4NLNA

Structure of human dna polymerase beta complexed with nicked dna containing a template 8brg and incoming ctp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlnA03
3HP6A 4YD2A 4PGYA 4UAYA 4DSKA 2PXIA 2XC9A 3UQ2A 2BCRA 3ZDAA 4NY8A 4KN7A 1D9FA 2M9NA 4KLTA 3PNCA 2BQUA 1XU4A 5KFTA 4XRHA 1ZQQA 8ICCA 5KG3A 4B9LA 1ZQGA 4B9UA 1JQRA 4DLGA 1NO5A 4Z6DA 1S0VA 4B9SA 5HRIA 4M47A 4YN4A 1BPZA 4NLGA 1VFGA 4YQWA 1U48A 4EBDA 3G6XA 1NK4A 1NKCA 2VA8A 4RUAA 3OV7A 2ATLA 5IIMA 4IQVA 1U45A 9ICLA 4RPYA 8ICJA 3PMNA 4AT7B 4RQ3A 5KFNA 3H7IA 1DK3A 4B9NA 4MF8A 3AUOA 1H38A 3GILA 4PHPA 1S97A 3ZDBA 4BXOB 4J9PA 4M6WB 4JWMA 7ICPA 4QW8A 2M2UA 4J9LA 2ZH9A 2DR8A 3OVBA 2W8KA 2ID1A 3ZDDA 4WBYA 4EYHB 1RYSA 2VANA 3H40A 4UQGA 3JPRA 1T8EA 3BQ0A 4Z6EA 4HYKA 4LVSA 2O1PA 9ICJA 4I2AA 5J0SA 3B0XA 5EOZA 1BVSA 3FYHA 4RUCA 4ZH4A 5KG4A 1QTMA 1KSPA 1KFSA 4YFKA 1ZQSA 4KLGA 4E7XA 4BDPA 1TFWA 3H4BA 4QWCA 3FDSA 2PFNA 2KZ3A 2B21A 4ECYA 7ICVA 2NRXA 2R8IA 4P4OA 3C1ZA 3GIIA 1KTQA 2XY5A 4KLLA 2V4QA 3Q8QB 5J2BA 2IBKA 3RJJA 4F4KA 3H38A 4AT7A 3HT3A 2AGOA 8ICOA 2AQ0A 4J9MA 3T5LA 4QZAA 5BOMA 4GC7A 1QSSA 2I1QA 4X4RA 4J9QA 1JMSA 4GC6A 4BXOA 3JZ0A 3TANA 2AGPA 4M6WA 2BCUA 4KLEA 1WCLA 4YMOA 1X9SA 1ZQMA 4DFMA 3PX4A 1ZQLA 2AQ4A 3AQNA 4BWJA 5CB1A 2NRTA 4I2DA 3T5KA 4UD5A 4RNOA 9ICFA 4F93B 3V72A 3AQLA 5L1KA 3PO4A 5F9LA 1COOA 4F4WA 5KFKA 4TQSA 1XC9A 4MF2A 1S10A 4NLNA 2HHXA 4E80A 3Q8PB 2W8LA 3GFKB 4DQPA 3PW4A 1DK2A 2ZH7A 2J6UA 1S76D 1SL2A 2M2TA 4WC2A 1BPEA 4UAZA 7ICNA 4QZBA 2DRBA 5DB8A 3WFQE 3RAXA 2C2EA 4R63A 5JUMA 2HHTA 2DRAA 3PO5A 3MGHA 3ZD8A 3L9DA 3IHQB 3RH4A 1TKDA 3MBYA 1ZQBA 4LZGA 4P4MA 3TFSA 1KLNA 3RJEA 1UT5A 2HHWA 2W9AA 7ICIA 4AT9B 4DSFA 3OSNA 9ICTA 3BQ2A 1UT8A 4MFAA 3C21A 4NKTA 4X0AA 4JK1A 4G3IA 4DSJA 3MR3A 5DLFA 5J0PA 5KT6A 4UB5A 5KG2A 3TAQA 4R8UB 3TQ1A 1R89A 1ZQXA 4UD4A 4DQIA 5J2JA 4O3SA 1Z00B 5KFWA 4YXJA 2V4RA 1ZQYA 3TAPA 7ICRA 2NRZA 5J0OA 3H3AA 2BE3A 4ECVA 1NJYA 1SL1A 2BHNA 3SV3A 4YR2A 3MABA 1ZETA 3GIMA 3GQCA 2RDJA 1MC8A 5KFCA 2BCQA 1F5AA 4O3OA 1FA0A 3RJFA 2XO7A 5KFLA 3GDXA 1RZTA 9ICXA 5KFVA 4BWMA 4ECXA 1ZJMA 2P6RA 4M0AA 9ICKA 2KP7A 1R8BA 3UPSA 3BJYA 4AT8B 2BCVA 9ICWA 5DBBA 4O5CA 4RT2A 2DVIA 1VJ7A 3ORYA 4RPXA 4UAWA 3UPQA 5KT4A 3PW2A 1XSNA 1JXEA 4X4VA 4AT9A 3C2MA 4UB3A 3PMLA 3M9MB 5KFAA 1JIHA 2BDPA 1NKEA 4R64A 5J2AA 9ICBA 3MFHA 4ECQA 2BQRA 1L3TA 1ZQAA 4DOBA 5HRDA 4KLQA 4PGXA 4J9OA 3HJ4A 2NRKA 4X0BA 1WCNA 1T3NA 4ED8A 5DG8A 2GWSA 9ICQA 4DS5A 4WC3A 4Q8FA 2HHSA 4KLDA 4MEXA 4QWEA 1K1SA 3ISCA 1JXLA 4QZHA 4PH5A 5IIOA 4DLEA 5BOLA 5KFBA 4EZ9A 5EWEA 3JPNA 4AT8A 2AU0A 4F4ZA 4XA5A 4UB1A 1LV5A 2W9CB 2DPIA 9ICUA 2O5AA 5J2GA 4FBUA 5BPCA 8ICNA 1TAQA 5KG7A 2FPLA 5IIJA 4B9VA 4F92B 5DGAA 2HW3A 2FMQA 3RJIA 1KFTA 3G6VA 4I2HA 4RQ1A 1QSLA 4XQ7A 4R65A 4JWNA 1NJXA 1KDHA 4IR1A 8ICUA 1ZQKA 4I28A 4DSEA 5DQHA 4EYIB 1XSLA 1Q78A 3OUYB 3JPOA 2F1JA 3G6YA 4RQ2A 1RYRA 2W9BB 4KLHA 4FHWA 3V6HA 4RT3A 4QW9A 5L1IA 2JEGA 1ZQIA 4ED1A 2C2DA 5KT7A 4IRCA 8ICXA 5KFXA 7ICHA 3RH5A 4EBKA 4IRDA 1A76A 2BGWA 4KLIA 4P2HA 2ZTCA 4O3NA 3TARA 3MR2A 3RRGA 3KHGA 4I2BA 2ZH3A 2A1JB 2JEFA 4Q8EA 4RQ8A 3Q8KA 4YP3A 3PR4A 3PW7A 5EWFA 3M8RA 5CP2A 3HPOA 3RJHA 5HRGA 1V4AA 4WC0A 1N56A 2W9CA 3EYZA 1ZQNA 1NKBA 4DO9A 3MDAA 4NLZA 1NOMA 3OHBA 9ICGA 1MQ2A 2KTQA 5KT3A 4UBBA 2KN7A 2ZH5A 2ZH8A 3ZD9A 4DSLA 2ZUCA 1L5UA 4WC4A 4FS2A 9ICAA 2UVWA 4FH5A 2DPJA 2FPMA 3RRHA 1KEJA 2FPKA 2IHNA 1SL0A 1BNPA 3OUYA 3K4GA 8ICLA 2W9BA 2FLNA 4O3RA 8ICEA 3HIYA 2NRVA 4NLKA 2FLLA 1LB2B 3JPPA 1QSYA 4K4IA 4ECTA 1ZQWA 4I2IA 5DBAA 4DL2A 4WBZA 7ICKA 4DQSA 2R8JA 2ZHAA 1IXRA 2XGPA 3T5HA 4RWQA 9ICSA 5CJ7A 3ISDA 4TURA 1ZQVA 5KFJA 2A1JA 4QZ9A 9ICHA 4WC6A 3UXNA 3E2EA 1HJPA 4NM1A 1RXVA 3GV8B 3H8WA 4J9RA 4UB2A 1L3UA 3SYZA 5KFQA 3MDCA 3HJ1A 3BQ1A 4ATBB 4F50A 4YMMA 4ED0A 4EBCA 4TUPA 2XY7A 4M9HA 2HHVA 3RAQA 3N4MB 2C22A 5L1JA 1NJZA 1XS9D 4J9SA 4RPZA 3PR5B 4I2JA 4TUSA 5DG7A 4F5RA 4DEZA 2IMWP 8ICTA 7ICLA 3JPSA 4IQTA 3SV4A 2HVIA 5KFMA 3JPQA 2M2VA 4FHPA 2F1HA 4LT6A 4UB4A 4XUSA 1S0MA 4ELUA 3BQTA 3C23A 4ELVA 1UEVA 1ZQTA 1NK0A 2ZUDA 3UXPA 4DL6A 3PW5A 2PFOA 3LQCB 4WC7A 3PX0A 5HMLA 5J0QA 4M2YA 2BR0A 8ICGA 3C66A 2HHPA 4JV1A 4DL5A 2RFFA 5L9XA 4RQ6A 2BPGA 4M04A 5DBCA 1OU5A 3MR6A 5J0WA 4GXKA 3RBEA 4JV0A 4RQ5A 2J6TA 4X4UA 2R8HA 2PBEA 5DG9A 1DGSA 2MAXA 4O3QA 5CR0A 5HHIA 3Q8RB 5J2KA 4QZCA 5HNKA 4ECWA 4ED6A 3OGUA 4ED2A 5CHGA 4RNNA 3OVAA 4X4SA 8ICMA 5DGBA 3KHHA 3V7KA 1T4GA 3BDPA 4QZGA 4ED7A 3RB0A 7ICOA 2M2WA 4YXMA 5HRBA 3QEAZ 5KFFA 2FLPA 1NJWA 2MUTB 1BPDA 3KHLA 4I2EA 3RB3A 1MSWD 4O5EA 1NK8A 4EP7A 3Q8SB 2J6SA 3LWLA 4GLXA 5KFHA 3MR5A 4MEYA 2AJQA 5J2FA 3HW8A 2I9GA 4DFKA 2R8KA 5KFUA 2BPCA 5IIIA 1ZQDA 4IG8A 1ZYQA 2PFPA 4QWBA 1B43A 5J0YA 3C2LA 1U47A 4I29A 4F3OA 3M9OB 1BPYA 3RH6A 3AU6A 4TUQA 1S9FA 5J2CA 4C8LA 4CCHA 5DLGA 4FO6A 4NKUA 5HMMA 1S0NA 1PZNA 4IQUA 5DDMA 5KG5A 2VA2A 5J0UA 4JUZA 2ZH1A 1X2IA 4BGDA 2ZTEA 4ECRA 1T7PA 1UETA 2ZJAA 4R8UA 4J9NA 1KFDA 4DL4A 3Q8MA 4YMNA 4KITB 3NTUA 4UBCA 4PGQA 2C2RA 2HVHA 1Z00A 5DQGA 1NK7A 2ISPA 4LZDA 9ICVA 2MUTA 1ZQEA 4J9KA 1SKWA 1AROP 1U9LA 4M9LA 2P66A 1ZQHA 2ZUBA 4Q43A 5J29A 4ED3A 1BPBA 3RBDA 4GXJA 4MFCA 4ECUA 3LK9A 4YG2A 1U49A 1MIVA 3PY8A 3EW9A 5DKWA 3EPGA 4EZ6A 4KTQA 3IM1A 2R8GA 5HP4A 3GV5B 1MIYA 3H8SA 4DL7A 1XWLA 9ICOA 4RWPA 4O5KA 4NM2A 4PHEA 8ICSA 4IR9A 3QZ8A 1L3SA 2UVUA 2KFNA 4PHDA 4X4QA 3OVSA 1EXNA 3SZ2A 2DR9A 2C28A 5HRFA 2W9MA 5J0TA 3Q8LA 1ZQPA 4DSIA 4FBTA 4F5PA 2JEIA 3RR8A 2JZBB 2Y1JA 5KG1A 4QZ8A 5DDYA 1KNYA 2DFLA 4IQWA 2UVVA 4DQQA 5DB9A 3RR7A 2PFQA 2HHQA 4ECSA 1L3VA 4YR3A 4DF8A 3SI8A 3K75D 7ICUA 8ICAA 1QLNA 3RJKA 8ICHA 4I2CA 4ATBA 5D4BA 4F8RA 4QZFA 3GIJA 5KFSA 2V9WA 4WC5A 4KN4A 3UXOA 3ZDEA 5CWRA 1HUOA 7ICMA 4M9JA 2XCAA 4F5QA 3MFIA 3H39A 5HHHA 5KFRA 1XO1A 4TQRA 5KFOA 3JPTA 5J2IA 2ASJA 3EPIA 1UA1A 4PHAA 1MIWA 5HRHA 5KFGA 1N48A 8ICKA 4RNMA 1TK0A 2ZJ8A 1NK9A 3OJSA 8ICPA 5HR9A 2IHMA 5KFIA 8ICWA 4QZIA 3RTVA 1BNOA 3B0YA 3T3FA 4RQ4A 1HUZA 3ETLA 3OSPA 8ICRA 5HRLA 3AQMA 1ZQZA 5J0XA 4FHYA 2JZBA 2BQ3A 2ZTDA 3UQ0A 1X9WA 3H8JA 3LDAA 1ZQCA 4O9MA 4X4PA 4DS4A 4KLMA 3V7LA 3NGDA 3KHRA 5TZVA 1ZQJA 3WFOA 3C18A 2ZJ5A 8ICIA 3RB6A 2UVRA 1S77D 4KLJA 2FMPA 5KT2A 4DOAA 1JN3A 5IIKA 1V9PA 5KG0A 3M9NB 1MQ3A 3M8SA 2PI5A 1PX5A 3PVXA 4PPXA 2NRWA 5J2DA 1JAJA 4K4GA 4C8MA 5HREA 2ZH2A 3QE9Y 1IM4A 4Q44A 4M9GA 7ICGA 4QWDA 3V6KA 4I2FA 1TAUA 2XY6A 4I2GA 5F9NA 3OJUA 4F4YA 7ICSA 2JEJA 9ICMA 4YVZA 2H5XA 3TFRA 4DWIA 3NYBA 1ZQUA 1XSPA 4S3NA 1TFRA 2RDIA 1UA0A 2PI4A 1D9DA 4DQRA 4Q45A 3C5GA 3AQKA 5KFEA 3C5FA 4RQ7A 1SKSA 1BGXT 1TFYA 4QZEA 4F5NA 5HRKA 4E0DA 4Z6FA 5DB7A 5DQIA 3THVA 2Q0ZX 1A77A 4RQ0A 2OWOA 4IRKA 3EZ5A 3T5JA 3H37A 4EBJA 3JYYA 2ASDA 5J2HA 3V7JA 3TI0A 1NZPA 5KFDA 2Y1IA 1K1QA 3PW0A 3RB4A 2ALZA 4WCWA 2ISOA 4FHVA 2XGQA 5IINA 4B9TA 1WOTA 4FHXA 4DFPA 1TK5A 7ICJA 1SZPA 1DOQA 4RZRA 7ICTA 9ICRA 2ZH4A 5HC9A 3LWMA 4X4TA 3AU2A 2VA3A 5KTQA 3PX6A 8ICBA 2HHUA 5DEDA 5C5JA 1KRPA 4ELTA 3EWAA 1Q79A 1C7YA 4F4XA 1SKRA 2IA6A 1Y88A 5J0RA 1ZQRA 4F2SA 9ICCA 1R8CA 1CEZA 8ICZA 5F2VO 4F5OA 4DFJA 3ISBA 1BPXA 2WTFA 5L1LA 4I27A 9ICNA 9ICPA 4EEYA 2KZZA 2Q66A 3QEBZ 3WFSC 4YR0A 4R66A 3KTQA 7ICFA 1D8LA 1B22A 9ICIA 9ICEA 3QZ7A 3GIKA 4KMUA 3RJGA 1UEUA 2LYHA 4F2RA 4GXIA 4DOCA 3V6JA 1JX4A 4X4OA 4RWNA 4NXZA 1NK6A 5KFZA 5CA7A 1TK8A 5DECA 4YCXA 1RXWA 5DB6A 5KG6A 2BKEA 2F1IA 2FMSA 4Z6CA 4F91B 4ECZA 1TV9A 1TVAA 2BCSA 4C8KA 4RU9A 4P4PA 4O3PA 4KLUA 1R8AA 4X4NA 7ICEA 1YLQA 4DL3A 5IILA 3OHAA 4E8FA 4X5VA 1ZJNA 2BPFA 4K4HA 7ICQA 3C2KA 5D46A 4FS1A 1X9MA 4C8OA 2DR7A 4QWAA 8ICFA 5EWGA 2AGQA 1CUKA 4M9NA 4WC1A 3C1YA 5KFYA 4EBEA 2XCPA 1S0OA 2ZH6A 2P6UA 4QZDA 3N97B 4YD1A 8ICVA 5KFPA 8ICYA 4M5DA 3PV8A 1D8YA 5J2EA 1ZQFA 4C8NA 4KLOA 3WFPA 4KLFA 5D49A 1RPLA 3GV7B 3WFRE 4MFFA 2KZMA 8ICQA 4JV2A 1ZQOA 4KLSA 4RWOA 2ZHBA 3H4DA 2ASLA 1Z3EB 3HX0A 4DF4A 3MGIA 1U4BA 1NK5A 2DR5A 5KT5A 3HWTA 2KFZA 4O0IA 3ZDCA 4FH3A 4B9MA 4XQ8A
chains in the Genus database with same CATH superfamily
3HP6A 4YD2A 4DSKA 1KN5A 3ZDAA 2BQUA 1XU4A 5KFTA 3E58A 5AKIA 8ICCA 4B9LA 1ZQGA 1NI3A 4B9SA 3M6ZA 2JR5A 4M47A 4YN4A 3G6XA 1NKCA 1KKXA 2VA8A 4RPYA 3IRUA 8ICJA 1OW5A 5AKJA 4RQ3A 5T14A 3H7IA 5JRTA 4MF8A 1H38A 4PHPA 4LEYA 4J9PA 2LKYA 4UARA 3ZDDA 5AKZA 3H40A 1S8OA 4UQGA 3GU3A 1T8EA 4I2AA 2WF7A 2EZZA 4RUCA 4ZH4A 4E7XA 3L4PA 4QWCA 3FDSA 4ECYA 4P4OA 2ODGA 2YY6A 2IBKA 3RJJA 3UMGA 4EX6A 2KEYA 4QZAA 1QSSA 4J9QA 1JMSA 3JZ0A 3WK9A 2YTUA 4EX7A 3ERCC 1ZQMA 2EQYA 3PX4A 3NRZA 5AKGA 2F3NA 1QH9A 4RQNA 4TQSA 3Q8PB 4C4SA 3PW4A 1SL2A 2GLEA 2C2EA 1N60A 2DRAA 3MGHA 3IHQB 3RH4A 3MBYA 1ZQBA 1KLNA 4EV6A 2W9AA 3QX7A 1RQLA 1N62A 5KT6A 3F2DA 3TQ1A 1WWVA 1ZQXA 4DQIA 1IG6A 1PK1B 7ICRA 5J0OA 4ECVA 1RDFA 5KFCA 2RDJA 2BCQA 2XO7A 5KFLA 2WB1F 2P6RA 2RP5A 5KT4A 3PW2A 1ZD3A 1NKEA 5HRDA 1UQVA 1PK1A 3PZPA 2JV3A 9ICQA 4DS5A 4C4RA 4MEXA 4QWEA 3KFUF 3ISCA 4PH5A 2DWQA 2W3SA 5KFBA 1CRXA 2PMZF 4XA5A 5ALJA 2DPIA 2GA9D 5J2GA 4FBUA 5BPCA 8ICNA 1TAQA 5KG7A 4MHVA 5IIJA 3MCRA 5DGAA 2FMQA 3E0FA 4JWNA 1KDHA 8ICUA 4I28A 4EYIB 3JPOA 2F1JA 3G6YA 1ZQIA 4IRDA 2KIWA 2OCEA 1A76A 3QU4A 3TARA 3RRGA 2ZH3A 4YP3A 3RJHA 3M8RA 3HPOA 2KSOB 4NLZA 1NOMA 3CW2C 9ICGA 2K4IA 2KN7A 2ZH5A 4NXTA 2DL0A 2ZUCA 5AI6A 1N5XA 2IHNA 3RRHA 3SEIA 3K4GA 2FLNA 4O3RA 1L7PA 5ALZA 1QSYA 4K4IA 5DBAA 4ICAA 1O03A 3QUBA 1IXRA 2XGPA 3T5HA 4WQLA 5AI5A 5KFJA 2KMDA 4NM1A 1RXVA 1LVHA 2QLTA 4UB2A 1L3UA 4M9HA 5G5GA 2C22A 3K7DA 3K1RB 2IMWP 1L8OA 4F5RA 4DEZA 3HKZC 4LT6A 1YZ6A 3SV4A 3CYMA 1A6SA 2H3IA 4OJ6A 3BQTA 1N5WA 3OPXA 4NWIA 1ZQTA 2ZUDA 3UXPA 2KVSA 3T79A 1VJ5A 3BQ7A 5ALXA 2KKPA 2HHPA 2IOFA 2AHOB 3L5KA 1F44A 1RYUA 2RFFA 4GXKA 4X4UA 4JV0A 4RQ5A 3RJIA 4UD4A 3OVAA 3MC1A 4ED2A 2Y0SC 2PKEA 4YXMA 3SENA 3QEAZ 5KFFA 2MUTB 5AI8A 3QYPA 4EP7A 2YB1A 3Q8SB 5J2FA 3HW8A 3KZXA 5L1MA 4UW9A 2R8KA 5KFUA 2BPCA 3ALRA 5ALKA 4IG8A 5J0YA 1U47A 4I29A 2K4EA 4FO1A 2LPEA 5J2CA 2N1RA 4NL9A 3B9JA 4NKUA 5HMMA 2D3DA 1PZNA 4IQUA 2VA2A 5KG5A 2HOIA 4K99A 2ZH1A 4ECRA 4BGDA 2ZTEA 4ELVA 1JRPA 3Q8MA 1PUZA 4UBCA 2ISPA 4B6JA 4LZDA 2MUTA 1PVQA 4J9KA 4OJOA 2E8NA 4M9LA 1ZQHA 5J29A 1OXJA 4F71A 4NXXA 3LK9A 4N7RA 5HR6A 1MIVA 2XIDA 2EAMA 4EZ6A 4KTQA 5AI9A 1Z1BA 3GV5B 1MIYA 4DL7A 3NKUA 3CK6A 3QNMA 4RWPA 2F8KA 4PHDA 4X4QA 2VKQA 2C28A 2JEIA 3J81j 5EE0A 4CF5A 5KAFU 2Y1JA 5DDYA 5JTIA 2DFLA 2HCFA 3QUQA 4PJ0U 3RJKA 4WC5A 2QARB 2V9WA 2XCAA 3F5EA 3MFIA 4FFDA 1VFGA 5J2IA 3EPIA 1J2MA 4PHAA 1N48A 5CFSA 4RNMA 1TK0A 2ZJ8A 3OJSA 5KFIA 2B56A 8ICWA 4QZIA 3RTVA 5HRLA 5ALMA 1ZQZA 5J0XA 4FHYA 4QIWF 2P35A 3H8JA 1ZQCA 4O9MA 4X4PA 3H8MA 2QARA 1J2NA 4US8A 1JN3A 2KICA 3AQEA 1QQ6A 2NRWA 3QE9Y 4M9GA 7ICGA 2KV2A 3V6KA 3CP8A 4JB3A 4OAGA 2I5HA 3TFRA 2OYYA 4GIBA 1TFRA 1UA0A 2PI4A 1S5LU 3C5GA 2RRDA 5AM3A 3C5FA 4RQ7A 5HRKA 4Z6FA 3THVA 2OWOA 4ATBA 4IRKA 2WF8A 4UB6U 5J8YA 2ASDA 5CHEA 2W55A 3RF9A 1KW4A 2WAQF 2ISOA 2XGQA 5IINA 4FHXA 1AQ6A 2ZG6A 1DOQA 4OJLA 4RZRA 7ICJA 9ICRA 2ZH4A 8ICBA 5C5JA 1KRPA 1C7YA 4F4XA 2IA6A 1Y88A 5J0RA 1ZQRA 4F2SA 8ICZA 2WF5A 4DFJA 4BJQA 1BPXA 3M7DA 9ICPA 4J03A 4EEYA 3NVOA 3WFSC 4YR0A 2EWRA 4KMUA 3RJGA 2ZIWB 4FZLA 5KFZA 3SQIA 1C20A 5DB6A 4Z6CA 4O3PA 4KLUA 2KJ9A 1R8AA 5C0YA 2AH5A 4AYBC 1YLQA 5AK5A 4E8FA 1ZJNA 2DGZA 4K4HA 3AQFA 5D46A 3C2KA 2K89A 5ALYA 2P6UA 4KX5A 4YD1A 3PV8A 4A8EA 5D49A 3WFRE 4RWOA 2ZHBA 1Z3EB 1U4BA 5KT5A 3UQ2A 4EELA 1SZHA 2HN1A 5KG3A 2IOFK 4B9UA 3VCBA 4DLGA 1NO5A 4Z6DA 1S0VA 2JH7A 5ALNA 1U48A 1NK4A 4RUAA 2ATLA 9ICLA 2BBJA 1DK3A 3GILA 1S97A 7ICPA 3OVBA 4J9LA 4EGWA 4WBYA 2VIXA 3OTQA 4EYHB 3GZFA 2EANA 2O1PA 4Z6EA 4HYKA 1QTMA 3B0XA 5EOZA 3FYHA 1J97A 1KFSA 2KHQA 3H4BA 2JMGA 2KZ3A 7ICVA 2RQ5A 2FCLA 2NRXA 2FE9A 3C1ZA 3GIIA 2EH9A 1FFUA 4F4KA 8ICOA 4X4RA 4GC7A 1WCLA 1Q8KA 1X9SA 2AQ4A 5CB1A 3WK7A 3QU2A 1FO4A 5TISU 3V72A 2AXTU 5L1KA 4O3MA 5KFKA 3H0MB 1XC9A 1S10A 4NLNA 2HHXA 4E80A 2D8CA 4DQPA 1S76D 4UAZA 7ICNA 4QZBA 2DRBA 3WFQE 3QUCA 2XVTA 2HOQA 4R63A 2JGAA 3ZD8A 1NNLA 1TKDA 2K8CB 2DKZA 2W04A 4LZGA 3TFSA 2E1EA 2HHWA 4DSFA 4WH5A 2K8BB 3F2CA 1UT8A 3C21A 2ES6A 1R89A 4R8UB 5ALLA 1Z00B 3TAPA 2YN4A 5GTHU 5KL8B 4C4TA 3CRXA 3H0RB 5D62A 3GIMA 3GQCA 4WC1A 4O3OA 3RJFA 1RZTA 9ICXA 3ED5A 1R8BA 4ECXA 1ZJMA 4K9AA 1SIJA 2BCVA 9ICWA 5E79U 4RPXA 4X4VA 3C2MA 3M9MB 3D2NA 2DUYA 5KFAA 4Y2SA 1Q3UA 4ECQA 1L3TA 4Y2YA 2F77X 4KMOB 1WCNA 4ED8A 5DG8A 5AK3A 4XJEA 4WC3A 4Q8FA 3SAFA 3ICXA 3IDWA 4QZHA 4DLEA 1NZBA 2GAFD 5EWEA 1LV5A 3NRWA 9ICUA 2FI1A 3PSTA 4NLBA 1TE2A 5B66U 4I2HA 3IG5A 2HBMA 1ZQKA 1XSLA 1FIQA 1Q78A 2EZXA 3A0BU 4BUGA 4C7ZA 3V6HA 5L1IA 2JEGA 3CNHA 2KKVA 4ED1A 5KT7A 5KFXA 4EBKA 2BGWA 2MU2A 2ZTCA 3MR2A 1ZRMA 2A1JB 1SWVA 4Q8EA 4RQ8A 3PR4A 4EEBA 3TADC 4PZNA 1N56A 3MDAA 1ZOLA 2B6GA 2NV3A 4FS2A 9ICAA 2UVWA 4FH5A 2FPKA 3NS1A 2NRVA 3WKEA 3AEVA 1ZQWA 4DL2A 4WBZA 2R8JA 2B4VA 3F53A 1X6JA 4RWQA 4TURA 1LKYB 1ZQVA 5CRXA 4Y2TA 3KBBA 2A1JA 9ICHA 3UXNA 3ZI4A 1HJPA 3GV8B 4J9RA 3SYZA 5KFQA 4AYBF 3IN5A 4FE3A 2YB4A 2EZYA 1F0MA 4TUPA 2XY7A 4J9SA 4TUSA 8ICTA 1S0MA 2G08A 4ELUA 3C23A 3N7SC 4DL6A 2ZIXB 2G09A 5HMLA 3PX0A 2BR0A 4JMUA 1LKYA 2BPGA 1OU5A 2WHEA 5J0WA 5CR0A 3Q8RB 2DF4B 4ECWA 5J2KA 5HNKA 3OGUA 4RNNA 2ESEA 1T4GA 4QZGA 4ED7A 3RB0A 7ICOA 5HRBA 2FLPA 5ALHA 3KHLA 1MSWD 4NLCA 2A3VA 5AM4A 2J6SA 4MEYA 5AKYA 4DFKA 2ZIXA 1ZYQA 4QWBA 4U6PA 2OEHA 3HILA 3AU6A 4CCHA 4C80A 1S0NA 5DDMA 1X66A 1T7PA 2ZJAA 1KFDA 4YMNA 5ALSA 2HVHA 1NK7A 1X9XA 1U9LA 2P66A 3FM9A 5J8YC 4ECUA 3EW9A 2XICA 2R8GA 1QQ5A 3AMZA 4O5KA 4NM2A 4PHEA 2UVUA 1EXNA 3U26A 5AKKA 2A19A 3QXGA 1ZQPA 4F5PA 2JZBB 4CF3A 1N61A 2HHQA 3RR7A 5HR7A 2PFQA 1L3VA 4K98A 5D4BA 4F8RA 3GIJA 5KFSA 4KN4A 7ICMA 4M9JA 5AKEA 2MA1A 3H39A 3JPTA 1M6YA 1XO1A 5KFRA 5KFOA 4TQRA 2ASJA 1PVRA 4C8LA 1WG8A 5KFGA 5AM2A 1NK9A 4RQ4A 3ETLA 8ICRA 3AQMA 2JZBA 2FJ6A 3K1ZA 1HEKA 3NGDA 1ZQJA 4Y2UA 3C18A 8ICIA 3RB6A 3HJEA 2KSOA 2W03A 5KG0A 3PVXA 4PPXA 5B3PA 1PVPA 1ZRNA 1IM4A 2E8PA 1SWWA 3FC4A 2XY6A 4I2GA 1Q46A 5F9NA 4K8VA 7ICSA 2YQEA 9ICMA 5AK4A 2H3ZA 1ZQUA 3LVVA 4Q45A 1SKSA 1BGXT 3WK8A 3UM9A 4E0DA 1K5OA 3EUB2 3HJ1A 2VJ4A 4EBJA 2KHVA 3T5JA 3H37A 4EENA 1NZPA 3QU5A 5AKHA 2Y1IA 2ALZA 2HMXA 4B9TA 1SZPA 4O67A 5HC9A 2VA3A 3KZIU 5AKLA 5KTQA 2HHUA 4ELTA 3EWAA 1SKRA 3NWIA 4PL1A 1R8CA 3EF2A 2G5HB 3S6JA 2WTFA 5L1LA 9ICNA 1ED1A 3KTQA 5KNIA 2KJ8A 1B22A 9ICEA 3GIKA 2Y9TA 2LYHA 3NASA 4GXIA 4DOCA 4DFDA 2OH2A 5CA7A 4P0QB 2ZIVB 2F1IA 1TVAA 4NXUA 4OAHA 2K8AA 4X4NA 5ALGA 4NV0A 7ICEA 4X5VA 4AP9A 2KVCA 2YX8A 1CUKA 4M9NA 1S0OA 4QZDA 1WUDA 1GPJA 3N97B 1UHUA 4CRXA 3GV7B 4P0QA 4MFFA 1ZQOA 3HX0A 4DF4A 3MGIA 5GTIU 4B9MA 2NO4A 4XQ8A 4UAYA 2PXIA 2BCRA 4KN7A 2M9NA 5ALOA 3SAGA 3PNCA 3NVZA 4XRHA 1ZQQA 5A0LA 1JQRA 3D2SA 1F5SA 3FAHA 3QU7A 1BPZA 4NLGA 4EBDA 3D2QA 5EE1A 3NVWA 5IIMA 1U45A 3PMNA 5KFNA 2OM6A 3QUTA 4KX3A 4B9NA 3AUOA 1IIPA 4BXOB 1X40A 3ZDBA 2M2UA 4QW8A 2ZH9A 2ID1A 1JROA 2VANA 1X6IA 1L6NA 2CPRA 3JPRA 9ICJA 4BDPA 2KOBA 2FDRA 2PFNA 2B21A 4ZOHC 1KTQA 5B5EU 2QKQA 3UMBA 2XY5A 2V4QA 4KLLA 5J2BA 3H38A 2AGOA 2AQ0A 3WK6A 3T5LA 5BOMA 2I1QA 3BZKA 4BXOA 1N63A 2KK0A 4YMOA 3AQNA 4BWJA 4I2DA 2W3RA 4F93B 4MKPA 3AQLA 3VC8A 5F9LA 2W8LA 1OUQA 1DK2A 2ZH7A 2YMPA 2M2TA 3O0FA 4Y2VA 5DB8A 5D63A 3PO5A 3L9DA 4P4MA 3RJEA 1UT5A 7ICIA 2OXOA 3OSNA 9ICTA 4Y2PA 4JK1A 4G3IA 5DLFA 5J0PA 5KG2A 1IV8A 5J2JA 2V4RA 4YXJA 1ZQYA 2BE3A 1NJYA 1T3QA 1SL1A 2BHNA 1L8LA 4IC9A 3MABA 1ZETA 1F5AA 3H3AA 1FA0A 1MC8A 3GDXA 4I0UA 3I76A 5KFVA 2KP7A 9ICKA 4K97A 4AT8B 5DBBA 4O5CA 4RT2A 2DVIA 3ORYA 4UAWA 1JXEA 4WQKA 2QB0B 3PMLA 2K4PA 5J2AA 3MFHA 2BQRA 4LEWA 4NXVA 1ZQAA 2CXYA 4KLQA 3LYSA 2NYVA 2W43A 1SGGA 2DKXA 2ZXIA 3HJ4A 2KD1A 2ZIWA 3ER9B 2K4HA 2VJ5A 1K1SA 1JXLA 2ZIUB 3HKZF 3WK5A 1P7DA 3QU9A 1D8BA 5IIOA 2B51A 4AT8A 4Y2RA 2CN1A 4UB1A 2W9CB 2O5AA 2FPLA 3M1YA 4B9VA 5AI4A 4F92B 2HW3A 4LEVA 3WKAA 2EAPA 2QB0A 4CNQA 1N2XA 1KFTA 3SAHA 1QSLA 4R65A 1NJXA 4IR1A 2JHDA 5ALEA 2E8OA 2Q4TA 4KLHA 2W9BB 2RHFA 4QW9A 2Y0SF 4IRCA 8ICXA 1JUDA 1A0PA 3DDHA 2ZIUA 4KLIA 4I2BA 3AL0B 3KHGA 4UAVA 3Q8KA 3PW7A 4WC0A 5CP2A 1ZD2P 2W9CA 1NKBA 4DO9A 5ALRA 2KTQA 3AM9A 2LM4A 5KT3A 2ZH8A 5G5HA 1L5UA 4HX0A 2FPMA 2WB1C 1KEJA 4EEDA 1SL0A 2LYBA 3SD7A 8ICLA 2W9BA 8ICEA 3HIYA 4CE6A 2FLLA 1LB2B 3JPPA 4I2IA 2ZHAA 7ICKA 4C0ZA 4NXWA 5CJ7A 3ISDA 5H2FU 4WC6A 5AIAA 2G06A 1KL9A 3H8WA 4F50A 2MRLA 4YMMA 4EBCA 2HHVA 3RAQA 1NJZA 5L1JA 1XS9D 4RPZA 3PR5B 5DG7A 7ICLA 3JPSA 4IQTA 5KFMA 2DBYA 1HIWA 4FHPA 3BS5B 2PMZC 1UEVA 2PFOA 3LQCB 4WC7A 8ICGA 3JCFA 4RQ6A 4M04A 1Z4NA 3MR6A 2KE7A 3RBEA 2J6TA 4USAA 4Y2XA 2PBEA 4IS7A 1DGSA 5DG9A 4KLEA 3N28A 5CHGA 4Y2JA 2E8MA 5DGBA 4QNLA 3BDPA 4O68A 2M2WA 4Y2QA 4I2EA 3RB3A 4O5EA 1NK8A 3BS5A 3LWLA 5KFHA 3MR5A 2AJQA 2W7OA 2I9GA 3PHZA 4OO1J 5IIIA 1ZQDA 2F8LA 2PFPA 2G5IB 4F3OA 3M9OB 1BPYA 5DLGA 2QB1A 2LM1A 5J0UA 4JUZA 1X2IA 1UETA 4R8UA 4J9NA 1ECWA 3NTUA 9ICVA 1Z00A 1B4FA 1ZQEA 2YMLA 1COKA 1SKWA 5CEHA 2ZUBA 4ED3A 3DEEA 5AI0A 5F3XB 4YG2A 2I6XA 1U49A 3IP4B 5DKWA 3H8SA 9ICOA 8ICSA 1L3SA 5AIBA 3SZ2A 2DR9A 5HRFA 2W9MA 4DSIA 4WJ3B 3RR8A 2F44A 4QZ8A 4IQWA 4NL9C 2UVVA 1L7NA 5DB9A 4ECSA 1CI4A 2HBKA 3K75D 1QLNA 4I2CA 4QZFA 5CWRA 3UXOA 2OHFA 2JH1A 4F5QA 3KKAA 5HHHA 8ICKA 2H3VA 1KQQA 8ICPA 2BDUA 4OJ5A 4UATA 1DGJA 1GO3F 2KG5A 3B0YA 2ZXHA 3T3FA 1HUZA 5ALIA 5AM0A 4BX9C 2ZTDA 1X9WA 3MGVA 3F2BA 4KLMA 3V7LA 5TZVA 3ETRA 5ALFA 2UVRA 1S77D 1Z4OA 4KLJA 2FMPA 2H3QA 3M9NB 5IIKA 1JI7A 1V9PA 1MQ3A 2PI5A 3M8SA 5J2DA 1ZQ1C 3F5AA 4K4GA 4C8MA 5HREA 4Q44A 2LBOA 4I2FA 1TAUA 4LEZA 4F4YA 4O69A 4K96A 1RQNA 2H5XA 2JXJA 4DWIA 1Q3VA 3NYBA 3M6KA 4CDGA 1XSPA 2RDIA 4DQRA 4FZNA 4P0PB 5KFEA 3NVVA 2Q0ZX 1A77A 1VLBA 3V7JA 5KFDA 1K1QA 3RB4A 4FHVA 7ICTA 3LWMA 2HSZA 2F76X 5DEDA 1Q79A 2G07A 9ICCA 4P0PA 5AHXA 4I27A 4NJ8A 2KZZA 2HN2A 4R66A 7ICFA 1D8LA 3QZ7A 4QIWC 1UEUA 5ALPA 1JX4A 4RWNA 2IUBA 4NXZA 5K4LA 1RXWA 1SXDA 2FMSA 5FP0A 4O6AA 4ECZA 2BCSA 4P4PA 4WOYA 1PK3A 2K60A 1YZ7A 5IILA 1SV0A 3WU2U 7ICQA 4C8OA 2DR7A 8ICFA 2AGQA 3C1YA 1WYGA 2XCPA 3I1YA 2ZH6A 2B0CA 3BS7A 2GH1A 4UAUA 4M5DA 5KFPA 1ZQFA 3WFPA 2KZMA 8ICQA 4KLSA 1MN8A 3H4DA 4JLZA 3HWTA 3ZDCA 5ALTA 4QJFB 4PGYA 2XC9A 2LI6A 4NY8A 1D9FA 4KLTA 5JTGA 2WAQC 3C28A 4CGZA 5HRIA 2Z7JA 2R18A 4YQWA 3OV7A 2LYAA 4IQVA 2KJ5A 4AT7B 2W11A 5HRHA 4JWMA 4M6WB 2DR8A 2W8KA 1WWUA 1RYSA 2KIVA 3BQ0A 3PSFA 3LVWA 4LVSA 5J0SA 1KSPA 1BVSA 5KG4A 5ALVA 4KLGA 4YFKA 1ZQSA 1TFWA 3WKCA 2BZFA 4OCZA 2R8IA 5CFUA 3Q8QB 2D6FC 4AT7A 3HT3A 4J9MA 4IL6U 4GC6A 3TANA 2AGPA 4M6WA 2BCUA 4DFMA 1ZQLA 2NRTA 3T5KA 4UD5A 4RNOA 9ICFA 1T94A 4DCCA 3PO4A 1COOA 4F4WA 1FFVA 4MF2A 2A1AA 2GO7A 2HBJA 1YT3A 3GFKB 4US9A 3PSPA 2DQNB 2J6UA 5AM1A 1BPEA 3RAXA 5JUMA 2HHTA 3IG8A 4AT9B 3BQ2A 4MFAA 4NKTA 4X0AA 2BBHA 4DSJA 3MR3A 3L3FX 4UB5A 3TAQA 4O3SA 5KFWA 2NRZA 3SV3A 4YR2A 3DV9A 5D61A 4M0AA 4BWMA 3UPSA 3BJYA 3TKAA 5KL1B 1VJ7A 2IHOA 3UPQA 1XSNA 4AT9A 2WF9A 4UB3A 4KM5A 1JIHA 2BDPA 4R64A 5AICA 9ICBA 4PL2A 2NO5A 2E3TA 4DOBA 4UASA 4PGXA 2XI9A 3TADA 1DRGA 3H0LB 4J9OA 2NRKA 4X0BA 1T3NA 2GWSA 2WFAA 2E1FA 2H3FA 2ZIVA 4EEKA 2HHSA 4KLDA 4RQMA 2O6KA 4F72A 1KBUA 5BOLA 4EZ9A 3JPNA 2IOHA 2AU0A 4F4ZA 3WK4A 2KNJA 5AKXA 3C29A 3N7PD 3G6VA 2L5YA 4RQ1A 4XQ7A 4DSEA 5DQHA 5ALDA 5ALUA 3OUYB 1RYRA 4RQ2A 2LHTA 2YMQA 4FHWA 4RT3A 2C2DA 4LJXA 7ICHA 3RH5A 1SB3C 4P2HA 4O3NA 2JEFA 4KB6A 5EWFA 5HRGA 1V4AA 2HI0A 1ZQNA 3EYZA 3OHBA 1XO0A 1MQ2A 4UBBA 3ZD9A 4DSLA 4WC4A 2DPJA 1BNPA 3OUYA 4NLKA 4ECTA 4DQSA 9ICSA 5EE3A 1UCVA 3WKDA 4QZ9A 3E2EA 3MDCA 3ONNA 3BQ1A 2HOFA 4ATBB 4ED0A 3N4MB 1TAMA 2YMMA 4I2JA 2HVIA 2M2VA 1URJA 3JPQA 2F1HA 4UB4A 4XUSA 2LMRA 3KKAC 1NK0A 3PW5A 2RLTA 5ALWA 4M2YA 5J0QA 3C66A 1ZD4A 2Y9UA 4JV1A 4FZMA 4DL5A 5L9XA 5DBCA 1SXEA 2G0AA 2M0NA 2R8HA 2MAXA 4O3QA 5HHIA 4WC2A 4C7YA 4QZCA 4ED6A 1VDVA 1QQ7A 3OWGA 8ICMA 4X4SA 5AM5A 4ACOA 3KHHA 3V7KA 4OJPA 2MSNA 4UB8U 1NJWA 1BPDA 1ZD5A 2W54A 2GOLA 4GLXA 1B43A 3SR6A 3BZCA 2F2AB 3C2LA 3RH6A 4TUQA 1S9FA 4FO6A 3N7RC 2EAOA 5CFTA 4DL4A 4PGQA 4KITB 2C2RA 5DQGA 1L7OA 1AROP 1ZXIA 4K9BA 4Q43A 1L7MA 4CF4A 3TACB 1BPBA 3RBDA 4GXJA 4MFCA 3HRDD 3SMVA 5AK6A 3PY8A 3EPGA 3NVYA 2EDUA 3IM1A 1Z19A 5HP4A 1XWLA 4IR9A 3QZ8A 2KFNA 3OVSA 1MA7A 3Q8LA 5J0TA 4FBTA 5KG1A 1KNYA 3A0HU 4DQQA 5JU5A 4YR3A 4DF8A 2JRZA 3SI8A 2HDOA 7ICUA 8ICAA 8ICHA 3ZDEA 1HUOA 3AN1A 1UA1A 1MIWA 3I28A 5HR9A 2IHMA 3ER8C 1BNOA 1SV0C 3OSPA 5ALQA 1QCKA 2BQ3A 1Z1VA 3UQ0A 3LDAA 4DS4A 3KHRA 3WFOA 2W7PA 1V97A 2ZJ5A 5KT2A 4DOAA 1PX5A 1JAJA 2ZH2A 1X42A 1RG6A 4QWDA 4JLXA 3NUQA 5EE9A 3OJUA 1B0XA 1O08A 3UMCA 2JEJA 4YVZA 5B3QA 4S3NA 2CRXA 1D9DA 3AQKA 1TFYA 4QZEA 4F5NA 3WKBA 5DB7A 5DQIA 4RQ0A 3EZ5A 3JYYA 3PSIA 5J2HA 3TI0A 3PW0A 1DXSA 4WCWA 1WOTA 4DFPA 1TK5A 4X4TA 1JALA 3AU2A 3PX6A 3R9KA 1CEZA 4OAIZ 5F2VO 4F5OA 2E5SA 3ISBA 1V85A 3IV6A 2Q66A 3QEBZ 9ICIA 3KOOA 4F2RA 3V6JA 4X4OA 2WF6A 1NK6A 3RFAA 1TK8A 5DECA 3KD3A 4YCXA 5KG6A 2BKEA 4F91B 3D6JA 1TV9A 4C8KA 4RU9A 1FEZA 4DL3A 3OHAA 1UPHA 2BPFA 4OD0A 4FS1A 1X9MA 2HBLA 4QWAA 4U7CA 5EWGA 4PZOA 5KFYA 5KAIU 4EBEA 1V38A 1RM6C 8ICVA 8ICYA 4OAFA 1D8YA 5J2EA 1XNSA 4C8NA 4KLOA 4KLFA 1RPLA 4JV2A 1SV4A 2ASLA 4GFJA 1NK5A 4G9BA 2DR5A 2KFZA 4O0IA 4FH3A 4HAIA
chains in the Genus database with same CATH topology
3HP6A 4YD2A 4PGYA 4UAYA 4DSKA 2PXIA 2XC9A 3UQ2A 2BCRA 3ZDAA 4NY8A 4KN7A 1D9FA 2M9NA 4KLTA 3PNCA 2BQUA 1XU4A 5KFTA 4XRHA 1ZQQA 8ICCA 5KG3A 4B9LA 1ZQGA 4B9UA 1JQRA 4DLGA 1NO5A 4Z6DA 1S0VA 4B9SA 5HRIA 4M47A 4YN4A 1BPZA 4NLGA 1VFGA 4YQWA 1U48A 4EBDA 3G6XA 1NK4A 1NKCA 2VA8A 4RUAA 3OV7A 2ATLA 5IIMA 4IQVA 1U45A 9ICLA 4RPYA 8ICJA 3PMNA 4AT7B 4RQ3A 5KFNA 3H7IA 1DK3A 4B9NA 4MF8A 3AUOA 1H38A 3GILA 4PHPA 1S97A 3ZDBA 4BXOB 4J9PA 4M6WB 4JWMA 7ICPA 4QW8A 2M2UA 4J9LA 2ZH9A 2DR8A 3OVBA 2W8KA 2ID1A 3ZDDA 4WBYA 4EYHB 1RYSA 2VANA 3H40A 4UQGA 3JPRA 1T8EA 3BQ0A 4Z6EA 4HYKA 4LVSA 2O1PA 9ICJA 4I2AA 5J0SA 3B0XA 5EOZA 1BVSA 3FYHA 4RUCA 4ZH4A 5KG4A 1QTMA 1KSPA 1KFSA 4YFKA 1ZQSA 4KLGA 4E7XA 4BDPA 1TFWA 3H4BA 4QWCA 3FDSA 2PFNA 2KZ3A 2B21A 4ECYA 7ICVA 2NRXA 2R8IA 4P4OA 3C1ZA 3GIIA 1KTQA 2XY5A 4KLLA 2V4QA 3Q8QB 5J2BA 2IBKA 3RJJA 4F4KA 3H38A 4AT7A 3HT3A 2AGOA 8ICOA 2AQ0A 4J9MA 3T5LA 4QZAA 5BOMA 4GC7A 1QSSA 2I1QA 4X4RA 4J9QA 1JMSA 4GC6A 4BXOA 3JZ0A 3TANA 2AGPA 4M6WA 2BCUA 4KLEA 1WCLA 4YMOA 1X9SA 1ZQMA 4DFMA 3PX4A 1ZQLA 2AQ4A 3AQNA 4BWJA 5CB1A 2NRTA 4I2DA 3T5KA 4UD5A 4RNOA 9ICFA 4F93B 3V72A 3AQLA 5L1KA 3PO4A 5F9LA 1COOA 4F4WA 5KFKA 4TQSA 1XC9A 4MF2A 1S10A 4NLNA 2HHXA 4E80A 3Q8PB 2W8LA 3GFKB 4DQPA 3PW4A 1DK2A 2ZH7A 2J6UA 1S76D 1SL2A 2M2TA 4WC2A 1BPEA 4UAZA 7ICNA 4QZBA 2DRBA 5DB8A 3WFQE 3RAXA 2C2EA 4R63A 5JUMA 2HHTA 2DRAA 3PO5A 3MGHA 3ZD8A 3L9DA 3IHQB 3RH4A 1TKDA 3MBYA 1ZQBA 4LZGA 4P4MA 3TFSA 1KLNA 3RJEA 1UT5A 2HHWA 2W9AA 7ICIA 4AT9B 4DSFA 3OSNA 9ICTA 3BQ2A 1UT8A 4MFAA 3C21A 4NKTA 4X0AA 4JK1A 4G3IA 4DSJA 3MR3A 5DLFA 5J0PA 5KT6A 4UB5A 5KG2A 3TAQA 4R8UB 3TQ1A 1R89A 1ZQXA 4UD4A 4DQIA 5J2JA 4O3SA 1Z00B 5KFWA 4YXJA 2V4RA 1ZQYA 3TAPA 7ICRA 2NRZA 5J0OA 3H3AA 2BE3A 4ECVA 1NJYA 1SL1A 2BHNA 3SV3A 4YR2A 3MABA 1ZETA 3GIMA 3GQCA 2RDJA 1MC8A 5KFCA 2BCQA 1F5AA 4O3OA 1FA0A 3RJFA 2XO7A 5KFLA 3GDXA 1RZTA 9ICXA 5KFVA 4BWMA 4ECXA 1ZJMA 2P6RA 4M0AA 9ICKA 2KP7A 1R8BA 3UPSA 3BJYA 4AT8B 2BCVA 9ICWA 5DBBA 4O5CA 4RT2A 2DVIA 1VJ7A 3ORYA 4RPXA 4UAWA 3UPQA 5KT4A 3PW2A 1XSNA 1JXEA 4X4VA 4AT9A 3C2MA 4UB3A 3PMLA 3M9MB 5KFAA 1JIHA 2BDPA 1NKEA 4R64A 5J2AA 9ICBA 3MFHA 4ECQA 2BQRA 1L3TA 1ZQAA 4DOBA 5HRDA 4KLQA 4PGXA 4J9OA 3HJ4A 2NRKA 4X0BA 1WCNA 1T3NA 4ED8A 5DG8A 2GWSA 9ICQA 4DS5A 4WC3A 4Q8FA 2HHSA 4KLDA 4MEXA 4QWEA 1K1SA 3ISCA 1JXLA 4QZHA 4PH5A 5IIOA 4DLEA 5BOLA 5KFBA 4EZ9A 5EWEA 3JPNA 4AT8A 2AU0A 4F4ZA 4XA5A 4UB1A 1LV5A 2W9CB 2DPIA 9ICUA 2O5AA 5J2GA 4FBUA 5BPCA 8ICNA 1TAQA 5KG7A 2FPLA 5IIJA 4B9VA 4F92B 5DGAA 2HW3A 2FMQA 3RJIA 1KFTA 3G6VA 4I2HA 4RQ1A 1QSLA 4XQ7A 4R65A 4JWNA 1NJXA 1KDHA 4IR1A 8ICUA 1ZQKA 4I28A 4DSEA 5DQHA 4EYIB 1XSLA 1Q78A 3OUYB 3JPOA 2F1JA 3G6YA 4RQ2A 1RYRA 2W9BB 4KLHA 4FHWA 3V6HA 4RT3A 4QW9A 5L1IA 2JEGA 1ZQIA 4ED1A 2C2DA 5KT7A 4IRCA 8ICXA 5KFXA 7ICHA 3RH5A 4EBKA 4IRDA 1A76A 2BGWA 4KLIA 4P2HA 2ZTCA 4O3NA 3TARA 3MR2A 3RRGA 3KHGA 4I2BA 2ZH3A 2A1JB 2JEFA 4Q8EA 4RQ8A 3Q8KA 4YP3A 3PR4A 3PW7A 5EWFA 3M8RA 5CP2A 3HPOA 3RJHA 5HRGA 1V4AA 4WC0A 1N56A 2W9CA 3EYZA 1ZQNA 1NKBA 4DO9A 3MDAA 4NLZA 1NOMA 3OHBA 9ICGA 1MQ2A 2KTQA 5KT3A 4UBBA 2KN7A 2ZH5A 2ZH8A 3ZD9A 4DSLA 2ZUCA 1L5UA 4WC4A 4FS2A 9ICAA 2UVWA 4FH5A 2DPJA 2FPMA 3RRHA 1KEJA 2FPKA 2IHNA 1SL0A 1BNPA 3OUYA 3K4GA 8ICLA 2W9BA 2FLNA 4O3RA 8ICEA 3HIYA 2NRVA 4NLKA 2FLLA 1LB2B 3JPPA 1QSYA 4K4IA 4ECTA 1ZQWA 4I2IA 5DBAA 4DL2A 4WBZA 7ICKA 4DQSA 2R8JA 2ZHAA 1IXRA 2XGPA 3T5HA 4RWQA 9ICSA 5CJ7A 3ISDA 4TURA 1ZQVA 5KFJA 2A1JA 4QZ9A 9ICHA 4WC6A 3UXNA 3E2EA 1HJPA 4NM1A 1RXVA 3GV8B 3H8WA 4J9RA 4UB2A 1L3UA 3SYZA 5KFQA 3MDCA 3HJ1A 3BQ1A 4ATBB 4F50A 4YMMA 4ED0A 4EBCA 4TUPA 2XY7A 4M9HA 2HHVA 3RAQA 3N4MB 2C22A 5L1JA 1NJZA 1XS9D 4J9SA 4RPZA 3PR5B 4I2JA 4TUSA 5DG7A 4F5RA 4DEZA 2IMWP 8ICTA 7ICLA 3JPSA 4IQTA 3SV4A 2HVIA 5KFMA 3JPQA 2M2VA 4FHPA 2F1HA 4LT6A 4UB4A 4XUSA 1S0MA 4ELUA 3BQTA 3C23A 4ELVA 1UEVA 1ZQTA 1NK0A 2ZUDA 3UXPA 4DL6A 3PW5A 2PFOA 3LQCB 4WC7A 3PX0A 5HMLA 5J0QA 4M2YA 2BR0A 8ICGA 3C66A 2HHPA 4JV1A 4DL5A 2RFFA 5L9XA 4RQ6A 2BPGA 4M04A 5DBCA 1OU5A 3MR6A 5J0WA 4GXKA 3RBEA 4JV0A 4RQ5A 2J6TA 4X4UA 2R8HA 2PBEA 5DG9A 1DGSA 2MAXA 4O3QA 5CR0A 5HHIA 3Q8RB 5J2KA 4QZCA 5HNKA 4ECWA 4ED6A 3OGUA 4ED2A 5CHGA 4RNNA 3OVAA 4X4SA 8ICMA 5DGBA 3KHHA 3V7KA 1T4GA 3BDPA 4QZGA 4ED7A 3RB0A 7ICOA 2M2WA 4YXMA 5HRBA 3QEAZ 5KFFA 2FLPA 1NJWA 2MUTB 1BPDA 3KHLA 4I2EA 3RB3A 1MSWD 4O5EA 1NK8A 4EP7A 3Q8SB 2J6SA 3LWLA 4GLXA 5KFHA 3MR5A 4MEYA 2AJQA 5J2FA 3HW8A 2I9GA 4DFKA 2R8KA 5KFUA 2BPCA 5IIIA 1ZQDA 4IG8A 1ZYQA 2PFPA 4QWBA 1B43A 5J0YA 3C2LA 1U47A 4I29A 4F3OA 3M9OB 1BPYA 3RH6A 3AU6A 4TUQA 1S9FA 5J2CA 4C8LA 4CCHA 5DLGA 4FO6A 4NKUA 5HMMA 1S0NA 1PZNA 4IQUA 5DDMA 5KG5A 2VA2A 5J0UA 4JUZA 2ZH1A 1X2IA 4BGDA 2ZTEA 4ECRA 1T7PA 1UETA 2ZJAA 4R8UA 4J9NA 1KFDA 4DL4A 3Q8MA 4YMNA 4KITB 3NTUA 4UBCA 4PGQA 2C2RA 2HVHA 1Z00A 5DQGA 1NK7A 2ISPA 4LZDA 9ICVA 2MUTA 1ZQEA 4J9KA 1SKWA 1AROP 1U9LA 4M9LA 2P66A 1ZQHA 2ZUBA 4Q43A 5J29A 4ED3A 1BPBA 3RBDA 4GXJA 4MFCA 4ECUA 3LK9A 4YG2A 1U49A 1MIVA 3PY8A 3EW9A 5DKWA 3EPGA 4EZ6A 4KTQA 3IM1A 2R8GA 5HP4A 3GV5B 1MIYA 3H8SA 4DL7A 1XWLA 9ICOA 4RWPA 4O5KA 4NM2A 4PHEA 8ICSA 4IR9A 3QZ8A 1L3SA 2UVUA 2KFNA 4PHDA 4X4QA 3OVSA 1EXNA 3SZ2A 2DR9A 2C28A 5HRFA 2W9MA 5J0TA 3Q8LA 1ZQPA 4DSIA 4FBTA 4F5PA 2JEIA 3RR8A 2JZBB 2Y1JA 5KG1A 4QZ8A 5DDYA 1KNYA 2DFLA 4IQWA 2UVVA 4DQQA 5DB9A 3RR7A 2PFQA 2HHQA 4ECSA 1L3VA 4YR3A 4DF8A 3SI8A 3K75D 7ICUA 8ICAA 1QLNA 3RJKA 8ICHA 4I2CA 4ATBA 5D4BA 4F8RA 4QZFA 3GIJA 5KFSA 2V9WA 4WC5A 4KN4A 3UXOA 3ZDEA 5CWRA 1HUOA 7ICMA 4M9JA 2XCAA 4F5QA 3MFIA 3H39A 5HHHA 5KFRA 1XO1A 4TQRA 5KFOA 3JPTA 5J2IA 2ASJA 3EPIA 1UA1A 4PHAA 1MIWA 5HRHA 5KFGA 1N48A 8ICKA 4RNMA 1TK0A 2ZJ8A 1NK9A 3OJSA 8ICPA 5HR9A 2IHMA 5KFIA 8ICWA 4QZIA 3RTVA 1BNOA 3B0YA 3T3FA 4RQ4A 1HUZA 3ETLA 3OSPA 8ICRA 5HRLA 3AQMA 1ZQZA 5J0XA 4FHYA 2JZBA 2BQ3A 2ZTDA 3UQ0A 1X9WA 3H8JA 3LDAA 1ZQCA 4O9MA 4X4PA 4DS4A 4KLMA 3V7LA 3NGDA 3KHRA 5TZVA 1ZQJA 3WFOA 3C18A 2ZJ5A 8ICIA 3RB6A 2UVRA 1S77D 4KLJA 2FMPA 5KT2A 4DOAA 1JN3A 5IIKA 1V9PA 5KG0A 3M9NB 1MQ3A 3M8SA 2PI5A 1PX5A 3PVXA 4PPXA 2NRWA 5J2DA 1JAJA 4K4GA 4C8MA 5HREA 2ZH2A 3QE9Y 1IM4A 4Q44A 4M9GA 7ICGA 4QWDA 3V6KA 4I2FA 1TAUA 2XY6A 4I2GA 5F9NA 3OJUA 4F4YA 7ICSA 2JEJA 9ICMA 4YVZA 2H5XA 3TFRA 4DWIA 3NYBA 1ZQUA 1XSPA 4S3NA 1TFRA 2RDIA 1UA0A 2PI4A 1D9DA 4DQRA 4Q45A 3C5GA 3AQKA 5KFEA 3C5FA 4RQ7A 1SKSA 1BGXT 1TFYA 4QZEA 4F5NA 5HRKA 4E0DA 4Z6FA 5DB7A 5DQIA 3THVA 2Q0ZX 1A77A 4RQ0A 2OWOA 4IRKA 3EZ5A 3T5JA 3H37A 4EBJA 3JYYA 2ASDA 5J2HA 3V7JA 3TI0A 1NZPA 5KFDA 2Y1IA 1K1QA 3PW0A 3RB4A 2ALZA 4WCWA 2ISOA 4FHVA 2XGQA 5IINA 4B9TA 1WOTA 4FHXA 4DFPA 1TK5A 7ICJA 1SZPA 1DOQA 4RZRA 7ICTA 9ICRA 2ZH4A 5HC9A 3LWMA 4X4TA 3AU2A 2VA3A 5KTQA 3PX6A 8ICBA 2HHUA 5DEDA 5C5JA 1KRPA 4ELTA 3EWAA 1Q79A 1C7YA 4F4XA 1SKRA 2IA6A 1Y88A 5J0RA 1ZQRA 4F2SA 9ICCA 1R8CA 1CEZA 8ICZA 5F2VO 4F5OA 4DFJA 3ISBA 1BPXA 2WTFA 5L1LA 4I27A 9ICNA 9ICPA 4EEYA 2KZZA 2Q66A 3QEBZ 3WFSC 4YR0A 4R66A 3KTQA 7ICFA 1D8LA 1B22A 9ICIA 9ICEA 3QZ7A 3GIKA 4KMUA 3RJGA 1UEUA 2LYHA 4F2RA 4GXIA 4DOCA 3V6JA 1JX4A 4X4OA 4RWNA 4NXZA 1NK6A 5KFZA 5CA7A 1TK8A 5DECA 4YCXA 1RXWA 5DB6A 5KG6A 2BKEA 2F1IA 2FMSA 4Z6CA 4F91B 4ECZA 1TV9A 1TVAA 2BCSA 4C8KA 4RU9A 4P4PA 4O3PA 4KLUA 1R8AA 4X4NA 7ICEA 1YLQA 4DL3A 5IILA 3OHAA 4E8FA 4X5VA 1ZJNA 2BPFA 4K4HA 7ICQA 3C2KA 5D46A 4FS1A 1X9MA 4C8OA 2DR7A 4QWAA 8ICFA 5EWGA 2AGQA 1CUKA 4M9NA 4WC1A 3C1YA 5KFYA 4EBEA 2XCPA 1S0OA 2ZH6A 2P6UA 4QZDA 3N97B 4YD1A 8ICVA 5KFPA 8ICYA 4M5DA 3PV8A 1D8YA 5J2EA 1ZQFA 4C8NA 4KLOA 3WFPA 4KLFA 5D49A 1RPLA 3GV7B 3WFRE 4MFFA 2KZMA 8ICQA 4JV2A 1ZQOA 4KLSA 4RWOA 2ZHBA 3H4DA 2ASLA 1Z3EB 3HX0A 4DF4A 3MGIA 1U4BA 1NK5A 2DR5A 5KT5A 3HWTA 2KFZA 4O0IA 3ZDCA 4FH3A 4B9MA 4XQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HP6 A;  4YD2 A;  4PGY A;  4UAY A;  4DSK A;  2PXI A;  2XC9 A;  3UQ2 A;  2BCR A;  3ZDA A;  4NY8 A;  4KN7 A;  1D9F A;  2M9N A;  4KLT A;  3PNC A;  2BQU A;  1XU4 A;  5KFT A;  4XRH A;  1ZQQ A;  8ICC A;  5KG3 A;  4B9L A;  1ZQG A;  4B9U A;  1JQR A;  4DLG A;  1NO5 A;  4Z6D A;  1S0V A;  4B9S A;  5HRI A;  4M47 A;  4YN4 A;  1BPZ A;  4NLG A;  1VFG A;  4YQW A;  1U48 A;  4EBD A;  3G6X A;  1NK4 A;  1NKC A;  2VA8 A;  4RUA A;  3OV7 A;  2ATL A;  5IIM A;  4IQV A;  1U45 A;  9ICL A;  4RPY A;  8ICJ A;  3PMN A;  4AT7 B;  4RQ3 A;  5KFN A;  3H7I A;  1DK3 A;  4B9N A;  4MF8 A;  3AUO A;  1H38 A;  3GIL A;  4PHP A;  1S97 A;  3ZDB A;  4BXO B;  4J9P A;  4M6W B;  4JWM A;  7ICP A;  4QW8 A;  2M2U A;  4J9L A;  2ZH9 A;  2DR8 A;  3OVB A;  2W8K A;  2ID1 A;  3ZDD A;  4WBY A;  4EYH B;  1RYS A;  2VAN A;  3H40 A;  4UQG A;  3JPR A;  1T8E A;  3BQ0 A;  4Z6E A;  4HYK A;  4LVS A;  2O1P A;  9ICJ A;  4I2A A;  5J0S A;  3B0X A;  5EOZ A;  1BVS A;  3FYH A;  4RUC A;  4ZH4 A;  5KG4 A;  1QTM A;  1KSP A;  1KFS A;  4YFK A;  1ZQS A;  4KLG A;  4E7X A;  4BDP A;  1TFW A;  3H4B A;  4QWC A;  3FDS A;  2PFN A;  2KZ3 A;  2B21 A;  4ECY A;  7ICV A;  2NRX A;  2R8I A;  4P4O A;  3C1Z A;  3GII A;  1KTQ A;  2XY5 A;  4KLL A;  2V4Q A;  3Q8Q B;  5J2B A;  2IBK A;  3RJJ A;  4F4K A;  3H38 A;  4AT7 A;  3HT3 A;  2AGO A;  8ICO A;  2AQ0 A;  4J9M A;  3T5L A;  4QZA A;  5BOM A;  4GC7 A;  1QSS A;  2I1Q A;  4X4R A;  4J9Q A;  1JMS A;  4GC6 A;  4BXO A;  3JZ0 A;  3TAN A;  2AGP A;  4M6W A;  2BCU A;  4KLE A;  1WCL A;  4YMO A;  1X9S A;  1ZQM A;  4DFM A;  3PX4 A;  1ZQL A;  2AQ4 A;  3AQN A;  4BWJ A;  5CB1 A;  2NRT A;  4I2D A;  3T5K A;  4UD5 A;  4RNO A;  9ICF A;  4F93 B;  3V72 A;  3AQL A;  5L1K A;  3PO4 A;  5F9L A;  1COO A;  4F4W A;  5KFK A;  4TQS A;  1XC9 A;  4MF2 A;  1S10 A;  4NLN A;  2HHX A;  4E80 A;  3Q8P B;  2W8L A;  3GFK B;  4DQP A;  3PW4 A;  1DK2 A;  2ZH7 A;  2J6U A;  1S76 D;  1SL2 A;  2M2T A;  4WC2 A;  1BPE A;  4UAZ A;  7ICN A;  4QZB A;  2DRB A;  5DB8 A;  3WFQ E;  3RAX A;  2C2E A;  4R63 A;  5JUM A;  2HHT A;  2DRA A;  3PO5 A;  3MGH A;  3ZD8 A;  3L9D A;  3IHQ B;  3RH4 A;  1TKD A;  3MBY A;  1ZQB A;  4LZG A;  4P4M A;  3TFS A;  1KLN A;  3RJE A;  1UT5 A;  2HHW A;  2W9A A;  7ICI A;  4AT9 B;  4DSF A;  3OSN A;  9ICT A;  3BQ2 A;  1UT8 A;  4MFA A;  3C21 A;  4NKT A;  4X0A A;  4JK1 A;  4G3I A;  4DSJ A;  3MR3 A;  5DLF A;  5J0P A;  5KT6 A;  4UB5 A;  5KG2 A;  3TAQ A;  4R8U B;  3TQ1 A;  1R89 A;  1ZQX A;  4UD4 A;  4DQI A;  5J2J A;  4O3S A;  1Z00 B;  5KFW A;  4YXJ A;  2V4R A;  1ZQY A;  3TAP A;  7ICR A;  2NRZ A;  5J0O A;  3H3A A;  2BE3 A;  4ECV A;  1NJY A;  1SL1 A;  2BHN A;  3SV3 A;  4YR2 A;  3MAB A;  1ZET A;  3GIM A;  3GQC A;  2RDJ A;  1MC8 A;  5KFC A;  2BCQ A;  1F5A A;  4O3O A;  1FA0 A;  3RJF A;  2XO7 A;  5KFL A;  3GDX A;  1RZT A;  9ICX A;  5KFV A;  4BWM A;  4ECX A;  1ZJM A;  2P6R A;  4M0A A;  9ICK A;  2KP7 A;  1R8B A;  3UPS A;  3BJY A;  4AT8 B;  2BCV A;  9ICW A;  5DBB A;  4O5C A;  4RT2 A;  2DVI A;  1VJ7 A;  3ORY A;  4RPX A;  4UAW A;  3UPQ A;  5KT4 A;  3PW2 A;  1XSN A;  1JXE A;  4X4V A;  4AT9 A;  3C2M A;  4UB3 A;  3PML A;  3M9M B;  5KFA A;  1JIH A;  2BDP A;  1NKE A;  4R64 A;  5J2A A;  9ICB A;  3MFH A;  4ECQ A;  2BQR A;  1L3T A;  1ZQA A;  4DOB A;  5HRD A;  4KLQ A;  4PGX A;  4J9O A;  3HJ4 A;  2NRK A;  4X0B A;  1WCN A;  1T3N A;  4ED8 A;  5DG8 A;  2GWS A;  9ICQ A;  4DS5 A;  4WC3 A;  4Q8F A;  2HHS A;  4KLD A;  4MEX A;  4QWE A;  1K1S A;  3ISC A;  1JXL A;  4QZH A;  4PH5 A;  5IIO A;  4DLE A;  5BOL A;  5KFB A;  4EZ9 A;  5EWE A;  3JPN A;  4AT8 A;  2AU0 A;  4F4Z A;  4XA5 A;  4UB1 A;  1LV5 A;  2W9C B;  2DPI A;  9ICU A;  2O5A A;  5J2G A;  4FBU A;  5BPC A;  8ICN A;  1TAQ A;  5KG7 A;  2FPL A;  5IIJ A;  4B9V A;  4F92 B;  5DGA A;  2HW3 A;  2FMQ A;  3RJI A;  1KFT A;  3G6V A;  4I2H A;  4RQ1 A;  1QSL A;  4XQ7 A;  4R65 A;  4JWN A;  1NJX A;  1KDH A;  4IR1 A;  8ICU A;  1ZQK A;  4I28 A;  4DSE A;  5DQH A;  4EYI B;  1XSL A;  1Q78 A;  3OUY B;  3JPO A;  2F1J A;  3G6Y A;  4RQ2 A;  1RYR A;  2W9B B;  4KLH A;  4FHW A;  3V6H A;  4RT3 A;  4QW9 A;  5L1I A;  2JEG A;  1ZQI A;  4ED1 A;  2C2D A;  5KT7 A;  4IRC A;  8ICX A;  5KFX A;  7ICH A;  3RH5 A;  4EBK A;  4IRD A;  1A76 A;  2BGW A;  4KLI A;  4P2H A;  2ZTC A;  4O3N A;  3TAR A;  3MR2 A;  3RRG A;  3KHG A;  4I2B A;  2ZH3 A;  2A1J B;  2JEF A;  4Q8E A;  4RQ8 A;  3Q8K A;  4YP3 A;  3PR4 A;  3PW7 A;  5EWF A;  3M8R A;  5CP2 A;  3HPO A;  3RJH A;  5HRG A;  1V4A A;  4WC0 A;  1N56 A;  2W9C A;  3EYZ A;  1ZQN A;  1NKB A;  4DO9 A;  3MDA A;  4NLZ A;  1NOM A;  3OHB A;  9ICG A;  1MQ2 A;  2KTQ A;  5KT3 A;  4UBB A;  2KN7 A;  2ZH5 A;  2ZH8 A;  3ZD9 A;  4DSL A;  2ZUC A;  1L5U A;  4WC4 A;  4FS2 A;  9ICA A;  2UVW A;  4FH5 A;  2DPJ A;  2FPM A;  3RRH A;  1KEJ A;  2FPK A;  2IHN A;  1SL0 A;  1BNP A;  3OUY A;  3K4G A;  8ICL A;  2W9B A;  2FLN A;  4O3R A;  8ICE A;  3HIY A;  2NRV A;  4NLK A;  2FLL A;  1LB2 B;  3JPP A;  1QSY A;  4K4I A;  4ECT A;  1ZQW A;  4I2I A;  5DBA A;  4DL2 A;  4WBZ A;  7ICK A;  4DQS A;  2R8J A;  2ZHA A;  1IXR A;  2XGP A;  3T5H A;  4RWQ A;  9ICS A;  5CJ7 A;  3ISD A;  4TUR A;  1ZQV A;  5KFJ A;  2A1J A;  4QZ9 A;  9ICH A;  4WC6 A;  3UXN A;  3E2E A;  1HJP A;  4NM1 A;  1RXV A;  3GV8 B;  3H8W A;  4J9R A;  4UB2 A;  1L3U A;  3SYZ A;  5KFQ A;  3MDC A;  3HJ1 A;  3BQ1 A;  4ATB B;  4F50 A;  4YMM A;  4ED0 A;  4EBC A;  4TUP A;  2XY7 A;  4M9H A;  2HHV A;  3RAQ A;  3N4M B;  2C22 A;  5L1J A;  1NJZ A;  1XS9 D;  4J9S A;  4RPZ A;  3PR5 B;  4I2J A;  4TUS A;  5DG7 A;  4F5R A;  4DEZ A;  2IMW P;  8ICT A;  7ICL A;  3JPS A;  4IQT A;  3SV4 A;  2HVI A;  5KFM A;  3JPQ A;  2M2V A;  4FHP A;  2F1H A;  4LT6 A;  4UB4 A;  4XUS A;  1S0M A;  4ELU A;  3BQT A;  3C23 A;  4ELV A;  1UEV A;  1ZQT A;  1NK0 A;  2ZUD A;  3UXP A;  4DL6 A;  3PW5 A;  2PFO A;  3LQC B;  4WC7 A;  3PX0 A;  5HML A;  5J0Q A;  4M2Y A;  2BR0 A;  8ICG A;  3C66 A;  2HHP A;  4JV1 A;  4DL5 A;  2RFF A;  5L9X A;  4RQ6 A;  2BPG A;  4M04 A;  5DBC A;  1OU5 A;  3MR6 A;  5J0W A;  4GXK A;  3RBE A;  4JV0 A;  4RQ5 A;  2J6T A;  4X4U A;  2R8H A;  2PBE A;  5DG9 A;  1DGS A;  2MAX A;  4O3Q A;  5CR0 A;  5HHI A;  3Q8R B;  5J2K A;  4QZC A;  5HNK A;  4ECW A;  4ED6 A;  3OGU A;  4ED2 A;  5CHG A;  4RNN A;  3OVA A;  4X4S A;  8ICM A;  5DGB A;  3KHH A;  3V7K A;  1T4G A;  3BDP A;  4QZG A;  4ED7 A;  3RB0 A;  7ICO A;  2M2W A;  4YXM A;  5HRB A;  3QEA Z;  5KFF A;  2FLP A;  1NJW A;  2MUT B;  1BPD A;  3KHL A;  4I2E A;  3RB3 A;  1MSW D;  4O5E A;  1NK8 A;  4EP7 A;  3Q8S B;  2J6S A;  3LWL A;  4GLX A;  5KFH A;  3MR5 A;  4MEY A;  2AJQ A;  5J2F A;  3HW8 A;  2I9G A;  4DFK A;  2R8K A;  5KFU A;  2BPC A;  5III A;  1ZQD A;  4IG8 A;  1ZYQ A;  2PFP A;  4QWB A;  1B43 A;  5J0Y A;  3C2L A;  1U47 A;  4I29 A;  4F3O A;  3M9O B;  1BPY A;  3RH6 A;  3AU6 A;  4TUQ A;  1S9F A;  5J2C A;  4C8L A;  4CCH A;  5DLG A;  4FO6 A;  4NKU A;  5HMM A;  1S0N A;  1PZN A;  4IQU A;  5DDM A;  5KG5 A;  2VA2 A;  5J0U A;  4JUZ A;  2ZH1 A;  1X2I A;  4BGD A;  2ZTE A;  4ECR A;  1T7P A;  1UET A;  2ZJA A;  4R8U A;  4J9N A;  1KFD A;  4DL4 A;  3Q8M A;  4YMN A;  4KIT B;  3NTU A;  4UBC A;  4PGQ A;  2C2R A;  2HVH A;  1Z00 A;  5DQG A;  1NK7 A;  2ISP A;  4LZD A;  9ICV A;  2MUT A;  1ZQE A;  4J9K A;  1SKW A;  1ARO P;  1U9L A;  4M9L A;  2P66 A;  1ZQH A;  2ZUB A;  4Q43 A;  5J29 A;  4ED3 A;  1BPB A;  3RBD A;  4GXJ A;  4MFC A;  4ECU A;  3LK9 A;  4YG2 A;  1U49 A;  1MIV A;  3PY8 A;  3EW9 A;  5DKW A;  3EPG A;  4EZ6 A;  4KTQ A;  3IM1 A;  2R8G A;  5HP4 A;  3GV5 B;  1MIY A;  3H8S A;  4DL7 A;  1XWL A;  9ICO A;  4RWP A;  4O5K A;  4NM2 A;  4PHE A;  8ICS A;  4IR9 A;  3QZ8 A;  1L3S A;  2UVU A;  2KFN A;  4PHD A;  4X4Q A;  3OVS A;  1EXN A;  3SZ2 A;  2DR9 A;  2C28 A;  5HRF A;  2W9M A;  5J0T A;  3Q8L A;  1ZQP A;  4DSI A;  4FBT A;  4F5P A;  2JEI A;  3RR8 A;  2JZB B;  2Y1J A;  5KG1 A;  4QZ8 A;  5DDY A;  1KNY A;  2DFL A;  4IQW A;  2UVV A;  4DQQ A;  5DB9 A;  3RR7 A;  2PFQ A;  2HHQ A;  4ECS A;  1L3V A;  4YR3 A;  4DF8 A;  3SI8 A;  3K75 D;  7ICU A;  8ICA A;  1QLN A;  3RJK A;  8ICH A;  4I2C A;  4ATB A;  5D4B A;  4F8R A;  4QZF A;  3GIJ A;  5KFS A;  2V9W A;  4WC5 A;  4KN4 A;  3UXO A;  3ZDE A;  5CWR A;  1HUO A;  7ICM A;  4M9J A;  2XCA A;  4F5Q A;  3MFI A;  3H39 A;  5HHH A;  5KFR A;  1XO1 A;  4TQR A;  5KFO A;  3JPT A;  5J2I A;  2ASJ A;  3EPI A;  1UA1 A;  4PHA A;  1MIW A;  5HRH A;  5KFG A;  1N48 A;  8ICK A;  4RNM A;  1TK0 A;  2ZJ8 A;  1NK9 A;  3OJS A;  8ICP A;  5HR9 A;  2IHM A;  5KFI A;  8ICW A;  4QZI A;  3RTV A;  1BNO A;  3B0Y A;  3T3F A;  4RQ4 A;  1HUZ A;  3ETL A;  3OSP A;  8ICR A;  5HRL A;  3AQM A;  1ZQZ A;  5J0X A;  4FHY A;  2JZB A;  2BQ3 A;  2ZTD A;  3UQ0 A;  1X9W A;  3H8J A;  3LDA A;  1ZQC A;  4O9M A;  4X4P A;  4DS4 A;  4KLM A;  3V7L A;  3NGD A;  3KHR A;  5TZV A;  1ZQJ A;  3WFO A;  3C18 A;  2ZJ5 A;  8ICI A;  3RB6 A;  2UVR A;  1S77 D;  4KLJ A;  2FMP A;  5KT2 A;  4DOA A;  1JN3 A;  5IIK A;  1V9P A;  5KG0 A;  3M9N B;  1MQ3 A;  3M8S A;  2PI5 A;  1PX5 A;  3PVX A;  4PPX A;  2NRW A;  5J2D A;  1JAJ A;  4K4G A;  4C8M A;  5HRE A;  2ZH2 A;  3QE9 Y;  1IM4 A;  4Q44 A;  4M9G A;  7ICG A;  4QWD A;  3V6K A;  4I2F A;  1TAU A;  2XY6 A;  4I2G A;  5F9N A;  3OJU A;  4F4Y A;  7ICS A;  2JEJ A;  9ICM A;  4YVZ A;  2H5X A;  3TFR A;  4DWI A;  3NYB A;  1ZQU A;  1XSP A;  4S3N A;  1TFR A;  2RDI A;  1UA0 A;  2PI4 A;  1D9D A;  4DQR A;  4Q45 A;  3C5G A;  3AQK A;  5KFE A;  3C5F A;  4RQ7 A;  1SKS A;  1BGX T;  1TFY A;  4QZE A;  4F5N A;  5HRK A;  4E0D A;  4Z6F A;  5DB7 A;  5DQI A;  3THV A;  2Q0Z X;  1A77 A;  4RQ0 A;  2OWO A;  4IRK A;  3EZ5 A;  3T5J A;  3H37 A;  4EBJ A;  3JYY A;  2ASD A;  5J2H A;  3V7J A;  3TI0 A;  1NZP A;  5KFD A;  2Y1I A;  1K1Q A;  3PW0 A;  3RB4 A;  2ALZ A;  4WCW A;  2ISO A;  4FHV A;  2XGQ A;  5IIN A;  4B9T A;  1WOT A;  4FHX A;  4DFP A;  1TK5 A;  7ICJ A;  1SZP A;  1DOQ A;  4RZR A;  7ICT A;  9ICR A;  2ZH4 A;  5HC9 A;  3LWM A;  4X4T A;  3AU2 A;  2VA3 A;  5KTQ A;  3PX6 A;  8ICB A;  2HHU A;  5DED A;  5C5J A;  1KRP A;  4ELT A;  3EWA A;  1Q79 A;  1C7Y A;  4F4X A;  1SKR A;  2IA6 A;  1Y88 A;  5J0R A;  1ZQR A;  4F2S A;  9ICC A;  1R8C A;  1CEZ A;  8ICZ A;  5F2V O;  4F5O A;  4DFJ A;  3ISB A;  1BPX A;  2WTF A;  5L1L A;  4I27 A;  9ICN A;  9ICP A;  4EEY A;  2KZZ A;  2Q66 A;  3QEB Z;  3WFS C;  4YR0 A;  4R66 A;  3KTQ A;  7ICF A;  1D8L A;  1B22 A;  9ICI A;  9ICE A;  3QZ7 A;  3GIK A;  4KMU A;  3RJG A;  1UEU A;  2LYH A;  4F2R A;  4GXI A;  4DOC A;  3V6J A;  1JX4 A;  4X4O A;  4RWN A;  4NXZ A;  1NK6 A;  5KFZ A;  5CA7 A;  1TK8 A;  5DEC A;  4YCX A;  1RXW A;  5DB6 A;  5KG6 A;  2BKE A;  2F1I A;  2FMS A;  4Z6C A;  4F91 B;  4ECZ A;  1TV9 A;  1TVA A;  2BCS A;  4C8K A;  4RU9 A;  4P4P A;  4O3P A;  4KLU A;  1R8A A;  4X4N A;  7ICE A;  1YLQ A;  4DL3 A;  5IIL A;  3OHA A;  4E8F A;  4X5V A;  1ZJN A;  2BPF A;  4K4H A;  7ICQ A;  3C2K A;  5D46 A;  4FS1 A;  1X9M A;  4C8O A;  2DR7 A;  4QWA A;  8ICF A;  5EWG A;  2AGQ A;  1CUK A;  4M9N A;  4WC1 A;  3C1Y A;  5KFY A;  4EBE A;  2XCP A;  1S0O A;  2ZH6 A;  2P6U A;  4QZD A;  3N97 B;  4YD1 A;  8ICV A;  5KFP A;  8ICY A;  4M5D A;  3PV8 A;  1D8Y A;  5J2E A;  1ZQF A;  4C8N A;  4KLO A;  3WFP A;  4KLF A;  5D49 A;  1RPL A;  3GV7 B;  3WFR E;  4MFF A;  2KZM A;  8ICQ A;  4JV2 A;  1ZQO A;  4KLS A;  4RWO A;  2ZHB A;  3H4D A;  2ASL A;  1Z3E B;  3HX0 A;  4DF4 A;  3MGI A;  1U4B A;  1NK5 A;  2DR5 A;  5KT5 A;  3HWT A;  2KFZ A;  4O0I A;  3ZDC A;  4FH3 A;  4B9M A;  4XQ8 A; 
#chains in the Genus database with same CATH topology
 3HP6 A;  4YD2 A;  4DSK A;  1KN5 A;  3ZDA A;  2BQU A;  1XU4 A;  5KFT A;  3E58 A;  5AKI A;  8ICC A;  4B9L A;  1ZQG A;  1NI3 A;  4B9S A;  3M6Z A;  2JR5 A;  4M47 A;  4YN4 A;  3G6X A;  1NKC A;  1KKX A;  2VA8 A;  4RPY A;  3IRU A;  8ICJ A;  1OW5 A;  5AKJ A;  4RQ3 A;  5T14 A;  3H7I A;  5JRT A;  4MF8 A;  1H38 A;  4PHP A;  4LEY A;  4J9P A;  2LKY A;  4UAR A;  3ZDD A;  5AKZ A;  3H40 A;  1S8O A;  4UQG A;  3GU3 A;  1T8E A;  4I2A A;  2WF7 A;  2EZZ A;  4RUC A;  4ZH4 A;  4E7X A;  3L4P A;  4QWC A;  3FDS A;  4ECY A;  4P4O A;  2ODG A;  2YY6 A;  2IBK A;  3RJJ A;  3UMG A;  4EX6 A;  2KEY A;  4QZA A;  1QSS A;  4J9Q A;  1JMS A;  3JZ0 A;  3WK9 A;  2YTU A;  4EX7 A;  3ERC C;  1ZQM A;  2EQY A;  3PX4 A;  3NRZ A;  5AKG A;  2F3N A;  1QH9 A;  4RQN A;  4TQS A;  3Q8P B;  4C4S A;  3PW4 A;  1SL2 A;  2GLE A;  2C2E A;  1N60 A;  2DRA A;  3MGH A;  3IHQ B;  3RH4 A;  3MBY A;  1ZQB A;  1KLN A;  4EV6 A;  2W9A A;  3QX7 A;  1RQL A;  1N62 A;  5KT6 A;  3F2D A;  3TQ1 A;  1WWV A;  1ZQX A;  4DQI A;  1IG6 A;  1PK1 B;  7ICR A;  5J0O A;  4ECV A;  1RDF A;  5KFC A;  2RDJ A;  2BCQ A;  2XO7 A;  5KFL A;  2WB1 F;  2P6R A;  2RP5 A;  5KT4 A;  3PW2 A;  1ZD3 A;  1NKE A;  5HRD A;  1UQV A;  1PK1 A;  3PZP A;  2JV3 A;  9ICQ A;  4DS5 A;  4C4R A;  4MEX A;  4QWE A;  3KFU F;  3ISC A;  4PH5 A;  2DWQ A;  2W3S A;  5KFB A;  1CRX A;  2PMZ F;  4XA5 A;  5ALJ A;  2DPI A;  2GA9 D;  5J2G A;  4FBU A;  5BPC A;  8ICN A;  1TAQ A;  5KG7 A;  4MHV A;  5IIJ A;  3MCR A;  5DGA A;  2FMQ A;  3E0F A;  4JWN A;  1KDH A;  8ICU A;  4I28 A;  4EYI B;  3JPO A;  2F1J A;  3G6Y A;  1ZQI A;  4IRD A;  2KIW A;  2OCE A;  1A76 A;  3QU4 A;  3TAR A;  3RRG A;  2ZH3 A;  4YP3 A;  3RJH A;  3M8R A;  3HPO A;  2KSO B;  4NLZ A;  1NOM A;  3CW2 C;  9ICG A;  2K4I A;  2KN7 A;  2ZH5 A;  4NXT A;  2DL0 A;  2ZUC A;  5AI6 A;  1N5X A;  2IHN A;  3RRH A;  3SEI A;  3K4G A;  2FLN A;  4O3R A;  1L7P A;  5ALZ A;  1QSY A;  4K4I A;  5DBA A;  4ICA A;  1O03 A;  3QUB A;  1IXR A;  2XGP A;  3T5H A;  4WQL A;  5AI5 A;  5KFJ A;  2KMD A;  4NM1 A;  1RXV A;  1LVH A;  2QLT A;  4UB2 A;  1L3U A;  4M9H A;  5G5G A;  2C22 A;  3K7D A;  3K1R B;  2IMW P;  1L8O A;  4F5R A;  4DEZ A;  3HKZ C;  4LT6 A;  1YZ6 A;  3SV4 A;  3CYM A;  1A6S A;  2H3I A;  4OJ6 A;  3BQT A;  1N5W A;  3OPX A;  4NWI A;  1ZQT A;  2ZUD A;  3UXP A;  2KVS A;  3T79 A;  1VJ5 A;  3BQ7 A;  5ALX A;  2KKP A;  2HHP A;  2IOF A;  2AHO B;  3L5K A;  1F44 A;  1RYU A;  2RFF A;  4GXK A;  4X4U A;  4JV0 A;  4RQ5 A;  3RJI A;  4UD4 A;  3OVA A;  3MC1 A;  4ED2 A;  2Y0S C;  2PKE A;  4YXM A;  3SEN A;  3QEA Z;  5KFF A;  2MUT B;  5AI8 A;  3QYP A;  4EP7 A;  2YB1 A;  3Q8S B;  5J2F A;  3HW8 A;  3KZX A;  5L1M A;  4UW9 A;  2R8K A;  5KFU A;  2BPC A;  3ALR A;  5ALK A;  4IG8 A;  5J0Y A;  1U47 A;  4I29 A;  2K4E A;  4FO1 A;  2LPE A;  5J2C A;  2N1R A;  4NL9 A;  3B9J A;  4NKU A;  5HMM A;  2D3D A;  1PZN A;  4IQU A;  2VA2 A;  5KG5 A;  2HOI A;  4K99 A;  2ZH1 A;  4ECR A;  4BGD A;  2ZTE A;  4ELV A;  1JRP A;  3Q8M A;  1PUZ A;  4UBC A;  2ISP A;  4B6J A;  4LZD A;  2MUT A;  1PVQ A;  4J9K A;  4OJO A;  2E8N A;  4M9L A;  1ZQH A;  5J29 A;  1OXJ A;  4F71 A;  4NXX A;  3LK9 A;  4N7R A;  5HR6 A;  1MIV A;  2XID A;  2EAM A;  4EZ6 A;  4KTQ A;  5AI9 A;  1Z1B A;  3GV5 B;  1MIY A;  4DL7 A;  3NKU A;  3CK6 A;  3QNM A;  4RWP A;  2F8K A;  4PHD A;  4X4Q A;  2VKQ A;  2C28 A;  2JEI A;  3J81 j;  5EE0 A;  4CF5 A;  5KAF U;  2Y1J A;  5DDY A;  5JTI A;  2DFL A;  2HCF A;  3QUQ A;  4PJ0 U;  3RJK A;  4WC5 A;  2QAR B;  2V9W A;  2XCA A;  3F5E A;  3MFI A;  4FFD A;  1VFG A;  5J2I A;  3EPI A;  1J2M A;  4PHA A;  1N48 A;  5CFS A;  4RNM A;  1TK0 A;  2ZJ8 A;  3OJS A;  5KFI A;  2B56 A;  8ICW A;  4QZI A;  3RTV A;  5HRL A;  5ALM A;  1ZQZ A;  5J0X A;  4FHY A;  4QIW F;  2P35 A;  3H8J A;  1ZQC A;  4O9M A;  4X4P A;  3H8M A;  2QAR A;  1J2N A;  4US8 A;  1JN3 A;  2KIC A;  3AQE A;  1QQ6 A;  2NRW A;  3QE9 Y;  4M9G A;  7ICG A;  2KV2 A;  3V6K A;  3CP8 A;  4JB3 A;  4OAG A;  2I5H A;  3TFR A;  2OYY A;  4GIB A;  1TFR A;  1UA0 A;  2PI4 A;  1S5L U;  3C5G A;  2RRD A;  5AM3 A;  3C5F A;  4RQ7 A;  5HRK A;  4Z6F A;  3THV A;  2OWO A;  4ATB A;  4IRK A;  2WF8 A;  4UB6 U;  5J8Y A;  2ASD A;  5CHE A;  2W55 A;  3RF9 A;  1KW4 A;  2WAQ F;  2ISO A;  2XGQ A;  5IIN A;  4FHX A;  1AQ6 A;  2ZG6 A;  1DOQ A;  4OJL A;  4RZR A;  7ICJ A;  9ICR A;  2ZH4 A;  8ICB A;  5C5J A;  1KRP A;  1C7Y A;  4F4X A;  2IA6 A;  1Y88 A;  5J0R A;  1ZQR A;  4F2S A;  8ICZ A;  2WF5 A;  4DFJ A;  4BJQ A;  1BPX A;  3M7D A;  9ICP A;  4J03 A;  4EEY A;  3NVO A;  3WFS C;  4YR0 A;  2EWR A;  4KMU A;  3RJG A;  2ZIW B;  4FZL A;  5KFZ A;  3SQI A;  1C20 A;  5DB6 A;  4Z6C A;  4O3P A;  4KLU A;  2KJ9 A;  1R8A A;  5C0Y A;  2AH5 A;  4AYB C;  1YLQ A;  5AK5 A;  4E8F A;  1ZJN A;  2DGZ A;  4K4H A;  3AQF A;  5D46 A;  3C2K A;  2K89 A;  5ALY A;  2P6U A;  4KX5 A;  4YD1 A;  3PV8 A;  4A8E A;  5D49 A;  3WFR E;  4RWO A;  2ZHB A;  1Z3E B;  1U4B A;  5KT5 A;  3UQ2 A;  4EEL A;  1SZH A;  2HN1 A;  5KG3 A;  2IOF K;  4B9U A;  3VCB A;  4DLG A;  1NO5 A;  4Z6D A;  1S0V A;  2JH7 A;  5ALN A;  1U48 A;  1NK4 A;  4RUA A;  2ATL A;  9ICL A;  2BBJ A;  1DK3 A;  3GIL A;  1S97 A;  7ICP A;  3OVB A;  4J9L A;  4EGW A;  4WBY A;  2VIX A;  3OTQ A;  4EYH B;  3GZF A;  2EAN A;  2O1P A;  4Z6E A;  4HYK A;  1QTM A;  3B0X A;  5EOZ A;  3FYH A;  1J97 A;  1KFS A;  2KHQ A;  3H4B A;  2JMG A;  2KZ3 A;  7ICV A;  2RQ5 A;  2FCL A;  2NRX A;  2FE9 A;  3C1Z A;  3GII A;  2EH9 A;  1FFU A;  4F4K A;  8ICO A;  4X4R A;  4GC7 A;  1WCL A;  1Q8K A;  1X9S A;  2AQ4 A;  5CB1 A;  3WK7 A;  3QU2 A;  1FO4 A;  5TIS U;  3V72 A;  2AXT U;  5L1K A;  4O3M A;  5KFK A;  3H0M B;  1XC9 A;  1S10 A;  4NLN A;  2HHX A;  4E80 A;  2D8C A;  4DQP A;  1S76 D;  4UAZ A;  7ICN A;  4QZB A;  2DRB A;  3WFQ E;  3QUC A;  2XVT A;  2HOQ A;  4R63 A;  2JGA A;  3ZD8 A;  1NNL A;  1TKD A;  2K8C B;  2DKZ A;  2W04 A;  4LZG A;  3TFS A;  2E1E A;  2HHW A;  4DSF A;  4WH5 A;  2K8B B;  3F2C A;  1UT8 A;  3C21 A;  2ES6 A;  1R89 A;  4R8U B;  5ALL A;  1Z00 B;  3TAP A;  2YN4 A;  5GTH U;  5KL8 B;  4C4T A;  3CRX A;  3H0R B;  5D62 A;  3GIM A;  3GQC A;  4WC1 A;  4O3O A;  3RJF A;  1RZT A;  9ICX A;  3ED5 A;  1R8B A;  4ECX A;  1ZJM A;  4K9A A;  1SIJ A;  2BCV A;  9ICW A;  5E79 U;  4RPX A;  4X4V A;  3C2M A;  3M9M B;  3D2N A;  2DUY A;  5KFA A;  4Y2S A;  1Q3U A;  4ECQ A;  1L3T A;  4Y2Y A;  2F77 X;  4KMO B;  1WCN A;  4ED8 A;  5DG8 A;  5AK3 A;  4XJE A;  4WC3 A;  4Q8F A;  3SAF A;  3ICX A;  3IDW A;  4QZH A;  4DLE A;  1NZB A;  2GAF D;  5EWE A;  1LV5 A;  3NRW A;  9ICU A;  2FI1 A;  3PST A;  4NLB A;  1TE2 A;  5B66 U;  4I2H A;  3IG5 A;  2HBM A;  1ZQK A;  1XSL A;  1FIQ A;  1Q78 A;  2EZX A;  3A0B U;  4BUG A;  4C7Z A;  3V6H A;  5L1I A;  2JEG A;  3CNH A;  2KKV A;  4ED1 A;  5KT7 A;  5KFX A;  4EBK A;  2BGW A;  2MU2 A;  2ZTC A;  3MR2 A;  1ZRM A;  2A1J B;  1SWV A;  4Q8E A;  4RQ8 A;  3PR4 A;  4EEB A;  3TAD C;  4PZN A;  1N56 A;  3MDA A;  1ZOL A;  2B6G A;  2NV3 A;  4FS2 A;  9ICA A;  2UVW A;  4FH5 A;  2FPK A;  3NS1 A;  2NRV A;  3WKE A;  3AEV A;  1ZQW A;  4DL2 A;  4WBZ A;  2R8J A;  2B4V A;  3F53 A;  1X6J A;  4RWQ A;  4TUR A;  1LKY B;  1ZQV A;  5CRX A;  4Y2T A;  3KBB A;  2A1J A;  9ICH A;  3UXN A;  3ZI4 A;  1HJP A;  3GV8 B;  4J9R A;  3SYZ A;  5KFQ A;  4AYB F;  3IN5 A;  4FE3 A;  2YB4 A;  2EZY A;  1F0M A;  4TUP A;  2XY7 A;  4J9S A;  4TUS A;  8ICT A;  1S0M A;  2G08 A;  4ELU A;  3C23 A;  3N7S C;  4DL6 A;  2ZIX B;  2G09 A;  5HML A;  3PX0 A;  2BR0 A;  4JMU A;  1LKY A;  2BPG A;  1OU5 A;  2WHE A;  5J0W A;  5CR0 A;  3Q8R B;  2DF4 B;  4ECW A;  5J2K A;  5HNK A;  3OGU A;  4RNN A;  2ESE A;  1T4G A;  4QZG A;  4ED7 A;  3RB0 A;  7ICO A;  5HRB A;  2FLP A;  5ALH A;  3KHL A;  1MSW D;  4NLC A;  2A3V A;  5AM4 A;  2J6S A;  4MEY A;  5AKY A;  4DFK A;  2ZIX A;  1ZYQ A;  4QWB A;  4U6P A;  2OEH A;  3HIL A;  3AU6 A;  4CCH A;  4C80 A;  1S0N A;  5DDM A;  1X66 A;  1T7P A;  2ZJA A;  1KFD A;  4YMN A;  5ALS A;  2HVH A;  1NK7 A;  1X9X A;  1U9L A;  2P66 A;  3FM9 A;  5J8Y C;  4ECU A;  3EW9 A;  2XIC A;  2R8G A;  1QQ5 A;  3AMZ A;  4O5K A;  4NM2 A;  4PHE A;  2UVU A;  1EXN A;  3U26 A;  5AKK A;  2A19 A;  3QXG A;  1ZQP A;  4F5P A;  2JZB B;  4CF3 A;  1N61 A;  2HHQ A;  3RR7 A;  5HR7 A;  2PFQ A;  1L3V A;  4K98 A;  5D4B A;  4F8R A;  3GIJ A;  5KFS A;  4KN4 A;  7ICM A;  4M9J A;  5AKE A;  2MA1 A;  3H39 A;  3JPT A;  1M6Y A;  1XO1 A;  5KFR A;  5KFO A;  4TQR A;  2ASJ A;  1PVR A;  4C8L A;  1WG8 A;  5KFG A;  5AM2 A;  1NK9 A;  4RQ4 A;  3ETL A;  8ICR A;  3AQM A;  2JZB A;  2FJ6 A;  3K1Z A;  1HEK A;  3NGD A;  1ZQJ A;  4Y2U A;  3C18 A;  8ICI A;  3RB6 A;  3HJE A;  2KSO A;  2W03 A;  5KG0 A;  3PVX A;  4PPX A;  5B3P A;  1PVP A;  1ZRN A;  1IM4 A;  2E8P A;  1SWW A;  3FC4 A;  2XY6 A;  4I2G A;  1Q46 A;  5F9N A;  4K8V A;  7ICS A;  2YQE A;  9ICM A;  5AK4 A;  2H3Z A;  1ZQU A;  3LVV A;  4Q45 A;  1SKS A;  1BGX T;  3WK8 A;  3UM9 A;  4E0D A;  1K5O A;  3EUB 2;  3HJ1 A;  2VJ4 A;  4EBJ A;  2KHV A;  3T5J A;  3H37 A;  4EEN A;  1NZP A;  3QU5 A;  5AKH A;  2Y1I A;  2ALZ A;  2HMX A;  4B9T A;  1SZP A;  4O67 A;  5HC9 A;  2VA3 A;  3KZI U;  5AKL A;  5KTQ A;  2HHU A;  4ELT A;  3EWA A;  1SKR A;  3NWI A;  4PL1 A;  1R8C A;  3EF2 A;  2G5H B;  3S6J A;  2WTF A;  5L1L A;  9ICN A;  1ED1 A;  3KTQ A;  5KNI A;  2KJ8 A;  1B22 A;  9ICE A;  3GIK A;  2Y9T A;  2LYH A;  3NAS A;  4GXI A;  4DOC A;  4DFD A;  2OH2 A;  5CA7 A;  4P0Q B;  2ZIV B;  2F1I A;  1TVA A;  4NXU A;  4OAH A;  2K8A A;  4X4N A;  5ALG A;  4NV0 A;  7ICE A;  4X5V A;  4AP9 A;  2KVC A;  2YX8 A;  1CUK A;  4M9N A;  1S0O A;  4QZD A;  1WUD A;  1GPJ A;  3N97 B;  1UHU A;  4CRX A;  3GV7 B;  4P0Q A;  4MFF A;  1ZQO A;  3HX0 A;  4DF4 A;  3MGI A;  5GTI U;  4B9M A;  2NO4 A;  4XQ8 A;  4UAY A;  2PXI A;  2BCR A;  4KN7 A;  2M9N A;  5ALO A;  3SAG A;  3PNC A;  3NVZ A;  4XRH A;  1ZQQ A;  5A0L A;  1JQR A;  3D2S A;  1F5S A;  3FAH A;  3QU7 A;  1BPZ A;  4NLG A;  4EBD A;  3D2Q A;  5EE1 A;  3NVW A;  5IIM A;  1U45 A;  3PMN A;  5KFN A;  2OM6 A;  3QUT A;  4KX3 A;  4B9N A;  3AUO A;  1IIP A;  4BXO B;  1X40 A;  3ZDB A;  2M2U A;  4QW8 A;  2ZH9 A;  2ID1 A;  1JRO A;  2VAN A;  1X6I A;  1L6N A;  2CPR A;  3JPR A;  9ICJ A;  4BDP A;  2KOB A;  2FDR A;  2PFN A;  2B21 A;  4ZOH C;  1KTQ A;  5B5E U;  2QKQ A;  3UMB A;  2XY5 A;  2V4Q A;  4KLL A;  5J2B A;  3H38 A;  2AGO A;  2AQ0 A;  3WK6 A;  3T5L A;  5BOM A;  2I1Q A;  3BZK A;  4BXO A;  1N63 A;  2KK0 A;  4YMO A;  3AQN A;  4BWJ A;  4I2D A;  2W3R A;  4F93 B;  4MKP A;  3AQL A;  3VC8 A;  5F9L A;  2W8L A;  1OUQ A;  1DK2 A;  2ZH7 A;  2YMP A;  2M2T A;  3O0F A;  4Y2V A;  5DB8 A;  5D63 A;  3PO5 A;  3L9D A;  4P4M A;  3RJE A;  1UT5 A;  7ICI A;  2OXO A;  3OSN A;  9ICT A;  4Y2P A;  4JK1 A;  4G3I A;  5DLF A;  5J0P A;  5KG2 A;  1IV8 A;  5J2J A;  2V4R A;  4YXJ A;  1ZQY A;  2BE3 A;  1NJY A;  1T3Q A;  1SL1 A;  2BHN A;  1L8L A;  4IC9 A;  3MAB A;  1ZET A;  1F5A A;  3H3A A;  1FA0 A;  1MC8 A;  3GDX A;  4I0U A;  3I76 A;  5KFV A;  2KP7 A;  9ICK A;  4K97 A;  4AT8 B;  5DBB A;  4O5C A;  4RT2 A;  2DVI A;  3ORY A;  4UAW A;  1JXE A;  4WQK A;  2QB0 B;  3PML A;  2K4P A;  5J2A A;  3MFH A;  2BQR A;  4LEW A;  4NXV A;  1ZQA A;  2CXY A;  4KLQ A;  3LYS A;  2NYV A;  2W43 A;  1SGG A;  2DKX A;  2ZXI A;  3HJ4 A;  2KD1 A;  2ZIW A;  3ER9 B;  2K4H A;  2VJ5 A;  1K1S A;  1JXL A;  2ZIU B;  3HKZ F;  3WK5 A;  1P7D A;  3QU9 A;  1D8B A;  5IIO A;  2B51 A;  4AT8 A;  4Y2R A;  2CN1 A;  4UB1 A;  2W9C B;  2O5A A;  2FPL A;  3M1Y A;  4B9V A;  5AI4 A;  4F92 B;  2HW3 A;  4LEV A;  3WKA A;  2EAP A;  2QB0 A;  4CNQ A;  1N2X A;  1KFT A;  3SAH A;  1QSL A;  4R65 A;  1NJX A;  4IR1 A;  2JHD A;  5ALE A;  2E8O A;  2Q4T A;  4KLH A;  2W9B B;  2RHF A;  4QW9 A;  2Y0S F;  4IRC A;  8ICX A;  1JUD A;  1A0P A;  3DDH A;  2ZIU A;  4KLI A;  4I2B A;  3AL0 B;  3KHG A;  4UAV A;  3Q8K A;  3PW7 A;  4WC0 A;  5CP2 A;  1ZD2 P;  2W9C A;  1NKB A;  4DO9 A;  5ALR A;  2KTQ A;  3AM9 A;  2LM4 A;  5KT3 A;  2ZH8 A;  5G5H A;  1L5U A;  4HX0 A;  2FPM A;  2WB1 C;  1KEJ A;  4EED A;  1SL0 A;  2LYB A;  3SD7 A;  8ICL A;  2W9B A;  8ICE A;  3HIY A;  4CE6 A;  2FLL A;  1LB2 B;  3JPP A;  4I2I A;  2ZHA A;  7ICK A;  4C0Z A;  4NXW A;  5CJ7 A;  3ISD A;  5H2F U;  4WC6 A;  5AIA A;  2G06 A;  1KL9 A;  3H8W A;  4F50 A;  2MRL A;  4YMM A;  4EBC A;  2HHV A;  3RAQ A;  1NJZ A;  5L1J A;  1XS9 D;  4RPZ A;  3PR5 B;  5DG7 A;  7ICL A;  3JPS A;  4IQT A;  5KFM A;  2DBY A;  1HIW A;  4FHP A;  3BS5 B;  2PMZ C;  1UEV A;  2PFO A;  3LQC B;  4WC7 A;  8ICG A;  3JCF A;  4RQ6 A;  4M04 A;  1Z4N A;  3MR6 A;  2KE7 A;  3RBE A;  2J6T A;  4USA A;  4Y2X A;  2PBE A;  4IS7 A;  1DGS A;  5DG9 A;  4KLE A;  3N28 A;  5CHG A;  4Y2J A;  2E8M A;  5DGB A;  4QNL A;  3BDP A;  4O68 A;  2M2W A;  4Y2Q A;  4I2E A;  3RB3 A;  4O5E A;  1NK8 A;  3BS5 A;  3LWL A;  5KFH A;  3MR5 A;  2AJQ A;  2W7O A;  2I9G A;  3PHZ A;  4OO1 J;  5III A;  1ZQD A;  2F8L A;  2PFP A;  2G5I B;  4F3O A;  3M9O B;  1BPY A;  5DLG A;  2QB1 A;  2LM1 A;  5J0U A;  4JUZ A;  1X2I A;  1UET A;  4R8U A;  4J9N A;  1ECW A;  3NTU A;  9ICV A;  1Z00 A;  1B4F A;  1ZQE A;  2YML A;  1COK A;  1SKW A;  5CEH A;  2ZUB A;  4ED3 A;  3DEE A;  5AI0 A;  5F3X B;  4YG2 A;  2I6X A;  1U49 A;  3IP4 B;  5DKW A;  3H8S A;  9ICO A;  8ICS A;  1L3S A;  5AIB A;  3SZ2 A;  2DR9 A;  5HRF A;  2W9M A;  4DSI A;  4WJ3 B;  3RR8 A;  2F44 A;  4QZ8 A;  4IQW A;  4NL9 C;  2UVV A;  1L7N A;  5DB9 A;  4ECS A;  1CI4 A;  2HBK A;  3K75 D;  1QLN A;  4I2C A;  4QZF A;  5CWR A;  3UXO A;  2OHF A;  2JH1 A;  4F5Q A;  3KKA A;  5HHH A;  8ICK A;  2H3V A;  1KQQ A;  8ICP A;  2BDU A;  4OJ5 A;  4UAT A;  1DGJ A;  1GO3 F;  2KG5 A;  3B0Y A;  2ZXH A;  3T3F A;  1HUZ A;  5ALI A;  5AM0 A;  4BX9 C;  2ZTD A;  1X9W A;  3MGV A;  3F2B A;  4KLM A;  3V7L A;  5TZV A;  3ETR A;  5ALF A;  2UVR A;  1S77 D;  1Z4O A;  4KLJ A;  2FMP A;  2H3Q A;  3M9N B;  5IIK A;  1JI7 A;  1V9P A;  1MQ3 A;  2PI5 A;  3M8S A;  5J2D A;  1ZQ1 C;  3F5A A;  4K4G A;  4C8M A;  5HRE A;  4Q44 A;  2LBO A;  4I2F A;  1TAU A;  4LEZ A;  4F4Y A;  4O69 A;  4K96 A;  1RQN A;  2H5X A;  2JXJ A;  4DWI A;  1Q3V A;  3NYB A;  3M6K A;  4CDG A;  1XSP A;  2RDI A;  4DQR A;  4FZN A;  4P0P B;  5KFE A;  3NVV A;  2Q0Z X;  1A77 A;  1VLB A;  3V7J A;  5KFD A;  1K1Q A;  3RB4 A;  4FHV A;  7ICT A;  3LWM A;  2HSZ A;  2F76 X;  5DED A;  1Q79 A;  2G07 A;  9ICC A;  4P0P A;  5AHX A;  4I27 A;  4NJ8 A;  2KZZ A;  2HN2 A;  4R66 A;  7ICF A;  1D8L A;  3QZ7 A;  4QIW C;  1UEU A;  5ALP A;  1JX4 A;  4RWN A;  2IUB A;  4NXZ A;  5K4L A;  1RXW A;  1SXD A;  2FMS A;  5FP0 A;  4O6A A;  4ECZ A;  2BCS A;  4P4P A;  4WOY A;  1PK3 A;  2K60 A;  1YZ7 A;  5IIL A;  1SV0 A;  3WU2 U;  7ICQ A;  4C8O A;  2DR7 A;  8ICF A;  2AGQ A;  3C1Y A;  1WYG A;  2XCP A;  3I1Y A;  2ZH6 A;  2B0C A;  3BS7 A;  2GH1 A;  4UAU A;  4M5D A;  5KFP A;  1ZQF A;  3WFP A;  2KZM A;  8ICQ A;  4KLS A;  1MN8 A;  3H4D A;  4JLZ A;  3HWT A;  3ZDC A;  5ALT A;  4QJF B;  4PGY A;  2XC9 A;  2LI6 A;  4NY8 A;  1D9F A;  4KLT A;  5JTG A;  2WAQ C;  3C28 A;  4CGZ A;  5HRI A;  2Z7J A;  2R18 A;  4YQW A;  3OV7 A;  2LYA A;  4IQV A;  2KJ5 A;  4AT7 B;  2W11 A;  5HRH A;  4JWM A;  4M6W B;  2DR8 A;  2W8K A;  1WWU A;  1RYS A;  2KIV A;  3BQ0 A;  3PSF A;  3LVW A;  4LVS A;  5J0S A;  1KSP A;  1BVS A;  5KG4 A;  5ALV A;  4KLG A;  4YFK A;  1ZQS A;  1TFW A;  3WKC A;  2BZF A;  4OCZ A;  2R8I A;  5CFU A;  3Q8Q B;  2D6F C;  4AT7 A;  3HT3 A;  4J9M A;  4IL6 U;  4GC6 A;  3TAN A;  2AGP A;  4M6W A;  2BCU A;  4DFM A;  1ZQL A;  2NRT A;  3T5K A;  4UD5 A;  4RNO A;  9ICF A;  1T94 A;  4DCC A;  3PO4 A;  1COO A;  4F4W A;  1FFV A;  4MF2 A;  2A1A A;  2GO7 A;  2HBJ A;  1YT3 A;  3GFK B;  4US9 A;  3PSP A;  2DQN B;  2J6U A;  5AM1 A;  1BPE A;  3RAX A;  5JUM A;  2HHT A;  3IG8 A;  4AT9 B;  3BQ2 A;  4MFA A;  4NKT A;  4X0A A;  2BBH A;  4DSJ A;  3MR3 A;  3L3F X;  4UB5 A;  3TAQ A;  4O3S A;  5KFW A;  2NRZ A;  3SV3 A;  4YR2 A;  3DV9 A;  5D61 A;  4M0A A;  4BWM A;  3UPS A;  3BJY A;  3TKA A;  5KL1 B;  1VJ7 A;  2IHO A;  3UPQ A;  1XSN A;  4AT9 A;  2WF9 A;  4UB3 A;  4KM5 A;  1JIH A;  2BDP A;  4R64 A;  5AIC A;  9ICB A;  4PL2 A;  2NO5 A;  2E3T A;  4DOB A;  4UAS A;  4PGX A;  2XI9 A;  3TAD A;  1DRG A;  3H0L B;  4J9O A;  2NRK A;  4X0B A;  1T3N A;  2GWS A;  2WFA A;  2E1F A;  2H3F A;  2ZIV A;  4EEK A;  2HHS A;  4KLD A;  4RQM A;  2O6K A;  4F72 A;  1KBU A;  5BOL A;  4EZ9 A;  3JPN A;  2IOH A;  2AU0 A;  4F4Z A;  3WK4 A;  2KNJ A;  5AKX A;  3C29 A;  3N7P D;  3G6V A;  2L5Y A;  4RQ1 A;  4XQ7 A;  4DSE A;  5DQH A;  5ALD A;  5ALU A;  3OUY B;  1RYR A;  4RQ2 A;  2LHT A;  2YMQ A;  4FHW A;  4RT3 A;  2C2D A;  4LJX A;  7ICH A;  3RH5 A;  1SB3 C;  4P2H A;  4O3N A;  2JEF A;  4KB6 A;  5EWF A;  5HRG A;  1V4A A;  2HI0 A;  1ZQN A;  3EYZ A;  3OHB A;  1XO0 A;  1MQ2 A;  4UBB A;  3ZD9 A;  4DSL A;  4WC4 A;  2DPJ A;  1BNP A;  3OUY A;  4NLK A;  4ECT A;  4DQS A;  9ICS A;  5EE3 A;  1UCV A;  3WKD A;  4QZ9 A;  3E2E A;  3MDC A;  3ONN A;  3BQ1 A;  2HOF A;  4ATB B;  4ED0 A;  3N4M B;  1TAM A;  2YMM A;  4I2J A;  2HVI A;  2M2V A;  1URJ A;  3JPQ A;  2F1H A;  4UB4 A;  4XUS A;  2LMR A;  3KKA C;  1NK0 A;  3PW5 A;  2RLT A;  5ALW A;  4M2Y A;  5J0Q A;  3C66 A;  1ZD4 A;  2Y9U A;  4JV1 A;  4FZM A;  4DL5 A;  5L9X A;  5DBC A;  1SXE A;  2G0A A;  2M0N A;  2R8H A;  2MAX A;  4O3Q A;  5HHI A;  4WC2 A;  4C7Y A;  4QZC A;  4ED6 A;  1VDV A;  1QQ7 A;  3OWG A;  8ICM A;  4X4S A;  5AM5 A;  4ACO A;  3KHH A;  3V7K A;  4OJP A;  2MSN A;  4UB8 U;  1NJW A;  1BPD A;  1ZD5 A;  2W54 A;  2GOL A;  4GLX A;  1B43 A;  3SR6 A;  3BZC A;  2F2A B;  3C2L A;  3RH6 A;  4TUQ A;  1S9F A;  4FO6 A;  3N7R C;  2EAO A;  5CFT A;  4DL4 A;  4PGQ A;  4KIT B;  2C2R A;  5DQG A;  1L7O A;  1ARO P;  1ZXI A;  4K9B A;  4Q43 A;  1L7M A;  4CF4 A;  3TAC B;  1BPB A;  3RBD A;  4GXJ A;  4MFC A;  3HRD D;  3SMV A;  5AK6 A;  3PY8 A;  3EPG A;  3NVY A;  2EDU A;  3IM1 A;  1Z19 A;  5HP4 A;  1XWL A;  4IR9 A;  3QZ8 A;  2KFN A;  3OVS A;  1MA7 A;  3Q8L A;  5J0T A;  4FBT A;  5KG1 A;  1KNY A;  3A0H U;  4DQQ A;  5JU5 A;  4YR3 A;  4DF8 A;  2JRZ A;  3SI8 A;  2HDO A;  7ICU A;  8ICA A;  8ICH A;  3ZDE A;  1HUO A;  3AN1 A;  1UA1 A;  1MIW A;  3I28 A;  5HR9 A;  2IHM A;  3ER8 C;  1BNO A;  1SV0 C;  3OSP A;  5ALQ A;  1QCK A;  2BQ3 A;  1Z1V A;  3UQ0 A;  3LDA A;  4DS4 A;  3KHR A;  3WFO A;  2W7P A;  1V97 A;  2ZJ5 A;  5KT2 A;  4DOA A;  1PX5 A;  1JAJ A;  2ZH2 A;  1X42 A;  1RG6 A;  4QWD A;  4JLX A;  3NUQ A;  5EE9 A;  3OJU A;  1B0X A;  1O08 A;  3UMC A;  2JEJ A;  4YVZ A;  5B3Q A;  4S3N A;  2CRX A;  1D9D A;  3AQK A;  1TFY A;  4QZE A;  4F5N A;  3WKB A;  5DB7 A;  5DQI A;  4RQ0 A;  3EZ5 A;  3JYY A;  3PSI A;  5J2H A;  3TI0 A;  3PW0 A;  1DXS A;  4WCW A;  1WOT A;  4DFP A;  1TK5 A;  4X4T A;  1JAL A;  3AU2 A;  3PX6 A;  3R9K A;  1CEZ A;  4OAI Z;  5F2V O;  4F5O A;  2E5S A;  3ISB A;  1V85 A;  3IV6 A;  2Q66 A;  3QEB Z;  9ICI A;  3KOO A;  4F2R A;  3V6J A;  4X4O A;  2WF6 A;  1NK6 A;  3RFA A;  1TK8 A;  5DEC A;  3KD3 A;  4YCX A;  5KG6 A;  2BKE A;  4F91 B;  3D6J A;  1TV9 A;  4C8K A;  4RU9 A;  1FEZ A;  4DL3 A;  3OHA A;  1UPH A;  2BPF A;  4OD0 A;  4FS1 A;  1X9M A;  2HBL A;  4QWA A;  4U7C A;  5EWG A;  4PZO A;  5KFY A;  5KAI U;  4EBE A;  1V38 A;  1RM6 C;  8ICV A;  8ICY A;  4OAF A;  1D8Y A;  5J2E A;  1XNS A;  4C8N A;  4KLO A;  4KLF A;  1RPL A;  4JV2 A;  1SV4 A;  2ASL A;  4GFJ A;  1NK5 A;  4G9B A;  2DR5 A;  2KFZ A;  4O0I A;  4FH3 A;  4HAI A; 
#chains in the Genus database with same CATH homology
 3HP6 A;  4YD2 A;  4PGY A;  4UAY A;  4DSK A;  2PXI A;  2XC9 A;  3UQ2 A;  2BCR A;  3ZDA A;  4NY8 A;  4KN7 A;  1D9F A;  2M9N A;  4KLT A;  3PNC A;  2BQU A;  1XU4 A;  5KFT A;  4XRH A;  1ZQQ A;  8ICC A;  5KG3 A;  4B9L A;  1ZQG A;  4B9U A;  1JQR A;  4DLG A;  1NO5 A;  4Z6D A;  1S0V A;  4B9S A;  5HRI A;  4M47 A;  4YN4 A;  1BPZ A;  4NLG A;  1VFG A;  4YQW A;  1U48 A;  4EBD A;  3G6X A;  1NK4 A;  1NKC A;  2VA8 A;  4RUA A;  3OV7 A;  2ATL A;  5IIM A;  4IQV A;  1U45 A;  9ICL A;  4RPY A;  8ICJ A;  3PMN A;  4AT7 B;  4RQ3 A;  5KFN A;  3H7I A;  1DK3 A;  4B9N A;  4MF8 A;  3AUO A;  1H38 A;  3GIL A;  4PHP A;  1S97 A;  3ZDB A;  4BXO B;  4J9P A;  4M6W B;  4JWM A;  7ICP A;  4QW8 A;  2M2U A;  4J9L A;  2ZH9 A;  2DR8 A;  3OVB A;  2W8K A;  2ID1 A;  3ZDD A;  4WBY A;  4EYH B;  1RYS A;  2VAN A;  3H40 A;  4UQG A;  3JPR A;  1T8E A;  3BQ0 A;  4Z6E A;  4HYK A;  4LVS A;  2O1P A;  9ICJ A;  4I2A A;  5J0S A;  3B0X A;  5EOZ A;  1BVS A;  3FYH A;  4RUC A;  4ZH4 A;  5KG4 A;  1QTM A;  1KSP A;  1KFS A;  4YFK A;  1ZQS A;  4KLG A;  4E7X A;  4BDP A;  1TFW A;  3H4B A;  4QWC A;  3FDS A;  2PFN A;  2KZ3 A;  2B21 A;  4ECY A;  7ICV A;  2NRX A;  2R8I A;  4P4O A;  3C1Z A;  3GII A;  1KTQ A;  2XY5 A;  4KLL A;  2V4Q A;  3Q8Q B;  5J2B A;  2IBK A;  3RJJ A;  4F4K A;  3H38 A;  4AT7 A;  3HT3 A;  2AGO A;  8ICO A;  2AQ0 A;  4J9M A;  3T5L A;  4QZA A;  5BOM A;  4GC7 A;  1QSS A;  2I1Q A;  4X4R A;  4J9Q A;  1JMS A;  4GC6 A;  4BXO A;  3JZ0 A;  3TAN A;  2AGP A;  4M6W A;  2BCU A;  4KLE A;  1WCL A;  4YMO A;  1X9S A;  1ZQM A;  4DFM A;  3PX4 A;  1ZQL A;  2AQ4 A;  3AQN A;  4BWJ A;  5CB1 A;  2NRT A;  4I2D A;  3T5K A;  4UD5 A;  4RNO A;  9ICF A;  4F93 B;  3V72 A;  3AQL A;  5L1K A;  3PO4 A;  5F9L A;  1COO A;  4F4W A;  5KFK A;  4TQS A;  1XC9 A;  4MF2 A;  1S10 A;  4NLN A;  2HHX A;  4E80 A;  3Q8P B;  2W8L A;  3GFK B;  4DQP A;  3PW4 A;  1DK2 A;  2ZH7 A;  2J6U A;  1S76 D;  1SL2 A;  2M2T A;  4WC2 A;  1BPE A;  4UAZ A;  7ICN A;  4QZB A;  2DRB A;  5DB8 A;  3WFQ E;  3RAX A;  2C2E A;  4R63 A;  5JUM A;  2HHT A;  2DRA A;  3PO5 A;  3MGH A;  3ZD8 A;  3L9D A;  3IHQ B;  3RH4 A;  1TKD A;  3MBY A;  1ZQB A;  4LZG A;  4P4M A;  3TFS A;  1KLN A;  3RJE A;  1UT5 A;  2HHW A;  2W9A A;  7ICI A;  4AT9 B;  4DSF A;  3OSN A;  9ICT A;  3BQ2 A;  1UT8 A;  4MFA A;  3C21 A;  4NKT A;  4X0A A;  4JK1 A;  4G3I A;  4DSJ A;  3MR3 A;  5DLF A;  5J0P A;  5KT6 A;  4UB5 A;  5KG2 A;  3TAQ A;  4R8U B;  3TQ1 A;  1R89 A;  1ZQX A;  4UD4 A;  4DQI A;  5J2J A;  4O3S A;  1Z00 B;  5KFW A;  4YXJ A;  2V4R A;  1ZQY A;  3TAP A;  7ICR A;  2NRZ A;  5J0O A;  3H3A A;  2BE3 A;  4ECV A;  1NJY A;  1SL1 A;  2BHN A;  3SV3 A;  4YR2 A;  3MAB A;  1ZET A;  3GIM A;  3GQC A;  2RDJ A;  1MC8 A;  5KFC A;  2BCQ A;  1F5A A;  4O3O A;  1FA0 A;  3RJF A;  2XO7 A;  5KFL A;  3GDX A;  1RZT A;  9ICX A;  5KFV A;  4BWM A;  4ECX A;  1ZJM A;  2P6R A;  4M0A A;  9ICK A;  2KP7 A;  1R8B A;  3UPS A;  3BJY A;  4AT8 B;  2BCV A;  9ICW A;  5DBB A;  4O5C A;  4RT2 A;  2DVI A;  1VJ7 A;  3ORY A;  4RPX A;  4UAW A;  3UPQ A;  5KT4 A;  3PW2 A;  1XSN A;  1JXE A;  4X4V A;  4AT9 A;  3C2M A;  4UB3 A;  3PML A;  3M9M B;  5KFA A;  1JIH A;  2BDP A;  1NKE A;  4R64 A;  5J2A A;  9ICB A;  3MFH A;  4ECQ A;  2BQR A;  1L3T A;  1ZQA A;  4DOB A;  5HRD A;  4KLQ A;  4PGX A;  4J9O A;  3HJ4 A;  2NRK A;  4X0B A;  1WCN A;  1T3N A;  4ED8 A;  5DG8 A;  2GWS A;  9ICQ A;  4DS5 A;  4WC3 A;  4Q8F A;  2HHS A;  4KLD A;  4MEX A;  4QWE A;  1K1S A;  3ISC A;  1JXL A;  4QZH A;  4PH5 A;  5IIO A;  4DLE A;  5BOL A;  5KFB A;  4EZ9 A;  5EWE A;  3JPN A;  4AT8 A;  2AU0 A;  4F4Z A;  4XA5 A;  4UB1 A;  1LV5 A;  2W9C B;  2DPI A;  9ICU A;  2O5A A;  5J2G A;  4FBU A;  5BPC A;  8ICN A;  1TAQ A;  5KG7 A;  2FPL A;  5IIJ A;  4B9V A;  4F92 B;  5DGA A;  2HW3 A;  2FMQ A;  3RJI A;  1KFT A;  3G6V A;  4I2H A;  4RQ1 A;  1QSL A;  4XQ7 A;  4R65 A;  4JWN A;  1NJX A;  1KDH A;  4IR1 A;  8ICU A;  1ZQK A;  4I28 A;  4DSE A;  5DQH A;  4EYI B;  1XSL A;  1Q78 A;  3OUY B;  3JPO A;  2F1J A;  3G6Y A;  4RQ2 A;  1RYR A;  2W9B B;  4KLH A;  4FHW A;  3V6H A;  4RT3 A;  4QW9 A;  5L1I A;  2JEG A;  1ZQI A;  4ED1 A;  2C2D A;  5KT7 A;  4IRC A;  8ICX A;  5KFX A;  7ICH A;  3RH5 A;  4EBK A;  4IRD A;  1A76 A;  2BGW A;  4KLI A;  4P2H A;  2ZTC A;  4O3N A;  3TAR A;  3MR2 A;  3RRG A;  3KHG A;  4I2B A;  2ZH3 A;  2A1J B;  2JEF A;  4Q8E A;  4RQ8 A;  3Q8K A;  4YP3 A;  3PR4 A;  3PW7 A;  5EWF A;  3M8R A;  5CP2 A;  3HPO A;  3RJH A;  5HRG A;  1V4A A;  4WC0 A;  1N56 A;  2W9C A;  3EYZ A;  1ZQN A;  1NKB A;  4DO9 A;  3MDA A;  4NLZ A;  1NOM A;  3OHB A;  9ICG A;  1MQ2 A;  2KTQ A;  5KT3 A;  4UBB A;  2KN7 A;  2ZH5 A;  2ZH8 A;  3ZD9 A;  4DSL A;  2ZUC A;  1L5U A;  4WC4 A;  4FS2 A;  9ICA A;  2UVW A;  4FH5 A;  2DPJ A;  2FPM A;  3RRH A;  1KEJ A;  2FPK A;  2IHN A;  1SL0 A;  1BNP A;  3OUY A;  3K4G A;  8ICL A;  2W9B A;  2FLN A;  4O3R A;  8ICE A;  3HIY A;  2NRV A;  4NLK A;  2FLL A;  1LB2 B;  3JPP A;  1QSY A;  4K4I A;  4ECT A;  1ZQW A;  4I2I A;  5DBA A;  4DL2 A;  4WBZ A;  7ICK A;  4DQS A;  2R8J A;  2ZHA A;  1IXR A;  2XGP A;  3T5H A;  4RWQ A;  9ICS A;  5CJ7 A;  3ISD A;  4TUR A;  1ZQV A;  5KFJ A;  2A1J A;  4QZ9 A;  9ICH A;  4WC6 A;  3UXN A;  3E2E A;  1HJP A;  4NM1 A;  1RXV A;  3GV8 B;  3H8W A;  4J9R A;  4UB2 A;  1L3U A;  3SYZ A;  5KFQ A;  3MDC A;  3HJ1 A;  3BQ1 A;  4ATB B;  4F50 A;  4YMM A;  4ED0 A;  4EBC A;  4TUP A;  2XY7 A;  4M9H A;  2HHV A;  3RAQ A;  3N4M B;  2C22 A;  5L1J A;  1NJZ A;  1XS9 D;  4J9S A;  4RPZ A;  3PR5 B;  4I2J A;  4TUS A;  5DG7 A;  4F5R A;  4DEZ A;  2IMW P;  8ICT A;  7ICL A;  3JPS A;  4IQT A;  3SV4 A;  2HVI A;  5KFM A;  3JPQ A;  2M2V A;  4FHP A;  2F1H A;  4LT6 A;  4UB4 A;  4XUS A;  1S0M A;  4ELU A;  3BQT A;  3C23 A;  4ELV A;  1UEV A;  1ZQT A;  1NK0 A;  2ZUD A;  3UXP A;  4DL6 A;  3PW5 A;  2PFO A;  3LQC B;  4WC7 A;  3PX0 A;  5HML A;  5J0Q A;  4M2Y A;  2BR0 A;  8ICG A;  3C66 A;  2HHP A;  4JV1 A;  4DL5 A;  2RFF A;  5L9X A;  4RQ6 A;  2BPG A;  4M04 A;  5DBC A;  1OU5 A;  3MR6 A;  5J0W A;  4GXK A;  3RBE A;  4JV0 A;  4RQ5 A;  2J6T A;  4X4U A;  2R8H A;  2PBE A;  5DG9 A;  1DGS A;  2MAX A;  4O3Q A;  5CR0 A;  5HHI A;  3Q8R B;  5J2K A;  4QZC A;  5HNK A;  4ECW A;  4ED6 A;  3OGU A;  4ED2 A;  5CHG A;  4RNN A;  3OVA A;  4X4S A;  8ICM A;  5DGB A;  3KHH A;  3V7K A;  1T4G A;  3BDP A;  4QZG A;  4ED7 A;  3RB0 A;  7ICO A;  2M2W A;  4YXM A;  5HRB A;  3QEA Z;  5KFF A;  2FLP A;  1NJW A;  2MUT B;  1BPD A;  3KHL A;  4I2E A;  3RB3 A;  1MSW D;  4O5E A;  1NK8 A;  4EP7 A;  3Q8S B;  2J6S A;  3LWL A;  4GLX A;  5KFH A;  3MR5 A;  4MEY A;  2AJQ A;  5J2F A;  3HW8 A;  2I9G A;  4DFK A;  2R8K A;  5KFU A;  2BPC A;  5III A;  1ZQD A;  4IG8 A;  1ZYQ A;  2PFP A;  4QWB A;  1B43 A;  5J0Y A;  3C2L A;  1U47 A;  4I29 A;  4F3O A;  3M9O B;  1BPY A;  3RH6 A;  3AU6 A;  4TUQ A;  1S9F A;  5J2C A;  4C8L A;  4CCH A;  5DLG A;  4FO6 A;  4NKU A;  5HMM A;  1S0N A;  1PZN A;  4IQU A;  5DDM A;  5KG5 A;  2VA2 A;  5J0U A;  4JUZ A;  2ZH1 A;  1X2I A;  4BGD A;  2ZTE A;  4ECR A;  1T7P A;  1UET A;  2ZJA A;  4R8U A;  4J9N A;  1KFD A;  4DL4 A;  3Q8M A;  4YMN A;  4KIT B;  3NTU A;  4UBC A;  4PGQ A;  2C2R A;  2HVH A;  1Z00 A;  5DQG A;  1NK7 A;  2ISP A;  4LZD A;  9ICV A;  2MUT A;  1ZQE A;  4J9K A;  1SKW A;  1ARO P;  1U9L A;  4M9L A;  2P66 A;  1ZQH A;  2ZUB A;  4Q43 A;  5J29 A;  4ED3 A;  1BPB A;  3RBD A;  4GXJ A;  4MFC A;  4ECU A;  3LK9 A;  4YG2 A;  1U49 A;  1MIV A;  3PY8 A;  3EW9 A;  5DKW A;  3EPG A;  4EZ6 A;  4KTQ A;  3IM1 A;  2R8G A;  5HP4 A;  3GV5 B;  1MIY A;  3H8S A;  4DL7 A;  1XWL A;  9ICO A;  4RWP A;  4O5K A;  4NM2 A;  4PHE A;  8ICS A;  4IR9 A;  3QZ8 A;  1L3S A;  2UVU A;  2KFN A;  4PHD A;  4X4Q A;  3OVS A;  1EXN A;  3SZ2 A;  2DR9 A;  2C28 A;  5HRF A;  2W9M A;  5J0T A;  3Q8L A;  1ZQP A;  4DSI A;  4FBT A;  4F5P A;  2JEI A;  3RR8 A;  2JZB B;  2Y1J A;  5KG1 A;  4QZ8 A;  5DDY A;  1KNY A;  2DFL A;  4IQW A;  2UVV A;  4DQQ A;  5DB9 A;  3RR7 A;  2PFQ A;  2HHQ A;  4ECS A;  1L3V A;  4YR3 A;  4DF8 A;  3SI8 A;  3K75 D;  7ICU A;  8ICA A;  1QLN A;  3RJK A;  8ICH A;  4I2C A;  4ATB A;  5D4B A;  4F8R A;  4QZF A;  3GIJ A;  5KFS A;  2V9W A;  4WC5 A;  4KN4 A;  3UXO A;  3ZDE A;  5CWR A;  1HUO A;  7ICM A;  4M9J A;  2XCA A;  4F5Q A;  3MFI A;  3H39 A;  5HHH A;  5KFR A;  1XO1 A;  4TQR A;  5KFO A;  3JPT A;  5J2I A;  2ASJ A;  3EPI A;  1UA1 A;  4PHA A;  1MIW A;  5HRH A;  5KFG A;  1N48 A;  8ICK A;  4RNM A;  1TK0 A;  2ZJ8 A;  1NK9 A;  3OJS A;  8ICP A;  5HR9 A;  2IHM A;  5KFI A;  8ICW A;  4QZI A;  3RTV A;  1BNO A;  3B0Y A;  3T3F A;  4RQ4 A;  1HUZ A;  3ETL A;  3OSP A;  8ICR A;  5HRL A;  3AQM A;  1ZQZ A;  5J0X A;  4FHY A;  2JZB A;  2BQ3 A;  2ZTD A;  3UQ0 A;  1X9W A;  3H8J A;  3LDA A;  1ZQC A;  4O9M A;  4X4P A;  4DS4 A;  4KLM A;  3V7L A;  3NGD A;  3KHR A;  5TZV A;  1ZQJ A;  3WFO A;  3C18 A;  2ZJ5 A;  8ICI A;  3RB6 A;  2UVR A;  1S77 D;  4KLJ A;  2FMP A;  5KT2 A;  4DOA A;  1JN3 A;  5IIK A;  1V9P A;  5KG0 A;  3M9N B;  1MQ3 A;  3M8S A;  2PI5 A;  1PX5 A;  3PVX A;  4PPX A;  2NRW A;  5J2D A;  1JAJ A;  4K4G A;  4C8M A;  5HRE A;  2ZH2 A;  3QE9 Y;  1IM4 A;  4Q44 A;  4M9G A;  7ICG A;  4QWD A;  3V6K A;  4I2F A;  1TAU A;  2XY6 A;  4I2G A;  5F9N A;  3OJU A;  4F4Y A;  7ICS A;  2JEJ A;  9ICM A;  4YVZ A;  2H5X A;  3TFR A;  4DWI A;  3NYB A;  1ZQU A;  1XSP A;  4S3N A;  1TFR A;  2RDI A;  1UA0 A;  2PI4 A;  1D9D A;  4DQR A;  4Q45 A;  3C5G A;  3AQK A;  5KFE A;  3C5F A;  4RQ7 A;  1SKS A;  1BGX T;  1TFY A;  4QZE A;  4F5N A;  5HRK A;  4E0D A;  4Z6F A;  5DB7 A;  5DQI A;  3THV A;  2Q0Z X;  1A77 A;  4RQ0 A;  2OWO A;  4IRK A;  3EZ5 A;  3T5J A;  3H37 A;  4EBJ A;  3JYY A;  2ASD A;  5J2H A;  3V7J A;  3TI0 A;  1NZP A;  5KFD A;  2Y1I A;  1K1Q A;  3PW0 A;  3RB4 A;  2ALZ A;  4WCW A;  2ISO A;  4FHV A;  2XGQ A;  5IIN A;  4B9T A;  1WOT A;  4FHX A;  4DFP A;  1TK5 A;  7ICJ A;  1SZP A;  1DOQ A;  4RZR A;  7ICT A;  9ICR A;  2ZH4 A;  5HC9 A;  3LWM A;  4X4T A;  3AU2 A;  2VA3 A;  5KTQ A;  3PX6 A;  8ICB A;  2HHU A;  5DED A;  5C5J A;  1KRP A;  4ELT A;  3EWA A;  1Q79 A;  1C7Y A;  4F4X A;  1SKR A;  2IA6 A;  1Y88 A;  5J0R A;  1ZQR A;  4F2S A;  9ICC A;  1R8C A;  1CEZ A;  8ICZ A;  5F2V O;  4F5O A;  4DFJ A;  3ISB A;  1BPX A;  2WTF A;  5L1L A;  4I27 A;  9ICN A;  9ICP A;  4EEY A;  2KZZ A;  2Q66 A;  3QEB Z;  3WFS C;  4YR0 A;  4R66 A;  3KTQ A;  7ICF A;  1D8L A;  1B22 A;  9ICI A;  9ICE A;  3QZ7 A;  3GIK A;  4KMU A;  3RJG A;  1UEU A;  2LYH A;  4F2R A;  4GXI A;  4DOC A;  3V6J A;  1JX4 A;  4X4O A;  4RWN A;  4NXZ A;  1NK6 A;  5KFZ A;  5CA7 A;  1TK8 A;  5DEC A;  4YCX A;  1RXW A;  5DB6 A;  5KG6 A;  2BKE A;  2F1I A;  2FMS A;  4Z6C A;  4F91 B;  4ECZ A;  1TV9 A;  1TVA A;  2BCS A;  4C8K A;  4RU9 A;  4P4P A;  4O3P A;  4KLU A;  1R8A A;  4X4N A;  7ICE A;  1YLQ A;  4DL3 A;  5IIL A;  3OHA A;  4E8F A;  4X5V A;  1ZJN A;  2BPF A;  4K4H A;  7ICQ A;  3C2K A;  5D46 A;  4FS1 A;  1X9M A;  4C8O A;  2DR7 A;  4QWA A;  8ICF A;  5EWG A;  2AGQ A;  1CUK A;  4M9N A;  4WC1 A;  3C1Y A;  5KFY A;  4EBE A;  2XCP A;  1S0O A;  2ZH6 A;  2P6U A;  4QZD A;  3N97 B;  4YD1 A;  8ICV A;  5KFP A;  8ICY A;  4M5D A;  3PV8 A;  1D8Y A;  5J2E A;  1ZQF A;  4C8N A;  4KLO A;  3WFP A;  4KLF A;  5D49 A;  1RPL A;  3GV7 B;  3WFR E;  4MFF A;  2KZM A;  8ICQ A;  4JV2 A;  1ZQO A;  4KLS A;  4RWO A;  2ZHB A;  3H4D A;  2ASL A;  1Z3E B;  3HX0 A;  4DF4 A;  3MGI A;  1U4B A;  1NK5 A;  2DR5 A;  5KT5 A;  3HWT A;  2KFZ A;  4O0I A;  3ZDC A;  4FH3 A;  4B9M A;  4XQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...