5DBCA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dg
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 102
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbcA03
7ICOA 3OHAA 9ICBA 3T3FA 4FHXA 1S0OA 2UVUA 4XQ7A 4NKUA 3V7LA 3OVSA 4F5OA 1S77D 3V6HA 4UQGA 2GWSA 8ICSA 1NK7A 2C28A 1ZQLA 3G6XA 5BPCA 5D4BA 4QWEA 4HYKA 4RNOA 4J9MA 3B0YA 3M9NB 2C2RA 4ELTA 1NK0A 1JN3A 3TAQA 4IRKA 5DKWA 5J2BA 2WTFA 4MFFA 2HVIA 3UPQA 1ZQSA 3JPTA 4YMOA 3JPSA 3PVXA 4B9UA 1R8BA 4DQQA 4FHVA 1ZQIA 1XWLA 5DB6A 4R8UA 4ECUA 2O5AA 2FMQA 1RYRA 8ICEA 2BQ3A 1TK5A 3BQ2A 4C8MA 3JPPA 8ICUA 5DDMA 2FMPA 4O9MA 4NM2A 4IG8A 1L3TA 3MGHA 3MR2A 1ZQGA 2NRZA 4TUQA 3Q8MA 2BGWA 3MFHA 4DFPA 2V4RA 4K4IA 3AQMA 4KLFA 4ED1A 2XY6A 1S76D 3HP6A 1X9MA 9ICFA 4EBJA 5KFIA 3TFSA 4LZGA 4IQVA 4UAWA 7ICHA 2ZH9A 4RQ3A 1TK0A 3KHLA 5HRLA 4KLJA 5J0SA 3H8JA 3C2KA 4QZIA 3PW0A 3Q8QB 5DBCA 5KFGA 1L3VA 2ASJA 3H37A 1NKCA 3H7IA 4PGQA 2DVIA 2DR7A 4YXMA 3WFRE 4ELUA 5J0QA 4QZGA 4O5CA 3HIYA 5KG6A 2JEIA 4I2DA 4ED3A 4AT7A 2RDJA 4Z6CA 1H38A 3IM1A 5IIOA 3T5KA 4Q43A 1TFWA 4PHEA 2M2WA 1KDHA 5D46A 3LQCB 4I2FA 9ICHA 5CR0A 3Q8KA 2M2VA 4F93B 3BQ0A 2IMWP 4WC3A 2XGQA 4J9RA 4DQIA 4ATBA 1ZQFA 4MEYA 5KFXA 2UVVA 3PW4A 5KG1A 2NRKA 4NY8A 3GIIA 1ZQWA 3KTQA 5DGBA 1Y88A 2ISPA 4B9MA 5HREA 8ICVA 5KFFA 3SI8A 8ICJA 1ZQAA 1V4AA 4RPXA 4M6WA 3KHRA 2J6SA 4IR9A 1SZPA 2MUTA 1NZPA 5EWFA 4IR1A 3C21A 3ORYA 4UBBA 4X5VA 1NJXA 1COOA 3JPQA 1SL1A 1B43A 2AQ0A 4M47A 7ICQA 4NLNA 1NO5A 1V9PA 9ICUA 3WFQE 4S3NA 4QZEA 4DS5A 4UD4A 4M9LA 5KG4A 4FBTA 2FMSA 4AT8A 3OVBA 4AT7B 3UXNA 2VANA 5KT3A 2W8KA 3MR6A 2W8LA 4DEZA 3C23A 4X0AA 4WC4A 1ZQXA 9ICAA 2Q66A 4FHPA 4QWAA 3QEBZ 4KLMA 4MF2A 3Q8LA 1ZETA 1U48A 4JV0A 3RH5A 4F4WA 8ICNA 4ATBB 1JXLA 1NK6A 5KFYA 2P66A 2RFFA 3C2MA 4KLGA 4QWDA 4DQPA 4FS2A 4WC0A 4RPZA 7ICLA 2AGPA 3GILA 9ICNA 2HHXA 4DO9A 4F8RA 5KG5A 5DG9A 1Z00A 4DLGA 4DF8A 1ZQCA 4RT3A 5HR9A 2HVHA 1F5AA 3PMLA 5L1LA 4F5QA 1L3SA 4X4NA 3GDXA 4J9SA 5DQHA 2ZTEA 9ICQA 4EP7A 4M9HA 4EBDA 2HHTA 5KT2A 5J2JA 3NGDA 3UQ0A 9ICRA 4KITB 3H8SA 3SV3A 4O3SA 2JEJA 2IBKA 5KFPA 3PX6A 1NK5A 8ICMA 1MIVA 4RWPA 3E2EA 4GXJA 2ZH8A 3IHQB 1C7YA 1Q78A 3OSNA 7ICKA 4X4QA 2HHSA 1T7PA 4RWNA 3BQTA 9ICGA 4RWQA 5DB8A 3ETLA 4DOBA 1ZQKA 3TI0A 3EW9A 2M2TA 3EPIA 1RXVA 5DBBA 4DL4A 4IRCA 1KEJA 3AQLA 4WC7A 2V9WA 2PXIA 3TQ1A 4YP3A 4JWMA 4B9VA 2ZH2A 4O5EA 2R8JA 1Z00B 3N97B 2AGQA 2FLNA 4F2RA 5KG0A 5KG2A 5EOZA 3TAPA 2ZJAA 1ZQDA 2BPCA 1R8AA 4DQRA 8ICOA 3JPOA 1RXWA 4RQ0A 4UB4A 2PI5A 4AT9A 2ZH7A 1DOQA 4NLGA 3LK9A 3HWTA 3RR8A 3TFRA 3MGIA 4PPXA 2ZHBA 3MABA 4KN7A 1NKEA 2HW3A 4FHYA 4J9PA 1SL2A 2AU0A 3NTUA 5JUMA 8ICHA 3PY8A 3MR5A 5HHIA 4KLIA 4ECXA 4ZH4A 3EZ5A 4ED2A 4ED6A 3PW2A 4E7XA 2W9CA 3RJIA 5F9NA 1KFTA 1WCNA 2KN7A 2ZUCA 5KFJA 1RPLA 4RQ4A 1N48A 4O5KA 1PZNA 2DRBA 5DDYA 5DG8A 1ZJNA 4Z6DA 4QWCA 1S10A 2PFPA 1BVSA 3OUYA 2A1JA 4P2HA 4KLLA 5HRHA 5CWRA 4F5NA 1BPYA 4QZHA 1MQ3A 3QEAZ 3OSPA 3BQ1A 3ISBA 5HHHA 3SYZA 3JYYA 1A77A 3H38A 7ICNA 5L9XA 4DL3A 5KFDA 5CHGA 5KTQA 3PO5A 1TFRA 4QZ9A 2ASDA 2XC9A 3MDAA 1K1QA 1RYSA 3AQKA 1XU4A 4F5RA 4ED8A 7ICEA 4ECWA 4YR3A 2V4QA 2BHNA 5KFAA 4FBUA 7ICUA 4JUZA 4BWMA 3N4MB 1JX4A 4DSJA 3JZ0A 2W9CB 4XRHA 3V72A 2ZUBA 4J9LA 8ICFA 4BWJA 4KLDA 5CJ7A 4KLSA 2NRTA 5CP2A 4WC2A 4KN4A 1KTQA 4EBKA 2P6UA 4X4RA 9ICLA 4UB3A 5KFTA 5L1KA 4MFCA 1FA0A 4WC1A 4GXKA 2ZH4A 4DOAA 2ASLA 4ECTA 4R8UB 3EYZA 3HT3A 1NK4A 2BE3A 4GXIA 5DG7A 3RH4A 3OUYB 2ZHAA 1VFGA 4X4VA 4YD2A 3C5FA 2Y1IA 2UVRA 4QZAA 3HX0A 3RB0A 4RNMA 5L1JA 4GLXA 1DK3A 4WC6A 1S0MA 5HRIA 4QW8A 1TV9A 9ICKA 4R64A 3PX4A 4RPYA 1HJPA 3ISCA 5DBAA 1Z3EB 4I2GA 9ICTA 2HHPA 4YD1A 1XO1A 3LDAA 3T5JA 4YMNA 2BR0A 2BKEA 4J9OA 2JEGA 7ICVA 3QZ8A 2W9BA 5BOLA 3PV8A 1X9WA 4BXOA 2ZH6A 4F3OA 4I2EA 1TFYA 4UB5A 3OJUA 2BDPA 1ZQRA 1SKSA 4EYHB 1TVAA 9ICVA 5J0PA 3RJHA 7ICIA 4TQSA 3SZ2A 1BNOA 4TUPA 4X4TA 4UAYA 1WOTA 4F4YA 4IQTA 1N56A 5KFEA 3ZDDA 4EZ6A 2HHVA 4R63A 8ICZA 5DQGA 1ZQEA 8ICCA 2FLPA 4QW9A 3GFKB 3RRHA 1HUZA 4DSEA 4F50A 3GIMA 1AROP 2J6TA 3FYHA 3PW5A 1BPBA 4O3RA 4B9NA 5KFQA 1DK2A 5KFKA 3GIJA 1XS9D 4YMMA 4QZFA 5HRFA 1ZQOA 2KZMA 4UBCA 4DSKA 3AU6A 3OJSA 3ZDCA 4FHWA 1ZQNA 2ISOA 9ICOA 1CEZA 1SL0A 4FH5A 1TAUA 4F4ZA 5HRGA 1KLNA 7ICMA 1KSPA 4M6WB 2W9BB 5DLFA 8ICAA 1UA1A 5KT6A 2MUTB 1KFSA 2C2EA 4MF8A 4F92B 4DQSA 4NM1A 2BCUA 2F1HA 1D9FA 2H5XA 4UAZA 8ICIA 3WFPA 3OV7A 1IXRA 2Q0ZX 3JPRA 3T5HA 2IHNA 2KFNA 8ICBA 4X4OA 4YVZA 2W9MA 3BDPA 4XA5A 4O3PA 2DPIA 3V7KA 3K4GA 2NRWA 4AT8B 1SKWA 1ZQYA 5HNKA 3B0XA 4ECSA 1NJZA 1XSPA 4F4XA 5KT4A 4Z6EA 3BJYA 1RZTA 1LV5A 8ICTA 2IHMA 4WCWA 3PR4A 1TAQA 3MFIA 2XY5A 4PGYA 1JIHA 4PH5A 2ZTDA 5DB7A 4YFKA 1XC9A 4B9SA 4I2CA 3HJ1A 3QZ7A 5J2KA 3RAXA 4O0IA 4QZCA 8ICLA 2UVWA 4ED7A 1MSWD 5DGAA 3M8RA 4Q8EA 3MDCA 4UD5A 1KRPA 4DOCA 2ZUDA 4Q8FA 5HRKA 1BPEA 4K4GA 4X4PA 4YR0A 1D9DA 2B21A 4M9JA 2OWOA 3WFSC 1UETA 5L1IA 1NOMA 2KTQA 4M5DA 3KHHA 3Q8SB 3UXOA 9ICEA 3RJEA 7ICTA 1BNPA 4QZDA 4Z6FA 4YQWA 4I2AA 4TURA 1ZJMA 2BQRA 5KFVA 4E8FA 5J0UA 4DL7A 4UB2A 4RQ5A 1BPDA 4C8NA 3G6YA 5J2HA 3RH6A 3RBEA 2DR8A 2FPLA 1UT8A 1WCLA 3ZD8A 2PI4A 1PX5A 4DSIA 3G6VA 1TK8A 2BCQA 2P6RA 4RUCA 4BGDA 5DQIA 2VA8A 1CUKA 2BCRA 5J2CA 2KZ3A 3C1ZA 1LB2B 2AJQA 1ZQJA 3GIKA 4EYIB 5F2VO 1A76A 3PW7A 1BPZA 4KLQA 1DGSA 2VA2A 3OGUA 5IIJA 9ICSA 4LT6A 3MBYA 1U9LA 4PHPA 3KHGA 3TARA 4NLKA 2ZH3A 1S9FA 3T5LA 1EXNA 2PFNA 4B9TA 3GV8B 4PHDA 2HHWA 1R8CA 4WC5A 1ZQVA 2ZJ8A 5HMLA 4ED0A 4C8KA 3L9DA 4NKTA 3PO4A 7ICPA 5KFOA 3JPNA 2RDIA 2W9AA 2R8GA 5BOMA 2HHUA 9ICPA 2I1QA 4ECYA 3SV4A 5KFRA 4ECZA 1D8LA 4AT9B 5KG3A 2DRAA 8ICRA 3GV7B 5KFHA 4GC7A 5HC9A 4PGXA 3OHBA 4YG2A 4MEXA 1BGXT 3Q8PB 4RNNA 3RTVA 1B22A 1UEVA 4KLOA 1ZQUA 1NJYA 4DSLA 2AGOA 4I2IA 1ZYQA 2DR5A 2DPJA 3K75D 7ICFA 2KFZA 4DFMA 4LVSA 5F9LA 4DL2A 5KFNA 2KP7A 1MIYA 1QLNA 2ZJ5A 4DLEA 4RQ6A 8ICYA 2HHQA 1ZQPA 5CA7A 3PX0A 3ZDBA 4P4OA 1ZQHA 4I2HA 3HJ4A 1S0NA 2KZZA 1T8EA 4JWNA 3ZDEA 1BPXA 2PFOA 3M8SA 2LYHA 5KG7A 1U45A 4DL6A 1TKDA 2A1JB 3H4BA 4EBCA 1QSYA 4F4KA 3ISDA 2AQ4A 1U49A 8ICQA 4ECVA 3H4DA 4F5PA 5J2DA 4RQ7A 8ICKA 4QZBA 4IQWA 1OU5A 1JQRA 3GV5B 4GC6A 3H8WA 3PR5B 3RJKA 4KLTA 5J2FA 1UT5A 2BCVA 1QTMA 5J2EA 3ZDAA 5EWEA 7ICJA 3PMNA 9ICMA 1YLQA 4Q44A 3RBDA 1MC8A 3UXPA 2ZTCA 7ICGA 5KFBA 2ZH1A 4EEYA 4C8OA 4P4PA 1IM4A 4J9NA 1NJWA 4M0AA 5KFMA 4PHAA 5DB9A 2R8IA 5IIMA 1NKBA 1T4GA 4YXJA 4J9QA 1ZQQA 4EZ9A 4LZDA 4C8LA 5DECA 4E0DA 4YR2A 3LWMA 1ZQZA 4KTQA 2O1PA 2XY7A 4WBYA 4DWIA 4M04A 4RWOA 3AQNA 2FLLA 1X2IA 5J2GA 1QSLA 2JEFA 4KLUA 3C66A 3EWAA 3M9OB 2PFQA 4BDPA 4IRDA 4KLHA 3C2LA 9ICIA 4RQ8A 2J6UA 2F1IA 4G3IA 8ICXA 3GQCA 4DL5A 3RJFA 4CCHA 3NYBA 2BCSA 4JV1A 3AUOA 4TQRA 2BPGA 4M9GA 4DS4A 4M9NA 2DR9A 5KFSA 5IIKA 4ECRA 3V7JA 5C5JA 4O3OA 8ICWA 4XQ8A 3OVAA 1MIWA 5KT5A 4FH3A 4X0BA 5KFUA 5KFLA 5KFZA 5J0RA 3LWLA 8ICPA 4JV2A 3RB4A 4BXOB 1MQ2A 3WFOA 7ICSA 1JXEA 5KT7A 3QE9Y 9ICCA 3Q8RB 2Y1JA 1Q79A 4UB1A 1KFDA 1T3NA 3V6JA 4NLZA 4WBZA 4F91B 4P4MA 4RUAA 3TANA 5J29A 8ICGA 4TUSA 5J0WA 1D8YA 2VA3A 9ICWA 5IIIA 1JAJA 5J0XA 3C18A 2DFLA 4XUSA 1U47A 1XSLA 3HW8A 5J0YA 4O3NA 2IA6A 2R8KA 2NRVA 4F2SA 5HP4A 1KNYA 4RQ1A 9ICJA 2JZBA 1S97A 4QWBA 5DLGA 1UEUA 3HPOA 3RB6A 5J2IA 1L5UA 1S0VA 4DFJA 4YN4A 5IINA 4JK1A 4RT2A 4X4UA 1UA0A 3H39A 4FS1A 2C22A 4DSFA 4R66A 2FPMA 4EBEA 9ICXA 4DF4A 3AU2A 3UQ2A 3RR7A 3H40A 4KMUA 2M2UA 4O3QA 2ID1A 4MFAA 3PNCA 3RB3A 2MAXA 1ZQMA 2BPFA 4I2BA 2M9NA 2ALZA 1XSNA 1K1SA 4FO6A 4RQ2A 1ZQBA 1NK9A 2BQUA 5KFWA 4IQUA 2R8HA 2C2DA 4J9KA 1U4BA 4KLEA 1VJ7A 3ZD9A 5D49A 4RZRA 3EPGA 5HMMA 2ZH5A 5EWGA 2F1JA 2XCAA 4I29A 3C1YA 7ICRA 3C5GA 4YCXA 2ATLA 1X9SA 1R89A 1QSSA 3FDSA 5KFCA 2FPKA 2JZBB 5J0OA 5J0TA 3RAQA 1ZQTA 5HRBA 4ECQA 5DEDA 1SKRA 4I2JA 4I27A 2XCPA 1JMSA 5IILA 4RU9A 4R65A 4QZ8A 3THVA 1HUOA 3RJGA 5CB1A 4K4HA 4M2YA 2NRXA 3MR3A 2I9GA 5TZVA 2PBEA 5J2AA 5HRDA 4ELVA 3M9MB 1NK8A 3V6KA 3H3AA 4Q45A 2XGPA 3RRGA 4E80A 2XO7A 4NXZA 3RJJA 4I28A 3UPSA 4DFKA 4X4SA 1L3UA 4B9LA
chains in the Genus database with same CATH superfamily
4FHXA 2G08A 5ALVA 3V7LA 1QH9A 4UQGA 4C4SA 8ICSA 4K97A 4J9MA 3M9NB 3H38A 1NK0A 3TAQA 5AKJA 4IRKA 5J2BA 4B9UA 4YMOA 3JPSA 1Q46A 3S6JA 1ZQIA 2HN2A 2FMQA 1RYRA 5D63A 1TK5A 2F76X 2CPRA 2FMPA 2Y0SC 3WK8A 2V4RA 4ED1A 2XY6A 3HP6A 1X9MA 9ICFA 4EELA 4LZGA 5J0SA 3I76A 4QZIA 5KFGA 1Z19A 1NKCA 3D2SA 5ALMA 4O5CA 1L7OA 3KBBA 3HIYA 5KG6A 2JEIA 2JR5A 4I2DA 1H38A 3CYMA 4Q43A 5ALFA 2M2WA 5ALLA 1SXDA 4CE6A 2WB1F 4F93B 4DQIA 4PL2A 2UVVA 4PL1A 2BBHA 5KG1A 1X9XA 2XI9A 1ZD3A 2DF4B 1IG6A 8ICVA 5KFFA 5JTIA 2J6SA 3ORYA 4O3MA 3NVOA 4NLNA 3WFQE 4S3NA 1N2XA 1PK3A 5KT3A 2VANA 3TADA 9ICAA 4FHPA 4MF2A 3Q8LA 4JV0A 4F4WA 8ICNA 4ATBB 1JXLA 2RFFA 3VCBA 4FS2A 4WC0A 2NYVA 3WK7A 2AGPA 3RFAA 9ICNA 1JRPA 3C29A 5DG9A 5KAFU 4DF8A 4KMOB 1J2MA 5L1LA 4J9SA 2ZTEA 3F53A 4EBDA 4M9HA 3SV3A 3H8SA 2JEJA 2IBKA 5KFPA 2FI1A 8ICMA 2K8CB 4P0QB 3IHQB 3OSNA 2HHSA 3BQTA 3QUQA 5DB8A 3TI0A 2M2TA 3EPIA 1RXVA 5DBBA 4WC7A 2V9WA 5B3QA 2F77X 4NLCA 4F2RA 3SD7A 5KG2A 5EOZA 1ZQDA 2HDOA 1R8AA 3KOOA 3JPOA 3RR8A 2RRDA 1SL2A 2AU0A 3NTUA 5JUMA 1Q3VA 3PY8A 4ECXA 1OUQA 4K99A 4E7XA 4Y2YA 2D6FC 5ALDA 5KFJA 3PSFA 4RQ4A 2DRBA 2AHOB 4O5KA 2OHFA 5DDYA 2PFPA 4QWCA 1BVSA 1JALA 3OUYA 5L1MA 2H3VA 1BPYA 3BS7A 3QEAZ 3BQ1A 3ISBA 5HHHA 2WHEA 3AM9A 1A77A 4DL3A 1SV4A 3O0FA 4QZ9A 4ED8A 3BS5A 2HOQA 4QIWC 5A0LA 2JHDA 3JZ0A 4XRHA 2ZUBA 1X42A 4J9LA 4KLDA 8ICFA 5CJ7A 4KLSA 2VIXA 9ICLA 3WK5A 4DOAA 3CK6A 3HT3A 2HBKA 2YY6A 1GO3F 3HX0A 4K9AA 4RPYA 1HJPA 3ISCA 1PK1A 5B3PA 3T5JA 1XO1A 7ICVA 2HSZA 4YMNA 2JEGA 2BKEA 5BOLA 1LVHA 3NRZA 2ZH6A 4IS7A 4FFDA 4EYHB 4HAIA 2HOIA 3CW2C 1V38A 3PSTA 4X4TA 4UAYA 1N56A 3ZDDA 3GFKB 2BBJA 3H0RB 2G07A 1Z1BA 1DK2A 3GIJA 1XS9D 4YMMA 3ICXA 4UBCA 2LKYA 4DSKA 3CNHA 3OJSA 4FHWA 1CEZA 1TAUA 2AXTU 2HCFA 3E58A 4MF8A 2IOFA 4F92B 4NLBA 4DQSA 4NM1A 1D9FA 2ZIWB 4N7RA 2HBMA 2BDUA 1AQ6A 3K4GA 2NRWA 2BZFA 4ACOA 2XVTA 3BJYA 2IHMA 2B0CA 4PGYA 4PH5A 5DB7A 1XC9A 2QB0B 2QLTA 3QZ7A 1C20A 3HJ1A 4O0IA 1Q8KA 8ICLA 2UVWA 4ED7A 2E5SA 4K4GA 1D9DA 2E8NA 4M9JA 1UETA 2RP5A 1N61A 1NOMA 3Q8SB 9ICEA 1BNPA 1ZJMA 3K1ZA 5J0UA 1T3QA 1BPDA 4C8NA 2NO4A 1WCLA 1PX5A 4DSIA 2VJ4A 1LB2B 1ZQJA 5F2VO 2HBLA 4LT6A 3B9JA 1SIJA 2ZH3A 3T5LA 4B9TA 1R8CA 4WC5A 4PHDA 2ZJ8A 3CP8A 1V97A 3L9DA 4NKTA 3PO4A 2RDIA 2DRAA 5HC9A 3OHBA 1TAMA 3AQEA 4NJ8A 3WKBA 1B22A 1ZQUA 2AGOA 5ALPA 2DPJA 2KFZA 2KKVA 1ZQ1C 4Y2RA 5F9LA 2KP7A 4RQ6A 8ICYA 1T8EA 4G9BA 2QB1A 4JWNA 2PFOA 2LYHA 1QSYA 4EBCA 2AQ4A 1U49A 4F5PA 8ICKA 4KLTA 1DGJA 4Q44A 3RBDA 7ICGA 2KV2A 2ZIVA 2A1AA 1ZXIA 4C8OA 1IM4A 3N7SC 5IIMA 4M9NA 4YXJA 5DECA 2DKZA 4UB8U 4E0DA 4YR2A 2A19A 1ZQZA 4KTQA 4UARA 4WBYA 4DWIA 3MC1A 2FLLA 5J2GA 1QSLA 4KLUA 4DL5A 4CCHA 3NYBA 1HEKA 2BCSA 5ALOA 2DR9A 1KQQA 3V7JA 1MIWA 3ZI4A 1PK1B 5AHXA 3QYPA 1B4FA 1ED1A 4OAGA 8ICPA 1P7DA 1IV8A 1XNSA 7ICSA 1N60A 4UB1A 1T3NA 3V6JA 1WG8A 2HMXA 1ZD2P 4RUAA 3TANA 2K4PA 1RYUA 4K9BA 5IIIA 2DFLA 1U47A 1CI4A 3FC4A 2R8KA 4F2SA 4RQ1A 5HR6A 1S0VA 5IINA 3BZKA 2C22A 5AKHA 3ETRA 1M6YA 3AU2A 3RB3A 2MAXA 1ZQMA 2BPFA 1XSNA 4RQ2A 2YQEA 1U4BA 4KLEA 1VJ7A 2ZH5A 4OO1J 3C5GA 1X9SA 5AKEA 5J0TA 1YZ6A 5G5GA 3PSIA 4ECQA 4I2JA 4R65A 3RJGA 4K96A 1NK8A 1XO0A 3KKAA 2NO5A 2PKEA 9ICBA 2UVUA 2B51A 1S77D 2GWSA 4OD0A 3G6XA 4QWEA 2C2RA 5KL8B 3F5EA 5EE1A 2WTFA 3UPQA 3C28A 4ECUA 4R8UA 2HOFA 2O5AA 8ICEA 2BQ3A 3BQ2A 3GZFA 4C8MA 4Y2TA 4IG8A 1L3TA 1ZQGA 2NRZA 4KLFA 2Z7JA 2ZH9A 4EX7A 5HRLA 1KN5A 3Q8QB 3H37A 2ASJA 5AKLA 4PHEA 1KDHA 1X6JA 4I2FA 9ICHA 5ALNA 3BQ0A 2IMWP 4WC3A 4ATBA 4MEYA 5EE9A 4NY8A 3KTQA 3MCRA 1A0PA 3ED5A 8ICJA 2W55A 4RPXA 3KHRA 3LVWA 4IR9A 3FAHA 4IR1A 5AIAA 3AEVA 3WU2U 1NJXA 1KBUA 1SL1A 5CFTA 1B43A 4M47A 4NL9C 3PZPA 5KG4A 2DQNB 3OVBA 2KG5A 2W8KA 2HI0A 4P0QA 2W8LA 3C23A 2KEYA 1ZQXA 4KX3A 4QWAA 3L3FX 4IC9A 1U48A 1Z1VA 2LM1A 4UASA 4EEDA 5ALJA 3C2MA 5JRTA 3F2DA 4FZNA 2HHXA 4F8RA 5KG5A 5HR9A 5ALSA 4RT3A 4O69A 2HVHA 2G06A 1F5AA 4F5QA 1L3SA 1KKXA 2W03A 3UQ0A 4O3SA 1SV0A 4MHVA 4RWPA 1C7YA 2YB1A 1T7PA 4RWQA 3ETLA 4U6PA 1ZQKA 3WKEA 3ER9B 2Y0SF 4DL4A 3DEEA 3TQ1A 2ZIUA 2ZH2A 4O5EA 5HR7A 5AI5A 2FLNA 3TAPA 2ZJAA 3QUCA 8ICOA 3NWIA 4RQ0A 1DOQA 3QU5A 3LK9A 3HWTA 1LKYB 3MGIA 3AQFA 3MABA 4KN7A 2HW3A 4US9A 3QU7A 4ZH4A 2MA1A 4ED2A 3PW2A 2HBJA 4Y2VA 4LJXA 3HRDD 1NNLA 1ZJNA 5DG8A 1S10A 5ALUA 2A1JA 3R9KA 4QZHA 3HKZF 1MQ3A 3SYZA 3JYYA 2EAPA 7ICNA 2LMRA 5KFDA 4RQNA 5KTQA 4OJLA 2B56A 3AQKA 4ECWA 2V4QA 5KFAA 4FBUA 7ICUA 2AH5A 1JX4A 2W3RA 2Y9UA 1L7NA 4WC2A 2ZH4A 4WC1A 4UB3A 1J2NA 4MFCA 1FA0A 4Y2XA 4GXKA 4ECTA 4R8UB 3RH4A 3RB0A 4RNMA 4FO1A 2ZXHA 5T14A 3NVZA 1Z3EB 2HHPA 2I6XA 4J9OA 3QZ8A 1TFYA 4UB5A 2BDPA 1SKSA 5J0PA 5KNIA 4TQSA 3SZ2A 3HJEA 2ZIWA 4F4YA 4EZ6A 5CFUA 5KFEA 4XJEA 5DQGA 3WKCA 1ZQEA 1HUZA 4CNQA 2J6TA 3FYHA 4O3RA 1BPBA 5KFQA 5AK5A 2KZMA 2QB0A 3AU6A 3ZDCA 3NASA 2ISOA 1SL0A 4FH5A 2CN1A 3H8MA 1KSPA 5DLFA 8ICAA 1UA1A 2OYYA 5KT6A 1KFSA 1X6IA 3QU4A 2BCUA 1YT3A 3NUQA 8ICIA 2Q0ZX 2IHNA 3BDPA 2OH2A 2D3DA 2DPIA 3ONNA 4ECSA 5KT4A 4GFJA 1RZTA 1LV5A 8ICTA 2K89A 1ECWA 1UHUA 3MFIA 1SB3C 2XY5A 2K60A 1JIHA 3SQIA 5TISU 4I2CA 4QZCA 5DGAA 2ZUDA 4Q8FA 4YR0A 2LM4A 4FZMA 3AL0B 2MSNA 3QXGA 5L1IA 2F8KA 4M5DA 5ALZA 1F5SA 4QIWF 4TURA 4OJPA 3OPXA 5KFVA 4UB2A 5E79U 5AKKA 3A0HU 2BCQA 2P6RA 4BGDA 2KK0A 2BCRA 5J2CA 3C1ZA 2FJ6A 4EV6A 4LEWA 2AJQA 4EYIB 1A76A 5AI0A 1BPZA 4WQKA 1DGSA 2VA2A 3OGUA 9ICSA 4NLKA 1U9LA 4PHPA 1FEZA 2ZIUB 4PJ0U 1ZQVA 5HMLA 4C8KA 7ICPA 5KFOA 5BOMA 2HHUA 4RQMA 4QJFB 3SV4A 4ECZA 4GC7A 4YG2A 1D8BA 2JRZA 2FCLA 1FIQA 1UEVA 5AM5A 4LEVA 1NJYA 4DSLA 1NI3A 1ZYQA 5KFNA 1L8OA 1QLNA 2ZJ5A 2EH9A 1ZQPA 2KZZA 3SMVA 4OJ5A 1TKDA 2JH1A 2A1JB 3DDHA 4ECVA 4QZBA 3E0FA 1OU5A 1JQRA 3GV5B 3H8WA 5J2FA 1UT5A 5J2EA 5EWEA 9ICMA 1YLQA 1WWVA 2ZTCA 2ZXIA 2DBYA 5DB9A 1T4GA 4J9QA 2KKPA 2E1FA 2O1PA 1T94A 2XY7A 4M04A 2JEFA 3C66A 2KVSA 3EWAA 3M9OB 4KLHA 4IRDA 9ICIA 3C2LA 5D61A 4RQ8A 4E80A 8ICXA 2K8BB 3RJFA 3QX7A 3PSPA 3AUOA 4DS4A 2GA9D 5C5JA 5KT5A 4FH3A 5J0RA 5CEHA 2B6GA 3NKUA 5AI8A 2HN1A 3AN1A 3WFOA 3QE9Y 2OXOA 3Q8RB 2Y1JA 1Q79A 2K4IA 2CXYA 3SAHA 4TUSA 2VA3A 2RHFA 1XSLA 2IA6A 5J0YA 5HP4A 4QWBA 5DLGA 1UEUA 4Y2PA 3HPOA 1L5UA 4OAFA 2Y9TA 4JK1A 5J8YC 4RT2A 2KICA 4DSFA 2LPEA 2H3IA 2D8CA 4O3QA 5ALKA 4NV0A 1ZQBA 2WF6A 2BQUA 1NK9A 2CRXA 2C2DA 3LVVA 5ALXA 2DGZA 3EPGA 1URJA 4JLXA 4I29A 7ICRA 1R89A 1QSSA 2P35A 2FPKA 1ZQTA 3IV6A 4I27A 2XCPA 5IILA 3THVA 4K4HA 1X40A 4KB6A 1N5XA 2I9GA 2RLTA 5HRDA 3M9MB 3V6KA 4Q45A 3RRGA 3RJJA 5B5EU 3OHAA 3T3FA 4NKUA 3WK4A 2K4HA 4AYBF 1NK7A 1ZQLA 4HYKA 1JN3A 2HVIA 3JPTA 3K7DA 3PVXA 3NVWA 4FHVA 4P0PA 1XWLA 5DB6A 3JPPA 4O68A 5AM3A 4TUQA 1FFUA 2BGWA 2GLEA 1COKA 4K4IA 1S76D 3QU2A 5KFIA 3TFSA 4IQVA 1TK0A 3KHLA 4KLJA 2KVCA 3PW0A 3C2KA 5KL1B 5ALWA 2DVIA 4PGQA 2DR7A 3WFRE 4ELUA 5J0QA 4QZGA 3M6ZA 4WQLA 5GTHU 2F8LA 5IIOA 1TFWA 4C7ZA 2PMZF 3F2BA 2M2VA 3WK9A 4J9RA 2MRLA 1ZQFA 5KFXA 3PW4A 2EQYA 5ALYA 4A8EA 5JU5A 5DGBA 1SXEA 1Y88A 2ISPA 1ZRNA 3BQ7A 4M6WA 2WAQC 1SZPA 1NZPA 5EWFA 3C21A 5C0YA 4UBBA 4X5VA 1S5LU 1GPJA 5ALIA 1COOA 3JPQA 7ICQA 2ODGA 4KX5A 9ICUA 2JV3A 4QZEA 4UD4A 4M9LA 1PVQA 3UXNA 4AT7B 3KZIU 4X0AA 2F2AB 3QEBZ 1ZETA 1WYGA 1ZRMA 5KFYA 4KLGA 4QWDA 4RPZA 7ICLA 1N5WA 3SR6A 1WWUA 1N63A 3PMLA 1WUDA 4PZNA 1LKYA 4EP7A 5KT2A 4KITB 2W54A 1MIVA 3PX6A 1OW5A 3E2EA 1ZOLA 4X4QA 7ICKA 4RWNA 3TKAA 1JI7A 3EW9A 4IRCA 1KEJA 3AQLA 2KNJA 3HILA 2PXIA 4YP3A 4LEYA 2R8JA 1FFVA 1Z00B 3N97B 5KG0A 5KAIU 1RXWA 4UB4A 4AT9A 2ZH7A 2W04A 4WOYA 4FHYA 4J9PA 8ICHA 3EZ5A 3RJIA 1KFTA 3M1YA 2ZUCA 1RPLA 5AM1A 1N48A 4Z6DA 3TACB 4P2HA 5CWRA 3WK6A 3N7PD 3H0MB 3OSPA 5L9XA 4CDGA 2XC9A 4EGWA 1K1QA 1RYSA 3QUTA 2F3NA 4JUZA 2E3TA 4BWMA 3N4MB 2W9CB 3V72A 2NRTA 5CP2A 4X4RA 1MN8A 2P6UA 1Z4OA 4EBKA 4Y2QA 5KFTA 5L1KA 4US8A 4P0PB 3EYZA 2BE3A 5DG7A 2ZHAA 1VFGA 5K4LA 3C5FA 2UVRA 4QZAA 4GLXA 3UMBA 1S0MA 4F72A 3IG8A 2FE9A 5HRIA 1TV9A 4R64A 4DCCA 1N62A 3PX4A 2DKXA 9ICTA 4PZOA 4YD1A 3PV8A 4BXOA 1ZQRA 3RJHA 7ICIA 4USAA 1YZ7A 4R63A 5D62A 4DFDA 8ICCA 2FLPA 3NVYA 4DSEA 3GIMA 1AROP 5G5HA 2GAFD 4B9NA 1UPHA 4C4TA 1L8LA 5ALHA 4F4ZA 5HRGA 1KLNA 7ICMA 5AIBA 4M6WB 3QUBA 2W9BB 5ALTA 2WF9A 2C2EA 3WFPA 2H5XA 3OV7A 3JPRA 3F2CA 8ICBA 4X4OA 3F5AA 3V7KA 4C80A 1SKWA 5HNKA 3B0XA 1NJZA 1XSPA 4Z6EA 2B4VA 4U7CA 3D2NA 3PR4A 2ZTDA 3MDCA 4UD5A 3M7DA 4DOCA 3RF9A 5HRKA 2KOBA 1PVRA 3FM9A 2OWOA 3WFSC 1O03A 4EENA 2KTQA 4NXUA 3KHHA 3UXOA 3RJEA 4YQWA 2BQRA 2YMMA 2DR8A 2KIVA 2FPLA 4AP9A 2PI4A 5ALQA 3G6VA 1TK8A 4FZLA 5DQIA 4RUCA 2EDUA 2KZ3A 4NL9A 1JROA 5AK3A 4OCZA 1VJ5A 2IHOA 4ICAA 2GO7A 3MBYA 3TARA 4C7YA 1F44A 4CGZA 3JPNA 2W9AA 9ICPA 2M0NA 4EEBA 5KFRA 5AI6A 3TADC 5KG3A 4AT9B 1SWVA 2JH7A 4JB3A 3WKAA 2YTUA 2Q4TA 3Q8PB 4I2IA 2DR5A 3K75D 3WKDA 4LVSA 4DL2A 4NXTA 4I2HA 3ZDEA 4DL6A 4F4KA 3ISDA 8ICQA 5J2DA 2GH1A 4RQ7A 2F44A 2LYAA 4CRXA 3RJKA 1QTMA 2XICA 3VC8A 2E1EA 2YN4A 5KFBA 2ZH1A 4EEYA 1NJWA 4J9NA 2MU2A 5KFMA 1ZQQA 1NKBA 4LZDA 2RQ5A 5EE0A 3CRXA 2KE7A 2PFQA 2EAOA 4ZOHC 2F1IA 4G3IA 4JV1A 2BPGA 4TQRA 5KFSA 5IIKA 3HKZC 4O3OA 8ICWA 4NXXA 4XQ8A 3L4PA 1L6NA 1QCKA 3LWLA 5KFLA 4JV2A 3RB4A 4BXOB 4I0UA 4BJQA 1KFDA 3SENA 5AM2A 8ICGA 3OTQA 2WFAA 5J0XA 4UW9A 3C18A 4WH5A 3HW8A 1KNYA 4B6JA 9ICJA 1S97A 4EX6A 3M6KA 3ALRA 4DFJA 4YN4A 2WB1C 3QNMA 4X4UA 3H39A 1SWWA 2KIWA 5AKGA 4FS1A 4EBEA 4DF4A 3DV9A 3RR7A 4KMUA 4MFAA 2DUYA 4NXVA 4I2BA 2M9NA 1K1SA 4UB6U 4FO6A 2A3VA 5KFWA 4F71A 1TE2A 4OAHA 4RZRA 3IN5A 5EWGA 2F1JA 3C1YA 5KFCA 3OVSA 2JZBB 5HRBA 5DEDA 1UQVA 1JMSA 1HUOA 2LHTA 4QZ8A 4M2YA 2NRXA 5AKIA 5TZVA 4UATA 5J2AA 2PBEA 2OM6A 2N1RA 3UM9A 2XO7A 5AM0A 3UPSA 4I28A 3KFUF 7ICOA 1S0OA 4XQ7A 4F5OA 3V6HA 2C28A 5BPCA 5D4BA 4RNOA 4ELTA 3B0YA 4EEKA 4MFFA 5DKWA 1ZQSA 1R8BA 3JCFA 2KHQA 4DQQA 2H3QA 2EWRA 8ICUA 4QNLA 2KHVA 5DDMA 4J03A 2KD1A 4O9MA 2G5HB 4NM2A 3MGHA 3MR2A 2W11A 3Q8MA 3MFHA 4DFPA 3BZCA 3AQMA 1MA7A 2KJ9A 4EBJA 2WF5A 4UAWA 7ICHA 3IP4B 4RQ3A 3H8JA 5DBCA 2IUBA 1PUZA 1L3VA 3H7IA 3L5KA 4YXMA 4Y2UA 1RQNA 4ED3A 4AT7A 2RDJA 1SGGA 4Z6CA 3GU3A 3IM1A 5GTIU 3T5KA 2FDRA 5D46A 3LQCB 1QQ7A 5CR0A 3Q8KA 2YX8A 2XGQA 1F0MA 2NRKA 4WJ3B 3GIIA 3EF2A 1ZQWA 4B9MA 5HREA 3SI8A 1ZQAA 1OXJA 3N7RC 1V4AA 2MUTA 1CRXA 2AQ0A 1NO5A 1V9PA 5AK4A 4DS5A 4FBTA 2E8PA 2DL0A 2FMSA 2W3SA 2ZIXA 3SEIA 1RQLA 4AT8A 1J97A 3MR6A 4DEZA 4WC4A 2Q66A 4KLMA 3RH5A 2JXJA 1NK6A 2P66A 3IDWA 4DQPA 5B66U 5AI9A 3GILA 4DO9A 1VDVA 1Z00A 4DLGA 1ZQCA 4JLZA 4JMUA 4X4NA 3GDXA 5DQHA 3SAFA 9ICQA 2HHTA 5J2JA 3NGDA 9ICRA 1NK5A 1VLBA 1UCVA 4GXJA 2ZH8A 1Q78A 4BUGA 2KJ5A 9ICGA 4C4RA 1K5OA 2EZYA 4DOBA 3IRUA 4JWMA 1FO4A 4B9VA 2H3FA 3ERCC 2AGQA 2BPCA 4DQRA 4MKPA 2PI5A 4NLGA 4K8VA 4OAIZ 3TFRA 5H2FU 4PPXA 2ZHBA 4Y2JA 2VJ5A 1NKEA 3MR5A 1RG6A 5HHIA 4KLIA 2OCEA 1KL9A 1ZD4A 4ED6A 2VKQA 3NS1A 2W9CA 5F9NA 4BX9C 1WCNA 2KN7A 1PZNA 1L7PA 3N28A 1RM6C 4KLLA 5HRHA 4F5NA 3A0BU 2WAQF 3OWGA 4IL6U 5CHGA 5J8YA 3PO5A 1TFRA 2ASDA 3MDAA 1XU4A 4F5RA 7ICEA 4YR3A 2BHNA 2YB4A 1B0XA 4DSJA 2QKQA 5ALEA 4BWJA 4KN4A 1KTQA 2I5HA 2ASLA 3KD3A 1NK4A 5AKXA 4NXWA 4GXIA 3OUYB 2E8OA 4X4VA 2KMDA 4YD2A 2Y1IA 5L1JA 1DK3A 4WC6A 4QW8A 9ICKA 3UMGA 3U26A 5DBAA 1Z4NA 4I2GA 3ER8C 3LDAA 2BR0A 2W9BA 1X9WA 4O6AA 4F3OA 4I2EA 3OJUA 3BS5B 3D6JA 1TVAA 9ICVA 4AYBC 1BNOA 1ZD5A 2JMGA 4TUPA 4KM5A 1WOTA 5CRXA 4IQTA 2HHVA 2QARA 2R18A 3MGVA 8ICZA 4QW9A 3RRHA 3D2QA 3EUB2 2LBOA 4F50A 3PW5A 3KKAC 2KJ8A 5KFKA 4CF4A 4QZFA 5HRFA 2G0AA 1ZQOA 2WF7A 2YMLA 1ZQNA 9ICOA 2NV3A 4GIBA 2MUTB 3J81j 5AKZA 2F1HA 4UAZA 1IXRA 3T5HA 2KFNA 5JTGA 4YVZA 2W9MA 1Q3UA 4XA5A 4O3PA 4HX0A 5AM4A 2ZIXB 4AT8B 1ZQYA 2KSOA 4F4XA 1NZBA 1SZHA 2IOFK 4WCWA 2PMZC 1TAQA 4B9SA 4YFKA 5J2KA 3RAXA 5AI4A 1MSWD 3M8RA 4Q8EA 5CHEA 2EZZA 4FE3A 1KRPA 1IIPA 4X4PA 1BPEA 2B21A 2ESEA 5AK6A 7ICTA 4K98A 4QZDA 4Z6FA 4I2AA 2ZG6A 4E8FA 4DL7A 4RQ5A 3G6YA 5J2HA 3RH6A 3RBEA 1KW4A 1UT8A 3ZD8A 2YMPA 1DXSA 2VA8A 1CUKA 1V85A 2W43A 2G09A 2GOLA 5AKYA 3GIKA 2ES6A 3PW7A 4KLQA 5IIJA 2H3ZA 3KHGA 1S9FA 2PFNA 1EXNA 2HHWA 3GV8B 1A6SA 4ED0A 3T79A 2R8GA 2I1QA 4ECYA 4UAVA 1D8LA 8ICRA 3GV7B 5KFHA 2W7PA 4PGXA 4MEXA 1BGXT 3IG5A 4RNNA 3RTVA 4KLOA 3PHZA 1QQ5A 7ICFA 4DFMA 1MIYA 4DLEA 2HHQA 5CA7A 3PX0A 3ZDBA 4P4OA 1ZQHA 3HJ4A 2LI6A 1S0NA 1BPXA 3SAGA 2E8MA 2EZXA 4CF3A 3M8SA 5KG7A 1U45A 3H4BA 3H4DA 3K1RB 4IQWA 1O08A 1SV0C 4GC6A 3PR5B 2BCVA 1S8OA 3ZDAA 7ICJA 3PMNA 1QQ6A 1MC8A 3UXPA 1JUDA 4C0ZA 2K4EA 4P4PA 4M0AA 2R8IA 4PHAA 4EZ9A 2YMQA 2JGAA 4C8LA 3QU9A 5AICA 3LWMA 4Y2SA 4UAUA 2OEHA 3KZXA 4RWOA 3AQNA 1X2IA 2DWQA 2L5YA 4NWIA 4BDPA 3LYSA 4OJOA 2J6UA 3GQCA 3NVVA 1DRGA 2K8AA 3NRWA 5ALGA 4M9GA 4ECRA 3OVAA 4CF5A 4X0BA 4LEZA 2WF8A 5ALRA 5KFUA 3I1YA 5KFZA 1PVPA 2ZIVB 2W7OA 1MQ2A 1JXEA 5KT7A 2G5IB 9ICCA 5FP0A 4OJ6A 2EANA 3AMZA 4NLZA 4WBZA 4F91B 4P4MA 5J29A 1HIWA 2QARB 5J0WA 1D8YA 9ICWA 1JAJA 4XUSA 4O3NA 1X66A 2NRVA 2JZBA 3RB6A 3UMCA 5J2IA 4O67A 1UA0A 4R66A 2FPMA 9ICXA 3UQ2A 2M2UA 3H40A 2ID1A 3PNCA 2ALZA 2LYBA 1L7MA 4IQUA 2R8HA 4J9KA 3ZD9A 5D49A 5F3XB 5HMMA 2O6KA 2XCAA 2KSOB 4YCXA 2ATLA 2XIDA 3FDSA 5J0OA 1RDFA 3RAQA 3H0LB 1SKRA 5CFSA 4RU9A 5EE3A 5CB1A 3MR3A 3I28A 2EAMA 4ELVA 3H3AA 2XGPA 2IOHA 4NXZA 4DFKA 4X4SA 1L3UA 4B9LA
chains in the Genus database with same CATH topology
7ICOA 3OHAA 9ICBA 3T3FA 4FHXA 1S0OA 2UVUA 4XQ7A 4NKUA 3V7LA 3OVSA 4F5OA 1S77D 3V6HA 4UQGA 2GWSA 8ICSA 1NK7A 2C28A 1ZQLA 3G6XA 5BPCA 5D4BA 4QWEA 4HYKA 4RNOA 4J9MA 3B0YA 3M9NB 2C2RA 4ELTA 1NK0A 1JN3A 3TAQA 4IRKA 5DKWA 5J2BA 2WTFA 4MFFA 2HVIA 3UPQA 1ZQSA 3JPTA 4YMOA 3JPSA 3PVXA 4B9UA 1R8BA 4DQQA 4FHVA 1ZQIA 1XWLA 5DB6A 4R8UA 4ECUA 2O5AA 2FMQA 1RYRA 8ICEA 2BQ3A 1TK5A 3BQ2A 4C8MA 3JPPA 8ICUA 5DDMA 2FMPA 4O9MA 4NM2A 4IG8A 1L3TA 3MGHA 3MR2A 1ZQGA 2NRZA 4TUQA 3Q8MA 2BGWA 3MFHA 4DFPA 2V4RA 4K4IA 3AQMA 4KLFA 4ED1A 2XY6A 1S76D 3HP6A 1X9MA 9ICFA 4EBJA 5KFIA 3TFSA 4LZGA 4IQVA 4UAWA 7ICHA 2ZH9A 4RQ3A 1TK0A 3KHLA 5HRLA 4KLJA 5J0SA 3H8JA 3C2KA 4QZIA 3PW0A 3Q8QB 5DBCA 5KFGA 1L3VA 2ASJA 3H37A 1NKCA 3H7IA 4PGQA 2DVIA 2DR7A 4YXMA 3WFRE 4ELUA 5J0QA 4QZGA 4O5CA 3HIYA 5KG6A 2JEIA 4I2DA 4ED3A 4AT7A 2RDJA 4Z6CA 1H38A 3IM1A 5IIOA 3T5KA 4Q43A 1TFWA 4PHEA 2M2WA 1KDHA 5D46A 3LQCB 4I2FA 9ICHA 5CR0A 3Q8KA 2M2VA 4F93B 3BQ0A 2IMWP 4WC3A 2XGQA 4J9RA 4DQIA 4ATBA 1ZQFA 4MEYA 5KFXA 2UVVA 3PW4A 5KG1A 2NRKA 4NY8A 3GIIA 1ZQWA 3KTQA 5DGBA 1Y88A 2ISPA 4B9MA 5HREA 8ICVA 5KFFA 3SI8A 8ICJA 1ZQAA 1V4AA 4RPXA 4M6WA 3KHRA 2J6SA 4IR9A 1SZPA 2MUTA 1NZPA 5EWFA 4IR1A 3C21A 3ORYA 4UBBA 4X5VA 1NJXA 1COOA 3JPQA 1SL1A 1B43A 2AQ0A 4M47A 7ICQA 4NLNA 1NO5A 1V9PA 9ICUA 3WFQE 4S3NA 4QZEA 4DS5A 4UD4A 4M9LA 5KG4A 4FBTA 2FMSA 4AT8A 3OVBA 4AT7B 3UXNA 2VANA 5KT3A 2W8KA 3MR6A 2W8LA 4DEZA 3C23A 4X0AA 4WC4A 1ZQXA 9ICAA 2Q66A 4FHPA 4QWAA 3QEBZ 4KLMA 4MF2A 3Q8LA 1ZETA 1U48A 4JV0A 3RH5A 4F4WA 8ICNA 4ATBB 1JXLA 1NK6A 5KFYA 2P66A 2RFFA 3C2MA 4KLGA 4QWDA 4DQPA 4FS2A 4WC0A 4RPZA 7ICLA 2AGPA 3GILA 9ICNA 2HHXA 4DO9A 4F8RA 5KG5A 5DG9A 1Z00A 4DLGA 4DF8A 1ZQCA 4RT3A 5HR9A 2HVHA 1F5AA 3PMLA 5L1LA 4F5QA 1L3SA 4X4NA 3GDXA 4J9SA 5DQHA 2ZTEA 9ICQA 4EP7A 4M9HA 4EBDA 2HHTA 5KT2A 5J2JA 3NGDA 3UQ0A 9ICRA 4KITB 3H8SA 3SV3A 4O3SA 2JEJA 2IBKA 5KFPA 3PX6A 1NK5A 8ICMA 1MIVA 4RWPA 3E2EA 4GXJA 2ZH8A 3IHQB 1C7YA 1Q78A 3OSNA 7ICKA 4X4QA 2HHSA 1T7PA 4RWNA 3BQTA 9ICGA 4RWQA 5DB8A 3ETLA 4DOBA 1ZQKA 3TI0A 3EW9A 2M2TA 3EPIA 1RXVA 5DBBA 4DL4A 4IRCA 1KEJA 3AQLA 4WC7A 2V9WA 2PXIA 3TQ1A 4YP3A 4JWMA 4B9VA 2ZH2A 4O5EA 2R8JA 1Z00B 3N97B 2AGQA 2FLNA 4F2RA 5KG0A 5KG2A 5EOZA 3TAPA 2ZJAA 1ZQDA 2BPCA 1R8AA 4DQRA 8ICOA 3JPOA 1RXWA 4RQ0A 4UB4A 2PI5A 4AT9A 2ZH7A 1DOQA 4NLGA 3LK9A 3HWTA 3RR8A 3TFRA 3MGIA 4PPXA 2ZHBA 3MABA 4KN7A 1NKEA 2HW3A 4FHYA 4J9PA 1SL2A 2AU0A 3NTUA 5JUMA 8ICHA 3PY8A 3MR5A 5HHIA 4KLIA 4ECXA 4ZH4A 3EZ5A 4ED2A 4ED6A 3PW2A 4E7XA 2W9CA 3RJIA 5F9NA 1KFTA 1WCNA 2KN7A 2ZUCA 5KFJA 1RPLA 4RQ4A 1N48A 4O5KA 1PZNA 2DRBA 5DDYA 5DG8A 1ZJNA 4Z6DA 4QWCA 1S10A 2PFPA 1BVSA 3OUYA 2A1JA 4P2HA 4KLLA 5HRHA 5CWRA 4F5NA 1BPYA 4QZHA 1MQ3A 3QEAZ 3OSPA 3BQ1A 3ISBA 5HHHA 3SYZA 3JYYA 1A77A 3H38A 7ICNA 5L9XA 4DL3A 5KFDA 5CHGA 5KTQA 3PO5A 1TFRA 4QZ9A 2ASDA 2XC9A 3MDAA 1K1QA 1RYSA 3AQKA 1XU4A 4F5RA 4ED8A 7ICEA 4ECWA 4YR3A 2V4QA 2BHNA 5KFAA 4FBUA 7ICUA 4JUZA 4BWMA 3N4MB 1JX4A 4DSJA 3JZ0A 2W9CB 4XRHA 3V72A 2ZUBA 4J9LA 8ICFA 4BWJA 4KLDA 5CJ7A 4KLSA 2NRTA 5CP2A 4WC2A 4KN4A 1KTQA 4EBKA 2P6UA 4X4RA 9ICLA 4UB3A 5KFTA 5L1KA 4MFCA 1FA0A 4WC1A 4GXKA 2ZH4A 4DOAA 2ASLA 4ECTA 4R8UB 3EYZA 3HT3A 1NK4A 2BE3A 4GXIA 5DG7A 3RH4A 3OUYB 2ZHAA 1VFGA 4X4VA 4YD2A 3C5FA 2Y1IA 2UVRA 4QZAA 3HX0A 3RB0A 4RNMA 5L1JA 4GLXA 1DK3A 4WC6A 1S0MA 5HRIA 4QW8A 1TV9A 9ICKA 4R64A 3PX4A 4RPYA 1HJPA 3ISCA 5DBAA 1Z3EB 4I2GA 9ICTA 2HHPA 4YD1A 1XO1A 3LDAA 3T5JA 4YMNA 2BR0A 2BKEA 4J9OA 2JEGA 7ICVA 3QZ8A 2W9BA 5BOLA 3PV8A 1X9WA 4BXOA 2ZH6A 4F3OA 4I2EA 1TFYA 4UB5A 3OJUA 2BDPA 1ZQRA 1SKSA 4EYHB 1TVAA 9ICVA 5J0PA 3RJHA 7ICIA 4TQSA 3SZ2A 1BNOA 4TUPA 4X4TA 4UAYA 1WOTA 4F4YA 4IQTA 1N56A 5KFEA 3ZDDA 4EZ6A 2HHVA 4R63A 8ICZA 5DQGA 1ZQEA 8ICCA 2FLPA 4QW9A 3GFKB 3RRHA 1HUZA 4DSEA 4F50A 3GIMA 1AROP 2J6TA 3FYHA 3PW5A 1BPBA 4O3RA 4B9NA 5KFQA 1DK2A 5KFKA 3GIJA 1XS9D 4YMMA 4QZFA 5HRFA 1ZQOA 2KZMA 4UBCA 4DSKA 3AU6A 3OJSA 3ZDCA 4FHWA 1ZQNA 2ISOA 9ICOA 1CEZA 1SL0A 4FH5A 1TAUA 4F4ZA 5HRGA 1KLNA 7ICMA 1KSPA 4M6WB 2W9BB 5DLFA 8ICAA 1UA1A 5KT6A 2MUTB 1KFSA 2C2EA 4MF8A 4F92B 4DQSA 4NM1A 2BCUA 2F1HA 1D9FA 2H5XA 4UAZA 8ICIA 3WFPA 3OV7A 1IXRA 2Q0ZX 3JPRA 3T5HA 2IHNA 2KFNA 8ICBA 4X4OA 4YVZA 2W9MA 3BDPA 4XA5A 4O3PA 2DPIA 3V7KA 3K4GA 2NRWA 4AT8B 1SKWA 1ZQYA 5HNKA 3B0XA 4ECSA 1NJZA 1XSPA 4F4XA 5KT4A 4Z6EA 3BJYA 1RZTA 1LV5A 8ICTA 2IHMA 4WCWA 3PR4A 1TAQA 3MFIA 2XY5A 4PGYA 1JIHA 4PH5A 2ZTDA 5DB7A 4YFKA 1XC9A 4B9SA 4I2CA 3HJ1A 3QZ7A 5J2KA 3RAXA 4O0IA 4QZCA 8ICLA 2UVWA 4ED7A 1MSWD 5DGAA 3M8RA 4Q8EA 3MDCA 4UD5A 1KRPA 4DOCA 2ZUDA 4Q8FA 5HRKA 1BPEA 4K4GA 4X4PA 4YR0A 1D9DA 2B21A 4M9JA 2OWOA 3WFSC 1UETA 5L1IA 1NOMA 2KTQA 4M5DA 3KHHA 3Q8SB 3UXOA 9ICEA 3RJEA 7ICTA 1BNPA 4QZDA 4Z6FA 4YQWA 4I2AA 4TURA 1ZJMA 2BQRA 5KFVA 4E8FA 5J0UA 4DL7A 4UB2A 4RQ5A 1BPDA 4C8NA 3G6YA 5J2HA 3RH6A 3RBEA 2DR8A 2FPLA 1UT8A 1WCLA 3ZD8A 2PI4A 1PX5A 4DSIA 3G6VA 1TK8A 2BCQA 2P6RA 4RUCA 4BGDA 5DQIA 2VA8A 1CUKA 2BCRA 5J2CA 2KZ3A 3C1ZA 1LB2B 2AJQA 1ZQJA 3GIKA 4EYIB 5F2VO 1A76A 3PW7A 1BPZA 4KLQA 1DGSA 2VA2A 3OGUA 5IIJA 9ICSA 4LT6A 3MBYA 1U9LA 4PHPA 3KHGA 3TARA 4NLKA 2ZH3A 1S9FA 3T5LA 1EXNA 2PFNA 4B9TA 3GV8B 4PHDA 2HHWA 1R8CA 4WC5A 1ZQVA 2ZJ8A 5HMLA 4ED0A 4C8KA 3L9DA 4NKTA 3PO4A 7ICPA 5KFOA 3JPNA 2RDIA 2W9AA 2R8GA 5BOMA 2HHUA 9ICPA 2I1QA 4ECYA 3SV4A 5KFRA 4ECZA 1D8LA 4AT9B 5KG3A 2DRAA 8ICRA 3GV7B 5KFHA 4GC7A 5HC9A 4PGXA 3OHBA 4YG2A 4MEXA 1BGXT 3Q8PB 4RNNA 3RTVA 1B22A 1UEVA 4KLOA 1ZQUA 1NJYA 4DSLA 2AGOA 4I2IA 1ZYQA 2DR5A 2DPJA 3K75D 7ICFA 2KFZA 4DFMA 4LVSA 5F9LA 4DL2A 5KFNA 2KP7A 1MIYA 1QLNA 2ZJ5A 4DLEA 4RQ6A 8ICYA 2HHQA 1ZQPA 5CA7A 3PX0A 3ZDBA 4P4OA 1ZQHA 4I2HA 3HJ4A 1S0NA 2KZZA 1T8EA 4JWNA 3ZDEA 1BPXA 2PFOA 3M8SA 2LYHA 5KG7A 1U45A 4DL6A 1TKDA 2A1JB 3H4BA 4EBCA 1QSYA 4F4KA 3ISDA 2AQ4A 1U49A 8ICQA 4ECVA 3H4DA 4F5PA 5J2DA 4RQ7A 8ICKA 4QZBA 4IQWA 1OU5A 1JQRA 3GV5B 4GC6A 3H8WA 3PR5B 3RJKA 4KLTA 5J2FA 1UT5A 2BCVA 1QTMA 5J2EA 3ZDAA 5EWEA 7ICJA 3PMNA 9ICMA 1YLQA 4Q44A 3RBDA 1MC8A 3UXPA 2ZTCA 7ICGA 5KFBA 2ZH1A 4EEYA 4C8OA 4P4PA 1IM4A 4J9NA 1NJWA 4M0AA 5KFMA 4PHAA 5DB9A 2R8IA 5IIMA 1NKBA 1T4GA 4YXJA 4J9QA 1ZQQA 4EZ9A 4LZDA 4C8LA 5DECA 4E0DA 4YR2A 3LWMA 1ZQZA 4KTQA 2O1PA 2XY7A 4WBYA 4DWIA 4M04A 4RWOA 3AQNA 2FLLA 1X2IA 5J2GA 1QSLA 2JEFA 4KLUA 3C66A 3EWAA 3M9OB 2PFQA 4BDPA 4IRDA 4KLHA 3C2LA 9ICIA 4RQ8A 2J6UA 2F1IA 4G3IA 8ICXA 3GQCA 4DL5A 3RJFA 4CCHA 3NYBA 2BCSA 4JV1A 3AUOA 4TQRA 2BPGA 4M9GA 4DS4A 4M9NA 2DR9A 5KFSA 5IIKA 4ECRA 3V7JA 5C5JA 4O3OA 8ICWA 4XQ8A 3OVAA 1MIWA 5KT5A 4FH3A 4X0BA 5KFUA 5KFLA 5KFZA 5J0RA 3LWLA 8ICPA 4JV2A 3RB4A 4BXOB 1MQ2A 3WFOA 7ICSA 1JXEA 5KT7A 3QE9Y 9ICCA 3Q8RB 2Y1JA 1Q79A 4UB1A 1KFDA 1T3NA 3V6JA 4NLZA 4WBZA 4F91B 4P4MA 4RUAA 3TANA 5J29A 8ICGA 4TUSA 5J0WA 1D8YA 2VA3A 9ICWA 5IIIA 1JAJA 5J0XA 3C18A 2DFLA 4XUSA 1U47A 1XSLA 3HW8A 5J0YA 4O3NA 2IA6A 2R8KA 2NRVA 4F2SA 5HP4A 1KNYA 4RQ1A 9ICJA 2JZBA 1S97A 4QWBA 5DLGA 1UEUA 3HPOA 3RB6A 5J2IA 1L5UA 1S0VA 4DFJA 4YN4A 5IINA 4JK1A 4RT2A 4X4UA 1UA0A 3H39A 4FS1A 2C22A 4DSFA 4R66A 2FPMA 4EBEA 9ICXA 4DF4A 3AU2A 3UQ2A 3RR7A 3H40A 4KMUA 2M2UA 4O3QA 2ID1A 4MFAA 3PNCA 3RB3A 2MAXA 1ZQMA 2BPFA 4I2BA 2M9NA 2ALZA 1XSNA 1K1SA 4FO6A 4RQ2A 1ZQBA 1NK9A 2BQUA 5KFWA 4IQUA 2R8HA 2C2DA 4J9KA 1U4BA 4KLEA 1VJ7A 3ZD9A 5D49A 4RZRA 3EPGA 5HMMA 2ZH5A 5EWGA 2F1JA 2XCAA 4I29A 3C1YA 7ICRA 3C5GA 4YCXA 2ATLA 1X9SA 1R89A 1QSSA 3FDSA 5KFCA 2FPKA 2JZBB 5J0OA 5J0TA 3RAQA 1ZQTA 5HRBA 4ECQA 5DEDA 1SKRA 4I2JA 4I27A 2XCPA 1JMSA 5IILA 4RU9A 4R65A 4QZ8A 3THVA 1HUOA 3RJGA 5CB1A 4K4HA 4M2YA 2NRXA 3MR3A 2I9GA 5TZVA 2PBEA 5J2AA 5HRDA 4ELVA 3M9MB 1NK8A 3V6KA 3H3AA 4Q45A 2XGPA 3RRGA 4E80A 2XO7A 4NXZA 3RJJA 4I28A 3UPSA 4DFKA 4X4SA 1L3UA 4B9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICO A;  3OHA A;  9ICB A;  3T3F A;  4FHX A;  1S0O A;  2UVU A;  4XQ7 A;  4NKU A;  3V7L A;  3OVS A;  4F5O A;  1S77 D;  3V6H A;  4UQG A;  2GWS A;  8ICS A;  1NK7 A;  2C28 A;  1ZQL A;  3G6X A;  5BPC A;  5D4B A;  4QWE A;  4HYK A;  4RNO A;  4J9M A;  3B0Y A;  3M9N B;  2C2R A;  4ELT A;  1NK0 A;  1JN3 A;  3TAQ A;  4IRK A;  5DKW A;  5J2B A;  2WTF A;  4MFF A;  2HVI A;  3UPQ A;  1ZQS A;  3JPT A;  4YMO A;  3JPS A;  3PVX A;  4B9U A;  1R8B A;  4DQQ A;  4FHV A;  1ZQI A;  1XWL A;  5DB6 A;  4R8U A;  4ECU A;  2O5A A;  2FMQ A;  1RYR A;  8ICE A;  2BQ3 A;  1TK5 A;  3BQ2 A;  4C8M A;  3JPP A;  8ICU A;  5DDM A;  2FMP A;  4O9M A;  4NM2 A;  4IG8 A;  1L3T A;  3MGH A;  3MR2 A;  1ZQG A;  2NRZ A;  4TUQ A;  3Q8M A;  2BGW A;  3MFH A;  4DFP A;  2V4R A;  4K4I A;  3AQM A;  4KLF A;  4ED1 A;  2XY6 A;  1S76 D;  3HP6 A;  1X9M A;  9ICF A;  4EBJ A;  5KFI A;  3TFS A;  4LZG A;  4IQV A;  4UAW A;  7ICH A;  2ZH9 A;  4RQ3 A;  1TK0 A;  3KHL A;  5HRL A;  4KLJ A;  5J0S A;  3H8J A;  3C2K A;  4QZI A;  3PW0 A;  3Q8Q B;  5DBC A;  5KFG A;  1L3V A;  2ASJ A;  3H37 A;  1NKC A;  3H7I A;  4PGQ A;  2DVI A;  2DR7 A;  4YXM A;  3WFR E;  4ELU A;  5J0Q A;  4QZG A;  4O5C A;  3HIY A;  5KG6 A;  2JEI A;  4I2D A;  4ED3 A;  4AT7 A;  2RDJ A;  4Z6C A;  1H38 A;  3IM1 A;  5IIO A;  3T5K A;  4Q43 A;  1TFW A;  4PHE A;  2M2W A;  1KDH A;  5D46 A;  3LQC B;  4I2F A;  9ICH A;  5CR0 A;  3Q8K A;  2M2V A;  4F93 B;  3BQ0 A;  2IMW P;  4WC3 A;  2XGQ A;  4J9R A;  4DQI A;  4ATB A;  1ZQF A;  4MEY A;  5KFX A;  2UVV A;  3PW4 A;  5KG1 A;  2NRK A;  4NY8 A;  3GII A;  1ZQW A;  3KTQ A;  5DGB A;  1Y88 A;  2ISP A;  4B9M A;  5HRE A;  8ICV A;  5KFF A;  3SI8 A;  8ICJ A;  1ZQA A;  1V4A A;  4RPX A;  4M6W A;  3KHR A;  2J6S A;  4IR9 A;  1SZP A;  2MUT A;  1NZP A;  5EWF A;  4IR1 A;  3C21 A;  3ORY A;  4UBB A;  4X5V A;  1NJX A;  1COO A;  3JPQ A;  1SL1 A;  1B43 A;  2AQ0 A;  4M47 A;  7ICQ A;  4NLN A;  1NO5 A;  1V9P A;  9ICU A;  3WFQ E;  4S3N A;  4QZE A;  4DS5 A;  4UD4 A;  4M9L A;  5KG4 A;  4FBT A;  2FMS A;  4AT8 A;  3OVB A;  4AT7 B;  3UXN A;  2VAN A;  5KT3 A;  2W8K A;  3MR6 A;  2W8L A;  4DEZ A;  3C23 A;  4X0A A;  4WC4 A;  1ZQX A;  9ICA A;  2Q66 A;  4FHP A;  4QWA A;  3QEB Z;  4KLM A;  4MF2 A;  3Q8L A;  1ZET A;  1U48 A;  4JV0 A;  3RH5 A;  4F4W A;  8ICN A;  4ATB B;  1JXL A;  1NK6 A;  5KFY A;  2P66 A;  2RFF A;  3C2M A;  4KLG A;  4QWD A;  4DQP A;  4FS2 A;  4WC0 A;  4RPZ A;  7ICL A;  2AGP A;  3GIL A;  9ICN A;  2HHX A;  4DO9 A;  4F8R A;  5KG5 A;  5DG9 A;  1Z00 A;  4DLG A;  4DF8 A;  1ZQC A;  4RT3 A;  5HR9 A;  2HVH A;  1F5A A;  3PML A;  5L1L A;  4F5Q A;  1L3S A;  4X4N A;  3GDX A;  4J9S A;  5DQH A;  2ZTE A;  9ICQ A;  4EP7 A;  4M9H A;  4EBD A;  2HHT A;  5KT2 A;  5J2J A;  3NGD A;  3UQ0 A;  9ICR A;  4KIT B;  3H8S A;  3SV3 A;  4O3S A;  2JEJ A;  2IBK A;  5KFP A;  3PX6 A;  1NK5 A;  8ICM A;  1MIV A;  4RWP A;  3E2E A;  4GXJ A;  2ZH8 A;  3IHQ B;  1C7Y A;  1Q78 A;  3OSN A;  7ICK A;  4X4Q A;  2HHS A;  1T7P A;  4RWN A;  3BQT A;  9ICG A;  4RWQ A;  5DB8 A;  3ETL A;  4DOB A;  1ZQK A;  3TI0 A;  3EW9 A;  2M2T A;  3EPI A;  1RXV A;  5DBB A;  4DL4 A;  4IRC A;  1KEJ A;  3AQL A;  4WC7 A;  2V9W A;  2PXI A;  3TQ1 A;  4YP3 A;  4JWM A;  4B9V A;  2ZH2 A;  4O5E A;  2R8J A;  1Z00 B;  3N97 B;  2AGQ A;  2FLN A;  4F2R A;  5KG0 A;  5KG2 A;  5EOZ A;  3TAP A;  2ZJA A;  1ZQD A;  2BPC A;  1R8A A;  4DQR A;  8ICO A;  3JPO A;  1RXW A;  4RQ0 A;  4UB4 A;  2PI5 A;  4AT9 A;  2ZH7 A;  1DOQ A;  4NLG A;  3LK9 A;  3HWT A;  3RR8 A;  3TFR A;  3MGI A;  4PPX A;  2ZHB A;  3MAB A;  4KN7 A;  1NKE A;  2HW3 A;  4FHY A;  4J9P A;  1SL2 A;  2AU0 A;  3NTU A;  5JUM A;  8ICH A;  3PY8 A;  3MR5 A;  5HHI A;  4KLI A;  4ECX A;  4ZH4 A;  3EZ5 A;  4ED2 A;  4ED6 A;  3PW2 A;  4E7X A;  2W9C A;  3RJI A;  5F9N A;  1KFT A;  1WCN A;  2KN7 A;  2ZUC A;  5KFJ A;  1RPL A;  4RQ4 A;  1N48 A;  4O5K A;  1PZN A;  2DRB A;  5DDY A;  5DG8 A;  1ZJN A;  4Z6D A;  4QWC A;  1S10 A;  2PFP A;  1BVS A;  3OUY A;  2A1J A;  4P2H A;  4KLL A;  5HRH A;  5CWR A;  4F5N A;  1BPY A;  4QZH A;  1MQ3 A;  3QEA Z;  3OSP A;  3BQ1 A;  3ISB A;  5HHH A;  3SYZ A;  3JYY A;  1A77 A;  3H38 A;  7ICN A;  5L9X A;  4DL3 A;  5KFD A;  5CHG A;  5KTQ A;  3PO5 A;  1TFR A;  4QZ9 A;  2ASD A;  2XC9 A;  3MDA A;  1K1Q A;  1RYS A;  3AQK A;  1XU4 A;  4F5R A;  4ED8 A;  7ICE A;  4ECW A;  4YR3 A;  2V4Q A;  2BHN A;  5KFA A;  4FBU A;  7ICU A;  4JUZ A;  4BWM A;  3N4M B;  1JX4 A;  4DSJ A;  3JZ0 A;  2W9C B;  4XRH A;  3V72 A;  2ZUB A;  4J9L A;  8ICF A;  4BWJ A;  4KLD A;  5CJ7 A;  4KLS A;  2NRT A;  5CP2 A;  4WC2 A;  4KN4 A;  1KTQ A;  4EBK A;  2P6U A;  4X4R A;  9ICL A;  4UB3 A;  5KFT A;  5L1K A;  4MFC A;  1FA0 A;  4WC1 A;  4GXK A;  2ZH4 A;  4DOA A;  2ASL A;  4ECT A;  4R8U B;  3EYZ A;  3HT3 A;  1NK4 A;  2BE3 A;  4GXI A;  5DG7 A;  3RH4 A;  3OUY B;  2ZHA A;  1VFG A;  4X4V A;  4YD2 A;  3C5F A;  2Y1I A;  2UVR A;  4QZA A;  3HX0 A;  3RB0 A;  4RNM A;  5L1J A;  4GLX A;  1DK3 A;  4WC6 A;  1S0M A;  5HRI A;  4QW8 A;  1TV9 A;  9ICK A;  4R64 A;  3PX4 A;  4RPY A;  1HJP A;  3ISC A;  5DBA A;  1Z3E B;  4I2G A;  9ICT A;  2HHP A;  4YD1 A;  1XO1 A;  3LDA A;  3T5J A;  4YMN A;  2BR0 A;  2BKE A;  4J9O A;  2JEG A;  7ICV A;  3QZ8 A;  2W9B A;  5BOL A;  3PV8 A;  1X9W A;  4BXO A;  2ZH6 A;  4F3O A;  4I2E A;  1TFY A;  4UB5 A;  3OJU A;  2BDP A;  1ZQR A;  1SKS A;  4EYH B;  1TVA A;  9ICV A;  5J0P A;  3RJH A;  7ICI A;  4TQS A;  3SZ2 A;  1BNO A;  4TUP A;  4X4T A;  4UAY A;  1WOT A;  4F4Y A;  4IQT A;  1N56 A;  5KFE A;  3ZDD A;  4EZ6 A;  2HHV A;  4R63 A;  8ICZ A;  5DQG A;  1ZQE A;  8ICC A;  2FLP A;  4QW9 A;  3GFK B;  3RRH A;  1HUZ A;  4DSE A;  4F50 A;  3GIM A;  1ARO P;  2J6T A;  3FYH A;  3PW5 A;  1BPB A;  4O3R A;  4B9N A;  5KFQ A;  1DK2 A;  5KFK A;  3GIJ A;  1XS9 D;  4YMM A;  4QZF A;  5HRF A;  1ZQO A;  2KZM A;  4UBC A;  4DSK A;  3AU6 A;  3OJS A;  3ZDC A;  4FHW A;  1ZQN A;  2ISO A;  9ICO A;  1CEZ A;  1SL0 A;  4FH5 A;  1TAU A;  4F4Z A;  5HRG A;  1KLN A;  7ICM A;  1KSP A;  4M6W B;  2W9B B;  5DLF A;  8ICA A;  1UA1 A;  5KT6 A;  2MUT B;  1KFS A;  2C2E A;  4MF8 A;  4F92 B;  4DQS A;  4NM1 A;  2BCU A;  2F1H A;  1D9F A;  2H5X A;  4UAZ A;  8ICI A;  3WFP A;  3OV7 A;  1IXR A;  2Q0Z X;  3JPR A;  3T5H A;  2IHN A;  2KFN A;  8ICB A;  4X4O A;  4YVZ A;  2W9M A;  3BDP A;  4XA5 A;  4O3P A;  2DPI A;  3V7K A;  3K4G A;  2NRW A;  4AT8 B;  1SKW A;  1ZQY A;  5HNK A;  3B0X A;  4ECS A;  1NJZ A;  1XSP A;  4F4X A;  5KT4 A;  4Z6E A;  3BJY A;  1RZT A;  1LV5 A;  8ICT A;  2IHM A;  4WCW A;  3PR4 A;  1TAQ A;  3MFI A;  2XY5 A;  4PGY A;  1JIH A;  4PH5 A;  2ZTD A;  5DB7 A;  4YFK A;  1XC9 A;  4B9S A;  4I2C A;  3HJ1 A;  3QZ7 A;  5J2K A;  3RAX A;  4O0I A;  4QZC A;  8ICL A;  2UVW A;  4ED7 A;  1MSW D;  5DGA A;  3M8R A;  4Q8E A;  3MDC A;  4UD5 A;  1KRP A;  4DOC A;  2ZUD A;  4Q8F A;  5HRK A;  1BPE A;  4K4G A;  4X4P A;  4YR0 A;  1D9D A;  2B21 A;  4M9J A;  2OWO A;  3WFS C;  1UET A;  5L1I A;  1NOM A;  2KTQ A;  4M5D A;  3KHH A;  3Q8S B;  3UXO A;  9ICE A;  3RJE A;  7ICT A;  1BNP A;  4QZD A;  4Z6F A;  4YQW A;  4I2A A;  4TUR A;  1ZJM A;  2BQR A;  5KFV A;  4E8F A;  5J0U A;  4DL7 A;  4UB2 A;  4RQ5 A;  1BPD A;  4C8N A;  3G6Y A;  5J2H A;  3RH6 A;  3RBE A;  2DR8 A;  2FPL A;  1UT8 A;  1WCL A;  3ZD8 A;  2PI4 A;  1PX5 A;  4DSI A;  3G6V A;  1TK8 A;  2BCQ A;  2P6R A;  4RUC A;  4BGD A;  5DQI A;  2VA8 A;  1CUK A;  2BCR A;  5J2C A;  2KZ3 A;  3C1Z A;  1LB2 B;  2AJQ A;  1ZQJ A;  3GIK A;  4EYI B;  5F2V O;  1A76 A;  3PW7 A;  1BPZ A;  4KLQ A;  1DGS A;  2VA2 A;  3OGU A;  5IIJ A;  9ICS A;  4LT6 A;  3MBY A;  1U9L A;  4PHP A;  3KHG A;  3TAR A;  4NLK A;  2ZH3 A;  1S9F A;  3T5L A;  1EXN A;  2PFN A;  4B9T A;  3GV8 B;  4PHD A;  2HHW A;  1R8C A;  4WC5 A;  1ZQV A;  2ZJ8 A;  5HML A;  4ED0 A;  4C8K A;  3L9D A;  4NKT A;  3PO4 A;  7ICP A;  5KFO A;  3JPN A;  2RDI A;  2W9A A;  2R8G A;  5BOM A;  2HHU A;  9ICP A;  2I1Q A;  4ECY A;  3SV4 A;  5KFR A;  4ECZ A;  1D8L A;  4AT9 B;  5KG3 A;  2DRA A;  8ICR A;  3GV7 B;  5KFH A;  4GC7 A;  5HC9 A;  4PGX A;  3OHB A;  4YG2 A;  4MEX A;  1BGX T;  3Q8P B;  4RNN A;  3RTV A;  1B22 A;  1UEV A;  4KLO A;  1ZQU A;  1NJY A;  4DSL A;  2AGO A;  4I2I A;  1ZYQ A;  2DR5 A;  2DPJ A;  3K75 D;  7ICF A;  2KFZ A;  4DFM A;  4LVS A;  5F9L A;  4DL2 A;  5KFN A;  2KP7 A;  1MIY A;  1QLN A;  2ZJ5 A;  4DLE A;  4RQ6 A;  8ICY A;  2HHQ A;  1ZQP A;  5CA7 A;  3PX0 A;  3ZDB A;  4P4O A;  1ZQH A;  4I2H A;  3HJ4 A;  1S0N A;  2KZZ A;  1T8E A;  4JWN A;  3ZDE A;  1BPX A;  2PFO A;  3M8S A;  2LYH A;  5KG7 A;  1U45 A;  4DL6 A;  1TKD A;  2A1J B;  3H4B A;  4EBC A;  1QSY A;  4F4K A;  3ISD A;  2AQ4 A;  1U49 A;  8ICQ A;  4ECV A;  3H4D A;  4F5P A;  5J2D A;  4RQ7 A;  8ICK A;  4QZB A;  4IQW A;  1OU5 A;  1JQR A;  3GV5 B;  4GC6 A;  3H8W A;  3PR5 B;  3RJK A;  4KLT A;  5J2F A;  1UT5 A;  2BCV A;  1QTM A;  5J2E A;  3ZDA A;  5EWE A;  7ICJ A;  3PMN A;  9ICM A;  1YLQ A;  4Q44 A;  3RBD A;  1MC8 A;  3UXP A;  2ZTC A;  7ICG A;  5KFB A;  2ZH1 A;  4EEY A;  4C8O A;  4P4P A;  1IM4 A;  4J9N A;  1NJW A;  4M0A A;  5KFM A;  4PHA A;  5DB9 A;  2R8I A;  5IIM A;  1NKB A;  1T4G A;  4YXJ A;  4J9Q A;  1ZQQ A;  4EZ9 A;  4LZD A;  4C8L A;  5DEC A;  4E0D A;  4YR2 A;  3LWM A;  1ZQZ A;  4KTQ A;  2O1P A;  2XY7 A;  4WBY A;  4DWI A;  4M04 A;  4RWO A;  3AQN A;  2FLL A;  1X2I A;  5J2G A;  1QSL A;  2JEF A;  4KLU A;  3C66 A;  3EWA A;  3M9O B;  2PFQ A;  4BDP A;  4IRD A;  4KLH A;  3C2L A;  9ICI A;  4RQ8 A;  2J6U A;  2F1I A;  4G3I A;  8ICX A;  3GQC A;  4DL5 A;  3RJF A;  4CCH A;  3NYB A;  2BCS A;  4JV1 A;  3AUO A;  4TQR A;  2BPG A;  4M9G A;  4DS4 A;  4M9N A;  2DR9 A;  5KFS A;  5IIK A;  4ECR A;  3V7J A;  5C5J A;  4O3O A;  8ICW A;  4XQ8 A;  3OVA A;  1MIW A;  5KT5 A;  4FH3 A;  4X0B A;  5KFU A;  5KFL A;  5KFZ A;  5J0R A;  3LWL A;  8ICP A;  4JV2 A;  3RB4 A;  4BXO B;  1MQ2 A;  3WFO A;  7ICS A;  1JXE A;  5KT7 A;  3QE9 Y;  9ICC A;  3Q8R B;  2Y1J A;  1Q79 A;  4UB1 A;  1KFD A;  1T3N A;  3V6J A;  4NLZ A;  4WBZ A;  4F91 B;  4P4M A;  4RUA A;  3TAN A;  5J29 A;  8ICG A;  4TUS A;  5J0W A;  1D8Y A;  2VA3 A;  9ICW A;  5III A;  1JAJ A;  5J0X A;  3C18 A;  2DFL A;  4XUS A;  1U47 A;  1XSL A;  3HW8 A;  5J0Y A;  4O3N A;  2IA6 A;  2R8K A;  2NRV A;  4F2S A;  5HP4 A;  1KNY A;  4RQ1 A;  9ICJ A;  2JZB A;  1S97 A;  4QWB A;  5DLG A;  1UEU A;  3HPO A;  3RB6 A;  5J2I A;  1L5U A;  1S0V A;  4DFJ A;  4YN4 A;  5IIN A;  4JK1 A;  4RT2 A;  4X4U A;  1UA0 A;  3H39 A;  4FS1 A;  2C22 A;  4DSF A;  4R66 A;  2FPM A;  4EBE A;  9ICX A;  4DF4 A;  3AU2 A;  3UQ2 A;  3RR7 A;  3H40 A;  4KMU A;  2M2U A;  4O3Q A;  2ID1 A;  4MFA A;  3PNC A;  3RB3 A;  2MAX A;  1ZQM A;  2BPF A;  4I2B A;  2M9N A;  2ALZ A;  1XSN A;  1K1S A;  4FO6 A;  4RQ2 A;  1ZQB A;  1NK9 A;  2BQU A;  5KFW A;  4IQU A;  2R8H A;  2C2D A;  4J9K A;  1U4B A;  4KLE A;  1VJ7 A;  3ZD9 A;  5D49 A;  4RZR A;  3EPG A;  5HMM A;  2ZH5 A;  5EWG A;  2F1J A;  2XCA A;  4I29 A;  3C1Y A;  7ICR A;  3C5G A;  4YCX A;  2ATL A;  1X9S A;  1R89 A;  1QSS A;  3FDS A;  5KFC A;  2FPK A;  2JZB B;  5J0O A;  5J0T A;  3RAQ A;  1ZQT A;  5HRB A;  4ECQ A;  5DED A;  1SKR A;  4I2J A;  4I27 A;  2XCP A;  1JMS A;  5IIL A;  4RU9 A;  4R65 A;  4QZ8 A;  3THV A;  1HUO A;  3RJG A;  5CB1 A;  4K4H A;  4M2Y A;  2NRX A;  3MR3 A;  2I9G A;  5TZV A;  2PBE A;  5J2A A;  5HRD A;  4ELV A;  3M9M B;  1NK8 A;  3V6K A;  3H3A A;  4Q45 A;  2XGP A;  3RRG A;  4E80 A;  2XO7 A;  4NXZ A;  3RJJ A;  4I28 A;  3UPS A;  4DFK A;  4X4S A;  1L3U A;  4B9L A; 
#chains in the Genus database with same CATH topology
 4FHX A;  2G08 A;  5ALV A;  3V7L A;  1QH9 A;  4UQG A;  4C4S A;  8ICS A;  4K97 A;  4J9M A;  3M9N B;  3H38 A;  1NK0 A;  3TAQ A;  5AKJ A;  4IRK A;  5J2B A;  4B9U A;  4YMO A;  3JPS A;  1Q46 A;  3S6J A;  1ZQI A;  2HN2 A;  2FMQ A;  1RYR A;  5D63 A;  1TK5 A;  2F76 X;  2CPR A;  2FMP A;  2Y0S C;  3WK8 A;  2V4R A;  4ED1 A;  2XY6 A;  3HP6 A;  1X9M A;  9ICF A;  4EEL A;  4LZG A;  5J0S A;  3I76 A;  4QZI A;  5KFG A;  1Z19 A;  1NKC A;  3D2S A;  5ALM A;  4O5C A;  1L7O A;  3KBB A;  3HIY A;  5KG6 A;  2JEI A;  2JR5 A;  4I2D A;  1H38 A;  3CYM A;  4Q43 A;  5ALF A;  2M2W A;  5ALL A;  1SXD A;  4CE6 A;  2WB1 F;  4F93 B;  4DQI A;  4PL2 A;  2UVV A;  4PL1 A;  2BBH A;  5KG1 A;  1X9X A;  2XI9 A;  1ZD3 A;  2DF4 B;  1IG6 A;  8ICV A;  5KFF A;  5JTI A;  2J6S A;  3ORY A;  4O3M A;  3NVO A;  4NLN A;  3WFQ E;  4S3N A;  1N2X A;  1PK3 A;  5KT3 A;  2VAN A;  3TAD A;  9ICA A;  4FHP A;  4MF2 A;  3Q8L A;  4JV0 A;  4F4W A;  8ICN A;  4ATB B;  1JXL A;  2RFF A;  3VCB A;  4FS2 A;  4WC0 A;  2NYV A;  3WK7 A;  2AGP A;  3RFA A;  9ICN A;  1JRP A;  3C29 A;  5DG9 A;  5KAF U;  4DF8 A;  4KMO B;  1J2M A;  5L1L A;  4J9S A;  2ZTE A;  3F53 A;  4EBD A;  4M9H A;  3SV3 A;  3H8S A;  2JEJ A;  2IBK A;  5KFP A;  2FI1 A;  8ICM A;  2K8C B;  4P0Q B;  3IHQ B;  3OSN A;  2HHS A;  3BQT A;  3QUQ A;  5DB8 A;  3TI0 A;  2M2T A;  3EPI A;  1RXV A;  5DBB A;  4WC7 A;  2V9W A;  5B3Q A;  2F77 X;  4NLC A;  4F2R A;  3SD7 A;  5KG2 A;  5EOZ A;  1ZQD A;  2HDO A;  1R8A A;  3KOO A;  3JPO A;  3RR8 A;  2RRD A;  1SL2 A;  2AU0 A;  3NTU A;  5JUM A;  1Q3V A;  3PY8 A;  4ECX A;  1OUQ A;  4K99 A;  4E7X A;  4Y2Y A;  2D6F C;  5ALD A;  5KFJ A;  3PSF A;  4RQ4 A;  2DRB A;  2AHO B;  4O5K A;  2OHF A;  5DDY A;  2PFP A;  4QWC A;  1BVS A;  1JAL A;  3OUY A;  5L1M A;  2H3V A;  1BPY A;  3BS7 A;  3QEA Z;  3BQ1 A;  3ISB A;  5HHH A;  2WHE A;  3AM9 A;  1A77 A;  4DL3 A;  1SV4 A;  3O0F A;  4QZ9 A;  4ED8 A;  3BS5 A;  2HOQ A;  4QIW C;  5A0L A;  2JHD A;  3JZ0 A;  4XRH A;  2ZUB A;  1X42 A;  4J9L A;  4KLD A;  8ICF A;  5CJ7 A;  4KLS A;  2VIX A;  9ICL A;  3WK5 A;  4DOA A;  3CK6 A;  3HT3 A;  2HBK A;  2YY6 A;  1GO3 F;  3HX0 A;  4K9A A;  4RPY A;  1HJP A;  3ISC A;  1PK1 A;  5B3P A;  3T5J A;  1XO1 A;  7ICV A;  2HSZ A;  4YMN A;  2JEG A;  2BKE A;  5BOL A;  1LVH A;  3NRZ A;  2ZH6 A;  4IS7 A;  4FFD A;  4EYH B;  4HAI A;  2HOI A;  3CW2 C;  1V38 A;  3PST A;  4X4T A;  4UAY A;  1N56 A;  3ZDD A;  3GFK B;  2BBJ A;  3H0R B;  2G07 A;  1Z1B A;  1DK2 A;  3GIJ A;  1XS9 D;  4YMM A;  3ICX A;  4UBC A;  2LKY A;  4DSK A;  3CNH A;  3OJS A;  4FHW A;  1CEZ A;  1TAU A;  2AXT U;  2HCF A;  3E58 A;  4MF8 A;  2IOF A;  4F92 B;  4NLB A;  4DQS A;  4NM1 A;  1D9F A;  2ZIW B;  4N7R A;  2HBM A;  2BDU A;  1AQ6 A;  3K4G A;  2NRW A;  2BZF A;  4ACO A;  2XVT A;  3BJY A;  2IHM A;  2B0C A;  4PGY A;  4PH5 A;  5DB7 A;  1XC9 A;  2QB0 B;  2QLT A;  3QZ7 A;  1C20 A;  3HJ1 A;  4O0I A;  1Q8K A;  8ICL A;  2UVW A;  4ED7 A;  2E5S A;  4K4G A;  1D9D A;  2E8N A;  4M9J A;  1UET A;  2RP5 A;  1N61 A;  1NOM A;  3Q8S B;  9ICE A;  1BNP A;  1ZJM A;  3K1Z A;  5J0U A;  1T3Q A;  1BPD A;  4C8N A;  2NO4 A;  1WCL A;  1PX5 A;  4DSI A;  2VJ4 A;  1LB2 B;  1ZQJ A;  5F2V O;  2HBL A;  4LT6 A;  3B9J A;  1SIJ A;  2ZH3 A;  3T5L A;  4B9T A;  1R8C A;  4WC5 A;  4PHD A;  2ZJ8 A;  3CP8 A;  1V97 A;  3L9D A;  4NKT A;  3PO4 A;  2RDI A;  2DRA A;  5HC9 A;  3OHB A;  1TAM A;  3AQE A;  4NJ8 A;  3WKB A;  1B22 A;  1ZQU A;  2AGO A;  5ALP A;  2DPJ A;  2KFZ A;  2KKV A;  1ZQ1 C;  4Y2R A;  5F9L A;  2KP7 A;  4RQ6 A;  8ICY A;  1T8E A;  4G9B A;  2QB1 A;  4JWN A;  2PFO A;  2LYH A;  1QSY A;  4EBC A;  2AQ4 A;  1U49 A;  4F5P A;  8ICK A;  4KLT A;  1DGJ A;  4Q44 A;  3RBD A;  7ICG A;  2KV2 A;  2ZIV A;  2A1A A;  1ZXI A;  4C8O A;  1IM4 A;  3N7S C;  5IIM A;  4M9N A;  4YXJ A;  5DEC A;  2DKZ A;  4UB8 U;  4E0D A;  4YR2 A;  2A19 A;  1ZQZ A;  4KTQ A;  4UAR A;  4WBY A;  4DWI A;  3MC1 A;  2FLL A;  5J2G A;  1QSL A;  4KLU A;  4DL5 A;  4CCH A;  3NYB A;  1HEK A;  2BCS A;  5ALO A;  2DR9 A;  1KQQ A;  3V7J A;  1MIW A;  3ZI4 A;  1PK1 B;  5AHX A;  3QYP A;  1B4F A;  1ED1 A;  4OAG A;  8ICP A;  1P7D A;  1IV8 A;  1XNS A;  7ICS A;  1N60 A;  4UB1 A;  1T3N A;  3V6J A;  1WG8 A;  2HMX A;  1ZD2 P;  4RUA A;  3TAN A;  2K4P A;  1RYU A;  4K9B A;  5III A;  2DFL A;  1U47 A;  1CI4 A;  3FC4 A;  2R8K A;  4F2S A;  4RQ1 A;  5HR6 A;  1S0V A;  5IIN A;  3BZK A;  2C22 A;  5AKH A;  3ETR A;  1M6Y A;  3AU2 A;  3RB3 A;  2MAX A;  1ZQM A;  2BPF A;  1XSN A;  4RQ2 A;  2YQE A;  1U4B A;  4KLE A;  1VJ7 A;  2ZH5 A;  4OO1 J;  3C5G A;  1X9S A;  5AKE A;  5J0T A;  1YZ6 A;  5G5G A;  3PSI A;  4ECQ A;  4I2J A;  4R65 A;  3RJG A;  4K96 A;  1NK8 A;  1XO0 A;  3KKA A;  2NO5 A;  2PKE A;  9ICB A;  2UVU A;  2B51 A;  1S77 D;  2GWS A;  4OD0 A;  3G6X A;  4QWE A;  2C2R A;  5KL8 B;  3F5E A;  5EE1 A;  2WTF A;  3UPQ A;  3C28 A;  4ECU A;  4R8U A;  2HOF A;  2O5A A;  8ICE A;  2BQ3 A;  3BQ2 A;  3GZF A;  4C8M A;  4Y2T A;  4IG8 A;  1L3T A;  1ZQG A;  2NRZ A;  4KLF A;  2Z7J A;  2ZH9 A;  4EX7 A;  5HRL A;  1KN5 A;  3Q8Q B;  3H37 A;  2ASJ A;  5AKL A;  4PHE A;  1KDH A;  1X6J A;  4I2F A;  9ICH A;  5ALN A;  3BQ0 A;  2IMW P;  4WC3 A;  4ATB A;  4MEY A;  5EE9 A;  4NY8 A;  3KTQ A;  3MCR A;  1A0P A;  3ED5 A;  8ICJ A;  2W55 A;  4RPX A;  3KHR A;  3LVW A;  4IR9 A;  3FAH A;  4IR1 A;  5AIA A;  3AEV A;  3WU2 U;  1NJX A;  1KBU A;  1SL1 A;  5CFT A;  1B43 A;  4M47 A;  4NL9 C;  3PZP A;  5KG4 A;  2DQN B;  3OVB A;  2KG5 A;  2W8K A;  2HI0 A;  4P0Q A;  2W8L A;  3C23 A;  2KEY A;  1ZQX A;  4KX3 A;  4QWA A;  3L3F X;  4IC9 A;  1U48 A;  1Z1V A;  2LM1 A;  4UAS A;  4EED A;  5ALJ A;  3C2M A;  5JRT A;  3F2D A;  4FZN A;  2HHX A;  4F8R A;  5KG5 A;  5HR9 A;  5ALS A;  4RT3 A;  4O69 A;  2HVH A;  2G06 A;  1F5A A;  4F5Q A;  1L3S A;  1KKX A;  2W03 A;  3UQ0 A;  4O3S A;  1SV0 A;  4MHV A;  4RWP A;  1C7Y A;  2YB1 A;  1T7P A;  4RWQ A;  3ETL A;  4U6P A;  1ZQK A;  3WKE A;  3ER9 B;  2Y0S F;  4DL4 A;  3DEE A;  3TQ1 A;  2ZIU A;  2ZH2 A;  4O5E A;  5HR7 A;  5AI5 A;  2FLN A;  3TAP A;  2ZJA A;  3QUC A;  8ICO A;  3NWI A;  4RQ0 A;  1DOQ A;  3QU5 A;  3LK9 A;  3HWT A;  1LKY B;  3MGI A;  3AQF A;  3MAB A;  4KN7 A;  2HW3 A;  4US9 A;  3QU7 A;  4ZH4 A;  2MA1 A;  4ED2 A;  3PW2 A;  2HBJ A;  4Y2V A;  4LJX A;  3HRD D;  1NNL A;  1ZJN A;  5DG8 A;  1S10 A;  5ALU A;  2A1J A;  3R9K A;  4QZH A;  3HKZ F;  1MQ3 A;  3SYZ A;  3JYY A;  2EAP A;  7ICN A;  2LMR A;  5KFD A;  4RQN A;  5KTQ A;  4OJL A;  2B56 A;  3AQK A;  4ECW A;  2V4Q A;  5KFA A;  4FBU A;  7ICU A;  2AH5 A;  1JX4 A;  2W3R A;  2Y9U A;  1L7N A;  4WC2 A;  2ZH4 A;  4WC1 A;  4UB3 A;  1J2N A;  4MFC A;  1FA0 A;  4Y2X A;  4GXK A;  4ECT A;  4R8U B;  3RH4 A;  3RB0 A;  4RNM A;  4FO1 A;  2ZXH A;  5T14 A;  3NVZ A;  1Z3E B;  2HHP A;  2I6X A;  4J9O A;  3QZ8 A;  1TFY A;  4UB5 A;  2BDP A;  1SKS A;  5J0P A;  5KNI A;  4TQS A;  3SZ2 A;  3HJE A;  2ZIW A;  4F4Y A;  4EZ6 A;  5CFU A;  5KFE A;  4XJE A;  5DQG A;  3WKC A;  1ZQE A;  1HUZ A;  4CNQ A;  2J6T A;  3FYH A;  4O3R A;  1BPB A;  5KFQ A;  5AK5 A;  2KZM A;  2QB0 A;  3AU6 A;  3ZDC A;  3NAS A;  2ISO A;  1SL0 A;  4FH5 A;  2CN1 A;  3H8M A;  1KSP A;  5DLF A;  8ICA A;  1UA1 A;  2OYY A;  5KT6 A;  1KFS A;  1X6I A;  3QU4 A;  2BCU A;  1YT3 A;  3NUQ A;  8ICI A;  2Q0Z X;  2IHN A;  3BDP A;  2OH2 A;  2D3D A;  2DPI A;  3ONN A;  4ECS A;  5KT4 A;  4GFJ A;  1RZT A;  1LV5 A;  8ICT A;  2K89 A;  1ECW A;  1UHU A;  3MFI A;  1SB3 C;  2XY5 A;  2K60 A;  1JIH A;  3SQI A;  5TIS U;  4I2C A;  4QZC A;  5DGA A;  2ZUD A;  4Q8F A;  4YR0 A;  2LM4 A;  4FZM A;  3AL0 B;  2MSN A;  3QXG A;  5L1I A;  2F8K A;  4M5D A;  5ALZ A;  1F5S A;  4QIW F;  4TUR A;  4OJP A;  3OPX A;  5KFV A;  4UB2 A;  5E79 U;  5AKK A;  3A0H U;  2BCQ A;  2P6R A;  4BGD A;  2KK0 A;  2BCR A;  5J2C A;  3C1Z A;  2FJ6 A;  4EV6 A;  4LEW A;  2AJQ A;  4EYI B;  1A76 A;  5AI0 A;  1BPZ A;  4WQK A;  1DGS A;  2VA2 A;  3OGU A;  9ICS A;  4NLK A;  1U9L A;  4PHP A;  1FEZ A;  2ZIU B;  4PJ0 U;  1ZQV A;  5HML A;  4C8K A;  7ICP A;  5KFO A;  5BOM A;  2HHU A;  4RQM A;  4QJF B;  3SV4 A;  4ECZ A;  4GC7 A;  4YG2 A;  1D8B A;  2JRZ A;  2FCL A;  1FIQ A;  1UEV A;  5AM5 A;  4LEV A;  1NJY A;  4DSL A;  1NI3 A;  1ZYQ A;  5KFN A;  1L8O A;  1QLN A;  2ZJ5 A;  2EH9 A;  1ZQP A;  2KZZ A;  3SMV A;  4OJ5 A;  1TKD A;  2JH1 A;  2A1J B;  3DDH A;  4ECV A;  4QZB A;  3E0F A;  1OU5 A;  1JQR A;  3GV5 B;  3H8W A;  5J2F A;  1UT5 A;  5J2E A;  5EWE A;  9ICM A;  1YLQ A;  1WWV A;  2ZTC A;  2ZXI A;  2DBY A;  5DB9 A;  1T4G A;  4J9Q A;  2KKP A;  2E1F A;  2O1P A;  1T94 A;  2XY7 A;  4M04 A;  2JEF A;  3C66 A;  2KVS A;  3EWA A;  3M9O B;  4KLH A;  4IRD A;  9ICI A;  3C2L A;  5D61 A;  4RQ8 A;  4E80 A;  8ICX A;  2K8B B;  3RJF A;  3QX7 A;  3PSP A;  3AUO A;  4DS4 A;  2GA9 D;  5C5J A;  5KT5 A;  4FH3 A;  5J0R A;  5CEH A;  2B6G A;  3NKU A;  5AI8 A;  2HN1 A;  3AN1 A;  3WFO A;  3QE9 Y;  2OXO A;  3Q8R B;  2Y1J A;  1Q79 A;  2K4I A;  2CXY A;  3SAH A;  4TUS A;  2VA3 A;  2RHF A;  1XSL A;  2IA6 A;  5J0Y A;  5HP4 A;  4QWB A;  5DLG A;  1UEU A;  4Y2P A;  3HPO A;  1L5U A;  4OAF A;  2Y9T A;  4JK1 A;  5J8Y C;  4RT2 A;  2KIC A;  4DSF A;  2LPE A;  2H3I A;  2D8C A;  4O3Q A;  5ALK A;  4NV0 A;  1ZQB A;  2WF6 A;  2BQU A;  1NK9 A;  2CRX A;  2C2D A;  3LVV A;  5ALX A;  2DGZ A;  3EPG A;  1URJ A;  4JLX A;  4I29 A;  7ICR A;  1R89 A;  1QSS A;  2P35 A;  2FPK A;  1ZQT A;  3IV6 A;  4I27 A;  2XCP A;  5IIL A;  3THV A;  4K4H A;  1X40 A;  4KB6 A;  1N5X A;  2I9G A;  2RLT A;  5HRD A;  3M9M B;  3V6K A;  4Q45 A;  3RRG A;  3RJJ A;  5B5E U;  3OHA A;  3T3F A;  4NKU A;  3WK4 A;  2K4H A;  4AYB F;  1NK7 A;  1ZQL A;  4HYK A;  1JN3 A;  2HVI A;  3JPT A;  3K7D A;  3PVX A;  3NVW A;  4FHV A;  4P0P A;  1XWL A;  5DB6 A;  3JPP A;  4O68 A;  5AM3 A;  4TUQ A;  1FFU A;  2BGW A;  2GLE A;  1COK A;  4K4I A;  1S76 D;  3QU2 A;  5KFI A;  3TFS A;  4IQV A;  1TK0 A;  3KHL A;  4KLJ A;  2KVC A;  3PW0 A;  3C2K A;  5KL1 B;  5ALW A;  2DVI A;  4PGQ A;  2DR7 A;  3WFR E;  4ELU A;  5J0Q A;  4QZG A;  3M6Z A;  4WQL A;  5GTH U;  2F8L A;  5IIO A;  1TFW A;  4C7Z A;  2PMZ F;  3F2B A;  2M2V A;  3WK9 A;  4J9R A;  2MRL A;  1ZQF A;  5KFX A;  3PW4 A;  2EQY A;  5ALY A;  4A8E A;  5JU5 A;  5DGB A;  1SXE A;  1Y88 A;  2ISP A;  1ZRN A;  3BQ7 A;  4M6W A;  2WAQ C;  1SZP A;  1NZP A;  5EWF A;  3C21 A;  5C0Y A;  4UBB A;  4X5V A;  1S5L U;  1GPJ A;  5ALI A;  1COO A;  3JPQ A;  7ICQ A;  2ODG A;  4KX5 A;  9ICU A;  2JV3 A;  4QZE A;  4UD4 A;  4M9L A;  1PVQ A;  3UXN A;  4AT7 B;  3KZI U;  4X0A A;  2F2A B;  3QEB Z;  1ZET A;  1WYG A;  1ZRM A;  5KFY A;  4KLG A;  4QWD A;  4RPZ A;  7ICL A;  1N5W A;  3SR6 A;  1WWU A;  1N63 A;  3PML A;  1WUD A;  4PZN A;  1LKY A;  4EP7 A;  5KT2 A;  4KIT B;  2W54 A;  1MIV A;  3PX6 A;  1OW5 A;  3E2E A;  1ZOL A;  4X4Q A;  7ICK A;  4RWN A;  3TKA A;  1JI7 A;  3EW9 A;  4IRC A;  1KEJ A;  3AQL A;  2KNJ A;  3HIL A;  2PXI A;  4YP3 A;  4LEY A;  2R8J A;  1FFV A;  1Z00 B;  3N97 B;  5KG0 A;  5KAI U;  1RXW A;  4UB4 A;  4AT9 A;  2ZH7 A;  2W04 A;  4WOY A;  4FHY A;  4J9P A;  8ICH A;  3EZ5 A;  3RJI A;  1KFT A;  3M1Y A;  2ZUC A;  1RPL A;  5AM1 A;  1N48 A;  4Z6D A;  3TAC B;  4P2H A;  5CWR A;  3WK6 A;  3N7P D;  3H0M B;  3OSP A;  5L9X A;  4CDG A;  2XC9 A;  4EGW A;  1K1Q A;  1RYS A;  3QUT A;  2F3N A;  4JUZ A;  2E3T A;  4BWM A;  3N4M B;  2W9C B;  3V72 A;  2NRT A;  5CP2 A;  4X4R A;  1MN8 A;  2P6U A;  1Z4O A;  4EBK A;  4Y2Q A;  5KFT A;  5L1K A;  4US8 A;  4P0P B;  3EYZ A;  2BE3 A;  5DG7 A;  2ZHA A;  1VFG A;  5K4L A;  3C5F A;  2UVR A;  4QZA A;  4GLX A;  3UMB A;  1S0M A;  4F72 A;  3IG8 A;  2FE9 A;  5HRI A;  1TV9 A;  4R64 A;  4DCC A;  1N62 A;  3PX4 A;  2DKX A;  9ICT A;  4PZO A;  4YD1 A;  3PV8 A;  4BXO A;  1ZQR A;  3RJH A;  7ICI A;  4USA A;  1YZ7 A;  4R63 A;  5D62 A;  4DFD A;  8ICC A;  2FLP A;  3NVY A;  4DSE A;  3GIM A;  1ARO P;  5G5H A;  2GAF D;  4B9N A;  1UPH A;  4C4T A;  1L8L A;  5ALH A;  4F4Z A;  5HRG A;  1KLN A;  7ICM A;  5AIB A;  4M6W B;  3QUB A;  2W9B B;  5ALT A;  2WF9 A;  2C2E A;  3WFP A;  2H5X A;  3OV7 A;  3JPR A;  3F2C A;  8ICB A;  4X4O A;  3F5A A;  3V7K A;  4C80 A;  1SKW A;  5HNK A;  3B0X A;  1NJZ A;  1XSP A;  4Z6E A;  2B4V A;  4U7C A;  3D2N A;  3PR4 A;  2ZTD A;  3MDC A;  4UD5 A;  3M7D A;  4DOC A;  3RF9 A;  5HRK A;  2KOB A;  1PVR A;  3FM9 A;  2OWO A;  3WFS C;  1O03 A;  4EEN A;  2KTQ A;  4NXU A;  3KHH A;  3UXO A;  3RJE A;  4YQW A;  2BQR A;  2YMM A;  2DR8 A;  2KIV A;  2FPL A;  4AP9 A;  2PI4 A;  5ALQ A;  3G6V A;  1TK8 A;  4FZL A;  5DQI A;  4RUC A;  2EDU A;  2KZ3 A;  4NL9 A;  1JRO A;  5AK3 A;  4OCZ A;  1VJ5 A;  2IHO A;  4ICA A;  2GO7 A;  3MBY A;  3TAR A;  4C7Y A;  1F44 A;  4CGZ A;  3JPN A;  2W9A A;  9ICP A;  2M0N A;  4EEB A;  5KFR A;  5AI6 A;  3TAD C;  5KG3 A;  4AT9 B;  1SWV A;  2JH7 A;  4JB3 A;  3WKA A;  2YTU A;  2Q4T A;  3Q8P B;  4I2I A;  2DR5 A;  3K75 D;  3WKD A;  4LVS A;  4DL2 A;  4NXT A;  4I2H A;  3ZDE A;  4DL6 A;  4F4K A;  3ISD A;  8ICQ A;  5J2D A;  2GH1 A;  4RQ7 A;  2F44 A;  2LYA A;  4CRX A;  3RJK A;  1QTM A;  2XIC A;  3VC8 A;  2E1E A;  2YN4 A;  5KFB A;  2ZH1 A;  4EEY A;  1NJW A;  4J9N A;  2MU2 A;  5KFM A;  1ZQQ A;  1NKB A;  4LZD A;  2RQ5 A;  5EE0 A;  3CRX A;  2KE7 A;  2PFQ A;  2EAO A;  4ZOH C;  2F1I A;  4G3I A;  4JV1 A;  2BPG A;  4TQR A;  5KFS A;  5IIK A;  3HKZ C;  4O3O A;  8ICW A;  4NXX A;  4XQ8 A;  3L4P A;  1L6N A;  1QCK A;  3LWL A;  5KFL A;  4JV2 A;  3RB4 A;  4BXO B;  4I0U A;  4BJQ A;  1KFD A;  3SEN A;  5AM2 A;  8ICG A;  3OTQ A;  2WFA A;  5J0X A;  4UW9 A;  3C18 A;  4WH5 A;  3HW8 A;  1KNY A;  4B6J A;  9ICJ A;  1S97 A;  4EX6 A;  3M6K A;  3ALR A;  4DFJ A;  4YN4 A;  2WB1 C;  3QNM A;  4X4U A;  3H39 A;  1SWW A;  2KIW A;  5AKG A;  4FS1 A;  4EBE A;  4DF4 A;  3DV9 A;  3RR7 A;  4KMU A;  4MFA A;  2DUY A;  4NXV A;  4I2B A;  2M9N A;  1K1S A;  4UB6 U;  4FO6 A;  2A3V A;  5KFW A;  4F71 A;  1TE2 A;  4OAH A;  4RZR A;  3IN5 A;  5EWG A;  2F1J A;  3C1Y A;  5KFC A;  3OVS A;  2JZB B;  5HRB A;  5DED A;  1UQV A;  1JMS A;  1HUO A;  2LHT A;  4QZ8 A;  4M2Y A;  2NRX A;  5AKI A;  5TZV A;  4UAT A;  5J2A A;  2PBE A;  2OM6 A;  2N1R A;  3UM9 A;  2XO7 A;  5AM0 A;  3UPS A;  4I28 A;  3KFU F;  7ICO A;  1S0O A;  4XQ7 A;  4F5O A;  3V6H A;  2C28 A;  5BPC A;  5D4B A;  4RNO A;  4ELT A;  3B0Y A;  4EEK A;  4MFF A;  5DKW A;  1ZQS A;  1R8B A;  3JCF A;  2KHQ A;  4DQQ A;  2H3Q A;  2EWR A;  8ICU A;  4QNL A;  2KHV A;  5DDM A;  4J03 A;  2KD1 A;  4O9M A;  2G5H B;  4NM2 A;  3MGH A;  3MR2 A;  2W11 A;  3Q8M A;  3MFH A;  4DFP A;  3BZC A;  3AQM A;  1MA7 A;  2KJ9 A;  4EBJ A;  2WF5 A;  4UAW A;  7ICH A;  3IP4 B;  4RQ3 A;  3H8J A;  5DBC A;  2IUB A;  1PUZ A;  1L3V A;  3H7I A;  3L5K A;  4YXM A;  4Y2U A;  1RQN A;  4ED3 A;  4AT7 A;  2RDJ A;  1SGG A;  4Z6C A;  3GU3 A;  3IM1 A;  5GTI U;  3T5K A;  2FDR A;  5D46 A;  3LQC B;  1QQ7 A;  5CR0 A;  3Q8K A;  2YX8 A;  2XGQ A;  1F0M A;  2NRK A;  4WJ3 B;  3GII A;  3EF2 A;  1ZQW A;  4B9M A;  5HRE A;  3SI8 A;  1ZQA A;  1OXJ A;  3N7R C;  1V4A A;  2MUT A;  1CRX A;  2AQ0 A;  1NO5 A;  1V9P A;  5AK4 A;  4DS5 A;  4FBT A;  2E8P A;  2DL0 A;  2FMS A;  2W3S A;  2ZIX A;  3SEI A;  1RQL A;  4AT8 A;  1J97 A;  3MR6 A;  4DEZ A;  4WC4 A;  2Q66 A;  4KLM A;  3RH5 A;  2JXJ A;  1NK6 A;  2P66 A;  3IDW A;  4DQP A;  5B66 U;  5AI9 A;  3GIL A;  4DO9 A;  1VDV A;  1Z00 A;  4DLG A;  1ZQC A;  4JLZ A;  4JMU A;  4X4N A;  3GDX A;  5DQH A;  3SAF A;  9ICQ A;  2HHT A;  5J2J A;  3NGD A;  9ICR A;  1NK5 A;  1VLB A;  1UCV A;  4GXJ A;  2ZH8 A;  1Q78 A;  4BUG A;  2KJ5 A;  9ICG A;  4C4R A;  1K5O A;  2EZY A;  4DOB A;  3IRU A;  4JWM A;  1FO4 A;  4B9V A;  2H3F A;  3ERC C;  2AGQ A;  2BPC A;  4DQR A;  4MKP A;  2PI5 A;  4NLG A;  4K8V A;  4OAI Z;  3TFR A;  5H2F U;  4PPX A;  2ZHB A;  4Y2J A;  2VJ5 A;  1NKE A;  3MR5 A;  1RG6 A;  5HHI A;  4KLI A;  2OCE A;  1KL9 A;  1ZD4 A;  4ED6 A;  2VKQ A;  3NS1 A;  2W9C A;  5F9N A;  4BX9 C;  1WCN A;  2KN7 A;  1PZN A;  1L7P A;  3N28 A;  1RM6 C;  4KLL A;  5HRH A;  4F5N A;  3A0B U;  2WAQ F;  3OWG A;  4IL6 U;  5CHG A;  5J8Y A;  3PO5 A;  1TFR A;  2ASD A;  3MDA A;  1XU4 A;  4F5R A;  7ICE A;  4YR3 A;  2BHN A;  2YB4 A;  1B0X A;  4DSJ A;  2QKQ A;  5ALE A;  4BWJ A;  4KN4 A;  1KTQ A;  2I5H A;  2ASL A;  3KD3 A;  1NK4 A;  5AKX A;  4NXW A;  4GXI A;  3OUY B;  2E8O A;  4X4V A;  2KMD A;  4YD2 A;  2Y1I A;  5L1J A;  1DK3 A;  4WC6 A;  4QW8 A;  9ICK A;  3UMG A;  3U26 A;  5DBA A;  1Z4N A;  4I2G A;  3ER8 C;  3LDA A;  2BR0 A;  2W9B A;  1X9W A;  4O6A A;  4F3O A;  4I2E A;  3OJU A;  3BS5 B;  3D6J A;  1TVA A;  9ICV A;  4AYB C;  1BNO A;  1ZD5 A;  2JMG A;  4TUP A;  4KM5 A;  1WOT A;  5CRX A;  4IQT A;  2HHV A;  2QAR A;  2R18 A;  3MGV A;  8ICZ A;  4QW9 A;  3RRH A;  3D2Q A;  3EUB 2;  2LBO A;  4F50 A;  3PW5 A;  3KKA C;  2KJ8 A;  5KFK A;  4CF4 A;  4QZF A;  5HRF A;  2G0A A;  1ZQO A;  2WF7 A;  2YML A;  1ZQN A;  9ICO A;  2NV3 A;  4GIB A;  2MUT B;  3J81 j;  5AKZ A;  2F1H A;  4UAZ A;  1IXR A;  3T5H A;  2KFN A;  5JTG A;  4YVZ A;  2W9M A;  1Q3U A;  4XA5 A;  4O3P A;  4HX0 A;  5AM4 A;  2ZIX B;  4AT8 B;  1ZQY A;  2KSO A;  4F4X A;  1NZB A;  1SZH A;  2IOF K;  4WCW A;  2PMZ C;  1TAQ A;  4B9S A;  4YFK A;  5J2K A;  3RAX A;  5AI4 A;  1MSW D;  3M8R A;  4Q8E A;  5CHE A;  2EZZ A;  4FE3 A;  1KRP A;  1IIP A;  4X4P A;  1BPE A;  2B21 A;  2ESE A;  5AK6 A;  7ICT A;  4K98 A;  4QZD A;  4Z6F A;  4I2A A;  2ZG6 A;  4E8F A;  4DL7 A;  4RQ5 A;  3G6Y A;  5J2H A;  3RH6 A;  3RBE A;  1KW4 A;  1UT8 A;  3ZD8 A;  2YMP A;  1DXS A;  2VA8 A;  1CUK A;  1V85 A;  2W43 A;  2G09 A;  2GOL A;  5AKY A;  3GIK A;  2ES6 A;  3PW7 A;  4KLQ A;  5IIJ A;  2H3Z A;  3KHG A;  1S9F A;  2PFN A;  1EXN A;  2HHW A;  3GV8 B;  1A6S A;  4ED0 A;  3T79 A;  2R8G A;  2I1Q A;  4ECY A;  4UAV A;  1D8L A;  8ICR A;  3GV7 B;  5KFH A;  2W7P A;  4PGX A;  4MEX A;  1BGX T;  3IG5 A;  4RNN A;  3RTV A;  4KLO A;  3PHZ A;  1QQ5 A;  7ICF A;  4DFM A;  1MIY A;  4DLE A;  2HHQ A;  5CA7 A;  3PX0 A;  3ZDB A;  4P4O A;  1ZQH A;  3HJ4 A;  2LI6 A;  1S0N A;  1BPX A;  3SAG A;  2E8M A;  2EZX A;  4CF3 A;  3M8S A;  5KG7 A;  1U45 A;  3H4B A;  3H4D A;  3K1R B;  4IQW A;  1O08 A;  1SV0 C;  4GC6 A;  3PR5 B;  2BCV A;  1S8O A;  3ZDA A;  7ICJ A;  3PMN A;  1QQ6 A;  1MC8 A;  3UXP A;  1JUD A;  4C0Z A;  2K4E A;  4P4P A;  4M0A A;  2R8I A;  4PHA A;  4EZ9 A;  2YMQ A;  2JGA A;  4C8L A;  3QU9 A;  5AIC A;  3LWM A;  4Y2S A;  4UAU A;  2OEH A;  3KZX A;  4RWO A;  3AQN A;  1X2I A;  2DWQ A;  2L5Y A;  4NWI A;  4BDP A;  3LYS A;  4OJO A;  2J6U A;  3GQC A;  3NVV A;  1DRG A;  2K8A A;  3NRW A;  5ALG A;  4M9G A;  4ECR A;  3OVA A;  4CF5 A;  4X0B A;  4LEZ A;  2WF8 A;  5ALR A;  5KFU A;  3I1Y A;  5KFZ A;  1PVP A;  2ZIV B;  2W7O A;  1MQ2 A;  1JXE A;  5KT7 A;  2G5I B;  9ICC A;  5FP0 A;  4OJ6 A;  2EAN A;  3AMZ A;  4NLZ A;  4WBZ A;  4F91 B;  4P4M A;  5J29 A;  1HIW A;  2QAR B;  5J0W A;  1D8Y A;  9ICW A;  1JAJ A;  4XUS A;  4O3N A;  1X66 A;  2NRV A;  2JZB A;  3RB6 A;  3UMC A;  5J2I A;  4O67 A;  1UA0 A;  4R66 A;  2FPM A;  9ICX A;  3UQ2 A;  2M2U A;  3H40 A;  2ID1 A;  3PNC A;  2ALZ A;  2LYB A;  1L7M A;  4IQU A;  2R8H A;  4J9K A;  3ZD9 A;  5D49 A;  5F3X B;  5HMM A;  2O6K A;  2XCA A;  2KSO B;  4YCX A;  2ATL A;  2XID A;  3FDS A;  5J0O A;  1RDF A;  3RAQ A;  3H0L B;  1SKR A;  5CFS A;  4RU9 A;  5EE3 A;  5CB1 A;  3MR3 A;  3I28 A;  2EAM A;  4ELV A;  3H3A A;  2XGP A;  2IOH A;  4NXZ A;  4DFK A;  4X4S A;  1L3U A;  4B9L A; 
#chains in the Genus database with same CATH homology
 7ICO A;  3OHA A;  9ICB A;  3T3F A;  4FHX A;  1S0O A;  2UVU A;  4XQ7 A;  4NKU A;  3V7L A;  3OVS A;  4F5O A;  1S77 D;  3V6H A;  4UQG A;  2GWS A;  8ICS A;  1NK7 A;  2C28 A;  1ZQL A;  3G6X A;  5BPC A;  5D4B A;  4QWE A;  4HYK A;  4RNO A;  4J9M A;  3B0Y A;  3M9N B;  2C2R A;  4ELT A;  1NK0 A;  1JN3 A;  3TAQ A;  4IRK A;  5DKW A;  5J2B A;  2WTF A;  4MFF A;  2HVI A;  3UPQ A;  1ZQS A;  3JPT A;  4YMO A;  3JPS A;  3PVX A;  4B9U A;  1R8B A;  4DQQ A;  4FHV A;  1ZQI A;  1XWL A;  5DB6 A;  4R8U A;  4ECU A;  2O5A A;  2FMQ A;  1RYR A;  8ICE A;  2BQ3 A;  1TK5 A;  3BQ2 A;  4C8M A;  3JPP A;  8ICU A;  5DDM A;  2FMP A;  4O9M A;  4NM2 A;  4IG8 A;  1L3T A;  3MGH A;  3MR2 A;  1ZQG A;  2NRZ A;  4TUQ A;  3Q8M A;  2BGW A;  3MFH A;  4DFP A;  2V4R A;  4K4I A;  3AQM A;  4KLF A;  4ED1 A;  2XY6 A;  1S76 D;  3HP6 A;  1X9M A;  9ICF A;  4EBJ A;  5KFI A;  3TFS A;  4LZG A;  4IQV A;  4UAW A;  7ICH A;  2ZH9 A;  4RQ3 A;  1TK0 A;  3KHL A;  5HRL A;  4KLJ A;  5J0S A;  3H8J A;  3C2K A;  4QZI A;  3PW0 A;  3Q8Q B;  5DBC A;  5KFG A;  1L3V A;  2ASJ A;  3H37 A;  1NKC A;  3H7I A;  4PGQ A;  2DVI A;  2DR7 A;  4YXM A;  3WFR E;  4ELU A;  5J0Q A;  4QZG A;  4O5C A;  3HIY A;  5KG6 A;  2JEI A;  4I2D A;  4ED3 A;  4AT7 A;  2RDJ A;  4Z6C A;  1H38 A;  3IM1 A;  5IIO A;  3T5K A;  4Q43 A;  1TFW A;  4PHE A;  2M2W A;  1KDH A;  5D46 A;  3LQC B;  4I2F A;  9ICH A;  5CR0 A;  3Q8K A;  2M2V A;  4F93 B;  3BQ0 A;  2IMW P;  4WC3 A;  2XGQ A;  4J9R A;  4DQI A;  4ATB A;  1ZQF A;  4MEY A;  5KFX A;  2UVV A;  3PW4 A;  5KG1 A;  2NRK A;  4NY8 A;  3GII A;  1ZQW A;  3KTQ A;  5DGB A;  1Y88 A;  2ISP A;  4B9M A;  5HRE A;  8ICV A;  5KFF A;  3SI8 A;  8ICJ A;  1ZQA A;  1V4A A;  4RPX A;  4M6W A;  3KHR A;  2J6S A;  4IR9 A;  1SZP A;  2MUT A;  1NZP A;  5EWF A;  4IR1 A;  3C21 A;  3ORY A;  4UBB A;  4X5V A;  1NJX A;  1COO A;  3JPQ A;  1SL1 A;  1B43 A;  2AQ0 A;  4M47 A;  7ICQ A;  4NLN A;  1NO5 A;  1V9P A;  9ICU A;  3WFQ E;  4S3N A;  4QZE A;  4DS5 A;  4UD4 A;  4M9L A;  5KG4 A;  4FBT A;  2FMS A;  4AT8 A;  3OVB A;  4AT7 B;  3UXN A;  2VAN A;  5KT3 A;  2W8K A;  3MR6 A;  2W8L A;  4DEZ A;  3C23 A;  4X0A A;  4WC4 A;  1ZQX A;  9ICA A;  2Q66 A;  4FHP A;  4QWA A;  3QEB Z;  4KLM A;  4MF2 A;  3Q8L A;  1ZET A;  1U48 A;  4JV0 A;  3RH5 A;  4F4W A;  8ICN A;  4ATB B;  1JXL A;  1NK6 A;  5KFY A;  2P66 A;  2RFF A;  3C2M A;  4KLG A;  4QWD A;  4DQP A;  4FS2 A;  4WC0 A;  4RPZ A;  7ICL A;  2AGP A;  3GIL A;  9ICN A;  2HHX A;  4DO9 A;  4F8R A;  5KG5 A;  5DG9 A;  1Z00 A;  4DLG A;  4DF8 A;  1ZQC A;  4RT3 A;  5HR9 A;  2HVH A;  1F5A A;  3PML A;  5L1L A;  4F5Q A;  1L3S A;  4X4N A;  3GDX A;  4J9S A;  5DQH A;  2ZTE A;  9ICQ A;  4EP7 A;  4M9H A;  4EBD A;  2HHT A;  5KT2 A;  5J2J A;  3NGD A;  3UQ0 A;  9ICR A;  4KIT B;  3H8S A;  3SV3 A;  4O3S A;  2JEJ A;  2IBK A;  5KFP A;  3PX6 A;  1NK5 A;  8ICM A;  1MIV A;  4RWP A;  3E2E A;  4GXJ A;  2ZH8 A;  3IHQ B;  1C7Y A;  1Q78 A;  3OSN A;  7ICK A;  4X4Q A;  2HHS A;  1T7P A;  4RWN A;  3BQT A;  9ICG A;  4RWQ A;  5DB8 A;  3ETL A;  4DOB A;  1ZQK A;  3TI0 A;  3EW9 A;  2M2T A;  3EPI A;  1RXV A;  5DBB A;  4DL4 A;  4IRC A;  1KEJ A;  3AQL A;  4WC7 A;  2V9W A;  2PXI A;  3TQ1 A;  4YP3 A;  4JWM A;  4B9V A;  2ZH2 A;  4O5E A;  2R8J A;  1Z00 B;  3N97 B;  2AGQ A;  2FLN A;  4F2R A;  5KG0 A;  5KG2 A;  5EOZ A;  3TAP A;  2ZJA A;  1ZQD A;  2BPC A;  1R8A A;  4DQR A;  8ICO A;  3JPO A;  1RXW A;  4RQ0 A;  4UB4 A;  2PI5 A;  4AT9 A;  2ZH7 A;  1DOQ A;  4NLG A;  3LK9 A;  3HWT A;  3RR8 A;  3TFR A;  3MGI A;  4PPX A;  2ZHB A;  3MAB A;  4KN7 A;  1NKE A;  2HW3 A;  4FHY A;  4J9P A;  1SL2 A;  2AU0 A;  3NTU A;  5JUM A;  8ICH A;  3PY8 A;  3MR5 A;  5HHI A;  4KLI A;  4ECX A;  4ZH4 A;  3EZ5 A;  4ED2 A;  4ED6 A;  3PW2 A;  4E7X A;  2W9C A;  3RJI A;  5F9N A;  1KFT A;  1WCN A;  2KN7 A;  2ZUC A;  5KFJ A;  1RPL A;  4RQ4 A;  1N48 A;  4O5K A;  1PZN A;  2DRB A;  5DDY A;  5DG8 A;  1ZJN A;  4Z6D A;  4QWC A;  1S10 A;  2PFP A;  1BVS A;  3OUY A;  2A1J A;  4P2H A;  4KLL A;  5HRH A;  5CWR A;  4F5N A;  1BPY A;  4QZH A;  1MQ3 A;  3QEA Z;  3OSP A;  3BQ1 A;  3ISB A;  5HHH A;  3SYZ A;  3JYY A;  1A77 A;  3H38 A;  7ICN A;  5L9X A;  4DL3 A;  5KFD A;  5CHG A;  5KTQ A;  3PO5 A;  1TFR A;  4QZ9 A;  2ASD A;  2XC9 A;  3MDA A;  1K1Q A;  1RYS A;  3AQK A;  1XU4 A;  4F5R A;  4ED8 A;  7ICE A;  4ECW A;  4YR3 A;  2V4Q A;  2BHN A;  5KFA A;  4FBU A;  7ICU A;  4JUZ A;  4BWM A;  3N4M B;  1JX4 A;  4DSJ A;  3JZ0 A;  2W9C B;  4XRH A;  3V72 A;  2ZUB A;  4J9L A;  8ICF A;  4BWJ A;  4KLD A;  5CJ7 A;  4KLS A;  2NRT A;  5CP2 A;  4WC2 A;  4KN4 A;  1KTQ A;  4EBK A;  2P6U A;  4X4R A;  9ICL A;  4UB3 A;  5KFT A;  5L1K A;  4MFC A;  1FA0 A;  4WC1 A;  4GXK A;  2ZH4 A;  4DOA A;  2ASL A;  4ECT A;  4R8U B;  3EYZ A;  3HT3 A;  1NK4 A;  2BE3 A;  4GXI A;  5DG7 A;  3RH4 A;  3OUY B;  2ZHA A;  1VFG A;  4X4V A;  4YD2 A;  3C5F A;  2Y1I A;  2UVR A;  4QZA A;  3HX0 A;  3RB0 A;  4RNM A;  5L1J A;  4GLX A;  1DK3 A;  4WC6 A;  1S0M A;  5HRI A;  4QW8 A;  1TV9 A;  9ICK A;  4R64 A;  3PX4 A;  4RPY A;  1HJP A;  3ISC A;  5DBA A;  1Z3E B;  4I2G A;  9ICT A;  2HHP A;  4YD1 A;  1XO1 A;  3LDA A;  3T5J A;  4YMN A;  2BR0 A;  2BKE A;  4J9O A;  2JEG A;  7ICV A;  3QZ8 A;  2W9B A;  5BOL A;  3PV8 A;  1X9W A;  4BXO A;  2ZH6 A;  4F3O A;  4I2E A;  1TFY A;  4UB5 A;  3OJU A;  2BDP A;  1ZQR A;  1SKS A;  4EYH B;  1TVA A;  9ICV A;  5J0P A;  3RJH A;  7ICI A;  4TQS A;  3SZ2 A;  1BNO A;  4TUP A;  4X4T A;  4UAY A;  1WOT A;  4F4Y A;  4IQT A;  1N56 A;  5KFE A;  3ZDD A;  4EZ6 A;  2HHV A;  4R63 A;  8ICZ A;  5DQG A;  1ZQE A;  8ICC A;  2FLP A;  4QW9 A;  3GFK B;  3RRH A;  1HUZ A;  4DSE A;  4F50 A;  3GIM A;  1ARO P;  2J6T A;  3FYH A;  3PW5 A;  1BPB A;  4O3R A;  4B9N A;  5KFQ A;  1DK2 A;  5KFK A;  3GIJ A;  1XS9 D;  4YMM A;  4QZF A;  5HRF A;  1ZQO A;  2KZM A;  4UBC A;  4DSK A;  3AU6 A;  3OJS A;  3ZDC A;  4FHW A;  1ZQN A;  2ISO A;  9ICO A;  1CEZ A;  1SL0 A;  4FH5 A;  1TAU A;  4F4Z A;  5HRG A;  1KLN A;  7ICM A;  1KSP A;  4M6W B;  2W9B B;  5DLF A;  8ICA A;  1UA1 A;  5KT6 A;  2MUT B;  1KFS A;  2C2E A;  4MF8 A;  4F92 B;  4DQS A;  4NM1 A;  2BCU A;  2F1H A;  1D9F A;  2H5X A;  4UAZ A;  8ICI A;  3WFP A;  3OV7 A;  1IXR A;  2Q0Z X;  3JPR A;  3T5H A;  2IHN A;  2KFN A;  8ICB A;  4X4O A;  4YVZ A;  2W9M A;  3BDP A;  4XA5 A;  4O3P A;  2DPI A;  3V7K A;  3K4G A;  2NRW A;  4AT8 B;  1SKW A;  1ZQY A;  5HNK A;  3B0X A;  4ECS A;  1NJZ A;  1XSP A;  4F4X A;  5KT4 A;  4Z6E A;  3BJY A;  1RZT A;  1LV5 A;  8ICT A;  2IHM A;  4WCW A;  3PR4 A;  1TAQ A;  3MFI A;  2XY5 A;  4PGY A;  1JIH A;  4PH5 A;  2ZTD A;  5DB7 A;  4YFK A;  1XC9 A;  4B9S A;  4I2C A;  3HJ1 A;  3QZ7 A;  5J2K A;  3RAX A;  4O0I A;  4QZC A;  8ICL A;  2UVW A;  4ED7 A;  1MSW D;  5DGA A;  3M8R A;  4Q8E A;  3MDC A;  4UD5 A;  1KRP A;  4DOC A;  2ZUD A;  4Q8F A;  5HRK A;  1BPE A;  4K4G A;  4X4P A;  4YR0 A;  1D9D A;  2B21 A;  4M9J A;  2OWO A;  3WFS C;  1UET A;  5L1I A;  1NOM A;  2KTQ A;  4M5D A;  3KHH A;  3Q8S B;  3UXO A;  9ICE A;  3RJE A;  7ICT A;  1BNP A;  4QZD A;  4Z6F A;  4YQW A;  4I2A A;  4TUR A;  1ZJM A;  2BQR A;  5KFV A;  4E8F A;  5J0U A;  4DL7 A;  4UB2 A;  4RQ5 A;  1BPD A;  4C8N A;  3G6Y A;  5J2H A;  3RH6 A;  3RBE A;  2DR8 A;  2FPL A;  1UT8 A;  1WCL A;  3ZD8 A;  2PI4 A;  1PX5 A;  4DSI A;  3G6V A;  1TK8 A;  2BCQ A;  2P6R A;  4RUC A;  4BGD A;  5DQI A;  2VA8 A;  1CUK A;  2BCR A;  5J2C A;  2KZ3 A;  3C1Z A;  1LB2 B;  2AJQ A;  1ZQJ A;  3GIK A;  4EYI B;  5F2V O;  1A76 A;  3PW7 A;  1BPZ A;  4KLQ A;  1DGS A;  2VA2 A;  3OGU A;  5IIJ A;  9ICS A;  4LT6 A;  3MBY A;  1U9L A;  4PHP A;  3KHG A;  3TAR A;  4NLK A;  2ZH3 A;  1S9F A;  3T5L A;  1EXN A;  2PFN A;  4B9T A;  3GV8 B;  4PHD A;  2HHW A;  1R8C A;  4WC5 A;  1ZQV A;  2ZJ8 A;  5HML A;  4ED0 A;  4C8K A;  3L9D A;  4NKT A;  3PO4 A;  7ICP A;  5KFO A;  3JPN A;  2RDI A;  2W9A A;  2R8G A;  5BOM A;  2HHU A;  9ICP A;  2I1Q A;  4ECY A;  3SV4 A;  5KFR A;  4ECZ A;  1D8L A;  4AT9 B;  5KG3 A;  2DRA A;  8ICR A;  3GV7 B;  5KFH A;  4GC7 A;  5HC9 A;  4PGX A;  3OHB A;  4YG2 A;  4MEX A;  1BGX T;  3Q8P B;  4RNN A;  3RTV A;  1B22 A;  1UEV A;  4KLO A;  1ZQU A;  1NJY A;  4DSL A;  2AGO A;  4I2I A;  1ZYQ A;  2DR5 A;  2DPJ A;  3K75 D;  7ICF A;  2KFZ A;  4DFM A;  4LVS A;  5F9L A;  4DL2 A;  5KFN A;  2KP7 A;  1MIY A;  1QLN A;  2ZJ5 A;  4DLE A;  4RQ6 A;  8ICY A;  2HHQ A;  1ZQP A;  5CA7 A;  3PX0 A;  3ZDB A;  4P4O A;  1ZQH A;  4I2H A;  3HJ4 A;  1S0N A;  2KZZ A;  1T8E A;  4JWN A;  3ZDE A;  1BPX A;  2PFO A;  3M8S A;  2LYH A;  5KG7 A;  1U45 A;  4DL6 A;  1TKD A;  2A1J B;  3H4B A;  4EBC A;  1QSY A;  4F4K A;  3ISD A;  2AQ4 A;  1U49 A;  8ICQ A;  4ECV A;  3H4D A;  4F5P A;  5J2D A;  4RQ7 A;  8ICK A;  4QZB A;  4IQW A;  1OU5 A;  1JQR A;  3GV5 B;  4GC6 A;  3H8W A;  3PR5 B;  3RJK A;  4KLT A;  5J2F A;  1UT5 A;  2BCV A;  1QTM A;  5J2E A;  3ZDA A;  5EWE A;  7ICJ A;  3PMN A;  9ICM A;  1YLQ A;  4Q44 A;  3RBD A;  1MC8 A;  3UXP A;  2ZTC A;  7ICG A;  5KFB A;  2ZH1 A;  4EEY A;  4C8O A;  4P4P A;  1IM4 A;  4J9N A;  1NJW A;  4M0A A;  5KFM A;  4PHA A;  5DB9 A;  2R8I A;  5IIM A;  1NKB A;  1T4G A;  4YXJ A;  4J9Q A;  1ZQQ A;  4EZ9 A;  4LZD A;  4C8L A;  5DEC A;  4E0D A;  4YR2 A;  3LWM A;  1ZQZ A;  4KTQ A;  2O1P A;  2XY7 A;  4WBY A;  4DWI A;  4M04 A;  4RWO A;  3AQN A;  2FLL A;  1X2I A;  5J2G A;  1QSL A;  2JEF A;  4KLU A;  3C66 A;  3EWA A;  3M9O B;  2PFQ A;  4BDP A;  4IRD A;  4KLH A;  3C2L A;  9ICI A;  4RQ8 A;  2J6U A;  2F1I A;  4G3I A;  8ICX A;  3GQC A;  4DL5 A;  3RJF A;  4CCH A;  3NYB A;  2BCS A;  4JV1 A;  3AUO A;  4TQR A;  2BPG A;  4M9G A;  4DS4 A;  4M9N A;  2DR9 A;  5KFS A;  5IIK A;  4ECR A;  3V7J A;  5C5J A;  4O3O A;  8ICW A;  4XQ8 A;  3OVA A;  1MIW A;  5KT5 A;  4FH3 A;  4X0B A;  5KFU A;  5KFL A;  5KFZ A;  5J0R A;  3LWL A;  8ICP A;  4JV2 A;  3RB4 A;  4BXO B;  1MQ2 A;  3WFO A;  7ICS A;  1JXE A;  5KT7 A;  3QE9 Y;  9ICC A;  3Q8R B;  2Y1J A;  1Q79 A;  4UB1 A;  1KFD A;  1T3N A;  3V6J A;  4NLZ A;  4WBZ A;  4F91 B;  4P4M A;  4RUA A;  3TAN A;  5J29 A;  8ICG A;  4TUS A;  5J0W A;  1D8Y A;  2VA3 A;  9ICW A;  5III A;  1JAJ A;  5J0X A;  3C18 A;  2DFL A;  4XUS A;  1U47 A;  1XSL A;  3HW8 A;  5J0Y A;  4O3N A;  2IA6 A;  2R8K A;  2NRV A;  4F2S A;  5HP4 A;  1KNY A;  4RQ1 A;  9ICJ A;  2JZB A;  1S97 A;  4QWB A;  5DLG A;  1UEU A;  3HPO A;  3RB6 A;  5J2I A;  1L5U A;  1S0V A;  4DFJ A;  4YN4 A;  5IIN A;  4JK1 A;  4RT2 A;  4X4U A;  1UA0 A;  3H39 A;  4FS1 A;  2C22 A;  4DSF A;  4R66 A;  2FPM A;  4EBE A;  9ICX A;  4DF4 A;  3AU2 A;  3UQ2 A;  3RR7 A;  3H40 A;  4KMU A;  2M2U A;  4O3Q A;  2ID1 A;  4MFA A;  3PNC A;  3RB3 A;  2MAX A;  1ZQM A;  2BPF A;  4I2B A;  2M9N A;  2ALZ A;  1XSN A;  1K1S A;  4FO6 A;  4RQ2 A;  1ZQB A;  1NK9 A;  2BQU A;  5KFW A;  4IQU A;  2R8H A;  2C2D A;  4J9K A;  1U4B A;  4KLE A;  1VJ7 A;  3ZD9 A;  5D49 A;  4RZR A;  3EPG A;  5HMM A;  2ZH5 A;  5EWG A;  2F1J A;  2XCA A;  4I29 A;  3C1Y A;  7ICR A;  3C5G A;  4YCX A;  2ATL A;  1X9S A;  1R89 A;  1QSS A;  3FDS A;  5KFC A;  2FPK A;  2JZB B;  5J0O A;  5J0T A;  3RAQ A;  1ZQT A;  5HRB A;  4ECQ A;  5DED A;  1SKR A;  4I2J A;  4I27 A;  2XCP A;  1JMS A;  5IIL A;  4RU9 A;  4R65 A;  4QZ8 A;  3THV A;  1HUO A;  3RJG A;  5CB1 A;  4K4H A;  4M2Y A;  2NRX A;  3MR3 A;  2I9G A;  5TZV A;  2PBE A;  5J2A A;  5HRD A;  4ELV A;  3M9M B;  1NK8 A;  3V6K A;  3H3A A;  4Q45 A;  2XGP A;  3RRG A;  4E80 A;  2XO7 A;  4NXZ A;  3RJJ A;  4I28 A;  3UPS A;  4DFK A;  4X4S A;  1L3U A;  4B9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...