4MF8A

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ctp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
318
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 103
structure length 318
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf8A03
4KMUA 4DSIA 2ZH4A 4ECVA 4Z6DA 5KT6A 8ICXA 2PBEA 2KZMA 4F4WA 4AT7B 4DFKA 1X2IA 3PNCA 1NJZA 4X5VA 1ZQVA 5HMMA 3JPNA 5BPCA 3M9NB 1SKWA 2W9BB 1N56A 4WBZA 3MABA 3RJKA 3T5JA 9ICUA 5HRDA 4QZIA 5KFLA 1WCLA 1Z00B 4DFMA 3TQ1A 4DL3A 2MAXA 4F5NA 4KLTA 3V6KA 2KTQA 3NGDA 1UEUA 3RR8A 2M2VA 3THVA 1ZQDA 5J2GA 3IM1A 5CHGA 3H8WA 4WC6A 2NRKA 4MF8A 5DG7A 3OUYA 3OSPA 3T5LA 3LWLA 4MEXA 2BPFA 1ZQLA 1KRPA 3G6VA 4NLZA 4ELTA 4GLXA 3KHRA 1S76D 2FPLA 5KG0A 1COOA 4ECTA 4O5KA 5DGAA 4TURA 3TI0A 3RH5A 2DFLA 1ZQFA 2KZ3A 3ORYA 1ZQSA 2HVIA 4G3IA 8ICAA 5DEDA 3V7LA 4EBDA 5D4BA 1KFDA 4RNNA 3RH4A 3EPIA 1ZQKA 2J6TA 5KFRA 3PMLA 1D9DA 1JQRA 2XC9A 4DF4A 2C22A 2BCRA 3UPQA 1X9MA 9ICAA 5HRGA 2FLLA 5D46A 3C21A 3RRHA 4LZGA 2V9WA 9ICQA 3WFRE 4RWNA 4YXMA 1A77A 5IINA 5KFWA 5EWEA 1HUOA 4I2AA 5DGBA 4F5OA 1PX5A 4ATBB 3ZDBA 4UBCA 4XQ7A 4Z6CA 1ZQZA 4ELVA 3QE9Y 5J0OA 4ECYA 1QSYA 3B0YA 4QZAA 1TFRA 4RQ7A 3ISCA 1ZQJA 3RR7A 4F2SA 4FHXA 4X4TA 1IXRA 1ZQUA 2BQUA 2PI4A 1TAUA 3RAQA 1T4GA 4DL4A 4GC7A 4M6WA 2KFNA 2MUTB 4B9SA 2KFZA 3ETLA 3PR5B 3Q8MA 1WOTA 4UAWA 3PMNA 4B9LA 1U4BA 4JV2A 7ICFA 5J2JA 4F5RA 4DOAA 8ICGA 3G6YA 4ECXA 2AQ0A 1U48A 4QZEA 3TANA 8ICSA 3GV8B 1YLQA 4R8UB 3LDAA 3OV7A 4TUSA 7ICKA 3TAQA 3JPOA 2BCVA 4DF8A 4LVSA 4RWOA 2JZBB 1B43A 3PVXA 4YR2A 4DL5A 2F1HA 3ZDCA 1X9WA 4M9NA 2B21A 5KFMA 4KN7A 1SKRA 2BPGA 8ICWA 2ZJ5A 3C2MA 1NOMA 4DL6A 5J0QA 4O3PA 4NM2A 4TQRA 1VJ7A 4DQIA 3PW4A 9ICPA 3RJEA 3UPSA 4ECZA 3AU2A 2WTFA 1DK2A 3WFQE 1TKDA 3PO4A 5HMLA 5C5JA 3EZ5A 4JV1A 2HHSA 5J0PA 5KFTA 2Q66A 4YVZA 3BJYA 1ZQOA 4QZDA 1XSPA 3H8JA 4CCHA 3NTUA 9ICVA 4K4HA 4DSEA 4O3OA 1F5AA 1X9SA 2W9CA 2BGWA 9ICEA 1KFTA 4Z6EA 5KFIA 4YR3A 3M9OB 4ECQA 4MFCA 5D49A 7ICVA 1R8CA 2C28A 4O3SA 2ZH9A 3AQMA 4M9JA 3Q8RB 3KHGA 1RPLA 3OVBA 4DQSA 1C7YA 9ICKA 3H4BA 1ZQMA 1D8YA 4NLGA 4UD5A 4J9SA 2C2EA 4M0AA 2HHXA 4X4OA 5HC9A 4PGXA 3C2LA 1KNYA 2ISPA 1VFGA 5KFFA 3H8SA 3BDPA 4DQRA 1BPXA 1KFSA 4DQPA 4KTQA 7ICQA 1XU4A 4NXZA 1BGXT 3JZ0A 3HP6A 4RT3A 1R89A 1SZPA 4K4IA 5KFOA 2ZTDA 2AGOA 4KLEA 4KLSA 4F92B 5HRIA 3NYBA 2ZHAA 3L9DA 3GIJA 5F2VO 2XCPA 8ICUA 4ELUA 2XGPA 4YQWA 4QZGA 4J9MA 4E0DA 4IR1A 4XUSA 2VANA 1QTMA 1BPDA 1A76A 5F9LA 3OJUA 5KG7A 4WC2A 3RAXA 4X4PA 3PW5A 3MR2A 3RB0A 3JPQA 2A1JB 2ASLA 1NK7A 2FMQA 8ICLA 1NJYA 3IHQB 4DWIA 3V7JA 1R8AA 5HRKA 2FMSA 4DLGA 3Q8QB 4FHWA 5DLFA 1NO5A 3MR3A 3WFPA 3H40A 3ISBA 8ICNA 2AGPA 7ICHA 4PGQA 2PI5A 1V4AA 1RZTA 2KP7A 4C8MA 4DLEA 2I9GA 2P66A 4M9LA 1S77D 2BR0A 4I2JA 1NJXA 1SL0A 2AGQA 3T3FA 2M2TA 5J2KA 4O3NA 5CA7A 4KLJA 1XSLA 3H7IA 1MIYA 4BWMA 4R63A 1RYRA 1K1QA 4AT8A 3UXNA 5DBCA 2M2UA 9ICHA 1ZQAA 9ICLA 3HX0A 2ASJA 2JEIA 8ICHA 5DECA 2IHNA 4ED8A 1BPYA 2XGQA 4HYKA 3PW2A 4DFJA 5DLGA 4J9NA 1BVSA 2XY6A 3T5KA 4RUCA 4K4GA 4JK1A 2IMWP 4QWBA 5CWRA 2IA6A 7ICIA 8ICQA 4X4QA 2ZH6A 5KFYA 3KHLA 3T5HA 4DSLA 3C1ZA 4DO9A 2BKEA 2BHNA 5DQIA 1NJWA 4Q43A 4RNOA 3C5GA 8ICKA 4YR0A 4M9HA 4GXJA 5JUMA 3OGUA 1TAQA 2ZTEA 1NK6A 4RWPA 1UETA 3MGIA 4ED2A 2DR8A 2FLPA 5IIMA 4BXOB 3PX0A 3OHBA 1L3UA 4ECWA 4NY8A 4F4XA 4F5PA 5IIJA 3M8RA 4FS2A 2HHWA 1ZJNA 4FH3A 1TFYA 2P6UA 3RJJA 5KT2A 4RQ2A 3KHHA 4KLOA 4PHEA 2KN7A 2R8IA 4WC4A 3JPSA 3H39A 1RXWA 7ICUA 4RNMA 3C1YA 1PZNA 4UD4A 2BCUA 4X4UA 3V7KA 4IRDA 3RJFA 1Q79A 3GFKB 1S10A 8ICPA 2FPMA 4YMNA 4ED3A 3E2EA 4AT9A 2F1IA 5F9NA 4RPXA 4NKTA 4RZRA 2XY5A 3PX4A 4ECUA 3WFSC 3PV8A 1D9FA 4QZFA 4B9NA 1NKCA 1L3TA 4IRCA 4KLGA 2AU0A 4Q8FA 4X4NA 2ID1A 4TUQA 5KTQA 4YMMA 1S0NA 3FYHA 5CB1A 1UT5A 1ZQPA 1MIVA 4WC5A 5KG1A 4EZ9A 4AT7A 5KFQA 3GDXA 2V4RA 2W9BA 3RBDA 5IIKA 1B22A 3AQNA 1LV5A 1QSLA 4WBYA 5KFBA 4DOCA 4O0IA 2GWSA 1Z00A 4RU9A 1R8BA 1NZPA 3JPRA 2W9MA 4F8RA 2HHTA 4KLMA 3C2KA 3JPPA 4KLQA 3H37A 4YXJA 3AU6A 4MFFA 2W9CB 8ICYA 2ZH3A 2HVHA 1JXLA 2DPJA 3UXOA 2PFQA 4MEYA 5KFJA 1ZQCA 4B9TA 3Q8SB 3AQKA 1L3SA 1BPEA 4QZ9A 3OVSA 1ZQXA 4RPYA 4PHDA 2VA3A 5KT7A 3ZDAA 2ZJ8A 5DDYA 1H38A 2I1QA 7ICRA 3LK9A 5HHIA 7ICLA 4C8NA 4I2BA 5EWGA 4PGYA 4O3QA 4TUPA 4JV0A 2NRVA 3GV5B 8ICVA 2JEGA 4I28A 9ICSA 2ALZA 3MBYA 9ICXA 3C18A 4DS5A 5HRFA 2Q0ZX 2IHMA 4RPZA 2J6UA 2OWOA 7ICNA 4J9PA 3V6HA 1SL1A 4P4OA 2UVWA 5HRBA 4FHVA 5HHHA 3MGHA 1S0VA 5IIOA 4KLDA 4ATBA 9ICNA 1JXEA 5BOMA 5KFPA 3RB6A 3BQTA 3AQLA 2UVVA 1K1SA 1QSSA 4JWMA 3G6XA 5DG9A 4UB5A 3Q8PB 4B9UA 4E7XA 3M9MB 3RB3A 2MUTA 4IRKA 4UB3A 3PW7A 3PO5A 4WC0A 4C8LA 3TFSA 2FLNA 1HJPA 3SZ2A 8ICRA 2O5AA 4M2YA 4BWJA 4R64A 4J9RA 5HR9A 1TK0A 4X4SA 4NLKA 1UA0A 4R8UA 3RTVA 1U49A 3UXPA 2P6RA 2ZH7A 4QWEA 3PY8A 4O9MA 4NM1A 3GQCA 5KG4A 2H5XA 2JZBA 2BE3A 4B9MA 4I2HA 3UQ0A 4NLNA 4AT8B 2FPKA 4MF2A 1TK5A 3C23A 5DBAA 1JX4A 2DPIA 8ICIA 1SL2A 5J2HA 4KLUA 2ZUDA 3MR6A 2M2WA 3MDAA 4EBCA 4FO6A 3WFOA 3PX6A 1MSWD 2UVUA 4KLIA 3RJIA 4FBTA 4UB2A 3EYZA 1U45A 2BQ3A 2C2DA 3K75D 4PPXA 4EP7A 4PHAA 4ECRA 1TVAA 2R8KA 1DK3A 1T8EA 4B9VA 5HRHA 5EOZA 8ICJA 2HHPA 3OUYB 4IQUA 4R65A 3LWMA 1Q78A 5L9XA 4F5QA 4WC3A 8ICEA 2VA8A 8ICFA 4P4PA 3RRGA 5KFEA 5KFCA 5DB9A 4Q45A 4P2HA 8ICMA 3MFHA 4UAYA 4QWAA 1JN3A 2NRXA 3SYZA 4QW8A 8ICZA 3BQ2A 3QZ7A 5J0XA 2O1PA 3H3AA 5KT4A 5J0WA 4QZHA 4DS4A 4YCXA 5DDMA 2UVRA 9ICFA 3V72A 2ASDA 3RJGA 4KLFA 8ICCA 2Y1JA 4F50A 5KG6A 5J0UA 5KFZA 1XSNA 5KT5A 1KEJA 5J2CA 2ZHBA 3RBEA 4UQGA 3GIMA 3V6JA 2PFOA 7ICOA 3OSNA 9ICJA 5J2FA 4EBJA 4UBBA 4AT9B 1NK0A 1EXNA 4UAZA 3GIKA 3SV4A 5KFXA 4ED0A 3BQ0A 5L1LA 4DOBA 4DFPA 9ICMA 1WCNA 3K4GA 5CR0A 2W9AA 1ZQIA 4IG8A 4QWDA 1DOQA 7ICGA 3EWAA 3M8SA 3HT3A 1V9PA 4EYIB 5HREA 1MQ2A 5KFUA 4YMOA 2VA2A 4S3NA 2A1JA 4I2GA 1U47A 5J0YA 4GXKA 4DSFA 5DB7A 4M6WB 1CEZA 1JMSA 3N4MB 9ICGA 2DRBA 4Q8EA 9ICCA 1XC9A 5KFAA 5L1KA 4RQ6A 1S0MA 5DBBA 1MQ3A 4TQSA 4RT2A 1ZETA 2NRTA 3RB4A 3RJHA 4E80A 4BDPA 4MFAA 4EEYA 3GV7B 2DRAA 2LYHA 4M47A 4F4YA 3QZ8A 2XCAA 1T7PA 5J0RA 5DG8A 2NRZA 3EPGA 2NRWA 2XY7A 3RH6A 1SKSA 2ZUBA 1UEVA 4RQ8A 3H38A 2ISOA 5J2BA 3HPOA 3OJSA 4WCWA 5EWFA 1ZJMA 1RXVA 1ZQTA 4JUZA 5J2EA 4KITB 4XQ8A 4P4MA 3TFRA 1ZQQA 2BCSA 4I27A 3MDCA 1FA0A 2ZH1A 4I29A 5HP4A 4FHYA 4YG2A 4YP3A 5KFHA 5DB8A 4RQ3A 4YD2A 4RQ1A 2ZUCA 1AROP 2HHUA 2IBKA 1XS9D 4YFKA 1XWLA 4DSKA 4FHPA 4X0AA 3TAPA 2JEJA 2W8KA 4FBUA 1TK8A 8ICOA 3GILA 5DQGA 9ICIA 1JIHA 4X0BA 2HW3A 4NKUA 1UA1A 5IIIA 1OU5A 1ZYQA 2PFNA 4X4VA 2F1JA 4EBEA 4BXOA 3ZD8A 1N48A 5HRLA 4DQQA 2DVIA 3Q8LA 3MFIA 1NK5A 4RQ4A 4F2RA 1XO1A 2BDPA 3N97B 7ICMA 4FS1A 2RDIA 3AUOA 3TARA 1Z3EB 1TV9A 1ZQNA 5KFKA 4M9GA 3ZDEA 5L1IA 1KDHA 4Z6FA 4DL2A 7ICTA 3QEAZ 4XA5A 2AJQA 5DQHA 1BNPA 1MIWA 3HJ1A 4EBKA 7ICPA 2HHQA 9ICWA 4KLHA 1BNOA 3PR4A 5CJ7A 4DEZA 3JPTA 3HJ4A 5KT3A 4J9KA 2J6SA 2ATLA 2XO7A 4XRHA 3SI8A 4O5EA 1Y88A 2DR5A 2V4QA 4F4ZA 9ICOA 5KFNA 2RFFA 4UB1A 5KG2A 4M04A 3H4DA 8ICTA 5J2IA 5BOLA 3C5FA 3OHAA 1ZQHA 2ZH8A 4Q44A 4GXIA 2W8LA 4WC1A 3HW8A 4DL7A 4QW9A 1ZQRA 1L5UA 5J2DA 2BPCA 3MR5A 1QLNA 9ICRA 1ZQWA 4I2IA 5KG3A 2KZZA 1JAJA 4R66A 1U9LA 4QZ8A 1NKEA 3QEBZ 1S97A 1ZQGA 4J9LA 4C8OA 5J0SA 1KLNA 4LZDA 4EYHB 5DB6A 1NK9A 4YD1A 4RWQA 2PFPA 3OVAA 3KTQA 4ED6A 4EZ6A 4WC7A 4J9OA 1IM4A 4RQ0A 4JWNA 5IILA 4ZH4A 2R8JA 4I2EA 4IQVA 1NK4A 2ZH5A 4I2CA 4RUAA 4PH5A 1RYSA 1KSPA 1BPBA 4BGDA 1HUZA 4IQWA 4C8KA 2M9NA 5J0TA 2HHVA 5CP2A 3LQCB 3PW0A 3EW9A 3C66A 3BQ1A 2Y1IA 2DR9A 4QZCA 1NKBA 4QWCA 4UB4A 4O5CA 1CUKA 2RDJA 5J2AA 1S9FA 1LB2B 7ICSA 4E8FA 3HWTA 7ICEA 2R8GA 2ZH2A 2BQRA 1KTQA 2JEFA 4YN4A 4GC6A 4X4RA 2ZTCA 1ZQBA 3JYYA 3ZDDA 4FH5A 3FDSA 9ICTA 4F93B 4RQ5A 5HNKA 1T3NA 2FMPA 4LT6A 5J29A 2BCQA 2DR7A 4F91B 2PXIA 4ED7A 1NK8A 4KN4A 4F4KA 8ICBA 4F3OA 5KFVA 5KFDA 3ISDA 1DGSA 5KFSA 5L1JA 4ECSA 1MC8A 4ED1A 1L3VA 5KFGA 5TZVA 3SV3A 4I2DA 1TFWA 4I2FA 5KG5A 4IR9A 2ZJAA 3GIIA 4O3RA 3HIYA 1ZQYA 4M5DA 3UQ2A 7ICJA 2AQ4A 1BPZA 4PHPA 3B0XA 2R8HA 4DSJA 4KLLA 4QZBA 2C2RA 9ICBA 1UT8A 4J9QA 1D8LA 3Q8KA 4IQTA 5DKWA 1S0OA 3ZD9A 1ZQEA
chains in the Genus database with same CATH superfamily
4ECVA 2PBEA 1WUDA 2KZMA 4F4WA 3PNCA 4FFDA 3JPNA 5BPCA 2W9BB 1N56A 4FZNA 5HRDA 1L7PA 2LI6A 5JTIA 4PZNA 3RR8A 3IM1A 3N7SC 1VLBA 4PZOA 3OSPA 3KHRA 2FDRA 3N7RC 1L6NA 1HIWA 4TURA 8ICAA 1KFDA 5KFRA 1B4FA 4DF4A 9ICAA 3DDHA 3SENA 1HUOA 4C0ZA 4F5OA 3BZCA 2QARA 2ZIWA 3BZKA 1ZQZA 4ELVA 1QSYA 4QZAA 2YY6A 1TFRA 4RQ7A 3ISCA 4QNLA 3RR7A 1PVPA 1IXRA 1TAUA 5K4LA 1T4GA 4DL4A 4M6WA 2KFNA 3BS5A 1AQ6A 2W3RA 8ICCA 4JV2A 7ICFA 2EH9A 4DOAA 3G6YA 3K1ZA 3TANA 4CE6A 3OV7A 7ICKA 3QUCA 2YB1A 2KJ8A 2LM1A 3N7PD 4FHPA 8ICWA 2E8OA 3C2MA 2E1FA 4DL6A 4O3PA 4DQIA 9ICPA 2DBYA 3RJEA 3UPSA 1DK2A 1N62A 5C5JA 3EZ5A 4U6PA 5ALLA 1JALA 4OAHA 2EZXA 5ALTA 4Z6EA 4ECQA 4YR3A 4MFCA 7ICVA 5D49A 1YT3A 4O3SA 4NLCA 1SZHA 3KHGA 1F44A 1ZQMA 3CNHA 2L5YA 2WF6A 5HC9A 5D61A 1KNYA 1J2MA 5KFFA 4AYBF 2B51A 1L8OA 2MU2A 4C7ZA 2ZTDA 4KLSA 3L9DA 4O67A 3GIJA 2XCPA 4OJLA 4J9MA 4N7RA 3O0FA 2OYYA 2K4PA 4XJEA 3OJUA 3LYSA 5KG7A 4WC2A 3MR2A 3M6KA 8ICLA 3C28A 3IHQB 4DLGA 3Q8QB 4FHWA 1NO5A 3H40A 7ICHA 4PGQA 1UQVA 1FFVA 2P66A 3H8MA 3T3FA 1COKA 5CA7A 4KLJA 2FI1A 2KVSA 3H7IA 2HN1A 1RYRA 1KL9A 1ZQAA 3AQFA 2YMLA 2IHNA 1JROA 3PW2A 2ZIXA 1BVSA 4RUCA 2IMWP 5CWRA 7ICIA 4X4QA 3KHLA 4Q43A 3C5GA 2GA9D 1TAQA 2F2AB 3IP4B 1L3UA 2BZFA 5D62A 2HHWA 4FH3A 1KW4A 2HOQA 4Y2RA 2LKYA 3TACB 5ALJA 2KN7A 3M7DA 1Q79A 1S10A 8ICPA 4NKTA 4RZRA 1ZD3A 4QZFA 1L3TA 4IRCA 3QUTA 1S0NA 1UT5A 5J8YA 2B6GA 3RBDA 5IIKA 3AQNA 4UAUA 3KKAA 3TKAA 4Y2TA 4KLMA 3C2KA 8ICYA 3UXOA 4MEYA 2K4HA 1OXJA 2I5HA 3AQKA 5AM0A 1BPEA 4QZ9A 3OVSA 4O3MA 7ICRA 3JCFA 5EWGA 3F2DA 2EAMA 2K8CB 8ICVA 5HRFA 5A0LA 2Q0ZX 2NV3A 7ICNA 4J9PA 3RFAA 3MGHA 4KLDA 5BOMA 2QB0B 3ER8C 2HBLA 2ZIUA 3M9MB 5T14A 3RB3A 4WC0A 4C8LA 1HJPA 4R64A 5HR9A 4NLKA 4R8UA 4QWEA 3PY8A 2F8LA 2JZBA 2BE3A 3UQ0A 3DEEA 1TK5A 3C23A 5DBAA 1JX4A 5B66U 1SL2A 5J2HA 4CGZA 3MDAA 3WK6A 2EWRA 5H2FU 1MSWD 5AIAA 2UVUA 3IN5A 3RJIA 1Q3VA 1T8EA 2EANA 5HRHA 8ICJA 2XICA 3OUYB 3LWMA 2G06A 3KOOA 1Q78A 2NO4A 2Y9TA 4Q45A 3F5AA 3GU3A 4BJQA 4QW8A 2O1PA 5J0WA 2UVRA 3RJGA 4KLFA 2BBHA 3ERCC 3RBEA 3GIMA 3WK5A 3V6JA 1EXNA 3SV4A 1F0MA 2W9AA 1WCNA 5CR0A 4QWDA 2P35A 3HT3A 1V9PA 4YMOA 2W04A 1YZ7A 4GXKA 5DB7A 1JMSA 2DRBA 3IDWA 1S0MA 5DBBA 1ZETA 2NRTA 3RB4A 4E80A 4MFAA 3L5KA 3EPGA 3RH6A 4Y2JA 2ZUBA 1UEVA 5B3PA 1SWVA 2ISOA 3HPOA 5EWFA 1ZJMA 1ZQTA 3M1YA 1FA0A 2VJ5A 3M6ZA 5ALIA 4FHYA 4RQ3A 2ZUCA 5JU5A 1RQNA 1N5XA 1XWLA 4X0AA 3TAPA 4FBUA 3GILA 5DQGA 1L8LA 2RLTA 5IIIA 5KAIU 1ZYQA 4X4VA 2DVIA 4ICAA 4OCZA 3N97B 3TARA 1ZQNA 5KFKA 3ZDEA 5L1IA 2AJQA 2DWQA 2LBOA 4XA5A 5DQHA 4EBKA 3ONNA 5CJ7A 2HDOA 3AEVA 2J6SA 2ATLA 2XO7A 4XRHA 3SI8A 2A3VA 1Y88A 3WU2U 1FIQA 2DR5A 3K1RB 2XVTA 4F4ZA 2RFFA 4M04A 8ICTA 4U7CA 2KKPA 5BOLA 4QW9A 2BPCA 1CI4A 1QLNA 3WKDA 4R66A 4QZ8A 1NKEA 2KICA 4WJ3B 4LZDA 5DB6A 4EEDA 1WWVA 3D2NA 4ED6A 4USAA 1NK4A 4LEVA 4QIWC 3UM9A 5J0TA 3PW0A 3NWIA 4QWCA 3UMGA 3HKZF 1FO4A 2R8GA 7ICEA 1KTQA 5AM5A 4F93B 4RQ5A 5J29A 2MSNA 4ED7A 8ICBA 5KFVA 5KFDA 5KFSA 1ZQEA 5L1JA 4G9BA 1L3VA 3FM9A 4I2DA 3CP8A 4IR9A 2A19A 4Y2XA 4IL6U 5B3QA 4QZBA 2C2RA 3Q8KA 4WC4A 4DSIA 5KT6A 8ICXA 1ZRNA 4AT7B 1X2IA 1NJZA 1SKWA 4WBZA 2Q4TA 2OH2A 3RJKA 3T5JA 9ICUA 5KFLA 1WCLA 2W7OA 3QUBA 4JB3A 1YZ6A 1ZRMA 2HMXA 3NGDA 1ZQDA 3H8WA 4WC6A 3HJEA 3LWLA 3SQIA 2CXYA 2CRXA 3WK8A 4O5KA 4NXXA 2N1RA 3RH5A 1DRGA 5DEDA 4G3IA 5ALWA 3RH4A 4RNNA 2J6TA 1S8OA 3PMLA 1J97A 2FLLA 3RRHA 4RWNA 4FO1A 4UAVA 2WAQF 4I2AA 3ZDBA 4XQ7A 4CF5A 3QE9Y 1ZOLA 3B0YA 4K99A 2YN4A 2BQUA 2HOIA 2MUTB 1SV0C 4B9SA 2KFZA 4P0QB 4DCCA 1WOTA 3PMNA 1U4BA 2DKZA 4F5RA 8ICGA 2OHFA 1YLQA 3TAQA 2B0CA 4US9A 4RWOA 4LJXA 2YQEA 5AKYA 1WYGA 3PVXA 4YR2A 4DL5A 5J8YC 1SKRA 5KFMA 4KN7A 2ZJ5A 1N5WA 5J0QA 1KN5A 4NM2A 3F2BA 1RYUA 4ECZA 2WTFA 1TKDA 4QJFB 2HHSA 4YVZA 9ICVA 4DSEA 4O3OA 1F5AA 1X9SA 1KFTA 5KFIA 2W54A 3QU5A 4KMOB 3M9OB 5CEHA 2K4IA 5CFUA 4M9JA 4DQSA 1L7NA 2OXOA 4NLGA 4UD5A 4J9SA 4M0AA 4X4OA 4CDGA 4PGXA 3H8SA 7ICQA 3VC8A 5KFOA 2AGOA 4F92B 3NYBA 8ICUA 4QZGA 4XUSA 2WFAA 4CRXA 2VANA 2IHOA 1MN8A 1PVQA 2QB1A 3RAXA 2LHTA 3JPQA 2FMQA 1IV8A 5HRKA 4Y2PA 5DLFA 2AGPA 5AKXA 1Q46A 1RZTA 2I9GA 2BR0A 4I2JA 2G5IB 1QCKA 2OM6A 2Z7JA 2AGQA 2M2TA 5J2KA 4R63A 1K1QA 2M2UA 9ICLA 5AHXA 2JEIA 3WK7A 8ICHA 5DECA 5AI5A 4DFJA 4J9NA 5AK5A 3T5KA 2JR5A 2IA6A 8ICQA 2ZH6A 4F71A 4DO9A 3ER9B 2BKEA 5AKZA 4RQMA 4GXJA 5JUMA 1O08A 3A0HU 4ED2A 5AM3A 3L3FX 3PX0A 3OHBA 4ECWA 3RF9A 2IOFA 3M8RA 4FS2A 5CHEA 1T3QA 3RJJA 4K96A 3KHHA 3QYPA 4PHEA 2DKXA 1Q3UA 2IOFK 4RNMA 1SB3C 1PZNA 1V38A 2KIWA 4UD4A 4X4UA 4IRDA 2FPMA 3E2EA 4ED3A 3CK6A 5F9NA 4RPXA 4ECUA 1D9FA 1NKCA 4X4NA 4KLGA 4UW9A 2AU0A 2ID1A 4YMMA 3FYHA 1MIVA 5KG1A 4EZ9A 2OCEA 1LV5A 4WBYA 4DOCA 4O0IA 2ESEA 1Z00A 4RU9A 2GWSA 2F8KA 3H37A 3AU6A 2KSOA 4MFFA 2HVHA 1JXLA 2DQNB 5KFJA 1ZQXA 4RPYA 2JRZA 2KG5A 2ZJ8A 1H38A 3IRUA 7ICLA 4ACOA 2NRVA 3GV5B 3C18A 4I28A 4PL2A 1A0PA 2IUBA 1PUZA 2UVWA 5AM2A 2HN2A 5HHHA 4ATBA 3RB6A 3AQLA 1L7MA 3G6XA 5DG9A 4UB5A 5AKLA 1ZXIA 4E7XA 3NVYA 5E79U 3KBBA 5AK6A 3IG5A 3SZ2A 4NWIA 8ICRA 4M2YA 4BWJA 1UA0A 3RTVA 4B9MA 4NLNA 2F77X 4KLUA 2ZUDA 1S5LU 4HAIA 1TAMA 3PX6A 4KLIA 4UB2A 4PPXA 4PHAA 4ECRA 4B9VA 3NKUA 4IQUA 4C4TA 5ALHA 4R65A 2NO5A 2YMMA 5L9XA 4F5QA 8ICEA 2Y9UA 8ICMA 5KFEA 2WF5A 3MFHA 2I6XA 1JN3A 3SYZA 8ICZA 3QZ7A 4QZHA 2H3VA 1PK1A 2Y1JA 5J0UA 1XO0A 5J2CA 2ZHBA 4EBJA 1V97A 3OSNA 5ALQA 5ALSA 3CRXA 1NK0A 4UAZA 4ED0A 4DFPA 9ICMA 3QX7A 3K4GA 2QARB 1L7OA 3VCBA 2ZIWB 1DOQA 3EWAA 1IG6A 2A1JA 4I2GA 5J0YA 1CEZA 4M6WB 3OTQA 3BS5B 2KK0A 5KFAA 5L1KA 5KAFU 1SV0A 1MQ3A 4RT2A 2YB4A 2Y0SF 2LYHA 1T7PA 2NRWA 2MA1A 3FC4A 4GFJA 5J2BA 3OJSA 5J2EA 5AKEA 4P4MA 1Z4NA 4I29A 4K9AA 4YP3A 4EV6A 1AROP 4YFKA 4AP9A 4DSKA 9ICIA 1JIHA 4NKUA 4EBEA 4BXOA 4DQQA 4UATA 4FS1A 2RDIA 3AUOA 1Z3EB 5TISU 4Z6FA 4DL2A 2LM4A 1BNPA 1MIWA 2HHQA 9ICWA 4KLHA 3HJ4A 3JPTA 5G5HA 2JGAA 5KT3A 1K5OA 3J81j 3KZXA 2RQ5A 2K8AA 5J2IA 3C5FA 1ZQHA 1N2XA 3MR5A 5KG3A 2KZZA 1JAJA 4C8OA 5J0SA 2DL0A 1KLNA 5GTIU 1NK9A 2QLTA 4RWQA 1LKYA 4WC7A 2B4VA 3C29A 2R8JA 4WQKA 4I2EA 2ZH5A 5AIBA 2K8BB 5ALNA 2ZIXB 3I28A 4AYBC 3PZPA 2M9NA 2D6FC 3LQCB 3EW9A 2Y1IA 1DGJA 1ECWA 4UB4A 4O5CA 1TE2A 4Y2QA 5J2AA 1LB2B 4P0PA 4WOYA 2HOFA 2ZH2A 2BQRA 1ZQBA 4KM5A 4BX9C 3FDSA 5HNKA 4LT6A 4F91B 2PXIA 1NK8A 4KN4A 4NXWA 1DGSA 1MC8A 4I2FA 2ZJAA 2RP5A 1ZQYA 5AI8A 3QU2A 2AQ4A 3B0XA 4DSJA 4KLLA 4IQTA 4ELTA 1S0OA 4KMUA 2KD1A 1ZD5A 2ZH4A 4Z6DA 3TADC 1ZQVA 3M9NB 3MABA 3S6JA 4QZIA 2GAFD 4DFMA 3TQ1A 1LVHA 2MAXA 2ZIVA 3OPXA 4F5NA 4KLTA 2KTQA 1UEUA 2M2VA 3THVA 5J2GA 5CHGA 2NRKA 5DG7A 2WB1F 3T5LA 3IV6A 3G6VA 4GLXA 1S76D 3UMCA 1PK3A 2F76X 5DGAA 3TI0A 2W43A 5C0YA 1Q8KA 2AHOB 5D4BA 3EPIA 1JQRA 2C22A 3D2SA 3UPQA 1X9MA 3C21A 4LZGA 2V9WA 9ICQA 3WFRE 1A77A 1PX5A 5KFWA 5EWEA 5AI9A 2Y0SC 4Z6CA 1ZQJA 4FHXA 4F2SA 1SGGA 1ZQUA 2ZIUB 3L4PA 3RAQA 4NL9C 4GC7A 1O03A 2W7PA 2E3TA 4BUGA 3PR5B 3Q8MA 4UAWA 5J2JA 3HIYA 3QUQA 1U48A 8ICSA 3GV8B 4R8UB 3LDAA 4CF4A 3JPOA 4DF8A 4LVSA 4F72A 2VIXA 2JZBB 1B43A 2LMRA 2F1HA 2B21A 1Z1VA 4C4RA 1VJ7A 1MA7A 3PW4A 3WFQE 3ICXA 4JV1A 5J0PA 5KFTA 2Q66A 4CCHA 1XSPA 2QKQA 4K4HA 2KMDA 2W9CA 2CN1A 3AQMA 5AKGA 2WF7A 1RPLA 3OVBA 9ICKA 1D8YA 2HBMA 2ISPA 3BDPA 1KFSA 4KTQA 4DQPA 1XU4A 4K4IA 2JHDA 3NASA 5HRIA 5ALFA 4ELUA 2XGPA 4E0DA 2F3NA 4EX7A 5D63A 1QTMA 1BPDA 5B5EU 5AKHA 2KHQA 4X4PA 3RB0A 1NK7A 2EZZA 4DWIA 1R8AA 2WHEA 5ALGA 2KIVA 3WFPA 3ISBA 1NI3A 8ICNA 2PI5A 1JI7A 3F53A 1JUDA 2KP7A 4C8MA 1S77D 1F5SA 3ETRA 2DGZA 1MIYA 4BWMA 3UXNA 5DBCA 1QQ5A 9ICHA 3HX0A 5AICA 3PSIA 2XGQA 4HYKA 5DLGA 3EUB2 2XY6A 2CPRA 2OEHA 2W11A 1WWUA 4JK1A 4K4GA 1X40A 3T5HA 2KKVA 3B9JA 2BHNA 5DQIA 4RNOA 2GLEA 4YR0A 2DR8A 2FLPA 4US8A 2VKQA 4F5PA 5IIJA 1ZJNA 1TFYA 2P6UA 3U26A 5KT2A 2R8IA 3H39A 7ICUA 5AI0A 2BCUA 2A1AA 3GFKB 4UB6U 2W3SA 2F1IA 2YX8A 3WFSC 1X66A 3F5EA 4JLXA 5KTQA 4WC5A 3SAGA 5ALZA 5KFQA 2H3IA 1OW5A 3GDXA 4EX6A 2W9BA 1QSLA 1R8BA 1NZPA 3NUQA 2W9MA 3JPRA 4F8RA 4O6AA 4KLQA 3JPPA 5AKJA 2W9CB 4K9BA 1ZQCA 4B9TA 1KBUA 1QQ6A 4J03A 4O68A 3DV9A 3ZDAA 2YMPA 2I1QA 3LK9A 4O3QA 4TUPA 9ICXA 2JEGA 2ALZA 2HBJA 1GPJA 4RPZA 2J6UA 2OWOA 1SL1A 1IIPA 4MHVA 3MGVA 3V6HA 1S0VA 5IIOA 9ICNA 1JXEA 1VDVA 5KFPA 5AI4A 1K1SA 1V85A 4B9UA 2RRDA 2DF4B 4KB6A 4UB3A 2K60A 3PW7A 5CFTA 5JTGA 4OD0A 3NVVA 4UARA 1M6YA 2WF9A 2FLNA 1UCVA 4O69A 2O5AA 4X4SA 1B0XA 1TK0A 1U49A 2ZH7A 2P6RA 4O9MA 4NM1A 3GQCA 4I2HA 2LYAA 2NYVA 2FPKA 8ICIA 5AKKA 1KQQA 2KE7A 3TADA 3BQ7A 4FBTA 2KJ9A 2BQ3A 2G08A 2C2DA 2R8KA 3I1YA 4GIBA 3HKZC 5FP0A 3ZD9A 5GTHU 2VA8A 4P4PA 3RRGA 5DB9A 5KFCA 3H0MB 1UPHA 3BS7A 3BQ2A 5J0XA 1XNSA 3WKEA 5KT4A 3AN1A 4YCXA 3V72A 2ASDA 2M2WA 1X6IA 1XSNA 5KG6A 5KT5A 2JH7A 4DFDA 7ICOA 4FZMA 5J2FA 3GIKA 3K7DA 5KFXA 4IG8A 1ZQIA 1P7DA 7ICGA 3M8SA 1J2NA 1MQ2A 5KFUA 2VA2A 2JXJA 1U47A 4DSFA 2ZG6A 4I0UA 2FE9A 9ICCA 1XC9A 3AMZA 4NL9A 4RQ6A 3LVVA 4LEWA 4BDPA 4EEYA 4M47A 3CW2C 2XCAA 1N60A 2XY7A 1SKSA 2GH1A 2NRZA 4OAGA 4RQ8A 5AK3A 4WCWA 1RXVA 4JUZA 1ZQQA 2BCSA 5ALDA 1SV4A 3TFRA 2RHFA 5HR7A 2ZH1A 3MDCA 5HR6A 4YG2A 5KFHA 5DB8A 4YD2A 4RQ1A 2B56A 2JEJA 1N63A 2W8KA 2WAQC 4IC9A 4X0BA 2HW3A 2PFNA 3ZD8A 5HRLA 4HX0A 5ALXA 3T79A 3MFIA 2GOLA 1NK5A 4F2RA 5ALMA 2BDPA 1RG6A 1TV9A 4M9GA 4UASA 2KV2A 7ICTA 3QEAZ 3LVWA 3HJ1A 7ICPA 2PMZF 4O5EA 3QU9A 2D3DA 3HRDD 9ICOA 3H4DA 3OHAA 4Q44A 4GXIA 2W8LA 4WC1A 3HW8A 1ZQWA 4I2IA 3QEBZ 1S97A 1ZQGA 4EGWA 5JRTA 4EYHB 4YD1A 4A8EA 5KNIA 2PFPA 3KTQA 4EZ6A 4CNQA 1IM4A 4RQ0A 4IQVA 4K98A 4RUAA 4IS7A 4PH5A 3R9KA 2JH1A 4C8KA 2HI0A 2HHVA 5CP2A 2D8CA 3BQ1A 3C66A 1ZD4A 2RDJA 3SMVA 1S9FA 5KL8B 5AM4A 3WK9A 4OAIZ 1X42A 2JEFA 2QB0A 5ALVA 3QNMA 4GC6A 4X4RA 2ZTCA 3JYYA 3ZDDA 4FH5A 9ICTA 1T3NA 2FMPA 2BCQA 4F3OA 3ISDA 2E8MA 2ES6A 1TFWA 5KG5A 3GIIA 4O3RA 4FE3A 7ICJA 4PHPA 1ED1A 1N61A 9ICBA 1UT8A 1D8LA 1BNOA 3WK4A 4OJ6A 4KX5A 4DFKA 4X5VA 5HMMA 5ALPA 5ALKA 1Z00B 4DL3A 3SD7A 3V6KA 2W03A 4MF8A 2KSOB 3OUYA 1KRPA 2IOHA 4MEXA 2BPFA 1ZQLA 4NLZA 4NXTA 2FPLA 5KG0A 1COOA 4ECTA 3ZI4A 2DFLA 1ZQFA 2KZ3A 3ORYA 1ZQSA 2HVIA 3V7LA 4EBDA 1ZQKA 1D9DA 2XC9A 1RQLA 5HRGA 2BCRA 5D46A 4YXMA 5IINA 5DGBA 4ATBB 4UBCA 4M9HA 5J0OA 4ECYA 2E5SA 2E8PA 4X4TA 3A0BU 1SIJA 2PI4A 2HSZA 3ETLA 4B9LA 4ECXA 2AQ0A 4QZEA 4TUSA 2BCVA 3H0RB 3KZIU 1RDFA 5EE3A 3CYMA 1RM6C 3ZDCA 1UETA 1X9WA 4M9NA 5F3XB 2BPGA 2E8NA 5ALUA 1NOMA 4TQRA 2KOBA 3AU2A 3PSTA 3PO4A 4JMUA 5HMLA 4UB8U 4NJ8A 5AM1A 4B6JA 3BJYA 1ZQOA 4QZDA 4K97A 3H8JA 3NTUA 2PMZC 2BGWA 9ICEA 4C4SA 2C28A 1R8CA 2ZH9A 3Q8RB 1C7YA 3H4BA 2C2EA 2WF8A 2HHXA 2JMGA 4NXUA 4QIWF 3C2LA 1VFGA 4DQRA 1BPXA 1PK1B 1HEKA 4NXZA 1BGXT 3JZ0A 3HP6A 4RT3A 1R89A 1SZPA 2ZHAA 4KLEA 2W55A 3N28A 2H3FA 5F2VO 4KX3A 4YQWA 1VJ5A 4IR1A 1A76A 2LPEA 5F9LA 3NRZA 2GO7A 3PW5A 2ASLA 2A1JB 1NJYA 3SEIA 3V7JA 2FMSA 2XI9A 4EENA 3UMBA 3MR3A 5CFSA 1V4AA 4DLEA 4EEKA 4M9LA 2EAOA 1NJXA 1SL0A 4O3NA 1XSLA 4AT8A 2ASJA 1NZBA 4ED8A 1BPYA 5G5GA 3WKAA 2E1EA 3QU4A 4QWBA 5KFYA 4DSLA 3C1ZA 4CF3A 1NJWA 1SXDA 8ICKA 3OGUA 2ZTEA 4C7YA 2LYBA 1NK6A 4RWPA 3MGIA 5IIMA 2XIDA 4BXOB 4NXVA 3SAHA 4NY8A 4F4XA 3D6JA 4RQ2A 4KLOA 3QXGA 3NVZA 1FEZA 3JPSA 3IG8A 1RXWA 3C1YA 3V7KA 3WKBA 1A6SA 3RJFA 4AT9A 4YMNA 2XY5A 3PX4A 3PV8A 4B9NA 4Q8FA 2F44A 2O6KA 4TUQA 1QH9A 2K89A 5CB1A 1ZQPA 4AT7A 4NLBA 2V4RA 1B22A 1T94A 5KFBA 4OJ5A 2HHTA 4LEYA 4YXJA 1Z19A 2ZH3A 2DPJA 2H3QA 1LKYB 2PFQA 2EZYA 4LEZA 3Q8SB 1L3SA 2ZXHA 4PHDA 2VA3A 5KT7A 3NRWA 5DDYA 2PKEA 5HHIA 4C80A 2AH5A 4C8NA 4I2BA 4PGYA 2DUYA 5AK4A 4JV0A 9ICSA 1SWWA 3MBYA 1DXSA 4DS5A 4P0PB 4MKPA 3ALRA 2IHMA 5HRBA 1FFUA 4P4OA 4FHVA 4OAFA 2FCLA 3BQTA 4K8VA 2UVVA 4WH5A 1QSSA 4JWMA 3Q8PB 4IRKA 2MUTA 1ZD2P 3PO5A 4P0QA 5EE0A 3TFSA 4J9RA 4OO1J 4Y2YA 3UXPA 5KG4A 2H5XA 2G5HB 3KFUF 4AT8B 4MF2A 2DPIA 2BDUA 1OUQA 2VJ4A 3MR6A 4EBCA 4FO6A 5EE9A 3WFOA 3D2QA 3EYZA 1U45A 2ZIVB 4Y2UA 1Z1BA 4EP7A 3K75D 1DK3A 1TVAA 2BBJA 5EOZA 2HHPA 4WC3A 8ICFA 2M0NA 4P2HA 4UAYA 4QWAA 3E58A 2NRXA 3SR6A 4FZLA 3H3AA 2EDUA 4DS4A 9ICFA 5DDMA 2FJ6A 4F50A 5ALEA 2AXTU 5KFZA 1KEJA 4UQGA 2KJ5A 2PFOA 9ICJA 4UBBA 4AT9B 3NS1A 5KL1B 2KNJA 3BQ0A 1GO3F 5L1LA 4DOBA 2HBKA 4EYIB 5HREA 2EQYA 4S3NA 2G07A 2ZXIA 9ICGA 3N4MB 3AL0B 4Q8EA 2YMQA 4TQSA 3RJHA 4PJ0U 2YTUA 3PSFA 3GV7B 2DRAA 2WB1C 4F4YA 3QZ8A 1ZQ1C 3GZFA 5J0RA 5DG8A 3H38A 3EF2A 1UHUA 4KITB 4XQ8A 4I27A 5HP4A 3PHZA 1PVRA 2HHUA 2IBKA 1XS9D 3OWGA 8ICOA 4ZOHC 3F2CA 1TK8A 4EELA 1KKXA 5ALOA 2G09A 3NVOA 1UA1A 1OU5A 2F1JA 5AKIA 1N48A 3Q8LA 1X6JA 4RQ4A 3H0LB 1XO1A 2JV3A 7ICMA 5AI6A 1KDHA 3MCRA 3PR4A 4DEZA 4J9KA 5CRXA 4OJPA 3I76A 2V4QA 1URJA 3HILA 5KFNA 4UB1A 5KG2A 2KHVA 1X9XA 2ZH8A 2K4EA 4DL7A 1ZQRA 1L5UA 5J2DA 2R18A 3KKAC 3PSPA 5EE1A 9ICRA 4RQNA 4OJOA 2G0AA 1U9LA 2MRLA 1Z4OA 1SXEA 4J9LA 3WKCA 2KEYA 3OVAA 4J9OA 4JWNA 5IILA 4ZH4A 1WG8A 1D8BA 4NV0A 1QQ7A 3MC1A 4I2CA 1RYSA 1KSPA 1BPBA 4BGDA 1HUZA 4IQWA 3AQEA 3NVWA 2DR9A 4QZCA 1JRPA 4JLZA 1NNLA 1NKBA 1CUKA 7ICSA 4E8FA 3KD3A 3HWTA 3AM9A 2HCFA 4YN4A 3FAHA 2KVCA 5ALYA 1C20A 5L1MA 5ALRA 1CRXA 3SAFA 2DR7A 2ODGA 3QU7A 4F4KA 4ECSA 4Y2SA 3E0FA 4ED1A 5KFGA 5TZVA 3SV3A 2EAPA 4WQLA 4M5DA 4Y2VA 3UQ2A 4EEBA 1BPZA 2R8HA 4PL1A 3ED5A 2H3ZA 5DKWA 4J9QA
chains in the Genus database with same CATH topology
4KMUA 4DSIA 2ZH4A 4ECVA 4Z6DA 5KT6A 8ICXA 2PBEA 2KZMA 4F4WA 4AT7B 4DFKA 1X2IA 3PNCA 1NJZA 4X5VA 1ZQVA 5HMMA 3JPNA 5BPCA 3M9NB 1SKWA 2W9BB 1N56A 4WBZA 3MABA 3RJKA 3T5JA 9ICUA 5HRDA 4QZIA 5KFLA 1WCLA 1Z00B 4DFMA 3TQ1A 4DL3A 2MAXA 4F5NA 4KLTA 3V6KA 2KTQA 3NGDA 1UEUA 3RR8A 2M2VA 3THVA 1ZQDA 5J2GA 3IM1A 5CHGA 3H8WA 4WC6A 2NRKA 4MF8A 5DG7A 3OUYA 3OSPA 3T5LA 3LWLA 4MEXA 2BPFA 1ZQLA 1KRPA 3G6VA 4NLZA 4ELTA 4GLXA 3KHRA 1S76D 2FPLA 5KG0A 1COOA 4ECTA 4O5KA 5DGAA 4TURA 3TI0A 3RH5A 2DFLA 1ZQFA 2KZ3A 3ORYA 1ZQSA 2HVIA 4G3IA 8ICAA 5DEDA 3V7LA 4EBDA 5D4BA 1KFDA 4RNNA 3RH4A 3EPIA 1ZQKA 2J6TA 5KFRA 3PMLA 1D9DA 1JQRA 2XC9A 4DF4A 2C22A 2BCRA 3UPQA 1X9MA 9ICAA 5HRGA 2FLLA 5D46A 3C21A 3RRHA 4LZGA 2V9WA 9ICQA 3WFRE 4RWNA 4YXMA 1A77A 5IINA 5KFWA 5EWEA 1HUOA 4I2AA 5DGBA 4F5OA 1PX5A 4ATBB 3ZDBA 4UBCA 4XQ7A 4Z6CA 1ZQZA 4ELVA 3QE9Y 5J0OA 4ECYA 1QSYA 3B0YA 4QZAA 1TFRA 4RQ7A 3ISCA 1ZQJA 3RR7A 4F2SA 4FHXA 4X4TA 1IXRA 1ZQUA 2BQUA 2PI4A 1TAUA 3RAQA 1T4GA 4DL4A 4GC7A 4M6WA 2KFNA 2MUTB 4B9SA 2KFZA 3ETLA 3PR5B 3Q8MA 1WOTA 4UAWA 3PMNA 4B9LA 1U4BA 4JV2A 7ICFA 5J2JA 4F5RA 4DOAA 8ICGA 3G6YA 4ECXA 2AQ0A 1U48A 4QZEA 3TANA 8ICSA 3GV8B 1YLQA 4R8UB 3LDAA 3OV7A 4TUSA 7ICKA 3TAQA 3JPOA 2BCVA 4DF8A 4LVSA 4RWOA 2JZBB 1B43A 3PVXA 4YR2A 4DL5A 2F1HA 3ZDCA 1X9WA 4M9NA 2B21A 5KFMA 4KN7A 1SKRA 2BPGA 8ICWA 2ZJ5A 3C2MA 1NOMA 4DL6A 5J0QA 4O3PA 4NM2A 4TQRA 1VJ7A 4DQIA 3PW4A 9ICPA 3RJEA 3UPSA 4ECZA 3AU2A 2WTFA 1DK2A 3WFQE 1TKDA 3PO4A 5HMLA 5C5JA 3EZ5A 4JV1A 2HHSA 5J0PA 5KFTA 2Q66A 4YVZA 3BJYA 1ZQOA 4QZDA 1XSPA 3H8JA 4CCHA 3NTUA 9ICVA 4K4HA 4DSEA 4O3OA 1F5AA 1X9SA 2W9CA 2BGWA 9ICEA 1KFTA 4Z6EA 5KFIA 4YR3A 3M9OB 4ECQA 4MFCA 5D49A 7ICVA 1R8CA 2C28A 4O3SA 2ZH9A 3AQMA 4M9JA 3Q8RB 3KHGA 1RPLA 3OVBA 4DQSA 1C7YA 9ICKA 3H4BA 1ZQMA 1D8YA 4NLGA 4UD5A 4J9SA 2C2EA 4M0AA 2HHXA 4X4OA 5HC9A 4PGXA 3C2LA 1KNYA 2ISPA 1VFGA 5KFFA 3H8SA 3BDPA 4DQRA 1BPXA 1KFSA 4DQPA 4KTQA 7ICQA 1XU4A 4NXZA 1BGXT 3JZ0A 3HP6A 4RT3A 1R89A 1SZPA 4K4IA 5KFOA 2ZTDA 2AGOA 4KLEA 4KLSA 4F92B 5HRIA 3NYBA 2ZHAA 3L9DA 3GIJA 5F2VO 2XCPA 8ICUA 4ELUA 2XGPA 4YQWA 4QZGA 4J9MA 4E0DA 4IR1A 4XUSA 2VANA 1QTMA 1BPDA 1A76A 5F9LA 3OJUA 5KG7A 4WC2A 3RAXA 4X4PA 3PW5A 3MR2A 3RB0A 3JPQA 2A1JB 2ASLA 1NK7A 2FMQA 8ICLA 1NJYA 3IHQB 4DWIA 3V7JA 1R8AA 5HRKA 2FMSA 4DLGA 3Q8QB 4FHWA 5DLFA 1NO5A 3MR3A 3WFPA 3H40A 3ISBA 8ICNA 2AGPA 7ICHA 4PGQA 2PI5A 1V4AA 1RZTA 2KP7A 4C8MA 4DLEA 2I9GA 2P66A 4M9LA 1S77D 2BR0A 4I2JA 1NJXA 1SL0A 2AGQA 3T3FA 2M2TA 5J2KA 4O3NA 5CA7A 4KLJA 1XSLA 3H7IA 1MIYA 4BWMA 4R63A 1RYRA 1K1QA 4AT8A 3UXNA 5DBCA 2M2UA 9ICHA 1ZQAA 9ICLA 3HX0A 2ASJA 2JEIA 8ICHA 5DECA 2IHNA 4ED8A 1BPYA 2XGQA 4HYKA 3PW2A 4DFJA 5DLGA 4J9NA 1BVSA 2XY6A 3T5KA 4RUCA 4K4GA 4JK1A 2IMWP 4QWBA 5CWRA 2IA6A 7ICIA 8ICQA 4X4QA 2ZH6A 5KFYA 3KHLA 3T5HA 4DSLA 3C1ZA 4DO9A 2BKEA 2BHNA 5DQIA 1NJWA 4Q43A 4RNOA 3C5GA 8ICKA 4YR0A 4M9HA 4GXJA 5JUMA 3OGUA 1TAQA 2ZTEA 1NK6A 4RWPA 1UETA 3MGIA 4ED2A 2DR8A 2FLPA 5IIMA 4BXOB 3PX0A 3OHBA 1L3UA 4ECWA 4NY8A 4F4XA 4F5PA 5IIJA 3M8RA 4FS2A 2HHWA 1ZJNA 4FH3A 1TFYA 2P6UA 3RJJA 5KT2A 4RQ2A 3KHHA 4KLOA 4PHEA 2KN7A 2R8IA 4WC4A 3JPSA 3H39A 1RXWA 7ICUA 4RNMA 3C1YA 1PZNA 4UD4A 2BCUA 4X4UA 3V7KA 4IRDA 3RJFA 1Q79A 3GFKB 1S10A 8ICPA 2FPMA 4YMNA 4ED3A 3E2EA 4AT9A 2F1IA 5F9NA 4RPXA 4NKTA 4RZRA 2XY5A 3PX4A 4ECUA 3WFSC 3PV8A 1D9FA 4QZFA 4B9NA 1NKCA 1L3TA 4IRCA 4KLGA 2AU0A 4Q8FA 4X4NA 2ID1A 4TUQA 5KTQA 4YMMA 1S0NA 3FYHA 5CB1A 1UT5A 1ZQPA 1MIVA 4WC5A 5KG1A 4EZ9A 4AT7A 5KFQA 3GDXA 2V4RA 2W9BA 3RBDA 5IIKA 1B22A 3AQNA 1LV5A 1QSLA 4WBYA 5KFBA 4DOCA 4O0IA 2GWSA 1Z00A 4RU9A 1R8BA 1NZPA 3JPRA 2W9MA 4F8RA 2HHTA 4KLMA 3C2KA 3JPPA 4KLQA 3H37A 4YXJA 3AU6A 4MFFA 2W9CB 8ICYA 2ZH3A 2HVHA 1JXLA 2DPJA 3UXOA 2PFQA 4MEYA 5KFJA 1ZQCA 4B9TA 3Q8SB 3AQKA 1L3SA 1BPEA 4QZ9A 3OVSA 1ZQXA 4RPYA 4PHDA 2VA3A 5KT7A 3ZDAA 2ZJ8A 5DDYA 1H38A 2I1QA 7ICRA 3LK9A 5HHIA 7ICLA 4C8NA 4I2BA 5EWGA 4PGYA 4O3QA 4TUPA 4JV0A 2NRVA 3GV5B 8ICVA 2JEGA 4I28A 9ICSA 2ALZA 3MBYA 9ICXA 3C18A 4DS5A 5HRFA 2Q0ZX 2IHMA 4RPZA 2J6UA 2OWOA 7ICNA 4J9PA 3V6HA 1SL1A 4P4OA 2UVWA 5HRBA 4FHVA 5HHHA 3MGHA 1S0VA 5IIOA 4KLDA 4ATBA 9ICNA 1JXEA 5BOMA 5KFPA 3RB6A 3BQTA 3AQLA 2UVVA 1K1SA 1QSSA 4JWMA 3G6XA 5DG9A 4UB5A 3Q8PB 4B9UA 4E7XA 3M9MB 3RB3A 2MUTA 4IRKA 4UB3A 3PW7A 3PO5A 4WC0A 4C8LA 3TFSA 2FLNA 1HJPA 3SZ2A 8ICRA 2O5AA 4M2YA 4BWJA 4R64A 4J9RA 5HR9A 1TK0A 4X4SA 4NLKA 1UA0A 4R8UA 3RTVA 1U49A 3UXPA 2P6RA 2ZH7A 4QWEA 3PY8A 4O9MA 4NM1A 3GQCA 5KG4A 2H5XA 2JZBA 2BE3A 4B9MA 4I2HA 3UQ0A 4NLNA 4AT8B 2FPKA 4MF2A 1TK5A 3C23A 5DBAA 1JX4A 2DPIA 8ICIA 1SL2A 5J2HA 4KLUA 2ZUDA 3MR6A 2M2WA 3MDAA 4EBCA 4FO6A 3WFOA 3PX6A 1MSWD 2UVUA 4KLIA 3RJIA 4FBTA 4UB2A 3EYZA 1U45A 2BQ3A 2C2DA 3K75D 4PPXA 4EP7A 4PHAA 4ECRA 1TVAA 2R8KA 1DK3A 1T8EA 4B9VA 5HRHA 5EOZA 8ICJA 2HHPA 3OUYB 4IQUA 4R65A 3LWMA 1Q78A 5L9XA 4F5QA 4WC3A 8ICEA 2VA8A 8ICFA 4P4PA 3RRGA 5KFEA 5KFCA 5DB9A 4Q45A 4P2HA 8ICMA 3MFHA 4UAYA 4QWAA 1JN3A 2NRXA 3SYZA 4QW8A 8ICZA 3BQ2A 3QZ7A 5J0XA 2O1PA 3H3AA 5KT4A 5J0WA 4QZHA 4DS4A 4YCXA 5DDMA 2UVRA 9ICFA 3V72A 2ASDA 3RJGA 4KLFA 8ICCA 2Y1JA 4F50A 5KG6A 5J0UA 5KFZA 1XSNA 5KT5A 1KEJA 5J2CA 2ZHBA 3RBEA 4UQGA 3GIMA 3V6JA 2PFOA 7ICOA 3OSNA 9ICJA 5J2FA 4EBJA 4UBBA 4AT9B 1NK0A 1EXNA 4UAZA 3GIKA 3SV4A 5KFXA 4ED0A 3BQ0A 5L1LA 4DOBA 4DFPA 9ICMA 1WCNA 3K4GA 5CR0A 2W9AA 1ZQIA 4IG8A 4QWDA 1DOQA 7ICGA 3EWAA 3M8SA 3HT3A 1V9PA 4EYIB 5HREA 1MQ2A 5KFUA 4YMOA 2VA2A 4S3NA 2A1JA 4I2GA 1U47A 5J0YA 4GXKA 4DSFA 5DB7A 4M6WB 1CEZA 1JMSA 3N4MB 9ICGA 2DRBA 4Q8EA 9ICCA 1XC9A 5KFAA 5L1KA 4RQ6A 1S0MA 5DBBA 1MQ3A 4TQSA 4RT2A 1ZETA 2NRTA 3RB4A 3RJHA 4E80A 4BDPA 4MFAA 4EEYA 3GV7B 2DRAA 2LYHA 4M47A 4F4YA 3QZ8A 2XCAA 1T7PA 5J0RA 5DG8A 2NRZA 3EPGA 2NRWA 2XY7A 3RH6A 1SKSA 2ZUBA 1UEVA 4RQ8A 3H38A 2ISOA 5J2BA 3HPOA 3OJSA 4WCWA 5EWFA 1ZJMA 1RXVA 1ZQTA 4JUZA 5J2EA 4KITB 4XQ8A 4P4MA 3TFRA 1ZQQA 2BCSA 4I27A 3MDCA 1FA0A 2ZH1A 4I29A 5HP4A 4FHYA 4YG2A 4YP3A 5KFHA 5DB8A 4RQ3A 4YD2A 4RQ1A 2ZUCA 1AROP 2HHUA 2IBKA 1XS9D 4YFKA 1XWLA 4DSKA 4FHPA 4X0AA 3TAPA 2JEJA 2W8KA 4FBUA 1TK8A 8ICOA 3GILA 5DQGA 9ICIA 1JIHA 4X0BA 2HW3A 4NKUA 1UA1A 5IIIA 1OU5A 1ZYQA 2PFNA 4X4VA 2F1JA 4EBEA 4BXOA 3ZD8A 1N48A 5HRLA 4DQQA 2DVIA 3Q8LA 3MFIA 1NK5A 4RQ4A 4F2RA 1XO1A 2BDPA 3N97B 7ICMA 4FS1A 2RDIA 3AUOA 3TARA 1Z3EB 1TV9A 1ZQNA 5KFKA 4M9GA 3ZDEA 5L1IA 1KDHA 4Z6FA 4DL2A 7ICTA 3QEAZ 4XA5A 2AJQA 5DQHA 1BNPA 1MIWA 3HJ1A 4EBKA 7ICPA 2HHQA 9ICWA 4KLHA 1BNOA 3PR4A 5CJ7A 4DEZA 3JPTA 3HJ4A 5KT3A 4J9KA 2J6SA 2ATLA 2XO7A 4XRHA 3SI8A 4O5EA 1Y88A 2DR5A 2V4QA 4F4ZA 9ICOA 5KFNA 2RFFA 4UB1A 5KG2A 4M04A 3H4DA 8ICTA 5J2IA 5BOLA 3C5FA 3OHAA 1ZQHA 2ZH8A 4Q44A 4GXIA 2W8LA 4WC1A 3HW8A 4DL7A 4QW9A 1ZQRA 1L5UA 5J2DA 2BPCA 3MR5A 1QLNA 9ICRA 1ZQWA 4I2IA 5KG3A 2KZZA 1JAJA 4R66A 1U9LA 4QZ8A 1NKEA 3QEBZ 1S97A 1ZQGA 4J9LA 4C8OA 5J0SA 1KLNA 4LZDA 4EYHB 5DB6A 1NK9A 4YD1A 4RWQA 2PFPA 3OVAA 3KTQA 4ED6A 4EZ6A 4WC7A 4J9OA 1IM4A 4RQ0A 4JWNA 5IILA 4ZH4A 2R8JA 4I2EA 4IQVA 1NK4A 2ZH5A 4I2CA 4RUAA 4PH5A 1RYSA 1KSPA 1BPBA 4BGDA 1HUZA 4IQWA 4C8KA 2M9NA 5J0TA 2HHVA 5CP2A 3LQCB 3PW0A 3EW9A 3C66A 3BQ1A 2Y1IA 2DR9A 4QZCA 1NKBA 4QWCA 4UB4A 4O5CA 1CUKA 2RDJA 5J2AA 1S9FA 1LB2B 7ICSA 4E8FA 3HWTA 7ICEA 2R8GA 2ZH2A 2BQRA 1KTQA 2JEFA 4YN4A 4GC6A 4X4RA 2ZTCA 1ZQBA 3JYYA 3ZDDA 4FH5A 3FDSA 9ICTA 4F93B 4RQ5A 5HNKA 1T3NA 2FMPA 4LT6A 5J29A 2BCQA 2DR7A 4F91B 2PXIA 4ED7A 1NK8A 4KN4A 4F4KA 8ICBA 4F3OA 5KFVA 5KFDA 3ISDA 1DGSA 5KFSA 5L1JA 4ECSA 1MC8A 4ED1A 1L3VA 5KFGA 5TZVA 3SV3A 4I2DA 1TFWA 4I2FA 5KG5A 4IR9A 2ZJAA 3GIIA 4O3RA 3HIYA 1ZQYA 4M5DA 3UQ2A 7ICJA 2AQ4A 1BPZA 4PHPA 3B0XA 2R8HA 4DSJA 4KLLA 4QZBA 2C2RA 9ICBA 1UT8A 4J9QA 1D8LA 3Q8KA 4IQTA 5DKWA 1S0OA 3ZD9A 1ZQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMU A;  4DSI A;  2ZH4 A;  4ECV A;  4Z6D A;  5KT6 A;  8ICX A;  2PBE A;  2KZM A;  4F4W A;  4AT7 B;  4DFK A;  1X2I A;  3PNC A;  1NJZ A;  4X5V A;  1ZQV A;  5HMM A;  3JPN A;  5BPC A;  3M9N B;  1SKW A;  2W9B B;  1N56 A;  4WBZ A;  3MAB A;  3RJK A;  3T5J A;  9ICU A;  5HRD A;  4QZI A;  5KFL A;  1WCL A;  1Z00 B;  4DFM A;  3TQ1 A;  4DL3 A;  2MAX A;  4F5N A;  4KLT A;  3V6K A;  2KTQ A;  3NGD A;  1UEU A;  3RR8 A;  2M2V A;  3THV A;  1ZQD A;  5J2G A;  3IM1 A;  5CHG A;  3H8W A;  4WC6 A;  2NRK A;  4MF8 A;  5DG7 A;  3OUY A;  3OSP A;  3T5L A;  3LWL A;  4MEX A;  2BPF A;  1ZQL A;  1KRP A;  3G6V A;  4NLZ A;  4ELT A;  4GLX A;  3KHR A;  1S76 D;  2FPL A;  5KG0 A;  1COO A;  4ECT A;  4O5K A;  5DGA A;  4TUR A;  3TI0 A;  3RH5 A;  2DFL A;  1ZQF A;  2KZ3 A;  3ORY A;  1ZQS A;  2HVI A;  4G3I A;  8ICA A;  5DED A;  3V7L A;  4EBD A;  5D4B A;  1KFD A;  4RNN A;  3RH4 A;  3EPI A;  1ZQK A;  2J6T A;  5KFR A;  3PML A;  1D9D A;  1JQR A;  2XC9 A;  4DF4 A;  2C22 A;  2BCR A;  3UPQ A;  1X9M A;  9ICA A;  5HRG A;  2FLL A;  5D46 A;  3C21 A;  3RRH A;  4LZG A;  2V9W A;  9ICQ A;  3WFR E;  4RWN A;  4YXM A;  1A77 A;  5IIN A;  5KFW A;  5EWE A;  1HUO A;  4I2A A;  5DGB A;  4F5O A;  1PX5 A;  4ATB B;  3ZDB A;  4UBC A;  4XQ7 A;  4Z6C A;  1ZQZ A;  4ELV A;  3QE9 Y;  5J0O A;  4ECY A;  1QSY A;  3B0Y A;  4QZA A;  1TFR A;  4RQ7 A;  3ISC A;  1ZQJ A;  3RR7 A;  4F2S A;  4FHX A;  4X4T A;  1IXR A;  1ZQU A;  2BQU A;  2PI4 A;  1TAU A;  3RAQ A;  1T4G A;  4DL4 A;  4GC7 A;  4M6W A;  2KFN A;  2MUT B;  4B9S A;  2KFZ A;  3ETL A;  3PR5 B;  3Q8M A;  1WOT A;  4UAW A;  3PMN A;  4B9L A;  1U4B A;  4JV2 A;  7ICF A;  5J2J A;  4F5R A;  4DOA A;  8ICG A;  3G6Y A;  4ECX A;  2AQ0 A;  1U48 A;  4QZE A;  3TAN A;  8ICS A;  3GV8 B;  1YLQ A;  4R8U B;  3LDA A;  3OV7 A;  4TUS A;  7ICK A;  3TAQ A;  3JPO A;  2BCV A;  4DF8 A;  4LVS A;  4RWO A;  2JZB B;  1B43 A;  3PVX A;  4YR2 A;  4DL5 A;  2F1H A;  3ZDC A;  1X9W A;  4M9N A;  2B21 A;  5KFM A;  4KN7 A;  1SKR A;  2BPG A;  8ICW A;  2ZJ5 A;  3C2M A;  1NOM A;  4DL6 A;  5J0Q A;  4O3P A;  4NM2 A;  4TQR A;  1VJ7 A;  4DQI A;  3PW4 A;  9ICP A;  3RJE A;  3UPS A;  4ECZ A;  3AU2 A;  2WTF A;  1DK2 A;  3WFQ E;  1TKD A;  3PO4 A;  5HML A;  5C5J A;  3EZ5 A;  4JV1 A;  2HHS A;  5J0P A;  5KFT A;  2Q66 A;  4YVZ A;  3BJY A;  1ZQO A;  4QZD A;  1XSP A;  3H8J A;  4CCH A;  3NTU A;  9ICV A;  4K4H A;  4DSE A;  4O3O A;  1F5A A;  1X9S A;  2W9C A;  2BGW A;  9ICE A;  1KFT A;  4Z6E A;  5KFI A;  4YR3 A;  3M9O B;  4ECQ A;  4MFC A;  5D49 A;  7ICV A;  1R8C A;  2C28 A;  4O3S A;  2ZH9 A;  3AQM A;  4M9J A;  3Q8R B;  3KHG A;  1RPL A;  3OVB A;  4DQS A;  1C7Y A;  9ICK A;  3H4B A;  1ZQM A;  1D8Y A;  4NLG A;  4UD5 A;  4J9S A;  2C2E A;  4M0A A;  2HHX A;  4X4O A;  5HC9 A;  4PGX A;  3C2L A;  1KNY A;  2ISP A;  1VFG A;  5KFF A;  3H8S A;  3BDP A;  4DQR A;  1BPX A;  1KFS A;  4DQP A;  4KTQ A;  7ICQ A;  1XU4 A;  4NXZ A;  1BGX T;  3JZ0 A;  3HP6 A;  4RT3 A;  1R89 A;  1SZP A;  4K4I A;  5KFO A;  2ZTD A;  2AGO A;  4KLE A;  4KLS A;  4F92 B;  5HRI A;  3NYB A;  2ZHA A;  3L9D A;  3GIJ A;  5F2V O;  2XCP A;  8ICU A;  4ELU A;  2XGP A;  4YQW A;  4QZG A;  4J9M A;  4E0D A;  4IR1 A;  4XUS A;  2VAN A;  1QTM A;  1BPD A;  1A76 A;  5F9L A;  3OJU A;  5KG7 A;  4WC2 A;  3RAX A;  4X4P A;  3PW5 A;  3MR2 A;  3RB0 A;  3JPQ A;  2A1J B;  2ASL A;  1NK7 A;  2FMQ A;  8ICL A;  1NJY A;  3IHQ B;  4DWI A;  3V7J A;  1R8A A;  5HRK A;  2FMS A;  4DLG A;  3Q8Q B;  4FHW A;  5DLF A;  1NO5 A;  3MR3 A;  3WFP A;  3H40 A;  3ISB A;  8ICN A;  2AGP A;  7ICH A;  4PGQ A;  2PI5 A;  1V4A A;  1RZT A;  2KP7 A;  4C8M A;  4DLE A;  2I9G A;  2P66 A;  4M9L A;  1S77 D;  2BR0 A;  4I2J A;  1NJX A;  1SL0 A;  2AGQ A;  3T3F A;  2M2T A;  5J2K A;  4O3N A;  5CA7 A;  4KLJ A;  1XSL A;  3H7I A;  1MIY A;  4BWM A;  4R63 A;  1RYR A;  1K1Q A;  4AT8 A;  3UXN A;  5DBC A;  2M2U A;  9ICH A;  1ZQA A;  9ICL A;  3HX0 A;  2ASJ A;  2JEI A;  8ICH A;  5DEC A;  2IHN A;  4ED8 A;  1BPY A;  2XGQ A;  4HYK A;  3PW2 A;  4DFJ A;  5DLG A;  4J9N A;  1BVS A;  2XY6 A;  3T5K A;  4RUC A;  4K4G A;  4JK1 A;  2IMW P;  4QWB A;  5CWR A;  2IA6 A;  7ICI A;  8ICQ A;  4X4Q A;  2ZH6 A;  5KFY A;  3KHL A;  3T5H A;  4DSL A;  3C1Z A;  4DO9 A;  2BKE A;  2BHN A;  5DQI A;  1NJW A;  4Q43 A;  4RNO A;  3C5G A;  8ICK A;  4YR0 A;  4M9H A;  4GXJ A;  5JUM A;  3OGU A;  1TAQ A;  2ZTE A;  1NK6 A;  4RWP A;  1UET A;  3MGI A;  4ED2 A;  2DR8 A;  2FLP A;  5IIM A;  4BXO B;  3PX0 A;  3OHB A;  1L3U A;  4ECW A;  4NY8 A;  4F4X A;  4F5P A;  5IIJ A;  3M8R A;  4FS2 A;  2HHW A;  1ZJN A;  4FH3 A;  1TFY A;  2P6U A;  3RJJ A;  5KT2 A;  4RQ2 A;  3KHH A;  4KLO A;  4PHE A;  2KN7 A;  2R8I A;  4WC4 A;  3JPS A;  3H39 A;  1RXW A;  7ICU A;  4RNM A;  3C1Y A;  1PZN A;  4UD4 A;  2BCU A;  4X4U A;  3V7K A;  4IRD A;  3RJF A;  1Q79 A;  3GFK B;  1S10 A;  8ICP A;  2FPM A;  4YMN A;  4ED3 A;  3E2E A;  4AT9 A;  2F1I A;  5F9N A;  4RPX A;  4NKT A;  4RZR A;  2XY5 A;  3PX4 A;  4ECU A;  3WFS C;  3PV8 A;  1D9F A;  4QZF A;  4B9N A;  1NKC A;  1L3T A;  4IRC A;  4KLG A;  2AU0 A;  4Q8F A;  4X4N A;  2ID1 A;  4TUQ A;  5KTQ A;  4YMM A;  1S0N A;  3FYH A;  5CB1 A;  1UT5 A;  1ZQP A;  1MIV A;  4WC5 A;  5KG1 A;  4EZ9 A;  4AT7 A;  5KFQ A;  3GDX A;  2V4R A;  2W9B A;  3RBD A;  5IIK A;  1B22 A;  3AQN A;  1LV5 A;  1QSL A;  4WBY A;  5KFB A;  4DOC A;  4O0I A;  2GWS A;  1Z00 A;  4RU9 A;  1R8B A;  1NZP A;  3JPR A;  2W9M A;  4F8R A;  2HHT A;  4KLM A;  3C2K A;  3JPP A;  4KLQ A;  3H37 A;  4YXJ A;  3AU6 A;  4MFF A;  2W9C B;  8ICY A;  2ZH3 A;  2HVH A;  1JXL A;  2DPJ A;  3UXO A;  2PFQ A;  4MEY A;  5KFJ A;  1ZQC A;  4B9T A;  3Q8S B;  3AQK A;  1L3S A;  1BPE A;  4QZ9 A;  3OVS A;  1ZQX A;  4RPY A;  4PHD A;  2VA3 A;  5KT7 A;  3ZDA A;  2ZJ8 A;  5DDY A;  1H38 A;  2I1Q A;  7ICR A;  3LK9 A;  5HHI A;  7ICL A;  4C8N A;  4I2B A;  5EWG A;  4PGY A;  4O3Q A;  4TUP A;  4JV0 A;  2NRV A;  3GV5 B;  8ICV A;  2JEG A;  4I28 A;  9ICS A;  2ALZ A;  3MBY A;  9ICX A;  3C18 A;  4DS5 A;  5HRF A;  2Q0Z X;  2IHM A;  4RPZ A;  2J6U A;  2OWO A;  7ICN A;  4J9P A;  3V6H A;  1SL1 A;  4P4O A;  2UVW A;  5HRB A;  4FHV A;  5HHH A;  3MGH A;  1S0V A;  5IIO A;  4KLD A;  4ATB A;  9ICN A;  1JXE A;  5BOM A;  5KFP A;  3RB6 A;  3BQT A;  3AQL A;  2UVV A;  1K1S A;  1QSS A;  4JWM A;  3G6X A;  5DG9 A;  4UB5 A;  3Q8P B;  4B9U A;  4E7X A;  3M9M B;  3RB3 A;  2MUT A;  4IRK A;  4UB3 A;  3PW7 A;  3PO5 A;  4WC0 A;  4C8L A;  3TFS A;  2FLN A;  1HJP A;  3SZ2 A;  8ICR A;  2O5A A;  4M2Y A;  4BWJ A;  4R64 A;  4J9R A;  5HR9 A;  1TK0 A;  4X4S A;  4NLK A;  1UA0 A;  4R8U A;  3RTV A;  1U49 A;  3UXP A;  2P6R A;  2ZH7 A;  4QWE A;  3PY8 A;  4O9M A;  4NM1 A;  3GQC A;  5KG4 A;  2H5X A;  2JZB A;  2BE3 A;  4B9M A;  4I2H A;  3UQ0 A;  4NLN A;  4AT8 B;  2FPK A;  4MF2 A;  1TK5 A;  3C23 A;  5DBA A;  1JX4 A;  2DPI A;  8ICI A;  1SL2 A;  5J2H A;  4KLU A;  2ZUD A;  3MR6 A;  2M2W A;  3MDA A;  4EBC A;  4FO6 A;  3WFO A;  3PX6 A;  1MSW D;  2UVU A;  4KLI A;  3RJI A;  4FBT A;  4UB2 A;  3EYZ A;  1U45 A;  2BQ3 A;  2C2D A;  3K75 D;  4PPX A;  4EP7 A;  4PHA A;  4ECR A;  1TVA A;  2R8K A;  1DK3 A;  1T8E A;  4B9V A;  5HRH A;  5EOZ A;  8ICJ A;  2HHP A;  3OUY B;  4IQU A;  4R65 A;  3LWM A;  1Q78 A;  5L9X A;  4F5Q A;  4WC3 A;  8ICE A;  2VA8 A;  8ICF A;  4P4P A;  3RRG A;  5KFE A;  5KFC A;  5DB9 A;  4Q45 A;  4P2H A;  8ICM A;  3MFH A;  4UAY A;  4QWA A;  1JN3 A;  2NRX A;  3SYZ A;  4QW8 A;  8ICZ A;  3BQ2 A;  3QZ7 A;  5J0X A;  2O1P A;  3H3A A;  5KT4 A;  5J0W A;  4QZH A;  4DS4 A;  4YCX A;  5DDM A;  2UVR A;  9ICF A;  3V72 A;  2ASD A;  3RJG A;  4KLF A;  8ICC A;  2Y1J A;  4F50 A;  5KG6 A;  5J0U A;  5KFZ A;  1XSN A;  5KT5 A;  1KEJ A;  5J2C A;  2ZHB A;  3RBE A;  4UQG A;  3GIM A;  3V6J A;  2PFO A;  7ICO A;  3OSN A;  9ICJ A;  5J2F A;  4EBJ A;  4UBB A;  4AT9 B;  1NK0 A;  1EXN A;  4UAZ A;  3GIK A;  3SV4 A;  5KFX A;  4ED0 A;  3BQ0 A;  5L1L A;  4DOB A;  4DFP A;  9ICM A;  1WCN A;  3K4G A;  5CR0 A;  2W9A A;  1ZQI A;  4IG8 A;  4QWD A;  1DOQ A;  7ICG A;  3EWA A;  3M8S A;  3HT3 A;  1V9P A;  4EYI B;  5HRE A;  1MQ2 A;  5KFU A;  4YMO A;  2VA2 A;  4S3N A;  2A1J A;  4I2G A;  1U47 A;  5J0Y A;  4GXK A;  4DSF A;  5DB7 A;  4M6W B;  1CEZ A;  1JMS A;  3N4M B;  9ICG A;  2DRB A;  4Q8E A;  9ICC A;  1XC9 A;  5KFA A;  5L1K A;  4RQ6 A;  1S0M A;  5DBB A;  1MQ3 A;  4TQS A;  4RT2 A;  1ZET A;  2NRT A;  3RB4 A;  3RJH A;  4E80 A;  4BDP A;  4MFA A;  4EEY A;  3GV7 B;  2DRA A;  2LYH A;  4M47 A;  4F4Y A;  3QZ8 A;  2XCA A;  1T7P A;  5J0R A;  5DG8 A;  2NRZ A;  3EPG A;  2NRW A;  2XY7 A;  3RH6 A;  1SKS A;  2ZUB A;  1UEV A;  4RQ8 A;  3H38 A;  2ISO A;  5J2B A;  3HPO A;  3OJS A;  4WCW A;  5EWF A;  1ZJM A;  1RXV A;  1ZQT A;  4JUZ A;  5J2E A;  4KIT B;  4XQ8 A;  4P4M A;  3TFR A;  1ZQQ A;  2BCS A;  4I27 A;  3MDC A;  1FA0 A;  2ZH1 A;  4I29 A;  5HP4 A;  4FHY A;  4YG2 A;  4YP3 A;  5KFH A;  5DB8 A;  4RQ3 A;  4YD2 A;  4RQ1 A;  2ZUC A;  1ARO P;  2HHU A;  2IBK A;  1XS9 D;  4YFK A;  1XWL A;  4DSK A;  4FHP A;  4X0A A;  3TAP A;  2JEJ A;  2W8K A;  4FBU A;  1TK8 A;  8ICO A;  3GIL A;  5DQG A;  9ICI A;  1JIH A;  4X0B A;  2HW3 A;  4NKU A;  1UA1 A;  5III A;  1OU5 A;  1ZYQ A;  2PFN A;  4X4V A;  2F1J A;  4EBE A;  4BXO A;  3ZD8 A;  1N48 A;  5HRL A;  4DQQ A;  2DVI A;  3Q8L A;  3MFI A;  1NK5 A;  4RQ4 A;  4F2R A;  1XO1 A;  2BDP A;  3N97 B;  7ICM A;  4FS1 A;  2RDI A;  3AUO A;  3TAR A;  1Z3E B;  1TV9 A;  1ZQN A;  5KFK A;  4M9G A;  3ZDE A;  5L1I A;  1KDH A;  4Z6F A;  4DL2 A;  7ICT A;  3QEA Z;  4XA5 A;  2AJQ A;  5DQH A;  1BNP A;  1MIW A;  3HJ1 A;  4EBK A;  7ICP A;  2HHQ A;  9ICW A;  4KLH A;  1BNO A;  3PR4 A;  5CJ7 A;  4DEZ A;  3JPT A;  3HJ4 A;  5KT3 A;  4J9K A;  2J6S A;  2ATL A;  2XO7 A;  4XRH A;  3SI8 A;  4O5E A;  1Y88 A;  2DR5 A;  2V4Q A;  4F4Z A;  9ICO A;  5KFN A;  2RFF A;  4UB1 A;  5KG2 A;  4M04 A;  3H4D A;  8ICT A;  5J2I A;  5BOL A;  3C5F A;  3OHA A;  1ZQH A;  2ZH8 A;  4Q44 A;  4GXI A;  2W8L A;  4WC1 A;  3HW8 A;  4DL7 A;  4QW9 A;  1ZQR A;  1L5U A;  5J2D A;  2BPC A;  3MR5 A;  1QLN A;  9ICR A;  1ZQW A;  4I2I A;  5KG3 A;  2KZZ A;  1JAJ A;  4R66 A;  1U9L A;  4QZ8 A;  1NKE A;  3QEB Z;  1S97 A;  1ZQG A;  4J9L A;  4C8O A;  5J0S A;  1KLN A;  4LZD A;  4EYH B;  5DB6 A;  1NK9 A;  4YD1 A;  4RWQ A;  2PFP A;  3OVA A;  3KTQ A;  4ED6 A;  4EZ6 A;  4WC7 A;  4J9O A;  1IM4 A;  4RQ0 A;  4JWN A;  5IIL A;  4ZH4 A;  2R8J A;  4I2E A;  4IQV A;  1NK4 A;  2ZH5 A;  4I2C A;  4RUA A;  4PH5 A;  1RYS A;  1KSP A;  1BPB A;  4BGD A;  1HUZ A;  4IQW A;  4C8K A;  2M9N A;  5J0T A;  2HHV A;  5CP2 A;  3LQC B;  3PW0 A;  3EW9 A;  3C66 A;  3BQ1 A;  2Y1I A;  2DR9 A;  4QZC A;  1NKB A;  4QWC A;  4UB4 A;  4O5C A;  1CUK A;  2RDJ A;  5J2A A;  1S9F A;  1LB2 B;  7ICS A;  4E8F A;  3HWT A;  7ICE A;  2R8G A;  2ZH2 A;  2BQR A;  1KTQ A;  2JEF A;  4YN4 A;  4GC6 A;  4X4R A;  2ZTC A;  1ZQB A;  3JYY A;  3ZDD A;  4FH5 A;  3FDS A;  9ICT A;  4F93 B;  4RQ5 A;  5HNK A;  1T3N A;  2FMP A;  4LT6 A;  5J29 A;  2BCQ A;  2DR7 A;  4F91 B;  2PXI A;  4ED7 A;  1NK8 A;  4KN4 A;  4F4K A;  8ICB A;  4F3O A;  5KFV A;  5KFD A;  3ISD A;  1DGS A;  5KFS A;  5L1J A;  4ECS A;  1MC8 A;  4ED1 A;  1L3V A;  5KFG A;  5TZV A;  3SV3 A;  4I2D A;  1TFW A;  4I2F A;  5KG5 A;  4IR9 A;  2ZJA A;  3GII A;  4O3R A;  3HIY A;  1ZQY A;  4M5D A;  3UQ2 A;  7ICJ A;  2AQ4 A;  1BPZ A;  4PHP A;  3B0X A;  2R8H A;  4DSJ A;  4KLL A;  4QZB A;  2C2R A;  9ICB A;  1UT8 A;  4J9Q A;  1D8L A;  3Q8K A;  4IQT A;  5DKW A;  1S0O A;  3ZD9 A;  1ZQE A; 
#chains in the Genus database with same CATH topology
 4ECV A;  2PBE A;  1WUD A;  2KZM A;  4F4W A;  3PNC A;  4FFD A;  3JPN A;  5BPC A;  2W9B B;  1N56 A;  4FZN A;  5HRD A;  1L7P A;  2LI6 A;  5JTI A;  4PZN A;  3RR8 A;  3IM1 A;  3N7S C;  1VLB A;  4PZO A;  3OSP A;  3KHR A;  2FDR A;  3N7R C;  1L6N A;  1HIW A;  4TUR A;  8ICA A;  1KFD A;  5KFR A;  1B4F A;  4DF4 A;  9ICA A;  3DDH A;  3SEN A;  1HUO A;  4C0Z A;  4F5O A;  3BZC A;  2QAR A;  2ZIW A;  3BZK A;  1ZQZ A;  4ELV A;  1QSY A;  4QZA A;  2YY6 A;  1TFR A;  4RQ7 A;  3ISC A;  4QNL A;  3RR7 A;  1PVP A;  1IXR A;  1TAU A;  5K4L A;  1T4G A;  4DL4 A;  4M6W A;  2KFN A;  3BS5 A;  1AQ6 A;  2W3R A;  8ICC A;  4JV2 A;  7ICF A;  2EH9 A;  4DOA A;  3G6Y A;  3K1Z A;  3TAN A;  4CE6 A;  3OV7 A;  7ICK A;  3QUC A;  2YB1 A;  2KJ8 A;  2LM1 A;  3N7P D;  4FHP A;  8ICW A;  2E8O A;  3C2M A;  2E1F A;  4DL6 A;  4O3P A;  4DQI A;  9ICP A;  2DBY A;  3RJE A;  3UPS A;  1DK2 A;  1N62 A;  5C5J A;  3EZ5 A;  4U6P A;  5ALL A;  1JAL A;  4OAH A;  2EZX A;  5ALT A;  4Z6E A;  4ECQ A;  4YR3 A;  4MFC A;  7ICV A;  5D49 A;  1YT3 A;  4O3S A;  4NLC A;  1SZH A;  3KHG A;  1F44 A;  1ZQM A;  3CNH A;  2L5Y A;  2WF6 A;  5HC9 A;  5D61 A;  1KNY A;  1J2M A;  5KFF A;  4AYB F;  2B51 A;  1L8O A;  2MU2 A;  4C7Z A;  2ZTD A;  4KLS A;  3L9D A;  4O67 A;  3GIJ A;  2XCP A;  4OJL A;  4J9M A;  4N7R A;  3O0F A;  2OYY A;  2K4P A;  4XJE A;  3OJU A;  3LYS A;  5KG7 A;  4WC2 A;  3MR2 A;  3M6K A;  8ICL A;  3C28 A;  3IHQ B;  4DLG A;  3Q8Q B;  4FHW A;  1NO5 A;  3H40 A;  7ICH A;  4PGQ A;  1UQV A;  1FFV A;  2P66 A;  3H8M A;  3T3F A;  1COK A;  5CA7 A;  4KLJ A;  2FI1 A;  2KVS A;  3H7I A;  2HN1 A;  1RYR A;  1KL9 A;  1ZQA A;  3AQF A;  2YML A;  2IHN A;  1JRO A;  3PW2 A;  2ZIX A;  1BVS A;  4RUC A;  2IMW P;  5CWR A;  7ICI A;  4X4Q A;  3KHL A;  4Q43 A;  3C5G A;  2GA9 D;  1TAQ A;  2F2A B;  3IP4 B;  1L3U A;  2BZF A;  5D62 A;  2HHW A;  4FH3 A;  1KW4 A;  2HOQ A;  4Y2R A;  2LKY A;  3TAC B;  5ALJ A;  2KN7 A;  3M7D A;  1Q79 A;  1S10 A;  8ICP A;  4NKT A;  4RZR A;  1ZD3 A;  4QZF A;  1L3T A;  4IRC A;  3QUT A;  1S0N A;  1UT5 A;  5J8Y A;  2B6G A;  3RBD A;  5IIK A;  3AQN A;  4UAU A;  3KKA A;  3TKA A;  4Y2T A;  4KLM A;  3C2K A;  8ICY A;  3UXO A;  4MEY A;  2K4H A;  1OXJ A;  2I5H A;  3AQK A;  5AM0 A;  1BPE A;  4QZ9 A;  3OVS A;  4O3M A;  7ICR A;  3JCF A;  5EWG A;  3F2D A;  2EAM A;  2K8C B;  8ICV A;  5HRF A;  5A0L A;  2Q0Z X;  2NV3 A;  7ICN A;  4J9P A;  3RFA A;  3MGH A;  4KLD A;  5BOM A;  2QB0 B;  3ER8 C;  2HBL A;  2ZIU A;  3M9M B;  5T14 A;  3RB3 A;  4WC0 A;  4C8L A;  1HJP A;  4R64 A;  5HR9 A;  4NLK A;  4R8U A;  4QWE A;  3PY8 A;  2F8L A;  2JZB A;  2BE3 A;  3UQ0 A;  3DEE A;  1TK5 A;  3C23 A;  5DBA A;  1JX4 A;  5B66 U;  1SL2 A;  5J2H A;  4CGZ A;  3MDA A;  3WK6 A;  2EWR A;  5H2F U;  1MSW D;  5AIA A;  2UVU A;  3IN5 A;  3RJI A;  1Q3V A;  1T8E A;  2EAN A;  5HRH A;  8ICJ A;  2XIC A;  3OUY B;  3LWM A;  2G06 A;  3KOO A;  1Q78 A;  2NO4 A;  2Y9T A;  4Q45 A;  3F5A A;  3GU3 A;  4BJQ A;  4QW8 A;  2O1P A;  5J0W A;  2UVR A;  3RJG A;  4KLF A;  2BBH A;  3ERC C;  3RBE A;  3GIM A;  3WK5 A;  3V6J A;  1EXN A;  3SV4 A;  1F0M A;  2W9A A;  1WCN A;  5CR0 A;  4QWD A;  2P35 A;  3HT3 A;  1V9P A;  4YMO A;  2W04 A;  1YZ7 A;  4GXK A;  5DB7 A;  1JMS A;  2DRB A;  3IDW A;  1S0M A;  5DBB A;  1ZET A;  2NRT A;  3RB4 A;  4E80 A;  4MFA A;  3L5K A;  3EPG A;  3RH6 A;  4Y2J A;  2ZUB A;  1UEV A;  5B3P A;  1SWV A;  2ISO A;  3HPO A;  5EWF A;  1ZJM A;  1ZQT A;  3M1Y A;  1FA0 A;  2VJ5 A;  3M6Z A;  5ALI A;  4FHY A;  4RQ3 A;  2ZUC A;  5JU5 A;  1RQN A;  1N5X A;  1XWL A;  4X0A A;  3TAP A;  4FBU A;  3GIL A;  5DQG A;  1L8L A;  2RLT A;  5III A;  5KAI U;  1ZYQ A;  4X4V A;  2DVI A;  4ICA A;  4OCZ A;  3N97 B;  3TAR A;  1ZQN A;  5KFK A;  3ZDE A;  5L1I A;  2AJQ A;  2DWQ A;  2LBO A;  4XA5 A;  5DQH A;  4EBK A;  3ONN A;  5CJ7 A;  2HDO A;  3AEV A;  2J6S A;  2ATL A;  2XO7 A;  4XRH A;  3SI8 A;  2A3V A;  1Y88 A;  3WU2 U;  1FIQ A;  2DR5 A;  3K1R B;  2XVT A;  4F4Z A;  2RFF A;  4M04 A;  8ICT A;  4U7C A;  2KKP A;  5BOL A;  4QW9 A;  2BPC A;  1CI4 A;  1QLN A;  3WKD A;  4R66 A;  4QZ8 A;  1NKE A;  2KIC A;  4WJ3 B;  4LZD A;  5DB6 A;  4EED A;  1WWV A;  3D2N A;  4ED6 A;  4USA A;  1NK4 A;  4LEV A;  4QIW C;  3UM9 A;  5J0T A;  3PW0 A;  3NWI A;  4QWC A;  3UMG A;  3HKZ F;  1FO4 A;  2R8G A;  7ICE A;  1KTQ A;  5AM5 A;  4F93 B;  4RQ5 A;  5J29 A;  2MSN A;  4ED7 A;  8ICB A;  5KFV A;  5KFD A;  5KFS A;  1ZQE A;  5L1J A;  4G9B A;  1L3V A;  3FM9 A;  4I2D A;  3CP8 A;  4IR9 A;  2A19 A;  4Y2X A;  4IL6 U;  5B3Q A;  4QZB A;  2C2R A;  3Q8K A;  4WC4 A;  4DSI A;  5KT6 A;  8ICX A;  1ZRN A;  4AT7 B;  1X2I A;  1NJZ A;  1SKW A;  4WBZ A;  2Q4T A;  2OH2 A;  3RJK A;  3T5J A;  9ICU A;  5KFL A;  1WCL A;  2W7O A;  3QUB A;  4JB3 A;  1YZ6 A;  1ZRM A;  2HMX A;  3NGD A;  1ZQD A;  3H8W A;  4WC6 A;  3HJE A;  3LWL A;  3SQI A;  2CXY A;  2CRX A;  3WK8 A;  4O5K A;  4NXX A;  2N1R A;  3RH5 A;  1DRG A;  5DED A;  4G3I A;  5ALW A;  3RH4 A;  4RNN A;  2J6T A;  1S8O A;  3PML A;  1J97 A;  2FLL A;  3RRH A;  4RWN A;  4FO1 A;  4UAV A;  2WAQ F;  4I2A A;  3ZDB A;  4XQ7 A;  4CF5 A;  3QE9 Y;  1ZOL A;  3B0Y A;  4K99 A;  2YN4 A;  2BQU A;  2HOI A;  2MUT B;  1SV0 C;  4B9S A;  2KFZ A;  4P0Q B;  4DCC A;  1WOT A;  3PMN A;  1U4B A;  2DKZ A;  4F5R A;  8ICG A;  2OHF A;  1YLQ A;  3TAQ A;  2B0C A;  4US9 A;  4RWO A;  4LJX A;  2YQE A;  5AKY A;  1WYG A;  3PVX A;  4YR2 A;  4DL5 A;  5J8Y C;  1SKR A;  5KFM A;  4KN7 A;  2ZJ5 A;  1N5W A;  5J0Q A;  1KN5 A;  4NM2 A;  3F2B A;  1RYU A;  4ECZ A;  2WTF A;  1TKD A;  4QJF B;  2HHS A;  4YVZ A;  9ICV A;  4DSE A;  4O3O A;  1F5A A;  1X9S A;  1KFT A;  5KFI A;  2W54 A;  3QU5 A;  4KMO B;  3M9O B;  5CEH A;  2K4I A;  5CFU A;  4M9J A;  4DQS A;  1L7N A;  2OXO A;  4NLG A;  4UD5 A;  4J9S A;  4M0A A;  4X4O A;  4CDG A;  4PGX A;  3H8S A;  7ICQ A;  3VC8 A;  5KFO A;  2AGO A;  4F92 B;  3NYB A;  8ICU A;  4QZG A;  4XUS A;  2WFA A;  4CRX A;  2VAN A;  2IHO A;  1MN8 A;  1PVQ A;  2QB1 A;  3RAX A;  2LHT A;  3JPQ A;  2FMQ A;  1IV8 A;  5HRK A;  4Y2P A;  5DLF A;  2AGP A;  5AKX A;  1Q46 A;  1RZT A;  2I9G A;  2BR0 A;  4I2J A;  2G5I B;  1QCK A;  2OM6 A;  2Z7J A;  2AGQ A;  2M2T A;  5J2K A;  4R63 A;  1K1Q A;  2M2U A;  9ICL A;  5AHX A;  2JEI A;  3WK7 A;  8ICH A;  5DEC A;  5AI5 A;  4DFJ A;  4J9N A;  5AK5 A;  3T5K A;  2JR5 A;  2IA6 A;  8ICQ A;  2ZH6 A;  4F71 A;  4DO9 A;  3ER9 B;  2BKE A;  5AKZ A;  4RQM A;  4GXJ A;  5JUM A;  1O08 A;  3A0H U;  4ED2 A;  5AM3 A;  3L3F X;  3PX0 A;  3OHB A;  4ECW A;  3RF9 A;  2IOF A;  3M8R A;  4FS2 A;  5CHE A;  1T3Q A;  3RJJ A;  4K96 A;  3KHH A;  3QYP A;  4PHE A;  2DKX A;  1Q3U A;  2IOF K;  4RNM A;  1SB3 C;  1PZN A;  1V38 A;  2KIW A;  4UD4 A;  4X4U A;  4IRD A;  2FPM A;  3E2E A;  4ED3 A;  3CK6 A;  5F9N A;  4RPX A;  4ECU A;  1D9F A;  1NKC A;  4X4N A;  4KLG A;  4UW9 A;  2AU0 A;  2ID1 A;  4YMM A;  3FYH A;  1MIV A;  5KG1 A;  4EZ9 A;  2OCE A;  1LV5 A;  4WBY A;  4DOC A;  4O0I A;  2ESE A;  1Z00 A;  4RU9 A;  2GWS A;  2F8K A;  3H37 A;  3AU6 A;  2KSO A;  4MFF A;  2HVH A;  1JXL A;  2DQN B;  5KFJ A;  1ZQX A;  4RPY A;  2JRZ A;  2KG5 A;  2ZJ8 A;  1H38 A;  3IRU A;  7ICL A;  4ACO A;  2NRV A;  3GV5 B;  3C18 A;  4I28 A;  4PL2 A;  1A0P A;  2IUB A;  1PUZ A;  2UVW A;  5AM2 A;  2HN2 A;  5HHH A;  4ATB A;  3RB6 A;  3AQL A;  1L7M A;  3G6X A;  5DG9 A;  4UB5 A;  5AKL A;  1ZXI A;  4E7X A;  3NVY A;  5E79 U;  3KBB A;  5AK6 A;  3IG5 A;  3SZ2 A;  4NWI A;  8ICR A;  4M2Y A;  4BWJ A;  1UA0 A;  3RTV A;  4B9M A;  4NLN A;  2F77 X;  4KLU A;  2ZUD A;  1S5L U;  4HAI A;  1TAM A;  3PX6 A;  4KLI A;  4UB2 A;  4PPX A;  4PHA A;  4ECR A;  4B9V A;  3NKU A;  4IQU A;  4C4T A;  5ALH A;  4R65 A;  2NO5 A;  2YMM A;  5L9X A;  4F5Q A;  8ICE A;  2Y9U A;  8ICM A;  5KFE A;  2WF5 A;  3MFH A;  2I6X A;  1JN3 A;  3SYZ A;  8ICZ A;  3QZ7 A;  4QZH A;  2H3V A;  1PK1 A;  2Y1J A;  5J0U A;  1XO0 A;  5J2C A;  2ZHB A;  4EBJ A;  1V97 A;  3OSN A;  5ALQ A;  5ALS A;  3CRX A;  1NK0 A;  4UAZ A;  4ED0 A;  4DFP A;  9ICM A;  3QX7 A;  3K4G A;  2QAR B;  1L7O A;  3VCB A;  2ZIW B;  1DOQ A;  3EWA A;  1IG6 A;  2A1J A;  4I2G A;  5J0Y A;  1CEZ A;  4M6W B;  3OTQ A;  3BS5 B;  2KK0 A;  5KFA A;  5L1K A;  5KAF U;  1SV0 A;  1MQ3 A;  4RT2 A;  2YB4 A;  2Y0S F;  2LYH A;  1T7P A;  2NRW A;  2MA1 A;  3FC4 A;  4GFJ A;  5J2B A;  3OJS A;  5J2E A;  5AKE A;  4P4M A;  1Z4N A;  4I29 A;  4K9A A;  4YP3 A;  4EV6 A;  1ARO P;  4YFK A;  4AP9 A;  4DSK A;  9ICI A;  1JIH A;  4NKU A;  4EBE A;  4BXO A;  4DQQ A;  4UAT A;  4FS1 A;  2RDI A;  3AUO A;  1Z3E B;  5TIS U;  4Z6F A;  4DL2 A;  2LM4 A;  1BNP A;  1MIW A;  2HHQ A;  9ICW A;  4KLH A;  3HJ4 A;  3JPT A;  5G5H A;  2JGA A;  5KT3 A;  1K5O A;  3J81 j;  3KZX A;  2RQ5 A;  2K8A A;  5J2I A;  3C5F A;  1ZQH A;  1N2X A;  3MR5 A;  5KG3 A;  2KZZ A;  1JAJ A;  4C8O A;  5J0S A;  2DL0 A;  1KLN A;  5GTI U;  1NK9 A;  2QLT A;  4RWQ A;  1LKY A;  4WC7 A;  2B4V A;  3C29 A;  2R8J A;  4WQK A;  4I2E A;  2ZH5 A;  5AIB A;  2K8B B;  5ALN A;  2ZIX B;  3I28 A;  4AYB C;  3PZP A;  2M9N A;  2D6F C;  3LQC B;  3EW9 A;  2Y1I A;  1DGJ A;  1ECW A;  4UB4 A;  4O5C A;  1TE2 A;  4Y2Q A;  5J2A A;  1LB2 B;  4P0P A;  4WOY A;  2HOF A;  2ZH2 A;  2BQR A;  1ZQB A;  4KM5 A;  4BX9 C;  3FDS A;  5HNK A;  4LT6 A;  4F91 B;  2PXI A;  1NK8 A;  4KN4 A;  4NXW A;  1DGS A;  1MC8 A;  4I2F A;  2ZJA A;  2RP5 A;  1ZQY A;  5AI8 A;  3QU2 A;  2AQ4 A;  3B0X A;  4DSJ A;  4KLL A;  4IQT A;  4ELT A;  1S0O A;  4KMU A;  2KD1 A;  1ZD5 A;  2ZH4 A;  4Z6D A;  3TAD C;  1ZQV A;  3M9N B;  3MAB A;  3S6J A;  4QZI A;  2GAF D;  4DFM A;  3TQ1 A;  1LVH A;  2MAX A;  2ZIV A;  3OPX A;  4F5N A;  4KLT A;  2KTQ A;  1UEU A;  2M2V A;  3THV A;  5J2G A;  5CHG A;  2NRK A;  5DG7 A;  2WB1 F;  3T5L A;  3IV6 A;  3G6V A;  4GLX A;  1S76 D;  3UMC A;  1PK3 A;  2F76 X;  5DGA A;  3TI0 A;  2W43 A;  5C0Y A;  1Q8K A;  2AHO B;  5D4B A;  3EPI A;  1JQR A;  2C22 A;  3D2S A;  3UPQ A;  1X9M A;  3C21 A;  4LZG A;  2V9W A;  9ICQ A;  3WFR E;  1A77 A;  1PX5 A;  5KFW A;  5EWE A;  5AI9 A;  2Y0S C;  4Z6C A;  1ZQJ A;  4FHX A;  4F2S A;  1SGG A;  1ZQU A;  2ZIU B;  3L4P A;  3RAQ A;  4NL9 C;  4GC7 A;  1O03 A;  2W7P A;  2E3T A;  4BUG A;  3PR5 B;  3Q8M A;  4UAW A;  5J2J A;  3HIY A;  3QUQ A;  1U48 A;  8ICS A;  3GV8 B;  4R8U B;  3LDA A;  4CF4 A;  3JPO A;  4DF8 A;  4LVS A;  4F72 A;  2VIX A;  2JZB B;  1B43 A;  2LMR A;  2F1H A;  2B21 A;  1Z1V A;  4C4R A;  1VJ7 A;  1MA7 A;  3PW4 A;  3WFQ E;  3ICX A;  4JV1 A;  5J0P A;  5KFT A;  2Q66 A;  4CCH A;  1XSP A;  2QKQ A;  4K4H A;  2KMD A;  2W9C A;  2CN1 A;  3AQM A;  5AKG A;  2WF7 A;  1RPL A;  3OVB A;  9ICK A;  1D8Y A;  2HBM A;  2ISP A;  3BDP A;  1KFS A;  4KTQ A;  4DQP A;  1XU4 A;  4K4I A;  2JHD A;  3NAS A;  5HRI A;  5ALF A;  4ELU A;  2XGP A;  4E0D A;  2F3N A;  4EX7 A;  5D63 A;  1QTM A;  1BPD A;  5B5E U;  5AKH A;  2KHQ A;  4X4P A;  3RB0 A;  1NK7 A;  2EZZ A;  4DWI A;  1R8A A;  2WHE A;  5ALG A;  2KIV A;  3WFP A;  3ISB A;  1NI3 A;  8ICN A;  2PI5 A;  1JI7 A;  3F53 A;  1JUD A;  2KP7 A;  4C8M A;  1S77 D;  1F5S A;  3ETR A;  2DGZ A;  1MIY A;  4BWM A;  3UXN A;  5DBC A;  1QQ5 A;  9ICH A;  3HX0 A;  5AIC A;  3PSI A;  2XGQ A;  4HYK A;  5DLG A;  3EUB 2;  2XY6 A;  2CPR A;  2OEH A;  2W11 A;  1WWU A;  4JK1 A;  4K4G A;  1X40 A;  3T5H A;  2KKV A;  3B9J A;  2BHN A;  5DQI A;  4RNO A;  2GLE A;  4YR0 A;  2DR8 A;  2FLP A;  4US8 A;  2VKQ A;  4F5P A;  5IIJ A;  1ZJN A;  1TFY A;  2P6U A;  3U26 A;  5KT2 A;  2R8I A;  3H39 A;  7ICU A;  5AI0 A;  2BCU A;  2A1A A;  3GFK B;  4UB6 U;  2W3S A;  2F1I A;  2YX8 A;  3WFS C;  1X66 A;  3F5E A;  4JLX A;  5KTQ A;  4WC5 A;  3SAG A;  5ALZ A;  5KFQ A;  2H3I A;  1OW5 A;  3GDX A;  4EX6 A;  2W9B A;  1QSL A;  1R8B A;  1NZP A;  3NUQ A;  2W9M A;  3JPR A;  4F8R A;  4O6A A;  4KLQ A;  3JPP A;  5AKJ A;  2W9C B;  4K9B A;  1ZQC A;  4B9T A;  1KBU A;  1QQ6 A;  4J03 A;  4O68 A;  3DV9 A;  3ZDA A;  2YMP A;  2I1Q A;  3LK9 A;  4O3Q A;  4TUP A;  9ICX A;  2JEG A;  2ALZ A;  2HBJ A;  1GPJ A;  4RPZ A;  2J6U A;  2OWO A;  1SL1 A;  1IIP A;  4MHV A;  3MGV A;  3V6H A;  1S0V A;  5IIO A;  9ICN A;  1JXE A;  1VDV A;  5KFP A;  5AI4 A;  1K1S A;  1V85 A;  4B9U A;  2RRD A;  2DF4 B;  4KB6 A;  4UB3 A;  2K60 A;  3PW7 A;  5CFT A;  5JTG A;  4OD0 A;  3NVV A;  4UAR A;  1M6Y A;  2WF9 A;  2FLN A;  1UCV A;  4O69 A;  2O5A A;  4X4S A;  1B0X A;  1TK0 A;  1U49 A;  2ZH7 A;  2P6R A;  4O9M A;  4NM1 A;  3GQC A;  4I2H A;  2LYA A;  2NYV A;  2FPK A;  8ICI A;  5AKK A;  1KQQ A;  2KE7 A;  3TAD A;  3BQ7 A;  4FBT A;  2KJ9 A;  2BQ3 A;  2G08 A;  2C2D A;  2R8K A;  3I1Y A;  4GIB A;  3HKZ C;  5FP0 A;  3ZD9 A;  5GTH U;  2VA8 A;  4P4P A;  3RRG A;  5DB9 A;  5KFC A;  3H0M B;  1UPH A;  3BS7 A;  3BQ2 A;  5J0X A;  1XNS A;  3WKE A;  5KT4 A;  3AN1 A;  4YCX A;  3V72 A;  2ASD A;  2M2W A;  1X6I A;  1XSN A;  5KG6 A;  5KT5 A;  2JH7 A;  4DFD A;  7ICO A;  4FZM A;  5J2F A;  3GIK A;  3K7D A;  5KFX A;  4IG8 A;  1ZQI A;  1P7D A;  7ICG A;  3M8S A;  1J2N A;  1MQ2 A;  5KFU A;  2VA2 A;  2JXJ A;  1U47 A;  4DSF A;  2ZG6 A;  4I0U A;  2FE9 A;  9ICC A;  1XC9 A;  3AMZ A;  4NL9 A;  4RQ6 A;  3LVV A;  4LEW A;  4BDP A;  4EEY A;  4M47 A;  3CW2 C;  2XCA A;  1N60 A;  2XY7 A;  1SKS A;  2GH1 A;  2NRZ A;  4OAG A;  4RQ8 A;  5AK3 A;  4WCW A;  1RXV A;  4JUZ A;  1ZQQ A;  2BCS A;  5ALD A;  1SV4 A;  3TFR A;  2RHF A;  5HR7 A;  2ZH1 A;  3MDC A;  5HR6 A;  4YG2 A;  5KFH A;  5DB8 A;  4YD2 A;  4RQ1 A;  2B56 A;  2JEJ A;  1N63 A;  2W8K A;  2WAQ C;  4IC9 A;  4X0B A;  2HW3 A;  2PFN A;  3ZD8 A;  5HRL A;  4HX0 A;  5ALX A;  3T79 A;  3MFI A;  2GOL A;  1NK5 A;  4F2R A;  5ALM A;  2BDP A;  1RG6 A;  1TV9 A;  4M9G A;  4UAS A;  2KV2 A;  7ICT A;  3QEA Z;  3LVW A;  3HJ1 A;  7ICP A;  2PMZ F;  4O5E A;  3QU9 A;  2D3D A;  3HRD D;  9ICO A;  3H4D A;  3OHA A;  4Q44 A;  4GXI A;  2W8L A;  4WC1 A;  3HW8 A;  1ZQW A;  4I2I A;  3QEB Z;  1S97 A;  1ZQG A;  4EGW A;  5JRT A;  4EYH B;  4YD1 A;  4A8E A;  5KNI A;  2PFP A;  3KTQ A;  4EZ6 A;  4CNQ A;  1IM4 A;  4RQ0 A;  4IQV A;  4K98 A;  4RUA A;  4IS7 A;  4PH5 A;  3R9K A;  2JH1 A;  4C8K A;  2HI0 A;  2HHV A;  5CP2 A;  2D8C A;  3BQ1 A;  3C66 A;  1ZD4 A;  2RDJ A;  3SMV A;  1S9F A;  5KL8 B;  5AM4 A;  3WK9 A;  4OAI Z;  1X42 A;  2JEF A;  2QB0 A;  5ALV A;  3QNM A;  4GC6 A;  4X4R A;  2ZTC A;  3JYY A;  3ZDD A;  4FH5 A;  9ICT A;  1T3N A;  2FMP A;  2BCQ A;  4F3O A;  3ISD A;  2E8M A;  2ES6 A;  1TFW A;  5KG5 A;  3GII A;  4O3R A;  4FE3 A;  7ICJ A;  4PHP A;  1ED1 A;  1N61 A;  9ICB A;  1UT8 A;  1D8L A;  1BNO A;  3WK4 A;  4OJ6 A;  4KX5 A;  4DFK A;  4X5V A;  5HMM A;  5ALP A;  5ALK A;  1Z00 B;  4DL3 A;  3SD7 A;  3V6K A;  2W03 A;  4MF8 A;  2KSO B;  3OUY A;  1KRP A;  2IOH A;  4MEX A;  2BPF A;  1ZQL A;  4NLZ A;  4NXT A;  2FPL A;  5KG0 A;  1COO A;  4ECT A;  3ZI4 A;  2DFL A;  1ZQF A;  2KZ3 A;  3ORY A;  1ZQS A;  2HVI A;  3V7L A;  4EBD A;  1ZQK A;  1D9D A;  2XC9 A;  1RQL A;  5HRG A;  2BCR A;  5D46 A;  4YXM A;  5IIN A;  5DGB A;  4ATB B;  4UBC A;  4M9H A;  5J0O A;  4ECY A;  2E5S A;  2E8P A;  4X4T A;  3A0B U;  1SIJ A;  2PI4 A;  2HSZ A;  3ETL A;  4B9L A;  4ECX A;  2AQ0 A;  4QZE A;  4TUS A;  2BCV A;  3H0R B;  3KZI U;  1RDF A;  5EE3 A;  3CYM A;  1RM6 C;  3ZDC A;  1UET A;  1X9W A;  4M9N A;  5F3X B;  2BPG A;  2E8N A;  5ALU A;  1NOM A;  4TQR A;  2KOB A;  3AU2 A;  3PST A;  3PO4 A;  4JMU A;  5HML A;  4UB8 U;  4NJ8 A;  5AM1 A;  4B6J A;  3BJY A;  1ZQO A;  4QZD A;  4K97 A;  3H8J A;  3NTU A;  2PMZ C;  2BGW A;  9ICE A;  4C4S A;  2C28 A;  1R8C A;  2ZH9 A;  3Q8R B;  1C7Y A;  3H4B A;  2C2E A;  2WF8 A;  2HHX A;  2JMG A;  4NXU A;  4QIW F;  3C2L A;  1VFG A;  4DQR A;  1BPX A;  1PK1 B;  1HEK A;  4NXZ A;  1BGX T;  3JZ0 A;  3HP6 A;  4RT3 A;  1R89 A;  1SZP A;  2ZHA A;  4KLE A;  2W55 A;  3N28 A;  2H3F A;  5F2V O;  4KX3 A;  4YQW A;  1VJ5 A;  4IR1 A;  1A76 A;  2LPE A;  5F9L A;  3NRZ A;  2GO7 A;  3PW5 A;  2ASL A;  2A1J B;  1NJY A;  3SEI A;  3V7J A;  2FMS A;  2XI9 A;  4EEN A;  3UMB A;  3MR3 A;  5CFS A;  1V4A A;  4DLE A;  4EEK A;  4M9L A;  2EAO A;  1NJX A;  1SL0 A;  4O3N A;  1XSL A;  4AT8 A;  2ASJ A;  1NZB A;  4ED8 A;  1BPY A;  5G5G A;  3WKA A;  2E1E A;  3QU4 A;  4QWB A;  5KFY A;  4DSL A;  3C1Z A;  4CF3 A;  1NJW A;  1SXD A;  8ICK A;  3OGU A;  2ZTE A;  4C7Y A;  2LYB A;  1NK6 A;  4RWP A;  3MGI A;  5IIM A;  2XID A;  4BXO B;  4NXV A;  3SAH A;  4NY8 A;  4F4X A;  3D6J A;  4RQ2 A;  4KLO A;  3QXG A;  3NVZ A;  1FEZ A;  3JPS A;  3IG8 A;  1RXW A;  3C1Y A;  3V7K A;  3WKB A;  1A6S A;  3RJF A;  4AT9 A;  4YMN A;  2XY5 A;  3PX4 A;  3PV8 A;  4B9N A;  4Q8F A;  2F44 A;  2O6K A;  4TUQ A;  1QH9 A;  2K89 A;  5CB1 A;  1ZQP A;  4AT7 A;  4NLB A;  2V4R A;  1B22 A;  1T94 A;  5KFB A;  4OJ5 A;  2HHT A;  4LEY A;  4YXJ A;  1Z19 A;  2ZH3 A;  2DPJ A;  2H3Q A;  1LKY B;  2PFQ A;  2EZY A;  4LEZ A;  3Q8S B;  1L3S A;  2ZXH A;  4PHD A;  2VA3 A;  5KT7 A;  3NRW A;  5DDY A;  2PKE A;  5HHI A;  4C80 A;  2AH5 A;  4C8N A;  4I2B A;  4PGY A;  2DUY A;  5AK4 A;  4JV0 A;  9ICS A;  1SWW A;  3MBY A;  1DXS A;  4DS5 A;  4P0P B;  4MKP A;  3ALR A;  2IHM A;  5HRB A;  1FFU A;  4P4O A;  4FHV A;  4OAF A;  2FCL A;  3BQT A;  4K8V A;  2UVV A;  4WH5 A;  1QSS A;  4JWM A;  3Q8P B;  4IRK A;  2MUT A;  1ZD2 P;  3PO5 A;  4P0Q A;  5EE0 A;  3TFS A;  4J9R A;  4OO1 J;  4Y2Y A;  3UXP A;  5KG4 A;  2H5X A;  2G5H B;  3KFU F;  4AT8 B;  4MF2 A;  2DPI A;  2BDU A;  1OUQ A;  2VJ4 A;  3MR6 A;  4EBC A;  4FO6 A;  5EE9 A;  3WFO A;  3D2Q A;  3EYZ A;  1U45 A;  2ZIV B;  4Y2U A;  1Z1B A;  4EP7 A;  3K75 D;  1DK3 A;  1TVA A;  2BBJ A;  5EOZ A;  2HHP A;  4WC3 A;  8ICF A;  2M0N A;  4P2H A;  4UAY A;  4QWA A;  3E58 A;  2NRX A;  3SR6 A;  4FZL A;  3H3A A;  2EDU A;  4DS4 A;  9ICF A;  5DDM A;  2FJ6 A;  4F50 A;  5ALE A;  2AXT U;  5KFZ A;  1KEJ A;  4UQG A;  2KJ5 A;  2PFO A;  9ICJ A;  4UBB A;  4AT9 B;  3NS1 A;  5KL1 B;  2KNJ A;  3BQ0 A;  1GO3 F;  5L1L A;  4DOB A;  2HBK A;  4EYI B;  5HRE A;  2EQY A;  4S3N A;  2G07 A;  2ZXI A;  9ICG A;  3N4M B;  3AL0 B;  4Q8E A;  2YMQ A;  4TQS A;  3RJH A;  4PJ0 U;  2YTU A;  3PSF A;  3GV7 B;  2DRA A;  2WB1 C;  4F4Y A;  3QZ8 A;  1ZQ1 C;  3GZF A;  5J0R A;  5DG8 A;  3H38 A;  3EF2 A;  1UHU A;  4KIT B;  4XQ8 A;  4I27 A;  5HP4 A;  3PHZ A;  1PVR A;  2HHU A;  2IBK A;  1XS9 D;  3OWG A;  8ICO A;  4ZOH C;  3F2C A;  1TK8 A;  4EEL A;  1KKX A;  5ALO A;  2G09 A;  3NVO A;  1UA1 A;  1OU5 A;  2F1J A;  5AKI A;  1N48 A;  3Q8L A;  1X6J A;  4RQ4 A;  3H0L B;  1XO1 A;  2JV3 A;  7ICM A;  5AI6 A;  1KDH A;  3MCR A;  3PR4 A;  4DEZ A;  4J9K A;  5CRX A;  4OJP A;  3I76 A;  2V4Q A;  1URJ A;  3HIL A;  5KFN A;  4UB1 A;  5KG2 A;  2KHV A;  1X9X A;  2ZH8 A;  2K4E A;  4DL7 A;  1ZQR A;  1L5U A;  5J2D A;  2R18 A;  3KKA C;  3PSP A;  5EE1 A;  9ICR A;  4RQN A;  4OJO A;  2G0A A;  1U9L A;  2MRL A;  1Z4O A;  1SXE A;  4J9L A;  3WKC A;  2KEY A;  3OVA A;  4J9O A;  4JWN A;  5IIL A;  4ZH4 A;  1WG8 A;  1D8B A;  4NV0 A;  1QQ7 A;  3MC1 A;  4I2C A;  1RYS A;  1KSP A;  1BPB A;  4BGD A;  1HUZ A;  4IQW A;  3AQE A;  3NVW A;  2DR9 A;  4QZC A;  1JRP A;  4JLZ A;  1NNL A;  1NKB A;  1CUK A;  7ICS A;  4E8F A;  3KD3 A;  3HWT A;  3AM9 A;  2HCF A;  4YN4 A;  3FAH A;  2KVC A;  5ALY A;  1C20 A;  5L1M A;  5ALR A;  1CRX A;  3SAF A;  2DR7 A;  2ODG A;  3QU7 A;  4F4K A;  4ECS A;  4Y2S A;  3E0F A;  4ED1 A;  5KFG A;  5TZV A;  3SV3 A;  2EAP A;  4WQL A;  4M5D A;  4Y2V A;  3UQ2 A;  4EEB A;  1BPZ A;  2R8H A;  4PL1 A;  3ED5 A;  2H3Z A;  5DKW A;  4J9Q A; 
#chains in the Genus database with same CATH homology
 4KMU A;  4DSI A;  2ZH4 A;  4ECV A;  4Z6D A;  5KT6 A;  8ICX A;  2PBE A;  2KZM A;  4F4W A;  4AT7 B;  4DFK A;  1X2I A;  3PNC A;  1NJZ A;  4X5V A;  1ZQV A;  5HMM A;  3JPN A;  5BPC A;  3M9N B;  1SKW A;  2W9B B;  1N56 A;  4WBZ A;  3MAB A;  3RJK A;  3T5J A;  9ICU A;  5HRD A;  4QZI A;  5KFL A;  1WCL A;  1Z00 B;  4DFM A;  3TQ1 A;  4DL3 A;  2MAX A;  4F5N A;  4KLT A;  3V6K A;  2KTQ A;  3NGD A;  1UEU A;  3RR8 A;  2M2V A;  3THV A;  1ZQD A;  5J2G A;  3IM1 A;  5CHG A;  3H8W A;  4WC6 A;  2NRK A;  4MF8 A;  5DG7 A;  3OUY A;  3OSP A;  3T5L A;  3LWL A;  4MEX A;  2BPF A;  1ZQL A;  1KRP A;  3G6V A;  4NLZ A;  4ELT A;  4GLX A;  3KHR A;  1S76 D;  2FPL A;  5KG0 A;  1COO A;  4ECT A;  4O5K A;  5DGA A;  4TUR A;  3TI0 A;  3RH5 A;  2DFL A;  1ZQF A;  2KZ3 A;  3ORY A;  1ZQS A;  2HVI A;  4G3I A;  8ICA A;  5DED A;  3V7L A;  4EBD A;  5D4B A;  1KFD A;  4RNN A;  3RH4 A;  3EPI A;  1ZQK A;  2J6T A;  5KFR A;  3PML A;  1D9D A;  1JQR A;  2XC9 A;  4DF4 A;  2C22 A;  2BCR A;  3UPQ A;  1X9M A;  9ICA A;  5HRG A;  2FLL A;  5D46 A;  3C21 A;  3RRH A;  4LZG A;  2V9W A;  9ICQ A;  3WFR E;  4RWN A;  4YXM A;  1A77 A;  5IIN A;  5KFW A;  5EWE A;  1HUO A;  4I2A A;  5DGB A;  4F5O A;  1PX5 A;  4ATB B;  3ZDB A;  4UBC A;  4XQ7 A;  4Z6C A;  1ZQZ A;  4ELV A;  3QE9 Y;  5J0O A;  4ECY A;  1QSY A;  3B0Y A;  4QZA A;  1TFR A;  4RQ7 A;  3ISC A;  1ZQJ A;  3RR7 A;  4F2S A;  4FHX A;  4X4T A;  1IXR A;  1ZQU A;  2BQU A;  2PI4 A;  1TAU A;  3RAQ A;  1T4G A;  4DL4 A;  4GC7 A;  4M6W A;  2KFN A;  2MUT B;  4B9S A;  2KFZ A;  3ETL A;  3PR5 B;  3Q8M A;  1WOT A;  4UAW A;  3PMN A;  4B9L A;  1U4B A;  4JV2 A;  7ICF A;  5J2J A;  4F5R A;  4DOA A;  8ICG A;  3G6Y A;  4ECX A;  2AQ0 A;  1U48 A;  4QZE A;  3TAN A;  8ICS A;  3GV8 B;  1YLQ A;  4R8U B;  3LDA A;  3OV7 A;  4TUS A;  7ICK A;  3TAQ A;  3JPO A;  2BCV A;  4DF8 A;  4LVS A;  4RWO A;  2JZB B;  1B43 A;  3PVX A;  4YR2 A;  4DL5 A;  2F1H A;  3ZDC A;  1X9W A;  4M9N A;  2B21 A;  5KFM A;  4KN7 A;  1SKR A;  2BPG A;  8ICW A;  2ZJ5 A;  3C2M A;  1NOM A;  4DL6 A;  5J0Q A;  4O3P A;  4NM2 A;  4TQR A;  1VJ7 A;  4DQI A;  3PW4 A;  9ICP A;  3RJE A;  3UPS A;  4ECZ A;  3AU2 A;  2WTF A;  1DK2 A;  3WFQ E;  1TKD A;  3PO4 A;  5HML A;  5C5J A;  3EZ5 A;  4JV1 A;  2HHS A;  5J0P A;  5KFT A;  2Q66 A;  4YVZ A;  3BJY A;  1ZQO A;  4QZD A;  1XSP A;  3H8J A;  4CCH A;  3NTU A;  9ICV A;  4K4H A;  4DSE A;  4O3O A;  1F5A A;  1X9S A;  2W9C A;  2BGW A;  9ICE A;  1KFT A;  4Z6E A;  5KFI A;  4YR3 A;  3M9O B;  4ECQ A;  4MFC A;  5D49 A;  7ICV A;  1R8C A;  2C28 A;  4O3S A;  2ZH9 A;  3AQM A;  4M9J A;  3Q8R B;  3KHG A;  1RPL A;  3OVB A;  4DQS A;  1C7Y A;  9ICK A;  3H4B A;  1ZQM A;  1D8Y A;  4NLG A;  4UD5 A;  4J9S A;  2C2E A;  4M0A A;  2HHX A;  4X4O A;  5HC9 A;  4PGX A;  3C2L A;  1KNY A;  2ISP A;  1VFG A;  5KFF A;  3H8S A;  3BDP A;  4DQR A;  1BPX A;  1KFS A;  4DQP A;  4KTQ A;  7ICQ A;  1XU4 A;  4NXZ A;  1BGX T;  3JZ0 A;  3HP6 A;  4RT3 A;  1R89 A;  1SZP A;  4K4I A;  5KFO A;  2ZTD A;  2AGO A;  4KLE A;  4KLS A;  4F92 B;  5HRI A;  3NYB A;  2ZHA A;  3L9D A;  3GIJ A;  5F2V O;  2XCP A;  8ICU A;  4ELU A;  2XGP A;  4YQW A;  4QZG A;  4J9M A;  4E0D A;  4IR1 A;  4XUS A;  2VAN A;  1QTM A;  1BPD A;  1A76 A;  5F9L A;  3OJU A;  5KG7 A;  4WC2 A;  3RAX A;  4X4P A;  3PW5 A;  3MR2 A;  3RB0 A;  3JPQ A;  2A1J B;  2ASL A;  1NK7 A;  2FMQ A;  8ICL A;  1NJY A;  3IHQ B;  4DWI A;  3V7J A;  1R8A A;  5HRK A;  2FMS A;  4DLG A;  3Q8Q B;  4FHW A;  5DLF A;  1NO5 A;  3MR3 A;  3WFP A;  3H40 A;  3ISB A;  8ICN A;  2AGP A;  7ICH A;  4PGQ A;  2PI5 A;  1V4A A;  1RZT A;  2KP7 A;  4C8M A;  4DLE A;  2I9G A;  2P66 A;  4M9L A;  1S77 D;  2BR0 A;  4I2J A;  1NJX A;  1SL0 A;  2AGQ A;  3T3F A;  2M2T A;  5J2K A;  4O3N A;  5CA7 A;  4KLJ A;  1XSL A;  3H7I A;  1MIY A;  4BWM A;  4R63 A;  1RYR A;  1K1Q A;  4AT8 A;  3UXN A;  5DBC A;  2M2U A;  9ICH A;  1ZQA A;  9ICL A;  3HX0 A;  2ASJ A;  2JEI A;  8ICH A;  5DEC A;  2IHN A;  4ED8 A;  1BPY A;  2XGQ A;  4HYK A;  3PW2 A;  4DFJ A;  5DLG A;  4J9N A;  1BVS A;  2XY6 A;  3T5K A;  4RUC A;  4K4G A;  4JK1 A;  2IMW P;  4QWB A;  5CWR A;  2IA6 A;  7ICI A;  8ICQ A;  4X4Q A;  2ZH6 A;  5KFY A;  3KHL A;  3T5H A;  4DSL A;  3C1Z A;  4DO9 A;  2BKE A;  2BHN A;  5DQI A;  1NJW A;  4Q43 A;  4RNO A;  3C5G A;  8ICK A;  4YR0 A;  4M9H A;  4GXJ A;  5JUM A;  3OGU A;  1TAQ A;  2ZTE A;  1NK6 A;  4RWP A;  1UET A;  3MGI A;  4ED2 A;  2DR8 A;  2FLP A;  5IIM A;  4BXO B;  3PX0 A;  3OHB A;  1L3U A;  4ECW A;  4NY8 A;  4F4X A;  4F5P A;  5IIJ A;  3M8R A;  4FS2 A;  2HHW A;  1ZJN A;  4FH3 A;  1TFY A;  2P6U A;  3RJJ A;  5KT2 A;  4RQ2 A;  3KHH A;  4KLO A;  4PHE A;  2KN7 A;  2R8I A;  4WC4 A;  3JPS A;  3H39 A;  1RXW A;  7ICU A;  4RNM A;  3C1Y A;  1PZN A;  4UD4 A;  2BCU A;  4X4U A;  3V7K A;  4IRD A;  3RJF A;  1Q79 A;  3GFK B;  1S10 A;  8ICP A;  2FPM A;  4YMN A;  4ED3 A;  3E2E A;  4AT9 A;  2F1I A;  5F9N A;  4RPX A;  4NKT A;  4RZR A;  2XY5 A;  3PX4 A;  4ECU A;  3WFS C;  3PV8 A;  1D9F A;  4QZF A;  4B9N A;  1NKC A;  1L3T A;  4IRC A;  4KLG A;  2AU0 A;  4Q8F A;  4X4N A;  2ID1 A;  4TUQ A;  5KTQ A;  4YMM A;  1S0N A;  3FYH A;  5CB1 A;  1UT5 A;  1ZQP A;  1MIV A;  4WC5 A;  5KG1 A;  4EZ9 A;  4AT7 A;  5KFQ A;  3GDX A;  2V4R A;  2W9B A;  3RBD A;  5IIK A;  1B22 A;  3AQN A;  1LV5 A;  1QSL A;  4WBY A;  5KFB A;  4DOC A;  4O0I A;  2GWS A;  1Z00 A;  4RU9 A;  1R8B A;  1NZP A;  3JPR A;  2W9M A;  4F8R A;  2HHT A;  4KLM A;  3C2K A;  3JPP A;  4KLQ A;  3H37 A;  4YXJ A;  3AU6 A;  4MFF A;  2W9C B;  8ICY A;  2ZH3 A;  2HVH A;  1JXL A;  2DPJ A;  3UXO A;  2PFQ A;  4MEY A;  5KFJ A;  1ZQC A;  4B9T A;  3Q8S B;  3AQK A;  1L3S A;  1BPE A;  4QZ9 A;  3OVS A;  1ZQX A;  4RPY A;  4PHD A;  2VA3 A;  5KT7 A;  3ZDA A;  2ZJ8 A;  5DDY A;  1H38 A;  2I1Q A;  7ICR A;  3LK9 A;  5HHI A;  7ICL A;  4C8N A;  4I2B A;  5EWG A;  4PGY A;  4O3Q A;  4TUP A;  4JV0 A;  2NRV A;  3GV5 B;  8ICV A;  2JEG A;  4I28 A;  9ICS A;  2ALZ A;  3MBY A;  9ICX A;  3C18 A;  4DS5 A;  5HRF A;  2Q0Z X;  2IHM A;  4RPZ A;  2J6U A;  2OWO A;  7ICN A;  4J9P A;  3V6H A;  1SL1 A;  4P4O A;  2UVW A;  5HRB A;  4FHV A;  5HHH A;  3MGH A;  1S0V A;  5IIO A;  4KLD A;  4ATB A;  9ICN A;  1JXE A;  5BOM A;  5KFP A;  3RB6 A;  3BQT A;  3AQL A;  2UVV A;  1K1S A;  1QSS A;  4JWM A;  3G6X A;  5DG9 A;  4UB5 A;  3Q8P B;  4B9U A;  4E7X A;  3M9M B;  3RB3 A;  2MUT A;  4IRK A;  4UB3 A;  3PW7 A;  3PO5 A;  4WC0 A;  4C8L A;  3TFS A;  2FLN A;  1HJP A;  3SZ2 A;  8ICR A;  2O5A A;  4M2Y A;  4BWJ A;  4R64 A;  4J9R A;  5HR9 A;  1TK0 A;  4X4S A;  4NLK A;  1UA0 A;  4R8U A;  3RTV A;  1U49 A;  3UXP A;  2P6R A;  2ZH7 A;  4QWE A;  3PY8 A;  4O9M A;  4NM1 A;  3GQC A;  5KG4 A;  2H5X A;  2JZB A;  2BE3 A;  4B9M A;  4I2H A;  3UQ0 A;  4NLN A;  4AT8 B;  2FPK A;  4MF2 A;  1TK5 A;  3C23 A;  5DBA A;  1JX4 A;  2DPI A;  8ICI A;  1SL2 A;  5J2H A;  4KLU A;  2ZUD A;  3MR6 A;  2M2W A;  3MDA A;  4EBC A;  4FO6 A;  3WFO A;  3PX6 A;  1MSW D;  2UVU A;  4KLI A;  3RJI A;  4FBT A;  4UB2 A;  3EYZ A;  1U45 A;  2BQ3 A;  2C2D A;  3K75 D;  4PPX A;  4EP7 A;  4PHA A;  4ECR A;  1TVA A;  2R8K A;  1DK3 A;  1T8E A;  4B9V A;  5HRH A;  5EOZ A;  8ICJ A;  2HHP A;  3OUY B;  4IQU A;  4R65 A;  3LWM A;  1Q78 A;  5L9X A;  4F5Q A;  4WC3 A;  8ICE A;  2VA8 A;  8ICF A;  4P4P A;  3RRG A;  5KFE A;  5KFC A;  5DB9 A;  4Q45 A;  4P2H A;  8ICM A;  3MFH A;  4UAY A;  4QWA A;  1JN3 A;  2NRX A;  3SYZ A;  4QW8 A;  8ICZ A;  3BQ2 A;  3QZ7 A;  5J0X A;  2O1P A;  3H3A A;  5KT4 A;  5J0W A;  4QZH A;  4DS4 A;  4YCX A;  5DDM A;  2UVR A;  9ICF A;  3V72 A;  2ASD A;  3RJG A;  4KLF A;  8ICC A;  2Y1J A;  4F50 A;  5KG6 A;  5J0U A;  5KFZ A;  1XSN A;  5KT5 A;  1KEJ A;  5J2C A;  2ZHB A;  3RBE A;  4UQG A;  3GIM A;  3V6J A;  2PFO A;  7ICO A;  3OSN A;  9ICJ A;  5J2F A;  4EBJ A;  4UBB A;  4AT9 B;  1NK0 A;  1EXN A;  4UAZ A;  3GIK A;  3SV4 A;  5KFX A;  4ED0 A;  3BQ0 A;  5L1L A;  4DOB A;  4DFP A;  9ICM A;  1WCN A;  3K4G A;  5CR0 A;  2W9A A;  1ZQI A;  4IG8 A;  4QWD A;  1DOQ A;  7ICG A;  3EWA A;  3M8S A;  3HT3 A;  1V9P A;  4EYI B;  5HRE A;  1MQ2 A;  5KFU A;  4YMO A;  2VA2 A;  4S3N A;  2A1J A;  4I2G A;  1U47 A;  5J0Y A;  4GXK A;  4DSF A;  5DB7 A;  4M6W B;  1CEZ A;  1JMS A;  3N4M B;  9ICG A;  2DRB A;  4Q8E A;  9ICC A;  1XC9 A;  5KFA A;  5L1K A;  4RQ6 A;  1S0M A;  5DBB A;  1MQ3 A;  4TQS A;  4RT2 A;  1ZET A;  2NRT A;  3RB4 A;  3RJH A;  4E80 A;  4BDP A;  4MFA A;  4EEY A;  3GV7 B;  2DRA A;  2LYH A;  4M47 A;  4F4Y A;  3QZ8 A;  2XCA A;  1T7P A;  5J0R A;  5DG8 A;  2NRZ A;  3EPG A;  2NRW A;  2XY7 A;  3RH6 A;  1SKS A;  2ZUB A;  1UEV A;  4RQ8 A;  3H38 A;  2ISO A;  5J2B A;  3HPO A;  3OJS A;  4WCW A;  5EWF A;  1ZJM A;  1RXV A;  1ZQT A;  4JUZ A;  5J2E A;  4KIT B;  4XQ8 A;  4P4M A;  3TFR A;  1ZQQ A;  2BCS A;  4I27 A;  3MDC A;  1FA0 A;  2ZH1 A;  4I29 A;  5HP4 A;  4FHY A;  4YG2 A;  4YP3 A;  5KFH A;  5DB8 A;  4RQ3 A;  4YD2 A;  4RQ1 A;  2ZUC A;  1ARO P;  2HHU A;  2IBK A;  1XS9 D;  4YFK A;  1XWL A;  4DSK A;  4FHP A;  4X0A A;  3TAP A;  2JEJ A;  2W8K A;  4FBU A;  1TK8 A;  8ICO A;  3GIL A;  5DQG A;  9ICI A;  1JIH A;  4X0B A;  2HW3 A;  4NKU A;  1UA1 A;  5III A;  1OU5 A;  1ZYQ A;  2PFN A;  4X4V A;  2F1J A;  4EBE A;  4BXO A;  3ZD8 A;  1N48 A;  5HRL A;  4DQQ A;  2DVI A;  3Q8L A;  3MFI A;  1NK5 A;  4RQ4 A;  4F2R A;  1XO1 A;  2BDP A;  3N97 B;  7ICM A;  4FS1 A;  2RDI A;  3AUO A;  3TAR A;  1Z3E B;  1TV9 A;  1ZQN A;  5KFK A;  4M9G A;  3ZDE A;  5L1I A;  1KDH A;  4Z6F A;  4DL2 A;  7ICT A;  3QEA Z;  4XA5 A;  2AJQ A;  5DQH A;  1BNP A;  1MIW A;  3HJ1 A;  4EBK A;  7ICP A;  2HHQ A;  9ICW A;  4KLH A;  1BNO A;  3PR4 A;  5CJ7 A;  4DEZ A;  3JPT A;  3HJ4 A;  5KT3 A;  4J9K A;  2J6S A;  2ATL A;  2XO7 A;  4XRH A;  3SI8 A;  4O5E A;  1Y88 A;  2DR5 A;  2V4Q A;  4F4Z A;  9ICO A;  5KFN A;  2RFF A;  4UB1 A;  5KG2 A;  4M04 A;  3H4D A;  8ICT A;  5J2I A;  5BOL A;  3C5F A;  3OHA A;  1ZQH A;  2ZH8 A;  4Q44 A;  4GXI A;  2W8L A;  4WC1 A;  3HW8 A;  4DL7 A;  4QW9 A;  1ZQR A;  1L5U A;  5J2D A;  2BPC A;  3MR5 A;  1QLN A;  9ICR A;  1ZQW A;  4I2I A;  5KG3 A;  2KZZ A;  1JAJ A;  4R66 A;  1U9L A;  4QZ8 A;  1NKE A;  3QEB Z;  1S97 A;  1ZQG A;  4J9L A;  4C8O A;  5J0S A;  1KLN A;  4LZD A;  4EYH B;  5DB6 A;  1NK9 A;  4YD1 A;  4RWQ A;  2PFP A;  3OVA A;  3KTQ A;  4ED6 A;  4EZ6 A;  4WC7 A;  4J9O A;  1IM4 A;  4RQ0 A;  4JWN A;  5IIL A;  4ZH4 A;  2R8J A;  4I2E A;  4IQV A;  1NK4 A;  2ZH5 A;  4I2C A;  4RUA A;  4PH5 A;  1RYS A;  1KSP A;  1BPB A;  4BGD A;  1HUZ A;  4IQW A;  4C8K A;  2M9N A;  5J0T A;  2HHV A;  5CP2 A;  3LQC B;  3PW0 A;  3EW9 A;  3C66 A;  3BQ1 A;  2Y1I A;  2DR9 A;  4QZC A;  1NKB A;  4QWC A;  4UB4 A;  4O5C A;  1CUK A;  2RDJ A;  5J2A A;  1S9F A;  1LB2 B;  7ICS A;  4E8F A;  3HWT A;  7ICE A;  2R8G A;  2ZH2 A;  2BQR A;  1KTQ A;  2JEF A;  4YN4 A;  4GC6 A;  4X4R A;  2ZTC A;  1ZQB A;  3JYY A;  3ZDD A;  4FH5 A;  3FDS A;  9ICT A;  4F93 B;  4RQ5 A;  5HNK A;  1T3N A;  2FMP A;  4LT6 A;  5J29 A;  2BCQ A;  2DR7 A;  4F91 B;  2PXI A;  4ED7 A;  1NK8 A;  4KN4 A;  4F4K A;  8ICB A;  4F3O A;  5KFV A;  5KFD A;  3ISD A;  1DGS A;  5KFS A;  5L1J A;  4ECS A;  1MC8 A;  4ED1 A;  1L3V A;  5KFG A;  5TZV A;  3SV3 A;  4I2D A;  1TFW A;  4I2F A;  5KG5 A;  4IR9 A;  2ZJA A;  3GII A;  4O3R A;  3HIY A;  1ZQY A;  4M5D A;  3UQ2 A;  7ICJ A;  2AQ4 A;  1BPZ A;  4PHP A;  3B0X A;  2R8H A;  4DSJ A;  4KLL A;  4QZB A;  2C2R A;  9ICB A;  1UT8 A;  4J9Q A;  1D8L A;  3Q8K A;  4IQT A;  5DKW A;  1S0O A;  3ZD9 A;  1ZQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...