4MF8A

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ctp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
318
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 103
structure length 318
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf8A03
3RB4A 2MUTB 2NRTA 2NRKA 3RTVA 4M6WB 4DQSA 3PW7A 4P4MA 4X4RA 1ZQEA 5KFQA 3JZ0A 1ZYQA 5KT2A 9ICLA 3C1ZA 2FLLA 4O3SA 5D46A 3UQ0A 2KN7A 3SV4A 1QSSA 2WTFA 3RJGA 3C23A 2JZBB 1NKCA 1KTQA 3AU6A 4B9TA 3C5GA 3UXOA 4B9LA 9ICCA 5TZVA 1MQ2A 4I27A 4RNMA 8ICNA 5L1IA 4XUSA 2A1JA 3JPQA 3UPQA 1LV5A 1F5AA 4DSLA 2HHQA 5KFFA 2A1JB 4F50A 1UEUA 4MEYA 1HUOA 1T3NA 4UQGA 2P66A 1ZQFA 4O3NA 1JAJA 5DG8A 3H7IA 4YFKA 3TI0A 4RWOA 3OV7A 5EWEA 3SYZA 5F9LA 1RXVA 1ZQMA 1TV9A 1JIHA 1BGXT 4QZ8A 4RNNA 3BQ2A 4UB2A 4DL6A 3Q8KA 2C2EA 4K4HA 3T5LA 1NOMA 1XU4A 5CP2A 3HPOA 3G6XA 3Q8SB 2AQ4A 4FBUA 3NTUA 5BOLA 2GWSA 4M9LA 4KLJA 4FH3A 3ZDBA 4WC7A 5KFBA 2O5AA 4UBCA 3BQ1A 4QZCA 4M2YA 2ZHBA 4RQ0A 5KFNA 2ZJ8A 3V6KA 4QZFA 1MC8A 4GLXA 2F1JA 2ZTDA 2OWOA 4O5KA 2HW3A 7ICQA 4DF8A 3MR5A 5KTQA 3RAQA 4JK1A 1XO1A 2F1HA 5KG6A 4YR0A 4PHEA 4QWDA 2PXIA 5IILA 3H40A 3OVAA 3BDPA 4J9SA 4TUQA 4EBEA 5J2GA 4DL2A 4PGQA 4B9VA 4KLHA 1NK6A 1OU5A 2HHPA 3OVBA 2XO7A 1SL0A 8ICLA 1S97A 4DL4A 3H38A 1U47A 3WFQE 5KFKA 1NK5A 2KP7A 3PMLA 8ICCA 2ZH9A 4RWQA 1ZQUA 4C8OA 4Z6CA 4ED2A 1U9LA 4YVZA 5J2FA 1ZQBA 1NJXA 7ICGA 4ELUA 1S0VA 1ZQNA 3PNCA 8ICYA 4F93B 4X0AA 4J9PA 2NRZA 2HVHA 5KG5A 5DQHA 1ZQIA 4KLEA 2KFZA 2DRAA 4DL7A 5HREA 5HMMA 5J2CA 4Q45A 4F5OA 9ICNA 1ZJNA 3TFRA 1XSLA 1UA0A 9ICAA 1QTMA 9ICFA 9ICGA 2DPJA 4QZEA 3Q8QB 4QZAA 2AGQA 2BPGA 4AT7B 4O5EA 3T5KA 3HW8A 3GIJA 3RR8A 1WCNA 1NJYA 1L3TA 2HHTA 3ORYA 3RJFA 3RRHA 1DGSA 4QZDA 8ICFA 4DQRA 2BCQA 3H3AA 9ICVA 4O5CA 3MDAA 4YG2A 4KTQA 5DBAA 3JPOA 1H38A 4KLDA 2AJQA 3C66A 4ECRA 4UAZA 5CR0A 5EWGA 3IHQB 1V9PA 4XQ7A 4UB4A 2C2RA 1R8CA 3HJ1A 4WBYA 1QSLA 4J9RA 5KFJA 8ICBA 3AU2A 1ZETA 4JUZA 3C1YA 5DQGA 2ZUBA 5KFZA 3M9OB 4WBZA 2VA8A 4E0DA 2JEGA 3ZDAA 4Z6EA 5IIJA 4F5PA 2HHUA 4FS1A 4DS5A 3QEBZ 3SZ2A 1X9MA 1NJZA 5DQIA 3C21A 2Y1IA 2W8LA 2FMQA 7ICJA 7ICVA 4NKUA 3Q8PB 5DB8A 3G6VA 2V9WA 9ICIA 1ZQAA 9ICWA 2FPKA 4ED8A 4X4PA 1KFSA 1TK0A 4PH5A 4C8NA 4RPXA 2UVVA 3LQCB 1R89A 1NK0A 4DQIA 4M5DA 3IM1A 3GIKA 4YMNA 5J2DA 2M2UA 4F5QA 1RYSA 9ICHA 1UEVA 5EOZA 4ECVA 3QE9Y 1S10A 3G6YA 1KFTA 4KITB 3WFPA 4RWPA 8ICVA 1D9FA 2HHWA 2ISPA 5HRIA 1BPDA 5KG4A 3EPGA 9ICRA 1Z00A 3TANA 4I29A 2AQ0A 4ELVA 1YLQA 1Z00B 4QZBA 4JWMA 1ZQWA 3PW5A 3RBDA 2ASLA 8ICZA 4QZIA 4FO6A 4R8UA 1NZPA 1TFRA 2B21A 5KG2A 4WC5A 3V7LA 5KFIA 5CWRA 4YP3A 2RFFA 4WC6A 4TUPA 2IA6A 1BPEA 1S76D 3OUYA 1U45A 1JMSA 1COOA 2W9BA 3N4MB 1Y88A 4PHPA 3EYZA 1PX5A 4YD1A 5KT4A 4UBBA 2W9BB 4YXMA 4QWAA 5L1LA 4DSJA 4MFCA 4E80A 1MIVA 4YMOA 2KZ3A 4IQUA 5HRLA 3AUOA 4JV0A 2XC9A 2XY7A 4FBTA 3M8SA 7ICKA 1L3SA 3MFIA 3AQKA 5HNKA 1UT8A 3BQ0A 4Q8FA 4M9HA 8ICAA 4AT9A 1WCLA 3RAXA 5KFSA 4WC4A 5IINA 3T5HA 1S9FA 4I2EA 4PPXA 4RQ5A 3PO5A 4M47A 5KFOA 2KTQA 3UPSA 5J0TA 2BKEA 2F1IA 8ICEA 2Q66A 4HYKA 3E2EA 3T5JA 4JWNA 1NK8A 5C5JA 5KFPA 4GC6A 4DF4A 3GILA 2DR8A 2V4QA 9ICTA 3EW9A 4RQ4A 4F5RA 3TFSA 1KDHA 1S77D 2FPLA 2KZZA 5J2AA 1Z3EB 1UT5A 3GIMA 1S0MA 4RUCA 5DLGA 4I28A 1TAQA 5J29A 1DOQA 4DFMA 4NLNA 4RT2A 3OJSA 3EPIA 1L3VA 3HWTA 1K1SA 4J9QA 2DR9A 3ZDEA 1TFWA 4P4PA 2BE3A 4P4OA 4DSFA 2ZJAA 3H8JA 1ZQTA 3OHBA 2UVWA 7ICPA 4B9SA 3H8SA 8ICUA 3V6HA 3RH5A 3QZ8A 4RUAA 3MGHA 1SKWA 2BDPA 4JV2A 4QZ9A 3C18A 3WFOA 1ZQZA 5KFXA 4RPZA 4TURA 5L1JA 3HJ4A 4DWIA 3H37A 1ZQVA 1VJ7A 2VA2A 5J0PA 4ATBA 3MDCA 1RZTA 4O3QA 1ZQXA 2AGPA 4YMMA 1L5UA 1NK7A 2PFQA 4UAWA 4R64A 1SKRA 2J6TA 4O3OA 4X5VA 4NXZA 4ZH4A 3V72A 3RJKA 3ZDCA 3Q8RB 4ECWA 5HP4A 4E8FA 4DS4A 1ZQDA 2PBEA 3LDAA 9ICXA 9ICPA 8ICWA 4R66A 4KLLA 2ZHAA 3LK9A 2IBKA 5KFRA 4F4YA 4RQ2A 4FS2A 2XY5A 4XA5A 4DSEA 4ED0A 1TVAA 2IMWP 1SZPA 1LB2B 1ZQYA 4NLZA 9ICMA 5HRDA 3AQMA 5IIIA 2ASDA 2ZH6A 4GXIA 3OJUA 1S0OA 4LZGA 2BHNA 1XSNA 4RQ8A 3AQNA 1T4GA 5J0SA 5DB6A 4ECZA 3PVXA 4DLEA 4NY8A 1ZQQA 4UD5A 1VFGA 9ICUA 4IR9A 3MGIA 3OHAA 1SKSA 5DGBA 5L1KA 3V7JA 5J0UA 8ICHA 3PR5B 3KHHA 4QWEA 3GQCA 3RB0A 5D4BA 2PFPA 4DFPA 4QW8A 3Q8LA 4DQQA 4DOAA 3RH4A 4XQ8A 2IHMA 2R8JA 1X9SA 5KFHA 2ZH8A 5J2HA 9ICEA 4IRCA 3TQ1A 8ICIA 1KFDA 2ZUCA 4RT3A 3ETLA 3EZ5A 2W9CA 4K4IA 3JPRA 4NM1A 5KFCA 3RJJA 2JEFA 4BDPA 5KG1A 4F5NA 8ICQA 7ICNA 4X4TA 2DR5A 3M9NB 2DFLA 4F4XA 2W8KA 2BCRA 2W9MA 1SL2A 2J6SA 3HX0A 4RQ7A 1KRPA 5DECA 2RDJA 4EYIB 4I2JA 4IG8A 8ICTA 4M0AA 4LZDA 2ZH5A 3ZD9A 4LT6A 3C2LA 4M9GA 5IIOA 2FLPA 3JPPA 4RU9A 4YR2A 3HT3A 1KEJA 4QWBA 1KSPA 1QLNA 4NM2A 8ICOA 4X4NA 2W9AA 3GDXA 4DL5A 5DBBA 4EBDA 9ICJA 4X4UA 3B0YA 5J2JA 1ZQOA 4YN4A 4ELTA 1A77A 1N48A 1BPYA 2DVIA 3RH6A 4BWMA 2BQRA 1TKDA 4B9UA 2ZH2A 5DB9A 4NKTA 5HHIA 5HRHA 4FHPA 2ASJA 3RR7A 4B9MA 5KT6A 1XC9A 5DDMA 4GXKA 4Q8EA 2I1QA 3C2MA 5DEDA 2M9NA 3JYYA 2BR0A 2C2DA 3OVSA 4DEZA 4O9MA 2UVRA 3Q8MA 2BCSA 1N56A 7ICRA 4R8UB 2ALZA 4F92B 4TQSA 4DL3A 2ATLA 2C28A 4B9NA 1T8EA 4IRDA 4WC0A 1KLNA 4F91B 2FPMA 2UVUA 5J0OA 4QWCA 4P2HA 5HRKA 4C8MA 5KG3A 4I2BA 2XGQA 1R8AA 3OUYB 4DOBA 3NGDA 5J2IA 4KLGA 4KN7A 2DR7A 7ICMA 4MF2A 4BXOA 4F4KA 4O0IA 4KLTA 8ICSA 4I2AA 4J9LA 3PMNA 3UQ2A 3PW2A 2FMSA 4C8KA 3ZD8A 1X2IA 3H39A 4WC1A 2NRXA 1XSPA 4AT9B 3OSPA 3ISBA 4KLSA 3FDSA 3PO4A 3THVA 5KFLA 1WOTA 5J0XA 2PFOA 4DSKA 5CA7A 4R63A 4ECQA 1BNPA 3LWMA 1JQRA 3MR2A 3GIIA 3GV5B 5KG0A 3C2KA 3WFSC 2Y1JA 4X4VA 5HHHA 4RQ6A 1CUKA 1XWLA 3KHRA 5HRGA 1TFYA 4KLIA 2KZMA 4M6WA 5KFVA 4J9MA 2VANA 4QZHA 5BOMA 3QZ7A 4RQ3A 4J9OA 1ZQHA 3BQTA 4DOCA 4CCHA 2KFNA 2ID1A 4NLGA 3MFHA 4ECSA 4PGYA 4Q44A 2ISOA 4MFFA 2HVIA 1R8BA 3MR6A 1UETA 3UXPA 4X4OA 4MF8A 2BQ3A 4KLMA 4GC7A 4ED1A 5KG7A 8ICPA 2JZBA 3K75D 3KHGA 4IR1A 1ZQLA 5KFAA 5KFDA 3RJEA 5J2BA 2V4RA 1ZQCA 1ZQPA 4IQVA 9ICBA 5HRFA 3JPTA 3GV7B 4F4ZA 3PV8A 2ZH7A 3K4GA 8ICGA 1PZNA 7ICHA 4FH5A 4I2DA 4QW9A 3RB3A 2HHVA 2ZTEA 2R8HA 3TAPA 4JV1A 4MFAA 3PX0A 1RPLA 1DK3A 4IQWA 5HRBA 3JPNA 1C7YA 8ICMA 4WCWA 4ATBB 4EYHB 5KT3A 2NRVA 7ICEA 2ZUDA 4YD2A 3KTQA 2ZH3A 5IIMA 3RRGA 4J9NA 1XS9D 3GV8B 1L3UA 2HHSA 9ICQA 2M2TA 4FHVA 1BPBA 4WC2A 1JN3A 2JEJA 5D49A 4YR3A 4F4WA 4GXJA 4Q43A 1ZQRA 4LVSA 7ICTA 4FHXA 2NRWA 4YCXA 5JUMA 2ZJ5A 7ICOA 3HIYA 2DRBA 1RXWA 9ICOA 1TK5A 2R8KA 3V6JA 1D8YA 3PR4A 5DG7A 1Q79A 4E7XA 1D8LA 3B0XA 1TK8A 4EBKA 2XGPA 3RJIA 2PI5A 4EZ9A 7ICIA 1JX4A 2BGWA 5EWFA 5J0QA 4MEXA 4RWNA 3MBYA 5DDYA 4YQWA 4UB3A 5DBCA 1A76A 4RPYA 8ICJA 4EEYA 7ICUA 4UAYA 4UB1A 2XCPA 3KHLA 3L9DA 2H5XA 4KLQA 4UB5A 2BPCA 4TUSA 5BPCA 1NK4A 1U48A 1NKEA 4I2HA 4M9NA 7ICSA 1MSWD 3H4BA 2P6UA 1U49A 1KNYA 4QZGA 2AU0A 3H4DA 1ZQKA 2R8GA 4KLUA 2BQUA 1DK2A 3ISDA 7ICFA 1IM4A 1HJPA 3TARA 1TAUA 4Z6DA 4DLGA 3HP6A 5F2VO 5L9XA 5DG9A 8ICXA 3ZDDA 1EXNA 2M2WA 1BPZA 2W9CB 4ED6A 1HUZA 5KFUA 2R8IA 1T7PA 2Q0ZX 1NK9A 3RJHA 3GFKB 3PY8A 5IIKA 4RZRA 3QEAZ 4I2IA 4KLFA 2RDIA 3EWAA 1Q78A 3N97B 3BJYA 4AT7A 4DFKA 3MR3A 5CJ7A 3PX4A 2ZH1A 3UXNA 4O3PA 5DKWA 1BNOA 2BPFA 4NLKA 3ISCA 7ICLA 1JXLA 4J9KA 3RB6A 4ECYA 5J0WA 3PX6A 3LWLA 4ED3A 4RQ1A 3OGUA 5KFYA 3M9MB 2DPIA 2XY6A 4X4QA 3V7KA 3SV3A 4EP7A 3M8RA 2ZTCA 4UD4A 2FLNA 3WFRE 2O1PA 3JPSA 4C8LA 4IRKA 1B22A 4PHAA 4O3RA 2P6RA 1ZQSA 2AGOA 5KFMA 3PW4A 4F2SA 2BCVA 4FHWA 5J2KA 2MAXA 3SI8A 5HR9A 1MIWA 4WC3A 1MIYA 9ICKA 4XRHA 5DLFA 5J0RA 1UA1A 1MQ3A 4F3OA 4M9JA 4AT8A 5HC9A 4YXJA 5KFEA 2LYHA 4R65A 1BPXA 4AT8B 4PHDA 1X9WA 2JEIA 4S3NA 4ED7A 2ZH4A 5KFGA 4BWJA 4F2RA 3TAQA 4ECXA 1NO5A 1S0NA 5KFTA 5KT5A 1AROP 4X0BA 5KFWA 3RBEA 3MABA 3H8WA 2I9GA 2BCUA 5KT7A 2PFNA 4PGXA 2J6UA 2HHXA 9ICSA 1FA0A 1ZQJA 4EBCA 5DGAA 3AQLA 4ECTA 4RNOA 5CHGA 5F9NA 4X4SA 4Z6FA 4ECUA 5J2EA 3C5FA 1SL1A 1IXRA 3OSNA 4I2FA 1NJWA 4G3IA 4BXOB 4IQTA 5CB1A 1ZJMA 4K4GA 4EBJA 4FHYA 1B43A 2IHNA 1D9DA 3PW0A 4KLOA 4TQRA 4DFJA 2M2VA 2PI4A 1ZQGA 4I2CA 4DO9A 4F8RA 8ICRA 8ICKA 1K1QA 5J0YA 2XCAA 1V4AA 1JXEA 1RYRA 4BGDA 5DB7A 4EZ6A 2C22A 4DSIA 4KMUA 1CEZA 4DQPA 3T3FA 2VA3A 3NYBA 1U4BA 1QSYA 5HMLA 4KN4A 4I2GA 3FYHA 4M04A 2MUTA 1NKBA 2FMPA 1BVSA
chains in the Genus database with same CATH superfamily
1KN5A 4UAVA 4DQSA 3PW7A 5KAIU 4NL9C 5KT2A 9ICLA 5HR7A 3SV4A 1QSSA 3ZI4A 1NKCA 1KTQA 4B9TA 3C5GA 9ICCA 2MSNA 4I27A 4RNMA 5L1IA 4XUSA 2A1JA 2HHQA 3ALRA 1SV0C 1HUOA 2P66A 5AKKA 1JAJA 3TI0A 4RWOA 3K1RB 3AQFA 3OV7A 4O67A 1JIHA 3WK6A 1NOMA 1XU4A 5CP2A 3F5AA 2AQ4A 3NTUA 2KSOB 2IOFA 3IG8A 4UBCA 4M2YA 1D8BA 4KM5A 2ZJ8A 3V6KA 7ICQA 1MC8A 3UMBA 1IV8A 4DF8A 3MR5A 5KTQA 2WAQC 3RAQA 2PXIA 2D3DA 4PHEA 4QWDA 5IILA 2WB1F 4TUQA 1X40A 2WF7A 4EBEA 4DL2A 1OU5A 3ER9B 4KLHA 1COKA 3NRWA 2GOLA 4C4SA 1V85A 8ICCA 4RWQA 4C8OA 4ED2A 1U9LA 2LM1A 1Q3VA 1ZQBA 4X0AA 4P0QB 4J9PA 2NRZA 2DUYA 3WKAA 4KLEA 5J2CA 1ZJNA 9ICGA 5CRXA 1L7MA 3N7SC 2OYYA 5AKJA 2ZIVA 3T5KA 2FJ6A 2LHTA 1L3TA 3DEEA 3RJFA 1FFVA 4QZDA 8ICFA 4O5CA 3MDAA 4YG2A 2IHOA 5EWGA 5B66U 4WBYA 5AICA 8ICBA 4JUZA 4RQMA 3UM9A 4WBZA 3M9OB 2JEGA 2HBMA 4FS1A 1NJZA 5DQIA 2FMQA 7ICVA 4NKUA 7ICJA 5AK3A 2UVVA 2EANA 3LQCB 4AP9A 1NK0A 2NYVA 3BZKA 4K96A 1QCKA 4Y2RA 2WF5A 4F5QA 2K8CB 1RYSA 5D63A 3QE9Y 4FE3A 4RWPA 5HRIA 4CDGA 3TANA 1M6YA 3PW5A 3RBDA 1L7PA 4IS7A 4FO6A 4R8UA 4LEZA 5CWRA 5AK6A 4WC6A 2KICA 1JMSA 5AKZA 4JLXA 4MFCA 3I76A 1MIVA 2KZ3A 3AUOA 4FBTA 1L3SA 5KNIA 4QIWC 1WCLA 2XICA 4NLCA 2WHEA 5J0TA 2Q66A 4JWNA 1NK8A 5C5JA 2JRZA 2DR8A 1HEKA 2V4QA 9ICTA 2ZIWA 5T14A 1KDHA 1JALA 5J2AA 1Z3EB 5DLGA 5J29A 1DOQA 4NLNA 4RT2A 3EPIA 1ZRMA 4P0PA 1JUDA 3PSTA 3QU7A 4DSFA 3H8JA 2HBKA 1X9XA 3M6KA 2BDPA 3QZ8A 4JV2A 2EZXA 5KFXA 4TURA 4DWIA 3H37A 3QNMA 3BS5A 4YMMA 2E8PA 2PFQA 3U26A 2HDOA 5ALSA 1JI7A 4ZH4A 3WK5A 4CF5A 2YMMA 5HP4A 2PBEA 2D8CA 9ICXA 4KLLA 5JRTA 4BUGA 4FS2A 4K9BA 3WKCA 5ALVA 2IMWP 1SZPA 1LB2B 4NXXA 1FEZA 4GXIA 3DV9A 3KD3A 5EE1A 4UATA 5DB6A 4NY8A 2QB0B 1ZQQA 4MHVA 4USAA 4NV0A 2E8NA 3LVWA 5K4LA 5J0UA 3RB0A 2ZIVB 4DFPA 1B4FA 4DOAA 4DQQA 2IHMA 1MN8A 4K97A 3EZ5A 4K4IA 2W9CA 2YTUA 2W43A 5AI5A 3SAGA 2JEFA 4BDPA 2DR5A 2MA1A 3N28A 2YX8A 1SL2A 2J6SA 2Y9TA 1KRPA 4EYIB 4I2JA 4CF3A 8ICTA 3C2LA 4YR2A 3HT3A 3WKBA 1KSPA 2HN1A 4OAFA 2KIWA 4YN4A 4ELTA 2RLTA 2KJ9A 3WKEA 3RH6A 2ZH2A 1DXSA 5DB9A 3NVZA 2ES6A 4OCZA 4FHPA 2YQEA 3HRDD 2LM4A 2ZIUA 3KKAA 2G06A 2BR0A 4DEZA 4NXUA 3Q8MA 2B56A 2BCSA 1DGJA 5AKXA 4R8UB 4F92B 2K8BB 2FPMA 2UVUA 4QWCA 5HRKA 4C8MA 4I2BA 2FE9A 3I28A 7ICMA 2RQ5A 2FMSA 3UQ2A 5KAFU 4O69A 2A19A 4DSKA 3KOOA 2DF4B 2KG5A 4RQ6A 1TFYA 4KLIA 5KFVA 4QZHA 1ZQHA 4RQ3A 2YMPA 2ID1A 2ZIWB 4PGYA 4Q44A 2ISOA 2HVIA 4MF8A 4KLMA 4GC7A 2E5SA 2H3FA 3K75D 4IR1A 1ZQLA 4OO1J 5J2BA 4IQVA 3GV7B 3H8MA 3K4GA 7ICHA 2ZTEA 3TAPA 4MFAA 1OUQA 4IQWA 3PZPA 8ICMA 1FIQA 1ZD3A 1N5WA 4EYHB 5KT3A 2NRVA 2ZH3A 1A0PA 3RRGA 3GV8B 2HHSA 2M2TA 1V97A 3HKZC 5EE3A 5D49A 4F4WA 4LVSA 1WUDA 3D6JA 1RXWA 2R8KA 4C7YA 1Q79A 1D8LA 2RP5A 2PI5A 7ICIA 2BGWA 3A0BU 2EWRA 4RPYA 2BPCA 1U48A 7ICSA 3BQ7A 3H4BA 2AU0A 1DK2A 1L8OA 3TARA 4DLGA 5L9XA 2WB1C 3ZDDA 1EXNA 2W9CB 5TISU 5KFUA 2RRDA 1UHUA 2R8IA 1T7PA 2Q0ZX 1NK9A 2YMQA 3RJHA 1ZD2P 2DL0A 4RZRA 3QEAZ 2LKYA 3PX4A 2ZH1A 1BNOA 2BPFA 4NLKA 3ISCA 4J9KA 3RB6A 4Y2UA 3PX6A 4JMUA 5AKIA 3WFRE 4C8LA 4IRKA 2P6RA 4F2SA 2WF9A 3PW4A 5HR9A 9ICKA 4F3OA 4AT8A 2LYHA 2ZIUB 4PHDA 1IIPA 2JEIA 5ALGA 4ED7A 5KFGA 4BWJA 1WG8A 3TAQA 5KFTA 4LEYA 1JRPA 4C4RA 2BCUA 2J6UA 9ICSA 4EBCA 2HOIA 5CHGA 5F9NA 4ECUA 3C5FA 1SL1A 1PK1A 3OSNA 4I2FA 3MCRA 1ZJMA 1CRXA 3AM9A 4I2CA 2I5HA 2O6KA 1V4AA 2KJ5A 4DSIA 4KMUA 1NNLA 3F2DA 3T3FA 1CEZA 2FMPA 2MUTB 2NRTA 3JZ0A 2HN2A 3C1ZA 4O3SA 5D46A 3UQ0A 3AU6A 4B9LA 1X6IA 2ESEA 1F5AA 3UPQA 5ALQA 4DSLA 2CXYA 4F50A 4MEYA 4UW9A 2FDRA 1ZQFA 4YFKA 5ALNA 1ZQMA 3BQ2A 4DL6A 4RNNA 3Q8KA 2C2EA 1SXEA 3WK7A 3HPOA 1Q8KA 5ALDA 4M9LA 2LYBA 4FH3A 4Y2SA 4KLJA 4B6JA 5KFBA 2EZZA 1N60A 4RQ0A 5KFNA 4QZFA 4GLXA 2ZTDA 2HBJA 1XO1A 4YR0A 3AEVA 3OVBA 1NK6A 2JH1A 8ICLA 1S97A 2ZH9A 1LKYA 1ZQUA 4YVZA 4P0QA 1NJXA 4ELUA 1ZQNA 8ICYA 5KG5A 1O03A 1N2XA 2DRAA 3F2CA 2D6FC 4DL7A 5HMMA 3UMCA 1UA0A 9ICAA 1RQNA 1Z4NA 4UB6U 2AGQA 2BPGA 3HW8A 3GIJA 3RR8A 1NJYA 3ORYA 2YN4A 1DGSA 3WKDA 3H3AA 3HJEA 4KTQA 3JPOA 5ALKA 5CR0A 1V9PA 3VCBA 2C2RA 1R8CA 4J9RA 5ALWA 2ZUBA 1O08A 3ZDAA 4F5PA 1X9MA 1S5LU 5DB8A 9ICIA 2V9WA 1L7NA 2FPKA 5AM2A 4LJXA 2G5HB 1KFSA 1R89A 4CRXA 4M5DA 3N7RC 2M2UA 1ZXIA 1S10A 3G6YA 2GAFD 2JHDA 4KITB 3WFPA 1ZD5A 2HHWA 5AIAA 2G07A 5ALYA 3EPGA 4OAIZ 4I29A 1YLQA 4ELVA 1Z00B 4QZBA 1ZQWA 4QZIA 4PZNA 1NZPA 3RF9A 2DQNB 1TFRA 2B21A 4WOYA 4WQLA 4YP3A 1KQQA 3TADA 1S76D 4WJ3B 3N4MB 3EYZA 4PHPA 4YD1A 5KT4A 2W9BB 4YXMA 4E80A 4LEWA 1N62A 5HRLA 4UB8U 5ALOA 3AQKA 1UT8A 1NI3A 4WC4A 2KTQA 2NV3A 2PMZF 1ECWA 3T5JA 1DRGA 2N1RA 2ZXIA 3GILA 2HCFA 5AI6A 2VJ4A 4F5RA 1UT5A 3GIMA 4I28A 4DFMA 1ZOLA 3SEIA 2Y0SF 3ZDEA 2I6XA 2ZJAA 3OHBA 2UVWA 1SXDA 1KL9A 4RUAA 2GA9D 4QZ9A 4ATBA 2VA2A 4FZLA 1L5UA 1NK7A 1F44A 1SKRA 2J6TA 4O3OA 1Q3UA 2Y9UA 3IDWA 4NXZA 3ZDCA 4E8FA 2H3ZA 2LYAA 2ZHAA 2IBKA 5KFRA 4F4YA 3AN1A 3GU3A 2XY5A 1LKYB 2BBJA 3WU2U 4ED0A 2KKPA 4NLZA 9ICMA 3AQMA 2ASDA 4LZGA 3LYSA 4HX0A 2DWQA 2BHNA 2QB0A 4RQ8A 1T4GA 3AQNA 5J0SA 1VJ5A 2QKQA 5ALZA 4UAUA 4IR9A 3PR5B 7ICPA 4QWEA 3RH4A 4C80A 4XQ8A 2EQYA 1X9SA 3QUBA 9ICEA 3TQ1A 8ICIA 3ETLA 4NM1A 2IUBA 8ICQA 4F5NA 4U6PA 3UMGA 4US8A 1PVQA 4GIBA 2JMGA 2F8KA 4IG8A 2ZH5A 4M9GA 4OJ5A 5IIOA 2FLPA 3IRUA 3SQIA 4QWBA 3T79A 4DL5A 3NRZA 1A6SA 2B4VA 2A3VA 1RDFA 4X4UA 3QU9A 1A77A 1BPYA 5ALRA 2DVIA 2BQRA 4B9UA 4B9MA 1XC9A 4GXKA 4Q8EA 3I1YA 2VIXA 2C2DA 2E3TA 2HMXA 3OVSA 2DKZA 2ALZA 2C28A 4B9NA 4TQSA 2ATLA 4WC0A 4K99A 5AI9A 3NGDA 5J2IA 4KN7A 4BXOA 4F4KA 4KLTA 8ICSA 4KX3A 3PMNA 3PW2A 4C8KA 4WC1A 3D2SA 3OSPA 3ISBA 4KLSA 1JQRA 5CA7A 3LWMA 3HILA 5KG0A 3C2KA 2EAMA 5CEHA 3WFSC 3F53A 2W3SA 3NUQA 4M6WA 4J9MA 4CCHA 5BOMA 3JYYA 3MFHA 4ECSA 4X4OA 1WYGA 3MR6A 3UXPA 5CFUA 2JZBA 4EGWA 1ED1A 2F76X 5KFDA 3ED5A 1PK3A 1ZQPA 1ZQCA 1MA7A 4F4ZA 2ZH7A 2HHVA 2R8HA 4NJ8A 4ATBB 5ALEA 7ICEA 3KTQA 2ODGA 4LEVA 3L4PA 1ZRNA 1JN3A 4FHXA 3ONNA 7ICTA 2K4PA 7ICOA 2DRBA 9ICOA 3PR4A 5EE9A 1PVRA 4E7XA 3B0XA 4EBKA 1TK8A 2WF8A 4G9BA 2XIDA 4EZ9A 1SZHA 3QYPA 5EWFA 5J0QA 1JX4A 4MEXA 5DDYA 4YQWA 5DBCA 2QARA 2LPEA 3L9DA 3PSIA 2F2AB 4NWIA 4I2HA 1NKEA 1MSWD 2L5YA 4QZGA 1ZQKA 3H4DA 4KLUA 3ISDA 1P7DA 4US9A 7ICFA 1HJPA 3OTQA 4Z6DA 4HAIA 5DG9A 3KZXA 5KL8B 1BPZA 2GH1A 1HUZA 1SWWA 4KLFA 2RDIA 3EWAA 4QJFB 2YB1A 3N97B 3BJYA 2ZXHA 4DFKA 4AT7A 1F5SA 1JXLA 4ECYA 2KIVA 5G5GA 5CHEA 2O1PA 3JPSA 1ZQ1C 5JU5A 3DDHA 3FM9A 5KFMA 2EH9A 2MAXA 4WC3A 1MQ3A 4F72A 4M9JA 4Y2VA 4YXJA 5KFEA 2VJ5A 2G5IB 4F2RA 1NO5A 2KKVA 3RBEA 3H8WA 4Y2TA 5A0LA 4PGXA 5DGAA 3NKUA 3IV6A 1TAMA 1Z4OA 2KHVA 5J2EA 2R18A 1SWVA 4BXOB 5CB1A 5B3QA 2E1EA 2IHNA 4IC9A 4DFJA 2M2VA 2PI4A 4DO9A 4F8RA 8ICRA 1L6NA 1K1QA 4NXWA 5J0YA 1RYRA 4OJ6A 4BGDA 4DQPA 2XI9A 3NYBA 1QSYA 4KN4A 4I2GA 3FYHA 2MUTA 1NKBA 1BVSA 3RB4A 2NRKA 1GPJA 4M6WB 5KFQA 2H3VA 2KN7A 2WTFA 3RJGA 3C23A 2JZBB 3M1YA 1MQ2A 4PL2A 3JPQA 2HOQA 2WF6A 4FO1A 1YZ7A 4EEKA 2F3NA 4Y2QA 1T3NA 2YMLA 4WQKA 5EWEA 1RXVA 1TV9A 4QZ8A 4UB2A 2PMZC 3CP8A 2AH5A 3BS7A 3SD7A 2W11A 3Q8SB 4FBUA 2RHFA 2GWSA 3ZDBA 1URJA 3BQ1A 3NASA 2ZHBA 2OWOA 2HW3A 4O5KA 2WFAA 2DBYA 5KG6A 2F1HA 4Y2JA 3H40A 5AKYA 3BDPA 2AHOB 4OAHA 2QARB 1WWVA 4PGQA 1U47A 3WFQE 5KFKA 2KP7A 1NK5A 3PMLA 4U7CA 2Z7JA 7ICGA 5J2FA 1S0VA 2QLTA 3H0RB 2HVHA 2KFZA 5AI8A 2YB4A 2KOBA 1UCVA 2LBOA 9ICFA 4EX7A 2DPJA 4AT7B 4O5EA 2HHTA 3RFAA 4DQRA 2BCQA 2IOHA 2AJQA 3C66A 4UAZA 3IHQB 3D2QA 2KNJA 3HJ1A 1QSLA 5KFJA 4K98A 3AU2A 1ZETA 1K5OA 5IIJA 2HHUA 4DS5A 3QEBZ 3SZ2A 2W8LA 2VKQA 5AK5A 1ZQAA 4X4PA 1TK0A 4C8NA 3QX7A 4RPXA 2BZFA 5J2DA 1X66A 5C0YA 9ICHA 5EOZA 4ECVA 8ICVA 3SAFA 1BPDA 5KG4A 1Z00A 1FFUA 2HI0A 1YZ6A 2ASLA 8ICZA 5E79U 3AMZA 5KG2A 4WC5A 2RFFA 4TUPA 2IA6A 1U45A 1COOA 2W9BA 4UBBA 4QWAA 5L1LA 1N5XA 4DSJA 1QQ6A 4YMOA 5L1MA 3ICXA 2XC9A 2XY7A 3M8SA 4AT9A 3MFIA 2KV2A 3PSFA 8ICAA 3RAXA 3SENA 5KFSA 1S9FA 4PPXA 3CNHA 2K89A 4EEBA 4RQ5A 3PO5A 3NVVA 4HYKA 3E2EA 5KFPA 4GC6A 4DF4A 4EENA 1QQ5A 3CW2C 3QUTA 2KVSA 3TFSA 1S77D 2FPLA 2KZZA 3L5KA 2B6GA 2ZIXA 4RUCA 1L3VA 3HWTA 1K1SA 2LI6A 1TFWA 4P4PA 2BE3A 4OJLA 3H8SA 5AHXA 3N7PD 3V6HA 3F2BA 3WFOA 3C18A 1ZQZA 5L1JA 3HJ4A 1ZQVA 2OH2A 1VJ7A 4O3QA 4UAWA 4R64A 5ALMA 2KHQA 4X5VA 3V72A 3Q8RB 4ECWA 1ZQDA 5AIBA 3LDAA 9ICPA 8ICWA 3TKAA 1XNSA 4RQ2A 4GFJA 4DSEA 1TVAA 2HOFA 2ZH6A 1J2NA 1XSNA 3PVXA 2KVCA 4DLEA 4DCCA 3MGIA 1SKSA 5DGBA 3V7JA 2B51A 4EV6A 3NVWA 8ICHA 1PX5A 3Q8LA 2ZH8A 5KFHA 5J2HA 1SV4A 2ZUCA 3JPRA 3RJJA 5KG1A 3M9NB 2DFLA 2KEYA 2BCRA 3HX0A 5DECA 5JTGA 3JPPA 1KEJA 4ACOA 2W9AA 4EBDA 4EX6A 5FP0A 5KL1B 9ICJA 3B0YA 5J2JA 3E0FA 1ZQOA 4I0UA 2OHFA 4BWMA 1RQLA 1TKDA 4NKTA 1KKXA 2ASJA 5KT6A 4J03A 4KB6A 5DDMA 2I1QA 3C2MA 2M9NA 4O9MA 3QXGA 2KD1A 1XO0A 5J0OA 5J8YA 1R8AA 4DOBA 1C20A 3QUCA 2DR7A 3SAHA 4O0IA 2OCEA 2K8AA 1PUZA 2LMRA 1X2IA 4CGZA 4NL9A 3H39A 2EZYA 1XSPA 4AT9B 1WOTA 3FDSA 4QNLA 3THVA 5KFLA 5J0XA 2PFOA 1BNPA 2AXTU 4R63A 4ECQA 5G5HA 3IP4B 5ALIA 3TADC 1J97A 1CUKA 1SV0A 1XWLA 5HRGA 1VLBA 4WC2A 2VANA 4C4TA 4NLGA 1VDVA 1UETA 4MFFA 1R8BA 5ALHA 1V38A 2DGZA 2ZIXB 3NVYA 4ED1A 5KG7A 3KHGA 4N7RA 3HKZF 2K4EA 3PV8A 8ICGA 1PZNA 4FH5A 4I2DA 1RPLA 4Y2PA 3JPNA 1Z1BA 1C7YA 4JLZA 4O3MA 1XS9D 2W7OA 5AI0A 9ICQA 2BDUA 5JUMA 3HIYA 2K4IA 2G09A 2Q4TA 2XGPA 2XVTA 4RWNA 3MBYA 2EAOA 1N61A 2F77X 4EELA 4UAYA 4UB1A 2XCPA 3KHLA 4KLQA 1DK3A 4UB5A 1ZD4A 4M9NA 1U49A 1KNYA 4WH5A 2R8GA 1J2MA 5F2VO 2GO7A 2JV3A 3PY8A 5IIKA 3SMVA 4O68A 2BBHA 3MR3A 5CJ7A 3UXNA 4O3PA 5DKWA 7ICLA 4BJQA 5J0WA 4ED3A 4RQ1A 3VC8A 2DPIA 2P35A 2XY6A 3V7KA 2KE7A 1B22A 1F0MA 4O3RA 2PKEA 2BCVA 1MIWA 1MIYA 4XRHA 1UPHA 5J0RA 5HC9A 4XJEA 4R65A 4C7ZA 3WK8A 4CE6A 4NXTA 3EF2A 1S0NA 1AROP 2DKXA 5AKLA 5KFWA 1UQVA 2I9GA 2PFNA 2CRXA 1FA0A 1L8LA 1ZQJA 3AQLA 4RNOA 2H3QA 1NZBA 2A1AA 1IXRA 4K4GA 1B43A 3PW0A 4KLOA 4TQRA 4OJOA 1ZQGA 1OW5A 2C22A 3H0MB 5HMLA 4M04A 3KFUF 3RTVA 4P4MA 4X4RA 1ZQEA 2E8OA 1ZYQA 2FLLA 1JROA 2EDUA 5ALXA 3TACB 3ERCC 3UXOA 5TZVA 8ICNA 1LV5A 3MC1A 5KFFA 2A1JB 1UEUA 4CNQA 4UQGA 2G08A 4O3NA 5DG8A 3H7IA 3SYZA 5F9LA 3J81j 5JTIA 1BGXT 3FC4A 4FZMA 3C28A 4K4HA 1KW4A 4JB3A 3T5LA 2NO4A 3FAHA 3G6XA 5BOLA 2M0NA 4WC7A 1Z1VA 2O5AA 4QZCA 2W3RA 3QU5A 5ALUA 4F71A 2F1JA 2KJ8A 4JK1A 3K7DA 3OVAA 4J9SA 2W55A 3IG5A 5J2GA 4B9VA 2HHPA 2XO7A 1SL0A 4DL4A 3H38A 1N63A 2MRLA 4Z6CA 1Z19A 4EEDA 3PNCA 4F93B 4PZOA 5F3XB 3QUQA 5DQHA 1ZQIA 2GLEA 4OJPA 5HREA 2CN1A 4Q45A 4F5OA 9ICNA 2OM6A 1XSLA 3TFRA 1QTMA 2ZG6A 5B5EU 4NXVA 4QZEA 3Q8QB 4QZAA 5AKHA 1Q46A 2F44A 1WCNA 3RRHA 4ZOHC 2CPRA 4BX9C 2QB1A 9ICVA 5DBAA 1H38A 4KLDA 3PHZA 3D2NA 4ECRA 4MKPA 4XQ7A 4UB4A 4FFDA 3JCFA 3C1YA 5DQGA 5KFZA 2VA8A 4E0DA 2JGAA 4Z6EA 3KBBA 5ALFA 3C21A 5GTHU 2Y1IA 4C0ZA 4OAGA 3Q8PB 3G6VA 9ICWA 4PL1A 4ED8A 3WK4A 4PH5A 4DQIA 3IM1A 3GIKA 4YMNA 5HR6A 1UEVA 1KFTA 4AYBF 1D9FA 2ISPA 3KKAC 9ICRA 5AM0A 2AQ0A 4JWMA 1RM6C 5ALTA 3V7LA 2K4HA 5KFIA 1BPEA 3OUYA 1Y88A 2F8LA 2FI1A 5B3PA 4IQUA 4PJ0U 4JV0A 4FHVA 3M7DA 7ICKA 5HNKA 4FZNA 3BQ0A 4Q8FA 5AKGA 4M9HA 5ALPA 1HIWA 4K8VA 5IINA 3T5HA 4I2EA 4M47A 5KFOA 3C29A 3UPSA 2BKEA 2F1IA 8ICEA 3AL0B 3OWGA 4CF4A 2YY6A 3S6JA 4KX5A 3EW9A 4RQ4A 5D62A 5AKEA 2W7PA 1S0MA 1TAQA 3OJSA 2WAQF 4J9QA 2DR9A 2HBLA 5AM4A 4P0PB 4P4OA 1ZQTA 3WK9A 4B9SA 8ICUA 1SKWA 3RH5A 3MGHA 2MU2A 4RPZA 5J0PA 3MDCA 1RZTA 2Y0SC 1OXJA 1ZQXA 5AM1A 2AGPA 3BS5B 3A0HU 5AI4A 3RJKA 1RG6A 4DS4A 4R66A 3LK9A 3OPXA 4XA5A 1KBUA 1ZQYA 5HRDA 5IIIA 3OJUA 1S0OA 4O6AA 4UARA 3PSPA 4ECZA 4UD5A 1VFGA 9ICUA 1RYUA 2K60A 3OHAA 5L1KA 1CI4A 3KHHA 2PFPA 3GQCA 3AQEA 5D4BA 4K9AA 3ER8C 4QW8A 2R8JA 3B9JA 4IRCA 3LVVA 1KFDA 4RT3A 5KFCA 7ICNA 4KMOB 4X4TA 4F4XA 2W8KA 2EAPA 2W9MA 4RQ7A 1IG6A 2RDJA 5AM3A 4LZDA 4M0AA 3ZD9A 4LT6A 4RU9A 1S8OA 2W04A 1SGGA 2IOFK 3E58A 1QLNA 4NM2A 8ICOA 4OD0A 3IN5A 4X4NA 1T3QA 3GDXA 2NO5A 5DBBA 1N48A 1SB3C 5HHIA 5HRHA 2JH7A 3RR7A 5DEDA 3QU2A 2UVRA 1N56A 7ICRA 4DL3A 4QIWF 1T8EA 4IRDA 1KLNA 4F91B 1GO3F 4P2HA 3OUYB 5KG3A 2XGQA 4KLGA 4Y2YA 1PVPA 4MF2A 2OXOA 3QU4A 4I2AA 4J9LA 4NLBA 5GTIU 3NWIA 3ZD8A 2NRXA 2FCLA 1QH9A 3PO4A 5CFSA 3MR2A 3GIIA 3GV5B 1B0XA 3CK6A 1LVHA 2Y1JA 3NS1A 4X4VA 5HHHA 3KHRA 3CRXA 2KZMA 3QZ7A 4J9OA 2KFNA 3BQTA 4DOCA 5D61A 1T94A 2H3IA 2BQ3A 8ICPA 5KFAA 3RJEA 2E1FA 1FO4A 3GZFA 2V4RA 9ICBA 5HRFA 4Y2XA 3JPTA 3NVOA 4QW9A 3RB3A 3K1ZA 2OEHA 4JV1A 3PX0A 5HRBA 4WCWA 1X42A 2ZUDA 4YD2A 5IIMA 4J9NA 2JR5A 1L3UA 4A8EA 1BPBA 2B0CA 5CFTA 2JEJA 4YR3A 4GXJA 1ZQRA 4Q43A 2NRWA 4RQNA 4YCXA 2ZJ5A 2KSOA 1TK5A 3V6JA 3R9KA 2W54A 5DG7A 1D8YA 1YT3A 3CYMA 3RJIA 2W03A 4UB3A 3ETRA 1A76A 8ICJA 4EEYA 7ICUA 3H0LB 3L3FX 2H5XA 5EE0A 1NK4A 4TUSA 5H2FU 5BPCA 4UASA 2P6UA 5ALLA 2BQUA 2JXJA 1IM4A 1TE2A 3O0FA 1TAUA 3HP6A 8ICXA 2M2WA 4ED6A 3GFKB 4I2IA 1Q78A 2HSZA 1WWUA 2E8MA 4ICAA 1AQ6A 1QQ7A 3MGVA 3LWLA 3OGUA 5KFYA 3M9MB 4X4QA 4EP7A 3SV3A 3M8RA 2ZTCA 4UD4A 2FLNA 4PHAA 1ZQSA 2AGOA 4FHWA 5J2KA 3SI8A 5DLFA 1UA1A 4IL6U 1BPXA 4AT8B 1X9WA 4S3NA 2ZH4A 4ECXA 3SR6A 5KT5A 4X0BA 3MABA 5ALJA 5KT7A 2HHXA 5AK4A 4ECTA 3EUB2 4X4SA 4Z6FA 2KMDA 2G0AA 3M6ZA 1NJWA 4G3IA 3F5EA 4IQTA 1PK1B 4EBJA 4FHYA 5AM5A 1SIJA 1D9DA 4DFDA 8ICKA 1L7OA 2XCAA 3BZCA 1JXEA 1X6JA 2KK0A 5DB7A 4EZ6A 2VA3A 5J8YC 1U4BA 4AYBC 3KZIU
chains in the Genus database with same CATH topology
3RB4A 2MUTB 2NRTA 2NRKA 3RTVA 4M6WB 4DQSA 3PW7A 4P4MA 4X4RA 1ZQEA 5KFQA 3JZ0A 1ZYQA 5KT2A 9ICLA 3C1ZA 2FLLA 4O3SA 5D46A 3UQ0A 2KN7A 3SV4A 1QSSA 2WTFA 3RJGA 3C23A 2JZBB 1NKCA 1KTQA 3AU6A 4B9TA 3C5GA 3UXOA 4B9LA 9ICCA 5TZVA 1MQ2A 4I27A 4RNMA 8ICNA 5L1IA 4XUSA 2A1JA 3JPQA 3UPQA 1LV5A 1F5AA 4DSLA 2HHQA 5KFFA 2A1JB 4F50A 1UEUA 4MEYA 1HUOA 1T3NA 4UQGA 2P66A 1ZQFA 4O3NA 1JAJA 5DG8A 3H7IA 4YFKA 3TI0A 4RWOA 3OV7A 5EWEA 3SYZA 5F9LA 1RXVA 1ZQMA 1TV9A 1JIHA 1BGXT 4QZ8A 4RNNA 3BQ2A 4UB2A 4DL6A 3Q8KA 2C2EA 4K4HA 3T5LA 1NOMA 1XU4A 5CP2A 3HPOA 3G6XA 3Q8SB 2AQ4A 4FBUA 3NTUA 5BOLA 2GWSA 4M9LA 4KLJA 4FH3A 3ZDBA 4WC7A 5KFBA 2O5AA 4UBCA 3BQ1A 4QZCA 4M2YA 2ZHBA 4RQ0A 5KFNA 2ZJ8A 3V6KA 4QZFA 1MC8A 4GLXA 2F1JA 2ZTDA 2OWOA 4O5KA 2HW3A 7ICQA 4DF8A 3MR5A 5KTQA 3RAQA 4JK1A 1XO1A 2F1HA 5KG6A 4YR0A 4PHEA 4QWDA 2PXIA 5IILA 3H40A 3OVAA 3BDPA 4J9SA 4TUQA 4EBEA 5J2GA 4DL2A 4PGQA 4B9VA 4KLHA 1NK6A 1OU5A 2HHPA 3OVBA 2XO7A 1SL0A 8ICLA 1S97A 4DL4A 3H38A 1U47A 3WFQE 5KFKA 1NK5A 2KP7A 3PMLA 8ICCA 2ZH9A 4RWQA 1ZQUA 4C8OA 4Z6CA 4ED2A 1U9LA 4YVZA 5J2FA 1ZQBA 1NJXA 7ICGA 4ELUA 1S0VA 1ZQNA 3PNCA 8ICYA 4F93B 4X0AA 4J9PA 2NRZA 2HVHA 5KG5A 5DQHA 1ZQIA 4KLEA 2KFZA 2DRAA 4DL7A 5HREA 5HMMA 5J2CA 4Q45A 4F5OA 9ICNA 1ZJNA 3TFRA 1XSLA 1UA0A 9ICAA 1QTMA 9ICFA 9ICGA 2DPJA 4QZEA 3Q8QB 4QZAA 2AGQA 2BPGA 4AT7B 4O5EA 3T5KA 3HW8A 3GIJA 3RR8A 1WCNA 1NJYA 1L3TA 2HHTA 3ORYA 3RJFA 3RRHA 1DGSA 4QZDA 8ICFA 4DQRA 2BCQA 3H3AA 9ICVA 4O5CA 3MDAA 4YG2A 4KTQA 5DBAA 3JPOA 1H38A 4KLDA 2AJQA 3C66A 4ECRA 4UAZA 5CR0A 5EWGA 3IHQB 1V9PA 4XQ7A 4UB4A 2C2RA 1R8CA 3HJ1A 4WBYA 1QSLA 4J9RA 5KFJA 8ICBA 3AU2A 1ZETA 4JUZA 3C1YA 5DQGA 2ZUBA 5KFZA 3M9OB 4WBZA 2VA8A 4E0DA 2JEGA 3ZDAA 4Z6EA 5IIJA 4F5PA 2HHUA 4FS1A 4DS5A 3QEBZ 3SZ2A 1X9MA 1NJZA 5DQIA 3C21A 2Y1IA 2W8LA 2FMQA 7ICJA 7ICVA 4NKUA 3Q8PB 5DB8A 3G6VA 2V9WA 9ICIA 1ZQAA 9ICWA 2FPKA 4ED8A 4X4PA 1KFSA 1TK0A 4PH5A 4C8NA 4RPXA 2UVVA 3LQCB 1R89A 1NK0A 4DQIA 4M5DA 3IM1A 3GIKA 4YMNA 5J2DA 2M2UA 4F5QA 1RYSA 9ICHA 1UEVA 5EOZA 4ECVA 3QE9Y 1S10A 3G6YA 1KFTA 4KITB 3WFPA 4RWPA 8ICVA 1D9FA 2HHWA 2ISPA 5HRIA 1BPDA 5KG4A 3EPGA 9ICRA 1Z00A 3TANA 4I29A 2AQ0A 4ELVA 1YLQA 1Z00B 4QZBA 4JWMA 1ZQWA 3PW5A 3RBDA 2ASLA 8ICZA 4QZIA 4FO6A 4R8UA 1NZPA 1TFRA 2B21A 5KG2A 4WC5A 3V7LA 5KFIA 5CWRA 4YP3A 2RFFA 4WC6A 4TUPA 2IA6A 1BPEA 1S76D 3OUYA 1U45A 1JMSA 1COOA 2W9BA 3N4MB 1Y88A 4PHPA 3EYZA 1PX5A 4YD1A 5KT4A 4UBBA 2W9BB 4YXMA 4QWAA 5L1LA 4DSJA 4MFCA 4E80A 1MIVA 4YMOA 2KZ3A 4IQUA 5HRLA 3AUOA 4JV0A 2XC9A 2XY7A 4FBTA 3M8SA 7ICKA 1L3SA 3MFIA 3AQKA 5HNKA 1UT8A 3BQ0A 4Q8FA 4M9HA 8ICAA 4AT9A 1WCLA 3RAXA 5KFSA 4WC4A 5IINA 3T5HA 1S9FA 4I2EA 4PPXA 4RQ5A 3PO5A 4M47A 5KFOA 2KTQA 3UPSA 5J0TA 2BKEA 2F1IA 8ICEA 2Q66A 4HYKA 3E2EA 3T5JA 4JWNA 1NK8A 5C5JA 5KFPA 4GC6A 4DF4A 3GILA 2DR8A 2V4QA 9ICTA 3EW9A 4RQ4A 4F5RA 3TFSA 1KDHA 1S77D 2FPLA 2KZZA 5J2AA 1Z3EB 1UT5A 3GIMA 1S0MA 4RUCA 5DLGA 4I28A 1TAQA 5J29A 1DOQA 4DFMA 4NLNA 4RT2A 3OJSA 3EPIA 1L3VA 3HWTA 1K1SA 4J9QA 2DR9A 3ZDEA 1TFWA 4P4PA 2BE3A 4P4OA 4DSFA 2ZJAA 3H8JA 1ZQTA 3OHBA 2UVWA 7ICPA 4B9SA 3H8SA 8ICUA 3V6HA 3RH5A 3QZ8A 4RUAA 3MGHA 1SKWA 2BDPA 4JV2A 4QZ9A 3C18A 3WFOA 1ZQZA 5KFXA 4RPZA 4TURA 5L1JA 3HJ4A 4DWIA 3H37A 1ZQVA 1VJ7A 2VA2A 5J0PA 4ATBA 3MDCA 1RZTA 4O3QA 1ZQXA 2AGPA 4YMMA 1L5UA 1NK7A 2PFQA 4UAWA 4R64A 1SKRA 2J6TA 4O3OA 4X5VA 4NXZA 4ZH4A 3V72A 3RJKA 3ZDCA 3Q8RB 4ECWA 5HP4A 4E8FA 4DS4A 1ZQDA 2PBEA 3LDAA 9ICXA 9ICPA 8ICWA 4R66A 4KLLA 2ZHAA 3LK9A 2IBKA 5KFRA 4F4YA 4RQ2A 4FS2A 2XY5A 4XA5A 4DSEA 4ED0A 1TVAA 2IMWP 1SZPA 1LB2B 1ZQYA 4NLZA 9ICMA 5HRDA 3AQMA 5IIIA 2ASDA 2ZH6A 4GXIA 3OJUA 1S0OA 4LZGA 2BHNA 1XSNA 4RQ8A 3AQNA 1T4GA 5J0SA 5DB6A 4ECZA 3PVXA 4DLEA 4NY8A 1ZQQA 4UD5A 1VFGA 9ICUA 4IR9A 3MGIA 3OHAA 1SKSA 5DGBA 5L1KA 3V7JA 5J0UA 8ICHA 3PR5B 3KHHA 4QWEA 3GQCA 3RB0A 5D4BA 2PFPA 4DFPA 4QW8A 3Q8LA 4DQQA 4DOAA 3RH4A 4XQ8A 2IHMA 2R8JA 1X9SA 5KFHA 2ZH8A 5J2HA 9ICEA 4IRCA 3TQ1A 8ICIA 1KFDA 2ZUCA 4RT3A 3ETLA 3EZ5A 2W9CA 4K4IA 3JPRA 4NM1A 5KFCA 3RJJA 2JEFA 4BDPA 5KG1A 4F5NA 8ICQA 7ICNA 4X4TA 2DR5A 3M9NB 2DFLA 4F4XA 2W8KA 2BCRA 2W9MA 1SL2A 2J6SA 3HX0A 4RQ7A 1KRPA 5DECA 2RDJA 4EYIB 4I2JA 4IG8A 8ICTA 4M0AA 4LZDA 2ZH5A 3ZD9A 4LT6A 3C2LA 4M9GA 5IIOA 2FLPA 3JPPA 4RU9A 4YR2A 3HT3A 1KEJA 4QWBA 1KSPA 1QLNA 4NM2A 8ICOA 4X4NA 2W9AA 3GDXA 4DL5A 5DBBA 4EBDA 9ICJA 4X4UA 3B0YA 5J2JA 1ZQOA 4YN4A 4ELTA 1A77A 1N48A 1BPYA 2DVIA 3RH6A 4BWMA 2BQRA 1TKDA 4B9UA 2ZH2A 5DB9A 4NKTA 5HHIA 5HRHA 4FHPA 2ASJA 3RR7A 4B9MA 5KT6A 1XC9A 5DDMA 4GXKA 4Q8EA 2I1QA 3C2MA 5DEDA 2M9NA 3JYYA 2BR0A 2C2DA 3OVSA 4DEZA 4O9MA 2UVRA 3Q8MA 2BCSA 1N56A 7ICRA 4R8UB 2ALZA 4F92B 4TQSA 4DL3A 2ATLA 2C28A 4B9NA 1T8EA 4IRDA 4WC0A 1KLNA 4F91B 2FPMA 2UVUA 5J0OA 4QWCA 4P2HA 5HRKA 4C8MA 5KG3A 4I2BA 2XGQA 1R8AA 3OUYB 4DOBA 3NGDA 5J2IA 4KLGA 4KN7A 2DR7A 7ICMA 4MF2A 4BXOA 4F4KA 4O0IA 4KLTA 8ICSA 4I2AA 4J9LA 3PMNA 3UQ2A 3PW2A 2FMSA 4C8KA 3ZD8A 1X2IA 3H39A 4WC1A 2NRXA 1XSPA 4AT9B 3OSPA 3ISBA 4KLSA 3FDSA 3PO4A 3THVA 5KFLA 1WOTA 5J0XA 2PFOA 4DSKA 5CA7A 4R63A 4ECQA 1BNPA 3LWMA 1JQRA 3MR2A 3GIIA 3GV5B 5KG0A 3C2KA 3WFSC 2Y1JA 4X4VA 5HHHA 4RQ6A 1CUKA 1XWLA 3KHRA 5HRGA 1TFYA 4KLIA 2KZMA 4M6WA 5KFVA 4J9MA 2VANA 4QZHA 5BOMA 3QZ7A 4RQ3A 4J9OA 1ZQHA 3BQTA 4DOCA 4CCHA 2KFNA 2ID1A 4NLGA 3MFHA 4ECSA 4PGYA 4Q44A 2ISOA 4MFFA 2HVIA 1R8BA 3MR6A 1UETA 3UXPA 4X4OA 4MF8A 2BQ3A 4KLMA 4GC7A 4ED1A 5KG7A 8ICPA 2JZBA 3K75D 3KHGA 4IR1A 1ZQLA 5KFAA 5KFDA 3RJEA 5J2BA 2V4RA 1ZQCA 1ZQPA 4IQVA 9ICBA 5HRFA 3JPTA 3GV7B 4F4ZA 3PV8A 2ZH7A 3K4GA 8ICGA 1PZNA 7ICHA 4FH5A 4I2DA 4QW9A 3RB3A 2HHVA 2ZTEA 2R8HA 3TAPA 4JV1A 4MFAA 3PX0A 1RPLA 1DK3A 4IQWA 5HRBA 3JPNA 1C7YA 8ICMA 4WCWA 4ATBB 4EYHB 5KT3A 2NRVA 7ICEA 2ZUDA 4YD2A 3KTQA 2ZH3A 5IIMA 3RRGA 4J9NA 1XS9D 3GV8B 1L3UA 2HHSA 9ICQA 2M2TA 4FHVA 1BPBA 4WC2A 1JN3A 2JEJA 5D49A 4YR3A 4F4WA 4GXJA 4Q43A 1ZQRA 4LVSA 7ICTA 4FHXA 2NRWA 4YCXA 5JUMA 2ZJ5A 7ICOA 3HIYA 2DRBA 1RXWA 9ICOA 1TK5A 2R8KA 3V6JA 1D8YA 3PR4A 5DG7A 1Q79A 4E7XA 1D8LA 3B0XA 1TK8A 4EBKA 2XGPA 3RJIA 2PI5A 4EZ9A 7ICIA 1JX4A 2BGWA 5EWFA 5J0QA 4MEXA 4RWNA 3MBYA 5DDYA 4YQWA 4UB3A 5DBCA 1A76A 4RPYA 8ICJA 4EEYA 7ICUA 4UAYA 4UB1A 2XCPA 3KHLA 3L9DA 2H5XA 4KLQA 4UB5A 2BPCA 4TUSA 5BPCA 1NK4A 1U48A 1NKEA 4I2HA 4M9NA 7ICSA 1MSWD 3H4BA 2P6UA 1U49A 1KNYA 4QZGA 2AU0A 3H4DA 1ZQKA 2R8GA 4KLUA 2BQUA 1DK2A 3ISDA 7ICFA 1IM4A 1HJPA 3TARA 1TAUA 4Z6DA 4DLGA 3HP6A 5F2VO 5L9XA 5DG9A 8ICXA 3ZDDA 1EXNA 2M2WA 1BPZA 2W9CB 4ED6A 1HUZA 5KFUA 2R8IA 1T7PA 2Q0ZX 1NK9A 3RJHA 3GFKB 3PY8A 5IIKA 4RZRA 3QEAZ 4I2IA 4KLFA 2RDIA 3EWAA 1Q78A 3N97B 3BJYA 4AT7A 4DFKA 3MR3A 5CJ7A 3PX4A 2ZH1A 3UXNA 4O3PA 5DKWA 1BNOA 2BPFA 4NLKA 3ISCA 7ICLA 1JXLA 4J9KA 3RB6A 4ECYA 5J0WA 3PX6A 3LWLA 4ED3A 4RQ1A 3OGUA 5KFYA 3M9MB 2DPIA 2XY6A 4X4QA 3V7KA 3SV3A 4EP7A 3M8RA 2ZTCA 4UD4A 2FLNA 3WFRE 2O1PA 3JPSA 4C8LA 4IRKA 1B22A 4PHAA 4O3RA 2P6RA 1ZQSA 2AGOA 5KFMA 3PW4A 4F2SA 2BCVA 4FHWA 5J2KA 2MAXA 3SI8A 5HR9A 1MIWA 4WC3A 1MIYA 9ICKA 4XRHA 5DLFA 5J0RA 1UA1A 1MQ3A 4F3OA 4M9JA 4AT8A 5HC9A 4YXJA 5KFEA 2LYHA 4R65A 1BPXA 4AT8B 4PHDA 1X9WA 2JEIA 4S3NA 4ED7A 2ZH4A 5KFGA 4BWJA 4F2RA 3TAQA 4ECXA 1NO5A 1S0NA 5KFTA 5KT5A 1AROP 4X0BA 5KFWA 3RBEA 3MABA 3H8WA 2I9GA 2BCUA 5KT7A 2PFNA 4PGXA 2J6UA 2HHXA 9ICSA 1FA0A 1ZQJA 4EBCA 5DGAA 3AQLA 4ECTA 4RNOA 5CHGA 5F9NA 4X4SA 4Z6FA 4ECUA 5J2EA 3C5FA 1SL1A 1IXRA 3OSNA 4I2FA 1NJWA 4G3IA 4BXOB 4IQTA 5CB1A 1ZJMA 4K4GA 4EBJA 4FHYA 1B43A 2IHNA 1D9DA 3PW0A 4KLOA 4TQRA 4DFJA 2M2VA 2PI4A 1ZQGA 4I2CA 4DO9A 4F8RA 8ICRA 8ICKA 1K1QA 5J0YA 2XCAA 1V4AA 1JXEA 1RYRA 4BGDA 5DB7A 4EZ6A 2C22A 4DSIA 4KMUA 1CEZA 4DQPA 3T3FA 2VA3A 3NYBA 1U4BA 1QSYA 5HMLA 4KN4A 4I2GA 3FYHA 4M04A 2MUTA 1NKBA 2FMPA 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RB4 A;  2MUT B;  2NRT A;  2NRK A;  3RTV A;  4M6W B;  4DQS A;  3PW7 A;  4P4M A;  4X4R A;  1ZQE A;  5KFQ A;  3JZ0 A;  1ZYQ A;  5KT2 A;  9ICL A;  3C1Z A;  2FLL A;  4O3S A;  5D46 A;  3UQ0 A;  2KN7 A;  3SV4 A;  1QSS A;  2WTF A;  3RJG A;  3C23 A;  2JZB B;  1NKC A;  1KTQ A;  3AU6 A;  4B9T A;  3C5G A;  3UXO A;  4B9L A;  9ICC A;  5TZV A;  1MQ2 A;  4I27 A;  4RNM A;  8ICN A;  5L1I A;  4XUS A;  2A1J A;  3JPQ A;  3UPQ A;  1LV5 A;  1F5A A;  4DSL A;  2HHQ A;  5KFF A;  2A1J B;  4F50 A;  1UEU A;  4MEY A;  1HUO A;  1T3N A;  4UQG A;  2P66 A;  1ZQF A;  4O3N A;  1JAJ A;  5DG8 A;  3H7I A;  4YFK A;  3TI0 A;  4RWO A;  3OV7 A;  5EWE A;  3SYZ A;  5F9L A;  1RXV A;  1ZQM A;  1TV9 A;  1JIH A;  1BGX T;  4QZ8 A;  4RNN A;  3BQ2 A;  4UB2 A;  4DL6 A;  3Q8K A;  2C2E A;  4K4H A;  3T5L A;  1NOM A;  1XU4 A;  5CP2 A;  3HPO A;  3G6X A;  3Q8S B;  2AQ4 A;  4FBU A;  3NTU A;  5BOL A;  2GWS A;  4M9L A;  4KLJ A;  4FH3 A;  3ZDB A;  4WC7 A;  5KFB A;  2O5A A;  4UBC A;  3BQ1 A;  4QZC A;  4M2Y A;  2ZHB A;  4RQ0 A;  5KFN A;  2ZJ8 A;  3V6K A;  4QZF A;  1MC8 A;  4GLX A;  2F1J A;  2ZTD A;  2OWO A;  4O5K A;  2HW3 A;  7ICQ A;  4DF8 A;  3MR5 A;  5KTQ A;  3RAQ A;  4JK1 A;  1XO1 A;  2F1H A;  5KG6 A;  4YR0 A;  4PHE A;  4QWD A;  2PXI A;  5IIL A;  3H40 A;  3OVA A;  3BDP A;  4J9S A;  4TUQ A;  4EBE A;  5J2G A;  4DL2 A;  4PGQ A;  4B9V A;  4KLH A;  1NK6 A;  1OU5 A;  2HHP A;  3OVB A;  2XO7 A;  1SL0 A;  8ICL A;  1S97 A;  4DL4 A;  3H38 A;  1U47 A;  3WFQ E;  5KFK A;  1NK5 A;  2KP7 A;  3PML A;  8ICC A;  2ZH9 A;  4RWQ A;  1ZQU A;  4C8O A;  4Z6C A;  4ED2 A;  1U9L A;  4YVZ A;  5J2F A;  1ZQB A;  1NJX A;  7ICG A;  4ELU A;  1S0V A;  1ZQN A;  3PNC A;  8ICY A;  4F93 B;  4X0A A;  4J9P A;  2NRZ A;  2HVH A;  5KG5 A;  5DQH A;  1ZQI A;  4KLE A;  2KFZ A;  2DRA A;  4DL7 A;  5HRE A;  5HMM A;  5J2C A;  4Q45 A;  4F5O A;  9ICN A;  1ZJN A;  3TFR A;  1XSL A;  1UA0 A;  9ICA A;  1QTM A;  9ICF A;  9ICG A;  2DPJ A;  4QZE A;  3Q8Q B;  4QZA A;  2AGQ A;  2BPG A;  4AT7 B;  4O5E A;  3T5K A;  3HW8 A;  3GIJ A;  3RR8 A;  1WCN A;  1NJY A;  1L3T A;  2HHT A;  3ORY A;  3RJF A;  3RRH A;  1DGS A;  4QZD A;  8ICF A;  4DQR A;  2BCQ A;  3H3A A;  9ICV A;  4O5C A;  3MDA A;  4YG2 A;  4KTQ A;  5DBA A;  3JPO A;  1H38 A;  4KLD A;  2AJQ A;  3C66 A;  4ECR A;  4UAZ A;  5CR0 A;  5EWG A;  3IHQ B;  1V9P A;  4XQ7 A;  4UB4 A;  2C2R A;  1R8C A;  3HJ1 A;  4WBY A;  1QSL A;  4J9R A;  5KFJ A;  8ICB A;  3AU2 A;  1ZET A;  4JUZ A;  3C1Y A;  5DQG A;  2ZUB A;  5KFZ A;  3M9O B;  4WBZ A;  2VA8 A;  4E0D A;  2JEG A;  3ZDA A;  4Z6E A;  5IIJ A;  4F5P A;  2HHU A;  4FS1 A;  4DS5 A;  3QEB Z;  3SZ2 A;  1X9M A;  1NJZ A;  5DQI A;  3C21 A;  2Y1I A;  2W8L A;  2FMQ A;  7ICJ A;  7ICV A;  4NKU A;  3Q8P B;  5DB8 A;  3G6V A;  2V9W A;  9ICI A;  1ZQA A;  9ICW A;  2FPK A;  4ED8 A;  4X4P A;  1KFS A;  1TK0 A;  4PH5 A;  4C8N A;  4RPX A;  2UVV A;  3LQC B;  1R89 A;  1NK0 A;  4DQI A;  4M5D A;  3IM1 A;  3GIK A;  4YMN A;  5J2D A;  2M2U A;  4F5Q A;  1RYS A;  9ICH A;  1UEV A;  5EOZ A;  4ECV A;  3QE9 Y;  1S10 A;  3G6Y A;  1KFT A;  4KIT B;  3WFP A;  4RWP A;  8ICV A;  1D9F A;  2HHW A;  2ISP A;  5HRI A;  1BPD A;  5KG4 A;  3EPG A;  9ICR A;  1Z00 A;  3TAN A;  4I29 A;  2AQ0 A;  4ELV A;  1YLQ A;  1Z00 B;  4QZB A;  4JWM A;  1ZQW A;  3PW5 A;  3RBD A;  2ASL A;  8ICZ A;  4QZI A;  4FO6 A;  4R8U A;  1NZP A;  1TFR A;  2B21 A;  5KG2 A;  4WC5 A;  3V7L A;  5KFI A;  5CWR A;  4YP3 A;  2RFF A;  4WC6 A;  4TUP A;  2IA6 A;  1BPE A;  1S76 D;  3OUY A;  1U45 A;  1JMS A;  1COO A;  2W9B A;  3N4M B;  1Y88 A;  4PHP A;  3EYZ A;  1PX5 A;  4YD1 A;  5KT4 A;  4UBB A;  2W9B B;  4YXM A;  4QWA A;  5L1L A;  4DSJ A;  4MFC A;  4E80 A;  1MIV A;  4YMO A;  2KZ3 A;  4IQU A;  5HRL A;  3AUO A;  4JV0 A;  2XC9 A;  2XY7 A;  4FBT A;  3M8S A;  7ICK A;  1L3S A;  3MFI A;  3AQK A;  5HNK A;  1UT8 A;  3BQ0 A;  4Q8F A;  4M9H A;  8ICA A;  4AT9 A;  1WCL A;  3RAX A;  5KFS A;  4WC4 A;  5IIN A;  3T5H A;  1S9F A;  4I2E A;  4PPX A;  4RQ5 A;  3PO5 A;  4M47 A;  5KFO A;  2KTQ A;  3UPS A;  5J0T A;  2BKE A;  2F1I A;  8ICE A;  2Q66 A;  4HYK A;  3E2E A;  3T5J A;  4JWN A;  1NK8 A;  5C5J A;  5KFP A;  4GC6 A;  4DF4 A;  3GIL A;  2DR8 A;  2V4Q A;  9ICT A;  3EW9 A;  4RQ4 A;  4F5R A;  3TFS A;  1KDH A;  1S77 D;  2FPL A;  2KZZ A;  5J2A A;  1Z3E B;  1UT5 A;  3GIM A;  1S0M A;  4RUC A;  5DLG A;  4I28 A;  1TAQ A;  5J29 A;  1DOQ A;  4DFM A;  4NLN A;  4RT2 A;  3OJS A;  3EPI A;  1L3V A;  3HWT A;  1K1S A;  4J9Q A;  2DR9 A;  3ZDE A;  1TFW A;  4P4P A;  2BE3 A;  4P4O A;  4DSF A;  2ZJA A;  3H8J A;  1ZQT A;  3OHB A;  2UVW A;  7ICP A;  4B9S A;  3H8S A;  8ICU A;  3V6H A;  3RH5 A;  3QZ8 A;  4RUA A;  3MGH A;  1SKW A;  2BDP A;  4JV2 A;  4QZ9 A;  3C18 A;  3WFO A;  1ZQZ A;  5KFX A;  4RPZ A;  4TUR A;  5L1J A;  3HJ4 A;  4DWI A;  3H37 A;  1ZQV A;  1VJ7 A;  2VA2 A;  5J0P A;  4ATB A;  3MDC A;  1RZT A;  4O3Q A;  1ZQX A;  2AGP A;  4YMM A;  1L5U A;  1NK7 A;  2PFQ A;  4UAW A;  4R64 A;  1SKR A;  2J6T A;  4O3O A;  4X5V A;  4NXZ A;  4ZH4 A;  3V72 A;  3RJK A;  3ZDC A;  3Q8R B;  4ECW A;  5HP4 A;  4E8F A;  4DS4 A;  1ZQD A;  2PBE A;  3LDA A;  9ICX A;  9ICP A;  8ICW A;  4R66 A;  4KLL A;  2ZHA A;  3LK9 A;  2IBK A;  5KFR A;  4F4Y A;  4RQ2 A;  4FS2 A;  2XY5 A;  4XA5 A;  4DSE A;  4ED0 A;  1TVA A;  2IMW P;  1SZP A;  1LB2 B;  1ZQY A;  4NLZ A;  9ICM A;  5HRD A;  3AQM A;  5III A;  2ASD A;  2ZH6 A;  4GXI A;  3OJU A;  1S0O A;  4LZG A;  2BHN A;  1XSN A;  4RQ8 A;  3AQN A;  1T4G A;  5J0S A;  5DB6 A;  4ECZ A;  3PVX A;  4DLE A;  4NY8 A;  1ZQQ A;  4UD5 A;  1VFG A;  9ICU A;  4IR9 A;  3MGI A;  3OHA A;  1SKS A;  5DGB A;  5L1K A;  3V7J A;  5J0U A;  8ICH A;  3PR5 B;  3KHH A;  4QWE A;  3GQC A;  3RB0 A;  5D4B A;  2PFP A;  4DFP A;  4QW8 A;  3Q8L A;  4DQQ A;  4DOA A;  3RH4 A;  4XQ8 A;  2IHM A;  2R8J A;  1X9S A;  5KFH A;  2ZH8 A;  5J2H A;  9ICE A;  4IRC A;  3TQ1 A;  8ICI A;  1KFD A;  2ZUC A;  4RT3 A;  3ETL A;  3EZ5 A;  2W9C A;  4K4I A;  3JPR A;  4NM1 A;  5KFC A;  3RJJ A;  2JEF A;  4BDP A;  5KG1 A;  4F5N A;  8ICQ A;  7ICN A;  4X4T A;  2DR5 A;  3M9N B;  2DFL A;  4F4X A;  2W8K A;  2BCR A;  2W9M A;  1SL2 A;  2J6S A;  3HX0 A;  4RQ7 A;  1KRP A;  5DEC A;  2RDJ A;  4EYI B;  4I2J A;  4IG8 A;  8ICT A;  4M0A A;  4LZD A;  2ZH5 A;  3ZD9 A;  4LT6 A;  3C2L A;  4M9G A;  5IIO A;  2FLP A;  3JPP A;  4RU9 A;  4YR2 A;  3HT3 A;  1KEJ A;  4QWB A;  1KSP A;  1QLN A;  4NM2 A;  8ICO A;  4X4N A;  2W9A A;  3GDX A;  4DL5 A;  5DBB A;  4EBD A;  9ICJ A;  4X4U A;  3B0Y A;  5J2J A;  1ZQO A;  4YN4 A;  4ELT A;  1A77 A;  1N48 A;  1BPY A;  2DVI A;  3RH6 A;  4BWM A;  2BQR A;  1TKD A;  4B9U A;  2ZH2 A;  5DB9 A;  4NKT A;  5HHI A;  5HRH A;  4FHP A;  2ASJ A;  3RR7 A;  4B9M A;  5KT6 A;  1XC9 A;  5DDM A;  4GXK A;  4Q8E A;  2I1Q A;  3C2M A;  5DED A;  2M9N A;  3JYY A;  2BR0 A;  2C2D A;  3OVS A;  4DEZ A;  4O9M A;  2UVR A;  3Q8M A;  2BCS A;  1N56 A;  7ICR A;  4R8U B;  2ALZ A;  4F92 B;  4TQS A;  4DL3 A;  2ATL A;  2C28 A;  4B9N A;  1T8E A;  4IRD A;  4WC0 A;  1KLN A;  4F91 B;  2FPM A;  2UVU A;  5J0O A;  4QWC A;  4P2H A;  5HRK A;  4C8M A;  5KG3 A;  4I2B A;  2XGQ A;  1R8A A;  3OUY B;  4DOB A;  3NGD A;  5J2I A;  4KLG A;  4KN7 A;  2DR7 A;  7ICM A;  4MF2 A;  4BXO A;  4F4K A;  4O0I A;  4KLT A;  8ICS A;  4I2A A;  4J9L A;  3PMN A;  3UQ2 A;  3PW2 A;  2FMS A;  4C8K A;  3ZD8 A;  1X2I A;  3H39 A;  4WC1 A;  2NRX A;  1XSP A;  4AT9 B;  3OSP A;  3ISB A;  4KLS A;  3FDS A;  3PO4 A;  3THV A;  5KFL A;  1WOT A;  5J0X A;  2PFO A;  4DSK A;  5CA7 A;  4R63 A;  4ECQ A;  1BNP A;  3LWM A;  1JQR A;  3MR2 A;  3GII A;  3GV5 B;  5KG0 A;  3C2K A;  3WFS C;  2Y1J A;  4X4V A;  5HHH A;  4RQ6 A;  1CUK A;  1XWL A;  3KHR A;  5HRG A;  1TFY A;  4KLI A;  2KZM A;  4M6W A;  5KFV A;  4J9M A;  2VAN A;  4QZH A;  5BOM A;  3QZ7 A;  4RQ3 A;  4J9O A;  1ZQH A;  3BQT A;  4DOC A;  4CCH A;  2KFN A;  2ID1 A;  4NLG A;  3MFH A;  4ECS A;  4PGY A;  4Q44 A;  2ISO A;  4MFF A;  2HVI A;  1R8B A;  3MR6 A;  1UET A;  3UXP A;  4X4O A;  4MF8 A;  2BQ3 A;  4KLM A;  4GC7 A;  4ED1 A;  5KG7 A;  8ICP A;  2JZB A;  3K75 D;  3KHG A;  4IR1 A;  1ZQL A;  5KFA A;  5KFD A;  3RJE A;  5J2B A;  2V4R A;  1ZQC A;  1ZQP A;  4IQV A;  9ICB A;  5HRF A;  3JPT A;  3GV7 B;  4F4Z A;  3PV8 A;  2ZH7 A;  3K4G A;  8ICG A;  1PZN A;  7ICH A;  4FH5 A;  4I2D A;  4QW9 A;  3RB3 A;  2HHV A;  2ZTE A;  2R8H A;  3TAP A;  4JV1 A;  4MFA A;  3PX0 A;  1RPL A;  1DK3 A;  4IQW A;  5HRB A;  3JPN A;  1C7Y A;  8ICM A;  4WCW A;  4ATB B;  4EYH B;  5KT3 A;  2NRV A;  7ICE A;  2ZUD A;  4YD2 A;  3KTQ A;  2ZH3 A;  5IIM A;  3RRG A;  4J9N A;  1XS9 D;  3GV8 B;  1L3U A;  2HHS A;  9ICQ A;  2M2T A;  4FHV A;  1BPB A;  4WC2 A;  1JN3 A;  2JEJ A;  5D49 A;  4YR3 A;  4F4W A;  4GXJ A;  4Q43 A;  1ZQR A;  4LVS A;  7ICT A;  4FHX A;  2NRW A;  4YCX A;  5JUM A;  2ZJ5 A;  7ICO A;  3HIY A;  2DRB A;  1RXW A;  9ICO A;  1TK5 A;  2R8K A;  3V6J A;  1D8Y A;  3PR4 A;  5DG7 A;  1Q79 A;  4E7X A;  1D8L A;  3B0X A;  1TK8 A;  4EBK A;  2XGP A;  3RJI A;  2PI5 A;  4EZ9 A;  7ICI A;  1JX4 A;  2BGW A;  5EWF A;  5J0Q A;  4MEX A;  4RWN A;  3MBY A;  5DDY A;  4YQW A;  4UB3 A;  5DBC A;  1A76 A;  4RPY A;  8ICJ A;  4EEY A;  7ICU A;  4UAY A;  4UB1 A;  2XCP A;  3KHL A;  3L9D A;  2H5X A;  4KLQ A;  4UB5 A;  2BPC A;  4TUS A;  5BPC A;  1NK4 A;  1U48 A;  1NKE A;  4I2H A;  4M9N A;  7ICS A;  1MSW D;  3H4B A;  2P6U A;  1U49 A;  1KNY A;  4QZG A;  2AU0 A;  3H4D A;  1ZQK A;  2R8G A;  4KLU A;  2BQU A;  1DK2 A;  3ISD A;  7ICF A;  1IM4 A;  1HJP A;  3TAR A;  1TAU A;  4Z6D A;  4DLG A;  3HP6 A;  5F2V O;  5L9X A;  5DG9 A;  8ICX A;  3ZDD A;  1EXN A;  2M2W A;  1BPZ A;  2W9C B;  4ED6 A;  1HUZ A;  5KFU A;  2R8I A;  1T7P A;  2Q0Z X;  1NK9 A;  3RJH A;  3GFK B;  3PY8 A;  5IIK A;  4RZR A;  3QEA Z;  4I2I A;  4KLF A;  2RDI A;  3EWA A;  1Q78 A;  3N97 B;  3BJY A;  4AT7 A;  4DFK A;  3MR3 A;  5CJ7 A;  3PX4 A;  2ZH1 A;  3UXN A;  4O3P A;  5DKW A;  1BNO A;  2BPF A;  4NLK A;  3ISC A;  7ICL A;  1JXL A;  4J9K A;  3RB6 A;  4ECY A;  5J0W A;  3PX6 A;  3LWL A;  4ED3 A;  4RQ1 A;  3OGU A;  5KFY A;  3M9M B;  2DPI A;  2XY6 A;  4X4Q A;  3V7K A;  3SV3 A;  4EP7 A;  3M8R A;  2ZTC A;  4UD4 A;  2FLN A;  3WFR E;  2O1P A;  3JPS A;  4C8L A;  4IRK A;  1B22 A;  4PHA A;  4O3R A;  2P6R A;  1ZQS A;  2AGO A;  5KFM A;  3PW4 A;  4F2S A;  2BCV A;  4FHW A;  5J2K A;  2MAX A;  3SI8 A;  5HR9 A;  1MIW A;  4WC3 A;  1MIY A;  9ICK A;  4XRH A;  5DLF A;  5J0R A;  1UA1 A;  1MQ3 A;  4F3O A;  4M9J A;  4AT8 A;  5HC9 A;  4YXJ A;  5KFE A;  2LYH A;  4R65 A;  1BPX A;  4AT8 B;  4PHD A;  1X9W A;  2JEI A;  4S3N A;  4ED7 A;  2ZH4 A;  5KFG A;  4BWJ A;  4F2R A;  3TAQ A;  4ECX A;  1NO5 A;  1S0N A;  5KFT A;  5KT5 A;  1ARO P;  4X0B A;  5KFW A;  3RBE A;  3MAB A;  3H8W A;  2I9G A;  2BCU A;  5KT7 A;  2PFN A;  4PGX A;  2J6U A;  2HHX A;  9ICS A;  1FA0 A;  1ZQJ A;  4EBC A;  5DGA A;  3AQL A;  4ECT A;  4RNO A;  5CHG A;  5F9N A;  4X4S A;  4Z6F A;  4ECU A;  5J2E A;  3C5F A;  1SL1 A;  1IXR A;  3OSN A;  4I2F A;  1NJW A;  4G3I A;  4BXO B;  4IQT A;  5CB1 A;  1ZJM A;  4K4G A;  4EBJ A;  4FHY A;  1B43 A;  2IHN A;  1D9D A;  3PW0 A;  4KLO A;  4TQR A;  4DFJ A;  2M2V A;  2PI4 A;  1ZQG A;  4I2C A;  4DO9 A;  4F8R A;  8ICR A;  8ICK A;  1K1Q A;  5J0Y A;  2XCA A;  1V4A A;  1JXE A;  1RYR A;  4BGD A;  5DB7 A;  4EZ6 A;  2C22 A;  4DSI A;  4KMU A;  1CEZ A;  4DQP A;  3T3F A;  2VA3 A;  3NYB A;  1U4B A;  1QSY A;  5HML A;  4KN4 A;  4I2G A;  3FYH A;  4M04 A;  2MUT A;  1NKB A;  2FMP A;  1BVS A; 
#chains in the Genus database with same CATH topology
 1KN5 A;  4UAV A;  4DQS A;  3PW7 A;  5KAI U;  4NL9 C;  5KT2 A;  9ICL A;  5HR7 A;  3SV4 A;  1QSS A;  3ZI4 A;  1NKC A;  1KTQ A;  4B9T A;  3C5G A;  9ICC A;  2MSN A;  4I27 A;  4RNM A;  5L1I A;  4XUS A;  2A1J A;  2HHQ A;  3ALR A;  1SV0 C;  1HUO A;  2P66 A;  5AKK A;  1JAJ A;  3TI0 A;  4RWO A;  3K1R B;  3AQF A;  3OV7 A;  4O67 A;  1JIH A;  3WK6 A;  1NOM A;  1XU4 A;  5CP2 A;  3F5A A;  2AQ4 A;  3NTU A;  2KSO B;  2IOF A;  3IG8 A;  4UBC A;  4M2Y A;  1D8B A;  4KM5 A;  2ZJ8 A;  3V6K A;  7ICQ A;  1MC8 A;  3UMB A;  1IV8 A;  4DF8 A;  3MR5 A;  5KTQ A;  2WAQ C;  3RAQ A;  2PXI A;  2D3D A;  4PHE A;  4QWD A;  5IIL A;  2WB1 F;  4TUQ A;  1X40 A;  2WF7 A;  4EBE A;  4DL2 A;  1OU5 A;  3ER9 B;  4KLH A;  1COK A;  3NRW A;  2GOL A;  4C4S A;  1V85 A;  8ICC A;  4RWQ A;  4C8O A;  4ED2 A;  1U9L A;  2LM1 A;  1Q3V A;  1ZQB A;  4X0A A;  4P0Q B;  4J9P A;  2NRZ A;  2DUY A;  3WKA A;  4KLE A;  5J2C A;  1ZJN A;  9ICG A;  5CRX A;  1L7M A;  3N7S C;  2OYY A;  5AKJ A;  2ZIV A;  3T5K A;  2FJ6 A;  2LHT A;  1L3T A;  3DEE A;  3RJF A;  1FFV A;  4QZD A;  8ICF A;  4O5C A;  3MDA A;  4YG2 A;  2IHO A;  5EWG A;  5B66 U;  4WBY A;  5AIC A;  8ICB A;  4JUZ A;  4RQM A;  3UM9 A;  4WBZ A;  3M9O B;  2JEG A;  2HBM A;  4FS1 A;  1NJZ A;  5DQI A;  2FMQ A;  7ICV A;  4NKU A;  7ICJ A;  5AK3 A;  2UVV A;  2EAN A;  3LQC B;  4AP9 A;  1NK0 A;  2NYV A;  3BZK A;  4K96 A;  1QCK A;  4Y2R A;  2WF5 A;  4F5Q A;  2K8C B;  1RYS A;  5D63 A;  3QE9 Y;  4FE3 A;  4RWP A;  5HRI A;  4CDG A;  3TAN A;  1M6Y A;  3PW5 A;  3RBD A;  1L7P A;  4IS7 A;  4FO6 A;  4R8U A;  4LEZ A;  5CWR A;  5AK6 A;  4WC6 A;  2KIC A;  1JMS A;  5AKZ A;  4JLX A;  4MFC A;  3I76 A;  1MIV A;  2KZ3 A;  3AUO A;  4FBT A;  1L3S A;  5KNI A;  4QIW C;  1WCL A;  2XIC A;  4NLC A;  2WHE A;  5J0T A;  2Q66 A;  4JWN A;  1NK8 A;  5C5J A;  2JRZ A;  2DR8 A;  1HEK A;  2V4Q A;  9ICT A;  2ZIW A;  5T14 A;  1KDH A;  1JAL A;  5J2A A;  1Z3E B;  5DLG A;  5J29 A;  1DOQ A;  4NLN A;  4RT2 A;  3EPI A;  1ZRM A;  4P0P A;  1JUD A;  3PST A;  3QU7 A;  4DSF A;  3H8J A;  2HBK A;  1X9X A;  3M6K A;  2BDP A;  3QZ8 A;  4JV2 A;  2EZX A;  5KFX A;  4TUR A;  4DWI A;  3H37 A;  3QNM A;  3BS5 A;  4YMM A;  2E8P A;  2PFQ A;  3U26 A;  2HDO A;  5ALS A;  1JI7 A;  4ZH4 A;  3WK5 A;  4CF5 A;  2YMM A;  5HP4 A;  2PBE A;  2D8C A;  9ICX A;  4KLL A;  5JRT A;  4BUG A;  4FS2 A;  4K9B A;  3WKC A;  5ALV A;  2IMW P;  1SZP A;  1LB2 B;  4NXX A;  1FEZ A;  4GXI A;  3DV9 A;  3KD3 A;  5EE1 A;  4UAT A;  5DB6 A;  4NY8 A;  2QB0 B;  1ZQQ A;  4MHV A;  4USA A;  4NV0 A;  2E8N A;  3LVW A;  5K4L A;  5J0U A;  3RB0 A;  2ZIV B;  4DFP A;  1B4F A;  4DOA A;  4DQQ A;  2IHM A;  1MN8 A;  4K97 A;  3EZ5 A;  4K4I A;  2W9C A;  2YTU A;  2W43 A;  5AI5 A;  3SAG A;  2JEF A;  4BDP A;  2DR5 A;  2MA1 A;  3N28 A;  2YX8 A;  1SL2 A;  2J6S A;  2Y9T A;  1KRP A;  4EYI B;  4I2J A;  4CF3 A;  8ICT A;  3C2L A;  4YR2 A;  3HT3 A;  3WKB A;  1KSP A;  2HN1 A;  4OAF A;  2KIW A;  4YN4 A;  4ELT A;  2RLT A;  2KJ9 A;  3WKE A;  3RH6 A;  2ZH2 A;  1DXS A;  5DB9 A;  3NVZ A;  2ES6 A;  4OCZ A;  4FHP A;  2YQE A;  3HRD D;  2LM4 A;  2ZIU A;  3KKA A;  2G06 A;  2BR0 A;  4DEZ A;  4NXU A;  3Q8M A;  2B56 A;  2BCS A;  1DGJ A;  5AKX A;  4R8U B;  4F92 B;  2K8B B;  2FPM A;  2UVU A;  4QWC A;  5HRK A;  4C8M A;  4I2B A;  2FE9 A;  3I28 A;  7ICM A;  2RQ5 A;  2FMS A;  3UQ2 A;  5KAF U;  4O69 A;  2A19 A;  4DSK A;  3KOO A;  2DF4 B;  2KG5 A;  4RQ6 A;  1TFY A;  4KLI A;  5KFV A;  4QZH A;  1ZQH A;  4RQ3 A;  2YMP A;  2ID1 A;  2ZIW B;  4PGY A;  4Q44 A;  2ISO A;  2HVI A;  4MF8 A;  4KLM A;  4GC7 A;  2E5S A;  2H3F A;  3K75 D;  4IR1 A;  1ZQL A;  4OO1 J;  5J2B A;  4IQV A;  3GV7 B;  3H8M A;  3K4G A;  7ICH A;  2ZTE A;  3TAP A;  4MFA A;  1OUQ A;  4IQW A;  3PZP A;  8ICM A;  1FIQ A;  1ZD3 A;  1N5W A;  4EYH B;  5KT3 A;  2NRV A;  2ZH3 A;  1A0P A;  3RRG A;  3GV8 B;  2HHS A;  2M2T A;  1V97 A;  3HKZ C;  5EE3 A;  5D49 A;  4F4W A;  4LVS A;  1WUD A;  3D6J A;  1RXW A;  2R8K A;  4C7Y A;  1Q79 A;  1D8L A;  2RP5 A;  2PI5 A;  7ICI A;  2BGW A;  3A0B U;  2EWR A;  4RPY A;  2BPC A;  1U48 A;  7ICS A;  3BQ7 A;  3H4B A;  2AU0 A;  1DK2 A;  1L8O A;  3TAR A;  4DLG A;  5L9X A;  2WB1 C;  3ZDD A;  1EXN A;  2W9C B;  5TIS U;  5KFU A;  2RRD A;  1UHU A;  2R8I A;  1T7P A;  2Q0Z X;  1NK9 A;  2YMQ A;  3RJH A;  1ZD2 P;  2DL0 A;  4RZR A;  3QEA Z;  2LKY A;  3PX4 A;  2ZH1 A;  1BNO A;  2BPF A;  4NLK A;  3ISC A;  4J9K A;  3RB6 A;  4Y2U A;  3PX6 A;  4JMU A;  5AKI A;  3WFR E;  4C8L A;  4IRK A;  2P6R A;  4F2S A;  2WF9 A;  3PW4 A;  5HR9 A;  9ICK A;  4F3O A;  4AT8 A;  2LYH A;  2ZIU B;  4PHD A;  1IIP A;  2JEI A;  5ALG A;  4ED7 A;  5KFG A;  4BWJ A;  1WG8 A;  3TAQ A;  5KFT A;  4LEY A;  1JRP A;  4C4R A;  2BCU A;  2J6U A;  9ICS A;  4EBC A;  2HOI A;  5CHG A;  5F9N A;  4ECU A;  3C5F A;  1SL1 A;  1PK1 A;  3OSN A;  4I2F A;  3MCR A;  1ZJM A;  1CRX A;  3AM9 A;  4I2C A;  2I5H A;  2O6K A;  1V4A A;  2KJ5 A;  4DSI A;  4KMU A;  1NNL A;  3F2D A;  3T3F A;  1CEZ A;  2FMP A;  2MUT B;  2NRT A;  3JZ0 A;  2HN2 A;  3C1Z A;  4O3S A;  5D46 A;  3UQ0 A;  3AU6 A;  4B9L A;  1X6I A;  2ESE A;  1F5A A;  3UPQ A;  5ALQ A;  4DSL A;  2CXY A;  4F50 A;  4MEY A;  4UW9 A;  2FDR A;  1ZQF A;  4YFK A;  5ALN A;  1ZQM A;  3BQ2 A;  4DL6 A;  4RNN A;  3Q8K A;  2C2E A;  1SXE A;  3WK7 A;  3HPO A;  1Q8K A;  5ALD A;  4M9L A;  2LYB A;  4FH3 A;  4Y2S A;  4KLJ A;  4B6J A;  5KFB A;  2EZZ A;  1N60 A;  4RQ0 A;  5KFN A;  4QZF A;  4GLX A;  2ZTD A;  2HBJ A;  1XO1 A;  4YR0 A;  3AEV A;  3OVB A;  1NK6 A;  2JH1 A;  8ICL A;  1S97 A;  2ZH9 A;  1LKY A;  1ZQU A;  4YVZ A;  4P0Q A;  1NJX A;  4ELU A;  1ZQN A;  8ICY A;  5KG5 A;  1O03 A;  1N2X A;  2DRA A;  3F2C A;  2D6F C;  4DL7 A;  5HMM A;  3UMC A;  1UA0 A;  9ICA A;  1RQN A;  1Z4N A;  4UB6 U;  2AGQ A;  2BPG A;  3HW8 A;  3GIJ A;  3RR8 A;  1NJY A;  3ORY A;  2YN4 A;  1DGS A;  3WKD A;  3H3A A;  3HJE A;  4KTQ A;  3JPO A;  5ALK A;  5CR0 A;  1V9P A;  3VCB A;  2C2R A;  1R8C A;  4J9R A;  5ALW A;  2ZUB A;  1O08 A;  3ZDA A;  4F5P A;  1X9M A;  1S5L U;  5DB8 A;  9ICI A;  2V9W A;  1L7N A;  2FPK A;  5AM2 A;  4LJX A;  2G5H B;  1KFS A;  1R89 A;  4CRX A;  4M5D A;  3N7R C;  2M2U A;  1ZXI A;  1S10 A;  3G6Y A;  2GAF D;  2JHD A;  4KIT B;  3WFP A;  1ZD5 A;  2HHW A;  5AIA A;  2G07 A;  5ALY A;  3EPG A;  4OAI Z;  4I29 A;  1YLQ A;  4ELV A;  1Z00 B;  4QZB A;  1ZQW A;  4QZI A;  4PZN A;  1NZP A;  3RF9 A;  2DQN B;  1TFR A;  2B21 A;  4WOY A;  4WQL A;  4YP3 A;  1KQQ A;  3TAD A;  1S76 D;  4WJ3 B;  3N4M B;  3EYZ A;  4PHP A;  4YD1 A;  5KT4 A;  2W9B B;  4YXM A;  4E80 A;  4LEW A;  1N62 A;  5HRL A;  4UB8 U;  5ALO A;  3AQK A;  1UT8 A;  1NI3 A;  4WC4 A;  2KTQ A;  2NV3 A;  2PMZ F;  1ECW A;  3T5J A;  1DRG A;  2N1R A;  2ZXI A;  3GIL A;  2HCF A;  5AI6 A;  2VJ4 A;  4F5R A;  1UT5 A;  3GIM A;  4I28 A;  4DFM A;  1ZOL A;  3SEI A;  2Y0S F;  3ZDE A;  2I6X A;  2ZJA A;  3OHB A;  2UVW A;  1SXD A;  1KL9 A;  4RUA A;  2GA9 D;  4QZ9 A;  4ATB A;  2VA2 A;  4FZL A;  1L5U A;  1NK7 A;  1F44 A;  1SKR A;  2J6T A;  4O3O A;  1Q3U A;  2Y9U A;  3IDW A;  4NXZ A;  3ZDC A;  4E8F A;  2H3Z A;  2LYA A;  2ZHA A;  2IBK A;  5KFR A;  4F4Y A;  3AN1 A;  3GU3 A;  2XY5 A;  1LKY B;  2BBJ A;  3WU2 U;  4ED0 A;  2KKP A;  4NLZ A;  9ICM A;  3AQM A;  2ASD A;  4LZG A;  3LYS A;  4HX0 A;  2DWQ A;  2BHN A;  2QB0 A;  4RQ8 A;  1T4G A;  3AQN A;  5J0S A;  1VJ5 A;  2QKQ A;  5ALZ A;  4UAU A;  4IR9 A;  3PR5 B;  7ICP A;  4QWE A;  3RH4 A;  4C80 A;  4XQ8 A;  2EQY A;  1X9S A;  3QUB A;  9ICE A;  3TQ1 A;  8ICI A;  3ETL A;  4NM1 A;  2IUB A;  8ICQ A;  4F5N A;  4U6P A;  3UMG A;  4US8 A;  1PVQ A;  4GIB A;  2JMG A;  2F8K A;  4IG8 A;  2ZH5 A;  4M9G A;  4OJ5 A;  5IIO A;  2FLP A;  3IRU A;  3SQI A;  4QWB A;  3T79 A;  4DL5 A;  3NRZ A;  1A6S A;  2B4V A;  2A3V A;  1RDF A;  4X4U A;  3QU9 A;  1A77 A;  1BPY A;  5ALR A;  2DVI A;  2BQR A;  4B9U A;  4B9M A;  1XC9 A;  4GXK A;  4Q8E A;  3I1Y A;  2VIX A;  2C2D A;  2E3T A;  2HMX A;  3OVS A;  2DKZ A;  2ALZ A;  2C28 A;  4B9N A;  4TQS A;  2ATL A;  4WC0 A;  4K99 A;  5AI9 A;  3NGD A;  5J2I A;  4KN7 A;  4BXO A;  4F4K A;  4KLT A;  8ICS A;  4KX3 A;  3PMN A;  3PW2 A;  4C8K A;  4WC1 A;  3D2S A;  3OSP A;  3ISB A;  4KLS A;  1JQR A;  5CA7 A;  3LWM A;  3HIL A;  5KG0 A;  3C2K A;  2EAM A;  5CEH A;  3WFS C;  3F53 A;  2W3S A;  3NUQ A;  4M6W A;  4J9M A;  4CCH A;  5BOM A;  3JYY A;  3MFH A;  4ECS A;  4X4O A;  1WYG A;  3MR6 A;  3UXP A;  5CFU A;  2JZB A;  4EGW A;  1ED1 A;  2F76 X;  5KFD A;  3ED5 A;  1PK3 A;  1ZQP A;  1ZQC A;  1MA7 A;  4F4Z A;  2ZH7 A;  2HHV A;  2R8H A;  4NJ8 A;  4ATB B;  5ALE A;  7ICE A;  3KTQ A;  2ODG A;  4LEV A;  3L4P A;  1ZRN A;  1JN3 A;  4FHX A;  3ONN A;  7ICT A;  2K4P A;  7ICO A;  2DRB A;  9ICO A;  3PR4 A;  5EE9 A;  1PVR A;  4E7X A;  3B0X A;  4EBK A;  1TK8 A;  2WF8 A;  4G9B A;  2XID A;  4EZ9 A;  1SZH A;  3QYP A;  5EWF A;  5J0Q A;  1JX4 A;  4MEX A;  5DDY A;  4YQW A;  5DBC A;  2QAR A;  2LPE A;  3L9D A;  3PSI A;  2F2A B;  4NWI A;  4I2H A;  1NKE A;  1MSW D;  2L5Y A;  4QZG A;  1ZQK A;  3H4D A;  4KLU A;  3ISD A;  1P7D A;  4US9 A;  7ICF A;  1HJP A;  3OTQ A;  4Z6D A;  4HAI A;  5DG9 A;  3KZX A;  5KL8 B;  1BPZ A;  2GH1 A;  1HUZ A;  1SWW A;  4KLF A;  2RDI A;  3EWA A;  4QJF B;  2YB1 A;  3N97 B;  3BJY A;  2ZXH A;  4DFK A;  4AT7 A;  1F5S A;  1JXL A;  4ECY A;  2KIV A;  5G5G A;  5CHE A;  2O1P A;  3JPS A;  1ZQ1 C;  5JU5 A;  3DDH A;  3FM9 A;  5KFM A;  2EH9 A;  2MAX A;  4WC3 A;  1MQ3 A;  4F72 A;  4M9J A;  4Y2V A;  4YXJ A;  5KFE A;  2VJ5 A;  2G5I B;  4F2R A;  1NO5 A;  2KKV A;  3RBE A;  3H8W A;  4Y2T A;  5A0L A;  4PGX A;  5DGA A;  3NKU A;  3IV6 A;  1TAM A;  1Z4O A;  2KHV A;  5J2E A;  2R18 A;  1SWV A;  4BXO B;  5CB1 A;  5B3Q A;  2E1E A;  2IHN A;  4IC9 A;  4DFJ A;  2M2V A;  2PI4 A;  4DO9 A;  4F8R A;  8ICR A;  1L6N A;  1K1Q A;  4NXW A;  5J0Y A;  1RYR A;  4OJ6 A;  4BGD A;  4DQP A;  2XI9 A;  3NYB A;  1QSY A;  4KN4 A;  4I2G A;  3FYH A;  2MUT A;  1NKB A;  1BVS A;  3RB4 A;  2NRK A;  1GPJ A;  4M6W B;  5KFQ A;  2H3V A;  2KN7 A;  2WTF A;  3RJG A;  3C23 A;  2JZB B;  3M1Y A;  1MQ2 A;  4PL2 A;  3JPQ A;  2HOQ A;  2WF6 A;  4FO1 A;  1YZ7 A;  4EEK A;  2F3N A;  4Y2Q A;  1T3N A;  2YML A;  4WQK A;  5EWE A;  1RXV A;  1TV9 A;  4QZ8 A;  4UB2 A;  2PMZ C;  3CP8 A;  2AH5 A;  3BS7 A;  3SD7 A;  2W11 A;  3Q8S B;  4FBU A;  2RHF A;  2GWS A;  3ZDB A;  1URJ A;  3BQ1 A;  3NAS A;  2ZHB A;  2OWO A;  2HW3 A;  4O5K A;  2WFA A;  2DBY A;  5KG6 A;  2F1H A;  4Y2J A;  3H40 A;  5AKY A;  3BDP A;  2AHO B;  4OAH A;  2QAR B;  1WWV A;  4PGQ A;  1U47 A;  3WFQ E;  5KFK A;  2KP7 A;  1NK5 A;  3PML A;  4U7C A;  2Z7J A;  7ICG A;  5J2F A;  1S0V A;  2QLT A;  3H0R B;  2HVH A;  2KFZ A;  5AI8 A;  2YB4 A;  2KOB A;  1UCV A;  2LBO A;  9ICF A;  4EX7 A;  2DPJ A;  4AT7 B;  4O5E A;  2HHT A;  3RFA A;  4DQR A;  2BCQ A;  2IOH A;  2AJQ A;  3C66 A;  4UAZ A;  3IHQ B;  3D2Q A;  2KNJ A;  3HJ1 A;  1QSL A;  5KFJ A;  4K98 A;  3AU2 A;  1ZET A;  1K5O A;  5IIJ A;  2HHU A;  4DS5 A;  3QEB Z;  3SZ2 A;  2W8L A;  2VKQ A;  5AK5 A;  1ZQA A;  4X4P A;  1TK0 A;  4C8N A;  3QX7 A;  4RPX A;  2BZF A;  5J2D A;  1X66 A;  5C0Y A;  9ICH A;  5EOZ A;  4ECV A;  8ICV A;  3SAF A;  1BPD A;  5KG4 A;  1Z00 A;  1FFU A;  2HI0 A;  1YZ6 A;  2ASL A;  8ICZ A;  5E79 U;  3AMZ A;  5KG2 A;  4WC5 A;  2RFF A;  4TUP A;  2IA6 A;  1U45 A;  1COO A;  2W9B A;  4UBB A;  4QWA A;  5L1L A;  1N5X A;  4DSJ A;  1QQ6 A;  4YMO A;  5L1M A;  3ICX A;  2XC9 A;  2XY7 A;  3M8S A;  4AT9 A;  3MFI A;  2KV2 A;  3PSF A;  8ICA A;  3RAX A;  3SEN A;  5KFS A;  1S9F A;  4PPX A;  3CNH A;  2K89 A;  4EEB A;  4RQ5 A;  3PO5 A;  3NVV A;  4HYK A;  3E2E A;  5KFP A;  4GC6 A;  4DF4 A;  4EEN A;  1QQ5 A;  3CW2 C;  3QUT A;  2KVS A;  3TFS A;  1S77 D;  2FPL A;  2KZZ A;  3L5K A;  2B6G A;  2ZIX A;  4RUC A;  1L3V A;  3HWT A;  1K1S A;  2LI6 A;  1TFW A;  4P4P A;  2BE3 A;  4OJL A;  3H8S A;  5AHX A;  3N7P D;  3V6H A;  3F2B A;  3WFO A;  3C18 A;  1ZQZ A;  5L1J A;  3HJ4 A;  1ZQV A;  2OH2 A;  1VJ7 A;  4O3Q A;  4UAW A;  4R64 A;  5ALM A;  2KHQ A;  4X5V A;  3V72 A;  3Q8R B;  4ECW A;  1ZQD A;  5AIB A;  3LDA A;  9ICP A;  8ICW A;  3TKA A;  1XNS A;  4RQ2 A;  4GFJ A;  4DSE A;  1TVA A;  2HOF A;  2ZH6 A;  1J2N A;  1XSN A;  3PVX A;  2KVC A;  4DLE A;  4DCC A;  3MGI A;  1SKS A;  5DGB A;  3V7J A;  2B51 A;  4EV6 A;  3NVW A;  8ICH A;  1PX5 A;  3Q8L A;  2ZH8 A;  5KFH A;  5J2H A;  1SV4 A;  2ZUC A;  3JPR A;  3RJJ A;  5KG1 A;  3M9N B;  2DFL A;  2KEY A;  2BCR A;  3HX0 A;  5DEC A;  5JTG A;  3JPP A;  1KEJ A;  4ACO A;  2W9A A;  4EBD A;  4EX6 A;  5FP0 A;  5KL1 B;  9ICJ A;  3B0Y A;  5J2J A;  3E0F A;  1ZQO A;  4I0U A;  2OHF A;  4BWM A;  1RQL A;  1TKD A;  4NKT A;  1KKX A;  2ASJ A;  5KT6 A;  4J03 A;  4KB6 A;  5DDM A;  2I1Q A;  3C2M A;  2M9N A;  4O9M A;  3QXG A;  2KD1 A;  1XO0 A;  5J0O A;  5J8Y A;  1R8A A;  4DOB A;  1C20 A;  3QUC A;  2DR7 A;  3SAH A;  4O0I A;  2OCE A;  2K8A A;  1PUZ A;  2LMR A;  1X2I A;  4CGZ A;  4NL9 A;  3H39 A;  2EZY A;  1XSP A;  4AT9 B;  1WOT A;  3FDS A;  4QNL A;  3THV A;  5KFL A;  5J0X A;  2PFO A;  1BNP A;  2AXT U;  4R63 A;  4ECQ A;  5G5H A;  3IP4 B;  5ALI A;  3TAD C;  1J97 A;  1CUK A;  1SV0 A;  1XWL A;  5HRG A;  1VLB A;  4WC2 A;  2VAN A;  4C4T A;  4NLG A;  1VDV A;  1UET A;  4MFF A;  1R8B A;  5ALH A;  1V38 A;  2DGZ A;  2ZIX B;  3NVY A;  4ED1 A;  5KG7 A;  3KHG A;  4N7R A;  3HKZ F;  2K4E A;  3PV8 A;  8ICG A;  1PZN A;  4FH5 A;  4I2D A;  1RPL A;  4Y2P A;  3JPN A;  1Z1B A;  1C7Y A;  4JLZ A;  4O3M A;  1XS9 D;  2W7O A;  5AI0 A;  9ICQ A;  2BDU A;  5JUM A;  3HIY A;  2K4I A;  2G09 A;  2Q4T A;  2XGP A;  2XVT A;  4RWN A;  3MBY A;  2EAO A;  1N61 A;  2F77 X;  4EEL A;  4UAY A;  4UB1 A;  2XCP A;  3KHL A;  4KLQ A;  1DK3 A;  4UB5 A;  1ZD4 A;  4M9N A;  1U49 A;  1KNY A;  4WH5 A;  2R8G A;  1J2M A;  5F2V O;  2GO7 A;  2JV3 A;  3PY8 A;  5IIK A;  3SMV A;  4O68 A;  2BBH A;  3MR3 A;  5CJ7 A;  3UXN A;  4O3P A;  5DKW A;  7ICL A;  4BJQ A;  5J0W A;  4ED3 A;  4RQ1 A;  3VC8 A;  2DPI A;  2P35 A;  2XY6 A;  3V7K A;  2KE7 A;  1B22 A;  1F0M A;  4O3R A;  2PKE A;  2BCV A;  1MIW A;  1MIY A;  4XRH A;  1UPH A;  5J0R A;  5HC9 A;  4XJE A;  4R65 A;  4C7Z A;  3WK8 A;  4CE6 A;  4NXT A;  3EF2 A;  1S0N A;  1ARO P;  2DKX A;  5AKL A;  5KFW A;  1UQV A;  2I9G A;  2PFN A;  2CRX A;  1FA0 A;  1L8L A;  1ZQJ A;  3AQL A;  4RNO A;  2H3Q A;  1NZB A;  2A1A A;  1IXR A;  4K4G A;  1B43 A;  3PW0 A;  4KLO A;  4TQR A;  4OJO A;  1ZQG A;  1OW5 A;  2C22 A;  3H0M B;  5HML A;  4M04 A;  3KFU F;  3RTV A;  4P4M A;  4X4R A;  1ZQE A;  2E8O A;  1ZYQ A;  2FLL A;  1JRO A;  2EDU A;  5ALX A;  3TAC B;  3ERC C;  3UXO A;  5TZV A;  8ICN A;  1LV5 A;  3MC1 A;  5KFF A;  2A1J B;  1UEU A;  4CNQ A;  4UQG A;  2G08 A;  4O3N A;  5DG8 A;  3H7I A;  3SYZ A;  5F9L A;  3J81 j;  5JTI A;  1BGX T;  3FC4 A;  4FZM A;  3C28 A;  4K4H A;  1KW4 A;  4JB3 A;  3T5L A;  2NO4 A;  3FAH A;  3G6X A;  5BOL A;  2M0N A;  4WC7 A;  1Z1V A;  2O5A A;  4QZC A;  2W3R A;  3QU5 A;  5ALU A;  4F71 A;  2F1J A;  2KJ8 A;  4JK1 A;  3K7D A;  3OVA A;  4J9S A;  2W55 A;  3IG5 A;  5J2G A;  4B9V A;  2HHP A;  2XO7 A;  1SL0 A;  4DL4 A;  3H38 A;  1N63 A;  2MRL A;  4Z6C A;  1Z19 A;  4EED A;  3PNC A;  4F93 B;  4PZO A;  5F3X B;  3QUQ A;  5DQH A;  1ZQI A;  2GLE A;  4OJP A;  5HRE A;  2CN1 A;  4Q45 A;  4F5O A;  9ICN A;  2OM6 A;  1XSL A;  3TFR A;  1QTM A;  2ZG6 A;  5B5E U;  4NXV A;  4QZE A;  3Q8Q B;  4QZA A;  5AKH A;  1Q46 A;  2F44 A;  1WCN A;  3RRH A;  4ZOH C;  2CPR A;  4BX9 C;  2QB1 A;  9ICV A;  5DBA A;  1H38 A;  4KLD A;  3PHZ A;  3D2N A;  4ECR A;  4MKP A;  4XQ7 A;  4UB4 A;  4FFD A;  3JCF A;  3C1Y A;  5DQG A;  5KFZ A;  2VA8 A;  4E0D A;  2JGA A;  4Z6E A;  3KBB A;  5ALF A;  3C21 A;  5GTH U;  2Y1I A;  4C0Z A;  4OAG A;  3Q8P B;  3G6V A;  9ICW A;  4PL1 A;  4ED8 A;  3WK4 A;  4PH5 A;  4DQI A;  3IM1 A;  3GIK A;  4YMN A;  5HR6 A;  1UEV A;  1KFT A;  4AYB F;  1D9F A;  2ISP A;  3KKA C;  9ICR A;  5AM0 A;  2AQ0 A;  4JWM A;  1RM6 C;  5ALT A;  3V7L A;  2K4H A;  5KFI A;  1BPE A;  3OUY A;  1Y88 A;  2F8L A;  2FI1 A;  5B3P A;  4IQU A;  4PJ0 U;  4JV0 A;  4FHV A;  3M7D A;  7ICK A;  5HNK A;  4FZN A;  3BQ0 A;  4Q8F A;  5AKG A;  4M9H A;  5ALP A;  1HIW A;  4K8V A;  5IIN A;  3T5H A;  4I2E A;  4M47 A;  5KFO A;  3C29 A;  3UPS A;  2BKE A;  2F1I A;  8ICE A;  3AL0 B;  3OWG A;  4CF4 A;  2YY6 A;  3S6J A;  4KX5 A;  3EW9 A;  4RQ4 A;  5D62 A;  5AKE A;  2W7P A;  1S0M A;  1TAQ A;  3OJS A;  2WAQ F;  4J9Q A;  2DR9 A;  2HBL A;  5AM4 A;  4P0P B;  4P4O A;  1ZQT A;  3WK9 A;  4B9S A;  8ICU A;  1SKW A;  3RH5 A;  3MGH A;  2MU2 A;  4RPZ A;  5J0P A;  3MDC A;  1RZT A;  2Y0S C;  1OXJ A;  1ZQX A;  5AM1 A;  2AGP A;  3BS5 B;  3A0H U;  5AI4 A;  3RJK A;  1RG6 A;  4DS4 A;  4R66 A;  3LK9 A;  3OPX A;  4XA5 A;  1KBU A;  1ZQY A;  5HRD A;  5III A;  3OJU A;  1S0O A;  4O6A A;  4UAR A;  3PSP A;  4ECZ A;  4UD5 A;  1VFG A;  9ICU A;  1RYU A;  2K60 A;  3OHA A;  5L1K A;  1CI4 A;  3KHH A;  2PFP A;  3GQC A;  3AQE A;  5D4B A;  4K9A A;  3ER8 C;  4QW8 A;  2R8J A;  3B9J A;  4IRC A;  3LVV A;  1KFD A;  4RT3 A;  5KFC A;  7ICN A;  4KMO B;  4X4T A;  4F4X A;  2W8K A;  2EAP A;  2W9M A;  4RQ7 A;  1IG6 A;  2RDJ A;  5AM3 A;  4LZD A;  4M0A A;  3ZD9 A;  4LT6 A;  4RU9 A;  1S8O A;  2W04 A;  1SGG A;  2IOF K;  3E58 A;  1QLN A;  4NM2 A;  8ICO A;  4OD0 A;  3IN5 A;  4X4N A;  1T3Q A;  3GDX A;  2NO5 A;  5DBB A;  1N48 A;  1SB3 C;  5HHI A;  5HRH A;  2JH7 A;  3RR7 A;  5DED A;  3QU2 A;  2UVR A;  1N56 A;  7ICR A;  4DL3 A;  4QIW F;  1T8E A;  4IRD A;  1KLN A;  4F91 B;  1GO3 F;  4P2H A;  3OUY B;  5KG3 A;  2XGQ A;  4KLG A;  4Y2Y A;  1PVP A;  4MF2 A;  2OXO A;  3QU4 A;  4I2A A;  4J9L A;  4NLB A;  5GTI U;  3NWI A;  3ZD8 A;  2NRX A;  2FCL A;  1QH9 A;  3PO4 A;  5CFS A;  3MR2 A;  3GII A;  3GV5 B;  1B0X A;  3CK6 A;  1LVH A;  2Y1J A;  3NS1 A;  4X4V A;  5HHH A;  3KHR A;  3CRX A;  2KZM A;  3QZ7 A;  4J9O A;  2KFN A;  3BQT A;  4DOC A;  5D61 A;  1T94 A;  2H3I A;  2BQ3 A;  8ICP A;  5KFA A;  3RJE A;  2E1F A;  1FO4 A;  3GZF A;  2V4R A;  9ICB A;  5HRF A;  4Y2X A;  3JPT A;  3NVO A;  4QW9 A;  3RB3 A;  3K1Z A;  2OEH A;  4JV1 A;  3PX0 A;  5HRB A;  4WCW A;  1X42 A;  2ZUD A;  4YD2 A;  5IIM A;  4J9N A;  2JR5 A;  1L3U A;  4A8E A;  1BPB A;  2B0C A;  5CFT A;  2JEJ A;  4YR3 A;  4GXJ A;  1ZQR A;  4Q43 A;  2NRW A;  4RQN A;  4YCX A;  2ZJ5 A;  2KSO A;  1TK5 A;  3V6J A;  3R9K A;  2W54 A;  5DG7 A;  1D8Y A;  1YT3 A;  3CYM A;  3RJI A;  2W03 A;  4UB3 A;  3ETR A;  1A76 A;  8ICJ A;  4EEY A;  7ICU A;  3H0L B;  3L3F X;  2H5X A;  5EE0 A;  1NK4 A;  4TUS A;  5H2F U;  5BPC A;  4UAS A;  2P6U A;  5ALL A;  2BQU A;  2JXJ A;  1IM4 A;  1TE2 A;  3O0F A;  1TAU A;  3HP6 A;  8ICX A;  2M2W A;  4ED6 A;  3GFK B;  4I2I A;  1Q78 A;  2HSZ A;  1WWU A;  2E8M A;  4ICA A;  1AQ6 A;  1QQ7 A;  3MGV A;  3LWL A;  3OGU A;  5KFY A;  3M9M B;  4X4Q A;  4EP7 A;  3SV3 A;  3M8R A;  2ZTC A;  4UD4 A;  2FLN A;  4PHA A;  1ZQS A;  2AGO A;  4FHW A;  5J2K A;  3SI8 A;  5DLF A;  1UA1 A;  4IL6 U;  1BPX A;  4AT8 B;  1X9W A;  4S3N A;  2ZH4 A;  4ECX A;  3SR6 A;  5KT5 A;  4X0B A;  3MAB A;  5ALJ A;  5KT7 A;  2HHX A;  5AK4 A;  4ECT A;  3EUB 2;  4X4S A;  4Z6F A;  2KMD A;  2G0A A;  3M6Z A;  1NJW A;  4G3I A;  3F5E A;  4IQT A;  1PK1 B;  4EBJ A;  4FHY A;  5AM5 A;  1SIJ A;  1D9D A;  4DFD A;  8ICK A;  1L7O A;  2XCA A;  3BZC A;  1JXE A;  1X6J A;  2KK0 A;  5DB7 A;  4EZ6 A;  2VA3 A;  5J8Y C;  1U4B A;  4AYB C;  3KZI U; 
#chains in the Genus database with same CATH homology
 3RB4 A;  2MUT B;  2NRT A;  2NRK A;  3RTV A;  4M6W B;  4DQS A;  3PW7 A;  4P4M A;  4X4R A;  1ZQE A;  5KFQ A;  3JZ0 A;  1ZYQ A;  5KT2 A;  9ICL A;  3C1Z A;  2FLL A;  4O3S A;  5D46 A;  3UQ0 A;  2KN7 A;  3SV4 A;  1QSS A;  2WTF A;  3RJG A;  3C23 A;  2JZB B;  1NKC A;  1KTQ A;  3AU6 A;  4B9T A;  3C5G A;  3UXO A;  4B9L A;  9ICC A;  5TZV A;  1MQ2 A;  4I27 A;  4RNM A;  8ICN A;  5L1I A;  4XUS A;  2A1J A;  3JPQ A;  3UPQ A;  1LV5 A;  1F5A A;  4DSL A;  2HHQ A;  5KFF A;  2A1J B;  4F50 A;  1UEU A;  4MEY A;  1HUO A;  1T3N A;  4UQG A;  2P66 A;  1ZQF A;  4O3N A;  1JAJ A;  5DG8 A;  3H7I A;  4YFK A;  3TI0 A;  4RWO A;  3OV7 A;  5EWE A;  3SYZ A;  5F9L A;  1RXV A;  1ZQM A;  1TV9 A;  1JIH A;  1BGX T;  4QZ8 A;  4RNN A;  3BQ2 A;  4UB2 A;  4DL6 A;  3Q8K A;  2C2E A;  4K4H A;  3T5L A;  1NOM A;  1XU4 A;  5CP2 A;  3HPO A;  3G6X A;  3Q8S B;  2AQ4 A;  4FBU A;  3NTU A;  5BOL A;  2GWS A;  4M9L A;  4KLJ A;  4FH3 A;  3ZDB A;  4WC7 A;  5KFB A;  2O5A A;  4UBC A;  3BQ1 A;  4QZC A;  4M2Y A;  2ZHB A;  4RQ0 A;  5KFN A;  2ZJ8 A;  3V6K A;  4QZF A;  1MC8 A;  4GLX A;  2F1J A;  2ZTD A;  2OWO A;  4O5K A;  2HW3 A;  7ICQ A;  4DF8 A;  3MR5 A;  5KTQ A;  3RAQ A;  4JK1 A;  1XO1 A;  2F1H A;  5KG6 A;  4YR0 A;  4PHE A;  4QWD A;  2PXI A;  5IIL A;  3H40 A;  3OVA A;  3BDP A;  4J9S A;  4TUQ A;  4EBE A;  5J2G A;  4DL2 A;  4PGQ A;  4B9V A;  4KLH A;  1NK6 A;  1OU5 A;  2HHP A;  3OVB A;  2XO7 A;  1SL0 A;  8ICL A;  1S97 A;  4DL4 A;  3H38 A;  1U47 A;  3WFQ E;  5KFK A;  1NK5 A;  2KP7 A;  3PML A;  8ICC A;  2ZH9 A;  4RWQ A;  1ZQU A;  4C8O A;  4Z6C A;  4ED2 A;  1U9L A;  4YVZ A;  5J2F A;  1ZQB A;  1NJX A;  7ICG A;  4ELU A;  1S0V A;  1ZQN A;  3PNC A;  8ICY A;  4F93 B;  4X0A A;  4J9P A;  2NRZ A;  2HVH A;  5KG5 A;  5DQH A;  1ZQI A;  4KLE A;  2KFZ A;  2DRA A;  4DL7 A;  5HRE A;  5HMM A;  5J2C A;  4Q45 A;  4F5O A;  9ICN A;  1ZJN A;  3TFR A;  1XSL A;  1UA0 A;  9ICA A;  1QTM A;  9ICF A;  9ICG A;  2DPJ A;  4QZE A;  3Q8Q B;  4QZA A;  2AGQ A;  2BPG A;  4AT7 B;  4O5E A;  3T5K A;  3HW8 A;  3GIJ A;  3RR8 A;  1WCN A;  1NJY A;  1L3T A;  2HHT A;  3ORY A;  3RJF A;  3RRH A;  1DGS A;  4QZD A;  8ICF A;  4DQR A;  2BCQ A;  3H3A A;  9ICV A;  4O5C A;  3MDA A;  4YG2 A;  4KTQ A;  5DBA A;  3JPO A;  1H38 A;  4KLD A;  2AJQ A;  3C66 A;  4ECR A;  4UAZ A;  5CR0 A;  5EWG A;  3IHQ B;  1V9P A;  4XQ7 A;  4UB4 A;  2C2R A;  1R8C A;  3HJ1 A;  4WBY A;  1QSL A;  4J9R A;  5KFJ A;  8ICB A;  3AU2 A;  1ZET A;  4JUZ A;  3C1Y A;  5DQG A;  2ZUB A;  5KFZ A;  3M9O B;  4WBZ A;  2VA8 A;  4E0D A;  2JEG A;  3ZDA A;  4Z6E A;  5IIJ A;  4F5P A;  2HHU A;  4FS1 A;  4DS5 A;  3QEB Z;  3SZ2 A;  1X9M A;  1NJZ A;  5DQI A;  3C21 A;  2Y1I A;  2W8L A;  2FMQ A;  7ICJ A;  7ICV A;  4NKU A;  3Q8P B;  5DB8 A;  3G6V A;  2V9W A;  9ICI A;  1ZQA A;  9ICW A;  2FPK A;  4ED8 A;  4X4P A;  1KFS A;  1TK0 A;  4PH5 A;  4C8N A;  4RPX A;  2UVV A;  3LQC B;  1R89 A;  1NK0 A;  4DQI A;  4M5D A;  3IM1 A;  3GIK A;  4YMN A;  5J2D A;  2M2U A;  4F5Q A;  1RYS A;  9ICH A;  1UEV A;  5EOZ A;  4ECV A;  3QE9 Y;  1S10 A;  3G6Y A;  1KFT A;  4KIT B;  3WFP A;  4RWP A;  8ICV A;  1D9F A;  2HHW A;  2ISP A;  5HRI A;  1BPD A;  5KG4 A;  3EPG A;  9ICR A;  1Z00 A;  3TAN A;  4I29 A;  2AQ0 A;  4ELV A;  1YLQ A;  1Z00 B;  4QZB A;  4JWM A;  1ZQW A;  3PW5 A;  3RBD A;  2ASL A;  8ICZ A;  4QZI A;  4FO6 A;  4R8U A;  1NZP A;  1TFR A;  2B21 A;  5KG2 A;  4WC5 A;  3V7L A;  5KFI A;  5CWR A;  4YP3 A;  2RFF A;  4WC6 A;  4TUP A;  2IA6 A;  1BPE A;  1S76 D;  3OUY A;  1U45 A;  1JMS A;  1COO A;  2W9B A;  3N4M B;  1Y88 A;  4PHP A;  3EYZ A;  1PX5 A;  4YD1 A;  5KT4 A;  4UBB A;  2W9B B;  4YXM A;  4QWA A;  5L1L A;  4DSJ A;  4MFC A;  4E80 A;  1MIV A;  4YMO A;  2KZ3 A;  4IQU A;  5HRL A;  3AUO A;  4JV0 A;  2XC9 A;  2XY7 A;  4FBT A;  3M8S A;  7ICK A;  1L3S A;  3MFI A;  3AQK A;  5HNK A;  1UT8 A;  3BQ0 A;  4Q8F A;  4M9H A;  8ICA A;  4AT9 A;  1WCL A;  3RAX A;  5KFS A;  4WC4 A;  5IIN A;  3T5H A;  1S9F A;  4I2E A;  4PPX A;  4RQ5 A;  3PO5 A;  4M47 A;  5KFO A;  2KTQ A;  3UPS A;  5J0T A;  2BKE A;  2F1I A;  8ICE A;  2Q66 A;  4HYK A;  3E2E A;  3T5J A;  4JWN A;  1NK8 A;  5C5J A;  5KFP A;  4GC6 A;  4DF4 A;  3GIL A;  2DR8 A;  2V4Q A;  9ICT A;  3EW9 A;  4RQ4 A;  4F5R A;  3TFS A;  1KDH A;  1S77 D;  2FPL A;  2KZZ A;  5J2A A;  1Z3E B;  1UT5 A;  3GIM A;  1S0M A;  4RUC A;  5DLG A;  4I28 A;  1TAQ A;  5J29 A;  1DOQ A;  4DFM A;  4NLN A;  4RT2 A;  3OJS A;  3EPI A;  1L3V A;  3HWT A;  1K1S A;  4J9Q A;  2DR9 A;  3ZDE A;  1TFW A;  4P4P A;  2BE3 A;  4P4O A;  4DSF A;  2ZJA A;  3H8J A;  1ZQT A;  3OHB A;  2UVW A;  7ICP A;  4B9S A;  3H8S A;  8ICU A;  3V6H A;  3RH5 A;  3QZ8 A;  4RUA A;  3MGH A;  1SKW A;  2BDP A;  4JV2 A;  4QZ9 A;  3C18 A;  3WFO A;  1ZQZ A;  5KFX A;  4RPZ A;  4TUR A;  5L1J A;  3HJ4 A;  4DWI A;  3H37 A;  1ZQV A;  1VJ7 A;  2VA2 A;  5J0P A;  4ATB A;  3MDC A;  1RZT A;  4O3Q A;  1ZQX A;  2AGP A;  4YMM A;  1L5U A;  1NK7 A;  2PFQ A;  4UAW A;  4R64 A;  1SKR A;  2J6T A;  4O3O A;  4X5V A;  4NXZ A;  4ZH4 A;  3V72 A;  3RJK A;  3ZDC A;  3Q8R B;  4ECW A;  5HP4 A;  4E8F A;  4DS4 A;  1ZQD A;  2PBE A;  3LDA A;  9ICX A;  9ICP A;  8ICW A;  4R66 A;  4KLL A;  2ZHA A;  3LK9 A;  2IBK A;  5KFR A;  4F4Y A;  4RQ2 A;  4FS2 A;  2XY5 A;  4XA5 A;  4DSE A;  4ED0 A;  1TVA A;  2IMW P;  1SZP A;  1LB2 B;  1ZQY A;  4NLZ A;  9ICM A;  5HRD A;  3AQM A;  5III A;  2ASD A;  2ZH6 A;  4GXI A;  3OJU A;  1S0O A;  4LZG A;  2BHN A;  1XSN A;  4RQ8 A;  3AQN A;  1T4G A;  5J0S A;  5DB6 A;  4ECZ A;  3PVX A;  4DLE A;  4NY8 A;  1ZQQ A;  4UD5 A;  1VFG A;  9ICU A;  4IR9 A;  3MGI A;  3OHA A;  1SKS A;  5DGB A;  5L1K A;  3V7J A;  5J0U A;  8ICH A;  3PR5 B;  3KHH A;  4QWE A;  3GQC A;  3RB0 A;  5D4B A;  2PFP A;  4DFP A;  4QW8 A;  3Q8L A;  4DQQ A;  4DOA A;  3RH4 A;  4XQ8 A;  2IHM A;  2R8J A;  1X9S A;  5KFH A;  2ZH8 A;  5J2H A;  9ICE A;  4IRC A;  3TQ1 A;  8ICI A;  1KFD A;  2ZUC A;  4RT3 A;  3ETL A;  3EZ5 A;  2W9C A;  4K4I A;  3JPR A;  4NM1 A;  5KFC A;  3RJJ A;  2JEF A;  4BDP A;  5KG1 A;  4F5N A;  8ICQ A;  7ICN A;  4X4T A;  2DR5 A;  3M9N B;  2DFL A;  4F4X A;  2W8K A;  2BCR A;  2W9M A;  1SL2 A;  2J6S A;  3HX0 A;  4RQ7 A;  1KRP A;  5DEC A;  2RDJ A;  4EYI B;  4I2J A;  4IG8 A;  8ICT A;  4M0A A;  4LZD A;  2ZH5 A;  3ZD9 A;  4LT6 A;  3C2L A;  4M9G A;  5IIO A;  2FLP A;  3JPP A;  4RU9 A;  4YR2 A;  3HT3 A;  1KEJ A;  4QWB A;  1KSP A;  1QLN A;  4NM2 A;  8ICO A;  4X4N A;  2W9A A;  3GDX A;  4DL5 A;  5DBB A;  4EBD A;  9ICJ A;  4X4U A;  3B0Y A;  5J2J A;  1ZQO A;  4YN4 A;  4ELT A;  1A77 A;  1N48 A;  1BPY A;  2DVI A;  3RH6 A;  4BWM A;  2BQR A;  1TKD A;  4B9U A;  2ZH2 A;  5DB9 A;  4NKT A;  5HHI A;  5HRH A;  4FHP A;  2ASJ A;  3RR7 A;  4B9M A;  5KT6 A;  1XC9 A;  5DDM A;  4GXK A;  4Q8E A;  2I1Q A;  3C2M A;  5DED A;  2M9N A;  3JYY A;  2BR0 A;  2C2D A;  3OVS A;  4DEZ A;  4O9M A;  2UVR A;  3Q8M A;  2BCS A;  1N56 A;  7ICR A;  4R8U B;  2ALZ A;  4F92 B;  4TQS A;  4DL3 A;  2ATL A;  2C28 A;  4B9N A;  1T8E A;  4IRD A;  4WC0 A;  1KLN A;  4F91 B;  2FPM A;  2UVU A;  5J0O A;  4QWC A;  4P2H A;  5HRK A;  4C8M A;  5KG3 A;  4I2B A;  2XGQ A;  1R8A A;  3OUY B;  4DOB A;  3NGD A;  5J2I A;  4KLG A;  4KN7 A;  2DR7 A;  7ICM A;  4MF2 A;  4BXO A;  4F4K A;  4O0I A;  4KLT A;  8ICS A;  4I2A A;  4J9L A;  3PMN A;  3UQ2 A;  3PW2 A;  2FMS A;  4C8K A;  3ZD8 A;  1X2I A;  3H39 A;  4WC1 A;  2NRX A;  1XSP A;  4AT9 B;  3OSP A;  3ISB A;  4KLS A;  3FDS A;  3PO4 A;  3THV A;  5KFL A;  1WOT A;  5J0X A;  2PFO A;  4DSK A;  5CA7 A;  4R63 A;  4ECQ A;  1BNP A;  3LWM A;  1JQR A;  3MR2 A;  3GII A;  3GV5 B;  5KG0 A;  3C2K A;  3WFS C;  2Y1J A;  4X4V A;  5HHH A;  4RQ6 A;  1CUK A;  1XWL A;  3KHR A;  5HRG A;  1TFY A;  4KLI A;  2KZM A;  4M6W A;  5KFV A;  4J9M A;  2VAN A;  4QZH A;  5BOM A;  3QZ7 A;  4RQ3 A;  4J9O A;  1ZQH A;  3BQT A;  4DOC A;  4CCH A;  2KFN A;  2ID1 A;  4NLG A;  3MFH A;  4ECS A;  4PGY A;  4Q44 A;  2ISO A;  4MFF A;  2HVI A;  1R8B A;  3MR6 A;  1UET A;  3UXP A;  4X4O A;  4MF8 A;  2BQ3 A;  4KLM A;  4GC7 A;  4ED1 A;  5KG7 A;  8ICP A;  2JZB A;  3K75 D;  3KHG A;  4IR1 A;  1ZQL A;  5KFA A;  5KFD A;  3RJE A;  5J2B A;  2V4R A;  1ZQC A;  1ZQP A;  4IQV A;  9ICB A;  5HRF A;  3JPT A;  3GV7 B;  4F4Z A;  3PV8 A;  2ZH7 A;  3K4G A;  8ICG A;  1PZN A;  7ICH A;  4FH5 A;  4I2D A;  4QW9 A;  3RB3 A;  2HHV A;  2ZTE A;  2R8H A;  3TAP A;  4JV1 A;  4MFA A;  3PX0 A;  1RPL A;  1DK3 A;  4IQW A;  5HRB A;  3JPN A;  1C7Y A;  8ICM A;  4WCW A;  4ATB B;  4EYH B;  5KT3 A;  2NRV A;  7ICE A;  2ZUD A;  4YD2 A;  3KTQ A;  2ZH3 A;  5IIM A;  3RRG A;  4J9N A;  1XS9 D;  3GV8 B;  1L3U A;  2HHS A;  9ICQ A;  2M2T A;  4FHV A;  1BPB A;  4WC2 A;  1JN3 A;  2JEJ A;  5D49 A;  4YR3 A;  4F4W A;  4GXJ A;  4Q43 A;  1ZQR A;  4LVS A;  7ICT A;  4FHX A;  2NRW A;  4YCX A;  5JUM A;  2ZJ5 A;  7ICO A;  3HIY A;  2DRB A;  1RXW A;  9ICO A;  1TK5 A;  2R8K A;  3V6J A;  1D8Y A;  3PR4 A;  5DG7 A;  1Q79 A;  4E7X A;  1D8L A;  3B0X A;  1TK8 A;  4EBK A;  2XGP A;  3RJI A;  2PI5 A;  4EZ9 A;  7ICI A;  1JX4 A;  2BGW A;  5EWF A;  5J0Q A;  4MEX A;  4RWN A;  3MBY A;  5DDY A;  4YQW A;  4UB3 A;  5DBC A;  1A76 A;  4RPY A;  8ICJ A;  4EEY A;  7ICU A;  4UAY A;  4UB1 A;  2XCP A;  3KHL A;  3L9D A;  2H5X A;  4KLQ A;  4UB5 A;  2BPC A;  4TUS A;  5BPC A;  1NK4 A;  1U48 A;  1NKE A;  4I2H A;  4M9N A;  7ICS A;  1MSW D;  3H4B A;  2P6U A;  1U49 A;  1KNY A;  4QZG A;  2AU0 A;  3H4D A;  1ZQK A;  2R8G A;  4KLU A;  2BQU A;  1DK2 A;  3ISD A;  7ICF A;  1IM4 A;  1HJP A;  3TAR A;  1TAU A;  4Z6D A;  4DLG A;  3HP6 A;  5F2V O;  5L9X A;  5DG9 A;  8ICX A;  3ZDD A;  1EXN A;  2M2W A;  1BPZ A;  2W9C B;  4ED6 A;  1HUZ A;  5KFU A;  2R8I A;  1T7P A;  2Q0Z X;  1NK9 A;  3RJH A;  3GFK B;  3PY8 A;  5IIK A;  4RZR A;  3QEA Z;  4I2I A;  4KLF A;  2RDI A;  3EWA A;  1Q78 A;  3N97 B;  3BJY A;  4AT7 A;  4DFK A;  3MR3 A;  5CJ7 A;  3PX4 A;  2ZH1 A;  3UXN A;  4O3P A;  5DKW A;  1BNO A;  2BPF A;  4NLK A;  3ISC A;  7ICL A;  1JXL A;  4J9K A;  3RB6 A;  4ECY A;  5J0W A;  3PX6 A;  3LWL A;  4ED3 A;  4RQ1 A;  3OGU A;  5KFY A;  3M9M B;  2DPI A;  2XY6 A;  4X4Q A;  3V7K A;  3SV3 A;  4EP7 A;  3M8R A;  2ZTC A;  4UD4 A;  2FLN A;  3WFR E;  2O1P A;  3JPS A;  4C8L A;  4IRK A;  1B22 A;  4PHA A;  4O3R A;  2P6R A;  1ZQS A;  2AGO A;  5KFM A;  3PW4 A;  4F2S A;  2BCV A;  4FHW A;  5J2K A;  2MAX A;  3SI8 A;  5HR9 A;  1MIW A;  4WC3 A;  1MIY A;  9ICK A;  4XRH A;  5DLF A;  5J0R A;  1UA1 A;  1MQ3 A;  4F3O A;  4M9J A;  4AT8 A;  5HC9 A;  4YXJ A;  5KFE A;  2LYH A;  4R65 A;  1BPX A;  4AT8 B;  4PHD A;  1X9W A;  2JEI A;  4S3N A;  4ED7 A;  2ZH4 A;  5KFG A;  4BWJ A;  4F2R A;  3TAQ A;  4ECX A;  1NO5 A;  1S0N A;  5KFT A;  5KT5 A;  1ARO P;  4X0B A;  5KFW A;  3RBE A;  3MAB A;  3H8W A;  2I9G A;  2BCU A;  5KT7 A;  2PFN A;  4PGX A;  2J6U A;  2HHX A;  9ICS A;  1FA0 A;  1ZQJ A;  4EBC A;  5DGA A;  3AQL A;  4ECT A;  4RNO A;  5CHG A;  5F9N A;  4X4S A;  4Z6F A;  4ECU A;  5J2E A;  3C5F A;  1SL1 A;  1IXR A;  3OSN A;  4I2F A;  1NJW A;  4G3I A;  4BXO B;  4IQT A;  5CB1 A;  1ZJM A;  4K4G A;  4EBJ A;  4FHY A;  1B43 A;  2IHN A;  1D9D A;  3PW0 A;  4KLO A;  4TQR A;  4DFJ A;  2M2V A;  2PI4 A;  1ZQG A;  4I2C A;  4DO9 A;  4F8R A;  8ICR A;  8ICK A;  1K1Q A;  5J0Y A;  2XCA A;  1V4A A;  1JXE A;  1RYR A;  4BGD A;  5DB7 A;  4EZ6 A;  2C22 A;  4DSI A;  4KMU A;  1CEZ A;  4DQP A;  3T3F A;  2VA3 A;  3NYB A;  1U4B A;  1QSY A;  5HML A;  4KN4 A;  4I2G A;  3FYH A;  4M04 A;  2MUT A;  1NKB A;  2FMP A;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...