4MFFA

Structure of human dna polymerase beta complexed with o6mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 109
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mffA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mffA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mffA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mffA03
4WC0A 3QEBZ 3H8JA 9ICFA 1LB2B 3EWAA 8ICHA 1D8YA 9ICEA 4X4QA 4KTQA 5KG5A 4EBJA 3LWLA 1TK0A 3JPSA 4DL6A 3B0XA 4TQSA 4KN4A 1MSWD 3V7LA 5J0WA 1SKSA 3WFRE 4DFMA 4M2YA 3BQ2A 5CB1A 5KG3A 4I2JA 5KT6A 3GIKA 4MEXA 3KHRA 2RFFA 5KFAA 4DQPA 4YN4A 3C1ZA 4RT2A 4PH5A 2XC9A 4QWBA 1SKRA 1A77A 1KTQA 4I27A 4FS1A 2F1HA 2FMPA 3PVXA 5IIOA 5J2EA 1QTMA 2WTFA 4TQRA 5DG9A 5EWEA 3PR4A 5HRDA 9ICLA 2ZTEA 3MABA 4BWJA 5HRBA 5KFKA 5D4BA 1S10A 3EW9A 4YD2A 5HNKA 9ICKA 1RXWA 2GWSA 1U49A 4YR3A 3MGIA 3C5GA 4DLGA 2V9WA 5KG2A 5DBCA 7ICOA 2W9CB 5J2BA 4WCWA 1NK8A 4I2FA 5KFHA 3RAXA 3HIYA 3QZ7A 2ATLA 2PI4A 8ICNA 2IA6A 4O9MA 2XGQA 4X4VA 4KLMA 2R8JA 3EPGA 4MEYA 2P66A 3PW2A 4QZFA 4TUSA 8ICZA 4AT7B 3MR6A 3G6YA 8ICXA 5J2JA 4B9LA 4BWMA 2FLPA 3H4DA 1ZQXA 3ZDBA 3HW8A 8ICTA 4RQ5A 2F1JA 3EYZA 5DDMA 2J6SA 3KHLA 1D9DA 4RWPA 2AGQA 4UAZA 2IMWP 4WC2A 4KLHA 4JUZA 2ZJ5A 4RT3A 4F5QA 1NK0A 5KG4A 1HUZA 1BPZA 4DSJA 3GIMA 1H38A 4YR2A 1UEUA 2PFPA 4PHPA 4HYKA 2Y1JA 2M2TA 3OJUA 2P6UA 5C5JA 4O0IA 1ZQTA 2DPIA 3OVAA 1IXRA 4M9NA 1Q78A 1ZJNA 4QZ9A 1KDHA 5J0RA 3JPPA 4UAYA 3SV4A 4WC3A 4GXIA 2XCPA 1NK6A 1DK2A 4DOCA 3UQ0A 2OWOA 3PMNA 3RRHA 3UXNA 4RWNA 1RYRA 1L3TA 4Q8FA 8ICPA 1F5AA 5DQGA 2FMSA 7ICGA 3OUYA 4WC7A 1JIHA 5DGAA 1ZQLA 5KFLA 4MFCA 2BQRA 1RPLA 2C2DA 4FHXA 2W9CA 5KFCA 3PW7A 2HHXA 4F5RA 3WFOA 3QE9Y 8ICKA 9ICVA 3PX6A 4NLNA 4EZ9A 2ZJAA 4KLGA 3MR2A 3T5HA 3TFRA 7ICEA 1ZQNA 8ICLA 3KHGA 5HREA 4RNMA 1CUKA 2BKEA 2HHUA 4O3QA 4PHEA 2W8KA 1VJ7A 2KP7A 4ZH4A 4RUAA 1NK4A 8ICFA 1S0OA 8ICBA 4GC7A 2IBKA 1BGXT 3HP6A 4UB1A 4BDPA 3MDAA 4LZGA 2O5AA 4I2BA 1X9MA 4MF2A 5KT3A 3PY8A 4E7XA 4ED8A 3ZDEA 5DB6A 5D49A 4ECZA 3HT3A 5J0YA 7ICLA 4FH3A 3Q8KA 2ZH1A 4YFKA 3HJ1A 4FH5A 5DQHA 3C2KA 1Z3EB 1XO1A 4Z6FA 5DLGA 5CP2A 4RNNA 1ZQSA 5CWRA 4PGYA 2ASJA 1KRPA 3RJKA 3ORYA 4I2EA 9ICRA 2R8KA 2KZ3A 2M9NA 4C8KA 4NY8A 1UT5A 5HHIA 8ICOA 4QZDA 4X5VA 2UVWA 4XRHA 4KN7A 4QWAA 2ZH5A 2H5XA 4NLGA 3WFPA 4FBTA 1TFRA 2AGOA 4B9VA 1ZQVA 4ELTA 3M8RA 2JZBB 3LDAA 3Q8RB 2AJQA 1NJZA 3RB3A 5DBAA 4PHDA 4FHYA 3GQCA 5DBBA 4UD5A 3KHHA 2BQUA 4X4TA 2DVIA 2NRVA 3NYBA 3V6JA 4UB2A 4I2CA 4YVZA 3AQKA 3M9OB 1ZETA 2PFNA 3GIJA 3BDPA 3C21A 4G3IA 4WC4A 4DL4A 2W8LA 2PFQA 1KEJA 3OGUA 4IQTA 4FO6A 3UPSA 4X4RA 1ZQQA 2DR9A 3EZ5A 1S0MA 4DSKA 5KG7A 4RWQA 1PX5A 2ZH3A 3G6XA 3RRGA 3PMLA 4IQUA 4KLQA 1L3UA 3AU2A 4UB5A 3TAQA 4F8RA 1KFDA 2I1QA 3C1YA 4RQ6A 9ICTA 5KG6A 5DB9A 1CEZA 1ZQWA 8ICWA 3T5JA 2PFOA 4KLLA 1MIYA 1XC9A 2NRKA 4ED7A 5J2GA 2NRTA 1U48A 4UB3A 2M2VA 1A76A 4GC6A 1SL2A 1R8BA 5EWFA 4O5KA 9ICIA 4ECRA 1COOA 4ECTA 4LVSA 5BOLA 3PR5B 3MGHA 1SL1A 5KFEA 1N48A 4AT9B 3H40A 2BCUA 1IM4A 5DG8A 3JPQA 1MQ2A 4IQVA 1R89A 9ICHA 1C7YA 4JWNA 2Q66A 5KFQA 4IR1A 3TARA 1T8EA 4FBUA 4E80A 5J0UA 7ICVA 3JZ0A 2JZBA 4P4PA 2M2UA 5J2DA 2BHNA 4FHPA 4S3NA 3OUYB 1V9PA 4RZRA 4QW9A 9ICBA 1XSNA 3SYZA 5KT4A 3OV7A 2B21A 4O5EA 3AUOA 4UD4A 2HHVA 8ICQA 4DL2A 5J2KA 1XU4A 3H8SA 3GV7B 3C5FA 3V6HA 4WBZA 4WC5A 4XUSA 4KLFA 4RQ8A 4O3OA 4ELVA 1X2IA 5HMMA 4QZGA 4DQIA 1B22A 1WCNA 4NM1A 1DOQA 3K4GA 5KT2A 3EPIA 3T3FA 3H3AA 4DWIA 4GXKA 2V4RA 2IHMA 1AROP 5KG0A 2HVHA 5IIJA 4XA5A 4TUQA 3H4BA 1MIWA 2V4QA 2NRZA 1TKDA 1ZQRA 4ECUA 3RR8A 5DEDA 4ECWA 5KFFA 1NKEA 5KFZA 4MF8A 5L1IA 5DLFA 2JEFA 5KFWA 3GFKB 4DSEA 5TZVA 4NM2A 4DO9A 5KTQA 4WC6A 4RQ0A 1OU5A 4J9RA 1ZQCA 2BGWA 8ICRA 4J9QA 4ED3A 2JEGA 1R8CA 2BCSA 2C22A 3MDCA 1QLNA 5KFRA 4R63A 1ZQPA 1T3NA 1WOTA 2ZH8A 4R64A 4DF4A 4AT9A 1JN3A 3MR5A 4MFFA 7ICNA 1SKWA 2XO7A 4I2IA 4J9LA 4ECXA 4ED6A 4B9NA 4KLIA 9ICUA 3TAPA 2M2WA 1JAJA 4XQ7A 3OSNA 1DK3A 2C2EA 1QSSA 4J9KA 3RBEA 1ZQKA 1XS9D 3Q8QB 2KZMA 1T7PA 5KFBA 3V7KA 3PV8A 2DPJA 8ICMA 5J0OA 2ZTCA 4F5OA 3QEAZ 4QW8A 1NJYA 8ICCA 1KFTA 5DECA 2DFLA 4F4KA 4DFKA 8ICJA 4DQQA 3PW4A 7ICTA 8ICSA 5L1KA 3UQ2A 5HRHA 4ECVA 5HMLA 4R65A 2ISOA 3JYYA 3ZD9A 2ZHAA 1PZNA 3C23A 5CA7A 5DB8A 3ISCA 2ZUDA 3FYHA 2XGPA 4F4WA 4DS5A 3RJGA 5KFJA 4QZIA 3PW0A 1ZQIA 4JV1A 4FS2A 3PO5A 3UPQA 4ELUA 1UEVA 1TFWA 1HJPA 3TANA 2JEIA 2LYHA 2ZH7A 2Y1IA 2BPFA 4F91B 4YR0A 2AU0A 4QWDA 4QZ8A 1L5UA 2UVRA 4P4MA 4F4ZA 5KT5A 3BQ1A 4ECQA 4QZBA 3TI0A 4I28A 3OJSA 5J0PA 4DSFA 2W9BA 4O3NA 8ICVA 5CHGA 4O3SA 4XQ8A 4B9TA 4UAWA 4DOAA 7ICJA 1DGSA 4DQSA 3QZ8A 4QZCA 4NLKA 5KFDA 3GDXA 4QZEA 2R8IA 2ZH4A 4DOBA 2JEJA 2HHPA 3SI8A 4DSLA 2DR7A 4NXZA 1UA1A 4EBKA 2XY6A 3AU6A 2DR5A 4PGQA 1TVAA 4YMMA 3ZDAA 3GIIA 5J0QA 1QSLA 2FMQA 3FDSA 2FPMA 1XSPA 4DL7A 2IHNA 4IRDA 4M9HA 4I2GA 3LQCB 1S76D 1Q79A 2ZUCA 5KFMA 3RJJA 3M9NB 2Q0ZX 4JK1A 2RDJA 3H37A 3BJYA 4UQGA 1U45A 2ZTDA 4PPXA 2HVIA 3RJEA 1TAQA 4EBCA 4DF8A 5HRGA 4Q44A 3PX4A 3ZDCA 2BPGA 5DGBA 4B9UA 1X9SA 3AQMA 1L3SA 5KFUA 9ICPA 3NTUA 4I2DA 3RBDA 1JXLA 3JPOA 1ZQBA 4I29A 4JV2A 8ICAA 9ICXA 3WFSC 5J2AA 2BCVA 3K75D 5HHHA 3UXPA 2BCQA 4F3OA 1BNPA 3PX0A 4KLOA 1BPBA 2PI5A 7ICUA 3M8SA 5BPCA 4YP3A 2XY7A 1ZQAA 4Z6DA 3RH6A 3GV5B 1S97A 2HHQA 4BXOB 3E2EA 3C66A 4DSIA 4I2HA 1ZYQA 2O1PA 4PHAA 5J2IA 4RUCA 1KSPA 1ZQOA 1B43A 1TAUA 4LT6A 9ICMA 2FPKA 4Z6CA 3MFIA 5J29A 7ICSA 1K1SA 4KLSA 3BQ0A 5HRLA 2ZUBA 3H38A 1WCLA 4NKTA 4X0AA 4IG8A 2ALZA 3OHBA 4X0BA 5HRIA 2XY5A 2FPLA 5HR9A 4AT8B 4F4XA 3L9DA 4YMOA 3KTQA 1ZQFA 4C8LA 4ECSA 4EP7A 4O5CA 5KFSA 3GV8B 1NO5A 4RQ3A 5DKWA 3N97B 4B9SA 9ICGA 4F2RA 5HRFA 5DDYA 2FLLA 3Q8LA 3RAQA 2BQ3A 5KFVA 4F50A 3LK9A 2F1IA 2ZH2A 4LZDA 5KFNA 1KLNA 4K4GA 7ICFA 4YG2A 9ICNA 4X4SA 4X4UA 4YXMA 3HWTA 1UETA 1D8LA 1T4GA 4QWCA 3ZD8A 3C2LA 3NGDA 1KFSA 3IM1A 5KFYA 4YMNA 1RZTA 1ZQMA 2DRAA 4KLDA 3H39A 4K4IA 5BOMA 1U4BA 2ZH6A 2MUTB 5L9XA 4JV0A 4EBDA 1TK5A 8ICGA 4K4HA 1NK9A 3AQLA 4BXOA 1S0NA 1ZQEA 1ZJMA 7ICQA 2ZJ8A 4UB4A 4RWOA 4ATBB 2PXIA 3GILA 2C28A 1NKBA 4I2AA 9ICSA 4DL5A 5KT7A 4IQWA 4QWEA 2KFNA 1ZQUA 3TFSA 1FA0A 2BR0A 1ZQYA 5KG1A 2W9AA 4J9PA 4GXJA 2W9BB 3H8WA 5EWGA 5L1LA 5IIMA 3N4MB 1ZQDA 5KFXA 2KZZA 7ICHA 5DG7A 3RJFA 4RQ2A 2KN7A 4M6WA 5HP4A 4KITB 3M9MB 5J0TA 5D46A 3ISBA 2A1JA 1YLQA 4O3PA 4YXJA 4ECYA 2ZH9A 4AT8A 4J9MA 1UA0A 1V4AA 5DQIA 2ASLA 3RR7A 2I9GA 4F5PA 2ID1A 3ETLA 4GLXA 1XSLA 3C18A 5IIKA 4QZHA 2UVUA 1LV5A 3Q8MA 4J9NA 7ICIA 4F4YA 3TQ1A 1ZQJA 4KLUA 4M9JA 1EXNA 1BVSA 3B0YA 3G6VA 1NJWA 1MIVA 1S0VA 2BE3A 4EBEA 1N56A 3MR3A 2R8HA 2DR8A 4J9SA 4UBBA 4C8MA 1QSYA 4E0DA 4O3RA 1XWLA 3IHQB 1TV9A 4M47A 1NZPA 4MFAA 5JUMA 3HPOA 9ICAA 4RPZA 1TK8A 3Q8SB 5J0XA 2MAXA 5J2CA 1TFYA 5J2FA 1NJXA 4DL3A 1BNOA 3OVBA 2HHWA 2MUTA 2PBEA 5F2VO 3SZ2A 5CJ7A 3Q8PB 3V7JA 4Q45A 4JWMA 3OHAA 5J2HA 4Q8EA 4X4NA 5KFPA 4IRCA 3C2MA 4R8UB 3RB0A 3RB4A 1L3VA 1NK5A 4ATBA 4ED0A 2AQ4A 4FHWA 4RNOA 2VA2A 4RQ7A 5F9LA 4RPXA 4RPYA 1U9LA 1K1QA 1NOMA 5KFGA 3PW5A 1X9WA 2KFZA 1VFGA 4EYHB 4UBCA 3HX0A 2AGPA 1ZQHA 2UVVA 3ISDA 8ICUA 7ICKA 3MBYA 2VA8A 4KLJA 4YQWA 4M9GA 4KLEA 2XCAA 3OSPA 4P2HA 3T5LA 4M04A 2VANA 2FLNA 4EEYA 4CCHA 2DRBA 2NRXA 9ICWA 8ICYA 2W9MA 3JPTA 4YCXA 4DS4A 3RB6A 2R8GA 4AT7A 3OVSA 4NKUA 2NRWA 8ICEA 2BPCA 4WC1A 5EOZA 1Z00B 1SZPA 4C8NA 4R66A 4Z6EA 4RU9A 4ED1A 3V6KA 4DFPA 1BPXA 2BCRA 4RQ4A 5HRKA 3WFQE 4F5NA 1RXVA 4TURA 2HHTA 9ICOA 1R8AA 3RH5A 2ASDA 4F92B 5J0SA 3JPRA 3H7IA 4YD1A 1BPEA 4TUPA 4PGXA 5IILA 2J6UA 8ICIA 4X4OA 5HC9A 4M9LA 3SV3A 4J9OA 2RDIA 4DQRA 4FHVA 4NLZA 4WBYA 3V72A 1Y88A 3MFHA 5L1JA 1BPYA 2ISPA 4B9MA 5IIIA 1MC8A 3HJ4A 5KFOA 4R8UA 4F93B 1S9FA 3RJIA 3RH4A 1HUOA 1JMSA 1MQ3A 5KFTA 2HHSA 4IR9A 4X4PA 7ICPA 3BQTA 3RTVA 4KMUA 3JPNA 1BPDA 4M5DA 3PO4A 4IRKA 5CR0A 4QZAA 9ICJA 4DLEA 4EZ6A 1KNYA 1U47A 2HW3A 2P6RA 3THVA 1JQRA 2ZHBA 4E8FA 4Q43A 4DEZA 5DB7A 1NKCA 1SL0A 2AQ0A 1D9FA 1UT8A 4C8OA 1ZQGA 2C2RA 1JX4A 4KLTA 9ICQA 4M6WB 4EYIB 4DFJA 3RJHA 4BGDA 4RQ1A 5IINA 7ICMA 2A1JB 4P4OA 2KTQA 2J6TA 4ED2A 1NK7A 5KFIA 5F9NA 3PNCA 4M0AA 7ICRA 4F2SA 3LWMA 3UXOA 1Z00A 3T5KA 1RYSA 1S77D 9ICCA 2VA3A 2BDPA 3ZDDA 3AQNA 1ZQZA 1JXEA
chains in the Genus database with same CATH superfamily
9ICEA 3H8JA 9ICFA 4K8VA 1O08A 4EBJA 1TK0A 3B0XA 4TQSA 2H3FA 3WKEA 3V7LA 4K98A 1L6NA 5AKEA 5CB1A 2KHQA 4I2JA 4ZOHC 2GAFD 4YN4A 1A77A 2OXOA 3WKCA 1S8OA 4Y2PA 2F1HA 5IIOA 5DG9A 1N5XA 2PMZC 4YD2A 2YMMA 5KNIA 2V9WA 1ZD5A 3F2DA 1NK8A 3RAXA 2ATLA 3CYMA 2XGQA 4X4VA 2P66A 5E79U 3MR6A 5ALIA 3G6YA 4B9LA 4BWMA 5ALRA 1ZQXA 3ZDBA 4C7YA 3HW8A 2W7OA 4RQ5A 5DDMA 3KHLA 1D9DA 4UAZA 4J03A 1UPHA 4F5QA 4UB8U 2WAQC 2ZIUB 2DRBA 4F71A 4YR2A 1UEUA 2G07A 2OYYA 3OJUA 1PUZA 5C5JA 2HCFA 1IXRA 1Q78A 3JPPA 4UAYA 4WC3A 2XCPA 1DK2A 4DOCA 4XJEA 1L3TA 4NWIA 2K8AA 4MFCA 4FHXA 3PW7A 4F5RA 2LBOA 2ZJAA 1ZRNA 2BBJA 1ZQNA 1CUKA 2BKEA 2ZXHA 4PHEA 1S0OA 2G06A 3J81j 2IOHA 4MF2A 4WJ3B 2VIXA 3PY8A 3FC4A 2Z7JA 3ETRA 3ZDEA 2ZIUA 3CP8A 2ZH1A 1A6SA 4YFKA 3E0FA 4O9MA 4Z6FA 5DLGA 5CP2A 4PGYA 3ORYA 4C8KA 4NY8A 4XRHA 2GO7A 2GOLA 4OAIZ 2ZH5A 3I76A 4FBTA 3M8RA 5DBAA 1L7PA 5DBBA 3KHHA 3ZI4A 2WF5A 4YVZA 3DV9A 2H3QA 3BDPA 3C21A 3OGUA 2Y9TA 3UPSA 1ZQQA 3DDHA 2BZFA 2LM4A 3CNHA 2CXYA 2ZH3A 3G6XA 3QX7A 4IQUA 5JRTA 4F8RA 2K89A 2I1QA 5ALOA 2PFOA 4GC6A 4C80A 5EWFA 9ICIA 4ECRA 1SB3C 3LVWA 1IG6A 3H40A 2BCUA 1IM4A 1MQ2A 1RDFA 1F5SA 3TARA 1T8EA 1YZ6A 7ICVA 4P4PA 2M2UA 2BHNA 1Q3VA 9ICBA 1XSNA 4O5EA 2ODGA 1XU4A 4O69A 4WC5A 5D62A 1YZ7A 3FAHA 1LKYB 3JCFA 4QZGA 4DQIA 4NM1A 3K4GA 3H3AA 2W7PA 3H4BA 5KFFA 1NKEA 4MF8A 3GFKB 4DSEA 4NM2A 2DUYA 5KTQA 4OCZA 4J9RA 1ZQCA 2BGWA 2BCSA 1QLNA 5KFRA 1ZQPA 1WOTA 3MR5A 1SKWA 2VJ5A 4XQ7A 1DK3A 3OSNA 2EH9A 2QB0A 2KZMA 2QARA 2DPJA 3TADA 4QW8A 1NJYA 5ALWA 2A19A 2HSZA 4QIWF 4F4KA 4US8A 4DQQA 8ICSA 5L1KA 3UQ2A 2YB4A 3AMZA 2ISOA 3JYYA 5CA7A 3FYHA 2EAOA 3PW0A 2JEIA 2ZH7A 1X6IA 2BPFA 2YY6A 4KX3A 4YR0A 2UVRA 5ALNA 4P4MA 5AKXA 5J0PA 2KP7A 4PJ0U 2ZIVA 4O3NA 4O3SA 4XQ8A 4B9TA 5CFUA 1DGSA 1URJA 3QZ8A 4NLKA 3GDXA 2R8IA 2N1RA 4LEWA 2E8PA 3SI8A 2WF8A 2DR7A 3C29A 2DR5A 4YMMA 3ZDAA 5F3XB 5J0QA 3RFAA 3FDSA 4IRDA 1XSPA 2W3RA 3LQCB 1S76D 3L4PA 2Q0ZX 4EBCA 3ZDCA 2DKZA 2BPGA 5KFUA 3RBDA 4DFDA 3BS7A 9ICXA 5J2AA 2YMPA 3K75D 5CFSA 4KLOA 5CEHA 1BPBA 3M1YA 5BPCA 1ZQAA 4Z6DA 3GV5B 4BXOB 4JB3A 3C66A 4I2HA 3QUCA 3F2BA 5J2IA 1N60A 1B43A 3NVZA 1Q8KA 5ALSA 4EX7A 4CNQA 4LT6A 2EDUA 3H0RB 3BQ0A 2WF6A 2ZUBA 4NKTA 1J2MA 4JLXA 3L9DA 2WB1C 4O5CA 3GV8B 2B0CA 9ICGA 4B9SA 5HRFA 2OEHA 1XO0A 5ALKA 4F50A 3LK9A 4GIBA 4BJQA 7ICFA 4X4SA 3HWTA 3F5AA 2F8LA 1T4GA 3NGDA 4YMNA 1ZQMA 2HMXA 2E5SA 4K4IA 1T3QA 5AKGA 5CFTA 4BXOA 2FDRA 1ZJMA 4ATBB 2C28A 4I2AA 2KFNA 5KG1A 2W9BB 3H8WA 5EWGA 2KZZA 7ICHA 5CHEA 5HP4A 2KN7A 4KITB 1OXJA 2JR5A 5D46A 3E58A 3NVVA 3ISBA 1L7MA 4F5PA 1OW5A 3C18A 5IIKA 1ZQJA 4M9JA 1EXNA 1NZBA 3B0YA 1S0VA 2KSOA 1N56A 2R8HA 1TE2A 4OAHA 3EF2A 2M0NA 1QSYA 1XWLA 5AI6A 5ALFA 4RPZA 3Q8SB 2MAXA 3MC1A 4DL3A 4ICAA 3NUQA 3OHAA 2LYAA 3RB4A 3GU3A 1NK5A 3QUQA 2HOIA 4ATBA 1RQNA 2W03A 3IDWA 2K8BB 4JV1A 3PSPA 1K1QA 1X9WA 1VFGA 2YQEA 3KZIU 4KX5A 2UVVA 3HX0A 2AGPA 5AI0A 2LKYA 1PK3A 4CCHA 2CPRA 3CW2C 9ICWA 4UASA 2NRWA 8ICEA 4WC1A 2XICA 4CF3A 2HHTA 1R8AA 4F72A 5J0SA 3JPRA 5IILA 5HC9A 4Y2QA 4OD0A 4DQRA 4NLZA 5AIAA 2OH2A 3V72A 5IIIA 2L5YA 1V85A 2DRAA 2RP5A 5G5HA 3JPNA 4USAA 4QZAA 4EZ6A 1KNYA 2HOQA 3THVA 4EV6A 4E8FA 4Q43A 1UT8A 4C8OA 3QU2A 5AM5A 2PMZF 4EYIB 5IINA 1GPJA 2KTQA 3PNCA 4M0AA 2A1AA 4Y2RA 4OJOA 3T5KA 2Q4TA 5AKJA 2KMDA 1LB2B 1N5WA 2I6XA 3EWAA 8ICHA 4X4QA 1QH9A 3LWLA 3IN5A 4DL6A 2VKQA 5J0WA 4M2YA 3BQ2A 5KG3A 4DQPA 2XC9A 3B9JA 2WAQF 5GTHU 1KTQA 4FS1A 1QTMA 2WTFA 2YMQA 3PR4A 3MABA 4BWJA 5KFKA 5D4BA 1COKA 3AQFA 3HJEA 4YR3A 4PZNA 4DLGA 3S6JA 5G5GA 5DBCA 1WYGA 7ICOA 4WQLA 5KFHA 2PI4A 2KKVA 4EX6A 4KLMA 4CE6A 8ICZA 3I28A 4QZFA 2ZG6A 5J2JA 3H4DA 2NYVA 1SXDA 3EYZA 5D63A 2IMWP 4WC2A 2ZJ5A 4RT3A 1NK0A 1KL9A 2PFPA 1L8LA 2KJ8A 4PHPA 2KNJA 2Y1JA 2M2TA 1FEZA 1HEKA 1ZQTA 1ZJNA 4QZ9A 5J0RA 3SV4A 4C4SA 4GXIA 2YN4A 3PMNA 1FIQA 1RYRA 4Q8FA 8ICPA 4US9A 1F5AA 3OUYA 4EEDA 4WC7A 4LJXA 2BQRA 1RPLA 3WFOA 2HHXA 9ICVA 3TFRA 7ICEA 4RNMA 4O3QA 2W8KA 1NK4A 3HP6A 4LZGA 1X9MA 2F76X 3ED5A 4E7XA 4ED8A 5ALUA 5J0YA 5AK6A 7ICLA 1XO1A 4RNNA 2K4PA 5J8YA 2ASJA 2G08A 2KZ3A 2M9NA 1UT5A 5HHIA 4EGWA 4X5VA 2UVWA 4QWAA 4NLGA 3SAGA 1TFRA 2AGOA 4B9VA 4OO1J 2JZBB 3LDAA 4C4RA 3HILA 3WKAA 2AJQA 4FHYA 2HDOA 4Y2VA 2BQUA 2NRVA 1V38A 2MSNA 4Y2TA 3M9OB 4FO1A 2PFNA 3GIJA 5JU5A 2XIDA 4G3IA 1KEJA 2W55A 4IQTA 4FO6A 2JHDA 1S0MA 4DSKA 4NXTA 1PVQA 5KG7A 4RWQA 1PX5A 3PMLA 1L3UA 4EEBA 3TAQA 3C1YA 4RQ6A 1CEZA 2KK0A 1ZQWA 2F3NA 2JGAA 8ICWA 4KLLA 1MIYA 2NRKA 4ED7A 5J2GA 1U48A 1R8BA 4PL1A 1COOA 4LVSA 3MGHA 5KFEA 4AT9B 2D3DA 1KW4A 5ALZA 3JPQA 1R89A 9ICHA 1C7YA 4JWNA 4FBUA 4E80A 2E3TA 1RQLA 2JZBA 4FHPA 4RZRA 4KB6A 4QW9A 3SYZA 5KT4A 4UD4A 1F0MA 3V6HA 3H8SA 4WBZA 1DRGA 4ELVA 1X2IA 2JRZA 1B22A 3VC8A 3LVVA 3EPIA 1FFVA 4BX9C 2IHMA 4WOYA 2DGZA 2FJ6A 4ECUA 5DEDA 1SWWA 3KFUF 5L1IA 2EZXA 5DLFA 2JEFA 1UQVA 5EE1A 3SAFA 2JEGA 1R8CA 2C22A 3H8MA 5JTGA 2ZH8A 3SQIA 4K96A 3K7DA 4AT9A 3ER9B 2XO7A 4I2IA 4KLIA 3QUTA 3TAPA 3WK8A 4WH5A 2C2EA 4J9KA 3RBEA 5AK5A 1XS9D 4EENA 8ICMA 2DKXA 4F5OA 5AIBA 3QEAZ 3WK6A 1Z1VA 2KD1A 1KFTA 5B66U 2DFLA 5CRXA 3PW4A 5AM2A 5HRHA 3M7DA 4Y2YA 3UMCA 2FCLA 4NXXA 2ZHAA 3DEEA 2ZUDA 2XGPA 3MGVA 1TFWA 1WWUA 1RYUA 1HJPA 3ERCC 2LYHA 2Y1IA 4F91B 4P0QB 1L5UA 4QWDA 4QZ8A 1KKXA 5KT5A 4ECQA 4QZBA 4I28A 1WG8A 4DSFA 8ICVA 4UAWA 5AM3A 1L7NA 2AHOB 5KL8B 4DOAA 5KFDA 4QZEA 3AQEA 4EBKA 4PGQA 1TVAA 2ZIXA 3OVAA 4M9HA 3RJJA 4Y2UA 4HAIA 2WB1F 5ALJA 5HRGA 4Q44A 5AI4A 1CRXA 2W54A 1Z4OA 3WK4A 1JXLA 8ICAA 2BCVA 3UXPA 4F3OA 1BNPA 5AKYA 3PX0A 3LYSA 4P0QA 4YP3A 3N7PD 2HHQA 4DSIA 3MCRA 4Z6CA 3L3FX 2I5HA 4CF4A 2E8MA 2ALZA 2R18A 2XY5A 5HR9A 4YMOA 3A0HU 4C8LA 2K4EA 4UARA 4RQ3A 2QB0B 3RAQA 2PKEA 2QARB 2ZH2A 2F1IA 2Y0SF 4LZDA 1X66A 4YG2A 4YXMA 3C2LA 2CRXA 5L9XA 3OTQA 3NRWA 4RWOA 2PXIA 3K1RB 9ICSA 3UMBA 4DL5A 5KT7A 2FE9A 1ZQUA 1J97A 1ZQYA 4RQMA 4J9PA 2W9AA 2BR0A 4O3RA 2ZIVB 5KFXA 3RJFA 4M6WA 5J0TA 5ALQA 5AHXA 4AYBC 2XI9A 5HR7A 4AP9A 1UA0A 2I9GA 1QQ5A 3Q8MA 4KLUA 1N63A 1C20A 4EBEA 4UBBA 3IHQB 9ICAA 2GH1A 5J0XA 5J2CA 2GLEA 4OJPA 5J2FA 5F2VO 3WU2U 2JH7A 3Q8PB 4Q8EA 5J2HA 3NWIA 1L3VA 3K1ZA 2ESEA 1NOMA 5KFGA 1ZQHA 1AQ6A 5C0YA 7ICKA 4UB6U 2XCAA 3T5LA 4M04A 2FLNA 2NRXA 2LPEA 4NKUA 4AT7A 3WKDA 4C8NA 2RLTA 2F44A 4Z6EA 4RU9A 5JTIA 1M6YA 4DFPA 1BPXA 4GFJA 2MU2A 1D8BA 3RH5A 2ASDA 4PGXA 2J6UA 3SV3A 4J9OA 4FHVA 4WBYA 3MFHA 4B9MA 3D2NA 3HJ4A 5KFOA 1S9FA 3RJIA 3RH4A 4JLZA 4IR9A 4X4PA 4K97A 2E8OA 4KMUA 3O0FA 4M5DA 4PZOA 3PO4A 4DLEA 2ZHBA 5B3PA 3GZFA 5DB7A 3IG5A 1SL0A 2EWRA 3D2SA 2AQ0A 3IG8A 2EZZA 3PSIA 7ICMA 3RJHA 2E1FA 1TAMA 4G9BA 4UAUA 1NK7A 5F9NA 7ICRA 3LWMA 4NXWA 3ZDDA 1JXEA 4WC0A 3QEBZ 1D8YA 1ED1A 2KIWA 4JMUA 3JPSA 2KSOB 2YX8A 4KN4A 5KT6A 3GIKA 4MEXA 2D8CA 3KHRA 2RFFA 3C1ZA 4PH5A 5J8YC 3AEVA 3U26A 4QWBA 5ALEA 2HBKA 5J2EA 4TQRA 9ICLA 1S10A 1SZHA 1RXWA 1U49A 5H2FU 5KG2A 5J2BA 4WCWA 8ICNA 3EPGA 3PW2A 3ALRA 2Y0SC 4EELA 2FLPA 2AGQA 1BPZA 3GIMA 1H38A 1ZD2P 1ZRMA 1K5OA 3QUBA 2P6UA 4N7RA 5D61A 1OUQA 1CI4A 1DXSA 2AH5A 2OWOA 1A0PA 3RRHA 3UXNA 5DQGA 2FMSA 2DQNB 2Y9UA 1N61A 5DGAA 1KQQA 1ZQLA 5AK3A 3M6KA 3M6ZA 5AKIA 3QE9Y 8ICKA 4EZ9A 4KLGA 3MR2A 3T5HA 8ICLA 2EAPA 3A0BU 3QYPA 5KAIU 2HHUA 4ZH4A 1ZD4A 4GC7A 3FM9A 2IBKA 3WK7A 1WUDA 3MDAA 3F53A 2O5AA 1X40A 5DB6A 5D49A 1S5LU 4ECZA 4O3MA 3Q8KA 5DQHA 3C2KA 1KRPA 9ICRA 4MKPA 5L1MA 3F5EA 4QZDA 3IP4B 2MA1A 1ZQVA 4ELTA 2KOBA 4PHDA 4X4TA 3NYBA 4RQNA 2F77X 2LHTA 3H0LB 5KAFU 1GO3F 4NXUA 2W8LA 2PFQA 2DR9A 4X4RA 2OHFA 3EZ5A 3RRGA 4UB5A 1KFDA 1O03A 9ICTA 3T5JA 1A76A 2F2AB 4O5KA 3AL0B 3PR5B 1SL1A 2H3IA 1JALA 5DG8A 4IQVA 2Q66A 5KFQA 4IR1A 2QB1A 5J2DA 1FFUA 4S3NA 3OUYB 1V9PA 3QU7A 2B21A 2YMLA 5J2KA 3GV7B 2IOFA 3C5FA 3SENA 4XUSA 4O6AA 3NRZA 4O3OA 4RQ8A 2ZIWB 1WCNA 2B4VA 3UM9A 5KT2A 4GXKA 2V4RA 5KG0A 1V97A 2V4QA 2NRZA 1TKDA 3RR8A 4ECWA 3PSTA 5KFWA 5TZVA 4CGZA 2QKQA 4DO9A 4WC6A 8ICRA 1QQ7A 4J9QA 1MA7A 3MDCA 4R63A 1L8OA 4DF4A 3UMGA 1JN3A 4MFFA 7ICNA 4J9LA 4ED6A 9ICUA 1VDVA 2M2WA 1QSSA 3ER8C 1ZQKA 2YTUA 2NV3A 3PV8A 5J0OA 2ZTCA 5AICA 5DECA 7ICTA 4DFKA 4ECVA 5HMLA 1PZNA 3ISCA 2ZIWA 3NASA 4I2EA 5KFJA 4QZIA 1ZQIA 4ELUA 3PO5A 3TANA 2G09A 4F4ZA 3BQ1A 3TI0A 3OJSA 5CHGA 4DQSA 1Q3UA 4QZCA 4NV0A 1WWVA 4UATA 2HHPA 4DSLA 4FZLA 4NXZA 2FI1A 4P0PA 2FMQA 5ALPA 2WFAA 1N62A 4I2GA 2ZUCA 5KFMA 2RDJA 3BJYA 3TADC 4UQGA 2ZTDA 1U45A 3RJEA 4DF8A 1IIPA 5DGBA 4B9UA 1X9SA 4CRXA 3AQMA 3QU9A 5AM4A 4KM5A 1JROA 2KV2A 1ZQBA 4I29A 2KICA 3WFSC 1J2NA 2BCQA 3SMVA 3M8SA 4FHWA 1S97A 3RH6A 2JMGA 2BBHA 3SR6A 4PHAA 5EE3A 3N7RC 4RUCA 4FZMA 1KSPA 1ZQOA 5ALVA 2LM1A 2YB1A 7ICSA 1K1SA 4KLSA 1WCLA 3KZXA 3SAHA 4IG8A 3OHBA 5HRIA 4AT8B 4F4XA 3RF9A 3KTQA 4AYBF 1NO5A 1UHUA 5ALHA 4F2RA 3PSFA 2FLLA 4OJ6A 5KFNA 1UETA 1D8LA 5AKZA 1KN5A 1ZQ1C 4QWCA 3ZD8A 2G0AA 1KFSA 5KFYA 1HIWA 1RZTA 1LVHA 4KLDA 1U4BA 2MUTB 4JV0A 8ICGA 4QJFB 1VLBA 3H0MB 3AQLA 2ZJ8A 4UB4A 1RG6A 3GILA 1NKBA 4QNLA 4QWEA 4IQWA 5AM0A 2HOFA 3TFSA 1FA0A 4GXJA 2IA6A 3N4MB 5L1LA 2E1EA 4NXVA 3R9KA 2A1JA 1YLQA 4O3PA 2ZH9A 4ECYA 4AT8A 2KVCA 2ASLA 3RR7A 3D2QA 3ETLA 4GLXA 1XSLA 5K4LA 2ZIXB 1LV5A 4F4YA 3TQ1A 3BS5B 1MIVA 3G6VA 3BQ7A 1NJWA 3MR3A 2DR8A 1NZPA 4M47A 2CN1A 1TFYA 2ZXIA 1BNOA 5TISU 3SD7A 2MUTA 2PBEA 2K4IA 3V7JA 4JWMA 5KFPA 4IRCA 2AQ4A 4Y2SA 2VA2A 5F9LA 3PW5A 1Z19A 2HBLA 4M9GA 3OSPA 1JI7A 4P2HA 2VANA 2W9MA 2R8GA 4YCXA 1X42A 3RB6A 3OVSA 2BPCA 3BS5A 5EOZA 4PL2A 4R66A 4ED1A 2BCRA 3WFQE 3BZKA 5HRKA 4RQ4A 5B3QA 1KBUA 5FP0A 1F44A 4F92B 8ICIA 1P7DA 2HBJA 2HI0A 2ISPA 1MC8A 1Z1BA 4C7ZA 4IC9A 4F93B 1HUOA 2HHSA 1MQ3A 3N28A 1SIJA 7ICPA 3RTVA 4DCCA 4IRKA 5CR0A 2DF4B 3WKBA 1U47A 1UCVA 2P6RA 2OM6A 4UW9A 4DEZA 5AKKA 1D9FA 2JXJA 2C2RA 4KLTA 9ICQA 4M6WB 3BZCA 2J6TA 5KFIA 4F2SA 1YT3A 9ICCA 2EQYA 2BDPA 1ZQZA 2HVIA 2JV3A 4KTQA 4LEYA 5KG5A 2HN1A 1MSWD 1SKSA 3WFRE 4DFMA 2A3VA 4K99A 3KKAA 4U7CA 3KD3A 5KFAA 4RT2A 1SKRA 3CRXA 5AKLA 4I27A 2FMPA 5A0LA 3PVXA 5EWEA 3AN1A 2EZYA 2ZTEA 5HRDA 5HRBA 3EW9A 5HNKA 9ICKA 2NO4A 2GWSA 3MGIA 4NLCA 3EUB2 3C5GA 2W9CB 3WK9A 4I2FA 3HIYA 3QZ7A 2BDUA 4CDGA 2R8JA 4MEYA 4TUSA 4AT7B 1QCKA 8ICXA 8ICTA 2F1JA 4RWPA 2J6SA 2D6FC 4KLHA 4JUZA 4K9AA 5KG4A 1HUZA 4DSJA 5HR6A 4HYKA 1SV0A 4NL9A 5ALGA 4O0IA 2XVTA 2DPIA 4M9NA 5AKHA 1KDHA 1NK6A 3UQ0A 4RWNA 2WF9A 7ICGA 1T94A 1JIHA 4LEZA 2HN2A 5KFLA 2C2DA 2W9CA 5KFCA 4K9BA 1X6JA 3PX6A 4NLNA 1JUDA 1LKYA 2LI6A 5HREA 2F8KA 3KHGA 1VJ7A 2QLTA 3AM9A 4RUAA 8ICFA 8ICBA 1Q46A 1BGXT 4UB1A 4BDPA 3QNMA 4I2BA 2EAMA 5KT3A 3TKAA 1ZXIA 3HT3A 2JH1A 3OPXA 4FH3A 3HJ1A 4FH5A 1Z3EB 3RJKA 1ZQSA 4FFDA 5CWRA 4LEVA 1L7OA 3L5KA 2OCEA 2R8KA 1QQ6A 8ICOA 4KN7A 4IS7A 2H5XA 3WFPA 2DBYA 3Q8RB 2VJ4A 3RB3A 1NJZA 3GQCA 4UD5A 3PHZA 3V6JA 4UB2A 2RHFA 3AQKA 4C4TA 1ZETA 2RRDA 4WC4A 4DL4A 3NKUA 4UAVA 2IHOA 2W3SA 4NLBA 3HKZF 4KLQA 2P35A 1NNLA 3AU2A 5KG6A 5DB9A 2O6KA 1XC9A 4O68A 2NRTA 2M2VA 4UB3A 1SL2A 2K60A 4ECTA 5BOLA 1N48A 2KJ9A 4BUGA 5ALDA 3KBBA 2LYBA 5J0UA 3JZ0A 2KEYA 2DVIA 3OV7A 3AUOA 2W04A 2HHVA 8ICQA 4DL2A 3OWGA 4KLFA 5HMMA 1DOQA 2B51A 1RM6C 3T3FA 1PVRA 4DWIA 1AROP 1XNSA 2HVHA 5IIJA 4XA5A 4TUQA 1MIWA 1ZQRA 2IUBA 5KFZA 4RQ0A 1OU5A 5EE9A 4ACOA 4ED3A 1T3NA 2KIVA 4R64A 3NVOA 4ECXA 4B9NA 1JAJA 5AK4A 4CF5A 2KJ5A 1FO4A 3VCBA 3Q8QB 1ECWA 1T7PA 5KFBA 3V7KA 5B5EU 8ICCA 8ICJA 2E8NA 4R65A 4I0UA 3ZD9A 1SGGA 3C23A 5DB8A 3RJGA 2KG5A 4DS5A 1MN8A 4F4WA 3PZPA 1UEVA 4FS2A 3UPQA 3NVYA 5KL1B 2ES6A 2AU0A 2W9BA 2WHEA 7ICJA 1SWVA 2ZH4A 4DOBA 4NJ8A 2JEJA 4OAFA 1UA1A 2G5IB 2XY6A 3AU6A 3GIIA 1QSLA 2NO5A 2FPMA 2IHNA 4DL7A 1Q79A 2AXTU 4Y2XA 2KVSA 4QIWC 5AI5A 3QXGA 3ONNA 4JK1A 3M9NB 2IOFK 3H37A 5AM1A 4PPXA 1TAQA 3KOOA 3PX4A 4A8EA 3TACB 4OJ5A 1L3SA 9ICPA 3NTUA 4I2DA 3JPOA 4JV2A 5HHHA 3C28A 2PI5A 7ICUA 2KHVA 2XY7A 3E2EA 1ZYQA 2O1PA 4Y2JA 2DWQA 1TAUA 9ICMA 2FPKA 3MFIA 4FE3A 5EE0A 5J29A 5HRLA 2GA9D 3H38A 4X0AA 5AI8A 5ALLA 4X0BA 3CK6A 2FPLA 2MRLA 2KKPA 1ZQFA 3NS1A 4ECSA 4WQKA 4EP7A 5KFSA 5DKWA 3N97B 1PK1B 3QU5A 5DDYA 3Q8LA 2BQ3A 5KFVA 1JRPA 3D6JA 1KLNA 4K4GA 9ICNA 4X4UA 3IM1A 5ALYA 3SEIA 2W11A 3H39A 5BOMA 2ZH6A 4EBDA 1TK5A 1NI3A 4K4HA 1NK9A 3HKZC 1S0NA 1ZQEA 7ICQA 4MHVA 3WK5A 4C0ZA 5IIMA 1ZQDA 2B56A 5DG7A 4RQ2A 3M9MB 1DGJA 4YXJA 3IRUA 4J9MA 2EANA 1V4AA 2H3VA 5DQIA 2ID1A 4P0PB 4QZHA 2UVUA 4O67A 4J9NA 7ICIA 1BVSA 1PK1A 4FZNA 2BE3A 2WF7A 1B0XA 1X9XA 5ALTA 4J9SA 4C8MA 1SXEA 3N7SC 4E0DA 5T14A 5ALMA 1TV9A 4MFAA 5JUMA 3HPOA 1TK8A 3KKAC 1NJXA 3OVBA 2DL0A 3SZ2A 5CJ7A 4Q45A 4X4NA 3F2CA 2G5HB 3ICXA 3C2MA 4R8UB 3RB0A 4ED0A 4KMOB 4RNOA 4RPYA 4RQ7A 4RPXA 2KFZA 1U9LA 1Z4NA 2RQ5A 1SV4A 5AI9A 4EYHB 4UBCA 1ZD3A 3ISDA 8ICUA 5ALXA 1IV8A 3MBYA 2VA8A 4KLJA 4YQWA 4KLEA 3QU4A 4EEYA 3IV6A 8ICYA 3JPTA 4OAGA 4DS4A 2HBMA 3NVWA 1Z00B 1SZPA 2HHWA 3V6KA 2B6GA 4F5NA 1RXVA 4U6PA 4TURA 9ICOA 4I2CA 3H7IA 4YD1A 1BPEA 5GTIU 4TUPA 1PVPA 4X4OA 4M9LA 4HX0A 1ZOLA 3I1YA 2RDIA 3T79A 1SV0C 1Y88A 5L1JA 4NL9C 1BPYA 4R8UA 4OJLA 1JMSA 5KFTA 3BQTA 1B4FA 1BPDA 9ICJA 4B6JA 1N2XA 2HW3A 1JQRA 2H3ZA 1NKCA 2LMRA 2K4HA 4EEKA 2W43A 1JX4A 1ZQGA 4DFJA 4BGDA 4RQ1A 2A1JB 4P4OA 4ED2A 2K8CB 3HRDD 1VJ5A 3UXOA 1Z00A 2KE7A 1RYSA 1S77D 2VA3A 3AQNA 4IL6U
chains in the Genus database with same CATH topology
4WC0A 3QEBZ 3H8JA 9ICFA 1LB2B 3EWAA 8ICHA 1D8YA 9ICEA 4X4QA 4KTQA 5KG5A 4EBJA 3LWLA 1TK0A 3JPSA 4DL6A 3B0XA 4TQSA 4KN4A 1MSWD 3V7LA 5J0WA 1SKSA 3WFRE 4DFMA 4M2YA 3BQ2A 5CB1A 5KG3A 4I2JA 5KT6A 3GIKA 4MEXA 3KHRA 2RFFA 5KFAA 4DQPA 4YN4A 3C1ZA 4RT2A 4PH5A 2XC9A 4QWBA 1SKRA 1A77A 1KTQA 4I27A 4FS1A 2F1HA 2FMPA 3PVXA 5IIOA 5J2EA 1QTMA 2WTFA 4TQRA 5DG9A 5EWEA 3PR4A 5HRDA 9ICLA 2ZTEA 3MABA 4BWJA 5HRBA 5KFKA 5D4BA 1S10A 3EW9A 4YD2A 5HNKA 9ICKA 1RXWA 2GWSA 1U49A 4YR3A 3MGIA 3C5GA 4DLGA 2V9WA 5KG2A 5DBCA 7ICOA 2W9CB 5J2BA 4WCWA 1NK8A 4I2FA 5KFHA 3RAXA 3HIYA 3QZ7A 2ATLA 2PI4A 8ICNA 2IA6A 4O9MA 2XGQA 4X4VA 4KLMA 2R8JA 3EPGA 4MEYA 2P66A 3PW2A 4QZFA 4TUSA 8ICZA 4AT7B 3MR6A 3G6YA 8ICXA 5J2JA 4B9LA 4BWMA 2FLPA 3H4DA 1ZQXA 3ZDBA 3HW8A 8ICTA 4RQ5A 2F1JA 3EYZA 5DDMA 2J6SA 3KHLA 1D9DA 4RWPA 2AGQA 4UAZA 2IMWP 4WC2A 4KLHA 4JUZA 2ZJ5A 4RT3A 4F5QA 1NK0A 5KG4A 1HUZA 1BPZA 4DSJA 3GIMA 1H38A 4YR2A 1UEUA 2PFPA 4PHPA 4HYKA 2Y1JA 2M2TA 3OJUA 2P6UA 5C5JA 4O0IA 1ZQTA 2DPIA 3OVAA 1IXRA 4M9NA 1Q78A 1ZJNA 4QZ9A 1KDHA 5J0RA 3JPPA 4UAYA 3SV4A 4WC3A 4GXIA 2XCPA 1NK6A 1DK2A 4DOCA 3UQ0A 2OWOA 3PMNA 3RRHA 3UXNA 4RWNA 1RYRA 1L3TA 4Q8FA 8ICPA 1F5AA 5DQGA 2FMSA 7ICGA 3OUYA 4WC7A 1JIHA 5DGAA 1ZQLA 5KFLA 4MFCA 2BQRA 1RPLA 2C2DA 4FHXA 2W9CA 5KFCA 3PW7A 2HHXA 4F5RA 3WFOA 3QE9Y 8ICKA 9ICVA 3PX6A 4NLNA 4EZ9A 2ZJAA 4KLGA 3MR2A 3T5HA 3TFRA 7ICEA 1ZQNA 8ICLA 3KHGA 5HREA 4RNMA 1CUKA 2BKEA 2HHUA 4O3QA 4PHEA 2W8KA 1VJ7A 2KP7A 4ZH4A 4RUAA 1NK4A 8ICFA 1S0OA 8ICBA 4GC7A 2IBKA 1BGXT 3HP6A 4UB1A 4BDPA 3MDAA 4LZGA 2O5AA 4I2BA 1X9MA 4MF2A 5KT3A 3PY8A 4E7XA 4ED8A 3ZDEA 5DB6A 5D49A 4ECZA 3HT3A 5J0YA 7ICLA 4FH3A 3Q8KA 2ZH1A 4YFKA 3HJ1A 4FH5A 5DQHA 3C2KA 1Z3EB 1XO1A 4Z6FA 5DLGA 5CP2A 4RNNA 1ZQSA 5CWRA 4PGYA 2ASJA 1KRPA 3RJKA 3ORYA 4I2EA 9ICRA 2R8KA 2KZ3A 2M9NA 4C8KA 4NY8A 1UT5A 5HHIA 8ICOA 4QZDA 4X5VA 2UVWA 4XRHA 4KN7A 4QWAA 2ZH5A 2H5XA 4NLGA 3WFPA 4FBTA 1TFRA 2AGOA 4B9VA 1ZQVA 4ELTA 3M8RA 2JZBB 3LDAA 3Q8RB 2AJQA 1NJZA 3RB3A 5DBAA 4PHDA 4FHYA 3GQCA 5DBBA 4UD5A 3KHHA 2BQUA 4X4TA 2DVIA 2NRVA 3NYBA 3V6JA 4UB2A 4I2CA 4YVZA 3AQKA 3M9OB 1ZETA 2PFNA 3GIJA 3BDPA 3C21A 4G3IA 4WC4A 4DL4A 2W8LA 2PFQA 1KEJA 3OGUA 4IQTA 4FO6A 3UPSA 4X4RA 1ZQQA 2DR9A 3EZ5A 1S0MA 4DSKA 5KG7A 4RWQA 1PX5A 2ZH3A 3G6XA 3RRGA 3PMLA 4IQUA 4KLQA 1L3UA 3AU2A 4UB5A 3TAQA 4F8RA 1KFDA 2I1QA 3C1YA 4RQ6A 9ICTA 5KG6A 5DB9A 1CEZA 1ZQWA 8ICWA 3T5JA 2PFOA 4KLLA 1MIYA 1XC9A 2NRKA 4ED7A 5J2GA 2NRTA 1U48A 4UB3A 2M2VA 1A76A 4GC6A 1SL2A 1R8BA 5EWFA 4O5KA 9ICIA 4ECRA 1COOA 4ECTA 4LVSA 5BOLA 3PR5B 3MGHA 1SL1A 5KFEA 1N48A 4AT9B 3H40A 2BCUA 1IM4A 5DG8A 3JPQA 1MQ2A 4IQVA 1R89A 9ICHA 1C7YA 4JWNA 2Q66A 5KFQA 4IR1A 3TARA 1T8EA 4FBUA 4E80A 5J0UA 7ICVA 3JZ0A 2JZBA 4P4PA 2M2UA 5J2DA 2BHNA 4FHPA 4S3NA 3OUYB 1V9PA 4RZRA 4QW9A 9ICBA 1XSNA 3SYZA 5KT4A 3OV7A 2B21A 4O5EA 3AUOA 4UD4A 2HHVA 8ICQA 4DL2A 5J2KA 1XU4A 3H8SA 3GV7B 3C5FA 3V6HA 4WBZA 4WC5A 4XUSA 4KLFA 4RQ8A 4O3OA 4ELVA 1X2IA 5HMMA 4QZGA 4DQIA 1B22A 1WCNA 4NM1A 1DOQA 3K4GA 5KT2A 3EPIA 3T3FA 3H3AA 4DWIA 4GXKA 2V4RA 2IHMA 1AROP 5KG0A 2HVHA 5IIJA 4XA5A 4TUQA 3H4BA 1MIWA 2V4QA 2NRZA 1TKDA 1ZQRA 4ECUA 3RR8A 5DEDA 4ECWA 5KFFA 1NKEA 5KFZA 4MF8A 5L1IA 5DLFA 2JEFA 5KFWA 3GFKB 4DSEA 5TZVA 4NM2A 4DO9A 5KTQA 4WC6A 4RQ0A 1OU5A 4J9RA 1ZQCA 2BGWA 8ICRA 4J9QA 4ED3A 2JEGA 1R8CA 2BCSA 2C22A 3MDCA 1QLNA 5KFRA 4R63A 1ZQPA 1T3NA 1WOTA 2ZH8A 4R64A 4DF4A 4AT9A 1JN3A 3MR5A 4MFFA 7ICNA 1SKWA 2XO7A 4I2IA 4J9LA 4ECXA 4ED6A 4B9NA 4KLIA 9ICUA 3TAPA 2M2WA 1JAJA 4XQ7A 3OSNA 1DK3A 2C2EA 1QSSA 4J9KA 3RBEA 1ZQKA 1XS9D 3Q8QB 2KZMA 1T7PA 5KFBA 3V7KA 3PV8A 2DPJA 8ICMA 5J0OA 2ZTCA 4F5OA 3QEAZ 4QW8A 1NJYA 8ICCA 1KFTA 5DECA 2DFLA 4F4KA 4DFKA 8ICJA 4DQQA 3PW4A 7ICTA 8ICSA 5L1KA 3UQ2A 5HRHA 4ECVA 5HMLA 4R65A 2ISOA 3JYYA 3ZD9A 2ZHAA 1PZNA 3C23A 5CA7A 5DB8A 3ISCA 2ZUDA 3FYHA 2XGPA 4F4WA 4DS5A 3RJGA 5KFJA 4QZIA 3PW0A 1ZQIA 4JV1A 4FS2A 3PO5A 3UPQA 4ELUA 1UEVA 1TFWA 1HJPA 3TANA 2JEIA 2LYHA 2ZH7A 2Y1IA 2BPFA 4F91B 4YR0A 2AU0A 4QWDA 4QZ8A 1L5UA 2UVRA 4P4MA 4F4ZA 5KT5A 3BQ1A 4ECQA 4QZBA 3TI0A 4I28A 3OJSA 5J0PA 4DSFA 2W9BA 4O3NA 8ICVA 5CHGA 4O3SA 4XQ8A 4B9TA 4UAWA 4DOAA 7ICJA 1DGSA 4DQSA 3QZ8A 4QZCA 4NLKA 5KFDA 3GDXA 4QZEA 2R8IA 2ZH4A 4DOBA 2JEJA 2HHPA 3SI8A 4DSLA 2DR7A 4NXZA 1UA1A 4EBKA 2XY6A 3AU6A 2DR5A 4PGQA 1TVAA 4YMMA 3ZDAA 3GIIA 5J0QA 1QSLA 2FMQA 3FDSA 2FPMA 1XSPA 4DL7A 2IHNA 4IRDA 4M9HA 4I2GA 3LQCB 1S76D 1Q79A 2ZUCA 5KFMA 3RJJA 3M9NB 2Q0ZX 4JK1A 2RDJA 3H37A 3BJYA 4UQGA 1U45A 2ZTDA 4PPXA 2HVIA 3RJEA 1TAQA 4EBCA 4DF8A 5HRGA 4Q44A 3PX4A 3ZDCA 2BPGA 5DGBA 4B9UA 1X9SA 3AQMA 1L3SA 5KFUA 9ICPA 3NTUA 4I2DA 3RBDA 1JXLA 3JPOA 1ZQBA 4I29A 4JV2A 8ICAA 9ICXA 3WFSC 5J2AA 2BCVA 3K75D 5HHHA 3UXPA 2BCQA 4F3OA 1BNPA 3PX0A 4KLOA 1BPBA 2PI5A 7ICUA 3M8SA 5BPCA 4YP3A 2XY7A 1ZQAA 4Z6DA 3RH6A 3GV5B 1S97A 2HHQA 4BXOB 3E2EA 3C66A 4DSIA 4I2HA 1ZYQA 2O1PA 4PHAA 5J2IA 4RUCA 1KSPA 1ZQOA 1B43A 1TAUA 4LT6A 9ICMA 2FPKA 4Z6CA 3MFIA 5J29A 7ICSA 1K1SA 4KLSA 3BQ0A 5HRLA 2ZUBA 3H38A 1WCLA 4NKTA 4X0AA 4IG8A 2ALZA 3OHBA 4X0BA 5HRIA 2XY5A 2FPLA 5HR9A 4AT8B 4F4XA 3L9DA 4YMOA 3KTQA 1ZQFA 4C8LA 4ECSA 4EP7A 4O5CA 5KFSA 3GV8B 1NO5A 4RQ3A 5DKWA 3N97B 4B9SA 9ICGA 4F2RA 5HRFA 5DDYA 2FLLA 3Q8LA 3RAQA 2BQ3A 5KFVA 4F50A 3LK9A 2F1IA 2ZH2A 4LZDA 5KFNA 1KLNA 4K4GA 7ICFA 4YG2A 9ICNA 4X4SA 4X4UA 4YXMA 3HWTA 1UETA 1D8LA 1T4GA 4QWCA 3ZD8A 3C2LA 3NGDA 1KFSA 3IM1A 5KFYA 4YMNA 1RZTA 1ZQMA 2DRAA 4KLDA 3H39A 4K4IA 5BOMA 1U4BA 2ZH6A 2MUTB 5L9XA 4JV0A 4EBDA 1TK5A 8ICGA 4K4HA 1NK9A 3AQLA 4BXOA 1S0NA 1ZQEA 1ZJMA 7ICQA 2ZJ8A 4UB4A 4RWOA 4ATBB 2PXIA 3GILA 2C28A 1NKBA 4I2AA 9ICSA 4DL5A 5KT7A 4IQWA 4QWEA 2KFNA 1ZQUA 3TFSA 1FA0A 2BR0A 1ZQYA 5KG1A 2W9AA 4J9PA 4GXJA 2W9BB 3H8WA 5EWGA 5L1LA 5IIMA 3N4MB 1ZQDA 5KFXA 2KZZA 7ICHA 5DG7A 3RJFA 4RQ2A 2KN7A 4M6WA 5HP4A 4KITB 3M9MB 5J0TA 5D46A 3ISBA 2A1JA 1YLQA 4O3PA 4YXJA 4ECYA 2ZH9A 4AT8A 4J9MA 1UA0A 1V4AA 5DQIA 2ASLA 3RR7A 2I9GA 4F5PA 2ID1A 3ETLA 4GLXA 1XSLA 3C18A 5IIKA 4QZHA 2UVUA 1LV5A 3Q8MA 4J9NA 7ICIA 4F4YA 3TQ1A 1ZQJA 4KLUA 4M9JA 1EXNA 1BVSA 3B0YA 3G6VA 1NJWA 1MIVA 1S0VA 2BE3A 4EBEA 1N56A 3MR3A 2R8HA 2DR8A 4J9SA 4UBBA 4C8MA 1QSYA 4E0DA 4O3RA 1XWLA 3IHQB 1TV9A 4M47A 1NZPA 4MFAA 5JUMA 3HPOA 9ICAA 4RPZA 1TK8A 3Q8SB 5J0XA 2MAXA 5J2CA 1TFYA 5J2FA 1NJXA 4DL3A 1BNOA 3OVBA 2HHWA 2MUTA 2PBEA 5F2VO 3SZ2A 5CJ7A 3Q8PB 3V7JA 4Q45A 4JWMA 3OHAA 5J2HA 4Q8EA 4X4NA 5KFPA 4IRCA 3C2MA 4R8UB 3RB0A 3RB4A 1L3VA 1NK5A 4ATBA 4ED0A 2AQ4A 4FHWA 4RNOA 2VA2A 4RQ7A 5F9LA 4RPXA 4RPYA 1U9LA 1K1QA 1NOMA 5KFGA 3PW5A 1X9WA 2KFZA 1VFGA 4EYHB 4UBCA 3HX0A 2AGPA 1ZQHA 2UVVA 3ISDA 8ICUA 7ICKA 3MBYA 2VA8A 4KLJA 4YQWA 4M9GA 4KLEA 2XCAA 3OSPA 4P2HA 3T5LA 4M04A 2VANA 2FLNA 4EEYA 4CCHA 2DRBA 2NRXA 9ICWA 8ICYA 2W9MA 3JPTA 4YCXA 4DS4A 3RB6A 2R8GA 4AT7A 3OVSA 4NKUA 2NRWA 8ICEA 2BPCA 4WC1A 5EOZA 1Z00B 1SZPA 4C8NA 4R66A 4Z6EA 4RU9A 4ED1A 3V6KA 4DFPA 1BPXA 2BCRA 4RQ4A 5HRKA 3WFQE 4F5NA 1RXVA 4TURA 2HHTA 9ICOA 1R8AA 3RH5A 2ASDA 4F92B 5J0SA 3JPRA 3H7IA 4YD1A 1BPEA 4TUPA 4PGXA 5IILA 2J6UA 8ICIA 4X4OA 5HC9A 4M9LA 3SV3A 4J9OA 2RDIA 4DQRA 4FHVA 4NLZA 4WBYA 3V72A 1Y88A 3MFHA 5L1JA 1BPYA 2ISPA 4B9MA 5IIIA 1MC8A 3HJ4A 5KFOA 4R8UA 4F93B 1S9FA 3RJIA 3RH4A 1HUOA 1JMSA 1MQ3A 5KFTA 2HHSA 4IR9A 4X4PA 7ICPA 3BQTA 3RTVA 4KMUA 3JPNA 1BPDA 4M5DA 3PO4A 4IRKA 5CR0A 4QZAA 9ICJA 4DLEA 4EZ6A 1KNYA 1U47A 2HW3A 2P6RA 3THVA 1JQRA 2ZHBA 4E8FA 4Q43A 4DEZA 5DB7A 1NKCA 1SL0A 2AQ0A 1D9FA 1UT8A 4C8OA 1ZQGA 2C2RA 1JX4A 4KLTA 9ICQA 4M6WB 4EYIB 4DFJA 3RJHA 4BGDA 4RQ1A 5IINA 7ICMA 2A1JB 4P4OA 2KTQA 2J6TA 4ED2A 1NK7A 5KFIA 5F9NA 3PNCA 4M0AA 7ICRA 4F2SA 3LWMA 3UXOA 1Z00A 3T5KA 1RYSA 1S77D 9ICCA 2VA3A 2BDPA 3ZDDA 3AQNA 1ZQZA 1JXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC0 A;  3QEB Z;  3H8J A;  9ICF A;  1LB2 B;  3EWA A;  8ICH A;  1D8Y A;  9ICE A;  4X4Q A;  4KTQ A;  5KG5 A;  4EBJ A;  3LWL A;  1TK0 A;  3JPS A;  4DL6 A;  3B0X A;  4TQS A;  4KN4 A;  1MSW D;  3V7L A;  5J0W A;  1SKS A;  3WFR E;  4DFM A;  4M2Y A;  3BQ2 A;  5CB1 A;  5KG3 A;  4I2J A;  5KT6 A;  3GIK A;  4MEX A;  3KHR A;  2RFF A;  5KFA A;  4DQP A;  4YN4 A;  3C1Z A;  4RT2 A;  4PH5 A;  2XC9 A;  4QWB A;  1SKR A;  1A77 A;  1KTQ A;  4I27 A;  4FS1 A;  2F1H A;  2FMP A;  3PVX A;  5IIO A;  5J2E A;  1QTM A;  2WTF A;  4TQR A;  5DG9 A;  5EWE A;  3PR4 A;  5HRD A;  9ICL A;  2ZTE A;  3MAB A;  4BWJ A;  5HRB A;  5KFK A;  5D4B A;  1S10 A;  3EW9 A;  4YD2 A;  5HNK A;  9ICK A;  1RXW A;  2GWS A;  1U49 A;  4YR3 A;  3MGI A;  3C5G A;  4DLG A;  2V9W A;  5KG2 A;  5DBC A;  7ICO A;  2W9C B;  5J2B A;  4WCW A;  1NK8 A;  4I2F A;  5KFH A;  3RAX A;  3HIY A;  3QZ7 A;  2ATL A;  2PI4 A;  8ICN A;  2IA6 A;  4O9M A;  2XGQ A;  4X4V A;  4KLM A;  2R8J A;  3EPG A;  4MEY A;  2P66 A;  3PW2 A;  4QZF A;  4TUS A;  8ICZ A;  4AT7 B;  3MR6 A;  3G6Y A;  8ICX A;  5J2J A;  4B9L A;  4BWM A;  2FLP A;  3H4D A;  1ZQX A;  3ZDB A;  3HW8 A;  8ICT A;  4RQ5 A;  2F1J A;  3EYZ A;  5DDM A;  2J6S A;  3KHL A;  1D9D A;  4RWP A;  2AGQ A;  4UAZ A;  2IMW P;  4WC2 A;  4KLH A;  4JUZ A;  2ZJ5 A;  4RT3 A;  4F5Q A;  1NK0 A;  5KG4 A;  1HUZ A;  1BPZ A;  4DSJ A;  3GIM A;  1H38 A;  4YR2 A;  1UEU A;  2PFP A;  4PHP A;  4HYK A;  2Y1J A;  2M2T A;  3OJU A;  2P6U A;  5C5J A;  4O0I A;  1ZQT A;  2DPI A;  3OVA A;  1IXR A;  4M9N A;  1Q78 A;  1ZJN A;  4QZ9 A;  1KDH A;  5J0R A;  3JPP A;  4UAY A;  3SV4 A;  4WC3 A;  4GXI A;  2XCP A;  1NK6 A;  1DK2 A;  4DOC A;  3UQ0 A;  2OWO A;  3PMN A;  3RRH A;  3UXN A;  4RWN A;  1RYR A;  1L3T A;  4Q8F A;  8ICP A;  1F5A A;  5DQG A;  2FMS A;  7ICG A;  3OUY A;  4WC7 A;  1JIH A;  5DGA A;  1ZQL A;  5KFL A;  4MFC A;  2BQR A;  1RPL A;  2C2D A;  4FHX A;  2W9C A;  5KFC A;  3PW7 A;  2HHX A;  4F5R A;  3WFO A;  3QE9 Y;  8ICK A;  9ICV A;  3PX6 A;  4NLN A;  4EZ9 A;  2ZJA A;  4KLG A;  3MR2 A;  3T5H A;  3TFR A;  7ICE A;  1ZQN A;  8ICL A;  3KHG A;  5HRE A;  4RNM A;  1CUK A;  2BKE A;  2HHU A;  4O3Q A;  4PHE A;  2W8K A;  1VJ7 A;  2KP7 A;  4ZH4 A;  4RUA A;  1NK4 A;  8ICF A;  1S0O A;  8ICB A;  4GC7 A;  2IBK A;  1BGX T;  3HP6 A;  4UB1 A;  4BDP A;  3MDA A;  4LZG A;  2O5A A;  4I2B A;  1X9M A;  4MF2 A;  5KT3 A;  3PY8 A;  4E7X A;  4ED8 A;  3ZDE A;  5DB6 A;  5D49 A;  4ECZ A;  3HT3 A;  5J0Y A;  7ICL A;  4FH3 A;  3Q8K A;  2ZH1 A;  4YFK A;  3HJ1 A;  4FH5 A;  5DQH A;  3C2K A;  1Z3E B;  1XO1 A;  4Z6F A;  5DLG A;  5CP2 A;  4RNN A;  1ZQS A;  5CWR A;  4PGY A;  2ASJ A;  1KRP A;  3RJK A;  3ORY A;  4I2E A;  9ICR A;  2R8K A;  2KZ3 A;  2M9N A;  4C8K A;  4NY8 A;  1UT5 A;  5HHI A;  8ICO A;  4QZD A;  4X5V A;  2UVW A;  4XRH A;  4KN7 A;  4QWA A;  2ZH5 A;  2H5X A;  4NLG A;  3WFP A;  4FBT A;  1TFR A;  2AGO A;  4B9V A;  1ZQV A;  4ELT A;  3M8R A;  2JZB B;  3LDA A;  3Q8R B;  2AJQ A;  1NJZ A;  3RB3 A;  5DBA A;  4PHD A;  4FHY A;  3GQC A;  5DBB A;  4UD5 A;  3KHH A;  2BQU A;  4X4T A;  2DVI A;  2NRV A;  3NYB A;  3V6J A;  4UB2 A;  4I2C A;  4YVZ A;  3AQK A;  3M9O B;  1ZET A;  2PFN A;  3GIJ A;  3BDP A;  3C21 A;  4G3I A;  4WC4 A;  4DL4 A;  2W8L A;  2PFQ A;  1KEJ A;  3OGU A;  4IQT A;  4FO6 A;  3UPS A;  4X4R A;  1ZQQ A;  2DR9 A;  3EZ5 A;  1S0M A;  4DSK A;  5KG7 A;  4RWQ A;  1PX5 A;  2ZH3 A;  3G6X A;  3RRG A;  3PML A;  4IQU A;  4KLQ A;  1L3U A;  3AU2 A;  4UB5 A;  3TAQ A;  4F8R A;  1KFD A;  2I1Q A;  3C1Y A;  4RQ6 A;  9ICT A;  5KG6 A;  5DB9 A;  1CEZ A;  1ZQW A;  8ICW A;  3T5J A;  2PFO A;  4KLL A;  1MIY A;  1XC9 A;  2NRK A;  4ED7 A;  5J2G A;  2NRT A;  1U48 A;  4UB3 A;  2M2V A;  1A76 A;  4GC6 A;  1SL2 A;  1R8B A;  5EWF A;  4O5K A;  9ICI A;  4ECR A;  1COO A;  4ECT A;  4LVS A;  5BOL A;  3PR5 B;  3MGH A;  1SL1 A;  5KFE A;  1N48 A;  4AT9 B;  3H40 A;  2BCU A;  1IM4 A;  5DG8 A;  3JPQ A;  1MQ2 A;  4IQV A;  1R89 A;  9ICH A;  1C7Y A;  4JWN A;  2Q66 A;  5KFQ A;  4IR1 A;  3TAR A;  1T8E A;  4FBU A;  4E80 A;  5J0U A;  7ICV A;  3JZ0 A;  2JZB A;  4P4P A;  2M2U A;  5J2D A;  2BHN A;  4FHP A;  4S3N A;  3OUY B;  1V9P A;  4RZR A;  4QW9 A;  9ICB A;  1XSN A;  3SYZ A;  5KT4 A;  3OV7 A;  2B21 A;  4O5E A;  3AUO A;  4UD4 A;  2HHV A;  8ICQ A;  4DL2 A;  5J2K A;  1XU4 A;  3H8S A;  3GV7 B;  3C5F A;  3V6H A;  4WBZ A;  4WC5 A;  4XUS A;  4KLF A;  4RQ8 A;  4O3O A;  4ELV A;  1X2I A;  5HMM A;  4QZG A;  4DQI A;  1B22 A;  1WCN A;  4NM1 A;  1DOQ A;  3K4G A;  5KT2 A;  3EPI A;  3T3F A;  3H3A A;  4DWI A;  4GXK A;  2V4R A;  2IHM A;  1ARO P;  5KG0 A;  2HVH A;  5IIJ A;  4XA5 A;  4TUQ A;  3H4B A;  1MIW A;  2V4Q A;  2NRZ A;  1TKD A;  1ZQR A;  4ECU A;  3RR8 A;  5DED A;  4ECW A;  5KFF A;  1NKE A;  5KFZ A;  4MF8 A;  5L1I A;  5DLF A;  2JEF A;  5KFW A;  3GFK B;  4DSE A;  5TZV A;  4NM2 A;  4DO9 A;  5KTQ A;  4WC6 A;  4RQ0 A;  1OU5 A;  4J9R A;  1ZQC A;  2BGW A;  8ICR A;  4J9Q A;  4ED3 A;  2JEG A;  1R8C A;  2BCS A;  2C22 A;  3MDC A;  1QLN A;  5KFR A;  4R63 A;  1ZQP A;  1T3N A;  1WOT A;  2ZH8 A;  4R64 A;  4DF4 A;  4AT9 A;  1JN3 A;  3MR5 A;  4MFF A;  7ICN A;  1SKW A;  2XO7 A;  4I2I A;  4J9L A;  4ECX A;  4ED6 A;  4B9N A;  4KLI A;  9ICU A;  3TAP A;  2M2W A;  1JAJ A;  4XQ7 A;  3OSN A;  1DK3 A;  2C2E A;  1QSS A;  4J9K A;  3RBE A;  1ZQK A;  1XS9 D;  3Q8Q B;  2KZM A;  1T7P A;  5KFB A;  3V7K A;  3PV8 A;  2DPJ A;  8ICM A;  5J0O A;  2ZTC A;  4F5O A;  3QEA Z;  4QW8 A;  1NJY A;  8ICC A;  1KFT A;  5DEC A;  2DFL A;  4F4K A;  4DFK A;  8ICJ A;  4DQQ A;  3PW4 A;  7ICT A;  8ICS A;  5L1K A;  3UQ2 A;  5HRH A;  4ECV A;  5HML A;  4R65 A;  2ISO A;  3JYY A;  3ZD9 A;  2ZHA A;  1PZN A;  3C23 A;  5CA7 A;  5DB8 A;  3ISC A;  2ZUD A;  3FYH A;  2XGP A;  4F4W A;  4DS5 A;  3RJG A;  5KFJ A;  4QZI A;  3PW0 A;  1ZQI A;  4JV1 A;  4FS2 A;  3PO5 A;  3UPQ A;  4ELU A;  1UEV A;  1TFW A;  1HJP A;  3TAN A;  2JEI A;  2LYH A;  2ZH7 A;  2Y1I A;  2BPF A;  4F91 B;  4YR0 A;  2AU0 A;  4QWD A;  4QZ8 A;  1L5U A;  2UVR A;  4P4M A;  4F4Z A;  5KT5 A;  3BQ1 A;  4ECQ A;  4QZB A;  3TI0 A;  4I28 A;  3OJS A;  5J0P A;  4DSF A;  2W9B A;  4O3N A;  8ICV A;  5CHG A;  4O3S A;  4XQ8 A;  4B9T A;  4UAW A;  4DOA A;  7ICJ A;  1DGS A;  4DQS A;  3QZ8 A;  4QZC A;  4NLK A;  5KFD A;  3GDX A;  4QZE A;  2R8I A;  2ZH4 A;  4DOB A;  2JEJ A;  2HHP A;  3SI8 A;  4DSL A;  2DR7 A;  4NXZ A;  1UA1 A;  4EBK A;  2XY6 A;  3AU6 A;  2DR5 A;  4PGQ A;  1TVA A;  4YMM A;  3ZDA A;  3GII A;  5J0Q A;  1QSL A;  2FMQ A;  3FDS A;  2FPM A;  1XSP A;  4DL7 A;  2IHN A;  4IRD A;  4M9H A;  4I2G A;  3LQC B;  1S76 D;  1Q79 A;  2ZUC A;  5KFM A;  3RJJ A;  3M9N B;  2Q0Z X;  4JK1 A;  2RDJ A;  3H37 A;  3BJY A;  4UQG A;  1U45 A;  2ZTD A;  4PPX A;  2HVI A;  3RJE A;  1TAQ A;  4EBC A;  4DF8 A;  5HRG A;  4Q44 A;  3PX4 A;  3ZDC A;  2BPG A;  5DGB A;  4B9U A;  1X9S A;  3AQM A;  1L3S A;  5KFU A;  9ICP A;  3NTU A;  4I2D A;  3RBD A;  1JXL A;  3JPO A;  1ZQB A;  4I29 A;  4JV2 A;  8ICA A;  9ICX A;  3WFS C;  5J2A A;  2BCV A;  3K75 D;  5HHH A;  3UXP A;  2BCQ A;  4F3O A;  1BNP A;  3PX0 A;  4KLO A;  1BPB A;  2PI5 A;  7ICU A;  3M8S A;  5BPC A;  4YP3 A;  2XY7 A;  1ZQA A;  4Z6D A;  3RH6 A;  3GV5 B;  1S97 A;  2HHQ A;  4BXO B;  3E2E A;  3C66 A;  4DSI A;  4I2H A;  1ZYQ A;  2O1P A;  4PHA A;  5J2I A;  4RUC A;  1KSP A;  1ZQO A;  1B43 A;  1TAU A;  4LT6 A;  9ICM A;  2FPK A;  4Z6C A;  3MFI A;  5J29 A;  7ICS A;  1K1S A;  4KLS A;  3BQ0 A;  5HRL A;  2ZUB A;  3H38 A;  1WCL A;  4NKT A;  4X0A A;  4IG8 A;  2ALZ A;  3OHB A;  4X0B A;  5HRI A;  2XY5 A;  2FPL A;  5HR9 A;  4AT8 B;  4F4X A;  3L9D A;  4YMO A;  3KTQ A;  1ZQF A;  4C8L A;  4ECS A;  4EP7 A;  4O5C A;  5KFS A;  3GV8 B;  1NO5 A;  4RQ3 A;  5DKW A;  3N97 B;  4B9S A;  9ICG A;  4F2R A;  5HRF A;  5DDY A;  2FLL A;  3Q8L A;  3RAQ A;  2BQ3 A;  5KFV A;  4F50 A;  3LK9 A;  2F1I A;  2ZH2 A;  4LZD A;  5KFN A;  1KLN A;  4K4G A;  7ICF A;  4YG2 A;  9ICN A;  4X4S A;  4X4U A;  4YXM A;  3HWT A;  1UET A;  1D8L A;  1T4G A;  4QWC A;  3ZD8 A;  3C2L A;  3NGD A;  1KFS A;  3IM1 A;  5KFY A;  4YMN A;  1RZT A;  1ZQM A;  2DRA A;  4KLD A;  3H39 A;  4K4I A;  5BOM A;  1U4B A;  2ZH6 A;  2MUT B;  5L9X A;  4JV0 A;  4EBD A;  1TK5 A;  8ICG A;  4K4H A;  1NK9 A;  3AQL A;  4BXO A;  1S0N A;  1ZQE A;  1ZJM A;  7ICQ A;  2ZJ8 A;  4UB4 A;  4RWO A;  4ATB B;  2PXI A;  3GIL A;  2C28 A;  1NKB A;  4I2A A;  9ICS A;  4DL5 A;  5KT7 A;  4IQW A;  4QWE A;  2KFN A;  1ZQU A;  3TFS A;  1FA0 A;  2BR0 A;  1ZQY A;  5KG1 A;  2W9A A;  4J9P A;  4GXJ A;  2W9B B;  3H8W A;  5EWG A;  5L1L A;  5IIM A;  3N4M B;  1ZQD A;  5KFX A;  2KZZ A;  7ICH A;  5DG7 A;  3RJF A;  4RQ2 A;  2KN7 A;  4M6W A;  5HP4 A;  4KIT B;  3M9M B;  5J0T A;  5D46 A;  3ISB A;  2A1J A;  1YLQ A;  4O3P A;  4YXJ A;  4ECY A;  2ZH9 A;  4AT8 A;  4J9M A;  1UA0 A;  1V4A A;  5DQI A;  2ASL A;  3RR7 A;  2I9G A;  4F5P A;  2ID1 A;  3ETL A;  4GLX A;  1XSL A;  3C18 A;  5IIK A;  4QZH A;  2UVU A;  1LV5 A;  3Q8M A;  4J9N A;  7ICI A;  4F4Y A;  3TQ1 A;  1ZQJ A;  4KLU A;  4M9J A;  1EXN A;  1BVS A;  3B0Y A;  3G6V A;  1NJW A;  1MIV A;  1S0V A;  2BE3 A;  4EBE A;  1N56 A;  3MR3 A;  2R8H A;  2DR8 A;  4J9S A;  4UBB A;  4C8M A;  1QSY A;  4E0D A;  4O3R A;  1XWL A;  3IHQ B;  1TV9 A;  4M47 A;  1NZP A;  4MFA A;  5JUM A;  3HPO A;  9ICA A;  4RPZ A;  1TK8 A;  3Q8S B;  5J0X A;  2MAX A;  5J2C A;  1TFY A;  5J2F A;  1NJX A;  4DL3 A;  1BNO A;  3OVB A;  2HHW A;  2MUT A;  2PBE A;  5F2V O;  3SZ2 A;  5CJ7 A;  3Q8P B;  3V7J A;  4Q45 A;  4JWM A;  3OHA A;  5J2H A;  4Q8E A;  4X4N A;  5KFP A;  4IRC A;  3C2M A;  4R8U B;  3RB0 A;  3RB4 A;  1L3V A;  1NK5 A;  4ATB A;  4ED0 A;  2AQ4 A;  4FHW A;  4RNO A;  2VA2 A;  4RQ7 A;  5F9L A;  4RPX A;  4RPY A;  1U9L A;  1K1Q A;  1NOM A;  5KFG A;  3PW5 A;  1X9W A;  2KFZ A;  1VFG A;  4EYH B;  4UBC A;  3HX0 A;  2AGP A;  1ZQH A;  2UVV A;  3ISD A;  8ICU A;  7ICK A;  3MBY A;  2VA8 A;  4KLJ A;  4YQW A;  4M9G A;  4KLE A;  2XCA A;  3OSP A;  4P2H A;  3T5L A;  4M04 A;  2VAN A;  2FLN A;  4EEY A;  4CCH A;  2DRB A;  2NRX A;  9ICW A;  8ICY A;  2W9M A;  3JPT A;  4YCX A;  4DS4 A;  3RB6 A;  2R8G A;  4AT7 A;  3OVS A;  4NKU A;  2NRW A;  8ICE A;  2BPC A;  4WC1 A;  5EOZ A;  1Z00 B;  1SZP A;  4C8N A;  4R66 A;  4Z6E A;  4RU9 A;  4ED1 A;  3V6K A;  4DFP A;  1BPX A;  2BCR A;  4RQ4 A;  5HRK A;  3WFQ E;  4F5N A;  1RXV A;  4TUR A;  2HHT A;  9ICO A;  1R8A A;  3RH5 A;  2ASD A;  4F92 B;  5J0S A;  3JPR A;  3H7I A;  4YD1 A;  1BPE A;  4TUP A;  4PGX A;  5IIL A;  2J6U A;  8ICI A;  4X4O A;  5HC9 A;  4M9L A;  3SV3 A;  4J9O A;  2RDI A;  4DQR A;  4FHV A;  4NLZ A;  4WBY A;  3V72 A;  1Y88 A;  3MFH A;  5L1J A;  1BPY A;  2ISP A;  4B9M A;  5III A;  1MC8 A;  3HJ4 A;  5KFO A;  4R8U A;  4F93 B;  1S9F A;  3RJI A;  3RH4 A;  1HUO A;  1JMS A;  1MQ3 A;  5KFT A;  2HHS A;  4IR9 A;  4X4P A;  7ICP A;  3BQT A;  3RTV A;  4KMU A;  3JPN A;  1BPD A;  4M5D A;  3PO4 A;  4IRK A;  5CR0 A;  4QZA A;  9ICJ A;  4DLE A;  4EZ6 A;  1KNY A;  1U47 A;  2HW3 A;  2P6R A;  3THV A;  1JQR A;  2ZHB A;  4E8F A;  4Q43 A;  4DEZ A;  5DB7 A;  1NKC A;  1SL0 A;  2AQ0 A;  1D9F A;  1UT8 A;  4C8O A;  1ZQG A;  2C2R A;  1JX4 A;  4KLT A;  9ICQ A;  4M6W B;  4EYI B;  4DFJ A;  3RJH A;  4BGD A;  4RQ1 A;  5IIN A;  7ICM A;  2A1J B;  4P4O A;  2KTQ A;  2J6T A;  4ED2 A;  1NK7 A;  5KFI A;  5F9N A;  3PNC A;  4M0A A;  7ICR A;  4F2S A;  3LWM A;  3UXO A;  1Z00 A;  3T5K A;  1RYS A;  1S77 D;  9ICC A;  2VA3 A;  2BDP A;  3ZDD A;  3AQN A;  1ZQZ A;  1JXE A; 
#chains in the Genus database with same CATH topology
 9ICE A;  3H8J A;  9ICF A;  4K8V A;  1O08 A;  4EBJ A;  1TK0 A;  3B0X A;  4TQS A;  2H3F A;  3WKE A;  3V7L A;  4K98 A;  1L6N A;  5AKE A;  5CB1 A;  2KHQ A;  4I2J A;  4ZOH C;  2GAF D;  4YN4 A;  1A77 A;  2OXO A;  3WKC A;  1S8O A;  4Y2P A;  2F1H A;  5IIO A;  5DG9 A;  1N5X A;  2PMZ C;  4YD2 A;  2YMM A;  5KNI A;  2V9W A;  1ZD5 A;  3F2D A;  1NK8 A;  3RAX A;  2ATL A;  3CYM A;  2XGQ A;  4X4V A;  2P66 A;  5E79 U;  3MR6 A;  5ALI A;  3G6Y A;  4B9L A;  4BWM A;  5ALR A;  1ZQX A;  3ZDB A;  4C7Y A;  3HW8 A;  2W7O A;  4RQ5 A;  5DDM A;  3KHL A;  1D9D A;  4UAZ A;  4J03 A;  1UPH A;  4F5Q A;  4UB8 U;  2WAQ C;  2ZIU B;  2DRB A;  4F71 A;  4YR2 A;  1UEU A;  2G07 A;  2OYY A;  3OJU A;  1PUZ A;  5C5J A;  2HCF A;  1IXR A;  1Q78 A;  3JPP A;  4UAY A;  4WC3 A;  2XCP A;  1DK2 A;  4DOC A;  4XJE A;  1L3T A;  4NWI A;  2K8A A;  4MFC A;  4FHX A;  3PW7 A;  4F5R A;  2LBO A;  2ZJA A;  1ZRN A;  2BBJ A;  1ZQN A;  1CUK A;  2BKE A;  2ZXH A;  4PHE A;  1S0O A;  2G06 A;  3J81 j;  2IOH A;  4MF2 A;  4WJ3 B;  2VIX A;  3PY8 A;  3FC4 A;  2Z7J A;  3ETR A;  3ZDE A;  2ZIU A;  3CP8 A;  2ZH1 A;  1A6S A;  4YFK A;  3E0F A;  4O9M A;  4Z6F A;  5DLG A;  5CP2 A;  4PGY A;  3ORY A;  4C8K A;  4NY8 A;  4XRH A;  2GO7 A;  2GOL A;  4OAI Z;  2ZH5 A;  3I76 A;  4FBT A;  3M8R A;  5DBA A;  1L7P A;  5DBB A;  3KHH A;  3ZI4 A;  2WF5 A;  4YVZ A;  3DV9 A;  2H3Q A;  3BDP A;  3C21 A;  3OGU A;  2Y9T A;  3UPS A;  1ZQQ A;  3DDH A;  2BZF A;  2LM4 A;  3CNH A;  2CXY A;  2ZH3 A;  3G6X A;  3QX7 A;  4IQU A;  5JRT A;  4F8R A;  2K89 A;  2I1Q A;  5ALO A;  2PFO A;  4GC6 A;  4C80 A;  5EWF A;  9ICI A;  4ECR A;  1SB3 C;  3LVW A;  1IG6 A;  3H40 A;  2BCU A;  1IM4 A;  1MQ2 A;  1RDF A;  1F5S A;  3TAR A;  1T8E A;  1YZ6 A;  7ICV A;  4P4P A;  2M2U A;  2BHN A;  1Q3V A;  9ICB A;  1XSN A;  4O5E A;  2ODG A;  1XU4 A;  4O69 A;  4WC5 A;  5D62 A;  1YZ7 A;  3FAH A;  1LKY B;  3JCF A;  4QZG A;  4DQI A;  4NM1 A;  3K4G A;  3H3A A;  2W7P A;  3H4B A;  5KFF A;  1NKE A;  4MF8 A;  3GFK B;  4DSE A;  4NM2 A;  2DUY A;  5KTQ A;  4OCZ A;  4J9R A;  1ZQC A;  2BGW A;  2BCS A;  1QLN A;  5KFR A;  1ZQP A;  1WOT A;  3MR5 A;  1SKW A;  2VJ5 A;  4XQ7 A;  1DK3 A;  3OSN A;  2EH9 A;  2QB0 A;  2KZM A;  2QAR A;  2DPJ A;  3TAD A;  4QW8 A;  1NJY A;  5ALW A;  2A19 A;  2HSZ A;  4QIW F;  4F4K A;  4US8 A;  4DQQ A;  8ICS A;  5L1K A;  3UQ2 A;  2YB4 A;  3AMZ A;  2ISO A;  3JYY A;  5CA7 A;  3FYH A;  2EAO A;  3PW0 A;  2JEI A;  2ZH7 A;  1X6I A;  2BPF A;  2YY6 A;  4KX3 A;  4YR0 A;  2UVR A;  5ALN A;  4P4M A;  5AKX A;  5J0P A;  2KP7 A;  4PJ0 U;  2ZIV A;  4O3N A;  4O3S A;  4XQ8 A;  4B9T A;  5CFU A;  1DGS A;  1URJ A;  3QZ8 A;  4NLK A;  3GDX A;  2R8I A;  2N1R A;  4LEW A;  2E8P A;  3SI8 A;  2WF8 A;  2DR7 A;  3C29 A;  2DR5 A;  4YMM A;  3ZDA A;  5F3X B;  5J0Q A;  3RFA A;  3FDS A;  4IRD A;  1XSP A;  2W3R A;  3LQC B;  1S76 D;  3L4P A;  2Q0Z X;  4EBC A;  3ZDC A;  2DKZ A;  2BPG A;  5KFU A;  3RBD A;  4DFD A;  3BS7 A;  9ICX A;  5J2A A;  2YMP A;  3K75 D;  5CFS A;  4KLO A;  5CEH A;  1BPB A;  3M1Y A;  5BPC A;  1ZQA A;  4Z6D A;  3GV5 B;  4BXO B;  4JB3 A;  3C66 A;  4I2H A;  3QUC A;  3F2B A;  5J2I A;  1N60 A;  1B43 A;  3NVZ A;  1Q8K A;  5ALS A;  4EX7 A;  4CNQ A;  4LT6 A;  2EDU A;  3H0R B;  3BQ0 A;  2WF6 A;  2ZUB A;  4NKT A;  1J2M A;  4JLX A;  3L9D A;  2WB1 C;  4O5C A;  3GV8 B;  2B0C A;  9ICG A;  4B9S A;  5HRF A;  2OEH A;  1XO0 A;  5ALK A;  4F50 A;  3LK9 A;  4GIB A;  4BJQ A;  7ICF A;  4X4S A;  3HWT A;  3F5A A;  2F8L A;  1T4G A;  3NGD A;  4YMN A;  1ZQM A;  2HMX A;  2E5S A;  4K4I A;  1T3Q A;  5AKG A;  5CFT A;  4BXO A;  2FDR A;  1ZJM A;  4ATB B;  2C28 A;  4I2A A;  2KFN A;  5KG1 A;  2W9B B;  3H8W A;  5EWG A;  2KZZ A;  7ICH A;  5CHE A;  5HP4 A;  2KN7 A;  4KIT B;  1OXJ A;  2JR5 A;  5D46 A;  3E58 A;  3NVV A;  3ISB A;  1L7M A;  4F5P A;  1OW5 A;  3C18 A;  5IIK A;  1ZQJ A;  4M9J A;  1EXN A;  1NZB A;  3B0Y A;  1S0V A;  2KSO A;  1N56 A;  2R8H A;  1TE2 A;  4OAH A;  3EF2 A;  2M0N A;  1QSY A;  1XWL A;  5AI6 A;  5ALF A;  4RPZ A;  3Q8S B;  2MAX A;  3MC1 A;  4DL3 A;  4ICA A;  3NUQ A;  3OHA A;  2LYA A;  3RB4 A;  3GU3 A;  1NK5 A;  3QUQ A;  2HOI A;  4ATB A;  1RQN A;  2W03 A;  3IDW A;  2K8B B;  4JV1 A;  3PSP A;  1K1Q A;  1X9W A;  1VFG A;  2YQE A;  3KZI U;  4KX5 A;  2UVV A;  3HX0 A;  2AGP A;  5AI0 A;  2LKY A;  1PK3 A;  4CCH A;  2CPR A;  3CW2 C;  9ICW A;  4UAS A;  2NRW A;  8ICE A;  4WC1 A;  2XIC A;  4CF3 A;  2HHT A;  1R8A A;  4F72 A;  5J0S A;  3JPR A;  5IIL A;  5HC9 A;  4Y2Q A;  4OD0 A;  4DQR A;  4NLZ A;  5AIA A;  2OH2 A;  3V72 A;  5III A;  2L5Y A;  1V85 A;  2DRA A;  2RP5 A;  5G5H A;  3JPN A;  4USA A;  4QZA A;  4EZ6 A;  1KNY A;  2HOQ A;  3THV A;  4EV6 A;  4E8F A;  4Q43 A;  1UT8 A;  4C8O A;  3QU2 A;  5AM5 A;  2PMZ F;  4EYI B;  5IIN A;  1GPJ A;  2KTQ A;  3PNC A;  4M0A A;  2A1A A;  4Y2R A;  4OJO A;  3T5K A;  2Q4T A;  5AKJ A;  2KMD A;  1LB2 B;  1N5W A;  2I6X A;  3EWA A;  8ICH A;  4X4Q A;  1QH9 A;  3LWL A;  3IN5 A;  4DL6 A;  2VKQ A;  5J0W A;  4M2Y A;  3BQ2 A;  5KG3 A;  4DQP A;  2XC9 A;  3B9J A;  2WAQ F;  5GTH U;  1KTQ A;  4FS1 A;  1QTM A;  2WTF A;  2YMQ A;  3PR4 A;  3MAB A;  4BWJ A;  5KFK A;  5D4B A;  1COK A;  3AQF A;  3HJE A;  4YR3 A;  4PZN A;  4DLG A;  3S6J A;  5G5G A;  5DBC A;  1WYG A;  7ICO A;  4WQL A;  5KFH A;  2PI4 A;  2KKV A;  4EX6 A;  4KLM A;  4CE6 A;  8ICZ A;  3I28 A;  4QZF A;  2ZG6 A;  5J2J A;  3H4D A;  2NYV A;  1SXD A;  3EYZ A;  5D63 A;  2IMW P;  4WC2 A;  2ZJ5 A;  4RT3 A;  1NK0 A;  1KL9 A;  2PFP A;  1L8L A;  2KJ8 A;  4PHP A;  2KNJ A;  2Y1J A;  2M2T A;  1FEZ A;  1HEK A;  1ZQT A;  1ZJN A;  4QZ9 A;  5J0R A;  3SV4 A;  4C4S A;  4GXI A;  2YN4 A;  3PMN A;  1FIQ A;  1RYR A;  4Q8F A;  8ICP A;  4US9 A;  1F5A A;  3OUY A;  4EED A;  4WC7 A;  4LJX A;  2BQR A;  1RPL A;  3WFO A;  2HHX A;  9ICV A;  3TFR A;  7ICE A;  4RNM A;  4O3Q A;  2W8K A;  1NK4 A;  3HP6 A;  4LZG A;  1X9M A;  2F76 X;  3ED5 A;  4E7X A;  4ED8 A;  5ALU A;  5J0Y A;  5AK6 A;  7ICL A;  1XO1 A;  4RNN A;  2K4P A;  5J8Y A;  2ASJ A;  2G08 A;  2KZ3 A;  2M9N A;  1UT5 A;  5HHI A;  4EGW A;  4X5V A;  2UVW A;  4QWA A;  4NLG A;  3SAG A;  1TFR A;  2AGO A;  4B9V A;  4OO1 J;  2JZB B;  3LDA A;  4C4R A;  3HIL A;  3WKA A;  2AJQ A;  4FHY A;  2HDO A;  4Y2V A;  2BQU A;  2NRV A;  1V38 A;  2MSN A;  4Y2T A;  3M9O B;  4FO1 A;  2PFN A;  3GIJ A;  5JU5 A;  2XID A;  4G3I A;  1KEJ A;  2W55 A;  4IQT A;  4FO6 A;  2JHD A;  1S0M A;  4DSK A;  4NXT A;  1PVQ A;  5KG7 A;  4RWQ A;  1PX5 A;  3PML A;  1L3U A;  4EEB A;  3TAQ A;  3C1Y A;  4RQ6 A;  1CEZ A;  2KK0 A;  1ZQW A;  2F3N A;  2JGA A;  8ICW A;  4KLL A;  1MIY A;  2NRK A;  4ED7 A;  5J2G A;  1U48 A;  1R8B A;  4PL1 A;  1COO A;  4LVS A;  3MGH A;  5KFE A;  4AT9 B;  2D3D A;  1KW4 A;  5ALZ A;  3JPQ A;  1R89 A;  9ICH A;  1C7Y A;  4JWN A;  4FBU A;  4E80 A;  2E3T A;  1RQL A;  2JZB A;  4FHP A;  4RZR A;  4KB6 A;  4QW9 A;  3SYZ A;  5KT4 A;  4UD4 A;  1F0M A;  3V6H A;  3H8S A;  4WBZ A;  1DRG A;  4ELV A;  1X2I A;  2JRZ A;  1B22 A;  3VC8 A;  3LVV A;  3EPI A;  1FFV A;  4BX9 C;  2IHM A;  4WOY A;  2DGZ A;  2FJ6 A;  4ECU A;  5DED A;  1SWW A;  3KFU F;  5L1I A;  2EZX A;  5DLF A;  2JEF A;  1UQV A;  5EE1 A;  3SAF A;  2JEG A;  1R8C A;  2C22 A;  3H8M A;  5JTG A;  2ZH8 A;  3SQI A;  4K96 A;  3K7D A;  4AT9 A;  3ER9 B;  2XO7 A;  4I2I A;  4KLI A;  3QUT A;  3TAP A;  3WK8 A;  4WH5 A;  2C2E A;  4J9K A;  3RBE A;  5AK5 A;  1XS9 D;  4EEN A;  8ICM A;  2DKX A;  4F5O A;  5AIB A;  3QEA Z;  3WK6 A;  1Z1V A;  2KD1 A;  1KFT A;  5B66 U;  2DFL A;  5CRX A;  3PW4 A;  5AM2 A;  5HRH A;  3M7D A;  4Y2Y A;  3UMC A;  2FCL A;  4NXX A;  2ZHA A;  3DEE A;  2ZUD A;  2XGP A;  3MGV A;  1TFW A;  1WWU A;  1RYU A;  1HJP A;  3ERC C;  2LYH A;  2Y1I A;  4F91 B;  4P0Q B;  1L5U A;  4QWD A;  4QZ8 A;  1KKX A;  5KT5 A;  4ECQ A;  4QZB A;  4I28 A;  1WG8 A;  4DSF A;  8ICV A;  4UAW A;  5AM3 A;  1L7N A;  2AHO B;  5KL8 B;  4DOA A;  5KFD A;  4QZE A;  3AQE A;  4EBK A;  4PGQ A;  1TVA A;  2ZIX A;  3OVA A;  4M9H A;  3RJJ A;  4Y2U A;  4HAI A;  2WB1 F;  5ALJ A;  5HRG A;  4Q44 A;  5AI4 A;  1CRX A;  2W54 A;  1Z4O A;  3WK4 A;  1JXL A;  8ICA A;  2BCV A;  3UXP A;  4F3O A;  1BNP A;  5AKY A;  3PX0 A;  3LYS A;  4P0Q A;  4YP3 A;  3N7P D;  2HHQ A;  4DSI A;  3MCR A;  4Z6C A;  3L3F X;  2I5H A;  4CF4 A;  2E8M A;  2ALZ A;  2R18 A;  2XY5 A;  5HR9 A;  4YMO A;  3A0H U;  4C8L A;  2K4E A;  4UAR A;  4RQ3 A;  2QB0 B;  3RAQ A;  2PKE A;  2QAR B;  2ZH2 A;  2F1I A;  2Y0S F;  4LZD A;  1X66 A;  4YG2 A;  4YXM A;  3C2L A;  2CRX A;  5L9X A;  3OTQ A;  3NRW A;  4RWO A;  2PXI A;  3K1R B;  9ICS A;  3UMB A;  4DL5 A;  5KT7 A;  2FE9 A;  1ZQU A;  1J97 A;  1ZQY A;  4RQM A;  4J9P A;  2W9A A;  2BR0 A;  4O3R A;  2ZIV B;  5KFX A;  3RJF A;  4M6W A;  5J0T A;  5ALQ A;  5AHX A;  4AYB C;  2XI9 A;  5HR7 A;  4AP9 A;  1UA0 A;  2I9G A;  1QQ5 A;  3Q8M A;  4KLU A;  1N63 A;  1C20 A;  4EBE A;  4UBB A;  3IHQ B;  9ICA A;  2GH1 A;  5J0X A;  5J2C A;  2GLE A;  4OJP A;  5J2F A;  5F2V O;  3WU2 U;  2JH7 A;  3Q8P B;  4Q8E A;  5J2H A;  3NWI A;  1L3V A;  3K1Z A;  2ESE A;  1NOM A;  5KFG A;  1ZQH A;  1AQ6 A;  5C0Y A;  7ICK A;  4UB6 U;  2XCA A;  3T5L A;  4M04 A;  2FLN A;  2NRX A;  2LPE A;  4NKU A;  4AT7 A;  3WKD A;  4C8N A;  2RLT A;  2F44 A;  4Z6E A;  4RU9 A;  5JTI A;  1M6Y A;  4DFP A;  1BPX A;  4GFJ A;  2MU2 A;  1D8B A;  3RH5 A;  2ASD A;  4PGX A;  2J6U A;  3SV3 A;  4J9O A;  4FHV A;  4WBY A;  3MFH A;  4B9M A;  3D2N A;  3HJ4 A;  5KFO A;  1S9F A;  3RJI A;  3RH4 A;  4JLZ A;  4IR9 A;  4X4P A;  4K97 A;  2E8O A;  4KMU A;  3O0F A;  4M5D A;  4PZO A;  3PO4 A;  4DLE A;  2ZHB A;  5B3P A;  3GZF A;  5DB7 A;  3IG5 A;  1SL0 A;  2EWR A;  3D2S A;  2AQ0 A;  3IG8 A;  2EZZ A;  3PSI A;  7ICM A;  3RJH A;  2E1F A;  1TAM A;  4G9B A;  4UAU A;  1NK7 A;  5F9N A;  7ICR A;  3LWM A;  4NXW A;  3ZDD A;  1JXE A;  4WC0 A;  3QEB Z;  1D8Y A;  1ED1 A;  2KIW A;  4JMU A;  3JPS A;  2KSO B;  2YX8 A;  4KN4 A;  5KT6 A;  3GIK A;  4MEX A;  2D8C A;  3KHR A;  2RFF A;  3C1Z A;  4PH5 A;  5J8Y C;  3AEV A;  3U26 A;  4QWB A;  5ALE A;  2HBK A;  5J2E A;  4TQR A;  9ICL A;  1S10 A;  1SZH A;  1RXW A;  1U49 A;  5H2F U;  5KG2 A;  5J2B A;  4WCW A;  8ICN A;  3EPG A;  3PW2 A;  3ALR A;  2Y0S C;  4EEL A;  2FLP A;  2AGQ A;  1BPZ A;  3GIM A;  1H38 A;  1ZD2 P;  1ZRM A;  1K5O A;  3QUB A;  2P6U A;  4N7R A;  5D61 A;  1OUQ A;  1CI4 A;  1DXS A;  2AH5 A;  2OWO A;  1A0P A;  3RRH A;  3UXN A;  5DQG A;  2FMS A;  2DQN B;  2Y9U A;  1N61 A;  5DGA A;  1KQQ A;  1ZQL A;  5AK3 A;  3M6K A;  3M6Z A;  5AKI A;  3QE9 Y;  8ICK A;  4EZ9 A;  4KLG A;  3MR2 A;  3T5H A;  8ICL A;  2EAP A;  3A0B U;  3QYP A;  5KAI U;  2HHU A;  4ZH4 A;  1ZD4 A;  4GC7 A;  3FM9 A;  2IBK A;  3WK7 A;  1WUD A;  3MDA A;  3F53 A;  2O5A A;  1X40 A;  5DB6 A;  5D49 A;  1S5L U;  4ECZ A;  4O3M A;  3Q8K A;  5DQH A;  3C2K A;  1KRP A;  9ICR A;  4MKP A;  5L1M A;  3F5E A;  4QZD A;  3IP4 B;  2MA1 A;  1ZQV A;  4ELT A;  2KOB A;  4PHD A;  4X4T A;  3NYB A;  4RQN A;  2F77 X;  2LHT A;  3H0L B;  5KAF U;  1GO3 F;  4NXU A;  2W8L A;  2PFQ A;  2DR9 A;  4X4R A;  2OHF A;  3EZ5 A;  3RRG A;  4UB5 A;  1KFD A;  1O03 A;  9ICT A;  3T5J A;  1A76 A;  2F2A B;  4O5K A;  3AL0 B;  3PR5 B;  1SL1 A;  2H3I A;  1JAL A;  5DG8 A;  4IQV A;  2Q66 A;  5KFQ A;  4IR1 A;  2QB1 A;  5J2D A;  1FFU A;  4S3N A;  3OUY B;  1V9P A;  3QU7 A;  2B21 A;  2YML A;  5J2K A;  3GV7 B;  2IOF A;  3C5F A;  3SEN A;  4XUS A;  4O6A A;  3NRZ A;  4O3O A;  4RQ8 A;  2ZIW B;  1WCN A;  2B4V A;  3UM9 A;  5KT2 A;  4GXK A;  2V4R A;  5KG0 A;  1V97 A;  2V4Q A;  2NRZ A;  1TKD A;  3RR8 A;  4ECW A;  3PST A;  5KFW A;  5TZV A;  4CGZ A;  2QKQ A;  4DO9 A;  4WC6 A;  8ICR A;  1QQ7 A;  4J9Q A;  1MA7 A;  3MDC A;  4R63 A;  1L8O A;  4DF4 A;  3UMG A;  1JN3 A;  4MFF A;  7ICN A;  4J9L A;  4ED6 A;  9ICU A;  1VDV A;  2M2W A;  1QSS A;  3ER8 C;  1ZQK A;  2YTU A;  2NV3 A;  3PV8 A;  5J0O A;  2ZTC A;  5AIC A;  5DEC A;  7ICT A;  4DFK A;  4ECV A;  5HML A;  1PZN A;  3ISC A;  2ZIW A;  3NAS A;  4I2E A;  5KFJ A;  4QZI A;  1ZQI A;  4ELU A;  3PO5 A;  3TAN A;  2G09 A;  4F4Z A;  3BQ1 A;  3TI0 A;  3OJS A;  5CHG A;  4DQS A;  1Q3U A;  4QZC A;  4NV0 A;  1WWV A;  4UAT A;  2HHP A;  4DSL A;  4FZL A;  4NXZ A;  2FI1 A;  4P0P A;  2FMQ A;  5ALP A;  2WFA A;  1N62 A;  4I2G A;  2ZUC A;  5KFM A;  2RDJ A;  3BJY A;  3TAD C;  4UQG A;  2ZTD A;  1U45 A;  3RJE A;  4DF8 A;  1IIP A;  5DGB A;  4B9U A;  1X9S A;  4CRX A;  3AQM A;  3QU9 A;  5AM4 A;  4KM5 A;  1JRO A;  2KV2 A;  1ZQB A;  4I29 A;  2KIC A;  3WFS C;  1J2N A;  2BCQ A;  3SMV A;  3M8S A;  4FHW A;  1S97 A;  3RH6 A;  2JMG A;  2BBH A;  3SR6 A;  4PHA A;  5EE3 A;  3N7R C;  4RUC A;  4FZM A;  1KSP A;  1ZQO A;  5ALV A;  2LM1 A;  2YB1 A;  7ICS A;  1K1S A;  4KLS A;  1WCL A;  3KZX A;  3SAH A;  4IG8 A;  3OHB A;  5HRI A;  4AT8 B;  4F4X A;  3RF9 A;  3KTQ A;  4AYB F;  1NO5 A;  1UHU A;  5ALH A;  4F2R A;  3PSF A;  2FLL A;  4OJ6 A;  5KFN A;  1UET A;  1D8L A;  5AKZ A;  1KN5 A;  1ZQ1 C;  4QWC A;  3ZD8 A;  2G0A A;  1KFS A;  5KFY A;  1HIW A;  1RZT A;  1LVH A;  4KLD A;  1U4B A;  2MUT B;  4JV0 A;  8ICG A;  4QJF B;  1VLB A;  3H0M B;  3AQL A;  2ZJ8 A;  4UB4 A;  1RG6 A;  3GIL A;  1NKB A;  4QNL A;  4QWE A;  4IQW A;  5AM0 A;  2HOF A;  3TFS A;  1FA0 A;  4GXJ A;  2IA6 A;  3N4M B;  5L1L A;  2E1E A;  4NXV A;  3R9K A;  2A1J A;  1YLQ A;  4O3P A;  2ZH9 A;  4ECY A;  4AT8 A;  2KVC A;  2ASL A;  3RR7 A;  3D2Q A;  3ETL A;  4GLX A;  1XSL A;  5K4L A;  2ZIX B;  1LV5 A;  4F4Y A;  3TQ1 A;  3BS5 B;  1MIV A;  3G6V A;  3BQ7 A;  1NJW A;  3MR3 A;  2DR8 A;  1NZP A;  4M47 A;  2CN1 A;  1TFY A;  2ZXI A;  1BNO A;  5TIS U;  3SD7 A;  2MUT A;  2PBE A;  2K4I A;  3V7J A;  4JWM A;  5KFP A;  4IRC A;  2AQ4 A;  4Y2S A;  2VA2 A;  5F9L A;  3PW5 A;  1Z19 A;  2HBL A;  4M9G A;  3OSP A;  1JI7 A;  4P2H A;  2VAN A;  2W9M A;  2R8G A;  4YCX A;  1X42 A;  3RB6 A;  3OVS A;  2BPC A;  3BS5 A;  5EOZ A;  4PL2 A;  4R66 A;  4ED1 A;  2BCR A;  3WFQ E;  3BZK A;  5HRK A;  4RQ4 A;  5B3Q A;  1KBU A;  5FP0 A;  1F44 A;  4F92 B;  8ICI A;  1P7D A;  2HBJ A;  2HI0 A;  2ISP A;  1MC8 A;  1Z1B A;  4C7Z A;  4IC9 A;  4F93 B;  1HUO A;  2HHS A;  1MQ3 A;  3N28 A;  1SIJ A;  7ICP A;  3RTV A;  4DCC A;  4IRK A;  5CR0 A;  2DF4 B;  3WKB A;  1U47 A;  1UCV A;  2P6R A;  2OM6 A;  4UW9 A;  4DEZ A;  5AKK A;  1D9F A;  2JXJ A;  2C2R A;  4KLT A;  9ICQ A;  4M6W B;  3BZC A;  2J6T A;  5KFI A;  4F2S A;  1YT3 A;  9ICC A;  2EQY A;  2BDP A;  1ZQZ A;  2HVI A;  2JV3 A;  4KTQ A;  4LEY A;  5KG5 A;  2HN1 A;  1MSW D;  1SKS A;  3WFR E;  4DFM A;  2A3V A;  4K99 A;  3KKA A;  4U7C A;  3KD3 A;  5KFA A;  4RT2 A;  1SKR A;  3CRX A;  5AKL A;  4I27 A;  2FMP A;  5A0L A;  3PVX A;  5EWE A;  3AN1 A;  2EZY A;  2ZTE A;  5HRD A;  5HRB A;  3EW9 A;  5HNK A;  9ICK A;  2NO4 A;  2GWS A;  3MGI A;  4NLC A;  3EUB 2;  3C5G A;  2W9C B;  3WK9 A;  4I2F A;  3HIY A;  3QZ7 A;  2BDU A;  4CDG A;  2R8J A;  4MEY A;  4TUS A;  4AT7 B;  1QCK A;  8ICX A;  8ICT A;  2F1J A;  4RWP A;  2J6S A;  2D6F C;  4KLH A;  4JUZ A;  4K9A A;  5KG4 A;  1HUZ A;  4DSJ A;  5HR6 A;  4HYK A;  1SV0 A;  4NL9 A;  5ALG A;  4O0I A;  2XVT A;  2DPI A;  4M9N A;  5AKH A;  1KDH A;  1NK6 A;  3UQ0 A;  4RWN A;  2WF9 A;  7ICG A;  1T94 A;  1JIH A;  4LEZ A;  2HN2 A;  5KFL A;  2C2D A;  2W9C A;  5KFC A;  4K9B A;  1X6J A;  3PX6 A;  4NLN A;  1JUD A;  1LKY A;  2LI6 A;  5HRE A;  2F8K A;  3KHG A;  1VJ7 A;  2QLT A;  3AM9 A;  4RUA A;  8ICF A;  8ICB A;  1Q46 A;  1BGX T;  4UB1 A;  4BDP A;  3QNM A;  4I2B A;  2EAM A;  5KT3 A;  3TKA A;  1ZXI A;  3HT3 A;  2JH1 A;  3OPX A;  4FH3 A;  3HJ1 A;  4FH5 A;  1Z3E B;  3RJK A;  1ZQS A;  4FFD A;  5CWR A;  4LEV A;  1L7O A;  3L5K A;  2OCE A;  2R8K A;  1QQ6 A;  8ICO A;  4KN7 A;  4IS7 A;  2H5X A;  3WFP A;  2DBY A;  3Q8R B;  2VJ4 A;  3RB3 A;  1NJZ A;  3GQC A;  4UD5 A;  3PHZ A;  3V6J A;  4UB2 A;  2RHF A;  3AQK A;  4C4T A;  1ZET A;  2RRD A;  4WC4 A;  4DL4 A;  3NKU A;  4UAV A;  2IHO A;  2W3S A;  4NLB A;  3HKZ F;  4KLQ A;  2P35 A;  1NNL A;  3AU2 A;  5KG6 A;  5DB9 A;  2O6K A;  1XC9 A;  4O68 A;  2NRT A;  2M2V A;  4UB3 A;  1SL2 A;  2K60 A;  4ECT A;  5BOL A;  1N48 A;  2KJ9 A;  4BUG A;  5ALD A;  3KBB A;  2LYB A;  5J0U A;  3JZ0 A;  2KEY A;  2DVI A;  3OV7 A;  3AUO A;  2W04 A;  2HHV A;  8ICQ A;  4DL2 A;  3OWG A;  4KLF A;  5HMM A;  1DOQ A;  2B51 A;  1RM6 C;  3T3F A;  1PVR A;  4DWI A;  1ARO P;  1XNS A;  2HVH A;  5IIJ A;  4XA5 A;  4TUQ A;  1MIW A;  1ZQR A;  2IUB A;  5KFZ A;  4RQ0 A;  1OU5 A;  5EE9 A;  4ACO A;  4ED3 A;  1T3N A;  2KIV A;  4R64 A;  3NVO A;  4ECX A;  4B9N A;  1JAJ A;  5AK4 A;  4CF5 A;  2KJ5 A;  1FO4 A;  3VCB A;  3Q8Q B;  1ECW A;  1T7P A;  5KFB A;  3V7K A;  5B5E U;  8ICC A;  8ICJ A;  2E8N A;  4R65 A;  4I0U A;  3ZD9 A;  1SGG A;  3C23 A;  5DB8 A;  3RJG A;  2KG5 A;  4DS5 A;  1MN8 A;  4F4W A;  3PZP A;  1UEV A;  4FS2 A;  3UPQ A;  3NVY A;  5KL1 B;  2ES6 A;  2AU0 A;  2W9B A;  2WHE A;  7ICJ A;  1SWV A;  2ZH4 A;  4DOB A;  4NJ8 A;  2JEJ A;  4OAF A;  1UA1 A;  2G5I B;  2XY6 A;  3AU6 A;  3GII A;  1QSL A;  2NO5 A;  2FPM A;  2IHN A;  4DL7 A;  1Q79 A;  2AXT U;  4Y2X A;  2KVS A;  4QIW C;  5AI5 A;  3QXG A;  3ONN A;  4JK1 A;  3M9N B;  2IOF K;  3H37 A;  5AM1 A;  4PPX A;  1TAQ A;  3KOO A;  3PX4 A;  4A8E A;  3TAC B;  4OJ5 A;  1L3S A;  9ICP A;  3NTU A;  4I2D A;  3JPO A;  4JV2 A;  5HHH A;  3C28 A;  2PI5 A;  7ICU A;  2KHV A;  2XY7 A;  3E2E A;  1ZYQ A;  2O1P A;  4Y2J A;  2DWQ A;  1TAU A;  9ICM A;  2FPK A;  3MFI A;  4FE3 A;  5EE0 A;  5J29 A;  5HRL A;  2GA9 D;  3H38 A;  4X0A A;  5AI8 A;  5ALL A;  4X0B A;  3CK6 A;  2FPL A;  2MRL A;  2KKP A;  1ZQF A;  3NS1 A;  4ECS A;  4WQK A;  4EP7 A;  5KFS A;  5DKW A;  3N97 B;  1PK1 B;  3QU5 A;  5DDY A;  3Q8L A;  2BQ3 A;  5KFV A;  1JRP A;  3D6J A;  1KLN A;  4K4G A;  9ICN A;  4X4U A;  3IM1 A;  5ALY A;  3SEI A;  2W11 A;  3H39 A;  5BOM A;  2ZH6 A;  4EBD A;  1TK5 A;  1NI3 A;  4K4H A;  1NK9 A;  3HKZ C;  1S0N A;  1ZQE A;  7ICQ A;  4MHV A;  3WK5 A;  4C0Z A;  5IIM A;  1ZQD A;  2B56 A;  5DG7 A;  4RQ2 A;  3M9M B;  1DGJ A;  4YXJ A;  3IRU A;  4J9M A;  2EAN A;  1V4A A;  2H3V A;  5DQI A;  2ID1 A;  4P0P B;  4QZH A;  2UVU A;  4O67 A;  4J9N A;  7ICI A;  1BVS A;  1PK1 A;  4FZN A;  2BE3 A;  2WF7 A;  1B0X A;  1X9X A;  5ALT A;  4J9S A;  4C8M A;  1SXE A;  3N7S C;  4E0D A;  5T14 A;  5ALM A;  1TV9 A;  4MFA A;  5JUM A;  3HPO A;  1TK8 A;  3KKA C;  1NJX A;  3OVB A;  2DL0 A;  3SZ2 A;  5CJ7 A;  4Q45 A;  4X4N A;  3F2C A;  2G5H B;  3ICX A;  3C2M A;  4R8U B;  3RB0 A;  4ED0 A;  4KMO B;  4RNO A;  4RPY A;  4RQ7 A;  4RPX A;  2KFZ A;  1U9L A;  1Z4N A;  2RQ5 A;  1SV4 A;  5AI9 A;  4EYH B;  4UBC A;  1ZD3 A;  3ISD A;  8ICU A;  5ALX A;  1IV8 A;  3MBY A;  2VA8 A;  4KLJ A;  4YQW A;  4KLE A;  3QU4 A;  4EEY A;  3IV6 A;  8ICY A;  3JPT A;  4OAG A;  4DS4 A;  2HBM A;  3NVW A;  1Z00 B;  1SZP A;  2HHW A;  3V6K A;  2B6G A;  4F5N A;  1RXV A;  4U6P A;  4TUR A;  9ICO A;  4I2C A;  3H7I A;  4YD1 A;  1BPE A;  5GTI U;  4TUP A;  1PVP A;  4X4O A;  4M9L A;  4HX0 A;  1ZOL A;  3I1Y A;  2RDI A;  3T79 A;  1SV0 C;  1Y88 A;  5L1J A;  4NL9 C;  1BPY A;  4R8U A;  4OJL A;  1JMS A;  5KFT A;  3BQT A;  1B4F A;  1BPD A;  9ICJ A;  4B6J A;  1N2X A;  2HW3 A;  1JQR A;  2H3Z A;  1NKC A;  2LMR A;  2K4H A;  4EEK A;  2W43 A;  1JX4 A;  1ZQG A;  4DFJ A;  4BGD A;  4RQ1 A;  2A1J B;  4P4O A;  4ED2 A;  2K8C B;  3HRD D;  1VJ5 A;  3UXO A;  1Z00 A;  2KE7 A;  1RYS A;  1S77 D;  2VA3 A;  3AQN A;  4IL6 U; 
#chains in the Genus database with same CATH homology
 4WC0 A;  3QEB Z;  3H8J A;  9ICF A;  1LB2 B;  3EWA A;  8ICH A;  1D8Y A;  9ICE A;  4X4Q A;  4KTQ A;  5KG5 A;  4EBJ A;  3LWL A;  1TK0 A;  3JPS A;  4DL6 A;  3B0X A;  4TQS A;  4KN4 A;  1MSW D;  3V7L A;  5J0W A;  1SKS A;  3WFR E;  4DFM A;  4M2Y A;  3BQ2 A;  5CB1 A;  5KG3 A;  4I2J A;  5KT6 A;  3GIK A;  4MEX A;  3KHR A;  2RFF A;  5KFA A;  4DQP A;  4YN4 A;  3C1Z A;  4RT2 A;  4PH5 A;  2XC9 A;  4QWB A;  1SKR A;  1A77 A;  1KTQ A;  4I27 A;  4FS1 A;  2F1H A;  2FMP A;  3PVX A;  5IIO A;  5J2E A;  1QTM A;  2WTF A;  4TQR A;  5DG9 A;  5EWE A;  3PR4 A;  5HRD A;  9ICL A;  2ZTE A;  3MAB A;  4BWJ A;  5HRB A;  5KFK A;  5D4B A;  1S10 A;  3EW9 A;  4YD2 A;  5HNK A;  9ICK A;  1RXW A;  2GWS A;  1U49 A;  4YR3 A;  3MGI A;  3C5G A;  4DLG A;  2V9W A;  5KG2 A;  5DBC A;  7ICO A;  2W9C B;  5J2B A;  4WCW A;  1NK8 A;  4I2F A;  5KFH A;  3RAX A;  3HIY A;  3QZ7 A;  2ATL A;  2PI4 A;  8ICN A;  2IA6 A;  4O9M A;  2XGQ A;  4X4V A;  4KLM A;  2R8J A;  3EPG A;  4MEY A;  2P66 A;  3PW2 A;  4QZF A;  4TUS A;  8ICZ A;  4AT7 B;  3MR6 A;  3G6Y A;  8ICX A;  5J2J A;  4B9L A;  4BWM A;  2FLP A;  3H4D A;  1ZQX A;  3ZDB A;  3HW8 A;  8ICT A;  4RQ5 A;  2F1J A;  3EYZ A;  5DDM A;  2J6S A;  3KHL A;  1D9D A;  4RWP A;  2AGQ A;  4UAZ A;  2IMW P;  4WC2 A;  4KLH A;  4JUZ A;  2ZJ5 A;  4RT3 A;  4F5Q A;  1NK0 A;  5KG4 A;  1HUZ A;  1BPZ A;  4DSJ A;  3GIM A;  1H38 A;  4YR2 A;  1UEU A;  2PFP A;  4PHP A;  4HYK A;  2Y1J A;  2M2T A;  3OJU A;  2P6U A;  5C5J A;  4O0I A;  1ZQT A;  2DPI A;  3OVA A;  1IXR A;  4M9N A;  1Q78 A;  1ZJN A;  4QZ9 A;  1KDH A;  5J0R A;  3JPP A;  4UAY A;  3SV4 A;  4WC3 A;  4GXI A;  2XCP A;  1NK6 A;  1DK2 A;  4DOC A;  3UQ0 A;  2OWO A;  3PMN A;  3RRH A;  3UXN A;  4RWN A;  1RYR A;  1L3T A;  4Q8F A;  8ICP A;  1F5A A;  5DQG A;  2FMS A;  7ICG A;  3OUY A;  4WC7 A;  1JIH A;  5DGA A;  1ZQL A;  5KFL A;  4MFC A;  2BQR A;  1RPL A;  2C2D A;  4FHX A;  2W9C A;  5KFC A;  3PW7 A;  2HHX A;  4F5R A;  3WFO A;  3QE9 Y;  8ICK A;  9ICV A;  3PX6 A;  4NLN A;  4EZ9 A;  2ZJA A;  4KLG A;  3MR2 A;  3T5H A;  3TFR A;  7ICE A;  1ZQN A;  8ICL A;  3KHG A;  5HRE A;  4RNM A;  1CUK A;  2BKE A;  2HHU A;  4O3Q A;  4PHE A;  2W8K A;  1VJ7 A;  2KP7 A;  4ZH4 A;  4RUA A;  1NK4 A;  8ICF A;  1S0O A;  8ICB A;  4GC7 A;  2IBK A;  1BGX T;  3HP6 A;  4UB1 A;  4BDP A;  3MDA A;  4LZG A;  2O5A A;  4I2B A;  1X9M A;  4MF2 A;  5KT3 A;  3PY8 A;  4E7X A;  4ED8 A;  3ZDE A;  5DB6 A;  5D49 A;  4ECZ A;  3HT3 A;  5J0Y A;  7ICL A;  4FH3 A;  3Q8K A;  2ZH1 A;  4YFK A;  3HJ1 A;  4FH5 A;  5DQH A;  3C2K A;  1Z3E B;  1XO1 A;  4Z6F A;  5DLG A;  5CP2 A;  4RNN A;  1ZQS A;  5CWR A;  4PGY A;  2ASJ A;  1KRP A;  3RJK A;  3ORY A;  4I2E A;  9ICR A;  2R8K A;  2KZ3 A;  2M9N A;  4C8K A;  4NY8 A;  1UT5 A;  5HHI A;  8ICO A;  4QZD A;  4X5V A;  2UVW A;  4XRH A;  4KN7 A;  4QWA A;  2ZH5 A;  2H5X A;  4NLG A;  3WFP A;  4FBT A;  1TFR A;  2AGO A;  4B9V A;  1ZQV A;  4ELT A;  3M8R A;  2JZB B;  3LDA A;  3Q8R B;  2AJQ A;  1NJZ A;  3RB3 A;  5DBA A;  4PHD A;  4FHY A;  3GQC A;  5DBB A;  4UD5 A;  3KHH A;  2BQU A;  4X4T A;  2DVI A;  2NRV A;  3NYB A;  3V6J A;  4UB2 A;  4I2C A;  4YVZ A;  3AQK A;  3M9O B;  1ZET A;  2PFN A;  3GIJ A;  3BDP A;  3C21 A;  4G3I A;  4WC4 A;  4DL4 A;  2W8L A;  2PFQ A;  1KEJ A;  3OGU A;  4IQT A;  4FO6 A;  3UPS A;  4X4R A;  1ZQQ A;  2DR9 A;  3EZ5 A;  1S0M A;  4DSK A;  5KG7 A;  4RWQ A;  1PX5 A;  2ZH3 A;  3G6X A;  3RRG A;  3PML A;  4IQU A;  4KLQ A;  1L3U A;  3AU2 A;  4UB5 A;  3TAQ A;  4F8R A;  1KFD A;  2I1Q A;  3C1Y A;  4RQ6 A;  9ICT A;  5KG6 A;  5DB9 A;  1CEZ A;  1ZQW A;  8ICW A;  3T5J A;  2PFO A;  4KLL A;  1MIY A;  1XC9 A;  2NRK A;  4ED7 A;  5J2G A;  2NRT A;  1U48 A;  4UB3 A;  2M2V A;  1A76 A;  4GC6 A;  1SL2 A;  1R8B A;  5EWF A;  4O5K A;  9ICI A;  4ECR A;  1COO A;  4ECT A;  4LVS A;  5BOL A;  3PR5 B;  3MGH A;  1SL1 A;  5KFE A;  1N48 A;  4AT9 B;  3H40 A;  2BCU A;  1IM4 A;  5DG8 A;  3JPQ A;  1MQ2 A;  4IQV A;  1R89 A;  9ICH A;  1C7Y A;  4JWN A;  2Q66 A;  5KFQ A;  4IR1 A;  3TAR A;  1T8E A;  4FBU A;  4E80 A;  5J0U A;  7ICV A;  3JZ0 A;  2JZB A;  4P4P A;  2M2U A;  5J2D A;  2BHN A;  4FHP A;  4S3N A;  3OUY B;  1V9P A;  4RZR A;  4QW9 A;  9ICB A;  1XSN A;  3SYZ A;  5KT4 A;  3OV7 A;  2B21 A;  4O5E A;  3AUO A;  4UD4 A;  2HHV A;  8ICQ A;  4DL2 A;  5J2K A;  1XU4 A;  3H8S A;  3GV7 B;  3C5F A;  3V6H A;  4WBZ A;  4WC5 A;  4XUS A;  4KLF A;  4RQ8 A;  4O3O A;  4ELV A;  1X2I A;  5HMM A;  4QZG A;  4DQI A;  1B22 A;  1WCN A;  4NM1 A;  1DOQ A;  3K4G A;  5KT2 A;  3EPI A;  3T3F A;  3H3A A;  4DWI A;  4GXK A;  2V4R A;  2IHM A;  1ARO P;  5KG0 A;  2HVH A;  5IIJ A;  4XA5 A;  4TUQ A;  3H4B A;  1MIW A;  2V4Q A;  2NRZ A;  1TKD A;  1ZQR A;  4ECU A;  3RR8 A;  5DED A;  4ECW A;  5KFF A;  1NKE A;  5KFZ A;  4MF8 A;  5L1I A;  5DLF A;  2JEF A;  5KFW A;  3GFK B;  4DSE A;  5TZV A;  4NM2 A;  4DO9 A;  5KTQ A;  4WC6 A;  4RQ0 A;  1OU5 A;  4J9R A;  1ZQC A;  2BGW A;  8ICR A;  4J9Q A;  4ED3 A;  2JEG A;  1R8C A;  2BCS A;  2C22 A;  3MDC A;  1QLN A;  5KFR A;  4R63 A;  1ZQP A;  1T3N A;  1WOT A;  2ZH8 A;  4R64 A;  4DF4 A;  4AT9 A;  1JN3 A;  3MR5 A;  4MFF A;  7ICN A;  1SKW A;  2XO7 A;  4I2I A;  4J9L A;  4ECX A;  4ED6 A;  4B9N A;  4KLI A;  9ICU A;  3TAP A;  2M2W A;  1JAJ A;  4XQ7 A;  3OSN A;  1DK3 A;  2C2E A;  1QSS A;  4J9K A;  3RBE A;  1ZQK A;  1XS9 D;  3Q8Q B;  2KZM A;  1T7P A;  5KFB A;  3V7K A;  3PV8 A;  2DPJ A;  8ICM A;  5J0O A;  2ZTC A;  4F5O A;  3QEA Z;  4QW8 A;  1NJY A;  8ICC A;  1KFT A;  5DEC A;  2DFL A;  4F4K A;  4DFK A;  8ICJ A;  4DQQ A;  3PW4 A;  7ICT A;  8ICS A;  5L1K A;  3UQ2 A;  5HRH A;  4ECV A;  5HML A;  4R65 A;  2ISO A;  3JYY A;  3ZD9 A;  2ZHA A;  1PZN A;  3C23 A;  5CA7 A;  5DB8 A;  3ISC A;  2ZUD A;  3FYH A;  2XGP A;  4F4W A;  4DS5 A;  3RJG A;  5KFJ A;  4QZI A;  3PW0 A;  1ZQI A;  4JV1 A;  4FS2 A;  3PO5 A;  3UPQ A;  4ELU A;  1UEV A;  1TFW A;  1HJP A;  3TAN A;  2JEI A;  2LYH A;  2ZH7 A;  2Y1I A;  2BPF A;  4F91 B;  4YR0 A;  2AU0 A;  4QWD A;  4QZ8 A;  1L5U A;  2UVR A;  4P4M A;  4F4Z A;  5KT5 A;  3BQ1 A;  4ECQ A;  4QZB A;  3TI0 A;  4I28 A;  3OJS A;  5J0P A;  4DSF A;  2W9B A;  4O3N A;  8ICV A;  5CHG A;  4O3S A;  4XQ8 A;  4B9T A;  4UAW A;  4DOA A;  7ICJ A;  1DGS A;  4DQS A;  3QZ8 A;  4QZC A;  4NLK A;  5KFD A;  3GDX A;  4QZE A;  2R8I A;  2ZH4 A;  4DOB A;  2JEJ A;  2HHP A;  3SI8 A;  4DSL A;  2DR7 A;  4NXZ A;  1UA1 A;  4EBK A;  2XY6 A;  3AU6 A;  2DR5 A;  4PGQ A;  1TVA A;  4YMM A;  3ZDA A;  3GII A;  5J0Q A;  1QSL A;  2FMQ A;  3FDS A;  2FPM A;  1XSP A;  4DL7 A;  2IHN A;  4IRD A;  4M9H A;  4I2G A;  3LQC B;  1S76 D;  1Q79 A;  2ZUC A;  5KFM A;  3RJJ A;  3M9N B;  2Q0Z X;  4JK1 A;  2RDJ A;  3H37 A;  3BJY A;  4UQG A;  1U45 A;  2ZTD A;  4PPX A;  2HVI A;  3RJE A;  1TAQ A;  4EBC A;  4DF8 A;  5HRG A;  4Q44 A;  3PX4 A;  3ZDC A;  2BPG A;  5DGB A;  4B9U A;  1X9S A;  3AQM A;  1L3S A;  5KFU A;  9ICP A;  3NTU A;  4I2D A;  3RBD A;  1JXL A;  3JPO A;  1ZQB A;  4I29 A;  4JV2 A;  8ICA A;  9ICX A;  3WFS C;  5J2A A;  2BCV A;  3K75 D;  5HHH A;  3UXP A;  2BCQ A;  4F3O A;  1BNP A;  3PX0 A;  4KLO A;  1BPB A;  2PI5 A;  7ICU A;  3M8S A;  5BPC A;  4YP3 A;  2XY7 A;  1ZQA A;  4Z6D A;  3RH6 A;  3GV5 B;  1S97 A;  2HHQ A;  4BXO B;  3E2E A;  3C66 A;  4DSI A;  4I2H A;  1ZYQ A;  2O1P A;  4PHA A;  5J2I A;  4RUC A;  1KSP A;  1ZQO A;  1B43 A;  1TAU A;  4LT6 A;  9ICM A;  2FPK A;  4Z6C A;  3MFI A;  5J29 A;  7ICS A;  1K1S A;  4KLS A;  3BQ0 A;  5HRL A;  2ZUB A;  3H38 A;  1WCL A;  4NKT A;  4X0A A;  4IG8 A;  2ALZ A;  3OHB A;  4X0B A;  5HRI A;  2XY5 A;  2FPL A;  5HR9 A;  4AT8 B;  4F4X A;  3L9D A;  4YMO A;  3KTQ A;  1ZQF A;  4C8L A;  4ECS A;  4EP7 A;  4O5C A;  5KFS A;  3GV8 B;  1NO5 A;  4RQ3 A;  5DKW A;  3N97 B;  4B9S A;  9ICG A;  4F2R A;  5HRF A;  5DDY A;  2FLL A;  3Q8L A;  3RAQ A;  2BQ3 A;  5KFV A;  4F50 A;  3LK9 A;  2F1I A;  2ZH2 A;  4LZD A;  5KFN A;  1KLN A;  4K4G A;  7ICF A;  4YG2 A;  9ICN A;  4X4S A;  4X4U A;  4YXM A;  3HWT A;  1UET A;  1D8L A;  1T4G A;  4QWC A;  3ZD8 A;  3C2L A;  3NGD A;  1KFS A;  3IM1 A;  5KFY A;  4YMN A;  1RZT A;  1ZQM A;  2DRA A;  4KLD A;  3H39 A;  4K4I A;  5BOM A;  1U4B A;  2ZH6 A;  2MUT B;  5L9X A;  4JV0 A;  4EBD A;  1TK5 A;  8ICG A;  4K4H A;  1NK9 A;  3AQL A;  4BXO A;  1S0N A;  1ZQE A;  1ZJM A;  7ICQ A;  2ZJ8 A;  4UB4 A;  4RWO A;  4ATB B;  2PXI A;  3GIL A;  2C28 A;  1NKB A;  4I2A A;  9ICS A;  4DL5 A;  5KT7 A;  4IQW A;  4QWE A;  2KFN A;  1ZQU A;  3TFS A;  1FA0 A;  2BR0 A;  1ZQY A;  5KG1 A;  2W9A A;  4J9P A;  4GXJ A;  2W9B B;  3H8W A;  5EWG A;  5L1L A;  5IIM A;  3N4M B;  1ZQD A;  5KFX A;  2KZZ A;  7ICH A;  5DG7 A;  3RJF A;  4RQ2 A;  2KN7 A;  4M6W A;  5HP4 A;  4KIT B;  3M9M B;  5J0T A;  5D46 A;  3ISB A;  2A1J A;  1YLQ A;  4O3P A;  4YXJ A;  4ECY A;  2ZH9 A;  4AT8 A;  4J9M A;  1UA0 A;  1V4A A;  5DQI A;  2ASL A;  3RR7 A;  2I9G A;  4F5P A;  2ID1 A;  3ETL A;  4GLX A;  1XSL A;  3C18 A;  5IIK A;  4QZH A;  2UVU A;  1LV5 A;  3Q8M A;  4J9N A;  7ICI A;  4F4Y A;  3TQ1 A;  1ZQJ A;  4KLU A;  4M9J A;  1EXN A;  1BVS A;  3B0Y A;  3G6V A;  1NJW A;  1MIV A;  1S0V A;  2BE3 A;  4EBE A;  1N56 A;  3MR3 A;  2R8H A;  2DR8 A;  4J9S A;  4UBB A;  4C8M A;  1QSY A;  4E0D A;  4O3R A;  1XWL A;  3IHQ B;  1TV9 A;  4M47 A;  1NZP A;  4MFA A;  5JUM A;  3HPO A;  9ICA A;  4RPZ A;  1TK8 A;  3Q8S B;  5J0X A;  2MAX A;  5J2C A;  1TFY A;  5J2F A;  1NJX A;  4DL3 A;  1BNO A;  3OVB A;  2HHW A;  2MUT A;  2PBE A;  5F2V O;  3SZ2 A;  5CJ7 A;  3Q8P B;  3V7J A;  4Q45 A;  4JWM A;  3OHA A;  5J2H A;  4Q8E A;  4X4N A;  5KFP A;  4IRC A;  3C2M A;  4R8U B;  3RB0 A;  3RB4 A;  1L3V A;  1NK5 A;  4ATB A;  4ED0 A;  2AQ4 A;  4FHW A;  4RNO A;  2VA2 A;  4RQ7 A;  5F9L A;  4RPX A;  4RPY A;  1U9L A;  1K1Q A;  1NOM A;  5KFG A;  3PW5 A;  1X9W A;  2KFZ A;  1VFG A;  4EYH B;  4UBC A;  3HX0 A;  2AGP A;  1ZQH A;  2UVV A;  3ISD A;  8ICU A;  7ICK A;  3MBY A;  2VA8 A;  4KLJ A;  4YQW A;  4M9G A;  4KLE A;  2XCA A;  3OSP A;  4P2H A;  3T5L A;  4M04 A;  2VAN A;  2FLN A;  4EEY A;  4CCH A;  2DRB A;  2NRX A;  9ICW A;  8ICY A;  2W9M A;  3JPT A;  4YCX A;  4DS4 A;  3RB6 A;  2R8G A;  4AT7 A;  3OVS A;  4NKU A;  2NRW A;  8ICE A;  2BPC A;  4WC1 A;  5EOZ A;  1Z00 B;  1SZP A;  4C8N A;  4R66 A;  4Z6E A;  4RU9 A;  4ED1 A;  3V6K A;  4DFP A;  1BPX A;  2BCR A;  4RQ4 A;  5HRK A;  3WFQ E;  4F5N A;  1RXV A;  4TUR A;  2HHT A;  9ICO A;  1R8A A;  3RH5 A;  2ASD A;  4F92 B;  5J0S A;  3JPR A;  3H7I A;  4YD1 A;  1BPE A;  4TUP A;  4PGX A;  5IIL A;  2J6U A;  8ICI A;  4X4O A;  5HC9 A;  4M9L A;  3SV3 A;  4J9O A;  2RDI A;  4DQR A;  4FHV A;  4NLZ A;  4WBY A;  3V72 A;  1Y88 A;  3MFH A;  5L1J A;  1BPY A;  2ISP A;  4B9M A;  5III A;  1MC8 A;  3HJ4 A;  5KFO A;  4R8U A;  4F93 B;  1S9F A;  3RJI A;  3RH4 A;  1HUO A;  1JMS A;  1MQ3 A;  5KFT A;  2HHS A;  4IR9 A;  4X4P A;  7ICP A;  3BQT A;  3RTV A;  4KMU A;  3JPN A;  1BPD A;  4M5D A;  3PO4 A;  4IRK A;  5CR0 A;  4QZA A;  9ICJ A;  4DLE A;  4EZ6 A;  1KNY A;  1U47 A;  2HW3 A;  2P6R A;  3THV A;  1JQR A;  2ZHB A;  4E8F A;  4Q43 A;  4DEZ A;  5DB7 A;  1NKC A;  1SL0 A;  2AQ0 A;  1D9F A;  1UT8 A;  4C8O A;  1ZQG A;  2C2R A;  1JX4 A;  4KLT A;  9ICQ A;  4M6W B;  4EYI B;  4DFJ A;  3RJH A;  4BGD A;  4RQ1 A;  5IIN A;  7ICM A;  2A1J B;  4P4O A;  2KTQ A;  2J6T A;  4ED2 A;  1NK7 A;  5KFI A;  5F9N A;  3PNC A;  4M0A A;  7ICR A;  4F2S A;  3LWM A;  3UXO A;  1Z00 A;  3T5K A;  1RYS A;  1S77 D;  9ICC A;  2VA3 A;  2BDP A;  3ZDD A;  3AQN A;  1ZQZ A;  1JXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...