4MF8A

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ctp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
318
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
total genus 103
structure length 318
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf8A03
4KLSA 4RT3A 4R64A 3WFOA 4R8UA 9ICTA 4X4PA 5DGBA 1EXNA 3G6VA 8ICUA 1NK6A 2FPMA 4M5DA 4UB4A 1ZQQA 3C2KA 1ZQNA 3OGUA 4ECTA 4GLXA 2PFPA 1CEZA 5KFHA 4X4VA 3NTUA 1SKWA 4J9NA 3ISCA 2F1JA 3C5GA 4ED2A 2IHMA 5CB1A 4F50A 8ICWA 4O0IA 2VA3A 3G6XA 1ZQFA 4PHPA 2M2VA 1MIYA 4YCXA 3RJJA 5HR9A 2HVIA 4RUAA 4KLIA 2ZH8A 1NK5A 5J2CA 1MQ2A 5CP2A 4RQ8A 1SKRA 5KFVA 1ZQOA 2BCSA 1QSLA 4ECWA 2DR9A 3PX0A 4P4PA 4FHPA 3ZDDA 3UPSA 5D4BA 5KFCA 5J2HA 1ZQVA 4X5VA 2J6SA 4CCHA 1KFDA 1D8LA 2RDIA 4DSLA 3HJ1A 1XWLA 4S3NA 5KFPA 3KHRA 5L9XA 2MAXA 4G3IA 1NK8A 4UB3A 2PI4A 5KT4A 5DBAA 4RPYA 3H4BA 4YVZA 4YG2A 2KFZA 2DPIA 3RAQA 8ICNA 4RWNA 4F5QA 2KFNA 3RBDA 3OVAA 4KLJA 3C5FA 3ZD9A 2JEIA 8ICZA 4DOAA 1BNPA 3WFRE 3M8RA 2ZUDA 1ZJMA 1JAJA 4F2SA 9ICQA 3EW9A 5KG4A 4B9VA 4LZGA 2DVIA 4FH3A 2JEFA 4WC7A 5KFFA 1Q79A 2KZZA 3OHAA 1DOQA 5HHIA 2BCRA 9ICJA 4IQWA 1NK9A 3V6HA 1S10A 1UETA 5CA7A 2P6RA 4ATBA 4BDPA 4I2EA 3UQ2A 4MEYA 3PR5B 2R8IA 4ED8A 2KTQA 2DR8A 2JZBA 3H4DA 3GV5B 4MEXA 7ICFA 5KFLA 4F93B 1T3NA 1XC9A 4C8NA 1L5UA 7ICQA 4O5EA 3HP6A 4X0AA 2XY7A 4PGQA 3NYBA 1FA0A 4RQ3A 4GXIA 1T7PA 3SV3A 1ZQUA 3FDSA 3LK9A 5L1LA 3T5KA 7ICVA 3KHLA 9ICSA 4I2DA 4P4MA 2KZMA 5HP4A 2B21A 4IQVA 4R63A 3N97B 3H3AA 1Z00B 5DQHA 1XO1A 3Q8PB 5KFTA 3T5JA 2ZH6A 3SI8A 2HW3A 1NJYA 4WC2A 1X2IA 3RRGA 4YFKA 2FLPA 3NGDA 1ZJNA 3QEAZ 4M6WB 4X4OA 4J9QA 4O3PA 1RXVA 2FPKA 1KLNA 2BQUA 4QZFA 2ZH3A 5J0YA 4J9OA 3C21A 4XUSA 4DWIA 2O1PA 3MDCA 1ZQYA 4E80A 2ZH9A 2Q66A 5J2DA 4EBCA 7ICGA 5DLGA 4AT7A 3MABA 4DQSA 4X4NA 4RQ6A 2ZJAA 7ICLA 4DSIA 4I2GA 3ZD8A 3ZDEA 4RPZA 2XCPA 4DL7A 4F5OA 4IRDA 3OUYB 1HUOA 3GIKA 4AT7B 5KFJA 9ICKA 9ICNA 4NM1A 4PHDA 3QZ8A 3PO4A 2ZTCA 5KFAA 2HHXA 1UT5A 3RJIA 4TUSA 5J0SA 1JX4A 4JK1A 5EWGA 4DS4A 1JIHA 5KG2A 2XO7A 1QSSA 4UBCA 9ICHA 2XY6A 1R8CA 2BDPA 4KLOA 1MIVA 2IMWP 1ZQAA 4QZAA 3LQCB 3H39A 3PR4A 4R65A 3JPPA 3V6KA 4DF4A 2C22A 1U45A 1TK0A 4QW8A 2XGPA 3T3FA 5D46A 3IM1A 1NJZA 2AGOA 7ICJA 4F8RA 4NKTA 4DFMA 3SV4A 2IHNA 4DFKA 2HHUA 2ASJA 4E7XA 2BR0A 3C1YA 9ICBA 3KHHA 3UPQA 4JWMA 3JPQA 4IQTA 8ICMA 2ZHBA 1DK2A 5DEDA 4PHAA 1L3SA 3PW7A 2NRWA 4EBKA 4UAYA 1R8AA 4B9NA 3HPOA 1DGSA 9ICLA 1MSWD 3G6YA 3HIYA 4AT8B 5BPCA 4QWAA 4BGDA 5F9NA 5KFUA 3C2MA 2BPGA 2J6UA 8ICVA 4M9JA 2P66A 2V9WA 5J0WA 4GC7A 3FYHA 4UAWA 4JUZA 4F4WA 2ASLA 4X0BA 1TFYA 2PFNA 2M2UA 8ICJA 4XRHA 8ICAA 5KT6A 3RJFA 3OV7A 5KFWA 3HW8A 1BPDA 5HMMA 3OJUA 1L3TA 3ZDBA 4YQWA 4C8OA 3PY8A 4R8UB 2W9CA 2HHPA 3AQMA 2P6UA 4Q43A 4RWPA 4F5PA 1SL2A 9ICIA 4YP3A 3H8JA 3RR8A 4UQGA 4AT9A 5J2BA 4YD1A 4J9SA 9ICCA 2I9GA 3RR7A 2M2WA 1X9SA 3GILA 1R89A 4ED3A 4B9LA 3GIJA 4P2HA 2BPFA 4AT9B 4M04A 5JUMA 4RUCA 3C1ZA 3H38A 2VA8A 1SKSA 2ZUBA 3AQKA 9ICAA 4DL3A 2VANA 4I2AA 4KN7A 2UVRA 2I1QA 4YMOA 1TVAA 3AQLA 4O3OA 4R66A 4LVSA 5J2KA 4M9LA 1X9MA 2R8GA 4MFFA 1V9PA 1Z3EB 1RYRA 4KTQA 1H38A 1NK0A 4KN4A 2BQRA 5KG1A 4WC0A 4IRKA 8ICHA 1KRPA 5HRBA 3LWLA 3AU6A 1T8EA 1RXWA 1HJPA 4QWCA 4TUQA 1ZQXA 8ICIA 5KG0A 3JPOA 4NXZA 4O5CA 4KLGA 4E0DA 4NLZA 2DR5A 4KLUA 2MUTA 1UEUA 4X4UA 2W8LA 2PFOA 5CWRA 8ICBA 4ECXA 4XQ8A 4FHYA 2DRAA 5KFDA 1ZQBA 5KFIA 3RH6A 4TQSA 2FPLA 1TAQA 3MR3A 3TQ1A 3GQCA 3OJSA 4DFPA 4TURA 1OU5A 4QZBA 4DQIA 4QZHA 3RTVA 2HHWA 1CUKA 4RNOA 4JV0A 5J0QA 4ATBB 5DB7A 1D9DA 7ICRA 4EEYA 4EZ9A 2XC9A 3MR6A 4WC5A 2JZBB 1BPZA 4TQRA 5HNKA 3PMLA 2W9MA 2W9AA 1SZPA 3UXPA 3QZ7A 4UAZA 2FLLA 4Z6FA 4NLGA 4QWDA 2LYHA 5BOMA 3WFQE 3EYZA 3B0XA 1UA0A 3BJYA 9ICOA 4XQ7A 4DL4A 4X4SA 4F5RA 5KT5A 2C28A 7ICPA 3JPNA 4DO9A 4YXJA 2FMQA 4DFJA 1NJWA 4F3OA 3PW2A 4Q45A 3M9MB 4X4RA 9ICGA 4EYHB 3K4GA 2JEJA 2NRTA 4DQQA 4ECRA 1ZQKA 7ICHA 4Z6EA 3TANA 3TARA 1NK4A 2PFQA 4ECSA 5F9LA 3THVA 3T5LA 1N48A 3RB3A 5J29A 2WTFA 5IIJA 4FH5A 4KMUA 1KFSA 4Z6DA 5CJ7A 4E8FA 8ICTA 4DS5A 9ICVA 3C23A 5KFXA 1NZPA 2KN7A 4ZH4A 1BVSA 1KSPA 1XU4A 5KFZA 5HRGA 5J0RA 4EZ6A 1JN3A 4IR9A 4JV2A 4J9KA 4DLEA 3BQ0A 3OVBA 1L3VA 2AQ4A 1NKCA 1KTQA 5HRFA 2HHTA 1QTMA 7ICIA 4C8MA 3PNCA 9ICMA 4F4ZA 4UB2A 8ICKA 4WC3A 3QE9Y 4NY8A 5J0TA 5DECA 5HMLA 9ICUA 3Q8MA 4BWMA 3MDAA 1BPEA 4YR3A 1UT8A 2V4QA 1JQRA 4B9MA 4RQ5A 2BQ3A 3PMNA 3IHQB 3HT3A 4KLMA 2ALZA 5KFMA 3RB4A 4PHEA 8ICFA 3PVXA 5KFKA 3V72A 4DEZA 3TFSA 2DPJA 4WC1A 3WFSC 3AUOA 2KP7A 4K4HA 4EYIB 1LV5A 4TUPA 3N4MB 1WOTA 2IA6A 3HX0A 4YMNA 1NK7A 4LZDA 1K1QA 5L1KA 1NKEA 2C2RA 4O3RA 4F4YA 8ICRA 1SL1A 1NO5A 5KFSA 4DSFA 5J0OA 3Q8RB 3QEBZ 4I2BA 4KLFA 1ZQLA 5DBBA 3WFPA 5KG7A 3Q8LA 2HVHA 8ICEA 4J9PA 3RJGA 9ICXA 3M9OB 9ICWA 4DSEA 3BQTA 4I2HA 3V7JA 2AU0A 1ZQPA 9ICEA 1PX5A 3HWTA 3Q8QB 4B9TA 4WBYA 4MFCA 1R8BA 5KG5A 2PXIA 1F5AA 2ZTDA 4UB5A 2PBEA 4UD5A 4QZ8A 1ZQJA 3M9NB 5KFNA 3GFKB 3BQ1A 3SZ2A 1D9FA 5KT3A 3AQNA 1WCNA 1JMSA 5DB8A 5DQIA 1S0OA 1U47A 2M9NA 3ZDCA 3UXNA 1S76D 5HRIA 4J9LA 2ZUCA 4Q8FA 1TAUA 4DQPA 1TV9A 4O3NA 3PX4A 8ICQA 4KLTA 1B22A 4WC6A 4QWBA 3ORYA 3EPIA 2W9CB 1XSPA 4WBZA 4WC4A 4GXKA 4PGYA 5DBCA 5DQGA 3MR5A 5L1IA 4ECQA 3MBYA 3LDAA 5KG6A 5KFEA 2J6TA 4BXOA 7ICEA 5HC9A 2ISPA 5J2FA 2Q0ZX 8ICYA 2RDJA 1V4AA 2DFLA 4BXOB 1BPXA 4DSKA 2BCQA 4IRCA 5DKWA 1B43A 1NJXA 4NLKA 4RQ1A 4NLNA 2HHQA 5IIKA 7ICOA 3RH5A 3EZ5A 2AGQA 2NRXA 4ED7A 2C2EA 1RZTA 4F4KA 5HREA 3JYYA 1K1SA 2ZH5A 3EWAA 1KNYA 4IG8A 4MFAA 4C8LA 4GC6A 1JXEA 4DF8A 3H37A 3ISDA 1A77A 4RT2A 1L3UA 4K4GA 4EP7A 5BOLA 2OWOA 4QZEA 4KLEA 5J2IA 4HYKA 1TFRA 4IQUA 3T5HA 4RZRA 3RJEA 2DR7A 1TFWA 4UBBA 4J9MA 4M2YA 5HRHA 3ZDAA 1T4GA 3OSPA 1VFGA 4XA5A 3LWMA 5IINA 3TAQA 1C7YA 1ZQIA 2HHSA 3ETLA 2ZH4A 5HRLA 4YR0A 1BPYA 2NRZA 1MQ3A 2MUTB 5J0UA 1S0NA 2GWSA 4IR1A 1BNOA 3GIMA 4YXMA 4BWJA 4DOCA 5L1JA 9ICPA 5KFOA 4F2RA 4DL5A 3L9DA 4M9HA 4M47A 3B0YA 3MFIA 1MC8A 2W9BA 4GXJA 4ELUA 8ICSA 4FHVA 2A1JA 5DB9A 1NOMA 5J0PA 2AGPA 1X9WA 1S97A 4NM2A 1N56A 2ASDA 1ZQCA 1SL0A 4FBTA 8ICLA 1RYSA 4YD2A 1Q78A 2ZJ8A 1KEJA 3BDPA 5KT7A 3C18A 5KFYA 2H5XA 2KZ3A 2W9BB 3MGHA 2ATLA 4I2FA 1ZQSA 4FHXA 2A1JB 5DG9A 3V6JA 2AJQA 7ICSA 2BPCA 1COOA 2F1IA 1RPLA 5J2GA 5IIOA 5J2AA 3RRHA 4ECVA 2VA2A 2DRBA 8ICOA 3GV8B 3PW5A 5D49A 2ZJ5A 1ZQGA 3JPSA 2XY5A 3OVSA 2C2DA 5KTQA 5DG8A 8ICXA 1BPBA 9ICFA 5DGAA 1DK3A 3JPTA 4RU9A 3TAPA 2IBKA 4QZ9A 4M9NA 1U9LA 3H8SA 1LB2B 4FS2A 4RNMA 1TK5A 4M0AA 2ID1A 3M8SA 4X4QA 4YN4A 4DLGA 2HHVA 4P4OA 4QWEA 4I2JA 5CHGA 3SYZA 4DL2A 5EOZA 3TI0A 3C66A 4DOBA 8ICPA 3RH4A 1U4BA 4KLQA 5DDYA 2R8HA 4F91B 4QW9A 3PW4A 2FMSA 3RBEA 2R8JA 1UEVA 1Z00A 4KITB 5KT2A 3BQ2A 2BCUA 4DSJA 3UXOA 2Y1JA 4B9SA 5DB6A 4Q8EA 5J2EA 4UB1A 1YLQA 2ZH1A 1KFTA 7ICNA 5DLFA 3PV8A 1XS9D 3MGIA 4I2IA 5DDMA 4J9RA 4PPXA 3E2EA 8ICGA 3H7IA 2ZH2A 4RWOA 3JZ0A 1D8YA 4M6WA 5HRKA 4EBJA 4QZIA 5KFQA 1XSNA 2ZH7A 2PI5A 4DQRA 4ED1A 3TFRA 1U49A 8ICCA 1BGXT 3PW0A 5KFGA 4YR2A 1S77D 3Q8SB 1KDHA 3KHGA 4I29A 4O5KA 1MIWA 4X4TA 1AROP 5C5JA 4KLDA 3MR2A 1ZQWA 4PGXA 1ZQRA 4RWQA 2FMPA 4RQ7A 5EWFA 4LT6A 4KLHA 1PZNA 3OUYA 3RAXA 3RB0A 1ZETA 7ICMA 4FO6A 1Y88A 4PH5A 4I28A 7ICTA 2ISOA 2XCAA 4I27A 4K4IA 3H8WA 1A76A 1TKDA 4FHWA 3UQ0A 5KFRA 4DL6A 1S0MA 4JWNA 1ZQDA 1ZQHA 4JV1A 4EBEA 4ED0A 1TK8A 2V4RA 5IILA 4RQ2A 4MF8A 2W8KA 4I2CA 1NKBA 4M9GA 3AU2A 3MFHA 4F92B 1ZQEA 4C8KA 4O9MA 4ED6A 5TZVA 4UD4A 2UVVA 4RNNA 4ECZA 2NRVA 3C2LA 1XSLA 1ZQZA 4ECUA 4QZCA 5IIMA 4MF2A 5HRDA 1VJ7A 2ZHAA 3V7LA 5KFBA 5J2JA 2F1HA 1UA1A 2FLNA 4ELVA 3OHBA 5CR0A 4EBDA 2Y1IA 1S9FA 4O3SA 4RQ0A 2BKEA 4QZDA 3GV7B 1JXLA 1QSYA 3RB6A 4Z6CA 2UVWA 2UVUA 3OSNA 1IXRA 5HHHA 4QZGA 5DG7A 1ZQMA 4ELTA 4F5NA 5J0XA 3PO5A 2BCVA 4B9UA 1S0VA 2NRKA 4Q44A 4ECYA 7ICKA 1U48A 7ICUA 4AT8A 1ZQTA 2BE3A 1WCLA 9ICRA 4O3QA 2O5AA 2XGQA 3HJ4A 3GDXA 4F4XA 3RJKA 2M2TA 1QLNA 2JEGA 3KTQA 3RJHA 4KLLA 2AQ0A 3Q8KA 4FS1A 5IIIA 2BGWA 3K75D 4RQ4A 3H40A 1ZYQA 2RFFA 3ISBA 2BHNA 2ZTEA 1HUZA 5EWEA 3PX6A 4WCWA 5F2VO 3JPRA 3V7KA 4RPXA 5KG3A 3EPGA 1IM4A 2R8KA 3GIIA 4FBUA 4YMMA 4NKUA
chains in the Genus database with same CATH superfamily
3LVWA 8ICUA 4OAFA 2ZIXA 4LEWA 3OGUA 4ECTA 2F8LA 4UATA 2IHOA 2E1EA 2VIXA 5AIAA 3C5GA 5CB1A 4O0IA 5EE9A 4PHPA 5HR9A 2ZH8A 1MQ2A 5J2CA 4RQ8A 1SKRA 1JUDA 4KX5A 1ZQOA 4ECWA 4P4PA 2Q4TA 5D4BA 1ZQVA 2RDIA 5ALVA 1XWLA 4S3NA 5L9XA 4UB3A 3H4BA 5ALXA 4YG2A 2LYBA 3C5FA 3ZD9A 8ICZA 3M8RA 4UAVA 3EW9A 4B9VA 2DVIA 4FE3A 2F44A 4EEDA 1ZOLA 3V6HA 4ATBA 3N7SC 4I2EA 3QUCA 1Z4NA 3BS5A 1XC9A 4NXVA 3HP6A 4X0AA 4GXIA 3SR6A 2I6XA 1ZQUA 5L1LA 3T5KA 4I2DA 4P4MA 1PVRA 2B21A 2KNJA 4IQVA 3H3AA 2JXJA 5KFTA 2ZH6A 1RQNA 3RFAA 4WOYA 1A0PA 1X2IA 4YFKA 2K4EA 3QEAZ 3CYMA 4J9QA 2FPKA 1UPHA 2W43A 2BQUA 4J9OA 4XUSA 2O1PA 3MDCA 1ZQYA 2ZH9A 2B51A 3M6KA 4I2GA 3ZDEA 4F5OA 9ICKA 4NM1A 3CRXA 5KFAA 4K9AA 2KIVA 1TFYA 1QSSA 2EZYA 1R8CA 4KLOA 3DEEA 1ZQAA 3LQCB 2BBHA 2LPEA 3PR4A 1U45A 3T3FA 3UMBA 2AHOB 1YZ6A 4DFKA 2HHUA 2ASJA 3C1YA 2HSZA 3UPQA 1Z19A 4JWMA 2KVCA 1X6IA 2JH1A 2DGZA 1DK2A 4EBKA 3ETRA 4UAYA 4B9NA 9ICLA 4QWAA 2J6UA 5KFUA 2WAQC 4M9JA 2EH9A 2DQNB 4JUZA 2M2UA 4XRHA 1ECWA 1BPDA 1WUDA 4NXWA 2KEYA 4WQLA 4C8OA 4F5PA 5KL1B 4YP3A 3RR8A 4UQGA 2W3RA 4J9SA 4YD1A 3RR7A 3A0BU 1QQ7A 1O08A 5ALWA 1Q8KA 3GIJA 2PMZC 3QU4A 2ZUBA 1IV8A 2MA1A 1N5XA 2UVRA 4O3OA 4PL1A 4LVSA 3NVOA 4M9LA 2K4PA 1NK0A 4GIBA 2BQRA 5KG1A 1KRPA 1VLBA 2YN4A 4QWCA 4TUQA 1ZQXA 8ICIA 3AMZA 4O5CA 5C0YA 4KLUA 2W8LA 4ECXA 5KFIA 4OJ5A 5ALSA 3WU2U 3RTVA 4EEYA 2W7OA 2XC9A 4UAUA 2JZBB 5HNKA 2W9AA 1SZPA 1V85A 3C28A 2YMMA 2F8KA 3WFQE 3B0XA 4XQ7A 4JB3A 1TAMA 5AHXA 4DO9A 2FMQA 4DFJA 4X4RA 4CNQA 1GO3F 1Q3UA 2NRTA 5B5EU 4ECRA 4DQQA 4Z6EA 3TARA 4ECSA 1QQ5A 1S8OA 4O3MA 1N48A 3RB3A 4FH5A 4E8FA 8ICTA 1NZPA 3E58A 4ZH4A 1BVSA 5AM5A 5KFZA 5J0RA 3N7RC 1JN3A 4J9KA 1KTQA 4DFDA 3TADA 1QTMA 3IV6A 9ICMA 5L1MA 3QUQA 5J0TA 5HMLA 9ICUA 3Q8MA 4BWMA 1BPEA 4YR3A 2V4QA 3PSTA 2YMLA 2K89A 2GA9D 4KLMA 2G06A 1D8BA 4PHEA 3TFSA 3I28A 2KP7A 4TUPA 1Q46A 4YMNA 3HX0A 4CGZA 5HR7A 2C2RA 4F4YA 2JHDA 1SL1A 5KFSA 4DSFA 3QEBZ 4I2BA 9ICXA 5EE3A 9ICWA 2IOFK 4DSEA 2ZXIA 4I2HA 1L6NA 1ZQPA 3B9JA 4P0QA 1F5AA 2ZTDA 2PBEA 1ZQJA 1JRPA 4OD0A 5KFNA 3KKAC 2WB1C 2GLEA 1JMSA 2ZIVB 3LYSA 5DQIA 1U47A 2M9NA 3ZDCA 3UXNA 1X42A 4O3NA 5B3QA 5AKEA 1L7MA 8ICQA 2KV2A 4WC6A 3EPIA 1XSPA 3QU9A 4PGYA 5DBCA 3MR5A 8ICSA 2J6TA 3MBYA 3LDAA 5J2FA 2RDJA 2DFLA 5ALNA 4BXOB 4MKPA 2LM1A 3WKCA 1M6YA 1NJXA 7ICOA 1K1SA 2ZH5A 4MFAA 4C8LA 4DF8A 5BOLA 2OWOA 4QZEA 1X9XA 2K8AA 4HYKA 2DR7A 4RZRA 2DKZA 5HRHA 3ZDAA 3F53A 5IINA 2HHSA 4OO1J 2KK0A 3ETLA 4YR0A 1MQ3A 1AQ6A 2MUTB 5J0UA 2GWSA 3GIMA 4DOCA 4UB6U 5KFOA 1VJ5A 1PUZA 2D6FC 1MC8A 2HN1A 4NM2A 2ASDA 4YD2A 2ZJ8A 3E0FA 4I2FA 2H5XA 4FHXA 3AQFA 5DG9A 8ICOA 2ZJ5A 1ZQGA 2IBKA 4RU9A 4NL9A 3SD7A 4UW9A 2ID1A 2HHVA 2JR5A 2FI1A 1U4BA 3PW4A 2FMSA 2F2AB 2BCUA 2Y1JA 2ZH1A 1XS9D 3MGIA 2G0AA 3NRWA 5DDMA 4PPXA 3JZ0A 3J81j 1LKYA 1D8YA 2ZH7A 8ICCA 5CFUA 1BGXT 4YR2A 5AIBA 2RRDA 1MIWA 4O5KA 5B66U 2QKQA 2E1FA 1AROP 3MR2A 2DUYA 3LVVA 3RAXA 4F71A 2XCAA 4K4IA 3H8WA 2I5HA 5KFRA 4JWNA 1ZQHA 5EE0A 4I2CA 4G9BA 3AU2A 4UD4A 3L4PA 2UVVA 4ECZA 2NRVA 3C2LA 2H3QA 1VJ7A 3BZCA 4UASA 5J2JA 1K5OA 2F1HA 4EEKA 3OHBA 4EBDA 2KZMA 1JXLA 2UVWA 4WBZA 3RB6A 4NY8A 4ELTA 2DRAA 5HHHA 5J0XA 3PO5A 1S0VA 4Q44A 2M0NA 4AT8A 5CEHA 2BE3A 2O5AA 3HJ4A 3GDXA 1QLNA 4KLLA 2BGWA 1XNSA 5IIIA 4RQ4A 3JPRA 5KAIU 1IM4A 3GIIA 4R64A 3WFOA 4R8UA 4X4PA 5DGBA 3CNHA 2LYAA 3PZPA 4X4VA 5KFHA 1JALA 2QB0A 4ED2A 8ICWA 2VA3A 1FO4A 1MIYA 4YCXA 2PKEA 3RJJA 5D62A 3SEIA 2BCSA 1WWUA 4FHPA 3ZDDA 2W7PA 3UPSA 1VDVA 5AM1A 1Z1BA 2HBLA 2MAXA 2PI4A 5KT4A 5DBAA 4RPYA 2ZIUB 3T79A 4KB6A 1FEZA 4C4SA 3RAQA 2KFNA 4KLJA 5ALGA 2ZUDA 1ZJMA 4RQMA 4F2SA 9ICQA 5KG4A 1JAJA 2XVTA 4LZGA 2JEFA 2F3NA 2Z7JA 1Q79A 2KZZA 2NO5A 2P6RA 3UQ2A 4MEYA 1RDFA 2R8IA 3UMGA 2CXYA 7ICFA 5KFLA 1T3NA 1L5UA 2XY7A 3AN1A 3WKAA 2F76X 3LK9A 1JI7A 2E8PA 5HP4A 3N97B 1XO1A 1NJYA 3F2BA 4IC9A 1RXVA 1V97A 4QZFA 2ZH3A 7ICGA 4EBCA 3K7DA 2K4HA 5DLGA 3MABA 4DQSA 4AT7A 4X4NA 4QJFB 3ZD8A 4K96A 2XCPA 5AI9A 4PHDA 3PO4A 4PL2A 3A0HU 4DS4A 1JIHA 2XO7A 4UBCA 9ICHA 2XY6A 4EX7A 5ALMA 2QARA 3JPPA 1TK0A 1PK1B 1YT3A 5CHEA 2XGPA 4NXUA 5D46A 3IM1A 2AGOA 7ICJA 4F8RA 1N62A 2DBYA 4DFMA 2RLTA 9ICBA 2ODGA 3EUB2 4IQTA 2B6GA 4OJLA 4NXTA 4CDGA 4U6PA 3L3FX 3PW7A 1COKA 1R8AA 2WFAA 1DGSA 1MSWD 3G6YA 3SAHA 5BPCA 4BGDA 4OAIZ 3FYHA 2VJ5A 4UARA 5KT6A 3OV7A 5KFWA 3HW8A 5HMMA 2ZIWB 1L3TA 3ZDBA 4YQWA 3WK5A 2W9CA 3AQMA 2P6UA 9ICIA 5AICA 9ICCA 2CN1A 2I9GA 3QXGA 4ED3A 2EZXA 4M04A 5JUMA 2KICA 2VA8A 1OW5A 3JCFA 3KBBA 2VANA 4I2AA 3NASA 4KN7A 3AQLA 2ES6A 4OAGA 5J2KA 2R8GA 3MC1A 1Z3EB 1H38A 2E8MA 4IRKA 8ICHA 4K8VA 4BJQA 1T8EA 5B3PA 2EWRA 2RP5A 3F2DA 4KLGA 3KZIU 4E0DA 4OAHA 4NV0A 1UEUA 2PFOA 5CWRA 4XQ8A 5KFDA 2BDUA 3OTQA 4K97A 3RH6A 4TQSA 3OJSA 2KD1A 2OYYA 1CUKA 3VC8A 4JV0A 5DB7A 1QH9A 1ZQ1C 1D9DA 7ICRA 1SB3C 4LJXA 3MR6A 4WC5A 1BPZA 2W9MA 2WHEA 1SGGA 4EX6A 2FLLA 4NLGA 3ER9B 3TADC 4QWDA 3BJYA 2KKVA 3HKZF 1Z4OA 4N7RA 7ICPA 3WK6A 4YXJA 1NJWA 4CF4A 3QUBA 1ZQKA 5AKJA 3TANA 1NK4A 1PK3A 5J29A 2WTFA 1RQLA 5CJ7A 2G5IB 5KFXA 2KN7A 2O6KA 1KSPA 4FZNA 2OH2A 2K4IA 2JH7A 4Y2XA 5HRGA 4DLEA 1ZD2P 5JRTA 2HHTA 4F4ZA 4UB2A 4QIWC 1ZD4A 3MDAA 1UT8A 1L7PA 4P0PA 2EAOA 4B6JA 3I76A 2ALZA 1FIQA 2DPJA 5J8YA 4WC1A 5AM2A 4K4HA 4AYBC 3N4MB 1WOTA 4QNLA 1NNLA 2FDRA 2HVHA 4J9PA 2GH1A 4NWIA 3IDWA 3V7JA 5ALFA 9ICEA 3NVYA 3U26A 4UD5A 1X40A 3M9NB 3GFKB 5KT3A 1S0OA 3KFUF 1CRXA 3SMVA 1S76D 5HRIA 4O68A 4Q8FA 1Z1VA 1TV9A 4A8EA 1FFUA 5ALTA 3ORYA 4WC4A 4M9GA 5L1IA 5KG6A 5KFEA 4ZOHC 1N63A 1N5WA 1V4AA 5AKLA 2KJ9A 2BBJA 1BPXA 4IRCA 3IRUA 4C80A 1B43A 4RQ1A 4NLNA 2OCEA 2KSOB 2AGQA 4F4KA 2NRXA 1RZTA 3EF2A 4GC6A 3H37A 1A77A 4EP7A 4Y2UA 4KLEA 1N60A 5J2IA 1TFRA 4IQUA 4BX9C 1TFWA 4NLBA 5ALPA 3FM9A 4NLCA 3ZI4A 4M2YA 4NL9C 1VFGA 4XA5A 3LWMA 3TAQA 2ZH4A 1ZQIA 1BNOA 2IOHA 1S0NA 9ICPA 4F2RA 4DL5A 2E8NA 1SWVA 5AI6A 2W9BA 4FHVA 5DB9A 1S97A 1NOMA 1T3QA 2W03A 5J0PA 3MGVA 2AGPA 1X9WA 2G09A 8ICLA 1Q78A 1SV0A 5KFYA 3HRDD 3MGHA 3V6JA 2DRBA 3RRHA 4ECVA 1ZXIA 2VA2A 3IP4B 5KL8B 2G08A 3PW5A 5AI0A 5D49A 2WF5A 9ICFA 3TAPA 3SAGA 5HR6A 1LB2B 1TK5A 4M0AA 4X4QA 4CE6A 1L8LA 2GOLA 3SYZA 5EOZA 2R8HA 2R8JA 3M1YA 1UEVA 3RBEA 2CPRA 4O6AA 3UXOA 4Q8EA 5DB6A 5J2EA 1KFTA 7ICNA 3TKAA 2HI0A 3H7IA 5HRKA 4QZIA 5E79U 4ED1A 3TFRA 3PW0A 1S77D 3Q8SB 1LKYB 1ZQWA 4PGXA 4RWQA 2FMPA 4FZMA 5EWFA 4LT6A 1PZNA 1KQQA 3RB0A 4FO6A 4PH5A 2ISOA 2WAQF 3RF9A 4J03A 4I27A 4DL6A 1ZQDA 4EBEA 1TK8A 4MF8A 2W8KA 4F92B 5AI5A 4EEBA 4O9MA 4ED6A 3IN5A 4RNNA 1ZQZA 4QZCA 5IIMA 3V7LA 5CFTA 1UA1A 2FLNA 2BKEA 3S6JA 1QSYA 5EE1A 4E80A 1RM6C 4QZGA 2PMZF 8ICRA 3BQ7A 1WCLA 4O3QA 4C7YA 2LMRA 1KL9A 2XGQA 4F4XA 2M2TA 2NV3A 3RJHA 4FS1A 3K75D 3ISBA 2BHNA 5ALZA 4Y2PA 3EPGA 5AI8A 2RQ5A 5F3XB 4KLSA 2W54A 5GTIU 2EQYA 9ICTA 1ZQQA 4U7CA 3C2KA 1ZQNA 4GLXA 1WWVA 5TISU 2PFPA 3NTUA 4J9NA 3ISCA 3NVZA 3G6XA 1ZQFA 5D63A 2M2VA 4RUAA 4KLIA 1NK5A 1QSLA 2YMQA 5KFVA 2MU2A 1RG6A 4X5VA 5KFCA 5J2HA 2J6SA 4CCHA 3HJ1A 1KFDA 5KFPA 3KHRA 2Y9TA 4JMUA 4G3IA 1ED1A 2Y0SC 1QQ6A 2DPIA 4RWNA 5AK3A 3IG8A 3RBDA 3OVAA 4FO1A 2JEIA 4DOAA 1BNPA 4FH3A 4CF5A 4WC7A 5KFFA 4CF3A 9ICJA 2DKXA 4IQWA 1S10A 5CA7A 2A1AA 5JTIA 4ED8A 2KTQA 2JZBA 4WJ3B 3H4DA 3GV5B 2E5SA 1Q3VA 2MSNA 7ICQA 4PGQA 2B0CA 1T7PA 3SV3A 1N2XA 2H3FA 4UB8U 9ICSA 3WKBA 1Z00B 3Q8PB 1HIWA 2LM4A 3SI8A 2KOBA 2YY6A 3D2QA 2FLPA 1ZJNA 2GO7A 4M6WB 4X4OA 4O3PA 2R18A 5J0YA 3C21A 4RQ6A 7ICLA 4DSIA 4RPZA 4DL7A 2KJ8A 4IRDA 3OUYB 1HUOA 3GIKA 4AT7B 9ICNA 2A19A 2HBMA 1UT5A 3RJIA 4TUSA 2WB1F 5EWGA 1LVHA 2BDPA 2IMWP 3FC4A 3H39A 3M7DA 2WF9A 5KNIA 3WK9A 3V6KA 4QW8A 2KHVA 5D61A 1L7NA 4NKTA 5FP0A 3SV4A 2IHNA 2DWQA 3KHHA 3JPQA 5DEDA 4PHAA 2NRWA 2XI9A 3HIYA 4HAIA 5F9NA 2BPGA 2DF4B 8ICVA 2NYVA 2V9WA 5J0WA 4GC7A 4UAWA 4C4RA 2ZIVA 2PFNA 8ICJA 8ICAA 1C20A 3OJUA 3PSIA 3PY8A 4C4TA 4Q43A 4RWPA 1J2NA 1YZ7A 3H8JA 4AT9A 2ZIXB 5J2BA 5AKYA 1X9SA 3M6ZA 1R89A 1ZRNA 1F0MA 2BPFA 1NI3A 3C1ZA 4PZOA 3QU2A 3H38A 2EAPA 4DL3A 4PZNA 4YMOA 4R66A 4MFFA 1V9PA 1RYRA 4KTQA 2MRLA 1S5LU 1WG8A 3KOOA 3KKAA 5HRBA 3QX7A 1HJPA 2N1RA 5KG0A 1CI4A 3JPOA 2VJ4A 4AP9A 3H0MB 4NLZA 2DR5A 1T94A 3ONNA 2MUTA 2LBOA 4FHYA 2K60A 1O03A 3WKEA 5G5HA 2XIDA 2FPLA 1TAQA 3PSPA 3MR3A 3TQ1A 4DFPA 1OU5A 1JROA 4BUGA 4DQIA 4QZHA 4EV6A 2HHWA 4US8A 1OUQA 4RNOA 5J0QA 4ATBB 5ALOA 2ESEA 4EZ9A 3PMLA 1QCKA 3BS5B 3QZ7A 2Y9UA 4O69A 4Z6FA 5BOMA 3EYZA 2HOFA 2FJ6A 5KT5A 2B4VA 2C28A 1DRGA 3M9MB 1XO0A 9ICGA 4EYHB 2JEJA 5AKIA 1IIPA 7ICHA 5J8YC 5AK4A 2B56A 5IIJA 1KFSA 3KZXA 2EANA 1ZD3A 2GAFD 1XU4A 4WQKA 4EZ6A 3SQIA 3BQ0A 3OVBA 1L3VA 1NKCA 5HRFA 7ICIA 4C8MA 3PNCA 8ICKA 3O0FA 5DECA 4RQ5A 3PMNA 3HT3A 5KFMA 3RB4A 4OJPA 8ICFA 3PVXA 5KFKA 4DEZA 5CFSA 2YTUA 1NK7A 4O3RA 3CP8A 5ALQA 1K1QA 4C0ZA 5L1KA 4KM5A 3Q8RB 1B0XA 4KLFA 1UQVA 2G5HB 2KJ5A 5KG7A 3WFPA 3RJGA 4MHVA 3BQTA 4Y2VA 4B9TA 2AXTU 1R8BA 5AK6A 5KG5A 2PXIA 4UB5A 4QZ8A 4JLZA 3SZ2A 1D9FA 3SAFA 3AQNA 1F5SA 2YB1A 3NKUA 4J9LA 2ZUCA 1TAUA 4DQPA 3SENA 4OJ6A 5K4LA 4KLTA 1B22A 5AM4A 2W3SA 4O67A 5ALJA 4ECQA 5HC9A 2QLTA 5ALEA 2BCQA 5DKWA 2HHQA 5IIKA 5JU5A 3RH5A 5HREA 2VKQA 4ED7A 3JYYA 1SV0C 4IG8A 1KNYA 3F2CA 2E3TA 1JXEA 2HDOA 3ISDA 1KW4A 4RT2A 2XICA 3N7PD 2ZG6A 3T5HA 3OWGA 2IOFA 4US9A 3OSPA 1C7YA 2ZIUA 2NRZA 4IR1A 1N61A 5AI4A 4PJ0U 4BWJA 5AK5A 5L1JA 4OCZA 3L9DA 4M9HA 4M47A 3B0YA 3MFIA 4GXJA 3OVSA 2A1JA 1N56A 1ZQCA 4FBTA 1RYSA 3WFRE 5KT7A 2KZ3A 2W9BB 7ICSA 5J2GA 1COOA 1RPLA 5J2AA 3H0LB 2FE9A 3MCRA 2EAMA 2C2DA 5KTQA 5DG8A 5DGAA 3WKDA 4M9NA 1U9LA 3H8SA 4YN4A 2OM6A 3TI0A 5CHGA 2AH5A 4DOBA 2DR8A 2D8CA 5DDYA 4F91B 3GU3A 4KITB 5KT2A 4DSJA 1YLQA 3AEVA 5DLFA 3VCBA 2ZH2A 1OXJA 3E2EA 2HOIA 4RWOA 3UMCA 4EBJA 5KFQA 1XSNA 2PI5A 2EDUA 3C29A 1KDHA 5C5JA 2W55A 2LHTA 4RQ7A 4CRXA 4I28A 7ICTA 1A76A 1TKDA 2W04A 1S0MA 4EELA 4JV1A 5GTHU 4ED0A 2V4RA 4RQ2A 1NKBA 4C8KA 1PK1A 5TZVA 1XSLA 5HRDA 2ZHAA 5KFBA 3I1YA 4ELVA 5CR0A 1S9FA 2Y1IA 4RQNA 4Z6CA 1UETA 4P0QB 2YB4A 1ZQMA 2DL0A 2BCVA 4B9UA 4ECYA 7ICKA 2KIWA 4WH5A 3RJKA 2JEGA 2AQ0A 3H40A 1ZYQA 2ZTEA 1SIJA 5AKXA 4IS7A 4RPXA 2ZIWA 5KG3A 2R8KA 4YMMA 3RH4A 3D6JA 2WF6A 4RT3A 1EXNA 3G6VA 4IL6U 1NK6A 2FPMA 4M5DA 4UB4A 2JV3A 1CEZA 3L5KA 1SKWA 5ALUA 2F1JA 2IHMA 4F50A 2L5YA 1TE2A 1B4FA 4DCCA 3ER8C 2K8BB 2HVIA 4K98A 1FFVA 5CP2A 3PX0A 2YMPA 3H8MA 4LEVA 4DSLA 1D8LA 4K99A 2FCLA 1NK8A 4YVZA 2KFZA 8ICNA 4F5QA 2HBKA 3FAHA 2E8OA 2ZXHA 2YX8A 3HJEA 3OHAA 1DOQA 5HHIA 2BCRA 1NK9A 4EGWA 4BDPA 3PR5B 2KKPA 4MEXA 4F93B 2NO4A 4C8NA 4O5EA 4QIWF 3DDHA 3NYBA 1FA0A 1SWWA 1ZD5A 4RQ3A 3FDSA 7ICVA 5ALDA 3KHLA 3DV9A 3AQEA 4R63A 5DQHA 4XJEA 2HMXA 3T5JA 2HW3A 5KAFU 4AYBF 3NVWA 3ICXA 4WC2A 2K8CB 3RRGA 4OJOA 3NGDA 4NJ8A 2F77X 1KLNA 4DWIA 2Q66A 5AKGA 5J2DA 2ZJAA 1PVPA 5KFJA 3QZ8A 2ZTCA 2HHXA 3PHZA 1WYGA 1JX4A 5J0SA 4JK1A 5KG2A 1MIVA 3BZKA 5AKHA 4QZAA 3R9KA 3D2SA 3TACB 4R65A 4DF4A 3NWIA 2C22A 1NJZA 4E7XA 2BR0A 4FFDA 8ICMA 2ZHBA 4I0UA 1L3SA 2JGAA 3WK4A 1UHUA 2QB1A 3HPOA 4AT8B 3C2MA 1KBUA 2P66A 2ASLA 4F4WA 4X0BA 3RJFA 4Y2RA 3WK8A 4R8UB 2HHPA 1SL2A 4GFJA 2IUBA 1L7OA 3F5AA 2OXOA 2M2WA 3GILA 2JRZA 2EZZA 4B9LA 4P2HA 2QB0B 4AT9B 4RUCA 1SKSA 3AQKA 9ICAA 3NRZA 2KSOA 2I1QA 1TVAA 1X9MA 4KN4A 2D3DA 3KD3A 4WC0A 5ALLA 3LWLA 3AU6A 2G07A 1RXWA 1SXDA 2KVSA 3F5EA 3D2NA 3ALRA 4NXZA 2H3VA 4X4UA 8ICBA 3CW2C 5AM0A 1ZQBA 3GQCA 4TURA 4QZBA 1X6JA 1UCVA 4TQRA 3UXPA 5G5GA 4UAZA 2CRXA 2LYHA 4X4SA 1UA0A 9ICOA 4DL4A 4F5RA 3JPNA 4F3OA 3PW2A 4Q45A 1ZRMA 4K9BA 1MA7A 3K4GA 4ICAA 5A0LA 2PFQA 5F9LA 3THVA 3T5LA 4KMUA 2WF8A 4Z6DA 2H3ZA 9ICVA 3QU5A 4DS5A 3C23A 2P35A 4IR9A 4JV2A 2RHFA 3QNMA 2AQ4A 4WC3A 4F72A 3QE9Y 1HEKA 1JQRA 4B9MA 1DGJA 2BQ3A 4LEZA 3IHQB 5AM3A 2KG5A 4KMOB 4Y2JA 1RYUA 1SZHA 3ED5A 3V72A 2QARB 3WFSC 3AUOA 4EYIB 1LV5A 2IA6A 2HBJA 1IG6A 4LZDA 1NKEA 1NO5A 5J0OA 1ZQLA 5DBBA 3Q8LA 8ICEA 3M9OB 2AU0A 1PX5A 3HWTA 3Q8QB 4WBYA 4MFCA 2HOQA 1KKXA 2KMDA 3BQ1A 2H3IA 3CK6A 1WCNA 5DB8A 2KE7A 3ERCC 3BS7A 1X66A 1KN5A 3UM9A 4HX0A 3PX4A 4FZLA 2YQEA 4QWBA 2W9CB 1SV4A 4GXKA 5DQGA 7ICEA 2Y0SF 4BXOA 3NS1A 3H0RB 2ISPA 4JLXA 5H2FU 2Q0ZX 8ICYA 2KHQA 3QYPA 3NUQA 4DSKA 3QUTA 4LEYA 4NLKA 1J2MA 3EZ5A 2C2EA 3K1ZA 1DXSA 3EWAA 1PVQA 1L3UA 4K4GA 3RJEA 4UBBA 4J9MA 1T4GA 2DR9A 5ALYA 5HRLA 1BPYA 2LKYA 1V38A 4YXMA 3K1RB 3QU7A 4ELUA 3GZFA 1SL0A 2JMGA 3C18A 1KEJA 3BDPA 2ATLA 1ZQSA 4EENA 2A1JB 2AJQA 2BPCA 2F1IA 5IIOA 1P7DA 3GV8B 1L8OA 5T14A 3JPSA 2XY5A 5ALIA 1SXEA 8ICXA 1A6SA 1DK3A 1BPBA 2WF7A 3JPTA 1J97A 4QZ9A 3AM9A 5ALHA 4RNMA 4FS2A 4Y2YA 3M8SA 4C7ZA 3AL0B 4DLGA 4P4OA 4QWEA 4I2JA 3C66A 4DL2A 8ICPA 4KLQA 4QW9A 1Z00A 4NXXA 3BQ2A 4B9SA 4UB1A 2W11A 5ALKA 2BZFA 2OEHA 3PV8A 8ICGA 4I2IA 4J9RA 5AKZA 4M6WA 4DQRA 1U49A 3OPXA 5KFGA 4I29A 3KHGA 4Y2QA 1GPJA 4X4TA 3HKZC 4KLDA 1ZQRA 4ACOA 2OHFA 3NVVA 4P0PB 4KLHA 3OUYA 1ZETA 7ICMA 1Y88A 1F44A 3HILA 2HCFA 4Y2SA 1NZBA 3UQ0A 4FHWA 1MN8A 5JTGA 5AKKA 5IILA 2A3VA 3MFHA 1ZQEA 3WK7A 3N28A 4MF2A 4ECUA 3IG5A 4KX3A 4Y2TA 4O3SA 4RQ0A 4QZDA 3GV7B 2UVUA 4USAA 3OSNA 1IXRA 5DG7A 4F5NA 2NRKA 1U48A 7ICUA 3PSFA 5ALRA 1ZQTA 1URJA 9ICRA 5CRXA 3KTQA 3Q8KA 2LI6A 2RFFA 1HUZA 5EWEA 3PX6A 4WCWA 5F2VO 3V7KA 2HN2A 4FBUA 4NKUA
chains in the Genus database with same CATH topology
4KLSA 4RT3A 4R64A 3WFOA 4R8UA 9ICTA 4X4PA 5DGBA 1EXNA 3G6VA 8ICUA 1NK6A 2FPMA 4M5DA 4UB4A 1ZQQA 3C2KA 1ZQNA 3OGUA 4ECTA 4GLXA 2PFPA 1CEZA 5KFHA 4X4VA 3NTUA 1SKWA 4J9NA 3ISCA 2F1JA 3C5GA 4ED2A 2IHMA 5CB1A 4F50A 8ICWA 4O0IA 2VA3A 3G6XA 1ZQFA 4PHPA 2M2VA 1MIYA 4YCXA 3RJJA 5HR9A 2HVIA 4RUAA 4KLIA 2ZH8A 1NK5A 5J2CA 1MQ2A 5CP2A 4RQ8A 1SKRA 5KFVA 1ZQOA 2BCSA 1QSLA 4ECWA 2DR9A 3PX0A 4P4PA 4FHPA 3ZDDA 3UPSA 5D4BA 5KFCA 5J2HA 1ZQVA 4X5VA 2J6SA 4CCHA 1KFDA 1D8LA 2RDIA 4DSLA 3HJ1A 1XWLA 4S3NA 5KFPA 3KHRA 5L9XA 2MAXA 4G3IA 1NK8A 4UB3A 2PI4A 5KT4A 5DBAA 4RPYA 3H4BA 4YVZA 4YG2A 2KFZA 2DPIA 3RAQA 8ICNA 4RWNA 4F5QA 2KFNA 3RBDA 3OVAA 4KLJA 3C5FA 3ZD9A 2JEIA 8ICZA 4DOAA 1BNPA 3WFRE 3M8RA 2ZUDA 1ZJMA 1JAJA 4F2SA 9ICQA 3EW9A 5KG4A 4B9VA 4LZGA 2DVIA 4FH3A 2JEFA 4WC7A 5KFFA 1Q79A 2KZZA 3OHAA 1DOQA 5HHIA 2BCRA 9ICJA 4IQWA 1NK9A 3V6HA 1S10A 1UETA 5CA7A 2P6RA 4ATBA 4BDPA 4I2EA 3UQ2A 4MEYA 3PR5B 2R8IA 4ED8A 2KTQA 2DR8A 2JZBA 3H4DA 3GV5B 4MEXA 7ICFA 5KFLA 4F93B 1T3NA 1XC9A 4C8NA 1L5UA 7ICQA 4O5EA 3HP6A 4X0AA 2XY7A 4PGQA 3NYBA 1FA0A 4RQ3A 4GXIA 1T7PA 3SV3A 1ZQUA 3FDSA 3LK9A 5L1LA 3T5KA 7ICVA 3KHLA 9ICSA 4I2DA 4P4MA 2KZMA 5HP4A 2B21A 4IQVA 4R63A 3N97B 3H3AA 1Z00B 5DQHA 1XO1A 3Q8PB 5KFTA 3T5JA 2ZH6A 3SI8A 2HW3A 1NJYA 4WC2A 1X2IA 3RRGA 4YFKA 2FLPA 3NGDA 1ZJNA 3QEAZ 4M6WB 4X4OA 4J9QA 4O3PA 1RXVA 2FPKA 1KLNA 2BQUA 4QZFA 2ZH3A 5J0YA 4J9OA 3C21A 4XUSA 4DWIA 2O1PA 3MDCA 1ZQYA 4E80A 2ZH9A 2Q66A 5J2DA 4EBCA 7ICGA 5DLGA 4AT7A 3MABA 4DQSA 4X4NA 4RQ6A 2ZJAA 7ICLA 4DSIA 4I2GA 3ZD8A 3ZDEA 4RPZA 2XCPA 4DL7A 4F5OA 4IRDA 3OUYB 1HUOA 3GIKA 4AT7B 5KFJA 9ICKA 9ICNA 4NM1A 4PHDA 3QZ8A 3PO4A 2ZTCA 5KFAA 2HHXA 1UT5A 3RJIA 4TUSA 5J0SA 1JX4A 4JK1A 5EWGA 4DS4A 1JIHA 5KG2A 2XO7A 1QSSA 4UBCA 9ICHA 2XY6A 1R8CA 2BDPA 4KLOA 1MIVA 2IMWP 1ZQAA 4QZAA 3LQCB 3H39A 3PR4A 4R65A 3JPPA 3V6KA 4DF4A 2C22A 1U45A 1TK0A 4QW8A 2XGPA 3T3FA 5D46A 3IM1A 1NJZA 2AGOA 7ICJA 4F8RA 4NKTA 4DFMA 3SV4A 2IHNA 4DFKA 2HHUA 2ASJA 4E7XA 2BR0A 3C1YA 9ICBA 3KHHA 3UPQA 4JWMA 3JPQA 4IQTA 8ICMA 2ZHBA 1DK2A 5DEDA 4PHAA 1L3SA 3PW7A 2NRWA 4EBKA 4UAYA 1R8AA 4B9NA 3HPOA 1DGSA 9ICLA 1MSWD 3G6YA 3HIYA 4AT8B 5BPCA 4QWAA 4BGDA 5F9NA 5KFUA 3C2MA 2BPGA 2J6UA 8ICVA 4M9JA 2P66A 2V9WA 5J0WA 4GC7A 3FYHA 4UAWA 4JUZA 4F4WA 2ASLA 4X0BA 1TFYA 2PFNA 2M2UA 8ICJA 4XRHA 8ICAA 5KT6A 3RJFA 3OV7A 5KFWA 3HW8A 1BPDA 5HMMA 3OJUA 1L3TA 3ZDBA 4YQWA 4C8OA 3PY8A 4R8UB 2W9CA 2HHPA 3AQMA 2P6UA 4Q43A 4RWPA 4F5PA 1SL2A 9ICIA 4YP3A 3H8JA 3RR8A 4UQGA 4AT9A 5J2BA 4YD1A 4J9SA 9ICCA 2I9GA 3RR7A 2M2WA 1X9SA 3GILA 1R89A 4ED3A 4B9LA 3GIJA 4P2HA 2BPFA 4AT9B 4M04A 5JUMA 4RUCA 3C1ZA 3H38A 2VA8A 1SKSA 2ZUBA 3AQKA 9ICAA 4DL3A 2VANA 4I2AA 4KN7A 2UVRA 2I1QA 4YMOA 1TVAA 3AQLA 4O3OA 4R66A 4LVSA 5J2KA 4M9LA 1X9MA 2R8GA 4MFFA 1V9PA 1Z3EB 1RYRA 4KTQA 1H38A 1NK0A 4KN4A 2BQRA 5KG1A 4WC0A 4IRKA 8ICHA 1KRPA 5HRBA 3LWLA 3AU6A 1T8EA 1RXWA 1HJPA 4QWCA 4TUQA 1ZQXA 8ICIA 5KG0A 3JPOA 4NXZA 4O5CA 4KLGA 4E0DA 4NLZA 2DR5A 4KLUA 2MUTA 1UEUA 4X4UA 2W8LA 2PFOA 5CWRA 8ICBA 4ECXA 4XQ8A 4FHYA 2DRAA 5KFDA 1ZQBA 5KFIA 3RH6A 4TQSA 2FPLA 1TAQA 3MR3A 3TQ1A 3GQCA 3OJSA 4DFPA 4TURA 1OU5A 4QZBA 4DQIA 4QZHA 3RTVA 2HHWA 1CUKA 4RNOA 4JV0A 5J0QA 4ATBB 5DB7A 1D9DA 7ICRA 4EEYA 4EZ9A 2XC9A 3MR6A 4WC5A 2JZBB 1BPZA 4TQRA 5HNKA 3PMLA 2W9MA 2W9AA 1SZPA 3UXPA 3QZ7A 4UAZA 2FLLA 4Z6FA 4NLGA 4QWDA 2LYHA 5BOMA 3WFQE 3EYZA 3B0XA 1UA0A 3BJYA 9ICOA 4XQ7A 4DL4A 4X4SA 4F5RA 5KT5A 2C28A 7ICPA 3JPNA 4DO9A 4YXJA 2FMQA 4DFJA 1NJWA 4F3OA 3PW2A 4Q45A 3M9MB 4X4RA 9ICGA 4EYHB 3K4GA 2JEJA 2NRTA 4DQQA 4ECRA 1ZQKA 7ICHA 4Z6EA 3TANA 3TARA 1NK4A 2PFQA 4ECSA 5F9LA 3THVA 3T5LA 1N48A 3RB3A 5J29A 2WTFA 5IIJA 4FH5A 4KMUA 1KFSA 4Z6DA 5CJ7A 4E8FA 8ICTA 4DS5A 9ICVA 3C23A 5KFXA 1NZPA 2KN7A 4ZH4A 1BVSA 1KSPA 1XU4A 5KFZA 5HRGA 5J0RA 4EZ6A 1JN3A 4IR9A 4JV2A 4J9KA 4DLEA 3BQ0A 3OVBA 1L3VA 2AQ4A 1NKCA 1KTQA 5HRFA 2HHTA 1QTMA 7ICIA 4C8MA 3PNCA 9ICMA 4F4ZA 4UB2A 8ICKA 4WC3A 3QE9Y 4NY8A 5J0TA 5DECA 5HMLA 9ICUA 3Q8MA 4BWMA 3MDAA 1BPEA 4YR3A 1UT8A 2V4QA 1JQRA 4B9MA 4RQ5A 2BQ3A 3PMNA 3IHQB 3HT3A 4KLMA 2ALZA 5KFMA 3RB4A 4PHEA 8ICFA 3PVXA 5KFKA 3V72A 4DEZA 3TFSA 2DPJA 4WC1A 3WFSC 3AUOA 2KP7A 4K4HA 4EYIB 1LV5A 4TUPA 3N4MB 1WOTA 2IA6A 3HX0A 4YMNA 1NK7A 4LZDA 1K1QA 5L1KA 1NKEA 2C2RA 4O3RA 4F4YA 8ICRA 1SL1A 1NO5A 5KFSA 4DSFA 5J0OA 3Q8RB 3QEBZ 4I2BA 4KLFA 1ZQLA 5DBBA 3WFPA 5KG7A 3Q8LA 2HVHA 8ICEA 4J9PA 3RJGA 9ICXA 3M9OB 9ICWA 4DSEA 3BQTA 4I2HA 3V7JA 2AU0A 1ZQPA 9ICEA 1PX5A 3HWTA 3Q8QB 4B9TA 4WBYA 4MFCA 1R8BA 5KG5A 2PXIA 1F5AA 2ZTDA 4UB5A 2PBEA 4UD5A 4QZ8A 1ZQJA 3M9NB 5KFNA 3GFKB 3BQ1A 3SZ2A 1D9FA 5KT3A 3AQNA 1WCNA 1JMSA 5DB8A 5DQIA 1S0OA 1U47A 2M9NA 3ZDCA 3UXNA 1S76D 5HRIA 4J9LA 2ZUCA 4Q8FA 1TAUA 4DQPA 1TV9A 4O3NA 3PX4A 8ICQA 4KLTA 1B22A 4WC6A 4QWBA 3ORYA 3EPIA 2W9CB 1XSPA 4WBZA 4WC4A 4GXKA 4PGYA 5DBCA 5DQGA 3MR5A 5L1IA 4ECQA 3MBYA 3LDAA 5KG6A 5KFEA 2J6TA 4BXOA 7ICEA 5HC9A 2ISPA 5J2FA 2Q0ZX 8ICYA 2RDJA 1V4AA 2DFLA 4BXOB 1BPXA 4DSKA 2BCQA 4IRCA 5DKWA 1B43A 1NJXA 4NLKA 4RQ1A 4NLNA 2HHQA 5IIKA 7ICOA 3RH5A 3EZ5A 2AGQA 2NRXA 4ED7A 2C2EA 1RZTA 4F4KA 5HREA 3JYYA 1K1SA 2ZH5A 3EWAA 1KNYA 4IG8A 4MFAA 4C8LA 4GC6A 1JXEA 4DF8A 3H37A 3ISDA 1A77A 4RT2A 1L3UA 4K4GA 4EP7A 5BOLA 2OWOA 4QZEA 4KLEA 5J2IA 4HYKA 1TFRA 4IQUA 3T5HA 4RZRA 3RJEA 2DR7A 1TFWA 4UBBA 4J9MA 4M2YA 5HRHA 3ZDAA 1T4GA 3OSPA 1VFGA 4XA5A 3LWMA 5IINA 3TAQA 1C7YA 1ZQIA 2HHSA 3ETLA 2ZH4A 5HRLA 4YR0A 1BPYA 2NRZA 1MQ3A 2MUTB 5J0UA 1S0NA 2GWSA 4IR1A 1BNOA 3GIMA 4YXMA 4BWJA 4DOCA 5L1JA 9ICPA 5KFOA 4F2RA 4DL5A 3L9DA 4M9HA 4M47A 3B0YA 3MFIA 1MC8A 2W9BA 4GXJA 4ELUA 8ICSA 4FHVA 2A1JA 5DB9A 1NOMA 5J0PA 2AGPA 1X9WA 1S97A 4NM2A 1N56A 2ASDA 1ZQCA 1SL0A 4FBTA 8ICLA 1RYSA 4YD2A 1Q78A 2ZJ8A 1KEJA 3BDPA 5KT7A 3C18A 5KFYA 2H5XA 2KZ3A 2W9BB 3MGHA 2ATLA 4I2FA 1ZQSA 4FHXA 2A1JB 5DG9A 3V6JA 2AJQA 7ICSA 2BPCA 1COOA 2F1IA 1RPLA 5J2GA 5IIOA 5J2AA 3RRHA 4ECVA 2VA2A 2DRBA 8ICOA 3GV8B 3PW5A 5D49A 2ZJ5A 1ZQGA 3JPSA 2XY5A 3OVSA 2C2DA 5KTQA 5DG8A 8ICXA 1BPBA 9ICFA 5DGAA 1DK3A 3JPTA 4RU9A 3TAPA 2IBKA 4QZ9A 4M9NA 1U9LA 3H8SA 1LB2B 4FS2A 4RNMA 1TK5A 4M0AA 2ID1A 3M8SA 4X4QA 4YN4A 4DLGA 2HHVA 4P4OA 4QWEA 4I2JA 5CHGA 3SYZA 4DL2A 5EOZA 3TI0A 3C66A 4DOBA 8ICPA 3RH4A 1U4BA 4KLQA 5DDYA 2R8HA 4F91B 4QW9A 3PW4A 2FMSA 3RBEA 2R8JA 1UEVA 1Z00A 4KITB 5KT2A 3BQ2A 2BCUA 4DSJA 3UXOA 2Y1JA 4B9SA 5DB6A 4Q8EA 5J2EA 4UB1A 1YLQA 2ZH1A 1KFTA 7ICNA 5DLFA 3PV8A 1XS9D 3MGIA 4I2IA 5DDMA 4J9RA 4PPXA 3E2EA 8ICGA 3H7IA 2ZH2A 4RWOA 3JZ0A 1D8YA 4M6WA 5HRKA 4EBJA 4QZIA 5KFQA 1XSNA 2ZH7A 2PI5A 4DQRA 4ED1A 3TFRA 1U49A 8ICCA 1BGXT 3PW0A 5KFGA 4YR2A 1S77D 3Q8SB 1KDHA 3KHGA 4I29A 4O5KA 1MIWA 4X4TA 1AROP 5C5JA 4KLDA 3MR2A 1ZQWA 4PGXA 1ZQRA 4RWQA 2FMPA 4RQ7A 5EWFA 4LT6A 4KLHA 1PZNA 3OUYA 3RAXA 3RB0A 1ZETA 7ICMA 4FO6A 1Y88A 4PH5A 4I28A 7ICTA 2ISOA 2XCAA 4I27A 4K4IA 3H8WA 1A76A 1TKDA 4FHWA 3UQ0A 5KFRA 4DL6A 1S0MA 4JWNA 1ZQDA 1ZQHA 4JV1A 4EBEA 4ED0A 1TK8A 2V4RA 5IILA 4RQ2A 4MF8A 2W8KA 4I2CA 1NKBA 4M9GA 3AU2A 3MFHA 4F92B 1ZQEA 4C8KA 4O9MA 4ED6A 5TZVA 4UD4A 2UVVA 4RNNA 4ECZA 2NRVA 3C2LA 1XSLA 1ZQZA 4ECUA 4QZCA 5IIMA 4MF2A 5HRDA 1VJ7A 2ZHAA 3V7LA 5KFBA 5J2JA 2F1HA 1UA1A 2FLNA 4ELVA 3OHBA 5CR0A 4EBDA 2Y1IA 1S9FA 4O3SA 4RQ0A 2BKEA 4QZDA 3GV7B 1JXLA 1QSYA 3RB6A 4Z6CA 2UVWA 2UVUA 3OSNA 1IXRA 5HHHA 4QZGA 5DG7A 1ZQMA 4ELTA 4F5NA 5J0XA 3PO5A 2BCVA 4B9UA 1S0VA 2NRKA 4Q44A 4ECYA 7ICKA 1U48A 7ICUA 4AT8A 1ZQTA 2BE3A 1WCLA 9ICRA 4O3QA 2O5AA 2XGQA 3HJ4A 3GDXA 4F4XA 3RJKA 2M2TA 1QLNA 2JEGA 3KTQA 3RJHA 4KLLA 2AQ0A 3Q8KA 4FS1A 5IIIA 2BGWA 3K75D 4RQ4A 3H40A 1ZYQA 2RFFA 3ISBA 2BHNA 2ZTEA 1HUZA 5EWEA 3PX6A 4WCWA 5F2VO 3JPRA 3V7KA 4RPXA 5KG3A 3EPGA 1IM4A 2R8KA 3GIIA 4FBUA 4YMMA 4NKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLS A;  4RT3 A;  4R64 A;  3WFO A;  4R8U A;  9ICT A;  4X4P A;  5DGB A;  1EXN A;  3G6V A;  8ICU A;  1NK6 A;  2FPM A;  4M5D A;  4UB4 A;  1ZQQ A;  3C2K A;  1ZQN A;  3OGU A;  4ECT A;  4GLX A;  2PFP A;  1CEZ A;  5KFH A;  4X4V A;  3NTU A;  1SKW A;  4J9N A;  3ISC A;  2F1J A;  3C5G A;  4ED2 A;  2IHM A;  5CB1 A;  4F50 A;  8ICW A;  4O0I A;  2VA3 A;  3G6X A;  1ZQF A;  4PHP A;  2M2V A;  1MIY A;  4YCX A;  3RJJ A;  5HR9 A;  2HVI A;  4RUA A;  4KLI A;  2ZH8 A;  1NK5 A;  5J2C A;  1MQ2 A;  5CP2 A;  4RQ8 A;  1SKR A;  5KFV A;  1ZQO A;  2BCS A;  1QSL A;  4ECW A;  2DR9 A;  3PX0 A;  4P4P A;  4FHP A;  3ZDD A;  3UPS A;  5D4B A;  5KFC A;  5J2H A;  1ZQV A;  4X5V A;  2J6S A;  4CCH A;  1KFD A;  1D8L A;  2RDI A;  4DSL A;  3HJ1 A;  1XWL A;  4S3N A;  5KFP A;  3KHR A;  5L9X A;  2MAX A;  4G3I A;  1NK8 A;  4UB3 A;  2PI4 A;  5KT4 A;  5DBA A;  4RPY A;  3H4B A;  4YVZ A;  4YG2 A;  2KFZ A;  2DPI A;  3RAQ A;  8ICN A;  4RWN A;  4F5Q A;  2KFN A;  3RBD A;  3OVA A;  4KLJ A;  3C5F A;  3ZD9 A;  2JEI A;  8ICZ A;  4DOA A;  1BNP A;  3WFR E;  3M8R A;  2ZUD A;  1ZJM A;  1JAJ A;  4F2S A;  9ICQ A;  3EW9 A;  5KG4 A;  4B9V A;  4LZG A;  2DVI A;  4FH3 A;  2JEF A;  4WC7 A;  5KFF A;  1Q79 A;  2KZZ A;  3OHA A;  1DOQ A;  5HHI A;  2BCR A;  9ICJ A;  4IQW A;  1NK9 A;  3V6H A;  1S10 A;  1UET A;  5CA7 A;  2P6R A;  4ATB A;  4BDP A;  4I2E A;  3UQ2 A;  4MEY A;  3PR5 B;  2R8I A;  4ED8 A;  2KTQ A;  2DR8 A;  2JZB A;  3H4D A;  3GV5 B;  4MEX A;  7ICF A;  5KFL A;  4F93 B;  1T3N A;  1XC9 A;  4C8N A;  1L5U A;  7ICQ A;  4O5E A;  3HP6 A;  4X0A A;  2XY7 A;  4PGQ A;  3NYB A;  1FA0 A;  4RQ3 A;  4GXI A;  1T7P A;  3SV3 A;  1ZQU A;  3FDS A;  3LK9 A;  5L1L A;  3T5K A;  7ICV A;  3KHL A;  9ICS A;  4I2D A;  4P4M A;  2KZM A;  5HP4 A;  2B21 A;  4IQV A;  4R63 A;  3N97 B;  3H3A A;  1Z00 B;  5DQH A;  1XO1 A;  3Q8P B;  5KFT A;  3T5J A;  2ZH6 A;  3SI8 A;  2HW3 A;  1NJY A;  4WC2 A;  1X2I A;  3RRG A;  4YFK A;  2FLP A;  3NGD A;  1ZJN A;  3QEA Z;  4M6W B;  4X4O A;  4J9Q A;  4O3P A;  1RXV A;  2FPK A;  1KLN A;  2BQU A;  4QZF A;  2ZH3 A;  5J0Y A;  4J9O A;  3C21 A;  4XUS A;  4DWI A;  2O1P A;  3MDC A;  1ZQY A;  4E80 A;  2ZH9 A;  2Q66 A;  5J2D A;  4EBC A;  7ICG A;  5DLG A;  4AT7 A;  3MAB A;  4DQS A;  4X4N A;  4RQ6 A;  2ZJA A;  7ICL A;  4DSI A;  4I2G A;  3ZD8 A;  3ZDE A;  4RPZ A;  2XCP A;  4DL7 A;  4F5O A;  4IRD A;  3OUY B;  1HUO A;  3GIK A;  4AT7 B;  5KFJ A;  9ICK A;  9ICN A;  4NM1 A;  4PHD A;  3QZ8 A;  3PO4 A;  2ZTC A;  5KFA A;  2HHX A;  1UT5 A;  3RJI A;  4TUS A;  5J0S A;  1JX4 A;  4JK1 A;  5EWG A;  4DS4 A;  1JIH A;  5KG2 A;  2XO7 A;  1QSS A;  4UBC A;  9ICH A;  2XY6 A;  1R8C A;  2BDP A;  4KLO A;  1MIV A;  2IMW P;  1ZQA A;  4QZA A;  3LQC B;  3H39 A;  3PR4 A;  4R65 A;  3JPP A;  3V6K A;  4DF4 A;  2C22 A;  1U45 A;  1TK0 A;  4QW8 A;  2XGP A;  3T3F A;  5D46 A;  3IM1 A;  1NJZ A;  2AGO A;  7ICJ A;  4F8R A;  4NKT A;  4DFM A;  3SV4 A;  2IHN A;  4DFK A;  2HHU A;  2ASJ A;  4E7X A;  2BR0 A;  3C1Y A;  9ICB A;  3KHH A;  3UPQ A;  4JWM A;  3JPQ A;  4IQT A;  8ICM A;  2ZHB A;  1DK2 A;  5DED A;  4PHA A;  1L3S A;  3PW7 A;  2NRW A;  4EBK A;  4UAY A;  1R8A A;  4B9N A;  3HPO A;  1DGS A;  9ICL A;  1MSW D;  3G6Y A;  3HIY A;  4AT8 B;  5BPC A;  4QWA A;  4BGD A;  5F9N A;  5KFU A;  3C2M A;  2BPG A;  2J6U A;  8ICV A;  4M9J A;  2P66 A;  2V9W A;  5J0W A;  4GC7 A;  3FYH A;  4UAW A;  4JUZ A;  4F4W A;  2ASL A;  4X0B A;  1TFY A;  2PFN A;  2M2U A;  8ICJ A;  4XRH A;  8ICA A;  5KT6 A;  3RJF A;  3OV7 A;  5KFW A;  3HW8 A;  1BPD A;  5HMM A;  3OJU A;  1L3T A;  3ZDB A;  4YQW A;  4C8O A;  3PY8 A;  4R8U B;  2W9C A;  2HHP A;  3AQM A;  2P6U A;  4Q43 A;  4RWP A;  4F5P A;  1SL2 A;  9ICI A;  4YP3 A;  3H8J A;  3RR8 A;  4UQG A;  4AT9 A;  5J2B A;  4YD1 A;  4J9S A;  9ICC A;  2I9G A;  3RR7 A;  2M2W A;  1X9S A;  3GIL A;  1R89 A;  4ED3 A;  4B9L A;  3GIJ A;  4P2H A;  2BPF A;  4AT9 B;  4M04 A;  5JUM A;  4RUC A;  3C1Z A;  3H38 A;  2VA8 A;  1SKS A;  2ZUB A;  3AQK A;  9ICA A;  4DL3 A;  2VAN A;  4I2A A;  4KN7 A;  2UVR A;  2I1Q A;  4YMO A;  1TVA A;  3AQL A;  4O3O A;  4R66 A;  4LVS A;  5J2K A;  4M9L A;  1X9M A;  2R8G A;  4MFF A;  1V9P A;  1Z3E B;  1RYR A;  4KTQ A;  1H38 A;  1NK0 A;  4KN4 A;  2BQR A;  5KG1 A;  4WC0 A;  4IRK A;  8ICH A;  1KRP A;  5HRB A;  3LWL A;  3AU6 A;  1T8E A;  1RXW A;  1HJP A;  4QWC A;  4TUQ A;  1ZQX A;  8ICI A;  5KG0 A;  3JPO A;  4NXZ A;  4O5C A;  4KLG A;  4E0D A;  4NLZ A;  2DR5 A;  4KLU A;  2MUT A;  1UEU A;  4X4U A;  2W8L A;  2PFO A;  5CWR A;  8ICB A;  4ECX A;  4XQ8 A;  4FHY A;  2DRA A;  5KFD A;  1ZQB A;  5KFI A;  3RH6 A;  4TQS A;  2FPL A;  1TAQ A;  3MR3 A;  3TQ1 A;  3GQC A;  3OJS A;  4DFP A;  4TUR A;  1OU5 A;  4QZB A;  4DQI A;  4QZH A;  3RTV A;  2HHW A;  1CUK A;  4RNO A;  4JV0 A;  5J0Q A;  4ATB B;  5DB7 A;  1D9D A;  7ICR A;  4EEY A;  4EZ9 A;  2XC9 A;  3MR6 A;  4WC5 A;  2JZB B;  1BPZ A;  4TQR A;  5HNK A;  3PML A;  2W9M A;  2W9A A;  1SZP A;  3UXP A;  3QZ7 A;  4UAZ A;  2FLL A;  4Z6F A;  4NLG A;  4QWD A;  2LYH A;  5BOM A;  3WFQ E;  3EYZ A;  3B0X A;  1UA0 A;  3BJY A;  9ICO A;  4XQ7 A;  4DL4 A;  4X4S A;  4F5R A;  5KT5 A;  2C28 A;  7ICP A;  3JPN A;  4DO9 A;  4YXJ A;  2FMQ A;  4DFJ A;  1NJW A;  4F3O A;  3PW2 A;  4Q45 A;  3M9M B;  4X4R A;  9ICG A;  4EYH B;  3K4G A;  2JEJ A;  2NRT A;  4DQQ A;  4ECR A;  1ZQK A;  7ICH A;  4Z6E A;  3TAN A;  3TAR A;  1NK4 A;  2PFQ A;  4ECS A;  5F9L A;  3THV A;  3T5L A;  1N48 A;  3RB3 A;  5J29 A;  2WTF A;  5IIJ A;  4FH5 A;  4KMU A;  1KFS A;  4Z6D A;  5CJ7 A;  4E8F A;  8ICT A;  4DS5 A;  9ICV A;  3C23 A;  5KFX A;  1NZP A;  2KN7 A;  4ZH4 A;  1BVS A;  1KSP A;  1XU4 A;  5KFZ A;  5HRG A;  5J0R A;  4EZ6 A;  1JN3 A;  4IR9 A;  4JV2 A;  4J9K A;  4DLE A;  3BQ0 A;  3OVB A;  1L3V A;  2AQ4 A;  1NKC A;  1KTQ A;  5HRF A;  2HHT A;  1QTM A;  7ICI A;  4C8M A;  3PNC A;  9ICM A;  4F4Z A;  4UB2 A;  8ICK A;  4WC3 A;  3QE9 Y;  4NY8 A;  5J0T A;  5DEC A;  5HML A;  9ICU A;  3Q8M A;  4BWM A;  3MDA A;  1BPE A;  4YR3 A;  1UT8 A;  2V4Q A;  1JQR A;  4B9M A;  4RQ5 A;  2BQ3 A;  3PMN A;  3IHQ B;  3HT3 A;  4KLM A;  2ALZ A;  5KFM A;  3RB4 A;  4PHE A;  8ICF A;  3PVX A;  5KFK A;  3V72 A;  4DEZ A;  3TFS A;  2DPJ A;  4WC1 A;  3WFS C;  3AUO A;  2KP7 A;  4K4H A;  4EYI B;  1LV5 A;  4TUP A;  3N4M B;  1WOT A;  2IA6 A;  3HX0 A;  4YMN A;  1NK7 A;  4LZD A;  1K1Q A;  5L1K A;  1NKE A;  2C2R A;  4O3R A;  4F4Y A;  8ICR A;  1SL1 A;  1NO5 A;  5KFS A;  4DSF A;  5J0O A;  3Q8R B;  3QEB Z;  4I2B A;  4KLF A;  1ZQL A;  5DBB A;  3WFP A;  5KG7 A;  3Q8L A;  2HVH A;  8ICE A;  4J9P A;  3RJG A;  9ICX A;  3M9O B;  9ICW A;  4DSE A;  3BQT A;  4I2H A;  3V7J A;  2AU0 A;  1ZQP A;  9ICE A;  1PX5 A;  3HWT A;  3Q8Q B;  4B9T A;  4WBY A;  4MFC A;  1R8B A;  5KG5 A;  2PXI A;  1F5A A;  2ZTD A;  4UB5 A;  2PBE A;  4UD5 A;  4QZ8 A;  1ZQJ A;  3M9N B;  5KFN A;  3GFK B;  3BQ1 A;  3SZ2 A;  1D9F A;  5KT3 A;  3AQN A;  1WCN A;  1JMS A;  5DB8 A;  5DQI A;  1S0O A;  1U47 A;  2M9N A;  3ZDC A;  3UXN A;  1S76 D;  5HRI A;  4J9L A;  2ZUC A;  4Q8F A;  1TAU A;  4DQP A;  1TV9 A;  4O3N A;  3PX4 A;  8ICQ A;  4KLT A;  1B22 A;  4WC6 A;  4QWB A;  3ORY A;  3EPI A;  2W9C B;  1XSP A;  4WBZ A;  4WC4 A;  4GXK A;  4PGY A;  5DBC A;  5DQG A;  3MR5 A;  5L1I A;  4ECQ A;  3MBY A;  3LDA A;  5KG6 A;  5KFE A;  2J6T A;  4BXO A;  7ICE A;  5HC9 A;  2ISP A;  5J2F A;  2Q0Z X;  8ICY A;  2RDJ A;  1V4A A;  2DFL A;  4BXO B;  1BPX A;  4DSK A;  2BCQ A;  4IRC A;  5DKW A;  1B43 A;  1NJX A;  4NLK A;  4RQ1 A;  4NLN A;  2HHQ A;  5IIK A;  7ICO A;  3RH5 A;  3EZ5 A;  2AGQ A;  2NRX A;  4ED7 A;  2C2E A;  1RZT A;  4F4K A;  5HRE A;  3JYY A;  1K1S A;  2ZH5 A;  3EWA A;  1KNY A;  4IG8 A;  4MFA A;  4C8L A;  4GC6 A;  1JXE A;  4DF8 A;  3H37 A;  3ISD A;  1A77 A;  4RT2 A;  1L3U A;  4K4G A;  4EP7 A;  5BOL A;  2OWO A;  4QZE A;  4KLE A;  5J2I A;  4HYK A;  1TFR A;  4IQU A;  3T5H A;  4RZR A;  3RJE A;  2DR7 A;  1TFW A;  4UBB A;  4J9M A;  4M2Y A;  5HRH A;  3ZDA A;  1T4G A;  3OSP A;  1VFG A;  4XA5 A;  3LWM A;  5IIN A;  3TAQ A;  1C7Y A;  1ZQI A;  2HHS A;  3ETL A;  2ZH4 A;  5HRL A;  4YR0 A;  1BPY A;  2NRZ A;  1MQ3 A;  2MUT B;  5J0U A;  1S0N A;  2GWS A;  4IR1 A;  1BNO A;  3GIM A;  4YXM A;  4BWJ A;  4DOC A;  5L1J A;  9ICP A;  5KFO A;  4F2R A;  4DL5 A;  3L9D A;  4M9H A;  4M47 A;  3B0Y A;  3MFI A;  1MC8 A;  2W9B A;  4GXJ A;  4ELU A;  8ICS A;  4FHV A;  2A1J A;  5DB9 A;  1NOM A;  5J0P A;  2AGP A;  1X9W A;  1S97 A;  4NM2 A;  1N56 A;  2ASD A;  1ZQC A;  1SL0 A;  4FBT A;  8ICL A;  1RYS A;  4YD2 A;  1Q78 A;  2ZJ8 A;  1KEJ A;  3BDP A;  5KT7 A;  3C18 A;  5KFY A;  2H5X A;  2KZ3 A;  2W9B B;  3MGH A;  2ATL A;  4I2F A;  1ZQS A;  4FHX A;  2A1J B;  5DG9 A;  3V6J A;  2AJQ A;  7ICS A;  2BPC A;  1COO A;  2F1I A;  1RPL A;  5J2G A;  5IIO A;  5J2A A;  3RRH A;  4ECV A;  2VA2 A;  2DRB A;  8ICO A;  3GV8 B;  3PW5 A;  5D49 A;  2ZJ5 A;  1ZQG A;  3JPS A;  2XY5 A;  3OVS A;  2C2D A;  5KTQ A;  5DG8 A;  8ICX A;  1BPB A;  9ICF A;  5DGA A;  1DK3 A;  3JPT A;  4RU9 A;  3TAP A;  2IBK A;  4QZ9 A;  4M9N A;  1U9L A;  3H8S A;  1LB2 B;  4FS2 A;  4RNM A;  1TK5 A;  4M0A A;  2ID1 A;  3M8S A;  4X4Q A;  4YN4 A;  4DLG A;  2HHV A;  4P4O A;  4QWE A;  4I2J A;  5CHG A;  3SYZ A;  4DL2 A;  5EOZ A;  3TI0 A;  3C66 A;  4DOB A;  8ICP A;  3RH4 A;  1U4B A;  4KLQ A;  5DDY A;  2R8H A;  4F91 B;  4QW9 A;  3PW4 A;  2FMS A;  3RBE A;  2R8J A;  1UEV A;  1Z00 A;  4KIT B;  5KT2 A;  3BQ2 A;  2BCU A;  4DSJ A;  3UXO A;  2Y1J A;  4B9S A;  5DB6 A;  4Q8E A;  5J2E A;  4UB1 A;  1YLQ A;  2ZH1 A;  1KFT A;  7ICN A;  5DLF A;  3PV8 A;  1XS9 D;  3MGI A;  4I2I A;  5DDM A;  4J9R A;  4PPX A;  3E2E A;  8ICG A;  3H7I A;  2ZH2 A;  4RWO A;  3JZ0 A;  1D8Y A;  4M6W A;  5HRK A;  4EBJ A;  4QZI A;  5KFQ A;  1XSN A;  2ZH7 A;  2PI5 A;  4DQR A;  4ED1 A;  3TFR A;  1U49 A;  8ICC A;  1BGX T;  3PW0 A;  5KFG A;  4YR2 A;  1S77 D;  3Q8S B;  1KDH A;  3KHG A;  4I29 A;  4O5K A;  1MIW A;  4X4T A;  1ARO P;  5C5J A;  4KLD A;  3MR2 A;  1ZQW A;  4PGX A;  1ZQR A;  4RWQ A;  2FMP A;  4RQ7 A;  5EWF A;  4LT6 A;  4KLH A;  1PZN A;  3OUY A;  3RAX A;  3RB0 A;  1ZET A;  7ICM A;  4FO6 A;  1Y88 A;  4PH5 A;  4I28 A;  7ICT A;  2ISO A;  2XCA A;  4I27 A;  4K4I A;  3H8W A;  1A76 A;  1TKD A;  4FHW A;  3UQ0 A;  5KFR A;  4DL6 A;  1S0M A;  4JWN A;  1ZQD A;  1ZQH A;  4JV1 A;  4EBE A;  4ED0 A;  1TK8 A;  2V4R A;  5IIL A;  4RQ2 A;  4MF8 A;  2W8K A;  4I2C A;  1NKB A;  4M9G A;  3AU2 A;  3MFH A;  4F92 B;  1ZQE A;  4C8K A;  4O9M A;  4ED6 A;  5TZV A;  4UD4 A;  2UVV A;  4RNN A;  4ECZ A;  2NRV A;  3C2L A;  1XSL A;  1ZQZ A;  4ECU A;  4QZC A;  5IIM A;  4MF2 A;  5HRD A;  1VJ7 A;  2ZHA A;  3V7L A;  5KFB A;  5J2J A;  2F1H A;  1UA1 A;  2FLN A;  4ELV A;  3OHB A;  5CR0 A;  4EBD A;  2Y1I A;  1S9F A;  4O3S A;  4RQ0 A;  2BKE A;  4QZD A;  3GV7 B;  1JXL A;  1QSY A;  3RB6 A;  4Z6C A;  2UVW A;  2UVU A;  3OSN A;  1IXR A;  5HHH A;  4QZG A;  5DG7 A;  1ZQM A;  4ELT A;  4F5N A;  5J0X A;  3PO5 A;  2BCV A;  4B9U A;  1S0V A;  2NRK A;  4Q44 A;  4ECY A;  7ICK A;  1U48 A;  7ICU A;  4AT8 A;  1ZQT A;  2BE3 A;  1WCL A;  9ICR A;  4O3Q A;  2O5A A;  2XGQ A;  3HJ4 A;  3GDX A;  4F4X A;  3RJK A;  2M2T A;  1QLN A;  2JEG A;  3KTQ A;  3RJH A;  4KLL A;  2AQ0 A;  3Q8K A;  4FS1 A;  5III A;  2BGW A;  3K75 D;  4RQ4 A;  3H40 A;  1ZYQ A;  2RFF A;  3ISB A;  2BHN A;  2ZTE A;  1HUZ A;  5EWE A;  3PX6 A;  4WCW A;  5F2V O;  3JPR A;  3V7K A;  4RPX A;  5KG3 A;  3EPG A;  1IM4 A;  2R8K A;  3GII A;  4FBU A;  4YMM A;  4NKU A; 
#chains in the Genus database with same CATH topology
 3LVW A;  8ICU A;  4OAF A;  2ZIX A;  4LEW A;  3OGU A;  4ECT A;  2F8L A;  4UAT A;  2IHO A;  2E1E A;  2VIX A;  5AIA A;  3C5G A;  5CB1 A;  4O0I A;  5EE9 A;  4PHP A;  5HR9 A;  2ZH8 A;  1MQ2 A;  5J2C A;  4RQ8 A;  1SKR A;  1JUD A;  4KX5 A;  1ZQO A;  4ECW A;  4P4P A;  2Q4T A;  5D4B A;  1ZQV A;  2RDI A;  5ALV A;  1XWL A;  4S3N A;  5L9X A;  4UB3 A;  3H4B A;  5ALX A;  4YG2 A;  2LYB A;  3C5F A;  3ZD9 A;  8ICZ A;  3M8R A;  4UAV A;  3EW9 A;  4B9V A;  2DVI A;  4FE3 A;  2F44 A;  4EED A;  1ZOL A;  3V6H A;  4ATB A;  3N7S C;  4I2E A;  3QUC A;  1Z4N A;  3BS5 A;  1XC9 A;  4NXV A;  3HP6 A;  4X0A A;  4GXI A;  3SR6 A;  2I6X A;  1ZQU A;  5L1L A;  3T5K A;  4I2D A;  4P4M A;  1PVR A;  2B21 A;  2KNJ A;  4IQV A;  3H3A A;  2JXJ A;  5KFT A;  2ZH6 A;  1RQN A;  3RFA A;  4WOY A;  1A0P A;  1X2I A;  4YFK A;  2K4E A;  3QEA Z;  3CYM A;  4J9Q A;  2FPK A;  1UPH A;  2W43 A;  2BQU A;  4J9O A;  4XUS A;  2O1P A;  3MDC A;  1ZQY A;  2ZH9 A;  2B51 A;  3M6K A;  4I2G A;  3ZDE A;  4F5O A;  9ICK A;  4NM1 A;  3CRX A;  5KFA A;  4K9A A;  2KIV A;  1TFY A;  1QSS A;  2EZY A;  1R8C A;  4KLO A;  3DEE A;  1ZQA A;  3LQC B;  2BBH A;  2LPE A;  3PR4 A;  1U45 A;  3T3F A;  3UMB A;  2AHO B;  1YZ6 A;  4DFK A;  2HHU A;  2ASJ A;  3C1Y A;  2HSZ A;  3UPQ A;  1Z19 A;  4JWM A;  2KVC A;  1X6I A;  2JH1 A;  2DGZ A;  1DK2 A;  4EBK A;  3ETR A;  4UAY A;  4B9N A;  9ICL A;  4QWA A;  2J6U A;  5KFU A;  2WAQ C;  4M9J A;  2EH9 A;  2DQN B;  4JUZ A;  2M2U A;  4XRH A;  1ECW A;  1BPD A;  1WUD A;  4NXW A;  2KEY A;  4WQL A;  4C8O A;  4F5P A;  5KL1 B;  4YP3 A;  3RR8 A;  4UQG A;  2W3R A;  4J9S A;  4YD1 A;  3RR7 A;  3A0B U;  1QQ7 A;  1O08 A;  5ALW A;  1Q8K A;  3GIJ A;  2PMZ C;  3QU4 A;  2ZUB A;  1IV8 A;  2MA1 A;  1N5X A;  2UVR A;  4O3O A;  4PL1 A;  4LVS A;  3NVO A;  4M9L A;  2K4P A;  1NK0 A;  4GIB A;  2BQR A;  5KG1 A;  1KRP A;  1VLB A;  2YN4 A;  4QWC A;  4TUQ A;  1ZQX A;  8ICI A;  3AMZ A;  4O5C A;  5C0Y A;  4KLU A;  2W8L A;  4ECX A;  5KFI A;  4OJ5 A;  5ALS A;  3WU2 U;  3RTV A;  4EEY A;  2W7O A;  2XC9 A;  4UAU A;  2JZB B;  5HNK A;  2W9A A;  1SZP A;  1V85 A;  3C28 A;  2YMM A;  2F8K A;  3WFQ E;  3B0X A;  4XQ7 A;  4JB3 A;  1TAM A;  5AHX A;  4DO9 A;  2FMQ A;  4DFJ A;  4X4R A;  4CNQ A;  1GO3 F;  1Q3U A;  2NRT A;  5B5E U;  4ECR A;  4DQQ A;  4Z6E A;  3TAR A;  4ECS A;  1QQ5 A;  1S8O A;  4O3M A;  1N48 A;  3RB3 A;  4FH5 A;  4E8F A;  8ICT A;  1NZP A;  3E58 A;  4ZH4 A;  1BVS A;  5AM5 A;  5KFZ A;  5J0R A;  3N7R C;  1JN3 A;  4J9K A;  1KTQ A;  4DFD A;  3TAD A;  1QTM A;  3IV6 A;  9ICM A;  5L1M A;  3QUQ A;  5J0T A;  5HML A;  9ICU A;  3Q8M A;  4BWM A;  1BPE A;  4YR3 A;  2V4Q A;  3PST A;  2YML A;  2K89 A;  2GA9 D;  4KLM A;  2G06 A;  1D8B A;  4PHE A;  3TFS A;  3I28 A;  2KP7 A;  4TUP A;  1Q46 A;  4YMN A;  3HX0 A;  4CGZ A;  5HR7 A;  2C2R A;  4F4Y A;  2JHD A;  1SL1 A;  5KFS A;  4DSF A;  3QEB Z;  4I2B A;  9ICX A;  5EE3 A;  9ICW A;  2IOF K;  4DSE A;  2ZXI A;  4I2H A;  1L6N A;  1ZQP A;  3B9J A;  4P0Q A;  1F5A A;  2ZTD A;  2PBE A;  1ZQJ A;  1JRP A;  4OD0 A;  5KFN A;  3KKA C;  2WB1 C;  2GLE A;  1JMS A;  2ZIV B;  3LYS A;  5DQI A;  1U47 A;  2M9N A;  3ZDC A;  3UXN A;  1X42 A;  4O3N A;  5B3Q A;  5AKE A;  1L7M A;  8ICQ A;  2KV2 A;  4WC6 A;  3EPI A;  1XSP A;  3QU9 A;  4PGY A;  5DBC A;  3MR5 A;  8ICS A;  2J6T A;  3MBY A;  3LDA A;  5J2F A;  2RDJ A;  2DFL A;  5ALN A;  4BXO B;  4MKP A;  2LM1 A;  3WKC A;  1M6Y A;  1NJX A;  7ICO A;  1K1S A;  2ZH5 A;  4MFA A;  4C8L A;  4DF8 A;  5BOL A;  2OWO A;  4QZE A;  1X9X A;  2K8A A;  4HYK A;  2DR7 A;  4RZR A;  2DKZ A;  5HRH A;  3ZDA A;  3F53 A;  5IIN A;  2HHS A;  4OO1 J;  2KK0 A;  3ETL A;  4YR0 A;  1MQ3 A;  1AQ6 A;  2MUT B;  5J0U A;  2GWS A;  3GIM A;  4DOC A;  4UB6 U;  5KFO A;  1VJ5 A;  1PUZ A;  2D6F C;  1MC8 A;  2HN1 A;  4NM2 A;  2ASD A;  4YD2 A;  2ZJ8 A;  3E0F A;  4I2F A;  2H5X A;  4FHX A;  3AQF A;  5DG9 A;  8ICO A;  2ZJ5 A;  1ZQG A;  2IBK A;  4RU9 A;  4NL9 A;  3SD7 A;  4UW9 A;  2ID1 A;  2HHV A;  2JR5 A;  2FI1 A;  1U4B A;  3PW4 A;  2FMS A;  2F2A B;  2BCU A;  2Y1J A;  2ZH1 A;  1XS9 D;  3MGI A;  2G0A A;  3NRW A;  5DDM A;  4PPX A;  3JZ0 A;  3J81 j;  1LKY A;  1D8Y A;  2ZH7 A;  8ICC A;  5CFU A;  1BGX T;  4YR2 A;  5AIB A;  2RRD A;  1MIW A;  4O5K A;  5B66 U;  2QKQ A;  2E1F A;  1ARO P;  3MR2 A;  2DUY A;  3LVV A;  3RAX A;  4F71 A;  2XCA A;  4K4I A;  3H8W A;  2I5H A;  5KFR A;  4JWN A;  1ZQH A;  5EE0 A;  4I2C A;  4G9B A;  3AU2 A;  4UD4 A;  3L4P A;  2UVV A;  4ECZ A;  2NRV A;  3C2L A;  2H3Q A;  1VJ7 A;  3BZC A;  4UAS A;  5J2J A;  1K5O A;  2F1H A;  4EEK A;  3OHB A;  4EBD A;  2KZM A;  1JXL A;  2UVW A;  4WBZ A;  3RB6 A;  4NY8 A;  4ELT A;  2DRA A;  5HHH A;  5J0X A;  3PO5 A;  1S0V A;  4Q44 A;  2M0N A;  4AT8 A;  5CEH A;  2BE3 A;  2O5A A;  3HJ4 A;  3GDX A;  1QLN A;  4KLL A;  2BGW A;  1XNS A;  5III A;  4RQ4 A;  3JPR A;  5KAI U;  1IM4 A;  3GII A;  4R64 A;  3WFO A;  4R8U A;  4X4P A;  5DGB A;  3CNH A;  2LYA A;  3PZP A;  4X4V A;  5KFH A;  1JAL A;  2QB0 A;  4ED2 A;  8ICW A;  2VA3 A;  1FO4 A;  1MIY A;  4YCX A;  2PKE A;  3RJJ A;  5D62 A;  3SEI A;  2BCS A;  1WWU A;  4FHP A;  3ZDD A;  2W7P A;  3UPS A;  1VDV A;  5AM1 A;  1Z1B A;  2HBL A;  2MAX A;  2PI4 A;  5KT4 A;  5DBA A;  4RPY A;  2ZIU B;  3T79 A;  4KB6 A;  1FEZ A;  4C4S A;  3RAQ A;  2KFN A;  4KLJ A;  5ALG A;  2ZUD A;  1ZJM A;  4RQM A;  4F2S A;  9ICQ A;  5KG4 A;  1JAJ A;  2XVT A;  4LZG A;  2JEF A;  2F3N A;  2Z7J A;  1Q79 A;  2KZZ A;  2NO5 A;  2P6R A;  3UQ2 A;  4MEY A;  1RDF A;  2R8I A;  3UMG A;  2CXY A;  7ICF A;  5KFL A;  1T3N A;  1L5U A;  2XY7 A;  3AN1 A;  3WKA A;  2F76 X;  3LK9 A;  1JI7 A;  2E8P A;  5HP4 A;  3N97 B;  1XO1 A;  1NJY A;  3F2B A;  4IC9 A;  1RXV A;  1V97 A;  4QZF A;  2ZH3 A;  7ICG A;  4EBC A;  3K7D A;  2K4H A;  5DLG A;  3MAB A;  4DQS A;  4AT7 A;  4X4N A;  4QJF B;  3ZD8 A;  4K96 A;  2XCP A;  5AI9 A;  4PHD A;  3PO4 A;  4PL2 A;  3A0H U;  4DS4 A;  1JIH A;  2XO7 A;  4UBC A;  9ICH A;  2XY6 A;  4EX7 A;  5ALM A;  2QAR A;  3JPP A;  1TK0 A;  1PK1 B;  1YT3 A;  5CHE A;  2XGP A;  4NXU A;  5D46 A;  3IM1 A;  2AGO A;  7ICJ A;  4F8R A;  1N62 A;  2DBY A;  4DFM A;  2RLT A;  9ICB A;  2ODG A;  3EUB 2;  4IQT A;  2B6G A;  4OJL A;  4NXT A;  4CDG A;  4U6P A;  3L3F X;  3PW7 A;  1COK A;  1R8A A;  2WFA A;  1DGS A;  1MSW D;  3G6Y A;  3SAH A;  5BPC A;  4BGD A;  4OAI Z;  3FYH A;  2VJ5 A;  4UAR A;  5KT6 A;  3OV7 A;  5KFW A;  3HW8 A;  5HMM A;  2ZIW B;  1L3T A;  3ZDB A;  4YQW A;  3WK5 A;  2W9C A;  3AQM A;  2P6U A;  9ICI A;  5AIC A;  9ICC A;  2CN1 A;  2I9G A;  3QXG A;  4ED3 A;  2EZX A;  4M04 A;  5JUM A;  2KIC A;  2VA8 A;  1OW5 A;  3JCF A;  3KBB A;  2VAN A;  4I2A A;  3NAS A;  4KN7 A;  3AQL A;  2ES6 A;  4OAG A;  5J2K A;  2R8G A;  3MC1 A;  1Z3E B;  1H38 A;  2E8M A;  4IRK A;  8ICH A;  4K8V A;  4BJQ A;  1T8E A;  5B3P A;  2EWR A;  2RP5 A;  3F2D A;  4KLG A;  3KZI U;  4E0D A;  4OAH A;  4NV0 A;  1UEU A;  2PFO A;  5CWR A;  4XQ8 A;  5KFD A;  2BDU A;  3OTQ A;  4K97 A;  3RH6 A;  4TQS A;  3OJS A;  2KD1 A;  2OYY A;  1CUK A;  3VC8 A;  4JV0 A;  5DB7 A;  1QH9 A;  1ZQ1 C;  1D9D A;  7ICR A;  1SB3 C;  4LJX A;  3MR6 A;  4WC5 A;  1BPZ A;  2W9M A;  2WHE A;  1SGG A;  4EX6 A;  2FLL A;  4NLG A;  3ER9 B;  3TAD C;  4QWD A;  3BJY A;  2KKV A;  3HKZ F;  1Z4O A;  4N7R A;  7ICP A;  3WK6 A;  4YXJ A;  1NJW A;  4CF4 A;  3QUB A;  1ZQK A;  5AKJ A;  3TAN A;  1NK4 A;  1PK3 A;  5J29 A;  2WTF A;  1RQL A;  5CJ7 A;  2G5I B;  5KFX A;  2KN7 A;  2O6K A;  1KSP A;  4FZN A;  2OH2 A;  2K4I A;  2JH7 A;  4Y2X A;  5HRG A;  4DLE A;  1ZD2 P;  5JRT A;  2HHT A;  4F4Z A;  4UB2 A;  4QIW C;  1ZD4 A;  3MDA A;  1UT8 A;  1L7P A;  4P0P A;  2EAO A;  4B6J A;  3I76 A;  2ALZ A;  1FIQ A;  2DPJ A;  5J8Y A;  4WC1 A;  5AM2 A;  4K4H A;  4AYB C;  3N4M B;  1WOT A;  4QNL A;  1NNL A;  2FDR A;  2HVH A;  4J9P A;  2GH1 A;  4NWI A;  3IDW A;  3V7J A;  5ALF A;  9ICE A;  3NVY A;  3U26 A;  4UD5 A;  1X40 A;  3M9N B;  3GFK B;  5KT3 A;  1S0O A;  3KFU F;  1CRX A;  3SMV A;  1S76 D;  5HRI A;  4O68 A;  4Q8F A;  1Z1V A;  1TV9 A;  4A8E A;  1FFU A;  5ALT A;  3ORY A;  4WC4 A;  4M9G A;  5L1I A;  5KG6 A;  5KFE A;  4ZOH C;  1N63 A;  1N5W A;  1V4A A;  5AKL A;  2KJ9 A;  2BBJ A;  1BPX A;  4IRC A;  3IRU A;  4C80 A;  1B43 A;  4RQ1 A;  4NLN A;  2OCE A;  2KSO B;  2AGQ A;  4F4K A;  2NRX A;  1RZT A;  3EF2 A;  4GC6 A;  3H37 A;  1A77 A;  4EP7 A;  4Y2U A;  4KLE A;  1N60 A;  5J2I A;  1TFR A;  4IQU A;  4BX9 C;  1TFW A;  4NLB A;  5ALP A;  3FM9 A;  4NLC A;  3ZI4 A;  4M2Y A;  4NL9 C;  1VFG A;  4XA5 A;  3LWM A;  3TAQ A;  2ZH4 A;  1ZQI A;  1BNO A;  2IOH A;  1S0N A;  9ICP A;  4F2R A;  4DL5 A;  2E8N A;  1SWV A;  5AI6 A;  2W9B A;  4FHV A;  5DB9 A;  1S97 A;  1NOM A;  1T3Q A;  2W03 A;  5J0P A;  3MGV A;  2AGP A;  1X9W A;  2G09 A;  8ICL A;  1Q78 A;  1SV0 A;  5KFY A;  3HRD D;  3MGH A;  3V6J A;  2DRB A;  3RRH A;  4ECV A;  1ZXI A;  2VA2 A;  3IP4 B;  5KL8 B;  2G08 A;  3PW5 A;  5AI0 A;  5D49 A;  2WF5 A;  9ICF A;  3TAP A;  3SAG A;  5HR6 A;  1LB2 B;  1TK5 A;  4M0A A;  4X4Q A;  4CE6 A;  1L8L A;  2GOL A;  3SYZ A;  5EOZ A;  2R8H A;  2R8J A;  3M1Y A;  1UEV A;  3RBE A;  2CPR A;  4O6A A;  3UXO A;  4Q8E A;  5DB6 A;  5J2E A;  1KFT A;  7ICN A;  3TKA A;  2HI0 A;  3H7I A;  5HRK A;  4QZI A;  5E79 U;  4ED1 A;  3TFR A;  3PW0 A;  1S77 D;  3Q8S B;  1LKY B;  1ZQW A;  4PGX A;  4RWQ A;  2FMP A;  4FZM A;  5EWF A;  4LT6 A;  1PZN A;  1KQQ A;  3RB0 A;  4FO6 A;  4PH5 A;  2ISO A;  2WAQ F;  3RF9 A;  4J03 A;  4I27 A;  4DL6 A;  1ZQD A;  4EBE A;  1TK8 A;  4MF8 A;  2W8K A;  4F92 B;  5AI5 A;  4EEB A;  4O9M A;  4ED6 A;  3IN5 A;  4RNN A;  1ZQZ A;  4QZC A;  5IIM A;  3V7L A;  5CFT A;  1UA1 A;  2FLN A;  2BKE A;  3S6J A;  1QSY A;  5EE1 A;  4E80 A;  1RM6 C;  4QZG A;  2PMZ F;  8ICR A;  3BQ7 A;  1WCL A;  4O3Q A;  4C7Y A;  2LMR A;  1KL9 A;  2XGQ A;  4F4X A;  2M2T A;  2NV3 A;  3RJH A;  4FS1 A;  3K75 D;  3ISB A;  2BHN A;  5ALZ A;  4Y2P A;  3EPG A;  5AI8 A;  2RQ5 A;  5F3X B;  4KLS A;  2W54 A;  5GTI U;  2EQY A;  9ICT A;  1ZQQ A;  4U7C A;  3C2K A;  1ZQN A;  4GLX A;  1WWV A;  5TIS U;  2PFP A;  3NTU A;  4J9N A;  3ISC A;  3NVZ A;  3G6X A;  1ZQF A;  5D63 A;  2M2V A;  4RUA A;  4KLI A;  1NK5 A;  1QSL A;  2YMQ A;  5KFV A;  2MU2 A;  1RG6 A;  4X5V A;  5KFC A;  5J2H A;  2J6S A;  4CCH A;  3HJ1 A;  1KFD A;  5KFP A;  3KHR A;  2Y9T A;  4JMU A;  4G3I A;  1ED1 A;  2Y0S C;  1QQ6 A;  2DPI A;  4RWN A;  5AK3 A;  3IG8 A;  3RBD A;  3OVA A;  4FO1 A;  2JEI A;  4DOA A;  1BNP A;  4FH3 A;  4CF5 A;  4WC7 A;  5KFF A;  4CF3 A;  9ICJ A;  2DKX A;  4IQW A;  1S10 A;  5CA7 A;  2A1A A;  5JTI A;  4ED8 A;  2KTQ A;  2JZB A;  4WJ3 B;  3H4D A;  3GV5 B;  2E5S A;  1Q3V A;  2MSN A;  7ICQ A;  4PGQ A;  2B0C A;  1T7P A;  3SV3 A;  1N2X A;  2H3F A;  4UB8 U;  9ICS A;  3WKB A;  1Z00 B;  3Q8P B;  1HIW A;  2LM4 A;  3SI8 A;  2KOB A;  2YY6 A;  3D2Q A;  2FLP A;  1ZJN A;  2GO7 A;  4M6W B;  4X4O A;  4O3P A;  2R18 A;  5J0Y A;  3C21 A;  4RQ6 A;  7ICL A;  4DSI A;  4RPZ A;  4DL7 A;  2KJ8 A;  4IRD A;  3OUY B;  1HUO A;  3GIK A;  4AT7 B;  9ICN A;  2A19 A;  2HBM A;  1UT5 A;  3RJI A;  4TUS A;  2WB1 F;  5EWG A;  1LVH A;  2BDP A;  2IMW P;  3FC4 A;  3H39 A;  3M7D A;  2WF9 A;  5KNI A;  3WK9 A;  3V6K A;  4QW8 A;  2KHV A;  5D61 A;  1L7N A;  4NKT A;  5FP0 A;  3SV4 A;  2IHN A;  2DWQ A;  3KHH A;  3JPQ A;  5DED A;  4PHA A;  2NRW A;  2XI9 A;  3HIY A;  4HAI A;  5F9N A;  2BPG A;  2DF4 B;  8ICV A;  2NYV A;  2V9W A;  5J0W A;  4GC7 A;  4UAW A;  4C4R A;  2ZIV A;  2PFN A;  8ICJ A;  8ICA A;  1C20 A;  3OJU A;  3PSI A;  3PY8 A;  4C4T A;  4Q43 A;  4RWP A;  1J2N A;  1YZ7 A;  3H8J A;  4AT9 A;  2ZIX B;  5J2B A;  5AKY A;  1X9S A;  3M6Z A;  1R89 A;  1ZRN A;  1F0M A;  2BPF A;  1NI3 A;  3C1Z A;  4PZO A;  3QU2 A;  3H38 A;  2EAP A;  4DL3 A;  4PZN A;  4YMO A;  4R66 A;  4MFF A;  1V9P A;  1RYR A;  4KTQ A;  2MRL A;  1S5L U;  1WG8 A;  3KOO A;  3KKA A;  5HRB A;  3QX7 A;  1HJP A;  2N1R A;  5KG0 A;  1CI4 A;  3JPO A;  2VJ4 A;  4AP9 A;  3H0M B;  4NLZ A;  2DR5 A;  1T94 A;  3ONN A;  2MUT A;  2LBO A;  4FHY A;  2K60 A;  1O03 A;  3WKE A;  5G5H A;  2XID A;  2FPL A;  1TAQ A;  3PSP A;  3MR3 A;  3TQ1 A;  4DFP A;  1OU5 A;  1JRO A;  4BUG A;  4DQI A;  4QZH A;  4EV6 A;  2HHW A;  4US8 A;  1OUQ A;  4RNO A;  5J0Q A;  4ATB B;  5ALO A;  2ESE A;  4EZ9 A;  3PML A;  1QCK A;  3BS5 B;  3QZ7 A;  2Y9U A;  4O69 A;  4Z6F A;  5BOM A;  3EYZ A;  2HOF A;  2FJ6 A;  5KT5 A;  2B4V A;  2C28 A;  1DRG A;  3M9M B;  1XO0 A;  9ICG A;  4EYH B;  2JEJ A;  5AKI A;  1IIP A;  7ICH A;  5J8Y C;  5AK4 A;  2B56 A;  5IIJ A;  1KFS A;  3KZX A;  2EAN A;  1ZD3 A;  2GAF D;  1XU4 A;  4WQK A;  4EZ6 A;  3SQI A;  3BQ0 A;  3OVB A;  1L3V A;  1NKC A;  5HRF A;  7ICI A;  4C8M A;  3PNC A;  8ICK A;  3O0F A;  5DEC A;  4RQ5 A;  3PMN A;  3HT3 A;  5KFM A;  3RB4 A;  4OJP A;  8ICF A;  3PVX A;  5KFK A;  4DEZ A;  5CFS A;  2YTU A;  1NK7 A;  4O3R A;  3CP8 A;  5ALQ A;  1K1Q A;  4C0Z A;  5L1K A;  4KM5 A;  3Q8R B;  1B0X A;  4KLF A;  1UQV A;  2G5H B;  2KJ5 A;  5KG7 A;  3WFP A;  3RJG A;  4MHV A;  3BQT A;  4Y2V A;  4B9T A;  2AXT U;  1R8B A;  5AK6 A;  5KG5 A;  2PXI A;  4UB5 A;  4QZ8 A;  4JLZ A;  3SZ2 A;  1D9F A;  3SAF A;  3AQN A;  1F5S A;  2YB1 A;  3NKU A;  4J9L A;  2ZUC A;  1TAU A;  4DQP A;  3SEN A;  4OJ6 A;  5K4L A;  4KLT A;  1B22 A;  5AM4 A;  2W3S A;  4O67 A;  5ALJ A;  4ECQ A;  5HC9 A;  2QLT A;  5ALE A;  2BCQ A;  5DKW A;  2HHQ A;  5IIK A;  5JU5 A;  3RH5 A;  5HRE A;  2VKQ A;  4ED7 A;  3JYY A;  1SV0 C;  4IG8 A;  1KNY A;  3F2C A;  2E3T A;  1JXE A;  2HDO A;  3ISD A;  1KW4 A;  4RT2 A;  2XIC A;  3N7P D;  2ZG6 A;  3T5H A;  3OWG A;  2IOF A;  4US9 A;  3OSP A;  1C7Y A;  2ZIU A;  2NRZ A;  4IR1 A;  1N61 A;  5AI4 A;  4PJ0 U;  4BWJ A;  5AK5 A;  5L1J A;  4OCZ A;  3L9D A;  4M9H A;  4M47 A;  3B0Y A;  3MFI A;  4GXJ A;  3OVS A;  2A1J A;  1N56 A;  1ZQC A;  4FBT A;  1RYS A;  3WFR E;  5KT7 A;  2KZ3 A;  2W9B B;  7ICS A;  5J2G A;  1COO A;  1RPL A;  5J2A A;  3H0L B;  2FE9 A;  3MCR A;  2EAM A;  2C2D A;  5KTQ A;  5DG8 A;  5DGA A;  3WKD A;  4M9N A;  1U9L A;  3H8S A;  4YN4 A;  2OM6 A;  3TI0 A;  5CHG A;  2AH5 A;  4DOB A;  2DR8 A;  2D8C A;  5DDY A;  4F91 B;  3GU3 A;  4KIT B;  5KT2 A;  4DSJ A;  1YLQ A;  3AEV A;  5DLF A;  3VCB A;  2ZH2 A;  1OXJ A;  3E2E A;  2HOI A;  4RWO A;  3UMC A;  4EBJ A;  5KFQ A;  1XSN A;  2PI5 A;  2EDU A;  3C29 A;  1KDH A;  5C5J A;  2W55 A;  2LHT A;  4RQ7 A;  4CRX A;  4I28 A;  7ICT A;  1A76 A;  1TKD A;  2W04 A;  1S0M A;  4EEL A;  4JV1 A;  5GTH U;  4ED0 A;  2V4R A;  4RQ2 A;  1NKB A;  4C8K A;  1PK1 A;  5TZV A;  1XSL A;  5HRD A;  2ZHA A;  5KFB A;  3I1Y A;  4ELV A;  5CR0 A;  1S9F A;  2Y1I A;  4RQN A;  4Z6C A;  1UET A;  4P0Q B;  2YB4 A;  1ZQM A;  2DL0 A;  2BCV A;  4B9U A;  4ECY A;  7ICK A;  2KIW A;  4WH5 A;  3RJK A;  2JEG A;  2AQ0 A;  3H40 A;  1ZYQ A;  2ZTE A;  1SIJ A;  5AKX A;  4IS7 A;  4RPX A;  2ZIW A;  5KG3 A;  2R8K A;  4YMM A;  3RH4 A;  3D6J A;  2WF6 A;  4RT3 A;  1EXN A;  3G6V A;  4IL6 U;  1NK6 A;  2FPM A;  4M5D A;  4UB4 A;  2JV3 A;  1CEZ A;  3L5K A;  1SKW A;  5ALU A;  2F1J A;  2IHM A;  4F50 A;  2L5Y A;  1TE2 A;  1B4F A;  4DCC A;  3ER8 C;  2K8B B;  2HVI A;  4K98 A;  1FFV A;  5CP2 A;  3PX0 A;  2YMP A;  3H8M A;  4LEV A;  4DSL A;  1D8L A;  4K99 A;  2FCL A;  1NK8 A;  4YVZ A;  2KFZ A;  8ICN A;  4F5Q A;  2HBK A;  3FAH A;  2E8O A;  2ZXH A;  2YX8 A;  3HJE A;  3OHA A;  1DOQ A;  5HHI A;  2BCR A;  1NK9 A;  4EGW A;  4BDP A;  3PR5 B;  2KKP A;  4MEX A;  4F93 B;  2NO4 A;  4C8N A;  4O5E A;  4QIW F;  3DDH A;  3NYB A;  1FA0 A;  1SWW A;  1ZD5 A;  4RQ3 A;  3FDS A;  7ICV A;  5ALD A;  3KHL A;  3DV9 A;  3AQE A;  4R63 A;  5DQH A;  4XJE A;  2HMX A;  3T5J A;  2HW3 A;  5KAF U;  4AYB F;  3NVW A;  3ICX A;  4WC2 A;  2K8C B;  3RRG A;  4OJO A;  3NGD A;  4NJ8 A;  2F77 X;  1KLN A;  4DWI A;  2Q66 A;  5AKG A;  5J2D A;  2ZJA A;  1PVP A;  5KFJ A;  3QZ8 A;  2ZTC A;  2HHX A;  3PHZ A;  1WYG A;  1JX4 A;  5J0S A;  4JK1 A;  5KG2 A;  1MIV A;  3BZK A;  5AKH A;  4QZA A;  3R9K A;  3D2S A;  3TAC B;  4R65 A;  4DF4 A;  3NWI A;  2C22 A;  1NJZ A;  4E7X A;  2BR0 A;  4FFD A;  8ICM A;  2ZHB A;  4I0U A;  1L3S A;  2JGA A;  3WK4 A;  1UHU A;  2QB1 A;  3HPO A;  4AT8 B;  3C2M A;  1KBU A;  2P66 A;  2ASL A;  4F4W A;  4X0B A;  3RJF A;  4Y2R A;  3WK8 A;  4R8U B;  2HHP A;  1SL2 A;  4GFJ A;  2IUB A;  1L7O A;  3F5A A;  2OXO A;  2M2W A;  3GIL A;  2JRZ A;  2EZZ A;  4B9L A;  4P2H A;  2QB0 B;  4AT9 B;  4RUC A;  1SKS A;  3AQK A;  9ICA A;  3NRZ A;  2KSO A;  2I1Q A;  1TVA A;  1X9M A;  4KN4 A;  2D3D A;  3KD3 A;  4WC0 A;  5ALL A;  3LWL A;  3AU6 A;  2G07 A;  1RXW A;  1SXD A;  2KVS A;  3F5E A;  3D2N A;  3ALR A;  4NXZ A;  2H3V A;  4X4U A;  8ICB A;  3CW2 C;  5AM0 A;  1ZQB A;  3GQC A;  4TUR A;  4QZB A;  1X6J A;  1UCV A;  4TQR A;  3UXP A;  5G5G A;  4UAZ A;  2CRX A;  2LYH A;  4X4S A;  1UA0 A;  9ICO A;  4DL4 A;  4F5R A;  3JPN A;  4F3O A;  3PW2 A;  4Q45 A;  1ZRM A;  4K9B A;  1MA7 A;  3K4G A;  4ICA A;  5A0L A;  2PFQ A;  5F9L A;  3THV A;  3T5L A;  4KMU A;  2WF8 A;  4Z6D A;  2H3Z A;  9ICV A;  3QU5 A;  4DS5 A;  3C23 A;  2P35 A;  4IR9 A;  4JV2 A;  2RHF A;  3QNM A;  2AQ4 A;  4WC3 A;  4F72 A;  3QE9 Y;  1HEK A;  1JQR A;  4B9M A;  1DGJ A;  2BQ3 A;  4LEZ A;  3IHQ B;  5AM3 A;  2KG5 A;  4KMO B;  4Y2J A;  1RYU A;  1SZH A;  3ED5 A;  3V72 A;  2QAR B;  3WFS C;  3AUO A;  4EYI B;  1LV5 A;  2IA6 A;  2HBJ A;  1IG6 A;  4LZD A;  1NKE A;  1NO5 A;  5J0O A;  1ZQL A;  5DBB A;  3Q8L A;  8ICE A;  3M9O B;  2AU0 A;  1PX5 A;  3HWT A;  3Q8Q B;  4WBY A;  4MFC A;  2HOQ A;  1KKX A;  2KMD A;  3BQ1 A;  2H3I A;  3CK6 A;  1WCN A;  5DB8 A;  2KE7 A;  3ERC C;  3BS7 A;  1X66 A;  1KN5 A;  3UM9 A;  4HX0 A;  3PX4 A;  4FZL A;  2YQE A;  4QWB A;  2W9C B;  1SV4 A;  4GXK A;  5DQG A;  7ICE A;  2Y0S F;  4BXO A;  3NS1 A;  3H0R B;  2ISP A;  4JLX A;  5H2F U;  2Q0Z X;  8ICY A;  2KHQ A;  3QYP A;  3NUQ A;  4DSK A;  3QUT A;  4LEY A;  4NLK A;  1J2M A;  3EZ5 A;  2C2E A;  3K1Z A;  1DXS A;  3EWA A;  1PVQ A;  1L3U A;  4K4G A;  3RJE A;  4UBB A;  4J9M A;  1T4G A;  2DR9 A;  5ALY A;  5HRL A;  1BPY A;  2LKY A;  1V38 A;  4YXM A;  3K1R B;  3QU7 A;  4ELU A;  3GZF A;  1SL0 A;  2JMG A;  3C18 A;  1KEJ A;  3BDP A;  2ATL A;  1ZQS A;  4EEN A;  2A1J B;  2AJQ A;  2BPC A;  2F1I A;  5IIO A;  1P7D A;  3GV8 B;  1L8O A;  5T14 A;  3JPS A;  2XY5 A;  5ALI A;  1SXE A;  8ICX A;  1A6S A;  1DK3 A;  1BPB A;  2WF7 A;  3JPT A;  1J97 A;  4QZ9 A;  3AM9 A;  5ALH A;  4RNM A;  4FS2 A;  4Y2Y A;  3M8S A;  4C7Z A;  3AL0 B;  4DLG A;  4P4O A;  4QWE A;  4I2J A;  3C66 A;  4DL2 A;  8ICP A;  4KLQ A;  4QW9 A;  1Z00 A;  4NXX A;  3BQ2 A;  4B9S A;  4UB1 A;  2W11 A;  5ALK A;  2BZF A;  2OEH A;  3PV8 A;  8ICG A;  4I2I A;  4J9R A;  5AKZ A;  4M6W A;  4DQR A;  1U49 A;  3OPX A;  5KFG A;  4I29 A;  3KHG A;  4Y2Q A;  1GPJ A;  4X4T A;  3HKZ C;  4KLD A;  1ZQR A;  4ACO A;  2OHF A;  3NVV A;  4P0P B;  4KLH A;  3OUY A;  1ZET A;  7ICM A;  1Y88 A;  1F44 A;  3HIL A;  2HCF A;  4Y2S A;  1NZB A;  3UQ0 A;  4FHW A;  1MN8 A;  5JTG A;  5AKK A;  5IIL A;  2A3V A;  3MFH A;  1ZQE A;  3WK7 A;  3N28 A;  4MF2 A;  4ECU A;  3IG5 A;  4KX3 A;  4Y2T A;  4O3S A;  4RQ0 A;  4QZD A;  3GV7 B;  2UVU A;  4USA A;  3OSN A;  1IXR A;  5DG7 A;  4F5N A;  2NRK A;  1U48 A;  7ICU A;  3PSF A;  5ALR A;  1ZQT A;  1URJ A;  9ICR A;  5CRX A;  3KTQ A;  3Q8K A;  2LI6 A;  2RFF A;  1HUZ A;  5EWE A;  3PX6 A;  4WCW A;  5F2V O;  3V7K A;  2HN2 A;  4FBU A;  4NKU A; 
#chains in the Genus database with same CATH homology
 4KLS A;  4RT3 A;  4R64 A;  3WFO A;  4R8U A;  9ICT A;  4X4P A;  5DGB A;  1EXN A;  3G6V A;  8ICU A;  1NK6 A;  2FPM A;  4M5D A;  4UB4 A;  1ZQQ A;  3C2K A;  1ZQN A;  3OGU A;  4ECT A;  4GLX A;  2PFP A;  1CEZ A;  5KFH A;  4X4V A;  3NTU A;  1SKW A;  4J9N A;  3ISC A;  2F1J A;  3C5G A;  4ED2 A;  2IHM A;  5CB1 A;  4F50 A;  8ICW A;  4O0I A;  2VA3 A;  3G6X A;  1ZQF A;  4PHP A;  2M2V A;  1MIY A;  4YCX A;  3RJJ A;  5HR9 A;  2HVI A;  4RUA A;  4KLI A;  2ZH8 A;  1NK5 A;  5J2C A;  1MQ2 A;  5CP2 A;  4RQ8 A;  1SKR A;  5KFV A;  1ZQO A;  2BCS A;  1QSL A;  4ECW A;  2DR9 A;  3PX0 A;  4P4P A;  4FHP A;  3ZDD A;  3UPS A;  5D4B A;  5KFC A;  5J2H A;  1ZQV A;  4X5V A;  2J6S A;  4CCH A;  1KFD A;  1D8L A;  2RDI A;  4DSL A;  3HJ1 A;  1XWL A;  4S3N A;  5KFP A;  3KHR A;  5L9X A;  2MAX A;  4G3I A;  1NK8 A;  4UB3 A;  2PI4 A;  5KT4 A;  5DBA A;  4RPY A;  3H4B A;  4YVZ A;  4YG2 A;  2KFZ A;  2DPI A;  3RAQ A;  8ICN A;  4RWN A;  4F5Q A;  2KFN A;  3RBD A;  3OVA A;  4KLJ A;  3C5F A;  3ZD9 A;  2JEI A;  8ICZ A;  4DOA A;  1BNP A;  3WFR E;  3M8R A;  2ZUD A;  1ZJM A;  1JAJ A;  4F2S A;  9ICQ A;  3EW9 A;  5KG4 A;  4B9V A;  4LZG A;  2DVI A;  4FH3 A;  2JEF A;  4WC7 A;  5KFF A;  1Q79 A;  2KZZ A;  3OHA A;  1DOQ A;  5HHI A;  2BCR A;  9ICJ A;  4IQW A;  1NK9 A;  3V6H A;  1S10 A;  1UET A;  5CA7 A;  2P6R A;  4ATB A;  4BDP A;  4I2E A;  3UQ2 A;  4MEY A;  3PR5 B;  2R8I A;  4ED8 A;  2KTQ A;  2DR8 A;  2JZB A;  3H4D A;  3GV5 B;  4MEX A;  7ICF A;  5KFL A;  4F93 B;  1T3N A;  1XC9 A;  4C8N A;  1L5U A;  7ICQ A;  4O5E A;  3HP6 A;  4X0A A;  2XY7 A;  4PGQ A;  3NYB A;  1FA0 A;  4RQ3 A;  4GXI A;  1T7P A;  3SV3 A;  1ZQU A;  3FDS A;  3LK9 A;  5L1L A;  3T5K A;  7ICV A;  3KHL A;  9ICS A;  4I2D A;  4P4M A;  2KZM A;  5HP4 A;  2B21 A;  4IQV A;  4R63 A;  3N97 B;  3H3A A;  1Z00 B;  5DQH A;  1XO1 A;  3Q8P B;  5KFT A;  3T5J A;  2ZH6 A;  3SI8 A;  2HW3 A;  1NJY A;  4WC2 A;  1X2I A;  3RRG A;  4YFK A;  2FLP A;  3NGD A;  1ZJN A;  3QEA Z;  4M6W B;  4X4O A;  4J9Q A;  4O3P A;  1RXV A;  2FPK A;  1KLN A;  2BQU A;  4QZF A;  2ZH3 A;  5J0Y A;  4J9O A;  3C21 A;  4XUS A;  4DWI A;  2O1P A;  3MDC A;  1ZQY A;  4E80 A;  2ZH9 A;  2Q66 A;  5J2D A;  4EBC A;  7ICG A;  5DLG A;  4AT7 A;  3MAB A;  4DQS A;  4X4N A;  4RQ6 A;  2ZJA A;  7ICL A;  4DSI A;  4I2G A;  3ZD8 A;  3ZDE A;  4RPZ A;  2XCP A;  4DL7 A;  4F5O A;  4IRD A;  3OUY B;  1HUO A;  3GIK A;  4AT7 B;  5KFJ A;  9ICK A;  9ICN A;  4NM1 A;  4PHD A;  3QZ8 A;  3PO4 A;  2ZTC A;  5KFA A;  2HHX A;  1UT5 A;  3RJI A;  4TUS A;  5J0S A;  1JX4 A;  4JK1 A;  5EWG A;  4DS4 A;  1JIH A;  5KG2 A;  2XO7 A;  1QSS A;  4UBC A;  9ICH A;  2XY6 A;  1R8C A;  2BDP A;  4KLO A;  1MIV A;  2IMW P;  1ZQA A;  4QZA A;  3LQC B;  3H39 A;  3PR4 A;  4R65 A;  3JPP A;  3V6K A;  4DF4 A;  2C22 A;  1U45 A;  1TK0 A;  4QW8 A;  2XGP A;  3T3F A;  5D46 A;  3IM1 A;  1NJZ A;  2AGO A;  7ICJ A;  4F8R A;  4NKT A;  4DFM A;  3SV4 A;  2IHN A;  4DFK A;  2HHU A;  2ASJ A;  4E7X A;  2BR0 A;  3C1Y A;  9ICB A;  3KHH A;  3UPQ A;  4JWM A;  3JPQ A;  4IQT A;  8ICM A;  2ZHB A;  1DK2 A;  5DED A;  4PHA A;  1L3S A;  3PW7 A;  2NRW A;  4EBK A;  4UAY A;  1R8A A;  4B9N A;  3HPO A;  1DGS A;  9ICL A;  1MSW D;  3G6Y A;  3HIY A;  4AT8 B;  5BPC A;  4QWA A;  4BGD A;  5F9N A;  5KFU A;  3C2M A;  2BPG A;  2J6U A;  8ICV A;  4M9J A;  2P66 A;  2V9W A;  5J0W A;  4GC7 A;  3FYH A;  4UAW A;  4JUZ A;  4F4W A;  2ASL A;  4X0B A;  1TFY A;  2PFN A;  2M2U A;  8ICJ A;  4XRH A;  8ICA A;  5KT6 A;  3RJF A;  3OV7 A;  5KFW A;  3HW8 A;  1BPD A;  5HMM A;  3OJU A;  1L3T A;  3ZDB A;  4YQW A;  4C8O A;  3PY8 A;  4R8U B;  2W9C A;  2HHP A;  3AQM A;  2P6U A;  4Q43 A;  4RWP A;  4F5P A;  1SL2 A;  9ICI A;  4YP3 A;  3H8J A;  3RR8 A;  4UQG A;  4AT9 A;  5J2B A;  4YD1 A;  4J9S A;  9ICC A;  2I9G A;  3RR7 A;  2M2W A;  1X9S A;  3GIL A;  1R89 A;  4ED3 A;  4B9L A;  3GIJ A;  4P2H A;  2BPF A;  4AT9 B;  4M04 A;  5JUM A;  4RUC A;  3C1Z A;  3H38 A;  2VA8 A;  1SKS A;  2ZUB A;  3AQK A;  9ICA A;  4DL3 A;  2VAN A;  4I2A A;  4KN7 A;  2UVR A;  2I1Q A;  4YMO A;  1TVA A;  3AQL A;  4O3O A;  4R66 A;  4LVS A;  5J2K A;  4M9L A;  1X9M A;  2R8G A;  4MFF A;  1V9P A;  1Z3E B;  1RYR A;  4KTQ A;  1H38 A;  1NK0 A;  4KN4 A;  2BQR A;  5KG1 A;  4WC0 A;  4IRK A;  8ICH A;  1KRP A;  5HRB A;  3LWL A;  3AU6 A;  1T8E A;  1RXW A;  1HJP A;  4QWC A;  4TUQ A;  1ZQX A;  8ICI A;  5KG0 A;  3JPO A;  4NXZ A;  4O5C A;  4KLG A;  4E0D A;  4NLZ A;  2DR5 A;  4KLU A;  2MUT A;  1UEU A;  4X4U A;  2W8L A;  2PFO A;  5CWR A;  8ICB A;  4ECX A;  4XQ8 A;  4FHY A;  2DRA A;  5KFD A;  1ZQB A;  5KFI A;  3RH6 A;  4TQS A;  2FPL A;  1TAQ A;  3MR3 A;  3TQ1 A;  3GQC A;  3OJS A;  4DFP A;  4TUR A;  1OU5 A;  4QZB A;  4DQI A;  4QZH A;  3RTV A;  2HHW A;  1CUK A;  4RNO A;  4JV0 A;  5J0Q A;  4ATB B;  5DB7 A;  1D9D A;  7ICR A;  4EEY A;  4EZ9 A;  2XC9 A;  3MR6 A;  4WC5 A;  2JZB B;  1BPZ A;  4TQR A;  5HNK A;  3PML A;  2W9M A;  2W9A A;  1SZP A;  3UXP A;  3QZ7 A;  4UAZ A;  2FLL A;  4Z6F A;  4NLG A;  4QWD A;  2LYH A;  5BOM A;  3WFQ E;  3EYZ A;  3B0X A;  1UA0 A;  3BJY A;  9ICO A;  4XQ7 A;  4DL4 A;  4X4S A;  4F5R A;  5KT5 A;  2C28 A;  7ICP A;  3JPN A;  4DO9 A;  4YXJ A;  2FMQ A;  4DFJ A;  1NJW A;  4F3O A;  3PW2 A;  4Q45 A;  3M9M B;  4X4R A;  9ICG A;  4EYH B;  3K4G A;  2JEJ A;  2NRT A;  4DQQ A;  4ECR A;  1ZQK A;  7ICH A;  4Z6E A;  3TAN A;  3TAR A;  1NK4 A;  2PFQ A;  4ECS A;  5F9L A;  3THV A;  3T5L A;  1N48 A;  3RB3 A;  5J29 A;  2WTF A;  5IIJ A;  4FH5 A;  4KMU A;  1KFS A;  4Z6D A;  5CJ7 A;  4E8F A;  8ICT A;  4DS5 A;  9ICV A;  3C23 A;  5KFX A;  1NZP A;  2KN7 A;  4ZH4 A;  1BVS A;  1KSP A;  1XU4 A;  5KFZ A;  5HRG A;  5J0R A;  4EZ6 A;  1JN3 A;  4IR9 A;  4JV2 A;  4J9K A;  4DLE A;  3BQ0 A;  3OVB A;  1L3V A;  2AQ4 A;  1NKC A;  1KTQ A;  5HRF A;  2HHT A;  1QTM A;  7ICI A;  4C8M A;  3PNC A;  9ICM A;  4F4Z A;  4UB2 A;  8ICK A;  4WC3 A;  3QE9 Y;  4NY8 A;  5J0T A;  5DEC A;  5HML A;  9ICU A;  3Q8M A;  4BWM A;  3MDA A;  1BPE A;  4YR3 A;  1UT8 A;  2V4Q A;  1JQR A;  4B9M A;  4RQ5 A;  2BQ3 A;  3PMN A;  3IHQ B;  3HT3 A;  4KLM A;  2ALZ A;  5KFM A;  3RB4 A;  4PHE A;  8ICF A;  3PVX A;  5KFK A;  3V72 A;  4DEZ A;  3TFS A;  2DPJ A;  4WC1 A;  3WFS C;  3AUO A;  2KP7 A;  4K4H A;  4EYI B;  1LV5 A;  4TUP A;  3N4M B;  1WOT A;  2IA6 A;  3HX0 A;  4YMN A;  1NK7 A;  4LZD A;  1K1Q A;  5L1K A;  1NKE A;  2C2R A;  4O3R A;  4F4Y A;  8ICR A;  1SL1 A;  1NO5 A;  5KFS A;  4DSF A;  5J0O A;  3Q8R B;  3QEB Z;  4I2B A;  4KLF A;  1ZQL A;  5DBB A;  3WFP A;  5KG7 A;  3Q8L A;  2HVH A;  8ICE A;  4J9P A;  3RJG A;  9ICX A;  3M9O B;  9ICW A;  4DSE A;  3BQT A;  4I2H A;  3V7J A;  2AU0 A;  1ZQP A;  9ICE A;  1PX5 A;  3HWT A;  3Q8Q B;  4B9T A;  4WBY A;  4MFC A;  1R8B A;  5KG5 A;  2PXI A;  1F5A A;  2ZTD A;  4UB5 A;  2PBE A;  4UD5 A;  4QZ8 A;  1ZQJ A;  3M9N B;  5KFN A;  3GFK B;  3BQ1 A;  3SZ2 A;  1D9F A;  5KT3 A;  3AQN A;  1WCN A;  1JMS A;  5DB8 A;  5DQI A;  1S0O A;  1U47 A;  2M9N A;  3ZDC A;  3UXN A;  1S76 D;  5HRI A;  4J9L A;  2ZUC A;  4Q8F A;  1TAU A;  4DQP A;  1TV9 A;  4O3N A;  3PX4 A;  8ICQ A;  4KLT A;  1B22 A;  4WC6 A;  4QWB A;  3ORY A;  3EPI A;  2W9C B;  1XSP A;  4WBZ A;  4WC4 A;  4GXK A;  4PGY A;  5DBC A;  5DQG A;  3MR5 A;  5L1I A;  4ECQ A;  3MBY A;  3LDA A;  5KG6 A;  5KFE A;  2J6T A;  4BXO A;  7ICE A;  5HC9 A;  2ISP A;  5J2F A;  2Q0Z X;  8ICY A;  2RDJ A;  1V4A A;  2DFL A;  4BXO B;  1BPX A;  4DSK A;  2BCQ A;  4IRC A;  5DKW A;  1B43 A;  1NJX A;  4NLK A;  4RQ1 A;  4NLN A;  2HHQ A;  5IIK A;  7ICO A;  3RH5 A;  3EZ5 A;  2AGQ A;  2NRX A;  4ED7 A;  2C2E A;  1RZT A;  4F4K A;  5HRE A;  3JYY A;  1K1S A;  2ZH5 A;  3EWA A;  1KNY A;  4IG8 A;  4MFA A;  4C8L A;  4GC6 A;  1JXE A;  4DF8 A;  3H37 A;  3ISD A;  1A77 A;  4RT2 A;  1L3U A;  4K4G A;  4EP7 A;  5BOL A;  2OWO A;  4QZE A;  4KLE A;  5J2I A;  4HYK A;  1TFR A;  4IQU A;  3T5H A;  4RZR A;  3RJE A;  2DR7 A;  1TFW A;  4UBB A;  4J9M A;  4M2Y A;  5HRH A;  3ZDA A;  1T4G A;  3OSP A;  1VFG A;  4XA5 A;  3LWM A;  5IIN A;  3TAQ A;  1C7Y A;  1ZQI A;  2HHS A;  3ETL A;  2ZH4 A;  5HRL A;  4YR0 A;  1BPY A;  2NRZ A;  1MQ3 A;  2MUT B;  5J0U A;  1S0N A;  2GWS A;  4IR1 A;  1BNO A;  3GIM A;  4YXM A;  4BWJ A;  4DOC A;  5L1J A;  9ICP A;  5KFO A;  4F2R A;  4DL5 A;  3L9D A;  4M9H A;  4M47 A;  3B0Y A;  3MFI A;  1MC8 A;  2W9B A;  4GXJ A;  4ELU A;  8ICS A;  4FHV A;  2A1J A;  5DB9 A;  1NOM A;  5J0P A;  2AGP A;  1X9W A;  1S97 A;  4NM2 A;  1N56 A;  2ASD A;  1ZQC A;  1SL0 A;  4FBT A;  8ICL A;  1RYS A;  4YD2 A;  1Q78 A;  2ZJ8 A;  1KEJ A;  3BDP A;  5KT7 A;  3C18 A;  5KFY A;  2H5X A;  2KZ3 A;  2W9B B;  3MGH A;  2ATL A;  4I2F A;  1ZQS A;  4FHX A;  2A1J B;  5DG9 A;  3V6J A;  2AJQ A;  7ICS A;  2BPC A;  1COO A;  2F1I A;  1RPL A;  5J2G A;  5IIO A;  5J2A A;  3RRH A;  4ECV A;  2VA2 A;  2DRB A;  8ICO A;  3GV8 B;  3PW5 A;  5D49 A;  2ZJ5 A;  1ZQG A;  3JPS A;  2XY5 A;  3OVS A;  2C2D A;  5KTQ A;  5DG8 A;  8ICX A;  1BPB A;  9ICF A;  5DGA A;  1DK3 A;  3JPT A;  4RU9 A;  3TAP A;  2IBK A;  4QZ9 A;  4M9N A;  1U9L A;  3H8S A;  1LB2 B;  4FS2 A;  4RNM A;  1TK5 A;  4M0A A;  2ID1 A;  3M8S A;  4X4Q A;  4YN4 A;  4DLG A;  2HHV A;  4P4O A;  4QWE A;  4I2J A;  5CHG A;  3SYZ A;  4DL2 A;  5EOZ A;  3TI0 A;  3C66 A;  4DOB A;  8ICP A;  3RH4 A;  1U4B A;  4KLQ A;  5DDY A;  2R8H A;  4F91 B;  4QW9 A;  3PW4 A;  2FMS A;  3RBE A;  2R8J A;  1UEV A;  1Z00 A;  4KIT B;  5KT2 A;  3BQ2 A;  2BCU A;  4DSJ A;  3UXO A;  2Y1J A;  4B9S A;  5DB6 A;  4Q8E A;  5J2E A;  4UB1 A;  1YLQ A;  2ZH1 A;  1KFT A;  7ICN A;  5DLF A;  3PV8 A;  1XS9 D;  3MGI A;  4I2I A;  5DDM A;  4J9R A;  4PPX A;  3E2E A;  8ICG A;  3H7I A;  2ZH2 A;  4RWO A;  3JZ0 A;  1D8Y A;  4M6W A;  5HRK A;  4EBJ A;  4QZI A;  5KFQ A;  1XSN A;  2ZH7 A;  2PI5 A;  4DQR A;  4ED1 A;  3TFR A;  1U49 A;  8ICC A;  1BGX T;  3PW0 A;  5KFG A;  4YR2 A;  1S77 D;  3Q8S B;  1KDH A;  3KHG A;  4I29 A;  4O5K A;  1MIW A;  4X4T A;  1ARO P;  5C5J A;  4KLD A;  3MR2 A;  1ZQW A;  4PGX A;  1ZQR A;  4RWQ A;  2FMP A;  4RQ7 A;  5EWF A;  4LT6 A;  4KLH A;  1PZN A;  3OUY A;  3RAX A;  3RB0 A;  1ZET A;  7ICM A;  4FO6 A;  1Y88 A;  4PH5 A;  4I28 A;  7ICT A;  2ISO A;  2XCA A;  4I27 A;  4K4I A;  3H8W A;  1A76 A;  1TKD A;  4FHW A;  3UQ0 A;  5KFR A;  4DL6 A;  1S0M A;  4JWN A;  1ZQD A;  1ZQH A;  4JV1 A;  4EBE A;  4ED0 A;  1TK8 A;  2V4R A;  5IIL A;  4RQ2 A;  4MF8 A;  2W8K A;  4I2C A;  1NKB A;  4M9G A;  3AU2 A;  3MFH A;  4F92 B;  1ZQE A;  4C8K A;  4O9M A;  4ED6 A;  5TZV A;  4UD4 A;  2UVV A;  4RNN A;  4ECZ A;  2NRV A;  3C2L A;  1XSL A;  1ZQZ A;  4ECU A;  4QZC A;  5IIM A;  4MF2 A;  5HRD A;  1VJ7 A;  2ZHA A;  3V7L A;  5KFB A;  5J2J A;  2F1H A;  1UA1 A;  2FLN A;  4ELV A;  3OHB A;  5CR0 A;  4EBD A;  2Y1I A;  1S9F A;  4O3S A;  4RQ0 A;  2BKE A;  4QZD A;  3GV7 B;  1JXL A;  1QSY A;  3RB6 A;  4Z6C A;  2UVW A;  2UVU A;  3OSN A;  1IXR A;  5HHH A;  4QZG A;  5DG7 A;  1ZQM A;  4ELT A;  4F5N A;  5J0X A;  3PO5 A;  2BCV A;  4B9U A;  1S0V A;  2NRK A;  4Q44 A;  4ECY A;  7ICK A;  1U48 A;  7ICU A;  4AT8 A;  1ZQT A;  2BE3 A;  1WCL A;  9ICR A;  4O3Q A;  2O5A A;  2XGQ A;  3HJ4 A;  3GDX A;  4F4X A;  3RJK A;  2M2T A;  1QLN A;  2JEG A;  3KTQ A;  3RJH A;  4KLL A;  2AQ0 A;  3Q8K A;  4FS1 A;  5III A;  2BGW A;  3K75 D;  4RQ4 A;  3H40 A;  1ZYQ A;  2RFF A;  3ISB A;  2BHN A;  2ZTE A;  1HUZ A;  5EWE A;  3PX6 A;  4WCW A;  5F2V O;  3JPR A;  3V7K A;  4RPX A;  5KG3 A;  3EPG A;  1IM4 A;  2R8K A;  3GII A;  4FBU A;  4YMM A;  4NKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...