4MF8A

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ctp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
318
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 318
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf8A03
2BPGA 4RNNA 5L1IA 2ZH4A 4EEYA 4ECZA 3EPIA 3T5KA 1CUKA 5DBBA 4X4SA 1ZQTA 4KLGA 4DSLA 9ICAA 1A77A 2FPMA 5KFUA 3NYBA 2MAXA 1SL2A 1WCNA 2HVIA 2ZH8A 3EPGA 4MEXA 4F5NA 2Y1JA 2M2VA 1S9FA 5KFRA 2NRXA 5J0YA 4UAYA 3OSNA 2ZJ8A 3ZDEA 4O3QA 2I1QA 3C23A 3TAQA 1TAUA 3V7JA 3OUYA 2P6UA 4YG2A 4DL7A 9ICSA 1RPLA 4MEYA 4F50A 3RR8A 2P6RA 4P4MA 4MFAA 1B22A 4KLLA 5J2JA 4C8OA 5KFMA 2XY6A 4P4OA 4QZDA 5CP2A 3TANA 1L3SA 4S3NA 4EBEA 2ZJAA 2UVVA 4ELUA 4HYKA 4IQTA 5DB7A 4UAWA 4UB5A 4PHDA 4JWNA 4I2EA 4NLNA 1YLQA 3RJHA 3JPTA 1KRPA 4F8RA 3Q8MA 3JPQA 4KLJA 5CJ7A 4PHEA 3JPNA 1TKDA 1NK4A 3GQCA 2KZZA 5HC9A 5DQHA 3PW2A 2JEFA 5EWEA 3V7KA 2H5XA 5J0PA 4R66A 2J6SA 3C18A 4C8MA 5J2DA 4K4HA 4AT9A 2XCAA 1MSWD 3JPRA 2HHWA 3Q8KA 8ICQA 1DK3A 3LWMA 3UPQA 4WC5A 4EBJA 2HHTA 4R8UB 8ICNA 4RQ1A 5KFTA 1K1QA 4J9MA 3JYYA 4NKTA 2DFLA 4KLHA 1L3TA 2PI4A 4F92B 1RZTA 1KTQA 5J0OA 5HNKA 4QZIA 4B9TA 1Z3EB 4FHWA 2ZH9A 3BQTA 3H8WA 3ETLA 5DLGA 4J9LA 9ICXA 2XGPA 4EZ6A 2ZTDA 3Q8PB 2Y1IA 7ICUA 1NKCA 5DG8A 7ICGA 3LWLA 4KLIA 3SV4A 1BVSA 4QWBA 4RPXA 4YR2A 1TVAA 2BGWA 1UEVA 4RU9A 3M9OB 5IILA 5DG9A 4PPXA 3FDSA 3PX0A 4M47A 4WC3A 7ICLA 1BNOA 2FLNA 3BQ1A 4RUCA 5IIJA 3C5FA 4DSJA 1ZQFA 4YXJA 4M9NA 3PR5B 4WC1A 3RJFA 3PV8A 4I29A 4FHVA 3EW9A 5EOZA 4IRDA 9ICPA 2F1JA 4EBCA 4DFMA 2P66A 4LT6A 5HHHA 4FHYA 4WBZA 3GIKA 4DL2A 2NRVA 1ZETA 4O5KA 4E7XA 2IBKA 1ZQUA 1RXVA 4I2AA 4DOCA 4QWCA 3L9DA 8ICVA 5EWFA 2NRZA 2DRBA 2AU0A 1XSPA 2AGOA 1HUZA 3H40A 3GILA 3PW7A 5HMLA 1S0VA 3JPOA 8ICHA 5KFYA 4DSEA 1MQ3A 4I2DA 8ICZA 4R64A 2M2UA 2ALZA 3G6VA 5KFCA 3PY8A 4R65A 4FS2A 3HJ1A 4PHPA 3MGHA 1TAQA 1K1SA 5DLFA 2IA6A 3SZ2A 8ICYA 9ICGA 1UEUA 4FHPA 4AT7B 4I2JA 3TAPA 2AQ4A 2ISPA 4M6WB 4Z6EA 4RQ4A 3IM1A 4QW8A 5L1KA 4KITB 3TQ1A 2BCVA 7ICNA 1L5UA 4PHAA 5KFBA 4M9LA 5KFFA 3H4DA 1DOQA 4BGDA 4KLDA 4IQUA 4F2SA 1ZQJA 2KP7A 1T4GA 4DLEA 1NK7A 1R8BA 4QZCA 4WBYA 2M9NA 5KT5A 2C2RA 5C5JA 4QZEA 5KG1A 9ICWA 8ICPA 1MIYA 2ZHAA 3M8RA 5KFEA 5KG6A 1IXRA 4O5EA 8ICJA 3RBEA 2KTQA 5D46A 4PGQA 2AGPA 2HHQA 3AQNA 1XC9A 4XA5A 1N56A 4RWOA 4ECSA 4F4WA 1U47A 1S10A 7ICQA 8ICEA 3ZD9A 2BPFA 8ICSA 2R8JA 4C8NA 5KFKA 8ICGA 3WFQE 5KFXA 3UQ0A 2UVWA 4BDPA 4X4TA 4QZAA 1T3NA 4XQ7A 1ZQMA 2A1JA 5J2EA 4X5VA 7ICTA 9ICOA 1IM4A 1UA0A 4JV1A 4ECVA 2DPJA 4M5DA 4IR1A 4FBTA 4UAZA 2JEGA 1R8AA 4DSKA 1ZQIA 4QZBA 4FH3A 4QZ9A 1Z00A 4TQRA 1CEZA 1Q78A 4DQQA 5DDMA 2VANA 4UB1A 4J9OA 8ICCA 1X9MA 8ICTA 4DOBA 2BHNA 1SKWA 4I2GA 5KFZA 1WCLA 3PVXA 1U4BA 2BQ3A 9ICUA 1V9PA 2PFNA 4MFCA 3QEBZ 5KT7A 2HHSA 4WC0A 5KFAA 2BCQA 3RB6A 2HHUA 2ZTCA 1BPEA 5IIIA 2JZBA 4J9QA 1TK8A 2VA3A 4MF2A 3OVSA 5DGBA 3GV8B 5DDYA 4YN4A 5KFIA 5CR0A 2HVHA 2ASDA 7ICPA 2R8IA 3MR2A 3TI0A 1NK6A 4ELTA 4QZHA 3V6KA 3HJ4A 2ISOA 3JPSA 4M0AA 3WFRE 4EP7A 4TURA 4ECTA 7ICEA 4KLMA 2ZUDA 4O5CA 4I2IA 3PNCA 4UBBA 4TUSA 2HW3A 9ICKA 9ICLA 3JZ0A 3PMLA 3ZDDA 3RAQA 8ICBA 3RBDA 4RQ6A 2R8GA 4RNOA 4UD4A 2DR7A 1U49A 1TFWA 4X0BA 3EWAA 1BPBA 1ZQRA 4X4RA 5KT2A 3MR5A 4J9PA 2ZH2A 3C1ZA 5J0TA 1D8LA 1ZQAA 4KMUA 8ICMA 2IHMA 1NJZA 5HHIA 3HX0A 1ZQDA 4X4QA 2O1PA 2R8HA 3C66A 4AT7A 3GFKB 5KFNA 4RWPA 4I2HA 1S76D 4PGXA 5TZVA 1JXLA 4NLZA 5J0QA 2IHNA 4BWMA 1R8CA 2PXIA 4FO6A 2JEIA 8ICKA 5KFDA 3QZ8A 4GXKA 4I2CA 9ICFA 2ID1A 4F93B 4C8KA 1JAJA 1X2IA 2ATLA 1KFDA 4YR0A 1Y88A 1JX4A 1BPYA 4ECXA 3E2EA 1PX5A 3B0YA 4FBUA 7ICHA 2ZUBA 5IIOA 3ZDBA 3LK9A 2VA8A 1X9WA 1ZJNA 1ZQLA 2B21A 2M2WA 3WFSC 4MF8A 3GIIA 5J0XA 3RH5A 2ZH5A 3M8SA 1S0NA 4JWMA 8ICWA 5CA7A 1WOTA 4R8UA 4JV0A 2O5AA 3ZD8A 2F1HA 1BPZA 4F5QA 1ZQYA 3H4BA 2C28A 5KFQA 3EYZA 3H38A 2PFQA 5DKWA 4DO9A 3AU6A 2BCUA 1DK2A 1NOMA 4NM2A 4J9SA 4ZH4A 4QZ8A 5BOMA 3MDCA 3T5HA 9ICRA 5IINA 2BE3A 4RT2A 3TARA 4I28A 4M9JA 1A76A 1F5AA 4F4ZA 4ELVA 3H3AA 3C5GA 4TUQA 2JZBB 4QWAA 4IG8A 5HRDA 4M9GA 5KT6A 5EWGA 2C2EA 1NK5A 3RJEA 5DECA 4RWNA 1XSNA 4K4GA 2ASJA 3LQCB 3AQKA 2DR9A 4RPZA 1XO1A 2ZUCA 4DL6A 3UQ2A 5KFGA 3SI8A 1BPDA 2VA2A 4DFJA 3C2LA 1ZQSA 3H8JA 3ISBA 4F3OA 3OVAA 1XS9D 2ZH1A 4RZRA 4J9RA 5IIKA 4ED3A 4Q43A 4F91B 2BR0A 4XRHA 2FMPA 5HRBA 3RJGA 3NTUA 2PI5A 1S97A 2BQRA 2XCPA 4ED2A 4B9LA 4M6WA 5KG2A 7ICKA 2C22A 1TK5A 1L3VA 1HUOA 5J2BA 2C2DA 8ICXA 4NM1A 4UB4A 5KG5A 5DB6A 4UQGA 1NKEA 4O3RA 1OU5A 4XQ8A 4Q8EA 4GC7A 5J0UA 7ICFA 4UB3A 3GV7B 2A1JB 3HPOA 3M9MB 5JUMA 3OV7A 2RDIA 5DB8A 3KHGA 1SL1A 5DQGA 5KG7A 4E8FA 5F9NA 4DF4A 1Z00B 4YFKA 1XSLA 4WCWA 3T3FA 2KZMA 3HW8A 4KLOA 4YMMA 3MBYA 3QE9Y 4Q45A 3QZ7A 5DGAA 2HHVA 3RH6A 1LB2B 4YR3A 4B9MA 1UT8A 3UPSA 4FS1A 1H38A 2W9CA 2XGQA 4GXJA 5HRIA 4EBKA 1JN3A 4DOAA 4RNMA 8ICIA 3OJSA 5HP4A 3Q8SB 1S0OA 1SKRA 1C7YA 1NKBA 5HRLA 4DL5A 9ICVA 1NZPA 5J2IA 2IMWP 4DLGA 4Z6DA 2LYHA 4Z6FA 2PBEA 3MFHA 4DS5A 4KTQA 4E80A 4DF8A 1ZQZA 3N4MB 3THVA 1EXNA 3Q8LA 2KZ3A 2ZTEA 3PO5A 1ZQEA 1ZQQA 4IR9A 4O3OA 4RQ8A 5J29A 5J2HA 1COOA 4RWQA 2PFPA 5KFJA 3C21A 1MC8A 4RQ2A 4F4YA 4YVZA 1BNPA 4P4PA 5D4BA 4YQWA 3RB4A 1UA1A 8ICFA 1V4AA 2XY7A 3RB0A 4YMOA 5DBAA 2FMSA 4JV2A 4O3PA 1MIVA 4X4PA 2ZJ5A 1S0MA 5KFOA 3K4GA 3G6XA 3KHHA 4TQSA 3GV5B 4G3IA 4I2FA 1PZNA 5D49A 3PW4A 4NLKA 1U9LA 2V4QA 4PGYA 4UBCA 3RJIA 3AU2A 4X4VA 7ICOA 4ECWA 4DSFA 4ED1A 3PW5A 4F4KA 3V7LA 4Q44A 3TFSA 4X4UA 5HR9A 4RPYA 2W8LA 1ZYQA 5HRGA 5BOLA 3RTVA 1SKSA 3BDPA 3C1YA 1NJYA 5DB9A 3BQ0A 1S77D 7ICSA 3C2MA 1ZQBA 2OWOA 4YD2A 4C8LA 4LZGA 4XUSA 4IRKA 1XWLA 2XY5A 1RYSA 1QLNA 1D8YA 1TFRA 3NGDA 2XC9A 1T8EA 5DEDA 5J2FA 4K4IA 1DGSA 4M04A 1NJXA 4ED0A 5KFSA 4KLEA 4BWJA 3OGUA 1JMSA 2W9AA 4B9VA 4DQPA 4NY8A 2ZHBA 3BJYA 4JUZA 1BGXT 4BXOA 2DR8A 1MIWA 3V72A 3BQ2A 4DSIA 4AT8A 4F4XA 4ECQA 1RXWA 1ZQNA 2R8KA 2AJQA 4RT3A 1KSPA 2J6UA 1JXEA 2MUTA 1QSYA 1KLNA 5KG4A 3ISDA 4KLFA 1AROP 3PX6A 2HHPA 2W8KA 5J0WA 1ZQHA 4GLXA 5L1LA 9ICMA 7ICRA 1FA0A 1T7PA 2NRKA 4YCXA 2PFOA 4WC7A 8ICOA 3Q8QB 5L9XA 5KT3A 5BPCA 9ICNA 4YMNA 4GXIA 5J0SA 3IHQB 3RRHA 3MFIA 3HWTA 1QSSA 3RRGA 1ZQCA 4F5PA 2W9BA 1D9FA 5F2VO 3RR7A 3SV3A 5DBCA 3UXOA 9ICHA 4O3SA 2BKEA 3AQLA 3PW0A 2RDJA 2BQUA 9ICIA 4Z6CA 3MGIA 3MABA 1Q79A 4LVSA 4ED8A 4RUAA 4DQSA 2J6TA 7ICVA 3RB3A 8ICUA 4ED6A 5HMMA 3GIJA 2BCRA 4DWIA 3QEAZ 2F1IA 2ZH7A 1ZQGA 7ICIA 1ZQPA 4DQIA 4DEZA 1LV5A 2ASLA 5KFHA 4KN7A 1SL0A 2FMQA 4AT9B 3RAXA 3MR3A 4DL4A 2UVUA 3ORYA 4WC6A 1TFYA 1U48A 3ZDAA 4WC4A 3H7IA 4EYIB 3EZ5A 5CHGA 2HHXA 4KLTA 1HJPA 3RJKA 2DRAA 1U45A 4I2BA 4YP3A 3V6JA 4F2RA 4B9SA 3GIMA 2W9MA 4DFKA 1NK0A 1ZQOA 3AQMA 4QZFA 5KFWA 1JIHA 4IRCA 1D9DA 5J2AA 3RH4A 1L3UA 3T5LA 2GWSA 4X0AA 3OUYB 4X4NA 4YXMA 1TK0A 2ZH3A 5HRKA 2MUTB 4E0DA 4IQVA 1B43A 2FPKA 4QWDA 4GC6A 4B9UA 4DFPA 3HIYA 2FLPA 1ZQXA 4KLUA 1KEJA 3K75D 2Q0ZX 3AUOA 2V9WA 1NK9A 4P2HA 4QW9A 4CCHA 5KG0A 3TFRA 4KLQA 2NRTA 3FYHA 4KN4A 2AGQA 3RJJA 8ICLA 1NO5A 1R89A 4FHXA 4UD5A 4WC2A 2ZH6A 4KLSA 4EZ9A 9ICBA 1UT5A 1SZPA 3UXPA 3M9NB 1ZJMA 2M2TA 3V6HA 2KFNA 7ICMA 2UVRA 4RQ0A 3ISCA 5J2CA 2JEJA 4O0IA 2KN7A 4RQ5A 3PX4A 3KHLA 4ECUA 4QWEA 3T5JA 3OSPA 2W9CB 1ZQKA 2BCSA 1QTMA 2WTFA 1VFGA 2NRWA 4Q8FA 1JQRA 2W9BB 4M9HA 2Q66A 5DG7A 9ICEA 3HP6A 3JPPA 3KHRA 4DQRA 1RYRA 1QSLA 7ICJA 5KFLA 5KT4A 8ICAA 2DPIA 5F9LA 4IQWA 5CB1A 4R63A 4AT8B 4RQ3A 2RFFA 4TUPA 3OJUA 4F5RA 2XO7A 3UXNA 4ED7A 5IIMA 4EBDA 1KDHA 1KFSA 5HREA 4X4OA 9ICTA 3OVBA 4DS4A 3LDAA 2AQ0A 1MQ2A 4ECRA 3Q8RB 5L1JA 1VJ7A 3WFPA 2DVIA 3OHBA 4M2YA 4O3NA 1UETA 5HRFA 3WFOA 2FPLA 3H37A 4NKUA 4F5OA 5J2KA 4ATBB 5CWRA 4FH5A 1TV9A 2V4RA 5KTQA 5KFPA 3G6YA 2I9GA 9ICJA 4BXOB 4J9KA 2DR5A 4JK1A 4UB2A 3SYZA 5KFVA 2FLLA 1KFTA 5J2GA 3B0XA 3MR6A 8ICRA 4EYHB 3MDAA 5KG3A 1NJWA 4RQ7A 3N97B 3H39A 4ECYA 3KTQA 3H8SA 5DQIA 2BPCA 4YD1A 3PMNA 4QZGA 4NLGA 4DL3A 4PH5A 5HRHA 1N48A 1XU4A 4MFFA 1NK8A 4O9MA 1KNYA 5J0RA 2BDPA 3HT3A 2KFZA 4B9NA 3C2KA 1BPXA 3PO4A 1ZQVA 3OHAA 3ZDCA 9ICQA 4LZDA 3PR4A 4NXZA 1ZQWA 3GDXA 1X9SA 4I27A 9ICCA 4ATBA 4J9NA
chains in the Genus database with same CATH superfamily
2HN2A 4C4TA 5DBBA 2KG5A 2KJ9A 4X4SA 4KLGA 2BZFA 2FPMA 4OJ5A 2MAXA 3EPGA 2Y1JA 2ES6A 3F2CA 5J0YA 2I1QA 3TAQA 1RPLA 4WQLA 3OWGA 5J2JA 3PSTA 4ELUA 5AK3A 4IQTA 4UB5A 4UAWA 4JWNA 4F8RA 4PHEA 1TKDA 3V7KA 2EWRA 3C18A 5J2DA 4K4HA 5CEHA 8ICQA 3UPQA 3QX7A 2HHTA 4RQ1A 2F8LA 2GAFD 1Z3EB 2G5HB 4FHWA 3ETLA 9ICXA 2ZTDA 7ICUA 5DG8A 3SV4A 5CFSA 2L5YA 4C0ZA 2BGWA 1UEVA 1ZD5A 4C4RA 3BZKA 7ICLA 2KE7A 3CNHA 2DBYA 4YXJA 3PR5B 3UMGA 3EW9A 3N7PD 4FHYA 5G5HA 2NRVA 4O5KA 4UAVA 1RXVA 4A8EA 2YMQA 1XSPA 3NVWA 3H40A 5AM5A 3PW7A 3JPOA 3NASA 1MQ3A 3G6VA 3AQEA 4R65A 2K8CB 2GLEA 3MGHA 2G06A 2F3NA 3SZ2A 8ICYA 9ICGA 4AT7B 2JV3A 1ED1A 4QW8A 1J2MA 5KFBA 5KFFA 2RRDA 3A0HU 1DOQA 4BGDA 4KLDA 3QUQA 1PVPA 1QQ5A 4KX5A 4WBYA 4LEVA 5C5JA 4QZEA 2LMRA 1MIYA 1ZD2P 2HI0A 5AI5A 3UM9A 2CN1A 4PGQA 2HHQA 1XC9A 2AH5A 1N56A 3WFQE 2H3VA 2E3TA 3UQ0A 4BDPA 2RHFA 4QZAA 4OAHA 2A1JA 5J2EA 4X5VA 7ICTA 1IM4A 4JV1A 2YB4A 1T94A 4ECVA 4M5DA 4IR1A 4UAZA 2JEGA 4DSKA 3F2BA 5HR7A 5DDMA 1X9MA 2LHTA 8ICTA 3ONNA 2BHNA 3PVXA 3B9JA 4WC0A 1RDFA 4J9QA 3OVSA 5DDYA 4K97A 2HVHA 2XI9A 4JMUA 2EDUA 4F71A 3V6KA 3JPSA 4M0AA 5AM3A 4OAIZ 4ECTA 7ICEA 2ZUDA 2AHOB 9ICKA 3PNCA 2EZZA 4TUSA 5KAFU 3RBDA 1TFWA 4X0BA 2ZH2A 5AM1A 3AMZA 2KIWA 3H0MB 5ALVA 5HHIA 3HX0A 1ZQDA 4X4QA 1K5OA 2IUBA 2R8HA 2D8CA 5KFNA 3C28A 4I2HA 4NLZA 5TZVA 4BWMA 2F76X 2YQEA 4YR0A 3E2EA 3B0YA 4FBUA 3ZDBA 3M7DA 2QB0B 2ZH5A 3RH5A 3HKZC 8ICWA 1Z4OA 2O5AA 3ZD8A 2F1HA 3S6JA 4F5QA 4WJ3B 2PFQA 3AU6A 2BCUA 4NM2A 2BE3A 4QZ8A 3H0RB 3NVVA 3TARA 4I28A 1F5AA 3H3AA 4TUQA 4QWAA 2C2EA 3RJEA 1YZ7A 5DECA 2ASJA 5CFUA 5KFGA 3ERCC 1BPDA 2VA2A 3C2LA 1XS9D 1YZ6A 5HRBA 1JI7A 1CI4A 2PI5A 2KOBA 4ED2A 4B9LA 3CRXA 2EAMA 2C22A 4FZMA 1HUOA 4UQGA 3WK9A 4O3RA 1SXDA 4XQ8A 4GC7A 3OV7A 4UB3A 2A1JB 2RDIA 3KHGA 1SL1A 5KG7A 5F9NA 2KNJA 3MC1A 1Z00B 1XSLA 1KN5A 4QJFB 4WCWA 3T3FA 2KZMA 2DF4B 4YMMA 2MU2A 4EEDA 3IP4B 2PMZC 3RH6A 3DEEA 5A0LA 4FS1A 3UPSA 2W9CA 2XGQA 5HRIA 2JHDA 4IC9A 8ICIA 3QYPA 1C7YA 5AKJA 4GIBA 4DLGA 1NNLA 4Z6FA 4E80A 1EXNA 3PO5A 3F5EA 4UARA 1ZQQA 2EANA 5J29A 2PFPA 3FC4A 1MC8A 4RQ2A 4YVZA 4YQWA 1UA1A 4ACOA 1V4AA 2XY7A 2G08A 5E79U 2IOHA 5ALGA 2A3VA 5ALUA 5KFOA 1IIPA 2WB1F 3NRWA 2RP5A 4EELA 2KJ8A 3PSPA 4PGYA 4UBCA 1KBUA 3TFSA 4NXWA 5HRGA 3ER9B 2JH1A 5ALFA 1ZQBA 2KVCA 2WFAA 3FM9A 5JTIA 2HSZA 3NGDA 5J2FA 1DGSA 4ED0A 5KFSA 4B9VA 4DQPA 4NY8A 3BJYA 4BXOA 2H3FA 3SAHA 3KOOA 2WF8A 5AIBA 1WG8A 2B0CA 4ECQA 1ZQNA 2AJQA 1KSPA 2J6UA 9ICMA 1T7PA 3N28A 3PHZA 5CRXA 2Q4TA 5L9XA 4NWIA 5BPCA 4PZOA 3D2NA 3RRHA 2ODGA 2ZIUA 3H8MA 3HWTA 1KQQA 1D9FA 3WU2U 9ICHA 3AQLA 3PW0A 4FZNA 1P7DA 9ICIA 2EZYA 4Z6CA 4P0PA 1Q79A 4ED8A 4DQSA 3DDHA 3RB3A 5HMMA 3QEAZ 4DFDA 2ZH7A 1ZQPA 4EX6A 2ASLA 1SL0A 4KN7A 1LV5A 2FMQA 4AT9B 3RAXA 3QUCA 2E8NA 3MR3A 3WKBA 2UVUA 2B51A 3QUTA 3CYMA 1U48A 1KKXA 3EZ5A 5CHGA 4YP3A 2YY6A 2XIDA 4B9SA 3GIMA 1ZQOA 3MGVA 3RH4A 2LKYA 2GWSA 3OUYB 4YXMA 5HRKA 4IQVA 2FPKA 2HCFA 3VCBA 4GC6A 3HIYA 4KLUA 2IOFK 2Q0ZX 4P2HA 4QW9A 2NRTA 2AGQA 3SMVA 4FHXA 2ZH6A 2E8PA 1PUZA 1UT5A 1ZJMA 3E58A 3WKAA 3V6HA 4RQ0A 1RM6C 2KN7A 4CRXA 3PX4A 2BCSA 3L3FX 4QWEA 5ALJA 3T5JA 1QTMA 2W9BB 2Q66A 9ICEA 3KHRA 1ZXIA 1JROA 5G5GA 1RQLA 4IQWA 4R63A 4AT8B 1SB3C 2LBOA 4ED7A 4NXVA 4OJPA 3LDAA 5EE9A 3NVYA 3R9KA 2YB1A 3Q8RB 4ECRA 3WFOA 5T14A 2FPLA 4DCCA 4EGWA 4O3MA 4J9KA 1Q46A 4JK1A 3SYZA 1OUQA 4EYHB 1NJWA 3N97B 3H8SA 4NLGA 2BPCA 3PMNA 1NZBA 1NK8A 2KFZA 2BDPA 3WK4A 1BPXA 5ALQA 9ICQA 2W7OA 4LZDA 5AKXA 3GDXA 3F53A 2W54A 4RNNA 3EPIA 1CUKA 1ZQTA 1Z19A 1A77A 2JMGA 5KFUA 3NYBA 4PZNA 1LKYB 4O67A 2YX8A 3C23A 3OUYA 2DL0A 1N63A 4YG2A 9ICSA 3IG5A 4MFAA 4KLLA 5B3PA 5KFMA 2XY6A 4P4OA 1GO3F 4S3NA 3LVWA 3L4PA 2HBKA 4HYKA 3NVOA 2W43A 3JPTA 1KRPA 4O6AA 5CJ7A 5HC9A 5DQHA 2KKVA 2JEFA 5EWEA 4R66A 2J6SA 2F8KA 4USAA 1D8BA 4EV6A 2OXOA 3Q8KA 3LWMA 2R18A 2GA9D 4EBJA 3JYYA 1K1QA 4NKTA 1L3TA 4B9TA 4O68A 2ZH9A 1S5LU 1QCKA 1NKCA 3LWLA 4RPXA 1TVAA 5ALPA 3M9OB 2ESEA 5DG9A 4PPXA 1Z4NA 4UW9A 1UCVA 3C5FA 5IIJA 1N61A 2VJ4A 4N7RA 2GH1A 5AK6A 2K4HA 3PV8A 4FHVA 4PL1A 2NO5A 4NV0A 4DFMA 4WBZA 3GIKA 4FO1A 4DL2A 1CRXA 5D62A 5AI6A 2IBKA 3L9DA 5EWFA 4BX9C 2AU0A 2YN4A 3NRZA 2KV2A 8ICHA 8ICZA 5KFYA 5AI8A 2M2UA 3AN1A 2ALZA 2W04A 5KFCA 3PY8A 1LKYA 3HJ1A 3F5AA 1TAQA 4Z6EA 1M6YA 2BCVA 3H4DA 5AM2A 5L1MA 2ZXIA 4ZOHC 1T4GA 4DLEA 5AIAA 4QZCA 1F5SA 2OEHA 1IXRA 5KG6A 2KTQA 3AQNA 2QB1A 4ECSA 1VDVA 2NYVA 3E0FA 3ZD9A 2BPFA 4C8NA 5KFXA 3WK7A 4X4TA 3BZCA 3D2QA 4XQ7A 3BS7A 1ZQMA 1UA0A 1SGGA 1V97A 2MSNA 4QIWF 3GU3A 2DPJA 2HBJA 4NL9A 1R8AA 2JGAA 8ICCA 4RQMA 5KL1B 3WKEA 2JR5A 5CFTA 9ICUA 5ALSA 4CF3A 4WOYA 5K4LA 3QEBZ 5IIIA 2VA3A 2ASDA 1NK6A 4BUGA 4QZHA 3HJ4A 3T79A 5D63A 2W03A 4TURA 2HW3A 4UBBA 3PMLA 3ZDDA 3RAQA 2JXJA 4RNOA 1QH9A 1U49A 3EWAA 1BPBA 3MR5A 4J9PA 3C1ZA 1D8LA 8ICMA 4KMUA 3BS5A 1NJZA 2VKQA 3C66A 1MN8A 4PGXA 2DUYA 2KHVA 2IHNA 1R8CA 2JEIA 1X2IA 3D2SA 5C0YA 1Y88A 2KSOA 1JX4A 1BPYA 2JH7A 2EQYA 2VA8A 5GTIU 2YMLA 2B21A 3WFSC 4MF8A 3M8SA 2LI6A 5CA7A 4R8UA 4JV0A 4UASA 3OTQA 5DKWA 2H3IA 1XNSA 1NOMA 3MDCA 9ICRA 5IINA 4M9JA 4F4ZA 4ELVA 1X42A 4IG8A 2G07A 5KT6A 2KSOB 3LQCB 3SR6A 3UQ2A 4CDGA 5IIKA 2WAQF 4XRHA 4CF5A 4Y2XA 1V38A 1X9XA 2BQRA 2XCPA 5KG2A 1KL9A 3NUQA 1L3VA 2C2DA 4UB4A 1OU5A 5HR6A 4XJEA 2KICA 5D61A 2IHOA 3IG8A 5CHEA 4E8FA 1ZD3A 1XO0A 4YFKA 3U26A 3HW8A 3QZ7A 5DGAA 1X66A 4GXJA 2VIXA 3PSIA 3Q8SB 1S0OA 1SKRA 1PK1A 5JTGA 9ICVA 2LYHA 4DS5A 2WF7A 2YMPA 3THVA 2KZ3A 2ZTEA 4IR9A 4RQ8A 1ZOLA 3C21A 2EAPA 1ZQ1C 1BNPA 3RB0A 2FMSA 5AM0A 1B0XA 3BQ7A 4P0PB 2EAOA 1F0MA 5D49A 3PW4A 4NLKA 2V4QA 7ICOA 4ECWA 4AYBC 4F4KA 4Q44A 1QQ6A 5BOLA 3C1YA 1NJYA 4LZGA 3PSFA 4YD2A 4C8LA 1XWLA 2XY5A 2XC9A 5DEDA 4CE6A 4M04A 3OGUA 2ZHBA 1VLBA 2DR8A 3H0LB 1ZRNA 5JU5A 3AEVA 2MA1A 4IS7A 2ZXHA 4FFDA 4KLFA 3ISDA 1AROP 7ICRA 4GLXA 4YCXA 2PFOA 4WC7A 8ICOA 3K1ZA 3JCFA 2DWQA 2HOQA 4LEYA 1QSSA 4B6JA 3RRGA 2E1FA 1ZQCA 4F5PA 2Y0SC 3SV3A 5AKKA 2BKEA 3MGIA 3MABA 4LVSA 4RUAA 2J6TA 7ICVA 3GIJA 2BCRA 2B6GA 7ICIA 3IRUA 2B4VA 4DQIA 2D3DA 2BBJA 5ALOA 4WC4A 2HHXA 2DRAA 4KLTA 3RJKA 2QARA 4I2BA 1FIQA 4F2RA 2FJ6A 2ZIVA 5AKLA 5KFWA 4I0UA 4OJLA 4X0AA 4X4NA 3KZIU 1TK0A 2K89A 3EUB2 3N7SC 3IV6A 4B9UA 4DFPA 2FLPA 2RQ5A 4CCHA 5KG0A 1SV0A 5ALEA 4U6PA 3TFRA 2ZIXB 3RJJA 1R89A 4WC2A 2NV3A 9ICBA 1SZPA 2M2TA 3M9NB 7ICMA 3HJEA 4J03A 3F2DA 2CRXA 2K4EA 4RQ5A 3KHLA 3HRDD 5JRTA 5AI9A 1QSLA 3CK6A 5KT4A 8ICAA 1YT3A 2DPIA 5F9LA 2RFFA 3OJUA 3UXNA 1KFSA 4OAFA 2OYYA 9ICTA 3ALRA 5L1JA 4O3NA 5HRFA 3RFAA 4NKUA 3KZXA 5AKGA 1RQNA 5CWRA 1TV9A 1DRGA 3G6YA 5KTQA 5KFPA 2I9GA 1TAMA 2K8AA 4BXOB 2FLLA 1COKA 4RQ7A 3H39A 3SD7A 4PH5A 5HRHA 2A1AA 2OM6A 5J0RA 3I1YA 5AHXA 3WKCA 3ZDCA 3NWIA 4NXZA 9ICCA 5J8YC 2BPGA 2ZH4A 4EEYA 4ECZA 4DSLA 2OH2A 1WCNA 2HVIA 2ZH8A 4F5NA 3MCRA 1Z1VA 2NRXA 3CW2C 4UAYA 4P0QB 3ZDEA 4O3QA 1LVHA 3V7JA 4C80A 4F50A 3RR8A 1B22A 4P4MA 3GZFA 2FCLA 4LEZA 4QZDA 1RG6A 4EBEA 2ZJAA 5DB7A 1YLQA 4I2EA 4NLNA 3RJHA 1PK1B 3Q8MA 3JPQA 4KLJA 3JPNA 2GOLA 2Z7JA 1NK4A 3GQCA 1UPHA 4US8A 4C8MA 4K96A 4AT9A 1JALA 2XCAA 1DGJA 5ALYA 1DK3A 3KKAA 4F72A 4WC5A 2NO4A 1JRPA 8ICNA 2DFLA 2PI4A 4F92B 1KTQA 3TKAA 5HNKA 5J0OA 3BQTA 2E1EA 5DLGA 4J9LA 2B56A 3Q8PB 2Y1IA 7ICGA 2ZIUB 1WUDA 1BVSA 1SWVA 4QWBA 2H3QA 4YR2A 3FDSA 4M47A 4AP9A 1BNOA 4RUCA 4WC1A 5EOZA 5EE0A 4US9A 5HHHA 1ZETA 2W7PA 4I2AA 2DRBA 8ICVA 2NRZA 2AGOA 2KJ5A 3GILA 4DSEA 4R64A 2ZG6A 4BJQA 1K1SA 2W3RA 5DLFA 1QQ7A 3PZPA 2AQ4A 2ISPA 2CPRA 4RQ4A 1L5UA 2KK0A 4PHAA 4M9LA 1L7NA 4F2SA 1ZQJA 3D6JA 4GFJA 2M9NA 2C2RA 4QIWC 5KG1A 2ZHAA 3BS5B 3M8RA 4O5EA 8ICJA 2Y9UA 5D46A 1OW5A 2AGPA 1U47A 4F4WA 4EEKA 2P35A 2UVWA 2OCEA 1T3NA 4LJXA 9ICOA 1ZQIA 4QZBA 4FH3A 4QZ9A 1CEZA 1Q78A 3SQIA 2VANA 4J9OA 1Q8KA 4HX0A 1SKWA 4ICAA 4HAIA 5KFZA 5B3QA 4EENA 5H2FU 3VC8A 3N7RC 2AXTU 2HHUA 2BCQA 3RB6A 2HN1A 2ZTCA 1BPEA 3AL0B 1HEKA 3ED5A 4MF2A 2KD1A 4MHVA 4NJ8A 5DGBA 3GV8B 5KFIA 5CR0A 4JB3A 2JRZA 2R8IA 3TI0A 4ELTA 2ISOA 3WFRE 4EP7A 2HOFA 3UMCA 4I2IA 8ICBA 2Y0SF 4UD4A 2DR7A 1ZQRA 4X4RA 2A19A 5KT2A 2IHMA 2O1PA 4AT7A 1IV8A 3GFKB 1S76D 1JXLA 1J2NA 5J0QA 4EX7A 2PXIA 4FO6A 3FAHA 5KFDA 3QZ8A 4GXKA 4I2CA 2ID1A 3QU7A 4F93B 4C8KA 2ATLA 1SZHA 4ECXA 4WQKA 4KM5A 3RF9A 5IIOA 4Y2JA 3QU5A 1ZJNA 2M2WA 5J0XA 4JWMA 2C28A 5KFQA 4DO9A 4J9SA 3T5HA 4RT2A 1OXJA 3C5GA 3ER8C 2JZBB 2FDRA 4M9GA 5AKEA 5EWGA 5FP0A 4K4GA 2DR9A 1XO1A 2ZUCA 4DL6A 3SI8A 4DFJA 2ZH1A 3H8JA 3OVAA 4RZRA 1L7MA 3WK8A 2BR0A 2FMPA 2YMMA 3RJGA 3NTUA 4K9BA 7ICKA 4NM1A 5KG5A 4P0QA 5J0UA 3GV7B 5DB8A 1RYUA 2QKQA 2M0NA 2G5IB 2ZIWA 3MBYA 3QE9Y 4Q45A 2HHVA 1LB2B 4YR3A 4B9MA 2G0AA 3K7DA 1X6IA 1H38A 4EBKA 4DOAA 4RNMA 2WF5A 5HP4A 3CP8A 5HRLA 5J2IA 5J8YA 3MFHA 5AICA 4DF8A 4IL6U 2D6FC 5J2HA 5EE1A 5KFJA 1SWWA 2K4PA 1SV4A 4F4YA 4P4PA 3RB4A 1KW4A 2I6XA 4K8VA 4X4PA 1MIVA 4YMOA 3KHHA 4TQSA 5ALNA 5ALWA 1PZNA 1U9LA 4AYBF 5ALRA 4DSFA 4C7YA 3V7LA 3PW5A 4OAGA 4RPYA 1S77D 3BQ0A 7ICSA 3C2MA 2ZIXA 1RYSA 1D8YA 4K4IA 2IOFA 1JMSA 4JUZA 1BGXT 3V72A 4DSIA 4F4XA 5B5EU 1RXWA 2E5SA 4RT3A 1QSYA 1KLNA 3ETRA 2W8KA 1Q3VA 1ZQHA 5AI0A 5L1LA 2E8OA 5KT3A 2G09A 9ICNA 1SXEA 4YMNA 2HBMA 2LYAA 3IHQB 4OJ6A 3MFIA 1Z1BA 2W9BA 5F2VO 5DBCA 3UXOA 1TE2A 4FZLA 4O3SA 2RDJA 1AQ6A 4NXXA 1ZD4A 5B66U 4RQNA 2DQNB 8ICUA 4ED6A 2F1IA 4DEZA 3ORYA 2XICA 5KAIU 3ZDAA 4Y2YA 3H7IA 1HJPA 4LEWA 1N5XA 4DFKA 2W9MA 1NK0A 3AQMA 3NVZA 4QZFA 2LYBA 1FO4A 4CGZA 4IRCA 2VJ5A 1L3UA 3A0BU 3T5LA 3L5KA 2MUTB 4E0DA 1MA7A 1FFVA 3OPXA 5AKIA 1ZQXA 3K75D 3AUOA 4OO1J 2LM4A 4NL9C 4KN4A 3SENA 1NO5A 4UD5A 4KLSA 1FFUA 3UXPA 4WH5A 4UAUA 2UVRA 3UMBA 5J2CA 3ISCA 2JEJA 3OSPA 4ECUA 2KIVA 1ZQKA 2NRWA 4Q8FA 4M9HA 5DG7A 3HP6A 4CNQA 4DQRA 1RYRA 3C29A 2QLTA 5CB1A 2XO7A 3DV9A 4DS4A 1L8OA 1MQ2A 3OHBA 1SIJA 5J2KA 4ATBB 4KX3A 2DR5A 4UB2A 5J2GA 3B0XA 8ICRA 5AKYA 5KG3A 3MDAA 3KTQA 4UB6U 4YD1A 5DQIA 2CXYA 4QZGA 4DL3A 1N48A 1XU4A 2W55A 1KNYA 3HT3A 4B9NA 3OHAA 1UQVA 1N5WA 3PR4A 3EF2A 2ZIWB 3M1YA 4J9NA 5L1IA 3T5KA 2WHEA 9ICAA 1SL2A 4Y2SA 4MEXA 2M2VA 1S9FA 5KFRA 2KMDA 3OSNA 2ZJ8A 1TAUA 2P6UA 4DL7A 4MEYA 2P6RA 4C8OA 5CP2A 3TANA 1L3SA 2UVVA 4PHDA 2QARB 5ALLA 2KZZA 5ALHA 5ALXA 3PW2A 2H5XA 5J0PA 2KKPA 1N60A 1MSWD 3JPRA 2HHWA 4Y2VA 4R8UB 5KFTA 4J9MA 4KLHA 1RZTA 4QZIA 2N1RA 3H8WA 2XGPA 4EZ6A 4KB6A 1URJA 4KLIA 2YTUA 4RU9A 5IILA 5ALZA 3PX0A 1HIWA 4MKPA 3KFUF 2FLNA 1VJ5A 4Y2RA 3BQ1A 4M9NA 4DSJA 1ZQFA 1JUDA 3RJFA 4I29A 4IRDA 9ICPA 2F1JA 4EBCA 2P66A 4LT6A 2DKXA 3IDWA 4E7XA 4EEBA 1ZQUA 4DOCA 4QWCA 5AKZA 1HUZA 1B4FA 5HMLA 1S0VA 4WC3A 2F44A 3I28A 1FEZA 4I2DA 4JLZA 4FS2A 4PHPA 2IA6A 1UEUA 4FHPA 4I2JA 3TAPA 3QU4A 4M6WB 3IM1A 5L1KA 4KITB 2K60A 3TQ1A 7ICNA 4IQUA 2KP7A 1NK7A 1R8BA 5KT5A 2F2AB 9ICWA 8ICPA 5KFEA 3RBEA 4XA5A 4RWOA 4PJ0U 1S10A 7ICQA 8ICEA 8ICSA 2R8JA 5KFKA 8ICGA 4K9AA 1N62A 2DKZA 1A6SA 3KD3A 3NKUA 4FBTA 1Z00A 4TQRA 4DQQA 4UB1A 4PL2A 2XVTA 4DOBA 4I2GA 1WCLA 1U4BA 2BQ3A 1V9PA 2K4IA 2PFNA 4MFCA 5KT7A 2HHSA 1V85A 5KFAA 1TK8A 2JZBA 5AI4A 4YN4A 7ICPA 3SAGA 1J97A 3MR2A 4Y2QA 2OHFA 1L7PA 1O08A 4KLMA 4O5CA 9ICLA 2FI1A 3JZ0A 3QU2A 2QB0A 4RQ6A 5ALTA 2R8GA 5J0TA 1ZQAA 3TACB 4RWPA 8ICKA 2LPEA 9ICFA 2RLTA 4NXUA 1JAJA 1KFDA 4FE3A 2HBLA 1L7OA 5KL8B 1PK3A 3QNMA 1PX5A 7ICHA 2ZUBA 3LK9A 1X9WA 2HOIA 1ZQLA 3GIIA 2WF6A 1S0NA 1WOTA 1BPZA 1ZQYA 3H4BA 3H38A 3EYZA 2EZXA 3LYSA 1DK2A 4ZH4A 5BOMA 2O6KA 1A76A 3QXGA 3M6KA 5HRDA 1NK5A 4RWNA 1XSNA 3AQKA 4RPZA 1N2XA 2WB1C 1F44A 4OCZA 1ZQSA 4F3OA 3ISBA 4J9RA 2ZIVB 4ED3A 4Q43A 4F91B 5AKHA 5ALMA 5EE3A 1S97A 3WK6A 4K98A 4M6WA 2GO7A 4OD0A 1TK5A 1NI3A 5J2BA 8ICXA 5DB6A 1NKEA 1IG6A 2FE9A 2PKEA 5KNIA 4Q8EA 1UHUA 7ICFA 3M9MB 3HPOA 5JUMA 2WAQC 4OJOA 5DQGA 4DF4A 2W3SA 4KLOA 1UT8A 1JN3A 3OJSA 1C20A 4CF4A 1NKBA 4DL5A 1NZPA 2IMWP 1WWUA 4Z6DA 2PBEA 4KTQA 1ZQZA 3N4MB 3ZI4A 1PVQA 3Q8LA 4G9BA 1ZQEA 4QNLA 4O3OA 1COOA 4RWQA 5D4BA 8ICFA 2E8MA 2F77X 5F3XB 2K8BB 3HILA 5DBAA 4JV2A 4O3PA 2ZJ5A 1S0MA 1GPJA 3K4GA 3G6XA 3GV5B 4G3IA 4I2FA 3AQFA 3TADA 3RJIA 3AU2A 4X4VA 4C4SA 4X4UA 4ED1A 2PMZF 5HR9A 2W8LA 1ZYQA 3RTVA 2HMXA 1SKSA 3BDPA 5DB9A 3I76A 4KMOB 2OWOA 1L6NA 4NLCA 4XUSA 4IRKA 1QLNA 1TFRA 1T8EA 2WF9A 1NJXA 1X6JA 4KLEA 4BWJA 2W9AA 1MIWA 3SAFA 3BQ2A 1X40A 3IN5A 4AT8A 5AK5A 2R8KA 4Y2UA 3WKDA 4U7CA 1JXEA 2MUTA 5KG4A 2HHPA 3PX6A 5J0WA 1FA0A 2NRKA 4NXTA 3Q8QB 2Y9TA 2KEYA 4GXIA 5J0SA 2BDUA 3O0FA 5AM4A 4JLXA 3ICXA 3SEIA 3LVVA 3RR7A 2DGZA 2BQUA 2HDOA 3K1RB 4UATA 4DWIA 3J81j 1ZQGA 2KHQA 2W11A 5KFHA 1T3QA 4DL4A 3QUBA 3KBBA 4WC6A 1WYGA 2KVSA 1TFYA 4EYIB 1U45A 1S8OA 1ZRMA 5AK4A 3V6JA 3AM9A 1JIHA 1D9DA 5J2AA 2ZH3A 3NS1A 1B43A 4QWDA 4Y2PA 4Y2TA 3WK5A 1KEJA 5TISU 2V9WA 1NK9A 2LM1A 4KLQA 3FYHA 8ICLA 3M6ZA 4UB8U 2I5HA 4EZ9A 5ALDA 2BBHA 1WWVA 4C7ZA 2KFNA 3HKZF 4O0IA 2DVIA 2EH9A 2W9CB 2WTFA 1VFGA 3QU9A 1JQRA 3JPPA 7ICJA 5KFLA 1A0PA 4RQ3A 4TUPA 5IIMA 4F5RA 1KDHA 4EBDA 4X4OA 5HREA 3OVBA 5GTHU 1O03A 4NLBA 2AQ0A 1VJ7A 3WFPA 4M2YA 1UETA 4K99A 3KKAC 1ECWA 5ALIA 3H37A 4O69A 4F5OA 1L8LA 3TADC 4FH5A 1PVRA 2V4RA 9ICJA 2H3ZA 5KFVA 1KFTA 3MR6A 4ECYA 1Q3UA 5ALKA 4MFFA 4O9MA 3C2KA 3PO4A 1ZQVA 1SV0C 2MRLA 1DXSA 1ZQWA 1X9SA 4I27A 4ATBA
chains in the Genus database with same CATH topology
2BPGA 4RNNA 5L1IA 2ZH4A 4EEYA 4ECZA 3EPIA 3T5KA 1CUKA 5DBBA 4X4SA 1ZQTA 4KLGA 4DSLA 9ICAA 1A77A 2FPMA 5KFUA 3NYBA 2MAXA 1SL2A 1WCNA 2HVIA 2ZH8A 3EPGA 4MEXA 4F5NA 2Y1JA 2M2VA 1S9FA 5KFRA 2NRXA 5J0YA 4UAYA 3OSNA 2ZJ8A 3ZDEA 4O3QA 2I1QA 3C23A 3TAQA 1TAUA 3V7JA 3OUYA 2P6UA 4YG2A 4DL7A 9ICSA 1RPLA 4MEYA 4F50A 3RR8A 2P6RA 4P4MA 4MFAA 1B22A 4KLLA 5J2JA 4C8OA 5KFMA 2XY6A 4P4OA 4QZDA 5CP2A 3TANA 1L3SA 4S3NA 4EBEA 2ZJAA 2UVVA 4ELUA 4HYKA 4IQTA 5DB7A 4UAWA 4UB5A 4PHDA 4JWNA 4I2EA 4NLNA 1YLQA 3RJHA 3JPTA 1KRPA 4F8RA 3Q8MA 3JPQA 4KLJA 5CJ7A 4PHEA 3JPNA 1TKDA 1NK4A 3GQCA 2KZZA 5HC9A 5DQHA 3PW2A 2JEFA 5EWEA 3V7KA 2H5XA 5J0PA 4R66A 2J6SA 3C18A 4C8MA 5J2DA 4K4HA 4AT9A 2XCAA 1MSWD 3JPRA 2HHWA 3Q8KA 8ICQA 1DK3A 3LWMA 3UPQA 4WC5A 4EBJA 2HHTA 4R8UB 8ICNA 4RQ1A 5KFTA 1K1QA 4J9MA 3JYYA 4NKTA 2DFLA 4KLHA 1L3TA 2PI4A 4F92B 1RZTA 1KTQA 5J0OA 5HNKA 4QZIA 4B9TA 1Z3EB 4FHWA 2ZH9A 3BQTA 3H8WA 3ETLA 5DLGA 4J9LA 9ICXA 2XGPA 4EZ6A 2ZTDA 3Q8PB 2Y1IA 7ICUA 1NKCA 5DG8A 7ICGA 3LWLA 4KLIA 3SV4A 1BVSA 4QWBA 4RPXA 4YR2A 1TVAA 2BGWA 1UEVA 4RU9A 3M9OB 5IILA 5DG9A 4PPXA 3FDSA 3PX0A 4M47A 4WC3A 7ICLA 1BNOA 2FLNA 3BQ1A 4RUCA 5IIJA 3C5FA 4DSJA 1ZQFA 4YXJA 4M9NA 3PR5B 4WC1A 3RJFA 3PV8A 4I29A 4FHVA 3EW9A 5EOZA 4IRDA 9ICPA 2F1JA 4EBCA 4DFMA 2P66A 4LT6A 5HHHA 4FHYA 4WBZA 3GIKA 4DL2A 2NRVA 1ZETA 4O5KA 4E7XA 2IBKA 1ZQUA 1RXVA 4I2AA 4DOCA 4QWCA 3L9DA 8ICVA 5EWFA 2NRZA 2DRBA 2AU0A 1XSPA 2AGOA 1HUZA 3H40A 3GILA 3PW7A 5HMLA 1S0VA 3JPOA 8ICHA 5KFYA 4DSEA 1MQ3A 4I2DA 8ICZA 4R64A 2M2UA 2ALZA 3G6VA 5KFCA 3PY8A 4R65A 4FS2A 3HJ1A 4PHPA 3MGHA 1TAQA 1K1SA 5DLFA 2IA6A 3SZ2A 8ICYA 9ICGA 1UEUA 4FHPA 4AT7B 4I2JA 3TAPA 2AQ4A 2ISPA 4M6WB 4Z6EA 4RQ4A 3IM1A 4QW8A 5L1KA 4KITB 3TQ1A 2BCVA 7ICNA 1L5UA 4PHAA 5KFBA 4M9LA 5KFFA 3H4DA 1DOQA 4BGDA 4KLDA 4IQUA 4F2SA 1ZQJA 2KP7A 1T4GA 4DLEA 1NK7A 1R8BA 4QZCA 4WBYA 2M9NA 5KT5A 2C2RA 5C5JA 4QZEA 5KG1A 9ICWA 8ICPA 1MIYA 2ZHAA 3M8RA 5KFEA 5KG6A 1IXRA 4O5EA 8ICJA 3RBEA 2KTQA 5D46A 4PGQA 2AGPA 2HHQA 3AQNA 1XC9A 4XA5A 1N56A 4RWOA 4ECSA 4F4WA 1U47A 1S10A 7ICQA 8ICEA 3ZD9A 2BPFA 8ICSA 2R8JA 4C8NA 5KFKA 8ICGA 3WFQE 5KFXA 3UQ0A 2UVWA 4BDPA 4X4TA 4QZAA 1T3NA 4XQ7A 1ZQMA 2A1JA 5J2EA 4X5VA 7ICTA 9ICOA 1IM4A 1UA0A 4JV1A 4ECVA 2DPJA 4M5DA 4IR1A 4FBTA 4UAZA 2JEGA 1R8AA 4DSKA 1ZQIA 4QZBA 4FH3A 4QZ9A 1Z00A 4TQRA 1CEZA 1Q78A 4DQQA 5DDMA 2VANA 4UB1A 4J9OA 8ICCA 1X9MA 8ICTA 4DOBA 2BHNA 1SKWA 4I2GA 5KFZA 1WCLA 3PVXA 1U4BA 2BQ3A 9ICUA 1V9PA 2PFNA 4MFCA 3QEBZ 5KT7A 2HHSA 4WC0A 5KFAA 2BCQA 3RB6A 2HHUA 2ZTCA 1BPEA 5IIIA 2JZBA 4J9QA 1TK8A 2VA3A 4MF2A 3OVSA 5DGBA 3GV8B 5DDYA 4YN4A 5KFIA 5CR0A 2HVHA 2ASDA 7ICPA 2R8IA 3MR2A 3TI0A 1NK6A 4ELTA 4QZHA 3V6KA 3HJ4A 2ISOA 3JPSA 4M0AA 3WFRE 4EP7A 4TURA 4ECTA 7ICEA 4KLMA 2ZUDA 4O5CA 4I2IA 3PNCA 4UBBA 4TUSA 2HW3A 9ICKA 9ICLA 3JZ0A 3PMLA 3ZDDA 3RAQA 8ICBA 3RBDA 4RQ6A 2R8GA 4RNOA 4UD4A 2DR7A 1U49A 1TFWA 4X0BA 3EWAA 1BPBA 1ZQRA 4X4RA 5KT2A 3MR5A 4J9PA 2ZH2A 3C1ZA 5J0TA 1D8LA 1ZQAA 4KMUA 8ICMA 2IHMA 1NJZA 5HHIA 3HX0A 1ZQDA 4X4QA 2O1PA 2R8HA 3C66A 4AT7A 3GFKB 5KFNA 4RWPA 4I2HA 1S76D 4PGXA 5TZVA 1JXLA 4NLZA 5J0QA 2IHNA 4BWMA 1R8CA 2PXIA 4FO6A 2JEIA 8ICKA 5KFDA 3QZ8A 4GXKA 4I2CA 9ICFA 2ID1A 4F93B 4C8KA 1JAJA 1X2IA 2ATLA 1KFDA 4YR0A 1Y88A 1JX4A 1BPYA 4ECXA 3E2EA 1PX5A 3B0YA 4FBUA 7ICHA 2ZUBA 5IIOA 3ZDBA 3LK9A 2VA8A 1X9WA 1ZJNA 1ZQLA 2B21A 2M2WA 3WFSC 4MF8A 3GIIA 5J0XA 3RH5A 2ZH5A 3M8SA 1S0NA 4JWMA 8ICWA 5CA7A 1WOTA 4R8UA 4JV0A 2O5AA 3ZD8A 2F1HA 1BPZA 4F5QA 1ZQYA 3H4BA 2C28A 5KFQA 3EYZA 3H38A 2PFQA 5DKWA 4DO9A 3AU6A 2BCUA 1DK2A 1NOMA 4NM2A 4J9SA 4ZH4A 4QZ8A 5BOMA 3MDCA 3T5HA 9ICRA 5IINA 2BE3A 4RT2A 3TARA 4I28A 4M9JA 1A76A 1F5AA 4F4ZA 4ELVA 3H3AA 3C5GA 4TUQA 2JZBB 4QWAA 4IG8A 5HRDA 4M9GA 5KT6A 5EWGA 2C2EA 1NK5A 3RJEA 5DECA 4RWNA 1XSNA 4K4GA 2ASJA 3LQCB 3AQKA 2DR9A 4RPZA 1XO1A 2ZUCA 4DL6A 3UQ2A 5KFGA 3SI8A 1BPDA 2VA2A 4DFJA 3C2LA 1ZQSA 3H8JA 3ISBA 4F3OA 3OVAA 1XS9D 2ZH1A 4RZRA 4J9RA 5IIKA 4ED3A 4Q43A 4F91B 2BR0A 4XRHA 2FMPA 5HRBA 3RJGA 3NTUA 2PI5A 1S97A 2BQRA 2XCPA 4ED2A 4B9LA 4M6WA 5KG2A 7ICKA 2C22A 1TK5A 1L3VA 1HUOA 5J2BA 2C2DA 8ICXA 4NM1A 4UB4A 5KG5A 5DB6A 4UQGA 1NKEA 4O3RA 1OU5A 4XQ8A 4Q8EA 4GC7A 5J0UA 7ICFA 4UB3A 3GV7B 2A1JB 3HPOA 3M9MB 5JUMA 3OV7A 2RDIA 5DB8A 3KHGA 1SL1A 5DQGA 5KG7A 4E8FA 5F9NA 4DF4A 1Z00B 4YFKA 1XSLA 4WCWA 3T3FA 2KZMA 3HW8A 4KLOA 4YMMA 3MBYA 3QE9Y 4Q45A 3QZ7A 5DGAA 2HHVA 3RH6A 1LB2B 4YR3A 4B9MA 1UT8A 3UPSA 4FS1A 1H38A 2W9CA 2XGQA 4GXJA 5HRIA 4EBKA 1JN3A 4DOAA 4RNMA 8ICIA 3OJSA 5HP4A 3Q8SB 1S0OA 1SKRA 1C7YA 1NKBA 5HRLA 4DL5A 9ICVA 1NZPA 5J2IA 2IMWP 4DLGA 4Z6DA 2LYHA 4Z6FA 2PBEA 3MFHA 4DS5A 4KTQA 4E80A 4DF8A 1ZQZA 3N4MB 3THVA 1EXNA 3Q8LA 2KZ3A 2ZTEA 3PO5A 1ZQEA 1ZQQA 4IR9A 4O3OA 4RQ8A 5J29A 5J2HA 1COOA 4RWQA 2PFPA 5KFJA 3C21A 1MC8A 4RQ2A 4F4YA 4YVZA 1BNPA 4P4PA 5D4BA 4YQWA 3RB4A 1UA1A 8ICFA 1V4AA 2XY7A 3RB0A 4YMOA 5DBAA 2FMSA 4JV2A 4O3PA 1MIVA 4X4PA 2ZJ5A 1S0MA 5KFOA 3K4GA 3G6XA 3KHHA 4TQSA 3GV5B 4G3IA 4I2FA 1PZNA 5D49A 3PW4A 4NLKA 1U9LA 2V4QA 4PGYA 4UBCA 3RJIA 3AU2A 4X4VA 7ICOA 4ECWA 4DSFA 4ED1A 3PW5A 4F4KA 3V7LA 4Q44A 3TFSA 4X4UA 5HR9A 4RPYA 2W8LA 1ZYQA 5HRGA 5BOLA 3RTVA 1SKSA 3BDPA 3C1YA 1NJYA 5DB9A 3BQ0A 1S77D 7ICSA 3C2MA 1ZQBA 2OWOA 4YD2A 4C8LA 4LZGA 4XUSA 4IRKA 1XWLA 2XY5A 1RYSA 1QLNA 1D8YA 1TFRA 3NGDA 2XC9A 1T8EA 5DEDA 5J2FA 4K4IA 1DGSA 4M04A 1NJXA 4ED0A 5KFSA 4KLEA 4BWJA 3OGUA 1JMSA 2W9AA 4B9VA 4DQPA 4NY8A 2ZHBA 3BJYA 4JUZA 1BGXT 4BXOA 2DR8A 1MIWA 3V72A 3BQ2A 4DSIA 4AT8A 4F4XA 4ECQA 1RXWA 1ZQNA 2R8KA 2AJQA 4RT3A 1KSPA 2J6UA 1JXEA 2MUTA 1QSYA 1KLNA 5KG4A 3ISDA 4KLFA 1AROP 3PX6A 2HHPA 2W8KA 5J0WA 1ZQHA 4GLXA 5L1LA 9ICMA 7ICRA 1FA0A 1T7PA 2NRKA 4YCXA 2PFOA 4WC7A 8ICOA 3Q8QB 5L9XA 5KT3A 5BPCA 9ICNA 4YMNA 4GXIA 5J0SA 3IHQB 3RRHA 3MFIA 3HWTA 1QSSA 3RRGA 1ZQCA 4F5PA 2W9BA 1D9FA 5F2VO 3RR7A 3SV3A 5DBCA 3UXOA 9ICHA 4O3SA 2BKEA 3AQLA 3PW0A 2RDJA 2BQUA 9ICIA 4Z6CA 3MGIA 3MABA 1Q79A 4LVSA 4ED8A 4RUAA 4DQSA 2J6TA 7ICVA 3RB3A 8ICUA 4ED6A 5HMMA 3GIJA 2BCRA 4DWIA 3QEAZ 2F1IA 2ZH7A 1ZQGA 7ICIA 1ZQPA 4DQIA 4DEZA 1LV5A 2ASLA 5KFHA 4KN7A 1SL0A 2FMQA 4AT9B 3RAXA 3MR3A 4DL4A 2UVUA 3ORYA 4WC6A 1TFYA 1U48A 3ZDAA 4WC4A 3H7IA 4EYIB 3EZ5A 5CHGA 2HHXA 4KLTA 1HJPA 3RJKA 2DRAA 1U45A 4I2BA 4YP3A 3V6JA 4F2RA 4B9SA 3GIMA 2W9MA 4DFKA 1NK0A 1ZQOA 3AQMA 4QZFA 5KFWA 1JIHA 4IRCA 1D9DA 5J2AA 3RH4A 1L3UA 3T5LA 2GWSA 4X0AA 3OUYB 4X4NA 4YXMA 1TK0A 2ZH3A 5HRKA 2MUTB 4E0DA 4IQVA 1B43A 2FPKA 4QWDA 4GC6A 4B9UA 4DFPA 3HIYA 2FLPA 1ZQXA 4KLUA 1KEJA 3K75D 2Q0ZX 3AUOA 2V9WA 1NK9A 4P2HA 4QW9A 4CCHA 5KG0A 3TFRA 4KLQA 2NRTA 3FYHA 4KN4A 2AGQA 3RJJA 8ICLA 1NO5A 1R89A 4FHXA 4UD5A 4WC2A 2ZH6A 4KLSA 4EZ9A 9ICBA 1UT5A 1SZPA 3UXPA 3M9NB 1ZJMA 2M2TA 3V6HA 2KFNA 7ICMA 2UVRA 4RQ0A 3ISCA 5J2CA 2JEJA 4O0IA 2KN7A 4RQ5A 3PX4A 3KHLA 4ECUA 4QWEA 3T5JA 3OSPA 2W9CB 1ZQKA 2BCSA 1QTMA 2WTFA 1VFGA 2NRWA 4Q8FA 1JQRA 2W9BB 4M9HA 2Q66A 5DG7A 9ICEA 3HP6A 3JPPA 3KHRA 4DQRA 1RYRA 1QSLA 7ICJA 5KFLA 5KT4A 8ICAA 2DPIA 5F9LA 4IQWA 5CB1A 4R63A 4AT8B 4RQ3A 2RFFA 4TUPA 3OJUA 4F5RA 2XO7A 3UXNA 4ED7A 5IIMA 4EBDA 1KDHA 1KFSA 5HREA 4X4OA 9ICTA 3OVBA 4DS4A 3LDAA 2AQ0A 1MQ2A 4ECRA 3Q8RB 5L1JA 1VJ7A 3WFPA 2DVIA 3OHBA 4M2YA 4O3NA 1UETA 5HRFA 3WFOA 2FPLA 3H37A 4NKUA 4F5OA 5J2KA 4ATBB 5CWRA 4FH5A 1TV9A 2V4RA 5KTQA 5KFPA 3G6YA 2I9GA 9ICJA 4BXOB 4J9KA 2DR5A 4JK1A 4UB2A 3SYZA 5KFVA 2FLLA 1KFTA 5J2GA 3B0XA 3MR6A 8ICRA 4EYHB 3MDAA 5KG3A 1NJWA 4RQ7A 3N97B 3H39A 4ECYA 3KTQA 3H8SA 5DQIA 2BPCA 4YD1A 3PMNA 4QZGA 4NLGA 4DL3A 4PH5A 5HRHA 1N48A 1XU4A 4MFFA 1NK8A 4O9MA 1KNYA 5J0RA 2BDPA 3HT3A 2KFZA 4B9NA 3C2KA 1BPXA 3PO4A 1ZQVA 3OHAA 3ZDCA 9ICQA 4LZDA 3PR4A 4NXZA 1ZQWA 3GDXA 1X9SA 4I27A 9ICCA 4ATBA 4J9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPG A;  4RNN A;  5L1I A;  2ZH4 A;  4EEY A;  4ECZ A;  3EPI A;  3T5K A;  1CUK A;  5DBB A;  4X4S A;  1ZQT A;  4KLG A;  4DSL A;  9ICA A;  1A77 A;  2FPM A;  5KFU A;  3NYB A;  2MAX A;  1SL2 A;  1WCN A;  2HVI A;  2ZH8 A;  3EPG A;  4MEX A;  4F5N A;  2Y1J A;  2M2V A;  1S9F A;  5KFR A;  2NRX A;  5J0Y A;  4UAY A;  3OSN A;  2ZJ8 A;  3ZDE A;  4O3Q A;  2I1Q A;  3C23 A;  3TAQ A;  1TAU A;  3V7J A;  3OUY A;  2P6U A;  4YG2 A;  4DL7 A;  9ICS A;  1RPL A;  4MEY A;  4F50 A;  3RR8 A;  2P6R A;  4P4M A;  4MFA A;  1B22 A;  4KLL A;  5J2J A;  4C8O A;  5KFM A;  2XY6 A;  4P4O A;  4QZD A;  5CP2 A;  3TAN A;  1L3S A;  4S3N A;  4EBE A;  2ZJA A;  2UVV A;  4ELU A;  4HYK A;  4IQT A;  5DB7 A;  4UAW A;  4UB5 A;  4PHD A;  4JWN A;  4I2E A;  4NLN A;  1YLQ A;  3RJH A;  3JPT A;  1KRP A;  4F8R A;  3Q8M A;  3JPQ A;  4KLJ A;  5CJ7 A;  4PHE A;  3JPN A;  1TKD A;  1NK4 A;  3GQC A;  2KZZ A;  5HC9 A;  5DQH A;  3PW2 A;  2JEF A;  5EWE A;  3V7K A;  2H5X A;  5J0P A;  4R66 A;  2J6S A;  3C18 A;  4C8M A;  5J2D A;  4K4H A;  4AT9 A;  2XCA A;  1MSW D;  3JPR A;  2HHW A;  3Q8K A;  8ICQ A;  1DK3 A;  3LWM A;  3UPQ A;  4WC5 A;  4EBJ A;  2HHT A;  4R8U B;  8ICN A;  4RQ1 A;  5KFT A;  1K1Q A;  4J9M A;  3JYY A;  4NKT A;  2DFL A;  4KLH A;  1L3T A;  2PI4 A;  4F92 B;  1RZT A;  1KTQ A;  5J0O A;  5HNK A;  4QZI A;  4B9T A;  1Z3E B;  4FHW A;  2ZH9 A;  3BQT A;  3H8W A;  3ETL A;  5DLG A;  4J9L A;  9ICX A;  2XGP A;  4EZ6 A;  2ZTD A;  3Q8P B;  2Y1I A;  7ICU A;  1NKC A;  5DG8 A;  7ICG A;  3LWL A;  4KLI A;  3SV4 A;  1BVS A;  4QWB A;  4RPX A;  4YR2 A;  1TVA A;  2BGW A;  1UEV A;  4RU9 A;  3M9O B;  5IIL A;  5DG9 A;  4PPX A;  3FDS A;  3PX0 A;  4M47 A;  4WC3 A;  7ICL A;  1BNO A;  2FLN A;  3BQ1 A;  4RUC A;  5IIJ A;  3C5F A;  4DSJ A;  1ZQF A;  4YXJ A;  4M9N A;  3PR5 B;  4WC1 A;  3RJF A;  3PV8 A;  4I29 A;  4FHV A;  3EW9 A;  5EOZ A;  4IRD A;  9ICP A;  2F1J A;  4EBC A;  4DFM A;  2P66 A;  4LT6 A;  5HHH A;  4FHY A;  4WBZ A;  3GIK A;  4DL2 A;  2NRV A;  1ZET A;  4O5K A;  4E7X A;  2IBK A;  1ZQU A;  1RXV A;  4I2A A;  4DOC A;  4QWC A;  3L9D A;  8ICV A;  5EWF A;  2NRZ A;  2DRB A;  2AU0 A;  1XSP A;  2AGO A;  1HUZ A;  3H40 A;  3GIL A;  3PW7 A;  5HML A;  1S0V A;  3JPO A;  8ICH A;  5KFY A;  4DSE A;  1MQ3 A;  4I2D A;  8ICZ A;  4R64 A;  2M2U A;  2ALZ A;  3G6V A;  5KFC A;  3PY8 A;  4R65 A;  4FS2 A;  3HJ1 A;  4PHP A;  3MGH A;  1TAQ A;  1K1S A;  5DLF A;  2IA6 A;  3SZ2 A;  8ICY A;  9ICG A;  1UEU A;  4FHP A;  4AT7 B;  4I2J A;  3TAP A;  2AQ4 A;  2ISP A;  4M6W B;  4Z6E A;  4RQ4 A;  3IM1 A;  4QW8 A;  5L1K A;  4KIT B;  3TQ1 A;  2BCV A;  7ICN A;  1L5U A;  4PHA A;  5KFB A;  4M9L A;  5KFF A;  3H4D A;  1DOQ A;  4BGD A;  4KLD A;  4IQU A;  4F2S A;  1ZQJ A;  2KP7 A;  1T4G A;  4DLE A;  1NK7 A;  1R8B A;  4QZC A;  4WBY A;  2M9N A;  5KT5 A;  2C2R A;  5C5J A;  4QZE A;  5KG1 A;  9ICW A;  8ICP A;  1MIY A;  2ZHA A;  3M8R A;  5KFE A;  5KG6 A;  1IXR A;  4O5E A;  8ICJ A;  3RBE A;  2KTQ A;  5D46 A;  4PGQ A;  2AGP A;  2HHQ A;  3AQN A;  1XC9 A;  4XA5 A;  1N56 A;  4RWO A;  4ECS A;  4F4W A;  1U47 A;  1S10 A;  7ICQ A;  8ICE A;  3ZD9 A;  2BPF A;  8ICS A;  2R8J A;  4C8N A;  5KFK A;  8ICG A;  3WFQ E;  5KFX A;  3UQ0 A;  2UVW A;  4BDP A;  4X4T A;  4QZA A;  1T3N A;  4XQ7 A;  1ZQM A;  2A1J A;  5J2E A;  4X5V A;  7ICT A;  9ICO A;  1IM4 A;  1UA0 A;  4JV1 A;  4ECV A;  2DPJ A;  4M5D A;  4IR1 A;  4FBT A;  4UAZ A;  2JEG A;  1R8A A;  4DSK A;  1ZQI A;  4QZB A;  4FH3 A;  4QZ9 A;  1Z00 A;  4TQR A;  1CEZ A;  1Q78 A;  4DQQ A;  5DDM A;  2VAN A;  4UB1 A;  4J9O A;  8ICC A;  1X9M A;  8ICT A;  4DOB A;  2BHN A;  1SKW A;  4I2G A;  5KFZ A;  1WCL A;  3PVX A;  1U4B A;  2BQ3 A;  9ICU A;  1V9P A;  2PFN A;  4MFC A;  3QEB Z;  5KT7 A;  2HHS A;  4WC0 A;  5KFA A;  2BCQ A;  3RB6 A;  2HHU A;  2ZTC A;  1BPE A;  5III A;  2JZB A;  4J9Q A;  1TK8 A;  2VA3 A;  4MF2 A;  3OVS A;  5DGB A;  3GV8 B;  5DDY A;  4YN4 A;  5KFI A;  5CR0 A;  2HVH A;  2ASD A;  7ICP A;  2R8I A;  3MR2 A;  3TI0 A;  1NK6 A;  4ELT A;  4QZH A;  3V6K A;  3HJ4 A;  2ISO A;  3JPS A;  4M0A A;  3WFR E;  4EP7 A;  4TUR A;  4ECT A;  7ICE A;  4KLM A;  2ZUD A;  4O5C A;  4I2I A;  3PNC A;  4UBB A;  4TUS A;  2HW3 A;  9ICK A;  9ICL A;  3JZ0 A;  3PML A;  3ZDD A;  3RAQ A;  8ICB A;  3RBD A;  4RQ6 A;  2R8G A;  4RNO A;  4UD4 A;  2DR7 A;  1U49 A;  1TFW A;  4X0B A;  3EWA A;  1BPB A;  1ZQR A;  4X4R A;  5KT2 A;  3MR5 A;  4J9P A;  2ZH2 A;  3C1Z A;  5J0T A;  1D8L A;  1ZQA A;  4KMU A;  8ICM A;  2IHM A;  1NJZ A;  5HHI A;  3HX0 A;  1ZQD A;  4X4Q A;  2O1P A;  2R8H A;  3C66 A;  4AT7 A;  3GFK B;  5KFN A;  4RWP A;  4I2H A;  1S76 D;  4PGX A;  5TZV A;  1JXL A;  4NLZ A;  5J0Q A;  2IHN A;  4BWM A;  1R8C A;  2PXI A;  4FO6 A;  2JEI A;  8ICK A;  5KFD A;  3QZ8 A;  4GXK A;  4I2C A;  9ICF A;  2ID1 A;  4F93 B;  4C8K A;  1JAJ A;  1X2I A;  2ATL A;  1KFD A;  4YR0 A;  1Y88 A;  1JX4 A;  1BPY A;  4ECX A;  3E2E A;  1PX5 A;  3B0Y A;  4FBU A;  7ICH A;  2ZUB A;  5IIO A;  3ZDB A;  3LK9 A;  2VA8 A;  1X9W A;  1ZJN A;  1ZQL A;  2B21 A;  2M2W A;  3WFS C;  4MF8 A;  3GII A;  5J0X A;  3RH5 A;  2ZH5 A;  3M8S A;  1S0N A;  4JWM A;  8ICW A;  5CA7 A;  1WOT A;  4R8U A;  4JV0 A;  2O5A A;  3ZD8 A;  2F1H A;  1BPZ A;  4F5Q A;  1ZQY A;  3H4B A;  2C28 A;  5KFQ A;  3EYZ A;  3H38 A;  2PFQ A;  5DKW A;  4DO9 A;  3AU6 A;  2BCU A;  1DK2 A;  1NOM A;  4NM2 A;  4J9S A;  4ZH4 A;  4QZ8 A;  5BOM A;  3MDC A;  3T5H A;  9ICR A;  5IIN A;  2BE3 A;  4RT2 A;  3TAR A;  4I28 A;  4M9J A;  1A76 A;  1F5A A;  4F4Z A;  4ELV A;  3H3A A;  3C5G A;  4TUQ A;  2JZB B;  4QWA A;  4IG8 A;  5HRD A;  4M9G A;  5KT6 A;  5EWG A;  2C2E A;  1NK5 A;  3RJE A;  5DEC A;  4RWN A;  1XSN A;  4K4G A;  2ASJ A;  3LQC B;  3AQK A;  2DR9 A;  4RPZ A;  1XO1 A;  2ZUC A;  4DL6 A;  3UQ2 A;  5KFG A;  3SI8 A;  1BPD A;  2VA2 A;  4DFJ A;  3C2L A;  1ZQS A;  3H8J A;  3ISB A;  4F3O A;  3OVA A;  1XS9 D;  2ZH1 A;  4RZR A;  4J9R A;  5IIK A;  4ED3 A;  4Q43 A;  4F91 B;  2BR0 A;  4XRH A;  2FMP A;  5HRB A;  3RJG A;  3NTU A;  2PI5 A;  1S97 A;  2BQR A;  2XCP A;  4ED2 A;  4B9L A;  4M6W A;  5KG2 A;  7ICK A;  2C22 A;  1TK5 A;  1L3V A;  1HUO A;  5J2B A;  2C2D A;  8ICX A;  4NM1 A;  4UB4 A;  5KG5 A;  5DB6 A;  4UQG A;  1NKE A;  4O3R A;  1OU5 A;  4XQ8 A;  4Q8E A;  4GC7 A;  5J0U A;  7ICF A;  4UB3 A;  3GV7 B;  2A1J B;  3HPO A;  3M9M B;  5JUM A;  3OV7 A;  2RDI A;  5DB8 A;  3KHG A;  1SL1 A;  5DQG A;  5KG7 A;  4E8F A;  5F9N A;  4DF4 A;  1Z00 B;  4YFK A;  1XSL A;  4WCW A;  3T3F A;  2KZM A;  3HW8 A;  4KLO A;  4YMM A;  3MBY A;  3QE9 Y;  4Q45 A;  3QZ7 A;  5DGA A;  2HHV A;  3RH6 A;  1LB2 B;  4YR3 A;  4B9M A;  1UT8 A;  3UPS A;  4FS1 A;  1H38 A;  2W9C A;  2XGQ A;  4GXJ A;  5HRI A;  4EBK A;  1JN3 A;  4DOA A;  4RNM A;  8ICI A;  3OJS A;  5HP4 A;  3Q8S B;  1S0O A;  1SKR A;  1C7Y A;  1NKB A;  5HRL A;  4DL5 A;  9ICV A;  1NZP A;  5J2I A;  2IMW P;  4DLG A;  4Z6D A;  2LYH A;  4Z6F A;  2PBE A;  3MFH A;  4DS5 A;  4KTQ A;  4E80 A;  4DF8 A;  1ZQZ A;  3N4M B;  3THV A;  1EXN A;  3Q8L A;  2KZ3 A;  2ZTE A;  3PO5 A;  1ZQE A;  1ZQQ A;  4IR9 A;  4O3O A;  4RQ8 A;  5J29 A;  5J2H A;  1COO A;  4RWQ A;  2PFP A;  5KFJ A;  3C21 A;  1MC8 A;  4RQ2 A;  4F4Y A;  4YVZ A;  1BNP A;  4P4P A;  5D4B A;  4YQW A;  3RB4 A;  1UA1 A;  8ICF A;  1V4A A;  2XY7 A;  3RB0 A;  4YMO A;  5DBA A;  2FMS A;  4JV2 A;  4O3P A;  1MIV A;  4X4P A;  2ZJ5 A;  1S0M A;  5KFO A;  3K4G A;  3G6X A;  3KHH A;  4TQS A;  3GV5 B;  4G3I A;  4I2F A;  1PZN A;  5D49 A;  3PW4 A;  4NLK A;  1U9L A;  2V4Q A;  4PGY A;  4UBC A;  3RJI A;  3AU2 A;  4X4V A;  7ICO A;  4ECW A;  4DSF A;  4ED1 A;  3PW5 A;  4F4K A;  3V7L A;  4Q44 A;  3TFS A;  4X4U A;  5HR9 A;  4RPY A;  2W8L A;  1ZYQ A;  5HRG A;  5BOL A;  3RTV A;  1SKS A;  3BDP A;  3C1Y A;  1NJY A;  5DB9 A;  3BQ0 A;  1S77 D;  7ICS A;  3C2M A;  1ZQB A;  2OWO A;  4YD2 A;  4C8L A;  4LZG A;  4XUS A;  4IRK A;  1XWL A;  2XY5 A;  1RYS A;  1QLN A;  1D8Y A;  1TFR A;  3NGD A;  2XC9 A;  1T8E A;  5DED A;  5J2F A;  4K4I A;  1DGS A;  4M04 A;  1NJX A;  4ED0 A;  5KFS A;  4KLE A;  4BWJ A;  3OGU A;  1JMS A;  2W9A A;  4B9V A;  4DQP A;  4NY8 A;  2ZHB A;  3BJY A;  4JUZ A;  1BGX T;  4BXO A;  2DR8 A;  1MIW A;  3V72 A;  3BQ2 A;  4DSI A;  4AT8 A;  4F4X A;  4ECQ A;  1RXW A;  1ZQN A;  2R8K A;  2AJQ A;  4RT3 A;  1KSP A;  2J6U A;  1JXE A;  2MUT A;  1QSY A;  1KLN A;  5KG4 A;  3ISD A;  4KLF A;  1ARO P;  3PX6 A;  2HHP A;  2W8K A;  5J0W A;  1ZQH A;  4GLX A;  5L1L A;  9ICM A;  7ICR A;  1FA0 A;  1T7P A;  2NRK A;  4YCX A;  2PFO A;  4WC7 A;  8ICO A;  3Q8Q B;  5L9X A;  5KT3 A;  5BPC A;  9ICN A;  4YMN A;  4GXI A;  5J0S A;  3IHQ B;  3RRH A;  3MFI A;  3HWT A;  1QSS A;  3RRG A;  1ZQC A;  4F5P A;  2W9B A;  1D9F A;  5F2V O;  3RR7 A;  3SV3 A;  5DBC A;  3UXO A;  9ICH A;  4O3S A;  2BKE A;  3AQL A;  3PW0 A;  2RDJ A;  2BQU A;  9ICI A;  4Z6C A;  3MGI A;  3MAB A;  1Q79 A;  4LVS A;  4ED8 A;  4RUA A;  4DQS A;  2J6T A;  7ICV A;  3RB3 A;  8ICU A;  4ED6 A;  5HMM A;  3GIJ A;  2BCR A;  4DWI A;  3QEA Z;  2F1I A;  2ZH7 A;  1ZQG A;  7ICI A;  1ZQP A;  4DQI A;  4DEZ A;  1LV5 A;  2ASL A;  5KFH A;  4KN7 A;  1SL0 A;  2FMQ A;  4AT9 B;  3RAX A;  3MR3 A;  4DL4 A;  2UVU A;  3ORY A;  4WC6 A;  1TFY A;  1U48 A;  3ZDA A;  4WC4 A;  3H7I A;  4EYI B;  3EZ5 A;  5CHG A;  2HHX A;  4KLT A;  1HJP A;  3RJK A;  2DRA A;  1U45 A;  4I2B A;  4YP3 A;  3V6J A;  4F2R A;  4B9S A;  3GIM A;  2W9M A;  4DFK A;  1NK0 A;  1ZQO A;  3AQM A;  4QZF A;  5KFW A;  1JIH A;  4IRC A;  1D9D A;  5J2A A;  3RH4 A;  1L3U A;  3T5L A;  2GWS A;  4X0A A;  3OUY B;  4X4N A;  4YXM A;  1TK0 A;  2ZH3 A;  5HRK A;  2MUT B;  4E0D A;  4IQV A;  1B43 A;  2FPK A;  4QWD A;  4GC6 A;  4B9U A;  4DFP A;  3HIY A;  2FLP A;  1ZQX A;  4KLU A;  1KEJ A;  3K75 D;  2Q0Z X;  3AUO A;  2V9W A;  1NK9 A;  4P2H A;  4QW9 A;  4CCH A;  5KG0 A;  3TFR A;  4KLQ A;  2NRT A;  3FYH A;  4KN4 A;  2AGQ A;  3RJJ A;  8ICL A;  1NO5 A;  1R89 A;  4FHX A;  4UD5 A;  4WC2 A;  2ZH6 A;  4KLS A;  4EZ9 A;  9ICB A;  1UT5 A;  1SZP A;  3UXP A;  3M9N B;  1ZJM A;  2M2T A;  3V6H A;  2KFN A;  7ICM A;  2UVR A;  4RQ0 A;  3ISC A;  5J2C A;  2JEJ A;  4O0I A;  2KN7 A;  4RQ5 A;  3PX4 A;  3KHL A;  4ECU A;  4QWE A;  3T5J A;  3OSP A;  2W9C B;  1ZQK A;  2BCS A;  1QTM A;  2WTF A;  1VFG A;  2NRW A;  4Q8F A;  1JQR A;  2W9B B;  4M9H A;  2Q66 A;  5DG7 A;  9ICE A;  3HP6 A;  3JPP A;  3KHR A;  4DQR A;  1RYR A;  1QSL A;  7ICJ A;  5KFL A;  5KT4 A;  8ICA A;  2DPI A;  5F9L A;  4IQW A;  5CB1 A;  4R63 A;  4AT8 B;  4RQ3 A;  2RFF A;  4TUP A;  3OJU A;  4F5R A;  2XO7 A;  3UXN A;  4ED7 A;  5IIM A;  4EBD A;  1KDH A;  1KFS A;  5HRE A;  4X4O A;  9ICT A;  3OVB A;  4DS4 A;  3LDA A;  2AQ0 A;  1MQ2 A;  4ECR A;  3Q8R B;  5L1J A;  1VJ7 A;  3WFP A;  2DVI A;  3OHB A;  4M2Y A;  4O3N A;  1UET A;  5HRF A;  3WFO A;  2FPL A;  3H37 A;  4NKU A;  4F5O A;  5J2K A;  4ATB B;  5CWR A;  4FH5 A;  1TV9 A;  2V4R A;  5KTQ A;  5KFP A;  3G6Y A;  2I9G A;  9ICJ A;  4BXO B;  4J9K A;  2DR5 A;  4JK1 A;  4UB2 A;  3SYZ A;  5KFV A;  2FLL A;  1KFT A;  5J2G A;  3B0X A;  3MR6 A;  8ICR A;  4EYH B;  3MDA A;  5KG3 A;  1NJW A;  4RQ7 A;  3N97 B;  3H39 A;  4ECY A;  3KTQ A;  3H8S A;  5DQI A;  2BPC A;  4YD1 A;  3PMN A;  4QZG A;  4NLG A;  4DL3 A;  4PH5 A;  5HRH A;  1N48 A;  1XU4 A;  4MFF A;  1NK8 A;  4O9M A;  1KNY A;  5J0R A;  2BDP A;  3HT3 A;  2KFZ A;  4B9N A;  3C2K A;  1BPX A;  3PO4 A;  1ZQV A;  3OHA A;  3ZDC A;  9ICQ A;  4LZD A;  3PR4 A;  4NXZ A;  1ZQW A;  3GDX A;  1X9S A;  4I27 A;  9ICC A;  4ATB A;  4J9N A; 
#chains in the Genus database with same CATH topology
 2HN2 A;  4C4T A;  5DBB A;  2KG5 A;  2KJ9 A;  4X4S A;  4KLG A;  2BZF A;  2FPM A;  4OJ5 A;  2MAX A;  3EPG A;  2Y1J A;  2ES6 A;  3F2C A;  5J0Y A;  2I1Q A;  3TAQ A;  1RPL A;  4WQL A;  3OWG A;  5J2J A;  3PST A;  4ELU A;  5AK3 A;  4IQT A;  4UB5 A;  4UAW A;  4JWN A;  4F8R A;  4PHE A;  1TKD A;  3V7K A;  2EWR A;  3C18 A;  5J2D A;  4K4H A;  5CEH A;  8ICQ A;  3UPQ A;  3QX7 A;  2HHT A;  4RQ1 A;  2F8L A;  2GAF D;  1Z3E B;  2G5H B;  4FHW A;  3ETL A;  9ICX A;  2ZTD A;  7ICU A;  5DG8 A;  3SV4 A;  5CFS A;  2L5Y A;  4C0Z A;  2BGW A;  1UEV A;  1ZD5 A;  4C4R A;  3BZK A;  7ICL A;  2KE7 A;  3CNH A;  2DBY A;  4YXJ A;  3PR5 B;  3UMG A;  3EW9 A;  3N7P D;  4FHY A;  5G5H A;  2NRV A;  4O5K A;  4UAV A;  1RXV A;  4A8E A;  2YMQ A;  1XSP A;  3NVW A;  3H40 A;  5AM5 A;  3PW7 A;  3JPO A;  3NAS A;  1MQ3 A;  3G6V A;  3AQE A;  4R65 A;  2K8C B;  2GLE A;  3MGH A;  2G06 A;  2F3N A;  3SZ2 A;  8ICY A;  9ICG A;  4AT7 B;  2JV3 A;  1ED1 A;  4QW8 A;  1J2M A;  5KFB A;  5KFF A;  2RRD A;  3A0H U;  1DOQ A;  4BGD A;  4KLD A;  3QUQ A;  1PVP A;  1QQ5 A;  4KX5 A;  4WBY A;  4LEV A;  5C5J A;  4QZE A;  2LMR A;  1MIY A;  1ZD2 P;  2HI0 A;  5AI5 A;  3UM9 A;  2CN1 A;  4PGQ A;  2HHQ A;  1XC9 A;  2AH5 A;  1N56 A;  3WFQ E;  2H3V A;  2E3T A;  3UQ0 A;  4BDP A;  2RHF A;  4QZA A;  4OAH A;  2A1J A;  5J2E A;  4X5V A;  7ICT A;  1IM4 A;  4JV1 A;  2YB4 A;  1T94 A;  4ECV A;  4M5D A;  4IR1 A;  4UAZ A;  2JEG A;  4DSK A;  3F2B A;  5HR7 A;  5DDM A;  1X9M A;  2LHT A;  8ICT A;  3ONN A;  2BHN A;  3PVX A;  3B9J A;  4WC0 A;  1RDF A;  4J9Q A;  3OVS A;  5DDY A;  4K97 A;  2HVH A;  2XI9 A;  4JMU A;  2EDU A;  4F71 A;  3V6K A;  3JPS A;  4M0A A;  5AM3 A;  4OAI Z;  4ECT A;  7ICE A;  2ZUD A;  2AHO B;  9ICK A;  3PNC A;  2EZZ A;  4TUS A;  5KAF U;  3RBD A;  1TFW A;  4X0B A;  2ZH2 A;  5AM1 A;  3AMZ A;  2KIW A;  3H0M B;  5ALV A;  5HHI A;  3HX0 A;  1ZQD A;  4X4Q A;  1K5O A;  2IUB A;  2R8H A;  2D8C A;  5KFN A;  3C28 A;  4I2H A;  4NLZ A;  5TZV A;  4BWM A;  2F76 X;  2YQE A;  4YR0 A;  3E2E A;  3B0Y A;  4FBU A;  3ZDB A;  3M7D A;  2QB0 B;  2ZH5 A;  3RH5 A;  3HKZ C;  8ICW A;  1Z4O A;  2O5A A;  3ZD8 A;  2F1H A;  3S6J A;  4F5Q A;  4WJ3 B;  2PFQ A;  3AU6 A;  2BCU A;  4NM2 A;  2BE3 A;  4QZ8 A;  3H0R B;  3NVV A;  3TAR A;  4I28 A;  1F5A A;  3H3A A;  4TUQ A;  4QWA A;  2C2E A;  3RJE A;  1YZ7 A;  5DEC A;  2ASJ A;  5CFU A;  5KFG A;  3ERC C;  1BPD A;  2VA2 A;  3C2L A;  1XS9 D;  1YZ6 A;  5HRB A;  1JI7 A;  1CI4 A;  2PI5 A;  2KOB A;  4ED2 A;  4B9L A;  3CRX A;  2EAM A;  2C22 A;  4FZM A;  1HUO A;  4UQG A;  3WK9 A;  4O3R A;  1SXD A;  4XQ8 A;  4GC7 A;  3OV7 A;  4UB3 A;  2A1J B;  2RDI A;  3KHG A;  1SL1 A;  5KG7 A;  5F9N A;  2KNJ A;  3MC1 A;  1Z00 B;  1XSL A;  1KN5 A;  4QJF B;  4WCW A;  3T3F A;  2KZM A;  2DF4 B;  4YMM A;  2MU2 A;  4EED A;  3IP4 B;  2PMZ C;  3RH6 A;  3DEE A;  5A0L A;  4FS1 A;  3UPS A;  2W9C A;  2XGQ A;  5HRI A;  2JHD A;  4IC9 A;  8ICI A;  3QYP A;  1C7Y A;  5AKJ A;  4GIB A;  4DLG A;  1NNL A;  4Z6F A;  4E80 A;  1EXN A;  3PO5 A;  3F5E A;  4UAR A;  1ZQQ A;  2EAN A;  5J29 A;  2PFP A;  3FC4 A;  1MC8 A;  4RQ2 A;  4YVZ A;  4YQW A;  1UA1 A;  4ACO A;  1V4A A;  2XY7 A;  2G08 A;  5E79 U;  2IOH A;  5ALG A;  2A3V A;  5ALU A;  5KFO A;  1IIP A;  2WB1 F;  3NRW A;  2RP5 A;  4EEL A;  2KJ8 A;  3PSP A;  4PGY A;  4UBC A;  1KBU A;  3TFS A;  4NXW A;  5HRG A;  3ER9 B;  2JH1 A;  5ALF A;  1ZQB A;  2KVC A;  2WFA A;  3FM9 A;  5JTI A;  2HSZ A;  3NGD A;  5J2F A;  1DGS A;  4ED0 A;  5KFS A;  4B9V A;  4DQP A;  4NY8 A;  3BJY A;  4BXO A;  2H3F A;  3SAH A;  3KOO A;  2WF8 A;  5AIB A;  1WG8 A;  2B0C A;  4ECQ A;  1ZQN A;  2AJQ A;  1KSP A;  2J6U A;  9ICM A;  1T7P A;  3N28 A;  3PHZ A;  5CRX A;  2Q4T A;  5L9X A;  4NWI A;  5BPC A;  4PZO A;  3D2N A;  3RRH A;  2ODG A;  2ZIU A;  3H8M A;  3HWT A;  1KQQ A;  1D9F A;  3WU2 U;  9ICH A;  3AQL A;  3PW0 A;  4FZN A;  1P7D A;  9ICI A;  2EZY A;  4Z6C A;  4P0P A;  1Q79 A;  4ED8 A;  4DQS A;  3DDH A;  3RB3 A;  5HMM A;  3QEA Z;  4DFD A;  2ZH7 A;  1ZQP A;  4EX6 A;  2ASL A;  1SL0 A;  4KN7 A;  1LV5 A;  2FMQ A;  4AT9 B;  3RAX A;  3QUC A;  2E8N A;  3MR3 A;  3WKB A;  2UVU A;  2B51 A;  3QUT A;  3CYM A;  1U48 A;  1KKX A;  3EZ5 A;  5CHG A;  4YP3 A;  2YY6 A;  2XID A;  4B9S A;  3GIM A;  1ZQO A;  3MGV A;  3RH4 A;  2LKY A;  2GWS A;  3OUY B;  4YXM A;  5HRK A;  4IQV A;  2FPK A;  2HCF A;  3VCB A;  4GC6 A;  3HIY A;  4KLU A;  2IOF K;  2Q0Z X;  4P2H A;  4QW9 A;  2NRT A;  2AGQ A;  3SMV A;  4FHX A;  2ZH6 A;  2E8P A;  1PUZ A;  1UT5 A;  1ZJM A;  3E58 A;  3WKA A;  3V6H A;  4RQ0 A;  1RM6 C;  2KN7 A;  4CRX A;  3PX4 A;  2BCS A;  3L3F X;  4QWE A;  5ALJ A;  3T5J A;  1QTM A;  2W9B B;  2Q66 A;  9ICE A;  3KHR A;  1ZXI A;  1JRO A;  5G5G A;  1RQL A;  4IQW A;  4R63 A;  4AT8 B;  1SB3 C;  2LBO A;  4ED7 A;  4NXV A;  4OJP A;  3LDA A;  5EE9 A;  3NVY A;  3R9K A;  2YB1 A;  3Q8R B;  4ECR A;  3WFO A;  5T14 A;  2FPL A;  4DCC A;  4EGW A;  4O3M A;  4J9K A;  1Q46 A;  4JK1 A;  3SYZ A;  1OUQ A;  4EYH B;  1NJW A;  3N97 B;  3H8S A;  4NLG A;  2BPC A;  3PMN A;  1NZB A;  1NK8 A;  2KFZ A;  2BDP A;  3WK4 A;  1BPX A;  5ALQ A;  9ICQ A;  2W7O A;  4LZD A;  5AKX A;  3GDX A;  3F53 A;  2W54 A;  4RNN A;  3EPI A;  1CUK A;  1ZQT A;  1Z19 A;  1A77 A;  2JMG A;  5KFU A;  3NYB A;  4PZN A;  1LKY B;  4O67 A;  2YX8 A;  3C23 A;  3OUY A;  2DL0 A;  1N63 A;  4YG2 A;  9ICS A;  3IG5 A;  4MFA A;  4KLL A;  5B3P A;  5KFM A;  2XY6 A;  4P4O A;  1GO3 F;  4S3N A;  3LVW A;  3L4P A;  2HBK A;  4HYK A;  3NVO A;  2W43 A;  3JPT A;  1KRP A;  4O6A A;  5CJ7 A;  5HC9 A;  5DQH A;  2KKV A;  2JEF A;  5EWE A;  4R66 A;  2J6S A;  2F8K A;  4USA A;  1D8B A;  4EV6 A;  2OXO A;  3Q8K A;  3LWM A;  2R18 A;  2GA9 D;  4EBJ A;  3JYY A;  1K1Q A;  4NKT A;  1L3T A;  4B9T A;  4O68 A;  2ZH9 A;  1S5L U;  1QCK A;  1NKC A;  3LWL A;  4RPX A;  1TVA A;  5ALP A;  3M9O B;  2ESE A;  5DG9 A;  4PPX A;  1Z4N A;  4UW9 A;  1UCV A;  3C5F A;  5IIJ A;  1N61 A;  2VJ4 A;  4N7R A;  2GH1 A;  5AK6 A;  2K4H A;  3PV8 A;  4FHV A;  4PL1 A;  2NO5 A;  4NV0 A;  4DFM A;  4WBZ A;  3GIK A;  4FO1 A;  4DL2 A;  1CRX A;  5D62 A;  5AI6 A;  2IBK A;  3L9D A;  5EWF A;  4BX9 C;  2AU0 A;  2YN4 A;  3NRZ A;  2KV2 A;  8ICH A;  8ICZ A;  5KFY A;  5AI8 A;  2M2U A;  3AN1 A;  2ALZ A;  2W04 A;  5KFC A;  3PY8 A;  1LKY A;  3HJ1 A;  3F5A A;  1TAQ A;  4Z6E A;  1M6Y A;  2BCV A;  3H4D A;  5AM2 A;  5L1M A;  2ZXI A;  4ZOH C;  1T4G A;  4DLE A;  5AIA A;  4QZC A;  1F5S A;  2OEH A;  1IXR A;  5KG6 A;  2KTQ A;  3AQN A;  2QB1 A;  4ECS A;  1VDV A;  2NYV A;  3E0F A;  3ZD9 A;  2BPF A;  4C8N A;  5KFX A;  3WK7 A;  4X4T A;  3BZC A;  3D2Q A;  4XQ7 A;  3BS7 A;  1ZQM A;  1UA0 A;  1SGG A;  1V97 A;  2MSN A;  4QIW F;  3GU3 A;  2DPJ A;  2HBJ A;  4NL9 A;  1R8A A;  2JGA A;  8ICC A;  4RQM A;  5KL1 B;  3WKE A;  2JR5 A;  5CFT A;  9ICU A;  5ALS A;  4CF3 A;  4WOY A;  5K4L A;  3QEB Z;  5III A;  2VA3 A;  2ASD A;  1NK6 A;  4BUG A;  4QZH A;  3HJ4 A;  3T79 A;  5D63 A;  2W03 A;  4TUR A;  2HW3 A;  4UBB A;  3PML A;  3ZDD A;  3RAQ A;  2JXJ A;  4RNO A;  1QH9 A;  1U49 A;  3EWA A;  1BPB A;  3MR5 A;  4J9P A;  3C1Z A;  1D8L A;  8ICM A;  4KMU A;  3BS5 A;  1NJZ A;  2VKQ A;  3C66 A;  1MN8 A;  4PGX A;  2DUY A;  2KHV A;  2IHN A;  1R8C A;  2JEI A;  1X2I A;  3D2S A;  5C0Y A;  1Y88 A;  2KSO A;  1JX4 A;  1BPY A;  2JH7 A;  2EQY A;  2VA8 A;  5GTI U;  2YML A;  2B21 A;  3WFS C;  4MF8 A;  3M8S A;  2LI6 A;  5CA7 A;  4R8U A;  4JV0 A;  4UAS A;  3OTQ A;  5DKW A;  2H3I A;  1XNS A;  1NOM A;  3MDC A;  9ICR A;  5IIN A;  4M9J A;  4F4Z A;  4ELV A;  1X42 A;  4IG8 A;  2G07 A;  5KT6 A;  2KSO B;  3LQC B;  3SR6 A;  3UQ2 A;  4CDG A;  5IIK A;  2WAQ F;  4XRH A;  4CF5 A;  4Y2X A;  1V38 A;  1X9X A;  2BQR A;  2XCP A;  5KG2 A;  1KL9 A;  3NUQ A;  1L3V A;  2C2D A;  4UB4 A;  1OU5 A;  5HR6 A;  4XJE A;  2KIC A;  5D61 A;  2IHO A;  3IG8 A;  5CHE A;  4E8F A;  1ZD3 A;  1XO0 A;  4YFK A;  3U26 A;  3HW8 A;  3QZ7 A;  5DGA A;  1X66 A;  4GXJ A;  2VIX A;  3PSI A;  3Q8S B;  1S0O A;  1SKR A;  1PK1 A;  5JTG A;  9ICV A;  2LYH A;  4DS5 A;  2WF7 A;  2YMP A;  3THV A;  2KZ3 A;  2ZTE A;  4IR9 A;  4RQ8 A;  1ZOL A;  3C21 A;  2EAP A;  1ZQ1 C;  1BNP A;  3RB0 A;  2FMS A;  5AM0 A;  1B0X A;  3BQ7 A;  4P0P B;  2EAO A;  1F0M A;  5D49 A;  3PW4 A;  4NLK A;  2V4Q A;  7ICO A;  4ECW A;  4AYB C;  4F4K A;  4Q44 A;  1QQ6 A;  5BOL A;  3C1Y A;  1NJY A;  4LZG A;  3PSF A;  4YD2 A;  4C8L A;  1XWL A;  2XY5 A;  2XC9 A;  5DED A;  4CE6 A;  4M04 A;  3OGU A;  2ZHB A;  1VLB A;  2DR8 A;  3H0L B;  1ZRN A;  5JU5 A;  3AEV A;  2MA1 A;  4IS7 A;  2ZXH A;  4FFD A;  4KLF A;  3ISD A;  1ARO P;  7ICR A;  4GLX A;  4YCX A;  2PFO A;  4WC7 A;  8ICO A;  3K1Z A;  3JCF A;  2DWQ A;  2HOQ A;  4LEY A;  1QSS A;  4B6J A;  3RRG A;  2E1F A;  1ZQC A;  4F5P A;  2Y0S C;  3SV3 A;  5AKK A;  2BKE A;  3MGI A;  3MAB A;  4LVS A;  4RUA A;  2J6T A;  7ICV A;  3GIJ A;  2BCR A;  2B6G A;  7ICI A;  3IRU A;  2B4V A;  4DQI A;  2D3D A;  2BBJ A;  5ALO A;  4WC4 A;  2HHX A;  2DRA A;  4KLT A;  3RJK A;  2QAR A;  4I2B A;  1FIQ A;  4F2R A;  2FJ6 A;  2ZIV A;  5AKL A;  5KFW A;  4I0U A;  4OJL A;  4X0A A;  4X4N A;  3KZI U;  1TK0 A;  2K89 A;  3EUB 2;  3N7S C;  3IV6 A;  4B9U A;  4DFP A;  2FLP A;  2RQ5 A;  4CCH A;  5KG0 A;  1SV0 A;  5ALE A;  4U6P A;  3TFR A;  2ZIX B;  3RJJ A;  1R89 A;  4WC2 A;  2NV3 A;  9ICB A;  1SZP A;  2M2T A;  3M9N B;  7ICM A;  3HJE A;  4J03 A;  3F2D A;  2CRX A;  2K4E A;  4RQ5 A;  3KHL A;  3HRD D;  5JRT A;  5AI9 A;  1QSL A;  3CK6 A;  5KT4 A;  8ICA A;  1YT3 A;  2DPI A;  5F9L A;  2RFF A;  3OJU A;  3UXN A;  1KFS A;  4OAF A;  2OYY A;  9ICT A;  3ALR A;  5L1J A;  4O3N A;  5HRF A;  3RFA A;  4NKU A;  3KZX A;  5AKG A;  1RQN A;  5CWR A;  1TV9 A;  1DRG A;  3G6Y A;  5KTQ A;  5KFP A;  2I9G A;  1TAM A;  2K8A A;  4BXO B;  2FLL A;  1COK A;  4RQ7 A;  3H39 A;  3SD7 A;  4PH5 A;  5HRH A;  2A1A A;  2OM6 A;  5J0R A;  3I1Y A;  5AHX A;  3WKC A;  3ZDC A;  3NWI A;  4NXZ A;  9ICC A;  5J8Y C;  2BPG A;  2ZH4 A;  4EEY A;  4ECZ A;  4DSL A;  2OH2 A;  1WCN A;  2HVI A;  2ZH8 A;  4F5N A;  3MCR A;  1Z1V A;  2NRX A;  3CW2 C;  4UAY A;  4P0Q B;  3ZDE A;  4O3Q A;  1LVH A;  3V7J A;  4C80 A;  4F50 A;  3RR8 A;  1B22 A;  4P4M A;  3GZF A;  2FCL A;  4LEZ A;  4QZD A;  1RG6 A;  4EBE A;  2ZJA A;  5DB7 A;  1YLQ A;  4I2E A;  4NLN A;  3RJH A;  1PK1 B;  3Q8M A;  3JPQ A;  4KLJ A;  3JPN A;  2GOL A;  2Z7J A;  1NK4 A;  3GQC A;  1UPH A;  4US8 A;  4C8M A;  4K96 A;  4AT9 A;  1JAL A;  2XCA A;  1DGJ A;  5ALY A;  1DK3 A;  3KKA A;  4F72 A;  4WC5 A;  2NO4 A;  1JRP A;  8ICN A;  2DFL A;  2PI4 A;  4F92 B;  1KTQ A;  3TKA A;  5HNK A;  5J0O A;  3BQT A;  2E1E A;  5DLG A;  4J9L A;  2B56 A;  3Q8P B;  2Y1I A;  7ICG A;  2ZIU B;  1WUD A;  1BVS A;  1SWV A;  4QWB A;  2H3Q A;  4YR2 A;  3FDS A;  4M47 A;  4AP9 A;  1BNO A;  4RUC A;  4WC1 A;  5EOZ A;  5EE0 A;  4US9 A;  5HHH A;  1ZET A;  2W7P A;  4I2A A;  2DRB A;  8ICV A;  2NRZ A;  2AGO A;  2KJ5 A;  3GIL A;  4DSE A;  4R64 A;  2ZG6 A;  4BJQ A;  1K1S A;  2W3R A;  5DLF A;  1QQ7 A;  3PZP A;  2AQ4 A;  2ISP A;  2CPR A;  4RQ4 A;  1L5U A;  2KK0 A;  4PHA A;  4M9L A;  1L7N A;  4F2S A;  1ZQJ A;  3D6J A;  4GFJ A;  2M9N A;  2C2R A;  4QIW C;  5KG1 A;  2ZHA A;  3BS5 B;  3M8R A;  4O5E A;  8ICJ A;  2Y9U A;  5D46 A;  1OW5 A;  2AGP A;  1U47 A;  4F4W A;  4EEK A;  2P35 A;  2UVW A;  2OCE A;  1T3N A;  4LJX A;  9ICO A;  1ZQI A;  4QZB A;  4FH3 A;  4QZ9 A;  1CEZ A;  1Q78 A;  3SQI A;  2VAN A;  4J9O A;  1Q8K A;  4HX0 A;  1SKW A;  4ICA A;  4HAI A;  5KFZ A;  5B3Q A;  4EEN A;  5H2F U;  3VC8 A;  3N7R C;  2AXT U;  2HHU A;  2BCQ A;  3RB6 A;  2HN1 A;  2ZTC A;  1BPE A;  3AL0 B;  1HEK A;  3ED5 A;  4MF2 A;  2KD1 A;  4MHV A;  4NJ8 A;  5DGB A;  3GV8 B;  5KFI A;  5CR0 A;  4JB3 A;  2JRZ A;  2R8I A;  3TI0 A;  4ELT A;  2ISO A;  3WFR E;  4EP7 A;  2HOF A;  3UMC A;  4I2I A;  8ICB A;  2Y0S F;  4UD4 A;  2DR7 A;  1ZQR A;  4X4R A;  2A19 A;  5KT2 A;  2IHM A;  2O1P A;  4AT7 A;  1IV8 A;  3GFK B;  1S76 D;  1JXL A;  1J2N A;  5J0Q A;  4EX7 A;  2PXI A;  4FO6 A;  3FAH A;  5KFD A;  3QZ8 A;  4GXK A;  4I2C A;  2ID1 A;  3QU7 A;  4F93 B;  4C8K A;  2ATL A;  1SZH A;  4ECX A;  4WQK A;  4KM5 A;  3RF9 A;  5IIO A;  4Y2J A;  3QU5 A;  1ZJN A;  2M2W A;  5J0X A;  4JWM A;  2C28 A;  5KFQ A;  4DO9 A;  4J9S A;  3T5H A;  4RT2 A;  1OXJ A;  3C5G A;  3ER8 C;  2JZB B;  2FDR A;  4M9G A;  5AKE A;  5EWG A;  5FP0 A;  4K4G A;  2DR9 A;  1XO1 A;  2ZUC A;  4DL6 A;  3SI8 A;  4DFJ A;  2ZH1 A;  3H8J A;  3OVA A;  4RZR A;  1L7M A;  3WK8 A;  2BR0 A;  2FMP A;  2YMM A;  3RJG A;  3NTU A;  4K9B A;  7ICK A;  4NM1 A;  5KG5 A;  4P0Q A;  5J0U A;  3GV7 B;  5DB8 A;  1RYU A;  2QKQ A;  2M0N A;  2G5I B;  2ZIW A;  3MBY A;  3QE9 Y;  4Q45 A;  2HHV A;  1LB2 B;  4YR3 A;  4B9M A;  2G0A A;  3K7D A;  1X6I A;  1H38 A;  4EBK A;  4DOA A;  4RNM A;  2WF5 A;  5HP4 A;  3CP8 A;  5HRL A;  5J2I A;  5J8Y A;  3MFH A;  5AIC A;  4DF8 A;  4IL6 U;  2D6F C;  5J2H A;  5EE1 A;  5KFJ A;  1SWW A;  2K4P A;  1SV4 A;  4F4Y A;  4P4P A;  3RB4 A;  1KW4 A;  2I6X A;  4K8V A;  4X4P A;  1MIV A;  4YMO A;  3KHH A;  4TQS A;  5ALN A;  5ALW A;  1PZN A;  1U9L A;  4AYB F;  5ALR A;  4DSF A;  4C7Y A;  3V7L A;  3PW5 A;  4OAG A;  4RPY A;  1S77 D;  3BQ0 A;  7ICS A;  3C2M A;  2ZIX A;  1RYS A;  1D8Y A;  4K4I A;  2IOF A;  1JMS A;  4JUZ A;  1BGX T;  3V72 A;  4DSI A;  4F4X A;  5B5E U;  1RXW A;  2E5S A;  4RT3 A;  1QSY A;  1KLN A;  3ETR A;  2W8K A;  1Q3V A;  1ZQH A;  5AI0 A;  5L1L A;  2E8O A;  5KT3 A;  2G09 A;  9ICN A;  1SXE A;  4YMN A;  2HBM A;  2LYA A;  3IHQ B;  4OJ6 A;  3MFI A;  1Z1B A;  2W9B A;  5F2V O;  5DBC A;  3UXO A;  1TE2 A;  4FZL A;  4O3S A;  2RDJ A;  1AQ6 A;  4NXX A;  1ZD4 A;  5B66 U;  4RQN A;  2DQN B;  8ICU A;  4ED6 A;  2F1I A;  4DEZ A;  3ORY A;  2XIC A;  5KAI U;  3ZDA A;  4Y2Y A;  3H7I A;  1HJP A;  4LEW A;  1N5X A;  4DFK A;  2W9M A;  1NK0 A;  3AQM A;  3NVZ A;  4QZF A;  2LYB A;  1FO4 A;  4CGZ A;  4IRC A;  2VJ5 A;  1L3U A;  3A0B U;  3T5L A;  3L5K A;  2MUT B;  4E0D A;  1MA7 A;  1FFV A;  3OPX A;  5AKI A;  1ZQX A;  3K75 D;  3AUO A;  4OO1 J;  2LM4 A;  4NL9 C;  4KN4 A;  3SEN A;  1NO5 A;  4UD5 A;  4KLS A;  1FFU A;  3UXP A;  4WH5 A;  4UAU A;  2UVR A;  3UMB A;  5J2C A;  3ISC A;  2JEJ A;  3OSP A;  4ECU A;  2KIV A;  1ZQK A;  2NRW A;  4Q8F A;  4M9H A;  5DG7 A;  3HP6 A;  4CNQ A;  4DQR A;  1RYR A;  3C29 A;  2QLT A;  5CB1 A;  2XO7 A;  3DV9 A;  4DS4 A;  1L8O A;  1MQ2 A;  3OHB A;  1SIJ A;  5J2K A;  4ATB B;  4KX3 A;  2DR5 A;  4UB2 A;  5J2G A;  3B0X A;  8ICR A;  5AKY A;  5KG3 A;  3MDA A;  3KTQ A;  4UB6 U;  4YD1 A;  5DQI A;  2CXY A;  4QZG A;  4DL3 A;  1N48 A;  1XU4 A;  2W55 A;  1KNY A;  3HT3 A;  4B9N A;  3OHA A;  1UQV A;  1N5W A;  3PR4 A;  3EF2 A;  2ZIW B;  3M1Y A;  4J9N A;  5L1I A;  3T5K A;  2WHE A;  9ICA A;  1SL2 A;  4Y2S A;  4MEX A;  2M2V A;  1S9F A;  5KFR A;  2KMD A;  3OSN A;  2ZJ8 A;  1TAU A;  2P6U A;  4DL7 A;  4MEY A;  2P6R A;  4C8O A;  5CP2 A;  3TAN A;  1L3S A;  2UVV A;  4PHD A;  2QAR B;  5ALL A;  2KZZ A;  5ALH A;  5ALX A;  3PW2 A;  2H5X A;  5J0P A;  2KKP A;  1N60 A;  1MSW D;  3JPR A;  2HHW A;  4Y2V A;  4R8U B;  5KFT A;  4J9M A;  4KLH A;  1RZT A;  4QZI A;  2N1R A;  3H8W A;  2XGP A;  4EZ6 A;  4KB6 A;  1URJ A;  4KLI A;  2YTU A;  4RU9 A;  5IIL A;  5ALZ A;  3PX0 A;  1HIW A;  4MKP A;  3KFU F;  2FLN A;  1VJ5 A;  4Y2R A;  3BQ1 A;  4M9N A;  4DSJ A;  1ZQF A;  1JUD A;  3RJF A;  4I29 A;  4IRD A;  9ICP A;  2F1J A;  4EBC A;  2P66 A;  4LT6 A;  2DKX A;  3IDW A;  4E7X A;  4EEB A;  1ZQU A;  4DOC A;  4QWC A;  5AKZ A;  1HUZ A;  1B4F A;  5HML A;  1S0V A;  4WC3 A;  2F44 A;  3I28 A;  1FEZ A;  4I2D A;  4JLZ A;  4FS2 A;  4PHP A;  2IA6 A;  1UEU A;  4FHP A;  4I2J A;  3TAP A;  3QU4 A;  4M6W B;  3IM1 A;  5L1K A;  4KIT B;  2K60 A;  3TQ1 A;  7ICN A;  4IQU A;  2KP7 A;  1NK7 A;  1R8B A;  5KT5 A;  2F2A B;  9ICW A;  8ICP A;  5KFE A;  3RBE A;  4XA5 A;  4RWO A;  4PJ0 U;  1S10 A;  7ICQ A;  8ICE A;  8ICS A;  2R8J A;  5KFK A;  8ICG A;  4K9A A;  1N62 A;  2DKZ A;  1A6S A;  3KD3 A;  3NKU A;  4FBT A;  1Z00 A;  4TQR A;  4DQQ A;  4UB1 A;  4PL2 A;  2XVT A;  4DOB A;  4I2G A;  1WCL A;  1U4B A;  2BQ3 A;  1V9P A;  2K4I A;  2PFN A;  4MFC A;  5KT7 A;  2HHS A;  1V85 A;  5KFA A;  1TK8 A;  2JZB A;  5AI4 A;  4YN4 A;  7ICP A;  3SAG A;  1J97 A;  3MR2 A;  4Y2Q A;  2OHF A;  1L7P A;  1O08 A;  4KLM A;  4O5C A;  9ICL A;  2FI1 A;  3JZ0 A;  3QU2 A;  2QB0 A;  4RQ6 A;  5ALT A;  2R8G A;  5J0T A;  1ZQA A;  3TAC B;  4RWP A;  8ICK A;  2LPE A;  9ICF A;  2RLT A;  4NXU A;  1JAJ A;  1KFD A;  4FE3 A;  2HBL A;  1L7O A;  5KL8 B;  1PK3 A;  3QNM A;  1PX5 A;  7ICH A;  2ZUB A;  3LK9 A;  1X9W A;  2HOI A;  1ZQL A;  3GII A;  2WF6 A;  1S0N A;  1WOT A;  1BPZ A;  1ZQY A;  3H4B A;  3H38 A;  3EYZ A;  2EZX A;  3LYS A;  1DK2 A;  4ZH4 A;  5BOM A;  2O6K A;  1A76 A;  3QXG A;  3M6K A;  5HRD A;  1NK5 A;  4RWN A;  1XSN A;  3AQK A;  4RPZ A;  1N2X A;  2WB1 C;  1F44 A;  4OCZ A;  1ZQS A;  4F3O A;  3ISB A;  4J9R A;  2ZIV B;  4ED3 A;  4Q43 A;  4F91 B;  5AKH A;  5ALM A;  5EE3 A;  1S97 A;  3WK6 A;  4K98 A;  4M6W A;  2GO7 A;  4OD0 A;  1TK5 A;  1NI3 A;  5J2B A;  8ICX A;  5DB6 A;  1NKE A;  1IG6 A;  2FE9 A;  2PKE A;  5KNI A;  4Q8E A;  1UHU A;  7ICF A;  3M9M B;  3HPO A;  5JUM A;  2WAQ C;  4OJO A;  5DQG A;  4DF4 A;  2W3S A;  4KLO A;  1UT8 A;  1JN3 A;  3OJS A;  1C20 A;  4CF4 A;  1NKB A;  4DL5 A;  1NZP A;  2IMW P;  1WWU A;  4Z6D A;  2PBE A;  4KTQ A;  1ZQZ A;  3N4M B;  3ZI4 A;  1PVQ A;  3Q8L A;  4G9B A;  1ZQE A;  4QNL A;  4O3O A;  1COO A;  4RWQ A;  5D4B A;  8ICF A;  2E8M A;  2F77 X;  5F3X B;  2K8B B;  3HIL A;  5DBA A;  4JV2 A;  4O3P A;  2ZJ5 A;  1S0M A;  1GPJ A;  3K4G A;  3G6X A;  3GV5 B;  4G3I A;  4I2F A;  3AQF A;  3TAD A;  3RJI A;  3AU2 A;  4X4V A;  4C4S A;  4X4U A;  4ED1 A;  2PMZ F;  5HR9 A;  2W8L A;  1ZYQ A;  3RTV A;  2HMX A;  1SKS A;  3BDP A;  5DB9 A;  3I76 A;  4KMO B;  2OWO A;  1L6N A;  4NLC A;  4XUS A;  4IRK A;  1QLN A;  1TFR A;  1T8E A;  2WF9 A;  1NJX A;  1X6J A;  4KLE A;  4BWJ A;  2W9A A;  1MIW A;  3SAF A;  3BQ2 A;  1X40 A;  3IN5 A;  4AT8 A;  5AK5 A;  2R8K A;  4Y2U A;  3WKD A;  4U7C A;  1JXE A;  2MUT A;  5KG4 A;  2HHP A;  3PX6 A;  5J0W A;  1FA0 A;  2NRK A;  4NXT A;  3Q8Q B;  2Y9T A;  2KEY A;  4GXI A;  5J0S A;  2BDU A;  3O0F A;  5AM4 A;  4JLX A;  3ICX A;  3SEI A;  3LVV A;  3RR7 A;  2DGZ A;  2BQU A;  2HDO A;  3K1R B;  4UAT A;  4DWI A;  3J81 j;  1ZQG A;  2KHQ A;  2W11 A;  5KFH A;  1T3Q A;  4DL4 A;  3QUB A;  3KBB A;  4WC6 A;  1WYG A;  2KVS A;  1TFY A;  4EYI B;  1U45 A;  1S8O A;  1ZRM A;  5AK4 A;  3V6J A;  3AM9 A;  1JIH A;  1D9D A;  5J2A A;  2ZH3 A;  3NS1 A;  1B43 A;  4QWD A;  4Y2P A;  4Y2T A;  3WK5 A;  1KEJ A;  5TIS U;  2V9W A;  1NK9 A;  2LM1 A;  4KLQ A;  3FYH A;  8ICL A;  3M6Z A;  4UB8 U;  2I5H A;  4EZ9 A;  5ALD A;  2BBH A;  1WWV A;  4C7Z A;  2KFN A;  3HKZ F;  4O0I A;  2DVI A;  2EH9 A;  2W9C B;  2WTF A;  1VFG A;  3QU9 A;  1JQR A;  3JPP A;  7ICJ A;  5KFL A;  1A0P A;  4RQ3 A;  4TUP A;  5IIM A;  4F5R A;  1KDH A;  4EBD A;  4X4O A;  5HRE A;  3OVB A;  5GTH U;  1O03 A;  4NLB A;  2AQ0 A;  1VJ7 A;  3WFP A;  4M2Y A;  1UET A;  4K99 A;  3KKA C;  1ECW A;  5ALI A;  3H37 A;  4O69 A;  4F5O A;  1L8L A;  3TAD C;  4FH5 A;  1PVR A;  2V4R A;  9ICJ A;  2H3Z A;  5KFV A;  1KFT A;  3MR6 A;  4ECY A;  1Q3U A;  5ALK A;  4MFF A;  4O9M A;  3C2K A;  3PO4 A;  1ZQV A;  1SV0 C;  2MRL A;  1DXS A;  1ZQW A;  1X9S A;  4I27 A;  4ATB A; 
#chains in the Genus database with same CATH homology
 2BPG A;  4RNN A;  5L1I A;  2ZH4 A;  4EEY A;  4ECZ A;  3EPI A;  3T5K A;  1CUK A;  5DBB A;  4X4S A;  1ZQT A;  4KLG A;  4DSL A;  9ICA A;  1A77 A;  2FPM A;  5KFU A;  3NYB A;  2MAX A;  1SL2 A;  1WCN A;  2HVI A;  2ZH8 A;  3EPG A;  4MEX A;  4F5N A;  2Y1J A;  2M2V A;  1S9F A;  5KFR A;  2NRX A;  5J0Y A;  4UAY A;  3OSN A;  2ZJ8 A;  3ZDE A;  4O3Q A;  2I1Q A;  3C23 A;  3TAQ A;  1TAU A;  3V7J A;  3OUY A;  2P6U A;  4YG2 A;  4DL7 A;  9ICS A;  1RPL A;  4MEY A;  4F50 A;  3RR8 A;  2P6R A;  4P4M A;  4MFA A;  1B22 A;  4KLL A;  5J2J A;  4C8O A;  5KFM A;  2XY6 A;  4P4O A;  4QZD A;  5CP2 A;  3TAN A;  1L3S A;  4S3N A;  4EBE A;  2ZJA A;  2UVV A;  4ELU A;  4HYK A;  4IQT A;  5DB7 A;  4UAW A;  4UB5 A;  4PHD A;  4JWN A;  4I2E A;  4NLN A;  1YLQ A;  3RJH A;  3JPT A;  1KRP A;  4F8R A;  3Q8M A;  3JPQ A;  4KLJ A;  5CJ7 A;  4PHE A;  3JPN A;  1TKD A;  1NK4 A;  3GQC A;  2KZZ A;  5HC9 A;  5DQH A;  3PW2 A;  2JEF A;  5EWE A;  3V7K A;  2H5X A;  5J0P A;  4R66 A;  2J6S A;  3C18 A;  4C8M A;  5J2D A;  4K4H A;  4AT9 A;  2XCA A;  1MSW D;  3JPR A;  2HHW A;  3Q8K A;  8ICQ A;  1DK3 A;  3LWM A;  3UPQ A;  4WC5 A;  4EBJ A;  2HHT A;  4R8U B;  8ICN A;  4RQ1 A;  5KFT A;  1K1Q A;  4J9M A;  3JYY A;  4NKT A;  2DFL A;  4KLH A;  1L3T A;  2PI4 A;  4F92 B;  1RZT A;  1KTQ A;  5J0O A;  5HNK A;  4QZI A;  4B9T A;  1Z3E B;  4FHW A;  2ZH9 A;  3BQT A;  3H8W A;  3ETL A;  5DLG A;  4J9L A;  9ICX A;  2XGP A;  4EZ6 A;  2ZTD A;  3Q8P B;  2Y1I A;  7ICU A;  1NKC A;  5DG8 A;  7ICG A;  3LWL A;  4KLI A;  3SV4 A;  1BVS A;  4QWB A;  4RPX A;  4YR2 A;  1TVA A;  2BGW A;  1UEV A;  4RU9 A;  3M9O B;  5IIL A;  5DG9 A;  4PPX A;  3FDS A;  3PX0 A;  4M47 A;  4WC3 A;  7ICL A;  1BNO A;  2FLN A;  3BQ1 A;  4RUC A;  5IIJ A;  3C5F A;  4DSJ A;  1ZQF A;  4YXJ A;  4M9N A;  3PR5 B;  4WC1 A;  3RJF A;  3PV8 A;  4I29 A;  4FHV A;  3EW9 A;  5EOZ A;  4IRD A;  9ICP A;  2F1J A;  4EBC A;  4DFM A;  2P66 A;  4LT6 A;  5HHH A;  4FHY A;  4WBZ A;  3GIK A;  4DL2 A;  2NRV A;  1ZET A;  4O5K A;  4E7X A;  2IBK A;  1ZQU A;  1RXV A;  4I2A A;  4DOC A;  4QWC A;  3L9D A;  8ICV A;  5EWF A;  2NRZ A;  2DRB A;  2AU0 A;  1XSP A;  2AGO A;  1HUZ A;  3H40 A;  3GIL A;  3PW7 A;  5HML A;  1S0V A;  3JPO A;  8ICH A;  5KFY A;  4DSE A;  1MQ3 A;  4I2D A;  8ICZ A;  4R64 A;  2M2U A;  2ALZ A;  3G6V A;  5KFC A;  3PY8 A;  4R65 A;  4FS2 A;  3HJ1 A;  4PHP A;  3MGH A;  1TAQ A;  1K1S A;  5DLF A;  2IA6 A;  3SZ2 A;  8ICY A;  9ICG A;  1UEU A;  4FHP A;  4AT7 B;  4I2J A;  3TAP A;  2AQ4 A;  2ISP A;  4M6W B;  4Z6E A;  4RQ4 A;  3IM1 A;  4QW8 A;  5L1K A;  4KIT B;  3TQ1 A;  2BCV A;  7ICN A;  1L5U A;  4PHA A;  5KFB A;  4M9L A;  5KFF A;  3H4D A;  1DOQ A;  4BGD A;  4KLD A;  4IQU A;  4F2S A;  1ZQJ A;  2KP7 A;  1T4G A;  4DLE A;  1NK7 A;  1R8B A;  4QZC A;  4WBY A;  2M9N A;  5KT5 A;  2C2R A;  5C5J A;  4QZE A;  5KG1 A;  9ICW A;  8ICP A;  1MIY A;  2ZHA A;  3M8R A;  5KFE A;  5KG6 A;  1IXR A;  4O5E A;  8ICJ A;  3RBE A;  2KTQ A;  5D46 A;  4PGQ A;  2AGP A;  2HHQ A;  3AQN A;  1XC9 A;  4XA5 A;  1N56 A;  4RWO A;  4ECS A;  4F4W A;  1U47 A;  1S10 A;  7ICQ A;  8ICE A;  3ZD9 A;  2BPF A;  8ICS A;  2R8J A;  4C8N A;  5KFK A;  8ICG A;  3WFQ E;  5KFX A;  3UQ0 A;  2UVW A;  4BDP A;  4X4T A;  4QZA A;  1T3N A;  4XQ7 A;  1ZQM A;  2A1J A;  5J2E A;  4X5V A;  7ICT A;  9ICO A;  1IM4 A;  1UA0 A;  4JV1 A;  4ECV A;  2DPJ A;  4M5D A;  4IR1 A;  4FBT A;  4UAZ A;  2JEG A;  1R8A A;  4DSK A;  1ZQI A;  4QZB A;  4FH3 A;  4QZ9 A;  1Z00 A;  4TQR A;  1CEZ A;  1Q78 A;  4DQQ A;  5DDM A;  2VAN A;  4UB1 A;  4J9O A;  8ICC A;  1X9M A;  8ICT A;  4DOB A;  2BHN A;  1SKW A;  4I2G A;  5KFZ A;  1WCL A;  3PVX A;  1U4B A;  2BQ3 A;  9ICU A;  1V9P A;  2PFN A;  4MFC A;  3QEB Z;  5KT7 A;  2HHS A;  4WC0 A;  5KFA A;  2BCQ A;  3RB6 A;  2HHU A;  2ZTC A;  1BPE A;  5III A;  2JZB A;  4J9Q A;  1TK8 A;  2VA3 A;  4MF2 A;  3OVS A;  5DGB A;  3GV8 B;  5DDY A;  4YN4 A;  5KFI A;  5CR0 A;  2HVH A;  2ASD A;  7ICP A;  2R8I A;  3MR2 A;  3TI0 A;  1NK6 A;  4ELT A;  4QZH A;  3V6K A;  3HJ4 A;  2ISO A;  3JPS A;  4M0A A;  3WFR E;  4EP7 A;  4TUR A;  4ECT A;  7ICE A;  4KLM A;  2ZUD A;  4O5C A;  4I2I A;  3PNC A;  4UBB A;  4TUS A;  2HW3 A;  9ICK A;  9ICL A;  3JZ0 A;  3PML A;  3ZDD A;  3RAQ A;  8ICB A;  3RBD A;  4RQ6 A;  2R8G A;  4RNO A;  4UD4 A;  2DR7 A;  1U49 A;  1TFW A;  4X0B A;  3EWA A;  1BPB A;  1ZQR A;  4X4R A;  5KT2 A;  3MR5 A;  4J9P A;  2ZH2 A;  3C1Z A;  5J0T A;  1D8L A;  1ZQA A;  4KMU A;  8ICM A;  2IHM A;  1NJZ A;  5HHI A;  3HX0 A;  1ZQD A;  4X4Q A;  2O1P A;  2R8H A;  3C66 A;  4AT7 A;  3GFK B;  5KFN A;  4RWP A;  4I2H A;  1S76 D;  4PGX A;  5TZV A;  1JXL A;  4NLZ A;  5J0Q A;  2IHN A;  4BWM A;  1R8C A;  2PXI A;  4FO6 A;  2JEI A;  8ICK A;  5KFD A;  3QZ8 A;  4GXK A;  4I2C A;  9ICF A;  2ID1 A;  4F93 B;  4C8K A;  1JAJ A;  1X2I A;  2ATL A;  1KFD A;  4YR0 A;  1Y88 A;  1JX4 A;  1BPY A;  4ECX A;  3E2E A;  1PX5 A;  3B0Y A;  4FBU A;  7ICH A;  2ZUB A;  5IIO A;  3ZDB A;  3LK9 A;  2VA8 A;  1X9W A;  1ZJN A;  1ZQL A;  2B21 A;  2M2W A;  3WFS C;  4MF8 A;  3GII A;  5J0X A;  3RH5 A;  2ZH5 A;  3M8S A;  1S0N A;  4JWM A;  8ICW A;  5CA7 A;  1WOT A;  4R8U A;  4JV0 A;  2O5A A;  3ZD8 A;  2F1H A;  1BPZ A;  4F5Q A;  1ZQY A;  3H4B A;  2C28 A;  5KFQ A;  3EYZ A;  3H38 A;  2PFQ A;  5DKW A;  4DO9 A;  3AU6 A;  2BCU A;  1DK2 A;  1NOM A;  4NM2 A;  4J9S A;  4ZH4 A;  4QZ8 A;  5BOM A;  3MDC A;  3T5H A;  9ICR A;  5IIN A;  2BE3 A;  4RT2 A;  3TAR A;  4I28 A;  4M9J A;  1A76 A;  1F5A A;  4F4Z A;  4ELV A;  3H3A A;  3C5G A;  4TUQ A;  2JZB B;  4QWA A;  4IG8 A;  5HRD A;  4M9G A;  5KT6 A;  5EWG A;  2C2E A;  1NK5 A;  3RJE A;  5DEC A;  4RWN A;  1XSN A;  4K4G A;  2ASJ A;  3LQC B;  3AQK A;  2DR9 A;  4RPZ A;  1XO1 A;  2ZUC A;  4DL6 A;  3UQ2 A;  5KFG A;  3SI8 A;  1BPD A;  2VA2 A;  4DFJ A;  3C2L A;  1ZQS A;  3H8J A;  3ISB A;  4F3O A;  3OVA A;  1XS9 D;  2ZH1 A;  4RZR A;  4J9R A;  5IIK A;  4ED3 A;  4Q43 A;  4F91 B;  2BR0 A;  4XRH A;  2FMP A;  5HRB A;  3RJG A;  3NTU A;  2PI5 A;  1S97 A;  2BQR A;  2XCP A;  4ED2 A;  4B9L A;  4M6W A;  5KG2 A;  7ICK A;  2C22 A;  1TK5 A;  1L3V A;  1HUO A;  5J2B A;  2C2D A;  8ICX A;  4NM1 A;  4UB4 A;  5KG5 A;  5DB6 A;  4UQG A;  1NKE A;  4O3R A;  1OU5 A;  4XQ8 A;  4Q8E A;  4GC7 A;  5J0U A;  7ICF A;  4UB3 A;  3GV7 B;  2A1J B;  3HPO A;  3M9M B;  5JUM A;  3OV7 A;  2RDI A;  5DB8 A;  3KHG A;  1SL1 A;  5DQG A;  5KG7 A;  4E8F A;  5F9N A;  4DF4 A;  1Z00 B;  4YFK A;  1XSL A;  4WCW A;  3T3F A;  2KZM A;  3HW8 A;  4KLO A;  4YMM A;  3MBY A;  3QE9 Y;  4Q45 A;  3QZ7 A;  5DGA A;  2HHV A;  3RH6 A;  1LB2 B;  4YR3 A;  4B9M A;  1UT8 A;  3UPS A;  4FS1 A;  1H38 A;  2W9C A;  2XGQ A;  4GXJ A;  5HRI A;  4EBK A;  1JN3 A;  4DOA A;  4RNM A;  8ICI A;  3OJS A;  5HP4 A;  3Q8S B;  1S0O A;  1SKR A;  1C7Y A;  1NKB A;  5HRL A;  4DL5 A;  9ICV A;  1NZP A;  5J2I A;  2IMW P;  4DLG A;  4Z6D A;  2LYH A;  4Z6F A;  2PBE A;  3MFH A;  4DS5 A;  4KTQ A;  4E80 A;  4DF8 A;  1ZQZ A;  3N4M B;  3THV A;  1EXN A;  3Q8L A;  2KZ3 A;  2ZTE A;  3PO5 A;  1ZQE A;  1ZQQ A;  4IR9 A;  4O3O A;  4RQ8 A;  5J29 A;  5J2H A;  1COO A;  4RWQ A;  2PFP A;  5KFJ A;  3C21 A;  1MC8 A;  4RQ2 A;  4F4Y A;  4YVZ A;  1BNP A;  4P4P A;  5D4B A;  4YQW A;  3RB4 A;  1UA1 A;  8ICF A;  1V4A A;  2XY7 A;  3RB0 A;  4YMO A;  5DBA A;  2FMS A;  4JV2 A;  4O3P A;  1MIV A;  4X4P A;  2ZJ5 A;  1S0M A;  5KFO A;  3K4G A;  3G6X A;  3KHH A;  4TQS A;  3GV5 B;  4G3I A;  4I2F A;  1PZN A;  5D49 A;  3PW4 A;  4NLK A;  1U9L A;  2V4Q A;  4PGY A;  4UBC A;  3RJI A;  3AU2 A;  4X4V A;  7ICO A;  4ECW A;  4DSF A;  4ED1 A;  3PW5 A;  4F4K A;  3V7L A;  4Q44 A;  3TFS A;  4X4U A;  5HR9 A;  4RPY A;  2W8L A;  1ZYQ A;  5HRG A;  5BOL A;  3RTV A;  1SKS A;  3BDP A;  3C1Y A;  1NJY A;  5DB9 A;  3BQ0 A;  1S77 D;  7ICS A;  3C2M A;  1ZQB A;  2OWO A;  4YD2 A;  4C8L A;  4LZG A;  4XUS A;  4IRK A;  1XWL A;  2XY5 A;  1RYS A;  1QLN A;  1D8Y A;  1TFR A;  3NGD A;  2XC9 A;  1T8E A;  5DED A;  5J2F A;  4K4I A;  1DGS A;  4M04 A;  1NJX A;  4ED0 A;  5KFS A;  4KLE A;  4BWJ A;  3OGU A;  1JMS A;  2W9A A;  4B9V A;  4DQP A;  4NY8 A;  2ZHB A;  3BJY A;  4JUZ A;  1BGX T;  4BXO A;  2DR8 A;  1MIW A;  3V72 A;  3BQ2 A;  4DSI A;  4AT8 A;  4F4X A;  4ECQ A;  1RXW A;  1ZQN A;  2R8K A;  2AJQ A;  4RT3 A;  1KSP A;  2J6U A;  1JXE A;  2MUT A;  1QSY A;  1KLN A;  5KG4 A;  3ISD A;  4KLF A;  1ARO P;  3PX6 A;  2HHP A;  2W8K A;  5J0W A;  1ZQH A;  4GLX A;  5L1L A;  9ICM A;  7ICR A;  1FA0 A;  1T7P A;  2NRK A;  4YCX A;  2PFO A;  4WC7 A;  8ICO A;  3Q8Q B;  5L9X A;  5KT3 A;  5BPC A;  9ICN A;  4YMN A;  4GXI A;  5J0S A;  3IHQ B;  3RRH A;  3MFI A;  3HWT A;  1QSS A;  3RRG A;  1ZQC A;  4F5P A;  2W9B A;  1D9F A;  5F2V O;  3RR7 A;  3SV3 A;  5DBC A;  3UXO A;  9ICH A;  4O3S A;  2BKE A;  3AQL A;  3PW0 A;  2RDJ A;  2BQU A;  9ICI A;  4Z6C A;  3MGI A;  3MAB A;  1Q79 A;  4LVS A;  4ED8 A;  4RUA A;  4DQS A;  2J6T A;  7ICV A;  3RB3 A;  8ICU A;  4ED6 A;  5HMM A;  3GIJ A;  2BCR A;  4DWI A;  3QEA Z;  2F1I A;  2ZH7 A;  1ZQG A;  7ICI A;  1ZQP A;  4DQI A;  4DEZ A;  1LV5 A;  2ASL A;  5KFH A;  4KN7 A;  1SL0 A;  2FMQ A;  4AT9 B;  3RAX A;  3MR3 A;  4DL4 A;  2UVU A;  3ORY A;  4WC6 A;  1TFY A;  1U48 A;  3ZDA A;  4WC4 A;  3H7I A;  4EYI B;  3EZ5 A;  5CHG A;  2HHX A;  4KLT A;  1HJP A;  3RJK A;  2DRA A;  1U45 A;  4I2B A;  4YP3 A;  3V6J A;  4F2R A;  4B9S A;  3GIM A;  2W9M A;  4DFK A;  1NK0 A;  1ZQO A;  3AQM A;  4QZF A;  5KFW A;  1JIH A;  4IRC A;  1D9D A;  5J2A A;  3RH4 A;  1L3U A;  3T5L A;  2GWS A;  4X0A A;  3OUY B;  4X4N A;  4YXM A;  1TK0 A;  2ZH3 A;  5HRK A;  2MUT B;  4E0D A;  4IQV A;  1B43 A;  2FPK A;  4QWD A;  4GC6 A;  4B9U A;  4DFP A;  3HIY A;  2FLP A;  1ZQX A;  4KLU A;  1KEJ A;  3K75 D;  2Q0Z X;  3AUO A;  2V9W A;  1NK9 A;  4P2H A;  4QW9 A;  4CCH A;  5KG0 A;  3TFR A;  4KLQ A;  2NRT A;  3FYH A;  4KN4 A;  2AGQ A;  3RJJ A;  8ICL A;  1NO5 A;  1R89 A;  4FHX A;  4UD5 A;  4WC2 A;  2ZH6 A;  4KLS A;  4EZ9 A;  9ICB A;  1UT5 A;  1SZP A;  3UXP A;  3M9N B;  1ZJM A;  2M2T A;  3V6H A;  2KFN A;  7ICM A;  2UVR A;  4RQ0 A;  3ISC A;  5J2C A;  2JEJ A;  4O0I A;  2KN7 A;  4RQ5 A;  3PX4 A;  3KHL A;  4ECU A;  4QWE A;  3T5J A;  3OSP A;  2W9C B;  1ZQK A;  2BCS A;  1QTM A;  2WTF A;  1VFG A;  2NRW A;  4Q8F A;  1JQR A;  2W9B B;  4M9H A;  2Q66 A;  5DG7 A;  9ICE A;  3HP6 A;  3JPP A;  3KHR A;  4DQR A;  1RYR A;  1QSL A;  7ICJ A;  5KFL A;  5KT4 A;  8ICA A;  2DPI A;  5F9L A;  4IQW A;  5CB1 A;  4R63 A;  4AT8 B;  4RQ3 A;  2RFF A;  4TUP A;  3OJU A;  4F5R A;  2XO7 A;  3UXN A;  4ED7 A;  5IIM A;  4EBD A;  1KDH A;  1KFS A;  5HRE A;  4X4O A;  9ICT A;  3OVB A;  4DS4 A;  3LDA A;  2AQ0 A;  1MQ2 A;  4ECR A;  3Q8R B;  5L1J A;  1VJ7 A;  3WFP A;  2DVI A;  3OHB A;  4M2Y A;  4O3N A;  1UET A;  5HRF A;  3WFO A;  2FPL A;  3H37 A;  4NKU A;  4F5O A;  5J2K A;  4ATB B;  5CWR A;  4FH5 A;  1TV9 A;  2V4R A;  5KTQ A;  5KFP A;  3G6Y A;  2I9G A;  9ICJ A;  4BXO B;  4J9K A;  2DR5 A;  4JK1 A;  4UB2 A;  3SYZ A;  5KFV A;  2FLL A;  1KFT A;  5J2G A;  3B0X A;  3MR6 A;  8ICR A;  4EYH B;  3MDA A;  5KG3 A;  1NJW A;  4RQ7 A;  3N97 B;  3H39 A;  4ECY A;  3KTQ A;  3H8S A;  5DQI A;  2BPC A;  4YD1 A;  3PMN A;  4QZG A;  4NLG A;  4DL3 A;  4PH5 A;  5HRH A;  1N48 A;  1XU4 A;  4MFF A;  1NK8 A;  4O9M A;  1KNY A;  5J0R A;  2BDP A;  3HT3 A;  2KFZ A;  4B9N A;  3C2K A;  1BPX A;  3PO4 A;  1ZQV A;  3OHA A;  3ZDC A;  9ICQ A;  4LZD A;  3PR4 A;  4NXZ A;  1ZQW A;  3GDX A;  1X9S A;  4I27 A;  9ICC A;  4ATB A;  4J9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...