4MF8A

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ctp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
318
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 318
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf8A03
2M2WA 4J9SA 4PHDA 4RQ7A 1BPXA 4DS4A 4DSFA 1CEZA 2KP7A 3HT3A 3H8JA 5HHIA 4C8MA 2JEJA 1JAJA 2RFFA 4DO9A 4JWMA 1RXWA 1RXVA 2DVIA 3BJYA 1NK8A 4DL4A 4ED0A 3M8RA 1L3TA 4UAWA 4DL3A 1KEJA 1S0NA 2J6SA 1UA0A 4XRHA 3H37A 4M9JA 1T8EA 7ICPA 1ZQEA 3PW4A 5KFQA 1RYRA 1DK2A 5KFJA 1TK5A 5J2IA 4QZFA 3M9NB 4RQ5A 1NO5A 4M5DA 4J9LA 1S9FA 2PFOA 4YP3A 4YMMA 4JV1A 4IR9A 2OWOA 7ICOA 8ICQA 4J9NA 2WTFA 5CA7A 4RNNA 1U45A 1Q79A 3MBYA 4MFFA 3PW0A 3JPSA 4PHAA 2ZH5A 2MUTB 5KFHA 4DQSA 2VA8A 4AT8B 4DOAA 1MIYA 2VA3A 4ECRA 5L1JA 3H38A 4F5OA 4J9QA 4ECQA 4KLTA 5KG4A 1NKBA 4KLFA 5DEDA 5J0WA 2FPMA 5KG6A 5IIIA 4M2YA 5KFTA 5JUMA 2HHVA 4QW8A 2AU0A 1H38A 9ICWA 2ISOA 4WC5A 2DRAA 4FBTA 3JPOA 5CJ7A 2FMPA 4F4ZA 5KFMA 2A1JB 4UBBA 1ZQAA 2W9AA 4EBJA 3IM1A 1QLNA 1U49A 4KLHA 1NK6A 2JEFA 4X4OA 1UT8A 4ED2A 5EWEA 3KTQA 4F92B 4I2IA 1SKRA 8ICGA 5KT2A 4BXOB 5DQGA 5KFWA 5KFGA 5KFAA 4KN7A 2AQ0A 1KDHA 4QWDA 3GIIA 3PW7A 1ZETA 4KLLA 3KHGA 4FBUA 2R8KA 5DG7A 2NRKA 2JZBA 1TK8A 3MR5A 1D9FA 5HRGA 3SV3A 3KHRA 3KHLA 3Q8KA 1A76A 4QZHA 4ECVA 3RJFA 4QWEA 1KTQA 1S97A 3V7LA 5DBAA 2ISPA 3OVBA 4MF2A 3OUYA 2KFZA 3ORYA 4IQWA 7ICIA 1R8AA 5KG3A 2FLLA 2M2VA 4NLNA 3OVSA 3ISBA 4FH3A 4LT6A 4P2HA 2UVUA 2DPJA 3UXNA 5KFZA 4X4TA 2XCPA 3ZDDA 5HRLA 3T5JA 2DFLA 4DFMA 4YR0A 3JPQA 2V4RA 5KFIA 8ICWA 5J2KA 1MSWD 3MR6A 4I2GA 9ICHA 4RPZA 2BGWA 2FMSA 3HIYA 5J0OA 1Q78A 7ICMA 3Q8PB 5DDMA 5EWGA 3T3FA 1QSLA 3C1ZA 2XGQA 1ZQNA 7ICKA 4PHPA 4BXOA 2M2TA 5HRKA 2HHQA 2W9MA 4F2SA 2V4QA 3GIMA 5KFRA 4KLIA 1MQ2A 3PO4A 4B9MA 2KZMA 1XWLA 5HHHA 2F1HA 5DGBA 3H40A 5J2GA 5J0PA 5J0YA 2IHNA 2O1PA 3PMNA 1NKEA 1MQ3A 1TV9A 2W9CB 2IMWP 1HUZA 1R8BA 4X4RA 2RDJA 1OU5A 4QW9A 4FO6A 4E7XA 3OSNA 8ICJA 9ICUA 3V7KA 1DOQA 3N97B 1NK5A 1VJ7A 4YQWA 4Q8FA 1U9LA 4S3NA 1D9DA 4ED7A 4I28A 4J9KA 5HREA 3OJUA 4ATBA 4CCHA 4YG2A 3C1YA 2UVWA 2P6RA 7ICFA 4F50A 2XY5A 4WC4A 3JZ0A 4XQ7A 3C23A 4RWQA 1JXEA 3MGIA 5F2VO 3UQ0A 4RWNA 3HJ1A 5KFNA 3ISDA 4O3NA 1ZQBA 2BQ3A 2BPFA 2ZJAA 3RJHA 4XQ8A 4ECSA 4I2BA 4WC2A 3V7JA 5J0UA 3RJGA 4MFCA 3PW2A 3AU6A 2C2DA 3TARA 4I2JA 1U48A 4ELUA 2W8KA 4ED6A 3ISCA 2AGOA 2W9BB 1XSLA 1KLNA 1SL2A 2ZH3A 4ECUA 4P4PA 2XY7A 3EPGA 2PFNA 3RR7A 2ZH2A 5KFPA 1V9PA 2W9CA 3PY8A 1PZNA 5L9XA 8ICVA 9ICIA 1DK3A 5IILA 4QZBA 4YR2A 2PFQA 1ZQUA 4ELVA 3AU2A 3GV5B 1SL0A 3PNCA 1S0MA 7ICJA 4DS5A 3JPNA 1BPYA 3AQLA 2DR8A 3NYBA 4DFJA 5J2DA 2NRZA 4ATBB 1IXRA 4C8NA 5DKWA 2I9GA 4E8FA 3IHQB 7ICLA 4O0IA 3Q8QB 2ASJA 1V4AA 1K1SA 3OHBA 3MR2A 3BQ0A 2Y1JA 3H8WA 1UETA 1XO1A 2AGPA 4X0AA 4F4WA 2C22A 3WFQE 3K75D 3TI0A 3RRGA 4EZ6A 1TAQA 3C18A 1L5UA 4RZRA 1SZPA 4LZDA 3RBEA 1ZQJA 1JQRA 4RT3A 1MIWA 4GXKA 1TAUA 2NRWA 4I29A 5J0SA 1F5AA 1BPDA 2DRBA 4PH5A 5KTQA 3PR5B 8ICKA 3G6YA 5D4BA 4DF4A 5KFVA 1ZJNA 1MIVA 5DLGA 8ICEA 7ICUA 5IIKA 2J6UA 1R8CA 5IIJA 5KG5A 4NLGA 8ICSA 5DLFA 1RPLA 3T5HA 3V6KA 3LQCB 1L3UA 2XGPA 3HPOA 3JPTA 3WFOA 4IG8A 5KT5A 4LZGA 4RNMA 1RYSA 3EZ5A 9ICRA 2FPLA 4O3OA 4ED1A 3MGHA 9ICXA 2BR0A 3RJEA 3HW8A 4M9HA 1WCLA 5DG9A 3UXPA 2MAXA 4WC6A 3EYZA 5KFSA 3MDAA 4AT7A 2ASDA 3H4BA 9ICBA 5DECA 5KFLA 1LB2B 3GILA 5L1KA 5J2CA 4X5VA 4I2FA 4JV0A 1XSPA 4J9PA 4QZCA 4M6WA 2IA6A 4DFPA 4DL6A 2XY6A 1B43A 5KT7A 4NM2A 2PBEA 8ICIA 2HHSA 1ZQDA 4WBZA 5HMLA 4X4NA 5KFBA 1SKWA 4KN4A 1XC9A 2DR9A 2Q66A 3TFSA 1ZQVA 2XO7A 4MFAA 4O5CA 1NK4A 9ICLA 1S77D 4EYHB 2JZBB 3AQMA 4Q8EA 1CUKA 4J9RA 3NTUA 3RTVA 4F4KA 4BDPA 1Z00B 1JXLA 3MFIA 7ICRA 4QWBA 1X9MA 3AQNA 3Q8LA 4YD2A 5J0QA 4KITB 2HHXA 2HHWA 1XU4A 3C5FA 3TQ1A 3RH4A 1U47A 3NGDA 2P66A 3FDSA 8ICXA 1BPBA 5DB7A 2GWSA 2PXIA 3OHAA 4UBCA 2M9NA 1KRPA 3RJJA 4WCWA 2Y1IA 3SV4A 4X4QA 4RWOA 5DBCA 5IIOA 4M9GA 3GDXA 3B0XA 4QZGA 4WC0A 3OJSA 2ZHBA 3PX4A 1QSYA 9ICEA 4WC3A 3WFSC 5DQHA 4EZ9A 1L3SA 3UXOA 4QZ8A 3QEBZ 2ZTCA 4EBDA 4F5RA 3L9DA 4GC6A 4DF8A 9ICTA 4KLDA 1UEUA 5KG7A 5HRFA 5J2FA 4MF8A 4K4GA 4ECTA 2C28A 5HR9A 4KLOA 4B9TA 1B22A 4IQVA 5HRHA 1L3VA 4I2EA 4PHEA 2FLPA 3H8SA 1ZQCA 3H39A 3B0YA 4YFKA 2KTQA 4ECWA 4PGYA 4RU9A 3C66A 4NXZA 2AQ4A 2C2RA 1X9SA 4F91B 1QSSA 9ICAA 3ZDEA 4RUAA 1ZQTA 1JX4A 1COOA 9ICMA 4ZH4A 4XUSA 4UB3A 3PO5A 4DL5A 4R64A 4QZIA 3PR4A 1JN3A 4ECYA 2HHTA 4FHYA 1TFWA 1D8LA 4YMNA 5F9NA 5KFFA 4RUCA 3ETLA 4DOCA 1ZJMA 8ICLA 4I2CA 2JEGA 3OSPA 1ZQMA 4M9NA 1NKCA 3TANA 1UEVA 3PX6A 1T7PA 1IM4A 5J0TA 8ICBA 3Q8SB 3PVXA 4UAYA 2R8GA 4NLKA 4BWMA 8ICHA 1FA0A 5KFXA 4YXJA 3H3AA 2O5AA 4M6WB 4RNOA 2BKEA 5J2HA 4UB4A 4C8KA 4EP7A 3K4GA 3RB4A 4C8OA 4RQ0A 2IBKA 3ZD8A 3HX0A 3Q8RB 5DB6A 3C21A 3ZDAA 2RDIA 5L1IA 4B9VA 4K4IA 9ICPA 5DDYA 4RPXA 3SI8A 1KFTA 3PX0A 3OUYB 4KLJA 1S10A 4F2RA 2LYHA 1N56A 2VANA 3G6VA 1T3NA 3RB3A 8ICZA 5KT6A 4J9MA 5DGAA 4FHVA 2ZH7A 4JV2A 4YVZA 1Z00A 1ZQXA 4I27A 4M04A 4O9MA 3AQKA 4F3OA 2XCAA 2FPKA 5DQIA 2IHMA 2KN7A 2ATLA 1ZQSA 1ZQWA 1UA1A 4DSJA 4TQSA 2ZH9A 1S0VA 5KFYA 2BHNA 3M9MB 4EBKA 3RR8A 1BVSA 2BCQA 5CHGA 4DOBA 2R8HA 3TFRA 1NK7A 1ZQRA 4RQ2A 4KLSA 2BPCA 4AT9A 4WC7A 4I2DA 3QZ7A 1KFDA 4M47A 9ICOA 4RWPA 4Z6DA 3LWLA 4F4YA 2ZJ5A 4UB5A 5J0XA 5KFCA 1ZQLA 4KTQA 2M2UA 7ICEA 4ECZA 1NOMA 4Z6FA 2BQUA 1ZQHA 3RJIA 4MEYA 1TKDA 2HHUA 8ICMA 1KNYA 3SYZA 2HVHA 5KFUA 4GLXA 5BPCA 4ED8A 3HP6A 1ZQZA 4B9UA 2ZH4A 4R63A 2DPIA 4QZEA 3TAQA 4NM1A 1ZQYA 3ZD9A 1HJPA 3C2LA 4WBYA 1VFGA 1WCNA 1NJWA 4AT8A 4RQ3A 2BCSA 2FMQA 4Q44A 5J2EA 5L1LA 3QEAZ 4PPXA 5HC9A 3UPSA 4I2AA 3BQ2A 3V6HA 1MC8A 4QZDA 2B21A 3PMLA 4YN4A 4GC7A 5D46A 4DLGA 4DL7A 4IR1A 1BGXT 3E2EA 5HRDA 4B9NA 1Y88A 3GFKB 3H7IA 3UPQA 8ICPA 4F5NA 7ICNA 5BOLA 2DR5A 3EPIA 4YMOA 4DFKA 1SL1A 3C2MA 2AJQA 2NRTA 4KLUA 4P4OA 4UB1A 4FS1A 8ICFA 2V9WA 3MR3A 3BDPA 1S76D 2ZUBA 4BGDA 3BQTA 4TURA 4R66A 3GIKA 9ICGA 3V6JA 2Q0ZX 3HWTA 4F5QA 5KG0A 1TVAA 4B9LA 7ICTA 5BOMA 4F8RA 2PI5A 4F4XA 4XA5A 4FHXA 4X4VA 4Q45A 8ICRA 4NKTA 4BWJA 4IRKA 9ICFA 4E80A 1X2IA 3ZDCA 5KFDA 3PV8A 4B9SA 4UD5A 5CR0A 4MEXA 4JWNA 5J2AA 8ICOA 4IRDA 3WFPA 3OVAA 2ZH6A 1K1QA 7ICSA 2MUTA 5KT3A 2P6UA 4NY8A 3WFRE 7ICHA 3LK9A 4KLQA 2ZJ8A 2F1JA 4F5PA 1BNPA 2ZH1A 4TQRA 4F93B 1NZPA 8ICYA 2FLNA 2C2EA 2AGQA 5KFOA 4GXJA 3MDCA 3M9OB 3C5GA 1NJXA 1Z3EB 5TZVA 4ELTA 4RQ8A 3C2KA 1ZQFA 1A77A 4O3SA 2KZZA 9ICNA 4GXIA 4KLEA 4DQRA 1ZQKA 2BPGA 2ZUCA 3RJKA 7ICVA 4AT7B 3GV7B 4TUQA 3AUOA 2A1JA 5KG2A 4RQ4A 5EOZA 3LWMA 5KFEA 4YD1A 4X4PA 2HVIA 2BCRA 4QZAA 3JPPA 3THVA 4ED3A 4QWAA 9ICQA 1PX5A 5KT4A 4RQ6A 5F9LA 1UT5A 4KLGA 4PGQA 8ICAA 4FHPA 2UVVA 1ZQIA 4DSKA 4WC1A 5CP2A 3G6XA 3TAPA 4EBCA 4EBEA 1QTMA 5J2BA 3RH5A 1SKSA 4DL2A 4DQQA 4EYIB 2ZTEA 4RPYA 3Q8MA 2F1IA 2ZTDA 3LDAA 1X9WA 1NK9A 2NRXA 7ICQA 2H5XA 3V72A 4TUSA 5DB9A 4X4UA 2BQRA 5HRIA 4QZ9A 1BPEA 4UB2A 4DSEA 1BNOA 3OV7A 8ICUA 3GV8B 4I2HA 4DLEA 2UVRA 1S0OA 3MFHA 4YR3A 5IIMA 4X0BA 2ZHAA 4DSLA 4TUPA 3KHHA 3EW9A 3BQ1A 4R65A 4DQPA 1XSNA 2BE3A 4Z6EA 1XS9D 4NLZA 4X4SA 5D49A 3RB6A 2KFNA 9ICJA 5KFKA 4K4HA 1TFYA 4DQIA 4E0DA 4O5EA 1NJYA 1BPZA 4YCXA 4R8UB 3T5LA 4P4MA 3T5KA 2ZUDA 8ICTA 1TFRA 1HUOA 4RQ1A 2BCUA 2R8JA 1LV5A 2PFPA 5DB8A 3PW5A 4O3QA 7ICGA 5DBBA 5DG8A 5J0RA 2JEIA 1U4BA 1DGSA 1ZQPA 2PI4A 4RT2A 4NKUA 2BDPA 4IRCA 4IQTA 3SZ2A 4UQGA 2VA2A 1YLQA 4DWIA 1NJZA 2J6TA 4Q43A 5CWRA 1RZTA 1ZYQA 8ICNA 2HW3A 9ICKA 3HJ4A 4KMUA 3UQ2A 2I1QA 5KG1A 2KZ3A 3GIJA 3ZDBA 8ICCA 3QZ8A 4M0AA 5HRBA 2W9BA 4JK1A 2XC9A 2ZH8A 4C8LA 1R89A 2ALZA 4IQUA 5CB1A 4QWCA 3QE9Y 4J9OA 2HHPA 4Z6CA 5EWFA 3JYYA 1ZQQA 4AT9B 4LVSA 4FS2A 1ZQOA 2NRVA 4DEZA 3MABA 4HYKA 5C5JA 9ICVA 2DR7A 3GQCA 1NK0A 1T4GA 1N48A 4O3RA 4R8UA 1D8YA 3H4DA 4ECXA 2BCVA 5IINA 3RBDA 4FH5A 1WOTA 4O3PA 4PGXA 4UD4A 5HNKA 3RRHA 3RAXA 2W8LA 4JUZA 4EEYA 3N4MB 3RAQA 1TK0A 1C7YA 1KFSA 3RB0A 3M8SA 3RH6A 1EXNA 5J29A 1ZQGA 2R8IA 4FHWA 3EWAA 5J2JA 4UAZA 1KSPA 4DSIA 4KLMA 9ICSA 2ID1A 9ICCA 1AROP 2ASLA 4M9LA 4YXMA 5HMMA 1JIHA 3OGUA 4O5KA 3FYHA 5HP4A 3JPRA 4G3IA 1JMSA
chains in the Genus database with same CATH superfamily
4HX0A 2E8PA 4J9SA 1CEZA 3HT3A 4Y2JA 3CRXA 1JAJA 2DVIA 5TISU 5ALUA 2B4VA 4DL4A 5G5HA 2K4EA 4UAWA 4DL3A 4MHVA 1UA0A 4XRHA 3H37A 4IL6U 1T8EA 2CXYA 1K5OA 4J9LA 1S9FA 4JV1A 2ZIVB 3F2DA 5AKLA 4RNNA 3MBYA 3PW0A 4PHAA 2ZH5A 4DQSA 3KZIU 5ALMA 5KG6A 5JUMA 1H38A 2K4HA 3JPOA 4FBTA 1COKA 5KFMA 4EBJA 1NZBA 1U49A 2K8AA 5D62A 3A0HU 4J03A 4BXOB 1Z4OA 5KFWA 2EZXA 5KFAA 4KN7A 4OAHA 5ALGA 2YY6A 5CFTA 4Y2QA 4FBUA 2R8KA 5DG7A 1M6YA 1TK8A 2W11A 1S97A 3V7LA 2ISPA 3OVBA 4MF2A 3OUYA 1R8AA 3ORYA 4IQWA 1KL9A 2M2VA 4NLNA 3TADA 3ISBA 4PZNA 2M0NA 3T5JA 2ZIWA 4DCCA 5KAIU 4OJ5A 5KFIA 2NYVA 5J2KA 3QUQA 3JPQA 8ICWA 5CFUA 4G9BA 3MR6A 9ICHA 3PHZA 4RPZA 3HIYA 2Q4TA 1Q78A 7ICMA 3T3FA 5EWGA 2WF5A 1QSLA 3QU5A 3SAFA 1ZQNA 4PHPA 2EANA 5AKYA 3GIMA 3PO4A 5DGBA 2IHNA 2O1PA 2W9CB 2MSNA 2RDJA 2P35A 4QW9A 4FO6A 9ICUA 1NK5A 1DOQA 2LMRA 4Q8FA 5E79U 3DDHA 2YMQA 4DFDA 3VCBA 5HREA 4ATBA 3C1YA 4XQ7A 3N7SC 3M1YA 3MGIA 1JROA 4I2BA 4XQ8A 2AH5A 4MFCA 3BZKA 4I2JA 1U48A 4ELUA 1QQ6A 2KKPA 1SL2A 2LKYA 3OUYB 2W9CA 4YR2A 4OO1J 1S0MA 7ICJA 2ZXIA 3AQEA 5J2DA 4DFJA 3NASA 4CF4A 1IXRA 3M6ZA 3UMCA 2EAMA 2I9GA 1XO0A 7ICLA 1SWVA 2ASJA 3BQ0A 1WUDA 3H8WA 3TI0A 4F72A 1JRPA 2DKZA 1SZPA 4RT3A 1MIWA 5AI0A 1PK1B 3B9JA 3HKZF 2DRBA 2DGZA 5D4BA 1ZJNA 5DLGA 7ICUA 3ETRA 1R8CA 2ZIUB 5IIJA 4CGZA 3NVZA 8ICSA 1RPLA 3T5HA 3IP4B 3HPOA 5KT5A 3A0BU 1XNSA 2EH9A 1L6NA 4JLZA 2IHOA 2FPLA 2YMLA 3HW8A 4WC6A 3EYZA 4FZNA 3ALRA 5J2CA 1Q3UA 4JV0A 1XSPA 4QZCA 2NO4A 4M6WA 5AHXA 4DFPA 2IA6A 2HOFA 8ICIA 1SKWA 2OHFA 3E0FA 3TFSA 2XO7A 9ICLA 2ZIUA 1CUKA 3K1ZA 3NTUA 1Z00B 2WAQF 7ICRA 2GLEA 2HHXA 1U47A 1VLBA 3FDSA 2PXIA 3RJJA 4WCWA 3BZCA 3SV4A 4RWOA 5IIOA 2HOIA 4WQLA 1SV0A 3PX4A 3QEBZ 4QZ8A 4GC6A 9ICTA 1UEUA 2QB1A 2DBYA 5J2FA 4K4GA 4ECTA 1B22A 4B9TA 5HRHA 4I2EA 2KJ9A 2G09A 1ZQCA 3H39A 4YFKA 4PZOA 4PL1A 5D63A 2XIDA 4PGYA 2ZIVA 4F91B 9ICMA 9ICAA 2F8LA 4XUSA 3PO5A 4DL5A 5EE9A 3PR4A 1JN3A 4YMNA 1ZJMA 8ICLA 2E3TA 1J2MA 4CF5A 1RDFA 1GO3F 8ICBA 3PVXA 2R8GA 2W03A 1X6IA 4NLKA 4BWMA 8ICHA 1FA0A 2K8CB 1A0PA 4OAGA 2KICA 3ZDAA 2M2WA 2E5SA 4U7CA 3G6VA 3MC1A 1T3NA 2Y9UA 2ES6A 5KNIA 2EAOA 4J9MA 4YVZA 4I27A 1SWWA 4DSJA 1ZQWA 5AM1A 1UA1A 4TQSA 3QUBA 5KFYA 2BHNA 4EBKA 2BCQA 3F5EA 1NK7A 1ZQRA 3LVWA 3MCRA 4WC7A 4M47A 2ZJ5A 4UB5A 1ZQLA 1DGJA 4Z6FA 2FJ6A 3I76A 3RJIA 1KNYA 2H3QA 1RYUA 3UMBA 1ZQZA 2ZH4A 3S6JA 4QZEA 1ZQYA 4EELA 1VFGA 1WCNA 2ODGA 3E58A 4RQ3A 2BCSA 4Q44A 5L1LA 2KK0A 2NO5A 4QZDA 4IR1A 3ZI4A 4C7YA 5D46A 3UPQA 1Y88A 3H7IA 4P4OA 2V9WA 3WK9A 1S76D 2ZUBA 4BGDA 3BQTA 9ICGA 5KG0A 4Q45A 8ICRA 9ICFA 1X2IA 3ICXA 2QKQA 4UB8U 4MEXA 8ICOA 3WFRE 2VIXA 5KT3A 2P6UA 4NY8A 7ICHA 3LK9A 2ZJ8A 5KFOA 3M9OB 4ELTA 1ZQFA 3C2KA 9ICNA 2KZZA 3SENA 1SV0C 3GV7B 5KG2A 4RQ4A 2XI9A 3IG8A 4NLBA 4X4PA 5AI8A 4ED3A 1HEKA 2G06A 5F9LA 8ICAA 4PGQA 1YT3A 2UVVA 1YZ6A 4EEBA 1LKYA 2D8CA 4RPYA 1NK9A 1RQLA 1Q46A 4TUSA 1TAMA 5DB9A 2BQRA 1BNOA 2JXJA 2PMZC 2HN2A 4TUPA 4DQPA 3RB6A 2KFNA 4UAVA 4RQNA 5JRTA 1N5XA 3T5LA 3T5KA 3AQFA 4NL9A 2BCUA 1LV5A 2PFPA 3PW5A 5DG8A 1DGSA 4AP9A 4RT2A 2PI4A 2BDPA 4IRCA 1RG6A 2QLTA 5EE3A 1ZYQA 2HW3A 1MN8A 5ALTA 5HRBA 4JK1A 3UMGA 2ZH8A 1KW4A 5CB1A 4AT9B 3JYYA 4HYKA 2DR7A 1ZD5A 1N48A 4FO1A 2ZIWB 3H4DA 3NVYA 3RRHA 3N4MB 4EEYA 4NXXA 3IV6A 1KFSA 1KSPA 9ICSA 4OAFA 2DF4B 1AROP 2EWRA 4YXMA 2G08A 1O08A 3D2SA 4O5KA 5HP4A 1BNPA 1ZD4A 4G3IA 1UPHA 4PHDA 3NVWA 4RQ7A 4DSFA 1Z4NA 3L3FX 3WK8A 3SAHA 1NI3A 5HHIA 3IRUA 2RFFA 4DO9A 4JWMA 1NK8A 2L5YA 3M8RA 1L3TA 4O67A 1S0NA 3QU4A 4Y2XA 4M9JA 7ICPA 5KFQA 1NO5A 2WHEA 1ZQ1C 5J2IA 4QZFA 3M9NB 4RQ5A 4M5DA 3IN5A 2W54A 2OWOA 2WTFA 5CA7A 2EAPA 4MFFA 2MUTB 4DOAA 4ECRA 5L1JA 4UW9A 4KLTA 2Y0SF 2F76X 2YN4A 5KG4A 1NKBA 5J0WA 3TACB 5IIIA 3C28A 2KG5A 5KFTA 2DRAA 1X9XA 5CJ7A 5AKIA 2G0AA 4I0UA 4F4ZA 2A1JB 4UBBA 3IM1A 1QLNA 1NK6A 2JEFA 1UT8A 4CF3A 5EWEA 3KTQA 4I2IA 1VJ5A 5KT2A 5DQGA 1KDHA 1ZETA 3KHGA 3BQ7A 1CI4A 2JZBA 5HRGA 3SV3A 1FEZA 3KHRA 3RJFA 4QZHA 4QWEA 5DBAA 3NUQA 3UXNA 3WKBA 4OCZA 3PSFA 4US8A 3PZPA 2FMSA 2BGWA 2LM4A 2YMMA 4KX3A 2LPEA 7ICKA 1D8BA 5HRKA 3LYSA 2W9MA 4KLIA 2PKEA 2KZMA 1ED1A 1L8LA 5J2GA 4BX9C 4X4RA 5J8YC 8ICJA 3V7KA 1VJ7A 1D9DA 4ED7A 4I28A 3TADC 4CCHA 4WC4A 5JTGA 2P6RA 3JZ0A 1X40A 1JXEA 1QQ5A 3SEIA 5KFNA 3ISDA 4WC2A 3RJGA 3ONNA 5AKZA 3PW2A 3TARA 2H3ZA 4NLCA 2W8KA 3H8MA 2W9BB 2AGOA 1KLNA 1PK1A 3K7DA 2ZH2A 5KFPA 3PY8A 3LQCB 2DL0A 2E8OA 4ELVA 3AU2A 3GV5B 1SL0A 4DS5A 1BPYA 2DR8A 3NYBA 3WK7A 2F3NA 3K1RB 1SZHA 3O0FA 4OJPA 5DKWA 4O0IA 1K1SA 2Y1JA 4AYBF 1L5UA 4RZRA 1JQRA 4LZDA 1ZQJA 4GXKA 4I29A 2KSOA 2IUBA 5J0SA 1F5AA 3ER9B 3NWIA 4PH5A 8ICKA 1MIVA 3QU2A 5KFVA 4UARA 4LEZA 3V6KA 4IG8A 4RNMA 2KE7A 1RYSA 3EZ5A 1ZOLA 3QUTA 1QQ7A 2KKVA 3RJEA 1OW5A 2W7PA 3UXPA 1A6SA 4AT7A 4EX7A 5T14A 2E1EA 9ICBA 3GILA 4X5VA 2WAQC 4DL6A 4RQMA 1B43A 4PL2A 5ALRA 4NM2A 2HMXA 2HHSA 1ZQDA 4WBZA 3BS5A 5KFBA 2Q66A 4O5CA 2OXOA 2LYAA 4LJXA 1S77D 1N62A 3BS7A 1ZD3A 3RTVA 4F4KA 4BDPA 4NXVA 1SXDA 3MFIA 4YD2A 4NXTA 2HHWA 2DUYA 3C5FA 2P66A 8ICXA 4FFDA 4KB6A 3OHAA 1KRPA 2M9NA 5ALPA 5DBCA 4M9GA 2Z7JA 4WC0A 4WC3A 2RRDA 4GFJA 3WFSC 3PSIA 2D6FC 3LVVA 3F2CA 4FHYA 4K9BA 2ZTCA 2I6XA 5HRFA 2C28A 1X42A 4KLOA 4FE3A 4IQVA 1C20A 2FLPA 3B0YA 3KBBA 2KTQA 3NVOA 3C66A 4NXZA 1X9SA 4RUAA 1COOA 4ZH4A 2QARB 4UB3A 3CP8A 2W55A 4R64A 4QZIA 4ECYA 1TFWA 1D8LA 4RUCA 3ETLA 1FIQA 5L1MA 2FDRA 1UEVA 1T7PA 1QH9A 3Q8SB 4WH5A 3BS5B 4YXJA 1T3QA 2O5AA 4BJQA 5ALYA 4RNOA 5J2HA 2OM6A 4RQ0A 4O69A 9ICPA 3C21A 4B9VA 5DDYA 4RPXA 1KFTA 4KLJA 1JI7A 2VANA 1N56A 8ICZA 5KT6A 4F71A 2ZH7A 2JH7A 2HN1A 3AN1A 2ZH9A 2GA9D 3SAGA 3RR8A 5CHGA 1ZRNA 4KLSA 3NS1A 2GO7A 3QZ7A 9ICOA 4RWPA 2W3SA 4C4SA 3LWLA 1B0XA 2MA1A 1PVQA 1SV4A 4ECZA 3SYZA 2HVHA 2IOFA 2JMGA 3HP6A 4R63A 2DPIA 2H3IA 2G5IB 4WBYA 1HJPA 3CW2C 2ZXHA 1NJWA 4PPXA 2EDUA 3V6HA 4K96A 4YN4A 4GC7A 3E2EA 4KM5A 8ICPA 3GFKB 7ICNA 5BOLA 3EPIA 4YMOA 3C2MA 2AJQA 5AK3A 1URJA 4N7RA 4CE6A 3V6JA 2Q0ZX 3HWTA 4F5QA 3KFUF 7ICTA 4Y2VA 2PI5A 2AHOB 2AXTU 4HAIA 4X4VA 3EUB2 5AM5A 5AIAA 1X66A 4IRKA 1N5WA 5KFDA 5HR7A 5CR0A 1P7DA 4JWNA 3WFPA 2ZH6A 7ICSA 2K8BB 2ZH1A 4F5PA 2FLNA 4GXJA 5TZVA 4OJOA 1A77A 1Q3VA 1HIWA 4TUQA 4QIWC 5KFEA 4YD1A 2HVIA 3JPPA 3THVA 2BBJA 1PX5A 5KT4A 2HBMA 4RQ6A 1UT5A 1UCVA 4FHPA 1ZQIA 3G6XA 4EBEA 1QTMA 5J2BA 1SKSA 4EYIB 2KV2A 2F1IA 2F8KA 3QYPA 7ICQA 1KQQA 3QUCA 4DSEA 2UVRA 2QARA 2ZHAA 5IIMA 4X0BA 4DSLA 3KHHA 4X4SA 1XS9D 1KN5A 5KFKA 4K4HA 4CDGA 4R8UB 2ZUDA 8ICTA 1HUOA 4RQ1A 2R8JA 3AMZA 4Y2TA 3WK6A 4LEWA 2CPRA 3KOOA 4IQTA 2VA2A 4UQGA 1YLQA 5K4LA 4EX6A 5CWRA 2KZ3A 4M0AA 2XC9A 4C8LA 1R89A 5J8YA 2JGAA 4FZLA 4C4TA 3F5AA 4QWCA 4J9OA 5EWFA 1ZQQA 3H0RB 4EEKA 2NRVA 4OD0A 2GOLA 3GQCA 1T4GA 4R8UA 4FH5A 3KKAC 2KSOB 4O3PA 4UD4A 2W8LA 3RAQA 3FM9A 1TK0A 3RB0A 5J29A 2R8IA 3EWAA 2KVCA 2QB0A 1DRGA 2MRLA 1JIHA 4US9A 4K99A 3FYHA 4NJ8A 2G07A 2KMDA 4OAIZ 3H8JA 2JEJA 2CRXA 2I5HA 3T79A 3BJYA 3N28A 4ED0A 4WOYA 4AYBC 2HBLA 1TK5A 4YP3A 4IR9A 3H0LB 4J9NA 2R18A 5ALFA 1J97A 5KFHA 2EZYA 4AT8B 1Z1BA 2VA3A 2HSZA 2FPMA 5AI4A 2W9AA 4KLHA 4X4OA 4ED2A 1SKRA 4QWDA 4KLLA 2NRKA 3AM9A 3OPXA 3MR5A 3PSPA 3KHLA 3R9KA 4NXUA 2KFZA 5KG3A 2FLLA 3OVSA 4FH3A 4LT6A 2KIVA 4X4TA 2B51A 2Y9TA 2XCPA 5HRLA 2W04A 4DFMA 2DFLA 4YR0A 3WK5A 2V4RA 2JH1A 3JCFA 5DDMA 2IOHA 4F2SA 2V4QA 1OU5A 5KFRA 5HHHA 5AK5A 5ALDA 5J0PA 3PMNA 1MQ3A 1TV9A 4UASA 5ALHA 1L7PA 3OSNA 1IG6A 4YQWA 3HRDD 1U9LA 1IV8A 1PK3A 5ALSA 4J9KA 5AKXA 3SQIA 7ICFA 1YZ7A 3C23A 5KL8B 5AM3A 4RWQA 5F2VO 3HJ1A 4O3NA 2BQ3A 4ECSA 3V7JA 1L8OA 3D2QA 3AU6A 2C2DA 2ZIXB 4JB3A 3ISCA 1XSLA 1KKXA 4P4PA 2XY7A 4LEYA 1ZRMA 1F5SA 1V9PA 1DK3A 9ICIA 2K60A 4QZBA 2PFQA 2E1FA 5G5GA 2GAFD 3AQLA 2PMZF 2NRZA 4ATBB 3I1YA 3IHQB 1N61A 5C0YA 3Q8QB 1V4AA 5ALXA 5F3XB 3WKEA 1XO1A 3WFQE 3RRGA 4EZ6A 1F44A 2DWQA 3C18A 3CK6A 1TAUA 4NXWA 5AI5A 1BPDA 5ALJA 1SIJA 4DF4A 5EE1A 8ICEA 5IIKA 1NNLA 2KIWA 2J6UA 1N63A 1L7NA 5GTHU 4NLGA 3D2NA 3L5KA 2XGPA 3WFOA 4LZGA 2G5HB 9ICRA 2EQYA 3MGHA 4C7ZA 4ED1A 9ICXA 2BR0A 5B3QA 2MAXA 3H0MB 5AI9A 3MDAA 2VJ4A 2ASDA 3HILA 5DECA 3SD7A 5KAFU 2XY6A 5KT7A 2PBEA 1ZD2P 2B0CA 2VJ5A 1XC9A 1S8OA 1NK4A 3AQMA 4Q8EA 4K98A 3PSTA 1X9MA 5ALNA 3Q8LA 5AICA 1IIPA 1XU4A 5AK4A 3RH4A 3NGDA 5DB7A 2GWSA 4UBCA 2Y1IA 4X4QA 3RF9A 3B0XA 4QZGA 2ZHBA 1QSYA 9ICEA 5DQHA 4EZ9A 1L3SA 3UXOA 3L9DA 4DF8A 4KLDA 5KG7A 2ZG6A 1L3VA 4PHEA 3H8SA 1V38A 4RU9A 2AQ4A 2A1AA 2C2RA 3ZDEA 1ZQTA 5ALKA 2HHTA 5KFFA 4DOCA 3CYMA 4I2CA 3OSPA 4M9NA 1SB3C 3PX6A 2ESEA 4K97A 2JR5A 2Y0SC 3NRWA 4M6WB 2BKEA 2RHFA 4EP7A 3RB4A 2IBKA 3HX0A 4K4IA 5L1IA 3SI8A 3HKZC 4F2RA 1S5LU 2KNJA 2DQNB 4FHVA 4O9MA 5AK6A 5KL1B 2ATLA 1ZQSA 2IHMA 2OH2A 3M9MB 1BVSA 1DXSA 4DOBA 3TFRA 2HBKA 4RQ2A 2YB4A 1FFVA 1KFDA 4EGWA 1GPJA 4F4YA 5J0XA 2M2UA 7ICEA 1NOMA 2BQUA 1TKDA 2HHUA 8ICMA 4GLXA 5BPCA 4ED8A 4B9UA 3TAQA 3ZD9A 4AT8A 5J2EA 3QEAZ 2OEHA 1X6JA 4LEVA 1ECWA 4I2AA 1MC8A 4DLGA 4E8FA 3HJEA 5HRDA 1J2NA 4WC5A 2WFAA 4B9NA 3QU7A 4C80A 4DFKA 1SL1A 2FE9A 2NRTA 4KLUA 3J81j 4NWIA 8ICFA 3MR3A 4TURA 4R66A 3M6KA 4WQKA 4FHXA 1WG8A 4U6PA 2F44A 4P0QA 4BWJA 2OYYA 4E80A 3PV8A 3F2BA 5J2AA 3OVAA 1KBUA 2MUTA 2LI6A 2LM1A 2F1JA 2FI1A 5H2FU 3C5GA 4O3SA 1CRXA 4GXIA 7ICVA 4DQRA 3RJKA 2ZUCA 4K9AA 4C0ZA 4QWAA 9ICQA 1L7MA 4KLGA 3OTQA 4EV6A 4WC1A 3FAHA 3TAPA 4EBCA 4Y2SA 4DL2A 1X9WA 3Q8MA 2ZTEA 3LDAA 1T94A 3V72A 4X4UA 2KEYA 4QZ9A 1SGGA 3OV7A 8ICUA 4I2HA 1ZXIA 1S0OA 2YX8A 4R65A 2K4IA 4NLZA 1TFYA 4E0DA 4O5EA 4YCXA 5FP0A 2O6KA 2IOFK 5AKEA 2BBHA 5AIBA 2JHDA 5DB8A 1MA7A 4O3QA 5DBBA 5A0LA 2JEIA 1U4BA 4KMOB 2QB0B 1NJZA 2B56A 3MGVA 1RZTA 3UQ2A 2ZIXA 5KG1A 3GIJA 5B5EU 3QZ8A 3DV9A 2W9BA 3QNMA 4QJFB 4IQUA 3VC8A 1RQNA 2HHPA 4Z6CA 4LVSA 2KOBA 1ZQOA 5AM2A 4DEZA 4ICAA 3MABA 5ALVA 2XVTA 9ICVA 1NK0A 4FZMA 4A8EA 1D8YA 2HCFA 3D6JA 5IINA 2YTUA 2BCVA 3RBDA 1WWVA 1V97A 3RAXA 4JUZA 1ZQGA 3U26A 4FHWA 4UAZA 4DSIA 9ICCA 2ASLA 5HMMA 3OGUA 5CRXA 3JPRA 1JMSA 2YQEA 2KP7A 1BPXA 4DS4A 2RP5A 4C8MA 4P0PA 1RXWA 1RXVA 3WU2U 2EZZA 1KEJA 2J6SA 1ZQEA 1QCKA 5JU5A 3PW4A 1RYRA 1DK2A 5KFJA 4CRXA 2PFOA 4YMMA 3IG5A 7ICOA 8ICQA 1Q79A 1U45A 2KHVA 3JPSA 4Y2PA 2F77X 2VA8A 3H38A 1MIYA 4F5OA 4J9QA 4ECQA 4KLFA 5DEDA 4M2YA 2WF6A 2WB1F 2HHVA 4QW8A 2AU0A 1SXEA 2F2AB 2ISOA 1Z1VA 9ICWA 2FMPA 1ZQAA 1Q8KA 5AKKA 4F92B 5ALQA 8ICGA 5KFGA 2AQ0A 3GIIA 3PW7A 3WKDA 4BUGA 1D9FA 3Q8KA 1A76A 1LVHA 4ECVA 1KTQA 7ICIA 3WKAA 1AQ6A 4P2HA 2UVUA 2DPJA 5KFZA 3ZDDA 4JLXA 5AKJA 2GH1A 1MSWD 2WF8A 4I2GA 3KD3A 5J0OA 2HDOA 3Q8PB 5AI6A 3C1ZA 2XGQA 4BXOA 2M2TA 2HHQA 4NV0A 5AKGA 1MQ2A 1OXJA 1WWUA 3WK4A 1XWLA 3CNHA 4B9MA 2F1HA 3H40A 5J0YA 1NKEA 2IMWP 1HUZA 4UB6U 1R8BA 5CHEA 5AKHA 4E7XA 3SMVA 3N97B 4IS7A 4S3NA 3OJUA 4YG2A 2KJ8A 2UVWA 4F50A 2XY5A 4IC9A 4RWNA 3UQ0A 1UHUA 1ZQBA 3RJHA 2BPFA 2ZJAA 5J0UA 4ED6A 2ZH3A 4ECUA 3EPGA 2PFNA 3RR7A 1JALA 1PZNA 5L9XA 8ICVA 5IILA 1ZQUA 3EF2A 5GTIU 3PNCA 3NRZA 2N1RA 4OJLA 4PJ0U 3JPNA 1FFUA 3AEVA 4C8NA 3KKAA 3MR2A 3OHBA 1UETA 4GIBA 2AGPA 4X0AA 4OJ6A 4F4WA 2C22A 1RM6C 3K75D 1TAQA 3RBEA 4JMUA 2FCLA 5ALOA 5KTQA 3PR5B 3G6YA 4KX5A 5KG5A 5DLFA 1L3UA 2KD1A 3JPTA 2W43A 4O3OA 4O6AA 4M9HA 1WCLA 5DG9A 5KFSA 2HBJA 5CEHA 3H4BA 5KFLA 5JTIA 1LB2B 5L1KA 4I2FA 2B6GA 4J9PA 3QXGA 3SR6A 4EENA 4X4NA 5HMLA 4KN4A 2DR9A 1ZQVA 4MFAA 4EYHB 2JZBB 4J9RA 3ED5A 2VKQA 4C4RA 1JXLA 4QWBA 3AQNA 3OWGA 3F53A 5J0QA 1TE2A 4KITB 2DKXA 3TQ1A 2HI0A 1BPBA 3GDXA 2H3FA 3N7PD 3OJSA 2BZFA 3GU3A 1VDVA 4EBDA 4F5RA 2XICA 1PUZA 4MF8A 5HR9A 2MU2A 5B3PA 5B66U 2A3VA 2BDUA 3QU9A 4QNLA 4ECWA 3ERCC 2HOQA 1QSSA 1JX4A 3UM9A 5F9NA 1L7OA 2RLTA 4WJ3B 2D3DA 4P0PB 2JEGA 1ZQMA 1NKCA 3TANA 5AM4A 3NKUA 1IM4A 5J0TA 3KZXA 4UAYA 5ALEA 4USAA 5KFXA 3H3AA 4C8KA 4UB4A 3K4GA 4C8OA 3GZFA 3ZD8A 3Q8RB 5DB6A 2RDIA 2E8MA 3PX0A 1S10A 2LYHA 3RB3A 5DGAA 4XJEA 4JV2A 1Z00A 1ZQXA 4M04A 3M7DA 3AQKA 5AM0A 5HR6A 4F3OA 2XCAA 2FPKA 5DQIA 2KN7A 3DEEA 4B6JA 1S0VA 3TKAA 2R8HA 2BPCA 4AT9A 4I2DA 3QX7A 4Z6DA 4KTQA 5KFCA 1ZQHA 4MEYA 4QIWF 5KFUA 2CN1A 1V85A 4NM1A 4Y2UA 3C2LA 2W3RA 2FMQA 5HC9A 3UPSA 3BQ2A 4DL7A 3PMLA 2B21A 1BGXT 3L4PA 3C29A 2DR5A 4F5NA 5EE0A 4EEDA 2NV3A 4UB1A 4FS1A 3BDPA 4Y2YA 3WKCA 3GIKA 1TVAA 4B9LA 4CNQA 5BOMA 4F8RA 1FO4A 4F4XA 4XA5A 5ALWA 3FC4A 4ZOHC 1B4FA 4NKTA 3ZDCA 4O68A 5ALLA 4B9SA 4UD5A 3NVVA 4IRDA 1LKYB 1K1QA 2WF9A 4KLQA 4TQRA 4F93B 1NZPA 8ICYA 2K4PA 2AGQA 1N2XA 2C2EA 3MDCA 1NJXA 1Z3EB 4RQ8A 4NL9C 4KLEA 2BPGA 1ZQKA 4AT7B 2WB1C 3AUOA 1Z19A 2A1JA 3LWMA 5EOZA 2BCRA 4QZAA 5D61A 5ALIA 2K89A 1PVRA 2LHTA 4UATA 2JV3A 4DSKA 5CP2A 2LYBA 3RH5A 4DQQA 2A19A 2ZTDA 2NRXA 2H5XA 5HRIA 2KJ5A 1BPEA 4UB2A 3RFAA 3GV8B 4K8VA 4DLEA 2WF7A 3MFHA 4YR3A 3AL0B 5ALZA 3EW9A 3BQ1A 1PVPA 4O3MA 1O03A 1XSNA 2KVSA 4Z6EA 2BE3A 5D49A 9ICJA 4DQIA 2RQ5A 2LBOA 1NJYA 1BPZA 3ER8C 4P4MA 2KHQA 2W7OA 1TFRA 4P0QB 2H3VA 7ICGA 5J0RA 2JRZA 1ZQPA 4NKUA 1OUQA 3SZ2A 3I28A 4DWIA 2J6TA 4Q43A 8ICNA 9ICKA 4MKPA 3HJ4A 4KMUA 2I1QA 3ZDBA 8ICCA 1JUDA 3IDWA 2YB1A 1UQVA 2ALZA 3N7RC 3QE9Y 4ACOA 4FS2A 2E8NA 5C5JA 4O3RA 4ECXA 5CFSA 1WOTA 1F0MA 4Y2RA 4PGXA 5HNKA 1C7YA 3M8SA 3RH6A 1EXNA 1N60A 5J2JA 4KLMA 2ID1A 2OCEA 4UAUA 4M9LA 1WYGA 2NRWA 2YMPA
chains in the Genus database with same CATH topology
2M2WA 4J9SA 4PHDA 4RQ7A 1BPXA 4DS4A 4DSFA 1CEZA 2KP7A 3HT3A 3H8JA 5HHIA 4C8MA 2JEJA 1JAJA 2RFFA 4DO9A 4JWMA 1RXWA 1RXVA 2DVIA 3BJYA 1NK8A 4DL4A 4ED0A 3M8RA 1L3TA 4UAWA 4DL3A 1KEJA 1S0NA 2J6SA 1UA0A 4XRHA 3H37A 4M9JA 1T8EA 7ICPA 1ZQEA 3PW4A 5KFQA 1RYRA 1DK2A 5KFJA 1TK5A 5J2IA 4QZFA 3M9NB 4RQ5A 1NO5A 4M5DA 4J9LA 1S9FA 2PFOA 4YP3A 4YMMA 4JV1A 4IR9A 2OWOA 7ICOA 8ICQA 4J9NA 2WTFA 5CA7A 4RNNA 1U45A 1Q79A 3MBYA 4MFFA 3PW0A 3JPSA 4PHAA 2ZH5A 2MUTB 5KFHA 4DQSA 2VA8A 4AT8B 4DOAA 1MIYA 2VA3A 4ECRA 5L1JA 3H38A 4F5OA 4J9QA 4ECQA 4KLTA 5KG4A 1NKBA 4KLFA 5DEDA 5J0WA 2FPMA 5KG6A 5IIIA 4M2YA 5KFTA 5JUMA 2HHVA 4QW8A 2AU0A 1H38A 9ICWA 2ISOA 4WC5A 2DRAA 4FBTA 3JPOA 5CJ7A 2FMPA 4F4ZA 5KFMA 2A1JB 4UBBA 1ZQAA 2W9AA 4EBJA 3IM1A 1QLNA 1U49A 4KLHA 1NK6A 2JEFA 4X4OA 1UT8A 4ED2A 5EWEA 3KTQA 4F92B 4I2IA 1SKRA 8ICGA 5KT2A 4BXOB 5DQGA 5KFWA 5KFGA 5KFAA 4KN7A 2AQ0A 1KDHA 4QWDA 3GIIA 3PW7A 1ZETA 4KLLA 3KHGA 4FBUA 2R8KA 5DG7A 2NRKA 2JZBA 1TK8A 3MR5A 1D9FA 5HRGA 3SV3A 3KHRA 3KHLA 3Q8KA 1A76A 4QZHA 4ECVA 3RJFA 4QWEA 1KTQA 1S97A 3V7LA 5DBAA 2ISPA 3OVBA 4MF2A 3OUYA 2KFZA 3ORYA 4IQWA 7ICIA 1R8AA 5KG3A 2FLLA 2M2VA 4NLNA 3OVSA 3ISBA 4FH3A 4LT6A 4P2HA 2UVUA 2DPJA 3UXNA 5KFZA 4X4TA 2XCPA 3ZDDA 5HRLA 3T5JA 2DFLA 4DFMA 4YR0A 3JPQA 2V4RA 5KFIA 8ICWA 5J2KA 1MSWD 3MR6A 4I2GA 9ICHA 4RPZA 2BGWA 2FMSA 3HIYA 5J0OA 1Q78A 7ICMA 3Q8PB 5DDMA 5EWGA 3T3FA 1QSLA 3C1ZA 2XGQA 1ZQNA 7ICKA 4PHPA 4BXOA 2M2TA 5HRKA 2HHQA 2W9MA 4F2SA 2V4QA 3GIMA 5KFRA 4KLIA 1MQ2A 3PO4A 4B9MA 2KZMA 1XWLA 5HHHA 2F1HA 5DGBA 3H40A 5J2GA 5J0PA 5J0YA 2IHNA 2O1PA 3PMNA 1NKEA 1MQ3A 1TV9A 2W9CB 2IMWP 1HUZA 1R8BA 4X4RA 2RDJA 1OU5A 4QW9A 4FO6A 4E7XA 3OSNA 8ICJA 9ICUA 3V7KA 1DOQA 3N97B 1NK5A 1VJ7A 4YQWA 4Q8FA 1U9LA 4S3NA 1D9DA 4ED7A 4I28A 4J9KA 5HREA 3OJUA 4ATBA 4CCHA 4YG2A 3C1YA 2UVWA 2P6RA 7ICFA 4F50A 2XY5A 4WC4A 3JZ0A 4XQ7A 3C23A 4RWQA 1JXEA 3MGIA 5F2VO 3UQ0A 4RWNA 3HJ1A 5KFNA 3ISDA 4O3NA 1ZQBA 2BQ3A 2BPFA 2ZJAA 3RJHA 4XQ8A 4ECSA 4I2BA 4WC2A 3V7JA 5J0UA 3RJGA 4MFCA 3PW2A 3AU6A 2C2DA 3TARA 4I2JA 1U48A 4ELUA 2W8KA 4ED6A 3ISCA 2AGOA 2W9BB 1XSLA 1KLNA 1SL2A 2ZH3A 4ECUA 4P4PA 2XY7A 3EPGA 2PFNA 3RR7A 2ZH2A 5KFPA 1V9PA 2W9CA 3PY8A 1PZNA 5L9XA 8ICVA 9ICIA 1DK3A 5IILA 4QZBA 4YR2A 2PFQA 1ZQUA 4ELVA 3AU2A 3GV5B 1SL0A 3PNCA 1S0MA 7ICJA 4DS5A 3JPNA 1BPYA 3AQLA 2DR8A 3NYBA 4DFJA 5J2DA 2NRZA 4ATBB 1IXRA 4C8NA 5DKWA 2I9GA 4E8FA 3IHQB 7ICLA 4O0IA 3Q8QB 2ASJA 1V4AA 1K1SA 3OHBA 3MR2A 3BQ0A 2Y1JA 3H8WA 1UETA 1XO1A 2AGPA 4X0AA 4F4WA 2C22A 3WFQE 3K75D 3TI0A 3RRGA 4EZ6A 1TAQA 3C18A 1L5UA 4RZRA 1SZPA 4LZDA 3RBEA 1ZQJA 1JQRA 4RT3A 1MIWA 4GXKA 1TAUA 2NRWA 4I29A 5J0SA 1F5AA 1BPDA 2DRBA 4PH5A 5KTQA 3PR5B 8ICKA 3G6YA 5D4BA 4DF4A 5KFVA 1ZJNA 1MIVA 5DLGA 8ICEA 7ICUA 5IIKA 2J6UA 1R8CA 5IIJA 5KG5A 4NLGA 8ICSA 5DLFA 1RPLA 3T5HA 3V6KA 3LQCB 1L3UA 2XGPA 3HPOA 3JPTA 3WFOA 4IG8A 5KT5A 4LZGA 4RNMA 1RYSA 3EZ5A 9ICRA 2FPLA 4O3OA 4ED1A 3MGHA 9ICXA 2BR0A 3RJEA 3HW8A 4M9HA 1WCLA 5DG9A 3UXPA 2MAXA 4WC6A 3EYZA 5KFSA 3MDAA 4AT7A 2ASDA 3H4BA 9ICBA 5DECA 5KFLA 1LB2B 3GILA 5L1KA 5J2CA 4X5VA 4I2FA 4JV0A 1XSPA 4J9PA 4QZCA 4M6WA 2IA6A 4DFPA 4DL6A 2XY6A 1B43A 5KT7A 4NM2A 2PBEA 8ICIA 2HHSA 1ZQDA 4WBZA 5HMLA 4X4NA 5KFBA 1SKWA 4KN4A 1XC9A 2DR9A 2Q66A 3TFSA 1ZQVA 2XO7A 4MFAA 4O5CA 1NK4A 9ICLA 1S77D 4EYHB 2JZBB 3AQMA 4Q8EA 1CUKA 4J9RA 3NTUA 3RTVA 4F4KA 4BDPA 1Z00B 1JXLA 3MFIA 7ICRA 4QWBA 1X9MA 3AQNA 3Q8LA 4YD2A 5J0QA 4KITB 2HHXA 2HHWA 1XU4A 3C5FA 3TQ1A 3RH4A 1U47A 3NGDA 2P66A 3FDSA 8ICXA 1BPBA 5DB7A 2GWSA 2PXIA 3OHAA 4UBCA 2M9NA 1KRPA 3RJJA 4WCWA 2Y1IA 3SV4A 4X4QA 4RWOA 5DBCA 5IIOA 4M9GA 3GDXA 3B0XA 4QZGA 4WC0A 3OJSA 2ZHBA 3PX4A 1QSYA 9ICEA 4WC3A 3WFSC 5DQHA 4EZ9A 1L3SA 3UXOA 4QZ8A 3QEBZ 2ZTCA 4EBDA 4F5RA 3L9DA 4GC6A 4DF8A 9ICTA 4KLDA 1UEUA 5KG7A 5HRFA 5J2FA 4MF8A 4K4GA 4ECTA 2C28A 5HR9A 4KLOA 4B9TA 1B22A 4IQVA 5HRHA 1L3VA 4I2EA 4PHEA 2FLPA 3H8SA 1ZQCA 3H39A 3B0YA 4YFKA 2KTQA 4ECWA 4PGYA 4RU9A 3C66A 4NXZA 2AQ4A 2C2RA 1X9SA 4F91B 1QSSA 9ICAA 3ZDEA 4RUAA 1ZQTA 1JX4A 1COOA 9ICMA 4ZH4A 4XUSA 4UB3A 3PO5A 4DL5A 4R64A 4QZIA 3PR4A 1JN3A 4ECYA 2HHTA 4FHYA 1TFWA 1D8LA 4YMNA 5F9NA 5KFFA 4RUCA 3ETLA 4DOCA 1ZJMA 8ICLA 4I2CA 2JEGA 3OSPA 1ZQMA 4M9NA 1NKCA 3TANA 1UEVA 3PX6A 1T7PA 1IM4A 5J0TA 8ICBA 3Q8SB 3PVXA 4UAYA 2R8GA 4NLKA 4BWMA 8ICHA 1FA0A 5KFXA 4YXJA 3H3AA 2O5AA 4M6WB 4RNOA 2BKEA 5J2HA 4UB4A 4C8KA 4EP7A 3K4GA 3RB4A 4C8OA 4RQ0A 2IBKA 3ZD8A 3HX0A 3Q8RB 5DB6A 3C21A 3ZDAA 2RDIA 5L1IA 4B9VA 4K4IA 9ICPA 5DDYA 4RPXA 3SI8A 1KFTA 3PX0A 3OUYB 4KLJA 1S10A 4F2RA 2LYHA 1N56A 2VANA 3G6VA 1T3NA 3RB3A 8ICZA 5KT6A 4J9MA 5DGAA 4FHVA 2ZH7A 4JV2A 4YVZA 1Z00A 1ZQXA 4I27A 4M04A 4O9MA 3AQKA 4F3OA 2XCAA 2FPKA 5DQIA 2IHMA 2KN7A 2ATLA 1ZQSA 1ZQWA 1UA1A 4DSJA 4TQSA 2ZH9A 1S0VA 5KFYA 2BHNA 3M9MB 4EBKA 3RR8A 1BVSA 2BCQA 5CHGA 4DOBA 2R8HA 3TFRA 1NK7A 1ZQRA 4RQ2A 4KLSA 2BPCA 4AT9A 4WC7A 4I2DA 3QZ7A 1KFDA 4M47A 9ICOA 4RWPA 4Z6DA 3LWLA 4F4YA 2ZJ5A 4UB5A 5J0XA 5KFCA 1ZQLA 4KTQA 2M2UA 7ICEA 4ECZA 1NOMA 4Z6FA 2BQUA 1ZQHA 3RJIA 4MEYA 1TKDA 2HHUA 8ICMA 1KNYA 3SYZA 2HVHA 5KFUA 4GLXA 5BPCA 4ED8A 3HP6A 1ZQZA 4B9UA 2ZH4A 4R63A 2DPIA 4QZEA 3TAQA 4NM1A 1ZQYA 3ZD9A 1HJPA 3C2LA 4WBYA 1VFGA 1WCNA 1NJWA 4AT8A 4RQ3A 2BCSA 2FMQA 4Q44A 5J2EA 5L1LA 3QEAZ 4PPXA 5HC9A 3UPSA 4I2AA 3BQ2A 3V6HA 1MC8A 4QZDA 2B21A 3PMLA 4YN4A 4GC7A 5D46A 4DLGA 4DL7A 4IR1A 1BGXT 3E2EA 5HRDA 4B9NA 1Y88A 3GFKB 3H7IA 3UPQA 8ICPA 4F5NA 7ICNA 5BOLA 2DR5A 3EPIA 4YMOA 4DFKA 1SL1A 3C2MA 2AJQA 2NRTA 4KLUA 4P4OA 4UB1A 4FS1A 8ICFA 2V9WA 3MR3A 3BDPA 1S76D 2ZUBA 4BGDA 3BQTA 4TURA 4R66A 3GIKA 9ICGA 3V6JA 2Q0ZX 3HWTA 4F5QA 5KG0A 1TVAA 4B9LA 7ICTA 5BOMA 4F8RA 2PI5A 4F4XA 4XA5A 4FHXA 4X4VA 4Q45A 8ICRA 4NKTA 4BWJA 4IRKA 9ICFA 4E80A 1X2IA 3ZDCA 5KFDA 3PV8A 4B9SA 4UD5A 5CR0A 4MEXA 4JWNA 5J2AA 8ICOA 4IRDA 3WFPA 3OVAA 2ZH6A 1K1QA 7ICSA 2MUTA 5KT3A 2P6UA 4NY8A 3WFRE 7ICHA 3LK9A 4KLQA 2ZJ8A 2F1JA 4F5PA 1BNPA 2ZH1A 4TQRA 4F93B 1NZPA 8ICYA 2FLNA 2C2EA 2AGQA 5KFOA 4GXJA 3MDCA 3M9OB 3C5GA 1NJXA 1Z3EB 5TZVA 4ELTA 4RQ8A 3C2KA 1ZQFA 1A77A 4O3SA 2KZZA 9ICNA 4GXIA 4KLEA 4DQRA 1ZQKA 2BPGA 2ZUCA 3RJKA 7ICVA 4AT7B 3GV7B 4TUQA 3AUOA 2A1JA 5KG2A 4RQ4A 5EOZA 3LWMA 5KFEA 4YD1A 4X4PA 2HVIA 2BCRA 4QZAA 3JPPA 3THVA 4ED3A 4QWAA 9ICQA 1PX5A 5KT4A 4RQ6A 5F9LA 1UT5A 4KLGA 4PGQA 8ICAA 4FHPA 2UVVA 1ZQIA 4DSKA 4WC1A 5CP2A 3G6XA 3TAPA 4EBCA 4EBEA 1QTMA 5J2BA 3RH5A 1SKSA 4DL2A 4DQQA 4EYIB 2ZTEA 4RPYA 3Q8MA 2F1IA 2ZTDA 3LDAA 1X9WA 1NK9A 2NRXA 7ICQA 2H5XA 3V72A 4TUSA 5DB9A 4X4UA 2BQRA 5HRIA 4QZ9A 1BPEA 4UB2A 4DSEA 1BNOA 3OV7A 8ICUA 3GV8B 4I2HA 4DLEA 2UVRA 1S0OA 3MFHA 4YR3A 5IIMA 4X0BA 2ZHAA 4DSLA 4TUPA 3KHHA 3EW9A 3BQ1A 4R65A 4DQPA 1XSNA 2BE3A 4Z6EA 1XS9D 4NLZA 4X4SA 5D49A 3RB6A 2KFNA 9ICJA 5KFKA 4K4HA 1TFYA 4DQIA 4E0DA 4O5EA 1NJYA 1BPZA 4YCXA 4R8UB 3T5LA 4P4MA 3T5KA 2ZUDA 8ICTA 1TFRA 1HUOA 4RQ1A 2BCUA 2R8JA 1LV5A 2PFPA 5DB8A 3PW5A 4O3QA 7ICGA 5DBBA 5DG8A 5J0RA 2JEIA 1U4BA 1DGSA 1ZQPA 2PI4A 4RT2A 4NKUA 2BDPA 4IRCA 4IQTA 3SZ2A 4UQGA 2VA2A 1YLQA 4DWIA 1NJZA 2J6TA 4Q43A 5CWRA 1RZTA 1ZYQA 8ICNA 2HW3A 9ICKA 3HJ4A 4KMUA 3UQ2A 2I1QA 5KG1A 2KZ3A 3GIJA 3ZDBA 8ICCA 3QZ8A 4M0AA 5HRBA 2W9BA 4JK1A 2XC9A 2ZH8A 4C8LA 1R89A 2ALZA 4IQUA 5CB1A 4QWCA 3QE9Y 4J9OA 2HHPA 4Z6CA 5EWFA 3JYYA 1ZQQA 4AT9B 4LVSA 4FS2A 1ZQOA 2NRVA 4DEZA 3MABA 4HYKA 5C5JA 9ICVA 2DR7A 3GQCA 1NK0A 1T4GA 1N48A 4O3RA 4R8UA 1D8YA 3H4DA 4ECXA 2BCVA 5IINA 3RBDA 4FH5A 1WOTA 4O3PA 4PGXA 4UD4A 5HNKA 3RRHA 3RAXA 2W8LA 4JUZA 4EEYA 3N4MB 3RAQA 1TK0A 1C7YA 1KFSA 3RB0A 3M8SA 3RH6A 1EXNA 5J29A 1ZQGA 2R8IA 4FHWA 3EWAA 5J2JA 4UAZA 1KSPA 4DSIA 4KLMA 9ICSA 2ID1A 9ICCA 1AROP 2ASLA 4M9LA 4YXMA 5HMMA 1JIHA 3OGUA 4O5KA 3FYHA 5HP4A 3JPRA 4G3IA 1JMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2W A;  4J9S A;  4PHD A;  4RQ7 A;  1BPX A;  4DS4 A;  4DSF A;  1CEZ A;  2KP7 A;  3HT3 A;  3H8J A;  5HHI A;  4C8M A;  2JEJ A;  1JAJ A;  2RFF A;  4DO9 A;  4JWM A;  1RXW A;  1RXV A;  2DVI A;  3BJY A;  1NK8 A;  4DL4 A;  4ED0 A;  3M8R A;  1L3T A;  4UAW A;  4DL3 A;  1KEJ A;  1S0N A;  2J6S A;  1UA0 A;  4XRH A;  3H37 A;  4M9J A;  1T8E A;  7ICP A;  1ZQE A;  3PW4 A;  5KFQ A;  1RYR A;  1DK2 A;  5KFJ A;  1TK5 A;  5J2I A;  4QZF A;  3M9N B;  4RQ5 A;  1NO5 A;  4M5D A;  4J9L A;  1S9F A;  2PFO A;  4YP3 A;  4YMM A;  4JV1 A;  4IR9 A;  2OWO A;  7ICO A;  8ICQ A;  4J9N A;  2WTF A;  5CA7 A;  4RNN A;  1U45 A;  1Q79 A;  3MBY A;  4MFF A;  3PW0 A;  3JPS A;  4PHA A;  2ZH5 A;  2MUT B;  5KFH A;  4DQS A;  2VA8 A;  4AT8 B;  4DOA A;  1MIY A;  2VA3 A;  4ECR A;  5L1J A;  3H38 A;  4F5O A;  4J9Q A;  4ECQ A;  4KLT A;  5KG4 A;  1NKB A;  4KLF A;  5DED A;  5J0W A;  2FPM A;  5KG6 A;  5III A;  4M2Y A;  5KFT A;  5JUM A;  2HHV A;  4QW8 A;  2AU0 A;  1H38 A;  9ICW A;  2ISO A;  4WC5 A;  2DRA A;  4FBT A;  3JPO A;  5CJ7 A;  2FMP A;  4F4Z A;  5KFM A;  2A1J B;  4UBB A;  1ZQA A;  2W9A A;  4EBJ A;  3IM1 A;  1QLN A;  1U49 A;  4KLH A;  1NK6 A;  2JEF A;  4X4O A;  1UT8 A;  4ED2 A;  5EWE A;  3KTQ A;  4F92 B;  4I2I A;  1SKR A;  8ICG A;  5KT2 A;  4BXO B;  5DQG A;  5KFW A;  5KFG A;  5KFA A;  4KN7 A;  2AQ0 A;  1KDH A;  4QWD A;  3GII A;  3PW7 A;  1ZET A;  4KLL A;  3KHG A;  4FBU A;  2R8K A;  5DG7 A;  2NRK A;  2JZB A;  1TK8 A;  3MR5 A;  1D9F A;  5HRG A;  3SV3 A;  3KHR A;  3KHL A;  3Q8K A;  1A76 A;  4QZH A;  4ECV A;  3RJF A;  4QWE A;  1KTQ A;  1S97 A;  3V7L A;  5DBA A;  2ISP A;  3OVB A;  4MF2 A;  3OUY A;  2KFZ A;  3ORY A;  4IQW A;  7ICI A;  1R8A A;  5KG3 A;  2FLL A;  2M2V A;  4NLN A;  3OVS A;  3ISB A;  4FH3 A;  4LT6 A;  4P2H A;  2UVU A;  2DPJ A;  3UXN A;  5KFZ A;  4X4T A;  2XCP A;  3ZDD A;  5HRL A;  3T5J A;  2DFL A;  4DFM A;  4YR0 A;  3JPQ A;  2V4R A;  5KFI A;  8ICW A;  5J2K A;  1MSW D;  3MR6 A;  4I2G A;  9ICH A;  4RPZ A;  2BGW A;  2FMS A;  3HIY A;  5J0O A;  1Q78 A;  7ICM A;  3Q8P B;  5DDM A;  5EWG A;  3T3F A;  1QSL A;  3C1Z A;  2XGQ A;  1ZQN A;  7ICK A;  4PHP A;  4BXO A;  2M2T A;  5HRK A;  2HHQ A;  2W9M A;  4F2S A;  2V4Q A;  3GIM A;  5KFR A;  4KLI A;  1MQ2 A;  3PO4 A;  4B9M A;  2KZM A;  1XWL A;  5HHH A;  2F1H A;  5DGB A;  3H40 A;  5J2G A;  5J0P A;  5J0Y A;  2IHN A;  2O1P A;  3PMN A;  1NKE A;  1MQ3 A;  1TV9 A;  2W9C B;  2IMW P;  1HUZ A;  1R8B A;  4X4R A;  2RDJ A;  1OU5 A;  4QW9 A;  4FO6 A;  4E7X A;  3OSN A;  8ICJ A;  9ICU A;  3V7K A;  1DOQ A;  3N97 B;  1NK5 A;  1VJ7 A;  4YQW A;  4Q8F A;  1U9L A;  4S3N A;  1D9D A;  4ED7 A;  4I28 A;  4J9K A;  5HRE A;  3OJU A;  4ATB A;  4CCH A;  4YG2 A;  3C1Y A;  2UVW A;  2P6R A;  7ICF A;  4F50 A;  2XY5 A;  4WC4 A;  3JZ0 A;  4XQ7 A;  3C23 A;  4RWQ A;  1JXE A;  3MGI A;  5F2V O;  3UQ0 A;  4RWN A;  3HJ1 A;  5KFN A;  3ISD A;  4O3N A;  1ZQB A;  2BQ3 A;  2BPF A;  2ZJA A;  3RJH A;  4XQ8 A;  4ECS A;  4I2B A;  4WC2 A;  3V7J A;  5J0U A;  3RJG A;  4MFC A;  3PW2 A;  3AU6 A;  2C2D A;  3TAR A;  4I2J A;  1U48 A;  4ELU A;  2W8K A;  4ED6 A;  3ISC A;  2AGO A;  2W9B B;  1XSL A;  1KLN A;  1SL2 A;  2ZH3 A;  4ECU A;  4P4P A;  2XY7 A;  3EPG A;  2PFN A;  3RR7 A;  2ZH2 A;  5KFP A;  1V9P A;  2W9C A;  3PY8 A;  1PZN A;  5L9X A;  8ICV A;  9ICI A;  1DK3 A;  5IIL A;  4QZB A;  4YR2 A;  2PFQ A;  1ZQU A;  4ELV A;  3AU2 A;  3GV5 B;  1SL0 A;  3PNC A;  1S0M A;  7ICJ A;  4DS5 A;  3JPN A;  1BPY A;  3AQL A;  2DR8 A;  3NYB A;  4DFJ A;  5J2D A;  2NRZ A;  4ATB B;  1IXR A;  4C8N A;  5DKW A;  2I9G A;  4E8F A;  3IHQ B;  7ICL A;  4O0I A;  3Q8Q B;  2ASJ A;  1V4A A;  1K1S A;  3OHB A;  3MR2 A;  3BQ0 A;  2Y1J A;  3H8W A;  1UET A;  1XO1 A;  2AGP A;  4X0A A;  4F4W A;  2C22 A;  3WFQ E;  3K75 D;  3TI0 A;  3RRG A;  4EZ6 A;  1TAQ A;  3C18 A;  1L5U A;  4RZR A;  1SZP A;  4LZD A;  3RBE A;  1ZQJ A;  1JQR A;  4RT3 A;  1MIW A;  4GXK A;  1TAU A;  2NRW A;  4I29 A;  5J0S A;  1F5A A;  1BPD A;  2DRB A;  4PH5 A;  5KTQ A;  3PR5 B;  8ICK A;  3G6Y A;  5D4B A;  4DF4 A;  5KFV A;  1ZJN A;  1MIV A;  5DLG A;  8ICE A;  7ICU A;  5IIK A;  2J6U A;  1R8C A;  5IIJ A;  5KG5 A;  4NLG A;  8ICS A;  5DLF A;  1RPL A;  3T5H A;  3V6K A;  3LQC B;  1L3U A;  2XGP A;  3HPO A;  3JPT A;  3WFO A;  4IG8 A;  5KT5 A;  4LZG A;  4RNM A;  1RYS A;  3EZ5 A;  9ICR A;  2FPL A;  4O3O A;  4ED1 A;  3MGH A;  9ICX A;  2BR0 A;  3RJE A;  3HW8 A;  4M9H A;  1WCL A;  5DG9 A;  3UXP A;  2MAX A;  4WC6 A;  3EYZ A;  5KFS A;  3MDA A;  4AT7 A;  2ASD A;  3H4B A;  9ICB A;  5DEC A;  5KFL A;  1LB2 B;  3GIL A;  5L1K A;  5J2C A;  4X5V A;  4I2F A;  4JV0 A;  1XSP A;  4J9P A;  4QZC A;  4M6W A;  2IA6 A;  4DFP A;  4DL6 A;  2XY6 A;  1B43 A;  5KT7 A;  4NM2 A;  2PBE A;  8ICI A;  2HHS A;  1ZQD A;  4WBZ A;  5HML A;  4X4N A;  5KFB A;  1SKW A;  4KN4 A;  1XC9 A;  2DR9 A;  2Q66 A;  3TFS A;  1ZQV A;  2XO7 A;  4MFA A;  4O5C A;  1NK4 A;  9ICL A;  1S77 D;  4EYH B;  2JZB B;  3AQM A;  4Q8E A;  1CUK A;  4J9R A;  3NTU A;  3RTV A;  4F4K A;  4BDP A;  1Z00 B;  1JXL A;  3MFI A;  7ICR A;  4QWB A;  1X9M A;  3AQN A;  3Q8L A;  4YD2 A;  5J0Q A;  4KIT B;  2HHX A;  2HHW A;  1XU4 A;  3C5F A;  3TQ1 A;  3RH4 A;  1U47 A;  3NGD A;  2P66 A;  3FDS A;  8ICX A;  1BPB A;  5DB7 A;  2GWS A;  2PXI A;  3OHA A;  4UBC A;  2M9N A;  1KRP A;  3RJJ A;  4WCW A;  2Y1I A;  3SV4 A;  4X4Q A;  4RWO A;  5DBC A;  5IIO A;  4M9G A;  3GDX A;  3B0X A;  4QZG A;  4WC0 A;  3OJS A;  2ZHB A;  3PX4 A;  1QSY A;  9ICE A;  4WC3 A;  3WFS C;  5DQH A;  4EZ9 A;  1L3S A;  3UXO A;  4QZ8 A;  3QEB Z;  2ZTC A;  4EBD A;  4F5R A;  3L9D A;  4GC6 A;  4DF8 A;  9ICT A;  4KLD A;  1UEU A;  5KG7 A;  5HRF A;  5J2F A;  4MF8 A;  4K4G A;  4ECT A;  2C28 A;  5HR9 A;  4KLO A;  4B9T A;  1B22 A;  4IQV A;  5HRH A;  1L3V A;  4I2E A;  4PHE A;  2FLP A;  3H8S A;  1ZQC A;  3H39 A;  3B0Y A;  4YFK A;  2KTQ A;  4ECW A;  4PGY A;  4RU9 A;  3C66 A;  4NXZ A;  2AQ4 A;  2C2R A;  1X9S A;  4F91 B;  1QSS A;  9ICA A;  3ZDE A;  4RUA A;  1ZQT A;  1JX4 A;  1COO A;  9ICM A;  4ZH4 A;  4XUS A;  4UB3 A;  3PO5 A;  4DL5 A;  4R64 A;  4QZI A;  3PR4 A;  1JN3 A;  4ECY A;  2HHT A;  4FHY A;  1TFW A;  1D8L A;  4YMN A;  5F9N A;  5KFF A;  4RUC A;  3ETL A;  4DOC A;  1ZJM A;  8ICL A;  4I2C A;  2JEG A;  3OSP A;  1ZQM A;  4M9N A;  1NKC A;  3TAN A;  1UEV A;  3PX6 A;  1T7P A;  1IM4 A;  5J0T A;  8ICB A;  3Q8S B;  3PVX A;  4UAY A;  2R8G A;  4NLK A;  4BWM A;  8ICH A;  1FA0 A;  5KFX A;  4YXJ A;  3H3A A;  2O5A A;  4M6W B;  4RNO A;  2BKE A;  5J2H A;  4UB4 A;  4C8K A;  4EP7 A;  3K4G A;  3RB4 A;  4C8O A;  4RQ0 A;  2IBK A;  3ZD8 A;  3HX0 A;  3Q8R B;  5DB6 A;  3C21 A;  3ZDA A;  2RDI A;  5L1I A;  4B9V A;  4K4I A;  9ICP A;  5DDY A;  4RPX A;  3SI8 A;  1KFT A;  3PX0 A;  3OUY B;  4KLJ A;  1S10 A;  4F2R A;  2LYH A;  1N56 A;  2VAN A;  3G6V A;  1T3N A;  3RB3 A;  8ICZ A;  5KT6 A;  4J9M A;  5DGA A;  4FHV A;  2ZH7 A;  4JV2 A;  4YVZ A;  1Z00 A;  1ZQX A;  4I27 A;  4M04 A;  4O9M A;  3AQK A;  4F3O A;  2XCA A;  2FPK A;  5DQI A;  2IHM A;  2KN7 A;  2ATL A;  1ZQS A;  1ZQW A;  1UA1 A;  4DSJ A;  4TQS A;  2ZH9 A;  1S0V A;  5KFY A;  2BHN A;  3M9M B;  4EBK A;  3RR8 A;  1BVS A;  2BCQ A;  5CHG A;  4DOB A;  2R8H A;  3TFR A;  1NK7 A;  1ZQR A;  4RQ2 A;  4KLS A;  2BPC A;  4AT9 A;  4WC7 A;  4I2D A;  3QZ7 A;  1KFD A;  4M47 A;  9ICO A;  4RWP A;  4Z6D A;  3LWL A;  4F4Y A;  2ZJ5 A;  4UB5 A;  5J0X A;  5KFC A;  1ZQL A;  4KTQ A;  2M2U A;  7ICE A;  4ECZ A;  1NOM A;  4Z6F A;  2BQU A;  1ZQH A;  3RJI A;  4MEY A;  1TKD A;  2HHU A;  8ICM A;  1KNY A;  3SYZ A;  2HVH A;  5KFU A;  4GLX A;  5BPC A;  4ED8 A;  3HP6 A;  1ZQZ A;  4B9U A;  2ZH4 A;  4R63 A;  2DPI A;  4QZE A;  3TAQ A;  4NM1 A;  1ZQY A;  3ZD9 A;  1HJP A;  3C2L A;  4WBY A;  1VFG A;  1WCN A;  1NJW A;  4AT8 A;  4RQ3 A;  2BCS A;  2FMQ A;  4Q44 A;  5J2E A;  5L1L A;  3QEA Z;  4PPX A;  5HC9 A;  3UPS A;  4I2A A;  3BQ2 A;  3V6H A;  1MC8 A;  4QZD A;  2B21 A;  3PML A;  4YN4 A;  4GC7 A;  5D46 A;  4DLG A;  4DL7 A;  4IR1 A;  1BGX T;  3E2E A;  5HRD A;  4B9N A;  1Y88 A;  3GFK B;  3H7I A;  3UPQ A;  8ICP A;  4F5N A;  7ICN A;  5BOL A;  2DR5 A;  3EPI A;  4YMO A;  4DFK A;  1SL1 A;  3C2M A;  2AJQ A;  2NRT A;  4KLU A;  4P4O A;  4UB1 A;  4FS1 A;  8ICF A;  2V9W A;  3MR3 A;  3BDP A;  1S76 D;  2ZUB A;  4BGD A;  3BQT A;  4TUR A;  4R66 A;  3GIK A;  9ICG A;  3V6J A;  2Q0Z X;  3HWT A;  4F5Q A;  5KG0 A;  1TVA A;  4B9L A;  7ICT A;  5BOM A;  4F8R A;  2PI5 A;  4F4X A;  4XA5 A;  4FHX A;  4X4V A;  4Q45 A;  8ICR A;  4NKT A;  4BWJ A;  4IRK A;  9ICF A;  4E80 A;  1X2I A;  3ZDC A;  5KFD A;  3PV8 A;  4B9S A;  4UD5 A;  5CR0 A;  4MEX A;  4JWN A;  5J2A A;  8ICO A;  4IRD A;  3WFP A;  3OVA A;  2ZH6 A;  1K1Q A;  7ICS A;  2MUT A;  5KT3 A;  2P6U A;  4NY8 A;  3WFR E;  7ICH A;  3LK9 A;  4KLQ A;  2ZJ8 A;  2F1J A;  4F5P A;  1BNP A;  2ZH1 A;  4TQR A;  4F93 B;  1NZP A;  8ICY A;  2FLN A;  2C2E A;  2AGQ A;  5KFO A;  4GXJ A;  3MDC A;  3M9O B;  3C5G A;  1NJX A;  1Z3E B;  5TZV A;  4ELT A;  4RQ8 A;  3C2K A;  1ZQF A;  1A77 A;  4O3S A;  2KZZ A;  9ICN A;  4GXI A;  4KLE A;  4DQR A;  1ZQK A;  2BPG A;  2ZUC A;  3RJK A;  7ICV A;  4AT7 B;  3GV7 B;  4TUQ A;  3AUO A;  2A1J A;  5KG2 A;  4RQ4 A;  5EOZ A;  3LWM A;  5KFE A;  4YD1 A;  4X4P A;  2HVI A;  2BCR A;  4QZA A;  3JPP A;  3THV A;  4ED3 A;  4QWA A;  9ICQ A;  1PX5 A;  5KT4 A;  4RQ6 A;  5F9L A;  1UT5 A;  4KLG A;  4PGQ A;  8ICA A;  4FHP A;  2UVV A;  1ZQI A;  4DSK A;  4WC1 A;  5CP2 A;  3G6X A;  3TAP A;  4EBC A;  4EBE A;  1QTM A;  5J2B A;  3RH5 A;  1SKS A;  4DL2 A;  4DQQ A;  4EYI B;  2ZTE A;  4RPY A;  3Q8M A;  2F1I A;  2ZTD A;  3LDA A;  1X9W A;  1NK9 A;  2NRX A;  7ICQ A;  2H5X A;  3V72 A;  4TUS A;  5DB9 A;  4X4U A;  2BQR A;  5HRI A;  4QZ9 A;  1BPE A;  4UB2 A;  4DSE A;  1BNO A;  3OV7 A;  8ICU A;  3GV8 B;  4I2H A;  4DLE A;  2UVR A;  1S0O A;  3MFH A;  4YR3 A;  5IIM A;  4X0B A;  2ZHA A;  4DSL A;  4TUP A;  3KHH A;  3EW9 A;  3BQ1 A;  4R65 A;  4DQP A;  1XSN A;  2BE3 A;  4Z6E A;  1XS9 D;  4NLZ A;  4X4S A;  5D49 A;  3RB6 A;  2KFN A;  9ICJ A;  5KFK A;  4K4H A;  1TFY A;  4DQI A;  4E0D A;  4O5E A;  1NJY A;  1BPZ A;  4YCX A;  4R8U B;  3T5L A;  4P4M A;  3T5K A;  2ZUD A;  8ICT A;  1TFR A;  1HUO A;  4RQ1 A;  2BCU A;  2R8J A;  1LV5 A;  2PFP A;  5DB8 A;  3PW5 A;  4O3Q A;  7ICG A;  5DBB A;  5DG8 A;  5J0R A;  2JEI A;  1U4B A;  1DGS A;  1ZQP A;  2PI4 A;  4RT2 A;  4NKU A;  2BDP A;  4IRC A;  4IQT A;  3SZ2 A;  4UQG A;  2VA2 A;  1YLQ A;  4DWI A;  1NJZ A;  2J6T A;  4Q43 A;  5CWR A;  1RZT A;  1ZYQ A;  8ICN A;  2HW3 A;  9ICK A;  3HJ4 A;  4KMU A;  3UQ2 A;  2I1Q A;  5KG1 A;  2KZ3 A;  3GIJ A;  3ZDB A;  8ICC A;  3QZ8 A;  4M0A A;  5HRB A;  2W9B A;  4JK1 A;  2XC9 A;  2ZH8 A;  4C8L A;  1R89 A;  2ALZ A;  4IQU A;  5CB1 A;  4QWC A;  3QE9 Y;  4J9O A;  2HHP A;  4Z6C A;  5EWF A;  3JYY A;  1ZQQ A;  4AT9 B;  4LVS A;  4FS2 A;  1ZQO A;  2NRV A;  4DEZ A;  3MAB A;  4HYK A;  5C5J A;  9ICV A;  2DR7 A;  3GQC A;  1NK0 A;  1T4G A;  1N48 A;  4O3R A;  4R8U A;  1D8Y A;  3H4D A;  4ECX A;  2BCV A;  5IIN A;  3RBD A;  4FH5 A;  1WOT A;  4O3P A;  4PGX A;  4UD4 A;  5HNK A;  3RRH A;  3RAX A;  2W8L A;  4JUZ A;  4EEY A;  3N4M B;  3RAQ A;  1TK0 A;  1C7Y A;  1KFS A;  3RB0 A;  3M8S A;  3RH6 A;  1EXN A;  5J29 A;  1ZQG A;  2R8I A;  4FHW A;  3EWA A;  5J2J A;  4UAZ A;  1KSP A;  4DSI A;  4KLM A;  9ICS A;  2ID1 A;  9ICC A;  1ARO P;  2ASL A;  4M9L A;  4YXM A;  5HMM A;  1JIH A;  3OGU A;  4O5K A;  3FYH A;  5HP4 A;  3JPR A;  4G3I A;  1JMS A; 
#chains in the Genus database with same CATH topology
 4HX0 A;  2E8P A;  4J9S A;  1CEZ A;  3HT3 A;  4Y2J A;  3CRX A;  1JAJ A;  2DVI A;  5TIS U;  5ALU A;  2B4V A;  4DL4 A;  5G5H A;  2K4E A;  4UAW A;  4DL3 A;  4MHV A;  1UA0 A;  4XRH A;  3H37 A;  4IL6 U;  1T8E A;  2CXY A;  1K5O A;  4J9L A;  1S9F A;  4JV1 A;  2ZIV B;  3F2D A;  5AKL A;  4RNN A;  3MBY A;  3PW0 A;  4PHA A;  2ZH5 A;  4DQS A;  3KZI U;  5ALM A;  5KG6 A;  5JUM A;  1H38 A;  2K4H A;  3JPO A;  4FBT A;  1COK A;  5KFM A;  4EBJ A;  1NZB A;  1U49 A;  2K8A A;  5D62 A;  3A0H U;  4J03 A;  4BXO B;  1Z4O A;  5KFW A;  2EZX A;  5KFA A;  4KN7 A;  4OAH A;  5ALG A;  2YY6 A;  5CFT A;  4Y2Q A;  4FBU A;  2R8K A;  5DG7 A;  1M6Y A;  1TK8 A;  2W11 A;  1S97 A;  3V7L A;  2ISP A;  3OVB A;  4MF2 A;  3OUY A;  1R8A A;  3ORY A;  4IQW A;  1KL9 A;  2M2V A;  4NLN A;  3TAD A;  3ISB A;  4PZN A;  2M0N A;  3T5J A;  2ZIW A;  4DCC A;  5KAI U;  4OJ5 A;  5KFI A;  2NYV A;  5J2K A;  3QUQ A;  3JPQ A;  8ICW A;  5CFU A;  4G9B A;  3MR6 A;  9ICH A;  3PHZ A;  4RPZ A;  3HIY A;  2Q4T A;  1Q78 A;  7ICM A;  3T3F A;  5EWG A;  2WF5 A;  1QSL A;  3QU5 A;  3SAF A;  1ZQN A;  4PHP A;  2EAN A;  5AKY A;  3GIM A;  3PO4 A;  5DGB A;  2IHN A;  2O1P A;  2W9C B;  2MSN A;  2RDJ A;  2P35 A;  4QW9 A;  4FO6 A;  9ICU A;  1NK5 A;  1DOQ A;  2LMR A;  4Q8F A;  5E79 U;  3DDH A;  2YMQ A;  4DFD A;  3VCB A;  5HRE A;  4ATB A;  3C1Y A;  4XQ7 A;  3N7S C;  3M1Y A;  3MGI A;  1JRO A;  4I2B A;  4XQ8 A;  2AH5 A;  4MFC A;  3BZK A;  4I2J A;  1U48 A;  4ELU A;  1QQ6 A;  2KKP A;  1SL2 A;  2LKY A;  3OUY B;  2W9C A;  4YR2 A;  4OO1 J;  1S0M A;  7ICJ A;  2ZXI A;  3AQE A;  5J2D A;  4DFJ A;  3NAS A;  4CF4 A;  1IXR A;  3M6Z A;  3UMC A;  2EAM A;  2I9G A;  1XO0 A;  7ICL A;  1SWV A;  2ASJ A;  3BQ0 A;  1WUD A;  3H8W A;  3TI0 A;  4F72 A;  1JRP A;  2DKZ A;  1SZP A;  4RT3 A;  1MIW A;  5AI0 A;  1PK1 B;  3B9J A;  3HKZ F;  2DRB A;  2DGZ A;  5D4B A;  1ZJN A;  5DLG A;  7ICU A;  3ETR A;  1R8C A;  2ZIU B;  5IIJ A;  4CGZ A;  3NVZ A;  8ICS A;  1RPL A;  3T5H A;  3IP4 B;  3HPO A;  5KT5 A;  3A0B U;  1XNS A;  2EH9 A;  1L6N A;  4JLZ A;  2IHO A;  2FPL A;  2YML A;  3HW8 A;  4WC6 A;  3EYZ A;  4FZN A;  3ALR A;  5J2C A;  1Q3U A;  4JV0 A;  1XSP A;  4QZC A;  2NO4 A;  4M6W A;  5AHX A;  4DFP A;  2IA6 A;  2HOF A;  8ICI A;  1SKW A;  2OHF A;  3E0F A;  3TFS A;  2XO7 A;  9ICL A;  2ZIU A;  1CUK A;  3K1Z A;  3NTU A;  1Z00 B;  2WAQ F;  7ICR A;  2GLE A;  2HHX A;  1U47 A;  1VLB A;  3FDS A;  2PXI A;  3RJJ A;  4WCW A;  3BZC A;  3SV4 A;  4RWO A;  5IIO A;  2HOI A;  4WQL A;  1SV0 A;  3PX4 A;  3QEB Z;  4QZ8 A;  4GC6 A;  9ICT A;  1UEU A;  2QB1 A;  2DBY A;  5J2F A;  4K4G A;  4ECT A;  1B22 A;  4B9T A;  5HRH A;  4I2E A;  2KJ9 A;  2G09 A;  1ZQC A;  3H39 A;  4YFK A;  4PZO A;  4PL1 A;  5D63 A;  2XID A;  4PGY A;  2ZIV A;  4F91 B;  9ICM A;  9ICA A;  2F8L A;  4XUS A;  3PO5 A;  4DL5 A;  5EE9 A;  3PR4 A;  1JN3 A;  4YMN A;  1ZJM A;  8ICL A;  2E3T A;  1J2M A;  4CF5 A;  1RDF A;  1GO3 F;  8ICB A;  3PVX A;  2R8G A;  2W03 A;  1X6I A;  4NLK A;  4BWM A;  8ICH A;  1FA0 A;  2K8C B;  1A0P A;  4OAG A;  2KIC A;  3ZDA A;  2M2W A;  2E5S A;  4U7C A;  3G6V A;  3MC1 A;  1T3N A;  2Y9U A;  2ES6 A;  5KNI A;  2EAO A;  4J9M A;  4YVZ A;  4I27 A;  1SWW A;  4DSJ A;  1ZQW A;  5AM1 A;  1UA1 A;  4TQS A;  3QUB A;  5KFY A;  2BHN A;  4EBK A;  2BCQ A;  3F5E A;  1NK7 A;  1ZQR A;  3LVW A;  3MCR A;  4WC7 A;  4M47 A;  2ZJ5 A;  4UB5 A;  1ZQL A;  1DGJ A;  4Z6F A;  2FJ6 A;  3I76 A;  3RJI A;  1KNY A;  2H3Q A;  1RYU A;  3UMB A;  1ZQZ A;  2ZH4 A;  3S6J A;  4QZE A;  1ZQY A;  4EEL A;  1VFG A;  1WCN A;  2ODG A;  3E58 A;  4RQ3 A;  2BCS A;  4Q44 A;  5L1L A;  2KK0 A;  2NO5 A;  4QZD A;  4IR1 A;  3ZI4 A;  4C7Y A;  5D46 A;  3UPQ A;  1Y88 A;  3H7I A;  4P4O A;  2V9W A;  3WK9 A;  1S76 D;  2ZUB A;  4BGD A;  3BQT A;  9ICG A;  5KG0 A;  4Q45 A;  8ICR A;  9ICF A;  1X2I A;  3ICX A;  2QKQ A;  4UB8 U;  4MEX A;  8ICO A;  3WFR E;  2VIX A;  5KT3 A;  2P6U A;  4NY8 A;  7ICH A;  3LK9 A;  2ZJ8 A;  5KFO A;  3M9O B;  4ELT A;  1ZQF A;  3C2K A;  9ICN A;  2KZZ A;  3SEN A;  1SV0 C;  3GV7 B;  5KG2 A;  4RQ4 A;  2XI9 A;  3IG8 A;  4NLB A;  4X4P A;  5AI8 A;  4ED3 A;  1HEK A;  2G06 A;  5F9L A;  8ICA A;  4PGQ A;  1YT3 A;  2UVV A;  1YZ6 A;  4EEB A;  1LKY A;  2D8C A;  4RPY A;  1NK9 A;  1RQL A;  1Q46 A;  4TUS A;  1TAM A;  5DB9 A;  2BQR A;  1BNO A;  2JXJ A;  2PMZ C;  2HN2 A;  4TUP A;  4DQP A;  3RB6 A;  2KFN A;  4UAV A;  4RQN A;  5JRT A;  1N5X A;  3T5L A;  3T5K A;  3AQF A;  4NL9 A;  2BCU A;  1LV5 A;  2PFP A;  3PW5 A;  5DG8 A;  1DGS A;  4AP9 A;  4RT2 A;  2PI4 A;  2BDP A;  4IRC A;  1RG6 A;  2QLT A;  5EE3 A;  1ZYQ A;  2HW3 A;  1MN8 A;  5ALT A;  5HRB A;  4JK1 A;  3UMG A;  2ZH8 A;  1KW4 A;  5CB1 A;  4AT9 B;  3JYY A;  4HYK A;  2DR7 A;  1ZD5 A;  1N48 A;  4FO1 A;  2ZIW B;  3H4D A;  3NVY A;  3RRH A;  3N4M B;  4EEY A;  4NXX A;  3IV6 A;  1KFS A;  1KSP A;  9ICS A;  4OAF A;  2DF4 B;  1ARO P;  2EWR A;  4YXM A;  2G08 A;  1O08 A;  3D2S A;  4O5K A;  5HP4 A;  1BNP A;  1ZD4 A;  4G3I A;  1UPH A;  4PHD A;  3NVW A;  4RQ7 A;  4DSF A;  1Z4N A;  3L3F X;  3WK8 A;  3SAH A;  1NI3 A;  5HHI A;  3IRU A;  2RFF A;  4DO9 A;  4JWM A;  1NK8 A;  2L5Y A;  3M8R A;  1L3T A;  4O67 A;  1S0N A;  3QU4 A;  4Y2X A;  4M9J A;  7ICP A;  5KFQ A;  1NO5 A;  2WHE A;  1ZQ1 C;  5J2I A;  4QZF A;  3M9N B;  4RQ5 A;  4M5D A;  3IN5 A;  2W54 A;  2OWO A;  2WTF A;  5CA7 A;  2EAP A;  4MFF A;  2MUT B;  4DOA A;  4ECR A;  5L1J A;  4UW9 A;  4KLT A;  2Y0S F;  2F76 X;  2YN4 A;  5KG4 A;  1NKB A;  5J0W A;  3TAC B;  5III A;  3C28 A;  2KG5 A;  5KFT A;  2DRA A;  1X9X A;  5CJ7 A;  5AKI A;  2G0A A;  4I0U A;  4F4Z A;  2A1J B;  4UBB A;  3IM1 A;  1QLN A;  1NK6 A;  2JEF A;  1UT8 A;  4CF3 A;  5EWE A;  3KTQ A;  4I2I A;  1VJ5 A;  5KT2 A;  5DQG A;  1KDH A;  1ZET A;  3KHG A;  3BQ7 A;  1CI4 A;  2JZB A;  5HRG A;  3SV3 A;  1FEZ A;  3KHR A;  3RJF A;  4QZH A;  4QWE A;  5DBA A;  3NUQ A;  3UXN A;  3WKB A;  4OCZ A;  3PSF A;  4US8 A;  3PZP A;  2FMS A;  2BGW A;  2LM4 A;  2YMM A;  4KX3 A;  2LPE A;  7ICK A;  1D8B A;  5HRK A;  3LYS A;  2W9M A;  4KLI A;  2PKE A;  2KZM A;  1ED1 A;  1L8L A;  5J2G A;  4BX9 C;  4X4R A;  5J8Y C;  8ICJ A;  3V7K A;  1VJ7 A;  1D9D A;  4ED7 A;  4I28 A;  3TAD C;  4CCH A;  4WC4 A;  5JTG A;  2P6R A;  3JZ0 A;  1X40 A;  1JXE A;  1QQ5 A;  3SEI A;  5KFN A;  3ISD A;  4WC2 A;  3RJG A;  3ONN A;  5AKZ A;  3PW2 A;  3TAR A;  2H3Z A;  4NLC A;  2W8K A;  3H8M A;  2W9B B;  2AGO A;  1KLN A;  1PK1 A;  3K7D A;  2ZH2 A;  5KFP A;  3PY8 A;  3LQC B;  2DL0 A;  2E8O A;  4ELV A;  3AU2 A;  3GV5 B;  1SL0 A;  4DS5 A;  1BPY A;  2DR8 A;  3NYB A;  3WK7 A;  2F3N A;  3K1R B;  1SZH A;  3O0F A;  4OJP A;  5DKW A;  4O0I A;  1K1S A;  2Y1J A;  4AYB F;  1L5U A;  4RZR A;  1JQR A;  4LZD A;  1ZQJ A;  4GXK A;  4I29 A;  2KSO A;  2IUB A;  5J0S A;  1F5A A;  3ER9 B;  3NWI A;  4PH5 A;  8ICK A;  1MIV A;  3QU2 A;  5KFV A;  4UAR A;  4LEZ A;  3V6K A;  4IG8 A;  4RNM A;  2KE7 A;  1RYS A;  3EZ5 A;  1ZOL A;  3QUT A;  1QQ7 A;  2KKV A;  3RJE A;  1OW5 A;  2W7P A;  3UXP A;  1A6S A;  4AT7 A;  4EX7 A;  5T14 A;  2E1E A;  9ICB A;  3GIL A;  4X5V A;  2WAQ C;  4DL6 A;  4RQM A;  1B43 A;  4PL2 A;  5ALR A;  4NM2 A;  2HMX A;  2HHS A;  1ZQD A;  4WBZ A;  3BS5 A;  5KFB A;  2Q66 A;  4O5C A;  2OXO A;  2LYA A;  4LJX A;  1S77 D;  1N62 A;  3BS7 A;  1ZD3 A;  3RTV A;  4F4K A;  4BDP A;  4NXV A;  1SXD A;  3MFI A;  4YD2 A;  4NXT A;  2HHW A;  2DUY A;  3C5F A;  2P66 A;  8ICX A;  4FFD A;  4KB6 A;  3OHA A;  1KRP A;  2M9N A;  5ALP A;  5DBC A;  4M9G A;  2Z7J A;  4WC0 A;  4WC3 A;  2RRD A;  4GFJ A;  3WFS C;  3PSI A;  2D6F C;  3LVV A;  3F2C A;  4FHY A;  4K9B A;  2ZTC A;  2I6X A;  5HRF A;  2C28 A;  1X42 A;  4KLO A;  4FE3 A;  4IQV A;  1C20 A;  2FLP A;  3B0Y A;  3KBB A;  2KTQ A;  3NVO A;  3C66 A;  4NXZ A;  1X9S A;  4RUA A;  1COO A;  4ZH4 A;  2QAR B;  4UB3 A;  3CP8 A;  2W55 A;  4R64 A;  4QZI A;  4ECY A;  1TFW A;  1D8L A;  4RUC A;  3ETL A;  1FIQ A;  5L1M A;  2FDR A;  1UEV A;  1T7P A;  1QH9 A;  3Q8S B;  4WH5 A;  3BS5 B;  4YXJ A;  1T3Q A;  2O5A A;  4BJQ A;  5ALY A;  4RNO A;  5J2H A;  2OM6 A;  4RQ0 A;  4O69 A;  9ICP A;  3C21 A;  4B9V A;  5DDY A;  4RPX A;  1KFT A;  4KLJ A;  1JI7 A;  2VAN A;  1N56 A;  8ICZ A;  5KT6 A;  4F71 A;  2ZH7 A;  2JH7 A;  2HN1 A;  3AN1 A;  2ZH9 A;  2GA9 D;  3SAG A;  3RR8 A;  5CHG A;  1ZRN A;  4KLS A;  3NS1 A;  2GO7 A;  3QZ7 A;  9ICO A;  4RWP A;  2W3S A;  4C4S A;  3LWL A;  1B0X A;  2MA1 A;  1PVQ A;  1SV4 A;  4ECZ A;  3SYZ A;  2HVH A;  2IOF A;  2JMG A;  3HP6 A;  4R63 A;  2DPI A;  2H3I A;  2G5I B;  4WBY A;  1HJP A;  3CW2 C;  2ZXH A;  1NJW A;  4PPX A;  2EDU A;  3V6H A;  4K96 A;  4YN4 A;  4GC7 A;  3E2E A;  4KM5 A;  8ICP A;  3GFK B;  7ICN A;  5BOL A;  3EPI A;  4YMO A;  3C2M A;  2AJQ A;  5AK3 A;  1URJ A;  4N7R A;  4CE6 A;  3V6J A;  2Q0Z X;  3HWT A;  4F5Q A;  3KFU F;  7ICT A;  4Y2V A;  2PI5 A;  2AHO B;  2AXT U;  4HAI A;  4X4V A;  3EUB 2;  5AM5 A;  5AIA A;  1X66 A;  4IRK A;  1N5W A;  5KFD A;  5HR7 A;  5CR0 A;  1P7D A;  4JWN A;  3WFP A;  2ZH6 A;  7ICS A;  2K8B B;  2ZH1 A;  4F5P A;  2FLN A;  4GXJ A;  5TZV A;  4OJO A;  1A77 A;  1Q3V A;  1HIW A;  4TUQ A;  4QIW C;  5KFE A;  4YD1 A;  2HVI A;  3JPP A;  3THV A;  2BBJ A;  1PX5 A;  5KT4 A;  2HBM A;  4RQ6 A;  1UT5 A;  1UCV A;  4FHP A;  1ZQI A;  3G6X A;  4EBE A;  1QTM A;  5J2B A;  1SKS A;  4EYI B;  2KV2 A;  2F1I A;  2F8K A;  3QYP A;  7ICQ A;  1KQQ A;  3QUC A;  4DSE A;  2UVR A;  2QAR A;  2ZHA A;  5IIM A;  4X0B A;  4DSL A;  3KHH A;  4X4S A;  1XS9 D;  1KN5 A;  5KFK A;  4K4H A;  4CDG A;  4R8U B;  2ZUD A;  8ICT A;  1HUO A;  4RQ1 A;  2R8J A;  3AMZ A;  4Y2T A;  3WK6 A;  4LEW A;  2CPR A;  3KOO A;  4IQT A;  2VA2 A;  4UQG A;  1YLQ A;  5K4L A;  4EX6 A;  5CWR A;  2KZ3 A;  4M0A A;  2XC9 A;  4C8L A;  1R89 A;  5J8Y A;  2JGA A;  4FZL A;  4C4T A;  3F5A A;  4QWC A;  4J9O A;  5EWF A;  1ZQQ A;  3H0R B;  4EEK A;  2NRV A;  4OD0 A;  2GOL A;  3GQC A;  1T4G A;  4R8U A;  4FH5 A;  3KKA C;  2KSO B;  4O3P A;  4UD4 A;  2W8L A;  3RAQ A;  3FM9 A;  1TK0 A;  3RB0 A;  5J29 A;  2R8I A;  3EWA A;  2KVC A;  2QB0 A;  1DRG A;  2MRL A;  1JIH A;  4US9 A;  4K99 A;  3FYH A;  4NJ8 A;  2G07 A;  2KMD A;  4OAI Z;  3H8J A;  2JEJ A;  2CRX A;  2I5H A;  3T79 A;  3BJY A;  3N28 A;  4ED0 A;  4WOY A;  4AYB C;  2HBL A;  1TK5 A;  4YP3 A;  4IR9 A;  3H0L B;  4J9N A;  2R18 A;  5ALF A;  1J97 A;  5KFH A;  2EZY A;  4AT8 B;  1Z1B A;  2VA3 A;  2HSZ A;  2FPM A;  5AI4 A;  2W9A A;  4KLH A;  4X4O A;  4ED2 A;  1SKR A;  4QWD A;  4KLL A;  2NRK A;  3AM9 A;  3OPX A;  3MR5 A;  3PSP A;  3KHL A;  3R9K A;  4NXU A;  2KFZ A;  5KG3 A;  2FLL A;  3OVS A;  4FH3 A;  4LT6 A;  2KIV A;  4X4T A;  2B51 A;  2Y9T A;  2XCP A;  5HRL A;  2W04 A;  4DFM A;  2DFL A;  4YR0 A;  3WK5 A;  2V4R A;  2JH1 A;  3JCF A;  5DDM A;  2IOH A;  4F2S A;  2V4Q A;  1OU5 A;  5KFR A;  5HHH A;  5AK5 A;  5ALD A;  5J0P A;  3PMN A;  1MQ3 A;  1TV9 A;  4UAS A;  5ALH A;  1L7P A;  3OSN A;  1IG6 A;  4YQW A;  3HRD D;  1U9L A;  1IV8 A;  1PK3 A;  5ALS A;  4J9K A;  5AKX A;  3SQI A;  7ICF A;  1YZ7 A;  3C23 A;  5KL8 B;  5AM3 A;  4RWQ A;  5F2V O;  3HJ1 A;  4O3N A;  2BQ3 A;  4ECS A;  3V7J A;  1L8O A;  3D2Q A;  3AU6 A;  2C2D A;  2ZIX B;  4JB3 A;  3ISC A;  1XSL A;  1KKX A;  4P4P A;  2XY7 A;  4LEY A;  1ZRM A;  1F5S A;  1V9P A;  1DK3 A;  9ICI A;  2K60 A;  4QZB A;  2PFQ A;  2E1F A;  5G5G A;  2GAF D;  3AQL A;  2PMZ F;  2NRZ A;  4ATB B;  3I1Y A;  3IHQ B;  1N61 A;  5C0Y A;  3Q8Q B;  1V4A A;  5ALX A;  5F3X B;  3WKE A;  1XO1 A;  3WFQ E;  3RRG A;  4EZ6 A;  1F44 A;  2DWQ A;  3C18 A;  3CK6 A;  1TAU A;  4NXW A;  5AI5 A;  1BPD A;  5ALJ A;  1SIJ A;  4DF4 A;  5EE1 A;  8ICE A;  5IIK A;  1NNL A;  2KIW A;  2J6U A;  1N63 A;  1L7N A;  5GTH U;  4NLG A;  3D2N A;  3L5K A;  2XGP A;  3WFO A;  4LZG A;  2G5H B;  9ICR A;  2EQY A;  3MGH A;  4C7Z A;  4ED1 A;  9ICX A;  2BR0 A;  5B3Q A;  2MAX A;  3H0M B;  5AI9 A;  3MDA A;  2VJ4 A;  2ASD A;  3HIL A;  5DEC A;  3SD7 A;  5KAF U;  2XY6 A;  5KT7 A;  2PBE A;  1ZD2 P;  2B0C A;  2VJ5 A;  1XC9 A;  1S8O A;  1NK4 A;  3AQM A;  4Q8E A;  4K98 A;  3PST A;  1X9M A;  5ALN A;  3Q8L A;  5AIC A;  1IIP A;  1XU4 A;  5AK4 A;  3RH4 A;  3NGD A;  5DB7 A;  2GWS A;  4UBC A;  2Y1I A;  4X4Q A;  3RF9 A;  3B0X A;  4QZG A;  2ZHB A;  1QSY A;  9ICE A;  5DQH A;  4EZ9 A;  1L3S A;  3UXO A;  3L9D A;  4DF8 A;  4KLD A;  5KG7 A;  2ZG6 A;  1L3V A;  4PHE A;  3H8S A;  1V38 A;  4RU9 A;  2AQ4 A;  2A1A A;  2C2R A;  3ZDE A;  1ZQT A;  5ALK A;  2HHT A;  5KFF A;  4DOC A;  3CYM A;  4I2C A;  3OSP A;  4M9N A;  1SB3 C;  3PX6 A;  2ESE A;  4K97 A;  2JR5 A;  2Y0S C;  3NRW A;  4M6W B;  2BKE A;  2RHF A;  4EP7 A;  3RB4 A;  2IBK A;  3HX0 A;  4K4I A;  5L1I A;  3SI8 A;  3HKZ C;  4F2R A;  1S5L U;  2KNJ A;  2DQN B;  4FHV A;  4O9M A;  5AK6 A;  5KL1 B;  2ATL A;  1ZQS A;  2IHM A;  2OH2 A;  3M9M B;  1BVS A;  1DXS A;  4DOB A;  3TFR A;  2HBK A;  4RQ2 A;  2YB4 A;  1FFV A;  1KFD A;  4EGW A;  1GPJ A;  4F4Y A;  5J0X A;  2M2U A;  7ICE A;  1NOM A;  2BQU A;  1TKD A;  2HHU A;  8ICM A;  4GLX A;  5BPC A;  4ED8 A;  4B9U A;  3TAQ A;  3ZD9 A;  4AT8 A;  5J2E A;  3QEA Z;  2OEH A;  1X6J A;  4LEV A;  1ECW A;  4I2A A;  1MC8 A;  4DLG A;  4E8F A;  3HJE A;  5HRD A;  1J2N A;  4WC5 A;  2WFA A;  4B9N A;  3QU7 A;  4C80 A;  4DFK A;  1SL1 A;  2FE9 A;  2NRT A;  4KLU A;  3J81 j;  4NWI A;  8ICF A;  3MR3 A;  4TUR A;  4R66 A;  3M6K A;  4WQK A;  4FHX A;  1WG8 A;  4U6P A;  2F44 A;  4P0Q A;  4BWJ A;  2OYY A;  4E80 A;  3PV8 A;  3F2B A;  5J2A A;  3OVA A;  1KBU A;  2MUT A;  2LI6 A;  2LM1 A;  2F1J A;  2FI1 A;  5H2F U;  3C5G A;  4O3S A;  1CRX A;  4GXI A;  7ICV A;  4DQR A;  3RJK A;  2ZUC A;  4K9A A;  4C0Z A;  4QWA A;  9ICQ A;  1L7M A;  4KLG A;  3OTQ A;  4EV6 A;  4WC1 A;  3FAH A;  3TAP A;  4EBC A;  4Y2S A;  4DL2 A;  1X9W A;  3Q8M A;  2ZTE A;  3LDA A;  1T94 A;  3V72 A;  4X4U A;  2KEY A;  4QZ9 A;  1SGG A;  3OV7 A;  8ICU A;  4I2H A;  1ZXI A;  1S0O A;  2YX8 A;  4R65 A;  2K4I A;  4NLZ A;  1TFY A;  4E0D A;  4O5E A;  4YCX A;  5FP0 A;  2O6K A;  2IOF K;  5AKE A;  2BBH A;  5AIB A;  2JHD A;  5DB8 A;  1MA7 A;  4O3Q A;  5DBB A;  5A0L A;  2JEI A;  1U4B A;  4KMO B;  2QB0 B;  1NJZ A;  2B56 A;  3MGV A;  1RZT A;  3UQ2 A;  2ZIX A;  5KG1 A;  3GIJ A;  5B5E U;  3QZ8 A;  3DV9 A;  2W9B A;  3QNM A;  4QJF B;  4IQU A;  3VC8 A;  1RQN A;  2HHP A;  4Z6C A;  4LVS A;  2KOB A;  1ZQO A;  5AM2 A;  4DEZ A;  4ICA A;  3MAB A;  5ALV A;  2XVT A;  9ICV A;  1NK0 A;  4FZM A;  4A8E A;  1D8Y A;  2HCF A;  3D6J A;  5IIN A;  2YTU A;  2BCV A;  3RBD A;  1WWV A;  1V97 A;  3RAX A;  4JUZ A;  1ZQG A;  3U26 A;  4FHW A;  4UAZ A;  4DSI A;  9ICC A;  2ASL A;  5HMM A;  3OGU A;  5CRX A;  3JPR A;  1JMS A;  2YQE A;  2KP7 A;  1BPX A;  4DS4 A;  2RP5 A;  4C8M A;  4P0P A;  1RXW A;  1RXV A;  3WU2 U;  2EZZ A;  1KEJ A;  2J6S A;  1ZQE A;  1QCK A;  5JU5 A;  3PW4 A;  1RYR A;  1DK2 A;  5KFJ A;  4CRX A;  2PFO A;  4YMM A;  3IG5 A;  7ICO A;  8ICQ A;  1Q79 A;  1U45 A;  2KHV A;  3JPS A;  4Y2P A;  2F77 X;  2VA8 A;  3H38 A;  1MIY A;  4F5O A;  4J9Q A;  4ECQ A;  4KLF A;  5DED A;  4M2Y A;  2WF6 A;  2WB1 F;  2HHV A;  4QW8 A;  2AU0 A;  1SXE A;  2F2A B;  2ISO A;  1Z1V A;  9ICW A;  2FMP A;  1ZQA A;  1Q8K A;  5AKK A;  4F92 B;  5ALQ A;  8ICG A;  5KFG A;  2AQ0 A;  3GII A;  3PW7 A;  3WKD A;  4BUG A;  1D9F A;  3Q8K A;  1A76 A;  1LVH A;  4ECV A;  1KTQ A;  7ICI A;  3WKA A;  1AQ6 A;  4P2H A;  2UVU A;  2DPJ A;  5KFZ A;  3ZDD A;  4JLX A;  5AKJ A;  2GH1 A;  1MSW D;  2WF8 A;  4I2G A;  3KD3 A;  5J0O A;  2HDO A;  3Q8P B;  5AI6 A;  3C1Z A;  2XGQ A;  4BXO A;  2M2T A;  2HHQ A;  4NV0 A;  5AKG A;  1MQ2 A;  1OXJ A;  1WWU A;  3WK4 A;  1XWL A;  3CNH A;  4B9M A;  2F1H A;  3H40 A;  5J0Y A;  1NKE A;  2IMW P;  1HUZ A;  4UB6 U;  1R8B A;  5CHE A;  5AKH A;  4E7X A;  3SMV A;  3N97 B;  4IS7 A;  4S3N A;  3OJU A;  4YG2 A;  2KJ8 A;  2UVW A;  4F50 A;  2XY5 A;  4IC9 A;  4RWN A;  3UQ0 A;  1UHU A;  1ZQB A;  3RJH A;  2BPF A;  2ZJA A;  5J0U A;  4ED6 A;  2ZH3 A;  4ECU A;  3EPG A;  2PFN A;  3RR7 A;  1JAL A;  1PZN A;  5L9X A;  8ICV A;  5IIL A;  1ZQU A;  3EF2 A;  5GTI U;  3PNC A;  3NRZ A;  2N1R A;  4OJL A;  4PJ0 U;  3JPN A;  1FFU A;  3AEV A;  4C8N A;  3KKA A;  3MR2 A;  3OHB A;  1UET A;  4GIB A;  2AGP A;  4X0A A;  4OJ6 A;  4F4W A;  2C22 A;  1RM6 C;  3K75 D;  1TAQ A;  3RBE A;  4JMU A;  2FCL A;  5ALO A;  5KTQ A;  3PR5 B;  3G6Y A;  4KX5 A;  5KG5 A;  5DLF A;  1L3U A;  2KD1 A;  3JPT A;  2W43 A;  4O3O A;  4O6A A;  4M9H A;  1WCL A;  5DG9 A;  5KFS A;  2HBJ A;  5CEH A;  3H4B A;  5KFL A;  5JTI A;  1LB2 B;  5L1K A;  4I2F A;  2B6G A;  4J9P A;  3QXG A;  3SR6 A;  4EEN A;  4X4N A;  5HML A;  4KN4 A;  2DR9 A;  1ZQV A;  4MFA A;  4EYH B;  2JZB B;  4J9R A;  3ED5 A;  2VKQ A;  4C4R A;  1JXL A;  4QWB A;  3AQN A;  3OWG A;  3F53 A;  5J0Q A;  1TE2 A;  4KIT B;  2DKX A;  3TQ1 A;  2HI0 A;  1BPB A;  3GDX A;  2H3F A;  3N7P D;  3OJS A;  2BZF A;  3GU3 A;  1VDV A;  4EBD A;  4F5R A;  2XIC A;  1PUZ A;  4MF8 A;  5HR9 A;  2MU2 A;  5B3P A;  5B66 U;  2A3V A;  2BDU A;  3QU9 A;  4QNL A;  4ECW A;  3ERC C;  2HOQ A;  1QSS A;  1JX4 A;  3UM9 A;  5F9N A;  1L7O A;  2RLT A;  4WJ3 B;  2D3D A;  4P0P B;  2JEG A;  1ZQM A;  1NKC A;  3TAN A;  5AM4 A;  3NKU A;  1IM4 A;  5J0T A;  3KZX A;  4UAY A;  5ALE A;  4USA A;  5KFX A;  3H3A A;  4C8K A;  4UB4 A;  3K4G A;  4C8O A;  3GZF A;  3ZD8 A;  3Q8R B;  5DB6 A;  2RDI A;  2E8M A;  3PX0 A;  1S10 A;  2LYH A;  3RB3 A;  5DGA A;  4XJE A;  4JV2 A;  1Z00 A;  1ZQX A;  4M04 A;  3M7D A;  3AQK A;  5AM0 A;  5HR6 A;  4F3O A;  2XCA A;  2FPK A;  5DQI A;  2KN7 A;  3DEE A;  4B6J A;  1S0V A;  3TKA A;  2R8H A;  2BPC A;  4AT9 A;  4I2D A;  3QX7 A;  4Z6D A;  4KTQ A;  5KFC A;  1ZQH A;  4MEY A;  4QIW F;  5KFU A;  2CN1 A;  1V85 A;  4NM1 A;  4Y2U A;  3C2L A;  2W3R A;  2FMQ A;  5HC9 A;  3UPS A;  3BQ2 A;  4DL7 A;  3PML A;  2B21 A;  1BGX T;  3L4P A;  3C29 A;  2DR5 A;  4F5N A;  5EE0 A;  4EED A;  2NV3 A;  4UB1 A;  4FS1 A;  3BDP A;  4Y2Y A;  3WKC A;  3GIK A;  1TVA A;  4B9L A;  4CNQ A;  5BOM A;  4F8R A;  1FO4 A;  4F4X A;  4XA5 A;  5ALW A;  3FC4 A;  4ZOH C;  1B4F A;  4NKT A;  3ZDC A;  4O68 A;  5ALL A;  4B9S A;  4UD5 A;  3NVV A;  4IRD A;  1LKY B;  1K1Q A;  2WF9 A;  4KLQ A;  4TQR A;  4F93 B;  1NZP A;  8ICY A;  2K4P A;  2AGQ A;  1N2X A;  2C2E A;  3MDC A;  1NJX A;  1Z3E B;  4RQ8 A;  4NL9 C;  4KLE A;  2BPG A;  1ZQK A;  4AT7 B;  2WB1 C;  3AUO A;  1Z19 A;  2A1J A;  3LWM A;  5EOZ A;  2BCR A;  4QZA A;  5D61 A;  5ALI A;  2K89 A;  1PVR A;  2LHT A;  4UAT A;  2JV3 A;  4DSK A;  5CP2 A;  2LYB A;  3RH5 A;  4DQQ A;  2A19 A;  2ZTD A;  2NRX A;  2H5X A;  5HRI A;  2KJ5 A;  1BPE A;  4UB2 A;  3RFA A;  3GV8 B;  4K8V A;  4DLE A;  2WF7 A;  3MFH A;  4YR3 A;  3AL0 B;  5ALZ A;  3EW9 A;  3BQ1 A;  1PVP A;  4O3M A;  1O03 A;  1XSN A;  2KVS A;  4Z6E A;  2BE3 A;  5D49 A;  9ICJ A;  4DQI A;  2RQ5 A;  2LBO A;  1NJY A;  1BPZ A;  3ER8 C;  4P4M A;  2KHQ A;  2W7O A;  1TFR A;  4P0Q B;  2H3V A;  7ICG A;  5J0R A;  2JRZ A;  1ZQP A;  4NKU A;  1OUQ A;  3SZ2 A;  3I28 A;  4DWI A;  2J6T A;  4Q43 A;  8ICN A;  9ICK A;  4MKP A;  3HJ4 A;  4KMU A;  2I1Q A;  3ZDB A;  8ICC A;  1JUD A;  3IDW A;  2YB1 A;  1UQV A;  2ALZ A;  3N7R C;  3QE9 Y;  4ACO A;  4FS2 A;  2E8N A;  5C5J A;  4O3R A;  4ECX A;  5CFS A;  1WOT A;  1F0M A;  4Y2R A;  4PGX A;  5HNK A;  1C7Y A;  3M8S A;  3RH6 A;  1EXN A;  1N60 A;  5J2J A;  4KLM A;  2ID1 A;  2OCE A;  4UAU A;  4M9L A;  1WYG A;  2NRW A;  2YMP A; 
#chains in the Genus database with same CATH homology
 2M2W A;  4J9S A;  4PHD A;  4RQ7 A;  1BPX A;  4DS4 A;  4DSF A;  1CEZ A;  2KP7 A;  3HT3 A;  3H8J A;  5HHI A;  4C8M A;  2JEJ A;  1JAJ A;  2RFF A;  4DO9 A;  4JWM A;  1RXW A;  1RXV A;  2DVI A;  3BJY A;  1NK8 A;  4DL4 A;  4ED0 A;  3M8R A;  1L3T A;  4UAW A;  4DL3 A;  1KEJ A;  1S0N A;  2J6S A;  1UA0 A;  4XRH A;  3H37 A;  4M9J A;  1T8E A;  7ICP A;  1ZQE A;  3PW4 A;  5KFQ A;  1RYR A;  1DK2 A;  5KFJ A;  1TK5 A;  5J2I A;  4QZF A;  3M9N B;  4RQ5 A;  1NO5 A;  4M5D A;  4J9L A;  1S9F A;  2PFO A;  4YP3 A;  4YMM A;  4JV1 A;  4IR9 A;  2OWO A;  7ICO A;  8ICQ A;  4J9N A;  2WTF A;  5CA7 A;  4RNN A;  1U45 A;  1Q79 A;  3MBY A;  4MFF A;  3PW0 A;  3JPS A;  4PHA A;  2ZH5 A;  2MUT B;  5KFH A;  4DQS A;  2VA8 A;  4AT8 B;  4DOA A;  1MIY A;  2VA3 A;  4ECR A;  5L1J A;  3H38 A;  4F5O A;  4J9Q A;  4ECQ A;  4KLT A;  5KG4 A;  1NKB A;  4KLF A;  5DED A;  5J0W A;  2FPM A;  5KG6 A;  5III A;  4M2Y A;  5KFT A;  5JUM A;  2HHV A;  4QW8 A;  2AU0 A;  1H38 A;  9ICW A;  2ISO A;  4WC5 A;  2DRA A;  4FBT A;  3JPO A;  5CJ7 A;  2FMP A;  4F4Z A;  5KFM A;  2A1J B;  4UBB A;  1ZQA A;  2W9A A;  4EBJ A;  3IM1 A;  1QLN A;  1U49 A;  4KLH A;  1NK6 A;  2JEF A;  4X4O A;  1UT8 A;  4ED2 A;  5EWE A;  3KTQ A;  4F92 B;  4I2I A;  1SKR A;  8ICG A;  5KT2 A;  4BXO B;  5DQG A;  5KFW A;  5KFG A;  5KFA A;  4KN7 A;  2AQ0 A;  1KDH A;  4QWD A;  3GII A;  3PW7 A;  1ZET A;  4KLL A;  3KHG A;  4FBU A;  2R8K A;  5DG7 A;  2NRK A;  2JZB A;  1TK8 A;  3MR5 A;  1D9F A;  5HRG A;  3SV3 A;  3KHR A;  3KHL A;  3Q8K A;  1A76 A;  4QZH A;  4ECV A;  3RJF A;  4QWE A;  1KTQ A;  1S97 A;  3V7L A;  5DBA A;  2ISP A;  3OVB A;  4MF2 A;  3OUY A;  2KFZ A;  3ORY A;  4IQW A;  7ICI A;  1R8A A;  5KG3 A;  2FLL A;  2M2V A;  4NLN A;  3OVS A;  3ISB A;  4FH3 A;  4LT6 A;  4P2H A;  2UVU A;  2DPJ A;  3UXN A;  5KFZ A;  4X4T A;  2XCP A;  3ZDD A;  5HRL A;  3T5J A;  2DFL A;  4DFM A;  4YR0 A;  3JPQ A;  2V4R A;  5KFI A;  8ICW A;  5J2K A;  1MSW D;  3MR6 A;  4I2G A;  9ICH A;  4RPZ A;  2BGW A;  2FMS A;  3HIY A;  5J0O A;  1Q78 A;  7ICM A;  3Q8P B;  5DDM A;  5EWG A;  3T3F A;  1QSL A;  3C1Z A;  2XGQ A;  1ZQN A;  7ICK A;  4PHP A;  4BXO A;  2M2T A;  5HRK A;  2HHQ A;  2W9M A;  4F2S A;  2V4Q A;  3GIM A;  5KFR A;  4KLI A;  1MQ2 A;  3PO4 A;  4B9M A;  2KZM A;  1XWL A;  5HHH A;  2F1H A;  5DGB A;  3H40 A;  5J2G A;  5J0P A;  5J0Y A;  2IHN A;  2O1P A;  3PMN A;  1NKE A;  1MQ3 A;  1TV9 A;  2W9C B;  2IMW P;  1HUZ A;  1R8B A;  4X4R A;  2RDJ A;  1OU5 A;  4QW9 A;  4FO6 A;  4E7X A;  3OSN A;  8ICJ A;  9ICU A;  3V7K A;  1DOQ A;  3N97 B;  1NK5 A;  1VJ7 A;  4YQW A;  4Q8F A;  1U9L A;  4S3N A;  1D9D A;  4ED7 A;  4I28 A;  4J9K A;  5HRE A;  3OJU A;  4ATB A;  4CCH A;  4YG2 A;  3C1Y A;  2UVW A;  2P6R A;  7ICF A;  4F50 A;  2XY5 A;  4WC4 A;  3JZ0 A;  4XQ7 A;  3C23 A;  4RWQ A;  1JXE A;  3MGI A;  5F2V O;  3UQ0 A;  4RWN A;  3HJ1 A;  5KFN A;  3ISD A;  4O3N A;  1ZQB A;  2BQ3 A;  2BPF A;  2ZJA A;  3RJH A;  4XQ8 A;  4ECS A;  4I2B A;  4WC2 A;  3V7J A;  5J0U A;  3RJG A;  4MFC A;  3PW2 A;  3AU6 A;  2C2D A;  3TAR A;  4I2J A;  1U48 A;  4ELU A;  2W8K A;  4ED6 A;  3ISC A;  2AGO A;  2W9B B;  1XSL A;  1KLN A;  1SL2 A;  2ZH3 A;  4ECU A;  4P4P A;  2XY7 A;  3EPG A;  2PFN A;  3RR7 A;  2ZH2 A;  5KFP A;  1V9P A;  2W9C A;  3PY8 A;  1PZN A;  5L9X A;  8ICV A;  9ICI A;  1DK3 A;  5IIL A;  4QZB A;  4YR2 A;  2PFQ A;  1ZQU A;  4ELV A;  3AU2 A;  3GV5 B;  1SL0 A;  3PNC A;  1S0M A;  7ICJ A;  4DS5 A;  3JPN A;  1BPY A;  3AQL A;  2DR8 A;  3NYB A;  4DFJ A;  5J2D A;  2NRZ A;  4ATB B;  1IXR A;  4C8N A;  5DKW A;  2I9G A;  4E8F A;  3IHQ B;  7ICL A;  4O0I A;  3Q8Q B;  2ASJ A;  1V4A A;  1K1S A;  3OHB A;  3MR2 A;  3BQ0 A;  2Y1J A;  3H8W A;  1UET A;  1XO1 A;  2AGP A;  4X0A A;  4F4W A;  2C22 A;  3WFQ E;  3K75 D;  3TI0 A;  3RRG A;  4EZ6 A;  1TAQ A;  3C18 A;  1L5U A;  4RZR A;  1SZP A;  4LZD A;  3RBE A;  1ZQJ A;  1JQR A;  4RT3 A;  1MIW A;  4GXK A;  1TAU A;  2NRW A;  4I29 A;  5J0S A;  1F5A A;  1BPD A;  2DRB A;  4PH5 A;  5KTQ A;  3PR5 B;  8ICK A;  3G6Y A;  5D4B A;  4DF4 A;  5KFV A;  1ZJN A;  1MIV A;  5DLG A;  8ICE A;  7ICU A;  5IIK A;  2J6U A;  1R8C A;  5IIJ A;  5KG5 A;  4NLG A;  8ICS A;  5DLF A;  1RPL A;  3T5H A;  3V6K A;  3LQC B;  1L3U A;  2XGP A;  3HPO A;  3JPT A;  3WFO A;  4IG8 A;  5KT5 A;  4LZG A;  4RNM A;  1RYS A;  3EZ5 A;  9ICR A;  2FPL A;  4O3O A;  4ED1 A;  3MGH A;  9ICX A;  2BR0 A;  3RJE A;  3HW8 A;  4M9H A;  1WCL A;  5DG9 A;  3UXP A;  2MAX A;  4WC6 A;  3EYZ A;  5KFS A;  3MDA A;  4AT7 A;  2ASD A;  3H4B A;  9ICB A;  5DEC A;  5KFL A;  1LB2 B;  3GIL A;  5L1K A;  5J2C A;  4X5V A;  4I2F A;  4JV0 A;  1XSP A;  4J9P A;  4QZC A;  4M6W A;  2IA6 A;  4DFP A;  4DL6 A;  2XY6 A;  1B43 A;  5KT7 A;  4NM2 A;  2PBE A;  8ICI A;  2HHS A;  1ZQD A;  4WBZ A;  5HML A;  4X4N A;  5KFB A;  1SKW A;  4KN4 A;  1XC9 A;  2DR9 A;  2Q66 A;  3TFS A;  1ZQV A;  2XO7 A;  4MFA A;  4O5C A;  1NK4 A;  9ICL A;  1S77 D;  4EYH B;  2JZB B;  3AQM A;  4Q8E A;  1CUK A;  4J9R A;  3NTU A;  3RTV A;  4F4K A;  4BDP A;  1Z00 B;  1JXL A;  3MFI A;  7ICR A;  4QWB A;  1X9M A;  3AQN A;  3Q8L A;  4YD2 A;  5J0Q A;  4KIT B;  2HHX A;  2HHW A;  1XU4 A;  3C5F A;  3TQ1 A;  3RH4 A;  1U47 A;  3NGD A;  2P66 A;  3FDS A;  8ICX A;  1BPB A;  5DB7 A;  2GWS A;  2PXI A;  3OHA A;  4UBC A;  2M9N A;  1KRP A;  3RJJ A;  4WCW A;  2Y1I A;  3SV4 A;  4X4Q A;  4RWO A;  5DBC A;  5IIO A;  4M9G A;  3GDX A;  3B0X A;  4QZG A;  4WC0 A;  3OJS A;  2ZHB A;  3PX4 A;  1QSY A;  9ICE A;  4WC3 A;  3WFS C;  5DQH A;  4EZ9 A;  1L3S A;  3UXO A;  4QZ8 A;  3QEB Z;  2ZTC A;  4EBD A;  4F5R A;  3L9D A;  4GC6 A;  4DF8 A;  9ICT A;  4KLD A;  1UEU A;  5KG7 A;  5HRF A;  5J2F A;  4MF8 A;  4K4G A;  4ECT A;  2C28 A;  5HR9 A;  4KLO A;  4B9T A;  1B22 A;  4IQV A;  5HRH A;  1L3V A;  4I2E A;  4PHE A;  2FLP A;  3H8S A;  1ZQC A;  3H39 A;  3B0Y A;  4YFK A;  2KTQ A;  4ECW A;  4PGY A;  4RU9 A;  3C66 A;  4NXZ A;  2AQ4 A;  2C2R A;  1X9S A;  4F91 B;  1QSS A;  9ICA A;  3ZDE A;  4RUA A;  1ZQT A;  1JX4 A;  1COO A;  9ICM A;  4ZH4 A;  4XUS A;  4UB3 A;  3PO5 A;  4DL5 A;  4R64 A;  4QZI A;  3PR4 A;  1JN3 A;  4ECY A;  2HHT A;  4FHY A;  1TFW A;  1D8L A;  4YMN A;  5F9N A;  5KFF A;  4RUC A;  3ETL A;  4DOC A;  1ZJM A;  8ICL A;  4I2C A;  2JEG A;  3OSP A;  1ZQM A;  4M9N A;  1NKC A;  3TAN A;  1UEV A;  3PX6 A;  1T7P A;  1IM4 A;  5J0T A;  8ICB A;  3Q8S B;  3PVX A;  4UAY A;  2R8G A;  4NLK A;  4BWM A;  8ICH A;  1FA0 A;  5KFX A;  4YXJ A;  3H3A A;  2O5A A;  4M6W B;  4RNO A;  2BKE A;  5J2H A;  4UB4 A;  4C8K A;  4EP7 A;  3K4G A;  3RB4 A;  4C8O A;  4RQ0 A;  2IBK A;  3ZD8 A;  3HX0 A;  3Q8R B;  5DB6 A;  3C21 A;  3ZDA A;  2RDI A;  5L1I A;  4B9V A;  4K4I A;  9ICP A;  5DDY A;  4RPX A;  3SI8 A;  1KFT A;  3PX0 A;  3OUY B;  4KLJ A;  1S10 A;  4F2R A;  2LYH A;  1N56 A;  2VAN A;  3G6V A;  1T3N A;  3RB3 A;  8ICZ A;  5KT6 A;  4J9M A;  5DGA A;  4FHV A;  2ZH7 A;  4JV2 A;  4YVZ A;  1Z00 A;  1ZQX A;  4I27 A;  4M04 A;  4O9M A;  3AQK A;  4F3O A;  2XCA A;  2FPK A;  5DQI A;  2IHM A;  2KN7 A;  2ATL A;  1ZQS A;  1ZQW A;  1UA1 A;  4DSJ A;  4TQS A;  2ZH9 A;  1S0V A;  5KFY A;  2BHN A;  3M9M B;  4EBK A;  3RR8 A;  1BVS A;  2BCQ A;  5CHG A;  4DOB A;  2R8H A;  3TFR A;  1NK7 A;  1ZQR A;  4RQ2 A;  4KLS A;  2BPC A;  4AT9 A;  4WC7 A;  4I2D A;  3QZ7 A;  1KFD A;  4M47 A;  9ICO A;  4RWP A;  4Z6D A;  3LWL A;  4F4Y A;  2ZJ5 A;  4UB5 A;  5J0X A;  5KFC A;  1ZQL A;  4KTQ A;  2M2U A;  7ICE A;  4ECZ A;  1NOM A;  4Z6F A;  2BQU A;  1ZQH A;  3RJI A;  4MEY A;  1TKD A;  2HHU A;  8ICM A;  1KNY A;  3SYZ A;  2HVH A;  5KFU A;  4GLX A;  5BPC A;  4ED8 A;  3HP6 A;  1ZQZ A;  4B9U A;  2ZH4 A;  4R63 A;  2DPI A;  4QZE A;  3TAQ A;  4NM1 A;  1ZQY A;  3ZD9 A;  1HJP A;  3C2L A;  4WBY A;  1VFG A;  1WCN A;  1NJW A;  4AT8 A;  4RQ3 A;  2BCS A;  2FMQ A;  4Q44 A;  5J2E A;  5L1L A;  3QEA Z;  4PPX A;  5HC9 A;  3UPS A;  4I2A A;  3BQ2 A;  3V6H A;  1MC8 A;  4QZD A;  2B21 A;  3PML A;  4YN4 A;  4GC7 A;  5D46 A;  4DLG A;  4DL7 A;  4IR1 A;  1BGX T;  3E2E A;  5HRD A;  4B9N A;  1Y88 A;  3GFK B;  3H7I A;  3UPQ A;  8ICP A;  4F5N A;  7ICN A;  5BOL A;  2DR5 A;  3EPI A;  4YMO A;  4DFK A;  1SL1 A;  3C2M A;  2AJQ A;  2NRT A;  4KLU A;  4P4O A;  4UB1 A;  4FS1 A;  8ICF A;  2V9W A;  3MR3 A;  3BDP A;  1S76 D;  2ZUB A;  4BGD A;  3BQT A;  4TUR A;  4R66 A;  3GIK A;  9ICG A;  3V6J A;  2Q0Z X;  3HWT A;  4F5Q A;  5KG0 A;  1TVA A;  4B9L A;  7ICT A;  5BOM A;  4F8R A;  2PI5 A;  4F4X A;  4XA5 A;  4FHX A;  4X4V A;  4Q45 A;  8ICR A;  4NKT A;  4BWJ A;  4IRK A;  9ICF A;  4E80 A;  1X2I A;  3ZDC A;  5KFD A;  3PV8 A;  4B9S A;  4UD5 A;  5CR0 A;  4MEX A;  4JWN A;  5J2A A;  8ICO A;  4IRD A;  3WFP A;  3OVA A;  2ZH6 A;  1K1Q A;  7ICS A;  2MUT A;  5KT3 A;  2P6U A;  4NY8 A;  3WFR E;  7ICH A;  3LK9 A;  4KLQ A;  2ZJ8 A;  2F1J A;  4F5P A;  1BNP A;  2ZH1 A;  4TQR A;  4F93 B;  1NZP A;  8ICY A;  2FLN A;  2C2E A;  2AGQ A;  5KFO A;  4GXJ A;  3MDC A;  3M9O B;  3C5G A;  1NJX A;  1Z3E B;  5TZV A;  4ELT A;  4RQ8 A;  3C2K A;  1ZQF A;  1A77 A;  4O3S A;  2KZZ A;  9ICN A;  4GXI A;  4KLE A;  4DQR A;  1ZQK A;  2BPG A;  2ZUC A;  3RJK A;  7ICV A;  4AT7 B;  3GV7 B;  4TUQ A;  3AUO A;  2A1J A;  5KG2 A;  4RQ4 A;  5EOZ A;  3LWM A;  5KFE A;  4YD1 A;  4X4P A;  2HVI A;  2BCR A;  4QZA A;  3JPP A;  3THV A;  4ED3 A;  4QWA A;  9ICQ A;  1PX5 A;  5KT4 A;  4RQ6 A;  5F9L A;  1UT5 A;  4KLG A;  4PGQ A;  8ICA A;  4FHP A;  2UVV A;  1ZQI A;  4DSK A;  4WC1 A;  5CP2 A;  3G6X A;  3TAP A;  4EBC A;  4EBE A;  1QTM A;  5J2B A;  3RH5 A;  1SKS A;  4DL2 A;  4DQQ A;  4EYI B;  2ZTE A;  4RPY A;  3Q8M A;  2F1I A;  2ZTD A;  3LDA A;  1X9W A;  1NK9 A;  2NRX A;  7ICQ A;  2H5X A;  3V72 A;  4TUS A;  5DB9 A;  4X4U A;  2BQR A;  5HRI A;  4QZ9 A;  1BPE A;  4UB2 A;  4DSE A;  1BNO A;  3OV7 A;  8ICU A;  3GV8 B;  4I2H A;  4DLE A;  2UVR A;  1S0O A;  3MFH A;  4YR3 A;  5IIM A;  4X0B A;  2ZHA A;  4DSL A;  4TUP A;  3KHH A;  3EW9 A;  3BQ1 A;  4R65 A;  4DQP A;  1XSN A;  2BE3 A;  4Z6E A;  1XS9 D;  4NLZ A;  4X4S A;  5D49 A;  3RB6 A;  2KFN A;  9ICJ A;  5KFK A;  4K4H A;  1TFY A;  4DQI A;  4E0D A;  4O5E A;  1NJY A;  1BPZ A;  4YCX A;  4R8U B;  3T5L A;  4P4M A;  3T5K A;  2ZUD A;  8ICT A;  1TFR A;  1HUO A;  4RQ1 A;  2BCU A;  2R8J A;  1LV5 A;  2PFP A;  5DB8 A;  3PW5 A;  4O3Q A;  7ICG A;  5DBB A;  5DG8 A;  5J0R A;  2JEI A;  1U4B A;  1DGS A;  1ZQP A;  2PI4 A;  4RT2 A;  4NKU A;  2BDP A;  4IRC A;  4IQT A;  3SZ2 A;  4UQG A;  2VA2 A;  1YLQ A;  4DWI A;  1NJZ A;  2J6T A;  4Q43 A;  5CWR A;  1RZT A;  1ZYQ A;  8ICN A;  2HW3 A;  9ICK A;  3HJ4 A;  4KMU A;  3UQ2 A;  2I1Q A;  5KG1 A;  2KZ3 A;  3GIJ A;  3ZDB A;  8ICC A;  3QZ8 A;  4M0A A;  5HRB A;  2W9B A;  4JK1 A;  2XC9 A;  2ZH8 A;  4C8L A;  1R89 A;  2ALZ A;  4IQU A;  5CB1 A;  4QWC A;  3QE9 Y;  4J9O A;  2HHP A;  4Z6C A;  5EWF A;  3JYY A;  1ZQQ A;  4AT9 B;  4LVS A;  4FS2 A;  1ZQO A;  2NRV A;  4DEZ A;  3MAB A;  4HYK A;  5C5J A;  9ICV A;  2DR7 A;  3GQC A;  1NK0 A;  1T4G A;  1N48 A;  4O3R A;  4R8U A;  1D8Y A;  3H4D A;  4ECX A;  2BCV A;  5IIN A;  3RBD A;  4FH5 A;  1WOT A;  4O3P A;  4PGX A;  4UD4 A;  5HNK A;  3RRH A;  3RAX A;  2W8L A;  4JUZ A;  4EEY A;  3N4M B;  3RAQ A;  1TK0 A;  1C7Y A;  1KFS A;  3RB0 A;  3M8S A;  3RH6 A;  1EXN A;  5J29 A;  1ZQG A;  2R8I A;  4FHW A;  3EWA A;  5J2J A;  4UAZ A;  1KSP A;  4DSI A;  4KLM A;  9ICS A;  2ID1 A;  9ICC A;  1ARO P;  2ASL A;  4M9L A;  4YXM A;  5HMM A;  1JIH A;  3OGU A;  4O5K A;  3FYH A;  5HP4 A;  3JPR A;  4G3I A;  1JMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...