4O9MA

Human dna polymerase beta complexed with adenylated tetrahydrofuran (abasic site) containing dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
publication title Role of polymerase beta in complementing aprataxin deficiency during abasic-site base excision repair.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o9mA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o9mA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o9mA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o9mA03
4F2SA 2PXIA 2AGOA 3JPOA 2HVIA 4ELUA 2FMPA 1QLNA 4FHPA 1ZQQA 4E7XA 3RH6A 4NY8A 5HNKA 2UVVA 4WBYA 5DQHA 5J2IA 3M8RA 2XY5A 4RUAA 1RYSA 4I2AA 4M9NA 2KZZA 8ICUA 2C2DA 4FH3A 4X4SA 4Q43A 3HT3A 4KLSA 1MC8A 3RJFA 2H5XA 1K1QA 4BWJA 4I2JA 5KT7A 4YCXA 4TUPA 2IMWP 3PW5A 4B9VA 4DSJA 4AT9A 2DR5A 2UVRA 5DKWA 2VA8A 3OVBA 3K75D 5KFYA 3EYZA 3RB3A 1ZQCA 4J9NA 1NK6A 3PW7A 7ICIA 1TAUA 5KG4A 4R65A 3PX6A 1ZQEA 4DS5A 4QZ9A 4ECWA 8ICWA 2J6UA 1UETA 4LT6A 2I9GA 4DL7A 4X4RA 4YVZA 4UB2A 3G6XA 1C7YA 4RQ5A 4NLZA 4M6WB 4J9PA 3H4DA 5IIKA 3LK9A 1NK7A 7ICGA 2AJQA 8ICXA 4JV0A 4UD5A 1KFDA 4P4MA 3MGIA 1XSPA 2ZH9A 3HW8A 2PFNA 1ZQJA 4XRHA 4BWMA 9ICKA 2ATLA 5DECA 9ICUA 5J2HA 4P4PA 4IG8A 3JPQA 1S9FA 4K4HA 9ICHA 5J0QA 4RNOA 3SV3A 2R8KA 4QZCA 4J9LA 8ICLA 1JAJA 5DG8A 3AQMA 3LDAA 3BJYA 3RAXA 4QWAA 2F1HA 4F50A 3MFHA 4DFMA 4M9JA 4ED3A 2ISOA 3GV8B 2BPFA 3C2KA 1L3VA 1KEJA 1XWLA 2ZTEA 4YFKA 5KT5A 2W9CA 5L1LA 4DSFA 2PFQA 4I2FA 5J0SA 1ZJNA 8ICHA 4QW8A 3RH4A 4P2HA 1A76A 4J9QA 3TFSA 1D9FA 5KFUA 1JX4A 4Q8EA 3PY8A 4RQ3A 3HJ4A 3G6VA 4RQ7A 5KTQA 2XO7A 8ICMA 4X0BA 9ICRA 2MAXA 5KT3A 4M2YA 9ICFA 2UVWA 4MFFA 4I28A 3HJ1A 2FPLA 4FS1A 7ICEA 3RBDA 5KFKA 5DBAA 4FHVA 5DB8A 8ICVA 1MIYA 2V4RA 4ECSA 4I2HA 1VJ7A 1BGXT 4I2BA 2FLLA 4QWCA 2KFZA 5DB9A 3C5GA 4DFJA 4KN7A 4RQ0A 5L1IA 4TQSA 3RAQA 1BPXA 5J2KA 3TQ1A 5HRGA 2AGQA 1X9SA 8ICFA 4ED0A 1U47A 2FMQA 5KFBA 3FDSA 4JWNA 3PX0A 3Q8RB 4ED8A 9ICCA 4ED6A 3H39A 7ICVA 4I2CA 4F8RA 4AT7A 4YQWA 5KFWA 1MIVA 2ZH8A 4I2IA 4X0AA 4IRDA 5KFDA 7ICJA 4J9OA 3GIJA 3PW2A 4FS2A 3C66A 4GC6A 3WFRE 5HHIA 4XUSA 5CR0A 3OSNA 1NKCA 9ICJA 4PH5A 4I2GA 4DOAA 4X4NA 2P6UA 5HRLA 4NKUA 4YG2A 5KG6A 1FA0A 2NRTA 4QZBA 5KFEA 3OVAA 1TFYA 4X4UA 5KFRA 9ICSA 1ZQLA 4RU9A 3HPOA 2HW3A 1MSWD 3JPSA 4YXMA 5D46A 2IHNA 1NJWA 4UBBA 1DK2A 1JN3A 2F1JA 4QW9A 4EBEA 3RR8A 4YD2A 5DGBA 4DL3A 2KFNA 4UB4A 2A1JA 2C22A 4IQWA 3QZ7A 4IQUA 7ICOA 2ZUDA 4KLUA 5J0XA 4MFAA 2BQRA 4F4KA 8ICIA 4F93B 1NKEA 1ZQKA 4EBDA 1DK3A 4WC4A 4UAZA 5KG1A 4F4YA 4IQTA 4RPZA 8ICGA 4RUCA 4QWEA 3RB4A 1ZQFA 3RJJA 1NJYA 1BNOA 4RWPA 1JIHA 5DDYA 3ISCA 2W9BA 3RJIA 1JXLA 4JV1A 4E8FA 1NZPA 5BOMA 4WC2A 2FMSA 4I27A 2JEFA 1S10A 5J0PA 7ICUA 9ICXA 1JMSA 4ECTA 5IIIA 1IXRA 3K4GA 3MFIA 2AGPA 3PW0A 1SL2A 4UB1A 2FPMA 4F5NA 2FLNA 2IBKA 1UA0A 4B9LA 4PPXA 5DB6A 7ICPA 3OJSA 2DR8A 3EW9A 1TK0A 2M2UA 3B0YA 2HHTA 1WCLA 4RT3A 3PR5B 3Q8PB 4MEXA 4XQ8A 4O5KA 3RRGA 3SI8A 4F5RA 1S0OA 5CHGA 4F5OA 4TURA 1LV5A 4KLOA 3UXPA 4QZIA 3RJKA 2M2WA 3OV7A 8ICOA 1SKWA 3G6YA 3Q8SB 1JQRA 2BCUA 1D9DA 4BXOB 4KLFA 1ZQDA 1TAQA 4IR9A 5J2AA 4KMUA 4DL6A 3MR3A 1S77D 2HHSA 5HRKA 8ICSA 5F9LA 5C5JA 3LWLA 5KFFA 1N48A 5EWGA 2Y1IA 2JEIA 5HC9A 2J6SA 5HP4A 1L3SA 2ZUBA 3EWAA 4IQVA 4GLXA 2M2VA 2BE3A 1HUZA 4DO9A 3PO5A 1ZQGA 2NRKA 1ZETA 4JV2A 1HUOA 5TZVA 4M5DA 3NTUA 3H37A 4AT8B 4E0DA 1OU5A 4R64A 3IHQB 5KFPA 2AQ0A 4EBJA 3H8WA 3THVA 4YMMA 3Q8LA 1MIWA 5KFCA 4RPXA 1XO1A 5KT4A 3BDPA 2HHUA 1BPYA 2BHNA 1Y88A 9ICWA 2F1IA 2FPKA 3KHGA 5KFNA 4O0IA 3OHAA 4ED7A 7ICSA 4G3IA 2JZBA 3MR2A 5IILA 4B9MA 5J0RA 1Q78A 4DQPA 4O3RA 2BQUA 4I29A 3MDCA 1KTQA 3TAPA 2R8IA 2J6TA 2P66A 9ICBA 4YN4A 4ECVA 1B22A 1PZNA 3M9NB 4Z6CA 4DOCA 3M9OB 4WC1A 5DQIA 2ZJAA 1X2IA 3V6JA 4UD4A 4I2EA 4DFKA 4JUZA 5HR9A 1JXEA 4QZEA 2ZJ5A 4Z6FA 5DQGA 4YR0A 4DFPA 3Q8QB 1S97A 1L3UA 1ZQBA 5HMMA 2FLPA 2MUTA 4YD1A 3ZDAA 2C2EA 5DLGA 2ZJ8A 5F2VO 4IRCA 2PFPA 2WTFA 3RJHA 4KLJA 4FHYA 3OHBA 5CJ7A 3RB6A 3OGUA 5L1JA 4NXZA 4C8LA 2ZH2A 5D4BA 5KFJA 3TFRA 4TUQA 8ICAA 1ZQIA 2XY7A 5DBCA 3V7KA 1RYRA 3C21A 4UAYA 9ICVA 1VFGA 1NK4A 3TI0A 2W8LA 3QE9Y 3OSPA 2P6RA 5J2CA 2V9WA 8ICPA 5DG7A 3QEAZ 4KTQA 4RQ2A 1QSSA 4K4IA 2DR9A 2PI5A 2BQ3A 2JEGA 3HWTA 4FBTA 4C8NA 4RPYA 4J9MA 2Q66A 3PMNA 1SZPA 5HRIA 3H40A 3AUOA 3PVXA 3TANA 3QEBZ 4R8UB 4UAWA 5KFVA 1A77A 3T3FA 5KG2A 2XCPA 3N4MB 3C5FA 4IRKA 1CEZA 8ICYA 3OUYB 7ICQA 4F4ZA 4K4GA 9ICTA 4RT2A 2BR0A 4KITB 3WFSC 3H8SA 3GIKA 5DDMA 7ICNA 4WC3A 2DRBA 1ZQYA 4DF4A 4TUSA 2KP7A 4RQ4A 2HHVA 4EEYA 5HHHA 4GXKA 1ZQUA 8ICQA 2HHXA 3UPQA 2DPIA 3SV4A 3H3AA 4KN4A 9ICGA 3H8JA 2ZTDA 4F91B 5J2EA 5HMLA 3B0XA 5KFZA 4UBCA 4DF8A 1D8LA 3UXNA 4JWMA 4O5CA 2VANA 9ICEA 3WFQE 2BKEA 3LQCB 1ZJMA 4DSIA 4O5EA 1KRPA 1U4BA 3GDXA 4B9TA 3T5KA 4ECUA 8ICTA 1TFRA 4GC7A 3BQ2A 4J9RA 2OWOA 4DSKA 1UEUA 5L9XA 3GV5B 2BGWA 4AT7B 1KSPA 9ICMA 4F5QA 4X4OA 1R89A 3C1ZA 5L1KA 3RJGA 1DOQA 4LVSA 4KLGA 3GIIA 3KHLA 1T8EA 8ICRA 4RWQA 3ZDEA 3V72A 1U45A 1NK9A 2ISPA 4Z6DA 4ECRA 3BQ1A 4FH5A 7ICLA 3ZD8A 1RZTA 2BPGA 4MF2A 3HP6A 3SZ2A 4O3QA 5JUMA 4MF8A 3JPTA 4ED2A 4LZGA 9ICPA 1CUKA 4QZDA 5DLFA 7ICFA 1K1SA 4C8OA 1Z00B 3C18A 3HIYA 4FO6A 1N56A 3ETLA 4RQ8A 4GXIA 4M9HA 4R63A 4C8KA 4NLGA 1KDHA 1S76D 4RQ1A 3T5LA 1Q79A 4QZ8A 2I1QA 1L3TA 2ID1A 4KLEA 4LZDA 5J0YA 3V7JA 1U49A 9ICQA 2ZTCA 3M9MB 4ATBB 4X4PA 2DVIA 5J2GA 5CA7A 3GV7B 2ZH5A 7ICTA 2HVHA 1T4GA 2XGQA 5KFTA 9ICOA 4WCWA 3PX4A 2M2TA 2KZMA 4DS4A 2KZ3A 7ICHA 5HRDA 5HRBA 5J2FA 2DRAA 3E2EA 1V4AA 4NM2A 5KFMA 3PR4A 2VA2A 3MBYA 4DL2A 4DSLA 3MGHA 1ZQVA 4NLNA 1QTMA 8ICJA 4DL5A 4X4QA 1UEVA 1AROP 4DQQA 2ASJA 2BCVA 5DB7A 2PBEA 2NRWA 5KFGA 4B9NA 4WC6A 4WC7A 1R8AA 4YMOA 2XGPA 4DQRA 3T5JA 4X5VA 4M0AA 4QZGA 5IIJA 1KLNA 3N97B 3ZDBA 3C1YA 4J9SA 4DEZA 3M8SA 1UT8A 4J9KA 4WC5A 2GWSA 3C2LA 4M6WA 5DG9A 3RBEA 1F5AA 3TARA 2KN7A 1RXWA 1H38A 4KLLA 5CB1A 2NRXA 3EPIA 2RFFA 2HHPA 2XC9A 1UA1A 1NK5A 2R8HA 2W9AA 2B21A 4FHWA 2BCQA 4WC0A 3MR6A 4YR3A 3RRHA 5HRHA 1EXNA 3RTVA 5IIOA 5KFXA 4PGYA 4ECZA 2XY6A 3PV8A 4F4XA 3PO4A 3Q8MA 3KHHA 8ICEA 5KG5A 5HRFA 2Q0ZX 4PHAA 1ZQRA 7ICMA 2M9NA 4JK1A 4B9UA 4ECXA 3SYZA 2RDIA 4PGQA 4R66A 3ORYA 3H38A 8ICKA 4NM1A 9ICLA 2V4QA 5J2BA 4AT9B 4YXJA 3UPSA 5KFOA 3C2MA 2BPCA 2VA3A 1ZQPA 3PMLA 1XSLA 3RH5A 4YMNA 2DPJA 4MEYA 1NK0A 1ZQMA 2ALZA 4KLHA 1BPBA 4KLIA 3LWMA 4EP7A 3H7IA 1Z3EB 5J0WA 3MDAA 4QZAA 1RXVA 1XC9A 2UVUA 9ICIA 4EBCA 7ICKA 3ISBA 2BDPA 1S0MA 1KFTA 4S3NA 4FBUA 1ZQTA 8ICCA 3UQ0A 1MQ3A 8ICZA 1NJZA 3JZ0A 4UB5A 1ZQWA 5HREA 2JZBB 5KT6A 7ICRA 4R8UA 1TKDA 5KFQA 5F9NA 3PNCA 4KLQA 2BCSA 3KTQA 2AQ4A 3OUYA 3KHRA 1S0VA 1ZQNA 4ECYA 4F2RA 4ELTA 1ZQZA 4ZH4A 5D49A 5J0UA 1UT5A 4ECQA 3QZ8A 1NK8A 2PI4A 4ED1A 1ZQAA 4RWOA 1D8YA 2JEJA 4CCHA 4B9SA 3OVSA 4RWNA 1WCNA 2W9CB 3GQCA 3EPGA 5J0OA 4O3PA 2MUTB 2HHWA 3WFOA 1BVSA 1TK8A 3GIMA 5KFLA 3RJEA 2HHQA 4RNMA 5KFHA 4TQRA 4EBKA 9ICNA 4F4WA 5EWEA 3OJUA 4P4OA 3AU2A 5KFIA 1PX5A 3MABA 4KLTA 2ZH3A 1SKSA 4DQIA 3ISDA 2W9MA 4O9MA 2O1PA 5J0TA 3C23A 1X9MA 3BQTA 4KLMA 2ZH1A 4QZHA 5KT2A 4DLEA 9ICAA 4PGXA 5BPCA 3EZ5A 1TV9A 3RR7A 4BDPA 2NRZA 4YR2A 1TVAA 1TK5A 3ZDDA 8ICNA 2IHMA 1COOA 1RPLA 4EYIB 1U9LA 5IINA 1NJXA 4KLDA 3HX0A 3UQ2A 3RB0A 1T7PA 1L5UA 1B43A 1ZYQA 3ZDCA 2ZH6A 1TFWA 1X9WA 4NKTA 4X4VA 1KFSA 4RNNA 4EZ9A 4F92B 5J29A 4PHDA 4EYHB 1LB2B 4M9LA 2KTQA 4PHPA 3JPRA 2ZUCA 4HYKA 2C28A 1SL0A 3V7LA 1Z00A 5EWFA 4E80A 2ZH4A 2LYHA 4FHXA 4Q44A 4XA5A 1BPDA 4QZFA 3IM1A 3TAQA 2W8KA 1WOTA 2BCRA 4O3NA 1YLQA 3NGDA 3L9DA 4QWDA 5KG0A 4DOBA 1S0NA 5KG7A 3Q8KA 1BPZA 3H4BA 2O5AA 4ATBA 3JPPA 3GILA 4DWIA 4XQ7A 1ZQOA 3JYYA 4M9GA 3GFKB 4PHEA 5IIMA 1XS9D 5EOZA 3V6HA 5J2DA 4DL4A 2ASDA 1QSLA 5DGAA 2A1JB 8ICBA 2ZHAA 1R8BA 4X4TA 1IM4A 3AQNA 4BXOA 2ZH7A 5KFAA 4EZ6A 3T5HA 3JPNA 4DLGA 4ELVA 1HJPA 4DQSA 4Q8FA 2ZHBA 4YP3A 1SL1A 1NKBA 4RQ6A 3AQKA 4UQGA 4WBZA 4F3OA 4O3OA 1U48A 4O3SA 4BGDA 4NLKA 5DEDA 4DSEA 5DBBA 4RZRA 3AU6A 2W9BB 2R8GA 4C8MA 1KNYA 4QWBA 2XCAA 2AU0A 2NRVA 4MFCA 4Q45A 3NYBA 1R8CA 3WFPA 5CWRA 2DR7A 4M47A 3FYHA 3PW4A 4Z6EA 4UB3A 2Y1JA 1MQ2A 3BQ0A 1XSNA 4I2DA 5BOLA 4AT8A 3UXOA 2ASLA 1ZQHA 1V9PA 1ZQSA 1QSYA 1XU4A 2IA6A 1DGSA 5KG3A 1ZQXA 2PFOA 1T3NA 4F5PA 5J2JA 3AQLA 5KFSA 3ZD9A 4GXJA 2C2RA 4IR1A 1SKRA 1BPEA 1BNPA 4M04A 1NOMA 1NO5A 2RDJA 3V6KA 3MR5A 2R8JA 2DFLA 5CP2A
chains in the Genus database with same CATH superfamily
3JPOA 2DKZA 3ALRA 4US8A 5AK6A 3GZFA 1KKXA 4CE6A 2K8BB 1MC8A 1K1QA 4BWJA 4I2JA 2IMWP 4YCXA 3UMBA 3OVBA 3K75D 3RB3A 4J9NA 1NK6A 4O3MA 7ICIA 4PJ0U 5KL8B 1K5OA 1ZQEA 4DL7A 4UB2A 4NLZA 1C7YA 3OTQA 1NK7A 4UD5A 4DFDA 3HW8A 2PFNA 4XRHA 1X66A 3KZXA 3JPQA 1S9FA 5KNIA 4RNOA 3AQMA 4B6JA 4M9JA 2BPFA 4M2YA 4J9QA 1MN8A 2K4PA 5KTQA 2Y0SC 5A0LA 5AI9A 5KAIU 1A0PA 4FS1A 2EH9A 3CP8A 4I2HA 2K8AA 2FLLA 3C5GA 3RAQA 4P0QA 5L1IA 5HRGA 5ALGA 2AGQA 1SV4A 2FMQA 3FDSA 4JWNA 1JALA 2GAFD 2W7OA 3SR6A 2K4IA 4AT7A 4JB3A 4YQWA 2ZH8A 4X0AA 7ICJA 4J9OA 4FS2A 3C66A 2H3QA 3OSNA 5E79U 5HRLA 4NKUA 2EWRA 2OEHA 3UMCA 3H0LB 1ECWA 5KFRA 9ICSA 4RU9A 2I5HA 3WK7A 5D46A 2IHNA 2XICA 1L7PA 4EBEA 3RR8A 4YD2A 2A19A 2G5HB 5DGBA 2WF5A 5CRXA 4UB4A 2LM1A 2ZUDA 2F2AB 3NVWA 4UAZA 3F5EA 5ALPA 4IQTA 2KD1A 4LJXA 5DDYA 1HIWA 2DF4B 3M6KA 4Y2UA 9ICXA 1JMSA 4ECTA 4X4SA 1IXRA 4DSJA 3MGVA 1SL2A 1UA0A 4PPXA 5DB6A 3NRWA 2DR8A 1ZQ1C 3EW9A 2MRLA 1SV0A 4RT3A 4CGZA 1Q3VA 2FCLA 4TURA 5AI8A 3UXPA 8ICOA 1SKWA 1DXSA 3G6YA 4EEDA 8ICIA 2HHSA 2ZIXA 2WHEA 5HC9A 2Y9TA 3PSFA 4I0UA 4IQVA 4GLXA 1N63A 1YZ6A 3IN5A 4M5DA 3NTUA 1PVRA 4E0DA 3IHQB 5KFPA 1C20A 4EBJA 3BS5B 4NL9A 3CRXA 4RPXA 3A0BU 3QNMA 5KT4A 1N5XA 1ZOLA 1VDVA 5KFNA 4G3IA 3IRUA 5D63A 2LM4A 4I29A 1PK1A 3TAPA 2P66A 3DV9A 4DOCA 5DQIA 2ZJAA 2OM6A 4NXVA 4QZEA 1L3UA 5HMMA 5F2VO 2ZJ8A 2KOBA 2M0NA 2HBJA 4FHYA 2HBMA 2HOQA 4NXZA 5AM5A 4EV6A 2GOLA 4UAYA 1NK4A 3TI0A 3JCFA 4O69A 2W8LA 2P6RA 5J2CA 3T79A 4U6PA 4RQ2A 1QSSA 2PI5A 2QB1A 2BQ3A 2JEGA 2HMXA 4FBTA 4RPYA 1RYUA 3PMNA 1SZPA 5HRIA 3PVXA 3AUOA 4R8UB 4UAWA 3T3FA 5KG2A 2XCPA 1CEZA 8ICYA 4NJ8A 1NI3A 4FZNA 4KITB 5DDMA 5AI5A 4WC3A 2DRBA 2HHVA 5EE3A 4GXKA 8ICQA 2KKPA 2EQYA 2ZTDA 3WFQE 4CF3A 4P0QB 2JHDA 2F77X 4EENA 4WQKA 2RP5A 1RQNA 8ICTA 3I1YA 4GC7A 3BQ2A 1UEUA 4AT7B 9ICMA 3C1ZA 8ICRA 3RJGA 4KLGA 3AM9A 3GIIA 3F53A 4FH5A 3IP4B 2WB1F 4JMUA 5G5GA 2BPGA 4MF2A 5HR7A 1SGGA 2K8CB 4FO6A 3ETLA 4M9HA 4OAIZ 4C8KA 1KDHA 2E8PA 2ID1A 1L3TA 3V7JA 5J0YA 3M9MB 2DVIA 2ZH5A 4CDGA 9ICOA 2M2TA 4AYBF 2KZ3A 2EAPA 5HRBA 3E2EA 1V4AA 3K7DA 3PR4A 4DL2A 1ZQVA 4X4QA 1AROP 5DB7A 4EGWA 2NRWA 5KFGA 1R8AA 2LBOA 4YMOA 5AI0A 2JGAA 3C1YA 2QB0A 3M8SA 4UARA 4J9KA 2GWSA 4EELA 2NRXA 3C29A 3MR6A 3AEVA 3UMGA 3RTVA 4A8EA 5AIBA 5AKLA 5KFXA 4PGYA 2XY6A 3VC8A 4F4XA 2ZIXB 1L7MA 2W43A 5ALRA 4B9UA 4OJ5A 4ECXA 3SYZA 8ICKA 1VLBA 4UASA 2V4QA 5J2BA 5ALHA 2ODGA 5ALIA 5ALUA 2KMDA 2NV3A 2DPJA 2ALZA 2CXYA 4BUGA 2HCFA 3LWMA 3MDAA 2KJ5A 7ICKA 4U7CA 8ICCA 1NJZA 5T14A 1ZQWA 1PK1B 3PNCA 4KLQA 3WK9A 2BCSA 3KTQA 2AQ4A 1ZQNA 2HSZA 5J0UA 4ECQA 1ZQAA 2JEJA 3EPGA 5AK5A 2HHWA 3WFOA 1BVSA 2FDRA 2HHQA 2KHVA 2WF7A 4CF5A 2OHFA 2ZH3A 3MABA 4KLTA 2WB1C 4DQIA 3S6JA 2IOFK 3FM9A 1FIQA 5ALLA 5KT2A 3EZ5A 5BPCA 3H38A 3WU2U 2NRZA 4YR2A 3ZDDA 1COOA 3HX0A 5ALJA 1L5UA 4ZOHC 2E8NA 4M9LA 4PHPA 2C28A 3QU9A 1SL0A 3V7LA 5ALYA 3ZI4A 4FHXA 2IOFA 5ALOA 4AYBC 4Q44A 1TE2A 3ONNA 3IDWA 4NXWA 4PL1A 2BCRA 1YLQA 3MCRA 1BPZA 1V85A 1DRGA 2LI6A 1F0MA 4DL4A 3KKAA 2A1JB 2ZHAA 2JXJA 3AQNA 5KFAA 4EZ6A 5J8YC 3T5HA 4Q8FA 1NKBA 1V97A 4RQ6A 4UQGA 4WBZA 1UPHA 4K98A 2R8GA 2W9BB 1KNYA 5AI6A 2NRVA 1P7DA 2EZYA 2Y9UA 4UB3A 4WJ3B 5BOLA 4AT8A 2EAMA 1XU4A 3WK5A 5KFSA 1SKRA 4NLCA 1NOMA 2HN1A 2RDJA 1Q8KA 2YY6A 5CP2A 2AGOA 2YTUA 3L3FX 2F8LA 3O0FA 2BZFA 2FMPA 4ELUA 4WBYA 5HNKA 2UVVA 5J2IA 3M8RA 4RUAA 4M9NA 4FH3A 2LHTA 3HT3A 4KLSA 5KT7A 4TUPA 4AT9A 2DR5A 2UVRA 4RQMA 2VA8A 3AQEA 5KFYA 3EYZA 5KG4A 4ECWA 5AK3A 1X9XA 3LVVA 2QB0B 3G6XA 4J9PA 2AJQA 4WOYA 2WF6A 4P4PA 9ICHA 4K4HA 3SV3A 4J9LA 3ER9B 5DG8A 3LDAA 4QWAA 4C4TA 4ED3A 2ISOA 5KT5A 4O5CA 2H3FA 1HEKA 1D9FA 3LVWA 9ICRA 2MAXA 9ICFA 2UVWA 7ICEA 5KFKA 4FHVA 8ICVA 1N2XA 2V4RA 4ECSA 2F44A 4I2BA 2KFZA 1L8LA 4QWCA 1O03A 5DB9A 4KX5A 5J2KA 4G9BA 5TISU 1X9SA 2RRDA 3TACB 1IIPA 3PX0A 4ED8A 9ICCA 4I2CA 2Y0SF 3GIJA 2GLEA 3PW2A 2NO5A 3WFRE 3NRZA 5AM4A 3N7SC 2VIXA 2YX8A 4YG2A 2NRTA 4QZBA 5GTIU 1SB3C 5KFEA 4LEZA 1TFYA 2JV3A 2HW3A 3TADA 5AHXA 4YXMA 2KICA 4UBBA 1NJWA 1JN3A 4RQNA 1L8OA 3NUQA 4Y2VA 4C80A 2BQRA 4F4KA 1NKEA 4NV0A 1ZQKA 3CW2C 4F4YA 4RPZA 3RB4A 1ZQFA 3ISCA 4OAGA 1NZPA 1WUDA 2YMPA 2FMSA 7ICUA 2OYYA 2JEFA 2HDOA 5IIIA 3MFIA 4F5NA 2FPMA 1MA7A 3OJSA 4FE3A 4MEXA 3TKAA 4F5RA 2R18A 1VJ5A 3RJKA 1RM6C 1JQRA 4NY8A 8ICZA 4DL6A 5C5JA 5EWGA 2B4VA 2J6SA 2BE3A 3CNHA 4DO9A 2NRKA 4K97A 3N7PD 4JV2A 4AT8B 1N60A 4R64A 4QIWF 3THVA 1MIWA 5KL1B 1XO1A 4EX7A 4FFDA 3BDPA 2HHUA 2BHNA 1Y88A 2F1IA 7ICSA 3OHAA 2JH1A 4C4SA 1Q78A 3MDCA 1KTQA 3N28A 2R8IA 3FAHA 9ICBA 3M9NB 3M9OB 5G5HA 4I2EA 4DFKA 5HR9A 1JXEA 5DQGA 2ZJ5A 4Z6FA 3Q8QB 4OAHA 3E58A 2FLPA 2H3ZA 2MUTA 1KBUA 4S3NA 5DLGA 2DGZA 3QUTA 5CJ7A 3RB6A 3OGUA 2ZH2A 1ZRMA 3QYPA 1ZQIA 3OSPA 5C0YA 3QEAZ 4KTQA 5D61A 2Q66A 4FO1A 5AM0A 3H40A 3TANA 3QEBZ 2KK0A 5KFVA 5KAFU 3OUYB 2BR0A 3WFSC 3H8SA 4EEBA 7ICNA 4TUSA 2W3SA 3H3AA 4KN4A 3H8JA 5HMLA 4UBCA 1D8LA 4UB8U 2VANA 3LQCB 1ZJMA 2WAQF 1DGJA 2OWOA 5L9XA 3GV5B 1KSPA 1OXJA 1T8EA 3KHLA 4RWQA 2RLTA 4ECRA 2CRXA 3ZD8A 1RZTA 2EAOA 1Z4NA 3HP6A 4MF8A 2I6XA 1B0XA 4ED2A 4LZGA 4C8OA 1Z00B 3HIYA 4Y2SA 4RQ8A 3F2CA 1WYGA 5AKJA 1Q79A 5ALFA 2I1QA 3R9KA 4EX6A 4KLEA 4ATBB 4C7YA 5J2GA 2HVHA 1T4GA 2YMMA 2KZMA 4DS4A 4QIWC 2CPRA 5HRDA 2DRAA 4NM2A 2VA2A 4OJ6A 5H2FU 4DL5A 3J81j 4NL9C 2XGPA 5IIJA 1KLNA 3ZDBA 4WC5A 1F5AA 5DG9A 2EANA 3TARA 1RXWA 1H38A 2OH2A 4KLLA 4OCZA 3EPIA 1UA1A 1NK5A 2R8HA 4LEYA 2HN2A 4FHWA 1EXNA 4ECZA 4UW9A 4O67A 1JRPA 3PSTA 1JROA 4PHAA 1ZQRA 4Y2YA 4PGQA 3UPSA 1J97A 2JR5A 2AH5A 1XSLA 1ZQPA 4MEYA 1SIJA 1ZQMA 4KLHA 2JMGA 5AKIA 4EP7A 3H7IA 1RXVA 9ICIA 4NWIA 3KOOA 2BDPA 1S0MA 4FBUA 3VCBA 4XJEA 3L4PA 1TKDA 2K60A 2JH7A 5KFQA 2JRZA 1KL9A 5ALNA 3KHRA 4Y2RA 1S0VA 1DK3A 4F2RA 4ELTA 2WAQC 4ZH4A 1UT5A 2PI4A 5HR6A 3QUBA 1LKYA 3GQCA 2MUTB 5CFUA 3GIMA 4OAFA 3OJUA 5AKGA 1SKSA 2O1PA 5J0TA 1X9MA 3BQTA 4KLMA 2ZH1A 4N7RA 9ICAA 5ALWA 4PGXA 1TV9A 3RR7A 4KM5A 1TK5A 2IHMA 4K9AA 1PVPA 1U9LA 4KX3A 5IINA 4KLDA 1B43A 1ZYQA 2L5YA 3ZDCA 4QNLA 1X9WA 2QLTA 4X4VA 3RFAA 1KFSA 4EZ9A 5J29A 4PHDA 3JPRA 2H3IA 4E80A 2LYHA 2YMQA 1BPDA 4QZFA 3IM1A 3TAQA 1WOTA 4O3NA 3N7RC 3NGDA 4DOBA 3Q8KA 3H4BA 3GILA 1ZQOA 3JYYA 3IV6A 4PHEA 2MU2A 5IIMA 1XS9D 5EOZA 1FFVA 3KD3A 2MA1A 1QSLA 2NO4A 2CN1A 4PZNA 5CEHA 3C28A 4BXOA 2ZH7A 2W3RA 3NVOA 4IC9A 3AQKA 1WG8A 4F3OA 1U48A 4O3SA 4BGDA 1SXEA 4DSEA 4FZLA 4QWBA 2XCAA 2E1EA 2DR7A 4Q45A 1UCVA 1R8CA 5CWRA 1PK3A 3FYHA 5GTHU 4Z6EA 2Y1JA 1MQ2A 2DUYA 3UXOA 1T94A 5ALQA 1QSYA 1ZD4A 2IA6A 1ZQXA 4F5PA 5J2JA 1QH9A 4M04A 3V6KA 2XIDA 2PXIA 2HVIA 3M1YA 1QLNA 4I2AA 2LYBA 2XY5A 8ICUA 2KZZA 3QU5A 2C2DA 2AXTU 4Q43A 3RJFA 2H5XA 3PW5A 5DKWA 2B0CA 2QARA 3PW7A 4R65A 2LYAA 3PX6A 8ICWA 4LT6A 2I9GA 3H4DA 5IIKA 4JV0A 4P4MA 1Q3UA 2GA9D 5CFTA 5J0QA 4QZCA 3BJYA 4F50A 3MFHA 4DFMA 2W11A 3SQIA 3GV8B 3C2KA 1KEJA 1XWLA 2W9CA 5L1LA 2PFQA 4QW8A 3RH4A 1A76A 3TFSA 2F76X 5KFUA 1JX4A 4RQ3A 2XO7A 8ICMA 4X0BA 3BZKA 4I28A 2FPLA 5DB8A 1MIYA 1VJ7A 5B5EU 4DFJA 4KN7A 4RQ0A 1QQ6A 4TQSA 1BPXA 3TQ1A 1X42A 4ED0A 5KFBA 3AN1A 4USAA 3Q8RB 3H39A 3WK4A 7ICVA 4OJLA 2B56A 2HI0A 4IRDA 3OWGA 2E8OA 4GC6A 4LEWA 4CRXA 1LKYB 1NKCA 2KE7A 4I2GA 4X4NA 2FI1A 2P6UA 4OJOA 1OUQA 1FA0A 2G09A 1ZQLA 3HPOA 4C7ZA 4IS7A 3EF2A 2F1JA 4QW9A 4DL3A 2C22A 5AICA 4IQWA 5D62A 4IQUA 7ICOA 5J0XA 4MFAA 2Z7JA 4F93B 3OPXA 4WC4A 3PHZA 5KG1A 3SAGA 4QWEA 1BNOA 1JIHA 3RJIA 4JV1A 5BOMA 4WC2A 3CK6A 4I27A 1S10A 5J0PA 1RDFA 3PW0A 2FLNA 1TK0A 2M2UA 2GH1A 1WCLA 3SENA 3PR5B 1L7OA 1N62A 3RRGA 1OW5A 2YB4A 1S0OA 4F5OA 2E5SA 1LV5A 3OV7A 3Q8SB 1D9DA 4BXOB 1ZQDA 1TAQA 4IR9A 5J2AA 3MR3A 1S77D 4UAVA 8ICSA 5F9LA 3LWLA 2JEIA 2DKXA 3K1RB 4Y2PA 5HP4A 2ZUBA 2D8CA 1SXDA 5JTIA 3PO5A 1ZQGA 5J8YA 5TZVA 4O6AA 1OU5A 2AQ0A 3H8WA 4YMMA 2G08A 4NXXA 4Y2QA 3KZIU 5KFCA 4KMOB 1TAMA 3KHGA 4O0IA 4B9MA 5J0RA 2BQUA 1S8OA 2N1RA 2J6TA 4YN4A 4ECVA 1B22A 4JLZA 4Z6CA 4WC1A 4HAIA 1X2IA 3V6JA 1X6IA 2KIVA 3ZDAA 4P0PA 4IRCA 2WTFA 3RJHA 5L1JA 5D4BA 1UQVA 5KFJA 2DBYA 4UATA 4TUQA 8ICAA 1RYRA 1VFGA 2HBLA 2E8MA 9ICVA 3QE9Y 2V9WA 8ICPA 5AKXA 5AM3A 3HJEA 2DR9A 4C8NA 1X40A 3NVVA 2GO7A 1A77A 4FZMA 3C5FA 4F4ZA 1KQQA 4RT2A 4IL6U 4HX0A 3U26A 1ZQYA 4DF4A 2KP7A 4EEYA 1ZD3A 3UPQA 2DPIA 3WKCA 2KSOA 9ICGA 5F3XB 4F91B 5J2EA 4DF8A 5KFZA 4JWMA 3UXNA 2BKEA 3MC1A 4DSIA 4O5EA 1KRPA 3H0MB 3AMZA 1U4BA 3WKAA 3GDXA 4B9TA 5EE1A 3T5KA 1TFRA 4DSKA 3NS1A 3D2QA 4X4OA 4F5QA 1R89A 1DOQA 2E3TA 3V72A 1U45A 4F72A 7ICLA 5FP0A 5AM2A 1GO3F 1CUKA 4QZDA 5DLFA 7ICFA 3C18A 1N56A 2ZIVA 2IHOA 1S76D 4RQ1A 3T5LA 9ICQA 4PL2A 5CA7A 1RG6A 2XGQA 3DDHA 1XO0A 5JTGA 5KFMA 4NLNA 3AQFA 1QTMA 5ALKA 1SWWA 4DQQA 2VKQA 2PBEA 4DCCA 2DL0A 4WC7A 3ED5A 1ZRNA 3GU3A 4DQRA 1NNLA 3T5JA 4M0AA 3BS5A 4QZGA 3F5AA 1UT8A 3C2LA 4M6WA 3RBEA 5CB1A 2RFFA 2XC9A 2HOFA 4AP9A 4WC0A 2BCQA 4YR3A 3RRHA 5IIOA 3PO4A 8ICEA 5KG5A 3SD7A 2M9NA 4JK1A 4R66A 2B6GA 2EZZA 4NM1A 9ICLA 4AT9B 4YXJA 4MHVA 2KJ9A 2BPCA 2VA3A 3PMLA 5ALVA 4YMNA 2KVSA 2F8KA 5JU5A 4GIBA 1Z3EB 3F2DA 5CFSA 1MQ3A 3JZ0A 4UB5A 5AKEA 3QXGA 3HKZC 4R8UA 5F9NA 2KV2A 4O68A 1NK8A 3QZ8A 4NXUA 4RWNA 1D8YA 4CCHA 4B9SA 5J0OA 4P0PB 3E0FA 2W03A 3RJEA 5KFHA 4EBKA 1PX5A 1QCKA 3NWIA 3C23A 4QZHA 3BZCA 1XNSA 3UM9A 1TVAA 8ICNA 1S5LU 4EYIB 2G0AA 3UQ2A 3RB0A 3D2NA 2ZH6A 1TFWA 2KEYA 1JI7A 2O6KA 1RQLA 5AKZA 4RNNA 4EYHB 1X6JA 4ACOA 4XA5A 2KNJA 2DQNB 3PZPA 1SV0C 2W8KA 2KSOB 3L9DA 4QWDA 5KG0A 2DWQA 1Z19A 5KG7A 1S0NA 1JUDA 4DWIA 4M9GA 3GFKB 3WK6A 2RQ5A 2ES6A 3ERCC 5J2DA 5DGAA 4X4TA 1IM4A 4QJFB 1WWVA 4ELVA 4DQSA 2ZHBA 4YP3A 1SL1A 2K89A 5DBBA 4C8MA 2AU0A 3NYBA 3WFPA 3B9JA 3PSIA 5B3PA 2ZIVB 1ED1A 3RF9A 4Y2TA 1ZQHA 1DGSA 5KG3A 1T3NA 3ZD9A 2C2RA 3NVZA 1NO5A 3MR5A 1J2NA 4C0ZA 2R8JA 2F1HA 4F2SA 5L1MA 4FHPA 1ZQQA 4E7XA 3RH6A 5DQHA 1RYSA 3NVYA 4B9VA 4NKTA 3QX7A 1ZXIA 1ZQCA 1TAUA 3LYSA 4DS5A 4QZ9A 1UETA 2J6UA 4X4RA 4YVZA 4RQ5A 5CHEA 4M6WB 7ICGA 3LK9A 8ICXA 1NZBA 1KFDA 3MGIA 1XSPA 2H3VA 2KG5A 2ZH9A 1ZQJA 5DECA 4BWMA 9ICKA 2ATLA 2KKVA 9ICUA 1T3QA 3WKEA 5J2HA 4IG8A 2HBKA 2R8KA 8ICLA 1JAJA 3RAXA 2A3VA 2IUBA 2KJ8A 1L3VA 2ZTEA 4YFKA 4I2FA 4DSFA 4KB6A 8ICHA 5J0SA 1ZJNA 4Y2JA 2E1FA 4P2HA 2W55A 3HJ4A 4Q8EA 3PY8A 4GFJA 3G6VA 4RQ7A 2IOHA 3EUB2 5KT3A 4MFFA 3HJ1A 3RBDA 2EDUA 3WK8A 5DBAA 1BGXT 5AKKA 1YZ7A 1SZHA 8ICFA 1U47A 4ED6A 5AK4A 3SMVA 4F8RA 5ALTA 5KFWA 1MIVA 4I2IA 5KFDA 4Y2XA 5HHIA 4XUSA 3IG5A 2WFAA 5CR0A 2Q4TA 4PH5A 9ICJA 4DOAA 5KG6A 4C4RA 1L6NA 3OVAA 4X4UA 3ETRA 1MSWD 3JPSA 5ALSA 1DK2A 2NYVA 2KFNA 2A1JA 5ALEA 3QZ7A 4KLUA 1AQ6A 4UAUA 4EBDA 1B4FA 5B3QA 8ICGA 4RUCA 3RJJA 4RWPA 1NJYA 2W9BA 1JXLA 2WF8A 4E8FA 3DEEA 1J2MA 2RHFA 3I76A 4WH5A 1IV8A 2LPEA 4K4GA 2AGPA 3K4GA 2IBKA 4UB1A 4B9LA 2ZIWA 7ICPA 3IG8A 3B0YA 3WKBA 2HHTA 3Q8PB 4XQ8A 4O5KA 3SI8A 1FO4A 3D6JA 5CHGA 4KLOA 4JLXA 4QZIA 2M2WA 2BCUA 4KLFA 5HRKA 4KMUA 5AKYA 1IG6A 5KFFA 1N48A 2Y1IA 1L3SA 3EWAA 3M7DA 2M2VA 3HILA 1D8BA 2FJ6A 1HUZA 3NKUA 5ALMA 1ZETA 3QU4A 1HUOA 1M6YA 3H37A 3QU2A 4NLBA 3Q8LA 3BS7A 2G06A 5ALDA 1BPYA 9ICWA 2FPKA 3ICXA 4ED7A 4NXTA 2ESEA 1ZD2P 4CNQA 2JZBA 3MR2A 5IILA 4DQPA 4O3RA 3KFUF 2F3NA 2KHQA 5EE0A 2G07A 1PZNA 2D3DA 5AI4A 4UD4A 4JUZA 1S97A 4YR0A 4DFPA 1ZQBA 4YD1A 1YT3A 2C2EA 4KLJA 2PFPA 3OHBA 4C8LA 3TFRA 2XVTA 2XY7A 5DBCA 3V7KA 3C21A 5B66U 5DG7A 2FE9A 4K4IA 1ZD5A 3QU7A 3HWTA 2WF9A 1N61A 4J9MA 2BBHA 2YQEA 2AHOB 4CF4A 3I28A 2K4HA 3N4MB 4IRKA 7ICQA 2B51A 9ICTA 3GIKA 4UB6U 2PKEA 1L7NA 4RQ4A 5HHHA 1ZQUA 2HHXA 3SV4A 3H0RB 3KKAC 3B0XA 9ICEA 2ZIUA 1UHUA 4ECUA 4J9RA 2ZXHA 2BGWA 2HOIA 5L1KA 4LVSA 3WKDA 3QUQA 3ZDEA 1NK9A 2ISPA 4Z6DA 3BQ1A 3PSPA 3SZ2A 4O3QA 5JUMA 3JPTA 1FFUA 9ICPA 4OD0A 1K1SA 4PZOA 2YMLA 4BJQA 4GXIA 4R63A 2G5IB 4NLGA 4K96A 4QZ8A 5JRTA 4LZDA 1U49A 2ZTCA 2KIWA 4X4PA 4OJPA 3KBBA 3GV7B 7ICTA 5KFTA 2PMZF 3PX4A 4WCWA 4F71A 7ICHA 2YB1A 5J2FA 5ALZA 3MBYA 4DSLA 3MGHA 8ICJA 1UEVA 2ASJA 2OXOA 2BCVA 4B9NA 4WC6A 2BDUA 2ZG6A 1LVHA 1A6SA 1F44A 2W54A 4X5VA 4BX9C 3N97B 3SAHA 4J9SA 4DEZA 2ZIWB 2KN7A 3BQ7A 2HHPA 5AIAA 3A0HU 5AKHA 2W9AA 2B21A 1QQ5A 1KW4A 5HRHA 1Z1VA 2YN4A 3SAFA 3PV8A 4WQLA 2ZXIA 4K9BA 3Q8MA 3KHHA 5HRFA 2Q0ZX 2EZXA 7ICMA 2LMRA 2KVCA 2RDIA 3H8MA 3D2SA 3ORYA 1CI4A 2BBJA 5KFOA 3C2MA 2W04A 2QARB 3RH5A 1NK0A 1BPBA 4KLIA 5ALXA 5J0WA 4QZAA 1XC9A 2UVUA 4EBCA 1PUZA 3ISBA 2A1AA 3K1ZA 1KFTA 4US9A 1ZQTA 3UQ0A 1WWUA 1F5SA 5HREA 2JZBB 5KT6A 7ICRA 3CYMA 4ICAA 2MSNA 1FEZA 3OUYA 1URJA 2P35A 4ECYA 1ZQZA 5D49A 4ED1A 4EEKA 4RWOA 2K4EA 3ER8C 3OVSA 1WCNA 3TADC 2W9CB 4O3PA 1TK8A 5KFLA 4RNMA 4TQRA 9ICNA 4F4WA 5EWEA 4P4OA 3AU2A 5KFIA 3ISDA 2W9MA 4O9MA 3HKZF 1N5WA 3F2BA 4DLEA 4BDPA 5AM1A 5EE9A 1RPLA 1NJXA 1T7PA 2XI9A 3M6ZA 1CRXA 5K4LA 1SWVA 2VJ5A 2OCEA 4F92B 1LB2B 2KTQA 1QQ7A 2ZUCA 4HYKA 3L5KA 2PMZC 5EWFA 1Z00A 2ZH4A 1PVQA 1O08A 4K99A 1GPJA 1KN5A 2O5AA 4ATBA 2ZIUB 3JPPA 4XQ7A 3V6HA 2ASDA 3SEIA 3NASA 8ICBA 1R8BA 3FC4A 4OO1J 3JPNA 4DLGA 1HJPA 4LEVA 5DEDA 1Z1BA 4O3OA 4NLKA 2QKQA 2VJ4A 4RZRA 3AU6A 1Q46A 4MFCA 2D6FC 4M47A 3PW4A 3HRDD 4MKPA 3BQ0A 1XSNA 4I2DA 2LKYA 2ASLA 1COKA 1V9PA 1ZQSA 2W7PA 2PFOA 1Z4OA 3AQLA 4GXJA 4IR1A 3AL0B 4K8VA 1BPEA 3QUCA 1BNPA 4J03A 1V38A 2DFLA
chains in the Genus database with same CATH topology
4F2SA 2PXIA 2AGOA 3JPOA 2HVIA 4ELUA 2FMPA 1QLNA 4FHPA 1ZQQA 4E7XA 3RH6A 4NY8A 5HNKA 2UVVA 4WBYA 5DQHA 5J2IA 3M8RA 2XY5A 4RUAA 1RYSA 4I2AA 4M9NA 2KZZA 8ICUA 2C2DA 4FH3A 4X4SA 4Q43A 3HT3A 4KLSA 1MC8A 3RJFA 2H5XA 1K1QA 4BWJA 4I2JA 5KT7A 4YCXA 4TUPA 2IMWP 3PW5A 4B9VA 4DSJA 4AT9A 2DR5A 2UVRA 5DKWA 2VA8A 3OVBA 3K75D 5KFYA 3EYZA 3RB3A 1ZQCA 4J9NA 1NK6A 3PW7A 7ICIA 1TAUA 5KG4A 4R65A 3PX6A 1ZQEA 4DS5A 4QZ9A 4ECWA 8ICWA 2J6UA 1UETA 4LT6A 2I9GA 4DL7A 4X4RA 4YVZA 4UB2A 3G6XA 1C7YA 4RQ5A 4NLZA 4M6WB 4J9PA 3H4DA 5IIKA 3LK9A 1NK7A 7ICGA 2AJQA 8ICXA 4JV0A 4UD5A 1KFDA 4P4MA 3MGIA 1XSPA 2ZH9A 3HW8A 2PFNA 1ZQJA 4XRHA 4BWMA 9ICKA 2ATLA 5DECA 9ICUA 5J2HA 4P4PA 4IG8A 3JPQA 1S9FA 4K4HA 9ICHA 5J0QA 4RNOA 3SV3A 2R8KA 4QZCA 4J9LA 8ICLA 1JAJA 5DG8A 3AQMA 3LDAA 3BJYA 3RAXA 4QWAA 2F1HA 4F50A 3MFHA 4DFMA 4M9JA 4ED3A 2ISOA 3GV8B 2BPFA 3C2KA 1L3VA 1KEJA 1XWLA 2ZTEA 4YFKA 5KT5A 2W9CA 5L1LA 4DSFA 2PFQA 4I2FA 5J0SA 1ZJNA 8ICHA 4QW8A 3RH4A 4P2HA 1A76A 4J9QA 3TFSA 1D9FA 5KFUA 1JX4A 4Q8EA 3PY8A 4RQ3A 3HJ4A 3G6VA 4RQ7A 5KTQA 2XO7A 8ICMA 4X0BA 9ICRA 2MAXA 5KT3A 4M2YA 9ICFA 2UVWA 4MFFA 4I28A 3HJ1A 2FPLA 4FS1A 7ICEA 3RBDA 5KFKA 5DBAA 4FHVA 5DB8A 8ICVA 1MIYA 2V4RA 4ECSA 4I2HA 1VJ7A 1BGXT 4I2BA 2FLLA 4QWCA 2KFZA 5DB9A 3C5GA 4DFJA 4KN7A 4RQ0A 5L1IA 4TQSA 3RAQA 1BPXA 5J2KA 3TQ1A 5HRGA 2AGQA 1X9SA 8ICFA 4ED0A 1U47A 2FMQA 5KFBA 3FDSA 4JWNA 3PX0A 3Q8RB 4ED8A 9ICCA 4ED6A 3H39A 7ICVA 4I2CA 4F8RA 4AT7A 4YQWA 5KFWA 1MIVA 2ZH8A 4I2IA 4X0AA 4IRDA 5KFDA 7ICJA 4J9OA 3GIJA 3PW2A 4FS2A 3C66A 4GC6A 3WFRE 5HHIA 4XUSA 5CR0A 3OSNA 1NKCA 9ICJA 4PH5A 4I2GA 4DOAA 4X4NA 2P6UA 5HRLA 4NKUA 4YG2A 5KG6A 1FA0A 2NRTA 4QZBA 5KFEA 3OVAA 1TFYA 4X4UA 5KFRA 9ICSA 1ZQLA 4RU9A 3HPOA 2HW3A 1MSWD 3JPSA 4YXMA 5D46A 2IHNA 1NJWA 4UBBA 1DK2A 1JN3A 2F1JA 4QW9A 4EBEA 3RR8A 4YD2A 5DGBA 4DL3A 2KFNA 4UB4A 2A1JA 2C22A 4IQWA 3QZ7A 4IQUA 7ICOA 2ZUDA 4KLUA 5J0XA 4MFAA 2BQRA 4F4KA 8ICIA 4F93B 1NKEA 1ZQKA 4EBDA 1DK3A 4WC4A 4UAZA 5KG1A 4F4YA 4IQTA 4RPZA 8ICGA 4RUCA 4QWEA 3RB4A 1ZQFA 3RJJA 1NJYA 1BNOA 4RWPA 1JIHA 5DDYA 3ISCA 2W9BA 3RJIA 1JXLA 4JV1A 4E8FA 1NZPA 5BOMA 4WC2A 2FMSA 4I27A 2JEFA 1S10A 5J0PA 7ICUA 9ICXA 1JMSA 4ECTA 5IIIA 1IXRA 3K4GA 3MFIA 2AGPA 3PW0A 1SL2A 4UB1A 2FPMA 4F5NA 2FLNA 2IBKA 1UA0A 4B9LA 4PPXA 5DB6A 7ICPA 3OJSA 2DR8A 3EW9A 1TK0A 2M2UA 3B0YA 2HHTA 1WCLA 4RT3A 3PR5B 3Q8PB 4MEXA 4XQ8A 4O5KA 3RRGA 3SI8A 4F5RA 1S0OA 5CHGA 4F5OA 4TURA 1LV5A 4KLOA 3UXPA 4QZIA 3RJKA 2M2WA 3OV7A 8ICOA 1SKWA 3G6YA 3Q8SB 1JQRA 2BCUA 1D9DA 4BXOB 4KLFA 1ZQDA 1TAQA 4IR9A 5J2AA 4KMUA 4DL6A 3MR3A 1S77D 2HHSA 5HRKA 8ICSA 5F9LA 5C5JA 3LWLA 5KFFA 1N48A 5EWGA 2Y1IA 2JEIA 5HC9A 2J6SA 5HP4A 1L3SA 2ZUBA 3EWAA 4IQVA 4GLXA 2M2VA 2BE3A 1HUZA 4DO9A 3PO5A 1ZQGA 2NRKA 1ZETA 4JV2A 1HUOA 5TZVA 4M5DA 3NTUA 3H37A 4AT8B 4E0DA 1OU5A 4R64A 3IHQB 5KFPA 2AQ0A 4EBJA 3H8WA 3THVA 4YMMA 3Q8LA 1MIWA 5KFCA 4RPXA 1XO1A 5KT4A 3BDPA 2HHUA 1BPYA 2BHNA 1Y88A 9ICWA 2F1IA 2FPKA 3KHGA 5KFNA 4O0IA 3OHAA 4ED7A 7ICSA 4G3IA 2JZBA 3MR2A 5IILA 4B9MA 5J0RA 1Q78A 4DQPA 4O3RA 2BQUA 4I29A 3MDCA 1KTQA 3TAPA 2R8IA 2J6TA 2P66A 9ICBA 4YN4A 4ECVA 1B22A 1PZNA 3M9NB 4Z6CA 4DOCA 3M9OB 4WC1A 5DQIA 2ZJAA 1X2IA 3V6JA 4UD4A 4I2EA 4DFKA 4JUZA 5HR9A 1JXEA 4QZEA 2ZJ5A 4Z6FA 5DQGA 4YR0A 4DFPA 3Q8QB 1S97A 1L3UA 1ZQBA 5HMMA 2FLPA 2MUTA 4YD1A 3ZDAA 2C2EA 5DLGA 2ZJ8A 5F2VO 4IRCA 2PFPA 2WTFA 3RJHA 4KLJA 4FHYA 3OHBA 5CJ7A 3RB6A 3OGUA 5L1JA 4NXZA 4C8LA 2ZH2A 5D4BA 5KFJA 3TFRA 4TUQA 8ICAA 1ZQIA 2XY7A 5DBCA 3V7KA 1RYRA 3C21A 4UAYA 9ICVA 1VFGA 1NK4A 3TI0A 2W8LA 3QE9Y 3OSPA 2P6RA 5J2CA 2V9WA 8ICPA 5DG7A 3QEAZ 4KTQA 4RQ2A 1QSSA 4K4IA 2DR9A 2PI5A 2BQ3A 2JEGA 3HWTA 4FBTA 4C8NA 4RPYA 4J9MA 2Q66A 3PMNA 1SZPA 5HRIA 3H40A 3AUOA 3PVXA 3TANA 3QEBZ 4R8UB 4UAWA 5KFVA 1A77A 3T3FA 5KG2A 2XCPA 3N4MB 3C5FA 4IRKA 1CEZA 8ICYA 3OUYB 7ICQA 4F4ZA 4K4GA 9ICTA 4RT2A 2BR0A 4KITB 3WFSC 3H8SA 3GIKA 5DDMA 7ICNA 4WC3A 2DRBA 1ZQYA 4DF4A 4TUSA 2KP7A 4RQ4A 2HHVA 4EEYA 5HHHA 4GXKA 1ZQUA 8ICQA 2HHXA 3UPQA 2DPIA 3SV4A 3H3AA 4KN4A 9ICGA 3H8JA 2ZTDA 4F91B 5J2EA 5HMLA 3B0XA 5KFZA 4UBCA 4DF8A 1D8LA 3UXNA 4JWMA 4O5CA 2VANA 9ICEA 3WFQE 2BKEA 3LQCB 1ZJMA 4DSIA 4O5EA 1KRPA 1U4BA 3GDXA 4B9TA 3T5KA 4ECUA 8ICTA 1TFRA 4GC7A 3BQ2A 4J9RA 2OWOA 4DSKA 1UEUA 5L9XA 3GV5B 2BGWA 4AT7B 1KSPA 9ICMA 4F5QA 4X4OA 1R89A 3C1ZA 5L1KA 3RJGA 1DOQA 4LVSA 4KLGA 3GIIA 3KHLA 1T8EA 8ICRA 4RWQA 3ZDEA 3V72A 1U45A 1NK9A 2ISPA 4Z6DA 4ECRA 3BQ1A 4FH5A 7ICLA 3ZD8A 1RZTA 2BPGA 4MF2A 3HP6A 3SZ2A 4O3QA 5JUMA 4MF8A 3JPTA 4ED2A 4LZGA 9ICPA 1CUKA 4QZDA 5DLFA 7ICFA 1K1SA 4C8OA 1Z00B 3C18A 3HIYA 4FO6A 1N56A 3ETLA 4RQ8A 4GXIA 4M9HA 4R63A 4C8KA 4NLGA 1KDHA 1S76D 4RQ1A 3T5LA 1Q79A 4QZ8A 2I1QA 1L3TA 2ID1A 4KLEA 4LZDA 5J0YA 3V7JA 1U49A 9ICQA 2ZTCA 3M9MB 4ATBB 4X4PA 2DVIA 5J2GA 5CA7A 3GV7B 2ZH5A 7ICTA 2HVHA 1T4GA 2XGQA 5KFTA 9ICOA 4WCWA 3PX4A 2M2TA 2KZMA 4DS4A 2KZ3A 7ICHA 5HRDA 5HRBA 5J2FA 2DRAA 3E2EA 1V4AA 4NM2A 5KFMA 3PR4A 2VA2A 3MBYA 4DL2A 4DSLA 3MGHA 1ZQVA 4NLNA 1QTMA 8ICJA 4DL5A 4X4QA 1UEVA 1AROP 4DQQA 2ASJA 2BCVA 5DB7A 2PBEA 2NRWA 5KFGA 4B9NA 4WC6A 4WC7A 1R8AA 4YMOA 2XGPA 4DQRA 3T5JA 4X5VA 4M0AA 4QZGA 5IIJA 1KLNA 3N97B 3ZDBA 3C1YA 4J9SA 4DEZA 3M8SA 1UT8A 4J9KA 4WC5A 2GWSA 3C2LA 4M6WA 5DG9A 3RBEA 1F5AA 3TARA 2KN7A 1RXWA 1H38A 4KLLA 5CB1A 2NRXA 3EPIA 2RFFA 2HHPA 2XC9A 1UA1A 1NK5A 2R8HA 2W9AA 2B21A 4FHWA 2BCQA 4WC0A 3MR6A 4YR3A 3RRHA 5HRHA 1EXNA 3RTVA 5IIOA 5KFXA 4PGYA 4ECZA 2XY6A 3PV8A 4F4XA 3PO4A 3Q8MA 3KHHA 8ICEA 5KG5A 5HRFA 2Q0ZX 4PHAA 1ZQRA 7ICMA 2M9NA 4JK1A 4B9UA 4ECXA 3SYZA 2RDIA 4PGQA 4R66A 3ORYA 3H38A 8ICKA 4NM1A 9ICLA 2V4QA 5J2BA 4AT9B 4YXJA 3UPSA 5KFOA 3C2MA 2BPCA 2VA3A 1ZQPA 3PMLA 1XSLA 3RH5A 4YMNA 2DPJA 4MEYA 1NK0A 1ZQMA 2ALZA 4KLHA 1BPBA 4KLIA 3LWMA 4EP7A 3H7IA 1Z3EB 5J0WA 3MDAA 4QZAA 1RXVA 1XC9A 2UVUA 9ICIA 4EBCA 7ICKA 3ISBA 2BDPA 1S0MA 1KFTA 4S3NA 4FBUA 1ZQTA 8ICCA 3UQ0A 1MQ3A 8ICZA 1NJZA 3JZ0A 4UB5A 1ZQWA 5HREA 2JZBB 5KT6A 7ICRA 4R8UA 1TKDA 5KFQA 5F9NA 3PNCA 4KLQA 2BCSA 3KTQA 2AQ4A 3OUYA 3KHRA 1S0VA 1ZQNA 4ECYA 4F2RA 4ELTA 1ZQZA 4ZH4A 5D49A 5J0UA 1UT5A 4ECQA 3QZ8A 1NK8A 2PI4A 4ED1A 1ZQAA 4RWOA 1D8YA 2JEJA 4CCHA 4B9SA 3OVSA 4RWNA 1WCNA 2W9CB 3GQCA 3EPGA 5J0OA 4O3PA 2MUTB 2HHWA 3WFOA 1BVSA 1TK8A 3GIMA 5KFLA 3RJEA 2HHQA 4RNMA 5KFHA 4TQRA 4EBKA 9ICNA 4F4WA 5EWEA 3OJUA 4P4OA 3AU2A 5KFIA 1PX5A 3MABA 4KLTA 2ZH3A 1SKSA 4DQIA 3ISDA 2W9MA 4O9MA 2O1PA 5J0TA 3C23A 1X9MA 3BQTA 4KLMA 2ZH1A 4QZHA 5KT2A 4DLEA 9ICAA 4PGXA 5BPCA 3EZ5A 1TV9A 3RR7A 4BDPA 2NRZA 4YR2A 1TVAA 1TK5A 3ZDDA 8ICNA 2IHMA 1COOA 1RPLA 4EYIB 1U9LA 5IINA 1NJXA 4KLDA 3HX0A 3UQ2A 3RB0A 1T7PA 1L5UA 1B43A 1ZYQA 3ZDCA 2ZH6A 1TFWA 1X9WA 4NKTA 4X4VA 1KFSA 4RNNA 4EZ9A 4F92B 5J29A 4PHDA 4EYHB 1LB2B 4M9LA 2KTQA 4PHPA 3JPRA 2ZUCA 4HYKA 2C28A 1SL0A 3V7LA 1Z00A 5EWFA 4E80A 2ZH4A 2LYHA 4FHXA 4Q44A 4XA5A 1BPDA 4QZFA 3IM1A 3TAQA 2W8KA 1WOTA 2BCRA 4O3NA 1YLQA 3NGDA 3L9DA 4QWDA 5KG0A 4DOBA 1S0NA 5KG7A 3Q8KA 1BPZA 3H4BA 2O5AA 4ATBA 3JPPA 3GILA 4DWIA 4XQ7A 1ZQOA 3JYYA 4M9GA 3GFKB 4PHEA 5IIMA 1XS9D 5EOZA 3V6HA 5J2DA 4DL4A 2ASDA 1QSLA 5DGAA 2A1JB 8ICBA 2ZHAA 1R8BA 4X4TA 1IM4A 3AQNA 4BXOA 2ZH7A 5KFAA 4EZ6A 3T5HA 3JPNA 4DLGA 4ELVA 1HJPA 4DQSA 4Q8FA 2ZHBA 4YP3A 1SL1A 1NKBA 4RQ6A 3AQKA 4UQGA 4WBZA 4F3OA 4O3OA 1U48A 4O3SA 4BGDA 4NLKA 5DEDA 4DSEA 5DBBA 4RZRA 3AU6A 2W9BB 2R8GA 4C8MA 1KNYA 4QWBA 2XCAA 2AU0A 2NRVA 4MFCA 4Q45A 3NYBA 1R8CA 3WFPA 5CWRA 2DR7A 4M47A 3FYHA 3PW4A 4Z6EA 4UB3A 2Y1JA 1MQ2A 3BQ0A 1XSNA 4I2DA 5BOLA 4AT8A 3UXOA 2ASLA 1ZQHA 1V9PA 1ZQSA 1QSYA 1XU4A 2IA6A 1DGSA 5KG3A 1ZQXA 2PFOA 1T3NA 4F5PA 5J2JA 3AQLA 5KFSA 3ZD9A 4GXJA 2C2RA 4IR1A 1SKRA 1BPEA 1BNPA 4M04A 1NOMA 1NO5A 2RDJA 3V6KA 3MR5A 2R8JA 2DFLA 5CP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2S A;  2PXI A;  2AGO A;  3JPO A;  2HVI A;  4ELU A;  2FMP A;  1QLN A;  4FHP A;  1ZQQ A;  4E7X A;  3RH6 A;  4NY8 A;  5HNK A;  2UVV A;  4WBY A;  5DQH A;  5J2I A;  3M8R A;  2XY5 A;  4RUA A;  1RYS A;  4I2A A;  4M9N A;  2KZZ A;  8ICU A;  2C2D A;  4FH3 A;  4X4S A;  4Q43 A;  3HT3 A;  4KLS A;  1MC8 A;  3RJF A;  2H5X A;  1K1Q A;  4BWJ A;  4I2J A;  5KT7 A;  4YCX A;  4TUP A;  2IMW P;  3PW5 A;  4B9V A;  4DSJ A;  4AT9 A;  2DR5 A;  2UVR A;  5DKW A;  2VA8 A;  3OVB A;  3K75 D;  5KFY A;  3EYZ A;  3RB3 A;  1ZQC A;  4J9N A;  1NK6 A;  3PW7 A;  7ICI A;  1TAU A;  5KG4 A;  4R65 A;  3PX6 A;  1ZQE A;  4DS5 A;  4QZ9 A;  4ECW A;  8ICW A;  2J6U A;  1UET A;  4LT6 A;  2I9G A;  4DL7 A;  4X4R A;  4YVZ A;  4UB2 A;  3G6X A;  1C7Y A;  4RQ5 A;  4NLZ A;  4M6W B;  4J9P A;  3H4D A;  5IIK A;  3LK9 A;  1NK7 A;  7ICG A;  2AJQ A;  8ICX A;  4JV0 A;  4UD5 A;  1KFD A;  4P4M A;  3MGI A;  1XSP A;  2ZH9 A;  3HW8 A;  2PFN A;  1ZQJ A;  4XRH A;  4BWM A;  9ICK A;  2ATL A;  5DEC A;  9ICU A;  5J2H A;  4P4P A;  4IG8 A;  3JPQ A;  1S9F A;  4K4H A;  9ICH A;  5J0Q A;  4RNO A;  3SV3 A;  2R8K A;  4QZC A;  4J9L A;  8ICL A;  1JAJ A;  5DG8 A;  3AQM A;  3LDA A;  3BJY A;  3RAX A;  4QWA A;  2F1H A;  4F50 A;  3MFH A;  4DFM A;  4M9J A;  4ED3 A;  2ISO A;  3GV8 B;  2BPF A;  3C2K A;  1L3V A;  1KEJ A;  1XWL A;  2ZTE A;  4YFK A;  5KT5 A;  2W9C A;  5L1L A;  4DSF A;  2PFQ A;  4I2F A;  5J0S A;  1ZJN A;  8ICH A;  4QW8 A;  3RH4 A;  4P2H A;  1A76 A;  4J9Q A;  3TFS A;  1D9F A;  5KFU A;  1JX4 A;  4Q8E A;  3PY8 A;  4RQ3 A;  3HJ4 A;  3G6V A;  4RQ7 A;  5KTQ A;  2XO7 A;  8ICM A;  4X0B A;  9ICR A;  2MAX A;  5KT3 A;  4M2Y A;  9ICF A;  2UVW A;  4MFF A;  4I28 A;  3HJ1 A;  2FPL A;  4FS1 A;  7ICE A;  3RBD A;  5KFK A;  5DBA A;  4FHV A;  5DB8 A;  8ICV A;  1MIY A;  2V4R A;  4ECS A;  4I2H A;  1VJ7 A;  1BGX T;  4I2B A;  2FLL A;  4QWC A;  2KFZ A;  5DB9 A;  3C5G A;  4DFJ A;  4KN7 A;  4RQ0 A;  5L1I A;  4TQS A;  3RAQ A;  1BPX A;  5J2K A;  3TQ1 A;  5HRG A;  2AGQ A;  1X9S A;  8ICF A;  4ED0 A;  1U47 A;  2FMQ A;  5KFB A;  3FDS A;  4JWN A;  3PX0 A;  3Q8R B;  4ED8 A;  9ICC A;  4ED6 A;  3H39 A;  7ICV A;  4I2C A;  4F8R A;  4AT7 A;  4YQW A;  5KFW A;  1MIV A;  2ZH8 A;  4I2I A;  4X0A A;  4IRD A;  5KFD A;  7ICJ A;  4J9O A;  3GIJ A;  3PW2 A;  4FS2 A;  3C66 A;  4GC6 A;  3WFR E;  5HHI A;  4XUS A;  5CR0 A;  3OSN A;  1NKC A;  9ICJ A;  4PH5 A;  4I2G A;  4DOA A;  4X4N A;  2P6U A;  5HRL A;  4NKU A;  4YG2 A;  5KG6 A;  1FA0 A;  2NRT A;  4QZB A;  5KFE A;  3OVA A;  1TFY A;  4X4U A;  5KFR A;  9ICS A;  1ZQL A;  4RU9 A;  3HPO A;  2HW3 A;  1MSW D;  3JPS A;  4YXM A;  5D46 A;  2IHN A;  1NJW A;  4UBB A;  1DK2 A;  1JN3 A;  2F1J A;  4QW9 A;  4EBE A;  3RR8 A;  4YD2 A;  5DGB A;  4DL3 A;  2KFN A;  4UB4 A;  2A1J A;  2C22 A;  4IQW A;  3QZ7 A;  4IQU A;  7ICO A;  2ZUD A;  4KLU A;  5J0X A;  4MFA A;  2BQR A;  4F4K A;  8ICI A;  4F93 B;  1NKE A;  1ZQK A;  4EBD A;  1DK3 A;  4WC4 A;  4UAZ A;  5KG1 A;  4F4Y A;  4IQT A;  4RPZ A;  8ICG A;  4RUC A;  4QWE A;  3RB4 A;  1ZQF A;  3RJJ A;  1NJY A;  1BNO A;  4RWP A;  1JIH A;  5DDY A;  3ISC A;  2W9B A;  3RJI A;  1JXL A;  4JV1 A;  4E8F A;  1NZP A;  5BOM A;  4WC2 A;  2FMS A;  4I27 A;  2JEF A;  1S10 A;  5J0P A;  7ICU A;  9ICX A;  1JMS A;  4ECT A;  5III A;  1IXR A;  3K4G A;  3MFI A;  2AGP A;  3PW0 A;  1SL2 A;  4UB1 A;  2FPM A;  4F5N A;  2FLN A;  2IBK A;  1UA0 A;  4B9L A;  4PPX A;  5DB6 A;  7ICP A;  3OJS A;  2DR8 A;  3EW9 A;  1TK0 A;  2M2U A;  3B0Y A;  2HHT A;  1WCL A;  4RT3 A;  3PR5 B;  3Q8P B;  4MEX A;  4XQ8 A;  4O5K A;  3RRG A;  3SI8 A;  4F5R A;  1S0O A;  5CHG A;  4F5O A;  4TUR A;  1LV5 A;  4KLO A;  3UXP A;  4QZI A;  3RJK A;  2M2W A;  3OV7 A;  8ICO A;  1SKW A;  3G6Y A;  3Q8S B;  1JQR A;  2BCU A;  1D9D A;  4BXO B;  4KLF A;  1ZQD A;  1TAQ A;  4IR9 A;  5J2A A;  4KMU A;  4DL6 A;  3MR3 A;  1S77 D;  2HHS A;  5HRK A;  8ICS A;  5F9L A;  5C5J A;  3LWL A;  5KFF A;  1N48 A;  5EWG A;  2Y1I A;  2JEI A;  5HC9 A;  2J6S A;  5HP4 A;  1L3S A;  2ZUB A;  3EWA A;  4IQV A;  4GLX A;  2M2V A;  2BE3 A;  1HUZ A;  4DO9 A;  3PO5 A;  1ZQG A;  2NRK A;  1ZET A;  4JV2 A;  1HUO A;  5TZV A;  4M5D A;  3NTU A;  3H37 A;  4AT8 B;  4E0D A;  1OU5 A;  4R64 A;  3IHQ B;  5KFP A;  2AQ0 A;  4EBJ A;  3H8W A;  3THV A;  4YMM A;  3Q8L A;  1MIW A;  5KFC A;  4RPX A;  1XO1 A;  5KT4 A;  3BDP A;  2HHU A;  1BPY A;  2BHN A;  1Y88 A;  9ICW A;  2F1I A;  2FPK A;  3KHG A;  5KFN A;  4O0I A;  3OHA A;  4ED7 A;  7ICS A;  4G3I A;  2JZB A;  3MR2 A;  5IIL A;  4B9M A;  5J0R A;  1Q78 A;  4DQP A;  4O3R A;  2BQU A;  4I29 A;  3MDC A;  1KTQ A;  3TAP A;  2R8I A;  2J6T A;  2P66 A;  9ICB A;  4YN4 A;  4ECV A;  1B22 A;  1PZN A;  3M9N B;  4Z6C A;  4DOC A;  3M9O B;  4WC1 A;  5DQI A;  2ZJA A;  1X2I A;  3V6J A;  4UD4 A;  4I2E A;  4DFK A;  4JUZ A;  5HR9 A;  1JXE A;  4QZE A;  2ZJ5 A;  4Z6F A;  5DQG A;  4YR0 A;  4DFP A;  3Q8Q B;  1S97 A;  1L3U A;  1ZQB A;  5HMM A;  2FLP A;  2MUT A;  4YD1 A;  3ZDA A;  2C2E A;  5DLG A;  2ZJ8 A;  5F2V O;  4IRC A;  2PFP A;  2WTF A;  3RJH A;  4KLJ A;  4FHY A;  3OHB A;  5CJ7 A;  3RB6 A;  3OGU A;  5L1J A;  4NXZ A;  4C8L A;  2ZH2 A;  5D4B A;  5KFJ A;  3TFR A;  4TUQ A;  8ICA A;  1ZQI A;  2XY7 A;  5DBC A;  3V7K A;  1RYR A;  3C21 A;  4UAY A;  9ICV A;  1VFG A;  1NK4 A;  3TI0 A;  2W8L A;  3QE9 Y;  3OSP A;  2P6R A;  5J2C A;  2V9W A;  8ICP A;  5DG7 A;  3QEA Z;  4KTQ A;  4RQ2 A;  1QSS A;  4K4I A;  2DR9 A;  2PI5 A;  2BQ3 A;  2JEG A;  3HWT A;  4FBT A;  4C8N A;  4RPY A;  4J9M A;  2Q66 A;  3PMN A;  1SZP A;  5HRI A;  3H40 A;  3AUO A;  3PVX A;  3TAN A;  3QEB Z;  4R8U B;  4UAW A;  5KFV A;  1A77 A;  3T3F A;  5KG2 A;  2XCP A;  3N4M B;  3C5F A;  4IRK A;  1CEZ A;  8ICY A;  3OUY B;  7ICQ A;  4F4Z A;  4K4G A;  9ICT A;  4RT2 A;  2BR0 A;  4KIT B;  3WFS C;  3H8S A;  3GIK A;  5DDM A;  7ICN A;  4WC3 A;  2DRB A;  1ZQY A;  4DF4 A;  4TUS A;  2KP7 A;  4RQ4 A;  2HHV A;  4EEY A;  5HHH A;  4GXK A;  1ZQU A;  8ICQ A;  2HHX A;  3UPQ A;  2DPI A;  3SV4 A;  3H3A A;  4KN4 A;  9ICG A;  3H8J A;  2ZTD A;  4F91 B;  5J2E A;  5HML A;  3B0X A;  5KFZ A;  4UBC A;  4DF8 A;  1D8L A;  3UXN A;  4JWM A;  4O5C A;  2VAN A;  9ICE A;  3WFQ E;  2BKE A;  3LQC B;  1ZJM A;  4DSI A;  4O5E A;  1KRP A;  1U4B A;  3GDX A;  4B9T A;  3T5K A;  4ECU A;  8ICT A;  1TFR A;  4GC7 A;  3BQ2 A;  4J9R A;  2OWO A;  4DSK A;  1UEU A;  5L9X A;  3GV5 B;  2BGW A;  4AT7 B;  1KSP A;  9ICM A;  4F5Q A;  4X4O A;  1R89 A;  3C1Z A;  5L1K A;  3RJG A;  1DOQ A;  4LVS A;  4KLG A;  3GII A;  3KHL A;  1T8E A;  8ICR A;  4RWQ A;  3ZDE A;  3V72 A;  1U45 A;  1NK9 A;  2ISP A;  4Z6D A;  4ECR A;  3BQ1 A;  4FH5 A;  7ICL A;  3ZD8 A;  1RZT A;  2BPG A;  4MF2 A;  3HP6 A;  3SZ2 A;  4O3Q A;  5JUM A;  4MF8 A;  3JPT A;  4ED2 A;  4LZG A;  9ICP A;  1CUK A;  4QZD A;  5DLF A;  7ICF A;  1K1S A;  4C8O A;  1Z00 B;  3C18 A;  3HIY A;  4FO6 A;  1N56 A;  3ETL A;  4RQ8 A;  4GXI A;  4M9H A;  4R63 A;  4C8K A;  4NLG A;  1KDH A;  1S76 D;  4RQ1 A;  3T5L A;  1Q79 A;  4QZ8 A;  2I1Q A;  1L3T A;  2ID1 A;  4KLE A;  4LZD A;  5J0Y A;  3V7J A;  1U49 A;  9ICQ A;  2ZTC A;  3M9M B;  4ATB B;  4X4P A;  2DVI A;  5J2G A;  5CA7 A;  3GV7 B;  2ZH5 A;  7ICT A;  2HVH A;  1T4G A;  2XGQ A;  5KFT A;  9ICO A;  4WCW A;  3PX4 A;  2M2T A;  2KZM A;  4DS4 A;  2KZ3 A;  7ICH A;  5HRD A;  5HRB A;  5J2F A;  2DRA A;  3E2E A;  1V4A A;  4NM2 A;  5KFM A;  3PR4 A;  2VA2 A;  3MBY A;  4DL2 A;  4DSL A;  3MGH A;  1ZQV A;  4NLN A;  1QTM A;  8ICJ A;  4DL5 A;  4X4Q A;  1UEV A;  1ARO P;  4DQQ A;  2ASJ A;  2BCV A;  5DB7 A;  2PBE A;  2NRW A;  5KFG A;  4B9N A;  4WC6 A;  4WC7 A;  1R8A A;  4YMO A;  2XGP A;  4DQR A;  3T5J A;  4X5V A;  4M0A A;  4QZG A;  5IIJ A;  1KLN A;  3N97 B;  3ZDB A;  3C1Y A;  4J9S A;  4DEZ A;  3M8S A;  1UT8 A;  4J9K A;  4WC5 A;  2GWS A;  3C2L A;  4M6W A;  5DG9 A;  3RBE A;  1F5A A;  3TAR A;  2KN7 A;  1RXW A;  1H38 A;  4KLL A;  5CB1 A;  2NRX A;  3EPI A;  2RFF A;  2HHP A;  2XC9 A;  1UA1 A;  1NK5 A;  2R8H A;  2W9A A;  2B21 A;  4FHW A;  2BCQ A;  4WC0 A;  3MR6 A;  4YR3 A;  3RRH A;  5HRH A;  1EXN A;  3RTV A;  5IIO A;  5KFX A;  4PGY A;  4ECZ A;  2XY6 A;  3PV8 A;  4F4X A;  3PO4 A;  3Q8M A;  3KHH A;  8ICE A;  5KG5 A;  5HRF A;  2Q0Z X;  4PHA A;  1ZQR A;  7ICM A;  2M9N A;  4JK1 A;  4B9U A;  4ECX A;  3SYZ A;  2RDI A;  4PGQ A;  4R66 A;  3ORY A;  3H38 A;  8ICK A;  4NM1 A;  9ICL A;  2V4Q A;  5J2B A;  4AT9 B;  4YXJ A;  3UPS A;  5KFO A;  3C2M A;  2BPC A;  2VA3 A;  1ZQP A;  3PML A;  1XSL A;  3RH5 A;  4YMN A;  2DPJ A;  4MEY A;  1NK0 A;  1ZQM A;  2ALZ A;  4KLH A;  1BPB A;  4KLI A;  3LWM A;  4EP7 A;  3H7I A;  1Z3E B;  5J0W A;  3MDA A;  4QZA A;  1RXV A;  1XC9 A;  2UVU A;  9ICI A;  4EBC A;  7ICK A;  3ISB A;  2BDP A;  1S0M A;  1KFT A;  4S3N A;  4FBU A;  1ZQT A;  8ICC A;  3UQ0 A;  1MQ3 A;  8ICZ A;  1NJZ A;  3JZ0 A;  4UB5 A;  1ZQW A;  5HRE A;  2JZB B;  5KT6 A;  7ICR A;  4R8U A;  1TKD A;  5KFQ A;  5F9N A;  3PNC A;  4KLQ A;  2BCS A;  3KTQ A;  2AQ4 A;  3OUY A;  3KHR A;  1S0V A;  1ZQN A;  4ECY A;  4F2R A;  4ELT A;  1ZQZ A;  4ZH4 A;  5D49 A;  5J0U A;  1UT5 A;  4ECQ A;  3QZ8 A;  1NK8 A;  2PI4 A;  4ED1 A;  1ZQA A;  4RWO A;  1D8Y A;  2JEJ A;  4CCH A;  4B9S A;  3OVS A;  4RWN A;  1WCN A;  2W9C B;  3GQC A;  3EPG A;  5J0O A;  4O3P A;  2MUT B;  2HHW A;  3WFO A;  1BVS A;  1TK8 A;  3GIM A;  5KFL A;  3RJE A;  2HHQ A;  4RNM A;  5KFH A;  4TQR A;  4EBK A;  9ICN A;  4F4W A;  5EWE A;  3OJU A;  4P4O A;  3AU2 A;  5KFI A;  1PX5 A;  3MAB A;  4KLT A;  2ZH3 A;  1SKS A;  4DQI A;  3ISD A;  2W9M A;  4O9M A;  2O1P A;  5J0T A;  3C23 A;  1X9M A;  3BQT A;  4KLM A;  2ZH1 A;  4QZH A;  5KT2 A;  4DLE A;  9ICA A;  4PGX A;  5BPC A;  3EZ5 A;  1TV9 A;  3RR7 A;  4BDP A;  2NRZ A;  4YR2 A;  1TVA A;  1TK5 A;  3ZDD A;  8ICN A;  2IHM A;  1COO A;  1RPL A;  4EYI B;  1U9L A;  5IIN A;  1NJX A;  4KLD A;  3HX0 A;  3UQ2 A;  3RB0 A;  1T7P A;  1L5U A;  1B43 A;  1ZYQ A;  3ZDC A;  2ZH6 A;  1TFW A;  1X9W A;  4NKT A;  4X4V A;  1KFS A;  4RNN A;  4EZ9 A;  4F92 B;  5J29 A;  4PHD A;  4EYH B;  1LB2 B;  4M9L A;  2KTQ A;  4PHP A;  3JPR A;  2ZUC A;  4HYK A;  2C28 A;  1SL0 A;  3V7L A;  1Z00 A;  5EWF A;  4E80 A;  2ZH4 A;  2LYH A;  4FHX A;  4Q44 A;  4XA5 A;  1BPD A;  4QZF A;  3IM1 A;  3TAQ A;  2W8K A;  1WOT A;  2BCR A;  4O3N A;  1YLQ A;  3NGD A;  3L9D A;  4QWD A;  5KG0 A;  4DOB A;  1S0N A;  5KG7 A;  3Q8K A;  1BPZ A;  3H4B A;  2O5A A;  4ATB A;  3JPP A;  3GIL A;  4DWI A;  4XQ7 A;  1ZQO A;  3JYY A;  4M9G A;  3GFK B;  4PHE A;  5IIM A;  1XS9 D;  5EOZ A;  3V6H A;  5J2D A;  4DL4 A;  2ASD A;  1QSL A;  5DGA A;  2A1J B;  8ICB A;  2ZHA A;  1R8B A;  4X4T A;  1IM4 A;  3AQN A;  4BXO A;  2ZH7 A;  5KFA A;  4EZ6 A;  3T5H A;  3JPN A;  4DLG A;  4ELV A;  1HJP A;  4DQS A;  4Q8F A;  2ZHB A;  4YP3 A;  1SL1 A;  1NKB A;  4RQ6 A;  3AQK A;  4UQG A;  4WBZ A;  4F3O A;  4O3O A;  1U48 A;  4O3S A;  4BGD A;  4NLK A;  5DED A;  4DSE A;  5DBB A;  4RZR A;  3AU6 A;  2W9B B;  2R8G A;  4C8M A;  1KNY A;  4QWB A;  2XCA A;  2AU0 A;  2NRV A;  4MFC A;  4Q45 A;  3NYB A;  1R8C A;  3WFP A;  5CWR A;  2DR7 A;  4M47 A;  3FYH A;  3PW4 A;  4Z6E A;  4UB3 A;  2Y1J A;  1MQ2 A;  3BQ0 A;  1XSN A;  4I2D A;  5BOL A;  4AT8 A;  3UXO A;  2ASL A;  1ZQH A;  1V9P A;  1ZQS A;  1QSY A;  1XU4 A;  2IA6 A;  1DGS A;  5KG3 A;  1ZQX A;  2PFO A;  1T3N A;  4F5P A;  5J2J A;  3AQL A;  5KFS A;  3ZD9 A;  4GXJ A;  2C2R A;  4IR1 A;  1SKR A;  1BPE A;  1BNP A;  4M04 A;  1NOM A;  1NO5 A;  2RDJ A;  3V6K A;  3MR5 A;  2R8J A;  2DFL A;  5CP2 A; 
#chains in the Genus database with same CATH topology
 3JPO A;  2DKZ A;  3ALR A;  4US8 A;  5AK6 A;  3GZF A;  1KKX A;  4CE6 A;  2K8B B;  1MC8 A;  1K1Q A;  4BWJ A;  4I2J A;  2IMW P;  4YCX A;  3UMB A;  3OVB A;  3K75 D;  3RB3 A;  4J9N A;  1NK6 A;  4O3M A;  7ICI A;  4PJ0 U;  5KL8 B;  1K5O A;  1ZQE A;  4DL7 A;  4UB2 A;  4NLZ A;  1C7Y A;  3OTQ A;  1NK7 A;  4UD5 A;  4DFD A;  3HW8 A;  2PFN A;  4XRH A;  1X66 A;  3KZX A;  3JPQ A;  1S9F A;  5KNI A;  4RNO A;  3AQM A;  4B6J A;  4M9J A;  2BPF A;  4M2Y A;  4J9Q A;  1MN8 A;  2K4P A;  5KTQ A;  2Y0S C;  5A0L A;  5AI9 A;  5KAI U;  1A0P A;  4FS1 A;  2EH9 A;  3CP8 A;  4I2H A;  2K8A A;  2FLL A;  3C5G A;  3RAQ A;  4P0Q A;  5L1I A;  5HRG A;  5ALG A;  2AGQ A;  1SV4 A;  2FMQ A;  3FDS A;  4JWN A;  1JAL A;  2GAF D;  2W7O A;  3SR6 A;  2K4I A;  4AT7 A;  4JB3 A;  4YQW A;  2ZH8 A;  4X0A A;  7ICJ A;  4J9O A;  4FS2 A;  3C66 A;  2H3Q A;  3OSN A;  5E79 U;  5HRL A;  4NKU A;  2EWR A;  2OEH A;  3UMC A;  3H0L B;  1ECW A;  5KFR A;  9ICS A;  4RU9 A;  2I5H A;  3WK7 A;  5D46 A;  2IHN A;  2XIC A;  1L7P A;  4EBE A;  3RR8 A;  4YD2 A;  2A19 A;  2G5H B;  5DGB A;  2WF5 A;  5CRX A;  4UB4 A;  2LM1 A;  2ZUD A;  2F2A B;  3NVW A;  4UAZ A;  3F5E A;  5ALP A;  4IQT A;  2KD1 A;  4LJX A;  5DDY A;  1HIW A;  2DF4 B;  3M6K A;  4Y2U A;  9ICX A;  1JMS A;  4ECT A;  4X4S A;  1IXR A;  4DSJ A;  3MGV A;  1SL2 A;  1UA0 A;  4PPX A;  5DB6 A;  3NRW A;  2DR8 A;  1ZQ1 C;  3EW9 A;  2MRL A;  1SV0 A;  4RT3 A;  4CGZ A;  1Q3V A;  2FCL A;  4TUR A;  5AI8 A;  3UXP A;  8ICO A;  1SKW A;  1DXS A;  3G6Y A;  4EED A;  8ICI A;  2HHS A;  2ZIX A;  2WHE A;  5HC9 A;  2Y9T A;  3PSF A;  4I0U A;  4IQV A;  4GLX A;  1N63 A;  1YZ6 A;  3IN5 A;  4M5D A;  3NTU A;  1PVR A;  4E0D A;  3IHQ B;  5KFP A;  1C20 A;  4EBJ A;  3BS5 B;  4NL9 A;  3CRX A;  4RPX A;  3A0B U;  3QNM A;  5KT4 A;  1N5X A;  1ZOL A;  1VDV A;  5KFN A;  4G3I A;  3IRU A;  5D63 A;  2LM4 A;  4I29 A;  1PK1 A;  3TAP A;  2P66 A;  3DV9 A;  4DOC A;  5DQI A;  2ZJA A;  2OM6 A;  4NXV A;  4QZE A;  1L3U A;  5HMM A;  5F2V O;  2ZJ8 A;  2KOB A;  2M0N A;  2HBJ A;  4FHY A;  2HBM A;  2HOQ A;  4NXZ A;  5AM5 A;  4EV6 A;  2GOL A;  4UAY A;  1NK4 A;  3TI0 A;  3JCF A;  4O69 A;  2W8L A;  2P6R A;  5J2C A;  3T79 A;  4U6P A;  4RQ2 A;  1QSS A;  2PI5 A;  2QB1 A;  2BQ3 A;  2JEG A;  2HMX A;  4FBT A;  4RPY A;  1RYU A;  3PMN A;  1SZP A;  5HRI A;  3PVX A;  3AUO A;  4R8U B;  4UAW A;  3T3F A;  5KG2 A;  2XCP A;  1CEZ A;  8ICY A;  4NJ8 A;  1NI3 A;  4FZN A;  4KIT B;  5DDM A;  5AI5 A;  4WC3 A;  2DRB A;  2HHV A;  5EE3 A;  4GXK A;  8ICQ A;  2KKP A;  2EQY A;  2ZTD A;  3WFQ E;  4CF3 A;  4P0Q B;  2JHD A;  2F77 X;  4EEN A;  4WQK A;  2RP5 A;  1RQN A;  8ICT A;  3I1Y A;  4GC7 A;  3BQ2 A;  1UEU A;  4AT7 B;  9ICM A;  3C1Z A;  8ICR A;  3RJG A;  4KLG A;  3AM9 A;  3GII A;  3F53 A;  4FH5 A;  3IP4 B;  2WB1 F;  4JMU A;  5G5G A;  2BPG A;  4MF2 A;  5HR7 A;  1SGG A;  2K8C B;  4FO6 A;  3ETL A;  4M9H A;  4OAI Z;  4C8K A;  1KDH A;  2E8P A;  2ID1 A;  1L3T A;  3V7J A;  5J0Y A;  3M9M B;  2DVI A;  2ZH5 A;  4CDG A;  9ICO A;  2M2T A;  4AYB F;  2KZ3 A;  2EAP A;  5HRB A;  3E2E A;  1V4A A;  3K7D A;  3PR4 A;  4DL2 A;  1ZQV A;  4X4Q A;  1ARO P;  5DB7 A;  4EGW A;  2NRW A;  5KFG A;  1R8A A;  2LBO A;  4YMO A;  5AI0 A;  2JGA A;  3C1Y A;  2QB0 A;  3M8S A;  4UAR A;  4J9K A;  2GWS A;  4EEL A;  2NRX A;  3C29 A;  3MR6 A;  3AEV A;  3UMG A;  3RTV A;  4A8E A;  5AIB A;  5AKL A;  5KFX A;  4PGY A;  2XY6 A;  3VC8 A;  4F4X A;  2ZIX B;  1L7M A;  2W43 A;  5ALR A;  4B9U A;  4OJ5 A;  4ECX A;  3SYZ A;  8ICK A;  1VLB A;  4UAS A;  2V4Q A;  5J2B A;  5ALH A;  2ODG A;  5ALI A;  5ALU A;  2KMD A;  2NV3 A;  2DPJ A;  2ALZ A;  2CXY A;  4BUG A;  2HCF A;  3LWM A;  3MDA A;  2KJ5 A;  7ICK A;  4U7C A;  8ICC A;  1NJZ A;  5T14 A;  1ZQW A;  1PK1 B;  3PNC A;  4KLQ A;  3WK9 A;  2BCS A;  3KTQ A;  2AQ4 A;  1ZQN A;  2HSZ A;  5J0U A;  4ECQ A;  1ZQA A;  2JEJ A;  3EPG A;  5AK5 A;  2HHW A;  3WFO A;  1BVS A;  2FDR A;  2HHQ A;  2KHV A;  2WF7 A;  4CF5 A;  2OHF A;  2ZH3 A;  3MAB A;  4KLT A;  2WB1 C;  4DQI A;  3S6J A;  2IOF K;  3FM9 A;  1FIQ A;  5ALL A;  5KT2 A;  3EZ5 A;  5BPC A;  3H38 A;  3WU2 U;  2NRZ A;  4YR2 A;  3ZDD A;  1COO A;  3HX0 A;  5ALJ A;  1L5U A;  4ZOH C;  2E8N A;  4M9L A;  4PHP A;  2C28 A;  3QU9 A;  1SL0 A;  3V7L A;  5ALY A;  3ZI4 A;  4FHX A;  2IOF A;  5ALO A;  4AYB C;  4Q44 A;  1TE2 A;  3ONN A;  3IDW A;  4NXW A;  4PL1 A;  2BCR A;  1YLQ A;  3MCR A;  1BPZ A;  1V85 A;  1DRG A;  2LI6 A;  1F0M A;  4DL4 A;  3KKA A;  2A1J B;  2ZHA A;  2JXJ A;  3AQN A;  5KFA A;  4EZ6 A;  5J8Y C;  3T5H A;  4Q8F A;  1NKB A;  1V97 A;  4RQ6 A;  4UQG A;  4WBZ A;  1UPH A;  4K98 A;  2R8G A;  2W9B B;  1KNY A;  5AI6 A;  2NRV A;  1P7D A;  2EZY A;  2Y9U A;  4UB3 A;  4WJ3 B;  5BOL A;  4AT8 A;  2EAM A;  1XU4 A;  3WK5 A;  5KFS A;  1SKR A;  4NLC A;  1NOM A;  2HN1 A;  2RDJ A;  1Q8K A;  2YY6 A;  5CP2 A;  2AGO A;  2YTU A;  3L3F X;  2F8L A;  3O0F A;  2BZF A;  2FMP A;  4ELU A;  4WBY A;  5HNK A;  2UVV A;  5J2I A;  3M8R A;  4RUA A;  4M9N A;  4FH3 A;  2LHT A;  3HT3 A;  4KLS A;  5KT7 A;  4TUP A;  4AT9 A;  2DR5 A;  2UVR A;  4RQM A;  2VA8 A;  3AQE A;  5KFY A;  3EYZ A;  5KG4 A;  4ECW A;  5AK3 A;  1X9X A;  3LVV A;  2QB0 B;  3G6X A;  4J9P A;  2AJQ A;  4WOY A;  2WF6 A;  4P4P A;  9ICH A;  4K4H A;  3SV3 A;  4J9L A;  3ER9 B;  5DG8 A;  3LDA A;  4QWA A;  4C4T A;  4ED3 A;  2ISO A;  5KT5 A;  4O5C A;  2H3F A;  1HEK A;  1D9F A;  3LVW A;  9ICR A;  2MAX A;  9ICF A;  2UVW A;  7ICE A;  5KFK A;  4FHV A;  8ICV A;  1N2X A;  2V4R A;  4ECS A;  2F44 A;  4I2B A;  2KFZ A;  1L8L A;  4QWC A;  1O03 A;  5DB9 A;  4KX5 A;  5J2K A;  4G9B A;  5TIS U;  1X9S A;  2RRD A;  3TAC B;  1IIP A;  3PX0 A;  4ED8 A;  9ICC A;  4I2C A;  2Y0S F;  3GIJ A;  2GLE A;  3PW2 A;  2NO5 A;  3WFR E;  3NRZ A;  5AM4 A;  3N7S C;  2VIX A;  2YX8 A;  4YG2 A;  2NRT A;  4QZB A;  5GTI U;  1SB3 C;  5KFE A;  4LEZ A;  1TFY A;  2JV3 A;  2HW3 A;  3TAD A;  5AHX A;  4YXM A;  2KIC A;  4UBB A;  1NJW A;  1JN3 A;  4RQN A;  1L8O A;  3NUQ A;  4Y2V A;  4C80 A;  2BQR A;  4F4K A;  1NKE A;  4NV0 A;  1ZQK A;  3CW2 C;  4F4Y A;  4RPZ A;  3RB4 A;  1ZQF A;  3ISC A;  4OAG A;  1NZP A;  1WUD A;  2YMP A;  2FMS A;  7ICU A;  2OYY A;  2JEF A;  2HDO A;  5III A;  3MFI A;  4F5N A;  2FPM A;  1MA7 A;  3OJS A;  4FE3 A;  4MEX A;  3TKA A;  4F5R A;  2R18 A;  1VJ5 A;  3RJK A;  1RM6 C;  1JQR A;  4NY8 A;  8ICZ A;  4DL6 A;  5C5J A;  5EWG A;  2B4V A;  2J6S A;  2BE3 A;  3CNH A;  4DO9 A;  2NRK A;  4K97 A;  3N7P D;  4JV2 A;  4AT8 B;  1N60 A;  4R64 A;  4QIW F;  3THV A;  1MIW A;  5KL1 B;  1XO1 A;  4EX7 A;  4FFD A;  3BDP A;  2HHU A;  2BHN A;  1Y88 A;  2F1I A;  7ICS A;  3OHA A;  2JH1 A;  4C4S A;  1Q78 A;  3MDC A;  1KTQ A;  3N28 A;  2R8I A;  3FAH A;  9ICB A;  3M9N B;  3M9O B;  5G5H A;  4I2E A;  4DFK A;  5HR9 A;  1JXE A;  5DQG A;  2ZJ5 A;  4Z6F A;  3Q8Q B;  4OAH A;  3E58 A;  2FLP A;  2H3Z A;  2MUT A;  1KBU A;  4S3N A;  5DLG A;  2DGZ A;  3QUT A;  5CJ7 A;  3RB6 A;  3OGU A;  2ZH2 A;  1ZRM A;  3QYP A;  1ZQI A;  3OSP A;  5C0Y A;  3QEA Z;  4KTQ A;  5D61 A;  2Q66 A;  4FO1 A;  5AM0 A;  3H40 A;  3TAN A;  3QEB Z;  2KK0 A;  5KFV A;  5KAF U;  3OUY B;  2BR0 A;  3WFS C;  3H8S A;  4EEB A;  7ICN A;  4TUS A;  2W3S A;  3H3A A;  4KN4 A;  3H8J A;  5HML A;  4UBC A;  1D8L A;  4UB8 U;  2VAN A;  3LQC B;  1ZJM A;  2WAQ F;  1DGJ A;  2OWO A;  5L9X A;  3GV5 B;  1KSP A;  1OXJ A;  1T8E A;  3KHL A;  4RWQ A;  2RLT A;  4ECR A;  2CRX A;  3ZD8 A;  1RZT A;  2EAO A;  1Z4N A;  3HP6 A;  4MF8 A;  2I6X A;  1B0X A;  4ED2 A;  4LZG A;  4C8O A;  1Z00 B;  3HIY A;  4Y2S A;  4RQ8 A;  3F2C A;  1WYG A;  5AKJ A;  1Q79 A;  5ALF A;  2I1Q A;  3R9K A;  4EX6 A;  4KLE A;  4ATB B;  4C7Y A;  5J2G A;  2HVH A;  1T4G A;  2YMM A;  2KZM A;  4DS4 A;  4QIW C;  2CPR A;  5HRD A;  2DRA A;  4NM2 A;  2VA2 A;  4OJ6 A;  5H2F U;  4DL5 A;  3J81 j;  4NL9 C;  2XGP A;  5IIJ A;  1KLN A;  3ZDB A;  4WC5 A;  1F5A A;  5DG9 A;  2EAN A;  3TAR A;  1RXW A;  1H38 A;  2OH2 A;  4KLL A;  4OCZ A;  3EPI A;  1UA1 A;  1NK5 A;  2R8H A;  4LEY A;  2HN2 A;  4FHW A;  1EXN A;  4ECZ A;  4UW9 A;  4O67 A;  1JRP A;  3PST A;  1JRO A;  4PHA A;  1ZQR A;  4Y2Y A;  4PGQ A;  3UPS A;  1J97 A;  2JR5 A;  2AH5 A;  1XSL A;  1ZQP A;  4MEY A;  1SIJ A;  1ZQM A;  4KLH A;  2JMG A;  5AKI A;  4EP7 A;  3H7I A;  1RXV A;  9ICI A;  4NWI A;  3KOO A;  2BDP A;  1S0M A;  4FBU A;  3VCB A;  4XJE A;  3L4P A;  1TKD A;  2K60 A;  2JH7 A;  5KFQ A;  2JRZ A;  1KL9 A;  5ALN A;  3KHR A;  4Y2R A;  1S0V A;  1DK3 A;  4F2R A;  4ELT A;  2WAQ C;  4ZH4 A;  1UT5 A;  2PI4 A;  5HR6 A;  3QUB A;  1LKY A;  3GQC A;  2MUT B;  5CFU A;  3GIM A;  4OAF A;  3OJU A;  5AKG A;  1SKS A;  2O1P A;  5J0T A;  1X9M A;  3BQT A;  4KLM A;  2ZH1 A;  4N7R A;  9ICA A;  5ALW A;  4PGX A;  1TV9 A;  3RR7 A;  4KM5 A;  1TK5 A;  2IHM A;  4K9A A;  1PVP A;  1U9L A;  4KX3 A;  5IIN A;  4KLD A;  1B43 A;  1ZYQ A;  2L5Y A;  3ZDC A;  4QNL A;  1X9W A;  2QLT A;  4X4V A;  3RFA A;  1KFS A;  4EZ9 A;  5J29 A;  4PHD A;  3JPR A;  2H3I A;  4E80 A;  2LYH A;  2YMQ A;  1BPD A;  4QZF A;  3IM1 A;  3TAQ A;  1WOT A;  4O3N A;  3N7R C;  3NGD A;  4DOB A;  3Q8K A;  3H4B A;  3GIL A;  1ZQO A;  3JYY A;  3IV6 A;  4PHE A;  2MU2 A;  5IIM A;  1XS9 D;  5EOZ A;  1FFV A;  3KD3 A;  2MA1 A;  1QSL A;  2NO4 A;  2CN1 A;  4PZN A;  5CEH A;  3C28 A;  4BXO A;  2ZH7 A;  2W3R A;  3NVO A;  4IC9 A;  3AQK A;  1WG8 A;  4F3O A;  1U48 A;  4O3S A;  4BGD A;  1SXE A;  4DSE A;  4FZL A;  4QWB A;  2XCA A;  2E1E A;  2DR7 A;  4Q45 A;  1UCV A;  1R8C A;  5CWR A;  1PK3 A;  3FYH A;  5GTH U;  4Z6E A;  2Y1J A;  1MQ2 A;  2DUY A;  3UXO A;  1T94 A;  5ALQ A;  1QSY A;  1ZD4 A;  2IA6 A;  1ZQX A;  4F5P A;  5J2J A;  1QH9 A;  4M04 A;  3V6K A;  2XID A;  2PXI A;  2HVI A;  3M1Y A;  1QLN A;  4I2A A;  2LYB A;  2XY5 A;  8ICU A;  2KZZ A;  3QU5 A;  2C2D A;  2AXT U;  4Q43 A;  3RJF A;  2H5X A;  3PW5 A;  5DKW A;  2B0C A;  2QAR A;  3PW7 A;  4R65 A;  2LYA A;  3PX6 A;  8ICW A;  4LT6 A;  2I9G A;  3H4D A;  5IIK A;  4JV0 A;  4P4M A;  1Q3U A;  2GA9 D;  5CFT A;  5J0Q A;  4QZC A;  3BJY A;  4F50 A;  3MFH A;  4DFM A;  2W11 A;  3SQI A;  3GV8 B;  3C2K A;  1KEJ A;  1XWL A;  2W9C A;  5L1L A;  2PFQ A;  4QW8 A;  3RH4 A;  1A76 A;  3TFS A;  2F76 X;  5KFU A;  1JX4 A;  4RQ3 A;  2XO7 A;  8ICM A;  4X0B A;  3BZK A;  4I28 A;  2FPL A;  5DB8 A;  1MIY A;  1VJ7 A;  5B5E U;  4DFJ A;  4KN7 A;  4RQ0 A;  1QQ6 A;  4TQS A;  1BPX A;  3TQ1 A;  1X42 A;  4ED0 A;  5KFB A;  3AN1 A;  4USA A;  3Q8R B;  3H39 A;  3WK4 A;  7ICV A;  4OJL A;  2B56 A;  2HI0 A;  4IRD A;  3OWG A;  2E8O A;  4GC6 A;  4LEW A;  4CRX A;  1LKY B;  1NKC A;  2KE7 A;  4I2G A;  4X4N A;  2FI1 A;  2P6U A;  4OJO A;  1OUQ A;  1FA0 A;  2G09 A;  1ZQL A;  3HPO A;  4C7Z A;  4IS7 A;  3EF2 A;  2F1J A;  4QW9 A;  4DL3 A;  2C22 A;  5AIC A;  4IQW A;  5D62 A;  4IQU A;  7ICO A;  5J0X A;  4MFA A;  2Z7J A;  4F93 B;  3OPX A;  4WC4 A;  3PHZ A;  5KG1 A;  3SAG A;  4QWE A;  1BNO A;  1JIH A;  3RJI A;  4JV1 A;  5BOM A;  4WC2 A;  3CK6 A;  4I27 A;  1S10 A;  5J0P A;  1RDF A;  3PW0 A;  2FLN A;  1TK0 A;  2M2U A;  2GH1 A;  1WCL A;  3SEN A;  3PR5 B;  1L7O A;  1N62 A;  3RRG A;  1OW5 A;  2YB4 A;  1S0O A;  4F5O A;  2E5S A;  1LV5 A;  3OV7 A;  3Q8S B;  1D9D A;  4BXO B;  1ZQD A;  1TAQ A;  4IR9 A;  5J2A A;  3MR3 A;  1S77 D;  4UAV A;  8ICS A;  5F9L A;  3LWL A;  2JEI A;  2DKX A;  3K1R B;  4Y2P A;  5HP4 A;  2ZUB A;  2D8C A;  1SXD A;  5JTI A;  3PO5 A;  1ZQG A;  5J8Y A;  5TZV A;  4O6A A;  1OU5 A;  2AQ0 A;  3H8W A;  4YMM A;  2G08 A;  4NXX A;  4Y2Q A;  3KZI U;  5KFC A;  4KMO B;  1TAM A;  3KHG A;  4O0I A;  4B9M A;  5J0R A;  2BQU A;  1S8O A;  2N1R A;  2J6T A;  4YN4 A;  4ECV A;  1B22 A;  4JLZ A;  4Z6C A;  4WC1 A;  4HAI A;  1X2I A;  3V6J A;  1X6I A;  2KIV A;  3ZDA A;  4P0P A;  4IRC A;  2WTF A;  3RJH A;  5L1J A;  5D4B A;  1UQV A;  5KFJ A;  2DBY A;  4UAT A;  4TUQ A;  8ICA A;  1RYR A;  1VFG A;  2HBL A;  2E8M A;  9ICV A;  3QE9 Y;  2V9W A;  8ICP A;  5AKX A;  5AM3 A;  3HJE A;  2DR9 A;  4C8N A;  1X40 A;  3NVV A;  2GO7 A;  1A77 A;  4FZM A;  3C5F A;  4F4Z A;  1KQQ A;  4RT2 A;  4IL6 U;  4HX0 A;  3U26 A;  1ZQY A;  4DF4 A;  2KP7 A;  4EEY A;  1ZD3 A;  3UPQ A;  2DPI A;  3WKC A;  2KSO A;  9ICG A;  5F3X B;  4F91 B;  5J2E A;  4DF8 A;  5KFZ A;  4JWM A;  3UXN A;  2BKE A;  3MC1 A;  4DSI A;  4O5E A;  1KRP A;  3H0M B;  3AMZ A;  1U4B A;  3WKA A;  3GDX A;  4B9T A;  5EE1 A;  3T5K A;  1TFR A;  4DSK A;  3NS1 A;  3D2Q A;  4X4O A;  4F5Q A;  1R89 A;  1DOQ A;  2E3T A;  3V72 A;  1U45 A;  4F72 A;  7ICL A;  5FP0 A;  5AM2 A;  1GO3 F;  1CUK A;  4QZD A;  5DLF A;  7ICF A;  3C18 A;  1N56 A;  2ZIV A;  2IHO A;  1S76 D;  4RQ1 A;  3T5L A;  9ICQ A;  4PL2 A;  5CA7 A;  1RG6 A;  2XGQ A;  3DDH A;  1XO0 A;  5JTG A;  5KFM A;  4NLN A;  3AQF A;  1QTM A;  5ALK A;  1SWW A;  4DQQ A;  2VKQ A;  2PBE A;  4DCC A;  2DL0 A;  4WC7 A;  3ED5 A;  1ZRN A;  3GU3 A;  4DQR A;  1NNL A;  3T5J A;  4M0A A;  3BS5 A;  4QZG A;  3F5A A;  1UT8 A;  3C2L A;  4M6W A;  3RBE A;  5CB1 A;  2RFF A;  2XC9 A;  2HOF A;  4AP9 A;  4WC0 A;  2BCQ A;  4YR3 A;  3RRH A;  5IIO A;  3PO4 A;  8ICE A;  5KG5 A;  3SD7 A;  2M9N A;  4JK1 A;  4R66 A;  2B6G A;  2EZZ A;  4NM1 A;  9ICL A;  4AT9 B;  4YXJ A;  4MHV A;  2KJ9 A;  2BPC A;  2VA3 A;  3PML A;  5ALV A;  4YMN A;  2KVS A;  2F8K A;  5JU5 A;  4GIB A;  1Z3E B;  3F2D A;  5CFS A;  1MQ3 A;  3JZ0 A;  4UB5 A;  5AKE A;  3QXG A;  3HKZ C;  4R8U A;  5F9N A;  2KV2 A;  4O68 A;  1NK8 A;  3QZ8 A;  4NXU A;  4RWN A;  1D8Y A;  4CCH A;  4B9S A;  5J0O A;  4P0P B;  3E0F A;  2W03 A;  3RJE A;  5KFH A;  4EBK A;  1PX5 A;  1QCK A;  3NWI A;  3C23 A;  4QZH A;  3BZC A;  1XNS A;  3UM9 A;  1TVA A;  8ICN A;  1S5L U;  4EYI B;  2G0A A;  3UQ2 A;  3RB0 A;  3D2N A;  2ZH6 A;  1TFW A;  2KEY A;  1JI7 A;  2O6K A;  1RQL A;  5AKZ A;  4RNN A;  4EYH B;  1X6J A;  4ACO A;  4XA5 A;  2KNJ A;  2DQN B;  3PZP A;  1SV0 C;  2W8K A;  2KSO B;  3L9D A;  4QWD A;  5KG0 A;  2DWQ A;  1Z19 A;  5KG7 A;  1S0N A;  1JUD A;  4DWI A;  4M9G A;  3GFK B;  3WK6 A;  2RQ5 A;  2ES6 A;  3ERC C;  5J2D A;  5DGA A;  4X4T A;  1IM4 A;  4QJF B;  1WWV A;  4ELV A;  4DQS A;  2ZHB A;  4YP3 A;  1SL1 A;  2K89 A;  5DBB A;  4C8M A;  2AU0 A;  3NYB A;  3WFP A;  3B9J A;  3PSI A;  5B3P A;  2ZIV B;  1ED1 A;  3RF9 A;  4Y2T A;  1ZQH A;  1DGS A;  5KG3 A;  1T3N A;  3ZD9 A;  2C2R A;  3NVZ A;  1NO5 A;  3MR5 A;  1J2N A;  4C0Z A;  2R8J A;  2F1H A;  4F2S A;  5L1M A;  4FHP A;  1ZQQ A;  4E7X A;  3RH6 A;  5DQH A;  1RYS A;  3NVY A;  4B9V A;  4NKT A;  3QX7 A;  1ZXI A;  1ZQC A;  1TAU A;  3LYS A;  4DS5 A;  4QZ9 A;  1UET A;  2J6U A;  4X4R A;  4YVZ A;  4RQ5 A;  5CHE A;  4M6W B;  7ICG A;  3LK9 A;  8ICX A;  1NZB A;  1KFD A;  3MGI A;  1XSP A;  2H3V A;  2KG5 A;  2ZH9 A;  1ZQJ A;  5DEC A;  4BWM A;  9ICK A;  2ATL A;  2KKV A;  9ICU A;  1T3Q A;  3WKE A;  5J2H A;  4IG8 A;  2HBK A;  2R8K A;  8ICL A;  1JAJ A;  3RAX A;  2A3V A;  2IUB A;  2KJ8 A;  1L3V A;  2ZTE A;  4YFK A;  4I2F A;  4DSF A;  4KB6 A;  8ICH A;  5J0S A;  1ZJN A;  4Y2J A;  2E1F A;  4P2H A;  2W55 A;  3HJ4 A;  4Q8E A;  3PY8 A;  4GFJ A;  3G6V A;  4RQ7 A;  2IOH A;  3EUB 2;  5KT3 A;  4MFF A;  3HJ1 A;  3RBD A;  2EDU A;  3WK8 A;  5DBA A;  1BGX T;  5AKK A;  1YZ7 A;  1SZH A;  8ICF A;  1U47 A;  4ED6 A;  5AK4 A;  3SMV A;  4F8R A;  5ALT A;  5KFW A;  1MIV A;  4I2I A;  5KFD A;  4Y2X A;  5HHI A;  4XUS A;  3IG5 A;  2WFA A;  5CR0 A;  2Q4T A;  4PH5 A;  9ICJ A;  4DOA A;  5KG6 A;  4C4R A;  1L6N A;  3OVA A;  4X4U A;  3ETR A;  1MSW D;  3JPS A;  5ALS A;  1DK2 A;  2NYV A;  2KFN A;  2A1J A;  5ALE A;  3QZ7 A;  4KLU A;  1AQ6 A;  4UAU A;  4EBD A;  1B4F A;  5B3Q A;  8ICG A;  4RUC A;  3RJJ A;  4RWP A;  1NJY A;  2W9B A;  1JXL A;  2WF8 A;  4E8F A;  3DEE A;  1J2M A;  2RHF A;  3I76 A;  4WH5 A;  1IV8 A;  2LPE A;  4K4G A;  2AGP A;  3K4G A;  2IBK A;  4UB1 A;  4B9L A;  2ZIW A;  7ICP A;  3IG8 A;  3B0Y A;  3WKB A;  2HHT A;  3Q8P B;  4XQ8 A;  4O5K A;  3SI8 A;  1FO4 A;  3D6J A;  5CHG A;  4KLO A;  4JLX A;  4QZI A;  2M2W A;  2BCU A;  4KLF A;  5HRK A;  4KMU A;  5AKY A;  1IG6 A;  5KFF A;  1N48 A;  2Y1I A;  1L3S A;  3EWA A;  3M7D A;  2M2V A;  3HIL A;  1D8B A;  2FJ6 A;  1HUZ A;  3NKU A;  5ALM A;  1ZET A;  3QU4 A;  1HUO A;  1M6Y A;  3H37 A;  3QU2 A;  4NLB A;  3Q8L A;  3BS7 A;  2G06 A;  5ALD A;  1BPY A;  9ICW A;  2FPK A;  3ICX A;  4ED7 A;  4NXT A;  2ESE A;  1ZD2 P;  4CNQ A;  2JZB A;  3MR2 A;  5IIL A;  4DQP A;  4O3R A;  3KFU F;  2F3N A;  2KHQ A;  5EE0 A;  2G07 A;  1PZN A;  2D3D A;  5AI4 A;  4UD4 A;  4JUZ A;  1S97 A;  4YR0 A;  4DFP A;  1ZQB A;  4YD1 A;  1YT3 A;  2C2E A;  4KLJ A;  2PFP A;  3OHB A;  4C8L A;  3TFR A;  2XVT A;  2XY7 A;  5DBC A;  3V7K A;  3C21 A;  5B66 U;  5DG7 A;  2FE9 A;  4K4I A;  1ZD5 A;  3QU7 A;  3HWT A;  2WF9 A;  1N61 A;  4J9M A;  2BBH A;  2YQE A;  2AHO B;  4CF4 A;  3I28 A;  2K4H A;  3N4M B;  4IRK A;  7ICQ A;  2B51 A;  9ICT A;  3GIK A;  4UB6 U;  2PKE A;  1L7N A;  4RQ4 A;  5HHH A;  1ZQU A;  2HHX A;  3SV4 A;  3H0R B;  3KKA C;  3B0X A;  9ICE A;  2ZIU A;  1UHU A;  4ECU A;  4J9R A;  2ZXH A;  2BGW A;  2HOI A;  5L1K A;  4LVS A;  3WKD A;  3QUQ A;  3ZDE A;  1NK9 A;  2ISP A;  4Z6D A;  3BQ1 A;  3PSP A;  3SZ2 A;  4O3Q A;  5JUM A;  3JPT A;  1FFU A;  9ICP A;  4OD0 A;  1K1S A;  4PZO A;  2YML A;  4BJQ A;  4GXI A;  4R63 A;  2G5I B;  4NLG A;  4K96 A;  4QZ8 A;  5JRT A;  4LZD A;  1U49 A;  2ZTC A;  2KIW A;  4X4P A;  4OJP A;  3KBB A;  3GV7 B;  7ICT A;  5KFT A;  2PMZ F;  3PX4 A;  4WCW A;  4F71 A;  7ICH A;  2YB1 A;  5J2F A;  5ALZ A;  3MBY A;  4DSL A;  3MGH A;  8ICJ A;  1UEV A;  2ASJ A;  2OXO A;  2BCV A;  4B9N A;  4WC6 A;  2BDU A;  2ZG6 A;  1LVH A;  1A6S A;  1F44 A;  2W54 A;  4X5V A;  4BX9 C;  3N97 B;  3SAH A;  4J9S A;  4DEZ A;  2ZIW B;  2KN7 A;  3BQ7 A;  2HHP A;  5AIA A;  3A0H U;  5AKH A;  2W9A A;  2B21 A;  1QQ5 A;  1KW4 A;  5HRH A;  1Z1V A;  2YN4 A;  3SAF A;  3PV8 A;  4WQL A;  2ZXI A;  4K9B A;  3Q8M A;  3KHH A;  5HRF A;  2Q0Z X;  2EZX A;  7ICM A;  2LMR A;  2KVC A;  2RDI A;  3H8M A;  3D2S A;  3ORY A;  1CI4 A;  2BBJ A;  5KFO A;  3C2M A;  2W04 A;  2QAR B;  3RH5 A;  1NK0 A;  1BPB A;  4KLI A;  5ALX A;  5J0W A;  4QZA A;  1XC9 A;  2UVU A;  4EBC A;  1PUZ A;  3ISB A;  2A1A A;  3K1Z A;  1KFT A;  4US9 A;  1ZQT A;  3UQ0 A;  1WWU A;  1F5S A;  5HRE A;  2JZB B;  5KT6 A;  7ICR A;  3CYM A;  4ICA A;  2MSN A;  1FEZ A;  3OUY A;  1URJ A;  2P35 A;  4ECY A;  1ZQZ A;  5D49 A;  4ED1 A;  4EEK A;  4RWO A;  2K4E A;  3ER8 C;  3OVS A;  1WCN A;  3TAD C;  2W9C B;  4O3P A;  1TK8 A;  5KFL A;  4RNM A;  4TQR A;  9ICN A;  4F4W A;  5EWE A;  4P4O A;  3AU2 A;  5KFI A;  3ISD A;  2W9M A;  4O9M A;  3HKZ F;  1N5W A;  3F2B A;  4DLE A;  4BDP A;  5AM1 A;  5EE9 A;  1RPL A;  1NJX A;  1T7P A;  2XI9 A;  3M6Z A;  1CRX A;  5K4L A;  1SWV A;  2VJ5 A;  2OCE A;  4F92 B;  1LB2 B;  2KTQ A;  1QQ7 A;  2ZUC A;  4HYK A;  3L5K A;  2PMZ C;  5EWF A;  1Z00 A;  2ZH4 A;  1PVQ A;  1O08 A;  4K99 A;  1GPJ A;  1KN5 A;  2O5A A;  4ATB A;  2ZIU B;  3JPP A;  4XQ7 A;  3V6H A;  2ASD A;  3SEI A;  3NAS A;  8ICB A;  1R8B A;  3FC4 A;  4OO1 J;  3JPN A;  4DLG A;  1HJP A;  4LEV A;  5DED A;  1Z1B A;  4O3O A;  4NLK A;  2QKQ A;  2VJ4 A;  4RZR A;  3AU6 A;  1Q46 A;  4MFC A;  2D6F C;  4M47 A;  3PW4 A;  3HRD D;  4MKP A;  3BQ0 A;  1XSN A;  4I2D A;  2LKY A;  2ASL A;  1COK A;  1V9P A;  1ZQS A;  2W7P A;  2PFO A;  1Z4O A;  3AQL A;  4GXJ A;  4IR1 A;  3AL0 B;  4K8V A;  1BPE A;  3QUC A;  1BNP A;  4J03 A;  1V38 A;  2DFL A; 
#chains in the Genus database with same CATH homology
 4F2S A;  2PXI A;  2AGO A;  3JPO A;  2HVI A;  4ELU A;  2FMP A;  1QLN A;  4FHP A;  1ZQQ A;  4E7X A;  3RH6 A;  4NY8 A;  5HNK A;  2UVV A;  4WBY A;  5DQH A;  5J2I A;  3M8R A;  2XY5 A;  4RUA A;  1RYS A;  4I2A A;  4M9N A;  2KZZ A;  8ICU A;  2C2D A;  4FH3 A;  4X4S A;  4Q43 A;  3HT3 A;  4KLS A;  1MC8 A;  3RJF A;  2H5X A;  1K1Q A;  4BWJ A;  4I2J A;  5KT7 A;  4YCX A;  4TUP A;  2IMW P;  3PW5 A;  4B9V A;  4DSJ A;  4AT9 A;  2DR5 A;  2UVR A;  5DKW A;  2VA8 A;  3OVB A;  3K75 D;  5KFY A;  3EYZ A;  3RB3 A;  1ZQC A;  4J9N A;  1NK6 A;  3PW7 A;  7ICI A;  1TAU A;  5KG4 A;  4R65 A;  3PX6 A;  1ZQE A;  4DS5 A;  4QZ9 A;  4ECW A;  8ICW A;  2J6U A;  1UET A;  4LT6 A;  2I9G A;  4DL7 A;  4X4R A;  4YVZ A;  4UB2 A;  3G6X A;  1C7Y A;  4RQ5 A;  4NLZ A;  4M6W B;  4J9P A;  3H4D A;  5IIK A;  3LK9 A;  1NK7 A;  7ICG A;  2AJQ A;  8ICX A;  4JV0 A;  4UD5 A;  1KFD A;  4P4M A;  3MGI A;  1XSP A;  2ZH9 A;  3HW8 A;  2PFN A;  1ZQJ A;  4XRH A;  4BWM A;  9ICK A;  2ATL A;  5DEC A;  9ICU A;  5J2H A;  4P4P A;  4IG8 A;  3JPQ A;  1S9F A;  4K4H A;  9ICH A;  5J0Q A;  4RNO A;  3SV3 A;  2R8K A;  4QZC A;  4J9L A;  8ICL A;  1JAJ A;  5DG8 A;  3AQM A;  3LDA A;  3BJY A;  3RAX A;  4QWA A;  2F1H A;  4F50 A;  3MFH A;  4DFM A;  4M9J A;  4ED3 A;  2ISO A;  3GV8 B;  2BPF A;  3C2K A;  1L3V A;  1KEJ A;  1XWL A;  2ZTE A;  4YFK A;  5KT5 A;  2W9C A;  5L1L A;  4DSF A;  2PFQ A;  4I2F A;  5J0S A;  1ZJN A;  8ICH A;  4QW8 A;  3RH4 A;  4P2H A;  1A76 A;  4J9Q A;  3TFS A;  1D9F A;  5KFU A;  1JX4 A;  4Q8E A;  3PY8 A;  4RQ3 A;  3HJ4 A;  3G6V A;  4RQ7 A;  5KTQ A;  2XO7 A;  8ICM A;  4X0B A;  9ICR A;  2MAX A;  5KT3 A;  4M2Y A;  9ICF A;  2UVW A;  4MFF A;  4I28 A;  3HJ1 A;  2FPL A;  4FS1 A;  7ICE A;  3RBD A;  5KFK A;  5DBA A;  4FHV A;  5DB8 A;  8ICV A;  1MIY A;  2V4R A;  4ECS A;  4I2H A;  1VJ7 A;  1BGX T;  4I2B A;  2FLL A;  4QWC A;  2KFZ A;  5DB9 A;  3C5G A;  4DFJ A;  4KN7 A;  4RQ0 A;  5L1I A;  4TQS A;  3RAQ A;  1BPX A;  5J2K A;  3TQ1 A;  5HRG A;  2AGQ A;  1X9S A;  8ICF A;  4ED0 A;  1U47 A;  2FMQ A;  5KFB A;  3FDS A;  4JWN A;  3PX0 A;  3Q8R B;  4ED8 A;  9ICC A;  4ED6 A;  3H39 A;  7ICV A;  4I2C A;  4F8R A;  4AT7 A;  4YQW A;  5KFW A;  1MIV A;  2ZH8 A;  4I2I A;  4X0A A;  4IRD A;  5KFD A;  7ICJ A;  4J9O A;  3GIJ A;  3PW2 A;  4FS2 A;  3C66 A;  4GC6 A;  3WFR E;  5HHI A;  4XUS A;  5CR0 A;  3OSN A;  1NKC A;  9ICJ A;  4PH5 A;  4I2G A;  4DOA A;  4X4N A;  2P6U A;  5HRL A;  4NKU A;  4YG2 A;  5KG6 A;  1FA0 A;  2NRT A;  4QZB A;  5KFE A;  3OVA A;  1TFY A;  4X4U A;  5KFR A;  9ICS A;  1ZQL A;  4RU9 A;  3HPO A;  2HW3 A;  1MSW D;  3JPS A;  4YXM A;  5D46 A;  2IHN A;  1NJW A;  4UBB A;  1DK2 A;  1JN3 A;  2F1J A;  4QW9 A;  4EBE A;  3RR8 A;  4YD2 A;  5DGB A;  4DL3 A;  2KFN A;  4UB4 A;  2A1J A;  2C22 A;  4IQW A;  3QZ7 A;  4IQU A;  7ICO A;  2ZUD A;  4KLU A;  5J0X A;  4MFA A;  2BQR A;  4F4K A;  8ICI A;  4F93 B;  1NKE A;  1ZQK A;  4EBD A;  1DK3 A;  4WC4 A;  4UAZ A;  5KG1 A;  4F4Y A;  4IQT A;  4RPZ A;  8ICG A;  4RUC A;  4QWE A;  3RB4 A;  1ZQF A;  3RJJ A;  1NJY A;  1BNO A;  4RWP A;  1JIH A;  5DDY A;  3ISC A;  2W9B A;  3RJI A;  1JXL A;  4JV1 A;  4E8F A;  1NZP A;  5BOM A;  4WC2 A;  2FMS A;  4I27 A;  2JEF A;  1S10 A;  5J0P A;  7ICU A;  9ICX A;  1JMS A;  4ECT A;  5III A;  1IXR A;  3K4G A;  3MFI A;  2AGP A;  3PW0 A;  1SL2 A;  4UB1 A;  2FPM A;  4F5N A;  2FLN A;  2IBK A;  1UA0 A;  4B9L A;  4PPX A;  5DB6 A;  7ICP A;  3OJS A;  2DR8 A;  3EW9 A;  1TK0 A;  2M2U A;  3B0Y A;  2HHT A;  1WCL A;  4RT3 A;  3PR5 B;  3Q8P B;  4MEX A;  4XQ8 A;  4O5K A;  3RRG A;  3SI8 A;  4F5R A;  1S0O A;  5CHG A;  4F5O A;  4TUR A;  1LV5 A;  4KLO A;  3UXP A;  4QZI A;  3RJK A;  2M2W A;  3OV7 A;  8ICO A;  1SKW A;  3G6Y A;  3Q8S B;  1JQR A;  2BCU A;  1D9D A;  4BXO B;  4KLF A;  1ZQD A;  1TAQ A;  4IR9 A;  5J2A A;  4KMU A;  4DL6 A;  3MR3 A;  1S77 D;  2HHS A;  5HRK A;  8ICS A;  5F9L A;  5C5J A;  3LWL A;  5KFF A;  1N48 A;  5EWG A;  2Y1I A;  2JEI A;  5HC9 A;  2J6S A;  5HP4 A;  1L3S A;  2ZUB A;  3EWA A;  4IQV A;  4GLX A;  2M2V A;  2BE3 A;  1HUZ A;  4DO9 A;  3PO5 A;  1ZQG A;  2NRK A;  1ZET A;  4JV2 A;  1HUO A;  5TZV A;  4M5D A;  3NTU A;  3H37 A;  4AT8 B;  4E0D A;  1OU5 A;  4R64 A;  3IHQ B;  5KFP A;  2AQ0 A;  4EBJ A;  3H8W A;  3THV A;  4YMM A;  3Q8L A;  1MIW A;  5KFC A;  4RPX A;  1XO1 A;  5KT4 A;  3BDP A;  2HHU A;  1BPY A;  2BHN A;  1Y88 A;  9ICW A;  2F1I A;  2FPK A;  3KHG A;  5KFN A;  4O0I A;  3OHA A;  4ED7 A;  7ICS A;  4G3I A;  2JZB A;  3MR2 A;  5IIL A;  4B9M A;  5J0R A;  1Q78 A;  4DQP A;  4O3R A;  2BQU A;  4I29 A;  3MDC A;  1KTQ A;  3TAP A;  2R8I A;  2J6T A;  2P66 A;  9ICB A;  4YN4 A;  4ECV A;  1B22 A;  1PZN A;  3M9N B;  4Z6C A;  4DOC A;  3M9O B;  4WC1 A;  5DQI A;  2ZJA A;  1X2I A;  3V6J A;  4UD4 A;  4I2E A;  4DFK A;  4JUZ A;  5HR9 A;  1JXE A;  4QZE A;  2ZJ5 A;  4Z6F A;  5DQG A;  4YR0 A;  4DFP A;  3Q8Q B;  1S97 A;  1L3U A;  1ZQB A;  5HMM A;  2FLP A;  2MUT A;  4YD1 A;  3ZDA A;  2C2E A;  5DLG A;  2ZJ8 A;  5F2V O;  4IRC A;  2PFP A;  2WTF A;  3RJH A;  4KLJ A;  4FHY A;  3OHB A;  5CJ7 A;  3RB6 A;  3OGU A;  5L1J A;  4NXZ A;  4C8L A;  2ZH2 A;  5D4B A;  5KFJ A;  3TFR A;  4TUQ A;  8ICA A;  1ZQI A;  2XY7 A;  5DBC A;  3V7K A;  1RYR A;  3C21 A;  4UAY A;  9ICV A;  1VFG A;  1NK4 A;  3TI0 A;  2W8L A;  3QE9 Y;  3OSP A;  2P6R A;  5J2C A;  2V9W A;  8ICP A;  5DG7 A;  3QEA Z;  4KTQ A;  4RQ2 A;  1QSS A;  4K4I A;  2DR9 A;  2PI5 A;  2BQ3 A;  2JEG A;  3HWT A;  4FBT A;  4C8N A;  4RPY A;  4J9M A;  2Q66 A;  3PMN A;  1SZP A;  5HRI A;  3H40 A;  3AUO A;  3PVX A;  3TAN A;  3QEB Z;  4R8U B;  4UAW A;  5KFV A;  1A77 A;  3T3F A;  5KG2 A;  2XCP A;  3N4M B;  3C5F A;  4IRK A;  1CEZ A;  8ICY A;  3OUY B;  7ICQ A;  4F4Z A;  4K4G A;  9ICT A;  4RT2 A;  2BR0 A;  4KIT B;  3WFS C;  3H8S A;  3GIK A;  5DDM A;  7ICN A;  4WC3 A;  2DRB A;  1ZQY A;  4DF4 A;  4TUS A;  2KP7 A;  4RQ4 A;  2HHV A;  4EEY A;  5HHH A;  4GXK A;  1ZQU A;  8ICQ A;  2HHX A;  3UPQ A;  2DPI A;  3SV4 A;  3H3A A;  4KN4 A;  9ICG A;  3H8J A;  2ZTD A;  4F91 B;  5J2E A;  5HML A;  3B0X A;  5KFZ A;  4UBC A;  4DF8 A;  1D8L A;  3UXN A;  4JWM A;  4O5C A;  2VAN A;  9ICE A;  3WFQ E;  2BKE A;  3LQC B;  1ZJM A;  4DSI A;  4O5E A;  1KRP A;  1U4B A;  3GDX A;  4B9T A;  3T5K A;  4ECU A;  8ICT A;  1TFR A;  4GC7 A;  3BQ2 A;  4J9R A;  2OWO A;  4DSK A;  1UEU A;  5L9X A;  3GV5 B;  2BGW A;  4AT7 B;  1KSP A;  9ICM A;  4F5Q A;  4X4O A;  1R89 A;  3C1Z A;  5L1K A;  3RJG A;  1DOQ A;  4LVS A;  4KLG A;  3GII A;  3KHL A;  1T8E A;  8ICR A;  4RWQ A;  3ZDE A;  3V72 A;  1U45 A;  1NK9 A;  2ISP A;  4Z6D A;  4ECR A;  3BQ1 A;  4FH5 A;  7ICL A;  3ZD8 A;  1RZT A;  2BPG A;  4MF2 A;  3HP6 A;  3SZ2 A;  4O3Q A;  5JUM A;  4MF8 A;  3JPT A;  4ED2 A;  4LZG A;  9ICP A;  1CUK A;  4QZD A;  5DLF A;  7ICF A;  1K1S A;  4C8O A;  1Z00 B;  3C18 A;  3HIY A;  4FO6 A;  1N56 A;  3ETL A;  4RQ8 A;  4GXI A;  4M9H A;  4R63 A;  4C8K A;  4NLG A;  1KDH A;  1S76 D;  4RQ1 A;  3T5L A;  1Q79 A;  4QZ8 A;  2I1Q A;  1L3T A;  2ID1 A;  4KLE A;  4LZD A;  5J0Y A;  3V7J A;  1U49 A;  9ICQ A;  2ZTC A;  3M9M B;  4ATB B;  4X4P A;  2DVI A;  5J2G A;  5CA7 A;  3GV7 B;  2ZH5 A;  7ICT A;  2HVH A;  1T4G A;  2XGQ A;  5KFT A;  9ICO A;  4WCW A;  3PX4 A;  2M2T A;  2KZM A;  4DS4 A;  2KZ3 A;  7ICH A;  5HRD A;  5HRB A;  5J2F A;  2DRA A;  3E2E A;  1V4A A;  4NM2 A;  5KFM A;  3PR4 A;  2VA2 A;  3MBY A;  4DL2 A;  4DSL A;  3MGH A;  1ZQV A;  4NLN A;  1QTM A;  8ICJ A;  4DL5 A;  4X4Q A;  1UEV A;  1ARO P;  4DQQ A;  2ASJ A;  2BCV A;  5DB7 A;  2PBE A;  2NRW A;  5KFG A;  4B9N A;  4WC6 A;  4WC7 A;  1R8A A;  4YMO A;  2XGP A;  4DQR A;  3T5J A;  4X5V A;  4M0A A;  4QZG A;  5IIJ A;  1KLN A;  3N97 B;  3ZDB A;  3C1Y A;  4J9S A;  4DEZ A;  3M8S A;  1UT8 A;  4J9K A;  4WC5 A;  2GWS A;  3C2L A;  4M6W A;  5DG9 A;  3RBE A;  1F5A A;  3TAR A;  2KN7 A;  1RXW A;  1H38 A;  4KLL A;  5CB1 A;  2NRX A;  3EPI A;  2RFF A;  2HHP A;  2XC9 A;  1UA1 A;  1NK5 A;  2R8H A;  2W9A A;  2B21 A;  4FHW A;  2BCQ A;  4WC0 A;  3MR6 A;  4YR3 A;  3RRH A;  5HRH A;  1EXN A;  3RTV A;  5IIO A;  5KFX A;  4PGY A;  4ECZ A;  2XY6 A;  3PV8 A;  4F4X A;  3PO4 A;  3Q8M A;  3KHH A;  8ICE A;  5KG5 A;  5HRF A;  2Q0Z X;  4PHA A;  1ZQR A;  7ICM A;  2M9N A;  4JK1 A;  4B9U A;  4ECX A;  3SYZ A;  2RDI A;  4PGQ A;  4R66 A;  3ORY A;  3H38 A;  8ICK A;  4NM1 A;  9ICL A;  2V4Q A;  5J2B A;  4AT9 B;  4YXJ A;  3UPS A;  5KFO A;  3C2M A;  2BPC A;  2VA3 A;  1ZQP A;  3PML A;  1XSL A;  3RH5 A;  4YMN A;  2DPJ A;  4MEY A;  1NK0 A;  1ZQM A;  2ALZ A;  4KLH A;  1BPB A;  4KLI A;  3LWM A;  4EP7 A;  3H7I A;  1Z3E B;  5J0W A;  3MDA A;  4QZA A;  1RXV A;  1XC9 A;  2UVU A;  9ICI A;  4EBC A;  7ICK A;  3ISB A;  2BDP A;  1S0M A;  1KFT A;  4S3N A;  4FBU A;  1ZQT A;  8ICC A;  3UQ0 A;  1MQ3 A;  8ICZ A;  1NJZ A;  3JZ0 A;  4UB5 A;  1ZQW A;  5HRE A;  2JZB B;  5KT6 A;  7ICR A;  4R8U A;  1TKD A;  5KFQ A;  5F9N A;  3PNC A;  4KLQ A;  2BCS A;  3KTQ A;  2AQ4 A;  3OUY A;  3KHR A;  1S0V A;  1ZQN A;  4ECY A;  4F2R A;  4ELT A;  1ZQZ A;  4ZH4 A;  5D49 A;  5J0U A;  1UT5 A;  4ECQ A;  3QZ8 A;  1NK8 A;  2PI4 A;  4ED1 A;  1ZQA A;  4RWO A;  1D8Y A;  2JEJ A;  4CCH A;  4B9S A;  3OVS A;  4RWN A;  1WCN A;  2W9C B;  3GQC A;  3EPG A;  5J0O A;  4O3P A;  2MUT B;  2HHW A;  3WFO A;  1BVS A;  1TK8 A;  3GIM A;  5KFL A;  3RJE A;  2HHQ A;  4RNM A;  5KFH A;  4TQR A;  4EBK A;  9ICN A;  4F4W A;  5EWE A;  3OJU A;  4P4O A;  3AU2 A;  5KFI A;  1PX5 A;  3MAB A;  4KLT A;  2ZH3 A;  1SKS A;  4DQI A;  3ISD A;  2W9M A;  4O9M A;  2O1P A;  5J0T A;  3C23 A;  1X9M A;  3BQT A;  4KLM A;  2ZH1 A;  4QZH A;  5KT2 A;  4DLE A;  9ICA A;  4PGX A;  5BPC A;  3EZ5 A;  1TV9 A;  3RR7 A;  4BDP A;  2NRZ A;  4YR2 A;  1TVA A;  1TK5 A;  3ZDD A;  8ICN A;  2IHM A;  1COO A;  1RPL A;  4EYI B;  1U9L A;  5IIN A;  1NJX A;  4KLD A;  3HX0 A;  3UQ2 A;  3RB0 A;  1T7P A;  1L5U A;  1B43 A;  1ZYQ A;  3ZDC A;  2ZH6 A;  1TFW A;  1X9W A;  4NKT A;  4X4V A;  1KFS A;  4RNN A;  4EZ9 A;  4F92 B;  5J29 A;  4PHD A;  4EYH B;  1LB2 B;  4M9L A;  2KTQ A;  4PHP A;  3JPR A;  2ZUC A;  4HYK A;  2C28 A;  1SL0 A;  3V7L A;  1Z00 A;  5EWF A;  4E80 A;  2ZH4 A;  2LYH A;  4FHX A;  4Q44 A;  4XA5 A;  1BPD A;  4QZF A;  3IM1 A;  3TAQ A;  2W8K A;  1WOT A;  2BCR A;  4O3N A;  1YLQ A;  3NGD A;  3L9D A;  4QWD A;  5KG0 A;  4DOB A;  1S0N A;  5KG7 A;  3Q8K A;  1BPZ A;  3H4B A;  2O5A A;  4ATB A;  3JPP A;  3GIL A;  4DWI A;  4XQ7 A;  1ZQO A;  3JYY A;  4M9G A;  3GFK B;  4PHE A;  5IIM A;  1XS9 D;  5EOZ A;  3V6H A;  5J2D A;  4DL4 A;  2ASD A;  1QSL A;  5DGA A;  2A1J B;  8ICB A;  2ZHA A;  1R8B A;  4X4T A;  1IM4 A;  3AQN A;  4BXO A;  2ZH7 A;  5KFA A;  4EZ6 A;  3T5H A;  3JPN A;  4DLG A;  4ELV A;  1HJP A;  4DQS A;  4Q8F A;  2ZHB A;  4YP3 A;  1SL1 A;  1NKB A;  4RQ6 A;  3AQK A;  4UQG A;  4WBZ A;  4F3O A;  4O3O A;  1U48 A;  4O3S A;  4BGD A;  4NLK A;  5DED A;  4DSE A;  5DBB A;  4RZR A;  3AU6 A;  2W9B B;  2R8G A;  4C8M A;  1KNY A;  4QWB A;  2XCA A;  2AU0 A;  2NRV A;  4MFC A;  4Q45 A;  3NYB A;  1R8C A;  3WFP A;  5CWR A;  2DR7 A;  4M47 A;  3FYH A;  3PW4 A;  4Z6E A;  4UB3 A;  2Y1J A;  1MQ2 A;  3BQ0 A;  1XSN A;  4I2D A;  5BOL A;  4AT8 A;  3UXO A;  2ASL A;  1ZQH A;  1V9P A;  1ZQS A;  1QSY A;  1XU4 A;  2IA6 A;  1DGS A;  5KG3 A;  1ZQX A;  2PFO A;  1T3N A;  4F5P A;  5J2J A;  3AQL A;  5KFS A;  3ZD9 A;  4GXJ A;  2C2R A;  4IR1 A;  1SKR A;  1BPE A;  1BNP A;  4M04 A;  1NOM A;  1NO5 A;  2RDJ A;  3V6K A;  3MR5 A;  2R8J A;  2DFL A;  5CP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...