4NXWA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
325
Chain Sequence
MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
total genus 109
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxwA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxwA02
4WOYA 4K9AA 4AT9B 4MKPA 4O67A 4K99A 4OAGA 4AT7A 4LEVA 4KM5A 4NXXA 4ATBB 4NXTA 4AT8A 4O69A 4NXVA 4AT8B 4JLXA 4JLZA 4OAHA 4AT7B 4LEZA 4K97A 4K8VA 4O6AA 4O68A 4OAFA 4ATBA 4KB6A 4K9BA 4AT9A 4LEYA 4NXUA 4LEWA 4NXWA 4K96A 4OAIZ 4K98A
chains in the Genus database with same CATH superfamily
4EV6A 8ICNA 4XQ8A 4RQ6A 8ICTA 4AT9B 2M2TA 1ZJMA 2ID1A 5J2EA 7ICSA 4DOAA 1MIYA 3C5GA 4AT8A 7ICTA 4NLKA 1ZQPA 3UXOA 4RQ7A 4JLZA 4I2FA 3JPNA 4ATBA 7ICUA 4IQWA 4M9GA 4IQUA 5HRHA 4IQTA 5DDMA 7ICHA 3LQCB 8ICLA 1ZQKA 3AU6A 1WOTA 3JPOA 5IILA 4YMMA 3NVOA 4YMNA 4UAZA 4YD2A 3MCRA 8ICAA 9ICXA 5D49A 7ICVA 5J0PA 4P4MA 4OAHA 4O68A 3H3AA 4F5QA 9ICAA 4Z6CA 3WFPA 2M2UA 3WFOA 4R64A 4NM1A 1VJ7A 4RQ1A 1KEJA 3WFQE 1Q78A 2O5AA 3C2MA 4MF2A 4FHXA 8ICFA 2BCVA 7ICKA 4Z6EA 4EBKA 2GAFD 4X4SA 4JWMA 8ICVA 5J2FA 4M47A 4I2EA 1UEVA 4PHPA 4K8VA 3JPSA 4M9HA 2BCQA 4LZGA 4TURA 4R66A 3MDAA 5HRKA 5HRIA 4K98A 5CR0A 4NXZA 1ZQFA 5CHEA 2PXIA 2FMSA 5CA7A 4KM5A 4RPXA 5BPCA 5J0SA 1XSLA 3C66A 8ICWA 4XJEA 1UEUA 1ZJNA 2B4VA 5BOMA 4RQ8A 3RH6A 3C2LA 4WC1A 2DVIA 5D61A 4I29A 3EF2A 3JPQA 7ICEA 1XSPA 1ZQRA 4DO9A 7ICGA 1NOMA 9ICVA 5HRGA 4NLZA 1HUZA 2IUBA 3ISBA 1KNYA 1VFGA 5J2HA 4F5OA 5DECA 4AT8B 3MGIA 3PMNA 3JCFA 4FH5A 5EOZA 1ZQNA 2BPFA 4I28A 8ICBA 3JYYA 4E7XA 5CB1A 8ICMA 2Q66A 4QZ9A 4FHPA 4I2AA 3HJ4A 5J2DA 2FMQA 4X4PA 9ICNA 1F5AA 1ZQTA 3V7JA 4YCXA 2I9GA 4WOYA 1TFWA 2PFQA 4X4NA 3ERCC 4AT7A 4EEDA 4ATBB 5J2JA 4GXKA 4I2HA 3V7LA 4I2CA 4O69A 4GXIA 4NXVA 4JWNA 4WQLA 5CWRA 4WH5A 4KLFA 4Z6DA 4RQ4A 5B3PA 1NO5A 4WC3A 4KLLA 4AT9A 2PFOA 1R89A 4LEWA 4NKUA 5J2AA 3OVSA 2ZH9A 3UPQA 4M0AA 4E8FA 4PGYA 4WBZA 8ICCA 8ICGA 4UB4A 4QZHA 3UXPA 5J0QA 1OU5A 5CFUA 4WC4A 2BBHA 3HIYA 4EGWA 3JPPA 4PH5A 4KLIA 9ICCA 9ICQA 4RWPA 4RQ3A 5HRFA 5JTGA 4FO6A 3H37A 4QZEA 4I0UA 4QZAA 3RJGA 4UB1A 4XRHA 3C5FA 2GA9D 3TFSA 5J0XA 9ICRA 7ICPA 3RJFA 4GXJA 9ICMA 4RQ5A 4KLQA 4KLGA 3H38A 3OUYA 5J0TA 1R8BA 1ZQOA 4FHWA 4O9MA 3OUYB 2PFPA 4QZGA 4PPXA 4UD4A 1ZQUA 5DB6A 3JPTA 8ICUA 9ICSA 4KB6A 4WBYA 3RJHA 1KDHA 4F5RA 5DBCA 1ZQMA 3AQKA 4NXUA 4UBBA 7ICNA 9ICPA 9ICEA 4RT2A 5BOLA 3TFRA 4KLUA 1ZQYA 8ICZA 2DRAA 4RQ2A 4X0AA 3MGHA 5D63A 4S3NA 3OVBA 9ICFA 2ISPA 2ZHBA 2BBJA 5DB8A 3NKUA 4WC6A 3PMLA 4MFFA 4M9NA 3C18A 3HWTA 4I2GA 4QZIA 3OWGA 5IIJA 2DR9A 1ZQSA 4KLDA 4UAYA 4M9LA 5J2KA 4LEZA 1BPDA 2B51A 4FO1A 4K9BA 8ICOA 4KLHA 8ICPA 3UQ2A 5J2GA 1JMSA 3MDCA 8ICHA 4DOCA 4NXWA 2DR8A 5IIKA 4QZCA 7ICIA 3RH4A 1TFYA 4LVSA 4I27A 4MFAA 5DBAA 1ZQDA 1MIWA 4MFCA 3H39A 4LT6A 2NRKA 3HJ1A 5J0OA 4NKTA 4DOBA 2BCSA 4XUSA 4X4RA 4N7RA 1HUOA 4MF8A 5HC9A 4WQKA 5DDYA 5B3QA 1TVAA 1ZQEA 4K97A 5DKWA 1V4AA 2BE3A 1JQRA 1PX5A 3AQNA 2PFNA 5DBBA 4PHAA 1TV9A 4R63A 4PHEA 2EWRA 5HRLA 5D46A 1ZQWA 9ICKA 2ZH1A 1MIVA 9ICWA 2HHPA 9ICTA 1JN3A 4YD1A 4TUQA 4X4TA 4O67A 5F2VO 4OAGA 4X4OA 3JPRA 5CP2A 4I2DA 4K4IA 4XA5A 4O5CA 3AQLA 4UB3A 1ZQQA 4KLEA 3UXNA 3WFRE 4FHYA 3OVAA 8ICQA 5IIMA 4E80A 2ZH7A 5J0WA 2HN2A 4I2IA 4F5PA 1BPEA 4WC2A 4M5DA 9ICGA 4P4PA 1ZQCA 4K96A 4RWOA 2ZH3A 3AUOA 1ZQZA 4EEBA 8ICIA 1JAJA 4M04A 4MKPA 5HHHA 5DB9A 3K7DA 8ICJA 7ICRA 2ZH8A 3GDXA 4PGQA 1R8CA 4P2HA 4FHVA 4PHDA 3RJKA 3OGUA 5D62A 4HX0A 4RT3A 4QZDA 4AT7B 4YN4A 8ICEA 9ICJA 4M2YA 5J2CA 4LZDA 4X4VA 5DB7A 1ZQAA 1ZQHA 4LEYA 4UB2A 2FMPA 2ZHAA 1BPYA 2HN1A 4IQVA 9ICLA 4OAIZ 2W9MA 2M2VA 5J29A 2B56A 4UAWA 5CJ7A 7ICLA 4KLMA 4LEVA 2ZH4A 3PNCA 4RPZA 9ICHA 3PHZA 5TZVA 1GPJA 2RFFA 2M2WA 8ICXA 3OV7A 3RH5A 2BPCA 3HX0A 3ISDA 4KLJA 5CHGA 5IIOA 3NWIA 3AU2A 8ICYA 3RJJA 3V72A 4WCWA 1YLQA 3C2KA 3RJEA 4XQ7A 5IIIA 4I2JA 3MBYA 4EBJA 3UPSA 2ZH5A 1ZQVA 3JZ0A 4RWNA 4X5VA 4K9AA 4K99A 5HR9A 1ZQJA 4RWQA 7ICFA 4NXXA 2DRBA 7ICMA 4IG8A 5HRBA 4P4OA 4Z6FA 3K75D 4EP7A 3B0XA 1ZQIA 4KLOA 3RJIA 1XSNA 4UD5A 5J2BA 7ICJA 1ZQLA 4KLSA 4O6AA 2ZH2A 5DEDA 2ISOA 4O5KA 5J0UA 4X4UA 5J0RA 4RPYA 8ICKA 1UETA 2IHOA 3B0YA 4TUSA 1MQ3A 4X0BA 7ICOA 1Q79A 4UBCA 1ZQBA 4I2BA 4WC0A 4KLTA 3AQMA 2PBEA 1BPBA 4QZ8A 5IINA 4QZBA 1FA0A 2GWSA 4NLNA 3LK9A 8ICSA 9ICIA 1R8AA 5CFTA 3ISCA 4YMOA 3HW8A 4WC5A 1ZQGA 2BCRA 2IHMA 5CFSA 5HREA 3NYBA 1RPLA 9ICUA 5HHIA 1BPXA 4RQ0A 8ICRA 1MQ2A 3ER9B 4F5NA 4NY8A 2DR5A 3WFSC 2VANA 3V7KA 4K4GA 4QZFA 4TUPA 4NXTA 5D4BA 4K4HA 4M9JA 2O1PA 4X4QA 3CK6A 4PGXA 1BPZA 9ICOA 3UQ0A 4WC7A 4JLXA 5HRDA 2BPGA 2BCUA 9ICBA 7ICQA 2DR7A 4NM2A 2ZH6A 2FCLA 4OAFA 5J0YA 4UB5A 1ZQXA 4O5EA 4R65A 2P66A 1RZTA 3ER8C 4FH3A 3L9DA 5J2IA
chains in the Genus database with same CATH topology
2B56A 2DRAA 4AT9B 5D63A 3OVBA 4LEVA 2ZHBA 2ZH4A 4AT8A 3NKUA 3PHZA 1GPJA 4AT8B 3OV7A 3OWGA 2DR9A 4FH5A 4JLZA 4LEZA 2B51A 4FO1A 4ATBA 4K9BA 4E7XA 2Q66A 4FHPA 4NXWA 3HJ4A 4X4PA 2ZH5A 2DR8A 1F5AA 1TFYA 4WOYA 4K9AA 4K99A 1TFWA 4X4NA 3ERCC 4AT7A 4LT6A 3MCRA 4ATBB 3HJ1A 4NXXA 2DRBA 4NKTA 4O69A 4X4RA 4N7RA 4NXVA 4EP7A 4WQKA 4WQLA 5B3QA 4UD5A 4OAHA 4WH5A 4K97A 4O6AA 4O68A 2ZH2A 5B3PA 4AT9A 1R89A 4X4UA 4LEWA 4NKUA 2EWRA 3OVSA 2ZH9A 1UETA 2ZH1A 2IHOA 2HHPA 4E8FA 1Q78A 4X4TA 4O67A 4OAGA 4FHXA 4X4OA 1Q79A 2GAFD 4X4SA 1FA0A 5CFUA 4FHYA 3OVAA 3HIYA 1R8AA 1UEVA 5CFTA 4K8VA 4E80A 2ZH7A 4M5DA 5CFSA 4K96A 2ZH3A 2GA9D 4K98A 3NYBA 3ER9B 2DR5A 4MKPA 5CHEA 3OUYA 3K7DA 1R8BA 4FHWA 4KM5A 2ZH8A 4NXTA 1R8CA 3OUYB 4FHVA 2O1PA 4X4QA 5D62A 3C66A 4JLXA 4HX0A 4UD4A 2DR7A 4XJEA 4AT7B 2ZH6A 1UEUA 2FCLA 4OAFA 4KB6A 4X4VA 2B4VA 4LEYA 4NXUA 3ER8C 2ZHAA 4FH3A 2DVIA 5D61A 3EF2A 4OAIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WOY A;  4K9A A;  4AT9 B;  4MKP A;  4O67 A;  4K99 A;  4OAG A;  4AT7 A;  4LEV A;  4KM5 A;  4NXX A;  4ATB B;  4NXT A;  4AT8 A;  4O69 A;  4NXV A;  4AT8 B;  4JLX A;  4JLZ A;  4OAH A;  4AT7 B;  4LEZ A;  4K97 A;  4K8V A;  4O6A A;  4O68 A;  4OAF A;  4ATB A;  4KB6 A;  4K9B A;  4AT9 A;  4LEY A;  4NXU A;  4LEW A;  4NXW A;  4K96 A;  4OAI Z;  4K98 A; 
#chains in the Genus database with same CATH topology
 4EV6 A;  8ICN A;  4XQ8 A;  4RQ6 A;  8ICT A;  4AT9 B;  2M2T A;  1ZJM A;  2ID1 A;  5J2E A;  7ICS A;  4DOA A;  1MIY A;  3C5G A;  4AT8 A;  7ICT A;  4NLK A;  1ZQP A;  3UXO A;  4RQ7 A;  4JLZ A;  4I2F A;  3JPN A;  4ATB A;  7ICU A;  4IQW A;  4M9G A;  4IQU A;  5HRH A;  4IQT A;  5DDM A;  7ICH A;  3LQC B;  8ICL A;  1ZQK A;  3AU6 A;  1WOT A;  3JPO A;  5IIL A;  4YMM A;  3NVO A;  4YMN A;  4UAZ A;  4YD2 A;  3MCR A;  8ICA A;  9ICX A;  5D49 A;  7ICV A;  5J0P A;  4P4M A;  4OAH A;  4O68 A;  3H3A A;  4F5Q A;  9ICA A;  4Z6C A;  3WFP A;  2M2U A;  3WFO A;  4R64 A;  4NM1 A;  1VJ7 A;  4RQ1 A;  1KEJ A;  3WFQ E;  1Q78 A;  2O5A A;  3C2M A;  4MF2 A;  4FHX A;  8ICF A;  2BCV A;  7ICK A;  4Z6E A;  4EBK A;  2GAF D;  4X4S A;  4JWM A;  8ICV A;  5J2F A;  4M47 A;  4I2E A;  1UEV A;  4PHP A;  4K8V A;  3JPS A;  4M9H A;  2BCQ A;  4LZG A;  4TUR A;  4R66 A;  3MDA A;  5HRK A;  5HRI A;  4K98 A;  5CR0 A;  4NXZ A;  1ZQF A;  5CHE A;  2PXI A;  2FMS A;  5CA7 A;  4KM5 A;  4RPX A;  5BPC A;  5J0S A;  1XSL A;  3C66 A;  8ICW A;  4XJE A;  1UEU A;  1ZJN A;  2B4V A;  5BOM A;  4RQ8 A;  3RH6 A;  3C2L A;  4WC1 A;  2DVI A;  5D61 A;  4I29 A;  3EF2 A;  3JPQ A;  7ICE A;  1XSP A;  1ZQR A;  4DO9 A;  7ICG A;  1NOM A;  9ICV A;  5HRG A;  4NLZ A;  1HUZ A;  2IUB A;  3ISB A;  1KNY A;  1VFG A;  5J2H A;  4F5O A;  5DEC A;  4AT8 B;  3MGI A;  3PMN A;  3JCF A;  4FH5 A;  5EOZ A;  1ZQN A;  2BPF A;  4I28 A;  8ICB A;  3JYY A;  4E7X A;  5CB1 A;  8ICM A;  2Q66 A;  4QZ9 A;  4FHP A;  4I2A A;  3HJ4 A;  5J2D A;  2FMQ A;  4X4P A;  9ICN A;  1F5A A;  1ZQT A;  3V7J A;  4YCX A;  2I9G A;  4WOY A;  1TFW A;  2PFQ A;  4X4N A;  3ERC C;  4AT7 A;  4EED A;  4ATB B;  5J2J A;  4GXK A;  4I2H A;  3V7L A;  4I2C A;  4O69 A;  4GXI A;  4NXV A;  4JWN A;  4WQL A;  5CWR A;  4WH5 A;  4KLF A;  4Z6D A;  4RQ4 A;  5B3P A;  1NO5 A;  4WC3 A;  4KLL A;  4AT9 A;  2PFO A;  1R89 A;  4LEW A;  4NKU A;  5J2A A;  3OVS A;  2ZH9 A;  3UPQ A;  4M0A A;  4E8F A;  4PGY A;  4WBZ A;  8ICC A;  8ICG A;  4UB4 A;  4QZH A;  3UXP A;  5J0Q A;  1OU5 A;  5CFU A;  4WC4 A;  2BBH A;  3HIY A;  4EGW A;  3JPP A;  4PH5 A;  4KLI A;  9ICC A;  9ICQ A;  4RWP A;  4RQ3 A;  5HRF A;  5JTG A;  4FO6 A;  3H37 A;  4QZE A;  4I0U A;  4QZA A;  3RJG A;  4UB1 A;  4XRH A;  3C5F A;  2GA9 D;  3TFS A;  5J0X A;  9ICR A;  7ICP A;  3RJF A;  4GXJ A;  9ICM A;  4RQ5 A;  4KLQ A;  4KLG A;  3H38 A;  3OUY A;  5J0T A;  1R8B A;  1ZQO A;  4FHW A;  4O9M A;  3OUY B;  2PFP A;  4QZG A;  4PPX A;  4UD4 A;  1ZQU A;  5DB6 A;  3JPT A;  8ICU A;  9ICS A;  4KB6 A;  4WBY A;  3RJH A;  1KDH A;  4F5R A;  5DBC A;  1ZQM A;  3AQK A;  4NXU A;  4UBB A;  7ICN A;  9ICP A;  9ICE A;  4RT2 A;  5BOL A;  3TFR A;  4KLU A;  1ZQY A;  8ICZ A;  2DRA A;  4RQ2 A;  4X0A A;  3MGH A;  5D63 A;  4S3N A;  3OVB A;  9ICF A;  2ISP A;  2ZHB A;  2BBJ A;  5DB8 A;  3NKU A;  4WC6 A;  3PML A;  4MFF A;  4M9N A;  3C18 A;  3HWT A;  4I2G A;  4QZI A;  3OWG A;  5IIJ A;  2DR9 A;  1ZQS A;  4KLD A;  4UAY A;  4M9L A;  5J2K A;  4LEZ A;  1BPD A;  2B51 A;  4FO1 A;  4K9B A;  8ICO A;  4KLH A;  8ICP A;  3UQ2 A;  5J2G A;  1JMS A;  3MDC A;  8ICH A;  4DOC A;  4NXW A;  2DR8 A;  5IIK A;  4QZC A;  7ICI A;  3RH4 A;  1TFY A;  4LVS A;  4I27 A;  4MFA A;  5DBA A;  1ZQD A;  1MIW A;  4MFC A;  3H39 A;  4LT6 A;  2NRK A;  3HJ1 A;  5J0O A;  4NKT A;  4DOB A;  2BCS A;  4XUS A;  4X4R A;  4N7R A;  1HUO A;  4MF8 A;  5HC9 A;  4WQK A;  5DDY A;  5B3Q A;  1TVA A;  1ZQE A;  4K97 A;  5DKW A;  1V4A A;  2BE3 A;  1JQR A;  1PX5 A;  3AQN A;  2PFN A;  5DBB A;  4PHA A;  1TV9 A;  4R63 A;  4PHE A;  2EWR A;  5HRL A;  5D46 A;  1ZQW A;  9ICK A;  2ZH1 A;  1MIV A;  9ICW A;  2HHP A;  9ICT A;  1JN3 A;  4YD1 A;  4TUQ A;  4X4T A;  4O67 A;  5F2V O;  4OAG A;  4X4O A;  3JPR A;  5CP2 A;  4I2D A;  4K4I A;  4XA5 A;  4O5C A;  3AQL A;  4UB3 A;  1ZQQ A;  4KLE A;  3UXN A;  3WFR E;  4FHY A;  3OVA A;  8ICQ A;  5IIM A;  4E80 A;  2ZH7 A;  5J0W A;  2HN2 A;  4I2I A;  4F5P A;  1BPE A;  4WC2 A;  4M5D A;  9ICG A;  4P4P A;  1ZQC A;  4K96 A;  4RWO A;  2ZH3 A;  3AUO A;  1ZQZ A;  4EEB A;  8ICI A;  1JAJ A;  4M04 A;  4MKP A;  5HHH A;  5DB9 A;  3K7D A;  8ICJ A;  7ICR A;  2ZH8 A;  3GDX A;  4PGQ A;  1R8C A;  4P2H A;  4FHV A;  4PHD A;  3RJK A;  3OGU A;  5D62 A;  4HX0 A;  4RT3 A;  4QZD A;  4AT7 B;  4YN4 A;  8ICE A;  9ICJ A;  4M2Y A;  5J2C A;  4LZD A;  4X4V A;  5DB7 A;  1ZQA A;  1ZQH A;  4LEY A;  4UB2 A;  2FMP A;  2ZHA A;  1BPY A;  2HN1 A;  4IQV A;  9ICL A;  4OAI Z;  2W9M A;  2M2V A;  5J29 A;  2B56 A;  4UAW A;  5CJ7 A;  7ICL A;  4KLM A;  4LEV A;  2ZH4 A;  3PNC A;  4RPZ A;  9ICH A;  3PHZ A;  5TZV A;  1GPJ A;  2RFF A;  2M2W A;  8ICX A;  3OV7 A;  3RH5 A;  2BPC A;  3HX0 A;  3ISD A;  4KLJ A;  5CHG A;  5IIO A;  3NWI A;  3AU2 A;  8ICY A;  3RJJ A;  3V72 A;  4WCW A;  1YLQ A;  3C2K A;  3RJE A;  4XQ7 A;  5III A;  4I2J A;  3MBY A;  4EBJ A;  3UPS A;  2ZH5 A;  1ZQV A;  3JZ0 A;  4RWN A;  4X5V A;  4K9A A;  4K99 A;  5HR9 A;  1ZQJ A;  4RWQ A;  7ICF A;  4NXX A;  2DRB A;  7ICM A;  4IG8 A;  5HRB A;  4P4O A;  4Z6F A;  3K75 D;  4EP7 A;  3B0X A;  1ZQI A;  4KLO A;  3RJI A;  1XSN A;  4UD5 A;  5J2B A;  7ICJ A;  1ZQL A;  4KLS A;  4O6A A;  2ZH2 A;  5DED A;  2ISO A;  4O5K A;  5J0U A;  4X4U A;  5J0R A;  4RPY A;  8ICK A;  1UET A;  2IHO A;  3B0Y A;  4TUS A;  1MQ3 A;  4X0B A;  7ICO A;  1Q79 A;  4UBC A;  1ZQB A;  4I2B A;  4WC0 A;  4KLT A;  3AQM A;  2PBE A;  1BPB A;  4QZ8 A;  5IIN A;  4QZB A;  1FA0 A;  2GWS A;  4NLN A;  3LK9 A;  8ICS A;  9ICI A;  1R8A A;  5CFT A;  3ISC A;  4YMO A;  3HW8 A;  4WC5 A;  1ZQG A;  2BCR A;  2IHM A;  5CFS A;  5HRE A;  3NYB A;  1RPL A;  9ICU A;  5HHI A;  1BPX A;  4RQ0 A;  8ICR A;  1MQ2 A;  3ER9 B;  4F5N A;  4NY8 A;  2DR5 A;  3WFS C;  2VAN A;  3V7K A;  4K4G A;  4QZF A;  4TUP A;  4NXT A;  5D4B A;  4K4H A;  4M9J A;  2O1P A;  4X4Q A;  3CK6 A;  4PGX A;  1BPZ A;  9ICO A;  3UQ0 A;  4WC7 A;  4JLX A;  5HRD A;  2BPG A;  2BCU A;  9ICB A;  7ICQ A;  2DR7 A;  4NM2 A;  2ZH6 A;  2FCL A;  4OAF A;  5J0Y A;  4UB5 A;  1ZQX A;  4O5E A;  4R65 A;  2P66 A;  1RZT A;  3ER8 C;  4FH3 A;  3L9D A;  5J2I A; 
#chains in the Genus database with same CATH homology
 2B56 A;  2DRA A;  4AT9 B;  5D63 A;  3OVB A;  4LEV A;  2ZHB A;  2ZH4 A;  4AT8 A;  3NKU A;  3PHZ A;  1GPJ A;  4AT8 B;  3OV7 A;  3OWG A;  2DR9 A;  4FH5 A;  4JLZ A;  4LEZ A;  2B51 A;  4FO1 A;  4ATB A;  4K9B A;  4E7X A;  2Q66 A;  4FHP A;  4NXW A;  3HJ4 A;  4X4P A;  2ZH5 A;  2DR8 A;  1F5A A;  1TFY A;  4WOY A;  4K9A A;  4K99 A;  1TFW A;  4X4N A;  3ERC C;  4AT7 A;  4LT6 A;  3MCR A;  4ATB B;  3HJ1 A;  4NXX A;  2DRB A;  4NKT A;  4O69 A;  4X4R A;  4N7R A;  4NXV A;  4EP7 A;  4WQK A;  4WQL A;  5B3Q A;  4UD5 A;  4OAH A;  4WH5 A;  4K97 A;  4O6A A;  4O68 A;  2ZH2 A;  5B3P A;  4AT9 A;  1R89 A;  4X4U A;  4LEW A;  4NKU A;  2EWR A;  3OVS A;  2ZH9 A;  1UET A;  2ZH1 A;  2IHO A;  2HHP A;  4E8F A;  1Q78 A;  4X4T A;  4O67 A;  4OAG A;  4FHX A;  4X4O A;  1Q79 A;  2GAF D;  4X4S A;  1FA0 A;  5CFU A;  4FHY A;  3OVA A;  3HIY A;  1R8A A;  1UEV A;  5CFT A;  4K8V A;  4E80 A;  2ZH7 A;  4M5D A;  5CFS A;  4K96 A;  2ZH3 A;  2GA9 D;  4K98 A;  3NYB A;  3ER9 B;  2DR5 A;  4MKP A;  5CHE A;  3OUY A;  3K7D A;  1R8B A;  4FHW A;  4KM5 A;  2ZH8 A;  4NXT A;  1R8C A;  3OUY B;  4FHV A;  2O1P A;  4X4Q A;  5D62 A;  3C66 A;  4JLX A;  4HX0 A;  4UD4 A;  2DR7 A;  4XJE A;  4AT7 B;  2ZH6 A;  1UEU A;  2FCL A;  4OAF A;  4KB6 A;  4X4V A;  2B4V A;  4LEY A;  4NXU A;  3ER8 C;  2ZHA A;  4FH3 A;  2DVI A;  5D61 A;  3EF2 A;  4OAI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...