5DBCA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dg
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbcA03
4EBDA 1X9MA 4J9QA 4FS1A 4I2IA 1D9DA 1HUZA 2BR0A 5HNKA 2PFQA 8ICQA 3JPRA 1NO5A 3H4DA 1ZQNA 1PZNA 2XGPA 1FA0A 4RQ6A 5J0WA 5DQIA 2BKEA 4XUSA 4EYIB 9ICGA 1NK6A 4ED2A 2KFNA 3WFQE 4QZFA 4ECQA 5C5JA 4PGQA 4FHVA 3OV7A 4DFPA 4PH5A 5DDYA 3ISBA 4B9LA 2KFZA 3ZDCA 5HRKA 4E0DA 2NRTA 2W8KA 4R66A 4TUSA 4C8LA 3PVXA 5DB9A 1TK5A 4EBCA 4R65A 4F5PA 4EEYA 1SKWA 4Q43A 3LWMA 1EXNA 3Q8SB 5KFNA 1WCNA 4UB3A 3G6XA 2R8IA 5EWGA 4YG2A 1NJZA 3BDPA 3M9OB 3MDCA 2BCRA 2BQ3A 1ZQRA 1MIWA 4UAYA 2P6RA 2ZH4A 3MFIA 4DOBA 1S0OA 3RR7A 3Q8PB 3OVSA 4I2DA 4YR3A 5HRHA 4RT2A 2NRKA 3MDAA 5BPCA 4J9KA 3QE9Y 2AQ4A 3C21A 1TK0A 4UB5A 1S0MA 1ZQBA 2ISOA 3PY8A 4M2YA 1H38A 4J9OA 1Q78A 5KFRA 2ZJ8A 3ORYA 4DL5A 4RQ1A 2GWSA 1BPYA 4DFJA 4DSKA 1R89A 1TFWA 4K4HA 5L1LA 4F5NA 2HHVA 4PGXA 4F4ZA 4ATBA 4ELTA 3GV5B 5HRFA 3ISDA 4UB4A 1KSPA 4I2EA 1BPBA 2FPLA 4QZHA 4I2AA 8ICXA 3PX6A 1QTMA 4XQ7A 4DQSA 4XRHA 4QWBA 1QSYA 4NXZA 2ASJA 4FBUA 2M2TA 7ICFA 9ICLA 1JQRA 4JWMA 3RJEA 3UPSA 4YD1A 4ED8A 4O3QA 2J6UA 4NKUA 1WOTA 3C2KA 4FS2A 4GXKA 4B9NA 7ICKA 5KT2A 4X4QA 1K1QA 4KLSA 3RJGA 7ICSA 4DQIA 3RTVA 1X2IA 2VANA 4KN7A 4ZH4A 3SZ2A 4DL3A 3C2MA 3PX4A 4EZ9A 1COOA 3H8JA 5J2GA 4YCXA 5J0QA 3GIJA 9ICTA 4F5QA 3HT3A 2ISPA 5D4BA 2F1IA 5DGBA 3PW2A 2IA6A 3BQTA 4EZ6A 4PGYA 3HIYA 7ICJA 4J9NA 1U45A 2NRZA 5DKWA 4IRCA 1Q79A 5HR9A 4UB2A 4GC7A 5HREA 1KFTA 4F92B 4ED6A 1MIVA 3AQKA 5J0UA 3LK9A 4I2CA 5HC9A 4YXJA 3Q8LA 4X5VA 8ICIA 1S10A 3M8SA 2BCVA 3V6KA 4YMNA 4M9HA 4NY8A 1ZQZA 4O5KA 4DSLA 5DG7A 3RB0A 4E7XA 3GDXA 3ZDBA 4I27A 2M2VA 2UVVA 4MFCA 1XWLA 4P4PA 4JWNA 3H37A 1ZQEA 4M6WB 3V7LA 5DG9A 1A76A 3HJ1A 4KLGA 5L1KA 1DOQA 3C66A 3RR8A 3C5FA 7ICIA 1A77A 3QZ8A 2HHXA 3OUYB 3C5GA 2ZH8A 1JMSA 4DF8A 3NTUA 3NGDA 4FH5A 1BPEA 1F5AA 2FLLA 4J9LA 4YFKA 2NRXA 4NLZA 5KG0A 1U47A 2IHNA 4UBCA 2HW3A 7ICHA 9ICPA 4AT7A 4WC2A 2HHQA 2W9MA 4X4TA 3MR5A 1JX4A 1ZQLA 3C18A 2ZHBA 2ZH6A 1HJPA 2FLPA 2ZUBA 5J2KA 2BPFA 4UD4A 3K4GA 4RQ3A 5KFPA 4UBBA 2VA2A 2ZH7A 4RQ2A 2ASLA 2O5AA 3AUOA 4KMUA 2A1JB 2HHSA 3ZD8A 4C8KA 7ICTA 5DBAA 3EWAA 1KLNA 4DF4A 5F9NA 3RAXA 4KITB 4KLDA 1T7PA 4KLEA 4C8MA 3RJFA 3EYZA 1XO1A 1UT8A 5F9LA 4F5OA 4WBZA 3NYBA 5DLGA 3E2EA 4KTQA 8ICUA 4O0IA 4QW9A 4IQVA 3TAQA 2J6SA 3Q8MA 9ICAA 2KZZA 2OWOA 4S3NA 4F4XA 1ZQCA 1U9LA 4ELVA 4KLLA 4DL4A 3RBDA 1NZPA 4WCWA 3OVBA 5KG4A 4TURA 3BQ2A 4CCHA 5J2CA 2NRWA 1NJYA 4QZGA 4M5DA 5HRBA 4ED7A 4HYKA 3H39A 1R8BA 4WC6A 2BQUA 9ICMA 2PFPA 4RQ5A 3ZD9A 1BNPA 5HRLA 1CEZA 8ICCA 1ZJMA 2R8GA 5J2JA 4DLGA 7ICGA 1R8AA 9ICBA 1TFRA 3OJUA 7ICEA 5KFLA 2M2UA 1DGSA 1ZQGA 5JUMA 4ELUA 1S0NA 4I2JA 1ZQSA 4B9UA 4BWJA 8ICNA 4GLXA 1DK2A 4WC1A 3N4MB 2FMSA 2LYHA 2ZTEA 4TUPA 2W9CB 1ZQJA 4WC0A 4F5RA 3OHAA 5J0XA 4PHEA 3V6JA 3UXOA 1TVAA 5DDMA 3PV8A 3GIIA 4PHDA 2KZ3A 1XSLA 1OU5A 1TV9A 3PO5A 3K75D 3TQ1A 4FH3A 4RUCA 3PMNA 2XC9A 4AT7B 4KLJA 4X4PA 2RFFA 4RPYA 2BCUA 3H8SA 7ICPA 2ATLA 1KRPA 5KFHA 1R8CA 2MUTB 1TFYA 5KG5A 2IBKA 3RRGA 4K4GA 1XSPA 3HP6A 1S77D 5HHHA 3AU6A 2W9AA 5CJ7A 9ICKA 5KG1A 4RQ0A 4M47A 1ZQYA 4I28A 4BWMA 3OJSA 4NLGA 5KFJA 4GXIA 1ZETA 2WTFA 1NK7A 4YVZA 4AT8B 4O3RA 5DBBA 2RDJA 4M6WA 5IIKA 4NM1A 1RYSA 2BDPA 4JV0A 1MC8A 2AGQA 3T5LA 4RWQA 3OUYA 2J6TA 4DQQA 4BDPA 4RT3A 1QSLA 3WFPA 1KFDA 5J2BA 2ALZA 1C7YA 5KFMA 2M9NA 2C22A 8ICMA 5HHIA 4DSFA 5KFOA 5KFYA 4KLUA 4RPXA 4RQ8A 3RJHA 4FHYA 2HHUA 9ICJA 1UT5A 3FDSA 2C2EA 7ICUA 5KT7A 4MF8A 4UD5A 2FMQA 5J29A 1RXWA 2AQ0A 3JPQA 2FMPA 2R8KA 4NLKA 8ICLA 3KHHA 4C8NA 3C2LA 4B9SA 2A1JA 2PI5A 1ZQVA 4BGDA 1KTQA 5KT5A 4YQWA 4DFMA 1S9FA 1S97A 4KLQA 4EBEA 4DOAA 3C1YA 8ICYA 2M2WA 5KT3A 8ICJA 3PR4A 4B9TA 1JN3A 4X4VA 1BPDA 5L9XA 2HVIA 1ZQQA 2R8HA 4QZIA 5KFTA 1B43A 5KFGA 5J2EA 1ZQPA 2BQRA 1X9WA 4KN4A 1ZQAA 2FPMA 4DSIA 1MSWD 1PX5A 5HRIA 9ICWA 3L9DA 5IILA 3HWTA 4GC6A 1TAQA 3V72A 4M9GA 1ZQUA 2BCQA 4I2GA 7ICMA 2PBEA 3GFKB 3H3AA 4UQGA 2R8JA 4ECSA 4O3OA 1SZPA 1BNOA 3T5JA 4O3PA 5J0OA 1Y88A 4QZDA 2XCAA 1JXEA 1MQ2A 1ZQKA 5DQGA 2IHMA 4J9MA 4X0BA 4QZ9A 5L1JA 2JZBB 1BVSA 3SYZA 2ZH2A 3RRHA 5DEDA 4R8UB 3OHBA 3G6YA 4TUQA 3UPQA 5J0RA 4RWOA 3H4BA 4WC7A 2Q66A 5J0SA 2BCSA 4R64A 3RJJA 4E80A 5KFUA 1U4BA 2PI4A 4ED3A 5J0TA 3UQ0A 2W9CA 5DGAA 2ZJAA 4UAZA 3M8RA 8ICWA 8ICEA 5J2IA 5BOLA 2HHWA 1XS9D 2BE3A 4JV2A 4MEXA 3ZDEA 2C2RA 3PX0A 2DPJA 2JEGA 1NK5A 1QLNA 4LZGA 4ED0A 4RPZA 2IMWP 1V4AA 4XA5A 2O1PA 1VFGA 4IQUA 1UEVA 3WFOA 4QZBA 2MUTA 2ZH3A 3QEAZ 4DSJA 1ZQHA 7ICRA 1JAJA 4B9VA 4DLEA 2BHNA 5KFBA 4YMMA 4KLOA 1ZJNA 3M9MB 4UB1A 2HVHA 2P66A 4IQWA 2NRVA 1BPZA 8ICFA 3RH6A 4MFFA 1JIHA 4IQTA 5D49A 4WBYA 4JUZA 9ICIA 3OVAA 2C28A 4AT8A 9ICUA 4F2SA 4IR9A 5KG3A 4FO6A 5DECA 1DK3A 2I9GA 2FLNA 2RDIA 5CWRA 1ZQXA 9ICSA 9ICQA 1UA1A 3TI0A 3PO4A 8ICPA 2H5XA 4LVSA 4YD2A 3HX0A 3MBYA 3THVA 5KTQA 1S0VA 4FHWA 2XCPA 4FBTA 4EP7A 3OSPA 1NK8A 3IM1A 1L3TA 1SKSA 3AQNA 4I2BA 4O5EA 1D8LA 3MR6A 2W9BA 1NK0A 2HHTA 5KFIA 2W8LA 4Q8EA 2DVIA 3EW9A 1XU4A 8ICAA 4WC4A 4P2HA 4QWDA 4F2RA 4MF2A 4B9MA 5CA7A 3PW5A 3JYYA 3MFHA 2DRAA 4F8RA 3KHRA 5D46A 5KT6A 4DO9A 3EPGA 1T3NA 4NM2A 1ZQIA 5DQHA 4YXMA 3BQ0A 4EBKA 2C2DA 3OSNA 2Q0ZX 3KTQA 4AT9A 3HPOA 3Q8QB 1MQ3A 1B22A 4QZAA 1SL1A 3OGUA 2ZTCA 4QZ8A 3ISCA 4ECYA 3RJIA 3RAQA 2JEFA 3MABA 3T3FA 1CUKA 4KLFA 9ICNA 3JPOA 1SL0A 3PMLA 3KHGA 3SI8A 3WFSC 3H8WA 5KFWA 4G3IA 2MAXA 1NKCA 2ZUDA 3AU2A 4DL2A 3V7JA 5CP2A 1RPLA 4LZDA 2F1JA 3V6HA 4IR1A 5CHGA 1LB2B 4RQ7A 5KFEA 2JZBA 1NK9A 8ICZA 3G6VA 4R8UA 4DS5A 9ICRA 3AQMA 3FYHA 3GIKA 5IIOA 8ICRA 4UAWA 3TAPA 4X4OA 1NK4A 2F1HA 2AU0A 4GXJA 3RJKA 8ICGA 3SV3A 3LWLA 2XO7A 4M0AA 2ZHAA 4YR0A 1T4GA 4IRDA 3KHLA 1NJWA 1RYRA 2JEIA 3N97B 1V9PA 2KP7A 3MR3A 3JPSA 2DFLA 4RUAA 2W9BB 4X4RA 5HP4A 3PW7A 5F2VO 1XC9A 4DEZA 5KFKA 3B0YA 4P4MA 3QZ7A 4DL7A 8ICBA 5KFDA 1X9SA 1RXVA 3V7KA 3PNCA 3T5KA 8ICTA 1Z00B 4DL6A 8ICSA 3H40A 1KDHA 4YP3A 4XQ8A 4Q8FA 2DR8A 5CB1A 4O5CA 4EBJA 2AJQA 4QW8A 3T5HA 5J2AA 2BGWA 1KFSA 4FHPA 4K4IA 3TFRA 5KG7A 4R63A 3MR2A 3UQ2A 4DS4A 3B0XA 4IRKA 8ICKA 4JK1A 5HRDA 4X4SA 2HHPA 3H7IA 5DLFA 4E8FA 4LT6A 4AT9B 5KFZA 4QWCA 2KZMA 4WC5A 2ZTDA 4BXOB 1Z3EB 2ZH9A 5J0PA 4M9NA 4YMOA 4Z6EA 7ICNA 2JEJA 4QWAA 1SKRA 3M9NB 3LQCB 5KG2A 3AQLA 2DR5A 1L3SA 1IM4A 1NKBA 4YR2A 7ICLA 2P6UA 2ID1A 1RZTA 4DOCA 4RNNA 4RQ4A 4I29A 3JPTA 1ZQTA 1ZQWA 3Q8RB 2VA8A 4RWPA 4ED1A 3TFSA 3TANA 3GQCA 4O3NA 4M9LA 1UEUA 4O9MA 2KTQA 4P4OA 3UXPA 2UVUA 2PXIA 1L5UA 4Q44A 3HW8A 1L3VA 1QSSA 1ZQFA 4DSEA 3PW4A 3RH4A 4DWIA 3QEBZ 7ICQA 9ICOA 4RZRA 4PHPA 4MEYA 9ICVA 1D8YA 1NKEA 4NKTA 1ZQOA 3RB3A 4YN4A 9ICHA 1UETA 1T8EA 8ICHA 2DR7A 1SL2A 2BPGA 4X0AA 1NOMA 1BGXT 1ZQDA 4F91B 1TK8A 3JPPA 4F50A 2DR9A 5BOMA 2ZH1A 3SV4A 4C8OA 5J2DA 2ZH5A 4WC3A 4NLNA 7ICVA 1XSNA 5EWFA 4DQPA 4ECWA 2FPKA 3GV7B 2DRBA 1K1SA 3HJ4A 4X4UA 4ECXA 3RB6A 1UA0A 4I2FA 3GV8B 3BJYA 8ICOA 1JXLA 4Q45A 5HMLA 4J9PA 4F4YA 4ECTA 5DB6A 5EOZA 1TKDA 2VA3A 5KFQA 3PR5B 5L1IA 2PFOA 4RNOA 9ICXA 3WFRE 1HUOA 9ICFA 4PPXA 2BPCA 3LDAA 5DG8A 5KG6A 4TQRA 2UVRA 4DFKA 4F3OA 4M04A 1BPXA 4ATBB 2Y1IA 1AROP 2AGPA 2PFNA 2XY7A 4Z6DA 4ECUA 3C1ZA 4F93B 5EWEA 2V4RA 2XGQA 2AGOA 4QZCA 3GILA 3ZDDA 2V4QA 3EZ5A 4F4WA 4MFAA 2ZJ5A 5IIMA 3RB4A 1D9FA 4X4NA 5KFCA 5KFAA 4I2HA 2XY5A 3ETLA 4IG8A 2UVWA 3MGIA 4O3SA 1N56A 5IIJA 4DQRA 5TZVA 9ICCA 1KNYA 5HMMA 4ECZA 3JPNA 5KFVA 5CR0A 5J2FA 8ICVA 1U49A 3GIMA 3H38A 1IXRA 3RBEA 4KLTA 1Z00A 2Y1JA 5DB7A 3PW0A 4ECVA 4KLMA 1NJXA 4QWEA 3IHQB 4J9RA 1KEJA 4RU9A 3EPIA 1ZYQA 1N48A 2V9WA 3ZDAA 1VJ7A 4FHXA 5J2HA 4J9SA 4RNMA 4KLIA 1MIYA 9ICEA 3JZ0A 4RWNA 2B21A 2I1QA 7ICOA 3C23A 3BQ1A 4ECRA 2DPIA 4F4KA 1TAUA 1YLQA 4KLHA 4TQSA 5J0YA 4EYHB 3Q8KA 1L3UA 4BXOA 5KFXA 5KFFA 1ZQMA 5IIIA 3UXNA 5KFSA 5IINA 4M9JA 2KN7A 2ASDA 4Z6CA 4PHAA 5DBCA 5DB8A 1LV5A 3RH5A 1WCLA 4Z6FA 4QZEA 3TARA 2ZUCA 1U48A 5KT4A 2XY6A 3MGHA 1S76D 4JV1A 5HRGA
chains in the Genus database with same CATH superfamily
4J9QA 1F5SA 3MCRA 2PFQA 5HNKA 4K96A 2EDUA 2BKEA 4UATA 1NK6A 2KFNA 4LEZA 3OV7A 3ISBA 3ZDCA 2W8KA 4R66A 4C8LA 2HBMA 2HI0A 3QU5A 4UB3A 4IC9A 3G6XA 2K8AA 1ZQRA 1L8LA 1Q46A 4UASA 3FAHA 3Q8PB 4YR3A 5HRHA 2KSOB 4O3MA 2NRKA 2AQ4A 4J9KA 3QE9Y 3PY8A 4UB5A 3DDHA 5KFRA 2RRDA 1BPYA 5ALIA 4F4ZA 4ELTA 1JUDA 3SR6A 3QUTA 4I2EA 2FPLA 4FE3A 1ZXIA 4DQSA 4QWBA 3SEIA 3RJEA 3UPSA 4O3QA 1WOTA 7ICKA 2W7PA 2RHFA 7ICSA 1S8OA 1X2IA 2VANA 4ZH4A 3RTVA 3SZ2A 4DL3A 3GIJA 4YCXA 5J0QA 5L1MA 5DGBA 2IA6A 4EZ6A 3BQTA 3HIYA 7ICJA 5J0UA 1L8OA 3M8SA 1SXEA 4O5KA 2ZIUA 3RB0A 4PL2A 3ZDBA 3QYPA 4KLGA 3C66A 3RR8A 3C5FA 1A77A 3OUYB 5GTIU 1JMSA 1BPEA 2FLLA 2WF5A 2HW3A 3SAHA 4Y2QA 3PHZA 1V38A 4AT7A 2HHQA 1FFVA 2ZH6A 4UD4A 3K4GA 5KFPA 4UBBA 5F3XB 2HHSA 7ICTA 3EUB2 4KLEA 4KITB 3SAFA 2HDOA 4GFJA 3EYZA 5F9LA 5DLGA 4NXXA 3F5EA 5ALHA 4KTQA 8ICUA 4QW9A 3NVOA 4KLLA 1P7DA 5ALGA 4C7YA 2GO7A 5J8YC 2NRWA 3CW2C 4M5DA 5HRBA 1R8BA 9ICMA 1BNPA 2YB4A 5J2JA 3E58A 9ICBA 3N7RC 7ICEA 4ELUA 5JUMA 2WAQC 4I2JA 4B9UA 2ZTEA 2WAQF 3V6JA 5DDMA 3PV8A 1OU5A 4C7ZA 5K4LA 3K75D 3TQ1A 2HOIA 4FH3A 3WKDA 1NNLA 2E1EA 4RPYA 1KRPA 1TFYA 5D63A 5AI8A 4K4GA 1PK3A 5HHHA 1PK1A 3AU6A 5CJ7A 4RQ0A 4M47A 1ZQYA 1HIWA 4I28A 5KFJA 2AHOB 4MHVA 4Y2VA 4O3RA 4JLXA 3A0BU 4RQMA 4M6WA 4NM1A 2HBLA 4JV0A 2AGQA 3T5LA 4RWQA 3K1RB 5HHIA 4DSFA 3RJHA 4FHYA 1CRXA 2K4PA 4ZOHC 7ICUA 3NVVA 1SWWA 4FZNA 4UD5A 5J29A 2FMPA 3C2LA 4OAHA 1KTQA 1MN8A 1S9FA 4EBEA 4DOAA 3C1YA 2M2WA 2BZFA 2E8MA 1ZQQA 2R8HA 4QZIA 3L5KA 2BQRA 1PX5A 1ZQAA 4OJLA 3NASA 1ZD2P 4USAA 9ICWA 3CK6A 5IILA 3HWTA 3BQ7A 4M9GA 3M6ZA 4PZNA 4I2GA 4P0PB 4ECSA 1SZPA 3QNMA 4O3PA 2KK0A 4QZDA 2XCAA 1MQ2A 1BVSA 2ZH2A 2K60A 4Y2UA 3UPQA 3H4BA 1ZOLA 1IIPA 4E80A 2ZJAA 2JRZA 2OXOA 2HHWA 1N62A 5AKJA 2IMWP 4K99A 3WFOA 4QZBA 2MUTA 2ZH3A 4DSJA 2XICA 3M9MB 4P0QB 5T14A 8ICFA 1BPZA 2LI6A 2G0AA 4WBYA 4JUZA 4F2SA 5DECA 4FO6A 5ALUA 1DK3A 2I9GA 5CWRA 1ZQXA 9ICQA 1UA1A 3TI0A 2G07A 4LVSA 2E8OA 2ZIVB 5KTQA 5KAIU 4FBTA 3OSPA 3BZKA 3IM1A 2ZG6A 5AM4A 3ZI4A 3EF2A 1NK0A 2DL0A 4P2HA 4U7CA 4O6AA 4MF2A 5KT6A 3EPGA 1S5LU 2WHEA 2R18A 5B66U 2DF4B 2KHVA 1MQ3A 1B22A 2CN1A 5ALWA 3RAQA 4KLFA 9ICNA 3N7PD 3JPOA 4OJ6A 4K9BA 2VKQA 2WFAA 2QB0B 2ZUDA 3V7JA 5CHGA 2PMZF 4RQ7A 5KFEA 3CYMA 1JALA 9ICRA 1B0XA 3GU3A 8ICRA 4OD0A 4EV6A 1NK4A 3IDWA 4GXJA 3RJKA 2H3VA 4KM5A 2CPRA 4NJ8A 2ZHAA 4YR0A 5ALFA 2G09A 2F76X 1KL9A 3KD3A 3KFUF 2KP7A 3JPSA 2W9BB 5ALYA 4DEZA 2BBHA 2LKYA 4DL7A 8ICBA 5KFDA 3C28A 4YP3A 4EEBA 5CB1A 2AJQA 2BGWA 2GOLA 2Z7JA 4K4IA 4JLZA 2A19A 4R63A 3UQ2A 3MR2A 5HRDA 3BS5A 4DCCA 4WC5A 5KFZA 3OTQA 4BXOB 2QKQA 2B4VA 3LQCB 1NKBA 2I5HA 1RZTA 4DOCA 2ID1A 4I29A 3IP4B 3Q8RB 2VA8A 2P35A 1C20A 3TANA 4O3NA 3UXPA 4AYBC 1L5UA 4QJFB 3RH4A 4DWIA 3QUBA 4AP9A 4RZRA 4MEYA 4YN4A 1UETA 2HMXA 1SWVA 8ICHA 4F91B 1TK8A 3JPPA 2ZH1A 5J2DA 2OH2A 3AL0B 1UHUA 4I2FA 4ECTA 5HMLA 4F4YA 7ICLA 5DB6A 5KFQA 4O69A 4C4RA 2K4EA 1IG6A 2RQ5A 3LDAA 2HOQA 2UVRA 4M04A 4ATBB 4ICAA 4Z6DA 3ALRA 3C1ZA 4F93B 2XGQA 4QZCA 3RB4A 2ZJ5A 5AM1A 2IUBA 1D9FA 4X4NA 1J2MA 4EENA 1J97A 1T3QA 2FI1A 5KFAA 2UVWA 5CR0A 8ICVA 1TAMA 1IXRA 2W3SA 4RU9A 2MU2A 3EPIA 2V9WA 3F5AA 5J2HA 4KLIA 4RWNA 5ALJA 4IS7A 3C23A 2DPIA 4KLHA 4TQSA 4EYHB 1L3UA 5KFFA 5IIIA 3PZPA 5KFSA 3WKAA 4M9JA 2KN7A 1Q8KA 4Z6FA 3TARA 5HRGA 5KT4A 2XY6A 3MGHA 4FS1A 1NI3A 1D9DA 1HUZA 1NO5A 2FDRA 3JPRA 3H4DA 1ZQNA 4RQ6A 5J0WA 4EYIB 3U26A 2LPEA 4ECQA 4DFPA 5CFTA 4PH5A 1KW4A 2KFZA 2EANA 5HRKA 4E0DA 4NXWA 4TUSA 4F5PA 1L7OA 1X66A 5KFNA 3WFSC 5B5EU 3MDCA 2BQ3A 4UAYA 2ZIXA 5A0LA 2HBKA 4DOBA 2DUYA 3RR7A 3OVSA 1SB3C 4RT2A 1TK0A 2ISOA 4DL5A 2ZJ8A 4DSKA 4O68A 1TFWA 4K4HA 2A1AA 1Z1BA 4PGXA 3F2BA 3GV5B 1RDFA 4OAIZ 2Y0SC 4I2AA 8ICXA 3K7DA 4CF3A 2M2TA 1PVRA 2F44A 4JWMA 4YD1A 4ED8A 1YZ6A 5KL1B 4FS2A 5KT2A 5B3PA 1RM6C 2NYVA 2MRLA 3RJGA 3RFAA 9ICTA 3H8JA 3N7SC 4F5QA 1UCVA 3HT3A 4WC7A 2DKZA 2F1IA 3PW2A 3SENA 1KQQA 4J9NA 1UPHA 2NRZA 1VDVA 5ALTA 1Q79A 5HR9A 4UB2A 4GC7A 5HC9A 1MIVA 3LK9A 4I2CA 4YXJA 3Q8LA 4KX3A 4CF4A 2EQYA 4KB6A 3HRDD 3V6KA 1N2XA 3O0FA 4M9HA 2M2VA 2JHDA 4JWNA 3HJ1A 5DG9A 5AM2A 3IRUA 5L1KA 1DOQA 3QZ8A 2KKVA 4FH5A 4J9LA 9ICPA 5D62A 1U47A 4UBCA 4WC2A 2GAFD 3C18A 1HJPA 4EEDA 5J2KA 1SZHA 2VA2A 3IG8A 3F2DA 2O5AA 2JH7A 5DBAA 3H0MB 1KLNA 4KLDA 3RJFA 1PVQA 2H3FA 4F5OA 4US9A 3NYBA 1VLBA 4O0IA 3Q8MA 2OWOA 3KZIU 4ELVA 4DL4A 3RBDA 3OVBA 4CCHA 2N1RA 5J2CA 1NJYA 5FP0A 4ED7A 5D61A 2BQUA 4RQ5A 3MC1A 1CEZA 5AK4A 3OJUA 5KFLA 2M2UA 4Y2XA 8ICNA 5TISU 4WC1A 3N4MB 2F8KA 3TADC 1ZQJA 4F5RA 2KZ3A 1WWUA 1XSLA 3JCFA 1TV9A 3PO5A 1AQ6A 3TACB 4RUCA 3PMNA 1L7MA 2RFFA 3H8SA 2ATLA 1HEKA 4Y2TA 5KFHA 1R8CA 5KG5A 3TADA 2IBKA 2W7OA 3RRGA 1XSPA 1S77D 4HAIA 3UMGA 2YMLA 5KG1A 4G9BA 3QUQA 2WTFA 1NK7A 4AT8B 1N61A 5DBBA 2RDJA 5CFSA 5IIKA 1RYSA 1MC8A 2J6TA 3T79A 4RT3A 1QSLA 3WFPA 5J2BA 2ALZA 4EGWA 2M9NA 8ICMA 5KFYA 4KLUA 4RPXA 9ICJA 1UT5A 1DGJA 2R8KA 2OM6A 3ICXA 4NLKA 1JI7A 4C8NA 2ES6A 4B9SA 4XJEA 2A1JA 4YQWA 5KT5A 2H3IA 5AKZA 4HX0A 1ZD3A 5KT3A 2XI9A 4IL6U 4Y2RA 1WWVA 4X4VA 1BPDA 5L9XA 2HVIA 3IV6A 2WF8A 2EWRA 5J2EA 2XVTA 3AM9A 4GC6A 3WKBA 1ZQUA 3GFKB 4O3OA 2EZZA 1ZQKA 4X0BA 4QZ9A 2W03A 3SYZA 2RP5A 5DEDA 4R8UB 2KIWA 1LKYB 5J0SA 2BCSA 2IOFA 4K97A 3UMBA 2PI4A 4ED3A 2W9CA 8ICWA 8ICEA 5AKXA 2BE3A 4MEXA 3ZDEA 2C2RA 2DPJA 2JEGA 1V4AA 4IQUA 2YMQA 7ICRA 3PSIA 1ZQHA 4KLOA 4EELA 3R9KA 4EEKA 4MFFA 1JIHA 4WH5A 3AMZA 3CP8A 1QH9A 4IR9A 3F53A 2RDIA 3NS1A 5EE3A 3THVA 3MGVA 1S0VA 3J81j 1L3TA 3K1ZA 4OJ5A 3MR6A 2W9BA 2HHTA 4UAUA 4Q8EA 2DVIA 3EW9A 2D3DA 3BS7A 2IOHA 1UQVA 4B9MA 3PW5A 3MFHA 2DRAA 5D46A 1F44A 1T3NA 4NM2A 3CNHA 4YXMA 3SQIA 3KTQA 4UB6U 5AIBA 3SAGA 3AQEA 4QZAA 5AKIA 3OGUA 3T3FA 1CUKA 3PMLA 3KHGA 3H8WA 3AEVA 2MAXA 4IR1A 4Y2JA 2F1JA 2JZBA 1NK9A 4C0ZA 3AQMA 2WF6A 2JR5A 3GIKA 5IIOA 3B9JA 3TAPA 2F1HA 5CEHA 3SV3A 3LWLA 4M0AA 1KKXA 1ZD5A 1T4GA 4IRDA 4CGZA 1V9PA 3MR3A 1XC9A 4P4MA 3E0FA 5ALQA 1T94A 8ICSA 2DR8A 3KOOA 4Q8FA 1N5WA 5J2AA 3B0XA 4X4SA 3H7IA 4O67A 5ALSA 4E8FA 2K89A 4AT9B 4QWCA 2ZIWB 1Q3VA 5J0PA 5H2FU 4M9NA 1M6YA 1SKRA 4BUGA 5KG2A 5CRXA 1L3SA 2MA1A 2P6UA 2H3ZA 4RQ4A 4U6PA 4M9LA 2KTQA 2UVUA 2PXIA 1JROA 2BBJA 5ALZA 1ZQOA 3RB3A 2DR7A 1BGXT 1ZQDA 1KBUA 4F50A 3SV4A 4DQPA 4CE6A 4ECWA 2A3VA 3GV7B 2DRBA 1K1SA 3HJ4A 4X4UA 1DXSA 3PSPA 4ECXA 3BJYA 8ICOA 1JXLA 4Q45A 3OVAA 3OPXA 2VA3A 5EOZA 3HKZC 1HUOA 9ICFA 2BPCA 3HKZF 5DG8A 2Y1IA 2AGPA 4MKPA 4ECUA 5C0YA 2M0NA 5EWEA 3ZDDA 4F4WA 5IIMA 3HILA 4I2HA 2XY5A 4IG8A 4O3SA 9ICCA 1KNYA 5TZVA 2ZXHA 2QLTA 4OJPA 5HMMA 4ECZA 5ALKA 1U49A 3GIMA 1Z00A 3PW0A 5DB7A 4QWEA 2KMDA 1KEJA 1ZYQA 1VJ7A 1MIYA 3JZ0A 2B21A 2I1QA 4DFDA 3BQ1A 2JXJA 4F4KA 1TAUA 5GTHU 3Q8KA 1ZQMA 4NXTA 2B0CA 4US8A 5DB8A 2ZIUB 4QZEA 1QLNA 1SL1A 4EBDA 1X9MA 3F2CA 2BR0A 2XGPA 2EAPA 5DQIA 4XUSA 4CRXA 3WFQE 4QZFA 4FHVA 2CRXA 3UM9A 4B9LA 1VJ5A 2K8BB 2NRTA 5ALRA 4EBCA 4R65A 3WKEA 1SKWA 3OWGA 4Q43A 1EXNA 3Q8SB 1WCNA 4J03A 4YG2A 1MIWA 2P6RA 3NKUA 5JU5A 3BZCA 2NV3A 1X42A 5BPCA 4M2YA 4K9AA 1H38A 3ORYA 2F3NA 2GWSA 1R89A 4F5NA 4NXVA 5HRFA 3ISDA 1KSPA 3WK5A 4XQ7A 3PX6A 4XRHA 3H0RB 2ODGA 4FBUA 5AICA 1JQRA 1JRPA 2J6UA 1SV0A 3C2KA 4OO1J 4X4QA 1OUQA 4DQIA 2IHOA 4KN7A 3PX4A 1MA7A 5AKEA 3C2MA 4EZ9A 1COOA 5J2GA 2ISPA 5D4BA 2I6XA 4PGYA 4AYBF 1WUDA 4C4TA 1U45A 2YMPA 3A0HU 2W3RA 2K8CB 1K5OA 4IRCA 3KBBA 2QARA 4F92B 3AQKA 2EZXA 2Y9TA 4X5VA 5ALDA 1PK1B 1ZQZA 4OAFA 5DG7A 3GDXA 4I27A 2UVVA 4P4PA 4M6WB 3V7LA 1A76A 2KD1A 4CF5A 7ICIA 2ZH8A 5HR6A 3NGDA 2LYAA 4YFKA 4NLZA 2IHNA 4LJXA 3WK8A 1FIQA 4UW9A 4X4TA 3MR5A 2L5YA 1ZQLA 2ZHBA 2FLPA 2HBJA 4RQ3A 4RQ2A 2ASLA 5EE1A 3AUOA 5JTIA 4C8KA 3EWAA 4DF4A 3RAXA 4C8MA 2KSOA 1UT8A 4WBZA 2B6GA 3TAQA 9ICAA 2DGZA 4F4XA 4TURA 3NWIA 2Y9UA 4HYKA 3H39A 4WC6A 1IV8A 2GH1A 3ZD9A 5HRLA 8ICCA 1ZJMA 2HCFA 4OCZA 1DGSA 2CXYA 1ZQSA 1DK2A 4BWJA 2LYHA 4CNQA 4N7RA 3M1YA 3OHAA 5J0XA 1TVAA 3GIIA 3DEEA 4PHDA 4BJQA 2AH5A 1COKA 2XC9A 2BCUA 7ICPA 2MUTB 2K4IA 2F77X 3UMCA 3HP6A 5ALXA 1LVHA 3GZFA 4CDGA 4BWMA 1SGGA 3OJSA 2HN2A 3DV9A 3I1YA 1LKYA 3M7DA 2BDPA 5CFUA 3OUYA 4DQQA 3KZXA 3I28A 1KFDA 1C7YA 5KFOA 4WCWA 1TE2A 3I76A 4RQ8A 2HHUA 2KNJA 5KT7A 4MF8A 2NO5A 2Y0SF 2IOFK 2FMQA 4LEYA 1GO3F 2OCEA 3KHHA 5JTGA 3NRZA 4KX5A 1ZQVA 4BGDA 4DFMA 4KLQA 8ICJA 4B9TA 1JN3A 5AI5A 1YT3A 1B43A 5KFGA 1ZQPA 2FE9A 3RF9A 4KN4A 1X9WA 4DSIA 5AI6A 2WB1C 5HRIA 1RG6A 4K8VA 2BCQA 7ICMA 1L7NA 1QCKA 3T5JA 5J0OA 1JXEA 1WYGA 4J9MA 5L1JA 3KKAA 3RRHA 3OHBA 4EX6A 4TUQA 5ALNA 5J0RA 4RWOA 3QU2A 2Q66A 4R64A 5KFUA 1U4BA 5J0TA 3UQ0A 1XS9D 4JV2A 3PX0A 2ZXIA 4ED0A 4RPZA 2O1PA 4XA5A 1UEVA 2KE7A 4QIWC 1JAJA 3S6JA 4B9VA 4DLEA 5KFBA 4YMMA 1ZJNA 4QIWF 4UB1A 2HVHA 2NRVA 3RH6A 4IQTA 2DBYA 5D49A 4Y2SA 3QU4A 1J2NA 3WK9A 9ICSA 2G5IB 3PO4A 5ALVA 1F0MA 3HX0A 1URJA 1NK8A 1SKSA 3AQFA 4I2BA 4O5EA 5KFIA 2W8LA 1XU4A 1ZRNA 4F2RA 3JYYA 5AIAA 4F8RA 3KHRA 1QQ7A 1DRGA 2Q0ZX 1N5XA 4AT9A 2HSZA 3Q8QB 2HOFA 5KAFU 2ZTCA 4QZ8A 3ISCA 2JEFA 3MABA 2YB1A 2F2AB 1SL0A 3SI8A 4P0PA 5KFWA 4G3IA 5HR7A 1NKCA 3AU2A 4DL2A 1RPLA 3V6HA 2VIXA 1L7PA 4UAWA 1FO4A 4X4OA 2AU0A 4UARA 3VC8A 3WU2U 2KJ8A 2XO7A 3KHLA 1NJWA 3FC4A 1RYRA 2JEIA 3N97B 4RUAA 3NRWA 5HP4A 2E8PA 8ICTA 4DL6A 1OXJA 1KDHA 4P0QA 4XQ8A 4EX7A 4O5CA 4QW8A 3T5HA 4KMOB 1OW5A 4DS4A 8ICKA 2E3TA 4YMOA 4Z6EA 4QWAA 3M9NB 2ZIVA 4NLCA 3AQLA 2DR5A 2DQNB 3WKCA 4RNNA 3D2SA 2G06A 4RWPA 3TFSA 4OAGA 3GQCA 4O9MA 4Q44A 3HW8A 1L3VA 1QSSA 4DSEA 7ICQA 1NKEA 4NKTA 5EE9A 1RQLA 2O6KA 2BPGA 1NOMA 4WQLA 2BDUA 1NZBA 2DR9A 5BOMA 2ZH5A 1RQNA 4NLNA 1XSNA 2FJ6A 2RLTA 4RQNA 5EWFA 4Y2PA 2ZIXB 3RB6A 2QB0A 3GV8B 2G5HB 1XNSA 2GLEA 2B51A 2YTUA 4NXUA 3PR5B 3LVWA 9ICXA 3WFRE 2LM4A 5KG6A 2KJ9A 4F3OA 1BPXA 2V4RA 2AGOA 4QNLA 5CHEA 3ETLA 3MGIA 1N56A 5IIJA 3JPNA 5KFVA 4LEVA 2LM1A 3H38A 3RBEA 4KLTA 2KVCA 3C29A 2Y1JA 5AI4A 5AKYA 4ECVA 1NJXA 4J9RA 3D2QA 3ZDAA 4FZMA 4FHXA 4J9SA 4RNMA 2D8CA 3D2NA 7ICOA 4ECRA 5ALLA 1YLQA 5J0YA 4BXOA 3ERCC 5AK5A 4UAVA 5ALOA 3UXNA 5IINA 2ASDA 4Z6CA 1LV5A 3RH5A 1S76D 3H37A 4JV1A 4OJOA 4I2IA 2YN4A 8ICQA 5J8YA 1PZNA 3HJEA 4B6JA 1FA0A 9ICGA 1A0PA 4ED2A 2E1FA 3NUQA 2EAMA 5C5JA 4PGQA 5DDYA 2JV3A 3IG5A 4NLBA 5DB9A 3PVXA 1TK5A 4EEYA 2OEHA 3LWMA 1NJZA 2R8IA 3BDPA 1ECWA 5EWGA 4X4RA 3M9OB 2BCRA 2ZH4A 3MFIA 1S0OA 2HN1A 3TKAA 3WK6A 4I2DA 3QX7A 3MDAA 1S0MA 3C21A 1ZQBA 1Q78A 4J9OA 1ED1A 2KV2A 4BX9C 4RQ1A 4DFJA 5L1LA 2HHVA 4ATBA 1Z1VA 2XIDA 4UB4A 1XO0A 1BPBA 4QZHA 1QTMA 1QSYA 1FFUA 4NXZA 2ASJA 7ICFA 9ICLA 4NKUA 4B9NA 4GXKA 1K1QA 4KLSA 3D6JA 4LT6A 2F8LA 3ER9B 4FO1A 3QXGA 2W43A 5DKWA 4A8EA 5HREA 1KFTA 1Z4OA 4ED6A 8ICIA 4LEWA 1S10A 4F72A 2BCVA 4YMNA 4NY8A 3PSFA 4DSLA 4E7XA 4MFCA 1X6JA 1XWLA 3N28A 1ZQEA 1RYUA 2DWQA 4NL9C 2YQEA 2HHXA 3C5GA 4DF8A 3NTUA 4UB8U 1F5AA 7ICHA 2NRXA 5KG0A 1FEZA 2W9MA 5AM5A 3WK7A 2LBOA 1JX4A 2KJ5A 2ZUBA 1PVPA 2BPFA 4NL9A 3PSTA 2ZH7A 4KMUA 2ESEA 2A1JB 3ZD8A 5F9NA 1T7PA 2KKPA 2K4HA 1XO1A 1B4FA 2JH1A 4C4SA 3QU7A 3E2EA 4IQVA 2J6SA 2KZZA 4S3NA 1ZQCA 1U9LA 1NZPA 5KG4A 3BQ2A 1WG8A 3QU9A 4QZGA 5AM3A 2KICA 2PFPA 1R8AA 2R8GA 4DLGA 2VJ5A 7ICGA 1TFRA 1Z4NA 1ZQGA 2GA9D 2JGAA 1S0NA 4GLXA 2OYYA 2FMSA 4TUPA 2W9CB 4WC0A 4PHEA 3UXOA 1D8BA 4PZOA 3WK4A 4AT7B 4KLJA 4X4PA 2LHTA 2YMMA 2W04A 3NVYA 5AI0A 5KNIA 2PMZC 2YX8A 2W9AA 9ICKA 3ER8C 4NLGA 5G5GA 4GXIA 1ZETA 4YVZA 4PL1A 1N60A 4BDPA 1SV0C 5KFMA 2C22A 4GIBA 3FDSA 2C2EA 1RXWA 2AQ0A 3JPQA 8ICLA 2G08A 5B3QA 2PI5A 8ICYA 5AK3A 1S97A 2DKXA 2MSNA 3CRXA 3PR4A 1ZRMA 5EE0A 1A6SA 2YY6A 5KFTA 3H8MA 3AN1A 1MSWD 2FPMA 2FCLA 4I0UA 3L9DA 5KL8B 4F71A 2EH9A 3V72A 1TAQA 2PBEA 3H3AA 4UQGA 2B56A 2R8JA 1BNOA 1O03A 1Y88A 2IHMA 2Q4TA 5DQGA 4K98A 2JZBB 4WQKA 3G6YA 2W11A 3RJJA 2E5SA 1O08A 5DGAA 4UAZA 3M8RA 5ALPA 1V97A 1CI4A 5J2IA 5BOLA 5AKGA 1NK5A 5AKHA 4LZGA 1VFGA 2EAOA 3QUCA 3QEAZ 4ACOA 2BHNA 3ED5A 2P66A 4IQWA 2KHQA 3L3FX 9ICIA 2C28A 4AT8A 9ICUA 4WOYA 4PJ0U 5KG3A 3H0LB 5ALEA 2FLNA 3NVWA 3SMVA 3ETRA 8ICPA 2QB1A 2H5XA 4YD2A 3MBYA 1X9XA 4FHWA 2XCPA 4EP7A 2LYBA 3AQNA 1PUZA 1D8LA 1X6IA 5AKLA 8ICAA 4WC4A 4QWDA 1ZQ1C 5CA7A 2PKEA 4DO9A 2KOBA 1ZQIA 5DQHA 3BQ0A 1SIJA 4EBKA 2C2DA 3OSNA 3HPOA 2VJ4A 3SD7A 4ECYA 3RJIA 5CP2A 4LZDA 5AM0A 1L6NA 1LB2B 5ALMA 8ICZA 3G6VA 4R8UA 4DS5A 2EZYA 2AXTU 2OHFA 3FYHA 2KG5A 5AI9A 8ICGA 3VCBA 2H3QA 1SXDA 1N63A 2W54A 2DFLA 1X40A 4WJ3B 3PW7A 5F2VO 3B0YA 5KFKA 4NV0A 3QZ7A 2NO4A 1X9SA 1RXVA 3V7KA 3PNCA 3T5KA 1Z00B 1KN5A 4C80A 3H40A 2WF9A 4EBJA 4FHPA 1KFSA 3TFRA 4FZLA 5AKKA 5KG7A 4IRKA 4JK1A 2HHPA 5DLFA 3KKAC 2ZH9A 2KZMA 2ZTDA 1Z3EB 3FM9A 7ICNA 2JEJA 2WB1F 1IM4A 4YR2A 4NWIA 3JPTA 1ZQTA 1ZQWA 4ED1A 5AHXA 2JMGA 1UEUA 1ZD4A 4P4OA 2W55A 4Y2YA 1ZQFA 3PW4A 1QQ6A 4FFDA 3QEBZ 9ICOA 4PHPA 1Q3UA 9ICVA 1D8YA 9ICHA 1T8EA 1SL2A 4X0AA 1GPJA 1V85A 2E8NA 1Z19A 4C8OA 4WC3A 7ICVA 2FPKA 1UA0A 1SV4A 4J9PA 1TKDA 5L1IA 2PFOA 4RNOA 5AK6A 4PPXA 3NVZA 4TQRA 1QQ5A 3BS5B 4DFKA 2LMRA 3LYSA 1AROP 2PFNA 2XY7A 5JRTA 3L4PA 3GILA 2V4QA 3EZ5A 4MFAA 5KFCA 2KEYA 3LVVA 4DQRA 5E79U 5J2FA 4KLMA 2KIVA 3IN5A 3IHQB 1N48A 9ICEA 5G5HA 1YZ7A 2QARB 4JB3A 2WF7A 2ZIWA 5KFXA 2D6FC 4JMUA 4PHAA 5DBCA 3ONNA 2KVSA 1WCLA 1U48A 2ZUCA 3M6KA
chains in the Genus database with same CATH topology
4EBDA 1X9MA 4J9QA 4FS1A 4I2IA 1D9DA 1HUZA 2BR0A 5HNKA 2PFQA 8ICQA 3JPRA 1NO5A 3H4DA 1ZQNA 1PZNA 2XGPA 1FA0A 4RQ6A 5J0WA 5DQIA 2BKEA 4XUSA 4EYIB 9ICGA 1NK6A 4ED2A 2KFNA 3WFQE 4QZFA 4ECQA 5C5JA 4PGQA 4FHVA 3OV7A 4DFPA 4PH5A 5DDYA 3ISBA 4B9LA 2KFZA 3ZDCA 5HRKA 4E0DA 2NRTA 2W8KA 4R66A 4TUSA 4C8LA 3PVXA 5DB9A 1TK5A 4EBCA 4R65A 4F5PA 4EEYA 1SKWA 4Q43A 3LWMA 1EXNA 3Q8SB 5KFNA 1WCNA 4UB3A 3G6XA 2R8IA 5EWGA 4YG2A 1NJZA 3BDPA 3M9OB 3MDCA 2BCRA 2BQ3A 1ZQRA 1MIWA 4UAYA 2P6RA 2ZH4A 3MFIA 4DOBA 1S0OA 3RR7A 3Q8PB 3OVSA 4I2DA 4YR3A 5HRHA 4RT2A 2NRKA 3MDAA 5BPCA 4J9KA 3QE9Y 2AQ4A 3C21A 1TK0A 4UB5A 1S0MA 1ZQBA 2ISOA 3PY8A 4M2YA 1H38A 4J9OA 1Q78A 5KFRA 2ZJ8A 3ORYA 4DL5A 4RQ1A 2GWSA 1BPYA 4DFJA 4DSKA 1R89A 1TFWA 4K4HA 5L1LA 4F5NA 2HHVA 4PGXA 4F4ZA 4ATBA 4ELTA 3GV5B 5HRFA 3ISDA 4UB4A 1KSPA 4I2EA 1BPBA 2FPLA 4QZHA 4I2AA 8ICXA 3PX6A 1QTMA 4XQ7A 4DQSA 4XRHA 4QWBA 1QSYA 4NXZA 2ASJA 4FBUA 2M2TA 7ICFA 9ICLA 1JQRA 4JWMA 3RJEA 3UPSA 4YD1A 4ED8A 4O3QA 2J6UA 4NKUA 1WOTA 3C2KA 4FS2A 4GXKA 4B9NA 7ICKA 5KT2A 4X4QA 1K1QA 4KLSA 3RJGA 7ICSA 4DQIA 3RTVA 1X2IA 2VANA 4KN7A 4ZH4A 3SZ2A 4DL3A 3C2MA 3PX4A 4EZ9A 1COOA 3H8JA 5J2GA 4YCXA 5J0QA 3GIJA 9ICTA 4F5QA 3HT3A 2ISPA 5D4BA 2F1IA 5DGBA 3PW2A 2IA6A 3BQTA 4EZ6A 4PGYA 3HIYA 7ICJA 4J9NA 1U45A 2NRZA 5DKWA 4IRCA 1Q79A 5HR9A 4UB2A 4GC7A 5HREA 1KFTA 4F92B 4ED6A 1MIVA 3AQKA 5J0UA 3LK9A 4I2CA 5HC9A 4YXJA 3Q8LA 4X5VA 8ICIA 1S10A 3M8SA 2BCVA 3V6KA 4YMNA 4M9HA 4NY8A 1ZQZA 4O5KA 4DSLA 5DG7A 3RB0A 4E7XA 3GDXA 3ZDBA 4I27A 2M2VA 2UVVA 4MFCA 1XWLA 4P4PA 4JWNA 3H37A 1ZQEA 4M6WB 3V7LA 5DG9A 1A76A 3HJ1A 4KLGA 5L1KA 1DOQA 3C66A 3RR8A 3C5FA 7ICIA 1A77A 3QZ8A 2HHXA 3OUYB 3C5GA 2ZH8A 1JMSA 4DF8A 3NTUA 3NGDA 4FH5A 1BPEA 1F5AA 2FLLA 4J9LA 4YFKA 2NRXA 4NLZA 5KG0A 1U47A 2IHNA 4UBCA 2HW3A 7ICHA 9ICPA 4AT7A 4WC2A 2HHQA 2W9MA 4X4TA 3MR5A 1JX4A 1ZQLA 3C18A 2ZHBA 2ZH6A 1HJPA 2FLPA 2ZUBA 5J2KA 2BPFA 4UD4A 3K4GA 4RQ3A 5KFPA 4UBBA 2VA2A 2ZH7A 4RQ2A 2ASLA 2O5AA 3AUOA 4KMUA 2A1JB 2HHSA 3ZD8A 4C8KA 7ICTA 5DBAA 3EWAA 1KLNA 4DF4A 5F9NA 3RAXA 4KITB 4KLDA 1T7PA 4KLEA 4C8MA 3RJFA 3EYZA 1XO1A 1UT8A 5F9LA 4F5OA 4WBZA 3NYBA 5DLGA 3E2EA 4KTQA 8ICUA 4O0IA 4QW9A 4IQVA 3TAQA 2J6SA 3Q8MA 9ICAA 2KZZA 2OWOA 4S3NA 4F4XA 1ZQCA 1U9LA 4ELVA 4KLLA 4DL4A 3RBDA 1NZPA 4WCWA 3OVBA 5KG4A 4TURA 3BQ2A 4CCHA 5J2CA 2NRWA 1NJYA 4QZGA 4M5DA 5HRBA 4ED7A 4HYKA 3H39A 1R8BA 4WC6A 2BQUA 9ICMA 2PFPA 4RQ5A 3ZD9A 1BNPA 5HRLA 1CEZA 8ICCA 1ZJMA 2R8GA 5J2JA 4DLGA 7ICGA 1R8AA 9ICBA 1TFRA 3OJUA 7ICEA 5KFLA 2M2UA 1DGSA 1ZQGA 5JUMA 4ELUA 1S0NA 4I2JA 1ZQSA 4B9UA 4BWJA 8ICNA 4GLXA 1DK2A 4WC1A 3N4MB 2FMSA 2LYHA 2ZTEA 4TUPA 2W9CB 1ZQJA 4WC0A 4F5RA 3OHAA 5J0XA 4PHEA 3V6JA 3UXOA 1TVAA 5DDMA 3PV8A 3GIIA 4PHDA 2KZ3A 1XSLA 1OU5A 1TV9A 3PO5A 3K75D 3TQ1A 4FH3A 4RUCA 3PMNA 2XC9A 4AT7B 4KLJA 4X4PA 2RFFA 4RPYA 2BCUA 3H8SA 7ICPA 2ATLA 1KRPA 5KFHA 1R8CA 2MUTB 1TFYA 5KG5A 2IBKA 3RRGA 4K4GA 1XSPA 3HP6A 1S77D 5HHHA 3AU6A 2W9AA 5CJ7A 9ICKA 5KG1A 4RQ0A 4M47A 1ZQYA 4I28A 4BWMA 3OJSA 4NLGA 5KFJA 4GXIA 1ZETA 2WTFA 1NK7A 4YVZA 4AT8B 4O3RA 5DBBA 2RDJA 4M6WA 5IIKA 4NM1A 1RYSA 2BDPA 4JV0A 1MC8A 2AGQA 3T5LA 4RWQA 3OUYA 2J6TA 4DQQA 4BDPA 4RT3A 1QSLA 3WFPA 1KFDA 5J2BA 2ALZA 1C7YA 5KFMA 2M9NA 2C22A 8ICMA 5HHIA 4DSFA 5KFOA 5KFYA 4KLUA 4RPXA 4RQ8A 3RJHA 4FHYA 2HHUA 9ICJA 1UT5A 3FDSA 2C2EA 7ICUA 5KT7A 4MF8A 4UD5A 2FMQA 5J29A 1RXWA 2AQ0A 3JPQA 2FMPA 2R8KA 4NLKA 8ICLA 3KHHA 4C8NA 3C2LA 4B9SA 2A1JA 2PI5A 1ZQVA 4BGDA 1KTQA 5KT5A 4YQWA 4DFMA 1S9FA 1S97A 4KLQA 4EBEA 4DOAA 3C1YA 8ICYA 2M2WA 5KT3A 8ICJA 3PR4A 4B9TA 1JN3A 4X4VA 1BPDA 5L9XA 2HVIA 1ZQQA 2R8HA 4QZIA 5KFTA 1B43A 5KFGA 5J2EA 1ZQPA 2BQRA 1X9WA 4KN4A 1ZQAA 2FPMA 4DSIA 1MSWD 1PX5A 5HRIA 9ICWA 3L9DA 5IILA 3HWTA 4GC6A 1TAQA 3V72A 4M9GA 1ZQUA 2BCQA 4I2GA 7ICMA 2PBEA 3GFKB 3H3AA 4UQGA 2R8JA 4ECSA 4O3OA 1SZPA 1BNOA 3T5JA 4O3PA 5J0OA 1Y88A 4QZDA 2XCAA 1JXEA 1MQ2A 1ZQKA 5DQGA 2IHMA 4J9MA 4X0BA 4QZ9A 5L1JA 2JZBB 1BVSA 3SYZA 2ZH2A 3RRHA 5DEDA 4R8UB 3OHBA 3G6YA 4TUQA 3UPQA 5J0RA 4RWOA 3H4BA 4WC7A 2Q66A 5J0SA 2BCSA 4R64A 3RJJA 4E80A 5KFUA 1U4BA 2PI4A 4ED3A 5J0TA 3UQ0A 2W9CA 5DGAA 2ZJAA 4UAZA 3M8RA 8ICWA 8ICEA 5J2IA 5BOLA 2HHWA 1XS9D 2BE3A 4JV2A 4MEXA 3ZDEA 2C2RA 3PX0A 2DPJA 2JEGA 1NK5A 1QLNA 4LZGA 4ED0A 4RPZA 2IMWP 1V4AA 4XA5A 2O1PA 1VFGA 4IQUA 1UEVA 3WFOA 4QZBA 2MUTA 2ZH3A 3QEAZ 4DSJA 1ZQHA 7ICRA 1JAJA 4B9VA 4DLEA 2BHNA 5KFBA 4YMMA 4KLOA 1ZJNA 3M9MB 4UB1A 2HVHA 2P66A 4IQWA 2NRVA 1BPZA 8ICFA 3RH6A 4MFFA 1JIHA 4IQTA 5D49A 4WBYA 4JUZA 9ICIA 3OVAA 2C28A 4AT8A 9ICUA 4F2SA 4IR9A 5KG3A 4FO6A 5DECA 1DK3A 2I9GA 2FLNA 2RDIA 5CWRA 1ZQXA 9ICSA 9ICQA 1UA1A 3TI0A 3PO4A 8ICPA 2H5XA 4LVSA 4YD2A 3HX0A 3MBYA 3THVA 5KTQA 1S0VA 4FHWA 2XCPA 4FBTA 4EP7A 3OSPA 1NK8A 3IM1A 1L3TA 1SKSA 3AQNA 4I2BA 4O5EA 1D8LA 3MR6A 2W9BA 1NK0A 2HHTA 5KFIA 2W8LA 4Q8EA 2DVIA 3EW9A 1XU4A 8ICAA 4WC4A 4P2HA 4QWDA 4F2RA 4MF2A 4B9MA 5CA7A 3PW5A 3JYYA 3MFHA 2DRAA 4F8RA 3KHRA 5D46A 5KT6A 4DO9A 3EPGA 1T3NA 4NM2A 1ZQIA 5DQHA 4YXMA 3BQ0A 4EBKA 2C2DA 3OSNA 2Q0ZX 3KTQA 4AT9A 3HPOA 3Q8QB 1MQ3A 1B22A 4QZAA 1SL1A 3OGUA 2ZTCA 4QZ8A 3ISCA 4ECYA 3RJIA 3RAQA 2JEFA 3MABA 3T3FA 1CUKA 4KLFA 9ICNA 3JPOA 1SL0A 3PMLA 3KHGA 3SI8A 3WFSC 3H8WA 5KFWA 4G3IA 2MAXA 1NKCA 2ZUDA 3AU2A 4DL2A 3V7JA 5CP2A 1RPLA 4LZDA 2F1JA 3V6HA 4IR1A 5CHGA 1LB2B 4RQ7A 5KFEA 2JZBA 1NK9A 8ICZA 3G6VA 4R8UA 4DS5A 9ICRA 3AQMA 3FYHA 3GIKA 5IIOA 8ICRA 4UAWA 3TAPA 4X4OA 1NK4A 2F1HA 2AU0A 4GXJA 3RJKA 8ICGA 3SV3A 3LWLA 2XO7A 4M0AA 2ZHAA 4YR0A 1T4GA 4IRDA 3KHLA 1NJWA 1RYRA 2JEIA 3N97B 1V9PA 2KP7A 3MR3A 3JPSA 2DFLA 4RUAA 2W9BB 4X4RA 5HP4A 3PW7A 5F2VO 1XC9A 4DEZA 5KFKA 3B0YA 4P4MA 3QZ7A 4DL7A 8ICBA 5KFDA 1X9SA 1RXVA 3V7KA 3PNCA 3T5KA 8ICTA 1Z00B 4DL6A 8ICSA 3H40A 1KDHA 4YP3A 4XQ8A 4Q8FA 2DR8A 5CB1A 4O5CA 4EBJA 2AJQA 4QW8A 3T5HA 5J2AA 2BGWA 1KFSA 4FHPA 4K4IA 3TFRA 5KG7A 4R63A 3MR2A 3UQ2A 4DS4A 3B0XA 4IRKA 8ICKA 4JK1A 5HRDA 4X4SA 2HHPA 3H7IA 5DLFA 4E8FA 4LT6A 4AT9B 5KFZA 4QWCA 2KZMA 4WC5A 2ZTDA 4BXOB 1Z3EB 2ZH9A 5J0PA 4M9NA 4YMOA 4Z6EA 7ICNA 2JEJA 4QWAA 1SKRA 3M9NB 3LQCB 5KG2A 3AQLA 2DR5A 1L3SA 1IM4A 1NKBA 4YR2A 7ICLA 2P6UA 2ID1A 1RZTA 4DOCA 4RNNA 4RQ4A 4I29A 3JPTA 1ZQTA 1ZQWA 3Q8RB 2VA8A 4RWPA 4ED1A 3TFSA 3TANA 3GQCA 4O3NA 4M9LA 1UEUA 4O9MA 2KTQA 4P4OA 3UXPA 2UVUA 2PXIA 1L5UA 4Q44A 3HW8A 1L3VA 1QSSA 1ZQFA 4DSEA 3PW4A 3RH4A 4DWIA 3QEBZ 7ICQA 9ICOA 4RZRA 4PHPA 4MEYA 9ICVA 1D8YA 1NKEA 4NKTA 1ZQOA 3RB3A 4YN4A 9ICHA 1UETA 1T8EA 8ICHA 2DR7A 1SL2A 2BPGA 4X0AA 1NOMA 1BGXT 1ZQDA 4F91B 1TK8A 3JPPA 4F50A 2DR9A 5BOMA 2ZH1A 3SV4A 4C8OA 5J2DA 2ZH5A 4WC3A 4NLNA 7ICVA 1XSNA 5EWFA 4DQPA 4ECWA 2FPKA 3GV7B 2DRBA 1K1SA 3HJ4A 4X4UA 4ECXA 3RB6A 1UA0A 4I2FA 3GV8B 3BJYA 8ICOA 1JXLA 4Q45A 5HMLA 4J9PA 4F4YA 4ECTA 5DB6A 5EOZA 1TKDA 2VA3A 5KFQA 3PR5B 5L1IA 2PFOA 4RNOA 9ICXA 3WFRE 1HUOA 9ICFA 4PPXA 2BPCA 3LDAA 5DG8A 5KG6A 4TQRA 2UVRA 4DFKA 4F3OA 4M04A 1BPXA 4ATBB 2Y1IA 1AROP 2AGPA 2PFNA 2XY7A 4Z6DA 4ECUA 3C1ZA 4F93B 5EWEA 2V4RA 2XGQA 2AGOA 4QZCA 3GILA 3ZDDA 2V4QA 3EZ5A 4F4WA 4MFAA 2ZJ5A 5IIMA 3RB4A 1D9FA 4X4NA 5KFCA 5KFAA 4I2HA 2XY5A 3ETLA 4IG8A 2UVWA 3MGIA 4O3SA 1N56A 5IIJA 4DQRA 5TZVA 9ICCA 1KNYA 5HMMA 4ECZA 3JPNA 5KFVA 5CR0A 5J2FA 8ICVA 1U49A 3GIMA 3H38A 1IXRA 3RBEA 4KLTA 1Z00A 2Y1JA 5DB7A 3PW0A 4ECVA 4KLMA 1NJXA 4QWEA 3IHQB 4J9RA 1KEJA 4RU9A 3EPIA 1ZYQA 1N48A 2V9WA 3ZDAA 1VJ7A 4FHXA 5J2HA 4J9SA 4RNMA 4KLIA 1MIYA 9ICEA 3JZ0A 4RWNA 2B21A 2I1QA 7ICOA 3C23A 3BQ1A 4ECRA 2DPIA 4F4KA 1TAUA 1YLQA 4KLHA 4TQSA 5J0YA 4EYHB 3Q8KA 1L3UA 4BXOA 5KFXA 5KFFA 1ZQMA 5IIIA 3UXNA 5KFSA 5IINA 4M9JA 2KN7A 2ASDA 4Z6CA 4PHAA 5DBCA 5DB8A 1LV5A 3RH5A 1WCLA 4Z6FA 4QZEA 3TARA 2ZUCA 1U48A 5KT4A 2XY6A 3MGHA 1S76D 4JV1A 5HRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBD A;  1X9M A;  4J9Q A;  4FS1 A;  4I2I A;  1D9D A;  1HUZ A;  2BR0 A;  5HNK A;  2PFQ A;  8ICQ A;  3JPR A;  1NO5 A;  3H4D A;  1ZQN A;  1PZN A;  2XGP A;  1FA0 A;  4RQ6 A;  5J0W A;  5DQI A;  2BKE A;  4XUS A;  4EYI B;  9ICG A;  1NK6 A;  4ED2 A;  2KFN A;  3WFQ E;  4QZF A;  4ECQ A;  5C5J A;  4PGQ A;  4FHV A;  3OV7 A;  4DFP A;  4PH5 A;  5DDY A;  3ISB A;  4B9L A;  2KFZ A;  3ZDC A;  5HRK A;  4E0D A;  2NRT A;  2W8K A;  4R66 A;  4TUS A;  4C8L A;  3PVX A;  5DB9 A;  1TK5 A;  4EBC A;  4R65 A;  4F5P A;  4EEY A;  1SKW A;  4Q43 A;  3LWM A;  1EXN A;  3Q8S B;  5KFN A;  1WCN A;  4UB3 A;  3G6X A;  2R8I A;  5EWG A;  4YG2 A;  1NJZ A;  3BDP A;  3M9O B;  3MDC A;  2BCR A;  2BQ3 A;  1ZQR A;  1MIW A;  4UAY A;  2P6R A;  2ZH4 A;  3MFI A;  4DOB A;  1S0O A;  3RR7 A;  3Q8P B;  3OVS A;  4I2D A;  4YR3 A;  5HRH A;  4RT2 A;  2NRK A;  3MDA A;  5BPC A;  4J9K A;  3QE9 Y;  2AQ4 A;  3C21 A;  1TK0 A;  4UB5 A;  1S0M A;  1ZQB A;  2ISO A;  3PY8 A;  4M2Y A;  1H38 A;  4J9O A;  1Q78 A;  5KFR A;  2ZJ8 A;  3ORY A;  4DL5 A;  4RQ1 A;  2GWS A;  1BPY A;  4DFJ A;  4DSK A;  1R89 A;  1TFW A;  4K4H A;  5L1L A;  4F5N A;  2HHV A;  4PGX A;  4F4Z A;  4ATB A;  4ELT A;  3GV5 B;  5HRF A;  3ISD A;  4UB4 A;  1KSP A;  4I2E A;  1BPB A;  2FPL A;  4QZH A;  4I2A A;  8ICX A;  3PX6 A;  1QTM A;  4XQ7 A;  4DQS A;  4XRH A;  4QWB A;  1QSY A;  4NXZ A;  2ASJ A;  4FBU A;  2M2T A;  7ICF A;  9ICL A;  1JQR A;  4JWM A;  3RJE A;  3UPS A;  4YD1 A;  4ED8 A;  4O3Q A;  2J6U A;  4NKU A;  1WOT A;  3C2K A;  4FS2 A;  4GXK A;  4B9N A;  7ICK A;  5KT2 A;  4X4Q A;  1K1Q A;  4KLS A;  3RJG A;  7ICS A;  4DQI A;  3RTV A;  1X2I A;  2VAN A;  4KN7 A;  4ZH4 A;  3SZ2 A;  4DL3 A;  3C2M A;  3PX4 A;  4EZ9 A;  1COO A;  3H8J A;  5J2G A;  4YCX A;  5J0Q A;  3GIJ A;  9ICT A;  4F5Q A;  3HT3 A;  2ISP A;  5D4B A;  2F1I A;  5DGB A;  3PW2 A;  2IA6 A;  3BQT A;  4EZ6 A;  4PGY A;  3HIY A;  7ICJ A;  4J9N A;  1U45 A;  2NRZ A;  5DKW A;  4IRC A;  1Q79 A;  5HR9 A;  4UB2 A;  4GC7 A;  5HRE A;  1KFT A;  4F92 B;  4ED6 A;  1MIV A;  3AQK A;  5J0U A;  3LK9 A;  4I2C A;  5HC9 A;  4YXJ A;  3Q8L A;  4X5V A;  8ICI A;  1S10 A;  3M8S A;  2BCV A;  3V6K A;  4YMN A;  4M9H A;  4NY8 A;  1ZQZ A;  4O5K A;  4DSL A;  5DG7 A;  3RB0 A;  4E7X A;  3GDX A;  3ZDB A;  4I27 A;  2M2V A;  2UVV A;  4MFC A;  1XWL A;  4P4P A;  4JWN A;  3H37 A;  1ZQE A;  4M6W B;  3V7L A;  5DG9 A;  1A76 A;  3HJ1 A;  4KLG A;  5L1K A;  1DOQ A;  3C66 A;  3RR8 A;  3C5F A;  7ICI A;  1A77 A;  3QZ8 A;  2HHX A;  3OUY B;  3C5G A;  2ZH8 A;  1JMS A;  4DF8 A;  3NTU A;  3NGD A;  4FH5 A;  1BPE A;  1F5A A;  2FLL A;  4J9L A;  4YFK A;  2NRX A;  4NLZ A;  5KG0 A;  1U47 A;  2IHN A;  4UBC A;  2HW3 A;  7ICH A;  9ICP A;  4AT7 A;  4WC2 A;  2HHQ A;  2W9M A;  4X4T A;  3MR5 A;  1JX4 A;  1ZQL A;  3C18 A;  2ZHB A;  2ZH6 A;  1HJP A;  2FLP A;  2ZUB A;  5J2K A;  2BPF A;  4UD4 A;  3K4G A;  4RQ3 A;  5KFP A;  4UBB A;  2VA2 A;  2ZH7 A;  4RQ2 A;  2ASL A;  2O5A A;  3AUO A;  4KMU A;  2A1J B;  2HHS A;  3ZD8 A;  4C8K A;  7ICT A;  5DBA A;  3EWA A;  1KLN A;  4DF4 A;  5F9N A;  3RAX A;  4KIT B;  4KLD A;  1T7P A;  4KLE A;  4C8M A;  3RJF A;  3EYZ A;  1XO1 A;  1UT8 A;  5F9L A;  4F5O A;  4WBZ A;  3NYB A;  5DLG A;  3E2E A;  4KTQ A;  8ICU A;  4O0I A;  4QW9 A;  4IQV A;  3TAQ A;  2J6S A;  3Q8M A;  9ICA A;  2KZZ A;  2OWO A;  4S3N A;  4F4X A;  1ZQC A;  1U9L A;  4ELV A;  4KLL A;  4DL4 A;  3RBD A;  1NZP A;  4WCW A;  3OVB A;  5KG4 A;  4TUR A;  3BQ2 A;  4CCH A;  5J2C A;  2NRW A;  1NJY A;  4QZG A;  4M5D A;  5HRB A;  4ED7 A;  4HYK A;  3H39 A;  1R8B A;  4WC6 A;  2BQU A;  9ICM A;  2PFP A;  4RQ5 A;  3ZD9 A;  1BNP A;  5HRL A;  1CEZ A;  8ICC A;  1ZJM A;  2R8G A;  5J2J A;  4DLG A;  7ICG A;  1R8A A;  9ICB A;  1TFR A;  3OJU A;  7ICE A;  5KFL A;  2M2U A;  1DGS A;  1ZQG A;  5JUM A;  4ELU A;  1S0N A;  4I2J A;  1ZQS A;  4B9U A;  4BWJ A;  8ICN A;  4GLX A;  1DK2 A;  4WC1 A;  3N4M B;  2FMS A;  2LYH A;  2ZTE A;  4TUP A;  2W9C B;  1ZQJ A;  4WC0 A;  4F5R A;  3OHA A;  5J0X A;  4PHE A;  3V6J A;  3UXO A;  1TVA A;  5DDM A;  3PV8 A;  3GII A;  4PHD A;  2KZ3 A;  1XSL A;  1OU5 A;  1TV9 A;  3PO5 A;  3K75 D;  3TQ1 A;  4FH3 A;  4RUC A;  3PMN A;  2XC9 A;  4AT7 B;  4KLJ A;  4X4P A;  2RFF A;  4RPY A;  2BCU A;  3H8S A;  7ICP A;  2ATL A;  1KRP A;  5KFH A;  1R8C A;  2MUT B;  1TFY A;  5KG5 A;  2IBK A;  3RRG A;  4K4G A;  1XSP A;  3HP6 A;  1S77 D;  5HHH A;  3AU6 A;  2W9A A;  5CJ7 A;  9ICK A;  5KG1 A;  4RQ0 A;  4M47 A;  1ZQY A;  4I28 A;  4BWM A;  3OJS A;  4NLG A;  5KFJ A;  4GXI A;  1ZET A;  2WTF A;  1NK7 A;  4YVZ A;  4AT8 B;  4O3R A;  5DBB A;  2RDJ A;  4M6W A;  5IIK A;  4NM1 A;  1RYS A;  2BDP A;  4JV0 A;  1MC8 A;  2AGQ A;  3T5L A;  4RWQ A;  3OUY A;  2J6T A;  4DQQ A;  4BDP A;  4RT3 A;  1QSL A;  3WFP A;  1KFD A;  5J2B A;  2ALZ A;  1C7Y A;  5KFM A;  2M9N A;  2C22 A;  8ICM A;  5HHI A;  4DSF A;  5KFO A;  5KFY A;  4KLU A;  4RPX A;  4RQ8 A;  3RJH A;  4FHY A;  2HHU A;  9ICJ A;  1UT5 A;  3FDS A;  2C2E A;  7ICU A;  5KT7 A;  4MF8 A;  4UD5 A;  2FMQ A;  5J29 A;  1RXW A;  2AQ0 A;  3JPQ A;  2FMP A;  2R8K A;  4NLK A;  8ICL A;  3KHH A;  4C8N A;  3C2L A;  4B9S A;  2A1J A;  2PI5 A;  1ZQV A;  4BGD A;  1KTQ A;  5KT5 A;  4YQW A;  4DFM A;  1S9F A;  1S97 A;  4KLQ A;  4EBE A;  4DOA A;  3C1Y A;  8ICY A;  2M2W A;  5KT3 A;  8ICJ A;  3PR4 A;  4B9T A;  1JN3 A;  4X4V A;  1BPD A;  5L9X A;  2HVI A;  1ZQQ A;  2R8H A;  4QZI A;  5KFT A;  1B43 A;  5KFG A;  5J2E A;  1ZQP A;  2BQR A;  1X9W A;  4KN4 A;  1ZQA A;  2FPM A;  4DSI A;  1MSW D;  1PX5 A;  5HRI A;  9ICW A;  3L9D A;  5IIL A;  3HWT A;  4GC6 A;  1TAQ A;  3V72 A;  4M9G A;  1ZQU A;  2BCQ A;  4I2G A;  7ICM A;  2PBE A;  3GFK B;  3H3A A;  4UQG A;  2R8J A;  4ECS A;  4O3O A;  1SZP A;  1BNO A;  3T5J A;  4O3P A;  5J0O A;  1Y88 A;  4QZD A;  2XCA A;  1JXE A;  1MQ2 A;  1ZQK A;  5DQG A;  2IHM A;  4J9M A;  4X0B A;  4QZ9 A;  5L1J A;  2JZB B;  1BVS A;  3SYZ A;  2ZH2 A;  3RRH A;  5DED A;  4R8U B;  3OHB A;  3G6Y A;  4TUQ A;  3UPQ A;  5J0R A;  4RWO A;  3H4B A;  4WC7 A;  2Q66 A;  5J0S A;  2BCS A;  4R64 A;  3RJJ A;  4E80 A;  5KFU A;  1U4B A;  2PI4 A;  4ED3 A;  5J0T A;  3UQ0 A;  2W9C A;  5DGA A;  2ZJA A;  4UAZ A;  3M8R A;  8ICW A;  8ICE A;  5J2I A;  5BOL A;  2HHW A;  1XS9 D;  2BE3 A;  4JV2 A;  4MEX A;  3ZDE A;  2C2R A;  3PX0 A;  2DPJ A;  2JEG A;  1NK5 A;  1QLN A;  4LZG A;  4ED0 A;  4RPZ A;  2IMW P;  1V4A A;  4XA5 A;  2O1P A;  1VFG A;  4IQU A;  1UEV A;  3WFO A;  4QZB A;  2MUT A;  2ZH3 A;  3QEA Z;  4DSJ A;  1ZQH A;  7ICR A;  1JAJ A;  4B9V A;  4DLE A;  2BHN A;  5KFB A;  4YMM A;  4KLO A;  1ZJN A;  3M9M B;  4UB1 A;  2HVH A;  2P66 A;  4IQW A;  2NRV A;  1BPZ A;  8ICF A;  3RH6 A;  4MFF A;  1JIH A;  4IQT A;  5D49 A;  4WBY A;  4JUZ A;  9ICI A;  3OVA A;  2C28 A;  4AT8 A;  9ICU A;  4F2S A;  4IR9 A;  5KG3 A;  4FO6 A;  5DEC A;  1DK3 A;  2I9G A;  2FLN A;  2RDI A;  5CWR A;  1ZQX A;  9ICS A;  9ICQ A;  1UA1 A;  3TI0 A;  3PO4 A;  8ICP A;  2H5X A;  4LVS A;  4YD2 A;  3HX0 A;  3MBY A;  3THV A;  5KTQ A;  1S0V A;  4FHW A;  2XCP A;  4FBT A;  4EP7 A;  3OSP A;  1NK8 A;  3IM1 A;  1L3T A;  1SKS A;  3AQN A;  4I2B A;  4O5E A;  1D8L A;  3MR6 A;  2W9B A;  1NK0 A;  2HHT A;  5KFI A;  2W8L A;  4Q8E A;  2DVI A;  3EW9 A;  1XU4 A;  8ICA A;  4WC4 A;  4P2H A;  4QWD A;  4F2R A;  4MF2 A;  4B9M A;  5CA7 A;  3PW5 A;  3JYY A;  3MFH A;  2DRA A;  4F8R A;  3KHR A;  5D46 A;  5KT6 A;  4DO9 A;  3EPG A;  1T3N A;  4NM2 A;  1ZQI A;  5DQH A;  4YXM A;  3BQ0 A;  4EBK A;  2C2D A;  3OSN A;  2Q0Z X;  3KTQ A;  4AT9 A;  3HPO A;  3Q8Q B;  1MQ3 A;  1B22 A;  4QZA A;  1SL1 A;  3OGU A;  2ZTC A;  4QZ8 A;  3ISC A;  4ECY A;  3RJI A;  3RAQ A;  2JEF A;  3MAB A;  3T3F A;  1CUK A;  4KLF A;  9ICN A;  3JPO A;  1SL0 A;  3PML A;  3KHG A;  3SI8 A;  3WFS C;  3H8W A;  5KFW A;  4G3I A;  2MAX A;  1NKC A;  2ZUD A;  3AU2 A;  4DL2 A;  3V7J A;  5CP2 A;  1RPL A;  4LZD A;  2F1J A;  3V6H A;  4IR1 A;  5CHG A;  1LB2 B;  4RQ7 A;  5KFE A;  2JZB A;  1NK9 A;  8ICZ A;  3G6V A;  4R8U A;  4DS5 A;  9ICR A;  3AQM A;  3FYH A;  3GIK A;  5IIO A;  8ICR A;  4UAW A;  3TAP A;  4X4O A;  1NK4 A;  2F1H A;  2AU0 A;  4GXJ A;  3RJK A;  8ICG A;  3SV3 A;  3LWL A;  2XO7 A;  4M0A A;  2ZHA A;  4YR0 A;  1T4G A;  4IRD A;  3KHL A;  1NJW A;  1RYR A;  2JEI A;  3N97 B;  1V9P A;  2KP7 A;  3MR3 A;  3JPS A;  2DFL A;  4RUA A;  2W9B B;  4X4R A;  5HP4 A;  3PW7 A;  5F2V O;  1XC9 A;  4DEZ A;  5KFK A;  3B0Y A;  4P4M A;  3QZ7 A;  4DL7 A;  8ICB A;  5KFD A;  1X9S A;  1RXV A;  3V7K A;  3PNC A;  3T5K A;  8ICT A;  1Z00 B;  4DL6 A;  8ICS A;  3H40 A;  1KDH A;  4YP3 A;  4XQ8 A;  4Q8F A;  2DR8 A;  5CB1 A;  4O5C A;  4EBJ A;  2AJQ A;  4QW8 A;  3T5H A;  5J2A A;  2BGW A;  1KFS A;  4FHP A;  4K4I A;  3TFR A;  5KG7 A;  4R63 A;  3MR2 A;  3UQ2 A;  4DS4 A;  3B0X A;  4IRK A;  8ICK A;  4JK1 A;  5HRD A;  4X4S A;  2HHP A;  3H7I A;  5DLF A;  4E8F A;  4LT6 A;  4AT9 B;  5KFZ A;  4QWC A;  2KZM A;  4WC5 A;  2ZTD A;  4BXO B;  1Z3E B;  2ZH9 A;  5J0P A;  4M9N A;  4YMO A;  4Z6E A;  7ICN A;  2JEJ A;  4QWA A;  1SKR A;  3M9N B;  3LQC B;  5KG2 A;  3AQL A;  2DR5 A;  1L3S A;  1IM4 A;  1NKB A;  4YR2 A;  7ICL A;  2P6U A;  2ID1 A;  1RZT A;  4DOC A;  4RNN A;  4RQ4 A;  4I29 A;  3JPT A;  1ZQT A;  1ZQW A;  3Q8R B;  2VA8 A;  4RWP A;  4ED1 A;  3TFS A;  3TAN A;  3GQC A;  4O3N A;  4M9L A;  1UEU A;  4O9M A;  2KTQ A;  4P4O A;  3UXP A;  2UVU A;  2PXI A;  1L5U A;  4Q44 A;  3HW8 A;  1L3V A;  1QSS A;  1ZQF A;  4DSE A;  3PW4 A;  3RH4 A;  4DWI A;  3QEB Z;  7ICQ A;  9ICO A;  4RZR A;  4PHP A;  4MEY A;  9ICV A;  1D8Y A;  1NKE A;  4NKT A;  1ZQO A;  3RB3 A;  4YN4 A;  9ICH A;  1UET A;  1T8E A;  8ICH A;  2DR7 A;  1SL2 A;  2BPG A;  4X0A A;  1NOM A;  1BGX T;  1ZQD A;  4F91 B;  1TK8 A;  3JPP A;  4F50 A;  2DR9 A;  5BOM A;  2ZH1 A;  3SV4 A;  4C8O A;  5J2D A;  2ZH5 A;  4WC3 A;  4NLN A;  7ICV A;  1XSN A;  5EWF A;  4DQP A;  4ECW A;  2FPK A;  3GV7 B;  2DRB A;  1K1S A;  3HJ4 A;  4X4U A;  4ECX A;  3RB6 A;  1UA0 A;  4I2F A;  3GV8 B;  3BJY A;  8ICO A;  1JXL A;  4Q45 A;  5HML A;  4J9P A;  4F4Y A;  4ECT A;  5DB6 A;  5EOZ A;  1TKD A;  2VA3 A;  5KFQ A;  3PR5 B;  5L1I A;  2PFO A;  4RNO A;  9ICX A;  3WFR E;  1HUO A;  9ICF A;  4PPX A;  2BPC A;  3LDA A;  5DG8 A;  5KG6 A;  4TQR A;  2UVR A;  4DFK A;  4F3O A;  4M04 A;  1BPX A;  4ATB B;  2Y1I A;  1ARO P;  2AGP A;  2PFN A;  2XY7 A;  4Z6D A;  4ECU A;  3C1Z A;  4F93 B;  5EWE A;  2V4R A;  2XGQ A;  2AGO A;  4QZC A;  3GIL A;  3ZDD A;  2V4Q A;  3EZ5 A;  4F4W A;  4MFA A;  2ZJ5 A;  5IIM A;  3RB4 A;  1D9F A;  4X4N A;  5KFC A;  5KFA A;  4I2H A;  2XY5 A;  3ETL A;  4IG8 A;  2UVW A;  3MGI A;  4O3S A;  1N56 A;  5IIJ A;  4DQR A;  5TZV A;  9ICC A;  1KNY A;  5HMM A;  4ECZ A;  3JPN A;  5KFV A;  5CR0 A;  5J2F A;  8ICV A;  1U49 A;  3GIM A;  3H38 A;  1IXR A;  3RBE A;  4KLT A;  1Z00 A;  2Y1J A;  5DB7 A;  3PW0 A;  4ECV A;  4KLM A;  1NJX A;  4QWE A;  3IHQ B;  4J9R A;  1KEJ A;  4RU9 A;  3EPI A;  1ZYQ A;  1N48 A;  2V9W A;  3ZDA A;  1VJ7 A;  4FHX A;  5J2H A;  4J9S A;  4RNM A;  4KLI A;  1MIY A;  9ICE A;  3JZ0 A;  4RWN A;  2B21 A;  2I1Q A;  7ICO A;  3C23 A;  3BQ1 A;  4ECR A;  2DPI A;  4F4K A;  1TAU A;  1YLQ A;  4KLH A;  4TQS A;  5J0Y A;  4EYH B;  3Q8K A;  1L3U A;  4BXO A;  5KFX A;  5KFF A;  1ZQM A;  5III A;  3UXN A;  5KFS A;  5IIN A;  4M9J A;  2KN7 A;  2ASD A;  4Z6C A;  4PHA A;  5DBC A;  5DB8 A;  1LV5 A;  3RH5 A;  1WCL A;  4Z6F A;  4QZE A;  3TAR A;  2ZUC A;  1U48 A;  5KT4 A;  2XY6 A;  3MGH A;  1S76 D;  4JV1 A;  5HRG A; 
#chains in the Genus database with same CATH topology
 4J9Q A;  1F5S A;  3MCR A;  2PFQ A;  5HNK A;  4K96 A;  2EDU A;  2BKE A;  4UAT A;  1NK6 A;  2KFN A;  4LEZ A;  3OV7 A;  3ISB A;  3ZDC A;  2W8K A;  4R66 A;  4C8L A;  2HBM A;  2HI0 A;  3QU5 A;  4UB3 A;  4IC9 A;  3G6X A;  2K8A A;  1ZQR A;  1L8L A;  1Q46 A;  4UAS A;  3FAH A;  3Q8P B;  4YR3 A;  5HRH A;  2KSO B;  4O3M A;  2NRK A;  2AQ4 A;  4J9K A;  3QE9 Y;  3PY8 A;  4UB5 A;  3DDH A;  5KFR A;  2RRD A;  1BPY A;  5ALI A;  4F4Z A;  4ELT A;  1JUD A;  3SR6 A;  3QUT A;  4I2E A;  2FPL A;  4FE3 A;  1ZXI A;  4DQS A;  4QWB A;  3SEI A;  3RJE A;  3UPS A;  4O3Q A;  1WOT A;  7ICK A;  2W7P A;  2RHF A;  7ICS A;  1S8O A;  1X2I A;  2VAN A;  4ZH4 A;  3RTV A;  3SZ2 A;  4DL3 A;  3GIJ A;  4YCX A;  5J0Q A;  5L1M A;  5DGB A;  2IA6 A;  4EZ6 A;  3BQT A;  3HIY A;  7ICJ A;  5J0U A;  1L8O A;  3M8S A;  1SXE A;  4O5K A;  2ZIU A;  3RB0 A;  4PL2 A;  3ZDB A;  3QYP A;  4KLG A;  3C66 A;  3RR8 A;  3C5F A;  1A77 A;  3OUY B;  5GTI U;  1JMS A;  1BPE A;  2FLL A;  2WF5 A;  2HW3 A;  3SAH A;  4Y2Q A;  3PHZ A;  1V38 A;  4AT7 A;  2HHQ A;  1FFV A;  2ZH6 A;  4UD4 A;  3K4G A;  5KFP A;  4UBB A;  5F3X B;  2HHS A;  7ICT A;  3EUB 2;  4KLE A;  4KIT B;  3SAF A;  2HDO A;  4GFJ A;  3EYZ A;  5F9L A;  5DLG A;  4NXX A;  3F5E A;  5ALH A;  4KTQ A;  8ICU A;  4QW9 A;  3NVO A;  4KLL A;  1P7D A;  5ALG A;  4C7Y A;  2GO7 A;  5J8Y C;  2NRW A;  3CW2 C;  4M5D A;  5HRB A;  1R8B A;  9ICM A;  1BNP A;  2YB4 A;  5J2J A;  3E58 A;  9ICB A;  3N7R C;  7ICE A;  4ELU A;  5JUM A;  2WAQ C;  4I2J A;  4B9U A;  2ZTE A;  2WAQ F;  3V6J A;  5DDM A;  3PV8 A;  1OU5 A;  4C7Z A;  5K4L A;  3K75 D;  3TQ1 A;  2HOI A;  4FH3 A;  3WKD A;  1NNL A;  2E1E A;  4RPY A;  1KRP A;  1TFY A;  5D63 A;  5AI8 A;  4K4G A;  1PK3 A;  5HHH A;  1PK1 A;  3AU6 A;  5CJ7 A;  4RQ0 A;  4M47 A;  1ZQY A;  1HIW A;  4I28 A;  5KFJ A;  2AHO B;  4MHV A;  4Y2V A;  4O3R A;  4JLX A;  3A0B U;  4RQM A;  4M6W A;  4NM1 A;  2HBL A;  4JV0 A;  2AGQ A;  3T5L A;  4RWQ A;  3K1R B;  5HHI A;  4DSF A;  3RJH A;  4FHY A;  1CRX A;  2K4P A;  4ZOH C;  7ICU A;  3NVV A;  1SWW A;  4FZN A;  4UD5 A;  5J29 A;  2FMP A;  3C2L A;  4OAH A;  1KTQ A;  1MN8 A;  1S9F A;  4EBE A;  4DOA A;  3C1Y A;  2M2W A;  2BZF A;  2E8M A;  1ZQQ A;  2R8H A;  4QZI A;  3L5K A;  2BQR A;  1PX5 A;  1ZQA A;  4OJL A;  3NAS A;  1ZD2 P;  4USA A;  9ICW A;  3CK6 A;  5IIL A;  3HWT A;  3BQ7 A;  4M9G A;  3M6Z A;  4PZN A;  4I2G A;  4P0P B;  4ECS A;  1SZP A;  3QNM A;  4O3P A;  2KK0 A;  4QZD A;  2XCA A;  1MQ2 A;  1BVS A;  2ZH2 A;  2K60 A;  4Y2U A;  3UPQ A;  3H4B A;  1ZOL A;  1IIP A;  4E80 A;  2ZJA A;  2JRZ A;  2OXO A;  2HHW A;  1N62 A;  5AKJ A;  2IMW P;  4K99 A;  3WFO A;  4QZB A;  2MUT A;  2ZH3 A;  4DSJ A;  2XIC A;  3M9M B;  4P0Q B;  5T14 A;  8ICF A;  1BPZ A;  2LI6 A;  2G0A A;  4WBY A;  4JUZ A;  4F2S A;  5DEC A;  4FO6 A;  5ALU A;  1DK3 A;  2I9G A;  5CWR A;  1ZQX A;  9ICQ A;  1UA1 A;  3TI0 A;  2G07 A;  4LVS A;  2E8O A;  2ZIV B;  5KTQ A;  5KAI U;  4FBT A;  3OSP A;  3BZK A;  3IM1 A;  2ZG6 A;  5AM4 A;  3ZI4 A;  3EF2 A;  1NK0 A;  2DL0 A;  4P2H A;  4U7C A;  4O6A A;  4MF2 A;  5KT6 A;  3EPG A;  1S5L U;  2WHE A;  2R18 A;  5B66 U;  2DF4 B;  2KHV A;  1MQ3 A;  1B22 A;  2CN1 A;  5ALW A;  3RAQ A;  4KLF A;  9ICN A;  3N7P D;  3JPO A;  4OJ6 A;  4K9B A;  2VKQ A;  2WFA A;  2QB0 B;  2ZUD A;  3V7J A;  5CHG A;  2PMZ F;  4RQ7 A;  5KFE A;  3CYM A;  1JAL A;  9ICR A;  1B0X A;  3GU3 A;  8ICR A;  4OD0 A;  4EV6 A;  1NK4 A;  3IDW A;  4GXJ A;  3RJK A;  2H3V A;  4KM5 A;  2CPR A;  4NJ8 A;  2ZHA A;  4YR0 A;  5ALF A;  2G09 A;  2F76 X;  1KL9 A;  3KD3 A;  3KFU F;  2KP7 A;  3JPS A;  2W9B B;  5ALY A;  4DEZ A;  2BBH A;  2LKY A;  4DL7 A;  8ICB A;  5KFD A;  3C28 A;  4YP3 A;  4EEB A;  5CB1 A;  2AJQ A;  2BGW A;  2GOL A;  2Z7J A;  4K4I A;  4JLZ A;  2A19 A;  4R63 A;  3UQ2 A;  3MR2 A;  5HRD A;  3BS5 A;  4DCC A;  4WC5 A;  5KFZ A;  3OTQ A;  4BXO B;  2QKQ A;  2B4V A;  3LQC B;  1NKB A;  2I5H A;  1RZT A;  4DOC A;  2ID1 A;  4I29 A;  3IP4 B;  3Q8R B;  2VA8 A;  2P35 A;  1C20 A;  3TAN A;  4O3N A;  3UXP A;  4AYB C;  1L5U A;  4QJF B;  3RH4 A;  4DWI A;  3QUB A;  4AP9 A;  4RZR A;  4MEY A;  4YN4 A;  1UET A;  2HMX A;  1SWV A;  8ICH A;  4F91 B;  1TK8 A;  3JPP A;  2ZH1 A;  5J2D A;  2OH2 A;  3AL0 B;  1UHU A;  4I2F A;  4ECT A;  5HML A;  4F4Y A;  7ICL A;  5DB6 A;  5KFQ A;  4O69 A;  4C4R A;  2K4E A;  1IG6 A;  2RQ5 A;  3LDA A;  2HOQ A;  2UVR A;  4M04 A;  4ATB B;  4ICA A;  4Z6D A;  3ALR A;  3C1Z A;  4F93 B;  2XGQ A;  4QZC A;  3RB4 A;  2ZJ5 A;  5AM1 A;  2IUB A;  1D9F A;  4X4N A;  1J2M A;  4EEN A;  1J97 A;  1T3Q A;  2FI1 A;  5KFA A;  2UVW A;  5CR0 A;  8ICV A;  1TAM A;  1IXR A;  2W3S A;  4RU9 A;  2MU2 A;  3EPI A;  2V9W A;  3F5A A;  5J2H A;  4KLI A;  4RWN A;  5ALJ A;  4IS7 A;  3C23 A;  2DPI A;  4KLH A;  4TQS A;  4EYH B;  1L3U A;  5KFF A;  5III A;  3PZP A;  5KFS A;  3WKA A;  4M9J A;  2KN7 A;  1Q8K A;  4Z6F A;  3TAR A;  5HRG A;  5KT4 A;  2XY6 A;  3MGH A;  4FS1 A;  1NI3 A;  1D9D A;  1HUZ A;  1NO5 A;  2FDR A;  3JPR A;  3H4D A;  1ZQN A;  4RQ6 A;  5J0W A;  4EYI B;  3U26 A;  2LPE A;  4ECQ A;  4DFP A;  5CFT A;  4PH5 A;  1KW4 A;  2KFZ A;  2EAN A;  5HRK A;  4E0D A;  4NXW A;  4TUS A;  4F5P A;  1L7O A;  1X66 A;  5KFN A;  3WFS C;  5B5E U;  3MDC A;  2BQ3 A;  4UAY A;  2ZIX A;  5A0L A;  2HBK A;  4DOB A;  2DUY A;  3RR7 A;  3OVS A;  1SB3 C;  4RT2 A;  1TK0 A;  2ISO A;  4DL5 A;  2ZJ8 A;  4DSK A;  4O68 A;  1TFW A;  4K4H A;  2A1A A;  1Z1B A;  4PGX A;  3F2B A;  3GV5 B;  1RDF A;  4OAI Z;  2Y0S C;  4I2A A;  8ICX A;  3K7D A;  4CF3 A;  2M2T A;  1PVR A;  2F44 A;  4JWM A;  4YD1 A;  4ED8 A;  1YZ6 A;  5KL1 B;  4FS2 A;  5KT2 A;  5B3P A;  1RM6 C;  2NYV A;  2MRL A;  3RJG A;  3RFA A;  9ICT A;  3H8J A;  3N7S C;  4F5Q A;  1UCV A;  3HT3 A;  4WC7 A;  2DKZ A;  2F1I A;  3PW2 A;  3SEN A;  1KQQ A;  4J9N A;  1UPH A;  2NRZ A;  1VDV A;  5ALT A;  1Q79 A;  5HR9 A;  4UB2 A;  4GC7 A;  5HC9 A;  1MIV A;  3LK9 A;  4I2C A;  4YXJ A;  3Q8L A;  4KX3 A;  4CF4 A;  2EQY A;  4KB6 A;  3HRD D;  3V6K A;  1N2X A;  3O0F A;  4M9H A;  2M2V A;  2JHD A;  4JWN A;  3HJ1 A;  5DG9 A;  5AM2 A;  3IRU A;  5L1K A;  1DOQ A;  3QZ8 A;  2KKV A;  4FH5 A;  4J9L A;  9ICP A;  5D62 A;  1U47 A;  4UBC A;  4WC2 A;  2GAF D;  3C18 A;  1HJP A;  4EED A;  5J2K A;  1SZH A;  2VA2 A;  3IG8 A;  3F2D A;  2O5A A;  2JH7 A;  5DBA A;  3H0M B;  1KLN A;  4KLD A;  3RJF A;  1PVQ A;  2H3F A;  4F5O A;  4US9 A;  3NYB A;  1VLB A;  4O0I A;  3Q8M A;  2OWO A;  3KZI U;  4ELV A;  4DL4 A;  3RBD A;  3OVB A;  4CCH A;  2N1R A;  5J2C A;  1NJY A;  5FP0 A;  4ED7 A;  5D61 A;  2BQU A;  4RQ5 A;  3MC1 A;  1CEZ A;  5AK4 A;  3OJU A;  5KFL A;  2M2U A;  4Y2X A;  8ICN A;  5TIS U;  4WC1 A;  3N4M B;  2F8K A;  3TAD C;  1ZQJ A;  4F5R A;  2KZ3 A;  1WWU A;  1XSL A;  3JCF A;  1TV9 A;  3PO5 A;  1AQ6 A;  3TAC B;  4RUC A;  3PMN A;  1L7M A;  2RFF A;  3H8S A;  2ATL A;  1HEK A;  4Y2T A;  5KFH A;  1R8C A;  5KG5 A;  3TAD A;  2IBK A;  2W7O A;  3RRG A;  1XSP A;  1S77 D;  4HAI A;  3UMG A;  2YML A;  5KG1 A;  4G9B A;  3QUQ A;  2WTF A;  1NK7 A;  4AT8 B;  1N61 A;  5DBB A;  2RDJ A;  5CFS A;  5IIK A;  1RYS A;  1MC8 A;  2J6T A;  3T79 A;  4RT3 A;  1QSL A;  3WFP A;  5J2B A;  2ALZ A;  4EGW A;  2M9N A;  8ICM A;  5KFY A;  4KLU A;  4RPX A;  9ICJ A;  1UT5 A;  1DGJ A;  2R8K A;  2OM6 A;  3ICX A;  4NLK A;  1JI7 A;  4C8N A;  2ES6 A;  4B9S A;  4XJE A;  2A1J A;  4YQW A;  5KT5 A;  2H3I A;  5AKZ A;  4HX0 A;  1ZD3 A;  5KT3 A;  2XI9 A;  4IL6 U;  4Y2R A;  1WWV A;  4X4V A;  1BPD A;  5L9X A;  2HVI A;  3IV6 A;  2WF8 A;  2EWR A;  5J2E A;  2XVT A;  3AM9 A;  4GC6 A;  3WKB A;  1ZQU A;  3GFK B;  4O3O A;  2EZZ A;  1ZQK A;  4X0B A;  4QZ9 A;  2W03 A;  3SYZ A;  2RP5 A;  5DED A;  4R8U B;  2KIW A;  1LKY B;  5J0S A;  2BCS A;  2IOF A;  4K97 A;  3UMB A;  2PI4 A;  4ED3 A;  2W9C A;  8ICW A;  8ICE A;  5AKX A;  2BE3 A;  4MEX A;  3ZDE A;  2C2R A;  2DPJ A;  2JEG A;  1V4A A;  4IQU A;  2YMQ A;  7ICR A;  3PSI A;  1ZQH A;  4KLO A;  4EEL A;  3R9K A;  4EEK A;  4MFF A;  1JIH A;  4WH5 A;  3AMZ A;  3CP8 A;  1QH9 A;  4IR9 A;  3F53 A;  2RDI A;  3NS1 A;  5EE3 A;  3THV A;  3MGV A;  1S0V A;  3J81 j;  1L3T A;  3K1Z A;  4OJ5 A;  3MR6 A;  2W9B A;  2HHT A;  4UAU A;  4Q8E A;  2DVI A;  3EW9 A;  2D3D A;  3BS7 A;  2IOH A;  1UQV A;  4B9M A;  3PW5 A;  3MFH A;  2DRA A;  5D46 A;  1F44 A;  1T3N A;  4NM2 A;  3CNH A;  4YXM A;  3SQI A;  3KTQ A;  4UB6 U;  5AIB A;  3SAG A;  3AQE A;  4QZA A;  5AKI A;  3OGU A;  3T3F A;  1CUK A;  3PML A;  3KHG A;  3H8W A;  3AEV A;  2MAX A;  4IR1 A;  4Y2J A;  2F1J A;  2JZB A;  1NK9 A;  4C0Z A;  3AQM A;  2WF6 A;  2JR5 A;  3GIK A;  5IIO A;  3B9J A;  3TAP A;  2F1H A;  5CEH A;  3SV3 A;  3LWL A;  4M0A A;  1KKX A;  1ZD5 A;  1T4G A;  4IRD A;  4CGZ A;  1V9P A;  3MR3 A;  1XC9 A;  4P4M A;  3E0F A;  5ALQ A;  1T94 A;  8ICS A;  2DR8 A;  3KOO A;  4Q8F A;  1N5W A;  5J2A A;  3B0X A;  4X4S A;  3H7I A;  4O67 A;  5ALS A;  4E8F A;  2K89 A;  4AT9 B;  4QWC A;  2ZIW B;  1Q3V A;  5J0P A;  5H2F U;  4M9N A;  1M6Y A;  1SKR A;  4BUG A;  5KG2 A;  5CRX A;  1L3S A;  2MA1 A;  2P6U A;  2H3Z A;  4RQ4 A;  4U6P A;  4M9L A;  2KTQ A;  2UVU A;  2PXI A;  1JRO A;  2BBJ A;  5ALZ A;  1ZQO A;  3RB3 A;  2DR7 A;  1BGX T;  1ZQD A;  1KBU A;  4F50 A;  3SV4 A;  4DQP A;  4CE6 A;  4ECW A;  2A3V A;  3GV7 B;  2DRB A;  1K1S A;  3HJ4 A;  4X4U A;  1DXS A;  3PSP A;  4ECX A;  3BJY A;  8ICO A;  1JXL A;  4Q45 A;  3OVA A;  3OPX A;  2VA3 A;  5EOZ A;  3HKZ C;  1HUO A;  9ICF A;  2BPC A;  3HKZ F;  5DG8 A;  2Y1I A;  2AGP A;  4MKP A;  4ECU A;  5C0Y A;  2M0N A;  5EWE A;  3ZDD A;  4F4W A;  5IIM A;  3HIL A;  4I2H A;  2XY5 A;  4IG8 A;  4O3S A;  9ICC A;  1KNY A;  5TZV A;  2ZXH A;  2QLT A;  4OJP A;  5HMM A;  4ECZ A;  5ALK A;  1U49 A;  3GIM A;  1Z00 A;  3PW0 A;  5DB7 A;  4QWE A;  2KMD A;  1KEJ A;  1ZYQ A;  1VJ7 A;  1MIY A;  3JZ0 A;  2B21 A;  2I1Q A;  4DFD A;  3BQ1 A;  2JXJ A;  4F4K A;  1TAU A;  5GTH U;  3Q8K A;  1ZQM A;  4NXT A;  2B0C A;  4US8 A;  5DB8 A;  2ZIU B;  4QZE A;  1QLN A;  1SL1 A;  4EBD A;  1X9M A;  3F2C A;  2BR0 A;  2XGP A;  2EAP A;  5DQI A;  4XUS A;  4CRX A;  3WFQ E;  4QZF A;  4FHV A;  2CRX A;  3UM9 A;  4B9L A;  1VJ5 A;  2K8B B;  2NRT A;  5ALR A;  4EBC A;  4R65 A;  3WKE A;  1SKW A;  3OWG A;  4Q43 A;  1EXN A;  3Q8S B;  1WCN A;  4J03 A;  4YG2 A;  1MIW A;  2P6R A;  3NKU A;  5JU5 A;  3BZC A;  2NV3 A;  1X42 A;  5BPC A;  4M2Y A;  4K9A A;  1H38 A;  3ORY A;  2F3N A;  2GWS A;  1R89 A;  4F5N A;  4NXV A;  5HRF A;  3ISD A;  1KSP A;  3WK5 A;  4XQ7 A;  3PX6 A;  4XRH A;  3H0R B;  2ODG A;  4FBU A;  5AIC A;  1JQR A;  1JRP A;  2J6U A;  1SV0 A;  3C2K A;  4OO1 J;  4X4Q A;  1OUQ A;  4DQI A;  2IHO A;  4KN7 A;  3PX4 A;  1MA7 A;  5AKE A;  3C2M A;  4EZ9 A;  1COO A;  5J2G A;  2ISP A;  5D4B A;  2I6X A;  4PGY A;  4AYB F;  1WUD A;  4C4T A;  1U45 A;  2YMP A;  3A0H U;  2W3R A;  2K8C B;  1K5O A;  4IRC A;  3KBB A;  2QAR A;  4F92 B;  3AQK A;  2EZX A;  2Y9T A;  4X5V A;  5ALD A;  1PK1 B;  1ZQZ A;  4OAF A;  5DG7 A;  3GDX A;  4I27 A;  2UVV A;  4P4P A;  4M6W B;  3V7L A;  1A76 A;  2KD1 A;  4CF5 A;  7ICI A;  2ZH8 A;  5HR6 A;  3NGD A;  2LYA A;  4YFK A;  4NLZ A;  2IHN A;  4LJX A;  3WK8 A;  1FIQ A;  4UW9 A;  4X4T A;  3MR5 A;  2L5Y A;  1ZQL A;  2ZHB A;  2FLP A;  2HBJ A;  4RQ3 A;  4RQ2 A;  2ASL A;  5EE1 A;  3AUO A;  5JTI A;  4C8K A;  3EWA A;  4DF4 A;  3RAX A;  4C8M A;  2KSO A;  1UT8 A;  4WBZ A;  2B6G A;  3TAQ A;  9ICA A;  2DGZ A;  4F4X A;  4TUR A;  3NWI A;  2Y9U A;  4HYK A;  3H39 A;  4WC6 A;  1IV8 A;  2GH1 A;  3ZD9 A;  5HRL A;  8ICC A;  1ZJM A;  2HCF A;  4OCZ A;  1DGS A;  2CXY A;  1ZQS A;  1DK2 A;  4BWJ A;  2LYH A;  4CNQ A;  4N7R A;  3M1Y A;  3OHA A;  5J0X A;  1TVA A;  3GII A;  3DEE A;  4PHD A;  4BJQ A;  2AH5 A;  1COK A;  2XC9 A;  2BCU A;  7ICP A;  2MUT B;  2K4I A;  2F77 X;  3UMC A;  3HP6 A;  5ALX A;  1LVH A;  3GZF A;  4CDG A;  4BWM A;  1SGG A;  3OJS A;  2HN2 A;  3DV9 A;  3I1Y A;  1LKY A;  3M7D A;  2BDP A;  5CFU A;  3OUY A;  4DQQ A;  3KZX A;  3I28 A;  1KFD A;  1C7Y A;  5KFO A;  4WCW A;  1TE2 A;  3I76 A;  4RQ8 A;  2HHU A;  2KNJ A;  5KT7 A;  4MF8 A;  2NO5 A;  2Y0S F;  2IOF K;  2FMQ A;  4LEY A;  1GO3 F;  2OCE A;  3KHH A;  5JTG A;  3NRZ A;  4KX5 A;  1ZQV A;  4BGD A;  4DFM A;  4KLQ A;  8ICJ A;  4B9T A;  1JN3 A;  5AI5 A;  1YT3 A;  1B43 A;  5KFG A;  1ZQP A;  2FE9 A;  3RF9 A;  4KN4 A;  1X9W A;  4DSI A;  5AI6 A;  2WB1 C;  5HRI A;  1RG6 A;  4K8V A;  2BCQ A;  7ICM A;  1L7N A;  1QCK A;  3T5J A;  5J0O A;  1JXE A;  1WYG A;  4J9M A;  5L1J A;  3KKA A;  3RRH A;  3OHB A;  4EX6 A;  4TUQ A;  5ALN A;  5J0R A;  4RWO A;  3QU2 A;  2Q66 A;  4R64 A;  5KFU A;  1U4B A;  5J0T A;  3UQ0 A;  1XS9 D;  4JV2 A;  3PX0 A;  2ZXI A;  4ED0 A;  4RPZ A;  2O1P A;  4XA5 A;  1UEV A;  2KE7 A;  4QIW C;  1JAJ A;  3S6J A;  4B9V A;  4DLE A;  5KFB A;  4YMM A;  1ZJN A;  4QIW F;  4UB1 A;  2HVH A;  2NRV A;  3RH6 A;  4IQT A;  2DBY A;  5D49 A;  4Y2S A;  3QU4 A;  1J2N A;  3WK9 A;  9ICS A;  2G5I B;  3PO4 A;  5ALV A;  1F0M A;  3HX0 A;  1URJ A;  1NK8 A;  1SKS A;  3AQF A;  4I2B A;  4O5E A;  5KFI A;  2W8L A;  1XU4 A;  1ZRN A;  4F2R A;  3JYY A;  5AIA A;  4F8R A;  3KHR A;  1QQ7 A;  1DRG A;  2Q0Z X;  1N5X A;  4AT9 A;  2HSZ A;  3Q8Q B;  2HOF A;  5KAF U;  2ZTC A;  4QZ8 A;  3ISC A;  2JEF A;  3MAB A;  2YB1 A;  2F2A B;  1SL0 A;  3SI8 A;  4P0P A;  5KFW A;  4G3I A;  5HR7 A;  1NKC A;  3AU2 A;  4DL2 A;  1RPL A;  3V6H A;  2VIX A;  1L7P A;  4UAW A;  1FO4 A;  4X4O A;  2AU0 A;  4UAR A;  3VC8 A;  3WU2 U;  2KJ8 A;  2XO7 A;  3KHL A;  1NJW A;  3FC4 A;  1RYR A;  2JEI A;  3N97 B;  4RUA A;  3NRW A;  5HP4 A;  2E8P A;  8ICT A;  4DL6 A;  1OXJ A;  1KDH A;  4P0Q A;  4XQ8 A;  4EX7 A;  4O5C A;  4QW8 A;  3T5H A;  4KMO B;  1OW5 A;  4DS4 A;  8ICK A;  2E3T A;  4YMO A;  4Z6E A;  4QWA A;  3M9N B;  2ZIV A;  4NLC A;  3AQL A;  2DR5 A;  2DQN B;  3WKC A;  4RNN A;  3D2S A;  2G06 A;  4RWP A;  3TFS A;  4OAG A;  3GQC A;  4O9M A;  4Q44 A;  3HW8 A;  1L3V A;  1QSS A;  4DSE A;  7ICQ A;  1NKE A;  4NKT A;  5EE9 A;  1RQL A;  2O6K A;  2BPG A;  1NOM A;  4WQL A;  2BDU A;  1NZB A;  2DR9 A;  5BOM A;  2ZH5 A;  1RQN A;  4NLN A;  1XSN A;  2FJ6 A;  2RLT A;  4RQN A;  5EWF A;  4Y2P A;  2ZIX B;  3RB6 A;  2QB0 A;  3GV8 B;  2G5H B;  1XNS A;  2GLE A;  2B51 A;  2YTU A;  4NXU A;  3PR5 B;  3LVW A;  9ICX A;  3WFR E;  2LM4 A;  5KG6 A;  2KJ9 A;  4F3O A;  1BPX A;  2V4R A;  2AGO A;  4QNL A;  5CHE A;  3ETL A;  3MGI A;  1N56 A;  5IIJ A;  3JPN A;  5KFV A;  4LEV A;  2LM1 A;  3H38 A;  3RBE A;  4KLT A;  2KVC A;  3C29 A;  2Y1J A;  5AI4 A;  5AKY A;  4ECV A;  1NJX A;  4J9R A;  3D2Q A;  3ZDA A;  4FZM A;  4FHX A;  4J9S A;  4RNM A;  2D8C A;  3D2N A;  7ICO A;  4ECR A;  5ALL A;  1YLQ A;  5J0Y A;  4BXO A;  3ERC C;  5AK5 A;  4UAV A;  5ALO A;  3UXN A;  5IIN A;  2ASD A;  4Z6C A;  1LV5 A;  3RH5 A;  1S76 D;  3H37 A;  4JV1 A;  4OJO A;  4I2I A;  2YN4 A;  8ICQ A;  5J8Y A;  1PZN A;  3HJE A;  4B6J A;  1FA0 A;  9ICG A;  1A0P A;  4ED2 A;  2E1F A;  3NUQ A;  2EAM A;  5C5J A;  4PGQ A;  5DDY A;  2JV3 A;  3IG5 A;  4NLB A;  5DB9 A;  3PVX A;  1TK5 A;  4EEY A;  2OEH A;  3LWM A;  1NJZ A;  2R8I A;  3BDP A;  1ECW A;  5EWG A;  4X4R A;  3M9O B;  2BCR A;  2ZH4 A;  3MFI A;  1S0O A;  2HN1 A;  3TKA A;  3WK6 A;  4I2D A;  3QX7 A;  3MDA A;  1S0M A;  3C21 A;  1ZQB A;  1Q78 A;  4J9O A;  1ED1 A;  2KV2 A;  4BX9 C;  4RQ1 A;  4DFJ A;  5L1L A;  2HHV A;  4ATB A;  1Z1V A;  2XID A;  4UB4 A;  1XO0 A;  1BPB A;  4QZH A;  1QTM A;  1QSY A;  1FFU A;  4NXZ A;  2ASJ A;  7ICF A;  9ICL A;  4NKU A;  4B9N A;  4GXK A;  1K1Q A;  4KLS A;  3D6J A;  4LT6 A;  2F8L A;  3ER9 B;  4FO1 A;  3QXG A;  2W43 A;  5DKW A;  4A8E A;  5HRE A;  1KFT A;  1Z4O A;  4ED6 A;  8ICI A;  4LEW A;  1S10 A;  4F72 A;  2BCV A;  4YMN A;  4NY8 A;  3PSF A;  4DSL A;  4E7X A;  4MFC A;  1X6J A;  1XWL A;  3N28 A;  1ZQE A;  1RYU A;  2DWQ A;  4NL9 C;  2YQE A;  2HHX A;  3C5G A;  4DF8 A;  3NTU A;  4UB8 U;  1F5A A;  7ICH A;  2NRX A;  5KG0 A;  1FEZ A;  2W9M A;  5AM5 A;  3WK7 A;  2LBO A;  1JX4 A;  2KJ5 A;  2ZUB A;  1PVP A;  2BPF A;  4NL9 A;  3PST A;  2ZH7 A;  4KMU A;  2ESE A;  2A1J B;  3ZD8 A;  5F9N A;  1T7P A;  2KKP A;  2K4H A;  1XO1 A;  1B4F A;  2JH1 A;  4C4S A;  3QU7 A;  3E2E A;  4IQV A;  2J6S A;  2KZZ A;  4S3N A;  1ZQC A;  1U9L A;  1NZP A;  5KG4 A;  3BQ2 A;  1WG8 A;  3QU9 A;  4QZG A;  5AM3 A;  2KIC A;  2PFP A;  1R8A A;  2R8G A;  4DLG A;  2VJ5 A;  7ICG A;  1TFR A;  1Z4N A;  1ZQG A;  2GA9 D;  2JGA A;  1S0N A;  4GLX A;  2OYY A;  2FMS A;  4TUP A;  2W9C B;  4WC0 A;  4PHE A;  3UXO A;  1D8B A;  4PZO A;  3WK4 A;  4AT7 B;  4KLJ A;  4X4P A;  2LHT A;  2YMM A;  2W04 A;  3NVY A;  5AI0 A;  5KNI A;  2PMZ C;  2YX8 A;  2W9A A;  9ICK A;  3ER8 C;  4NLG A;  5G5G A;  4GXI A;  1ZET A;  4YVZ A;  4PL1 A;  1N60 A;  4BDP A;  1SV0 C;  5KFM A;  2C22 A;  4GIB A;  3FDS A;  2C2E A;  1RXW A;  2AQ0 A;  3JPQ A;  8ICL A;  2G08 A;  5B3Q A;  2PI5 A;  8ICY A;  5AK3 A;  1S97 A;  2DKX A;  2MSN A;  3CRX A;  3PR4 A;  1ZRM A;  5EE0 A;  1A6S A;  2YY6 A;  5KFT A;  3H8M A;  3AN1 A;  1MSW D;  2FPM A;  2FCL A;  4I0U A;  3L9D A;  5KL8 B;  4F71 A;  2EH9 A;  3V72 A;  1TAQ A;  2PBE A;  3H3A A;  4UQG A;  2B56 A;  2R8J A;  1BNO A;  1O03 A;  1Y88 A;  2IHM A;  2Q4T A;  5DQG A;  4K98 A;  2JZB B;  4WQK A;  3G6Y A;  2W11 A;  3RJJ A;  2E5S A;  1O08 A;  5DGA A;  4UAZ A;  3M8R A;  5ALP A;  1V97 A;  1CI4 A;  5J2I A;  5BOL A;  5AKG A;  1NK5 A;  5AKH A;  4LZG A;  1VFG A;  2EAO A;  3QUC A;  3QEA Z;  4ACO A;  2BHN A;  3ED5 A;  2P66 A;  4IQW A;  2KHQ A;  3L3F X;  9ICI A;  2C28 A;  4AT8 A;  9ICU A;  4WOY A;  4PJ0 U;  5KG3 A;  3H0L B;  5ALE A;  2FLN A;  3NVW A;  3SMV A;  3ETR A;  8ICP A;  2QB1 A;  2H5X A;  4YD2 A;  3MBY A;  1X9X A;  4FHW A;  2XCP A;  4EP7 A;  2LYB A;  3AQN A;  1PUZ A;  1D8L A;  1X6I A;  5AKL A;  8ICA A;  4WC4 A;  4QWD A;  1ZQ1 C;  5CA7 A;  2PKE A;  4DO9 A;  2KOB A;  1ZQI A;  5DQH A;  3BQ0 A;  1SIJ A;  4EBK A;  2C2D A;  3OSN A;  3HPO A;  2VJ4 A;  3SD7 A;  4ECY A;  3RJI A;  5CP2 A;  4LZD A;  5AM0 A;  1L6N A;  1LB2 B;  5ALM A;  8ICZ A;  3G6V A;  4R8U A;  4DS5 A;  2EZY A;  2AXT U;  2OHF A;  3FYH A;  2KG5 A;  5AI9 A;  8ICG A;  3VCB A;  2H3Q A;  1SXD A;  1N63 A;  2W54 A;  2DFL A;  1X40 A;  4WJ3 B;  3PW7 A;  5F2V O;  3B0Y A;  5KFK A;  4NV0 A;  3QZ7 A;  2NO4 A;  1X9S A;  1RXV A;  3V7K A;  3PNC A;  3T5K A;  1Z00 B;  1KN5 A;  4C80 A;  3H40 A;  2WF9 A;  4EBJ A;  4FHP A;  1KFS A;  3TFR A;  4FZL A;  5AKK A;  5KG7 A;  4IRK A;  4JK1 A;  2HHP A;  5DLF A;  3KKA C;  2ZH9 A;  2KZM A;  2ZTD A;  1Z3E B;  3FM9 A;  7ICN A;  2JEJ A;  2WB1 F;  1IM4 A;  4YR2 A;  4NWI A;  3JPT A;  1ZQT A;  1ZQW A;  4ED1 A;  5AHX A;  2JMG A;  1UEU A;  1ZD4 A;  4P4O A;  2W55 A;  4Y2Y A;  1ZQF A;  3PW4 A;  1QQ6 A;  4FFD A;  3QEB Z;  9ICO A;  4PHP A;  1Q3U A;  9ICV A;  1D8Y A;  9ICH A;  1T8E A;  1SL2 A;  4X0A A;  1GPJ A;  1V85 A;  2E8N A;  1Z19 A;  4C8O A;  4WC3 A;  7ICV A;  2FPK A;  1UA0 A;  1SV4 A;  4J9P A;  1TKD A;  5L1I A;  2PFO A;  4RNO A;  5AK6 A;  4PPX A;  3NVZ A;  4TQR A;  1QQ5 A;  3BS5 B;  4DFK A;  2LMR A;  3LYS A;  1ARO P;  2PFN A;  2XY7 A;  5JRT A;  3L4P A;  3GIL A;  2V4Q A;  3EZ5 A;  4MFA A;  5KFC A;  2KEY A;  3LVV A;  4DQR A;  5E79 U;  5J2F A;  4KLM A;  2KIV A;  3IN5 A;  3IHQ B;  1N48 A;  9ICE A;  5G5H A;  1YZ7 A;  2QAR B;  4JB3 A;  2WF7 A;  2ZIW A;  5KFX A;  2D6F C;  4JMU A;  4PHA A;  5DBC A;  3ONN A;  2KVS A;  1WCL A;  1U48 A;  2ZUC A;  3M6K A; 
#chains in the Genus database with same CATH homology
 4EBD A;  1X9M A;  4J9Q A;  4FS1 A;  4I2I A;  1D9D A;  1HUZ A;  2BR0 A;  5HNK A;  2PFQ A;  8ICQ A;  3JPR A;  1NO5 A;  3H4D A;  1ZQN A;  1PZN A;  2XGP A;  1FA0 A;  4RQ6 A;  5J0W A;  5DQI A;  2BKE A;  4XUS A;  4EYI B;  9ICG A;  1NK6 A;  4ED2 A;  2KFN A;  3WFQ E;  4QZF A;  4ECQ A;  5C5J A;  4PGQ A;  4FHV A;  3OV7 A;  4DFP A;  4PH5 A;  5DDY A;  3ISB A;  4B9L A;  2KFZ A;  3ZDC A;  5HRK A;  4E0D A;  2NRT A;  2W8K A;  4R66 A;  4TUS A;  4C8L A;  3PVX A;  5DB9 A;  1TK5 A;  4EBC A;  4R65 A;  4F5P A;  4EEY A;  1SKW A;  4Q43 A;  3LWM A;  1EXN A;  3Q8S B;  5KFN A;  1WCN A;  4UB3 A;  3G6X A;  2R8I A;  5EWG A;  4YG2 A;  1NJZ A;  3BDP A;  3M9O B;  3MDC A;  2BCR A;  2BQ3 A;  1ZQR A;  1MIW A;  4UAY A;  2P6R A;  2ZH4 A;  3MFI A;  4DOB A;  1S0O A;  3RR7 A;  3Q8P B;  3OVS A;  4I2D A;  4YR3 A;  5HRH A;  4RT2 A;  2NRK A;  3MDA A;  5BPC A;  4J9K A;  3QE9 Y;  2AQ4 A;  3C21 A;  1TK0 A;  4UB5 A;  1S0M A;  1ZQB A;  2ISO A;  3PY8 A;  4M2Y A;  1H38 A;  4J9O A;  1Q78 A;  5KFR A;  2ZJ8 A;  3ORY A;  4DL5 A;  4RQ1 A;  2GWS A;  1BPY A;  4DFJ A;  4DSK A;  1R89 A;  1TFW A;  4K4H A;  5L1L A;  4F5N A;  2HHV A;  4PGX A;  4F4Z A;  4ATB A;  4ELT A;  3GV5 B;  5HRF A;  3ISD A;  4UB4 A;  1KSP A;  4I2E A;  1BPB A;  2FPL A;  4QZH A;  4I2A A;  8ICX A;  3PX6 A;  1QTM A;  4XQ7 A;  4DQS A;  4XRH A;  4QWB A;  1QSY A;  4NXZ A;  2ASJ A;  4FBU A;  2M2T A;  7ICF A;  9ICL A;  1JQR A;  4JWM A;  3RJE A;  3UPS A;  4YD1 A;  4ED8 A;  4O3Q A;  2J6U A;  4NKU A;  1WOT A;  3C2K A;  4FS2 A;  4GXK A;  4B9N A;  7ICK A;  5KT2 A;  4X4Q A;  1K1Q A;  4KLS A;  3RJG A;  7ICS A;  4DQI A;  3RTV A;  1X2I A;  2VAN A;  4KN7 A;  4ZH4 A;  3SZ2 A;  4DL3 A;  3C2M A;  3PX4 A;  4EZ9 A;  1COO A;  3H8J A;  5J2G A;  4YCX A;  5J0Q A;  3GIJ A;  9ICT A;  4F5Q A;  3HT3 A;  2ISP A;  5D4B A;  2F1I A;  5DGB A;  3PW2 A;  2IA6 A;  3BQT A;  4EZ6 A;  4PGY A;  3HIY A;  7ICJ A;  4J9N A;  1U45 A;  2NRZ A;  5DKW A;  4IRC A;  1Q79 A;  5HR9 A;  4UB2 A;  4GC7 A;  5HRE A;  1KFT A;  4F92 B;  4ED6 A;  1MIV A;  3AQK A;  5J0U A;  3LK9 A;  4I2C A;  5HC9 A;  4YXJ A;  3Q8L A;  4X5V A;  8ICI A;  1S10 A;  3M8S A;  2BCV A;  3V6K A;  4YMN A;  4M9H A;  4NY8 A;  1ZQZ A;  4O5K A;  4DSL A;  5DG7 A;  3RB0 A;  4E7X A;  3GDX A;  3ZDB A;  4I27 A;  2M2V A;  2UVV A;  4MFC A;  1XWL A;  4P4P A;  4JWN A;  3H37 A;  1ZQE A;  4M6W B;  3V7L A;  5DG9 A;  1A76 A;  3HJ1 A;  4KLG A;  5L1K A;  1DOQ A;  3C66 A;  3RR8 A;  3C5F A;  7ICI A;  1A77 A;  3QZ8 A;  2HHX A;  3OUY B;  3C5G A;  2ZH8 A;  1JMS A;  4DF8 A;  3NTU A;  3NGD A;  4FH5 A;  1BPE A;  1F5A A;  2FLL A;  4J9L A;  4YFK A;  2NRX A;  4NLZ A;  5KG0 A;  1U47 A;  2IHN A;  4UBC A;  2HW3 A;  7ICH A;  9ICP A;  4AT7 A;  4WC2 A;  2HHQ A;  2W9M A;  4X4T A;  3MR5 A;  1JX4 A;  1ZQL A;  3C18 A;  2ZHB A;  2ZH6 A;  1HJP A;  2FLP A;  2ZUB A;  5J2K A;  2BPF A;  4UD4 A;  3K4G A;  4RQ3 A;  5KFP A;  4UBB A;  2VA2 A;  2ZH7 A;  4RQ2 A;  2ASL A;  2O5A A;  3AUO A;  4KMU A;  2A1J B;  2HHS A;  3ZD8 A;  4C8K A;  7ICT A;  5DBA A;  3EWA A;  1KLN A;  4DF4 A;  5F9N A;  3RAX A;  4KIT B;  4KLD A;  1T7P A;  4KLE A;  4C8M A;  3RJF A;  3EYZ A;  1XO1 A;  1UT8 A;  5F9L A;  4F5O A;  4WBZ A;  3NYB A;  5DLG A;  3E2E A;  4KTQ A;  8ICU A;  4O0I A;  4QW9 A;  4IQV A;  3TAQ A;  2J6S A;  3Q8M A;  9ICA A;  2KZZ A;  2OWO A;  4S3N A;  4F4X A;  1ZQC A;  1U9L A;  4ELV A;  4KLL A;  4DL4 A;  3RBD A;  1NZP A;  4WCW A;  3OVB A;  5KG4 A;  4TUR A;  3BQ2 A;  4CCH A;  5J2C A;  2NRW A;  1NJY A;  4QZG A;  4M5D A;  5HRB A;  4ED7 A;  4HYK A;  3H39 A;  1R8B A;  4WC6 A;  2BQU A;  9ICM A;  2PFP A;  4RQ5 A;  3ZD9 A;  1BNP A;  5HRL A;  1CEZ A;  8ICC A;  1ZJM A;  2R8G A;  5J2J A;  4DLG A;  7ICG A;  1R8A A;  9ICB A;  1TFR A;  3OJU A;  7ICE A;  5KFL A;  2M2U A;  1DGS A;  1ZQG A;  5JUM A;  4ELU A;  1S0N A;  4I2J A;  1ZQS A;  4B9U A;  4BWJ A;  8ICN A;  4GLX A;  1DK2 A;  4WC1 A;  3N4M B;  2FMS A;  2LYH A;  2ZTE A;  4TUP A;  2W9C B;  1ZQJ A;  4WC0 A;  4F5R A;  3OHA A;  5J0X A;  4PHE A;  3V6J A;  3UXO A;  1TVA A;  5DDM A;  3PV8 A;  3GII A;  4PHD A;  2KZ3 A;  1XSL A;  1OU5 A;  1TV9 A;  3PO5 A;  3K75 D;  3TQ1 A;  4FH3 A;  4RUC A;  3PMN A;  2XC9 A;  4AT7 B;  4KLJ A;  4X4P A;  2RFF A;  4RPY A;  2BCU A;  3H8S A;  7ICP A;  2ATL A;  1KRP A;  5KFH A;  1R8C A;  2MUT B;  1TFY A;  5KG5 A;  2IBK A;  3RRG A;  4K4G A;  1XSP A;  3HP6 A;  1S77 D;  5HHH A;  3AU6 A;  2W9A A;  5CJ7 A;  9ICK A;  5KG1 A;  4RQ0 A;  4M47 A;  1ZQY A;  4I28 A;  4BWM A;  3OJS A;  4NLG A;  5KFJ A;  4GXI A;  1ZET A;  2WTF A;  1NK7 A;  4YVZ A;  4AT8 B;  4O3R A;  5DBB A;  2RDJ A;  4M6W A;  5IIK A;  4NM1 A;  1RYS A;  2BDP A;  4JV0 A;  1MC8 A;  2AGQ A;  3T5L A;  4RWQ A;  3OUY A;  2J6T A;  4DQQ A;  4BDP A;  4RT3 A;  1QSL A;  3WFP A;  1KFD A;  5J2B A;  2ALZ A;  1C7Y A;  5KFM A;  2M9N A;  2C22 A;  8ICM A;  5HHI A;  4DSF A;  5KFO A;  5KFY A;  4KLU A;  4RPX A;  4RQ8 A;  3RJH A;  4FHY A;  2HHU A;  9ICJ A;  1UT5 A;  3FDS A;  2C2E A;  7ICU A;  5KT7 A;  4MF8 A;  4UD5 A;  2FMQ A;  5J29 A;  1RXW A;  2AQ0 A;  3JPQ A;  2FMP A;  2R8K A;  4NLK A;  8ICL A;  3KHH A;  4C8N A;  3C2L A;  4B9S A;  2A1J A;  2PI5 A;  1ZQV A;  4BGD A;  1KTQ A;  5KT5 A;  4YQW A;  4DFM A;  1S9F A;  1S97 A;  4KLQ A;  4EBE A;  4DOA A;  3C1Y A;  8ICY A;  2M2W A;  5KT3 A;  8ICJ A;  3PR4 A;  4B9T A;  1JN3 A;  4X4V A;  1BPD A;  5L9X A;  2HVI A;  1ZQQ A;  2R8H A;  4QZI A;  5KFT A;  1B43 A;  5KFG A;  5J2E A;  1ZQP A;  2BQR A;  1X9W A;  4KN4 A;  1ZQA A;  2FPM A;  4DSI A;  1MSW D;  1PX5 A;  5HRI A;  9ICW A;  3L9D A;  5IIL A;  3HWT A;  4GC6 A;  1TAQ A;  3V72 A;  4M9G A;  1ZQU A;  2BCQ A;  4I2G A;  7ICM A;  2PBE A;  3GFK B;  3H3A A;  4UQG A;  2R8J A;  4ECS A;  4O3O A;  1SZP A;  1BNO A;  3T5J A;  4O3P A;  5J0O A;  1Y88 A;  4QZD A;  2XCA A;  1JXE A;  1MQ2 A;  1ZQK A;  5DQG A;  2IHM A;  4J9M A;  4X0B A;  4QZ9 A;  5L1J A;  2JZB B;  1BVS A;  3SYZ A;  2ZH2 A;  3RRH A;  5DED A;  4R8U B;  3OHB A;  3G6Y A;  4TUQ A;  3UPQ A;  5J0R A;  4RWO A;  3H4B A;  4WC7 A;  2Q66 A;  5J0S A;  2BCS A;  4R64 A;  3RJJ A;  4E80 A;  5KFU A;  1U4B A;  2PI4 A;  4ED3 A;  5J0T A;  3UQ0 A;  2W9C A;  5DGA A;  2ZJA A;  4UAZ A;  3M8R A;  8ICW A;  8ICE A;  5J2I A;  5BOL A;  2HHW A;  1XS9 D;  2BE3 A;  4JV2 A;  4MEX A;  3ZDE A;  2C2R A;  3PX0 A;  2DPJ A;  2JEG A;  1NK5 A;  1QLN A;  4LZG A;  4ED0 A;  4RPZ A;  2IMW P;  1V4A A;  4XA5 A;  2O1P A;  1VFG A;  4IQU A;  1UEV A;  3WFO A;  4QZB A;  2MUT A;  2ZH3 A;  3QEA Z;  4DSJ A;  1ZQH A;  7ICR A;  1JAJ A;  4B9V A;  4DLE A;  2BHN A;  5KFB A;  4YMM A;  4KLO A;  1ZJN A;  3M9M B;  4UB1 A;  2HVH A;  2P66 A;  4IQW A;  2NRV A;  1BPZ A;  8ICF A;  3RH6 A;  4MFF A;  1JIH A;  4IQT A;  5D49 A;  4WBY A;  4JUZ A;  9ICI A;  3OVA A;  2C28 A;  4AT8 A;  9ICU A;  4F2S A;  4IR9 A;  5KG3 A;  4FO6 A;  5DEC A;  1DK3 A;  2I9G A;  2FLN A;  2RDI A;  5CWR A;  1ZQX A;  9ICS A;  9ICQ A;  1UA1 A;  3TI0 A;  3PO4 A;  8ICP A;  2H5X A;  4LVS A;  4YD2 A;  3HX0 A;  3MBY A;  3THV A;  5KTQ A;  1S0V A;  4FHW A;  2XCP A;  4FBT A;  4EP7 A;  3OSP A;  1NK8 A;  3IM1 A;  1L3T A;  1SKS A;  3AQN A;  4I2B A;  4O5E A;  1D8L A;  3MR6 A;  2W9B A;  1NK0 A;  2HHT A;  5KFI A;  2W8L A;  4Q8E A;  2DVI A;  3EW9 A;  1XU4 A;  8ICA A;  4WC4 A;  4P2H A;  4QWD A;  4F2R A;  4MF2 A;  4B9M A;  5CA7 A;  3PW5 A;  3JYY A;  3MFH A;  2DRA A;  4F8R A;  3KHR A;  5D46 A;  5KT6 A;  4DO9 A;  3EPG A;  1T3N A;  4NM2 A;  1ZQI A;  5DQH A;  4YXM A;  3BQ0 A;  4EBK A;  2C2D A;  3OSN A;  2Q0Z X;  3KTQ A;  4AT9 A;  3HPO A;  3Q8Q B;  1MQ3 A;  1B22 A;  4QZA A;  1SL1 A;  3OGU A;  2ZTC A;  4QZ8 A;  3ISC A;  4ECY A;  3RJI A;  3RAQ A;  2JEF A;  3MAB A;  3T3F A;  1CUK A;  4KLF A;  9ICN A;  3JPO A;  1SL0 A;  3PML A;  3KHG A;  3SI8 A;  3WFS C;  3H8W A;  5KFW A;  4G3I A;  2MAX A;  1NKC A;  2ZUD A;  3AU2 A;  4DL2 A;  3V7J A;  5CP2 A;  1RPL A;  4LZD A;  2F1J A;  3V6H A;  4IR1 A;  5CHG A;  1LB2 B;  4RQ7 A;  5KFE A;  2JZB A;  1NK9 A;  8ICZ A;  3G6V A;  4R8U A;  4DS5 A;  9ICR A;  3AQM A;  3FYH A;  3GIK A;  5IIO A;  8ICR A;  4UAW A;  3TAP A;  4X4O A;  1NK4 A;  2F1H A;  2AU0 A;  4GXJ A;  3RJK A;  8ICG A;  3SV3 A;  3LWL A;  2XO7 A;  4M0A A;  2ZHA A;  4YR0 A;  1T4G A;  4IRD A;  3KHL A;  1NJW A;  1RYR A;  2JEI A;  3N97 B;  1V9P A;  2KP7 A;  3MR3 A;  3JPS A;  2DFL A;  4RUA A;  2W9B B;  4X4R A;  5HP4 A;  3PW7 A;  5F2V O;  1XC9 A;  4DEZ A;  5KFK A;  3B0Y A;  4P4M A;  3QZ7 A;  4DL7 A;  8ICB A;  5KFD A;  1X9S A;  1RXV A;  3V7K A;  3PNC A;  3T5K A;  8ICT A;  1Z00 B;  4DL6 A;  8ICS A;  3H40 A;  1KDH A;  4YP3 A;  4XQ8 A;  4Q8F A;  2DR8 A;  5CB1 A;  4O5C A;  4EBJ A;  2AJQ A;  4QW8 A;  3T5H A;  5J2A A;  2BGW A;  1KFS A;  4FHP A;  4K4I A;  3TFR A;  5KG7 A;  4R63 A;  3MR2 A;  3UQ2 A;  4DS4 A;  3B0X A;  4IRK A;  8ICK A;  4JK1 A;  5HRD A;  4X4S A;  2HHP A;  3H7I A;  5DLF A;  4E8F A;  4LT6 A;  4AT9 B;  5KFZ A;  4QWC A;  2KZM A;  4WC5 A;  2ZTD A;  4BXO B;  1Z3E B;  2ZH9 A;  5J0P A;  4M9N A;  4YMO A;  4Z6E A;  7ICN A;  2JEJ A;  4QWA A;  1SKR A;  3M9N B;  3LQC B;  5KG2 A;  3AQL A;  2DR5 A;  1L3S A;  1IM4 A;  1NKB A;  4YR2 A;  7ICL A;  2P6U A;  2ID1 A;  1RZT A;  4DOC A;  4RNN A;  4RQ4 A;  4I29 A;  3JPT A;  1ZQT A;  1ZQW A;  3Q8R B;  2VA8 A;  4RWP A;  4ED1 A;  3TFS A;  3TAN A;  3GQC A;  4O3N A;  4M9L A;  1UEU A;  4O9M A;  2KTQ A;  4P4O A;  3UXP A;  2UVU A;  2PXI A;  1L5U A;  4Q44 A;  3HW8 A;  1L3V A;  1QSS A;  1ZQF A;  4DSE A;  3PW4 A;  3RH4 A;  4DWI A;  3QEB Z;  7ICQ A;  9ICO A;  4RZR A;  4PHP A;  4MEY A;  9ICV A;  1D8Y A;  1NKE A;  4NKT A;  1ZQO A;  3RB3 A;  4YN4 A;  9ICH A;  1UET A;  1T8E A;  8ICH A;  2DR7 A;  1SL2 A;  2BPG A;  4X0A A;  1NOM A;  1BGX T;  1ZQD A;  4F91 B;  1TK8 A;  3JPP A;  4F50 A;  2DR9 A;  5BOM A;  2ZH1 A;  3SV4 A;  4C8O A;  5J2D A;  2ZH5 A;  4WC3 A;  4NLN A;  7ICV A;  1XSN A;  5EWF A;  4DQP A;  4ECW A;  2FPK A;  3GV7 B;  2DRB A;  1K1S A;  3HJ4 A;  4X4U A;  4ECX A;  3RB6 A;  1UA0 A;  4I2F A;  3GV8 B;  3BJY A;  8ICO A;  1JXL A;  4Q45 A;  5HML A;  4J9P A;  4F4Y A;  4ECT A;  5DB6 A;  5EOZ A;  1TKD A;  2VA3 A;  5KFQ A;  3PR5 B;  5L1I A;  2PFO A;  4RNO A;  9ICX A;  3WFR E;  1HUO A;  9ICF A;  4PPX A;  2BPC A;  3LDA A;  5DG8 A;  5KG6 A;  4TQR A;  2UVR A;  4DFK A;  4F3O A;  4M04 A;  1BPX A;  4ATB B;  2Y1I A;  1ARO P;  2AGP A;  2PFN A;  2XY7 A;  4Z6D A;  4ECU A;  3C1Z A;  4F93 B;  5EWE A;  2V4R A;  2XGQ A;  2AGO A;  4QZC A;  3GIL A;  3ZDD A;  2V4Q A;  3EZ5 A;  4F4W A;  4MFA A;  2ZJ5 A;  5IIM A;  3RB4 A;  1D9F A;  4X4N A;  5KFC A;  5KFA A;  4I2H A;  2XY5 A;  3ETL A;  4IG8 A;  2UVW A;  3MGI A;  4O3S A;  1N56 A;  5IIJ A;  4DQR A;  5TZV A;  9ICC A;  1KNY A;  5HMM A;  4ECZ A;  3JPN A;  5KFV A;  5CR0 A;  5J2F A;  8ICV A;  1U49 A;  3GIM A;  3H38 A;  1IXR A;  3RBE A;  4KLT A;  1Z00 A;  2Y1J A;  5DB7 A;  3PW0 A;  4ECV A;  4KLM A;  1NJX A;  4QWE A;  3IHQ B;  4J9R A;  1KEJ A;  4RU9 A;  3EPI A;  1ZYQ A;  1N48 A;  2V9W A;  3ZDA A;  1VJ7 A;  4FHX A;  5J2H A;  4J9S A;  4RNM A;  4KLI A;  1MIY A;  9ICE A;  3JZ0 A;  4RWN A;  2B21 A;  2I1Q A;  7ICO A;  3C23 A;  3BQ1 A;  4ECR A;  2DPI A;  4F4K A;  1TAU A;  1YLQ A;  4KLH A;  4TQS A;  5J0Y A;  4EYH B;  3Q8K A;  1L3U A;  4BXO A;  5KFX A;  5KFF A;  1ZQM A;  5III A;  3UXN A;  5KFS A;  5IIN A;  4M9J A;  2KN7 A;  2ASD A;  4Z6C A;  4PHA A;  5DBC A;  5DB8 A;  1LV5 A;  3RH5 A;  1WCL A;  4Z6F A;  4QZE A;  3TAR A;  2ZUC A;  1U48 A;  5KT4 A;  2XY6 A;  3MGH A;  1S76 D;  4JV1 A;  5HRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...