5BOMA

Dna polymerase beta binary complex with a templating 5clc
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
320
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 320
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bomA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bomA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bomA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bomA03
1ZJMA 8ICEA 4DQIA 5DBBA 7ICOA 4TQRA 5L1LA 2XCAA 1LB2B 8ICGA 1X9SA 1L3VA 1NO5A 1A77A 2M2WA 3H8SA 4TUQA 5HHHA 5KFGA 4FHWA 9ICMA 2AU0A 3UQ0A 1NK4A 5J2DA 4PGQA 4J9SA 5HREA 4DSIA 2JEGA 4F2RA 2MAXA 3G6XA 4DEZA 1SKSA 1ZQIA 8ICOA 4K4HA 4UD4A 3V6KA 3RJHA 4KLFA 3RJKA 3PMLA 3GILA 1XSNA 5KG7A 4XQ7A 4GLXA 1S10A 9ICXA 5EWFA 4FHVA 5J2HA 4ECQA 5KFTA 5J2GA 1PZNA 5J29A 2XGQA 3ZDDA 4I2DA 3RAQA 4RPYA 1RYRA 4M9LA 1ZQDA 2JEIA 4WC0A 4EP7A 1XO1A 4X0BA 2Q66A 4HYKA 4WC5A 2I1QA 5BOLA 4EBDA 4KLMA 4YFKA 4RQ0A 3HIYA 4J9MA 1ZQOA 4F5RA 3PR4A 4GC7A 2UVVA 2PI5A 2ZHBA 3N97B 1XS9D 4G3IA 4LT6A 1ZQLA 3BDPA 2BE3A 4DO9A 1H38A 3H39A 5KT2A 2BQRA 9ICFA 2AQ4A 1X9WA 1ZQSA 4ECSA 2FPMA 4DFPA 1ZQUA 4B9VA 1T3NA 4P4MA 9ICVA 7ICQA 4BWMA 3PV8A 1JQRA 3ETLA 3MDCA 3K75D 1T4GA 3KHLA 2BPGA 4LZGA 3H3AA 3K4GA 3PNCA 4Q43A 9ICQA 5CP2A 1UETA 5HC9A 3KHGA 3MFHA 1F5AA 3NYBA 5J0OA 1D9FA 3T3FA 1TKDA 7ICPA 1V9PA 4JWMA 3H4BA 4O3NA 1IM4A 1MIVA 2A1JA 4X4TA 1JXEA 2XGPA 5DQIA 4O0IA 1UA0A 2JEJA 1RPLA 2C22A 2ALZA 1MQ2A 1LV5A 3GFKB 5DECA 4RQ3A 5J0SA 5KFQA 2BGWA 3GV7B 2XY6A 2BDPA 4O3RA 3V7KA 1KFDA 1S0OA 2AGQA 2ISOA 8ICLA 4QZ9A 1BPZA 3N4MB 4C8KA 9ICGA 2C2RA 4DF4A 4UBCA 5KFRA 1PX5A 5HRGA 4KN4A 3RB3A 4M9NA 4KLHA 4M6WB 4QZCA 4QWAA 4O3QA 4R8UA 1NJYA 4XRHA 4B9TA 2ZJ8A 4M47A 3H7IA 3UQ2A 3V7LA 4O5CA 4J9QA 4ECYA 2FMPA 5J2FA 3C18A 3TFSA 5J2AA 2HHTA 2IBKA 4EYHB 4DWIA 9ICEA 3AQNA 3H37A 5DEDA 3OHBA 4UQGA 1N56A 3OGUA 4EZ9A 9ICBA 3JPSA 1NK7A 4Q8FA 5KFKA 3RRHA 3RB6A 4ELTA 2ZH9A 4RUCA 4DQSA 1R8BA 3ISCA 3H40A 5DGAA 4AT8B 1COOA 4M5DA 1SZPA 3MR6A 4GC6A 3QEBZ 2IMWP 4PH5A 4RQ1A 4O5KA 8ICQA 5HRLA 4DF8A 4AT7A 4KTQA 2ZJAA 7ICVA 3T5JA 4NLNA 2ISPA 4FBTA 5KTQA 4QZFA 3PW2A 3OUYB 2RDJA 1SKRA 2BQ3A 3OUYA 2DR5A 7ICEA 7ICUA 4O3PA 2NRVA 7ICFA 1B43A 1S76D 4JV2A 5KG0A 5IILA 5KFLA 3G6YA 4WC3A 2XO7A 1U4BA 1QSLA 3EPGA 2IA6A 2DFLA 4JK1A 4B9UA 4RZRA 8ICNA 4I28A 4PHAA 4I2IA 2VA2A 2HHXA 4RPZA 1ZQQA 3RJGA 4R64A 3PX0A 1BPDA 4BGDA 4I27A 9ICRA 4BXOB 8ICIA 2ZUBA 4QZGA 2KP7A 5KFSA 4YMMA 4RWQA 4X4NA 3JPPA 8ICPA 1S0VA 4S3NA 2BKEA 3JPNA 2V4QA 4ED8A 3TAQA 1S97A 4MFCA 2Y1JA 2NRTA 2P66A 9ICNA 4M9JA 2NRKA 2FPLA 4FO6A 2HHWA 4NKUA 3H8WA 3KHHA 1TVAA 5KFUA 4UAYA 1D9DA 4YD1A 4DLEA 4JV1A 3C2MA 3JPOA 3UPQA 4Q8EA 2J6UA 2OWOA 1CEZA 2ASJA 8ICTA 4NLKA 5KG4A 4DFMA 2KN7A 1D8LA 5IIOA 5IINA 4DSLA 4I2EA 5KFNA 2RDIA 1S77D 4J9PA 4WCWA 1BVSA 3GIMA 1ZETA 3GIJA 1XWLA 1U47A 3QEAZ 3M8RA 4DL4A 4J9KA 3PX6A 4NY8A 2RFFA 4DL5A 5KFVA 5HRDA 7ICSA 4PHDA 8ICZA 1NJZA 7ICTA 3GIKA 5HHIA 9ICLA 1KTQA 3V72A 1ZQTA 5KFFA 3LDAA 8ICMA 4ED0A 4RWOA 3OVBA 4RNOA 2XC9A 3EW9A 5BOMA 4DL3A 3RB4A 1ZQRA 4DL2A 1ZQYA 4UB3A 3MR5A 4WC1A 4J9LA 1QSSA 4PHEA 4EBCA 5D4BA 4YR3A 4F93B 3RJEA 5DBCA 4TUSA 4UB2A 3TAPA 1K1QA 4C8LA 1DK3A 1SL2A 3T5HA 5L9XA 2XY7A 5KG3A 4F5NA 4F5OA 5IIKA 4DFKA 2PFOA 2M2TA 4QWCA 4FS1A 4XUSA 2W9CB 3BQ2A 3T5KA 4FHXA 3GV5B 4IG8A 3Q8QB 4YMNA 4EBEA 4RPXA 1NK5A 8ICRA 4FHYA 3LK9A 3TI0A 1UA1A 1RXWA 3AQKA 3AQMA 4E8FA 3AU2A 2J6TA 4EBJA 4O3SA 9ICUA 1ZQXA 2XCPA 3V6HA 3PW7A 4F8RA 2M2UA 1NK6A 3C1ZA 4KMUA 3MBYA 3C2LA 4E0DA 4DS4A 1TAQA 1L3TA 4F4WA 2JZBB 3QZ7A 4X4QA 1TFYA 2VANA 4YD2A 4X4VA 1DGSA 4TUPA 5KT5A 3BQTA 3V7JA 3PW0A 4X5VA 1RXVA 5HP4A 1ZQBA 5L1IA 7ICIA 2ZH8A 3HJ1A 3JYYA 5CA7A 2H5XA 4DSEA 1FA0A 3SZ2A 3MABA 1BPEA 2ZH4A 1WCNA 3FYHA 1V4AA 2PBEA 4FBUA 5HRBA 3IHQB 3RR7A 5C5JA 5KG1A 9ICOA 2R8KA 4ATBB 4ATBA 5F9NA 2B21A 2DR9A 4RWNA 5IIIA 2BR0A 1KSPA 2FLLA 5KFIA 4R66A 3MR3A 4GXIA 3TQ1A 4M9HA 4WC7A 4QWEA 3THVA 4JUZA 4YP3A 2C2DA 3KTQA 3ZDCA 1U45A 9ICWA 2BHNA 5DBAA 4F5PA 1D8YA 5DB7A 4YXMA 1T7PA 3RJFA 3NGDA 1ZQAA 1HUZA 1ZYQA 3EYZA 4MFAA 3MFIA 4RNMA 3M8SA 3JPRA 4GXKA 5L1KA 3C23A 2DPJA 5HR9A 2O5AA 3WFPA 8ICJA 4YVZA 8ICVA 4MF2A 2WTFA 1UEUA 4UAZA 3KHRA 4QW8A 4M6WA 4CCHA 7ICRA 1T8EA 8ICXA 1ZQNA 5KFCA 9ICSA 2DRAA 3RBEA 3OVSA 5J0WA 4KLLA 3RJJA 1R8CA 3EWAA 5HNKA 3ISDA 4EYIB 4KLTA 8ICKA 4UB4A 4KLJA 2ZH1A 5DDYA 4Z6FA 4NXZA 1NKCA 8ICCA 2KZ3A 3RB0A 3Q8MA 3UPSA 1HUOA 3GQCA 1TFWA 1K1SA 4IQWA 3ZD8A 3BQ1A 1TAUA 1Z3EB 2J6SA 5HRFA 4E7XA 4AT8A 4J9NA 5D46A 4ZH4A 5KFAA 2ASLA 1SKWA 2R8JA 4DSKA 4LVSA 5KG6A 5F9LA 4ECUA 2HVIA 4ECZA 2KTQA 2LYHA 3PO5A 3PO4A 1MC8A 3OJSA 2R8GA 4KLSA 1ZQKA 3TFRA 4I2JA 3AUOA 2W9AA 4PGXA 5KT3A 4F5QA 5KFWA 2XY5A 2FLPA 1NOMA 5KFJA 4AT9B 1KFTA 4AT9A 3WFOA 3OSNA 5KFDA 4IQVA 4BXOA 3H8JA 1JMSA 4RU9A 2ATLA 2HHUA 8ICBA 7ICJA 4UBBA 4YMOA 3RTVA 4X0AA 4I2AA 4WC4A 9ICHA 3M9MB 1MIWA 2C28A 5HRIA 3RH5A 4X4RA 5J0PA 4YR2A 4TURA 3RR8A 9ICTA 1MIYA 5F2VO 2W9BB 5J0TA 3T5LA 4DFJA 4RNNA 2ZH3A 2ZTDA 1ZQHA 5BPCA 3ISBA 1JX4A 2I9GA 3SV4A 1X9MA 1BPYA 1ZQEA 4X4OA 7ICGA 4ED3A 3B0YA 5DB6A 4I2BA 5J0QA 4DSJA 1DK2A 2FLNA 4RWPA 1XU4A 5CJ7A 3ZD9A 3LWLA 3EZ5A 4DQRA 2M2VA 3Q8SB 1JAJA 5KT4A 2BCVA 4F92B 1ZQZA 4P4OA 1ZQGA 3RRGA 2HHVA 8ICYA 3Q8RB 9ICCA 4WC2A 4DOBA 1R89A 5HRHA 2BCSA 4C8OA 1S0MA 4IR1A 4Z6CA 7ICLA 1JN3A 1YLQA 4I29A 4X4PA 4WBZA 4J9RA 5J0RA 4UAWA 3SV3A 3PW5A 4F91B 4C8MA 4GXJA 1Q79A 1L5UA 5DB9A 5KFZA 5KFYA 3LWMA 5DG7A 2MUTB 3JPTA 1KDHA 2KZMA 3C66A 3G6VA 2Q0ZX 5KG2A 1C7YA 1Y88A 4NM2A 4P4PA 4QZAA 3RH6A 4J9OA 1L3SA 2BCUA 2PFPA 4M0AA 2ZH7A 3HW8A 4KLEA 2V4RA 5HRKA 5CR0A 4F4YA 1ZJNA 4ED6A 8ICHA 4I2GA 4JV0A 3OSPA 1NK9A 4YQWA 2AQ0A 1AROP 1Q78A 3MR2A 4X4SA 4IQTA 2W9CA 1VFGA 4RQ8A 3RAXA 1NJWA 3GDXA 3AQLA 2ZUCA 3M9NB 4KLOA 3WFSC 3GV8B 1TK0A 1Z00B 3AU6A 2DR7A 1Z00A 3UXNA 5EWGA 4IR9A 1U9LA 1XSLA 4IQUA 5KFXA 3MDAA 4PGYA 2NRXA 5EOZA 4QZIA 3GIIA 1NKEA 1ZQCA 4K4IA 2ZTCA 5KFBA 2JZBA 1NKBA 2C2EA 4Z6DA 3PW4A 4DOAA 1BPBA 4M04A 1UT8A 2DVIA 5IIMA 4RQ5A 4M2YA 4EEYA 1RYSA 2FPKA 5JUMA 5KFHA 3PR5B 4DL6A 2BQUA 4B9SA 4IRCA 3C5FA 9ICPA 2O1PA 2ZH5A 2PFQA 2VA3A 1KFSA 3HT3A 4QWBA 2R8IA 1BNOA 4FH3A 4WBYA 4TQSA 4DQQA 5CB1A 2V9WA 4DLGA 1U48A 4YXJA 3QE9Y 1ZQFA 2W8LA 4DSFA 2R8HA 4ECTA 2HHQA 4Z6EA 2GWSA 1N48A 2ID1A 3PMNA 3JPQA 3MGHA 3HWTA 3E2EA 1BNPA 1KLNA 5DKWA 3WFQE 5DQHA 1ZQWA 5IIJA 2P6UA 4XA5A 4Q45A 2P6RA 3OV7A 2UVUA 1WCLA 5J2BA 3M9OB 7ICMA 2VA8A 3UXPA 2HVHA 9ICKA 2ZH2A 4O5EA 3HPOA 4B9LA 1X2IA 4F2SA 3QZ8A 4UD5A 3NTUA 3RH4A 8ICUA 2ZUDA 4KITB 4RQ4A 8ICAA 2W9MA 2ZTEA 1ZQPA 4B9MA 5KFMA 4NLZA 1KNYA 2HHPA 4DQPA 3C5GA 4RQ6A 4QZBA 4BDPA 2F1JA 4MEYA 4QZHA 4MF8A 1QLNA 3RBDA 4IRKA 3MGIA 4KLQA 1ZQVA 4FS2A 2A1JB 4XQ8A 1QSYA 5KG5A 4DS5A 1NJXA 4PHPA 5KFOA 3RJIA 1MQ3A 2BCRA 2PI4A 4ELVA 3EPIA 4ED1A 4ECRA 4X4UA 8ICWA 3H4DA 4M9GA 5HMMA 3TANA 2DPIA 5HMLA 1S0NA 3PY8A 1MSWD 3H38A 1NK8A 1UEVA 1JXLA 5DLGA 4O3OA 5J2CA 4KN7A 4UB5A 3TARA 4QZ8A 1U49A 3L9DA 5J2EA 3UXOA 4R65A 4ED2A 5DDMA 9ICIA 4UB1A 2F1IA 1ZQJA 2NRWA 4RQ7A 5J0XA 4ECXA 1NK0A 2IHNA 2UVRA 5KT6A 4IRDA 1WOTA 3ORYA 4E80A 4RUAA 3WFRE 9ICAA 4R8UB 5KT7A 4I2FA 1KEJA 3C21A 2BPFA 4F50A 4EBKA 7ICKA 1VJ7A 4DOCA 4NLGA 2AJQA 1KRPA 4QW9A 4DL7A 3B0XA 9ICJA 3JZ0A 4MEXA 1SL1A 8ICFA 5L1JA 2KFZA 5EWEA 5J2IA 4QZDA 3BQ0A 1TK5A 4Q44A 5TZVA 1BPXA 2KZZA 2FMSA 2IHMA 4I2CA 1R8AA 2ZHAA 2BCQA 1CUKA 4F4KA 4KLDA 1JIHA 3HJ4A 2DRBA 1B22A 4AT7B 3FDSA 3Q8LA 4JWNA 4KLIA 4WC6A 4F3OA 3ZDBA 3OJUA 1XC9A 1IXRA 5DQGA 3V6JA 1QTMA 4RQ2A 4KLUA 2KFNA 4FHPA 5DG9A 1HJPA 2HHSA 5J0YA 2W9BA 3LQCB 2NRZA 3HP6A 1A76A 2ZJ5A 5D49A 5KFPA 3BJYA 4O9MA 3Q8KA 2BPCA 3IM1A 3C2KA 2AGOA 4C8NA 5DG8A 1TK8A 1DOQA 1XSPA 4K4GA 1S9FA 4MFFA 2HW3A 1OU5A 2UVWA 2ZH6A 4RT3A 3PVXA 4NKTA 5KFEA 2Y1IA 4ED7A 4F4XA 7ICNA 4BWJA 3ZDEA 4YG2A 1RZTA 4B9NA 2ASDA 1EXNA 1SL0A 8ICSA 5J2KA 5J2JA 5CHGA 5DLFA 3OHAA 3PX4A 1TV9A 4ELUA 3SI8A 3C1YA 4PPXA 5J0UA 2FMQA 2W8KA 1BGXT 1UT5A 3HX0A 2AGPA 4EZ6A 2JEFA 2PFNA 4F4ZA 2MUTA 2PXIA 2M9NA 4ECVA 1TFRA 4R63A 5DGBA 1ZQMA 5CWRA 2DR8A 4YCXA 4NM1A 2F1HA 4YR0A 7ICHA 3OVAA 4KLGA 4ECWA 1NZPA 4QZEA 1L3UA 3SYZA 4RT2A 4I2HA 4QWDA 5DB8A 3Q8PB 4P2HA 4FH5A 3ZDAA 4LZDA 4YN4A
chains in the Genus database with same CATH superfamily
3NVYA 2IHOA 4F72A 3SAFA 4OAHA 1X9SA 3ER8C 4TUQA 5KFGA 9ICMA 2MAXA 1DGJA 2K4HA 8ICOA 1L8OA 4Y2XA 3V6KA 3E0FA 3RJHA 2GAFD 4FHVA 4ECQA 1QH9A 2LMRA 5KFTA 3NVVA 4I2DA 1RYRA 2KVCA 1XO1A 4HYKA 1GO3F 3CRXA 2FE9A 3L3FX 4F5RA 3TADC 4LT6A 3C29A 3BDPA 2B51A 9ICFA 3ZI4A 2F77X 4ECSA 1ZQUA 9ICVA 1T3NA 3IRUA 3PV8A 1NI3A 3ETLA 3KHLA 3PNCA 4Q43A 1S8OA 3KD3A 1TKDA 1V9PA 5L1MA 1MIVA 1LV5A 1SZHA 4DFDA 5KFQA 2BGWA 2BDPA 4O3RA 4ICAA 3S6JA 4QZ9A 1BPZA 4C8KA 2E5SA 4UASA 4DF4A 1C20A 3UM9A 2JHDA 1Z1BA 3SENA 4KLHA 4O3QA 4M47A 3H7IA 2WF5A 4O5CA 4J9QA 2QARA 2NO5A 5DEDA 3OHBA 4UARA 4LEVA 3RRHA 4NXUA 3RB6A 2EWRA 3CW2C 2DWQA 4AT8B 5DGAA 2WB1C 3MR6A 3QEBZ 1ZD4A 2WB1F 1M6YA 3KOOA 5HRLA 4KTQA 3T5JA 4NLNA 1SKRA 7ICUA 1S76D 7ICFA 5IILA 5KFLA 4P0QB 1QSLA 4KM5A 4JK1A 2Y9TA 8ICNA 1MN8A 4PHAA 2VA2A 1ZQQA 5AKZA 3PX0A 1BPDA 4CF5A 2YN4A 3F53A 4QZGA 1PK3A 2BKEA 3TAQA 2V4QA 2P66A 4UAYA 4FZLA 1D9DA 1L7PA 4Q8EA 5AM3A 2ASJA 3DDHA 1HIWA 2HOQA 1S77D 4WCWA 3JCFA 2RFFA 8ICZA 2CPRA 4NV0A 3V72A 4ED0A 3OVBA 2GO7A 5BOMA 2YMPA 4LEZA 3WK9A 4EBCA 4US9A 4FE3A 4PL1A 4YR3A 4F93B 2CRXA 3QU9A 3TAPA 1FO4A 1K1QA 4EEKA 5IIKA 4XUSA 2W9CB 3BQ2A 3T5KA 5D61A 4EBEA 4RPXA 3TI0A 4O6AA 1NK6A 3C1ZA 3MBYA 3C2LA 4CE6A 2F3NA 4C4RA 2JZBB 3QZ7A 5HR6A 2FDRA 4X4VA 1DGSA 5AK3A 2EAPA 5GTIU 1B4FA 2HCFA 2KJ5A 2Q4TA 4FBUA 4C4TA 5HRBA 2KICA 5KG1A 4ATBA 2DR9A 4RWNA 2B21A 4OJOA 1SB3C 2RLTA 5KFIA 4OAIZ 3KTQA 3ZDCA 3ETRA 4F5PA 5ALTA 1T7PA 5ALVA 3NGDA 4PJ0U 4HX0A 1Z4NA 4UAZA 1ZQNA 5KFCA 9ICSA 8ICKA 4KLJA 5DDYA 1Z1VA 4NXZA 2ZG6A 3Q8MA 3UPSA 3VC8A 1TFWA 1K1SA 4IQWA 4UAVA 4AT8A 4B6JA 4J9NA 2ASLA 5ALUA 4PL2A 2LYHA 3PO4A 3NRWA 2VJ5A 4P0QA 4I2JA 2E8MA 3AM9A 2XY5A 1NOMA 2KMDA 4AT9B 2KJ8A 5KFDA 1X6IA 1JMSA 4RU9A 7ICJA 4UBBA 4YMOA 4X0AA 4I2AA 3I76A 9ICHA 1MIWA 5FP0A 4X4RA 3RR8A 3AN1A 5AHXA 4RNNA 4FO1A 2ZTDA 5BPCA 1Q3VA 2LM1A 4ED3A 3B0YA 2DF4B 1DK2A 2FLNA 1XU4A 3CNHA 5CJ7A 3EZ5A 2M2VA 1JAJA 3RRGA 2HHVA 9ICCA 4DOBA 1NNLA 1S0MA 2EH9A 1YLQA 3I28A 4I29A 4WBZA 5J0RA 4UAWA 3PW5A 3PZPA 2G5IB 4GXJA 4JB3A 5KFZA 3LWMA 1KDHA 2KZMA 2JR5A 3G6VA 1Y88A 2HBLA 4P4PA 2PFPA 2QB0B 2W7PA 3H0MB 2NYVA 2AQ0A 1AROP 5JU5A 5ALRA 3MR2A 2B56A 3H8MA 4EX7A 2W9CA 5AK4A 3RAXA 2JH7A 3AQLA 4NLCA 1Z00B 3AU6A 2D6FC 5EWGA 1U9LA 4IQUA 3MDAA 2NRXA 4QZIA 1PVRA 1ZQCA 2JZBA 2C2EA 4Z6DA 3PW4A 2FJ6A 2EQYA 1BPBA 1UT8A 3MCRA 5IIMA 4UW9A 4B9SA 3WK6A 4Y2RA 3AEVA 1KFSA 3HT3A 4QWBA 4DQQA 5CB1A 1X40A 4NWIA 1ZQFA 2KIVA 4Y2QA 4IC9A 2R8HA 4ECTA 2ES6A 2HMXA 2GWSA 3HWTA 4O67A 5DQHA 5IIJA 2P6UA 3SAGA 4B9LA 1X2IA 3QZ8A 5G5HA 8ICUA 8ICAA 5AKJA 1JALA 3CP8A 1QLNA 3MGIA 4KLQA 4FS2A 5KFOA 3EPIA 4ED1A 4ECRA 4O69A 4X4UA 3H4DA 1S0NA 3PY8A 1JXLA 4KN7A 3L9DA 3UXOA 4ED2A 9ICIA 2UVRA 4WJ3B 3WFRE 2RHFA 3WK4A 2H3IA 7ICKA 5ALXA 2ZXIA 1KRPA 4QW9A 4DL7A 1SL1A 5L1JA 5J2IA 3K1RB 1N5XA 2M0NA 2FMSA 4F4KA 3OTQA 1JIHA 3QU5A 4JWNA 4KLIA 4WC6A 3OJUA 1XC9A 2KFNA 5DQGA 2KOBA 2LM4A 4KX3A 5J0YA 1SV0C 3LYSA 2WF8A 3QU4A 3Q8KA 3FC4A 2LI6A 4RT3A 3PVXA 2Y1IA 4ED7A 4F4XA 4B9NA 2WF7A 5CHGA 2GOLA 2XVTA 4PPXA 5J0UA 1FIQA 3HX0A 4F4ZA 2PXIA 2M9NA 2YY6A 5ALQA 4NM1A 2F1HA 2QB0A 3M6KA 1NZPA 4ECWA 2HN2A 3R9KA 4RT2A 1ZJMA 2YMQA 5DBBA 7ICOA 5C0YA 4FHWA 2M2WA 2KKPA 1D8BA 2KE7A 2AU0A 3UQ0A 4J9SA 1ZQIA 1COKA 1SKSA 1SGGA 4K4HA 3GILA 1XSNA 4XQ7A 3F2BA 2Z7JA 5J2HA 2WAQC 1VLBA 2WAQF 4RPYA 2HDOA 2JEIA 4WC0A 4EP7A 4WC5A 3HIYA 4O68A 4J9MA 4NXWA 5AKGA 3NWIA 1J97A 2FI1A 3A0HU 4DO9A 2BQRA 2W03A 1X9WA 3HJEA 2IOFK 4P4MA 1T4GA 1NZBA 3H3AA 3K4GA 2DL0A 5HC9A 3KHGA 3MFHA 1F5AA 3MC1A 5J0OA 5AKHA 1D9FA 2CN1A 4JWMA 4O3NA 4US8A 1IM4A 4J03A 5DQIA 4O0IA 1IV8A 2C22A 1MQ2A 3D6JA 1FFUA 3WKEA 2R18A 3GFKB 3QUTA 5DECA 4RQ3A 8ICLA 3N4MB 9ICGA 2C2RA 4UAUA 4A8EA 5HRGA 3E58A 4M6WB 4QZCA 2HVIA 3UQ2A 3V7LA 3C18A 2FMPA 5J2FA 3PSIA 4DWIA 2YB4A 3OGUA 4C0ZA 5AIAA 4Q8FA 2OH2A 2MSNA 3WK5A 2ZH9A 4DQSA 1R8BA 1UPHA 4PH5A 2DUYA 7ICVA 2ISPA 4FBTA 5KTQA 3PSPA 4IS7A 2DR5A 2NRVA 1B43A 2OHFA 1K5OA 4JV2A 4OO1J 5KG0A 5AM1A 4WC3A 2IA6A 1JRPA 2ZIXB 4RZRA 4CDGA 4R64A 4BGDA 2G0AA 2KHQA 1A6SA 5KAFU 2E3TA 3JPPA 1O03A 4ED8A 1ZXIA 2EZXA 2NRTA 2G09A 2FPLA 4JMUA 2KD1A 4WOYA 2HHWA 4JV1A 4AYBC 3C2MA 3UPQA 1CEZA 5AI6A 4NLKA 3WKAA 2KN7A 4DSLA 2KEYA 3GIMA 3GIJA 1XWLA 1U47A 3M8RA 4DL5A 4PHDA 1ZQTA 4DL2A 4WC1A 1QSSA 2A3VA 3F2CA 3RJEA 4C8LA 1SL2A 4F5NA 4QWCA 2G5HB 3Q8QB 1NK5A 4FHYA 3AQKA 1RXWA 2J6TA 4EBJA 4O3SA 2XCPA 4F8RA 2M2UA 1TAQA 1L3TA 4F4WA 5D62A 4X4QA 1TFYA 2VANA 4OJPA 3V7JA 1O08A 3PW0A 4X5VA 1RXVA 5HP4A 4WH5A 7ICIA 2ZH8A 1WWVA 5ALMA 5CA7A 2H5XA 4DSEA 2DKZA 1FA0A 3MABA 5ALGA 4ATBB 2R8KA 2YB1A 4WQLA 2BR0A 2FLLA 4EGWA 3TQ1A 3MR3A 1LKYA 4USAA 4M9HA 1L7OA 4WQKA 4QWEA 4C7ZA 1U45A 9ICWA 2BHNA 2ESEA 5DB7A 3NASA 3M8SA 3WFPA 2DPJA 8ICJA 4YVZA 8ICVA 1ZRMA 4MF2A 4NLBA 2DGZA 4M6WA 8ICXA 2DRAA 2QLTA 5J0WA 4KLLA 2JRZA 4G9BA 4K98A 3ZD8A 3BQ1A 5D46A 5KFAA 4LVSA 5KG6A 4ECUA 2MA1A 2FCLA 5KNIA 4F71A 2R8GA 3NKUA 1ZQKA 1Q3UA 1XO0A 2ZIXA 4F5QA 5KFWA 4EX6A 4OD0A 5KFJA 4K8VA 4IQVA 2ATLA 8ICBA 3DV9A 2K8CB 2C28A 5HRIA 4TURA 1MIYA 5F2VO 3MGVA 2W9BB 2DQNB 3T5LA 4DFJA 5B5EU 2ZH3A 2I9GA 3D2SA 1X9MA 4Y2TA 2YX8A 4DSJA 4N7RA 3ZD9A 5KT4A 3LVVA 5AKXA 1R89A 5ALNA 4BX9C 3K7DA 2BCSA 4Z6CA 2F8LA 1KW4A 4X4PA 4J9RA 4Y2JA 2PMZC 5AI4A 2OYYA 4F91B 2PMZF 5T14A 4NXXA 3N28A 2W11A 1L5UA 5DB9A 2MUTB 3JPTA 3C66A 5G5GA 4RWPA 4NM2A 3RH6A 1L3SA 2BCUA 4J9OA 2ZH7A 2JMGA 1OUQA 4KLEA 5HRKA 4F4YA 4ED6A 3OSPA 2EAMA 4YQWA 4C4SA 4IQTA 1DXSA 3H0LB 5EOZA 5JTIA 1ZQ1C 2ZTCA 2DVIA 4EEYA 1RYSA 5KFHA 2HBMA 1P7DA 4IRCA 5AKIA 1UQVA 3N7RC 3C5FA 5CFUA 2ZH5A 2VA3A 3WKBA 3NRZA 1U48A 1WYGA 2HOIA 4YXJA 4I0UA 2W8LA 4DSFA 1N48A 2ID1A 3PMNA 3JPQA 1ECWA 2PKEA 3KKAA 2QB1A 9ICKA 3M9OB 7ICMA 2HVHA 4O5EA 3HPOA 4F2SA 5CHEA 2ZUDA 3IP4B 1QCKA 2N1RA 2HHPA 5F3XB 4DQPA 3C5GA 4RQ6A 2F1JA 1PVPA 2VKQA 1F44A 3ERCC 1QSYA 1IIPA 2OCEA 5KG5A 4DS5A 1NJXA 3QNMA 3WU2U 3F5EA 5HMMA 3H38A 2K8BB 1B0XA 3OPXA 5AM4A 2CXYA 5DLGA 5J2CA 4UB5A 2OEHA 4K9AA 4R65A 2Y0SC 5AI9A 1ZQJA 4IRDA 2NRWA 2Y0SF 4RQ7A 2EAOA 3L5KA 4ECXA 3QUBA 5KT6A 4E80A 4BJQA 3O0FA 9ICAA 4R8UB 5KT7A 1KEJA 3C21A 3H0RB 2LPEA 5J8YA 3JZ0A 5B66U 2KZZA 1R8AA 5TZVA 4PZNA 2DRBA 4NXVA 4F3OA 5AM5A 1QTMA 4KLUA 4RQ2A 3U26A 1JI7A 2LBOA 2W9BA 2GLEA 3BZKA 3HP6A 3BJYA 1L7MA 2B0CA 4C8NA 5DG8A 4K4GA 1DOQA 2HW3A 1S9FA 1QQ6A 4NKTA 1RG6A 1YZ6A 3ZDEA 1RZTA 8ICSA 5J2KA 5J2JA 3UMBA 4QNLA 2OXOA 3OHAA 4Y2PA 3BZCA 5ALHA 2W8KA 4EZ6A 2PFNA 2MUTA 2RP5A 5ALJA 5CWRA 2DR8A 3OVAA 4QZEA 4K9BA 4I2HA 4P2HA 3Q8PB 3ZDAA 8ICEA 4DQIA 4TQRA 1LB2B 3BQ7A 8ICGA 1A77A 2JH1A 5HREA 2JEGA 4F2RA 2L5YA 3G6XA 4DEZA 3RJKA 2HOFA 3PMLA 3FM9A 5KG7A 1S10A 2EZZA 2B6GA 1PVQA 2F76X 3RAQA 1ZD5A 4M9LA 2HBJA 2I1QA 4KLMA 4RQ0A 1KQQA 1ZQOA 4GC7A 2PI5A 4OJLA 1F5SA 3N97B 1XS9D 4G3IA 1ZQLA 1H38A 2B4VA 3H39A 2AQ4A 4B9VA 1SWVA 4BWMA 3AQEA 1JQRA 2YTUA 4KMOB 9ICQA 3D2NA 5CP2A 3NYBA 7ICPA 3T3FA 1VDVA 2A19A 3EUB2 1RDFA 1RYUA 3QYPA 2JEJA 2ALZA 2D3DA 5J0SA 3V7KA 1KFDA 5AKEA 2K60A 4UBCA 1PX5A 3RB3A 4M9NA 4QWAA 4R8UA 9ICBA 3TFSA 2DKXA 2MRLA 3H37A 3AQNA 1N56A 4UQGA 5KFKA 5KL1B 3QUQA 4RUCA 3H40A 1COOA 4GC6A 3RF9A 2IMWP 4O5KA 4K96A 8ICQA 2ZJAA 3PW2A 2RDJA 3OUYA 7ICEA 4O3PA 3F2DA 2JGAA 4EEBA 1U4BA 3M7DA 4MKPA 2HHXA 4NJ8A 4RQNA 1ZD3A 2E1EA 4X4NA 3SMVA 4S3NA 1S0VA 1S97A 5GTHU 2Y1JA 4Y2SA 4M9JA 4FO6A 4NKUA 3KHHA 5KFUA 2EZYA 3JPOA 1RQLA 5ALWA 2J6UA 2BBJA 1D8LA 1UCVA 4AP9A 4I2EA 3GU3A 2RDIA 1CRXA 4J9PA 1BVSA 4DL4A 4NY8A 2G06A 5HRDA 7ICSA 1NJZA 7ICTA 5EE0A 3GIKA 5HHIA 9ICLA 4RWOA 3LDAA 3EW9A 4DL3A 1ZQRA 1ZQYA 3MR5A 4J9LA 3NVZA 2IOHA 5DBCA 3AQFA 4UB2A 3T5HA 5L9XA 2XY7A 5KG3A 4DFKA 5H2FU 3OWGA 4IG8A 4YMNA 1UA1A 3AQMA 1SWWA 3AU2A 1ZQXA 2KIWA 3PW7A 4E0DA 4DS4A 1PUZA 4TUPA 5KT5A 1L8LA 3SQIA 2HI0A 2ZIUA 5L1IA 1T94A 3HJ1A 4QJFB 3SAHA 3BS7A 3SZ2A 1BPEA 2ZH4A 1WCNA 3FYHA 3RR7A 9ICOA 4K97A 3CYMA 1KSPA 1TE2A 1WWUA 3UMCA 1LKYB 4R66A 4WC7A 3THVA 2C2DA 5DBAA 2G08A 1ZQAA 4RNMA 2KNJA 5HR9A 5L1KA 3DEEA 3KHRA 7ICRA 4QW8A 3RBEA 3OVSA 3RJJA 3EWAA 5HNKA 1NKCA 3RB0A 1HUOA 4ZH4A 2R8JA 1SKWA 4DSKA 4ECZA 5CRXA 3CK6A 1FEZA 3PO5A 1QQ7A 2W3SA 5AIBA 4KLSA 1WG8A 3AUOA 1LVHA 4PGXA 5ALEA 5KT3A 1KFTA 3WFOA 2W55A 3OSNA 1MA7A 3H8JA 5AKKA 3M9MB 2ZIVA 4Y2UA 3RH5A 4HAIA 4YR2A 2GH1A 1ZQHA 3ISBA 4U6PA 3SV4A 1YZ7A 4I2BA 5J0QA 3C28A 2W04A 3LWLA 5AKYA 3Q8SB 2AHOB 1SXDA 4F92B 4P4OA 5HRHA 5AI5A 2H3VA 2W43A 7ICLA 2EANA 1Q79A 3QU7A 5EE1A 2KG5A 2LYBA 1C7YA 4QZAA 4M0AA 3HW8A 3IN5A 5CR0A 8ICHA 4I2GA 4JV0A 1Z4OA 1Q78A 4X4SA 3M1YA 1GPJA 1T3QA 3HKZC 3HKZF 3AMZA 1NJWA 1ZOLA 3M9NB 2KHVA 3D2QA 3GV8B 1TK0A 2E8OA 2DR7A 4IR9A 1XSLA 2JXJA 5ALZA 4PGYA 1NKEA 5JRTA 3GIIA 4UB6U 1WUDA 5KAIU 4C80A 4M04A 3EF2A 3BS5A 4M2YA 3I1YA 5JUMA 3N7SC 1JUDA 3PR5B 5B3QA 1RM6C 2ODGA 2BQUA 2O1PA 1X66A 4FH3A 2R8IA 4UATA 2V9WA 4DLGA 3QE9Y 2HHQA 4Z6EA 3MGHA 3TKAA 5A0LA 1BNPA 3RFAA 5J2BA 3UXPA 1X42A 3NTUA 3RH4A 4RQ4A 1RQNA 2W9MA 2ZTEA 1ZQPA 4NLZA 1KNYA 1Z19A 1Q46A 4QZBA 4BDPA 4MEYA 4QZHA 1X9XA 4MF8A 4IRKA 2A1JB 4XQ8A 3J81j 3QX7A 3RJIA 2BCRA 4ELVA 3N7PD 3IG8A 5HMLA 2AXTU 2ZIWA 1UEVA 4OCZA 4QZ8A 1OXJA 1YT3A 5DDMA 4UB1A 2F1IA 2IHNA 1A0PA 4EENA 5TISU 1WOTA 3ORYA 4RUAA 1KBUA 4I2FA 2BPFA 4EBKA 4F50A 4DOCA 2AJQA 3B0XA 9ICJA 8ICFA 4K99A 2VJ4A 1TK5A 3T79A 4Q44A 3A0BU 4I2CA 2ZHAA 2BCQA 1CUKA 4KLDA 3HJ4A 3SEIA 1B22A 4AT7B 3WKCA 2WFAA 3ZDBA 3V6JA 4FHPA 2HHSA 1A76A 5KFPA 2KVSA 4OAGA 3IM1A 3C2KA 5EE9A 1OU5A 2WF6A 2ZH6A 5KFEA 5B3PA 1PK1B 2HN1A 1EXNA 5ALFA 2DBYA 3PX4A 2I6XA 3F5AA 3SI8A 2KSOB 1BGXT 1UT5A 2AGPA 1ZQMA 4NL9A 4R63A 2KKVA 5KL8B 5DGBA 4YCXA 5HR7A 3IDWA 1L3UA 3SYZA 5DB8A 4FH5A 4YN4A 2F2AB 2XIDA 5L1LA 1NO5A 2XCAA 3GZFA 1L3VA 3H8SA 5HHHA 1NK4A 3QUCA 5J2DA 4PGQA 4DSIA 4UD4A 2K4IA 4IL6U 4KLFA 4OJ6A 4GLXA 9ICXA 3FAHA 5EWFA 2XICA 5J2GA 1PZNA 5J29A 2XGQA 3ZDDA 1ZQDA 3PSFA 2F8KA 4X0BA 2Q66A 5BOLA 4EBDA 4YFKA 3PR4A 2UVVA 2ZHBA 1XNSA 2RRDA 2LYAA 2BE3A 5KT2A 4JLZA 1KKXA 1ZQSA 2FPMA 4DFPA 4RQMA 2W3RA 1HEKA 7ICQA 3MDCA 3K75D 3TACB 2BPGA 2XI9A 4LZGA 2F44A 1UETA 5AK5A 3H4BA 1SIJA 5AK6A 2A1JA 4X4TA 1JXEA 2XGPA 1UA0A 1RPLA 3QXGA 4C7YA 5ALSA 1VJ5A 3GV7B 2XY6A 2BBHA 1S0OA 2AGQA 2ISOA 4UB8U 5KFRA 4NXTA 4KN4A 2D8CA 1NJYA 4XRHA 4B9TA 2ZJ8A 4ECYA 5J2AA 2HHTA 1SXEA 4EYHB 2IBKA 9ICEA 5CFTA 4QIWC 5ALYA 4EZ9A 2K4PA 4QIWF 3JPSA 1NK7A 2AH5A 4ELTA 5AICA 3ISCA 4M5DA 1SZPA 4RQ1A 4Y2VA 4DF8A 4AT7A 2VIXA 5ALPA 1SV4A 4QZFA 3OUYB 2BQ3A 2MU2A 4OAFA 3SR6A 3G6YA 2XO7A 4U7CA 3EPGA 2DFLA 4B9UA 4NL9C 4I2IA 4RPZA 2K89A 3RJGA 4I27A 9ICRA 1JROA 4BXOB 8ICIA 2ZUBA 2KP7A 5KFSA 4YMMA 4RWQA 1PK1A 8ICPA 4JLXA 3JPNA 4MFCA 9ICNA 2NRKA 4CRXA 5AKLA 3H8WA 3KZXA 1TVAA 2E1FA 4YD1A 4DLEA 2KSOA 2OWOA 8ICTA 5KG4A 4DFMA 5IINA 5IIOA 3WKDA 1V38A 5KFNA 2O6KA 1ZETA 3QEAZ 4FFDA 4ACOA 4J9KA 3PX6A 4LEYA 5KFVA 2H3FA 1CI4A 3VCBA 4FHXA 1KTQA 5KFFA 8ICMA 1FFVA 1SV0A 2E8NA 4RNOA 2XC9A 3RB4A 4UB3A 4FZNA 4PHEA 3KKAC 5D4BA 2W7OA 2Y9UA 4TUSA 1DK3A 3PHZA 1F0MA 4F5OA 2PFOA 2RQ5A 2M2TA 4FS1A 1N62A 5AI8A 1J2MA 2H3ZA 3GV5B 4EV6A 1J2NA 8ICRA 3LK9A 4P0PB 2HSZA 2KV2A 4E8FA 2BDUA 3V6HA 3KFUF 9ICUA 2QKQA 2JV3A 4PZOA 4KMUA 2YMMA 4YD2A 2NV3A 3KZIU 3BQTA 2ZIUB 1OW5A 2YMLA 4BUGA 1ZQBA 5EE3A 3JYYA 1V4AA 2PBEA 5K4LA 3IHQB 5C5JA 1QQ5A 5F9NA 4EEDA 2WHEA 5IIIA 4GXIA 5J8YC 3ONNA 4JUZA 5ALIA 4YP3A 2OM6A 1D8YA 2EDUA 4XJEA 4YXMA 3ED5A 3RJFA 1HUZA 1ZYQA 3EYZA 4MFAA 3MFIA 3JPRA 4GXKA 2O5AA 3C23A 3B9JA 5CEHA 2P35A 1N60A 2WTFA 1UEUA 1KL9A 4GFJA 2G07A 4CCHA 5ALOA 1T8EA 5AM2A 1R8CA 2H3QA 4CNQA 3ISDA 4EYIB 4KLTA 4UB4A 2ZH1A 4Z6FA 8ICCA 2KZ3A 5E79U 3GQCA 4Y2YA 1TAUA 1Z3EB 2J6SA 5HRFA 4E7XA 3NVOA 3SD7A 2E8PA 5F9LA 2KTQA 3KBBA 3HRDD 1MC8A 1Q8KA 3OJSA 3TFRA 3L4PA 2W9AA 3IG5A 2FLPA 4KB6A 1N63A 4AT9A 4BXOA 4DCCA 2HHUA 3RTVA 1N5WA 4WC4A 2ZIVB 5J0PA 9ICTA 5J0TA 1S5LU 1V97A 1JX4A 3K1ZA 1BPYA 1ZQEA 4X4OA 4LJXA 7ICGA 3WK8A 1ED1A 5DB6A 4DQRA 1L7NA 2BCVA 1ZQGA 1ZQZA 8ICYA 4WC2A 3Q8RB 3PSTA 4IR1A 4C8OA 1JN3A 3SV3A 4C8MA 4FZMA 5KFYA 5DG7A 2Q0ZX 5KG2A 5D63A 2IOFA 2V4RA 1ZJNA 2I5HA 1NK9A 2K8AA 1VFGA 4RQ8A 3GDXA 5JTGA 2ZUCA 3HILA 4KLOA 1N61A 3NUQA 4P0PA 3WFSC 1Z00A 3UXNA 1L6NA 5KFXA 4K4IA 3UMGA 5KFBA 1NKBA 3AL0B 4DOAA 4KX5A 3BS5B 4RQ5A 1N2XA 2FPKA 3WK7A 5CFSA 1URJA 4DL6A 9ICPA 1KN5A 2PFQA 1X6JA 1BNOA 4OJ5A 4WBYA 3IV6A 4TQSA 2KJ9A 2W54A 1TAMA 3ALRA 4O3MA 3E2EA 1KLNA 5DKWA 3WFQE 1ZQWA 4XA5A 1UHUA 3OV7A 4Q45A 2P6RA 2UVUA 1WCLA 2BZFA 2ZH2A 2LKYA 2VA8A 1V85A 4UD5A 2WF9A 4KITB 4B9MA 5KFMA 2A1AA 3NS1A 3RBDA 1ZQVA 3TADA 5AM0A 4PHPA 2PI4A 1MQ3A 3QU2A 4GIBA 8ICWA 4M9GA 3TANA 2DPIA 5ALDA 1MSWD 2ZIWB 1NK8A 4O3OA 3TARA 4MHVA 4CF3A 1U49A 5J2EA 5J0XA 1NK0A 5ALLA 4NLGA 2QARB 4ZOHC 4MEXA 2IUBA 1DRGA 2KFZA 5EWEA 1BPXA 4QZDA 3BQ0A 2IHMA 4EELA 1IG6A 1ZRNA 3FDSA 3Q8LA 2HBKA 1IXRA 5DG9A 1HJPA 1AQ6A 3ICXA 4CF4A 3LQCB 2NRZA 2ZJ5A 5D49A 4O9MA 2ZXHA 2BPCA 2AGOA 1TK8A 4MFFA 1XSPA 4LEWA 4CGZA 2UVWA 2GA9D 7ICNA 4BWJA 4YG2A 2ASDA 3NVWA 1SL0A 2NO4A 5DLFA 1TV9A 4ELUA 3C1YA 2FMQA 3ER9B 2KK0A 2JEFA 5ALKA 4AYBF 4ECVA 1TFRA 2LHTA 1ZD2P 2YQEA 5AI0A 2K4EA 3LVWA 4YR0A 7ICHA 4KLGA 3M6ZA 4QWDA 1VJ7A 4LZDA 4I28A
chains in the Genus database with same CATH topology
1ZJMA 8ICEA 4DQIA 5DBBA 7ICOA 4TQRA 5L1LA 2XCAA 1LB2B 8ICGA 1X9SA 1L3VA 1NO5A 1A77A 2M2WA 3H8SA 4TUQA 5HHHA 5KFGA 4FHWA 9ICMA 2AU0A 3UQ0A 1NK4A 5J2DA 4PGQA 4J9SA 5HREA 4DSIA 2JEGA 4F2RA 2MAXA 3G6XA 4DEZA 1SKSA 1ZQIA 8ICOA 4K4HA 4UD4A 3V6KA 3RJHA 4KLFA 3RJKA 3PMLA 3GILA 1XSNA 5KG7A 4XQ7A 4GLXA 1S10A 9ICXA 5EWFA 4FHVA 5J2HA 4ECQA 5KFTA 5J2GA 1PZNA 5J29A 2XGQA 3ZDDA 4I2DA 3RAQA 4RPYA 1RYRA 4M9LA 1ZQDA 2JEIA 4WC0A 4EP7A 1XO1A 4X0BA 2Q66A 4HYKA 4WC5A 2I1QA 5BOLA 4EBDA 4KLMA 4YFKA 4RQ0A 3HIYA 4J9MA 1ZQOA 4F5RA 3PR4A 4GC7A 2UVVA 2PI5A 2ZHBA 3N97B 1XS9D 4G3IA 4LT6A 1ZQLA 3BDPA 2BE3A 4DO9A 1H38A 3H39A 5KT2A 2BQRA 9ICFA 2AQ4A 1X9WA 1ZQSA 4ECSA 2FPMA 4DFPA 1ZQUA 4B9VA 1T3NA 4P4MA 9ICVA 7ICQA 4BWMA 3PV8A 1JQRA 3ETLA 3MDCA 3K75D 1T4GA 3KHLA 2BPGA 4LZGA 3H3AA 3K4GA 3PNCA 4Q43A 9ICQA 5CP2A 1UETA 5HC9A 3KHGA 3MFHA 1F5AA 3NYBA 5J0OA 1D9FA 3T3FA 1TKDA 7ICPA 1V9PA 4JWMA 3H4BA 4O3NA 1IM4A 1MIVA 2A1JA 4X4TA 1JXEA 2XGPA 5DQIA 4O0IA 1UA0A 2JEJA 1RPLA 2C22A 2ALZA 1MQ2A 1LV5A 3GFKB 5DECA 4RQ3A 5J0SA 5KFQA 2BGWA 3GV7B 2XY6A 2BDPA 4O3RA 3V7KA 1KFDA 1S0OA 2AGQA 2ISOA 8ICLA 4QZ9A 1BPZA 3N4MB 4C8KA 9ICGA 2C2RA 4DF4A 4UBCA 5KFRA 1PX5A 5HRGA 4KN4A 3RB3A 4M9NA 4KLHA 4M6WB 4QZCA 4QWAA 4O3QA 4R8UA 1NJYA 4XRHA 4B9TA 2ZJ8A 4M47A 3H7IA 3UQ2A 3V7LA 4O5CA 4J9QA 4ECYA 2FMPA 5J2FA 3C18A 3TFSA 5J2AA 2HHTA 2IBKA 4EYHB 4DWIA 9ICEA 3AQNA 3H37A 5DEDA 3OHBA 4UQGA 1N56A 3OGUA 4EZ9A 9ICBA 3JPSA 1NK7A 4Q8FA 5KFKA 3RRHA 3RB6A 4ELTA 2ZH9A 4RUCA 4DQSA 1R8BA 3ISCA 3H40A 5DGAA 4AT8B 1COOA 4M5DA 1SZPA 3MR6A 4GC6A 3QEBZ 2IMWP 4PH5A 4RQ1A 4O5KA 8ICQA 5HRLA 4DF8A 4AT7A 4KTQA 2ZJAA 7ICVA 3T5JA 4NLNA 2ISPA 4FBTA 5KTQA 4QZFA 3PW2A 3OUYB 2RDJA 1SKRA 2BQ3A 3OUYA 2DR5A 7ICEA 7ICUA 4O3PA 2NRVA 7ICFA 1B43A 1S76D 4JV2A 5KG0A 5IILA 5KFLA 3G6YA 4WC3A 2XO7A 1U4BA 1QSLA 3EPGA 2IA6A 2DFLA 4JK1A 4B9UA 4RZRA 8ICNA 4I28A 4PHAA 4I2IA 2VA2A 2HHXA 4RPZA 1ZQQA 3RJGA 4R64A 3PX0A 1BPDA 4BGDA 4I27A 9ICRA 4BXOB 8ICIA 2ZUBA 4QZGA 2KP7A 5KFSA 4YMMA 4RWQA 4X4NA 3JPPA 8ICPA 1S0VA 4S3NA 2BKEA 3JPNA 2V4QA 4ED8A 3TAQA 1S97A 4MFCA 2Y1JA 2NRTA 2P66A 9ICNA 4M9JA 2NRKA 2FPLA 4FO6A 2HHWA 4NKUA 3H8WA 3KHHA 1TVAA 5KFUA 4UAYA 1D9DA 4YD1A 4DLEA 4JV1A 3C2MA 3JPOA 3UPQA 4Q8EA 2J6UA 2OWOA 1CEZA 2ASJA 8ICTA 4NLKA 5KG4A 4DFMA 2KN7A 1D8LA 5IIOA 5IINA 4DSLA 4I2EA 5KFNA 2RDIA 1S77D 4J9PA 4WCWA 1BVSA 3GIMA 1ZETA 3GIJA 1XWLA 1U47A 3QEAZ 3M8RA 4DL4A 4J9KA 3PX6A 4NY8A 2RFFA 4DL5A 5KFVA 5HRDA 7ICSA 4PHDA 8ICZA 1NJZA 7ICTA 3GIKA 5HHIA 9ICLA 1KTQA 3V72A 1ZQTA 5KFFA 3LDAA 8ICMA 4ED0A 4RWOA 3OVBA 4RNOA 2XC9A 3EW9A 5BOMA 4DL3A 3RB4A 1ZQRA 4DL2A 1ZQYA 4UB3A 3MR5A 4WC1A 4J9LA 1QSSA 4PHEA 4EBCA 5D4BA 4YR3A 4F93B 3RJEA 5DBCA 4TUSA 4UB2A 3TAPA 1K1QA 4C8LA 1DK3A 1SL2A 3T5HA 5L9XA 2XY7A 5KG3A 4F5NA 4F5OA 5IIKA 4DFKA 2PFOA 2M2TA 4QWCA 4FS1A 4XUSA 2W9CB 3BQ2A 3T5KA 4FHXA 3GV5B 4IG8A 3Q8QB 4YMNA 4EBEA 4RPXA 1NK5A 8ICRA 4FHYA 3LK9A 3TI0A 1UA1A 1RXWA 3AQKA 3AQMA 4E8FA 3AU2A 2J6TA 4EBJA 4O3SA 9ICUA 1ZQXA 2XCPA 3V6HA 3PW7A 4F8RA 2M2UA 1NK6A 3C1ZA 4KMUA 3MBYA 3C2LA 4E0DA 4DS4A 1TAQA 1L3TA 4F4WA 2JZBB 3QZ7A 4X4QA 1TFYA 2VANA 4YD2A 4X4VA 1DGSA 4TUPA 5KT5A 3BQTA 3V7JA 3PW0A 4X5VA 1RXVA 5HP4A 1ZQBA 5L1IA 7ICIA 2ZH8A 3HJ1A 3JYYA 5CA7A 2H5XA 4DSEA 1FA0A 3SZ2A 3MABA 1BPEA 2ZH4A 1WCNA 3FYHA 1V4AA 2PBEA 4FBUA 5HRBA 3IHQB 3RR7A 5C5JA 5KG1A 9ICOA 2R8KA 4ATBB 4ATBA 5F9NA 2B21A 2DR9A 4RWNA 5IIIA 2BR0A 1KSPA 2FLLA 5KFIA 4R66A 3MR3A 4GXIA 3TQ1A 4M9HA 4WC7A 4QWEA 3THVA 4JUZA 4YP3A 2C2DA 3KTQA 3ZDCA 1U45A 9ICWA 2BHNA 5DBAA 4F5PA 1D8YA 5DB7A 4YXMA 1T7PA 3RJFA 3NGDA 1ZQAA 1HUZA 1ZYQA 3EYZA 4MFAA 3MFIA 4RNMA 3M8SA 3JPRA 4GXKA 5L1KA 3C23A 2DPJA 5HR9A 2O5AA 3WFPA 8ICJA 4YVZA 8ICVA 4MF2A 2WTFA 1UEUA 4UAZA 3KHRA 4QW8A 4M6WA 4CCHA 7ICRA 1T8EA 8ICXA 1ZQNA 5KFCA 9ICSA 2DRAA 3RBEA 3OVSA 5J0WA 4KLLA 3RJJA 1R8CA 3EWAA 5HNKA 3ISDA 4EYIB 4KLTA 8ICKA 4UB4A 4KLJA 2ZH1A 5DDYA 4Z6FA 4NXZA 1NKCA 8ICCA 2KZ3A 3RB0A 3Q8MA 3UPSA 1HUOA 3GQCA 1TFWA 1K1SA 4IQWA 3ZD8A 3BQ1A 1TAUA 1Z3EB 2J6SA 5HRFA 4E7XA 4AT8A 4J9NA 5D46A 4ZH4A 5KFAA 2ASLA 1SKWA 2R8JA 4DSKA 4LVSA 5KG6A 5F9LA 4ECUA 2HVIA 4ECZA 2KTQA 2LYHA 3PO5A 3PO4A 1MC8A 3OJSA 2R8GA 4KLSA 1ZQKA 3TFRA 4I2JA 3AUOA 2W9AA 4PGXA 5KT3A 4F5QA 5KFWA 2XY5A 2FLPA 1NOMA 5KFJA 4AT9B 1KFTA 4AT9A 3WFOA 3OSNA 5KFDA 4IQVA 4BXOA 3H8JA 1JMSA 4RU9A 2ATLA 2HHUA 8ICBA 7ICJA 4UBBA 4YMOA 3RTVA 4X0AA 4I2AA 4WC4A 9ICHA 3M9MB 1MIWA 2C28A 5HRIA 3RH5A 4X4RA 5J0PA 4YR2A 4TURA 3RR8A 9ICTA 1MIYA 5F2VO 2W9BB 5J0TA 3T5LA 4DFJA 4RNNA 2ZH3A 2ZTDA 1ZQHA 5BPCA 3ISBA 1JX4A 2I9GA 3SV4A 1X9MA 1BPYA 1ZQEA 4X4OA 7ICGA 4ED3A 3B0YA 5DB6A 4I2BA 5J0QA 4DSJA 1DK2A 2FLNA 4RWPA 1XU4A 5CJ7A 3ZD9A 3LWLA 3EZ5A 4DQRA 2M2VA 3Q8SB 1JAJA 5KT4A 2BCVA 4F92B 1ZQZA 4P4OA 1ZQGA 3RRGA 2HHVA 8ICYA 3Q8RB 9ICCA 4WC2A 4DOBA 1R89A 5HRHA 2BCSA 4C8OA 1S0MA 4IR1A 4Z6CA 7ICLA 1JN3A 1YLQA 4I29A 4X4PA 4WBZA 4J9RA 5J0RA 4UAWA 3SV3A 3PW5A 4F91B 4C8MA 4GXJA 1Q79A 1L5UA 5DB9A 5KFZA 5KFYA 3LWMA 5DG7A 2MUTB 3JPTA 1KDHA 2KZMA 3C66A 3G6VA 2Q0ZX 5KG2A 1C7YA 1Y88A 4NM2A 4P4PA 4QZAA 3RH6A 4J9OA 1L3SA 2BCUA 2PFPA 4M0AA 2ZH7A 3HW8A 4KLEA 2V4RA 5HRKA 5CR0A 4F4YA 1ZJNA 4ED6A 8ICHA 4I2GA 4JV0A 3OSPA 1NK9A 4YQWA 2AQ0A 1AROP 1Q78A 3MR2A 4X4SA 4IQTA 2W9CA 1VFGA 4RQ8A 3RAXA 1NJWA 3GDXA 3AQLA 2ZUCA 3M9NB 4KLOA 3WFSC 3GV8B 1TK0A 1Z00B 3AU6A 2DR7A 1Z00A 3UXNA 5EWGA 4IR9A 1U9LA 1XSLA 4IQUA 5KFXA 3MDAA 4PGYA 2NRXA 5EOZA 4QZIA 3GIIA 1NKEA 1ZQCA 4K4IA 2ZTCA 5KFBA 2JZBA 1NKBA 2C2EA 4Z6DA 3PW4A 4DOAA 1BPBA 4M04A 1UT8A 2DVIA 5IIMA 4RQ5A 4M2YA 4EEYA 1RYSA 2FPKA 5JUMA 5KFHA 3PR5B 4DL6A 2BQUA 4B9SA 4IRCA 3C5FA 9ICPA 2O1PA 2ZH5A 2PFQA 2VA3A 1KFSA 3HT3A 4QWBA 2R8IA 1BNOA 4FH3A 4WBYA 4TQSA 4DQQA 5CB1A 2V9WA 4DLGA 1U48A 4YXJA 3QE9Y 1ZQFA 2W8LA 4DSFA 2R8HA 4ECTA 2HHQA 4Z6EA 2GWSA 1N48A 2ID1A 3PMNA 3JPQA 3MGHA 3HWTA 3E2EA 1BNPA 1KLNA 5DKWA 3WFQE 5DQHA 1ZQWA 5IIJA 2P6UA 4XA5A 4Q45A 2P6RA 3OV7A 2UVUA 1WCLA 5J2BA 3M9OB 7ICMA 2VA8A 3UXPA 2HVHA 9ICKA 2ZH2A 4O5EA 3HPOA 4B9LA 1X2IA 4F2SA 3QZ8A 4UD5A 3NTUA 3RH4A 8ICUA 2ZUDA 4KITB 4RQ4A 8ICAA 2W9MA 2ZTEA 1ZQPA 4B9MA 5KFMA 4NLZA 1KNYA 2HHPA 4DQPA 3C5GA 4RQ6A 4QZBA 4BDPA 2F1JA 4MEYA 4QZHA 4MF8A 1QLNA 3RBDA 4IRKA 3MGIA 4KLQA 1ZQVA 4FS2A 2A1JB 4XQ8A 1QSYA 5KG5A 4DS5A 1NJXA 4PHPA 5KFOA 3RJIA 1MQ3A 2BCRA 2PI4A 4ELVA 3EPIA 4ED1A 4ECRA 4X4UA 8ICWA 3H4DA 4M9GA 5HMMA 3TANA 2DPIA 5HMLA 1S0NA 3PY8A 1MSWD 3H38A 1NK8A 1UEVA 1JXLA 5DLGA 4O3OA 5J2CA 4KN7A 4UB5A 3TARA 4QZ8A 1U49A 3L9DA 5J2EA 3UXOA 4R65A 4ED2A 5DDMA 9ICIA 4UB1A 2F1IA 1ZQJA 2NRWA 4RQ7A 5J0XA 4ECXA 1NK0A 2IHNA 2UVRA 5KT6A 4IRDA 1WOTA 3ORYA 4E80A 4RUAA 3WFRE 9ICAA 4R8UB 5KT7A 4I2FA 1KEJA 3C21A 2BPFA 4F50A 4EBKA 7ICKA 1VJ7A 4DOCA 4NLGA 2AJQA 1KRPA 4QW9A 4DL7A 3B0XA 9ICJA 3JZ0A 4MEXA 1SL1A 8ICFA 5L1JA 2KFZA 5EWEA 5J2IA 4QZDA 3BQ0A 1TK5A 4Q44A 5TZVA 1BPXA 2KZZA 2FMSA 2IHMA 4I2CA 1R8AA 2ZHAA 2BCQA 1CUKA 4F4KA 4KLDA 1JIHA 3HJ4A 2DRBA 1B22A 4AT7B 3FDSA 3Q8LA 4JWNA 4KLIA 4WC6A 4F3OA 3ZDBA 3OJUA 1XC9A 1IXRA 5DQGA 3V6JA 1QTMA 4RQ2A 4KLUA 2KFNA 4FHPA 5DG9A 1HJPA 2HHSA 5J0YA 2W9BA 3LQCB 2NRZA 3HP6A 1A76A 2ZJ5A 5D49A 5KFPA 3BJYA 4O9MA 3Q8KA 2BPCA 3IM1A 3C2KA 2AGOA 4C8NA 5DG8A 1TK8A 1DOQA 1XSPA 4K4GA 1S9FA 4MFFA 2HW3A 1OU5A 2UVWA 2ZH6A 4RT3A 3PVXA 4NKTA 5KFEA 2Y1IA 4ED7A 4F4XA 7ICNA 4BWJA 3ZDEA 4YG2A 1RZTA 4B9NA 2ASDA 1EXNA 1SL0A 8ICSA 5J2KA 5J2JA 5CHGA 5DLFA 3OHAA 3PX4A 1TV9A 4ELUA 3SI8A 3C1YA 4PPXA 5J0UA 2FMQA 2W8KA 1BGXT 1UT5A 3HX0A 2AGPA 4EZ6A 2JEFA 2PFNA 4F4ZA 2MUTA 2PXIA 2M9NA 4ECVA 1TFRA 4R63A 5DGBA 1ZQMA 5CWRA 2DR8A 4YCXA 4NM1A 2F1HA 4YR0A 7ICHA 3OVAA 4KLGA 4ECWA 1NZPA 4QZEA 1L3UA 3SYZA 4RT2A 4I2HA 4QWDA 5DB8A 3Q8PB 4P2HA 4FH5A 3ZDAA 4LZDA 4YN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJM A;  8ICE A;  4DQI A;  5DBB A;  7ICO A;  4TQR A;  5L1L A;  2XCA A;  1LB2 B;  8ICG A;  1X9S A;  1L3V A;  1NO5 A;  1A77 A;  2M2W A;  3H8S A;  4TUQ A;  5HHH A;  5KFG A;  4FHW A;  9ICM A;  2AU0 A;  3UQ0 A;  1NK4 A;  5J2D A;  4PGQ A;  4J9S A;  5HRE A;  4DSI A;  2JEG A;  4F2R A;  2MAX A;  3G6X A;  4DEZ A;  1SKS A;  1ZQI A;  8ICO A;  4K4H A;  4UD4 A;  3V6K A;  3RJH A;  4KLF A;  3RJK A;  3PML A;  3GIL A;  1XSN A;  5KG7 A;  4XQ7 A;  4GLX A;  1S10 A;  9ICX A;  5EWF A;  4FHV A;  5J2H A;  4ECQ A;  5KFT A;  5J2G A;  1PZN A;  5J29 A;  2XGQ A;  3ZDD A;  4I2D A;  3RAQ A;  4RPY A;  1RYR A;  4M9L A;  1ZQD A;  2JEI A;  4WC0 A;  4EP7 A;  1XO1 A;  4X0B A;  2Q66 A;  4HYK A;  4WC5 A;  2I1Q A;  5BOL A;  4EBD A;  4KLM A;  4YFK A;  4RQ0 A;  3HIY A;  4J9M A;  1ZQO A;  4F5R A;  3PR4 A;  4GC7 A;  2UVV A;  2PI5 A;  2ZHB A;  3N97 B;  1XS9 D;  4G3I A;  4LT6 A;  1ZQL A;  3BDP A;  2BE3 A;  4DO9 A;  1H38 A;  3H39 A;  5KT2 A;  2BQR A;  9ICF A;  2AQ4 A;  1X9W A;  1ZQS A;  4ECS A;  2FPM A;  4DFP A;  1ZQU A;  4B9V A;  1T3N A;  4P4M A;  9ICV A;  7ICQ A;  4BWM A;  3PV8 A;  1JQR A;  3ETL A;  3MDC A;  3K75 D;  1T4G A;  3KHL A;  2BPG A;  4LZG A;  3H3A A;  3K4G A;  3PNC A;  4Q43 A;  9ICQ A;  5CP2 A;  1UET A;  5HC9 A;  3KHG A;  3MFH A;  1F5A A;  3NYB A;  5J0O A;  1D9F A;  3T3F A;  1TKD A;  7ICP A;  1V9P A;  4JWM A;  3H4B A;  4O3N A;  1IM4 A;  1MIV A;  2A1J A;  4X4T A;  1JXE A;  2XGP A;  5DQI A;  4O0I A;  1UA0 A;  2JEJ A;  1RPL A;  2C22 A;  2ALZ A;  1MQ2 A;  1LV5 A;  3GFK B;  5DEC A;  4RQ3 A;  5J0S A;  5KFQ A;  2BGW A;  3GV7 B;  2XY6 A;  2BDP A;  4O3R A;  3V7K A;  1KFD A;  1S0O A;  2AGQ A;  2ISO A;  8ICL A;  4QZ9 A;  1BPZ A;  3N4M B;  4C8K A;  9ICG A;  2C2R A;  4DF4 A;  4UBC A;  5KFR A;  1PX5 A;  5HRG A;  4KN4 A;  3RB3 A;  4M9N A;  4KLH A;  4M6W B;  4QZC A;  4QWA A;  4O3Q A;  4R8U A;  1NJY A;  4XRH A;  4B9T A;  2ZJ8 A;  4M47 A;  3H7I A;  3UQ2 A;  3V7L A;  4O5C A;  4J9Q A;  4ECY A;  2FMP A;  5J2F A;  3C18 A;  3TFS A;  5J2A A;  2HHT A;  2IBK A;  4EYH B;  4DWI A;  9ICE A;  3AQN A;  3H37 A;  5DED A;  3OHB A;  4UQG A;  1N56 A;  3OGU A;  4EZ9 A;  9ICB A;  3JPS A;  1NK7 A;  4Q8F A;  5KFK A;  3RRH A;  3RB6 A;  4ELT A;  2ZH9 A;  4RUC A;  4DQS A;  1R8B A;  3ISC A;  3H40 A;  5DGA A;  4AT8 B;  1COO A;  4M5D A;  1SZP A;  3MR6 A;  4GC6 A;  3QEB Z;  2IMW P;  4PH5 A;  4RQ1 A;  4O5K A;  8ICQ A;  5HRL A;  4DF8 A;  4AT7 A;  4KTQ A;  2ZJA A;  7ICV A;  3T5J A;  4NLN A;  2ISP A;  4FBT A;  5KTQ A;  4QZF A;  3PW2 A;  3OUY B;  2RDJ A;  1SKR A;  2BQ3 A;  3OUY A;  2DR5 A;  7ICE A;  7ICU A;  4O3P A;  2NRV A;  7ICF A;  1B43 A;  1S76 D;  4JV2 A;  5KG0 A;  5IIL A;  5KFL A;  3G6Y A;  4WC3 A;  2XO7 A;  1U4B A;  1QSL A;  3EPG A;  2IA6 A;  2DFL A;  4JK1 A;  4B9U A;  4RZR A;  8ICN A;  4I28 A;  4PHA A;  4I2I A;  2VA2 A;  2HHX A;  4RPZ A;  1ZQQ A;  3RJG A;  4R64 A;  3PX0 A;  1BPD A;  4BGD A;  4I27 A;  9ICR A;  4BXO B;  8ICI A;  2ZUB A;  4QZG A;  2KP7 A;  5KFS A;  4YMM A;  4RWQ A;  4X4N A;  3JPP A;  8ICP A;  1S0V A;  4S3N A;  2BKE A;  3JPN A;  2V4Q A;  4ED8 A;  3TAQ A;  1S97 A;  4MFC A;  2Y1J A;  2NRT A;  2P66 A;  9ICN A;  4M9J A;  2NRK A;  2FPL A;  4FO6 A;  2HHW A;  4NKU A;  3H8W A;  3KHH A;  1TVA A;  5KFU A;  4UAY A;  1D9D A;  4YD1 A;  4DLE A;  4JV1 A;  3C2M A;  3JPO A;  3UPQ A;  4Q8E A;  2J6U A;  2OWO A;  1CEZ A;  2ASJ A;  8ICT A;  4NLK A;  5KG4 A;  4DFM A;  2KN7 A;  1D8L A;  5IIO A;  5IIN A;  4DSL A;  4I2E A;  5KFN A;  2RDI A;  1S77 D;  4J9P A;  4WCW A;  1BVS A;  3GIM A;  1ZET A;  3GIJ A;  1XWL A;  1U47 A;  3QEA Z;  3M8R A;  4DL4 A;  4J9K A;  3PX6 A;  4NY8 A;  2RFF A;  4DL5 A;  5KFV A;  5HRD A;  7ICS A;  4PHD A;  8ICZ A;  1NJZ A;  7ICT A;  3GIK A;  5HHI A;  9ICL A;  1KTQ A;  3V72 A;  1ZQT A;  5KFF A;  3LDA A;  8ICM A;  4ED0 A;  4RWO A;  3OVB A;  4RNO A;  2XC9 A;  3EW9 A;  5BOM A;  4DL3 A;  3RB4 A;  1ZQR A;  4DL2 A;  1ZQY A;  4UB3 A;  3MR5 A;  4WC1 A;  4J9L A;  1QSS A;  4PHE A;  4EBC A;  5D4B A;  4YR3 A;  4F93 B;  3RJE A;  5DBC A;  4TUS A;  4UB2 A;  3TAP A;  1K1Q A;  4C8L A;  1DK3 A;  1SL2 A;  3T5H A;  5L9X A;  2XY7 A;  5KG3 A;  4F5N A;  4F5O A;  5IIK A;  4DFK A;  2PFO A;  2M2T A;  4QWC A;  4FS1 A;  4XUS A;  2W9C B;  3BQ2 A;  3T5K A;  4FHX A;  3GV5 B;  4IG8 A;  3Q8Q B;  4YMN A;  4EBE A;  4RPX A;  1NK5 A;  8ICR A;  4FHY A;  3LK9 A;  3TI0 A;  1UA1 A;  1RXW A;  3AQK A;  3AQM A;  4E8F A;  3AU2 A;  2J6T A;  4EBJ A;  4O3S A;  9ICU A;  1ZQX A;  2XCP A;  3V6H A;  3PW7 A;  4F8R A;  2M2U A;  1NK6 A;  3C1Z A;  4KMU A;  3MBY A;  3C2L A;  4E0D A;  4DS4 A;  1TAQ A;  1L3T A;  4F4W A;  2JZB B;  3QZ7 A;  4X4Q A;  1TFY A;  2VAN A;  4YD2 A;  4X4V A;  1DGS A;  4TUP A;  5KT5 A;  3BQT A;  3V7J A;  3PW0 A;  4X5V A;  1RXV A;  5HP4 A;  1ZQB A;  5L1I A;  7ICI A;  2ZH8 A;  3HJ1 A;  3JYY A;  5CA7 A;  2H5X A;  4DSE A;  1FA0 A;  3SZ2 A;  3MAB A;  1BPE A;  2ZH4 A;  1WCN A;  3FYH A;  1V4A A;  2PBE A;  4FBU A;  5HRB A;  3IHQ B;  3RR7 A;  5C5J A;  5KG1 A;  9ICO A;  2R8K A;  4ATB B;  4ATB A;  5F9N A;  2B21 A;  2DR9 A;  4RWN A;  5III A;  2BR0 A;  1KSP A;  2FLL A;  5KFI A;  4R66 A;  3MR3 A;  4GXI A;  3TQ1 A;  4M9H A;  4WC7 A;  4QWE A;  3THV A;  4JUZ A;  4YP3 A;  2C2D A;  3KTQ A;  3ZDC A;  1U45 A;  9ICW A;  2BHN A;  5DBA A;  4F5P A;  1D8Y A;  5DB7 A;  4YXM A;  1T7P A;  3RJF A;  3NGD A;  1ZQA A;  1HUZ A;  1ZYQ A;  3EYZ A;  4MFA A;  3MFI A;  4RNM A;  3M8S A;  3JPR A;  4GXK A;  5L1K A;  3C23 A;  2DPJ A;  5HR9 A;  2O5A A;  3WFP A;  8ICJ A;  4YVZ A;  8ICV A;  4MF2 A;  2WTF A;  1UEU A;  4UAZ A;  3KHR A;  4QW8 A;  4M6W A;  4CCH A;  7ICR A;  1T8E A;  8ICX A;  1ZQN A;  5KFC A;  9ICS A;  2DRA A;  3RBE A;  3OVS A;  5J0W A;  4KLL A;  3RJJ A;  1R8C A;  3EWA A;  5HNK A;  3ISD A;  4EYI B;  4KLT A;  8ICK A;  4UB4 A;  4KLJ A;  2ZH1 A;  5DDY A;  4Z6F A;  4NXZ A;  1NKC A;  8ICC A;  2KZ3 A;  3RB0 A;  3Q8M A;  3UPS A;  1HUO A;  3GQC A;  1TFW A;  1K1S A;  4IQW A;  3ZD8 A;  3BQ1 A;  1TAU A;  1Z3E B;  2J6S A;  5HRF A;  4E7X A;  4AT8 A;  4J9N A;  5D46 A;  4ZH4 A;  5KFA A;  2ASL A;  1SKW A;  2R8J A;  4DSK A;  4LVS A;  5KG6 A;  5F9L A;  4ECU A;  2HVI A;  4ECZ A;  2KTQ A;  2LYH A;  3PO5 A;  3PO4 A;  1MC8 A;  3OJS A;  2R8G A;  4KLS A;  1ZQK A;  3TFR A;  4I2J A;  3AUO A;  2W9A A;  4PGX A;  5KT3 A;  4F5Q A;  5KFW A;  2XY5 A;  2FLP A;  1NOM A;  5KFJ A;  4AT9 B;  1KFT A;  4AT9 A;  3WFO A;  3OSN A;  5KFD A;  4IQV A;  4BXO A;  3H8J A;  1JMS A;  4RU9 A;  2ATL A;  2HHU A;  8ICB A;  7ICJ A;  4UBB A;  4YMO A;  3RTV A;  4X0A A;  4I2A A;  4WC4 A;  9ICH A;  3M9M B;  1MIW A;  2C28 A;  5HRI A;  3RH5 A;  4X4R A;  5J0P A;  4YR2 A;  4TUR A;  3RR8 A;  9ICT A;  1MIY A;  5F2V O;  2W9B B;  5J0T A;  3T5L A;  4DFJ A;  4RNN A;  2ZH3 A;  2ZTD A;  1ZQH A;  5BPC A;  3ISB A;  1JX4 A;  2I9G A;  3SV4 A;  1X9M A;  1BPY A;  1ZQE A;  4X4O A;  7ICG A;  4ED3 A;  3B0Y A;  5DB6 A;  4I2B A;  5J0Q A;  4DSJ A;  1DK2 A;  2FLN A;  4RWP A;  1XU4 A;  5CJ7 A;  3ZD9 A;  3LWL A;  3EZ5 A;  4DQR A;  2M2V A;  3Q8S B;  1JAJ A;  5KT4 A;  2BCV A;  4F92 B;  1ZQZ A;  4P4O A;  1ZQG A;  3RRG A;  2HHV A;  8ICY A;  3Q8R B;  9ICC A;  4WC2 A;  4DOB A;  1R89 A;  5HRH A;  2BCS A;  4C8O A;  1S0M A;  4IR1 A;  4Z6C A;  7ICL A;  1JN3 A;  1YLQ A;  4I29 A;  4X4P A;  4WBZ A;  4J9R A;  5J0R A;  4UAW A;  3SV3 A;  3PW5 A;  4F91 B;  4C8M A;  4GXJ A;  1Q79 A;  1L5U A;  5DB9 A;  5KFZ A;  5KFY A;  3LWM A;  5DG7 A;  2MUT B;  3JPT A;  1KDH A;  2KZM A;  3C66 A;  3G6V A;  2Q0Z X;  5KG2 A;  1C7Y A;  1Y88 A;  4NM2 A;  4P4P A;  4QZA A;  3RH6 A;  4J9O A;  1L3S A;  2BCU A;  2PFP A;  4M0A A;  2ZH7 A;  3HW8 A;  4KLE A;  2V4R A;  5HRK A;  5CR0 A;  4F4Y A;  1ZJN A;  4ED6 A;  8ICH A;  4I2G A;  4JV0 A;  3OSP A;  1NK9 A;  4YQW A;  2AQ0 A;  1ARO P;  1Q78 A;  3MR2 A;  4X4S A;  4IQT A;  2W9C A;  1VFG A;  4RQ8 A;  3RAX A;  1NJW A;  3GDX A;  3AQL A;  2ZUC A;  3M9N B;  4KLO A;  3WFS C;  3GV8 B;  1TK0 A;  1Z00 B;  3AU6 A;  2DR7 A;  1Z00 A;  3UXN A;  5EWG A;  4IR9 A;  1U9L A;  1XSL A;  4IQU A;  5KFX A;  3MDA A;  4PGY A;  2NRX A;  5EOZ A;  4QZI A;  3GII A;  1NKE A;  1ZQC A;  4K4I A;  2ZTC A;  5KFB A;  2JZB A;  1NKB A;  2C2E A;  4Z6D A;  3PW4 A;  4DOA A;  1BPB A;  4M04 A;  1UT8 A;  2DVI A;  5IIM A;  4RQ5 A;  4M2Y A;  4EEY A;  1RYS A;  2FPK A;  5JUM A;  5KFH A;  3PR5 B;  4DL6 A;  2BQU A;  4B9S A;  4IRC A;  3C5F A;  9ICP A;  2O1P A;  2ZH5 A;  2PFQ A;  2VA3 A;  1KFS A;  3HT3 A;  4QWB A;  2R8I A;  1BNO A;  4FH3 A;  4WBY A;  4TQS A;  4DQQ A;  5CB1 A;  2V9W A;  4DLG A;  1U48 A;  4YXJ A;  3QE9 Y;  1ZQF A;  2W8L A;  4DSF A;  2R8H A;  4ECT A;  2HHQ A;  4Z6E A;  2GWS A;  1N48 A;  2ID1 A;  3PMN A;  3JPQ A;  3MGH A;  3HWT A;  3E2E A;  1BNP A;  1KLN A;  5DKW A;  3WFQ E;  5DQH A;  1ZQW A;  5IIJ A;  2P6U A;  4XA5 A;  4Q45 A;  2P6R A;  3OV7 A;  2UVU A;  1WCL A;  5J2B A;  3M9O B;  7ICM A;  2VA8 A;  3UXP A;  2HVH A;  9ICK A;  2ZH2 A;  4O5E A;  3HPO A;  4B9L A;  1X2I A;  4F2S A;  3QZ8 A;  4UD5 A;  3NTU A;  3RH4 A;  8ICU A;  2ZUD A;  4KIT B;  4RQ4 A;  8ICA A;  2W9M A;  2ZTE A;  1ZQP A;  4B9M A;  5KFM A;  4NLZ A;  1KNY A;  2HHP A;  4DQP A;  3C5G A;  4RQ6 A;  4QZB A;  4BDP A;  2F1J A;  4MEY A;  4QZH A;  4MF8 A;  1QLN A;  3RBD A;  4IRK A;  3MGI A;  4KLQ A;  1ZQV A;  4FS2 A;  2A1J B;  4XQ8 A;  1QSY A;  5KG5 A;  4DS5 A;  1NJX A;  4PHP A;  5KFO A;  3RJI A;  1MQ3 A;  2BCR A;  2PI4 A;  4ELV A;  3EPI A;  4ED1 A;  4ECR A;  4X4U A;  8ICW A;  3H4D A;  4M9G A;  5HMM A;  3TAN A;  2DPI A;  5HML A;  1S0N A;  3PY8 A;  1MSW D;  3H38 A;  1NK8 A;  1UEV A;  1JXL A;  5DLG A;  4O3O A;  5J2C A;  4KN7 A;  4UB5 A;  3TAR A;  4QZ8 A;  1U49 A;  3L9D A;  5J2E A;  3UXO A;  4R65 A;  4ED2 A;  5DDM A;  9ICI A;  4UB1 A;  2F1I A;  1ZQJ A;  2NRW A;  4RQ7 A;  5J0X A;  4ECX A;  1NK0 A;  2IHN A;  2UVR A;  5KT6 A;  4IRD A;  1WOT A;  3ORY A;  4E80 A;  4RUA A;  3WFR E;  9ICA A;  4R8U B;  5KT7 A;  4I2F A;  1KEJ A;  3C21 A;  2BPF A;  4F50 A;  4EBK A;  7ICK A;  1VJ7 A;  4DOC A;  4NLG A;  2AJQ A;  1KRP A;  4QW9 A;  4DL7 A;  3B0X A;  9ICJ A;  3JZ0 A;  4MEX A;  1SL1 A;  8ICF A;  5L1J A;  2KFZ A;  5EWE A;  5J2I A;  4QZD A;  3BQ0 A;  1TK5 A;  4Q44 A;  5TZV A;  1BPX A;  2KZZ A;  2FMS A;  2IHM A;  4I2C A;  1R8A A;  2ZHA A;  2BCQ A;  1CUK A;  4F4K A;  4KLD A;  1JIH A;  3HJ4 A;  2DRB A;  1B22 A;  4AT7 B;  3FDS A;  3Q8L A;  4JWN A;  4KLI A;  4WC6 A;  4F3O A;  3ZDB A;  3OJU A;  1XC9 A;  1IXR A;  5DQG A;  3V6J A;  1QTM A;  4RQ2 A;  4KLU A;  2KFN A;  4FHP A;  5DG9 A;  1HJP A;  2HHS A;  5J0Y A;  2W9B A;  3LQC B;  2NRZ A;  3HP6 A;  1A76 A;  2ZJ5 A;  5D49 A;  5KFP A;  3BJY A;  4O9M A;  3Q8K A;  2BPC A;  3IM1 A;  3C2K A;  2AGO A;  4C8N A;  5DG8 A;  1TK8 A;  1DOQ A;  1XSP A;  4K4G A;  1S9F A;  4MFF A;  2HW3 A;  1OU5 A;  2UVW A;  2ZH6 A;  4RT3 A;  3PVX A;  4NKT A;  5KFE A;  2Y1I A;  4ED7 A;  4F4X A;  7ICN A;  4BWJ A;  3ZDE A;  4YG2 A;  1RZT A;  4B9N A;  2ASD A;  1EXN A;  1SL0 A;  8ICS A;  5J2K A;  5J2J A;  5CHG A;  5DLF A;  3OHA A;  3PX4 A;  1TV9 A;  4ELU A;  3SI8 A;  3C1Y A;  4PPX A;  5J0U A;  2FMQ A;  2W8K A;  1BGX T;  1UT5 A;  3HX0 A;  2AGP A;  4EZ6 A;  2JEF A;  2PFN A;  4F4Z A;  2MUT A;  2PXI A;  2M9N A;  4ECV A;  1TFR A;  4R63 A;  5DGB A;  1ZQM A;  5CWR A;  2DR8 A;  4YCX A;  4NM1 A;  2F1H A;  4YR0 A;  7ICH A;  3OVA A;  4KLG A;  4ECW A;  1NZP A;  4QZE A;  1L3U A;  3SYZ A;  4RT2 A;  4I2H A;  4QWD A;  5DB8 A;  3Q8P B;  4P2H A;  4FH5 A;  3ZDA A;  4LZD A;  4YN4 A; 
#chains in the Genus database with same CATH topology
 3NVY A;  2IHO A;  4F72 A;  3SAF A;  4OAH A;  1X9S A;  3ER8 C;  4TUQ A;  5KFG A;  9ICM A;  2MAX A;  1DGJ A;  2K4H A;  8ICO A;  1L8O A;  4Y2X A;  3V6K A;  3E0F A;  3RJH A;  2GAF D;  4FHV A;  4ECQ A;  1QH9 A;  2LMR A;  5KFT A;  3NVV A;  4I2D A;  1RYR A;  2KVC A;  1XO1 A;  4HYK A;  1GO3 F;  3CRX A;  2FE9 A;  3L3F X;  4F5R A;  3TAD C;  4LT6 A;  3C29 A;  3BDP A;  2B51 A;  9ICF A;  3ZI4 A;  2F77 X;  4ECS A;  1ZQU A;  9ICV A;  1T3N A;  3IRU A;  3PV8 A;  1NI3 A;  3ETL A;  3KHL A;  3PNC A;  4Q43 A;  1S8O A;  3KD3 A;  1TKD A;  1V9P A;  5L1M A;  1MIV A;  1LV5 A;  1SZH A;  4DFD A;  5KFQ A;  2BGW A;  2BDP A;  4O3R A;  4ICA A;  3S6J A;  4QZ9 A;  1BPZ A;  4C8K A;  2E5S A;  4UAS A;  4DF4 A;  1C20 A;  3UM9 A;  2JHD A;  1Z1B A;  3SEN A;  4KLH A;  4O3Q A;  4M47 A;  3H7I A;  2WF5 A;  4O5C A;  4J9Q A;  2QAR A;  2NO5 A;  5DED A;  3OHB A;  4UAR A;  4LEV A;  3RRH A;  4NXU A;  3RB6 A;  2EWR A;  3CW2 C;  2DWQ A;  4AT8 B;  5DGA A;  2WB1 C;  3MR6 A;  3QEB Z;  1ZD4 A;  2WB1 F;  1M6Y A;  3KOO A;  5HRL A;  4KTQ A;  3T5J A;  4NLN A;  1SKR A;  7ICU A;  1S76 D;  7ICF A;  5IIL A;  5KFL A;  4P0Q B;  1QSL A;  4KM5 A;  4JK1 A;  2Y9T A;  8ICN A;  1MN8 A;  4PHA A;  2VA2 A;  1ZQQ A;  5AKZ A;  3PX0 A;  1BPD A;  4CF5 A;  2YN4 A;  3F53 A;  4QZG A;  1PK3 A;  2BKE A;  3TAQ A;  2V4Q A;  2P66 A;  4UAY A;  4FZL A;  1D9D A;  1L7P A;  4Q8E A;  5AM3 A;  2ASJ A;  3DDH A;  1HIW A;  2HOQ A;  1S77 D;  4WCW A;  3JCF A;  2RFF A;  8ICZ A;  2CPR A;  4NV0 A;  3V72 A;  4ED0 A;  3OVB A;  2GO7 A;  5BOM A;  2YMP A;  4LEZ A;  3WK9 A;  4EBC A;  4US9 A;  4FE3 A;  4PL1 A;  4YR3 A;  4F93 B;  2CRX A;  3QU9 A;  3TAP A;  1FO4 A;  1K1Q A;  4EEK A;  5IIK A;  4XUS A;  2W9C B;  3BQ2 A;  3T5K A;  5D61 A;  4EBE A;  4RPX A;  3TI0 A;  4O6A A;  1NK6 A;  3C1Z A;  3MBY A;  3C2L A;  4CE6 A;  2F3N A;  4C4R A;  2JZB B;  3QZ7 A;  5HR6 A;  2FDR A;  4X4V A;  1DGS A;  5AK3 A;  2EAP A;  5GTI U;  1B4F A;  2HCF A;  2KJ5 A;  2Q4T A;  4FBU A;  4C4T A;  5HRB A;  2KIC A;  5KG1 A;  4ATB A;  2DR9 A;  4RWN A;  2B21 A;  4OJO A;  1SB3 C;  2RLT A;  5KFI A;  4OAI Z;  3KTQ A;  3ZDC A;  3ETR A;  4F5P A;  5ALT A;  1T7P A;  5ALV A;  3NGD A;  4PJ0 U;  4HX0 A;  1Z4N A;  4UAZ A;  1ZQN A;  5KFC A;  9ICS A;  8ICK A;  4KLJ A;  5DDY A;  1Z1V A;  4NXZ A;  2ZG6 A;  3Q8M A;  3UPS A;  3VC8 A;  1TFW A;  1K1S A;  4IQW A;  4UAV A;  4AT8 A;  4B6J A;  4J9N A;  2ASL A;  5ALU A;  4PL2 A;  2LYH A;  3PO4 A;  3NRW A;  2VJ5 A;  4P0Q A;  4I2J A;  2E8M A;  3AM9 A;  2XY5 A;  1NOM A;  2KMD A;  4AT9 B;  2KJ8 A;  5KFD A;  1X6I A;  1JMS A;  4RU9 A;  7ICJ A;  4UBB A;  4YMO A;  4X0A A;  4I2A A;  3I76 A;  9ICH A;  1MIW A;  5FP0 A;  4X4R A;  3RR8 A;  3AN1 A;  5AHX A;  4RNN A;  4FO1 A;  2ZTD A;  5BPC A;  1Q3V A;  2LM1 A;  4ED3 A;  3B0Y A;  2DF4 B;  1DK2 A;  2FLN A;  1XU4 A;  3CNH A;  5CJ7 A;  3EZ5 A;  2M2V A;  1JAJ A;  3RRG A;  2HHV A;  9ICC A;  4DOB A;  1NNL A;  1S0M A;  2EH9 A;  1YLQ A;  3I28 A;  4I29 A;  4WBZ A;  5J0R A;  4UAW A;  3PW5 A;  3PZP A;  2G5I B;  4GXJ A;  4JB3 A;  5KFZ A;  3LWM A;  1KDH A;  2KZM A;  2JR5 A;  3G6V A;  1Y88 A;  2HBL A;  4P4P A;  2PFP A;  2QB0 B;  2W7P A;  3H0M B;  2NYV A;  2AQ0 A;  1ARO P;  5JU5 A;  5ALR A;  3MR2 A;  2B56 A;  3H8M A;  4EX7 A;  2W9C A;  5AK4 A;  3RAX A;  2JH7 A;  3AQL A;  4NLC A;  1Z00 B;  3AU6 A;  2D6F C;  5EWG A;  1U9L A;  4IQU A;  3MDA A;  2NRX A;  4QZI A;  1PVR A;  1ZQC A;  2JZB A;  2C2E A;  4Z6D A;  3PW4 A;  2FJ6 A;  2EQY A;  1BPB A;  1UT8 A;  3MCR A;  5IIM A;  4UW9 A;  4B9S A;  3WK6 A;  4Y2R A;  3AEV A;  1KFS A;  3HT3 A;  4QWB A;  4DQQ A;  5CB1 A;  1X40 A;  4NWI A;  1ZQF A;  2KIV A;  4Y2Q A;  4IC9 A;  2R8H A;  4ECT A;  2ES6 A;  2HMX A;  2GWS A;  3HWT A;  4O67 A;  5DQH A;  5IIJ A;  2P6U A;  3SAG A;  4B9L A;  1X2I A;  3QZ8 A;  5G5H A;  8ICU A;  8ICA A;  5AKJ A;  1JAL A;  3CP8 A;  1QLN A;  3MGI A;  4KLQ A;  4FS2 A;  5KFO A;  3EPI A;  4ED1 A;  4ECR A;  4O69 A;  4X4U A;  3H4D A;  1S0N A;  3PY8 A;  1JXL A;  4KN7 A;  3L9D A;  3UXO A;  4ED2 A;  9ICI A;  2UVR A;  4WJ3 B;  3WFR E;  2RHF A;  3WK4 A;  2H3I A;  7ICK A;  5ALX A;  2ZXI A;  1KRP A;  4QW9 A;  4DL7 A;  1SL1 A;  5L1J A;  5J2I A;  3K1R B;  1N5X A;  2M0N A;  2FMS A;  4F4K A;  3OTQ A;  1JIH A;  3QU5 A;  4JWN A;  4KLI A;  4WC6 A;  3OJU A;  1XC9 A;  2KFN A;  5DQG A;  2KOB A;  2LM4 A;  4KX3 A;  5J0Y A;  1SV0 C;  3LYS A;  2WF8 A;  3QU4 A;  3Q8K A;  3FC4 A;  2LI6 A;  4RT3 A;  3PVX A;  2Y1I A;  4ED7 A;  4F4X A;  4B9N A;  2WF7 A;  5CHG A;  2GOL A;  2XVT A;  4PPX A;  5J0U A;  1FIQ A;  3HX0 A;  4F4Z A;  2PXI A;  2M9N A;  2YY6 A;  5ALQ A;  4NM1 A;  2F1H A;  2QB0 A;  3M6K A;  1NZP A;  4ECW A;  2HN2 A;  3R9K A;  4RT2 A;  1ZJM A;  2YMQ A;  5DBB A;  7ICO A;  5C0Y A;  4FHW A;  2M2W A;  2KKP A;  1D8B A;  2KE7 A;  2AU0 A;  3UQ0 A;  4J9S A;  1ZQI A;  1COK A;  1SKS A;  1SGG A;  4K4H A;  3GIL A;  1XSN A;  4XQ7 A;  3F2B A;  2Z7J A;  5J2H A;  2WAQ C;  1VLB A;  2WAQ F;  4RPY A;  2HDO A;  2JEI A;  4WC0 A;  4EP7 A;  4WC5 A;  3HIY A;  4O68 A;  4J9M A;  4NXW A;  5AKG A;  3NWI A;  1J97 A;  2FI1 A;  3A0H U;  4DO9 A;  2BQR A;  2W03 A;  1X9W A;  3HJE A;  2IOF K;  4P4M A;  1T4G A;  1NZB A;  3H3A A;  3K4G A;  2DL0 A;  5HC9 A;  3KHG A;  3MFH A;  1F5A A;  3MC1 A;  5J0O A;  5AKH A;  1D9F A;  2CN1 A;  4JWM A;  4O3N A;  4US8 A;  1IM4 A;  4J03 A;  5DQI A;  4O0I A;  1IV8 A;  2C22 A;  1MQ2 A;  3D6J A;  1FFU A;  3WKE A;  2R18 A;  3GFK B;  3QUT A;  5DEC A;  4RQ3 A;  8ICL A;  3N4M B;  9ICG A;  2C2R A;  4UAU A;  4A8E A;  5HRG A;  3E58 A;  4M6W B;  4QZC A;  2HVI A;  3UQ2 A;  3V7L A;  3C18 A;  2FMP A;  5J2F A;  3PSI A;  4DWI A;  2YB4 A;  3OGU A;  4C0Z A;  5AIA A;  4Q8F A;  2OH2 A;  2MSN A;  3WK5 A;  2ZH9 A;  4DQS A;  1R8B A;  1UPH A;  4PH5 A;  2DUY A;  7ICV A;  2ISP A;  4FBT A;  5KTQ A;  3PSP A;  4IS7 A;  2DR5 A;  2NRV A;  1B43 A;  2OHF A;  1K5O A;  4JV2 A;  4OO1 J;  5KG0 A;  5AM1 A;  4WC3 A;  2IA6 A;  1JRP A;  2ZIX B;  4RZR A;  4CDG A;  4R64 A;  4BGD A;  2G0A A;  2KHQ A;  1A6S A;  5KAF U;  2E3T A;  3JPP A;  1O03 A;  4ED8 A;  1ZXI A;  2EZX A;  2NRT A;  2G09 A;  2FPL A;  4JMU A;  2KD1 A;  4WOY A;  2HHW A;  4JV1 A;  4AYB C;  3C2M A;  3UPQ A;  1CEZ A;  5AI6 A;  4NLK A;  3WKA A;  2KN7 A;  4DSL A;  2KEY A;  3GIM A;  3GIJ A;  1XWL A;  1U47 A;  3M8R A;  4DL5 A;  4PHD A;  1ZQT A;  4DL2 A;  4WC1 A;  1QSS A;  2A3V A;  3F2C A;  3RJE A;  4C8L A;  1SL2 A;  4F5N A;  4QWC A;  2G5H B;  3Q8Q B;  1NK5 A;  4FHY A;  3AQK A;  1RXW A;  2J6T A;  4EBJ A;  4O3S A;  2XCP A;  4F8R A;  2M2U A;  1TAQ A;  1L3T A;  4F4W A;  5D62 A;  4X4Q A;  1TFY A;  2VAN A;  4OJP A;  3V7J A;  1O08 A;  3PW0 A;  4X5V A;  1RXV A;  5HP4 A;  4WH5 A;  7ICI A;  2ZH8 A;  1WWV A;  5ALM A;  5CA7 A;  2H5X A;  4DSE A;  2DKZ A;  1FA0 A;  3MAB A;  5ALG A;  4ATB B;  2R8K A;  2YB1 A;  4WQL A;  2BR0 A;  2FLL A;  4EGW A;  3TQ1 A;  3MR3 A;  1LKY A;  4USA A;  4M9H A;  1L7O A;  4WQK A;  4QWE A;  4C7Z A;  1U45 A;  9ICW A;  2BHN A;  2ESE A;  5DB7 A;  3NAS A;  3M8S A;  3WFP A;  2DPJ A;  8ICJ A;  4YVZ A;  8ICV A;  1ZRM A;  4MF2 A;  4NLB A;  2DGZ A;  4M6W A;  8ICX A;  2DRA A;  2QLT A;  5J0W A;  4KLL A;  2JRZ A;  4G9B A;  4K98 A;  3ZD8 A;  3BQ1 A;  5D46 A;  5KFA A;  4LVS A;  5KG6 A;  4ECU A;  2MA1 A;  2FCL A;  5KNI A;  4F71 A;  2R8G A;  3NKU A;  1ZQK A;  1Q3U A;  1XO0 A;  2ZIX A;  4F5Q A;  5KFW A;  4EX6 A;  4OD0 A;  5KFJ A;  4K8V A;  4IQV A;  2ATL A;  8ICB A;  3DV9 A;  2K8C B;  2C28 A;  5HRI A;  4TUR A;  1MIY A;  5F2V O;  3MGV A;  2W9B B;  2DQN B;  3T5L A;  4DFJ A;  5B5E U;  2ZH3 A;  2I9G A;  3D2S A;  1X9M A;  4Y2T A;  2YX8 A;  4DSJ A;  4N7R A;  3ZD9 A;  5KT4 A;  3LVV A;  5AKX A;  1R89 A;  5ALN A;  4BX9 C;  3K7D A;  2BCS A;  4Z6C A;  2F8L A;  1KW4 A;  4X4P A;  4J9R A;  4Y2J A;  2PMZ C;  5AI4 A;  2OYY A;  4F91 B;  2PMZ F;  5T14 A;  4NXX A;  3N28 A;  2W11 A;  1L5U A;  5DB9 A;  2MUT B;  3JPT A;  3C66 A;  5G5G A;  4RWP A;  4NM2 A;  3RH6 A;  1L3S A;  2BCU A;  4J9O A;  2ZH7 A;  2JMG A;  1OUQ A;  4KLE A;  5HRK A;  4F4Y A;  4ED6 A;  3OSP A;  2EAM A;  4YQW A;  4C4S A;  4IQT A;  1DXS A;  3H0L B;  5EOZ A;  5JTI A;  1ZQ1 C;  2ZTC A;  2DVI A;  4EEY A;  1RYS A;  5KFH A;  2HBM A;  1P7D A;  4IRC A;  5AKI A;  1UQV A;  3N7R C;  3C5F A;  5CFU A;  2ZH5 A;  2VA3 A;  3WKB A;  3NRZ A;  1U48 A;  1WYG A;  2HOI A;  4YXJ A;  4I0U A;  2W8L A;  4DSF A;  1N48 A;  2ID1 A;  3PMN A;  3JPQ A;  1ECW A;  2PKE A;  3KKA A;  2QB1 A;  9ICK A;  3M9O B;  7ICM A;  2HVH A;  4O5E A;  3HPO A;  4F2S A;  5CHE A;  2ZUD A;  3IP4 B;  1QCK A;  2N1R A;  2HHP A;  5F3X B;  4DQP A;  3C5G A;  4RQ6 A;  2F1J A;  1PVP A;  2VKQ A;  1F44 A;  3ERC C;  1QSY A;  1IIP A;  2OCE A;  5KG5 A;  4DS5 A;  1NJX A;  3QNM A;  3WU2 U;  3F5E A;  5HMM A;  3H38 A;  2K8B B;  1B0X A;  3OPX A;  5AM4 A;  2CXY A;  5DLG A;  5J2C A;  4UB5 A;  2OEH A;  4K9A A;  4R65 A;  2Y0S C;  5AI9 A;  1ZQJ A;  4IRD A;  2NRW A;  2Y0S F;  4RQ7 A;  2EAO A;  3L5K A;  4ECX A;  3QUB A;  5KT6 A;  4E80 A;  4BJQ A;  3O0F A;  9ICA A;  4R8U B;  5KT7 A;  1KEJ A;  3C21 A;  3H0R B;  2LPE A;  5J8Y A;  3JZ0 A;  5B66 U;  2KZZ A;  1R8A A;  5TZV A;  4PZN A;  2DRB A;  4NXV A;  4F3O A;  5AM5 A;  1QTM A;  4KLU A;  4RQ2 A;  3U26 A;  1JI7 A;  2LBO A;  2W9B A;  2GLE A;  3BZK A;  3HP6 A;  3BJY A;  1L7M A;  2B0C A;  4C8N A;  5DG8 A;  4K4G A;  1DOQ A;  2HW3 A;  1S9F A;  1QQ6 A;  4NKT A;  1RG6 A;  1YZ6 A;  3ZDE A;  1RZT A;  8ICS A;  5J2K A;  5J2J A;  3UMB A;  4QNL A;  2OXO A;  3OHA A;  4Y2P A;  3BZC A;  5ALH A;  2W8K A;  4EZ6 A;  2PFN A;  2MUT A;  2RP5 A;  5ALJ A;  5CWR A;  2DR8 A;  3OVA A;  4QZE A;  4K9B A;  4I2H A;  4P2H A;  3Q8P B;  3ZDA A;  8ICE A;  4DQI A;  4TQR A;  1LB2 B;  3BQ7 A;  8ICG A;  1A77 A;  2JH1 A;  5HRE A;  2JEG A;  4F2R A;  2L5Y A;  3G6X A;  4DEZ A;  3RJK A;  2HOF A;  3PML A;  3FM9 A;  5KG7 A;  1S10 A;  2EZZ A;  2B6G A;  1PVQ A;  2F76 X;  3RAQ A;  1ZD5 A;  4M9L A;  2HBJ A;  2I1Q A;  4KLM A;  4RQ0 A;  1KQQ A;  1ZQO A;  4GC7 A;  2PI5 A;  4OJL A;  1F5S A;  3N97 B;  1XS9 D;  4G3I A;  1ZQL A;  1H38 A;  2B4V A;  3H39 A;  2AQ4 A;  4B9V A;  1SWV A;  4BWM A;  3AQE A;  1JQR A;  2YTU A;  4KMO B;  9ICQ A;  3D2N A;  5CP2 A;  3NYB A;  7ICP A;  3T3F A;  1VDV A;  2A19 A;  3EUB 2;  1RDF A;  1RYU A;  3QYP A;  2JEJ A;  2ALZ A;  2D3D A;  5J0S A;  3V7K A;  1KFD A;  5AKE A;  2K60 A;  4UBC A;  1PX5 A;  3RB3 A;  4M9N A;  4QWA A;  4R8U A;  9ICB A;  3TFS A;  2DKX A;  2MRL A;  3H37 A;  3AQN A;  1N56 A;  4UQG A;  5KFK A;  5KL1 B;  3QUQ A;  4RUC A;  3H40 A;  1COO A;  4GC6 A;  3RF9 A;  2IMW P;  4O5K A;  4K96 A;  8ICQ A;  2ZJA A;  3PW2 A;  2RDJ A;  3OUY A;  7ICE A;  4O3P A;  3F2D A;  2JGA A;  4EEB A;  1U4B A;  3M7D A;  4MKP A;  2HHX A;  4NJ8 A;  4RQN A;  1ZD3 A;  2E1E A;  4X4N A;  3SMV A;  4S3N A;  1S0V A;  1S97 A;  5GTH U;  2Y1J A;  4Y2S A;  4M9J A;  4FO6 A;  4NKU A;  3KHH A;  5KFU A;  2EZY A;  3JPO A;  1RQL A;  5ALW A;  2J6U A;  2BBJ A;  1D8L A;  1UCV A;  4AP9 A;  4I2E A;  3GU3 A;  2RDI A;  1CRX A;  4J9P A;  1BVS A;  4DL4 A;  4NY8 A;  2G06 A;  5HRD A;  7ICS A;  1NJZ A;  7ICT A;  5EE0 A;  3GIK A;  5HHI A;  9ICL A;  4RWO A;  3LDA A;  3EW9 A;  4DL3 A;  1ZQR A;  1ZQY A;  3MR5 A;  4J9L A;  3NVZ A;  2IOH A;  5DBC A;  3AQF A;  4UB2 A;  3T5H A;  5L9X A;  2XY7 A;  5KG3 A;  4DFK A;  5H2F U;  3OWG A;  4IG8 A;  4YMN A;  1UA1 A;  3AQM A;  1SWW A;  3AU2 A;  1ZQX A;  2KIW A;  3PW7 A;  4E0D A;  4DS4 A;  1PUZ A;  4TUP A;  5KT5 A;  1L8L A;  3SQI A;  2HI0 A;  2ZIU A;  5L1I A;  1T94 A;  3HJ1 A;  4QJF B;  3SAH A;  3BS7 A;  3SZ2 A;  1BPE A;  2ZH4 A;  1WCN A;  3FYH A;  3RR7 A;  9ICO A;  4K97 A;  3CYM A;  1KSP A;  1TE2 A;  1WWU A;  3UMC A;  1LKY B;  4R66 A;  4WC7 A;  3THV A;  2C2D A;  5DBA A;  2G08 A;  1ZQA A;  4RNM A;  2KNJ A;  5HR9 A;  5L1K A;  3DEE A;  3KHR A;  7ICR A;  4QW8 A;  3RBE A;  3OVS A;  3RJJ A;  3EWA A;  5HNK A;  1NKC A;  3RB0 A;  1HUO A;  4ZH4 A;  2R8J A;  1SKW A;  4DSK A;  4ECZ A;  5CRX A;  3CK6 A;  1FEZ A;  3PO5 A;  1QQ7 A;  2W3S A;  5AIB A;  4KLS A;  1WG8 A;  3AUO A;  1LVH A;  4PGX A;  5ALE A;  5KT3 A;  1KFT A;  3WFO A;  2W55 A;  3OSN A;  1MA7 A;  3H8J A;  5AKK A;  3M9M B;  2ZIV A;  4Y2U A;  3RH5 A;  4HAI A;  4YR2 A;  2GH1 A;  1ZQH A;  3ISB A;  4U6P A;  3SV4 A;  1YZ7 A;  4I2B A;  5J0Q A;  3C28 A;  2W04 A;  3LWL A;  5AKY A;  3Q8S B;  2AHO B;  1SXD A;  4F92 B;  4P4O A;  5HRH A;  5AI5 A;  2H3V A;  2W43 A;  7ICL A;  2EAN A;  1Q79 A;  3QU7 A;  5EE1 A;  2KG5 A;  2LYB A;  1C7Y A;  4QZA A;  4M0A A;  3HW8 A;  3IN5 A;  5CR0 A;  8ICH A;  4I2G A;  4JV0 A;  1Z4O A;  1Q78 A;  4X4S A;  3M1Y A;  1GPJ A;  1T3Q A;  3HKZ C;  3HKZ F;  3AMZ A;  1NJW A;  1ZOL A;  3M9N B;  2KHV A;  3D2Q A;  3GV8 B;  1TK0 A;  2E8O A;  2DR7 A;  4IR9 A;  1XSL A;  2JXJ A;  5ALZ A;  4PGY A;  1NKE A;  5JRT A;  3GII A;  4UB6 U;  1WUD A;  5KAI U;  4C80 A;  4M04 A;  3EF2 A;  3BS5 A;  4M2Y A;  3I1Y A;  5JUM A;  3N7S C;  1JUD A;  3PR5 B;  5B3Q A;  1RM6 C;  2ODG A;  2BQU A;  2O1P A;  1X66 A;  4FH3 A;  2R8I A;  4UAT A;  2V9W A;  4DLG A;  3QE9 Y;  2HHQ A;  4Z6E A;  3MGH A;  3TKA A;  5A0L A;  1BNP A;  3RFA A;  5J2B A;  3UXP A;  1X42 A;  3NTU A;  3RH4 A;  4RQ4 A;  1RQN A;  2W9M A;  2ZTE A;  1ZQP A;  4NLZ A;  1KNY A;  1Z19 A;  1Q46 A;  4QZB A;  4BDP A;  4MEY A;  4QZH A;  1X9X A;  4MF8 A;  4IRK A;  2A1J B;  4XQ8 A;  3J81 j;  3QX7 A;  3RJI A;  2BCR A;  4ELV A;  3N7P D;  3IG8 A;  5HML A;  2AXT U;  2ZIW A;  1UEV A;  4OCZ A;  4QZ8 A;  1OXJ A;  1YT3 A;  5DDM A;  4UB1 A;  2F1I A;  2IHN A;  1A0P A;  4EEN A;  5TIS U;  1WOT A;  3ORY A;  4RUA A;  1KBU A;  4I2F A;  2BPF A;  4EBK A;  4F50 A;  4DOC A;  2AJQ A;  3B0X A;  9ICJ A;  8ICF A;  4K99 A;  2VJ4 A;  1TK5 A;  3T79 A;  4Q44 A;  3A0B U;  4I2C A;  2ZHA A;  2BCQ A;  1CUK A;  4KLD A;  3HJ4 A;  3SEI A;  1B22 A;  4AT7 B;  3WKC A;  2WFA A;  3ZDB A;  3V6J A;  4FHP A;  2HHS A;  1A76 A;  5KFP A;  2KVS A;  4OAG A;  3IM1 A;  3C2K A;  5EE9 A;  1OU5 A;  2WF6 A;  2ZH6 A;  5KFE A;  5B3P A;  1PK1 B;  2HN1 A;  1EXN A;  5ALF A;  2DBY A;  3PX4 A;  2I6X A;  3F5A A;  3SI8 A;  2KSO B;  1BGX T;  1UT5 A;  2AGP A;  1ZQM A;  4NL9 A;  4R63 A;  2KKV A;  5KL8 B;  5DGB A;  4YCX A;  5HR7 A;  3IDW A;  1L3U A;  3SYZ A;  5DB8 A;  4FH5 A;  4YN4 A;  2F2A B;  2XID A;  5L1L A;  1NO5 A;  2XCA A;  3GZF A;  1L3V A;  3H8S A;  5HHH A;  1NK4 A;  3QUC A;  5J2D A;  4PGQ A;  4DSI A;  4UD4 A;  2K4I A;  4IL6 U;  4KLF A;  4OJ6 A;  4GLX A;  9ICX A;  3FAH A;  5EWF A;  2XIC A;  5J2G A;  1PZN A;  5J29 A;  2XGQ A;  3ZDD A;  1ZQD A;  3PSF A;  2F8K A;  4X0B A;  2Q66 A;  5BOL A;  4EBD A;  4YFK A;  3PR4 A;  2UVV A;  2ZHB A;  1XNS A;  2RRD A;  2LYA A;  2BE3 A;  5KT2 A;  4JLZ A;  1KKX A;  1ZQS A;  2FPM A;  4DFP A;  4RQM A;  2W3R A;  1HEK A;  7ICQ A;  3MDC A;  3K75 D;  3TAC B;  2BPG A;  2XI9 A;  4LZG A;  2F44 A;  1UET A;  5AK5 A;  3H4B A;  1SIJ A;  5AK6 A;  2A1J A;  4X4T A;  1JXE A;  2XGP A;  1UA0 A;  1RPL A;  3QXG A;  4C7Y A;  5ALS A;  1VJ5 A;  3GV7 B;  2XY6 A;  2BBH A;  1S0O A;  2AGQ A;  2ISO A;  4UB8 U;  5KFR A;  4NXT A;  4KN4 A;  2D8C A;  1NJY A;  4XRH A;  4B9T A;  2ZJ8 A;  4ECY A;  5J2A A;  2HHT A;  1SXE A;  4EYH B;  2IBK A;  9ICE A;  5CFT A;  4QIW C;  5ALY A;  4EZ9 A;  2K4P A;  4QIW F;  3JPS A;  1NK7 A;  2AH5 A;  4ELT A;  5AIC A;  3ISC A;  4M5D A;  1SZP A;  4RQ1 A;  4Y2V A;  4DF8 A;  4AT7 A;  2VIX A;  5ALP A;  1SV4 A;  4QZF A;  3OUY B;  2BQ3 A;  2MU2 A;  4OAF A;  3SR6 A;  3G6Y A;  2XO7 A;  4U7C A;  3EPG A;  2DFL A;  4B9U A;  4NL9 C;  4I2I A;  4RPZ A;  2K89 A;  3RJG A;  4I27 A;  9ICR A;  1JRO A;  4BXO B;  8ICI A;  2ZUB A;  2KP7 A;  5KFS A;  4YMM A;  4RWQ A;  1PK1 A;  8ICP A;  4JLX A;  3JPN A;  4MFC A;  9ICN A;  2NRK A;  4CRX A;  5AKL A;  3H8W A;  3KZX A;  1TVA A;  2E1F A;  4YD1 A;  4DLE A;  2KSO A;  2OWO A;  8ICT A;  5KG4 A;  4DFM A;  5IIN A;  5IIO A;  3WKD A;  1V38 A;  5KFN A;  2O6K A;  1ZET A;  3QEA Z;  4FFD A;  4ACO A;  4J9K A;  3PX6 A;  4LEY A;  5KFV A;  2H3F A;  1CI4 A;  3VCB A;  4FHX A;  1KTQ A;  5KFF A;  8ICM A;  1FFV A;  1SV0 A;  2E8N A;  4RNO A;  2XC9 A;  3RB4 A;  4UB3 A;  4FZN A;  4PHE A;  3KKA C;  5D4B A;  2W7O A;  2Y9U A;  4TUS A;  1DK3 A;  3PHZ A;  1F0M A;  4F5O A;  2PFO A;  2RQ5 A;  2M2T A;  4FS1 A;  1N62 A;  5AI8 A;  1J2M A;  2H3Z A;  3GV5 B;  4EV6 A;  1J2N A;  8ICR A;  3LK9 A;  4P0P B;  2HSZ A;  2KV2 A;  4E8F A;  2BDU A;  3V6H A;  3KFU F;  9ICU A;  2QKQ A;  2JV3 A;  4PZO A;  4KMU A;  2YMM A;  4YD2 A;  2NV3 A;  3KZI U;  3BQT A;  2ZIU B;  1OW5 A;  2YML A;  4BUG A;  1ZQB A;  5EE3 A;  3JYY A;  1V4A A;  2PBE A;  5K4L A;  3IHQ B;  5C5J A;  1QQ5 A;  5F9N A;  4EED A;  2WHE A;  5III A;  4GXI A;  5J8Y C;  3ONN A;  4JUZ A;  5ALI A;  4YP3 A;  2OM6 A;  1D8Y A;  2EDU A;  4XJE A;  4YXM A;  3ED5 A;  3RJF A;  1HUZ A;  1ZYQ A;  3EYZ A;  4MFA A;  3MFI A;  3JPR A;  4GXK A;  2O5A A;  3C23 A;  3B9J A;  5CEH A;  2P35 A;  1N60 A;  2WTF A;  1UEU A;  1KL9 A;  4GFJ A;  2G07 A;  4CCH A;  5ALO A;  1T8E A;  5AM2 A;  1R8C A;  2H3Q A;  4CNQ A;  3ISD A;  4EYI B;  4KLT A;  4UB4 A;  2ZH1 A;  4Z6F A;  8ICC A;  2KZ3 A;  5E79 U;  3GQC A;  4Y2Y A;  1TAU A;  1Z3E B;  2J6S A;  5HRF A;  4E7X A;  3NVO A;  3SD7 A;  2E8P A;  5F9L A;  2KTQ A;  3KBB A;  3HRD D;  1MC8 A;  1Q8K A;  3OJS A;  3TFR A;  3L4P A;  2W9A A;  3IG5 A;  2FLP A;  4KB6 A;  1N63 A;  4AT9 A;  4BXO A;  4DCC A;  2HHU A;  3RTV A;  1N5W A;  4WC4 A;  2ZIV B;  5J0P A;  9ICT A;  5J0T A;  1S5L U;  1V97 A;  1JX4 A;  3K1Z A;  1BPY A;  1ZQE A;  4X4O A;  4LJX A;  7ICG A;  3WK8 A;  1ED1 A;  5DB6 A;  4DQR A;  1L7N A;  2BCV A;  1ZQG A;  1ZQZ A;  8ICY A;  4WC2 A;  3Q8R B;  3PST A;  4IR1 A;  4C8O A;  1JN3 A;  3SV3 A;  4C8M A;  4FZM A;  5KFY A;  5DG7 A;  2Q0Z X;  5KG2 A;  5D63 A;  2IOF A;  2V4R A;  1ZJN A;  2I5H A;  1NK9 A;  2K8A A;  1VFG A;  4RQ8 A;  3GDX A;  5JTG A;  2ZUC A;  3HIL A;  4KLO A;  1N61 A;  3NUQ A;  4P0P A;  3WFS C;  1Z00 A;  3UXN A;  1L6N A;  5KFX A;  4K4I A;  3UMG A;  5KFB A;  1NKB A;  3AL0 B;  4DOA A;  4KX5 A;  3BS5 B;  4RQ5 A;  1N2X A;  2FPK A;  3WK7 A;  5CFS A;  1URJ A;  4DL6 A;  9ICP A;  1KN5 A;  2PFQ A;  1X6J A;  1BNO A;  4OJ5 A;  4WBY A;  3IV6 A;  4TQS A;  2KJ9 A;  2W54 A;  1TAM A;  3ALR A;  4O3M A;  3E2E A;  1KLN A;  5DKW A;  3WFQ E;  1ZQW A;  4XA5 A;  1UHU A;  3OV7 A;  4Q45 A;  2P6R A;  2UVU A;  1WCL A;  2BZF A;  2ZH2 A;  2LKY A;  2VA8 A;  1V85 A;  4UD5 A;  2WF9 A;  4KIT B;  4B9M A;  5KFM A;  2A1A A;  3NS1 A;  3RBD A;  1ZQV A;  3TAD A;  5AM0 A;  4PHP A;  2PI4 A;  1MQ3 A;  3QU2 A;  4GIB A;  8ICW A;  4M9G A;  3TAN A;  2DPI A;  5ALD A;  1MSW D;  2ZIW B;  1NK8 A;  4O3O A;  3TAR A;  4MHV A;  4CF3 A;  1U49 A;  5J2E A;  5J0X A;  1NK0 A;  5ALL A;  4NLG A;  2QAR B;  4ZOH C;  4MEX A;  2IUB A;  1DRG A;  2KFZ A;  5EWE A;  1BPX A;  4QZD A;  3BQ0 A;  2IHM A;  4EEL A;  1IG6 A;  1ZRN A;  3FDS A;  3Q8L A;  2HBK A;  1IXR A;  5DG9 A;  1HJP A;  1AQ6 A;  3ICX A;  4CF4 A;  3LQC B;  2NRZ A;  2ZJ5 A;  5D49 A;  4O9M A;  2ZXH A;  2BPC A;  2AGO A;  1TK8 A;  4MFF A;  1XSP A;  4LEW A;  4CGZ A;  2UVW A;  2GA9 D;  7ICN A;  4BWJ A;  4YG2 A;  2ASD A;  3NVW A;  1SL0 A;  2NO4 A;  5DLF A;  1TV9 A;  4ELU A;  3C1Y A;  2FMQ A;  3ER9 B;  2KK0 A;  2JEF A;  5ALK A;  4AYB F;  4ECV A;  1TFR A;  2LHT A;  1ZD2 P;  2YQE A;  5AI0 A;  2K4E A;  3LVW A;  4YR0 A;  7ICH A;  4KLG A;  3M6Z A;  4QWD A;  1VJ7 A;  4LZD A;  4I28 A; 
#chains in the Genus database with same CATH homology
 1ZJM A;  8ICE A;  4DQI A;  5DBB A;  7ICO A;  4TQR A;  5L1L A;  2XCA A;  1LB2 B;  8ICG A;  1X9S A;  1L3V A;  1NO5 A;  1A77 A;  2M2W A;  3H8S A;  4TUQ A;  5HHH A;  5KFG A;  4FHW A;  9ICM A;  2AU0 A;  3UQ0 A;  1NK4 A;  5J2D A;  4PGQ A;  4J9S A;  5HRE A;  4DSI A;  2JEG A;  4F2R A;  2MAX A;  3G6X A;  4DEZ A;  1SKS A;  1ZQI A;  8ICO A;  4K4H A;  4UD4 A;  3V6K A;  3RJH A;  4KLF A;  3RJK A;  3PML A;  3GIL A;  1XSN A;  5KG7 A;  4XQ7 A;  4GLX A;  1S10 A;  9ICX A;  5EWF A;  4FHV A;  5J2H A;  4ECQ A;  5KFT A;  5J2G A;  1PZN A;  5J29 A;  2XGQ A;  3ZDD A;  4I2D A;  3RAQ A;  4RPY A;  1RYR A;  4M9L A;  1ZQD A;  2JEI A;  4WC0 A;  4EP7 A;  1XO1 A;  4X0B A;  2Q66 A;  4HYK A;  4WC5 A;  2I1Q A;  5BOL A;  4EBD A;  4KLM A;  4YFK A;  4RQ0 A;  3HIY A;  4J9M A;  1ZQO A;  4F5R A;  3PR4 A;  4GC7 A;  2UVV A;  2PI5 A;  2ZHB A;  3N97 B;  1XS9 D;  4G3I A;  4LT6 A;  1ZQL A;  3BDP A;  2BE3 A;  4DO9 A;  1H38 A;  3H39 A;  5KT2 A;  2BQR A;  9ICF A;  2AQ4 A;  1X9W A;  1ZQS A;  4ECS A;  2FPM A;  4DFP A;  1ZQU A;  4B9V A;  1T3N A;  4P4M A;  9ICV A;  7ICQ A;  4BWM A;  3PV8 A;  1JQR A;  3ETL A;  3MDC A;  3K75 D;  1T4G A;  3KHL A;  2BPG A;  4LZG A;  3H3A A;  3K4G A;  3PNC A;  4Q43 A;  9ICQ A;  5CP2 A;  1UET A;  5HC9 A;  3KHG A;  3MFH A;  1F5A A;  3NYB A;  5J0O A;  1D9F A;  3T3F A;  1TKD A;  7ICP A;  1V9P A;  4JWM A;  3H4B A;  4O3N A;  1IM4 A;  1MIV A;  2A1J A;  4X4T A;  1JXE A;  2XGP A;  5DQI A;  4O0I A;  1UA0 A;  2JEJ A;  1RPL A;  2C22 A;  2ALZ A;  1MQ2 A;  1LV5 A;  3GFK B;  5DEC A;  4RQ3 A;  5J0S A;  5KFQ A;  2BGW A;  3GV7 B;  2XY6 A;  2BDP A;  4O3R A;  3V7K A;  1KFD A;  1S0O A;  2AGQ A;  2ISO A;  8ICL A;  4QZ9 A;  1BPZ A;  3N4M B;  4C8K A;  9ICG A;  2C2R A;  4DF4 A;  4UBC A;  5KFR A;  1PX5 A;  5HRG A;  4KN4 A;  3RB3 A;  4M9N A;  4KLH A;  4M6W B;  4QZC A;  4QWA A;  4O3Q A;  4R8U A;  1NJY A;  4XRH A;  4B9T A;  2ZJ8 A;  4M47 A;  3H7I A;  3UQ2 A;  3V7L A;  4O5C A;  4J9Q A;  4ECY A;  2FMP A;  5J2F A;  3C18 A;  3TFS A;  5J2A A;  2HHT A;  2IBK A;  4EYH B;  4DWI A;  9ICE A;  3AQN A;  3H37 A;  5DED A;  3OHB A;  4UQG A;  1N56 A;  3OGU A;  4EZ9 A;  9ICB A;  3JPS A;  1NK7 A;  4Q8F A;  5KFK A;  3RRH A;  3RB6 A;  4ELT A;  2ZH9 A;  4RUC A;  4DQS A;  1R8B A;  3ISC A;  3H40 A;  5DGA A;  4AT8 B;  1COO A;  4M5D A;  1SZP A;  3MR6 A;  4GC6 A;  3QEB Z;  2IMW P;  4PH5 A;  4RQ1 A;  4O5K A;  8ICQ A;  5HRL A;  4DF8 A;  4AT7 A;  4KTQ A;  2ZJA A;  7ICV A;  3T5J A;  4NLN A;  2ISP A;  4FBT A;  5KTQ A;  4QZF A;  3PW2 A;  3OUY B;  2RDJ A;  1SKR A;  2BQ3 A;  3OUY A;  2DR5 A;  7ICE A;  7ICU A;  4O3P A;  2NRV A;  7ICF A;  1B43 A;  1S76 D;  4JV2 A;  5KG0 A;  5IIL A;  5KFL A;  3G6Y A;  4WC3 A;  2XO7 A;  1U4B A;  1QSL A;  3EPG A;  2IA6 A;  2DFL A;  4JK1 A;  4B9U A;  4RZR A;  8ICN A;  4I28 A;  4PHA A;  4I2I A;  2VA2 A;  2HHX A;  4RPZ A;  1ZQQ A;  3RJG A;  4R64 A;  3PX0 A;  1BPD A;  4BGD A;  4I27 A;  9ICR A;  4BXO B;  8ICI A;  2ZUB A;  4QZG A;  2KP7 A;  5KFS A;  4YMM A;  4RWQ A;  4X4N A;  3JPP A;  8ICP A;  1S0V A;  4S3N A;  2BKE A;  3JPN A;  2V4Q A;  4ED8 A;  3TAQ A;  1S97 A;  4MFC A;  2Y1J A;  2NRT A;  2P66 A;  9ICN A;  4M9J A;  2NRK A;  2FPL A;  4FO6 A;  2HHW A;  4NKU A;  3H8W A;  3KHH A;  1TVA A;  5KFU A;  4UAY A;  1D9D A;  4YD1 A;  4DLE A;  4JV1 A;  3C2M A;  3JPO A;  3UPQ A;  4Q8E A;  2J6U A;  2OWO A;  1CEZ A;  2ASJ A;  8ICT A;  4NLK A;  5KG4 A;  4DFM A;  2KN7 A;  1D8L A;  5IIO A;  5IIN A;  4DSL A;  4I2E A;  5KFN A;  2RDI A;  1S77 D;  4J9P A;  4WCW A;  1BVS A;  3GIM A;  1ZET A;  3GIJ A;  1XWL A;  1U47 A;  3QEA Z;  3M8R A;  4DL4 A;  4J9K A;  3PX6 A;  4NY8 A;  2RFF A;  4DL5 A;  5KFV A;  5HRD A;  7ICS A;  4PHD A;  8ICZ A;  1NJZ A;  7ICT A;  3GIK A;  5HHI A;  9ICL A;  1KTQ A;  3V72 A;  1ZQT A;  5KFF A;  3LDA A;  8ICM A;  4ED0 A;  4RWO A;  3OVB A;  4RNO A;  2XC9 A;  3EW9 A;  5BOM A;  4DL3 A;  3RB4 A;  1ZQR A;  4DL2 A;  1ZQY A;  4UB3 A;  3MR5 A;  4WC1 A;  4J9L A;  1QSS A;  4PHE A;  4EBC A;  5D4B A;  4YR3 A;  4F93 B;  3RJE A;  5DBC A;  4TUS A;  4UB2 A;  3TAP A;  1K1Q A;  4C8L A;  1DK3 A;  1SL2 A;  3T5H A;  5L9X A;  2XY7 A;  5KG3 A;  4F5N A;  4F5O A;  5IIK A;  4DFK A;  2PFO A;  2M2T A;  4QWC A;  4FS1 A;  4XUS A;  2W9C B;  3BQ2 A;  3T5K A;  4FHX A;  3GV5 B;  4IG8 A;  3Q8Q B;  4YMN A;  4EBE A;  4RPX A;  1NK5 A;  8ICR A;  4FHY A;  3LK9 A;  3TI0 A;  1UA1 A;  1RXW A;  3AQK A;  3AQM A;  4E8F A;  3AU2 A;  2J6T A;  4EBJ A;  4O3S A;  9ICU A;  1ZQX A;  2XCP A;  3V6H A;  3PW7 A;  4F8R A;  2M2U A;  1NK6 A;  3C1Z A;  4KMU A;  3MBY A;  3C2L A;  4E0D A;  4DS4 A;  1TAQ A;  1L3T A;  4F4W A;  2JZB B;  3QZ7 A;  4X4Q A;  1TFY A;  2VAN A;  4YD2 A;  4X4V A;  1DGS A;  4TUP A;  5KT5 A;  3BQT A;  3V7J A;  3PW0 A;  4X5V A;  1RXV A;  5HP4 A;  1ZQB A;  5L1I A;  7ICI A;  2ZH8 A;  3HJ1 A;  3JYY A;  5CA7 A;  2H5X A;  4DSE A;  1FA0 A;  3SZ2 A;  3MAB A;  1BPE A;  2ZH4 A;  1WCN A;  3FYH A;  1V4A A;  2PBE A;  4FBU A;  5HRB A;  3IHQ B;  3RR7 A;  5C5J A;  5KG1 A;  9ICO A;  2R8K A;  4ATB B;  4ATB A;  5F9N A;  2B21 A;  2DR9 A;  4RWN A;  5III A;  2BR0 A;  1KSP A;  2FLL A;  5KFI A;  4R66 A;  3MR3 A;  4GXI A;  3TQ1 A;  4M9H A;  4WC7 A;  4QWE A;  3THV A;  4JUZ A;  4YP3 A;  2C2D A;  3KTQ A;  3ZDC A;  1U45 A;  9ICW A;  2BHN A;  5DBA A;  4F5P A;  1D8Y A;  5DB7 A;  4YXM A;  1T7P A;  3RJF A;  3NGD A;  1ZQA A;  1HUZ A;  1ZYQ A;  3EYZ A;  4MFA A;  3MFI A;  4RNM A;  3M8S A;  3JPR A;  4GXK A;  5L1K A;  3C23 A;  2DPJ A;  5HR9 A;  2O5A A;  3WFP A;  8ICJ A;  4YVZ A;  8ICV A;  4MF2 A;  2WTF A;  1UEU A;  4UAZ A;  3KHR A;  4QW8 A;  4M6W A;  4CCH A;  7ICR A;  1T8E A;  8ICX A;  1ZQN A;  5KFC A;  9ICS A;  2DRA A;  3RBE A;  3OVS A;  5J0W A;  4KLL A;  3RJJ A;  1R8C A;  3EWA A;  5HNK A;  3ISD A;  4EYI B;  4KLT A;  8ICK A;  4UB4 A;  4KLJ A;  2ZH1 A;  5DDY A;  4Z6F A;  4NXZ A;  1NKC A;  8ICC A;  2KZ3 A;  3RB0 A;  3Q8M A;  3UPS A;  1HUO A;  3GQC A;  1TFW A;  1K1S A;  4IQW A;  3ZD8 A;  3BQ1 A;  1TAU A;  1Z3E B;  2J6S A;  5HRF A;  4E7X A;  4AT8 A;  4J9N A;  5D46 A;  4ZH4 A;  5KFA A;  2ASL A;  1SKW A;  2R8J A;  4DSK A;  4LVS A;  5KG6 A;  5F9L A;  4ECU A;  2HVI A;  4ECZ A;  2KTQ A;  2LYH A;  3PO5 A;  3PO4 A;  1MC8 A;  3OJS A;  2R8G A;  4KLS A;  1ZQK A;  3TFR A;  4I2J A;  3AUO A;  2W9A A;  4PGX A;  5KT3 A;  4F5Q A;  5KFW A;  2XY5 A;  2FLP A;  1NOM A;  5KFJ A;  4AT9 B;  1KFT A;  4AT9 A;  3WFO A;  3OSN A;  5KFD A;  4IQV A;  4BXO A;  3H8J A;  1JMS A;  4RU9 A;  2ATL A;  2HHU A;  8ICB A;  7ICJ A;  4UBB A;  4YMO A;  3RTV A;  4X0A A;  4I2A A;  4WC4 A;  9ICH A;  3M9M B;  1MIW A;  2C28 A;  5HRI A;  3RH5 A;  4X4R A;  5J0P A;  4YR2 A;  4TUR A;  3RR8 A;  9ICT A;  1MIY A;  5F2V O;  2W9B B;  5J0T A;  3T5L A;  4DFJ A;  4RNN A;  2ZH3 A;  2ZTD A;  1ZQH A;  5BPC A;  3ISB A;  1JX4 A;  2I9G A;  3SV4 A;  1X9M A;  1BPY A;  1ZQE A;  4X4O A;  7ICG A;  4ED3 A;  3B0Y A;  5DB6 A;  4I2B A;  5J0Q A;  4DSJ A;  1DK2 A;  2FLN A;  4RWP A;  1XU4 A;  5CJ7 A;  3ZD9 A;  3LWL A;  3EZ5 A;  4DQR A;  2M2V A;  3Q8S B;  1JAJ A;  5KT4 A;  2BCV A;  4F92 B;  1ZQZ A;  4P4O A;  1ZQG A;  3RRG A;  2HHV A;  8ICY A;  3Q8R B;  9ICC A;  4WC2 A;  4DOB A;  1R89 A;  5HRH A;  2BCS A;  4C8O A;  1S0M A;  4IR1 A;  4Z6C A;  7ICL A;  1JN3 A;  1YLQ A;  4I29 A;  4X4P A;  4WBZ A;  4J9R A;  5J0R A;  4UAW A;  3SV3 A;  3PW5 A;  4F91 B;  4C8M A;  4GXJ A;  1Q79 A;  1L5U A;  5DB9 A;  5KFZ A;  5KFY A;  3LWM A;  5DG7 A;  2MUT B;  3JPT A;  1KDH A;  2KZM A;  3C66 A;  3G6V A;  2Q0Z X;  5KG2 A;  1C7Y A;  1Y88 A;  4NM2 A;  4P4P A;  4QZA A;  3RH6 A;  4J9O A;  1L3S A;  2BCU A;  2PFP A;  4M0A A;  2ZH7 A;  3HW8 A;  4KLE A;  2V4R A;  5HRK A;  5CR0 A;  4F4Y A;  1ZJN A;  4ED6 A;  8ICH A;  4I2G A;  4JV0 A;  3OSP A;  1NK9 A;  4YQW A;  2AQ0 A;  1ARO P;  1Q78 A;  3MR2 A;  4X4S A;  4IQT A;  2W9C A;  1VFG A;  4RQ8 A;  3RAX A;  1NJW A;  3GDX A;  3AQL A;  2ZUC A;  3M9N B;  4KLO A;  3WFS C;  3GV8 B;  1TK0 A;  1Z00 B;  3AU6 A;  2DR7 A;  1Z00 A;  3UXN A;  5EWG A;  4IR9 A;  1U9L A;  1XSL A;  4IQU A;  5KFX A;  3MDA A;  4PGY A;  2NRX A;  5EOZ A;  4QZI A;  3GII A;  1NKE A;  1ZQC A;  4K4I A;  2ZTC A;  5KFB A;  2JZB A;  1NKB A;  2C2E A;  4Z6D A;  3PW4 A;  4DOA A;  1BPB A;  4M04 A;  1UT8 A;  2DVI A;  5IIM A;  4RQ5 A;  4M2Y A;  4EEY A;  1RYS A;  2FPK A;  5JUM A;  5KFH A;  3PR5 B;  4DL6 A;  2BQU A;  4B9S A;  4IRC A;  3C5F A;  9ICP A;  2O1P A;  2ZH5 A;  2PFQ A;  2VA3 A;  1KFS A;  3HT3 A;  4QWB A;  2R8I A;  1BNO A;  4FH3 A;  4WBY A;  4TQS A;  4DQQ A;  5CB1 A;  2V9W A;  4DLG A;  1U48 A;  4YXJ A;  3QE9 Y;  1ZQF A;  2W8L A;  4DSF A;  2R8H A;  4ECT A;  2HHQ A;  4Z6E A;  2GWS A;  1N48 A;  2ID1 A;  3PMN A;  3JPQ A;  3MGH A;  3HWT A;  3E2E A;  1BNP A;  1KLN A;  5DKW A;  3WFQ E;  5DQH A;  1ZQW A;  5IIJ A;  2P6U A;  4XA5 A;  4Q45 A;  2P6R A;  3OV7 A;  2UVU A;  1WCL A;  5J2B A;  3M9O B;  7ICM A;  2VA8 A;  3UXP A;  2HVH A;  9ICK A;  2ZH2 A;  4O5E A;  3HPO A;  4B9L A;  1X2I A;  4F2S A;  3QZ8 A;  4UD5 A;  3NTU A;  3RH4 A;  8ICU A;  2ZUD A;  4KIT B;  4RQ4 A;  8ICA A;  2W9M A;  2ZTE A;  1ZQP A;  4B9M A;  5KFM A;  4NLZ A;  1KNY A;  2HHP A;  4DQP A;  3C5G A;  4RQ6 A;  4QZB A;  4BDP A;  2F1J A;  4MEY A;  4QZH A;  4MF8 A;  1QLN A;  3RBD A;  4IRK A;  3MGI A;  4KLQ A;  1ZQV A;  4FS2 A;  2A1J B;  4XQ8 A;  1QSY A;  5KG5 A;  4DS5 A;  1NJX A;  4PHP A;  5KFO A;  3RJI A;  1MQ3 A;  2BCR A;  2PI4 A;  4ELV A;  3EPI A;  4ED1 A;  4ECR A;  4X4U A;  8ICW A;  3H4D A;  4M9G A;  5HMM A;  3TAN A;  2DPI A;  5HML A;  1S0N A;  3PY8 A;  1MSW D;  3H38 A;  1NK8 A;  1UEV A;  1JXL A;  5DLG A;  4O3O A;  5J2C A;  4KN7 A;  4UB5 A;  3TAR A;  4QZ8 A;  1U49 A;  3L9D A;  5J2E A;  3UXO A;  4R65 A;  4ED2 A;  5DDM A;  9ICI A;  4UB1 A;  2F1I A;  1ZQJ A;  2NRW A;  4RQ7 A;  5J0X A;  4ECX A;  1NK0 A;  2IHN A;  2UVR A;  5KT6 A;  4IRD A;  1WOT A;  3ORY A;  4E80 A;  4RUA A;  3WFR E;  9ICA A;  4R8U B;  5KT7 A;  4I2F A;  1KEJ A;  3C21 A;  2BPF A;  4F50 A;  4EBK A;  7ICK A;  1VJ7 A;  4DOC A;  4NLG A;  2AJQ A;  1KRP A;  4QW9 A;  4DL7 A;  3B0X A;  9ICJ A;  3JZ0 A;  4MEX A;  1SL1 A;  8ICF A;  5L1J A;  2KFZ A;  5EWE A;  5J2I A;  4QZD A;  3BQ0 A;  1TK5 A;  4Q44 A;  5TZV A;  1BPX A;  2KZZ A;  2FMS A;  2IHM A;  4I2C A;  1R8A A;  2ZHA A;  2BCQ A;  1CUK A;  4F4K A;  4KLD A;  1JIH A;  3HJ4 A;  2DRB A;  1B22 A;  4AT7 B;  3FDS A;  3Q8L A;  4JWN A;  4KLI A;  4WC6 A;  4F3O A;  3ZDB A;  3OJU A;  1XC9 A;  1IXR A;  5DQG A;  3V6J A;  1QTM A;  4RQ2 A;  4KLU A;  2KFN A;  4FHP A;  5DG9 A;  1HJP A;  2HHS A;  5J0Y A;  2W9B A;  3LQC B;  2NRZ A;  3HP6 A;  1A76 A;  2ZJ5 A;  5D49 A;  5KFP A;  3BJY A;  4O9M A;  3Q8K A;  2BPC A;  3IM1 A;  3C2K A;  2AGO A;  4C8N A;  5DG8 A;  1TK8 A;  1DOQ A;  1XSP A;  4K4G A;  1S9F A;  4MFF A;  2HW3 A;  1OU5 A;  2UVW A;  2ZH6 A;  4RT3 A;  3PVX A;  4NKT A;  5KFE A;  2Y1I A;  4ED7 A;  4F4X A;  7ICN A;  4BWJ A;  3ZDE A;  4YG2 A;  1RZT A;  4B9N A;  2ASD A;  1EXN A;  1SL0 A;  8ICS A;  5J2K A;  5J2J A;  5CHG A;  5DLF A;  3OHA A;  3PX4 A;  1TV9 A;  4ELU A;  3SI8 A;  3C1Y A;  4PPX A;  5J0U A;  2FMQ A;  2W8K A;  1BGX T;  1UT5 A;  3HX0 A;  2AGP A;  4EZ6 A;  2JEF A;  2PFN A;  4F4Z A;  2MUT A;  2PXI A;  2M9N A;  4ECV A;  1TFR A;  4R63 A;  5DGB A;  1ZQM A;  5CWR A;  2DR8 A;  4YCX A;  4NM1 A;  2F1H A;  4YR0 A;  7ICH A;  3OVA A;  4KLG A;  4ECW A;  1NZP A;  4QZE A;  1L3U A;  3SYZ A;  4RT2 A;  4I2H A;  4QWD A;  5DB8 A;  3Q8P B;  4P2H A;  4FH5 A;  3ZDA A;  4LZD A;  4YN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...