4NXWA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
325
Chain Sequence
MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxwA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxwA02
4WOYA 4NXXA 4ATBB 4O67A 4LEVA 4OAHA 4ATBA 4AT8B 4K99A 4AT8A 4KM5A 4O6AA 4OAIZ 4OAGA 4NXUA 4K97A 4K96A 4K98A 4LEWA 4NXWA 4K9BA 4OAFA 4O68A 4NXTA 4JLXA 4JLZA 4MKPA 4AT7B 4K9AA 4KB6A 4NXVA 4AT9B 4LEZA 4AT7A 4LEYA 4O69A 4AT9A 4K8VA
chains in the Genus database with same CATH superfamily
1ZQZA 4RPZA 4EV6A 9ICAA 1ZQXA 4E8FA 2DR5A 8ICXA 4EP7A 5CFUA 2ZH3A 4KM5A 4X0AA 1JMSA 4I2JA 1ZQCA 4UAYA 4NLZA 4KLQA 4NXWA 3WFPA 4QZBA 5HR9A 8ICAA 2ISOA 2BCRA 3RJJA 4QZ9A 1BPBA 2BPCA 4GXIA 9ICJA 3OVBA 4RQ5A 1JN3A 4I2AA 3OGUA 1JQRA 4LT6A 3H39A 4AT9A 3H3AA 8ICVA 4JWNA 4EEBA 4QZEA 3C18A 5HRBA 4RQ7A 4FO6A 8ICEA 1TV9A 8ICZA 4K97A 1BPDA 2B4VA 4TUPA 4R63A 4K4HA 7ICKA 4P4PA 2I9GA 2DR9A 1NOMA 4KLMA 5J0OA 3NVOA 5HRGA 2M2UA 4QZGA 4I2GA 3RH5A 1ZJNA 4E80A 2ZH1A 4JLZA 4IQTA 5CP2A 5EOZA 3RJEA 2ZH2A 4M9GA 4QZAA 3RJHA 3AU2A 3ISCA 4FHYA 2DR8A 4OAHA 5J2HA 4M9LA 4E7XA 4RWOA 4EGWA 4YD1A 4YMOA 1HUZA 5HC9A 7ICTA 1ZQQA 4EEDA 5J2CA 3K75D 4M0AA 4UB2A 4WH5A 9ICUA 2IHOA 3JPQA 3V7LA 4FHPA 2PFOA 4R66A 5CFTA 5HRHA 5CR0A 4ATBB 4QZCA 3HIYA 4YN4A 1KEJA 1ZQUA 7ICLA 3NKUA 5CWRA 4WQLA 3UXNA 5D4BA 3OV7A 4WC4A 7ICJA 4KLLA 4JLXA 4NXTA 1UETA 4EBJA 5DBCA 2ZH4A 3PHZA 7ICHA 1ZQHA 3TFRA 4KLDA 4O5KA 4I2FA 1Q79A 9ICOA 3UQ0A 3UPQA 3HWTA 2O5AA 4F5PA 2EWRA 4O6AA 4FHVA 4YCXA 3AQLA 5BPCA 4I29A 4UB1A 3ISDA 4NLKA 4QZDA 4XA5A 3HJ4A 4NKTA 3AQNA 4PHAA 8ICRA 4X4PA 4P2HA 3WFOA 4RQ6A 1R8AA 9ICRA 8ICCA 4RQ4A 2BCUA 3JPRA 3HX0A 4IQWA 4NXZA 7ICMA 4PHDA 9ICKA 1ZQMA 8ICJA 2FMPA 2ZHBA 1BPEA 4K99A 4WBZA 8ICLA 4WC1A 2BPFA 7ICRA 3MGIA 4UB4A 1ZQIA 4X5VA 3HJ1A 8ICOA 5D46A 4RPXA 4F5OA 4FH3A 5J2KA 5J0SA 3RJKA 4O9MA 4KLHA 8ICPA 4F5NA 4K4GA 4O69A 3C2LA 1ZQDA 2ZH6A 2DVIA 4LVSA 5DB6A 5CFSA 4MFAA 2PBEA 4AT8B 3UXOA 3L9DA 4XRHA 4M9JA 1XSPA 3RJIA 2M2TA 9ICXA 4K98A 1R8BA 4R65A 2GA9D 5J0UA 4I2HA 3MCRA 4F5RA 4FHXA 4K9BA 9ICLA 4RT3A 5IINA 3LK9A 2PFQA 5D62A 1ZQLA 3HW8A 4RWQA 3TFSA 4MKPA 4AT7B 5J2DA 4KB6A 4P4MA 1ZQSA 1ZQKA 4FHWA 2M2VA 2VANA 2O1PA 4I27A 4FH5A 2IHMA 4WC5A 4JWMA 3NYBA 4O67A 2HN2A 5J2FA 5CHEA 2RFFA 3OUYB 5IIKA 1VFGA 9ICNA 4X4QA 3MDCA 2FMSA 1MIVA 4WC3A 2BBJA 9ICBA 3NWIA 4YMNA 5DBBA 8ICUA 3B0YA 4N7RA 5IILA 1ZQJA 7ICGA 2PFPA 4S3NA 5DBAA 4KLIA 4X4TA 1OU5A 3UPSA 4UB5A 3AU6A 4NY8A 2HHPA 4UAZA 5BOMA 4YMMA 1ZQEA 2IUBA 3WFRE 9ICQA 4EBKA 5HHHA 4RWNA 4NXXA 3AUOA 5HRLA 4PHEA 3JZ0A 4TUQA 4PHPA 3JCFA 3JPTA 8ICWA 4OAIZ 1ZQYA 4OAGA 9ICFA 5CHGA 2ID1A 2FCLA 2DR7A 3EF2A 2Q66A 4RPYA 4RT2A 5J0PA 1FA0A 9ICMA 4OAFA 4RQ8A 5DB9A 2FMQA 4RQ1A 2ZH7A 4HX0A 3MDAA 5J0WA 2BE3A 4K9AA 4NXVA 4R64A 4AT9B 4I2CA 4KLFA 4XQ7A 4NM1A 7ICNA 5DB8A 9ICEA 7ICUA 4X4NA 3UQ2A 5CB1A 1XSNA 1YLQA 1MIYA 4QZ8A 1RZTA 7ICPA 4IQVA 5F2VO 8ICNA 4AT8A 4FO1A 9ICIA 2ISPA 2ZH9A 3C66A 4K4IA 3C5GA 1V4AA 4DO9A 3JYYA 5JTGA 2W9MA 4QZHA 4XJEA 4Z6EA 4WC7A 3RH4A 5J2JA 7ICFA 9ICVA 1PX5A 8ICGA 4Z6CA 2M2WA 4TURA 1F5AA 1R89A 3OVSA 1TFYA 3PMNA 7ICEA 4WC6A 3GDXA 5HRDA 4M47A 4X4VA 5J2IA 4NXUA 4XUSA 5DKWA 4X4SA 1VJ7A 5CA7A 5J0YA 3WFQE 4UBBA 9ICTA 1ZQBA 5J0TA 4X0BA 9ICHA 4X4OA 2BCVA 4GXKA 3MGHA 8ICQA 5IIJA 1ZQNA 4K8VA 1ZQVA 5TZVA 1NO5A 2PXIA 1ZQPA 4ATBA 3AQKA 4WC2A 5DECA 1MQ3A 7ICIA 1BPYA 1UEUA 1GPJA 4KLGA 8ICSA 1ZQFA 3H38A 3JPOA 4LZGA 5B3QA 4RWPA 4O5CA 7ICQA 7ICVA 4O68A 2B56A 3H37A 1KDHA 4KLTA 5DB7A 3B0XA 4QZFA 5DDMA 5HRIA 4DOAA 4I2EA 3OVAA 3K7DA 3PMLA 2DRBA 1JAJA 5B3PA 3AQMA 9ICSA 4M9HA 1UEVA 2GWSA 9ICGA 4M04A 4X4RA 3C5FA 1Q78A 1XSLA 3OWGA 3RH6A 7ICOA 1ZQAA 1RPLA 4WQKA 8ICHA 5J29A 5HRFA 4PPXA 2HN1A 4DOBA 1BPZA 1MQ2A 4I0UA 5J0RA 2PFNA 8ICFA 4Z6DA 8ICIA 2BPGA 2B51A 2BCSA 4WOYA 3V7JA 4I2IA 5HREA 3ERCC 4TUSA 9ICCA 5D49A 4MF8A 2P66A 1ZQOA 1ZQGA 4M5DA 4DOCA 4KLJA 4K96A 9ICPA 5CJ7A 4RQ3A 4KLSA 5D63A 4Z6FA 4PH5A 4RQ2A 3RJGA 5HRKA 8ICTA 1HUOA 5J0XA 5J2AA 5J2BA 4KLEA 1ZQWA 5IIMA 3LQCB 4NM2A 4F5QA 4GXJA 4IQUA 4UB3A 5J2GA 4PGXA 4RQ0A 4M2YA 1R8CA 4MFFA 1ZQRA 5HHIA 2ZH5A 3WFSC 4P4OA 4O5EA 4YD2A 3C2MA 5DDYA 2GAFD 2ZHAA 5J2EA 4UAWA 3MBYA 4LEWA 4UBCA 2ZH8A 4I2DA 3V72A 4I2BA 4UD5A 1MIWA 8ICYA 3C2KA 3V7KA 4NKUA 2BCQA 4WC0A 5DEDA 3ER8C 4M9NA 1ZQTA 5IIOA 5BOLA 3JPSA 8ICMA 4AT7A 4PGQA 2BBHA 2DRAA 1KNYA 8ICBA 7ICSA 3RJFA 5D61A 4KLUA 4X4UA 4UD4A 8ICKA 2NRKA 4LEVA 3OUYA 4MFCA 9ICWA 5J0QA 3JPPA 4NLNA 4MF2A 1TFWA 1ZJMA 5IIIA 4KLOA 3PNCA 4IG8A 4WCWA 4I28A 1BPXA 3CK6A 4PGYA 1WOTA 4LZDA 3ISBA 4QZIA 4WBYA 4LEZA 4XQ8A 4LEYA 3JPNA 3ER9B 3UXPA 1TVAA
chains in the Genus database with same CATH topology
1Q79A 4NXXA 4E8FA 3OVAA 2DR5A 3K7DA 4EP7A 5CFUA 2ZH3A 2EWRA 4KM5A 4O6AA 2DRBA 5B3PA 4OAIZ 4OAGA 4FHVA 1UEVA 2FCLA 2DR7A 3EF2A 2Q66A 4X4RA 1Q78A 4NXWA 3OWGA 3HJ4A 4NKTA 4WQKA 1FA0A 4OAFA 4X4PA 2ZH7A 4HX0A 1R8AA 4K9AA 4NXVA 4AT9B 3OVBA 4LT6A 4X4NA 4AT9A 2B51A 4WOYA 2ZHBA 3ERCC 4K99A 4AT8A 4FO1A 4M5DA 2ZH9A 3C66A 4K97A 4K96A 2B4VA 3HJ1A 5D63A 4FH3A 4XJEA 2DR9A 4E80A 2ZH1A 4JLZA 2ZH2A 1F5AA 1R89A 1R8CA 4O69A 3OVSA 1TFYA 2ZH6A 2DVIA 2ZH5A 4FHYA 2DR8A 5CFSA 4OAHA 4AT8B 4X4VA 4E7XA 2GAFD 2ZHAA 4NXUA 4K98A 1R8BA 2GA9D 4LEWA 4X4SA 2ZH8A 3MCRA 4FHXA 4K9BA 4UD5A 4NKUA 4WH5A 5D62A 2IHOA 3ER8C 4X4OA 4MKPA 4AT7B 4KB6A 4FHWA 4AT7A 2O1PA 4FHPA 2DRAA 4FH5A 4K8VA 5CFTA 5D61A 3NYBA 4ATBB 4X4UA 4UD4A 4O67A 4LEVA 4ATBA 5CHEA 3OUYB 3HIYA 1UEUA 3OUYA 1GPJA 4X4QA 1TFWA 4N7RA 3NKUA 4WQLA 5B3QA 4X4TA 3OV7A 4O68A 2B56A 4JLXA 4NXTA 1UETA 2HHPA 2ZH4A 4LEZA 3PHZA 4LEYA 3ER9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WOY A;  4NXX A;  4ATB B;  4O67 A;  4LEV A;  4OAH A;  4ATB A;  4AT8 B;  4K99 A;  4AT8 A;  4KM5 A;  4O6A A;  4OAI Z;  4OAG A;  4NXU A;  4K97 A;  4K96 A;  4K98 A;  4LEW A;  4NXW A;  4K9B A;  4OAF A;  4O68 A;  4NXT A;  4JLX A;  4JLZ A;  4MKP A;  4AT7 B;  4K9A A;  4KB6 A;  4NXV A;  4AT9 B;  4LEZ A;  4AT7 A;  4LEY A;  4O69 A;  4AT9 A;  4K8V A; 
#chains in the Genus database with same CATH topology
 1ZQZ A;  4RPZ A;  4EV6 A;  9ICA A;  1ZQX A;  4E8F A;  2DR5 A;  8ICX A;  4EP7 A;  5CFU A;  2ZH3 A;  4KM5 A;  4X0A A;  1JMS A;  4I2J A;  1ZQC A;  4UAY A;  4NLZ A;  4KLQ A;  4NXW A;  3WFP A;  4QZB A;  5HR9 A;  8ICA A;  2ISO A;  2BCR A;  3RJJ A;  4QZ9 A;  1BPB A;  2BPC A;  4GXI A;  9ICJ A;  3OVB A;  4RQ5 A;  1JN3 A;  4I2A A;  3OGU A;  1JQR A;  4LT6 A;  3H39 A;  4AT9 A;  3H3A A;  8ICV A;  4JWN A;  4EEB A;  4QZE A;  3C18 A;  5HRB A;  4RQ7 A;  4FO6 A;  8ICE A;  1TV9 A;  8ICZ A;  4K97 A;  1BPD A;  2B4V A;  4TUP A;  4R63 A;  4K4H A;  7ICK A;  4P4P A;  2I9G A;  2DR9 A;  1NOM A;  4KLM A;  5J0O A;  3NVO A;  5HRG A;  2M2U A;  4QZG A;  4I2G A;  3RH5 A;  1ZJN A;  4E80 A;  2ZH1 A;  4JLZ A;  4IQT A;  5CP2 A;  5EOZ A;  3RJE A;  2ZH2 A;  4M9G A;  4QZA A;  3RJH A;  3AU2 A;  3ISC A;  4FHY A;  2DR8 A;  4OAH A;  5J2H A;  4M9L A;  4E7X A;  4RWO A;  4EGW A;  4YD1 A;  4YMO A;  1HUZ A;  5HC9 A;  7ICT A;  1ZQQ A;  4EED A;  5J2C A;  3K75 D;  4M0A A;  4UB2 A;  4WH5 A;  9ICU A;  2IHO A;  3JPQ A;  3V7L A;  4FHP A;  2PFO A;  4R66 A;  5CFT A;  5HRH A;  5CR0 A;  4ATB B;  4QZC A;  3HIY A;  4YN4 A;  1KEJ A;  1ZQU A;  7ICL A;  3NKU A;  5CWR A;  4WQL A;  3UXN A;  5D4B A;  3OV7 A;  4WC4 A;  7ICJ A;  4KLL A;  4JLX A;  4NXT A;  1UET A;  4EBJ A;  5DBC A;  2ZH4 A;  3PHZ A;  7ICH A;  1ZQH A;  3TFR A;  4KLD A;  4O5K A;  4I2F A;  1Q79 A;  9ICO A;  3UQ0 A;  3UPQ A;  3HWT A;  2O5A A;  4F5P A;  2EWR A;  4O6A A;  4FHV A;  4YCX A;  3AQL A;  5BPC A;  4I29 A;  4UB1 A;  3ISD A;  4NLK A;  4QZD A;  4XA5 A;  3HJ4 A;  4NKT A;  3AQN A;  4PHA A;  8ICR A;  4X4P A;  4P2H A;  3WFO A;  4RQ6 A;  1R8A A;  9ICR A;  8ICC A;  4RQ4 A;  2BCU A;  3JPR A;  3HX0 A;  4IQW A;  4NXZ A;  7ICM A;  4PHD A;  9ICK A;  1ZQM A;  8ICJ A;  2FMP A;  2ZHB A;  1BPE A;  4K99 A;  4WBZ A;  8ICL A;  4WC1 A;  2BPF A;  7ICR A;  3MGI A;  4UB4 A;  1ZQI A;  4X5V A;  3HJ1 A;  8ICO A;  5D46 A;  4RPX A;  4F5O A;  4FH3 A;  5J2K A;  5J0S A;  3RJK A;  4O9M A;  4KLH A;  8ICP A;  4F5N A;  4K4G A;  4O69 A;  3C2L A;  1ZQD A;  2ZH6 A;  2DVI A;  4LVS A;  5DB6 A;  5CFS A;  4MFA A;  2PBE A;  4AT8 B;  3UXO A;  3L9D A;  4XRH A;  4M9J A;  1XSP A;  3RJI A;  2M2T A;  9ICX A;  4K98 A;  1R8B A;  4R65 A;  2GA9 D;  5J0U A;  4I2H A;  3MCR A;  4F5R A;  4FHX A;  4K9B A;  9ICL A;  4RT3 A;  5IIN A;  3LK9 A;  2PFQ A;  5D62 A;  1ZQL A;  3HW8 A;  4RWQ A;  3TFS A;  4MKP A;  4AT7 B;  5J2D A;  4KB6 A;  4P4M A;  1ZQS A;  1ZQK A;  4FHW A;  2M2V A;  2VAN A;  2O1P A;  4I27 A;  4FH5 A;  2IHM A;  4WC5 A;  4JWM A;  3NYB A;  4O67 A;  2HN2 A;  5J2F A;  5CHE A;  2RFF A;  3OUY B;  5IIK A;  1VFG A;  9ICN A;  4X4Q A;  3MDC A;  2FMS A;  1MIV A;  4WC3 A;  2BBJ A;  9ICB A;  3NWI A;  4YMN A;  5DBB A;  8ICU A;  3B0Y A;  4N7R A;  5IIL A;  1ZQJ A;  7ICG A;  2PFP A;  4S3N A;  5DBA A;  4KLI A;  4X4T A;  1OU5 A;  3UPS A;  4UB5 A;  3AU6 A;  4NY8 A;  2HHP A;  4UAZ A;  5BOM A;  4YMM A;  1ZQE A;  2IUB A;  3WFR E;  9ICQ A;  4EBK A;  5HHH A;  4RWN A;  4NXX A;  3AUO A;  5HRL A;  4PHE A;  3JZ0 A;  4TUQ A;  4PHP A;  3JCF A;  3JPT A;  8ICW A;  4OAI Z;  1ZQY A;  4OAG A;  9ICF A;  5CHG A;  2ID1 A;  2FCL A;  2DR7 A;  3EF2 A;  2Q66 A;  4RPY A;  4RT2 A;  5J0P A;  1FA0 A;  9ICM A;  4OAF A;  4RQ8 A;  5DB9 A;  2FMQ A;  4RQ1 A;  2ZH7 A;  4HX0 A;  3MDA A;  5J0W A;  2BE3 A;  4K9A A;  4NXV A;  4R64 A;  4AT9 B;  4I2C A;  4KLF A;  4XQ7 A;  4NM1 A;  7ICN A;  5DB8 A;  9ICE A;  7ICU A;  4X4N A;  3UQ2 A;  5CB1 A;  1XSN A;  1YLQ A;  1MIY A;  4QZ8 A;  1RZT A;  7ICP A;  4IQV A;  5F2V O;  8ICN A;  4AT8 A;  4FO1 A;  9ICI A;  2ISP A;  2ZH9 A;  3C66 A;  4K4I A;  3C5G A;  1V4A A;  4DO9 A;  3JYY A;  5JTG A;  2W9M A;  4QZH A;  4XJE A;  4Z6E A;  4WC7 A;  3RH4 A;  5J2J A;  7ICF A;  9ICV A;  1PX5 A;  8ICG A;  4Z6C A;  2M2W A;  4TUR A;  1F5A A;  1R89 A;  3OVS A;  1TFY A;  3PMN A;  7ICE A;  4WC6 A;  3GDX A;  5HRD A;  4M47 A;  4X4V A;  5J2I A;  4NXU A;  4XUS A;  5DKW A;  4X4S A;  1VJ7 A;  5CA7 A;  5J0Y A;  3WFQ E;  4UBB A;  9ICT A;  1ZQB A;  5J0T A;  4X0B A;  9ICH A;  4X4O A;  2BCV A;  4GXK A;  3MGH A;  8ICQ A;  5IIJ A;  1ZQN A;  4K8V A;  1ZQV A;  5TZV A;  1NO5 A;  2PXI A;  1ZQP A;  4ATB A;  3AQK A;  4WC2 A;  5DEC A;  1MQ3 A;  7ICI A;  1BPY A;  1UEU A;  1GPJ A;  4KLG A;  8ICS A;  1ZQF A;  3H38 A;  3JPO A;  4LZG A;  5B3Q A;  4RWP A;  4O5C A;  7ICQ A;  7ICV A;  4O68 A;  2B56 A;  3H37 A;  1KDH A;  4KLT A;  5DB7 A;  3B0X A;  4QZF A;  5DDM A;  5HRI A;  4DOA A;  4I2E A;  3OVA A;  3K7D A;  3PML A;  2DRB A;  1JAJ A;  5B3P A;  3AQM A;  9ICS A;  4M9H A;  1UEV A;  2GWS A;  9ICG A;  4M04 A;  4X4R A;  3C5F A;  1Q78 A;  1XSL A;  3OWG A;  3RH6 A;  7ICO A;  1ZQA A;  1RPL A;  4WQK A;  8ICH A;  5J29 A;  5HRF A;  4PPX A;  2HN1 A;  4DOB A;  1BPZ A;  1MQ2 A;  4I0U A;  5J0R A;  2PFN A;  8ICF A;  4Z6D A;  8ICI A;  2BPG A;  2B51 A;  2BCS A;  4WOY A;  3V7J A;  4I2I A;  5HRE A;  3ERC C;  4TUS A;  9ICC A;  5D49 A;  4MF8 A;  2P66 A;  1ZQO A;  1ZQG A;  4M5D A;  4DOC A;  4KLJ A;  4K96 A;  9ICP A;  5CJ7 A;  4RQ3 A;  4KLS A;  5D63 A;  4Z6F A;  4PH5 A;  4RQ2 A;  3RJG A;  5HRK A;  8ICT A;  1HUO A;  5J0X A;  5J2A A;  5J2B A;  4KLE A;  1ZQW A;  5IIM A;  3LQC B;  4NM2 A;  4F5Q A;  4GXJ A;  4IQU A;  4UB3 A;  5J2G A;  4PGX A;  4RQ0 A;  4M2Y A;  1R8C A;  4MFF A;  1ZQR A;  5HHI A;  2ZH5 A;  3WFS C;  4P4O A;  4O5E A;  4YD2 A;  3C2M A;  5DDY A;  2GAF D;  2ZHA A;  5J2E A;  4UAW A;  3MBY A;  4LEW A;  4UBC A;  2ZH8 A;  4I2D A;  3V72 A;  4I2B A;  4UD5 A;  1MIW A;  8ICY A;  3C2K A;  3V7K A;  4NKU A;  2BCQ A;  4WC0 A;  5DED A;  3ER8 C;  4M9N A;  1ZQT A;  5IIO A;  5BOL A;  3JPS A;  8ICM A;  4AT7 A;  4PGQ A;  2BBH A;  2DRA A;  1KNY A;  8ICB A;  7ICS A;  3RJF A;  5D61 A;  4KLU A;  4X4U A;  4UD4 A;  8ICK A;  2NRK A;  4LEV A;  3OUY A;  4MFC A;  9ICW A;  5J0Q A;  3JPP A;  4NLN A;  4MF2 A;  1TFW A;  1ZJM A;  5III A;  4KLO A;  3PNC A;  4IG8 A;  4WCW A;  4I28 A;  1BPX A;  3CK6 A;  4PGY A;  1WOT A;  4LZD A;  3ISB A;  4QZI A;  4WBY A;  4LEZ A;  4XQ8 A;  4LEY A;  3JPN A;  3ER9 B;  3UXP A;  1TVA A; 
#chains in the Genus database with same CATH homology
 1Q79 A;  4NXX A;  4E8F A;  3OVA A;  2DR5 A;  3K7D A;  4EP7 A;  5CFU A;  2ZH3 A;  2EWR A;  4KM5 A;  4O6A A;  2DRB A;  5B3P A;  4OAI Z;  4OAG A;  4FHV A;  1UEV A;  2FCL A;  2DR7 A;  3EF2 A;  2Q66 A;  4X4R A;  1Q78 A;  4NXW A;  3OWG A;  3HJ4 A;  4NKT A;  4WQK A;  1FA0 A;  4OAF A;  4X4P A;  2ZH7 A;  4HX0 A;  1R8A A;  4K9A A;  4NXV A;  4AT9 B;  3OVB A;  4LT6 A;  4X4N A;  4AT9 A;  2B51 A;  4WOY A;  2ZHB A;  3ERC C;  4K99 A;  4AT8 A;  4FO1 A;  4M5D A;  2ZH9 A;  3C66 A;  4K97 A;  4K96 A;  2B4V A;  3HJ1 A;  5D63 A;  4FH3 A;  4XJE A;  2DR9 A;  4E80 A;  2ZH1 A;  4JLZ A;  2ZH2 A;  1F5A A;  1R89 A;  1R8C A;  4O69 A;  3OVS A;  1TFY A;  2ZH6 A;  2DVI A;  2ZH5 A;  4FHY A;  2DR8 A;  5CFS A;  4OAH A;  4AT8 B;  4X4V A;  4E7X A;  2GAF D;  2ZHA A;  4NXU A;  4K98 A;  1R8B A;  2GA9 D;  4LEW A;  4X4S A;  2ZH8 A;  3MCR A;  4FHX A;  4K9B A;  4UD5 A;  4NKU A;  4WH5 A;  5D62 A;  2IHO A;  3ER8 C;  4X4O A;  4MKP A;  4AT7 B;  4KB6 A;  4FHW A;  4AT7 A;  2O1P A;  4FHP A;  2DRA A;  4FH5 A;  4K8V A;  5CFT A;  5D61 A;  3NYB A;  4ATB B;  4X4U A;  4UD4 A;  4O67 A;  4LEV A;  4ATB A;  5CHE A;  3OUY B;  3HIY A;  1UEU A;  3OUY A;  1GPJ A;  4X4Q A;  1TFW A;  4N7R A;  3NKU A;  4WQL A;  5B3Q A;  4X4T A;  3OV7 A;  4O68 A;  2B56 A;  4JLX A;  4NXT A;  1UET A;  2HHP A;  2ZH4 A;  4LEZ A;  3PHZ A;  4LEY A;  3ER9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...