4MFFA

Structure of human dna polymerase beta complexed with o6mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mffA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mffA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mffA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mffA03
4O5EA 1UETA 4PGYA 2ZJ8A 2FLNA 4JK1A 5J0TA 4EBJA 4J9LA 3V7JA 7ICIA 7ICOA 5D49A 2HHWA 3ISCA 3OGUA 4QZEA 4TUQA 4WC0A 4TUSA 4F5RA 1NK9A 4IQVA 3OHAA 2P6UA 3ZDCA 3TARA 3T5KA 4M9NA 3QEAZ 2ISOA 5KG0A 4UB4A 1EXNA 4LT6A 1V4AA 4O3NA 4QW9A 5KG3A 3PNCA 7ICVA 4KLHA 3SI8A 3T5LA 4ECUA 3PY8A 5KFOA 8ICCA 4RT2A 2J6TA 4PHAA 4YMNA 5DBAA 4Q43A 4WCWA 3RJFA 1NK4A 4F2SA 4RU9A 3MGIA 4M9JA 4YG2A 4QZHA 1ZQDA 3UPSA 1TVAA 5CR0A 2OWOA 1JIHA 4QWBA 4FS2A 3RRGA 3C21A 3BDPA 3RJIA 2FMSA 3RB3A 3MFIA 1WCNA 4F5OA 1MIVA 5J0SA 4DS5A 2KZMA 5KFAA 3GDXA 1KDHA 2UVVA 5KFEA 5KFKA 4K4GA 3WFOA 1T8EA 1X9MA 8ICPA 4R66A 3GIIA 1JXEA 4Q8EA 3OVAA 5HMLA 5F9LA 3MR3A 2BQ3A 4B9VA 1UT8A 5CJ7A 3RB4A 8ICWA 1WOTA 5KFPA 5KTQA 4UBCA 3M9MB 3JYYA 4KLDA 3C66A 4RQ4A 5KFIA 2XC9A 4UD4A 4P4OA 2A1JB 3TQ1A 4FHXA 4UAYA 1ZQPA 5BOLA 1ZQVA 2W9BB 4ECXA 4Z6FA 3H8SA 3H38A 1PX5A 1ZQGA 4O0IA 4RUAA 3WFPA 4EYHB 4Z6CA 4ED1A 5CA7A 1KLNA 2ZTCA 4M9HA 3MR5A 5HRIA 1QTMA 2Y1IA 1COOA 4DWIA 4F4ZA 2KFNA 4RT3A 2J6UA 1BGXT 4F4YA 1KTQA 4O3OA 4DO9A 5DG8A 4QWEA 4UD5A 4RWQA 3EPIA 8ICVA 4UB3A 5F9NA 4DL2A 2PBEA 4TUPA 2W9AA 2XCAA 1XC9A 2FLPA 4IRDA 5DBCA 1SL1A 1BNOA 3HJ4A 8ICYA 4R8UB 4GXIA 1N48A 3AQMA 2XGPA 4O5CA 5DEDA 1Z00A 1TFRA 1U49A 2O5AA 4F5QA 3EYZA 4X0BA 5KFCA 4B9MA 3TI0A 1NK0A 3AU2A 1XO1A 3GIMA 1K1SA 2M9NA 3TFSA 4RQ3A 4DL7A 4C8OA 1VJ7A 4XQ7A 4F91B 4UBBA 4UB1A 5HRLA 1JMSA 3C2KA 2R8GA 3L9DA 4DQPA 4KN4A 5KFBA 4DSEA 8ICBA 2HVHA 5HRDA 4PGQA 5DB8A 9ICWA 4EYIB 1SL2A 9ICOA 2C2EA 5EOZA 3C5FA 4AT9B 4ZH4A 1NKCA 4RNOA 4UB5A 5DGAA 1ZQLA 3PR5B 1S0NA 3RRHA 3RR8A 5EWFA 3KHLA 4NM2A 4WC7A 4MFFA 5L1LA 3T3FA 2XO7A 5D46A 2V4RA 1RXVA 2J6SA 1ZJMA 9ICSA 4WBZA 5HRGA 4EEYA 7ICHA 3HIYA 1ZQFA 4B9TA 4NM1A 2HHTA 4FBUA 5HRHA 3OVSA 3TFRA 3RJJA 4F92B 5KFYA 5KT6A 1A77A 3M9NB 4ED3A 3T5JA 4DFPA 5DGBA 5KFRA 2AQ4A 3JPSA 2M2UA 4C8KA 1ZQAA 2PFQA 4FHPA 4KLUA 3LDAA 2ZUBA 1X2IA 2XY7A 2R8KA 1HUOA 3H40A 4ATBB 3RJKA 3HPOA 1JN3A 4IQUA 2FPKA 2BCRA 1MC8A 5DLGA 2IHNA 4KLQA 1RYSA 5KFGA 5DDMA 1UA0A 2DRBA 4ED8A 5DG7A 1JQRA 1ZQBA 5L9XA 4QZ8A 4E0DA 4AT7A 4P4MA 3GQCA 4BXOB 1ZQEA 4XA5A 4BDPA 4I2HA 4R64A 2IBKA 1MIWA 4DS4A 1UEUA 3BJYA 5KFFA 5L1JA 4DOCA 3H7IA 3PVXA 3RB0A 4DFJA 2XGQA 3PW5A 2PFOA 4B9NA 2W9CB 4I2DA 3KTQA 1ZQUA 4YD2A 3Q8KA 4NLGA 1ZQYA 4MEXA 3OUYA 3UXPA 3OHBA 5KFXA 5KT7A 4WC5A 3OSPA 1S9FA 8ICNA 4K4HA 4X4VA 2UVUA 3H4BA 3RBDA 4EBEA 4JV0A 5HMMA 4I29A 3LK9A 9ICPA 1TV9A 2UVWA 4TQRA 2C28A 1TKDA 1D8YA 2JEFA 2FLLA 4Q8FA 4QZIA 1MQ3A 4KLLA 3ZDAA 4F2RA 2V9WA 5J0UA 5KFNA 4ECYA 7ICKA 3UQ2A 4X0AA 1KSPA 2JZBA 4CCHA 4I2BA 4MFAA 4F4WA 3RJGA 1ZQJA 1XS9D 2O1PA 5KT4A 4YN4A 4GXKA 3V6KA 3Q8QB 2PXIA 1SKWA 1BPZA 4Q45A 2BCUA 9ICCA 5J0OA 4RPYA 1XSNA 2P6RA 2DR8A 3C2MA 2BDPA 1ZQWA 8ICRA 7ICSA 2Q66A 1NOMA 3ETLA 5HREA 4MF8A 2RFFA 9ICGA 5DQGA 4RNNA 4ECVA 2ASDA 1UEVA 5HHHA 4O9MA 1H38A 9ICTA 5IILA 1S0MA 5KFDA 4IG8A 1ZQTA 4NY8A 4XQ8A 3G6XA 2ZH3A 1Q79A 3ZD8A 4ECTA 5J0PA 4PHEA 1ZQRA 3RJHA 2NRXA 5KFHA 7ICFA 9ICEA 1XWLA 8ICIA 2C22A 4P4PA 2BPFA 7ICQA 4F4XA 4QW8A 5IIJA 2HHSA 3Q8LA 9ICMA 8ICUA 4C8NA 5DQHA 2P66A 3PO4A 1NO5A 4ELTA 4M9GA 2ZTEA 3MDCA 3KHHA 1JX4A 1NZPA 2HHVA 4YXJA 4YR2A 2C2RA 4DOAA 3Q8SB 4DQQA 2BPGA 4GXJA 8ICAA 4RQ5A 8ICGA 2H5XA 2ZJAA 3TAPA 3EPGA 2JEJA 4IR1A 1Q78A 2ZH5A 4M2YA 3MR6A 5J0XA 3LWLA 1KFDA 4IR9A 1T4GA 3PW4A 1LB2B 4X4OA 9ICVA 1U48A 5IIMA 2FMPA 3ZDDA 4ED7A 4R65A 2BE3A 3AQLA 2AQ0A 2W8LA 4ED6A 2BQUA 4YR3A 1R8BA 4KLOA 4F5PA 4RUCA 4DFMA 2BCQA 2GWSA 9ICQA 4EP7A 5DB6A 1XSLA 4I2FA 4FHYA 3PMLA 2LYHA 2M2TA 4DF4A 1ZQQA 1ZQIA 5D4BA 4NLNA 3UPQA 4IRCA 2ZH2A 3QZ8A 5L1KA 2BPCA 4QZFA 3G6VA 4DEZA 2ZHAA 2NRTA 4YP3A 8ICQA 3UXNA 9ICBA 2A1JA 4QZ9A 5KG7A 3JPNA 3V7LA 2W9BA 4C8MA 4M04A 4RWPA 3EWAA 1SKSA 1NJZA 3KHGA 7ICEA 4S3NA 3H3AA 2BGWA 4BWJA 4AT8B 4WC4A 4E80A 9ICHA 4TURA 4I28A 2ZH7A 2ZTDA 3BQ0A 1TAUA 7ICTA 5J2JA 4M0AA 5JUMA 4DFKA 3N97B 4X4RA 3Q8RB 4RQ1A 1BPEA 1V9PA 3GV8B 4PPXA 2RDIA 2B21A 3KHRA 4WBYA 1NK5A 3V72A 1NJWA 2IA6A 8ICTA 4B9SA 1D8LA 4R8UA 4BWMA 2RDJA 3RJEA 4I27A 1MIYA 3RTVA 5J2BA 2Q0ZX 3SV3A 5KFLA 7ICLA 2ZUDA 1S0OA 5KG6A 4MEYA 3V6JA 1ZQNA 1QSYA 4ECQA 1ZQSA 4QZBA 2BHNA 5DECA 3RR7A 1B22A 3LQCB 3OVBA 4LZDA 3MR2A 4I2JA 4FBTA 2VA2A 3NYBA 1B43A 5KG4A 1JXLA 4DF8A 2PFNA 4J9PA 2VA3A 4F4KA 1L3UA 1L3SA 4KLJA 3PW7A 3PV8A 4RPXA 3NTUA 4ELUA 4DL6A 1R8CA 4AT9A 2C2DA 2MAXA 2UVRA 4RQ6A 1CUKA 1KEJA 3JPQA 5J2HA 3LWMA 5L1IA 1A76A 1WCLA 1NK8A 4DOBA 4IQWA 4J9OA 1AROP 3H8JA 4M6WB 5KG5A 5KFWA 4RQ0A 1XU4A 4QWDA 5KFZA 4KLTA 2ZH6A 3JPRA 4O5KA 1R8AA 4FHWA 2ZH1A 4BGDA 2R8IA 3PX6A 8ICEA 4YQWA 4UAZA 3JPPA 9ICIA 9ICUA 3V6HA 1RZTA 4WC3A 5J29A 4I2GA 2JEIA 4JV2A 2XCPA 5DG9A 4XRHA 3RH4A 3NGDA 3C1YA 1T3NA 2BKEA 8ICKA 4M5DA 1DGSA 5KT3A 2ASLA 2FPMA 4QZDA 1ZQOA 1Y88A 3PMNA 1BPDA 2VA8A 4FS1A 8ICFA 8ICHA 2MUTB 3GIJA 2F1IA 2KZZA 1ZQMA 4PH5A 4ATBA 4Z6EA 3H8WA 4X5VA 2F1HA 2JEGA 4LVSA 8ICXA 3PW0A 4E7XA 4ED0A 5J0WA 3WFQE 4ECWA 1UT5A 3WFSC 3IHQB 4KN7A 5DBBA 3M9OB 3V7KA 2ZH8A 5HC9A 4X4TA 4BXOA 5KFSA 4EZ6A 8ICJA 1U9LA 4O3RA 1TK0A 4YMMA 2DR9A 3GILA 1SZPA 3RH5A 4YVZA 4TQSA 2ZUCA 5J0YA 2W9CA 5IINA 3Q8MA 1ZYQA 5KFVA 4K4IA 1ZQXA 3AQNA 2DRAA 3GIKA 2R8HA 4QZGA 2VANA 2XY5A 4QWAA 4J9QA 1U4BA 1NJYA 2ZJ5A 1ZQCA 2PI5A 2NRVA 3MFHA 4FH3A 4DL5A 3ZDEA 2AJQA 1X9SA 9ICKA 4YFKA 3JPTA 9ICLA 1YLQA 3JZ0A 3PO5A 5DB7A 4NLZA 3Q8PB 4R63A 3OSNA 4J9MA 4NKTA 4ELVA 1IM4A 5J2FA 2BCVA 4DQIA 4WC6A 2KFZA 4DL4A 2PI4A 1BPBA 1SKRA 4PHPA 1S97A 4DSJA 3IM1A 1DK3A 3N4MB 4O3QA 3UQ0A 3PW2A 3K4GA 4I2IA 3RH6A 2ASJA 1UA1A 1L5UA 5J2CA 2HHQA 3RAQA 2M2WA 2DVIA 4KMUA 9ICFA 4E8FA 3BQ1A 2AU0A 4UB2A 5J2GA 7ICJA 9ICAA 5KFJA 1MSWD 3C1ZA 9ICXA 1ZQHA 4KLFA 3C5GA 2WTFA 4X4QA 3THVA 1BNPA 4YXMA 4F93B 2FPLA 5HR9A 4X4SA 4KLGA 3FDSA 4O3PA 1RPLA 5HHIA 5J2EA 3OJUA 3G6YA 3M8RA 2DPJA 4KTQA 5BOMA 7ICRA 2NRWA 1L3VA 1KFSA 3EW9A 4RQ7A 3C18A 5KT5A 3GV7B 3GFKB 5TZVA 1Z3EB 4PGXA 4X4NA 3ZD9A 4LZGA 4KLMA 4X4PA 3WFRE 1BPXA 3GV5B 2KP7A 3RB6A 3B0XA 3BQTA 2KZ3A 4J9NA 2W9MA 4UAWA 4JWMA 1DK2A 5HRKA 4YD1A 1ZJNA 5J0QA 3JPOA 4DLGA 4DL3A 1SL0A 5HRBA 1ZQZA 5KG2A 5CB1A 1ZETA 2DPIA 1D9DA 5CHGA 2HVIA 4FH5A 3PX4A 2Y1JA 3QE9Y 1BPYA 5DDYA 4GC6A 3MDAA 4ECRA 4KLSA 4RPZA 4Q44A 2AGQA 2ZHBA 1NKEA 1NJXA 7ICMA 2PFPA 5J2AA 4NLKA 1D9FA 3OV7A 1Z00B 3TAQA 4J9KA 4JWNA 9ICNA 2ID1A 1VFGA 1TFYA 4HYKA 5KG1A 4GC7A 1ZQKA 3BQ2A 4EZ9A 2HHPA 3B0YA 5J0RA 3HX0A 1RYRA 1NK6A 4DQRA 5F2VO 2V4QA 4ECZA 4F50A 2ATLA 1S10A 4F3OA 2ISPA 4NXZA 3ISBA 1QSSA 4YR0A 4FO6A 2NRKA 5KT2A 4IQTA 4B9LA 4G3IA 4I2CA 3PX0A 1S77D 1QSLA 2FMQA 1CEZA 4QZCA 2W8KA 1N56A 4RNMA 2KN7A 1U47A 3OJSA 1BVSA 5J2KA 2IMWP 1S76D 5HNKA 7ICGA 2HHXA 4AT8A 4WC2A 1X9WA 4YMOA 3TANA 4RQ2A 4QZAA 4KLIA 2ZH4A 1TFWA 3MBYA 5CWRA 4F5NA 5HP4A 3ORYA 3RBEA 1HJPA 3QZ7A 7ICNA 3SYZA 4EBKA 4O3SA 5IIKA 3SZ2A 1QLNA 4NKUA 4DQSA 4JUZA 3EZ5A 1TAQA 4PHDA 5CP2A 5KFQA 4DSKA 1K1QA 4DSFA 5DKWA 4M9LA 1JAJA 4F8RA 3H39A 4FHVA 5DLFA 1KRPA 2DFLA 2R8JA 3SV4A 3HWTA 5KFTA 4M47A 3AUOA 3K75D 3AQKA 2DR5A 3PR4A 4XUSA 1PZNA 1U45A 1HUZA 4AT7B 4DSLA 4QWCA 2HHUA 8ICOA 8ICSA 4UQGA 5EWEA 1C7YA 8ICMA 2NRZA 2KTQA 2AGOA 1R89A 1RXWA 4RQ8A 4I2EA 4RWOA 1XSPA 3T5HA 2I9GA 1KNYA 3E2EA 5J2DA 7ICPA 5IIOA 1NKBA 1T7PA 1FA0A 3OUYB 4RZRA 4EBCA 2AGPA 2IHMA 4C8LA 4M6WA 3ISDA 4J9RA 1TK8A 4KLEA 4B9UA 4IRKA 2BCSA 3MABA 5DQIA 3MGHA 1IXRA 9ICJA 1KFTA 2I1QA 5KFUA 3HP6A 1NK7A 5C5JA 2ALZA 4Z6DA 4EBDA 4MFCA 3HT3A 2XY6A 2BQRA 4P2HA 2M2VA 1F5AA 2ZH9A 3QEBZ 4RWNA 4DLEA 4ECSA 2HW3A 3C23A 4YCXA 4J9SA 5IIIA 1MQ2A 3ZDBA 3HJ1A 3RAXA 1TK5A 4JV1A 4X4UA 4I2AA 4KITB 2F1JA 3FYHA 4DSIA 3HW8A 2BR0A 2JZBB 7ICUA 2MUTA 5HRFA 4WC1A 3M8SA 3UXOA 1DOQA 5KFMA 5EWGA 3AU6A 8ICZA 8ICLA 3H4DA 4ED2A 2DR7A 5DB9A 1L3TA 5J2IA 4MF2A 9ICRA 1OU5A 3C2LA 3H37A 1S0VA 5BPCA 1LV5A 4GLXA
chains in the Genus database with same CATH superfamily
2ZIWA 3M6KA 3NKUA 4PGYA 2ZJ8A 1WWUA 1FEZA 1JUDA 5CFSA 3ISCA 3OGUA 1OUQA 3H0RB 5AICA 4IQVA 4UW9A 3F2CA 5KG0A 1EXNA 1SXEA 2HMXA 2MU2A 5KG3A 7ICVA 5KFOA 8ICCA 2J6TA 5DBAA 5CRXA 4OAIZ 4WCWA 5ALKA 3MGIA 4YG2A 3UPSA 3KBBA 5KL8B 5HR6A 2BBHA 3KZIU 3RJIA 4JLXA 1L7NA 2WF5A 4F5OA 2UVVA 5KFEA 1S8OA 4XJEA 2JH1A 3GIIA 3BZCA 5CJ7A 3JYYA 4UBCA 3M9MB 3C66A 5EE1A 4P4OA 2K4IA 2CXYA 3L5KA 4UAYA 2XICA 1N63A 5AM2A 4ECXA 4O0IA 3MR5A 4F4ZA 2KFNA 3SD7A 1KTQA 4O3OA 2XCAA 3HJ4A 8ICYA 4R8UB 4USAA 3AQMA 1TFRA 4FZLA 5ALMA 2P35A 3OPXA 3PSFA 3O0FA 1NK0A 3TFSA 4RQ3A 1B4FA 1VJ7A 4XQ7A 2HBMA 5HRLA 4DSEA 2C2EA 1SWWA 3C5FA 4NV0A 4AT9B 5DGAA 3RRHA 4C4SA 5EWFA 4LEZA 4WC7A 4MFFA 4WBZA 1RXVA 2WF6A 4EEYA 3D2SA 5HRHA 3TFRA 3RJJA 5KFYA 4DFPA 5KFRA 2ZXHA 5AM1A 2M2UA 5G5GA 3CP8A 3LDAA 1KQQA 2R8KA 4FFDA 3RJKA 1JN3A 2B0CA 1RYSA 5KFGA 1UA0A 1VJ5A 2KKPA 1ZQBA 4BDPA 1UCVA 1UHUA 4DOCA 2KTQA 3PW5A 1ZQYA 4MEXA 3OUYA 5AI9A 3OSPA 8ICNA 4K4HA 1J2NA 4RQNA 2UVUA 3H4BA 9ICPA 4KMOB 4CE6A 2JEFA 2FLLA 2A3VA 4ECYA 3UQ2A 4C80A 4I2BA 5KT4A 2PXIA 3NVWA 1FIQA 1XSNA 1ZQWA 2Q66A 3D2QA 9ICGA 1QCKA 1UEVA 1F44A 5IILA 3G6XA 4P4PA 7ICQA 3T79A 9ICMA 1JX4A 1Z4OA 1A6SA 4YR2A 5AM3A 8ICAA 2KJ5A 8ICGA 2ZJAA 2ZH5A 3EPGA 3MR6A 1T4GA 3PW4A 4OAFA 5IIMA 3ZDDA 2AQ0A 4ED6A 2BQUA 4AYBC 4YR3A 2OH2A 5AKIA 3PMLA 2M2TA 1JI7A 5D4BA 2HOIA 1OW5A 3G6VA 2ZHAA 2NRTA 8ICQA 2G0AA 9ICBA 3M7DA 3JPNA 4C8MA 1SKSA 4S3NA 4OCZA 4AT8B 4WC4A 3KKAC 5J8YA 1PVRA 2EDUA 4TURA 2ZTDA 1TAUA 2H3QA 2OHFA 4U6PA 4DFKA 3GV8B 1F5SA 2EAPA 1NJWA 2PMZF 1D8LA 4R8UA 3IRUA 1LVHA 2Q0ZX 5KG6A 2DQNB 1ZQSA 5DECA 2KICA 3RR7A 3OVBA 2VA2A 1MN8A 5AKKA 3F53A 3NRZA 4J9PA 4RPXA 2LPEA 4AT9A 2C2DA 2MAXA 4RQ6A 1CUKA 5L1IA 1RDFA 3LWMA 1WCLA 4O3RA 1AROP 4M6WB 4O5KA 4FHWA 2R8IA 8ICEA 9ICUA 3J81j 4EEBA 3V6HA 4I2GA 5DG9A 3RH4A 4NXVA 3NGDA 3C1YA 3TADC 2A1AA 1BPDA 4AP9A 4PH5A 4LVSA 4HX0A 3CW2C 8ICXA 1M6YA 3HKZC 3PW0A 3QUCA 4Y2JA 2HBLA 5DBBA 1KW4A 2WAQF 8ICJA 3WU2U 1TK0A 2F8LA 4YVZA 3WKAA 5J0YA 3AQNA 4LEWA 2CRXA 1U4BA 4CF4A 2OEHA 4DL5A 3ZDEA 2AJQA 2OM6A 5T14A 5ALUA 4BJQA 3ICXA 4NKTA 5J2FA 2PI4A 1DK3A 4K9AA 3IM1A 3N4MB 5KAFU 3UQ0A 3F5EA 4IL6U 2M2WA 5ALHA 4GFJA 2F8KA 2KD1A 3C1ZA 1RQNA 1PVPA 2G09A 2FI1A 2KVCA 5AK5A 3C5GA 4KLFA 4X4QA 5HR9A 2FPLA 3OJUA 4NJ8A 3M8RA 4F71A 5ALLA 5ALRA 3KKAA 1L3VA 1WG8A 1KFSA 4WQKA 5ALTA 1Z1BA 3GV7B 3ETRA 1Z3EB 1S5LU 3ZD9A 4X4PA 3DEEA 1BPXA 2KP7A 3RB6A 3BQTA 3CRXA 4UAWA 4JWMA 5HRKA 1DK2A 4YD1A 2ODGA 4KX5A 4DL3A 1SL0A 1ZQZA 1ZETA 1D9DA 4WH5A 3QE9Y 4ECRA 4RPZA 2PFPA 4NLKA 1Z00B 4J9KA 5AI8A 9ICNA 1VFGA 4HYKA 5F2VO 2V4QA 5G5HA 2ATLA 1S10A 2D3DA 3QU7A 4B9LA 3PX0A 2W03A 1QSLA 1CEZA 4QZCA 2W8KA 1N56A 4Y2SA 1U47A 1S76D 4AT8A 3HJEA 1X9WA 3TADA 4CRXA 2WF8A 4F5NA 2K4EA 2HN2A 4EBKA 2IUBA 1GPJA 3EF2A 1TAQA 4PHDA 5KFQA 4F8RA 2YMLA 5EE0A 2R8JA 4M47A 4C4RA 3BZKA 3ONNA 4UQGA 1XO0A 8ICMA 1RXWA 4RWOA 3T5HA 3NS1A 3E2EA 1NKBA 5ALIA 4RZRA 2MSNA 4M6WA 3E0FA 2Y0SC 2BCSA 9ICJA 1KFTA 3HT3A 2M2VA 4P2HA 4RWNA 4YCXA 2K8BB 2KOBA 4JV1A 4X4UA 4ICAA 1ZD2P 2F1JA 2QKQA 3FYHA 4DSIA 1DOQA 8ICLA 4ED2A 2H3VA 2DR7A 5J2IA 4MF2A 3C2LA 5BPCA 3GU3A 4O5EA 2FLNA 4JK1A 5J0TA 4IS7A 1JROA 4TUQA 1NK9A 3OHAA 3T5KA 3QEAZ 2ISOA 4UB4A 1V4AA 4QW9A 5AKXA 5AM4A 3SAHA 4PHAA 4Q43A 3M6ZA 3RJFA 4RU9A 4QZHA 2W55A 2NYVA 5CR0A 2W11A 4QWBA 4FS2A 1IIPA 2FMSA 3MFIA 5J0SA 3SAFA 4DS5A 5KFAA 3GDXA 2KZMA 5KFKA 5ALEA 3WFOA 1ZXIA 5D63A 4Q8EA 1XNSA 1JXEA 5CFTA 5HMLA 3VCBA 5F9LA 3MR3A 4B9VA 8ICWA 1WOTA 1L7OA 4KLDA 4RQ4A 2XC9A 3F2BA 2A1JB 3TQ1A 3DV9A 4FHXA 1ZQPA 2W9BB 4KX3A 4Z6FA 2YMQA 1VDVA 4EYHB 5HRIA 2KV2A 3LVWA 3NVZA 2RP5A 4F4YA 2WF9A 4G9BA 4RWQA 3EPIA 3HKZF 4MHVA 5DBCA 1UPHA 2JXJA 2Y9TA 5ALWA 1N48A 2G06A 3WK7A 5DEDA 1Z00A 3UMGA 5KFCA 1ECWA 1Z1VA 3AU2A 1DGJA 4DL7A 1AQ6A 1JRPA 1JMSA 3C2KA 2R8GA 5HRDA 4PGQA 2QB1A 2EH9A 1A0PA 1WUDA 5EOZA 4ZH4A 1NKCA 4RNOA 1ZQLA 2NO5A 1S0NA 1T3QA 5L1LA 3T3FA 9ICSA 2V4RA 1ZQFA 4NM1A 4FE3A 5B3PA 5DGBA 4FHPA 4EEDA 2ZUBA 1X2IA 4EEKA 1HUOA 2W7PA 4PL2A 4K9BA 5KL1B 1MC8A 4KLQA 2IHNA 4MKPA 5DDMA 2W43A 5DG7A 4CNQA 5L9XA 4E0DA 2DRAA 4P4MA 1UEUA 1J2MA 2IBKA 4DS4A 3BJYA 5KFFA 4B9NA 3H7IA 3PVXA 4DFJA 2PFOA 2W9CB 3KTQA 1ZQUA 4YD2A 3UXPA 3ALRA 2MRLA 1S9FA 5AI6A 4X4VA 4PL1A 3LK9A 2E8NA 1TV9A 1NNLA 2YB1A 2Q4TA 3ZDAA 2V9WA 4X0AA 1ZD4A 2K8CB 3TKAA 1ZD3A 4F4WA 3RJGA 1ZQJA 1XS9D 5ALFA 2BCUA 1BPZA 2A19A 2IOFA 2KIVA 4RPYA 2HBKA 3C2MA 7ICSA 5JRTA 1NOMA 3RFAA 5DQGA 4BX9C 3WK5A 9ICTA 5KFDA 1X6IA 4NY8A 4ECTA 5J0PA 2N1RA 1XWLA 3MC1A 1ZQ1C 4F4XA 5IIJA 2HHSA 3QU2A 5DQHA 2P66A 1NO5A 2ZTEA 3KHHA 4OAGA 3Q8SB 4DQQA 1MA7A 4GXJA 4RQ5A 2H5XA 3TAPA 3AL0B 3MCRA 3LWLA 1LB2B 3WK4A 9ICVA 4ED7A 4Y2QA 2W8LA 1R8BA 2BCQA 2GLEA 5DB6A 1XSLA 4I2FA 4EX7A 1ZQQA 1ZQIA 2AHOB 1ZD5A 2LI6A 5L1KA 2BPCA 4QZFA 1HIWA 4DEZA 3WK6A 4YP3A 2A1JA 4QZ9A 2W9BA 4M04A 1DXSA 2LMRA 3KHGA 2BGWA 4E80A 3QX7A 9ICHA 2JH7A 4M0AA 2WF7A 2JV3A 1ZRNA 4WBYA 3PSTA 2RDJA 3RJEA 1MIYA 3CYMA 5KFLA 2QB0B 1ZQNA 2AXTU 1B22A 4LZDA 3MR2A 4I2JA 4FBTA 1CRXA 1JXLA 4DF8A 4F4KA 4CF5A 1L3SA 4EENA 3PV8A 3NTUA 4DL6A 1R8CA 4K97A 2UVRA 2DBYA 1KEJA 5AKYA 5KG5A 2Y9UA 1XU4A 3JPRA 1WWVA 1YT3A 2IOFK 4K8VA 4UAZA 9ICIA 4FZNA 4K98A 5ALSA 4WC3A 5J29A 2JEIA 4JV2A 2XCPA 4M5DA 2BKEA 1L8LA 8ICKA 1DGSA 2FPMA 8ICFA 8ICHA 1Y88A 4FS1A 2VA8A 2I6XA 1P7DA 4CDGA 2JEGA 1X40A 1Z4NA 4ED0A 3A0BU 3WFQE 2E8PA 1FO4A 3V7KA 4NLBA 1U9LA 2W3SA 3ER9B 5IINA 1SGGA 2W9CA 5KFVA 2K89A 4QZGA 2VANA 2DGZA 4QWAA 4J9QA 5AK4A 1NJYA 2PI5A 4FH3A 1X9SA 9ICKA 4YFKA 9ICLA 3JZ0A 4NLZA 5E79U 4J9MA 4ELVA 4WC6A 1SV0C 2F3NA 4O6AA 5JTGA 1X42A 4O3QA 1UA1A 2YMPA 5J2CA 3RAQA 2DVIA 4Y2UA 2DF4B 2KIWA 9ICFA 2KKVA 3BQ1A 5J2GA 7ICJA 1MSWD 1ZQHA 3NVOA 1BNPA 4WQLA 2KEYA 4O3PA 5HHIA 2DPJA 4KTQA 5BOMA 1RM6C 3B9JA 2F2AB 2MA1A 3DDHA 3GFKB 5TZVA 3B0XA 4C7ZA 4J9NA 2YTUA 3JPOA 5CB1A 2B4VA 3PZPA 4O67A 5DDYA 4GC6A 3MDAA 2ZHBA 2AGQA 1NKEA 7ICMA 5J2AA 5AK3A 4PJ0U 2VKQA 4OJ6A 5KG1A 3FAHA 5J0RA 2F77X 4JLZA 2ISPA 3ISBA 1QSSA 4YR0A 2NRKA 5KT2A 4G3IA 4I2CA 4OAHA 1S77D 3IV6A 2KN7A 2YN4A 4N7RA 7ICGA 3OWGA 1TFWA 2ZIXB 2CPRA 2K8AA 2M0NA 3ORYA 5ALNA 4EELA 1HJPA 2KE7A 4BUGA 3QZ7A 3SYZA 5C0YA 2K60A 3SZ2A 3WKBA 4NKUA 5CP2A 1K1QA 2QB0A 5DKWA 4DSFA 1JAJA 1KRPA 5B66U 3SV4A 4NL9C 2LYBA 3AQKA 1F0MA 1HUZA 4AT7B 4DSLA 5ALYA 1SV0A 2AGPA 2IHMA 5TISU 3ISDA 4J9RA 2FDRA 1C20A 5DQIA 3HP6A 2DUYA 4EBDA 2ZH9A 5D61A 5AI5A 3QEBZ 2DL0A 3R9KA 3C23A 1MQ2A 3RAXA 1TK5A 4KITB 2EANA 7ICUA 2JZBB 4Y2RA 5HRFA 3UXOA 2ZG6A 3I28A 5ALJA 5DB9A 1L3TA 4I0UA 3F5AA 5AM5A 1S0VA 1LV5A 1UETA 5CHEA 3HILA 3V7JA 2HHWA 4QZEA 3NUQA 4TUSA 4F5RA 1B0XA 3CK6A 2P6UA 3VC8A 2DKXA 5JU5A 3TARA 3N28A 3SI8A 3T5LA 4KLHA 2YX8A 1KL9A 2KVSA 4F2SA 4M9JA 1TE2A 3KD3A 1ZQDA 2OWOA 1JIHA 2GOLA 5AKJA 3C21A 4LJXA 3F2DA 3BDPA 2OXOA 1ZOLA 5ALVA 1WCNA 1MIVA 4WJ3B 1KDHA 3WKDA 1COKA 4K4GA 4LEVA 8ICPA 4R66A 3IG8A 1UT8A 2EZZA 3QUBA 2DKZA 3RB4A 5KFPA 5ALGA 3SQIA 1ZQVA 3H8SA 3SEIA 3WFPA 4Z6CA 5AKHA 5CA7A 4ED1A 2ZTCA 4M9HA 2OCEA 4UAVA 1QTMA 2IHOA 1COOA 4RT3A 2JR5A 2XI9A 1SB3C 4QWEA 4UD5A 3HRDD 8ICVA 5AIAA 4TUPA 2W9AA 2FLPA 4NL9A 1SL1A 4GXIA 4X0BA 4B9MA 4FO1A 3UMCA 3TI0A 3QU5A 1XO1A 1K1SA 2M9NA 3C29A 4DCCA 4C8OA 2B6GA 3PSIA 4DQPA 4KN4A 5KFBA 5DB8A 9ICWA 1SL2A 9ICOA 5ALDA 2ZXIA 4UB5A 4KM5A 3PR5B 3RR8A 1PUZA 2ZIXA 2J6SA 1ZJMA 3L4PA 2HHTA 1WYGA 3BS7A 4FBUA 3OVSA 4F92B 3T5JA 2AQ4A 4ED3A 3U26A 3JPSA 4C8KA 4Y2VA 1ZQAA 2IOHA 5GTHU 3H40A 4ATBB 4IQUA 2KMDA 5DLGA 2DRBA 4ED8A 4QZ8A 1PVQA 3GQCA 4AT7A 1ZQEA 4XA5A 4I2HA 1MIWA 4R64A 2YY6A 5L1JA 2LBOA 3RB0A 4AYBF 1JALA 2EAMA 3I76A 3C28A 3Q8KA 4F72A 2OYYA 4WC5A 3RBDA 2HN1A 4I29A 2UVWA 4TQRA 1D8YA 4QZIA 4KLLA 4F2RA 2G08A 1QQ5A 2QARB 5KNIA 5J0UA 2K4HA 2ESEA 2L5YA 7ICKA 1KSPA 2JZBA 3LYSA 5CEHA 4CCHA 4MFAA 2O1PA 4GXKA 3Q8QB 4Q45A 2E1FA 5H2FU 1KBUA 2P6RA 2BDPA 2AH5A 4QIWC 3ETLA 5HREA 4MF8A 2RFFA 4ECVA 2ASDA 4O9MA 2H3IA 4IG8A 2ZH3A 1Q79A 4PHEA 3NVYA 3QNMA 3RJHA 3IP4B 5KFHA 9ICEA 8ICIA 2C22A 2BPFA 1K5OA 3ER8C 5HR7A 4ELTA 2LM1A 4M9GA 1NZPA 3H0LB 4YXJA 2C2RA 4NXUA 4DOAA 1J97A 4U7CA 1KFDA 4IR9A 4X4OA 1U48A 1GO3F 4R65A 2BE3A 1YZ6A 3IN5A 3AEVA 4F5PA 4RUCA 4DFMA 2GWSA 2H3ZA 9ICQA 4UARA 2XIDA 4DF4A 5AM0A 4NLNA 3UPQA 1NZBA 5ALOA 3UXNA 2YB4A 2WB1C 3H8MA 1Z19A 4RWPA 5AK6A 1NJZA 7ICEA 4BWJA 2G5HB 4CF3A 3RF9A 2ZH7A 3BQ0A 1N60A 5J2JA 2FCLA 5JUMA 4PPXA 2RDIA 2B21A 1NK5A 3V72A 2IA6A 2W7OA 4ACOA 5FP0A 5J2BA 3SV3A 7ICLA 1S0OA 5EE3A 3V6JA 5AKGA 4ECQA 4QZBA 3LQCB 1Q3UA 5KG4A 4OD0A 1QQ6A 2VA3A 5AIBA 4ELUA 1T94A 1NK8A 3L9DA 1A76A 3SR6A 1YZ7A 4J9OA 5KFWA 3H8JA 4GIBA 4Y2PA 4KLTA 1D8BA 2E8OA 2ZH1A 4BGDA 2H3FA 2W04A 4YQWA 3IDWA 2PKEA 1RZTA 1N2XA 2B51A 1T3NA 3ERCC 5KT3A 2ES6A 2G5IB 3L3FX 4QZDA 2MUTB 3GIJA 1ZQMA 4ATBA 2WHEA 1PK1B 4E7XA 1O08A 2HOFA 1QH9A 3WFSC 3IHQB 3M9OB 2ZH8A 5HC9A 2RRDA 4YMMA 1SZPA 3RH5A 1ZYQA 2EWRA 3K1ZA 3GIKA 2XY5A 1LKYB 2ZJ5A 2NRVA 4UB8U 5ALZA 3JPTA 1YLQA 4Y2TA 2GA9D 1IM4A 2BCVA 4DL4A 1SKRA 1N62A 1L8OA 1N61A 3K4GA 2QARA 3CNHA 4C0ZA 2AU0A 9ICAA 4O69A 2WTFA 3KZXA 3THVA 4YXMA 4KLGA 3G6YA 1RPLA 7ICRA 5J2EA 3QUTA 3BS5B 2EAOA 3EW9A 3QU9A 5KT5A 3NRWA 2Z7JA 4Y2YA 4X4NA 4LZGA 3GV5B 4HAIA 1L6NA 2W9MA 5J0QA 4DLGA 5HRBA 2Y0SF 2DPIA 5CHGA 4FH5A 2Y1JA 1BPYA 4KLSA 4Q44A 2WAQC 1D9FA 1QQ7A 1ZQKA 2RQ5A 3BQ2A 5AI4A 1RYRA 1NK6A 4DQRA 4F50A 4F3OA 1V38A 4NXZA 4UAUA 3UMBA 5GTIU 3OJSA 3D2NA 2HHXA 5HNKA 3AN1A 2ZH4A 4YMOA 4KLIA 4RQ2A 4OJLA 1DRGA 3RBEA 5AKEA 3ED5A 4EGWA 5IIKA 1QLNA 4DQSA 4JUZA 4QIWF 4M9LA 4FHVA 3H39A 4C4TA 1N5WA 1X6JA 3HWTA 5KFTA 3PR4A 4XUSA 1PZNA 3E58A 1U45A 8ICOA 4QWCA 8ICSA 5EWEA 1C7YA 5J8YC 4RQ8A 2LYAA 1KNYA 5J2DA 7ICPA 4EBCA 1TK8A 1N5XA 4KLEA 5L1MA 4B9UA 3MGHA 2JMGA 5C5JA 2ALZA 4MFCA 2XY6A 2HI0A 2BQRA 2NV3A 3HJ1A 1V85A 1L7MA 2E3TA 2HSZA 1Q46A 3HW8A 4EX6A 2MUTA 4WC1A 3M8SA 3FC4A 3AU6A 8ICZA 1PK1A 1TAMA 4QNLA 3H37A 4GLXA 4C7YA 2WB1F 5AKZA 2ZIUB 4EBJA 4J9LA 2HCFA 7ICIA 7ICOA 2W3RA 5D49A 1LKYA 4JMUA 4WC0A 3AM9A 3ZDCA 4M9NA 4LT6A 2EZYA 4O3NA 3PNCA 3PY8A 4ECUA 4RT2A 2JRZA 4YMNA 1NK4A 4NXXA 1TVAA 3RRGA 3H0MB 1Q8KA 2R18A 3RB3A 1RYUA 2E1EA 2KNJA 1T8EA 1X9MA 3OVAA 3K1RB 2BQ3A 5KTQA 2EQYA 5KFIA 3BS5A 4UD4A 5AHXA 1RQLA 5BOLA 4QJFB 3H38A 1VLBA 2NO4A 1ZQGA 1PX5A 4RUAA 2WFAA 1KLNA 3KFUF 2Y1IA 4DWIA 4RQMA 1CI4A 5ALPA 2J6UA 3A0HU 1BGXT 2G07A 3LVVA 4DO9A 5DG8A 3K7DA 3JCFA 1KN5A 2VIXA 4UB3A 5F9NA 4DL2A 2PBEA 4O68A 1XC9A 1BNOA 4IRDA 2XGPA 4O5CA 3EUB2 1U49A 2O5AA 4F5QA 1SWVA 3EYZA 3BQ7A 3IG5A 3GIMA 4NWIA 3AQFA 4F91B 4UBBA 4UB1A 2I5HA 3OTQA 2HVHA 8ICBA 4EYIB 1O03A 2JHDA 1X9XA 3KHLA 4NM2A 2XO7A 5D46A 1ZRMA 5HRGA 7ICHA 3HIYA 4B9TA 4NLCA 4O3MA 3M9NB 5KT6A 1A77A 4OJOA 2PFQA 4KLUA 3NWIA 1URJA 2XY7A 1HEKA 4UATA 2KG5A 5ALXA 2KSOB 3HPOA 2FPKA 2BCRA 3N7SC 1JQRA 4UASA 4BXOB 3PSPA 5A0LA 2XGQA 4I2DA 3UM9A 2VJ4A 5EE9A 4NLGA 3OHBA 5KFXA 5KT7A 2JGAA 3N7PD 5F3XB 4OJ5A 4EBEA 4JV0A 5HMMA 3SAGA 2C28A 1TKDA 3WK8A 4Q8FA 1MQ3A 2EZXA 5KFNA 4PZNA 4OO1J 4NXTA 4YN4A 3V6KA 1SKWA 9ICCA 2W54A 2O6KA 5J0OA 1ED1A 2DR8A 8ICRA 4KB6A 2ZIUA 5CFUA 4RNNA 5HHHA 1H38A 5JTIA 1S0MA 1ZQTA 4XQ8A 2K4PA 3ZD8A 1ZQRA 4FZMA 2NRXA 7ICFA 2F76X 1IV8A 4QW8A 8ICUA 3Q8LA 1SIJA 2KK0A 4C8NA 4US9A 3PO4A 3MDCA 4P0PB 2HHVA 2LKYA 2GH1A 2B56A 2BPGA 2JEJA 4IR1A 1Q78A 2ZIVB 4M2YA 5J0XA 3PHZA 3WKCA 2FMPA 3AQLA 2BDUA 4KLOA 4LEYA 4IC9A 4EP7A 4JB3A 4FHYA 2LYHA 3WKEA 4IRCA 2ZH2A 3QZ8A 5KG7A 3V7LA 3I1YA 3EWAA 3H3AA 4I28A 3KOOA 7ICTA 3N97B 4X4RA 3Q8RB 4RQ1A 1BPEA 1V9PA 3KHRA 8ICTA 4B9SA 1FFUA 4BWMA 4I27A 3RTVA 2CN1A 2ZUDA 1L7PA 4MEYA 3ZI4A 1QSYA 4P0QB 2BHNA 1NI3A 3GZFA 3NYBA 1B43A 2KJ9A 3SENA 1V97A 2PFNA 4KLJA 2YMMA 4B6JA 1L3UA 3PW7A 2KHQA 3JPQA 5J2HA 4PZOA 4IQWA 4DOBA 4RQ0A 4QWDA 2D6FC 5B3QA 2ZH6A 5KFZA 1R8AA 5KAIU 3PX6A 5D62A 3JPPA 2FE9A 1UQVA 3NASA 1IG6A 4US8A 3QXGA 4XRHA 2ASLA 1ZQOA 3PMNA 2KZZA 1SZHA 2F1IA 4Z6EA 2KSOA 3H8WA 4X5VA 2F1HA 3TACB 5J0WA 4ECWA 1UT5A 3NVVA 4KN7A 2DWQA 2RLTA 4X4TA 2ZIWB 5KFSA 4BXOA 4EZ6A 2DR9A 3GILA 4TQSA 2ZUCA 2D8CA 3Q8MA 4K4IA 2E8MA 1ZQXA 2R8HA 3MGVA 1ZQCA 3MFHA 2KJ8A 3PO5A 5DB7A 3Q8PB 4R63A 3OSNA 4DQIA 2KFZA 1BPBA 4PHPA 1S97A 4DSJA 2ASJA 3PW2A 1L5UA 2HBJA 4I2IA 3RH6A 3WK9A 2HHQA 4KMUA 4OJPA 4E8FA 1SXDA 1RG6A 4UB2A 5B5EU 5KFJA 9ICXA 4WOYA 4F93B 4X4SA 3FDSA 2FJ6A 2NRWA 2XVTA 2GO7A 1PK3A 4RQ7A 3C18A 4EV6A 4PGXA 1OXJA 4KLMA 3WFRE 4A8EA 2GAFD 5ALQA 2KZ3A 4P0PA 3QUQA 1ZJNA 3M1YA 3SMVA 5KG2A 2ZIVA 2HVIA 3PX4A 3N7RC 1NJXA 2F44A 4CGZA 3OV7A 3TAQA 3QU4A 4JWNA 2ID1A 1TFYA 4GC7A 4EZ9A 4DFDA 3AMZA 2HHPA 3B0YA 4NXWA 3HX0A 2E5SA 4ECZA 1FFVA 4FO6A 4IQTA 2YQEA 2FMQA 3S6JA 5AI0A 4RNMA 2HDOA 1BVSA 4J03A 5J2KA 2IMWP 4WC2A 2VJ5A 2HOQA 3TANA 4QZAA 3MBYA 5CWRA 5HP4A 4ZOHC 2LHTA 7ICNA 1X66A 4O3SA 2RHFA 3EZ5A 4DSKA 5DLFA 2DFLA 4Y2XA 4P0QA 3AUOA 3K75D 2DR5A 3FM9A 2KHVA 4K96A 2HHUA 5AKLA 2NRZA 1R89A 2AGOA 2LM4A 2BZFA 4I2EA 4K99A 1XSPA 2I9GA 5IIOA 1T7PA 1FA0A 3OUYB 4C8LA 3QYPA 1SV4A 4IRKA 3MABA 1IXRA 2I1QA 5KFUA 1NK7A 4Z6DA 1F5AA 4DLEA 4ECSA 2HW3A 2QLTA 4J9SA 5IIIA 3ZDBA 4I2AA 4UB6U 2BR0A 2BBJA 3D6JA 1KKXA 5KFMA 5EWGA 3AQEA 3H4DA 1OU5A 2PMZC 9ICRA 5K4LA 1Q3VA
chains in the Genus database with same CATH topology
4O5EA 1UETA 4PGYA 2ZJ8A 2FLNA 4JK1A 5J0TA 4EBJA 4J9LA 3V7JA 7ICIA 7ICOA 5D49A 2HHWA 3ISCA 3OGUA 4QZEA 4TUQA 4WC0A 4TUSA 4F5RA 1NK9A 4IQVA 3OHAA 2P6UA 3ZDCA 3TARA 3T5KA 4M9NA 3QEAZ 2ISOA 5KG0A 4UB4A 1EXNA 4LT6A 1V4AA 4O3NA 4QW9A 5KG3A 3PNCA 7ICVA 4KLHA 3SI8A 3T5LA 4ECUA 3PY8A 5KFOA 8ICCA 4RT2A 2J6TA 4PHAA 4YMNA 5DBAA 4Q43A 4WCWA 3RJFA 1NK4A 4F2SA 4RU9A 3MGIA 4M9JA 4YG2A 4QZHA 1ZQDA 3UPSA 1TVAA 5CR0A 2OWOA 1JIHA 4QWBA 4FS2A 3RRGA 3C21A 3BDPA 3RJIA 2FMSA 3RB3A 3MFIA 1WCNA 4F5OA 1MIVA 5J0SA 4DS5A 2KZMA 5KFAA 3GDXA 1KDHA 2UVVA 5KFEA 5KFKA 4K4GA 3WFOA 1T8EA 1X9MA 8ICPA 4R66A 3GIIA 1JXEA 4Q8EA 3OVAA 5HMLA 5F9LA 3MR3A 2BQ3A 4B9VA 1UT8A 5CJ7A 3RB4A 8ICWA 1WOTA 5KFPA 5KTQA 4UBCA 3M9MB 3JYYA 4KLDA 3C66A 4RQ4A 5KFIA 2XC9A 4UD4A 4P4OA 2A1JB 3TQ1A 4FHXA 4UAYA 1ZQPA 5BOLA 1ZQVA 2W9BB 4ECXA 4Z6FA 3H8SA 3H38A 1PX5A 1ZQGA 4O0IA 4RUAA 3WFPA 4EYHB 4Z6CA 4ED1A 5CA7A 1KLNA 2ZTCA 4M9HA 3MR5A 5HRIA 1QTMA 2Y1IA 1COOA 4DWIA 4F4ZA 2KFNA 4RT3A 2J6UA 1BGXT 4F4YA 1KTQA 4O3OA 4DO9A 5DG8A 4QWEA 4UD5A 4RWQA 3EPIA 8ICVA 4UB3A 5F9NA 4DL2A 2PBEA 4TUPA 2W9AA 2XCAA 1XC9A 2FLPA 4IRDA 5DBCA 1SL1A 1BNOA 3HJ4A 8ICYA 4R8UB 4GXIA 1N48A 3AQMA 2XGPA 4O5CA 5DEDA 1Z00A 1TFRA 1U49A 2O5AA 4F5QA 3EYZA 4X0BA 5KFCA 4B9MA 3TI0A 1NK0A 3AU2A 1XO1A 3GIMA 1K1SA 2M9NA 3TFSA 4RQ3A 4DL7A 4C8OA 1VJ7A 4XQ7A 4F91B 4UBBA 4UB1A 5HRLA 1JMSA 3C2KA 2R8GA 3L9DA 4DQPA 4KN4A 5KFBA 4DSEA 8ICBA 2HVHA 5HRDA 4PGQA 5DB8A 9ICWA 4EYIB 1SL2A 9ICOA 2C2EA 5EOZA 3C5FA 4AT9B 4ZH4A 1NKCA 4RNOA 4UB5A 5DGAA 1ZQLA 3PR5B 1S0NA 3RRHA 3RR8A 5EWFA 3KHLA 4NM2A 4WC7A 4MFFA 5L1LA 3T3FA 2XO7A 5D46A 2V4RA 1RXVA 2J6SA 1ZJMA 9ICSA 4WBZA 5HRGA 4EEYA 7ICHA 3HIYA 1ZQFA 4B9TA 4NM1A 2HHTA 4FBUA 5HRHA 3OVSA 3TFRA 3RJJA 4F92B 5KFYA 5KT6A 1A77A 3M9NB 4ED3A 3T5JA 4DFPA 5DGBA 5KFRA 2AQ4A 3JPSA 2M2UA 4C8KA 1ZQAA 2PFQA 4FHPA 4KLUA 3LDAA 2ZUBA 1X2IA 2XY7A 2R8KA 1HUOA 3H40A 4ATBB 3RJKA 3HPOA 1JN3A 4IQUA 2FPKA 2BCRA 1MC8A 5DLGA 2IHNA 4KLQA 1RYSA 5KFGA 5DDMA 1UA0A 2DRBA 4ED8A 5DG7A 1JQRA 1ZQBA 5L9XA 4QZ8A 4E0DA 4AT7A 4P4MA 3GQCA 4BXOB 1ZQEA 4XA5A 4BDPA 4I2HA 4R64A 2IBKA 1MIWA 4DS4A 1UEUA 3BJYA 5KFFA 5L1JA 4DOCA 3H7IA 3PVXA 3RB0A 4DFJA 2XGQA 3PW5A 2PFOA 4B9NA 2W9CB 4I2DA 3KTQA 1ZQUA 4YD2A 3Q8KA 4NLGA 1ZQYA 4MEXA 3OUYA 3UXPA 3OHBA 5KFXA 5KT7A 4WC5A 3OSPA 1S9FA 8ICNA 4K4HA 4X4VA 2UVUA 3H4BA 3RBDA 4EBEA 4JV0A 5HMMA 4I29A 3LK9A 9ICPA 1TV9A 2UVWA 4TQRA 2C28A 1TKDA 1D8YA 2JEFA 2FLLA 4Q8FA 4QZIA 1MQ3A 4KLLA 3ZDAA 4F2RA 2V9WA 5J0UA 5KFNA 4ECYA 7ICKA 3UQ2A 4X0AA 1KSPA 2JZBA 4CCHA 4I2BA 4MFAA 4F4WA 3RJGA 1ZQJA 1XS9D 2O1PA 5KT4A 4YN4A 4GXKA 3V6KA 3Q8QB 2PXIA 1SKWA 1BPZA 4Q45A 2BCUA 9ICCA 5J0OA 4RPYA 1XSNA 2P6RA 2DR8A 3C2MA 2BDPA 1ZQWA 8ICRA 7ICSA 2Q66A 1NOMA 3ETLA 5HREA 4MF8A 2RFFA 9ICGA 5DQGA 4RNNA 4ECVA 2ASDA 1UEVA 5HHHA 4O9MA 1H38A 9ICTA 5IILA 1S0MA 5KFDA 4IG8A 1ZQTA 4NY8A 4XQ8A 3G6XA 2ZH3A 1Q79A 3ZD8A 4ECTA 5J0PA 4PHEA 1ZQRA 3RJHA 2NRXA 5KFHA 7ICFA 9ICEA 1XWLA 8ICIA 2C22A 4P4PA 2BPFA 7ICQA 4F4XA 4QW8A 5IIJA 2HHSA 3Q8LA 9ICMA 8ICUA 4C8NA 5DQHA 2P66A 3PO4A 1NO5A 4ELTA 4M9GA 2ZTEA 3MDCA 3KHHA 1JX4A 1NZPA 2HHVA 4YXJA 4YR2A 2C2RA 4DOAA 3Q8SB 4DQQA 2BPGA 4GXJA 8ICAA 4RQ5A 8ICGA 2H5XA 2ZJAA 3TAPA 3EPGA 2JEJA 4IR1A 1Q78A 2ZH5A 4M2YA 3MR6A 5J0XA 3LWLA 1KFDA 4IR9A 1T4GA 3PW4A 1LB2B 4X4OA 9ICVA 1U48A 5IIMA 2FMPA 3ZDDA 4ED7A 4R65A 2BE3A 3AQLA 2AQ0A 2W8LA 4ED6A 2BQUA 4YR3A 1R8BA 4KLOA 4F5PA 4RUCA 4DFMA 2BCQA 2GWSA 9ICQA 4EP7A 5DB6A 1XSLA 4I2FA 4FHYA 3PMLA 2LYHA 2M2TA 4DF4A 1ZQQA 1ZQIA 5D4BA 4NLNA 3UPQA 4IRCA 2ZH2A 3QZ8A 5L1KA 2BPCA 4QZFA 3G6VA 4DEZA 2ZHAA 2NRTA 4YP3A 8ICQA 3UXNA 9ICBA 2A1JA 4QZ9A 5KG7A 3JPNA 3V7LA 2W9BA 4C8MA 4M04A 4RWPA 3EWAA 1SKSA 1NJZA 3KHGA 7ICEA 4S3NA 3H3AA 2BGWA 4BWJA 4AT8B 4WC4A 4E80A 9ICHA 4TURA 4I28A 2ZH7A 2ZTDA 3BQ0A 1TAUA 7ICTA 5J2JA 4M0AA 5JUMA 4DFKA 3N97B 4X4RA 3Q8RB 4RQ1A 1BPEA 1V9PA 3GV8B 4PPXA 2RDIA 2B21A 3KHRA 4WBYA 1NK5A 3V72A 1NJWA 2IA6A 8ICTA 4B9SA 1D8LA 4R8UA 4BWMA 2RDJA 3RJEA 4I27A 1MIYA 3RTVA 5J2BA 2Q0ZX 3SV3A 5KFLA 7ICLA 2ZUDA 1S0OA 5KG6A 4MEYA 3V6JA 1ZQNA 1QSYA 4ECQA 1ZQSA 4QZBA 2BHNA 5DECA 3RR7A 1B22A 3LQCB 3OVBA 4LZDA 3MR2A 4I2JA 4FBTA 2VA2A 3NYBA 1B43A 5KG4A 1JXLA 4DF8A 2PFNA 4J9PA 2VA3A 4F4KA 1L3UA 1L3SA 4KLJA 3PW7A 3PV8A 4RPXA 3NTUA 4ELUA 4DL6A 1R8CA 4AT9A 2C2DA 2MAXA 2UVRA 4RQ6A 1CUKA 1KEJA 3JPQA 5J2HA 3LWMA 5L1IA 1A76A 1WCLA 1NK8A 4DOBA 4IQWA 4J9OA 1AROP 3H8JA 4M6WB 5KG5A 5KFWA 4RQ0A 1XU4A 4QWDA 5KFZA 4KLTA 2ZH6A 3JPRA 4O5KA 1R8AA 4FHWA 2ZH1A 4BGDA 2R8IA 3PX6A 8ICEA 4YQWA 4UAZA 3JPPA 9ICIA 9ICUA 3V6HA 1RZTA 4WC3A 5J29A 4I2GA 2JEIA 4JV2A 2XCPA 5DG9A 4XRHA 3RH4A 3NGDA 3C1YA 1T3NA 2BKEA 8ICKA 4M5DA 1DGSA 5KT3A 2ASLA 2FPMA 4QZDA 1ZQOA 1Y88A 3PMNA 1BPDA 2VA8A 4FS1A 8ICFA 8ICHA 2MUTB 3GIJA 2F1IA 2KZZA 1ZQMA 4PH5A 4ATBA 4Z6EA 3H8WA 4X5VA 2F1HA 2JEGA 4LVSA 8ICXA 3PW0A 4E7XA 4ED0A 5J0WA 3WFQE 4ECWA 1UT5A 3WFSC 3IHQB 4KN7A 5DBBA 3M9OB 3V7KA 2ZH8A 5HC9A 4X4TA 4BXOA 5KFSA 4EZ6A 8ICJA 1U9LA 4O3RA 1TK0A 4YMMA 2DR9A 3GILA 1SZPA 3RH5A 4YVZA 4TQSA 2ZUCA 5J0YA 2W9CA 5IINA 3Q8MA 1ZYQA 5KFVA 4K4IA 1ZQXA 3AQNA 2DRAA 3GIKA 2R8HA 4QZGA 2VANA 2XY5A 4QWAA 4J9QA 1U4BA 1NJYA 2ZJ5A 1ZQCA 2PI5A 2NRVA 3MFHA 4FH3A 4DL5A 3ZDEA 2AJQA 1X9SA 9ICKA 4YFKA 3JPTA 9ICLA 1YLQA 3JZ0A 3PO5A 5DB7A 4NLZA 3Q8PB 4R63A 3OSNA 4J9MA 4NKTA 4ELVA 1IM4A 5J2FA 2BCVA 4DQIA 4WC6A 2KFZA 4DL4A 2PI4A 1BPBA 1SKRA 4PHPA 1S97A 4DSJA 3IM1A 1DK3A 3N4MB 4O3QA 3UQ0A 3PW2A 3K4GA 4I2IA 3RH6A 2ASJA 1UA1A 1L5UA 5J2CA 2HHQA 3RAQA 2M2WA 2DVIA 4KMUA 9ICFA 4E8FA 3BQ1A 2AU0A 4UB2A 5J2GA 7ICJA 9ICAA 5KFJA 1MSWD 3C1ZA 9ICXA 1ZQHA 4KLFA 3C5GA 2WTFA 4X4QA 3THVA 1BNPA 4YXMA 4F93B 2FPLA 5HR9A 4X4SA 4KLGA 3FDSA 4O3PA 1RPLA 5HHIA 5J2EA 3OJUA 3G6YA 3M8RA 2DPJA 4KTQA 5BOMA 7ICRA 2NRWA 1L3VA 1KFSA 3EW9A 4RQ7A 3C18A 5KT5A 3GV7B 3GFKB 5TZVA 1Z3EB 4PGXA 4X4NA 3ZD9A 4LZGA 4KLMA 4X4PA 3WFRE 1BPXA 3GV5B 2KP7A 3RB6A 3B0XA 3BQTA 2KZ3A 4J9NA 2W9MA 4UAWA 4JWMA 1DK2A 5HRKA 4YD1A 1ZJNA 5J0QA 3JPOA 4DLGA 4DL3A 1SL0A 5HRBA 1ZQZA 5KG2A 5CB1A 1ZETA 2DPIA 1D9DA 5CHGA 2HVIA 4FH5A 3PX4A 2Y1JA 3QE9Y 1BPYA 5DDYA 4GC6A 3MDAA 4ECRA 4KLSA 4RPZA 4Q44A 2AGQA 2ZHBA 1NKEA 1NJXA 7ICMA 2PFPA 5J2AA 4NLKA 1D9FA 3OV7A 1Z00B 3TAQA 4J9KA 4JWNA 9ICNA 2ID1A 1VFGA 1TFYA 4HYKA 5KG1A 4GC7A 1ZQKA 3BQ2A 4EZ9A 2HHPA 3B0YA 5J0RA 3HX0A 1RYRA 1NK6A 4DQRA 5F2VO 2V4QA 4ECZA 4F50A 2ATLA 1S10A 4F3OA 2ISPA 4NXZA 3ISBA 1QSSA 4YR0A 4FO6A 2NRKA 5KT2A 4IQTA 4B9LA 4G3IA 4I2CA 3PX0A 1S77D 1QSLA 2FMQA 1CEZA 4QZCA 2W8KA 1N56A 4RNMA 2KN7A 1U47A 3OJSA 1BVSA 5J2KA 2IMWP 1S76D 5HNKA 7ICGA 2HHXA 4AT8A 4WC2A 1X9WA 4YMOA 3TANA 4RQ2A 4QZAA 4KLIA 2ZH4A 1TFWA 3MBYA 5CWRA 4F5NA 5HP4A 3ORYA 3RBEA 1HJPA 3QZ7A 7ICNA 3SYZA 4EBKA 4O3SA 5IIKA 3SZ2A 1QLNA 4NKUA 4DQSA 4JUZA 3EZ5A 1TAQA 4PHDA 5CP2A 5KFQA 4DSKA 1K1QA 4DSFA 5DKWA 4M9LA 1JAJA 4F8RA 3H39A 4FHVA 5DLFA 1KRPA 2DFLA 2R8JA 3SV4A 3HWTA 5KFTA 4M47A 3AUOA 3K75D 3AQKA 2DR5A 3PR4A 4XUSA 1PZNA 1U45A 1HUZA 4AT7B 4DSLA 4QWCA 2HHUA 8ICOA 8ICSA 4UQGA 5EWEA 1C7YA 8ICMA 2NRZA 2KTQA 2AGOA 1R89A 1RXWA 4RQ8A 4I2EA 4RWOA 1XSPA 3T5HA 2I9GA 1KNYA 3E2EA 5J2DA 7ICPA 5IIOA 1NKBA 1T7PA 1FA0A 3OUYB 4RZRA 4EBCA 2AGPA 2IHMA 4C8LA 4M6WA 3ISDA 4J9RA 1TK8A 4KLEA 4B9UA 4IRKA 2BCSA 3MABA 5DQIA 3MGHA 1IXRA 9ICJA 1KFTA 2I1QA 5KFUA 3HP6A 1NK7A 5C5JA 2ALZA 4Z6DA 4EBDA 4MFCA 3HT3A 2XY6A 2BQRA 4P2HA 2M2VA 1F5AA 2ZH9A 3QEBZ 4RWNA 4DLEA 4ECSA 2HW3A 3C23A 4YCXA 4J9SA 5IIIA 1MQ2A 3ZDBA 3HJ1A 3RAXA 1TK5A 4JV1A 4X4UA 4I2AA 4KITB 2F1JA 3FYHA 4DSIA 3HW8A 2BR0A 2JZBB 7ICUA 2MUTA 5HRFA 4WC1A 3M8SA 3UXOA 1DOQA 5KFMA 5EWGA 3AU6A 8ICZA 8ICLA 3H4DA 4ED2A 2DR7A 5DB9A 1L3TA 5J2IA 4MF2A 9ICRA 1OU5A 3C2LA 3H37A 1S0VA 5BPCA 1LV5A 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5E A;  1UET A;  4PGY A;  2ZJ8 A;  2FLN A;  4JK1 A;  5J0T A;  4EBJ A;  4J9L A;  3V7J A;  7ICI A;  7ICO A;  5D49 A;  2HHW A;  3ISC A;  3OGU A;  4QZE A;  4TUQ A;  4WC0 A;  4TUS A;  4F5R A;  1NK9 A;  4IQV A;  3OHA A;  2P6U A;  3ZDC A;  3TAR A;  3T5K A;  4M9N A;  3QEA Z;  2ISO A;  5KG0 A;  4UB4 A;  1EXN A;  4LT6 A;  1V4A A;  4O3N A;  4QW9 A;  5KG3 A;  3PNC A;  7ICV A;  4KLH A;  3SI8 A;  3T5L A;  4ECU A;  3PY8 A;  5KFO A;  8ICC A;  4RT2 A;  2J6T A;  4PHA A;  4YMN A;  5DBA A;  4Q43 A;  4WCW A;  3RJF A;  1NK4 A;  4F2S A;  4RU9 A;  3MGI A;  4M9J A;  4YG2 A;  4QZH A;  1ZQD A;  3UPS A;  1TVA A;  5CR0 A;  2OWO A;  1JIH A;  4QWB A;  4FS2 A;  3RRG A;  3C21 A;  3BDP A;  3RJI A;  2FMS A;  3RB3 A;  3MFI A;  1WCN A;  4F5O A;  1MIV A;  5J0S A;  4DS5 A;  2KZM A;  5KFA A;  3GDX A;  1KDH A;  2UVV A;  5KFE A;  5KFK A;  4K4G A;  3WFO A;  1T8E A;  1X9M A;  8ICP A;  4R66 A;  3GII A;  1JXE A;  4Q8E A;  3OVA A;  5HML A;  5F9L A;  3MR3 A;  2BQ3 A;  4B9V A;  1UT8 A;  5CJ7 A;  3RB4 A;  8ICW A;  1WOT A;  5KFP A;  5KTQ A;  4UBC A;  3M9M B;  3JYY A;  4KLD A;  3C66 A;  4RQ4 A;  5KFI A;  2XC9 A;  4UD4 A;  4P4O A;  2A1J B;  3TQ1 A;  4FHX A;  4UAY A;  1ZQP A;  5BOL A;  1ZQV A;  2W9B B;  4ECX A;  4Z6F A;  3H8S A;  3H38 A;  1PX5 A;  1ZQG A;  4O0I A;  4RUA A;  3WFP A;  4EYH B;  4Z6C A;  4ED1 A;  5CA7 A;  1KLN A;  2ZTC A;  4M9H A;  3MR5 A;  5HRI A;  1QTM A;  2Y1I A;  1COO A;  4DWI A;  4F4Z A;  2KFN A;  4RT3 A;  2J6U A;  1BGX T;  4F4Y A;  1KTQ A;  4O3O A;  4DO9 A;  5DG8 A;  4QWE A;  4UD5 A;  4RWQ A;  3EPI A;  8ICV A;  4UB3 A;  5F9N A;  4DL2 A;  2PBE A;  4TUP A;  2W9A A;  2XCA A;  1XC9 A;  2FLP A;  4IRD A;  5DBC A;  1SL1 A;  1BNO A;  3HJ4 A;  8ICY A;  4R8U B;  4GXI A;  1N48 A;  3AQM A;  2XGP A;  4O5C A;  5DED A;  1Z00 A;  1TFR A;  1U49 A;  2O5A A;  4F5Q A;  3EYZ A;  4X0B A;  5KFC A;  4B9M A;  3TI0 A;  1NK0 A;  3AU2 A;  1XO1 A;  3GIM A;  1K1S A;  2M9N A;  3TFS A;  4RQ3 A;  4DL7 A;  4C8O A;  1VJ7 A;  4XQ7 A;  4F91 B;  4UBB A;  4UB1 A;  5HRL A;  1JMS A;  3C2K A;  2R8G A;  3L9D A;  4DQP A;  4KN4 A;  5KFB A;  4DSE A;  8ICB A;  2HVH A;  5HRD A;  4PGQ A;  5DB8 A;  9ICW A;  4EYI B;  1SL2 A;  9ICO A;  2C2E A;  5EOZ A;  3C5F A;  4AT9 B;  4ZH4 A;  1NKC A;  4RNO A;  4UB5 A;  5DGA A;  1ZQL A;  3PR5 B;  1S0N A;  3RRH A;  3RR8 A;  5EWF A;  3KHL A;  4NM2 A;  4WC7 A;  4MFF A;  5L1L A;  3T3F A;  2XO7 A;  5D46 A;  2V4R A;  1RXV A;  2J6S A;  1ZJM A;  9ICS A;  4WBZ A;  5HRG A;  4EEY A;  7ICH A;  3HIY A;  1ZQF A;  4B9T A;  4NM1 A;  2HHT A;  4FBU A;  5HRH A;  3OVS A;  3TFR A;  3RJJ A;  4F92 B;  5KFY A;  5KT6 A;  1A77 A;  3M9N B;  4ED3 A;  3T5J A;  4DFP A;  5DGB A;  5KFR A;  2AQ4 A;  3JPS A;  2M2U A;  4C8K A;  1ZQA A;  2PFQ A;  4FHP A;  4KLU A;  3LDA A;  2ZUB A;  1X2I A;  2XY7 A;  2R8K A;  1HUO A;  3H40 A;  4ATB B;  3RJK A;  3HPO A;  1JN3 A;  4IQU A;  2FPK A;  2BCR A;  1MC8 A;  5DLG A;  2IHN A;  4KLQ A;  1RYS A;  5KFG A;  5DDM A;  1UA0 A;  2DRB A;  4ED8 A;  5DG7 A;  1JQR A;  1ZQB A;  5L9X A;  4QZ8 A;  4E0D A;  4AT7 A;  4P4M A;  3GQC A;  4BXO B;  1ZQE A;  4XA5 A;  4BDP A;  4I2H A;  4R64 A;  2IBK A;  1MIW A;  4DS4 A;  1UEU A;  3BJY A;  5KFF A;  5L1J A;  4DOC A;  3H7I A;  3PVX A;  3RB0 A;  4DFJ A;  2XGQ A;  3PW5 A;  2PFO A;  4B9N A;  2W9C B;  4I2D A;  3KTQ A;  1ZQU A;  4YD2 A;  3Q8K A;  4NLG A;  1ZQY A;  4MEX A;  3OUY A;  3UXP A;  3OHB A;  5KFX A;  5KT7 A;  4WC5 A;  3OSP A;  1S9F A;  8ICN A;  4K4H A;  4X4V A;  2UVU A;  3H4B A;  3RBD A;  4EBE A;  4JV0 A;  5HMM A;  4I29 A;  3LK9 A;  9ICP A;  1TV9 A;  2UVW A;  4TQR A;  2C28 A;  1TKD A;  1D8Y A;  2JEF A;  2FLL A;  4Q8F A;  4QZI A;  1MQ3 A;  4KLL A;  3ZDA A;  4F2R A;  2V9W A;  5J0U A;  5KFN A;  4ECY A;  7ICK A;  3UQ2 A;  4X0A A;  1KSP A;  2JZB A;  4CCH A;  4I2B A;  4MFA A;  4F4W A;  3RJG A;  1ZQJ A;  1XS9 D;  2O1P A;  5KT4 A;  4YN4 A;  4GXK A;  3V6K A;  3Q8Q B;  2PXI A;  1SKW A;  1BPZ A;  4Q45 A;  2BCU A;  9ICC A;  5J0O A;  4RPY A;  1XSN A;  2P6R A;  2DR8 A;  3C2M A;  2BDP A;  1ZQW A;  8ICR A;  7ICS A;  2Q66 A;  1NOM A;  3ETL A;  5HRE A;  4MF8 A;  2RFF A;  9ICG A;  5DQG A;  4RNN A;  4ECV A;  2ASD A;  1UEV A;  5HHH A;  4O9M A;  1H38 A;  9ICT A;  5IIL A;  1S0M A;  5KFD A;  4IG8 A;  1ZQT A;  4NY8 A;  4XQ8 A;  3G6X A;  2ZH3 A;  1Q79 A;  3ZD8 A;  4ECT A;  5J0P A;  4PHE A;  1ZQR A;  3RJH A;  2NRX A;  5KFH A;  7ICF A;  9ICE A;  1XWL A;  8ICI A;  2C22 A;  4P4P A;  2BPF A;  7ICQ A;  4F4X A;  4QW8 A;  5IIJ A;  2HHS A;  3Q8L A;  9ICM A;  8ICU A;  4C8N A;  5DQH A;  2P66 A;  3PO4 A;  1NO5 A;  4ELT A;  4M9G A;  2ZTE A;  3MDC A;  3KHH A;  1JX4 A;  1NZP A;  2HHV A;  4YXJ A;  4YR2 A;  2C2R A;  4DOA A;  3Q8S B;  4DQQ A;  2BPG A;  4GXJ A;  8ICA A;  4RQ5 A;  8ICG A;  2H5X A;  2ZJA A;  3TAP A;  3EPG A;  2JEJ A;  4IR1 A;  1Q78 A;  2ZH5 A;  4M2Y A;  3MR6 A;  5J0X A;  3LWL A;  1KFD A;  4IR9 A;  1T4G A;  3PW4 A;  1LB2 B;  4X4O A;  9ICV A;  1U48 A;  5IIM A;  2FMP A;  3ZDD A;  4ED7 A;  4R65 A;  2BE3 A;  3AQL A;  2AQ0 A;  2W8L A;  4ED6 A;  2BQU A;  4YR3 A;  1R8B A;  4KLO A;  4F5P A;  4RUC A;  4DFM A;  2BCQ A;  2GWS A;  9ICQ A;  4EP7 A;  5DB6 A;  1XSL A;  4I2F A;  4FHY A;  3PML A;  2LYH A;  2M2T A;  4DF4 A;  1ZQQ A;  1ZQI A;  5D4B A;  4NLN A;  3UPQ A;  4IRC A;  2ZH2 A;  3QZ8 A;  5L1K A;  2BPC A;  4QZF A;  3G6V A;  4DEZ A;  2ZHA A;  2NRT A;  4YP3 A;  8ICQ A;  3UXN A;  9ICB A;  2A1J A;  4QZ9 A;  5KG7 A;  3JPN A;  3V7L A;  2W9B A;  4C8M A;  4M04 A;  4RWP A;  3EWA A;  1SKS A;  1NJZ A;  3KHG A;  7ICE A;  4S3N A;  3H3A A;  2BGW A;  4BWJ A;  4AT8 B;  4WC4 A;  4E80 A;  9ICH A;  4TUR A;  4I28 A;  2ZH7 A;  2ZTD A;  3BQ0 A;  1TAU A;  7ICT A;  5J2J A;  4M0A A;  5JUM A;  4DFK A;  3N97 B;  4X4R A;  3Q8R B;  4RQ1 A;  1BPE A;  1V9P A;  3GV8 B;  4PPX A;  2RDI A;  2B21 A;  3KHR A;  4WBY A;  1NK5 A;  3V72 A;  1NJW A;  2IA6 A;  8ICT A;  4B9S A;  1D8L A;  4R8U A;  4BWM A;  2RDJ A;  3RJE A;  4I27 A;  1MIY A;  3RTV A;  5J2B A;  2Q0Z X;  3SV3 A;  5KFL A;  7ICL A;  2ZUD A;  1S0O A;  5KG6 A;  4MEY A;  3V6J A;  1ZQN A;  1QSY A;  4ECQ A;  1ZQS A;  4QZB A;  2BHN A;  5DEC A;  3RR7 A;  1B22 A;  3LQC B;  3OVB A;  4LZD A;  3MR2 A;  4I2J A;  4FBT A;  2VA2 A;  3NYB A;  1B43 A;  5KG4 A;  1JXL A;  4DF8 A;  2PFN A;  4J9P A;  2VA3 A;  4F4K A;  1L3U A;  1L3S A;  4KLJ A;  3PW7 A;  3PV8 A;  4RPX A;  3NTU A;  4ELU A;  4DL6 A;  1R8C A;  4AT9 A;  2C2D A;  2MAX A;  2UVR A;  4RQ6 A;  1CUK A;  1KEJ A;  3JPQ A;  5J2H A;  3LWM A;  5L1I A;  1A76 A;  1WCL A;  1NK8 A;  4DOB A;  4IQW A;  4J9O A;  1ARO P;  3H8J A;  4M6W B;  5KG5 A;  5KFW A;  4RQ0 A;  1XU4 A;  4QWD A;  5KFZ A;  4KLT A;  2ZH6 A;  3JPR A;  4O5K A;  1R8A A;  4FHW A;  2ZH1 A;  4BGD A;  2R8I A;  3PX6 A;  8ICE A;  4YQW A;  4UAZ A;  3JPP A;  9ICI A;  9ICU A;  3V6H A;  1RZT A;  4WC3 A;  5J29 A;  4I2G A;  2JEI A;  4JV2 A;  2XCP A;  5DG9 A;  4XRH A;  3RH4 A;  3NGD A;  3C1Y A;  1T3N A;  2BKE A;  8ICK A;  4M5D A;  1DGS A;  5KT3 A;  2ASL A;  2FPM A;  4QZD A;  1ZQO A;  1Y88 A;  3PMN A;  1BPD A;  2VA8 A;  4FS1 A;  8ICF A;  8ICH A;  2MUT B;  3GIJ A;  2F1I A;  2KZZ A;  1ZQM A;  4PH5 A;  4ATB A;  4Z6E A;  3H8W A;  4X5V A;  2F1H A;  2JEG A;  4LVS A;  8ICX A;  3PW0 A;  4E7X A;  4ED0 A;  5J0W A;  3WFQ E;  4ECW A;  1UT5 A;  3WFS C;  3IHQ B;  4KN7 A;  5DBB A;  3M9O B;  3V7K A;  2ZH8 A;  5HC9 A;  4X4T A;  4BXO A;  5KFS A;  4EZ6 A;  8ICJ A;  1U9L A;  4O3R A;  1TK0 A;  4YMM A;  2DR9 A;  3GIL A;  1SZP A;  3RH5 A;  4YVZ A;  4TQS A;  2ZUC A;  5J0Y A;  2W9C A;  5IIN A;  3Q8M A;  1ZYQ A;  5KFV A;  4K4I A;  1ZQX A;  3AQN A;  2DRA A;  3GIK A;  2R8H A;  4QZG A;  2VAN A;  2XY5 A;  4QWA A;  4J9Q A;  1U4B A;  1NJY A;  2ZJ5 A;  1ZQC A;  2PI5 A;  2NRV A;  3MFH A;  4FH3 A;  4DL5 A;  3ZDE A;  2AJQ A;  1X9S A;  9ICK A;  4YFK A;  3JPT A;  9ICL A;  1YLQ A;  3JZ0 A;  3PO5 A;  5DB7 A;  4NLZ A;  3Q8P B;  4R63 A;  3OSN A;  4J9M A;  4NKT A;  4ELV A;  1IM4 A;  5J2F A;  2BCV A;  4DQI A;  4WC6 A;  2KFZ A;  4DL4 A;  2PI4 A;  1BPB A;  1SKR A;  4PHP A;  1S97 A;  4DSJ A;  3IM1 A;  1DK3 A;  3N4M B;  4O3Q A;  3UQ0 A;  3PW2 A;  3K4G A;  4I2I A;  3RH6 A;  2ASJ A;  1UA1 A;  1L5U A;  5J2C A;  2HHQ A;  3RAQ A;  2M2W A;  2DVI A;  4KMU A;  9ICF A;  4E8F A;  3BQ1 A;  2AU0 A;  4UB2 A;  5J2G A;  7ICJ A;  9ICA A;  5KFJ A;  1MSW D;  3C1Z A;  9ICX A;  1ZQH A;  4KLF A;  3C5G A;  2WTF A;  4X4Q A;  3THV A;  1BNP A;  4YXM A;  4F93 B;  2FPL A;  5HR9 A;  4X4S A;  4KLG A;  3FDS A;  4O3P A;  1RPL A;  5HHI A;  5J2E A;  3OJU A;  3G6Y A;  3M8R A;  2DPJ A;  4KTQ A;  5BOM A;  7ICR A;  2NRW A;  1L3V A;  1KFS A;  3EW9 A;  4RQ7 A;  3C18 A;  5KT5 A;  3GV7 B;  3GFK B;  5TZV A;  1Z3E B;  4PGX A;  4X4N A;  3ZD9 A;  4LZG A;  4KLM A;  4X4P A;  3WFR E;  1BPX A;  3GV5 B;  2KP7 A;  3RB6 A;  3B0X A;  3BQT A;  2KZ3 A;  4J9N A;  2W9M A;  4UAW A;  4JWM A;  1DK2 A;  5HRK A;  4YD1 A;  1ZJN A;  5J0Q A;  3JPO A;  4DLG A;  4DL3 A;  1SL0 A;  5HRB A;  1ZQZ A;  5KG2 A;  5CB1 A;  1ZET A;  2DPI A;  1D9D A;  5CHG A;  2HVI A;  4FH5 A;  3PX4 A;  2Y1J A;  3QE9 Y;  1BPY A;  5DDY A;  4GC6 A;  3MDA A;  4ECR A;  4KLS A;  4RPZ A;  4Q44 A;  2AGQ A;  2ZHB A;  1NKE A;  1NJX A;  7ICM A;  2PFP A;  5J2A A;  4NLK A;  1D9F A;  3OV7 A;  1Z00 B;  3TAQ A;  4J9K A;  4JWN A;  9ICN A;  2ID1 A;  1VFG A;  1TFY A;  4HYK A;  5KG1 A;  4GC7 A;  1ZQK A;  3BQ2 A;  4EZ9 A;  2HHP A;  3B0Y A;  5J0R A;  3HX0 A;  1RYR A;  1NK6 A;  4DQR A;  5F2V O;  2V4Q A;  4ECZ A;  4F50 A;  2ATL A;  1S10 A;  4F3O A;  2ISP A;  4NXZ A;  3ISB A;  1QSS A;  4YR0 A;  4FO6 A;  2NRK A;  5KT2 A;  4IQT A;  4B9L A;  4G3I A;  4I2C A;  3PX0 A;  1S77 D;  1QSL A;  2FMQ A;  1CEZ A;  4QZC A;  2W8K A;  1N56 A;  4RNM A;  2KN7 A;  1U47 A;  3OJS A;  1BVS A;  5J2K A;  2IMW P;  1S76 D;  5HNK A;  7ICG A;  2HHX A;  4AT8 A;  4WC2 A;  1X9W A;  4YMO A;  3TAN A;  4RQ2 A;  4QZA A;  4KLI A;  2ZH4 A;  1TFW A;  3MBY A;  5CWR A;  4F5N A;  5HP4 A;  3ORY A;  3RBE A;  1HJP A;  3QZ7 A;  7ICN A;  3SYZ A;  4EBK A;  4O3S A;  5IIK A;  3SZ2 A;  1QLN A;  4NKU A;  4DQS A;  4JUZ A;  3EZ5 A;  1TAQ A;  4PHD A;  5CP2 A;  5KFQ A;  4DSK A;  1K1Q A;  4DSF A;  5DKW A;  4M9L A;  1JAJ A;  4F8R A;  3H39 A;  4FHV A;  5DLF A;  1KRP A;  2DFL A;  2R8J A;  3SV4 A;  3HWT A;  5KFT A;  4M47 A;  3AUO A;  3K75 D;  3AQK A;  2DR5 A;  3PR4 A;  4XUS A;  1PZN A;  1U45 A;  1HUZ A;  4AT7 B;  4DSL A;  4QWC A;  2HHU A;  8ICO A;  8ICS A;  4UQG A;  5EWE A;  1C7Y A;  8ICM A;  2NRZ A;  2KTQ A;  2AGO A;  1R89 A;  1RXW A;  4RQ8 A;  4I2E A;  4RWO A;  1XSP A;  3T5H A;  2I9G A;  1KNY A;  3E2E A;  5J2D A;  7ICP A;  5IIO A;  1NKB A;  1T7P A;  1FA0 A;  3OUY B;  4RZR A;  4EBC A;  2AGP A;  2IHM A;  4C8L A;  4M6W A;  3ISD A;  4J9R A;  1TK8 A;  4KLE A;  4B9U A;  4IRK A;  2BCS A;  3MAB A;  5DQI A;  3MGH A;  1IXR A;  9ICJ A;  1KFT A;  2I1Q A;  5KFU A;  3HP6 A;  1NK7 A;  5C5J A;  2ALZ A;  4Z6D A;  4EBD A;  4MFC A;  3HT3 A;  2XY6 A;  2BQR A;  4P2H A;  2M2V A;  1F5A A;  2ZH9 A;  3QEB Z;  4RWN A;  4DLE A;  4ECS A;  2HW3 A;  3C23 A;  4YCX A;  4J9S A;  5III A;  1MQ2 A;  3ZDB A;  3HJ1 A;  3RAX A;  1TK5 A;  4JV1 A;  4X4U A;  4I2A A;  4KIT B;  2F1J A;  3FYH A;  4DSI A;  3HW8 A;  2BR0 A;  2JZB B;  7ICU A;  2MUT A;  5HRF A;  4WC1 A;  3M8S A;  3UXO A;  1DOQ A;  5KFM A;  5EWG A;  3AU6 A;  8ICZ A;  8ICL A;  3H4D A;  4ED2 A;  2DR7 A;  5DB9 A;  1L3T A;  5J2I A;  4MF2 A;  9ICR A;  1OU5 A;  3C2L A;  3H37 A;  1S0V A;  5BPC A;  1LV5 A;  4GLX A; 
#chains in the Genus database with same CATH topology
 2ZIW A;  3M6K A;  3NKU A;  4PGY A;  2ZJ8 A;  1WWU A;  1FEZ A;  1JUD A;  5CFS A;  3ISC A;  3OGU A;  1OUQ A;  3H0R B;  5AIC A;  4IQV A;  4UW9 A;  3F2C A;  5KG0 A;  1EXN A;  1SXE A;  2HMX A;  2MU2 A;  5KG3 A;  7ICV A;  5KFO A;  8ICC A;  2J6T A;  5DBA A;  5CRX A;  4OAI Z;  4WCW A;  5ALK A;  3MGI A;  4YG2 A;  3UPS A;  3KBB A;  5KL8 B;  5HR6 A;  2BBH A;  3KZI U;  3RJI A;  4JLX A;  1L7N A;  2WF5 A;  4F5O A;  2UVV A;  5KFE A;  1S8O A;  4XJE A;  2JH1 A;  3GII A;  3BZC A;  5CJ7 A;  3JYY A;  4UBC A;  3M9M B;  3C66 A;  5EE1 A;  4P4O A;  2K4I A;  2CXY A;  3L5K A;  4UAY A;  2XIC A;  1N63 A;  5AM2 A;  4ECX A;  4O0I A;  3MR5 A;  4F4Z A;  2KFN A;  3SD7 A;  1KTQ A;  4O3O A;  2XCA A;  3HJ4 A;  8ICY A;  4R8U B;  4USA A;  3AQM A;  1TFR A;  4FZL A;  5ALM A;  2P35 A;  3OPX A;  3PSF A;  3O0F A;  1NK0 A;  3TFS A;  4RQ3 A;  1B4F A;  1VJ7 A;  4XQ7 A;  2HBM A;  5HRL A;  4DSE A;  2C2E A;  1SWW A;  3C5F A;  4NV0 A;  4AT9 B;  5DGA A;  3RRH A;  4C4S A;  5EWF A;  4LEZ A;  4WC7 A;  4MFF A;  4WBZ A;  1RXV A;  2WF6 A;  4EEY A;  3D2S A;  5HRH A;  3TFR A;  3RJJ A;  5KFY A;  4DFP A;  5KFR A;  2ZXH A;  5AM1 A;  2M2U A;  5G5G A;  3CP8 A;  3LDA A;  1KQQ A;  2R8K A;  4FFD A;  3RJK A;  1JN3 A;  2B0C A;  1RYS A;  5KFG A;  1UA0 A;  1VJ5 A;  2KKP A;  1ZQB A;  4BDP A;  1UCV A;  1UHU A;  4DOC A;  2KTQ A;  3PW5 A;  1ZQY A;  4MEX A;  3OUY A;  5AI9 A;  3OSP A;  8ICN A;  4K4H A;  1J2N A;  4RQN A;  2UVU A;  3H4B A;  9ICP A;  4KMO B;  4CE6 A;  2JEF A;  2FLL A;  2A3V A;  4ECY A;  3UQ2 A;  4C80 A;  4I2B A;  5KT4 A;  2PXI A;  3NVW A;  1FIQ A;  1XSN A;  1ZQW A;  2Q66 A;  3D2Q A;  9ICG A;  1QCK A;  1UEV A;  1F44 A;  5IIL A;  3G6X A;  4P4P A;  7ICQ A;  3T79 A;  9ICM A;  1JX4 A;  1Z4O A;  1A6S A;  4YR2 A;  5AM3 A;  8ICA A;  2KJ5 A;  8ICG A;  2ZJA A;  2ZH5 A;  3EPG A;  3MR6 A;  1T4G A;  3PW4 A;  4OAF A;  5IIM A;  3ZDD A;  2AQ0 A;  4ED6 A;  2BQU A;  4AYB C;  4YR3 A;  2OH2 A;  5AKI A;  3PML A;  2M2T A;  1JI7 A;  5D4B A;  2HOI A;  1OW5 A;  3G6V A;  2ZHA A;  2NRT A;  8ICQ A;  2G0A A;  9ICB A;  3M7D A;  3JPN A;  4C8M A;  1SKS A;  4S3N A;  4OCZ A;  4AT8 B;  4WC4 A;  3KKA C;  5J8Y A;  1PVR A;  2EDU A;  4TUR A;  2ZTD A;  1TAU A;  2H3Q A;  2OHF A;  4U6P A;  4DFK A;  3GV8 B;  1F5S A;  2EAP A;  1NJW A;  2PMZ F;  1D8L A;  4R8U A;  3IRU A;  1LVH A;  2Q0Z X;  5KG6 A;  2DQN B;  1ZQS A;  5DEC A;  2KIC A;  3RR7 A;  3OVB A;  2VA2 A;  1MN8 A;  5AKK A;  3F53 A;  3NRZ A;  4J9P A;  4RPX A;  2LPE A;  4AT9 A;  2C2D A;  2MAX A;  4RQ6 A;  1CUK A;  5L1I A;  1RDF A;  3LWM A;  1WCL A;  4O3R A;  1ARO P;  4M6W B;  4O5K A;  4FHW A;  2R8I A;  8ICE A;  9ICU A;  3J81 j;  4EEB A;  3V6H A;  4I2G A;  5DG9 A;  3RH4 A;  4NXV A;  3NGD A;  3C1Y A;  3TAD C;  2A1A A;  1BPD A;  4AP9 A;  4PH5 A;  4LVS A;  4HX0 A;  3CW2 C;  8ICX A;  1M6Y A;  3HKZ C;  3PW0 A;  3QUC A;  4Y2J A;  2HBL A;  5DBB A;  1KW4 A;  2WAQ F;  8ICJ A;  3WU2 U;  1TK0 A;  2F8L A;  4YVZ A;  3WKA A;  5J0Y A;  3AQN A;  4LEW A;  2CRX A;  1U4B A;  4CF4 A;  2OEH A;  4DL5 A;  3ZDE A;  2AJQ A;  2OM6 A;  5T14 A;  5ALU A;  4BJQ A;  3ICX A;  4NKT A;  5J2F A;  2PI4 A;  1DK3 A;  4K9A A;  3IM1 A;  3N4M B;  5KAF U;  3UQ0 A;  3F5E A;  4IL6 U;  2M2W A;  5ALH A;  4GFJ A;  2F8K A;  2KD1 A;  3C1Z A;  1RQN A;  1PVP A;  2G09 A;  2FI1 A;  2KVC A;  5AK5 A;  3C5G A;  4KLF A;  4X4Q A;  5HR9 A;  2FPL A;  3OJU A;  4NJ8 A;  3M8R A;  4F71 A;  5ALL A;  5ALR A;  3KKA A;  1L3V A;  1WG8 A;  1KFS A;  4WQK A;  5ALT A;  1Z1B A;  3GV7 B;  3ETR A;  1Z3E B;  1S5L U;  3ZD9 A;  4X4P A;  3DEE A;  1BPX A;  2KP7 A;  3RB6 A;  3BQT A;  3CRX A;  4UAW A;  4JWM A;  5HRK A;  1DK2 A;  4YD1 A;  2ODG A;  4KX5 A;  4DL3 A;  1SL0 A;  1ZQZ A;  1ZET A;  1D9D A;  4WH5 A;  3QE9 Y;  4ECR A;  4RPZ A;  2PFP A;  4NLK A;  1Z00 B;  4J9K A;  5AI8 A;  9ICN A;  1VFG A;  4HYK A;  5F2V O;  2V4Q A;  5G5H A;  2ATL A;  1S10 A;  2D3D A;  3QU7 A;  4B9L A;  3PX0 A;  2W03 A;  1QSL A;  1CEZ A;  4QZC A;  2W8K A;  1N56 A;  4Y2S A;  1U47 A;  1S76 D;  4AT8 A;  3HJE A;  1X9W A;  3TAD A;  4CRX A;  2WF8 A;  4F5N A;  2K4E A;  2HN2 A;  4EBK A;  2IUB A;  1GPJ A;  3EF2 A;  1TAQ A;  4PHD A;  5KFQ A;  4F8R A;  2YML A;  5EE0 A;  2R8J A;  4M47 A;  4C4R A;  3BZK A;  3ONN A;  4UQG A;  1XO0 A;  8ICM A;  1RXW A;  4RWO A;  3T5H A;  3NS1 A;  3E2E A;  1NKB A;  5ALI A;  4RZR A;  2MSN A;  4M6W A;  3E0F A;  2Y0S C;  2BCS A;  9ICJ A;  1KFT A;  3HT3 A;  2M2V A;  4P2H A;  4RWN A;  4YCX A;  2K8B B;  2KOB A;  4JV1 A;  4X4U A;  4ICA A;  1ZD2 P;  2F1J A;  2QKQ A;  3FYH A;  4DSI A;  1DOQ A;  8ICL A;  4ED2 A;  2H3V A;  2DR7 A;  5J2I A;  4MF2 A;  3C2L A;  5BPC A;  3GU3 A;  4O5E A;  2FLN A;  4JK1 A;  5J0T A;  4IS7 A;  1JRO A;  4TUQ A;  1NK9 A;  3OHA A;  3T5K A;  3QEA Z;  2ISO A;  4UB4 A;  1V4A A;  4QW9 A;  5AKX A;  5AM4 A;  3SAH A;  4PHA A;  4Q43 A;  3M6Z A;  3RJF A;  4RU9 A;  4QZH A;  2W55 A;  2NYV A;  5CR0 A;  2W11 A;  4QWB A;  4FS2 A;  1IIP A;  2FMS A;  3MFI A;  5J0S A;  3SAF A;  4DS5 A;  5KFA A;  3GDX A;  2KZM A;  5KFK A;  5ALE A;  3WFO A;  1ZXI A;  5D63 A;  4Q8E A;  1XNS A;  1JXE A;  5CFT A;  5HML A;  3VCB A;  5F9L A;  3MR3 A;  4B9V A;  8ICW A;  1WOT A;  1L7O A;  4KLD A;  4RQ4 A;  2XC9 A;  3F2B A;  2A1J B;  3TQ1 A;  3DV9 A;  4FHX A;  1ZQP A;  2W9B B;  4KX3 A;  4Z6F A;  2YMQ A;  1VDV A;  4EYH B;  5HRI A;  2KV2 A;  3LVW A;  3NVZ A;  2RP5 A;  4F4Y A;  2WF9 A;  4G9B A;  4RWQ A;  3EPI A;  3HKZ F;  4MHV A;  5DBC A;  1UPH A;  2JXJ A;  2Y9T A;  5ALW A;  1N48 A;  2G06 A;  3WK7 A;  5DED A;  1Z00 A;  3UMG A;  5KFC A;  1ECW A;  1Z1V A;  3AU2 A;  1DGJ A;  4DL7 A;  1AQ6 A;  1JRP A;  1JMS A;  3C2K A;  2R8G A;  5HRD A;  4PGQ A;  2QB1 A;  2EH9 A;  1A0P A;  1WUD A;  5EOZ A;  4ZH4 A;  1NKC A;  4RNO A;  1ZQL A;  2NO5 A;  1S0N A;  1T3Q A;  5L1L A;  3T3F A;  9ICS A;  2V4R A;  1ZQF A;  4NM1 A;  4FE3 A;  5B3P A;  5DGB A;  4FHP A;  4EED A;  2ZUB A;  1X2I A;  4EEK A;  1HUO A;  2W7P A;  4PL2 A;  4K9B A;  5KL1 B;  1MC8 A;  4KLQ A;  2IHN A;  4MKP A;  5DDM A;  2W43 A;  5DG7 A;  4CNQ A;  5L9X A;  4E0D A;  2DRA A;  4P4M A;  1UEU A;  1J2M A;  2IBK A;  4DS4 A;  3BJY A;  5KFF A;  4B9N A;  3H7I A;  3PVX A;  4DFJ A;  2PFO A;  2W9C B;  3KTQ A;  1ZQU A;  4YD2 A;  3UXP A;  3ALR A;  2MRL A;  1S9F A;  5AI6 A;  4X4V A;  4PL1 A;  3LK9 A;  2E8N A;  1TV9 A;  1NNL A;  2YB1 A;  2Q4T A;  3ZDA A;  2V9W A;  4X0A A;  1ZD4 A;  2K8C B;  3TKA A;  1ZD3 A;  4F4W A;  3RJG A;  1ZQJ A;  1XS9 D;  5ALF A;  2BCU A;  1BPZ A;  2A19 A;  2IOF A;  2KIV A;  4RPY A;  2HBK A;  3C2M A;  7ICS A;  5JRT A;  1NOM A;  3RFA A;  5DQG A;  4BX9 C;  3WK5 A;  9ICT A;  5KFD A;  1X6I A;  4NY8 A;  4ECT A;  5J0P A;  2N1R A;  1XWL A;  3MC1 A;  1ZQ1 C;  4F4X A;  5IIJ A;  2HHS A;  3QU2 A;  5DQH A;  2P66 A;  1NO5 A;  2ZTE A;  3KHH A;  4OAG A;  3Q8S B;  4DQQ A;  1MA7 A;  4GXJ A;  4RQ5 A;  2H5X A;  3TAP A;  3AL0 B;  3MCR A;  3LWL A;  1LB2 B;  3WK4 A;  9ICV A;  4ED7 A;  4Y2Q A;  2W8L A;  1R8B A;  2BCQ A;  2GLE A;  5DB6 A;  1XSL A;  4I2F A;  4EX7 A;  1ZQQ A;  1ZQI A;  2AHO B;  1ZD5 A;  2LI6 A;  5L1K A;  2BPC A;  4QZF A;  1HIW A;  4DEZ A;  3WK6 A;  4YP3 A;  2A1J A;  4QZ9 A;  2W9B A;  4M04 A;  1DXS A;  2LMR A;  3KHG A;  2BGW A;  4E80 A;  3QX7 A;  9ICH A;  2JH7 A;  4M0A A;  2WF7 A;  2JV3 A;  1ZRN A;  4WBY A;  3PST A;  2RDJ A;  3RJE A;  1MIY A;  3CYM A;  5KFL A;  2QB0 B;  1ZQN A;  2AXT U;  1B22 A;  4LZD A;  3MR2 A;  4I2J A;  4FBT A;  1CRX A;  1JXL A;  4DF8 A;  4F4K A;  4CF5 A;  1L3S A;  4EEN A;  3PV8 A;  3NTU A;  4DL6 A;  1R8C A;  4K97 A;  2UVR A;  2DBY A;  1KEJ A;  5AKY A;  5KG5 A;  2Y9U A;  1XU4 A;  3JPR A;  1WWV A;  1YT3 A;  2IOF K;  4K8V A;  4UAZ A;  9ICI A;  4FZN A;  4K98 A;  5ALS A;  4WC3 A;  5J29 A;  2JEI A;  4JV2 A;  2XCP A;  4M5D A;  2BKE A;  1L8L A;  8ICK A;  1DGS A;  2FPM A;  8ICF A;  8ICH A;  1Y88 A;  4FS1 A;  2VA8 A;  2I6X A;  1P7D A;  4CDG A;  2JEG A;  1X40 A;  1Z4N A;  4ED0 A;  3A0B U;  3WFQ E;  2E8P A;  1FO4 A;  3V7K A;  4NLB A;  1U9L A;  2W3S A;  3ER9 B;  5IIN A;  1SGG A;  2W9C A;  5KFV A;  2K89 A;  4QZG A;  2VAN A;  2DGZ A;  4QWA A;  4J9Q A;  5AK4 A;  1NJY A;  2PI5 A;  4FH3 A;  1X9S A;  9ICK A;  4YFK A;  9ICL A;  3JZ0 A;  4NLZ A;  5E79 U;  4J9M A;  4ELV A;  4WC6 A;  1SV0 C;  2F3N A;  4O6A A;  5JTG A;  1X42 A;  4O3Q A;  1UA1 A;  2YMP A;  5J2C A;  3RAQ A;  2DVI A;  4Y2U A;  2DF4 B;  2KIW A;  9ICF A;  2KKV A;  3BQ1 A;  5J2G A;  7ICJ A;  1MSW D;  1ZQH A;  3NVO A;  1BNP A;  4WQL A;  2KEY A;  4O3P A;  5HHI A;  2DPJ A;  4KTQ A;  5BOM A;  1RM6 C;  3B9J A;  2F2A B;  2MA1 A;  3DDH A;  3GFK B;  5TZV A;  3B0X A;  4C7Z A;  4J9N A;  2YTU A;  3JPO A;  5CB1 A;  2B4V A;  3PZP A;  4O67 A;  5DDY A;  4GC6 A;  3MDA A;  2ZHB A;  2AGQ A;  1NKE A;  7ICM A;  5J2A A;  5AK3 A;  4PJ0 U;  2VKQ A;  4OJ6 A;  5KG1 A;  3FAH A;  5J0R A;  2F77 X;  4JLZ A;  2ISP A;  3ISB A;  1QSS A;  4YR0 A;  2NRK A;  5KT2 A;  4G3I A;  4I2C A;  4OAH A;  1S77 D;  3IV6 A;  2KN7 A;  2YN4 A;  4N7R A;  7ICG A;  3OWG A;  1TFW A;  2ZIX B;  2CPR A;  2K8A A;  2M0N A;  3ORY A;  5ALN A;  4EEL A;  1HJP A;  2KE7 A;  4BUG A;  3QZ7 A;  3SYZ A;  5C0Y A;  2K60 A;  3SZ2 A;  3WKB A;  4NKU A;  5CP2 A;  1K1Q A;  2QB0 A;  5DKW A;  4DSF A;  1JAJ A;  1KRP A;  5B66 U;  3SV4 A;  4NL9 C;  2LYB A;  3AQK A;  1F0M A;  1HUZ A;  4AT7 B;  4DSL A;  5ALY A;  1SV0 A;  2AGP A;  2IHM A;  5TIS U;  3ISD A;  4J9R A;  2FDR A;  1C20 A;  5DQI A;  3HP6 A;  2DUY A;  4EBD A;  2ZH9 A;  5D61 A;  5AI5 A;  3QEB Z;  2DL0 A;  3R9K A;  3C23 A;  1MQ2 A;  3RAX A;  1TK5 A;  4KIT B;  2EAN A;  7ICU A;  2JZB B;  4Y2R A;  5HRF A;  3UXO A;  2ZG6 A;  3I28 A;  5ALJ A;  5DB9 A;  1L3T A;  4I0U A;  3F5A A;  5AM5 A;  1S0V A;  1LV5 A;  1UET A;  5CHE A;  3HIL A;  3V7J A;  2HHW A;  4QZE A;  3NUQ A;  4TUS A;  4F5R A;  1B0X A;  3CK6 A;  2P6U A;  3VC8 A;  2DKX A;  5JU5 A;  3TAR A;  3N28 A;  3SI8 A;  3T5L A;  4KLH A;  2YX8 A;  1KL9 A;  2KVS A;  4F2S A;  4M9J A;  1TE2 A;  3KD3 A;  1ZQD A;  2OWO A;  1JIH A;  2GOL A;  5AKJ A;  3C21 A;  4LJX A;  3F2D A;  3BDP A;  2OXO A;  1ZOL A;  5ALV A;  1WCN A;  1MIV A;  4WJ3 B;  1KDH A;  3WKD A;  1COK A;  4K4G A;  4LEV A;  8ICP A;  4R66 A;  3IG8 A;  1UT8 A;  2EZZ A;  3QUB A;  2DKZ A;  3RB4 A;  5KFP A;  5ALG A;  3SQI A;  1ZQV A;  3H8S A;  3SEI A;  3WFP A;  4Z6C A;  5AKH A;  5CA7 A;  4ED1 A;  2ZTC A;  4M9H A;  2OCE A;  4UAV A;  1QTM A;  2IHO A;  1COO A;  4RT3 A;  2JR5 A;  2XI9 A;  1SB3 C;  4QWE A;  4UD5 A;  3HRD D;  8ICV A;  5AIA A;  4TUP A;  2W9A A;  2FLP A;  4NL9 A;  1SL1 A;  4GXI A;  4X0B A;  4B9M A;  4FO1 A;  3UMC A;  3TI0 A;  3QU5 A;  1XO1 A;  1K1S A;  2M9N A;  3C29 A;  4DCC A;  4C8O A;  2B6G A;  3PSI A;  4DQP A;  4KN4 A;  5KFB A;  5DB8 A;  9ICW A;  1SL2 A;  9ICO A;  5ALD A;  2ZXI A;  4UB5 A;  4KM5 A;  3PR5 B;  3RR8 A;  1PUZ A;  2ZIX A;  2J6S A;  1ZJM A;  3L4P A;  2HHT A;  1WYG A;  3BS7 A;  4FBU A;  3OVS A;  4F92 B;  3T5J A;  2AQ4 A;  4ED3 A;  3U26 A;  3JPS A;  4C8K A;  4Y2V A;  1ZQA A;  2IOH A;  5GTH U;  3H40 A;  4ATB B;  4IQU A;  2KMD A;  5DLG A;  2DRB A;  4ED8 A;  4QZ8 A;  1PVQ A;  3GQC A;  4AT7 A;  1ZQE A;  4XA5 A;  4I2H A;  1MIW A;  4R64 A;  2YY6 A;  5L1J A;  2LBO A;  3RB0 A;  4AYB F;  1JAL A;  2EAM A;  3I76 A;  3C28 A;  3Q8K A;  4F72 A;  2OYY A;  4WC5 A;  3RBD A;  2HN1 A;  4I29 A;  2UVW A;  4TQR A;  1D8Y A;  4QZI A;  4KLL A;  4F2R A;  2G08 A;  1QQ5 A;  2QAR B;  5KNI A;  5J0U A;  2K4H A;  2ESE A;  2L5Y A;  7ICK A;  1KSP A;  2JZB A;  3LYS A;  5CEH A;  4CCH A;  4MFA A;  2O1P A;  4GXK A;  3Q8Q B;  4Q45 A;  2E1F A;  5H2F U;  1KBU A;  2P6R A;  2BDP A;  2AH5 A;  4QIW C;  3ETL A;  5HRE A;  4MF8 A;  2RFF A;  4ECV A;  2ASD A;  4O9M A;  2H3I A;  4IG8 A;  2ZH3 A;  1Q79 A;  4PHE A;  3NVY A;  3QNM A;  3RJH A;  3IP4 B;  5KFH A;  9ICE A;  8ICI A;  2C22 A;  2BPF A;  1K5O A;  3ER8 C;  5HR7 A;  4ELT A;  2LM1 A;  4M9G A;  1NZP A;  3H0L B;  4YXJ A;  2C2R A;  4NXU A;  4DOA A;  1J97 A;  4U7C A;  1KFD A;  4IR9 A;  4X4O A;  1U48 A;  1GO3 F;  4R65 A;  2BE3 A;  1YZ6 A;  3IN5 A;  3AEV A;  4F5P A;  4RUC A;  4DFM A;  2GWS A;  2H3Z A;  9ICQ A;  4UAR A;  2XID A;  4DF4 A;  5AM0 A;  4NLN A;  3UPQ A;  1NZB A;  5ALO A;  3UXN A;  2YB4 A;  2WB1 C;  3H8M A;  1Z19 A;  4RWP A;  5AK6 A;  1NJZ A;  7ICE A;  4BWJ A;  2G5H B;  4CF3 A;  3RF9 A;  2ZH7 A;  3BQ0 A;  1N60 A;  5J2J A;  2FCL A;  5JUM A;  4PPX A;  2RDI A;  2B21 A;  1NK5 A;  3V72 A;  2IA6 A;  2W7O A;  4ACO A;  5FP0 A;  5J2B A;  3SV3 A;  7ICL A;  1S0O A;  5EE3 A;  3V6J A;  5AKG A;  4ECQ A;  4QZB A;  3LQC B;  1Q3U A;  5KG4 A;  4OD0 A;  1QQ6 A;  2VA3 A;  5AIB A;  4ELU A;  1T94 A;  1NK8 A;  3L9D A;  1A76 A;  3SR6 A;  1YZ7 A;  4J9O A;  5KFW A;  3H8J A;  4GIB A;  4Y2P A;  4KLT A;  1D8B A;  2E8O A;  2ZH1 A;  4BGD A;  2H3F A;  2W04 A;  4YQW A;  3IDW A;  2PKE A;  1RZT A;  1N2X A;  2B51 A;  1T3N A;  3ERC C;  5KT3 A;  2ES6 A;  2G5I B;  3L3F X;  4QZD A;  2MUT B;  3GIJ A;  1ZQM A;  4ATB A;  2WHE A;  1PK1 B;  4E7X A;  1O08 A;  2HOF A;  1QH9 A;  3WFS C;  3IHQ B;  3M9O B;  2ZH8 A;  5HC9 A;  2RRD A;  4YMM A;  1SZP A;  3RH5 A;  1ZYQ A;  2EWR A;  3K1Z A;  3GIK A;  2XY5 A;  1LKY B;  2ZJ5 A;  2NRV A;  4UB8 U;  5ALZ A;  3JPT A;  1YLQ A;  4Y2T A;  2GA9 D;  1IM4 A;  2BCV A;  4DL4 A;  1SKR A;  1N62 A;  1L8O A;  1N61 A;  3K4G A;  2QAR A;  3CNH A;  4C0Z A;  2AU0 A;  9ICA A;  4O69 A;  2WTF A;  3KZX A;  3THV A;  4YXM A;  4KLG A;  3G6Y A;  1RPL A;  7ICR A;  5J2E A;  3QUT A;  3BS5 B;  2EAO A;  3EW9 A;  3QU9 A;  5KT5 A;  3NRW A;  2Z7J A;  4Y2Y A;  4X4N A;  4LZG A;  3GV5 B;  4HAI A;  1L6N A;  2W9M A;  5J0Q A;  4DLG A;  5HRB A;  2Y0S F;  2DPI A;  5CHG A;  4FH5 A;  2Y1J A;  1BPY A;  4KLS A;  4Q44 A;  2WAQ C;  1D9F A;  1QQ7 A;  1ZQK A;  2RQ5 A;  3BQ2 A;  5AI4 A;  1RYR A;  1NK6 A;  4DQR A;  4F50 A;  4F3O A;  1V38 A;  4NXZ A;  4UAU A;  3UMB A;  5GTI U;  3OJS A;  3D2N A;  2HHX A;  5HNK A;  3AN1 A;  2ZH4 A;  4YMO A;  4KLI A;  4RQ2 A;  4OJL A;  1DRG A;  3RBE A;  5AKE A;  3ED5 A;  4EGW A;  5IIK A;  1QLN A;  4DQS A;  4JUZ A;  4QIW F;  4M9L A;  4FHV A;  3H39 A;  4C4T A;  1N5W A;  1X6J A;  3HWT A;  5KFT A;  3PR4 A;  4XUS A;  1PZN A;  3E58 A;  1U45 A;  8ICO A;  4QWC A;  8ICS A;  5EWE A;  1C7Y A;  5J8Y C;  4RQ8 A;  2LYA A;  1KNY A;  5J2D A;  7ICP A;  4EBC A;  1TK8 A;  1N5X A;  4KLE A;  5L1M A;  4B9U A;  3MGH A;  2JMG A;  5C5J A;  2ALZ A;  4MFC A;  2XY6 A;  2HI0 A;  2BQR A;  2NV3 A;  3HJ1 A;  1V85 A;  1L7M A;  2E3T A;  2HSZ A;  1Q46 A;  3HW8 A;  4EX6 A;  2MUT A;  4WC1 A;  3M8S A;  3FC4 A;  3AU6 A;  8ICZ A;  1PK1 A;  1TAM A;  4QNL A;  3H37 A;  4GLX A;  4C7Y A;  2WB1 F;  5AKZ A;  2ZIU B;  4EBJ A;  4J9L A;  2HCF A;  7ICI A;  7ICO A;  2W3R A;  5D49 A;  1LKY A;  4JMU A;  4WC0 A;  3AM9 A;  3ZDC A;  4M9N A;  4LT6 A;  2EZY A;  4O3N A;  3PNC A;  3PY8 A;  4ECU A;  4RT2 A;  2JRZ A;  4YMN A;  1NK4 A;  4NXX A;  1TVA A;  3RRG A;  3H0M B;  1Q8K A;  2R18 A;  3RB3 A;  1RYU A;  2E1E A;  2KNJ A;  1T8E A;  1X9M A;  3OVA A;  3K1R B;  2BQ3 A;  5KTQ A;  2EQY A;  5KFI A;  3BS5 A;  4UD4 A;  5AHX A;  1RQL A;  5BOL A;  4QJF B;  3H38 A;  1VLB A;  2NO4 A;  1ZQG A;  1PX5 A;  4RUA A;  2WFA A;  1KLN A;  3KFU F;  2Y1I A;  4DWI A;  4RQM A;  1CI4 A;  5ALP A;  2J6U A;  3A0H U;  1BGX T;  2G07 A;  3LVV A;  4DO9 A;  5DG8 A;  3K7D A;  3JCF A;  1KN5 A;  2VIX A;  4UB3 A;  5F9N A;  4DL2 A;  2PBE A;  4O68 A;  1XC9 A;  1BNO A;  4IRD A;  2XGP A;  4O5C A;  3EUB 2;  1U49 A;  2O5A A;  4F5Q A;  1SWV A;  3EYZ A;  3BQ7 A;  3IG5 A;  3GIM A;  4NWI A;  3AQF A;  4F91 B;  4UBB A;  4UB1 A;  2I5H A;  3OTQ A;  2HVH A;  8ICB A;  4EYI B;  1O03 A;  2JHD A;  1X9X A;  3KHL A;  4NM2 A;  2XO7 A;  5D46 A;  1ZRM A;  5HRG A;  7ICH A;  3HIY A;  4B9T A;  4NLC A;  4O3M A;  3M9N B;  5KT6 A;  1A77 A;  4OJO A;  2PFQ A;  4KLU A;  3NWI A;  1URJ A;  2XY7 A;  1HEK A;  4UAT A;  2KG5 A;  5ALX A;  2KSO B;  3HPO A;  2FPK A;  2BCR A;  3N7S C;  1JQR A;  4UAS A;  4BXO B;  3PSP A;  5A0L A;  2XGQ A;  4I2D A;  3UM9 A;  2VJ4 A;  5EE9 A;  4NLG A;  3OHB A;  5KFX A;  5KT7 A;  2JGA A;  3N7P D;  5F3X B;  4OJ5 A;  4EBE A;  4JV0 A;  5HMM A;  3SAG A;  2C28 A;  1TKD A;  3WK8 A;  4Q8F A;  1MQ3 A;  2EZX A;  5KFN A;  4PZN A;  4OO1 J;  4NXT A;  4YN4 A;  3V6K A;  1SKW A;  9ICC A;  2W54 A;  2O6K A;  5J0O A;  1ED1 A;  2DR8 A;  8ICR A;  4KB6 A;  2ZIU A;  5CFU A;  4RNN A;  5HHH A;  1H38 A;  5JTI A;  1S0M A;  1ZQT A;  4XQ8 A;  2K4P A;  3ZD8 A;  1ZQR A;  4FZM A;  2NRX A;  7ICF A;  2F76 X;  1IV8 A;  4QW8 A;  8ICU A;  3Q8L A;  1SIJ A;  2KK0 A;  4C8N A;  4US9 A;  3PO4 A;  3MDC A;  4P0P B;  2HHV A;  2LKY A;  2GH1 A;  2B56 A;  2BPG A;  2JEJ A;  4IR1 A;  1Q78 A;  2ZIV B;  4M2Y A;  5J0X A;  3PHZ A;  3WKC A;  2FMP A;  3AQL A;  2BDU A;  4KLO A;  4LEY A;  4IC9 A;  4EP7 A;  4JB3 A;  4FHY A;  2LYH A;  3WKE A;  4IRC A;  2ZH2 A;  3QZ8 A;  5KG7 A;  3V7L A;  3I1Y A;  3EWA A;  3H3A A;  4I28 A;  3KOO A;  7ICT A;  3N97 B;  4X4R A;  3Q8R B;  4RQ1 A;  1BPE A;  1V9P A;  3KHR A;  8ICT A;  4B9S A;  1FFU A;  4BWM A;  4I27 A;  3RTV A;  2CN1 A;  2ZUD A;  1L7P A;  4MEY A;  3ZI4 A;  1QSY A;  4P0Q B;  2BHN A;  1NI3 A;  3GZF A;  3NYB A;  1B43 A;  2KJ9 A;  3SEN A;  1V97 A;  2PFN A;  4KLJ A;  2YMM A;  4B6J A;  1L3U A;  3PW7 A;  2KHQ A;  3JPQ A;  5J2H A;  4PZO A;  4IQW A;  4DOB A;  4RQ0 A;  4QWD A;  2D6F C;  5B3Q A;  2ZH6 A;  5KFZ A;  1R8A A;  5KAI U;  3PX6 A;  5D62 A;  3JPP A;  2FE9 A;  1UQV A;  3NAS A;  1IG6 A;  4US8 A;  3QXG A;  4XRH A;  2ASL A;  1ZQO A;  3PMN A;  2KZZ A;  1SZH A;  2F1I A;  4Z6E A;  2KSO A;  3H8W A;  4X5V A;  2F1H A;  3TAC B;  5J0W A;  4ECW A;  1UT5 A;  3NVV A;  4KN7 A;  2DWQ A;  2RLT A;  4X4T A;  2ZIW B;  5KFS A;  4BXO A;  4EZ6 A;  2DR9 A;  3GIL A;  4TQS A;  2ZUC A;  2D8C A;  3Q8M A;  4K4I A;  2E8M A;  1ZQX A;  2R8H A;  3MGV A;  1ZQC A;  3MFH A;  2KJ8 A;  3PO5 A;  5DB7 A;  3Q8P B;  4R63 A;  3OSN A;  4DQI A;  2KFZ A;  1BPB A;  4PHP A;  1S97 A;  4DSJ A;  2ASJ A;  3PW2 A;  1L5U A;  2HBJ A;  4I2I A;  3RH6 A;  3WK9 A;  2HHQ A;  4KMU A;  4OJP A;  4E8F A;  1SXD A;  1RG6 A;  4UB2 A;  5B5E U;  5KFJ A;  9ICX A;  4WOY A;  4F93 B;  4X4S A;  3FDS A;  2FJ6 A;  2NRW A;  2XVT A;  2GO7 A;  1PK3 A;  4RQ7 A;  3C18 A;  4EV6 A;  4PGX A;  1OXJ A;  4KLM A;  3WFR E;  4A8E A;  2GAF D;  5ALQ A;  2KZ3 A;  4P0P A;  3QUQ A;  1ZJN A;  3M1Y A;  3SMV A;  5KG2 A;  2ZIV A;  2HVI A;  3PX4 A;  3N7R C;  1NJX A;  2F44 A;  4CGZ A;  3OV7 A;  3TAQ A;  3QU4 A;  4JWN A;  2ID1 A;  1TFY A;  4GC7 A;  4EZ9 A;  4DFD A;  3AMZ A;  2HHP A;  3B0Y A;  4NXW A;  3HX0 A;  2E5S A;  4ECZ A;  1FFV A;  4FO6 A;  4IQT A;  2YQE A;  2FMQ A;  3S6J A;  5AI0 A;  4RNM A;  2HDO A;  1BVS A;  4J03 A;  5J2K A;  2IMW P;  4WC2 A;  2VJ5 A;  2HOQ A;  3TAN A;  4QZA A;  3MBY A;  5CWR A;  5HP4 A;  4ZOH C;  2LHT A;  7ICN A;  1X66 A;  4O3S A;  2RHF A;  3EZ5 A;  4DSK A;  5DLF A;  2DFL A;  4Y2X A;  4P0Q A;  3AUO A;  3K75 D;  2DR5 A;  3FM9 A;  2KHV A;  4K96 A;  2HHU A;  5AKL A;  2NRZ A;  1R89 A;  2AGO A;  2LM4 A;  2BZF A;  4I2E A;  4K99 A;  1XSP A;  2I9G A;  5IIO A;  1T7P A;  1FA0 A;  3OUY B;  4C8L A;  3QYP A;  1SV4 A;  4IRK A;  3MAB A;  1IXR A;  2I1Q A;  5KFU A;  1NK7 A;  4Z6D A;  1F5A A;  4DLE A;  4ECS A;  2HW3 A;  2QLT A;  4J9S A;  5III A;  3ZDB A;  4I2A A;  4UB6 U;  2BR0 A;  2BBJ A;  3D6J A;  1KKX A;  5KFM A;  5EWG A;  3AQE A;  3H4D A;  1OU5 A;  2PMZ C;  9ICR A;  5K4L A;  1Q3V A; 
#chains in the Genus database with same CATH homology
 4O5E A;  1UET A;  4PGY A;  2ZJ8 A;  2FLN A;  4JK1 A;  5J0T A;  4EBJ A;  4J9L A;  3V7J A;  7ICI A;  7ICO A;  5D49 A;  2HHW A;  3ISC A;  3OGU A;  4QZE A;  4TUQ A;  4WC0 A;  4TUS A;  4F5R A;  1NK9 A;  4IQV A;  3OHA A;  2P6U A;  3ZDC A;  3TAR A;  3T5K A;  4M9N A;  3QEA Z;  2ISO A;  5KG0 A;  4UB4 A;  1EXN A;  4LT6 A;  1V4A A;  4O3N A;  4QW9 A;  5KG3 A;  3PNC A;  7ICV A;  4KLH A;  3SI8 A;  3T5L A;  4ECU A;  3PY8 A;  5KFO A;  8ICC A;  4RT2 A;  2J6T A;  4PHA A;  4YMN A;  5DBA A;  4Q43 A;  4WCW A;  3RJF A;  1NK4 A;  4F2S A;  4RU9 A;  3MGI A;  4M9J A;  4YG2 A;  4QZH A;  1ZQD A;  3UPS A;  1TVA A;  5CR0 A;  2OWO A;  1JIH A;  4QWB A;  4FS2 A;  3RRG A;  3C21 A;  3BDP A;  3RJI A;  2FMS A;  3RB3 A;  3MFI A;  1WCN A;  4F5O A;  1MIV A;  5J0S A;  4DS5 A;  2KZM A;  5KFA A;  3GDX A;  1KDH A;  2UVV A;  5KFE A;  5KFK A;  4K4G A;  3WFO A;  1T8E A;  1X9M A;  8ICP A;  4R66 A;  3GII A;  1JXE A;  4Q8E A;  3OVA A;  5HML A;  5F9L A;  3MR3 A;  2BQ3 A;  4B9V A;  1UT8 A;  5CJ7 A;  3RB4 A;  8ICW A;  1WOT A;  5KFP A;  5KTQ A;  4UBC A;  3M9M B;  3JYY A;  4KLD A;  3C66 A;  4RQ4 A;  5KFI A;  2XC9 A;  4UD4 A;  4P4O A;  2A1J B;  3TQ1 A;  4FHX A;  4UAY A;  1ZQP A;  5BOL A;  1ZQV A;  2W9B B;  4ECX A;  4Z6F A;  3H8S A;  3H38 A;  1PX5 A;  1ZQG A;  4O0I A;  4RUA A;  3WFP A;  4EYH B;  4Z6C A;  4ED1 A;  5CA7 A;  1KLN A;  2ZTC A;  4M9H A;  3MR5 A;  5HRI A;  1QTM A;  2Y1I A;  1COO A;  4DWI A;  4F4Z A;  2KFN A;  4RT3 A;  2J6U A;  1BGX T;  4F4Y A;  1KTQ A;  4O3O A;  4DO9 A;  5DG8 A;  4QWE A;  4UD5 A;  4RWQ A;  3EPI A;  8ICV A;  4UB3 A;  5F9N A;  4DL2 A;  2PBE A;  4TUP A;  2W9A A;  2XCA A;  1XC9 A;  2FLP A;  4IRD A;  5DBC A;  1SL1 A;  1BNO A;  3HJ4 A;  8ICY A;  4R8U B;  4GXI A;  1N48 A;  3AQM A;  2XGP A;  4O5C A;  5DED A;  1Z00 A;  1TFR A;  1U49 A;  2O5A A;  4F5Q A;  3EYZ A;  4X0B A;  5KFC A;  4B9M A;  3TI0 A;  1NK0 A;  3AU2 A;  1XO1 A;  3GIM A;  1K1S A;  2M9N A;  3TFS A;  4RQ3 A;  4DL7 A;  4C8O A;  1VJ7 A;  4XQ7 A;  4F91 B;  4UBB A;  4UB1 A;  5HRL A;  1JMS A;  3C2K A;  2R8G A;  3L9D A;  4DQP A;  4KN4 A;  5KFB A;  4DSE A;  8ICB A;  2HVH A;  5HRD A;  4PGQ A;  5DB8 A;  9ICW A;  4EYI B;  1SL2 A;  9ICO A;  2C2E A;  5EOZ A;  3C5F A;  4AT9 B;  4ZH4 A;  1NKC A;  4RNO A;  4UB5 A;  5DGA A;  1ZQL A;  3PR5 B;  1S0N A;  3RRH A;  3RR8 A;  5EWF A;  3KHL A;  4NM2 A;  4WC7 A;  4MFF A;  5L1L A;  3T3F A;  2XO7 A;  5D46 A;  2V4R A;  1RXV A;  2J6S A;  1ZJM A;  9ICS A;  4WBZ A;  5HRG A;  4EEY A;  7ICH A;  3HIY A;  1ZQF A;  4B9T A;  4NM1 A;  2HHT A;  4FBU A;  5HRH A;  3OVS A;  3TFR A;  3RJJ A;  4F92 B;  5KFY A;  5KT6 A;  1A77 A;  3M9N B;  4ED3 A;  3T5J A;  4DFP A;  5DGB A;  5KFR A;  2AQ4 A;  3JPS A;  2M2U A;  4C8K A;  1ZQA A;  2PFQ A;  4FHP A;  4KLU A;  3LDA A;  2ZUB A;  1X2I A;  2XY7 A;  2R8K A;  1HUO A;  3H40 A;  4ATB B;  3RJK A;  3HPO A;  1JN3 A;  4IQU A;  2FPK A;  2BCR A;  1MC8 A;  5DLG A;  2IHN A;  4KLQ A;  1RYS A;  5KFG A;  5DDM A;  1UA0 A;  2DRB A;  4ED8 A;  5DG7 A;  1JQR A;  1ZQB A;  5L9X A;  4QZ8 A;  4E0D A;  4AT7 A;  4P4M A;  3GQC A;  4BXO B;  1ZQE A;  4XA5 A;  4BDP A;  4I2H A;  4R64 A;  2IBK A;  1MIW A;  4DS4 A;  1UEU A;  3BJY A;  5KFF A;  5L1J A;  4DOC A;  3H7I A;  3PVX A;  3RB0 A;  4DFJ A;  2XGQ A;  3PW5 A;  2PFO A;  4B9N A;  2W9C B;  4I2D A;  3KTQ A;  1ZQU A;  4YD2 A;  3Q8K A;  4NLG A;  1ZQY A;  4MEX A;  3OUY A;  3UXP A;  3OHB A;  5KFX A;  5KT7 A;  4WC5 A;  3OSP A;  1S9F A;  8ICN A;  4K4H A;  4X4V A;  2UVU A;  3H4B A;  3RBD A;  4EBE A;  4JV0 A;  5HMM A;  4I29 A;  3LK9 A;  9ICP A;  1TV9 A;  2UVW A;  4TQR A;  2C28 A;  1TKD A;  1D8Y A;  2JEF A;  2FLL A;  4Q8F A;  4QZI A;  1MQ3 A;  4KLL A;  3ZDA A;  4F2R A;  2V9W A;  5J0U A;  5KFN A;  4ECY A;  7ICK A;  3UQ2 A;  4X0A A;  1KSP A;  2JZB A;  4CCH A;  4I2B A;  4MFA A;  4F4W A;  3RJG A;  1ZQJ A;  1XS9 D;  2O1P A;  5KT4 A;  4YN4 A;  4GXK A;  3V6K A;  3Q8Q B;  2PXI A;  1SKW A;  1BPZ A;  4Q45 A;  2BCU A;  9ICC A;  5J0O A;  4RPY A;  1XSN A;  2P6R A;  2DR8 A;  3C2M A;  2BDP A;  1ZQW A;  8ICR A;  7ICS A;  2Q66 A;  1NOM A;  3ETL A;  5HRE A;  4MF8 A;  2RFF A;  9ICG A;  5DQG A;  4RNN A;  4ECV A;  2ASD A;  1UEV A;  5HHH A;  4O9M A;  1H38 A;  9ICT A;  5IIL A;  1S0M A;  5KFD A;  4IG8 A;  1ZQT A;  4NY8 A;  4XQ8 A;  3G6X A;  2ZH3 A;  1Q79 A;  3ZD8 A;  4ECT A;  5J0P A;  4PHE A;  1ZQR A;  3RJH A;  2NRX A;  5KFH A;  7ICF A;  9ICE A;  1XWL A;  8ICI A;  2C22 A;  4P4P A;  2BPF A;  7ICQ A;  4F4X A;  4QW8 A;  5IIJ A;  2HHS A;  3Q8L A;  9ICM A;  8ICU A;  4C8N A;  5DQH A;  2P66 A;  3PO4 A;  1NO5 A;  4ELT A;  4M9G A;  2ZTE A;  3MDC A;  3KHH A;  1JX4 A;  1NZP A;  2HHV A;  4YXJ A;  4YR2 A;  2C2R A;  4DOA A;  3Q8S B;  4DQQ A;  2BPG A;  4GXJ A;  8ICA A;  4RQ5 A;  8ICG A;  2H5X A;  2ZJA A;  3TAP A;  3EPG A;  2JEJ A;  4IR1 A;  1Q78 A;  2ZH5 A;  4M2Y A;  3MR6 A;  5J0X A;  3LWL A;  1KFD A;  4IR9 A;  1T4G A;  3PW4 A;  1LB2 B;  4X4O A;  9ICV A;  1U48 A;  5IIM A;  2FMP A;  3ZDD A;  4ED7 A;  4R65 A;  2BE3 A;  3AQL A;  2AQ0 A;  2W8L A;  4ED6 A;  2BQU A;  4YR3 A;  1R8B A;  4KLO A;  4F5P A;  4RUC A;  4DFM A;  2BCQ A;  2GWS A;  9ICQ A;  4EP7 A;  5DB6 A;  1XSL A;  4I2F A;  4FHY A;  3PML A;  2LYH A;  2M2T A;  4DF4 A;  1ZQQ A;  1ZQI A;  5D4B A;  4NLN A;  3UPQ A;  4IRC A;  2ZH2 A;  3QZ8 A;  5L1K A;  2BPC A;  4QZF A;  3G6V A;  4DEZ A;  2ZHA A;  2NRT A;  4YP3 A;  8ICQ A;  3UXN A;  9ICB A;  2A1J A;  4QZ9 A;  5KG7 A;  3JPN A;  3V7L A;  2W9B A;  4C8M A;  4M04 A;  4RWP A;  3EWA A;  1SKS A;  1NJZ A;  3KHG A;  7ICE A;  4S3N A;  3H3A A;  2BGW A;  4BWJ A;  4AT8 B;  4WC4 A;  4E80 A;  9ICH A;  4TUR A;  4I28 A;  2ZH7 A;  2ZTD A;  3BQ0 A;  1TAU A;  7ICT A;  5J2J A;  4M0A A;  5JUM A;  4DFK A;  3N97 B;  4X4R A;  3Q8R B;  4RQ1 A;  1BPE A;  1V9P A;  3GV8 B;  4PPX A;  2RDI A;  2B21 A;  3KHR A;  4WBY A;  1NK5 A;  3V72 A;  1NJW A;  2IA6 A;  8ICT A;  4B9S A;  1D8L A;  4R8U A;  4BWM A;  2RDJ A;  3RJE A;  4I27 A;  1MIY A;  3RTV A;  5J2B A;  2Q0Z X;  3SV3 A;  5KFL A;  7ICL A;  2ZUD A;  1S0O A;  5KG6 A;  4MEY A;  3V6J A;  1ZQN A;  1QSY A;  4ECQ A;  1ZQS A;  4QZB A;  2BHN A;  5DEC A;  3RR7 A;  1B22 A;  3LQC B;  3OVB A;  4LZD A;  3MR2 A;  4I2J A;  4FBT A;  2VA2 A;  3NYB A;  1B43 A;  5KG4 A;  1JXL A;  4DF8 A;  2PFN A;  4J9P A;  2VA3 A;  4F4K A;  1L3U A;  1L3S A;  4KLJ A;  3PW7 A;  3PV8 A;  4RPX A;  3NTU A;  4ELU A;  4DL6 A;  1R8C A;  4AT9 A;  2C2D A;  2MAX A;  2UVR A;  4RQ6 A;  1CUK A;  1KEJ A;  3JPQ A;  5J2H A;  3LWM A;  5L1I A;  1A76 A;  1WCL A;  1NK8 A;  4DOB A;  4IQW A;  4J9O A;  1ARO P;  3H8J A;  4M6W B;  5KG5 A;  5KFW A;  4RQ0 A;  1XU4 A;  4QWD A;  5KFZ A;  4KLT A;  2ZH6 A;  3JPR A;  4O5K A;  1R8A A;  4FHW A;  2ZH1 A;  4BGD A;  2R8I A;  3PX6 A;  8ICE A;  4YQW A;  4UAZ A;  3JPP A;  9ICI A;  9ICU A;  3V6H A;  1RZT A;  4WC3 A;  5J29 A;  4I2G A;  2JEI A;  4JV2 A;  2XCP A;  5DG9 A;  4XRH A;  3RH4 A;  3NGD A;  3C1Y A;  1T3N A;  2BKE A;  8ICK A;  4M5D A;  1DGS A;  5KT3 A;  2ASL A;  2FPM A;  4QZD A;  1ZQO A;  1Y88 A;  3PMN A;  1BPD A;  2VA8 A;  4FS1 A;  8ICF A;  8ICH A;  2MUT B;  3GIJ A;  2F1I A;  2KZZ A;  1ZQM A;  4PH5 A;  4ATB A;  4Z6E A;  3H8W A;  4X5V A;  2F1H A;  2JEG A;  4LVS A;  8ICX A;  3PW0 A;  4E7X A;  4ED0 A;  5J0W A;  3WFQ E;  4ECW A;  1UT5 A;  3WFS C;  3IHQ B;  4KN7 A;  5DBB A;  3M9O B;  3V7K A;  2ZH8 A;  5HC9 A;  4X4T A;  4BXO A;  5KFS A;  4EZ6 A;  8ICJ A;  1U9L A;  4O3R A;  1TK0 A;  4YMM A;  2DR9 A;  3GIL A;  1SZP A;  3RH5 A;  4YVZ A;  4TQS A;  2ZUC A;  5J0Y A;  2W9C A;  5IIN A;  3Q8M A;  1ZYQ A;  5KFV A;  4K4I A;  1ZQX A;  3AQN A;  2DRA A;  3GIK A;  2R8H A;  4QZG A;  2VAN A;  2XY5 A;  4QWA A;  4J9Q A;  1U4B A;  1NJY A;  2ZJ5 A;  1ZQC A;  2PI5 A;  2NRV A;  3MFH A;  4FH3 A;  4DL5 A;  3ZDE A;  2AJQ A;  1X9S A;  9ICK A;  4YFK A;  3JPT A;  9ICL A;  1YLQ A;  3JZ0 A;  3PO5 A;  5DB7 A;  4NLZ A;  3Q8P B;  4R63 A;  3OSN A;  4J9M A;  4NKT A;  4ELV A;  1IM4 A;  5J2F A;  2BCV A;  4DQI A;  4WC6 A;  2KFZ A;  4DL4 A;  2PI4 A;  1BPB A;  1SKR A;  4PHP A;  1S97 A;  4DSJ A;  3IM1 A;  1DK3 A;  3N4M B;  4O3Q A;  3UQ0 A;  3PW2 A;  3K4G A;  4I2I A;  3RH6 A;  2ASJ A;  1UA1 A;  1L5U A;  5J2C A;  2HHQ A;  3RAQ A;  2M2W A;  2DVI A;  4KMU A;  9ICF A;  4E8F A;  3BQ1 A;  2AU0 A;  4UB2 A;  5J2G A;  7ICJ A;  9ICA A;  5KFJ A;  1MSW D;  3C1Z A;  9ICX A;  1ZQH A;  4KLF A;  3C5G A;  2WTF A;  4X4Q A;  3THV A;  1BNP A;  4YXM A;  4F93 B;  2FPL A;  5HR9 A;  4X4S A;  4KLG A;  3FDS A;  4O3P A;  1RPL A;  5HHI A;  5J2E A;  3OJU A;  3G6Y A;  3M8R A;  2DPJ A;  4KTQ A;  5BOM A;  7ICR A;  2NRW A;  1L3V A;  1KFS A;  3EW9 A;  4RQ7 A;  3C18 A;  5KT5 A;  3GV7 B;  3GFK B;  5TZV A;  1Z3E B;  4PGX A;  4X4N A;  3ZD9 A;  4LZG A;  4KLM A;  4X4P A;  3WFR E;  1BPX A;  3GV5 B;  2KP7 A;  3RB6 A;  3B0X A;  3BQT A;  2KZ3 A;  4J9N A;  2W9M A;  4UAW A;  4JWM A;  1DK2 A;  5HRK A;  4YD1 A;  1ZJN A;  5J0Q A;  3JPO A;  4DLG A;  4DL3 A;  1SL0 A;  5HRB A;  1ZQZ A;  5KG2 A;  5CB1 A;  1ZET A;  2DPI A;  1D9D A;  5CHG A;  2HVI A;  4FH5 A;  3PX4 A;  2Y1J A;  3QE9 Y;  1BPY A;  5DDY A;  4GC6 A;  3MDA A;  4ECR A;  4KLS A;  4RPZ A;  4Q44 A;  2AGQ A;  2ZHB A;  1NKE A;  1NJX A;  7ICM A;  2PFP A;  5J2A A;  4NLK A;  1D9F A;  3OV7 A;  1Z00 B;  3TAQ A;  4J9K A;  4JWN A;  9ICN A;  2ID1 A;  1VFG A;  1TFY A;  4HYK A;  5KG1 A;  4GC7 A;  1ZQK A;  3BQ2 A;  4EZ9 A;  2HHP A;  3B0Y A;  5J0R A;  3HX0 A;  1RYR A;  1NK6 A;  4DQR A;  5F2V O;  2V4Q A;  4ECZ A;  4F50 A;  2ATL A;  1S10 A;  4F3O A;  2ISP A;  4NXZ A;  3ISB A;  1QSS A;  4YR0 A;  4FO6 A;  2NRK A;  5KT2 A;  4IQT A;  4B9L A;  4G3I A;  4I2C A;  3PX0 A;  1S77 D;  1QSL A;  2FMQ A;  1CEZ A;  4QZC A;  2W8K A;  1N56 A;  4RNM A;  2KN7 A;  1U47 A;  3OJS A;  1BVS A;  5J2K A;  2IMW P;  1S76 D;  5HNK A;  7ICG A;  2HHX A;  4AT8 A;  4WC2 A;  1X9W A;  4YMO A;  3TAN A;  4RQ2 A;  4QZA A;  4KLI A;  2ZH4 A;  1TFW A;  3MBY A;  5CWR A;  4F5N A;  5HP4 A;  3ORY A;  3RBE A;  1HJP A;  3QZ7 A;  7ICN A;  3SYZ A;  4EBK A;  4O3S A;  5IIK A;  3SZ2 A;  1QLN A;  4NKU A;  4DQS A;  4JUZ A;  3EZ5 A;  1TAQ A;  4PHD A;  5CP2 A;  5KFQ A;  4DSK A;  1K1Q A;  4DSF A;  5DKW A;  4M9L A;  1JAJ A;  4F8R A;  3H39 A;  4FHV A;  5DLF A;  1KRP A;  2DFL A;  2R8J A;  3SV4 A;  3HWT A;  5KFT A;  4M47 A;  3AUO A;  3K75 D;  3AQK A;  2DR5 A;  3PR4 A;  4XUS A;  1PZN A;  1U45 A;  1HUZ A;  4AT7 B;  4DSL A;  4QWC A;  2HHU A;  8ICO A;  8ICS A;  4UQG A;  5EWE A;  1C7Y A;  8ICM A;  2NRZ A;  2KTQ A;  2AGO A;  1R89 A;  1RXW A;  4RQ8 A;  4I2E A;  4RWO A;  1XSP A;  3T5H A;  2I9G A;  1KNY A;  3E2E A;  5J2D A;  7ICP A;  5IIO A;  1NKB A;  1T7P A;  1FA0 A;  3OUY B;  4RZR A;  4EBC A;  2AGP A;  2IHM A;  4C8L A;  4M6W A;  3ISD A;  4J9R A;  1TK8 A;  4KLE A;  4B9U A;  4IRK A;  2BCS A;  3MAB A;  5DQI A;  3MGH A;  1IXR A;  9ICJ A;  1KFT A;  2I1Q A;  5KFU A;  3HP6 A;  1NK7 A;  5C5J A;  2ALZ A;  4Z6D A;  4EBD A;  4MFC A;  3HT3 A;  2XY6 A;  2BQR A;  4P2H A;  2M2V A;  1F5A A;  2ZH9 A;  3QEB Z;  4RWN A;  4DLE A;  4ECS A;  2HW3 A;  3C23 A;  4YCX A;  4J9S A;  5III A;  1MQ2 A;  3ZDB A;  3HJ1 A;  3RAX A;  1TK5 A;  4JV1 A;  4X4U A;  4I2A A;  4KIT B;  2F1J A;  3FYH A;  4DSI A;  3HW8 A;  2BR0 A;  2JZB B;  7ICU A;  2MUT A;  5HRF A;  4WC1 A;  3M8S A;  3UXO A;  1DOQ A;  5KFM A;  5EWG A;  3AU6 A;  8ICZ A;  8ICL A;  3H4D A;  4ED2 A;  2DR7 A;  5DB9 A;  1L3T A;  5J2I A;  4MF2 A;  9ICR A;  1OU5 A;  3C2L A;  3H37 A;  1S0V A;  5BPC A;  1LV5 A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...