4NLNA

Structure of human dna polymerase beta complexed with nicked dna containing a template 8brg and incoming ctp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nlnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nlnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nlnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nlnA03
1D9DA 3HW8A 4AT8A 1ZQUA 3ZD8A 5KFNA 2NRKA 5J0OA 2VA2A 4PHPA 5L9XA 1KLNA 8ICKA 4IR9A 5DQGA 4F4XA 4ECQA 4FH5A 4QZ9A 9ICTA 3SV4A 2ZH1A 3AQMA 3V72A 1QTMA 4Q44A 1ZQOA 3ISCA 3EWAA 4BXOB 2C2EA 3PW2A 5KFQA 4IQUA 2J6TA 2PFQA 4Z6FA 4WC2A 3PV8A 4X0BA 5KFWA 5DB9A 4F50A 4FS1A 4FHWA 5KT2A 3TFSA 1QLNA 2M2UA 5DKWA 3AQNA 1QSYA 1DK2A 1UEVA 3K4GA 5KT5A 2PI5A 3WFRE 5DECA 1V9PA 5KFZA 4M9JA 3SYZA 1TFWA 4JV0A 3PW0A 5HRDA 3PW5A 1ZJNA 2ZTDA 2ASLA 1RYSA 2FMPA 3ZDEA 5KG0A 2AGQA 1OU5A 5BPCA 9ICLA 3MFHA 2BQRA 5J2EA 7ICFA 5KFKA 4UBBA 3BJYA 1XSNA 4RT2A 5DG7A 5J2IA 1JXLA 2P6RA 5F9NA 1BPEA 3G6VA 1DK3A 4R63A 3T5JA 5KFAA 5KFCA 4KLMA 4KMUA 5KG7A 4J9MA 2FLLA 4KLLA 1V4AA 7ICJA 3MGIA 5EWFA 4RPYA 3HJ4A 3H3AA 4F5NA 8ICYA 3ZDBA 4ECUA 2BKEA 4MFFA 4F91B 4BDPA 5D46A 4GXJA 4R66A 3LWLA 3GIJA 5J0YA 2ZTCA 2W9AA 4IR1A 4DS5A 3H8WA 5DGAA 1L5UA 4WC7A 4UB3A 3QE9Y 2GWSA 5IIKA 2BCQA 1UT5A 3NTUA 2UVUA 1KFSA 2VA8A 1NK5A 2UVVA 1ZQEA 4F4KA 4KN4A 1XWLA 2C2DA 1X9MA 7ICSA 4DSJA 4F5OA 2P6UA 3M9NB 2IHMA 4K4IA 4F4YA 4DLGA 4QWBA 7ICUA 3HJ1A 3L9DA 4WC0A 4QZBA 2NRXA 2R8HA 2KZ3A 1NJYA 2FMSA 2PFOA 1HJPA 4WC5A 3QZ8A 3HP6A 1BGXT 4QWAA 2XGPA 1U45A 1SL2A 3JPNA 3RJIA 2DFLA 3KHRA 1IXRA 3MR6A 3RJFA 4LT6A 1XU4A 3H4BA 5J0WA 2BCSA 8ICVA 2M2WA 1PZNA 4YG2A 4F5PA 4NM2A 4C8KA 4NLKA 4GXIA 4O3SA 1NZPA 9ICBA 2BQ3A 5DG9A 2R8KA 2V4QA 4MF8A 3RH6A 2C2RA 5DQIA 5KG1A 4RWPA 2BCRA 2PFNA 3RH5A 3AUOA 1HUZA 5DDMA 1S77D 5KFOA 4AT9A 3OUYA 4RUCA 4WC3A 2FLNA 5CA7A 4RZRA 1ZQXA 3C1YA 4BWMA 4TUQA 2BQUA 1QSLA 4K4GA 3H8SA 4EZ6A 4NM1A 5J2JA 2MAXA 3V6JA 3SI8A 5J2KA 3UXPA 4JV1A 2HVIA 4FHXA 1Z00B 3JPSA 7ICEA 2ZH7A 3HIYA 5J2GA 4ELVA 5DB6A 1SZPA 4BWJA 5KFLA 4E7XA 4QW9A 5J2AA 4UB1A 1ZQNA 2BPGA 5KFUA 2ZUCA 2IA6A 3OVBA 5DBBA 1RZTA 4DOAA 3RTVA 2AGOA 3RR7A 8ICMA 4EBJA 5F2VO 4JUZA 5KG6A 2XY5A 1NJXA 4C8LA 1TK8A 1Z3EB 4P4MA 3GV8B 9ICUA 4QZCA 8ICHA 4ECRA 2ALZA 2KN7A 1NJZA 3RJJA 3OVAA 5L1KA 5EOZA 9ICRA 3RJGA 3M8SA 2ZH4A 4DWIA 1BNPA 2XY7A 2NRZA 4DO9A 2HW3A 3OUYB 1COOA 3OV7A 2ZH2A 4I2CA 2J6UA 9ICOA 4RQ5A 4QZDA 3E2EA 4X4TA 2PBEA 4P4PA 4MFAA 9ICFA 9ICEA 2A1JA 2Y1IA 5HRGA 1A76A 5J2CA 4UAZA 1DGSA 1ZQGA 2R8GA 5IINA 3M9MB 3TFRA 5KT3A 5F9LA 1WCNA 2MUTA 4YMOA 3H7IA 5J0SA 3RB0A 4TQRA 4O3OA 8ICAA 4GC7A 2W9BA 4UBCA 1XSPA 9ICXA 3OJSA 2DRAA 8ICFA 5KFBA 3JPOA 1Y88A 5KFJA 5J0PA 5J0RA 3PR4A 1ZQSA 3RJHA 2KTQA 7ICGA 4ECVA 2RFFA 2HHWA 8ICCA 1TFRA 2ZUBA 1KFDA 1MQ3A 4PH5A 4YXJA 4ED0A 1NKEA 1ZQBA 7ICHA 7ICVA 3NYBA 4X5VA 5CHGA 3PNCA 1R89A 2ZH5A 2Y1JA 4JV2A 3G6XA 3LDAA 4NLGA 4KLUA 3EZ5A 4I2EA 4WC4A 4DL7A 1VJ7A 4FHVA 1Q79A 2VANA 4M9NA 1L3UA 4RWOA 4TURA 3ETLA 1K1SA 4RNNA 4QZIA 4NKTA 2UVWA 4ED7A 2W9BB 1S10A 2KZZA 1TAUA 2ISPA 3RAQA 3T3FA 5HNKA 3KHLA 3GV7B 2NRTA 4MEXA 1NK0A 1ZQKA 4P2HA 3QZ7A 3LWMA 4RU9A 4KN7A 4M0AA 1ZQLA 4YR2A 2KFZA 5DG8A 1PX5A 4LVSA 4DEZA 4FO6A 4DS4A 5HRHA 3KHHA 3HT3A 5KT6A 3UQ2A 3N97B 2ID1A 3RBDA 3WFQE 1ZQFA 4QZFA 8ICWA 4YCXA 7ICKA 3TANA 1RXWA 3V7JA 1BPDA 1YLQA 1A77A 1NOMA 4J9KA 4QWCA 5KFFA 7ICMA 3PX4A 4WC6A 2AQ0A 3Q8QB 2XGQA 3PW4A 4AT8B 2HHPA 5DGBA 4WC1A 5KTQA 3GIIA 3Q8LA 5KG3A 3RAXA 4PHDA 3SV3A 2KFNA 1JIHA 9ICVA 3H8JA 2BDPA 1MIWA 4MF2A 5D49A 3V7KA 1JQRA 4MEYA 3H38A 4X4VA 4M9LA 4GLXA 4ED8A 1TKDA 2JEFA 9ICNA 2PI4A 5IIIA 1BPXA 4F5RA 5HRFA 4KLIA 4F2RA 4XQ8A 3JPPA 4XQ7A 8ICJA 2FPLA 1ZQZA 2M9NA 1TK0A 1ZQDA 4PHEA 1F5AA 3FDSA 8ICQA 1ZQCA 4C8MA 1KRPA 1NK4A 4O5CA 2W8LA 3PR5B 5IILA 2ZJ5A 1L3TA 4EBCA 1R8AA 3C23A 4EBKA 5J2BA 4IRDA 3GIKA 2PXIA 3RR8A 4UB5A 2W8KA 1HUOA 2BR0A 1UETA 2VA3A 4KLSA 7ICRA 5HMLA 2ZUDA 2C22A 1XC9A 4B9UA 4B9LA 2W9MA 4I27A 4O9MA 4I29A 3UPSA 3OVSA 4C8OA 5J29A 3N4MB 4LZGA 5KFRA 3LQCB 3GFKB 1JMSA 5KT7A 3Q8PB 5KFVA 2XCAA 3TI0A 2HHSA 1ZETA 1RXVA 3JPQA 5J2HA 1S0NA 8ICEA 5BOLA 3RB3A 2M2VA 3B0YA 4UD4A 4YD1A 3G6YA 1NJWA 4Q45A 3JPTA 3BQ2A 4QWEA 4KITB 2NRVA 3AU2A 1X9WA 1ZQQA 5HHIA 5KFPA 4RWNA 1S0MA 1MC8A 5J0QA 4TUSA 8ICRA 4PGYA 8ICLA 4ED6A 4P4OA 2W9CA 3ZDCA 1VFGA 4PHAA 1NKBA 5DB8A 4R65A 1L3VA 4KLJA 3OSNA 5KFGA 3HX0A 3MR3A 4FBTA 2R8JA 4B9NA 4JWNA 4TUPA 4Q8FA 1UEUA 3AQLA 4M04A 2AGPA 3UPQA 2I1QA 4RPZA 8ICXA 4EYHB 4O3RA 3OHBA 1S9FA 4X0AA 4RQ8A 2I9GA 1SL0A 2R8IA 9ICWA 1SL1A 3PO5A 1Q78A 4F92B 1UA1A 4O3PA 2IMWP 4ELTA 4I2HA 1S0VA 1AROP 2V9WA 5DEDA 3ZD9A 3Q8SB 3MGHA 2HHQA 3UXOA 4YR0A 4DOBA 2ISOA 2P66A 5KFSA 4AT9B 4QZHA 4X4NA 2ZH9A 4PGQA 1NK7A 5J0XA 4EP7A 5IIJA 1ZQAA 2ZHAA 3THVA 1U49A 2HVHA 1T3NA 2KZMA 3C66A 4EYIB 1WOTA 3GDXA 1U4BA 4M47A 8ICPA 4M5DA 2Q0ZX 4ED2A 1TFYA 2J6SA 4DLEA 4F8RA 5HREA 2XCPA 4NLNA 8ICGA 5KFIA 4UAYA 1LV5A 2UVRA 5L1LA 1ZQVA 3LK9A 4MFCA 4O3QA 5KFXA 4UB2A 4DL5A 2JZBA 2HHVA 8ICTA 4I28A 1WCLA 1N56A 4FH3A 4ECXA 4RWQA 9ICPA 3PY8A 5KFMA 4RQ2A 4GXKA 4XRHA 4RQ1A 3OGUA 4FBUA 1XO1A 3C1ZA 2FMQA 4G3IA 4X4UA 4C8NA 3C2LA 3HWTA 3RB4A 5KG5A 3NGDA 2A1JB 4RQ7A 3MR2A 1UT8A 2DRBA 2B21A 1QSSA 4NY8A 7ICTA 2FLPA 4EBEA 4NLZA 2HHUA 4B9MA 1JAJA 4IRKA 2MUTB 4ECTA 1H38A 2BE3A 2DR7A 3EPIA 1MQ2A 4BXOA 2RDIA 4RPXA 4Q43A 4DF4A 3RRGA 5L1JA 3EPGA 4KLTA 1ZJMA 2ZH6A 4RQ6A 1B43A 4X4PA 4J9LA 3BQ0A 4RNOA 3OSPA 1KDHA 3RJEA 1KFTA 2PFPA 4I2FA 5HRKA 2DPIA 2AU0A 1ZYQA 2WTFA 4IQWA 1BPYA 2FPKA 1TVAA 2XO7A 4IG8A 1NK8A 1LB2B 3EW9A 2ASJA 4IRCA 2DR8A 3JZ0A 4FS2A 4DFJA 1D8YA 1IM4A 7ICQA 4M9HA 4RUAA 8ICSA 1C7YA 3JYYA 4LZDA 5IIOA 4J9QA 4DF8A 4B9VA 4J9SA 4O5KA 8ICBA 9ICKA 1JX4A 2HHXA 4J9RA 2F1JA 1D9FA 1MSWD 4QW8A 1KEJA 5KG4A 5KG2A 5EWGA 4YQWA 4UB4A 4YMNA 3B0XA 3RRHA 1SKSA 4O0IA 1B22A 4TQSA 5IIMA 4ECSA 4FHYA 4KLOA 5KFHA 3KTQA 2LYHA 5JUMA 1CUKA 4YXMA 4X4OA 4ED1A 4E8FA 4KLHA 5DLFA 4DSIA 9ICIA 1N48A 1JN3A 4DSFA 4Q8EA 4I2DA 4I2JA 1NK9A 4M9GA 5HRLA 5D4BA 5BOMA 4YR3A 2AQ4A 8ICIA 4F4ZA 4DL4A 3UXNA 9ICAA 2O1PA 1TK5A 4R8UA 4QZGA 4UQGA 1ZQHA 7ICPA 1BPBA 4UD5A 1NK6A 4CCHA 1ZQTA 4B9TA 1X9SA 3IHQB 1MIVA 3Q8MA 3WFPA 3V6HA 5J0TA 2ZJAA 3ORYA 4Z6DA 4DFMA 3C2MA 5EWEA 8ICOA 1ZQWA 3EYZA 3PW7A 1BVSA 4NXZA 5HP4A 4DQQA 3T5LA 4JWMA 1BNOA 3MABA 5DBCA 5J2FA 3T5KA 2BGWA 4ECWA 1CEZA 9ICMA 2ZTEA 1ZQJA 4ATBA 2AJQA 4EBDA 2IHNA 5KFEA 3TAQA 1U47A 2JEJA 3TQ1A 7ICIA 1T7PA 4DSLA 4YN4A 2ZJ8A 1T4GA 3QEBZ 1SKRA 8ICUA 3WFOA 5CJ7A 4DOCA 2ATLA 1ZQYA 4Z6CA 2Q66A 2DR5A 2JEIA 4IQVA 5KFDA 3OJUA 4WBZA 1ZQMA 2V4RA 4DSEA 4DFPA 4ELUA 3TARA 5DBAA 5KT4A 5HR9A 3ZDDA 5HRIA 2FPMA 3K75D 3Q8RB 4DQIA 9ICSA 5HC9A 1Z00A 4ZH4A 3QEAZ 2OWOA 3IM1A 3MBYA 4R8UB 2IBKA 3V7LA 3AQKA 4WCWA 4DQSA 1S0OA 4DSKA 4F4WA 5CR0A 3H4DA 2XY6A 2RDJA 1K1QA 2BPCA 5L1IA 2ASDA 4FHPA 4DL2A 2HHTA 4RQ3A 4DQRA 2ZH8A 3PX6A 1R8CA 1SKWA 3C2KA 5TZVA 5DQHA 3ISBA 4YVZA 1T8EA 4I2AA 4PPXA 3H40A 5CP2A 7ICLA 3GQCA 4JK1A 1TV9A 5C5JA 2NRWA 3C5FA 3V6KA 4E0DA 3C5GA 3HPOA 4KLFA 4KLGA 1X2IA 1XS9D 4XUSA 4ATBB 4I2GA 1KNYA 5J0UA 3KHGA 1U9LA 1S97A 4AT7A 1TAQA 3PX0A 4F5QA 1NKCA 4HYKA 3ZDAA 4EEYA 4RT3A 2F1IA 4ED3A 1EXNA 3MFIA 4QZAA 4QZEA 2XC9A 2ZH3A 4Z6EA 4ECZA 4BGDA 2BHNA 1KTQA 4DQPA 4UAWA 3MDAA 4RQ0A 3BDPA 1RPLA 4RQ4A 3JPRA 4XA5A 9ICGA 1XSLA 2C28A 1RYRA 3BQ1A 1D8LA 4S3NA 1FA0A 4YMMA 1MIYA 4X4RA 3H39A 4PGXA 3ISDA 2W9CB 1BPZA 2BCVA 5HHHA 5CWRA 5DB7A 4GC6A 1KSPA 7ICNA 1UA0A 3AU6A 1ZQPA 4M6WA 2KP7A 3GIMA 4B9SA 2ZHBA 4KLQA 5CB1A 4QWDA 3PMLA 4DL6A 3Q8KA 8ICNA 4AT7B 3H37A 4F2SA 1NO5A 9ICHA 5HRBA 4NKUA 3SZ2A 4QZ8A 1S76D 4RNMA 3M8RA 1L3SA 3PO4A 9ICJA 4X4SA 3MR5A 8ICZA 3T5HA 2BPFA 2M2TA 2DR9A 4X4QA 3GILA 3RBEA 4F93B 3C18A 4I2IA 3WFSC 4J9PA 7ICOA 5J2DA 4YD2A 3UQ0A 1ZQIA 1ZQRA 3RJKA 2O5AA 3PMNA 3OHAA 1U48A 3C21A 4M2YA 4EZ9A 3FYHA 3GV5B 9ICCA 2F1HA 5DDYA 4J9OA 3TAPA 4DL3A 5HMMA 3MDCA 2JEGA 4M6WB 4O5EA 9ICQA 3M9OB 4K4HA 4WBYA 3RB6A 4KLDA 4YFKA 1JXEA 1R8BA 4ECYA 4O3NA 3BQTA 4KLEA 5KFYA 2JZBB 1DOQA 2DPJA 5KFTA 4KTQA 5DLGA 2DVIA 3PVXA 4DFKA 4E80A 4IQTA 4R64A 2H5XA 3RH4A 4YP3A 4F3OA 4J9NA 2BCUA 4I2BA
chains in the Genus database with same CATH superfamily
3HW8A 1ZQUA 1Z19A 2IHOA 1KLNA 4ECQA 9ICTA 3V72A 2ESEA 2KJ9A 2H3QA 2C2EA 3PW2A 4WC2A 2J6TA 3NVVA 5KT2A 5DKWA 1QSYA 4RQMA 2Y0SC 2PI5A 3WFRE 3SYZA 2FMPA 2AGQA 3MFHA 1DK3A 2Y9UA 1XSNA 2P6RA 3T5JA 2KJ5A 4KLMA 5KFCA 5CRXA 4KMUA 5KG7A 2E3TA 3MGIA 3HJ4A 3H3AA 3ZDBA 2BKEA 4BDPA 3QU5A 2VJ4A 5AI4A 5D46A 2KNJA 3LWLA 2KVCA 5ALUA 1X40A 4DS5A 5DGAA 1T94A 4UB3A 2WF8A 3QE9Y 5IIKA 5ALIA 2EZYA 2UVVA 3SAGA 4KN4A 2C2DA 7ICSA 2P6UA 3M9NB 3L9DA 4WC0A 1HJPA 4WC5A 3HP6A 1KQQA 2XGPA 3RJIA 2DFLA 1PK1A 2EH9A 2RHFA 4F5PA 4WQKA 2KIWA 9ICBA 2R8KA 2C2RA 3FAHA 2BCRA 1HUZA 5KFOA 3OUYA 1ZQXA 4BWMA 1QSLA 4NM1A 3H8SA 5AM5A 1N5WA 3V6JA 3SI8A 1JROA 1Z00B 4FHXA 2ZH7A 5J2GA 2QLTA 3HKZF 4ELVA 5KFLA 4QW9A 3OVBA 1O03A 5DBBA 8ICMA 3CW2C 5KG6A 2XY5A 1NJZA 3OVAA 5EOZA 3JCFA 3ER9B 9ICRA 3RJGA 3M8SA 3L3FX 3OUYB 3OV7A 4I2CA 3E2EA 2PBEA 4MFAA 5HRGA 2LPEA 2R8GA 1JRPA 4YMOA 5J0SA 4TQRA 4O3OA 2OEHA 1WYGA 4GC7A 2DL0A 4NXVA 3OJSA 2DRAA 3JPOA 1Y88A 5J0RA 1ZQSA 5K4LA 3RJHA 2KTQA 4ECVA 2RFFA 2HHWA 8ICCA 1TFRA 1KFDA 7ICVA 2OCEA 2ZH5A 4WH5A 2WF5A 3N28A 4UAVA 2Y1JA 4JV2A 1X66A 4NLGA 3L5KA 4WC4A 3ED5A 1L8OA 1L3UA 4TURA 4QZIA 2UVWA 4ED7A 1S10A 2KVSA 3T3FA 1LVHA 4MEXA 1NK0A 5ALKA 4KN7A 4YR2A 2IOFK 4DEZA 4FO6A 4DS4A 3WFQE 3HT3A 5KT6A 1FFUA 3N97B 3M1YA 4I2BA 4QZFA 3ZI4A 8ICWA 7ICKA 1RXWA 5AI9A 1YLQA 1A77A 4J9KA 5AKLA 3MGVA 3PW4A 2RP5A 3GIIA 9ICVA 1JIHA 3H8JA 2BDPA 4X4VA 1CRXA 1JQRA 4BJQA 1D8BA 4M9LA 1TKDA 1F44A 2JH1A 4F5RA 4KLIA 3JPPA 3IG5A 4NJ8A 1ZQDA 1F5AA 1MA7A 3FDSA 2W3SA 4O5CA 4CNQA 5IILA 5J2BA 4IRDA 2O6KA 1HUOA 1UETA 4O68A 2ZUDA 3I28A 1UCVA 4EELA 4I29A 3UPSA 3N4MB 2WF7A 2LYBA 1PVQA 1JMSA 5KFVA 1RXVA 8ICEA 4KX5A 4F71A 4RWNA 5KFPA 5EE3A 1S0MA 1MC8A 8ICRA 2KKVA 8ICLA 3ETRA 3QU2A 3ZDCA 4FE3A 4KLJA 3OSNA 5KFGA 4FBTA 1S8OA 2RQ5A 1Q8KA 4O3RA 3OHBA 9ICWA 2HOFA 2WF6A 3OPXA 4I2HA 3I76A 1S0VA 2QB1A 2V9WA 5DEDA 2HHQA 4YR0A 4QZHA 4X4NA 5FP0A 4PL1A 5J0XA 1SGGA 1U49A 2KZMA 1T3NA 5CFSA 4M5DA 4ED2A 2YMMA 5F3XB 1TFYA 2J6SA 2WF9A 3RFAA 8ICGA 4UAYA 2BBJA 1ZQVA 2EDUA 4O3QA 5KFXA 2HHVA 8ICTA 4I28A 3UMCA 4ECXA 4GXKA 4FBUA 4RQ1A 3OGUA 3C1ZA 3TKAA 3EUB2 4C8NA 2A1JB 1Q3VA 2B21A 1QSSA 4Y2SA 2FLPA 4B9MA 2MUTB 2BE3A 3QU9A 2YTUA 3EPIA 4BXOA 2ZH6A 4X4PA 4J9LA 2PFPA 4I2FA 1ZYQA 4IQWA 1RYUA 4IRCA 2LBOA 5AHXA 1D8YA 4RUAA 5IIOA 4DF8A 4O5KA 2HHXA 3D2SA 4QW8A 5KNIA 5EWGA 2W7PA 1SKSA 2ZIWB 2FCLA 2QARB 5J8YA 1WUDA 4KLOA 5KFHA 3PZPA 4OO1J 3NVOA 4ED1A 4E8FA 4KLHA 1JN3A 2JH7A 1QQ6A 5D62A 4PL2A 3WU2U 4I2DA 1NK9A 1X6JA 4M9GA 3DDHA 2AQ4A 8ICIA 3UXNA 2LKYA 4R8UA 1ZQHA 1JUDA 1X9SA 3IHQB 5ALQA 1MIVA 3Q8MA 3LYSA 3ORYA 2E1EA 1SV4A 3C2MA 3EYZA 1BVSA 4NXZA 5HP4A 4DQQA 3T5KA 5C0YA 5J2FA 9ICMA 2BZFA 4ECWA 4ATBA 1ZQJA 2JEJA 1U47A 4YN4A 4NLBA 1QQ7A 5CJ7A 2ATLA 2Q66A 2V4RA 4DSEA 3ERCC 3Q8RB 9ICSA 5HC9A 1N63A 1A6SA 2OWOA 3IM1A 3MBYA 4NXWA 4R8UB 4WCWA 1S0OA 9ICOA 2XY6A 2ZH8A 4DL2A 1J2MA 1R8CA 5TZVA 7ICLA 4JK1A 5C5JA 4KLGA 4KLFA 4CF3A 1X2IA 5B66U 4ATBB 4UAUA 1S5LU 1U9LA 4HX0A 1S97A 4K9BA 4AT7A 1NNLA 3HRDD 4F5QA 4PZNA 3ZDAA 4PJ0U 4EEYA 2F1IA 3MFIA 3PHZA 2XC9A 3NVWA 2BHNA 3FC4A 1KTQA 3MDAA 1RPLA 3CP8A 2W04A 3JPRA 9ICGA 2LM1A 1RYRA 3O0FA 2W9CB 3UMBA 1BPZA 4NL9C 2BCVA 2EWRA 4GIBA 1UA0A 3AU6A 2KP7A 4B9SA 2ZHBA 2G06A 3BZCA 3K1ZA 1XO0A 3F53A 4DL6A 2A3VA 2F2AB 4AT7B 2DQNB 4NKUA 4ZOHC 4UASA 4O3MA 2E8MA 4RNMA 4OJPA 2JGAA 9ICJA 5D61A 4X4QA 3WFSC 4NXXA 4I2IA 4J9PA 3UQ0A 4KX3A 4US9A 4C0ZA 4O5EA 4WBYA 2PMZC 4O3NA 4KLEA 2JZBB 4FZLA 3PVXA 4R64A 3E58A 1ZD5A 4J9NA 2HHUA 1D9DA 4AT8A 5L9XA 8ICKA 4FH5A 5DQGA 4QZ9A 3H0MB 4Q44A 5KFWA 5DB9A 4FS1A 5ALLA 3TFSA 3VC8A 1DK2A 4BX9C 1UEVA 4LEZA 1V9PA 4K9AA 3SMVA 4JV0A 5HRDA 3PW5A 1ZJNA 2HOIA 5KG0A 2BQRA 1HIWA 5J2EA 4UBBA 4MKPA 4JMUA 5F9NA 1V4AA 5KFAA 5AK3A 4RPYA 4F5NA 8ICYA 4ECUA 1N60A 1URJA 2ZTCA 4P0QB 3H8WA 3NTUA 2VA8A 1NK5A 1ZQEA 4FO1A 5JTGA 4K4IA 4Y2UA 4DLGA 4QWBA 4S3NA 4K98A 3QNMA 2NRXA 4QZBA 2KZ3A 2R8HA 4LEVA 2AHOB 3QZ8A 1SWWA 1U45A 1T3QA 3JPNA 4QIWC 1B0XA 1XU4A 1PZNA 4NLKA 2V4QA 3WKDA 4N7RA 4RWPA 2PFNA 3AUOA 5DDMA 1S77D 3QYPA 1Z1BA 3SD7A 4RUCA 4WC3A 4TUQA 2A1AA 5J2JA 7ICEA 3MCRA 3AQFA 1SZPA 4BWJA 1F5SA 5KFUA 3TACB 3RTVA 2AGOA 5F2VO 4JUZA 1NJXA 2HN2A 1Z3EB 4P4MA 3GV8B 2CRXA 2ALZA 2KN7A 3QUTA 1BNPA 2NRZA 2ZH2A 1KBUA 2J6UA 4RQ5A 9ICFA 9ICEA 2Y1IA 1A76A 4UAZA 1Z4OA 3M9MB 5KT3A 3H7IA 2H3ZA 2E5SA 4UBCA 2KE7A 5ALYA 8ICFA 4X4SA 5KFJA 3PR4A 7ICGA 2ZIVB 4DFDA 4OAFA 2F3NA 7ICHA 3NYBA 3R9KA 4KLUA 3LDAA 2M0NA 2PKEA 2VANA 3HILA 3QUCA 1IIPA 1Q3UA 1TAUA 2NRTA 4P2HA 1PX5A 3WK6A 5DG8A 4LVSA 3KHHA 3UQ2A 1ZQFA 2CN1A 2ODGA 3D2QA 1NOMA 4WC6A 3Q8QB 4DCCA 2K8AA 3A0BU 2H3FA 2HI0A 5DGBA 4WC1A 4EEBA 3Q8LA 3H38A 3C29A 1N5XA 4ED8A 2PI4A 5IIIA 1BPXA 4JLXA 5B3QA 1ZD2P 8ICJA 2B56A 1DXSA 1ZQZA 3H0LB 1TK0A 8ICQA 1ZQCA 1ZRNA 2KD1A 1N2XA 2K4HA 4EBCA 4EBKA 3GIKA 2W8KA 2BR0A 4KLSA 1RDFA 2C22A 3OVSA 3DV9A 4C8OA 4PZOA 3Q8PB 2HHSA 4UD4A 5BOLA 3RB3A 4YD1A 2BDUA 1RQLA 3N7PD 1ZQQA 5HHIA 2K8CB 1FFVA 2JXJA 1NKBA 2F77X 1L3VA 2YB4A 5ALGA 3HX0A 4JWNA 9ICNA 1ED1A 2R8JA 5AI0A 1PK1B 2AGPA 4OAIZ 4EYHB 1S9FA 3ICXA 1SL1A 3PO5A 4F92B 4O3PA 3MGHA 5CEHA 1ECWA 5KFSA 5ALRA 2ZH9A 1NK7A 1ZQAA 3THVA 2WAQF 3GZFA 3C66A 4EYIB 1KN5A 2E8PA 1U4BA 8ICPA 1WOTA 2Q0ZX 3KOOA 4LJXA 4DLEA 4F8RA 4I0UA 3AEVA 2JRZA 4NLNA 4KMOB 5AM1A 1C20A 4DL5A 4IC9A 4FH3A 5ALTA 3PY8A 5KFMA 4XRHA 2AH5A 4G3IA 3ONNA 2XICA 1X42A 4J03A 3HWTA 2WB1C 3MR2A 1UT8A 7ICTA 4NLZA 2DF4B 3CYMA 4IRKA 4Q43A 3RRGA 4RQ6A 4RNOA 1KDHA 3RJEA 2DPIA 2AU0A 4IG8A 3WKAA 3F2DA 1NK8A 2ASJA 1Z4NA 3JZ0A 4DFJA 4M9HA 8ICSA 2K4IA 3IDWA 4J9QA 4B9VA 4J9SA 4J9RA 1J2NA 1D9FA 3NS1A 2JHDA 1MSWD 5KG2A 3RRHA 2YX8A 4YMNA 4LEWA 1SXDA 4TQSA 5G5HA 3WK7A 2F8LA 3KTQA 5JUMA 4YXMA 2K4EA 5ALOA 9ICIA 3BZKA 4EV6A 5D4BA 4NXTA 9ICAA 1TK5A 4UQGA 7ICPA 1NK6A 4CCHA 1ZQTA 4B9TA 4UW9A 4FFDA 3WFPA 2FDRA 4DFMA 1VLBA 5EWEA 8ICOA 3M6ZA 1ZQWA 3PW7A 5CHEA 5J8YC 4JWMA 1BNOA 2BGWA 1SB3C 4NXUA 5AM2A 3QEBZ 3ER8C 3WFOA 2IOHA 1ZQYA 4K97A 2DR5A 4IQVA 4JLZA 1ZQMA 4KM5A 4ELUA 2F76X 5DBAA 5HRIA 3ZDDA 5AI8A 4C7YA 4DQIA 1N62A 4ZH4A 3NKUA 2IBKA 3AQKA 3V7LA 4F4WA 2ASDA 4FHPA 5L1IA 4DQRA 4AYBF 1SKWA 3C2KA 3CRXA 4LEYA 2IOFA 1ZRMA 1XS9D 5J0UA 4XJEA 4UB6U 4OJOA 5A0LA 1EXNA 4ECZA 4BGDA 4WQLA 2KIVA 4UAWA 1ZD4A 4RQ4A 4A8EA 5AKIA 4EEKA 2C28A 1D8LA 2HOQA 4X4RA 5HHHA 5T14A 1KSPA 1ZQPA 4Y2RA 5AKXA 4KLQA 2ZIUA 2HMXA 4JB3A 2L5YA 8ICNA 5EE1A 3H37A 4F2SA 1KKXA 3SZ2A 1KL9A 3AQEA 3M8RA 3PO4A 8ICZA 2DR9A 2ZXHA 3GILA 4F93B 7ICOA 4YD2A 1ZQIA 4U6PA 1ZQRA 2G09A 1SIJA 4UARA 3GV5B 3TAPA 4DL3A 5HMMA 3WK4A 4K4HA 3AN1A 4Y2TA 5KFYA 4OAGA 2GOLA 2HN1A 4IQTA 5B5EU 4YP3A 1WWVA 1L7OA 2KOBA 2KSOA 3KZIU 3ZD8A 2NRKA 2VA2A 4PHPA 2EQYA 4IR9A 1QTMA 1ZQOA 3ISCA 3EWAA 4BXOB 4UB8U 4USAA 5KFQA 2PFQA 4F50A 4FHWA 3WK8A 2I5HA 5KFZA 4M9JA 2H3VA 2KICA 2ASLA 3ZDEA 2OXOA 5BPCA 9ICLA 4WJ3B 3EF2A 3BJYA 1JXLA 4RT2A 5J2IA 1BPEA 2G5HB 1V85A 4J9MA 1V38A 2FLLA 4K96A 7ICJA 5EWFA 3IP4B 3QX7A 4F91B 5AI5A 4R66A 3GIJA 5J0YA 4IR1A 2DKXA 2R18A 1L5UA 2KJ8A 2ES6A 2BCQA 1UT5A 2UVUA 1KFSA 2EZXA 4F4KA 1XWLA 2A19A 1X9MA 4DSJA 4F5OA 4P0PA 5GTHU 2IHMA 4F4YA 7ICUA 2PFOA 1SL2A 5L1MA 4Y2VA 2YN4A 3MR6A 5J0WA 5AKEA 2BCSA 2LM4A 1CI4A 4C8KA 1NZPA 2HBKA 4GXIA 2BQ3A 2OH2A 2K89A 4Y2JA 3AMZA 2P35A 4AT9A 3C1YA 4K4GA 4EZ6A 2JMGA 5J2KA 2OM6A 2HVIA 3D2NA 3JPSA 4F72A 4E7XA 2MRLA 5AKYA 5JTIA 5J2AA 4UB1A 2ZG6A 1RZTA 4OJ6A 3RR7A 5AM3A 2DBYA 1TK8A 9ICUA 3MC1A 4QZCA 8ICHA 3IG8A 3RJJA 4ICAA 1RQNA 1JALA 1NZBA 2H3IA 2ZH4A 4DWIA 2XY7A 4DO9A 2KG5A 1XNSA 4X4TA 1L7NA 3PSTA 2B0CA 4MHVA 5AIBA 5J2CA 1ZQGA 1DGSA 5ALHA 3TFRA 5IINA 1WCNA 3RB0A 2W9BA 2HBJA 2MSNA 1VJ5A 2KV2A 2I6XA 1GPJA 4FZMA 2Y0SF 2ZUBA 4PH5A 1QQ5A 4ACOA 5CHGA 3PNCA 1R89A 2HDOA 3SEIA 3KBBA 4G9BA 4DL7A 4KB6A 3ALRA 1VJ7A 2W43A 4M9NA 4RWOA 1COKA 2N1RA 4B6JA 2HSZA 2W9BB 2KZZA 2ISPA 5HNKA 3KHLA 3F2BA 1ZQKA 3QXGA 5KL8B 4M0AA 4CF4A 2KFZA 3B9JA 4X4OA 3BS5A 5AKJA 5ALFA 3TANA 5ALJA 2AQ0A 2XGQA 4AT8B 2ZIXA 5KTQA 3RAXA 4PHDA 3SV3A 2KFNA 4MF2A 5D49A 3V7KA 4MEYA 1UPHA 2JEFA 1OUQA 4F2RA 2IUBA 4XQ7A 2FPLA 1SWVA 2M9NA 1WWUA 4PHEA 1O08A 1V97A 5AIAA 1L3TA 3RR8A 4RQNA 2W7OA 1TAMA 1MN8A 7ICRA 5GTIU 1XC9A 4B9LA 4O9MA 2W9MA 4U7CA 2KK0A 3QU4A 2Z7JA 5EE0A 5J29A 3LQCB 5KFRA 3GFKB 3S6JA 3KKAC 3TI0A 3FM9A 2HBLA 3JPQA 2M2VA 3B0YA 1RM6C 1ZD3A 1NJWA 4Q45A 3JPTA 3BQ2A 4KITB 1X9WA 3AU2A 2NO5A 4TUSA 4ED6A 4P4OA 2HBMA 3MR3A 1UEUA 4BUGA 4B9NA 4Q8FA 3AQLA 4M04A 3E0FA 4RPZA 1F0MA 8ICXA 2E1FA 4X0AA 4RQ8A 1SL0A 4EEDA 2ZXIA 2WHEA 2IMWP 2NYVA 1AROP 5AKGA 2QB0A 2W55A 4DOBA 2P66A 4PGQA 5IIJA 2NV3A 2GAFD 4M47A 3H8MA 4OJLA 2XCPA 1LV5A 5L1LA 5H2FU 3LK9A 4MFCA 4UB2A 2E8NA 1K5OA 1XO1A 4X4UA 2G0AA 3C2LA 2W3RA 4C4SA 2D8CA 3RB4A 5KG5A 3NGDA 4NY8A 2K60A 1JAJA 1H38A 1MQ2A 4RPXA 4DF4A 2F8KA 3UMGA 1ZJMA 1B43A 5ALXA 2KHVA 3OSPA 1KFTA 2FJ6A 4HAIA 2WTFA 2RRDA 5AM0A 1TVAA 2XO7A 4QNLA 3SENA 2YMPA 4FS2A 1IM4A 1C7YA 4K99A 1WG8A 3PSIA 2OYYA 1KEJA 3NVZA 4YQWA 4UB4A 2DUYA 4O0IA 3WKEA 4FHYA 5KAFU 2LYHA 1CUKA 4US8A 5AI6A 5DLFA 4C7ZA 3KKAA 4Q8EA 5AK5A 3F2CA 1SXEA 5HRLA 4CGZA 4DL4A 2YQEA 2O1PA 3IV6A 1L6NA 3DEEA 3V6HA 5J0TA 3M7DA 3T5LA 3MABA 1J97A 3GU3A 2AJQA 5KFEA 3TAQA 7ICIA 8ICUA 1T7PA 1T4GA 4DOCA 2JEIA 3OJUA 4EBJA 3TARA 5HR9A 2B4VA 1UHUA 1Z00A 4O69A 3TADA 4C4TA 4DSKA 3H4DA 2RDJA 1K1QA 2HHTA 4RQ3A 5DQHA 3ISBA 4YVZA 1T8EA 4I2AA 3NUQA 5CP2A 3H40A 3GQCA 1TV9A 2NRWA 3V6KA 4I2GA 2W54A 2YB1A 1TAQA 3PX0A 2XIDA 5CFTA 1PVRA 2KMDA 2G08A 4ED3A 4QZEA 3BS7A 2ZH3A 3WK9A 5TISU 1JI7A 4WOYA 4RQ0A 3BQ1A 1MIYA 4YMMA 3H39A 5CWRA 5DB7A 7ICNA 4M6WA 3GIMA 3J81j 3K7DA 4EX7A 3NRZA 3LVWA 1NO5A 3N7SC 4NWIA 1S76D 3MR5A 4FZNA 2MA1A 3T5HA 2M2TA 2EZZA 2MU2A 5J2DA 3RJKA 2VIXA 3PMNA 1U48A 3FYHA 3I1YA 4J9OA 4Y2YA 2JEGA 3MDCA 4M6WB 2Q4TA 3IN5A 1R8BA 4ECYA 3BQTA 1GO3F 1DOQA 5KFTA 4KTQA 5AKKA 5DLGA 3HJEA 4DFKA 3RH4A 1YT3A 5AKHA 5HR6A 2KHQA 4C80A 5AK4A 5KFNA 5J0OA 2AXTU 4F4XA 3WKCA 3SV4A 2ZH1A 3AQMA 1PK3A 4IQUA 4X0BA 4Z6FA 3PV8A 2M2UA 1QLNA 3AQNA 2VJ5A 3H0RB 3K4GA 3WKBA 5KT5A 5DECA 2D3DA 1TFWA 2YMLA 3PW0A 2ZTDA 1RYSA 3SAFA 7ICFA 1M6YA 5KFKA 5HRBA 5DG7A 3G6VA 4IS7A 1HEKA 4R63A 4KLLA 2FE9A 4MFFA 4GXJA 1OU5A 2W9AA 5JU5A 4QJFB 4WC7A 1OXJA 1UQVA 2GWSA 3F5AA 3AL0B 3WK5A 3HJ1A 3NWIA 1NJYA 2FMSA 5D63A 4Y2QA 1BGXT 4QWAA 3KHRA 1IXRA 1Q46A 3RJFA 4LT6A 5ALPA 3H4BA 8ICVA 2M2WA 4YG2A 4NM2A 4O3SA 4GFJA 5DG9A 1L7MA 4MF8A 3RH6A 5DQIA 3UM9A 5KG1A 3RH5A 2GLEA 2WFAA 4OJ5A 2FLNA 5CA7A 4RZRA 3T79A 2RLTA 2BQUA 2Y9TA 1N61A 2MAXA 1RG6A 3UXPA 4JV1A 3HIYA 5DB6A 1ZQNA 2BPGA 2IA6A 2ZUCA 4DOAA 4EENA 4C8LA 2PMZF 5G5GA 4ECRA 2EAMA 5L1KA 3SQIA 5B3PA 2HW3A 1COOA 5AK6A 4QZDA 4P4PA 2A1JA 2XI9A 5ALNA 5F9LA 1PVPA 2MUTA 1FIQA 8ICAA 2G07A 1XSPA 3HKZC 9ICXA 5KFBA 1SZHA 5J0PA 4UATA 5ALDA 5ALVA 1MQ3A 2ZIUB 4YXJA 4ED0A 1NKEA 1ZQBA 1IG6A 2CXYA 1P7DA 4X5VA 3QU7A 4CE6A 3G6XA 3EZ5A 4I2EA 2W03A 4FHVA 1Q79A 2YY6A 3ETLA 1K1SA 2ZIWA 4RNNA 4NKTA 2QARA 2WAQC 4OCZA 3NVYA 2EANA 3A0HU 3RAQA 3N7RC 3PSPA 3GV7B 3QZ7A 3LWMA 4RU9A 3IRUA 1ZQLA 1ZQ1C 2E8OA 2GA9D 5HRHA 2ID1A 3RBDA 5KL1B 1FO4A 4YCXA 5JRTA 3V7JA 1BPDA 7ICMA 4QWCA 5KFFA 3PX4A 4QIWF 1L8LA 1ZOLA 3LVVA 2KSOB 2HHPA 5KG3A 1MIWA 2D6FC 4GLXA 2GH1A 2KEYA 5HRFA 4XQ8A 5ALMA 2YMQA 2JR5A 3L4PA 5ALWA 4C8MA 3F5EA 1KRPA 1NK4A 3NRWA 2W8LA 3PR5B 2ZJ5A 2BBHA 1R8AA 3C23A 2PXIA 4UB5A 3C28A 1LKYA 1X9XA 1ZXIA 2VA3A 2JV3A 5HMLA 4B9UA 4I27A 3NASA 4LZGA 5KT7A 2XCAA 1ZETA 5AICA 5J2HA 1S0NA 3G6YA 3AM9A 4CF5A 4QWEA 2NRVA 4P0PB 2LI6A 5J0QA 4PGYA 2W9CA 3VCBA 1VFGA 4PHAA 5DB8A 1LKYB 5ALSA 4R65A 2KKPA 2DGZA 2LHTA 4TUPA 3UPQA 2I1QA 2I9GA 3RF9A 2LYAA 2R8IA 1YZ6A 1Q78A 1UA1A 4ELTA 1X6IA 3ZD9A 3Q8SB 3UXOA 2ISOA 4AT9B 1DGJA 3SAHA 4EP7A 2ZHAA 2HVHA 3GDXA 4Y2PA 5EE9A 3KD3A 2EAOA 5HREA 2DWQA 4AYBC 1FEZA 5KFIA 2UVRA 3CK6A 1IV8A 2JZBA 1WCLA 1N56A 4AP9A 4RWQA 1Z1VA 9ICPA 2B51A 4RQ2A 2FMQA 1QCKA 1PUZA 4RQ7A 2CPRA 2DRBA 4EBEA 4ECTA 2DR7A 5AM4A 2RDIA 5L1JA 3EPGA 4KLTA 5HR7A 2K4PA 3BQ0A 2XVTA 4OAHA 4NLCA 5HRKA 1BPYA 2FPKA 1LB2B 3EW9A 5CFUA 2DR8A 5AKZA 7ICQA 3JYYA 1A0PA 4LZDA 8ICBA 3U26A 1JX4A 9ICKA 2F1JA 3PSFA 1TE2A 5KG4A 3B0XA 4C4RA 4P0QA 1B22A 5IIMA 4ECSA 3QUQA 4DSIA 2HCFA 1N48A 4DSFA 1SV0C 3SR6A 4I2JA 4EGWA 2F44A 3BS5B 2W11A 5BOMA 4YR3A 3OWGA 4F4ZA 4QZGA 1KW4A 1BPBA 4UD5A 1DRGA 3BQ7A 2ZJAA 4Z6DA 1L7PA 2ZIXB 2VKQA 5DBCA 1CEZA 2ZTEA 4EBDA 2IHNA 3TQ1A 4DSLA 1SKRA 2ZJ8A 4Z6CA 4WBZA 5KFDA 4O67A 4DFPA 5KAIU 5KT4A 2FPMA 3K75D 3QEAZ 4DQSA 4PPXA 5CR0A 3OTQA 2BPCA 3PX6A 2OHFA 3D6JA 5ALEA 4NL9A 2FI1A 3C5FA 4E0DA 3C5GA 3HPOA 2QKQA 5E79U 4XUSA 2NO4A 4K8VA 1KNYA 3QUBA 3KHGA 4O6AA 1NKCA 4HYKA 4RT3A 3KFUF 3K1RB 1OW5A 2WB1F 4QZAA 3TADC 4Z6EA 1QH9A 4DQPA 3BDPA 1AQ6A 4XA5A 1XSLA 3CNHA 2LMRA 1FA0A 4CDGA 1NI3A 4PGXA 3ISDA 2B6GA 4GC6A 5ALZA 2GO7A 2ZIVA 3KZXA 1VDVA 2DKZA 5CB1A 4QWDA 2EAPA 3PMLA 3Q8KA 4IL6U 9ICHA 4NV0A 4QZ8A 1L3SA 3M6KA 2QB0B 2BPFA 4EX6A 3C18A 3RBEA 2O5AA 3OHAA 3C21A 4CRXA 4EZ9A 4M2YA 9ICCA 2F1HA 2K8BB 5DDYA 1B4FA 9ICQA 3M9OB 4Y2XA 3RB6A 4KLDA 4YFKA 1JXEA 2DPJA 1SV0A 2DVIA 4E80A 4OD0A 2H5XA 4F3OA 2BCUA 1YZ7A 2G5IB
chains in the Genus database with same CATH topology
1D9DA 3HW8A 4AT8A 1ZQUA 3ZD8A 5KFNA 2NRKA 5J0OA 2VA2A 4PHPA 5L9XA 1KLNA 8ICKA 4IR9A 5DQGA 4F4XA 4ECQA 4FH5A 4QZ9A 9ICTA 3SV4A 2ZH1A 3AQMA 3V72A 1QTMA 4Q44A 1ZQOA 3ISCA 3EWAA 4BXOB 2C2EA 3PW2A 5KFQA 4IQUA 2J6TA 2PFQA 4Z6FA 4WC2A 3PV8A 4X0BA 5KFWA 5DB9A 4F50A 4FS1A 4FHWA 5KT2A 3TFSA 1QLNA 2M2UA 5DKWA 3AQNA 1QSYA 1DK2A 1UEVA 3K4GA 5KT5A 2PI5A 3WFRE 5DECA 1V9PA 5KFZA 4M9JA 3SYZA 1TFWA 4JV0A 3PW0A 5HRDA 3PW5A 1ZJNA 2ZTDA 2ASLA 1RYSA 2FMPA 3ZDEA 5KG0A 2AGQA 1OU5A 5BPCA 9ICLA 3MFHA 2BQRA 5J2EA 7ICFA 5KFKA 4UBBA 3BJYA 1XSNA 4RT2A 5DG7A 5J2IA 1JXLA 2P6RA 5F9NA 1BPEA 3G6VA 1DK3A 4R63A 3T5JA 5KFAA 5KFCA 4KLMA 4KMUA 5KG7A 4J9MA 2FLLA 4KLLA 1V4AA 7ICJA 3MGIA 5EWFA 4RPYA 3HJ4A 3H3AA 4F5NA 8ICYA 3ZDBA 4ECUA 2BKEA 4MFFA 4F91B 4BDPA 5D46A 4GXJA 4R66A 3LWLA 3GIJA 5J0YA 2ZTCA 2W9AA 4IR1A 4DS5A 3H8WA 5DGAA 1L5UA 4WC7A 4UB3A 3QE9Y 2GWSA 5IIKA 2BCQA 1UT5A 3NTUA 2UVUA 1KFSA 2VA8A 1NK5A 2UVVA 1ZQEA 4F4KA 4KN4A 1XWLA 2C2DA 1X9MA 7ICSA 4DSJA 4F5OA 2P6UA 3M9NB 2IHMA 4K4IA 4F4YA 4DLGA 4QWBA 7ICUA 3HJ1A 3L9DA 4WC0A 4QZBA 2NRXA 2R8HA 2KZ3A 1NJYA 2FMSA 2PFOA 1HJPA 4WC5A 3QZ8A 3HP6A 1BGXT 4QWAA 2XGPA 1U45A 1SL2A 3JPNA 3RJIA 2DFLA 3KHRA 1IXRA 3MR6A 3RJFA 4LT6A 1XU4A 3H4BA 5J0WA 2BCSA 8ICVA 2M2WA 1PZNA 4YG2A 4F5PA 4NM2A 4C8KA 4NLKA 4GXIA 4O3SA 1NZPA 9ICBA 2BQ3A 5DG9A 2R8KA 2V4QA 4MF8A 3RH6A 2C2RA 5DQIA 5KG1A 4RWPA 2BCRA 2PFNA 3RH5A 3AUOA 1HUZA 5DDMA 1S77D 5KFOA 4AT9A 3OUYA 4RUCA 4WC3A 2FLNA 5CA7A 4RZRA 1ZQXA 3C1YA 4BWMA 4TUQA 2BQUA 1QSLA 4K4GA 3H8SA 4EZ6A 4NM1A 5J2JA 2MAXA 3V6JA 3SI8A 5J2KA 3UXPA 4JV1A 2HVIA 4FHXA 1Z00B 3JPSA 7ICEA 2ZH7A 3HIYA 5J2GA 4ELVA 5DB6A 1SZPA 4BWJA 5KFLA 4E7XA 4QW9A 5J2AA 4UB1A 1ZQNA 2BPGA 5KFUA 2ZUCA 2IA6A 3OVBA 5DBBA 1RZTA 4DOAA 3RTVA 2AGOA 3RR7A 8ICMA 4EBJA 5F2VO 4JUZA 5KG6A 2XY5A 1NJXA 4C8LA 1TK8A 1Z3EB 4P4MA 3GV8B 9ICUA 4QZCA 8ICHA 4ECRA 2ALZA 2KN7A 1NJZA 3RJJA 3OVAA 5L1KA 5EOZA 9ICRA 3RJGA 3M8SA 2ZH4A 4DWIA 1BNPA 2XY7A 2NRZA 4DO9A 2HW3A 3OUYB 1COOA 3OV7A 2ZH2A 4I2CA 2J6UA 9ICOA 4RQ5A 4QZDA 3E2EA 4X4TA 2PBEA 4P4PA 4MFAA 9ICFA 9ICEA 2A1JA 2Y1IA 5HRGA 1A76A 5J2CA 4UAZA 1DGSA 1ZQGA 2R8GA 5IINA 3M9MB 3TFRA 5KT3A 5F9LA 1WCNA 2MUTA 4YMOA 3H7IA 5J0SA 3RB0A 4TQRA 4O3OA 8ICAA 4GC7A 2W9BA 4UBCA 1XSPA 9ICXA 3OJSA 2DRAA 8ICFA 5KFBA 3JPOA 1Y88A 5KFJA 5J0PA 5J0RA 3PR4A 1ZQSA 3RJHA 2KTQA 7ICGA 4ECVA 2RFFA 2HHWA 8ICCA 1TFRA 2ZUBA 1KFDA 1MQ3A 4PH5A 4YXJA 4ED0A 1NKEA 1ZQBA 7ICHA 7ICVA 3NYBA 4X5VA 5CHGA 3PNCA 1R89A 2ZH5A 2Y1JA 4JV2A 3G6XA 3LDAA 4NLGA 4KLUA 3EZ5A 4I2EA 4WC4A 4DL7A 1VJ7A 4FHVA 1Q79A 2VANA 4M9NA 1L3UA 4RWOA 4TURA 3ETLA 1K1SA 4RNNA 4QZIA 4NKTA 2UVWA 4ED7A 2W9BB 1S10A 2KZZA 1TAUA 2ISPA 3RAQA 3T3FA 5HNKA 3KHLA 3GV7B 2NRTA 4MEXA 1NK0A 1ZQKA 4P2HA 3QZ7A 3LWMA 4RU9A 4KN7A 4M0AA 1ZQLA 4YR2A 2KFZA 5DG8A 1PX5A 4LVSA 4DEZA 4FO6A 4DS4A 5HRHA 3KHHA 3HT3A 5KT6A 3UQ2A 3N97B 2ID1A 3RBDA 3WFQE 1ZQFA 4QZFA 8ICWA 4YCXA 7ICKA 3TANA 1RXWA 3V7JA 1BPDA 1YLQA 1A77A 1NOMA 4J9KA 4QWCA 5KFFA 7ICMA 3PX4A 4WC6A 2AQ0A 3Q8QB 2XGQA 3PW4A 4AT8B 2HHPA 5DGBA 4WC1A 5KTQA 3GIIA 3Q8LA 5KG3A 3RAXA 4PHDA 3SV3A 2KFNA 1JIHA 9ICVA 3H8JA 2BDPA 1MIWA 4MF2A 5D49A 3V7KA 1JQRA 4MEYA 3H38A 4X4VA 4M9LA 4GLXA 4ED8A 1TKDA 2JEFA 9ICNA 2PI4A 5IIIA 1BPXA 4F5RA 5HRFA 4KLIA 4F2RA 4XQ8A 3JPPA 4XQ7A 8ICJA 2FPLA 1ZQZA 2M9NA 1TK0A 1ZQDA 4PHEA 1F5AA 3FDSA 8ICQA 1ZQCA 4C8MA 1KRPA 1NK4A 4O5CA 2W8LA 3PR5B 5IILA 2ZJ5A 1L3TA 4EBCA 1R8AA 3C23A 4EBKA 5J2BA 4IRDA 3GIKA 2PXIA 3RR8A 4UB5A 2W8KA 1HUOA 2BR0A 1UETA 2VA3A 4KLSA 7ICRA 5HMLA 2ZUDA 2C22A 1XC9A 4B9UA 4B9LA 2W9MA 4I27A 4O9MA 4I29A 3UPSA 3OVSA 4C8OA 5J29A 3N4MB 4LZGA 5KFRA 3LQCB 3GFKB 1JMSA 5KT7A 3Q8PB 5KFVA 2XCAA 3TI0A 2HHSA 1ZETA 1RXVA 3JPQA 5J2HA 1S0NA 8ICEA 5BOLA 3RB3A 2M2VA 3B0YA 4UD4A 4YD1A 3G6YA 1NJWA 4Q45A 3JPTA 3BQ2A 4QWEA 4KITB 2NRVA 3AU2A 1X9WA 1ZQQA 5HHIA 5KFPA 4RWNA 1S0MA 1MC8A 5J0QA 4TUSA 8ICRA 4PGYA 8ICLA 4ED6A 4P4OA 2W9CA 3ZDCA 1VFGA 4PHAA 1NKBA 5DB8A 4R65A 1L3VA 4KLJA 3OSNA 5KFGA 3HX0A 3MR3A 4FBTA 2R8JA 4B9NA 4JWNA 4TUPA 4Q8FA 1UEUA 3AQLA 4M04A 2AGPA 3UPQA 2I1QA 4RPZA 8ICXA 4EYHB 4O3RA 3OHBA 1S9FA 4X0AA 4RQ8A 2I9GA 1SL0A 2R8IA 9ICWA 1SL1A 3PO5A 1Q78A 4F92B 1UA1A 4O3PA 2IMWP 4ELTA 4I2HA 1S0VA 1AROP 2V9WA 5DEDA 3ZD9A 3Q8SB 3MGHA 2HHQA 3UXOA 4YR0A 4DOBA 2ISOA 2P66A 5KFSA 4AT9B 4QZHA 4X4NA 2ZH9A 4PGQA 1NK7A 5J0XA 4EP7A 5IIJA 1ZQAA 2ZHAA 3THVA 1U49A 2HVHA 1T3NA 2KZMA 3C66A 4EYIB 1WOTA 3GDXA 1U4BA 4M47A 8ICPA 4M5DA 2Q0ZX 4ED2A 1TFYA 2J6SA 4DLEA 4F8RA 5HREA 2XCPA 4NLNA 8ICGA 5KFIA 4UAYA 1LV5A 2UVRA 5L1LA 1ZQVA 3LK9A 4MFCA 4O3QA 5KFXA 4UB2A 4DL5A 2JZBA 2HHVA 8ICTA 4I28A 1WCLA 1N56A 4FH3A 4ECXA 4RWQA 9ICPA 3PY8A 5KFMA 4RQ2A 4GXKA 4XRHA 4RQ1A 3OGUA 4FBUA 1XO1A 3C1ZA 2FMQA 4G3IA 4X4UA 4C8NA 3C2LA 3HWTA 3RB4A 5KG5A 3NGDA 2A1JB 4RQ7A 3MR2A 1UT8A 2DRBA 2B21A 1QSSA 4NY8A 7ICTA 2FLPA 4EBEA 4NLZA 2HHUA 4B9MA 1JAJA 4IRKA 2MUTB 4ECTA 1H38A 2BE3A 2DR7A 3EPIA 1MQ2A 4BXOA 2RDIA 4RPXA 4Q43A 4DF4A 3RRGA 5L1JA 3EPGA 4KLTA 1ZJMA 2ZH6A 4RQ6A 1B43A 4X4PA 4J9LA 3BQ0A 4RNOA 3OSPA 1KDHA 3RJEA 1KFTA 2PFPA 4I2FA 5HRKA 2DPIA 2AU0A 1ZYQA 2WTFA 4IQWA 1BPYA 2FPKA 1TVAA 2XO7A 4IG8A 1NK8A 1LB2B 3EW9A 2ASJA 4IRCA 2DR8A 3JZ0A 4FS2A 4DFJA 1D8YA 1IM4A 7ICQA 4M9HA 4RUAA 8ICSA 1C7YA 3JYYA 4LZDA 5IIOA 4J9QA 4DF8A 4B9VA 4J9SA 4O5KA 8ICBA 9ICKA 1JX4A 2HHXA 4J9RA 2F1JA 1D9FA 1MSWD 4QW8A 1KEJA 5KG4A 5KG2A 5EWGA 4YQWA 4UB4A 4YMNA 3B0XA 3RRHA 1SKSA 4O0IA 1B22A 4TQSA 5IIMA 4ECSA 4FHYA 4KLOA 5KFHA 3KTQA 2LYHA 5JUMA 1CUKA 4YXMA 4X4OA 4ED1A 4E8FA 4KLHA 5DLFA 4DSIA 9ICIA 1N48A 1JN3A 4DSFA 4Q8EA 4I2DA 4I2JA 1NK9A 4M9GA 5HRLA 5D4BA 5BOMA 4YR3A 2AQ4A 8ICIA 4F4ZA 4DL4A 3UXNA 9ICAA 2O1PA 1TK5A 4R8UA 4QZGA 4UQGA 1ZQHA 7ICPA 1BPBA 4UD5A 1NK6A 4CCHA 1ZQTA 4B9TA 1X9SA 3IHQB 1MIVA 3Q8MA 3WFPA 3V6HA 5J0TA 2ZJAA 3ORYA 4Z6DA 4DFMA 3C2MA 5EWEA 8ICOA 1ZQWA 3EYZA 3PW7A 1BVSA 4NXZA 5HP4A 4DQQA 3T5LA 4JWMA 1BNOA 3MABA 5DBCA 5J2FA 3T5KA 2BGWA 4ECWA 1CEZA 9ICMA 2ZTEA 1ZQJA 4ATBA 2AJQA 4EBDA 2IHNA 5KFEA 3TAQA 1U47A 2JEJA 3TQ1A 7ICIA 1T7PA 4DSLA 4YN4A 2ZJ8A 1T4GA 3QEBZ 1SKRA 8ICUA 3WFOA 5CJ7A 4DOCA 2ATLA 1ZQYA 4Z6CA 2Q66A 2DR5A 2JEIA 4IQVA 5KFDA 3OJUA 4WBZA 1ZQMA 2V4RA 4DSEA 4DFPA 4ELUA 3TARA 5DBAA 5KT4A 5HR9A 3ZDDA 5HRIA 2FPMA 3K75D 3Q8RB 4DQIA 9ICSA 5HC9A 1Z00A 4ZH4A 3QEAZ 2OWOA 3IM1A 3MBYA 4R8UB 2IBKA 3V7LA 3AQKA 4WCWA 4DQSA 1S0OA 4DSKA 4F4WA 5CR0A 3H4DA 2XY6A 2RDJA 1K1QA 2BPCA 5L1IA 2ASDA 4FHPA 4DL2A 2HHTA 4RQ3A 4DQRA 2ZH8A 3PX6A 1R8CA 1SKWA 3C2KA 5TZVA 5DQHA 3ISBA 4YVZA 1T8EA 4I2AA 4PPXA 3H40A 5CP2A 7ICLA 3GQCA 4JK1A 1TV9A 5C5JA 2NRWA 3C5FA 3V6KA 4E0DA 3C5GA 3HPOA 4KLFA 4KLGA 1X2IA 1XS9D 4XUSA 4ATBB 4I2GA 1KNYA 5J0UA 3KHGA 1U9LA 1S97A 4AT7A 1TAQA 3PX0A 4F5QA 1NKCA 4HYKA 3ZDAA 4EEYA 4RT3A 2F1IA 4ED3A 1EXNA 3MFIA 4QZAA 4QZEA 2XC9A 2ZH3A 4Z6EA 4ECZA 4BGDA 2BHNA 1KTQA 4DQPA 4UAWA 3MDAA 4RQ0A 3BDPA 1RPLA 4RQ4A 3JPRA 4XA5A 9ICGA 1XSLA 2C28A 1RYRA 3BQ1A 1D8LA 4S3NA 1FA0A 4YMMA 1MIYA 4X4RA 3H39A 4PGXA 3ISDA 2W9CB 1BPZA 2BCVA 5HHHA 5CWRA 5DB7A 4GC6A 1KSPA 7ICNA 1UA0A 3AU6A 1ZQPA 4M6WA 2KP7A 3GIMA 4B9SA 2ZHBA 4KLQA 5CB1A 4QWDA 3PMLA 4DL6A 3Q8KA 8ICNA 4AT7B 3H37A 4F2SA 1NO5A 9ICHA 5HRBA 4NKUA 3SZ2A 4QZ8A 1S76D 4RNMA 3M8RA 1L3SA 3PO4A 9ICJA 4X4SA 3MR5A 8ICZA 3T5HA 2BPFA 2M2TA 2DR9A 4X4QA 3GILA 3RBEA 4F93B 3C18A 4I2IA 3WFSC 4J9PA 7ICOA 5J2DA 4YD2A 3UQ0A 1ZQIA 1ZQRA 3RJKA 2O5AA 3PMNA 3OHAA 1U48A 3C21A 4M2YA 4EZ9A 3FYHA 3GV5B 9ICCA 2F1HA 5DDYA 4J9OA 3TAPA 4DL3A 5HMMA 3MDCA 2JEGA 4M6WB 4O5EA 9ICQA 3M9OB 4K4HA 4WBYA 3RB6A 4KLDA 4YFKA 1JXEA 1R8BA 4ECYA 4O3NA 3BQTA 4KLEA 5KFYA 2JZBB 1DOQA 2DPJA 5KFTA 4KTQA 5DLGA 2DVIA 3PVXA 4DFKA 4E80A 4IQTA 4R64A 2H5XA 3RH4A 4YP3A 4F3OA 4J9NA 2BCUA 4I2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9D A;  3HW8 A;  4AT8 A;  1ZQU A;  3ZD8 A;  5KFN A;  2NRK A;  5J0O A;  2VA2 A;  4PHP A;  5L9X A;  1KLN A;  8ICK A;  4IR9 A;  5DQG A;  4F4X A;  4ECQ A;  4FH5 A;  4QZ9 A;  9ICT A;  3SV4 A;  2ZH1 A;  3AQM A;  3V72 A;  1QTM A;  4Q44 A;  1ZQO A;  3ISC A;  3EWA A;  4BXO B;  2C2E A;  3PW2 A;  5KFQ A;  4IQU A;  2J6T A;  2PFQ A;  4Z6F A;  4WC2 A;  3PV8 A;  4X0B A;  5KFW A;  5DB9 A;  4F50 A;  4FS1 A;  4FHW A;  5KT2 A;  3TFS A;  1QLN A;  2M2U A;  5DKW A;  3AQN A;  1QSY A;  1DK2 A;  1UEV A;  3K4G A;  5KT5 A;  2PI5 A;  3WFR E;  5DEC A;  1V9P A;  5KFZ A;  4M9J A;  3SYZ A;  1TFW A;  4JV0 A;  3PW0 A;  5HRD A;  3PW5 A;  1ZJN A;  2ZTD A;  2ASL A;  1RYS A;  2FMP A;  3ZDE A;  5KG0 A;  2AGQ A;  1OU5 A;  5BPC A;  9ICL A;  3MFH A;  2BQR A;  5J2E A;  7ICF A;  5KFK A;  4UBB A;  3BJY A;  1XSN A;  4RT2 A;  5DG7 A;  5J2I A;  1JXL A;  2P6R A;  5F9N A;  1BPE A;  3G6V A;  1DK3 A;  4R63 A;  3T5J A;  5KFA A;  5KFC A;  4KLM A;  4KMU A;  5KG7 A;  4J9M A;  2FLL A;  4KLL A;  1V4A A;  7ICJ A;  3MGI A;  5EWF A;  4RPY A;  3HJ4 A;  3H3A A;  4F5N A;  8ICY A;  3ZDB A;  4ECU A;  2BKE A;  4MFF A;  4F91 B;  4BDP A;  5D46 A;  4GXJ A;  4R66 A;  3LWL A;  3GIJ A;  5J0Y A;  2ZTC A;  2W9A A;  4IR1 A;  4DS5 A;  3H8W A;  5DGA A;  1L5U A;  4WC7 A;  4UB3 A;  3QE9 Y;  2GWS A;  5IIK A;  2BCQ A;  1UT5 A;  3NTU A;  2UVU A;  1KFS A;  2VA8 A;  1NK5 A;  2UVV A;  1ZQE A;  4F4K A;  4KN4 A;  1XWL A;  2C2D A;  1X9M A;  7ICS A;  4DSJ A;  4F5O A;  2P6U A;  3M9N B;  2IHM A;  4K4I A;  4F4Y A;  4DLG A;  4QWB A;  7ICU A;  3HJ1 A;  3L9D A;  4WC0 A;  4QZB A;  2NRX A;  2R8H A;  2KZ3 A;  1NJY A;  2FMS A;  2PFO A;  1HJP A;  4WC5 A;  3QZ8 A;  3HP6 A;  1BGX T;  4QWA A;  2XGP A;  1U45 A;  1SL2 A;  3JPN A;  3RJI A;  2DFL A;  3KHR A;  1IXR A;  3MR6 A;  3RJF A;  4LT6 A;  1XU4 A;  3H4B A;  5J0W A;  2BCS A;  8ICV A;  2M2W A;  1PZN A;  4YG2 A;  4F5P A;  4NM2 A;  4C8K A;  4NLK A;  4GXI A;  4O3S A;  1NZP A;  9ICB A;  2BQ3 A;  5DG9 A;  2R8K A;  2V4Q A;  4MF8 A;  3RH6 A;  2C2R A;  5DQI A;  5KG1 A;  4RWP A;  2BCR A;  2PFN A;  3RH5 A;  3AUO A;  1HUZ A;  5DDM A;  1S77 D;  5KFO A;  4AT9 A;  3OUY A;  4RUC A;  4WC3 A;  2FLN A;  5CA7 A;  4RZR A;  1ZQX A;  3C1Y A;  4BWM A;  4TUQ A;  2BQU A;  1QSL A;  4K4G A;  3H8S A;  4EZ6 A;  4NM1 A;  5J2J A;  2MAX A;  3V6J A;  3SI8 A;  5J2K A;  3UXP A;  4JV1 A;  2HVI A;  4FHX A;  1Z00 B;  3JPS A;  7ICE A;  2ZH7 A;  3HIY A;  5J2G A;  4ELV A;  5DB6 A;  1SZP A;  4BWJ A;  5KFL A;  4E7X A;  4QW9 A;  5J2A A;  4UB1 A;  1ZQN A;  2BPG A;  5KFU A;  2ZUC A;  2IA6 A;  3OVB A;  5DBB A;  1RZT A;  4DOA A;  3RTV A;  2AGO A;  3RR7 A;  8ICM A;  4EBJ A;  5F2V O;  4JUZ A;  5KG6 A;  2XY5 A;  1NJX A;  4C8L A;  1TK8 A;  1Z3E B;  4P4M A;  3GV8 B;  9ICU A;  4QZC A;  8ICH A;  4ECR A;  2ALZ A;  2KN7 A;  1NJZ A;  3RJJ A;  3OVA A;  5L1K A;  5EOZ A;  9ICR A;  3RJG A;  3M8S A;  2ZH4 A;  4DWI A;  1BNP A;  2XY7 A;  2NRZ A;  4DO9 A;  2HW3 A;  3OUY B;  1COO A;  3OV7 A;  2ZH2 A;  4I2C A;  2J6U A;  9ICO A;  4RQ5 A;  4QZD A;  3E2E A;  4X4T A;  2PBE A;  4P4P A;  4MFA A;  9ICF A;  9ICE A;  2A1J A;  2Y1I A;  5HRG A;  1A76 A;  5J2C A;  4UAZ A;  1DGS A;  1ZQG A;  2R8G A;  5IIN A;  3M9M B;  3TFR A;  5KT3 A;  5F9L A;  1WCN A;  2MUT A;  4YMO A;  3H7I A;  5J0S A;  3RB0 A;  4TQR A;  4O3O A;  8ICA A;  4GC7 A;  2W9B A;  4UBC A;  1XSP A;  9ICX A;  3OJS A;  2DRA A;  8ICF A;  5KFB A;  3JPO A;  1Y88 A;  5KFJ A;  5J0P A;  5J0R A;  3PR4 A;  1ZQS A;  3RJH A;  2KTQ A;  7ICG A;  4ECV A;  2RFF A;  2HHW A;  8ICC A;  1TFR A;  2ZUB A;  1KFD A;  1MQ3 A;  4PH5 A;  4YXJ A;  4ED0 A;  1NKE A;  1ZQB A;  7ICH A;  7ICV A;  3NYB A;  4X5V A;  5CHG A;  3PNC A;  1R89 A;  2ZH5 A;  2Y1J A;  4JV2 A;  3G6X A;  3LDA A;  4NLG A;  4KLU A;  3EZ5 A;  4I2E A;  4WC4 A;  4DL7 A;  1VJ7 A;  4FHV A;  1Q79 A;  2VAN A;  4M9N A;  1L3U A;  4RWO A;  4TUR A;  3ETL A;  1K1S A;  4RNN A;  4QZI A;  4NKT A;  2UVW A;  4ED7 A;  2W9B B;  1S10 A;  2KZZ A;  1TAU A;  2ISP A;  3RAQ A;  3T3F A;  5HNK A;  3KHL A;  3GV7 B;  2NRT A;  4MEX A;  1NK0 A;  1ZQK A;  4P2H A;  3QZ7 A;  3LWM A;  4RU9 A;  4KN7 A;  4M0A A;  1ZQL A;  4YR2 A;  2KFZ A;  5DG8 A;  1PX5 A;  4LVS A;  4DEZ A;  4FO6 A;  4DS4 A;  5HRH A;  3KHH A;  3HT3 A;  5KT6 A;  3UQ2 A;  3N97 B;  2ID1 A;  3RBD A;  3WFQ E;  1ZQF A;  4QZF A;  8ICW A;  4YCX A;  7ICK A;  3TAN A;  1RXW A;  3V7J A;  1BPD A;  1YLQ A;  1A77 A;  1NOM A;  4J9K A;  4QWC A;  5KFF A;  7ICM A;  3PX4 A;  4WC6 A;  2AQ0 A;  3Q8Q B;  2XGQ A;  3PW4 A;  4AT8 B;  2HHP A;  5DGB A;  4WC1 A;  5KTQ A;  3GII A;  3Q8L A;  5KG3 A;  3RAX A;  4PHD A;  3SV3 A;  2KFN A;  1JIH A;  9ICV A;  3H8J A;  2BDP A;  1MIW A;  4MF2 A;  5D49 A;  3V7K A;  1JQR A;  4MEY A;  3H38 A;  4X4V A;  4M9L A;  4GLX A;  4ED8 A;  1TKD A;  2JEF A;  9ICN A;  2PI4 A;  5III A;  1BPX A;  4F5R A;  5HRF A;  4KLI A;  4F2R A;  4XQ8 A;  3JPP A;  4XQ7 A;  8ICJ A;  2FPL A;  1ZQZ A;  2M9N A;  1TK0 A;  1ZQD A;  4PHE A;  1F5A A;  3FDS A;  8ICQ A;  1ZQC A;  4C8M A;  1KRP A;  1NK4 A;  4O5C A;  2W8L A;  3PR5 B;  5IIL A;  2ZJ5 A;  1L3T A;  4EBC A;  1R8A A;  3C23 A;  4EBK A;  5J2B A;  4IRD A;  3GIK A;  2PXI A;  3RR8 A;  4UB5 A;  2W8K A;  1HUO A;  2BR0 A;  1UET A;  2VA3 A;  4KLS A;  7ICR A;  5HML A;  2ZUD A;  2C22 A;  1XC9 A;  4B9U A;  4B9L A;  2W9M A;  4I27 A;  4O9M A;  4I29 A;  3UPS A;  3OVS A;  4C8O A;  5J29 A;  3N4M B;  4LZG A;  5KFR A;  3LQC B;  3GFK B;  1JMS A;  5KT7 A;  3Q8P B;  5KFV A;  2XCA A;  3TI0 A;  2HHS A;  1ZET A;  1RXV A;  3JPQ A;  5J2H A;  1S0N A;  8ICE A;  5BOL A;  3RB3 A;  2M2V A;  3B0Y A;  4UD4 A;  4YD1 A;  3G6Y A;  1NJW A;  4Q45 A;  3JPT A;  3BQ2 A;  4QWE A;  4KIT B;  2NRV A;  3AU2 A;  1X9W A;  1ZQQ A;  5HHI A;  5KFP A;  4RWN A;  1S0M A;  1MC8 A;  5J0Q A;  4TUS A;  8ICR A;  4PGY A;  8ICL A;  4ED6 A;  4P4O A;  2W9C A;  3ZDC A;  1VFG A;  4PHA A;  1NKB A;  5DB8 A;  4R65 A;  1L3V A;  4KLJ A;  3OSN A;  5KFG A;  3HX0 A;  3MR3 A;  4FBT A;  2R8J A;  4B9N A;  4JWN A;  4TUP A;  4Q8F A;  1UEU A;  3AQL A;  4M04 A;  2AGP A;  3UPQ A;  2I1Q A;  4RPZ A;  8ICX A;  4EYH B;  4O3R A;  3OHB A;  1S9F A;  4X0A A;  4RQ8 A;  2I9G A;  1SL0 A;  2R8I A;  9ICW A;  1SL1 A;  3PO5 A;  1Q78 A;  4F92 B;  1UA1 A;  4O3P A;  2IMW P;  4ELT A;  4I2H A;  1S0V A;  1ARO P;  2V9W A;  5DED A;  3ZD9 A;  3Q8S B;  3MGH A;  2HHQ A;  3UXO A;  4YR0 A;  4DOB A;  2ISO A;  2P66 A;  5KFS A;  4AT9 B;  4QZH A;  4X4N A;  2ZH9 A;  4PGQ A;  1NK7 A;  5J0X A;  4EP7 A;  5IIJ A;  1ZQA A;  2ZHA A;  3THV A;  1U49 A;  2HVH A;  1T3N A;  2KZM A;  3C66 A;  4EYI B;  1WOT A;  3GDX A;  1U4B A;  4M47 A;  8ICP A;  4M5D A;  2Q0Z X;  4ED2 A;  1TFY A;  2J6S A;  4DLE A;  4F8R A;  5HRE A;  2XCP A;  4NLN A;  8ICG A;  5KFI A;  4UAY A;  1LV5 A;  2UVR A;  5L1L A;  1ZQV A;  3LK9 A;  4MFC A;  4O3Q A;  5KFX A;  4UB2 A;  4DL5 A;  2JZB A;  2HHV A;  8ICT A;  4I28 A;  1WCL A;  1N56 A;  4FH3 A;  4ECX A;  4RWQ A;  9ICP A;  3PY8 A;  5KFM A;  4RQ2 A;  4GXK A;  4XRH A;  4RQ1 A;  3OGU A;  4FBU A;  1XO1 A;  3C1Z A;  2FMQ A;  4G3I A;  4X4U A;  4C8N A;  3C2L A;  3HWT A;  3RB4 A;  5KG5 A;  3NGD A;  2A1J B;  4RQ7 A;  3MR2 A;  1UT8 A;  2DRB A;  2B21 A;  1QSS A;  4NY8 A;  7ICT A;  2FLP A;  4EBE A;  4NLZ A;  2HHU A;  4B9M A;  1JAJ A;  4IRK A;  2MUT B;  4ECT A;  1H38 A;  2BE3 A;  2DR7 A;  3EPI A;  1MQ2 A;  4BXO A;  2RDI A;  4RPX A;  4Q43 A;  4DF4 A;  3RRG A;  5L1J A;  3EPG A;  4KLT A;  1ZJM A;  2ZH6 A;  4RQ6 A;  1B43 A;  4X4P A;  4J9L A;  3BQ0 A;  4RNO A;  3OSP A;  1KDH A;  3RJE A;  1KFT A;  2PFP A;  4I2F A;  5HRK A;  2DPI A;  2AU0 A;  1ZYQ A;  2WTF A;  4IQW A;  1BPY A;  2FPK A;  1TVA A;  2XO7 A;  4IG8 A;  1NK8 A;  1LB2 B;  3EW9 A;  2ASJ A;  4IRC A;  2DR8 A;  3JZ0 A;  4FS2 A;  4DFJ A;  1D8Y A;  1IM4 A;  7ICQ A;  4M9H A;  4RUA A;  8ICS A;  1C7Y A;  3JYY A;  4LZD A;  5IIO A;  4J9Q A;  4DF8 A;  4B9V A;  4J9S A;  4O5K A;  8ICB A;  9ICK A;  1JX4 A;  2HHX A;  4J9R A;  2F1J A;  1D9F A;  1MSW D;  4QW8 A;  1KEJ A;  5KG4 A;  5KG2 A;  5EWG A;  4YQW A;  4UB4 A;  4YMN A;  3B0X A;  3RRH A;  1SKS A;  4O0I A;  1B22 A;  4TQS A;  5IIM A;  4ECS A;  4FHY A;  4KLO A;  5KFH A;  3KTQ A;  2LYH A;  5JUM A;  1CUK A;  4YXM A;  4X4O A;  4ED1 A;  4E8F A;  4KLH A;  5DLF A;  4DSI A;  9ICI A;  1N48 A;  1JN3 A;  4DSF A;  4Q8E A;  4I2D A;  4I2J A;  1NK9 A;  4M9G A;  5HRL A;  5D4B A;  5BOM A;  4YR3 A;  2AQ4 A;  8ICI A;  4F4Z A;  4DL4 A;  3UXN A;  9ICA A;  2O1P A;  1TK5 A;  4R8U A;  4QZG A;  4UQG A;  1ZQH A;  7ICP A;  1BPB A;  4UD5 A;  1NK6 A;  4CCH A;  1ZQT A;  4B9T A;  1X9S A;  3IHQ B;  1MIV A;  3Q8M A;  3WFP A;  3V6H A;  5J0T A;  2ZJA A;  3ORY A;  4Z6D A;  4DFM A;  3C2M A;  5EWE A;  8ICO A;  1ZQW A;  3EYZ A;  3PW7 A;  1BVS A;  4NXZ A;  5HP4 A;  4DQQ A;  3T5L A;  4JWM A;  1BNO A;  3MAB A;  5DBC A;  5J2F A;  3T5K A;  2BGW A;  4ECW A;  1CEZ A;  9ICM A;  2ZTE A;  1ZQJ A;  4ATB A;  2AJQ A;  4EBD A;  2IHN A;  5KFE A;  3TAQ A;  1U47 A;  2JEJ A;  3TQ1 A;  7ICI A;  1T7P A;  4DSL A;  4YN4 A;  2ZJ8 A;  1T4G A;  3QEB Z;  1SKR A;  8ICU A;  3WFO A;  5CJ7 A;  4DOC A;  2ATL A;  1ZQY A;  4Z6C A;  2Q66 A;  2DR5 A;  2JEI A;  4IQV A;  5KFD A;  3OJU A;  4WBZ A;  1ZQM A;  2V4R A;  4DSE A;  4DFP A;  4ELU A;  3TAR A;  5DBA A;  5KT4 A;  5HR9 A;  3ZDD A;  5HRI A;  2FPM A;  3K75 D;  3Q8R B;  4DQI A;  9ICS A;  5HC9 A;  1Z00 A;  4ZH4 A;  3QEA Z;  2OWO A;  3IM1 A;  3MBY A;  4R8U B;  2IBK A;  3V7L A;  3AQK A;  4WCW A;  4DQS A;  1S0O A;  4DSK A;  4F4W A;  5CR0 A;  3H4D A;  2XY6 A;  2RDJ A;  1K1Q A;  2BPC A;  5L1I A;  2ASD A;  4FHP A;  4DL2 A;  2HHT A;  4RQ3 A;  4DQR A;  2ZH8 A;  3PX6 A;  1R8C A;  1SKW A;  3C2K A;  5TZV A;  5DQH A;  3ISB A;  4YVZ A;  1T8E A;  4I2A A;  4PPX A;  3H40 A;  5CP2 A;  7ICL A;  3GQC A;  4JK1 A;  1TV9 A;  5C5J A;  2NRW A;  3C5F A;  3V6K A;  4E0D A;  3C5G A;  3HPO A;  4KLF A;  4KLG A;  1X2I A;  1XS9 D;  4XUS A;  4ATB B;  4I2G A;  1KNY A;  5J0U A;  3KHG A;  1U9L A;  1S97 A;  4AT7 A;  1TAQ A;  3PX0 A;  4F5Q A;  1NKC A;  4HYK A;  3ZDA A;  4EEY A;  4RT3 A;  2F1I A;  4ED3 A;  1EXN A;  3MFI A;  4QZA A;  4QZE A;  2XC9 A;  2ZH3 A;  4Z6E A;  4ECZ A;  4BGD A;  2BHN A;  1KTQ A;  4DQP A;  4UAW A;  3MDA A;  4RQ0 A;  3BDP A;  1RPL A;  4RQ4 A;  3JPR A;  4XA5 A;  9ICG A;  1XSL A;  2C28 A;  1RYR A;  3BQ1 A;  1D8L A;  4S3N A;  1FA0 A;  4YMM A;  1MIY A;  4X4R A;  3H39 A;  4PGX A;  3ISD A;  2W9C B;  1BPZ A;  2BCV A;  5HHH A;  5CWR A;  5DB7 A;  4GC6 A;  1KSP A;  7ICN A;  1UA0 A;  3AU6 A;  1ZQP A;  4M6W A;  2KP7 A;  3GIM A;  4B9S A;  2ZHB A;  4KLQ A;  5CB1 A;  4QWD A;  3PML A;  4DL6 A;  3Q8K A;  8ICN A;  4AT7 B;  3H37 A;  4F2S A;  1NO5 A;  9ICH A;  5HRB A;  4NKU A;  3SZ2 A;  4QZ8 A;  1S76 D;  4RNM A;  3M8R A;  1L3S A;  3PO4 A;  9ICJ A;  4X4S A;  3MR5 A;  8ICZ A;  3T5H A;  2BPF A;  2M2T A;  2DR9 A;  4X4Q A;  3GIL A;  3RBE A;  4F93 B;  3C18 A;  4I2I A;  3WFS C;  4J9P A;  7ICO A;  5J2D A;  4YD2 A;  3UQ0 A;  1ZQI A;  1ZQR A;  3RJK A;  2O5A A;  3PMN A;  3OHA A;  1U48 A;  3C21 A;  4M2Y A;  4EZ9 A;  3FYH A;  3GV5 B;  9ICC A;  2F1H A;  5DDY A;  4J9O A;  3TAP A;  4DL3 A;  5HMM A;  3MDC A;  2JEG A;  4M6W B;  4O5E A;  9ICQ A;  3M9O B;  4K4H A;  4WBY A;  3RB6 A;  4KLD A;  4YFK A;  1JXE A;  1R8B A;  4ECY A;  4O3N A;  3BQT A;  4KLE A;  5KFY A;  2JZB B;  1DOQ A;  2DPJ A;  5KFT A;  4KTQ A;  5DLG A;  2DVI A;  3PVX A;  4DFK A;  4E80 A;  4IQT A;  4R64 A;  2H5X A;  3RH4 A;  4YP3 A;  4F3O A;  4J9N A;  2BCU A;  4I2B A; 
#chains in the Genus database with same CATH topology
 3HW8 A;  1ZQU A;  1Z19 A;  2IHO A;  1KLN A;  4ECQ A;  9ICT A;  3V72 A;  2ESE A;  2KJ9 A;  2H3Q A;  2C2E A;  3PW2 A;  4WC2 A;  2J6T A;  3NVV A;  5KT2 A;  5DKW A;  1QSY A;  4RQM A;  2Y0S C;  2PI5 A;  3WFR E;  3SYZ A;  2FMP A;  2AGQ A;  3MFH A;  1DK3 A;  2Y9U A;  1XSN A;  2P6R A;  3T5J A;  2KJ5 A;  4KLM A;  5KFC A;  5CRX A;  4KMU A;  5KG7 A;  2E3T A;  3MGI A;  3HJ4 A;  3H3A A;  3ZDB A;  2BKE A;  4BDP A;  3QU5 A;  2VJ4 A;  5AI4 A;  5D46 A;  2KNJ A;  3LWL A;  2KVC A;  5ALU A;  1X40 A;  4DS5 A;  5DGA A;  1T94 A;  4UB3 A;  2WF8 A;  3QE9 Y;  5IIK A;  5ALI A;  2EZY A;  2UVV A;  3SAG A;  4KN4 A;  2C2D A;  7ICS A;  2P6U A;  3M9N B;  3L9D A;  4WC0 A;  1HJP A;  4WC5 A;  3HP6 A;  1KQQ A;  2XGP A;  3RJI A;  2DFL A;  1PK1 A;  2EH9 A;  2RHF A;  4F5P A;  4WQK A;  2KIW A;  9ICB A;  2R8K A;  2C2R A;  3FAH A;  2BCR A;  1HUZ A;  5KFO A;  3OUY A;  1ZQX A;  4BWM A;  1QSL A;  4NM1 A;  3H8S A;  5AM5 A;  1N5W A;  3V6J A;  3SI8 A;  1JRO A;  1Z00 B;  4FHX A;  2ZH7 A;  5J2G A;  2QLT A;  3HKZ F;  4ELV A;  5KFL A;  4QW9 A;  3OVB A;  1O03 A;  5DBB A;  8ICM A;  3CW2 C;  5KG6 A;  2XY5 A;  1NJZ A;  3OVA A;  5EOZ A;  3JCF A;  3ER9 B;  9ICR A;  3RJG A;  3M8S A;  3L3F X;  3OUY B;  3OV7 A;  4I2C A;  3E2E A;  2PBE A;  4MFA A;  5HRG A;  2LPE A;  2R8G A;  1JRP A;  4YMO A;  5J0S A;  4TQR A;  4O3O A;  2OEH A;  1WYG A;  4GC7 A;  2DL0 A;  4NXV A;  3OJS A;  2DRA A;  3JPO A;  1Y88 A;  5J0R A;  1ZQS A;  5K4L A;  3RJH A;  2KTQ A;  4ECV A;  2RFF A;  2HHW A;  8ICC A;  1TFR A;  1KFD A;  7ICV A;  2OCE A;  2ZH5 A;  4WH5 A;  2WF5 A;  3N28 A;  4UAV A;  2Y1J A;  4JV2 A;  1X66 A;  4NLG A;  3L5K A;  4WC4 A;  3ED5 A;  1L8O A;  1L3U A;  4TUR A;  4QZI A;  2UVW A;  4ED7 A;  1S10 A;  2KVS A;  3T3F A;  1LVH A;  4MEX A;  1NK0 A;  5ALK A;  4KN7 A;  4YR2 A;  2IOF K;  4DEZ A;  4FO6 A;  4DS4 A;  3WFQ E;  3HT3 A;  5KT6 A;  1FFU A;  3N97 B;  3M1Y A;  4I2B A;  4QZF A;  3ZI4 A;  8ICW A;  7ICK A;  1RXW A;  5AI9 A;  1YLQ A;  1A77 A;  4J9K A;  5AKL A;  3MGV A;  3PW4 A;  2RP5 A;  3GII A;  9ICV A;  1JIH A;  3H8J A;  2BDP A;  4X4V A;  1CRX A;  1JQR A;  4BJQ A;  1D8B A;  4M9L A;  1TKD A;  1F44 A;  2JH1 A;  4F5R A;  4KLI A;  3JPP A;  3IG5 A;  4NJ8 A;  1ZQD A;  1F5A A;  1MA7 A;  3FDS A;  2W3S A;  4O5C A;  4CNQ A;  5IIL A;  5J2B A;  4IRD A;  2O6K A;  1HUO A;  1UET A;  4O68 A;  2ZUD A;  3I28 A;  1UCV A;  4EEL A;  4I29 A;  3UPS A;  3N4M B;  2WF7 A;  2LYB A;  1PVQ A;  1JMS A;  5KFV A;  1RXV A;  8ICE A;  4KX5 A;  4F71 A;  4RWN A;  5KFP A;  5EE3 A;  1S0M A;  1MC8 A;  8ICR A;  2KKV A;  8ICL A;  3ETR A;  3QU2 A;  3ZDC A;  4FE3 A;  4KLJ A;  3OSN A;  5KFG A;  4FBT A;  1S8O A;  2RQ5 A;  1Q8K A;  4O3R A;  3OHB A;  9ICW A;  2HOF A;  2WF6 A;  3OPX A;  4I2H A;  3I76 A;  1S0V A;  2QB1 A;  2V9W A;  5DED A;  2HHQ A;  4YR0 A;  4QZH A;  4X4N A;  5FP0 A;  4PL1 A;  5J0X A;  1SGG A;  1U49 A;  2KZM A;  1T3N A;  5CFS A;  4M5D A;  4ED2 A;  2YMM A;  5F3X B;  1TFY A;  2J6S A;  2WF9 A;  3RFA A;  8ICG A;  4UAY A;  2BBJ A;  1ZQV A;  2EDU A;  4O3Q A;  5KFX A;  2HHV A;  8ICT A;  4I28 A;  3UMC A;  4ECX A;  4GXK A;  4FBU A;  4RQ1 A;  3OGU A;  3C1Z A;  3TKA A;  3EUB 2;  4C8N A;  2A1J B;  1Q3V A;  2B21 A;  1QSS A;  4Y2S A;  2FLP A;  4B9M A;  2MUT B;  2BE3 A;  3QU9 A;  2YTU A;  3EPI A;  4BXO A;  2ZH6 A;  4X4P A;  4J9L A;  2PFP A;  4I2F A;  1ZYQ A;  4IQW A;  1RYU A;  4IRC A;  2LBO A;  5AHX A;  1D8Y A;  4RUA A;  5IIO A;  4DF8 A;  4O5K A;  2HHX A;  3D2S A;  4QW8 A;  5KNI A;  5EWG A;  2W7P A;  1SKS A;  2ZIW B;  2FCL A;  2QAR B;  5J8Y A;  1WUD A;  4KLO A;  5KFH A;  3PZP A;  4OO1 J;  3NVO A;  4ED1 A;  4E8F A;  4KLH A;  1JN3 A;  2JH7 A;  1QQ6 A;  5D62 A;  4PL2 A;  3WU2 U;  4I2D A;  1NK9 A;  1X6J A;  4M9G A;  3DDH A;  2AQ4 A;  8ICI A;  3UXN A;  2LKY A;  4R8U A;  1ZQH A;  1JUD A;  1X9S A;  3IHQ B;  5ALQ A;  1MIV A;  3Q8M A;  3LYS A;  3ORY A;  2E1E A;  1SV4 A;  3C2M A;  3EYZ A;  1BVS A;  4NXZ A;  5HP4 A;  4DQQ A;  3T5K A;  5C0Y A;  5J2F A;  9ICM A;  2BZF A;  4ECW A;  4ATB A;  1ZQJ A;  2JEJ A;  1U47 A;  4YN4 A;  4NLB A;  1QQ7 A;  5CJ7 A;  2ATL A;  2Q66 A;  2V4R A;  4DSE A;  3ERC C;  3Q8R B;  9ICS A;  5HC9 A;  1N63 A;  1A6S A;  2OWO A;  3IM1 A;  3MBY A;  4NXW A;  4R8U B;  4WCW A;  1S0O A;  9ICO A;  2XY6 A;  2ZH8 A;  4DL2 A;  1J2M A;  1R8C A;  5TZV A;  7ICL A;  4JK1 A;  5C5J A;  4KLG A;  4KLF A;  4CF3 A;  1X2I A;  5B66 U;  4ATB B;  4UAU A;  1S5L U;  1U9L A;  4HX0 A;  1S97 A;  4K9B A;  4AT7 A;  1NNL A;  3HRD D;  4F5Q A;  4PZN A;  3ZDA A;  4PJ0 U;  4EEY A;  2F1I A;  3MFI A;  3PHZ A;  2XC9 A;  3NVW A;  2BHN A;  3FC4 A;  1KTQ A;  3MDA A;  1RPL A;  3CP8 A;  2W04 A;  3JPR A;  9ICG A;  2LM1 A;  1RYR A;  3O0F A;  2W9C B;  3UMB A;  1BPZ A;  4NL9 C;  2BCV A;  2EWR A;  4GIB A;  1UA0 A;  3AU6 A;  2KP7 A;  4B9S A;  2ZHB A;  2G06 A;  3BZC A;  3K1Z A;  1XO0 A;  3F53 A;  4DL6 A;  2A3V A;  2F2A B;  4AT7 B;  2DQN B;  4NKU A;  4ZOH C;  4UAS A;  4O3M A;  2E8M A;  4RNM A;  4OJP A;  2JGA A;  9ICJ A;  5D61 A;  4X4Q A;  3WFS C;  4NXX A;  4I2I A;  4J9P A;  3UQ0 A;  4KX3 A;  4US9 A;  4C0Z A;  4O5E A;  4WBY A;  2PMZ C;  4O3N A;  4KLE A;  2JZB B;  4FZL A;  3PVX A;  4R64 A;  3E58 A;  1ZD5 A;  4J9N A;  2HHU A;  1D9D A;  4AT8 A;  5L9X A;  8ICK A;  4FH5 A;  5DQG A;  4QZ9 A;  3H0M B;  4Q44 A;  5KFW A;  5DB9 A;  4FS1 A;  5ALL A;  3TFS A;  3VC8 A;  1DK2 A;  4BX9 C;  1UEV A;  4LEZ A;  1V9P A;  4K9A A;  3SMV A;  4JV0 A;  5HRD A;  3PW5 A;  1ZJN A;  2HOI A;  5KG0 A;  2BQR A;  1HIW A;  5J2E A;  4UBB A;  4MKP A;  4JMU A;  5F9N A;  1V4A A;  5KFA A;  5AK3 A;  4RPY A;  4F5N A;  8ICY A;  4ECU A;  1N60 A;  1URJ A;  2ZTC A;  4P0Q B;  3H8W A;  3NTU A;  2VA8 A;  1NK5 A;  1ZQE A;  4FO1 A;  5JTG A;  4K4I A;  4Y2U A;  4DLG A;  4QWB A;  4S3N A;  4K98 A;  3QNM A;  2NRX A;  4QZB A;  2KZ3 A;  2R8H A;  4LEV A;  2AHO B;  3QZ8 A;  1SWW A;  1U45 A;  1T3Q A;  3JPN A;  4QIW C;  1B0X A;  1XU4 A;  1PZN A;  4NLK A;  2V4Q A;  3WKD A;  4N7R A;  4RWP A;  2PFN A;  3AUO A;  5DDM A;  1S77 D;  3QYP A;  1Z1B A;  3SD7 A;  4RUC A;  4WC3 A;  4TUQ A;  2A1A A;  5J2J A;  7ICE A;  3MCR A;  3AQF A;  1SZP A;  4BWJ A;  1F5S A;  5KFU A;  3TAC B;  3RTV A;  2AGO A;  5F2V O;  4JUZ A;  1NJX A;  2HN2 A;  1Z3E B;  4P4M A;  3GV8 B;  2CRX A;  2ALZ A;  2KN7 A;  3QUT A;  1BNP A;  2NRZ A;  2ZH2 A;  1KBU A;  2J6U A;  4RQ5 A;  9ICF A;  9ICE A;  2Y1I A;  1A76 A;  4UAZ A;  1Z4O A;  3M9M B;  5KT3 A;  3H7I A;  2H3Z A;  2E5S A;  4UBC A;  2KE7 A;  5ALY A;  8ICF A;  4X4S A;  5KFJ A;  3PR4 A;  7ICG A;  2ZIV B;  4DFD A;  4OAF A;  2F3N A;  7ICH A;  3NYB A;  3R9K A;  4KLU A;  3LDA A;  2M0N A;  2PKE A;  2VAN A;  3HIL A;  3QUC A;  1IIP A;  1Q3U A;  1TAU A;  2NRT A;  4P2H A;  1PX5 A;  3WK6 A;  5DG8 A;  4LVS A;  3KHH A;  3UQ2 A;  1ZQF A;  2CN1 A;  2ODG A;  3D2Q A;  1NOM A;  4WC6 A;  3Q8Q B;  4DCC A;  2K8A A;  3A0B U;  2H3F A;  2HI0 A;  5DGB A;  4WC1 A;  4EEB A;  3Q8L A;  3H38 A;  3C29 A;  1N5X A;  4ED8 A;  2PI4 A;  5III A;  1BPX A;  4JLX A;  5B3Q A;  1ZD2 P;  8ICJ A;  2B56 A;  1DXS A;  1ZQZ A;  3H0L B;  1TK0 A;  8ICQ A;  1ZQC A;  1ZRN A;  2KD1 A;  1N2X A;  2K4H A;  4EBC A;  4EBK A;  3GIK A;  2W8K A;  2BR0 A;  4KLS A;  1RDF A;  2C22 A;  3OVS A;  3DV9 A;  4C8O A;  4PZO A;  3Q8P B;  2HHS A;  4UD4 A;  5BOL A;  3RB3 A;  4YD1 A;  2BDU A;  1RQL A;  3N7P D;  1ZQQ A;  5HHI A;  2K8C B;  1FFV A;  2JXJ A;  1NKB A;  2F77 X;  1L3V A;  2YB4 A;  5ALG A;  3HX0 A;  4JWN A;  9ICN A;  1ED1 A;  2R8J A;  5AI0 A;  1PK1 B;  2AGP A;  4OAI Z;  4EYH B;  1S9F A;  3ICX A;  1SL1 A;  3PO5 A;  4F92 B;  4O3P A;  3MGH A;  5CEH A;  1ECW A;  5KFS A;  5ALR A;  2ZH9 A;  1NK7 A;  1ZQA A;  3THV A;  2WAQ F;  3GZF A;  3C66 A;  4EYI B;  1KN5 A;  2E8P A;  1U4B A;  8ICP A;  1WOT A;  2Q0Z X;  3KOO A;  4LJX A;  4DLE A;  4F8R A;  4I0U A;  3AEV A;  2JRZ A;  4NLN A;  4KMO B;  5AM1 A;  1C20 A;  4DL5 A;  4IC9 A;  4FH3 A;  5ALT A;  3PY8 A;  5KFM A;  4XRH A;  2AH5 A;  4G3I A;  3ONN A;  2XIC A;  1X42 A;  4J03 A;  3HWT A;  2WB1 C;  3MR2 A;  1UT8 A;  7ICT A;  4NLZ A;  2DF4 B;  3CYM A;  4IRK A;  4Q43 A;  3RRG A;  4RQ6 A;  4RNO A;  1KDH A;  3RJE A;  2DPI A;  2AU0 A;  4IG8 A;  3WKA A;  3F2D A;  1NK8 A;  2ASJ A;  1Z4N A;  3JZ0 A;  4DFJ A;  4M9H A;  8ICS A;  2K4I A;  3IDW A;  4J9Q A;  4B9V A;  4J9S A;  4J9R A;  1J2N A;  1D9F A;  3NS1 A;  2JHD A;  1MSW D;  5KG2 A;  3RRH A;  2YX8 A;  4YMN A;  4LEW A;  1SXD A;  4TQS A;  5G5H A;  3WK7 A;  2F8L A;  3KTQ A;  5JUM A;  4YXM A;  2K4E A;  5ALO A;  9ICI A;  3BZK A;  4EV6 A;  5D4B A;  4NXT A;  9ICA A;  1TK5 A;  4UQG A;  7ICP A;  1NK6 A;  4CCH A;  1ZQT A;  4B9T A;  4UW9 A;  4FFD A;  3WFP A;  2FDR A;  4DFM A;  1VLB A;  5EWE A;  8ICO A;  3M6Z A;  1ZQW A;  3PW7 A;  5CHE A;  5J8Y C;  4JWM A;  1BNO A;  2BGW A;  1SB3 C;  4NXU A;  5AM2 A;  3QEB Z;  3ER8 C;  3WFO A;  2IOH A;  1ZQY A;  4K97 A;  2DR5 A;  4IQV A;  4JLZ A;  1ZQM A;  4KM5 A;  4ELU A;  2F76 X;  5DBA A;  5HRI A;  3ZDD A;  5AI8 A;  4C7Y A;  4DQI A;  1N62 A;  4ZH4 A;  3NKU A;  2IBK A;  3AQK A;  3V7L A;  4F4W A;  2ASD A;  4FHP A;  5L1I A;  4DQR A;  4AYB F;  1SKW A;  3C2K A;  3CRX A;  4LEY A;  2IOF A;  1ZRM A;  1XS9 D;  5J0U A;  4XJE A;  4UB6 U;  4OJO A;  5A0L A;  1EXN A;  4ECZ A;  4BGD A;  4WQL A;  2KIV A;  4UAW A;  1ZD4 A;  4RQ4 A;  4A8E A;  5AKI A;  4EEK A;  2C28 A;  1D8L A;  2HOQ A;  4X4R A;  5HHH A;  5T14 A;  1KSP A;  1ZQP A;  4Y2R A;  5AKX A;  4KLQ A;  2ZIU A;  2HMX A;  4JB3 A;  2L5Y A;  8ICN A;  5EE1 A;  3H37 A;  4F2S A;  1KKX A;  3SZ2 A;  1KL9 A;  3AQE A;  3M8R A;  3PO4 A;  8ICZ A;  2DR9 A;  2ZXH A;  3GIL A;  4F93 B;  7ICO A;  4YD2 A;  1ZQI A;  4U6P A;  1ZQR A;  2G09 A;  1SIJ A;  4UAR A;  3GV5 B;  3TAP A;  4DL3 A;  5HMM A;  3WK4 A;  4K4H A;  3AN1 A;  4Y2T A;  5KFY A;  4OAG A;  2GOL A;  2HN1 A;  4IQT A;  5B5E U;  4YP3 A;  1WWV A;  1L7O A;  2KOB A;  2KSO A;  3KZI U;  3ZD8 A;  2NRK A;  2VA2 A;  4PHP A;  2EQY A;  4IR9 A;  1QTM A;  1ZQO A;  3ISC A;  3EWA A;  4BXO B;  4UB8 U;  4USA A;  5KFQ A;  2PFQ A;  4F50 A;  4FHW A;  3WK8 A;  2I5H A;  5KFZ A;  4M9J A;  2H3V A;  2KIC A;  2ASL A;  3ZDE A;  2OXO A;  5BPC A;  9ICL A;  4WJ3 B;  3EF2 A;  3BJY A;  1JXL A;  4RT2 A;  5J2I A;  1BPE A;  2G5H B;  1V85 A;  4J9M A;  1V38 A;  2FLL A;  4K96 A;  7ICJ A;  5EWF A;  3IP4 B;  3QX7 A;  4F91 B;  5AI5 A;  4R66 A;  3GIJ A;  5J0Y A;  4IR1 A;  2DKX A;  2R18 A;  1L5U A;  2KJ8 A;  2ES6 A;  2BCQ A;  1UT5 A;  2UVU A;  1KFS A;  2EZX A;  4F4K A;  1XWL A;  2A19 A;  1X9M A;  4DSJ A;  4F5O A;  4P0P A;  5GTH U;  2IHM A;  4F4Y A;  7ICU A;  2PFO A;  1SL2 A;  5L1M A;  4Y2V A;  2YN4 A;  3MR6 A;  5J0W A;  5AKE A;  2BCS A;  2LM4 A;  1CI4 A;  4C8K A;  1NZP A;  2HBK A;  4GXI A;  2BQ3 A;  2OH2 A;  2K89 A;  4Y2J A;  3AMZ A;  2P35 A;  4AT9 A;  3C1Y A;  4K4G A;  4EZ6 A;  2JMG A;  5J2K A;  2OM6 A;  2HVI A;  3D2N A;  3JPS A;  4F72 A;  4E7X A;  2MRL A;  5AKY A;  5JTI A;  5J2A A;  4UB1 A;  2ZG6 A;  1RZT A;  4OJ6 A;  3RR7 A;  5AM3 A;  2DBY A;  1TK8 A;  9ICU A;  3MC1 A;  4QZC A;  8ICH A;  3IG8 A;  3RJJ A;  4ICA A;  1RQN A;  1JAL A;  1NZB A;  2H3I A;  2ZH4 A;  4DWI A;  2XY7 A;  4DO9 A;  2KG5 A;  1XNS A;  4X4T A;  1L7N A;  3PST A;  2B0C A;  4MHV A;  5AIB A;  5J2C A;  1ZQG A;  1DGS A;  5ALH A;  3TFR A;  5IIN A;  1WCN A;  3RB0 A;  2W9B A;  2HBJ A;  2MSN A;  1VJ5 A;  2KV2 A;  2I6X A;  1GPJ A;  4FZM A;  2Y0S F;  2ZUB A;  4PH5 A;  1QQ5 A;  4ACO A;  5CHG A;  3PNC A;  1R89 A;  2HDO A;  3SEI A;  3KBB A;  4G9B A;  4DL7 A;  4KB6 A;  3ALR A;  1VJ7 A;  2W43 A;  4M9N A;  4RWO A;  1COK A;  2N1R A;  4B6J A;  2HSZ A;  2W9B B;  2KZZ A;  2ISP A;  5HNK A;  3KHL A;  3F2B A;  1ZQK A;  3QXG A;  5KL8 B;  4M0A A;  4CF4 A;  2KFZ A;  3B9J A;  4X4O A;  3BS5 A;  5AKJ A;  5ALF A;  3TAN A;  5ALJ A;  2AQ0 A;  2XGQ A;  4AT8 B;  2ZIX A;  5KTQ A;  3RAX A;  4PHD A;  3SV3 A;  2KFN A;  4MF2 A;  5D49 A;  3V7K A;  4MEY A;  1UPH A;  2JEF A;  1OUQ A;  4F2R A;  2IUB A;  4XQ7 A;  2FPL A;  1SWV A;  2M9N A;  1WWU A;  4PHE A;  1O08 A;  1V97 A;  5AIA A;  1L3T A;  3RR8 A;  4RQN A;  2W7O A;  1TAM A;  1MN8 A;  7ICR A;  5GTI U;  1XC9 A;  4B9L A;  4O9M A;  2W9M A;  4U7C A;  2KK0 A;  3QU4 A;  2Z7J A;  5EE0 A;  5J29 A;  3LQC B;  5KFR A;  3GFK B;  3S6J A;  3KKA C;  3TI0 A;  3FM9 A;  2HBL A;  3JPQ A;  2M2V A;  3B0Y A;  1RM6 C;  1ZD3 A;  1NJW A;  4Q45 A;  3JPT A;  3BQ2 A;  4KIT B;  1X9W A;  3AU2 A;  2NO5 A;  4TUS A;  4ED6 A;  4P4O A;  2HBM A;  3MR3 A;  1UEU A;  4BUG A;  4B9N A;  4Q8F A;  3AQL A;  4M04 A;  3E0F A;  4RPZ A;  1F0M A;  8ICX A;  2E1F A;  4X0A A;  4RQ8 A;  1SL0 A;  4EED A;  2ZXI A;  2WHE A;  2IMW P;  2NYV A;  1ARO P;  5AKG A;  2QB0 A;  2W55 A;  4DOB A;  2P66 A;  4PGQ A;  5IIJ A;  2NV3 A;  2GAF D;  4M47 A;  3H8M A;  4OJL A;  2XCP A;  1LV5 A;  5L1L A;  5H2F U;  3LK9 A;  4MFC A;  4UB2 A;  2E8N A;  1K5O A;  1XO1 A;  4X4U A;  2G0A A;  3C2L A;  2W3R A;  4C4S A;  2D8C A;  3RB4 A;  5KG5 A;  3NGD A;  4NY8 A;  2K60 A;  1JAJ A;  1H38 A;  1MQ2 A;  4RPX A;  4DF4 A;  2F8K A;  3UMG A;  1ZJM A;  1B43 A;  5ALX A;  2KHV A;  3OSP A;  1KFT A;  2FJ6 A;  4HAI A;  2WTF A;  2RRD A;  5AM0 A;  1TVA A;  2XO7 A;  4QNL A;  3SEN A;  2YMP A;  4FS2 A;  1IM4 A;  1C7Y A;  4K99 A;  1WG8 A;  3PSI A;  2OYY A;  1KEJ A;  3NVZ A;  4YQW A;  4UB4 A;  2DUY A;  4O0I A;  3WKE A;  4FHY A;  5KAF U;  2LYH A;  1CUK A;  4US8 A;  5AI6 A;  5DLF A;  4C7Z A;  3KKA A;  4Q8E A;  5AK5 A;  3F2C A;  1SXE A;  5HRL A;  4CGZ A;  4DL4 A;  2YQE A;  2O1P A;  3IV6 A;  1L6N A;  3DEE A;  3V6H A;  5J0T A;  3M7D A;  3T5L A;  3MAB A;  1J97 A;  3GU3 A;  2AJQ A;  5KFE A;  3TAQ A;  7ICI A;  8ICU A;  1T7P A;  1T4G A;  4DOC A;  2JEI A;  3OJU A;  4EBJ A;  3TAR A;  5HR9 A;  2B4V A;  1UHU A;  1Z00 A;  4O69 A;  3TAD A;  4C4T A;  4DSK A;  3H4D A;  2RDJ A;  1K1Q A;  2HHT A;  4RQ3 A;  5DQH A;  3ISB A;  4YVZ A;  1T8E A;  4I2A A;  3NUQ A;  5CP2 A;  3H40 A;  3GQC A;  1TV9 A;  2NRW A;  3V6K A;  4I2G A;  2W54 A;  2YB1 A;  1TAQ A;  3PX0 A;  2XID A;  5CFT A;  1PVR A;  2KMD A;  2G08 A;  4ED3 A;  4QZE A;  3BS7 A;  2ZH3 A;  3WK9 A;  5TIS U;  1JI7 A;  4WOY A;  4RQ0 A;  3BQ1 A;  1MIY A;  4YMM A;  3H39 A;  5CWR A;  5DB7 A;  7ICN A;  4M6W A;  3GIM A;  3J81 j;  3K7D A;  4EX7 A;  3NRZ A;  3LVW A;  1NO5 A;  3N7S C;  4NWI A;  1S76 D;  3MR5 A;  4FZN A;  2MA1 A;  3T5H A;  2M2T A;  2EZZ A;  2MU2 A;  5J2D A;  3RJK A;  2VIX A;  3PMN A;  1U48 A;  3FYH A;  3I1Y A;  4J9O A;  4Y2Y A;  2JEG A;  3MDC A;  4M6W B;  2Q4T A;  3IN5 A;  1R8B A;  4ECY A;  3BQT A;  1GO3 F;  1DOQ A;  5KFT A;  4KTQ A;  5AKK A;  5DLG A;  3HJE A;  4DFK A;  3RH4 A;  1YT3 A;  5AKH A;  5HR6 A;  2KHQ A;  4C80 A;  5AK4 A;  5KFN A;  5J0O A;  2AXT U;  4F4X A;  3WKC A;  3SV4 A;  2ZH1 A;  3AQM A;  1PK3 A;  4IQU A;  4X0B A;  4Z6F A;  3PV8 A;  2M2U A;  1QLN A;  3AQN A;  2VJ5 A;  3H0R B;  3K4G A;  3WKB A;  5KT5 A;  5DEC A;  2D3D A;  1TFW A;  2YML A;  3PW0 A;  2ZTD A;  1RYS A;  3SAF A;  7ICF A;  1M6Y A;  5KFK A;  5HRB A;  5DG7 A;  3G6V A;  4IS7 A;  1HEK A;  4R63 A;  4KLL A;  2FE9 A;  4MFF A;  4GXJ A;  1OU5 A;  2W9A A;  5JU5 A;  4QJF B;  4WC7 A;  1OXJ A;  1UQV A;  2GWS A;  3F5A A;  3AL0 B;  3WK5 A;  3HJ1 A;  3NWI A;  1NJY A;  2FMS A;  5D63 A;  4Y2Q A;  1BGX T;  4QWA A;  3KHR A;  1IXR A;  1Q46 A;  3RJF A;  4LT6 A;  5ALP A;  3H4B A;  8ICV A;  2M2W A;  4YG2 A;  4NM2 A;  4O3S A;  4GFJ A;  5DG9 A;  1L7M A;  4MF8 A;  3RH6 A;  5DQI A;  3UM9 A;  5KG1 A;  3RH5 A;  2GLE A;  2WFA A;  4OJ5 A;  2FLN A;  5CA7 A;  4RZR A;  3T79 A;  2RLT A;  2BQU A;  2Y9T A;  1N61 A;  2MAX A;  1RG6 A;  3UXP A;  4JV1 A;  3HIY A;  5DB6 A;  1ZQN A;  2BPG A;  2IA6 A;  2ZUC A;  4DOA A;  4EEN A;  4C8L A;  2PMZ F;  5G5G A;  4ECR A;  2EAM A;  5L1K A;  3SQI A;  5B3P A;  2HW3 A;  1COO A;  5AK6 A;  4QZD A;  4P4P A;  2A1J A;  2XI9 A;  5ALN A;  5F9L A;  1PVP A;  2MUT A;  1FIQ A;  8ICA A;  2G07 A;  1XSP A;  3HKZ C;  9ICX A;  5KFB A;  1SZH A;  5J0P A;  4UAT A;  5ALD A;  5ALV A;  1MQ3 A;  2ZIU B;  4YXJ A;  4ED0 A;  1NKE A;  1ZQB A;  1IG6 A;  2CXY A;  1P7D A;  4X5V A;  3QU7 A;  4CE6 A;  3G6X A;  3EZ5 A;  4I2E A;  2W03 A;  4FHV A;  1Q79 A;  2YY6 A;  3ETL A;  1K1S A;  2ZIW A;  4RNN A;  4NKT A;  2QAR A;  2WAQ C;  4OCZ A;  3NVY A;  2EAN A;  3A0H U;  3RAQ A;  3N7R C;  3PSP A;  3GV7 B;  3QZ7 A;  3LWM A;  4RU9 A;  3IRU A;  1ZQL A;  1ZQ1 C;  2E8O A;  2GA9 D;  5HRH A;  2ID1 A;  3RBD A;  5KL1 B;  1FO4 A;  4YCX A;  5JRT A;  3V7J A;  1BPD A;  7ICM A;  4QWC A;  5KFF A;  3PX4 A;  4QIW F;  1L8L A;  1ZOL A;  3LVV A;  2KSO B;  2HHP A;  5KG3 A;  1MIW A;  2D6F C;  4GLX A;  2GH1 A;  2KEY A;  5HRF A;  4XQ8 A;  5ALM A;  2YMQ A;  2JR5 A;  3L4P A;  5ALW A;  4C8M A;  3F5E A;  1KRP A;  1NK4 A;  3NRW A;  2W8L A;  3PR5 B;  2ZJ5 A;  2BBH A;  1R8A A;  3C23 A;  2PXI A;  4UB5 A;  3C28 A;  1LKY A;  1X9X A;  1ZXI A;  2VA3 A;  2JV3 A;  5HML A;  4B9U A;  4I27 A;  3NAS A;  4LZG A;  5KT7 A;  2XCA A;  1ZET A;  5AIC A;  5J2H A;  1S0N A;  3G6Y A;  3AM9 A;  4CF5 A;  4QWE A;  2NRV A;  4P0P B;  2LI6 A;  5J0Q A;  4PGY A;  2W9C A;  3VCB A;  1VFG A;  4PHA A;  5DB8 A;  1LKY B;  5ALS A;  4R65 A;  2KKP A;  2DGZ A;  2LHT A;  4TUP A;  3UPQ A;  2I1Q A;  2I9G A;  3RF9 A;  2LYA A;  2R8I A;  1YZ6 A;  1Q78 A;  1UA1 A;  4ELT A;  1X6I A;  3ZD9 A;  3Q8S B;  3UXO A;  2ISO A;  4AT9 B;  1DGJ A;  3SAH A;  4EP7 A;  2ZHA A;  2HVH A;  3GDX A;  4Y2P A;  5EE9 A;  3KD3 A;  2EAO A;  5HRE A;  2DWQ A;  4AYB C;  1FEZ A;  5KFI A;  2UVR A;  3CK6 A;  1IV8 A;  2JZB A;  1WCL A;  1N56 A;  4AP9 A;  4RWQ A;  1Z1V A;  9ICP A;  2B51 A;  4RQ2 A;  2FMQ A;  1QCK A;  1PUZ A;  4RQ7 A;  2CPR A;  2DRB A;  4EBE A;  4ECT A;  2DR7 A;  5AM4 A;  2RDI A;  5L1J A;  3EPG A;  4KLT A;  5HR7 A;  2K4P A;  3BQ0 A;  2XVT A;  4OAH A;  4NLC A;  5HRK A;  1BPY A;  2FPK A;  1LB2 B;  3EW9 A;  5CFU A;  2DR8 A;  5AKZ A;  7ICQ A;  3JYY A;  1A0P A;  4LZD A;  8ICB A;  3U26 A;  1JX4 A;  9ICK A;  2F1J A;  3PSF A;  1TE2 A;  5KG4 A;  3B0X A;  4C4R A;  4P0Q A;  1B22 A;  5IIM A;  4ECS A;  3QUQ A;  4DSI A;  2HCF A;  1N48 A;  4DSF A;  1SV0 C;  3SR6 A;  4I2J A;  4EGW A;  2F44 A;  3BS5 B;  2W11 A;  5BOM A;  4YR3 A;  3OWG A;  4F4Z A;  4QZG A;  1KW4 A;  1BPB A;  4UD5 A;  1DRG A;  3BQ7 A;  2ZJA A;  4Z6D A;  1L7P A;  2ZIX B;  2VKQ A;  5DBC A;  1CEZ A;  2ZTE A;  4EBD A;  2IHN A;  3TQ1 A;  4DSL A;  1SKR A;  2ZJ8 A;  4Z6C A;  4WBZ A;  5KFD A;  4O67 A;  4DFP A;  5KAI U;  5KT4 A;  2FPM A;  3K75 D;  3QEA Z;  4DQS A;  4PPX A;  5CR0 A;  3OTQ A;  2BPC A;  3PX6 A;  2OHF A;  3D6J A;  5ALE A;  4NL9 A;  2FI1 A;  3C5F A;  4E0D A;  3C5G A;  3HPO A;  2QKQ A;  5E79 U;  4XUS A;  2NO4 A;  4K8V A;  1KNY A;  3QUB A;  3KHG A;  4O6A A;  1NKC A;  4HYK A;  4RT3 A;  3KFU F;  3K1R B;  1OW5 A;  2WB1 F;  4QZA A;  3TAD C;  4Z6E A;  1QH9 A;  4DQP A;  3BDP A;  1AQ6 A;  4XA5 A;  1XSL A;  3CNH A;  2LMR A;  1FA0 A;  4CDG A;  1NI3 A;  4PGX A;  3ISD A;  2B6G A;  4GC6 A;  5ALZ A;  2GO7 A;  2ZIV A;  3KZX A;  1VDV A;  2DKZ A;  5CB1 A;  4QWD A;  2EAP A;  3PML A;  3Q8K A;  4IL6 U;  9ICH A;  4NV0 A;  4QZ8 A;  1L3S A;  3M6K A;  2QB0 B;  2BPF A;  4EX6 A;  3C18 A;  3RBE A;  2O5A A;  3OHA A;  3C21 A;  4CRX A;  4EZ9 A;  4M2Y A;  9ICC A;  2F1H A;  2K8B B;  5DDY A;  1B4F A;  9ICQ A;  3M9O B;  4Y2X A;  3RB6 A;  4KLD A;  4YFK A;  1JXE A;  2DPJ A;  1SV0 A;  2DVI A;  4E80 A;  4OD0 A;  2H5X A;  4F3O A;  2BCU A;  1YZ7 A;  2G5I B; 
#chains in the Genus database with same CATH homology
 1D9D A;  3HW8 A;  4AT8 A;  1ZQU A;  3ZD8 A;  5KFN A;  2NRK A;  5J0O A;  2VA2 A;  4PHP A;  5L9X A;  1KLN A;  8ICK A;  4IR9 A;  5DQG A;  4F4X A;  4ECQ A;  4FH5 A;  4QZ9 A;  9ICT A;  3SV4 A;  2ZH1 A;  3AQM A;  3V72 A;  1QTM A;  4Q44 A;  1ZQO A;  3ISC A;  3EWA A;  4BXO B;  2C2E A;  3PW2 A;  5KFQ A;  4IQU A;  2J6T A;  2PFQ A;  4Z6F A;  4WC2 A;  3PV8 A;  4X0B A;  5KFW A;  5DB9 A;  4F50 A;  4FS1 A;  4FHW A;  5KT2 A;  3TFS A;  1QLN A;  2M2U A;  5DKW A;  3AQN A;  1QSY A;  1DK2 A;  1UEV A;  3K4G A;  5KT5 A;  2PI5 A;  3WFR E;  5DEC A;  1V9P A;  5KFZ A;  4M9J A;  3SYZ A;  1TFW A;  4JV0 A;  3PW0 A;  5HRD A;  3PW5 A;  1ZJN A;  2ZTD A;  2ASL A;  1RYS A;  2FMP A;  3ZDE A;  5KG0 A;  2AGQ A;  1OU5 A;  5BPC A;  9ICL A;  3MFH A;  2BQR A;  5J2E A;  7ICF A;  5KFK A;  4UBB A;  3BJY A;  1XSN A;  4RT2 A;  5DG7 A;  5J2I A;  1JXL A;  2P6R A;  5F9N A;  1BPE A;  3G6V A;  1DK3 A;  4R63 A;  3T5J A;  5KFA A;  5KFC A;  4KLM A;  4KMU A;  5KG7 A;  4J9M A;  2FLL A;  4KLL A;  1V4A A;  7ICJ A;  3MGI A;  5EWF A;  4RPY A;  3HJ4 A;  3H3A A;  4F5N A;  8ICY A;  3ZDB A;  4ECU A;  2BKE A;  4MFF A;  4F91 B;  4BDP A;  5D46 A;  4GXJ A;  4R66 A;  3LWL A;  3GIJ A;  5J0Y A;  2ZTC A;  2W9A A;  4IR1 A;  4DS5 A;  3H8W A;  5DGA A;  1L5U A;  4WC7 A;  4UB3 A;  3QE9 Y;  2GWS A;  5IIK A;  2BCQ A;  1UT5 A;  3NTU A;  2UVU A;  1KFS A;  2VA8 A;  1NK5 A;  2UVV A;  1ZQE A;  4F4K A;  4KN4 A;  1XWL A;  2C2D A;  1X9M A;  7ICS A;  4DSJ A;  4F5O A;  2P6U A;  3M9N B;  2IHM A;  4K4I A;  4F4Y A;  4DLG A;  4QWB A;  7ICU A;  3HJ1 A;  3L9D A;  4WC0 A;  4QZB A;  2NRX A;  2R8H A;  2KZ3 A;  1NJY A;  2FMS A;  2PFO A;  1HJP A;  4WC5 A;  3QZ8 A;  3HP6 A;  1BGX T;  4QWA A;  2XGP A;  1U45 A;  1SL2 A;  3JPN A;  3RJI A;  2DFL A;  3KHR A;  1IXR A;  3MR6 A;  3RJF A;  4LT6 A;  1XU4 A;  3H4B A;  5J0W A;  2BCS A;  8ICV A;  2M2W A;  1PZN A;  4YG2 A;  4F5P A;  4NM2 A;  4C8K A;  4NLK A;  4GXI A;  4O3S A;  1NZP A;  9ICB A;  2BQ3 A;  5DG9 A;  2R8K A;  2V4Q A;  4MF8 A;  3RH6 A;  2C2R A;  5DQI A;  5KG1 A;  4RWP A;  2BCR A;  2PFN A;  3RH5 A;  3AUO A;  1HUZ A;  5DDM A;  1S77 D;  5KFO A;  4AT9 A;  3OUY A;  4RUC A;  4WC3 A;  2FLN A;  5CA7 A;  4RZR A;  1ZQX A;  3C1Y A;  4BWM A;  4TUQ A;  2BQU A;  1QSL A;  4K4G A;  3H8S A;  4EZ6 A;  4NM1 A;  5J2J A;  2MAX A;  3V6J A;  3SI8 A;  5J2K A;  3UXP A;  4JV1 A;  2HVI A;  4FHX A;  1Z00 B;  3JPS A;  7ICE A;  2ZH7 A;  3HIY A;  5J2G A;  4ELV A;  5DB6 A;  1SZP A;  4BWJ A;  5KFL A;  4E7X A;  4QW9 A;  5J2A A;  4UB1 A;  1ZQN A;  2BPG A;  5KFU A;  2ZUC A;  2IA6 A;  3OVB A;  5DBB A;  1RZT A;  4DOA A;  3RTV A;  2AGO A;  3RR7 A;  8ICM A;  4EBJ A;  5F2V O;  4JUZ A;  5KG6 A;  2XY5 A;  1NJX A;  4C8L A;  1TK8 A;  1Z3E B;  4P4M A;  3GV8 B;  9ICU A;  4QZC A;  8ICH A;  4ECR A;  2ALZ A;  2KN7 A;  1NJZ A;  3RJJ A;  3OVA A;  5L1K A;  5EOZ A;  9ICR A;  3RJG A;  3M8S A;  2ZH4 A;  4DWI A;  1BNP A;  2XY7 A;  2NRZ A;  4DO9 A;  2HW3 A;  3OUY B;  1COO A;  3OV7 A;  2ZH2 A;  4I2C A;  2J6U A;  9ICO A;  4RQ5 A;  4QZD A;  3E2E A;  4X4T A;  2PBE A;  4P4P A;  4MFA A;  9ICF A;  9ICE A;  2A1J A;  2Y1I A;  5HRG A;  1A76 A;  5J2C A;  4UAZ A;  1DGS A;  1ZQG A;  2R8G A;  5IIN A;  3M9M B;  3TFR A;  5KT3 A;  5F9L A;  1WCN A;  2MUT A;  4YMO A;  3H7I A;  5J0S A;  3RB0 A;  4TQR A;  4O3O A;  8ICA A;  4GC7 A;  2W9B A;  4UBC A;  1XSP A;  9ICX A;  3OJS A;  2DRA A;  8ICF A;  5KFB A;  3JPO A;  1Y88 A;  5KFJ A;  5J0P A;  5J0R A;  3PR4 A;  1ZQS A;  3RJH A;  2KTQ A;  7ICG A;  4ECV A;  2RFF A;  2HHW A;  8ICC A;  1TFR A;  2ZUB A;  1KFD A;  1MQ3 A;  4PH5 A;  4YXJ A;  4ED0 A;  1NKE A;  1ZQB A;  7ICH A;  7ICV A;  3NYB A;  4X5V A;  5CHG A;  3PNC A;  1R89 A;  2ZH5 A;  2Y1J A;  4JV2 A;  3G6X A;  3LDA A;  4NLG A;  4KLU A;  3EZ5 A;  4I2E A;  4WC4 A;  4DL7 A;  1VJ7 A;  4FHV A;  1Q79 A;  2VAN A;  4M9N A;  1L3U A;  4RWO A;  4TUR A;  3ETL A;  1K1S A;  4RNN A;  4QZI A;  4NKT A;  2UVW A;  4ED7 A;  2W9B B;  1S10 A;  2KZZ A;  1TAU A;  2ISP A;  3RAQ A;  3T3F A;  5HNK A;  3KHL A;  3GV7 B;  2NRT A;  4MEX A;  1NK0 A;  1ZQK A;  4P2H A;  3QZ7 A;  3LWM A;  4RU9 A;  4KN7 A;  4M0A A;  1ZQL A;  4YR2 A;  2KFZ A;  5DG8 A;  1PX5 A;  4LVS A;  4DEZ A;  4FO6 A;  4DS4 A;  5HRH A;  3KHH A;  3HT3 A;  5KT6 A;  3UQ2 A;  3N97 B;  2ID1 A;  3RBD A;  3WFQ E;  1ZQF A;  4QZF A;  8ICW A;  4YCX A;  7ICK A;  3TAN A;  1RXW A;  3V7J A;  1BPD A;  1YLQ A;  1A77 A;  1NOM A;  4J9K A;  4QWC A;  5KFF A;  7ICM A;  3PX4 A;  4WC6 A;  2AQ0 A;  3Q8Q B;  2XGQ A;  3PW4 A;  4AT8 B;  2HHP A;  5DGB A;  4WC1 A;  5KTQ A;  3GII A;  3Q8L A;  5KG3 A;  3RAX A;  4PHD A;  3SV3 A;  2KFN A;  1JIH A;  9ICV A;  3H8J A;  2BDP A;  1MIW A;  4MF2 A;  5D49 A;  3V7K A;  1JQR A;  4MEY A;  3H38 A;  4X4V A;  4M9L A;  4GLX A;  4ED8 A;  1TKD A;  2JEF A;  9ICN A;  2PI4 A;  5III A;  1BPX A;  4F5R A;  5HRF A;  4KLI A;  4F2R A;  4XQ8 A;  3JPP A;  4XQ7 A;  8ICJ A;  2FPL A;  1ZQZ A;  2M9N A;  1TK0 A;  1ZQD A;  4PHE A;  1F5A A;  3FDS A;  8ICQ A;  1ZQC A;  4C8M A;  1KRP A;  1NK4 A;  4O5C A;  2W8L A;  3PR5 B;  5IIL A;  2ZJ5 A;  1L3T A;  4EBC A;  1R8A A;  3C23 A;  4EBK A;  5J2B A;  4IRD A;  3GIK A;  2PXI A;  3RR8 A;  4UB5 A;  2W8K A;  1HUO A;  2BR0 A;  1UET A;  2VA3 A;  4KLS A;  7ICR A;  5HML A;  2ZUD A;  2C22 A;  1XC9 A;  4B9U A;  4B9L A;  2W9M A;  4I27 A;  4O9M A;  4I29 A;  3UPS A;  3OVS A;  4C8O A;  5J29 A;  3N4M B;  4LZG A;  5KFR A;  3LQC B;  3GFK B;  1JMS A;  5KT7 A;  3Q8P B;  5KFV A;  2XCA A;  3TI0 A;  2HHS A;  1ZET A;  1RXV A;  3JPQ A;  5J2H A;  1S0N A;  8ICE A;  5BOL A;  3RB3 A;  2M2V A;  3B0Y A;  4UD4 A;  4YD1 A;  3G6Y A;  1NJW A;  4Q45 A;  3JPT A;  3BQ2 A;  4QWE A;  4KIT B;  2NRV A;  3AU2 A;  1X9W A;  1ZQQ A;  5HHI A;  5KFP A;  4RWN A;  1S0M A;  1MC8 A;  5J0Q A;  4TUS A;  8ICR A;  4PGY A;  8ICL A;  4ED6 A;  4P4O A;  2W9C A;  3ZDC A;  1VFG A;  4PHA A;  1NKB A;  5DB8 A;  4R65 A;  1L3V A;  4KLJ A;  3OSN A;  5KFG A;  3HX0 A;  3MR3 A;  4FBT A;  2R8J A;  4B9N A;  4JWN A;  4TUP A;  4Q8F A;  1UEU A;  3AQL A;  4M04 A;  2AGP A;  3UPQ A;  2I1Q A;  4RPZ A;  8ICX A;  4EYH B;  4O3R A;  3OHB A;  1S9F A;  4X0A A;  4RQ8 A;  2I9G A;  1SL0 A;  2R8I A;  9ICW A;  1SL1 A;  3PO5 A;  1Q78 A;  4F92 B;  1UA1 A;  4O3P A;  2IMW P;  4ELT A;  4I2H A;  1S0V A;  1ARO P;  2V9W A;  5DED A;  3ZD9 A;  3Q8S B;  3MGH A;  2HHQ A;  3UXO A;  4YR0 A;  4DOB A;  2ISO A;  2P66 A;  5KFS A;  4AT9 B;  4QZH A;  4X4N A;  2ZH9 A;  4PGQ A;  1NK7 A;  5J0X A;  4EP7 A;  5IIJ A;  1ZQA A;  2ZHA A;  3THV A;  1U49 A;  2HVH A;  1T3N A;  2KZM A;  3C66 A;  4EYI B;  1WOT A;  3GDX A;  1U4B A;  4M47 A;  8ICP A;  4M5D A;  2Q0Z X;  4ED2 A;  1TFY A;  2J6S A;  4DLE A;  4F8R A;  5HRE A;  2XCP A;  4NLN A;  8ICG A;  5KFI A;  4UAY A;  1LV5 A;  2UVR A;  5L1L A;  1ZQV A;  3LK9 A;  4MFC A;  4O3Q A;  5KFX A;  4UB2 A;  4DL5 A;  2JZB A;  2HHV A;  8ICT A;  4I28 A;  1WCL A;  1N56 A;  4FH3 A;  4ECX A;  4RWQ A;  9ICP A;  3PY8 A;  5KFM A;  4RQ2 A;  4GXK A;  4XRH A;  4RQ1 A;  3OGU A;  4FBU A;  1XO1 A;  3C1Z A;  2FMQ A;  4G3I A;  4X4U A;  4C8N A;  3C2L A;  3HWT A;  3RB4 A;  5KG5 A;  3NGD A;  2A1J B;  4RQ7 A;  3MR2 A;  1UT8 A;  2DRB A;  2B21 A;  1QSS A;  4NY8 A;  7ICT A;  2FLP A;  4EBE A;  4NLZ A;  2HHU A;  4B9M A;  1JAJ A;  4IRK A;  2MUT B;  4ECT A;  1H38 A;  2BE3 A;  2DR7 A;  3EPI A;  1MQ2 A;  4BXO A;  2RDI A;  4RPX A;  4Q43 A;  4DF4 A;  3RRG A;  5L1J A;  3EPG A;  4KLT A;  1ZJM A;  2ZH6 A;  4RQ6 A;  1B43 A;  4X4P A;  4J9L A;  3BQ0 A;  4RNO A;  3OSP A;  1KDH A;  3RJE A;  1KFT A;  2PFP A;  4I2F A;  5HRK A;  2DPI A;  2AU0 A;  1ZYQ A;  2WTF A;  4IQW A;  1BPY A;  2FPK A;  1TVA A;  2XO7 A;  4IG8 A;  1NK8 A;  1LB2 B;  3EW9 A;  2ASJ A;  4IRC A;  2DR8 A;  3JZ0 A;  4FS2 A;  4DFJ A;  1D8Y A;  1IM4 A;  7ICQ A;  4M9H A;  4RUA A;  8ICS A;  1C7Y A;  3JYY A;  4LZD A;  5IIO A;  4J9Q A;  4DF8 A;  4B9V A;  4J9S A;  4O5K A;  8ICB A;  9ICK A;  1JX4 A;  2HHX A;  4J9R A;  2F1J A;  1D9F A;  1MSW D;  4QW8 A;  1KEJ A;  5KG4 A;  5KG2 A;  5EWG A;  4YQW A;  4UB4 A;  4YMN A;  3B0X A;  3RRH A;  1SKS A;  4O0I A;  1B22 A;  4TQS A;  5IIM A;  4ECS A;  4FHY A;  4KLO A;  5KFH A;  3KTQ A;  2LYH A;  5JUM A;  1CUK A;  4YXM A;  4X4O A;  4ED1 A;  4E8F A;  4KLH A;  5DLF A;  4DSI A;  9ICI A;  1N48 A;  1JN3 A;  4DSF A;  4Q8E A;  4I2D A;  4I2J A;  1NK9 A;  4M9G A;  5HRL A;  5D4B A;  5BOM A;  4YR3 A;  2AQ4 A;  8ICI A;  4F4Z A;  4DL4 A;  3UXN A;  9ICA A;  2O1P A;  1TK5 A;  4R8U A;  4QZG A;  4UQG A;  1ZQH A;  7ICP A;  1BPB A;  4UD5 A;  1NK6 A;  4CCH A;  1ZQT A;  4B9T A;  1X9S A;  3IHQ B;  1MIV A;  3Q8M A;  3WFP A;  3V6H A;  5J0T A;  2ZJA A;  3ORY A;  4Z6D A;  4DFM A;  3C2M A;  5EWE A;  8ICO A;  1ZQW A;  3EYZ A;  3PW7 A;  1BVS A;  4NXZ A;  5HP4 A;  4DQQ A;  3T5L A;  4JWM A;  1BNO A;  3MAB A;  5DBC A;  5J2F A;  3T5K A;  2BGW A;  4ECW A;  1CEZ A;  9ICM A;  2ZTE A;  1ZQJ A;  4ATB A;  2AJQ A;  4EBD A;  2IHN A;  5KFE A;  3TAQ A;  1U47 A;  2JEJ A;  3TQ1 A;  7ICI A;  1T7P A;  4DSL A;  4YN4 A;  2ZJ8 A;  1T4G A;  3QEB Z;  1SKR A;  8ICU A;  3WFO A;  5CJ7 A;  4DOC A;  2ATL A;  1ZQY A;  4Z6C A;  2Q66 A;  2DR5 A;  2JEI A;  4IQV A;  5KFD A;  3OJU A;  4WBZ A;  1ZQM A;  2V4R A;  4DSE A;  4DFP A;  4ELU A;  3TAR A;  5DBA A;  5KT4 A;  5HR9 A;  3ZDD A;  5HRI A;  2FPM A;  3K75 D;  3Q8R B;  4DQI A;  9ICS A;  5HC9 A;  1Z00 A;  4ZH4 A;  3QEA Z;  2OWO A;  3IM1 A;  3MBY A;  4R8U B;  2IBK A;  3V7L A;  3AQK A;  4WCW A;  4DQS A;  1S0O A;  4DSK A;  4F4W A;  5CR0 A;  3H4D A;  2XY6 A;  2RDJ A;  1K1Q A;  2BPC A;  5L1I A;  2ASD A;  4FHP A;  4DL2 A;  2HHT A;  4RQ3 A;  4DQR A;  2ZH8 A;  3PX6 A;  1R8C A;  1SKW A;  3C2K A;  5TZV A;  5DQH A;  3ISB A;  4YVZ A;  1T8E A;  4I2A A;  4PPX A;  3H40 A;  5CP2 A;  7ICL A;  3GQC A;  4JK1 A;  1TV9 A;  5C5J A;  2NRW A;  3C5F A;  3V6K A;  4E0D A;  3C5G A;  3HPO A;  4KLF A;  4KLG A;  1X2I A;  1XS9 D;  4XUS A;  4ATB B;  4I2G A;  1KNY A;  5J0U A;  3KHG A;  1U9L A;  1S97 A;  4AT7 A;  1TAQ A;  3PX0 A;  4F5Q A;  1NKC A;  4HYK A;  3ZDA A;  4EEY A;  4RT3 A;  2F1I A;  4ED3 A;  1EXN A;  3MFI A;  4QZA A;  4QZE A;  2XC9 A;  2ZH3 A;  4Z6E A;  4ECZ A;  4BGD A;  2BHN A;  1KTQ A;  4DQP A;  4UAW A;  3MDA A;  4RQ0 A;  3BDP A;  1RPL A;  4RQ4 A;  3JPR A;  4XA5 A;  9ICG A;  1XSL A;  2C28 A;  1RYR A;  3BQ1 A;  1D8L A;  4S3N A;  1FA0 A;  4YMM A;  1MIY A;  4X4R A;  3H39 A;  4PGX A;  3ISD A;  2W9C B;  1BPZ A;  2BCV A;  5HHH A;  5CWR A;  5DB7 A;  4GC6 A;  1KSP A;  7ICN A;  1UA0 A;  3AU6 A;  1ZQP A;  4M6W A;  2KP7 A;  3GIM A;  4B9S A;  2ZHB A;  4KLQ A;  5CB1 A;  4QWD A;  3PML A;  4DL6 A;  3Q8K A;  8ICN A;  4AT7 B;  3H37 A;  4F2S A;  1NO5 A;  9ICH A;  5HRB A;  4NKU A;  3SZ2 A;  4QZ8 A;  1S76 D;  4RNM A;  3M8R A;  1L3S A;  3PO4 A;  9ICJ A;  4X4S A;  3MR5 A;  8ICZ A;  3T5H A;  2BPF A;  2M2T A;  2DR9 A;  4X4Q A;  3GIL A;  3RBE A;  4F93 B;  3C18 A;  4I2I A;  3WFS C;  4J9P A;  7ICO A;  5J2D A;  4YD2 A;  3UQ0 A;  1ZQI A;  1ZQR A;  3RJK A;  2O5A A;  3PMN A;  3OHA A;  1U48 A;  3C21 A;  4M2Y A;  4EZ9 A;  3FYH A;  3GV5 B;  9ICC A;  2F1H A;  5DDY A;  4J9O A;  3TAP A;  4DL3 A;  5HMM A;  3MDC A;  2JEG A;  4M6W B;  4O5E A;  9ICQ A;  3M9O B;  4K4H A;  4WBY A;  3RB6 A;  4KLD A;  4YFK A;  1JXE A;  1R8B A;  4ECY A;  4O3N A;  3BQT A;  4KLE A;  5KFY A;  2JZB B;  1DOQ A;  2DPJ A;  5KFT A;  4KTQ A;  5DLG A;  2DVI A;  3PVX A;  4DFK A;  4E80 A;  4IQT A;  4R64 A;  2H5X A;  3RH4 A;  4YP3 A;  4F3O A;  4J9N A;  2BCU A;  4I2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...