5BOMA

Dna polymerase beta binary complex with a templating 5clc
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
320
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 320
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bomA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bomA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bomA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bomA03
3JPTA 1DOQA 2BPGA 1UEVA 3H3AA 2BQ3A 2A1JB 5F9NA 4F4XA 2ZH2A 4X4PA 3MR3A 3LWMA 3EZ5A 4ECVA 2BCQA 4KLQA 2P6UA 4NLKA 8ICLA 5CB1A 2FLNA 4KLOA 4DFMA 4FHPA 4AT8A 3OUYB 5KFZA 4M9NA 3MDCA 4IQVA 5J0XA 3NYBA 3ZDEA 1BNPA 5HRBA 4EZ9A 5KFHA 3M8RA 2J6SA 4KLFA 4FHXA 3C2MA 4RNNA 3OVBA 4XQ7A 4I2DA 3V6JA 2W9CA 3MDAA 8ICKA 4DL4A 2ZTCA 4X4RA 9ICEA 2ALZA 4RT3A 8ICTA 3RTVA 4RQ1A 4F50A 3PY8A 1ZQTA 4MF2A 4JV1A 1Z3EB 9ICTA 2ZH1A 2Q66A 3PV8A 5J0WA 3RH6A 4IR1A 3RB0A 5KT3A 4O3NA 4P4MA 4E0DA 2MUTA 4YVZA 4QZCA 5DBAA 4M0AA 5D49A 1B22A 4DOBA 2V9WA 4I2AA 2H5XA 1XO1A 4XRHA 3ISCA 1ZQCA 4UB3A 2XCPA 4CCHA 1BPYA 1UA1A 4BXOA 4DLEA 4X4QA 4ECUA 3C1YA 2BPFA 5J0YA 3RJGA 3EPGA 4X4SA 4RQ6A 4NKTA 3H8WA 4ECTA 2HW3A 7ICVA 5KG1A 5HRGA 4QWCA 3RJKA 2DFLA 2ZJ8A 4ECYA 1JIHA 1IM4A 2MUTB 1VFGA 4GC7A 3KHGA 1X2IA 3KHLA 3RBEA 1SL0A 1S77D 3OGUA 2C2DA 1XU4A 2C2EA 1KFTA 5DQIA 1VJ7A 4UB2A 1B43A 2FMQA 3GV8B 4DOCA 1U45A 3ZDDA 3QZ8A 3UXPA 2IBKA 3Q8QB 2J6UA 1SL1A 3MFHA 2XY7A 4O5EA 2MAXA 4B9VA 2ZH9A 3G6VA 5J2IA 4MFCA 5J2GA 4IRCA 4YR3A 4BGDA 3C2KA 4DOAA 3WFRE 1ZQZA 2ZTEA 2AGPA 1ZQKA 2ASJA 1ZQAA 1TFRA 4MFFA 3V7JA 3NTUA 4R65A 4I2JA 2HHSA 4YQWA 5KFAA 4DLGA 4JV0A 3MBYA 4O3OA 3PX4A 4NM2A 2XCAA 2B21A 4KN7A 2BCVA 5KFOA 2HHXA 4M5DA 2HHPA 1C7YA 5J0UA 4KLTA 8ICQA 4AT7B 4DQIA 3M9OB 4RWNA 4YXMA 4JWMA 7ICPA 1CEZA 4KLIA 4DQRA 1ZQFA 2FPMA 5L1IA 3H8SA 1ZYQA 5KFUA 2FLPA 4PPXA 3C66A 4WC0A 5DEDA 4P4PA 1PX5A 1RZTA 5HNKA 4F5RA 5DB7A 2BPCA 3RJHA 4KLDA 7ICFA 2I1QA 5EWGA 1JQRA 3GILA 2PXIA 4J9LA 5IILA 4X0BA 1IXRA 4BWMA 5DB8A 1Q79A 3EWAA 3GV5B 2P6RA 3H39A 1S0OA 4WC4A 3ORYA 5J2CA 4ED2A 1ZQBA 4GXKA 3PX0A 2IHNA 7ICJA 9ICIA 7ICRA 4F92B 2AU0A 4ECXA 2V4QA 2DPIA 5L1LA 4IQWA 2V4RA 1D9DA 2DR8A 3QEBZ 4I2FA 4X4VA 2NRTA 4B9UA 8ICMA 4ELVA 4YG2A 5DDYA 4RUAA 5KG4A 4J9KA 3GFKB 4EEYA 5BPCA 4Q44A 7ICIA 4YMNA 4WC2A 3LK9A 3JPNA 5DDMA 8ICEA 4ED6A 4LT6A 8ICBA 4BDPA 1N48A 5HRFA 1ZQYA 4WC3A 4Q43A 4F4YA 4DL2A 5J2HA 2XGPA 3WFOA 4Z6CA 4I29A 4E8FA 3UQ0A 4JWNA 2JEIA 2WTFA 5DGAA 1A77A 4PHEA 4DF4A 1U48A 5KFCA 8ICPA 4R66A 1R8AA 5EWEA 3QEAZ 2BCSA 3WFSC 1NJYA 4F2RA 1KLNA 3TAPA 3L9DA 8ICJA 4YMOA 4B9LA 3RR7A 4M2YA 5KG2A 8ICIA 2HHQA 3T5JA 5D4BA 4RT2A 1KFDA 5IIMA 1RYRA 2FLLA 5J2AA 3MGHA 9ICKA 4F91B 4X4TA 5JUMA 4XQ8A 5KFKA 4WBYA 4X0AA 3M9MB 1MQ3A 2ISOA 2RDJA 1U4BA 4I27A 2R8HA 2DPJA 5DKWA 4IQUA 4JUZA 5J29A 3LQCB 3AU6A 1KNYA 4F8RA 4YD2A 1KDHA 5KFPA 4F2SA 8ICOA 9ICGA 4R63A 3UXNA 4GXIA 4X4OA 4B9TA 1ZQIA 1JN3A 3UXOA 1XSPA 3SV4A 9ICPA 4WC1A 4O0IA 4IG8A 2NRWA 9ICRA 4J9MA 9ICJA 8ICUA 1KFSA 2UVVA 5KT4A 4KLHA 1NK8A 4M47A 3H4DA 1XS9D 1NJXA 7ICHA 9ICXA 4FHYA 1AROP 5IIKA 7ICNA 1T8EA 4QW9A 3HWTA 1TVAA 2ZTDA 5EOZA 3H7IA 5J0PA 1TK8A 4FBTA 1BGXT 5CWRA 8ICGA 3PO5A 2AJQA 4DSIA 1MIVA 2AQ0A 2HHWA 4YP3A 2KZZA 3RJIA 3RB4A 4QZ8A 1TK5A 3H37A 2C28A 4Q8FA 5KFNA 4RPYA 4YCXA 4GLXA 4KLMA 1Q78A 2P66A 1U9LA 1QLNA 1SZPA 3TARA 1NJZA 3RAXA 4EBCA 1K1SA 2R8JA 9ICAA 2DR7A 1H38A 4FHVA 4X4NA 2XGQA 3JPRA 3V72A 9ICUA 4KITB 8ICXA 4ATBA 1OU5A 4EZ6A 2JZBA 5IIIA 2AGQA 1UA0A 2HHUA 1QSYA 2ISPA 4XA5A 3PX6A 4I2GA 1UETA 2F1HA 4PHPA 2W9BB 3GDXA 4DQSA 4WC7A 2BHNA 5KFQA 2ASDA 2XY6A 2ZUDA 4P4OA 4LZGA 3KTQA 1F5AA 2DR5A 4UQGA 4RPZA 5KFXA 4J9PA 3ETLA 4DWIA 1ZQLA 4ED1A 7ICUA 2W8LA 4RUCA 1UT5A 4I2IA 5HR9A 1KRPA 4QZIA 3RRHA 1R8CA 1S0NA 3Q8PB 1JXLA 3HIYA 4FHWA 4DL3A 9ICVA 4DSJA 5DG8A 2W9BA 2W8KA 1NK6A 4Z6DA 5HP4A 2JEJA 1ZQRA 4DSKA 3OVSA 1NOMA 2FMPA 4ELUA 3QE9Y 2M2TA 3Q8KA 2DRBA 4DQPA 9ICQA 4RQ7A 3FYHA 3KHHA 1DGSA 4RQ5A 1S0MA 4QWAA 2NRZA 4RU9A 3ZDAA 8ICRA 5KFEA 5J2EA 4M9GA 4EBJA 4ECZA 1MC8A 2DVIA 1NKCA 1TAUA 2O5AA 3B0XA 4ED3A 4IR9A 1NKBA 5J2KA 1KTQA 1QTMA 4YD1A 4LZDA 3M8SA 1RYSA 4M9LA 1UT8A 1NK5A 3RB3A 4KLGA 4BWJA 2VANA 3BQTA 1BPBA 1X9WA 4NY8A 3BQ1A 1WOTA 4KLJA 2IA6A 3HP6A 3PO4A 4UB1A 9ICOA 9ICLA 4KLEA 1NK0A 4O9MA 2KZMA 2NRKA 1ZETA 1L3SA 3QZ7A 1JX4A 4LVSA 1R8BA 5DBCA 1XC9A 5HRIA 5HMMA 4RQ0A 4RNOA 3JPSA 2OWOA 3EW9A 5J0QA 1T3NA 4Z6FA 2PFQA 2VA2A 9ICFA 3MGIA 3BQ2A 1Z00A 2FMSA 2KFNA 3RBDA 4EYIB 4QWBA 2M9NA 5TZVA 4C8OA 3GQCA 4NKUA 2J6TA 5IINA 4EBDA 1COOA 4GXJA 4K4GA 4MFAA 5L1JA 4YMMA 2FPKA 2Q0ZX 5HHHA 5J0OA 4RWPA 2C2RA 2IHMA 3RJFA 3E2EA 4IRKA 5J2FA 4KLUA 4PH5A 1DK3A 4PHDA 2VA3A 2PI4A 4RPXA 2DRAA 3Q8RB 1Z00B 4YR0A 3G6YA 3UQ2A 1L3VA 4NM1A 2KTQA 4WBZA 3OV7A 4DFKA 4K4HA 2JEFA 2RFFA 2ZUCA 2HVIA 3C5FA 2BKEA 5KFYA 4KN4A 1HUOA 3JZ0A 4C8LA 4JV2A 2NRVA 4QWDA 3C21A 1R89A 8ICYA 4AT9A 3AQNA 4AT7A 1LV5A 2W9AA 4UAWA 7ICSA 4FS2A 3Q8SB 5KFTA 2W9MA 4M9HA 4ZH4A 2A1JA 2FPLA 3PVXA 4I2CA 1PZNA 1BVSA 1A76A 2F1IA 4Z6EA 3ZD8A 3IHQB 3NGDA 3OSNA 5DLFA 4UD5A 4QZ9A 5KTQA 2XO7A 3GIKA 3OJSA 4DL7A 4UB4A 5KFWA 5HREA 2BCRA 4DFJA 4KLSA 3SV3A 3AU2A 5KFSA 4X5VA 5KG5A 3RJEA 4E80A 4QW8A 9ICCA 1S10A 5DQHA 1RXWA 2ZUBA 1S0VA 3LDAA 4DQQA 2O1PA 5EWFA 4EP7A 1U47A 4YR2A 5KFLA 1XSLA 2UVUA 3Q8LA 2KP7A 2GWSA 4R64A 5L9XA 1ZQMA 4YXJA 1S76D 2KFZA 7ICKA 4JK1A 2M2WA 1FA0A 4Q45A 1X9SA 2HVHA 2R8GA 1BPEA 5CA7A 3RB6A 1D9FA 4RQ4A 4DFPA 3PR5B 3MR5A 2UVRA 4RWOA 4I28A 7ICQA 1NO5A 1NK4A 4FBUA 4WCWA 2I9GA 4EBKA 4QZEA 4FH3A 3TFRA 4BXOB 4UAZA 4DS4A 2LYHA 4EYHB 1NK9A 1YLQA 4O3PA 3HPOA 2DR9A 8ICCA 7ICMA 9ICBA 5KFJA 3K75D 1BPDA 5KFRA 3MR2A 4F5NA 4ECRA 1RXVA 1QSLA 2ZHAA 3B0YA 5DB6A 5KT7A 5KT2A 3WFQE 3HW8A 5DG9A 3WFPA 4NLGA 1DK2A 2F1JA 4I2EA 1S97A 2M2VA 3RAQA 1L3TA 1ZQOA 4F3OA 3HJ4A 2RDIA 3AQKA 4QZGA 3N4MB 4F5OA 2R8IA 3MFIA 4M6WB 3AUOA 3ZD9A 1ZQEA 5HHIA 4O5CA 5HC9A 4PHAA 5J2DA 4TUSA 1BPXA 4ED0A 8ICZA 3SYZA 5DECA 4RQ8A 8ICHA 5KG6A 5J0SA 3TI0A 4WC6A 5BOLA 2ZH5A 2ZHBA 1TKDA 1ZQSA 1HUZA 5DB9A 4UBCA 5J0TA 2HHVA 3V7KA 4DL5A 4ELTA 5HRKA 3T3FA 4RNMA 8ICSA 9ICWA 3MR6A 2PBEA 9ICSA 4QZDA 4HYKA 4M6WA 4R8UB 3SZ2A 2AQ4A 1RPLA 4J9SA 1TK0A 1SKRA 5KFIA 2XY5A 3PW5A 5J2BA 4O3RA 4NLZA 1TAQA 2PFPA 5KFFA 3PW7A 3ISBA 4F4WA 4FS1A 2IMWP 2JEGA 3ZDCA 3GIJA 4IRDA 5F2VO 1NK7A 4IQTA 2R8KA 3RH4A 8ICNA 2BQUA 3V6KA 1UEUA 1TV9A 1ZQDA 3C18A 1HJPA 4O3QA 4M04A 1SL2A 2KN7A 5DG7A 3JPOA 1SKWA 3HX0A 4TQSA 8ICVA 1NKEA 4J9OA 9ICNA 1JXEA 4NLNA 5DBBA 5J0RA 4J9RA 7ICOA 3H38A 4R8UA 3BDPA 4RZRA 4I2BA 3GIMA 1T4GA 9ICMA 4FH5A 4S3NA 4UBBA 3Q8MA 1ZQNA 3ISDA 1MIYA 4C8NA 3IM1A 3N97B 4ATBB 2VA8A 4TQRA 3TQ1A 7ICGA 1X9MA 7ICEA 4UB5A 1MIWA 1ZJMA 2AGOA 3TANA 4X4UA 2BR0A 3OSPA 2UVWA 5KFVA 4WC5A 1D8YA 1KEJA 4NXZA 5HMLA 4F5PA 4PGYA 4ED8A 4C8MA 4KLLA 3C23A 4K4IA 5KFGA 2NRXA 2ZH6A 3G6XA 2ZH7A 1ZQGA 2ID1A 4PGXA 4DL6A 4O5KA 5CJ7A 5KT6A 3THVA 3EYZA 3AQMA 4YN4A 3T5LA 1ZJNA 4ECWA 4ECQA 5CHGA 5IIOA 1ZQXA 3V6HA 5KFMA 1N56A 1NZPA 2ZH3A 4B9SA 2BE3A 4XUSA 2PI5A 9ICHA 1U49A 2ZJAA 1K1QA 5J2JA 1ZQWA 3OHAA 4F4ZA 3RH5A 4O3SA 1V9PA 3PMNA 2M2UA 3AQLA 3HJ1A 3PMLA 3JPPA 3MABA 5CR0A 3PW2A 4MEXA 1JAJA 3K4GA 4I2HA 2ATLA 4QZAA 3PR4A 2ZH4A 5KFBA 3LWLA 3ZDBA 5HRLA 1XWLA 5IIJA 3HT3A 4DO9A 4RWQA 2PFNA 3OHBA 3RR8A 1EXNA 3BJYA 1Y88A 4MEYA 3UPQA 1ZQQA 2BGWA 5HRHA 5DQGA 5HRDA 2XC9A 4TURA 4MF8A 2Y1JA 7ICTA 1ZQVA 3GIIA 1T7PA 1V4AA 1L3UA 1ZQHA 1ZQJA 4UD4A 2ZH8A 3PW4A 2BCUA 1XSNA 3C1ZA 4DSFA 1BPZA 4B9NA 1KSPA 5KG0A 4F93B 1S9FA 4C8KA 4DEZA 1WCNA 4KTQA 2HHTA 5DGBA 3PW0A 7ICLA 3PNCA 1CUKA 2ZJ5A 5KT5A 4TUQA 3V7LA 1MQ2A 1LB2B 5KG3A 4E7XA 5CP2A 4F4KA 4M9JA 3EPIA 3UPSA 1L5UA 1MSWD 5KG7A 3BQ0A 3OVAA 5BOMA 1D8LA 5C5JA 4PGQA 4UAYA 2ASLA 3RRGA 5DLGA 1TFWA 2KZ3A 4DSLA 3RJJA 4J9NA 4TUPA 4F5QA 2C22A 1QSSA 1BNOA 3T5KA 3H4BA 2PFOA 4J9QA 4ED7A 1ZQUA 8ICWA 4ECSA 3T5HA 1SKSA 1JMSA 4KMUA 4QWEA 1ZQPA 8ICAA 4DF8A 5D46A 4GC6A 4P2HA 4B9MA 1TFYA 4YFKA 2BDPA 1WCLA 4RQ3A 4QZHA 3JPQA 3C5GA 4QZFA 3C2LA 4RQ2A 4G3IA 4Q8EA 3KHRA 5L1KA 3M9NB 3JYYA 5KFDA 4EBEA 4FO6A 3OUYA 3GV7B 2JZBB 4AT8B 3FDSA 4QZBA 3OJUA 3TAQA 3H40A 3H8JA 4DSEA 8ICFA 1NJWA 3TFSA 4DS5A 5F9LA 4AT9B 2BQRA 2Y1IA 2W9CB 3SI8A
chains in the Genus database with same CATH superfamily
3H3AA 3IRUA 2R18A 2KVCA 2JH1A 5F9NA 1D8BA 4X4PA 3MR3A 2QLTA 4MKPA 1SV0A 4KLOA 4M9NA 4IQVA 4WQKA 1X40A 3ZDEA 4EZ9A 2J6SA 2D6FC 4DL4A 4X4RA 2KIWA 4RT3A 3RTVA 3PY8A 2KIVA 4JV1A 9ICTA 2QB0A 2RP5A 3ONNA 3RB0A 2Z7JA 5DBAA 3TACB 2YMPA 3IN5A 4DOBA 2V9WA 2H5XA 4X4QA 1UA1A 3C28A 4ECUA 2BPFA 1JI7A 3EPGA 1X66A 3H8WA 3O0FA 2LBOA 1PVQA 4ECTA 1OUQA 2AH5A 2K8AA 2QB0B 4QWCA 3RJKA 4GC7A 2I6XA 1X2IA 2C2DA 5AM0A 4CNQA 3ZDDA 2IBKA 3Q8QB 1SL1A 4O5EA 2MAXA 2ZH9A 1Q3VA 4C4SA 5AKYA 3AQFA 4YR3A 3C2KA 4DOAA 1S5LU 1WYGA 2AGPA 1ZQKA 4YQWA 4P0QA 3PX4A 2GA9D 4UB6U 2BCVA 1C7YA 4KLTA 2F8LA 4RWNA 7ICPA 1V85A 2NO4A 2FPMA 5L1IA 5KFUA 1FO4A 4WC0A 2JRZA 5ALHA 3NVYA 3CYMA 1JQRA 3GILA 2JMGA 1ZQBA 4GXKA 7ICJA 4F92B 2DPIA 1D9DA 1YZ6A 2NRTA 3T79A 2Y0SF 2K8CB 5KG4A 3GFKB 4Q44A 1L7MA 4WC2A 5DDMA 4BDPA 5HRFA 4Q43A 2XGPA 3KZXA 4FFDA 3CP8A 5DGAA 1A77A 3OWGA 3QEAZ 1NJYA 4F2RA 2KOBA 2HN1A 4M2YA 5J2AA 4XQ8A 4X0AA 2ISOA 2R8HA 2DPJA 4IQUA 3LQCB 4F8RA 4EX7A 4R63A 3UXOA 4K98A 3PSFA 3SV4A 1XSPA 3N7RC 2YQEA 4WC1A 4IG8A 9ICJA 5KT4A 1NK8A 3H4DA 1XS9D 4FHYA 1AROP 7ICNA 1X9XA 2ZTDA 5EOZA 1SZHA 3RJIA 1RM6C 2RHFA 2BBHA 4RPYA 4KLMA 4GLXA 2P66A 2R8JA 2HSZA 1FFUA 2JZBA 1UA0A 3FM9A 2W9BB 3GDXA 2XICA 2KNJA 1DXSA 4C0ZA 4ED1A 2JR5A 4RUCA 1S0NA 3AL0B 2DQNB 2E8OA 1RDFA 2DBYA 5HP4A 1ZQRA 1NOMA 2FMPA 9ICQA 3FYHA 5DEDA 3ERCC 1WWUA 3B0XA 4ED3A 2B51A 1NKBA 5J2KA 3SD7A 1NK5A 4KLGA 1X9WA 1WOTA 2ZIWB 2KVSA 2FE9A 3OV7A 4RQ0A 2B6GA 1Z00A 4EYIB 4NV0A 4C8OA 2NO5A 5IINA 4EBDA 4GXJA 2FPKA 2ZIWA 4Y2PA 4IRKA 1SXEA 2VA3A 1L3VA 5KAIU 4K4HA 1Z19A 2YN4A 4KN4A 1HUOA 2VJ5A 4C8LA 4B6JA 3IV6A 1R89A 3AQNA 1JROA 4UAWA 3Q8SB 1QQ5A 2E3TA 4US9A 1Q3UA 5AM2A 3MGVA 2EH9A 1WG8A 4DFJA 4KLSA 3RJEA 4O3MA 2NV3A 1RXWA 3WFRE 5AK3A 5KFLA 3WKDA 2GWSA 5JRTA 4R64A 1ZQMA 1FA0A 3NUQA 1Z1BA 2F3NA 2W3SA 1F44A 1BPEA 5CA7A 4RWOA 1NO5A 1T94A 1ZD5A 2JHDA 4QZEA 5AIBA 4FH3A 5AM5A 1YLQA 2DR9A 5AKKA 8ICCA 4ECRA 4F5NA 4OAIZ 5KT7A 5KT2A 3WFQE 5DG9A 1DK2A 2F1JA 4I2EA 1S97A 2KICA 2RDIA 2DKXA 5CRXA 5T14A 5D61A 5EE0A 1ZQEA 2KD1A 3SYZA 5DECA 2ZHBA 4AP9A 4P0PB 5CHEA 2HHVA 5J0TA 4ELTA 2MU2A 3T3FA 3MR6A 1O08A 3MC1A 2PBEA 4QZDA 2AQ4A 5AKZA 1SKRA 2XY5A 4CDGA 3PW7A 2JXJA 3RH4A 3C18A 1HJPA 3F5AA 7ICOA 4J9RA 3H38A 2OEHA 3BDPA 4I2BA 3GIMA 1T4GA 9ICMA 1ZD3A 1ZD4A 2LYAA 1ZQNA 3N97B 1X9MA 3HJEA 4CGZA 3OSPA 5KFVA 1KEJA 4ED8A 2BBJA 4K4IA 2NRXA 2ZH7A 2ID1A 4PGXA 4DL6A 4O5KA 5KT6A 1J2NA 4YN4A 1NZPA 2ZH3A 4UARA 1U49A 3KZIU 1K1QA 2K4PA 3PMNA 3PMLA 5CR0A 3PW2A 3K4GA 3UMGA 2ATLA 4QZAA 5HRLA 1L8OA 5IIJA 4DO9A 3OHBA 1PVPA 1EXNA 3BJYA 1Y88A 4MEYA 3UPQA 1N5XA 5ALGA 1N62A 5DQGA 5HRDA 2W11A 4TURA 4MF8A 3SAFA 4UD4A 3RF9A 2WF9A 3PW4A 1IV8A 3C1ZA 1BPZA 1GO3F 4F93B 1WWVA 4KTQA 5CFTA 4U6PA 7ICLA 2ZJ5A 4TUQA 1LB2B 5CP2A 3UPSA 1ZD2P 1MSWD 1PK3A 4PGQA 3RRGA 3PSIA 3BZCA 2CPRA 4DSLA 3F2CA 4J9NA 4Y2TA 3L4PA 3WK6A 1QSSA 1URJA 4J9QA 4ECSA 4DF8A 4GC6A 4KB6A 4YFKA 1ZXIA 3C5GA 4RQ3A 3C2LA 4QZHA 4RQ2A 4Q8EA 5B66U 5KFDA 4AT8B 3FDSA 5AHXA 4C80A 5KL8B 8ICFA 3TFSA 5ALVA 2BQRA 4EGWA 1UEVA 1KN5A 2BQ3A 4F4XA 5ALYA 3LWMA 3OUYB 2FLNA 4DFMA 5KFZA 5J0XA 3NYBA 1FFVA 1JUDA 1PK1A 3M8RA 4FHXA 4KLFA 1GPJA 4O6AA 1TE2A 2EWRA 3V6JA 4NL9C 2ZTCA 8ICTA 3SAHA 4OO1J 4LEVA 4MF2A 2GO7A 3PV8A 5J0WA 4IR1A 5KT3A 1YT3A 5AI4A 4O3NA 1MA7A 2MUTA 1PK1B 2OH2A 4EV6A 4M0AA 3NVZA 1XO1A 4CCHA 2XCPA 1BPYA 3C1YA 5J0YA 3RJGA 4K97A 1M6YA 5AK6A 5HRGA 4Y2VA 3CK6A 1IM4A 3ALRA 4C4RA 2XI9A 3KHGA 3KHLA 5AKLA 1XU4A 4OCZA 5DQIA 4UB2A 1B43A 1NNLA 1U45A 3G6VA 5J2GA 2QKQA 3BS7A 2ASJA 4WQLA 3V7JA 3A0HU 4R65A 5KFAA 2H3VA 4NM2A 2LHTA 2HHPA 5J0UA 4OJ5A 4DQIA 3M9OB 5GTHU 1V97A 4KLIA 1CEZA 3OVBA 3H8SA 1ZYQA 2HBMA 2W03A 4P4PA 1PX5A 5HNKA 4RQMA 2BPCA 2F77X 1X42A 7ICFA 5EWGA 2PXIA 3ORYA 5J2CA 9ICIA 2ZXHA 2AU0A 2V4RA 4I2FA 1Z4OA 4B9UA 2GOLA 4ELVA 4RUAA 4J9KA 3F2BA 4EEYA 5BPCA 3ETRA 4YMNA 2CXYA 3LK9A 3JPNA 8ICEA 1T3QA 8ICBA 4XJEA 4WC3A 1ZQYA 3K1RB 3H8MA 5AI9A 5J2HA 4E8FA 4I29A 4JWNA 5ALMA 2JEIA 2WTFA 3H0LB 3WKBA 4PHEA 4DF4A 3IG5A 1R8AA 3HKZF 3WFSC 5KAFU 4YMOA 4B9LA 3RR7A 5KG2A 5D4BA 5IIMA 4RT2A 2MSNA 3E0FA 4X4TA 5KFKA 4WBYA 3M9MB 1MQ3A 2RDJA 5DKWA 4JUZA 5J29A 3AU6A 4YD2A 3OTQA 5KFPA 8ICOA 3NRWA 9ICGA 3UXNA 3TADA 1ZQIA 5KNIA 4HAIA 9ICPA 3QU9A 4KLHA 1T8EA 4QW9A 1TVAA 4CF4A 2HN2A 1TK8A 3IG8A 2OM6A 1SXDA 8ICGA 3PO5A 4JLXA 2HHWA 4YP3A 3H37A 5G5HA 4QZ8A 1Q78A 1U9LA 2LPEA 1SZPA 1NJZA 4NXXA 1K1SA 1S8OA 9ICAA 5JTIA 4UATA 2KJ8A 3JPRA 4KITB 5IIIA 1LKYA 2HDOA 3PSTA 4XA5A 2ISPA 4I2GA 1UETA 2JGAA 4WC7A 2BHNA 2KE7A 4BX9C 2XY6A 2ASDA 2ZUDA 1F5AA 2DR5A 2KG5A 5KFXA 4DWIA 5HR7A 5HR9A 4G9BA 1R8CA 3CNHA 5AKIA 3Q8PB 1JXLA 3HIYA 1RYUA 4DL3A 2JEJA 2W8KA 4DSKA 3OVSA 5B3PA 2G09A 3F5EA 3QE9Y 3Q8KA 3K7DA 3IDWA 1ZQ1C 4QWAA 5KFEA 1MC8A 1NKCA 1N5WA 2O5AA 3QX7A 1KTQA 4YD1A 1RYSA 4M9LA 4O68A 2BZFA 2GLEA 4KLJA 3HP6A 9ICOA 4KLEA 1NK0A 4O9MA 3QZ7A 1JX4A 4LVSA 5DBCA 5HRIA 4RNOA 2OWOA 4IR9A 1JRPA 2F76X 2KMDA 3MGIA 3BQ2A 2KFNA 2ESEA 2M9NA 4NKUA 2J6TA 2YY6A 4K4GA 5L1JA 1Q46A 2Q0ZX 4RWPA 2C2RA 3RJFA 5J2FA 4PH5A 2DRAA 3Q8RB 3G6YA 2W3RA 4NM1A 1ED1A 2PMZF 3C5FA 2MA1A 4EEKA 4AT9A 4AT7A 2W9AA 4EENA 4M9HA 4ZH4A 1PZNA 2F1IA 4Y2YA 4QJFB 3IHQB 3NASA 2XO7A 2HMXA 3GIKA 5KFWA 3AU2A 2K4IA 4QW8A 3LDAA 4DQQA 5EWFA 1SB3C 1XSLA 2UVUA 3Q8LA 2KSOB 1S76D 7ICKA 4JK1A 1X9SA 3WK5A 2HVHA 4CF3A 2E8MA 2YMLA 2QARA 2WF5A 4BXOB 3F2DA 4K99A 4NLBA 1L8LA 5KFJA 3MR2A 1BPDA 2ZHAA 1N60A 2KEYA 2M2VA 1L3TA 1ZQOA 1LVHA 4QZGA 3N4MB 3AUOA 4USAA 3ZD9A 4O5CA 3EF2A 4PHAA 5J2DA 4K96A 4ED0A 4OAFA 3KKAC 4K9AA 5ALZA 5JTGA 4WC6A 8ICHA 5J0SA 2KHVA 5BOLA 1HUZA 3M7DA 2PMZC 4DL5A 4HYKA 5KFIA 2M0NA 5KFFA 4FS1A 2IMWP 2JEGA 4IRDA 2PKEA 3KBBA 2KV2A 4O3QA 4TQSA 1JALA 4NLNA 5DBBA 3AEVA 4RZRA 1CRXA 4BJQA 3ISDA 4C8NA 4ATBB 2VA8A 4TQRA 3TQ1A 3VCBA 2XIDA 1ZJMA 3TANA 2YMMA 4KX5A 3UMBA 4NXZA 4PGYA 5KFGA 5ALLA 2ZH6A 3UM9A 1ZQGA 2WF8A 3THVA 3EYZA 3AQMA 3T5LA 3SMVA 1N56A 4Y2QA 4B9SA 2ZIUA 4NXVA 9ICHA 4WH5A 1Q8KA 4F4ZA 3OHAA 1ZRNA 2E8NA 1V9PA 3AQLA 2ODGA 1JAJA 3OPXA 4I2HA 2JH7A 3WU2U 2ZH4A 5AI8A 2LI6A 1AQ6A 5HRHA 3NVVA 2QB1A 1ZOLA 7ICTA 3DDHA 4EELA 3GIIA 5AI0A 1ZQJA 5B5EU 3PSPA 2G06A 5KG0A 2OYYA 1Z4NA 5DGBA 1MQ2A 4E7XA 5H2FU 1FIQA 4K8VA 1L5UA 3HRDD 3OVAA 5BOMA 5DLGA 4CE6A 2KZ3A 3LYSA 4TUPA 2C22A 3H4BA 2PFOA 8ICWA 3T5HA 8ICAA 5D46A 1TFYA 2WFAA 3JPQA 5L1KA 4EBEA 3SENA 4FO6A 3GV7B 2JZBB 4QZBA 3TAQA 3S6JA 3H40A 5F9LA 1XO0A 4AT9B 4ZOHC 2W9CB 3SI8A 2WF7A 2NYVA 1DOQA 2BPGA 4X4OA 3DEEA 2A1JB 1B4FA 4ECVA 2BCQA 4KLQA 2P6UA 4NLKA 4LEWA 4I0UA 1N2XA 2AXTU 3MDCA 1KW4A 1BNPA 5HRBA 4RNNA 4I2DA 2W9CA 8ICKA 9ICEA 2ALZA 4RQ1A 2ZXIA 4F50A 4E0DA 1YZ7A 4QZCA 4OD0A 4N7RA 3ISCA 4XRHA 4UB3A 4BXOA 4DLEA 4X4SA 4RQ6A 7ICVA 1QCKA 5KG1A 2ZJ8A 3RBEA 2FCLA 3HILA 3WKCA 2C2EA 1KFTA 2YTUA 1VJ7A 4DOCA 3QZ8A 3UXPA 4IC9A 4B9VA 1HEKA 1CI4A 3I76A 4MFCA 4IRCA 4BGDA 1ZQZA 4MFFA 1TFRA 3NTUA 2HHSA 4DLGA 4O67A 2XCAA 2B21A 2YMQA 4KN7A 2B0CA 4Y2XA 2F8KA 4YXMA 4DQRA 2FLPA 4PPXA 5AM1A 4J9LA 2XVTA 1Q79A 3GV5B 4WC4A 3H39A 1S0OA 4ED2A 3PX0A 4UAUA 2V4QA 4IQWA 2DR8A 4X4VA 5ALNA 5AI6A 4NLCA 4F71A 8ICMA 4ACOA 2AHOB 3J81j 4F4YA 3WFOA 4Z6CA 1J2MA 3H0MB 1U48A 5ALWA 8ICPA 3FC4A 5KFCA 4R66A 2BCSA 5EE3A 1KLNA 2DUYA 3TAPA 3L9DA 4NJ8A 2LM1A 5ALJA 1K5OA 2EAOA 2HHQA 3T5JA 2FLLA 1RYRA 1KFDA 2F2AB 5C0YA 9ICKA 4F91B 5B3QA 5E79U 1KNYA 4F2SA 4GXIA 4B9TA 4O0IA 2NRWA 4J9MA 8ICUA 1KFSA 1KBUA 2JV3A 4M47A 2EAMA 5F3XB 7ICHA 3HWTA 5J0PA 3H7IA 1BGXT 1RG6A 5CWRA 4DSIA 1MIVA 2AQ0A 1TK5A 2C28A 5KFNA 3BZKA 4YCXA 1QLNA 3TARA 5ALDA 4EBCA 4Y2RA 4X4NA 2XGQA 9ICUA 1SWWA 1OU5A 2FJ6A 4EZ6A 4JLZA 2H3FA 2MRLA 2HHUA 2K8BB 1QSYA 3PX6A 2F1HA 2HBJA 4DQSA 5KFQA 4LZGA 3KTQA 4HX0A 2F44A 4UQGA 3EUB2 7ICUA 5AK5A 3WK9A 4PZOA 5J8YA 3RRHA 4FHWA 9ICVA 2K89A 5DG8A 2W9BA 2RLTA 4RQNA 2M2TA 5ALUA 4DQPA 3KHHA 1DGSA 2K4HA 3GU3A 3ZDAA 8ICRA 4M9GA 4ECZA 1PVRA 3KOOA 1QTMA 3M8SA 4LZDA 1UT8A 1VDVA 3RB3A 4NXWA 3BQTA 1BPBA 4NY8A 3BQ1A 3PO4A 9ICLA 2KZMA 2NRKA 4IL6U 1ZETA 5AM3A 2A3VA 1R8BA 5HMMA 1T3NA 3D2NA 4C4TA 2FMSA 3PHZA 3SEIA 5TZVA 3GQCA 2D3DA 4MFAA 5HHHA 1X6IA 2O6KA 3E2EA 4NL9A 4KLUA 5K4LA 1ECWA 2WAQC 1PUZA 3UQ2A 1Z00B 3CW2C 4WBZA 4DFKA 2JEFA 2LYBA 2ZUCA 2YB1A 2BKEA 2EZZA 4P0QB 3QYPA 4Y2SA 4JV2A 4KMOB 4QWDA 8ICYA 1LV5A 1QQ7A 4FS2A 2W9MA 2FPLA 2GH1A 2IOHA 4EEDA 1BVSA 3OSNA 5DLFA 4FZLA 4QZ9A 5KTQA 1L7PA 4UB4A 5HREA 4X5VA 4E80A 9ICCA 2VIXA 1S10A 2ZUBA 1S0VA 1L7OA 4YR2A 2KP7A 1SV4A 2IHOA 2KFZA 3H0RB 5L9XA 3WK8A 4YXJA 2M2WA 1KKXA 5J8YC 4Q45A 2R8GA 4OAGA 3RB6A 1D9FA 4DFPA 3MR5A 2UVRA 4I28A 4PJ0U 7ICQA 1NK4A 4FBUA 4WCWA 4EBKA 4LJXA 3QU2A 2DWQA 5ALXA 4EYHB 1NK9A 4O3PA 3HPOA 7ICMA 3K75D 5DB6A 2KHQA 4NXUA 3HW8A 4X0BA 3RAQA 4F3OA 2RRDA 2R8IA 3MFIA 5HHIA 2I5HA 4TUSA 1BPXA 8ICZA 5KG6A 3TI0A 1TKDA 3V7KA 4RNMA 9ICWA 1J97A 1TK0A 3SZ2A 1RPLA 4J9SA 4CF5A 5J2BA 4NLZA 1TAQA 2PFPA 8ICSA 2OHFA 2WB1F 5F2VO 4IQTA 2R8KA 8ICNA 2BQUA 1UEUA 4QIWF 5AKJA 4P0PA 4UASA 4OJPA 1UCVA 3HX0A 3C29A 1NKEA 4J9OA 5J0RA 4UB8U 4S3NA 1MIYA 7ICGA 7ICEA 4FO1A 2BR0A 5EE9A 2UVWA 4WC5A 3VC8A 5ALPA 4F5PA 4C8MA 4KLLA 2H3IA 4UW9A 2FDRA 2WF6A 1ZJNA 4O69A 5ALOA 4ECQA 5CHGA 2EDUA 5ALFA 5KFMA 1SIJA 1TAMA 2BE3A 3WKAA 2PI5A 1KL9A 5J2JA 3HJ1A 2DGZA 2M2UA 3MABA 3D2SA 4MEXA 5D62A 2ZIVB 3PR4A 3LWLA 4RWQA 2PFNA 1ZQQA 2BGWA 2VKQA 2XC9A 2Y1JA 1T7PA 3QU7A 2ZH8A 4WOYA 1VLBA 2BCUA 3L3FX 4KM5A 1S9FA 4DEZA 2HHTA 5JU5A 2WHEA 3PW0A 5KT5A 3V7LA 5AKHA 2A19A 3QU5A 5KG3A 1NZBA 4F4KA 4M9JA 5AKXA 5ALIA 1D8LA 2ASLA 3NVWA 4UAVA 3WKEA 2W55A 1ZQUA 3AM9A 1JMSA 1ZQPA 4P2HA 4B9MA 2BDPA 4G3IA 3SAGA 4QZFA 2LMRA 3KHRA 2OXOA 5G5GA 3M9NB 3OUYA 2L5YA 1L6NA 3H8JA 4JMUA 4DSEA 2DF4B 2Y1IA 2EANA 1QH9A 1V38A 3JPTA 2B4VA 2HOQA 3L5KA 2ZH2A 2EAPA 4GIBA 4FZNA 4U7CA 3EZ5A 3QNMA 5KL1B 8ICLA 5CB1A 4FHPA 4AT8A 3A0BU 3M6ZA 2G07A 5KFHA 1UPHA 4J03A 2VJ4A 4MHVA 3C2MA 3N7SC 4XQ7A 2EZXA 3MDAA 1L7NA 1ZQTA 2W7PA 2ZH1A 1Z3EB 2Q66A 3RH6A 1C20A 2E5SA 4P4MA 2YX8A 4CRXA 4YVZA 1FEZA 1B22A 5D49A 4A8EA 1COKA 4I2AA 1ZQCA 3NS1A 3WK4A 4NKTA 2HW3A 3NWIA 2DFLA 3BS5A 4KX3A 4ECYA 1JIHA 2MUTB 1VFGA 3ER8C 1S77D 1SL0A 3OGUA 2Y9UA 2FMQA 3GV8B 5AICA 5CEHA 2J6UA 3MFHA 5FP0A 2XY7A 1HIWA 5J2IA 3TADC 2ZTEA 1ZQAA 4I2JA 4JV0A 3MBYA 4O3OA 3MCRA 2K4EA 5KFOA 2HHXA 4NWIA 3TKAA 4ICAA 4M5DA 8ICQA 2H3ZA 4AT7B 4JWMA 1ZQFA 2HOFA 2RQ5A 3C66A 3QUTA 1RZTA 5AIAA 2LM4A 4F5RA 5DB7A 2HOIA 4KLDA 3RJHA 2I1QA 3CRXA 2EZYA 5IILA 1IXRA 1QQ6A 4BWMA 5DB8A 3EWAA 2P6RA 3M1YA 2IHNA 7ICRA 4OJ6A 4ECXA 5L1LA 3QEBZ 3F53A 4YG2A 5DDYA 3KKAA 3KD3A 7ICIA 4LT6A 4ED6A 1N48A 4DL2A 5TISU 3UQ0A 1F5SA 2QARB 3E58A 4Y2JA 5AKEA 5EWEA 3QXGA 5GTIU 8ICJA 2OCEA 4PZNA 2IUBA 1ZRMA 8ICIA 5CFUA 2Q4TA 2K60A 2ZIVA 3K1ZA 3MGHA 3NKUA 5JUMA 1U4BA 4I27A 3LVWA 2H3QA 3ZI4A 1KDHA 3I1YA 3U26A 1JN3A 2DL0A 3UMCA 5ALQA 9ICRA 2UVVA 1OXJA 3D2QA 1NJXA 9ICXA 5IIKA 4FE3A 4FBTA 4OAHA 1DGJA 2AJQA 2KZZA 3RB4A 4Q8FA 3SQIA 3RAXA 2DR7A 1H38A 4FHVA 3V72A 8ICXA 4ATBA 3NRZA 1RQLA 1IG6A 2AGQA 1VJ5A 4PHPA 5D63A 2WAQF 4C7ZA 4OJOA 4P4OA 2HBLA 4RPZA 5ALKA 3ETLA 3M6KA 4J9PA 1ZQLA 1N63A 2W8LA 3ICXA 1UT5A 2G5HB 2KKPA 4I2IA 1KRPA 4QZIA 4DSJA 1NK6A 4Z6DA 2G0AA 4ELUA 2DRBA 2W7OA 4RQ7A 3AQEA 4RQ5A 3N7PD 3QU4A 2NRZA 4RU9A 1S0MA 4EBJA 5J2EA 2DVIA 2BDUA 1TAUA 2A1AA 1F0MA 3KFUF 3ED5A 4GFJA 4BWJA 2VANA 2G5IB 2IA6A 3PZPA 1N61A 4UB1A 2LKYA 2GAFD 1L3SA 5A0LA 2ZIXA 1XC9A 3JPSA 2YB4A 9ICFA 3EW9A 5J0QA 2VA2A 4Z6FA 3BS5B 2PFQA 5HR6A 4C7YA 1DRGA 1SGGA 3RBDA 5AKGA 4QWBA 2IOFK 2FI1A 3QUCA 1COOA 4BUGA 2W04A 2P35A 5J0OA 5AI5A 4YMMA 2IOFA 4PL2A 2IHMA 1DK3A 1XNSA 2WB1C 2ZIXB 4PHDA 2PI4A 4RPXA 3R9KA 4YR0A 2Y0SC 2KTQA 2RFFA 2KKVA 2HVIA 5KFYA 4JB3A 3JZ0A 2NRVA 3C21A 7ICSA 5KFTA 1Z1VA 1WUDA 2A1JA 2KSOA 3PVXA 4I2CA 1A76A 4Z6EA 3ZD8A 3NGDA 4UD5A 1UQVA 3OJSA 4DL7A 2BCRA 3SV3A 5KFSA 3QUQA 5KG5A 1A0PA 5DQHA 5ALRA 4LEYA 2O1PA 4EP7A 1X6JA 1O03A 1U47A 4FZMA 4Y2UA 2D8CA 2Y9TA 4AYBC 4RQ4A 3PR5B 1UHUA 2I9GA 2HBKA 3TFRA 3JCFA 4UAZA 4DS4A 2LYHA 3NVOA 9ICBA 5KFRA 1RXVA 1QSLA 3B0YA 5L1MA 3WFPA 4NLGA 3HJ4A 4DFDA 5ALEA 3AQKA 4F5OA 2KK0A 2ZG6A 4M6WB 5HC9A 2HCFA 3AMZA 4RQ8A 2ZH5A 5AM4A 1ZQSA 5DB9A 4UBCA 4OJLA 3IP4B 5HRKA 2ES6A 4K9BA 9ICSA 4M6WA 4R8UB 3PW5A 4O3RA 9ICNA 3ISBA 4F4WA 3ZDCA 3I28A 3GIJA 1NK7A 3FAHA 3V6KA 1TV9A 1ZQDA 4M04A 1SL2A 2KN7A 5DG7A 3JPOA 1SKWA 8ICVA 1JXEA 2G08A 2W43A 4QNLA 4R8UA 4FH5A 4UBBA 3Q8MA 3IM1A 5EE1A 4UB5A 1MIWA 4NXTA 2AGOA 1LKYB 4X4UA 3SR6A 4F72A 2KJ5A 4AYBF 1D8YA 1KQQA 5HMLA 2N1RA 3D6JA 3C23A 3ER9B 3G6XA 5CJ7A 3GZFA 4PL1A 1P7DA 3DV9A 4ECWA 5IIOA 1ZQXA 3QUBA 3V6HA 3RFAA 4XUSA 3BQ7A 4LEZA 2ZJAA 3LVVA 3RH5A 1ZQWA 3HKZC 4US8A 4O3SA 1A6SA 1SV0C 3JPPA 4WJ3B 5KFBA 3ZDBA 1XWLA 3HT3A 3N28A 3WK7A 3RR8A 2DKZA 5ALTA 2ZIUB 4EX6A 1ZQVA 1V4AA 2W54A 5CFSA 1L3UA 1ZQHA 1NI3A 1XSNA 2E1FA 4DSFA 4B9NA 2B56A 1MN8A 2EQYA 1KSPA 4C8KA 1WCNA 2CRXA 1SWVA 3PNCA 1CUKA 3B9JA 5AK4A 3EPIA 5KG7A 3BQ0A 4QIWC 5C5JA 4UAYA 1TFWA 4IS7A 2HI0A 3RJJA 4F5QA 1BNOA 4DCCA 3T5KA 4ED7A 1SKSA 4KMUA 4QWEA 2E1EA 1OW5A 3AN1A 1WCLA 1RQNA 1IIPA 3JYYA 5ALSA 2CN1A 3OJUA 1B0XA 1NJWA 4DS5A 2E8PA 4EEBA 2KJ9A
chains in the Genus database with same CATH topology
3JPTA 1DOQA 2BPGA 1UEVA 3H3AA 2BQ3A 2A1JB 5F9NA 4F4XA 2ZH2A 4X4PA 3MR3A 3LWMA 3EZ5A 4ECVA 2BCQA 4KLQA 2P6UA 4NLKA 8ICLA 5CB1A 2FLNA 4KLOA 4DFMA 4FHPA 4AT8A 3OUYB 5KFZA 4M9NA 3MDCA 4IQVA 5J0XA 3NYBA 3ZDEA 1BNPA 5HRBA 4EZ9A 5KFHA 3M8RA 2J6SA 4KLFA 4FHXA 3C2MA 4RNNA 3OVBA 4XQ7A 4I2DA 3V6JA 2W9CA 3MDAA 8ICKA 4DL4A 2ZTCA 4X4RA 9ICEA 2ALZA 4RT3A 8ICTA 3RTVA 4RQ1A 4F50A 3PY8A 1ZQTA 4MF2A 4JV1A 1Z3EB 9ICTA 2ZH1A 2Q66A 3PV8A 5J0WA 3RH6A 4IR1A 3RB0A 5KT3A 4O3NA 4P4MA 4E0DA 2MUTA 4YVZA 4QZCA 5DBAA 4M0AA 5D49A 1B22A 4DOBA 2V9WA 4I2AA 2H5XA 1XO1A 4XRHA 3ISCA 1ZQCA 4UB3A 2XCPA 4CCHA 1BPYA 1UA1A 4BXOA 4DLEA 4X4QA 4ECUA 3C1YA 2BPFA 5J0YA 3RJGA 3EPGA 4X4SA 4RQ6A 4NKTA 3H8WA 4ECTA 2HW3A 7ICVA 5KG1A 5HRGA 4QWCA 3RJKA 2DFLA 2ZJ8A 4ECYA 1JIHA 1IM4A 2MUTB 1VFGA 4GC7A 3KHGA 1X2IA 3KHLA 3RBEA 1SL0A 1S77D 3OGUA 2C2DA 1XU4A 2C2EA 1KFTA 5DQIA 1VJ7A 4UB2A 1B43A 2FMQA 3GV8B 4DOCA 1U45A 3ZDDA 3QZ8A 3UXPA 2IBKA 3Q8QB 2J6UA 1SL1A 3MFHA 2XY7A 4O5EA 2MAXA 4B9VA 2ZH9A 3G6VA 5J2IA 4MFCA 5J2GA 4IRCA 4YR3A 4BGDA 3C2KA 4DOAA 3WFRE 1ZQZA 2ZTEA 2AGPA 1ZQKA 2ASJA 1ZQAA 1TFRA 4MFFA 3V7JA 3NTUA 4R65A 4I2JA 2HHSA 4YQWA 5KFAA 4DLGA 4JV0A 3MBYA 4O3OA 3PX4A 4NM2A 2XCAA 2B21A 4KN7A 2BCVA 5KFOA 2HHXA 4M5DA 2HHPA 1C7YA 5J0UA 4KLTA 8ICQA 4AT7B 4DQIA 3M9OB 4RWNA 4YXMA 4JWMA 7ICPA 1CEZA 4KLIA 4DQRA 1ZQFA 2FPMA 5L1IA 3H8SA 1ZYQA 5KFUA 2FLPA 4PPXA 3C66A 4WC0A 5DEDA 4P4PA 1PX5A 1RZTA 5HNKA 4F5RA 5DB7A 2BPCA 3RJHA 4KLDA 7ICFA 2I1QA 5EWGA 1JQRA 3GILA 2PXIA 4J9LA 5IILA 4X0BA 1IXRA 4BWMA 5DB8A 1Q79A 3EWAA 3GV5B 2P6RA 3H39A 1S0OA 4WC4A 3ORYA 5J2CA 4ED2A 1ZQBA 4GXKA 3PX0A 2IHNA 7ICJA 9ICIA 7ICRA 4F92B 2AU0A 4ECXA 2V4QA 2DPIA 5L1LA 4IQWA 2V4RA 1D9DA 2DR8A 3QEBZ 4I2FA 4X4VA 2NRTA 4B9UA 8ICMA 4ELVA 4YG2A 5DDYA 4RUAA 5KG4A 4J9KA 3GFKB 4EEYA 5BPCA 4Q44A 7ICIA 4YMNA 4WC2A 3LK9A 3JPNA 5DDMA 8ICEA 4ED6A 4LT6A 8ICBA 4BDPA 1N48A 5HRFA 1ZQYA 4WC3A 4Q43A 4F4YA 4DL2A 5J2HA 2XGPA 3WFOA 4Z6CA 4I29A 4E8FA 3UQ0A 4JWNA 2JEIA 2WTFA 5DGAA 1A77A 4PHEA 4DF4A 1U48A 5KFCA 8ICPA 4R66A 1R8AA 5EWEA 3QEAZ 2BCSA 3WFSC 1NJYA 4F2RA 1KLNA 3TAPA 3L9DA 8ICJA 4YMOA 4B9LA 3RR7A 4M2YA 5KG2A 8ICIA 2HHQA 3T5JA 5D4BA 4RT2A 1KFDA 5IIMA 1RYRA 2FLLA 5J2AA 3MGHA 9ICKA 4F91B 4X4TA 5JUMA 4XQ8A 5KFKA 4WBYA 4X0AA 3M9MB 1MQ3A 2ISOA 2RDJA 1U4BA 4I27A 2R8HA 2DPJA 5DKWA 4IQUA 4JUZA 5J29A 3LQCB 3AU6A 1KNYA 4F8RA 4YD2A 1KDHA 5KFPA 4F2SA 8ICOA 9ICGA 4R63A 3UXNA 4GXIA 4X4OA 4B9TA 1ZQIA 1JN3A 3UXOA 1XSPA 3SV4A 9ICPA 4WC1A 4O0IA 4IG8A 2NRWA 9ICRA 4J9MA 9ICJA 8ICUA 1KFSA 2UVVA 5KT4A 4KLHA 1NK8A 4M47A 3H4DA 1XS9D 1NJXA 7ICHA 9ICXA 4FHYA 1AROP 5IIKA 7ICNA 1T8EA 4QW9A 3HWTA 1TVAA 2ZTDA 5EOZA 3H7IA 5J0PA 1TK8A 4FBTA 1BGXT 5CWRA 8ICGA 3PO5A 2AJQA 4DSIA 1MIVA 2AQ0A 2HHWA 4YP3A 2KZZA 3RJIA 3RB4A 4QZ8A 1TK5A 3H37A 2C28A 4Q8FA 5KFNA 4RPYA 4YCXA 4GLXA 4KLMA 1Q78A 2P66A 1U9LA 1QLNA 1SZPA 3TARA 1NJZA 3RAXA 4EBCA 1K1SA 2R8JA 9ICAA 2DR7A 1H38A 4FHVA 4X4NA 2XGQA 3JPRA 3V72A 9ICUA 4KITB 8ICXA 4ATBA 1OU5A 4EZ6A 2JZBA 5IIIA 2AGQA 1UA0A 2HHUA 1QSYA 2ISPA 4XA5A 3PX6A 4I2GA 1UETA 2F1HA 4PHPA 2W9BB 3GDXA 4DQSA 4WC7A 2BHNA 5KFQA 2ASDA 2XY6A 2ZUDA 4P4OA 4LZGA 3KTQA 1F5AA 2DR5A 4UQGA 4RPZA 5KFXA 4J9PA 3ETLA 4DWIA 1ZQLA 4ED1A 7ICUA 2W8LA 4RUCA 1UT5A 4I2IA 5HR9A 1KRPA 4QZIA 3RRHA 1R8CA 1S0NA 3Q8PB 1JXLA 3HIYA 4FHWA 4DL3A 9ICVA 4DSJA 5DG8A 2W9BA 2W8KA 1NK6A 4Z6DA 5HP4A 2JEJA 1ZQRA 4DSKA 3OVSA 1NOMA 2FMPA 4ELUA 3QE9Y 2M2TA 3Q8KA 2DRBA 4DQPA 9ICQA 4RQ7A 3FYHA 3KHHA 1DGSA 4RQ5A 1S0MA 4QWAA 2NRZA 4RU9A 3ZDAA 8ICRA 5KFEA 5J2EA 4M9GA 4EBJA 4ECZA 1MC8A 2DVIA 1NKCA 1TAUA 2O5AA 3B0XA 4ED3A 4IR9A 1NKBA 5J2KA 1KTQA 1QTMA 4YD1A 4LZDA 3M8SA 1RYSA 4M9LA 1UT8A 1NK5A 3RB3A 4KLGA 4BWJA 2VANA 3BQTA 1BPBA 1X9WA 4NY8A 3BQ1A 1WOTA 4KLJA 2IA6A 3HP6A 3PO4A 4UB1A 9ICOA 9ICLA 4KLEA 1NK0A 4O9MA 2KZMA 2NRKA 1ZETA 1L3SA 3QZ7A 1JX4A 4LVSA 1R8BA 5DBCA 1XC9A 5HRIA 5HMMA 4RQ0A 4RNOA 3JPSA 2OWOA 3EW9A 5J0QA 1T3NA 4Z6FA 2PFQA 2VA2A 9ICFA 3MGIA 3BQ2A 1Z00A 2FMSA 2KFNA 3RBDA 4EYIB 4QWBA 2M9NA 5TZVA 4C8OA 3GQCA 4NKUA 2J6TA 5IINA 4EBDA 1COOA 4GXJA 4K4GA 4MFAA 5L1JA 4YMMA 2FPKA 2Q0ZX 5HHHA 5J0OA 4RWPA 2C2RA 2IHMA 3RJFA 3E2EA 4IRKA 5J2FA 4KLUA 4PH5A 1DK3A 4PHDA 2VA3A 2PI4A 4RPXA 2DRAA 3Q8RB 1Z00B 4YR0A 3G6YA 3UQ2A 1L3VA 4NM1A 2KTQA 4WBZA 3OV7A 4DFKA 4K4HA 2JEFA 2RFFA 2ZUCA 2HVIA 3C5FA 2BKEA 5KFYA 4KN4A 1HUOA 3JZ0A 4C8LA 4JV2A 2NRVA 4QWDA 3C21A 1R89A 8ICYA 4AT9A 3AQNA 4AT7A 1LV5A 2W9AA 4UAWA 7ICSA 4FS2A 3Q8SB 5KFTA 2W9MA 4M9HA 4ZH4A 2A1JA 2FPLA 3PVXA 4I2CA 1PZNA 1BVSA 1A76A 2F1IA 4Z6EA 3ZD8A 3IHQB 3NGDA 3OSNA 5DLFA 4UD5A 4QZ9A 5KTQA 2XO7A 3GIKA 3OJSA 4DL7A 4UB4A 5KFWA 5HREA 2BCRA 4DFJA 4KLSA 3SV3A 3AU2A 5KFSA 4X5VA 5KG5A 3RJEA 4E80A 4QW8A 9ICCA 1S10A 5DQHA 1RXWA 2ZUBA 1S0VA 3LDAA 4DQQA 2O1PA 5EWFA 4EP7A 1U47A 4YR2A 5KFLA 1XSLA 2UVUA 3Q8LA 2KP7A 2GWSA 4R64A 5L9XA 1ZQMA 4YXJA 1S76D 2KFZA 7ICKA 4JK1A 2M2WA 1FA0A 4Q45A 1X9SA 2HVHA 2R8GA 1BPEA 5CA7A 3RB6A 1D9FA 4RQ4A 4DFPA 3PR5B 3MR5A 2UVRA 4RWOA 4I28A 7ICQA 1NO5A 1NK4A 4FBUA 4WCWA 2I9GA 4EBKA 4QZEA 4FH3A 3TFRA 4BXOB 4UAZA 4DS4A 2LYHA 4EYHB 1NK9A 1YLQA 4O3PA 3HPOA 2DR9A 8ICCA 7ICMA 9ICBA 5KFJA 3K75D 1BPDA 5KFRA 3MR2A 4F5NA 4ECRA 1RXVA 1QSLA 2ZHAA 3B0YA 5DB6A 5KT7A 5KT2A 3WFQE 3HW8A 5DG9A 3WFPA 4NLGA 1DK2A 2F1JA 4I2EA 1S97A 2M2VA 3RAQA 1L3TA 1ZQOA 4F3OA 3HJ4A 2RDIA 3AQKA 4QZGA 3N4MB 4F5OA 2R8IA 3MFIA 4M6WB 3AUOA 3ZD9A 1ZQEA 5HHIA 4O5CA 5HC9A 4PHAA 5J2DA 4TUSA 1BPXA 4ED0A 8ICZA 3SYZA 5DECA 4RQ8A 8ICHA 5KG6A 5J0SA 3TI0A 4WC6A 5BOLA 2ZH5A 2ZHBA 1TKDA 1ZQSA 1HUZA 5DB9A 4UBCA 5J0TA 2HHVA 3V7KA 4DL5A 4ELTA 5HRKA 3T3FA 4RNMA 8ICSA 9ICWA 3MR6A 2PBEA 9ICSA 4QZDA 4HYKA 4M6WA 4R8UB 3SZ2A 2AQ4A 1RPLA 4J9SA 1TK0A 1SKRA 5KFIA 2XY5A 3PW5A 5J2BA 4O3RA 4NLZA 1TAQA 2PFPA 5KFFA 3PW7A 3ISBA 4F4WA 4FS1A 2IMWP 2JEGA 3ZDCA 3GIJA 4IRDA 5F2VO 1NK7A 4IQTA 2R8KA 3RH4A 8ICNA 2BQUA 3V6KA 1UEUA 1TV9A 1ZQDA 3C18A 1HJPA 4O3QA 4M04A 1SL2A 2KN7A 5DG7A 3JPOA 1SKWA 3HX0A 4TQSA 8ICVA 1NKEA 4J9OA 9ICNA 1JXEA 4NLNA 5DBBA 5J0RA 4J9RA 7ICOA 3H38A 4R8UA 3BDPA 4RZRA 4I2BA 3GIMA 1T4GA 9ICMA 4FH5A 4S3NA 4UBBA 3Q8MA 1ZQNA 3ISDA 1MIYA 4C8NA 3IM1A 3N97B 4ATBB 2VA8A 4TQRA 3TQ1A 7ICGA 1X9MA 7ICEA 4UB5A 1MIWA 1ZJMA 2AGOA 3TANA 4X4UA 2BR0A 3OSPA 2UVWA 5KFVA 4WC5A 1D8YA 1KEJA 4NXZA 5HMLA 4F5PA 4PGYA 4ED8A 4C8MA 4KLLA 3C23A 4K4IA 5KFGA 2NRXA 2ZH6A 3G6XA 2ZH7A 1ZQGA 2ID1A 4PGXA 4DL6A 4O5KA 5CJ7A 5KT6A 3THVA 3EYZA 3AQMA 4YN4A 3T5LA 1ZJNA 4ECWA 4ECQA 5CHGA 5IIOA 1ZQXA 3V6HA 5KFMA 1N56A 1NZPA 2ZH3A 4B9SA 2BE3A 4XUSA 2PI5A 9ICHA 1U49A 2ZJAA 1K1QA 5J2JA 1ZQWA 3OHAA 4F4ZA 3RH5A 4O3SA 1V9PA 3PMNA 2M2UA 3AQLA 3HJ1A 3PMLA 3JPPA 3MABA 5CR0A 3PW2A 4MEXA 1JAJA 3K4GA 4I2HA 2ATLA 4QZAA 3PR4A 2ZH4A 5KFBA 3LWLA 3ZDBA 5HRLA 1XWLA 5IIJA 3HT3A 4DO9A 4RWQA 2PFNA 3OHBA 3RR8A 1EXNA 3BJYA 1Y88A 4MEYA 3UPQA 1ZQQA 2BGWA 5HRHA 5DQGA 5HRDA 2XC9A 4TURA 4MF8A 2Y1JA 7ICTA 1ZQVA 3GIIA 1T7PA 1V4AA 1L3UA 1ZQHA 1ZQJA 4UD4A 2ZH8A 3PW4A 2BCUA 1XSNA 3C1ZA 4DSFA 1BPZA 4B9NA 1KSPA 5KG0A 4F93B 1S9FA 4C8KA 4DEZA 1WCNA 4KTQA 2HHTA 5DGBA 3PW0A 7ICLA 3PNCA 1CUKA 2ZJ5A 5KT5A 4TUQA 3V7LA 1MQ2A 1LB2B 5KG3A 4E7XA 5CP2A 4F4KA 4M9JA 3EPIA 3UPSA 1L5UA 1MSWD 5KG7A 3BQ0A 3OVAA 5BOMA 1D8LA 5C5JA 4PGQA 4UAYA 2ASLA 3RRGA 5DLGA 1TFWA 2KZ3A 4DSLA 3RJJA 4J9NA 4TUPA 4F5QA 2C22A 1QSSA 1BNOA 3T5KA 3H4BA 2PFOA 4J9QA 4ED7A 1ZQUA 8ICWA 4ECSA 3T5HA 1SKSA 1JMSA 4KMUA 4QWEA 1ZQPA 8ICAA 4DF8A 5D46A 4GC6A 4P2HA 4B9MA 1TFYA 4YFKA 2BDPA 1WCLA 4RQ3A 4QZHA 3JPQA 3C5GA 4QZFA 3C2LA 4RQ2A 4G3IA 4Q8EA 3KHRA 5L1KA 3M9NB 3JYYA 5KFDA 4EBEA 4FO6A 3OUYA 3GV7B 2JZBB 4AT8B 3FDSA 4QZBA 3OJUA 3TAQA 3H40A 3H8JA 4DSEA 8ICFA 1NJWA 3TFSA 4DS5A 5F9LA 4AT9B 2BQRA 2Y1IA 2W9CB 3SI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JPT A;  1DOQ A;  2BPG A;  1UEV A;  3H3A A;  2BQ3 A;  2A1J B;  5F9N A;  4F4X A;  2ZH2 A;  4X4P A;  3MR3 A;  3LWM A;  3EZ5 A;  4ECV A;  2BCQ A;  4KLQ A;  2P6U A;  4NLK A;  8ICL A;  5CB1 A;  2FLN A;  4KLO A;  4DFM A;  4FHP A;  4AT8 A;  3OUY B;  5KFZ A;  4M9N A;  3MDC A;  4IQV A;  5J0X A;  3NYB A;  3ZDE A;  1BNP A;  5HRB A;  4EZ9 A;  5KFH A;  3M8R A;  2J6S A;  4KLF A;  4FHX A;  3C2M A;  4RNN A;  3OVB A;  4XQ7 A;  4I2D A;  3V6J A;  2W9C A;  3MDA A;  8ICK A;  4DL4 A;  2ZTC A;  4X4R A;  9ICE A;  2ALZ A;  4RT3 A;  8ICT A;  3RTV A;  4RQ1 A;  4F50 A;  3PY8 A;  1ZQT A;  4MF2 A;  4JV1 A;  1Z3E B;  9ICT A;  2ZH1 A;  2Q66 A;  3PV8 A;  5J0W A;  3RH6 A;  4IR1 A;  3RB0 A;  5KT3 A;  4O3N A;  4P4M A;  4E0D A;  2MUT A;  4YVZ A;  4QZC A;  5DBA A;  4M0A A;  5D49 A;  1B22 A;  4DOB A;  2V9W A;  4I2A A;  2H5X A;  1XO1 A;  4XRH A;  3ISC A;  1ZQC A;  4UB3 A;  2XCP A;  4CCH A;  1BPY A;  1UA1 A;  4BXO A;  4DLE A;  4X4Q A;  4ECU A;  3C1Y A;  2BPF A;  5J0Y A;  3RJG A;  3EPG A;  4X4S A;  4RQ6 A;  4NKT A;  3H8W A;  4ECT A;  2HW3 A;  7ICV A;  5KG1 A;  5HRG A;  4QWC A;  3RJK A;  2DFL A;  2ZJ8 A;  4ECY A;  1JIH A;  1IM4 A;  2MUT B;  1VFG A;  4GC7 A;  3KHG A;  1X2I A;  3KHL A;  3RBE A;  1SL0 A;  1S77 D;  3OGU A;  2C2D A;  1XU4 A;  2C2E A;  1KFT A;  5DQI A;  1VJ7 A;  4UB2 A;  1B43 A;  2FMQ A;  3GV8 B;  4DOC A;  1U45 A;  3ZDD A;  3QZ8 A;  3UXP A;  2IBK A;  3Q8Q B;  2J6U A;  1SL1 A;  3MFH A;  2XY7 A;  4O5E A;  2MAX A;  4B9V A;  2ZH9 A;  3G6V A;  5J2I A;  4MFC A;  5J2G A;  4IRC A;  4YR3 A;  4BGD A;  3C2K A;  4DOA A;  3WFR E;  1ZQZ A;  2ZTE A;  2AGP A;  1ZQK A;  2ASJ A;  1ZQA A;  1TFR A;  4MFF A;  3V7J A;  3NTU A;  4R65 A;  4I2J A;  2HHS A;  4YQW A;  5KFA A;  4DLG A;  4JV0 A;  3MBY A;  4O3O A;  3PX4 A;  4NM2 A;  2XCA A;  2B21 A;  4KN7 A;  2BCV A;  5KFO A;  2HHX A;  4M5D A;  2HHP A;  1C7Y A;  5J0U A;  4KLT A;  8ICQ A;  4AT7 B;  4DQI A;  3M9O B;  4RWN A;  4YXM A;  4JWM A;  7ICP A;  1CEZ A;  4KLI A;  4DQR A;  1ZQF A;  2FPM A;  5L1I A;  3H8S A;  1ZYQ A;  5KFU A;  2FLP A;  4PPX A;  3C66 A;  4WC0 A;  5DED A;  4P4P A;  1PX5 A;  1RZT A;  5HNK A;  4F5R A;  5DB7 A;  2BPC A;  3RJH A;  4KLD A;  7ICF A;  2I1Q A;  5EWG A;  1JQR A;  3GIL A;  2PXI A;  4J9L A;  5IIL A;  4X0B A;  1IXR A;  4BWM A;  5DB8 A;  1Q79 A;  3EWA A;  3GV5 B;  2P6R A;  3H39 A;  1S0O A;  4WC4 A;  3ORY A;  5J2C A;  4ED2 A;  1ZQB A;  4GXK A;  3PX0 A;  2IHN A;  7ICJ A;  9ICI A;  7ICR A;  4F92 B;  2AU0 A;  4ECX A;  2V4Q A;  2DPI A;  5L1L A;  4IQW A;  2V4R A;  1D9D A;  2DR8 A;  3QEB Z;  4I2F A;  4X4V A;  2NRT A;  4B9U A;  8ICM A;  4ELV A;  4YG2 A;  5DDY A;  4RUA A;  5KG4 A;  4J9K A;  3GFK B;  4EEY A;  5BPC A;  4Q44 A;  7ICI A;  4YMN A;  4WC2 A;  3LK9 A;  3JPN A;  5DDM A;  8ICE A;  4ED6 A;  4LT6 A;  8ICB A;  4BDP A;  1N48 A;  5HRF A;  1ZQY A;  4WC3 A;  4Q43 A;  4F4Y A;  4DL2 A;  5J2H A;  2XGP A;  3WFO A;  4Z6C A;  4I29 A;  4E8F A;  3UQ0 A;  4JWN A;  2JEI A;  2WTF A;  5DGA A;  1A77 A;  4PHE A;  4DF4 A;  1U48 A;  5KFC A;  8ICP A;  4R66 A;  1R8A A;  5EWE A;  3QEA Z;  2BCS A;  3WFS C;  1NJY A;  4F2R A;  1KLN A;  3TAP A;  3L9D A;  8ICJ A;  4YMO A;  4B9L A;  3RR7 A;  4M2Y A;  5KG2 A;  8ICI A;  2HHQ A;  3T5J A;  5D4B A;  4RT2 A;  1KFD A;  5IIM A;  1RYR A;  2FLL A;  5J2A A;  3MGH A;  9ICK A;  4F91 B;  4X4T A;  5JUM A;  4XQ8 A;  5KFK A;  4WBY A;  4X0A A;  3M9M B;  1MQ3 A;  2ISO A;  2RDJ A;  1U4B A;  4I27 A;  2R8H A;  2DPJ A;  5DKW A;  4IQU A;  4JUZ A;  5J29 A;  3LQC B;  3AU6 A;  1KNY A;  4F8R A;  4YD2 A;  1KDH A;  5KFP A;  4F2S A;  8ICO A;  9ICG A;  4R63 A;  3UXN A;  4GXI A;  4X4O A;  4B9T A;  1ZQI A;  1JN3 A;  3UXO A;  1XSP A;  3SV4 A;  9ICP A;  4WC1 A;  4O0I A;  4IG8 A;  2NRW A;  9ICR A;  4J9M A;  9ICJ A;  8ICU A;  1KFS A;  2UVV A;  5KT4 A;  4KLH A;  1NK8 A;  4M47 A;  3H4D A;  1XS9 D;  1NJX A;  7ICH A;  9ICX A;  4FHY A;  1ARO P;  5IIK A;  7ICN A;  1T8E A;  4QW9 A;  3HWT A;  1TVA A;  2ZTD A;  5EOZ A;  3H7I A;  5J0P A;  1TK8 A;  4FBT A;  1BGX T;  5CWR A;  8ICG A;  3PO5 A;  2AJQ A;  4DSI A;  1MIV A;  2AQ0 A;  2HHW A;  4YP3 A;  2KZZ A;  3RJI A;  3RB4 A;  4QZ8 A;  1TK5 A;  3H37 A;  2C28 A;  4Q8F A;  5KFN A;  4RPY A;  4YCX A;  4GLX A;  4KLM A;  1Q78 A;  2P66 A;  1U9L A;  1QLN A;  1SZP A;  3TAR A;  1NJZ A;  3RAX A;  4EBC A;  1K1S A;  2R8J A;  9ICA A;  2DR7 A;  1H38 A;  4FHV A;  4X4N A;  2XGQ A;  3JPR A;  3V72 A;  9ICU A;  4KIT B;  8ICX A;  4ATB A;  1OU5 A;  4EZ6 A;  2JZB A;  5III A;  2AGQ A;  1UA0 A;  2HHU A;  1QSY A;  2ISP A;  4XA5 A;  3PX6 A;  4I2G A;  1UET A;  2F1H A;  4PHP A;  2W9B B;  3GDX A;  4DQS A;  4WC7 A;  2BHN A;  5KFQ A;  2ASD A;  2XY6 A;  2ZUD A;  4P4O A;  4LZG A;  3KTQ A;  1F5A A;  2DR5 A;  4UQG A;  4RPZ A;  5KFX A;  4J9P A;  3ETL A;  4DWI A;  1ZQL A;  4ED1 A;  7ICU A;  2W8L A;  4RUC A;  1UT5 A;  4I2I A;  5HR9 A;  1KRP A;  4QZI A;  3RRH A;  1R8C A;  1S0N A;  3Q8P B;  1JXL A;  3HIY A;  4FHW A;  4DL3 A;  9ICV A;  4DSJ A;  5DG8 A;  2W9B A;  2W8K A;  1NK6 A;  4Z6D A;  5HP4 A;  2JEJ A;  1ZQR A;  4DSK A;  3OVS A;  1NOM A;  2FMP A;  4ELU A;  3QE9 Y;  2M2T A;  3Q8K A;  2DRB A;  4DQP A;  9ICQ A;  4RQ7 A;  3FYH A;  3KHH A;  1DGS A;  4RQ5 A;  1S0M A;  4QWA A;  2NRZ A;  4RU9 A;  3ZDA A;  8ICR A;  5KFE A;  5J2E A;  4M9G A;  4EBJ A;  4ECZ A;  1MC8 A;  2DVI A;  1NKC A;  1TAU A;  2O5A A;  3B0X A;  4ED3 A;  4IR9 A;  1NKB A;  5J2K A;  1KTQ A;  1QTM A;  4YD1 A;  4LZD A;  3M8S A;  1RYS A;  4M9L A;  1UT8 A;  1NK5 A;  3RB3 A;  4KLG A;  4BWJ A;  2VAN A;  3BQT A;  1BPB A;  1X9W A;  4NY8 A;  3BQ1 A;  1WOT A;  4KLJ A;  2IA6 A;  3HP6 A;  3PO4 A;  4UB1 A;  9ICO A;  9ICL A;  4KLE A;  1NK0 A;  4O9M A;  2KZM A;  2NRK A;  1ZET A;  1L3S A;  3QZ7 A;  1JX4 A;  4LVS A;  1R8B A;  5DBC A;  1XC9 A;  5HRI A;  5HMM A;  4RQ0 A;  4RNO A;  3JPS A;  2OWO A;  3EW9 A;  5J0Q A;  1T3N A;  4Z6F A;  2PFQ A;  2VA2 A;  9ICF A;  3MGI A;  3BQ2 A;  1Z00 A;  2FMS A;  2KFN A;  3RBD A;  4EYI B;  4QWB A;  2M9N A;  5TZV A;  4C8O A;  3GQC A;  4NKU A;  2J6T A;  5IIN A;  4EBD A;  1COO A;  4GXJ A;  4K4G A;  4MFA A;  5L1J A;  4YMM A;  2FPK A;  2Q0Z X;  5HHH A;  5J0O A;  4RWP A;  2C2R A;  2IHM A;  3RJF A;  3E2E A;  4IRK A;  5J2F A;  4KLU A;  4PH5 A;  1DK3 A;  4PHD A;  2VA3 A;  2PI4 A;  4RPX A;  2DRA A;  3Q8R B;  1Z00 B;  4YR0 A;  3G6Y A;  3UQ2 A;  1L3V A;  4NM1 A;  2KTQ A;  4WBZ A;  3OV7 A;  4DFK A;  4K4H A;  2JEF A;  2RFF A;  2ZUC A;  2HVI A;  3C5F A;  2BKE A;  5KFY A;  4KN4 A;  1HUO A;  3JZ0 A;  4C8L A;  4JV2 A;  2NRV A;  4QWD A;  3C21 A;  1R89 A;  8ICY A;  4AT9 A;  3AQN A;  4AT7 A;  1LV5 A;  2W9A A;  4UAW A;  7ICS A;  4FS2 A;  3Q8S B;  5KFT A;  2W9M A;  4M9H A;  4ZH4 A;  2A1J A;  2FPL A;  3PVX A;  4I2C A;  1PZN A;  1BVS A;  1A76 A;  2F1I A;  4Z6E A;  3ZD8 A;  3IHQ B;  3NGD A;  3OSN A;  5DLF A;  4UD5 A;  4QZ9 A;  5KTQ A;  2XO7 A;  3GIK A;  3OJS A;  4DL7 A;  4UB4 A;  5KFW A;  5HRE A;  2BCR A;  4DFJ A;  4KLS A;  3SV3 A;  3AU2 A;  5KFS A;  4X5V A;  5KG5 A;  3RJE A;  4E80 A;  4QW8 A;  9ICC A;  1S10 A;  5DQH A;  1RXW A;  2ZUB A;  1S0V A;  3LDA A;  4DQQ A;  2O1P A;  5EWF A;  4EP7 A;  1U47 A;  4YR2 A;  5KFL A;  1XSL A;  2UVU A;  3Q8L A;  2KP7 A;  2GWS A;  4R64 A;  5L9X A;  1ZQM A;  4YXJ A;  1S76 D;  2KFZ A;  7ICK A;  4JK1 A;  2M2W A;  1FA0 A;  4Q45 A;  1X9S A;  2HVH A;  2R8G A;  1BPE A;  5CA7 A;  3RB6 A;  1D9F A;  4RQ4 A;  4DFP A;  3PR5 B;  3MR5 A;  2UVR A;  4RWO A;  4I28 A;  7ICQ A;  1NO5 A;  1NK4 A;  4FBU A;  4WCW A;  2I9G A;  4EBK A;  4QZE A;  4FH3 A;  3TFR A;  4BXO B;  4UAZ A;  4DS4 A;  2LYH A;  4EYH B;  1NK9 A;  1YLQ A;  4O3P A;  3HPO A;  2DR9 A;  8ICC A;  7ICM A;  9ICB A;  5KFJ A;  3K75 D;  1BPD A;  5KFR A;  3MR2 A;  4F5N A;  4ECR A;  1RXV A;  1QSL A;  2ZHA A;  3B0Y A;  5DB6 A;  5KT7 A;  5KT2 A;  3WFQ E;  3HW8 A;  5DG9 A;  3WFP A;  4NLG A;  1DK2 A;  2F1J A;  4I2E A;  1S97 A;  2M2V A;  3RAQ A;  1L3T A;  1ZQO A;  4F3O A;  3HJ4 A;  2RDI A;  3AQK A;  4QZG A;  3N4M B;  4F5O A;  2R8I A;  3MFI A;  4M6W B;  3AUO A;  3ZD9 A;  1ZQE A;  5HHI A;  4O5C A;  5HC9 A;  4PHA A;  5J2D A;  4TUS A;  1BPX A;  4ED0 A;  8ICZ A;  3SYZ A;  5DEC A;  4RQ8 A;  8ICH A;  5KG6 A;  5J0S A;  3TI0 A;  4WC6 A;  5BOL A;  2ZH5 A;  2ZHB A;  1TKD A;  1ZQS A;  1HUZ A;  5DB9 A;  4UBC A;  5J0T A;  2HHV A;  3V7K A;  4DL5 A;  4ELT A;  5HRK A;  3T3F A;  4RNM A;  8ICS A;  9ICW A;  3MR6 A;  2PBE A;  9ICS A;  4QZD A;  4HYK A;  4M6W A;  4R8U B;  3SZ2 A;  2AQ4 A;  1RPL A;  4J9S A;  1TK0 A;  1SKR A;  5KFI A;  2XY5 A;  3PW5 A;  5J2B A;  4O3R A;  4NLZ A;  1TAQ A;  2PFP A;  5KFF A;  3PW7 A;  3ISB A;  4F4W A;  4FS1 A;  2IMW P;  2JEG A;  3ZDC A;  3GIJ A;  4IRD A;  5F2V O;  1NK7 A;  4IQT A;  2R8K A;  3RH4 A;  8ICN A;  2BQU A;  3V6K A;  1UEU A;  1TV9 A;  1ZQD A;  3C18 A;  1HJP A;  4O3Q A;  4M04 A;  1SL2 A;  2KN7 A;  5DG7 A;  3JPO A;  1SKW A;  3HX0 A;  4TQS A;  8ICV A;  1NKE A;  4J9O A;  9ICN A;  1JXE A;  4NLN A;  5DBB A;  5J0R A;  4J9R A;  7ICO A;  3H38 A;  4R8U A;  3BDP A;  4RZR A;  4I2B A;  3GIM A;  1T4G A;  9ICM A;  4FH5 A;  4S3N A;  4UBB A;  3Q8M A;  1ZQN A;  3ISD A;  1MIY A;  4C8N A;  3IM1 A;  3N97 B;  4ATB B;  2VA8 A;  4TQR A;  3TQ1 A;  7ICG A;  1X9M A;  7ICE A;  4UB5 A;  1MIW A;  1ZJM A;  2AGO A;  3TAN A;  4X4U A;  2BR0 A;  3OSP A;  2UVW A;  5KFV A;  4WC5 A;  1D8Y A;  1KEJ A;  4NXZ A;  5HML A;  4F5P A;  4PGY A;  4ED8 A;  4C8M A;  4KLL A;  3C23 A;  4K4I A;  5KFG A;  2NRX A;  2ZH6 A;  3G6X A;  2ZH7 A;  1ZQG A;  2ID1 A;  4PGX A;  4DL6 A;  4O5K A;  5CJ7 A;  5KT6 A;  3THV A;  3EYZ A;  3AQM A;  4YN4 A;  3T5L A;  1ZJN A;  4ECW A;  4ECQ A;  5CHG A;  5IIO A;  1ZQX A;  3V6H A;  5KFM A;  1N56 A;  1NZP A;  2ZH3 A;  4B9S A;  2BE3 A;  4XUS A;  2PI5 A;  9ICH A;  1U49 A;  2ZJA A;  1K1Q A;  5J2J A;  1ZQW A;  3OHA A;  4F4Z A;  3RH5 A;  4O3S A;  1V9P A;  3PMN A;  2M2U A;  3AQL A;  3HJ1 A;  3PML A;  3JPP A;  3MAB A;  5CR0 A;  3PW2 A;  4MEX A;  1JAJ A;  3K4G A;  4I2H A;  2ATL A;  4QZA A;  3PR4 A;  2ZH4 A;  5KFB A;  3LWL A;  3ZDB A;  5HRL A;  1XWL A;  5IIJ A;  3HT3 A;  4DO9 A;  4RWQ A;  2PFN A;  3OHB A;  3RR8 A;  1EXN A;  3BJY A;  1Y88 A;  4MEY A;  3UPQ A;  1ZQQ A;  2BGW A;  5HRH A;  5DQG A;  5HRD A;  2XC9 A;  4TUR A;  4MF8 A;  2Y1J A;  7ICT A;  1ZQV A;  3GII A;  1T7P A;  1V4A A;  1L3U A;  1ZQH A;  1ZQJ A;  4UD4 A;  2ZH8 A;  3PW4 A;  2BCU A;  1XSN A;  3C1Z A;  4DSF A;  1BPZ A;  4B9N A;  1KSP A;  5KG0 A;  4F93 B;  1S9F A;  4C8K A;  4DEZ A;  1WCN A;  4KTQ A;  2HHT A;  5DGB A;  3PW0 A;  7ICL A;  3PNC A;  1CUK A;  2ZJ5 A;  5KT5 A;  4TUQ A;  3V7L A;  1MQ2 A;  1LB2 B;  5KG3 A;  4E7X A;  5CP2 A;  4F4K A;  4M9J A;  3EPI A;  3UPS A;  1L5U A;  1MSW D;  5KG7 A;  3BQ0 A;  3OVA A;  5BOM A;  1D8L A;  5C5J A;  4PGQ A;  4UAY A;  2ASL A;  3RRG A;  5DLG A;  1TFW A;  2KZ3 A;  4DSL A;  3RJJ A;  4J9N A;  4TUP A;  4F5Q A;  2C22 A;  1QSS A;  1BNO A;  3T5K A;  3H4B A;  2PFO A;  4J9Q A;  4ED7 A;  1ZQU A;  8ICW A;  4ECS A;  3T5H A;  1SKS A;  1JMS A;  4KMU A;  4QWE A;  1ZQP A;  8ICA A;  4DF8 A;  5D46 A;  4GC6 A;  4P2H A;  4B9M A;  1TFY A;  4YFK A;  2BDP A;  1WCL A;  4RQ3 A;  4QZH A;  3JPQ A;  3C5G A;  4QZF A;  3C2L A;  4RQ2 A;  4G3I A;  4Q8E A;  3KHR A;  5L1K A;  3M9N B;  3JYY A;  5KFD A;  4EBE A;  4FO6 A;  3OUY A;  3GV7 B;  2JZB B;  4AT8 B;  3FDS A;  4QZB A;  3OJU A;  3TAQ A;  3H40 A;  3H8J A;  4DSE A;  8ICF A;  1NJW A;  3TFS A;  4DS5 A;  5F9L A;  4AT9 B;  2BQR A;  2Y1I A;  2W9C B;  3SI8 A; 
#chains in the Genus database with same CATH topology
 3H3A A;  3IRU A;  2R18 A;  2KVC A;  2JH1 A;  5F9N A;  1D8B A;  4X4P A;  3MR3 A;  2QLT A;  4MKP A;  1SV0 A;  4KLO A;  4M9N A;  4IQV A;  4WQK A;  1X40 A;  3ZDE A;  4EZ9 A;  2J6S A;  2D6F C;  4DL4 A;  4X4R A;  2KIW A;  4RT3 A;  3RTV A;  3PY8 A;  2KIV A;  4JV1 A;  9ICT A;  2QB0 A;  2RP5 A;  3ONN A;  3RB0 A;  2Z7J A;  5DBA A;  3TAC B;  2YMP A;  3IN5 A;  4DOB A;  2V9W A;  2H5X A;  4X4Q A;  1UA1 A;  3C28 A;  4ECU A;  2BPF A;  1JI7 A;  3EPG A;  1X66 A;  3H8W A;  3O0F A;  2LBO A;  1PVQ A;  4ECT A;  1OUQ A;  2AH5 A;  2K8A A;  2QB0 B;  4QWC A;  3RJK A;  4GC7 A;  2I6X A;  1X2I A;  2C2D A;  5AM0 A;  4CNQ A;  3ZDD A;  2IBK A;  3Q8Q B;  1SL1 A;  4O5E A;  2MAX A;  2ZH9 A;  1Q3V A;  4C4S A;  5AKY A;  3AQF A;  4YR3 A;  3C2K A;  4DOA A;  1S5L U;  1WYG A;  2AGP A;  1ZQK A;  4YQW A;  4P0Q A;  3PX4 A;  2GA9 D;  4UB6 U;  2BCV A;  1C7Y A;  4KLT A;  2F8L A;  4RWN A;  7ICP A;  1V85 A;  2NO4 A;  2FPM A;  5L1I A;  5KFU A;  1FO4 A;  4WC0 A;  2JRZ A;  5ALH A;  3NVY A;  3CYM A;  1JQR A;  3GIL A;  2JMG A;  1ZQB A;  4GXK A;  7ICJ A;  4F92 B;  2DPI A;  1D9D A;  1YZ6 A;  2NRT A;  3T79 A;  2Y0S F;  2K8C B;  5KG4 A;  3GFK B;  4Q44 A;  1L7M A;  4WC2 A;  5DDM A;  4BDP A;  5HRF A;  4Q43 A;  2XGP A;  3KZX A;  4FFD A;  3CP8 A;  5DGA A;  1A77 A;  3OWG A;  3QEA Z;  1NJY A;  4F2R A;  2KOB A;  2HN1 A;  4M2Y A;  5J2A A;  4XQ8 A;  4X0A A;  2ISO A;  2R8H A;  2DPJ A;  4IQU A;  3LQC B;  4F8R A;  4EX7 A;  4R63 A;  3UXO A;  4K98 A;  3PSF A;  3SV4 A;  1XSP A;  3N7R C;  2YQE A;  4WC1 A;  4IG8 A;  9ICJ A;  5KT4 A;  1NK8 A;  3H4D A;  1XS9 D;  4FHY A;  1ARO P;  7ICN A;  1X9X A;  2ZTD A;  5EOZ A;  1SZH A;  3RJI A;  1RM6 C;  2RHF A;  2BBH A;  4RPY A;  4KLM A;  4GLX A;  2P66 A;  2R8J A;  2HSZ A;  1FFU A;  2JZB A;  1UA0 A;  3FM9 A;  2W9B B;  3GDX A;  2XIC A;  2KNJ A;  1DXS A;  4C0Z A;  4ED1 A;  2JR5 A;  4RUC A;  1S0N A;  3AL0 B;  2DQN B;  2E8O A;  1RDF A;  2DBY A;  5HP4 A;  1ZQR A;  1NOM A;  2FMP A;  9ICQ A;  3FYH A;  5DED A;  3ERC C;  1WWU A;  3B0X A;  4ED3 A;  2B51 A;  1NKB A;  5J2K A;  3SD7 A;  1NK5 A;  4KLG A;  1X9W A;  1WOT A;  2ZIW B;  2KVS A;  2FE9 A;  3OV7 A;  4RQ0 A;  2B6G A;  1Z00 A;  4EYI B;  4NV0 A;  4C8O A;  2NO5 A;  5IIN A;  4EBD A;  4GXJ A;  2FPK A;  2ZIW A;  4Y2P A;  4IRK A;  1SXE A;  2VA3 A;  1L3V A;  5KAI U;  4K4H A;  1Z19 A;  2YN4 A;  4KN4 A;  1HUO A;  2VJ5 A;  4C8L A;  4B6J A;  3IV6 A;  1R89 A;  3AQN A;  1JRO A;  4UAW A;  3Q8S B;  1QQ5 A;  2E3T A;  4US9 A;  1Q3U A;  5AM2 A;  3MGV A;  2EH9 A;  1WG8 A;  4DFJ A;  4KLS A;  3RJE A;  4O3M A;  2NV3 A;  1RXW A;  3WFR E;  5AK3 A;  5KFL A;  3WKD A;  2GWS A;  5JRT A;  4R64 A;  1ZQM A;  1FA0 A;  3NUQ A;  1Z1B A;  2F3N A;  2W3S A;  1F44 A;  1BPE A;  5CA7 A;  4RWO A;  1NO5 A;  1T94 A;  1ZD5 A;  2JHD A;  4QZE A;  5AIB A;  4FH3 A;  5AM5 A;  1YLQ A;  2DR9 A;  5AKK A;  8ICC A;  4ECR A;  4F5N A;  4OAI Z;  5KT7 A;  5KT2 A;  3WFQ E;  5DG9 A;  1DK2 A;  2F1J A;  4I2E A;  1S97 A;  2KIC A;  2RDI A;  2DKX A;  5CRX A;  5T14 A;  5D61 A;  5EE0 A;  1ZQE A;  2KD1 A;  3SYZ A;  5DEC A;  2ZHB A;  4AP9 A;  4P0P B;  5CHE A;  2HHV A;  5J0T A;  4ELT A;  2MU2 A;  3T3F A;  3MR6 A;  1O08 A;  3MC1 A;  2PBE A;  4QZD A;  2AQ4 A;  5AKZ A;  1SKR A;  2XY5 A;  4CDG A;  3PW7 A;  2JXJ A;  3RH4 A;  3C18 A;  1HJP A;  3F5A A;  7ICO A;  4J9R A;  3H38 A;  2OEH A;  3BDP A;  4I2B A;  3GIM A;  1T4G A;  9ICM A;  1ZD3 A;  1ZD4 A;  2LYA A;  1ZQN A;  3N97 B;  1X9M A;  3HJE A;  4CGZ A;  3OSP A;  5KFV A;  1KEJ A;  4ED8 A;  2BBJ A;  4K4I A;  2NRX A;  2ZH7 A;  2ID1 A;  4PGX A;  4DL6 A;  4O5K A;  5KT6 A;  1J2N A;  4YN4 A;  1NZP A;  2ZH3 A;  4UAR A;  1U49 A;  3KZI U;  1K1Q A;  2K4P A;  3PMN A;  3PML A;  5CR0 A;  3PW2 A;  3K4G A;  3UMG A;  2ATL A;  4QZA A;  5HRL A;  1L8O A;  5IIJ A;  4DO9 A;  3OHB A;  1PVP A;  1EXN A;  3BJY A;  1Y88 A;  4MEY A;  3UPQ A;  1N5X A;  5ALG A;  1N62 A;  5DQG A;  5HRD A;  2W11 A;  4TUR A;  4MF8 A;  3SAF A;  4UD4 A;  3RF9 A;  2WF9 A;  3PW4 A;  1IV8 A;  3C1Z A;  1BPZ A;  1GO3 F;  4F93 B;  1WWV A;  4KTQ A;  5CFT A;  4U6P A;  7ICL A;  2ZJ5 A;  4TUQ A;  1LB2 B;  5CP2 A;  3UPS A;  1ZD2 P;  1MSW D;  1PK3 A;  4PGQ A;  3RRG A;  3PSI A;  3BZC A;  2CPR A;  4DSL A;  3F2C A;  4J9N A;  4Y2T A;  3L4P A;  3WK6 A;  1QSS A;  1URJ A;  4J9Q A;  4ECS A;  4DF8 A;  4GC6 A;  4KB6 A;  4YFK A;  1ZXI A;  3C5G A;  4RQ3 A;  3C2L A;  4QZH A;  4RQ2 A;  4Q8E A;  5B66 U;  5KFD A;  4AT8 B;  3FDS A;  5AHX A;  4C80 A;  5KL8 B;  8ICF A;  3TFS A;  5ALV A;  2BQR A;  4EGW A;  1UEV A;  1KN5 A;  2BQ3 A;  4F4X A;  5ALY A;  3LWM A;  3OUY B;  2FLN A;  4DFM A;  5KFZ A;  5J0X A;  3NYB A;  1FFV A;  1JUD A;  1PK1 A;  3M8R A;  4FHX A;  4KLF A;  1GPJ A;  4O6A A;  1TE2 A;  2EWR A;  3V6J A;  4NL9 C;  2ZTC A;  8ICT A;  3SAH A;  4OO1 J;  4LEV A;  4MF2 A;  2GO7 A;  3PV8 A;  5J0W A;  4IR1 A;  5KT3 A;  1YT3 A;  5AI4 A;  4O3N A;  1MA7 A;  2MUT A;  1PK1 B;  2OH2 A;  4EV6 A;  4M0A A;  3NVZ A;  1XO1 A;  4CCH A;  2XCP A;  1BPY A;  3C1Y A;  5J0Y A;  3RJG A;  4K97 A;  1M6Y A;  5AK6 A;  5HRG A;  4Y2V A;  3CK6 A;  1IM4 A;  3ALR A;  4C4R A;  2XI9 A;  3KHG A;  3KHL A;  5AKL A;  1XU4 A;  4OCZ A;  5DQI A;  4UB2 A;  1B43 A;  1NNL A;  1U45 A;  3G6V A;  5J2G A;  2QKQ A;  3BS7 A;  2ASJ A;  4WQL A;  3V7J A;  3A0H U;  4R65 A;  5KFA A;  2H3V A;  4NM2 A;  2LHT A;  2HHP A;  5J0U A;  4OJ5 A;  4DQI A;  3M9O B;  5GTH U;  1V97 A;  4KLI A;  1CEZ A;  3OVB A;  3H8S A;  1ZYQ A;  2HBM A;  2W03 A;  4P4P A;  1PX5 A;  5HNK A;  4RQM A;  2BPC A;  2F77 X;  1X42 A;  7ICF A;  5EWG A;  2PXI A;  3ORY A;  5J2C A;  9ICI A;  2ZXH A;  2AU0 A;  2V4R A;  4I2F A;  1Z4O A;  4B9U A;  2GOL A;  4ELV A;  4RUA A;  4J9K A;  3F2B A;  4EEY A;  5BPC A;  3ETR A;  4YMN A;  2CXY A;  3LK9 A;  3JPN A;  8ICE A;  1T3Q A;  8ICB A;  4XJE A;  4WC3 A;  1ZQY A;  3K1R B;  3H8M A;  5AI9 A;  5J2H A;  4E8F A;  4I29 A;  4JWN A;  5ALM A;  2JEI A;  2WTF A;  3H0L B;  3WKB A;  4PHE A;  4DF4 A;  3IG5 A;  1R8A A;  3HKZ F;  3WFS C;  5KAF U;  4YMO A;  4B9L A;  3RR7 A;  5KG2 A;  5D4B A;  5IIM A;  4RT2 A;  2MSN A;  3E0F A;  4X4T A;  5KFK A;  4WBY A;  3M9M B;  1MQ3 A;  2RDJ A;  5DKW A;  4JUZ A;  5J29 A;  3AU6 A;  4YD2 A;  3OTQ A;  5KFP A;  8ICO A;  3NRW A;  9ICG A;  3UXN A;  3TAD A;  1ZQI A;  5KNI A;  4HAI A;  9ICP A;  3QU9 A;  4KLH A;  1T8E A;  4QW9 A;  1TVA A;  4CF4 A;  2HN2 A;  1TK8 A;  3IG8 A;  2OM6 A;  1SXD A;  8ICG A;  3PO5 A;  4JLX A;  2HHW A;  4YP3 A;  3H37 A;  5G5H A;  4QZ8 A;  1Q78 A;  1U9L A;  2LPE A;  1SZP A;  1NJZ A;  4NXX A;  1K1S A;  1S8O A;  9ICA A;  5JTI A;  4UAT A;  2KJ8 A;  3JPR A;  4KIT B;  5III A;  1LKY A;  2HDO A;  3PST A;  4XA5 A;  2ISP A;  4I2G A;  1UET A;  2JGA A;  4WC7 A;  2BHN A;  2KE7 A;  4BX9 C;  2XY6 A;  2ASD A;  2ZUD A;  1F5A A;  2DR5 A;  2KG5 A;  5KFX A;  4DWI A;  5HR7 A;  5HR9 A;  4G9B A;  1R8C A;  3CNH A;  5AKI A;  3Q8P B;  1JXL A;  3HIY A;  1RYU A;  4DL3 A;  2JEJ A;  2W8K A;  4DSK A;  3OVS A;  5B3P A;  2G09 A;  3F5E A;  3QE9 Y;  3Q8K A;  3K7D A;  3IDW A;  1ZQ1 C;  4QWA A;  5KFE A;  1MC8 A;  1NKC A;  1N5W A;  2O5A A;  3QX7 A;  1KTQ A;  4YD1 A;  1RYS A;  4M9L A;  4O68 A;  2BZF A;  2GLE A;  4KLJ A;  3HP6 A;  9ICO A;  4KLE A;  1NK0 A;  4O9M A;  3QZ7 A;  1JX4 A;  4LVS A;  5DBC A;  5HRI A;  4RNO A;  2OWO A;  4IR9 A;  1JRP A;  2F76 X;  2KMD A;  3MGI A;  3BQ2 A;  2KFN A;  2ESE A;  2M9N A;  4NKU A;  2J6T A;  2YY6 A;  4K4G A;  5L1J A;  1Q46 A;  2Q0Z X;  4RWP A;  2C2R A;  3RJF A;  5J2F A;  4PH5 A;  2DRA A;  3Q8R B;  3G6Y A;  2W3R A;  4NM1 A;  1ED1 A;  2PMZ F;  3C5F A;  2MA1 A;  4EEK A;  4AT9 A;  4AT7 A;  2W9A A;  4EEN A;  4M9H A;  4ZH4 A;  1PZN A;  2F1I A;  4Y2Y A;  4QJF B;  3IHQ B;  3NAS A;  2XO7 A;  2HMX A;  3GIK A;  5KFW A;  3AU2 A;  2K4I A;  4QW8 A;  3LDA A;  4DQQ A;  5EWF A;  1SB3 C;  1XSL A;  2UVU A;  3Q8L A;  2KSO B;  1S76 D;  7ICK A;  4JK1 A;  1X9S A;  3WK5 A;  2HVH A;  4CF3 A;  2E8M A;  2YML A;  2QAR A;  2WF5 A;  4BXO B;  3F2D A;  4K99 A;  4NLB A;  1L8L A;  5KFJ A;  3MR2 A;  1BPD A;  2ZHA A;  1N60 A;  2KEY A;  2M2V A;  1L3T A;  1ZQO A;  1LVH A;  4QZG A;  3N4M B;  3AUO A;  4USA A;  3ZD9 A;  4O5C A;  3EF2 A;  4PHA A;  5J2D A;  4K96 A;  4ED0 A;  4OAF A;  3KKA C;  4K9A A;  5ALZ A;  5JTG A;  4WC6 A;  8ICH A;  5J0S A;  2KHV A;  5BOL A;  1HUZ A;  3M7D A;  2PMZ C;  4DL5 A;  4HYK A;  5KFI A;  2M0N A;  5KFF A;  4FS1 A;  2IMW P;  2JEG A;  4IRD A;  2PKE A;  3KBB A;  2KV2 A;  4O3Q A;  4TQS A;  1JAL A;  4NLN A;  5DBB A;  3AEV A;  4RZR A;  1CRX A;  4BJQ A;  3ISD A;  4C8N A;  4ATB B;  2VA8 A;  4TQR A;  3TQ1 A;  3VCB A;  2XID A;  1ZJM A;  3TAN A;  2YMM A;  4KX5 A;  3UMB A;  4NXZ A;  4PGY A;  5KFG A;  5ALL A;  2ZH6 A;  3UM9 A;  1ZQG A;  2WF8 A;  3THV A;  3EYZ A;  3AQM A;  3T5L A;  3SMV A;  1N56 A;  4Y2Q A;  4B9S A;  2ZIU A;  4NXV A;  9ICH A;  4WH5 A;  1Q8K A;  4F4Z A;  3OHA A;  1ZRN A;  2E8N A;  1V9P A;  3AQL A;  2ODG A;  1JAJ A;  3OPX A;  4I2H A;  2JH7 A;  3WU2 U;  2ZH4 A;  5AI8 A;  2LI6 A;  1AQ6 A;  5HRH A;  3NVV A;  2QB1 A;  1ZOL A;  7ICT A;  3DDH A;  4EEL A;  3GII A;  5AI0 A;  1ZQJ A;  5B5E U;  3PSP A;  2G06 A;  5KG0 A;  2OYY A;  1Z4N A;  5DGB A;  1MQ2 A;  4E7X A;  5H2F U;  1FIQ A;  4K8V A;  1L5U A;  3HRD D;  3OVA A;  5BOM A;  5DLG A;  4CE6 A;  2KZ3 A;  3LYS A;  4TUP A;  2C22 A;  3H4B A;  2PFO A;  8ICW A;  3T5H A;  8ICA A;  5D46 A;  1TFY A;  2WFA A;  3JPQ A;  5L1K A;  4EBE A;  3SEN A;  4FO6 A;  3GV7 B;  2JZB B;  4QZB A;  3TAQ A;  3S6J A;  3H40 A;  5F9L A;  1XO0 A;  4AT9 B;  4ZOH C;  2W9C B;  3SI8 A;  2WF7 A;  2NYV A;  1DOQ A;  2BPG A;  4X4O A;  3DEE A;  2A1J B;  1B4F A;  4ECV A;  2BCQ A;  4KLQ A;  2P6U A;  4NLK A;  4LEW A;  4I0U A;  1N2X A;  2AXT U;  3MDC A;  1KW4 A;  1BNP A;  5HRB A;  4RNN A;  4I2D A;  2W9C A;  8ICK A;  9ICE A;  2ALZ A;  4RQ1 A;  2ZXI A;  4F50 A;  4E0D A;  1YZ7 A;  4QZC A;  4OD0 A;  4N7R A;  3ISC A;  4XRH A;  4UB3 A;  4BXO A;  4DLE A;  4X4S A;  4RQ6 A;  7ICV A;  1QCK A;  5KG1 A;  2ZJ8 A;  3RBE A;  2FCL A;  3HIL A;  3WKC A;  2C2E A;  1KFT A;  2YTU A;  1VJ7 A;  4DOC A;  3QZ8 A;  3UXP A;  4IC9 A;  4B9V A;  1HEK A;  1CI4 A;  3I76 A;  4MFC A;  4IRC A;  4BGD A;  1ZQZ A;  4MFF A;  1TFR A;  3NTU A;  2HHS A;  4DLG A;  4O67 A;  2XCA A;  2B21 A;  2YMQ A;  4KN7 A;  2B0C A;  4Y2X A;  2F8K A;  4YXM A;  4DQR A;  2FLP A;  4PPX A;  5AM1 A;  4J9L A;  2XVT A;  1Q79 A;  3GV5 B;  4WC4 A;  3H39 A;  1S0O A;  4ED2 A;  3PX0 A;  4UAU A;  2V4Q A;  4IQW A;  2DR8 A;  4X4V A;  5ALN A;  5AI6 A;  4NLC A;  4F71 A;  8ICM A;  4ACO A;  2AHO B;  3J81 j;  4F4Y A;  3WFO A;  4Z6C A;  1J2M A;  3H0M B;  1U48 A;  5ALW A;  8ICP A;  3FC4 A;  5KFC A;  4R66 A;  2BCS A;  5EE3 A;  1KLN A;  2DUY A;  3TAP A;  3L9D A;  4NJ8 A;  2LM1 A;  5ALJ A;  1K5O A;  2EAO A;  2HHQ A;  3T5J A;  2FLL A;  1RYR A;  1KFD A;  2F2A B;  5C0Y A;  9ICK A;  4F91 B;  5B3Q A;  5E79 U;  1KNY A;  4F2S A;  4GXI A;  4B9T A;  4O0I A;  2NRW A;  4J9M A;  8ICU A;  1KFS A;  1KBU A;  2JV3 A;  4M47 A;  2EAM A;  5F3X B;  7ICH A;  3HWT A;  5J0P A;  3H7I A;  1BGX T;  1RG6 A;  5CWR A;  4DSI A;  1MIV A;  2AQ0 A;  1TK5 A;  2C28 A;  5KFN A;  3BZK A;  4YCX A;  1QLN A;  3TAR A;  5ALD A;  4EBC A;  4Y2R A;  4X4N A;  2XGQ A;  9ICU A;  1SWW A;  1OU5 A;  2FJ6 A;  4EZ6 A;  4JLZ A;  2H3F A;  2MRL A;  2HHU A;  2K8B B;  1QSY A;  3PX6 A;  2F1H A;  2HBJ A;  4DQS A;  5KFQ A;  4LZG A;  3KTQ A;  4HX0 A;  2F44 A;  4UQG A;  3EUB 2;  7ICU A;  5AK5 A;  3WK9 A;  4PZO A;  5J8Y A;  3RRH A;  4FHW A;  9ICV A;  2K89 A;  5DG8 A;  2W9B A;  2RLT A;  4RQN A;  2M2T A;  5ALU A;  4DQP A;  3KHH A;  1DGS A;  2K4H A;  3GU3 A;  3ZDA A;  8ICR A;  4M9G A;  4ECZ A;  1PVR A;  3KOO A;  1QTM A;  3M8S A;  4LZD A;  1UT8 A;  1VDV A;  3RB3 A;  4NXW A;  3BQT A;  1BPB A;  4NY8 A;  3BQ1 A;  3PO4 A;  9ICL A;  2KZM A;  2NRK A;  4IL6 U;  1ZET A;  5AM3 A;  2A3V A;  1R8B A;  5HMM A;  1T3N A;  3D2N A;  4C4T A;  2FMS A;  3PHZ A;  3SEI A;  5TZV A;  3GQC A;  2D3D A;  4MFA A;  5HHH A;  1X6I A;  2O6K A;  3E2E A;  4NL9 A;  4KLU A;  5K4L A;  1ECW A;  2WAQ C;  1PUZ A;  3UQ2 A;  1Z00 B;  3CW2 C;  4WBZ A;  4DFK A;  2JEF A;  2LYB A;  2ZUC A;  2YB1 A;  2BKE A;  2EZZ A;  4P0Q B;  3QYP A;  4Y2S A;  4JV2 A;  4KMO B;  4QWD A;  8ICY A;  1LV5 A;  1QQ7 A;  4FS2 A;  2W9M A;  2FPL A;  2GH1 A;  2IOH A;  4EED A;  1BVS A;  3OSN A;  5DLF A;  4FZL A;  4QZ9 A;  5KTQ A;  1L7P A;  4UB4 A;  5HRE A;  4X5V A;  4E80 A;  9ICC A;  2VIX A;  1S10 A;  2ZUB A;  1S0V A;  1L7O A;  4YR2 A;  2KP7 A;  1SV4 A;  2IHO A;  2KFZ A;  3H0R B;  5L9X A;  3WK8 A;  4YXJ A;  2M2W A;  1KKX A;  5J8Y C;  4Q45 A;  2R8G A;  4OAG A;  3RB6 A;  1D9F A;  4DFP A;  3MR5 A;  2UVR A;  4I28 A;  4PJ0 U;  7ICQ A;  1NK4 A;  4FBU A;  4WCW A;  4EBK A;  4LJX A;  3QU2 A;  2DWQ A;  5ALX A;  4EYH B;  1NK9 A;  4O3P A;  3HPO A;  7ICM A;  3K75 D;  5DB6 A;  2KHQ A;  4NXU A;  3HW8 A;  4X0B A;  3RAQ A;  4F3O A;  2RRD A;  2R8I A;  3MFI A;  5HHI A;  2I5H A;  4TUS A;  1BPX A;  8ICZ A;  5KG6 A;  3TI0 A;  1TKD A;  3V7K A;  4RNM A;  9ICW A;  1J97 A;  1TK0 A;  3SZ2 A;  1RPL A;  4J9S A;  4CF5 A;  5J2B A;  4NLZ A;  1TAQ A;  2PFP A;  8ICS A;  2OHF A;  2WB1 F;  5F2V O;  4IQT A;  2R8K A;  8ICN A;  2BQU A;  1UEU A;  4QIW F;  5AKJ A;  4P0P A;  4UAS A;  4OJP A;  1UCV A;  3HX0 A;  3C29 A;  1NKE A;  4J9O A;  5J0R A;  4UB8 U;  4S3N A;  1MIY A;  7ICG A;  7ICE A;  4FO1 A;  2BR0 A;  5EE9 A;  2UVW A;  4WC5 A;  3VC8 A;  5ALP A;  4F5P A;  4C8M A;  4KLL A;  2H3I A;  4UW9 A;  2FDR A;  2WF6 A;  1ZJN A;  4O69 A;  5ALO A;  4ECQ A;  5CHG A;  2EDU A;  5ALF A;  5KFM A;  1SIJ A;  1TAM A;  2BE3 A;  3WKA A;  2PI5 A;  1KL9 A;  5J2J A;  3HJ1 A;  2DGZ A;  2M2U A;  3MAB A;  3D2S A;  4MEX A;  5D62 A;  2ZIV B;  3PR4 A;  3LWL A;  4RWQ A;  2PFN A;  1ZQQ A;  2BGW A;  2VKQ A;  2XC9 A;  2Y1J A;  1T7P A;  3QU7 A;  2ZH8 A;  4WOY A;  1VLB A;  2BCU A;  3L3F X;  4KM5 A;  1S9F A;  4DEZ A;  2HHT A;  5JU5 A;  2WHE A;  3PW0 A;  5KT5 A;  3V7L A;  5AKH A;  2A19 A;  3QU5 A;  5KG3 A;  1NZB A;  4F4K A;  4M9J A;  5AKX A;  5ALI A;  1D8L A;  2ASL A;  3NVW A;  4UAV A;  3WKE A;  2W55 A;  1ZQU A;  3AM9 A;  1JMS A;  1ZQP A;  4P2H A;  4B9M A;  2BDP A;  4G3I A;  3SAG A;  4QZF A;  2LMR A;  3KHR A;  2OXO A;  5G5G A;  3M9N B;  3OUY A;  2L5Y A;  1L6N A;  3H8J A;  4JMU A;  4DSE A;  2DF4 B;  2Y1I A;  2EAN A;  1QH9 A;  1V38 A;  3JPT A;  2B4V A;  2HOQ A;  3L5K A;  2ZH2 A;  2EAP A;  4GIB A;  4FZN A;  4U7C A;  3EZ5 A;  3QNM A;  5KL1 B;  8ICL A;  5CB1 A;  4FHP A;  4AT8 A;  3A0B U;  3M6Z A;  2G07 A;  5KFH A;  1UPH A;  4J03 A;  2VJ4 A;  4MHV A;  3C2M A;  3N7S C;  4XQ7 A;  2EZX A;  3MDA A;  1L7N A;  1ZQT A;  2W7P A;  2ZH1 A;  1Z3E B;  2Q66 A;  3RH6 A;  1C20 A;  2E5S A;  4P4M A;  2YX8 A;  4CRX A;  4YVZ A;  1FEZ A;  1B22 A;  5D49 A;  4A8E A;  1COK A;  4I2A A;  1ZQC A;  3NS1 A;  3WK4 A;  4NKT A;  2HW3 A;  3NWI A;  2DFL A;  3BS5 A;  4KX3 A;  4ECY A;  1JIH A;  2MUT B;  1VFG A;  3ER8 C;  1S77 D;  1SL0 A;  3OGU A;  2Y9U A;  2FMQ A;  3GV8 B;  5AIC A;  5CEH A;  2J6U A;  3MFH A;  5FP0 A;  2XY7 A;  1HIW A;  5J2I A;  3TAD C;  2ZTE A;  1ZQA A;  4I2J A;  4JV0 A;  3MBY A;  4O3O A;  3MCR A;  2K4E A;  5KFO A;  2HHX A;  4NWI A;  3TKA A;  4ICA A;  4M5D A;  8ICQ A;  2H3Z A;  4AT7 B;  4JWM A;  1ZQF A;  2HOF A;  2RQ5 A;  3C66 A;  3QUT A;  1RZT A;  5AIA A;  2LM4 A;  4F5R A;  5DB7 A;  2HOI A;  4KLD A;  3RJH A;  2I1Q A;  3CRX A;  2EZY A;  5IIL A;  1IXR A;  1QQ6 A;  4BWM A;  5DB8 A;  3EWA A;  2P6R A;  3M1Y A;  2IHN A;  7ICR A;  4OJ6 A;  4ECX A;  5L1L A;  3QEB Z;  3F53 A;  4YG2 A;  5DDY A;  3KKA A;  3KD3 A;  7ICI A;  4LT6 A;  4ED6 A;  1N48 A;  4DL2 A;  5TIS U;  3UQ0 A;  1F5S A;  2QAR B;  3E58 A;  4Y2J A;  5AKE A;  5EWE A;  3QXG A;  5GTI U;  8ICJ A;  2OCE A;  4PZN A;  2IUB A;  1ZRM A;  8ICI A;  5CFU A;  2Q4T A;  2K60 A;  2ZIV A;  3K1Z A;  3MGH A;  3NKU A;  5JUM A;  1U4B A;  4I27 A;  3LVW A;  2H3Q A;  3ZI4 A;  1KDH A;  3I1Y A;  3U26 A;  1JN3 A;  2DL0 A;  3UMC A;  5ALQ A;  9ICR A;  2UVV A;  1OXJ A;  3D2Q A;  1NJX A;  9ICX A;  5IIK A;  4FE3 A;  4FBT A;  4OAH A;  1DGJ A;  2AJQ A;  2KZZ A;  3RB4 A;  4Q8F A;  3SQI A;  3RAX A;  2DR7 A;  1H38 A;  4FHV A;  3V72 A;  8ICX A;  4ATB A;  3NRZ A;  1RQL A;  1IG6 A;  2AGQ A;  1VJ5 A;  4PHP A;  5D63 A;  2WAQ F;  4C7Z A;  4OJO A;  4P4O A;  2HBL A;  4RPZ A;  5ALK A;  3ETL A;  3M6K A;  4J9P A;  1ZQL A;  1N63 A;  2W8L A;  3ICX A;  1UT5 A;  2G5H B;  2KKP A;  4I2I A;  1KRP A;  4QZI A;  4DSJ A;  1NK6 A;  4Z6D A;  2G0A A;  4ELU A;  2DRB A;  2W7O A;  4RQ7 A;  3AQE A;  4RQ5 A;  3N7P D;  3QU4 A;  2NRZ A;  4RU9 A;  1S0M A;  4EBJ A;  5J2E A;  2DVI A;  2BDU A;  1TAU A;  2A1A A;  1F0M A;  3KFU F;  3ED5 A;  4GFJ A;  4BWJ A;  2VAN A;  2G5I B;  2IA6 A;  3PZP A;  1N61 A;  4UB1 A;  2LKY A;  2GAF D;  1L3S A;  5A0L A;  2ZIX A;  1XC9 A;  3JPS A;  2YB4 A;  9ICF A;  3EW9 A;  5J0Q A;  2VA2 A;  4Z6F A;  3BS5 B;  2PFQ A;  5HR6 A;  4C7Y A;  1DRG A;  1SGG A;  3RBD A;  5AKG A;  4QWB A;  2IOF K;  2FI1 A;  3QUC A;  1COO A;  4BUG A;  2W04 A;  2P35 A;  5J0O A;  5AI5 A;  4YMM A;  2IOF A;  4PL2 A;  2IHM A;  1DK3 A;  1XNS A;  2WB1 C;  2ZIX B;  4PHD A;  2PI4 A;  4RPX A;  3R9K A;  4YR0 A;  2Y0S C;  2KTQ A;  2RFF A;  2KKV A;  2HVI A;  5KFY A;  4JB3 A;  3JZ0 A;  2NRV A;  3C21 A;  7ICS A;  5KFT A;  1Z1V A;  1WUD A;  2A1J A;  2KSO A;  3PVX A;  4I2C A;  1A76 A;  4Z6E A;  3ZD8 A;  3NGD A;  4UD5 A;  1UQV A;  3OJS A;  4DL7 A;  2BCR A;  3SV3 A;  5KFS A;  3QUQ A;  5KG5 A;  1A0P A;  5DQH A;  5ALR A;  4LEY A;  2O1P A;  4EP7 A;  1X6J A;  1O03 A;  1U47 A;  4FZM A;  4Y2U A;  2D8C A;  2Y9T A;  4AYB C;  4RQ4 A;  3PR5 B;  1UHU A;  2I9G A;  2HBK A;  3TFR A;  3JCF A;  4UAZ A;  4DS4 A;  2LYH A;  3NVO A;  9ICB A;  5KFR A;  1RXV A;  1QSL A;  3B0Y A;  5L1M A;  3WFP A;  4NLG A;  3HJ4 A;  4DFD A;  5ALE A;  3AQK A;  4F5O A;  2KK0 A;  2ZG6 A;  4M6W B;  5HC9 A;  2HCF A;  3AMZ A;  4RQ8 A;  2ZH5 A;  5AM4 A;  1ZQS A;  5DB9 A;  4UBC A;  4OJL A;  3IP4 B;  5HRK A;  2ES6 A;  4K9B A;  9ICS A;  4M6W A;  4R8U B;  3PW5 A;  4O3R A;  9ICN A;  3ISB A;  4F4W A;  3ZDC A;  3I28 A;  3GIJ A;  1NK7 A;  3FAH A;  3V6K A;  1TV9 A;  1ZQD A;  4M04 A;  1SL2 A;  2KN7 A;  5DG7 A;  3JPO A;  1SKW A;  8ICV A;  1JXE A;  2G08 A;  2W43 A;  4QNL A;  4R8U A;  4FH5 A;  4UBB A;  3Q8M A;  3IM1 A;  5EE1 A;  4UB5 A;  1MIW A;  4NXT A;  2AGO A;  1LKY B;  4X4U A;  3SR6 A;  4F72 A;  2KJ5 A;  4AYB F;  1D8Y A;  1KQQ A;  5HML A;  2N1R A;  3D6J A;  3C23 A;  3ER9 B;  3G6X A;  5CJ7 A;  3GZF A;  4PL1 A;  1P7D A;  3DV9 A;  4ECW A;  5IIO A;  1ZQX A;  3QUB A;  3V6H A;  3RFA A;  4XUS A;  3BQ7 A;  4LEZ A;  2ZJA A;  3LVV A;  3RH5 A;  1ZQW A;  3HKZ C;  4US8 A;  4O3S A;  1A6S A;  1SV0 C;  3JPP A;  4WJ3 B;  5KFB A;  3ZDB A;  1XWL A;  3HT3 A;  3N28 A;  3WK7 A;  3RR8 A;  2DKZ A;  5ALT A;  2ZIU B;  4EX6 A;  1ZQV A;  1V4A A;  2W54 A;  5CFS A;  1L3U A;  1ZQH A;  1NI3 A;  1XSN A;  2E1F A;  4DSF A;  4B9N A;  2B56 A;  1MN8 A;  2EQY A;  1KSP A;  4C8K A;  1WCN A;  2CRX A;  1SWV A;  3PNC A;  1CUK A;  3B9J A;  5AK4 A;  3EPI A;  5KG7 A;  3BQ0 A;  4QIW C;  5C5J A;  4UAY A;  1TFW A;  4IS7 A;  2HI0 A;  3RJJ A;  4F5Q A;  1BNO A;  4DCC A;  3T5K A;  4ED7 A;  1SKS A;  4KMU A;  4QWE A;  2E1E A;  1OW5 A;  3AN1 A;  1WCL A;  1RQN A;  1IIP A;  3JYY A;  5ALS A;  2CN1 A;  3OJU A;  1B0X A;  1NJW A;  4DS5 A;  2E8P A;  4EEB A;  2KJ9 A; 
#chains in the Genus database with same CATH homology
 3JPT A;  1DOQ A;  2BPG A;  1UEV A;  3H3A A;  2BQ3 A;  2A1J B;  5F9N A;  4F4X A;  2ZH2 A;  4X4P A;  3MR3 A;  3LWM A;  3EZ5 A;  4ECV A;  2BCQ A;  4KLQ A;  2P6U A;  4NLK A;  8ICL A;  5CB1 A;  2FLN A;  4KLO A;  4DFM A;  4FHP A;  4AT8 A;  3OUY B;  5KFZ A;  4M9N A;  3MDC A;  4IQV A;  5J0X A;  3NYB A;  3ZDE A;  1BNP A;  5HRB A;  4EZ9 A;  5KFH A;  3M8R A;  2J6S A;  4KLF A;  4FHX A;  3C2M A;  4RNN A;  3OVB A;  4XQ7 A;  4I2D A;  3V6J A;  2W9C A;  3MDA A;  8ICK A;  4DL4 A;  2ZTC A;  4X4R A;  9ICE A;  2ALZ A;  4RT3 A;  8ICT A;  3RTV A;  4RQ1 A;  4F50 A;  3PY8 A;  1ZQT A;  4MF2 A;  4JV1 A;  1Z3E B;  9ICT A;  2ZH1 A;  2Q66 A;  3PV8 A;  5J0W A;  3RH6 A;  4IR1 A;  3RB0 A;  5KT3 A;  4O3N A;  4P4M A;  4E0D A;  2MUT A;  4YVZ A;  4QZC A;  5DBA A;  4M0A A;  5D49 A;  1B22 A;  4DOB A;  2V9W A;  4I2A A;  2H5X A;  1XO1 A;  4XRH A;  3ISC A;  1ZQC A;  4UB3 A;  2XCP A;  4CCH A;  1BPY A;  1UA1 A;  4BXO A;  4DLE A;  4X4Q A;  4ECU A;  3C1Y A;  2BPF A;  5J0Y A;  3RJG A;  3EPG A;  4X4S A;  4RQ6 A;  4NKT A;  3H8W A;  4ECT A;  2HW3 A;  7ICV A;  5KG1 A;  5HRG A;  4QWC A;  3RJK A;  2DFL A;  2ZJ8 A;  4ECY A;  1JIH A;  1IM4 A;  2MUT B;  1VFG A;  4GC7 A;  3KHG A;  1X2I A;  3KHL A;  3RBE A;  1SL0 A;  1S77 D;  3OGU A;  2C2D A;  1XU4 A;  2C2E A;  1KFT A;  5DQI A;  1VJ7 A;  4UB2 A;  1B43 A;  2FMQ A;  3GV8 B;  4DOC A;  1U45 A;  3ZDD A;  3QZ8 A;  3UXP A;  2IBK A;  3Q8Q B;  2J6U A;  1SL1 A;  3MFH A;  2XY7 A;  4O5E A;  2MAX A;  4B9V A;  2ZH9 A;  3G6V A;  5J2I A;  4MFC A;  5J2G A;  4IRC A;  4YR3 A;  4BGD A;  3C2K A;  4DOA A;  3WFR E;  1ZQZ A;  2ZTE A;  2AGP A;  1ZQK A;  2ASJ A;  1ZQA A;  1TFR A;  4MFF A;  3V7J A;  3NTU A;  4R65 A;  4I2J A;  2HHS A;  4YQW A;  5KFA A;  4DLG A;  4JV0 A;  3MBY A;  4O3O A;  3PX4 A;  4NM2 A;  2XCA A;  2B21 A;  4KN7 A;  2BCV A;  5KFO A;  2HHX A;  4M5D A;  2HHP A;  1C7Y A;  5J0U A;  4KLT A;  8ICQ A;  4AT7 B;  4DQI A;  3M9O B;  4RWN A;  4YXM A;  4JWM A;  7ICP A;  1CEZ A;  4KLI A;  4DQR A;  1ZQF A;  2FPM A;  5L1I A;  3H8S A;  1ZYQ A;  5KFU A;  2FLP A;  4PPX A;  3C66 A;  4WC0 A;  5DED A;  4P4P A;  1PX5 A;  1RZT A;  5HNK A;  4F5R A;  5DB7 A;  2BPC A;  3RJH A;  4KLD A;  7ICF A;  2I1Q A;  5EWG A;  1JQR A;  3GIL A;  2PXI A;  4J9L A;  5IIL A;  4X0B A;  1IXR A;  4BWM A;  5DB8 A;  1Q79 A;  3EWA A;  3GV5 B;  2P6R A;  3H39 A;  1S0O A;  4WC4 A;  3ORY A;  5J2C A;  4ED2 A;  1ZQB A;  4GXK A;  3PX0 A;  2IHN A;  7ICJ A;  9ICI A;  7ICR A;  4F92 B;  2AU0 A;  4ECX A;  2V4Q A;  2DPI A;  5L1L A;  4IQW A;  2V4R A;  1D9D A;  2DR8 A;  3QEB Z;  4I2F A;  4X4V A;  2NRT A;  4B9U A;  8ICM A;  4ELV A;  4YG2 A;  5DDY A;  4RUA A;  5KG4 A;  4J9K A;  3GFK B;  4EEY A;  5BPC A;  4Q44 A;  7ICI A;  4YMN A;  4WC2 A;  3LK9 A;  3JPN A;  5DDM A;  8ICE A;  4ED6 A;  4LT6 A;  8ICB A;  4BDP A;  1N48 A;  5HRF A;  1ZQY A;  4WC3 A;  4Q43 A;  4F4Y A;  4DL2 A;  5J2H A;  2XGP A;  3WFO A;  4Z6C A;  4I29 A;  4E8F A;  3UQ0 A;  4JWN A;  2JEI A;  2WTF A;  5DGA A;  1A77 A;  4PHE A;  4DF4 A;  1U48 A;  5KFC A;  8ICP A;  4R66 A;  1R8A A;  5EWE A;  3QEA Z;  2BCS A;  3WFS C;  1NJY A;  4F2R A;  1KLN A;  3TAP A;  3L9D A;  8ICJ A;  4YMO A;  4B9L A;  3RR7 A;  4M2Y A;  5KG2 A;  8ICI A;  2HHQ A;  3T5J A;  5D4B A;  4RT2 A;  1KFD A;  5IIM A;  1RYR A;  2FLL A;  5J2A A;  3MGH A;  9ICK A;  4F91 B;  4X4T A;  5JUM A;  4XQ8 A;  5KFK A;  4WBY A;  4X0A A;  3M9M B;  1MQ3 A;  2ISO A;  2RDJ A;  1U4B A;  4I27 A;  2R8H A;  2DPJ A;  5DKW A;  4IQU A;  4JUZ A;  5J29 A;  3LQC B;  3AU6 A;  1KNY A;  4F8R A;  4YD2 A;  1KDH A;  5KFP A;  4F2S A;  8ICO A;  9ICG A;  4R63 A;  3UXN A;  4GXI A;  4X4O A;  4B9T A;  1ZQI A;  1JN3 A;  3UXO A;  1XSP A;  3SV4 A;  9ICP A;  4WC1 A;  4O0I A;  4IG8 A;  2NRW A;  9ICR A;  4J9M A;  9ICJ A;  8ICU A;  1KFS A;  2UVV A;  5KT4 A;  4KLH A;  1NK8 A;  4M47 A;  3H4D A;  1XS9 D;  1NJX A;  7ICH A;  9ICX A;  4FHY A;  1ARO P;  5IIK A;  7ICN A;  1T8E A;  4QW9 A;  3HWT A;  1TVA A;  2ZTD A;  5EOZ A;  3H7I A;  5J0P A;  1TK8 A;  4FBT A;  1BGX T;  5CWR A;  8ICG A;  3PO5 A;  2AJQ A;  4DSI A;  1MIV A;  2AQ0 A;  2HHW A;  4YP3 A;  2KZZ A;  3RJI A;  3RB4 A;  4QZ8 A;  1TK5 A;  3H37 A;  2C28 A;  4Q8F A;  5KFN A;  4RPY A;  4YCX A;  4GLX A;  4KLM A;  1Q78 A;  2P66 A;  1U9L A;  1QLN A;  1SZP A;  3TAR A;  1NJZ A;  3RAX A;  4EBC A;  1K1S A;  2R8J A;  9ICA A;  2DR7 A;  1H38 A;  4FHV A;  4X4N A;  2XGQ A;  3JPR A;  3V72 A;  9ICU A;  4KIT B;  8ICX A;  4ATB A;  1OU5 A;  4EZ6 A;  2JZB A;  5III A;  2AGQ A;  1UA0 A;  2HHU A;  1QSY A;  2ISP A;  4XA5 A;  3PX6 A;  4I2G A;  1UET A;  2F1H A;  4PHP A;  2W9B B;  3GDX A;  4DQS A;  4WC7 A;  2BHN A;  5KFQ A;  2ASD A;  2XY6 A;  2ZUD A;  4P4O A;  4LZG A;  3KTQ A;  1F5A A;  2DR5 A;  4UQG A;  4RPZ A;  5KFX A;  4J9P A;  3ETL A;  4DWI A;  1ZQL A;  4ED1 A;  7ICU A;  2W8L A;  4RUC A;  1UT5 A;  4I2I A;  5HR9 A;  1KRP A;  4QZI A;  3RRH A;  1R8C A;  1S0N A;  3Q8P B;  1JXL A;  3HIY A;  4FHW A;  4DL3 A;  9ICV A;  4DSJ A;  5DG8 A;  2W9B A;  2W8K A;  1NK6 A;  4Z6D A;  5HP4 A;  2JEJ A;  1ZQR A;  4DSK A;  3OVS A;  1NOM A;  2FMP A;  4ELU A;  3QE9 Y;  2M2T A;  3Q8K A;  2DRB A;  4DQP A;  9ICQ A;  4RQ7 A;  3FYH A;  3KHH A;  1DGS A;  4RQ5 A;  1S0M A;  4QWA A;  2NRZ A;  4RU9 A;  3ZDA A;  8ICR A;  5KFE A;  5J2E A;  4M9G A;  4EBJ A;  4ECZ A;  1MC8 A;  2DVI A;  1NKC A;  1TAU A;  2O5A A;  3B0X A;  4ED3 A;  4IR9 A;  1NKB A;  5J2K A;  1KTQ A;  1QTM A;  4YD1 A;  4LZD A;  3M8S A;  1RYS A;  4M9L A;  1UT8 A;  1NK5 A;  3RB3 A;  4KLG A;  4BWJ A;  2VAN A;  3BQT A;  1BPB A;  1X9W A;  4NY8 A;  3BQ1 A;  1WOT A;  4KLJ A;  2IA6 A;  3HP6 A;  3PO4 A;  4UB1 A;  9ICO A;  9ICL A;  4KLE A;  1NK0 A;  4O9M A;  2KZM A;  2NRK A;  1ZET A;  1L3S A;  3QZ7 A;  1JX4 A;  4LVS A;  1R8B A;  5DBC A;  1XC9 A;  5HRI A;  5HMM A;  4RQ0 A;  4RNO A;  3JPS A;  2OWO A;  3EW9 A;  5J0Q A;  1T3N A;  4Z6F A;  2PFQ A;  2VA2 A;  9ICF A;  3MGI A;  3BQ2 A;  1Z00 A;  2FMS A;  2KFN A;  3RBD A;  4EYI B;  4QWB A;  2M9N A;  5TZV A;  4C8O A;  3GQC A;  4NKU A;  2J6T A;  5IIN A;  4EBD A;  1COO A;  4GXJ A;  4K4G A;  4MFA A;  5L1J A;  4YMM A;  2FPK A;  2Q0Z X;  5HHH A;  5J0O A;  4RWP A;  2C2R A;  2IHM A;  3RJF A;  3E2E A;  4IRK A;  5J2F A;  4KLU A;  4PH5 A;  1DK3 A;  4PHD A;  2VA3 A;  2PI4 A;  4RPX A;  2DRA A;  3Q8R B;  1Z00 B;  4YR0 A;  3G6Y A;  3UQ2 A;  1L3V A;  4NM1 A;  2KTQ A;  4WBZ A;  3OV7 A;  4DFK A;  4K4H A;  2JEF A;  2RFF A;  2ZUC A;  2HVI A;  3C5F A;  2BKE A;  5KFY A;  4KN4 A;  1HUO A;  3JZ0 A;  4C8L A;  4JV2 A;  2NRV A;  4QWD A;  3C21 A;  1R89 A;  8ICY A;  4AT9 A;  3AQN A;  4AT7 A;  1LV5 A;  2W9A A;  4UAW A;  7ICS A;  4FS2 A;  3Q8S B;  5KFT A;  2W9M A;  4M9H A;  4ZH4 A;  2A1J A;  2FPL A;  3PVX A;  4I2C A;  1PZN A;  1BVS A;  1A76 A;  2F1I A;  4Z6E A;  3ZD8 A;  3IHQ B;  3NGD A;  3OSN A;  5DLF A;  4UD5 A;  4QZ9 A;  5KTQ A;  2XO7 A;  3GIK A;  3OJS A;  4DL7 A;  4UB4 A;  5KFW A;  5HRE A;  2BCR A;  4DFJ A;  4KLS A;  3SV3 A;  3AU2 A;  5KFS A;  4X5V A;  5KG5 A;  3RJE A;  4E80 A;  4QW8 A;  9ICC A;  1S10 A;  5DQH A;  1RXW A;  2ZUB A;  1S0V A;  3LDA A;  4DQQ A;  2O1P A;  5EWF A;  4EP7 A;  1U47 A;  4YR2 A;  5KFL A;  1XSL A;  2UVU A;  3Q8L A;  2KP7 A;  2GWS A;  4R64 A;  5L9X A;  1ZQM A;  4YXJ A;  1S76 D;  2KFZ A;  7ICK A;  4JK1 A;  2M2W A;  1FA0 A;  4Q45 A;  1X9S A;  2HVH A;  2R8G A;  1BPE A;  5CA7 A;  3RB6 A;  1D9F A;  4RQ4 A;  4DFP A;  3PR5 B;  3MR5 A;  2UVR A;  4RWO A;  4I28 A;  7ICQ A;  1NO5 A;  1NK4 A;  4FBU A;  4WCW A;  2I9G A;  4EBK A;  4QZE A;  4FH3 A;  3TFR A;  4BXO B;  4UAZ A;  4DS4 A;  2LYH A;  4EYH B;  1NK9 A;  1YLQ A;  4O3P A;  3HPO A;  2DR9 A;  8ICC A;  7ICM A;  9ICB A;  5KFJ A;  3K75 D;  1BPD A;  5KFR A;  3MR2 A;  4F5N A;  4ECR A;  1RXV A;  1QSL A;  2ZHA A;  3B0Y A;  5DB6 A;  5KT7 A;  5KT2 A;  3WFQ E;  3HW8 A;  5DG9 A;  3WFP A;  4NLG A;  1DK2 A;  2F1J A;  4I2E A;  1S97 A;  2M2V A;  3RAQ A;  1L3T A;  1ZQO A;  4F3O A;  3HJ4 A;  2RDI A;  3AQK A;  4QZG A;  3N4M B;  4F5O A;  2R8I A;  3MFI A;  4M6W B;  3AUO A;  3ZD9 A;  1ZQE A;  5HHI A;  4O5C A;  5HC9 A;  4PHA A;  5J2D A;  4TUS A;  1BPX A;  4ED0 A;  8ICZ A;  3SYZ A;  5DEC A;  4RQ8 A;  8ICH A;  5KG6 A;  5J0S A;  3TI0 A;  4WC6 A;  5BOL A;  2ZH5 A;  2ZHB A;  1TKD A;  1ZQS A;  1HUZ A;  5DB9 A;  4UBC A;  5J0T A;  2HHV A;  3V7K A;  4DL5 A;  4ELT A;  5HRK A;  3T3F A;  4RNM A;  8ICS A;  9ICW A;  3MR6 A;  2PBE A;  9ICS A;  4QZD A;  4HYK A;  4M6W A;  4R8U B;  3SZ2 A;  2AQ4 A;  1RPL A;  4J9S A;  1TK0 A;  1SKR A;  5KFI A;  2XY5 A;  3PW5 A;  5J2B A;  4O3R A;  4NLZ A;  1TAQ A;  2PFP A;  5KFF A;  3PW7 A;  3ISB A;  4F4W A;  4FS1 A;  2IMW P;  2JEG A;  3ZDC A;  3GIJ A;  4IRD A;  5F2V O;  1NK7 A;  4IQT A;  2R8K A;  3RH4 A;  8ICN A;  2BQU A;  3V6K A;  1UEU A;  1TV9 A;  1ZQD A;  3C18 A;  1HJP A;  4O3Q A;  4M04 A;  1SL2 A;  2KN7 A;  5DG7 A;  3JPO A;  1SKW A;  3HX0 A;  4TQS A;  8ICV A;  1NKE A;  4J9O A;  9ICN A;  1JXE A;  4NLN A;  5DBB A;  5J0R A;  4J9R A;  7ICO A;  3H38 A;  4R8U A;  3BDP A;  4RZR A;  4I2B A;  3GIM A;  1T4G A;  9ICM A;  4FH5 A;  4S3N A;  4UBB A;  3Q8M A;  1ZQN A;  3ISD A;  1MIY A;  4C8N A;  3IM1 A;  3N97 B;  4ATB B;  2VA8 A;  4TQR A;  3TQ1 A;  7ICG A;  1X9M A;  7ICE A;  4UB5 A;  1MIW A;  1ZJM A;  2AGO A;  3TAN A;  4X4U A;  2BR0 A;  3OSP A;  2UVW A;  5KFV A;  4WC5 A;  1D8Y A;  1KEJ A;  4NXZ A;  5HML A;  4F5P A;  4PGY A;  4ED8 A;  4C8M A;  4KLL A;  3C23 A;  4K4I A;  5KFG A;  2NRX A;  2ZH6 A;  3G6X A;  2ZH7 A;  1ZQG A;  2ID1 A;  4PGX A;  4DL6 A;  4O5K A;  5CJ7 A;  5KT6 A;  3THV A;  3EYZ A;  3AQM A;  4YN4 A;  3T5L A;  1ZJN A;  4ECW A;  4ECQ A;  5CHG A;  5IIO A;  1ZQX A;  3V6H A;  5KFM A;  1N56 A;  1NZP A;  2ZH3 A;  4B9S A;  2BE3 A;  4XUS A;  2PI5 A;  9ICH A;  1U49 A;  2ZJA A;  1K1Q A;  5J2J A;  1ZQW A;  3OHA A;  4F4Z A;  3RH5 A;  4O3S A;  1V9P A;  3PMN A;  2M2U A;  3AQL A;  3HJ1 A;  3PML A;  3JPP A;  3MAB A;  5CR0 A;  3PW2 A;  4MEX A;  1JAJ A;  3K4G A;  4I2H A;  2ATL A;  4QZA A;  3PR4 A;  2ZH4 A;  5KFB A;  3LWL A;  3ZDB A;  5HRL A;  1XWL A;  5IIJ A;  3HT3 A;  4DO9 A;  4RWQ A;  2PFN A;  3OHB A;  3RR8 A;  1EXN A;  3BJY A;  1Y88 A;  4MEY A;  3UPQ A;  1ZQQ A;  2BGW A;  5HRH A;  5DQG A;  5HRD A;  2XC9 A;  4TUR A;  4MF8 A;  2Y1J A;  7ICT A;  1ZQV A;  3GII A;  1T7P A;  1V4A A;  1L3U A;  1ZQH A;  1ZQJ A;  4UD4 A;  2ZH8 A;  3PW4 A;  2BCU A;  1XSN A;  3C1Z A;  4DSF A;  1BPZ A;  4B9N A;  1KSP A;  5KG0 A;  4F93 B;  1S9F A;  4C8K A;  4DEZ A;  1WCN A;  4KTQ A;  2HHT A;  5DGB A;  3PW0 A;  7ICL A;  3PNC A;  1CUK A;  2ZJ5 A;  5KT5 A;  4TUQ A;  3V7L A;  1MQ2 A;  1LB2 B;  5KG3 A;  4E7X A;  5CP2 A;  4F4K A;  4M9J A;  3EPI A;  3UPS A;  1L5U A;  1MSW D;  5KG7 A;  3BQ0 A;  3OVA A;  5BOM A;  1D8L A;  5C5J A;  4PGQ A;  4UAY A;  2ASL A;  3RRG A;  5DLG A;  1TFW A;  2KZ3 A;  4DSL A;  3RJJ A;  4J9N A;  4TUP A;  4F5Q A;  2C22 A;  1QSS A;  1BNO A;  3T5K A;  3H4B A;  2PFO A;  4J9Q A;  4ED7 A;  1ZQU A;  8ICW A;  4ECS A;  3T5H A;  1SKS A;  1JMS A;  4KMU A;  4QWE A;  1ZQP A;  8ICA A;  4DF8 A;  5D46 A;  4GC6 A;  4P2H A;  4B9M A;  1TFY A;  4YFK A;  2BDP A;  1WCL A;  4RQ3 A;  4QZH A;  3JPQ A;  3C5G A;  4QZF A;  3C2L A;  4RQ2 A;  4G3I A;  4Q8E A;  3KHR A;  5L1K A;  3M9N B;  3JYY A;  5KFD A;  4EBE A;  4FO6 A;  3OUY A;  3GV7 B;  2JZB B;  4AT8 B;  3FDS A;  4QZB A;  3OJU A;  3TAQ A;  3H40 A;  3H8J A;  4DSE A;  8ICF A;  1NJW A;  3TFS A;  4DS5 A;  5F9L A;  4AT9 B;  2BQR A;  2Y1I A;  2W9C B;  3SI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...