4NLNA

Structure of human dna polymerase beta complexed with nicked dna containing a template 8brg and incoming ctp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlnA03
2W8KA 4EZ6A 7ICHA 5HRFA 5D46A 5KT2A 2M2WA 1X2IA 1UT5A 4DS5A 2ZJ5A 4F8RA 5HC9A 2J6TA 8ICMA 4EBDA 4F4XA 4ECWA 2VA2A 5DG8A 1TK0A 4F91B 4DQPA 4KLFA 3KHRA 4DL5A 3GFKB 1JX4A 4EEYA 2FPMA 1L3UA 2MUTB 4EBCA 4ELTA 4AT7A 3LK9A 4RNOA 3Q8RB 1SKWA 3ETLA 4KTQA 4X4NA 2DPJA 4Q45A 8ICLA 4WC7A 5DLGA 2FPLA 3BQ0A 2AQ0A 4I2DA 1L3VA 1NK0A 1XO1A 4RU9A 1BPEA 3TQ1A 1BGXT 2KN7A 4PGQA 1FA0A 1OU5A 1D9DA 4PGYA 2BGWA 5J0XA 4NLNA 5KFVA 4QZIA 3C18A 3KHLA 1ZQDA 1NKCA 3HWTA 4EZ9A 4RQ4A 2NRZA 4QZDA 4QWAA 4F5PA 9ICHA 2XC9A 4RQ2A 2W9CA 4CCHA 7ICIA 5DECA 9ICKA 3JPOA 5KFQA 2ID1A 2ZH9A 4X4VA 4AT8B 1R8AA 2NRWA 1XSPA 1U48A 4YG2A 1QSYA 4NXZA 3M8RA 4NM1A 3AQKA 3WFSC 1JN3A 5J29A 4DOAA 3G6XA 1XSLA 2V9WA 9ICLA 4PHEA 2MAXA 4TUQA 3UQ0A 4X5VA 4WC5A 2DR5A 4KLEA 4KLGA 1JMSA 5DBCA 5KG7A 5HNKA 7ICSA 1ZQJA 4QZHA 3NGDA 3BQ1A 4UB1A 4R66A 5EOZA 2XGPA 4KLMA 8ICEA 1UA1A 3RTVA 1T4GA 4AT9B 4I2GA 5F9LA 3GV5B 3PY8A 4KLSA 4NKUA 4DSLA 5L1IA 4RT3A 4XRHA 3QE9Y 1DK2A 1ZQKA 4DSFA 3Q8KA 5J0TA 1K1SA 2ZH5A 3H4DA 2XCAA 3TANA 7ICPA 4UB3A 4DFKA 5D4BA 3MR5A 7ICQA 5EWEA 5L1LA 2C2DA 3T5LA 1RYSA 3GILA 3PNCA 2UVUA 5HRHA 1R8CA 4X4PA 1NOMA 1QSLA 2KP7A 4P4PA 4DFPA 2ZH6A 4ED8A 4B9NA 8ICOA 4FH5A 4BDPA 5DBBA 3JYYA 3QZ7A 5HRBA 4F92B 1ZQNA 4YVZA 5J2EA 4DQIA 4PPXA 3RB3A 4ECVA 4X4UA 4QW8A 1U45A 2IMWP 1XU4A 1CUKA 3E2EA 3OHAA 3C1YA 3K75D 1MC8A 4PHPA 4TQRA 1XWLA 3TAPA 2BQ3A 4I2FA 2R8IA 5J2KA 4Q44A 1ZQHA 4F3OA 1PX5A 1SL0A 4BWMA 4F93B 5HHIA 1T3NA 2HHUA 9ICFA 3UXOA 2O1PA 3SZ2A 4E80A 1NO5A 4I29A 3G6YA 5DDYA 2V4QA 5HHHA 3T5KA 4FHYA 2DR8A 3M9MB 7ICGA 3HT3A 3SI8A 4IQVA 7ICMA 2BCVA 1QLNA 5KFGA 9ICBA 4DO9A 2PBEA 3MGHA 4PH5A 4ELVA 1ZQSA 1JIHA 4DOCA 9ICJA 1K1QA 8ICTA 2BKEA 4I2BA 3C2MA 1IM4A 1BPYA 2DR9A 4Z6EA 4P4MA 2BCUA 4WC4A 5KT6A 3SV3A 1NK4A 4UQGA 1WCLA 5D49A 1IXRA 4LT6A 2ZJ8A 5J2GA 3JPQA 8ICQA 1U4BA 5J2FA 3ISCA 4BWJA 4QZGA 2W8LA 4GXIA 3H40A 3N4MB 5L1JA 4X4TA 4KLHA 4F50A 4B9MA 4O3QA 2ZTDA 2ZH2A 3NYBA 4DSJA 4J9NA 2AU0A 3RJIA 4C8KA 3M9OB 1TK5A 4LZGA 5BOLA 3V72A 4KLUA 1D8LA 4KN4A 3PX4A 3RJEA 4M9HA 5J0YA 2JZBB 2JEGA 4BXOA 3GV7B 3OV7A 5DLFA 4FHPA 8ICCA 4ATBB 4DSIA 4PHDA 5J2BA 5HR9A 2ZH8A 4JWMA 1RZTA 3TAQA 1ZJNA 1XS9D 1YLQA 4I2IA 5KFXA 3BQ2A 1KFTA 2A1JB 2HHQA 4X4QA 1BPBA 2ASDA 3FYHA 2PFQA 1HJPA 5DEDA 4YD2A 4ECTA 3PO4A 4R8UB 3PW7A 4UAYA 4DLGA 3ZDEA 1ZETA 3T3FA 2FMPA 1ZQQA 2R8GA 1VFGA 4DL6A 2AGQA 3ISDA 4F5NA 4FS1A 4O3PA 3B0XA 2W9AA 4KLDA 3C1ZA 3SV4A 4M5DA 4JUZA 3C21A 2W9BA 7ICUA 1Q78A 4E7XA 3AU6A 1S9FA 1X9MA 2HHVA 4XUSA 5KFTA 3OSPA 2FLPA 9ICIA 8ICUA 1ZQUA 2Y1JA 4MEYA 4RQ8A 4TUPA 3ZD8A 4QZAA 2UVWA 4DL7A 2JEFA 4MF2A 4UBBA 3T5JA 2JEIA 5KFKA 1NK6A 4UAZA 3H8SA 1U49A 3LWMA 4DWIA 5J0PA 4I2EA 3Q8LA 3OSNA 2BPCA 4B9UA 2XGQA 1NK7A 2BE3A 2WTFA 4IR1A 2MUTA 3V6KA 8ICHA 5HRIA 9ICUA 4DOBA 4P4OA 4F2RA 4M47A 1ZQFA 3RBDA 5IIJA 1BPXA 1TFWA 1V9PA 2BPGA 2NRKA 3MGIA 2HHSA 4C8LA 1MQ3A 4RQ7A 3EWAA 3V6JA 2P6UA 4YP3A 4IRCA 3H37A 5KFPA 3UPSA 5HREA 1ZQRA 2VA3A 4QZ8A 7ICFA 4UD5A 3HPOA 5KFLA 9ICNA 5KG4A 9ICXA 1S0NA 1JAJA 2KZ3A 4FH3A 2M9NA 4EBKA 4M9GA 3AQNA 2HHXA 2F1JA 1COOA 5DGBA 4QZFA 4QWCA 3Q8MA 4Q43A 3HW8A 2Y1IA 2IBKA 7ICEA 8ICFA 5DQGA 1HUOA 4AT8A 5J2HA 3JPNA 1MQ2A 1ZQEA 4EP7A 3UXPA 4JWNA 5IILA 4MEXA 1VJ7A 3HJ4A 5KG6A 2NRTA 1NKBA 4G3IA 7ICTA 9ICRA 5EWGA 4WCWA 5DB7A 5KFRA 1ZQIA 2ISOA 4C8OA 4E0DA 7ICVA 4E8FA 5KFUA 2H5XA 2DPIA 4ED1A 4PGXA 1S97A 1KFDA 4RQ3A 3RB4A 2C22A 1RYRA 2HHWA 4NM2A 4WBYA 4AT9A 3N97B 4RWPA 4RZRA 4QZBA 3TFRA 5KT5A 3NTUA 5IIIA 5IIKA 2OWOA 4GXKA 2KFNA 1BNPA 4ECUA 2DRBA 5KFWA 3PVXA 2ZH4A 5J0QA 4J9MA 3LDAA 4MF8A 4GC7A 3JPSA 2AJQA 2ZHAA 1BNOA 3KTQA 3C5FA 4M6WB 1Z00B 3GIKA 2ZTEA 5C5JA 1UEVA 4P2HA 4UD4A 4I2JA 4ECZA 3BJYA 4B9TA 4KLQA 4ED0A 5J0OA 4K4GA 1A77A 3GV8B 1V4AA 2FPKA 1SZPA 1ZJMA 1ZQZA 5DB8A 4IR9A 1JQRA 4FHVA 5HMMA 1N48A 4F2SA 4DF4A 1TFRA 9ICAA 4WBZA 4WC2A 1ZQXA 5KFDA 9ICCA 4S3NA 2W9MA 1KEJA 5KFCA 4F5OA 4DSEA 4DFMA 4DFJA 2XY6A 1BPZA 3HIYA 4TURA 5J2CA 4NLGA 5CHGA 3HJ1A 8ICWA 4DQSA 4RQ1A 5J2IA 5KFNA 2KZMA 4YCXA 4DQRA 4IRKA 3RRHA 4R63A 1RXVA 1HUZA 4DSKA 3RR8A 4X4RA 5KFMA 3MFIA 3C2LA 1NK5A 1H38A 7ICNA 3Q8QB 2M2UA 2Q0ZX 2M2VA 9ICMA 1D8YA 4XA5A 4KN7A 2PFPA 3LQCB 2IHNA 5IINA 3HP6A 4DL4A 1TFYA 4LZDA 5J2AA 1Z3EB 3MABA 5HMLA 4J9QA 4ED2A 4KMUA 2LYHA 4YFKA 3B0YA 4RPYA 3UQ2A 1NK9A 3C66A 1KDHA 1ZYQA 4WC0A 4KLOA 1SKRA 2DRAA 4K4HA 5J0RA 1ZQAA 1UT8A 5CA7A 1ZQCA 8ICJA 3PMNA 2C2RA 3QEAZ 4UBCA 3PR5B 5KG1A 4J9RA 5KFZA 4M9NA 4KLJA 7ICLA 4F5RA 2VA8A 4O3SA 3IM1A 4O3OA 4J9KA 2XY7A 3PX0A 4O3RA 5KG0A 7ICKA 1TAQA 5KG5A 4NLZA 3OUYB 4F4ZA 5DG7A 2P66A 1NZPA 1L5UA 2AGOA 5HRGA 1S0OA 2M2TA 2DR7A 1X9WA 4WC6A 5KFJA 1S77D 3JPRA 1DK3A 2DVIA 2ZH1A 2PFOA 5CJ7A 4ED7A 2I9GA 3SYZA 4ED6A 5DG9A 5DDMA 2ZTCA 4GXJA 1KLNA 5CB1A 2JZBA 4DF8A 4GLXA 4RT2A 2BCSA 3THVA 3PO5A 4ATBA 2JEJA 3ZD9A 1XSNA 2ZUBA 3Q8PB 4IG8A 4UB2A 5KFYA 5HP4A 2A1JA 4O5EA 3KHHA 4O5KA 5DB6A 2RDJA 3TARA 4LVSA 2I1QA 3V7KA 3OVAA 3MBYA 2O5AA 4R8UA 3MR3A 3C23A 3ORYA 4IQTA 3QZ8A 1NJWA 3RBEA 1LB2B 4J9OA 4I2HA 4RPZA 4Z6DA 5BPCA 2ISPA 1UETA 2KFZA 1BPDA 1QTMA 9ICTA 3WFOA 3FDSA 9ICSA 4QWBA 4RWQA 3UXNA 4Z6FA 4IQWA 1L3SA 4R64A 3G6VA 1R8BA 3MDCA 2RDIA 1B43A 3OGUA 2V4RA 1RPLA 1F5AA 3WFQE 2FLNA 3V6HA 4ECQA 2AGPA 1NJXA 4O3NA 4QWEA 3H8JA 4RQ0A 3H38A 2RFFA 8ICPA 4R65A 5DQHA 1D9FA 4NY8A 4JK1A 1TVAA 1DOQA 2W9BB 4JV1A 4M04A 4PHAA 3MFHA 2ZH3A 3TFSA 4RPXA 4J9SA 5KTQA 1LV5A 2NRXA 4YMNA 4M9LA 2UVVA 4YQWA 3EPGA 4X0BA 1KFSA 4KITB 8ICXA 3JPTA 1JXLA 1PZNA 3WFPA 4BGDA 4M2YA 3GIMA 5JUMA 5J2JA 8ICZA 2F1HA 8ICIA 3MR6A 3K4GA 4O9MA 2BCRA 3PR4A 2XO7A 1SL1A 2HHTA 4AT7B 9ICGA 4QZCA 3ZDBA 1NJZA 2ZHBA 5KFFA 3KHGA 1KNYA 3RB0A 4X4OA 1KSPA 4MFAA 4ECYA 2AQ4A 3IHQB 4IRDA 3RJJA 4Q8EA 4ZH4A 4X4SA 5KFEA 2PXIA 2BQRA 4QZEA 4RQ6A 4B9SA 2PI4A 4KLLA 1NJYA 1WOTA 2W9CB 1TK8A 3PW2A 4IQUA 1S76D 3ZDCA 3H3AA 3C2KA 3MDAA 4YXJA 1XC9A 4YMOA 8ICBA 2HVIA 3RJFA 2C2EA 4QZ9A 1ZQPA 3V7JA 3JPPA 2BPFA 3EW9A 1ZQGA 2VANA 4YR0A 3RH4A 3ZDDA 1Q79A 4RNMA 3OJUA 2HHPA 4C8NA 1N56A 4RQ5A 3PW4A 3RJGA 3ZDAA 3ISBA 4KLTA 3OJSA 1RXWA 5F9NA 4ECXA 1MSWD 3V7LA 4M6WA 1Z00A 4MFFA 9ICOA 3RB6A 4O5CA 3GIIA 2ALZA 3TI0A 3RAQA 4QW9A 4ELUA 1TV9A 4HYKA 5TZVA 3MR2A 3H8WA 5DB9A 4RUCA 1TAUA 5DKWA 1MIWA 1R89A 1S10A 1U47A 3OVBA 4FS2A 1X9SA 7ICOA 5KFBA 3Q8SB 2BDPA 4ECSA 1L3TA 3M9NB 5KT4A 4XQ7A 1ZQWA 4UAWA 2PI5A 3PW5A 5J0UA 4DQQA 4YR2A 1ZQTA 2F1IA 4DEZA 1SL2A 4FBTA 3PMLA 4EBEA 9ICWA 3H39A 1T7PA 5KFSA 1QSSA 3OVSA 4F4WA 1T8EA 3PV8A 5KT3A 1NK8A 2ZH7A 1NKEA 1ZQOA 1KRPA 8ICSA 2UVRA 4DL2A 2HVHA 5HRLA 3H4BA 4YXMA 2FMSA 3GIJA 4JV2A 5HRKA 3BDPA 5J0WA 9ICVA 3JZ0A 2FMQA 5KFAA 3EYZA 3M8SA 2J6UA 4F4KA 7ICJA 5BOMA 5L9XA 1ZQYA 3OHBA 2BR0A 4M0AA 2KZZA 1UA0A 4DLEA 1CEZA 2NRVA 5KG2A 4F4YA 4FO6A 3GDXA 3PX6A 4YR3A 3RH6A 4MFCA 4RNNA 4O0IA 1S0VA 1ZQBA 8ICAA 4F5QA 5HRDA 8ICRA 5EWFA 3QEBZ 5CWRA 1ZQLA 4I28A 4YN4A 3RJKA 1EXNA 2ZUCA 5KT7A 1SKSA 3C5GA 1TKDA 4FBUA 8ICVA 2GWSA 4DL3A 1U9LA 2XCPA 4NKTA 4WC3A 5J2DA 3OUYA 3LWLA 2FLLA 9ICPA 5KG3A 9ICQA 1MIYA 8ICYA 4EYIB 1ZQVA 2ASJA 5KFHA 2IA6A 1ZQMA 7ICRA 4EYHB 2R8JA 3BQTA 4YD1A 2C28A 4GC6A 3RR7A 8ICNA 4FHWA 3EPIA 3HX0A 1S0MA 1BVSA 4B9VA 4TQSA 2B21A 2ASLA 5L1KA 2HW3A 4EBJA 4B9LA 2DFLA 1B22A 2ZUDA 4J9PA 2IHMA 1DGSA 5CR0A 1C7YA 3RAXA 2BHNA 4I27A 3EZ5A 5IIOA 4M9JA 4RUAA 4UB5A 3T5HA 4XQ8A 5J0SA 4WC1A 1Y88A 3RRGA 4UB4A 4Z6CA 2BCQA 3UPQA 2XY5A 2J6SA 5DGAA 2PFNA 4BXOB 4I2AA 3PW0A 4RWOA 4ED3A 4YMMA 3H7IA 4C8MA 5KFOA 4TUSA 3AUOA 3WFRE 2R8KA 4QWDA 4K4IA 1UEUA 3L9DA 4X0AA 1A76A 1WCNA 2ZJAA 5CP2A 1MIVA 4NLKA 4Q8FA 3AQLA 4J9LA 5IIMA 5F2VO 2KTQA 5DQIA 1JXEA 3RH5A 3GQCA 8ICGA 4I2CA 2BQUA 4RWNA 3AQMA 4ECRA 1KTQA 2R8HA 4KLIA 3RJHA 3AU2A 9ICEA 2Q66A 4FHXA 2P6RA 4DS4A 2ATLA 1AROP 5DBAA 5KFIA 4JV0A 8ICKA
chains in the Genus database with same CATH superfamily
5AKGA 2W8KA 4ICAA 1N5XA 2QLTA 2J6TA 8ICMA 2VA2A 5DG8A 1TK0A 5EE1A 4DL5A 2FPMA 3AM9A 3WK6A 4EBCA 1SKWA 3N28A 4X4NA 4I0UA 2FPLA 3F5EA 1L3VA 4RU9A 1BPEA 1QQ5A 3TQ1A 1BGXT 2KN7A 4EEBA 1ZQDA 4F5PA 2XC9A 4RQ2A 4CCHA 7ICIA 1SWVA 9ICKA 3JPOA 2ZH9A 1P7DA 2NRWA 2KE7A 3M1YA 3AQKA 4C80A 4JLXA 3NKUA 2MAXA 2KIVA 4QZHA 2G0AA 4UB1A 1J97A 2XGPA 5CFSA 1T4GA 2A19A 5AM5A 2KNJA 5F9LA 3GV5B 4I2GA 1ZQ1C 4NKUA 4DSLA 1DK2A 3CRXA 1X9XA 5D61A 2ZH5A 3TANA 1VDVA 4DFKA 3MR5A 7ICQA 5EWEA 2C2DA 3T5LA 4QJFB 1RYSA 5HRHA 4NLBA 2WAQF 2EDUA 2ZH6A 2XICA 3QZ7A 2JV3A 4PPXA 1J2NA 2KIWA 4ECVA 4RQMA 1U45A 3OHAA 3C1YA 3NRZA 1FFVA 4KX3A 2R8IA 1ZQHA 4F3OA 2O1PA 3UXOA 4UAVA 1AQ6A 5DDYA 1MA7A 2K4EA 2RLTA 2DR8A 5AK6A 9ICBA 2BCVA 1PK1B 4PH5A 1ZQSA 1NNLA 2WF6A 2BKEA 4PL2A 1IM4A 1BPYA 4WC4A 1NK4A 5D49A 2JMGA 2ZJ8A 3MCRA 2HOFA 4BWJA 1L7OA 5ALWA 4KLHA 4F50A 2ZTDA 4LEZA 2AU0A 3RJIA 2W3SA 5CHEA 2EZYA 4FHYA 2JEGA 8ICCA 2G07A 5ALNA 5J2BA 2WF9A 1ZJNA 3BQ2A 1ZRMA 4Y2UA 3N7SC 5ALDA 4YD2A 4R8UB 3PW7A 1F0MA 4MKPA 4M5DA 3C21A 1X9MA 2HHVA 4Y2TA 2FLPA 9ICIA 1ZD4A 2K4HA 4MEYA 4RQ8A 3LVWA 5KFKA 2YMPA 5AKXA 4UAZA 1NK6A 3LWMA 5ALOA 1RQNA 2BPCA 2XGQA 1NK7A 4G9BA 5B3QA 4MHVA 3NUQA 3KZIU 1TFWA 5IIJA 1BPXA 4C8LA 4QNLA 3EWAA 3V6JA 4YP3A 5AKKA 4QZ8A 3BZCA 2KZ3A 4EBKA 1L6NA 4M9GA 3E58A 4QZFA 5DGBA 4QWCA 2QKQA 4AT8A 1SGGA 2GA9D 2OYYA 4GIBA 5DB7A 4C8OA 2H3FA 2IOHA 5KFUA 2Y9UA 2LKYA 1KFDA 2W7OA 1RYRA 5ALIA 4WBYA 3TFRA 5KT5A 2OWOA 5IIKA 3WK4A 2DRBA 4Y2SA 4MF8A 1BNOA 4CRXA 3GIKA 5C5JA 4P2HA 4B9TA 1A77A 2FPKA 1SZPA 1ZJMA 1ZQZA 1N48A 2NYVA 1TFRA 3UMBA 4NXVA 1KEJA 3WK5A 4NLGA 4K96A 8ICWA 4KMOB 3QU4A 5J2IA 2KZMA 2EANA 3RRHA 4R63A 1RXVA 1HUZA 3J81j 5ALJA 5KFMA 3MFIA 3HRDD 3Q8QB 7ICNA 2KKVA 2ESEA 4DL4A 3IV6A 4LZDA 3MABA 4KMUA 1NK9A 1ZYQA 1L7NA 3OPXA 4K4HA 1JI7A 2W43A 1UT8A 5CA7A 1ZQCA 5KG1A 5KFZA 4M9NA 3SQIA 4J9KA 4O3RA 2KEYA 4F4ZA 2P66A 5AI6A 3SMVA 4O68A 3JCFA 1JROA 4ED7A 4ED6A 5DG9A 2FJ6A 5CB1A 2KJ5A 4RT2A 3BS7A 4WH5A 3ZD9A 3Q8PB 3ONNA 5AKHA 3MBYA 3FC4A 4I2HA 3C23A 3ORYA 4IQTA 1HEKA 3RBEA 2LI6A 4UATA 4EX7A 3FDSA 4QWBA 2B56A 3F53A 4P0QB 2VJ5A 1R8BA 4U7CA 3OGUA 2V4RA 1RPLA 3TADC 3WFQE 1ZD5A 2FLNA 3V6HA 4ECQA 2BDUA 2AGPA 1T94A 1NJXA 3H38A 2RFFA 8ICPA 1WWUA 3M6ZA 2ZH3A 4RPXA 4J9SA 1LV5A 4X0BA 1KFSA 4KITB 1UCVA 3WFPA 4BGDA 3GIMA 5J2JA 5G5HA 2F1HA 4O9MA 2BCRA 2MA1A 9ICGA 2ZHBA 1PK3A 5KFFA 3QU5A 4IRDA 3NVYA 3QUQA 2A1AA 4QZEA 3CP8A 4RQNA 3F2BA 4KLLA 3PW2A 1S76D 3ZDCA 4PZOA 2VIXA 8ICBA 4QZ9A 3NRWA 2H3VA 3JPPA 2VANA 1KN5A 3ZDDA 3OJUA 1B4FA 1N56A 2ZXHA 3PW4A 3RJGA 3ISBA 5F9NA 1LVHA 1ED1A 9ICOA 4O5CA 1HIWA 2KKPA 3MR2A 5AI4A 1MIWA 5AKLA 3OVBA 7ICOA 1Z4OA 2BDPA 1L3TA 3M9NB 4US9A 4UAWA 4IL6U 4DEZA 9ICWA 1SL2A 4FBTA 3PMLA 4EBEA 3WKBA 4OAFA 1KRPA 3H4BA 3QYPA 5CEHA 4JV2A 2F76X 5HRKA 5AKZA 9ICVA 1ECWA 5T14A 5L9XA 3OHBA 1CEZA 4DLEA 4MFCA 3GDXA 4YR3A 3SENA 3RH6A 4F5QA 4LEWA 1EXNA 4FBUA 4NKTA 4DL3A 1YT3A 5FP0A 1TAMA 2OHFA 5KFHA 2IA6A 1Z1BA 1PVQA 4EYHB 3BQTA 4YD1A 1KL9A 3A0HU 1BVSA 1RQLA 4TQSA 2B21A 4OCZA 5HR6A 4B9LA 1D8BA 4J9PA 1DGSA 1KBUA 2MRLA 4I27A 4M9JA 4UB5A 4PJ0U 4XQ8A 4WC1A 1Y88A 2Y0SC 3RRGA 2BCQA 5DGAA 5ALGA 1L7PA 4OO1J 4K4IA 3L9DA 1A76A 1WCNA 1MIVA 2DUYA 5F2VO 1JXEA 3TACB 3GQCA 2BQUA 4ACOA 3BQ7A 2JHDA 1KTQA 2R8HA 3RJHA 3ETRA 2H3IA 2ATLA 1AROP 5DBAA 4NXXA 3U26A 4UAUA 5HRFA 2M2WA 1X2IA 4DS5A 2ZJ5A 4F4XA 1N61A 1T3QA 4F91B 3SEIA 4DQPA 5J8YC 4ELTA 5AI8A 4KTQA 4Q45A 5DLGA 5F3XB 2AQ0A 4O69A 1XO1A 1FA0A 3I28A 4NLNA 4QZIA 3UM9A 2LYAA 2IOFA 4AT8B 5AKJA 1U48A 2Y0SF 4NXZA 4F72A 1JN3A 4DOAA 3G6XA 4PHEA 1F5SA 2LM1A 3UQ0A 4X5VA 2DR5A 4Y2YA 4KLEA 1JMSA 5DBCA 2PMZC 2GAFD 3BQ1A 5EOZA 4KLMA 5AI9A 1UA1A 4EV6A 3RTVA 2AHOB 2CXYA 3PY8A 2EAOA 5L1IA 4RT3A 4DSFA 2KV2A 3H4DA 1SXEA 3QUBA 5D4BA 5L1LA 3GILA 3PNCA 2KP7A 4C4RA 4P4PA 5CFUA 5KL8B 5DBBA 4DQIA 5J2EA 3RB3A 5A0LA 1LKYA 4BUGA 4TQRA 1XWLA 2CN1A 4Q44A 1SIJA 2K4IA 2QARA 5HHIA 2HHUA 3R9KA 3KKAC 4I29A 1QCKA 2DBYA 5HHHA 3SAFA 2EAMA 3HT3A 3SI8A 2ZIWA 3MGHA 1O03A 2DQNB 4C4SA 1RM6C 2CPRA 4I2BA 5AM3A 4Z6EA 2B4VA 5KT6A 3SV3A 2ZIVA 1WCLA 1L8OA 1IXRA 1GPJA 1UHUA 1ZD2P 2VKQA 1U4BA 8ICQA 4QZGA 2W8LA 3N4MB 4OJ5A 4O3QA 1URJA 3NYBA 4DSJA 4J9NA 1SZHA 4LZGA 5BOLA 3AQEA 5AK4A 1D8LA 3V72A 3PX4A 4KLUA 3OV7A 4BXOA 1X66A 4FHPA 2BBJA 4PHDA 5ALSA 1RZTA 2LMRA 3TAQA 1XS9D 1YLQA 1KFTA 2E1FA 2ASDA 2PFQA 3SAGA 3PO4A 3D6JA 4UAYA 1VFGA 1ZETA 3AEVA 4DL6A 2AGQA 3ISDA 4O3PA 4KLDA 3C1ZA 2WAQC 7ICUA 5AHXA 8ICUA 1JRPA 2Y1JA 1PVPA 2HBKA 4MF2A 5AI5A 4O67A 2E1EA 5JRTA 1U49A 4EEKA 4DWIA 4I2EA 1RG6A 4B9UA 5AKIA 4IR1A 5CRXA 8ICHA 1F44A 2Y9TA 9ICUA 4DOBA 4F2RA 1ZQFA 3RBDA 1DGJA 2NRKA 1Z19A 4RQ7A 4IRCA 3H37A 2OEHA 1ZQRA 3NVZA 2VA3A 4UD5A 3HPOA 4DFDA 1S0NA 2M9NA 1O08A 2HHXA 1COOA 2IHOA 1HUOA 5J2HA 1MQ2A 1ZQEA 3UXPA 4NL9A 3D2SA 5ALHA 1PVRA 4G3IA 9ICRA 5EWGA 3HJEA 4E8FA 5AM2A 2H5XA 4ED1A 3KZXA 1IV8A 2C22A 4AT9A 4CF4A 2W03A 4RZRA 4ECUA 4NXWA 2ZH4A 5J0QA 2YB4A 2AJQA 4PL1A 1NZBA 4K97A 3KTQA 2ZTEA 2HN1A 4UD4A 4KLQA 3GV8B 3NASA 3PZPA 1JQRA 4F2SA 4DF4A 4WBZA 1ZQXA 4S3NA 2W9MA 5KFCA 4DSEA 4F5OA 4DFMA 1BPZA 4DFJA 3HIYA 3HJ1A 5AM0A 3A0BU 5KFNA 4YCXA 4IRKA 1H38A 2Q0ZX 9ICMA 1JUDA 4XA5A 1D8YA 3QUTA 2N1RA 4KN7A 1X40A 5HMLA 5J2AA 2ZG6A 5ALUA 2QB1A 4EELA 8ICJA 3PMNA 2C2RA 3QEAZ 4J9RA 3CW2C 7ICLA 3K1ZA 1Q3UA 2EZXA 3PX0A 2XY7A 4N7RA 5KG0A 4A8EA 2HDOA 3QX7A 2PKEA 2AGOA 2RQ5A 4WC6A 2DVIA 2PFOA 3QU7A 2QB0A 5CJ7A 2YMQA 3SYZA 2I9GA 4DF8A 4XJEA 2BCSA 3PO5A 2JEJA 1XSNA 2ZUBA 4UB2A 2W54A 5HP4A 2A1JA 1VLBA 5JU5A 2RDJA 3TARA 4LVSA 3OVAA 3QZ8A 1S8OA 2ISPA 2KFZA 3WFOA 4Z6FA 1V97A 2IOFK 3MDCA 2RDIA 4Y2XA 1F5AA 5HR7A 4O3NA 4KM5A 1D9FA 2B0CA 1TVAA 4JLZA 4M04A 4PHAA 3TFSA 5KTQA 4M9LA 4YQWA 1JXLA 2I6XA 1ZRNA 5JUMA 8ICIA 2RRDA 2GO7A 1SL1A 4QZCA 3ZDBA 2OH2A 2LYBA 1KNYA 3S6JA 2HOQA 3VCBA 1KSPA 2PXIA 2BQRA 4RQ6A 3QU9A 4O3MA 3ALRA 3RF9A 2HBLA 4LEYA 4YR0A 1X42A 4RNMA 4WQKA 4K9BA 2Z7JA 2F8LA 2XI9A 3IP4B 3V7LA 4ECXA 2IUBA 4MFFA 1Q8KA 3T79A 3NVVA 3NS1A 1TV9A 5TZVA 1FIQA 5DB9A 5DKWA 1TE2A 2KJ8A 1S10A 5JTGA 1WYGA 3Q8SB 3ER8C 4ECSA 4XQ7A 2F44A 5J0UA 4DQQA 1ZQTA 2F1IA 3NVOA 3WK8A 5KAIU 8ICSA 2HVHA 4DL2A 5HRLA 4YXMA 2FMSA 5AK3A 1LKYB 2F77X 3KBBA 2E8OA 2K60A 5J0WA 2FMQA 1ZD3A 3M8SA 2QARB 1ZQYA 4J03A 4UASA 1UA0A 3AL0B 4F4YA 1S0VA 3PX6A 2HCFA 4O0IA 2XVTA 2ZIWB 5CWRA 3H0MB 4I28A 2O6KA 5KT7A 1SKSA 1TKDA 2XCPA 4BJQA 4UW9A 2FLLA 1MIYA 2G09A 4NXUA 4EYIB 2KSOA 1ZQVA 4B6JA 2ASJA 2ZIVB 2YMMA 1ZQMA 2R8JA 5G5GA 2C28A 3RR7A 4FHWA 2HMXA 2WFAA 3KFUF 4B9VA 1QQ7A 5L1KA 4UARA 2DFLA 1XNSA 3EZ5A 4RUAA 4FFDA 5AM4A 4WOYA 4UB4A 3IG5A 4BXOB 5ALZA 4ED3A 2FE9A 3H7IA 5KFOA 4TUSA 2Q4TA 4EX6A 2R8KA 4JMUA 2DKZA 4X0AA 5CP2A 4NLKA 4Q8FA 4J9LA 2YY6A 5DQIA 4I2CA 2B51A 2OXOA 4ECRA 3L5KA 9ICEA 2EH9A 4KB6A 8ICKA 4K8VA 3QNMA 5ALFA 7ICHA 5KT2A 4F8RA 4CNQA 1QH9A 3WK9A 3KHRA 1WUDA 1JX4A 4EEYA 1L3UA 4AT7A 3LK9A 4RNOA 3Q8RB 3ETLA 8ICLA 2I5HA 3BQ0A 2LBOA 1NK0A 1WWVA 4PGQA 3H0RB 3PSTA 4PGYA 5J0XA 2MU2A 3HWTA 4RQ4A 2NRZA 4EZ9A 3I1YA 2W9CA 5DECA 4X4VA 4Y2QA 5KFQA 4PZNA 5J29A 1XSLA 5EE9A 9ICLA 5EE0A 3PSPA 4KLGA 5KG7A 7ICSA 1ZQJA 1YZ7A 2KICA 5ALLA 4R66A 8ICEA 4O6AA 4AT9B 2KJ9A 1SV0C 2M0NA 4KLSA 3QE9Y 4XRHA 4U6PA 1ZQKA 7ICPA 2XCAA 2FI1A 4UB3A 3L4PA 2GOLA 4OD0A 4ZOHC 1R8CA 2WF8A 1QSLA 4DFPA 5AI0A 1VJ5A 4B9NA 8ICOA 4BDPA 4F92B 4YVZA 4X4UA 4QW8A 1XU4A 3KD3A 3K75D 1MC8A 4PHPA 2BQ3A 3QU2A 1PX5A 9ICFA 4BWMA 3TADA 1XO0A 1NO5A 3G6YA 3RFAA 3T5KA 7ICGA 4IQVA 2RHFA 7ICMA 4DO9A 4ELVA 4FZLA 1PUZA 9ICJA 1K1QA 3WKCA 2AH5A 3C2MA 5ALRA 2DR9A 4P4MA 3F2CA 5AIBA 4LT6A 3EF2A 3JPQA 5J2FA 3ISCA 4GXIA 3H40A 4B9MA 3BZKA 1CI4A 4C8KA 2NO5A 2QB0B 5GTIU 3RJEA 5J0YA 3GV7B 2ZH8A 2XIDA 4IG8A 4I2IA 3C28A 3NVWA 2A1JB 1SV4A 5ALPA 3B9JA 4ECTA 1IIPA 3ZDEA 1L7MA 1ZQQA 4F5NA 3B0XA 4K99A 3OTQA 3SV4A 1FFUA 4P0PA 5KAFU 1Q78A 2MSNA 4NXTA 1MN8A 4XUSA 5KFTA 4TUPA 4DL7A 2JEFA 4UBBA 2JEIA 3WU2U 3H8SA 5J0PA 3OSNA 4QIWC 2YN4A 2BE3A 2MUTA 4FE3A 2AXTU 3V6KA 5ALQA 5EE3A 1V9PA 4AP9A 3MGIA 1MQ3A 1SXDA 5KFPA 3WKAA 3UPSA 5AK5A 2HN2A 9ICXA 1JAJA 5B66U 3AQNA 2KHVA 2F1JA 3Q8MA 3HW8A 2Y1IA 5ALYA 2IBKA 7ICEA 8ICFA 3JPNA 2JXJA 4USAA 5IILA 4MEXA 1VJ7A 2F8KA 3CNHA 1ZQIA 5KFRA 2ISOA 4E0DA 7ICVA 2DPIA 4PGXA 4RQ3A 1OW5A 4QZBA 5IIIA 2KFNA 4GXKA 2DWQA 4LJXA 1FO4A 4J9MA 3LDAA 4HX0A 5E79U 1M6YA 4EENA 3C5FA 1N2XA 2HBJA 1UEVA 4ECZA 5AIAA 3BJYA 2NO4A 4ED0A 5J0OA 4K4GA 4IR9A 4FHVA 2D6FC 4WC2A 5KFDA 5CHGA 4QIWF 1SB3C 2HI0A 1K5OA 4RQ1A 5GTHU 4DQRA 4X4RA 4DSKA 5JTIA 3RR8A 1NK5A 1TFYA 1Z3EB 4ED2A 3JZ0A 3QXGA 4KX5A 3B0YA 1WG8A 4YFKA 3UQ2A 3C66A 1KDHA 4WC0A 4KLOA 1SKRA 2JGAA 2DRAA 3QUCA 5J0RA 1ZQAA 4KLJA 3MC1A 4OAIZ 5J8YA 2VA8A 4O3SA 4O3OA 7ICKA 1TAQA 5KG5A 4NLZA 1YZ6A 5DG7A 1NZPA 1L5UA 2KHQA 2KSOB 2DR7A 2KD1A 5KFJA 1DK3A 1RYUA 2ZH1A 5DDMA 4C7ZA 2JZBA 1N62A 3THVA 4ATBA 3BS5A 2E8NA 5KFYA 2JH1A 4O5EA 3KHHA 5DB6A 3V7KA 2O5AA 2A3VA 8ICXA 2BZFA 1NJWA 4J9OA 4RPZA 5BPCA 3LVVA 4RWQA 4IQWA 4R64A 1Z1VA 4QWEA 3H8JA 4RQ0A 2G06A 5DQHA 4NY8A 4JK1A 2ZIXA 2W9BB 5B5EU 2UVVA 2KVCA 2EAPA 1RDFA 3MR6A 3K4GA 5H2FU 2HHTA 4AT7B 1NJZA 3KHGA 3RB0A 4X4OA 1J2MA 3KKAA 4MFAA 4ECYA 3IHQB 4Q8EA 5KFEA 1COKA 4UB8U 4B9SA 2PI4A 2W9CB 1TK8A 3C2KA 3MDAA 4YXJA 1FEZA 2K89A 4OJLA 2C2EA 1ZQPA 3V7JA 3EW9A 1Q79A 2HHPA 4C8NA 4RQ5A 4Y2RA 3OJSA 1MSWD 4M6WA 1Z00A 3ER9B 3GIIA 4NWIA 3TI0A 2B6GA 3RAQA 4QW9A 1X6JA 2W3RA 3H8WA 1TAUA 3AQFA 1R89A 1U47A 4FS2A 1GO3F 2GH1A 1ZQWA 3CYMA 2PI5A 4YR2A 3H39A 1T7PA 1QSSA 4F4WA 1NK8A 5KT3A 1NKEA 1ZQOA 2UVRA 3L3FX 4JB3A 2OM6A 5KFAA 3EYZA 4F4KA 7ICJA 5BOMA 2BR0A 2KZZA 5KG2A 4CDGA 4OAGA 1DXSA 1ZQBA 5AM1A 8ICRA 5EWFA 3IDWA 3ICXA 4YN4A 3RJKA 8ICVA 3C5GA 2OCEA 4WC3A 2GWSA 3OUYA 3LWLA 5KG3A 9ICQA 2K8BB 7ICRA 4GC6A 1S0MA 3HX0A 5AKEA 2ASLA 5ALXA 4EBJA 1B22A 2IHMA 5CR0A 5IIOA 3GZFA 4Y2JA 3T5HA 3AMZA 5J0SA 5ALVA 2XY5A 4YMMA 4C8MA 1OXJA 2CRXA 3TKAA 4QWDA 2YQEA 2G5IB 5ALMA 3UMGA 4C4TA 3RH5A 8ICGA 1JALA 3PSFA 3HKZC 4P0PB 2P6RA 4DS4A 4Y2PA 3AUOA 3M9MB 4JV0A 2HBMA 4EZ6A 5D46A 1UT5A 5HC9A 2FDRA 4EBDA 4ECWA 3CK6A 2JR5A 4KLFA 3GFKB 2MUTB 3FAHA 2DPJA 3PSIA 4WC7A 4I2DA 4NV0A 2G5HB 2W7PA 2F3NA 1A0PA 1OU5A 2YB1A 1D9DA 2BGWA 5KFVA 3C18A 3KHLA 3D2NA 1NKCA 4QZDA 4QWAA 9ICHA 2DF4B 4C0ZA 2ID1A 1R8AA 2ZIUA 1XSPA 5ALKA 4YG2A 1QSYA 4NM1A 3M8RA 3WFSC 2V9WA 4K98A 4TUQA 4WC5A 5HNKA 3NGDA 3LYSA 3Q8KA 5J0TA 1K1SA 3HKZF 2UVUA 2NV3A 4X4PA 2H3ZA 1NOMA 4ED8A 2YMLA 2KVSA 4FH5A 3JYYA 5HRBA 1ZQNA 2IMWP 3E2EA 1CUKA 3TAPA 4I2FA 5J2KA 4OJPA 1SL0A 4F93B 1T3NA 4E80A 2K8AA 3SZ2A 3H0LB 2V4QA 4BX9C 1KW4A 1QLNA 2PBEA 5KFGA 1KKXA 1JIHA 2E8MA 4DOCA 8ICTA 3N7RC 2BCUA 5C0YA 5ALTA 2DGZA 1KQQA 4UQGA 5K4LA 5J2GA 3UMCA 5L1JA 4X4TA 3SR6A 2ZH2A 4FZMA 2HSZA 4WJ3B 3M9OB 1TK5A 4KN4A 4M9HA 2JZBB 1UQVA 5DLFA 2D8CA 1ZXIA 4ATBB 4DSIA 3BS5B 5HR9A 1N63A 4JWMA 3IG8A 5KFXA 4X4QA 2HHQA 1BPBA 5D63A 3FYHA 1HJPA 5DEDA 3F5AA 1QQ6A 4DLGA 4LEVA 3T3FA 2FMPA 2R8GA 4FS1A 2G08A 2W9AA 4NLCA 4JUZA 2W9BA 4E7XA 5ALEA 4CGZA 3AU6A 1S9FA 3OSPA 5AICA 1ZQUA 3ZD8A 4QZAA 2UVWA 4FO1A 3T5JA 1OUQA 2ZIXB 3Q8LA 2GLEA 4AYBC 1A6SA 2WTFA 2ES6A 5HRIA 3AN1A 4P4OA 2LHTA 4M47A 3N7PD 2BPGA 2HHSA 4HAIA 2P6UA 3OWGA 5HREA 2WB1C 7ICFA 4FH3A 5KFLA 9ICNA 5KG4A 4DCCA 4EEDA 4Q43A 5DQGA 2EWRA 1Q3VA 4EP7A 4JWNA 2KMDA 3SD7A 5CFTA 3HJ4A 3H8MA 5KG6A 2NRTA 1NKBA 7ICTA 1N60A 4WCWA 1CRXA 4UB6U 3E0FA 1S97A 3WKDA 3RB4A 2JRZA 4OJ6A 2HHWA 4NM2A 1IG6A 3N97B 4RWPA 2BBHA 3NTUA 1BNPA 5KFWA 3PVXA 3DDHA 4GC7A 3JPSA 2ZHAA 2K4PA 1Z00B 4M6WB 2KK0A 2VJ4A 2LM4A 4I2JA 1V4AA 3IRUA 2DKXA 5DB8A 5HMMA 9ICAA 9ICCA 1X6IA 2XY6A 3NWIA 4US8A 4TURA 3IN5A 5J2CA 4AYBF 4DQSA 2KOBA 4CF3A 2WHEA 3C2LA 1Z4NA 2M2VA 2PFPA 2WB1F 3LQCB 2IHNA 5IINA 3HP6A 4J9QA 2M2UA 4RPYA 2LYHA 3ED5A 1PK1A 3K7DA 1NI3A 4UBCA 3PR5B 2WF5A 5AKYA 4F5RA 3MGVA 3IM1A 3K1RB 2E3TA 3OUYB 5B3PA 5TISU 3D2QA 2LPEA 3DEEA 1UPHA 5HRGA 1S0OA 3M6KA 2M2TA 1X9WA 3M7DA 4CE6A 1S77D 5D62A 3JPRA 2W11A 2RP5A 4GXJA 2ZTCA 1KLNA 4GLXA 2FCLA 4OJOA 4FZNA 4EGWA 4O5KA 2I1QA 4IS7A 1B0XA 4R8UA 3MR3A 1LB2B 3O0FA 4Z6DA 4C7YA 5KNIA 1UETA 1BPDA 1QTMA 9ICTA 9ICSA 2YTUA 1SWWA 3UXNA 4K9AA 1SV0A 1L3SA 3G6VA 2EQYA 1B43A 2W55A 4WQLA 4R65A 1DOQA 4JV1A 3MFHA 3HILA 2NRXA 4YMNA 3EPGA 3DV9A 2ZXIA 3JPTA 1PZNA 2R18A 2E5SA 4M2YA 8ICZA 2JH7A 3PR4A 2XO7A 3PHZA 3I76A 4NJ8A 3EUB2 2AQ4A 3RJJA 4ZH4A 4X4SA 3ZI4A 1WOTA 3SAHA 3F2DA 1NJYA 5KL1B 2KG5A 4IQUA 3H3AA 2F2AB 2ZIUB 1XC9A 2HOIA 4YMOA 2HVIA 1ZOLA 3RJFA 2BPFA 1ZQGA 3VC8A 3RH4A 3ZDAA 1S5LU 4KLTA 1RXWA 3RB6A 2ALZA 4F71A 1V85A 2EZZA 2W04A 4ELUA 1C20A 4HYKA 4RUCA 1N5WA 1X9SA 5L1MA 5KFBA 1Q46A 5KT4A 2E8PA 3PW5A 1L8LA 5KFSA 3OVSA 1T8EA 3FM9A 3PV8A 2ZH7A 4IC9A 4Y2VA 3GIJA 3GU3A 3WK7A 2ODGA 3BDPA 2J6UA 4M0AA 3ERCC 2NRVA 4FO6A 2DL0A 4RNNA 4NL9C 8ICAA 5HRDA 3QEBZ 1ZQLA 2ZUCA 1U9LA 2L5YA 5J2DA 9ICPA 8ICYA 2WF7A 4OAHA 2H3QA 8ICNA 3EPIA 1V38A 3WKEA 2HW3A 2PMZF 2YX8A 2ZUDA 1C7YA 3RAXA 2BHNA 4Z6CA 2J6SA 3UPQA 2PFNA 4GFJA 4I2AA 4RWOA 4CF5A 3PW0A 3WFRE 1UEUA 1DRGA 2ZJAA 3AQLA 5IIMA 3KOOA 2KTQA 4P0QA 4RWNA 2D3DA 3C29A 3AQMA 4KLIA 2K8CB 3AU2A 2Q66A 4FHXA 2P35A 5KFIA
chains in the Genus database with same CATH topology
2W8KA 4EZ6A 7ICHA 5HRFA 5D46A 5KT2A 2M2WA 1X2IA 1UT5A 4DS5A 2ZJ5A 4F8RA 5HC9A 2J6TA 8ICMA 4EBDA 4F4XA 4ECWA 2VA2A 5DG8A 1TK0A 4F91B 4DQPA 4KLFA 3KHRA 4DL5A 3GFKB 1JX4A 4EEYA 2FPMA 1L3UA 2MUTB 4EBCA 4ELTA 4AT7A 3LK9A 4RNOA 3Q8RB 1SKWA 3ETLA 4KTQA 4X4NA 2DPJA 4Q45A 8ICLA 4WC7A 5DLGA 2FPLA 3BQ0A 2AQ0A 4I2DA 1L3VA 1NK0A 1XO1A 4RU9A 1BPEA 3TQ1A 1BGXT 2KN7A 4PGQA 1FA0A 1OU5A 1D9DA 4PGYA 2BGWA 5J0XA 4NLNA 5KFVA 4QZIA 3C18A 3KHLA 1ZQDA 1NKCA 3HWTA 4EZ9A 4RQ4A 2NRZA 4QZDA 4QWAA 4F5PA 9ICHA 2XC9A 4RQ2A 2W9CA 4CCHA 7ICIA 5DECA 9ICKA 3JPOA 5KFQA 2ID1A 2ZH9A 4X4VA 4AT8B 1R8AA 2NRWA 1XSPA 1U48A 4YG2A 1QSYA 4NXZA 3M8RA 4NM1A 3AQKA 3WFSC 1JN3A 5J29A 4DOAA 3G6XA 1XSLA 2V9WA 9ICLA 4PHEA 2MAXA 4TUQA 3UQ0A 4X5VA 4WC5A 2DR5A 4KLEA 4KLGA 1JMSA 5DBCA 5KG7A 5HNKA 7ICSA 1ZQJA 4QZHA 3NGDA 3BQ1A 4UB1A 4R66A 5EOZA 2XGPA 4KLMA 8ICEA 1UA1A 3RTVA 1T4GA 4AT9B 4I2GA 5F9LA 3GV5B 3PY8A 4KLSA 4NKUA 4DSLA 5L1IA 4RT3A 4XRHA 3QE9Y 1DK2A 1ZQKA 4DSFA 3Q8KA 5J0TA 1K1SA 2ZH5A 3H4DA 2XCAA 3TANA 7ICPA 4UB3A 4DFKA 5D4BA 3MR5A 7ICQA 5EWEA 5L1LA 2C2DA 3T5LA 1RYSA 3GILA 3PNCA 2UVUA 5HRHA 1R8CA 4X4PA 1NOMA 1QSLA 2KP7A 4P4PA 4DFPA 2ZH6A 4ED8A 4B9NA 8ICOA 4FH5A 4BDPA 5DBBA 3JYYA 3QZ7A 5HRBA 4F92B 1ZQNA 4YVZA 5J2EA 4DQIA 4PPXA 3RB3A 4ECVA 4X4UA 4QW8A 1U45A 2IMWP 1XU4A 1CUKA 3E2EA 3OHAA 3C1YA 3K75D 1MC8A 4PHPA 4TQRA 1XWLA 3TAPA 2BQ3A 4I2FA 2R8IA 5J2KA 4Q44A 1ZQHA 4F3OA 1PX5A 1SL0A 4BWMA 4F93B 5HHIA 1T3NA 2HHUA 9ICFA 3UXOA 2O1PA 3SZ2A 4E80A 1NO5A 4I29A 3G6YA 5DDYA 2V4QA 5HHHA 3T5KA 4FHYA 2DR8A 3M9MB 7ICGA 3HT3A 3SI8A 4IQVA 7ICMA 2BCVA 1QLNA 5KFGA 9ICBA 4DO9A 2PBEA 3MGHA 4PH5A 4ELVA 1ZQSA 1JIHA 4DOCA 9ICJA 1K1QA 8ICTA 2BKEA 4I2BA 3C2MA 1IM4A 1BPYA 2DR9A 4Z6EA 4P4MA 2BCUA 4WC4A 5KT6A 3SV3A 1NK4A 4UQGA 1WCLA 5D49A 1IXRA 4LT6A 2ZJ8A 5J2GA 3JPQA 8ICQA 1U4BA 5J2FA 3ISCA 4BWJA 4QZGA 2W8LA 4GXIA 3H40A 3N4MB 5L1JA 4X4TA 4KLHA 4F50A 4B9MA 4O3QA 2ZTDA 2ZH2A 3NYBA 4DSJA 4J9NA 2AU0A 3RJIA 4C8KA 3M9OB 1TK5A 4LZGA 5BOLA 3V72A 4KLUA 1D8LA 4KN4A 3PX4A 3RJEA 4M9HA 5J0YA 2JZBB 2JEGA 4BXOA 3GV7B 3OV7A 5DLFA 4FHPA 8ICCA 4ATBB 4DSIA 4PHDA 5J2BA 5HR9A 2ZH8A 4JWMA 1RZTA 3TAQA 1ZJNA 1XS9D 1YLQA 4I2IA 5KFXA 3BQ2A 1KFTA 2A1JB 2HHQA 4X4QA 1BPBA 2ASDA 3FYHA 2PFQA 1HJPA 5DEDA 4YD2A 4ECTA 3PO4A 4R8UB 3PW7A 4UAYA 4DLGA 3ZDEA 1ZETA 3T3FA 2FMPA 1ZQQA 2R8GA 1VFGA 4DL6A 2AGQA 3ISDA 4F5NA 4FS1A 4O3PA 3B0XA 2W9AA 4KLDA 3C1ZA 3SV4A 4M5DA 4JUZA 3C21A 2W9BA 7ICUA 1Q78A 4E7XA 3AU6A 1S9FA 1X9MA 2HHVA 4XUSA 5KFTA 3OSPA 2FLPA 9ICIA 8ICUA 1ZQUA 2Y1JA 4MEYA 4RQ8A 4TUPA 3ZD8A 4QZAA 2UVWA 4DL7A 2JEFA 4MF2A 4UBBA 3T5JA 2JEIA 5KFKA 1NK6A 4UAZA 3H8SA 1U49A 3LWMA 4DWIA 5J0PA 4I2EA 3Q8LA 3OSNA 2BPCA 4B9UA 2XGQA 1NK7A 2BE3A 2WTFA 4IR1A 2MUTA 3V6KA 8ICHA 5HRIA 9ICUA 4DOBA 4P4OA 4F2RA 4M47A 1ZQFA 3RBDA 5IIJA 1BPXA 1TFWA 1V9PA 2BPGA 2NRKA 3MGIA 2HHSA 4C8LA 1MQ3A 4RQ7A 3EWAA 3V6JA 2P6UA 4YP3A 4IRCA 3H37A 5KFPA 3UPSA 5HREA 1ZQRA 2VA3A 4QZ8A 7ICFA 4UD5A 3HPOA 5KFLA 9ICNA 5KG4A 9ICXA 1S0NA 1JAJA 2KZ3A 4FH3A 2M9NA 4EBKA 4M9GA 3AQNA 2HHXA 2F1JA 1COOA 5DGBA 4QZFA 4QWCA 3Q8MA 4Q43A 3HW8A 2Y1IA 2IBKA 7ICEA 8ICFA 5DQGA 1HUOA 4AT8A 5J2HA 3JPNA 1MQ2A 1ZQEA 4EP7A 3UXPA 4JWNA 5IILA 4MEXA 1VJ7A 3HJ4A 5KG6A 2NRTA 1NKBA 4G3IA 7ICTA 9ICRA 5EWGA 4WCWA 5DB7A 5KFRA 1ZQIA 2ISOA 4C8OA 4E0DA 7ICVA 4E8FA 5KFUA 2H5XA 2DPIA 4ED1A 4PGXA 1S97A 1KFDA 4RQ3A 3RB4A 2C22A 1RYRA 2HHWA 4NM2A 4WBYA 4AT9A 3N97B 4RWPA 4RZRA 4QZBA 3TFRA 5KT5A 3NTUA 5IIIA 5IIKA 2OWOA 4GXKA 2KFNA 1BNPA 4ECUA 2DRBA 5KFWA 3PVXA 2ZH4A 5J0QA 4J9MA 3LDAA 4MF8A 4GC7A 3JPSA 2AJQA 2ZHAA 1BNOA 3KTQA 3C5FA 4M6WB 1Z00B 3GIKA 2ZTEA 5C5JA 1UEVA 4P2HA 4UD4A 4I2JA 4ECZA 3BJYA 4B9TA 4KLQA 4ED0A 5J0OA 4K4GA 1A77A 3GV8B 1V4AA 2FPKA 1SZPA 1ZJMA 1ZQZA 5DB8A 4IR9A 1JQRA 4FHVA 5HMMA 1N48A 4F2SA 4DF4A 1TFRA 9ICAA 4WBZA 4WC2A 1ZQXA 5KFDA 9ICCA 4S3NA 2W9MA 1KEJA 5KFCA 4F5OA 4DSEA 4DFMA 4DFJA 2XY6A 1BPZA 3HIYA 4TURA 5J2CA 4NLGA 5CHGA 3HJ1A 8ICWA 4DQSA 4RQ1A 5J2IA 5KFNA 2KZMA 4YCXA 4DQRA 4IRKA 3RRHA 4R63A 1RXVA 1HUZA 4DSKA 3RR8A 4X4RA 5KFMA 3MFIA 3C2LA 1NK5A 1H38A 7ICNA 3Q8QB 2M2UA 2Q0ZX 2M2VA 9ICMA 1D8YA 4XA5A 4KN7A 2PFPA 3LQCB 2IHNA 5IINA 3HP6A 4DL4A 1TFYA 4LZDA 5J2AA 1Z3EB 3MABA 5HMLA 4J9QA 4ED2A 4KMUA 2LYHA 4YFKA 3B0YA 4RPYA 3UQ2A 1NK9A 3C66A 1KDHA 1ZYQA 4WC0A 4KLOA 1SKRA 2DRAA 4K4HA 5J0RA 1ZQAA 1UT8A 5CA7A 1ZQCA 8ICJA 3PMNA 2C2RA 3QEAZ 4UBCA 3PR5B 5KG1A 4J9RA 5KFZA 4M9NA 4KLJA 7ICLA 4F5RA 2VA8A 4O3SA 3IM1A 4O3OA 4J9KA 2XY7A 3PX0A 4O3RA 5KG0A 7ICKA 1TAQA 5KG5A 4NLZA 3OUYB 4F4ZA 5DG7A 2P66A 1NZPA 1L5UA 2AGOA 5HRGA 1S0OA 2M2TA 2DR7A 1X9WA 4WC6A 5KFJA 1S77D 3JPRA 1DK3A 2DVIA 2ZH1A 2PFOA 5CJ7A 4ED7A 2I9GA 3SYZA 4ED6A 5DG9A 5DDMA 2ZTCA 4GXJA 1KLNA 5CB1A 2JZBA 4DF8A 4GLXA 4RT2A 2BCSA 3THVA 3PO5A 4ATBA 2JEJA 3ZD9A 1XSNA 2ZUBA 3Q8PB 4IG8A 4UB2A 5KFYA 5HP4A 2A1JA 4O5EA 3KHHA 4O5KA 5DB6A 2RDJA 3TARA 4LVSA 2I1QA 3V7KA 3OVAA 3MBYA 2O5AA 4R8UA 3MR3A 3C23A 3ORYA 4IQTA 3QZ8A 1NJWA 3RBEA 1LB2B 4J9OA 4I2HA 4RPZA 4Z6DA 5BPCA 2ISPA 1UETA 2KFZA 1BPDA 1QTMA 9ICTA 3WFOA 3FDSA 9ICSA 4QWBA 4RWQA 3UXNA 4Z6FA 4IQWA 1L3SA 4R64A 3G6VA 1R8BA 3MDCA 2RDIA 1B43A 3OGUA 2V4RA 1RPLA 1F5AA 3WFQE 2FLNA 3V6HA 4ECQA 2AGPA 1NJXA 4O3NA 4QWEA 3H8JA 4RQ0A 3H38A 2RFFA 8ICPA 4R65A 5DQHA 1D9FA 4NY8A 4JK1A 1TVAA 1DOQA 2W9BB 4JV1A 4M04A 4PHAA 3MFHA 2ZH3A 3TFSA 4RPXA 4J9SA 5KTQA 1LV5A 2NRXA 4YMNA 4M9LA 2UVVA 4YQWA 3EPGA 4X0BA 1KFSA 4KITB 8ICXA 3JPTA 1JXLA 1PZNA 3WFPA 4BGDA 4M2YA 3GIMA 5JUMA 5J2JA 8ICZA 2F1HA 8ICIA 3MR6A 3K4GA 4O9MA 2BCRA 3PR4A 2XO7A 1SL1A 2HHTA 4AT7B 9ICGA 4QZCA 3ZDBA 1NJZA 2ZHBA 5KFFA 3KHGA 1KNYA 3RB0A 4X4OA 1KSPA 4MFAA 4ECYA 2AQ4A 3IHQB 4IRDA 3RJJA 4Q8EA 4ZH4A 4X4SA 5KFEA 2PXIA 2BQRA 4QZEA 4RQ6A 4B9SA 2PI4A 4KLLA 1NJYA 1WOTA 2W9CB 1TK8A 3PW2A 4IQUA 1S76D 3ZDCA 3H3AA 3C2KA 3MDAA 4YXJA 1XC9A 4YMOA 8ICBA 2HVIA 3RJFA 2C2EA 4QZ9A 1ZQPA 3V7JA 3JPPA 2BPFA 3EW9A 1ZQGA 2VANA 4YR0A 3RH4A 3ZDDA 1Q79A 4RNMA 3OJUA 2HHPA 4C8NA 1N56A 4RQ5A 3PW4A 3RJGA 3ZDAA 3ISBA 4KLTA 3OJSA 1RXWA 5F9NA 4ECXA 1MSWD 3V7LA 4M6WA 1Z00A 4MFFA 9ICOA 3RB6A 4O5CA 3GIIA 2ALZA 3TI0A 3RAQA 4QW9A 4ELUA 1TV9A 4HYKA 5TZVA 3MR2A 3H8WA 5DB9A 4RUCA 1TAUA 5DKWA 1MIWA 1R89A 1S10A 1U47A 3OVBA 4FS2A 1X9SA 7ICOA 5KFBA 3Q8SB 2BDPA 4ECSA 1L3TA 3M9NB 5KT4A 4XQ7A 1ZQWA 4UAWA 2PI5A 3PW5A 5J0UA 4DQQA 4YR2A 1ZQTA 2F1IA 4DEZA 1SL2A 4FBTA 3PMLA 4EBEA 9ICWA 3H39A 1T7PA 5KFSA 1QSSA 3OVSA 4F4WA 1T8EA 3PV8A 5KT3A 1NK8A 2ZH7A 1NKEA 1ZQOA 1KRPA 8ICSA 2UVRA 4DL2A 2HVHA 5HRLA 3H4BA 4YXMA 2FMSA 3GIJA 4JV2A 5HRKA 3BDPA 5J0WA 9ICVA 3JZ0A 2FMQA 5KFAA 3EYZA 3M8SA 2J6UA 4F4KA 7ICJA 5BOMA 5L9XA 1ZQYA 3OHBA 2BR0A 4M0AA 2KZZA 1UA0A 4DLEA 1CEZA 2NRVA 5KG2A 4F4YA 4FO6A 3GDXA 3PX6A 4YR3A 3RH6A 4MFCA 4RNNA 4O0IA 1S0VA 1ZQBA 8ICAA 4F5QA 5HRDA 8ICRA 5EWFA 3QEBZ 5CWRA 1ZQLA 4I28A 4YN4A 3RJKA 1EXNA 2ZUCA 5KT7A 1SKSA 3C5GA 1TKDA 4FBUA 8ICVA 2GWSA 4DL3A 1U9LA 2XCPA 4NKTA 4WC3A 5J2DA 3OUYA 3LWLA 2FLLA 9ICPA 5KG3A 9ICQA 1MIYA 8ICYA 4EYIB 1ZQVA 2ASJA 5KFHA 2IA6A 1ZQMA 7ICRA 4EYHB 2R8JA 3BQTA 4YD1A 2C28A 4GC6A 3RR7A 8ICNA 4FHWA 3EPIA 3HX0A 1S0MA 1BVSA 4B9VA 4TQSA 2B21A 2ASLA 5L1KA 2HW3A 4EBJA 4B9LA 2DFLA 1B22A 2ZUDA 4J9PA 2IHMA 1DGSA 5CR0A 1C7YA 3RAXA 2BHNA 4I27A 3EZ5A 5IIOA 4M9JA 4RUAA 4UB5A 3T5HA 4XQ8A 5J0SA 4WC1A 1Y88A 3RRGA 4UB4A 4Z6CA 2BCQA 3UPQA 2XY5A 2J6SA 5DGAA 2PFNA 4BXOB 4I2AA 3PW0A 4RWOA 4ED3A 4YMMA 3H7IA 4C8MA 5KFOA 4TUSA 3AUOA 3WFRE 2R8KA 4QWDA 4K4IA 1UEUA 3L9DA 4X0AA 1A76A 1WCNA 2ZJAA 5CP2A 1MIVA 4NLKA 4Q8FA 3AQLA 4J9LA 5IIMA 5F2VO 2KTQA 5DQIA 1JXEA 3RH5A 3GQCA 8ICGA 4I2CA 2BQUA 4RWNA 3AQMA 4ECRA 1KTQA 2R8HA 4KLIA 3RJHA 3AU2A 9ICEA 2Q66A 4FHXA 2P6RA 4DS4A 2ATLA 1AROP 5DBAA 5KFIA 4JV0A 8ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8K A;  4EZ6 A;  7ICH A;  5HRF A;  5D46 A;  5KT2 A;  2M2W A;  1X2I A;  1UT5 A;  4DS5 A;  2ZJ5 A;  4F8R A;  5HC9 A;  2J6T A;  8ICM A;  4EBD A;  4F4X A;  4ECW A;  2VA2 A;  5DG8 A;  1TK0 A;  4F91 B;  4DQP A;  4KLF A;  3KHR A;  4DL5 A;  3GFK B;  1JX4 A;  4EEY A;  2FPM A;  1L3U A;  2MUT B;  4EBC A;  4ELT A;  4AT7 A;  3LK9 A;  4RNO A;  3Q8R B;  1SKW A;  3ETL A;  4KTQ A;  4X4N A;  2DPJ A;  4Q45 A;  8ICL A;  4WC7 A;  5DLG A;  2FPL A;  3BQ0 A;  2AQ0 A;  4I2D A;  1L3V A;  1NK0 A;  1XO1 A;  4RU9 A;  1BPE A;  3TQ1 A;  1BGX T;  2KN7 A;  4PGQ A;  1FA0 A;  1OU5 A;  1D9D A;  4PGY A;  2BGW A;  5J0X A;  4NLN A;  5KFV A;  4QZI A;  3C18 A;  3KHL A;  1ZQD A;  1NKC A;  3HWT A;  4EZ9 A;  4RQ4 A;  2NRZ A;  4QZD A;  4QWA A;  4F5P A;  9ICH A;  2XC9 A;  4RQ2 A;  2W9C A;  4CCH A;  7ICI A;  5DEC A;  9ICK A;  3JPO A;  5KFQ A;  2ID1 A;  2ZH9 A;  4X4V A;  4AT8 B;  1R8A A;  2NRW A;  1XSP A;  1U48 A;  4YG2 A;  1QSY A;  4NXZ A;  3M8R A;  4NM1 A;  3AQK A;  3WFS C;  1JN3 A;  5J29 A;  4DOA A;  3G6X A;  1XSL A;  2V9W A;  9ICL A;  4PHE A;  2MAX A;  4TUQ A;  3UQ0 A;  4X5V A;  4WC5 A;  2DR5 A;  4KLE A;  4KLG A;  1JMS A;  5DBC A;  5KG7 A;  5HNK A;  7ICS A;  1ZQJ A;  4QZH A;  3NGD A;  3BQ1 A;  4UB1 A;  4R66 A;  5EOZ A;  2XGP A;  4KLM A;  8ICE A;  1UA1 A;  3RTV A;  1T4G A;  4AT9 B;  4I2G A;  5F9L A;  3GV5 B;  3PY8 A;  4KLS A;  4NKU A;  4DSL A;  5L1I A;  4RT3 A;  4XRH A;  3QE9 Y;  1DK2 A;  1ZQK A;  4DSF A;  3Q8K A;  5J0T A;  1K1S A;  2ZH5 A;  3H4D A;  2XCA A;  3TAN A;  7ICP A;  4UB3 A;  4DFK A;  5D4B A;  3MR5 A;  7ICQ A;  5EWE A;  5L1L A;  2C2D A;  3T5L A;  1RYS A;  3GIL A;  3PNC A;  2UVU A;  5HRH A;  1R8C A;  4X4P A;  1NOM A;  1QSL A;  2KP7 A;  4P4P A;  4DFP A;  2ZH6 A;  4ED8 A;  4B9N A;  8ICO A;  4FH5 A;  4BDP A;  5DBB A;  3JYY A;  3QZ7 A;  5HRB A;  4F92 B;  1ZQN A;  4YVZ A;  5J2E A;  4DQI A;  4PPX A;  3RB3 A;  4ECV A;  4X4U A;  4QW8 A;  1U45 A;  2IMW P;  1XU4 A;  1CUK A;  3E2E A;  3OHA A;  3C1Y A;  3K75 D;  1MC8 A;  4PHP A;  4TQR A;  1XWL A;  3TAP A;  2BQ3 A;  4I2F A;  2R8I A;  5J2K A;  4Q44 A;  1ZQH A;  4F3O A;  1PX5 A;  1SL0 A;  4BWM A;  4F93 B;  5HHI A;  1T3N A;  2HHU A;  9ICF A;  3UXO A;  2O1P A;  3SZ2 A;  4E80 A;  1NO5 A;  4I29 A;  3G6Y A;  5DDY A;  2V4Q A;  5HHH A;  3T5K A;  4FHY A;  2DR8 A;  3M9M B;  7ICG A;  3HT3 A;  3SI8 A;  4IQV A;  7ICM A;  2BCV A;  1QLN A;  5KFG A;  9ICB A;  4DO9 A;  2PBE A;  3MGH A;  4PH5 A;  4ELV A;  1ZQS A;  1JIH A;  4DOC A;  9ICJ A;  1K1Q A;  8ICT A;  2BKE A;  4I2B A;  3C2M A;  1IM4 A;  1BPY A;  2DR9 A;  4Z6E A;  4P4M A;  2BCU A;  4WC4 A;  5KT6 A;  3SV3 A;  1NK4 A;  4UQG A;  1WCL A;  5D49 A;  1IXR A;  4LT6 A;  2ZJ8 A;  5J2G A;  3JPQ A;  8ICQ A;  1U4B A;  5J2F A;  3ISC A;  4BWJ A;  4QZG A;  2W8L A;  4GXI A;  3H40 A;  3N4M B;  5L1J A;  4X4T A;  4KLH A;  4F50 A;  4B9M A;  4O3Q A;  2ZTD A;  2ZH2 A;  3NYB A;  4DSJ A;  4J9N A;  2AU0 A;  3RJI A;  4C8K A;  3M9O B;  1TK5 A;  4LZG A;  5BOL A;  3V72 A;  4KLU A;  1D8L A;  4KN4 A;  3PX4 A;  3RJE A;  4M9H A;  5J0Y A;  2JZB B;  2JEG A;  4BXO A;  3GV7 B;  3OV7 A;  5DLF A;  4FHP A;  8ICC A;  4ATB B;  4DSI A;  4PHD A;  5J2B A;  5HR9 A;  2ZH8 A;  4JWM A;  1RZT A;  3TAQ A;  1ZJN A;  1XS9 D;  1YLQ A;  4I2I A;  5KFX A;  3BQ2 A;  1KFT A;  2A1J B;  2HHQ A;  4X4Q A;  1BPB A;  2ASD A;  3FYH A;  2PFQ A;  1HJP A;  5DED A;  4YD2 A;  4ECT A;  3PO4 A;  4R8U B;  3PW7 A;  4UAY A;  4DLG A;  3ZDE A;  1ZET A;  3T3F A;  2FMP A;  1ZQQ A;  2R8G A;  1VFG A;  4DL6 A;  2AGQ A;  3ISD A;  4F5N A;  4FS1 A;  4O3P A;  3B0X A;  2W9A A;  4KLD A;  3C1Z A;  3SV4 A;  4M5D A;  4JUZ A;  3C21 A;  2W9B A;  7ICU A;  1Q78 A;  4E7X A;  3AU6 A;  1S9F A;  1X9M A;  2HHV A;  4XUS A;  5KFT A;  3OSP A;  2FLP A;  9ICI A;  8ICU A;  1ZQU A;  2Y1J A;  4MEY A;  4RQ8 A;  4TUP A;  3ZD8 A;  4QZA A;  2UVW A;  4DL7 A;  2JEF A;  4MF2 A;  4UBB A;  3T5J A;  2JEI A;  5KFK A;  1NK6 A;  4UAZ A;  3H8S A;  1U49 A;  3LWM A;  4DWI A;  5J0P A;  4I2E A;  3Q8L A;  3OSN A;  2BPC A;  4B9U A;  2XGQ A;  1NK7 A;  2BE3 A;  2WTF A;  4IR1 A;  2MUT A;  3V6K A;  8ICH A;  5HRI A;  9ICU A;  4DOB A;  4P4O A;  4F2R A;  4M47 A;  1ZQF A;  3RBD A;  5IIJ A;  1BPX A;  1TFW A;  1V9P A;  2BPG A;  2NRK A;  3MGI A;  2HHS A;  4C8L A;  1MQ3 A;  4RQ7 A;  3EWA A;  3V6J A;  2P6U A;  4YP3 A;  4IRC A;  3H37 A;  5KFP A;  3UPS A;  5HRE A;  1ZQR A;  2VA3 A;  4QZ8 A;  7ICF A;  4UD5 A;  3HPO A;  5KFL A;  9ICN A;  5KG4 A;  9ICX A;  1S0N A;  1JAJ A;  2KZ3 A;  4FH3 A;  2M9N A;  4EBK A;  4M9G A;  3AQN A;  2HHX A;  2F1J A;  1COO A;  5DGB A;  4QZF A;  4QWC A;  3Q8M A;  4Q43 A;  3HW8 A;  2Y1I A;  2IBK A;  7ICE A;  8ICF A;  5DQG A;  1HUO A;  4AT8 A;  5J2H A;  3JPN A;  1MQ2 A;  1ZQE A;  4EP7 A;  3UXP A;  4JWN A;  5IIL A;  4MEX A;  1VJ7 A;  3HJ4 A;  5KG6 A;  2NRT A;  1NKB A;  4G3I A;  7ICT A;  9ICR A;  5EWG A;  4WCW A;  5DB7 A;  5KFR A;  1ZQI A;  2ISO A;  4C8O A;  4E0D A;  7ICV A;  4E8F A;  5KFU A;  2H5X A;  2DPI A;  4ED1 A;  4PGX A;  1S97 A;  1KFD A;  4RQ3 A;  3RB4 A;  2C22 A;  1RYR A;  2HHW A;  4NM2 A;  4WBY A;  4AT9 A;  3N97 B;  4RWP A;  4RZR A;  4QZB A;  3TFR A;  5KT5 A;  3NTU A;  5III A;  5IIK A;  2OWO A;  4GXK A;  2KFN A;  1BNP A;  4ECU A;  2DRB A;  5KFW A;  3PVX A;  2ZH4 A;  5J0Q A;  4J9M A;  3LDA A;  4MF8 A;  4GC7 A;  3JPS A;  2AJQ A;  2ZHA A;  1BNO A;  3KTQ A;  3C5F A;  4M6W B;  1Z00 B;  3GIK A;  2ZTE A;  5C5J A;  1UEV A;  4P2H A;  4UD4 A;  4I2J A;  4ECZ A;  3BJY A;  4B9T A;  4KLQ A;  4ED0 A;  5J0O A;  4K4G A;  1A77 A;  3GV8 B;  1V4A A;  2FPK A;  1SZP A;  1ZJM A;  1ZQZ A;  5DB8 A;  4IR9 A;  1JQR A;  4FHV A;  5HMM A;  1N48 A;  4F2S A;  4DF4 A;  1TFR A;  9ICA A;  4WBZ A;  4WC2 A;  1ZQX A;  5KFD A;  9ICC A;  4S3N A;  2W9M A;  1KEJ A;  5KFC A;  4F5O A;  4DSE A;  4DFM A;  4DFJ A;  2XY6 A;  1BPZ A;  3HIY A;  4TUR A;  5J2C A;  4NLG A;  5CHG A;  3HJ1 A;  8ICW A;  4DQS A;  4RQ1 A;  5J2I A;  5KFN A;  2KZM A;  4YCX A;  4DQR A;  4IRK A;  3RRH A;  4R63 A;  1RXV A;  1HUZ A;  4DSK A;  3RR8 A;  4X4R A;  5KFM A;  3MFI A;  3C2L A;  1NK5 A;  1H38 A;  7ICN A;  3Q8Q B;  2M2U A;  2Q0Z X;  2M2V A;  9ICM A;  1D8Y A;  4XA5 A;  4KN7 A;  2PFP A;  3LQC B;  2IHN A;  5IIN A;  3HP6 A;  4DL4 A;  1TFY A;  4LZD A;  5J2A A;  1Z3E B;  3MAB A;  5HML A;  4J9Q A;  4ED2 A;  4KMU A;  2LYH A;  4YFK A;  3B0Y A;  4RPY A;  3UQ2 A;  1NK9 A;  3C66 A;  1KDH A;  1ZYQ A;  4WC0 A;  4KLO A;  1SKR A;  2DRA A;  4K4H A;  5J0R A;  1ZQA A;  1UT8 A;  5CA7 A;  1ZQC A;  8ICJ A;  3PMN A;  2C2R A;  3QEA Z;  4UBC A;  3PR5 B;  5KG1 A;  4J9R A;  5KFZ A;  4M9N A;  4KLJ A;  7ICL A;  4F5R A;  2VA8 A;  4O3S A;  3IM1 A;  4O3O A;  4J9K A;  2XY7 A;  3PX0 A;  4O3R A;  5KG0 A;  7ICK A;  1TAQ A;  5KG5 A;  4NLZ A;  3OUY B;  4F4Z A;  5DG7 A;  2P66 A;  1NZP A;  1L5U A;  2AGO A;  5HRG A;  1S0O A;  2M2T A;  2DR7 A;  1X9W A;  4WC6 A;  5KFJ A;  1S77 D;  3JPR A;  1DK3 A;  2DVI A;  2ZH1 A;  2PFO A;  5CJ7 A;  4ED7 A;  2I9G A;  3SYZ A;  4ED6 A;  5DG9 A;  5DDM A;  2ZTC A;  4GXJ A;  1KLN A;  5CB1 A;  2JZB A;  4DF8 A;  4GLX A;  4RT2 A;  2BCS A;  3THV A;  3PO5 A;  4ATB A;  2JEJ A;  3ZD9 A;  1XSN A;  2ZUB A;  3Q8P B;  4IG8 A;  4UB2 A;  5KFY A;  5HP4 A;  2A1J A;  4O5E A;  3KHH A;  4O5K A;  5DB6 A;  2RDJ A;  3TAR A;  4LVS A;  2I1Q A;  3V7K A;  3OVA A;  3MBY A;  2O5A A;  4R8U A;  3MR3 A;  3C23 A;  3ORY A;  4IQT A;  3QZ8 A;  1NJW A;  3RBE A;  1LB2 B;  4J9O A;  4I2H A;  4RPZ A;  4Z6D A;  5BPC A;  2ISP A;  1UET A;  2KFZ A;  1BPD A;  1QTM A;  9ICT A;  3WFO A;  3FDS A;  9ICS A;  4QWB A;  4RWQ A;  3UXN A;  4Z6F A;  4IQW A;  1L3S A;  4R64 A;  3G6V A;  1R8B A;  3MDC A;  2RDI A;  1B43 A;  3OGU A;  2V4R A;  1RPL A;  1F5A A;  3WFQ E;  2FLN A;  3V6H A;  4ECQ A;  2AGP A;  1NJX A;  4O3N A;  4QWE A;  3H8J A;  4RQ0 A;  3H38 A;  2RFF A;  8ICP A;  4R65 A;  5DQH A;  1D9F A;  4NY8 A;  4JK1 A;  1TVA A;  1DOQ A;  2W9B B;  4JV1 A;  4M04 A;  4PHA A;  3MFH A;  2ZH3 A;  3TFS A;  4RPX A;  4J9S A;  5KTQ A;  1LV5 A;  2NRX A;  4YMN A;  4M9L A;  2UVV A;  4YQW A;  3EPG A;  4X0B A;  1KFS A;  4KIT B;  8ICX A;  3JPT A;  1JXL A;  1PZN A;  3WFP A;  4BGD A;  4M2Y A;  3GIM A;  5JUM A;  5J2J A;  8ICZ A;  2F1H A;  8ICI A;  3MR6 A;  3K4G A;  4O9M A;  2BCR A;  3PR4 A;  2XO7 A;  1SL1 A;  2HHT A;  4AT7 B;  9ICG A;  4QZC A;  3ZDB A;  1NJZ A;  2ZHB A;  5KFF A;  3KHG A;  1KNY A;  3RB0 A;  4X4O A;  1KSP A;  4MFA A;  4ECY A;  2AQ4 A;  3IHQ B;  4IRD A;  3RJJ A;  4Q8E A;  4ZH4 A;  4X4S A;  5KFE A;  2PXI A;  2BQR A;  4QZE A;  4RQ6 A;  4B9S A;  2PI4 A;  4KLL A;  1NJY A;  1WOT A;  2W9C B;  1TK8 A;  3PW2 A;  4IQU A;  1S76 D;  3ZDC A;  3H3A A;  3C2K A;  3MDA A;  4YXJ A;  1XC9 A;  4YMO A;  8ICB A;  2HVI A;  3RJF A;  2C2E A;  4QZ9 A;  1ZQP A;  3V7J A;  3JPP A;  2BPF A;  3EW9 A;  1ZQG A;  2VAN A;  4YR0 A;  3RH4 A;  3ZDD A;  1Q79 A;  4RNM A;  3OJU A;  2HHP A;  4C8N A;  1N56 A;  4RQ5 A;  3PW4 A;  3RJG A;  3ZDA A;  3ISB A;  4KLT A;  3OJS A;  1RXW A;  5F9N A;  4ECX A;  1MSW D;  3V7L A;  4M6W A;  1Z00 A;  4MFF A;  9ICO A;  3RB6 A;  4O5C A;  3GII A;  2ALZ A;  3TI0 A;  3RAQ A;  4QW9 A;  4ELU A;  1TV9 A;  4HYK A;  5TZV A;  3MR2 A;  3H8W A;  5DB9 A;  4RUC A;  1TAU A;  5DKW A;  1MIW A;  1R89 A;  1S10 A;  1U47 A;  3OVB A;  4FS2 A;  1X9S A;  7ICO A;  5KFB A;  3Q8S B;  2BDP A;  4ECS A;  1L3T A;  3M9N B;  5KT4 A;  4XQ7 A;  1ZQW A;  4UAW A;  2PI5 A;  3PW5 A;  5J0U A;  4DQQ A;  4YR2 A;  1ZQT A;  2F1I A;  4DEZ A;  1SL2 A;  4FBT A;  3PML A;  4EBE A;  9ICW A;  3H39 A;  1T7P A;  5KFS A;  1QSS A;  3OVS A;  4F4W A;  1T8E A;  3PV8 A;  5KT3 A;  1NK8 A;  2ZH7 A;  1NKE A;  1ZQO A;  1KRP A;  8ICS A;  2UVR A;  4DL2 A;  2HVH A;  5HRL A;  3H4B A;  4YXM A;  2FMS A;  3GIJ A;  4JV2 A;  5HRK A;  3BDP A;  5J0W A;  9ICV A;  3JZ0 A;  2FMQ A;  5KFA A;  3EYZ A;  3M8S A;  2J6U A;  4F4K A;  7ICJ A;  5BOM A;  5L9X A;  1ZQY A;  3OHB A;  2BR0 A;  4M0A A;  2KZZ A;  1UA0 A;  4DLE A;  1CEZ A;  2NRV A;  5KG2 A;  4F4Y A;  4FO6 A;  3GDX A;  3PX6 A;  4YR3 A;  3RH6 A;  4MFC A;  4RNN A;  4O0I A;  1S0V A;  1ZQB A;  8ICA A;  4F5Q A;  5HRD A;  8ICR A;  5EWF A;  3QEB Z;  5CWR A;  1ZQL A;  4I28 A;  4YN4 A;  3RJK A;  1EXN A;  2ZUC A;  5KT7 A;  1SKS A;  3C5G A;  1TKD A;  4FBU A;  8ICV A;  2GWS A;  4DL3 A;  1U9L A;  2XCP A;  4NKT A;  4WC3 A;  5J2D A;  3OUY A;  3LWL A;  2FLL A;  9ICP A;  5KG3 A;  9ICQ A;  1MIY A;  8ICY A;  4EYI B;  1ZQV A;  2ASJ A;  5KFH A;  2IA6 A;  1ZQM A;  7ICR A;  4EYH B;  2R8J A;  3BQT A;  4YD1 A;  2C28 A;  4GC6 A;  3RR7 A;  8ICN A;  4FHW A;  3EPI A;  3HX0 A;  1S0M A;  1BVS A;  4B9V A;  4TQS A;  2B21 A;  2ASL A;  5L1K A;  2HW3 A;  4EBJ A;  4B9L A;  2DFL A;  1B22 A;  2ZUD A;  4J9P A;  2IHM A;  1DGS A;  5CR0 A;  1C7Y A;  3RAX A;  2BHN A;  4I27 A;  3EZ5 A;  5IIO A;  4M9J A;  4RUA A;  4UB5 A;  3T5H A;  4XQ8 A;  5J0S A;  4WC1 A;  1Y88 A;  3RRG A;  4UB4 A;  4Z6C A;  2BCQ A;  3UPQ A;  2XY5 A;  2J6S A;  5DGA A;  2PFN A;  4BXO B;  4I2A A;  3PW0 A;  4RWO A;  4ED3 A;  4YMM A;  3H7I A;  4C8M A;  5KFO A;  4TUS A;  3AUO A;  3WFR E;  2R8K A;  4QWD A;  4K4I A;  1UEU A;  3L9D A;  4X0A A;  1A76 A;  1WCN A;  2ZJA A;  5CP2 A;  1MIV A;  4NLK A;  4Q8F A;  3AQL A;  4J9L A;  5IIM A;  5F2V O;  2KTQ A;  5DQI A;  1JXE A;  3RH5 A;  3GQC A;  8ICG A;  4I2C A;  2BQU A;  4RWN A;  3AQM A;  4ECR A;  1KTQ A;  2R8H A;  4KLI A;  3RJH A;  3AU2 A;  9ICE A;  2Q66 A;  4FHX A;  2P6R A;  4DS4 A;  2ATL A;  1ARO P;  5DBA A;  5KFI A;  4JV0 A;  8ICK A; 
#chains in the Genus database with same CATH topology
 5AKG A;  2W8K A;  4ICA A;  1N5X A;  2QLT A;  2J6T A;  8ICM A;  2VA2 A;  5DG8 A;  1TK0 A;  5EE1 A;  4DL5 A;  2FPM A;  3AM9 A;  3WK6 A;  4EBC A;  1SKW A;  3N28 A;  4X4N A;  4I0U A;  2FPL A;  3F5E A;  1L3V A;  4RU9 A;  1BPE A;  1QQ5 A;  3TQ1 A;  1BGX T;  2KN7 A;  4EEB A;  1ZQD A;  4F5P A;  2XC9 A;  4RQ2 A;  4CCH A;  7ICI A;  1SWV A;  9ICK A;  3JPO A;  2ZH9 A;  1P7D A;  2NRW A;  2KE7 A;  3M1Y A;  3AQK A;  4C80 A;  4JLX A;  3NKU A;  2MAX A;  2KIV A;  4QZH A;  2G0A A;  4UB1 A;  1J97 A;  2XGP A;  5CFS A;  1T4G A;  2A19 A;  5AM5 A;  2KNJ A;  5F9L A;  3GV5 B;  4I2G A;  1ZQ1 C;  4NKU A;  4DSL A;  1DK2 A;  3CRX A;  1X9X A;  5D61 A;  2ZH5 A;  3TAN A;  1VDV A;  4DFK A;  3MR5 A;  7ICQ A;  5EWE A;  2C2D A;  3T5L A;  4QJF B;  1RYS A;  5HRH A;  4NLB A;  2WAQ F;  2EDU A;  2ZH6 A;  2XIC A;  3QZ7 A;  2JV3 A;  4PPX A;  1J2N A;  2KIW A;  4ECV A;  4RQM A;  1U45 A;  3OHA A;  3C1Y A;  3NRZ A;  1FFV A;  4KX3 A;  2R8I A;  1ZQH A;  4F3O A;  2O1P A;  3UXO A;  4UAV A;  1AQ6 A;  5DDY A;  1MA7 A;  2K4E A;  2RLT A;  2DR8 A;  5AK6 A;  9ICB A;  2BCV A;  1PK1 B;  4PH5 A;  1ZQS A;  1NNL A;  2WF6 A;  2BKE A;  4PL2 A;  1IM4 A;  1BPY A;  4WC4 A;  1NK4 A;  5D49 A;  2JMG A;  2ZJ8 A;  3MCR A;  2HOF A;  4BWJ A;  1L7O A;  5ALW A;  4KLH A;  4F50 A;  2ZTD A;  4LEZ A;  2AU0 A;  3RJI A;  2W3S A;  5CHE A;  2EZY A;  4FHY A;  2JEG A;  8ICC A;  2G07 A;  5ALN A;  5J2B A;  2WF9 A;  1ZJN A;  3BQ2 A;  1ZRM A;  4Y2U A;  3N7S C;  5ALD A;  4YD2 A;  4R8U B;  3PW7 A;  1F0M A;  4MKP A;  4M5D A;  3C21 A;  1X9M A;  2HHV A;  4Y2T A;  2FLP A;  9ICI A;  1ZD4 A;  2K4H A;  4MEY A;  4RQ8 A;  3LVW A;  5KFK A;  2YMP A;  5AKX A;  4UAZ A;  1NK6 A;  3LWM A;  5ALO A;  1RQN A;  2BPC A;  2XGQ A;  1NK7 A;  4G9B A;  5B3Q A;  4MHV A;  3NUQ A;  3KZI U;  1TFW A;  5IIJ A;  1BPX A;  4C8L A;  4QNL A;  3EWA A;  3V6J A;  4YP3 A;  5AKK A;  4QZ8 A;  3BZC A;  2KZ3 A;  4EBK A;  1L6N A;  4M9G A;  3E58 A;  4QZF A;  5DGB A;  4QWC A;  2QKQ A;  4AT8 A;  1SGG A;  2GA9 D;  2OYY A;  4GIB A;  5DB7 A;  4C8O A;  2H3F A;  2IOH A;  5KFU A;  2Y9U A;  2LKY A;  1KFD A;  2W7O A;  1RYR A;  5ALI A;  4WBY A;  3TFR A;  5KT5 A;  2OWO A;  5IIK A;  3WK4 A;  2DRB A;  4Y2S A;  4MF8 A;  1BNO A;  4CRX A;  3GIK A;  5C5J A;  4P2H A;  4B9T A;  1A77 A;  2FPK A;  1SZP A;  1ZJM A;  1ZQZ A;  1N48 A;  2NYV A;  1TFR A;  3UMB A;  4NXV A;  1KEJ A;  3WK5 A;  4NLG A;  4K96 A;  8ICW A;  4KMO B;  3QU4 A;  5J2I A;  2KZM A;  2EAN A;  3RRH A;  4R63 A;  1RXV A;  1HUZ A;  3J81 j;  5ALJ A;  5KFM A;  3MFI A;  3HRD D;  3Q8Q B;  7ICN A;  2KKV A;  2ESE A;  4DL4 A;  3IV6 A;  4LZD A;  3MAB A;  4KMU A;  1NK9 A;  1ZYQ A;  1L7N A;  3OPX A;  4K4H A;  1JI7 A;  2W43 A;  1UT8 A;  5CA7 A;  1ZQC A;  5KG1 A;  5KFZ A;  4M9N A;  3SQI A;  4J9K A;  4O3R A;  2KEY A;  4F4Z A;  2P66 A;  5AI6 A;  3SMV A;  4O68 A;  3JCF A;  1JRO A;  4ED7 A;  4ED6 A;  5DG9 A;  2FJ6 A;  5CB1 A;  2KJ5 A;  4RT2 A;  3BS7 A;  4WH5 A;  3ZD9 A;  3Q8P B;  3ONN A;  5AKH A;  3MBY A;  3FC4 A;  4I2H A;  3C23 A;  3ORY A;  4IQT A;  1HEK A;  3RBE A;  2LI6 A;  4UAT A;  4EX7 A;  3FDS A;  4QWB A;  2B56 A;  3F53 A;  4P0Q B;  2VJ5 A;  1R8B A;  4U7C A;  3OGU A;  2V4R A;  1RPL A;  3TAD C;  3WFQ E;  1ZD5 A;  2FLN A;  3V6H A;  4ECQ A;  2BDU A;  2AGP A;  1T94 A;  1NJX A;  3H38 A;  2RFF A;  8ICP A;  1WWU A;  3M6Z A;  2ZH3 A;  4RPX A;  4J9S A;  1LV5 A;  4X0B A;  1KFS A;  4KIT B;  1UCV A;  3WFP A;  4BGD A;  3GIM A;  5J2J A;  5G5H A;  2F1H A;  4O9M A;  2BCR A;  2MA1 A;  9ICG A;  2ZHB A;  1PK3 A;  5KFF A;  3QU5 A;  4IRD A;  3NVY A;  3QUQ A;  2A1A A;  4QZE A;  3CP8 A;  4RQN A;  3F2B A;  4KLL A;  3PW2 A;  1S76 D;  3ZDC A;  4PZO A;  2VIX A;  8ICB A;  4QZ9 A;  3NRW A;  2H3V A;  3JPP A;  2VAN A;  1KN5 A;  3ZDD A;  3OJU A;  1B4F A;  1N56 A;  2ZXH A;  3PW4 A;  3RJG A;  3ISB A;  5F9N A;  1LVH A;  1ED1 A;  9ICO A;  4O5C A;  1HIW A;  2KKP A;  3MR2 A;  5AI4 A;  1MIW A;  5AKL A;  3OVB A;  7ICO A;  1Z4O A;  2BDP A;  1L3T A;  3M9N B;  4US9 A;  4UAW A;  4IL6 U;  4DEZ A;  9ICW A;  1SL2 A;  4FBT A;  3PML A;  4EBE A;  3WKB A;  4OAF A;  1KRP A;  3H4B A;  3QYP A;  5CEH A;  4JV2 A;  2F76 X;  5HRK A;  5AKZ A;  9ICV A;  1ECW A;  5T14 A;  5L9X A;  3OHB A;  1CEZ A;  4DLE A;  4MFC A;  3GDX A;  4YR3 A;  3SEN A;  3RH6 A;  4F5Q A;  4LEW A;  1EXN A;  4FBU A;  4NKT A;  4DL3 A;  1YT3 A;  5FP0 A;  1TAM A;  2OHF A;  5KFH A;  2IA6 A;  1Z1B A;  1PVQ A;  4EYH B;  3BQT A;  4YD1 A;  1KL9 A;  3A0H U;  1BVS A;  1RQL A;  4TQS A;  2B21 A;  4OCZ A;  5HR6 A;  4B9L A;  1D8B A;  4J9P A;  1DGS A;  1KBU A;  2MRL A;  4I27 A;  4M9J A;  4UB5 A;  4PJ0 U;  4XQ8 A;  4WC1 A;  1Y88 A;  2Y0S C;  3RRG A;  2BCQ A;  5DGA A;  5ALG A;  1L7P A;  4OO1 J;  4K4I A;  3L9D A;  1A76 A;  1WCN A;  1MIV A;  2DUY A;  5F2V O;  1JXE A;  3TAC B;  3GQC A;  2BQU A;  4ACO A;  3BQ7 A;  2JHD A;  1KTQ A;  2R8H A;  3RJH A;  3ETR A;  2H3I A;  2ATL A;  1ARO P;  5DBA A;  4NXX A;  3U26 A;  4UAU A;  5HRF A;  2M2W A;  1X2I A;  4DS5 A;  2ZJ5 A;  4F4X A;  1N61 A;  1T3Q A;  4F91 B;  3SEI A;  4DQP A;  5J8Y C;  4ELT A;  5AI8 A;  4KTQ A;  4Q45 A;  5DLG A;  5F3X B;  2AQ0 A;  4O69 A;  1XO1 A;  1FA0 A;  3I28 A;  4NLN A;  4QZI A;  3UM9 A;  2LYA A;  2IOF A;  4AT8 B;  5AKJ A;  1U48 A;  2Y0S F;  4NXZ A;  4F72 A;  1JN3 A;  4DOA A;  3G6X A;  4PHE A;  1F5S A;  2LM1 A;  3UQ0 A;  4X5V A;  2DR5 A;  4Y2Y A;  4KLE A;  1JMS A;  5DBC A;  2PMZ C;  2GAF D;  3BQ1 A;  5EOZ A;  4KLM A;  5AI9 A;  1UA1 A;  4EV6 A;  3RTV A;  2AHO B;  2CXY A;  3PY8 A;  2EAO A;  5L1I A;  4RT3 A;  4DSF A;  2KV2 A;  3H4D A;  1SXE A;  3QUB A;  5D4B A;  5L1L A;  3GIL A;  3PNC A;  2KP7 A;  4C4R A;  4P4P A;  5CFU A;  5KL8 B;  5DBB A;  4DQI A;  5J2E A;  3RB3 A;  5A0L A;  1LKY A;  4BUG A;  4TQR A;  1XWL A;  2CN1 A;  4Q44 A;  1SIJ A;  2K4I A;  2QAR A;  5HHI A;  2HHU A;  3R9K A;  3KKA C;  4I29 A;  1QCK A;  2DBY A;  5HHH A;  3SAF A;  2EAM A;  3HT3 A;  3SI8 A;  2ZIW A;  3MGH A;  1O03 A;  2DQN B;  4C4S A;  1RM6 C;  2CPR A;  4I2B A;  5AM3 A;  4Z6E A;  2B4V A;  5KT6 A;  3SV3 A;  2ZIV A;  1WCL A;  1L8O A;  1IXR A;  1GPJ A;  1UHU A;  1ZD2 P;  2VKQ A;  1U4B A;  8ICQ A;  4QZG A;  2W8L A;  3N4M B;  4OJ5 A;  4O3Q A;  1URJ A;  3NYB A;  4DSJ A;  4J9N A;  1SZH A;  4LZG A;  5BOL A;  3AQE A;  5AK4 A;  1D8L A;  3V72 A;  3PX4 A;  4KLU A;  3OV7 A;  4BXO A;  1X66 A;  4FHP A;  2BBJ A;  4PHD A;  5ALS A;  1RZT A;  2LMR A;  3TAQ A;  1XS9 D;  1YLQ A;  1KFT A;  2E1F A;  2ASD A;  2PFQ A;  3SAG A;  3PO4 A;  3D6J A;  4UAY A;  1VFG A;  1ZET A;  3AEV A;  4DL6 A;  2AGQ A;  3ISD A;  4O3P A;  4KLD A;  3C1Z A;  2WAQ C;  7ICU A;  5AHX A;  8ICU A;  1JRP A;  2Y1J A;  1PVP A;  2HBK A;  4MF2 A;  5AI5 A;  4O67 A;  2E1E A;  5JRT A;  1U49 A;  4EEK A;  4DWI A;  4I2E A;  1RG6 A;  4B9U A;  5AKI A;  4IR1 A;  5CRX A;  8ICH A;  1F44 A;  2Y9T A;  9ICU A;  4DOB A;  4F2R A;  1ZQF A;  3RBD A;  1DGJ A;  2NRK A;  1Z19 A;  4RQ7 A;  4IRC A;  3H37 A;  2OEH A;  1ZQR A;  3NVZ A;  2VA3 A;  4UD5 A;  3HPO A;  4DFD A;  1S0N A;  2M9N A;  1O08 A;  2HHX A;  1COO A;  2IHO A;  1HUO A;  5J2H A;  1MQ2 A;  1ZQE A;  3UXP A;  4NL9 A;  3D2S A;  5ALH A;  1PVR A;  4G3I A;  9ICR A;  5EWG A;  3HJE A;  4E8F A;  5AM2 A;  2H5X A;  4ED1 A;  3KZX A;  1IV8 A;  2C22 A;  4AT9 A;  4CF4 A;  2W03 A;  4RZR A;  4ECU A;  4NXW A;  2ZH4 A;  5J0Q A;  2YB4 A;  2AJQ A;  4PL1 A;  1NZB A;  4K97 A;  3KTQ A;  2ZTE A;  2HN1 A;  4UD4 A;  4KLQ A;  3GV8 B;  3NAS A;  3PZP A;  1JQR A;  4F2S A;  4DF4 A;  4WBZ A;  1ZQX A;  4S3N A;  2W9M A;  5KFC A;  4DSE A;  4F5O A;  4DFM A;  1BPZ A;  4DFJ A;  3HIY A;  3HJ1 A;  5AM0 A;  3A0B U;  5KFN A;  4YCX A;  4IRK A;  1H38 A;  2Q0Z X;  9ICM A;  1JUD A;  4XA5 A;  1D8Y A;  3QUT A;  2N1R A;  4KN7 A;  1X40 A;  5HML A;  5J2A A;  2ZG6 A;  5ALU A;  2QB1 A;  4EEL A;  8ICJ A;  3PMN A;  2C2R A;  3QEA Z;  4J9R A;  3CW2 C;  7ICL A;  3K1Z A;  1Q3U A;  2EZX A;  3PX0 A;  2XY7 A;  4N7R A;  5KG0 A;  4A8E A;  2HDO A;  3QX7 A;  2PKE A;  2AGO A;  2RQ5 A;  4WC6 A;  2DVI A;  2PFO A;  3QU7 A;  2QB0 A;  5CJ7 A;  2YMQ A;  3SYZ A;  2I9G A;  4DF8 A;  4XJE A;  2BCS A;  3PO5 A;  2JEJ A;  1XSN A;  2ZUB A;  4UB2 A;  2W54 A;  5HP4 A;  2A1J A;  1VLB A;  5JU5 A;  2RDJ A;  3TAR A;  4LVS A;  3OVA A;  3QZ8 A;  1S8O A;  2ISP A;  2KFZ A;  3WFO A;  4Z6F A;  1V97 A;  2IOF K;  3MDC A;  2RDI A;  4Y2X A;  1F5A A;  5HR7 A;  4O3N A;  4KM5 A;  1D9F A;  2B0C A;  1TVA A;  4JLZ A;  4M04 A;  4PHA A;  3TFS A;  5KTQ A;  4M9L A;  4YQW A;  1JXL A;  2I6X A;  1ZRN A;  5JUM A;  8ICI A;  2RRD A;  2GO7 A;  1SL1 A;  4QZC A;  3ZDB A;  2OH2 A;  2LYB A;  1KNY A;  3S6J A;  2HOQ A;  3VCB A;  1KSP A;  2PXI A;  2BQR A;  4RQ6 A;  3QU9 A;  4O3M A;  3ALR A;  3RF9 A;  2HBL A;  4LEY A;  4YR0 A;  1X42 A;  4RNM A;  4WQK A;  4K9B A;  2Z7J A;  2F8L A;  2XI9 A;  3IP4 B;  3V7L A;  4ECX A;  2IUB A;  4MFF A;  1Q8K A;  3T79 A;  3NVV A;  3NS1 A;  1TV9 A;  5TZV A;  1FIQ A;  5DB9 A;  5DKW A;  1TE2 A;  2KJ8 A;  1S10 A;  5JTG A;  1WYG A;  3Q8S B;  3ER8 C;  4ECS A;  4XQ7 A;  2F44 A;  5J0U A;  4DQQ A;  1ZQT A;  2F1I A;  3NVO A;  3WK8 A;  5KAI U;  8ICS A;  2HVH A;  4DL2 A;  5HRL A;  4YXM A;  2FMS A;  5AK3 A;  1LKY B;  2F77 X;  3KBB A;  2E8O A;  2K60 A;  5J0W A;  2FMQ A;  1ZD3 A;  3M8S A;  2QAR B;  1ZQY A;  4J03 A;  4UAS A;  1UA0 A;  3AL0 B;  4F4Y A;  1S0V A;  3PX6 A;  2HCF A;  4O0I A;  2XVT A;  2ZIW B;  5CWR A;  3H0M B;  4I28 A;  2O6K A;  5KT7 A;  1SKS A;  1TKD A;  2XCP A;  4BJQ A;  4UW9 A;  2FLL A;  1MIY A;  2G09 A;  4NXU A;  4EYI B;  2KSO A;  1ZQV A;  4B6J A;  2ASJ A;  2ZIV B;  2YMM A;  1ZQM A;  2R8J A;  5G5G A;  2C28 A;  3RR7 A;  4FHW A;  2HMX A;  2WFA A;  3KFU F;  4B9V A;  1QQ7 A;  5L1K A;  4UAR A;  2DFL A;  1XNS A;  3EZ5 A;  4RUA A;  4FFD A;  5AM4 A;  4WOY A;  4UB4 A;  3IG5 A;  4BXO B;  5ALZ A;  4ED3 A;  2FE9 A;  3H7I A;  5KFO A;  4TUS A;  2Q4T A;  4EX6 A;  2R8K A;  4JMU A;  2DKZ A;  4X0A A;  5CP2 A;  4NLK A;  4Q8F A;  4J9L A;  2YY6 A;  5DQI A;  4I2C A;  2B51 A;  2OXO A;  4ECR A;  3L5K A;  9ICE A;  2EH9 A;  4KB6 A;  8ICK A;  4K8V A;  3QNM A;  5ALF A;  7ICH A;  5KT2 A;  4F8R A;  4CNQ A;  1QH9 A;  3WK9 A;  3KHR A;  1WUD A;  1JX4 A;  4EEY A;  1L3U A;  4AT7 A;  3LK9 A;  4RNO A;  3Q8R B;  3ETL A;  8ICL A;  2I5H A;  3BQ0 A;  2LBO A;  1NK0 A;  1WWV A;  4PGQ A;  3H0R B;  3PST A;  4PGY A;  5J0X A;  2MU2 A;  3HWT A;  4RQ4 A;  2NRZ A;  4EZ9 A;  3I1Y A;  2W9C A;  5DEC A;  4X4V A;  4Y2Q A;  5KFQ A;  4PZN A;  5J29 A;  1XSL A;  5EE9 A;  9ICL A;  5EE0 A;  3PSP A;  4KLG A;  5KG7 A;  7ICS A;  1ZQJ A;  1YZ7 A;  2KIC A;  5ALL A;  4R66 A;  8ICE A;  4O6A A;  4AT9 B;  2KJ9 A;  1SV0 C;  2M0N A;  4KLS A;  3QE9 Y;  4XRH A;  4U6P A;  1ZQK A;  7ICP A;  2XCA A;  2FI1 A;  4UB3 A;  3L4P A;  2GOL A;  4OD0 A;  4ZOH C;  1R8C A;  2WF8 A;  1QSL A;  4DFP A;  5AI0 A;  1VJ5 A;  4B9N A;  8ICO A;  4BDP A;  4F92 B;  4YVZ A;  4X4U A;  4QW8 A;  1XU4 A;  3KD3 A;  3K75 D;  1MC8 A;  4PHP A;  2BQ3 A;  3QU2 A;  1PX5 A;  9ICF A;  4BWM A;  3TAD A;  1XO0 A;  1NO5 A;  3G6Y A;  3RFA A;  3T5K A;  7ICG A;  4IQV A;  2RHF A;  7ICM A;  4DO9 A;  4ELV A;  4FZL A;  1PUZ A;  9ICJ A;  1K1Q A;  3WKC A;  2AH5 A;  3C2M A;  5ALR A;  2DR9 A;  4P4M A;  3F2C A;  5AIB A;  4LT6 A;  3EF2 A;  3JPQ A;  5J2F A;  3ISC A;  4GXI A;  3H40 A;  4B9M A;  3BZK A;  1CI4 A;  4C8K A;  2NO5 A;  2QB0 B;  5GTI U;  3RJE A;  5J0Y A;  3GV7 B;  2ZH8 A;  2XID A;  4IG8 A;  4I2I A;  3C28 A;  3NVW A;  2A1J B;  1SV4 A;  5ALP A;  3B9J A;  4ECT A;  1IIP A;  3ZDE A;  1L7M A;  1ZQQ A;  4F5N A;  3B0X A;  4K99 A;  3OTQ A;  3SV4 A;  1FFU A;  4P0P A;  5KAF U;  1Q78 A;  2MSN A;  4NXT A;  1MN8 A;  4XUS A;  5KFT A;  4TUP A;  4DL7 A;  2JEF A;  4UBB A;  2JEI A;  3WU2 U;  3H8S A;  5J0P A;  3OSN A;  4QIW C;  2YN4 A;  2BE3 A;  2MUT A;  4FE3 A;  2AXT U;  3V6K A;  5ALQ A;  5EE3 A;  1V9P A;  4AP9 A;  3MGI A;  1MQ3 A;  1SXD A;  5KFP A;  3WKA A;  3UPS A;  5AK5 A;  2HN2 A;  9ICX A;  1JAJ A;  5B66 U;  3AQN A;  2KHV A;  2F1J A;  3Q8M A;  3HW8 A;  2Y1I A;  5ALY A;  2IBK A;  7ICE A;  8ICF A;  3JPN A;  2JXJ A;  4USA A;  5IIL A;  4MEX A;  1VJ7 A;  2F8K A;  3CNH A;  1ZQI A;  5KFR A;  2ISO A;  4E0D A;  7ICV A;  2DPI A;  4PGX A;  4RQ3 A;  1OW5 A;  4QZB A;  5III A;  2KFN A;  4GXK A;  2DWQ A;  4LJX A;  1FO4 A;  4J9M A;  3LDA A;  4HX0 A;  5E79 U;  1M6Y A;  4EEN A;  3C5F A;  1N2X A;  2HBJ A;  1UEV A;  4ECZ A;  5AIA A;  3BJY A;  2NO4 A;  4ED0 A;  5J0O A;  4K4G A;  4IR9 A;  4FHV A;  2D6F C;  4WC2 A;  5KFD A;  5CHG A;  4QIW F;  1SB3 C;  2HI0 A;  1K5O A;  4RQ1 A;  5GTH U;  4DQR A;  4X4R A;  4DSK A;  5JTI A;  3RR8 A;  1NK5 A;  1TFY A;  1Z3E B;  4ED2 A;  3JZ0 A;  3QXG A;  4KX5 A;  3B0Y A;  1WG8 A;  4YFK A;  3UQ2 A;  3C66 A;  1KDH A;  4WC0 A;  4KLO A;  1SKR A;  2JGA A;  2DRA A;  3QUC A;  5J0R A;  1ZQA A;  4KLJ A;  3MC1 A;  4OAI Z;  5J8Y A;  2VA8 A;  4O3S A;  4O3O A;  7ICK A;  1TAQ A;  5KG5 A;  4NLZ A;  1YZ6 A;  5DG7 A;  1NZP A;  1L5U A;  2KHQ A;  2KSO B;  2DR7 A;  2KD1 A;  5KFJ A;  1DK3 A;  1RYU A;  2ZH1 A;  5DDM A;  4C7Z A;  2JZB A;  1N62 A;  3THV A;  4ATB A;  3BS5 A;  2E8N A;  5KFY A;  2JH1 A;  4O5E A;  3KHH A;  5DB6 A;  3V7K A;  2O5A A;  2A3V A;  8ICX A;  2BZF A;  1NJW A;  4J9O A;  4RPZ A;  5BPC A;  3LVV A;  4RWQ A;  4IQW A;  4R64 A;  1Z1V A;  4QWE A;  3H8J A;  4RQ0 A;  2G06 A;  5DQH A;  4NY8 A;  4JK1 A;  2ZIX A;  2W9B B;  5B5E U;  2UVV A;  2KVC A;  2EAP A;  1RDF A;  3MR6 A;  3K4G A;  5H2F U;  2HHT A;  4AT7 B;  1NJZ A;  3KHG A;  3RB0 A;  4X4O A;  1J2M A;  3KKA A;  4MFA A;  4ECY A;  3IHQ B;  4Q8E A;  5KFE A;  1COK A;  4UB8 U;  4B9S A;  2PI4 A;  2W9C B;  1TK8 A;  3C2K A;  3MDA A;  4YXJ A;  1FEZ A;  2K89 A;  4OJL A;  2C2E A;  1ZQP A;  3V7J A;  3EW9 A;  1Q79 A;  2HHP A;  4C8N A;  4RQ5 A;  4Y2R A;  3OJS A;  1MSW D;  4M6W A;  1Z00 A;  3ER9 B;  3GII A;  4NWI A;  3TI0 A;  2B6G A;  3RAQ A;  4QW9 A;  1X6J A;  2W3R A;  3H8W A;  1TAU A;  3AQF A;  1R89 A;  1U47 A;  4FS2 A;  1GO3 F;  2GH1 A;  1ZQW A;  3CYM A;  2PI5 A;  4YR2 A;  3H39 A;  1T7P A;  1QSS A;  4F4W A;  1NK8 A;  5KT3 A;  1NKE A;  1ZQO A;  2UVR A;  3L3F X;  4JB3 A;  2OM6 A;  5KFA A;  3EYZ A;  4F4K A;  7ICJ A;  5BOM A;  2BR0 A;  2KZZ A;  5KG2 A;  4CDG A;  4OAG A;  1DXS A;  1ZQB A;  5AM1 A;  8ICR A;  5EWF A;  3IDW A;  3ICX A;  4YN4 A;  3RJK A;  8ICV A;  3C5G A;  2OCE A;  4WC3 A;  2GWS A;  3OUY A;  3LWL A;  5KG3 A;  9ICQ A;  2K8B B;  7ICR A;  4GC6 A;  1S0M A;  3HX0 A;  5AKE A;  2ASL A;  5ALX A;  4EBJ A;  1B22 A;  2IHM A;  5CR0 A;  5IIO A;  3GZF A;  4Y2J A;  3T5H A;  3AMZ A;  5J0S A;  5ALV A;  2XY5 A;  4YMM A;  4C8M A;  1OXJ A;  2CRX A;  3TKA A;  4QWD A;  2YQE A;  2G5I B;  5ALM A;  3UMG A;  4C4T A;  3RH5 A;  8ICG A;  1JAL A;  3PSF A;  3HKZ C;  4P0P B;  2P6R A;  4DS4 A;  4Y2P A;  3AUO A;  3M9M B;  4JV0 A;  2HBM A;  4EZ6 A;  5D46 A;  1UT5 A;  5HC9 A;  2FDR A;  4EBD A;  4ECW A;  3CK6 A;  2JR5 A;  4KLF A;  3GFK B;  2MUT B;  3FAH A;  2DPJ A;  3PSI A;  4WC7 A;  4I2D A;  4NV0 A;  2G5H B;  2W7P A;  2F3N A;  1A0P A;  1OU5 A;  2YB1 A;  1D9D A;  2BGW A;  5KFV A;  3C18 A;  3KHL A;  3D2N A;  1NKC A;  4QZD A;  4QWA A;  9ICH A;  2DF4 B;  4C0Z A;  2ID1 A;  1R8A A;  2ZIU A;  1XSP A;  5ALK A;  4YG2 A;  1QSY A;  4NM1 A;  3M8R A;  3WFS C;  2V9W A;  4K98 A;  4TUQ A;  4WC5 A;  5HNK A;  3NGD A;  3LYS A;  3Q8K A;  5J0T A;  1K1S A;  3HKZ F;  2UVU A;  2NV3 A;  4X4P A;  2H3Z A;  1NOM A;  4ED8 A;  2YML A;  2KVS A;  4FH5 A;  3JYY A;  5HRB A;  1ZQN A;  2IMW P;  3E2E A;  1CUK A;  3TAP A;  4I2F A;  5J2K A;  4OJP A;  1SL0 A;  4F93 B;  1T3N A;  4E80 A;  2K8A A;  3SZ2 A;  3H0L B;  2V4Q A;  4BX9 C;  1KW4 A;  1QLN A;  2PBE A;  5KFG A;  1KKX A;  1JIH A;  2E8M A;  4DOC A;  8ICT A;  3N7R C;  2BCU A;  5C0Y A;  5ALT A;  2DGZ A;  1KQQ A;  4UQG A;  5K4L A;  5J2G A;  3UMC A;  5L1J A;  4X4T A;  3SR6 A;  2ZH2 A;  4FZM A;  2HSZ A;  4WJ3 B;  3M9O B;  1TK5 A;  4KN4 A;  4M9H A;  2JZB B;  1UQV A;  5DLF A;  2D8C A;  1ZXI A;  4ATB B;  4DSI A;  3BS5 B;  5HR9 A;  1N63 A;  4JWM A;  3IG8 A;  5KFX A;  4X4Q A;  2HHQ A;  1BPB A;  5D63 A;  3FYH A;  1HJP A;  5DED A;  3F5A A;  1QQ6 A;  4DLG A;  4LEV A;  3T3F A;  2FMP A;  2R8G A;  4FS1 A;  2G08 A;  2W9A A;  4NLC A;  4JUZ A;  2W9B A;  4E7X A;  5ALE A;  4CGZ A;  3AU6 A;  1S9F A;  3OSP A;  5AIC A;  1ZQU A;  3ZD8 A;  4QZA A;  2UVW A;  4FO1 A;  3T5J A;  1OUQ A;  2ZIX B;  3Q8L A;  2GLE A;  4AYB C;  1A6S A;  2WTF A;  2ES6 A;  5HRI A;  3AN1 A;  4P4O A;  2LHT A;  4M47 A;  3N7P D;  2BPG A;  2HHS A;  4HAI A;  2P6U A;  3OWG A;  5HRE A;  2WB1 C;  7ICF A;  4FH3 A;  5KFL A;  9ICN A;  5KG4 A;  4DCC A;  4EED A;  4Q43 A;  5DQG A;  2EWR A;  1Q3V A;  4EP7 A;  4JWN A;  2KMD A;  3SD7 A;  5CFT A;  3HJ4 A;  3H8M A;  5KG6 A;  2NRT A;  1NKB A;  7ICT A;  1N60 A;  4WCW A;  1CRX A;  4UB6 U;  3E0F A;  1S97 A;  3WKD A;  3RB4 A;  2JRZ A;  4OJ6 A;  2HHW A;  4NM2 A;  1IG6 A;  3N97 B;  4RWP A;  2BBH A;  3NTU A;  1BNP A;  5KFW A;  3PVX A;  3DDH A;  4GC7 A;  3JPS A;  2ZHA A;  2K4P A;  1Z00 B;  4M6W B;  2KK0 A;  2VJ4 A;  2LM4 A;  4I2J A;  1V4A A;  3IRU A;  2DKX A;  5DB8 A;  5HMM A;  9ICA A;  9ICC A;  1X6I A;  2XY6 A;  3NWI A;  4US8 A;  4TUR A;  3IN5 A;  5J2C A;  4AYB F;  4DQS A;  2KOB A;  4CF3 A;  2WHE A;  3C2L A;  1Z4N A;  2M2V A;  2PFP A;  2WB1 F;  3LQC B;  2IHN A;  5IIN A;  3HP6 A;  4J9Q A;  2M2U A;  4RPY A;  2LYH A;  3ED5 A;  1PK1 A;  3K7D A;  1NI3 A;  4UBC A;  3PR5 B;  2WF5 A;  5AKY A;  4F5R A;  3MGV A;  3IM1 A;  3K1R B;  2E3T A;  3OUY B;  5B3P A;  5TIS U;  3D2Q A;  2LPE A;  3DEE A;  1UPH A;  5HRG A;  1S0O A;  3M6K A;  2M2T A;  1X9W A;  3M7D A;  4CE6 A;  1S77 D;  5D62 A;  3JPR A;  2W11 A;  2RP5 A;  4GXJ A;  2ZTC A;  1KLN A;  4GLX A;  2FCL A;  4OJO A;  4FZN A;  4EGW A;  4O5K A;  2I1Q A;  4IS7 A;  1B0X A;  4R8U A;  3MR3 A;  1LB2 B;  3O0F A;  4Z6D A;  4C7Y A;  5KNI A;  1UET A;  1BPD A;  1QTM A;  9ICT A;  9ICS A;  2YTU A;  1SWW A;  3UXN A;  4K9A A;  1SV0 A;  1L3S A;  3G6V A;  2EQY A;  1B43 A;  2W55 A;  4WQL A;  4R65 A;  1DOQ A;  4JV1 A;  3MFH A;  3HIL A;  2NRX A;  4YMN A;  3EPG A;  3DV9 A;  2ZXI A;  3JPT A;  1PZN A;  2R18 A;  2E5S A;  4M2Y A;  8ICZ A;  2JH7 A;  3PR4 A;  2XO7 A;  3PHZ A;  3I76 A;  4NJ8 A;  3EUB 2;  2AQ4 A;  3RJJ A;  4ZH4 A;  4X4S A;  3ZI4 A;  1WOT A;  3SAH A;  3F2D A;  1NJY A;  5KL1 B;  2KG5 A;  4IQU A;  3H3A A;  2F2A B;  2ZIU B;  1XC9 A;  2HOI A;  4YMO A;  2HVI A;  1ZOL A;  3RJF A;  2BPF A;  1ZQG A;  3VC8 A;  3RH4 A;  3ZDA A;  1S5L U;  4KLT A;  1RXW A;  3RB6 A;  2ALZ A;  4F71 A;  1V85 A;  2EZZ A;  2W04 A;  4ELU A;  1C20 A;  4HYK A;  4RUC A;  1N5W A;  1X9S A;  5L1M A;  5KFB A;  1Q46 A;  5KT4 A;  2E8P A;  3PW5 A;  1L8L A;  5KFS A;  3OVS A;  1T8E A;  3FM9 A;  3PV8 A;  2ZH7 A;  4IC9 A;  4Y2V A;  3GIJ A;  3GU3 A;  3WK7 A;  2ODG A;  3BDP A;  2J6U A;  4M0A A;  3ERC C;  2NRV A;  4FO6 A;  2DL0 A;  4RNN A;  4NL9 C;  8ICA A;  5HRD A;  3QEB Z;  1ZQL A;  2ZUC A;  1U9L A;  2L5Y A;  5J2D A;  9ICP A;  8ICY A;  2WF7 A;  4OAH A;  2H3Q A;  8ICN A;  3EPI A;  1V38 A;  3WKE A;  2HW3 A;  2PMZ F;  2YX8 A;  2ZUD A;  1C7Y A;  3RAX A;  2BHN A;  4Z6C A;  2J6S A;  3UPQ A;  2PFN A;  4GFJ A;  4I2A A;  4RWO A;  4CF5 A;  3PW0 A;  3WFR E;  1UEU A;  1DRG A;  2ZJA A;  3AQL A;  5IIM A;  3KOO A;  2KTQ A;  4P0Q A;  4RWN A;  2D3D A;  3C29 A;  3AQM A;  4KLI A;  2K8C B;  3AU2 A;  2Q66 A;  4FHX A;  2P35 A;  5KFI A; 
#chains in the Genus database with same CATH homology
 2W8K A;  4EZ6 A;  7ICH A;  5HRF A;  5D46 A;  5KT2 A;  2M2W A;  1X2I A;  1UT5 A;  4DS5 A;  2ZJ5 A;  4F8R A;  5HC9 A;  2J6T A;  8ICM A;  4EBD A;  4F4X A;  4ECW A;  2VA2 A;  5DG8 A;  1TK0 A;  4F91 B;  4DQP A;  4KLF A;  3KHR A;  4DL5 A;  3GFK B;  1JX4 A;  4EEY A;  2FPM A;  1L3U A;  2MUT B;  4EBC A;  4ELT A;  4AT7 A;  3LK9 A;  4RNO A;  3Q8R B;  1SKW A;  3ETL A;  4KTQ A;  4X4N A;  2DPJ A;  4Q45 A;  8ICL A;  4WC7 A;  5DLG A;  2FPL A;  3BQ0 A;  2AQ0 A;  4I2D A;  1L3V A;  1NK0 A;  1XO1 A;  4RU9 A;  1BPE A;  3TQ1 A;  1BGX T;  2KN7 A;  4PGQ A;  1FA0 A;  1OU5 A;  1D9D A;  4PGY A;  2BGW A;  5J0X A;  4NLN A;  5KFV A;  4QZI A;  3C18 A;  3KHL A;  1ZQD A;  1NKC A;  3HWT A;  4EZ9 A;  4RQ4 A;  2NRZ A;  4QZD A;  4QWA A;  4F5P A;  9ICH A;  2XC9 A;  4RQ2 A;  2W9C A;  4CCH A;  7ICI A;  5DEC A;  9ICK A;  3JPO A;  5KFQ A;  2ID1 A;  2ZH9 A;  4X4V A;  4AT8 B;  1R8A A;  2NRW A;  1XSP A;  1U48 A;  4YG2 A;  1QSY A;  4NXZ A;  3M8R A;  4NM1 A;  3AQK A;  3WFS C;  1JN3 A;  5J29 A;  4DOA A;  3G6X A;  1XSL A;  2V9W A;  9ICL A;  4PHE A;  2MAX A;  4TUQ A;  3UQ0 A;  4X5V A;  4WC5 A;  2DR5 A;  4KLE A;  4KLG A;  1JMS A;  5DBC A;  5KG7 A;  5HNK A;  7ICS A;  1ZQJ A;  4QZH A;  3NGD A;  3BQ1 A;  4UB1 A;  4R66 A;  5EOZ A;  2XGP A;  4KLM A;  8ICE A;  1UA1 A;  3RTV A;  1T4G A;  4AT9 B;  4I2G A;  5F9L A;  3GV5 B;  3PY8 A;  4KLS A;  4NKU A;  4DSL A;  5L1I A;  4RT3 A;  4XRH A;  3QE9 Y;  1DK2 A;  1ZQK A;  4DSF A;  3Q8K A;  5J0T A;  1K1S A;  2ZH5 A;  3H4D A;  2XCA A;  3TAN A;  7ICP A;  4UB3 A;  4DFK A;  5D4B A;  3MR5 A;  7ICQ A;  5EWE A;  5L1L A;  2C2D A;  3T5L A;  1RYS A;  3GIL A;  3PNC A;  2UVU A;  5HRH A;  1R8C A;  4X4P A;  1NOM A;  1QSL A;  2KP7 A;  4P4P A;  4DFP A;  2ZH6 A;  4ED8 A;  4B9N A;  8ICO A;  4FH5 A;  4BDP A;  5DBB A;  3JYY A;  3QZ7 A;  5HRB A;  4F92 B;  1ZQN A;  4YVZ A;  5J2E A;  4DQI A;  4PPX A;  3RB3 A;  4ECV A;  4X4U A;  4QW8 A;  1U45 A;  2IMW P;  1XU4 A;  1CUK A;  3E2E A;  3OHA A;  3C1Y A;  3K75 D;  1MC8 A;  4PHP A;  4TQR A;  1XWL A;  3TAP A;  2BQ3 A;  4I2F A;  2R8I A;  5J2K A;  4Q44 A;  1ZQH A;  4F3O A;  1PX5 A;  1SL0 A;  4BWM A;  4F93 B;  5HHI A;  1T3N A;  2HHU A;  9ICF A;  3UXO A;  2O1P A;  3SZ2 A;  4E80 A;  1NO5 A;  4I29 A;  3G6Y A;  5DDY A;  2V4Q A;  5HHH A;  3T5K A;  4FHY A;  2DR8 A;  3M9M B;  7ICG A;  3HT3 A;  3SI8 A;  4IQV A;  7ICM A;  2BCV A;  1QLN A;  5KFG A;  9ICB A;  4DO9 A;  2PBE A;  3MGH A;  4PH5 A;  4ELV A;  1ZQS A;  1JIH A;  4DOC A;  9ICJ A;  1K1Q A;  8ICT A;  2BKE A;  4I2B A;  3C2M A;  1IM4 A;  1BPY A;  2DR9 A;  4Z6E A;  4P4M A;  2BCU A;  4WC4 A;  5KT6 A;  3SV3 A;  1NK4 A;  4UQG A;  1WCL A;  5D49 A;  1IXR A;  4LT6 A;  2ZJ8 A;  5J2G A;  3JPQ A;  8ICQ A;  1U4B A;  5J2F A;  3ISC A;  4BWJ A;  4QZG A;  2W8L A;  4GXI A;  3H40 A;  3N4M B;  5L1J A;  4X4T A;  4KLH A;  4F50 A;  4B9M A;  4O3Q A;  2ZTD A;  2ZH2 A;  3NYB A;  4DSJ A;  4J9N A;  2AU0 A;  3RJI A;  4C8K A;  3M9O B;  1TK5 A;  4LZG A;  5BOL A;  3V72 A;  4KLU A;  1D8L A;  4KN4 A;  3PX4 A;  3RJE A;  4M9H A;  5J0Y A;  2JZB B;  2JEG A;  4BXO A;  3GV7 B;  3OV7 A;  5DLF A;  4FHP A;  8ICC A;  4ATB B;  4DSI A;  4PHD A;  5J2B A;  5HR9 A;  2ZH8 A;  4JWM A;  1RZT A;  3TAQ A;  1ZJN A;  1XS9 D;  1YLQ A;  4I2I A;  5KFX A;  3BQ2 A;  1KFT A;  2A1J B;  2HHQ A;  4X4Q A;  1BPB A;  2ASD A;  3FYH A;  2PFQ A;  1HJP A;  5DED A;  4YD2 A;  4ECT A;  3PO4 A;  4R8U B;  3PW7 A;  4UAY A;  4DLG A;  3ZDE A;  1ZET A;  3T3F A;  2FMP A;  1ZQQ A;  2R8G A;  1VFG A;  4DL6 A;  2AGQ A;  3ISD A;  4F5N A;  4FS1 A;  4O3P A;  3B0X A;  2W9A A;  4KLD A;  3C1Z A;  3SV4 A;  4M5D A;  4JUZ A;  3C21 A;  2W9B A;  7ICU A;  1Q78 A;  4E7X A;  3AU6 A;  1S9F A;  1X9M A;  2HHV A;  4XUS A;  5KFT A;  3OSP A;  2FLP A;  9ICI A;  8ICU A;  1ZQU A;  2Y1J A;  4MEY A;  4RQ8 A;  4TUP A;  3ZD8 A;  4QZA A;  2UVW A;  4DL7 A;  2JEF A;  4MF2 A;  4UBB A;  3T5J A;  2JEI A;  5KFK A;  1NK6 A;  4UAZ A;  3H8S A;  1U49 A;  3LWM A;  4DWI A;  5J0P A;  4I2E A;  3Q8L A;  3OSN A;  2BPC A;  4B9U A;  2XGQ A;  1NK7 A;  2BE3 A;  2WTF A;  4IR1 A;  2MUT A;  3V6K A;  8ICH A;  5HRI A;  9ICU A;  4DOB A;  4P4O A;  4F2R A;  4M47 A;  1ZQF A;  3RBD A;  5IIJ A;  1BPX A;  1TFW A;  1V9P A;  2BPG A;  2NRK A;  3MGI A;  2HHS A;  4C8L A;  1MQ3 A;  4RQ7 A;  3EWA A;  3V6J A;  2P6U A;  4YP3 A;  4IRC A;  3H37 A;  5KFP A;  3UPS A;  5HRE A;  1ZQR A;  2VA3 A;  4QZ8 A;  7ICF A;  4UD5 A;  3HPO A;  5KFL A;  9ICN A;  5KG4 A;  9ICX A;  1S0N A;  1JAJ A;  2KZ3 A;  4FH3 A;  2M9N A;  4EBK A;  4M9G A;  3AQN A;  2HHX A;  2F1J A;  1COO A;  5DGB A;  4QZF A;  4QWC A;  3Q8M A;  4Q43 A;  3HW8 A;  2Y1I A;  2IBK A;  7ICE A;  8ICF A;  5DQG A;  1HUO A;  4AT8 A;  5J2H A;  3JPN A;  1MQ2 A;  1ZQE A;  4EP7 A;  3UXP A;  4JWN A;  5IIL A;  4MEX A;  1VJ7 A;  3HJ4 A;  5KG6 A;  2NRT A;  1NKB A;  4G3I A;  7ICT A;  9ICR A;  5EWG A;  4WCW A;  5DB7 A;  5KFR A;  1ZQI A;  2ISO A;  4C8O A;  4E0D A;  7ICV A;  4E8F A;  5KFU A;  2H5X A;  2DPI A;  4ED1 A;  4PGX A;  1S97 A;  1KFD A;  4RQ3 A;  3RB4 A;  2C22 A;  1RYR A;  2HHW A;  4NM2 A;  4WBY A;  4AT9 A;  3N97 B;  4RWP A;  4RZR A;  4QZB A;  3TFR A;  5KT5 A;  3NTU A;  5III A;  5IIK A;  2OWO A;  4GXK A;  2KFN A;  1BNP A;  4ECU A;  2DRB A;  5KFW A;  3PVX A;  2ZH4 A;  5J0Q A;  4J9M A;  3LDA A;  4MF8 A;  4GC7 A;  3JPS A;  2AJQ A;  2ZHA A;  1BNO A;  3KTQ A;  3C5F A;  4M6W B;  1Z00 B;  3GIK A;  2ZTE A;  5C5J A;  1UEV A;  4P2H A;  4UD4 A;  4I2J A;  4ECZ A;  3BJY A;  4B9T A;  4KLQ A;  4ED0 A;  5J0O A;  4K4G A;  1A77 A;  3GV8 B;  1V4A A;  2FPK A;  1SZP A;  1ZJM A;  1ZQZ A;  5DB8 A;  4IR9 A;  1JQR A;  4FHV A;  5HMM A;  1N48 A;  4F2S A;  4DF4 A;  1TFR A;  9ICA A;  4WBZ A;  4WC2 A;  1ZQX A;  5KFD A;  9ICC A;  4S3N A;  2W9M A;  1KEJ A;  5KFC A;  4F5O A;  4DSE A;  4DFM A;  4DFJ A;  2XY6 A;  1BPZ A;  3HIY A;  4TUR A;  5J2C A;  4NLG A;  5CHG A;  3HJ1 A;  8ICW A;  4DQS A;  4RQ1 A;  5J2I A;  5KFN A;  2KZM A;  4YCX A;  4DQR A;  4IRK A;  3RRH A;  4R63 A;  1RXV A;  1HUZ A;  4DSK A;  3RR8 A;  4X4R A;  5KFM A;  3MFI A;  3C2L A;  1NK5 A;  1H38 A;  7ICN A;  3Q8Q B;  2M2U A;  2Q0Z X;  2M2V A;  9ICM A;  1D8Y A;  4XA5 A;  4KN7 A;  2PFP A;  3LQC B;  2IHN A;  5IIN A;  3HP6 A;  4DL4 A;  1TFY A;  4LZD A;  5J2A A;  1Z3E B;  3MAB A;  5HML A;  4J9Q A;  4ED2 A;  4KMU A;  2LYH A;  4YFK A;  3B0Y A;  4RPY A;  3UQ2 A;  1NK9 A;  3C66 A;  1KDH A;  1ZYQ A;  4WC0 A;  4KLO A;  1SKR A;  2DRA A;  4K4H A;  5J0R A;  1ZQA A;  1UT8 A;  5CA7 A;  1ZQC A;  8ICJ A;  3PMN A;  2C2R A;  3QEA Z;  4UBC A;  3PR5 B;  5KG1 A;  4J9R A;  5KFZ A;  4M9N A;  4KLJ A;  7ICL A;  4F5R A;  2VA8 A;  4O3S A;  3IM1 A;  4O3O A;  4J9K A;  2XY7 A;  3PX0 A;  4O3R A;  5KG0 A;  7ICK A;  1TAQ A;  5KG5 A;  4NLZ A;  3OUY B;  4F4Z A;  5DG7 A;  2P66 A;  1NZP A;  1L5U A;  2AGO A;  5HRG A;  1S0O A;  2M2T A;  2DR7 A;  1X9W A;  4WC6 A;  5KFJ A;  1S77 D;  3JPR A;  1DK3 A;  2DVI A;  2ZH1 A;  2PFO A;  5CJ7 A;  4ED7 A;  2I9G A;  3SYZ A;  4ED6 A;  5DG9 A;  5DDM A;  2ZTC A;  4GXJ A;  1KLN A;  5CB1 A;  2JZB A;  4DF8 A;  4GLX A;  4RT2 A;  2BCS A;  3THV A;  3PO5 A;  4ATB A;  2JEJ A;  3ZD9 A;  1XSN A;  2ZUB A;  3Q8P B;  4IG8 A;  4UB2 A;  5KFY A;  5HP4 A;  2A1J A;  4O5E A;  3KHH A;  4O5K A;  5DB6 A;  2RDJ A;  3TAR A;  4LVS A;  2I1Q A;  3V7K A;  3OVA A;  3MBY A;  2O5A A;  4R8U A;  3MR3 A;  3C23 A;  3ORY A;  4IQT A;  3QZ8 A;  1NJW A;  3RBE A;  1LB2 B;  4J9O A;  4I2H A;  4RPZ A;  4Z6D A;  5BPC A;  2ISP A;  1UET A;  2KFZ A;  1BPD A;  1QTM A;  9ICT A;  3WFO A;  3FDS A;  9ICS A;  4QWB A;  4RWQ A;  3UXN A;  4Z6F A;  4IQW A;  1L3S A;  4R64 A;  3G6V A;  1R8B A;  3MDC A;  2RDI A;  1B43 A;  3OGU A;  2V4R A;  1RPL A;  1F5A A;  3WFQ E;  2FLN A;  3V6H A;  4ECQ A;  2AGP A;  1NJX A;  4O3N A;  4QWE A;  3H8J A;  4RQ0 A;  3H38 A;  2RFF A;  8ICP A;  4R65 A;  5DQH A;  1D9F A;  4NY8 A;  4JK1 A;  1TVA A;  1DOQ A;  2W9B B;  4JV1 A;  4M04 A;  4PHA A;  3MFH A;  2ZH3 A;  3TFS A;  4RPX A;  4J9S A;  5KTQ A;  1LV5 A;  2NRX A;  4YMN A;  4M9L A;  2UVV A;  4YQW A;  3EPG A;  4X0B A;  1KFS A;  4KIT B;  8ICX A;  3JPT A;  1JXL A;  1PZN A;  3WFP A;  4BGD A;  4M2Y A;  3GIM A;  5JUM A;  5J2J A;  8ICZ A;  2F1H A;  8ICI A;  3MR6 A;  3K4G A;  4O9M A;  2BCR A;  3PR4 A;  2XO7 A;  1SL1 A;  2HHT A;  4AT7 B;  9ICG A;  4QZC A;  3ZDB A;  1NJZ A;  2ZHB A;  5KFF A;  3KHG A;  1KNY A;  3RB0 A;  4X4O A;  1KSP A;  4MFA A;  4ECY A;  2AQ4 A;  3IHQ B;  4IRD A;  3RJJ A;  4Q8E A;  4ZH4 A;  4X4S A;  5KFE A;  2PXI A;  2BQR A;  4QZE A;  4RQ6 A;  4B9S A;  2PI4 A;  4KLL A;  1NJY A;  1WOT A;  2W9C B;  1TK8 A;  3PW2 A;  4IQU A;  1S76 D;  3ZDC A;  3H3A A;  3C2K A;  3MDA A;  4YXJ A;  1XC9 A;  4YMO A;  8ICB A;  2HVI A;  3RJF A;  2C2E A;  4QZ9 A;  1ZQP A;  3V7J A;  3JPP A;  2BPF A;  3EW9 A;  1ZQG A;  2VAN A;  4YR0 A;  3RH4 A;  3ZDD A;  1Q79 A;  4RNM A;  3OJU A;  2HHP A;  4C8N A;  1N56 A;  4RQ5 A;  3PW4 A;  3RJG A;  3ZDA A;  3ISB A;  4KLT A;  3OJS A;  1RXW A;  5F9N A;  4ECX A;  1MSW D;  3V7L A;  4M6W A;  1Z00 A;  4MFF A;  9ICO A;  3RB6 A;  4O5C A;  3GII A;  2ALZ A;  3TI0 A;  3RAQ A;  4QW9 A;  4ELU A;  1TV9 A;  4HYK A;  5TZV A;  3MR2 A;  3H8W A;  5DB9 A;  4RUC A;  1TAU A;  5DKW A;  1MIW A;  1R89 A;  1S10 A;  1U47 A;  3OVB A;  4FS2 A;  1X9S A;  7ICO A;  5KFB A;  3Q8S B;  2BDP A;  4ECS A;  1L3T A;  3M9N B;  5KT4 A;  4XQ7 A;  1ZQW A;  4UAW A;  2PI5 A;  3PW5 A;  5J0U A;  4DQQ A;  4YR2 A;  1ZQT A;  2F1I A;  4DEZ A;  1SL2 A;  4FBT A;  3PML A;  4EBE A;  9ICW A;  3H39 A;  1T7P A;  5KFS A;  1QSS A;  3OVS A;  4F4W A;  1T8E A;  3PV8 A;  5KT3 A;  1NK8 A;  2ZH7 A;  1NKE A;  1ZQO A;  1KRP A;  8ICS A;  2UVR A;  4DL2 A;  2HVH A;  5HRL A;  3H4B A;  4YXM A;  2FMS A;  3GIJ A;  4JV2 A;  5HRK A;  3BDP A;  5J0W A;  9ICV A;  3JZ0 A;  2FMQ A;  5KFA A;  3EYZ A;  3M8S A;  2J6U A;  4F4K A;  7ICJ A;  5BOM A;  5L9X A;  1ZQY A;  3OHB A;  2BR0 A;  4M0A A;  2KZZ A;  1UA0 A;  4DLE A;  1CEZ A;  2NRV A;  5KG2 A;  4F4Y A;  4FO6 A;  3GDX A;  3PX6 A;  4YR3 A;  3RH6 A;  4MFC A;  4RNN A;  4O0I A;  1S0V A;  1ZQB A;  8ICA A;  4F5Q A;  5HRD A;  8ICR A;  5EWF A;  3QEB Z;  5CWR A;  1ZQL A;  4I28 A;  4YN4 A;  3RJK A;  1EXN A;  2ZUC A;  5KT7 A;  1SKS A;  3C5G A;  1TKD A;  4FBU A;  8ICV A;  2GWS A;  4DL3 A;  1U9L A;  2XCP A;  4NKT A;  4WC3 A;  5J2D A;  3OUY A;  3LWL A;  2FLL A;  9ICP A;  5KG3 A;  9ICQ A;  1MIY A;  8ICY A;  4EYI B;  1ZQV A;  2ASJ A;  5KFH A;  2IA6 A;  1ZQM A;  7ICR A;  4EYH B;  2R8J A;  3BQT A;  4YD1 A;  2C28 A;  4GC6 A;  3RR7 A;  8ICN A;  4FHW A;  3EPI A;  3HX0 A;  1S0M A;  1BVS A;  4B9V A;  4TQS A;  2B21 A;  2ASL A;  5L1K A;  2HW3 A;  4EBJ A;  4B9L A;  2DFL A;  1B22 A;  2ZUD A;  4J9P A;  2IHM A;  1DGS A;  5CR0 A;  1C7Y A;  3RAX A;  2BHN A;  4I27 A;  3EZ5 A;  5IIO A;  4M9J A;  4RUA A;  4UB5 A;  3T5H A;  4XQ8 A;  5J0S A;  4WC1 A;  1Y88 A;  3RRG A;  4UB4 A;  4Z6C A;  2BCQ A;  3UPQ A;  2XY5 A;  2J6S A;  5DGA A;  2PFN A;  4BXO B;  4I2A A;  3PW0 A;  4RWO A;  4ED3 A;  4YMM A;  3H7I A;  4C8M A;  5KFO A;  4TUS A;  3AUO A;  3WFR E;  2R8K A;  4QWD A;  4K4I A;  1UEU A;  3L9D A;  4X0A A;  1A76 A;  1WCN A;  2ZJA A;  5CP2 A;  1MIV A;  4NLK A;  4Q8F A;  3AQL A;  4J9L A;  5IIM A;  5F2V O;  2KTQ A;  5DQI A;  1JXE A;  3RH5 A;  3GQC A;  8ICG A;  4I2C A;  2BQU A;  4RWN A;  3AQM A;  4ECR A;  1KTQ A;  2R8H A;  4KLI A;  3RJH A;  3AU2 A;  9ICE A;  2Q66 A;  4FHX A;  2P6R A;  4DS4 A;  2ATL A;  1ARO P;  5DBA A;  5KFI A;  4JV0 A;  8ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...