5BOMA

Dna polymerase beta binary complex with a templating 5clc
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
320
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 320
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bomA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bomA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bomA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bomA03
3OGUA 4PPXA 1BPEA 3RB4A 3AQLA 4R66A 1KLNA 4RWPA 1SL2A 5HRGA 4K4GA 1KFTA 4ECXA 4F92B 5DGBA 2Y1JA 1ZQEA 5HRDA 8ICHA 4AT8A 4Q8EA 4X4VA 2GWSA 2XCPA 4Z6CA 2FPMA 4RT2A 4DF4A 5J2DA 8ICMA 2M2TA 3QEBZ 5CA7A 5HR9A 5KG7A 1NK6A 4MF2A 1JXEA 4I2BA 1L5UA 7ICJA 4RQ4A 3BQ0A 5HMLA 4RT3A 2HHTA 2MUTA 4JWMA 3PW2A 4ECWA 9ICQA 4XQ8A 4J9LA 1RYSA 4LZDA 1ZETA 2R8IA 1LV5A 3PW0A 4DSEA 2KZ3A 2XGQA 3GIIA 1L3VA 4EBCA 4M04A 2BCSA 4PGYA 4EBEA 3MABA 4IQTA 3KHLA 9ICRA 2KP7A 2KFNA 2FLNA 1A77A 3C21A 3PW7A 2Q66A 5DKWA 4Q45A 3V7LA 2BQ3A 3PV8A 3WFPA 5TZVA 9ICVA 4M5DA 4PH5A 3JPSA 1PX5A 1BVSA 5J0UA 1ZQBA 8ICOA 1VFGA 3M9MB 1C7YA 5DB6A 2OWOA 4WBYA 2VANA 4C8MA 3V7JA 7ICTA 1X9WA 1ZQSA 3C5GA 5KTQA 5L1LA 8ICBA 3EPGA 5DG8A 3WFQE 3RJEA 4FH5A 1D8LA 4F93B 3MGIA 1ZQLA 4RQ1A 5BOLA 4UB5A 4RQ3A 2C2EA 1WCNA 4QZCA 4MFAA 4M9JA 4IG8A 4ECQA 1KNYA 3OHAA 1BPZA 1KEJA 3M8RA 2UVRA 1ZQOA 1ZQUA 5DDMA 4EYHB 3SV4A 4ED7A 4X5VA 4E0DA 4DSJA 3NGDA 1S76D 4X4NA 1R8CA 1L3UA 2ZUCA 4DS5A 3T3FA 4FHWA 5KFWA 4RNNA 8ICCA 4DFKA 4AT7A 3EWAA 4WC4A 1BGXT 1NJZA 4DL3A 2ZHAA 5EWEA 3SYZA 3H37A 5HHIA 4EBJA 1JMSA 5J2CA 1BNOA 5KG2A 4PGQA 5CP2A 5DB8A 4BWJA 5KFKA 1ZQJA 4PHDA 4KLGA 8ICQA 3UQ2A 1NK5A 1UEVA 5D46A 4ED3A 1V4AA 4O3SA 8ICSA 5KFFA 4RUCA 4O3OA 5EWFA 3HT3A 3KHRA 4DOAA 3KTQA 1Z00A 3UPSA 4JK1A 2PFQA 4MEYA 3JPQA 5J0YA 3T5JA 4DOBA 1KFDA 4P4MA 4RQ7A 3ZDCA 3TFSA 4DSLA 7ICLA 3QEAZ 4M9GA 4O0IA 4Q44A 4GC7A 4RU9A 7ICFA 7ICEA 8ICUA 1COOA 1S0OA 2J6TA 4WC6A 1MSWD 5KFIA 3C5FA 4RQ6A 3T5HA 4KLQA 3RRHA 2F1IA 8ICYA 2Y1IA 3AQKA 3UXOA 2V4QA 2ASDA 1BPXA 2NRZA 4RQ0A 3HP6A 2V9WA 2ZH3A 3C2MA 7ICOA 4M6WA 4X0BA 3RAQA 2DR8A 3GV5B 4BWMA 3MFHA 3PO5A 4I2HA 4QZHA 4J9NA 4KLTA 4UD4A 5KFTA 3V7KA 5KFNA 4IRDA 3WFSC 4I2JA 4I27A 4KTQA 1MIWA 4Z6FA 4M9LA 4TUQA 3T5KA 3JPPA 1BPBA 4ED0A 4RNOA 5L1IA 3C23A 4Z6EA 2UVVA 5KFHA 8ICZA 2HHQA 3JYYA 4KLFA 3PX6A 5C5JA 5CR0A 3HIYA 2R8KA 2DPIA 4KLUA 3RH4A 1U4BA 4DWIA 1WOTA 5DB7A 1S0MA 5HRIA 3N4MB 3JZ0A 8ICJA 4KLSA 1K1QA 5KFRA 4NLZA 5KFZA 1HUOA 1ZQCA 2KN7A 4MEXA 1QSYA 2BPFA 4QZFA 5J2KA 2BPGA 4DQPA 1NK7A 3PNCA 2ZH8A 4UAWA 3GQCA 9ICEA 4F2SA 2J6SA 4GXKA 3H8SA 4ED1A 8ICWA 1T3NA 3RR8A 2ZH2A 5HNKA 4DQQA 4PGXA 4TUPA 4J9PA 3OSPA 3LDAA 5J2BA 5KFVA 4WC3A 2DVIA 4GLXA 5DLGA 2DRAA 4JV0A 4UB2A 1MQ2A 5HRBA 1ZJMA 4YMMA 1N48A 1QTMA 4QZBA 5J0QA 4EBDA 2BDPA 4BXOB 4ELUA 4KLDA 4FHVA 4K4HA 4FS1A 2ZUDA 2HVIA 3IM1A 4YR3A 1ZQVA 4NM2A 3NYBA 2ATLA 3ZD9A 1CEZA 4O3RA 1UA1A 2DR5A 1OU5A 4MF8A 3HWTA 5J29A 2ALZA 5DEDA 4DFJA 4QWAA 4RPZA 4RQ5A 2IBKA 4DSIA 9ICNA 1KSPA 2XC9A 2ZTDA 3MR5A 5J2AA 4YFKA 5L1KA 4J9RA 1K1SA 1PZNA 1XSLA 1TVAA 1NK9A 1XU4A 3OJUA 7ICVA 2W9AA 2NRKA 2WTFA 9ICWA 1DOQA 4YR2A 4R63A 4AT9A 3IHQB 2JEFA 8ICNA 9ICPA 4F4KA 3V6KA 5KG4A 3BQ2A 3KHGA 1NKEA 4YD1A 5KT3A 3SV3A 3FDSA 3TANA 2BGWA 4B9UA 1HJPA 2KTQA 1S77D 5KFQA 4FBUA 4QWBA 4FBTA 2BHNA 4ECSA 1NJXA 5KFAA 4YCXA 4RNMA 5KT7A 4F4XA 3PW4A 4DL5A 5KFUA 2JEIA 3ZD8A 3BQTA 3SZ2A 7ICKA 4UB1A 4PHAA 5KFLA 3EYZA 3EZ5A 4KLHA 4EBKA 4ECVA 4QWCA 3C2KA 3RAXA 3AU6A 2JZBB 4HYKA 4J9MA 4DS4A 2ZH6A 5J0PA 3JPOA 3GIKA 1JQRA 9ICGA 1R8BA 2XY5A 3TQ1A 9ICFA 3PY8A 1Y88A 2M2VA 3RJHA 5IILA 2XCAA 1X9SA 2HHXA 5HREA 1ZQWA 2NRTA 2MUTB 4PHEA 1TV9A 2ZJ5A 4QZ8A 4JWNA 2UVWA 3RJKA 1QSSA 2FMSA 5KFCA 2ASJA 2O1PA 3OJSA 4ECTA 1TK0A 7ICHA 2P66A 1T7PA 2AQ0A 4UAYA 3H7IA 4DLEA 1EXNA 4FH3A 2B21A 1R89A 4B9LA 2W9MA 3AUOA 9ICCA 1KDHA 1IXRA 5JUMA 4R64A 1LB2B 1ZQAA 2C28A 4M9HA 4RZRA 2PFOA 5KT6A 4WCWA 2F1JA 1BPDA 3JPTA 3QE9Y 4DL7A 3ORYA 2HHSA 1XWLA 1B43A 2JEGA 2HHWA 1SKSA 3GV8B 3ZDBA 2BQUA 3MR6A 5J0RA 5KFMA 1NK0A 4B9VA 3UXNA 3V6HA 3G6XA 2FLLA 4XA5A 4WC2A 9ICSA 3PMLA 1MQ3A 2BPCA 3PR4A 5HP4A 4B9NA 4O5KA 4UD5A 4DEZA 3RH6A 4UBCA 4XQ7A 2NRVA 1ZQFA 4IQVA 4WC7A 3MR2A 1NKBA 1TAQA 4NKTA 3ZDEA 3OUYB 2W8LA 1KRPA 5DBBA 5F2VO 8ICXA 4X4TA 3GV7B 3HW8A 4DL6A 2JEJA 4O3QA 4YMOA 4DO9A 2PFPA 3UXPA 1KFSA 8ICEA 4I2DA 2RDJA 4FO6A 4ED2A 2XY6A 1U47A 1MIVA 2A1JB 1ZQMA 7ICMA 3H39A 3RBDA 4YP3A 1Z3EB 2R8HA 3MBYA 3G6VA 5DBCA 3RB3A 2ZHBA 5D4BA 3AQNA 1TKDA 4DF8A 4I2AA 4I28A 4ZH4A 4M9NA 4NM1A 7ICIA 2M2UA 1FA0A 4DFPA 2LYHA 3JPNA 1SL0A 2BCVA 4JV1A 2HW3A 3OV7A 2ZH5A 1TK5A 3MR3A 3KHHA 4DSFA 1DGSA 1XC9A 4RUAA 3H40A 4KLIA 4QZGA 4F5RA 1S10A 7ICPA 5J0XA 3ISBA 3OVSA 1IM4A 1RPLA 1ZQGA 3RH5A 1ZQIA 3WFRE 2W9BB 4UBBA 1NO5A 4PHPA 3V6JA 4WC5A 4UB3A 3RR7A 2DRBA 1WCLA 4ATBB 3TARA 4MFCA 1QSLA 4FS2A 5F9LA 1X9MA 1UETA 8ICKA 4B9MA 3RB6A 8ICVA 4X4RA 2C2DA 7ICUA 5CJ7A 4YXMA 3H4DA 9ICXA 5KFDA 2O5AA 4KMUA 5KT4A 2M9NA 4O9MA 2XGPA 3V72A 3RJIA 4TQSA 1S0NA 1XSPA 8ICLA 4QWDA 3HX0A 4IRKA 3UPQA 4UQGA 9ICOA 2AGPA 4UB4A 1HUZA 3PO4A 1ZQQA 4WC0A 4DLGA 2MAXA 4IQUA 4RPXA 3M8SA 5DQIA 5IIJA 3K75D 1ZQNA 1ZJNA 4X0AA 4X4SA 3EPIA 1D9DA 4S3NA 2Q0ZX 1S9FA 1VJ7A 3C66A 3GILA 9ICBA 1UA0A 3H38A 1V9PA 4K4IA 2FLPA 9ICIA 4X4OA 4IR9A 4IQWA 2ZH4A 4R8UB 3Q8PB 1CUKA 4BXOA 4BGDA 1T8EA 2KZZA 7ICSA 4ED8A 9ICKA 5KFYA 5KFGA 4P4PA 2W9CB 1NJWA 9ICMA 2ZH1A 5BPCA 1L3TA 3H3AA 3MDCA 4ECZA 9ICJA 2PI4A 4QZIA 1RYRA 1R8AA 4YVZA 4GXIA 4O3PA 4XRHA 3LWMA 8ICGA 4J9SA 2HHUA 3GIMA 1RXWA 4F50A 4NLNA 3M9NB 3UQ0A 4NXZA 5DGAA 1N56A 2FMQA 5L1JA 2IHMA 3Q8SB 8ICFA 7ICRA 1Q79A 1NKCA 2IMWP 5KT2A 3RJJA 4IR1A 3NTUA 5KFJA 2NRXA 3FYHA 3PMNA 3C1ZA 3HPOA 3MGHA 5DLFA 1BPYA 3RJFA 8ICAA 4ELVA 4YR0A 5DQGA 4F5OA 2AJQA 4F4ZA 4F5QA 3T5LA 4I29A 2UVUA 4NLGA 3H8JA 5KFXA 2R8JA 1QLNA 2RDIA 3PW5A 4ECUA 4AT8B 1ZQYA 1UT5A 3ETLA 3PX4A 1B22A 4E8FA 5KFEA 5IINA 3RBEA 2V4RA 2JZBA 1KTQA 5J0SA 4DQSA 2XY7A 4JUZA 5KT5A 8ICTA 3JPRA 4EZ6A 3OVBA 5HC9A 1S97A 7ICGA 2HVHA 5HMMA 1NK8A 4R65A 1ZQPA 2HHPA 4FHXA 4TUSA 2BE3A 2DR9A 4YQWA 1AROP 8ICIA 3LK9A 4X4QA 4ED6A 1X2IA 5CWRA 2ZTEA 2ISOA 4LT6A 5BOMA 4B9SA 4C8OA 1SZPA 3WFOA 4E7XA 2PBEA 4I2IA 5KG1A 2PFNA 3TAPA 5DDYA 4EP7A 1D9FA 2BQRA 5KFPA 4O3NA 2AQ4A 9ICAA 2ZTCA 3TI0A 9ICTA 5IIIA 1T4GA 4WBZA 4KITB 4J9QA 4TURA 5KG6A 2BCUA 4EZ9A 4QZAA 4P4OA 5J2FA 2DPJA 5HRHA 4DL2A 4GC6A 2AU0A 5DG7A 2C2RA 9ICHA 5J2HA 1RZTA 2FMPA 5EOZA 3N97B 2BCRA 4EYIB 2P6RA 4F3OA 3H4BA 3AQMA 4WC1A 3K4GA 1MC8A 1ZQXA 5J2IA 4M47A 4C8NA 5IIKA 3THVA 1ZYQA 4O5CA 3C1YA 4KLEA 3LWLA 3OUYA 2DFLA 4KLJA 5J2JA 1TFWA 9ICUA 2ZH9A 4AT7B 2ZH7A 1S0VA 3SI8A 4E80A 4RQ8A 2F1HA 3ISCA 2M2WA 2I9GA 5DB9A 3RRGA 3Q8KA 1TK8A 1DK3A 5DECA 3RJGA 3TAQA 1ZQZA 4B9TA 3B0XA 1SKRA 2ZUBA 4Z6DA 2XO7A 5L9XA 5CB1A 4I2GA 4MFFA 5J0TA 4F2RA 1NK4A 5DBAA 4Q8FA 2HHVA 2A1JA 3GFKB 5J0OA 4QZDA 1Z00B 4J9OA 3GIJA 1SL1A 1ZQDA 3BDPA 1YLQA 4FHYA 4EEYA 2KFZA 4QZEA 3G6YA 4KLOA 1TFYA 7ICNA 3BQ1A 1JXLA 1ZQRA 5J2GA 4ELTA 1A76A 2ID1A 4DQIA 5CHGA 3PR5B 2W8KA 2AGOA 5KFBA 4RWQA 3TFRA 4LZGA 1JX4A 5HHHA 4YG2A 4XUSA 1U9LA 2W9BA 4M6WB 4X4PA 1SKWA 4F8RA 4FHPA 3OVAA 4ATBA 4QZ9A 1U45A 4YXJA 1RXVA 1ZQTA 3OSNA 3QZ8A 4O5EA 4J9KA 3H8WA 8ICRA 4DOCA 4X4UA 2BR0A 3RTVA 2J6UA 3BJYA 2DR7A 4IRCA 5KG0A 5HRKA 4NY8A 4M2YA 3HJ4A 5KG3A 4QWEA 2P6UA 3MFIA 3MDAA 1JN3A 1ZQKA 1Q78A 3Q8QB 4UAZA 3Q8RB 1U48A 4DFMA 4JV2A 4YMNA 1TAUA 5HRLA 4P2HA 4YN4A 1TFRA 2VA2A 4I2FA 4NKUA 5IIMA 2R8GA 4M0AA 4I2EA 1UT8A 4F5NA 5IIOA 2RFFA 3ZDDA 4ECYA 4QW9A 2ZJAA 4KN4A 3C2LA 4TQRA 4I2CA 4Q43A 1ZQHA 4GXJA 1NZPA 3C18A 5DG9A 4DL4A 2IHNA 3ISDA 4KLLA 3QZ7A 4RQ2A 1U49A 4F4YA 2ISPA 4C8KA 1F5AA 2PXIA 7ICQA 2VA8A 4F5PA 4CCHA 4ECRA 2FPKA 3ZDAA 1BNPA 4G3IA 4RWOA 4RWNA 4R8UA 4F91B 3L9DA 2BCQA 2AGQA 4NLKA 1L3SA 3AU2A 3PX0A 2KZMA 3B0YA 4DQRA 2FPLA 5EWGA 1XSNA 2ZJ8A 4RPYA 2W9CA 1MIYA 3HJ1A 3PVXA 3LQCB 4KN7A 1D8YA 8ICPA 2ASLA 3Q8LA 4QW8A 5KFSA 3GDXA 1NJYA 4C8LA 1XS9D 1NOMA 9ICLA 5DQHA 5J2EA 2I1QA 1UEUA 1H38A 2BKEA 2IA6A 1DK2A 5HRFA 4BDPA 4KLMA 1XO1A 4F4WA 3EW9A 3M9OB 4YD2A 1JAJA 3OHBA 1JIHA 5KG5A 4DSKA 5KFOA 3RB0A 2C22A 5F9NA 2PI5A 2NRWA 4LVSA 2VA3A 3E2EA 5D49A 5J0WA 4AT9B 3Q8MA 2H5XA
chains in the Genus database with same CATH superfamily
4PPXA 3AQLA 1SL2A 5HRGA 4UAUA 1ZQEA 4AT8A 1DXSA 4O3MA 4K8VA 8ICMA 1KQQA 5HR9A 5KG7A 1SGGA 3QX7A 3BQ0A 3SMVA 9ICQA 4ECWA 2KEYA 1WG8A 4N7RA 4LZDA 3PW0A 4PGYA 5C0YA 2KP7A 2LYAA 1RDFA 1UCVA 1A77A 5B5EU 3PW7A 3MGVA 5G5GA 5DKWA 4Q45A 3V7LA 2A3VA 3HILA 4M5DA 1PX5A 4Y2SA 4UASA 1VFGA 5DB6A 3H0LB 4C8MA 7ICTA 1ZQSA 5L1LA 2K4EA 2EQYA 5DG8A 1J97A 3WFQE 1V85A 4F93B 3TADA 3MGIA 2VIXA 1BPZA 3SEIA 3M8RA 4EYHB 4X5VA 4E0DA 2YX8A 4DSJA 3NGDA 5ALJA 2DF4B 2ZUCA 4DS5A 4FHWA 3F5AA 4RQMA 4DL3A 3H37A 5J2CA 4EEDA 5F3XB 4P0PA 3FM9A 8ICQA 2RP5A 1X42A 2P35A 5KFFA 3HT3A 5EWFA 3UPSA 4JK1A 1PK1B 1KFDA 4P4MA 5AHXA 7ICLA 2F3NA 7ICEA 4WC6A 4RU9A 8ICUA 1N60A 1S0OA 1MSWD 4KLQA 5AK6A 4OJLA 2ZG6A 1BPXA 2ZH3A 2NRZA 5AKHA 4M6WA 4QZHA 4J9NA 4KLTA 3V7KA 5KFNA 4I2JA 1CRXA 4KTQA 4M9LA 3T5KA 4RNOA 4Z6EA 5KFHA 2HHQA 4I0UA 5CR0A 3IDWA 2R8KA 2DPIA 3RH4A 1U4BA 3WKDA 2LPEA 1S0MA 5HRIA 3JZ0A 4OJ5A 8ICJA 4KLSA 2BPGA 3PNCA 9ICEA 4EV6A 1T3NA 4DQQA 2E8MA 4LEWA 3U26A 5KFVA 5T14A 1MQ2A 4BXOB 4EBDA 2BDPA 4ELUA 4OJ6A 4FS1A 2JH1A 2HVIA 2ATLA 4O3RA 2ALZA 2K4IA 4QWAA 3SENA 3ZI4A 1A0PA 4R63A 3IHQB 2JEFA 5KG4A 2K8CB 2KTQA 2KSOA 1FO4A 5KFQA 3PW4A 4DL5A 3SZ2A 4UB1A 3AU6A 5J0PA 3JPOA 3B9JA 1R8BA 2LM4A 2HHXA 3QUTA 2CXYA 4JWNA 2FMSA 5KFCA 1T7PA 4FH3A 1TE2A 2EAMA 3IN5A 4B9LA 9ICCA 1ZQAA 2QB0B 4WCWA 2HOFA 2HHSA 1XWLA 2JEGA 5AM3A 1N5WA 5J0RA 2Y0SF 2FLLA 9ICSA 3PMLA 2IOHA 2HOQA 4DEZA 2F8KA 4XQ7A 2NRVA 4WC7A 4NV0A 3ZDEA 5F2VO 5CFSA 4NXVA 1ZQ1C 2XY6A 1UQVA 1MIVA 7ICMA 3H39A 5AKEA 2R8HA 3RBDA 4I2AA 2Q66A 3JPNA 3OV7A 1TK5A 4DSFA 4J03A 4RUAA 4KLIA 4CF3A 4F5RA 3ISBA 1RPLA 3RH5A 3WFRE 4UBBA 1XO0A 2DRBA 4ATBB 1N62A 1X9MA 1UETA 2C2DA 5CJ7A 9ICXA 5AI9A 4LEYA 2M9NA 3FAHA 9ICOA 4UB4A 4NXTA 1ZQQA 2MAXA 4US8A 1X6IA 3DV9A 1YZ7A 1OW5A 1D9DA 1NI3A 3QXGA 3S6JA 4OJOA 4K4IA 3D2SA 3NVYA 7ICSA 9ICKA 4P4PA 3MDCA 4QNLA 1R8AA 3NWIA 3F2CA 3LWMA 2HHUA 1RXWA 3UQ0A 2W04A 1NKCA 2IMWP 3PHZA 4IR1A 3NTUA 2MU2A 3MGHA 3QU7A 4DFDA 1QH9A 5DQGA 4F5OA 2UVUA 3H8JA 1V38A 1QLNA 2RDIA 4E8FA 1UT5A 5KFEA 3QYPA 1RM6C 5IINA 3RBEA 4DQSA 1F44A 5KT5A 5J8YC 4EZ6A 4R65A 4YQWA 3ETRA 3LK9A 4ED6A 5CWRA 1RYUA 5AKZA 5ALIA 4C8OA 3WFOA 3OPXA 1ECWA 2PBEA 2GO7A 3H0RB 5KG1A 2BZFA 2BBHA 4EEKA 5KFPA 5IIIA 4J9QA 2EZYA 5KG6A 2KOBA 5HRHA 1D8BA 5EOZA 1ZD2P 2ZIWB 5HR7A 5J2IA 4M47A 4C8NA 3THVA 2EH9A 4F71A 3C1YA 4NXWA 3OUYA 2DFLA 4LEZA 2W7OA 2ZH7A 3SI8A 2KK0A 3FC4A 2ZUBA 3OVAA 4MFFA 4F2RA 1SL1A 4FHYA 1ZQDA 1Z00B 3GIJA 3BDPA 2F2AB 2KFZA 4QZEA 3BQ1A 5J2GA 5CHGA 2AGOA 4CGZA 3A0HU 5KFBA 3TFRA 2WB1F 1O03A 4XUSA 2XIDA 4CDGA 1SV4A 2W9BA 2DQNB 2G5HB 2G06A 4CE6A 1SKWA 5EE1A 1K5OA 4QZ9A 1RXVA 5AM5A 5AK3A 3WK8A 3H8WA 4DOCA 4HX0A 5HRKA 4M2YA 3ICXA 1UPHA 4IL6U 1JN3A 3MFIA 4UAZA 2CRXA 5HRLA 2KE7A 4O6AA 2VA2A 2H3VA 2DBYA 5IIOA 3PSFA 3ZDDA 4QW9A 3IG8A 2ZJAA 1NZPA 4DL4A 2NYVA 3QZ7A 2PXIA 2VA8A 3IV6A 2FPKA 1BNPA 4G3IA 4R8UA 4F91B 5ALFA 1N63A 3AU2A 2FPLA 5J8YA 1XSNA 4F72A 1JROA 4RPYA 2W9CA 4KN7A 3Q8LA 5KFSA 1PVRA 5J2EA 2I1QA 3K1ZA 4EENA 1ZRMA 5HRFA 4O69A 5JRTA 4F4WA 2D8CA 3OHBA 4DSKA 3RB0A 2C22A 3E2EA 5ALQA 2NRWA 5AM0A 4WOYA 1LKYA 1JRPA 2K4PA 2H3IA 4K4GA 1KFTA 5DGBA 1SB3C 4Q8EA 2BDUA 2XCPA 4Z6CA 5J2DA 2RQ5A 2KG5A 4B6JA 1NK6A 4PL1A 1L5UA 1T3QA 2K4HA 5HMLA 4JWMA 3PW2A 1ZETA 3GIIA 1L3VA 4M04A 2BCSA 4EBEA 3MABA 4IQTA 2OHFA 2FLNA 3C21A 4OAGA 3N28A 5AKYA 2BQ3A 3WFPA 1KN5A 3QU2A 4PH5A 3JPSA 1BVSA 5J0UA 1ZQBA 1C7YA 2PKEA 5ALRA 3V7JA 1X9WA 8ICBA 4K9BA 3RJEA 1D8LA 2KKVA 2C2EA 4ECQA 3AQFA 2UVRA 1ZQOA 4KB6A 1GO3F 3AM9A 3T3FA 4RNNA 4DFKA 3R9KA 2ZHAA 3SYZA 2YTUA 1BNOA 2DUYA 5KG2A 5CP2A 5KFKA 2HCFA 1NK5A 1B0XA 4RUCA 1F0MA 3KTQA 3JPQA 3T5JA 5EE0A 4DOBA 3TFSA 2O1PA 4Q44A 4GC7A 7ICFA 2E8OA 8ICYA 4RQ6A 2F1IA 2ZIUB 2AXTU 3UXOA 2V4QA 2EDUA 3C2MA 7ICOA 2EWRA 3RAQA 2DR8A 4OJPA 3GV5B 4BWMA 4I2HA 4UD4A 4IRDA 1BPBA 4ED0A 2E8PA 2UVVA 8ICZA 4IC9A 3PSPA 1RQNA 2HBJA 3VC8A 3PX6A 5C5JA 3HIYA 5E79U 2G0AA 4MHVA 5AI5A 4DWIA 5DB7A 5KFRA 2HDOA 5AKJA 4QZFA 5ALEA 5J2KA 1NK7A 4AYBF 5ALNA 2ZH8A 5ALHA 2J6SA 2W11A 8ICWA 2CPRA 4PGXA 3OSPA 1X40A 4WC3A 5DLGA 4UB2A 3LVWA 1ZJMA 4YMMA 4C7ZA 3PZPA 4KLDA 2XICA 1SXEA 2ZUDA 1Z1VA 4NM2A 1CEZA 4MF8A 3HWTA 4FE3A 4DFJA 4DSIA 3LVVA 9ICNA 1KSPA 2W3SA 4YFKA 1PZNA 2NRKA 2WB1C 1TVAA 7ICVA 3SQIA 1J2MA 2WTFA 4AT9A 2XI9A 4F4KA 3M6KA 4CRXA 5D63A 3SV3A 2BGWA 4K96A 4Y2JA 3I76A 5KL1B 4U6PA 4FBUA 4FBTA 5ALVA 2BHNA 4LJXA 1NJXA 5KFAA 5KT7A 4Y2TA 7ICKA 4PHAA 5KFLA 4KLHA 4EBKA 2HMXA 2ZH6A 9ICFA 3PY8A 3RJHA 5IILA 5HREA 1KL9A 1ZQWA 1FFUA 5AM2A 4PHEA 4QZ8A 3OJSA 1TK0A 7ICHA 2AQ0A 4EX6A 3H0MB 4DLEA 1R89A 1KDHA 1IXRA 1LB2B 4R64A 2EAOA 2PMZC 4M9HA 5KT6A 2LKYA 2R18A 3ORYA 2O6KA 1SKSA 2KJ8A 3NVZA 1NK0A 4B9VA 5HP4A 4B9NA 3SAHA 3RH6A 5L1MA 1ZQFA 1TAMA 4IQVA 3TACB 2MSNA 1TAQA 2W8LA 1L8OA 1KRPA 5DBBA 1WYGA 4DL6A 4BJQA 1N2XA 2JXJA 4O3QA 2JEJA 2FCLA 4YMOA 4DO9A 2PFPA 3UXPA 2HBKA 8ICEA 1VJ5A 3EUB2 2A1JB 1ZQMA 4YP3A 1Z3EB 3G6VA 2LHTA 3IP4B 3RB3A 1RG6A 2ZHBA 1TKDA 4DF8A 5HC9A 4M9NA 4ZH4A 4X0AA 2NV3A 4ICAA 4C0ZA 4DFPA 2ZIVA 2ZH5A 3MR3A 2EAPA 3WU2U 1S10A 4UB3A 1J2NA 1QSLA 5F9LA 8ICKA 3RB6A 4X4RA 1NNLA 5G5HA 4YXMA 3H4DA 4KMUA 5A0LA 4BX9C 4O9MA 5B3PA 1S0NA 3BZKA 4UQGA 1HUZA 4WC0A 4DLGA 3JCFA 5ALWA 5IIJA 2W03A 3EPIA 3LYSA 1FEZA 2FLPA 4IR9A 3Q8PB 3WKBA 4BGDA 4C4TA 5KFYA 5B3QA 1NJWA 2ZH1A 3H3AA 5AKLA 9ICJA 2E5SA 3UMCA 4QZIA 3QU5A 4F50A 4NLNA 4C7YA 5DGAA 1N56A 2IHMA 1Q79A 1DK2A 2NRXA 3PMNA 1BPYA 5DLFA 4WQLA 3QUQA 4F5QA 3IG5A 2R8JA 5KFXA 4AT8B 3PX4A 3HKZF 2B56A 2JZBA 1KTQA 5J0SA 2XY7A 4JUZA 1WWUA 3JPRA 1NK8A 2HHPA 4FHXA 1SXDA 4C4RA 2JR5A 4JMUA 2ZTEA 3UMBA 2YMLA 4FZMA 4I2IA 2E3TA 3TAPA 2AQ4A 2ZTCA 3TI0A 9ICTA 2Q4TA 2GAFD 4UARA 4EZ9A 2DPJA 4DL2A 3KZIU 1DRGA 1FFVA 2K89A 4QIWF 2AU0A 4UW9A 3AL0B 1HEKA 1RZTA 2FMPA 3N97B 4EYIB 3NVOA 5IIKA 4KLEA 3LWLA 4KLJA 5J2JA 1S0VA 2YB4A 2M2WA 3RRGA 1TK8A 5DECA 2E1EA 3RJGA 4P0PB 5KAIU 1ZQZA 3B0XA 1SKRA 2XO7A 3BZCA 5J0TA 2H3ZA 5DBAA 2RRDA 3GFKB 5J0OA 1YLQA 4P0QA 4O68A 4EEYA 4HAIA 4KLOA 7ICNA 2ID1A 3L5KA 1A76A 2F76X 5AM4A 1KKXA 4LZGA 4YG2A 3C28A 1U9LA 3QUBA 4M6WB 4X4PA 4F8RA 4US9A 4RQNA 2EZXA 2LMRA 4J9KA 2H3FA 4X4UA 3BJYA 2DR7A 1ZXIA 4IRCA 4NY8A 3K7DA 1Q78A 3Q8QB 2IOFA 4NKUA 2B0CA 2W55A 4EELA 2A19A 4YN4A 4I2FA 4P2HA 4LEVA 2R8GA 1YZ6A 4M0AA 1UT8A 5AM1A 4NWIA 4Q43A 4GXJA 5DG9A 1VDVA 4RQ2A 2ISPA 2Y9UA 4ECRA 5EE3A 1ZRNA 2AGQA 3B0YA 2ZJ8A 5AKXA 2I6XA 3HJ1A 3LQCB 4K98A 3GDXA 4C8LA 1XS9D 5ALUA 3O0FA 3CK6A 2JRZA 4OAFA 4OD0A 1UEUA 2BKEA 4BDPA 3ER8C 1XO1A 3ER9B 2YMQA 1JIHA 2OXOA 4LVSA 4Y2RA 4IS7A 1BPEA 2WF6A 2KSOB 1GPJA 4ECXA 4QJFB 2Y1JA 8ICHA 4X4VA 4DF4A 4RT2A 2M2TA 2HN2A 3QEBZ 3NVWA 5CA7A 4MF2A 7ICJA 4RQ4A 4RT3A 2HHTA 2ZXIA 4XQ8A 4J9LA 1RYSA 1LV5A 2HBMA 2XGQA 1PK3A 1O08A 2L5YA 5TZVA 9ICVA 5ALYA 3CRXA 4WBYA 4NXXA 2VANA 2YN4A 1PVPA 3C5GA 5KTQA 2ZIXA 4FH5A 1Q8KA 1ZQLA 2OCEA 4RQ1A 5BOLA 4UB5A 1WCNA 5JU5A 4M9JA 3OHAA 1KEJA 5TISU 1ZQUA 5DDMA 4ED7A 1S76D 1WWVA 1L3UA 4Y2YA 4AT7A 8ICCA 3EWAA 3N7RC 4EBJA 2LBOA 4BWJA 3QU4A 1ZQJA 1UEVA 5D46A 1V4AA 4O3SA 8ICSA 3KHRA 4CF4A 2PFQA 2OM6A 4MEYA 5J0YA 3UMGA 4RQ7A 2LI6A 4DSLA 4Y2QA 4O0IA 3GZFA 1COOA 2FI1A 2J6TA 4K99A 5AKKA 5KFIA 5HR6A 1ZD3A 4P0QB 2Y1IA 2QARA 3HP6A 2V9WA 4A8EA 2WAQF 2OH2A 4X0BA 2HBLA 3WFSC 1MIWA 4Z6FA 2OEHA 4TUQA 3JPPA 5L1IA 3C23A 3QNMA 2YQEA 2BBJA 2Y0SC 3NKUA 1N5XA 1OXJA 3N4MB 2WHEA 1Z1BA 2W43A 4DCCA 4NLZA 5KFZA 1HUOA 1ZQCA 4MEXA 4C80A 2HI0A 4UAWA 3GQCA 2FE9A 2G5IB 3H8SA 4ED1A 4WH5A 2ZH2A 3PSTA 1M6YA 2KVSA 5J2BA 2DVIA 4GLXA 4JV0A 5HRBA 1N48A 3KBBA 4QZBA 3D2NA 4FHVA 3J81j 3IM1A 4YR3A 1UA1A 1OU5A 5J29A 1L6NA 5DEDA 2IBKA 2ZTDA 4J9RA 1XSLA 4EGWA 1NK9A 1XU4A 3OJUA 2W9AA 9ICWA 1DOQA 1FIQA 3SAGA 2F8LA 3V6KA 3BQ2A 4ZOHC 3KHGA 1NKEA 5KT3A 3FDSA 4PL2A 1DGJA 1ZOLA 1S77D 2RLTA 4KX3A 4ECSA 4YCXA 5AI4A 5KFUA 2JEIA 5ALZA 5FP0A 3C2KA 3RAXA 4DS4A 1X6JA 9ICGA 2GOLA 2XY5A 2M2VA 1Y88A 2XCAA 5D61A 2WFAA 3UM9A 2GH1A 2ZJ5A 2UVWA 1ZD5A 4ECTA 5AK4A 2P66A 3H7IA 3HJEA 1MN8A 3MCRA 2N1RA 2C28A 1ED1A 3CNHA 3QE9Y 4DL7A 3E58A 2HHWA 1B43A 2G09A 4FZLA 3ZDBA 1YT3A 5D62A 3V6HA 3G6XA 2YY6A 4UATA 3PR4A 1KBUA 2ZIXB 2JHDA 1UHUA 4UD5A 4WQKA 4UBCA 3M1YA 3OUYB 3MR2A 1NKBA 4NKTA 5EE9A 8ICXA 4X4TA 3GV7B 2NO5A 4USAA 5ALTA 5GTIU 4C4SA 1KFSA 1PK1A 2RDJA 4ED2A 4FZNA 1T94A 3NS1A 5D4BA 2M2UA 1FA0A 1RQLA 2BCVA 4XJEA 3D2QA 1XC9A 3H40A 2KKPA 7ICPA 3QUCA 5J0XA 1ZQGA 3TADC 2W9BB 1NO5A 4PHPA 3V6JA 4JLXA 3RR7A 1Z4OA 1WCLA 3BQ7A 2FDRA 4FS2A 2D3DA 1P7DA 8ICVA 3KOOA 5ALMA 2EANA 2O5AA 3RJIA 5AK5A 2K8AA 1XSPA 4IRKA 3F53A 5DQIA 2K8BB 3K75D 1ZQNA 4X4SA 2Q0ZX 1KW4A 1S9FA 3H38A 3GILA 2ZH4A 4R8UB 4BXOA 1CUKA 2KZZA 1T8EA 1SIJA 5CFTA 4ED8A 3D6JA 5KFGA 4ACOA 2W9CB 9ICMA 2AHOB 1N61A 4ECZA 8ICGA 3GIMA 1Z19A 8ICFA 2GLEA 4NXZA 2FMQA 5L1JA 7ICRA 5KT2A 3NRZA 1QQ6A 3HPOA 4ELVA 4YR0A 5ALOA 3ED5A 2DKXA 1LKYB 4F4ZA 2RHFA 2MA1A 4NLCA 3T5LA 4I29A 4NLGA 3L3FX 1ZQYA 1B22A 1S8OA 8ICTA 2QLTA 1QQ5A 3CYMA 3OVBA 1L7OA 1S97A 3E0FA 5HMMA 3ALRA 1ZQPA 4TUSA 4X4QA 3IRUA 1X2IA 4UB8U 4E7XA 1SZPA 2PFNA 3HRDD 5DDYA 4EP7A 3KKAC 1D9FA 2BQRA 4O3NA 2QB0A 2XVTA 3KZXA 3OWGA 2BCUA 1L7PA 4QZAA 4P4OA 5J2FA 4GC6A 2C2RA 9ICHA 5J2HA 3WKAA 1SV0C 2BCRA 4WC1A 2P6RA 4F3OA 3H4BA 2QB1A 1MC8A 2B6GA 4O5CA 5B66U 4RQ8A 3F2DA 3ISCA 5DB9A 4CNQA 1DK3A 3TAQA 4I2GA 5CB1A 1NK4A 4Q8FA 2HHVA 4J9OA 2Y9TA 3G6YA 1JXLA 5GTHU 4ELTA 2KV2A 4DQIA 2W8KA 1JX4A 1B4FA 3DDHA 4NJ8A 3C29A 3N7PD 4FHPA 4K9AA 4ATBA 1U45A 4YXJA 2LM1A 2DL0A 3QZ8A 4O5EA 1VLBA 3T79A 1X66A 2BR0A 3RTVA 2J6UA 5KG0A 2DGZA 3HJ4A 1ZQKA 1Q3VA 1U48A 4DFMA 1TAUA 1TFRA 5IIMA 4I2EA 2RFFA 4TQRA 4I2CA 5AIBA 3WKCA 3I1YA 2W54A 4C8KA 2ODGA 1F5AA 7ICQA 1JUDA 3PSIA 3NRWA 3EF2A 1XNSA 4RWNA 1COKA 4NLKA 5EWGA 3F2BA 3SAFA 5KNIA 3PVXA 1IIPA 1D8YA 8ICPA 2ASLA 4QW8A 1NJYA 2KHVA 1NOMA 4Y2PA 3OTQA 1H38A 2IA6A 2VKQA 3EW9A 1JAJA 4JLZA 5KFOA 5D49A 5J0WA 4AT9B 3KKAA 2MRLA 3Q8MA 1LVHA 3OGUA 3RB4A 1C20A 2KJ5A 4R66A 1KLNA 4RWPA 4F92B 2VJ4A 5HRDA 3WK7A 5CFUA 2GWSA 2FPMA 4OAHA 5AKIA 1SV0A 2E1FA 4AYBC 1JXEA 4I2BA 2KVCA 2MUTA 2KICA 3GU3A 4NLBA 2R8IA 2YMPA 4DSEA 2KZ3A 8ICLA 4EBCA 9ICRA 3KHLA 2KFNA 2KHQA 3PV8A 8ICOA 2B4VA 3M9MB 3K1RB 2OWOA 2KIVA 3M6ZA 2KJ9A 4NXUA 3EPGA 2W3RA 4RQ3A 4QZCA 4MFAA 4IG8A 5JTGA 1KNYA 2ZIWA 4Y2VA 1URJA 3SV4A 4X4NA 4MKPA 4Y2XA 1IV8A 1R8CA 5KFWA 4WC4A 3WK4A 1BGXT 1NJZA 5EWEA 1ZD4A 5HHIA 1JMSA 4GIBA 4PGQA 5DB8A 5K4LA 4PHDA 4KLGA 3UQ2A 4ED3A 4O3OA 4DOAA 1Z00A 3ZDCA 3QEAZ 4M9GA 3DEEA 3C5FA 3T5HA 3AQKA 3RRHA 2EZZA 2ASDA 2ZIVB 4RQ0A 2HN1A 2DWQA 3AMZA 2IOFK 2VJ5A 1QCKA 3MFHA 3PO5A 3VCBA 5KFTA 4I27A 2KD1A 3ERCC 2I5HA 5ALDA 2G07A 2IHOA 5AIAA 3M7DA 3WK5A 3JYYA 4KLFA 4KLUA 1WOTA 1K1QA 2BPFA 4DQPA 2KN7A 1QSYA 4F2SA 3N7SC 2AH5A 4GXKA 3A0BU 3RR8A 5HNKA 4TUPA 4J9PA 3LDAA 4UAVA 2A1AA 4WJ3B 2DRAA 3TKAA 2DKZA 1QTMA 5J0QA 4K4HA 3ONNA 1ZQVA 3NYBA 3ZD9A 4PZOA 2DR5A 2F77X 4CF5A 2W7PA 4RPZA 4RQ5A 2XC9A 3MR5A 5L1KA 5J2AA 5H2FU 1K1SA 4EX7A 5JTIA 4YR2A 8ICNA 9ICPA 1S5LU 5ALPA 4B9UA 4YD1A 3TANA 1HJPA 1X9XA 3WK6A 2G08A 4QWBA 4RNMA 4F4XA 2Z7JA 3ZD8A 3BQTA 3EYZA 3EZ5A 4ECVA 4QWCA 2JZBB 4HYKA 4J9MA 3I28A 1A6SA 3GIKA 1MA7A 1JQRA 1L7NA 3TQ1A 1CI4A 1X9SA 2NRTA 5ALLA 2MUTB 4FO1A 1TV9A 3RJKA 1QSSA 1Q46A 2ASJA 4NL9C 3NASA 4UAYA 1EXNA 2WF7A 2B21A 2W9MA 3AUOA 2KIWA 5JUMA 4RZRA 2JMGA 2PFOA 5ALKA 2F1JA 1BPDA 3JPTA 3WK9A 3QU9A 3GV8B 3BS5A 2BQUA 3MR6A 5KFMA 5AI0A 3UXNA 3L4PA 5KL8B 1V97A 4XA5A 4WC2A 1MQ3A 2BPCA 2E8NA 2ESEA 4O5KA 2GA9D 5AI6A 3MC1A 2JV3A 1SWWA 2JH7A 1IG6A 2OYYA 4OCZA 2HOIA 3HKZC 1L7MA 4Y2UA 3HW8A 3SR6A 4I2DA 4FO6A 3RF9A 2LYBA 1U47A 2JGAA 3MBYA 5DBCA 3AQNA 4I28A 4NM1A 7ICIA 2LYHA 2ZIUA 1SL0A 4JV1A 2HW3A 3KHHA 1DGSA 4QZGA 3OVSA 1IM4A 2H3QA 1ZQIA 3H8MA 3AQEA 4WC5A 2KNJA 5ALXA 3TARA 4MFCA 4QIWC 4B9MA 4OO1J 4FFDA 3NVVA 7ICUA 5KFDA 2WF9A 5KT4A 2XGPA 3V72A 4TQSA 4QWDA 1NZBA 2WF5A 3SD7A 3HX0A 3UPQA 2CN1A 2AGPA 3PO4A 5AI8A 4IQUA 4RPXA 2B51A 3M8SA 1ZJNA 4S3NA 4PJ0U 3C66A 1SWVA 1VJ7A 1HIWA 9ICBA 1UA0A 4X4OA 1V9PA 9ICIA 4IQWA 3RFAA 1JI7A 5BPCA 2M0NA 1L3TA 2PI4A 1RYRA 4YVZA 4GXIA 4O3PA 2PMZF 4XRHA 4J9SA 3M9NB 4NL9A 3Q8SB 5CRXA 3RJJA 5KFJA 3FYHA 3C1ZA 8ICAA 3RJFA 4UB6U 2IUBA 2AJQA 2WF8A 3PW5A 4ECUA 4OAIZ 3ETLA 2K60A 2V4RA 3KD3A 4GFJA 1F5SA 7ICGA 2HVHA 2BE3A 2DR9A 4U7CA 1AROP 8ICIA 4JB3A 2ISOA 4LT6A 5BOMA 4B9SA 1QQ7A 9ICAA 1T4GA 4WBZA 4KITB 3NUQA 4TURA 2HSZA 2YB1A 3AEVA 3KFUF 5DG7A 3WKEA 2YMMA 1JALA 3AQMA 3K4GA 2D6FC 1ZQXA 1ZYQA 3BS5B 3F5EA 2QKQA 1AQ6A 1TFWA 9ICUA 2ZH9A 4AT7B 4E80A 4AP9A 2F1HA 4KMOB 2I9GA 4K97A 3Q8KA 4EEBA 3CW2C 4B9TA 4Z6DA 1SZHA 5L9XA 5AICA 5AKGA 2A1JA 4QZDA 2F44A 4G9BA 1TFYA 1ZQRA 3PR5B 4RWQA 5HHHA 4KM5A 2QARB 3CP8A 4KX5A 4PZNA 2FJ6A 1PVQA 1OUQA 1ZQTA 3OSNA 8ICRA 2ZXHA 5KG3A 5CEHA 3MDAA 2P6UA 4QWEA 2NO4A 3Q8RB 4JV2A 1WUDA 1Z4NA 4YMNA 5ALGA 5KAFU 4F5NA 1PUZA 4ECYA 4KN4A 3C2LA 3C18A 1ZQHA 4KLLA 2IHNA 3BS7A 3ISDA 1U49A 4F4YA 5CHEA 4O67A 2KMDA 4F5PA 1Q3UA 4CCHA 3ZDAA 5ALSA 4RWOA 3AN1A 3L9DA 2BCQA 1L3SA 2KZMA 3PX0A 4DQRA 1MIYA 9ICLA 5DQHA 2WAQC 1L8LA 4KLMA 3M9OB 4YD2A 2ES6A 5KG5A 2PI5A 5F9NA 4BUGA 2VA3A 2H5XA
chains in the Genus database with same CATH topology
3OGUA 4PPXA 1BPEA 3RB4A 3AQLA 4R66A 1KLNA 4RWPA 1SL2A 5HRGA 4K4GA 1KFTA 4ECXA 4F92B 5DGBA 2Y1JA 1ZQEA 5HRDA 8ICHA 4AT8A 4Q8EA 4X4VA 2GWSA 2XCPA 4Z6CA 2FPMA 4RT2A 4DF4A 5J2DA 8ICMA 2M2TA 3QEBZ 5CA7A 5HR9A 5KG7A 1NK6A 4MF2A 1JXEA 4I2BA 1L5UA 7ICJA 4RQ4A 3BQ0A 5HMLA 4RT3A 2HHTA 2MUTA 4JWMA 3PW2A 4ECWA 9ICQA 4XQ8A 4J9LA 1RYSA 4LZDA 1ZETA 2R8IA 1LV5A 3PW0A 4DSEA 2KZ3A 2XGQA 3GIIA 1L3VA 4EBCA 4M04A 2BCSA 4PGYA 4EBEA 3MABA 4IQTA 3KHLA 9ICRA 2KP7A 2KFNA 2FLNA 1A77A 3C21A 3PW7A 2Q66A 5DKWA 4Q45A 3V7LA 2BQ3A 3PV8A 3WFPA 5TZVA 9ICVA 4M5DA 4PH5A 3JPSA 1PX5A 1BVSA 5J0UA 1ZQBA 8ICOA 1VFGA 3M9MB 1C7YA 5DB6A 2OWOA 4WBYA 2VANA 4C8MA 3V7JA 7ICTA 1X9WA 1ZQSA 3C5GA 5KTQA 5L1LA 8ICBA 3EPGA 5DG8A 3WFQE 3RJEA 4FH5A 1D8LA 4F93B 3MGIA 1ZQLA 4RQ1A 5BOLA 4UB5A 4RQ3A 2C2EA 1WCNA 4QZCA 4MFAA 4M9JA 4IG8A 4ECQA 1KNYA 3OHAA 1BPZA 1KEJA 3M8RA 2UVRA 1ZQOA 1ZQUA 5DDMA 4EYHB 3SV4A 4ED7A 4X5VA 4E0DA 4DSJA 3NGDA 1S76D 4X4NA 1R8CA 1L3UA 2ZUCA 4DS5A 3T3FA 4FHWA 5KFWA 4RNNA 8ICCA 4DFKA 4AT7A 3EWAA 4WC4A 1BGXT 1NJZA 4DL3A 2ZHAA 5EWEA 3SYZA 3H37A 5HHIA 4EBJA 1JMSA 5J2CA 1BNOA 5KG2A 4PGQA 5CP2A 5DB8A 4BWJA 5KFKA 1ZQJA 4PHDA 4KLGA 8ICQA 3UQ2A 1NK5A 1UEVA 5D46A 4ED3A 1V4AA 4O3SA 8ICSA 5KFFA 4RUCA 4O3OA 5EWFA 3HT3A 3KHRA 4DOAA 3KTQA 1Z00A 3UPSA 4JK1A 2PFQA 4MEYA 3JPQA 5J0YA 3T5JA 4DOBA 1KFDA 4P4MA 4RQ7A 3ZDCA 3TFSA 4DSLA 7ICLA 3QEAZ 4M9GA 4O0IA 4Q44A 4GC7A 4RU9A 7ICFA 7ICEA 8ICUA 1COOA 1S0OA 2J6TA 4WC6A 1MSWD 5KFIA 3C5FA 4RQ6A 3T5HA 4KLQA 3RRHA 2F1IA 8ICYA 2Y1IA 3AQKA 3UXOA 2V4QA 2ASDA 1BPXA 2NRZA 4RQ0A 3HP6A 2V9WA 2ZH3A 3C2MA 7ICOA 4M6WA 4X0BA 3RAQA 2DR8A 3GV5B 4BWMA 3MFHA 3PO5A 4I2HA 4QZHA 4J9NA 4KLTA 4UD4A 5KFTA 3V7KA 5KFNA 4IRDA 3WFSC 4I2JA 4I27A 4KTQA 1MIWA 4Z6FA 4M9LA 4TUQA 3T5KA 3JPPA 1BPBA 4ED0A 4RNOA 5L1IA 3C23A 4Z6EA 2UVVA 5KFHA 8ICZA 2HHQA 3JYYA 4KLFA 3PX6A 5C5JA 5CR0A 3HIYA 2R8KA 2DPIA 4KLUA 3RH4A 1U4BA 4DWIA 1WOTA 5DB7A 1S0MA 5HRIA 3N4MB 3JZ0A 8ICJA 4KLSA 1K1QA 5KFRA 4NLZA 5KFZA 1HUOA 1ZQCA 2KN7A 4MEXA 1QSYA 2BPFA 4QZFA 5J2KA 2BPGA 4DQPA 1NK7A 3PNCA 2ZH8A 4UAWA 3GQCA 9ICEA 4F2SA 2J6SA 4GXKA 3H8SA 4ED1A 8ICWA 1T3NA 3RR8A 2ZH2A 5HNKA 4DQQA 4PGXA 4TUPA 4J9PA 3OSPA 3LDAA 5J2BA 5KFVA 4WC3A 2DVIA 4GLXA 5DLGA 2DRAA 4JV0A 4UB2A 1MQ2A 5HRBA 1ZJMA 4YMMA 1N48A 1QTMA 4QZBA 5J0QA 4EBDA 2BDPA 4BXOB 4ELUA 4KLDA 4FHVA 4K4HA 4FS1A 2ZUDA 2HVIA 3IM1A 4YR3A 1ZQVA 4NM2A 3NYBA 2ATLA 3ZD9A 1CEZA 4O3RA 1UA1A 2DR5A 1OU5A 4MF8A 3HWTA 5J29A 2ALZA 5DEDA 4DFJA 4QWAA 4RPZA 4RQ5A 2IBKA 4DSIA 9ICNA 1KSPA 2XC9A 2ZTDA 3MR5A 5J2AA 4YFKA 5L1KA 4J9RA 1K1SA 1PZNA 1XSLA 1TVAA 1NK9A 1XU4A 3OJUA 7ICVA 2W9AA 2NRKA 2WTFA 9ICWA 1DOQA 4YR2A 4R63A 4AT9A 3IHQB 2JEFA 8ICNA 9ICPA 4F4KA 3V6KA 5KG4A 3BQ2A 3KHGA 1NKEA 4YD1A 5KT3A 3SV3A 3FDSA 3TANA 2BGWA 4B9UA 1HJPA 2KTQA 1S77D 5KFQA 4FBUA 4QWBA 4FBTA 2BHNA 4ECSA 1NJXA 5KFAA 4YCXA 4RNMA 5KT7A 4F4XA 3PW4A 4DL5A 5KFUA 2JEIA 3ZD8A 3BQTA 3SZ2A 7ICKA 4UB1A 4PHAA 5KFLA 3EYZA 3EZ5A 4KLHA 4EBKA 4ECVA 4QWCA 3C2KA 3RAXA 3AU6A 2JZBB 4HYKA 4J9MA 4DS4A 2ZH6A 5J0PA 3JPOA 3GIKA 1JQRA 9ICGA 1R8BA 2XY5A 3TQ1A 9ICFA 3PY8A 1Y88A 2M2VA 3RJHA 5IILA 2XCAA 1X9SA 2HHXA 5HREA 1ZQWA 2NRTA 2MUTB 4PHEA 1TV9A 2ZJ5A 4QZ8A 4JWNA 2UVWA 3RJKA 1QSSA 2FMSA 5KFCA 2ASJA 2O1PA 3OJSA 4ECTA 1TK0A 7ICHA 2P66A 1T7PA 2AQ0A 4UAYA 3H7IA 4DLEA 1EXNA 4FH3A 2B21A 1R89A 4B9LA 2W9MA 3AUOA 9ICCA 1KDHA 1IXRA 5JUMA 4R64A 1LB2B 1ZQAA 2C28A 4M9HA 4RZRA 2PFOA 5KT6A 4WCWA 2F1JA 1BPDA 3JPTA 3QE9Y 4DL7A 3ORYA 2HHSA 1XWLA 1B43A 2JEGA 2HHWA 1SKSA 3GV8B 3ZDBA 2BQUA 3MR6A 5J0RA 5KFMA 1NK0A 4B9VA 3UXNA 3V6HA 3G6XA 2FLLA 4XA5A 4WC2A 9ICSA 3PMLA 1MQ3A 2BPCA 3PR4A 5HP4A 4B9NA 4O5KA 4UD5A 4DEZA 3RH6A 4UBCA 4XQ7A 2NRVA 1ZQFA 4IQVA 4WC7A 3MR2A 1NKBA 1TAQA 4NKTA 3ZDEA 3OUYB 2W8LA 1KRPA 5DBBA 5F2VO 8ICXA 4X4TA 3GV7B 3HW8A 4DL6A 2JEJA 4O3QA 4YMOA 4DO9A 2PFPA 3UXPA 1KFSA 8ICEA 4I2DA 2RDJA 4FO6A 4ED2A 2XY6A 1U47A 1MIVA 2A1JB 1ZQMA 7ICMA 3H39A 3RBDA 4YP3A 1Z3EB 2R8HA 3MBYA 3G6VA 5DBCA 3RB3A 2ZHBA 5D4BA 3AQNA 1TKDA 4DF8A 4I2AA 4I28A 4ZH4A 4M9NA 4NM1A 7ICIA 2M2UA 1FA0A 4DFPA 2LYHA 3JPNA 1SL0A 2BCVA 4JV1A 2HW3A 3OV7A 2ZH5A 1TK5A 3MR3A 3KHHA 4DSFA 1DGSA 1XC9A 4RUAA 3H40A 4KLIA 4QZGA 4F5RA 1S10A 7ICPA 5J0XA 3ISBA 3OVSA 1IM4A 1RPLA 1ZQGA 3RH5A 1ZQIA 3WFRE 2W9BB 4UBBA 1NO5A 4PHPA 3V6JA 4WC5A 4UB3A 3RR7A 2DRBA 1WCLA 4ATBB 3TARA 4MFCA 1QSLA 4FS2A 5F9LA 1X9MA 1UETA 8ICKA 4B9MA 3RB6A 8ICVA 4X4RA 2C2DA 7ICUA 5CJ7A 4YXMA 3H4DA 9ICXA 5KFDA 2O5AA 4KMUA 5KT4A 2M9NA 4O9MA 2XGPA 3V72A 3RJIA 4TQSA 1S0NA 1XSPA 8ICLA 4QWDA 3HX0A 4IRKA 3UPQA 4UQGA 9ICOA 2AGPA 4UB4A 1HUZA 3PO4A 1ZQQA 4WC0A 4DLGA 2MAXA 4IQUA 4RPXA 3M8SA 5DQIA 5IIJA 3K75D 1ZQNA 1ZJNA 4X0AA 4X4SA 3EPIA 1D9DA 4S3NA 2Q0ZX 1S9FA 1VJ7A 3C66A 3GILA 9ICBA 1UA0A 3H38A 1V9PA 4K4IA 2FLPA 9ICIA 4X4OA 4IR9A 4IQWA 2ZH4A 4R8UB 3Q8PB 1CUKA 4BXOA 4BGDA 1T8EA 2KZZA 7ICSA 4ED8A 9ICKA 5KFYA 5KFGA 4P4PA 2W9CB 1NJWA 9ICMA 2ZH1A 5BPCA 1L3TA 3H3AA 3MDCA 4ECZA 9ICJA 2PI4A 4QZIA 1RYRA 1R8AA 4YVZA 4GXIA 4O3PA 4XRHA 3LWMA 8ICGA 4J9SA 2HHUA 3GIMA 1RXWA 4F50A 4NLNA 3M9NB 3UQ0A 4NXZA 5DGAA 1N56A 2FMQA 5L1JA 2IHMA 3Q8SB 8ICFA 7ICRA 1Q79A 1NKCA 2IMWP 5KT2A 3RJJA 4IR1A 3NTUA 5KFJA 2NRXA 3FYHA 3PMNA 3C1ZA 3HPOA 3MGHA 5DLFA 1BPYA 3RJFA 8ICAA 4ELVA 4YR0A 5DQGA 4F5OA 2AJQA 4F4ZA 4F5QA 3T5LA 4I29A 2UVUA 4NLGA 3H8JA 5KFXA 2R8JA 1QLNA 2RDIA 3PW5A 4ECUA 4AT8B 1ZQYA 1UT5A 3ETLA 3PX4A 1B22A 4E8FA 5KFEA 5IINA 3RBEA 2V4RA 2JZBA 1KTQA 5J0SA 4DQSA 2XY7A 4JUZA 5KT5A 8ICTA 3JPRA 4EZ6A 3OVBA 5HC9A 1S97A 7ICGA 2HVHA 5HMMA 1NK8A 4R65A 1ZQPA 2HHPA 4FHXA 4TUSA 2BE3A 2DR9A 4YQWA 1AROP 8ICIA 3LK9A 4X4QA 4ED6A 1X2IA 5CWRA 2ZTEA 2ISOA 4LT6A 5BOMA 4B9SA 4C8OA 1SZPA 3WFOA 4E7XA 2PBEA 4I2IA 5KG1A 2PFNA 3TAPA 5DDYA 4EP7A 1D9FA 2BQRA 5KFPA 4O3NA 2AQ4A 9ICAA 2ZTCA 3TI0A 9ICTA 5IIIA 1T4GA 4WBZA 4KITB 4J9QA 4TURA 5KG6A 2BCUA 4EZ9A 4QZAA 4P4OA 5J2FA 2DPJA 5HRHA 4DL2A 4GC6A 2AU0A 5DG7A 2C2RA 9ICHA 5J2HA 1RZTA 2FMPA 5EOZA 3N97B 2BCRA 4EYIB 2P6RA 4F3OA 3H4BA 3AQMA 4WC1A 3K4GA 1MC8A 1ZQXA 5J2IA 4M47A 4C8NA 5IIKA 3THVA 1ZYQA 4O5CA 3C1YA 4KLEA 3LWLA 3OUYA 2DFLA 4KLJA 5J2JA 1TFWA 9ICUA 2ZH9A 4AT7B 2ZH7A 1S0VA 3SI8A 4E80A 4RQ8A 2F1HA 3ISCA 2M2WA 2I9GA 5DB9A 3RRGA 3Q8KA 1TK8A 1DK3A 5DECA 3RJGA 3TAQA 1ZQZA 4B9TA 3B0XA 1SKRA 2ZUBA 4Z6DA 2XO7A 5L9XA 5CB1A 4I2GA 4MFFA 5J0TA 4F2RA 1NK4A 5DBAA 4Q8FA 2HHVA 2A1JA 3GFKB 5J0OA 4QZDA 1Z00B 4J9OA 3GIJA 1SL1A 1ZQDA 3BDPA 1YLQA 4FHYA 4EEYA 2KFZA 4QZEA 3G6YA 4KLOA 1TFYA 7ICNA 3BQ1A 1JXLA 1ZQRA 5J2GA 4ELTA 1A76A 2ID1A 4DQIA 5CHGA 3PR5B 2W8KA 2AGOA 5KFBA 4RWQA 3TFRA 4LZGA 1JX4A 5HHHA 4YG2A 4XUSA 1U9LA 2W9BA 4M6WB 4X4PA 1SKWA 4F8RA 4FHPA 3OVAA 4ATBA 4QZ9A 1U45A 4YXJA 1RXVA 1ZQTA 3OSNA 3QZ8A 4O5EA 4J9KA 3H8WA 8ICRA 4DOCA 4X4UA 2BR0A 3RTVA 2J6UA 3BJYA 2DR7A 4IRCA 5KG0A 5HRKA 4NY8A 4M2YA 3HJ4A 5KG3A 4QWEA 2P6UA 3MFIA 3MDAA 1JN3A 1ZQKA 1Q78A 3Q8QB 4UAZA 3Q8RB 1U48A 4DFMA 4JV2A 4YMNA 1TAUA 5HRLA 4P2HA 4YN4A 1TFRA 2VA2A 4I2FA 4NKUA 5IIMA 2R8GA 4M0AA 4I2EA 1UT8A 4F5NA 5IIOA 2RFFA 3ZDDA 4ECYA 4QW9A 2ZJAA 4KN4A 3C2LA 4TQRA 4I2CA 4Q43A 1ZQHA 4GXJA 1NZPA 3C18A 5DG9A 4DL4A 2IHNA 3ISDA 4KLLA 3QZ7A 4RQ2A 1U49A 4F4YA 2ISPA 4C8KA 1F5AA 2PXIA 7ICQA 2VA8A 4F5PA 4CCHA 4ECRA 2FPKA 3ZDAA 1BNPA 4G3IA 4RWOA 4RWNA 4R8UA 4F91B 3L9DA 2BCQA 2AGQA 4NLKA 1L3SA 3AU2A 3PX0A 2KZMA 3B0YA 4DQRA 2FPLA 5EWGA 1XSNA 2ZJ8A 4RPYA 2W9CA 1MIYA 3HJ1A 3PVXA 3LQCB 4KN7A 1D8YA 8ICPA 2ASLA 3Q8LA 4QW8A 5KFSA 3GDXA 1NJYA 4C8LA 1XS9D 1NOMA 9ICLA 5DQHA 5J2EA 2I1QA 1UEUA 1H38A 2BKEA 2IA6A 1DK2A 5HRFA 4BDPA 4KLMA 1XO1A 4F4WA 3EW9A 3M9OB 4YD2A 1JAJA 3OHBA 1JIHA 5KG5A 4DSKA 5KFOA 3RB0A 2C22A 5F9NA 2PI5A 2NRWA 4LVSA 2VA3A 3E2EA 5D49A 5J0WA 4AT9B 3Q8MA 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGU A;  4PPX A;  1BPE A;  3RB4 A;  3AQL A;  4R66 A;  1KLN A;  4RWP A;  1SL2 A;  5HRG A;  4K4G A;  1KFT A;  4ECX A;  4F92 B;  5DGB A;  2Y1J A;  1ZQE A;  5HRD A;  8ICH A;  4AT8 A;  4Q8E A;  4X4V A;  2GWS A;  2XCP A;  4Z6C A;  2FPM A;  4RT2 A;  4DF4 A;  5J2D A;  8ICM A;  2M2T A;  3QEB Z;  5CA7 A;  5HR9 A;  5KG7 A;  1NK6 A;  4MF2 A;  1JXE A;  4I2B A;  1L5U A;  7ICJ A;  4RQ4 A;  3BQ0 A;  5HML A;  4RT3 A;  2HHT A;  2MUT A;  4JWM A;  3PW2 A;  4ECW A;  9ICQ A;  4XQ8 A;  4J9L A;  1RYS A;  4LZD A;  1ZET A;  2R8I A;  1LV5 A;  3PW0 A;  4DSE A;  2KZ3 A;  2XGQ A;  3GII A;  1L3V A;  4EBC A;  4M04 A;  2BCS A;  4PGY A;  4EBE A;  3MAB A;  4IQT A;  3KHL A;  9ICR A;  2KP7 A;  2KFN A;  2FLN A;  1A77 A;  3C21 A;  3PW7 A;  2Q66 A;  5DKW A;  4Q45 A;  3V7L A;  2BQ3 A;  3PV8 A;  3WFP A;  5TZV A;  9ICV A;  4M5D A;  4PH5 A;  3JPS A;  1PX5 A;  1BVS A;  5J0U A;  1ZQB A;  8ICO A;  1VFG A;  3M9M B;  1C7Y A;  5DB6 A;  2OWO A;  4WBY A;  2VAN A;  4C8M A;  3V7J A;  7ICT A;  1X9W A;  1ZQS A;  3C5G A;  5KTQ A;  5L1L A;  8ICB A;  3EPG A;  5DG8 A;  3WFQ E;  3RJE A;  4FH5 A;  1D8L A;  4F93 B;  3MGI A;  1ZQL A;  4RQ1 A;  5BOL A;  4UB5 A;  4RQ3 A;  2C2E A;  1WCN A;  4QZC A;  4MFA A;  4M9J A;  4IG8 A;  4ECQ A;  1KNY A;  3OHA A;  1BPZ A;  1KEJ A;  3M8R A;  2UVR A;  1ZQO A;  1ZQU A;  5DDM A;  4EYH B;  3SV4 A;  4ED7 A;  4X5V A;  4E0D A;  4DSJ A;  3NGD A;  1S76 D;  4X4N A;  1R8C A;  1L3U A;  2ZUC A;  4DS5 A;  3T3F A;  4FHW A;  5KFW A;  4RNN A;  8ICC A;  4DFK A;  4AT7 A;  3EWA A;  4WC4 A;  1BGX T;  1NJZ A;  4DL3 A;  2ZHA A;  5EWE A;  3SYZ A;  3H37 A;  5HHI A;  4EBJ A;  1JMS A;  5J2C A;  1BNO A;  5KG2 A;  4PGQ A;  5CP2 A;  5DB8 A;  4BWJ A;  5KFK A;  1ZQJ A;  4PHD A;  4KLG A;  8ICQ A;  3UQ2 A;  1NK5 A;  1UEV A;  5D46 A;  4ED3 A;  1V4A A;  4O3S A;  8ICS A;  5KFF A;  4RUC A;  4O3O A;  5EWF A;  3HT3 A;  3KHR A;  4DOA A;  3KTQ A;  1Z00 A;  3UPS A;  4JK1 A;  2PFQ A;  4MEY A;  3JPQ A;  5J0Y A;  3T5J A;  4DOB A;  1KFD A;  4P4M A;  4RQ7 A;  3ZDC A;  3TFS A;  4DSL A;  7ICL A;  3QEA Z;  4M9G A;  4O0I A;  4Q44 A;  4GC7 A;  4RU9 A;  7ICF A;  7ICE A;  8ICU A;  1COO A;  1S0O A;  2J6T A;  4WC6 A;  1MSW D;  5KFI A;  3C5F A;  4RQ6 A;  3T5H A;  4KLQ A;  3RRH A;  2F1I A;  8ICY A;  2Y1I A;  3AQK A;  3UXO A;  2V4Q A;  2ASD A;  1BPX A;  2NRZ A;  4RQ0 A;  3HP6 A;  2V9W A;  2ZH3 A;  3C2M A;  7ICO A;  4M6W A;  4X0B A;  3RAQ A;  2DR8 A;  3GV5 B;  4BWM A;  3MFH A;  3PO5 A;  4I2H A;  4QZH A;  4J9N A;  4KLT A;  4UD4 A;  5KFT A;  3V7K A;  5KFN A;  4IRD A;  3WFS C;  4I2J A;  4I27 A;  4KTQ A;  1MIW A;  4Z6F A;  4M9L A;  4TUQ A;  3T5K A;  3JPP A;  1BPB A;  4ED0 A;  4RNO A;  5L1I A;  3C23 A;  4Z6E A;  2UVV A;  5KFH A;  8ICZ A;  2HHQ A;  3JYY A;  4KLF A;  3PX6 A;  5C5J A;  5CR0 A;  3HIY A;  2R8K A;  2DPI A;  4KLU A;  3RH4 A;  1U4B A;  4DWI A;  1WOT A;  5DB7 A;  1S0M A;  5HRI A;  3N4M B;  3JZ0 A;  8ICJ A;  4KLS A;  1K1Q A;  5KFR A;  4NLZ A;  5KFZ A;  1HUO A;  1ZQC A;  2KN7 A;  4MEX A;  1QSY A;  2BPF A;  4QZF A;  5J2K A;  2BPG A;  4DQP A;  1NK7 A;  3PNC A;  2ZH8 A;  4UAW A;  3GQC A;  9ICE A;  4F2S A;  2J6S A;  4GXK A;  3H8S A;  4ED1 A;  8ICW A;  1T3N A;  3RR8 A;  2ZH2 A;  5HNK A;  4DQQ A;  4PGX A;  4TUP A;  4J9P A;  3OSP A;  3LDA A;  5J2B A;  5KFV A;  4WC3 A;  2DVI A;  4GLX A;  5DLG A;  2DRA A;  4JV0 A;  4UB2 A;  1MQ2 A;  5HRB A;  1ZJM A;  4YMM A;  1N48 A;  1QTM A;  4QZB A;  5J0Q A;  4EBD A;  2BDP A;  4BXO B;  4ELU A;  4KLD A;  4FHV A;  4K4H A;  4FS1 A;  2ZUD A;  2HVI A;  3IM1 A;  4YR3 A;  1ZQV A;  4NM2 A;  3NYB A;  2ATL A;  3ZD9 A;  1CEZ A;  4O3R A;  1UA1 A;  2DR5 A;  1OU5 A;  4MF8 A;  3HWT A;  5J29 A;  2ALZ A;  5DED A;  4DFJ A;  4QWA A;  4RPZ A;  4RQ5 A;  2IBK A;  4DSI A;  9ICN A;  1KSP A;  2XC9 A;  2ZTD A;  3MR5 A;  5J2A A;  4YFK A;  5L1K A;  4J9R A;  1K1S A;  1PZN A;  1XSL A;  1TVA A;  1NK9 A;  1XU4 A;  3OJU A;  7ICV A;  2W9A A;  2NRK A;  2WTF A;  9ICW A;  1DOQ A;  4YR2 A;  4R63 A;  4AT9 A;  3IHQ B;  2JEF A;  8ICN A;  9ICP A;  4F4K A;  3V6K A;  5KG4 A;  3BQ2 A;  3KHG A;  1NKE A;  4YD1 A;  5KT3 A;  3SV3 A;  3FDS A;  3TAN A;  2BGW A;  4B9U A;  1HJP A;  2KTQ A;  1S77 D;  5KFQ A;  4FBU A;  4QWB A;  4FBT A;  2BHN A;  4ECS A;  1NJX A;  5KFA A;  4YCX A;  4RNM A;  5KT7 A;  4F4X A;  3PW4 A;  4DL5 A;  5KFU A;  2JEI A;  3ZD8 A;  3BQT A;  3SZ2 A;  7ICK A;  4UB1 A;  4PHA A;  5KFL A;  3EYZ A;  3EZ5 A;  4KLH A;  4EBK A;  4ECV A;  4QWC A;  3C2K A;  3RAX A;  3AU6 A;  2JZB B;  4HYK A;  4J9M A;  4DS4 A;  2ZH6 A;  5J0P A;  3JPO A;  3GIK A;  1JQR A;  9ICG A;  1R8B A;  2XY5 A;  3TQ1 A;  9ICF A;  3PY8 A;  1Y88 A;  2M2V A;  3RJH A;  5IIL A;  2XCA A;  1X9S A;  2HHX A;  5HRE A;  1ZQW A;  2NRT A;  2MUT B;  4PHE A;  1TV9 A;  2ZJ5 A;  4QZ8 A;  4JWN A;  2UVW A;  3RJK A;  1QSS A;  2FMS A;  5KFC A;  2ASJ A;  2O1P A;  3OJS A;  4ECT A;  1TK0 A;  7ICH A;  2P66 A;  1T7P A;  2AQ0 A;  4UAY A;  3H7I A;  4DLE A;  1EXN A;  4FH3 A;  2B21 A;  1R89 A;  4B9L A;  2W9M A;  3AUO A;  9ICC A;  1KDH A;  1IXR A;  5JUM A;  4R64 A;  1LB2 B;  1ZQA A;  2C28 A;  4M9H A;  4RZR A;  2PFO A;  5KT6 A;  4WCW A;  2F1J A;  1BPD A;  3JPT A;  3QE9 Y;  4DL7 A;  3ORY A;  2HHS A;  1XWL A;  1B43 A;  2JEG A;  2HHW A;  1SKS A;  3GV8 B;  3ZDB A;  2BQU A;  3MR6 A;  5J0R A;  5KFM A;  1NK0 A;  4B9V A;  3UXN A;  3V6H A;  3G6X A;  2FLL A;  4XA5 A;  4WC2 A;  9ICS A;  3PML A;  1MQ3 A;  2BPC A;  3PR4 A;  5HP4 A;  4B9N A;  4O5K A;  4UD5 A;  4DEZ A;  3RH6 A;  4UBC A;  4XQ7 A;  2NRV A;  1ZQF A;  4IQV A;  4WC7 A;  3MR2 A;  1NKB A;  1TAQ A;  4NKT A;  3ZDE A;  3OUY B;  2W8L A;  1KRP A;  5DBB A;  5F2V O;  8ICX A;  4X4T A;  3GV7 B;  3HW8 A;  4DL6 A;  2JEJ A;  4O3Q A;  4YMO A;  4DO9 A;  2PFP A;  3UXP A;  1KFS A;  8ICE A;  4I2D A;  2RDJ A;  4FO6 A;  4ED2 A;  2XY6 A;  1U47 A;  1MIV A;  2A1J B;  1ZQM A;  7ICM A;  3H39 A;  3RBD A;  4YP3 A;  1Z3E B;  2R8H A;  3MBY A;  3G6V A;  5DBC A;  3RB3 A;  2ZHB A;  5D4B A;  3AQN A;  1TKD A;  4DF8 A;  4I2A A;  4I28 A;  4ZH4 A;  4M9N A;  4NM1 A;  7ICI A;  2M2U A;  1FA0 A;  4DFP A;  2LYH A;  3JPN A;  1SL0 A;  2BCV A;  4JV1 A;  2HW3 A;  3OV7 A;  2ZH5 A;  1TK5 A;  3MR3 A;  3KHH A;  4DSF A;  1DGS A;  1XC9 A;  4RUA A;  3H40 A;  4KLI A;  4QZG A;  4F5R A;  1S10 A;  7ICP A;  5J0X A;  3ISB A;  3OVS A;  1IM4 A;  1RPL A;  1ZQG A;  3RH5 A;  1ZQI A;  3WFR E;  2W9B B;  4UBB A;  1NO5 A;  4PHP A;  3V6J A;  4WC5 A;  4UB3 A;  3RR7 A;  2DRB A;  1WCL A;  4ATB B;  3TAR A;  4MFC A;  1QSL A;  4FS2 A;  5F9L A;  1X9M A;  1UET A;  8ICK A;  4B9M A;  3RB6 A;  8ICV A;  4X4R A;  2C2D A;  7ICU A;  5CJ7 A;  4YXM A;  3H4D A;  9ICX A;  5KFD A;  2O5A A;  4KMU A;  5KT4 A;  2M9N A;  4O9M A;  2XGP A;  3V72 A;  3RJI A;  4TQS A;  1S0N A;  1XSP A;  8ICL A;  4QWD A;  3HX0 A;  4IRK A;  3UPQ A;  4UQG A;  9ICO A;  2AGP A;  4UB4 A;  1HUZ A;  3PO4 A;  1ZQQ A;  4WC0 A;  4DLG A;  2MAX A;  4IQU A;  4RPX A;  3M8S A;  5DQI A;  5IIJ A;  3K75 D;  1ZQN A;  1ZJN A;  4X0A A;  4X4S A;  3EPI A;  1D9D A;  4S3N A;  2Q0Z X;  1S9F A;  1VJ7 A;  3C66 A;  3GIL A;  9ICB A;  1UA0 A;  3H38 A;  1V9P A;  4K4I A;  2FLP A;  9ICI A;  4X4O A;  4IR9 A;  4IQW A;  2ZH4 A;  4R8U B;  3Q8P B;  1CUK A;  4BXO A;  4BGD A;  1T8E A;  2KZZ A;  7ICS A;  4ED8 A;  9ICK A;  5KFY A;  5KFG A;  4P4P A;  2W9C B;  1NJW A;  9ICM A;  2ZH1 A;  5BPC A;  1L3T A;  3H3A A;  3MDC A;  4ECZ A;  9ICJ A;  2PI4 A;  4QZI A;  1RYR A;  1R8A A;  4YVZ A;  4GXI A;  4O3P A;  4XRH A;  3LWM A;  8ICG A;  4J9S A;  2HHU A;  3GIM A;  1RXW A;  4F50 A;  4NLN A;  3M9N B;  3UQ0 A;  4NXZ A;  5DGA A;  1N56 A;  2FMQ A;  5L1J A;  2IHM A;  3Q8S B;  8ICF A;  7ICR A;  1Q79 A;  1NKC A;  2IMW P;  5KT2 A;  3RJJ A;  4IR1 A;  3NTU A;  5KFJ A;  2NRX A;  3FYH A;  3PMN A;  3C1Z A;  3HPO A;  3MGH A;  5DLF A;  1BPY A;  3RJF A;  8ICA A;  4ELV A;  4YR0 A;  5DQG A;  4F5O A;  2AJQ A;  4F4Z A;  4F5Q A;  3T5L A;  4I29 A;  2UVU A;  4NLG A;  3H8J A;  5KFX A;  2R8J A;  1QLN A;  2RDI A;  3PW5 A;  4ECU A;  4AT8 B;  1ZQY A;  1UT5 A;  3ETL A;  3PX4 A;  1B22 A;  4E8F A;  5KFE A;  5IIN A;  3RBE A;  2V4R A;  2JZB A;  1KTQ A;  5J0S A;  4DQS A;  2XY7 A;  4JUZ A;  5KT5 A;  8ICT A;  3JPR A;  4EZ6 A;  3OVB A;  5HC9 A;  1S97 A;  7ICG A;  2HVH A;  5HMM A;  1NK8 A;  4R65 A;  1ZQP A;  2HHP A;  4FHX A;  4TUS A;  2BE3 A;  2DR9 A;  4YQW A;  1ARO P;  8ICI A;  3LK9 A;  4X4Q A;  4ED6 A;  1X2I A;  5CWR A;  2ZTE A;  2ISO A;  4LT6 A;  5BOM A;  4B9S A;  4C8O A;  1SZP A;  3WFO A;  4E7X A;  2PBE A;  4I2I A;  5KG1 A;  2PFN A;  3TAP A;  5DDY A;  4EP7 A;  1D9F A;  2BQR A;  5KFP A;  4O3N A;  2AQ4 A;  9ICA A;  2ZTC A;  3TI0 A;  9ICT A;  5III A;  1T4G A;  4WBZ A;  4KIT B;  4J9Q A;  4TUR A;  5KG6 A;  2BCU A;  4EZ9 A;  4QZA A;  4P4O A;  5J2F A;  2DPJ A;  5HRH A;  4DL2 A;  4GC6 A;  2AU0 A;  5DG7 A;  2C2R A;  9ICH A;  5J2H A;  1RZT A;  2FMP A;  5EOZ A;  3N97 B;  2BCR A;  4EYI B;  2P6R A;  4F3O A;  3H4B A;  3AQM A;  4WC1 A;  3K4G A;  1MC8 A;  1ZQX A;  5J2I A;  4M47 A;  4C8N A;  5IIK A;  3THV A;  1ZYQ A;  4O5C A;  3C1Y A;  4KLE A;  3LWL A;  3OUY A;  2DFL A;  4KLJ A;  5J2J A;  1TFW A;  9ICU A;  2ZH9 A;  4AT7 B;  2ZH7 A;  1S0V A;  3SI8 A;  4E80 A;  4RQ8 A;  2F1H A;  3ISC A;  2M2W A;  2I9G A;  5DB9 A;  3RRG A;  3Q8K A;  1TK8 A;  1DK3 A;  5DEC A;  3RJG A;  3TAQ A;  1ZQZ A;  4B9T A;  3B0X A;  1SKR A;  2ZUB A;  4Z6D A;  2XO7 A;  5L9X A;  5CB1 A;  4I2G A;  4MFF A;  5J0T A;  4F2R A;  1NK4 A;  5DBA A;  4Q8F A;  2HHV A;  2A1J A;  3GFK B;  5J0O A;  4QZD A;  1Z00 B;  4J9O A;  3GIJ A;  1SL1 A;  1ZQD A;  3BDP A;  1YLQ A;  4FHY A;  4EEY A;  2KFZ A;  4QZE A;  3G6Y A;  4KLO A;  1TFY A;  7ICN A;  3BQ1 A;  1JXL A;  1ZQR A;  5J2G A;  4ELT A;  1A76 A;  2ID1 A;  4DQI A;  5CHG A;  3PR5 B;  2W8K A;  2AGO A;  5KFB A;  4RWQ A;  3TFR A;  4LZG A;  1JX4 A;  5HHH A;  4YG2 A;  4XUS A;  1U9L A;  2W9B A;  4M6W B;  4X4P A;  1SKW A;  4F8R A;  4FHP A;  3OVA A;  4ATB A;  4QZ9 A;  1U45 A;  4YXJ A;  1RXV A;  1ZQT A;  3OSN A;  3QZ8 A;  4O5E A;  4J9K A;  3H8W A;  8ICR A;  4DOC A;  4X4U A;  2BR0 A;  3RTV A;  2J6U A;  3BJY A;  2DR7 A;  4IRC A;  5KG0 A;  5HRK A;  4NY8 A;  4M2Y A;  3HJ4 A;  5KG3 A;  4QWE A;  2P6U A;  3MFI A;  3MDA A;  1JN3 A;  1ZQK A;  1Q78 A;  3Q8Q B;  4UAZ A;  3Q8R B;  1U48 A;  4DFM A;  4JV2 A;  4YMN A;  1TAU A;  5HRL A;  4P2H A;  4YN4 A;  1TFR A;  2VA2 A;  4I2F A;  4NKU A;  5IIM A;  2R8G A;  4M0A A;  4I2E A;  1UT8 A;  4F5N A;  5IIO A;  2RFF A;  3ZDD A;  4ECY A;  4QW9 A;  2ZJA A;  4KN4 A;  3C2L A;  4TQR A;  4I2C A;  4Q43 A;  1ZQH A;  4GXJ A;  1NZP A;  3C18 A;  5DG9 A;  4DL4 A;  2IHN A;  3ISD A;  4KLL A;  3QZ7 A;  4RQ2 A;  1U49 A;  4F4Y A;  2ISP A;  4C8K A;  1F5A A;  2PXI A;  7ICQ A;  2VA8 A;  4F5P A;  4CCH A;  4ECR A;  2FPK A;  3ZDA A;  1BNP A;  4G3I A;  4RWO A;  4RWN A;  4R8U A;  4F91 B;  3L9D A;  2BCQ A;  2AGQ A;  4NLK A;  1L3S A;  3AU2 A;  3PX0 A;  2KZM A;  3B0Y A;  4DQR A;  2FPL A;  5EWG A;  1XSN A;  2ZJ8 A;  4RPY A;  2W9C A;  1MIY A;  3HJ1 A;  3PVX A;  3LQC B;  4KN7 A;  1D8Y A;  8ICP A;  2ASL A;  3Q8L A;  4QW8 A;  5KFS A;  3GDX A;  1NJY A;  4C8L A;  1XS9 D;  1NOM A;  9ICL A;  5DQH A;  5J2E A;  2I1Q A;  1UEU A;  1H38 A;  2BKE A;  2IA6 A;  1DK2 A;  5HRF A;  4BDP A;  4KLM A;  1XO1 A;  4F4W A;  3EW9 A;  3M9O B;  4YD2 A;  1JAJ A;  3OHB A;  1JIH A;  5KG5 A;  4DSK A;  5KFO A;  3RB0 A;  2C22 A;  5F9N A;  2PI5 A;  2NRW A;  4LVS A;  2VA3 A;  3E2E A;  5D49 A;  5J0W A;  4AT9 B;  3Q8M A;  2H5X A; 
#chains in the Genus database with same CATH topology
 4PPX A;  3AQL A;  1SL2 A;  5HRG A;  4UAU A;  1ZQE A;  4AT8 A;  1DXS A;  4O3M A;  4K8V A;  8ICM A;  1KQQ A;  5HR9 A;  5KG7 A;  1SGG A;  3QX7 A;  3BQ0 A;  3SMV A;  9ICQ A;  4ECW A;  2KEY A;  1WG8 A;  4N7R A;  4LZD A;  3PW0 A;  4PGY A;  5C0Y A;  2KP7 A;  2LYA A;  1RDF A;  1UCV A;  1A77 A;  5B5E U;  3PW7 A;  3MGV A;  5G5G A;  5DKW A;  4Q45 A;  3V7L A;  2A3V A;  3HIL A;  4M5D A;  1PX5 A;  4Y2S A;  4UAS A;  1VFG A;  5DB6 A;  3H0L B;  4C8M A;  7ICT A;  1ZQS A;  5L1L A;  2K4E A;  2EQY A;  5DG8 A;  1J97 A;  3WFQ E;  1V85 A;  4F93 B;  3TAD A;  3MGI A;  2VIX A;  1BPZ A;  3SEI A;  3M8R A;  4EYH B;  4X5V A;  4E0D A;  2YX8 A;  4DSJ A;  3NGD A;  5ALJ A;  2DF4 B;  2ZUC A;  4DS5 A;  4FHW A;  3F5A A;  4RQM A;  4DL3 A;  3H37 A;  5J2C A;  4EED A;  5F3X B;  4P0P A;  3FM9 A;  8ICQ A;  2RP5 A;  1X42 A;  2P35 A;  5KFF A;  3HT3 A;  5EWF A;  3UPS A;  4JK1 A;  1PK1 B;  1KFD A;  4P4M A;  5AHX A;  7ICL A;  2F3N A;  7ICE A;  4WC6 A;  4RU9 A;  8ICU A;  1N60 A;  1S0O A;  1MSW D;  4KLQ A;  5AK6 A;  4OJL A;  2ZG6 A;  1BPX A;  2ZH3 A;  2NRZ A;  5AKH A;  4M6W A;  4QZH A;  4J9N A;  4KLT A;  3V7K A;  5KFN A;  4I2J A;  1CRX A;  4KTQ A;  4M9L A;  3T5K A;  4RNO A;  4Z6E A;  5KFH A;  2HHQ A;  4I0U A;  5CR0 A;  3IDW A;  2R8K A;  2DPI A;  3RH4 A;  1U4B A;  3WKD A;  2LPE A;  1S0M A;  5HRI A;  3JZ0 A;  4OJ5 A;  8ICJ A;  4KLS A;  2BPG A;  3PNC A;  9ICE A;  4EV6 A;  1T3N A;  4DQQ A;  2E8M A;  4LEW A;  3U26 A;  5KFV A;  5T14 A;  1MQ2 A;  4BXO B;  4EBD A;  2BDP A;  4ELU A;  4OJ6 A;  4FS1 A;  2JH1 A;  2HVI A;  2ATL A;  4O3R A;  2ALZ A;  2K4I A;  4QWA A;  3SEN A;  3ZI4 A;  1A0P A;  4R63 A;  3IHQ B;  2JEF A;  5KG4 A;  2K8C B;  2KTQ A;  2KSO A;  1FO4 A;  5KFQ A;  3PW4 A;  4DL5 A;  3SZ2 A;  4UB1 A;  3AU6 A;  5J0P A;  3JPO A;  3B9J A;  1R8B A;  2LM4 A;  2HHX A;  3QUT A;  2CXY A;  4JWN A;  2FMS A;  5KFC A;  1T7P A;  4FH3 A;  1TE2 A;  2EAM A;  3IN5 A;  4B9L A;  9ICC A;  1ZQA A;  2QB0 B;  4WCW A;  2HOF A;  2HHS A;  1XWL A;  2JEG A;  5AM3 A;  1N5W A;  5J0R A;  2Y0S F;  2FLL A;  9ICS A;  3PML A;  2IOH A;  2HOQ A;  4DEZ A;  2F8K A;  4XQ7 A;  2NRV A;  4WC7 A;  4NV0 A;  3ZDE A;  5F2V O;  5CFS A;  4NXV A;  1ZQ1 C;  2XY6 A;  1UQV A;  1MIV A;  7ICM A;  3H39 A;  5AKE A;  2R8H A;  3RBD A;  4I2A A;  2Q66 A;  3JPN A;  3OV7 A;  1TK5 A;  4DSF A;  4J03 A;  4RUA A;  4KLI A;  4CF3 A;  4F5R A;  3ISB A;  1RPL A;  3RH5 A;  3WFR E;  4UBB A;  1XO0 A;  2DRB A;  4ATB B;  1N62 A;  1X9M A;  1UET A;  2C2D A;  5CJ7 A;  9ICX A;  5AI9 A;  4LEY A;  2M9N A;  3FAH A;  9ICO A;  4UB4 A;  4NXT A;  1ZQQ A;  2MAX A;  4US8 A;  1X6I A;  3DV9 A;  1YZ7 A;  1OW5 A;  1D9D A;  1NI3 A;  3QXG A;  3S6J A;  4OJO A;  4K4I A;  3D2S A;  3NVY A;  7ICS A;  9ICK A;  4P4P A;  3MDC A;  4QNL A;  1R8A A;  3NWI A;  3F2C A;  3LWM A;  2HHU A;  1RXW A;  3UQ0 A;  2W04 A;  1NKC A;  2IMW P;  3PHZ A;  4IR1 A;  3NTU A;  2MU2 A;  3MGH A;  3QU7 A;  4DFD A;  1QH9 A;  5DQG A;  4F5O A;  2UVU A;  3H8J A;  1V38 A;  1QLN A;  2RDI A;  4E8F A;  1UT5 A;  5KFE A;  3QYP A;  1RM6 C;  5IIN A;  3RBE A;  4DQS A;  1F44 A;  5KT5 A;  5J8Y C;  4EZ6 A;  4R65 A;  4YQW A;  3ETR A;  3LK9 A;  4ED6 A;  5CWR A;  1RYU A;  5AKZ A;  5ALI A;  4C8O A;  3WFO A;  3OPX A;  1ECW A;  2PBE A;  2GO7 A;  3H0R B;  5KG1 A;  2BZF A;  2BBH A;  4EEK A;  5KFP A;  5III A;  4J9Q A;  2EZY A;  5KG6 A;  2KOB A;  5HRH A;  1D8B A;  5EOZ A;  1ZD2 P;  2ZIW B;  5HR7 A;  5J2I A;  4M47 A;  4C8N A;  3THV A;  2EH9 A;  4F71 A;  3C1Y A;  4NXW A;  3OUY A;  2DFL A;  4LEZ A;  2W7O A;  2ZH7 A;  3SI8 A;  2KK0 A;  3FC4 A;  2ZUB A;  3OVA A;  4MFF A;  4F2R A;  1SL1 A;  4FHY A;  1ZQD A;  1Z00 B;  3GIJ A;  3BDP A;  2F2A B;  2KFZ A;  4QZE A;  3BQ1 A;  5J2G A;  5CHG A;  2AGO A;  4CGZ A;  3A0H U;  5KFB A;  3TFR A;  2WB1 F;  1O03 A;  4XUS A;  2XID A;  4CDG A;  1SV4 A;  2W9B A;  2DQN B;  2G5H B;  2G06 A;  4CE6 A;  1SKW A;  5EE1 A;  1K5O A;  4QZ9 A;  1RXV A;  5AM5 A;  5AK3 A;  3WK8 A;  3H8W A;  4DOC A;  4HX0 A;  5HRK A;  4M2Y A;  3ICX A;  1UPH A;  4IL6 U;  1JN3 A;  3MFI A;  4UAZ A;  2CRX A;  5HRL A;  2KE7 A;  4O6A A;  2VA2 A;  2H3V A;  2DBY A;  5IIO A;  3PSF A;  3ZDD A;  4QW9 A;  3IG8 A;  2ZJA A;  1NZP A;  4DL4 A;  2NYV A;  3QZ7 A;  2PXI A;  2VA8 A;  3IV6 A;  2FPK A;  1BNP A;  4G3I A;  4R8U A;  4F91 B;  5ALF A;  1N63 A;  3AU2 A;  2FPL A;  5J8Y A;  1XSN A;  4F72 A;  1JRO A;  4RPY A;  2W9C A;  4KN7 A;  3Q8L A;  5KFS A;  1PVR A;  5J2E A;  2I1Q A;  3K1Z A;  4EEN A;  1ZRM A;  5HRF A;  4O69 A;  5JRT A;  4F4W A;  2D8C A;  3OHB A;  4DSK A;  3RB0 A;  2C22 A;  3E2E A;  5ALQ A;  2NRW A;  5AM0 A;  4WOY A;  1LKY A;  1JRP A;  2K4P A;  2H3I A;  4K4G A;  1KFT A;  5DGB A;  1SB3 C;  4Q8E A;  2BDU A;  2XCP A;  4Z6C A;  5J2D A;  2RQ5 A;  2KG5 A;  4B6J A;  1NK6 A;  4PL1 A;  1L5U A;  1T3Q A;  2K4H A;  5HML A;  4JWM A;  3PW2 A;  1ZET A;  3GII A;  1L3V A;  4M04 A;  2BCS A;  4EBE A;  3MAB A;  4IQT A;  2OHF A;  2FLN A;  3C21 A;  4OAG A;  3N28 A;  5AKY A;  2BQ3 A;  3WFP A;  1KN5 A;  3QU2 A;  4PH5 A;  3JPS A;  1BVS A;  5J0U A;  1ZQB A;  1C7Y A;  2PKE A;  5ALR A;  3V7J A;  1X9W A;  8ICB A;  4K9B A;  3RJE A;  1D8L A;  2KKV A;  2C2E A;  4ECQ A;  3AQF A;  2UVR A;  1ZQO A;  4KB6 A;  1GO3 F;  3AM9 A;  3T3F A;  4RNN A;  4DFK A;  3R9K A;  2ZHA A;  3SYZ A;  2YTU A;  1BNO A;  2DUY A;  5KG2 A;  5CP2 A;  5KFK A;  2HCF A;  1NK5 A;  1B0X A;  4RUC A;  1F0M A;  3KTQ A;  3JPQ A;  3T5J A;  5EE0 A;  4DOB A;  3TFS A;  2O1P A;  4Q44 A;  4GC7 A;  7ICF A;  2E8O A;  8ICY A;  4RQ6 A;  2F1I A;  2ZIU B;  2AXT U;  3UXO A;  2V4Q A;  2EDU A;  3C2M A;  7ICO A;  2EWR A;  3RAQ A;  2DR8 A;  4OJP A;  3GV5 B;  4BWM A;  4I2H A;  4UD4 A;  4IRD A;  1BPB A;  4ED0 A;  2E8P A;  2UVV A;  8ICZ A;  4IC9 A;  3PSP A;  1RQN A;  2HBJ A;  3VC8 A;  3PX6 A;  5C5J A;  3HIY A;  5E79 U;  2G0A A;  4MHV A;  5AI5 A;  4DWI A;  5DB7 A;  5KFR A;  2HDO A;  5AKJ A;  4QZF A;  5ALE A;  5J2K A;  1NK7 A;  4AYB F;  5ALN A;  2ZH8 A;  5ALH A;  2J6S A;  2W11 A;  8ICW A;  2CPR A;  4PGX A;  3OSP A;  1X40 A;  4WC3 A;  5DLG A;  4UB2 A;  3LVW A;  1ZJM A;  4YMM A;  4C7Z A;  3PZP A;  4KLD A;  2XIC A;  1SXE A;  2ZUD A;  1Z1V A;  4NM2 A;  1CEZ A;  4MF8 A;  3HWT A;  4FE3 A;  4DFJ A;  4DSI A;  3LVV A;  9ICN A;  1KSP A;  2W3S A;  4YFK A;  1PZN A;  2NRK A;  2WB1 C;  1TVA A;  7ICV A;  3SQI A;  1J2M A;  2WTF A;  4AT9 A;  2XI9 A;  4F4K A;  3M6K A;  4CRX A;  5D63 A;  3SV3 A;  2BGW A;  4K96 A;  4Y2J A;  3I76 A;  5KL1 B;  4U6P A;  4FBU A;  4FBT A;  5ALV A;  2BHN A;  4LJX A;  1NJX A;  5KFA A;  5KT7 A;  4Y2T A;  7ICK A;  4PHA A;  5KFL A;  4KLH A;  4EBK A;  2HMX A;  2ZH6 A;  9ICF A;  3PY8 A;  3RJH A;  5IIL A;  5HRE A;  1KL9 A;  1ZQW A;  1FFU A;  5AM2 A;  4PHE A;  4QZ8 A;  3OJS A;  1TK0 A;  7ICH A;  2AQ0 A;  4EX6 A;  3H0M B;  4DLE A;  1R89 A;  1KDH A;  1IXR A;  1LB2 B;  4R64 A;  2EAO A;  2PMZ C;  4M9H A;  5KT6 A;  2LKY A;  2R18 A;  3ORY A;  2O6K A;  1SKS A;  2KJ8 A;  3NVZ A;  1NK0 A;  4B9V A;  5HP4 A;  4B9N A;  3SAH A;  3RH6 A;  5L1M A;  1ZQF A;  1TAM A;  4IQV A;  3TAC B;  2MSN A;  1TAQ A;  2W8L A;  1L8O A;  1KRP A;  5DBB A;  1WYG A;  4DL6 A;  4BJQ A;  1N2X A;  2JXJ A;  4O3Q A;  2JEJ A;  2FCL A;  4YMO A;  4DO9 A;  2PFP A;  3UXP A;  2HBK A;  8ICE A;  1VJ5 A;  3EUB 2;  2A1J B;  1ZQM A;  4YP3 A;  1Z3E B;  3G6V A;  2LHT A;  3IP4 B;  3RB3 A;  1RG6 A;  2ZHB A;  1TKD A;  4DF8 A;  5HC9 A;  4M9N A;  4ZH4 A;  4X0A A;  2NV3 A;  4ICA A;  4C0Z A;  4DFP A;  2ZIV A;  2ZH5 A;  3MR3 A;  2EAP A;  3WU2 U;  1S10 A;  4UB3 A;  1J2N A;  1QSL A;  5F9L A;  8ICK A;  3RB6 A;  4X4R A;  1NNL A;  5G5H A;  4YXM A;  3H4D A;  4KMU A;  5A0L A;  4BX9 C;  4O9M A;  5B3P A;  1S0N A;  3BZK A;  4UQG A;  1HUZ A;  4WC0 A;  4DLG A;  3JCF A;  5ALW A;  5IIJ A;  2W03 A;  3EPI A;  3LYS A;  1FEZ A;  2FLP A;  4IR9 A;  3Q8P B;  3WKB A;  4BGD A;  4C4T A;  5KFY A;  5B3Q A;  1NJW A;  2ZH1 A;  3H3A A;  5AKL A;  9ICJ A;  2E5S A;  3UMC A;  4QZI A;  3QU5 A;  4F50 A;  4NLN A;  4C7Y A;  5DGA A;  1N56 A;  2IHM A;  1Q79 A;  1DK2 A;  2NRX A;  3PMN A;  1BPY A;  5DLF A;  4WQL A;  3QUQ A;  4F5Q A;  3IG5 A;  2R8J A;  5KFX A;  4AT8 B;  3PX4 A;  3HKZ F;  2B56 A;  2JZB A;  1KTQ A;  5J0S A;  2XY7 A;  4JUZ A;  1WWU A;  3JPR A;  1NK8 A;  2HHP A;  4FHX A;  1SXD A;  4C4R A;  2JR5 A;  4JMU A;  2ZTE A;  3UMB A;  2YML A;  4FZM A;  4I2I A;  2E3T A;  3TAP A;  2AQ4 A;  2ZTC A;  3TI0 A;  9ICT A;  2Q4T A;  2GAF D;  4UAR A;  4EZ9 A;  2DPJ A;  4DL2 A;  3KZI U;  1DRG A;  1FFV A;  2K89 A;  4QIW F;  2AU0 A;  4UW9 A;  3AL0 B;  1HEK A;  1RZT A;  2FMP A;  3N97 B;  4EYI B;  3NVO A;  5IIK A;  4KLE A;  3LWL A;  4KLJ A;  5J2J A;  1S0V A;  2YB4 A;  2M2W A;  3RRG A;  1TK8 A;  5DEC A;  2E1E A;  3RJG A;  4P0P B;  5KAI U;  1ZQZ A;  3B0X A;  1SKR A;  2XO7 A;  3BZC A;  5J0T A;  2H3Z A;  5DBA A;  2RRD A;  3GFK B;  5J0O A;  1YLQ A;  4P0Q A;  4O68 A;  4EEY A;  4HAI A;  4KLO A;  7ICN A;  2ID1 A;  3L5K A;  1A76 A;  2F76 X;  5AM4 A;  1KKX A;  4LZG A;  4YG2 A;  3C28 A;  1U9L A;  3QUB A;  4M6W B;  4X4P A;  4F8R A;  4US9 A;  4RQN A;  2EZX A;  2LMR A;  4J9K A;  2H3F A;  4X4U A;  3BJY A;  2DR7 A;  1ZXI A;  4IRC A;  4NY8 A;  3K7D A;  1Q78 A;  3Q8Q B;  2IOF A;  4NKU A;  2B0C A;  2W55 A;  4EEL A;  2A19 A;  4YN4 A;  4I2F A;  4P2H A;  4LEV A;  2R8G A;  1YZ6 A;  4M0A A;  1UT8 A;  5AM1 A;  4NWI A;  4Q43 A;  4GXJ A;  5DG9 A;  1VDV A;  4RQ2 A;  2ISP A;  2Y9U A;  4ECR A;  5EE3 A;  1ZRN A;  2AGQ A;  3B0Y A;  2ZJ8 A;  5AKX A;  2I6X A;  3HJ1 A;  3LQC B;  4K98 A;  3GDX A;  4C8L A;  1XS9 D;  5ALU A;  3O0F A;  3CK6 A;  2JRZ A;  4OAF A;  4OD0 A;  1UEU A;  2BKE A;  4BDP A;  3ER8 C;  1XO1 A;  3ER9 B;  2YMQ A;  1JIH A;  2OXO A;  4LVS A;  4Y2R A;  4IS7 A;  1BPE A;  2WF6 A;  2KSO B;  1GPJ A;  4ECX A;  4QJF B;  2Y1J A;  8ICH A;  4X4V A;  4DF4 A;  4RT2 A;  2M2T A;  2HN2 A;  3QEB Z;  3NVW A;  5CA7 A;  4MF2 A;  7ICJ A;  4RQ4 A;  4RT3 A;  2HHT A;  2ZXI A;  4XQ8 A;  4J9L A;  1RYS A;  1LV5 A;  2HBM A;  2XGQ A;  1PK3 A;  1O08 A;  2L5Y A;  5TZV A;  9ICV A;  5ALY A;  3CRX A;  4WBY A;  4NXX A;  2VAN A;  2YN4 A;  1PVP A;  3C5G A;  5KTQ A;  2ZIX A;  4FH5 A;  1Q8K A;  1ZQL A;  2OCE A;  4RQ1 A;  5BOL A;  4UB5 A;  1WCN A;  5JU5 A;  4M9J A;  3OHA A;  1KEJ A;  5TIS U;  1ZQU A;  5DDM A;  4ED7 A;  1S76 D;  1WWV A;  1L3U A;  4Y2Y A;  4AT7 A;  8ICC A;  3EWA A;  3N7R C;  4EBJ A;  2LBO A;  4BWJ A;  3QU4 A;  1ZQJ A;  1UEV A;  5D46 A;  1V4A A;  4O3S A;  8ICS A;  3KHR A;  4CF4 A;  2PFQ A;  2OM6 A;  4MEY A;  5J0Y A;  3UMG A;  4RQ7 A;  2LI6 A;  4DSL A;  4Y2Q A;  4O0I A;  3GZF A;  1COO A;  2FI1 A;  2J6T A;  4K99 A;  5AKK A;  5KFI A;  5HR6 A;  1ZD3 A;  4P0Q B;  2Y1I A;  2QAR A;  3HP6 A;  2V9W A;  4A8E A;  2WAQ F;  2OH2 A;  4X0B A;  2HBL A;  3WFS C;  1MIW A;  4Z6F A;  2OEH A;  4TUQ A;  3JPP A;  5L1I A;  3C23 A;  3QNM A;  2YQE A;  2BBJ A;  2Y0S C;  3NKU A;  1N5X A;  1OXJ A;  3N4M B;  2WHE A;  1Z1B A;  2W43 A;  4DCC A;  4NLZ A;  5KFZ A;  1HUO A;  1ZQC A;  4MEX A;  4C80 A;  2HI0 A;  4UAW A;  3GQC A;  2FE9 A;  2G5I B;  3H8S A;  4ED1 A;  4WH5 A;  2ZH2 A;  3PST A;  1M6Y A;  2KVS A;  5J2B A;  2DVI A;  4GLX A;  4JV0 A;  5HRB A;  1N48 A;  3KBB A;  4QZB A;  3D2N A;  4FHV A;  3J81 j;  3IM1 A;  4YR3 A;  1UA1 A;  1OU5 A;  5J29 A;  1L6N A;  5DED A;  2IBK A;  2ZTD A;  4J9R A;  1XSL A;  4EGW A;  1NK9 A;  1XU4 A;  3OJU A;  2W9A A;  9ICW A;  1DOQ A;  1FIQ A;  3SAG A;  2F8L A;  3V6K A;  3BQ2 A;  4ZOH C;  3KHG A;  1NKE A;  5KT3 A;  3FDS A;  4PL2 A;  1DGJ A;  1ZOL A;  1S77 D;  2RLT A;  4KX3 A;  4ECS A;  4YCX A;  5AI4 A;  5KFU A;  2JEI A;  5ALZ A;  5FP0 A;  3C2K A;  3RAX A;  4DS4 A;  1X6J A;  9ICG A;  2GOL A;  2XY5 A;  2M2V A;  1Y88 A;  2XCA A;  5D61 A;  2WFA A;  3UM9 A;  2GH1 A;  2ZJ5 A;  2UVW A;  1ZD5 A;  4ECT A;  5AK4 A;  2P66 A;  3H7I A;  3HJE A;  1MN8 A;  3MCR A;  2N1R A;  2C28 A;  1ED1 A;  3CNH A;  3QE9 Y;  4DL7 A;  3E58 A;  2HHW A;  1B43 A;  2G09 A;  4FZL A;  3ZDB A;  1YT3 A;  5D62 A;  3V6H A;  3G6X A;  2YY6 A;  4UAT A;  3PR4 A;  1KBU A;  2ZIX B;  2JHD A;  1UHU A;  4UD5 A;  4WQK A;  4UBC A;  3M1Y A;  3OUY B;  3MR2 A;  1NKB A;  4NKT A;  5EE9 A;  8ICX A;  4X4T A;  3GV7 B;  2NO5 A;  4USA A;  5ALT A;  5GTI U;  4C4S A;  1KFS A;  1PK1 A;  2RDJ A;  4ED2 A;  4FZN A;  1T94 A;  3NS1 A;  5D4B A;  2M2U A;  1FA0 A;  1RQL A;  2BCV A;  4XJE A;  3D2Q A;  1XC9 A;  3H40 A;  2KKP A;  7ICP A;  3QUC A;  5J0X A;  1ZQG A;  3TAD C;  2W9B B;  1NO5 A;  4PHP A;  3V6J A;  4JLX A;  3RR7 A;  1Z4O A;  1WCL A;  3BQ7 A;  2FDR A;  4FS2 A;  2D3D A;  1P7D A;  8ICV A;  3KOO A;  5ALM A;  2EAN A;  2O5A A;  3RJI A;  5AK5 A;  2K8A A;  1XSP A;  4IRK A;  3F53 A;  5DQI A;  2K8B B;  3K75 D;  1ZQN A;  4X4S A;  2Q0Z X;  1KW4 A;  1S9F A;  3H38 A;  3GIL A;  2ZH4 A;  4R8U B;  4BXO A;  1CUK A;  2KZZ A;  1T8E A;  1SIJ A;  5CFT A;  4ED8 A;  3D6J A;  5KFG A;  4ACO A;  2W9C B;  9ICM A;  2AHO B;  1N61 A;  4ECZ A;  8ICG A;  3GIM A;  1Z19 A;  8ICF A;  2GLE A;  4NXZ A;  2FMQ A;  5L1J A;  7ICR A;  5KT2 A;  3NRZ A;  1QQ6 A;  3HPO A;  4ELV A;  4YR0 A;  5ALO A;  3ED5 A;  2DKX A;  1LKY B;  4F4Z A;  2RHF A;  2MA1 A;  4NLC A;  3T5L A;  4I29 A;  4NLG A;  3L3F X;  1ZQY A;  1B22 A;  1S8O A;  8ICT A;  2QLT A;  1QQ5 A;  3CYM A;  3OVB A;  1L7O A;  1S97 A;  3E0F A;  5HMM A;  3ALR A;  1ZQP A;  4TUS A;  4X4Q A;  3IRU A;  1X2I A;  4UB8 U;  4E7X A;  1SZP A;  2PFN A;  3HRD D;  5DDY A;  4EP7 A;  3KKA C;  1D9F A;  2BQR A;  4O3N A;  2QB0 A;  2XVT A;  3KZX A;  3OWG A;  2BCU A;  1L7P A;  4QZA A;  4P4O A;  5J2F A;  4GC6 A;  2C2R A;  9ICH A;  5J2H A;  3WKA A;  1SV0 C;  2BCR A;  4WC1 A;  2P6R A;  4F3O A;  3H4B A;  2QB1 A;  1MC8 A;  2B6G A;  4O5C A;  5B66 U;  4RQ8 A;  3F2D A;  3ISC A;  5DB9 A;  4CNQ A;  1DK3 A;  3TAQ A;  4I2G A;  5CB1 A;  1NK4 A;  4Q8F A;  2HHV A;  4J9O A;  2Y9T A;  3G6Y A;  1JXL A;  5GTH U;  4ELT A;  2KV2 A;  4DQI A;  2W8K A;  1JX4 A;  1B4F A;  3DDH A;  4NJ8 A;  3C29 A;  3N7P D;  4FHP A;  4K9A A;  4ATB A;  1U45 A;  4YXJ A;  2LM1 A;  2DL0 A;  3QZ8 A;  4O5E A;  1VLB A;  3T79 A;  1X66 A;  2BR0 A;  3RTV A;  2J6U A;  5KG0 A;  2DGZ A;  3HJ4 A;  1ZQK A;  1Q3V A;  1U48 A;  4DFM A;  1TAU A;  1TFR A;  5IIM A;  4I2E A;  2RFF A;  4TQR A;  4I2C A;  5AIB A;  3WKC A;  3I1Y A;  2W54 A;  4C8K A;  2ODG A;  1F5A A;  7ICQ A;  1JUD A;  3PSI A;  3NRW A;  3EF2 A;  1XNS A;  4RWN A;  1COK A;  4NLK A;  5EWG A;  3F2B A;  3SAF A;  5KNI A;  3PVX A;  1IIP A;  1D8Y A;  8ICP A;  2ASL A;  4QW8 A;  1NJY A;  2KHV A;  1NOM A;  4Y2P A;  3OTQ A;  1H38 A;  2IA6 A;  2VKQ A;  3EW9 A;  1JAJ A;  4JLZ A;  5KFO A;  5D49 A;  5J0W A;  4AT9 B;  3KKA A;  2MRL A;  3Q8M A;  1LVH A;  3OGU A;  3RB4 A;  1C20 A;  2KJ5 A;  4R66 A;  1KLN A;  4RWP A;  4F92 B;  2VJ4 A;  5HRD A;  3WK7 A;  5CFU A;  2GWS A;  2FPM A;  4OAH A;  5AKI A;  1SV0 A;  2E1F A;  4AYB C;  1JXE A;  4I2B A;  2KVC A;  2MUT A;  2KIC A;  3GU3 A;  4NLB A;  2R8I A;  2YMP A;  4DSE A;  2KZ3 A;  8ICL A;  4EBC A;  9ICR A;  3KHL A;  2KFN A;  2KHQ A;  3PV8 A;  8ICO A;  2B4V A;  3M9M B;  3K1R B;  2OWO A;  2KIV A;  3M6Z A;  2KJ9 A;  4NXU A;  3EPG A;  2W3R A;  4RQ3 A;  4QZC A;  4MFA A;  4IG8 A;  5JTG A;  1KNY A;  2ZIW A;  4Y2V A;  1URJ A;  3SV4 A;  4X4N A;  4MKP A;  4Y2X A;  1IV8 A;  1R8C A;  5KFW A;  4WC4 A;  3WK4 A;  1BGX T;  1NJZ A;  5EWE A;  1ZD4 A;  5HHI A;  1JMS A;  4GIB A;  4PGQ A;  5DB8 A;  5K4L A;  4PHD A;  4KLG A;  3UQ2 A;  4ED3 A;  4O3O A;  4DOA A;  1Z00 A;  3ZDC A;  3QEA Z;  4M9G A;  3DEE A;  3C5F A;  3T5H A;  3AQK A;  3RRH A;  2EZZ A;  2ASD A;  2ZIV B;  4RQ0 A;  2HN1 A;  2DWQ A;  3AMZ A;  2IOF K;  2VJ5 A;  1QCK A;  3MFH A;  3PO5 A;  3VCB A;  5KFT A;  4I27 A;  2KD1 A;  3ERC C;  2I5H A;  5ALD A;  2G07 A;  2IHO A;  5AIA A;  3M7D A;  3WK5 A;  3JYY A;  4KLF A;  4KLU A;  1WOT A;  1K1Q A;  2BPF A;  4DQP A;  2KN7 A;  1QSY A;  4F2S A;  3N7S C;  2AH5 A;  4GXK A;  3A0B U;  3RR8 A;  5HNK A;  4TUP A;  4J9P A;  3LDA A;  4UAV A;  2A1A A;  4WJ3 B;  2DRA A;  3TKA A;  2DKZ A;  1QTM A;  5J0Q A;  4K4H A;  3ONN A;  1ZQV A;  3NYB A;  3ZD9 A;  4PZO A;  2DR5 A;  2F77 X;  4CF5 A;  2W7P A;  4RPZ A;  4RQ5 A;  2XC9 A;  3MR5 A;  5L1K A;  5J2A A;  5H2F U;  1K1S A;  4EX7 A;  5JTI A;  4YR2 A;  8ICN A;  9ICP A;  1S5L U;  5ALP A;  4B9U A;  4YD1 A;  3TAN A;  1HJP A;  1X9X A;  3WK6 A;  2G08 A;  4QWB A;  4RNM A;  4F4X A;  2Z7J A;  3ZD8 A;  3BQT A;  3EYZ A;  3EZ5 A;  4ECV A;  4QWC A;  2JZB B;  4HYK A;  4J9M A;  3I28 A;  1A6S A;  3GIK A;  1MA7 A;  1JQR A;  1L7N A;  3TQ1 A;  1CI4 A;  1X9S A;  2NRT A;  5ALL A;  2MUT B;  4FO1 A;  1TV9 A;  3RJK A;  1QSS A;  1Q46 A;  2ASJ A;  4NL9 C;  3NAS A;  4UAY A;  1EXN A;  2WF7 A;  2B21 A;  2W9M A;  3AUO A;  2KIW A;  5JUM A;  4RZR A;  2JMG A;  2PFO A;  5ALK A;  2F1J A;  1BPD A;  3JPT A;  3WK9 A;  3QU9 A;  3GV8 B;  3BS5 A;  2BQU A;  3MR6 A;  5KFM A;  5AI0 A;  3UXN A;  3L4P A;  5KL8 B;  1V97 A;  4XA5 A;  4WC2 A;  1MQ3 A;  2BPC A;  2E8N A;  2ESE A;  4O5K A;  2GA9 D;  5AI6 A;  3MC1 A;  2JV3 A;  1SWW A;  2JH7 A;  1IG6 A;  2OYY A;  4OCZ A;  2HOI A;  3HKZ C;  1L7M A;  4Y2U A;  3HW8 A;  3SR6 A;  4I2D A;  4FO6 A;  3RF9 A;  2LYB A;  1U47 A;  2JGA A;  3MBY A;  5DBC A;  3AQN A;  4I28 A;  4NM1 A;  7ICI A;  2LYH A;  2ZIU A;  1SL0 A;  4JV1 A;  2HW3 A;  3KHH A;  1DGS A;  4QZG A;  3OVS A;  1IM4 A;  2H3Q A;  1ZQI A;  3H8M A;  3AQE A;  4WC5 A;  2KNJ A;  5ALX A;  3TAR A;  4MFC A;  4QIW C;  4B9M A;  4OO1 J;  4FFD A;  3NVV A;  7ICU A;  5KFD A;  2WF9 A;  5KT4 A;  2XGP A;  3V72 A;  4TQS A;  4QWD A;  1NZB A;  2WF5 A;  3SD7 A;  3HX0 A;  3UPQ A;  2CN1 A;  2AGP A;  3PO4 A;  5AI8 A;  4IQU A;  4RPX A;  2B51 A;  3M8S A;  1ZJN A;  4S3N A;  4PJ0 U;  3C66 A;  1SWV A;  1VJ7 A;  1HIW A;  9ICB A;  1UA0 A;  4X4O A;  1V9P A;  9ICI A;  4IQW A;  3RFA A;  1JI7 A;  5BPC A;  2M0N A;  1L3T A;  2PI4 A;  1RYR A;  4YVZ A;  4GXI A;  4O3P A;  2PMZ F;  4XRH A;  4J9S A;  3M9N B;  4NL9 A;  3Q8S B;  5CRX A;  3RJJ A;  5KFJ A;  3FYH A;  3C1Z A;  8ICA A;  3RJF A;  4UB6 U;  2IUB A;  2AJQ A;  2WF8 A;  3PW5 A;  4ECU A;  4OAI Z;  3ETL A;  2K60 A;  2V4R A;  3KD3 A;  4GFJ A;  1F5S A;  7ICG A;  2HVH A;  2BE3 A;  2DR9 A;  4U7C A;  1ARO P;  8ICI A;  4JB3 A;  2ISO A;  4LT6 A;  5BOM A;  4B9S A;  1QQ7 A;  9ICA A;  1T4G A;  4WBZ A;  4KIT B;  3NUQ A;  4TUR A;  2HSZ A;  2YB1 A;  3AEV A;  3KFU F;  5DG7 A;  3WKE A;  2YMM A;  1JAL A;  3AQM A;  3K4G A;  2D6F C;  1ZQX A;  1ZYQ A;  3BS5 B;  3F5E A;  2QKQ A;  1AQ6 A;  1TFW A;  9ICU A;  2ZH9 A;  4AT7 B;  4E80 A;  4AP9 A;  2F1H A;  4KMO B;  2I9G A;  4K97 A;  3Q8K A;  4EEB A;  3CW2 C;  4B9T A;  4Z6D A;  1SZH A;  5L9X A;  5AIC A;  5AKG A;  2A1J A;  4QZD A;  2F44 A;  4G9B A;  1TFY A;  1ZQR A;  3PR5 B;  4RWQ A;  5HHH A;  4KM5 A;  2QAR B;  3CP8 A;  4KX5 A;  4PZN A;  2FJ6 A;  1PVQ A;  1OUQ A;  1ZQT A;  3OSN A;  8ICR A;  2ZXH A;  5KG3 A;  5CEH A;  3MDA A;  2P6U A;  4QWE A;  2NO4 A;  3Q8R B;  4JV2 A;  1WUD A;  1Z4N A;  4YMN A;  5ALG A;  5KAF U;  4F5N A;  1PUZ A;  4ECY A;  4KN4 A;  3C2L A;  3C18 A;  1ZQH A;  4KLL A;  2IHN A;  3BS7 A;  3ISD A;  1U49 A;  4F4Y A;  5CHE A;  4O67 A;  2KMD A;  4F5P A;  1Q3U A;  4CCH A;  3ZDA A;  5ALS A;  4RWO A;  3AN1 A;  3L9D A;  2BCQ A;  1L3S A;  2KZM A;  3PX0 A;  4DQR A;  1MIY A;  9ICL A;  5DQH A;  2WAQ C;  1L8L A;  4KLM A;  3M9O B;  4YD2 A;  2ES6 A;  5KG5 A;  2PI5 A;  5F9N A;  4BUG A;  2VA3 A;  2H5X A; 
#chains in the Genus database with same CATH homology
 3OGU A;  4PPX A;  1BPE A;  3RB4 A;  3AQL A;  4R66 A;  1KLN A;  4RWP A;  1SL2 A;  5HRG A;  4K4G A;  1KFT A;  4ECX A;  4F92 B;  5DGB A;  2Y1J A;  1ZQE A;  5HRD A;  8ICH A;  4AT8 A;  4Q8E A;  4X4V A;  2GWS A;  2XCP A;  4Z6C A;  2FPM A;  4RT2 A;  4DF4 A;  5J2D A;  8ICM A;  2M2T A;  3QEB Z;  5CA7 A;  5HR9 A;  5KG7 A;  1NK6 A;  4MF2 A;  1JXE A;  4I2B A;  1L5U A;  7ICJ A;  4RQ4 A;  3BQ0 A;  5HML A;  4RT3 A;  2HHT A;  2MUT A;  4JWM A;  3PW2 A;  4ECW A;  9ICQ A;  4XQ8 A;  4J9L A;  1RYS A;  4LZD A;  1ZET A;  2R8I A;  1LV5 A;  3PW0 A;  4DSE A;  2KZ3 A;  2XGQ A;  3GII A;  1L3V A;  4EBC A;  4M04 A;  2BCS A;  4PGY A;  4EBE A;  3MAB A;  4IQT A;  3KHL A;  9ICR A;  2KP7 A;  2KFN A;  2FLN A;  1A77 A;  3C21 A;  3PW7 A;  2Q66 A;  5DKW A;  4Q45 A;  3V7L A;  2BQ3 A;  3PV8 A;  3WFP A;  5TZV A;  9ICV A;  4M5D A;  4PH5 A;  3JPS A;  1PX5 A;  1BVS A;  5J0U A;  1ZQB A;  8ICO A;  1VFG A;  3M9M B;  1C7Y A;  5DB6 A;  2OWO A;  4WBY A;  2VAN A;  4C8M A;  3V7J A;  7ICT A;  1X9W A;  1ZQS A;  3C5G A;  5KTQ A;  5L1L A;  8ICB A;  3EPG A;  5DG8 A;  3WFQ E;  3RJE A;  4FH5 A;  1D8L A;  4F93 B;  3MGI A;  1ZQL A;  4RQ1 A;  5BOL A;  4UB5 A;  4RQ3 A;  2C2E A;  1WCN A;  4QZC A;  4MFA A;  4M9J A;  4IG8 A;  4ECQ A;  1KNY A;  3OHA A;  1BPZ A;  1KEJ A;  3M8R A;  2UVR A;  1ZQO A;  1ZQU A;  5DDM A;  4EYH B;  3SV4 A;  4ED7 A;  4X5V A;  4E0D A;  4DSJ A;  3NGD A;  1S76 D;  4X4N A;  1R8C A;  1L3U A;  2ZUC A;  4DS5 A;  3T3F A;  4FHW A;  5KFW A;  4RNN A;  8ICC A;  4DFK A;  4AT7 A;  3EWA A;  4WC4 A;  1BGX T;  1NJZ A;  4DL3 A;  2ZHA A;  5EWE A;  3SYZ A;  3H37 A;  5HHI A;  4EBJ A;  1JMS A;  5J2C A;  1BNO A;  5KG2 A;  4PGQ A;  5CP2 A;  5DB8 A;  4BWJ A;  5KFK A;  1ZQJ A;  4PHD A;  4KLG A;  8ICQ A;  3UQ2 A;  1NK5 A;  1UEV A;  5D46 A;  4ED3 A;  1V4A A;  4O3S A;  8ICS A;  5KFF A;  4RUC A;  4O3O A;  5EWF A;  3HT3 A;  3KHR A;  4DOA A;  3KTQ A;  1Z00 A;  3UPS A;  4JK1 A;  2PFQ A;  4MEY A;  3JPQ A;  5J0Y A;  3T5J A;  4DOB A;  1KFD A;  4P4M A;  4RQ7 A;  3ZDC A;  3TFS A;  4DSL A;  7ICL A;  3QEA Z;  4M9G A;  4O0I A;  4Q44 A;  4GC7 A;  4RU9 A;  7ICF A;  7ICE A;  8ICU A;  1COO A;  1S0O A;  2J6T A;  4WC6 A;  1MSW D;  5KFI A;  3C5F A;  4RQ6 A;  3T5H A;  4KLQ A;  3RRH A;  2F1I A;  8ICY A;  2Y1I A;  3AQK A;  3UXO A;  2V4Q A;  2ASD A;  1BPX A;  2NRZ A;  4RQ0 A;  3HP6 A;  2V9W A;  2ZH3 A;  3C2M A;  7ICO A;  4M6W A;  4X0B A;  3RAQ A;  2DR8 A;  3GV5 B;  4BWM A;  3MFH A;  3PO5 A;  4I2H A;  4QZH A;  4J9N A;  4KLT A;  4UD4 A;  5KFT A;  3V7K A;  5KFN A;  4IRD A;  3WFS C;  4I2J A;  4I27 A;  4KTQ A;  1MIW A;  4Z6F A;  4M9L A;  4TUQ A;  3T5K A;  3JPP A;  1BPB A;  4ED0 A;  4RNO A;  5L1I A;  3C23 A;  4Z6E A;  2UVV A;  5KFH A;  8ICZ A;  2HHQ A;  3JYY A;  4KLF A;  3PX6 A;  5C5J A;  5CR0 A;  3HIY A;  2R8K A;  2DPI A;  4KLU A;  3RH4 A;  1U4B A;  4DWI A;  1WOT A;  5DB7 A;  1S0M A;  5HRI A;  3N4M B;  3JZ0 A;  8ICJ A;  4KLS A;  1K1Q A;  5KFR A;  4NLZ A;  5KFZ A;  1HUO A;  1ZQC A;  2KN7 A;  4MEX A;  1QSY A;  2BPF A;  4QZF A;  5J2K A;  2BPG A;  4DQP A;  1NK7 A;  3PNC A;  2ZH8 A;  4UAW A;  3GQC A;  9ICE A;  4F2S A;  2J6S A;  4GXK A;  3H8S A;  4ED1 A;  8ICW A;  1T3N A;  3RR8 A;  2ZH2 A;  5HNK A;  4DQQ A;  4PGX A;  4TUP A;  4J9P A;  3OSP A;  3LDA A;  5J2B A;  5KFV A;  4WC3 A;  2DVI A;  4GLX A;  5DLG A;  2DRA A;  4JV0 A;  4UB2 A;  1MQ2 A;  5HRB A;  1ZJM A;  4YMM A;  1N48 A;  1QTM A;  4QZB A;  5J0Q A;  4EBD A;  2BDP A;  4BXO B;  4ELU A;  4KLD A;  4FHV A;  4K4H A;  4FS1 A;  2ZUD A;  2HVI A;  3IM1 A;  4YR3 A;  1ZQV A;  4NM2 A;  3NYB A;  2ATL A;  3ZD9 A;  1CEZ A;  4O3R A;  1UA1 A;  2DR5 A;  1OU5 A;  4MF8 A;  3HWT A;  5J29 A;  2ALZ A;  5DED A;  4DFJ A;  4QWA A;  4RPZ A;  4RQ5 A;  2IBK A;  4DSI A;  9ICN A;  1KSP A;  2XC9 A;  2ZTD A;  3MR5 A;  5J2A A;  4YFK A;  5L1K A;  4J9R A;  1K1S A;  1PZN A;  1XSL A;  1TVA A;  1NK9 A;  1XU4 A;  3OJU A;  7ICV A;  2W9A A;  2NRK A;  2WTF A;  9ICW A;  1DOQ A;  4YR2 A;  4R63 A;  4AT9 A;  3IHQ B;  2JEF A;  8ICN A;  9ICP A;  4F4K A;  3V6K A;  5KG4 A;  3BQ2 A;  3KHG A;  1NKE A;  4YD1 A;  5KT3 A;  3SV3 A;  3FDS A;  3TAN A;  2BGW A;  4B9U A;  1HJP A;  2KTQ A;  1S77 D;  5KFQ A;  4FBU A;  4QWB A;  4FBT A;  2BHN A;  4ECS A;  1NJX A;  5KFA A;  4YCX A;  4RNM A;  5KT7 A;  4F4X A;  3PW4 A;  4DL5 A;  5KFU A;  2JEI A;  3ZD8 A;  3BQT A;  3SZ2 A;  7ICK A;  4UB1 A;  4PHA A;  5KFL A;  3EYZ A;  3EZ5 A;  4KLH A;  4EBK A;  4ECV A;  4QWC A;  3C2K A;  3RAX A;  3AU6 A;  2JZB B;  4HYK A;  4J9M A;  4DS4 A;  2ZH6 A;  5J0P A;  3JPO A;  3GIK A;  1JQR A;  9ICG A;  1R8B A;  2XY5 A;  3TQ1 A;  9ICF A;  3PY8 A;  1Y88 A;  2M2V A;  3RJH A;  5IIL A;  2XCA A;  1X9S A;  2HHX A;  5HRE A;  1ZQW A;  2NRT A;  2MUT B;  4PHE A;  1TV9 A;  2ZJ5 A;  4QZ8 A;  4JWN A;  2UVW A;  3RJK A;  1QSS A;  2FMS A;  5KFC A;  2ASJ A;  2O1P A;  3OJS A;  4ECT A;  1TK0 A;  7ICH A;  2P66 A;  1T7P A;  2AQ0 A;  4UAY A;  3H7I A;  4DLE A;  1EXN A;  4FH3 A;  2B21 A;  1R89 A;  4B9L A;  2W9M A;  3AUO A;  9ICC A;  1KDH A;  1IXR A;  5JUM A;  4R64 A;  1LB2 B;  1ZQA A;  2C28 A;  4M9H A;  4RZR A;  2PFO A;  5KT6 A;  4WCW A;  2F1J A;  1BPD A;  3JPT A;  3QE9 Y;  4DL7 A;  3ORY A;  2HHS A;  1XWL A;  1B43 A;  2JEG A;  2HHW A;  1SKS A;  3GV8 B;  3ZDB A;  2BQU A;  3MR6 A;  5J0R A;  5KFM A;  1NK0 A;  4B9V A;  3UXN A;  3V6H A;  3G6X A;  2FLL A;  4XA5 A;  4WC2 A;  9ICS A;  3PML A;  1MQ3 A;  2BPC A;  3PR4 A;  5HP4 A;  4B9N A;  4O5K A;  4UD5 A;  4DEZ A;  3RH6 A;  4UBC A;  4XQ7 A;  2NRV A;  1ZQF A;  4IQV A;  4WC7 A;  3MR2 A;  1NKB A;  1TAQ A;  4NKT A;  3ZDE A;  3OUY B;  2W8L A;  1KRP A;  5DBB A;  5F2V O;  8ICX A;  4X4T A;  3GV7 B;  3HW8 A;  4DL6 A;  2JEJ A;  4O3Q A;  4YMO A;  4DO9 A;  2PFP A;  3UXP A;  1KFS A;  8ICE A;  4I2D A;  2RDJ A;  4FO6 A;  4ED2 A;  2XY6 A;  1U47 A;  1MIV A;  2A1J B;  1ZQM A;  7ICM A;  3H39 A;  3RBD A;  4YP3 A;  1Z3E B;  2R8H A;  3MBY A;  3G6V A;  5DBC A;  3RB3 A;  2ZHB A;  5D4B A;  3AQN A;  1TKD A;  4DF8 A;  4I2A A;  4I28 A;  4ZH4 A;  4M9N A;  4NM1 A;  7ICI A;  2M2U A;  1FA0 A;  4DFP A;  2LYH A;  3JPN A;  1SL0 A;  2BCV A;  4JV1 A;  2HW3 A;  3OV7 A;  2ZH5 A;  1TK5 A;  3MR3 A;  3KHH A;  4DSF A;  1DGS A;  1XC9 A;  4RUA A;  3H40 A;  4KLI A;  4QZG A;  4F5R A;  1S10 A;  7ICP A;  5J0X A;  3ISB A;  3OVS A;  1IM4 A;  1RPL A;  1ZQG A;  3RH5 A;  1ZQI A;  3WFR E;  2W9B B;  4UBB A;  1NO5 A;  4PHP A;  3V6J A;  4WC5 A;  4UB3 A;  3RR7 A;  2DRB A;  1WCL A;  4ATB B;  3TAR A;  4MFC A;  1QSL A;  4FS2 A;  5F9L A;  1X9M A;  1UET A;  8ICK A;  4B9M A;  3RB6 A;  8ICV A;  4X4R A;  2C2D A;  7ICU A;  5CJ7 A;  4YXM A;  3H4D A;  9ICX A;  5KFD A;  2O5A A;  4KMU A;  5KT4 A;  2M9N A;  4O9M A;  2XGP A;  3V72 A;  3RJI A;  4TQS A;  1S0N A;  1XSP A;  8ICL A;  4QWD A;  3HX0 A;  4IRK A;  3UPQ A;  4UQG A;  9ICO A;  2AGP A;  4UB4 A;  1HUZ A;  3PO4 A;  1ZQQ A;  4WC0 A;  4DLG A;  2MAX A;  4IQU A;  4RPX A;  3M8S A;  5DQI A;  5IIJ A;  3K75 D;  1ZQN A;  1ZJN A;  4X0A A;  4X4S A;  3EPI A;  1D9D A;  4S3N A;  2Q0Z X;  1S9F A;  1VJ7 A;  3C66 A;  3GIL A;  9ICB A;  1UA0 A;  3H38 A;  1V9P A;  4K4I A;  2FLP A;  9ICI A;  4X4O A;  4IR9 A;  4IQW A;  2ZH4 A;  4R8U B;  3Q8P B;  1CUK A;  4BXO A;  4BGD A;  1T8E A;  2KZZ A;  7ICS A;  4ED8 A;  9ICK A;  5KFY A;  5KFG A;  4P4P A;  2W9C B;  1NJW A;  9ICM A;  2ZH1 A;  5BPC A;  1L3T A;  3H3A A;  3MDC A;  4ECZ A;  9ICJ A;  2PI4 A;  4QZI A;  1RYR A;  1R8A A;  4YVZ A;  4GXI A;  4O3P A;  4XRH A;  3LWM A;  8ICG A;  4J9S A;  2HHU A;  3GIM A;  1RXW A;  4F50 A;  4NLN A;  3M9N B;  3UQ0 A;  4NXZ A;  5DGA A;  1N56 A;  2FMQ A;  5L1J A;  2IHM A;  3Q8S B;  8ICF A;  7ICR A;  1Q79 A;  1NKC A;  2IMW P;  5KT2 A;  3RJJ A;  4IR1 A;  3NTU A;  5KFJ A;  2NRX A;  3FYH A;  3PMN A;  3C1Z A;  3HPO A;  3MGH A;  5DLF A;  1BPY A;  3RJF A;  8ICA A;  4ELV A;  4YR0 A;  5DQG A;  4F5O A;  2AJQ A;  4F4Z A;  4F5Q A;  3T5L A;  4I29 A;  2UVU A;  4NLG A;  3H8J A;  5KFX A;  2R8J A;  1QLN A;  2RDI A;  3PW5 A;  4ECU A;  4AT8 B;  1ZQY A;  1UT5 A;  3ETL A;  3PX4 A;  1B22 A;  4E8F A;  5KFE A;  5IIN A;  3RBE A;  2V4R A;  2JZB A;  1KTQ A;  5J0S A;  4DQS A;  2XY7 A;  4JUZ A;  5KT5 A;  8ICT A;  3JPR A;  4EZ6 A;  3OVB A;  5HC9 A;  1S97 A;  7ICG A;  2HVH A;  5HMM A;  1NK8 A;  4R65 A;  1ZQP A;  2HHP A;  4FHX A;  4TUS A;  2BE3 A;  2DR9 A;  4YQW A;  1ARO P;  8ICI A;  3LK9 A;  4X4Q A;  4ED6 A;  1X2I A;  5CWR A;  2ZTE A;  2ISO A;  4LT6 A;  5BOM A;  4B9S A;  4C8O A;  1SZP A;  3WFO A;  4E7X A;  2PBE A;  4I2I A;  5KG1 A;  2PFN A;  3TAP A;  5DDY A;  4EP7 A;  1D9F A;  2BQR A;  5KFP A;  4O3N A;  2AQ4 A;  9ICA A;  2ZTC A;  3TI0 A;  9ICT A;  5III A;  1T4G A;  4WBZ A;  4KIT B;  4J9Q A;  4TUR A;  5KG6 A;  2BCU A;  4EZ9 A;  4QZA A;  4P4O A;  5J2F A;  2DPJ A;  5HRH A;  4DL2 A;  4GC6 A;  2AU0 A;  5DG7 A;  2C2R A;  9ICH A;  5J2H A;  1RZT A;  2FMP A;  5EOZ A;  3N97 B;  2BCR A;  4EYI B;  2P6R A;  4F3O A;  3H4B A;  3AQM A;  4WC1 A;  3K4G A;  1MC8 A;  1ZQX A;  5J2I A;  4M47 A;  4C8N A;  5IIK A;  3THV A;  1ZYQ A;  4O5C A;  3C1Y A;  4KLE A;  3LWL A;  3OUY A;  2DFL A;  4KLJ A;  5J2J A;  1TFW A;  9ICU A;  2ZH9 A;  4AT7 B;  2ZH7 A;  1S0V A;  3SI8 A;  4E80 A;  4RQ8 A;  2F1H A;  3ISC A;  2M2W A;  2I9G A;  5DB9 A;  3RRG A;  3Q8K A;  1TK8 A;  1DK3 A;  5DEC A;  3RJG A;  3TAQ A;  1ZQZ A;  4B9T A;  3B0X A;  1SKR A;  2ZUB A;  4Z6D A;  2XO7 A;  5L9X A;  5CB1 A;  4I2G A;  4MFF A;  5J0T A;  4F2R A;  1NK4 A;  5DBA A;  4Q8F A;  2HHV A;  2A1J A;  3GFK B;  5J0O A;  4QZD A;  1Z00 B;  4J9O A;  3GIJ A;  1SL1 A;  1ZQD A;  3BDP A;  1YLQ A;  4FHY A;  4EEY A;  2KFZ A;  4QZE A;  3G6Y A;  4KLO A;  1TFY A;  7ICN A;  3BQ1 A;  1JXL A;  1ZQR A;  5J2G A;  4ELT A;  1A76 A;  2ID1 A;  4DQI A;  5CHG A;  3PR5 B;  2W8K A;  2AGO A;  5KFB A;  4RWQ A;  3TFR A;  4LZG A;  1JX4 A;  5HHH A;  4YG2 A;  4XUS A;  1U9L A;  2W9B A;  4M6W B;  4X4P A;  1SKW A;  4F8R A;  4FHP A;  3OVA A;  4ATB A;  4QZ9 A;  1U45 A;  4YXJ A;  1RXV A;  1ZQT A;  3OSN A;  3QZ8 A;  4O5E A;  4J9K A;  3H8W A;  8ICR A;  4DOC A;  4X4U A;  2BR0 A;  3RTV A;  2J6U A;  3BJY A;  2DR7 A;  4IRC A;  5KG0 A;  5HRK A;  4NY8 A;  4M2Y A;  3HJ4 A;  5KG3 A;  4QWE A;  2P6U A;  3MFI A;  3MDA A;  1JN3 A;  1ZQK A;  1Q78 A;  3Q8Q B;  4UAZ A;  3Q8R B;  1U48 A;  4DFM A;  4JV2 A;  4YMN A;  1TAU A;  5HRL A;  4P2H A;  4YN4 A;  1TFR A;  2VA2 A;  4I2F A;  4NKU A;  5IIM A;  2R8G A;  4M0A A;  4I2E A;  1UT8 A;  4F5N A;  5IIO A;  2RFF A;  3ZDD A;  4ECY A;  4QW9 A;  2ZJA A;  4KN4 A;  3C2L A;  4TQR A;  4I2C A;  4Q43 A;  1ZQH A;  4GXJ A;  1NZP A;  3C18 A;  5DG9 A;  4DL4 A;  2IHN A;  3ISD A;  4KLL A;  3QZ7 A;  4RQ2 A;  1U49 A;  4F4Y A;  2ISP A;  4C8K A;  1F5A A;  2PXI A;  7ICQ A;  2VA8 A;  4F5P A;  4CCH A;  4ECR A;  2FPK A;  3ZDA A;  1BNP A;  4G3I A;  4RWO A;  4RWN A;  4R8U A;  4F91 B;  3L9D A;  2BCQ A;  2AGQ A;  4NLK A;  1L3S A;  3AU2 A;  3PX0 A;  2KZM A;  3B0Y A;  4DQR A;  2FPL A;  5EWG A;  1XSN A;  2ZJ8 A;  4RPY A;  2W9C A;  1MIY A;  3HJ1 A;  3PVX A;  3LQC B;  4KN7 A;  1D8Y A;  8ICP A;  2ASL A;  3Q8L A;  4QW8 A;  5KFS A;  3GDX A;  1NJY A;  4C8L A;  1XS9 D;  1NOM A;  9ICL A;  5DQH A;  5J2E A;  2I1Q A;  1UEU A;  1H38 A;  2BKE A;  2IA6 A;  1DK2 A;  5HRF A;  4BDP A;  4KLM A;  1XO1 A;  4F4W A;  3EW9 A;  3M9O B;  4YD2 A;  1JAJ A;  3OHB A;  1JIH A;  5KG5 A;  4DSK A;  5KFO A;  3RB0 A;  2C22 A;  5F9N A;  2PI5 A;  2NRW A;  4LVS A;  2VA3 A;  3E2E A;  5D49 A;  5J0W A;  4AT9 B;  3Q8M A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...