4O9MA

Human dna polymerase beta complexed with adenylated tetrahydrofuran (abasic site) containing dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of polymerase beta in complementing aprataxin deficiency during abasic-site base excision repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o9mA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o9mA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o9mA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o9mA03
3PW0A 4GLXA 5DLFA 5J2FA 4J9PA 2XC9A 3HT3A 3PW5A 3QEAZ 4AT7B 4EP7A 2KZMA 5CA7A 4ECWA 8ICYA 2HHVA 5F9NA 5HMMA 2FPKA 4EBCA 3JYYA 1ZQRA 5EOZA 5KFIA 5KFJA 5J2EA 3GIIA 3RB6A 2AGPA 2HHWA 3UPSA 2ZTDA 4GC6A 5CJ7A 2NRTA 4KN7A 5KFAA 1K1QA 5DLGA 5J0UA 3RJIA 3RAXA 4MFFA 1TAUA 5HRBA 4KLDA 3AQMA 4YR0A 4UB4A 1RPLA 1UT8A 4RWQA 3V6KA 2DRBA 3T5HA 4PGQA 2HVHA 7ICSA 3QEBZ 1NZPA 9ICWA 4JK1A 1JMSA 3HP6A 4KLHA 4M9LA 3PR4A 4TUPA 4RZRA 5KFYA 5KFRA 3UPQA 2BQ3A 4M9GA 7ICKA 5HNKA 4R66A 3G6YA 3C5FA 3FDSA 4QW8A 4DQRA 7ICPA 3OJSA 4I28A 3UXPA 9ICQA 1R8BA 2ZH1A 4BWMA 3EYZA 1TFWA 5IIJA 5KFBA 3B0XA 2NRVA 4O3RA 5CR0A 4RQ5A 4X4PA 4R64A 2NRZA 5J2HA 4DF8A 2HHQA 5DG8A 1TFYA 4P4OA 2J6UA 8ICLA 8ICHA 2ZH2A 4RWOA 3ORYA 4QWBA 3PMNA 4JWNA 3KHRA 1KFTA 1S10A 1NK0A 4I27A 3Q8MA 4F8RA 3UQ2A 1KTQA 1SZPA 4GXIA 5KFGA 1D9DA 3K4GA 2BE3A 1UEVA 3PO5A 3MGHA 4DFKA 4B9MA 1ZQMA 4YR3A 4PHAA 5KFSA 4LZGA 4O0IA 3TAQA 4NM1A 4KLGA 1MIVA 3HJ4A 3RRGA 2ZJ5A 5DB6A 2ZH7A 2BCVA 2DRAA 5KFCA 4EBEA 4ZH4A 1U47A 5KFFA 5CWRA 4F2RA 4QZHA 5D46A 5IIOA 3Q8QB 3RR8A 3RJJA 3AQNA 4PHDA 3RJFA 4KLLA 2AJQA 1B43A 2O1PA 3SI8A 1N56A 2P66A 2DVIA 2HVIA 4I2JA 1WCNA 4IG8A 5J2DA 4YMMA 3KHGA 3TFRA 3PX0A 1TV9A 2A1JA 3RTVA 1T7PA 8ICSA 3BQ0A 3WFOA 3H39A 5KG2A 2C2RA 5J2GA 2R8JA 1TFRA 1SKRA 4DSIA 4I2FA 4X0AA 4NXZA 1U4BA 4O3SA 8ICCA 4UBCA 2BDPA 2RFFA 1BGXT 4ED7A 1ZQPA 2P6RA 2BPCA 5J2AA 4I29A 5HRLA 4DSKA 1ZQUA 3BJYA 4RUAA 3RRHA 1MC8A 4R65A 4EYHB 3N97B 7ICVA 1BNPA 4RNNA 8ICXA 5KG0A 3M9NB 2W9BB 4X0BA 3RJKA 4FBUA 1QLNA 5CHGA 2R8GA 4IR9A 4F91B 1R8AA 1ZJNA 7ICTA 3NTUA 4YFKA 2KFZA 8ICPA 8ICIA 1NJYA 4KLTA 1TK0A 7ICFA 5J0RA 2XGPA 4DL7A 5IIIA 4YN4A 4I2AA 1CEZA 9ICCA 2HHTA 4KMUA 4YXJA 2O5AA 1QSLA 4DF4A 7ICUA 4UD4A 7ICGA 1Z00B 4O9MA 3GILA 1ZQIA 2BR0A 2KN7A 4I2DA 2ZH4A 3ISCA 8ICJA 2M2VA 5KFEA 4EBDA 8ICEA 4RQ0A 1RZTA 1NKCA 4F5QA 3TQ1A 1BNOA 1COOA 4UB1A 3MDCA 8ICOA 1L3VA 4C8LA 3WFQE 3V7JA 4BDPA 1JIHA 3EW9A 4EYIB 2ISOA 3PX6A 4UBBA 3BQTA 5KT4A 4RUCA 3AQKA 2JZBA 5DQGA 2BCQA 4ECRA 4TQRA 4F4ZA 2FLLA 3RJHA 4MF8A 4P4PA 5J0QA 9ICPA 2MUTA 4M5DA 4K4HA 4DSEA 4QZDA 4X4SA 1UEUA 1BPBA 1EXNA 4RQ3A 2W9CA 4ED6A 5KFXA 5HR9A 3MR5A 1FA0A 2ID1A 1ZQYA 2W8KA 3OSPA 1BPZA 1ZQGA 5DBCA 1NK7A 4C8KA 1BPXA 4DSFA 7ICHA 4DOBA 3HWTA 4IQVA 2C2EA 4LZDA 5KFNA 2BCSA 3ZD8A 4WC1A 2R8IA 4UAWA 4F4WA 4QZ8A 8ICVA 7ICRA 3PVXA 1XU4A 3PW7A 3Q8LA 1R89A 1PX5A 5KFPA 1TAQA 3JPTA 2MUTB 3RR7A 1ZQBA 4F93B 4PH5A 7ICIA 2ZHAA 4QZCA 2KP7A 5TZVA 4UB5A 4X4VA 9ICXA 2HW3A 4X4UA 4KLUA 5IINA 4F4KA 3IHQB 5HREA 3V6HA 2GWSA 4NKUA 5D4BA 1UA1A 4WC5A 4F5NA 3AU6A 4ECZA 3L9DA 4XQ8A 1ZQDA 1ZQTA 4KLMA 9ICGA 3SV3A 2ATLA 4JV0A 4WC7A 1ZQSA 4KLFA 4KLIA 4HYKA 3ISBA 3UXNA 4RT2A 4X4TA 3ISDA 2FLPA 4NY8A 1TKDA 4J9MA 1A76A 1JN3A 1ZQQA 4TQSA 4KLJA 4KTQA 1NK9A 4KLSA 8ICFA 3C2KA 9ICMA 3SV4A 1QSYA 5KFUA 5J0XA 2C2DA 4PGYA 4ED8A 2I9GA 4F2SA 1NK5A 3C1ZA 1U45A 2FPMA 3PY8A 1S76D 5BPCA 3MFIA 4M0AA 2VANA 5J0TA 1UETA 1DGSA 2PBEA 4RQ8A 1MSWD 8ICUA 5KT2A 5J2CA 4BGDA 2PFPA 2ZUCA 4YQWA 4NLNA 2DR7A 1NKBA 3V7LA 4QZ9A 1NJXA 3PX4A 2PFOA 4IR1A 2ZUBA 9ICUA 5KG1A 1RXWA 5J2JA 4DOAA 2C22A 5KG4A 1NK8A 7ICNA 9ICOA 5BOLA 1Z3EB 4DSJA 2IBKA 4S3NA 1V9PA 4ATBA 1NKEA 3OGUA 3M9OB 2R8HA 4ECUA 1U9LA 3H8JA 1KSPA 4O5EA 4O5KA 2M2WA 5DGAA 4Q44A 1Y88A 1ZQVA 4TUSA 4ELTA 5J0SA 3ETLA 4J9RA 4JV1A 4NLKA 8ICMA 2LYHA 5L9XA 3QE9Y 4FHYA 1BPEA 2BKEA 5J0WA 2Y1JA 4KITB 2DPIA 2F1JA 1XC9A 2ZTCA 4M6WA 5DGBA 3GDXA 1X9MA 3QZ7A 1LB2B 2PFNA 4B9SA 3TANA 4ELUA 2B21A 3LDAA 5KTQA 4FH3A 1XWLA 4GC7A 1R8CA 1JX4A 1MIWA 1H38A 4ECQA 5DB7A 1KRPA 4LT6A 8ICQA 2DR5A 4K4GA 2ZHBA 4DL2A 4M6WB 1MQ3A 4TURA 5KG6A 4UAYA 2ZJAA 1S97A 3FYHA 3GV8B 4O3OA 5HRHA 9ICNA 3MBYA 1NJZA 3AU2A 3LWLA 3PW4A 3WFSC 4EEYA 1ZYQA 3ZDBA 4B9LA 4F4XA 1CUKA 4ELVA 2BCRA 4ATBB 1WCLA 4YD1A 3NYBA 2XCAA 4X4RA 3BQ2A 4ECVA 4KN4A 3H40A 5IIKA 2M2TA 4RWPA 5DQHA 4I2IA 1XSNA 2ZJ8A 1QTMA 4BWJA 3HX0A 2ALZA 3ZDDA 4FHWA 3PO4A 8ICAA 1ZQOA 2JEJA 4E80A 4QWDA 4WC3A 2W9MA 8ICKA 8ICTA 4DFMA 3H8WA 1HUZA 4MFCA 3JZ0A 3C66A 1YLQA 3THVA 4B9UA 4IQTA 1HJPA 4M47A 1F5AA 2DR9A 1D9FA 4FS1A 1RXVA 4X5VA 3ZDAA 1PZNA 5KG5A 5DKWA 1DOQA 9ICEA 4E8FA 3V7KA 4WBYA 4IRCA 2H5XA 3C5GA 3AUOA 4YR2A 5HHIA 5KT5A 1DK3A 4RQ6A 4MF2A 4RT3A 3JPNA 3Q8SB 3QZ8A 4DS5A 2JZBB 3OHAA 1ZQNA 1X9WA 2FMSA 4Q8EA 1NO5A 4QZAA 3WFPA 2ZTEA 3OV7A 3MFHA 4DQQA 4M2YA 3PV8A 1L5UA 1X2IA 1KDHA 5KFLA 5KG3A 3PNCA 3Q8PB 4J9QA 1S0NA 3RB3A 5DG9A 5C5JA 3C18A 4YP3A 4DQIA 9ICRA 3MR2A 4XQ7A 2ZH6A 1XS9D 3IM1A 3LK9A 4F5RA 3RBEA 4BXOA 4GXKA 2UVUA 4DFPA 3MDAA 1AROP 2RDIA 3H8SA 2UVRA 4M9NA 3K75D 3C2MA 4KLEA 3SZ2A 4O3PA 4AT7A 2C28A 5HC9A 2HHSA 2XY6A 4RWNA 4EZ9A 3EZ5A 1KLNA 3TAPA 1Z00A 5J0OA 3KTQA 4YXMA 1D8YA 5KFTA 2ASJA 4DFJA 3G6VA 1ZQEA 5KT6A 3GFKB 2V4QA 1KFSA 1TK5A 4J9KA 3H4DA 3RJGA 2JEGA 1V4AA 4FHXA 4J9NA 3BQ1A 1Q78A 9ICFA 4O3NA 4Q43A 4FS2A 4B9VA 2W9CB 1MQ2A 4QZGA 4PHPA 1UA0A 2W9BA 5DDYA 2RDJA 1HUOA 4J9LA 4F50A 5F9LA 2BQRA 2HHUA 3OVAA 2NRWA 1QSSA 3JPPA 3GV5B 1ZQFA 7ICQA 4MEYA 4RU9A 3KHLA 1D8LA 4J9OA 3ZDEA 2XO7A 2XY7A 4RPXA 2BPFA 4R63A 3GV7B 1OU5A 4UAZA 3RH5A 5HMLA 4NKTA 5DB8A 4DL5A 4WCWA 4QZBA 4F4YA 1VFGA 2AGQA 4XUSA 2A1JB 2IHMA 3RBDA 4WC6A 3GIKA 4FHPA 3BDPA 1BVSA 4YCXA 1T8EA 3GIJA 2V9WA 5HRGA 4K4IA 4F5OA 3V72A 3V6JA 2UVWA 1KEJA 1JQRA 3RB4A 5EWFA 3HW8A 1NK6A 3G6XA 3EPGA 1X9SA 1ZQCA 4WC0A 9ICTA 4EBJA 4ECYA 1JXLA 2NRKA 4E0DA 4YVZA 4KLQA 4P4MA 1BPYA 1TVAA 5HP4A 4Q8FA 2HHPA 5KFWA 2Q0ZX 2FMQA 4JUZA 4ED1A 3AQLA 4ECSA 3H37A 2XCPA 1S0VA 5KFQA 3JPOA 3JPQA 8ICZA 3B0YA 1A77A 5DG7A 1XSPA 4NLGA 4FHVA 3OJUA 1ZETA 4YD2A 4C8OA 4AT9B 5KFHA 1BPDA 4QWCA 3C2LA 5EWGA 9ICHA 5HRKA 4DL6A 2W8LA 3UQ0A 1NJWA 1ZQJA 5EWEA 2OWOA 3PW2A 5KG7A 5L1JA 2KZ3A 5CP2A 2M9NA 1S9FA 7ICEA 2BQUA 3H38A 2DPJA 9ICBA 3RAQA 4QZEA 3M9MB 1S0OA 2AU0A 3Q8RB 4QZFA 8ICRA 4QZIA 3Q8KA 2MAXA 3OUYB 5J2BA 4XRHA 3MGIA 2BHNA 5IIMA 2PI5A 4M9HA 4G3IA 2I1QA 2PXIA 4PPXA 8ICNA 4YMOA 5IILA 3SYZA 1SKWA 4QWEA 4NLZA 5F2VO 2AQ0A 3M8RA 4TUQA 5DBBA 3NGDA 4B9NA 4DWIA 3C23A 5KFDA 5JUMA 3MABA 4F92B 3GQCA 1RYRA 3T5KA 3JPSA 4O5CA 8ICBA 2NRXA 1ZQKA 4EZ6A 4WC2A 2Q66A 3H7IA 4WC4A 3HPOA 4JV2A 3MR3A 1SL0A 1N48A 4XA5A 8ICGA 5DQIA 1SKSA 2ZUDA 2BCUA 1LV5A 2IMWP 4O3QA 3ZDCA 3C1YA 4RQ7A 4RPYA 7ICJA 2J6TA 3GIMA 9ICSA 3T5LA 2UVVA 5DDMA 4RQ1A 2ISPA 4I2BA 5DBAA 3UXOA 2J6SA 4M04A 5HRDA 2ZH9A 2VA2A 4ED0A 4DL3A 2JEFA 3TI0A 4Z6CA 2VA3A 4DL4A 4Z6EA 9ICAA 4RNOA 4EBKA 2Y1IA 2JEIA 3TARA 2IA6A 2IHNA 1U49A 5CB1A 4MFAA 1ZQZA 1L3SA 7ICLA 5HRIA 5KFZA 5HRFA 4RQ2A 5J2KA 4AT8B 4UD5A 4DQSA 4QWAA 4F5PA 3C21A 5J0YA 1XSLA 2PI4A 5D49A 4Z6DA 3KHHA 4ECXA 3T5JA 4FBTA 2HHXA 4M9JA 4ECTA 4C8MA 1ZQHA 3TFSA 7ICOA 4R8UB 1SL1A 2PFQA 1Q79A 2KTQA 4DS4A 1ZJMA 1U48A 3LWMA 5J2IA 9ICJA 2BPGA 3OUYA 2ZH5A 2AGOA 3H3AA 1ZQLA 5DB9A 4IQWA 1T4GA 3OVSA 4IRDA 2F1IA 5BOMA 1XO1A 3RB0A 4NM2A 2WTFA 4ED2A 4FO6A 1SL2A 4IRKA 3MR6A 4P2HA 2V4RA 4WBZA 5DEDA 2ZH8A 4I2EA 4E7XA 4Q45A 4AT9A 4Z6FA 5KFOA 4IQUA 1NOMA 8ICWA 1TK8A 3RH6A 3OSNA 4CCHA 4DLGA 3E2EA 1WOTA 5DECA 3WFRE 5KFKA 1UT5A 3PMLA 1K1SA 3EPIA 4DLEA 4MEXA 4I2HA 4UQGA 4RNMA 1DK2A 1ZQWA 4RPZA 3OHBA 5KT3A 9ICVA 4UB2A 5J0PA 2FLNA 1JAJA 2ASDA 1L3TA 7ICMA 5HHHA 4C8NA 4DOCA 4F3OA 3T3FA 4BXOB 4DQPA 2AQ4A 2BGWA 1JXEA 5L1LA 1RYSA 4YMNA 4I2CA 4I2GA 2ASLA 1T3NA 4DO9A 4QW9A 2XGQA 3ZD9A 1VJ7A 3RJEA 3M8SA 4R8UA 5J29A 5KFVA 2XY5A 4DSLA 4KLOA 3LQCB 1S77D 4PHEA 4B9TA 4FH5A 4YG2A 3OVBA 1NK4A 1B22A 2FMPA 9ICLA 5L1IA 4X4QA 2R8KA 2DFLA 4UB3A 1ZQXA 4AT8A 4X4OA 2FPLA 3N4MB 2KZZA 4ED3A 1S0MA 3JPRA 4LVSA 3RH4A 4RQ4A 4X4NA 1ZQAA 3HJ1A 1IXRA 1KFDA 5KFMA 1IM4A 5L1KA 2VA8A 1MIYA 2DR8A 2KFNA 3H4BA 2W9AA 4GXJA 9ICKA 2M2UA 3PR5B 4J9SA 4JWMA 2F1HA 3HIYA 1L3UA 3EWAA 1KNYA 2ZH3A 4DEZA 5KT7A 9ICIA 4PGXA 2P6UA 1C7YA
chains in the Genus database with same CATH superfamily
2F3NA 3PW0A 4GLXA 5DLFA 3QEAZ 4AT7B 2XC9A 4EP7A 3NKUA 2G0AA 8ICYA 3JYYA 3GIIA 2AGPA 4E80A 1K1QA 4HAIA 3RJIA 1TAUA 4UB4A 2DRBA 7ICSA 3D2NA 3PR4A 3HKZF 5HNKA 3G6YA 7ICPA 2WHEA 5K4LA 3OJSA 4I28A 3QU4A 2NRVA 5CR0A 4RQ5A 5J2HA 5DG8A 8ICLA 8ICHA 4QWBA 2DKXA 2NYVA 3Q8MA 1XNSA 3UQ2A 1KTQA 4OCZA 4OJPA 2BE3A 3PO5A 4DFKA 1ZRNA 4K97A 1ZQMA 4YR3A 4PHAA 5KFSA 4LZGA 4O0IA 1MIVA 2ZJ5A 5DB6A 5D46A 2ZIWB 3WK8A 1N56A 4IG8A 3KHGA 3PX0A 2C2RA 5J2GA 1U4BA 4O3SA 1UCVA 2BDPA 1BGXT 3BQ7A 5AI4A 1ZQUA 3RRHA 4R65A 4EYHB 1BNPA 4RNNA 8ICXA 1S5LU 4X0BA 4FBUA 4NV0A 4IR9A 3WKEA 4YFKA 8ICIA 3L4PA 3KBBA 4DL7A 1CEZA 2HHTA 4YXJA 1Z00B 4EX7A 3WKAA 2BR0A 2KN7A 4I2DA 3F5EA 1M6YA 5G5GA 8ICJA 4EBDA 3TQ1A 1COOA 4UB1A 4C8LA 3BS5B 2VIXA 2KNJA 2W3SA 3NVVA 4BJQA 3UM9A 4UBBA 4RUCA 2JZBA 2Y9UA 4F4ZA 4MF8A 2LM1A 2MUTA 5AKKA 1ZD5A 4X4SA 3SAFA 2W9CA 3AEVA 3MR5A 2ID1A 2HOIA 2O6KA 7ICHA 2ESEA 4QIWC 5KFNA 4UAVA 5ALQA 4UAWA 3Q8LA 1PX5A 5KFPA 2MUTB 3C28A 4F93B 7ICIA 1J2NA 4US9A 4OAHA 4X4VA 4KLUA 2AH5A 4O6AA 5HREA 3TKAA 4CE6A 2RHFA 1ZQDA 1ZQTA 4KLMA 4K99A 4KLFA 3SQIA 4HYKA 3ISBA 3UXNA 1Q8KA 1NI3A 1TKDA 4Y2XA 4TQSA 4KLSA 5HR7A 9ICMA 3SV4A 5ALMA 5J0XA 2I9GA 3LVWA 4F2SA 1U45A 2KEYA 3TADA 2MSNA 5BPCA 5B5EU 2Z7JA 5KT2A 5J2CA 4FFDA 4BGDA 1PK1B 3V7LA 5KG1A 2C22A 5KG4A 4DSJA 4ATBA 1NKEA 2R8HA 2M2WA 4ECUA 1U9LA 4WJ3B 4Q44A 2YQEA 4J9RA 1L7MA 5J0WA 2DPIA 2Y1JA 8ICOA 2ZTCA 1LB2B 3GDXA 2PFNA 3N28A 5AKHA 2QARB 5KTQA 4O3MA 1KRPA 4NXUA 1NZBA 2DR5A 2W54A 4P0QB 5HRHA 3GV8B 9ICNA 3MBYA 3LWLA 2BCRA 5CFTA 4RWPA 4I2IA 1F5SA 1QTMA 1PK1A 2KHQA 4AYBF 4QWDA 2W9MA 8ICTA 4DFMA 3H8WA 1HUZA 3C66A 4B9UA 2D8CA 3PSIA 2ES6A 1PZNA 5C0YA 4WBYA 3AUOA 4RQNA 1J97A 4YR2A 2VKQA 1Z4NA 4DS5A 2JZBB 2FMSA 1X9WA 3SD7A 2K4EA 1L5UA 5KG3A 2ZH6A 3SR6A 3NVOA 2FCLA 3GU3A 2RDIA 3H8SA 3K75D 3C2MA 2NV3A 3SZ2A 4AT7A 4RWNA 3TAPA 5J0OA 2K8CB 3G6VA 5AI5A 2DUYA 2EAOA 3BZCA 4J9KA 3RJGA 3SAGA 1ZD4A 1Q78A 4C80A 1UA0A 3OVAA 3NVYA 2HHUA 2KHVA 4J9LA 5F9LA 4MHVA 1QSSA 4KLGA 1D8LA 4NXXA 2BPFA 2XO7A 1OU5A 3QX7A 3AN1A 3RH5A 4NKTA 1LKYA 1VFGA 4UB6U 5AM2A 3BDPA 2V9WA 3MCRA 1KEJA 1SV0C 5EWFA 4C7ZA 1NK6A 1X9SA 4Y2RA 1JXLA 4E0DA 2WF6A 5JTIA 1BPYA 5HP4A 2K60A 2Q0ZX 2FMQA 4ECSA 3JPOA 3B0YA 1A77A 5DG7A 1XSPA 3OJUA 3N7RC 2JR5A 1DXSA 5EWGA 3N7PD 3GZFA 1ZQJA 5EWEA 7ICEA 2M9NA 1S9FA 2BQUA 1X42A 8ICRA 3ERCC 2BHNA 8ICNA 1VLBA 2RP5A 3AMZA 5IILA 2ZIXB 4NLZA 5F2VO 2OYYA 5DBBA 5KFDA 2CN1A 4F92B 1RYRA 3JPSA 8ICBA 5KAIU 1ZQKA 4OJ5A 1N63A 3M7DA 2Q66A 3HPOA 3MR3A 1QH9A 4UAUA 5DQIA 2BCUA 3ER8C 1TAMA 3GIMA 3T5LA 2ISPA 4IS7A 2J6SA 4K9BA 1OW5A 2VA2A 4Z6CA 4DL4A 4FZNA 4RNOA 2Y1IA 3TARA 3H8MA 2IA6A 2K8AA 1U49A 5CB1A 2HI0A 1ZQZA 4FO1A 3PSFA 5ALHA 4F5PA 2HSZA 1WG8A 5J0YA 1XSLA 3KHHA 4ECXA 2WB1F 2QB1A 4R8UB 1SL1A 1DRGA 3QXGA 3PZPA 1L8LA 1X9XA 2BZFA 2F1IA 3QNMA 2L5YA 5BOMA 4ED2A 2ZH8A 4IRKA 1T3QA 4I2EA 1Q3UA 4Z6FA 1NOMA 2WB1C 4WQKA 3E2EA 3F5AA 5DECA 2JH7A 3F2CA 4RPZA 4UB2A 5J0PA 1ECWA 5AKGA 4DOCA 2WAQC 2EZYA 2ZIUB 2E1EA 2ZXHA 1T3NA 4QW9A 1LKYB 4KLOA 3F53A 1ZD2P 1YZ7A 3KKAC 2HCFA 5FP0A 9ICLA 5L1IA 3JPRA 1IM4A 2M2UA 3PR5B 3HIYA 3I76A 3EWAA 2YB1A 2E8NA 4NL9A 4PGXA 2P6UA 1C7YA 3PW5A 3HT3A 2KZMA 2K8BB 5AM3A 5HMMA 2YMPA 1ZQRA 1QQ7A 5J2EA 2ZG6A 2ZTDA 4XJEA 5CJ7A 2NRTA 5KFAA 9ICOA 3RAXA 2HBJA 4KLDA 4YR0A 4RWQA 1UT8A 3VC8A 4EEDA 3T5HA 4KB6A 2HVHA 3QEBZ 9ICWA 4JK1A 4Y2YA 3HP6A 1ZRMA 4KLHA 7ICKA 7ICNA 5KFRA 4DFDA 5AM5A 2Y9TA 4R66A 5ALIA 2YMQA 3FDSA 4DQRA 9ICQA 2KOBA 3EYZA 3B0XA 4O3RA 1TFYA 2VJ4A 2J6UA 4RWOA 4JWNA 1UQVA 1S10A 4I27A 1KFTA 1D9DA 5KFGA 2OXOA 5ALKA 4NM1A 5KFCA 2DBYA 2JMGA 4QZHA 5IIOA 3Q8QB 5KL1B 3AQNA 5ALRA 2AJQA 1B43A 2O1PA 2DVIA 2HVIA 4I2JA 5J2DA 1T7PA 3RTVA 1KKXA 3BQ0A 3WFOA 5AKLA 4GFJA 4DSIA 4UBCA 1FEZA 2M0NA 4DSKA 7ICVA 3BJYA 4RUAA 3ICXA 2W9BB 5ALXA 1QLNA 5CHGA 3PSPA 1R8AA 1ZJNA 3NTUA 3H0MB 3WK4A 2DR7A 5J0RA 4I2AA 3NVZA 4C7YA 4KMUA 1QSLA 2H3QA 3KFUF 4UD4A 7ICGA 3QU2A 1ZQIA 4DCCA 5KFEA 4RQ0A 3WFQE 5AICA 2ISOA 3PX6A 1K5OA 2B4VA 5DQGA 2BCQA 4OO1J 2LI6A 2FI1A 5GTIU 4P4PA 3M6ZA 3WKDA 3HKZC 5ALVA 4K4HA 1EXNA 5AKZA 3OSPA 2W8KA 1ZQGA 1NK7A 1BPXA 4DSFA 4DOBA 2BCSA 4WC1A 4K98A 2JHDA 2R8IA 5D62A 8ICVA 3PVXA 3QUCA 4NWIA 3JPTA 3RR7A 5AI8A 1ZQBA 2KP7A 2H3FA 3WK9A 5TZVA 2HW3A 2HOQA 4NKUA 1UA1A 4F5NA 3L9DA 4XQ8A 1SB3C 2G09A 4JV0A 1ZQSA 4KLIA 3ISDA 5CHEA 3LVVA 1ZQQA 8ICFA 5AK3A 3C2KA 5ALPA 4PL1A 4PGYA 1NK5A 2VANA 5B3QA 1DGSA 2PBEA 1MSWD 8ICUA 2ZUCA 4YQWA 1JRPA 2XIDA 5AI0A 3PX4A 4PZNA 5J2JA 4DOAA 1NK8A 4S3NA 1Z3EB 4CF5A 2IBKA 3QUBA 2RLTA 3H8JA 3M6KA 5JRTA 4TUSA 4NLKA 2CRXA 2LYHA 1PVPA 2BKEA 1X9MA 4B9SA 5GTHU 4ELUA 1RG6A 3LDAA 4FH3A 4GC7A 1R8CA 2H3VA 2ZIWA 1MIWA 1H38A 5DB7A 4LT6A 2ZHBA 4M6WB 4TURA 5KG6A 3PW4A 4OAIZ 2W04A 3ZDBA 2HOFA 3FAHA 1CUKA 4ATBB 4YD1A 3S6JA 1SIJA 3H40A 2ZJ8A 3IG5A 3WKCA 2ALZA 4K8VA 1ZQOA 3KOOA 2JEJA 2W3RA 2QB0A 4Y2TA 3THVA 4M47A 2DGZA 4IQTA 4FS1A 1RXVA 3ZDAA 9ICEA 5KG5A 1ZD3A 2E8PA 4IRCA 2H5XA 3C5GA 1DK3A 5KT5A 2KK0A 4MF2A 1VDVA 4RT3A 3MGVA 1NO5A 1ZQNA 4Q8EA 1B4FA 1D8BA 1L7PA 3WFPA 4DQQA 1KDHA 3IV6A 3IRUA 2GOLA 3C18A 3RBEA 4BXOA 4GXKA 4DFPA 2WAQF 4OD0A 5AK4A 4C0ZA 2IHOA 2DKZA 3EZ5A 3KTQA 5ALSA 1URJA 1MN8A 4OJ6A 4JMUA 4DFJA 3KKAA 2JV3A 1TK5A 2PKEA 2JEGA 1V4AA 4FHXA 5JTGA 4O3NA 4G9BA 1SV4A 4FS2A 4B9VA 2W9CB 2K89A 4PHPA 2RDJA 4ACOA 4F50A 4GIBA 7ICQA 4MEYA 4X0AA 3ZDEA 3H0LB 1PUZA 3M1YA 5HMLA 5DB8A 2KVSA 4NLBA 4XUSA 3RBDA 4Y2VA 1T8EA 3GIJA 5HRGA 2UVWA 3V6JA 1JQRA 1F0MA 4O69A 4EENA 3MC1A 2XVTA 1ZQCA 4ECYA 4F71A 4KLQA 5AKYA 4NLCA 3AQLA 4JUZA 8ICZA 2IOHA 5A0LA 4NLGA 1ZETA 4YD2A 4NXTA 4C8OA 4AT9B 3C2LA 1SXDA 4DL6A 2XI9A 3PW2A 5L1JA 1S0OA 1N62A 3MGIA 4G3IA 3SYZA 1Z4OA 2KJ8A 4DWIA 2KJ9A 3C23A 5JUMA 3MABA 3GQCA 2YY6A 3NRWA 3T5KA 4O5CA 1MA7A 4EZ6A 4WC2A 5CEHA 1SL0A 1N48A 4O3QA 2ZIVB 3QUTA 1RDFA 3ZDCA 2P35A 2KICA 3ED5A 7ICJA 5B3PA 2J6TA 2G08A 9ICSA 3LYSA 4I2BA 4LEVA 4P0PB 5HRDA 4ED0A 3SEIA 2JEFA 3TI0A 2VA3A 1WUDA 2IOFK 4U6PA 4KMOB 2E3TA 1L3SA 5HRFA 4RQ2A 1L8OA 4NL9C 4CRXA 5J2KA 4QWAA 3C21A 2EZZA 5D49A 5ALNA 3SENA 7ICOA 1S8OA 2KTQA 1ED1A 1ZJMA 2YMLA 2KSOA 2AGOA 2DL0A 4BX9C 1ZQLA 2WFAA 5DB9A 1O08A 3CRXA 1PVQA 4IQWA 3F2DA 4IRDA 3KD3A 1SL2A 2WTFA 4NJ8A 4AT9A 4IQUA 4DLGA 3WFRE 3EUB2 3EPIA 1UT5A 2B0CA 4DLEA 4MEXA 1DK2A 1ZQWA 9ICVA 2ASDA 7ICMA 5HHHA 4C8NA 4F3OA 3T3FA 4I0UA 1JXEA 5L1LA 1RYSA 1N5XA 1ZXIA 4DO9A 3F2BA 1X6JA 2W7OA 4EEKA 1X6IA 3M8SA 5J29A 5KFVA 4PHEA 4B9TA 4FH5A 1NK4A 1Z19A 4Y2QA 3UMCA 4QJFB 4X4OA 1Q3VA 2FPLA 2KZZA 4X4NA 4RQ4A 1ZQAA 3HJ1A 1KFDA 3KZIU 3D2SA 1MIYA 3WK5A 9ICKA 3K7DA 2I5HA 2F1HA 3NRZA 4C4SA 1LVHA 1KN5A 5J2FA 4J9PA 2ZIVA 2HHVA 4EBCA 3UPSA 3UMGA 5KFIA 1RQLA 5KFJA 3RB6A 1PVRA 2HHWA 2RRDA 4KN7A 5J0UA 4EELA 1FFUA 3TACB 3AQMA 5EE0A 2GH1A 1RPLA 5ALDA 2LKYA 4M9LA 5KFYA 4M9GA 1UPHA 1WWUA 2DR8A 3C5FA 4QW8A 4NXVA 4BWMA 5E79U 1TFWA 5KFBA 5CRXA 4X4PA 2EQYA 4IC9A 2OEHA 4R64A 4DF8A 2ZH2A 3PMNA 3K1RB 4U7CA 3K4GA 2KJ5A 1UEVA 1V97A 5TISU 1COKA 1QCKA 2ZH7A 2DRAA 3HRDD 1U47A 5KFFA 3RR8A 3RJJA 4OAGA 2AHOB 3N7SC 3E0FA 3IP4B 3RJFA 4KLLA 2MRLA 5ALOA 3SI8A 2G06A 4YMMA 8ICSA 3ALRA 5CFUA 5KG2A 4I2FA 2R8JA 3WU2U 2RFFA 1WYGA 3N97B 4EGWA 2WF8A 5KG0A 3RJKA 1QQ6A 4O68A 7ICTA 8ICPA 1SZHA 1NJYA 4KLTA 1TK0A 3B9JA 2XGPA 2CPRA 5IIIA 4YN4A 9ICCA 3D2QA 4LEZA 2LM4A 1A0PA 1A6SA 4DF4A 2G07A 2JH1A 1GPJA 4O9MA 1YZ6A 3GILA 3R9KA 1JROA 3ISCA 5AHXA 2M2VA 8ICEA 5AKIA 1NKCA 3BS5A 5AM0A 3MDCA 1L3VA 3V7JA 4HX0A 4BDPA 4EYIB 3AQKA 3RJHA 4TQRA 3NASA 5J8YA 2OM6A 4QZDA 1UEUA 1BPBA 4KX5A 3BS7A 5KFXA 3ER9B 5DBCA 4C8KA 4IQVA 2C2EA 3ZD8A 4UATA 4F4WA 1XU4A 1R89A 1TAQA 1OXJA 4PH5A 1FO4A 4UB5A 9ICXA 4X4UA 1IIPA 3V6HA 2F8KA 1J2MA 3QU9A 4ECZA 9ICGA 2ATLA 4WC7A 4RT2A 2QARA 4J9MA 1JN3A 3E58A 4KTQA 1NK9A 2G5HB 3DV9A 3ZI4A 4ED8A 3D6JA 3C1ZA 4Y2UA 3MFIA 2DWQA 2FJ6A 1UETA 2B56A 5ALLA 3IG8A 2PFPA 4NLNA 3H0RB 4AYBC 3EF2A 2PFOA 5CFSA 4IR1A 2ZUBA 2F76X 4O5EA 4O5KA 3UMBA 1KSPA 4ELTA 1Y88A 8ICMA 5J0SA 2LPEA 3ETLA 4FHYA 3QE9Y 1BPEA 2JGAA 5KL8B 2F1JA 5DGBA 3QZ7A 3TANA 3WK7A 1WWVA 1JX4A 4ECQA 8ICQA 2WF7A 2EAPA 2VJ5A 4DL2A 1MQ3A 4J03A 4O3OA 1CI4A 1NJZA 3AU2A 4EEYA 3C29A 1ZYQA 2W03A 1HEKA 4X4RA 3BQ2A 4ECVA 4FHWA 3PO4A 1FFVA 1RQNA 2E5SA 4WC3A 1IV8A 4MFCA 2EAMA 1YLQA 2DR9A 1HJPA 2E8MA 4X5VA 4E8FA 1AQ6A 3V7KA 4RQ6A 4C4RA 4K96A 3QZ8A 4PJ0U 4QZAA 4OJLA 4M2YA 2BBHA 1X2IA 5KFLA 1S0NA 3Q8PB 5DG9A 5C5JA 4YP3A 3MR2A 3AM9A 1XS9D 3IM1A 3LK9A 4F5RA 1AROP 4M9NA 5HC9A 5AKXA 2C28A 2HHSA 3WKBA 2XY6A 5JU5A 4YXMA 1D8YA 5KFTA 5KT6A 1N5WA 4CDGA 1JI7A 2GLEA 3BQ1A 9ICFA 2Y0SF 4Q43A 5T14A 4IL6U 2W9BA 1HUOA 2BQRA 2NRWA 3GV5B 3KHLA 4UW9A 4DL5A 4QZBA 4F4YA 1X66A 2AGQA 1UHUA 2A1JB 3OTQA 4WC6A 2GAFD 3GIKA 4FHPA 4KM5A 1BVSA 2F77X 3AQEA 4F5OA 3V72A 4K4IA 3RB4A 2K4IA 1CRXA 4ICAA 2K4HA 3G6XA 3EPGA 9ICTA 4Q8FA 2HHPA 1L6NA 5KFWA 3H37A 4ED1A 2XCPA 1S0VA 5KFQA 3JPQA 4FHVA 4PL2A 1SWWA 5KFHA 4QWCA 4O67A 2W8LA 3UQ0A 5KG7A 2KZ3A 4N7RA 2DPJA 2YMMA 2OHFA 9ICBA 3RAQA 3M9MB 3Q8RB 1Q46A 3Q8KA 2MAXA 2F8LA 2W43A 3OUYB 2Y0SC 2DF4B 5IIMA 2I1QA 3J81j 4YMOA 1SKWA 2W7PA 2AQ0A 3M8RA 4TUQA 3NGDA 4B9NA 3TADC 4LJXA 2K4PA 1PK3A 3QYPA 1SKSA 2ZUDA 1LV5A 2IMWP 4WQLA 5KNIA 4RQ7A 4RPYA 1HIWA 2UVVA 4BUGA 4RQ1A 5AKJA 5DBAA 4M04A 2ZH9A 4K9AA 4DL3A 3OWGA 4Z6EA 2CXYA 9ICAA 2IHNA 1JUDA 4MFAA 3HILA 7ICLA 5HRIA 3PHZA 2ODGA 4Z6DA 2GO7A 4FBTA 4NXWA 4ECTA 4C8MA 3HJEA 2ZIXA 2PFQA 2N1RA 3QU7A 4CNQA 3OUYA 2ZH5A 3CNHA 3H3AA 4AP9A 1T4GA 2KMDA 1XO1A 3RB0A 4FO6A 4WBZA 3MR6A 3WK6A 2G5IB 3OSNA 4CCHA 1L7OA 5AIAA 4I2HA 1K1SA 5J8YC 4RNMA 3OHBA 1JAJA 1L3TA 1B0XA 2E8OA 2JRZA 1JALA 4BXOB 4DQPA 2AQ4A 3QUQA 1SGGA 2DQNB 5ALYA 4YMNA 4I2GA 2ASLA 3ZD9A 3RJEA 1OUQA 4R8UA 2XY5A 4DSLA 3AL0B 3LQCB 1S77D 4YG2A 3OVBA 2FMPA 2KVCA 2R8KA 5KAFU 1ZQXA 3NS1A 1YT3A 5AM4A 1S0MA 5ALEA 4LVSA 3RH4A 1IXRA 5KFMA 5AIBA 1SV0A 2VA8A 2LYBA 2KFNA 3H4BA 4GXJA 4J9SA 4JWMA 4F72A 3KZXA 2ZH3A 9ICIA 3AQFA 5CA7A 4ECWA 5F9NA 1V38A 2FPKA 2WF5A 2EANA 5EOZA 4OAFA 2KD1A 2KSOB 4GC6A 4UB8U 2AXTU 5DLGA 2LMRA 4MFFA 5HRBA 3L3FX 3IN5A 3V6KA 4PGQA 4JLZA 1NZPA 2B6GA 1ZQ1C 1JMSA 2EWRA 3UPQA 4TUPA 4RZRA 2BQ3A 3PSTA 1R8BA 5D61A 2ZH1A 3UXPA 2BDUA 1O03A 2HN2A 3QU5A 5IIJA 2YX8A 2NRZA 2HHQA 4P4OA 3ORYA 3KHRA 4P0PA 1NK0A 4F8RA 4GXIA 1SZPA 2H3ZA 5AKEA 3MGHA 4B9MA 3HJ4A 3TAQA 2OCEA 2NO5A 3RRGA 2BCVA 4EBEA 4ZH4A 4P0QA 3SAHA 5CWRA 4F2RA 4PHDA 3U26A 1N2XA 2HBKA 2P66A 1WCNA 5AK6A 3TFRA 1TV9A 5ALWA 2A1JA 3H39A 4CF4A 1TFRA 1SKRA 4NXZA 3CW2C 8ICCA 3BZKA 5ALFA 4ED7A 1ZQPA 2BPCA 5J2AA 2P6RA 4I29A 3L5KA 5HRLA 2QKQA 1MC8A 4JB3A 3I1YA 3M9NB 2KIVA 2R8GA 4F91B 2KFZA 2PMZF 7ICFA 2O5AA 7ICUA 4WH5A 2KE7A 1Z1BA 5EE9A 2ZH4A 1RZTA 4F5QA 5AM1A 1BNOA 4OJOA 1JIHA 3EW9A 2W11A 3BQTA 5HR6A 5KT4A 2H3IA 4ECRA 2FLLA 5J0QA 9ICPA 4M5DA 4DSEA 4ED6A 4RQ3A 2HN1A 5HR9A 2KG5A 1FA0A 1ZQYA 1BPZA 3DEEA 3HWTA 4LEYA 4LZDA 4MKPA 4QZ8A 7ICRA 3PW7A 2GA9D 2HDOA 2ZHAA 4QZCA 4UASA 2FE9A 2WF9A 5IINA 4F4KA 3IHQB 3ETRA 2GWSA 5D4BA 4Y2PA 3I28A 4WC5A 3AU6A 4EV6A 3SV3A 4CF3A 4X4TA 5H2FU 2FLPA 4NY8A 1NNLA 1A76A 4KLJA 2F2AB 1RM6C 2QLTA 5KFUA 2C2DA 1QSYA 3PY8A 2FPMA 1S76D 4M0AA 5L1MA 5J0TA 4RQ8A 2IUBA 2QB0B 3SMVA 1NKBA 1Z1VA 3RFAA 4QZ9A 1NJXA 4UARA 9ICUA 1T94A 1RXWA 1Q79A 5ALTA 5BOLA 4WOYA 1V9PA 3OGUA 3M9OB 5DGAA 2NRKA 4JV1A 1ZQVA 5L9XA 4KITB 1XC9A 4M6WA 1FIQA 2B21A 1XWLA 2LBOA 4K4GA 4ZOHC 1KQQA 4UAYA 2ZJAA 3VCBA 3FYHA 1S97A 4FZLA 2EH9A 3WFSC 4B9LA 4RQMA 4F4XA 4ELVA 1WCLA 2I6XA 2XCAA 4KN4A 5IIKA 2M2TA 2A19A 5DQHA 1XSNA 3ZDDA 4BWJA 3HX0A 1F44A 8ICAA 8ICKA 3JZ0A 1F5AA 1D9FA 5DKWA 1DOQA 2XICA 5AK5A 5HHIA 3IDWA 3JPNA 2LYAA 2Q4TA 3Q8SB 3OHAA 1SWVA 2KKPA 1ZOLA 1XO0A 2EDUA 2ZTEA 3OV7A 3MFHA 3PV8A 4J9QA 3PNCA 3RB3A 4DQIA 9ICRA 4XQ7A 1N60A 3CYMA 2UVUA 3MDAA 2UVRA 3FM9A 3K1ZA 4KLEA 4O3PA 4EZ9A 1KLNA 1Z00A 2YB4A 2ASJA 1ZQEA 2OH2A 3GFKB 2V4QA 1KFSA 4USAA 4B6JA 3H4DA 1KBUA 2W55A 4J9NA 4FZMA 1MQ2A 4QZGA 5AI6A 5DDYA 5ALGA 2A3VA 3JPPA 1ZQFA 4RU9A 4J9OA 2XY7A 2HBMA 4RPXA 4FE3A 4R63A 3GV7B 4UAZA 2LHTA 4WCWA 3ONNA 4CGZA 4A8EA 2IHMA 4YCXA 5AI9A 4QNLA 3HW8A 4WC0A 4EBJA 3OPXA 5B66U 4YVZA 4P4MA 1TVAA 2E1FA 1SXEA 4C4TA 2PMZC 1BPDA 2A1AA 4KX3A 9ICHA 5HRKA 2KV2A 1RYUA 2OWOA 1NJWA 3NYBA 5CP2A 3H38A 2IOFA 4QZEA 2AU0A 4QZFA 4QZIA 2KKVA 5J2BA 4XRHA 1P7DA 2PI5A 4M9HA 2PXIA 4PPXA 2B51A 1VJ5A 3T79A 5G5HA 1TE2A 4QWEA 2ZXIA 4QIWF 2KIWA 5ALUA 2MU2A 2NRXA 3H7IA 4WC4A 4JV2A 1X40A 4XA5A 1GO3F 8ICGA 3FC4A 2FDRA 5F3XB 3C1YA 3A0HU 1L7NA 3NUQA 5DDMA 3O0FA 3UXOA 2NO4A 4EBKA 2JEIA 5ALJA 2D3DA 5KFZA 4AT8B 4UD5A 4DQSA 5EE3A 4LEWA 2PI4A 1DGJA 2HHXA 3T5JA 2BBJA 1QQ5A 4M9JA 1ZQHA 4PZOA 3TFSA 4DS4A 2HMXA 1U48A 3LWMA 5J2IA 3NWIA 9ICJA 2BPGA 1N61A 2ZIUA 2YN4A 3OVSA 2MA1A 4NM2A 4P2HA 4JLXA 5DEDA 2V4RA 4E7XA 2D6FC 4Q45A 4Y2JA 5KFOA 8ICWA 1TK8A 3RF9A 3RH6A 5ALZA 1WOTA 5KFKA 3PMLA 2YTUA 3JCFA 4UQGA 3DDHA 5KT3A 4Y2SA 1C20A 2F44A 2FLNA 1KL9A 2BGWA 1KW4A 4I2CA 2R18A 2RQ5A 2XGQA 1VJ7A 4EEBA 5EE1A 3CP8A 1B22A 4X4QA 2DFLA 4UB3A 4AT8A 2JXJA 3N4MB 4ED3A 3CK6A 1V85A 5L1KA 1IG6A 4EX6A 4US8A 2W9AA 5D63A 1L3UA 2EZXA 1KNYA 3A0BU 4DEZA 3NVWA 5KT7A 2HBLA
chains in the Genus database with same CATH topology
3PW0A 4GLXA 5DLFA 5J2FA 4J9PA 2XC9A 3HT3A 3PW5A 3QEAZ 4AT7B 4EP7A 2KZMA 5CA7A 4ECWA 8ICYA 2HHVA 5F9NA 5HMMA 2FPKA 4EBCA 3JYYA 1ZQRA 5EOZA 5KFIA 5KFJA 5J2EA 3GIIA 3RB6A 2AGPA 2HHWA 3UPSA 2ZTDA 4GC6A 5CJ7A 2NRTA 4KN7A 5KFAA 1K1QA 5DLGA 5J0UA 3RJIA 3RAXA 4MFFA 1TAUA 5HRBA 4KLDA 3AQMA 4YR0A 4UB4A 1RPLA 1UT8A 4RWQA 3V6KA 2DRBA 3T5HA 4PGQA 2HVHA 7ICSA 3QEBZ 1NZPA 9ICWA 4JK1A 1JMSA 3HP6A 4KLHA 4M9LA 3PR4A 4TUPA 4RZRA 5KFYA 5KFRA 3UPQA 2BQ3A 4M9GA 7ICKA 5HNKA 4R66A 3G6YA 3C5FA 3FDSA 4QW8A 4DQRA 7ICPA 3OJSA 4I28A 3UXPA 9ICQA 1R8BA 2ZH1A 4BWMA 3EYZA 1TFWA 5IIJA 5KFBA 3B0XA 2NRVA 4O3RA 5CR0A 4RQ5A 4X4PA 4R64A 2NRZA 5J2HA 4DF8A 2HHQA 5DG8A 1TFYA 4P4OA 2J6UA 8ICLA 8ICHA 2ZH2A 4RWOA 3ORYA 4QWBA 3PMNA 4JWNA 3KHRA 1KFTA 1S10A 1NK0A 4I27A 3Q8MA 4F8RA 3UQ2A 1KTQA 1SZPA 4GXIA 5KFGA 1D9DA 3K4GA 2BE3A 1UEVA 3PO5A 3MGHA 4DFKA 4B9MA 1ZQMA 4YR3A 4PHAA 5KFSA 4LZGA 4O0IA 3TAQA 4NM1A 4KLGA 1MIVA 3HJ4A 3RRGA 2ZJ5A 5DB6A 2ZH7A 2BCVA 2DRAA 5KFCA 4EBEA 4ZH4A 1U47A 5KFFA 5CWRA 4F2RA 4QZHA 5D46A 5IIOA 3Q8QB 3RR8A 3RJJA 3AQNA 4PHDA 3RJFA 4KLLA 2AJQA 1B43A 2O1PA 3SI8A 1N56A 2P66A 2DVIA 2HVIA 4I2JA 1WCNA 4IG8A 5J2DA 4YMMA 3KHGA 3TFRA 3PX0A 1TV9A 2A1JA 3RTVA 1T7PA 8ICSA 3BQ0A 3WFOA 3H39A 5KG2A 2C2RA 5J2GA 2R8JA 1TFRA 1SKRA 4DSIA 4I2FA 4X0AA 4NXZA 1U4BA 4O3SA 8ICCA 4UBCA 2BDPA 2RFFA 1BGXT 4ED7A 1ZQPA 2P6RA 2BPCA 5J2AA 4I29A 5HRLA 4DSKA 1ZQUA 3BJYA 4RUAA 3RRHA 1MC8A 4R65A 4EYHB 3N97B 7ICVA 1BNPA 4RNNA 8ICXA 5KG0A 3M9NB 2W9BB 4X0BA 3RJKA 4FBUA 1QLNA 5CHGA 2R8GA 4IR9A 4F91B 1R8AA 1ZJNA 7ICTA 3NTUA 4YFKA 2KFZA 8ICPA 8ICIA 1NJYA 4KLTA 1TK0A 7ICFA 5J0RA 2XGPA 4DL7A 5IIIA 4YN4A 4I2AA 1CEZA 9ICCA 2HHTA 4KMUA 4YXJA 2O5AA 1QSLA 4DF4A 7ICUA 4UD4A 7ICGA 1Z00B 4O9MA 3GILA 1ZQIA 2BR0A 2KN7A 4I2DA 2ZH4A 3ISCA 8ICJA 2M2VA 5KFEA 4EBDA 8ICEA 4RQ0A 1RZTA 1NKCA 4F5QA 3TQ1A 1BNOA 1COOA 4UB1A 3MDCA 8ICOA 1L3VA 4C8LA 3WFQE 3V7JA 4BDPA 1JIHA 3EW9A 4EYIB 2ISOA 3PX6A 4UBBA 3BQTA 5KT4A 4RUCA 3AQKA 2JZBA 5DQGA 2BCQA 4ECRA 4TQRA 4F4ZA 2FLLA 3RJHA 4MF8A 4P4PA 5J0QA 9ICPA 2MUTA 4M5DA 4K4HA 4DSEA 4QZDA 4X4SA 1UEUA 1BPBA 1EXNA 4RQ3A 2W9CA 4ED6A 5KFXA 5HR9A 3MR5A 1FA0A 2ID1A 1ZQYA 2W8KA 3OSPA 1BPZA 1ZQGA 5DBCA 1NK7A 4C8KA 1BPXA 4DSFA 7ICHA 4DOBA 3HWTA 4IQVA 2C2EA 4LZDA 5KFNA 2BCSA 3ZD8A 4WC1A 2R8IA 4UAWA 4F4WA 4QZ8A 8ICVA 7ICRA 3PVXA 1XU4A 3PW7A 3Q8LA 1R89A 1PX5A 5KFPA 1TAQA 3JPTA 2MUTB 3RR7A 1ZQBA 4F93B 4PH5A 7ICIA 2ZHAA 4QZCA 2KP7A 5TZVA 4UB5A 4X4VA 9ICXA 2HW3A 4X4UA 4KLUA 5IINA 4F4KA 3IHQB 5HREA 3V6HA 2GWSA 4NKUA 5D4BA 1UA1A 4WC5A 4F5NA 3AU6A 4ECZA 3L9DA 4XQ8A 1ZQDA 1ZQTA 4KLMA 9ICGA 3SV3A 2ATLA 4JV0A 4WC7A 1ZQSA 4KLFA 4KLIA 4HYKA 3ISBA 3UXNA 4RT2A 4X4TA 3ISDA 2FLPA 4NY8A 1TKDA 4J9MA 1A76A 1JN3A 1ZQQA 4TQSA 4KLJA 4KTQA 1NK9A 4KLSA 8ICFA 3C2KA 9ICMA 3SV4A 1QSYA 5KFUA 5J0XA 2C2DA 4PGYA 4ED8A 2I9GA 4F2SA 1NK5A 3C1ZA 1U45A 2FPMA 3PY8A 1S76D 5BPCA 3MFIA 4M0AA 2VANA 5J0TA 1UETA 1DGSA 2PBEA 4RQ8A 1MSWD 8ICUA 5KT2A 5J2CA 4BGDA 2PFPA 2ZUCA 4YQWA 4NLNA 2DR7A 1NKBA 3V7LA 4QZ9A 1NJXA 3PX4A 2PFOA 4IR1A 2ZUBA 9ICUA 5KG1A 1RXWA 5J2JA 4DOAA 2C22A 5KG4A 1NK8A 7ICNA 9ICOA 5BOLA 1Z3EB 4DSJA 2IBKA 4S3NA 1V9PA 4ATBA 1NKEA 3OGUA 3M9OB 2R8HA 4ECUA 1U9LA 3H8JA 1KSPA 4O5EA 4O5KA 2M2WA 5DGAA 4Q44A 1Y88A 1ZQVA 4TUSA 4ELTA 5J0SA 3ETLA 4J9RA 4JV1A 4NLKA 8ICMA 2LYHA 5L9XA 3QE9Y 4FHYA 1BPEA 2BKEA 5J0WA 2Y1JA 4KITB 2DPIA 2F1JA 1XC9A 2ZTCA 4M6WA 5DGBA 3GDXA 1X9MA 3QZ7A 1LB2B 2PFNA 4B9SA 3TANA 4ELUA 2B21A 3LDAA 5KTQA 4FH3A 1XWLA 4GC7A 1R8CA 1JX4A 1MIWA 1H38A 4ECQA 5DB7A 1KRPA 4LT6A 8ICQA 2DR5A 4K4GA 2ZHBA 4DL2A 4M6WB 1MQ3A 4TURA 5KG6A 4UAYA 2ZJAA 1S97A 3FYHA 3GV8B 4O3OA 5HRHA 9ICNA 3MBYA 1NJZA 3AU2A 3LWLA 3PW4A 3WFSC 4EEYA 1ZYQA 3ZDBA 4B9LA 4F4XA 1CUKA 4ELVA 2BCRA 4ATBB 1WCLA 4YD1A 3NYBA 2XCAA 4X4RA 3BQ2A 4ECVA 4KN4A 3H40A 5IIKA 2M2TA 4RWPA 5DQHA 4I2IA 1XSNA 2ZJ8A 1QTMA 4BWJA 3HX0A 2ALZA 3ZDDA 4FHWA 3PO4A 8ICAA 1ZQOA 2JEJA 4E80A 4QWDA 4WC3A 2W9MA 8ICKA 8ICTA 4DFMA 3H8WA 1HUZA 4MFCA 3JZ0A 3C66A 1YLQA 3THVA 4B9UA 4IQTA 1HJPA 4M47A 1F5AA 2DR9A 1D9FA 4FS1A 1RXVA 4X5VA 3ZDAA 1PZNA 5KG5A 5DKWA 1DOQA 9ICEA 4E8FA 3V7KA 4WBYA 4IRCA 2H5XA 3C5GA 3AUOA 4YR2A 5HHIA 5KT5A 1DK3A 4RQ6A 4MF2A 4RT3A 3JPNA 3Q8SB 3QZ8A 4DS5A 2JZBB 3OHAA 1ZQNA 1X9WA 2FMSA 4Q8EA 1NO5A 4QZAA 3WFPA 2ZTEA 3OV7A 3MFHA 4DQQA 4M2YA 3PV8A 1L5UA 1X2IA 1KDHA 5KFLA 5KG3A 3PNCA 3Q8PB 4J9QA 1S0NA 3RB3A 5DG9A 5C5JA 3C18A 4YP3A 4DQIA 9ICRA 3MR2A 4XQ7A 2ZH6A 1XS9D 3IM1A 3LK9A 4F5RA 3RBEA 4BXOA 4GXKA 2UVUA 4DFPA 3MDAA 1AROP 2RDIA 3H8SA 2UVRA 4M9NA 3K75D 3C2MA 4KLEA 3SZ2A 4O3PA 4AT7A 2C28A 5HC9A 2HHSA 2XY6A 4RWNA 4EZ9A 3EZ5A 1KLNA 3TAPA 1Z00A 5J0OA 3KTQA 4YXMA 1D8YA 5KFTA 2ASJA 4DFJA 3G6VA 1ZQEA 5KT6A 3GFKB 2V4QA 1KFSA 1TK5A 4J9KA 3H4DA 3RJGA 2JEGA 1V4AA 4FHXA 4J9NA 3BQ1A 1Q78A 9ICFA 4O3NA 4Q43A 4FS2A 4B9VA 2W9CB 1MQ2A 4QZGA 4PHPA 1UA0A 2W9BA 5DDYA 2RDJA 1HUOA 4J9LA 4F50A 5F9LA 2BQRA 2HHUA 3OVAA 2NRWA 1QSSA 3JPPA 3GV5B 1ZQFA 7ICQA 4MEYA 4RU9A 3KHLA 1D8LA 4J9OA 3ZDEA 2XO7A 2XY7A 4RPXA 2BPFA 4R63A 3GV7B 1OU5A 4UAZA 3RH5A 5HMLA 4NKTA 5DB8A 4DL5A 4WCWA 4QZBA 4F4YA 1VFGA 2AGQA 4XUSA 2A1JB 2IHMA 3RBDA 4WC6A 3GIKA 4FHPA 3BDPA 1BVSA 4YCXA 1T8EA 3GIJA 2V9WA 5HRGA 4K4IA 4F5OA 3V72A 3V6JA 2UVWA 1KEJA 1JQRA 3RB4A 5EWFA 3HW8A 1NK6A 3G6XA 3EPGA 1X9SA 1ZQCA 4WC0A 9ICTA 4EBJA 4ECYA 1JXLA 2NRKA 4E0DA 4YVZA 4KLQA 4P4MA 1BPYA 1TVAA 5HP4A 4Q8FA 2HHPA 5KFWA 2Q0ZX 2FMQA 4JUZA 4ED1A 3AQLA 4ECSA 3H37A 2XCPA 1S0VA 5KFQA 3JPOA 3JPQA 8ICZA 3B0YA 1A77A 5DG7A 1XSPA 4NLGA 4FHVA 3OJUA 1ZETA 4YD2A 4C8OA 4AT9B 5KFHA 1BPDA 4QWCA 3C2LA 5EWGA 9ICHA 5HRKA 4DL6A 2W8LA 3UQ0A 1NJWA 1ZQJA 5EWEA 2OWOA 3PW2A 5KG7A 5L1JA 2KZ3A 5CP2A 2M9NA 1S9FA 7ICEA 2BQUA 3H38A 2DPJA 9ICBA 3RAQA 4QZEA 3M9MB 1S0OA 2AU0A 3Q8RB 4QZFA 8ICRA 4QZIA 3Q8KA 2MAXA 3OUYB 5J2BA 4XRHA 3MGIA 2BHNA 5IIMA 2PI5A 4M9HA 4G3IA 2I1QA 2PXIA 4PPXA 8ICNA 4YMOA 5IILA 3SYZA 1SKWA 4QWEA 4NLZA 5F2VO 2AQ0A 3M8RA 4TUQA 5DBBA 3NGDA 4B9NA 4DWIA 3C23A 5KFDA 5JUMA 3MABA 4F92B 3GQCA 1RYRA 3T5KA 3JPSA 4O5CA 8ICBA 2NRXA 1ZQKA 4EZ6A 4WC2A 2Q66A 3H7IA 4WC4A 3HPOA 4JV2A 3MR3A 1SL0A 1N48A 4XA5A 8ICGA 5DQIA 1SKSA 2ZUDA 2BCUA 1LV5A 2IMWP 4O3QA 3ZDCA 3C1YA 4RQ7A 4RPYA 7ICJA 2J6TA 3GIMA 9ICSA 3T5LA 2UVVA 5DDMA 4RQ1A 2ISPA 4I2BA 5DBAA 3UXOA 2J6SA 4M04A 5HRDA 2ZH9A 2VA2A 4ED0A 4DL3A 2JEFA 3TI0A 4Z6CA 2VA3A 4DL4A 4Z6EA 9ICAA 4RNOA 4EBKA 2Y1IA 2JEIA 3TARA 2IA6A 2IHNA 1U49A 5CB1A 4MFAA 1ZQZA 1L3SA 7ICLA 5HRIA 5KFZA 5HRFA 4RQ2A 5J2KA 4AT8B 4UD5A 4DQSA 4QWAA 4F5PA 3C21A 5J0YA 1XSLA 2PI4A 5D49A 4Z6DA 3KHHA 4ECXA 3T5JA 4FBTA 2HHXA 4M9JA 4ECTA 4C8MA 1ZQHA 3TFSA 7ICOA 4R8UB 1SL1A 2PFQA 1Q79A 2KTQA 4DS4A 1ZJMA 1U48A 3LWMA 5J2IA 9ICJA 2BPGA 3OUYA 2ZH5A 2AGOA 3H3AA 1ZQLA 5DB9A 4IQWA 1T4GA 3OVSA 4IRDA 2F1IA 5BOMA 1XO1A 3RB0A 4NM2A 2WTFA 4ED2A 4FO6A 1SL2A 4IRKA 3MR6A 4P2HA 2V4RA 4WBZA 5DEDA 2ZH8A 4I2EA 4E7XA 4Q45A 4AT9A 4Z6FA 5KFOA 4IQUA 1NOMA 8ICWA 1TK8A 3RH6A 3OSNA 4CCHA 4DLGA 3E2EA 1WOTA 5DECA 3WFRE 5KFKA 1UT5A 3PMLA 1K1SA 3EPIA 4DLEA 4MEXA 4I2HA 4UQGA 4RNMA 1DK2A 1ZQWA 4RPZA 3OHBA 5KT3A 9ICVA 4UB2A 5J0PA 2FLNA 1JAJA 2ASDA 1L3TA 7ICMA 5HHHA 4C8NA 4DOCA 4F3OA 3T3FA 4BXOB 4DQPA 2AQ4A 2BGWA 1JXEA 5L1LA 1RYSA 4YMNA 4I2CA 4I2GA 2ASLA 1T3NA 4DO9A 4QW9A 2XGQA 3ZD9A 1VJ7A 3RJEA 3M8SA 4R8UA 5J29A 5KFVA 2XY5A 4DSLA 4KLOA 3LQCB 1S77D 4PHEA 4B9TA 4FH5A 4YG2A 3OVBA 1NK4A 1B22A 2FMPA 9ICLA 5L1IA 4X4QA 2R8KA 2DFLA 4UB3A 1ZQXA 4AT8A 4X4OA 2FPLA 3N4MB 2KZZA 4ED3A 1S0MA 3JPRA 4LVSA 3RH4A 4RQ4A 4X4NA 1ZQAA 3HJ1A 1IXRA 1KFDA 5KFMA 1IM4A 5L1KA 2VA8A 1MIYA 2DR8A 2KFNA 3H4BA 2W9AA 4GXJA 9ICKA 2M2UA 3PR5B 4J9SA 4JWMA 2F1HA 3HIYA 1L3UA 3EWAA 1KNYA 2ZH3A 4DEZA 5KT7A 9ICIA 4PGXA 2P6UA 1C7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW0 A;  4GLX A;  5DLF A;  5J2F A;  4J9P A;  2XC9 A;  3HT3 A;  3PW5 A;  3QEA Z;  4AT7 B;  4EP7 A;  2KZM A;  5CA7 A;  4ECW A;  8ICY A;  2HHV A;  5F9N A;  5HMM A;  2FPK A;  4EBC A;  3JYY A;  1ZQR A;  5EOZ A;  5KFI A;  5KFJ A;  5J2E A;  3GII A;  3RB6 A;  2AGP A;  2HHW A;  3UPS A;  2ZTD A;  4GC6 A;  5CJ7 A;  2NRT A;  4KN7 A;  5KFA A;  1K1Q A;  5DLG A;  5J0U A;  3RJI A;  3RAX A;  4MFF A;  1TAU A;  5HRB A;  4KLD A;  3AQM A;  4YR0 A;  4UB4 A;  1RPL A;  1UT8 A;  4RWQ A;  3V6K A;  2DRB A;  3T5H A;  4PGQ A;  2HVH A;  7ICS A;  3QEB Z;  1NZP A;  9ICW A;  4JK1 A;  1JMS A;  3HP6 A;  4KLH A;  4M9L A;  3PR4 A;  4TUP A;  4RZR A;  5KFY A;  5KFR A;  3UPQ A;  2BQ3 A;  4M9G A;  7ICK A;  5HNK A;  4R66 A;  3G6Y A;  3C5F A;  3FDS A;  4QW8 A;  4DQR A;  7ICP A;  3OJS A;  4I28 A;  3UXP A;  9ICQ A;  1R8B A;  2ZH1 A;  4BWM A;  3EYZ A;  1TFW A;  5IIJ A;  5KFB A;  3B0X A;  2NRV A;  4O3R A;  5CR0 A;  4RQ5 A;  4X4P A;  4R64 A;  2NRZ A;  5J2H A;  4DF8 A;  2HHQ A;  5DG8 A;  1TFY A;  4P4O A;  2J6U A;  8ICL A;  8ICH A;  2ZH2 A;  4RWO A;  3ORY A;  4QWB A;  3PMN A;  4JWN A;  3KHR A;  1KFT A;  1S10 A;  1NK0 A;  4I27 A;  3Q8M A;  4F8R A;  3UQ2 A;  1KTQ A;  1SZP A;  4GXI A;  5KFG A;  1D9D A;  3K4G A;  2BE3 A;  1UEV A;  3PO5 A;  3MGH A;  4DFK A;  4B9M A;  1ZQM A;  4YR3 A;  4PHA A;  5KFS A;  4LZG A;  4O0I A;  3TAQ A;  4NM1 A;  4KLG A;  1MIV A;  3HJ4 A;  3RRG A;  2ZJ5 A;  5DB6 A;  2ZH7 A;  2BCV A;  2DRA A;  5KFC A;  4EBE A;  4ZH4 A;  1U47 A;  5KFF A;  5CWR A;  4F2R A;  4QZH A;  5D46 A;  5IIO A;  3Q8Q B;  3RR8 A;  3RJJ A;  3AQN A;  4PHD A;  3RJF A;  4KLL A;  2AJQ A;  1B43 A;  2O1P A;  3SI8 A;  1N56 A;  2P66 A;  2DVI A;  2HVI A;  4I2J A;  1WCN A;  4IG8 A;  5J2D A;  4YMM A;  3KHG A;  3TFR A;  3PX0 A;  1TV9 A;  2A1J A;  3RTV A;  1T7P A;  8ICS A;  3BQ0 A;  3WFO A;  3H39 A;  5KG2 A;  2C2R A;  5J2G A;  2R8J A;  1TFR A;  1SKR A;  4DSI A;  4I2F A;  4X0A A;  4NXZ A;  1U4B A;  4O3S A;  8ICC A;  4UBC A;  2BDP A;  2RFF A;  1BGX T;  4ED7 A;  1ZQP A;  2P6R A;  2BPC A;  5J2A A;  4I29 A;  5HRL A;  4DSK A;  1ZQU A;  3BJY A;  4RUA A;  3RRH A;  1MC8 A;  4R65 A;  4EYH B;  3N97 B;  7ICV A;  1BNP A;  4RNN A;  8ICX A;  5KG0 A;  3M9N B;  2W9B B;  4X0B A;  3RJK A;  4FBU A;  1QLN A;  5CHG A;  2R8G A;  4IR9 A;  4F91 B;  1R8A A;  1ZJN A;  7ICT A;  3NTU A;  4YFK A;  2KFZ A;  8ICP A;  8ICI A;  1NJY A;  4KLT A;  1TK0 A;  7ICF A;  5J0R A;  2XGP A;  4DL7 A;  5III A;  4YN4 A;  4I2A A;  1CEZ A;  9ICC A;  2HHT A;  4KMU A;  4YXJ A;  2O5A A;  1QSL A;  4DF4 A;  7ICU A;  4UD4 A;  7ICG A;  1Z00 B;  4O9M A;  3GIL A;  1ZQI A;  2BR0 A;  2KN7 A;  4I2D A;  2ZH4 A;  3ISC A;  8ICJ A;  2M2V A;  5KFE A;  4EBD A;  8ICE A;  4RQ0 A;  1RZT A;  1NKC A;  4F5Q A;  3TQ1 A;  1BNO A;  1COO A;  4UB1 A;  3MDC A;  8ICO A;  1L3V A;  4C8L A;  3WFQ E;  3V7J A;  4BDP A;  1JIH A;  3EW9 A;  4EYI B;  2ISO A;  3PX6 A;  4UBB A;  3BQT A;  5KT4 A;  4RUC A;  3AQK A;  2JZB A;  5DQG A;  2BCQ A;  4ECR A;  4TQR A;  4F4Z A;  2FLL A;  3RJH A;  4MF8 A;  4P4P A;  5J0Q A;  9ICP A;  2MUT A;  4M5D A;  4K4H A;  4DSE A;  4QZD A;  4X4S A;  1UEU A;  1BPB A;  1EXN A;  4RQ3 A;  2W9C A;  4ED6 A;  5KFX A;  5HR9 A;  3MR5 A;  1FA0 A;  2ID1 A;  1ZQY A;  2W8K A;  3OSP A;  1BPZ A;  1ZQG A;  5DBC A;  1NK7 A;  4C8K A;  1BPX A;  4DSF A;  7ICH A;  4DOB A;  3HWT A;  4IQV A;  2C2E A;  4LZD A;  5KFN A;  2BCS A;  3ZD8 A;  4WC1 A;  2R8I A;  4UAW A;  4F4W A;  4QZ8 A;  8ICV A;  7ICR A;  3PVX A;  1XU4 A;  3PW7 A;  3Q8L A;  1R89 A;  1PX5 A;  5KFP A;  1TAQ A;  3JPT A;  2MUT B;  3RR7 A;  1ZQB A;  4F93 B;  4PH5 A;  7ICI A;  2ZHA A;  4QZC A;  2KP7 A;  5TZV A;  4UB5 A;  4X4V A;  9ICX A;  2HW3 A;  4X4U A;  4KLU A;  5IIN A;  4F4K A;  3IHQ B;  5HRE A;  3V6H A;  2GWS A;  4NKU A;  5D4B A;  1UA1 A;  4WC5 A;  4F5N A;  3AU6 A;  4ECZ A;  3L9D A;  4XQ8 A;  1ZQD A;  1ZQT A;  4KLM A;  9ICG A;  3SV3 A;  2ATL A;  4JV0 A;  4WC7 A;  1ZQS A;  4KLF A;  4KLI A;  4HYK A;  3ISB A;  3UXN A;  4RT2 A;  4X4T A;  3ISD A;  2FLP A;  4NY8 A;  1TKD A;  4J9M A;  1A76 A;  1JN3 A;  1ZQQ A;  4TQS A;  4KLJ A;  4KTQ A;  1NK9 A;  4KLS A;  8ICF A;  3C2K A;  9ICM A;  3SV4 A;  1QSY A;  5KFU A;  5J0X A;  2C2D A;  4PGY A;  4ED8 A;  2I9G A;  4F2S A;  1NK5 A;  3C1Z A;  1U45 A;  2FPM A;  3PY8 A;  1S76 D;  5BPC A;  3MFI A;  4M0A A;  2VAN A;  5J0T A;  1UET A;  1DGS A;  2PBE A;  4RQ8 A;  1MSW D;  8ICU A;  5KT2 A;  5J2C A;  4BGD A;  2PFP A;  2ZUC A;  4YQW A;  4NLN A;  2DR7 A;  1NKB A;  3V7L A;  4QZ9 A;  1NJX A;  3PX4 A;  2PFO A;  4IR1 A;  2ZUB A;  9ICU A;  5KG1 A;  1RXW A;  5J2J A;  4DOA A;  2C22 A;  5KG4 A;  1NK8 A;  7ICN A;  9ICO A;  5BOL A;  1Z3E B;  4DSJ A;  2IBK A;  4S3N A;  1V9P A;  4ATB A;  1NKE A;  3OGU A;  3M9O B;  2R8H A;  4ECU A;  1U9L A;  3H8J A;  1KSP A;  4O5E A;  4O5K A;  2M2W A;  5DGA A;  4Q44 A;  1Y88 A;  1ZQV A;  4TUS A;  4ELT A;  5J0S A;  3ETL A;  4J9R A;  4JV1 A;  4NLK A;  8ICM A;  2LYH A;  5L9X A;  3QE9 Y;  4FHY A;  1BPE A;  2BKE A;  5J0W A;  2Y1J A;  4KIT B;  2DPI A;  2F1J A;  1XC9 A;  2ZTC A;  4M6W A;  5DGB A;  3GDX A;  1X9M A;  3QZ7 A;  1LB2 B;  2PFN A;  4B9S A;  3TAN A;  4ELU A;  2B21 A;  3LDA A;  5KTQ A;  4FH3 A;  1XWL A;  4GC7 A;  1R8C A;  1JX4 A;  1MIW A;  1H38 A;  4ECQ A;  5DB7 A;  1KRP A;  4LT6 A;  8ICQ A;  2DR5 A;  4K4G A;  2ZHB A;  4DL2 A;  4M6W B;  1MQ3 A;  4TUR A;  5KG6 A;  4UAY A;  2ZJA A;  1S97 A;  3FYH A;  3GV8 B;  4O3O A;  5HRH A;  9ICN A;  3MBY A;  1NJZ A;  3AU2 A;  3LWL A;  3PW4 A;  3WFS C;  4EEY A;  1ZYQ A;  3ZDB A;  4B9L A;  4F4X A;  1CUK A;  4ELV A;  2BCR A;  4ATB B;  1WCL A;  4YD1 A;  3NYB A;  2XCA A;  4X4R A;  3BQ2 A;  4ECV A;  4KN4 A;  3H40 A;  5IIK A;  2M2T A;  4RWP A;  5DQH A;  4I2I A;  1XSN A;  2ZJ8 A;  1QTM A;  4BWJ A;  3HX0 A;  2ALZ A;  3ZDD A;  4FHW A;  3PO4 A;  8ICA A;  1ZQO A;  2JEJ A;  4E80 A;  4QWD A;  4WC3 A;  2W9M A;  8ICK A;  8ICT A;  4DFM A;  3H8W A;  1HUZ A;  4MFC A;  3JZ0 A;  3C66 A;  1YLQ A;  3THV A;  4B9U A;  4IQT A;  1HJP A;  4M47 A;  1F5A A;  2DR9 A;  1D9F A;  4FS1 A;  1RXV A;  4X5V A;  3ZDA A;  1PZN A;  5KG5 A;  5DKW A;  1DOQ A;  9ICE A;  4E8F A;  3V7K A;  4WBY A;  4IRC A;  2H5X A;  3C5G A;  3AUO A;  4YR2 A;  5HHI A;  5KT5 A;  1DK3 A;  4RQ6 A;  4MF2 A;  4RT3 A;  3JPN A;  3Q8S B;  3QZ8 A;  4DS5 A;  2JZB B;  3OHA A;  1ZQN A;  1X9W A;  2FMS A;  4Q8E A;  1NO5 A;  4QZA A;  3WFP A;  2ZTE A;  3OV7 A;  3MFH A;  4DQQ A;  4M2Y A;  3PV8 A;  1L5U A;  1X2I A;  1KDH A;  5KFL A;  5KG3 A;  3PNC A;  3Q8P B;  4J9Q A;  1S0N A;  3RB3 A;  5DG9 A;  5C5J A;  3C18 A;  4YP3 A;  4DQI A;  9ICR A;  3MR2 A;  4XQ7 A;  2ZH6 A;  1XS9 D;  3IM1 A;  3LK9 A;  4F5R A;  3RBE A;  4BXO A;  4GXK A;  2UVU A;  4DFP A;  3MDA A;  1ARO P;  2RDI A;  3H8S A;  2UVR A;  4M9N A;  3K75 D;  3C2M A;  4KLE A;  3SZ2 A;  4O3P A;  4AT7 A;  2C28 A;  5HC9 A;  2HHS A;  2XY6 A;  4RWN A;  4EZ9 A;  3EZ5 A;  1KLN A;  3TAP A;  1Z00 A;  5J0O A;  3KTQ A;  4YXM A;  1D8Y A;  5KFT A;  2ASJ A;  4DFJ A;  3G6V A;  1ZQE A;  5KT6 A;  3GFK B;  2V4Q A;  1KFS A;  1TK5 A;  4J9K A;  3H4D A;  3RJG A;  2JEG A;  1V4A A;  4FHX A;  4J9N A;  3BQ1 A;  1Q78 A;  9ICF A;  4O3N A;  4Q43 A;  4FS2 A;  4B9V A;  2W9C B;  1MQ2 A;  4QZG A;  4PHP A;  1UA0 A;  2W9B A;  5DDY A;  2RDJ A;  1HUO A;  4J9L A;  4F50 A;  5F9L A;  2BQR A;  2HHU A;  3OVA A;  2NRW A;  1QSS A;  3JPP A;  3GV5 B;  1ZQF A;  7ICQ A;  4MEY A;  4RU9 A;  3KHL A;  1D8L A;  4J9O A;  3ZDE A;  2XO7 A;  2XY7 A;  4RPX A;  2BPF A;  4R63 A;  3GV7 B;  1OU5 A;  4UAZ A;  3RH5 A;  5HML A;  4NKT A;  5DB8 A;  4DL5 A;  4WCW A;  4QZB A;  4F4Y A;  1VFG A;  2AGQ A;  4XUS A;  2A1J B;  2IHM A;  3RBD A;  4WC6 A;  3GIK A;  4FHP A;  3BDP A;  1BVS A;  4YCX A;  1T8E A;  3GIJ A;  2V9W A;  5HRG A;  4K4I A;  4F5O A;  3V72 A;  3V6J A;  2UVW A;  1KEJ A;  1JQR A;  3RB4 A;  5EWF A;  3HW8 A;  1NK6 A;  3G6X A;  3EPG A;  1X9S A;  1ZQC A;  4WC0 A;  9ICT A;  4EBJ A;  4ECY A;  1JXL A;  2NRK A;  4E0D A;  4YVZ A;  4KLQ A;  4P4M A;  1BPY A;  1TVA A;  5HP4 A;  4Q8F A;  2HHP A;  5KFW A;  2Q0Z X;  2FMQ A;  4JUZ A;  4ED1 A;  3AQL A;  4ECS A;  3H37 A;  2XCP A;  1S0V A;  5KFQ A;  3JPO A;  3JPQ A;  8ICZ A;  3B0Y A;  1A77 A;  5DG7 A;  1XSP A;  4NLG A;  4FHV A;  3OJU A;  1ZET A;  4YD2 A;  4C8O A;  4AT9 B;  5KFH A;  1BPD A;  4QWC A;  3C2L A;  5EWG A;  9ICH A;  5HRK A;  4DL6 A;  2W8L A;  3UQ0 A;  1NJW A;  1ZQJ A;  5EWE A;  2OWO A;  3PW2 A;  5KG7 A;  5L1J A;  2KZ3 A;  5CP2 A;  2M9N A;  1S9F A;  7ICE A;  2BQU A;  3H38 A;  2DPJ A;  9ICB A;  3RAQ A;  4QZE A;  3M9M B;  1S0O A;  2AU0 A;  3Q8R B;  4QZF A;  8ICR A;  4QZI A;  3Q8K A;  2MAX A;  3OUY B;  5J2B A;  4XRH A;  3MGI A;  2BHN A;  5IIM A;  2PI5 A;  4M9H A;  4G3I A;  2I1Q A;  2PXI A;  4PPX A;  8ICN A;  4YMO A;  5IIL A;  3SYZ A;  1SKW A;  4QWE A;  4NLZ A;  5F2V O;  2AQ0 A;  3M8R A;  4TUQ A;  5DBB A;  3NGD A;  4B9N A;  4DWI A;  3C23 A;  5KFD A;  5JUM A;  3MAB A;  4F92 B;  3GQC A;  1RYR A;  3T5K A;  3JPS A;  4O5C A;  8ICB A;  2NRX A;  1ZQK A;  4EZ6 A;  4WC2 A;  2Q66 A;  3H7I A;  4WC4 A;  3HPO A;  4JV2 A;  3MR3 A;  1SL0 A;  1N48 A;  4XA5 A;  8ICG A;  5DQI A;  1SKS A;  2ZUD A;  2BCU A;  1LV5 A;  2IMW P;  4O3Q A;  3ZDC A;  3C1Y A;  4RQ7 A;  4RPY A;  7ICJ A;  2J6T A;  3GIM A;  9ICS A;  3T5L A;  2UVV A;  5DDM A;  4RQ1 A;  2ISP A;  4I2B A;  5DBA A;  3UXO A;  2J6S A;  4M04 A;  5HRD A;  2ZH9 A;  2VA2 A;  4ED0 A;  4DL3 A;  2JEF A;  3TI0 A;  4Z6C A;  2VA3 A;  4DL4 A;  4Z6E A;  9ICA A;  4RNO A;  4EBK A;  2Y1I A;  2JEI A;  3TAR A;  2IA6 A;  2IHN A;  1U49 A;  5CB1 A;  4MFA A;  1ZQZ A;  1L3S A;  7ICL A;  5HRI A;  5KFZ A;  5HRF A;  4RQ2 A;  5J2K A;  4AT8 B;  4UD5 A;  4DQS A;  4QWA A;  4F5P A;  3C21 A;  5J0Y A;  1XSL A;  2PI4 A;  5D49 A;  4Z6D A;  3KHH A;  4ECX A;  3T5J A;  4FBT A;  2HHX A;  4M9J A;  4ECT A;  4C8M A;  1ZQH A;  3TFS A;  7ICO A;  4R8U B;  1SL1 A;  2PFQ A;  1Q79 A;  2KTQ A;  4DS4 A;  1ZJM A;  1U48 A;  3LWM A;  5J2I A;  9ICJ A;  2BPG A;  3OUY A;  2ZH5 A;  2AGO A;  3H3A A;  1ZQL A;  5DB9 A;  4IQW A;  1T4G A;  3OVS A;  4IRD A;  2F1I A;  5BOM A;  1XO1 A;  3RB0 A;  4NM2 A;  2WTF A;  4ED2 A;  4FO6 A;  1SL2 A;  4IRK A;  3MR6 A;  4P2H A;  2V4R A;  4WBZ A;  5DED A;  2ZH8 A;  4I2E A;  4E7X A;  4Q45 A;  4AT9 A;  4Z6F A;  5KFO A;  4IQU A;  1NOM A;  8ICW A;  1TK8 A;  3RH6 A;  3OSN A;  4CCH A;  4DLG A;  3E2E A;  1WOT A;  5DEC A;  3WFR E;  5KFK A;  1UT5 A;  3PML A;  1K1S A;  3EPI A;  4DLE A;  4MEX A;  4I2H A;  4UQG A;  4RNM A;  1DK2 A;  1ZQW A;  4RPZ A;  3OHB A;  5KT3 A;  9ICV A;  4UB2 A;  5J0P A;  2FLN A;  1JAJ A;  2ASD A;  1L3T A;  7ICM A;  5HHH A;  4C8N A;  4DOC A;  4F3O A;  3T3F A;  4BXO B;  4DQP A;  2AQ4 A;  2BGW A;  1JXE A;  5L1L A;  1RYS A;  4YMN A;  4I2C A;  4I2G A;  2ASL A;  1T3N A;  4DO9 A;  4QW9 A;  2XGQ A;  3ZD9 A;  1VJ7 A;  3RJE A;  3M8S A;  4R8U A;  5J29 A;  5KFV A;  2XY5 A;  4DSL A;  4KLO A;  3LQC B;  1S77 D;  4PHE A;  4B9T A;  4FH5 A;  4YG2 A;  3OVB A;  1NK4 A;  1B22 A;  2FMP A;  9ICL A;  5L1I A;  4X4Q A;  2R8K A;  2DFL A;  4UB3 A;  1ZQX A;  4AT8 A;  4X4O A;  2FPL A;  3N4M B;  2KZZ A;  4ED3 A;  1S0M A;  3JPR A;  4LVS A;  3RH4 A;  4RQ4 A;  4X4N A;  1ZQA A;  3HJ1 A;  1IXR A;  1KFD A;  5KFM A;  1IM4 A;  5L1K A;  2VA8 A;  1MIY A;  2DR8 A;  2KFN A;  3H4B A;  2W9A A;  4GXJ A;  9ICK A;  2M2U A;  3PR5 B;  4J9S A;  4JWM A;  2F1H A;  3HIY A;  1L3U A;  3EWA A;  1KNY A;  2ZH3 A;  4DEZ A;  5KT7 A;  9ICI A;  4PGX A;  2P6U A;  1C7Y A; 
#chains in the Genus database with same CATH topology
 2F3N A;  3PW0 A;  4GLX A;  5DLF A;  3QEA Z;  4AT7 B;  2XC9 A;  4EP7 A;  3NKU A;  2G0A A;  8ICY A;  3JYY A;  3GII A;  2AGP A;  4E80 A;  1K1Q A;  4HAI A;  3RJI A;  1TAU A;  4UB4 A;  2DRB A;  7ICS A;  3D2N A;  3PR4 A;  3HKZ F;  5HNK A;  3G6Y A;  7ICP A;  2WHE A;  5K4L A;  3OJS A;  4I28 A;  3QU4 A;  2NRV A;  5CR0 A;  4RQ5 A;  5J2H A;  5DG8 A;  8ICL A;  8ICH A;  4QWB A;  2DKX A;  2NYV A;  3Q8M A;  1XNS A;  3UQ2 A;  1KTQ A;  4OCZ A;  4OJP A;  2BE3 A;  3PO5 A;  4DFK A;  1ZRN A;  4K97 A;  1ZQM A;  4YR3 A;  4PHA A;  5KFS A;  4LZG A;  4O0I A;  1MIV A;  2ZJ5 A;  5DB6 A;  5D46 A;  2ZIW B;  3WK8 A;  1N56 A;  4IG8 A;  3KHG A;  3PX0 A;  2C2R A;  5J2G A;  1U4B A;  4O3S A;  1UCV A;  2BDP A;  1BGX T;  3BQ7 A;  5AI4 A;  1ZQU A;  3RRH A;  4R65 A;  4EYH B;  1BNP A;  4RNN A;  8ICX A;  1S5L U;  4X0B A;  4FBU A;  4NV0 A;  4IR9 A;  3WKE A;  4YFK A;  8ICI A;  3L4P A;  3KBB A;  4DL7 A;  1CEZ A;  2HHT A;  4YXJ A;  1Z00 B;  4EX7 A;  3WKA A;  2BR0 A;  2KN7 A;  4I2D A;  3F5E A;  1M6Y A;  5G5G A;  8ICJ A;  4EBD A;  3TQ1 A;  1COO A;  4UB1 A;  4C8L A;  3BS5 B;  2VIX A;  2KNJ A;  2W3S A;  3NVV A;  4BJQ A;  3UM9 A;  4UBB A;  4RUC A;  2JZB A;  2Y9U A;  4F4Z A;  4MF8 A;  2LM1 A;  2MUT A;  5AKK A;  1ZD5 A;  4X4S A;  3SAF A;  2W9C A;  3AEV A;  3MR5 A;  2ID1 A;  2HOI A;  2O6K A;  7ICH A;  2ESE A;  4QIW C;  5KFN A;  4UAV A;  5ALQ A;  4UAW A;  3Q8L A;  1PX5 A;  5KFP A;  2MUT B;  3C28 A;  4F93 B;  7ICI A;  1J2N A;  4US9 A;  4OAH A;  4X4V A;  4KLU A;  2AH5 A;  4O6A A;  5HRE A;  3TKA A;  4CE6 A;  2RHF A;  1ZQD A;  1ZQT A;  4KLM A;  4K99 A;  4KLF A;  3SQI A;  4HYK A;  3ISB A;  3UXN A;  1Q8K A;  1NI3 A;  1TKD A;  4Y2X A;  4TQS A;  4KLS A;  5HR7 A;  9ICM A;  3SV4 A;  5ALM A;  5J0X A;  2I9G A;  3LVW A;  4F2S A;  1U45 A;  2KEY A;  3TAD A;  2MSN A;  5BPC A;  5B5E U;  2Z7J A;  5KT2 A;  5J2C A;  4FFD A;  4BGD A;  1PK1 B;  3V7L A;  5KG1 A;  2C22 A;  5KG4 A;  4DSJ A;  4ATB A;  1NKE A;  2R8H A;  2M2W A;  4ECU A;  1U9L A;  4WJ3 B;  4Q44 A;  2YQE A;  4J9R A;  1L7M A;  5J0W A;  2DPI A;  2Y1J A;  8ICO A;  2ZTC A;  1LB2 B;  3GDX A;  2PFN A;  3N28 A;  5AKH A;  2QAR B;  5KTQ A;  4O3M A;  1KRP A;  4NXU A;  1NZB A;  2DR5 A;  2W54 A;  4P0Q B;  5HRH A;  3GV8 B;  9ICN A;  3MBY A;  3LWL A;  2BCR A;  5CFT A;  4RWP A;  4I2I A;  1F5S A;  1QTM A;  1PK1 A;  2KHQ A;  4AYB F;  4QWD A;  2W9M A;  8ICT A;  4DFM A;  3H8W A;  1HUZ A;  3C66 A;  4B9U A;  2D8C A;  3PSI A;  2ES6 A;  1PZN A;  5C0Y A;  4WBY A;  3AUO A;  4RQN A;  1J97 A;  4YR2 A;  2VKQ A;  1Z4N A;  4DS5 A;  2JZB B;  2FMS A;  1X9W A;  3SD7 A;  2K4E A;  1L5U A;  5KG3 A;  2ZH6 A;  3SR6 A;  3NVO A;  2FCL A;  3GU3 A;  2RDI A;  3H8S A;  3K75 D;  3C2M A;  2NV3 A;  3SZ2 A;  4AT7 A;  4RWN A;  3TAP A;  5J0O A;  2K8C B;  3G6V A;  5AI5 A;  2DUY A;  2EAO A;  3BZC A;  4J9K A;  3RJG A;  3SAG A;  1ZD4 A;  1Q78 A;  4C80 A;  1UA0 A;  3OVA A;  3NVY A;  2HHU A;  2KHV A;  4J9L A;  5F9L A;  4MHV A;  1QSS A;  4KLG A;  1D8L A;  4NXX A;  2BPF A;  2XO7 A;  1OU5 A;  3QX7 A;  3AN1 A;  3RH5 A;  4NKT A;  1LKY A;  1VFG A;  4UB6 U;  5AM2 A;  3BDP A;  2V9W A;  3MCR A;  1KEJ A;  1SV0 C;  5EWF A;  4C7Z A;  1NK6 A;  1X9S A;  4Y2R A;  1JXL A;  4E0D A;  2WF6 A;  5JTI A;  1BPY A;  5HP4 A;  2K60 A;  2Q0Z X;  2FMQ A;  4ECS A;  3JPO A;  3B0Y A;  1A77 A;  5DG7 A;  1XSP A;  3OJU A;  3N7R C;  2JR5 A;  1DXS A;  5EWG A;  3N7P D;  3GZF A;  1ZQJ A;  5EWE A;  7ICE A;  2M9N A;  1S9F A;  2BQU A;  1X42 A;  8ICR A;  3ERC C;  2BHN A;  8ICN A;  1VLB A;  2RP5 A;  3AMZ A;  5IIL A;  2ZIX B;  4NLZ A;  5F2V O;  2OYY A;  5DBB A;  5KFD A;  2CN1 A;  4F92 B;  1RYR A;  3JPS A;  8ICB A;  5KAI U;  1ZQK A;  4OJ5 A;  1N63 A;  3M7D A;  2Q66 A;  3HPO A;  3MR3 A;  1QH9 A;  4UAU A;  5DQI A;  2BCU A;  3ER8 C;  1TAM A;  3GIM A;  3T5L A;  2ISP A;  4IS7 A;  2J6S A;  4K9B A;  1OW5 A;  2VA2 A;  4Z6C A;  4DL4 A;  4FZN A;  4RNO A;  2Y1I A;  3TAR A;  3H8M A;  2IA6 A;  2K8A A;  1U49 A;  5CB1 A;  2HI0 A;  1ZQZ A;  4FO1 A;  3PSF A;  5ALH A;  4F5P A;  2HSZ A;  1WG8 A;  5J0Y A;  1XSL A;  3KHH A;  4ECX A;  2WB1 F;  2QB1 A;  4R8U B;  1SL1 A;  1DRG A;  3QXG A;  3PZP A;  1L8L A;  1X9X A;  2BZF A;  2F1I A;  3QNM A;  2L5Y A;  5BOM A;  4ED2 A;  2ZH8 A;  4IRK A;  1T3Q A;  4I2E A;  1Q3U A;  4Z6F A;  1NOM A;  2WB1 C;  4WQK A;  3E2E A;  3F5A A;  5DEC A;  2JH7 A;  3F2C A;  4RPZ A;  4UB2 A;  5J0P A;  1ECW A;  5AKG A;  4DOC A;  2WAQ C;  2EZY A;  2ZIU B;  2E1E A;  2ZXH A;  1T3N A;  4QW9 A;  1LKY B;  4KLO A;  3F53 A;  1ZD2 P;  1YZ7 A;  3KKA C;  2HCF A;  5FP0 A;  9ICL A;  5L1I A;  3JPR A;  1IM4 A;  2M2U A;  3PR5 B;  3HIY A;  3I76 A;  3EWA A;  2YB1 A;  2E8N A;  4NL9 A;  4PGX A;  2P6U A;  1C7Y A;  3PW5 A;  3HT3 A;  2KZM A;  2K8B B;  5AM3 A;  5HMM A;  2YMP A;  1ZQR A;  1QQ7 A;  5J2E A;  2ZG6 A;  2ZTD A;  4XJE A;  5CJ7 A;  2NRT A;  5KFA A;  9ICO A;  3RAX A;  2HBJ A;  4KLD A;  4YR0 A;  4RWQ A;  1UT8 A;  3VC8 A;  4EED A;  3T5H A;  4KB6 A;  2HVH A;  3QEB Z;  9ICW A;  4JK1 A;  4Y2Y A;  3HP6 A;  1ZRM A;  4KLH A;  7ICK A;  7ICN A;  5KFR A;  4DFD A;  5AM5 A;  2Y9T A;  4R66 A;  5ALI A;  2YMQ A;  3FDS A;  4DQR A;  9ICQ A;  2KOB A;  3EYZ A;  3B0X A;  4O3R A;  1TFY A;  2VJ4 A;  2J6U A;  4RWO A;  4JWN A;  1UQV A;  1S10 A;  4I27 A;  1KFT A;  1D9D A;  5KFG A;  2OXO A;  5ALK A;  4NM1 A;  5KFC A;  2DBY A;  2JMG A;  4QZH A;  5IIO A;  3Q8Q B;  5KL1 B;  3AQN A;  5ALR A;  2AJQ A;  1B43 A;  2O1P A;  2DVI A;  2HVI A;  4I2J A;  5J2D A;  1T7P A;  3RTV A;  1KKX A;  3BQ0 A;  3WFO A;  5AKL A;  4GFJ A;  4DSI A;  4UBC A;  1FEZ A;  2M0N A;  4DSK A;  7ICV A;  3BJY A;  4RUA A;  3ICX A;  2W9B B;  5ALX A;  1QLN A;  5CHG A;  3PSP A;  1R8A A;  1ZJN A;  3NTU A;  3H0M B;  3WK4 A;  2DR7 A;  5J0R A;  4I2A A;  3NVZ A;  4C7Y A;  4KMU A;  1QSL A;  2H3Q A;  3KFU F;  4UD4 A;  7ICG A;  3QU2 A;  1ZQI A;  4DCC A;  5KFE A;  4RQ0 A;  3WFQ E;  5AIC A;  2ISO A;  3PX6 A;  1K5O A;  2B4V A;  5DQG A;  2BCQ A;  4OO1 J;  2LI6 A;  2FI1 A;  5GTI U;  4P4P A;  3M6Z A;  3WKD A;  3HKZ C;  5ALV A;  4K4H A;  1EXN A;  5AKZ A;  3OSP A;  2W8K A;  1ZQG A;  1NK7 A;  1BPX A;  4DSF A;  4DOB A;  2BCS A;  4WC1 A;  4K98 A;  2JHD A;  2R8I A;  5D62 A;  8ICV A;  3PVX A;  3QUC A;  4NWI A;  3JPT A;  3RR7 A;  5AI8 A;  1ZQB A;  2KP7 A;  2H3F A;  3WK9 A;  5TZV A;  2HW3 A;  2HOQ A;  4NKU A;  1UA1 A;  4F5N A;  3L9D A;  4XQ8 A;  1SB3 C;  2G09 A;  4JV0 A;  1ZQS A;  4KLI A;  3ISD A;  5CHE A;  3LVV A;  1ZQQ A;  8ICF A;  5AK3 A;  3C2K A;  5ALP A;  4PL1 A;  4PGY A;  1NK5 A;  2VAN A;  5B3Q A;  1DGS A;  2PBE A;  1MSW D;  8ICU A;  2ZUC A;  4YQW A;  1JRP A;  2XID A;  5AI0 A;  3PX4 A;  4PZN A;  5J2J A;  4DOA A;  1NK8 A;  4S3N A;  1Z3E B;  4CF5 A;  2IBK A;  3QUB A;  2RLT A;  3H8J A;  3M6K A;  5JRT A;  4TUS A;  4NLK A;  2CRX A;  2LYH A;  1PVP A;  2BKE A;  1X9M A;  4B9S A;  5GTH U;  4ELU A;  1RG6 A;  3LDA A;  4FH3 A;  4GC7 A;  1R8C A;  2H3V A;  2ZIW A;  1MIW A;  1H38 A;  5DB7 A;  4LT6 A;  2ZHB A;  4M6W B;  4TUR A;  5KG6 A;  3PW4 A;  4OAI Z;  2W04 A;  3ZDB A;  2HOF A;  3FAH A;  1CUK A;  4ATB B;  4YD1 A;  3S6J A;  1SIJ A;  3H40 A;  2ZJ8 A;  3IG5 A;  3WKC A;  2ALZ A;  4K8V A;  1ZQO A;  3KOO A;  2JEJ A;  2W3R A;  2QB0 A;  4Y2T A;  3THV A;  4M47 A;  2DGZ A;  4IQT A;  4FS1 A;  1RXV A;  3ZDA A;  9ICE A;  5KG5 A;  1ZD3 A;  2E8P A;  4IRC A;  2H5X A;  3C5G A;  1DK3 A;  5KT5 A;  2KK0 A;  4MF2 A;  1VDV A;  4RT3 A;  3MGV A;  1NO5 A;  1ZQN A;  4Q8E A;  1B4F A;  1D8B A;  1L7P A;  3WFP A;  4DQQ A;  1KDH A;  3IV6 A;  3IRU A;  2GOL A;  3C18 A;  3RBE A;  4BXO A;  4GXK A;  4DFP A;  2WAQ F;  4OD0 A;  5AK4 A;  4C0Z A;  2IHO A;  2DKZ A;  3EZ5 A;  3KTQ A;  5ALS A;  1URJ A;  1MN8 A;  4OJ6 A;  4JMU A;  4DFJ A;  3KKA A;  2JV3 A;  1TK5 A;  2PKE A;  2JEG A;  1V4A A;  4FHX A;  5JTG A;  4O3N A;  4G9B A;  1SV4 A;  4FS2 A;  4B9V A;  2W9C B;  2K89 A;  4PHP A;  2RDJ A;  4ACO A;  4F50 A;  4GIB A;  7ICQ A;  4MEY A;  4X0A A;  3ZDE A;  3H0L B;  1PUZ A;  3M1Y A;  5HML A;  5DB8 A;  2KVS A;  4NLB A;  4XUS A;  3RBD A;  4Y2V A;  1T8E A;  3GIJ A;  5HRG A;  2UVW A;  3V6J A;  1JQR A;  1F0M A;  4O69 A;  4EEN A;  3MC1 A;  2XVT A;  1ZQC A;  4ECY A;  4F71 A;  4KLQ A;  5AKY A;  4NLC A;  3AQL A;  4JUZ A;  8ICZ A;  2IOH A;  5A0L A;  4NLG A;  1ZET A;  4YD2 A;  4NXT A;  4C8O A;  4AT9 B;  3C2L A;  1SXD A;  4DL6 A;  2XI9 A;  3PW2 A;  5L1J A;  1S0O A;  1N62 A;  3MGI A;  4G3I A;  3SYZ A;  1Z4O A;  2KJ8 A;  4DWI A;  2KJ9 A;  3C23 A;  5JUM A;  3MAB A;  3GQC A;  2YY6 A;  3NRW A;  3T5K A;  4O5C A;  1MA7 A;  4EZ6 A;  4WC2 A;  5CEH A;  1SL0 A;  1N48 A;  4O3Q A;  2ZIV B;  3QUT A;  1RDF A;  3ZDC A;  2P35 A;  2KIC A;  3ED5 A;  7ICJ A;  5B3P A;  2J6T A;  2G08 A;  9ICS A;  3LYS A;  4I2B A;  4LEV A;  4P0P B;  5HRD A;  4ED0 A;  3SEI A;  2JEF A;  3TI0 A;  2VA3 A;  1WUD A;  2IOF K;  4U6P A;  4KMO B;  2E3T A;  1L3S A;  5HRF A;  4RQ2 A;  1L8O A;  4NL9 C;  4CRX A;  5J2K A;  4QWA A;  3C21 A;  2EZZ A;  5D49 A;  5ALN A;  3SEN A;  7ICO A;  1S8O A;  2KTQ A;  1ED1 A;  1ZJM A;  2YML A;  2KSO A;  2AGO A;  2DL0 A;  4BX9 C;  1ZQL A;  2WFA A;  5DB9 A;  1O08 A;  3CRX A;  1PVQ A;  4IQW A;  3F2D A;  4IRD A;  3KD3 A;  1SL2 A;  2WTF A;  4NJ8 A;  4AT9 A;  4IQU A;  4DLG A;  3WFR E;  3EUB 2;  3EPI A;  1UT5 A;  2B0C A;  4DLE A;  4MEX A;  1DK2 A;  1ZQW A;  9ICV A;  2ASD A;  7ICM A;  5HHH A;  4C8N A;  4F3O A;  3T3F A;  4I0U A;  1JXE A;  5L1L A;  1RYS A;  1N5X A;  1ZXI A;  4DO9 A;  3F2B A;  1X6J A;  2W7O A;  4EEK A;  1X6I A;  3M8S A;  5J29 A;  5KFV A;  4PHE A;  4B9T A;  4FH5 A;  1NK4 A;  1Z19 A;  4Y2Q A;  3UMC A;  4QJF B;  4X4O A;  1Q3V A;  2FPL A;  2KZZ A;  4X4N A;  4RQ4 A;  1ZQA A;  3HJ1 A;  1KFD A;  3KZI U;  3D2S A;  1MIY A;  3WK5 A;  9ICK A;  3K7D A;  2I5H A;  2F1H A;  3NRZ A;  4C4S A;  1LVH A;  1KN5 A;  5J2F A;  4J9P A;  2ZIV A;  2HHV A;  4EBC A;  3UPS A;  3UMG A;  5KFI A;  1RQL A;  5KFJ A;  3RB6 A;  1PVR A;  2HHW A;  2RRD A;  4KN7 A;  5J0U A;  4EEL A;  1FFU A;  3TAC B;  3AQM A;  5EE0 A;  2GH1 A;  1RPL A;  5ALD A;  2LKY A;  4M9L A;  5KFY A;  4M9G A;  1UPH A;  1WWU A;  2DR8 A;  3C5F A;  4QW8 A;  4NXV A;  4BWM A;  5E79 U;  1TFW A;  5KFB A;  5CRX A;  4X4P A;  2EQY A;  4IC9 A;  2OEH A;  4R64 A;  4DF8 A;  2ZH2 A;  3PMN A;  3K1R B;  4U7C A;  3K4G A;  2KJ5 A;  1UEV A;  1V97 A;  5TIS U;  1COK A;  1QCK A;  2ZH7 A;  2DRA A;  3HRD D;  1U47 A;  5KFF A;  3RR8 A;  3RJJ A;  4OAG A;  2AHO B;  3N7S C;  3E0F A;  3IP4 B;  3RJF A;  4KLL A;  2MRL A;  5ALO A;  3SI8 A;  2G06 A;  4YMM A;  8ICS A;  3ALR A;  5CFU A;  5KG2 A;  4I2F A;  2R8J A;  3WU2 U;  2RFF A;  1WYG A;  3N97 B;  4EGW A;  2WF8 A;  5KG0 A;  3RJK A;  1QQ6 A;  4O68 A;  7ICT A;  8ICP A;  1SZH A;  1NJY A;  4KLT A;  1TK0 A;  3B9J A;  2XGP A;  2CPR A;  5III A;  4YN4 A;  9ICC A;  3D2Q A;  4LEZ A;  2LM4 A;  1A0P A;  1A6S A;  4DF4 A;  2G07 A;  2JH1 A;  1GPJ A;  4O9M A;  1YZ6 A;  3GIL A;  3R9K A;  1JRO A;  3ISC A;  5AHX A;  2M2V A;  8ICE A;  5AKI A;  1NKC A;  3BS5 A;  5AM0 A;  3MDC A;  1L3V A;  3V7J A;  4HX0 A;  4BDP A;  4EYI B;  3AQK A;  3RJH A;  4TQR A;  3NAS A;  5J8Y A;  2OM6 A;  4QZD A;  1UEU A;  1BPB A;  4KX5 A;  3BS7 A;  5KFX A;  3ER9 B;  5DBC A;  4C8K A;  4IQV A;  2C2E A;  3ZD8 A;  4UAT A;  4F4W A;  1XU4 A;  1R89 A;  1TAQ A;  1OXJ A;  4PH5 A;  1FO4 A;  4UB5 A;  9ICX A;  4X4U A;  1IIP A;  3V6H A;  2F8K A;  1J2M A;  3QU9 A;  4ECZ A;  9ICG A;  2ATL A;  4WC7 A;  4RT2 A;  2QAR A;  4J9M A;  1JN3 A;  3E58 A;  4KTQ A;  1NK9 A;  2G5H B;  3DV9 A;  3ZI4 A;  4ED8 A;  3D6J A;  3C1Z A;  4Y2U A;  3MFI A;  2DWQ A;  2FJ6 A;  1UET A;  2B56 A;  5ALL A;  3IG8 A;  2PFP A;  4NLN A;  3H0R B;  4AYB C;  3EF2 A;  2PFO A;  5CFS A;  4IR1 A;  2ZUB A;  2F76 X;  4O5E A;  4O5K A;  3UMB A;  1KSP A;  4ELT A;  1Y88 A;  8ICM A;  5J0S A;  2LPE A;  3ETL A;  4FHY A;  3QE9 Y;  1BPE A;  2JGA A;  5KL8 B;  2F1J A;  5DGB A;  3QZ7 A;  3TAN A;  3WK7 A;  1WWV A;  1JX4 A;  4ECQ A;  8ICQ A;  2WF7 A;  2EAP A;  2VJ5 A;  4DL2 A;  1MQ3 A;  4J03 A;  4O3O A;  1CI4 A;  1NJZ A;  3AU2 A;  4EEY A;  3C29 A;  1ZYQ A;  2W03 A;  1HEK A;  4X4R A;  3BQ2 A;  4ECV A;  4FHW A;  3PO4 A;  1FFV A;  1RQN A;  2E5S A;  4WC3 A;  1IV8 A;  4MFC A;  2EAM A;  1YLQ A;  2DR9 A;  1HJP A;  2E8M A;  4X5V A;  4E8F A;  1AQ6 A;  3V7K A;  4RQ6 A;  4C4R A;  4K96 A;  3QZ8 A;  4PJ0 U;  4QZA A;  4OJL A;  4M2Y A;  2BBH A;  1X2I A;  5KFL A;  1S0N A;  3Q8P B;  5DG9 A;  5C5J A;  4YP3 A;  3MR2 A;  3AM9 A;  1XS9 D;  3IM1 A;  3LK9 A;  4F5R A;  1ARO P;  4M9N A;  5HC9 A;  5AKX A;  2C28 A;  2HHS A;  3WKB A;  2XY6 A;  5JU5 A;  4YXM A;  1D8Y A;  5KFT A;  5KT6 A;  1N5W A;  4CDG A;  1JI7 A;  2GLE A;  3BQ1 A;  9ICF A;  2Y0S F;  4Q43 A;  5T14 A;  4IL6 U;  2W9B A;  1HUO A;  2BQR A;  2NRW A;  3GV5 B;  3KHL A;  4UW9 A;  4DL5 A;  4QZB A;  4F4Y A;  1X66 A;  2AGQ A;  1UHU A;  2A1J B;  3OTQ A;  4WC6 A;  2GAF D;  3GIK A;  4FHP A;  4KM5 A;  1BVS A;  2F77 X;  3AQE A;  4F5O A;  3V72 A;  4K4I A;  3RB4 A;  2K4I A;  1CRX A;  4ICA A;  2K4H A;  3G6X A;  3EPG A;  9ICT A;  4Q8F A;  2HHP A;  1L6N A;  5KFW A;  3H37 A;  4ED1 A;  2XCP A;  1S0V A;  5KFQ A;  3JPQ A;  4FHV A;  4PL2 A;  1SWW A;  5KFH A;  4QWC A;  4O67 A;  2W8L A;  3UQ0 A;  5KG7 A;  2KZ3 A;  4N7R A;  2DPJ A;  2YMM A;  2OHF A;  9ICB A;  3RAQ A;  3M9M B;  3Q8R B;  1Q46 A;  3Q8K A;  2MAX A;  2F8L A;  2W43 A;  3OUY B;  2Y0S C;  2DF4 B;  5IIM A;  2I1Q A;  3J81 j;  4YMO A;  1SKW A;  2W7P A;  2AQ0 A;  3M8R A;  4TUQ A;  3NGD A;  4B9N A;  3TAD C;  4LJX A;  2K4P A;  1PK3 A;  3QYP A;  1SKS A;  2ZUD A;  1LV5 A;  2IMW P;  4WQL A;  5KNI A;  4RQ7 A;  4RPY A;  1HIW A;  2UVV A;  4BUG A;  4RQ1 A;  5AKJ A;  5DBA A;  4M04 A;  2ZH9 A;  4K9A A;  4DL3 A;  3OWG A;  4Z6E A;  2CXY A;  9ICA A;  2IHN A;  1JUD A;  4MFA A;  3HIL A;  7ICL A;  5HRI A;  3PHZ A;  2ODG A;  4Z6D A;  2GO7 A;  4FBT A;  4NXW A;  4ECT A;  4C8M A;  3HJE A;  2ZIX A;  2PFQ A;  2N1R A;  3QU7 A;  4CNQ A;  3OUY A;  2ZH5 A;  3CNH A;  3H3A A;  4AP9 A;  1T4G A;  2KMD A;  1XO1 A;  3RB0 A;  4FO6 A;  4WBZ A;  3MR6 A;  3WK6 A;  2G5I B;  3OSN A;  4CCH A;  1L7O A;  5AIA A;  4I2H A;  1K1S A;  5J8Y C;  4RNM A;  3OHB A;  1JAJ A;  1L3T A;  1B0X A;  2E8O A;  2JRZ A;  1JAL A;  4BXO B;  4DQP A;  2AQ4 A;  3QUQ A;  1SGG A;  2DQN B;  5ALY A;  4YMN A;  4I2G A;  2ASL A;  3ZD9 A;  3RJE A;  1OUQ A;  4R8U A;  2XY5 A;  4DSL A;  3AL0 B;  3LQC B;  1S77 D;  4YG2 A;  3OVB A;  2FMP A;  2KVC A;  2R8K A;  5KAF U;  1ZQX A;  3NS1 A;  1YT3 A;  5AM4 A;  1S0M A;  5ALE A;  4LVS A;  3RH4 A;  1IXR A;  5KFM A;  5AIB A;  1SV0 A;  2VA8 A;  2LYB A;  2KFN A;  3H4B A;  4GXJ A;  4J9S A;  4JWM A;  4F72 A;  3KZX A;  2ZH3 A;  9ICI A;  3AQF A;  5CA7 A;  4ECW A;  5F9N A;  1V38 A;  2FPK A;  2WF5 A;  2EAN A;  5EOZ A;  4OAF A;  2KD1 A;  2KSO B;  4GC6 A;  4UB8 U;  2AXT U;  5DLG A;  2LMR A;  4MFF A;  5HRB A;  3L3F X;  3IN5 A;  3V6K A;  4PGQ A;  4JLZ A;  1NZP A;  2B6G A;  1ZQ1 C;  1JMS A;  2EWR A;  3UPQ A;  4TUP A;  4RZR A;  2BQ3 A;  3PST A;  1R8B A;  5D61 A;  2ZH1 A;  3UXP A;  2BDU A;  1O03 A;  2HN2 A;  3QU5 A;  5IIJ A;  2YX8 A;  2NRZ A;  2HHQ A;  4P4O A;  3ORY A;  3KHR A;  4P0P A;  1NK0 A;  4F8R A;  4GXI A;  1SZP A;  2H3Z A;  5AKE A;  3MGH A;  4B9M A;  3HJ4 A;  3TAQ A;  2OCE A;  2NO5 A;  3RRG A;  2BCV A;  4EBE A;  4ZH4 A;  4P0Q A;  3SAH A;  5CWR A;  4F2R A;  4PHD A;  3U26 A;  1N2X A;  2HBK A;  2P66 A;  1WCN A;  5AK6 A;  3TFR A;  1TV9 A;  5ALW A;  2A1J A;  3H39 A;  4CF4 A;  1TFR A;  1SKR A;  4NXZ A;  3CW2 C;  8ICC A;  3BZK A;  5ALF A;  4ED7 A;  1ZQP A;  2BPC A;  5J2A A;  2P6R A;  4I29 A;  3L5K A;  5HRL A;  2QKQ A;  1MC8 A;  4JB3 A;  3I1Y A;  3M9N B;  2KIV A;  2R8G A;  4F91 B;  2KFZ A;  2PMZ F;  7ICF A;  2O5A A;  7ICU A;  4WH5 A;  2KE7 A;  1Z1B A;  5EE9 A;  2ZH4 A;  1RZT A;  4F5Q A;  5AM1 A;  1BNO A;  4OJO A;  1JIH A;  3EW9 A;  2W11 A;  3BQT A;  5HR6 A;  5KT4 A;  2H3I A;  4ECR A;  2FLL A;  5J0Q A;  9ICP A;  4M5D A;  4DSE A;  4ED6 A;  4RQ3 A;  2HN1 A;  5HR9 A;  2KG5 A;  1FA0 A;  1ZQY A;  1BPZ A;  3DEE A;  3HWT A;  4LEY A;  4LZD A;  4MKP A;  4QZ8 A;  7ICR A;  3PW7 A;  2GA9 D;  2HDO A;  2ZHA A;  4QZC A;  4UAS A;  2FE9 A;  2WF9 A;  5IIN A;  4F4K A;  3IHQ B;  3ETR A;  2GWS A;  5D4B A;  4Y2P A;  3I28 A;  4WC5 A;  3AU6 A;  4EV6 A;  3SV3 A;  4CF3 A;  4X4T A;  5H2F U;  2FLP A;  4NY8 A;  1NNL A;  1A76 A;  4KLJ A;  2F2A B;  1RM6 C;  2QLT A;  5KFU A;  2C2D A;  1QSY A;  3PY8 A;  2FPM A;  1S76 D;  4M0A A;  5L1M A;  5J0T A;  4RQ8 A;  2IUB A;  2QB0 B;  3SMV A;  1NKB A;  1Z1V A;  3RFA A;  4QZ9 A;  1NJX A;  4UAR A;  9ICU A;  1T94 A;  1RXW A;  1Q79 A;  5ALT A;  5BOL A;  4WOY A;  1V9P A;  3OGU A;  3M9O B;  5DGA A;  2NRK A;  4JV1 A;  1ZQV A;  5L9X A;  4KIT B;  1XC9 A;  4M6W A;  1FIQ A;  2B21 A;  1XWL A;  2LBO A;  4K4G A;  4ZOH C;  1KQQ A;  4UAY A;  2ZJA A;  3VCB A;  3FYH A;  1S97 A;  4FZL A;  2EH9 A;  3WFS C;  4B9L A;  4RQM A;  4F4X A;  4ELV A;  1WCL A;  2I6X A;  2XCA A;  4KN4 A;  5IIK A;  2M2T A;  2A19 A;  5DQH A;  1XSN A;  3ZDD A;  4BWJ A;  3HX0 A;  1F44 A;  8ICA A;  8ICK A;  3JZ0 A;  1F5A A;  1D9F A;  5DKW A;  1DOQ A;  2XIC A;  5AK5 A;  5HHI A;  3IDW A;  3JPN A;  2LYA A;  2Q4T A;  3Q8S B;  3OHA A;  1SWV A;  2KKP A;  1ZOL A;  1XO0 A;  2EDU A;  2ZTE A;  3OV7 A;  3MFH A;  3PV8 A;  4J9Q A;  3PNC A;  3RB3 A;  4DQI A;  9ICR A;  4XQ7 A;  1N60 A;  3CYM A;  2UVU A;  3MDA A;  2UVR A;  3FM9 A;  3K1Z A;  4KLE A;  4O3P A;  4EZ9 A;  1KLN A;  1Z00 A;  2YB4 A;  2ASJ A;  1ZQE A;  2OH2 A;  3GFK B;  2V4Q A;  1KFS A;  4USA A;  4B6J A;  3H4D A;  1KBU A;  2W55 A;  4J9N A;  4FZM A;  1MQ2 A;  4QZG A;  5AI6 A;  5DDY A;  5ALG A;  2A3V A;  3JPP A;  1ZQF A;  4RU9 A;  4J9O A;  2XY7 A;  2HBM A;  4RPX A;  4FE3 A;  4R63 A;  3GV7 B;  4UAZ A;  2LHT A;  4WCW A;  3ONN A;  4CGZ A;  4A8E A;  2IHM A;  4YCX A;  5AI9 A;  4QNL A;  3HW8 A;  4WC0 A;  4EBJ A;  3OPX A;  5B66 U;  4YVZ A;  4P4M A;  1TVA A;  2E1F A;  1SXE A;  4C4T A;  2PMZ C;  1BPD A;  2A1A A;  4KX3 A;  9ICH A;  5HRK A;  2KV2 A;  1RYU A;  2OWO A;  1NJW A;  3NYB A;  5CP2 A;  3H38 A;  2IOF A;  4QZE A;  2AU0 A;  4QZF A;  4QZI A;  2KKV A;  5J2B A;  4XRH A;  1P7D A;  2PI5 A;  4M9H A;  2PXI A;  4PPX A;  2B51 A;  1VJ5 A;  3T79 A;  5G5H A;  1TE2 A;  4QWE A;  2ZXI A;  4QIW F;  2KIW A;  5ALU A;  2MU2 A;  2NRX A;  3H7I A;  4WC4 A;  4JV2 A;  1X40 A;  4XA5 A;  1GO3 F;  8ICG A;  3FC4 A;  2FDR A;  5F3X B;  3C1Y A;  3A0H U;  1L7N A;  3NUQ A;  5DDM A;  3O0F A;  3UXO A;  2NO4 A;  4EBK A;  2JEI A;  5ALJ A;  2D3D A;  5KFZ A;  4AT8 B;  4UD5 A;  4DQS A;  5EE3 A;  4LEW A;  2PI4 A;  1DGJ A;  2HHX A;  3T5J A;  2BBJ A;  1QQ5 A;  4M9J A;  1ZQH A;  4PZO A;  3TFS A;  4DS4 A;  2HMX A;  1U48 A;  3LWM A;  5J2I A;  3NWI A;  9ICJ A;  2BPG A;  1N61 A;  2ZIU A;  2YN4 A;  3OVS A;  2MA1 A;  4NM2 A;  4P2H A;  4JLX A;  5DED A;  2V4R A;  4E7X A;  2D6F C;  4Q45 A;  4Y2J A;  5KFO A;  8ICW A;  1TK8 A;  3RF9 A;  3RH6 A;  5ALZ A;  1WOT A;  5KFK A;  3PML A;  2YTU A;  3JCF A;  4UQG A;  3DDH A;  5KT3 A;  4Y2S A;  1C20 A;  2F44 A;  2FLN A;  1KL9 A;  2BGW A;  1KW4 A;  4I2C A;  2R18 A;  2RQ5 A;  2XGQ A;  1VJ7 A;  4EEB A;  5EE1 A;  3CP8 A;  1B22 A;  4X4Q A;  2DFL A;  4UB3 A;  4AT8 A;  2JXJ A;  3N4M B;  4ED3 A;  3CK6 A;  1V85 A;  5L1K A;  1IG6 A;  4EX6 A;  4US8 A;  2W9A A;  5D63 A;  1L3U A;  2EZX A;  1KNY A;  3A0B U;  4DEZ A;  3NVW A;  5KT7 A;  2HBL A; 
#chains in the Genus database with same CATH homology
 3PW0 A;  4GLX A;  5DLF A;  5J2F A;  4J9P A;  2XC9 A;  3HT3 A;  3PW5 A;  3QEA Z;  4AT7 B;  4EP7 A;  2KZM A;  5CA7 A;  4ECW A;  8ICY A;  2HHV A;  5F9N A;  5HMM A;  2FPK A;  4EBC A;  3JYY A;  1ZQR A;  5EOZ A;  5KFI A;  5KFJ A;  5J2E A;  3GII A;  3RB6 A;  2AGP A;  2HHW A;  3UPS A;  2ZTD A;  4GC6 A;  5CJ7 A;  2NRT A;  4KN7 A;  5KFA A;  1K1Q A;  5DLG A;  5J0U A;  3RJI A;  3RAX A;  4MFF A;  1TAU A;  5HRB A;  4KLD A;  3AQM A;  4YR0 A;  4UB4 A;  1RPL A;  1UT8 A;  4RWQ A;  3V6K A;  2DRB A;  3T5H A;  4PGQ A;  2HVH A;  7ICS A;  3QEB Z;  1NZP A;  9ICW A;  4JK1 A;  1JMS A;  3HP6 A;  4KLH A;  4M9L A;  3PR4 A;  4TUP A;  4RZR A;  5KFY A;  5KFR A;  3UPQ A;  2BQ3 A;  4M9G A;  7ICK A;  5HNK A;  4R66 A;  3G6Y A;  3C5F A;  3FDS A;  4QW8 A;  4DQR A;  7ICP A;  3OJS A;  4I28 A;  3UXP A;  9ICQ A;  1R8B A;  2ZH1 A;  4BWM A;  3EYZ A;  1TFW A;  5IIJ A;  5KFB A;  3B0X A;  2NRV A;  4O3R A;  5CR0 A;  4RQ5 A;  4X4P A;  4R64 A;  2NRZ A;  5J2H A;  4DF8 A;  2HHQ A;  5DG8 A;  1TFY A;  4P4O A;  2J6U A;  8ICL A;  8ICH A;  2ZH2 A;  4RWO A;  3ORY A;  4QWB A;  3PMN A;  4JWN A;  3KHR A;  1KFT A;  1S10 A;  1NK0 A;  4I27 A;  3Q8M A;  4F8R A;  3UQ2 A;  1KTQ A;  1SZP A;  4GXI A;  5KFG A;  1D9D A;  3K4G A;  2BE3 A;  1UEV A;  3PO5 A;  3MGH A;  4DFK A;  4B9M A;  1ZQM A;  4YR3 A;  4PHA A;  5KFS A;  4LZG A;  4O0I A;  3TAQ A;  4NM1 A;  4KLG A;  1MIV A;  3HJ4 A;  3RRG A;  2ZJ5 A;  5DB6 A;  2ZH7 A;  2BCV A;  2DRA A;  5KFC A;  4EBE A;  4ZH4 A;  1U47 A;  5KFF A;  5CWR A;  4F2R A;  4QZH A;  5D46 A;  5IIO A;  3Q8Q B;  3RR8 A;  3RJJ A;  3AQN A;  4PHD A;  3RJF A;  4KLL A;  2AJQ A;  1B43 A;  2O1P A;  3SI8 A;  1N56 A;  2P66 A;  2DVI A;  2HVI A;  4I2J A;  1WCN A;  4IG8 A;  5J2D A;  4YMM A;  3KHG A;  3TFR A;  3PX0 A;  1TV9 A;  2A1J A;  3RTV A;  1T7P A;  8ICS A;  3BQ0 A;  3WFO A;  3H39 A;  5KG2 A;  2C2R A;  5J2G A;  2R8J A;  1TFR A;  1SKR A;  4DSI A;  4I2F A;  4X0A A;  4NXZ A;  1U4B A;  4O3S A;  8ICC A;  4UBC A;  2BDP A;  2RFF A;  1BGX T;  4ED7 A;  1ZQP A;  2P6R A;  2BPC A;  5J2A A;  4I29 A;  5HRL A;  4DSK A;  1ZQU A;  3BJY A;  4RUA A;  3RRH A;  1MC8 A;  4R65 A;  4EYH B;  3N97 B;  7ICV A;  1BNP A;  4RNN A;  8ICX A;  5KG0 A;  3M9N B;  2W9B B;  4X0B A;  3RJK A;  4FBU A;  1QLN A;  5CHG A;  2R8G A;  4IR9 A;  4F91 B;  1R8A A;  1ZJN A;  7ICT A;  3NTU A;  4YFK A;  2KFZ A;  8ICP A;  8ICI A;  1NJY A;  4KLT A;  1TK0 A;  7ICF A;  5J0R A;  2XGP A;  4DL7 A;  5III A;  4YN4 A;  4I2A A;  1CEZ A;  9ICC A;  2HHT A;  4KMU A;  4YXJ A;  2O5A A;  1QSL A;  4DF4 A;  7ICU A;  4UD4 A;  7ICG A;  1Z00 B;  4O9M A;  3GIL A;  1ZQI A;  2BR0 A;  2KN7 A;  4I2D A;  2ZH4 A;  3ISC A;  8ICJ A;  2M2V A;  5KFE A;  4EBD A;  8ICE A;  4RQ0 A;  1RZT A;  1NKC A;  4F5Q A;  3TQ1 A;  1BNO A;  1COO A;  4UB1 A;  3MDC A;  8ICO A;  1L3V A;  4C8L A;  3WFQ E;  3V7J A;  4BDP A;  1JIH A;  3EW9 A;  4EYI B;  2ISO A;  3PX6 A;  4UBB A;  3BQT A;  5KT4 A;  4RUC A;  3AQK A;  2JZB A;  5DQG A;  2BCQ A;  4ECR A;  4TQR A;  4F4Z A;  2FLL A;  3RJH A;  4MF8 A;  4P4P A;  5J0Q A;  9ICP A;  2MUT A;  4M5D A;  4K4H A;  4DSE A;  4QZD A;  4X4S A;  1UEU A;  1BPB A;  1EXN A;  4RQ3 A;  2W9C A;  4ED6 A;  5KFX A;  5HR9 A;  3MR5 A;  1FA0 A;  2ID1 A;  1ZQY A;  2W8K A;  3OSP A;  1BPZ A;  1ZQG A;  5DBC A;  1NK7 A;  4C8K A;  1BPX A;  4DSF A;  7ICH A;  4DOB A;  3HWT A;  4IQV A;  2C2E A;  4LZD A;  5KFN A;  2BCS A;  3ZD8 A;  4WC1 A;  2R8I A;  4UAW A;  4F4W A;  4QZ8 A;  8ICV A;  7ICR A;  3PVX A;  1XU4 A;  3PW7 A;  3Q8L A;  1R89 A;  1PX5 A;  5KFP A;  1TAQ A;  3JPT A;  2MUT B;  3RR7 A;  1ZQB A;  4F93 B;  4PH5 A;  7ICI A;  2ZHA A;  4QZC A;  2KP7 A;  5TZV A;  4UB5 A;  4X4V A;  9ICX A;  2HW3 A;  4X4U A;  4KLU A;  5IIN A;  4F4K A;  3IHQ B;  5HRE A;  3V6H A;  2GWS A;  4NKU A;  5D4B A;  1UA1 A;  4WC5 A;  4F5N A;  3AU6 A;  4ECZ A;  3L9D A;  4XQ8 A;  1ZQD A;  1ZQT A;  4KLM A;  9ICG A;  3SV3 A;  2ATL A;  4JV0 A;  4WC7 A;  1ZQS A;  4KLF A;  4KLI A;  4HYK A;  3ISB A;  3UXN A;  4RT2 A;  4X4T A;  3ISD A;  2FLP A;  4NY8 A;  1TKD A;  4J9M A;  1A76 A;  1JN3 A;  1ZQQ A;  4TQS A;  4KLJ A;  4KTQ A;  1NK9 A;  4KLS A;  8ICF A;  3C2K A;  9ICM A;  3SV4 A;  1QSY A;  5KFU A;  5J0X A;  2C2D A;  4PGY A;  4ED8 A;  2I9G A;  4F2S A;  1NK5 A;  3C1Z A;  1U45 A;  2FPM A;  3PY8 A;  1S76 D;  5BPC A;  3MFI A;  4M0A A;  2VAN A;  5J0T A;  1UET A;  1DGS A;  2PBE A;  4RQ8 A;  1MSW D;  8ICU A;  5KT2 A;  5J2C A;  4BGD A;  2PFP A;  2ZUC A;  4YQW A;  4NLN A;  2DR7 A;  1NKB A;  3V7L A;  4QZ9 A;  1NJX A;  3PX4 A;  2PFO A;  4IR1 A;  2ZUB A;  9ICU A;  5KG1 A;  1RXW A;  5J2J A;  4DOA A;  2C22 A;  5KG4 A;  1NK8 A;  7ICN A;  9ICO A;  5BOL A;  1Z3E B;  4DSJ A;  2IBK A;  4S3N A;  1V9P A;  4ATB A;  1NKE A;  3OGU A;  3M9O B;  2R8H A;  4ECU A;  1U9L A;  3H8J A;  1KSP A;  4O5E A;  4O5K A;  2M2W A;  5DGA A;  4Q44 A;  1Y88 A;  1ZQV A;  4TUS A;  4ELT A;  5J0S A;  3ETL A;  4J9R A;  4JV1 A;  4NLK A;  8ICM A;  2LYH A;  5L9X A;  3QE9 Y;  4FHY A;  1BPE A;  2BKE A;  5J0W A;  2Y1J A;  4KIT B;  2DPI A;  2F1J A;  1XC9 A;  2ZTC A;  4M6W A;  5DGB A;  3GDX A;  1X9M A;  3QZ7 A;  1LB2 B;  2PFN A;  4B9S A;  3TAN A;  4ELU A;  2B21 A;  3LDA A;  5KTQ A;  4FH3 A;  1XWL A;  4GC7 A;  1R8C A;  1JX4 A;  1MIW A;  1H38 A;  4ECQ A;  5DB7 A;  1KRP A;  4LT6 A;  8ICQ A;  2DR5 A;  4K4G A;  2ZHB A;  4DL2 A;  4M6W B;  1MQ3 A;  4TUR A;  5KG6 A;  4UAY A;  2ZJA A;  1S97 A;  3FYH A;  3GV8 B;  4O3O A;  5HRH A;  9ICN A;  3MBY A;  1NJZ A;  3AU2 A;  3LWL A;  3PW4 A;  3WFS C;  4EEY A;  1ZYQ A;  3ZDB A;  4B9L A;  4F4X A;  1CUK A;  4ELV A;  2BCR A;  4ATB B;  1WCL A;  4YD1 A;  3NYB A;  2XCA A;  4X4R A;  3BQ2 A;  4ECV A;  4KN4 A;  3H40 A;  5IIK A;  2M2T A;  4RWP A;  5DQH A;  4I2I A;  1XSN A;  2ZJ8 A;  1QTM A;  4BWJ A;  3HX0 A;  2ALZ A;  3ZDD A;  4FHW A;  3PO4 A;  8ICA A;  1ZQO A;  2JEJ A;  4E80 A;  4QWD A;  4WC3 A;  2W9M A;  8ICK A;  8ICT A;  4DFM A;  3H8W A;  1HUZ A;  4MFC A;  3JZ0 A;  3C66 A;  1YLQ A;  3THV A;  4B9U A;  4IQT A;  1HJP A;  4M47 A;  1F5A A;  2DR9 A;  1D9F A;  4FS1 A;  1RXV A;  4X5V A;  3ZDA A;  1PZN A;  5KG5 A;  5DKW A;  1DOQ A;  9ICE A;  4E8F A;  3V7K A;  4WBY A;  4IRC A;  2H5X A;  3C5G A;  3AUO A;  4YR2 A;  5HHI A;  5KT5 A;  1DK3 A;  4RQ6 A;  4MF2 A;  4RT3 A;  3JPN A;  3Q8S B;  3QZ8 A;  4DS5 A;  2JZB B;  3OHA A;  1ZQN A;  1X9W A;  2FMS A;  4Q8E A;  1NO5 A;  4QZA A;  3WFP A;  2ZTE A;  3OV7 A;  3MFH A;  4DQQ A;  4M2Y A;  3PV8 A;  1L5U A;  1X2I A;  1KDH A;  5KFL A;  5KG3 A;  3PNC A;  3Q8P B;  4J9Q A;  1S0N A;  3RB3 A;  5DG9 A;  5C5J A;  3C18 A;  4YP3 A;  4DQI A;  9ICR A;  3MR2 A;  4XQ7 A;  2ZH6 A;  1XS9 D;  3IM1 A;  3LK9 A;  4F5R A;  3RBE A;  4BXO A;  4GXK A;  2UVU A;  4DFP A;  3MDA A;  1ARO P;  2RDI A;  3H8S A;  2UVR A;  4M9N A;  3K75 D;  3C2M A;  4KLE A;  3SZ2 A;  4O3P A;  4AT7 A;  2C28 A;  5HC9 A;  2HHS A;  2XY6 A;  4RWN A;  4EZ9 A;  3EZ5 A;  1KLN A;  3TAP A;  1Z00 A;  5J0O A;  3KTQ A;  4YXM A;  1D8Y A;  5KFT A;  2ASJ A;  4DFJ A;  3G6V A;  1ZQE A;  5KT6 A;  3GFK B;  2V4Q A;  1KFS A;  1TK5 A;  4J9K A;  3H4D A;  3RJG A;  2JEG A;  1V4A A;  4FHX A;  4J9N A;  3BQ1 A;  1Q78 A;  9ICF A;  4O3N A;  4Q43 A;  4FS2 A;  4B9V A;  2W9C B;  1MQ2 A;  4QZG A;  4PHP A;  1UA0 A;  2W9B A;  5DDY A;  2RDJ A;  1HUO A;  4J9L A;  4F50 A;  5F9L A;  2BQR A;  2HHU A;  3OVA A;  2NRW A;  1QSS A;  3JPP A;  3GV5 B;  1ZQF A;  7ICQ A;  4MEY A;  4RU9 A;  3KHL A;  1D8L A;  4J9O A;  3ZDE A;  2XO7 A;  2XY7 A;  4RPX A;  2BPF A;  4R63 A;  3GV7 B;  1OU5 A;  4UAZ A;  3RH5 A;  5HML A;  4NKT A;  5DB8 A;  4DL5 A;  4WCW A;  4QZB A;  4F4Y A;  1VFG A;  2AGQ A;  4XUS A;  2A1J B;  2IHM A;  3RBD A;  4WC6 A;  3GIK A;  4FHP A;  3BDP A;  1BVS A;  4YCX A;  1T8E A;  3GIJ A;  2V9W A;  5HRG A;  4K4I A;  4F5O A;  3V72 A;  3V6J A;  2UVW A;  1KEJ A;  1JQR A;  3RB4 A;  5EWF A;  3HW8 A;  1NK6 A;  3G6X A;  3EPG A;  1X9S A;  1ZQC A;  4WC0 A;  9ICT A;  4EBJ A;  4ECY A;  1JXL A;  2NRK A;  4E0D A;  4YVZ A;  4KLQ A;  4P4M A;  1BPY A;  1TVA A;  5HP4 A;  4Q8F A;  2HHP A;  5KFW A;  2Q0Z X;  2FMQ A;  4JUZ A;  4ED1 A;  3AQL A;  4ECS A;  3H37 A;  2XCP A;  1S0V A;  5KFQ A;  3JPO A;  3JPQ A;  8ICZ A;  3B0Y A;  1A77 A;  5DG7 A;  1XSP A;  4NLG A;  4FHV A;  3OJU A;  1ZET A;  4YD2 A;  4C8O A;  4AT9 B;  5KFH A;  1BPD A;  4QWC A;  3C2L A;  5EWG A;  9ICH A;  5HRK A;  4DL6 A;  2W8L A;  3UQ0 A;  1NJW A;  1ZQJ A;  5EWE A;  2OWO A;  3PW2 A;  5KG7 A;  5L1J A;  2KZ3 A;  5CP2 A;  2M9N A;  1S9F A;  7ICE A;  2BQU A;  3H38 A;  2DPJ A;  9ICB A;  3RAQ A;  4QZE A;  3M9M B;  1S0O A;  2AU0 A;  3Q8R B;  4QZF A;  8ICR A;  4QZI A;  3Q8K A;  2MAX A;  3OUY B;  5J2B A;  4XRH A;  3MGI A;  2BHN A;  5IIM A;  2PI5 A;  4M9H A;  4G3I A;  2I1Q A;  2PXI A;  4PPX A;  8ICN A;  4YMO A;  5IIL A;  3SYZ A;  1SKW A;  4QWE A;  4NLZ A;  5F2V O;  2AQ0 A;  3M8R A;  4TUQ A;  5DBB A;  3NGD A;  4B9N A;  4DWI A;  3C23 A;  5KFD A;  5JUM A;  3MAB A;  4F92 B;  3GQC A;  1RYR A;  3T5K A;  3JPS A;  4O5C A;  8ICB A;  2NRX A;  1ZQK A;  4EZ6 A;  4WC2 A;  2Q66 A;  3H7I A;  4WC4 A;  3HPO A;  4JV2 A;  3MR3 A;  1SL0 A;  1N48 A;  4XA5 A;  8ICG A;  5DQI A;  1SKS A;  2ZUD A;  2BCU A;  1LV5 A;  2IMW P;  4O3Q A;  3ZDC A;  3C1Y A;  4RQ7 A;  4RPY A;  7ICJ A;  2J6T A;  3GIM A;  9ICS A;  3T5L A;  2UVV A;  5DDM A;  4RQ1 A;  2ISP A;  4I2B A;  5DBA A;  3UXO A;  2J6S A;  4M04 A;  5HRD A;  2ZH9 A;  2VA2 A;  4ED0 A;  4DL3 A;  2JEF A;  3TI0 A;  4Z6C A;  2VA3 A;  4DL4 A;  4Z6E A;  9ICA A;  4RNO A;  4EBK A;  2Y1I A;  2JEI A;  3TAR A;  2IA6 A;  2IHN A;  1U49 A;  5CB1 A;  4MFA A;  1ZQZ A;  1L3S A;  7ICL A;  5HRI A;  5KFZ A;  5HRF A;  4RQ2 A;  5J2K A;  4AT8 B;  4UD5 A;  4DQS A;  4QWA A;  4F5P A;  3C21 A;  5J0Y A;  1XSL A;  2PI4 A;  5D49 A;  4Z6D A;  3KHH A;  4ECX A;  3T5J A;  4FBT A;  2HHX A;  4M9J A;  4ECT A;  4C8M A;  1ZQH A;  3TFS A;  7ICO A;  4R8U B;  1SL1 A;  2PFQ A;  1Q79 A;  2KTQ A;  4DS4 A;  1ZJM A;  1U48 A;  3LWM A;  5J2I A;  9ICJ A;  2BPG A;  3OUY A;  2ZH5 A;  2AGO A;  3H3A A;  1ZQL A;  5DB9 A;  4IQW A;  1T4G A;  3OVS A;  4IRD A;  2F1I A;  5BOM A;  1XO1 A;  3RB0 A;  4NM2 A;  2WTF A;  4ED2 A;  4FO6 A;  1SL2 A;  4IRK A;  3MR6 A;  4P2H A;  2V4R A;  4WBZ A;  5DED A;  2ZH8 A;  4I2E A;  4E7X A;  4Q45 A;  4AT9 A;  4Z6F A;  5KFO A;  4IQU A;  1NOM A;  8ICW A;  1TK8 A;  3RH6 A;  3OSN A;  4CCH A;  4DLG A;  3E2E A;  1WOT A;  5DEC A;  3WFR E;  5KFK A;  1UT5 A;  3PML A;  1K1S A;  3EPI A;  4DLE A;  4MEX A;  4I2H A;  4UQG A;  4RNM A;  1DK2 A;  1ZQW A;  4RPZ A;  3OHB A;  5KT3 A;  9ICV A;  4UB2 A;  5J0P A;  2FLN A;  1JAJ A;  2ASD A;  1L3T A;  7ICM A;  5HHH A;  4C8N A;  4DOC A;  4F3O A;  3T3F A;  4BXO B;  4DQP A;  2AQ4 A;  2BGW A;  1JXE A;  5L1L A;  1RYS A;  4YMN A;  4I2C A;  4I2G A;  2ASL A;  1T3N A;  4DO9 A;  4QW9 A;  2XGQ A;  3ZD9 A;  1VJ7 A;  3RJE A;  3M8S A;  4R8U A;  5J29 A;  5KFV A;  2XY5 A;  4DSL A;  4KLO A;  3LQC B;  1S77 D;  4PHE A;  4B9T A;  4FH5 A;  4YG2 A;  3OVB A;  1NK4 A;  1B22 A;  2FMP A;  9ICL A;  5L1I A;  4X4Q A;  2R8K A;  2DFL A;  4UB3 A;  1ZQX A;  4AT8 A;  4X4O A;  2FPL A;  3N4M B;  2KZZ A;  4ED3 A;  1S0M A;  3JPR A;  4LVS A;  3RH4 A;  4RQ4 A;  4X4N A;  1ZQA A;  3HJ1 A;  1IXR A;  1KFD A;  5KFM A;  1IM4 A;  5L1K A;  2VA8 A;  1MIY A;  2DR8 A;  2KFN A;  3H4B A;  2W9A A;  4GXJ A;  9ICK A;  2M2U A;  3PR5 B;  4J9S A;  4JWM A;  2F1H A;  3HIY A;  1L3U A;  3EWA A;  1KNY A;  2ZH3 A;  4DEZ A;  5KT7 A;  9ICI A;  4PGX A;  2P6U A;  1C7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...