5BOMA

Dna polymerase beta binary complex with a templating 5clc
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
320
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 320
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bomA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bomA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bomA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bomA03
5DEDA 2M2WA 4Z6DA 1ZJMA 4IQWA 2A1JB 4GXKA 4YMNA 4FO6A 1CUKA 1XS9D 2FMSA 3GIIA 1ZQIA 8ICBA 4E80A 3JPNA 7ICRA 7ICGA 7ICUA 5J0UA 3OSNA 4X5VA 2BCSA 4IRCA 3ZDEA 1S0NA 2M2UA 3MABA 2ZTDA 5HRIA 3LWMA 2ZTCA 4MEYA 5BOMA 4WBYA 1KNYA 3OJUA 3ORYA 5CWRA 1ZQOA 3ZDCA 1TFRA 1TFYA 5KG0A 2O1PA 1QSYA 3PY8A 4X0AA 3SV3A 4IQUA 2ASLA 9ICMA 3V72A 1NKCA 4RQ6A 4PGQA 2MUTB 5IIJA 5TZVA 3T5HA 3ZDBA 1OU5A 1SKSA 2UVWA 2VA2A 4YD1A 4PHDA 4YFKA 4YMOA 1S77D 3V6JA 5EWGA 4F4YA 3Q8PB 5HRGA 1L3SA 3PVXA 2W9CA 2HHWA 2BCRA 4EBKA 2ZJ8A 3ZDAA 2XC9A 4Q43A 1KFDA 4DO9A 4RQ7A 4DOAA 4UAYA 1HUZA 4EZ6A 4JWNA 4P4OA 3RB6A 4WCWA 2BHNA 3RR7A 2NRTA 2KTQA 4GXIA 4R8UB 9ICXA 4AT8A 2KZ3A 4R65A 2ZJ5A 4QWAA 3OJSA 2C2DA 1T8EA 4B9SA 2MAXA 4IR9A 5KT7A 2BPGA 1QSSA 1NK4A 1N48A 2M2TA 2ZUBA 5C5JA 3QEAZ 2IHNA 4UD5A 4JWMA 2GWSA 5J2DA 5L1LA 3TQ1A 8ICRA 4ECZA 5KT2A 3OSPA 4C8KA 4B9NA 4KLEA 1SL0A 4EP7A 4J9QA 1ZQCA 2F1JA 3V7KA 4J9PA 4X4TA 5KG4A 2ZHAA 4YD2A 4DSFA 4I28A 4TUQA 1NJXA 3AQNA 4YMMA 1MIWA 4PHAA 4P4MA 3M8RA 3G6VA 1Y88A 2W9AA 4KTQA 4UB1A 5HNKA 3C2KA 3MR3A 4M9LA 2C2EA 5HHHA 4WC1A 3LWLA 8ICMA 2UVVA 1NZPA 4KITB 4MF8A 5KFCA 4DL5A 3PW5A 2BCUA 4EZ9A 3HW8A 2I1QA 2FPMA 8ICXA 4WC0A 3B0XA 4B9VA 1RPLA 3TFRA 2AGOA 1XC9A 4UB5A 3AQLA 5KFIA 2WTFA 1JXLA 4PGXA 4YXJA 3V7LA 5HRDA 4FHXA 4M5DA 2NRZA 1A77A 3UXNA 5DBCA 4QZHA 3AUOA 1ZQTA 2BPFA 4K4IA 4UB2A 8ICEA 1ZQUA 3MDAA 5KFRA 5J2GA 1LB2B 4M2YA 1QLNA 1IXRA 5KFZA 2RFFA 4FHPA 1AROP 3C23A 4DFKA 3RTVA 8ICKA 9ICBA 2W9CB 2W8LA 2KZMA 4YN4A 2BKEA 5EWFA 1V4AA 3BQ2A 4IQTA 8ICYA 2DR5A 4EEYA 4J9LA 1SZPA 4ECQA 1ZQAA 2HHTA 2ZUDA 1BPDA 4ED1A 4G3IA 4DFPA 4NY8A 1WOTA 5KFSA 5KG3A 2FLPA 4EBDA 3HT3A 1ZETA 3OGUA 2J6TA 4RQ8A 2VA3A 5J0QA 4F5RA 4KLLA 1S9FA 1WCLA 2NRXA 3Q8QB 1COOA 3GQCA 4ECRA 5J2IA 4X4OA 4EYHB 5IILA 2R8JA 3N97B 1IM4A 2KP7A 4O0IA 2JEJA 4RZRA 9ICAA 9ICNA 4NKUA 1NOMA 3H40A 5KG7A 4F4WA 4UB4A 1XSPA 7ICPA 2ZH6A 4XUSA 4C8MA 9ICPA 3C2MA 2ZH7A 5F9NA 3IHQB 3EWAA 5CJ7A 1S0MA 4F4KA 4O5EA 2W9MA 4DQPA 4ELTA 7ICVA 2F1HA 1X9WA 5KT3A 4C8OA 2XY5A 5KFXA 1SKRA 4JV2A 1JAJA 4DL6A 4KLJA 3NTUA 4Q8FA 3GIMA 2XY7A 4I2DA 1ZQDA 1ZQFA 3GV8B 4NXZA 4IRKA 4K4GA 3PW2A 4ED7A 4O3PA 3Q8LA 5KFTA 1N56A 1ZQRA 1ZQKA 4KLUA 9ICCA 3HJ1A 4M0AA 5BOLA 1MIYA 4KLHA 1BNPA 5L1KA 3MFHA 1BNOA 4X4PA 2VANA 4KLGA 5HRBA 1JN3A 4QW9A 7ICOA 3KHLA 2Y1JA 1KRPA 2ID1A 3HJ4A 1ZQJA 4DLEA 3H8SA 3PNCA 4RQ2A 8ICZA 1TK5A 4BGDA 1R8AA 1RXVA 3QZ7A 3JZ0A 1D8LA 2PBEA 4AT7A 4F8RA 4RWQA 3OVSA 5KFMA 4UQGA 8ICTA 4YVZA 4B9LA 4KLFA 1QSLA 4R66A 8ICJA 9ICKA 1DK2A 3Q8KA 4DF8A 4ELVA 3C21A 2ZH8A 4RQ1A 2UVRA 3V6KA 2LYHA 2NRVA 1NJYA 3L9DA 3JPSA 4UBBA 1RYSA 3H37A 1SL2A 3H4DA 1H38A 1KLNA 2H5XA 1ZQQA 1BVSA 5J2FA 4F5QA 3TAQA 4R63A 2NRKA 4AT9A 4FHWA 2AQ4A 1TAUA 1MC8A 2DFLA 3PW7A 4ECXA 4B9MA 9ICQA 5KFJA 2KN7A 8ICLA 4JV0A 4QZ8A 3H8WA 1ZQNA 4F93B 4RNMA 4DSEA 1D9FA 4M9GA 9ICOA 3THVA 1U9LA 5DB8A 4JK1A 4M9JA 2DR8A 3TI0A 5CB1A 8ICAA 1T7PA 3JPPA 4KN7A 5J0OA 4X4SA 3WFSC 3OHBA 1DK3A 4DSLA 4RT3A 2XY6A 4LVSA 5KFFA 3HIYA 4MFFA 4CCHA 2BCVA 3H8JA 4FHVA 1ZQZA 5KT4A 8ICFA 2HHVA 4QZFA 2XCPA 3KHGA 2DVIA 3C1YA 5D49A 2FPLA 3PW4A 2IMWP 4YQWA 4O3NA 4BXOA 2W9BA 1T4GA 1X2IA 4M9NA 2R8IA 1U45A 2DR7A 5J2HA 4LZDA 2ZH2A 3MGIA 1TV9A 4KLDA 9ICSA 5HRLA 5KFEA 1F5AA 1R8BA 1V9PA 5CR0A 4F91B 4P4PA 4F5OA 1FA0A 4RPZA 3MBYA 3PX4A 1NK0A 1VFGA 4AT7B 9ICUA 4B9UA 2JEFA 5HC9A 5J0SA 5CHGA 5J2JA 4F4ZA 1K1QA 4QWBA 1R89A 3EZ5A 1DOQA 4PH5A 3EYZA 2BDPA 4J9RA 2O5AA 2UVUA 5J0RA 5KT5A 1LV5A 1L3TA 4NLGA 4X4NA 3SYZA 3FYHA 5HMLA 1NK6A 5KFUA 1NK5A 4RT2A 5DG8A 4RUCA 1TKDA 1BPZA 3MR6A 4PGYA 2ZH9A 5J0PA 7ICTA 1UT8A 9ICRA 4C8NA 5KG5A 5HR9A 4J9NA 4R64A 2BQRA 1VJ7A 9ICFA 1L3VA 4QWDA 5J0WA 4DSKA 8ICNA 4C8LA 2BR0A 4P2HA 3HPOA 1Q79A 3C2LA 4UB3A 9ICWA 3QZ8A 1ZQXA 1Q78A 4I2HA 5IINA 5IIKA 4J9MA 5CP2A 2R8GA 5DGBA 4E0DA 4RPYA 4JUZA 3RJKA 9ICHA 1RZTA 4DS5A 2PFQA 4PHEA 5DDYA 5JUMA 4DQRA 4YXMA 1ZQVA 5KT6A 2ASDA 2HW3A 4M04A 4EYIB 4BXOB 4O5CA 3UXOA 4NLNA 5IIMA 3C18A 4UBCA 1DGSA 2XGPA 5L9XA 3T3FA 3UPQA 2AGPA 5HMMA 2BQ3A 4QZEA 1BPBA 1KSPA 1ZQEA 2J6SA 7ICMA 4TURA 5KFVA 1MQ3A 3PR4A 2Y1IA 4I29A 5DBBA 1U47A 4M47A 8ICHA 4KMUA 2OWOA 8ICWA 2W8KA 3C5FA 8ICIA 4KLIA 3H38A 3B0YA 4YG2A 4ECWA 4RQ3A 3GIJA 4ED6A 4O5KA 3T5JA 8ICCA 4WC3A 4IR1A 3EPGA 3G6YA 4RNNA 2ZH3A 4RWNA 1BPYA 2M2VA 1ZQMA 2V9WA 9ICGA 2ZHBA 4UD4A 1UEVA 2DRAA 1TAQA 3HX0A 2PI4A 1XSLA 1ZYQA 1HUOA 4Q44A 8ICQA 2HVHA 3E2EA 3AQMA 4QW8A 4TUPA 3T5KA 3Q8MA 1KFSA 2I9GA 4LT6A 4AT8B 2ZUCA 1NJWA 9ICJA 1UEUA 3H39A 5L1JA 4X4QA 2HHQA 5KFQA 4EBJA 2J6UA 5DECA 5D46A 4FS2A 3IM1A 4J9SA 4O9MA 4ECSA 5KFPA 1ZQPA 5HP4A 3M9NB 5DDMA 4Z6CA 2AU0A 2C28A 2BQUA 1ZQSA 4DOBA 4RUAA 2ATLA 3SI8A 2A1JA 1ZQWA 5J2BA 4DS4A 2BGWA 3RRHA 4ED0A 1XWLA 3WFPA 3OV7A 5J2EA 3RH5A 3PO4A 2ZH4A 3MFIA 2ISOA 7ICEA 3UQ2A 4ECVA 2R8KA 4RQ0A 3BQ0A 4ZH4A 3ZD9A 4B9TA 5HRHA 4I27A 3RJEA 2ZTEA 2Q0ZX 4I2IA 4Z6EA 2KZZA 7ICQA 4DEZA 7ICSA 5F2VO 4IQVA 4I2FA 1RXWA 2ZH1A 7ICLA 2HHPA 3LK9A 4ECYA 3C66A 1RYRA 3MDCA 4ED8A 3C1ZA 1XO1A 2V4RA 1NK7A 2KFZA 4PHPA 3JPRA 4RWPA 5KFKA 9ICVA 4F5NA 5KFHA 2MUTA 4NLKA 1B43A 3EPIA 5KFDA 1K1SA 3RAQA 2FMPA 3H3AA 4X4VA 1A76A 4F2SA 1R8CA 5DLGA 4TQRA 3ISCA 4KN4A 5KFAA 4NM2A 4DSJA 4I2EA 4O3RA 4ECUA 3BQTA 4GLXA 5KTQA 4ED3A 4HYKA 3EW9A 4YP3A 2JEIA 4I2AA 5DG9A 2PFNA 2PFPA 5DKWA 3PX0A 4R8UA 7ICKA 3ISBA 3QEBZ 4X4RA 5J0TA 1U49A 3NYBA 1NK9A 2Q66A 3BDPA 4IRDA 3V6HA 2FPKA 5KFGA 3UXPA 4X0BA 1ZQBA 1ZJNA 3RJHA 2ASJA 2JZBA 5KG6A 2PFOA 5KG2A 5J0XA 4TUSA 3RBDA 3BQ1A 1MSWD 5DG7A 3JPTA 2DRBA 4DL2A 4J9OA 4MEXA 3RB4A 4UAWA 5F9LA 1KTQA 4LZGA 3KTQA 4JV1A 4M9HA 4DL4A 5DQGA 2ZH5A 4MFCA 1D9DA 4DL3A 4E8FA 5DBAA 3PX6A 3TARA 3RH4A 3GFKB 2HHSA 8ICVA 2V4QA 2AGQA 3AU2A 3RB0A 4NM1A 4ATBA 4S3NA 2RDIA 3ZD8A 3OVBA 3C5GA 2ALZA 1TK0A 4DQSA 4WBZA 4KLSA 2PI5A 1YLQA 1PX5A 2FMQA 4DFJA 5J2AA 4YR2A 4DOCA 2KFNA 5DQIA 3ZDDA 2HHXA 3PMNA 5HHIA 4XRHA 3RRGA 3OUYA 3NGDA 4DSIA 3K75D 4WC5A 4XA5A 3AQKA 4IG8A 3Q8RB 4YCXA 1BPEA 1NKEA 3TANA 1U4BA 5KFYA 4AT9B 5KFBA 1XU4A 5KG1A 2HVIA 5L1IA 4RNOA 1PZNA 4QWEA 2VA8A 1L5UA 2JEGA 1Z3EB 2P6UA 3M9OB 8ICSA 4WC2A 1ZQLA 3BJYA 7ICIA 2XGQA 1U48A 5CA7A 5KFWA 2XCAA 4DFMA 8ICOA 2NRWA 4O3QA 3M9MB 3AU6A 3MR2A 1MQ2A 5DB6A 2ZJAA 3WFRE 1UA0A 3ISDA 2P66A 3GV7B 2JZBB 1NJZA 5HRFA 4QZ9A 4QZBA 5D4BA 3PO5A 4M6WA 1KFTA 3WFOA 1UETA 4F4XA 4KLTA 7ICNA 3HP6A 4QZCA 3RJGA 3JPQA 5IIOA 4QZIA 3RJIA 4F2RA 2W9BB 1X9SA 1S97A 5HRKA 1Z00A 3TFSA 1S76D 1EXNA 1NKBA 4F3OA 8ICGA 4FHYA 4I2JA 3RJFA 3JYYA 3KHRA 3SV4A 4DQIA 3K4GA 4RQ4A 4ATBB 4BWJA 1SKWA 5DLFA 1JMSA 4WC6A 3T5LA 4FBTA 5J2CA 1X9MA 2F1IA 4Q8EA 9ICIA 3GILA 7ICFA 1B22A 4YR0A 4WC7A 4Q45A 1S10A 4EBCA 4GC6A 5KFNA 9ICEA 3RH6A 2C22A 3LQCB 5BPCA 4YR3A 3HWTA 2AJQA 8ICPA 5DB9A 7ICHA 3OUYB 1HJPA 1CEZA 4QZAA 4QZDA 1JIHA 1ZQHA 2P6RA 3G6XA 4I2BA 1SL1A 4I2GA 3JPOA 3MR5A 5DGAA 1BPXA 7ICJA 9ICLA 4F92B 3SZ2A 2DPJA 2PXIA 2BE3A 3OVAA 4MF2A 4NKTA 5DQHA 2RDJA 3Q8SB 3OHAA 1L3UA 4RWOA 1XSNA 1ZQGA 1MIVA 2ISPA 4QZGA 4DL7A 4GXJA 2XO7A 4GC7A 5KFOA 3M8SA 3GV5B 4M6WB 1NO5A 5J2KA 4QWCA 3KHHA 4I2CA 4KLQA 3UPSA 4DF4A 3GDXA 2IA6A 1TVAA 5HREA 2BPCA 3GIKA 4FBUA 1JXEA 3V7JA 5EOZA 1S0VA 9ICTA 1TFWA 1KDHA 3H4BA 1QTMA 1BGXT 4KLOA 4WC4A 1Z00B 4NLZA 3RR8A 4DQQA 1S0OA 3PV8A 3RB3A 2DPIA 4BDPA 8ICUA 5J29A 4MFAA 2C2RA 3PR5B 2FLLA 4K4HA 4ED2A 4RPXA 4F5PA 3LDAA 1JQRA 4FH3A 3TAPA 1KEJA 5IIIA 1NK8A 4FH5A 5EWEA 1T3NA 5DB7A 2B21A 4TQSA 2IBKA 4DLGA 4KLMA 4RU9A 3PW0A 4RQ5A 2AQ0A 4DWIA 2FLNA 4XQ7A 3RBEA 3PMLA 5J0YA 4F50A 2DR9A 4EBEA 3QE9Y 1UT5A 3H7IA 4XQ8A 5KFLA 1UA1A 2BCQA 4X4UA 2M9NA 4O3OA 4J9KA 4BWMA 4UAZA 2HHUA 4ELUA 3WFQE 2R8HA 1ZQYA 4FS1A 4Z6FA 3FDSA 3UQ0A 4ECTA 1TK8A 1C7YA 3RJJA 1D8YA 3N4MB 4PPXA 3RAXA 3ETLA 4O3SA 2IHMA 1WCNA 3MGHA 4E7XA 1JX4A
chains in the Genus database with same CATH superfamily
2KJ5A 5DEDA 2M2WA 4Z6DA 4IQWA 1D8BA 2FMSA 8ICBA 5D62A 5J0UA 3OSNA 4IRCA 1RQNA 2M2UA 3KOOA 4AYBF 4MEYA 2YMMA 1ZQOA 1SB3C 2W03A 5KG0A 4X0AA 4IQUA 2ASLA 9ICMA 3NVWA 1NKCA 4RQ6A 4PGQA 1MN8A 2ZIUA 1QQ5A 1OU5A 2UVWA 1N60A 2VA2A 3ED5A 1S77D 5AKLA 2DL0A 4F4YA 1C20A 2W9CA 2BCRA 2ZJ8A 4Y2RA 2XC9A 4Q43A 4DO9A 1HUZA 4JWNA 4UAYA 2KTQA 4GXIA 1T94A 9ICXA 2C2DA 4QWAA 1T8EA 4IR9A 4WH5A 2ZUBA 5C5JA 3QEAZ 4C7YA 5GTHU 3OSPA 5ALPA 4DFDA 4YD2A 3F5EA 4PHAA 1Y88A 2W9AA 5AKEA 8ICMA 1NZPA 4EX7A 4MF8A 5KFCA 3CP8A 2DF4B 2Y9TA 3B0XA 2KVCA 2KSOA 3MC1A 4YXJA 2G08A 4FHXA 3TKAA 5DBCA 3SAHA 2BPFA 1ZQUA 4M2YA 4FHPA 2W7PA 1AROP 2WHEA 2JH1A 3M6KA 2BKEA 1V4AA 4IQTA 4EEYA 1SZPA 4ECQA 2HHTA 1BPDA 5AKKA 4EBDA 3GU3A 4OJOA 3GQCA 2XVTA 5J2IA 3SEIA 4EEKA 1IV8A 5ALNA 2JEJA 1LVHA 5AKGA 1SXDA 5EE0A 4NJ8A 5AM5A 3H40A 5CEHA 4EGWA 5H2FU 4F4WA 4XUSA 2ZIVB 2W9MA 1PK1B 5KFXA 4DL6A 4KLJA 4Q8FA 3GIMA 2XY7A 4NXZA 4K4GA 4ED7A 4O3PA 1ZQRA 1ZQKA 4OJ6A 2W43A 4M0AA 2K4IA 2VANA 1ZRNA 1O08A 3KKAC 1R8AA 4DLEA 8ICZA 4KM5A 2HCFA 2YY6A 3JZ0A 8ICTA 2Q4TA 4OD0A 5AK4A 4YVZA 4KLFA 1QSLA 2DBYA 2LYHA 3L9DA 4UATA 1A6SA 2F44A 1RYSA 3H37A 1KLNA 2G5HB 4F5QA 4R63A 4FHWA 2AQ4A 4FHYA 9ICQA 1DGJA 4F93B 4Y2QA 4RNMA 4C0ZA 4JK1A 2DR8A 4X4SA 3NRWA 4MFFA 2HHVA 1S5LU 2E1EA 2FPLA 1CRXA 3I28A 3K7DA 2DR7A 2ZH2A 9ICSA 4KLDA 3HKZF 1ZQ1C 4B9UA 2E8OA 1X6IA 4QWBA 1DOQA 2BDPA 5J0RA 2EZYA 5FP0A 4U6PA 4Y2UA 3SYZA 4O68A 1TKDA 1GO3F 3SAFA 4WJ3B 2ZH9A 7ICTA 1UT8A 1PVPA 9ICRA 5HR9A 5KG5A 2IOFK 4J9NA 3WK8A 1VJ7A 9ICFA 1VDVA 5J0WA 5ALZA 1QCKA 2FE9A 4J9MA 5CP2A 2D3DA 4JUZA 3UMCA 9ICHA 1RZTA 4PHEA 5DDYA 5JUMA 4M04A 4BXOB 3UXOA 4O67A 3DV9A 3NS1A 5IIMA 3C18A 4UBCA 3T3FA 2BQ3A 5HMMA 2J6SA 4QZEA 1KSPA 1KNYA 4M47A 5DBBA 2QARB 3B0YA 5ALFA 4ED6A 4OJPA 4IR1A 2ZH3A 1BPYA 2V9WA 3HX0A 8ICQA 4TUPA 2VJ4A 3Q8MA 4NXXA 1KFSA 5AIBA 4CF4A 3H39A 3C28A 4FS2A 4O9MA 4ECSA 2WB1C 1ZQSA 2BQUA 2C28A 3QU2A 4K97A 2W3RA 3SI8A 3KKAA 4DS4A 3RRHA 3WFPA 3CW2C 2ISOA 2AHOB 1T3QA 2LYBA 1RXWA 7ICLA 4ECYA 5ALYA 3C1ZA 2V4RA 2KFZA 1WWUA 3JPRA 5ALDA 1ZD4A 1ZD5A 2MUTA 2Y0SC 4Y2VA 3TADA 2KIWA 3VCBA 4F2SA 1V38A 4Y2TA 2HBJA 5AKZA 5AI9A 4KN4A 4KB6A 2E8MA 2GAFD 3EF2A 4ECUA 2JEIA 1N5WA 7ICKA 3QEBZ 1U49A 3NYBA 3UXPA 4X0BA 1ZQBA 3RJHA 2ASJA 4XJEA 1MSWD 4UAWA 2G07A 5F9LA 1KTQA 3L3FX 2HOQA 4E8FA 3O0FA 3TARA 3RH4A 2H3VA 5ALTA 4ATBA 1PUZA 3M6ZA 3ZD8A 4WBZA 2PI5A 3QUCA 4DOCA 2KFNA 2ZXHA 5HHIA 4XRHA 3RRGA 3HILA 3ETRA 3PSPA 4XA5A 1PK3A 3Q8RB 5AK3A 1NKEA 1CI4A 5KFBA 2HVIA 8ICSA 4WC2A 1ZQLA 7ICIA 5ALUA 2YMQA 5AI0A 2JZBB 2FCLA 5D4BA 4OAIZ 2ES6A 2L5YA 4BX9C 3WFOA 4F4XA 2KK0A 3RJGA 3JPQA 5IIOA 3RJIA 1X9SA 1S97A 1L6NA 4I2JA 3RJFA 3SV4A 1JMSA 4UW9A 4WC6A 3T5LA 4FBTA 4LEZA 1X9MA 2G0AA 1LKYB 9ICIA 1B22A 1DXSA 1RYUA 5KFNA 4OCZA 3RH6A 1HJPA 1CEZA 4QZAA 1ZQHA 3G6XA 3JPOA 3QU9A 4LEVA 2HBMA 3Q8SB 1L3UA 1ZQGA 1MIVA 2ISPA 4QZGA 2W55A 4GXJA 3GV5B 4M6WB 1NO5A 1QQ7A 5J2KA 2W04A 4QIWC 2IA6A 3PSFA 4FBUA 5D63A 5EOZA 1KDHA 5JU5A 4G9BA 4OAFA 3IP4B 3RR8A 2K89A 3LVWA 2DPIA 5L1MA 4K99A 8ICUA 5J29A 4K8VA 2ZIXB 2FLLA 4FH3A 4F5PA 4UARA 3QUBA 5IIIA 1NK8A 1T3NA 5DB7A 2YTUA 2KJ9A 3ONNA 2IBKA 1WWVA 3PW0A 2AQ0A 2WF5A 4DWIA 5J0YA 3QE9Y 1N2XA 1UT5A 5CFTA 2KOBA 4MKPA 1UA1A 4BWMA 2R8HA 1ZQYA 3UQ0A 5HRGA 3FDSA 3I76A 1C7YA 1TK8A 4PL1A 2OH2A 3MGHA 4E7XA 1XS9D 3GIIA 4HX0A 7ICGA 4X5VA 2BCSA 2LKYA 4U7CA 5HRIA 3LWMA 2ZTCA 4WBYA 4IL6U 3OJUA 1ED1A 3ZDCA 1TFYA 4WOYA 2O1PA 3V72A 2E8NA 2MUTB 3T5HA 2OXOA 1SKSA 2E8PA 1TAMA 3WKCA 2JRZA 2G5IB 3V6JA 1L3SA 3PVXA 5AKHA 1KFDA 2BHNA 2NRTA 4R65A 2LPEA 2MAXA 4EV6A 5AM4A 5KT7A 3QU5A 2M2TA 1JROA 3AN1A 2GWSA 5L1LA 8ICRA 1FO4A 4B9NA 4J9PA 2NYVA 5KG4A 2ZHAA 1KL9A 4DSFA 4FZMA 4TUQA 2WF9A 1NJXA 1MIWA 4KTQA 4UB1A 5HNKA 1PK1A 4WC1A 1F44A 2UVVA 8ICXA 3PW5A 4DL5A 3CYMA 2FPMA 4B9VA 4UB5A 5KFIA 4RQMA 4AYBC 4M5DA 3UXNA 1A77A 4QZHA 4C4SA 8ICEA 4RWOA 1JALA 5KFRA 5J2GA 1QLNA 5KFZA 3H0RB 4DFKA 3RTVA 2EZZA 3C29A 4QNLA 2NO5A 4US8A 4G3IA 4K9BA 4NY8A 1WOTA 5KG3A 2E3TA 2FLPA 3HT3A 2J6TA 5J0QA 3K1ZA 3IG8A 5ALHA 5AM2A 1COOA 4X4OA 2R8JA 1IM4A 2KP7A 4CGZA 4K98A 3MCRA 2WFAA 2K8AA 5KG7A 4Y2PA 4UB4A 3EWAA 4ELTA 7ICVA 1X9WA 5KT3A 4JV2A 2XY5A 1SKRA 3KZXA 1ZQFA 1WG8A 4IRKA 3PW2A 1N56A 5KFTA 3HJ1A 5AICA 1MIYA 5ALOA 3MFHA 4KLGA 5HRBA 3PSIA 1JN3A 4QW9A 3KHLA 1KRPA 2ID1A 3K1RB 3H8SA 4UAUA 4RQ2A 3QZ7A 3S6JA 4F8RA 3OVSA 2CXYA 2FI1A 5GTIU 3UMGA 2ZH8A 8ICJA 4KX3A 4DF8A 3C21A 2BBHA 2OM6A 4RQ1A 2UVRA 2LHTA 4F71A 3JPSA 4UBBA 1H38A 3H4DA 2H5XA 1BVSA 2NRKA 4EEDA 1MA7A 2ODGA 1TAUA 4B9MA 3ER9B 4DSEA 1U9LA 5DB8A 4M9JA 1RQLA 3TI0A 4KX5A 5J0OA 4EEBA 3WFSC 4EX6A 4LVSA 2BCVA 4FHVA 2KG5A 1ZQZA 5KT4A 2XCPA 2KJ8A 3C1YA 1KQQA 4CRXA 2DGZA 2OCEA 4BXOA 2ZG6A 5EE3A 2W9BA 1V85A 1T4GA 1X2IA 2R8IA 1KN5A 5J2HA 4LZDA 2EAOA 1TV9A 5KFEA 1R8BA 2QARA 1V9PA 3MBYA 2B51A 4DCCA 9ICUA 5HC9A 1URJA 1OUQA 5CHGA 4F4ZA 1K1QA 5EE9A 1R89A 3AMZA 2O5AA 4NLGA 1NK6A 3NASA 4RUCA 4FZNA 1BPZA 5KL1B 1YZ6A 4CF5A 4C8NA 1L8OA 2BQRA 4DSKA 4P2HA 1KKXA 3QZ8A 1XO0A 3WK4A 5HR7A 2R8GA 4E0DA 4NXTA 3N7RC 3WKBA 4O5CA 1Z4NA 1DGSA 2AGPA 3UPQA 4I29A 2Y1IA 3R9KA 4KMUA 5AKIA 4KLIA 3A0HU 4YG2A 5JTIA 3TACB 3G6YA 4RNNA 4RWNA 2D8CA 3OPXA 1UEVA 3HKZC 1TAQA 4OAHA 3BS7A 2PI4A 1WUDA 1ZYQA 4QW8A 5ALSA 2I9GA 3KZIU 2PMZF 2WF8A 9ICJA 5L1JA 4X4QA 5KFQA 2W7OA 4EBJA 2J6UA 2KICA 5KFPA 5CFSA 3M9NB 5DDMA 4Z6CA 2AU0A 1COKA 5ALVA 2OEHA 2XICA 4RUAA 2ATLA 2A1JA 4UAVA 2E1FA 5J2BA 1Q3UA 3CNHA 4ED0A 1XWLA 3ER8C 5J2EA 3RH5A 2JXJA 1YT3A 2H3FA 4ECVA 5ALJA 4RQ0A 4ZH4A 4B9TA 3KBBA 5HRHA 4I27A 2K8BB 2ZTEA 4I2IA 4PJ0U 7ICSA 5F2VO 4IQVA 2ZH1A 1RYRA 3MDCA 4ED8A 1RDFA 3NVOA 5C0YA 5AI8A 4PHPA 2D6FC 9ICVA 4NLKA 4RQNA 3EPIA 1K1SA 2YB1A 1A76A 5DLGA 1X9XA 4I2EA 4DSJA 4O3RA 4ED3A 4GLXA 5KTQA 4YP3A 2PFNA 1PVQA 3AM9A 4BUGA 3ISBA 4X4RA 5J0TA 2Q66A 2ZXIA 5TISU 3CK6A 2JZBA 2PFOA 5KG2A 2NO4A 4TUSA 2QLTA 2IOFA 4MEXA 4LZGA 3KTQA 4JV1A 4FE3A 4DL4A 4MFCA 4DL3A 2A19A 2EAMA 2V4QA 3NVZA 5AM0A 2HOIA 1LKYA 1N61A 4KLSA 4NXWA 1YLQA 4DFJA 3NKUA 3NGDA 2DQNB 2CPRA 1U4BA 2XIDA 1XU4A 5L1IA 5KAFU 4RNOA 4QWEA 1Z3EB 3M9OB 2XGQA 1U48A 5CA7A 1RG6A 5DB6A 2ZJAA 3WFRE 2P66A 1NJZA 3QUQA 3KD3A 3PO5A 4M6WA 4KLTA 7ICNA 3HP6A 4QZCA 4QZIA 3U26A 5HRKA 2W9BB 1EXNA 1NKBA 4F3OA 3KHRA 2WAQF 2ZIXA 3ICXA 3WKDA 5AK6A 2F1IA 5T14A 4Q8EA 3SAGA 4FZLA 5AIAA 9ICEA 2C22A 2K60A 3WKAA 1JIHA 2P6RA 4KMOB 4I2BA 9ICLA 1BPXA 2BE3A 3OVAA 4MF2A 4NKTA 3QU4A 5DQHA 2RDJA 3OHAA 2H3ZA 4DL7A 4GC7A 3M8SA 3SR6A 4QWCA 3KHHA 1TVAA 5HREA 3GIKA 1TFWA 4LEYA 1NI3A 4WC4A 2LM1A 2W54A 2C2RA 3PR5B 2K4EA 4ED2A 4RPXA 3WK6A 3PZPA 1ECWA 4RU9A 4RQ5A 4XQ7A 3PMLA 2KNJA 4O3OA 2HHUA 2QKQA 2DKZA 3F2BA 3N4MB 3RAXA 3ETLA 2JV3A 2IHMA 1L7NA 4B9LA 2HHQA 9ICBA 3SMVA 4GIBA 5AKYA 4N7RA 1ZJMA 2A1JB 4GXKA 2I6XA 4YMNA 7ICRA 2LI6A 7ICUA 4WQLA 1XNSA 5G5HA 2ZTDA 5D61A 5BOMA 5HR6A 3BZKA 3ORYA 4NLBA 1QSYA 3PY8A 1FFVA 4NL9C 1NZBA 5TZVA 5ALGA 5A0LA 4YMOA 5EWGA 2F76X 5ALIA 4JLXA 4DOAA 3RR7A 3AQFA 3OJSA 2ZJ5A 3LVVA 2BPGA 1QSSA 2H3QA 3NRZA 4UD5A 4C80A 3TQ1A 4ECZA 5KT2A 4C8KA 1SL0A 2KHQA 4X4TA 3V7KA 2WB1F 2R18A 4YMMA 4P4MA 3M8RA 3G6VA 2HI0A 2C2EA 5HHHA 3LWLA 4KITB 1VFGA 4EZ9A 5KAIU 2I1QA 1Z1VA 4WC0A 1RPLA 1XC9A 2KVSA 4FFDA 2RRDA 1SV4A 3V7LA 3JCFA 2NRZA 2B6GA 3AUOA 1ZQTA 4UB2A 3FAHA 3QXGA 1LB2B 2RFFA 1TE2A 3PSTA 2W8LA 2KZMA 4YN4A 5EWFA 3BQ2A 2WF7A 2BZFA 2DR5A 4J9LA 2ZUDA 4ED1A 4AT8B 2QB0B 4DFPA 5AKXA 5KFSA 3SD7A 4F5RA 4KLLA 4IS7A 2NRXA 3Q8QB 2CRXA 4OJ5A 4EYHB 5IILA 4P0PA 3B9JA 4O0IA 3NUQA 4RZRA 9ICAA 1VLBA 9ICNA 1XSPA 4C8MA 3A0BU 5F9NA 4F4KA 5CJ7A 1S0MA 3F53A 4O5EA 4DQPA 2KKPA 1JAJA 2VJ5A 3H0MB 1Q3VA 3Q8LA 4KLUA 9ICCA 5B3QA 4KLHA 1F0MA 1SGGA 5K4LA 3QU7A 7ICOA 2OHFA 4X4PA 3HJ4A 4CE6A 1TK5A 1ZOLA 4UB8U 3BS5A 4UQGA 1DK2A 3V6KA 2NRVA 1NJYA 1SWWA 3NVYA 1SL2A 1ZQQA 3TAQA 4AT9A 1MC8A 2DFLA 3H3AA 1X40A 5KFJA 2KN7A 4JV0A 3H8WA 1D9FA 3AQLA 9ICOA 5J8YC 4NL9A 5CB1A 8ICAA 1T7PA 1X6JA 3DDHA 3OHBA 4DSLA 1F5SA 2MSNA 2XY6A 3HIYA 3H8JA 2JGAA 2YN4A 4QZFA 2DVIA 5D49A 4YQWA 4O3NA 1IIPA 4NXUA 1DRGA 4M9NA 4K9AA 2DKXA 2RHFA 3MGIA 5CR0A 4F91B 4P4PA 4RPZA 1Q46A 4AT7B 2JEFA 1QQ6A 5J0SA 4CDGA 4ACOA 4PH5A 3EYZA 4IC9A 2UVUA 4B6JA 1HIWA 1ZD2P 1LV5A 1L3TA 2B56A 3FM9A 4X4NA 5HMLA 5KFUA 4RT2A 5AKJA 4R64A 4C8LA 2BR0A 2HDOA 4OJLA 3HPOA 4UB3A 4Y2JA 9ICWA 1ZQXA 3WK7A 4I2HA 5IINA 5IIKA 5AM3A 2HN2A 5DGBA 4RPYA 3RJKA 4YXMA 1ZQVA 4LJXA 3WK9A 3OV7A 1BPBA 1ZQEA 4TURA 3PR4A 1U47A 4LEWA 2OWOA 2W8KA 3C5FA 3H38A 4ECWA 5ALQA 8ICCA 2HOFA 2M2VA 1ZQMA 3GZFA 2ZHBA 4UD4A 2DRAA 1K5OA 4NV0A 1XSLA 1HUOA 3HRDD 4Q44A 5AM1A 2ZUCA 1NJWA 1UEUA 5AI5A 1Z4OA 3CRXA 2G09A 2YMPA 1J2MA 3IM1A 1ZQPA 5HP4A 2VIXA 4DOBA 4JMUA 3PO4A 3UMBA 3SQIA 3UQ2A 3EUB2 1B4FA 5ALEA 3ZD9A 1VJ5A 2Q0ZX 4Z6EA 4C4TA 4I2FA 2HHPA 3LK9A 3C66A 1XO1A 4RWPA 5KFKA 5KFHA 1B43A 2IOHA 2YQEA 1R8CA 4TQRA 2LBOA 5J8YA 4P0PB 3BQTA 4HYKA 3EW9A 1JUDA 5ALXA 4I2AA 2PFPA 5DKWA 3PX0A 4R8UA 1UCVA 4O3MA 3BDPA 4IRDA 4PL2A 2FPKA 1OXJA 5KG6A 2KMDA 5J0XA 3QUTA 3RBDA 5CFUA 2DRBA 5DG7A 2PMZC 4DL2A 2JHDA 2ZH5A 4C7ZA 5AHXA 3T79A 3PX6A 2GH1A 3GFKB 5AK5A 8ICVA 2AGQA 4S3NA 5CRXA 4NM1A 2B0CA 3OVBA 3C5GA 1TK0A 1S8OA 1PX5A 3BS5B 5J2AA 2KD1A 1L7OA 3ZDDA 2HHXA 4NLCA 3K75D 4WC5A 1BPEA 4AT9B 1PZNA 2HBLA 2VA8A 4A8EA 2P6UA 2B4VA 3BJYA 2XCAA 3AU6A 3MR2A 2LMRA 3GV7B 4QZ9A 2FJ6A 3RFAA 2Y9UA 5ALWA 1OW5A 1KFTA 1ZD3A 4C4RA 2ZIWB 1JRPA 2N1RA 4USAA 3D2NA 4QJFB 1UQVA 3JYYA 4DQIA 4RQ4A 5DLFA 4EELA 5J2CA 3H8MA 3GILA 4MHVA 4EBCA 4YR3A 3HWTA 8ICPA 3OUYB 4P0QB 2EH9A 4QZDA 3ERCC 1AQ6A 1YZ7A 4I2GA 5DGAA 4F92B 3SZ2A 1L7MA 2JH7A 4I0UA 4WQKA 3D6JA 4KLQA 2F77X 4DF4A 1S0VA 3V7JA 2A3VA 3H4BA 1QTMA 1BGXT 4KLOA 1Z00B 4NLZA 2EZXA 3PV8A 4BDPA 1JI7A 2YB4A 3LDAA 3TAPA 3M7DA 5AI6A 2B21A 3AL0B 2NV3A 4DLGA 2WAQC 2F2AB 2W3SA 3RBEA 4F50A 4EBEA 5B66U 4XQ8A 3QYPA 2AH5A 5KFLA 5ALRA 4UAZA 4ELUA 4IG8A 4CF3A 4FS1A 3RJJA 1D8YA 4PPXA 1WCNA 1JX4A 3WU2U 5JRTA 2F8LA 4FO6A 4E80A 1CUKA 3F2DA 1ZQIA 4Y2YA 3JPNA 2JR5A 3TADC 3ZDEA 1S0NA 3MABA 5ALMA 3L5KA 4PZOA 5CWRA 3ZI4A 1TFRA 2E5SA 4OO1J 4BJQA 3SV3A 1V97A 5IIJA 3ZDBA 4YD1A 4PHDA 3N7SC 4YFKA 2PKEA 3Q8PB 4GFJA 1IG6A 2HHWA 3ZDAA 4EZ6A 4RQ7A 2RP5A 4P4OA 3RB6A 4WCWA 4O6AA 4AT8A 2QB0A 4R8UB 2KZ3A 2CN1A 4B9SA 4JB3A 1NK4A 1N48A 2IHNA 4JWMA 3NVVA 5J2DA 2HSZA 1A0PA 3M1YA 3WK5A 4KLEA 4EP7A 4J9QA 1ZQCA 2F1JA 5F3XB 4I28A 2M0NA 2XI9A 2H3IA 3AQNA 2ESEA 1Z19A 3C2KA 3MR3A 4M9LA 2A1AA 2BCUA 3HW8A 2DWQA 2K4HA 3TFRA 2AGOA 2EDUA 2GLEA 2WTFA 1Q8KA 4PGXA 1JXLA 3OWGA 2ZIUB 3BQ7A 2EAPA 4K4IA 3MDAA 1IXRA 3C23A 8ICKA 2W9CB 4NWIA 8ICYA 1ZQAA 2JMGA 1ZETA 3I1YA 3OGUA 4RQ8A 2VA3A 1S9FA 1WCLA 4ECRA 3L4PA 3N97B 2MU2A 2RQ5A 3AEVA 4NKUA 2AXTU 1NOMA 4F72A 2KIVA 3E58A 7ICPA 2ZH6A 2ZH7A 9ICPA 3C2MA 3IHQB 2F1HA 4C8OA 3NTUA 1ZQDA 4I2DA 3GV8B 2KSOB 1SV0C 4PZNA 3BZCA 5BOLA 1BNPA 3N28A 5L1KA 1BNOA 2EWRA 4Y2XA 2Y1JA 1ZQJA 4EBKA 2KV2A 3PNCA 4BGDA 1RXVA 4AT7A 1D8LA 2PBEA 4RWQA 1UHUA 2MA1A 5KFMA 4ZOHC 1UPHA 9ICKA 4R66A 3Q8KA 4ELVA 5J2FA 3N7PD 3PW7A 5HRDA 4ECXA 3F2CA 1ZQNA 4QZ8A 8ICLA 4M9GA 3IRUA 2HBKA 3THVA 1X66A 3JPPA 2EANA 4KN7A 1DK3A 4RT3A 3IN5A 5KFFA 2FDRA 4CCHA 4FO1A 1SXEA 3ALRA 8ICFA 3KHGA 2K4PA 3IDWA 3PW4A 2IMWP 1U45A 1HEKA 5HRLA 1N5XA 1F5AA 4F5OA 1FA0A 3PX4A 1NK0A 1N62A 2Z7JA 5J2JA 3EZ5A 5ALLA 4J9RA 3IV6A 2MRLA 5KT5A 3FYHA 1NK5A 5JTGA 5DG8A 3MR6A 4PGYA 5J0PA 1L3VA 4QWDA 8ICNA 4JLZA 1Q79A 3C2LA 5ALKA 1Q78A 2WF6A 2BDUA 4DS5A 2PFQA 1J97A 4DQRA 2ASDA 5KT6A 4US9A 2HW3A 4OAGA 4EYIB 2Y0SF 4NLNA 2BBJA 2XGPA 5L9XA 7ICMA 5KFVA 1MQ3A 8ICHA 8ICWA 8ICIA 5G5GA 4RQ3A 1N63A 3VC8A 3GIJA 3T5JA 4O5KA 4WC3A 1NNLA 4J03A 3EPGA 1L7PA 9ICGA 2IUBA 1KW4A 2DUYA 2F3NA 2HVHA 3E2EA 3AQMA 3RF9A 3T5KA 4LT6A 1L8LA 2YX8A 5DECA 1SIJA 5D46A 4J9SA 1SV0A 1QH9A 1WYGA 2KHVA 1B0XA 1ZQWA 2VKQA 2BGWA 2HMXA 3QX7A 2ZH4A 3MFIA 7ICEA 1SWVA 2R8KA 3BQ0A 2KZZA 3RJEA 7ICQA 4DEZA 2K8CB 1NK7A 3F5AA 3D2QA 4F5NA 2KE7A 3SENA 5KFDA 3RAQA 1Z1BA 2FMPA 4X4VA 2F8KA 3ISCA 5KFAA 4NM2A 1FIQA 1M6YA 4O69A 2KKVA 2QB1A 3D2SA 5DG9A 2HN1A 2GA9D 4UB6U 1NK9A 1RM6C 3V6HA 5KFGA 1ZJNA 5KL8B 3BQ1A 3JPTA 1GPJA 2IHOA 4J9OA 3RB4A 2ZIWA 4M9HA 5DQGA 4K96A 1D9DA 3PHZA 5DBAA 2HHSA 2OYYA 5EE1A 2I5HA 3AU2A 3RB0A 2KEYA 2RDIA 5B5EU 4ICAA 1O03A 2ALZA 4DQSA 2P35A 2EQYA 2FMQA 4YR2A 5DQIA 2LM4A 3PMNA 1PVRA 3OUYA 1FEZA 4P0QA 4DSIA 2W11A 2LYAA 3AQKA 4YCXA 3TANA 2G06A 3QNMA 5KFYA 5KG1A 1L5UA 2JEGA 2YMLA 5KFWA 4DFMA 8ICOA 2NRWA 4O3QA 3M9MB 1ZRMA 4QIWF 1MQ2A 1UA0A 3ISDA 5HRFA 3J81j 4QZBA 3FC4A 1UETA 4AP9A 4F2RA 1SZHA 4UASA 1Z00A 3TFSA 1S76D 2ZIVA 8ICGA 5CHEA 3MGVA 3KFUF 3K4GA 4ATBB 4BWJA 1SKWA 2RLTA 5KNIA 5E79U 7ICFA 3E0FA 3NWIA 4YR0A 4WC7A 4Q45A 1S10A 3HJEA 5AI4A 4GC6A 3LQCB 1X42A 5BPCA 2AJQA 3AQEA 5DB9A 7ICHA 4EENA 4HAIA 3IG5A 1SL1A 3MR5A 7ICJA 1FFUA 2DPJA 2PXIA 4CNQA 3UM9A 1XSNA 3WKEA 1KBUA 1ZXIA 2XO7A 5KFOA 3OTQA 4I2CA 3UPSA 3GDXA 2BPCA 1JXEA 9ICTA 4DQQA 1S0OA 3RB3A 4MFAA 4K4HA 1JQRA 2GO7A 3LYSA 1KEJA 4FH5A 5EWEA 3DEEA 3H0LB 4TQSA 4KLMA 2GOLA 2DR9A 2FLNA 1P7DA 3H7IA 2BCQA 4X4UA 2M9NA 4J9KA 3WFQE 4Y2SA 4Z6FA 4ECTA 4NXVA 5B3PA 2O6KA 4O3SA 1J2NA
chains in the Genus database with same CATH topology
5DEDA 2M2WA 4Z6DA 1ZJMA 4IQWA 2A1JB 4GXKA 4YMNA 4FO6A 1CUKA 1XS9D 2FMSA 3GIIA 1ZQIA 8ICBA 4E80A 3JPNA 7ICRA 7ICGA 7ICUA 5J0UA 3OSNA 4X5VA 2BCSA 4IRCA 3ZDEA 1S0NA 2M2UA 3MABA 2ZTDA 5HRIA 3LWMA 2ZTCA 4MEYA 5BOMA 4WBYA 1KNYA 3OJUA 3ORYA 5CWRA 1ZQOA 3ZDCA 1TFRA 1TFYA 5KG0A 2O1PA 1QSYA 3PY8A 4X0AA 3SV3A 4IQUA 2ASLA 9ICMA 3V72A 1NKCA 4RQ6A 4PGQA 2MUTB 5IIJA 5TZVA 3T5HA 3ZDBA 1OU5A 1SKSA 2UVWA 2VA2A 4YD1A 4PHDA 4YFKA 4YMOA 1S77D 3V6JA 5EWGA 4F4YA 3Q8PB 5HRGA 1L3SA 3PVXA 2W9CA 2HHWA 2BCRA 4EBKA 2ZJ8A 3ZDAA 2XC9A 4Q43A 1KFDA 4DO9A 4RQ7A 4DOAA 4UAYA 1HUZA 4EZ6A 4JWNA 4P4OA 3RB6A 4WCWA 2BHNA 3RR7A 2NRTA 2KTQA 4GXIA 4R8UB 9ICXA 4AT8A 2KZ3A 4R65A 2ZJ5A 4QWAA 3OJSA 2C2DA 1T8EA 4B9SA 2MAXA 4IR9A 5KT7A 2BPGA 1QSSA 1NK4A 1N48A 2M2TA 2ZUBA 5C5JA 3QEAZ 2IHNA 4UD5A 4JWMA 2GWSA 5J2DA 5L1LA 3TQ1A 8ICRA 4ECZA 5KT2A 3OSPA 4C8KA 4B9NA 4KLEA 1SL0A 4EP7A 4J9QA 1ZQCA 2F1JA 3V7KA 4J9PA 4X4TA 5KG4A 2ZHAA 4YD2A 4DSFA 4I28A 4TUQA 1NJXA 3AQNA 4YMMA 1MIWA 4PHAA 4P4MA 3M8RA 3G6VA 1Y88A 2W9AA 4KTQA 4UB1A 5HNKA 3C2KA 3MR3A 4M9LA 2C2EA 5HHHA 4WC1A 3LWLA 8ICMA 2UVVA 1NZPA 4KITB 4MF8A 5KFCA 4DL5A 3PW5A 2BCUA 4EZ9A 3HW8A 2I1QA 2FPMA 8ICXA 4WC0A 3B0XA 4B9VA 1RPLA 3TFRA 2AGOA 1XC9A 4UB5A 3AQLA 5KFIA 2WTFA 1JXLA 4PGXA 4YXJA 3V7LA 5HRDA 4FHXA 4M5DA 2NRZA 1A77A 3UXNA 5DBCA 4QZHA 3AUOA 1ZQTA 2BPFA 4K4IA 4UB2A 8ICEA 1ZQUA 3MDAA 5KFRA 5J2GA 1LB2B 4M2YA 1QLNA 1IXRA 5KFZA 2RFFA 4FHPA 1AROP 3C23A 4DFKA 3RTVA 8ICKA 9ICBA 2W9CB 2W8LA 2KZMA 4YN4A 2BKEA 5EWFA 1V4AA 3BQ2A 4IQTA 8ICYA 2DR5A 4EEYA 4J9LA 1SZPA 4ECQA 1ZQAA 2HHTA 2ZUDA 1BPDA 4ED1A 4G3IA 4DFPA 4NY8A 1WOTA 5KFSA 5KG3A 2FLPA 4EBDA 3HT3A 1ZETA 3OGUA 2J6TA 4RQ8A 2VA3A 5J0QA 4F5RA 4KLLA 1S9FA 1WCLA 2NRXA 3Q8QB 1COOA 3GQCA 4ECRA 5J2IA 4X4OA 4EYHB 5IILA 2R8JA 3N97B 1IM4A 2KP7A 4O0IA 2JEJA 4RZRA 9ICAA 9ICNA 4NKUA 1NOMA 3H40A 5KG7A 4F4WA 4UB4A 1XSPA 7ICPA 2ZH6A 4XUSA 4C8MA 9ICPA 3C2MA 2ZH7A 5F9NA 3IHQB 3EWAA 5CJ7A 1S0MA 4F4KA 4O5EA 2W9MA 4DQPA 4ELTA 7ICVA 2F1HA 1X9WA 5KT3A 4C8OA 2XY5A 5KFXA 1SKRA 4JV2A 1JAJA 4DL6A 4KLJA 3NTUA 4Q8FA 3GIMA 2XY7A 4I2DA 1ZQDA 1ZQFA 3GV8B 4NXZA 4IRKA 4K4GA 3PW2A 4ED7A 4O3PA 3Q8LA 5KFTA 1N56A 1ZQRA 1ZQKA 4KLUA 9ICCA 3HJ1A 4M0AA 5BOLA 1MIYA 4KLHA 1BNPA 5L1KA 3MFHA 1BNOA 4X4PA 2VANA 4KLGA 5HRBA 1JN3A 4QW9A 7ICOA 3KHLA 2Y1JA 1KRPA 2ID1A 3HJ4A 1ZQJA 4DLEA 3H8SA 3PNCA 4RQ2A 8ICZA 1TK5A 4BGDA 1R8AA 1RXVA 3QZ7A 3JZ0A 1D8LA 2PBEA 4AT7A 4F8RA 4RWQA 3OVSA 5KFMA 4UQGA 8ICTA 4YVZA 4B9LA 4KLFA 1QSLA 4R66A 8ICJA 9ICKA 1DK2A 3Q8KA 4DF8A 4ELVA 3C21A 2ZH8A 4RQ1A 2UVRA 3V6KA 2LYHA 2NRVA 1NJYA 3L9DA 3JPSA 4UBBA 1RYSA 3H37A 1SL2A 3H4DA 1H38A 1KLNA 2H5XA 1ZQQA 1BVSA 5J2FA 4F5QA 3TAQA 4R63A 2NRKA 4AT9A 4FHWA 2AQ4A 1TAUA 1MC8A 2DFLA 3PW7A 4ECXA 4B9MA 9ICQA 5KFJA 2KN7A 8ICLA 4JV0A 4QZ8A 3H8WA 1ZQNA 4F93B 4RNMA 4DSEA 1D9FA 4M9GA 9ICOA 3THVA 1U9LA 5DB8A 4JK1A 4M9JA 2DR8A 3TI0A 5CB1A 8ICAA 1T7PA 3JPPA 4KN7A 5J0OA 4X4SA 3WFSC 3OHBA 1DK3A 4DSLA 4RT3A 2XY6A 4LVSA 5KFFA 3HIYA 4MFFA 4CCHA 2BCVA 3H8JA 4FHVA 1ZQZA 5KT4A 8ICFA 2HHVA 4QZFA 2XCPA 3KHGA 2DVIA 3C1YA 5D49A 2FPLA 3PW4A 2IMWP 4YQWA 4O3NA 4BXOA 2W9BA 1T4GA 1X2IA 4M9NA 2R8IA 1U45A 2DR7A 5J2HA 4LZDA 2ZH2A 3MGIA 1TV9A 4KLDA 9ICSA 5HRLA 5KFEA 1F5AA 1R8BA 1V9PA 5CR0A 4F91B 4P4PA 4F5OA 1FA0A 4RPZA 3MBYA 3PX4A 1NK0A 1VFGA 4AT7B 9ICUA 4B9UA 2JEFA 5HC9A 5J0SA 5CHGA 5J2JA 4F4ZA 1K1QA 4QWBA 1R89A 3EZ5A 1DOQA 4PH5A 3EYZA 2BDPA 4J9RA 2O5AA 2UVUA 5J0RA 5KT5A 1LV5A 1L3TA 4NLGA 4X4NA 3SYZA 3FYHA 5HMLA 1NK6A 5KFUA 1NK5A 4RT2A 5DG8A 4RUCA 1TKDA 1BPZA 3MR6A 4PGYA 2ZH9A 5J0PA 7ICTA 1UT8A 9ICRA 4C8NA 5KG5A 5HR9A 4J9NA 4R64A 2BQRA 1VJ7A 9ICFA 1L3VA 4QWDA 5J0WA 4DSKA 8ICNA 4C8LA 2BR0A 4P2HA 3HPOA 1Q79A 3C2LA 4UB3A 9ICWA 3QZ8A 1ZQXA 1Q78A 4I2HA 5IINA 5IIKA 4J9MA 5CP2A 2R8GA 5DGBA 4E0DA 4RPYA 4JUZA 3RJKA 9ICHA 1RZTA 4DS5A 2PFQA 4PHEA 5DDYA 5JUMA 4DQRA 4YXMA 1ZQVA 5KT6A 2ASDA 2HW3A 4M04A 4EYIB 4BXOB 4O5CA 3UXOA 4NLNA 5IIMA 3C18A 4UBCA 1DGSA 2XGPA 5L9XA 3T3FA 3UPQA 2AGPA 5HMMA 2BQ3A 4QZEA 1BPBA 1KSPA 1ZQEA 2J6SA 7ICMA 4TURA 5KFVA 1MQ3A 3PR4A 2Y1IA 4I29A 5DBBA 1U47A 4M47A 8ICHA 4KMUA 2OWOA 8ICWA 2W8KA 3C5FA 8ICIA 4KLIA 3H38A 3B0YA 4YG2A 4ECWA 4RQ3A 3GIJA 4ED6A 4O5KA 3T5JA 8ICCA 4WC3A 4IR1A 3EPGA 3G6YA 4RNNA 2ZH3A 4RWNA 1BPYA 2M2VA 1ZQMA 2V9WA 9ICGA 2ZHBA 4UD4A 1UEVA 2DRAA 1TAQA 3HX0A 2PI4A 1XSLA 1ZYQA 1HUOA 4Q44A 8ICQA 2HVHA 3E2EA 3AQMA 4QW8A 4TUPA 3T5KA 3Q8MA 1KFSA 2I9GA 4LT6A 4AT8B 2ZUCA 1NJWA 9ICJA 1UEUA 3H39A 5L1JA 4X4QA 2HHQA 5KFQA 4EBJA 2J6UA 5DECA 5D46A 4FS2A 3IM1A 4J9SA 4O9MA 4ECSA 5KFPA 1ZQPA 5HP4A 3M9NB 5DDMA 4Z6CA 2AU0A 2C28A 2BQUA 1ZQSA 4DOBA 4RUAA 2ATLA 3SI8A 2A1JA 1ZQWA 5J2BA 4DS4A 2BGWA 3RRHA 4ED0A 1XWLA 3WFPA 3OV7A 5J2EA 3RH5A 3PO4A 2ZH4A 3MFIA 2ISOA 7ICEA 3UQ2A 4ECVA 2R8KA 4RQ0A 3BQ0A 4ZH4A 3ZD9A 4B9TA 5HRHA 4I27A 3RJEA 2ZTEA 2Q0ZX 4I2IA 4Z6EA 2KZZA 7ICQA 4DEZA 7ICSA 5F2VO 4IQVA 4I2FA 1RXWA 2ZH1A 7ICLA 2HHPA 3LK9A 4ECYA 3C66A 1RYRA 3MDCA 4ED8A 3C1ZA 1XO1A 2V4RA 1NK7A 2KFZA 4PHPA 3JPRA 4RWPA 5KFKA 9ICVA 4F5NA 5KFHA 2MUTA 4NLKA 1B43A 3EPIA 5KFDA 1K1SA 3RAQA 2FMPA 3H3AA 4X4VA 1A76A 4F2SA 1R8CA 5DLGA 4TQRA 3ISCA 4KN4A 5KFAA 4NM2A 4DSJA 4I2EA 4O3RA 4ECUA 3BQTA 4GLXA 5KTQA 4ED3A 4HYKA 3EW9A 4YP3A 2JEIA 4I2AA 5DG9A 2PFNA 2PFPA 5DKWA 3PX0A 4R8UA 7ICKA 3ISBA 3QEBZ 4X4RA 5J0TA 1U49A 3NYBA 1NK9A 2Q66A 3BDPA 4IRDA 3V6HA 2FPKA 5KFGA 3UXPA 4X0BA 1ZQBA 1ZJNA 3RJHA 2ASJA 2JZBA 5KG6A 2PFOA 5KG2A 5J0XA 4TUSA 3RBDA 3BQ1A 1MSWD 5DG7A 3JPTA 2DRBA 4DL2A 4J9OA 4MEXA 3RB4A 4UAWA 5F9LA 1KTQA 4LZGA 3KTQA 4JV1A 4M9HA 4DL4A 5DQGA 2ZH5A 4MFCA 1D9DA 4DL3A 4E8FA 5DBAA 3PX6A 3TARA 3RH4A 3GFKB 2HHSA 8ICVA 2V4QA 2AGQA 3AU2A 3RB0A 4NM1A 4ATBA 4S3NA 2RDIA 3ZD8A 3OVBA 3C5GA 2ALZA 1TK0A 4DQSA 4WBZA 4KLSA 2PI5A 1YLQA 1PX5A 2FMQA 4DFJA 5J2AA 4YR2A 4DOCA 2KFNA 5DQIA 3ZDDA 2HHXA 3PMNA 5HHIA 4XRHA 3RRGA 3OUYA 3NGDA 4DSIA 3K75D 4WC5A 4XA5A 3AQKA 4IG8A 3Q8RB 4YCXA 1BPEA 1NKEA 3TANA 1U4BA 5KFYA 4AT9B 5KFBA 1XU4A 5KG1A 2HVIA 5L1IA 4RNOA 1PZNA 4QWEA 2VA8A 1L5UA 2JEGA 1Z3EB 2P6UA 3M9OB 8ICSA 4WC2A 1ZQLA 3BJYA 7ICIA 2XGQA 1U48A 5CA7A 5KFWA 2XCAA 4DFMA 8ICOA 2NRWA 4O3QA 3M9MB 3AU6A 3MR2A 1MQ2A 5DB6A 2ZJAA 3WFRE 1UA0A 3ISDA 2P66A 3GV7B 2JZBB 1NJZA 5HRFA 4QZ9A 4QZBA 5D4BA 3PO5A 4M6WA 1KFTA 3WFOA 1UETA 4F4XA 4KLTA 7ICNA 3HP6A 4QZCA 3RJGA 3JPQA 5IIOA 4QZIA 3RJIA 4F2RA 2W9BB 1X9SA 1S97A 5HRKA 1Z00A 3TFSA 1S76D 1EXNA 1NKBA 4F3OA 8ICGA 4FHYA 4I2JA 3RJFA 3JYYA 3KHRA 3SV4A 4DQIA 3K4GA 4RQ4A 4ATBB 4BWJA 1SKWA 5DLFA 1JMSA 4WC6A 3T5LA 4FBTA 5J2CA 1X9MA 2F1IA 4Q8EA 9ICIA 3GILA 7ICFA 1B22A 4YR0A 4WC7A 4Q45A 1S10A 4EBCA 4GC6A 5KFNA 9ICEA 3RH6A 2C22A 3LQCB 5BPCA 4YR3A 3HWTA 2AJQA 8ICPA 5DB9A 7ICHA 3OUYB 1HJPA 1CEZA 4QZAA 4QZDA 1JIHA 1ZQHA 2P6RA 3G6XA 4I2BA 1SL1A 4I2GA 3JPOA 3MR5A 5DGAA 1BPXA 7ICJA 9ICLA 4F92B 3SZ2A 2DPJA 2PXIA 2BE3A 3OVAA 4MF2A 4NKTA 5DQHA 2RDJA 3Q8SB 3OHAA 1L3UA 4RWOA 1XSNA 1ZQGA 1MIVA 2ISPA 4QZGA 4DL7A 4GXJA 2XO7A 4GC7A 5KFOA 3M8SA 3GV5B 4M6WB 1NO5A 5J2KA 4QWCA 3KHHA 4I2CA 4KLQA 3UPSA 4DF4A 3GDXA 2IA6A 1TVAA 5HREA 2BPCA 3GIKA 4FBUA 1JXEA 3V7JA 5EOZA 1S0VA 9ICTA 1TFWA 1KDHA 3H4BA 1QTMA 1BGXT 4KLOA 4WC4A 1Z00B 4NLZA 3RR8A 4DQQA 1S0OA 3PV8A 3RB3A 2DPIA 4BDPA 8ICUA 5J29A 4MFAA 2C2RA 3PR5B 2FLLA 4K4HA 4ED2A 4RPXA 4F5PA 3LDAA 1JQRA 4FH3A 3TAPA 1KEJA 5IIIA 1NK8A 4FH5A 5EWEA 1T3NA 5DB7A 2B21A 4TQSA 2IBKA 4DLGA 4KLMA 4RU9A 3PW0A 4RQ5A 2AQ0A 4DWIA 2FLNA 4XQ7A 3RBEA 3PMLA 5J0YA 4F50A 2DR9A 4EBEA 3QE9Y 1UT5A 3H7IA 4XQ8A 5KFLA 1UA1A 2BCQA 4X4UA 2M9NA 4O3OA 4J9KA 4BWMA 4UAZA 2HHUA 4ELUA 3WFQE 2R8HA 1ZQYA 4FS1A 4Z6FA 3FDSA 3UQ0A 4ECTA 1TK8A 1C7YA 3RJJA 1D8YA 3N4MB 4PPXA 3RAXA 3ETLA 4O3SA 2IHMA 1WCNA 3MGHA 4E7XA 1JX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DED A;  2M2W A;  4Z6D A;  1ZJM A;  4IQW A;  2A1J B;  4GXK A;  4YMN A;  4FO6 A;  1CUK A;  1XS9 D;  2FMS A;  3GII A;  1ZQI A;  8ICB A;  4E80 A;  3JPN A;  7ICR A;  7ICG A;  7ICU A;  5J0U A;  3OSN A;  4X5V A;  2BCS A;  4IRC A;  3ZDE A;  1S0N A;  2M2U A;  3MAB A;  2ZTD A;  5HRI A;  3LWM A;  2ZTC A;  4MEY A;  5BOM A;  4WBY A;  1KNY A;  3OJU A;  3ORY A;  5CWR A;  1ZQO A;  3ZDC A;  1TFR A;  1TFY A;  5KG0 A;  2O1P A;  1QSY A;  3PY8 A;  4X0A A;  3SV3 A;  4IQU A;  2ASL A;  9ICM A;  3V72 A;  1NKC A;  4RQ6 A;  4PGQ A;  2MUT B;  5IIJ A;  5TZV A;  3T5H A;  3ZDB A;  1OU5 A;  1SKS A;  2UVW A;  2VA2 A;  4YD1 A;  4PHD A;  4YFK A;  4YMO A;  1S77 D;  3V6J A;  5EWG A;  4F4Y A;  3Q8P B;  5HRG A;  1L3S A;  3PVX A;  2W9C A;  2HHW A;  2BCR A;  4EBK A;  2ZJ8 A;  3ZDA A;  2XC9 A;  4Q43 A;  1KFD A;  4DO9 A;  4RQ7 A;  4DOA A;  4UAY A;  1HUZ A;  4EZ6 A;  4JWN A;  4P4O A;  3RB6 A;  4WCW A;  2BHN A;  3RR7 A;  2NRT A;  2KTQ A;  4GXI A;  4R8U B;  9ICX A;  4AT8 A;  2KZ3 A;  4R65 A;  2ZJ5 A;  4QWA A;  3OJS A;  2C2D A;  1T8E A;  4B9S A;  2MAX A;  4IR9 A;  5KT7 A;  2BPG A;  1QSS A;  1NK4 A;  1N48 A;  2M2T A;  2ZUB A;  5C5J A;  3QEA Z;  2IHN A;  4UD5 A;  4JWM A;  2GWS A;  5J2D A;  5L1L A;  3TQ1 A;  8ICR A;  4ECZ A;  5KT2 A;  3OSP A;  4C8K A;  4B9N A;  4KLE A;  1SL0 A;  4EP7 A;  4J9Q A;  1ZQC A;  2F1J A;  3V7K A;  4J9P A;  4X4T A;  5KG4 A;  2ZHA A;  4YD2 A;  4DSF A;  4I28 A;  4TUQ A;  1NJX A;  3AQN A;  4YMM A;  1MIW A;  4PHA A;  4P4M A;  3M8R A;  3G6V A;  1Y88 A;  2W9A A;  4KTQ A;  4UB1 A;  5HNK A;  3C2K A;  3MR3 A;  4M9L A;  2C2E A;  5HHH A;  4WC1 A;  3LWL A;  8ICM A;  2UVV A;  1NZP A;  4KIT B;  4MF8 A;  5KFC A;  4DL5 A;  3PW5 A;  2BCU A;  4EZ9 A;  3HW8 A;  2I1Q A;  2FPM A;  8ICX A;  4WC0 A;  3B0X A;  4B9V A;  1RPL A;  3TFR A;  2AGO A;  1XC9 A;  4UB5 A;  3AQL A;  5KFI A;  2WTF A;  1JXL A;  4PGX A;  4YXJ A;  3V7L A;  5HRD A;  4FHX A;  4M5D A;  2NRZ A;  1A77 A;  3UXN A;  5DBC A;  4QZH A;  3AUO A;  1ZQT A;  2BPF A;  4K4I A;  4UB2 A;  8ICE A;  1ZQU A;  3MDA A;  5KFR A;  5J2G A;  1LB2 B;  4M2Y A;  1QLN A;  1IXR A;  5KFZ A;  2RFF A;  4FHP A;  1ARO P;  3C23 A;  4DFK A;  3RTV A;  8ICK A;  9ICB A;  2W9C B;  2W8L A;  2KZM A;  4YN4 A;  2BKE A;  5EWF A;  1V4A A;  3BQ2 A;  4IQT A;  8ICY A;  2DR5 A;  4EEY A;  4J9L A;  1SZP A;  4ECQ A;  1ZQA A;  2HHT A;  2ZUD A;  1BPD A;  4ED1 A;  4G3I A;  4DFP A;  4NY8 A;  1WOT A;  5KFS A;  5KG3 A;  2FLP A;  4EBD A;  3HT3 A;  1ZET A;  3OGU A;  2J6T A;  4RQ8 A;  2VA3 A;  5J0Q A;  4F5R A;  4KLL A;  1S9F A;  1WCL A;  2NRX A;  3Q8Q B;  1COO A;  3GQC A;  4ECR A;  5J2I A;  4X4O A;  4EYH B;  5IIL A;  2R8J A;  3N97 B;  1IM4 A;  2KP7 A;  4O0I A;  2JEJ A;  4RZR A;  9ICA A;  9ICN A;  4NKU A;  1NOM A;  3H40 A;  5KG7 A;  4F4W A;  4UB4 A;  1XSP A;  7ICP A;  2ZH6 A;  4XUS A;  4C8M A;  9ICP A;  3C2M A;  2ZH7 A;  5F9N A;  3IHQ B;  3EWA A;  5CJ7 A;  1S0M A;  4F4K A;  4O5E A;  2W9M A;  4DQP A;  4ELT A;  7ICV A;  2F1H A;  1X9W A;  5KT3 A;  4C8O A;  2XY5 A;  5KFX A;  1SKR A;  4JV2 A;  1JAJ A;  4DL6 A;  4KLJ A;  3NTU A;  4Q8F A;  3GIM A;  2XY7 A;  4I2D A;  1ZQD A;  1ZQF A;  3GV8 B;  4NXZ A;  4IRK A;  4K4G A;  3PW2 A;  4ED7 A;  4O3P A;  3Q8L A;  5KFT A;  1N56 A;  1ZQR A;  1ZQK A;  4KLU A;  9ICC A;  3HJ1 A;  4M0A A;  5BOL A;  1MIY A;  4KLH A;  1BNP A;  5L1K A;  3MFH A;  1BNO A;  4X4P A;  2VAN A;  4KLG A;  5HRB A;  1JN3 A;  4QW9 A;  7ICO A;  3KHL A;  2Y1J A;  1KRP A;  2ID1 A;  3HJ4 A;  1ZQJ A;  4DLE A;  3H8S A;  3PNC A;  4RQ2 A;  8ICZ A;  1TK5 A;  4BGD A;  1R8A A;  1RXV A;  3QZ7 A;  3JZ0 A;  1D8L A;  2PBE A;  4AT7 A;  4F8R A;  4RWQ A;  3OVS A;  5KFM A;  4UQG A;  8ICT A;  4YVZ A;  4B9L A;  4KLF A;  1QSL A;  4R66 A;  8ICJ A;  9ICK A;  1DK2 A;  3Q8K A;  4DF8 A;  4ELV A;  3C21 A;  2ZH8 A;  4RQ1 A;  2UVR A;  3V6K A;  2LYH A;  2NRV A;  1NJY A;  3L9D A;  3JPS A;  4UBB A;  1RYS A;  3H37 A;  1SL2 A;  3H4D A;  1H38 A;  1KLN A;  2H5X A;  1ZQQ A;  1BVS A;  5J2F A;  4F5Q A;  3TAQ A;  4R63 A;  2NRK A;  4AT9 A;  4FHW A;  2AQ4 A;  1TAU A;  1MC8 A;  2DFL A;  3PW7 A;  4ECX A;  4B9M A;  9ICQ A;  5KFJ A;  2KN7 A;  8ICL A;  4JV0 A;  4QZ8 A;  3H8W A;  1ZQN A;  4F93 B;  4RNM A;  4DSE A;  1D9F A;  4M9G A;  9ICO A;  3THV A;  1U9L A;  5DB8 A;  4JK1 A;  4M9J A;  2DR8 A;  3TI0 A;  5CB1 A;  8ICA A;  1T7P A;  3JPP A;  4KN7 A;  5J0O A;  4X4S A;  3WFS C;  3OHB A;  1DK3 A;  4DSL A;  4RT3 A;  2XY6 A;  4LVS A;  5KFF A;  3HIY A;  4MFF A;  4CCH A;  2BCV A;  3H8J A;  4FHV A;  1ZQZ A;  5KT4 A;  8ICF A;  2HHV A;  4QZF A;  2XCP A;  3KHG A;  2DVI A;  3C1Y A;  5D49 A;  2FPL A;  3PW4 A;  2IMW P;  4YQW A;  4O3N A;  4BXO A;  2W9B A;  1T4G A;  1X2I A;  4M9N A;  2R8I A;  1U45 A;  2DR7 A;  5J2H A;  4LZD A;  2ZH2 A;  3MGI A;  1TV9 A;  4KLD A;  9ICS A;  5HRL A;  5KFE A;  1F5A A;  1R8B A;  1V9P A;  5CR0 A;  4F91 B;  4P4P A;  4F5O A;  1FA0 A;  4RPZ A;  3MBY A;  3PX4 A;  1NK0 A;  1VFG A;  4AT7 B;  9ICU A;  4B9U A;  2JEF A;  5HC9 A;  5J0S A;  5CHG A;  5J2J A;  4F4Z A;  1K1Q A;  4QWB A;  1R89 A;  3EZ5 A;  1DOQ A;  4PH5 A;  3EYZ A;  2BDP A;  4J9R A;  2O5A A;  2UVU A;  5J0R A;  5KT5 A;  1LV5 A;  1L3T A;  4NLG A;  4X4N A;  3SYZ A;  3FYH A;  5HML A;  1NK6 A;  5KFU A;  1NK5 A;  4RT2 A;  5DG8 A;  4RUC A;  1TKD A;  1BPZ A;  3MR6 A;  4PGY A;  2ZH9 A;  5J0P A;  7ICT A;  1UT8 A;  9ICR A;  4C8N A;  5KG5 A;  5HR9 A;  4J9N A;  4R64 A;  2BQR A;  1VJ7 A;  9ICF A;  1L3V A;  4QWD A;  5J0W A;  4DSK A;  8ICN A;  4C8L A;  2BR0 A;  4P2H A;  3HPO A;  1Q79 A;  3C2L A;  4UB3 A;  9ICW A;  3QZ8 A;  1ZQX A;  1Q78 A;  4I2H A;  5IIN A;  5IIK A;  4J9M A;  5CP2 A;  2R8G A;  5DGB A;  4E0D A;  4RPY A;  4JUZ A;  3RJK A;  9ICH A;  1RZT A;  4DS5 A;  2PFQ A;  4PHE A;  5DDY A;  5JUM A;  4DQR A;  4YXM A;  1ZQV A;  5KT6 A;  2ASD A;  2HW3 A;  4M04 A;  4EYI B;  4BXO B;  4O5C A;  3UXO A;  4NLN A;  5IIM A;  3C18 A;  4UBC A;  1DGS A;  2XGP A;  5L9X A;  3T3F A;  3UPQ A;  2AGP A;  5HMM A;  2BQ3 A;  4QZE A;  1BPB A;  1KSP A;  1ZQE A;  2J6S A;  7ICM A;  4TUR A;  5KFV A;  1MQ3 A;  3PR4 A;  2Y1I A;  4I29 A;  5DBB A;  1U47 A;  4M47 A;  8ICH A;  4KMU A;  2OWO A;  8ICW A;  2W8K A;  3C5F A;  8ICI A;  4KLI A;  3H38 A;  3B0Y A;  4YG2 A;  4ECW A;  4RQ3 A;  3GIJ A;  4ED6 A;  4O5K A;  3T5J A;  8ICC A;  4WC3 A;  4IR1 A;  3EPG A;  3G6Y A;  4RNN A;  2ZH3 A;  4RWN A;  1BPY A;  2M2V A;  1ZQM A;  2V9W A;  9ICG A;  2ZHB A;  4UD4 A;  1UEV A;  2DRA A;  1TAQ A;  3HX0 A;  2PI4 A;  1XSL A;  1ZYQ A;  1HUO A;  4Q44 A;  8ICQ A;  2HVH A;  3E2E A;  3AQM A;  4QW8 A;  4TUP A;  3T5K A;  3Q8M A;  1KFS A;  2I9G A;  4LT6 A;  4AT8 B;  2ZUC A;  1NJW A;  9ICJ A;  1UEU A;  3H39 A;  5L1J A;  4X4Q A;  2HHQ A;  5KFQ A;  4EBJ A;  2J6U A;  5DEC A;  5D46 A;  4FS2 A;  3IM1 A;  4J9S A;  4O9M A;  4ECS A;  5KFP A;  1ZQP A;  5HP4 A;  3M9N B;  5DDM A;  4Z6C A;  2AU0 A;  2C28 A;  2BQU A;  1ZQS A;  4DOB A;  4RUA A;  2ATL A;  3SI8 A;  2A1J A;  1ZQW A;  5J2B A;  4DS4 A;  2BGW A;  3RRH A;  4ED0 A;  1XWL A;  3WFP A;  3OV7 A;  5J2E A;  3RH5 A;  3PO4 A;  2ZH4 A;  3MFI A;  2ISO A;  7ICE A;  3UQ2 A;  4ECV A;  2R8K A;  4RQ0 A;  3BQ0 A;  4ZH4 A;  3ZD9 A;  4B9T A;  5HRH A;  4I27 A;  3RJE A;  2ZTE A;  2Q0Z X;  4I2I A;  4Z6E A;  2KZZ A;  7ICQ A;  4DEZ A;  7ICS A;  5F2V O;  4IQV A;  4I2F A;  1RXW A;  2ZH1 A;  7ICL A;  2HHP A;  3LK9 A;  4ECY A;  3C66 A;  1RYR A;  3MDC A;  4ED8 A;  3C1Z A;  1XO1 A;  2V4R A;  1NK7 A;  2KFZ A;  4PHP A;  3JPR A;  4RWP A;  5KFK A;  9ICV A;  4F5N A;  5KFH A;  2MUT A;  4NLK A;  1B43 A;  3EPI A;  5KFD A;  1K1S A;  3RAQ A;  2FMP A;  3H3A A;  4X4V A;  1A76 A;  4F2S A;  1R8C A;  5DLG A;  4TQR A;  3ISC A;  4KN4 A;  5KFA A;  4NM2 A;  4DSJ A;  4I2E A;  4O3R A;  4ECU A;  3BQT A;  4GLX A;  5KTQ A;  4ED3 A;  4HYK A;  3EW9 A;  4YP3 A;  2JEI A;  4I2A A;  5DG9 A;  2PFN A;  2PFP A;  5DKW A;  3PX0 A;  4R8U A;  7ICK A;  3ISB A;  3QEB Z;  4X4R A;  5J0T A;  1U49 A;  3NYB A;  1NK9 A;  2Q66 A;  3BDP A;  4IRD A;  3V6H A;  2FPK A;  5KFG A;  3UXP A;  4X0B A;  1ZQB A;  1ZJN A;  3RJH A;  2ASJ A;  2JZB A;  5KG6 A;  2PFO A;  5KG2 A;  5J0X A;  4TUS A;  3RBD A;  3BQ1 A;  1MSW D;  5DG7 A;  3JPT A;  2DRB A;  4DL2 A;  4J9O A;  4MEX A;  3RB4 A;  4UAW A;  5F9L A;  1KTQ A;  4LZG A;  3KTQ A;  4JV1 A;  4M9H A;  4DL4 A;  5DQG A;  2ZH5 A;  4MFC A;  1D9D A;  4DL3 A;  4E8F A;  5DBA A;  3PX6 A;  3TAR A;  3RH4 A;  3GFK B;  2HHS A;  8ICV A;  2V4Q A;  2AGQ A;  3AU2 A;  3RB0 A;  4NM1 A;  4ATB A;  4S3N A;  2RDI A;  3ZD8 A;  3OVB A;  3C5G A;  2ALZ A;  1TK0 A;  4DQS A;  4WBZ A;  4KLS A;  2PI5 A;  1YLQ A;  1PX5 A;  2FMQ A;  4DFJ A;  5J2A A;  4YR2 A;  4DOC A;  2KFN A;  5DQI A;  3ZDD A;  2HHX A;  3PMN A;  5HHI A;  4XRH A;  3RRG A;  3OUY A;  3NGD A;  4DSI A;  3K75 D;  4WC5 A;  4XA5 A;  3AQK A;  4IG8 A;  3Q8R B;  4YCX A;  1BPE A;  1NKE A;  3TAN A;  1U4B A;  5KFY A;  4AT9 B;  5KFB A;  1XU4 A;  5KG1 A;  2HVI A;  5L1I A;  4RNO A;  1PZN A;  4QWE A;  2VA8 A;  1L5U A;  2JEG A;  1Z3E B;  2P6U A;  3M9O B;  8ICS A;  4WC2 A;  1ZQL A;  3BJY A;  7ICI A;  2XGQ A;  1U48 A;  5CA7 A;  5KFW A;  2XCA A;  4DFM A;  8ICO A;  2NRW A;  4O3Q A;  3M9M B;  3AU6 A;  3MR2 A;  1MQ2 A;  5DB6 A;  2ZJA A;  3WFR E;  1UA0 A;  3ISD A;  2P66 A;  3GV7 B;  2JZB B;  1NJZ A;  5HRF A;  4QZ9 A;  4QZB A;  5D4B A;  3PO5 A;  4M6W A;  1KFT A;  3WFO A;  1UET A;  4F4X A;  4KLT A;  7ICN A;  3HP6 A;  4QZC A;  3RJG A;  3JPQ A;  5IIO A;  4QZI A;  3RJI A;  4F2R A;  2W9B B;  1X9S A;  1S97 A;  5HRK A;  1Z00 A;  3TFS A;  1S76 D;  1EXN A;  1NKB A;  4F3O A;  8ICG A;  4FHY A;  4I2J A;  3RJF A;  3JYY A;  3KHR A;  3SV4 A;  4DQI A;  3K4G A;  4RQ4 A;  4ATB B;  4BWJ A;  1SKW A;  5DLF A;  1JMS A;  4WC6 A;  3T5L A;  4FBT A;  5J2C A;  1X9M A;  2F1I A;  4Q8E A;  9ICI A;  3GIL A;  7ICF A;  1B22 A;  4YR0 A;  4WC7 A;  4Q45 A;  1S10 A;  4EBC A;  4GC6 A;  5KFN A;  9ICE A;  3RH6 A;  2C22 A;  3LQC B;  5BPC A;  4YR3 A;  3HWT A;  2AJQ A;  8ICP A;  5DB9 A;  7ICH A;  3OUY B;  1HJP A;  1CEZ A;  4QZA A;  4QZD A;  1JIH A;  1ZQH A;  2P6R A;  3G6X A;  4I2B A;  1SL1 A;  4I2G A;  3JPO A;  3MR5 A;  5DGA A;  1BPX A;  7ICJ A;  9ICL A;  4F92 B;  3SZ2 A;  2DPJ A;  2PXI A;  2BE3 A;  3OVA A;  4MF2 A;  4NKT A;  5DQH A;  2RDJ A;  3Q8S B;  3OHA A;  1L3U A;  4RWO A;  1XSN A;  1ZQG A;  1MIV A;  2ISP A;  4QZG A;  4DL7 A;  4GXJ A;  2XO7 A;  4GC7 A;  5KFO A;  3M8S A;  3GV5 B;  4M6W B;  1NO5 A;  5J2K A;  4QWC A;  3KHH A;  4I2C A;  4KLQ A;  3UPS A;  4DF4 A;  3GDX A;  2IA6 A;  1TVA A;  5HRE A;  2BPC A;  3GIK A;  4FBU A;  1JXE A;  3V7J A;  5EOZ A;  1S0V A;  9ICT A;  1TFW A;  1KDH A;  3H4B A;  1QTM A;  1BGX T;  4KLO A;  4WC4 A;  1Z00 B;  4NLZ A;  3RR8 A;  4DQQ A;  1S0O A;  3PV8 A;  3RB3 A;  2DPI A;  4BDP A;  8ICU A;  5J29 A;  4MFA A;  2C2R A;  3PR5 B;  2FLL A;  4K4H A;  4ED2 A;  4RPX A;  4F5P A;  3LDA A;  1JQR A;  4FH3 A;  3TAP A;  1KEJ A;  5III A;  1NK8 A;  4FH5 A;  5EWE A;  1T3N A;  5DB7 A;  2B21 A;  4TQS A;  2IBK A;  4DLG A;  4KLM A;  4RU9 A;  3PW0 A;  4RQ5 A;  2AQ0 A;  4DWI A;  2FLN A;  4XQ7 A;  3RBE A;  3PML A;  5J0Y A;  4F50 A;  2DR9 A;  4EBE A;  3QE9 Y;  1UT5 A;  3H7I A;  4XQ8 A;  5KFL A;  1UA1 A;  2BCQ A;  4X4U A;  2M9N A;  4O3O A;  4J9K A;  4BWM A;  4UAZ A;  2HHU A;  4ELU A;  3WFQ E;  2R8H A;  1ZQY A;  4FS1 A;  4Z6F A;  3FDS A;  3UQ0 A;  4ECT A;  1TK8 A;  1C7Y A;  3RJJ A;  1D8Y A;  3N4M B;  4PPX A;  3RAX A;  3ETL A;  4O3S A;  2IHM A;  1WCN A;  3MGH A;  4E7X A;  1JX4 A; 
#chains in the Genus database with same CATH topology
 2KJ5 A;  5DED A;  2M2W A;  4Z6D A;  4IQW A;  1D8B A;  2FMS A;  8ICB A;  5D62 A;  5J0U A;  3OSN A;  4IRC A;  1RQN A;  2M2U A;  3KOO A;  4AYB F;  4MEY A;  2YMM A;  1ZQO A;  1SB3 C;  2W03 A;  5KG0 A;  4X0A A;  4IQU A;  2ASL A;  9ICM A;  3NVW A;  1NKC A;  4RQ6 A;  4PGQ A;  1MN8 A;  2ZIU A;  1QQ5 A;  1OU5 A;  2UVW A;  1N60 A;  2VA2 A;  3ED5 A;  1S77 D;  5AKL A;  2DL0 A;  4F4Y A;  1C20 A;  2W9C A;  2BCR A;  2ZJ8 A;  4Y2R A;  2XC9 A;  4Q43 A;  4DO9 A;  1HUZ A;  4JWN A;  4UAY A;  2KTQ A;  4GXI A;  1T94 A;  9ICX A;  2C2D A;  4QWA A;  1T8E A;  4IR9 A;  4WH5 A;  2ZUB A;  5C5J A;  3QEA Z;  4C7Y A;  5GTH U;  3OSP A;  5ALP A;  4DFD A;  4YD2 A;  3F5E A;  4PHA A;  1Y88 A;  2W9A A;  5AKE A;  8ICM A;  1NZP A;  4EX7 A;  4MF8 A;  5KFC A;  3CP8 A;  2DF4 B;  2Y9T A;  3B0X A;  2KVC A;  2KSO A;  3MC1 A;  4YXJ A;  2G08 A;  4FHX A;  3TKA A;  5DBC A;  3SAH A;  2BPF A;  1ZQU A;  4M2Y A;  4FHP A;  2W7P A;  1ARO P;  2WHE A;  2JH1 A;  3M6K A;  2BKE A;  1V4A A;  4IQT A;  4EEY A;  1SZP A;  4ECQ A;  2HHT A;  1BPD A;  5AKK A;  4EBD A;  3GU3 A;  4OJO A;  3GQC A;  2XVT A;  5J2I A;  3SEI A;  4EEK A;  1IV8 A;  5ALN A;  2JEJ A;  1LVH A;  5AKG A;  1SXD A;  5EE0 A;  4NJ8 A;  5AM5 A;  3H40 A;  5CEH A;  4EGW A;  5H2F U;  4F4W A;  4XUS A;  2ZIV B;  2W9M A;  1PK1 B;  5KFX A;  4DL6 A;  4KLJ A;  4Q8F A;  3GIM A;  2XY7 A;  4NXZ A;  4K4G A;  4ED7 A;  4O3P A;  1ZQR A;  1ZQK A;  4OJ6 A;  2W43 A;  4M0A A;  2K4I A;  2VAN A;  1ZRN A;  1O08 A;  3KKA C;  1R8A A;  4DLE A;  8ICZ A;  4KM5 A;  2HCF A;  2YY6 A;  3JZ0 A;  8ICT A;  2Q4T A;  4OD0 A;  5AK4 A;  4YVZ A;  4KLF A;  1QSL A;  2DBY A;  2LYH A;  3L9D A;  4UAT A;  1A6S A;  2F44 A;  1RYS A;  3H37 A;  1KLN A;  2G5H B;  4F5Q A;  4R63 A;  4FHW A;  2AQ4 A;  4FHY A;  9ICQ A;  1DGJ A;  4F93 B;  4Y2Q A;  4RNM A;  4C0Z A;  4JK1 A;  2DR8 A;  4X4S A;  3NRW A;  4MFF A;  2HHV A;  1S5L U;  2E1E A;  2FPL A;  1CRX A;  3I28 A;  3K7D A;  2DR7 A;  2ZH2 A;  9ICS A;  4KLD A;  3HKZ F;  1ZQ1 C;  4B9U A;  2E8O A;  1X6I A;  4QWB A;  1DOQ A;  2BDP A;  5J0R A;  2EZY A;  5FP0 A;  4U6P A;  4Y2U A;  3SYZ A;  4O68 A;  1TKD A;  1GO3 F;  3SAF A;  4WJ3 B;  2ZH9 A;  7ICT A;  1UT8 A;  1PVP A;  9ICR A;  5HR9 A;  5KG5 A;  2IOF K;  4J9N A;  3WK8 A;  1VJ7 A;  9ICF A;  1VDV A;  5J0W A;  5ALZ A;  1QCK A;  2FE9 A;  4J9M A;  5CP2 A;  2D3D A;  4JUZ A;  3UMC A;  9ICH A;  1RZT A;  4PHE A;  5DDY A;  5JUM A;  4M04 A;  4BXO B;  3UXO A;  4O67 A;  3DV9 A;  3NS1 A;  5IIM A;  3C18 A;  4UBC A;  3T3F A;  2BQ3 A;  5HMM A;  2J6S A;  4QZE A;  1KSP A;  1KNY A;  4M47 A;  5DBB A;  2QAR B;  3B0Y A;  5ALF A;  4ED6 A;  4OJP A;  4IR1 A;  2ZH3 A;  1BPY A;  2V9W A;  3HX0 A;  8ICQ A;  4TUP A;  2VJ4 A;  3Q8M A;  4NXX A;  1KFS A;  5AIB A;  4CF4 A;  3H39 A;  3C28 A;  4FS2 A;  4O9M A;  4ECS A;  2WB1 C;  1ZQS A;  2BQU A;  2C28 A;  3QU2 A;  4K97 A;  2W3R A;  3SI8 A;  3KKA A;  4DS4 A;  3RRH A;  3WFP A;  3CW2 C;  2ISO A;  2AHO B;  1T3Q A;  2LYB A;  1RXW A;  7ICL A;  4ECY A;  5ALY A;  3C1Z A;  2V4R A;  2KFZ A;  1WWU A;  3JPR A;  5ALD A;  1ZD4 A;  1ZD5 A;  2MUT A;  2Y0S C;  4Y2V A;  3TAD A;  2KIW A;  3VCB A;  4F2S A;  1V38 A;  4Y2T A;  2HBJ A;  5AKZ A;  5AI9 A;  4KN4 A;  4KB6 A;  2E8M A;  2GAF D;  3EF2 A;  4ECU A;  2JEI A;  1N5W A;  7ICK A;  3QEB Z;  1U49 A;  3NYB A;  3UXP A;  4X0B A;  1ZQB A;  3RJH A;  2ASJ A;  4XJE A;  1MSW D;  4UAW A;  2G07 A;  5F9L A;  1KTQ A;  3L3F X;  2HOQ A;  4E8F A;  3O0F A;  3TAR A;  3RH4 A;  2H3V A;  5ALT A;  4ATB A;  1PUZ A;  3M6Z A;  3ZD8 A;  4WBZ A;  2PI5 A;  3QUC A;  4DOC A;  2KFN A;  2ZXH A;  5HHI A;  4XRH A;  3RRG A;  3HIL A;  3ETR A;  3PSP A;  4XA5 A;  1PK3 A;  3Q8R B;  5AK3 A;  1NKE A;  1CI4 A;  5KFB A;  2HVI A;  8ICS A;  4WC2 A;  1ZQL A;  7ICI A;  5ALU A;  2YMQ A;  5AI0 A;  2JZB B;  2FCL A;  5D4B A;  4OAI Z;  2ES6 A;  2L5Y A;  4BX9 C;  3WFO A;  4F4X A;  2KK0 A;  3RJG A;  3JPQ A;  5IIO A;  3RJI A;  1X9S A;  1S97 A;  1L6N A;  4I2J A;  3RJF A;  3SV4 A;  1JMS A;  4UW9 A;  4WC6 A;  3T5L A;  4FBT A;  4LEZ A;  1X9M A;  2G0A A;  1LKY B;  9ICI A;  1B22 A;  1DXS A;  1RYU A;  5KFN A;  4OCZ A;  3RH6 A;  1HJP A;  1CEZ A;  4QZA A;  1ZQH A;  3G6X A;  3JPO A;  3QU9 A;  4LEV A;  2HBM A;  3Q8S B;  1L3U A;  1ZQG A;  1MIV A;  2ISP A;  4QZG A;  2W55 A;  4GXJ A;  3GV5 B;  4M6W B;  1NO5 A;  1QQ7 A;  5J2K A;  2W04 A;  4QIW C;  2IA6 A;  3PSF A;  4FBU A;  5D63 A;  5EOZ A;  1KDH A;  5JU5 A;  4G9B A;  4OAF A;  3IP4 B;  3RR8 A;  2K89 A;  3LVW A;  2DPI A;  5L1M A;  4K99 A;  8ICU A;  5J29 A;  4K8V A;  2ZIX B;  2FLL A;  4FH3 A;  4F5P A;  4UAR A;  3QUB A;  5III A;  1NK8 A;  1T3N A;  5DB7 A;  2YTU A;  2KJ9 A;  3ONN A;  2IBK A;  1WWV A;  3PW0 A;  2AQ0 A;  2WF5 A;  4DWI A;  5J0Y A;  3QE9 Y;  1N2X A;  1UT5 A;  5CFT A;  2KOB A;  4MKP A;  1UA1 A;  4BWM A;  2R8H A;  1ZQY A;  3UQ0 A;  5HRG A;  3FDS A;  3I76 A;  1C7Y A;  1TK8 A;  4PL1 A;  2OH2 A;  3MGH A;  4E7X A;  1XS9 D;  3GII A;  4HX0 A;  7ICG A;  4X5V A;  2BCS A;  2LKY A;  4U7C A;  5HRI A;  3LWM A;  2ZTC A;  4WBY A;  4IL6 U;  3OJU A;  1ED1 A;  3ZDC A;  1TFY A;  4WOY A;  2O1P A;  3V72 A;  2E8N A;  2MUT B;  3T5H A;  2OXO A;  1SKS A;  2E8P A;  1TAM A;  3WKC A;  2JRZ A;  2G5I B;  3V6J A;  1L3S A;  3PVX A;  5AKH A;  1KFD A;  2BHN A;  2NRT A;  4R65 A;  2LPE A;  2MAX A;  4EV6 A;  5AM4 A;  5KT7 A;  3QU5 A;  2M2T A;  1JRO A;  3AN1 A;  2GWS A;  5L1L A;  8ICR A;  1FO4 A;  4B9N A;  4J9P A;  2NYV A;  5KG4 A;  2ZHA A;  1KL9 A;  4DSF A;  4FZM A;  4TUQ A;  2WF9 A;  1NJX A;  1MIW A;  4KTQ A;  4UB1 A;  5HNK A;  1PK1 A;  4WC1 A;  1F44 A;  2UVV A;  8ICX A;  3PW5 A;  4DL5 A;  3CYM A;  2FPM A;  4B9V A;  4UB5 A;  5KFI A;  4RQM A;  4AYB C;  4M5D A;  3UXN A;  1A77 A;  4QZH A;  4C4S A;  8ICE A;  4RWO A;  1JAL A;  5KFR A;  5J2G A;  1QLN A;  5KFZ A;  3H0R B;  4DFK A;  3RTV A;  2EZZ A;  3C29 A;  4QNL A;  2NO5 A;  4US8 A;  4G3I A;  4K9B A;  4NY8 A;  1WOT A;  5KG3 A;  2E3T A;  2FLP A;  3HT3 A;  2J6T A;  5J0Q A;  3K1Z A;  3IG8 A;  5ALH A;  5AM2 A;  1COO A;  4X4O A;  2R8J A;  1IM4 A;  2KP7 A;  4CGZ A;  4K98 A;  3MCR A;  2WFA A;  2K8A A;  5KG7 A;  4Y2P A;  4UB4 A;  3EWA A;  4ELT A;  7ICV A;  1X9W A;  5KT3 A;  4JV2 A;  2XY5 A;  1SKR A;  3KZX A;  1ZQF A;  1WG8 A;  4IRK A;  3PW2 A;  1N56 A;  5KFT A;  3HJ1 A;  5AIC A;  1MIY A;  5ALO A;  3MFH A;  4KLG A;  5HRB A;  3PSI A;  1JN3 A;  4QW9 A;  3KHL A;  1KRP A;  2ID1 A;  3K1R B;  3H8S A;  4UAU A;  4RQ2 A;  3QZ7 A;  3S6J A;  4F8R A;  3OVS A;  2CXY A;  2FI1 A;  5GTI U;  3UMG A;  2ZH8 A;  8ICJ A;  4KX3 A;  4DF8 A;  3C21 A;  2BBH A;  2OM6 A;  4RQ1 A;  2UVR A;  2LHT A;  4F71 A;  3JPS A;  4UBB A;  1H38 A;  3H4D A;  2H5X A;  1BVS A;  2NRK A;  4EED A;  1MA7 A;  2ODG A;  1TAU A;  4B9M A;  3ER9 B;  4DSE A;  1U9L A;  5DB8 A;  4M9J A;  1RQL A;  3TI0 A;  4KX5 A;  5J0O A;  4EEB A;  3WFS C;  4EX6 A;  4LVS A;  2BCV A;  4FHV A;  2KG5 A;  1ZQZ A;  5KT4 A;  2XCP A;  2KJ8 A;  3C1Y A;  1KQQ A;  4CRX A;  2DGZ A;  2OCE A;  4BXO A;  2ZG6 A;  5EE3 A;  2W9B A;  1V85 A;  1T4G A;  1X2I A;  2R8I A;  1KN5 A;  5J2H A;  4LZD A;  2EAO A;  1TV9 A;  5KFE A;  1R8B A;  2QAR A;  1V9P A;  3MBY A;  2B51 A;  4DCC A;  9ICU A;  5HC9 A;  1URJ A;  1OUQ A;  5CHG A;  4F4Z A;  1K1Q A;  5EE9 A;  1R89 A;  3AMZ A;  2O5A A;  4NLG A;  1NK6 A;  3NAS A;  4RUC A;  4FZN A;  1BPZ A;  5KL1 B;  1YZ6 A;  4CF5 A;  4C8N A;  1L8O A;  2BQR A;  4DSK A;  4P2H A;  1KKX A;  3QZ8 A;  1XO0 A;  3WK4 A;  5HR7 A;  2R8G A;  4E0D A;  4NXT A;  3N7R C;  3WKB A;  4O5C A;  1Z4N A;  1DGS A;  2AGP A;  3UPQ A;  4I29 A;  2Y1I A;  3R9K A;  4KMU A;  5AKI A;  4KLI A;  3A0H U;  4YG2 A;  5JTI A;  3TAC B;  3G6Y A;  4RNN A;  4RWN A;  2D8C A;  3OPX A;  1UEV A;  3HKZ C;  1TAQ A;  4OAH A;  3BS7 A;  2PI4 A;  1WUD A;  1ZYQ A;  4QW8 A;  5ALS A;  2I9G A;  3KZI U;  2PMZ F;  2WF8 A;  9ICJ A;  5L1J A;  4X4Q A;  5KFQ A;  2W7O A;  4EBJ A;  2J6U A;  2KIC A;  5KFP A;  5CFS A;  3M9N B;  5DDM A;  4Z6C A;  2AU0 A;  1COK A;  5ALV A;  2OEH A;  2XIC A;  4RUA A;  2ATL A;  2A1J A;  4UAV A;  2E1F A;  5J2B A;  1Q3U A;  3CNH A;  4ED0 A;  1XWL A;  3ER8 C;  5J2E A;  3RH5 A;  2JXJ A;  1YT3 A;  2H3F A;  4ECV A;  5ALJ A;  4RQ0 A;  4ZH4 A;  4B9T A;  3KBB A;  5HRH A;  4I27 A;  2K8B B;  2ZTE A;  4I2I A;  4PJ0 U;  7ICS A;  5F2V O;  4IQV A;  2ZH1 A;  1RYR A;  3MDC A;  4ED8 A;  1RDF A;  3NVO A;  5C0Y A;  5AI8 A;  4PHP A;  2D6F C;  9ICV A;  4NLK A;  4RQN A;  3EPI A;  1K1S A;  2YB1 A;  1A76 A;  5DLG A;  1X9X A;  4I2E A;  4DSJ A;  4O3R A;  4ED3 A;  4GLX A;  5KTQ A;  4YP3 A;  2PFN A;  1PVQ A;  3AM9 A;  4BUG A;  3ISB A;  4X4R A;  5J0T A;  2Q66 A;  2ZXI A;  5TIS U;  3CK6 A;  2JZB A;  2PFO A;  5KG2 A;  2NO4 A;  4TUS A;  2QLT A;  2IOF A;  4MEX A;  4LZG A;  3KTQ A;  4JV1 A;  4FE3 A;  4DL4 A;  4MFC A;  4DL3 A;  2A19 A;  2EAM A;  2V4Q A;  3NVZ A;  5AM0 A;  2HOI A;  1LKY A;  1N61 A;  4KLS A;  4NXW A;  1YLQ A;  4DFJ A;  3NKU A;  3NGD A;  2DQN B;  2CPR A;  1U4B A;  2XID A;  1XU4 A;  5L1I A;  5KAF U;  4RNO A;  4QWE A;  1Z3E B;  3M9O B;  2XGQ A;  1U48 A;  5CA7 A;  1RG6 A;  5DB6 A;  2ZJA A;  3WFR E;  2P66 A;  1NJZ A;  3QUQ A;  3KD3 A;  3PO5 A;  4M6W A;  4KLT A;  7ICN A;  3HP6 A;  4QZC A;  4QZI A;  3U26 A;  5HRK A;  2W9B B;  1EXN A;  1NKB A;  4F3O A;  3KHR A;  2WAQ F;  2ZIX A;  3ICX A;  3WKD A;  5AK6 A;  2F1I A;  5T14 A;  4Q8E A;  3SAG A;  4FZL A;  5AIA A;  9ICE A;  2C22 A;  2K60 A;  3WKA A;  1JIH A;  2P6R A;  4KMO B;  4I2B A;  9ICL A;  1BPX A;  2BE3 A;  3OVA A;  4MF2 A;  4NKT A;  3QU4 A;  5DQH A;  2RDJ A;  3OHA A;  2H3Z A;  4DL7 A;  4GC7 A;  3M8S A;  3SR6 A;  4QWC A;  3KHH A;  1TVA A;  5HRE A;  3GIK A;  1TFW A;  4LEY A;  1NI3 A;  4WC4 A;  2LM1 A;  2W54 A;  2C2R A;  3PR5 B;  2K4E A;  4ED2 A;  4RPX A;  3WK6 A;  3PZP A;  1ECW A;  4RU9 A;  4RQ5 A;  4XQ7 A;  3PML A;  2KNJ A;  4O3O A;  2HHU A;  2QKQ A;  2DKZ A;  3F2B A;  3N4M B;  3RAX A;  3ETL A;  2JV3 A;  2IHM A;  1L7N A;  4B9L A;  2HHQ A;  9ICB A;  3SMV A;  4GIB A;  5AKY A;  4N7R A;  1ZJM A;  2A1J B;  4GXK A;  2I6X A;  4YMN A;  7ICR A;  2LI6 A;  7ICU A;  4WQL A;  1XNS A;  5G5H A;  2ZTD A;  5D61 A;  5BOM A;  5HR6 A;  3BZK A;  3ORY A;  4NLB A;  1QSY A;  3PY8 A;  1FFV A;  4NL9 C;  1NZB A;  5TZV A;  5ALG A;  5A0L A;  4YMO A;  5EWG A;  2F76 X;  5ALI A;  4JLX A;  4DOA A;  3RR7 A;  3AQF A;  3OJS A;  2ZJ5 A;  3LVV A;  2BPG A;  1QSS A;  2H3Q A;  3NRZ A;  4UD5 A;  4C80 A;  3TQ1 A;  4ECZ A;  5KT2 A;  4C8K A;  1SL0 A;  2KHQ A;  4X4T A;  3V7K A;  2WB1 F;  2R18 A;  4YMM A;  4P4M A;  3M8R A;  3G6V A;  2HI0 A;  2C2E A;  5HHH A;  3LWL A;  4KIT B;  1VFG A;  4EZ9 A;  5KAI U;  2I1Q A;  1Z1V A;  4WC0 A;  1RPL A;  1XC9 A;  2KVS A;  4FFD A;  2RRD A;  1SV4 A;  3V7L A;  3JCF A;  2NRZ A;  2B6G A;  3AUO A;  1ZQT A;  4UB2 A;  3FAH A;  3QXG A;  1LB2 B;  2RFF A;  1TE2 A;  3PST A;  2W8L A;  2KZM A;  4YN4 A;  5EWF A;  3BQ2 A;  2WF7 A;  2BZF A;  2DR5 A;  4J9L A;  2ZUD A;  4ED1 A;  4AT8 B;  2QB0 B;  4DFP A;  5AKX A;  5KFS A;  3SD7 A;  4F5R A;  4KLL A;  4IS7 A;  2NRX A;  3Q8Q B;  2CRX A;  4OJ5 A;  4EYH B;  5IIL A;  4P0P A;  3B9J A;  4O0I A;  3NUQ A;  4RZR A;  9ICA A;  1VLB A;  9ICN A;  1XSP A;  4C8M A;  3A0B U;  5F9N A;  4F4K A;  5CJ7 A;  1S0M A;  3F53 A;  4O5E A;  4DQP A;  2KKP A;  1JAJ A;  2VJ5 A;  3H0M B;  1Q3V A;  3Q8L A;  4KLU A;  9ICC A;  5B3Q A;  4KLH A;  1F0M A;  1SGG A;  5K4L A;  3QU7 A;  7ICO A;  2OHF A;  4X4P A;  3HJ4 A;  4CE6 A;  1TK5 A;  1ZOL A;  4UB8 U;  3BS5 A;  4UQG A;  1DK2 A;  3V6K A;  2NRV A;  1NJY A;  1SWW A;  3NVY A;  1SL2 A;  1ZQQ A;  3TAQ A;  4AT9 A;  1MC8 A;  2DFL A;  3H3A A;  1X40 A;  5KFJ A;  2KN7 A;  4JV0 A;  3H8W A;  1D9F A;  3AQL A;  9ICO A;  5J8Y C;  4NL9 A;  5CB1 A;  8ICA A;  1T7P A;  1X6J A;  3DDH A;  3OHB A;  4DSL A;  1F5S A;  2MSN A;  2XY6 A;  3HIY A;  3H8J A;  2JGA A;  2YN4 A;  4QZF A;  2DVI A;  5D49 A;  4YQW A;  4O3N A;  1IIP A;  4NXU A;  1DRG A;  4M9N A;  4K9A A;  2DKX A;  2RHF A;  3MGI A;  5CR0 A;  4F91 B;  4P4P A;  4RPZ A;  1Q46 A;  4AT7 B;  2JEF A;  1QQ6 A;  5J0S A;  4CDG A;  4ACO A;  4PH5 A;  3EYZ A;  4IC9 A;  2UVU A;  4B6J A;  1HIW A;  1ZD2 P;  1LV5 A;  1L3T A;  2B56 A;  3FM9 A;  4X4N A;  5HML A;  5KFU A;  4RT2 A;  5AKJ A;  4R64 A;  4C8L A;  2BR0 A;  2HDO A;  4OJL A;  3HPO A;  4UB3 A;  4Y2J A;  9ICW A;  1ZQX A;  3WK7 A;  4I2H A;  5IIN A;  5IIK A;  5AM3 A;  2HN2 A;  5DGB A;  4RPY A;  3RJK A;  4YXM A;  1ZQV A;  4LJX A;  3WK9 A;  3OV7 A;  1BPB A;  1ZQE A;  4TUR A;  3PR4 A;  1U47 A;  4LEW A;  2OWO A;  2W8K A;  3C5F A;  3H38 A;  4ECW A;  5ALQ A;  8ICC A;  2HOF A;  2M2V A;  1ZQM A;  3GZF A;  2ZHB A;  4UD4 A;  2DRA A;  1K5O A;  4NV0 A;  1XSL A;  1HUO A;  3HRD D;  4Q44 A;  5AM1 A;  2ZUC A;  1NJW A;  1UEU A;  5AI5 A;  1Z4O A;  3CRX A;  2G09 A;  2YMP A;  1J2M A;  3IM1 A;  1ZQP A;  5HP4 A;  2VIX A;  4DOB A;  4JMU A;  3PO4 A;  3UMB A;  3SQI A;  3UQ2 A;  3EUB 2;  1B4F A;  5ALE A;  3ZD9 A;  1VJ5 A;  2Q0Z X;  4Z6E A;  4C4T A;  4I2F A;  2HHP A;  3LK9 A;  3C66 A;  1XO1 A;  4RWP A;  5KFK A;  5KFH A;  1B43 A;  2IOH A;  2YQE A;  1R8C A;  4TQR A;  2LBO A;  5J8Y A;  4P0P B;  3BQT A;  4HYK A;  3EW9 A;  1JUD A;  5ALX A;  4I2A A;  2PFP A;  5DKW A;  3PX0 A;  4R8U A;  1UCV A;  4O3M A;  3BDP A;  4IRD A;  4PL2 A;  2FPK A;  1OXJ A;  5KG6 A;  2KMD A;  5J0X A;  3QUT A;  3RBD A;  5CFU A;  2DRB A;  5DG7 A;  2PMZ C;  4DL2 A;  2JHD A;  2ZH5 A;  4C7Z A;  5AHX A;  3T79 A;  3PX6 A;  2GH1 A;  3GFK B;  5AK5 A;  8ICV A;  2AGQ A;  4S3N A;  5CRX A;  4NM1 A;  2B0C A;  3OVB A;  3C5G A;  1TK0 A;  1S8O A;  1PX5 A;  3BS5 B;  5J2A A;  2KD1 A;  1L7O A;  3ZDD A;  2HHX A;  4NLC A;  3K75 D;  4WC5 A;  1BPE A;  4AT9 B;  1PZN A;  2HBL A;  2VA8 A;  4A8E A;  2P6U A;  2B4V A;  3BJY A;  2XCA A;  3AU6 A;  3MR2 A;  2LMR A;  3GV7 B;  4QZ9 A;  2FJ6 A;  3RFA A;  2Y9U A;  5ALW A;  1OW5 A;  1KFT A;  1ZD3 A;  4C4R A;  2ZIW B;  1JRP A;  2N1R A;  4USA A;  3D2N A;  4QJF B;  1UQV A;  3JYY A;  4DQI A;  4RQ4 A;  5DLF A;  4EEL A;  5J2C A;  3H8M A;  3GIL A;  4MHV A;  4EBC A;  4YR3 A;  3HWT A;  8ICP A;  3OUY B;  4P0Q B;  2EH9 A;  4QZD A;  3ERC C;  1AQ6 A;  1YZ7 A;  4I2G A;  5DGA A;  4F92 B;  3SZ2 A;  1L7M A;  2JH7 A;  4I0U A;  4WQK A;  3D6J A;  4KLQ A;  2F77 X;  4DF4 A;  1S0V A;  3V7J A;  2A3V A;  3H4B A;  1QTM A;  1BGX T;  4KLO A;  1Z00 B;  4NLZ A;  2EZX A;  3PV8 A;  4BDP A;  1JI7 A;  2YB4 A;  3LDA A;  3TAP A;  3M7D A;  5AI6 A;  2B21 A;  3AL0 B;  2NV3 A;  4DLG A;  2WAQ C;  2F2A B;  2W3S A;  3RBE A;  4F50 A;  4EBE A;  5B66 U;  4XQ8 A;  3QYP A;  2AH5 A;  5KFL A;  5ALR A;  4UAZ A;  4ELU A;  4IG8 A;  4CF3 A;  4FS1 A;  3RJJ A;  1D8Y A;  4PPX A;  1WCN A;  1JX4 A;  3WU2 U;  5JRT A;  2F8L A;  4FO6 A;  4E80 A;  1CUK A;  3F2D A;  1ZQI A;  4Y2Y A;  3JPN A;  2JR5 A;  3TAD C;  3ZDE A;  1S0N A;  3MAB A;  5ALM A;  3L5K A;  4PZO A;  5CWR A;  3ZI4 A;  1TFR A;  2E5S A;  4OO1 J;  4BJQ A;  3SV3 A;  1V97 A;  5IIJ A;  3ZDB A;  4YD1 A;  4PHD A;  3N7S C;  4YFK A;  2PKE A;  3Q8P B;  4GFJ A;  1IG6 A;  2HHW A;  3ZDA A;  4EZ6 A;  4RQ7 A;  2RP5 A;  4P4O A;  3RB6 A;  4WCW A;  4O6A A;  4AT8 A;  2QB0 A;  4R8U B;  2KZ3 A;  2CN1 A;  4B9S A;  4JB3 A;  1NK4 A;  1N48 A;  2IHN A;  4JWM A;  3NVV A;  5J2D A;  2HSZ A;  1A0P A;  3M1Y A;  3WK5 A;  4KLE A;  4EP7 A;  4J9Q A;  1ZQC A;  2F1J A;  5F3X B;  4I28 A;  2M0N A;  2XI9 A;  2H3I A;  3AQN A;  2ESE A;  1Z19 A;  3C2K A;  3MR3 A;  4M9L A;  2A1A A;  2BCU A;  3HW8 A;  2DWQ A;  2K4H A;  3TFR A;  2AGO A;  2EDU A;  2GLE A;  2WTF A;  1Q8K A;  4PGX A;  1JXL A;  3OWG A;  2ZIU B;  3BQ7 A;  2EAP A;  4K4I A;  3MDA A;  1IXR A;  3C23 A;  8ICK A;  2W9C B;  4NWI A;  8ICY A;  1ZQA A;  2JMG A;  1ZET A;  3I1Y A;  3OGU A;  4RQ8 A;  2VA3 A;  1S9F A;  1WCL A;  4ECR A;  3L4P A;  3N97 B;  2MU2 A;  2RQ5 A;  3AEV A;  4NKU A;  2AXT U;  1NOM A;  4F72 A;  2KIV A;  3E58 A;  7ICP A;  2ZH6 A;  2ZH7 A;  9ICP A;  3C2M A;  3IHQ B;  2F1H A;  4C8O A;  3NTU A;  1ZQD A;  4I2D A;  3GV8 B;  2KSO B;  1SV0 C;  4PZN A;  3BZC A;  5BOL A;  1BNP A;  3N28 A;  5L1K A;  1BNO A;  2EWR A;  4Y2X A;  2Y1J A;  1ZQJ A;  4EBK A;  2KV2 A;  3PNC A;  4BGD A;  1RXV A;  4AT7 A;  1D8L A;  2PBE A;  4RWQ A;  1UHU A;  2MA1 A;  5KFM A;  4ZOH C;  1UPH A;  9ICK A;  4R66 A;  3Q8K A;  4ELV A;  5J2F A;  3N7P D;  3PW7 A;  5HRD A;  4ECX A;  3F2C A;  1ZQN A;  4QZ8 A;  8ICL A;  4M9G A;  3IRU A;  2HBK A;  3THV A;  1X66 A;  3JPP A;  2EAN A;  4KN7 A;  1DK3 A;  4RT3 A;  3IN5 A;  5KFF A;  2FDR A;  4CCH A;  4FO1 A;  1SXE A;  3ALR A;  8ICF A;  3KHG A;  2K4P A;  3IDW A;  3PW4 A;  2IMW P;  1U45 A;  1HEK A;  5HRL A;  1N5X A;  1F5A A;  4F5O A;  1FA0 A;  3PX4 A;  1NK0 A;  1N62 A;  2Z7J A;  5J2J A;  3EZ5 A;  5ALL A;  4J9R A;  3IV6 A;  2MRL A;  5KT5 A;  3FYH A;  1NK5 A;  5JTG A;  5DG8 A;  3MR6 A;  4PGY A;  5J0P A;  1L3V A;  4QWD A;  8ICN A;  4JLZ A;  1Q79 A;  3C2L A;  5ALK A;  1Q78 A;  2WF6 A;  2BDU A;  4DS5 A;  2PFQ A;  1J97 A;  4DQR A;  2ASD A;  5KT6 A;  4US9 A;  2HW3 A;  4OAG A;  4EYI B;  2Y0S F;  4NLN A;  2BBJ A;  2XGP A;  5L9X A;  7ICM A;  5KFV A;  1MQ3 A;  8ICH A;  8ICW A;  8ICI A;  5G5G A;  4RQ3 A;  1N63 A;  3VC8 A;  3GIJ A;  3T5J A;  4O5K A;  4WC3 A;  1NNL A;  4J03 A;  3EPG A;  1L7P A;  9ICG A;  2IUB A;  1KW4 A;  2DUY A;  2F3N A;  2HVH A;  3E2E A;  3AQM A;  3RF9 A;  3T5K A;  4LT6 A;  1L8L A;  2YX8 A;  5DEC A;  1SIJ A;  5D46 A;  4J9S A;  1SV0 A;  1QH9 A;  1WYG A;  2KHV A;  1B0X A;  1ZQW A;  2VKQ A;  2BGW A;  2HMX A;  3QX7 A;  2ZH4 A;  3MFI A;  7ICE A;  1SWV A;  2R8K A;  3BQ0 A;  2KZZ A;  3RJE A;  7ICQ A;  4DEZ A;  2K8C B;  1NK7 A;  3F5A A;  3D2Q A;  4F5N A;  2KE7 A;  3SEN A;  5KFD A;  3RAQ A;  1Z1B A;  2FMP A;  4X4V A;  2F8K A;  3ISC A;  5KFA A;  4NM2 A;  1FIQ A;  1M6Y A;  4O69 A;  2KKV A;  2QB1 A;  3D2S A;  5DG9 A;  2HN1 A;  2GA9 D;  4UB6 U;  1NK9 A;  1RM6 C;  3V6H A;  5KFG A;  1ZJN A;  5KL8 B;  3BQ1 A;  3JPT A;  1GPJ A;  2IHO A;  4J9O A;  3RB4 A;  2ZIW A;  4M9H A;  5DQG A;  4K96 A;  1D9D A;  3PHZ A;  5DBA A;  2HHS A;  2OYY A;  5EE1 A;  2I5H A;  3AU2 A;  3RB0 A;  2KEY A;  2RDI A;  5B5E U;  4ICA A;  1O03 A;  2ALZ A;  4DQS A;  2P35 A;  2EQY A;  2FMQ A;  4YR2 A;  5DQI A;  2LM4 A;  3PMN A;  1PVR A;  3OUY A;  1FEZ A;  4P0Q A;  4DSI A;  2W11 A;  2LYA A;  3AQK A;  4YCX A;  3TAN A;  2G06 A;  3QNM A;  5KFY A;  5KG1 A;  1L5U A;  2JEG A;  2YML A;  5KFW A;  4DFM A;  8ICO A;  2NRW A;  4O3Q A;  3M9M B;  1ZRM A;  4QIW F;  1MQ2 A;  1UA0 A;  3ISD A;  5HRF A;  3J81 j;  4QZB A;  3FC4 A;  1UET A;  4AP9 A;  4F2R A;  1SZH A;  4UAS A;  1Z00 A;  3TFS A;  1S76 D;  2ZIV A;  8ICG A;  5CHE A;  3MGV A;  3KFU F;  3K4G A;  4ATB B;  4BWJ A;  1SKW A;  2RLT A;  5KNI A;  5E79 U;  7ICF A;  3E0F A;  3NWI A;  4YR0 A;  4WC7 A;  4Q45 A;  1S10 A;  3HJE A;  5AI4 A;  4GC6 A;  3LQC B;  1X42 A;  5BPC A;  2AJQ A;  3AQE A;  5DB9 A;  7ICH A;  4EEN A;  4HAI A;  3IG5 A;  1SL1 A;  3MR5 A;  7ICJ A;  1FFU A;  2DPJ A;  2PXI A;  4CNQ A;  3UM9 A;  1XSN A;  3WKE A;  1KBU A;  1ZXI A;  2XO7 A;  5KFO A;  3OTQ A;  4I2C A;  3UPS A;  3GDX A;  2BPC A;  1JXE A;  9ICT A;  4DQQ A;  1S0O A;  3RB3 A;  4MFA A;  4K4H A;  1JQR A;  2GO7 A;  3LYS A;  1KEJ A;  4FH5 A;  5EWE A;  3DEE A;  3H0L B;  4TQS A;  4KLM A;  2GOL A;  2DR9 A;  2FLN A;  1P7D A;  3H7I A;  2BCQ A;  4X4U A;  2M9N A;  4J9K A;  3WFQ E;  4Y2S A;  4Z6F A;  4ECT A;  4NXV A;  5B3P A;  2O6K A;  4O3S A;  1J2N A; 
#chains in the Genus database with same CATH homology
 5DED A;  2M2W A;  4Z6D A;  1ZJM A;  4IQW A;  2A1J B;  4GXK A;  4YMN A;  4FO6 A;  1CUK A;  1XS9 D;  2FMS A;  3GII A;  1ZQI A;  8ICB A;  4E80 A;  3JPN A;  7ICR A;  7ICG A;  7ICU A;  5J0U A;  3OSN A;  4X5V A;  2BCS A;  4IRC A;  3ZDE A;  1S0N A;  2M2U A;  3MAB A;  2ZTD A;  5HRI A;  3LWM A;  2ZTC A;  4MEY A;  5BOM A;  4WBY A;  1KNY A;  3OJU A;  3ORY A;  5CWR A;  1ZQO A;  3ZDC A;  1TFR A;  1TFY A;  5KG0 A;  2O1P A;  1QSY A;  3PY8 A;  4X0A A;  3SV3 A;  4IQU A;  2ASL A;  9ICM A;  3V72 A;  1NKC A;  4RQ6 A;  4PGQ A;  2MUT B;  5IIJ A;  5TZV A;  3T5H A;  3ZDB A;  1OU5 A;  1SKS A;  2UVW A;  2VA2 A;  4YD1 A;  4PHD A;  4YFK A;  4YMO A;  1S77 D;  3V6J A;  5EWG A;  4F4Y A;  3Q8P B;  5HRG A;  1L3S A;  3PVX A;  2W9C A;  2HHW A;  2BCR A;  4EBK A;  2ZJ8 A;  3ZDA A;  2XC9 A;  4Q43 A;  1KFD A;  4DO9 A;  4RQ7 A;  4DOA A;  4UAY A;  1HUZ A;  4EZ6 A;  4JWN A;  4P4O A;  3RB6 A;  4WCW A;  2BHN A;  3RR7 A;  2NRT A;  2KTQ A;  4GXI A;  4R8U B;  9ICX A;  4AT8 A;  2KZ3 A;  4R65 A;  2ZJ5 A;  4QWA A;  3OJS A;  2C2D A;  1T8E A;  4B9S A;  2MAX A;  4IR9 A;  5KT7 A;  2BPG A;  1QSS A;  1NK4 A;  1N48 A;  2M2T A;  2ZUB A;  5C5J A;  3QEA Z;  2IHN A;  4UD5 A;  4JWM A;  2GWS A;  5J2D A;  5L1L A;  3TQ1 A;  8ICR A;  4ECZ A;  5KT2 A;  3OSP A;  4C8K A;  4B9N A;  4KLE A;  1SL0 A;  4EP7 A;  4J9Q A;  1ZQC A;  2F1J A;  3V7K A;  4J9P A;  4X4T A;  5KG4 A;  2ZHA A;  4YD2 A;  4DSF A;  4I28 A;  4TUQ A;  1NJX A;  3AQN A;  4YMM A;  1MIW A;  4PHA A;  4P4M A;  3M8R A;  3G6V A;  1Y88 A;  2W9A A;  4KTQ A;  4UB1 A;  5HNK A;  3C2K A;  3MR3 A;  4M9L A;  2C2E A;  5HHH A;  4WC1 A;  3LWL A;  8ICM A;  2UVV A;  1NZP A;  4KIT B;  4MF8 A;  5KFC A;  4DL5 A;  3PW5 A;  2BCU A;  4EZ9 A;  3HW8 A;  2I1Q A;  2FPM A;  8ICX A;  4WC0 A;  3B0X A;  4B9V A;  1RPL A;  3TFR A;  2AGO A;  1XC9 A;  4UB5 A;  3AQL A;  5KFI A;  2WTF A;  1JXL A;  4PGX A;  4YXJ A;  3V7L A;  5HRD A;  4FHX A;  4M5D A;  2NRZ A;  1A77 A;  3UXN A;  5DBC A;  4QZH A;  3AUO A;  1ZQT A;  2BPF A;  4K4I A;  4UB2 A;  8ICE A;  1ZQU A;  3MDA A;  5KFR A;  5J2G A;  1LB2 B;  4M2Y A;  1QLN A;  1IXR A;  5KFZ A;  2RFF A;  4FHP A;  1ARO P;  3C23 A;  4DFK A;  3RTV A;  8ICK A;  9ICB A;  2W9C B;  2W8L A;  2KZM A;  4YN4 A;  2BKE A;  5EWF A;  1V4A A;  3BQ2 A;  4IQT A;  8ICY A;  2DR5 A;  4EEY A;  4J9L A;  1SZP A;  4ECQ A;  1ZQA A;  2HHT A;  2ZUD A;  1BPD A;  4ED1 A;  4G3I A;  4DFP A;  4NY8 A;  1WOT A;  5KFS A;  5KG3 A;  2FLP A;  4EBD A;  3HT3 A;  1ZET A;  3OGU A;  2J6T A;  4RQ8 A;  2VA3 A;  5J0Q A;  4F5R A;  4KLL A;  1S9F A;  1WCL A;  2NRX A;  3Q8Q B;  1COO A;  3GQC A;  4ECR A;  5J2I A;  4X4O A;  4EYH B;  5IIL A;  2R8J A;  3N97 B;  1IM4 A;  2KP7 A;  4O0I A;  2JEJ A;  4RZR A;  9ICA A;  9ICN A;  4NKU A;  1NOM A;  3H40 A;  5KG7 A;  4F4W A;  4UB4 A;  1XSP A;  7ICP A;  2ZH6 A;  4XUS A;  4C8M A;  9ICP A;  3C2M A;  2ZH7 A;  5F9N A;  3IHQ B;  3EWA A;  5CJ7 A;  1S0M A;  4F4K A;  4O5E A;  2W9M A;  4DQP A;  4ELT A;  7ICV A;  2F1H A;  1X9W A;  5KT3 A;  4C8O A;  2XY5 A;  5KFX A;  1SKR A;  4JV2 A;  1JAJ A;  4DL6 A;  4KLJ A;  3NTU A;  4Q8F A;  3GIM A;  2XY7 A;  4I2D A;  1ZQD A;  1ZQF A;  3GV8 B;  4NXZ A;  4IRK A;  4K4G A;  3PW2 A;  4ED7 A;  4O3P A;  3Q8L A;  5KFT A;  1N56 A;  1ZQR A;  1ZQK A;  4KLU A;  9ICC A;  3HJ1 A;  4M0A A;  5BOL A;  1MIY A;  4KLH A;  1BNP A;  5L1K A;  3MFH A;  1BNO A;  4X4P A;  2VAN A;  4KLG A;  5HRB A;  1JN3 A;  4QW9 A;  7ICO A;  3KHL A;  2Y1J A;  1KRP A;  2ID1 A;  3HJ4 A;  1ZQJ A;  4DLE A;  3H8S A;  3PNC A;  4RQ2 A;  8ICZ A;  1TK5 A;  4BGD A;  1R8A A;  1RXV A;  3QZ7 A;  3JZ0 A;  1D8L A;  2PBE A;  4AT7 A;  4F8R A;  4RWQ A;  3OVS A;  5KFM A;  4UQG A;  8ICT A;  4YVZ A;  4B9L A;  4KLF A;  1QSL A;  4R66 A;  8ICJ A;  9ICK A;  1DK2 A;  3Q8K A;  4DF8 A;  4ELV A;  3C21 A;  2ZH8 A;  4RQ1 A;  2UVR A;  3V6K A;  2LYH A;  2NRV A;  1NJY A;  3L9D A;  3JPS A;  4UBB A;  1RYS A;  3H37 A;  1SL2 A;  3H4D A;  1H38 A;  1KLN A;  2H5X A;  1ZQQ A;  1BVS A;  5J2F A;  4F5Q A;  3TAQ A;  4R63 A;  2NRK A;  4AT9 A;  4FHW A;  2AQ4 A;  1TAU A;  1MC8 A;  2DFL A;  3PW7 A;  4ECX A;  4B9M A;  9ICQ A;  5KFJ A;  2KN7 A;  8ICL A;  4JV0 A;  4QZ8 A;  3H8W A;  1ZQN A;  4F93 B;  4RNM A;  4DSE A;  1D9F A;  4M9G A;  9ICO A;  3THV A;  1U9L A;  5DB8 A;  4JK1 A;  4M9J A;  2DR8 A;  3TI0 A;  5CB1 A;  8ICA A;  1T7P A;  3JPP A;  4KN7 A;  5J0O A;  4X4S A;  3WFS C;  3OHB A;  1DK3 A;  4DSL A;  4RT3 A;  2XY6 A;  4LVS A;  5KFF A;  3HIY A;  4MFF A;  4CCH A;  2BCV A;  3H8J A;  4FHV A;  1ZQZ A;  5KT4 A;  8ICF A;  2HHV A;  4QZF A;  2XCP A;  3KHG A;  2DVI A;  3C1Y A;  5D49 A;  2FPL A;  3PW4 A;  2IMW P;  4YQW A;  4O3N A;  4BXO A;  2W9B A;  1T4G A;  1X2I A;  4M9N A;  2R8I A;  1U45 A;  2DR7 A;  5J2H A;  4LZD A;  2ZH2 A;  3MGI A;  1TV9 A;  4KLD A;  9ICS A;  5HRL A;  5KFE A;  1F5A A;  1R8B A;  1V9P A;  5CR0 A;  4F91 B;  4P4P A;  4F5O A;  1FA0 A;  4RPZ A;  3MBY A;  3PX4 A;  1NK0 A;  1VFG A;  4AT7 B;  9ICU A;  4B9U A;  2JEF A;  5HC9 A;  5J0S A;  5CHG A;  5J2J A;  4F4Z A;  1K1Q A;  4QWB A;  1R89 A;  3EZ5 A;  1DOQ A;  4PH5 A;  3EYZ A;  2BDP A;  4J9R A;  2O5A A;  2UVU A;  5J0R A;  5KT5 A;  1LV5 A;  1L3T A;  4NLG A;  4X4N A;  3SYZ A;  3FYH A;  5HML A;  1NK6 A;  5KFU A;  1NK5 A;  4RT2 A;  5DG8 A;  4RUC A;  1TKD A;  1BPZ A;  3MR6 A;  4PGY A;  2ZH9 A;  5J0P A;  7ICT A;  1UT8 A;  9ICR A;  4C8N A;  5KG5 A;  5HR9 A;  4J9N A;  4R64 A;  2BQR A;  1VJ7 A;  9ICF A;  1L3V A;  4QWD A;  5J0W A;  4DSK A;  8ICN A;  4C8L A;  2BR0 A;  4P2H A;  3HPO A;  1Q79 A;  3C2L A;  4UB3 A;  9ICW A;  3QZ8 A;  1ZQX A;  1Q78 A;  4I2H A;  5IIN A;  5IIK A;  4J9M A;  5CP2 A;  2R8G A;  5DGB A;  4E0D A;  4RPY A;  4JUZ A;  3RJK A;  9ICH A;  1RZT A;  4DS5 A;  2PFQ A;  4PHE A;  5DDY A;  5JUM A;  4DQR A;  4YXM A;  1ZQV A;  5KT6 A;  2ASD A;  2HW3 A;  4M04 A;  4EYI B;  4BXO B;  4O5C A;  3UXO A;  4NLN A;  5IIM A;  3C18 A;  4UBC A;  1DGS A;  2XGP A;  5L9X A;  3T3F A;  3UPQ A;  2AGP A;  5HMM A;  2BQ3 A;  4QZE A;  1BPB A;  1KSP A;  1ZQE A;  2J6S A;  7ICM A;  4TUR A;  5KFV A;  1MQ3 A;  3PR4 A;  2Y1I A;  4I29 A;  5DBB A;  1U47 A;  4M47 A;  8ICH A;  4KMU A;  2OWO A;  8ICW A;  2W8K A;  3C5F A;  8ICI A;  4KLI A;  3H38 A;  3B0Y A;  4YG2 A;  4ECW A;  4RQ3 A;  3GIJ A;  4ED6 A;  4O5K A;  3T5J A;  8ICC A;  4WC3 A;  4IR1 A;  3EPG A;  3G6Y A;  4RNN A;  2ZH3 A;  4RWN A;  1BPY A;  2M2V A;  1ZQM A;  2V9W A;  9ICG A;  2ZHB A;  4UD4 A;  1UEV A;  2DRA A;  1TAQ A;  3HX0 A;  2PI4 A;  1XSL A;  1ZYQ A;  1HUO A;  4Q44 A;  8ICQ A;  2HVH A;  3E2E A;  3AQM A;  4QW8 A;  4TUP A;  3T5K A;  3Q8M A;  1KFS A;  2I9G A;  4LT6 A;  4AT8 B;  2ZUC A;  1NJW A;  9ICJ A;  1UEU A;  3H39 A;  5L1J A;  4X4Q A;  2HHQ A;  5KFQ A;  4EBJ A;  2J6U A;  5DEC A;  5D46 A;  4FS2 A;  3IM1 A;  4J9S A;  4O9M A;  4ECS A;  5KFP A;  1ZQP A;  5HP4 A;  3M9N B;  5DDM A;  4Z6C A;  2AU0 A;  2C28 A;  2BQU A;  1ZQS A;  4DOB A;  4RUA A;  2ATL A;  3SI8 A;  2A1J A;  1ZQW A;  5J2B A;  4DS4 A;  2BGW A;  3RRH A;  4ED0 A;  1XWL A;  3WFP A;  3OV7 A;  5J2E A;  3RH5 A;  3PO4 A;  2ZH4 A;  3MFI A;  2ISO A;  7ICE A;  3UQ2 A;  4ECV A;  2R8K A;  4RQ0 A;  3BQ0 A;  4ZH4 A;  3ZD9 A;  4B9T A;  5HRH A;  4I27 A;  3RJE A;  2ZTE A;  2Q0Z X;  4I2I A;  4Z6E A;  2KZZ A;  7ICQ A;  4DEZ A;  7ICS A;  5F2V O;  4IQV A;  4I2F A;  1RXW A;  2ZH1 A;  7ICL A;  2HHP A;  3LK9 A;  4ECY A;  3C66 A;  1RYR A;  3MDC A;  4ED8 A;  3C1Z A;  1XO1 A;  2V4R A;  1NK7 A;  2KFZ A;  4PHP A;  3JPR A;  4RWP A;  5KFK A;  9ICV A;  4F5N A;  5KFH A;  2MUT A;  4NLK A;  1B43 A;  3EPI A;  5KFD A;  1K1S A;  3RAQ A;  2FMP A;  3H3A A;  4X4V A;  1A76 A;  4F2S A;  1R8C A;  5DLG A;  4TQR A;  3ISC A;  4KN4 A;  5KFA A;  4NM2 A;  4DSJ A;  4I2E A;  4O3R A;  4ECU A;  3BQT A;  4GLX A;  5KTQ A;  4ED3 A;  4HYK A;  3EW9 A;  4YP3 A;  2JEI A;  4I2A A;  5DG9 A;  2PFN A;  2PFP A;  5DKW A;  3PX0 A;  4R8U A;  7ICK A;  3ISB A;  3QEB Z;  4X4R A;  5J0T A;  1U49 A;  3NYB A;  1NK9 A;  2Q66 A;  3BDP A;  4IRD A;  3V6H A;  2FPK A;  5KFG A;  3UXP A;  4X0B A;  1ZQB A;  1ZJN A;  3RJH A;  2ASJ A;  2JZB A;  5KG6 A;  2PFO A;  5KG2 A;  5J0X A;  4TUS A;  3RBD A;  3BQ1 A;  1MSW D;  5DG7 A;  3JPT A;  2DRB A;  4DL2 A;  4J9O A;  4MEX A;  3RB4 A;  4UAW A;  5F9L A;  1KTQ A;  4LZG A;  3KTQ A;  4JV1 A;  4M9H A;  4DL4 A;  5DQG A;  2ZH5 A;  4MFC A;  1D9D A;  4DL3 A;  4E8F A;  5DBA A;  3PX6 A;  3TAR A;  3RH4 A;  3GFK B;  2HHS A;  8ICV A;  2V4Q A;  2AGQ A;  3AU2 A;  3RB0 A;  4NM1 A;  4ATB A;  4S3N A;  2RDI A;  3ZD8 A;  3OVB A;  3C5G A;  2ALZ A;  1TK0 A;  4DQS A;  4WBZ A;  4KLS A;  2PI5 A;  1YLQ A;  1PX5 A;  2FMQ A;  4DFJ A;  5J2A A;  4YR2 A;  4DOC A;  2KFN A;  5DQI A;  3ZDD A;  2HHX A;  3PMN A;  5HHI A;  4XRH A;  3RRG A;  3OUY A;  3NGD A;  4DSI A;  3K75 D;  4WC5 A;  4XA5 A;  3AQK A;  4IG8 A;  3Q8R B;  4YCX A;  1BPE A;  1NKE A;  3TAN A;  1U4B A;  5KFY A;  4AT9 B;  5KFB A;  1XU4 A;  5KG1 A;  2HVI A;  5L1I A;  4RNO A;  1PZN A;  4QWE A;  2VA8 A;  1L5U A;  2JEG A;  1Z3E B;  2P6U A;  3M9O B;  8ICS A;  4WC2 A;  1ZQL A;  3BJY A;  7ICI A;  2XGQ A;  1U48 A;  5CA7 A;  5KFW A;  2XCA A;  4DFM A;  8ICO A;  2NRW A;  4O3Q A;  3M9M B;  3AU6 A;  3MR2 A;  1MQ2 A;  5DB6 A;  2ZJA A;  3WFR E;  1UA0 A;  3ISD A;  2P66 A;  3GV7 B;  2JZB B;  1NJZ A;  5HRF A;  4QZ9 A;  4QZB A;  5D4B A;  3PO5 A;  4M6W A;  1KFT A;  3WFO A;  1UET A;  4F4X A;  4KLT A;  7ICN A;  3HP6 A;  4QZC A;  3RJG A;  3JPQ A;  5IIO A;  4QZI A;  3RJI A;  4F2R A;  2W9B B;  1X9S A;  1S97 A;  5HRK A;  1Z00 A;  3TFS A;  1S76 D;  1EXN A;  1NKB A;  4F3O A;  8ICG A;  4FHY A;  4I2J A;  3RJF A;  3JYY A;  3KHR A;  3SV4 A;  4DQI A;  3K4G A;  4RQ4 A;  4ATB B;  4BWJ A;  1SKW A;  5DLF A;  1JMS A;  4WC6 A;  3T5L A;  4FBT A;  5J2C A;  1X9M A;  2F1I A;  4Q8E A;  9ICI A;  3GIL A;  7ICF A;  1B22 A;  4YR0 A;  4WC7 A;  4Q45 A;  1S10 A;  4EBC A;  4GC6 A;  5KFN A;  9ICE A;  3RH6 A;  2C22 A;  3LQC B;  5BPC A;  4YR3 A;  3HWT A;  2AJQ A;  8ICP A;  5DB9 A;  7ICH A;  3OUY B;  1HJP A;  1CEZ A;  4QZA A;  4QZD A;  1JIH A;  1ZQH A;  2P6R A;  3G6X A;  4I2B A;  1SL1 A;  4I2G A;  3JPO A;  3MR5 A;  5DGA A;  1BPX A;  7ICJ A;  9ICL A;  4F92 B;  3SZ2 A;  2DPJ A;  2PXI A;  2BE3 A;  3OVA A;  4MF2 A;  4NKT A;  5DQH A;  2RDJ A;  3Q8S B;  3OHA A;  1L3U A;  4RWO A;  1XSN A;  1ZQG A;  1MIV A;  2ISP A;  4QZG A;  4DL7 A;  4GXJ A;  2XO7 A;  4GC7 A;  5KFO A;  3M8S A;  3GV5 B;  4M6W B;  1NO5 A;  5J2K A;  4QWC A;  3KHH A;  4I2C A;  4KLQ A;  3UPS A;  4DF4 A;  3GDX A;  2IA6 A;  1TVA A;  5HRE A;  2BPC A;  3GIK A;  4FBU A;  1JXE A;  3V7J A;  5EOZ A;  1S0V A;  9ICT A;  1TFW A;  1KDH A;  3H4B A;  1QTM A;  1BGX T;  4KLO A;  4WC4 A;  1Z00 B;  4NLZ A;  3RR8 A;  4DQQ A;  1S0O A;  3PV8 A;  3RB3 A;  2DPI A;  4BDP A;  8ICU A;  5J29 A;  4MFA A;  2C2R A;  3PR5 B;  2FLL A;  4K4H A;  4ED2 A;  4RPX A;  4F5P A;  3LDA A;  1JQR A;  4FH3 A;  3TAP A;  1KEJ A;  5III A;  1NK8 A;  4FH5 A;  5EWE A;  1T3N A;  5DB7 A;  2B21 A;  4TQS A;  2IBK A;  4DLG A;  4KLM A;  4RU9 A;  3PW0 A;  4RQ5 A;  2AQ0 A;  4DWI A;  2FLN A;  4XQ7 A;  3RBE A;  3PML A;  5J0Y A;  4F50 A;  2DR9 A;  4EBE A;  3QE9 Y;  1UT5 A;  3H7I A;  4XQ8 A;  5KFL A;  1UA1 A;  2BCQ A;  4X4U A;  2M9N A;  4O3O A;  4J9K A;  4BWM A;  4UAZ A;  2HHU A;  4ELU A;  3WFQ E;  2R8H A;  1ZQY A;  4FS1 A;  4Z6F A;  3FDS A;  3UQ0 A;  4ECT A;  1TK8 A;  1C7Y A;  3RJJ A;  1D8Y A;  3N4M B;  4PPX A;  3RAX A;  3ETL A;  4O3S A;  2IHM A;  1WCN A;  3MGH A;  4E7X A;  1JX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...