DL7A 1TAQA 5CP2A 2IA6A 5J2FA 5KFJA 1JIHA 4AT9A 4YR0A 1JRPA 5KFPA 5HRDA 4M9GA 1DRGA 3F53A 3GIMA 2A19A 2ZIVB 1JAJA 2AHOB 1SV0C 5AK6A 5KFSA 2KZZA 4FBTA 4KLOA 4NLBA 4IG8A 1S5LU 4FHYA 2ASJA 9ICQA 4ECRA 2LHTA 3BQTA 4ED1A 4X4OA 4UB4A 2PFQA 4QWEA 1Q78A 1N62A 2OCEA 4YFKA 3H3AA 1Z1BA 5ALZA 2FLPA 1UT8A 4HAIA 4JWMA 4CDGA 5DG7A 5AI4A 2I9GA 4KX3A 3T3FA 1V4AA 2KEYA 4IQTA 3M8SA 3F5AA 1S0NA 4RPXA 2V4RA 3AQEA 3I1YA 3OJUA 2ZTCA 3L4PA 4DSEA 1M6YA 5L9XA 3UMGA 1Q3UA 2F1JA 3QEBZ 9ICOA 2MRLA 3NKUA 3KOOA 3BDPA 7ICUA 2KZ3A 3NWIA 1ZQUA 3PW7A 1BGXT 3SI8A 5KFDA 2W9MA 2LKYA 2E1FA 2KSOA 5AM2A 3PSTA 8ICMA 3U26A 1PUZA 4Z6FA 8ICYA 5AICA 5KFHA 3A0HU 4C4SA 2GLEA 4KLQA 2DKXA 2IUBA 4F2SA 3AU6A 3QE9Y 4CE6A 5CFTA 4RWOA 5EE0A 3D2NA 5HRBA 2W11A 5J2HA 4UB1A 1JQRA 3PHZA 3ZDCA 2ES6A 2ZTEA 3F2DA 4PGQA 1SGGA 4MKPA 1JROA 2KMDA 2LM1A 4K9AA 1U9LA 4ED2A 3WKEA 1U45A 5ALKA 4DF4A 1V97A 4GXKA 3PX4A 4WC3A 3MABA 3HRDD 4EELA 2P66A 9ICKA 3H39A 2PKEA 2EZZA 2XY5A 4ED0A 5CB1A 5BOMA 3OSNA 3L3FX 3C66A 3OWGA 2HHUA 2DVIA 2DPJA 3QUQA 5H2FU 3ETRA 5DEDA 2ZH8A 2NV3A 5BPCA 4GC6A 1CUKA 4C4TA 1URJA 1ZD5A 4EBJA 2AU0A 4FHXA 2ZIVA 2AQ0A 3M6KA 4JB3A 3WKAA 4R63A 3PR5B 1SWWA 2ZH9A 3HKZF 5J2AA 3IDWA 2HHTA 3DEEA 3GV5B 2ISPA 4F92B 2C2DA 3PNCA 2R8HA 3RH4A 5ALIA 8ICRA 1YZ7A 1YZ6A 1NK6A 4UAWA 1ZQKA 3TQ1A 1COOA 2PFNA 3MR6A 2BCUA 7ICTA 1S8OA 3KZIU 2FJ6A 1NK8A 3N4MB 2KFNA 4QZCA 2HDOA 1S97A 3WU2U 5J2IA 4DFPA 4B9SA 4Q45A 7ICMA 9ICWA 5DBCA 4F5PA 5AK4A 3RRHA 5DQIA 4X0BA 3F2CA 3SR6A 1KBUA 4RU9A 1BPEA 7ICQA 3LVWA 2BR0A 4OJLA 3RJJA 1QTMA 9ICMA 1Z3EB 1Z1VA 3L9DA 3SV3A 1N5XA 1WYGA 4NWIA 4ELUA 4WQKA 2ISOA 4ECWA 4AT8A 1RM6C 4C7ZA 4MHVA 2E1EA 2H3FA 1TV9A 1DK3A 1TFYA 1AQ6A 3GIIA 2ZH1A 9ICTA 2EZXA 4RT2A 2WHEA 2H5XA 3SMVA 4M6WA 5ALUA 5J2GA 3E2EA 5DGAA 5B3PA 2IOFA 2RLTA 3ZI4A 3R9KA 3OVAA 4JWNA 3PV8A 4NXWA 2BKEA 2FDRA 1YLQA 4OCZA 2G08A 1OU5A 3C23A 3NS1A 4NV0A 2W04A 5KFRA 1QCKA 2ASLA 5HR6A 3HJ1A 4ECSA 2HOIA 3TANA 4ED8A 3UMBA 1SKSA 1MQ3A 4O5EA 4E80A 3NYBA 2LYAA 2CXYA 4BDPA 1T4GA 1BPZA 4F4ZA 2ZJ8A 3E0FA 5ALTA 2MUTB 1S9FA 1L8LA 2EQYA 5F3XB 4EBEA 3AQFA 1QQ5A 2BCVA 4BX9C 1SV0A 1GPJA 3TADC 2B6GA 3AQNA 5EE9A 3GFKB 3JPQA 3ONNA 5HRFA 3K1RB 3RR8A 2Z7JA 2H3IA 1KW4A 4BWMA 5IILA 2NRWA 4FHWA 1JN3A 4QZ9A 4XJEA 1Z4NA 2VA2A 1BNOA 2LYBA 4Y2TA 5KFLA 1LVHA 1L3VA 2XICA 3OPXA 1OW5A 4YD1A 4IRCA 1RYSA 4GC7A 2UVWA 5KFNA 7ICFA 2Y1JA 2P6UA 3Q8QB 5L1MA 3M6ZA 3PO4A 2NRKA 5AM5A 1Q79A 5J0QA 1Z4OA 2QB1A 4EYIB 4OJ6A 3MC1A 3EZ5A 3CNHA 4I2AA 5DECA 3KZXA 5CEHA 4JV0A 9ICBA 2ZG6A 1FEZA 1C20A 4KLIA 2VJ5A 3MR2A 2RQ5A 1OUQA 2NRTA 5KFEA 3CYMA 4RWQA 3RRGA 3ISCA 1Z00B 1CRXA 5IINA 5KAIU 2BPFA 3E58A 2FCLA 4O3OA 8ICEA 4Z6EA 3B0YA 1ZQJA 5KFXA 4DSIA 5D49A 4ECZA 1FFVA 2J6UA 2DR7A 3QUBA 4QZBA 4PHEA 4P0PB 5J0XA 3PR4A 3JPNA 1ZD3A 2K8CB 3HILA 4DFDA 2WF7A 2XGPA 4NM1A 2E8NA 1QSLA 2LBOA 4P0QA 2F8KA 4WH5A 2L5YA 5EE3A 3PMNA 1S76D 3RTVA 5ALYA 5ALSA 1ZQHA 5KFKA 4RQ3A 2J6SA 1ZYQA 3FM9A 1ZJNA 4Q8FA 3C1YA 3WFSC 5L1LA 4O3RA 4X4RA 5KFGA 5KFCA 2A1AA 5T14A 5ALQA 1FIQA 5JU5A 5HRHA 3WFRE 3MGHA 2KFZA 5HRIA 2QB0B 4QZ8A 4YR3A 1X9MA 8ICFA 4QNLA 4IRDA 3DDHA 2HOQA 3MDCA 1LV5A 4WC2A 2MUTA 1JXEA 2Y0SC 1KSPA 1QQ7A 4WQLA 1AROP 2PXIA 4WC7A 1NJWA 3V7JA 4JV2A 4X4SA 1PZNA 4BUGA 4DQSA 4KLHA 2VANA 4N7RA 3H37A 5B5EU 2BQUA 3A0BU 5AIBA 3K7DA 8ICPA 4RWPA 4KX5A 2WF8A 4C0ZA 1DGJA 4WC1A 3ZD9A 4AT7A 4IC9A 5KG5A 2UVVA 8ICAA 3OSPA 1ZQTA 4XA5A 3IG8A 2FPMA 4Y2UA 2F76X 5J2CA 5DKWA 4J9SA 3AQMA 5KFUA 1O03A 3WFQE 4OAGA 3ERCC 4CF5A 9ICSA 4PZOA 5J0WA 4RT3A 1UCVA 2ZH6A 3HKZC 9ICUA 7ICKA 3HJ4A 4QZHA 3F5EA 4MFFA 5DB6A 4IR9A 4NLKA 3ZDEA 1WWVA 4YR2A 5B3QA 1ZRNA 4NM2A 4Q43A 1HEKA 1UHUA 1NJXA 4P0PA 4FFDA 3RB0A 3TFRA 3QZ7A 5DG9A 3RJHA 3RBEA 3WFPA 3KHRA 4Y2YA 5DBBA 3H38A 2ZIWB 2M2VA 4MFAA 4OJPA 2WB1F 2KHQA 4DSJA 5AM4A 4PHAA 1ZQFA 3UXPA 4ECYA 4RQMA 5J0YA 2ZH2A 2I1QA 1KLNA 4X4PA 2KIVA 4TQSA 1L7OA 2HCFA 4WJ3B 5A0LA 3M9OB 3ISDA 5HHIA 1RQLA 9ICGA 1XS9D 2QB0A 2HN1A 3BJYA 4UAZA 4E7XA 1NZPA 4YN4A 8ICXA 4HYKA 3M1YA 3RB3A 2C2EA 4AYBC 5JRTA 4XQ8A 4BJQA 2ZXHA 5L1KA 3JPRA 2YTUA 3TADA 3D2SA 3SQIA 4ECQA 1KFDA 3QX7A 2XIDA 2BGWA 2UVRA 1KL9A 3M7DA 3G6YA 2K8AA 4O3PA 4I2GA 2I6XA 4FZNA 4JUZA 7ICSA 2DBYA 2E3TA 2HHXA 2YMMA 4RNNA 4DSKA 2PI4A 1ZQVA 1A77A 4UQGA 4EZ6A 4K4HA 2ODGA 2BZFA 4O9MA 1X9XA 5L1IA 4DL5A 3QYPA 8ICNA 1WUDA 1ZQZA 4LT6A 1KTQA 4FHPA 1ZQMA 4NLCA 1KQQA 2LYHA 1NKEA 3N97B 1BPYA 5D61A 2HMXA 4ECTA 3QU7A 2F8LA 5ALPA 2MAXA 5ALMA 2W9AA 4KTQA 2KN7A 3FC4A 4DCCA 3PZPA 1ZQDA 2W54A 5DLGA 2XCPA 4UB5A 1ZQIA 3F2BA 9ICFA 1MIVA 1K1SA 4OJOA 3H8WA 5CHGA 2KJ9A 2WF5A 3NUQA 4KMUA 1MA7A 4I2EA 4DOAA 8ICUA 5KFVA 8ICBA 3C29A 2F77X 4FZMA 2KVSA 2EAOA 4YVZA 2OEHA 1N5WA 1V85A 1D9DA 2V9WA 4X4QA 3QU9A 1SL1A 5KG6A 2KVCA 1L6NA 4LEVA 4QWCA 4CF4A 1WCLA 4F5RA 5AM0A 3TARA 5ALLA 4YG2A 5AKEA 2ZIWA 8ICLA 3JYYA 3B0XA 3AMZA 5HMMA 3RH5A 4K9BA 2D8CA 2XCAA 3JCFA 3GIJA 1KKXA 3BZCA 3IP4B 4RWNA 5ALFA 3B9JA 3BS7A 3H4BA 8ICQA 2JR5A 4J9KA 2ZJAA 4CGZA 4EV6A 2XGQA 4DL6A 1ZD4A 4JK1A 5CA7A 3NGDA 3HJEA 4KMOB 8ICTA 2NRXA 3Q8MA 2EWRA 2M2TA 1TAMA 2ZH5A 2MA1A 4I2FA 4X4VA 1NK5A 2JEFA 4U7CA 3OUYB 4CF3A 7ICGA 3PVXA 1ZXIA 3JPTA 4BXOB 2LI6A 2FMSA 2RP5A 2O5AA 3NRWA 3FDSA 2KICA 5J2KA 1JMSA 1RXVA 1L7MA 3ISBA 1A6SA 1L5UA 1UPHA 5KTQA 1MC8A 1U4BA 2BDPA 4DQQA 4GXIA 4ATBB 2HBLA 2VIXA 3PSPA 4LVSA 1D8YA 7ICLA 2ZIUB 2W43A 3RFAA 4M47A 3TI0A 2ZTDA 1TVAA 3LYSA 4DLGA 1RQNA 2DWQA 7ICPA 3C28A 3ER9B 4M9NA 3IG5A 4R64A 2JEIA 4B6JA 1TE2A 1X2IA 4WC6A 2JGAA 4RQ5A 4QIWC 1WG8A 4Y2QA 4QW8A 1IXRA 4WCWA 1HIWA 8ICGA 9ICNA 2YB1A 5HRKA 5G5HA 4F8RA 4UD5A 1UETA 5KFAA 7ICNA 4B9MA 2O1PA 2KD1A 5KT5A 1X42A 2QARB 2HVHA 3NVWA 2DRBA 1VFGA 1NI3A 4MEYA 4WOYA 1GO3F 4LEYA 1U49A 4PHPA 2MU2A 5J0RA 3QUTA 8ICCA 5HHHA 1A0PA 4LEWA 2ZH4A 1ZQQA 4B9TA 4K99A 3AM9A 2HOFA 5HR9A 5IIMA 3WK8A 1LB2B 4E8FA 2PI5A 4S3NA 3UXOA 4UW9A 2A1JB 3BQ7A 4C8NA 5AK5A 3H0LB 1ZQXA 2OWOA 3N7SC 4O0IA 1JXLA 7ICOA 1NZBA 1VLBA 2B0CA 3LDAA 4M9HA 2WF9A 4JMUA 4GXJA 1TAUA 1ECWA 3T5LA 3HWTA 3IM1A 3QEAZ 1UA0A 2A3VA 4I27A 1UQVA 4ED6A 2ZXIA 2HN2A 4USAA 2W9BB 4RQ4A 3RH6A 1ZETA 4QW9A 2W7OA 4RQ7A 4K4GA 4TURA 4LJXA 4UAYA 5KG3A 4X4TA 1YT3A 1CI4A 4B9VA 5AKKA 3WKDA 4XUSA 1X9SA 2MSNA 8ICIA 3H7IA 4PGXA 1WCNA 3G6XA 2HSZA 9ICAA 4ATBA 1BPBA 4PL1A 1TKDA 2ZHBA 4KITB 2ZIUA 4ED7A 1NKBA 5CRXA 3EW9A 2BQRA 4M5DA 2YY6A 3KHGA 3AU2A 4QZDA 4F5QA 5J8YC 2IOFK 2NO5A 3QXGA 4C7YA 2BCRA 1V9PA 5ALJA 4LZGA 5KG2A 3C2MA 4J9QA 3PW0A 4DEZA 2F3NA 2JHDA 2JRZA 2ASDA 1PVPA 2BCSA 5J0PA 4DSFA 5HC9A 3ICXA 3UMCA 2Y9UA 4DFJA 4F5NA 1BPXA 3C5FA 3V6KA 4IQUA 2B51A 5HRGA 4O6AA 2GWSA 1ZQPA 4M04A 5GTIU 4B9UA 3NTUA 2XC9A 2AQ4A 2KK0A 3K4GA 4RQ2A 2QARA 5KT6A 2GA9D 4O3NA 2LPEA 3ZDAA 5IIKA 2PFOA 2Q66A 3TACB 2FPLA 2CPRA 2RRDA 1K5OA 3MFIA 4J9RA 4KLJA 2EAMA 5DGBA 1MQ2A 2DR8A 1SIJA 4B9NA 1SV4A 1L8OA 3M9MB 1K1QA 4KN4A 2HBKA 3D6JA 4IS7A 9ICCA 2W7PA 3MGIA 3OJSA 4FS2A 3N7PD 9ICRA 4RQ6A 2XY7A 2A1JA 4FO6A 3CP8A 2K4HA 3GV8B 3O0FA 9ICIA 3RB4A 4NJ8A 3C18A 5D62A 1DGSA 1MN8A 5AKLA 1ZQEA 4WBYA 2AXTU 5IIIA 1J2MA 3H0RB 4WC0A 1L7NA 2M0NA 2XY6A 1SB3C 2IHMA 4MFCA 1NO5A 1BNPA 4Y2SA 9ICPA 1Y88A 3QZ8A 1F5SA 1NNLA 2K4PA 2W9BA 5IIJA 2EH9A 4NXTA 4FE3A 3T5KA 3BS5B 3V6JA 4GFJA 5AK3A 5J0OA 5ALOA 1MSWD 2PMZF 2W8KA 2XI9A 1ZQOA 3OTQA 3EF2A 1Q3VA 5J2BA 4F71A 4GLXA 1S0MA 1L3TA 1QSSA 3LVVA 4X4NA 2ZHAA 4RZRA 4Y2PA 2HHQA 3V72A 4WC4A 1N60A 1DXSA 3S6JA 3QU2A 4DOBA 4NLZA 1XNSA 3ALRA 2ZJ5A 3C5GA 4Y2XA 5AHXA 4EEKA 2UVUA 1TFRA 1Q46A 1SL0A 1NK9A 4KM5A 4F91B 2ID1A 4E0DA 5KG4A 2HBMA 4ELTA 3SZ2A 1L3UA 4IQVA 2P6RA 4G9BA 4YQWA 1QSYA 2W03A 5DLFA 1SXEA 8ICJA 1KRPA 4FBUA 3TAPA 1R8AA 2DPIA 1R89A 2AJQA 5G5GA 4QWBA 4RQ0A 5KAFU 2DKZA 4F72A 2HHVA 4O5KA 4NL9C 4G3IA 1RPLA 2AGPA 4AT9B 5J29A 3JPOA 4UATA 5EE1A 3UQ2A 4K97A 1PK1B 4P4OA 3OV7A 1Z00A 2BQ3A 4Q8EA 1PVQA 3WK5A 5KFYA 3C2KA 3SV4A 2KE7A 2KKPA 5KFWA 4DOCA 4F2RA 5EWGA 2F1HA 1H38A 4OAFA 4IQWA 3H8JA 4TUQA 2V4QA 4IR1A 3RBDA 1ZQCA 1UEVA 3AUOA 5HP4A 2GO7A 5C5JA 1X6JA 3SEIA 2K60A 8ICWA 5DBAA 5B66U 3N7RC 3Q8PB 5HNKA 1KDHA 2W3SA 2B21A 4TUPA 2IHOA 3MR5A 2RDIA 5DDYA 3HW8A 4DSLA 2VKQA 4MF2A 5J0UA 1ZQYA 2H3VA 2ZUDA 1X66A 2J6TA 1X9WA 4EX7A 3BS5A 5DG8A 2BPGA 1IG6A 2EAPA 2B56A 3EPIA 2JEGA 3PMLA 2VA8A 4M9JA 3I76A 1N61A 1VJ5A 3V6HA 1N56A 4X4UA 4PGYA 4Y2RA 4ICAA 5HRLA 3NASA 4RQ1A 4KLUA 4Z6CA 1U48A 4RNOA 1ED1A 5ALEA 4TQRA 4DQRA 2OHFA 5AM1A 5ALXA 4J9NA 3GIKA 2DQNB 5KFBA 1XSLA 2KZMA 3SD7A 1JI7A 4C80A 2BBHA 2LMRA 4O67A 2F2AB 1ZQ1C 2OXOA 2R18A 5J8YA 3JPSA 4EEYA 2DR9A 3H40A 3SAGA 4LEZA 5KG1A 2JH1A 2C2RA 4DL2A 5KL8B 2HVIA 2KTQA 2BBJA 2W55A 1RZTA 1T3QA 9ICJA 1V38A 2YB4A 4PL2A 2NYVA 1X40A 5F9LA 4I2CA 4NXVA
chains in the Genus database with same CATH topology
1XO1A 1D8YA 4LVSA 1ZJMA 7ICLA 3AQNA 3GFKB 3JPQA 9ICHA 4JV1A 5HRFA 3RR8A 4BWMA 4ED3A 5IILA 2NRWA 2WTFA 2ZTDA 1JN3A 4QZ9A 3TI0A 1TVAA 4M47A 4FHWA 4I2JA 4FH5A 4TUSA 4BWJA 4DLGA 2VA2A 5KT2A 3RJKA 7ICPA 1BNOA 1NK0A 2FMPA 2BCQA 4M9NA 3K75D 5KFLA 4R64A 1L3VA 2JEIA 5KFZA 4YD1A 4IRCA 1RYSA 4GC7A 4EBCA 2UVWA 3AQLA 5KFNA 1X2IA 4UBBA 4F4WA 4DO9A 7ICFA 1QLNA 2W9CA 4WC6A 3ZDBA 2Y1JA 4RQ5A 3PW2A 2P6UA 3Q8QB 1XWLA 9ICLA 5KFOA 1CEZA 3PO4A 5KFMA 4EBKA 4P4PA 2NRKA 4QW8A 7ICIA 1Q79A 1IXRA 5J0QA 5HREA 1F5AA 8ICGA 3RAXA 3H8SA 4J9LA 4EYIB 9ICNA 4RUAA 4WCWA 5KT7A 4C8OA 4DWIA 5HRKA 2PBEA 4XQ7A 4NKUA 1S0OA 4F8RA 3EZ5A 2ZH7A 4I2AA 1MIWA 4UD5A 1UETA 5DECA 3OHAA 5F2VO 1NK7A 3M9NB 1DK2A 5KFAA 4JV0A 4R66A 9ICBA 4BGDA 5D46A 7ICNA 4B9MA 1NJZA 1ZQBA 1D9FA 1S77D 4KLIA 5J2EA 3GV7B 7ICHA 2O1PA 3MR2A 5KT5A 5EWFA 2NRTA 4QWAA 5KFEA 1HUZA 2PFPA 5TZVA 2HVHA 1KFTA 4RWQA 5J0TA 3RRGA 3C21A 1VFGA 2DRBA 3ISCA 5KFIA 1Z00B 2IBKA 4DQPA 4MEYA 4F4YA 5IINA 2BPFA 1R8BA 5CWRA 4O3OA 5DQHA 1U49A 5DQGA 4PHPA 4KLTA 5J0RA 8ICEA 2C22A 4Z6EA 4KLGA 3B0YA 1SKWA 4ECUA 1ZQJA 8ICCA 5HHHA 5KFXA 4DSIA 3UPSA 4KLLA 3PY8A 2R8IA 3Q8LA 5D49A 2DFLA 3OHBA 4ECZA 1T8EA 1ZQQA 4B9TA 4WC5A 3GDXA 2ZH4A 4MF8A 2J6UA 2DR7A 4QZBA 4F4KA 8ICHA 5IIMA 5HR9A 4PHEA 3HIYA 1LB2B 4E8FA 3ZD8A 2PI5A 4XRHA 5J0XA 1D8LA 3PR4A 3UXOA 3LWMA 1ZQGA 3JPNA 2M2UA 4S3NA 4YP3A 4QZGA 2A1JB 4PH5A 1R8CA 4C8NA 1IM4A 1KEJA 3PW4A 1ZQXA 4F93B 3MR3A 3MDAA 2OWOA 3RJEA 3RJFA 4C8LA 2XGPA 2VA3A 3PW5A 4NM1A 3AQKA 1QSLA 4O0IA 3Q8SB 1HJPA 1JXLA 3RJIA 3JPPA 4QZIA 7ICOA 4QZAA 3PMNA 1S0VA 3LDAA 3Q8KA 4M9HA 1S76D 1SZPA 3RTVA 3THVA 4GXJA 4WBZA 5IIOA 1ZQHA 1TAUA 5KFKA 4RQ3A 1NJYA 4YMNA 2ZUCA 3H4DA 1ZYQA 2FLNA 5EWEA 1ZJNA 2IMWP 4Q8FA 4AT8B 3C1YA 1BVSA 3HWTA 3IM1A 3T5LA 3QEAZ 1UA0A 2R8JA 3KHLA 5L1LA 5F9NA 3WFSC 4I27A 4O3RA 4X4RA 2JEJA 5KFGA 5L1JA 4ED6A 3PX6A 5KFCA 1JX4A 2R8GA 2W9BB 3OVBA 4QZFA 2Y1IA 4RQ4A 3RH6A 1XSPA 4KLFA 3EWAA 5HRHA 4I2BA 3WFRE 1ZETA 3MGHA 3UPQA 5KG0A 4QW9A 4M2YA 2KFZA 1TK5A 2BPCA 4QZ8A 4RQ7A 4YR3A 4K4GA 5HRIA 4TURA 1X9MA 5DDMA 4MEXA 8ICOA 7ICEA 4M6WB 4KLSA 4RPZA 2BE3A 8ICFA 4UAYA 4C8KA 1UEUA 4IRDA 4I2IA 5KG3A 4X4TA 3MDCA 9ICVA 1LV5A 4WC2A 4B9VA 5EOZA 2MUTA 3SYZA 1KFSA 4XUSA 1X9SA 3G6VA 3IHQB 1JXEA 8ICIA 3MFHA 3H7IA 4PGXA 4J9MA 1WCNA 2RDJA 1KSPA 3G6XA 4KLDA 1AROP 2PXIA 9ICAA 2NRVA 4ATBA 4WC7A 4PHDA 4O3QA 1BPBA 1NJWA 4NLNA 1UA1A 1KNYA 4PPXA 3HPOA 3V7JA 1NKCA 4JV2A 4EZ9A 1TKDA 2ZHBA 1HUOA 4B9LA 1PZNA 4X4SA 1A76A 4KITB 4ED7A 1NKBA 4DQSA 4KLHA 4I2HA 2VANA 3EW9A 2BQRA 8ICSA 3H37A 1RXWA 4M5DA 4RQ8A 4YXMA 3GQCA 2IHNA 1ZQWA 4DL7A 3KHGA 2BQUA 3AU2A 4QZDA 1TAQA 5CP2A 4F5QA 2IA6A 5J2FA 5KFJA 4RPYA 4R65A 1JIHA 4AT9A 8ICPA 2ATLA 2BCRA 4RWPA 1V9PA 4YR0A 5KFPA 4LZGA 5JUMA 5KG2A 4WC1A 3ZD9A 2KP7A 4AT7A 3C2MA 5KG5A 4J9QA 2UVVA 8ICAA 3PW0A 4DEZA 4M9GA 2ASDA 4P2HA 2BCSA 3OSPA 5HRDA 5J0PA 4DSFA 3GIMA 5HC9A 1ZQTA 1JAJA 4XA5A 3T5JA 5KFSA 3V7LA 4F5NA 4DFJA 1BPXA 8ICKA 3C5FA 2JZBB 2FLLA 4FBTA 2KZZA 4IRKA 3V6KA 4DL3A 4KLOA 2FPMA 4IG8A 4IQUA 4F5OA 3TFSA 4X5VA 5HRGA 2GWSA 4FHYA 1ZQPA 2ASJA 4M04A 5J2CA 9ICQA 5DKWA 4J9SA 3BQTA 4ECRA 4ED1A 3BQ1A 4B9UA 5J2JA 4LT6A 4X4OA 3AQMA 3NTUA 5KFUA 4UB4A 2XC9A 2ALZA 5KFTA 2AQ4A 2PFQA 3WFQE 4QWEA 2BHNA 3K4GA 4RQ2A 5KT6A 1Q78A 4O3NA 9ICSA 2FMQA 4YFKA 5J0WA 4RT3A 3H3AA 2DR5A 1ZQNA 2FLPA 3ZDAA 1UT8A 5IIKA 2PFOA 4JWMA 2ZH6A 2Q66A 2FPLA 9ICUA 5DG7A 7ICKA 1WOTA 4QZHA 3HJ4A 4J9RA 3MFIA 2I9GA 4KLJA 1T7PA 5DGBA 3T3FA 1MQ2A 4MFFA 2DR8A 1V4AA 5DB6A 4IQTA 3KHHA 4IR9A 4B9NA 1ZQLA 4NLGA 5J2DA 3M9MB 4NLKA 3ZDEA 1K1QA 4YR2A 3M8SA 4DQIA 4NM2A 4KN4A 4Q43A 1XSNA 1S0NA 4RPXA 3TAQA 9ICCA 1NJXA 2V4RA 4UB2A 3RB0A 3MGIA 3OJSA 4FS2A 3OJUA 9ICRA 3TFRA 4RQ6A 2ZTCA 3QZ7A 2A1JA 5DG9A 4F50A 4Q44A 3EPGA 4FO6A 4DSEA 2XY7A 1U47A 3RBEA 3GV8B 9ICIA 5L9XA 4FHVA 3RB4A 3RJHA 2F1JA 3QEBZ 3C18A 1DGSA 2HW3A 9ICOA 3BDPA 7ICUA 2KZ3A 3KHRA 1ZQEA 4WBYA 1ZQUA 5IIIA 5DB7A 5DBBA 4K4IA 7ICJA 3H38A 4UB3A 3PW7A 8ICVA 2M2VA 4WC0A 3LK9A 3WFOA 1BGXT 4MFAA 3SI8A 5KFDA 2XY6A 1SKRA 4DSJA 4PHAA 2W9MA 1ZQFA 2IHMA 3UXPA 4ECYA 4MFCA 5J0YA 2ZH2A 3LQCB 1NO5A 1BNPA 3HP6A 9ICPA 1Y88A 2I1QA 3QZ8A 1ZQAA 8ICMA 1KLNA 4M9LA 4X4PA 4Z6FA 8ICYA 5KFHA 1BPDA 4TQSA 4KLQA 2W9BA 5IIJA 5CJ7A 4I2DA 4KN7A 3M9OB 3ISDA 3T5KA 3V6JA 1B43A 5HHIA 4DFKA 3AU6A 3QE9Y 4F2SA 9ICGA 3OUYA 1XS9D 5DB8A 4RWOA 4BXOA 1MIYA 3BJYA 5HRBA 4R8UB 5J2HA 4UAZA 4UB1A 5J0OA 4E7XA 1MSWD 1NZPA 4YN4A 1JQRA 8ICXA 3ZDCA 3MBYA 4HYKA 4P4MA 3ZDDA 2W8KA 3RB3A 3C1ZA 3KTQA 2ZTEA 1ZQOA 1EXNA 2C2EA 4NKTA 4PGQA 1VJ7A 5KFFA 4XQ8A 4EP7A 1U9LA 1ZQRA 5J2BA 4ED2A 4GLXA 3BQ0A 1UT5A 1U45A 4DF4A 3PX4A 1S0MA 4GXKA 3M8RA 5L1KA 3JPRA 1L3TA 1QSSA 3MABA 4X4NA 8ICZA 3ETLA 2P66A 2ZHAA 2HHSA 9ICKA 4ECQA 3RJGA 2Q0ZX 3H39A 4RZRA 2ZH3A 1KFDA 2HHQA 3V72A 4WC4A 2BGWA 4RNMA 3V7KA 4DOBA 2UVRA 4NLZA 2XY5A 3G6YA 5CB1A 4C8MA 2ZJ5A 4O3PA 3LWLA 4ED0A 4I2GA 1B22A 3C5GA 5BOMA 3OSNA 3C66A 2HHUA 2DVIA 4JUZA 2DPJA 2UVUA 1TFRA 1SL0A 7ICSA 3WFPA 2RFFA 1NK9A 4KLEA 4F91B 2ID1A 5DEDA 2HHXA 4E0DA 2ZH8A 5KG4A 5BPCA 4RNNA 4GC6A 2PI4A 1NK4A 1CUKA 4DSKA 1ZQVA 1A77A 4UQGA 4ELTA 3SZ2A 1RYRA 1L3UA 3PO5A 4EZ6A 4F4XA 4EBJA 3PX0A 4IQVA 2P6RA 4K4HA 5KG7A 2AU0A 1QSYA 4YQWA 3HX0A 5DLFA 4DF8A 2AQ0A 2C28A 4O9MA 8ICJA 4FHXA 1KRPA 5L1IA 4FBUA 4DL5A 3TAPA 1R8AA 8ICNA 4R63A 1ZQZA 2JZBA 2DPIA 1KTQA 4NY8A 2AJQA 1R89A 4RQ0A 4QWBA 4FHPA 3PR5B 4DLEA 1ZQMA 4X4QA 2ZH9A 2LYHA 5J2AA 5J0SA 1NKEA 3N97B 1BPYA 2HHVA 4O5KA 2HHTA 3GV5B 2ISPA 2R8KA 4ECTA 4F92B 2C2DA 4G3IA 1RPLA 2AGPA 1N48A 4AT9B 2MAXA 5J29A 2W8LA 2W9AA 3JPOA 4KTQA 2KN7A 4O3SA 3PNCA 1ZQDA 5DLGA 2XCPA 4UB5A 1ZQIA 3UQ2A 2R8HA 9ICFA 2NRZA 4YD2A 1TK8A 1MIVA 3RH4A 4P4OA 4AT7B 1K1SA 8ICRA 1Z00A 3OV7A 2BQ3A 1NK6A 4Z6DA 4UAWA 3H8WA 5CHGA 2W9CB 1ZQKA 4Q8EA 3TQ1A 1COOA 2PFNA 4YXJA 5KFYA 3C2KA 3SV4A 4KMUA 4DFMA 4I2EA 3OVSA 4DOAA 3MR6A 8ICUA 5KFVA 2BCUA 7ICTA 5KFWA 8ICBA 4DOCA 4F2RA 5CR0A 4F3OA 4O5CA 1NK8A 4YVZA 2DRAA 3C2LA 5EWGA 2F1HA 3N4MB 1H38A 1D9DA 2KFNA 9ICEA 4QZCA 3OGUA 2AGOA 2AGQA 1S97A 1L3SA 4DFPA 4NXZA 5J2IA 1T3NA 2V9WA 4B9SA 4Q45A 1SL1A 3RAQA 7ICMA 3H8JA 9ICWA 5DBCA 4UBCA 4F5PA 4TUQA 3RRHA 2V4QA 5DQIA 4IR1A 4X0BA 3GILA 3HT3A 3RBDA 5KG6A 4YMOA 4RU9A 1ZQCA 1UEVA 3AUOA 4KLMA 4QWCA 1BPEA 5HP4A 1WCLA 4F5RA 7ICQA 1S10A 2BR0A 3RJJA 5C5JA 5BOLA 1QTMA 1XC9A 2HHPA 9ICMA 3TARA 4YG2A 2XO7A 8ICWA 5DBAA 3BQ2A 3UQ0A 8ICLA 3JYYA 1Z3EB 1DOQA 3Q8PB 3B0XA 4ECXA 5HNKA 1KDHA 5HMMA 3RH5A 3L9DA 2B21A 4DS4A 4TUPA 2F1IA 4YMMA 3SV3A 1TK0A 2HHWA 3MR5A 4ELUA 2XCAA 1PX5A 2RDIA 5DDYA 3HW8A 2ISOA 4CCHA 4ECWA 4DSLA 4AT8A 4MF2A 4RUCA 5J0UA 3GIJA 1SL2A 1ZQYA 2ZUDA 7ICVA 3UXNA 5HMLA 4DS5A 1X9WA 2J6TA 1TV9A 1DK3A 1TFYA 5DG8A 2BPGA 3GIIA 2M2WA 4ECVA 9ICTA 2ZH1A 4RWNA 1TFWA 4RT2A 4EBDA 3EPIA 2M9NA 4R8UA 5KT4A 3H4BA 2H5XA 2JEGA 1FA0A 3PMLA 8ICQA 4J9KA 2VA8A 2ZJAA 4M9JA 3V6HA 4M6WA 1N56A 5J2GA 4M0AA 3E2EA 4X4UA 4PGYA 5DGAA 2XGQA 4DL6A 3RB6A 2ZUBA 5HRLA 3EYZA 3OVAA 4JWNA 4RQ1A 3PV8A 4DL4A 4JK1A 5CA7A 1XU4A 3NGDA 3T5HA 4KLUA 5KFQA 2BKEA 4Z6CA 1U48A 2J6SA 4RNOA 2NRXA 3Q8MA 8ICTA 4FS1A 4DQRA 4TQRA 1OU5A 1YLQA 2FPKA 3C23A 2M2TA 2ZH5A 5KFRA 4J9NA 4ELVA 4I2FA 4LZDA 4J9PA 4X4VA 9ICXA 2ASLA 4QZEA 1NK5A 2JEFA 4I29A 4EYHB 4WC3A 3GIKA 3HJ1A 4ECSA 3OUYB 5KFBA 5D4BA 3TANA 3PVXA 1XSLA 7ICGA 3JPTA 4ED8A 1NOMA 2KZMA 4ZH4A 1SKSA 4BXOB 1MQ3A 2FMSA 4QWDA 4I28A 4O5EA 4E80A 2O5AA 3NYBA 4UD4A 3FDSA 5KT3A 3JPSA 3RR7A 4EEYA 4BDPA 4X0AA 3FYHA 2DR9A 5J2KA 3H40A 1T4GA 4YCXA 5KG1A 1JMSA 2ZJ8A 4F4ZA 1BPZA 7ICRA 3Q8RB 2C2RA 4DL2A 1RXVA 4J9OA 3ISBA 1C7YA 2MUTB 2HVIA 1L5UA 2KTQA 1S9FA 1RZTA 9ICJA 4IQWA 3ORYA 5KTQA 4EBEA 1MC8A 1U4BA 2BDPA 4FH3A 3JZ0A 4DQQA 5DB9A 2BCVA 4GXIA 4ATBB 5F9LA 1ZQSA 4I2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO1 A;  1D8Y A;  4LVS A;  1ZJM A;  7ICL A;  3AQN A;  3GFK B;  3JPQ A;  9ICH A;  4JV1 A;  5HRF A;  3RR8 A;  4BWM A;  4ED3 A;  5IIL A;  2NRW A;  2WTF A;  2ZTD A;  1JN3 A;  4QZ9 A;  3TI0 A;  1TVA A;  4M47 A;  4FHW A;  4I2J A;  4FH5 A;  4TUS A;  4BWJ A;  4DLG A;  2VA2 A;  5KT2 A;  3RJK A;  7ICP A;  1BNO A;  1NK0 A;  2FMP A;  2BCQ A;  4M9N A;  3K75 D;  5KFL A;  4R64 A;  1L3V A;  2JEI A;  5KFZ A;  4YD1 A;  4IRC A;  1RYS A;  4GC7 A;  4EBC A;  2UVW A;  3AQL A;  5KFN A;  1X2I A;  4UBB A;  4F4W A;  4DO9 A;  7ICF A;  1QLN A;  2W9C A;  4WC6 A;  3ZDB A;  2Y1J A;  4RQ5 A;  3PW2 A;  2P6U A;  3Q8Q B;  1XWL A;  9ICL A;  5KFO A;  1CEZ A;  3PO4 A;  5KFM A;  4EBK A;  4P4P A;  2NRK A;  4QW8 A;  7ICI A;  1Q79 A;  1IXR A;  5J0Q A;  5HRE A;  1F5A A;  8ICG A;  3RAX A;  3H8S A;  4J9L A;  4EYI B;  9ICN A;  4RUA A;  4WCW A;  5KT7 A;  4C8O A;  4DWI A;  5HRK A;  2PBE A;  4XQ7 A;  4NKU A;  1S0O A;  4F8R A;  3EZ5 A;  2ZH7 A;  4I2A A;  1MIW A;  4UD5 A;  1UET A;  5DEC A;  3OHA A;  5F2V O;  1NK7 A;  3M9N B;  1DK2 A;  5KFA A;  4JV0 A;  4R66 A;  9ICB A;  4BGD A;  5D46 A;  7ICN A;  4B9M A;  1NJZ A;  1ZQB A;  1D9F A;  1S77 D;  4KLI A;  5J2E A;  3GV7 B;  7ICH A;  2O1P A;  3MR2 A;  5KT5 A;  5EWF A;  2NRT A;  4QWA A;  5KFE A;  1HUZ A;  2PFP A;  5TZV A;  2HVH A;  1KFT A;  4RWQ A;  5J0T A;  3RRG A;  3C21 A;  1VFG A;  2DRB A;  3ISC A;  5KFI A;  1Z00 B;  2IBK A;  4DQP A;  4MEY A;  4F4Y A;  5IIN A;  2BPF A;  1R8B A;  5CWR A;  4O3O A;  5DQH A;  1U49 A;  5DQG A;  4PHP A;  4KLT A;  5J0R A;  8ICE A;  2C22 A;  4Z6E A;  4KLG A;  3B0Y A;  1SKW A;  4ECU A;  1ZQJ A;  8ICC A;  5HHH A;  5KFX A;  4DSI A;  3UPS A;  4KLL A;  3PY8 A;  2R8I A;  3Q8L A;  5D49 A;  2DFL A;  3OHB A;  4ECZ A;  1T8E A;  1ZQQ A;  4B9T A;  4WC5 A;  3GDX A;  2ZH4 A;  4MF8 A;  2J6U A;  2DR7 A;  4QZB A;  4F4K A;  8ICH A;  5IIM A;  5HR9 A;  4PHE A;  3HIY A;  1LB2 B;  4E8F A;  3ZD8 A;  2PI5 A;  4XRH A;  5J0X A;  1D8L A;  3PR4 A;  3UXO A;  3LWM A;  1ZQG A;  3JPN A;  2M2U A;  4S3N A;  4YP3 A;  4QZG A;  2A1J B;  4PH5 A;  1R8C A;  4C8N A;  1IM4 A;  1KEJ A;  3PW4 A;  1ZQX A;  4F93 B;  3MR3 A;  3MDA A;  2OWO A;  3RJE A;  3RJF A;  4C8L A;  2XGP A;  2VA3 A;  3PW5 A;  4NM1 A;  3AQK A;  1QSL A;  4O0I A;  3Q8S B;  1HJP A;  1JXL A;  3RJI A;  3JPP A;  4QZI A;  7ICO A;  4QZA A;  3PMN A;  1S0V A;  3LDA A;  3Q8K A;  4M9H A;  1S76 D;  1SZP A;  3RTV A;  3THV A;  4GXJ A;  4WBZ A;  5IIO A;  1ZQH A;  1TAU A;  5KFK A;  4RQ3 A;  1NJY A;  4YMN A;  2ZUC A;  3H4D A;  1ZYQ A;  2FLN A;  5EWE A;  1ZJN A;  2IMW P;  4Q8F A;  4AT8 B;  3C1Y A;  1BVS A;  3HWT A;  3IM1 A;  3T5L A;  3QEA Z;  1UA0 A;  2R8J A;  3KHL A;  5L1L A;  5F9N A;  3WFS C;  4I27 A;  4O3R A;  4X4R A;  2JEJ A;  5KFG A;  5L1J A;  4ED6 A;  3PX6 A;  5KFC A;  1JX4 A;  2R8G A;  2W9B B;  3OVB A;  4QZF A;  2Y1I A;  4RQ4 A;  3RH6 A;  1XSP A;  4KLF A;  3EWA A;  5HRH A;  4I2B A;  3WFR E;  1ZET A;  3MGH A;  3UPQ A;  5KG0 A;  4QW9 A;  4M2Y A;  2KFZ A;  1TK5 A;  2BPC A;  4QZ8 A;  4RQ7 A;  4YR3 A;  4K4G A;  5HRI A;  4TUR A;  1X9M A;  5DDM A;  4MEX A;  8ICO A;  7ICE A;  4M6W B;  4KLS A;  4RPZ A;  2BE3 A;  8ICF A;  4UAY A;  4C8K A;  1UEU A;  4IRD A;  4I2I A;  5KG3 A;  4X4T A;  3MDC A;  9ICV A;  1LV5 A;  4WC2 A;  4B9V A;  5EOZ A;  2MUT A;  3SYZ A;  1KFS A;  4XUS A;  1X9S A;  3G6V A;  3IHQ B;  1JXE A;  8ICI A;  3MFH A;  3H7I A;  4PGX A;  4J9M A;  1WCN A;  2RDJ A;  1KSP A;  3G6X A;  4KLD A;  1ARO P;  2PXI A;  9ICA A;  2NRV A;  4ATB A;  4WC7 A;  4PHD A;  4O3Q A;  1BPB A;  1NJW A;  4NLN A;  1UA1 A;  1KNY A;  4PPX A;  3HPO A;  3V7J A;  1NKC A;  4JV2 A;  4EZ9 A;  1TKD A;  2ZHB A;  1HUO A;  4B9L A;  1PZN A;  4X4S A;  1A76 A;  4KIT B;  4ED7 A;  1NKB A;  4DQS A;  4KLH A;  4I2H A;  2VAN A;  3EW9 A;  2BQR A;  8ICS A;  3H37 A;  1RXW A;  4M5D A;  4RQ8 A;  4YXM A;  3GQC A;  2IHN A;  1ZQW A;  4DL7 A;  3KHG A;  2BQU A;  3AU2 A;  4QZD A;  1TAQ A;  5CP2 A;  4F5Q A;  2IA6 A;  5J2F A;  5KFJ A;  4RPY A;  4R65 A;  1JIH A;  4AT9 A;  8ICP A;  2ATL A;  2BCR A;  4RWP A;  1V9P A;  4YR0 A;  5KFP A;  4LZG A;  5JUM A;  5KG2 A;  4WC1 A;  3ZD9 A;  2KP7 A;  4AT7 A;  3C2M A;  5KG5 A;  4J9Q A;  2UVV A;  8ICA A;  3PW0 A;  4DEZ A;  4M9G A;  2ASD A;  4P2H A;  2BCS A;  3OSP A;  5HRD A;  5J0P A;  4DSF A;  3GIM A;  5HC9 A;  1ZQT A;  1JAJ A;  4XA5 A;  3T5J A;  5KFS A;  3V7L A;  4F5N A;  4DFJ A;  1BPX A;  8ICK A;  3C5F A;  2JZB B;  2FLL A;  4FBT A;  2KZZ A;  4IRK A;  3V6K A;  4DL3 A;  4KLO A;  2FPM A;  4IG8 A;  4IQU A;  4F5O A;  3TFS A;  4X5V A;  5HRG A;  2GWS A;  4FHY A;  1ZQP A;  2ASJ A;  4M04 A;  5J2C A;  9ICQ A;  5DKW A;  4J9S A;  3BQT A;  4ECR A;  4ED1 A;  3BQ1 A;  4B9U A;  5J2J A;  4LT6 A;  4X4O A;  3AQM A;  3NTU A;  5KFU A;  4UB4 A;  2XC9 A;  2ALZ A;  5KFT A;  2AQ4 A;  2PFQ A;  3WFQ E;  4QWE A;  2BHN A;  3K4G A;  4RQ2 A;  5KT6 A;  1Q78 A;  4O3N A;  9ICS A;  2FMQ A;  4YFK A;  5J0W A;  4RT3 A;  3H3A A;  2DR5 A;  1ZQN A;  2FLP A;  3ZDA A;  1UT8 A;  5IIK A;  2PFO A;  4JWM A;  2ZH6 A;  2Q66 A;  2FPL A;  9ICU A;  5DG7 A;  7ICK A;  1WOT A;  4QZH A;  3HJ4 A;  4J9R A;  3MFI A;  2I9G A;  4KLJ A;  1T7P A;  5DGB A;  3T3F A;  1MQ2 A;  4MFF A;  2DR8 A;  1V4A A;  5DB6 A;  4IQT A;  3KHH A;  4IR9 A;  4B9N A;  1ZQL A;  4NLG A;  5J2D A;  3M9M B;  4NLK A;  3ZDE A;  1K1Q A;  4YR2 A;  3M8S A;  4DQI A;  4NM2 A;  4KN4 A;  4Q43 A;  1XSN A;  1S0N A;  4RPX A;  3TAQ A;  9ICC A;  1NJX A;  2V4R A;  4UB2 A;  3RB0 A;  3MGI A;  3OJS A;  4FS2 A;  3OJU A;  9ICR A;  3TFR A;  4RQ6 A;  2ZTC A;  3QZ7 A;  2A1J A;  5DG9 A;  4F50 A;  4Q44 A;  3EPG A;  4FO6 A;  4DSE A;  2XY7 A;  1U47 A;  3RBE A;  3GV8 B;  9ICI A;  5L9X A;  4FHV A;  3RB4 A;  3RJH A;  2F1J A;  3QEB Z;  3C18 A;  1DGS A;  2HW3 A;  9ICO A;  3BDP A;  7ICU A;  2KZ3 A;  3KHR A;  1ZQE A;  4WBY A;  1ZQU A;  5III A;  5DB7 A;  5DBB A;  4K4I A;  7ICJ A;  3H38 A;  4UB3 A;  3PW7 A;  8ICV A;  2M2V A;  4WC0 A;  3LK9 A;  3WFO A;  1BGX T;  4MFA A;  3SI8 A;  5KFD A;  2XY6 A;  1SKR A;  4DSJ A;  4PHA A;  2W9M A;  1ZQF A;  2IHM A;  3UXP A;  4ECY A;  4MFC A;  5J0Y A;  2ZH2 A;  3LQC B;  1NO5 A;  1BNP A;  3HP6 A;  9ICP A;  1Y88 A;  2I1Q A;  3QZ8 A;  1ZQA A;  8ICM A;  1KLN A;  4M9L A;  4X4P A;  4Z6F A;  8ICY A;  5KFH A;  1BPD A;  4TQS A;  4KLQ A;  2W9B A;  5IIJ A;  5CJ7 A;  4I2D A;  4KN7 A;  3M9O B;  3ISD A;  3T5K A;  3V6J A;  1B43 A;  5HHI A;  4DFK A;  3AU6 A;  3QE9 Y;  4F2S A;  9ICG A;  3OUY A;  1XS9 D;  5DB8 A;  4RWO A;  4BXO A;  1MIY A;  3BJY A;  5HRB A;  4R8U B;  5J2H A;  4UAZ A;  4UB1 A;  5J0O A;  4E7X A;  1MSW D;  1NZP A;  4YN4 A;  1JQR A;  8ICX A;  3ZDC A;  3MBY A;  4HYK A;  4P4M A;  3ZDD A;  2W8K A;  3RB3 A;  3C1Z A;  3KTQ A;  2ZTE A;  1ZQO A;  1EXN A;  2C2E A;  4NKT A;  4PGQ A;  1VJ7 A;  5KFF A;  4XQ8 A;  4EP7 A;  1U9L A;  1ZQR A;  5J2B A;  4ED2 A;  4GLX A;  3BQ0 A;  1UT5 A;  1U45 A;  4DF4 A;  3PX4 A;  1S0M A;  4GXK A;  3M8R A;  5L1K A;  3JPR A;  1L3T A;  1QSS A;  3MAB A;  4X4N A;  8ICZ A;  3ETL A;  2P66 A;  2ZHA A;  2HHS A;  9ICK A;  4ECQ A;  3RJG A;  2Q0Z X;  3H39 A;  4RZR A;  2ZH3 A;  1KFD A;  2HHQ A;  3V72 A;  4WC4 A;  2BGW A;  4RNM A;  3V7K A;  4DOB A;  2UVR A;  4NLZ A;  2XY5 A;  3G6Y A;  5CB1 A;  4C8M A;  2ZJ5 A;  4O3P A;  3LWL A;  4ED0 A;  4I2G A;  1B22 A;  3C5G A;  5BOM A;  3OSN A;  3C66 A;  2HHU A;  2DVI A;  4JUZ A;  2DPJ A;  2UVU A;  1TFR A;  1SL0 A;  7ICS A;  3WFP A;  2RFF A;  1NK9 A;  4KLE A;  4F91 B;  2ID1 A;  5DED A;  2HHX A;  4E0D A;  2ZH8 A;  5KG4 A;  5BPC A;  4RNN A;  4GC6 A;  2PI4 A;  1NK4 A;  1CUK A;  4DSK A;  1ZQV A;  1A77 A;  4UQG A;  4ELT A;  3SZ2 A;  1RYR A;  1L3U A;  3PO5 A;  4EZ6 A;  4F4X A;  4EBJ A;  3PX0 A;  4IQV A;  2P6R A;  4K4H A;  5KG7 A;  2AU0 A;  1QSY A;  4YQW A;  3HX0 A;  5DLF A;  4DF8 A;  2AQ0 A;  2C28 A;  4O9M A;  8ICJ A;  4FHX A;  1KRP A;  5L1I A;  4FBU A;  4DL5 A;  3TAP A;  1R8A A;  8ICN A;  4R63 A;  1ZQZ A;  2JZB A;  2DPI A;  1KTQ A;  4NY8 A;  2AJQ A;  1R89 A;  4RQ0 A;  4QWB A;  4FHP A;  3PR5 B;  4DLE A;  1ZQM A;  4X4Q A;  2ZH9 A;  2LYH A;  5J2A A;  5J0S A;  1NKE A;  3N97 B;  1BPY A;  2HHV A;  4O5K A;  2HHT A;  3GV5 B;  2ISP A;  2R8K A;  4ECT A;  4F92 B;  2C2D A;  4G3I A;  1RPL A;  2AGP A;  1N48 A;  4AT9 B;  2MAX A;  5J29 A;  2W8L A;  2W9A A;  3JPO A;  4KTQ A;  2KN7 A;  4O3S A;  3PNC A;  1ZQD A;  5DLG A;  2XCP A;  4UB5 A;  1ZQI A;  3UQ2 A;  2R8H A;  9ICF A;  2NRZ A;  4YD2 A;  1TK8 A;  1MIV A;  3RH4 A;  4P4O A;  4AT7 B;  1K1S A;  8ICR A;  1Z00 A;  3OV7 A;  2BQ3 A;  1NK6 A;  4Z6D A;  4UAW A;  3H8W A;  5CHG A;  2W9C B;  1ZQK A;  4Q8E A;  3TQ1 A;  1COO A;  2PFN A;  4YXJ A;  5KFY A;  3C2K A;  3SV4 A;  4KMU A;  4DFM A;  4I2E A;  3OVS A;  4DOA A;  3MR6 A;  8ICU A;  5KFV A;  2BCU A;  7ICT A;  5KFW A;  8ICB A;  4DOC A;  4F2R A;  5CR0 A;  4F3O A;  4O5C A;  1NK8 A;  4YVZ A;  2DRA A;  3C2L A;  5EWG A;  2F1H A;  3N4M B;  1H38 A;  1D9D A;  2KFN A;  9ICE A;  4QZC A;  3OGU A;  2AGO A;  2AGQ A;  1S97 A;  1L3S A;  4DFP A;  4NXZ A;  5J2I A;  1T3N A;  2V9W A;  4B9S A;  4Q45 A;  1SL1 A;  3RAQ A;  7ICM A;  3H8J A;  9ICW A;  5DBC A;  4UBC A;  4F5P A;  4TUQ A;  3RRH A;  2V4Q A;  5DQI A;  4IR1 A;  4X0B A;  3GIL A;  3HT3 A;  3RBD A;  5KG6 A;  4YMO A;  4RU9 A;  1ZQC A;  1UEV A;  3AUO A;  4KLM A;  4QWC A;  1BPE A;  5HP4 A;  1WCL A;  4F5R A;  7ICQ A;  1S10 A;  2BR0 A;  3RJJ A;  5C5J A;  5BOL A;  1QTM A;  1XC9 A;  2HHP A;  9ICM A;  3TAR A;  4YG2 A;  2XO7 A;  8ICW A;  5DBA A;  3BQ2 A;  3UQ0 A;  8ICL A;  3JYY A;  1Z3E B;  1DOQ A;  3Q8P B;  3B0X A;  4ECX A;  5HNK A;  1KDH A;  5HMM A;  3RH5 A;  3L9D A;  2B21 A;  4DS4 A;  4TUP A;  2F1I A;  4YMM A;  3SV3 A;  1TK0 A;  2HHW A;  3MR5 A;  4ELU A;  2XCA A;  1PX5 A;  2RDI A;  5DDY A;  3HW8 A;  2ISO A;  4CCH A;  4ECW A;  4DSL A;  4AT8 A;  4MF2 A;  4RUC A;  5J0U A;  3GIJ A;  1SL2 A;  1ZQY A;  2ZUD A;  7ICV A;  3UXN A;  5HML A;  4DS5 A;  1X9W A;  2J6T A;  1TV9 A;  1DK3 A;  1TFY A;  5DG8 A;  2BPG A;  3GII A;  2M2W A;  4ECV A;  9ICT A;  2ZH1 A;  4RWN A;  1TFW A;  4RT2 A;  4EBD A;  3EPI A;  2M9N A;  4R8U A;  5KT4 A;  3H4B A;  2H5X A;  2JEG A;  1FA0 A;  3PML A;  8ICQ A;  4J9K A;  2VA8 A;  2ZJA A;  4M9J A;  3V6H A;  4M6W A;  1N56 A;  5J2G A;  4M0A A;  3E2E A;  4X4U A;  4PGY A;  5DGA A;  2XGQ A;  4DL6 A;  3RB6 A;  2ZUB A;  5HRL A;  3EYZ A;  3OVA A;  4JWN A;  4RQ1 A;  3PV8 A;  4DL4 A;  4JK1 A;  5CA7 A;  1XU4 A;  3NGD A;  3T5H A;  4KLU A;  5KFQ A;  2BKE A;  4Z6C A;  1U48 A;  2J6S A;  4RNO A;  2NRX A;  3Q8M A;  8ICT A;  4FS1 A;  4DQR A;  4TQR A;  1OU5 A;  1YLQ A;  2FPK A;  3C23 A;  2M2T A;  2ZH5 A;  5KFR A;  4J9N A;  4ELV A;  4I2F A;  4LZD A;  4J9P A;  4X4V A;  9ICX A;  2ASL A;  4QZE A;  1NK5 A;  2JEF A;  4I29 A;  4EYH B;  4WC3 A;  3GIK A;  3HJ1 A;  4ECS A;  3OUY B;  5KFB A;  5D4B A;  3TAN A;  3PVX A;  1XSL A;  7ICG A;  3JPT A;  4ED8 A;  1NOM A;  2KZM A;  4ZH4 A;  1SKS A;  4BXO B;  1MQ3 A;  2FMS A;  4QWD A;  4I28 A;  4O5E A;  4E80 A;  2O5A A;  3NYB A;  4UD4 A;  3FDS A;  5KT3 A;  3JPS A;  3RR7 A;  4EEY A;  4BDP A;  4X0A A;  3FYH A;  2DR9 A;  5J2K A;  3H40 A;  1T4G A;  4YCX A;  5KG1 A;  1JMS A;  2ZJ8 A;  4F4Z A;  1BPZ A;  7ICR A;  3Q8R B;  2C2R A;  4DL2 A;  1RXV A;  4J9O A;  3ISB A;  1C7Y A;  2MUT B;  2HVI A;  1L5U A;  2KTQ A;  1S9F A;  1RZT A;  9ICJ A;  4IQW A;  3ORY A;  5KTQ A;  4EBE A;  1MC8 A;  1U4B A;  2BDP A;  4FH3 A;  3JZ0 A;  4DQQ A;  5DB9 A;  2BCV A;  4GXI A;  4ATB B;  5F9L A;  1ZQS A;  4I2C A; 
#chains in the Genus database with same CATH topology
 3VC8 A;  1XO1 A;  5KL1 B;  1ZJM A;  4IL6 U;  2YMQ A;  4OD0 A;  2WTF A;  4I0U A;  3AN1 A;  4KB6 A;  4I2J A;  4FH5 A;  4BWJ A;  5KT2 A;  2G07 A;  2OYY A;  1NK0 A;  3WKC A;  3K75 D;  5KFZ A;  4US8 A;  4EBC A;  1PK1 A;  4UBB A;  4F4W A;  1QLN A;  3ZDB A;  2FI1 A;  4EBK A;  5KFM A;  2DL0 A;  3PSF A;  4P4P A;  7ICI A;  3KKA C;  1F5A A;  3RAX A;  1J2N A;  4J9L A;  2XVT A;  4NKU A;  4RUA A;  5KT7 A;  4C8O A;  4XQ7 A;  2E5S A;  5AKH A;  5F2V O;  1NK7 A;  3BZK A;  2W3R A;  1XO0 A;  1P7D A;  4R66 A;  4BGD A;  3ED5 A;  1ZQB A;  2JXJ A;  7ICH A;  5J2E A;  1PVR A;  2DUY A;  4QWA A;  2H3Q A;  1HUZ A;  4FO1 A;  1KFT A;  5TZV A;  4DQP A;  2G09 A;  1F44 A;  4Y2J A;  4KLT A;  2C22 A;  4KLG A;  1SKW A;  3AL0 B;  3PY8 A;  2R8I A;  3OHB A;  1SZH A;  4MF8 A;  4F4K A;  1COK A;  8ICH A;  3HIY A;  3H0M B;  3VCB A;  4UAR A;  1RG6 A;  1ZQG A;  1D8L A;  2M2U A;  4PH5 A;  1IM4 A;  2OM6 A;  3PW4 A;  4PZN A;  4F93 B;  3MDA A;  3RJF A;  5KNI A;  3NVV A;  3PW5 A;  3AQK A;  2ESE A;  4QZI A;  2QLT A;  1S0V A;  1L7P A;  3Q8K A;  3GZF A;  4WBZ A;  5IIO A;  2ZUC A;  3H4D A;  2FLN A;  4AT8 B;  2R8J A;  5F9N A;  4OO1 J;  5ALV A;  2JEJ A;  1JX4 A;  2Y0S F;  3CW2 C;  5HR7 A;  3OVB A;  3K1Z A;  1XSP A;  4KLF A;  3EWA A;  1B0X A;  3UPQ A;  5KG0 A;  4M2Y A;  2WAQ F;  2BPC A;  2AH5 A;  1ZOL A;  4MEX A;  5AI8 A;  4M6W B;  2BE3 A;  2JV3 A;  1WWU A;  4C8K A;  1UEU A;  1RDF A;  4I2I A;  4UAV A;  2G5H B;  9ICV A;  3J81 j;  1Q8K A;  5EOZ A;  3SYZ A;  2VJ4 A;  3KD3 A;  4J9M A;  4ACO A;  2K4I A;  5GTH U;  4PHD A;  4O3Q A;  5ALH A;  4NLN A;  4FZL A;  3HPO A;  4EZ9 A;  2PMZ C;  8ICS A;  1RXW A;  4NL9 A;  4YXM A;  3NRZ A;  2IHN A;  3ER8 C;  4RPY A;  4R65 A;  2F44 A;  4RQN A;  3QU4 A;  2ATL A;  2K8B B;  5JUM A;  2LM4 A;  2KP7 A;  4P2H A;  2KNJ A;  4UAS A;  1VDV A;  3KFU F;  2HBJ A;  3T5J A;  3V7L A;  4J03 A;  1ZD2 P;  8ICK A;  2JZB B;  2FLL A;  4IRK A;  4DL3 A;  4F5O A;  3TFS A;  4X5V A;  2H3Z A;  5AKG A;  1N63 A;  2I5H A;  3BQ1 A;  5J2J A;  4U6P A;  2ALZ A;  5KFT A;  2BHN A;  2FMQ A;  2DR5 A;  1ZQN A;  1WOT A;  2P35 A;  1T7P A;  5AM3 A;  3KHH A;  1ZQL A;  4NLG A;  5J2D A;  2YMP A;  4DQI A;  1XSN A;  1OXJ A;  3TAQ A;  2RHF A;  2KV2 A;  4UB2 A;  2GOL A;  4US9 A;  1RYU A;  4F50 A;  1SWV A;  4OJ5 A;  3MGV A;  1NKC A;  4Q44 A;  3EPG A;  1U47 A;  4FHV A;  2HW3 A;  2Q4T A;  4QJF B;  5K4L A;  5DB7 A;  4K4I A;  7ICJ A;  2E8P A;  4UB3 A;  8ICV A;  3WFO A;  3WKB A;  3LK9 A;  2FE9 A;  2KKV A;  1SKR A;  3WK9 A;  3LQC B;  3HP6 A;  4K8V A;  1ZQA A;  5ALG A;  4M9L A;  4AYB F;  2B4V A;  5CHE A;  1BPD A;  5CJ7 A;  4I2D A;  4KN7 A;  4DFK A;  3OUY A;  1B43 A;  3CK6 A;  5DB8 A;  4BXO A;  1MIY A;  2WB1 C;  1SXD A;  4R8U B;  2QKQ A;  1B4F A;  5AKX A;  3MBY A;  4P0Q B;  4P4M A;  2CN1 A;  3ZDD A;  4EX6 A;  3C1Z A;  3KTQ A;  1EXN A;  1VJ7 A;  5KFF A;  3T79 A;  4EP7 A;  2GH1 A;  4JLX A;  1ZQR A;  2N1R A;  3BQ0 A;  1UT5 A;  3SEN A;  9ICE A;  3M8R A;  4GIB A;  8ICZ A;  3ETL A;  5AIA A;  2HHS A;  3RJG A;  3SAH A;  2Q0Z X;  2ZH3 A;  5ALN A;  4RNM A;  2YX8 A;  3V7K A;  4O3M A;  1B22 A;  4C8M A;  3LWL A;  3CRX A;  2BDU A;  2RFF A;  4KLE A;  2DGZ A;  1NK4 A;  4EEN A;  3H8M A;  1RYR A;  3PO5 A;  4F4X A;  3PX0 A;  5KG7 A;  3HX0 A;  4DF8 A;  3KKA A;  2C28 A;  2JMG A;  2JZB A;  4NY8 A;  4CNQ A;  4DLE A;  5J0S A;  2R8K A;  1Z19 A;  4C4R A;  1N48 A;  2W8L A;  2WF6 A;  4O3S A;  4Y2V A;  2NRZ A;  4YD2 A;  1TK8 A;  4AT7 B;  5AKZ A;  4Z6D A;  2W9C B;  4YXJ A;  1LKY B;  4DFM A;  3OVS A;  1T94 A;  5CR0 A;  4F3O A;  4O69 A;  4O5C A;  5AKY A;  2DRA A;  3C2L A;  2G0A A;  3D2Q A;  1X6I A;  3OGU A;  2AGO A;  2AGQ A;  1L3S A;  1T3N A;  4NXZ A;  3RAQ A;  3FAH A;  4UBC A;  2K89 A;  3GIL A;  3HT3 A;  4YMO A;  4KLM A;  1S10 A;  5BOL A;  2HHP A;  1XC9 A;  2XO7 A;  3BQ2 A;  3UQ0 A;  3IN5 A;  4ZOH C;  5AKI A;  1DOQ A;  2G06 A;  4ECX A;  3KBB A;  1JAL A;  1J97 A;  4DS4 A;  2CRX A;  2F1I A;  3RF9 A;  4YMM A;  4NXU A;  1TK0 A;  2HHW A;  2NO4 A;  4EGW A;  1PX5 A;  4CCH A;  3NVO A;  5AI6 A;  3SAF A;  4RUC A;  7ICV A;  1SL2 A;  3UXN A;  5HML A;  4DS5 A;  2EAN A;  2M2W A;  4ECV A;  1TFW A;  4EBD A;  2M9N A;  4R8U A;  5KT4 A;  1FA0 A;  1FO4 A;  4EED A;  5CFS A;  4M0A A;  2ZIX B;  2KG5 A;  3RB6 A;  2EZY A;  2ZUB A;  3EYZ A;  1IV8 A;  5AI5 A;  4DL4 A;  1XU4 A;  3T5H A;  5KFQ A;  4FS1 A;  2FPK A;  5D63 A;  2KOB A;  2IOH A;  4ELV A;  4LZD A;  2HI0 A;  4J9P A;  9ICX A;  4QZE A;  4I29 A;  4EYH B;  2E8O A;  5D4B A;  4PJ0 U;  1NOM A;  4ZH4 A;  3MCR A;  4K98 A;  3PSI A;  4QWD A;  4I28 A;  5AKJ A;  4UD4 A;  5KT3 A;  3RR7 A;  4X0A A;  3FYH A;  3N28 A;  4YCX A;  2ZH7 A;  4NKT A;  1F0M A;  2KHV A;  3UM9 A;  7ICR A;  3Q8R B;  4J9O A;  1C7Y A;  2JH7 A;  1IIP A;  3ORY A;  4UB6 U;  4FH3 A;  5JTI A;  2WAQ C;  3JZ0 A;  5DB9 A;  2EDU A;  1KN5 A;  1ZQS A;  3GU3 A;  1D8B A;  2YQE A;  3EUB 2;  4QIW F;  9ICH A;  4JV1 A;  4ED3 A;  3TKA A;  4TUS A;  3RJK A;  1ZRM A;  1QQ6 A;  2BCQ A;  2FMP A;  5ALW A;  5C0Y A;  2DF4 B;  4K96 A;  1FFU A;  5ALR A;  3AQL A;  5CFU A;  4DO9 A;  2W9C A;  5TIS U;  3PW2 A;  9ICL A;  1XWL A;  5KFO A;  1CEZ A;  1LKY A;  4UB8 U;  4OAH A;  2KJ5 A;  5E79 U;  5HRE A;  3H8S A;  2G5I B;  2PBE A;  5AI0 A;  4DWI A;  2Y9T A;  4NXX A;  1S0O A;  4EEB A;  1MIW A;  3OHA A;  3M9N B;  1DK2 A;  3QU5 A;  5D46 A;  1NJZ A;  1D9F A;  1S77 D;  3GV7 B;  5EWF A;  2PFP A;  5J0T A;  3C21 A;  3I28 A;  5KFI A;  2IBK A;  4F4Y A;  3WK4 A;  1R8B A;  5CWR A;  5DQH A;  5DQG A;  2K4E A;  4ECU A;  3UPS A;  4KLL A;  3Q8L A;  2DFL A;  3IV6 A;  1T8E A;  4WC5 A;  3GDX A;  4A8E A;  3ZD8 A;  4XRH A;  2E8M A;  3LWM A;  4YP3 A;  3WK7 A;  4QZG A;  1R8C A;  1KEJ A;  2KJ8 A;  2GAF D;  3RJE A;  3MR3 A;  4CRX A;  4C8L A;  4O68 A;  2VA3 A;  2ZIX A;  3Q8S B;  1HJP A;  2D3D A;  3RJI A;  3JPP A;  2KIW A;  4QZA A;  1SZP A;  3DV9 A;  3THV A;  5ALD A;  3NVY A;  4YMN A;  1NJY A;  2KSO B;  5EWE A;  2IMW P;  1BVS A;  1JUD A;  3IRU A;  3KHL A;  5L1J A;  3QNM A;  3PX6 A;  4OAI Z;  2R8G A;  2OH2 A;  4QZF A;  2Y1I A;  1PK3 A;  4I2B A;  1TK5 A;  5DDM A;  8ICO A;  7ICE A;  4KLS A;  4RPZ A;  3L5K A;  2YN4 A;  1QH9 A;  4HX0 A;  1KFS A;  1N2X A;  3G6V A;  3IHQ B;  5FP0 A;  5AI9 A;  3WK6 A;  3MFH A;  2RDJ A;  4KLD A;  2NRV A;  1UA1 A;  1KNY A;  4PPX A;  3AEV A;  2D6F C;  1HUO A;  4B9L A;  4JLZ A;  1A76 A;  5JTG A;  2WFA A;  3QUC A;  4I2H A;  4AP9 A;  3NVZ A;  4UAU A;  4RQ8 A;  2YML A;  1O08 A;  3GQC A;  1ZQW A;  2O6K A;  4DL7 A;  1TAQ A;  5CP2 A;  2IA6 A;  5J2F A;  5KFJ A;  1JIH A;  4AT9 A;  4YR0 A;  1JRP A;  5KFP A;  5HRD A;  4M9G A;  1DRG A;  3F53 A;  3GIM A;  2A19 A;  2ZIV B;  1JAJ A;  2AHO B;  1SV0 C;  5AK6 A;  5KFS A;  2KZZ A;  4FBT A;  4KLO A;  4NLB A;  4IG8 A;  1S5L U;  4FHY A;  2ASJ A;  9ICQ A;  4ECR A;  2LHT A;  3BQT A;  4ED1 A;  4X4O A;  4UB4 A;  2PFQ A;  4QWE A;  1Q78 A;  1N62 A;  2OCE A;  4YFK A;  3H3A A;  1Z1B A;  5ALZ A;  2FLP A;  1UT8 A;  4HAI A;  4JWM A;  4CDG A;  5DG7 A;  5AI4 A;  2I9G A;  4KX3 A;  3T3F A;  1V4A A;  2KEY A;  4IQT A;  3M8S A;  3F5A A;  1S0N A;  4RPX A;  2V4R A;  3AQE A;  3I1Y A;  3OJU A;  2ZTC A;  3L4P A;  4DSE A;  1M6Y A;  5L9X A;  3UMG A;  1Q3U A;  2F1J A;  3QEB Z;  9ICO A;  2MRL A;  3NKU A;  3KOO A;  3BDP A;  7ICU A;  2KZ3 A;  3NWI A;  1ZQU A;  3PW7 A;  1BGX T;  3SI8 A;  5KFD A;  2W9M A;  2LKY A;  2E1F A;  2KSO A;  5AM2 A;  3PST A;  8ICM A;  3U26 A;  1PUZ A;  4Z6F A;  8ICY A;  5AIC A;  5KFH A;  3A0H U;  4C4S A;  2GLE A;  4KLQ A;  2DKX A;  2IUB A;  4F2S A;  3AU6 A;  3QE9 Y;  4CE6 A;  5CFT A;  4RWO A;  5EE0 A;  3D2N A;  5HRB A;  2W11 A;  5J2H A;  4UB1 A;  1JQR A;  3PHZ A;  3ZDC A;  2ES6 A;  2ZTE A;  3F2D A;  4PGQ A;  1SGG A;  4MKP A;  1JRO A;  2KMD A;  2LM1 A;  4K9A A;  1U9L A;  4ED2 A;  3WKE A;  1U45 A;  5ALK A;  4DF4 A;  1V97 A;  4GXK A;  3PX4 A;  4WC3 A;  3MAB A;  3HRD D;  4EEL A;  2P66 A;  9ICK A;  3H39 A;  2PKE A;  2EZZ A;  2XY5 A;  4ED0 A;  5CB1 A;  5BOM A;  3OSN A;  3L3F X;  3C66 A;  3OWG A;  2HHU A;  2DVI A;  2DPJ A;  3QUQ A;  5H2F U;  3ETR A;  5DED A;  2ZH8 A;  2NV3 A;  5BPC A;  4GC6 A;  1CUK A;  4C4T A;  1URJ A;  1ZD5 A;  4EBJ A;  2AU0 A;  4FHX A;  2ZIV A;  2AQ0 A;  3M6K A;  4JB3 A;  3WKA A;  4R63 A;  3PR5 B;  1SWW A;  2ZH9 A;  3HKZ F;  5J2A A;  3IDW A;  2HHT A;  3DEE A;  3GV5 B;  2ISP A;  4F92 B;  2C2D A;  3PNC A;  2R8H A;  3RH4 A;  5ALI A;  8ICR A;  1YZ7 A;  1YZ6 A;  1NK6 A;  4UAW A;  1ZQK A;  3TQ1 A;  1COO A;  2PFN A;  3MR6 A;  2BCU A;  7ICT A;  1S8O A;  3KZI U;  2FJ6 A;  1NK8 A;  3N4M B;  2KFN A;  4QZC A;  2HDO A;  1S97 A;  3WU2 U;  5J2I A;  4DFP A;  4B9S A;  4Q45 A;  7ICM A;  9ICW A;  5DBC A;  4F5P A;  5AK4 A;  3RRH A;  5DQI A;  4X0B A;  3F2C A;  3SR6 A;  1KBU A;  4RU9 A;  1BPE A;  7ICQ A;  3LVW A;  2BR0 A;  4OJL A;  3RJJ A;  1QTM A;  9ICM A;  1Z3E B;  1Z1V A;  3L9D A;  3SV3 A;  1N5X A;  1WYG A;  4NWI A;  4ELU A;  4WQK A;  2ISO A;  4ECW A;  4AT8 A;  1RM6 C;  4C7Z A;  4MHV A;  2E1E A;  2H3F A;  1TV9 A;  1DK3 A;  1TFY A;  1AQ6 A;  3GII A;  2ZH1 A;  9ICT A;  2EZX A;  4RT2 A;  2WHE A;  2H5X A;  3SMV A;  4M6W A;  5ALU A;  5J2G A;  3E2E A;  5DGA A;  5B3P A;  2IOF A;  2RLT A;  3ZI4 A;  3R9K A;  3OVA A;  4JWN A;  3PV8 A;  4NXW A;  2BKE A;  2FDR A;  1YLQ A;  4OCZ A;  2G08 A;  1OU5 A;  3C23 A;  3NS1 A;  4NV0 A;  2W04 A;  5KFR A;  1QCK A;  2ASL A;  5HR6 A;  3HJ1 A;  4ECS A;  2HOI A;  3TAN A;  4ED8 A;  3UMB A;  1SKS A;  1MQ3 A;  4O5E A;  4E80 A;  3NYB A;  2LYA A;  2CXY A;  4BDP A;  1T4G A;  1BPZ A;  4F4Z A;  2ZJ8 A;  3E0F A;  5ALT A;  2MUT B;  1S9F A;  1L8L A;  2EQY A;  5F3X B;  4EBE A;  3AQF A;  1QQ5 A;  2BCV A;  4BX9 C;  1SV0 A;  1GPJ A;  3TAD C;  2B6G A;  3AQN A;  5EE9 A;  3GFK B;  3JPQ A;  3ONN A;  5HRF A;  3K1R B;  3RR8 A;  2Z7J A;  2H3I A;  1KW4 A;  4BWM A;  5IIL A;  2NRW A;  4FHW A;  1JN3 A;  4QZ9 A;  4XJE A;  1Z4N A;  2VA2 A;  1BNO A;  2LYB A;  4Y2T A;  5KFL A;  1LVH A;  1L3V A;  2XIC A;  3OPX A;  1OW5 A;  4YD1 A;  4IRC A;  1RYS A;  4GC7 A;  2UVW A;  5KFN A;  7ICF A;  2Y1J A;  2P6U A;  3Q8Q B;  5L1M A;  3M6Z A;  3PO4 A;  2NRK A;  5AM5 A;  1Q79 A;  5J0Q A;  1Z4O A;  2QB1 A;  4EYI B;  4OJ6 A;  3MC1 A;  3EZ5 A;  3CNH A;  4I2A A;  5DEC A;  3KZX A;  5CEH A;  4JV0 A;  9ICB A;  2ZG6 A;  1FEZ A;  1C20 A;  4KLI A;  2VJ5 A;  3MR2 A;  2RQ5 A;  1OUQ A;  2NRT A;  5KFE A;  3CYM A;  4RWQ A;  3RRG A;  3ISC A;  1Z00 B;  1CRX A;  5IIN A;  5KAI U;  2BPF A;  3E58 A;  2FCL A;  4O3O A;  8ICE A;  4Z6E A;  3B0Y A;  1ZQJ A;  5KFX A;  4DSI A;  5D49 A;  4ECZ A;  1FFV A;  2J6U A;  2DR7 A;  3QUB A;  4QZB A;  4PHE A;  4P0P B;  5J0X A;  3PR4 A;  3JPN A;  1ZD3 A;  2K8C B;  3HIL A;  4DFD A;  2WF7 A;  2XGP A;  4NM1 A;  2E8N A;  1QSL A;  2LBO A;  4P0Q A;  2F8K A;  4WH5 A;  2L5Y A;  5EE3 A;  3PMN A;  1S76 D;  3RTV A;  5ALY A;  5ALS A;  1ZQH A;  5KFK A;  4RQ3 A;  2J6S A;  1ZYQ A;  3FM9 A;  1ZJN A;  4Q8F A;  3C1Y A;  3WFS C;  5L1L A;  4O3R A;  4X4R A;  5KFG A;  5KFC A;  2A1A A;  5T14 A;  5ALQ A;  1FIQ A;  5JU5 A;  5HRH A;  3WFR E;  3MGH A;  2KFZ A;  5HRI A;  2QB0 B;  4QZ8 A;  4YR3 A;  1X9M A;  8ICF A;  4QNL A;  4IRD A;  3DDH A;  2HOQ A;  3MDC A;  1LV5 A;  4WC2 A;  2MUT A;  1JXE A;  2Y0S C;  1KSP A;  1QQ7 A;  4WQL A;  1ARO P;  2PXI A;  4WC7 A;  1NJW A;  3V7J A;  4JV2 A;  4X4S A;  1PZN A;  4BUG A;  4DQS A;  4KLH A;  2VAN A;  4N7R A;  3H37 A;  5B5E U;  2BQU A;  3A0B U;  5AIB A;  3K7D A;  8ICP A;  4RWP A;  4KX5 A;  2WF8 A;  4C0Z A;  1DGJ A;  4WC1 A;  3ZD9 A;  4AT7 A;  4IC9 A;  5KG5 A;  2UVV A;  8ICA A;  3OSP A;  1ZQT A;  4XA5 A;  3IG8 A;  2FPM A;  4Y2U A;  2F76 X;  5J2C A;  5DKW A;  4J9S A;  3AQM A;  5KFU A;  1O03 A;  3WFQ E;  4OAG A;  3ERC C;  4CF5 A;  9ICS A;  4PZO A;  5J0W A;  4RT3 A;  1UCV A;  2ZH6 A;  3HKZ C;  9ICU A;  7ICK A;  3HJ4 A;  4QZH A;  3F5E A;  4MFF A;  5DB6 A;  4IR9 A;  4NLK A;  3ZDE A;  1WWV A;  4YR2 A;  5B3Q A;  1ZRN A;  4NM2 A;  4Q43 A;  1HEK A;  1UHU A;  1NJX A;  4P0P A;  4FFD A;  3RB0 A;  3TFR A;  3QZ7 A;  5DG9 A;  3RJH A;  3RBE A;  3WFP A;  3KHR A;  4Y2Y A;  5DBB A;  3H38 A;  2ZIW B;  2M2V A;  4MFA A;  4OJP A;  2WB1 F;  2KHQ A;  4DSJ A;  5AM4 A;  4PHA A;  1ZQF A;  3UXP A;  4ECY A;  4RQM A;  5J0Y A;  2ZH2 A;  2I1Q A;  1KLN A;  4X4P A;  2KIV A;  4TQS A;  1L7O A;  2HCF A;  4WJ3 B;  5A0L A;  3M9O B;  3ISD A;  5HHI A;  1RQL A;  9ICG A;  1XS9 D;  2QB0 A;  2HN1 A;  3BJY A;  4UAZ A;  4E7X A;  1NZP A;  4YN4 A;  8ICX A;  4HYK A;  3M1Y A;  3RB3 A;  2C2E A;  4AYB C;  5JRT A;  4XQ8 A;  4BJQ A;  2ZXH A;  5L1K A;  3JPR A;  2YTU A;  3TAD A;  3D2S A;  3SQI A;  4ECQ A;  1KFD A;  3QX7 A;  2XID A;  2BGW A;  2UVR A;  1KL9 A;  3M7D A;  3G6Y A;  2K8A A;  4O3P A;  4I2G A;  2I6X A;  4FZN A;  4JUZ A;  7ICS A;  2DBY A;  2E3T A;  2HHX A;  2YMM A;  4RNN A;  4DSK A;  2PI4 A;  1ZQV A;  1A77 A;  4UQG A;  4EZ6 A;  4K4H A;  2ODG A;  2BZF A;  4O9M A;  1X9X A;  5L1I A;  4DL5 A;  3QYP A;  8ICN A;  1WUD A;  1ZQZ A;  4LT6 A;  1KTQ A;  4FHP A;  1ZQM A;  4NLC A;  1KQQ A;  2LYH A;  1NKE A;  3N97 B;  1BPY A;  5D61 A;  2HMX A;  4ECT A;  3QU7 A;  2F8L A;  5ALP A;  2MAX A;  5ALM A;  2W9A A;  4KTQ A;  2KN7 A;  3FC4 A;  4DCC A;  3PZP A;  1ZQD A;  2W54 A;  5DLG A;  2XCP A;  4UB5 A;  1ZQI A;  3F2B A;  9ICF A;  1MIV A;  1K1S A;  4OJO A;  3H8W A;  5CHG A;  2KJ9 A;  2WF5 A;  3NUQ A;  4KMU A;  1MA7 A;  4I2E A;  4DOA A;  8ICU A;  5KFV A;  8ICB A;  3C29 A;  2F77 X;  4FZM A;  2KVS A;  2EAO A;  4YVZ A;  2OEH A;  1N5W A;  1V85 A;  1D9D A;  2V9W A;  4X4Q A;  3QU9 A;  1SL1 A;  5KG6 A;  2KVC A;  1L6N A;  4LEV A;  4QWC A;  4CF4 A;  1WCL A;  4F5R A;  5AM0 A;  3TAR A;  5ALL A;  4YG2 A;  5AKE A;  2ZIW A;  8ICL A;  3JYY A;  3B0X A;  3AMZ A;  5HMM A;  3RH5 A;  4K9B A;  2D8C A;  2XCA A;  3JCF A;  3GIJ A;  1KKX A;  3BZC A;  3IP4 B;  4RWN A;  5ALF A;  3B9J A;  3BS7 A;  3H4B A;  8ICQ A;  2JR5 A;  4J9K A;  2ZJA A;  4CGZ A;  4EV6 A;  2XGQ A;  4DL6 A;  1ZD4 A;  4JK1 A;  5CA7 A;  3NGD A;  3HJE A;  4KMO B;  8ICT A;  2NRX A;  3Q8M A;  2EWR A;  2M2T A;  1TAM A;  2ZH5 A;  2MA1 A;  4I2F A;  4X4V A;  1NK5 A;  2JEF A;  4U7C A;  3OUY B;  4CF3 A;  7ICG A;  3PVX A;  1ZXI A;  3JPT A;  4BXO B;  2LI6 A;  2FMS A;  2RP5 A;  2O5A A;  3NRW A;  3FDS A;  2KIC A;  5J2K A;  1JMS A;  1RXV A;  1L7M A;  3ISB A;  1A6S A;  1L5U A;  1UPH A;  5KTQ A;  1MC8 A;  1U4B A;  2BDP A;  4DQQ A;  4GXI A;  4ATB B;  2HBL A;  2VIX A;  3PSP A;  4LVS A;  1D8Y A;  7ICL A;  2ZIU B;  2W43 A;  3RFA A;  4M47 A;  3TI0 A;  2ZTD A;  1TVA A;  3LYS A;  4DLG A;  1RQN A;  2DWQ A;  7ICP A;  3C28 A;  3ER9 B;  4M9N A;  3IG5 A;  4R64 A;  2JEI A;  4B6J A;  1TE2 A;  1X2I A;  4WC6 A;  2JGA A;  4RQ5 A;  4QIW C;  1WG8 A;  4Y2Q A;  4QW8 A;  1IXR A;  4WCW A;  1HIW A;  8ICG A;  9ICN A;  2YB1 A;  5HRK A;  5G5H A;  4F8R A;  4UD5 A;  1UET A;  5KFA A;  7ICN A;  4B9M A;  2O1P A;  2KD1 A;  5KT5 A;  1X42 A;  2QAR B;  2HVH A;  3NVW A;  2DRB A;  1VFG A;  1NI3 A;  4MEY A;  4WOY A;  1GO3 F;  4LEY A;  1U49 A;  4PHP A;  2MU2 A;  5J0R A;  3QUT A;  8ICC A;  5HHH A;  1A0P A;  4LEW A;  2ZH4 A;  1ZQQ A;  4B9T A;  4K99 A;  3AM9 A;  2HOF A;  5HR9 A;  5IIM A;  3WK8 A;  1LB2 B;  4E8F A;  2PI5 A;  4S3N A;  3UXO A;  4UW9 A;  2A1J B;  3BQ7 A;  4C8N A;  5AK5 A;  3H0L B;  1ZQX A;  2OWO A;  3N7S C;  4O0I A;  1JXL A;  7ICO A;  1NZB A;  1VLB A;  2B0C A;  3LDA A;  4M9H A;  2WF9 A;  4JMU A;  4GXJ A;  1TAU A;  1ECW A;  3T5L A;  3HWT A;  3IM1 A;  3QEA Z;  1UA0 A;  2A3V A;  4I27 A;  1UQV A;  4ED6 A;  2ZXI A;  2HN2 A;  4USA A;  2W9B B;  4RQ4 A;  3RH6 A;  1ZET A;  4QW9 A;  2W7O A;  4RQ7 A;  4K4G A;  4TUR A;  4LJX A;  4UAY A;  5KG3 A;  4X4T A;  1YT3 A;  1CI4 A;  4B9V A;  5AKK A;  3WKD A;  4XUS A;  1X9S A;  2MSN A;  8ICI A;  3H7I A;  4PGX A;  1WCN A;  3G6X A;  2HSZ A;  9ICA A;  4ATB A;  1BPB A;  4PL1 A;  1TKD A;  2ZHB A;  4KIT B;  2ZIU A;  4ED7 A;  1NKB A;  5CRX A;  3EW9 A;  2BQR A;  4M5D A;  2YY6 A;  3KHG A;  3AU2 A;  4QZD A;  4F5Q A;  5J8Y C;  2IOF K;  2NO5 A;  3QXG A;  4C7Y A;  2BCR A;  1V9P A;  5ALJ A;  4LZG A;  5KG2 A;  3C2M A;  4J9Q A;  3PW0 A;  4DEZ A;  2F3N A;  2JHD A;  2JRZ A;  2ASD A;  1PVP A;  2BCS A;  5J0P A;  4DSF A;  5HC9 A;  3ICX A;  3UMC A;  2Y9U A;  4DFJ A;  4F5N A;  1BPX A;  3C5F A;  3V6K A;  4IQU A;  2B51 A;  5HRG A;  4O6A A;  2GWS A;  1ZQP A;  4M04 A;  5GTI U;  4B9U A;  3NTU A;  2XC9 A;  2AQ4 A;  2KK0 A;  3K4G A;  4RQ2 A;  2QAR A;  5KT6 A;  2GA9 D;  4O3N A;  2LPE A;  3ZDA A;  5IIK A;  2PFO A;  2Q66 A;  3TAC B;  2FPL A;  2CPR A;  2RRD A;  1K5O A;  3MFI A;  4J9R A;  4KLJ A;  2EAM A;  5DGB A;  1MQ2 A;  2DR8 A;  1SIJ A;  4B9N A;  1SV4 A;  1L8O A;  3M9M B;  1K1Q A;  4KN4 A;  2HBK A;  3D6J A;  4IS7 A;  9ICC A;  2W7P A;  3MGI A;  3OJS A;  4FS2 A;  3N7P D;  9ICR A;  4RQ6 A;  2XY7 A;  2A1J A;  4FO6 A;  3CP8 A;  2K4H A;  3GV8 B;  3O0F A;  9ICI A;  3RB4 A;  4NJ8 A;  3C18 A;  5D62 A;  1DGS A;  1MN8 A;  5AKL A;  1ZQE A;  4WBY A;  2AXT U;  5III A;  1J2M A;  3H0R B;  4WC0 A;  1L7N A;  2M0N A;  2XY6 A;  1SB3 C;  2IHM A;  4MFC A;  1NO5 A;  1BNP A;  4Y2S A;  9ICP A;  1Y88 A;  3QZ8 A;  1F5S A;  1NNL A;  2K4P A;  2W9B A;  5IIJ A;  2EH9 A;  4NXT A;  4FE3 A;  3T5K A;  3BS5 B;  3V6J A;  4GFJ A;  5AK3 A;  5J0O A;  5ALO A;  1MSW D;  2PMZ F;  2W8K A;  2XI9 A;  1ZQO A;  3OTQ A;  3EF2 A;  1Q3V A;  5J2B A;  4F71 A;  4GLX A;  1S0M A;  1L3T A;  1QSS A;  3LVV A;  4X4N A;  2ZHA A;  4RZR A;  4Y2P A;  2HHQ A;  3V72 A;  4WC4 A;  1N60 A;  1DXS A;  3S6J A;  3QU2 A;  4DOB A;  4NLZ A;  1XNS A;  3ALR A;  2ZJ5 A;  3C5G A;  4Y2X A;  5AHX A;  4EEK A;  2UVU A;  1TFR A;  1Q46 A;  1SL0 A;  1NK9 A;  4KM5 A;  4F91 B;  2ID1 A;  4E0D A;  5KG4 A;  2HBM A;  4ELT A;  3SZ2 A;  1L3U A;  4IQV A;  2P6R A;  4G9B A;  4YQW A;  1QSY A;  2W03 A;  5DLF A;  1SXE A;  8ICJ A;  1KRP A;  4FBU A;  3TAP A;  1R8A A;  2DPI A;  1R89 A;  2AJQ A;  5G5G A;  4QWB A;  4RQ0 A;  5KAF U;  2DKZ A;  4F72 A;  2HHV A;  4O5K A;  4NL9 C;  4G3I A;  1RPL A;  2AGP A;  4AT9 B;  5J29 A;  3JPO A;  4UAT A;  5EE1 A;  3UQ2 A;  4K97 A;  1PK1 B;  4P4O A;  3OV7 A;  1Z00 A;  2BQ3 A;  4Q8E A;  1PVQ A;  3WK5 A;  5KFY A;  3C2K A;  3SV4 A;  2KE7 A;  2KKP A;  5KFW A;  4DOC A;  4F2R A;  5EWG A;  2F1H A;  1H38 A;  4OAF A;  4IQW A;  3H8J A;  4TUQ A;  2V4Q A;  4IR1 A;  3RBD A;  1ZQC A;  1UEV A;  3AUO A;  5HP4 A;  2GO7 A;  5C5J A;  1X6J A;  3SEI A;  2K60 A;  8ICW A;  5DBA A;  5B66 U;  3N7R C;  3Q8P B;  5HNK A;  1KDH A;  2W3S A;  2B21 A;  4TUP A;  2IHO A;  3MR5 A;  2RDI A;  5DDY A;  3HW8 A;  4DSL A;  2VKQ A;  4MF2 A;  5J0U A;  1ZQY A;  2H3V A;  2ZUD A;  1X66 A;  2J6T A;  1X9W A;  4EX7 A;  3BS5 A;  5DG8 A;  2BPG A;  1IG6 A;  2EAP A;  2B56 A;  3EPI A;  2JEG A;  3PML A;  2VA8 A;  4M9J A;  3I76 A;  1N61 A;  1VJ5 A;  3V6H A;  1N56 A;  4X4U A;  4PGY A;  4Y2R A;  4ICA A;  5HRL A;  3NAS A;  4RQ1 A;  4KLU A;  4Z6C A;  1U48 A;  4RNO A;  1ED1 A;  5ALE A;  4TQR A;  4DQR A;  2OHF A;  5AM1 A;  5ALX A;  4J9N A;  3GIK A;  2DQN B;  5KFB A;  1XSL A;  2KZM A;  3SD7 A;  1JI7 A;  4C80 A;  2BBH A;  2LMR A;  4O67 A;  2F2A B;  1ZQ1 C;  2OXO A;  2R18 A;  5J8Y A;  3JPS A;  4EEY A;  2DR9 A;  3H40 A;  3SAG A;  4LEZ A;  5KG1 A;  2JH1 A;  2C2R A;  4DL2 A;  5KL8 B;  2HVI A;  2KTQ A;  2BBJ A;  2W55 A;  1RZT A;  1T3Q A;  9ICJ A;  1V38 A;  2YB4 A;  4PL2 A;  2NYV A;  1X40 A;  5F9L A;  4I2C A;  4NXV A; 
#chains in the Genus database with same CATH homology
 1XO1 A;  1D8Y A;  4LVS A;  1ZJM A;  7ICL A;  3AQN A;  3GFK B;  3JPQ A;  9ICH A;  4JV1 A;  5HRF A;  3RR8 A;  4BWM A;  4ED3 A;  5IIL A;  2NRW A;  2WTF A;  2ZTD A;  1JN3 A;  4QZ9 A;  3TI0 A;  1TVA A;  4M47 A;  4FHW A;  4I2J A;  4FH5 A;  4TUS A;  4BWJ A;  4DLG A;  2VA2 A;  5KT2 A;  3RJK A;  7ICP A;  1BNO A;  1NK0 A;  2FMP A;  2BCQ A;  4M9N A;  3K75 D;  5KFL A;  4R64 A;  1L3V A;  2JEI A;  5KFZ A;  4YD1 A;  4IRC A;  1RYS A;  4GC7 A;  4EBC A;  2UVW A;  3AQL A;  5KFN A;  1X2I A;  4UBB A;  4F4W A;  4DO9 A;  7ICF A;  1QLN A;  2W9C A;  4WC6 A;  3ZDB A;  2Y1J A;  4RQ5 A;  3PW2 A;  2P6U A;  3Q8Q B;  1XWL A;  9ICL A;  5KFO A;  1CEZ A;  3PO4 A;  5KFM A;  4EBK A;  4P4P A;  2NRK A;  4QW8 A;  7ICI A;  1Q79 A;  1IXR A;  5J0Q A;  5HRE A;  1F5A A;  8ICG A;  3RAX A;  3H8S A;  4J9L A;  4EYI B;  9ICN A;  4RUA A;  4WCW A;  5KT7 A;  4C8O A;  4DWI A;  5HRK A;  2PBE A;  4XQ7 A;  4NKU A;  1S0O A;  4F8R A;  3EZ5 A;  2ZH7 A;  4I2A A;  1MIW A;  4UD5 A;  1UET A;  5DEC A;  3OHA A;  5F2V O;  1NK7 A;  3M9N B;  1DK2 A;  5KFA A;  4JV0 A;  4R66 A;  9ICB A;  4BGD A;  5D46 A;  7ICN A;  4B9M A;  1NJZ A;  1ZQB A;  1D9F A;  1S77 D;  4KLI A;  5J2E A;  3GV7 B;  7ICH A;  2O1P A;  3MR2 A;  5KT5 A;  5EWF A;  2NRT A;  4QWA A;  5KFE A;  1HUZ A;  2PFP A;  5TZV A;  2HVH A;  1KFT A;  4RWQ A;  5J0T A;  3RRG A;  3C21 A;  1VFG A;  2DRB A;  3ISC A;  5KFI A;  1Z00 B;  2IBK A;  4DQP A;  4MEY A;  4F4Y A;  5IIN A;  2BPF A;  1R8B A;  5CWR A;  4O3O A;  5DQH A;  1U49 A;  5DQG A;  4PHP A;  4KLT A;  5J0R A;  8ICE A;  2C22 A;  4Z6E A;  4KLG A;  3B0Y A;  1SKW A;  4ECU A;  1ZQJ A;  8ICC A;  5HHH A;  5KFX A;  4DSI A;  3UPS A;  4KLL A;  3PY8 A;  2R8I A;  3Q8L A;  5D49 A;  2DFL A;  3OHB A;  4ECZ A;  1T8E A;  1ZQQ A;  4B9T A;  4WC5 A;  3GDX A;  2ZH4 A;  4MF8 A;  2J6U A;  2DR7 A;  4QZB A;  4F4K A;  8ICH A;  5IIM A;  5HR9 A;  4PHE A;  3HIY A;  1LB2 B;  4E8F A;  3ZD8 A;  2PI5 A;  4XRH A;  5J0X A;  1D8L A;  3PR4 A;  3UXO A;  3LWM A;  1ZQG A;  3JPN A;  2M2U A;  4S3N A;  4YP3 A;  4QZG A;  2A1J B;  4PH5 A;  1R8C A;  4C8N A;  1IM4 A;  1KEJ A;  3PW4 A;  1ZQX A;  4F93 B;  3MR3 A;  3MDA A;  2OWO A;  3RJE A;  3RJF A;  4C8L A;  2XGP A;  2VA3 A;  3PW5 A;  4NM1 A;  3AQK A;  1QSL A;  4O0I A;  3Q8S B;  1HJP A;  1JXL A;  3RJI A;  3JPP A;  4QZI A;  7ICO A;  4QZA A;  3PMN A;  1S0V A;  3LDA A;  3Q8K A;  4M9H A;  1S76 D;  1SZP A;  3RTV A;  3THV A;  4GXJ A;  4WBZ A;  5IIO A;  1ZQH A;  1TAU A;  5KFK A;  4RQ3 A;  1NJY A;  4YMN A;  2ZUC A;  3H4D A;  1ZYQ A;  2FLN A;  5EWE A;  1ZJN A;  2IMW P;  4Q8F A;  4AT8 B;  3C1Y A;  1BVS A;  3HWT A;  3IM1 A;  3T5L A;  3QEA Z;  1UA0 A;  2R8J A;  3KHL A;  5L1L A;  5F9N A;  3WFS C;  4I27 A;  4O3R A;  4X4R A;  2JEJ A;  5KFG A;  5L1J A;  4ED6 A;  3PX6 A;  5KFC A;  1JX4 A;  2R8G A;  2W9B B;  3OVB A;  4QZF A;  2Y1I A;  4RQ4 A;  3RH6 A;  1XSP A;  4KLF A;  3EWA A;  5HRH A;  4I2B A;  3WFR E;  1ZET A;  3MGH A;  3UPQ A;  5KG0 A;  4QW9 A;  4M2Y A;  2KFZ A;  1TK5 A;  2BPC A;  4QZ8 A;  4RQ7 A;  4YR3 A;  4K4G A;  5HRI A;  4TUR A;  1X9M A;  5DDM A;  4MEX A;  8ICO A;  7ICE A;  4M6W B;  4KLS A;  4RPZ A;  2BE3 A;  8ICF A;  4UAY A;  4C8K A;  1UEU A;  4IRD A;  4I2I A;  5KG3 A;  4X4T A;  3MDC A;  9ICV A;  1LV5 A;  4WC2 A;  4B9V A;  5EOZ A;  2MUT A;  3SYZ A;  1KFS A;  4XUS A;  1X9S A;  3G6V A;  3IHQ B;  1JXE A;  8ICI A;  3MFH A;  3H7I A;  4PGX A;  4J9M A;  1WCN A;  2RDJ A;  1KSP A;  3G6X A;  4KLD A;  1ARO P;  2PXI A;  9ICA A;  2NRV A;  4ATB A;  4WC7 A;  4PHD A;  4O3Q A;  1BPB A;  1NJW A;  4NLN A;  1UA1 A;  1KNY A;  4PPX A;  3HPO A;  3V7J A;  1NKC A;  4JV2 A;  4EZ9 A;  1TKD A;  2ZHB A;  1HUO A;  4B9L A;  1PZN A;  4X4S A;  1A76 A;  4KIT B;  4ED7 A;  1NKB A;  4DQS A;  4KLH A;  4I2H A;  2VAN A;  3EW9 A;  2BQR A;  8ICS A;  3H37 A;  1RXW A;  4M5D A;  4RQ8 A;  4YXM A;  3GQC A;  2IHN A;  1ZQW A;  4DL7 A;  3KHG A;  2BQU A;  3AU2 A;  4QZD A;  1TAQ A;  5CP2 A;  4F5Q A;  2IA6 A;  5J2F A;  5KFJ A;  4RPY A;  4R65 A;  1JIH A;  4AT9 A;  8ICP A;  2ATL A;  2BCR A;  4RWP A;  1V9P A;  4YR0 A;  5KFP A;  4LZG A;  5JUM A;  5KG2 A;  4WC1 A;  3ZD9 A;  2KP7 A;  4AT7 A;  3C2M A;  5KG5 A;  4J9Q A;  2UVV A;  8ICA A;  3PW0 A;  4DEZ A;  4M9G A;  2ASD A;  4P2H A;  2BCS A;  3OSP A;  5HRD A;  5J0P A;  4DSF A;  3GIM A;  5HC9 A;  1ZQT A;  1JAJ A;  4XA5 A;  3T5J A;  5KFS A;  3V7L A;  4F5N A;  4DFJ A;  1BPX A;  8ICK A;  3C5F A;  2JZB B;  2FLL A;  4FBT A;  2KZZ A;  4IRK A;  3V6K A;  4DL3 A;  4KLO A;  2FPM A;  4IG8 A;  4IQU A;  4F5O A;  3TFS A;  4X5V A;  5HRG A;  2GWS A;  4FHY A;  1ZQP A;  2ASJ A;  4M04 A;  5J2C A;  9ICQ A;  5DKW A;  4J9S A;  3BQT A;  4ECR A;  4ED1 A;  3BQ1 A;  4B9U A;  5J2J A;  4LT6 A;  4X4O A;  3AQM A;  3NTU A;  5KFU A;  4UB4 A;  2XC9 A;  2ALZ A;  5KFT A;  2AQ4 A;  2PFQ A;  3WFQ E;  4QWE A;  2BHN A;  3K4G A;  4RQ2 A;  5KT6 A;  1Q78 A;  4O3N A;  9ICS A;  2FMQ A;  4YFK A;  5J0W A;  4RT3 A;  3H3A A;  2DR5 A;  1ZQN A;  2FLP A;  3ZDA A;  1UT8 A;  5IIK A;  2PFO A;  4JWM A;  2ZH6 A;  2Q66 A;  2FPL A;  9ICU A;  5DG7 A;  7ICK A;  1WOT A;  4QZH A;  3HJ4 A;  4J9R A;  3MFI A;  2I9G A;  4KLJ A;  1T7P A;  5DGB A;  3T3F A;  1MQ2 A;  4MFF A;  2DR8 A;  1V4A A;  5DB6 A;  4IQT A;  3KHH A;  4IR9 A;  4B9N A;  1ZQL A;  4NLG A;  5J2D A;  3M9M B;  4NLK A;  3ZDE A;  1K1Q A;  4YR2 A;  3M8S A;  4DQI A;  4NM2 A;  4KN4 A;  4Q43 A;  1XSN A;  1S0N A;  4RPX A;  3TAQ A;  9ICC A;  1NJX A;  2V4R A;  4UB2 A;  3RB0 A;  3MGI A;  3OJS A;  4FS2 A;  3OJU A;  9ICR A;  3TFR A;  4RQ6 A;  2ZTC A;  3QZ7 A;  2A1J A;  5DG9 A;  4F50 A;  4Q44 A;  3EPG A;  4FO6 A;  4DSE A;  2XY7 A;  1U47 A;  3RBE A;  3GV8 B;  9ICI A;  5L9X A;  4FHV A;  3RB4 A;  3RJH A;  2F1J A;  3QEB Z;  3C18 A;  1DGS A;  2HW3 A;  9ICO A;  3BDP A;  7ICU A;  2KZ3 A;  3KHR A;  1ZQE A;  4WBY A;  1ZQU A;  5III A;  5DB7 A;  5DBB A;  4K4I A;  7ICJ A;  3H38 A;  4UB3 A;  3PW7 A;  8ICV A;  2M2V A;  4WC0 A;  3LK9 A;  3WFO A;  1BGX T;  4MFA A;  3SI8 A;  5KFD A;  2XY6 A;  1SKR A;  4DSJ A;  4PHA A;  2W9M A;  1ZQF A;  2IHM A;  3UXP A;  4ECY A;  4MFC A;  5J0Y A;  2ZH2 A;  3LQC B;  1NO5 A;  1BNP A;  3HP6 A;  9ICP A;  1Y88 A;  2I1Q A;  3QZ8 A;  1ZQA A;  8ICM A;  1KLN A;  4M9L A;  4X4P A;  4Z6F A;  8ICY A;  5KFH A;  1BPD A;  4TQS A;  4KLQ A;  2W9B A;  5IIJ A;  5CJ7 A;  4I2D A;  4KN7 A;  3M9O B;  3ISD A;  3T5K A;  3V6J A;  1B43 A;  5HHI A;  4DFK A;  3AU6 A;  3QE9 Y;  4F2S A;  9ICG A;  3OUY A;  1XS9 D;  5DB8 A;  4RWO A;  4BXO A;  1MIY A;  3BJY A;  5HRB A;  4R8U B;  5J2H A;  4UAZ A;  4UB1 A;  5J0O A;  4E7X A;  1MSW D;  1NZP A;  4YN4 A;  1JQR A;  8ICX A;  3ZDC A;  3MBY A;  4HYK A;  4P4M A;  3ZDD A;  2W8K A;  3RB3 A;  3C1Z A;  3KTQ A;  2ZTE A;  1ZQO A;  1EXN A;  2C2E A;  4NKT A;  4PGQ A;  1VJ7 A;  5KFF A;  4XQ8 A;  4EP7 A;  1U9L A;  1ZQR A;  5J2B A;  4ED2 A;  4GLX A;  3BQ0 A;  1UT5 A;  1U45 A;  4DF4 A;  3PX4 A;  1S0M A;  4GXK A;  3M8R A;  5L1K A;  3JPR A;  1L3T A;  1QSS A;  3MAB A;  4X4N A;  8ICZ A;  3ETL A;  2P66 A;  2ZHA A;  2HHS A;  9ICK A;  4ECQ A;  3RJG A;  2Q0Z X;  3H39 A;  4RZR A;  2ZH3 A;  1KFD A;  2HHQ A;  3V72 A;  4WC4 A;  2BGW A;  4RNM A;  3V7K A;  4DOB A;  2UVR A;  4NLZ A;  2XY5 A;  3G6Y A;  5CB1 A;  4C8M A;  2ZJ5 A;  4O3P A;  3LWL A;  4ED0 A;  4I2G A;  1B22 A;  3C5G A;  5BOM A;  3OSN A;  3C66 A;  2HHU A;  2DVI A;  4JUZ A;  2DPJ A;  2UVU A;  1TFR A;  1SL0 A;  7ICS A;  3WFP A;  2RFF A;  1NK9 A;  4KLE A;  4F91 B;  2ID1 A;  5DED A;  2HHX A;  4E0D A;  2ZH8 A;  5KG4 A;  5BPC A;  4RNN A;  4GC6 A;  2PI4 A;  1NK4 A;  1CUK A;  4DSK A;  1ZQV A;  1A77 A;  4UQG A;  4ELT A;  3SZ2 A;  1RYR A;  1L3U A;  3PO5 A;  4EZ6 A;  4F4X A;  4EBJ A;  3PX0 A;  4IQV A;  2P6R A;  4K4H A;  5KG7 A;  2AU0 A;  1QSY A;  4YQW A;  3HX0 A;  5DLF A;  4DF8 A;  2AQ0 A;  2C28 A;  4O9M A;  8ICJ A;  4FHX A;  1KRP A;  5L1I A;  4FBU A;  4DL5 A;  3TAP A;  1R8A A;  8ICN A;  4R63 A;  1ZQZ A;  2JZB A;  2DPI A;  1KTQ A;  4NY8 A;  2AJQ A;  1R89 A;  4RQ0 A;  4QWB A;  4FHP A;  3PR5 B;  4DLE A;  1ZQM A;  4X4Q A;  2ZH9 A;  2LYH A;  5J2A A;  5J0S A;  1NKE A;  3N97 B;  1BPY A;  2HHV A;  4O5K A;  2HHT A;  3GV5 B;  2ISP A;  2R8K A;  4ECT A;  4F92 B;  2C2D A;  4G3I A;  1RPL A;  2AGP A;  1N48 A;  4AT9 B;  2MAX A;  5J29 A;  2W8L A;  2W9A A;  3JPO A;  4KTQ A;  2KN7 A;  4O3S A;  3PNC A;  1ZQD A;  5DLG A;  2XCP A;  4UB5 A;  1ZQI A;  3UQ2 A;  2R8H A;  9ICF A;  2NRZ A;  4YD2 A;  1TK8 A;  1MIV A;  3RH4 A;  4P4O A;  4AT7 B;  1K1S A;  8ICR A;  1Z00 A;  3OV7 A;  2BQ3 A;  1NK6 A;  4Z6D A;  4UAW A;  3H8W A;  5CHG A;  2W9C B;  1ZQK A;  4Q8E A;  3TQ1 A;  1COO A;  2PFN A;  4YXJ A;  5KFY A;  3C2K A;  3SV4 A;  4KMU A;  4DFM A;  4I2E A;  3OVS A;  4DOA A;  3MR6 A;  8ICU A;  5KFV A;  2BCU A;  7ICT A;  5KFW A;  8ICB A;  4DOC A;  4F2R A;  5CR0 A;  4F3O A;  4O5C A;  1NK8 A;  4YVZ A;  2DRA A;  3C2L A;  5EWG A;  2F1H A;  3N4M B;  1H38 A;  1D9D A;  2KFN A;  9ICE A;  4QZC A;  3OGU A;  2AGO A;  2AGQ A;  1S97 A;  1L3S A;  4DFP A;  4NXZ A;  5J2I A;  1T3N A;  2V9W A;  4B9S A;  4Q45 A;  1SL1 A;  3RAQ A;  7ICM A;  3H8J A;  9ICW A;  5DBC A;  4UBC A;  4F5P A;  4TUQ A;  3RRH A;  2V4Q A;  5DQI A;  4IR1 A;  4X0B A;  3GIL A;  3HT3 A;  3RBD A;  5KG6 A;  4YMO A;  4RU9 A;  1ZQC A;  1UEV A;  3AUO A;  4KLM A;  4QWC A;  1BPE A;  5HP4 A;  1WCL A;  4F5R A;  7ICQ A;  1S10 A;  2BR0 A;  3RJJ A;  5C5J A;  5BOL A;  1QTM A;  1XC9 A;  2HHP A;  9ICM A;  3TAR A;  4YG2 A;  2XO7 A;  8ICW A;  5DBA A;  3BQ2 A;  3UQ0 A;  8ICL A;  3JYY A;  1Z3E B;  1DOQ A;  3Q8P B;  3B0X A;  4ECX A;  5HNK A;  1KDH A;  5HMM A;  3RH5 A;  3L9D A;  2B21 A;  4DS4 A;  4TUP A;  2F1I A;  4YMM A;  3SV3 A;  1TK0 A;  2HHW A;  3MR5 A;  4ELU A;  2XCA A;  1PX5 A;  2RDI A;  5DDY A;  3HW8 A;  2ISO A;  4CCH A;  4ECW A;  4DSL A;  4AT8 A;  4MF2 A;  4RUC A;  5J0U A;  3GIJ A;  1SL2 A;  1ZQY A;  2ZUD A;  7ICV A;  3UXN A;  5HML A;  4DS5 A;  1X9W A;  2J6T A;  1TV9 A;  1DK3 A;  1TFY A;  5DG8 A;  2BPG A;  3GII A;  2M2W A;  4ECV A;  9ICT A;  2ZH1 A;  4RWN A;  1TFW A;  4RT2 A;  4EBD A;  3EPI A;  2M9N A;  4R8U A;  5KT4 A;  3H4B A;  2H5X A;  2JEG A;  1FA0 A;  3PML A;  8ICQ A;  4J9K A;  2VA8 A;  2ZJA A;  4M9J A;  3V6H A;  4M6W A;  1N56 A;  5J2G A;  4M0A A;  3E2E A;  4X4U A;  4PGY A;  5DGA A;  2XGQ A;  4DL6 A;  3RB6 A;  2ZUB A;  5HRL A;  3EYZ A;  3OVA A;  4JWN A;  4RQ1 A;  3PV8 A;  4DL4 A;  4JK1 A;  5CA7 A;  1XU4 A;  3NGD A;  3T5H A;  4KLU A;  5KFQ A;  2BKE A;  4Z6C A;  1U48 A;  2J6S A;  4RNO A;  2NRX A;  3Q8M A;  8ICT A;  4FS1 A;  4DQR A;  4TQR A;  1OU5 A;  1YLQ A;  2FPK A;  3C23 A;  2M2T A;  2ZH5 A;  5KFR A;  4J9N A;  4ELV A;  4I2F A;  4LZD A;  4J9P A;  4X4V A;  9ICX A;  2ASL A;  4QZE A;  1NK5 A;  2JEF A;  4I29 A;  4EYH B;  4WC3 A;  3GIK A;  3HJ1 A;  4ECS A;  3OUY B;  5KFB A;  5D4B A;  3TAN A;  3PVX A;  1XSL A;  7ICG A;  3JPT A;  4ED8 A;  1NOM A;  2KZM A;  4ZH4 A;  1SKS A;  4BXO B;  1MQ3 A;  2FMS A;  4QWD A;  4I28 A;  4O5E A;  4E80 A;  2O5A A;  3NYB A;  4UD4 A;  3FDS A;  5KT3 A;  3JPS A;  3RR7 A;  4EEY A;  4BDP A;  4X0A A;  3FYH A;  2DR9 A;  5J2K A;  3H40 A;  1T4G A;  4YCX A;  5KG1 A;  1JMS A;  2ZJ8 A;  4F4Z A;  1BPZ A;  7ICR A;  3Q8R B;  2C2R A;  4DL2 A;  1RXV A;  4J9O A;  3ISB A;  1C7Y A;  2MUT B;  2HVI A;  1L5U A;  2KTQ A;  1S9F A;  1RZT A;  9ICJ A;  4IQW A;  3ORY A;  5KTQ A;  4EBE A;  1MC8 A;  1U4B A;  2BDP A;  4FH3 A;  3JZ0 A;  4DQQ A;  5DB9 A;  2BCV A;  4GXI A;  4ATB B;  5F9L A;  1ZQS A;  4I2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...