4NXWA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
325
Chain Sequence
MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
total genus 109
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxwA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxwA02
4K8VA 4JLZA 4NXXA 4KB6A 4AT9A 4K97A 4LEZA 4K9AA 4NXVA 4K96A 4AT7A 4NXWA 4OAHA 4K99A 4LEYA 4OAFA 4AT7B 4O68A 4KM5A 4O67A 4OAGA 4K98A 4NXTA 4O6AA 4K9BA 4MKPA 4AT9B 4OAIZ 4ATBA 4JLXA 4ATBB 4AT8B 4AT8A 4LEVA 4WOYA 4NXUA 4LEWA 4O69A
chains in the Genus database with same CATH superfamily
4F5QA 1ZQTA 3AQNA 2PFOA 4PHEA 3K7DA 4Z6CA 4PGQA 5HRHA 1ZQRA 1BPZA 1ZQYA 4GXIA 3AUOA 4FHWA 4NLNA 1ZQKA 4FH3A 1HUZA 1JAJA 8ICJA 4I2DA 9ICIA 3MCRA 4RQ4A 3JPRA 4K9BA 4N7RA 3AU2A 4WC0A 8ICBA 2ZHAA 3UPSA 4RQ6A 1ZJMA 9ICLA 4AT8B 5F2VO 5J2JA 7ICKA 3HIYA 3AQLA 3MDAA 4YMNA 4I2HA 1WOTA 1ZQQA 4K8VA 1ZQGA 8ICEA 7ICVA 4RWQA 9ICSA 4KLDA 2ZH3A 4KLLA 1R8BA 1BPEA 5IILA 4X4QA 4UB4A 3WFQE 9ICCA 4M9HA 4TUQA 1VJ7A 4FHPA 4PGXA 4E80A 1HUOA 3V7JA 1ZQAA 5J0YA 4YMMA 5HRGA 2PFNA 4OAIZ 3RJJA 9ICBA 5HHHA 9ICFA 4M5DA 3LQCB 1ZQUA 9ICWA 4LVSA 8ICWA 8ICZA 1ZQPA 4YMOA 3JZ0A 4NKTA 1R8CA 5DEDA 4K99A 3EF2A 8ICAA 1XSPA 4Z6FA 4LT6A 4PHPA 4PHDA 4R64A 7ICUA 5J29A 1BPBA 3JPOA 8ICPA 4O6AA 4WH5A 1ZQDA 4MKPA 4AT9B 2ZHBA 3NWIA 2ISOA 4WQKA 1ZJNA 4GXKA 9ICTA 8ICOA 5DBAA 4K97A 1MIWA 8ICVA 4RQ2A 3JPNA 4M9GA 4NLZA 5CWRA 5HRBA 3UXPA 4KLUA 5CA7A 4I0UA 2P66A 4QZEA 4FHYA 1Q79A 3MBYA 4MF8A 1ZQOA 4X5VA 2HHPA 1GPJA 2BBHA 4EBJA 3JPPA 4F5PA 5DKWA 4XQ8A 4LZDA 4WBYA 2FMPA 7ICGA 5EOZA 9ICOA 2DRBA 4X0BA 4ATBA 3V7KA 3UQ0A 5IIMA 8ICKA 4FO6A 4WOYA 2ZH1A 3UXOA 1ZQEA 4RQ8A 4MFFA 2DR5A 4UB3A 2BCSA 5J2HA 4M04A 3L9DA 4NM2A 4WC7A 7ICRA 3C2KA 5CHGA 2O1PA 5CFSA 3HX0A 5J0XA 3TFSA 4FH5A 4RPZA 5DDMA 4OAGA 3RJFA 3K75D 4X4UA 4AT8A 4RPXA 2BBJA 1R8AA 5HHIA 3ERCC 4LEWA 2FMSA 4UB1A 5J0UA 1ZQVA 5D4BA 3OUYA 1ZQNA 2BCVA 4K9AA 8ICFA 1ZQMA 1ZQHA 2BPCA 5J2GA 8ICNA 8ICHA 5IIJA 3B0YA 1ZQWA 1TFYA 4R65A 4O5EA 5DB8A 1OU5A 3ISBA 2ZH2A 4M47A 4RPYA 4MF2A 4X4TA 3PMLA 5B3PA 1PX5A 3AQKA 4KB6A 4JLZA 8ICGA 3WFOA 1ZQIA 4IG8A 5D62A 4HX0A 1R89A 4PH5A 3NKUA 3H37A 2DR8A 1XSLA 4X4NA 3PMNA 2Q66A 4OAFA 2IHOA 4RWPA 4IQWA 7ICIA 5IIOA 1RPLA 4KLTA 2M2UA 3NVOA 8ICCA 4RQ5A 4WC6A 5J2IA 4UAWA 2EWRA 8ICXA 5DB7A 1KNYA 1BPXA 9ICHA 1RZTA 2FCLA 3C5FA 3C2MA 2IHMA 4QZ8A 5HREA 5J2CA 3RH6A 3B0XA 4EEBA 5DECA 4K96A 2RFFA 4AT7A 1JMSA 4NXZA 4I2CA 1NO5A 3ER8C 4TUSA 3UXNA 4FHXA 4YD1A 4KM5A 3RJGA 5CHEA 4P4MA 7ICMA 1ZQSA 5DBBA 3C18A 4JWMA 2VANA 4DOAA 4X4OA 4KLSA 4DO9A 2BCUA 2ZH7A 4X4VA 5CJ7A 4AT9A 1UEVA 7ICPA 2O5AA 3OVBA 1VFGA 1KEJA 3RJIA 3OGUA 4X4RA 1MIYA 3LK9A 2I9GA 4AT7B 5CFTA 8ICTA 7ICFA 1ZQBA 4K4GA 4PPXA 4I27A 2PXIA 3AQMA 1TV9A 4NXTA 4K4HA 4DOCA 5D46A 4WC3A 1UETA 4KLHA 5HRFA 4KLOA 2M2WA 7ICJA 7ICLA 4LEVA 2IUBA 4QZHA 5D49A 2ZH5A 1BPYA 1TFWA 9ICKA 4QZFA 4M9JA 5BOMA 5DDYA 4WC4A 3CK6A 2M2TA 4RT2A 2ZH6A 3RJHA 4WC1A 9ICPA 4WC5A 4I2FA 4QZCA 4I2GA 7ICOA 4QZBA 4RQ3A 4I2IA 4Z6DA 4KLJA 5J2BA 3HW8A 1KDHA 7ICQA 4IQUA 7ICTA 1ZQFA 3WFPA 2BPFA 4RQ0A 9ICJA 9ICUA 2DVIA 4EGWA 4UAZA 4P2HA 5IIIA 1ZQXA 2ZH4A 3RJEA 4O5KA 5HRDA 4I2EA 3RH4A 4I2AA 4I2JA 8ICYA 4EEDA 4FHVA 3OVSA 4M0AA 9ICNA 4UAYA 1XSNA 3OVAA 2W9MA 4UD4A 4NXWA 5IINA 8ICQA 4UD5A 4Z6EA 5TZVA 4WCWA 5J0QA 4MFAA 4F5NA 8ICIA 2PFPA 1TVAA 2GA9D 3C66A 5CFUA 4QZAA 4QZIA 3RH5A 1JN3A 4TURA 2M2VA 4XA5A 4NXXA 4UB5A 2ISPA 9ICMA 4IQVA 3AU6A 4WC2A 4RT3A 2BCQA 2BPGA 1BPDA 5DB6A 3PHZA 4NM1A 5D63A 4EP7A 4RWOA 2HN2A 5CB1A 4OAHA 5J2AA 1Q78A 3JCFA 8ICRA 2HN1A 4RWNA 4UBBA 1V4AA 3JPQA 4K98A 1ZQLA 5CR0A 3PNCA 4X4PA 2DR7A 3OV7A 1UEUA 4JLXA 3V7LA 9ICGA 4XRHA 5J0TA 1ZQCA 4O9MA 2GWSA 4NXUA 4O69A 4X4SA 4GXJA 8ICMA 4UB2A 1MQ3A 4M2YA 9ICXA 4FO1A 5IIKA 4UBCA 4JWNA 4NXVA 2ID1A 4WBZA 2BE3A 4KLIA 3V72A 3HJ4A 3JPTA 4WQLA 3ISCA 2FMQA 4P4PA 4KLGA 4I28A 4YCXA 5BOLA 8ICLA 4NKUA 4QZDA 5J0RA 3ISDA 4ATBB 5JTGA 9ICEA 9ICVA 4IQTA 7ICNA 4M9LA 4MFCA 4LEZA 7ICSA 4XQ7A 3MDCA 3HWTA 4O5CA 5J2FA 3C5GA 1FA0A 4EBKA 4LZGA 4KLFA 4YD2A 3WFRE 3H39A 9ICAA 5D61A 5HR9A 4F5OA 4QZGA 3UPQA 5DBCA 9ICQA 2GAFD 5B3QA 2B51A 4X0AA 4PGYA 1MIVA 1YLQA 2PBEA 3MGHA 4R66A 4E7XA 4E8FA 4TUPA 3UQ2A 4DOBA 5HC9A 4RQ1A 4KLEA 5HRIA 3H38A 3WFSC 4YN4A 5J0WA 2BCRA 4P4OA 4XUSA 3OWGA 4R63A 5J2EA 7ICEA 4O68A 3GDXA 5J0SA 4KLMA 5J2KA 3RJKA 2ZH8A 3TFRA 5CP2A 8ICSA 2DR9A 7ICHA 5DB9A 2NRKA 1MQ2A 4NLKA 4PHAA 1F5AA 3JPSA 5J0PA 1JQRA 4I2BA 4QZ9A 4XJEA 4I29A 1ZQZA 3ER9B 4KLQA 3MGIA 3H3AA 1NOMA 5J0OA 2DRAA 3NYBA 4LEYA 3HJ1A 3C2LA 8ICUA 4F5RA 4O67A 4NY8A 5HRKA 1ZQJA 4RQ7A 4K4IA 5HRLA 2ZH9A 5BPCA 3OUYB 3JYYA 2PFQA 5J2DA 4S3NA 4EV6A 2B4VA 9ICRA 2B56A 4M9NA
chains in the Genus database with same CATH topology
2DR5A 4FO1A 4AT9A 1UEVA 3K7DA 3OVBA 4NXVA 4X4RA 2O1PA 4FHWA 3HJ4A 4AT7B 4WQLA 5CFSA 5CFTA 4FH3A 4FH5A 4OAGA 3MCRA 4NXTA 4K9BA 4NKUA 4N7RA 2ZHAA 4O69A 4X4UA 1UETA 4ATBB 4AT8B 4AT8A 3HIYA 4LEVA 3ERCC 1R8AA 4LEWA 4K8VA 2ZH5A 3OUYA 1TFWA 4LEZA 4K9AA 2ZH3A 1R8BA 2ZH6A 1FA0A 4X4QA 5D61A 1TFYA 4FHPA 4E80A 2ZH2A 2GAFD 5B3QA 2B51A 4OAIZ 4X4TA 2DVIA 5B3PA 4M5DA 4E7XA 4E8FA 2ZH4A 4KB6A 4JLZA 4NXUA 4FHVA 3OVSA 4HX0A 5D62A 1R89A 4NKTA 3OVAA 3NKUA 2DR8A 1R8CA 4UD4A 4NXWA 4K99A 4X4NA 3EF2A 2Q66A 4OAFA 3OWGA 2IHOA 4UD5A 4O68A 4LT6A 2ZH8A 4O6AA 4WH5A 4MKPA 4AT9B 2ZHBA 2DR9A 2GA9D 3C66A 4WQKA 5CFUA 2EWRA 1F5AA 2FCLA 4NXXA 4XJEA 4K97A 3ER9B 3PHZA 4K96A 5D63A 4AT7A 4EP7A 4OAHA 2DRAA 3NYBA 4LEYA 1Q78A 3HJ1A 3ER8C 4FHYA 1Q79A 4FHXA 4KM5A 2HHPA 1GPJA 4O67A 5CHEA 4K98A 4X4PA 2ZH9A 3OUYB 3OV7A 2DR7A 2DRBA 1UEUA 4ATBA 4JLXA 4X4SA 4X4OA 4WOYA 2ZH1A 2B4VA 2B56A 2ZH7A 4X4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8V A;  4JLZ A;  4NXX A;  4KB6 A;  4AT9 A;  4K97 A;  4LEZ A;  4K9A A;  4NXV A;  4K96 A;  4AT7 A;  4NXW A;  4OAH A;  4K99 A;  4LEY A;  4OAF A;  4AT7 B;  4O68 A;  4KM5 A;  4O67 A;  4OAG A;  4K98 A;  4NXT A;  4O6A A;  4K9B A;  4MKP A;  4AT9 B;  4OAI Z;  4ATB A;  4JLX A;  4ATB B;  4AT8 B;  4AT8 A;  4LEV A;  4WOY A;  4NXU A;  4LEW A;  4O69 A; 
#chains in the Genus database with same CATH topology
 4F5Q A;  1ZQT A;  3AQN A;  2PFO A;  4PHE A;  3K7D A;  4Z6C A;  4PGQ A;  5HRH A;  1ZQR A;  1BPZ A;  1ZQY A;  4GXI A;  3AUO A;  4FHW A;  4NLN A;  1ZQK A;  4FH3 A;  1HUZ A;  1JAJ A;  8ICJ A;  4I2D A;  9ICI A;  3MCR A;  4RQ4 A;  3JPR A;  4K9B A;  4N7R A;  3AU2 A;  4WC0 A;  8ICB A;  2ZHA A;  3UPS A;  4RQ6 A;  1ZJM A;  9ICL A;  4AT8 B;  5F2V O;  5J2J A;  7ICK A;  3HIY A;  3AQL A;  3MDA A;  4YMN A;  4I2H A;  1WOT A;  1ZQQ A;  4K8V A;  1ZQG A;  8ICE A;  7ICV A;  4RWQ A;  9ICS A;  4KLD A;  2ZH3 A;  4KLL A;  1R8B A;  1BPE A;  5IIL A;  4X4Q A;  4UB4 A;  3WFQ E;  9ICC A;  4M9H A;  4TUQ A;  1VJ7 A;  4FHP A;  4PGX A;  4E80 A;  1HUO A;  3V7J A;  1ZQA A;  5J0Y A;  4YMM A;  5HRG A;  2PFN A;  4OAI Z;  3RJJ A;  9ICB A;  5HHH A;  9ICF A;  4M5D A;  3LQC B;  1ZQU A;  9ICW A;  4LVS A;  8ICW A;  8ICZ A;  1ZQP A;  4YMO A;  3JZ0 A;  4NKT A;  1R8C A;  5DED A;  4K99 A;  3EF2 A;  8ICA A;  1XSP A;  4Z6F A;  4LT6 A;  4PHP A;  4PHD A;  4R64 A;  7ICU A;  5J29 A;  1BPB A;  3JPO A;  8ICP A;  4O6A A;  4WH5 A;  1ZQD A;  4MKP A;  4AT9 B;  2ZHB A;  3NWI A;  2ISO A;  4WQK A;  1ZJN A;  4GXK A;  9ICT A;  8ICO A;  5DBA A;  4K97 A;  1MIW A;  8ICV A;  4RQ2 A;  3JPN A;  4M9G A;  4NLZ A;  5CWR A;  5HRB A;  3UXP A;  4KLU A;  5CA7 A;  4I0U A;  2P66 A;  4QZE A;  4FHY A;  1Q79 A;  3MBY A;  4MF8 A;  1ZQO A;  4X5V A;  2HHP A;  1GPJ A;  2BBH A;  4EBJ A;  3JPP A;  4F5P A;  5DKW A;  4XQ8 A;  4LZD A;  4WBY A;  2FMP A;  7ICG A;  5EOZ A;  9ICO A;  2DRB A;  4X0B A;  4ATB A;  3V7K A;  3UQ0 A;  5IIM A;  8ICK A;  4FO6 A;  4WOY A;  2ZH1 A;  3UXO A;  1ZQE A;  4RQ8 A;  4MFF A;  2DR5 A;  4UB3 A;  2BCS A;  5J2H A;  4M04 A;  3L9D A;  4NM2 A;  4WC7 A;  7ICR A;  3C2K A;  5CHG A;  2O1P A;  5CFS A;  3HX0 A;  5J0X A;  3TFS A;  4FH5 A;  4RPZ A;  5DDM A;  4OAG A;  3RJF A;  3K75 D;  4X4U A;  4AT8 A;  4RPX A;  2BBJ A;  1R8A A;  5HHI A;  3ERC C;  4LEW A;  2FMS A;  4UB1 A;  5J0U A;  1ZQV A;  5D4B A;  3OUY A;  1ZQN A;  2BCV A;  4K9A A;  8ICF A;  1ZQM A;  1ZQH A;  2BPC A;  5J2G A;  8ICN A;  8ICH A;  5IIJ A;  3B0Y A;  1ZQW A;  1TFY A;  4R65 A;  4O5E A;  5DB8 A;  1OU5 A;  3ISB A;  2ZH2 A;  4M47 A;  4RPY A;  4MF2 A;  4X4T A;  3PML A;  5B3P A;  1PX5 A;  3AQK A;  4KB6 A;  4JLZ A;  8ICG A;  3WFO A;  1ZQI A;  4IG8 A;  5D62 A;  4HX0 A;  1R89 A;  4PH5 A;  3NKU A;  3H37 A;  2DR8 A;  1XSL A;  4X4N A;  3PMN A;  2Q66 A;  4OAF A;  2IHO A;  4RWP A;  4IQW A;  7ICI A;  5IIO A;  1RPL A;  4KLT A;  2M2U A;  3NVO A;  8ICC A;  4RQ5 A;  4WC6 A;  5J2I A;  4UAW A;  2EWR A;  8ICX A;  5DB7 A;  1KNY A;  1BPX A;  9ICH A;  1RZT A;  2FCL A;  3C5F A;  3C2M A;  2IHM A;  4QZ8 A;  5HRE A;  5J2C A;  3RH6 A;  3B0X A;  4EEB A;  5DEC A;  4K96 A;  2RFF A;  4AT7 A;  1JMS A;  4NXZ A;  4I2C A;  1NO5 A;  3ER8 C;  4TUS A;  3UXN A;  4FHX A;  4YD1 A;  4KM5 A;  3RJG A;  5CHE A;  4P4M A;  7ICM A;  1ZQS A;  5DBB A;  3C18 A;  4JWM A;  2VAN A;  4DOA A;  4X4O A;  4KLS A;  4DO9 A;  2BCU A;  2ZH7 A;  4X4V A;  5CJ7 A;  4AT9 A;  1UEV A;  7ICP A;  2O5A A;  3OVB A;  1VFG A;  1KEJ A;  3RJI A;  3OGU A;  4X4R A;  1MIY A;  3LK9 A;  2I9G A;  4AT7 B;  5CFT A;  8ICT A;  7ICF A;  1ZQB A;  4K4G A;  4PPX A;  4I27 A;  2PXI A;  3AQM A;  1TV9 A;  4NXT A;  4K4H A;  4DOC A;  5D46 A;  4WC3 A;  1UET A;  4KLH A;  5HRF A;  4KLO A;  2M2W A;  7ICJ A;  7ICL A;  4LEV A;  2IUB A;  4QZH A;  5D49 A;  2ZH5 A;  1BPY A;  1TFW A;  9ICK A;  4QZF A;  4M9J A;  5BOM A;  5DDY A;  4WC4 A;  3CK6 A;  2M2T A;  4RT2 A;  2ZH6 A;  3RJH A;  4WC1 A;  9ICP A;  4WC5 A;  4I2F A;  4QZC A;  4I2G A;  7ICO A;  4QZB A;  4RQ3 A;  4I2I A;  4Z6D A;  4KLJ A;  5J2B A;  3HW8 A;  1KDH A;  7ICQ A;  4IQU A;  7ICT A;  1ZQF A;  3WFP A;  2BPF A;  4RQ0 A;  9ICJ A;  9ICU A;  2DVI A;  4EGW A;  4UAZ A;  4P2H A;  5III A;  1ZQX A;  2ZH4 A;  3RJE A;  4O5K A;  5HRD A;  4I2E A;  3RH4 A;  4I2A A;  4I2J A;  8ICY A;  4EED A;  4FHV A;  3OVS A;  4M0A A;  9ICN A;  4UAY A;  1XSN A;  3OVA A;  2W9M A;  4UD4 A;  4NXW A;  5IIN A;  8ICQ A;  4UD5 A;  4Z6E A;  5TZV A;  4WCW A;  5J0Q A;  4MFA A;  4F5N A;  8ICI A;  2PFP A;  1TVA A;  2GA9 D;  3C66 A;  5CFU A;  4QZA A;  4QZI A;  3RH5 A;  1JN3 A;  4TUR A;  2M2V A;  4XA5 A;  4NXX A;  4UB5 A;  2ISP A;  9ICM A;  4IQV A;  3AU6 A;  4WC2 A;  4RT3 A;  2BCQ A;  2BPG A;  1BPD A;  5DB6 A;  3PHZ A;  4NM1 A;  5D63 A;  4EP7 A;  4RWO A;  2HN2 A;  5CB1 A;  4OAH A;  5J2A A;  1Q78 A;  3JCF A;  8ICR A;  2HN1 A;  4RWN A;  4UBB A;  1V4A A;  3JPQ A;  4K98 A;  1ZQL A;  5CR0 A;  3PNC A;  4X4P A;  2DR7 A;  3OV7 A;  1UEU A;  4JLX A;  3V7L A;  9ICG A;  4XRH A;  5J0T A;  1ZQC A;  4O9M A;  2GWS A;  4NXU A;  4O69 A;  4X4S A;  4GXJ A;  8ICM A;  4UB2 A;  1MQ3 A;  4M2Y A;  9ICX A;  4FO1 A;  5IIK A;  4UBC A;  4JWN A;  4NXV A;  2ID1 A;  4WBZ A;  2BE3 A;  4KLI A;  3V72 A;  3HJ4 A;  3JPT A;  4WQL A;  3ISC A;  2FMQ A;  4P4P A;  4KLG A;  4I28 A;  4YCX A;  5BOL A;  8ICL A;  4NKU A;  4QZD A;  5J0R A;  3ISD A;  4ATB B;  5JTG A;  9ICE A;  9ICV A;  4IQT A;  7ICN A;  4M9L A;  4MFC A;  4LEZ A;  7ICS A;  4XQ7 A;  3MDC A;  3HWT A;  4O5C A;  5J2F A;  3C5G A;  1FA0 A;  4EBK A;  4LZG A;  4KLF A;  4YD2 A;  3WFR E;  3H39 A;  9ICA A;  5D61 A;  5HR9 A;  4F5O A;  4QZG A;  3UPQ A;  5DBC A;  9ICQ A;  2GAF D;  5B3Q A;  2B51 A;  4X0A A;  4PGY A;  1MIV A;  1YLQ A;  2PBE A;  3MGH A;  4R66 A;  4E7X A;  4E8F A;  4TUP A;  3UQ2 A;  4DOB A;  5HC9 A;  4RQ1 A;  4KLE A;  5HRI A;  3H38 A;  3WFS C;  4YN4 A;  5J0W A;  2BCR A;  4P4O A;  4XUS A;  3OWG A;  4R63 A;  5J2E A;  7ICE A;  4O68 A;  3GDX A;  5J0S A;  4KLM A;  5J2K A;  3RJK A;  2ZH8 A;  3TFR A;  5CP2 A;  8ICS A;  2DR9 A;  7ICH A;  5DB9 A;  2NRK A;  1MQ2 A;  4NLK A;  4PHA A;  1F5A A;  3JPS A;  5J0P A;  1JQR A;  4I2B A;  4QZ9 A;  4XJE A;  4I29 A;  1ZQZ A;  3ER9 B;  4KLQ A;  3MGI A;  3H3A A;  1NOM A;  5J0O A;  2DRA A;  3NYB A;  4LEY A;  3HJ1 A;  3C2L A;  8ICU A;  4F5R A;  4O67 A;  4NY8 A;  5HRK A;  1ZQJ A;  4RQ7 A;  4K4I A;  5HRL A;  2ZH9 A;  5BPC A;  3OUY B;  3JYY A;  2PFQ A;  5J2D A;  4S3N A;  4EV6 A;  2B4V A;  9ICR A;  2B56 A;  4M9N A; 
#chains in the Genus database with same CATH homology
 2DR5 A;  4FO1 A;  4AT9 A;  1UEV A;  3K7D A;  3OVB A;  4NXV A;  4X4R A;  2O1P A;  4FHW A;  3HJ4 A;  4AT7 B;  4WQL A;  5CFS A;  5CFT A;  4FH3 A;  4FH5 A;  4OAG A;  3MCR A;  4NXT A;  4K9B A;  4NKU A;  4N7R A;  2ZHA A;  4O69 A;  4X4U A;  1UET A;  4ATB B;  4AT8 B;  4AT8 A;  3HIY A;  4LEV A;  3ERC C;  1R8A A;  4LEW A;  4K8V A;  2ZH5 A;  3OUY A;  1TFW A;  4LEZ A;  4K9A A;  2ZH3 A;  1R8B A;  2ZH6 A;  1FA0 A;  4X4Q A;  5D61 A;  1TFY A;  4FHP A;  4E80 A;  2ZH2 A;  2GAF D;  5B3Q A;  2B51 A;  4OAI Z;  4X4T A;  2DVI A;  5B3P A;  4M5D A;  4E7X A;  4E8F A;  2ZH4 A;  4KB6 A;  4JLZ A;  4NXU A;  4FHV A;  3OVS A;  4HX0 A;  5D62 A;  1R89 A;  4NKT A;  3OVA A;  3NKU A;  2DR8 A;  1R8C A;  4UD4 A;  4NXW A;  4K99 A;  4X4N A;  3EF2 A;  2Q66 A;  4OAF A;  3OWG A;  2IHO A;  4UD5 A;  4O68 A;  4LT6 A;  2ZH8 A;  4O6A A;  4WH5 A;  4MKP A;  4AT9 B;  2ZHB A;  2DR9 A;  2GA9 D;  3C66 A;  4WQK A;  5CFU A;  2EWR A;  1F5A A;  2FCL A;  4NXX A;  4XJE A;  4K97 A;  3ER9 B;  3PHZ A;  4K96 A;  5D63 A;  4AT7 A;  4EP7 A;  4OAH A;  2DRA A;  3NYB A;  4LEY A;  1Q78 A;  3HJ1 A;  3ER8 C;  4FHY A;  1Q79 A;  4FHX A;  4KM5 A;  2HHP A;  1GPJ A;  4O67 A;  5CHE A;  4K98 A;  4X4P A;  2ZH9 A;  3OUY B;  3OV7 A;  2DR7 A;  2DRB A;  1UEU A;  4ATB A;  4JLX A;  4X4S A;  4X4O A;  4WOY A;  2ZH1 A;  2B4V A;  2B56 A;  2ZH7 A;  4X4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...