4O9MA

Human dna polymerase beta complexed with adenylated tetrahydrofuran (abasic site) containing dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of polymerase beta in complementing aprataxin deficiency during abasic-site base excision repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o9mA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o9mA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o9mA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o9mA03
3H8SA 4QZHA 2HHVA 1HJPA 1V4AA 3AQNA 1UA1A 5KFQA 4DSJA 2BPGA 3RAQA 4P4OA 4I2JA 3JPNA 4DS5A 3TFRA 2ZJAA 4K4GA 2W9CB 4KLIA 4ECWA 1BPZA 1TV9A 4MFCA 4O3OA 3GV8B 4F2SA 1KFTA 5DDYA 5D49A 4M6WB 5KFMA 1UEVA 1NJYA 4QWEA 5IIIA 5KT6A 3OJSA 3TAPA 1ZQKA 4EZ6A 4EBCA 2BDPA 4M9HA 4KLQA 4FS2A 2IA6A 1U9LA 3RJJA 4I2AA 4UD5A 1DOQA 5KFEA 4E7XA 5HRHA 3UXOA 1A77A 4F4WA 4KMUA 4IR9A 4O5EA 1QSSA 9ICEA 5KTQA 3HW8A 5CWRA 2XO7A 3JPPA 3C21A 1VFGA 4UBCA 3EPIA 3SV3A 4ECYA 9ICCA 4C8KA 4J9QA 4ZH4A 5DBBA 2V4RA 3RJKA 9ICTA 1NZPA 1TAQA 9ICVA 2Q0ZX 3KHGA 5DG8A 4B9TA 3OVBA 5DDMA 4DO9A 1ZQRA 2WTFA 1XWLA 2P66A 5D46A 4Q43A 4RUCA 5EWFA 3NYBA 1NOMA 3C23A 4UAZA 2KZZA 2RDIA 5HRGA 4EEYA 3PW5A 1S0VA 2ZTCA 4PHAA 4I2EA 7ICRA 4FH3A 5EOZA 3MABA 5HHIA 4DQRA 5EWEA 3C18A 3PMLA 5DEDA 4IRDA 1ZQGA 4YR3A 1FA0A 2VANA 4X4TA 4YR2A 5KFPA 2JZBB 4DOCA 3TI0A 2AQ0A 4O3RA 4EBKA 2DPJA 4KLFA 4YFKA 2NRKA 3EPGA 3UPQA 4F5RA 8ICKA 1BGXT 4RPZA 4XUSA 3PW0A 4M9JA 7ICPA 4X4VA 4QW9A 4CCHA 4TUSA 1A76A 5DG7A 4ECSA 1TK5A 4NY8A 4UAWA 5IIJA 5IIMA 1SL1A 4YP3A 5KFAA 4YCXA 5KFWA 3K4GA 4B9VA 1YLQA 4BGDA 1SL0A 3MR6A 4O9MA 8ICYA 1RXWA 1BPYA 4DSEA 4X4SA 2HHPA 2I1QA 8ICPA 5KT7A 3PNCA 3PX4A 2AGOA 4DL2A 5J2CA 1NKCA 4J9PA 1NK0A 4NLZA 8ICLA 3WFQE 1NK5A 4QZGA 4EZ9A 1L3TA 3MR5A 1TK0A 2C22A 4ECQA 3H3AA 5HRBA 4G3IA 5J0YA 2DPIA 4IQTA 3H39A 5KT5A 4P4MA 5CR0A 1QLNA 1NK9A 3JZ0A 3MR2A 3ISCA 3ISDA 3EZ5A 3M9OB 3G6YA 4C8LA 4YVZA 9ICGA 1UETA 1MIYA 8ICGA 4YQWA 8ICAA 4ECZA 2BCSA 3AQLA 2DRBA 4UD4A 5KFVA 3OHBA 4J9KA 4YMMA 4FBTA 3H4DA 1XS9D 2UVVA 4DSIA 2IHMA 4JV2A 3Q8MA 1S77D 3T5HA 3BDPA 4Q8FA 1T8EA 2ZH3A 3TFSA 4DLEA 4ED8A 3RR8A 3EYZA 1X9SA 3OV7A 1XSNA 2JEFA 4YXJA 3HP6A 1ZQZA 3V7LA 4UB3A 2VA2A 4DLGA 2ZHBA 3WFRE 4NKUA 1JMSA 5KG7A 1EXNA 2F1IA 2JZBA 3GQCA 5KFKA 3KHLA 8ICNA 5F2VO 4X0BA 1L3UA 9ICBA 2KTQA 3LDAA 3SV4A 3GIJA 2UVUA 1N56A 4E0DA 2C2DA 4F2RA 1TVAA 4IG8A 4YMNA 3C1YA 1KEJA 7ICFA 4I2DA 3MBYA 1S76D 2J6TA 4AT7B 1R89A 1Z3EB 4KLDA 2HVIA 2ZHAA 1TFYA 4UB5A 1SKSA 1MQ2A 1JQRA 5KG6A 2KP7A 3OUYB 3GV5B 7ICMA 1BNOA 2ZH4A 4PPXA 1ZJNA 5DG9A 1LB2B 4ED0A 4DL3A 2ISPA 1D8LA 5KFBA 2NRTA 2FMPA 4QWAA 4QWCA 1ZJMA 2R8KA 2R8JA 4I27A 4B9LA 4BDPA 3RB4A 4PH5A 1D9FA 2JEGA 9ICWA 4KLUA 4FHVA 4QZ9A 1ZQCA 2BQ3A 2NRVA 1MC8A 1UT5A 4F5QA 3UXNA 1ZQSA 3H8JA 4TURA 3MGHA 2JEJA 2O5AA 4FHWA 4B9NA 4F8RA 3GFKB 1MSWD 4PGQA 3ORYA 5KG5A 1NJWA 4RZRA 1Q79A 2BKEA 5HHHA 5J0OA 3C2MA 2AGPA 1RZTA 4FH5A 4M6WA 4WC7A 1S0OA 2VA8A 1MQ3A 4DOAA 5DB8A 1T3NA 1IM4A 5L1JA 2KFNA 4X4PA 5KFRA 3MDAA 4R8UA 2AJQA 3HX0A 4M5DA 3RB0A 4RQ7A 4YXMA 2FPLA 2PXIA 4O3NA 9ICJA 4WCWA 5J2DA 4Q45A 2MUTA 4UB2A 4UBBA 1BPDA 1RPLA 1ZQFA 5KFSA 3ISBA 4J9RA 4E80A 4QZFA 4ECUA 4K4IA 3C66A 2ZUBA 3V7KA 1DK2A 4NLNA 5HP4A 4KN7A 3QZ7A 4Z6CA 2XGPA 4PHPA 7ICVA 1QSYA 2BCUA 5BOMA 4F3OA 4P4PA 3BQ1A 4ED6A 1BPEA 1H38A 4IQVA 5KFTA 2P6UA 4KLOA 4KLTA 2XCAA 4QZCA 1JIHA 1UA0A 1KFSA 2PFPA 3T3FA 4X5VA 3GIIA 5TZVA 3PW7A 4DSKA 4EBEA 4MF2A 5HREA 2KZ3A 2ZH8A 4RWPA 4RQ0A 2NRWA 4LZDA 4FBUA 4IQWA 3RJEA 1PZNA 2HHUA 1KRPA 2GWSA 1AROP 7ICOA 4JV0A 3M8SA 3H40A 2HHTA 3OVSA 4PGXA 1ZQHA 8ICVA 4O5KA 7ICEA 1T7PA 1NK6A 9ICOA 4C8MA 1K1SA 1BPXA 7ICJA 4KN4A 4F5NA 1R8AA 3FDSA 2A1JB 3HT3A 1K1QA 1XSPA 2DR5A 1L3VA 5HRKA 3G6VA 4YN4A 3PV8A 2W9BB 3HIYA 2XC9A 4DF4A 4K4HA 3WFSC 2W9BA 1S0MA 3RJGA 1X2IA 5EWGA 4EBDA 2BE3A 9ICUA 3IHQB 3TARA 1ZQIA 3OSPA 2BPCA 2ID1A 2W9AA 2FLNA 3BQ2A 4HYKA 4LZGA 3NTUA 5CA7A 4WC3A 1SZPA 3KHHA 5KFOA 4PHDA 3MGIA 4NM2A 4KLMA 1S97A 2KZMA 5KFJA 1ZQDA 3WFOA 4QW8A 8ICJA 1NJZA 4YD1A 4B9SA 3PX0A 4FHPA 1ZQYA 4IRCA 2B21A 1Z00A 3Q8KA 2UVWA 3SZ2A 8ICOA 5J2FA 3JPOA 8ICCA 2ZJ5A 1TFRA 4R66A 2BCQA 4I29A 9ICAA 5KT3A 4WC5A 3V6HA 4DEZA 3ZDDA 5J2GA 1ZQVA 3EW9A 4RWQA 2ZH2A 4F92B 4F4YA 1ZQQA 1KTQA 5DB7A 3C5FA 8ICQA 4AT9B 4X4OA 2ZH9A 4B9MA 2Q66A 3RR7A 2IHNA 3C2LA 1MIWA 3AU6A 5KG2A 4Q8EA 1L3SA 2NRZA 5IINA 3SI8A 9ICSA 2FLPA 4ECRA 1RYSA 3UPSA 2KN7A 3G6XA 3NGDA 9ICMA 4DQPA 1CUKA 2F1HA 4ED2A 4UQGA 3RBDA 4M9NA 1R8CA 3L9DA 4X4RA 4M9LA 3JPSA 2H5XA 2V9WA 4ELTA 4RWOA 4MF8A 5DGBA 4FS1A 4KTQA 2ZUCA 4AT7A 9ICRA 4LT6A 4LVSA 3C5GA 4GC7A 4TQRA 9ICLA 2HW3A 1WCNA 5DB6A 1S9FA 7ICLA 4DQIA 2LYHA 5IIKA 4R64A 4M04A 1T4GA 3K75D 3V6KA 4XA5A 1WCLA 4NXZA 8ICIA 8ICUA 1NKEA 4I28A 1D9DA 2ZH7A 1WOTA 3PX6A 4YMOA 2J6SA 2P6RA 5L1IA 3AQMA 4RT3A 2M2VA 1ZQAA 2C2EA 1XC9A 2ASDA 2FMSA 5J2KA 4X4QA 3IM1A 4KLLA 8ICSA 3OSNA 4ATBB 1U45A 1X9MA 3TQ1A 2IBKA 4Z6FA 2NRXA 3OGUA 4ED1A 1SKWA 4WC4A 4I2CA 3AQKA 3GV7B 5HR9A 5F9NA 3T5LA 5CHGA 4F4ZA 8ICRA 1JXEA 4WBZA 4E8FA 5J0UA 5DQGA 3HWTA 4EYIB 2AQ4A 2HHXA 4QZEA 3MFHA 4AT8B 3KHRA 1U49A 2RDJA 5J0RA 4BWMA 2PFOA 2HVHA 2HHWA 4JV1A 3RH4A 3RJHA 3B0XA 1ZYQA 1KDHA 3LQCB 1C7YA 1UEUA 3B0YA 4I2GA 4KLJA 4XQ8A 4DFJA 5D4BA 5KG0A 1TK8A 4ECXA 3BJYA 3T5JA 3Q8LA 2J6UA 4GC6A 2XCPA 4DFMA 5KFIA 4DOBA 4NKTA 4RU9A 4QWDA 3Q8RB 3LWLA 4KITB 4TUPA 5J0SA 4J9OA 3GIMA 5DBAA 2W8KA 4ECTA 3V7JA 4ED3A 1SL2A 1DK3A 3MFIA 4P2HA 4JUZA 2BCRA 5HRIA 1D8YA 3PW4A 2I9GA 7ICGA 4UB4A 4F5OA 3FYHA 4TUQA 3AUOA 1ZQUA 2HHSA 4DL5A 1KNYA 2VA3A 2UVRA 2BCVA 3QEAZ 5HNKA 4Z6EA 4XRHA 1ZQPA 9ICXA 8ICXA 1B22A 2MAXA 4M9GA 4KLEA 5KFCA 5DLFA 3M8RA 2M9NA 2XY6A 4RNOA 2ASJA 4F5PA 4DSLA 2RFFA 5KFDA 4O3QA 4RQ1A 2ZTDA 4DFKA 8ICTA 9ICPA 2O1PA 4BWJA 1TFWA 4PGYA 2F1JA 5KFLA 2M2UA 3QZ8A 3AU2A 4GLXA 2IMWP 1RYRA 2BQRA 4WC1A 4X0AA 2DR8A 1Y88A 3UXPA 5KFHA 1X9WA 4RUAA 2FMQA 1SKRA 2ALZA 1KLNA 4KLSA 3BQ0A 3GIKA 4AT8A 5KT4A 2XY5A 4J9MA 3Q8QB 3RAXA 1ZQXA 3KTQA 5DECA 4O0IA 2FPKA 1NO5A 1ZQJA 5KFXA 2MUTB 5CJ7A 3PO5A 2ZH6A 3UQ0A 3JYYA 1NJXA 4F50A 4F4KA 5CP2A 1TAUA 2DR9A 5DBCA 5J29A 5J2JA 3UQ2A 3TAQA 2JEIA 5HRFA 4O3PA 2Y1JA 5J2HA 4DS4A 2BQUA 3HJ1A 4QWBA 3RRGA 3C1ZA 4ELVA 2M2WA 2R8HA 1KFDA 4F93B 1ZQLA 4MFAA 5HMMA 1ZQNA 4ELUA 3H38A 2Y1IA 4WC6A 4FHYA 4O3SA 4QZIA 2PFQA 1KSPA 3OVAA 3N4MB 5J0PA 2ZH5A 3RRHA 3EWAA 3C2KA 4RPXA 2M2TA 4GXIA 4RQ6A 3ZD8A 5J2EA 5DQHA 5DQIA 5J2IA 4X4UA 4M2YA 3GILA 4C8OA 7ICSA 2PI5A 4IRKA 5KFFA 3JPQA 4DF8A 4RWNA 1RXVA 3PVXA 5DGAA 4RNMA 1NK4A 5CB1A 4RQ5A 1BVSA 4R8UB 5DB9A 2V4QA 1ZQTA 4I2HA 2KFZA 4YR0A 1ZQOA 3H37A 3H8WA 4IQUA 4TQSA 4DQQA 1F5AA 2R8IA 4JWNA 3QE9Y 4RQ2A 4KLHA 4F4XA 4DFPA 1V9PA 1JAJA 5HC9A 4UB1A 2AGQA 1JX4A 8ICHA 1ZQWA 4YD2A 2XY7A 4WBYA 3JPRA 1N48A 5KFZA 4QZBA 2AU0A 3PR5B 1XSLA 1BNPA 4O5CA 2ZH1A 7ICNA 3M9MB 4RQ8A 2XGQA 3LWMA 1ZETA 4AT9A 1Z00B 3OHAA 2BGWA 5KFUA 4GXKA 4MEYA 3PW2A 1HUZA 2FLLA 9ICFA 3OUYA 4UAYA 3ZD9A 1ZQEA 3T5KA 5HRDA 3MR3A 8ICWA 5J0QA 4EYHB 5J2BA 1CEZA 2FPMA 4DL7A 2W9CA 3RH6A 2ISOA 5KT2A 4DSFA 4KLGA 1LV5A 5KFYA 1OU5A 3RH5A 4R65A 4ECVA 4RQ3A 4WC2A 1U47A 3RBEA 3N97B 1XO1A 5IIOA 1NK8A 4MEXA 7ICIA 3V72A 1JN3A 5KG4A 2PFNA 2PI4A 4BXOA 3V6JA 1DGSA 3ZDCA 5C5JA 5F9LA 3Q8SB 4NLGA 4I2FA 1ZQMA 4FHXA 2A1JA 3JPTA 2DR7A 1Q78A 5KFGA 4NLKA 5L1KA 4RT2A 5J0WA 1B43A 3RJFA 4ED7A 2BHNA 2DVIA 3Q8PB 4Q44A 1COOA 4RPYA 4JWMA 3PR4A 5KG3A 1NKBA 1TKDA 4I2IA 3ETLA 1JXLA 3MDCA 4M47A 2DRAA 4NM1A 4I2BA 4FO6A 1S10A 1U48A 5IILA 2BR0A 2DFLA 2W8LA 3ZDAA 3WFPA 3RJIA 4RNNA 2C2RA 5HMLA 4M0AA 4J9SA 4Z6DA 4DL6A 3RB3A 2C28A 2R8GA 2OWOA 4J9LA 1QTMA 4ATBA 4C8NA 9ICNA 1BPBA 1L5UA 7ICQA 5DKWA 3BQTA 1PX5A 5KG1A 2HHQA 4QZAA 4DQSA 7ICHA 9ICQA 4IR1A 1U4BA 8ICFA 5BPCA 8ICBA 8ICMA 1UT8A 5KFNA 3RTVA 8ICEA 3OJUA 1IXRA 9ICIA 4X4NA 3LK9A 4BXOB 1ZQBA 5J0XA 4WC0A 4S3NA 2PBEA 4RQ4A 3M9NB 4B9UA 5J2AA 3ZDBA 3PY8A 2ZJ8A 3H7IA 3PO4A 5BOLA 5DLGA 5JUMA 5L1LA 4EP7A 4EBJA 4QZ8A 3E2EA 3H4BA 1R8BA 2ZUDA 5HRLA 3PMNA 1XU4A 4DL4A 3RB6A 4DWIA 7ICTA 1VJ7A 3SYZA 2ATLA 8ICZA 4F91B 3TANA 1S0NA 3THVA 9ICKA 4QZDA 4YG2A 5L9XA 2ZTEA 4GXJA 1NK7A 5J0TA 4J9NA 3ZDEA 1MIVA 4PHEA 3GDXA 3QEBZ 3HPOA 4XQ7A 2BPFA 4R63A 1HUOA 1QSLA 3HJ4A 7ICUA 9ICHA 2ASLA 7ICKA 2W9MA 4JK1A 4MFFA
chains in the Genus database with same CATH superfamily
2HHVA 1HJPA 3AQNA 1UA1A 4K99A 5KFQA 2WB1F 3TFRA 2ZJAA 2EWRA 2B0CA 1BPZA 2GAFD 2BDUA 5D49A 2CN1A 5KFMA 4M9HA 2BDPA 4I2AA 1U9LA 2OCEA 4F4WA 5KTQA 3NVYA 2KVCA 3AEVA 1VFGA 1JALA 1OXJA 2G06A 1O03A 1TAQA 9ICVA 2LYBA 4B9TA 3OVBA 5DDMA 4BJQA 3WK7A 1D8BA 5ALXA 5HRGA 5AI8A 3L3FX 3PW5A 1S0VA 5EOZA 3MABA 2JGAA 1AQ6A 3PMLA 4IRDA 1JRPA 4DOCA 2DPJA 4KLFA 4F5RA 1UCVA 2W43A 4QW9A 2D6FC 1LKYB 4YP3A 5KFAA 4YCXA 4B9VA 1YLQA 2K8BB 4BGDA 2F76X 2I1QA 8ICLA 4DL2A 4NLZA 1NKCA 5G5GA 4J9PA 5ALDA 2HDOA 3VCBA 2H3FA 2OXOA 5CR0A 1QLNA 1NK9A 3JZ0A 4NWIA 3MR2A 3TADC 9ICGA 4ATBB 4C8LA 2GA9D 2WFAA 2BCSA 3AQLA 4UD4A 5KFVA 3BZCA 4FBTA 1VJ5A 2IHMA 3BDPA 2ZH3A 5AI4A 4ED8A 3EYZA 1RG6A 1XSNA 4YXJA 2VA2A 3WFRE 4DLGA 2D3DA 1EXNA 2JZBA 1QH9A 3LDAA 2C2DA 3MBYA 1L7OA 4AT7B 1Z3EB 2HVIA 1ZRNA 1SKSA 4F72A 1Z4OA 1X9XA 2GLEA 5ALOA 5DG9A 1LB2B 2NRTA 2R8KA 2RLTA 4BDPA 4PH5A 3D2SA 2BQ3A 2NRVA 3KKAA 1UT5A 3O0FA 2ZIUA 3SAGA 1RYUA 4C0ZA 1ZQSA 1Z1BA 2JR5A 4EENA 2O5AA 3C2MA 5J0OA 1RZTA 2AGPA 4FH5A 4WC7A 2VA8A 1MQ3A 3A0HU 5DB8A 2GO7A 4FO1A 1FFUA 4YXMA 4O3NA 5B5EU 1ZQFA 3NWIA 2ZIVB 3V7KA 5HP4A 3QZ7A 5ALLA 2BBJA 1QSYA 3F53A 4P4PA 5ALTA 1H38A 4KLOA 4QZCA 5TZVA 4UASA 5ALRA 4EX7A 4IQWA 3RJEA 1PZNA 1KRPA 2GWSA 7ICOA 3M8SA 3OVSA 7ICJA 4OJ5A 3HT3A 1L3VA 2LI6A 3ED5A 3HIYA 3WFSC 3IHQB 3OSPA 4N7RA 3NTUA 5TISU 3KHHA 4FZLA 1S97A 2KZMA 3WFOA 4QW8A 1NJZA 1DGJA 3UMGA 4B9SA 1ZQYA 4IRCA 3NS1A 5J2FA 1IV8A 3F5EA 4I29A 3AQEA 4DEZA 3ZDDA 3QU4A 5AM2A 3EW9A 2MRLA 4F92B 1ZQQA 1KTQA 5DB7A 3C5FA 8ICQA 4AT9B 4B9MA 2KJ9A 3RR7A 3C2LA 3QYPA 3AU6A 9ICSA 3NGDA 2A1AA 4UQGA 3I28A 4M9LA 3JPSA 4ELTA 5DGBA 4P0QB 4KTQA 4GC7A 1WCNA 7ICLA 5IIKA 4C4TA 1WYGA 3D2QA 8ICIA 3V6KA 4XA5A 1WCLA 8ICUA 4O3MA 4I28A 1L6NA 3SD7A 1CRXA 2JRZA 1HIWA 2OM6A 4EEKA 3OGUA 4I2CA 3GV7B 3MC1A 2YQEA 3T5LA 4WBZA 1JXEA 2AQ4A 3NUQA 2PFOA 2HHWA 2RDJA 5CFSA 1KDHA 3LQCB 2LKYA 5ALPA 2IUBA 4ECXA 3BJYA 3T5JA 3AQFA 3Q8LA 4GC6A 5KFIA 4NKTA 2EAOA 3LWLA 2LM4A 1L8OA 5J0SA 4PL2A 5DBAA 3MFIA 4P2HA 5HRIA 1D8YA 1QQ7A 3FYHA 3AUOA 5ALVA 3PSIA 4OJLA 2KMDA 4Z6EA 5HNKA 9ICXA 3I1YA 8ICXA 2RHFA 2MAXA 4M9GA 2W54A 1ZOLA 4DSLA 4F5PA 2RFFA 5D61A 4IS7A 8ICTA 2M2UA 4C80A 1Z4NA 4RUAA 2VKQA 4US9A 4UARA 2ALZA 1KLNA 5EE1A 4KLSA 3GIKA 3PO5A 1NJXA 4F50A 1SB3C 2KSOA 5J2HA 4QWBA 2KG5A 2W7OA 3IN5A 2Y1IA 1MN8A 4EEBA 3OVAA 3N4MB 1QQ6A 3RRHA 3C2KA 5DQIA 2MSNA 3QX7A 2E5SA 1A0PA 4IRKA 5KFFA 2YY6A 5DGAA 1NK4A 2KFZA 4R8UB 2KEYA 4I2HA 1ZQOA 1PUZA 2R8IA 1V38A 4F4XA 4US8A 4DFPA 1JAJA 4UB1A 1ZQWA 1N48A 4WQKA 2Q4TA 5FP0A 5AM1A 2W04A 4P0QA 3OHAA 2BGWA 5KFUA 4MEYA 3OUYA 3WK6A 5AM4A 4EYHB 1B0XA 4WC2A 1U47A 1XO1A 7ICIA 2PFNA 1JN3A 3AN1A 4C4SA 4I2FA 1WWUA 1Q8KA 2RRDA 4NXXA 1Z1VA 5KFGA 4Y2QA 1SXEA 5AK5A 3RJFA 2BHNA 3QUTA 4CF4A 4JWMA 2KSOB 3ETLA 1JXLA 2DRAA 4NV0A 2BR0A 4RNNA 4J9SA 3RB3A 4J9LA 4C8NA 4NLCA 2EH9A 5KG1A 7ICHA 2DBYA 3KFUF 8ICFA 2YN4A 5KFNA 3F2BA 1IXRA 3QU9A 4IL6U 2PBEA 4RQ4A 2HOQA 2ZJ8A 3PO4A 2HOIA 5L1LA 4EBJA 2H3ZA 2WF6A 2ZIUB 3E2EA 1R8BA 2HOFA 4OAIZ 1S0NA 5L9XA 1NK7A 4J9NA 2YX8A 1MIVA 1KN5A 3QUQA 2RP5A 1HUOA 7ICUA 9ICHA 4JK1A 2XIDA 2O6KA 4DSJA 3RAQA 2YMPA 5ALUA 5ALQA 3BQ7A 4O3OA 3GV8B 4UB8U 5DDYA 1NJYA 4EGWA 3KD3A 5IIIA 5KT6A 1ZQKA 4KLQA 4UD5A 1DOQA 3UXOA 1A77A 4O5EA 1QSSA 3CRXA 3SV3A 4ECYA 4J9QA 4ZH4A 5DBBA 2EANA 4QIWF 2H3QA 3OTQA 5DG8A 2F8LA 4DO9A 2N1RA 2WTFA 1XWLA 3M6ZA 4RQNA 3C23A 2KZZA 2ZTCA 4I2EA 2K4EA 5AKYA 2KHQA 4DQRA 3WKBA 2JH1A 1UPHA 2AQ0A 3EPGA 3IP4B 8ICKA 1NZBA 1BGXT 2E8MA 4XUSA 1COKA 4P0PB 2JHDA 1A76A 4K8VA 5DG7A 3QNMA 4NY8A 4UAWA 5IIJA 1SL1A 5KFWA 3MR6A 8ICYA 1RXWA 4DSEA 2HHPA 8ICPA 2HBJA 5J2CA 4EZ9A 3EF2A 3MR5A 2C22A 4Y2SA 4C7YA 5D62A 5J0YA 4Y2YA 4P4MA 3C29A 4CNQA 3ISCA 4YVZA 1UETA 3DV9A 4YQWA 8ICAA 4ECZA 3OHBA 4J9KA 4DSIA 2UVVA 5ALZA 4JV2A 4Q8FA 1T8EA 3TFSA 3PSPA 3OV7A 1KKXA 3HP6A 5B3QA 1ZQZA 2LM1A 2HBKA 2W55A 1JMSA 4FE3A 2F1IA 3ALRA 4BX9C 2EAPA 5KFKA 4I0UA 1L3UA 9ICBA 4E0DA 2UVUA 4YMNA 2ESEA 2EZXA 1R89A 4KLDA 2KICA 3OUYB 1PVQA 1O08A 3GZFA 2K60A 1ZJNA 4WOYA 1SWWA 4QWAA 1VDVA 4B9LA 3NRWA 2JEGA 4QZ9A 5J8YA 4F5QA 3UXNA 4F8RA 3OWGA 1MSWD 3ORYA 5KG5A 4EX6A 4MHVA 1NNLA 4DOAA 1T3NA 5L1JA 2KFNA 4X4PA 5KFRA 2G07A 5ALNA 3HX0A 1X40A 9ICJA 5J2DA 2WF7A 4UB2A 1BPDA 1RPLA 4KMOB 4ZOHC 5ALFA 5KFSA 4E80A 1A6SA 2XGPA 7ICVA 3U26A 2CXYA 3FM9A 4IQVA 4KLTA 2P6UA 3F2CA 1JIHA 2ZXIA 4EBEA 2M0NA 4MF2A 1ED1A 4RQ0A 2NRWA 2G5HB 4JV0A 7ICEA 1SGGA 4C8MA 5AHXA 4F5NA 3S6JA 3G6VA 3PV8A 4LEVA 3FC4A 3A0BU 1S0MA 3RJGA 1X2IA 5EWGA 4EBDA 5L1MA 3TARA 2LMRA 2BPCA 3BQ2A 4LZGA 4WC3A 5CHEA 2F8KA 4KLMA 1ZQDA 3ZI4A 4FHPA 2UVWA 2ZIWB 4CDGA 4Y2UA 5KT3A 4WC5A 2ZH2A 2ZH9A 2Q66A 2IHNA 4UATA 3SI8A 1RYSA 3D2NA 5CFTA 2DGZA 2K4PA 3G6XA 3RBDA 2F1HA 3NVWA 4FS1A 1L7PA 2YB4A 3SR6A 4TQRA 9ICLA 2HW3A 5DB6A 2LYHA 4R64A 4O5KA 1T4GA 4A8EA 2I5HA 1NKEA 1D9DA 3CNHA 2ZH7A 3PX6A 2KIWA 3H8MA 1L7NA 5ALKA 1SXDA 5J2KA 4CRXA 2IBKA 4WC4A 4ED1A 1XNSA 5F9NA 4EELA 5DQGA 4EYIB 4AT8B 5ALGA 3KHRA 5J0RA 5AI5A 5A0LA 3RH4A 3RJHA 3B0XA 1ZYQA 2K8AA 2PMZC 3N7PD 3B0YA 1C7YA 4I2GA 4XQ8A 1UEUA 1ZD2P 5KG0A 2W3RA 1TK8A 1RM6C 5AKGA 3R9KA 4CF5A 4DFMA 4RU9A 3I76A 4QWDA 4ED3A 4TUPA 4J9OA 1SL2A 2OYYA 2BCRA 3PW4A 2I9GA 4UB4A 5ALYA 4TUQA 2Y9TA 5AKEA 3H0LB 5KFCA 3M8RA 2XY6A 2ASJA 4DFKA 2O1PA 4PGYA 3QZ8A 3LVVA 3AU2A 4GLXA 2IMWP 4WC1A 5K4LA 4OAHA 2DR8A 5KFHA 2FMQA 2W3SA 3QU2A 5AKKA 2ZIXA 3KTQA 4J9MA 1ZD4A 2FPKA 1ZQJA 5KFXA 4NL9C 2MUTB 2WF8A 4JB3A 3D6JA 3E58A 2DR9A 4PL1A 5J29A 4O3PA 4C4RA 4U6PA 2LPEA 3RRGA 3N7RC 4ELVA 2PMZF 4UB6U 2M2WA 2ZIVA 4ELUA 4MFAA 3H38A 2DKXA 1K5OA 3UM9A 4QZIA 2PFQA 1KSPA 2ZH5A 5J0PA 2EZZA 2M2TA 5J2EA 5J2IA 4X4UA 4M2YA 3GILA 2PI5A 5AM3A 1C20A 1ZQTA 3SMVA 2HBMA 2QB0A 4IQUA 1F5AA 1V9PA 1JX4A 8ICHA 2XY7A 4YD2A 5AI9A 5KFZA 1ZXIA 1XSLA 1YZ7A 2ZH1A 3M9MB 5EE3A 1ZETA 2HBLA 1IG6A 1Z00B 4FZNA 4GXKA 2JH7A 2FLLA 3ZD9A 1ZQEA 3MR3A 5J0QA 1Q3VA 2EZYA 1CEZA 4KLGA 1LV5A 3QUBA 3RH5A 5AK3A 4R65A 4RQ3A 4Y2RA 1NK8A 5IIOA 3V72A 2PI4A 1DGSA 3Q8SB 4FZMA 2A1JA 3JPTA 2DR7A 1Q78A 4HAIA 5AKIA 5J0WA 1B43A 3WKEA 5HR6A 4RPYA 1TKDA 1N2XA 1Q46A 4I2BA 4FO6A 1S10A 4UW9A 2C2RA 5HMLA 2R8GA 2OWOA 2CRXA 4IC9A 1L5UA 5DKWA 1IIPA 3BQTA 4QZAA 9ICQA 8ICMA 3JCFA 1UT8A 3RTVA 5KNIA 3OJUA 4F71A 3LK9A 4BXOB 4WC0A 3NVZA 1SV0A 3M9NB 4RQMA 2FCLA 5J2AA 2XICA 3H7IA 5BOLA 5JUMA 5F3XB 4EP7A 4OCZA 2YMMA 2ZUDA 5HRLA 7ICTA 1XU4A 3RB6A 4DWIA 8ICZA 4OJPA 3TANA 3THVA 5CEHA 3ZDEA 3QEBZ 2QB0B 5ALWA 3WK9A 7ICKA 2RQ5A 4MFFA 3H8SA 4QZHA 1V4AA 4P4OA 4I2JA 3JPNA 4K4GA 2W9CB 5G5HA 5JTGA 4KB6A 4OAFA 4J03A 2XVTA 3TACB 1UEVA 1L8LA 5JRTA 4EZ6A 3OJSA 3TAPA 4FS2A 2IA6A 3RJJA 5KFEA 4E7XA 1PK1A 4IR9A 9ICEA 3QUCA 3HW8A 1WUDA 4C8KA 3RJKA 2V4RA 9ICTA 1NZPA 2Q0ZX 1ZQRA 2P66A 2YTUA 3BS7A 4Q43A 4RUCA 5EWFA 1NOMA 4KX5A 4UAZA 2WHEA 5AM5A 3SAHA 4PHAA 7ICRA 5HHIA 3DDHA 3QU7A 1ZQGA 1TE2A 2VANA 4X4TA 5KFPA 2JZBB 3TI0A 4YFKA 3UPQA 4RPZA 3PW0A 1V97A 1SV0C 4CCHA 4TUSA 4O69A 4ECSA 1TK5A 2ODGA 5IIMA 3ETRA 3K4GA 1J97A 1KL9A 1SL0A 1BPYA 4X4SA 4K97A 3SAFA 2AGOA 3WFQE 1NK5A 3L5KA 1TK0A 4ECQA 3KOOA 3H0MB 3H39A 2G0AA 3WKDA 1F0MA 5KT5A 2W7PA 1GO3F 3M9OB 1TFYA 1MIYA 2VJ4A 4O68A 1S5LU 4NXUA 3H4DA 3RF9A 3T5HA 3LVWA 4DLEA 3RR8A 2JEFA 3V7LA 2D8CA 4UB3A 2KKVA 2IHOA 3IV6A 5F2VO 2KTQA 4F2RA 3GIJA 2GH1A 4IG8A 2QKQA 1KEJA 1UHUA 4I2DA 5EE0A 1S76D 3T79A 2E1EA 5AM0A 4UB5A 1MQ2A 1JQRA 2KP7A 3GV5B 3SQIA 3IG5A 2Y0SC 3IDWA 4ED0A 3PHZA 4DL3A 1D8LA 5AI0A 3H0RB 1SZHA 3RB4A 1SIJA 1D9FA 9ICWA 4FHVA 1MC8A 4TURA 5KAFU 2JMGA 1WG8A 3GFKB 4PGQA 1NJWA 4RZRA 2B51A 5HHHA 2EAMA 4CF3A 1S0OA 2K8CB 3NVOA 2KV2A 2AJQA 3RB0A 2LBOA 2FPLA 4WCWA 3WK8A 2MUTA 4UBBA 3ER8C 3ISBA 4NLBA 4ECUA 3C66A 2ZUBA 4KN7A 3CP8A 3KBBA 4NXVA 4PHPA 4F3OA 7ICFA 3BQ1A 1BPEA 5KFTA 3EUB2 1UA0A 1L7MA 2PFPA 4X5VA 1JI7A 4O6AA 3GU3A 5E79U 2H3IA 3NVVA 2NV3A 3RFAA 4LZDA 4NL9A 4FBUA 2HHUA 2IOHA 1AROP 2DL0A 3H40A 8ICVA 9ICOA 1NK6A 1LKYA 2HN1A 4KN4A 1R8AA 3FDSA 3C28A 1K1QA 5HRKA 3CK6A 2W9BB 2XC9A 4DF4A 4K4HA 2W9BA 2F3NA 2BE3A 2OHFA 5B66U 4BUGA 2ID1A 2W9AA 5KL8B 4HYKA 5CA7A 4PHDA 3MGIA 4NM2A 1VLBA 4YD1A 3PX0A 2B21A 3Q8KA 8ICOA 8ICCA 3K1RB 2BCQA 9ICAA 3V6HA 1ZQ1C 4X4OA 2YMQA 2DKZA 5KG2A 1L3SA 2NRZA 2FLPA 3UPSA 2KD1A 1CUKA 1X6JA 4ED2A 4M9NA 3F2DA 1R8CA 1KQQA 4K9BA 4RWOA 1MA7A 2ZUCA 1UQVA 5H2FU 4LVSA 3C5GA 4LT6A 3AM9A 1SV4A 2AHOB 2Y9UA 2HSZA 4M04A 1X6IA 2J6SA 2P6RA 3AQMA 1WWVA 2M2VA 2FMSA 4FFDA 1V85A 3IM1A 4KLLA 4QJFB 4Y2TA 2NRXA 3BS5B 3AQKA 5HR9A 4QNLA 4E8FA 2KOBA 2HHXA 3MFHA 4K98A 2VJ5A 4GIBA 4JV1A 2E8PA 5AIAA 2KE7A 4KLJA 1FFVA 5KAIU 4GFJA 2J6UA 3HRDD 1NI3A 3PSFA 4KITB 4CE6A 2W8KA 3V7JA 2PKEA 4Y2XA 2HHSA 1ZQUA 2ZIWA 2UVRA 2BCVA 5HR7A 1JUDA 4KLEA 1FO4A 4JLXA 5DLFA 1Z19A 4RNOA 3PSTA 1Q3UA 2ZTDA 9ICPA 4Y2VA 2F1JA 1RYRA 1Y88A 1YT3A 3UXPA 3M1YA 1X9WA 1X66A 1SKRA 3SENA 3BQ0A 3RAXA 3Q8QB 3WKCA 4O0IA 1NO5A 3DEEA 3JYYA 1TAUA 5J2JA 2JEIA 3TAQA 1OUQA 4UAUA 2BQUA 2B6GA 1N60A 3C1ZA 2R8HA 1ZQLA 5HMMA 1S8OA 1X42A 3K7DA 4FHYA 2A19A 4RPXA 4GXIA 4RQ6A 3ZD8A 7ICSA 2IOFA 2WF5A 2K4HA 4DF8A 1RXVA 4RNMA 4LEZA 5ALMA 5CB1A 5DB9A 2LHTA 1DXSA 2A3VA 3H8WA 4ACOA 3QE9Y 4RQ2A 4LEYA 3NKUA 2AGQA 1BNPA 2WAQC 4O5CA 1CI4A 7ICNA 3KZIU 4RQ8A 2XGQA 4AT9A 1N62A 1HUZA 9ICFA 5HRDA 5ALEA 4OJ6A 4DL7A 2W9CA 1DRGA 2ISOA 2B4VA 4DSFA 1OU5A 4ECVA 3N97B 4MEXA 2NO5A 5KG4A 3V6JA 3ZDCA 5C5JA 5F9LA 5AIBA 4HX0A 4FHXA 2HCFA 1YZ6A 2OEHA 1PVPA 2DVIA 3Q8PB 1COOA 3MDCA 3WK5A 4M47A 4NM1A 1U48A 4USAA 5IILA 2DFLA 2C28A 2KIVA 9ICNA 1BPBA 1PX5A 2F44A 2EDUA 2HHQA 1U4BA 8ICBA 9ICIA 3ER9B 1ZQBA 5J0XA 3NASA 3ZDBA 5C0YA 2L5YA 2MU2A 4QZ8A 2ZXHA 2G5IB 1VJ7A 4DL4A 1SWVA 4F91B 4QZDA 4YG2A 4GXJA 2ZTEA 5J0TA 3HPOA 2JV3A 2BPFA 2W03A 3HJ4A 2ASLA 4LJXA 1OW5A 1URJA 2BPGA 4DS5A 2XI9A 5B3PA 4KLIA 4ECWA 1TV9A 4MFCA 5ALSA 4F2SA 1KFTA 4WQLA 4M6WB 3QU5A 4QWEA 4EBCA 4PZNA 2FE9A 3HILA 5HRHA 4KMUA 5CWRA 2XO7A 3JPPA 3C21A 4UBCA 2P35A 3EPIA 9ICCA 5D63A 4AYBF 3KHGA 5D46A 3NYBA 3UMBA 1B4FA 2RDIA 1PK3A 2NO4A 4EEYA 2FI1A 4EV6A 4FH3A 3C18A 5EWEA 5DEDA 2QB1A 4YR3A 1FA0A 2DF4B 4YR2A 4O3RA 4EBKA 2NRKA 4M9JA 7ICPA 4X4VA 4ICAA 5AKLA 3TKAA 3LYSA 2E1FA 1LVHA 2E3TA 4O9MA 1F5SA 2MA1A 5KT7A 3PNCA 3PX4A 1NK0A 4QZGA 5GTIU 1L3TA 2Y0SF 3H3AA 5HRBA 4G3IA 3WKAA 2DPIA 4IQTA 1ECWA 3EZ5A 3ISDA 3G6YA 1FEZA 8ICGA 2DRBA 2WF9A 2G08A 4YMMA 1XS9D 3Q8MA 1S77D 1N63A 1PK1B 1X9SA 2ZHBA 4NKUA 5KG7A 1RQLA 3GQCA 3KHLA 3AL0B 8ICNA 4X0BA 5J8YC 3SV4A 1N56A 1TVAA 3ICXA 3C1YA 2K4IA 4QIWC 2EQYA 2J6TA 2ZHAA 5KG6A 7ICMA 1BNOA 2ZH4A 4PPXA 2KK0A 2K89A 2KJ8A 2ISPA 5KFBA 2FMPA 4I27A 4QWCA 1ZJMA 2R8JA 4G9BA 5AKHA 4KLUA 2DUYA 5AICA 3M7DA 1ZQCA 3H8JA 2JEJA 3CW2C 3MGHA 2GOLA 4FHWA 4B9NA 3E0FA 3ERCC 1Q79A 2BKEA 3B9JA 4M6WA 2OH2A 5T14A 1P7DA 1IM4A 2JXJA 3MDAA 2BZFA 4R8UA 4M5DA 4RQ7A 2PXIA 4Q45A 4DFDA 5AK6A 3KZXA 4Y2PA 4J9RA 4QZFA 4K4IA 2QARB 1DK2A 4NLNA 4Z6CA 2LYAA 2BCUA 5BOMA 3PZPA 1RQNA 4ED6A 4AYBC 2XCAA 1KFSA 2H3VA 2KJ5A 3T3FA 3GIIA 3PW7A 4DSKA 5HREA 4K9AA 2KZ3A 2ZH8A 2HMXA 4P0PA 4RWPA 2IOFK 1KBUA 3SEIA 5ALJA 5CFUA 2HHTA 4PGXA 1ZQHA 1TAMA 1T7PA 4CGZA 1BPXA 1K1SA 2A1JB 4PJ0U 5AK4A 1XSPA 2DR5A 1M6YA 4B6JA 2WAQF 4YN4A 1QQ5A 9ICUA 4MKPA 1ZQIA 2FLNA 1SZPA 5KFOA 5KFJA 8ICJA 1Z00A 1FIQA 3SZ2A 3JPOA 2I6XA 2ZJ5A 1TFRA 4R66A 3AMZA 3HKZF 3IG8A 4OD0A 2QARA 1ZQVA 3HKZC 5J2GA 4RWQA 1N5WA 4F4YA 3ONNA 2F2AB 4AP9A 1MIWA 1ZD3A 4K96A 4Q8EA 5IINA 4ECRA 2F77X 2KN7A 9ICMA 4DQPA 3L9DA 4X4RA 1J2NA 5ALHA 2V9WA 2H5XA 4MF8A 2FJ6A 4AT7A 9ICRA 2HI0A 3FAHA 1S9FA 4DQIA 3K75D 4NXZA 4XJEA 3F5AA 1WOTA 4YMOA 3NRZA 5L1IA 4RT3A 4NJ8A 1KW4A 1ZQAA 2C2EA 1XC9A 2ASDA 4X4QA 2VIXA 3QXGA 3UMCA 8ICSA 3OSNA 1U45A 1X9MA 2DQNB 3CYMA 3TQ1A 4Z6FA 1SKWA 3MCRA 5CHGA 4F4ZA 8ICRA 5J0UA 3HWTA 4QZEA 2ZIXB 2WB1C 4OAGA 2HVHA 1U49A 4BWMA 4O67A 2E8OA 1ZRMA 2AXTU 4DFJA 5D4BA 2QLTA 1T3QA 2XCPA 4DOBA 3Q8RB 3J81j 1DK3A 3GIMA 4ECTA 4JUZA 2KVSA 7ICGA 4F5OA 1KNYA 4DL5A 2YMLA 2VA3A 4NXWA 3QEAZ 1ZQPA 4XRHA 1B22A 3N28A 2M9NA 3IRUA 5KFDA 4O3QA 4WH5A 4RQ1A 3HJEA 4BWJA 3VC8A 1TFWA 3WU2U 5KFLA 2BQRA 3MGVA 4X0AA 4C7ZA 5JTIA 4AT8A 5KT4A 2XY5A 1ZQXA 5DECA 5CJ7A 5GTHU 2ZH6A 3UQ0A 4F4KA 5CP2A 5DBCA 3UQ2A 5HRFA 2Y1JA 4DS4A 4WJ3B 3HJ1A 2G09A 4DCCA 2DWQA 1KFDA 3TADA 4F93B 1ZQNA 5ALIA 4WC6A 4O3SA 2R18A 4NXTA 3K1ZA 2CPRA 3EWAA 5CRXA 5AKXA 5DQHA 2BBHA 5AKZA 5AI6A 4C8OA 4JLZA 4KX3A 3JPQA 4RWNA 2KKPA 4KM5A 3PVXA 3KKAC 4RQ5A 1BVSA 2V4QA 4LEWA 4YR0A 3H37A 4TQSA 1T94A 4DQQA 4JWNA 3L4PA 2NYVA 3BS5A 4KLHA 1RDFA 5HC9A 4OO1J 4WBYA 3JPRA 2KHVA 2AU0A 4QZBA 3PR5B 3LWMA 3PW2A 2E8NA 4UAYA 3T5KA 8ICWA 5J2BA 2FPMA 4Y2JA 2AH5A 3RH6A 5KT2A 5KFYA 2Z7JA 5AKJA 3WK4A 3RBEA 1J2MA 4BXOA 4NLGA 2FDRA 1ZQMA 2HN2A 4NLKA 5L1KA 4RT2A 1N5XA 2ES6A 4ED7A 4Q44A 3PR4A 3N7SC 5KG3A 1NKBA 4I2IA 4JMUA 3BZKA 2W11A 2W8LA 3ZDAA 3WFPA 3RJIA 4M0AA 1F44A 4Z6DA 4DL6A 4ATBA 1QTMA 2YB1A 7ICQA 4DQSA 3OPXA 4IR1A 1ZD5A 1HEKA 5BPCA 1JROA 1QCKA 2B56A 1N61A 8ICEA 4EEDA 1PVRA 4X4NA 5EE9A 4S3NA 4B9UA 2KNJA 3PY8A 3M6KA 4PZOA 5DLGA 3H4BA 5KL1B 4U7CA 3PMNA 2ZG6A 5JU5A 3SYZA 2ATLA 1XO0A 9ICKA 4OJOA 4PHEA 3GDXA 4UAVA 4XQ7A 4R63A 1QSLA 2W9MA 1GPJA
chains in the Genus database with same CATH topology
3H8SA 4QZHA 2HHVA 1HJPA 1V4AA 3AQNA 1UA1A 5KFQA 4DSJA 2BPGA 3RAQA 4P4OA 4I2JA 3JPNA 4DS5A 3TFRA 2ZJAA 4K4GA 2W9CB 4KLIA 4ECWA 1BPZA 1TV9A 4MFCA 4O3OA 3GV8B 4F2SA 1KFTA 5DDYA 5D49A 4M6WB 5KFMA 1UEVA 1NJYA 4QWEA 5IIIA 5KT6A 3OJSA 3TAPA 1ZQKA 4EZ6A 4EBCA 2BDPA 4M9HA 4KLQA 4FS2A 2IA6A 1U9LA 3RJJA 4I2AA 4UD5A 1DOQA 5KFEA 4E7XA 5HRHA 3UXOA 1A77A 4F4WA 4KMUA 4IR9A 4O5EA 1QSSA 9ICEA 5KTQA 3HW8A 5CWRA 2XO7A 3JPPA 3C21A 1VFGA 4UBCA 3EPIA 3SV3A 4ECYA 9ICCA 4C8KA 4J9QA 4ZH4A 5DBBA 2V4RA 3RJKA 9ICTA 1NZPA 1TAQA 9ICVA 2Q0ZX 3KHGA 5DG8A 4B9TA 3OVBA 5DDMA 4DO9A 1ZQRA 2WTFA 1XWLA 2P66A 5D46A 4Q43A 4RUCA 5EWFA 3NYBA 1NOMA 3C23A 4UAZA 2KZZA 2RDIA 5HRGA 4EEYA 3PW5A 1S0VA 2ZTCA 4PHAA 4I2EA 7ICRA 4FH3A 5EOZA 3MABA 5HHIA 4DQRA 5EWEA 3C18A 3PMLA 5DEDA 4IRDA 1ZQGA 4YR3A 1FA0A 2VANA 4X4TA 4YR2A 5KFPA 2JZBB 4DOCA 3TI0A 2AQ0A 4O3RA 4EBKA 2DPJA 4KLFA 4YFKA 2NRKA 3EPGA 3UPQA 4F5RA 8ICKA 1BGXT 4RPZA 4XUSA 3PW0A 4M9JA 7ICPA 4X4VA 4QW9A 4CCHA 4TUSA 1A76A 5DG7A 4ECSA 1TK5A 4NY8A 4UAWA 5IIJA 5IIMA 1SL1A 4YP3A 5KFAA 4YCXA 5KFWA 3K4GA 4B9VA 1YLQA 4BGDA 1SL0A 3MR6A 4O9MA 8ICYA 1RXWA 1BPYA 4DSEA 4X4SA 2HHPA 2I1QA 8ICPA 5KT7A 3PNCA 3PX4A 2AGOA 4DL2A 5J2CA 1NKCA 4J9PA 1NK0A 4NLZA 8ICLA 3WFQE 1NK5A 4QZGA 4EZ9A 1L3TA 3MR5A 1TK0A 2C22A 4ECQA 3H3AA 5HRBA 4G3IA 5J0YA 2DPIA 4IQTA 3H39A 5KT5A 4P4MA 5CR0A 1QLNA 1NK9A 3JZ0A 3MR2A 3ISCA 3ISDA 3EZ5A 3M9OB 3G6YA 4C8LA 4YVZA 9ICGA 1UETA 1MIYA 8ICGA 4YQWA 8ICAA 4ECZA 2BCSA 3AQLA 2DRBA 4UD4A 5KFVA 3OHBA 4J9KA 4YMMA 4FBTA 3H4DA 1XS9D 2UVVA 4DSIA 2IHMA 4JV2A 3Q8MA 1S77D 3T5HA 3BDPA 4Q8FA 1T8EA 2ZH3A 3TFSA 4DLEA 4ED8A 3RR8A 3EYZA 1X9SA 3OV7A 1XSNA 2JEFA 4YXJA 3HP6A 1ZQZA 3V7LA 4UB3A 2VA2A 4DLGA 2ZHBA 3WFRE 4NKUA 1JMSA 5KG7A 1EXNA 2F1IA 2JZBA 3GQCA 5KFKA 3KHLA 8ICNA 5F2VO 4X0BA 1L3UA 9ICBA 2KTQA 3LDAA 3SV4A 3GIJA 2UVUA 1N56A 4E0DA 2C2DA 4F2RA 1TVAA 4IG8A 4YMNA 3C1YA 1KEJA 7ICFA 4I2DA 3MBYA 1S76D 2J6TA 4AT7B 1R89A 1Z3EB 4KLDA 2HVIA 2ZHAA 1TFYA 4UB5A 1SKSA 1MQ2A 1JQRA 5KG6A 2KP7A 3OUYB 3GV5B 7ICMA 1BNOA 2ZH4A 4PPXA 1ZJNA 5DG9A 1LB2B 4ED0A 4DL3A 2ISPA 1D8LA 5KFBA 2NRTA 2FMPA 4QWAA 4QWCA 1ZJMA 2R8KA 2R8JA 4I27A 4B9LA 4BDPA 3RB4A 4PH5A 1D9FA 2JEGA 9ICWA 4KLUA 4FHVA 4QZ9A 1ZQCA 2BQ3A 2NRVA 1MC8A 1UT5A 4F5QA 3UXNA 1ZQSA 3H8JA 4TURA 3MGHA 2JEJA 2O5AA 4FHWA 4B9NA 4F8RA 3GFKB 1MSWD 4PGQA 3ORYA 5KG5A 1NJWA 4RZRA 1Q79A 2BKEA 5HHHA 5J0OA 3C2MA 2AGPA 1RZTA 4FH5A 4M6WA 4WC7A 1S0OA 2VA8A 1MQ3A 4DOAA 5DB8A 1T3NA 1IM4A 5L1JA 2KFNA 4X4PA 5KFRA 3MDAA 4R8UA 2AJQA 3HX0A 4M5DA 3RB0A 4RQ7A 4YXMA 2FPLA 2PXIA 4O3NA 9ICJA 4WCWA 5J2DA 4Q45A 2MUTA 4UB2A 4UBBA 1BPDA 1RPLA 1ZQFA 5KFSA 3ISBA 4J9RA 4E80A 4QZFA 4ECUA 4K4IA 3C66A 2ZUBA 3V7KA 1DK2A 4NLNA 5HP4A 4KN7A 3QZ7A 4Z6CA 2XGPA 4PHPA 7ICVA 1QSYA 2BCUA 5BOMA 4F3OA 4P4PA 3BQ1A 4ED6A 1BPEA 1H38A 4IQVA 5KFTA 2P6UA 4KLOA 4KLTA 2XCAA 4QZCA 1JIHA 1UA0A 1KFSA 2PFPA 3T3FA 4X5VA 3GIIA 5TZVA 3PW7A 4DSKA 4EBEA 4MF2A 5HREA 2KZ3A 2ZH8A 4RWPA 4RQ0A 2NRWA 4LZDA 4FBUA 4IQWA 3RJEA 1PZNA 2HHUA 1KRPA 2GWSA 1AROP 7ICOA 4JV0A 3M8SA 3H40A 2HHTA 3OVSA 4PGXA 1ZQHA 8ICVA 4O5KA 7ICEA 1T7PA 1NK6A 9ICOA 4C8MA 1K1SA 1BPXA 7ICJA 4KN4A 4F5NA 1R8AA 3FDSA 2A1JB 3HT3A 1K1QA 1XSPA 2DR5A 1L3VA 5HRKA 3G6VA 4YN4A 3PV8A 2W9BB 3HIYA 2XC9A 4DF4A 4K4HA 3WFSC 2W9BA 1S0MA 3RJGA 1X2IA 5EWGA 4EBDA 2BE3A 9ICUA 3IHQB 3TARA 1ZQIA 3OSPA 2BPCA 2ID1A 2W9AA 2FLNA 3BQ2A 4HYKA 4LZGA 3NTUA 5CA7A 4WC3A 1SZPA 3KHHA 5KFOA 4PHDA 3MGIA 4NM2A 4KLMA 1S97A 2KZMA 5KFJA 1ZQDA 3WFOA 4QW8A 8ICJA 1NJZA 4YD1A 4B9SA 3PX0A 4FHPA 1ZQYA 4IRCA 2B21A 1Z00A 3Q8KA 2UVWA 3SZ2A 8ICOA 5J2FA 3JPOA 8ICCA 2ZJ5A 1TFRA 4R66A 2BCQA 4I29A 9ICAA 5KT3A 4WC5A 3V6HA 4DEZA 3ZDDA 5J2GA 1ZQVA 3EW9A 4RWQA 2ZH2A 4F92B 4F4YA 1ZQQA 1KTQA 5DB7A 3C5FA 8ICQA 4AT9B 4X4OA 2ZH9A 4B9MA 2Q66A 3RR7A 2IHNA 3C2LA 1MIWA 3AU6A 5KG2A 4Q8EA 1L3SA 2NRZA 5IINA 3SI8A 9ICSA 2FLPA 4ECRA 1RYSA 3UPSA 2KN7A 3G6XA 3NGDA 9ICMA 4DQPA 1CUKA 2F1HA 4ED2A 4UQGA 3RBDA 4M9NA 1R8CA 3L9DA 4X4RA 4M9LA 3JPSA 2H5XA 2V9WA 4ELTA 4RWOA 4MF8A 5DGBA 4FS1A 4KTQA 2ZUCA 4AT7A 9ICRA 4LT6A 4LVSA 3C5GA 4GC7A 4TQRA 9ICLA 2HW3A 1WCNA 5DB6A 1S9FA 7ICLA 4DQIA 2LYHA 5IIKA 4R64A 4M04A 1T4GA 3K75D 3V6KA 4XA5A 1WCLA 4NXZA 8ICIA 8ICUA 1NKEA 4I28A 1D9DA 2ZH7A 1WOTA 3PX6A 4YMOA 2J6SA 2P6RA 5L1IA 3AQMA 4RT3A 2M2VA 1ZQAA 2C2EA 1XC9A 2ASDA 2FMSA 5J2KA 4X4QA 3IM1A 4KLLA 8ICSA 3OSNA 4ATBB 1U45A 1X9MA 3TQ1A 2IBKA 4Z6FA 2NRXA 3OGUA 4ED1A 1SKWA 4WC4A 4I2CA 3AQKA 3GV7B 5HR9A 5F9NA 3T5LA 5CHGA 4F4ZA 8ICRA 1JXEA 4WBZA 4E8FA 5J0UA 5DQGA 3HWTA 4EYIB 2AQ4A 2HHXA 4QZEA 3MFHA 4AT8B 3KHRA 1U49A 2RDJA 5J0RA 4BWMA 2PFOA 2HVHA 2HHWA 4JV1A 3RH4A 3RJHA 3B0XA 1ZYQA 1KDHA 3LQCB 1C7YA 1UEUA 3B0YA 4I2GA 4KLJA 4XQ8A 4DFJA 5D4BA 5KG0A 1TK8A 4ECXA 3BJYA 3T5JA 3Q8LA 2J6UA 4GC6A 2XCPA 4DFMA 5KFIA 4DOBA 4NKTA 4RU9A 4QWDA 3Q8RB 3LWLA 4KITB 4TUPA 5J0SA 4J9OA 3GIMA 5DBAA 2W8KA 4ECTA 3V7JA 4ED3A 1SL2A 1DK3A 3MFIA 4P2HA 4JUZA 2BCRA 5HRIA 1D8YA 3PW4A 2I9GA 7ICGA 4UB4A 4F5OA 3FYHA 4TUQA 3AUOA 1ZQUA 2HHSA 4DL5A 1KNYA 2VA3A 2UVRA 2BCVA 3QEAZ 5HNKA 4Z6EA 4XRHA 1ZQPA 9ICXA 8ICXA 1B22A 2MAXA 4M9GA 4KLEA 5KFCA 5DLFA 3M8RA 2M9NA 2XY6A 4RNOA 2ASJA 4F5PA 4DSLA 2RFFA 5KFDA 4O3QA 4RQ1A 2ZTDA 4DFKA 8ICTA 9ICPA 2O1PA 4BWJA 1TFWA 4PGYA 2F1JA 5KFLA 2M2UA 3QZ8A 3AU2A 4GLXA 2IMWP 1RYRA 2BQRA 4WC1A 4X0AA 2DR8A 1Y88A 3UXPA 5KFHA 1X9WA 4RUAA 2FMQA 1SKRA 2ALZA 1KLNA 4KLSA 3BQ0A 3GIKA 4AT8A 5KT4A 2XY5A 4J9MA 3Q8QB 3RAXA 1ZQXA 3KTQA 5DECA 4O0IA 2FPKA 1NO5A 1ZQJA 5KFXA 2MUTB 5CJ7A 3PO5A 2ZH6A 3UQ0A 3JYYA 1NJXA 4F50A 4F4KA 5CP2A 1TAUA 2DR9A 5DBCA 5J29A 5J2JA 3UQ2A 3TAQA 2JEIA 5HRFA 4O3PA 2Y1JA 5J2HA 4DS4A 2BQUA 3HJ1A 4QWBA 3RRGA 3C1ZA 4ELVA 2M2WA 2R8HA 1KFDA 4F93B 1ZQLA 4MFAA 5HMMA 1ZQNA 4ELUA 3H38A 2Y1IA 4WC6A 4FHYA 4O3SA 4QZIA 2PFQA 1KSPA 3OVAA 3N4MB 5J0PA 2ZH5A 3RRHA 3EWAA 3C2KA 4RPXA 2M2TA 4GXIA 4RQ6A 3ZD8A 5J2EA 5DQHA 5DQIA 5J2IA 4X4UA 4M2YA 3GILA 4C8OA 7ICSA 2PI5A 4IRKA 5KFFA 3JPQA 4DF8A 4RWNA 1RXVA 3PVXA 5DGAA 4RNMA 1NK4A 5CB1A 4RQ5A 1BVSA 4R8UB 5DB9A 2V4QA 1ZQTA 4I2HA 2KFZA 4YR0A 1ZQOA 3H37A 3H8WA 4IQUA 4TQSA 4DQQA 1F5AA 2R8IA 4JWNA 3QE9Y 4RQ2A 4KLHA 4F4XA 4DFPA 1V9PA 1JAJA 5HC9A 4UB1A 2AGQA 1JX4A 8ICHA 1ZQWA 4YD2A 2XY7A 4WBYA 3JPRA 1N48A 5KFZA 4QZBA 2AU0A 3PR5B 1XSLA 1BNPA 4O5CA 2ZH1A 7ICNA 3M9MB 4RQ8A 2XGQA 3LWMA 1ZETA 4AT9A 1Z00B 3OHAA 2BGWA 5KFUA 4GXKA 4MEYA 3PW2A 1HUZA 2FLLA 9ICFA 3OUYA 4UAYA 3ZD9A 1ZQEA 3T5KA 5HRDA 3MR3A 8ICWA 5J0QA 4EYHB 5J2BA 1CEZA 2FPMA 4DL7A 2W9CA 3RH6A 2ISOA 5KT2A 4DSFA 4KLGA 1LV5A 5KFYA 1OU5A 3RH5A 4R65A 4ECVA 4RQ3A 4WC2A 1U47A 3RBEA 3N97B 1XO1A 5IIOA 1NK8A 4MEXA 7ICIA 3V72A 1JN3A 5KG4A 2PFNA 2PI4A 4BXOA 3V6JA 1DGSA 3ZDCA 5C5JA 5F9LA 3Q8SB 4NLGA 4I2FA 1ZQMA 4FHXA 2A1JA 3JPTA 2DR7A 1Q78A 5KFGA 4NLKA 5L1KA 4RT2A 5J0WA 1B43A 3RJFA 4ED7A 2BHNA 2DVIA 3Q8PB 4Q44A 1COOA 4RPYA 4JWMA 3PR4A 5KG3A 1NKBA 1TKDA 4I2IA 3ETLA 1JXLA 3MDCA 4M47A 2DRAA 4NM1A 4I2BA 4FO6A 1S10A 1U48A 5IILA 2BR0A 2DFLA 2W8LA 3ZDAA 3WFPA 3RJIA 4RNNA 2C2RA 5HMLA 4M0AA 4J9SA 4Z6DA 4DL6A 3RB3A 2C28A 2R8GA 2OWOA 4J9LA 1QTMA 4ATBA 4C8NA 9ICNA 1BPBA 1L5UA 7ICQA 5DKWA 3BQTA 1PX5A 5KG1A 2HHQA 4QZAA 4DQSA 7ICHA 9ICQA 4IR1A 1U4BA 8ICFA 5BPCA 8ICBA 8ICMA 1UT8A 5KFNA 3RTVA 8ICEA 3OJUA 1IXRA 9ICIA 4X4NA 3LK9A 4BXOB 1ZQBA 5J0XA 4WC0A 4S3NA 2PBEA 4RQ4A 3M9NB 4B9UA 5J2AA 3ZDBA 3PY8A 2ZJ8A 3H7IA 3PO4A 5BOLA 5DLGA 5JUMA 5L1LA 4EP7A 4EBJA 4QZ8A 3E2EA 3H4BA 1R8BA 2ZUDA 5HRLA 3PMNA 1XU4A 4DL4A 3RB6A 4DWIA 7ICTA 1VJ7A 3SYZA 2ATLA 8ICZA 4F91B 3TANA 1S0NA 3THVA 9ICKA 4QZDA 4YG2A 5L9XA 2ZTEA 4GXJA 1NK7A 5J0TA 4J9NA 3ZDEA 1MIVA 4PHEA 3GDXA 3QEBZ 3HPOA 4XQ7A 2BPFA 4R63A 1HUOA 1QSLA 3HJ4A 7ICUA 9ICHA 2ASLA 7ICKA 2W9MA 4JK1A 4MFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8S A;  4QZH A;  2HHV A;  1HJP A;  1V4A A;  3AQN A;  1UA1 A;  5KFQ A;  4DSJ A;  2BPG A;  3RAQ A;  4P4O A;  4I2J A;  3JPN A;  4DS5 A;  3TFR A;  2ZJA A;  4K4G A;  2W9C B;  4KLI A;  4ECW A;  1BPZ A;  1TV9 A;  4MFC A;  4O3O A;  3GV8 B;  4F2S A;  1KFT A;  5DDY A;  5D49 A;  4M6W B;  5KFM A;  1UEV A;  1NJY A;  4QWE A;  5III A;  5KT6 A;  3OJS A;  3TAP A;  1ZQK A;  4EZ6 A;  4EBC A;  2BDP A;  4M9H A;  4KLQ A;  4FS2 A;  2IA6 A;  1U9L A;  3RJJ A;  4I2A A;  4UD5 A;  1DOQ A;  5KFE A;  4E7X A;  5HRH A;  3UXO A;  1A77 A;  4F4W A;  4KMU A;  4IR9 A;  4O5E A;  1QSS A;  9ICE A;  5KTQ A;  3HW8 A;  5CWR A;  2XO7 A;  3JPP A;  3C21 A;  1VFG A;  4UBC A;  3EPI A;  3SV3 A;  4ECY A;  9ICC A;  4C8K A;  4J9Q A;  4ZH4 A;  5DBB A;  2V4R A;  3RJK A;  9ICT A;  1NZP A;  1TAQ A;  9ICV A;  2Q0Z X;  3KHG A;  5DG8 A;  4B9T A;  3OVB A;  5DDM A;  4DO9 A;  1ZQR A;  2WTF A;  1XWL A;  2P66 A;  5D46 A;  4Q43 A;  4RUC A;  5EWF A;  3NYB A;  1NOM A;  3C23 A;  4UAZ A;  2KZZ A;  2RDI A;  5HRG A;  4EEY A;  3PW5 A;  1S0V A;  2ZTC A;  4PHA A;  4I2E A;  7ICR A;  4FH3 A;  5EOZ A;  3MAB A;  5HHI A;  4DQR A;  5EWE A;  3C18 A;  3PML A;  5DED A;  4IRD A;  1ZQG A;  4YR3 A;  1FA0 A;  2VAN A;  4X4T A;  4YR2 A;  5KFP A;  2JZB B;  4DOC A;  3TI0 A;  2AQ0 A;  4O3R A;  4EBK A;  2DPJ A;  4KLF A;  4YFK A;  2NRK A;  3EPG A;  3UPQ A;  4F5R A;  8ICK A;  1BGX T;  4RPZ A;  4XUS A;  3PW0 A;  4M9J A;  7ICP A;  4X4V A;  4QW9 A;  4CCH A;  4TUS A;  1A76 A;  5DG7 A;  4ECS A;  1TK5 A;  4NY8 A;  4UAW A;  5IIJ A;  5IIM A;  1SL1 A;  4YP3 A;  5KFA A;  4YCX A;  5KFW A;  3K4G A;  4B9V A;  1YLQ A;  4BGD A;  1SL0 A;  3MR6 A;  4O9M A;  8ICY A;  1RXW A;  1BPY A;  4DSE A;  4X4S A;  2HHP A;  2I1Q A;  8ICP A;  5KT7 A;  3PNC A;  3PX4 A;  2AGO A;  4DL2 A;  5J2C A;  1NKC A;  4J9P A;  1NK0 A;  4NLZ A;  8ICL A;  3WFQ E;  1NK5 A;  4QZG A;  4EZ9 A;  1L3T A;  3MR5 A;  1TK0 A;  2C22 A;  4ECQ A;  3H3A A;  5HRB A;  4G3I A;  5J0Y A;  2DPI A;  4IQT A;  3H39 A;  5KT5 A;  4P4M A;  5CR0 A;  1QLN A;  1NK9 A;  3JZ0 A;  3MR2 A;  3ISC A;  3ISD A;  3EZ5 A;  3M9O B;  3G6Y A;  4C8L A;  4YVZ A;  9ICG A;  1UET A;  1MIY A;  8ICG A;  4YQW A;  8ICA A;  4ECZ A;  2BCS A;  3AQL A;  2DRB A;  4UD4 A;  5KFV A;  3OHB A;  4J9K A;  4YMM A;  4FBT A;  3H4D A;  1XS9 D;  2UVV A;  4DSI A;  2IHM A;  4JV2 A;  3Q8M A;  1S77 D;  3T5H A;  3BDP A;  4Q8F A;  1T8E A;  2ZH3 A;  3TFS A;  4DLE A;  4ED8 A;  3RR8 A;  3EYZ A;  1X9S A;  3OV7 A;  1XSN A;  2JEF A;  4YXJ A;  3HP6 A;  1ZQZ A;  3V7L A;  4UB3 A;  2VA2 A;  4DLG A;  2ZHB A;  3WFR E;  4NKU A;  1JMS A;  5KG7 A;  1EXN A;  2F1I A;  2JZB A;  3GQC A;  5KFK A;  3KHL A;  8ICN A;  5F2V O;  4X0B A;  1L3U A;  9ICB A;  2KTQ A;  3LDA A;  3SV4 A;  3GIJ A;  2UVU A;  1N56 A;  4E0D A;  2C2D A;  4F2R A;  1TVA A;  4IG8 A;  4YMN A;  3C1Y A;  1KEJ A;  7ICF A;  4I2D A;  3MBY A;  1S76 D;  2J6T A;  4AT7 B;  1R89 A;  1Z3E B;  4KLD A;  2HVI A;  2ZHA A;  1TFY A;  4UB5 A;  1SKS A;  1MQ2 A;  1JQR A;  5KG6 A;  2KP7 A;  3OUY B;  3GV5 B;  7ICM A;  1BNO A;  2ZH4 A;  4PPX A;  1ZJN A;  5DG9 A;  1LB2 B;  4ED0 A;  4DL3 A;  2ISP A;  1D8L A;  5KFB A;  2NRT A;  2FMP A;  4QWA A;  4QWC A;  1ZJM A;  2R8K A;  2R8J A;  4I27 A;  4B9L A;  4BDP A;  3RB4 A;  4PH5 A;  1D9F A;  2JEG A;  9ICW A;  4KLU A;  4FHV A;  4QZ9 A;  1ZQC A;  2BQ3 A;  2NRV A;  1MC8 A;  1UT5 A;  4F5Q A;  3UXN A;  1ZQS A;  3H8J A;  4TUR A;  3MGH A;  2JEJ A;  2O5A A;  4FHW A;  4B9N A;  4F8R A;  3GFK B;  1MSW D;  4PGQ A;  3ORY A;  5KG5 A;  1NJW A;  4RZR A;  1Q79 A;  2BKE A;  5HHH A;  5J0O A;  3C2M A;  2AGP A;  1RZT A;  4FH5 A;  4M6W A;  4WC7 A;  1S0O A;  2VA8 A;  1MQ3 A;  4DOA A;  5DB8 A;  1T3N A;  1IM4 A;  5L1J A;  2KFN A;  4X4P A;  5KFR A;  3MDA A;  4R8U A;  2AJQ A;  3HX0 A;  4M5D A;  3RB0 A;  4RQ7 A;  4YXM A;  2FPL A;  2PXI A;  4O3N A;  9ICJ A;  4WCW A;  5J2D A;  4Q45 A;  2MUT A;  4UB2 A;  4UBB A;  1BPD A;  1RPL A;  1ZQF A;  5KFS A;  3ISB A;  4J9R A;  4E80 A;  4QZF A;  4ECU A;  4K4I A;  3C66 A;  2ZUB A;  3V7K A;  1DK2 A;  4NLN A;  5HP4 A;  4KN7 A;  3QZ7 A;  4Z6C A;  2XGP A;  4PHP A;  7ICV A;  1QSY A;  2BCU A;  5BOM A;  4F3O A;  4P4P A;  3BQ1 A;  4ED6 A;  1BPE A;  1H38 A;  4IQV A;  5KFT A;  2P6U A;  4KLO A;  4KLT A;  2XCA A;  4QZC A;  1JIH A;  1UA0 A;  1KFS A;  2PFP A;  3T3F A;  4X5V A;  3GII A;  5TZV A;  3PW7 A;  4DSK A;  4EBE A;  4MF2 A;  5HRE A;  2KZ3 A;  2ZH8 A;  4RWP A;  4RQ0 A;  2NRW A;  4LZD A;  4FBU A;  4IQW A;  3RJE A;  1PZN A;  2HHU A;  1KRP A;  2GWS A;  1ARO P;  7ICO A;  4JV0 A;  3M8S A;  3H40 A;  2HHT A;  3OVS A;  4PGX A;  1ZQH A;  8ICV A;  4O5K A;  7ICE A;  1T7P A;  1NK6 A;  9ICO A;  4C8M A;  1K1S A;  1BPX A;  7ICJ A;  4KN4 A;  4F5N A;  1R8A A;  3FDS A;  2A1J B;  3HT3 A;  1K1Q A;  1XSP A;  2DR5 A;  1L3V A;  5HRK A;  3G6V A;  4YN4 A;  3PV8 A;  2W9B B;  3HIY A;  2XC9 A;  4DF4 A;  4K4H A;  3WFS C;  2W9B A;  1S0M A;  3RJG A;  1X2I A;  5EWG A;  4EBD A;  2BE3 A;  9ICU A;  3IHQ B;  3TAR A;  1ZQI A;  3OSP A;  2BPC A;  2ID1 A;  2W9A A;  2FLN A;  3BQ2 A;  4HYK A;  4LZG A;  3NTU A;  5CA7 A;  4WC3 A;  1SZP A;  3KHH A;  5KFO A;  4PHD A;  3MGI A;  4NM2 A;  4KLM A;  1S97 A;  2KZM A;  5KFJ A;  1ZQD A;  3WFO A;  4QW8 A;  8ICJ A;  1NJZ A;  4YD1 A;  4B9S A;  3PX0 A;  4FHP A;  1ZQY A;  4IRC A;  2B21 A;  1Z00 A;  3Q8K A;  2UVW A;  3SZ2 A;  8ICO A;  5J2F A;  3JPO A;  8ICC A;  2ZJ5 A;  1TFR A;  4R66 A;  2BCQ A;  4I29 A;  9ICA A;  5KT3 A;  4WC5 A;  3V6H A;  4DEZ A;  3ZDD A;  5J2G A;  1ZQV A;  3EW9 A;  4RWQ A;  2ZH2 A;  4F92 B;  4F4Y A;  1ZQQ A;  1KTQ A;  5DB7 A;  3C5F A;  8ICQ A;  4AT9 B;  4X4O A;  2ZH9 A;  4B9M A;  2Q66 A;  3RR7 A;  2IHN A;  3C2L A;  1MIW A;  3AU6 A;  5KG2 A;  4Q8E A;  1L3S A;  2NRZ A;  5IIN A;  3SI8 A;  9ICS A;  2FLP A;  4ECR A;  1RYS A;  3UPS A;  2KN7 A;  3G6X A;  3NGD A;  9ICM A;  4DQP A;  1CUK A;  2F1H A;  4ED2 A;  4UQG A;  3RBD A;  4M9N A;  1R8C A;  3L9D A;  4X4R A;  4M9L A;  3JPS A;  2H5X A;  2V9W A;  4ELT A;  4RWO A;  4MF8 A;  5DGB A;  4FS1 A;  4KTQ A;  2ZUC A;  4AT7 A;  9ICR A;  4LT6 A;  4LVS A;  3C5G A;  4GC7 A;  4TQR A;  9ICL A;  2HW3 A;  1WCN A;  5DB6 A;  1S9F A;  7ICL A;  4DQI A;  2LYH A;  5IIK A;  4R64 A;  4M04 A;  1T4G A;  3K75 D;  3V6K A;  4XA5 A;  1WCL A;  4NXZ A;  8ICI A;  8ICU A;  1NKE A;  4I28 A;  1D9D A;  2ZH7 A;  1WOT A;  3PX6 A;  4YMO A;  2J6S A;  2P6R A;  5L1I A;  3AQM A;  4RT3 A;  2M2V A;  1ZQA A;  2C2E A;  1XC9 A;  2ASD A;  2FMS A;  5J2K A;  4X4Q A;  3IM1 A;  4KLL A;  8ICS A;  3OSN A;  4ATB B;  1U45 A;  1X9M A;  3TQ1 A;  2IBK A;  4Z6F A;  2NRX A;  3OGU A;  4ED1 A;  1SKW A;  4WC4 A;  4I2C A;  3AQK A;  3GV7 B;  5HR9 A;  5F9N A;  3T5L A;  5CHG A;  4F4Z A;  8ICR A;  1JXE A;  4WBZ A;  4E8F A;  5J0U A;  5DQG A;  3HWT A;  4EYI B;  2AQ4 A;  2HHX A;  4QZE A;  3MFH A;  4AT8 B;  3KHR A;  1U49 A;  2RDJ A;  5J0R A;  4BWM A;  2PFO A;  2HVH A;  2HHW A;  4JV1 A;  3RH4 A;  3RJH A;  3B0X A;  1ZYQ A;  1KDH A;  3LQC B;  1C7Y A;  1UEU A;  3B0Y A;  4I2G A;  4KLJ A;  4XQ8 A;  4DFJ A;  5D4B A;  5KG0 A;  1TK8 A;  4ECX A;  3BJY A;  3T5J A;  3Q8L A;  2J6U A;  4GC6 A;  2XCP A;  4DFM A;  5KFI A;  4DOB A;  4NKT A;  4RU9 A;  4QWD A;  3Q8R B;  3LWL A;  4KIT B;  4TUP A;  5J0S A;  4J9O A;  3GIM A;  5DBA A;  2W8K A;  4ECT A;  3V7J A;  4ED3 A;  1SL2 A;  1DK3 A;  3MFI A;  4P2H A;  4JUZ A;  2BCR A;  5HRI A;  1D8Y A;  3PW4 A;  2I9G A;  7ICG A;  4UB4 A;  4F5O A;  3FYH A;  4TUQ A;  3AUO A;  1ZQU A;  2HHS A;  4DL5 A;  1KNY A;  2VA3 A;  2UVR A;  2BCV A;  3QEA Z;  5HNK A;  4Z6E A;  4XRH A;  1ZQP A;  9ICX A;  8ICX A;  1B22 A;  2MAX A;  4M9G A;  4KLE A;  5KFC A;  5DLF A;  3M8R A;  2M9N A;  2XY6 A;  4RNO A;  2ASJ A;  4F5P A;  4DSL A;  2RFF A;  5KFD A;  4O3Q A;  4RQ1 A;  2ZTD A;  4DFK A;  8ICT A;  9ICP A;  2O1P A;  4BWJ A;  1TFW A;  4PGY A;  2F1J A;  5KFL A;  2M2U A;  3QZ8 A;  3AU2 A;  4GLX A;  2IMW P;  1RYR A;  2BQR A;  4WC1 A;  4X0A A;  2DR8 A;  1Y88 A;  3UXP A;  5KFH A;  1X9W A;  4RUA A;  2FMQ A;  1SKR A;  2ALZ A;  1KLN A;  4KLS A;  3BQ0 A;  3GIK A;  4AT8 A;  5KT4 A;  2XY5 A;  4J9M A;  3Q8Q B;  3RAX A;  1ZQX A;  3KTQ A;  5DEC A;  4O0I A;  2FPK A;  1NO5 A;  1ZQJ A;  5KFX A;  2MUT B;  5CJ7 A;  3PO5 A;  2ZH6 A;  3UQ0 A;  3JYY A;  1NJX A;  4F50 A;  4F4K A;  5CP2 A;  1TAU A;  2DR9 A;  5DBC A;  5J29 A;  5J2J A;  3UQ2 A;  3TAQ A;  2JEI A;  5HRF A;  4O3P A;  2Y1J A;  5J2H A;  4DS4 A;  2BQU A;  3HJ1 A;  4QWB A;  3RRG A;  3C1Z A;  4ELV A;  2M2W A;  2R8H A;  1KFD A;  4F93 B;  1ZQL A;  4MFA A;  5HMM A;  1ZQN A;  4ELU A;  3H38 A;  2Y1I A;  4WC6 A;  4FHY A;  4O3S A;  4QZI A;  2PFQ A;  1KSP A;  3OVA A;  3N4M B;  5J0P A;  2ZH5 A;  3RRH A;  3EWA A;  3C2K A;  4RPX A;  2M2T A;  4GXI A;  4RQ6 A;  3ZD8 A;  5J2E A;  5DQH A;  5DQI A;  5J2I A;  4X4U A;  4M2Y A;  3GIL A;  4C8O A;  7ICS A;  2PI5 A;  4IRK A;  5KFF A;  3JPQ A;  4DF8 A;  4RWN A;  1RXV A;  3PVX A;  5DGA A;  4RNM A;  1NK4 A;  5CB1 A;  4RQ5 A;  1BVS A;  4R8U B;  5DB9 A;  2V4Q A;  1ZQT A;  4I2H A;  2KFZ A;  4YR0 A;  1ZQO A;  3H37 A;  3H8W A;  4IQU A;  4TQS A;  4DQQ A;  1F5A A;  2R8I A;  4JWN A;  3QE9 Y;  4RQ2 A;  4KLH A;  4F4X A;  4DFP A;  1V9P A;  1JAJ A;  5HC9 A;  4UB1 A;  2AGQ A;  1JX4 A;  8ICH A;  1ZQW A;  4YD2 A;  2XY7 A;  4WBY A;  3JPR A;  1N48 A;  5KFZ A;  4QZB A;  2AU0 A;  3PR5 B;  1XSL A;  1BNP A;  4O5C A;  2ZH1 A;  7ICN A;  3M9M B;  4RQ8 A;  2XGQ A;  3LWM A;  1ZET A;  4AT9 A;  1Z00 B;  3OHA A;  2BGW A;  5KFU A;  4GXK A;  4MEY A;  3PW2 A;  1HUZ A;  2FLL A;  9ICF A;  3OUY A;  4UAY A;  3ZD9 A;  1ZQE A;  3T5K A;  5HRD A;  3MR3 A;  8ICW A;  5J0Q A;  4EYH B;  5J2B A;  1CEZ A;  2FPM A;  4DL7 A;  2W9C A;  3RH6 A;  2ISO A;  5KT2 A;  4DSF A;  4KLG A;  1LV5 A;  5KFY A;  1OU5 A;  3RH5 A;  4R65 A;  4ECV A;  4RQ3 A;  4WC2 A;  1U47 A;  3RBE A;  3N97 B;  1XO1 A;  5IIO A;  1NK8 A;  4MEX A;  7ICI A;  3V72 A;  1JN3 A;  5KG4 A;  2PFN A;  2PI4 A;  4BXO A;  3V6J A;  1DGS A;  3ZDC A;  5C5J A;  5F9L A;  3Q8S B;  4NLG A;  4I2F A;  1ZQM A;  4FHX A;  2A1J A;  3JPT A;  2DR7 A;  1Q78 A;  5KFG A;  4NLK A;  5L1K A;  4RT2 A;  5J0W A;  1B43 A;  3RJF A;  4ED7 A;  2BHN A;  2DVI A;  3Q8P B;  4Q44 A;  1COO A;  4RPY A;  4JWM A;  3PR4 A;  5KG3 A;  1NKB A;  1TKD A;  4I2I A;  3ETL A;  1JXL A;  3MDC A;  4M47 A;  2DRA A;  4NM1 A;  4I2B A;  4FO6 A;  1S10 A;  1U48 A;  5IIL A;  2BR0 A;  2DFL A;  2W8L A;  3ZDA A;  3WFP A;  3RJI A;  4RNN A;  2C2R A;  5HML A;  4M0A A;  4J9S A;  4Z6D A;  4DL6 A;  3RB3 A;  2C28 A;  2R8G A;  2OWO A;  4J9L A;  1QTM A;  4ATB A;  4C8N A;  9ICN A;  1BPB A;  1L5U A;  7ICQ A;  5DKW A;  3BQT A;  1PX5 A;  5KG1 A;  2HHQ A;  4QZA A;  4DQS A;  7ICH A;  9ICQ A;  4IR1 A;  1U4B A;  8ICF A;  5BPC A;  8ICB A;  8ICM A;  1UT8 A;  5KFN A;  3RTV A;  8ICE A;  3OJU A;  1IXR A;  9ICI A;  4X4N A;  3LK9 A;  4BXO B;  1ZQB A;  5J0X A;  4WC0 A;  4S3N A;  2PBE A;  4RQ4 A;  3M9N B;  4B9U A;  5J2A A;  3ZDB A;  3PY8 A;  2ZJ8 A;  3H7I A;  3PO4 A;  5BOL A;  5DLG A;  5JUM A;  5L1L A;  4EP7 A;  4EBJ A;  4QZ8 A;  3E2E A;  3H4B A;  1R8B A;  2ZUD A;  5HRL A;  3PMN A;  1XU4 A;  4DL4 A;  3RB6 A;  4DWI A;  7ICT A;  1VJ7 A;  3SYZ A;  2ATL A;  8ICZ A;  4F91 B;  3TAN A;  1S0N A;  3THV A;  9ICK A;  4QZD A;  4YG2 A;  5L9X A;  2ZTE A;  4GXJ A;  1NK7 A;  5J0T A;  4J9N A;  3ZDE A;  1MIV A;  4PHE A;  3GDX A;  3QEB Z;  3HPO A;  4XQ7 A;  2BPF A;  4R63 A;  1HUO A;  1QSL A;  3HJ4 A;  7ICU A;  9ICH A;  2ASL A;  7ICK A;  2W9M A;  4JK1 A;  4MFF A; 
#chains in the Genus database with same CATH topology
 2HHV A;  1HJP A;  3AQN A;  1UA1 A;  4K99 A;  5KFQ A;  2WB1 F;  3TFR A;  2ZJA A;  2EWR A;  2B0C A;  1BPZ A;  2GAF D;  2BDU A;  5D49 A;  2CN1 A;  5KFM A;  4M9H A;  2BDP A;  4I2A A;  1U9L A;  2OCE A;  4F4W A;  5KTQ A;  3NVY A;  2KVC A;  3AEV A;  1VFG A;  1JAL A;  1OXJ A;  2G06 A;  1O03 A;  1TAQ A;  9ICV A;  2LYB A;  4B9T A;  3OVB A;  5DDM A;  4BJQ A;  3WK7 A;  1D8B A;  5ALX A;  5HRG A;  5AI8 A;  3L3F X;  3PW5 A;  1S0V A;  5EOZ A;  3MAB A;  2JGA A;  1AQ6 A;  3PML A;  4IRD A;  1JRP A;  4DOC A;  2DPJ A;  4KLF A;  4F5R A;  1UCV A;  2W43 A;  4QW9 A;  2D6F C;  1LKY B;  4YP3 A;  5KFA A;  4YCX A;  4B9V A;  1YLQ A;  2K8B B;  4BGD A;  2F76 X;  2I1Q A;  8ICL A;  4DL2 A;  4NLZ A;  1NKC A;  5G5G A;  4J9P A;  5ALD A;  2HDO A;  3VCB A;  2H3F A;  2OXO A;  5CR0 A;  1QLN A;  1NK9 A;  3JZ0 A;  4NWI A;  3MR2 A;  3TAD C;  9ICG A;  4ATB B;  4C8L A;  2GA9 D;  2WFA A;  2BCS A;  3AQL A;  4UD4 A;  5KFV A;  3BZC A;  4FBT A;  1VJ5 A;  2IHM A;  3BDP A;  2ZH3 A;  5AI4 A;  4ED8 A;  3EYZ A;  1RG6 A;  1XSN A;  4YXJ A;  2VA2 A;  3WFR E;  4DLG A;  2D3D A;  1EXN A;  2JZB A;  1QH9 A;  3LDA A;  2C2D A;  3MBY A;  1L7O A;  4AT7 B;  1Z3E B;  2HVI A;  1ZRN A;  1SKS A;  4F72 A;  1Z4O A;  1X9X A;  2GLE A;  5ALO A;  5DG9 A;  1LB2 B;  2NRT A;  2R8K A;  2RLT A;  4BDP A;  4PH5 A;  3D2S A;  2BQ3 A;  2NRV A;  3KKA A;  1UT5 A;  3O0F A;  2ZIU A;  3SAG A;  1RYU A;  4C0Z A;  1ZQS A;  1Z1B A;  2JR5 A;  4EEN A;  2O5A A;  3C2M A;  5J0O A;  1RZT A;  2AGP A;  4FH5 A;  4WC7 A;  2VA8 A;  1MQ3 A;  3A0H U;  5DB8 A;  2GO7 A;  4FO1 A;  1FFU A;  4YXM A;  4O3N A;  5B5E U;  1ZQF A;  3NWI A;  2ZIV B;  3V7K A;  5HP4 A;  3QZ7 A;  5ALL A;  2BBJ A;  1QSY A;  3F53 A;  4P4P A;  5ALT A;  1H38 A;  4KLO A;  4QZC A;  5TZV A;  4UAS A;  5ALR A;  4EX7 A;  4IQW A;  3RJE A;  1PZN A;  1KRP A;  2GWS A;  7ICO A;  3M8S A;  3OVS A;  7ICJ A;  4OJ5 A;  3HT3 A;  1L3V A;  2LI6 A;  3ED5 A;  3HIY A;  3WFS C;  3IHQ B;  3OSP A;  4N7R A;  3NTU A;  5TIS U;  3KHH A;  4FZL A;  1S97 A;  2KZM A;  3WFO A;  4QW8 A;  1NJZ A;  1DGJ A;  3UMG A;  4B9S A;  1ZQY A;  4IRC A;  3NS1 A;  5J2F A;  1IV8 A;  3F5E A;  4I29 A;  3AQE A;  4DEZ A;  3ZDD A;  3QU4 A;  5AM2 A;  3EW9 A;  2MRL A;  4F92 B;  1ZQQ A;  1KTQ A;  5DB7 A;  3C5F A;  8ICQ A;  4AT9 B;  4B9M A;  2KJ9 A;  3RR7 A;  3C2L A;  3QYP A;  3AU6 A;  9ICS A;  3NGD A;  2A1A A;  4UQG A;  3I28 A;  4M9L A;  3JPS A;  4ELT A;  5DGB A;  4P0Q B;  4KTQ A;  4GC7 A;  1WCN A;  7ICL A;  5IIK A;  4C4T A;  1WYG A;  3D2Q A;  8ICI A;  3V6K A;  4XA5 A;  1WCL A;  8ICU A;  4O3M A;  4I28 A;  1L6N A;  3SD7 A;  1CRX A;  2JRZ A;  1HIW A;  2OM6 A;  4EEK A;  3OGU A;  4I2C A;  3GV7 B;  3MC1 A;  2YQE A;  3T5L A;  4WBZ A;  1JXE A;  2AQ4 A;  3NUQ A;  2PFO A;  2HHW A;  2RDJ A;  5CFS A;  1KDH A;  3LQC B;  2LKY A;  5ALP A;  2IUB A;  4ECX A;  3BJY A;  3T5J A;  3AQF A;  3Q8L A;  4GC6 A;  5KFI A;  4NKT A;  2EAO A;  3LWL A;  2LM4 A;  1L8O A;  5J0S A;  4PL2 A;  5DBA A;  3MFI A;  4P2H A;  5HRI A;  1D8Y A;  1QQ7 A;  3FYH A;  3AUO A;  5ALV A;  3PSI A;  4OJL A;  2KMD A;  4Z6E A;  5HNK A;  9ICX A;  3I1Y A;  8ICX A;  2RHF A;  2MAX A;  4M9G A;  2W54 A;  1ZOL A;  4DSL A;  4F5P A;  2RFF A;  5D61 A;  4IS7 A;  8ICT A;  2M2U A;  4C80 A;  1Z4N A;  4RUA A;  2VKQ A;  4US9 A;  4UAR A;  2ALZ A;  1KLN A;  5EE1 A;  4KLS A;  3GIK A;  3PO5 A;  1NJX A;  4F50 A;  1SB3 C;  2KSO A;  5J2H A;  4QWB A;  2KG5 A;  2W7O A;  3IN5 A;  2Y1I A;  1MN8 A;  4EEB A;  3OVA A;  3N4M B;  1QQ6 A;  3RRH A;  3C2K A;  5DQI A;  2MSN A;  3QX7 A;  2E5S A;  1A0P A;  4IRK A;  5KFF A;  2YY6 A;  5DGA A;  1NK4 A;  2KFZ A;  4R8U B;  2KEY A;  4I2H A;  1ZQO A;  1PUZ A;  2R8I A;  1V38 A;  4F4X A;  4US8 A;  4DFP A;  1JAJ A;  4UB1 A;  1ZQW A;  1N48 A;  4WQK A;  2Q4T A;  5FP0 A;  5AM1 A;  2W04 A;  4P0Q A;  3OHA A;  2BGW A;  5KFU A;  4MEY A;  3OUY A;  3WK6 A;  5AM4 A;  4EYH B;  1B0X A;  4WC2 A;  1U47 A;  1XO1 A;  7ICI A;  2PFN A;  1JN3 A;  3AN1 A;  4C4S A;  4I2F A;  1WWU A;  1Q8K A;  2RRD A;  4NXX A;  1Z1V A;  5KFG A;  4Y2Q A;  1SXE A;  5AK5 A;  3RJF A;  2BHN A;  3QUT A;  4CF4 A;  4JWM A;  2KSO B;  3ETL A;  1JXL A;  2DRA A;  4NV0 A;  2BR0 A;  4RNN A;  4J9S A;  3RB3 A;  4J9L A;  4C8N A;  4NLC A;  2EH9 A;  5KG1 A;  7ICH A;  2DBY A;  3KFU F;  8ICF A;  2YN4 A;  5KFN A;  3F2B A;  1IXR A;  3QU9 A;  4IL6 U;  2PBE A;  4RQ4 A;  2HOQ A;  2ZJ8 A;  3PO4 A;  2HOI A;  5L1L A;  4EBJ A;  2H3Z A;  2WF6 A;  2ZIU B;  3E2E A;  1R8B A;  2HOF A;  4OAI Z;  1S0N A;  5L9X A;  1NK7 A;  4J9N A;  2YX8 A;  1MIV A;  1KN5 A;  3QUQ A;  2RP5 A;  1HUO A;  7ICU A;  9ICH A;  4JK1 A;  2XID A;  2O6K A;  4DSJ A;  3RAQ A;  2YMP A;  5ALU A;  5ALQ A;  3BQ7 A;  4O3O A;  3GV8 B;  4UB8 U;  5DDY A;  1NJY A;  4EGW A;  3KD3 A;  5III A;  5KT6 A;  1ZQK A;  4KLQ A;  4UD5 A;  1DOQ A;  3UXO A;  1A77 A;  4O5E A;  1QSS A;  3CRX A;  3SV3 A;  4ECY A;  4J9Q A;  4ZH4 A;  5DBB A;  2EAN A;  4QIW F;  2H3Q A;  3OTQ A;  5DG8 A;  2F8L A;  4DO9 A;  2N1R A;  2WTF A;  1XWL A;  3M6Z A;  4RQN A;  3C23 A;  2KZZ A;  2ZTC A;  4I2E A;  2K4E A;  5AKY A;  2KHQ A;  4DQR A;  3WKB A;  2JH1 A;  1UPH A;  2AQ0 A;  3EPG A;  3IP4 B;  8ICK A;  1NZB A;  1BGX T;  2E8M A;  4XUS A;  1COK A;  4P0P B;  2JHD A;  1A76 A;  4K8V A;  5DG7 A;  3QNM A;  4NY8 A;  4UAW A;  5IIJ A;  1SL1 A;  5KFW A;  3MR6 A;  8ICY A;  1RXW A;  4DSE A;  2HHP A;  8ICP A;  2HBJ A;  5J2C A;  4EZ9 A;  3EF2 A;  3MR5 A;  2C22 A;  4Y2S A;  4C7Y A;  5D62 A;  5J0Y A;  4Y2Y A;  4P4M A;  3C29 A;  4CNQ A;  3ISC A;  4YVZ A;  1UET A;  3DV9 A;  4YQW A;  8ICA A;  4ECZ A;  3OHB A;  4J9K A;  4DSI A;  2UVV A;  5ALZ A;  4JV2 A;  4Q8F A;  1T8E A;  3TFS A;  3PSP A;  3OV7 A;  1KKX A;  3HP6 A;  5B3Q A;  1ZQZ A;  2LM1 A;  2HBK A;  2W55 A;  1JMS A;  4FE3 A;  2F1I A;  3ALR A;  4BX9 C;  2EAP A;  5KFK A;  4I0U A;  1L3U A;  9ICB A;  4E0D A;  2UVU A;  4YMN A;  2ESE A;  2EZX A;  1R89 A;  4KLD A;  2KIC A;  3OUY B;  1PVQ A;  1O08 A;  3GZF A;  2K60 A;  1ZJN A;  4WOY A;  1SWW A;  4QWA A;  1VDV A;  4B9L A;  3NRW A;  2JEG A;  4QZ9 A;  5J8Y A;  4F5Q A;  3UXN A;  4F8R A;  3OWG A;  1MSW D;  3ORY A;  5KG5 A;  4EX6 A;  4MHV A;  1NNL A;  4DOA A;  1T3N A;  5L1J A;  2KFN A;  4X4P A;  5KFR A;  2G07 A;  5ALN A;  3HX0 A;  1X40 A;  9ICJ A;  5J2D A;  2WF7 A;  4UB2 A;  1BPD A;  1RPL A;  4KMO B;  4ZOH C;  5ALF A;  5KFS A;  4E80 A;  1A6S A;  2XGP A;  7ICV A;  3U26 A;  2CXY A;  3FM9 A;  4IQV A;  4KLT A;  2P6U A;  3F2C A;  1JIH A;  2ZXI A;  4EBE A;  2M0N A;  4MF2 A;  1ED1 A;  4RQ0 A;  2NRW A;  2G5H B;  4JV0 A;  7ICE A;  1SGG A;  4C8M A;  5AHX A;  4F5N A;  3S6J A;  3G6V A;  3PV8 A;  4LEV A;  3FC4 A;  3A0B U;  1S0M A;  3RJG A;  1X2I A;  5EWG A;  4EBD A;  5L1M A;  3TAR A;  2LMR A;  2BPC A;  3BQ2 A;  4LZG A;  4WC3 A;  5CHE A;  2F8K A;  4KLM A;  1ZQD A;  3ZI4 A;  4FHP A;  2UVW A;  2ZIW B;  4CDG A;  4Y2U A;  5KT3 A;  4WC5 A;  2ZH2 A;  2ZH9 A;  2Q66 A;  2IHN A;  4UAT A;  3SI8 A;  1RYS A;  3D2N A;  5CFT A;  2DGZ A;  2K4P A;  3G6X A;  3RBD A;  2F1H A;  3NVW A;  4FS1 A;  1L7P A;  2YB4 A;  3SR6 A;  4TQR A;  9ICL A;  2HW3 A;  5DB6 A;  2LYH A;  4R64 A;  4O5K A;  1T4G A;  4A8E A;  2I5H A;  1NKE A;  1D9D A;  3CNH A;  2ZH7 A;  3PX6 A;  2KIW A;  3H8M A;  1L7N A;  5ALK A;  1SXD A;  5J2K A;  4CRX A;  2IBK A;  4WC4 A;  4ED1 A;  1XNS A;  5F9N A;  4EEL A;  5DQG A;  4EYI B;  4AT8 B;  5ALG A;  3KHR A;  5J0R A;  5AI5 A;  5A0L A;  3RH4 A;  3RJH A;  3B0X A;  1ZYQ A;  2K8A A;  2PMZ C;  3N7P D;  3B0Y A;  1C7Y A;  4I2G A;  4XQ8 A;  1UEU A;  1ZD2 P;  5KG0 A;  2W3R A;  1TK8 A;  1RM6 C;  5AKG A;  3R9K A;  4CF5 A;  4DFM A;  4RU9 A;  3I76 A;  4QWD A;  4ED3 A;  4TUP A;  4J9O A;  1SL2 A;  2OYY A;  2BCR A;  3PW4 A;  2I9G A;  4UB4 A;  5ALY A;  4TUQ A;  2Y9T A;  5AKE A;  3H0L B;  5KFC A;  3M8R A;  2XY6 A;  2ASJ A;  4DFK A;  2O1P A;  4PGY A;  3QZ8 A;  3LVV A;  3AU2 A;  4GLX A;  2IMW P;  4WC1 A;  5K4L A;  4OAH A;  2DR8 A;  5KFH A;  2FMQ A;  2W3S A;  3QU2 A;  5AKK A;  2ZIX A;  3KTQ A;  4J9M A;  1ZD4 A;  2FPK A;  1ZQJ A;  5KFX A;  4NL9 C;  2MUT B;  2WF8 A;  4JB3 A;  3D6J A;  3E58 A;  2DR9 A;  4PL1 A;  5J29 A;  4O3P A;  4C4R A;  4U6P A;  2LPE A;  3RRG A;  3N7R C;  4ELV A;  2PMZ F;  4UB6 U;  2M2W A;  2ZIV A;  4ELU A;  4MFA A;  3H38 A;  2DKX A;  1K5O A;  3UM9 A;  4QZI A;  2PFQ A;  1KSP A;  2ZH5 A;  5J0P A;  2EZZ A;  2M2T A;  5J2E A;  5J2I A;  4X4U A;  4M2Y A;  3GIL A;  2PI5 A;  5AM3 A;  1C20 A;  1ZQT A;  3SMV A;  2HBM A;  2QB0 A;  4IQU A;  1F5A A;  1V9P A;  1JX4 A;  8ICH A;  2XY7 A;  4YD2 A;  5AI9 A;  5KFZ A;  1ZXI A;  1XSL A;  1YZ7 A;  2ZH1 A;  3M9M B;  5EE3 A;  1ZET A;  2HBL A;  1IG6 A;  1Z00 B;  4FZN A;  4GXK A;  2JH7 A;  2FLL A;  3ZD9 A;  1ZQE A;  3MR3 A;  5J0Q A;  1Q3V A;  2EZY A;  1CEZ A;  4KLG A;  1LV5 A;  3QUB A;  3RH5 A;  5AK3 A;  4R65 A;  4RQ3 A;  4Y2R A;  1NK8 A;  5IIO A;  3V72 A;  2PI4 A;  1DGS A;  3Q8S B;  4FZM A;  2A1J A;  3JPT A;  2DR7 A;  1Q78 A;  4HAI A;  5AKI A;  5J0W A;  1B43 A;  3WKE A;  5HR6 A;  4RPY A;  1TKD A;  1N2X A;  1Q46 A;  4I2B A;  4FO6 A;  1S10 A;  4UW9 A;  2C2R A;  5HML A;  2R8G A;  2OWO A;  2CRX A;  4IC9 A;  1L5U A;  5DKW A;  1IIP A;  3BQT A;  4QZA A;  9ICQ A;  8ICM A;  3JCF A;  1UT8 A;  3RTV A;  5KNI A;  3OJU A;  4F71 A;  3LK9 A;  4BXO B;  4WC0 A;  3NVZ A;  1SV0 A;  3M9N B;  4RQM A;  2FCL A;  5J2A A;  2XIC A;  3H7I A;  5BOL A;  5JUM A;  5F3X B;  4EP7 A;  4OCZ A;  2YMM A;  2ZUD A;  5HRL A;  7ICT A;  1XU4 A;  3RB6 A;  4DWI A;  8ICZ A;  4OJP A;  3TAN A;  3THV A;  5CEH A;  3ZDE A;  3QEB Z;  2QB0 B;  5ALW A;  3WK9 A;  7ICK A;  2RQ5 A;  4MFF A;  3H8S A;  4QZH A;  1V4A A;  4P4O A;  4I2J A;  3JPN A;  4K4G A;  2W9C B;  5G5H A;  5JTG A;  4KB6 A;  4OAF A;  4J03 A;  2XVT A;  3TAC B;  1UEV A;  1L8L A;  5JRT A;  4EZ6 A;  3OJS A;  3TAP A;  4FS2 A;  2IA6 A;  3RJJ A;  5KFE A;  4E7X A;  1PK1 A;  4IR9 A;  9ICE A;  3QUC A;  3HW8 A;  1WUD A;  4C8K A;  3RJK A;  2V4R A;  9ICT A;  1NZP A;  2Q0Z X;  1ZQR A;  2P66 A;  2YTU A;  3BS7 A;  4Q43 A;  4RUC A;  5EWF A;  1NOM A;  4KX5 A;  4UAZ A;  2WHE A;  5AM5 A;  3SAH A;  4PHA A;  7ICR A;  5HHI A;  3DDH A;  3QU7 A;  1ZQG A;  1TE2 A;  2VAN A;  4X4T A;  5KFP A;  2JZB B;  3TI0 A;  4YFK A;  3UPQ A;  4RPZ A;  3PW0 A;  1V97 A;  1SV0 C;  4CCH A;  4TUS A;  4O69 A;  4ECS A;  1TK5 A;  2ODG A;  5IIM A;  3ETR A;  3K4G A;  1J97 A;  1KL9 A;  1SL0 A;  1BPY A;  4X4S A;  4K97 A;  3SAF A;  2AGO A;  3WFQ E;  1NK5 A;  3L5K A;  1TK0 A;  4ECQ A;  3KOO A;  3H0M B;  3H39 A;  2G0A A;  3WKD A;  1F0M A;  5KT5 A;  2W7P A;  1GO3 F;  3M9O B;  1TFY A;  1MIY A;  2VJ4 A;  4O68 A;  1S5L U;  4NXU A;  3H4D A;  3RF9 A;  3T5H A;  3LVW A;  4DLE A;  3RR8 A;  2JEF A;  3V7L A;  2D8C A;  4UB3 A;  2KKV A;  2IHO A;  3IV6 A;  5F2V O;  2KTQ A;  4F2R A;  3GIJ A;  2GH1 A;  4IG8 A;  2QKQ A;  1KEJ A;  1UHU A;  4I2D A;  5EE0 A;  1S76 D;  3T79 A;  2E1E A;  5AM0 A;  4UB5 A;  1MQ2 A;  1JQR A;  2KP7 A;  3GV5 B;  3SQI A;  3IG5 A;  2Y0S C;  3IDW A;  4ED0 A;  3PHZ A;  4DL3 A;  1D8L A;  5AI0 A;  3H0R B;  1SZH A;  3RB4 A;  1SIJ A;  1D9F A;  9ICW A;  4FHV A;  1MC8 A;  4TUR A;  5KAF U;  2JMG A;  1WG8 A;  3GFK B;  4PGQ A;  1NJW A;  4RZR A;  2B51 A;  5HHH A;  2EAM A;  4CF3 A;  1S0O A;  2K8C B;  3NVO A;  2KV2 A;  2AJQ A;  3RB0 A;  2LBO A;  2FPL A;  4WCW A;  3WK8 A;  2MUT A;  4UBB A;  3ER8 C;  3ISB A;  4NLB A;  4ECU A;  3C66 A;  2ZUB A;  4KN7 A;  3CP8 A;  3KBB A;  4NXV A;  4PHP A;  4F3O A;  7ICF A;  3BQ1 A;  1BPE A;  5KFT A;  3EUB 2;  1UA0 A;  1L7M A;  2PFP A;  4X5V A;  1JI7 A;  4O6A A;  3GU3 A;  5E79 U;  2H3I A;  3NVV A;  2NV3 A;  3RFA A;  4LZD A;  4NL9 A;  4FBU A;  2HHU A;  2IOH A;  1ARO P;  2DL0 A;  3H40 A;  8ICV A;  9ICO A;  1NK6 A;  1LKY A;  2HN1 A;  4KN4 A;  1R8A A;  3FDS A;  3C28 A;  1K1Q A;  5HRK A;  3CK6 A;  2W9B B;  2XC9 A;  4DF4 A;  4K4H A;  2W9B A;  2F3N A;  2BE3 A;  2OHF A;  5B66 U;  4BUG A;  2ID1 A;  2W9A A;  5KL8 B;  4HYK A;  5CA7 A;  4PHD A;  3MGI A;  4NM2 A;  1VLB A;  4YD1 A;  3PX0 A;  2B21 A;  3Q8K A;  8ICO A;  8ICC A;  3K1R B;  2BCQ A;  9ICA A;  3V6H A;  1ZQ1 C;  4X4O A;  2YMQ A;  2DKZ A;  5KG2 A;  1L3S A;  2NRZ A;  2FLP A;  3UPS A;  2KD1 A;  1CUK A;  1X6J A;  4ED2 A;  4M9N A;  3F2D A;  1R8C A;  1KQQ A;  4K9B A;  4RWO A;  1MA7 A;  2ZUC A;  1UQV A;  5H2F U;  4LVS A;  3C5G A;  4LT6 A;  3AM9 A;  1SV4 A;  2AHO B;  2Y9U A;  2HSZ A;  4M04 A;  1X6I A;  2J6S A;  2P6R A;  3AQM A;  1WWV A;  2M2V A;  2FMS A;  4FFD A;  1V85 A;  3IM1 A;  4KLL A;  4QJF B;  4Y2T A;  2NRX A;  3BS5 B;  3AQK A;  5HR9 A;  4QNL A;  4E8F A;  2KOB A;  2HHX A;  3MFH A;  4K98 A;  2VJ5 A;  4GIB A;  4JV1 A;  2E8P A;  5AIA A;  2KE7 A;  4KLJ A;  1FFV A;  5KAI U;  4GFJ A;  2J6U A;  3HRD D;  1NI3 A;  3PSF A;  4KIT B;  4CE6 A;  2W8K A;  3V7J A;  2PKE A;  4Y2X A;  2HHS A;  1ZQU A;  2ZIW A;  2UVR A;  2BCV A;  5HR7 A;  1JUD A;  4KLE A;  1FO4 A;  4JLX A;  5DLF A;  1Z19 A;  4RNO A;  3PST A;  1Q3U A;  2ZTD A;  9ICP A;  4Y2V A;  2F1J A;  1RYR A;  1Y88 A;  1YT3 A;  3UXP A;  3M1Y A;  1X9W A;  1X66 A;  1SKR A;  3SEN A;  3BQ0 A;  3RAX A;  3Q8Q B;  3WKC A;  4O0I A;  1NO5 A;  3DEE A;  3JYY A;  1TAU A;  5J2J A;  2JEI A;  3TAQ A;  1OUQ A;  4UAU A;  2BQU A;  2B6G A;  1N60 A;  3C1Z A;  2R8H A;  1ZQL A;  5HMM A;  1S8O A;  1X42 A;  3K7D A;  4FHY A;  2A19 A;  4RPX A;  4GXI A;  4RQ6 A;  3ZD8 A;  7ICS A;  2IOF A;  2WF5 A;  2K4H A;  4DF8 A;  1RXV A;  4RNM A;  4LEZ A;  5ALM A;  5CB1 A;  5DB9 A;  2LHT A;  1DXS A;  2A3V A;  3H8W A;  4ACO A;  3QE9 Y;  4RQ2 A;  4LEY A;  3NKU A;  2AGQ A;  1BNP A;  2WAQ C;  4O5C A;  1CI4 A;  7ICN A;  3KZI U;  4RQ8 A;  2XGQ A;  4AT9 A;  1N62 A;  1HUZ A;  9ICF A;  5HRD A;  5ALE A;  4OJ6 A;  4DL7 A;  2W9C A;  1DRG A;  2ISO A;  2B4V A;  4DSF A;  1OU5 A;  4ECV A;  3N97 B;  4MEX A;  2NO5 A;  5KG4 A;  3V6J A;  3ZDC A;  5C5J A;  5F9L A;  5AIB A;  4HX0 A;  4FHX A;  2HCF A;  1YZ6 A;  2OEH A;  1PVP A;  2DVI A;  3Q8P B;  1COO A;  3MDC A;  3WK5 A;  4M47 A;  4NM1 A;  1U48 A;  4USA A;  5IIL A;  2DFL A;  2C28 A;  2KIV A;  9ICN A;  1BPB A;  1PX5 A;  2F44 A;  2EDU A;  2HHQ A;  1U4B A;  8ICB A;  9ICI A;  3ER9 B;  1ZQB A;  5J0X A;  3NAS A;  3ZDB A;  5C0Y A;  2L5Y A;  2MU2 A;  4QZ8 A;  2ZXH A;  2G5I B;  1VJ7 A;  4DL4 A;  1SWV A;  4F91 B;  4QZD A;  4YG2 A;  4GXJ A;  2ZTE A;  5J0T A;  3HPO A;  2JV3 A;  2BPF A;  2W03 A;  3HJ4 A;  2ASL A;  4LJX A;  1OW5 A;  1URJ A;  2BPG A;  4DS5 A;  2XI9 A;  5B3P A;  4KLI A;  4ECW A;  1TV9 A;  4MFC A;  5ALS A;  4F2S A;  1KFT A;  4WQL A;  4M6W B;  3QU5 A;  4QWE A;  4EBC A;  4PZN A;  2FE9 A;  3HIL A;  5HRH A;  4KMU A;  5CWR A;  2XO7 A;  3JPP A;  3C21 A;  4UBC A;  2P35 A;  3EPI A;  9ICC A;  5D63 A;  4AYB F;  3KHG A;  5D46 A;  3NYB A;  3UMB A;  1B4F A;  2RDI A;  1PK3 A;  2NO4 A;  4EEY A;  2FI1 A;  4EV6 A;  4FH3 A;  3C18 A;  5EWE A;  5DED A;  2QB1 A;  4YR3 A;  1FA0 A;  2DF4 B;  4YR2 A;  4O3R A;  4EBK A;  2NRK A;  4M9J A;  7ICP A;  4X4V A;  4ICA A;  5AKL A;  3TKA A;  3LYS A;  2E1F A;  1LVH A;  2E3T A;  4O9M A;  1F5S A;  2MA1 A;  5KT7 A;  3PNC A;  3PX4 A;  1NK0 A;  4QZG A;  5GTI U;  1L3T A;  2Y0S F;  3H3A A;  5HRB A;  4G3I A;  3WKA A;  2DPI A;  4IQT A;  1ECW A;  3EZ5 A;  3ISD A;  3G6Y A;  1FEZ A;  8ICG A;  2DRB A;  2WF9 A;  2G08 A;  4YMM A;  1XS9 D;  3Q8M A;  1S77 D;  1N63 A;  1PK1 B;  1X9S A;  2ZHB A;  4NKU A;  5KG7 A;  1RQL A;  3GQC A;  3KHL A;  3AL0 B;  8ICN A;  4X0B A;  5J8Y C;  3SV4 A;  1N56 A;  1TVA A;  3ICX A;  3C1Y A;  2K4I A;  4QIW C;  2EQY A;  2J6T A;  2ZHA A;  5KG6 A;  7ICM A;  1BNO A;  2ZH4 A;  4PPX A;  2KK0 A;  2K89 A;  2KJ8 A;  2ISP A;  5KFB A;  2FMP A;  4I27 A;  4QWC A;  1ZJM A;  2R8J A;  4G9B A;  5AKH A;  4KLU A;  2DUY A;  5AIC A;  3M7D A;  1ZQC A;  3H8J A;  2JEJ A;  3CW2 C;  3MGH A;  2GOL A;  4FHW A;  4B9N A;  3E0F A;  3ERC C;  1Q79 A;  2BKE A;  3B9J A;  4M6W A;  2OH2 A;  5T14 A;  1P7D A;  1IM4 A;  2JXJ A;  3MDA A;  2BZF A;  4R8U A;  4M5D A;  4RQ7 A;  2PXI A;  4Q45 A;  4DFD A;  5AK6 A;  3KZX A;  4Y2P A;  4J9R A;  4QZF A;  4K4I A;  2QAR B;  1DK2 A;  4NLN A;  4Z6C A;  2LYA A;  2BCU A;  5BOM A;  3PZP A;  1RQN A;  4ED6 A;  4AYB C;  2XCA A;  1KFS A;  2H3V A;  2KJ5 A;  3T3F A;  3GII A;  3PW7 A;  4DSK A;  5HRE A;  4K9A A;  2KZ3 A;  2ZH8 A;  2HMX A;  4P0P A;  4RWP A;  2IOF K;  1KBU A;  3SEI A;  5ALJ A;  5CFU A;  2HHT A;  4PGX A;  1ZQH A;  1TAM A;  1T7P A;  4CGZ A;  1BPX A;  1K1S A;  2A1J B;  4PJ0 U;  5AK4 A;  1XSP A;  2DR5 A;  1M6Y A;  4B6J A;  2WAQ F;  4YN4 A;  1QQ5 A;  9ICU A;  4MKP A;  1ZQI A;  2FLN A;  1SZP A;  5KFO A;  5KFJ A;  8ICJ A;  1Z00 A;  1FIQ A;  3SZ2 A;  3JPO A;  2I6X A;  2ZJ5 A;  1TFR A;  4R66 A;  3AMZ A;  3HKZ F;  3IG8 A;  4OD0 A;  2QAR A;  1ZQV A;  3HKZ C;  5J2G A;  4RWQ A;  1N5W A;  4F4Y A;  3ONN A;  2F2A B;  4AP9 A;  1MIW A;  1ZD3 A;  4K96 A;  4Q8E A;  5IIN A;  4ECR A;  2F77 X;  2KN7 A;  9ICM A;  4DQP A;  3L9D A;  4X4R A;  1J2N A;  5ALH A;  2V9W A;  2H5X A;  4MF8 A;  2FJ6 A;  4AT7 A;  9ICR A;  2HI0 A;  3FAH A;  1S9F A;  4DQI A;  3K75 D;  4NXZ A;  4XJE A;  3F5A A;  1WOT A;  4YMO A;  3NRZ A;  5L1I A;  4RT3 A;  4NJ8 A;  1KW4 A;  1ZQA A;  2C2E A;  1XC9 A;  2ASD A;  4X4Q A;  2VIX A;  3QXG A;  3UMC A;  8ICS A;  3OSN A;  1U45 A;  1X9M A;  2DQN B;  3CYM A;  3TQ1 A;  4Z6F A;  1SKW A;  3MCR A;  5CHG A;  4F4Z A;  8ICR A;  5J0U A;  3HWT A;  4QZE A;  2ZIX B;  2WB1 C;  4OAG A;  2HVH A;  1U49 A;  4BWM A;  4O67 A;  2E8O A;  1ZRM A;  2AXT U;  4DFJ A;  5D4B A;  2QLT A;  1T3Q A;  2XCP A;  4DOB A;  3Q8R B;  3J81 j;  1DK3 A;  3GIM A;  4ECT A;  4JUZ A;  2KVS A;  7ICG A;  4F5O A;  1KNY A;  4DL5 A;  2YML A;  2VA3 A;  4NXW A;  3QEA Z;  1ZQP A;  4XRH A;  1B22 A;  3N28 A;  2M9N A;  3IRU A;  5KFD A;  4O3Q A;  4WH5 A;  4RQ1 A;  3HJE A;  4BWJ A;  3VC8 A;  1TFW A;  3WU2 U;  5KFL A;  2BQR A;  3MGV A;  4X0A A;  4C7Z A;  5JTI A;  4AT8 A;  5KT4 A;  2XY5 A;  1ZQX A;  5DEC A;  5CJ7 A;  5GTH U;  2ZH6 A;  3UQ0 A;  4F4K A;  5CP2 A;  5DBC A;  3UQ2 A;  5HRF A;  2Y1J A;  4DS4 A;  4WJ3 B;  3HJ1 A;  2G09 A;  4DCC A;  2DWQ A;  1KFD A;  3TAD A;  4F93 B;  1ZQN A;  5ALI A;  4WC6 A;  4O3S A;  2R18 A;  4NXT A;  3K1Z A;  2CPR A;  3EWA A;  5CRX A;  5AKX A;  5DQH A;  2BBH A;  5AKZ A;  5AI6 A;  4C8O A;  4JLZ A;  4KX3 A;  3JPQ A;  4RWN A;  2KKP A;  4KM5 A;  3PVX A;  3KKA C;  4RQ5 A;  1BVS A;  2V4Q A;  4LEW A;  4YR0 A;  3H37 A;  4TQS A;  1T94 A;  4DQQ A;  4JWN A;  3L4P A;  2NYV A;  3BS5 A;  4KLH A;  1RDF A;  5HC9 A;  4OO1 J;  4WBY A;  3JPR A;  2KHV A;  2AU0 A;  4QZB A;  3PR5 B;  3LWM A;  3PW2 A;  2E8N A;  4UAY A;  3T5K A;  8ICW A;  5J2B A;  2FPM A;  4Y2J A;  2AH5 A;  3RH6 A;  5KT2 A;  5KFY A;  2Z7J A;  5AKJ A;  3WK4 A;  3RBE A;  1J2M A;  4BXO A;  4NLG A;  2FDR A;  1ZQM A;  2HN2 A;  4NLK A;  5L1K A;  4RT2 A;  1N5X A;  2ES6 A;  4ED7 A;  4Q44 A;  3PR4 A;  3N7S C;  5KG3 A;  1NKB A;  4I2I A;  4JMU A;  3BZK A;  2W11 A;  2W8L A;  3ZDA A;  3WFP A;  3RJI A;  4M0A A;  1F44 A;  4Z6D A;  4DL6 A;  4ATB A;  1QTM A;  2YB1 A;  7ICQ A;  4DQS A;  3OPX A;  4IR1 A;  1ZD5 A;  1HEK A;  5BPC A;  1JRO A;  1QCK A;  2B56 A;  1N61 A;  8ICE A;  4EED A;  1PVR A;  4X4N A;  5EE9 A;  4S3N A;  4B9U A;  2KNJ A;  3PY8 A;  3M6K A;  4PZO A;  5DLG A;  3H4B A;  5KL1 B;  4U7C A;  3PMN A;  2ZG6 A;  5JU5 A;  3SYZ A;  2ATL A;  1XO0 A;  9ICK A;  4OJO A;  4PHE A;  3GDX A;  4UAV A;  4XQ7 A;  4R63 A;  1QSL A;  2W9M A;  1GPJ A; 
#chains in the Genus database with same CATH homology
 3H8S A;  4QZH A;  2HHV A;  1HJP A;  1V4A A;  3AQN A;  1UA1 A;  5KFQ A;  4DSJ A;  2BPG A;  3RAQ A;  4P4O A;  4I2J A;  3JPN A;  4DS5 A;  3TFR A;  2ZJA A;  4K4G A;  2W9C B;  4KLI A;  4ECW A;  1BPZ A;  1TV9 A;  4MFC A;  4O3O A;  3GV8 B;  4F2S A;  1KFT A;  5DDY A;  5D49 A;  4M6W B;  5KFM A;  1UEV A;  1NJY A;  4QWE A;  5III A;  5KT6 A;  3OJS A;  3TAP A;  1ZQK A;  4EZ6 A;  4EBC A;  2BDP A;  4M9H A;  4KLQ A;  4FS2 A;  2IA6 A;  1U9L A;  3RJJ A;  4I2A A;  4UD5 A;  1DOQ A;  5KFE A;  4E7X A;  5HRH A;  3UXO A;  1A77 A;  4F4W A;  4KMU A;  4IR9 A;  4O5E A;  1QSS A;  9ICE A;  5KTQ A;  3HW8 A;  5CWR A;  2XO7 A;  3JPP A;  3C21 A;  1VFG A;  4UBC A;  3EPI A;  3SV3 A;  4ECY A;  9ICC A;  4C8K A;  4J9Q A;  4ZH4 A;  5DBB A;  2V4R A;  3RJK A;  9ICT A;  1NZP A;  1TAQ A;  9ICV A;  2Q0Z X;  3KHG A;  5DG8 A;  4B9T A;  3OVB A;  5DDM A;  4DO9 A;  1ZQR A;  2WTF A;  1XWL A;  2P66 A;  5D46 A;  4Q43 A;  4RUC A;  5EWF A;  3NYB A;  1NOM A;  3C23 A;  4UAZ A;  2KZZ A;  2RDI A;  5HRG A;  4EEY A;  3PW5 A;  1S0V A;  2ZTC A;  4PHA A;  4I2E A;  7ICR A;  4FH3 A;  5EOZ A;  3MAB A;  5HHI A;  4DQR A;  5EWE A;  3C18 A;  3PML A;  5DED A;  4IRD A;  1ZQG A;  4YR3 A;  1FA0 A;  2VAN A;  4X4T A;  4YR2 A;  5KFP A;  2JZB B;  4DOC A;  3TI0 A;  2AQ0 A;  4O3R A;  4EBK A;  2DPJ A;  4KLF A;  4YFK A;  2NRK A;  3EPG A;  3UPQ A;  4F5R A;  8ICK A;  1BGX T;  4RPZ A;  4XUS A;  3PW0 A;  4M9J A;  7ICP A;  4X4V A;  4QW9 A;  4CCH A;  4TUS A;  1A76 A;  5DG7 A;  4ECS A;  1TK5 A;  4NY8 A;  4UAW A;  5IIJ A;  5IIM A;  1SL1 A;  4YP3 A;  5KFA A;  4YCX A;  5KFW A;  3K4G A;  4B9V A;  1YLQ A;  4BGD A;  1SL0 A;  3MR6 A;  4O9M A;  8ICY A;  1RXW A;  1BPY A;  4DSE A;  4X4S A;  2HHP A;  2I1Q A;  8ICP A;  5KT7 A;  3PNC A;  3PX4 A;  2AGO A;  4DL2 A;  5J2C A;  1NKC A;  4J9P A;  1NK0 A;  4NLZ A;  8ICL A;  3WFQ E;  1NK5 A;  4QZG A;  4EZ9 A;  1L3T A;  3MR5 A;  1TK0 A;  2C22 A;  4ECQ A;  3H3A A;  5HRB A;  4G3I A;  5J0Y A;  2DPI A;  4IQT A;  3H39 A;  5KT5 A;  4P4M A;  5CR0 A;  1QLN A;  1NK9 A;  3JZ0 A;  3MR2 A;  3ISC A;  3ISD A;  3EZ5 A;  3M9O B;  3G6Y A;  4C8L A;  4YVZ A;  9ICG A;  1UET A;  1MIY A;  8ICG A;  4YQW A;  8ICA A;  4ECZ A;  2BCS A;  3AQL A;  2DRB A;  4UD4 A;  5KFV A;  3OHB A;  4J9K A;  4YMM A;  4FBT A;  3H4D A;  1XS9 D;  2UVV A;  4DSI A;  2IHM A;  4JV2 A;  3Q8M A;  1S77 D;  3T5H A;  3BDP A;  4Q8F A;  1T8E A;  2ZH3 A;  3TFS A;  4DLE A;  4ED8 A;  3RR8 A;  3EYZ A;  1X9S A;  3OV7 A;  1XSN A;  2JEF A;  4YXJ A;  3HP6 A;  1ZQZ A;  3V7L A;  4UB3 A;  2VA2 A;  4DLG A;  2ZHB A;  3WFR E;  4NKU A;  1JMS A;  5KG7 A;  1EXN A;  2F1I A;  2JZB A;  3GQC A;  5KFK A;  3KHL A;  8ICN A;  5F2V O;  4X0B A;  1L3U A;  9ICB A;  2KTQ A;  3LDA A;  3SV4 A;  3GIJ A;  2UVU A;  1N56 A;  4E0D A;  2C2D A;  4F2R A;  1TVA A;  4IG8 A;  4YMN A;  3C1Y A;  1KEJ A;  7ICF A;  4I2D A;  3MBY A;  1S76 D;  2J6T A;  4AT7 B;  1R89 A;  1Z3E B;  4KLD A;  2HVI A;  2ZHA A;  1TFY A;  4UB5 A;  1SKS A;  1MQ2 A;  1JQR A;  5KG6 A;  2KP7 A;  3OUY B;  3GV5 B;  7ICM A;  1BNO A;  2ZH4 A;  4PPX A;  1ZJN A;  5DG9 A;  1LB2 B;  4ED0 A;  4DL3 A;  2ISP A;  1D8L A;  5KFB A;  2NRT A;  2FMP A;  4QWA A;  4QWC A;  1ZJM A;  2R8K A;  2R8J A;  4I27 A;  4B9L A;  4BDP A;  3RB4 A;  4PH5 A;  1D9F A;  2JEG A;  9ICW A;  4KLU A;  4FHV A;  4QZ9 A;  1ZQC A;  2BQ3 A;  2NRV A;  1MC8 A;  1UT5 A;  4F5Q A;  3UXN A;  1ZQS A;  3H8J A;  4TUR A;  3MGH A;  2JEJ A;  2O5A A;  4FHW A;  4B9N A;  4F8R A;  3GFK B;  1MSW D;  4PGQ A;  3ORY A;  5KG5 A;  1NJW A;  4RZR A;  1Q79 A;  2BKE A;  5HHH A;  5J0O A;  3C2M A;  2AGP A;  1RZT A;  4FH5 A;  4M6W A;  4WC7 A;  1S0O A;  2VA8 A;  1MQ3 A;  4DOA A;  5DB8 A;  1T3N A;  1IM4 A;  5L1J A;  2KFN A;  4X4P A;  5KFR A;  3MDA A;  4R8U A;  2AJQ A;  3HX0 A;  4M5D A;  3RB0 A;  4RQ7 A;  4YXM A;  2FPL A;  2PXI A;  4O3N A;  9ICJ A;  4WCW A;  5J2D A;  4Q45 A;  2MUT A;  4UB2 A;  4UBB A;  1BPD A;  1RPL A;  1ZQF A;  5KFS A;  3ISB A;  4J9R A;  4E80 A;  4QZF A;  4ECU A;  4K4I A;  3C66 A;  2ZUB A;  3V7K A;  1DK2 A;  4NLN A;  5HP4 A;  4KN7 A;  3QZ7 A;  4Z6C A;  2XGP A;  4PHP A;  7ICV A;  1QSY A;  2BCU A;  5BOM A;  4F3O A;  4P4P A;  3BQ1 A;  4ED6 A;  1BPE A;  1H38 A;  4IQV A;  5KFT A;  2P6U A;  4KLO A;  4KLT A;  2XCA A;  4QZC A;  1JIH A;  1UA0 A;  1KFS A;  2PFP A;  3T3F A;  4X5V A;  3GII A;  5TZV A;  3PW7 A;  4DSK A;  4EBE A;  4MF2 A;  5HRE A;  2KZ3 A;  2ZH8 A;  4RWP A;  4RQ0 A;  2NRW A;  4LZD A;  4FBU A;  4IQW A;  3RJE A;  1PZN A;  2HHU A;  1KRP A;  2GWS A;  1ARO P;  7ICO A;  4JV0 A;  3M8S A;  3H40 A;  2HHT A;  3OVS A;  4PGX A;  1ZQH A;  8ICV A;  4O5K A;  7ICE A;  1T7P A;  1NK6 A;  9ICO A;  4C8M A;  1K1S A;  1BPX A;  7ICJ A;  4KN4 A;  4F5N A;  1R8A A;  3FDS A;  2A1J B;  3HT3 A;  1K1Q A;  1XSP A;  2DR5 A;  1L3V A;  5HRK A;  3G6V A;  4YN4 A;  3PV8 A;  2W9B B;  3HIY A;  2XC9 A;  4DF4 A;  4K4H A;  3WFS C;  2W9B A;  1S0M A;  3RJG A;  1X2I A;  5EWG A;  4EBD A;  2BE3 A;  9ICU A;  3IHQ B;  3TAR A;  1ZQI A;  3OSP A;  2BPC A;  2ID1 A;  2W9A A;  2FLN A;  3BQ2 A;  4HYK A;  4LZG A;  3NTU A;  5CA7 A;  4WC3 A;  1SZP A;  3KHH A;  5KFO A;  4PHD A;  3MGI A;  4NM2 A;  4KLM A;  1S97 A;  2KZM A;  5KFJ A;  1ZQD A;  3WFO A;  4QW8 A;  8ICJ A;  1NJZ A;  4YD1 A;  4B9S A;  3PX0 A;  4FHP A;  1ZQY A;  4IRC A;  2B21 A;  1Z00 A;  3Q8K A;  2UVW A;  3SZ2 A;  8ICO A;  5J2F A;  3JPO A;  8ICC A;  2ZJ5 A;  1TFR A;  4R66 A;  2BCQ A;  4I29 A;  9ICA A;  5KT3 A;  4WC5 A;  3V6H A;  4DEZ A;  3ZDD A;  5J2G A;  1ZQV A;  3EW9 A;  4RWQ A;  2ZH2 A;  4F92 B;  4F4Y A;  1ZQQ A;  1KTQ A;  5DB7 A;  3C5F A;  8ICQ A;  4AT9 B;  4X4O A;  2ZH9 A;  4B9M A;  2Q66 A;  3RR7 A;  2IHN A;  3C2L A;  1MIW A;  3AU6 A;  5KG2 A;  4Q8E A;  1L3S A;  2NRZ A;  5IIN A;  3SI8 A;  9ICS A;  2FLP A;  4ECR A;  1RYS A;  3UPS A;  2KN7 A;  3G6X A;  3NGD A;  9ICM A;  4DQP A;  1CUK A;  2F1H A;  4ED2 A;  4UQG A;  3RBD A;  4M9N A;  1R8C A;  3L9D A;  4X4R A;  4M9L A;  3JPS A;  2H5X A;  2V9W A;  4ELT A;  4RWO A;  4MF8 A;  5DGB A;  4FS1 A;  4KTQ A;  2ZUC A;  4AT7 A;  9ICR A;  4LT6 A;  4LVS A;  3C5G A;  4GC7 A;  4TQR A;  9ICL A;  2HW3 A;  1WCN A;  5DB6 A;  1S9F A;  7ICL A;  4DQI A;  2LYH A;  5IIK A;  4R64 A;  4M04 A;  1T4G A;  3K75 D;  3V6K A;  4XA5 A;  1WCL A;  4NXZ A;  8ICI A;  8ICU A;  1NKE A;  4I28 A;  1D9D A;  2ZH7 A;  1WOT A;  3PX6 A;  4YMO A;  2J6S A;  2P6R A;  5L1I A;  3AQM A;  4RT3 A;  2M2V A;  1ZQA A;  2C2E A;  1XC9 A;  2ASD A;  2FMS A;  5J2K A;  4X4Q A;  3IM1 A;  4KLL A;  8ICS A;  3OSN A;  4ATB B;  1U45 A;  1X9M A;  3TQ1 A;  2IBK A;  4Z6F A;  2NRX A;  3OGU A;  4ED1 A;  1SKW A;  4WC4 A;  4I2C A;  3AQK A;  3GV7 B;  5HR9 A;  5F9N A;  3T5L A;  5CHG A;  4F4Z A;  8ICR A;  1JXE A;  4WBZ A;  4E8F A;  5J0U A;  5DQG A;  3HWT A;  4EYI B;  2AQ4 A;  2HHX A;  4QZE A;  3MFH A;  4AT8 B;  3KHR A;  1U49 A;  2RDJ A;  5J0R A;  4BWM A;  2PFO A;  2HVH A;  2HHW A;  4JV1 A;  3RH4 A;  3RJH A;  3B0X A;  1ZYQ A;  1KDH A;  3LQC B;  1C7Y A;  1UEU A;  3B0Y A;  4I2G A;  4KLJ A;  4XQ8 A;  4DFJ A;  5D4B A;  5KG0 A;  1TK8 A;  4ECX A;  3BJY A;  3T5J A;  3Q8L A;  2J6U A;  4GC6 A;  2XCP A;  4DFM A;  5KFI A;  4DOB A;  4NKT A;  4RU9 A;  4QWD A;  3Q8R B;  3LWL A;  4KIT B;  4TUP A;  5J0S A;  4J9O A;  3GIM A;  5DBA A;  2W8K A;  4ECT A;  3V7J A;  4ED3 A;  1SL2 A;  1DK3 A;  3MFI A;  4P2H A;  4JUZ A;  2BCR A;  5HRI A;  1D8Y A;  3PW4 A;  2I9G A;  7ICG A;  4UB4 A;  4F5O A;  3FYH A;  4TUQ A;  3AUO A;  1ZQU A;  2HHS A;  4DL5 A;  1KNY A;  2VA3 A;  2UVR A;  2BCV A;  3QEA Z;  5HNK A;  4Z6E A;  4XRH A;  1ZQP A;  9ICX A;  8ICX A;  1B22 A;  2MAX A;  4M9G A;  4KLE A;  5KFC A;  5DLF A;  3M8R A;  2M9N A;  2XY6 A;  4RNO A;  2ASJ A;  4F5P A;  4DSL A;  2RFF A;  5KFD A;  4O3Q A;  4RQ1 A;  2ZTD A;  4DFK A;  8ICT A;  9ICP A;  2O1P A;  4BWJ A;  1TFW A;  4PGY A;  2F1J A;  5KFL A;  2M2U A;  3QZ8 A;  3AU2 A;  4GLX A;  2IMW P;  1RYR A;  2BQR A;  4WC1 A;  4X0A A;  2DR8 A;  1Y88 A;  3UXP A;  5KFH A;  1X9W A;  4RUA A;  2FMQ A;  1SKR A;  2ALZ A;  1KLN A;  4KLS A;  3BQ0 A;  3GIK A;  4AT8 A;  5KT4 A;  2XY5 A;  4J9M A;  3Q8Q B;  3RAX A;  1ZQX A;  3KTQ A;  5DEC A;  4O0I A;  2FPK A;  1NO5 A;  1ZQJ A;  5KFX A;  2MUT B;  5CJ7 A;  3PO5 A;  2ZH6 A;  3UQ0 A;  3JYY A;  1NJX A;  4F50 A;  4F4K A;  5CP2 A;  1TAU A;  2DR9 A;  5DBC A;  5J29 A;  5J2J A;  3UQ2 A;  3TAQ A;  2JEI A;  5HRF A;  4O3P A;  2Y1J A;  5J2H A;  4DS4 A;  2BQU A;  3HJ1 A;  4QWB A;  3RRG A;  3C1Z A;  4ELV A;  2M2W A;  2R8H A;  1KFD A;  4F93 B;  1ZQL A;  4MFA A;  5HMM A;  1ZQN A;  4ELU A;  3H38 A;  2Y1I A;  4WC6 A;  4FHY A;  4O3S A;  4QZI A;  2PFQ A;  1KSP A;  3OVA A;  3N4M B;  5J0P A;  2ZH5 A;  3RRH A;  3EWA A;  3C2K A;  4RPX A;  2M2T A;  4GXI A;  4RQ6 A;  3ZD8 A;  5J2E A;  5DQH A;  5DQI A;  5J2I A;  4X4U A;  4M2Y A;  3GIL A;  4C8O A;  7ICS A;  2PI5 A;  4IRK A;  5KFF A;  3JPQ A;  4DF8 A;  4RWN A;  1RXV A;  3PVX A;  5DGA A;  4RNM A;  1NK4 A;  5CB1 A;  4RQ5 A;  1BVS A;  4R8U B;  5DB9 A;  2V4Q A;  1ZQT A;  4I2H A;  2KFZ A;  4YR0 A;  1ZQO A;  3H37 A;  3H8W A;  4IQU A;  4TQS A;  4DQQ A;  1F5A A;  2R8I A;  4JWN A;  3QE9 Y;  4RQ2 A;  4KLH A;  4F4X A;  4DFP A;  1V9P A;  1JAJ A;  5HC9 A;  4UB1 A;  2AGQ A;  1JX4 A;  8ICH A;  1ZQW A;  4YD2 A;  2XY7 A;  4WBY A;  3JPR A;  1N48 A;  5KFZ A;  4QZB A;  2AU0 A;  3PR5 B;  1XSL A;  1BNP A;  4O5C A;  2ZH1 A;  7ICN A;  3M9M B;  4RQ8 A;  2XGQ A;  3LWM A;  1ZET A;  4AT9 A;  1Z00 B;  3OHA A;  2BGW A;  5KFU A;  4GXK A;  4MEY A;  3PW2 A;  1HUZ A;  2FLL A;  9ICF A;  3OUY A;  4UAY A;  3ZD9 A;  1ZQE A;  3T5K A;  5HRD A;  3MR3 A;  8ICW A;  5J0Q A;  4EYH B;  5J2B A;  1CEZ A;  2FPM A;  4DL7 A;  2W9C A;  3RH6 A;  2ISO A;  5KT2 A;  4DSF A;  4KLG A;  1LV5 A;  5KFY A;  1OU5 A;  3RH5 A;  4R65 A;  4ECV A;  4RQ3 A;  4WC2 A;  1U47 A;  3RBE A;  3N97 B;  1XO1 A;  5IIO A;  1NK8 A;  4MEX A;  7ICI A;  3V72 A;  1JN3 A;  5KG4 A;  2PFN A;  2PI4 A;  4BXO A;  3V6J A;  1DGS A;  3ZDC A;  5C5J A;  5F9L A;  3Q8S B;  4NLG A;  4I2F A;  1ZQM A;  4FHX A;  2A1J A;  3JPT A;  2DR7 A;  1Q78 A;  5KFG A;  4NLK A;  5L1K A;  4RT2 A;  5J0W A;  1B43 A;  3RJF A;  4ED7 A;  2BHN A;  2DVI A;  3Q8P B;  4Q44 A;  1COO A;  4RPY A;  4JWM A;  3PR4 A;  5KG3 A;  1NKB A;  1TKD A;  4I2I A;  3ETL A;  1JXL A;  3MDC A;  4M47 A;  2DRA A;  4NM1 A;  4I2B A;  4FO6 A;  1S10 A;  1U48 A;  5IIL A;  2BR0 A;  2DFL A;  2W8L A;  3ZDA A;  3WFP A;  3RJI A;  4RNN A;  2C2R A;  5HML A;  4M0A A;  4J9S A;  4Z6D A;  4DL6 A;  3RB3 A;  2C28 A;  2R8G A;  2OWO A;  4J9L A;  1QTM A;  4ATB A;  4C8N A;  9ICN A;  1BPB A;  1L5U A;  7ICQ A;  5DKW A;  3BQT A;  1PX5 A;  5KG1 A;  2HHQ A;  4QZA A;  4DQS A;  7ICH A;  9ICQ A;  4IR1 A;  1U4B A;  8ICF A;  5BPC A;  8ICB A;  8ICM A;  1UT8 A;  5KFN A;  3RTV A;  8ICE A;  3OJU A;  1IXR A;  9ICI A;  4X4N A;  3LK9 A;  4BXO B;  1ZQB A;  5J0X A;  4WC0 A;  4S3N A;  2PBE A;  4RQ4 A;  3M9N B;  4B9U A;  5J2A A;  3ZDB A;  3PY8 A;  2ZJ8 A;  3H7I A;  3PO4 A;  5BOL A;  5DLG A;  5JUM A;  5L1L A;  4EP7 A;  4EBJ A;  4QZ8 A;  3E2E A;  3H4B A;  1R8B A;  2ZUD A;  5HRL A;  3PMN A;  1XU4 A;  4DL4 A;  3RB6 A;  4DWI A;  7ICT A;  1VJ7 A;  3SYZ A;  2ATL A;  8ICZ A;  4F91 B;  3TAN A;  1S0N A;  3THV A;  9ICK A;  4QZD A;  4YG2 A;  5L9X A;  2ZTE A;  4GXJ A;  1NK7 A;  5J0T A;  4J9N A;  3ZDE A;  1MIV A;  4PHE A;  3GDX A;  3QEB Z;  3HPO A;  4XQ7 A;  2BPF A;  4R63 A;  1HUO A;  1QSL A;  3HJ4 A;  7ICU A;  9ICH A;  2ASL A;  7ICK A;  2W9M A;  4JK1 A;  4MFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...