4NXWA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
325
Chain Sequence
MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxwA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxwA02
4K96A 4JLZA 4OAGA 4LEVA 4AT8A 4ATBB 4AT9A 4O67A 4NXVA 4O68A 4LEWA 4JLXA 4NXWA 4MKPA 4LEZA 4AT7A 4O69A 4K97A 4OAHA 4NXUA 4K98A 4OAFA 4K99A 4LEYA 4KB6A 4KM5A 4K9AA 4ATBA 4AT8B 4NXXA 4AT9B 4OAIZ 4K8VA 4WOYA 4NXTA 4K9BA 4AT7B 4O6AA
chains in the Genus database with same CATH superfamily
4FHVA 5CWRA 4PGQA 1JN3A 4FHWA 4ATBB 3K7DA 5J2BA 1BPZA 5DEDA 5DDYA 5EOZA 2HHPA 4E8FA 4M0AA 4HX0A 2PXIA 1UEUA 5CB1A 7ICVA 1ZQGA 7ICTA 3UXPA 9ICGA 3ISBA 4F5QA 9ICUA 4RQ1A 2BCRA 4LVSA 7ICFA 1JQRA 4PHDA 7ICLA 7ICQA 2M2VA 3LQCB 4F5OA 4PHEA 4P4PA 5IILA 1ZQWA 5J0XA 8ICHA 2ZH3A 5J2FA 4JWNA 3ISCA 4M9GA 4XQ8A 3RJJA 4DOAA 5J0RA 3NKUA 4AT7A 1ZQUA 5J2EA 3OVSA 2ZH2A 4X4OA 4UBCA 4I2DA 2IUBA 1ZQKA 3HWTA 2W9MA 2GWSA 5J0UA 4FH5A 4WBYA 4RWQA 2ZHAA 3L9DA 1ZQXA 9ICIA 4YCXA 4WC7A 4RWPA 9ICXA 3H3AA 4KLQA 2ZH8A 2BPGA 7ICMA 4O9MA 3PMLA 5J2JA 9ICKA 7ICUA 1BPYA 2B56A 1ZQFA 8ICCA 4YD1A 5DB8A 4FO1A 4K97A 4EBKA 5D62A 4DOBA 4XJEA 4M9NA 3ER8C 9ICFA 8ICXA 4K99A 3V7LA 1ZQTA 1ZQBA 4R63A 7ICHA 4P4MA 3WFQE 4M5DA 4PHAA 3OUYB 4NKUA 2FCLA 5HHIA 2DR8A 3JPPA 1KDHA 4KLIA 4Z6DA 4K96A 2ZH6A 5HRFA 4I2BA 1BPXA 7ICOA 9ICPA 5D49A 1KNYA 5HRBA 4KLDA 1ZQHA 4O68A 4IQUA 4JLXA 3JCFA 3H38A 4IG8A 2M2UA 3TFRA 3RJHA 4R65A 3EF2A 4RPZA 4RQ0A 5J2CA 3OGUA 4RQ3A 2NRKA 1ZQAA 5HR9A 4EP7A 3V72A 9ICJA 4QZBA 9ICSA 1ZQPA 4NLNA 4UD5A 3JPNA 3V7KA 4YMNA 4I2JA 4UB5A 4M2YA 2FMQA 4RWNA 9ICLA 1ZQRA 2M2TA 4QZIA 3C66A 5HC9A 1HUOA 3MBYA 3UXOA 4FHPA 4O5EA 3WFPA 4KLEA 3NVOA 4UB4A 4X4SA 7ICGA 4X4RA 4K8VA 4O5CA 5CJ7A 3AQKA 1MQ2A 4I29A 2Q66A 4QZHA 4RPXA 4RT2A 1MIWA 2GA9D 4WC2A 3MCRA 1JAJA 4YN4A 1ZQIA 3B0YA 5J2GA 9ICOA 5J2KA 8ICYA 7ICEA 4OAHA 3WFSC 8ICNA 1BPBA 9ICVA 4RQ6A 2BPFA 4I28A 5D63A 4F5PA 4NXTA 8ICGA 3HJ4A 1TVAA 4I2FA 3UPSA 2ZH9A 9ICCA 4I2HA 2DR7A 2IHOA 3JPTA 2DVIA 3C2MA 4Z6FA 4KLLA 1RPLA 5J0QA 4X4TA 5J0TA 4UAWA 3JPQA 4MFCA 7ICJA 8ICRA 3OV7A 2EWRA 3HJ1A 9ICHA 9ICNA 4K98A 4DOCA 4KB6A 2BBHA 3RJKA 4WC0A 4S3NA 1R8BA 4NXZA 3V7JA 2FMSA 5CA7A 4I2IA 3LK9A 4MFAA 2BE3A 4I2EA 2ISPA 2O5AA 1TFYA 4I2CA 4KLMA 9ICRA 1MIYA 2ID1A 5DB6A 3AQNA 4UD4A 1ZQLA 5DBCA 5CFTA 4PPXA 1OU5A 5JTGA 4O67A 5CHGA 4LEWA 4X4UA 8ICMA 2ZH4A 4RQ5A 3C5FA 3OUYA 4NXWA 3OVAA 1ZQOA 9ICWA 5DECA 1MQ3A 4O69A 3UQ0A 5IIKA 5DBBA 1ZQSA 8ICIA 2BCVA 4UAYA 4QZ9A 2BCQA 4YMMA 1Q79A 2BPCA 4OAIZ 2PFQA 9ICAA 1ZQDA 4LZGA 5CR0A 7ICNA 5J0PA 4EEBA 5D4BA 1JMSA 4WQKA 2P66A 4KLJA 3OVBA 3JPSA 8ICQA 5DB7A 1VFGA 4WC6A 1KEJA 3RH6A 4WC5A 3C5GA 4NLZA 4KLOA 4QZFA 4QZEA 8ICKA 3C2LA 4TUQA 5J0SA 4LT6A 3MDAA 1ZQYA 5CHEA 4KLFA 8ICJA 1XSNA 4O5KA 4NXUA 2DRAA 4FHYA 1WOTA 2O1PA 4YMOA 4X0BA 1YLQA 4E7XA 1ZQMA 4FH3A 3JPRA 5D61A 1ZQQA 1UEVA 1BPDA 3CK6A 8ICSA 4MF2A 4RQ7A 4XQ7A 4JLZA 5B3PA 5DKWA 5HRHA 5HRDA 2DR5A 4RT3A 4LEZA 2ZHBA 4PHPA 1TV9A 4QZGA 3JYYA 4TURA 4KM5A 3C2KA 8ICBA 4NKTA 7ICSA 4TUSA 1MIVA 3PHZA 5HRGA 8ICEA 4FHXA 5CFSA 5BOLA 3UQ2A 5IIIA 4NM2A 4F5NA 4KLUA 4KLSA 5IINA 1F5AA 4Z6EA 9ICEA 2B4VA 3TFSA 3C18A 4NXVA 4UB1A 7ICIA 4I2GA 9ICTA 2ZH1A 5J0YA 4K4IA 3AQLA 4XUSA 2IHMA 2FMPA 4RQ8A 5HRIA 3UXNA 1XSPA 4NXXA 1ZJNA 4NY8A 2BCSA 4K9BA 4N7RA 3RH4A 4M9HA 1HUZA 4NM1A 5J2IA 4KLHA 2DR9A 4OAGA 5HHHA 4QZAA 2DRBA 7ICKA 4AT9A 3ERCC 5HRKA 3HW8A 9ICBA 2ZH7A 3RH5A 4K4GA 4RQ2A 1ZQJA 4OAFA 1NO5A 3AU2A 2PFPA 5J0OA 3MGHA 3HX0A 4I2AA 1ZQCA 9ICMA 4AT9B 5J2AA 4WOYA 4PGXA 4I27A 2PBEA 4I0UA 4M47A 5DB9A 4XA5A 2GAFD 4O6AA 3AQMA 4YD2A 4EBJA 8ICUA 4WH5A 4Z6CA 2HN2A 4EV6A 3MDCA 2ZH5A 5IIJA 1RZTA 3RJEA 1UETA 8ICFA 4PH5A 3RJGA 4P4OA 1XSLA 1ZQZA 1GPJA 4X4NA 4EGWA 4WQLA 3NWIA 2M2WA 5DDMA 5BOMA 7ICPA 2B51A 1Q78A 3H37A 4AT7B 4RWOA 5BPCA 8ICLA 4RQ4A 5D46A 5HRLA 5IIOA 8ICTA 4WC3A 4IQVA 1PX5A 4X4QA 3RJFA 2PFNA 4QZ8A 4GXJA 4MKPA 3ER9B 4X4PA 5CFUA 4GXIA 1VJ7A 8ICVA 5CP2A 4QZDA 2BBJA 3JPOA 3OWGA 4X4VA 8ICPA 5B3QA 5J2HA 7ICRA 3JZ0A 8ICZA 4JWMA 5TZVA 4P2HA 2RFFA 5F2VO 3UPQA 4FO6A 4M9LA 5IIMA 3WFOA 3PMNA 4IQWA 3B0XA 3RJIA 8ICWA 8ICAA 3PNCA 1FA0A 4LEYA 4TUPA 4LZDA 3NYBA 4K9AA 4XRHA 9ICQA 2PFOA 4WBZA 4MF8A 4WCWA 4K4HA 1BPEA 4R66A 2HN1A 1ZJMA 4PGYA 4UBBA 4EEDA 4GXKA 3AU6A 2ISOA 4NLKA 1NOMA 4WC1A 4RPYA 3WFRE 4LEVA 4AT8A 4UAZA 4IQTA 4UB3A 3ISDA 5J2DA 3HIYA 4QZCA 4F5RA 3K75D 5DBAA 5J0WA 4UB2A 1ZQNA 1ZQEA 3MGIA 3GDXA 1TFWA 1R8AA 5HREA 5J29A 4WC4A 4KLTA 4KLGA 1V4AA 4MFFA 4M04A 1R8CA 4ATBA 4M9JA 4AT8B 1R89A 4X5VA 3H39A 2I9GA 4R64A 1ZQVA 2VANA 2BCUA 4E80A 8ICOA 4DO9A 3AUOA 4X0AA
chains in the Genus database with same CATH topology
3OVBA 4FHVA 4UD5A 4FHWA 4WH5A 4ATBB 3K7DA 2HHPA 4E8FA 4HX0A 1UEUA 2ZH5A 4LT6A 5CHEA 3C66A 4NXUA 2DRAA 4FHYA 1UETA 4FHPA 2O1PA 4X4SA 1GPJA 4E7XA 4X4NA 4X4RA 4FH3A 4K8VA 4WQLA 5D61A 2B51A 1UEVA 1Q78A 4AT7B 2Q66A 2ZH3A 4JLZA 5B3PA 2DR5A 4X4QA 2GA9D 3MCRA 4MKPA 2ZHBA 4LEZA 3ER9B 3NKUA 4X4PA 4AT7A 5CFUA 3OVSA 4OAHA 2ZH2A 4X4OA 4KM5A 4NKTA 3OWGA 4FH5A 3PHZA 5D63A 2ZHAA 4FHXA 4NXTA 4X4VA 5CFSA 3HJ4A 5B3QA 2ZH9A 2ZH8A 1F5AA 2DR7A 2B4VA 2IHOA 4NXVA 2DVIA 4X4TA 2B56A 2ZH1A 3OV7A 2EWRA 3HJ1A 4FO1A 4K97A 3ER8C 5D62A 4K98A 4XJEA 1FA0A 4K99A 4LEYA 4KB6A 3NYBA 4K9AA 4NXXA 1R8BA 4M5DA 3OUYB 4K9BA 4NKUA 4N7RA 2FCLA 2DR8A 4K96A 2ZH6A 1TFYA 2DR9A 4OAGA 4UD4A 4LEVA 4AT8A 5CFTA 2DRBA 4AT9A 4O67A 3HIYA 4O68A 4LEWA 3ERCC 4JLXA 4X4UA 2ZH4A 2ZH7A 3OUYA 4NXWA 3OVAA 4O69A 1TFWA 1R8AA 4OAFA 3EF2A 1Q79A 1R8CA 4ATBA 4AT8B 1R89A 4AT9B 4OAIZ 4WOYA 4EP7A 4E80A 4WQKA 2GAFD 4O6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K96 A;  4JLZ A;  4OAG A;  4LEV A;  4AT8 A;  4ATB B;  4AT9 A;  4O67 A;  4NXV A;  4O68 A;  4LEW A;  4JLX A;  4NXW A;  4MKP A;  4LEZ A;  4AT7 A;  4O69 A;  4K97 A;  4OAH A;  4NXU A;  4K98 A;  4OAF A;  4K99 A;  4LEY A;  4KB6 A;  4KM5 A;  4K9A A;  4ATB A;  4AT8 B;  4NXX A;  4AT9 B;  4OAI Z;  4K8V A;  4WOY A;  4NXT A;  4K9B A;  4AT7 B;  4O6A A; 
#chains in the Genus database with same CATH topology
 4FHV A;  5CWR A;  4PGQ A;  1JN3 A;  4FHW A;  4ATB B;  3K7D A;  5J2B A;  1BPZ A;  5DED A;  5DDY A;  5EOZ A;  2HHP A;  4E8F A;  4M0A A;  4HX0 A;  2PXI A;  1UEU A;  5CB1 A;  7ICV A;  1ZQG A;  7ICT A;  3UXP A;  9ICG A;  3ISB A;  4F5Q A;  9ICU A;  4RQ1 A;  2BCR A;  4LVS A;  7ICF A;  1JQR A;  4PHD A;  7ICL A;  7ICQ A;  2M2V A;  3LQC B;  4F5O A;  4PHE A;  4P4P A;  5IIL A;  1ZQW A;  5J0X A;  8ICH A;  2ZH3 A;  5J2F A;  4JWN A;  3ISC A;  4M9G A;  4XQ8 A;  3RJJ A;  4DOA A;  5J0R A;  3NKU A;  4AT7 A;  1ZQU A;  5J2E A;  3OVS A;  2ZH2 A;  4X4O A;  4UBC A;  4I2D A;  2IUB A;  1ZQK A;  3HWT A;  2W9M A;  2GWS A;  5J0U A;  4FH5 A;  4WBY A;  4RWQ A;  2ZHA A;  3L9D A;  1ZQX A;  9ICI A;  4YCX A;  4WC7 A;  4RWP A;  9ICX A;  3H3A A;  4KLQ A;  2ZH8 A;  2BPG A;  7ICM A;  4O9M A;  3PML A;  5J2J A;  9ICK A;  7ICU A;  1BPY A;  2B56 A;  1ZQF A;  8ICC A;  4YD1 A;  5DB8 A;  4FO1 A;  4K97 A;  4EBK A;  5D62 A;  4DOB A;  4XJE A;  4M9N A;  3ER8 C;  9ICF A;  8ICX A;  4K99 A;  3V7L A;  1ZQT A;  1ZQB A;  4R63 A;  7ICH A;  4P4M A;  3WFQ E;  4M5D A;  4PHA A;  3OUY B;  4NKU A;  2FCL A;  5HHI A;  2DR8 A;  3JPP A;  1KDH A;  4KLI A;  4Z6D A;  4K96 A;  2ZH6 A;  5HRF A;  4I2B A;  1BPX A;  7ICO A;  9ICP A;  5D49 A;  1KNY A;  5HRB A;  4KLD A;  1ZQH A;  4O68 A;  4IQU A;  4JLX A;  3JCF A;  3H38 A;  4IG8 A;  2M2U A;  3TFR A;  3RJH A;  4R65 A;  3EF2 A;  4RPZ A;  4RQ0 A;  5J2C A;  3OGU A;  4RQ3 A;  2NRK A;  1ZQA A;  5HR9 A;  4EP7 A;  3V72 A;  9ICJ A;  4QZB A;  9ICS A;  1ZQP A;  4NLN A;  4UD5 A;  3JPN A;  3V7K A;  4YMN A;  4I2J A;  4UB5 A;  4M2Y A;  2FMQ A;  4RWN A;  9ICL A;  1ZQR A;  2M2T A;  4QZI A;  3C66 A;  5HC9 A;  1HUO A;  3MBY A;  3UXO A;  4FHP A;  4O5E A;  3WFP A;  4KLE A;  3NVO A;  4UB4 A;  4X4S A;  7ICG A;  4X4R A;  4K8V A;  4O5C A;  5CJ7 A;  3AQK A;  1MQ2 A;  4I29 A;  2Q66 A;  4QZH A;  4RPX A;  4RT2 A;  1MIW A;  2GA9 D;  4WC2 A;  3MCR A;  1JAJ A;  4YN4 A;  1ZQI A;  3B0Y A;  5J2G A;  9ICO A;  5J2K A;  8ICY A;  7ICE A;  4OAH A;  3WFS C;  8ICN A;  1BPB A;  9ICV A;  4RQ6 A;  2BPF A;  4I28 A;  5D63 A;  4F5P A;  4NXT A;  8ICG A;  3HJ4 A;  1TVA A;  4I2F A;  3UPS A;  2ZH9 A;  9ICC A;  4I2H A;  2DR7 A;  2IHO A;  3JPT A;  2DVI A;  3C2M A;  4Z6F A;  4KLL A;  1RPL A;  5J0Q A;  4X4T A;  5J0T A;  4UAW A;  3JPQ A;  4MFC A;  7ICJ A;  8ICR A;  3OV7 A;  2EWR A;  3HJ1 A;  9ICH A;  9ICN A;  4K98 A;  4DOC A;  4KB6 A;  2BBH A;  3RJK A;  4WC0 A;  4S3N A;  1R8B A;  4NXZ A;  3V7J A;  2FMS A;  5CA7 A;  4I2I A;  3LK9 A;  4MFA A;  2BE3 A;  4I2E A;  2ISP A;  2O5A A;  1TFY A;  4I2C A;  4KLM A;  9ICR A;  1MIY A;  2ID1 A;  5DB6 A;  3AQN A;  4UD4 A;  1ZQL A;  5DBC A;  5CFT A;  4PPX A;  1OU5 A;  5JTG A;  4O67 A;  5CHG A;  4LEW A;  4X4U A;  8ICM A;  2ZH4 A;  4RQ5 A;  3C5F A;  3OUY A;  4NXW A;  3OVA A;  1ZQO A;  9ICW A;  5DEC A;  1MQ3 A;  4O69 A;  3UQ0 A;  5IIK A;  5DBB A;  1ZQS A;  8ICI A;  2BCV A;  4UAY A;  4QZ9 A;  2BCQ A;  4YMM A;  1Q79 A;  2BPC A;  4OAI Z;  2PFQ A;  9ICA A;  1ZQD A;  4LZG A;  5CR0 A;  7ICN A;  5J0P A;  4EEB A;  5D4B A;  1JMS A;  4WQK A;  2P66 A;  4KLJ A;  3OVB A;  3JPS A;  8ICQ A;  5DB7 A;  1VFG A;  4WC6 A;  1KEJ A;  3RH6 A;  4WC5 A;  3C5G A;  4NLZ A;  4KLO A;  4QZF A;  4QZE A;  8ICK A;  3C2L A;  4TUQ A;  5J0S A;  4LT6 A;  3MDA A;  1ZQY A;  5CHE A;  4KLF A;  8ICJ A;  1XSN A;  4O5K A;  4NXU A;  2DRA A;  4FHY A;  1WOT A;  2O1P A;  4YMO A;  4X0B A;  1YLQ A;  4E7X A;  1ZQM A;  4FH3 A;  3JPR A;  5D61 A;  1ZQQ A;  1UEV A;  1BPD A;  3CK6 A;  8ICS A;  4MF2 A;  4RQ7 A;  4XQ7 A;  4JLZ A;  5B3P A;  5DKW A;  5HRH A;  5HRD A;  2DR5 A;  4RT3 A;  4LEZ A;  2ZHB A;  4PHP A;  1TV9 A;  4QZG A;  3JYY A;  4TUR A;  4KM5 A;  3C2K A;  8ICB A;  4NKT A;  7ICS A;  4TUS A;  1MIV A;  3PHZ A;  5HRG A;  8ICE A;  4FHX A;  5CFS A;  5BOL A;  3UQ2 A;  5III A;  4NM2 A;  4F5N A;  4KLU A;  4KLS A;  5IIN A;  1F5A A;  4Z6E A;  9ICE A;  2B4V A;  3TFS A;  3C18 A;  4NXV A;  4UB1 A;  7ICI A;  4I2G A;  9ICT A;  2ZH1 A;  5J0Y A;  4K4I A;  3AQL A;  4XUS A;  2IHM A;  2FMP A;  4RQ8 A;  5HRI A;  3UXN A;  1XSP A;  4NXX A;  1ZJN A;  4NY8 A;  2BCS A;  4K9B A;  4N7R A;  3RH4 A;  4M9H A;  1HUZ A;  4NM1 A;  5J2I A;  4KLH A;  2DR9 A;  4OAG A;  5HHH A;  4QZA A;  2DRB A;  7ICK A;  4AT9 A;  3ERC C;  5HRK A;  3HW8 A;  9ICB A;  2ZH7 A;  3RH5 A;  4K4G A;  4RQ2 A;  1ZQJ A;  4OAF A;  1NO5 A;  3AU2 A;  2PFP A;  5J0O A;  3MGH A;  3HX0 A;  4I2A A;  1ZQC A;  9ICM A;  4AT9 B;  5J2A A;  4WOY A;  4PGX A;  4I27 A;  2PBE A;  4I0U A;  4M47 A;  5DB9 A;  4XA5 A;  2GAF D;  4O6A A;  3AQM A;  4YD2 A;  4EBJ A;  8ICU A;  4WH5 A;  4Z6C A;  2HN2 A;  4EV6 A;  3MDC A;  2ZH5 A;  5IIJ A;  1RZT A;  3RJE A;  1UET A;  8ICF A;  4PH5 A;  3RJG A;  4P4O A;  1XSL A;  1ZQZ A;  1GPJ A;  4X4N A;  4EGW A;  4WQL A;  3NWI A;  2M2W A;  5DDM A;  5BOM A;  7ICP A;  2B51 A;  1Q78 A;  3H37 A;  4AT7 B;  4RWO A;  5BPC A;  8ICL A;  4RQ4 A;  5D46 A;  5HRL A;  5IIO A;  8ICT A;  4WC3 A;  4IQV A;  1PX5 A;  4X4Q A;  3RJF A;  2PFN A;  4QZ8 A;  4GXJ A;  4MKP A;  3ER9 B;  4X4P A;  5CFU A;  4GXI A;  1VJ7 A;  8ICV A;  5CP2 A;  4QZD A;  2BBJ A;  3JPO A;  3OWG A;  4X4V A;  8ICP A;  5B3Q A;  5J2H A;  7ICR A;  3JZ0 A;  8ICZ A;  4JWM A;  5TZV A;  4P2H A;  2RFF A;  5F2V O;  3UPQ A;  4FO6 A;  4M9L A;  5IIM A;  3WFO A;  3PMN A;  4IQW A;  3B0X A;  3RJI A;  8ICW A;  8ICA A;  3PNC A;  1FA0 A;  4LEY A;  4TUP A;  4LZD A;  3NYB A;  4K9A A;  4XRH A;  9ICQ A;  2PFO A;  4WBZ A;  4MF8 A;  4WCW A;  4K4H A;  1BPE A;  4R66 A;  2HN1 A;  1ZJM A;  4PGY A;  4UBB A;  4EED A;  4GXK A;  3AU6 A;  2ISO A;  4NLK A;  1NOM A;  4WC1 A;  4RPY A;  3WFR E;  4LEV A;  4AT8 A;  4UAZ A;  4IQT A;  4UB3 A;  3ISD A;  5J2D A;  3HIY A;  4QZC A;  4F5R A;  3K75 D;  5DBA A;  5J0W A;  4UB2 A;  1ZQN A;  1ZQE A;  3MGI A;  3GDX A;  1TFW A;  1R8A A;  5HRE A;  5J29 A;  4WC4 A;  4KLT A;  4KLG A;  1V4A A;  4MFF A;  4M04 A;  1R8C A;  4ATB A;  4M9J A;  4AT8 B;  1R89 A;  4X5V A;  3H39 A;  2I9G A;  4R64 A;  1ZQV A;  2VAN A;  2BCU A;  4E80 A;  8ICO A;  4DO9 A;  3AUO A;  4X0A A; 
#chains in the Genus database with same CATH homology
 3OVB A;  4FHV A;  4UD5 A;  4FHW A;  4WH5 A;  4ATB B;  3K7D A;  2HHP A;  4E8F A;  4HX0 A;  1UEU A;  2ZH5 A;  4LT6 A;  5CHE A;  3C66 A;  4NXU A;  2DRA A;  4FHY A;  1UET A;  4FHP A;  2O1P A;  4X4S A;  1GPJ A;  4E7X A;  4X4N A;  4X4R A;  4FH3 A;  4K8V A;  4WQL A;  5D61 A;  2B51 A;  1UEV A;  1Q78 A;  4AT7 B;  2Q66 A;  2ZH3 A;  4JLZ A;  5B3P A;  2DR5 A;  4X4Q A;  2GA9 D;  3MCR A;  4MKP A;  2ZHB A;  4LEZ A;  3ER9 B;  3NKU A;  4X4P A;  4AT7 A;  5CFU A;  3OVS A;  4OAH A;  2ZH2 A;  4X4O A;  4KM5 A;  4NKT A;  3OWG A;  4FH5 A;  3PHZ A;  5D63 A;  2ZHA A;  4FHX A;  4NXT A;  4X4V A;  5CFS A;  3HJ4 A;  5B3Q A;  2ZH9 A;  2ZH8 A;  1F5A A;  2DR7 A;  2B4V A;  2IHO A;  4NXV A;  2DVI A;  4X4T A;  2B56 A;  2ZH1 A;  3OV7 A;  2EWR A;  3HJ1 A;  4FO1 A;  4K97 A;  3ER8 C;  5D62 A;  4K98 A;  4XJE A;  1FA0 A;  4K99 A;  4LEY A;  4KB6 A;  3NYB A;  4K9A A;  4NXX A;  1R8B A;  4M5D A;  3OUY B;  4K9B A;  4NKU A;  4N7R A;  2FCL A;  2DR8 A;  4K96 A;  2ZH6 A;  1TFY A;  2DR9 A;  4OAG A;  4UD4 A;  4LEV A;  4AT8 A;  5CFT A;  2DRB A;  4AT9 A;  4O67 A;  3HIY A;  4O68 A;  4LEW A;  3ERC C;  4JLX A;  4X4U A;  2ZH4 A;  2ZH7 A;  3OUY A;  4NXW A;  3OVA A;  4O69 A;  1TFW A;  1R8A A;  4OAF A;  3EF2 A;  1Q79 A;  1R8C A;  4ATB A;  4AT8 B;  1R89 A;  4AT9 B;  4OAI Z;  4WOY A;  4EP7 A;  4E80 A;  4WQK A;  2GAF D;  4O6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...