4NXWA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
325
Chain Sequence
b'MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxwA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxwA02
4O68A 4KM5A 4AT9B 4AT8A 4NXTA 4O67A 4AT8B 4OAHA 4NXWA 4KB6A 4K8VA 4JLXA 4JLZA 4K9AA 4LEYA 4O6AA 4O69A 4K99A 4LEVA 4OAFA 4LEZA 4NXXA 4ATBB 4ATBA 4NXVA 4WOYA 4AT7B 4AT7A 4LEWA 4K9BA 4K98A 4K96A 4OAIZ 4MKPA 4OAGA 4NXUA 4K97A 4AT9A
chains in the Genus database with same CATH superfamily
4X4OA 3LQCB 2IHOA 3H37A 4M9HA 3AU2A 4WC5A 4Z6FA 4Z6EA 4RT3A 4KLUA 4WC0A 4FHVA 5J2HA 2PFNA 4KLSA 3RJJA 4EP7A 4NM2A 4JLZA 4WC4A 4OAFA 4JWNA 2FMSA 4I2AA 4M9JA 2M2WA 3WFOA 1MIVA 2EWRA 9ICXA 1ZQYA 5J2DA 5DB6A 5DB9A 4YMOA 3TFSA 1TFWA 5IINA 3JYYA 3UPSA 4O5KA 3C66A 4AT9A 5CHEA 4YD1A 4MFFA 4NXTA 4I2EA 4Z6CA 1MIWA 4XA5A 5DBBA 4RQ6A 4X4SA 4X4PA 4UBBA 4YN4A 3UQ0A 1ZJNA 4X4NA 1ZJMA 5HRIA 4PGQA 8ICIA 5D63A 5BOMA 2DRBA 2B56A 4RT2A 4K4IA 4KLHA 4WC2A 1MQ2A 5HRKA 2ZHAA 1BPBA 1NOMA 4UB1A 4O6AA 3B0YA 7ICLA 4IQTA 1ZQDA 1TFYA 4I2FA 2ZH9A 1ZQEA 4RPZA 4UBCA 4OAGA 4DOAA 4X4UA 4RQ2A 1ZQSA 4LZGA 5CFTA 4AT8B 1R89A 2BBJA 4WC6A 3JPRA 4LVSA 4MFCA 9ICRA 2HN1A 5D62A 4O69A 3MGIA 7ICHA 4ATBB 4F5PA 5J0SA 5HRDA 4DOBA 5J0TA 7ICUA 4RQ3A 4LEWA 3OUYA 2I9GA 7ICNA 4K98A 5J0RA 5DDYA 3AU6A 4IQWA 1JN3A 1ZQFA 3PHZA 3JPTA 4PHEA 2GA9D 3JZ0A 7ICOA 4PHAA 2RFFA 1ZQAA 4N7RA 8ICOA 4UAYA 5F2VO 2PFQA 4RQ5A 3JPSA 2O1PA 4R65A 4NXZA 5J2FA 3H38A 4I27A 4WQKA 4M2YA 4FHXA 9ICUA 4WH5A 2ZH2A 1ZQOA 8ICTA 4RWOA 1XSNA 5HRFA 4O5EA 2DVIA 2PFOA 3GDXA 9ICNA 4X4QA 3V7JA 1ZQZA 5J2GA 9ICFA 2M2VA 4K8VA 4P4MA 1ZQRA 3V7LA 5CFSA 3C5GA 4GXIA 4I2CA 4GXJA 1ZQNA 4LEYA 8ICAA 4XJEA 2FCLA 5J2CA 1HUZA 4KLLA 4KLQA 4FHWA 3HJ1A 4P2HA 5J2BA 7ICTA 4QZFA 4RQ0A 1ZQHA 8ICKA 2DR5A 4PH5A 4HX0A 2IHMA 2BE3A 5CHGA 4RQ4A 3RJEA 9ICKA 1R8BA 8ICWA 5J29A 5CA7A 1KNYA 4UB3A 4E80A 3ISDA 4JLXA 3TFRA 3ISBA 1BPDA 4IG8A 4X4VA 4E7XA 3V7KA 1RZTA 5IIIA 3RJFA 4I2GA 3RJIA 4M9GA 4F5RA 2ISOA 4EEDA 4KLJA 7ICQA 4RWNA 4YMMA 9ICAA 1ZQLA 3JPQA 5J2IA 3OV7A 4QZEA 9ICGA 4MFAA 4OAHA 3ISCA 2ZH4A 3JPPA 3AUOA 3MDCA 4KLTA 2ZHBA 1ZQIA 7ICKA 4O9MA 4PGYA 8ICXA 8ICCA 3L9DA 4PHPA 4EV6A 4LT6A 4YD2A 4TURA 4FH5A 4JWMA 4I29A 3UXOA 1RPLA 5DBAA 3OUYB 5J0QA 2BBHA 4EBJA 1WOTA 1XSLA 3RJKA 5IIKA 9ICSA 1ZQMA 8ICSA 3OVBA 3MGHA 3B0XA 1UETA 4XQ8A 1F5AA 4FHPA 3C2KA 4LZDA 4X0AA 4F5QA 1GPJA 1VFGA 1ZQPA 4R63A 5IIMA 4PPXA 5BPCA 3PNCA 1FA0A 8ICRA 4R66A 5CJ7A 1MIYA 3NVOA 2W9MA 3MBYA 5HC9A 4I2JA 3RH6A 4NY8A 8ICJA 1BPXA 9ICCA 9ICTA 4NLZA 8ICPA 1Q79A 2BCQA 4AT7A 8ICNA 4I2IA 3PMLA 3RJHA 1YLQA 1UEUA 1ZQXA 1TVAA 2HN2A 2GAFD 4KLOA 3HX0A 2BCSA 4O68A 3JPNA 4UD5A 8ICBA 7ICVA 1NO5A 4EBKA 4MF8A 5CWRA 5DDMA 4NXWA 3ER9B 5CB1A 5J2EA 4QZBA 2PXIA 7ICSA 3H39A 1VJ7A 4FO6A 1ZQQA 7ICFA 5J2JA 5DKWA 5HRBA 1JQRA 5D61A 3C2LA 4MKPA 3AQNA 4UAWA 5J0PA 3HJ4A 3UPQA 2ZH6A 1ZQUA 4AT8A 4O67A 5CR0A 7ICPA 2P66A 4M9LA 9ICJA 1ZQBA 3HIYA 2DR7A 4QZGA 3ER8C 4WC7A 4UB5A 4QZ9A 4FO1A 8ICUA 4K4GA 1Q78A 4I2HA 4M0AA 3C2MA 1BPZA 4TUQA 4DO9A 1OU5A 4I0UA 3PMNA 1PX5A 3RH4A 5HR9A 2ZH5A 4RPXA 4AT9B 4KM5A 3H3AA 2BCVA 4NKUA 4MF2A 3CK6A 4XUSA 5HRGA 9ICLA 4UD4A 3NKUA 3AQLA 4WBYA 1ZQKA 2GWSA 2ZH8A 9ICPA 5J2KA 1HUOA 9ICQA 4K9AA 4QZAA 4M9NA 4K99A 3OVAA 4FH3A 4LEZA 4KLIA 8ICHA 3OVSA 9ICBA 8ICEA 4NLKA 8ICFA 7ICGA 4X4TA 4Z6DA 5IIJA 3HW8A 2ZH3A 2BPGA 8ICVA 8ICGA 1ZQTA 4M47A 4I28A 7ICJA 4QZHA 3MDAA 4I2BA 1BPYA 5DEDA 4M5DA 1BPEA 4PHDA 5DECA 2DRAA 1ZQVA 4KLMA 4KLGA 2VANA 5DB7A 4RWQA 5D46A 5D4BA 2NRKA 4RPYA 3WFRE 4P4OA 2ZH7A 3AQMA 1ZQGA 8ICMA 4WC1A 3OGUA 4AT7B 8ICYA 4X5VA 2O5AA 5CP2A 5D49A 4WQLA 3UXNA 4WBZA 5J0WA 4K96A 5CFUA 2BPFA 1JAJA 9ICVA 3MCRA 3HWTA 3AQKA 1R8AA 2FMPA 2ID1A 8ICZA 5HHHA 3K75D 5BOLA 4KLEA 3RH5A 4O5CA 4RWPA 4EGWA 3RJGA 5J0OA 5DB8A 1ZQWA 1UEVA 1V4AA 1TV9A 9ICOA 4TUPA 4FHYA 2PBEA 9ICWA 4KLDA 5HRHA 4K4HA 4K97A 4P4PA 2HHPA 3V72A 4X4RA 4NLNA 1MQ3A 3OWGA 1ZQJA 7ICIA 9ICIA 2IUBA 1R8CA 5IIOA 4YCXA 4WC3A 2PFPA 7ICMA 4WCWA 4IQUA 2FMQA 5IILA 5J0YA 3LK9A 4NKTA 5HREA 3UXPA 4RQ7A 4IQVA 3UQ2A 4K9BA 4QZIA 4S3NA 4RQ8A 3ERCC 1KDHA 4UB2A 1JMSA 7ICRA 4NXUA 4RQ1A 8ICQA 4GXKA 4TUSA 3NYBA 2BCUA 2ISPA 5J0XA 4QZDA 4E8FA 3K7DA 5DBCA 2M2UA 4M04A 3WFPA 4KB6A 4UB4A 3C18A 5EOZA 4YMNA 7ICEA 9ICHA 2B51A 5HRLA 3WFQE 4QZ8A 4F5NA 4LEVA 4NXXA 4ATBA 4NXVA 4R64A 4XRHA 5TZVA 1ZQCA 2BCRA 5J2AA 5B3PA 2BPCA 3EF2A 4QZCA 5HHIA 4KLFA 4EEBA 9ICEA 2DR8A 4F5OA 3C5FA 9ICMA 3JCFA 4XQ7A 5JTGA 5B3QA 8ICLA 2Q66A 1KEJA 4WOYA 2DR9A 4X0BA 1XSPA 3NWIA 4PGXA 2M2TA 4UAZA 2ZH1A 5J0UA 4OAIZ 4DOCA 2B4VA 4NM1A 3WFSC 3JPOA 4I2DA
chains in the Genus database with same CATH topology
4O68A 4X4OA 4UD5A 4X4QA 2IHOA 4NXWA 3ER9B 4K8VA 4FHVA 4EP7A 5CFSA 4JLZA 4LEYA 4XJEA 4OAFA 2FCLA 1UEVA 5D61A 4FHWA 3HJ1A 4FHYA 2EWRA 4MKPA 2DR5A 1TFWA 3C66A 3HJ4A 4K97A 2ZH6A 4AT9A 5CHEA 2HHPA 4AT8A 4NXTA 4O67A 4HX0A 4X4RA 4X4SA 3HIYA 1R8BA 4X4PA 2DR7A 4X4NA 3OWGA 4E80A 5D63A 4JLXA 2DRBA 1R8CA 2B56A 3ER8C 2ZHAA 4FO1A 4O6AA 4X4VA 4E7XA 4NKTA 1Q78A 1TFYA 4K9BA 3ERCC 2ZH9A 4OAGA 4NXUA 4X4UA 2ZH5A 3NYBA 4AT9B 4KM5A 4E8FA 5CFTA 4NKUA 3OV7A 4AT8B 1R89A 3K7DA 4UD4A 4OAHA 3NKUA 2ZH4A 2ZHBA 4KB6A 2ZH8A 2B51A 4LT6A 4K9AA 5D62A 4O69A 4FH5A 3OVAA 4LEVA 4FH3A 4NXXA 4ATBB 3OVSA 4ATBA 4NXVA 4LEZA 4X4TA 4LEWA 3OUYB 3OUYA 4K98A 2ZH3A 3OVBA 5B3PA 3EF2A 1UETA 4K99A 3PHZA 1F5AA 4FHPA 1GPJA 2GA9D 4M5DA 2DRAA 4N7RA 2DR8A 1FA0A 5B3QA 2O1PA 2ZH7A 1Q79A 2Q66A 4WOYA 4AT7B 2DR9A 4WQKA 4AT7A 4FHXA 4WQLA 4WH5A 2ZH2A 2ZH1A 4K96A 4OAIZ 1UEUA 5CFUA 2B4VA 3MCRA 2GAFD 2DVIA 1R8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O68 A;  4KM5 A;  4AT9 B;  4AT8 A;  4NXT A;  4O67 A;  4AT8 B;  4OAH A;  4NXW A;  4KB6 A;  4K8V A;  4JLX A;  4JLZ A;  4K9A A;  4LEY A;  4O6A A;  4O69 A;  4K99 A;  4LEV A;  4OAF A;  4LEZ A;  4NXX A;  4ATB B;  4ATB A;  4NXV A;  4WOY A;  4AT7 B;  4AT7 A;  4LEW A;  4K9B A;  4K98 A;  4K96 A;  4OAI Z;  4MKP A;  4OAG A;  4NXU A;  4K97 A;  4AT9 A; 
#chains in the Genus database with same CATH topology
 4X4O A;  3LQC B;  2IHO A;  3H37 A;  4M9H A;  3AU2 A;  4WC5 A;  4Z6F A;  4Z6E A;  4RT3 A;  4KLU A;  4WC0 A;  4FHV A;  5J2H A;  2PFN A;  4KLS A;  3RJJ A;  4EP7 A;  4NM2 A;  4JLZ A;  4WC4 A;  4OAF A;  4JWN A;  2FMS A;  4I2A A;  4M9J A;  2M2W A;  3WFO A;  1MIV A;  2EWR A;  9ICX A;  1ZQY A;  5J2D A;  5DB6 A;  5DB9 A;  4YMO A;  3TFS A;  1TFW A;  5IIN A;  3JYY A;  3UPS A;  4O5K A;  3C66 A;  4AT9 A;  5CHE A;  4YD1 A;  4MFF A;  4NXT A;  4I2E A;  4Z6C A;  1MIW A;  4XA5 A;  5DBB A;  4RQ6 A;  4X4S A;  4X4P A;  4UBB A;  4YN4 A;  3UQ0 A;  1ZJN A;  4X4N A;  1ZJM A;  5HRI A;  4PGQ A;  8ICI A;  5D63 A;  5BOM A;  2DRB A;  2B56 A;  4RT2 A;  4K4I A;  4KLH A;  4WC2 A;  1MQ2 A;  5HRK A;  2ZHA A;  1BPB A;  1NOM A;  4UB1 A;  4O6A A;  3B0Y A;  7ICL A;  4IQT A;  1ZQD A;  1TFY A;  4I2F A;  2ZH9 A;  1ZQE A;  4RPZ A;  4UBC A;  4OAG A;  4DOA A;  4X4U A;  4RQ2 A;  1ZQS A;  4LZG A;  5CFT A;  4AT8 B;  1R89 A;  2BBJ A;  4WC6 A;  3JPR A;  4LVS A;  4MFC A;  9ICR A;  2HN1 A;  5D62 A;  4O69 A;  3MGI A;  7ICH A;  4ATB B;  4F5P A;  5J0S A;  5HRD A;  4DOB A;  5J0T A;  7ICU A;  4RQ3 A;  4LEW A;  3OUY A;  2I9G A;  7ICN A;  4K98 A;  5J0R A;  5DDY A;  3AU6 A;  4IQW A;  1JN3 A;  1ZQF A;  3PHZ A;  3JPT A;  4PHE A;  2GA9 D;  3JZ0 A;  7ICO A;  4PHA A;  2RFF A;  1ZQA A;  4N7R A;  8ICO A;  4UAY A;  5F2V O;  2PFQ A;  4RQ5 A;  3JPS A;  2O1P A;  4R65 A;  4NXZ A;  5J2F A;  3H38 A;  4I27 A;  4WQK A;  4M2Y A;  4FHX A;  9ICU A;  4WH5 A;  2ZH2 A;  1ZQO A;  8ICT A;  4RWO A;  1XSN A;  5HRF A;  4O5E A;  2DVI A;  2PFO A;  3GDX A;  9ICN A;  4X4Q A;  3V7J A;  1ZQZ A;  5J2G A;  9ICF A;  2M2V A;  4K8V A;  4P4M A;  1ZQR A;  3V7L A;  5CFS A;  3C5G A;  4GXI A;  4I2C A;  4GXJ A;  1ZQN A;  4LEY A;  8ICA A;  4XJE A;  2FCL A;  5J2C A;  1HUZ A;  4KLL A;  4KLQ A;  4FHW A;  3HJ1 A;  4P2H A;  5J2B A;  7ICT A;  4QZF A;  4RQ0 A;  1ZQH A;  8ICK A;  2DR5 A;  4PH5 A;  4HX0 A;  2IHM A;  2BE3 A;  5CHG A;  4RQ4 A;  3RJE A;  9ICK A;  1R8B A;  8ICW A;  5J29 A;  5CA7 A;  1KNY A;  4UB3 A;  4E80 A;  3ISD A;  4JLX A;  3TFR A;  3ISB A;  1BPD A;  4IG8 A;  4X4V A;  4E7X A;  3V7K A;  1RZT A;  5III A;  3RJF A;  4I2G A;  3RJI A;  4M9G A;  4F5R A;  2ISO A;  4EED A;  4KLJ A;  7ICQ A;  4RWN A;  4YMM A;  9ICA A;  1ZQL A;  3JPQ A;  5J2I A;  3OV7 A;  4QZE A;  9ICG A;  4MFA A;  4OAH A;  3ISC A;  2ZH4 A;  3JPP A;  3AUO A;  3MDC A;  4KLT A;  2ZHB A;  1ZQI A;  7ICK A;  4O9M A;  4PGY A;  8ICX A;  8ICC A;  3L9D A;  4PHP A;  4EV6 A;  4LT6 A;  4YD2 A;  4TUR A;  4FH5 A;  4JWM A;  4I29 A;  3UXO A;  1RPL A;  5DBA A;  3OUY B;  5J0Q A;  2BBH A;  4EBJ A;  1WOT A;  1XSL A;  3RJK A;  5IIK A;  9ICS A;  1ZQM A;  8ICS A;  3OVB A;  3MGH A;  3B0X A;  1UET A;  4XQ8 A;  1F5A A;  4FHP A;  3C2K A;  4LZD A;  4X0A A;  4F5Q A;  1GPJ A;  1VFG A;  1ZQP A;  4R63 A;  5IIM A;  4PPX A;  5BPC A;  3PNC A;  1FA0 A;  8ICR A;  4R66 A;  5CJ7 A;  1MIY A;  3NVO A;  2W9M A;  3MBY A;  5HC9 A;  4I2J A;  3RH6 A;  4NY8 A;  8ICJ A;  1BPX A;  9ICC A;  9ICT A;  4NLZ A;  8ICP A;  1Q79 A;  2BCQ A;  4AT7 A;  8ICN A;  4I2I A;  3PML A;  3RJH A;  1YLQ A;  1UEU A;  1ZQX A;  1TVA A;  2HN2 A;  2GAF D;  4KLO A;  3HX0 A;  2BCS A;  4O68 A;  3JPN A;  4UD5 A;  8ICB A;  7ICV A;  1NO5 A;  4EBK A;  4MF8 A;  5CWR A;  5DDM A;  4NXW A;  3ER9 B;  5CB1 A;  5J2E A;  4QZB A;  2PXI A;  7ICS A;  3H39 A;  1VJ7 A;  4FO6 A;  1ZQQ A;  7ICF A;  5J2J A;  5DKW A;  5HRB A;  1JQR A;  5D61 A;  3C2L A;  4MKP A;  3AQN A;  4UAW A;  5J0P A;  3HJ4 A;  3UPQ A;  2ZH6 A;  1ZQU A;  4AT8 A;  4O67 A;  5CR0 A;  7ICP A;  2P66 A;  4M9L A;  9ICJ A;  1ZQB A;  3HIY A;  2DR7 A;  4QZG A;  3ER8 C;  4WC7 A;  4UB5 A;  4QZ9 A;  4FO1 A;  8ICU A;  4K4G A;  1Q78 A;  4I2H A;  4M0A A;  3C2M A;  1BPZ A;  4TUQ A;  4DO9 A;  1OU5 A;  4I0U A;  3PMN A;  1PX5 A;  3RH4 A;  5HR9 A;  2ZH5 A;  4RPX A;  4AT9 B;  4KM5 A;  3H3A A;  2BCV A;  4NKU A;  4MF2 A;  3CK6 A;  4XUS A;  5HRG A;  9ICL A;  4UD4 A;  3NKU A;  3AQL A;  4WBY A;  1ZQK A;  2GWS A;  2ZH8 A;  9ICP A;  5J2K A;  1HUO A;  9ICQ A;  4K9A A;  4QZA A;  4M9N A;  4K99 A;  3OVA A;  4FH3 A;  4LEZ A;  4KLI A;  8ICH A;  3OVS A;  9ICB A;  8ICE A;  4NLK A;  8ICF A;  7ICG A;  4X4T A;  4Z6D A;  5IIJ A;  3HW8 A;  2ZH3 A;  2BPG A;  8ICV A;  8ICG A;  1ZQT A;  4M47 A;  4I28 A;  7ICJ A;  4QZH A;  3MDA A;  4I2B A;  1BPY A;  5DED A;  4M5D A;  1BPE A;  4PHD A;  5DEC A;  2DRA A;  1ZQV A;  4KLM A;  4KLG A;  2VAN A;  5DB7 A;  4RWQ A;  5D46 A;  5D4B A;  2NRK A;  4RPY A;  3WFR E;  4P4O A;  2ZH7 A;  3AQM A;  1ZQG A;  8ICM A;  4WC1 A;  3OGU A;  4AT7 B;  8ICY A;  4X5V A;  2O5A A;  5CP2 A;  5D49 A;  4WQL A;  3UXN A;  4WBZ A;  5J0W A;  4K96 A;  5CFU A;  2BPF A;  1JAJ A;  9ICV A;  3MCR A;  3HWT A;  3AQK A;  1R8A A;  2FMP A;  2ID1 A;  8ICZ A;  5HHH A;  3K75 D;  5BOL A;  4KLE A;  3RH5 A;  4O5C A;  4RWP A;  4EGW A;  3RJG A;  5J0O A;  5DB8 A;  1ZQW A;  1UEV A;  1V4A A;  1TV9 A;  9ICO A;  4TUP A;  4FHY A;  2PBE A;  9ICW A;  4KLD A;  5HRH A;  4K4H A;  4K97 A;  4P4P A;  2HHP A;  3V72 A;  4X4R A;  4NLN A;  1MQ3 A;  3OWG A;  1ZQJ A;  7ICI A;  9ICI A;  2IUB A;  1R8C A;  5IIO A;  4YCX A;  4WC3 A;  2PFP A;  7ICM A;  4WCW A;  4IQU A;  2FMQ A;  5IIL A;  5J0Y A;  3LK9 A;  4NKT A;  5HRE A;  3UXP A;  4RQ7 A;  4IQV A;  3UQ2 A;  4K9B A;  4QZI A;  4S3N A;  4RQ8 A;  3ERC C;  1KDH A;  4UB2 A;  1JMS A;  7ICR A;  4NXU A;  4RQ1 A;  8ICQ A;  4GXK A;  4TUS A;  3NYB A;  2BCU A;  2ISP A;  5J0X A;  4QZD A;  4E8F A;  3K7D A;  5DBC A;  2M2U A;  4M04 A;  3WFP A;  4KB6 A;  4UB4 A;  3C18 A;  5EOZ A;  4YMN A;  7ICE A;  9ICH A;  2B51 A;  5HRL A;  3WFQ E;  4QZ8 A;  4F5N A;  4LEV A;  4NXX A;  4ATB A;  4NXV A;  4R64 A;  4XRH A;  5TZV A;  1ZQC A;  2BCR A;  5J2A A;  5B3P A;  2BPC A;  3EF2 A;  4QZC A;  5HHI A;  4KLF A;  4EEB A;  9ICE A;  2DR8 A;  4F5O A;  3C5F A;  9ICM A;  3JCF A;  4XQ7 A;  5JTG A;  5B3Q A;  8ICL A;  2Q66 A;  1KEJ A;  4WOY A;  2DR9 A;  4X0B A;  1XSP A;  3NWI A;  4PGX A;  2M2T A;  4UAZ A;  2ZH1 A;  5J0U A;  4OAI Z;  4DOC A;  2B4V A;  4NM1 A;  3WFS C;  3JPO A;  4I2D A; 
#chains in the Genus database with same CATH homology
 4O68 A;  4X4O A;  4UD5 A;  4X4Q A;  2IHO A;  4NXW A;  3ER9 B;  4K8V A;  4FHV A;  4EP7 A;  5CFS A;  4JLZ A;  4LEY A;  4XJE A;  4OAF A;  2FCL A;  1UEV A;  5D61 A;  4FHW A;  3HJ1 A;  4FHY A;  2EWR A;  4MKP A;  2DR5 A;  1TFW A;  3C66 A;  3HJ4 A;  4K97 A;  2ZH6 A;  4AT9 A;  5CHE A;  2HHP A;  4AT8 A;  4NXT A;  4O67 A;  4HX0 A;  4X4R A;  4X4S A;  3HIY A;  1R8B A;  4X4P A;  2DR7 A;  4X4N A;  3OWG A;  4E80 A;  5D63 A;  4JLX A;  2DRB A;  1R8C A;  2B56 A;  3ER8 C;  2ZHA A;  4FO1 A;  4O6A A;  4X4V A;  4E7X A;  4NKT A;  1Q78 A;  1TFY A;  4K9B A;  3ERC C;  2ZH9 A;  4OAG A;  4NXU A;  4X4U A;  2ZH5 A;  3NYB A;  4AT9 B;  4KM5 A;  4E8F A;  5CFT A;  4NKU A;  3OV7 A;  4AT8 B;  1R89 A;  3K7D A;  4UD4 A;  4OAH A;  3NKU A;  2ZH4 A;  2ZHB A;  4KB6 A;  2ZH8 A;  2B51 A;  4LT6 A;  4K9A A;  5D62 A;  4O69 A;  4FH5 A;  3OVA A;  4LEV A;  4FH3 A;  4NXX A;  4ATB B;  3OVS A;  4ATB A;  4NXV A;  4LEZ A;  4X4T A;  4LEW A;  3OUY B;  3OUY A;  4K98 A;  2ZH3 A;  3OVB A;  5B3P A;  3EF2 A;  1UET A;  4K99 A;  3PHZ A;  1F5A A;  4FHP A;  1GPJ A;  2GA9 D;  4M5D A;  2DRA A;  4N7R A;  2DR8 A;  1FA0 A;  5B3Q A;  2O1P A;  2ZH7 A;  1Q79 A;  2Q66 A;  4WOY A;  4AT7 B;  2DR9 A;  4WQK A;  4AT7 A;  4FHX A;  4WQL A;  4WH5 A;  2ZH2 A;  2ZH1 A;  4K96 A;  4OAI Z;  1UEU A;  5CFU A;  2B4V A;  3MCR A;  2GAF D;  2DVI A;  1R8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...