4NLNA

Structure of human dna polymerase beta complexed with nicked dna containing a template 8brg and incoming ctp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlnA03
3RB0A 8ICUA 4K4HA 1U47A 1BGXT 5HRKA 2IHMA 4K4GA 3EPIA 4ECSA 5J0OA 3ZDDA 2AQ4A 8ICGA 3GIIA 8ICPA 4ED6A 7ICVA 2W8KA 4IR9A 2M2UA 5DECA 5J0SA 5KT3A 3MDAA 1ZQEA 5KFFA 8ICWA 4X4RA 2ZHBA 1NK8A 4JWMA 1DK3A 3PV8A 2J6TA 2DVIA 2PXIA 5EWEA 1MQ2A 3SYZA 2V4QA 5KG6A 4B9TA 2ZHAA 1BPBA 4B9MA 4C8MA 8ICNA 1TVAA 3GDXA 3V6HA 5IIMA 2VANA 3PX0A 3OSPA 1S10A 3Q8PB 3H8JA 4YR3A 3LWMA 5KFBA 3PW5A 4R8UA 3MFHA 4ZH4A 3B0XA 7ICGA 1NK6A 1NO5A 4QWBA 2W8LA 2FLPA 4CCHA 1CEZA 4LVSA 7ICRA 2KTQA 1MIWA 2O5AA 5HNKA 4FS1A 1QTMA 8ICZA 8ICJA 3MR6A 3RRHA 2HHPA 2DR7A 2VA8A 2BPFA 4I2BA 1BPEA 4EBCA 1KNYA 1ZQWA 2DRBA 4RQ2A 4PGYA 4QZEA 2R8KA 2W9AA 5J2IA 4O5KA 1S77D 4QZIA 3EW9A 1JXEA 1DOQA 4IQUA 3UXOA 4DLEA 1ZQBA 5J0YA 1N48A 2PI4A 4P2HA 4ECQA 1SKWA 4FHVA 1U9LA 3RJHA 4KLMA 4DL6A 5KT5A 4M47A 4WC0A 4RQ3A 4RQ6A 1L3VA 2UVRA 4QZBA 2ZTDA 4AT7A 4ATBB 5DG8A 7ICHA 2KZMA 3PR4A 4DOAA 2BCQA 3G6VA 3PNCA 1RYSA 4NLGA 1SL2A 3RJJA 4KMUA 4KLUA 3JYYA 3OUYB 4YR0A 4M5DA 3Q8SB 8ICEA 9ICRA 4F4WA 2XY7A 1T7PA 5D46A 3SI8A 1KDHA 3NYBA 4EBEA 5D49A 2ASDA 2B21A 1S76D 7ICQA 4I2FA 4PHEA 2BHNA 4YXMA 3KHGA 5HREA 4X4QA 2ZH6A 1XS9D 4DL2A 1ZQQA 2ZH3A 1ZQAA 5F9NA 3FYHA 2UVUA 4FS2A 7ICNA 4I29A 8ICKA 4KITB 4P4OA 4Z6CA 2J6UA 4I28A 4I27A 3RBDA 5J0TA 5L1JA 3TAPA 3T5LA 4IRKA 5KG0A 5DBCA 4NLKA 4P4MA 4Q8EA 7ICJA 1NK4A 4NM2A 2XGQA 4J9MA 5HRFA 4Q8FA 4F50A 2BE3A 3PO5A 2OWOA 5KG1A 3L9DA 3OVAA 8ICIA 9ICSA 1A77A 4O3OA 3N4MB 2C28A 8ICCA 4J9PA 2BPCA 2JEIA 4AT8B 1VFGA 4EYHB 4GLXA 3PY8A 3V7KA 1QLNA 5KT2A 3Q8KA 2JEJA 3RR8A 4O3SA 5L1LA 4RWOA 4RZRA 2BDPA 3PW7A 4ELTA 1D8LA 4NXZA 4R65A 4UQGA 3HT3A 2KFZA 3K75D 3MFIA 7ICUA 4WCWA 4YXJA 2ASLA 3TFRA 5DQGA 3UQ0A 9ICTA 4M9NA 3AU2A 5L9XA 3V6JA 1NK9A 1XSPA 2LYHA 1IXRA 2HHSA 4X4NA 3UQ2A 3G6XA 4K4IA 4KLJA 9ICGA 5DBAA 1ZQCA 2PFQA 4WC3A 2Q0ZX 2FMSA 5HRBA 1TAUA 1SL0A 2NRWA 4Q44A 3HWTA 4ED0A 4E0DA 1TV9A 3H8SA 9ICFA 5KG4A 1ZQXA 5KG2A 1SKSA 1X9SA 3GILA 1L3UA 3K4GA 3KHLA 3AQMA 4DFMA 1YLQA 1NKCA 2XC9A 2DPJA 1FA0A 4UB2A 1JXLA 4BWMA 2Y1IA 4F4YA 3LDAA 1NOMA 2BQ3A 8ICFA 2BGWA 4LT6A 2IBKA 3C5GA 9ICIA 1B43A 3PR5B 4FHWA 2DR8A 5KFQA 5KFJA 3GQCA 9ICHA 5DEDA 3H7IA 2W9MA 1JN3A 3AQNA 4B9UA 4ED7A 2ZUCA 3MR2A 9ICOA 1X9MA 2RDJA 8ICRA 2KFNA 5L1KA 4J9QA 1AROP 1S0NA 5IIIA 2BCRA 4B9NA 2KZ3A 4RPXA 3RJGA 4F2SA 4NM1A 4KLEA 2M2TA 3T5KA 4DQPA 4FBUA 5J2BA 4J9KA 3TARA 3GIJA 4DO9A 2KN7A 4RQ5A 5IILA 4DL3A 1SZPA 9ICWA 2FPLA 4F3OA 5HHIA 3BDPA 3T3FA 1XU4A 5KFVA 1MC8A 3AUOA 5HP4A 2BCUA 3JZ0A 3N97B 1K1SA 4FH5A 2RFFA 1ZQOA 4F4ZA 3AQKA 2R8IA 2ZH5A 4IQWA 1ZQZA 3C5FA 4QZAA 1JMSA 5KFGA 4YMMA 4UAWA 1MQ3A 5F2VO 7ICSA 3H40A 4ECWA 2PFPA 3HJ1A 4BWJA 4UB5A 3ISCA 2XCAA 3T5JA 3GIKA 1ZQDA 4O0IA 4KLSA 9ICEA 5HC9A 1X2IA 5KFSA 5DDMA 4YD2A 4GXKA 1NJYA 1ZQFA 5KFPA 5KFNA 1D9DA 2HW3A 3GV5B 4QWAA 1H38A 5DG7A 1RXWA 3KTQA 4DQRA 3LK9A 3HP6A 4X4OA 4TUQA 5F9LA 1HJPA 5CA7A 1PX5A 1RZTA 5CB1A 2NRTA 1Y88A 5HMMA 4O3PA 2HHTA 4AT8A 4AT7B 2ZH2A 4X4UA 2FPKA 2XCPA 2ISPA 1BNOA 9ICMA 4EP7A 2R8JA 9ICVA 4WC6A 4FHXA 4YP3A 4ELVA 4QW9A 4LZDA 5HRGA 5KFHA 4WBZA 1Z3EB 9ICKA 5J29A 4TQSA 5DQIA 1KFSA 3TAQA 2RDIA 5DB7A 1QSYA 7ICMA 1Z00B 3HPOA 4DSEA 5DB6A 3WFRE 5KFIA 8ICBA 2AJQA 2BCVA 7ICTA 3PMNA 3EPGA 3OHAA 1NK0A 4GC6A 4DQQA 1N56A 9ICAA 1KEJA 2HHUA 1XC9A 1NKBA 2A1JB 4F5OA 3TQ1A 1NKEA 4R66A 3RR7A 4EBJA 4ECRA 1TK8A 1QSSA 2FPMA 1U49A 3RBEA 3ISDA 4X0BA 1A76A 2PFNA 4NKUA 4F4KA 3M8RA 3QEAZ 4DSJA 4MF2A 4I2EA 4KN4A 3UXPA 2HHQA 4NLZA 5KFRA 1F5AA 4EEYA 8ICSA 3KHRA 4UB4A 4ECYA 1UETA 7ICEA 3JPQA 2JEGA 4KLTA 1R8CA 2MAXA 2MUTA 2I9GA 4XQ7A 1XWLA 2AGQA 2UVVA 4YD1A 4RUCA 4TQRA 1LV5A 5CP2A 1LB2B 1TFWA 3WFOA 4Z6DA 5J2HA 8ICTA 5HR9A 3B0YA 3Q8MA 4ED3A 4YQWA 3MGHA 1ZQHA 9ICXA 1WOTA 4IQVA 4RQ4A 4MFAA 3Q8LA 5EWFA 4M9LA 1KFTA 3C1ZA 5DLFA 3RH5A 1JQRA 1Q78A 1ZYQA 5KFYA 2M9NA 3FDSA 3GFKB 3MDCA 9ICLA 4FHPA 5J2GA 1ZQYA 1UEVA 2ZJ8A 4DQIA 5J2EA 5KG5A 4RT2A 1SKRA 5KFZA 1NJXA 4I2DA 4QZ9A 5KT6A 4RPYA 1KTQA 4F4XA 2C2RA 2J6SA 2P6UA 2KP7A 4ECZA 3H3AA 3ORYA 4DFKA 4UB3A 1K1QA 4YCXA 1ZQNA 4O3NA 3M8SA 2DFLA 2PBEA 3V6KA 3BQ1A 3OJSA 2HHWA 3EZ5A 2F1IA 3C2LA 2C22A 4AT9A 4R64A 1UT8A 5BOMA 1U4BA 1TK0A 5KFDA 2JZBA 4RQ7A 5KFKA 4TUSA 3MGIA 3JPSA 2W9CB 5J2JA 2BQUA 4JWNA 1R8AA 4NKTA 3Q8QB 2NRZA 4FBTA 1ZQRA 3M9MB 1NJZA 3UPQA 4F92B 4DFJA 3RB4A 4QWCA 4JV2A 3OVSA 4JV1A 3PW0A 3RAXA 2NRXA 4QW8A 4DOCA 4DL5A 3TANA 4DWIA 2ZH8A 2PFOA 1DK2A 5IIJA 3HW8A 2W9CA 4KLIA 3Q8RB 9ICQA 4PGQA 3PMLA 4J9RA 3C18A 3ZDCA 4M9HA 3BQ0A 4JUZA 3M9OB 5HRIA 2IMWP 2ZH9A 4XRHA 4YMOA 1MIVA 5J2AA 4MEXA 5DB8A 4MFCA 3H4DA 5EOZA 1ZQPA 2NRVA 2P66A 1RPLA 4RUAA 1XSLA 3GIMA 2M2VA 1UEUA 1KRPA 2XY6A 8ICXA 3C66A 4X4PA 4ED1A 1ZQKA 3AQLA 4Z6FA 5KFOA 1S97A 4F8RA 3MABA 5J0PA 2XGPA 1JAJA 4X4SA 1T8EA 4IR1A 4ELUA 5J2DA 1NK5A 4M6WB 4B9SA 3THVA 4IRDA 4YVZA 4R63A 2DPIA 5J0RA 4XUSA 1B22A 2HHVA 4I2JA 4YN4A 5KFMA 2ISOA 2PI5A 4P4PA 5KFUA 3JPTA 5HMLA 3ISBA 4GXIA 5CWRA 9ICCA 4WC2A 1XO1A 5TZVA 3UPSA 4Q43A 2FLLA 1ZQIA 8ICAA 5CHGA 8ICLA 5KG7A 1NZPA 5KT7A 1ZQUA 3C2KA 1S0OA 4X4VA 2ZTCA 3OSNA 4X5VA 4DL4A 4BXOA 1RYRA 5C5JA 4QZFA 4DOBA 2ID1A 1T4GA 2FLNA 1COOA 5IIOA 1IM4A 5BPCA 3H38A 3PX4A 5BOLA 3IM1A 3MBYA 5DBBA 3PO4A 4WBYA 1UA0A 2FMPA 2O1PA 4J9OA 4DL7A 1SL1A 2JEFA 2VA2A 4I2HA 4E7XA 5J2FA 4GC7A 3SV4A 4RT3A 2W9BA 2ATLA 4KLGA 1BNPA 5KFXA 4F5NA 3RH6A 2ASJA 2UVWA 4KTQA 4QZHA 4M0AA 3OV7A 5D4BA 4RNOA 4JK1A 3PW2A 2BPGA 4KLHA 2KZZA 3H37A 4LZGA 2HHXA 4UD4A 4BDPA 4TURA 1RXVA 4F5RA 4IRCA 3NTUA 2R8HA 4Z6EA 2F1JA 3SZ2A 4YMNA 2R8GA 4E80A 4X4TA 4WC1A 4DS5A 4I2AA 3LQCB 4YG2A 4I2IA 8ICMA 4ED8A 4O3RA 4QWEA 4F5QA 2NRKA 4WC7A 2V9WA 4F93B 4M6WA 5J2CA 3RB6A 2IA6A 4EZ9A 7ICFA 4ECUA 1UA1A 1KLNA 1ZQTA 5J0UA 3KHHA 3EYZA 3NGDA 1ZQSA 4KN7A 2HVIA 2F1HA 1ZQGA 3QEBZ 9ICUA 3GV7B 3WFQE 5KFTA 3QZ7A 3RJKA 4GXJA 2WTFA 1CUKA 2AU0A 2ALZA 4UBCA 2JZBB 3OGUA 4EBKA 9ICNA 4JV0A 4EYIB 1TKDA 4AT9B 4X0AA 1X9WA 3RRGA 5KFLA 1S0VA 4O3QA 5KFWA 4PHDA 5DDYA 4M2YA 4MF8A 8ICOA 4S3NA 4ED2A 4I2GA 3V7LA 4PHAA 1DGSA 2ZH4A 4MEYA 3MR3A 4KLFA 2ZH7A 2AGPA 4C8NA 1C7YA 5KT4A 3E2EA 4DF4A 3H39A 1TK5A 7ICLA 4EBDA 2AGOA 3RTVA 1R8BA 1L3SA 4G3IA 4F91B 4YFKA 4QZ8A 3QE9Y 4I2CA 4YR2A 3OVBA 4DFPA 3MR5A 3RH4A 1ZJNA 3UXNA 5DLGA 1XSNA 1ZJMA 3C1YA 5KFAA 4DQSA 3IHQB 5KG3A 4C8KA 1ZQMA 4J9LA 9ICJA 4ECTA 5DGAA 4KLLA 3ZDEA 4UD5A 1BVSA 4RQ0A 4DSKA 3ETLA 1T3NA 1ZQJA 2V4RA 4FO6A 1WCNA 5J0WA 8ICYA 2XY5A 1NK7A 5HRDA 4MFFA 3ZD9A 4B9VA 3JPOA 1BPYA 2C2EA 3RJIA 1EXNA 3QZ8A 4ECVA 1KSPA 4KLOA 1MSWD 4UAYA 4QWDA 3V7JA 1Q79A 3JPRA 3C23A 4J9SA 8ICHA 1V4AA 8ICVA 3BQ2A 4WC4A 2IHNA 1PZNA 9ICPA 1KFDA 3HX0A 3RJEA 2AQ0A 3H8WA 7ICPA 2DR9A 5CJ7A 2BCSA 4Q45A 4DS4A 7ICIA 2ZH1A 3RAQA 2BKEA 2MUTB 4RU9A 3RB3A 1NJWA 1L3TA 4O5EA 3OHBA 4KLQA 5DB9A 2H5XA 2W9BB 1D9FA 1BPZA 1VJ7A 2ZUBA 4RWNA 2I1QA 4E8FA 3V72A 2GWSA 5IIKA 4M9JA 4NY8A 4M04A 2P6RA 4ECXA 4C8OA 4RWQA 5KFEA 3PW4A 1OU5A 3RJFA 2XO7A 3C2MA 2M2WA 9ICBA 1MIYA 1TFRA 1ZQLA 2A1JA 2Y1JA 4BXOB 3WFPA 1TAQA 3ZD8A 5DKWA 3EWAA 4HYKA 3AU6A 5DGBA 4C8LA 4PGXA 1V9PA 3JPNA 4FH3A 4WC5A 2FMQA 1TFYA 4RNMA 5CR0A 3ZDAA 4DEZA 2ZTEA 4J9NA 1Z00A 4QZCA 1ZQVA 5KFCA 4O9MA 4TUPA 5JUMA 4RQ1A 4O5CA 5HRLA 4IG8A 4XA5A 4QZDA 3WFSC 4RWPA 4DSFA 1WCLA 3LWLA 4EZ6A 4PHPA 5EWGA 4UBBA 7ICOA 4RNNA 4UAZA 5J0XA 5KTQA 4IQTA 4RPZA 3BJYA 3BQTA 1U48A 1HUZA 4FHYA 2DR5A 4ATBA 4F5PA 4F2RA 1S0MA 2Q66A 5DG9A 1S9FA 2BR0A 5HRHA 4DLGA 1JX4A 1ZETA 1R89A 1HUOA 3HJ4A 3HIYA 5HHHA 3TFSA 2HVHA 2ZJAA 2BQRA 1JIHA 2ZUDA 5J0QA 5L1IA 1L5UA 1D8YA 3H4BA 5IINA 2C2DA 4XQ8A 5J2KA 4QZGA 1U45A 2DRAA 4B9LA 3C21A 3PVXA 3OUYA 2VA3A 3T5HA 7ICKA 5DQHA 4DSIA 4PH5A 3G6YA 3ZDBA 3GV8B 4RQ8A 8ICQA 3SV3A 4KLDA 1BPXA 2ZJ5A 3TI0A 4BGDA 4PPXA 3OJUA 4DF8A 4R8UB 3JPPA 4NLNA 1QSLA 1BPDA 1UT5A 3PX6A 4UB1A 4DSLA 4M9GA 3M9NB
chains in the Genus database with same CATH superfamily
3RB0A 8ICUA 2XVTA 3D2NA 1U47A 5GTIU 4K4GA 5ALEA 5J0OA 2AQ4A 8ICPA 2K89A 3GIIA 5DECA 2W8KA 4IR9A 5J0SA 1ZQEA 1NK8A 1PVPA 1DK3A 3PV8A 2J6TA 2QB1A 2DVIA 2YMPA 3SYZA 4B9TA 2KMDA 1P7DA 2W04A 1BPBA 3ERCC 8ICNA 4EEKA 1KL9A 5IIMA 3PX0A 3SQIA 3I1YA 4YR3A 4WBYA 1B4FA 2FLPA 2KVSA 2YTUA 1MIWA 2JRZA 2Q4TA 5HNKA 1OXJA 2VA8A 5AKEA 2DRBA 2IOHA 4QZIA 2PI4A 4P2HA 1DGJA 3MGVA 4FHVA 1U9LA 1PUZA 4DL6A 3ICXA 5G5HA 2LM4A 2GLEA 2KZMA 3A0HU 2BCQA 3PNCA 1SB3C 4NLGA 2KJ5A 4KMUA 3TADA 3OUYB 5HR7A 4YR0A 5AI4A 4JB3A 8ICEA 3D2SA 1KDHA 5D49A 2B21A 1ZQQA 2ZH3A 3NVZA 4O67A 4KITB 2J6UA 3L4PA 5J0TA 5L1JA 4IRKA 5DBCA 4NLKA 4P4MA 2VIXA 1NK4A 3I76A 2XGQA 4J9MA 4Q8FA 4Y2PA 3OVAA 8ICIA 8ICCA 4J9PA 2G09A 1VFGA 3IRUA 4O3SA 4RZRA 3A0BU 1IV8A 3TFRA 3V6JA 1XSPA 3PSPA 1IXRA 4X4NA 3G6XA 4K4IA 4WC3A 2Q0ZX 4GIBA 1KBUA 4E0DA 2Y0SC 3VC8A 1ZQXA 5KG2A 2HN1A 5AK3A 1WWUA 3GILA 5AM1A 1YLQA 1NKCA 2GH1A 4BWMA 2BQ3A 3LDAA 1NOMA 8ICFA 2BGWA 2IBKA 2DR8A 2LM1A 5KFQA 3GQCA 4O6AA 9ICOA 1X9MA 2RDJA 4FZLA 4F2SA 2RLTA 4DQPA 4FBUA 3GIJA 4DO9A 5IILA 1SZPA 5HP4A 5AHXA 3N97B 1K1SA 4F4ZA 3AQKA 1PVQA 2R8IA 2ZH5A 1CRXA 1ZQZA 2AH5A 1JMSA 2BBHA 4YMMA 2YB4A 2PFPA 3HJ1A 4C0ZA 2RHFA 1ZQDA 4O0IA 1X2IA 1NJYA 1ZQFA 1Q8KA 5KFNA 3GV5B 1RXWA 2E1FA 4X4OA 3HP6A 2I6XA 1VDVA 1PK1A 1Y88A 1N62A 4OJLA 1ZD2P 4P0PB 1ED1A 2R8JA 9ICVA 5AI8A 4FHXA 3ONNA 1F0MA 5ALKA 4YP3A 4ELVA 4LZDA 1Z3EB 5ALDA 1KFSA 1RG6A 5DB7A 1DRGA 2LHTA 3WK5A 8ICBA 2BCVA 7ICTA 3PMNA 4DQQA 1N56A 1L6NA 3R9KA 1XC9A 4HX0A 3TQ1A 3RR7A 2HCFA 3NUQA 1U49A 3ISDA 3NASA 4F4KA 3GU3A 3QEAZ 4MF2A 4P0PA 3UXPA 4ECYA 1PK1B 2MUTA 2F2AB 4XQ7A 2KE7A 2UVVA 2XIDA 4TQRA 4OAGA 5HR9A 5J2HA 3SMVA 4KX3A 4ED3A 2E8PA 4YQWA 3Q8MA 1ZQHA 4IQVA 1YT3A 4M9LA 4MFAA 5EWFA 3RH5A 1JQRA 9ICLA 1MA7A 5J2GA 2ZJ8A 5CFSA 4QZ9A 3IG8A 4F4XA 4C4RA 3ORYA 4DFKA 2B56A 1ZQNA 2DFLA 3V6KA 3OJSA 3EZ5A 2C22A 2KJ8A 3RF9A 4MKPA 3M9MB 4UAVA 4QWCA 2K4EA 5ALVA 5ALMA 2NRXA 3RAXA 2ZIXA 5ALGA 4J9RA 3PMLA 3C18A 2RP5A 4JUZA 2IMWP 5TISU 4MEXA 2WF7A 3H4DA 5EOZA 1ZQPA 2M2VA 1XSLA 1UEUA 4EENA 1KRPA 1SV0C 4ED1A 4X4SA 3MABA 1JAJA 2W11A 1T8EA 4UATA 4ELUA 1URJA 4WJ3B 1LKYA 4R63A 4XUSA 5KFMA 1UPHA 4P4PA 5AI9A 5HMLA 3SD7A 4Y2SA 4Q43A 5CHGA 5AKXA 3C2KA 1O08A 5AM4A 3OSNA 2ZXHA 4DL4A 4BXOA 3QU9A 2GA9D 2GAFD 2E3TA 4QZFA 1N2XA 4DOBA 2FLNA 1COOA 3H38A 3PX4A 3MBYA 4OCZA 2RRDA 1KKXA 3CRXA 1X40A 3ER9B 1SL1A 4DL7A 2JEFA 5J2FA 1LVHA 2UVWA 2XICA 3PW2A 2HDOA 4TURA 5AKGA 4F5RA 2EQYA 4IRCA 3NTUA 2JH7A 2F1JA 1Q46A 3CW2C 2R8GA 3ED5A 4O3RA 4F5QA 2Q66A 2IA6A 4PZOA 5J0UA 1ZQSA 3WKDA 1B0XA 2W54A 3RJKA 3BQ7A 4GXJA 2ALZA 4Y2VA 9ICNA 4AT9B 5KAFU 2W03A 1UHUA 1S0VA 4NXVA 1Z4OA 2KOBA 4PL1A 3CYMA 5DDYA 2CRXA 3V7LA 1DGSA 2FJ6A 4DF4A 1TK5A 7ICLA 3F2CA 4YFKA 4I2CA 4PJ0U 3RH4A 4NJ8A 5DLGA 1SXEA 1OW5A 3C1YA 5KG3A 3FC4A 4J9LA 1FIQA 2H3VA 1ZQJA 2LBOA 1WCNA 1L8OA 4MFFA 1Q3UA 3ZD9A 4B9VA 1BPYA 2A19A 3QZ8A 3O0FA 1Q79A 4WC4A 2ODGA 3HX0A 4FFDA 2AQ0A 2DR9A 3RAQA 3RB3A 3OHBA 1VJ7A 2H5XA 2W9BB 1Z1VA 4RWNA 4E8FA 2W43A 3M1YA 5IIKA 3SAFA 5ALWA 4RWQA 2Y1JA 2YMLA 2OH2A 4QJFB 1TAQA 5DKWA 1A0PA 1V9PA 2KSOA 1TFYA 5CR0A 1ZD3A 3ZDAA 4DEZA 4J9NA 5KFCA 1Z00A 3QUTA 2EANA 1HIWA 4DSFA 3LWLA 1SGGA 4KB6A 3QNMA 3KOOA 4RNNA 4UAZA 5J0XA 1HUZA 4RPZA 3N7PD 2DR5A 4F5PA 4DLGA 1KW4A 3HIYA 2ZJAA 5ALRA 1JIHA 2WHEA 5J0QA 3K1RB 4XQ8A 1X42A 4B9LA 1HEKA 5AKIA 2VA3A 3OUYA 5JTIA 7ICKA 4DSIA 3G6YA 3VCBA 2K4HA 1BPDA 3PX6A 2G06A 2KHQA 4DSEA 4K4HA 3N28A 3K1ZA 4G9BA 4U6PA 5KFFA 2ZHBA 3NVWA 4JWMA 5EWEA 2V4QA 1JUDA 4C8MA 4EX6A 3UM9A 2ESEA 3OSPA 3F53A 4CF3A 3H8JA 3PW5A 2PMZF 3MFHA 5CRXA 1NO5A 4FO1A 4FS1A 1QTMA 2BPFA 2VJ4A 1BPEA 4EBCA 2QARB 3UMCA 1ZQWA 3EW9A 1DOQA 5JRTA 1J2MA 4KLMA 4WC0A 4M47A 5AI0A 4RQ6A 1L3VA 3G6VA 1QH9A 4KLUA 2EDUA 2ZXIA 3Q8SB 5D46A 3SI8A 2ASDA 7ICQA 1S76D 4PHEA 5HREA 3KHGA 5ALLA 4DL2A 5F9NA 3FYHA 2UVUA 4CGZA 2Y9TA 3RBDA 8ICWA 7ICJA 2D8CA 8ICVA 3NVVA 4NM2A 5HRFA 2JMGA 1FO4A 4FZNA 2OWOA 5KG1A 4AT7B 2DL0A 3BZKA 4OO1J 4AT8B 2BPCA 4ICAA 3PY8A 1QLNA 2JEJA 5CFTA 4RWOA 2BDPA 4ELTA 2EZZA 7ICUA 2F8KA 3K75D 2ASLA 4CDGA 1FFVA 2ZIVB 3AU2A 2LYHA 3DV9A 2HHSA 3UQ2A 4KLJA 3L3FX 1ZQCA 2EZXA 5EE1A 5HRBA 3FM9A 2NRWA 4Q44A 2KK0A 1XO0A 1L3UA 4DFMA 1FA0A 4BUGA 3C5GA 9ICIA 1B43A 5KFJA 1QQ7A 5DEDA 3AQNA 4ED7A 4B6JA 8ICMA 4B9NA 2KZ3A 3RJGA 4KLEA 3T5KA 2EAMA 5J2BA 4J9KA 2KN7A 4F3OA 1SXDA 1XU4A 3AUOA 4IC9A 2RFFA 3IN5A 1X6IA 3C5FA 4QZAA 5KFGA 4OD0A 1MQ3A 5F2VO 3GZFA 2MSNA 2OM6A 3H40A 1QQ6A 2WAQC 3HJEA 3ISCA 4K8VA 2JHDA 1O03A 4KLSA 3KZXA 4GXKA 5EE3A 4EEBA 1D9DA 2YQEA 4JMUA 1H38A 4QWAA 4NXTA 3PSIA 3KTQA 4DQRA 5F9LA 5CB1A 1RYUA 2NRTA 4AP9A 4O3PA 3WK4A 4X4UA 4EP7A 4LEYA 5KFHA 5J29A 4TQSA 3TAQA 1QSYA 2K4IA 2AJQA 5JU5A 3EPGA 3OHAA 3UMGA 2NYVA 2PKEA 4ECRA 1TK8A 2W7OA 3SR6A 1PVRA 1A76A 4NKUA 2ZIUB 3NRWA 4I2EA 2HHQA 1F5AA 3KHRA 1UETA 1J2NA 2JEGA 2O6KA 2AGQA 4RUCA 1LV5A 3BZCA 2Y0SF 2G5IB 3ETRA 4Y2TA 9ICXA 4RQ4A 1L7NA 1KFTA 2G08A 4OJ5A 1ZYQA 5KFYA 3MDCA 5GTHU 4CF4A 5KFZA 1NJXA 4I2DA 4ECZA 1K1QA 2YN4A 4YCXA 3M8SA 5L1MA 2F1IA 5KL8B 3K7DA 1UT8A 4HAIA 4RQ7A 5KFKA 3MGIA 3PSFA 2BQUA 1R8AA 3Q8QB 4ZOHC 5D63A 4F71A 1SV0A 3UPQA 4F92B 1ZQ1C 4DFJA 2F76X 3OVSA 4QW8A 4DOCA 3LVVA 4DWIA 3RFAA 1DK2A 4KLIA 2W9CA 3KD3A 3ZDCA 4DFDA 4M9HA 5HRIA 2QLTA 1UCVA 1VLBA 2D3DA 1MIVA 3HKZC 5DB8A 2NRVA 3GIMA 5AICA 4US9A 2XY6A 4X4PA 4BJQA 5J0PA 2XGPA 1JALA 4IR1A 4IRDA 4YVZA 2OXOA 5J0RA 2ISOA 1JROA 5KFUA 2FDRA 4XJEA 3JPTA 3ISBA 2FLLA 1ZQIA 4CNQA 1NZPA 5KG7A 2W7PA 5KT7A 1ZQUA 4A8EA 2HBMA 4QIWF 2DF4B 1T4GA 4NLCA 3H0LB 2FMPA 3WK9A 4I2HA 5J8YA 4GC7A 2ATLA 5KNIA 3RH6A 2KNJA 3H37A 3LVWA 4N7RA 2HHXA 1RXVA 4PZNA 4WQKA 2R8HA 4Z6EA 3SZ2A 4KMOB 4YMNA 4E80A 3QU7A 2P35A 4YG2A 1S5LU 2HMXA 1N63A 4KX5A 4QWEA 4WC7A 2V9WA 4EZ9A 4ECUA 1UA1A 3EYZA 3KHHA 3NGDA 4PL2A 3QEBZ 3WFQE 5KFTA 2WTFA 1WG8A 4JV0A 4EYIB 1Z1BA 5B3QA 3BS7A 8ICOA 4ED2A 4I2GA 4IL6U 4PHAA 1ZD4A 3MR3A 4KLFA 2AGPA 2ES6A 4C8NA 3S6JA 2Y9UA 1N61A 1L3SA 4F91B 4DFPA 3MR5A 2WB1F 3UXNA 1XSNA 5HR6A 4DQSA 3IHQB 4OAIZ 4UD5A 4RQ0A 4UAUA 4UB8U 8ICYA 2XY5A 5HRDA 1RQNA 3DDHA 3JPOA 2ZIVA 4RQMA 2Z7JA 1TAMA 4QWDA 3JPRA 1V4AA 2FE9A 1N60A 3BQ2A 9ICPA 7ICPA 2M0NA 2BKEA 2MUTB 1L3TA 4KLQA 1N5WA 5DB9A 1BPZA 2I1QA 3V72A 2GWSA 4NY8A 4M04A 2K4PA 4ECXA 4O69A 2WF6A 3RJFA 3F5AA 2M2WA 5H2FU 1MIYA 1TFRA 1ZQLA 4P0QA 3ZD8A 3JPNA 2FMQA 4CRXA 3AM9A 3SAGA 4TUPA 5HRLA 3NVOA 4IG8A 4XA5A 2LKYA 4RWPA 4PHPA 2KKVA 4FHYA 1S0MA 2BR0A 5HRHA 1JX4A 3HJ4A 5B66U 1K5OA 5CEHA 2HVHA 1RQLA 2QARA 3H4BA 5J2KA 1U45A 2E5SA 3C21A 3WKBA 1ZOLA 5AIBA 2F3NA 4RQ8A 3JPPA 3IV6A 3AQEA 2FI1A 1SZHA 3AEVA 1BGXT 5HRKA 3QU4A 8ICGA 1NNLA 3MDAA 4X4RA 5AKKA 4K96A 4UASA 3HKZF 3TKAA 3GDXA 3NVYA 2JXJA 3B0XA 4ZH4A 1NK6A 4QWBA 2W8LA 7ICGA 1CEZA 7ICRA 2KTQA 1SWWA 2DBYA 2DR7A 4I2BA 2KV2A 1KNYA 4QZEA 2R8KA 1S77D 2W9AA 3UXOA 4ECQA 3QYPA 1SKWA 5KT5A 3HRDD 4AT7A 4QZBA 5DG8A 1XNSA 3JCFA 3RJJA 3JYYA 2LPEA 3M6KA 2W3RA 1DXSA 9ICRA 1T7PA 4K9AA 4EBEA 2G0AA 2BHNA 4YXMA 1XS9D 5ALIA 4FS2A 7ICNA 8ICKA 4P4OA 4I28A 2ZIUA 4I27A 3T5LA 5KG0A 4K98A 2BE3A 3PO5A 4LEVA 3L9DA 9ICSA 4O3OA 2C28A 2JEIA 4EYHB 3V7KA 1V85A 5KT2A 3Q8KA 3PW7A 4NXZA 4R65A 4UQGA 2HOIA 4YXJA 2CXYA 2E1EA 1NK9A 3NKUA 3M6ZA 3CP8A 5DBAA 2HBJA 3B9JA 1TAUA 3C29A 4FZMA 4ED0A 3HWTA 3H8SA 2WF5A 1X9SA 4IS7A 5D61A 2XC9A 2DPJA 4UB2A 1JXLA 2Y1IA 2B0CA 4NLBA 3PR5B 5E79U 3H7IA 4B9UA 2ZUCA 3MR2A 4NXWA 5L1KA 1AROP 3KFUF 4NM1A 2M2TA 4DL3A 4Y2RA 2FPLA 3AN1A 3BDPA 2BCUA 5KFVA 3JZ0A 1MC8A 4FH5A 2JGAA 1S8OA 1ZQOA 4IQWA 2DKXA 4UAWA 7ICSA 4ECWA 4BWJA 4UB5A 2R18A 1WUDA 2XCAA 3T5JA 5FP0A 4NWIA 3GIKA 5KFSA 5DDMA 4YD2A 3N7RC 1AQ6A 2HW3A 2DUYA 2KIVA 5DG7A 3LK9A 5CA7A 4GFJA 1RZTA 2MRLA 3MCRA 2K8BB 2KVCA 2HHTA 2FPKA 2XCPA 9ICMA 5HRGA 9ICKA 5DQIA 7ICMA 1Z00B 3QUQA 2WAQF 2IOFK 5DB6A 2OEHA 1NK0A 9ICAA 1KEJA 2A1JB 2VJ5A 4F5OA 1QSSA 4X0BA 3RBEA 1V97A 2PFNA 3BS5A 4DSJA 4KN4A 2I5HA 8ICSA 3LYSA 7ICEA 3PSTA 1RM6C 4BX9C 2I9GA 1XWLA 4YD1A 1LB2B 5CP2A 3B0YA 1WOTA 3Q8LA 4FE3A 3C1ZA 5DLFA 3WK7A 2M9NA 3FDSA 3GFKB 1UEVA 4DQIA 5J2EA 1SKRA 3C28A 4RPYA 3H0RB 1KTQA 3H3AA 4QIWC 1UQVA 2ZG6A 5EE0A 3WK8A 2PBEA 3C2LA 1TE2A 1V38A 3SENA 4AT9A 4R64A 5BOMA 1U4BA 1TK0A 5KFDA 4TUSA 4JWNA 3JPSA 4NKTA 4FBTA 2W3SA 1ZQRA 4MHVA 4JV1A 2K8AA 2PFOA 5IIJA 9ICQA 4PGQA 5D62A 3T79A 4O3MA 1L7OA 3BQ0A 3M9OB 2ZH9A 4YMOA 5J2AA 2IOFA 2P66A 3C66A 8ICXA 3AQLA 1S97A 3OPXA 3WKEA 2HSZA 4M6WB 1ZRMA 1Z4NA 1B22A 2HHVA 4I2JA 2B4VA 4GXIA 4WC2A 1XO1A 8ICAA 5ALNA 2KJ9A 1S0OA 4X5VA 4P0QB 1RYRA 5C5JA 2RQ5A 2DKZA 1IM4A 5JTGA 5BOLA 2OHFA 5DBBA 1UA0A 3WK6A 2O1PA 2VA2A 4OJ6A 4KLGA 3SV4A 4RT3A 1BNPA 3OV7A 5EE9A 2EWRA 4JK1A 2BPGA 4KLHA 2KZZA 3IDWA 4LZGA 4UD4A 2EZYA 1FEZA 3F2BA 1ZD5A 3CNHA 4DS5A 4I2AA 3LQCB 4I2IA 4ED8A 2NRKA 5J2CA 4NXXA 1KLNA 3CK6A 3KZIU 2HVIA 2F1HA 4K97A 2KKPA 4Y2UA 3GV7B 2F77X 4U7CA 3QZ7A 5C0YA 2IUBA 1CUKA 4UBCA 1KN5A 2E8MA 3HILA 4X0AA 1X9WA 3RRGA 4WH5A 1QQ5A 5KFLA 4O3QA 5A0LA 5KFWA 3U26A 4M2YA 4MF8A 2D6FC 4S3NA 4NL9A 4MEYA 5AI5A 3FAHA 1C7YA 5KT4A 3E2EA 3H39A 1WYGA 4EBDA 1R8BA 4QZ8A 1MN8A 2ZIWA 4OJPA 1ZJNA 2F44A 3F2DA 5KFAA 2L5YA 4DCCA 5ALSA 4ECTA 1GO3F 1YZ7A 4KLLA 3ZDEA 4DSKA 3ETLA 1T3NA 5J0WA 4Y2XA 2AXTU 3UMBA 3RJIA 1KSPA 2DQNB 1MSWD 4UAYA 4J9SA 3C23A 2EH9A 8ICHA 4ACOA 5ALTA 4KM5A 3PHZA 2BCSA 4Q45A 7ICIA 1NJWA 4RU9A 2B51A 5AM5A 3H8MA 3ER8C 1T3QA 2E8OA 5ALZA 4C7YA 4EX7A 3PW4A 1OUQA 2LMRA 3WFPA 3AU6A 4HYKA 3EWAA 3E58A 5AK5A 5DGBA 4WC5A 4QZCA 1ZQVA 4EELA 4JLXA 4EZ6A 1WCLA 5KAIU 2LYBA 4NL9C 4UBBA 7ICOA 5KTQA 4IQTA 3BJYA 3BQTA 4F2RA 1S9FA 1PK3A 1X9XA 4CF5A 3DEEA 1HUOA 2VKQA 2BQRA 2ZUDA 5L1IA 1KQQA 1D8YA 2C2DA 5IINA 5DQHA 5AKJA 4PH5A 3ZDBA 4NV0A 1LKYB 4KLDA 1BPXA 4PPXA 4BGDA 1M6YA 4R8UB 5ALJA 1UT5A 4OAFA 4F8RA 8ICTA 2H3ZA 2IHMA 1L7MA 1T94A 3EPIA 4ECSA 3ZDDA 7ICVA 2M2UA 4C4SA 4ED6A 4I0UA 5KT3A 2QB0A 2PXIA 5ALUA 1MQ2A 5KG6A 2ZHAA 4B9MA 2YMQA 2DGZA 2HBKA 1TVAA 3V6HA 2VANA 1QCKA 1S10A 5B3PA 3Q8PB 3LWMA 5KFBA 4R8UA 4EBKA 5AM0A 4CCHA 2O5AA 4LVSA 2QB0B 2LI6A 8ICZA 8ICJA 3MR6A 3RRHA 2HHPA 2K60A 5CHEA 4RQ2A 4PGYA 2BBJA 5J2IA 4O5KA 5G5GA 4DLEA 1JXEA 1ZQBA 4IQUA 5J0YA 1N48A 3RJHA 5B5EU 1NI3A 1ZRNA 2OCEA 4RQ3A 2UVRA 2ZTDA 2HN2A 4ATBB 3QUCA 7ICHA 2QKQA 3PR4A 4DOAA 1RYSA 2JV3A 1SL2A 4AYBF 4M5DA 4F4WA 2XY7A 3EF2A 3NYBA 2N1RA 4LJXA 3QXGA 4I2FA 2KICA 4X4QA 2ZH6A 1ZQAA 4I29A 5ALHA 4Z6CA 3TAPA 4Q8EA 1RDFA 4F50A 3TADC 1A77A 3N4MB 3NS1A 4GLXA 3RR8A 4UW9A 4AYBC 5L1LA 1J97A 1D8LA 3HT3A 2KFZA 3MFIA 4WCWA 2YX8A 5DQGA 5T14A 3UQ0A 9ICTA 4M9NA 1SWVA 5L9XA 4Y2YA 3L5KA 9ICGA 2KIWA 2PFQA 2FMSA 1SL0A 2A1AA 3I28A 1TV9A 9ICFA 5AI6A 5KG4A 1SKSA 2A3VA 3K4GA 2JR5A 3KHLA 3AQMA 4EGWA 2YY6A 4F4YA 4LT6A 4FHWA 2PMZC 3ZI4A 9ICHA 4WOYA 3QU5A 2W9MA 1JN3A 4F72A 8ICRA 2KFNA 4J9QA 1S0NA 5IIIA 2BCRA 4RPXA 2H3FA 3QU2A 1FFUA 2NV3A 2CPRA 3AQFA 2ZIWB 4USAA 3SAHA 1SIJA 3TARA 9ICWA 4RQ5A 2GO7A 5HHIA 3T3FA 3IP4B 2DWQA 1X66A 3PZPA 4OJOA 5AKZA 3MC1A 1ECWA 2K8CB 3KKAC 1WWVA 5HC9A 9ICEA 1NZBA 4US8A 5AM3A 5KFPA 4TUQA 1HJPA 1PX5A 1D8BA 2FCLA 5HMMA 3ALRA 4AT8A 2ZH2A 1X6JA 3IG5A 2HI0A 4LEZA 2ISPA 1BNOA 1Q3VA 2MU2A 2BZFA 4WC6A 1F44A 4QW9A 4WBZA 2RDIA 5ALYA 3HPOA 3WFRE 5KFIA 4GC6A 2HHUA 4Y2JA 1NKBA 4EBJA 1NKEA 4R66A 5KL1B 2YB1A 2FPMA 3M8RA 4NLZA 5KFRA 4EEYA 4UB4A 4CE6A 2H3IA 3JPQA 4KLTA 2MAXA 1R8CA 3SEIA 3NWIA 5ALFA 1TFWA 3WFOA 4Z6DA 3WKCA 3MGHA 3QUBA 1CI4A 1Q78A 4FHPA 3EUB2 2G5HB 3D2QA 1ZQYA 2WF8A 5KG5A 4RT2A 2OYYA 2J6SA 5KT6A 2C2RA 2KP7A 2P6UA 4UB3A 4O3NA 5ALOA 3BQ1A 2WF9A 1GPJA 2HHWA 2W9CB 2JZBA 5ALPA 5J2JA 5AKLA 2NRZA 2E8NA 5F3XB 1NJZA 1A6SA 3N7SC 3RB4A 4WQLA 1IG6A 4JV2A 3PW0A 1VJ5A 3TANA 4DL5A 2ZH8A 2NO5A 3HW8A 5K4LA 4C4TA 3Q8RB 2KG5A 2AHOB 4RQNA 4XRHA 4MFCA 1RPLA 4RUAA 4LEWA 5AM2A 1ZQKA 4Z6FA 5KFOA 5CFUA 5J2DA 1NK5A 3BS5B 4B9SA 5J8YC 3THVA 4EV6A 5ALQA 2DPIA 5ALXA 4YN4A 2PI5A 5AKHA 5CWRA 9ICCA 5TZVA 3UPSA 1L7PA 1F5SA 2EAOA 8ICLA 4X4VA 2ZTCA 4O68A 2ID1A 5AK6A 3H0MB 5IIOA 2W55A 4OAHA 5BPCA 1SV4A 3IM1A 3PO4A 4E7XA 4Y2QA 4J9OA 2B6GA 2W9BA 5KFXA 4F5NA 2ASJA 4KTQA 4M0AA 4QZHA 5D4BA 4RNOA 4BDPA 4C80A 4X4TA 3AMZA 4WC1A 4JLZA 3F5EA 4F93B 4M6WA 3RB6A 4QNLA 7ICFA 1ZQTA 4KN7A 1ZQGA 9ICUA 2BDUA 1ZXIA 2AU0A 2LYAA 2JZBB 3OGUA 1TKDA 3WKAA 2HOQA 2JH1A 3E0FA 4K9BA 1JI7A 4C7ZA 4PHDA 5AK4A 2ZH4A 2ZH7A 4EEDA 2AGOA 2KHVA 3RTVA 4G3IA 2MA1A 3QE9Y 3OVBA 4YR2A 1ZJMA 1YZ6A 3OWGA 4C8KA 1ZQMA 1IIPA 9ICJA 5DGAA 2WFAA 3QX7A 1BVSA 2NO4A 2V4RA 4FO6A 1NK7A 1L8LA 2C2EA 1EXNA 4ECVA 2XI9A 4KLOA 3V7JA 2IHNA 1PZNA 3D6JA 1KFDA 3OTQA 3RJEA 2KEYA 3H8WA 3TACB 5CJ7A 4DS4A 2ZH1A 4O5EA 2KSOB 1D9FA 2ZUBA 2HOFA 3KBBA 4M9JA 2YMMA 2P6RA 4C8OA 3KKAA 5KFEA 5AKYA 1OU5A 4NXUA 2XO7A 3C2MA 1Z19A 9ICBA 2A1JA 4BXOB 4C8LA 2HBLA 2G07A 4PGXA 4FH3A 2EAPA 3J81j 4RNMA 4O9MA 2ZTEA 3WU2U 2CN1A 5JUMA 4RQ1A 4O5CA 4QZDA 3WFSC 5EWGA 3M7DA 4UARA 1U48A 4ATBA 1COKA 3NRZA 5DG9A 2WB1C 1ZETA 1R89A 5HHHA 3TFSA 1L5UA 2KD1A 4J03A 5AIAA 4QZGA 2DRAA 3PVXA 3T5HA 2IHOA 1C20A 1N5XA 2GOLA 3GV8B 3AL0B 8ICQA 3SV3A 2ZJ5A 3TI0A 2F8LA 3OJUA 4DF8A 4NLNA 1QSLA 2ZIXB 4UB6U 4K99A 4UB1A 4DSLA 2H3QA 4M9GA 1JRPA 3M9NB
chains in the Genus database with same CATH topology
3RB0A 8ICUA 4K4HA 1U47A 1BGXT 5HRKA 2IHMA 4K4GA 3EPIA 4ECSA 5J0OA 3ZDDA 2AQ4A 8ICGA 3GIIA 8ICPA 4ED6A 7ICVA 2W8KA 4IR9A 2M2UA 5DECA 5J0SA 5KT3A 3MDAA 1ZQEA 5KFFA 8ICWA 4X4RA 2ZHBA 1NK8A 4JWMA 1DK3A 3PV8A 2J6TA 2DVIA 2PXIA 5EWEA 1MQ2A 3SYZA 2V4QA 5KG6A 4B9TA 2ZHAA 1BPBA 4B9MA 4C8MA 8ICNA 1TVAA 3GDXA 3V6HA 5IIMA 2VANA 3PX0A 3OSPA 1S10A 3Q8PB 3H8JA 4YR3A 3LWMA 5KFBA 3PW5A 4R8UA 3MFHA 4ZH4A 3B0XA 7ICGA 1NK6A 1NO5A 4QWBA 2W8LA 2FLPA 4CCHA 1CEZA 4LVSA 7ICRA 2KTQA 1MIWA 2O5AA 5HNKA 4FS1A 1QTMA 8ICZA 8ICJA 3MR6A 3RRHA 2HHPA 2DR7A 2VA8A 2BPFA 4I2BA 1BPEA 4EBCA 1KNYA 1ZQWA 2DRBA 4RQ2A 4PGYA 4QZEA 2R8KA 2W9AA 5J2IA 4O5KA 1S77D 4QZIA 3EW9A 1JXEA 1DOQA 4IQUA 3UXOA 4DLEA 1ZQBA 5J0YA 1N48A 2PI4A 4P2HA 4ECQA 1SKWA 4FHVA 1U9LA 3RJHA 4KLMA 4DL6A 5KT5A 4M47A 4WC0A 4RQ3A 4RQ6A 1L3VA 2UVRA 4QZBA 2ZTDA 4AT7A 4ATBB 5DG8A 7ICHA 2KZMA 3PR4A 4DOAA 2BCQA 3G6VA 3PNCA 1RYSA 4NLGA 1SL2A 3RJJA 4KMUA 4KLUA 3JYYA 3OUYB 4YR0A 4M5DA 3Q8SB 8ICEA 9ICRA 4F4WA 2XY7A 1T7PA 5D46A 3SI8A 1KDHA 3NYBA 4EBEA 5D49A 2ASDA 2B21A 1S76D 7ICQA 4I2FA 4PHEA 2BHNA 4YXMA 3KHGA 5HREA 4X4QA 2ZH6A 1XS9D 4DL2A 1ZQQA 2ZH3A 1ZQAA 5F9NA 3FYHA 2UVUA 4FS2A 7ICNA 4I29A 8ICKA 4KITB 4P4OA 4Z6CA 2J6UA 4I28A 4I27A 3RBDA 5J0TA 5L1JA 3TAPA 3T5LA 4IRKA 5KG0A 5DBCA 4NLKA 4P4MA 4Q8EA 7ICJA 1NK4A 4NM2A 2XGQA 4J9MA 5HRFA 4Q8FA 4F50A 2BE3A 3PO5A 2OWOA 5KG1A 3L9DA 3OVAA 8ICIA 9ICSA 1A77A 4O3OA 3N4MB 2C28A 8ICCA 4J9PA 2BPCA 2JEIA 4AT8B 1VFGA 4EYHB 4GLXA 3PY8A 3V7KA 1QLNA 5KT2A 3Q8KA 2JEJA 3RR8A 4O3SA 5L1LA 4RWOA 4RZRA 2BDPA 3PW7A 4ELTA 1D8LA 4NXZA 4R65A 4UQGA 3HT3A 2KFZA 3K75D 3MFIA 7ICUA 4WCWA 4YXJA 2ASLA 3TFRA 5DQGA 3UQ0A 9ICTA 4M9NA 3AU2A 5L9XA 3V6JA 1NK9A 1XSPA 2LYHA 1IXRA 2HHSA 4X4NA 3UQ2A 3G6XA 4K4IA 4KLJA 9ICGA 5DBAA 1ZQCA 2PFQA 4WC3A 2Q0ZX 2FMSA 5HRBA 1TAUA 1SL0A 2NRWA 4Q44A 3HWTA 4ED0A 4E0DA 1TV9A 3H8SA 9ICFA 5KG4A 1ZQXA 5KG2A 1SKSA 1X9SA 3GILA 1L3UA 3K4GA 3KHLA 3AQMA 4DFMA 1YLQA 1NKCA 2XC9A 2DPJA 1FA0A 4UB2A 1JXLA 4BWMA 2Y1IA 4F4YA 3LDAA 1NOMA 2BQ3A 8ICFA 2BGWA 4LT6A 2IBKA 3C5GA 9ICIA 1B43A 3PR5B 4FHWA 2DR8A 5KFQA 5KFJA 3GQCA 9ICHA 5DEDA 3H7IA 2W9MA 1JN3A 3AQNA 4B9UA 4ED7A 2ZUCA 3MR2A 9ICOA 1X9MA 2RDJA 8ICRA 2KFNA 5L1KA 4J9QA 1AROP 1S0NA 5IIIA 2BCRA 4B9NA 2KZ3A 4RPXA 3RJGA 4F2SA 4NM1A 4KLEA 2M2TA 3T5KA 4DQPA 4FBUA 5J2BA 4J9KA 3TARA 3GIJA 4DO9A 2KN7A 4RQ5A 5IILA 4DL3A 1SZPA 9ICWA 2FPLA 4F3OA 5HHIA 3BDPA 3T3FA 1XU4A 5KFVA 1MC8A 3AUOA 5HP4A 2BCUA 3JZ0A 3N97B 1K1SA 4FH5A 2RFFA 1ZQOA 4F4ZA 3AQKA 2R8IA 2ZH5A 4IQWA 1ZQZA 3C5FA 4QZAA 1JMSA 5KFGA 4YMMA 4UAWA 1MQ3A 5F2VO 7ICSA 3H40A 4ECWA 2PFPA 3HJ1A 4BWJA 4UB5A 3ISCA 2XCAA 3T5JA 3GIKA 1ZQDA 4O0IA 4KLSA 9ICEA 5HC9A 1X2IA 5KFSA 5DDMA 4YD2A 4GXKA 1NJYA 1ZQFA 5KFPA 5KFNA 1D9DA 2HW3A 3GV5B 4QWAA 1H38A 5DG7A 1RXWA 3KTQA 4DQRA 3LK9A 3HP6A 4X4OA 4TUQA 5F9LA 1HJPA 5CA7A 1PX5A 1RZTA 5CB1A 2NRTA 1Y88A 5HMMA 4O3PA 2HHTA 4AT8A 4AT7B 2ZH2A 4X4UA 2FPKA 2XCPA 2ISPA 1BNOA 9ICMA 4EP7A 2R8JA 9ICVA 4WC6A 4FHXA 4YP3A 4ELVA 4QW9A 4LZDA 5HRGA 5KFHA 4WBZA 1Z3EB 9ICKA 5J29A 4TQSA 5DQIA 1KFSA 3TAQA 2RDIA 5DB7A 1QSYA 7ICMA 1Z00B 3HPOA 4DSEA 5DB6A 3WFRE 5KFIA 8ICBA 2AJQA 2BCVA 7ICTA 3PMNA 3EPGA 3OHAA 1NK0A 4GC6A 4DQQA 1N56A 9ICAA 1KEJA 2HHUA 1XC9A 1NKBA 2A1JB 4F5OA 3TQ1A 1NKEA 4R66A 3RR7A 4EBJA 4ECRA 1TK8A 1QSSA 2FPMA 1U49A 3RBEA 3ISDA 4X0BA 1A76A 2PFNA 4NKUA 4F4KA 3M8RA 3QEAZ 4DSJA 4MF2A 4I2EA 4KN4A 3UXPA 2HHQA 4NLZA 5KFRA 1F5AA 4EEYA 8ICSA 3KHRA 4UB4A 4ECYA 1UETA 7ICEA 3JPQA 2JEGA 4KLTA 1R8CA 2MAXA 2MUTA 2I9GA 4XQ7A 1XWLA 2AGQA 2UVVA 4YD1A 4RUCA 4TQRA 1LV5A 5CP2A 1LB2B 1TFWA 3WFOA 4Z6DA 5J2HA 8ICTA 5HR9A 3B0YA 3Q8MA 4ED3A 4YQWA 3MGHA 1ZQHA 9ICXA 1WOTA 4IQVA 4RQ4A 4MFAA 3Q8LA 5EWFA 4M9LA 1KFTA 3C1ZA 5DLFA 3RH5A 1JQRA 1Q78A 1ZYQA 5KFYA 2M9NA 3FDSA 3GFKB 3MDCA 9ICLA 4FHPA 5J2GA 1ZQYA 1UEVA 2ZJ8A 4DQIA 5J2EA 5KG5A 4RT2A 1SKRA 5KFZA 1NJXA 4I2DA 4QZ9A 5KT6A 4RPYA 1KTQA 4F4XA 2C2RA 2J6SA 2P6UA 2KP7A 4ECZA 3H3AA 3ORYA 4DFKA 4UB3A 1K1QA 4YCXA 1ZQNA 4O3NA 3M8SA 2DFLA 2PBEA 3V6KA 3BQ1A 3OJSA 2HHWA 3EZ5A 2F1IA 3C2LA 2C22A 4AT9A 4R64A 1UT8A 5BOMA 1U4BA 1TK0A 5KFDA 2JZBA 4RQ7A 5KFKA 4TUSA 3MGIA 3JPSA 2W9CB 5J2JA 2BQUA 4JWNA 1R8AA 4NKTA 3Q8QB 2NRZA 4FBTA 1ZQRA 3M9MB 1NJZA 3UPQA 4F92B 4DFJA 3RB4A 4QWCA 4JV2A 3OVSA 4JV1A 3PW0A 3RAXA 2NRXA 4QW8A 4DOCA 4DL5A 3TANA 4DWIA 2ZH8A 2PFOA 1DK2A 5IIJA 3HW8A 2W9CA 4KLIA 3Q8RB 9ICQA 4PGQA 3PMLA 4J9RA 3C18A 3ZDCA 4M9HA 3BQ0A 4JUZA 3M9OB 5HRIA 2IMWP 2ZH9A 4XRHA 4YMOA 1MIVA 5J2AA 4MEXA 5DB8A 4MFCA 3H4DA 5EOZA 1ZQPA 2NRVA 2P66A 1RPLA 4RUAA 1XSLA 3GIMA 2M2VA 1UEUA 1KRPA 2XY6A 8ICXA 3C66A 4X4PA 4ED1A 1ZQKA 3AQLA 4Z6FA 5KFOA 1S97A 4F8RA 3MABA 5J0PA 2XGPA 1JAJA 4X4SA 1T8EA 4IR1A 4ELUA 5J2DA 1NK5A 4M6WB 4B9SA 3THVA 4IRDA 4YVZA 4R63A 2DPIA 5J0RA 4XUSA 1B22A 2HHVA 4I2JA 4YN4A 5KFMA 2ISOA 2PI5A 4P4PA 5KFUA 3JPTA 5HMLA 3ISBA 4GXIA 5CWRA 9ICCA 4WC2A 1XO1A 5TZVA 3UPSA 4Q43A 2FLLA 1ZQIA 8ICAA 5CHGA 8ICLA 5KG7A 1NZPA 5KT7A 1ZQUA 3C2KA 1S0OA 4X4VA 2ZTCA 3OSNA 4X5VA 4DL4A 4BXOA 1RYRA 5C5JA 4QZFA 4DOBA 2ID1A 1T4GA 2FLNA 1COOA 5IIOA 1IM4A 5BPCA 3H38A 3PX4A 5BOLA 3IM1A 3MBYA 5DBBA 3PO4A 4WBYA 1UA0A 2FMPA 2O1PA 4J9OA 4DL7A 1SL1A 2JEFA 2VA2A 4I2HA 4E7XA 5J2FA 4GC7A 3SV4A 4RT3A 2W9BA 2ATLA 4KLGA 1BNPA 5KFXA 4F5NA 3RH6A 2ASJA 2UVWA 4KTQA 4QZHA 4M0AA 3OV7A 5D4BA 4RNOA 4JK1A 3PW2A 2BPGA 4KLHA 2KZZA 3H37A 4LZGA 2HHXA 4UD4A 4BDPA 4TURA 1RXVA 4F5RA 4IRCA 3NTUA 2R8HA 4Z6EA 2F1JA 3SZ2A 4YMNA 2R8GA 4E80A 4X4TA 4WC1A 4DS5A 4I2AA 3LQCB 4YG2A 4I2IA 8ICMA 4ED8A 4O3RA 4QWEA 4F5QA 2NRKA 4WC7A 2V9WA 4F93B 4M6WA 5J2CA 3RB6A 2IA6A 4EZ9A 7ICFA 4ECUA 1UA1A 1KLNA 1ZQTA 5J0UA 3KHHA 3EYZA 3NGDA 1ZQSA 4KN7A 2HVIA 2F1HA 1ZQGA 3QEBZ 9ICUA 3GV7B 3WFQE 5KFTA 3QZ7A 3RJKA 4GXJA 2WTFA 1CUKA 2AU0A 2ALZA 4UBCA 2JZBB 3OGUA 4EBKA 9ICNA 4JV0A 4EYIB 1TKDA 4AT9B 4X0AA 1X9WA 3RRGA 5KFLA 1S0VA 4O3QA 5KFWA 4PHDA 5DDYA 4M2YA 4MF8A 8ICOA 4S3NA 4ED2A 4I2GA 3V7LA 4PHAA 1DGSA 2ZH4A 4MEYA 3MR3A 4KLFA 2ZH7A 2AGPA 4C8NA 1C7YA 5KT4A 3E2EA 4DF4A 3H39A 1TK5A 7ICLA 4EBDA 2AGOA 3RTVA 1R8BA 1L3SA 4G3IA 4F91B 4YFKA 4QZ8A 3QE9Y 4I2CA 4YR2A 3OVBA 4DFPA 3MR5A 3RH4A 1ZJNA 3UXNA 5DLGA 1XSNA 1ZJMA 3C1YA 5KFAA 4DQSA 3IHQB 5KG3A 4C8KA 1ZQMA 4J9LA 9ICJA 4ECTA 5DGAA 4KLLA 3ZDEA 4UD5A 1BVSA 4RQ0A 4DSKA 3ETLA 1T3NA 1ZQJA 2V4RA 4FO6A 1WCNA 5J0WA 8ICYA 2XY5A 1NK7A 5HRDA 4MFFA 3ZD9A 4B9VA 3JPOA 1BPYA 2C2EA 3RJIA 1EXNA 3QZ8A 4ECVA 1KSPA 4KLOA 1MSWD 4UAYA 4QWDA 3V7JA 1Q79A 3JPRA 3C23A 4J9SA 8ICHA 1V4AA 8ICVA 3BQ2A 4WC4A 2IHNA 1PZNA 9ICPA 1KFDA 3HX0A 3RJEA 2AQ0A 3H8WA 7ICPA 2DR9A 5CJ7A 2BCSA 4Q45A 4DS4A 7ICIA 2ZH1A 3RAQA 2BKEA 2MUTB 4RU9A 3RB3A 1NJWA 1L3TA 4O5EA 3OHBA 4KLQA 5DB9A 2H5XA 2W9BB 1D9FA 1BPZA 1VJ7A 2ZUBA 4RWNA 2I1QA 4E8FA 3V72A 2GWSA 5IIKA 4M9JA 4NY8A 4M04A 2P6RA 4ECXA 4C8OA 4RWQA 5KFEA 3PW4A 1OU5A 3RJFA 2XO7A 3C2MA 2M2WA 9ICBA 1MIYA 1TFRA 1ZQLA 2A1JA 2Y1JA 4BXOB 3WFPA 1TAQA 3ZD8A 5DKWA 3EWAA 4HYKA 3AU6A 5DGBA 4C8LA 4PGXA 1V9PA 3JPNA 4FH3A 4WC5A 2FMQA 1TFYA 4RNMA 5CR0A 3ZDAA 4DEZA 2ZTEA 4J9NA 1Z00A 4QZCA 1ZQVA 5KFCA 4O9MA 4TUPA 5JUMA 4RQ1A 4O5CA 5HRLA 4IG8A 4XA5A 4QZDA 3WFSC 4RWPA 4DSFA 1WCLA 3LWLA 4EZ6A 4PHPA 5EWGA 4UBBA 7ICOA 4RNNA 4UAZA 5J0XA 5KTQA 4IQTA 4RPZA 3BJYA 3BQTA 1U48A 1HUZA 4FHYA 2DR5A 4ATBA 4F5PA 4F2RA 1S0MA 2Q66A 5DG9A 1S9FA 2BR0A 5HRHA 4DLGA 1JX4A 1ZETA 1R89A 1HUOA 3HJ4A 3HIYA 5HHHA 3TFSA 2HVHA 2ZJAA 2BQRA 1JIHA 2ZUDA 5J0QA 5L1IA 1L5UA 1D8YA 3H4BA 5IINA 2C2DA 4XQ8A 5J2KA 4QZGA 1U45A 2DRAA 4B9LA 3C21A 3PVXA 3OUYA 2VA3A 3T5HA 7ICKA 5DQHA 4DSIA 4PH5A 3G6YA 3ZDBA 3GV8B 4RQ8A 8ICQA 3SV3A 4KLDA 1BPXA 2ZJ5A 3TI0A 4BGDA 4PPXA 3OJUA 4DF8A 4R8UB 3JPPA 4NLNA 1QSLA 1BPDA 1UT5A 3PX6A 4UB1A 4DSLA 4M9GA 3M9NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RB0 A;  8ICU A;  4K4H A;  1U47 A;  1BGX T;  5HRK A;  2IHM A;  4K4G A;  3EPI A;  4ECS A;  5J0O A;  3ZDD A;  2AQ4 A;  8ICG A;  3GII A;  8ICP A;  4ED6 A;  7ICV A;  2W8K A;  4IR9 A;  2M2U A;  5DEC A;  5J0S A;  5KT3 A;  3MDA A;  1ZQE A;  5KFF A;  8ICW A;  4X4R A;  2ZHB A;  1NK8 A;  4JWM A;  1DK3 A;  3PV8 A;  2J6T A;  2DVI A;  2PXI A;  5EWE A;  1MQ2 A;  3SYZ A;  2V4Q A;  5KG6 A;  4B9T A;  2ZHA A;  1BPB A;  4B9M A;  4C8M A;  8ICN A;  1TVA A;  3GDX A;  3V6H A;  5IIM A;  2VAN A;  3PX0 A;  3OSP A;  1S10 A;  3Q8P B;  3H8J A;  4YR3 A;  3LWM A;  5KFB A;  3PW5 A;  4R8U A;  3MFH A;  4ZH4 A;  3B0X A;  7ICG A;  1NK6 A;  1NO5 A;  4QWB A;  2W8L A;  2FLP A;  4CCH A;  1CEZ A;  4LVS A;  7ICR A;  2KTQ A;  1MIW A;  2O5A A;  5HNK A;  4FS1 A;  1QTM A;  8ICZ A;  8ICJ A;  3MR6 A;  3RRH A;  2HHP A;  2DR7 A;  2VA8 A;  2BPF A;  4I2B A;  1BPE A;  4EBC A;  1KNY A;  1ZQW A;  2DRB A;  4RQ2 A;  4PGY A;  4QZE A;  2R8K A;  2W9A A;  5J2I A;  4O5K A;  1S77 D;  4QZI A;  3EW9 A;  1JXE A;  1DOQ A;  4IQU A;  3UXO A;  4DLE A;  1ZQB A;  5J0Y A;  1N48 A;  2PI4 A;  4P2H A;  4ECQ A;  1SKW A;  4FHV A;  1U9L A;  3RJH A;  4KLM A;  4DL6 A;  5KT5 A;  4M47 A;  4WC0 A;  4RQ3 A;  4RQ6 A;  1L3V A;  2UVR A;  4QZB A;  2ZTD A;  4AT7 A;  4ATB B;  5DG8 A;  7ICH A;  2KZM A;  3PR4 A;  4DOA A;  2BCQ A;  3G6V A;  3PNC A;  1RYS A;  4NLG A;  1SL2 A;  3RJJ A;  4KMU A;  4KLU A;  3JYY A;  3OUY B;  4YR0 A;  4M5D A;  3Q8S B;  8ICE A;  9ICR A;  4F4W A;  2XY7 A;  1T7P A;  5D46 A;  3SI8 A;  1KDH A;  3NYB A;  4EBE A;  5D49 A;  2ASD A;  2B21 A;  1S76 D;  7ICQ A;  4I2F A;  4PHE A;  2BHN A;  4YXM A;  3KHG A;  5HRE A;  4X4Q A;  2ZH6 A;  1XS9 D;  4DL2 A;  1ZQQ A;  2ZH3 A;  1ZQA A;  5F9N A;  3FYH A;  2UVU A;  4FS2 A;  7ICN A;  4I29 A;  8ICK A;  4KIT B;  4P4O A;  4Z6C A;  2J6U A;  4I28 A;  4I27 A;  3RBD A;  5J0T A;  5L1J A;  3TAP A;  3T5L A;  4IRK A;  5KG0 A;  5DBC A;  4NLK A;  4P4M A;  4Q8E A;  7ICJ A;  1NK4 A;  4NM2 A;  2XGQ A;  4J9M A;  5HRF A;  4Q8F A;  4F50 A;  2BE3 A;  3PO5 A;  2OWO A;  5KG1 A;  3L9D A;  3OVA A;  8ICI A;  9ICS A;  1A77 A;  4O3O A;  3N4M B;  2C28 A;  8ICC A;  4J9P A;  2BPC A;  2JEI A;  4AT8 B;  1VFG A;  4EYH B;  4GLX A;  3PY8 A;  3V7K A;  1QLN A;  5KT2 A;  3Q8K A;  2JEJ A;  3RR8 A;  4O3S A;  5L1L A;  4RWO A;  4RZR A;  2BDP A;  3PW7 A;  4ELT A;  1D8L A;  4NXZ A;  4R65 A;  4UQG A;  3HT3 A;  2KFZ A;  3K75 D;  3MFI A;  7ICU A;  4WCW A;  4YXJ A;  2ASL A;  3TFR A;  5DQG A;  3UQ0 A;  9ICT A;  4M9N A;  3AU2 A;  5L9X A;  3V6J A;  1NK9 A;  1XSP A;  2LYH A;  1IXR A;  2HHS A;  4X4N A;  3UQ2 A;  3G6X A;  4K4I A;  4KLJ A;  9ICG A;  5DBA A;  1ZQC A;  2PFQ A;  4WC3 A;  2Q0Z X;  2FMS A;  5HRB A;  1TAU A;  1SL0 A;  2NRW A;  4Q44 A;  3HWT A;  4ED0 A;  4E0D A;  1TV9 A;  3H8S A;  9ICF A;  5KG4 A;  1ZQX A;  5KG2 A;  1SKS A;  1X9S A;  3GIL A;  1L3U A;  3K4G A;  3KHL A;  3AQM A;  4DFM A;  1YLQ A;  1NKC A;  2XC9 A;  2DPJ A;  1FA0 A;  4UB2 A;  1JXL A;  4BWM A;  2Y1I A;  4F4Y A;  3LDA A;  1NOM A;  2BQ3 A;  8ICF A;  2BGW A;  4LT6 A;  2IBK A;  3C5G A;  9ICI A;  1B43 A;  3PR5 B;  4FHW A;  2DR8 A;  5KFQ A;  5KFJ A;  3GQC A;  9ICH A;  5DED A;  3H7I A;  2W9M A;  1JN3 A;  3AQN A;  4B9U A;  4ED7 A;  2ZUC A;  3MR2 A;  9ICO A;  1X9M A;  2RDJ A;  8ICR A;  2KFN A;  5L1K A;  4J9Q A;  1ARO P;  1S0N A;  5III A;  2BCR A;  4B9N A;  2KZ3 A;  4RPX A;  3RJG A;  4F2S A;  4NM1 A;  4KLE A;  2M2T A;  3T5K A;  4DQP A;  4FBU A;  5J2B A;  4J9K A;  3TAR A;  3GIJ A;  4DO9 A;  2KN7 A;  4RQ5 A;  5IIL A;  4DL3 A;  1SZP A;  9ICW A;  2FPL A;  4F3O A;  5HHI A;  3BDP A;  3T3F A;  1XU4 A;  5KFV A;  1MC8 A;  3AUO A;  5HP4 A;  2BCU A;  3JZ0 A;  3N97 B;  1K1S A;  4FH5 A;  2RFF A;  1ZQO A;  4F4Z A;  3AQK A;  2R8I A;  2ZH5 A;  4IQW A;  1ZQZ A;  3C5F A;  4QZA A;  1JMS A;  5KFG A;  4YMM A;  4UAW A;  1MQ3 A;  5F2V O;  7ICS A;  3H40 A;  4ECW A;  2PFP A;  3HJ1 A;  4BWJ A;  4UB5 A;  3ISC A;  2XCA A;  3T5J A;  3GIK A;  1ZQD A;  4O0I A;  4KLS A;  9ICE A;  5HC9 A;  1X2I A;  5KFS A;  5DDM A;  4YD2 A;  4GXK A;  1NJY A;  1ZQF A;  5KFP A;  5KFN A;  1D9D A;  2HW3 A;  3GV5 B;  4QWA A;  1H38 A;  5DG7 A;  1RXW A;  3KTQ A;  4DQR A;  3LK9 A;  3HP6 A;  4X4O A;  4TUQ A;  5F9L A;  1HJP A;  5CA7 A;  1PX5 A;  1RZT A;  5CB1 A;  2NRT A;  1Y88 A;  5HMM A;  4O3P A;  2HHT A;  4AT8 A;  4AT7 B;  2ZH2 A;  4X4U A;  2FPK A;  2XCP A;  2ISP A;  1BNO A;  9ICM A;  4EP7 A;  2R8J A;  9ICV A;  4WC6 A;  4FHX A;  4YP3 A;  4ELV A;  4QW9 A;  4LZD A;  5HRG A;  5KFH A;  4WBZ A;  1Z3E B;  9ICK A;  5J29 A;  4TQS A;  5DQI A;  1KFS A;  3TAQ A;  2RDI A;  5DB7 A;  1QSY A;  7ICM A;  1Z00 B;  3HPO A;  4DSE A;  5DB6 A;  3WFR E;  5KFI A;  8ICB A;  2AJQ A;  2BCV A;  7ICT A;  3PMN A;  3EPG A;  3OHA A;  1NK0 A;  4GC6 A;  4DQQ A;  1N56 A;  9ICA A;  1KEJ A;  2HHU A;  1XC9 A;  1NKB A;  2A1J B;  4F5O A;  3TQ1 A;  1NKE A;  4R66 A;  3RR7 A;  4EBJ A;  4ECR A;  1TK8 A;  1QSS A;  2FPM A;  1U49 A;  3RBE A;  3ISD A;  4X0B A;  1A76 A;  2PFN A;  4NKU A;  4F4K A;  3M8R A;  3QEA Z;  4DSJ A;  4MF2 A;  4I2E A;  4KN4 A;  3UXP A;  2HHQ A;  4NLZ A;  5KFR A;  1F5A A;  4EEY A;  8ICS A;  3KHR A;  4UB4 A;  4ECY A;  1UET A;  7ICE A;  3JPQ A;  2JEG A;  4KLT A;  1R8C A;  2MAX A;  2MUT A;  2I9G A;  4XQ7 A;  1XWL A;  2AGQ A;  2UVV A;  4YD1 A;  4RUC A;  4TQR A;  1LV5 A;  5CP2 A;  1LB2 B;  1TFW A;  3WFO A;  4Z6D A;  5J2H A;  8ICT A;  5HR9 A;  3B0Y A;  3Q8M A;  4ED3 A;  4YQW A;  3MGH A;  1ZQH A;  9ICX A;  1WOT A;  4IQV A;  4RQ4 A;  4MFA A;  3Q8L A;  5EWF A;  4M9L A;  1KFT A;  3C1Z A;  5DLF A;  3RH5 A;  1JQR A;  1Q78 A;  1ZYQ A;  5KFY A;  2M9N A;  3FDS A;  3GFK B;  3MDC A;  9ICL A;  4FHP A;  5J2G A;  1ZQY A;  1UEV A;  2ZJ8 A;  4DQI A;  5J2E A;  5KG5 A;  4RT2 A;  1SKR A;  5KFZ A;  1NJX A;  4I2D A;  4QZ9 A;  5KT6 A;  4RPY A;  1KTQ A;  4F4X A;  2C2R A;  2J6S A;  2P6U A;  2KP7 A;  4ECZ A;  3H3A A;  3ORY A;  4DFK A;  4UB3 A;  1K1Q A;  4YCX A;  1ZQN A;  4O3N A;  3M8S A;  2DFL A;  2PBE A;  3V6K A;  3BQ1 A;  3OJS A;  2HHW A;  3EZ5 A;  2F1I A;  3C2L A;  2C22 A;  4AT9 A;  4R64 A;  1UT8 A;  5BOM A;  1U4B A;  1TK0 A;  5KFD A;  2JZB A;  4RQ7 A;  5KFK A;  4TUS A;  3MGI A;  3JPS A;  2W9C B;  5J2J A;  2BQU A;  4JWN A;  1R8A A;  4NKT A;  3Q8Q B;  2NRZ A;  4FBT A;  1ZQR A;  3M9M B;  1NJZ A;  3UPQ A;  4F92 B;  4DFJ A;  3RB4 A;  4QWC A;  4JV2 A;  3OVS A;  4JV1 A;  3PW0 A;  3RAX A;  2NRX A;  4QW8 A;  4DOC A;  4DL5 A;  3TAN A;  4DWI A;  2ZH8 A;  2PFO A;  1DK2 A;  5IIJ A;  3HW8 A;  2W9C A;  4KLI A;  3Q8R B;  9ICQ A;  4PGQ A;  3PML A;  4J9R A;  3C18 A;  3ZDC A;  4M9H A;  3BQ0 A;  4JUZ A;  3M9O B;  5HRI A;  2IMW P;  2ZH9 A;  4XRH A;  4YMO A;  1MIV A;  5J2A A;  4MEX A;  5DB8 A;  4MFC A;  3H4D A;  5EOZ A;  1ZQP A;  2NRV A;  2P66 A;  1RPL A;  4RUA A;  1XSL A;  3GIM A;  2M2V A;  1UEU A;  1KRP A;  2XY6 A;  8ICX A;  3C66 A;  4X4P A;  4ED1 A;  1ZQK A;  3AQL A;  4Z6F A;  5KFO A;  1S97 A;  4F8R A;  3MAB A;  5J0P A;  2XGP A;  1JAJ A;  4X4S A;  1T8E A;  4IR1 A;  4ELU A;  5J2D A;  1NK5 A;  4M6W B;  4B9S A;  3THV A;  4IRD A;  4YVZ A;  4R63 A;  2DPI A;  5J0R A;  4XUS A;  1B22 A;  2HHV A;  4I2J A;  4YN4 A;  5KFM A;  2ISO A;  2PI5 A;  4P4P A;  5KFU A;  3JPT A;  5HML A;  3ISB A;  4GXI A;  5CWR A;  9ICC A;  4WC2 A;  1XO1 A;  5TZV A;  3UPS A;  4Q43 A;  2FLL A;  1ZQI A;  8ICA A;  5CHG A;  8ICL A;  5KG7 A;  1NZP A;  5KT7 A;  1ZQU A;  3C2K A;  1S0O A;  4X4V A;  2ZTC A;  3OSN A;  4X5V A;  4DL4 A;  4BXO A;  1RYR A;  5C5J A;  4QZF A;  4DOB A;  2ID1 A;  1T4G A;  2FLN A;  1COO A;  5IIO A;  1IM4 A;  5BPC A;  3H38 A;  3PX4 A;  5BOL A;  3IM1 A;  3MBY A;  5DBB A;  3PO4 A;  4WBY A;  1UA0 A;  2FMP A;  2O1P A;  4J9O A;  4DL7 A;  1SL1 A;  2JEF A;  2VA2 A;  4I2H A;  4E7X A;  5J2F A;  4GC7 A;  3SV4 A;  4RT3 A;  2W9B A;  2ATL A;  4KLG A;  1BNP A;  5KFX A;  4F5N A;  3RH6 A;  2ASJ A;  2UVW A;  4KTQ A;  4QZH A;  4M0A A;  3OV7 A;  5D4B A;  4RNO A;  4JK1 A;  3PW2 A;  2BPG A;  4KLH A;  2KZZ A;  3H37 A;  4LZG A;  2HHX A;  4UD4 A;  4BDP A;  4TUR A;  1RXV A;  4F5R A;  4IRC A;  3NTU A;  2R8H A;  4Z6E A;  2F1J A;  3SZ2 A;  4YMN A;  2R8G A;  4E80 A;  4X4T A;  4WC1 A;  4DS5 A;  4I2A A;  3LQC B;  4YG2 A;  4I2I A;  8ICM A;  4ED8 A;  4O3R A;  4QWE A;  4F5Q A;  2NRK A;  4WC7 A;  2V9W A;  4F93 B;  4M6W A;  5J2C A;  3RB6 A;  2IA6 A;  4EZ9 A;  7ICF A;  4ECU A;  1UA1 A;  1KLN A;  1ZQT A;  5J0U A;  3KHH A;  3EYZ A;  3NGD A;  1ZQS A;  4KN7 A;  2HVI A;  2F1H A;  1ZQG A;  3QEB Z;  9ICU A;  3GV7 B;  3WFQ E;  5KFT A;  3QZ7 A;  3RJK A;  4GXJ A;  2WTF A;  1CUK A;  2AU0 A;  2ALZ A;  4UBC A;  2JZB B;  3OGU A;  4EBK A;  9ICN A;  4JV0 A;  4EYI B;  1TKD A;  4AT9 B;  4X0A A;  1X9W A;  3RRG A;  5KFL A;  1S0V A;  4O3Q A;  5KFW A;  4PHD A;  5DDY A;  4M2Y A;  4MF8 A;  8ICO A;  4S3N A;  4ED2 A;  4I2G A;  3V7L A;  4PHA A;  1DGS A;  2ZH4 A;  4MEY A;  3MR3 A;  4KLF A;  2ZH7 A;  2AGP A;  4C8N A;  1C7Y A;  5KT4 A;  3E2E A;  4DF4 A;  3H39 A;  1TK5 A;  7ICL A;  4EBD A;  2AGO A;  3RTV A;  1R8B A;  1L3S A;  4G3I A;  4F91 B;  4YFK A;  4QZ8 A;  3QE9 Y;  4I2C A;  4YR2 A;  3OVB A;  4DFP A;  3MR5 A;  3RH4 A;  1ZJN A;  3UXN A;  5DLG A;  1XSN A;  1ZJM A;  3C1Y A;  5KFA A;  4DQS A;  3IHQ B;  5KG3 A;  4C8K A;  1ZQM A;  4J9L A;  9ICJ A;  4ECT A;  5DGA A;  4KLL A;  3ZDE A;  4UD5 A;  1BVS A;  4RQ0 A;  4DSK A;  3ETL A;  1T3N A;  1ZQJ A;  2V4R A;  4FO6 A;  1WCN A;  5J0W A;  8ICY A;  2XY5 A;  1NK7 A;  5HRD A;  4MFF A;  3ZD9 A;  4B9V A;  3JPO A;  1BPY A;  2C2E A;  3RJI A;  1EXN A;  3QZ8 A;  4ECV A;  1KSP A;  4KLO A;  1MSW D;  4UAY A;  4QWD A;  3V7J A;  1Q79 A;  3JPR A;  3C23 A;  4J9S A;  8ICH A;  1V4A A;  8ICV A;  3BQ2 A;  4WC4 A;  2IHN A;  1PZN A;  9ICP A;  1KFD A;  3HX0 A;  3RJE A;  2AQ0 A;  3H8W A;  7ICP A;  2DR9 A;  5CJ7 A;  2BCS A;  4Q45 A;  4DS4 A;  7ICI A;  2ZH1 A;  3RAQ A;  2BKE A;  2MUT B;  4RU9 A;  3RB3 A;  1NJW A;  1L3T A;  4O5E A;  3OHB A;  4KLQ A;  5DB9 A;  2H5X A;  2W9B B;  1D9F A;  1BPZ A;  1VJ7 A;  2ZUB A;  4RWN A;  2I1Q A;  4E8F A;  3V72 A;  2GWS A;  5IIK A;  4M9J A;  4NY8 A;  4M04 A;  2P6R A;  4ECX A;  4C8O A;  4RWQ A;  5KFE A;  3PW4 A;  1OU5 A;  3RJF A;  2XO7 A;  3C2M A;  2M2W A;  9ICB A;  1MIY A;  1TFR A;  1ZQL A;  2A1J A;  2Y1J A;  4BXO B;  3WFP A;  1TAQ A;  3ZD8 A;  5DKW A;  3EWA A;  4HYK A;  3AU6 A;  5DGB A;  4C8L A;  4PGX A;  1V9P A;  3JPN A;  4FH3 A;  4WC5 A;  2FMQ A;  1TFY A;  4RNM A;  5CR0 A;  3ZDA A;  4DEZ A;  2ZTE A;  4J9N A;  1Z00 A;  4QZC A;  1ZQV A;  5KFC A;  4O9M A;  4TUP A;  5JUM A;  4RQ1 A;  4O5C A;  5HRL A;  4IG8 A;  4XA5 A;  4QZD A;  3WFS C;  4RWP A;  4DSF A;  1WCL A;  3LWL A;  4EZ6 A;  4PHP A;  5EWG A;  4UBB A;  7ICO A;  4RNN A;  4UAZ A;  5J0X A;  5KTQ A;  4IQT A;  4RPZ A;  3BJY A;  3BQT A;  1U48 A;  1HUZ A;  4FHY A;  2DR5 A;  4ATB A;  4F5P A;  4F2R A;  1S0M A;  2Q66 A;  5DG9 A;  1S9F A;  2BR0 A;  5HRH A;  4DLG A;  1JX4 A;  1ZET A;  1R89 A;  1HUO A;  3HJ4 A;  3HIY A;  5HHH A;  3TFS A;  2HVH A;  2ZJA A;  2BQR A;  1JIH A;  2ZUD A;  5J0Q A;  5L1I A;  1L5U A;  1D8Y A;  3H4B A;  5IIN A;  2C2D A;  4XQ8 A;  5J2K A;  4QZG A;  1U45 A;  2DRA A;  4B9L A;  3C21 A;  3PVX A;  3OUY A;  2VA3 A;  3T5H A;  7ICK A;  5DQH A;  4DSI A;  4PH5 A;  3G6Y A;  3ZDB A;  3GV8 B;  4RQ8 A;  8ICQ A;  3SV3 A;  4KLD A;  1BPX A;  2ZJ5 A;  3TI0 A;  4BGD A;  4PPX A;  3OJU A;  4DF8 A;  4R8U B;  3JPP A;  4NLN A;  1QSL A;  1BPD A;  1UT5 A;  3PX6 A;  4UB1 A;  4DSL A;  4M9G A;  3M9N B; 
#chains in the Genus database with same CATH topology
 3RB0 A;  8ICU A;  2XVT A;  3D2N A;  1U47 A;  5GTI U;  4K4G A;  5ALE A;  5J0O A;  2AQ4 A;  8ICP A;  2K89 A;  3GII A;  5DEC A;  2W8K A;  4IR9 A;  5J0S A;  1ZQE A;  1NK8 A;  1PVP A;  1DK3 A;  3PV8 A;  2J6T A;  2QB1 A;  2DVI A;  2YMP A;  3SYZ A;  4B9T A;  2KMD A;  1P7D A;  2W04 A;  1BPB A;  3ERC C;  8ICN A;  4EEK A;  1KL9 A;  5IIM A;  3PX0 A;  3SQI A;  3I1Y A;  4YR3 A;  4WBY A;  1B4F A;  2FLP A;  2KVS A;  2YTU A;  1MIW A;  2JRZ A;  2Q4T A;  5HNK A;  1OXJ A;  2VA8 A;  5AKE A;  2DRB A;  2IOH A;  4QZI A;  2PI4 A;  4P2H A;  1DGJ A;  3MGV A;  4FHV A;  1U9L A;  1PUZ A;  4DL6 A;  3ICX A;  5G5H A;  2LM4 A;  2GLE A;  2KZM A;  3A0H U;  2BCQ A;  3PNC A;  1SB3 C;  4NLG A;  2KJ5 A;  4KMU A;  3TAD A;  3OUY B;  5HR7 A;  4YR0 A;  5AI4 A;  4JB3 A;  8ICE A;  3D2S A;  1KDH A;  5D49 A;  2B21 A;  1ZQQ A;  2ZH3 A;  3NVZ A;  4O67 A;  4KIT B;  2J6U A;  3L4P A;  5J0T A;  5L1J A;  4IRK A;  5DBC A;  4NLK A;  4P4M A;  2VIX A;  1NK4 A;  3I76 A;  2XGQ A;  4J9M A;  4Q8F A;  4Y2P A;  3OVA A;  8ICI A;  8ICC A;  4J9P A;  2G09 A;  1VFG A;  3IRU A;  4O3S A;  4RZR A;  3A0B U;  1IV8 A;  3TFR A;  3V6J A;  1XSP A;  3PSP A;  1IXR A;  4X4N A;  3G6X A;  4K4I A;  4WC3 A;  2Q0Z X;  4GIB A;  1KBU A;  4E0D A;  2Y0S C;  3VC8 A;  1ZQX A;  5KG2 A;  2HN1 A;  5AK3 A;  1WWU A;  3GIL A;  5AM1 A;  1YLQ A;  1NKC A;  2GH1 A;  4BWM A;  2BQ3 A;  3LDA A;  1NOM A;  8ICF A;  2BGW A;  2IBK A;  2DR8 A;  2LM1 A;  5KFQ A;  3GQC A;  4O6A A;  9ICO A;  1X9M A;  2RDJ A;  4FZL A;  4F2S A;  2RLT A;  4DQP A;  4FBU A;  3GIJ A;  4DO9 A;  5IIL A;  1SZP A;  5HP4 A;  5AHX A;  3N97 B;  1K1S A;  4F4Z A;  3AQK A;  1PVQ A;  2R8I A;  2ZH5 A;  1CRX A;  1ZQZ A;  2AH5 A;  1JMS A;  2BBH A;  4YMM A;  2YB4 A;  2PFP A;  3HJ1 A;  4C0Z A;  2RHF A;  1ZQD A;  4O0I A;  1X2I A;  1NJY A;  1ZQF A;  1Q8K A;  5KFN A;  3GV5 B;  1RXW A;  2E1F A;  4X4O A;  3HP6 A;  2I6X A;  1VDV A;  1PK1 A;  1Y88 A;  1N62 A;  4OJL A;  1ZD2 P;  4P0P B;  1ED1 A;  2R8J A;  9ICV A;  5AI8 A;  4FHX A;  3ONN A;  1F0M A;  5ALK A;  4YP3 A;  4ELV A;  4LZD A;  1Z3E B;  5ALD A;  1KFS A;  1RG6 A;  5DB7 A;  1DRG A;  2LHT A;  3WK5 A;  8ICB A;  2BCV A;  7ICT A;  3PMN A;  4DQQ A;  1N56 A;  1L6N A;  3R9K A;  1XC9 A;  4HX0 A;  3TQ1 A;  3RR7 A;  2HCF A;  3NUQ A;  1U49 A;  3ISD A;  3NAS A;  4F4K A;  3GU3 A;  3QEA Z;  4MF2 A;  4P0P A;  3UXP A;  4ECY A;  1PK1 B;  2MUT A;  2F2A B;  4XQ7 A;  2KE7 A;  2UVV A;  2XID A;  4TQR A;  4OAG A;  5HR9 A;  5J2H A;  3SMV A;  4KX3 A;  4ED3 A;  2E8P A;  4YQW A;  3Q8M A;  1ZQH A;  4IQV A;  1YT3 A;  4M9L A;  4MFA A;  5EWF A;  3RH5 A;  1JQR A;  9ICL A;  1MA7 A;  5J2G A;  2ZJ8 A;  5CFS A;  4QZ9 A;  3IG8 A;  4F4X A;  4C4R A;  3ORY A;  4DFK A;  2B56 A;  1ZQN A;  2DFL A;  3V6K A;  3OJS A;  3EZ5 A;  2C22 A;  2KJ8 A;  3RF9 A;  4MKP A;  3M9M B;  4UAV A;  4QWC A;  2K4E A;  5ALV A;  5ALM A;  2NRX A;  3RAX A;  2ZIX A;  5ALG A;  4J9R A;  3PML A;  3C18 A;  2RP5 A;  4JUZ A;  2IMW P;  5TIS U;  4MEX A;  2WF7 A;  3H4D A;  5EOZ A;  1ZQP A;  2M2V A;  1XSL A;  1UEU A;  4EEN A;  1KRP A;  1SV0 C;  4ED1 A;  4X4S A;  3MAB A;  1JAJ A;  2W11 A;  1T8E A;  4UAT A;  4ELU A;  1URJ A;  4WJ3 B;  1LKY A;  4R63 A;  4XUS A;  5KFM A;  1UPH A;  4P4P A;  5AI9 A;  5HML A;  3SD7 A;  4Y2S A;  4Q43 A;  5CHG A;  5AKX A;  3C2K A;  1O08 A;  5AM4 A;  3OSN A;  2ZXH A;  4DL4 A;  4BXO A;  3QU9 A;  2GA9 D;  2GAF D;  2E3T A;  4QZF A;  1N2X A;  4DOB A;  2FLN A;  1COO A;  3H38 A;  3PX4 A;  3MBY A;  4OCZ A;  2RRD A;  1KKX A;  3CRX A;  1X40 A;  3ER9 B;  1SL1 A;  4DL7 A;  2JEF A;  5J2F A;  1LVH A;  2UVW A;  2XIC A;  3PW2 A;  2HDO A;  4TUR A;  5AKG A;  4F5R A;  2EQY A;  4IRC A;  3NTU A;  2JH7 A;  2F1J A;  1Q46 A;  3CW2 C;  2R8G A;  3ED5 A;  4O3R A;  4F5Q A;  2Q66 A;  2IA6 A;  4PZO A;  5J0U A;  1ZQS A;  3WKD A;  1B0X A;  2W54 A;  3RJK A;  3BQ7 A;  4GXJ A;  2ALZ A;  4Y2V A;  9ICN A;  4AT9 B;  5KAF U;  2W03 A;  1UHU A;  1S0V A;  4NXV A;  1Z4O A;  2KOB A;  4PL1 A;  3CYM A;  5DDY A;  2CRX A;  3V7L A;  1DGS A;  2FJ6 A;  4DF4 A;  1TK5 A;  7ICL A;  3F2C A;  4YFK A;  4I2C A;  4PJ0 U;  3RH4 A;  4NJ8 A;  5DLG A;  1SXE A;  1OW5 A;  3C1Y A;  5KG3 A;  3FC4 A;  4J9L A;  1FIQ A;  2H3V A;  1ZQJ A;  2LBO A;  1WCN A;  1L8O A;  4MFF A;  1Q3U A;  3ZD9 A;  4B9V A;  1BPY A;  2A19 A;  3QZ8 A;  3O0F A;  1Q79 A;  4WC4 A;  2ODG A;  3HX0 A;  4FFD A;  2AQ0 A;  2DR9 A;  3RAQ A;  3RB3 A;  3OHB A;  1VJ7 A;  2H5X A;  2W9B B;  1Z1V A;  4RWN A;  4E8F A;  2W43 A;  3M1Y A;  5IIK A;  3SAF A;  5ALW A;  4RWQ A;  2Y1J A;  2YML A;  2OH2 A;  4QJF B;  1TAQ A;  5DKW A;  1A0P A;  1V9P A;  2KSO A;  1TFY A;  5CR0 A;  1ZD3 A;  3ZDA A;  4DEZ A;  4J9N A;  5KFC A;  1Z00 A;  3QUT A;  2EAN A;  1HIW A;  4DSF A;  3LWL A;  1SGG A;  4KB6 A;  3QNM A;  3KOO A;  4RNN A;  4UAZ A;  5J0X A;  1HUZ A;  4RPZ A;  3N7P D;  2DR5 A;  4F5P A;  4DLG A;  1KW4 A;  3HIY A;  2ZJA A;  5ALR A;  1JIH A;  2WHE A;  5J0Q A;  3K1R B;  4XQ8 A;  1X42 A;  4B9L A;  1HEK A;  5AKI A;  2VA3 A;  3OUY A;  5JTI A;  7ICK A;  4DSI A;  3G6Y A;  3VCB A;  2K4H A;  1BPD A;  3PX6 A;  2G06 A;  2KHQ A;  4DSE A;  4K4H A;  3N28 A;  3K1Z A;  4G9B A;  4U6P A;  5KFF A;  2ZHB A;  3NVW A;  4JWM A;  5EWE A;  2V4Q A;  1JUD A;  4C8M A;  4EX6 A;  3UM9 A;  2ESE A;  3OSP A;  3F53 A;  4CF3 A;  3H8J A;  3PW5 A;  2PMZ F;  3MFH A;  5CRX A;  1NO5 A;  4FO1 A;  4FS1 A;  1QTM A;  2BPF A;  2VJ4 A;  1BPE A;  4EBC A;  2QAR B;  3UMC A;  1ZQW A;  3EW9 A;  1DOQ A;  5JRT A;  1J2M A;  4KLM A;  4WC0 A;  4M47 A;  5AI0 A;  4RQ6 A;  1L3V A;  3G6V A;  1QH9 A;  4KLU A;  2EDU A;  2ZXI A;  3Q8S B;  5D46 A;  3SI8 A;  2ASD A;  7ICQ A;  1S76 D;  4PHE A;  5HRE A;  3KHG A;  5ALL A;  4DL2 A;  5F9N A;  3FYH A;  2UVU A;  4CGZ A;  2Y9T A;  3RBD A;  8ICW A;  7ICJ A;  2D8C A;  8ICV A;  3NVV A;  4NM2 A;  5HRF A;  2JMG A;  1FO4 A;  4FZN A;  2OWO A;  5KG1 A;  4AT7 B;  2DL0 A;  3BZK A;  4OO1 J;  4AT8 B;  2BPC A;  4ICA A;  3PY8 A;  1QLN A;  2JEJ A;  5CFT A;  4RWO A;  2BDP A;  4ELT A;  2EZZ A;  7ICU A;  2F8K A;  3K75 D;  2ASL A;  4CDG A;  1FFV A;  2ZIV B;  3AU2 A;  2LYH A;  3DV9 A;  2HHS A;  3UQ2 A;  4KLJ A;  3L3F X;  1ZQC A;  2EZX A;  5EE1 A;  5HRB A;  3FM9 A;  2NRW A;  4Q44 A;  2KK0 A;  1XO0 A;  1L3U A;  4DFM A;  1FA0 A;  4BUG A;  3C5G A;  9ICI A;  1B43 A;  5KFJ A;  1QQ7 A;  5DED A;  3AQN A;  4ED7 A;  4B6J A;  8ICM A;  4B9N A;  2KZ3 A;  3RJG A;  4KLE A;  3T5K A;  2EAM A;  5J2B A;  4J9K A;  2KN7 A;  4F3O A;  1SXD A;  1XU4 A;  3AUO A;  4IC9 A;  2RFF A;  3IN5 A;  1X6I A;  3C5F A;  4QZA A;  5KFG A;  4OD0 A;  1MQ3 A;  5F2V O;  3GZF A;  2MSN A;  2OM6 A;  3H40 A;  1QQ6 A;  2WAQ C;  3HJE A;  3ISC A;  4K8V A;  2JHD A;  1O03 A;  4KLS A;  3KZX A;  4GXK A;  5EE3 A;  4EEB A;  1D9D A;  2YQE A;  4JMU A;  1H38 A;  4QWA A;  4NXT A;  3PSI A;  3KTQ A;  4DQR A;  5F9L A;  5CB1 A;  1RYU A;  2NRT A;  4AP9 A;  4O3P A;  3WK4 A;  4X4U A;  4EP7 A;  4LEY A;  5KFH A;  5J29 A;  4TQS A;  3TAQ A;  1QSY A;  2K4I A;  2AJQ A;  5JU5 A;  3EPG A;  3OHA A;  3UMG A;  2NYV A;  2PKE A;  4ECR A;  1TK8 A;  2W7O A;  3SR6 A;  1PVR A;  1A76 A;  4NKU A;  2ZIU B;  3NRW A;  4I2E A;  2HHQ A;  1F5A A;  3KHR A;  1UET A;  1J2N A;  2JEG A;  2O6K A;  2AGQ A;  4RUC A;  1LV5 A;  3BZC A;  2Y0S F;  2G5I B;  3ETR A;  4Y2T A;  9ICX A;  4RQ4 A;  1L7N A;  1KFT A;  2G08 A;  4OJ5 A;  1ZYQ A;  5KFY A;  3MDC A;  5GTH U;  4CF4 A;  5KFZ A;  1NJX A;  4I2D A;  4ECZ A;  1K1Q A;  2YN4 A;  4YCX A;  3M8S A;  5L1M A;  2F1I A;  5KL8 B;  3K7D A;  1UT8 A;  4HAI A;  4RQ7 A;  5KFK A;  3MGI A;  3PSF A;  2BQU A;  1R8A A;  3Q8Q B;  4ZOH C;  5D63 A;  4F71 A;  1SV0 A;  3UPQ A;  4F92 B;  1ZQ1 C;  4DFJ A;  2F76 X;  3OVS A;  4QW8 A;  4DOC A;  3LVV A;  4DWI A;  3RFA A;  1DK2 A;  4KLI A;  2W9C A;  3KD3 A;  3ZDC A;  4DFD A;  4M9H A;  5HRI A;  2QLT A;  1UCV A;  1VLB A;  2D3D A;  1MIV A;  3HKZ C;  5DB8 A;  2NRV A;  3GIM A;  5AIC A;  4US9 A;  2XY6 A;  4X4P A;  4BJQ A;  5J0P A;  2XGP A;  1JAL A;  4IR1 A;  4IRD A;  4YVZ A;  2OXO A;  5J0R A;  2ISO A;  1JRO A;  5KFU A;  2FDR A;  4XJE A;  3JPT A;  3ISB A;  2FLL A;  1ZQI A;  4CNQ A;  1NZP A;  5KG7 A;  2W7P A;  5KT7 A;  1ZQU A;  4A8E A;  2HBM A;  4QIW F;  2DF4 B;  1T4G A;  4NLC A;  3H0L B;  2FMP A;  3WK9 A;  4I2H A;  5J8Y A;  4GC7 A;  2ATL A;  5KNI A;  3RH6 A;  2KNJ A;  3H37 A;  3LVW A;  4N7R A;  2HHX A;  1RXV A;  4PZN A;  4WQK A;  2R8H A;  4Z6E A;  3SZ2 A;  4KMO B;  4YMN A;  4E80 A;  3QU7 A;  2P35 A;  4YG2 A;  1S5L U;  2HMX A;  1N63 A;  4KX5 A;  4QWE A;  4WC7 A;  2V9W A;  4EZ9 A;  4ECU A;  1UA1 A;  3EYZ A;  3KHH A;  3NGD A;  4PL2 A;  3QEB Z;  3WFQ E;  5KFT A;  2WTF A;  1WG8 A;  4JV0 A;  4EYI B;  1Z1B A;  5B3Q A;  3BS7 A;  8ICO A;  4ED2 A;  4I2G A;  4IL6 U;  4PHA A;  1ZD4 A;  3MR3 A;  4KLF A;  2AGP A;  2ES6 A;  4C8N A;  3S6J A;  2Y9U A;  1N61 A;  1L3S A;  4F91 B;  4DFP A;  3MR5 A;  2WB1 F;  3UXN A;  1XSN A;  5HR6 A;  4DQS A;  3IHQ B;  4OAI Z;  4UD5 A;  4RQ0 A;  4UAU A;  4UB8 U;  8ICY A;  2XY5 A;  5HRD A;  1RQN A;  3DDH A;  3JPO A;  2ZIV A;  4RQM A;  2Z7J A;  1TAM A;  4QWD A;  3JPR A;  1V4A A;  2FE9 A;  1N60 A;  3BQ2 A;  9ICP A;  7ICP A;  2M0N A;  2BKE A;  2MUT B;  1L3T A;  4KLQ A;  1N5W A;  5DB9 A;  1BPZ A;  2I1Q A;  3V72 A;  2GWS A;  4NY8 A;  4M04 A;  2K4P A;  4ECX A;  4O69 A;  2WF6 A;  3RJF A;  3F5A A;  2M2W A;  5H2F U;  1MIY A;  1TFR A;  1ZQL A;  4P0Q A;  3ZD8 A;  3JPN A;  2FMQ A;  4CRX A;  3AM9 A;  3SAG A;  4TUP A;  5HRL A;  3NVO A;  4IG8 A;  4XA5 A;  2LKY A;  4RWP A;  4PHP A;  2KKV A;  4FHY A;  1S0M A;  2BR0 A;  5HRH A;  1JX4 A;  3HJ4 A;  5B66 U;  1K5O A;  5CEH A;  2HVH A;  1RQL A;  2QAR A;  3H4B A;  5J2K A;  1U45 A;  2E5S A;  3C21 A;  3WKB A;  1ZOL A;  5AIB A;  2F3N A;  4RQ8 A;  3JPP A;  3IV6 A;  3AQE A;  2FI1 A;  1SZH A;  3AEV A;  1BGX T;  5HRK A;  3QU4 A;  8ICG A;  1NNL A;  3MDA A;  4X4R A;  5AKK A;  4K96 A;  4UAS A;  3HKZ F;  3TKA A;  3GDX A;  3NVY A;  2JXJ A;  3B0X A;  4ZH4 A;  1NK6 A;  4QWB A;  2W8L A;  7ICG A;  1CEZ A;  7ICR A;  2KTQ A;  1SWW A;  2DBY A;  2DR7 A;  4I2B A;  2KV2 A;  1KNY A;  4QZE A;  2R8K A;  1S77 D;  2W9A A;  3UXO A;  4ECQ A;  3QYP A;  1SKW A;  5KT5 A;  3HRD D;  4AT7 A;  4QZB A;  5DG8 A;  1XNS A;  3JCF A;  3RJJ A;  3JYY A;  2LPE A;  3M6K A;  2W3R A;  1DXS A;  9ICR A;  1T7P A;  4K9A A;  4EBE A;  2G0A A;  2BHN A;  4YXM A;  1XS9 D;  5ALI A;  4FS2 A;  7ICN A;  8ICK A;  4P4O A;  4I28 A;  2ZIU A;  4I27 A;  3T5L A;  5KG0 A;  4K98 A;  2BE3 A;  3PO5 A;  4LEV A;  3L9D A;  9ICS A;  4O3O A;  2C28 A;  2JEI A;  4EYH B;  3V7K A;  1V85 A;  5KT2 A;  3Q8K A;  3PW7 A;  4NXZ A;  4R65 A;  4UQG A;  2HOI A;  4YXJ A;  2CXY A;  2E1E A;  1NK9 A;  3NKU A;  3M6Z A;  3CP8 A;  5DBA A;  2HBJ A;  3B9J A;  1TAU A;  3C29 A;  4FZM A;  4ED0 A;  3HWT A;  3H8S A;  2WF5 A;  1X9S A;  4IS7 A;  5D61 A;  2XC9 A;  2DPJ A;  4UB2 A;  1JXL A;  2Y1I A;  2B0C A;  4NLB A;  3PR5 B;  5E79 U;  3H7I A;  4B9U A;  2ZUC A;  3MR2 A;  4NXW A;  5L1K A;  1ARO P;  3KFU F;  4NM1 A;  2M2T A;  4DL3 A;  4Y2R A;  2FPL A;  3AN1 A;  3BDP A;  2BCU A;  5KFV A;  3JZ0 A;  1MC8 A;  4FH5 A;  2JGA A;  1S8O A;  1ZQO A;  4IQW A;  2DKX A;  4UAW A;  7ICS A;  4ECW A;  4BWJ A;  4UB5 A;  2R18 A;  1WUD A;  2XCA A;  3T5J A;  5FP0 A;  4NWI A;  3GIK A;  5KFS A;  5DDM A;  4YD2 A;  3N7R C;  1AQ6 A;  2HW3 A;  2DUY A;  2KIV A;  5DG7 A;  3LK9 A;  5CA7 A;  4GFJ A;  1RZT A;  2MRL A;  3MCR A;  2K8B B;  2KVC A;  2HHT A;  2FPK A;  2XCP A;  9ICM A;  5HRG A;  9ICK A;  5DQI A;  7ICM A;  1Z00 B;  3QUQ A;  2WAQ F;  2IOF K;  5DB6 A;  2OEH A;  1NK0 A;  9ICA A;  1KEJ A;  2A1J B;  2VJ5 A;  4F5O A;  1QSS A;  4X0B A;  3RBE A;  1V97 A;  2PFN A;  3BS5 A;  4DSJ A;  4KN4 A;  2I5H A;  8ICS A;  3LYS A;  7ICE A;  3PST A;  1RM6 C;  4BX9 C;  2I9G A;  1XWL A;  4YD1 A;  1LB2 B;  5CP2 A;  3B0Y A;  1WOT A;  3Q8L A;  4FE3 A;  3C1Z A;  5DLF A;  3WK7 A;  2M9N A;  3FDS A;  3GFK B;  1UEV A;  4DQI A;  5J2E A;  1SKR A;  3C28 A;  4RPY A;  3H0R B;  1KTQ A;  3H3A A;  4QIW C;  1UQV A;  2ZG6 A;  5EE0 A;  3WK8 A;  2PBE A;  3C2L A;  1TE2 A;  1V38 A;  3SEN A;  4AT9 A;  4R64 A;  5BOM A;  1U4B A;  1TK0 A;  5KFD A;  4TUS A;  4JWN A;  3JPS A;  4NKT A;  4FBT A;  2W3S A;  1ZQR A;  4MHV A;  4JV1 A;  2K8A A;  2PFO A;  5IIJ A;  9ICQ A;  4PGQ A;  5D62 A;  3T79 A;  4O3M A;  1L7O A;  3BQ0 A;  3M9O B;  2ZH9 A;  4YMO A;  5J2A A;  2IOF A;  2P66 A;  3C66 A;  8ICX A;  3AQL A;  1S97 A;  3OPX A;  3WKE A;  2HSZ A;  4M6W B;  1ZRM A;  1Z4N A;  1B22 A;  2HHV A;  4I2J A;  2B4V A;  4GXI A;  4WC2 A;  1XO1 A;  8ICA A;  5ALN A;  2KJ9 A;  1S0O A;  4X5V A;  4P0Q B;  1RYR A;  5C5J A;  2RQ5 A;  2DKZ A;  1IM4 A;  5JTG A;  5BOL A;  2OHF A;  5DBB A;  1UA0 A;  3WK6 A;  2O1P A;  2VA2 A;  4OJ6 A;  4KLG A;  3SV4 A;  4RT3 A;  1BNP A;  3OV7 A;  5EE9 A;  2EWR A;  4JK1 A;  2BPG A;  4KLH A;  2KZZ A;  3IDW A;  4LZG A;  4UD4 A;  2EZY A;  1FEZ A;  3F2B A;  1ZD5 A;  3CNH A;  4DS5 A;  4I2A A;  3LQC B;  4I2I A;  4ED8 A;  2NRK A;  5J2C A;  4NXX A;  1KLN A;  3CK6 A;  3KZI U;  2HVI A;  2F1H A;  4K97 A;  2KKP A;  4Y2U A;  3GV7 B;  2F77 X;  4U7C A;  3QZ7 A;  5C0Y A;  2IUB A;  1CUK A;  4UBC A;  1KN5 A;  2E8M A;  3HIL A;  4X0A A;  1X9W A;  3RRG A;  4WH5 A;  1QQ5 A;  5KFL A;  4O3Q A;  5A0L A;  5KFW A;  3U26 A;  4M2Y A;  4MF8 A;  2D6F C;  4S3N A;  4NL9 A;  4MEY A;  5AI5 A;  3FAH A;  1C7Y A;  5KT4 A;  3E2E A;  3H39 A;  1WYG A;  4EBD A;  1R8B A;  4QZ8 A;  1MN8 A;  2ZIW A;  4OJP A;  1ZJN A;  2F44 A;  3F2D A;  5KFA A;  2L5Y A;  4DCC A;  5ALS A;  4ECT A;  1GO3 F;  1YZ7 A;  4KLL A;  3ZDE A;  4DSK A;  3ETL A;  1T3N A;  5J0W A;  4Y2X A;  2AXT U;  3UMB A;  3RJI A;  1KSP A;  2DQN B;  1MSW D;  4UAY A;  4J9S A;  3C23 A;  2EH9 A;  8ICH A;  4ACO A;  5ALT A;  4KM5 A;  3PHZ A;  2BCS A;  4Q45 A;  7ICI A;  1NJW A;  4RU9 A;  2B51 A;  5AM5 A;  3H8M A;  3ER8 C;  1T3Q A;  2E8O A;  5ALZ A;  4C7Y A;  4EX7 A;  3PW4 A;  1OUQ A;  2LMR A;  3WFP A;  3AU6 A;  4HYK A;  3EWA A;  3E58 A;  5AK5 A;  5DGB A;  4WC5 A;  4QZC A;  1ZQV A;  4EEL A;  4JLX A;  4EZ6 A;  1WCL A;  5KAI U;  2LYB A;  4NL9 C;  4UBB A;  7ICO A;  5KTQ A;  4IQT A;  3BJY A;  3BQT A;  4F2R A;  1S9F A;  1PK3 A;  1X9X A;  4CF5 A;  3DEE A;  1HUO A;  2VKQ A;  2BQR A;  2ZUD A;  5L1I A;  1KQQ A;  1D8Y A;  2C2D A;  5IIN A;  5DQH A;  5AKJ A;  4PH5 A;  3ZDB A;  4NV0 A;  1LKY B;  4KLD A;  1BPX A;  4PPX A;  4BGD A;  1M6Y A;  4R8U B;  5ALJ A;  1UT5 A;  4OAF A;  4F8R A;  8ICT A;  2H3Z A;  2IHM A;  1L7M A;  1T94 A;  3EPI A;  4ECS A;  3ZDD A;  7ICV A;  2M2U A;  4C4S A;  4ED6 A;  4I0U A;  5KT3 A;  2QB0 A;  2PXI A;  5ALU A;  1MQ2 A;  5KG6 A;  2ZHA A;  4B9M A;  2YMQ A;  2DGZ A;  2HBK A;  1TVA A;  3V6H A;  2VAN A;  1QCK A;  1S10 A;  5B3P A;  3Q8P B;  3LWM A;  5KFB A;  4R8U A;  4EBK A;  5AM0 A;  4CCH A;  2O5A A;  4LVS A;  2QB0 B;  2LI6 A;  8ICZ A;  8ICJ A;  3MR6 A;  3RRH A;  2HHP A;  2K60 A;  5CHE A;  4RQ2 A;  4PGY A;  2BBJ A;  5J2I A;  4O5K A;  5G5G A;  4DLE A;  1JXE A;  1ZQB A;  4IQU A;  5J0Y A;  1N48 A;  3RJH A;  5B5E U;  1NI3 A;  1ZRN A;  2OCE A;  4RQ3 A;  2UVR A;  2ZTD A;  2HN2 A;  4ATB B;  3QUC A;  7ICH A;  2QKQ A;  3PR4 A;  4DOA A;  1RYS A;  2JV3 A;  1SL2 A;  4AYB F;  4M5D A;  4F4W A;  2XY7 A;  3EF2 A;  3NYB A;  2N1R A;  4LJX A;  3QXG A;  4I2F A;  2KIC A;  4X4Q A;  2ZH6 A;  1ZQA A;  4I29 A;  5ALH A;  4Z6C A;  3TAP A;  4Q8E A;  1RDF A;  4F50 A;  3TAD C;  1A77 A;  3N4M B;  3NS1 A;  4GLX A;  3RR8 A;  4UW9 A;  4AYB C;  5L1L A;  1J97 A;  1D8L A;  3HT3 A;  2KFZ A;  3MFI A;  4WCW A;  2YX8 A;  5DQG A;  5T14 A;  3UQ0 A;  9ICT A;  4M9N A;  1SWV A;  5L9X A;  4Y2Y A;  3L5K A;  9ICG A;  2KIW A;  2PFQ A;  2FMS A;  1SL0 A;  2A1A A;  3I28 A;  1TV9 A;  9ICF A;  5AI6 A;  5KG4 A;  1SKS A;  2A3V A;  3K4G A;  2JR5 A;  3KHL A;  3AQM A;  4EGW A;  2YY6 A;  4F4Y A;  4LT6 A;  4FHW A;  2PMZ C;  3ZI4 A;  9ICH A;  4WOY A;  3QU5 A;  2W9M A;  1JN3 A;  4F72 A;  8ICR A;  2KFN A;  4J9Q A;  1S0N A;  5III A;  2BCR A;  4RPX A;  2H3F A;  3QU2 A;  1FFU A;  2NV3 A;  2CPR A;  3AQF A;  2ZIW B;  4USA A;  3SAH A;  1SIJ A;  3TAR A;  9ICW A;  4RQ5 A;  2GO7 A;  5HHI A;  3T3F A;  3IP4 B;  2DWQ A;  1X66 A;  3PZP A;  4OJO A;  5AKZ A;  3MC1 A;  1ECW A;  2K8C B;  3KKA C;  1WWV A;  5HC9 A;  9ICE A;  1NZB A;  4US8 A;  5AM3 A;  5KFP A;  4TUQ A;  1HJP A;  1PX5 A;  1D8B A;  2FCL A;  5HMM A;  3ALR A;  4AT8 A;  2ZH2 A;  1X6J A;  3IG5 A;  2HI0 A;  4LEZ A;  2ISP A;  1BNO A;  1Q3V A;  2MU2 A;  2BZF A;  4WC6 A;  1F44 A;  4QW9 A;  4WBZ A;  2RDI A;  5ALY A;  3HPO A;  3WFR E;  5KFI A;  4GC6 A;  2HHU A;  4Y2J A;  1NKB A;  4EBJ A;  1NKE A;  4R66 A;  5KL1 B;  2YB1 A;  2FPM A;  3M8R A;  4NLZ A;  5KFR A;  4EEY A;  4UB4 A;  4CE6 A;  2H3I A;  3JPQ A;  4KLT A;  2MAX A;  1R8C A;  3SEI A;  3NWI A;  5ALF A;  1TFW A;  3WFO A;  4Z6D A;  3WKC A;  3MGH A;  3QUB A;  1CI4 A;  1Q78 A;  4FHP A;  3EUB 2;  2G5H B;  3D2Q A;  1ZQY A;  2WF8 A;  5KG5 A;  4RT2 A;  2OYY A;  2J6S A;  5KT6 A;  2C2R A;  2KP7 A;  2P6U A;  4UB3 A;  4O3N A;  5ALO A;  3BQ1 A;  2WF9 A;  1GPJ A;  2HHW A;  2W9C B;  2JZB A;  5ALP A;  5J2J A;  5AKL A;  2NRZ A;  2E8N A;  5F3X B;  1NJZ A;  1A6S A;  3N7S C;  3RB4 A;  4WQL A;  1IG6 A;  4JV2 A;  3PW0 A;  1VJ5 A;  3TAN A;  4DL5 A;  2ZH8 A;  2NO5 A;  3HW8 A;  5K4L A;  4C4T A;  3Q8R B;  2KG5 A;  2AHO B;  4RQN A;  4XRH A;  4MFC A;  1RPL A;  4RUA A;  4LEW A;  5AM2 A;  1ZQK A;  4Z6F A;  5KFO A;  5CFU A;  5J2D A;  1NK5 A;  3BS5 B;  4B9S A;  5J8Y C;  3THV A;  4EV6 A;  5ALQ A;  2DPI A;  5ALX A;  4YN4 A;  2PI5 A;  5AKH A;  5CWR A;  9ICC A;  5TZV A;  3UPS A;  1L7P A;  1F5S A;  2EAO A;  8ICL A;  4X4V A;  2ZTC A;  4O68 A;  2ID1 A;  5AK6 A;  3H0M B;  5IIO A;  2W55 A;  4OAH A;  5BPC A;  1SV4 A;  3IM1 A;  3PO4 A;  4E7X A;  4Y2Q A;  4J9O A;  2B6G A;  2W9B A;  5KFX A;  4F5N A;  2ASJ A;  4KTQ A;  4M0A A;  4QZH A;  5D4B A;  4RNO A;  4BDP A;  4C80 A;  4X4T A;  3AMZ A;  4WC1 A;  4JLZ A;  3F5E A;  4F93 B;  4M6W A;  3RB6 A;  4QNL A;  7ICF A;  1ZQT A;  4KN7 A;  1ZQG A;  9ICU A;  2BDU A;  1ZXI A;  2AU0 A;  2LYA A;  2JZB B;  3OGU A;  1TKD A;  3WKA A;  2HOQ A;  2JH1 A;  3E0F A;  4K9B A;  1JI7 A;  4C7Z A;  4PHD A;  5AK4 A;  2ZH4 A;  2ZH7 A;  4EED A;  2AGO A;  2KHV A;  3RTV A;  4G3I A;  2MA1 A;  3QE9 Y;  3OVB A;  4YR2 A;  1ZJM A;  1YZ6 A;  3OWG A;  4C8K A;  1ZQM A;  1IIP A;  9ICJ A;  5DGA A;  2WFA A;  3QX7 A;  1BVS A;  2NO4 A;  2V4R A;  4FO6 A;  1NK7 A;  1L8L A;  2C2E A;  1EXN A;  4ECV A;  2XI9 A;  4KLO A;  3V7J A;  2IHN A;  1PZN A;  3D6J A;  1KFD A;  3OTQ A;  3RJE A;  2KEY A;  3H8W A;  3TAC B;  5CJ7 A;  4DS4 A;  2ZH1 A;  4O5E A;  2KSO B;  1D9F A;  2ZUB A;  2HOF A;  3KBB A;  4M9J A;  2YMM A;  2P6R A;  4C8O A;  3KKA A;  5KFE A;  5AKY A;  1OU5 A;  4NXU A;  2XO7 A;  3C2M A;  1Z19 A;  9ICB A;  2A1J A;  4BXO B;  4C8L A;  2HBL A;  2G07 A;  4PGX A;  4FH3 A;  2EAP A;  3J81 j;  4RNM A;  4O9M A;  2ZTE A;  3WU2 U;  2CN1 A;  5JUM A;  4RQ1 A;  4O5C A;  4QZD A;  3WFS C;  5EWG A;  3M7D A;  4UAR A;  1U48 A;  4ATB A;  1COK A;  3NRZ A;  5DG9 A;  2WB1 C;  1ZET A;  1R89 A;  5HHH A;  3TFS A;  1L5U A;  2KD1 A;  4J03 A;  5AIA A;  4QZG A;  2DRA A;  3PVX A;  3T5H A;  2IHO A;  1C20 A;  1N5X A;  2GOL A;  3GV8 B;  3AL0 B;  8ICQ A;  3SV3 A;  2ZJ5 A;  3TI0 A;  2F8L A;  3OJU A;  4DF8 A;  4NLN A;  1QSL A;  2ZIX B;  4UB6 U;  4K99 A;  4UB1 A;  4DSL A;  2H3Q A;  4M9G A;  1JRP A;  3M9N B; 
#chains in the Genus database with same CATH homology
 3RB0 A;  8ICU A;  4K4H A;  1U47 A;  1BGX T;  5HRK A;  2IHM A;  4K4G A;  3EPI A;  4ECS A;  5J0O A;  3ZDD A;  2AQ4 A;  8ICG A;  3GII A;  8ICP A;  4ED6 A;  7ICV A;  2W8K A;  4IR9 A;  2M2U A;  5DEC A;  5J0S A;  5KT3 A;  3MDA A;  1ZQE A;  5KFF A;  8ICW A;  4X4R A;  2ZHB A;  1NK8 A;  4JWM A;  1DK3 A;  3PV8 A;  2J6T A;  2DVI A;  2PXI A;  5EWE A;  1MQ2 A;  3SYZ A;  2V4Q A;  5KG6 A;  4B9T A;  2ZHA A;  1BPB A;  4B9M A;  4C8M A;  8ICN A;  1TVA A;  3GDX A;  3V6H A;  5IIM A;  2VAN A;  3PX0 A;  3OSP A;  1S10 A;  3Q8P B;  3H8J A;  4YR3 A;  3LWM A;  5KFB A;  3PW5 A;  4R8U A;  3MFH A;  4ZH4 A;  3B0X A;  7ICG A;  1NK6 A;  1NO5 A;  4QWB A;  2W8L A;  2FLP A;  4CCH A;  1CEZ A;  4LVS A;  7ICR A;  2KTQ A;  1MIW A;  2O5A A;  5HNK A;  4FS1 A;  1QTM A;  8ICZ A;  8ICJ A;  3MR6 A;  3RRH A;  2HHP A;  2DR7 A;  2VA8 A;  2BPF A;  4I2B A;  1BPE A;  4EBC A;  1KNY A;  1ZQW A;  2DRB A;  4RQ2 A;  4PGY A;  4QZE A;  2R8K A;  2W9A A;  5J2I A;  4O5K A;  1S77 D;  4QZI A;  3EW9 A;  1JXE A;  1DOQ A;  4IQU A;  3UXO A;  4DLE A;  1ZQB A;  5J0Y A;  1N48 A;  2PI4 A;  4P2H A;  4ECQ A;  1SKW A;  4FHV A;  1U9L A;  3RJH A;  4KLM A;  4DL6 A;  5KT5 A;  4M47 A;  4WC0 A;  4RQ3 A;  4RQ6 A;  1L3V A;  2UVR A;  4QZB A;  2ZTD A;  4AT7 A;  4ATB B;  5DG8 A;  7ICH A;  2KZM A;  3PR4 A;  4DOA A;  2BCQ A;  3G6V A;  3PNC A;  1RYS A;  4NLG A;  1SL2 A;  3RJJ A;  4KMU A;  4KLU A;  3JYY A;  3OUY B;  4YR0 A;  4M5D A;  3Q8S B;  8ICE A;  9ICR A;  4F4W A;  2XY7 A;  1T7P A;  5D46 A;  3SI8 A;  1KDH A;  3NYB A;  4EBE A;  5D49 A;  2ASD A;  2B21 A;  1S76 D;  7ICQ A;  4I2F A;  4PHE A;  2BHN A;  4YXM A;  3KHG A;  5HRE A;  4X4Q A;  2ZH6 A;  1XS9 D;  4DL2 A;  1ZQQ A;  2ZH3 A;  1ZQA A;  5F9N A;  3FYH A;  2UVU A;  4FS2 A;  7ICN A;  4I29 A;  8ICK A;  4KIT B;  4P4O A;  4Z6C A;  2J6U A;  4I28 A;  4I27 A;  3RBD A;  5J0T A;  5L1J A;  3TAP A;  3T5L A;  4IRK A;  5KG0 A;  5DBC A;  4NLK A;  4P4M A;  4Q8E A;  7ICJ A;  1NK4 A;  4NM2 A;  2XGQ A;  4J9M A;  5HRF A;  4Q8F A;  4F50 A;  2BE3 A;  3PO5 A;  2OWO A;  5KG1 A;  3L9D A;  3OVA A;  8ICI A;  9ICS A;  1A77 A;  4O3O A;  3N4M B;  2C28 A;  8ICC A;  4J9P A;  2BPC A;  2JEI A;  4AT8 B;  1VFG A;  4EYH B;  4GLX A;  3PY8 A;  3V7K A;  1QLN A;  5KT2 A;  3Q8K A;  2JEJ A;  3RR8 A;  4O3S A;  5L1L A;  4RWO A;  4RZR A;  2BDP A;  3PW7 A;  4ELT A;  1D8L A;  4NXZ A;  4R65 A;  4UQG A;  3HT3 A;  2KFZ A;  3K75 D;  3MFI A;  7ICU A;  4WCW A;  4YXJ A;  2ASL A;  3TFR A;  5DQG A;  3UQ0 A;  9ICT A;  4M9N A;  3AU2 A;  5L9X A;  3V6J A;  1NK9 A;  1XSP A;  2LYH A;  1IXR A;  2HHS A;  4X4N A;  3UQ2 A;  3G6X A;  4K4I A;  4KLJ A;  9ICG A;  5DBA A;  1ZQC A;  2PFQ A;  4WC3 A;  2Q0Z X;  2FMS A;  5HRB A;  1TAU A;  1SL0 A;  2NRW A;  4Q44 A;  3HWT A;  4ED0 A;  4E0D A;  1TV9 A;  3H8S A;  9ICF A;  5KG4 A;  1ZQX A;  5KG2 A;  1SKS A;  1X9S A;  3GIL A;  1L3U A;  3K4G A;  3KHL A;  3AQM A;  4DFM A;  1YLQ A;  1NKC A;  2XC9 A;  2DPJ A;  1FA0 A;  4UB2 A;  1JXL A;  4BWM A;  2Y1I A;  4F4Y A;  3LDA A;  1NOM A;  2BQ3 A;  8ICF A;  2BGW A;  4LT6 A;  2IBK A;  3C5G A;  9ICI A;  1B43 A;  3PR5 B;  4FHW A;  2DR8 A;  5KFQ A;  5KFJ A;  3GQC A;  9ICH A;  5DED A;  3H7I A;  2W9M A;  1JN3 A;  3AQN A;  4B9U A;  4ED7 A;  2ZUC A;  3MR2 A;  9ICO A;  1X9M A;  2RDJ A;  8ICR A;  2KFN A;  5L1K A;  4J9Q A;  1ARO P;  1S0N A;  5III A;  2BCR A;  4B9N A;  2KZ3 A;  4RPX A;  3RJG A;  4F2S A;  4NM1 A;  4KLE A;  2M2T A;  3T5K A;  4DQP A;  4FBU A;  5J2B A;  4J9K A;  3TAR A;  3GIJ A;  4DO9 A;  2KN7 A;  4RQ5 A;  5IIL A;  4DL3 A;  1SZP A;  9ICW A;  2FPL A;  4F3O A;  5HHI A;  3BDP A;  3T3F A;  1XU4 A;  5KFV A;  1MC8 A;  3AUO A;  5HP4 A;  2BCU A;  3JZ0 A;  3N97 B;  1K1S A;  4FH5 A;  2RFF A;  1ZQO A;  4F4Z A;  3AQK A;  2R8I A;  2ZH5 A;  4IQW A;  1ZQZ A;  3C5F A;  4QZA A;  1JMS A;  5KFG A;  4YMM A;  4UAW A;  1MQ3 A;  5F2V O;  7ICS A;  3H40 A;  4ECW A;  2PFP A;  3HJ1 A;  4BWJ A;  4UB5 A;  3ISC A;  2XCA A;  3T5J A;  3GIK A;  1ZQD A;  4O0I A;  4KLS A;  9ICE A;  5HC9 A;  1X2I A;  5KFS A;  5DDM A;  4YD2 A;  4GXK A;  1NJY A;  1ZQF A;  5KFP A;  5KFN A;  1D9D A;  2HW3 A;  3GV5 B;  4QWA A;  1H38 A;  5DG7 A;  1RXW A;  3KTQ A;  4DQR A;  3LK9 A;  3HP6 A;  4X4O A;  4TUQ A;  5F9L A;  1HJP A;  5CA7 A;  1PX5 A;  1RZT A;  5CB1 A;  2NRT A;  1Y88 A;  5HMM A;  4O3P A;  2HHT A;  4AT8 A;  4AT7 B;  2ZH2 A;  4X4U A;  2FPK A;  2XCP A;  2ISP A;  1BNO A;  9ICM A;  4EP7 A;  2R8J A;  9ICV A;  4WC6 A;  4FHX A;  4YP3 A;  4ELV A;  4QW9 A;  4LZD A;  5HRG A;  5KFH A;  4WBZ A;  1Z3E B;  9ICK A;  5J29 A;  4TQS A;  5DQI A;  1KFS A;  3TAQ A;  2RDI A;  5DB7 A;  1QSY A;  7ICM A;  1Z00 B;  3HPO A;  4DSE A;  5DB6 A;  3WFR E;  5KFI A;  8ICB A;  2AJQ A;  2BCV A;  7ICT A;  3PMN A;  3EPG A;  3OHA A;  1NK0 A;  4GC6 A;  4DQQ A;  1N56 A;  9ICA A;  1KEJ A;  2HHU A;  1XC9 A;  1NKB A;  2A1J B;  4F5O A;  3TQ1 A;  1NKE A;  4R66 A;  3RR7 A;  4EBJ A;  4ECR A;  1TK8 A;  1QSS A;  2FPM A;  1U49 A;  3RBE A;  3ISD A;  4X0B A;  1A76 A;  2PFN A;  4NKU A;  4F4K A;  3M8R A;  3QEA Z;  4DSJ A;  4MF2 A;  4I2E A;  4KN4 A;  3UXP A;  2HHQ A;  4NLZ A;  5KFR A;  1F5A A;  4EEY A;  8ICS A;  3KHR A;  4UB4 A;  4ECY A;  1UET A;  7ICE A;  3JPQ A;  2JEG A;  4KLT A;  1R8C A;  2MAX A;  2MUT A;  2I9G A;  4XQ7 A;  1XWL A;  2AGQ A;  2UVV A;  4YD1 A;  4RUC A;  4TQR A;  1LV5 A;  5CP2 A;  1LB2 B;  1TFW A;  3WFO A;  4Z6D A;  5J2H A;  8ICT A;  5HR9 A;  3B0Y A;  3Q8M A;  4ED3 A;  4YQW A;  3MGH A;  1ZQH A;  9ICX A;  1WOT A;  4IQV A;  4RQ4 A;  4MFA A;  3Q8L A;  5EWF A;  4M9L A;  1KFT A;  3C1Z A;  5DLF A;  3RH5 A;  1JQR A;  1Q78 A;  1ZYQ A;  5KFY A;  2M9N A;  3FDS A;  3GFK B;  3MDC A;  9ICL A;  4FHP A;  5J2G A;  1ZQY A;  1UEV A;  2ZJ8 A;  4DQI A;  5J2E A;  5KG5 A;  4RT2 A;  1SKR A;  5KFZ A;  1NJX A;  4I2D A;  4QZ9 A;  5KT6 A;  4RPY A;  1KTQ A;  4F4X A;  2C2R A;  2J6S A;  2P6U A;  2KP7 A;  4ECZ A;  3H3A A;  3ORY A;  4DFK A;  4UB3 A;  1K1Q A;  4YCX A;  1ZQN A;  4O3N A;  3M8S A;  2DFL A;  2PBE A;  3V6K A;  3BQ1 A;  3OJS A;  2HHW A;  3EZ5 A;  2F1I A;  3C2L A;  2C22 A;  4AT9 A;  4R64 A;  1UT8 A;  5BOM A;  1U4B A;  1TK0 A;  5KFD A;  2JZB A;  4RQ7 A;  5KFK A;  4TUS A;  3MGI A;  3JPS A;  2W9C B;  5J2J A;  2BQU A;  4JWN A;  1R8A A;  4NKT A;  3Q8Q B;  2NRZ A;  4FBT A;  1ZQR A;  3M9M B;  1NJZ A;  3UPQ A;  4F92 B;  4DFJ A;  3RB4 A;  4QWC A;  4JV2 A;  3OVS A;  4JV1 A;  3PW0 A;  3RAX A;  2NRX A;  4QW8 A;  4DOC A;  4DL5 A;  3TAN A;  4DWI A;  2ZH8 A;  2PFO A;  1DK2 A;  5IIJ A;  3HW8 A;  2W9C A;  4KLI A;  3Q8R B;  9ICQ A;  4PGQ A;  3PML A;  4J9R A;  3C18 A;  3ZDC A;  4M9H A;  3BQ0 A;  4JUZ A;  3M9O B;  5HRI A;  2IMW P;  2ZH9 A;  4XRH A;  4YMO A;  1MIV A;  5J2A A;  4MEX A;  5DB8 A;  4MFC A;  3H4D A;  5EOZ A;  1ZQP A;  2NRV A;  2P66 A;  1RPL A;  4RUA A;  1XSL A;  3GIM A;  2M2V A;  1UEU A;  1KRP A;  2XY6 A;  8ICX A;  3C66 A;  4X4P A;  4ED1 A;  1ZQK A;  3AQL A;  4Z6F A;  5KFO A;  1S97 A;  4F8R A;  3MAB A;  5J0P A;  2XGP A;  1JAJ A;  4X4S A;  1T8E A;  4IR1 A;  4ELU A;  5J2D A;  1NK5 A;  4M6W B;  4B9S A;  3THV A;  4IRD A;  4YVZ A;  4R63 A;  2DPI A;  5J0R A;  4XUS A;  1B22 A;  2HHV A;  4I2J A;  4YN4 A;  5KFM A;  2ISO A;  2PI5 A;  4P4P A;  5KFU A;  3JPT A;  5HML A;  3ISB A;  4GXI A;  5CWR A;  9ICC A;  4WC2 A;  1XO1 A;  5TZV A;  3UPS A;  4Q43 A;  2FLL A;  1ZQI A;  8ICA A;  5CHG A;  8ICL A;  5KG7 A;  1NZP A;  5KT7 A;  1ZQU A;  3C2K A;  1S0O A;  4X4V A;  2ZTC A;  3OSN A;  4X5V A;  4DL4 A;  4BXO A;  1RYR A;  5C5J A;  4QZF A;  4DOB A;  2ID1 A;  1T4G A;  2FLN A;  1COO A;  5IIO A;  1IM4 A;  5BPC A;  3H38 A;  3PX4 A;  5BOL A;  3IM1 A;  3MBY A;  5DBB A;  3PO4 A;  4WBY A;  1UA0 A;  2FMP A;  2O1P A;  4J9O A;  4DL7 A;  1SL1 A;  2JEF A;  2VA2 A;  4I2H A;  4E7X A;  5J2F A;  4GC7 A;  3SV4 A;  4RT3 A;  2W9B A;  2ATL A;  4KLG A;  1BNP A;  5KFX A;  4F5N A;  3RH6 A;  2ASJ A;  2UVW A;  4KTQ A;  4QZH A;  4M0A A;  3OV7 A;  5D4B A;  4RNO A;  4JK1 A;  3PW2 A;  2BPG A;  4KLH A;  2KZZ A;  3H37 A;  4LZG A;  2HHX A;  4UD4 A;  4BDP A;  4TUR A;  1RXV A;  4F5R A;  4IRC A;  3NTU A;  2R8H A;  4Z6E A;  2F1J A;  3SZ2 A;  4YMN A;  2R8G A;  4E80 A;  4X4T A;  4WC1 A;  4DS5 A;  4I2A A;  3LQC B;  4YG2 A;  4I2I A;  8ICM A;  4ED8 A;  4O3R A;  4QWE A;  4F5Q A;  2NRK A;  4WC7 A;  2V9W A;  4F93 B;  4M6W A;  5J2C A;  3RB6 A;  2IA6 A;  4EZ9 A;  7ICF A;  4ECU A;  1UA1 A;  1KLN A;  1ZQT A;  5J0U A;  3KHH A;  3EYZ A;  3NGD A;  1ZQS A;  4KN7 A;  2HVI A;  2F1H A;  1ZQG A;  3QEB Z;  9ICU A;  3GV7 B;  3WFQ E;  5KFT A;  3QZ7 A;  3RJK A;  4GXJ A;  2WTF A;  1CUK A;  2AU0 A;  2ALZ A;  4UBC A;  2JZB B;  3OGU A;  4EBK A;  9ICN A;  4JV0 A;  4EYI B;  1TKD A;  4AT9 B;  4X0A A;  1X9W A;  3RRG A;  5KFL A;  1S0V A;  4O3Q A;  5KFW A;  4PHD A;  5DDY A;  4M2Y A;  4MF8 A;  8ICO A;  4S3N A;  4ED2 A;  4I2G A;  3V7L A;  4PHA A;  1DGS A;  2ZH4 A;  4MEY A;  3MR3 A;  4KLF A;  2ZH7 A;  2AGP A;  4C8N A;  1C7Y A;  5KT4 A;  3E2E A;  4DF4 A;  3H39 A;  1TK5 A;  7ICL A;  4EBD A;  2AGO A;  3RTV A;  1R8B A;  1L3S A;  4G3I A;  4F91 B;  4YFK A;  4QZ8 A;  3QE9 Y;  4I2C A;  4YR2 A;  3OVB A;  4DFP A;  3MR5 A;  3RH4 A;  1ZJN A;  3UXN A;  5DLG A;  1XSN A;  1ZJM A;  3C1Y A;  5KFA A;  4DQS A;  3IHQ B;  5KG3 A;  4C8K A;  1ZQM A;  4J9L A;  9ICJ A;  4ECT A;  5DGA A;  4KLL A;  3ZDE A;  4UD5 A;  1BVS A;  4RQ0 A;  4DSK A;  3ETL A;  1T3N A;  1ZQJ A;  2V4R A;  4FO6 A;  1WCN A;  5J0W A;  8ICY A;  2XY5 A;  1NK7 A;  5HRD A;  4MFF A;  3ZD9 A;  4B9V A;  3JPO A;  1BPY A;  2C2E A;  3RJI A;  1EXN A;  3QZ8 A;  4ECV A;  1KSP A;  4KLO A;  1MSW D;  4UAY A;  4QWD A;  3V7J A;  1Q79 A;  3JPR A;  3C23 A;  4J9S A;  8ICH A;  1V4A A;  8ICV A;  3BQ2 A;  4WC4 A;  2IHN A;  1PZN A;  9ICP A;  1KFD A;  3HX0 A;  3RJE A;  2AQ0 A;  3H8W A;  7ICP A;  2DR9 A;  5CJ7 A;  2BCS A;  4Q45 A;  4DS4 A;  7ICI A;  2ZH1 A;  3RAQ A;  2BKE A;  2MUT B;  4RU9 A;  3RB3 A;  1NJW A;  1L3T A;  4O5E A;  3OHB A;  4KLQ A;  5DB9 A;  2H5X A;  2W9B B;  1D9F A;  1BPZ A;  1VJ7 A;  2ZUB A;  4RWN A;  2I1Q A;  4E8F A;  3V72 A;  2GWS A;  5IIK A;  4M9J A;  4NY8 A;  4M04 A;  2P6R A;  4ECX A;  4C8O A;  4RWQ A;  5KFE A;  3PW4 A;  1OU5 A;  3RJF A;  2XO7 A;  3C2M A;  2M2W A;  9ICB A;  1MIY A;  1TFR A;  1ZQL A;  2A1J A;  2Y1J A;  4BXO B;  3WFP A;  1TAQ A;  3ZD8 A;  5DKW A;  3EWA A;  4HYK A;  3AU6 A;  5DGB A;  4C8L A;  4PGX A;  1V9P A;  3JPN A;  4FH3 A;  4WC5 A;  2FMQ A;  1TFY A;  4RNM A;  5CR0 A;  3ZDA A;  4DEZ A;  2ZTE A;  4J9N A;  1Z00 A;  4QZC A;  1ZQV A;  5KFC A;  4O9M A;  4TUP A;  5JUM A;  4RQ1 A;  4O5C A;  5HRL A;  4IG8 A;  4XA5 A;  4QZD A;  3WFS C;  4RWP A;  4DSF A;  1WCL A;  3LWL A;  4EZ6 A;  4PHP A;  5EWG A;  4UBB A;  7ICO A;  4RNN A;  4UAZ A;  5J0X A;  5KTQ A;  4IQT A;  4RPZ A;  3BJY A;  3BQT A;  1U48 A;  1HUZ A;  4FHY A;  2DR5 A;  4ATB A;  4F5P A;  4F2R A;  1S0M A;  2Q66 A;  5DG9 A;  1S9F A;  2BR0 A;  5HRH A;  4DLG A;  1JX4 A;  1ZET A;  1R89 A;  1HUO A;  3HJ4 A;  3HIY A;  5HHH A;  3TFS A;  2HVH A;  2ZJA A;  2BQR A;  1JIH A;  2ZUD A;  5J0Q A;  5L1I A;  1L5U A;  1D8Y A;  3H4B A;  5IIN A;  2C2D A;  4XQ8 A;  5J2K A;  4QZG A;  1U45 A;  2DRA A;  4B9L A;  3C21 A;  3PVX A;  3OUY A;  2VA3 A;  3T5H A;  7ICK A;  5DQH A;  4DSI A;  4PH5 A;  3G6Y A;  3ZDB A;  3GV8 B;  4RQ8 A;  8ICQ A;  3SV3 A;  4KLD A;  1BPX A;  2ZJ5 A;  3TI0 A;  4BGD A;  4PPX A;  3OJU A;  4DF8 A;  4R8U B;  3JPP A;  4NLN A;  1QSL A;  1BPD A;  1UT5 A;  3PX6 A;  4UB1 A;  4DSL A;  4M9G A;  3M9N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...