4MFFA

Structure of human dna polymerase beta complexed with o6mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 109
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mffA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mffA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mffA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mffA03
3Q8LA 5CR0A 3C2LA 3V6HA 3GIIA 3L9DA 2BPCA 5KG7A 3LK9A 3RR7A 1BPDA 2FPKA 1T8EA 4F5QA 2C2DA 4B9UA 2F1JA 4R65A 1X9WA 4KTQA 3PX0A 4KLDA 2HHVA 3C2MA 2HW3A 3H37A 4FHVA 1NOMA 7ICUA 4ED0A 4NKTA 1JAJA 7ICPA 1NK6A 3Q8KA 4FHXA 5DQHA 3V6KA 1RXVA 4ATBA 3PR4A 3V6JA 3WFSC 3AQKA 1WCLA 3IM1A 4B9SA 4PPXA 5KT2A 1ZQBA 2A1JB 9ICIA 2VA2A 3SZ2A 2P6UA 1ZQJA 5HRGA 3HIYA 1ZQSA 1UEUA 4WCWA 2XY7A 2BCSA 4GXKA 5J2KA 1NO5A 3OGUA 4YQWA 2BCQA 3V72A 1T4GA 4Z6FA 5KFKA 3GQCA 3RJKA 3MGHA 3RJEA 4IQTA 4LT6A 4KLQA 5HRFA 3JPSA 4QZFA 5J0OA 4YVZA 1ZQAA 3UXOA 4E7XA 3RB6A 8ICFA 4P4PA 4DSJA 2AU0A 2ZUBA 2JEGA 2HVHA 5KFFA 7ICRA 2IA6A 3EPIA 4K4GA 5HHIA 1ZQQA 4TQRA 5HRIA 3E2EA 5KFAA 4ELTA 1HUOA 4O3QA 8ICOA 3M9OB 3ORYA 4BGDA 3ISDA 3AQMA 2P6RA 1UT8A 2PXIA 1V4AA 7ICIA 4BXOB 3PMLA 4P4OA 4FHWA 4YXJA 4O3PA 4X5VA 8ICWA 4F5NA 1SZPA 1VJ7A 4F91B 4UB4A 1WCNA 4NKUA 4RUAA 3PW4A 3QEAZ 4UB2A 3UPQA 2ZH3A 1MQ2A 2DPJA 3C18A 1KTQA 4E80A 7ICFA 4DLEA 2JEJA 9ICXA 3OVAA 4F3OA 3BJYA 4B9TA 5HNKA 3G6YA 4DF4A 4RQ0A 4Q8EA 2C2RA 4UBBA 2NRXA 4UAYA 4GXIA 4EZ9A 3OSNA 5IIIA 4UAWA 3PW2A 2FPLA 3MR3A 1TFWA 2PFQA 3OHBA 3BQ1A 3M8SA 2FLPA 3M8RA 5DGBA 1SL0A 3THVA 2PFNA 4I27A 4ED1A 8ICNA 1ZQYA 5L1JA 2DRAA 4I2IA 4YMNA 4M2YA 4EEYA 9ICVA 1N48A 1U45A 2PI5A 4DQIA 4PHEA 4FBUA 4RUCA 4JWMA 7ICGA 2XY5A 2UVUA 3G6XA 2HHQA 5F2VO 4X4SA 3RJGA 1JN3A 4BDPA 5HRLA 2I1QA 2MUTB 4B9MA 5KFMA 1U49A 2J6SA 3BDPA 4J9OA 1DOQA 5IIOA 3UQ0A 5HHHA 4KLTA 4EBKA 2J6UA 8ICHA 4PHDA 1RYSA 4G3IA 4BWMA 9ICKA 1HUZA 2DR8A 4I2CA 4ED2A 4F5PA 1NK7A 1MIYA 4P2HA 1TFRA 4YD1A 1DK2A 5JUMA 2W9BB 1NK9A 4KLHA 4C8KA 1D8YA 1U48A 5J2AA 4DL3A 3H40A 3GFKB 4TURA 3RBEA 2W8LA 5DLGA 2RDJA 4I2BA 1U9LA 9ICLA 5KTQA 3KHHA 7ICQA 2MUTA 1BGXT 1L3SA 5KFPA 4R8UB 4O5EA 5DG9A 4JV1A 4RZRA 2W9CB 4NLGA 4WC1A 4O9MA 3ZDAA 7ICLA 2VA3A 1ZQEA 2ISPA 3JYYA 1SL1A 4WBZA 2XCAA 3N97B 4M9GA 4PHAA 4KITB 5L1KA 4IQWA 4C8NA 2ZJ8A 4I2DA 1Z3EB 5J0UA 1JXEA 3PNCA 4DQSA 4DL4A 2ZTEA 5KFRA 5J0RA 2AGOA 4YMMA 1ZQHA 4Z6EA 5DBAA 3RJFA 3H8JA 1SKWA 4I29A 4KLUA 2VANA 3K75D 3ZDEA 2ASJA 3HX0A 5BOMA 2BKEA 1TFYA 5CJ7A 4YR2A 1ZQFA 2BGWA 5KFSA 4PGQA 2OWOA 3MFIA 2ZH9A 4YP3A 4QWBA 4QWEA 2W9BA 3ZDDA 1NK8A 5HP4A 3Q8MA 4Z6DA 5J2BA 4XA5A 5C5JA 1SKSA 1S76D 1X2IA 4ECTA 1C7YA 4WC3A 4O3SA 5KT7A 2ZJ5A 1RXWA 4B9NA 1S77D 2KFNA 4TUQA 7ICSA 5HREA 1MIWA 1TK5A 4TUSA 1XC9A 4M5DA 4DLGA 1XWLA 4PHPA 3RTVA 3T5JA 1KFTA 2JZBB 1JIHA 2ZUCA 4LZDA 4FBTA 5KFTA 2IBKA 4FHYA 4KLMA 3UPSA 3JPTA 5CP2A 5KFWA 3H4BA 4YFKA 3G6VA 4F5OA 4ECYA 4DL5A 3B0YA 3JPPA 3RRGA 4KLGA 3KHGA 2KN7A 5J0WA 5IILA 1KLNA 2ZH5A 1TK0A 4RWPA 4I2FA 8ICZA 9ICWA 3OSPA 3C1ZA 2Q0ZX 4RQ5A 4DL7A 1JXLA 2HHXA 1OU5A 1ZQUA 4QZEA 3EYZA 3JPNA 2XY6A 3AUOA 4WC4A 1VFGA 4R64A 2V9WA 2W9MA 3EZ5A 1S0MA 4KN4A 1QSSA 4KLJA 4ED8A 1B22A 5KFCA 5KFXA 4F50A 1QSLA 4WC7A 2XC9A 1L3TA 3V7JA 1TAUA 4YCXA 3OUYB 4ECSA 3AQNA 4WBYA 3PX4A 1ZQTA 5DG8A 5D4BA 2M9NA 5DB7A 5J0PA 3GIMA 3T3FA 1KDHA 4M9NA 8ICYA 8ICRA 4UB3A 2F1HA 2KZ3A 2XO7A 1ZQLA 4DL6A 4ECZA 4X4RA 5DLFA 4NY8A 2H5XA 2DVIA 4NLNA 4X4QA 3MABA 4F4XA 5IIMA 4M9LA 2R8KA 3OUYA 5KG6A 1DK3A 3BQ0A 3TFSA 4DQQA 1UA0A 2KZMA 1TVAA 3Q8QB 4DSLA 4KLLA 3MR2A 4JUZA 9ICFA 3RR8A 5HRKA 2ZHBA 4IRCA 4MFFA 2KP7A 2IHNA 3MBYA 3T5HA 4DSEA 5DBCA 8ICXA 1KFSA 2HVIA 4FHPA 2R8IA 4JV2A 4C8MA 3RB0A 4DSIA 3WFPA 2ZH1A 4QWAA 2FMQA 4UD5A 4EBDA 2BPFA 2XCPA 1ZETA 2NRWA 5D49A 2C22A 4Q8FA 3RJJA 2NRTA 3ZDBA 1D9DA 4O3NA 1BPYA 3C66A 8ICLA 4QZGA 1YLQA 1QSYA 4F4WA 3KHLA 5DB8A 1TV9A 5BPCA 2KZZA 1Q78A 1ZQXA 2JZBA 3T5LA 5KFZA 1ZQOA 4RPYA 2R8JA 3WFQE 3UXNA 4QZIA 4ED6A 1D9FA 3H8WA 1HJPA 3ZD8A 4UAZA 2J6TA 4IR1A 9ICTA 1KSPA 2ATLA 4FH3A 1X9MA 4MF8A 2NRZA 8ICEA 1D8LA 4JK1A 2BCRA 5DDYA 4EZ6A 5L1LA 4XUSA 5KG2A 1WOTA 3BQTA 2PBEA 5KFQA 3PR5B 1ZQIA 2KFZA 4LVSA 4NLZA 3N4MB 1ZQRA 1PZNA 8ICSA 4EBEA 5KFVA 5J0TA 4NM1A 2ZH7A 5DECA 4WC5A 4HYKA 2M2VA 2NRVA 2ZTDA 3ISBA 2WTFA 4DFKA 3BQ2A 4J9QA 3TAQA 4F2SA 3EW9A 4RPZA 3JPQA 1COOA 2R8HA 4M9JA 2PI4A 9ICUA 2DR5A 4XRHA 1S0OA 4IQVA 7ICHA 2AQ4A 4RQ1A 9ICEA 3TQ1A 3MR6A 3ZD9A 3OHAA 1NJYA 9ICCA 4UB5A 5J2JA 3FDSA 2KTQA 5J2HA 2BR0A 5IINA 1SKRA 3V7KA 4R63A 1MQ3A 9ICPA 3M9MB 2W9CA 2DR7A 1ZYQA 5KG1A 1AROP 2ID1A 1UEVA 3FYHA 3HJ1A 3RH4A 1JX4A 1KRPA 4B9VA 4X4OA 3RJHA 1ZQPA 4S3NA 5HRBA 3OVSA 3SYZA 4F93B 3PX6A 3SV3A 3IHQB 1LV5A 1ZQNA 1BNOA 2ZH6A 4KN7A 3TAPA 3GIKA 1UA1A 2PFPA 2BE3A 4ECVA 1T3NA 4KLSA 4RWQA 2V4QA 3MDCA 4AT7A 3HW8A 1BPBA 1NKEA 4C8OA 4DEZA 4IR9A 4TUPA 4DFJA 8ICBA 4QZDA 8ICTA 2W9AA 2AJQA 3C5FA 2ZJAA 2JEIA 3RB4A 4F2RA 1NJXA 2UVWA 2FPMA 3RRHA 3TI0A 4M04A 8ICPA 3C2KA 1NJZA 3WFRE 2Q66A 9ICMA 4QWDA 4F8RA 2IMWP 5EWGA 2UVRA 4I28A 4J9LA 3H38A 1NKBA 4Q45A 3RJIA 4KLEA 3MR5A 4YG2A 5J2CA 4DQRA 2BDPA 3TFRA 2JEFA 5HRHA 4J9PA 1ZQZA 4RQ7A 2ISOA 3Q8SB 4TQSA 3ZDCA 2M2UA 3MDAA 7ICEA 1T7PA 4KLFA 2O5AA 3RB3A 5CHGA 3TANA 3LQCB 1NKCA 8ICJA 7ICOA 1UT5A 5KG0A 3RAXA 1NK0A 3M9NB 4FS1A 4F92B 3H7IA 1S97A 1JQRA 3OJUA 4J9SA 3HJ4A 1ZQDA 4DS4A 5EOZA 4EYIB 4O5KA 4R8UA 3EWAA 5EWEA 2P66A 1L3VA 4QWCA 3Q8PB 7ICJA 7ICVA 5J2GA 1V9PA 4ED3A 4I2GA 4XQ7A 3PY8A 2RDIA 4YR0A 5DDMA 1Z00A 4M6WB 5KFBA 4YMOA 1XSLA 1TK8A 4QZHA 9ICAA 1RPLA 4I2JA 1QTMA 1XU4A 5J2EA 1NZPA 4GXJA 2XGQA 1F5AA 4EBJA 5J2DA 4RT3A 4RQ4A 4AT9A 1A77A 4AT8B 3GILA 4ECXA 4R66A 1S0VA 4DOCA 4XQ8A 2FLLA 4RQ2A 4YN4A 4QZ9A 3MFHA 3K4GA 5CB1A 3RH6A 2XGPA 4GC7A 1B43A 3GV8B 4KLOA 4J9KA 1XO1A 4ECRA 2BQRA 3H39A 3OVBA 2BCVA 4KMUA 1ZQCA 4PGXA 3H3AA 8ICGA 1N56A 4MEXA 3QEBZ 4ELVA 1XSNA 2BCUA 2BQ3A 4C8LA 1K1QA 1BPZA 4ECUA 3OJSA 4F4YA 4X0BA 2ZH8A 9ICJA 5F9LA 3JPOA 1L3UA 5J0YA 2M2WA 2ZHAA 4GC6A 1MC8A 3GV5B 4ED7A 2FMPA 5DGAA 5KFIA 1DGSA 1XSPA 1U47A 1R8CA 5HC9A 4ECWA 4MF2A 3C23A 1L5UA 4Q44A 1ZJMA 1KNYA 3C5GA 5DKWA 5HRDA 4AT9B 4QZCA 5KFUA 5J0QA 2BQUA 2HHPA 4RNMA 3PMNA 4O3RA 4WC2A 4DFMA 3AU2A 5TZVA 3LWMA 4B9LA 4X4UA 1TAQA 5KT4A 2A1JA 1Z00B 4RNNA 5KFEA 3UQ2A 2GWSA 4ELUA 1EXNA 2Y1JA 2AGPA 4K4HA 2NRKA 3OV7A 4WC6A 4M47A 1Y88A 5KFOA 3PO5A 8ICCA 2HHSA 4F4KA 4QZ8A 5HMMA 5KG4A 5J0SA 2HHTA 4MEYA 3GIJA 5CA7A 3RAQA 4BXOA 3RBDA 1K1SA 2AQ0A 1BNPA 7ICTA 5L9XA 3KTQA 4X4TA 3AU6A 2ALZA 4O5CA 5DQIA 8ICUA 3HPOA 5DB9A 4UB1A 3HP6A 3H4DA 4GLXA 2DPIA 4E0DA 4CCHA 8ICQA 8ICKA 2C2EA 4IG8A 5KG3A 1ZJNA 2R8GA 5DBBA 1CEZA 2Y1IA 4Z6CA 3LWLA 4F5RA 4QZBA 3B0XA 3MGIA 4I2EA 3ETLA 4O0IA 3Q8RB 4RWOA 2RFFA 2ZH2A 4F4ZA 7ICMA 2HHUA 2DR9A 4X4NA 1LB2B 1IXRA 3T5KA 3C1YA 4P4MA 5DEDA 4RT2A 4DOAA 1XS9D 4E8FA 4FO6A 5KFHA 1JMSA 1UETA 4RNOA 1ZQGA 5KT3A 3GDXA 1BPEA 1NJWA 4RQ6A 3PW7A 4IQUA 1NK5A 3PW0A 5DG7A 9ICOA 4ECQA 1PX5A 3NTUA 4K4IA 1U4BA 5J0XA 9ICRA 3NYBA 3UXPA 1S0NA 3HWTA 1CUKA 4AT8A 1SL2A 2ASDA 5IIJA 4O3OA 4IRKA 5IIKA 2LYHA 2O1PA 4RWNA 1S9FA 4PGYA 3TARA 3AQLA 3WFOA 4BWJA 3HT3A 3RH5A 4QZAA 4M6WA 2DFLA 4ZH4A 9ICHA 2ZTCA 5BOLA 4MFAA 4JWNA 2DRBA 5J2FA 8ICVA 7ICNA 9ICQA 4MFCA 2ASLA 1TKDA 4EP7A 4FS2A 5J29A 3NGDA 4J9RA 1R8BA 2I9GA 4RQ3A 4DSFA 4ATBB 5KT6A 2V4RA 5HR9A 1H38A 4M9HA 5KFGA 5DB6A 4IRDA 4I2HA 1RYRA 1MSWD 4YD2A 3PW5A 8ICAA 4DL2A 4J9NA 4PH5A 9ICBA 1QLNA 2F1IA 2UVVA 3H8SA 4DWIA 9ICNA 2C28A 4I2AA 3V7LA 2W8KA 3LDAA 3PV8A 5F9NA 4FH5A 4DO9A 2AGQA 4DF8A 4M0AA 1ZQWA 2BPGA 1IM4A 2VA8A 4YR3A 4UBCA 5J2IA 4NLKA 4X4VA 1ZQVA 3ISCA 1R89A 4X4PA 4RQ8A 7ICKA 9ICSA 3QZ8A 1R8AA 4KLIA 1NK4A 8ICMA 2IHMA 4WC0A 4QW8A 2B21A 3QE9Y 2ZH4A 5D46A 1A76A 8ICIA 4QW9A 4AT7B 4Q43A 1ZQKA 3EPGA 4DSKA 4DFPA 2FMSA 4DQPA 1MIVA 4YXMA 1S10A 3PO4A 3KHRA 4UD4A 4DOBA 2FLNA 1KFDA 2HHWA 4NXZA 3QZ7A 4LZGA 2MAXA 5HMLA 9ICGA 1FA0A 1BVSA 5DQGA 2PFOA 4NM2A 3JZ0A 5EWFA 1KEJA 4EYHB 4J9MA 5KFLA 5KT5A 1BPXA 5KFYA 5L1IA 1RZTA 1ZQMA 4DS5A 4RPXA 4X0AA 3GV7B 1X9SA 5KFJA 3JPRA 2ZUDA 5CWRA 5KFNA 4RU9A 3C21A 4UQGA 3SV4A 4EBCA 2M2TA 2BHNA 5KG5A 1Q79A 4JV0A 3SI8A 3PVXA 5KFDA
chains in the Genus database with same CATH superfamily
3Q8LA 3V6HA 3GIIA 2WFAA 2YN4A 1BPDA 4R65A 4NLCA 3PX0A 7ICUA 4ED0A 4NKTA 1JAJA 5ALJA 2Y0SF 1NK6A 4CF3A 3PHZA 3WFSC 5KT2A 2BBHA 2A1JB 5AHXA 2RHFA 2VA2A 3SZ2A 9ICIA 3HIYA 2RRDA 1ZQSA 4GXKA 5J2KA 4FZNA 3OGUA 2DWQA 4C7YA 3V72A 3GQCA 3MGHA 2DBYA 1VLBA 1SXEA 4KLQA 5HRFA 3JPSA 4O6AA 5J0OA 3UXOA 3N7PD 5ALXA 2ZUBA 2AU0A 5KFFA 3EPIA 2KK0A 3I28A 5HRIA 2LMRA 3E2EA 3ISDA 1UT8A 5ALKA 2PXIA 2EANA 3HJEA 3AM9A 2PKEA 4O3PA 4IS7A 8ICWA 2ODGA 1WCNA 4QJFB 3PW4A 3QEAZ 4UB2A 3UPQA 1KTQA 1N61A 7ICFA 5JRTA 4Q8EA 3M6ZA 2C2RA 5KAFU 4GXIA 5IIIA 3MR3A 3OHBA 2FLPA 5CFTA 5DGBA 1SL0A 3JCFA 4O69A 2PFNA 4ED1A 5L1JA 3TADA 2GH1A 1VJ5A 2IOFK 1L7PA 1U45A 2PI5A 4FBUA 5F2VO 1QQ7A 4EBKA 4NXUA 4PHDA 4G3IA 9ICKA 2K8CB 5EE1A 3HILA 4EEKA 5JUMA 1NK9A 4C8KA 3GFKB 4C4RA 3D2NA 4TURA 2Q4TA 2W8LA 4U6PA 1ZQEA 3BS5B 3WKAA 1SWVA 1SL1A 3N97B 1V85A 2LPEA 1B4FA 2ZJ8A 4I2DA 4Y2TA 2EZXA 2GO7A 4I29A 2OCEA 5DBAA 2F8LA 3H8JA 4USAA 3O0FA 2VANA 2ASJA 1T3QA 5CJ7A 5KFSA 2W04A 1C7YA 2KJ9A 5KT7A 2ZJ5A 1S77D 2KFNA 7ICSA 1X66A 1TK5A 3C29A 3G6VA 4YFKA 3JPPA 2W7PA 2KN7A 5J0WA 1L7MA 2ZH5A 2R18A 4WQLA 2Q0ZX 5G5HA 3A0BU 4RQ5A 1ZQUA 1VFGA 2W9MA 1NI3A 3SD7A 1S0MA 3I76A 1B22A 5KFXA 1QSLA 4WC7A 2XC9A 1L3TA 1JI7A 1TE2A 3IV6A 1RYUA 4YCXA 3OUYB 2Y9UA 3PX4A 1ZQTA 1KDHA 3T3FA 4ECZA 5DLFA 3AEVA 4F4XA 1X9XA 1TVAA 3Q8QB 2NYVA 2ESEA 3RR8A 5ALEA 5HRKA 4IRCA 2LYAA 1SB3C 4FHPA 4P0PA 3RB0A 4QWAA 4UD5A 1ZETA 3VCBA 1YZ6A 2C22A 4FZLA 2NRTA 3ZDBA 1RQNA 4UAVA 3SEIA 1YLQA 3ED5A 5DB8A 5BPCA 2KZZA 3NRZA 1ZQXA 2JZBA 3UM9A 4ED6A 1KSPA 4FH3A 1D8LA 4XUSA 4EEBA 4P0QB 1ZD2P 4NLZA 1ZQRA 2F2AB 5J0TA 5DECA 3ISBA 2WTFA 3TKAA 3BQ2A 4RPZA 3JPQA 4EENA 3GU3A 2PI4A 2DR5A 4RQMA 7ICHA 2AQ4A 4NXWA 1YZ7A 3DV9A 2K4IA 4EELA 3ZD9A 2W7OA 3FDSA 2KTQA 2BR0A 5IINA 2DR7A 9ICPA 2W9CA 2K8BB 3FYHA 3N7RC 3RH4A 4B9VA 4S3NA 1ZQPA 1SXDA 4K99A 1ZQNA 1LV5A 2ES6A 2HOFA 2YB1A 4MKPA 2IHOA 4AT7A 4C80A 1BPBA 1D8BA 4UB6U 4IR9A 2HDOA 2ZJAA 3RB4A 3RRHA 3TI0A 2Q66A 3C2KA 4F8RA 5AKYA 4NXXA 4I28A 1PK1B 4J9LA 2BDPA 4KX5A 5J2CA 4DQRA 4J9PA 4OO1J 4KLFA 1ECWA 5KG0A 1NK0A 3M9NB 5K4LA 4F92B 3H7IA 3OJUA 4J9SA 1ZQDA 3CNHA 5EWEA 4I2GA 2FJ6A 2RDIA 1Z00A 1T94A 1RQLA 5CHEA 3IG5A 4I2JA 1NZPA 4NLBA 4GXJA 1F5AA 5J2DA 4RT3A 2JHDA 4AT9A 3GILA 4R66A 1S0VA 4RQ2A 4YN4A 3K4GA 4KLOA 3GV8B 2BQRA 3H39A 2BCVA 1ZQCA 4PGXA 3H3AA 4MEXA 2B4VA 1UCVA 4X0BA 2ZH8A 4OAHA 4CDGA 4GC6A 2YMPA 4ED7A 2Y9TA 3QU9A 3QX7A 2FMPA 1IIPA 5HC9A 1L5UA 3MGVA 4Q44A 3C5GA 4QZCA 2B6GA 2HHPA 5AM0A 3AU2A 5TZVA 4FE3A 3OV7A 2Y1JA 2AGPA 5ALDA 4NWIA 4NJ8A 5HMMA 5J0SA 4LJXA 3RAQA 3RBDA 1K1SA 3AN1A 2EAPA 3AU6A 5DQIA 3HPOA 4ZOHC 4UB1A 3H4DA 4GLXA 8ICKA 5D62A 2W11A 1ZJNA 4C4TA 3WKEA 2M0NA 3IDWA 5ALGA 3MGIA 4QZBA 3Q8RB 4DOAA 3ER8C 4FO6A 5KFHA 1WUDA 5KT3A 3H0MB 4ECQA 1U4BA 1HIWA 9ICRA 2I5HA 1S0NA 3HWTA 2N1RA 5ALHA 4PGYA 1ZQ1C 3HT3A 3RH5A 3K1RB 2QLTA 4M6WA 4ZH4A 4K98A 3NKUA 2IUBA 3ER9B 5BOLA 2KV2A 4JWNA 5J2FA 8ICVA 9ICQA 2ASLA 3NGDA 4J9RA 1R8BA 2I9GA 3FC4A 4OJPA 1A0PA 5KFGA 4M9HA 2FDRA 4YD2A 2E8NA 4DL2A 2CXYA 4J9NA 3H8SA 4I2AA 2W8KA 2BPGA 4YR3A 4X4VA 1ZQVA 1DGJA 1R89A 4PL1A 2O6KA 9ICSA 3QZ8A 1R8AA 2JGAA 3RFAA 2B21A 2OM6A 2ZH4A 4QW9A 4AT7B 1ZQKA 4WQKA 4DFPA 4DQPA 1S10A 4MHVA 2EAMA 4ACOA 2YX8A 5L1MA 2MAXA 1N2XA 5ALNA 5ALQA 2NO5A 4CF4A 2G08A 5AKIA 4J9MA 5KFLA 2BDUA 4RPXA 1X9SA 5KFJA 4RU9A 4B6JA 1Q79A 2BHNA 5KG5A 4JV0A 3SI8A 5KFDA 5AM2A 1ZD5A 2OYYA 3L9DA 5AM3A 3EUB2 5GTIU 1KKXA 3RR7A 3NVWA 2FPKA 1T8EA 4KTQA 4C4SA 4KLDA 3H37A 2HW3A 1NOMA 1CI4A 1OUQA 3Q8KA 5DQHA 1L8OA 5TISU 5T14A 4B9SA 4O3MA 1ZQBA 3SENA 2E8MA 2KHQA 2P6UA 1ZQJA 2DKZA 2E8OA 2KEYA 1ZOLA 2MU2A 3RJEA 4AYBC 4JMUA 2W55A 2H3FA 4EGWA 2WB1F 1ZQAA 3RB6A 4P4PA 5D61A 1COKA 3C28A 5HHIA 4TQRA 1WWVA 3QNMA 1Z1BA 4O3QA 1HUOA 8ICOA 3KD3A 3ORYA 4BGDA 2P6RA 2D3DA 7ICIA 4BXOB 4X5VA 1VJ7A 2ZIXA 2F8KA 2FCLA 2FI1A 1MQ2A 2A3VA 2JRZA 2GAFD 2DPJA 4E80A 4DLEA 2JEJA 9ICXA 3BJYA 4Y2XA 4DF4A 3VC8A 4OJ5A 2JMGA 3OSNA 3PW2A 2FPLA 2PMZF 3BQ1A 3SAFA 5AKJA 5B5EU 2DRAA 4YMNA 2YTUA 4EEYA 4JWMA 3RJGA 1B0XA 2I1QA 2MUTB 5B66U 4B9MA 5KFMA 2J6SA 4J9OA 2JH1A 5IIOA 2J6UA 1HUZA 4F5PA 1NK7A 4N7RA 4YD1A 1DK2A 1NZBA 2EH9A 1PUZA 4F72A 4I2BA 9ICLA 1ZXIA 2G5IB 2MUTA 3BZCA 3IP4B 1BGXT 4O5EA 1XO0A 4JV1A 4RZRA 3NRWA 1MA7A 1RDFA 2VA3A 5KNIA 3JYYA 2XCAA 5L1KA 4UASA 4C8NA 3AQFA 1Z3EB 5J0UA 1JXEA 4PL2A 3PNCA 2AGOA 5KFRA 5J0RA 4DQSA 4DL4A 4Z6EA 1SKWA 2YQEA 2HCFA 3SAHA 3HX0A 2WF6A 1TFYA 1ZQFA 3ALRA 1OXJA 2ZH9A 4YP3A 4NL9C 4QWBA 2ZIXB 4QWEA 3OWGA 3ZDDA 5AKEA 2ZIWA 5J2BA 5C5JA 3PZPA 1S76D 1X2IA 1TAMA 2LM4A 1RXWA 4CNQA 1MIWA 3ERCC 4LEYA 2YMLA 1XWLA 1XNSA 3RTVA 3T5JA 4LZDA 3OTQA 4FBTA 2E8PA 4FHYA 3UPSA 3JPTA 3T79A 1JXLA 3H4BA 3RRGA 4KLGA 1SIJA 1V38A 4I2FA 8ICZA 2W3RA 4DL7A 4QZEA 1FO4A 4LEVA 4WC4A 4Y2JA 2QKQA 4U7CA 3EZ5A 1QSSA 5KFCA 1TAUA 3KKAC 4ECSA 3AQNA 4WBYA 5D4BA 4M9NA 3I1YA 1N5WA 2KZ3A 2VJ4A 2B0CA 4QIWF 4DQQA 3SMVA 4OJ6A 5AI9A 4KLLA 1X6JA 4NXVA 2IHNA 4FZMA 3CP8A 1FFVA 1FEZA 8ICXA 2HOQA 3QXGA 2PMZC 4DSIA 2FMQA 2BPFA 3E0FA 2NRWA 4G9BA 5D49A 1CRXA 3N28A 4QZGA 4HX0A 3KZIU 3KHLA 1ED1A 2R8JA 3UXNA 9ICTA 3ZD8A 2VIXA 1Q3UA 2ATLA 1X9MA 4HAIA 2NRZA 2W3SA 2K4PA 2BCRA 2L5YA 2E3TA 5DDYA 4EZ6A 5L1LA 1WOTA 3M1YA 1N63A 3F2DA 3N7SC 3PR5B 3N4MB 2ZH7A 4KX3A 5GTHU 3CYMA 3TAQA 3AQEA 1URJA 4OD0A 5ALMA 2R8HA 2K60A 4XRHA 4IQVA 9ICEA 3TQ1A 4LEZA 5AI8A 5AKHA 9ICCA 4BUGA 1Q46A 3V7KA 1ZYQA 5KG1A 1AROP 2KIVA 3HJ1A 1KRPA 4X4OA 1JRPA 3CRXA 4F93B 3SV3A 1BNOA 2PFPA 3BS7A 4ECVA 1YT3A 3MDCA 1Q3VA 4TUPA 8ICBA 1UQVA 2JR5A 2W9AA 3C5FA 5AK5A 2UVWA 2KD1A 1O03A 5EWGA 3MR5A 5F3XB 1NNLA 2EZZA 3TFRA 1ZQZA 4RQ7A 1VDVA 2M2UA 7ICEA 2O5AA 5AKZA 3BS5A 2WB1C 8ICJA 4FS1A 1S97A 3HJ4A 7ICRA 7ICJA 7ICVA 4QWCA 5J2GA 1V9PA 4ED3A 4CGZA 3WK5A 4M6WB 2XI9A 1F5SA 5KFBA 1XSLA 3IN5A 1RPLA 5J2EA 4ICAA 4PZNA 2G09A 5B3PA 3NVOA 3MFHA 1XO1A 2K89A 4ECRA 2DKXA 1J97A 2VKQA 3QEBZ 4ELVA 2F3NA 2BQ3A 1K1QA 1BPZA 3ONNA 5J0YA 2ZHAA 1MC8A 2YMQA 5DGAA 4ECWA 1KNYA 5DKWA 5KFUA 5J0QA 3WK6A 3WU2U 4WC2A 5ALYA 4O3RA 4B9LA 4X4UA 5KT4A 3UQ2A 1Z00B 5AKXA 2AH5A 4ELUA 4K4HA 1EXNA 2NRKA 1Y88A 2KJ8A 2HHSA 4F4KA 4QZ8A 2KKPA 3B9JA 5CA7A 4BXOA 5L9XA 3HP6A 4IG8A 5AI5A 2R8GA 2Y1IA 1QH9A 1AQ6A 2E5SA 1PK1A 2RFFA 2ZH2A 2DR9A 5JU5A 1PVRA 1LB2B 2XVTA 5DEDA 4RT2A 3PSFA 2KG5A 4RQ6A 1NJWA 4IQUA 5DG7A 4RWNA 3NTUA 4Y2RA 3NYBA 5IIJA 2LYHA 2OHFA 1KQQA 1S9FA 4WOYA 5J8YA 3TARA 1Z4OA 2G06A 3D2SA 5AICA 2DRBA 4EP7A 4IL6U 4FS2A 5J29A 4RQ3A 4DSFA 3LVVA 5KT6A 3BQ7A 1H38A 4I2HA 4CF5A 1PVPA 3PW5A 4PH5A 4DWIA 9ICNA 3LDAA 5F9NA 3F5EA 4DF8A 1F0MA 2VA8A 5FP0A 5J2IA 5ALTA 3S6JA 2KE7A 5AKLA 1Z4NA 1NK4A 4WC0A 1FFUA 4QW8A 5JTIA 8ICIA 4I0UA 4DSKA 1ZD4A 2FMSA 1MIVA 1K5OA 2GOLA 4CE6A 3PO4A 2FLNA 1M6YA 4NXZA 3QZ7A 9ICGA 5DQGA 2PFOA 3QU2A 2G0AA 5EWFA 1GPJA 4EYHB 4OJOA 1BPXA 5KFYA 4X0AA 2HBKA 3JPRA 5CWRA 4JLZA 1JUDA 2KOBA 5CR0A 5AI4A 5KG7A 3LK9A 3WK8A 2A19A 1WYGA 2C2DA 2F1JA 4P0QA 4B9UA 4FHVA 3C2MA 1S8OA 4FHXA 1RXVA 3PR4A 3V6JA 3MCRA 3AQKA 1WCLA 4PPXA 5HRGA 2KJ5A 2XY7A 4YQWA 1T4GA 4IQTA 2MRLA 4QZFA 4YVZA 4E7XA 4P0PB 8ICFA 4DSJA 4GFJA 4DCCA 2HVHA 1L8LA 2OXOA 4Y2SA 1QQ5A 3AQMA 2Z7JA 2G07A 3PMLA 3DEEA 4P4OA 4FHWA 4YXJA 1SZPA 4F91B 1PK3A 4UB4A 4RUAA 2ZH3A 3OVAA 5ALZA 4B9TA 3G6YA 5KL8B 2NRXA 4UAYA 4EZ9A 4UAWA 3K7DA 1TFWA 3PSPA 8ICNA 4I27A 1ZQYA 2AXTU 4WJ3B 3NVZA 4I2IA 3WK4A 1N48A 4PHEA 7ICGA 4RUCA 3G6XA 2W03A 5HRLA 1U49A 3AMZA 1DOQA 3UQ0A 5HHHA 8ICHA 1MIYA 2HSZA 1D8YA 3H40A 2LYBA 5DLGA 5KTQA 1L3SA 3UMGA 4R8UB 5DG9A 4NLGA 4O9MA 3ZDAA 7ICLA 3L5KA 3OPXA 2ISPA 4WBZA 4M9GA 4PHAA 2F44A 4IQWA 1ZQHA 3RJFA 2QB1A 2ZG6A 3K75D 3ZDEA 2BKEA 2BGWA 4PGQA 2W9BA 2RP5A 2G5HB 3Q8MA 1SKSA 3RF9A 2WF8A 4ECTA 4O3SA 4B9NA 4TUSA 4M5DA 4PHPA 2JZBB 1JIHA 4KLMA 5KFWA 4ECYA 4F5OA 3KBBA 3KHGA 1KLNA 2KIWA 1TK0A 4RWPA 9ICWA 2RQ5A 2HHXA 1OU5A 3EYZA 3JPNA 2XY6A 4R64A 4KN4A 4KLJA 4ED8A 5AM1A 2B51A 3H0LB 2ZIUB 3V7JA 5DG8A 3TACB 5DB7A 5J0PA 3GIMA 2OEHA 3SR6A 4UB3A 2F1HA 2XO7A 4DL6A 4NL9A 3M6KA 2H3ZA 4X4QA 3MABA 1PVQA 5IIMA 1UHUA 2R8KA 3OUYA 5KG6A 2KZMA 4DSLA 4JUZA 4O67A 5ALOA 3MBYA 3T5HA 3QUTA 5DBCA 1KFSA 2VJ5A 4RQNA 5CRXA 1L7OA 1Z19A 5AIAA 5AK6A 1WG8A 3BZKA 2XCPA 3QU5A 4Q8FA 3RJJA 1FIQA 1BPYA 3C66A 4FO1A 1RG6A 1QSYA 4F4WA 1LVHA 1Q78A 3T5LA 3WFQE 1D9FA 4QZIA 3H8WA 3E58A 2J6TA 2EQYA 4Y2UA 3WK9A 8ICEA 2KICA 2ZIWB 4JK1A 5KG2A 1GO3F 5KFQA 1L7NA 2KFZA 4LVSA 4EV6A 1PZNA 4WC5A 4HYKA 4DFKA 2ZTDA 8ICLA 4J9QA 3EW9A 4M9JA 1COOA 2E1EA 2DQNB 4RQ1A 1OW5A 3OHAA 5J2HA 1DXSA 4R63A 3WKDA 3M9MB 2ID1A 1UEVA 3RJHA 5HRBA 3SYZA 1P7DA 3TAPA 3GIKA 4K8VA 2WAQF 1T3NA 4KLSA 3QUBA 3HW8A 4OAIZ 4C8OA 1IG6A 2AJQA 2QB0B 4M04A 1NJZA 3F2BA 4QWDA 4PJ0U 2IMWP 2UVRA 4Q45A 3RJIA 4O68A 4YG2A 5AK4A 2JEFA 5HRHA 2JV3A 3NS1A 4NV0A 3MDAA 3A0HU 3RB3A 7ICOA 1UT5A 2LBOA 3QU7A 4DS4A 4O5KA 3ZI4A 3PY8A 5DDMA 4EEDA 4YMOA 2XICA 1QTMA 3WK7A 1ZRNA 3H0RB 1A77A 4AT8B 3AL0B 5AI0A 2XIDA 2FLLA 4QIWC 4QZ9A 5CB1A 3RH6A 2K8AA 4J9KA 1C20A 2D8CA 1X6IA 8ICGA 2BCUA 1A6SA 4C8LA 4ECUA 1L3UA 3JPOA 3UMBA 3GV5B 1DRGA 5KFIA 1Z1VA 1U47A 3C23A 4WH5A 1HEKA 1ZJMA 4AT9B 5HRDA 4RNMA 3IRUA 4A8EA 3PMNA 1TAQA 4M47A 2A1JA 4NXTA 5KFEA 1LKYA 3F5AA 1L6NA 2NO4A 3HRDD 5KG4A 4OAGA 4MEYA 3GIJA 2AQ0A 3KTQA 4O5CA 3D6JA 8ICUA 1ZRMA 2MSNA 8ICQA 2CPRA 5KG3A 1CEZA 5DBBA 4F5RA 3B0XA 4QNLA 3ETLA 1N62A 4F4ZA 2HHUA 1IXRA 3T5KA 3C1YA 4P4MA 1ZQGA 9ICOA 2HN2A 5CFUA 4K4IA 4K96A 5J0XA 3UXPA 3HKZC 1WWUA 1KBUA 4AT8A 4O3OA 5IIKA 3ICXA 3AQLA 4BWJA 1O08A 1KN5A 5ALRA 5AK3A 4US9A 5HR9A 5DB6A 1MSWD 2P35A 1J2NA 8ICAA 3LVWA 2C28A 3V7LA 2QARA 3PV8A 4FH5A 4DO9A 4M0AA 3QUQA 4K97A 2GA9D 5AIBA 1IM4A 4UBCA 3ISCA 4X4PA 7ICKA 2DGZA 8ICMA 2AHOB 2H3VA 1V97A 5D46A 5AI6A 4Q43A 2NV3A 3KHRA 2KMDA 2HBLA 4DOBA 2ZXIA 3EF2A 1BVSA 3NVVA 4NM2A 3F53A 5L1IA 1ZQMA 4K9BA 5KFNA 4EBCA 3SV4A 3C2LA 2QARB 2BPCA 4UATA 5KAIU 4J03A 4F5QA 1X9WA 2HHVA 5AM4A 1MN8A 7ICPA 2K4HA 3V6KA 4ATBA 3IM1A 2LKYA 3J81j 2DR8A 3KFUF 2JXJA 1UEUA 4WCWA 2DL0A 2MA1A 2BCSA 1NO5A 3QUCA 2BCQA 4Z6FA 5KFKA 3RJKA 4LT6A 4UW9A 3CK6A 2JEGA 2IA6A 4K4GA 1ZQQA 5A0LA 5KFAA 4ELTA 3M9OB 1V4AA 4IC9A 3L3FX 4F5NA 5JTGA 4NKUA 3KZXA 4Y2PA 3C18A 2DUYA 3ETRA 4F3OA 2ZIUA 3R9KA 5HNKA 4RQ0A 3MC1A 4UBBA 3IG8A 3CW2C 2PFQA 5ALFA 3M8SA 3M8RA 3GZFA 3THVA 4M2YA 4C7ZA 9ICVA 4DQIA 2XY5A 2UVUA 2HHQA 4X4SA 3WKCA 1JN3A 4BDPA 4CRXA 5ALVA 2EDUA 1X42A 5ALSA 3KKAA 3BDPA 4EX6A 4KB6A 4KLTA 2BZFA 2WHEA 4C0ZA 1RYSA 1SWWA 4BWMA 4I2CA 4ED2A 4P2HA 1TFRA 2W9BB 4KLHA 1U48A 2HMXA 5J2AA 4DL3A 3RBEA 2RDJA 1U9LA 4BX9C 3KHHA 7ICQA 5KFPA 2LM1A 3HKZF 2W9CB 2KSOB 4OAFA 1SGGA 4KITB 1SV0A 2ZTEA 4WC1A 4YMMA 4KLUA 5ALIA 5EE3A 2Y0SC 5BOMA 4YR2A 5ALWA 2OWOA 3MFIA 1NK8A 5HP4A 4Z6DA 4XA5A 4WC3A 1SV0C 4TUQA 5HREA 1XC9A 4DLGA 1KFTA 2ZUCA 5KFTA 2IBKA 2HI0A 5CP2A 4UARA 4DL5A 3B0YA 5IILA 2EAOA 3OSPA 3C1ZA 2LHTA 3AUOA 2V9WA 2OH2A 1Q8KA 4F50A 1JROA 5G5GA 2M9NA 2LI6A 8ICYA 8ICRA 1ZQLA 4X4RA 1SZHA 3M7DA 4NY8A 5B3QA 5D63A 2H5XA 2DVIA 3UMCA 4NLNA 5CEHA 4M9LA 1DK3A 3BQ0A 3TFSA 1UA0A 5E79U 3MR2A 9ICFA 2ZHBA 4MFFA 2KP7A 4DSEA 2HVIA 2CN1A 2R8IA 4JV2A 4C8MA 3WFPA 2ZH1A 4EBDA 2E1FA 4KMOB 4PZOA 1D9DA 4O3NA 1QCKA 5EE9A 2JH7A 1TV9A 4OJLA 1ZQOA 5KFZA 5AKGA 4RPYA 5KL1B 1HJPA 4UAZA 5J8YC 4IR1A 2KKVA 4MF8A 2H3QA 2F76X 3BQTA 2PBEA 1ZQIA 8ICSA 4US8A 3PSIA 2CRXA 4EBEA 5KFVA 4NM1A 2M2VA 2NRVA 3WFRE 4F2SA 2HN1A 4BJQA 2B56A 9ICUA 3TADC 2DF4B 1S0OA 3MR6A 5C0YA 2A1AA 1NJYA 2H3IA 5J2JA 4UB5A 1SKRA 2KSOA 1MQ3A 3QU4A 1X40A 1JX4A 2KNJA 3OVSA 3PX6A 3PSTA 3IHQB 2ZH6A 4KN7A 5EE0A 4F71A 1JALA 1UA1A 2BE3A 5HR7A 4RWQA 2V4QA 4GIBA 3SAGA 1NKEA 4DEZA 3U26A 4DFJA 8ICTA 4QZDA 2I6XA 2JEIA 2RLTA 4F2RA 1NJXA 2FPMA 8ICPA 9ICMA 3FM9A 1N5XA 3H38A 1NKBA 4KLEA 3L4PA 2EZYA 4UAUA 2ISOA 3Q8SB 4TQSA 3ZDCA 1T7PA 5CHGA 3TANA 2F77X 4Y2YA 3LQCB 1NKCA 3FAHA 3RAXA 3DDHA 4AP9A 1JQRA 2YY6A 5EOZA 4EYIB 2HBMA 3EWAA 4R8UA 2P66A 1L3VA 3Q8PB 4XQ7A 4YR0A 1LKYB 5AKKA 1TK8A 4QZHA 9ICAA 1XU4A 2XGQA 5AM5A 4EBJA 2GLEA 4RQ4A 4ECXA 4DOCA 4XQ8A 5HR6A 2WAQC 2XGPA 4GC7A 1B43A 3OVBA 4KMUA 4UB8U 1N56A 1XSNA 3OJSA 4AYBF 4F4YA 9ICJA 5F9LA 2M2WA 3NASA 3F2CA 1DGSA 1XSPA 1R8CA 4MF2A 3WKBA 4FFDA 4K9AA 1ZD3A 2BQUA 2YB4A 4XJEA 4DFMA 3LWMA 2GWSA 4RNNA 4WC6A 5KFOA 3PO5A 8ICCA 1UPHA 2HHTA 1BNPA 7ICTA 4X4TA 5ALPA 2ALZA 5DB9A 2DPIA 4E0DA 4CCHA 2C2EA 2IOFA 4Z6CA 3LWLA 1IV8A 2HBJA 3NUQA 4I2EA 2EWRA 4O0IA 4RWOA 2W54A 7ICMA 4X4NA 1N60A 1KW4A 1XS9D 3NWIA 2QB0A 1JMSA 1UETA 4RNOA 3GDXA 1BPEA 3PW7A 1QQ6A 2ZIVB 1NK5A 3PW0A 2BBJA 1PX5A 4KM5A 2WF7A 1CUKA 1SL2A 2KHVA 2ASDA 2O1PA 4IRKA 4LEWA 3WFOA 4QZAA 2DFLA 9ICHA 3NVYA 2YMMA 2ZTCA 4MFAA 2KVSA 7ICNA 4MFCA 2ZXHA 2WF5A 1TKDA 4ATBB 5ALUA 2V4RA 4IRDA 1RYRA 3KOOA 2W43A 1RM6C 3K1ZA 4JLXA 2HOIA 9ICBA 1QLNA 2F1IA 2UVVA 2IOHA 1KL9A 3H8MA 2AGQA 1ZQWA 5CFSA 4NLKA 2WF9A 4RQ8A 3QYPA 4Y2QA 1SV4A 4KLIA 5ALLA 2IHMA 3QE9Y 2KVCA 1A76A 1J2MA 2FE9A 3EPGA 4YXMA 4DFDA 4UD4A 4JB3A 1KFDA 2HHWA 4LZGA 5HMLA 1FA0A 2K4EA 4Y2VA 2D6FC 3JZ0A 1KEJA 3D2QA 5KT5A 2ZIVA 3SQIA 1RZTA 4DS5A 3GV7B 1F44A 2ZUDA 5H2FU 2M2TA 4UQGA 4E8FA 1S5LU 4OCZA 3PVXA 3LYSA 3C21A 4EX7A
chains in the Genus database with same CATH topology
3Q8LA 5CR0A 3C2LA 3V6HA 3GIIA 3L9DA 2BPCA 5KG7A 3LK9A 3RR7A 1BPDA 2FPKA 1T8EA 4F5QA 2C2DA 4B9UA 2F1JA 4R65A 1X9WA 4KTQA 3PX0A 4KLDA 2HHVA 3C2MA 2HW3A 3H37A 4FHVA 1NOMA 7ICUA 4ED0A 4NKTA 1JAJA 7ICPA 1NK6A 3Q8KA 4FHXA 5DQHA 3V6KA 1RXVA 4ATBA 3PR4A 3V6JA 3WFSC 3AQKA 1WCLA 3IM1A 4B9SA 4PPXA 5KT2A 1ZQBA 2A1JB 9ICIA 2VA2A 3SZ2A 2P6UA 1ZQJA 5HRGA 3HIYA 1ZQSA 1UEUA 4WCWA 2XY7A 2BCSA 4GXKA 5J2KA 1NO5A 3OGUA 4YQWA 2BCQA 3V72A 1T4GA 4Z6FA 5KFKA 3GQCA 3RJKA 3MGHA 3RJEA 4IQTA 4LT6A 4KLQA 5HRFA 3JPSA 4QZFA 5J0OA 4YVZA 1ZQAA 3UXOA 4E7XA 3RB6A 8ICFA 4P4PA 4DSJA 2AU0A 2ZUBA 2JEGA 2HVHA 5KFFA 7ICRA 2IA6A 3EPIA 4K4GA 5HHIA 1ZQQA 4TQRA 5HRIA 3E2EA 5KFAA 4ELTA 1HUOA 4O3QA 8ICOA 3M9OB 3ORYA 4BGDA 3ISDA 3AQMA 2P6RA 1UT8A 2PXIA 1V4AA 7ICIA 4BXOB 3PMLA 4P4OA 4FHWA 4YXJA 4O3PA 4X5VA 8ICWA 4F5NA 1SZPA 1VJ7A 4F91B 4UB4A 1WCNA 4NKUA 4RUAA 3PW4A 3QEAZ 4UB2A 3UPQA 2ZH3A 1MQ2A 2DPJA 3C18A 1KTQA 4E80A 7ICFA 4DLEA 2JEJA 9ICXA 3OVAA 4F3OA 3BJYA 4B9TA 5HNKA 3G6YA 4DF4A 4RQ0A 4Q8EA 2C2RA 4UBBA 2NRXA 4UAYA 4GXIA 4EZ9A 3OSNA 5IIIA 4UAWA 3PW2A 2FPLA 3MR3A 1TFWA 2PFQA 3OHBA 3BQ1A 3M8SA 2FLPA 3M8RA 5DGBA 1SL0A 3THVA 2PFNA 4I27A 4ED1A 8ICNA 1ZQYA 5L1JA 2DRAA 4I2IA 4YMNA 4M2YA 4EEYA 9ICVA 1N48A 1U45A 2PI5A 4DQIA 4PHEA 4FBUA 4RUCA 4JWMA 7ICGA 2XY5A 2UVUA 3G6XA 2HHQA 5F2VO 4X4SA 3RJGA 1JN3A 4BDPA 5HRLA 2I1QA 2MUTB 4B9MA 5KFMA 1U49A 2J6SA 3BDPA 4J9OA 1DOQA 5IIOA 3UQ0A 5HHHA 4KLTA 4EBKA 2J6UA 8ICHA 4PHDA 1RYSA 4G3IA 4BWMA 9ICKA 1HUZA 2DR8A 4I2CA 4ED2A 4F5PA 1NK7A 1MIYA 4P2HA 1TFRA 4YD1A 1DK2A 5JUMA 2W9BB 1NK9A 4KLHA 4C8KA 1D8YA 1U48A 5J2AA 4DL3A 3H40A 3GFKB 4TURA 3RBEA 2W8LA 5DLGA 2RDJA 4I2BA 1U9LA 9ICLA 5KTQA 3KHHA 7ICQA 2MUTA 1BGXT 1L3SA 5KFPA 4R8UB 4O5EA 5DG9A 4JV1A 4RZRA 2W9CB 4NLGA 4WC1A 4O9MA 3ZDAA 7ICLA 2VA3A 1ZQEA 2ISPA 3JYYA 1SL1A 4WBZA 2XCAA 3N97B 4M9GA 4PHAA 4KITB 5L1KA 4IQWA 4C8NA 2ZJ8A 4I2DA 1Z3EB 5J0UA 1JXEA 3PNCA 4DQSA 4DL4A 2ZTEA 5KFRA 5J0RA 2AGOA 4YMMA 1ZQHA 4Z6EA 5DBAA 3RJFA 3H8JA 1SKWA 4I29A 4KLUA 2VANA 3K75D 3ZDEA 2ASJA 3HX0A 5BOMA 2BKEA 1TFYA 5CJ7A 4YR2A 1ZQFA 2BGWA 5KFSA 4PGQA 2OWOA 3MFIA 2ZH9A 4YP3A 4QWBA 4QWEA 2W9BA 3ZDDA 1NK8A 5HP4A 3Q8MA 4Z6DA 5J2BA 4XA5A 5C5JA 1SKSA 1S76D 1X2IA 4ECTA 1C7YA 4WC3A 4O3SA 5KT7A 2ZJ5A 1RXWA 4B9NA 1S77D 2KFNA 4TUQA 7ICSA 5HREA 1MIWA 1TK5A 4TUSA 1XC9A 4M5DA 4DLGA 1XWLA 4PHPA 3RTVA 3T5JA 1KFTA 2JZBB 1JIHA 2ZUCA 4LZDA 4FBTA 5KFTA 2IBKA 4FHYA 4KLMA 3UPSA 3JPTA 5CP2A 5KFWA 3H4BA 4YFKA 3G6VA 4F5OA 4ECYA 4DL5A 3B0YA 3JPPA 3RRGA 4KLGA 3KHGA 2KN7A 5J0WA 5IILA 1KLNA 2ZH5A 1TK0A 4RWPA 4I2FA 8ICZA 9ICWA 3OSPA 3C1ZA 2Q0ZX 4RQ5A 4DL7A 1JXLA 2HHXA 1OU5A 1ZQUA 4QZEA 3EYZA 3JPNA 2XY6A 3AUOA 4WC4A 1VFGA 4R64A 2V9WA 2W9MA 3EZ5A 1S0MA 4KN4A 1QSSA 4KLJA 4ED8A 1B22A 5KFCA 5KFXA 4F50A 1QSLA 4WC7A 2XC9A 1L3TA 3V7JA 1TAUA 4YCXA 3OUYB 4ECSA 3AQNA 4WBYA 3PX4A 1ZQTA 5DG8A 5D4BA 2M9NA 5DB7A 5J0PA 3GIMA 3T3FA 1KDHA 4M9NA 8ICYA 8ICRA 4UB3A 2F1HA 2KZ3A 2XO7A 1ZQLA 4DL6A 4ECZA 4X4RA 5DLFA 4NY8A 2H5XA 2DVIA 4NLNA 4X4QA 3MABA 4F4XA 5IIMA 4M9LA 2R8KA 3OUYA 5KG6A 1DK3A 3BQ0A 3TFSA 4DQQA 1UA0A 2KZMA 1TVAA 3Q8QB 4DSLA 4KLLA 3MR2A 4JUZA 9ICFA 3RR8A 5HRKA 2ZHBA 4IRCA 4MFFA 2KP7A 2IHNA 3MBYA 3T5HA 4DSEA 5DBCA 8ICXA 1KFSA 2HVIA 4FHPA 2R8IA 4JV2A 4C8MA 3RB0A 4DSIA 3WFPA 2ZH1A 4QWAA 2FMQA 4UD5A 4EBDA 2BPFA 2XCPA 1ZETA 2NRWA 5D49A 2C22A 4Q8FA 3RJJA 2NRTA 3ZDBA 1D9DA 4O3NA 1BPYA 3C66A 8ICLA 4QZGA 1YLQA 1QSYA 4F4WA 3KHLA 5DB8A 1TV9A 5BPCA 2KZZA 1Q78A 1ZQXA 2JZBA 3T5LA 5KFZA 1ZQOA 4RPYA 2R8JA 3WFQE 3UXNA 4QZIA 4ED6A 1D9FA 3H8WA 1HJPA 3ZD8A 4UAZA 2J6TA 4IR1A 9ICTA 1KSPA 2ATLA 4FH3A 1X9MA 4MF8A 2NRZA 8ICEA 1D8LA 4JK1A 2BCRA 5DDYA 4EZ6A 5L1LA 4XUSA 5KG2A 1WOTA 3BQTA 2PBEA 5KFQA 3PR5B 1ZQIA 2KFZA 4LVSA 4NLZA 3N4MB 1ZQRA 1PZNA 8ICSA 4EBEA 5KFVA 5J0TA 4NM1A 2ZH7A 5DECA 4WC5A 4HYKA 2M2VA 2NRVA 2ZTDA 3ISBA 2WTFA 4DFKA 3BQ2A 4J9QA 3TAQA 4F2SA 3EW9A 4RPZA 3JPQA 1COOA 2R8HA 4M9JA 2PI4A 9ICUA 2DR5A 4XRHA 1S0OA 4IQVA 7ICHA 2AQ4A 4RQ1A 9ICEA 3TQ1A 3MR6A 3ZD9A 3OHAA 1NJYA 9ICCA 4UB5A 5J2JA 3FDSA 2KTQA 5J2HA 2BR0A 5IINA 1SKRA 3V7KA 4R63A 1MQ3A 9ICPA 3M9MB 2W9CA 2DR7A 1ZYQA 5KG1A 1AROP 2ID1A 1UEVA 3FYHA 3HJ1A 3RH4A 1JX4A 1KRPA 4B9VA 4X4OA 3RJHA 1ZQPA 4S3NA 5HRBA 3OVSA 3SYZA 4F93B 3PX6A 3SV3A 3IHQB 1LV5A 1ZQNA 1BNOA 2ZH6A 4KN7A 3TAPA 3GIKA 1UA1A 2PFPA 2BE3A 4ECVA 1T3NA 4KLSA 4RWQA 2V4QA 3MDCA 4AT7A 3HW8A 1BPBA 1NKEA 4C8OA 4DEZA 4IR9A 4TUPA 4DFJA 8ICBA 4QZDA 8ICTA 2W9AA 2AJQA 3C5FA 2ZJAA 2JEIA 3RB4A 4F2RA 1NJXA 2UVWA 2FPMA 3RRHA 3TI0A 4M04A 8ICPA 3C2KA 1NJZA 3WFRE 2Q66A 9ICMA 4QWDA 4F8RA 2IMWP 5EWGA 2UVRA 4I28A 4J9LA 3H38A 1NKBA 4Q45A 3RJIA 4KLEA 3MR5A 4YG2A 5J2CA 4DQRA 2BDPA 3TFRA 2JEFA 5HRHA 4J9PA 1ZQZA 4RQ7A 2ISOA 3Q8SB 4TQSA 3ZDCA 2M2UA 3MDAA 7ICEA 1T7PA 4KLFA 2O5AA 3RB3A 5CHGA 3TANA 3LQCB 1NKCA 8ICJA 7ICOA 1UT5A 5KG0A 3RAXA 1NK0A 3M9NB 4FS1A 4F92B 3H7IA 1S97A 1JQRA 3OJUA 4J9SA 3HJ4A 1ZQDA 4DS4A 5EOZA 4EYIB 4O5KA 4R8UA 3EWAA 5EWEA 2P66A 1L3VA 4QWCA 3Q8PB 7ICJA 7ICVA 5J2GA 1V9PA 4ED3A 4I2GA 4XQ7A 3PY8A 2RDIA 4YR0A 5DDMA 1Z00A 4M6WB 5KFBA 4YMOA 1XSLA 1TK8A 4QZHA 9ICAA 1RPLA 4I2JA 1QTMA 1XU4A 5J2EA 1NZPA 4GXJA 2XGQA 1F5AA 4EBJA 5J2DA 4RT3A 4RQ4A 4AT9A 1A77A 4AT8B 3GILA 4ECXA 4R66A 1S0VA 4DOCA 4XQ8A 2FLLA 4RQ2A 4YN4A 4QZ9A 3MFHA 3K4GA 5CB1A 3RH6A 2XGPA 4GC7A 1B43A 3GV8B 4KLOA 4J9KA 1XO1A 4ECRA 2BQRA 3H39A 3OVBA 2BCVA 4KMUA 1ZQCA 4PGXA 3H3AA 8ICGA 1N56A 4MEXA 3QEBZ 4ELVA 1XSNA 2BCUA 2BQ3A 4C8LA 1K1QA 1BPZA 4ECUA 3OJSA 4F4YA 4X0BA 2ZH8A 9ICJA 5F9LA 3JPOA 1L3UA 5J0YA 2M2WA 2ZHAA 4GC6A 1MC8A 3GV5B 4ED7A 2FMPA 5DGAA 5KFIA 1DGSA 1XSPA 1U47A 1R8CA 5HC9A 4ECWA 4MF2A 3C23A 1L5UA 4Q44A 1ZJMA 1KNYA 3C5GA 5DKWA 5HRDA 4AT9B 4QZCA 5KFUA 5J0QA 2BQUA 2HHPA 4RNMA 3PMNA 4O3RA 4WC2A 4DFMA 3AU2A 5TZVA 3LWMA 4B9LA 4X4UA 1TAQA 5KT4A 2A1JA 1Z00B 4RNNA 5KFEA 3UQ2A 2GWSA 4ELUA 1EXNA 2Y1JA 2AGPA 4K4HA 2NRKA 3OV7A 4WC6A 4M47A 1Y88A 5KFOA 3PO5A 8ICCA 2HHSA 4F4KA 4QZ8A 5HMMA 5KG4A 5J0SA 2HHTA 4MEYA 3GIJA 5CA7A 3RAQA 4BXOA 3RBDA 1K1SA 2AQ0A 1BNPA 7ICTA 5L9XA 3KTQA 4X4TA 3AU6A 2ALZA 4O5CA 5DQIA 8ICUA 3HPOA 5DB9A 4UB1A 3HP6A 3H4DA 4GLXA 2DPIA 4E0DA 4CCHA 8ICQA 8ICKA 2C2EA 4IG8A 5KG3A 1ZJNA 2R8GA 5DBBA 1CEZA 2Y1IA 4Z6CA 3LWLA 4F5RA 4QZBA 3B0XA 3MGIA 4I2EA 3ETLA 4O0IA 3Q8RB 4RWOA 2RFFA 2ZH2A 4F4ZA 7ICMA 2HHUA 2DR9A 4X4NA 1LB2B 1IXRA 3T5KA 3C1YA 4P4MA 5DEDA 4RT2A 4DOAA 1XS9D 4E8FA 4FO6A 5KFHA 1JMSA 1UETA 4RNOA 1ZQGA 5KT3A 3GDXA 1BPEA 1NJWA 4RQ6A 3PW7A 4IQUA 1NK5A 3PW0A 5DG7A 9ICOA 4ECQA 1PX5A 3NTUA 4K4IA 1U4BA 5J0XA 9ICRA 3NYBA 3UXPA 1S0NA 3HWTA 1CUKA 4AT8A 1SL2A 2ASDA 5IIJA 4O3OA 4IRKA 5IIKA 2LYHA 2O1PA 4RWNA 1S9FA 4PGYA 3TARA 3AQLA 3WFOA 4BWJA 3HT3A 3RH5A 4QZAA 4M6WA 2DFLA 4ZH4A 9ICHA 2ZTCA 5BOLA 4MFAA 4JWNA 2DRBA 5J2FA 8ICVA 7ICNA 9ICQA 4MFCA 2ASLA 1TKDA 4EP7A 4FS2A 5J29A 3NGDA 4J9RA 1R8BA 2I9GA 4RQ3A 4DSFA 4ATBB 5KT6A 2V4RA 5HR9A 1H38A 4M9HA 5KFGA 5DB6A 4IRDA 4I2HA 1RYRA 1MSWD 4YD2A 3PW5A 8ICAA 4DL2A 4J9NA 4PH5A 9ICBA 1QLNA 2F1IA 2UVVA 3H8SA 4DWIA 9ICNA 2C28A 4I2AA 3V7LA 2W8KA 3LDAA 3PV8A 5F9NA 4FH5A 4DO9A 2AGQA 4DF8A 4M0AA 1ZQWA 2BPGA 1IM4A 2VA8A 4YR3A 4UBCA 5J2IA 4NLKA 4X4VA 1ZQVA 3ISCA 1R89A 4X4PA 4RQ8A 7ICKA 9ICSA 3QZ8A 1R8AA 4KLIA 1NK4A 8ICMA 2IHMA 4WC0A 4QW8A 2B21A 3QE9Y 2ZH4A 5D46A 1A76A 8ICIA 4QW9A 4AT7B 4Q43A 1ZQKA 3EPGA 4DSKA 4DFPA 2FMSA 4DQPA 1MIVA 4YXMA 1S10A 3PO4A 3KHRA 4UD4A 4DOBA 2FLNA 1KFDA 2HHWA 4NXZA 3QZ7A 4LZGA 2MAXA 5HMLA 9ICGA 1FA0A 1BVSA 5DQGA 2PFOA 4NM2A 3JZ0A 5EWFA 1KEJA 4EYHB 4J9MA 5KFLA 5KT5A 1BPXA 5KFYA 5L1IA 1RZTA 1ZQMA 4DS5A 4RPXA 4X0AA 3GV7B 1X9SA 5KFJA 3JPRA 2ZUDA 5CWRA 5KFNA 4RU9A 3C21A 4UQGA 3SV4A 4EBCA 2M2TA 2BHNA 5KG5A 1Q79A 4JV0A 3SI8A 3PVXA 5KFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8L A;  5CR0 A;  3C2L A;  3V6H A;  3GII A;  3L9D A;  2BPC A;  5KG7 A;  3LK9 A;  3RR7 A;  1BPD A;  2FPK A;  1T8E A;  4F5Q A;  2C2D A;  4B9U A;  2F1J A;  4R65 A;  1X9W A;  4KTQ A;  3PX0 A;  4KLD A;  2HHV A;  3C2M A;  2HW3 A;  3H37 A;  4FHV A;  1NOM A;  7ICU A;  4ED0 A;  4NKT A;  1JAJ A;  7ICP A;  1NK6 A;  3Q8K A;  4FHX A;  5DQH A;  3V6K A;  1RXV A;  4ATB A;  3PR4 A;  3V6J A;  3WFS C;  3AQK A;  1WCL A;  3IM1 A;  4B9S A;  4PPX A;  5KT2 A;  1ZQB A;  2A1J B;  9ICI A;  2VA2 A;  3SZ2 A;  2P6U A;  1ZQJ A;  5HRG A;  3HIY A;  1ZQS A;  1UEU A;  4WCW A;  2XY7 A;  2BCS A;  4GXK A;  5J2K A;  1NO5 A;  3OGU A;  4YQW A;  2BCQ A;  3V72 A;  1T4G A;  4Z6F A;  5KFK A;  3GQC A;  3RJK A;  3MGH A;  3RJE A;  4IQT A;  4LT6 A;  4KLQ A;  5HRF A;  3JPS A;  4QZF A;  5J0O A;  4YVZ A;  1ZQA A;  3UXO A;  4E7X A;  3RB6 A;  8ICF A;  4P4P A;  4DSJ A;  2AU0 A;  2ZUB A;  2JEG A;  2HVH A;  5KFF A;  7ICR A;  2IA6 A;  3EPI A;  4K4G A;  5HHI A;  1ZQQ A;  4TQR A;  5HRI A;  3E2E A;  5KFA A;  4ELT A;  1HUO A;  4O3Q A;  8ICO A;  3M9O B;  3ORY A;  4BGD A;  3ISD A;  3AQM A;  2P6R A;  1UT8 A;  2PXI A;  1V4A A;  7ICI A;  4BXO B;  3PML A;  4P4O A;  4FHW A;  4YXJ A;  4O3P A;  4X5V A;  8ICW A;  4F5N A;  1SZP A;  1VJ7 A;  4F91 B;  4UB4 A;  1WCN A;  4NKU A;  4RUA A;  3PW4 A;  3QEA Z;  4UB2 A;  3UPQ A;  2ZH3 A;  1MQ2 A;  2DPJ A;  3C18 A;  1KTQ A;  4E80 A;  7ICF A;  4DLE A;  2JEJ A;  9ICX A;  3OVA A;  4F3O A;  3BJY A;  4B9T A;  5HNK A;  3G6Y A;  4DF4 A;  4RQ0 A;  4Q8E A;  2C2R A;  4UBB A;  2NRX A;  4UAY A;  4GXI A;  4EZ9 A;  3OSN A;  5III A;  4UAW A;  3PW2 A;  2FPL A;  3MR3 A;  1TFW A;  2PFQ A;  3OHB A;  3BQ1 A;  3M8S A;  2FLP A;  3M8R A;  5DGB A;  1SL0 A;  3THV A;  2PFN A;  4I27 A;  4ED1 A;  8ICN A;  1ZQY A;  5L1J A;  2DRA A;  4I2I A;  4YMN A;  4M2Y A;  4EEY A;  9ICV A;  1N48 A;  1U45 A;  2PI5 A;  4DQI A;  4PHE A;  4FBU A;  4RUC A;  4JWM A;  7ICG A;  2XY5 A;  2UVU A;  3G6X A;  2HHQ A;  5F2V O;  4X4S A;  3RJG A;  1JN3 A;  4BDP A;  5HRL A;  2I1Q A;  2MUT B;  4B9M A;  5KFM A;  1U49 A;  2J6S A;  3BDP A;  4J9O A;  1DOQ A;  5IIO A;  3UQ0 A;  5HHH A;  4KLT A;  4EBK A;  2J6U A;  8ICH A;  4PHD A;  1RYS A;  4G3I A;  4BWM A;  9ICK A;  1HUZ A;  2DR8 A;  4I2C A;  4ED2 A;  4F5P A;  1NK7 A;  1MIY A;  4P2H A;  1TFR A;  4YD1 A;  1DK2 A;  5JUM A;  2W9B B;  1NK9 A;  4KLH A;  4C8K A;  1D8Y A;  1U48 A;  5J2A A;  4DL3 A;  3H40 A;  3GFK B;  4TUR A;  3RBE A;  2W8L A;  5DLG A;  2RDJ A;  4I2B A;  1U9L A;  9ICL A;  5KTQ A;  3KHH A;  7ICQ A;  2MUT A;  1BGX T;  1L3S A;  5KFP A;  4R8U B;  4O5E A;  5DG9 A;  4JV1 A;  4RZR A;  2W9C B;  4NLG A;  4WC1 A;  4O9M A;  3ZDA A;  7ICL A;  2VA3 A;  1ZQE A;  2ISP A;  3JYY A;  1SL1 A;  4WBZ A;  2XCA A;  3N97 B;  4M9G A;  4PHA A;  4KIT B;  5L1K A;  4IQW A;  4C8N A;  2ZJ8 A;  4I2D A;  1Z3E B;  5J0U A;  1JXE A;  3PNC A;  4DQS A;  4DL4 A;  2ZTE A;  5KFR A;  5J0R A;  2AGO A;  4YMM A;  1ZQH A;  4Z6E A;  5DBA A;  3RJF A;  3H8J A;  1SKW A;  4I29 A;  4KLU A;  2VAN A;  3K75 D;  3ZDE A;  2ASJ A;  3HX0 A;  5BOM A;  2BKE A;  1TFY A;  5CJ7 A;  4YR2 A;  1ZQF A;  2BGW A;  5KFS A;  4PGQ A;  2OWO A;  3MFI A;  2ZH9 A;  4YP3 A;  4QWB A;  4QWE A;  2W9B A;  3ZDD A;  1NK8 A;  5HP4 A;  3Q8M A;  4Z6D A;  5J2B A;  4XA5 A;  5C5J A;  1SKS A;  1S76 D;  1X2I A;  4ECT A;  1C7Y A;  4WC3 A;  4O3S A;  5KT7 A;  2ZJ5 A;  1RXW A;  4B9N A;  1S77 D;  2KFN A;  4TUQ A;  7ICS A;  5HRE A;  1MIW A;  1TK5 A;  4TUS A;  1XC9 A;  4M5D A;  4DLG A;  1XWL A;  4PHP A;  3RTV A;  3T5J A;  1KFT A;  2JZB B;  1JIH A;  2ZUC A;  4LZD A;  4FBT A;  5KFT A;  2IBK A;  4FHY A;  4KLM A;  3UPS A;  3JPT A;  5CP2 A;  5KFW A;  3H4B A;  4YFK A;  3G6V A;  4F5O A;  4ECY A;  4DL5 A;  3B0Y A;  3JPP A;  3RRG A;  4KLG A;  3KHG A;  2KN7 A;  5J0W A;  5IIL A;  1KLN A;  2ZH5 A;  1TK0 A;  4RWP A;  4I2F A;  8ICZ A;  9ICW A;  3OSP A;  3C1Z A;  2Q0Z X;  4RQ5 A;  4DL7 A;  1JXL A;  2HHX A;  1OU5 A;  1ZQU A;  4QZE A;  3EYZ A;  3JPN A;  2XY6 A;  3AUO A;  4WC4 A;  1VFG A;  4R64 A;  2V9W A;  2W9M A;  3EZ5 A;  1S0M A;  4KN4 A;  1QSS A;  4KLJ A;  4ED8 A;  1B22 A;  5KFC A;  5KFX A;  4F50 A;  1QSL A;  4WC7 A;  2XC9 A;  1L3T A;  3V7J A;  1TAU A;  4YCX A;  3OUY B;  4ECS A;  3AQN A;  4WBY A;  3PX4 A;  1ZQT A;  5DG8 A;  5D4B A;  2M9N A;  5DB7 A;  5J0P A;  3GIM A;  3T3F A;  1KDH A;  4M9N A;  8ICY A;  8ICR A;  4UB3 A;  2F1H A;  2KZ3 A;  2XO7 A;  1ZQL A;  4DL6 A;  4ECZ A;  4X4R A;  5DLF A;  4NY8 A;  2H5X A;  2DVI A;  4NLN A;  4X4Q A;  3MAB A;  4F4X A;  5IIM A;  4M9L A;  2R8K A;  3OUY A;  5KG6 A;  1DK3 A;  3BQ0 A;  3TFS A;  4DQQ A;  1UA0 A;  2KZM A;  1TVA A;  3Q8Q B;  4DSL A;  4KLL A;  3MR2 A;  4JUZ A;  9ICF A;  3RR8 A;  5HRK A;  2ZHB A;  4IRC A;  4MFF A;  2KP7 A;  2IHN A;  3MBY A;  3T5H A;  4DSE A;  5DBC A;  8ICX A;  1KFS A;  2HVI A;  4FHP A;  2R8I A;  4JV2 A;  4C8M A;  3RB0 A;  4DSI A;  3WFP A;  2ZH1 A;  4QWA A;  2FMQ A;  4UD5 A;  4EBD A;  2BPF A;  2XCP A;  1ZET A;  2NRW A;  5D49 A;  2C22 A;  4Q8F A;  3RJJ A;  2NRT A;  3ZDB A;  1D9D A;  4O3N A;  1BPY A;  3C66 A;  8ICL A;  4QZG A;  1YLQ A;  1QSY A;  4F4W A;  3KHL A;  5DB8 A;  1TV9 A;  5BPC A;  2KZZ A;  1Q78 A;  1ZQX A;  2JZB A;  3T5L A;  5KFZ A;  1ZQO A;  4RPY A;  2R8J A;  3WFQ E;  3UXN A;  4QZI A;  4ED6 A;  1D9F A;  3H8W A;  1HJP A;  3ZD8 A;  4UAZ A;  2J6T A;  4IR1 A;  9ICT A;  1KSP A;  2ATL A;  4FH3 A;  1X9M A;  4MF8 A;  2NRZ A;  8ICE A;  1D8L A;  4JK1 A;  2BCR A;  5DDY A;  4EZ6 A;  5L1L A;  4XUS A;  5KG2 A;  1WOT A;  3BQT A;  2PBE A;  5KFQ A;  3PR5 B;  1ZQI A;  2KFZ A;  4LVS A;  4NLZ A;  3N4M B;  1ZQR A;  1PZN A;  8ICS A;  4EBE A;  5KFV A;  5J0T A;  4NM1 A;  2ZH7 A;  5DEC A;  4WC5 A;  4HYK A;  2M2V A;  2NRV A;  2ZTD A;  3ISB A;  2WTF A;  4DFK A;  3BQ2 A;  4J9Q A;  3TAQ A;  4F2S A;  3EW9 A;  4RPZ A;  3JPQ A;  1COO A;  2R8H A;  4M9J A;  2PI4 A;  9ICU A;  2DR5 A;  4XRH A;  1S0O A;  4IQV A;  7ICH A;  2AQ4 A;  4RQ1 A;  9ICE A;  3TQ1 A;  3MR6 A;  3ZD9 A;  3OHA A;  1NJY A;  9ICC A;  4UB5 A;  5J2J A;  3FDS A;  2KTQ A;  5J2H A;  2BR0 A;  5IIN A;  1SKR A;  3V7K A;  4R63 A;  1MQ3 A;  9ICP A;  3M9M B;  2W9C A;  2DR7 A;  1ZYQ A;  5KG1 A;  1ARO P;  2ID1 A;  1UEV A;  3FYH A;  3HJ1 A;  3RH4 A;  1JX4 A;  1KRP A;  4B9V A;  4X4O A;  3RJH A;  1ZQP A;  4S3N A;  5HRB A;  3OVS A;  3SYZ A;  4F93 B;  3PX6 A;  3SV3 A;  3IHQ B;  1LV5 A;  1ZQN A;  1BNO A;  2ZH6 A;  4KN7 A;  3TAP A;  3GIK A;  1UA1 A;  2PFP A;  2BE3 A;  4ECV A;  1T3N A;  4KLS A;  4RWQ A;  2V4Q A;  3MDC A;  4AT7 A;  3HW8 A;  1BPB A;  1NKE A;  4C8O A;  4DEZ A;  4IR9 A;  4TUP A;  4DFJ A;  8ICB A;  4QZD A;  8ICT A;  2W9A A;  2AJQ A;  3C5F A;  2ZJA A;  2JEI A;  3RB4 A;  4F2R A;  1NJX A;  2UVW A;  2FPM A;  3RRH A;  3TI0 A;  4M04 A;  8ICP A;  3C2K A;  1NJZ A;  3WFR E;  2Q66 A;  9ICM A;  4QWD A;  4F8R A;  2IMW P;  5EWG A;  2UVR A;  4I28 A;  4J9L A;  3H38 A;  1NKB A;  4Q45 A;  3RJI A;  4KLE A;  3MR5 A;  4YG2 A;  5J2C A;  4DQR A;  2BDP A;  3TFR A;  2JEF A;  5HRH A;  4J9P A;  1ZQZ A;  4RQ7 A;  2ISO A;  3Q8S B;  4TQS A;  3ZDC A;  2M2U A;  3MDA A;  7ICE A;  1T7P A;  4KLF A;  2O5A A;  3RB3 A;  5CHG A;  3TAN A;  3LQC B;  1NKC A;  8ICJ A;  7ICO A;  1UT5 A;  5KG0 A;  3RAX A;  1NK0 A;  3M9N B;  4FS1 A;  4F92 B;  3H7I A;  1S97 A;  1JQR A;  3OJU A;  4J9S A;  3HJ4 A;  1ZQD A;  4DS4 A;  5EOZ A;  4EYI B;  4O5K A;  4R8U A;  3EWA A;  5EWE A;  2P66 A;  1L3V A;  4QWC A;  3Q8P B;  7ICJ A;  7ICV A;  5J2G A;  1V9P A;  4ED3 A;  4I2G A;  4XQ7 A;  3PY8 A;  2RDI A;  4YR0 A;  5DDM A;  1Z00 A;  4M6W B;  5KFB A;  4YMO A;  1XSL A;  1TK8 A;  4QZH A;  9ICA A;  1RPL A;  4I2J A;  1QTM A;  1XU4 A;  5J2E A;  1NZP A;  4GXJ A;  2XGQ A;  1F5A A;  4EBJ A;  5J2D A;  4RT3 A;  4RQ4 A;  4AT9 A;  1A77 A;  4AT8 B;  3GIL A;  4ECX A;  4R66 A;  1S0V A;  4DOC A;  4XQ8 A;  2FLL A;  4RQ2 A;  4YN4 A;  4QZ9 A;  3MFH A;  3K4G A;  5CB1 A;  3RH6 A;  2XGP A;  4GC7 A;  1B43 A;  3GV8 B;  4KLO A;  4J9K A;  1XO1 A;  4ECR A;  2BQR A;  3H39 A;  3OVB A;  2BCV A;  4KMU A;  1ZQC A;  4PGX A;  3H3A A;  8ICG A;  1N56 A;  4MEX A;  3QEB Z;  4ELV A;  1XSN A;  2BCU A;  2BQ3 A;  4C8L A;  1K1Q A;  1BPZ A;  4ECU A;  3OJS A;  4F4Y A;  4X0B A;  2ZH8 A;  9ICJ A;  5F9L A;  3JPO A;  1L3U A;  5J0Y A;  2M2W A;  2ZHA A;  4GC6 A;  1MC8 A;  3GV5 B;  4ED7 A;  2FMP A;  5DGA A;  5KFI A;  1DGS A;  1XSP A;  1U47 A;  1R8C A;  5HC9 A;  4ECW A;  4MF2 A;  3C23 A;  1L5U A;  4Q44 A;  1ZJM A;  1KNY A;  3C5G A;  5DKW A;  5HRD A;  4AT9 B;  4QZC A;  5KFU A;  5J0Q A;  2BQU A;  2HHP A;  4RNM A;  3PMN A;  4O3R A;  4WC2 A;  4DFM A;  3AU2 A;  5TZV A;  3LWM A;  4B9L A;  4X4U A;  1TAQ A;  5KT4 A;  2A1J A;  1Z00 B;  4RNN A;  5KFE A;  3UQ2 A;  2GWS A;  4ELU A;  1EXN A;  2Y1J A;  2AGP A;  4K4H A;  2NRK A;  3OV7 A;  4WC6 A;  4M47 A;  1Y88 A;  5KFO A;  3PO5 A;  8ICC A;  2HHS A;  4F4K A;  4QZ8 A;  5HMM A;  5KG4 A;  5J0S A;  2HHT A;  4MEY A;  3GIJ A;  5CA7 A;  3RAQ A;  4BXO A;  3RBD A;  1K1S A;  2AQ0 A;  1BNP A;  7ICT A;  5L9X A;  3KTQ A;  4X4T A;  3AU6 A;  2ALZ A;  4O5C A;  5DQI A;  8ICU A;  3HPO A;  5DB9 A;  4UB1 A;  3HP6 A;  3H4D A;  4GLX A;  2DPI A;  4E0D A;  4CCH A;  8ICQ A;  8ICK A;  2C2E A;  4IG8 A;  5KG3 A;  1ZJN A;  2R8G A;  5DBB A;  1CEZ A;  2Y1I A;  4Z6C A;  3LWL A;  4F5R A;  4QZB A;  3B0X A;  3MGI A;  4I2E A;  3ETL A;  4O0I A;  3Q8R B;  4RWO A;  2RFF A;  2ZH2 A;  4F4Z A;  7ICM A;  2HHU A;  2DR9 A;  4X4N A;  1LB2 B;  1IXR A;  3T5K A;  3C1Y A;  4P4M A;  5DED A;  4RT2 A;  4DOA A;  1XS9 D;  4E8F A;  4FO6 A;  5KFH A;  1JMS A;  1UET A;  4RNO A;  1ZQG A;  5KT3 A;  3GDX A;  1BPE A;  1NJW A;  4RQ6 A;  3PW7 A;  4IQU A;  1NK5 A;  3PW0 A;  5DG7 A;  9ICO A;  4ECQ A;  1PX5 A;  3NTU A;  4K4I A;  1U4B A;  5J0X A;  9ICR A;  3NYB A;  3UXP A;  1S0N A;  3HWT A;  1CUK A;  4AT8 A;  1SL2 A;  2ASD A;  5IIJ A;  4O3O A;  4IRK A;  5IIK A;  2LYH A;  2O1P A;  4RWN A;  1S9F A;  4PGY A;  3TAR A;  3AQL A;  3WFO A;  4BWJ A;  3HT3 A;  3RH5 A;  4QZA A;  4M6W A;  2DFL A;  4ZH4 A;  9ICH A;  2ZTC A;  5BOL A;  4MFA A;  4JWN A;  2DRB A;  5J2F A;  8ICV A;  7ICN A;  9ICQ A;  4MFC A;  2ASL A;  1TKD A;  4EP7 A;  4FS2 A;  5J29 A;  3NGD A;  4J9R A;  1R8B A;  2I9G A;  4RQ3 A;  4DSF A;  4ATB B;  5KT6 A;  2V4R A;  5HR9 A;  1H38 A;  4M9H A;  5KFG A;  5DB6 A;  4IRD A;  4I2H A;  1RYR A;  1MSW D;  4YD2 A;  3PW5 A;  8ICA A;  4DL2 A;  4J9N A;  4PH5 A;  9ICB A;  1QLN A;  2F1I A;  2UVV A;  3H8S A;  4DWI A;  9ICN A;  2C28 A;  4I2A A;  3V7L A;  2W8K A;  3LDA A;  3PV8 A;  5F9N A;  4FH5 A;  4DO9 A;  2AGQ A;  4DF8 A;  4M0A A;  1ZQW A;  2BPG A;  1IM4 A;  2VA8 A;  4YR3 A;  4UBC A;  5J2I A;  4NLK A;  4X4V A;  1ZQV A;  3ISC A;  1R89 A;  4X4P A;  4RQ8 A;  7ICK A;  9ICS A;  3QZ8 A;  1R8A A;  4KLI A;  1NK4 A;  8ICM A;  2IHM A;  4WC0 A;  4QW8 A;  2B21 A;  3QE9 Y;  2ZH4 A;  5D46 A;  1A76 A;  8ICI A;  4QW9 A;  4AT7 B;  4Q43 A;  1ZQK A;  3EPG A;  4DSK A;  4DFP A;  2FMS A;  4DQP A;  1MIV A;  4YXM A;  1S10 A;  3PO4 A;  3KHR A;  4UD4 A;  4DOB A;  2FLN A;  1KFD A;  2HHW A;  4NXZ A;  3QZ7 A;  4LZG A;  2MAX A;  5HML A;  9ICG A;  1FA0 A;  1BVS A;  5DQG A;  2PFO A;  4NM2 A;  3JZ0 A;  5EWF A;  1KEJ A;  4EYH B;  4J9M A;  5KFL A;  5KT5 A;  1BPX A;  5KFY A;  5L1I A;  1RZT A;  1ZQM A;  4DS5 A;  4RPX A;  4X0A A;  3GV7 B;  1X9S A;  5KFJ A;  3JPR A;  2ZUD A;  5CWR A;  5KFN A;  4RU9 A;  3C21 A;  4UQG A;  3SV4 A;  4EBC A;  2M2T A;  2BHN A;  5KG5 A;  1Q79 A;  4JV0 A;  3SI8 A;  3PVX A;  5KFD A; 
#chains in the Genus database with same CATH topology
 3Q8L A;  3V6H A;  3GII A;  2WFA A;  2YN4 A;  1BPD A;  4R65 A;  4NLC A;  3PX0 A;  7ICU A;  4ED0 A;  4NKT A;  1JAJ A;  5ALJ A;  2Y0S F;  1NK6 A;  4CF3 A;  3PHZ A;  3WFS C;  5KT2 A;  2BBH A;  2A1J B;  5AHX A;  2RHF A;  2VA2 A;  3SZ2 A;  9ICI A;  3HIY A;  2RRD A;  1ZQS A;  4GXK A;  5J2K A;  4FZN A;  3OGU A;  2DWQ A;  4C7Y A;  3V72 A;  3GQC A;  3MGH A;  2DBY A;  1VLB A;  1SXE A;  4KLQ A;  5HRF A;  3JPS A;  4O6A A;  5J0O A;  3UXO A;  3N7P D;  5ALX A;  2ZUB A;  2AU0 A;  5KFF A;  3EPI A;  2KK0 A;  3I28 A;  5HRI A;  2LMR A;  3E2E A;  3ISD A;  1UT8 A;  5ALK A;  2PXI A;  2EAN A;  3HJE A;  3AM9 A;  2PKE A;  4O3P A;  4IS7 A;  8ICW A;  2ODG A;  1WCN A;  4QJF B;  3PW4 A;  3QEA Z;  4UB2 A;  3UPQ A;  1KTQ A;  1N61 A;  7ICF A;  5JRT A;  4Q8E A;  3M6Z A;  2C2R A;  5KAF U;  4GXI A;  5III A;  3MR3 A;  3OHB A;  2FLP A;  5CFT A;  5DGB A;  1SL0 A;  3JCF A;  4O69 A;  2PFN A;  4ED1 A;  5L1J A;  3TAD A;  2GH1 A;  1VJ5 A;  2IOF K;  1L7P A;  1U45 A;  2PI5 A;  4FBU A;  5F2V O;  1QQ7 A;  4EBK A;  4NXU A;  4PHD A;  4G3I A;  9ICK A;  2K8C B;  5EE1 A;  3HIL A;  4EEK A;  5JUM A;  1NK9 A;  4C8K A;  3GFK B;  4C4R A;  3D2N A;  4TUR A;  2Q4T A;  2W8L A;  4U6P A;  1ZQE A;  3BS5 B;  3WKA A;  1SWV A;  1SL1 A;  3N97 B;  1V85 A;  2LPE A;  1B4F A;  2ZJ8 A;  4I2D A;  4Y2T A;  2EZX A;  2GO7 A;  4I29 A;  2OCE A;  5DBA A;  2F8L A;  3H8J A;  4USA A;  3O0F A;  2VAN A;  2ASJ A;  1T3Q A;  5CJ7 A;  5KFS A;  2W04 A;  1C7Y A;  2KJ9 A;  5KT7 A;  2ZJ5 A;  1S77 D;  2KFN A;  7ICS A;  1X66 A;  1TK5 A;  3C29 A;  3G6V A;  4YFK A;  3JPP A;  2W7P A;  2KN7 A;  5J0W A;  1L7M A;  2ZH5 A;  2R18 A;  4WQL A;  2Q0Z X;  5G5H A;  3A0B U;  4RQ5 A;  1ZQU A;  1VFG A;  2W9M A;  1NI3 A;  3SD7 A;  1S0M A;  3I76 A;  1B22 A;  5KFX A;  1QSL A;  4WC7 A;  2XC9 A;  1L3T A;  1JI7 A;  1TE2 A;  3IV6 A;  1RYU A;  4YCX A;  3OUY B;  2Y9U A;  3PX4 A;  1ZQT A;  1KDH A;  3T3F A;  4ECZ A;  5DLF A;  3AEV A;  4F4X A;  1X9X A;  1TVA A;  3Q8Q B;  2NYV A;  2ESE A;  3RR8 A;  5ALE A;  5HRK A;  4IRC A;  2LYA A;  1SB3 C;  4FHP A;  4P0P A;  3RB0 A;  4QWA A;  4UD5 A;  1ZET A;  3VCB A;  1YZ6 A;  2C22 A;  4FZL A;  2NRT A;  3ZDB A;  1RQN A;  4UAV A;  3SEI A;  1YLQ A;  3ED5 A;  5DB8 A;  5BPC A;  2KZZ A;  3NRZ A;  1ZQX A;  2JZB A;  3UM9 A;  4ED6 A;  1KSP A;  4FH3 A;  1D8L A;  4XUS A;  4EEB A;  4P0Q B;  1ZD2 P;  4NLZ A;  1ZQR A;  2F2A B;  5J0T A;  5DEC A;  3ISB A;  2WTF A;  3TKA A;  3BQ2 A;  4RPZ A;  3JPQ A;  4EEN A;  3GU3 A;  2PI4 A;  2DR5 A;  4RQM A;  7ICH A;  2AQ4 A;  4NXW A;  1YZ7 A;  3DV9 A;  2K4I A;  4EEL A;  3ZD9 A;  2W7O A;  3FDS A;  2KTQ A;  2BR0 A;  5IIN A;  2DR7 A;  9ICP A;  2W9C A;  2K8B B;  3FYH A;  3N7R C;  3RH4 A;  4B9V A;  4S3N A;  1ZQP A;  1SXD A;  4K99 A;  1ZQN A;  1LV5 A;  2ES6 A;  2HOF A;  2YB1 A;  4MKP A;  2IHO A;  4AT7 A;  4C80 A;  1BPB A;  1D8B A;  4UB6 U;  4IR9 A;  2HDO A;  2ZJA A;  3RB4 A;  3RRH A;  3TI0 A;  2Q66 A;  3C2K A;  4F8R A;  5AKY A;  4NXX A;  4I28 A;  1PK1 B;  4J9L A;  2BDP A;  4KX5 A;  5J2C A;  4DQR A;  4J9P A;  4OO1 J;  4KLF A;  1ECW A;  5KG0 A;  1NK0 A;  3M9N B;  5K4L A;  4F92 B;  3H7I A;  3OJU A;  4J9S A;  1ZQD A;  3CNH A;  5EWE A;  4I2G A;  2FJ6 A;  2RDI A;  1Z00 A;  1T94 A;  1RQL A;  5CHE A;  3IG5 A;  4I2J A;  1NZP A;  4NLB A;  4GXJ A;  1F5A A;  5J2D A;  4RT3 A;  2JHD A;  4AT9 A;  3GIL A;  4R66 A;  1S0V A;  4RQ2 A;  4YN4 A;  3K4G A;  4KLO A;  3GV8 B;  2BQR A;  3H39 A;  2BCV A;  1ZQC A;  4PGX A;  3H3A A;  4MEX A;  2B4V A;  1UCV A;  4X0B A;  2ZH8 A;  4OAH A;  4CDG A;  4GC6 A;  2YMP A;  4ED7 A;  2Y9T A;  3QU9 A;  3QX7 A;  2FMP A;  1IIP A;  5HC9 A;  1L5U A;  3MGV A;  4Q44 A;  3C5G A;  4QZC A;  2B6G A;  2HHP A;  5AM0 A;  3AU2 A;  5TZV A;  4FE3 A;  3OV7 A;  2Y1J A;  2AGP A;  5ALD A;  4NWI A;  4NJ8 A;  5HMM A;  5J0S A;  4LJX A;  3RAQ A;  3RBD A;  1K1S A;  3AN1 A;  2EAP A;  3AU6 A;  5DQI A;  3HPO A;  4ZOH C;  4UB1 A;  3H4D A;  4GLX A;  8ICK A;  5D62 A;  2W11 A;  1ZJN A;  4C4T A;  3WKE A;  2M0N A;  3IDW A;  5ALG A;  3MGI A;  4QZB A;  3Q8R B;  4DOA A;  3ER8 C;  4FO6 A;  5KFH A;  1WUD A;  5KT3 A;  3H0M B;  4ECQ A;  1U4B A;  1HIW A;  9ICR A;  2I5H A;  1S0N A;  3HWT A;  2N1R A;  5ALH A;  4PGY A;  1ZQ1 C;  3HT3 A;  3RH5 A;  3K1R B;  2QLT A;  4M6W A;  4ZH4 A;  4K98 A;  3NKU A;  2IUB A;  3ER9 B;  5BOL A;  2KV2 A;  4JWN A;  5J2F A;  8ICV A;  9ICQ A;  2ASL A;  3NGD A;  4J9R A;  1R8B A;  2I9G A;  3FC4 A;  4OJP A;  1A0P A;  5KFG A;  4M9H A;  2FDR A;  4YD2 A;  2E8N A;  4DL2 A;  2CXY A;  4J9N A;  3H8S A;  4I2A A;  2W8K A;  2BPG A;  4YR3 A;  4X4V A;  1ZQV A;  1DGJ A;  1R89 A;  4PL1 A;  2O6K A;  9ICS A;  3QZ8 A;  1R8A A;  2JGA A;  3RFA A;  2B21 A;  2OM6 A;  2ZH4 A;  4QW9 A;  4AT7 B;  1ZQK A;  4WQK A;  4DFP A;  4DQP A;  1S10 A;  4MHV A;  2EAM A;  4ACO A;  2YX8 A;  5L1M A;  2MAX A;  1N2X A;  5ALN A;  5ALQ A;  2NO5 A;  4CF4 A;  2G08 A;  5AKI A;  4J9M A;  5KFL A;  2BDU A;  4RPX A;  1X9S A;  5KFJ A;  4RU9 A;  4B6J A;  1Q79 A;  2BHN A;  5KG5 A;  4JV0 A;  3SI8 A;  5KFD A;  5AM2 A;  1ZD5 A;  2OYY A;  3L9D A;  5AM3 A;  3EUB 2;  5GTI U;  1KKX A;  3RR7 A;  3NVW A;  2FPK A;  1T8E A;  4KTQ A;  4C4S A;  4KLD A;  3H37 A;  2HW3 A;  1NOM A;  1CI4 A;  1OUQ A;  3Q8K A;  5DQH A;  1L8O A;  5TIS U;  5T14 A;  4B9S A;  4O3M A;  1ZQB A;  3SEN A;  2E8M A;  2KHQ A;  2P6U A;  1ZQJ A;  2DKZ A;  2E8O A;  2KEY A;  1ZOL A;  2MU2 A;  3RJE A;  4AYB C;  4JMU A;  2W55 A;  2H3F A;  4EGW A;  2WB1 F;  1ZQA A;  3RB6 A;  4P4P A;  5D61 A;  1COK A;  3C28 A;  5HHI A;  4TQR A;  1WWV A;  3QNM A;  1Z1B A;  4O3Q A;  1HUO A;  8ICO A;  3KD3 A;  3ORY A;  4BGD A;  2P6R A;  2D3D A;  7ICI A;  4BXO B;  4X5V A;  1VJ7 A;  2ZIX A;  2F8K A;  2FCL A;  2FI1 A;  1MQ2 A;  2A3V A;  2JRZ A;  2GAF D;  2DPJ A;  4E80 A;  4DLE A;  2JEJ A;  9ICX A;  3BJY A;  4Y2X A;  4DF4 A;  3VC8 A;  4OJ5 A;  2JMG A;  3OSN A;  3PW2 A;  2FPL A;  2PMZ F;  3BQ1 A;  3SAF A;  5AKJ A;  5B5E U;  2DRA A;  4YMN A;  2YTU A;  4EEY A;  4JWM A;  3RJG A;  1B0X A;  2I1Q A;  2MUT B;  5B66 U;  4B9M A;  5KFM A;  2J6S A;  4J9O A;  2JH1 A;  5IIO A;  2J6U A;  1HUZ A;  4F5P A;  1NK7 A;  4N7R A;  4YD1 A;  1DK2 A;  1NZB A;  2EH9 A;  1PUZ A;  4F72 A;  4I2B A;  9ICL A;  1ZXI A;  2G5I B;  2MUT A;  3BZC A;  3IP4 B;  1BGX T;  4O5E A;  1XO0 A;  4JV1 A;  4RZR A;  3NRW A;  1MA7 A;  1RDF A;  2VA3 A;  5KNI A;  3JYY A;  2XCA A;  5L1K A;  4UAS A;  4C8N A;  3AQF A;  1Z3E B;  5J0U A;  1JXE A;  4PL2 A;  3PNC A;  2AGO A;  5KFR A;  5J0R A;  4DQS A;  4DL4 A;  4Z6E A;  1SKW A;  2YQE A;  2HCF A;  3SAH A;  3HX0 A;  2WF6 A;  1TFY A;  1ZQF A;  3ALR A;  1OXJ A;  2ZH9 A;  4YP3 A;  4NL9 C;  4QWB A;  2ZIX B;  4QWE A;  3OWG A;  3ZDD A;  5AKE A;  2ZIW A;  5J2B A;  5C5J A;  3PZP A;  1S76 D;  1X2I A;  1TAM A;  2LM4 A;  1RXW A;  4CNQ A;  1MIW A;  3ERC C;  4LEY A;  2YML A;  1XWL A;  1XNS A;  3RTV A;  3T5J A;  4LZD A;  3OTQ A;  4FBT A;  2E8P A;  4FHY A;  3UPS A;  3JPT A;  3T79 A;  1JXL A;  3H4B A;  3RRG A;  4KLG A;  1SIJ A;  1V38 A;  4I2F A;  8ICZ A;  2W3R A;  4DL7 A;  4QZE A;  1FO4 A;  4LEV A;  4WC4 A;  4Y2J A;  2QKQ A;  4U7C A;  3EZ5 A;  1QSS A;  5KFC A;  1TAU A;  3KKA C;  4ECS A;  3AQN A;  4WBY A;  5D4B A;  4M9N A;  3I1Y A;  1N5W A;  2KZ3 A;  2VJ4 A;  2B0C A;  4QIW F;  4DQQ A;  3SMV A;  4OJ6 A;  5AI9 A;  4KLL A;  1X6J A;  4NXV A;  2IHN A;  4FZM A;  3CP8 A;  1FFV A;  1FEZ A;  8ICX A;  2HOQ A;  3QXG A;  2PMZ C;  4DSI A;  2FMQ A;  2BPF A;  3E0F A;  2NRW A;  4G9B A;  5D49 A;  1CRX A;  3N28 A;  4QZG A;  4HX0 A;  3KZI U;  3KHL A;  1ED1 A;  2R8J A;  3UXN A;  9ICT A;  3ZD8 A;  2VIX A;  1Q3U A;  2ATL A;  1X9M A;  4HAI A;  2NRZ A;  2W3S A;  2K4P A;  2BCR A;  2L5Y A;  2E3T A;  5DDY A;  4EZ6 A;  5L1L A;  1WOT A;  3M1Y A;  1N63 A;  3F2D A;  3N7S C;  3PR5 B;  3N4M B;  2ZH7 A;  4KX3 A;  5GTH U;  3CYM A;  3TAQ A;  3AQE A;  1URJ A;  4OD0 A;  5ALM A;  2R8H A;  2K60 A;  4XRH A;  4IQV A;  9ICE A;  3TQ1 A;  4LEZ A;  5AI8 A;  5AKH A;  9ICC A;  4BUG A;  1Q46 A;  3V7K A;  1ZYQ A;  5KG1 A;  1ARO P;  2KIV A;  3HJ1 A;  1KRP A;  4X4O A;  1JRP A;  3CRX A;  4F93 B;  3SV3 A;  1BNO A;  2PFP A;  3BS7 A;  4ECV A;  1YT3 A;  3MDC A;  1Q3V A;  4TUP A;  8ICB A;  1UQV A;  2JR5 A;  2W9A A;  3C5F A;  5AK5 A;  2UVW A;  2KD1 A;  1O03 A;  5EWG A;  3MR5 A;  5F3X B;  1NNL A;  2EZZ A;  3TFR A;  1ZQZ A;  4RQ7 A;  1VDV A;  2M2U A;  7ICE A;  2O5A A;  5AKZ A;  3BS5 A;  2WB1 C;  8ICJ A;  4FS1 A;  1S97 A;  3HJ4 A;  7ICR A;  7ICJ A;  7ICV A;  4QWC A;  5J2G A;  1V9P A;  4ED3 A;  4CGZ A;  3WK5 A;  4M6W B;  2XI9 A;  1F5S A;  5KFB A;  1XSL A;  3IN5 A;  1RPL A;  5J2E A;  4ICA A;  4PZN A;  2G09 A;  5B3P A;  3NVO A;  3MFH A;  1XO1 A;  2K89 A;  4ECR A;  2DKX A;  1J97 A;  2VKQ A;  3QEB Z;  4ELV A;  2F3N A;  2BQ3 A;  1K1Q A;  1BPZ A;  3ONN A;  5J0Y A;  2ZHA A;  1MC8 A;  2YMQ A;  5DGA A;  4ECW A;  1KNY A;  5DKW A;  5KFU A;  5J0Q A;  3WK6 A;  3WU2 U;  4WC2 A;  5ALY A;  4O3R A;  4B9L A;  4X4U A;  5KT4 A;  3UQ2 A;  1Z00 B;  5AKX A;  2AH5 A;  4ELU A;  4K4H A;  1EXN A;  2NRK A;  1Y88 A;  2KJ8 A;  2HHS A;  4F4K A;  4QZ8 A;  2KKP A;  3B9J A;  5CA7 A;  4BXO A;  5L9X A;  3HP6 A;  4IG8 A;  5AI5 A;  2R8G A;  2Y1I A;  1QH9 A;  1AQ6 A;  2E5S A;  1PK1 A;  2RFF A;  2ZH2 A;  2DR9 A;  5JU5 A;  1PVR A;  1LB2 B;  2XVT A;  5DED A;  4RT2 A;  3PSF A;  2KG5 A;  4RQ6 A;  1NJW A;  4IQU A;  5DG7 A;  4RWN A;  3NTU A;  4Y2R A;  3NYB A;  5IIJ A;  2LYH A;  2OHF A;  1KQQ A;  1S9F A;  4WOY A;  5J8Y A;  3TAR A;  1Z4O A;  2G06 A;  3D2S A;  5AIC A;  2DRB A;  4EP7 A;  4IL6 U;  4FS2 A;  5J29 A;  4RQ3 A;  4DSF A;  3LVV A;  5KT6 A;  3BQ7 A;  1H38 A;  4I2H A;  4CF5 A;  1PVP A;  3PW5 A;  4PH5 A;  4DWI A;  9ICN A;  3LDA A;  5F9N A;  3F5E A;  4DF8 A;  1F0M A;  2VA8 A;  5FP0 A;  5J2I A;  5ALT A;  3S6J A;  2KE7 A;  5AKL A;  1Z4N A;  1NK4 A;  4WC0 A;  1FFU A;  4QW8 A;  5JTI A;  8ICI A;  4I0U A;  4DSK A;  1ZD4 A;  2FMS A;  1MIV A;  1K5O A;  2GOL A;  4CE6 A;  3PO4 A;  2FLN A;  1M6Y A;  4NXZ A;  3QZ7 A;  9ICG A;  5DQG A;  2PFO A;  3QU2 A;  2G0A A;  5EWF A;  1GPJ A;  4EYH B;  4OJO A;  1BPX A;  5KFY A;  4X0A A;  2HBK A;  3JPR A;  5CWR A;  4JLZ A;  1JUD A;  2KOB A;  5CR0 A;  5AI4 A;  5KG7 A;  3LK9 A;  3WK8 A;  2A19 A;  1WYG A;  2C2D A;  2F1J A;  4P0Q A;  4B9U A;  4FHV A;  3C2M A;  1S8O A;  4FHX A;  1RXV A;  3PR4 A;  3V6J A;  3MCR A;  3AQK A;  1WCL A;  4PPX A;  5HRG A;  2KJ5 A;  2XY7 A;  4YQW A;  1T4G A;  4IQT A;  2MRL A;  4QZF A;  4YVZ A;  4E7X A;  4P0P B;  8ICF A;  4DSJ A;  4GFJ A;  4DCC A;  2HVH A;  1L8L A;  2OXO A;  4Y2S A;  1QQ5 A;  3AQM A;  2Z7J A;  2G07 A;  3PML A;  3DEE A;  4P4O A;  4FHW A;  4YXJ A;  1SZP A;  4F91 B;  1PK3 A;  4UB4 A;  4RUA A;  2ZH3 A;  3OVA A;  5ALZ A;  4B9T A;  3G6Y A;  5KL8 B;  2NRX A;  4UAY A;  4EZ9 A;  4UAW A;  3K7D A;  1TFW A;  3PSP A;  8ICN A;  4I27 A;  1ZQY A;  2AXT U;  4WJ3 B;  3NVZ A;  4I2I A;  3WK4 A;  1N48 A;  4PHE A;  7ICG A;  4RUC A;  3G6X A;  2W03 A;  5HRL A;  1U49 A;  3AMZ A;  1DOQ A;  3UQ0 A;  5HHH A;  8ICH A;  1MIY A;  2HSZ A;  1D8Y A;  3H40 A;  2LYB A;  5DLG A;  5KTQ A;  1L3S A;  3UMG A;  4R8U B;  5DG9 A;  4NLG A;  4O9M A;  3ZDA A;  7ICL A;  3L5K A;  3OPX A;  2ISP A;  4WBZ A;  4M9G A;  4PHA A;  2F44 A;  4IQW A;  1ZQH A;  3RJF A;  2QB1 A;  2ZG6 A;  3K75 D;  3ZDE A;  2BKE A;  2BGW A;  4PGQ A;  2W9B A;  2RP5 A;  2G5H B;  3Q8M A;  1SKS A;  3RF9 A;  2WF8 A;  4ECT A;  4O3S A;  4B9N A;  4TUS A;  4M5D A;  4PHP A;  2JZB B;  1JIH A;  4KLM A;  5KFW A;  4ECY A;  4F5O A;  3KBB A;  3KHG A;  1KLN A;  2KIW A;  1TK0 A;  4RWP A;  9ICW A;  2RQ5 A;  2HHX A;  1OU5 A;  3EYZ A;  3JPN A;  2XY6 A;  4R64 A;  4KN4 A;  4KLJ A;  4ED8 A;  5AM1 A;  2B51 A;  3H0L B;  2ZIU B;  3V7J A;  5DG8 A;  3TAC B;  5DB7 A;  5J0P A;  3GIM A;  2OEH A;  3SR6 A;  4UB3 A;  2F1H A;  2XO7 A;  4DL6 A;  4NL9 A;  3M6K A;  2H3Z A;  4X4Q A;  3MAB A;  1PVQ A;  5IIM A;  1UHU A;  2R8K A;  3OUY A;  5KG6 A;  2KZM A;  4DSL A;  4JUZ A;  4O67 A;  5ALO A;  3MBY A;  3T5H A;  3QUT A;  5DBC A;  1KFS A;  2VJ5 A;  4RQN A;  5CRX A;  1L7O A;  1Z19 A;  5AIA A;  5AK6 A;  1WG8 A;  3BZK A;  2XCP A;  3QU5 A;  4Q8F A;  3RJJ A;  1FIQ A;  1BPY A;  3C66 A;  4FO1 A;  1RG6 A;  1QSY A;  4F4W A;  1LVH A;  1Q78 A;  3T5L A;  3WFQ E;  1D9F A;  4QZI A;  3H8W A;  3E58 A;  2J6T A;  2EQY A;  4Y2U A;  3WK9 A;  8ICE A;  2KIC A;  2ZIW B;  4JK1 A;  5KG2 A;  1GO3 F;  5KFQ A;  1L7N A;  2KFZ A;  4LVS A;  4EV6 A;  1PZN A;  4WC5 A;  4HYK A;  4DFK A;  2ZTD A;  8ICL A;  4J9Q A;  3EW9 A;  4M9J A;  1COO A;  2E1E A;  2DQN B;  4RQ1 A;  1OW5 A;  3OHA A;  5J2H A;  1DXS A;  4R63 A;  3WKD A;  3M9M B;  2ID1 A;  1UEV A;  3RJH A;  5HRB A;  3SYZ A;  1P7D A;  3TAP A;  3GIK A;  4K8V A;  2WAQ F;  1T3N A;  4KLS A;  3QUB A;  3HW8 A;  4OAI Z;  4C8O A;  1IG6 A;  2AJQ A;  2QB0 B;  4M04 A;  1NJZ A;  3F2B A;  4QWD A;  4PJ0 U;  2IMW P;  2UVR A;  4Q45 A;  3RJI A;  4O68 A;  4YG2 A;  5AK4 A;  2JEF A;  5HRH A;  2JV3 A;  3NS1 A;  4NV0 A;  3MDA A;  3A0H U;  3RB3 A;  7ICO A;  1UT5 A;  2LBO A;  3QU7 A;  4DS4 A;  4O5K A;  3ZI4 A;  3PY8 A;  5DDM A;  4EED A;  4YMO A;  2XIC A;  1QTM A;  3WK7 A;  1ZRN A;  3H0R B;  1A77 A;  4AT8 B;  3AL0 B;  5AI0 A;  2XID A;  2FLL A;  4QIW C;  4QZ9 A;  5CB1 A;  3RH6 A;  2K8A A;  4J9K A;  1C20 A;  2D8C A;  1X6I A;  8ICG A;  2BCU A;  1A6S A;  4C8L A;  4ECU A;  1L3U A;  3JPO A;  3UMB A;  3GV5 B;  1DRG A;  5KFI A;  1Z1V A;  1U47 A;  3C23 A;  4WH5 A;  1HEK A;  1ZJM A;  4AT9 B;  5HRD A;  4RNM A;  3IRU A;  4A8E A;  3PMN A;  1TAQ A;  4M47 A;  2A1J A;  4NXT A;  5KFE A;  1LKY A;  3F5A A;  1L6N A;  2NO4 A;  3HRD D;  5KG4 A;  4OAG A;  4MEY A;  3GIJ A;  2AQ0 A;  3KTQ A;  4O5C A;  3D6J A;  8ICU A;  1ZRM A;  2MSN A;  8ICQ A;  2CPR A;  5KG3 A;  1CEZ A;  5DBB A;  4F5R A;  3B0X A;  4QNL A;  3ETL A;  1N62 A;  4F4Z A;  2HHU A;  1IXR A;  3T5K A;  3C1Y A;  4P4M A;  1ZQG A;  9ICO A;  2HN2 A;  5CFU A;  4K4I A;  4K96 A;  5J0X A;  3UXP A;  3HKZ C;  1WWU A;  1KBU A;  4AT8 A;  4O3O A;  5IIK A;  3ICX A;  3AQL A;  4BWJ A;  1O08 A;  1KN5 A;  5ALR A;  5AK3 A;  4US9 A;  5HR9 A;  5DB6 A;  1MSW D;  2P35 A;  1J2N A;  8ICA A;  3LVW A;  2C28 A;  3V7L A;  2QAR A;  3PV8 A;  4FH5 A;  4DO9 A;  4M0A A;  3QUQ A;  4K97 A;  2GA9 D;  5AIB A;  1IM4 A;  4UBC A;  3ISC A;  4X4P A;  7ICK A;  2DGZ A;  8ICM A;  2AHO B;  2H3V A;  1V97 A;  5D46 A;  5AI6 A;  4Q43 A;  2NV3 A;  3KHR A;  2KMD A;  2HBL A;  4DOB A;  2ZXI A;  3EF2 A;  1BVS A;  3NVV A;  4NM2 A;  3F53 A;  5L1I A;  1ZQM A;  4K9B A;  5KFN A;  4EBC A;  3SV4 A;  3C2L A;  2QAR B;  2BPC A;  4UAT A;  5KAI U;  4J03 A;  4F5Q A;  1X9W A;  2HHV A;  5AM4 A;  1MN8 A;  7ICP A;  2K4H A;  3V6K A;  4ATB A;  3IM1 A;  2LKY A;  3J81 j;  2DR8 A;  3KFU F;  2JXJ A;  1UEU A;  4WCW A;  2DL0 A;  2MA1 A;  2BCS A;  1NO5 A;  3QUC A;  2BCQ A;  4Z6F A;  5KFK A;  3RJK A;  4LT6 A;  4UW9 A;  3CK6 A;  2JEG A;  2IA6 A;  4K4G A;  1ZQQ A;  5A0L A;  5KFA A;  4ELT A;  3M9O B;  1V4A A;  4IC9 A;  3L3F X;  4F5N A;  5JTG A;  4NKU A;  3KZX A;  4Y2P A;  3C18 A;  2DUY A;  3ETR A;  4F3O A;  2ZIU A;  3R9K A;  5HNK A;  4RQ0 A;  3MC1 A;  4UBB A;  3IG8 A;  3CW2 C;  2PFQ A;  5ALF A;  3M8S A;  3M8R A;  3GZF A;  3THV A;  4M2Y A;  4C7Z A;  9ICV A;  4DQI A;  2XY5 A;  2UVU A;  2HHQ A;  4X4S A;  3WKC A;  1JN3 A;  4BDP A;  4CRX A;  5ALV A;  2EDU A;  1X42 A;  5ALS A;  3KKA A;  3BDP A;  4EX6 A;  4KB6 A;  4KLT A;  2BZF A;  2WHE A;  4C0Z A;  1RYS A;  1SWW A;  4BWM A;  4I2C A;  4ED2 A;  4P2H A;  1TFR A;  2W9B B;  4KLH A;  1U48 A;  2HMX A;  5J2A A;  4DL3 A;  3RBE A;  2RDJ A;  1U9L A;  4BX9 C;  3KHH A;  7ICQ A;  5KFP A;  2LM1 A;  3HKZ F;  2W9C B;  2KSO B;  4OAF A;  1SGG A;  4KIT B;  1SV0 A;  2ZTE A;  4WC1 A;  4YMM A;  4KLU A;  5ALI A;  5EE3 A;  2Y0S C;  5BOM A;  4YR2 A;  5ALW A;  2OWO A;  3MFI A;  1NK8 A;  5HP4 A;  4Z6D A;  4XA5 A;  4WC3 A;  1SV0 C;  4TUQ A;  5HRE A;  1XC9 A;  4DLG A;  1KFT A;  2ZUC A;  5KFT A;  2IBK A;  2HI0 A;  5CP2 A;  4UAR A;  4DL5 A;  3B0Y A;  5IIL A;  2EAO A;  3OSP A;  3C1Z A;  2LHT A;  3AUO A;  2V9W A;  2OH2 A;  1Q8K A;  4F50 A;  1JRO A;  5G5G A;  2M9N A;  2LI6 A;  8ICY A;  8ICR A;  1ZQL A;  4X4R A;  1SZH A;  3M7D A;  4NY8 A;  5B3Q A;  5D63 A;  2H5X A;  2DVI A;  3UMC A;  4NLN A;  5CEH A;  4M9L A;  1DK3 A;  3BQ0 A;  3TFS A;  1UA0 A;  5E79 U;  3MR2 A;  9ICF A;  2ZHB A;  4MFF A;  2KP7 A;  4DSE A;  2HVI A;  2CN1 A;  2R8I A;  4JV2 A;  4C8M A;  3WFP A;  2ZH1 A;  4EBD A;  2E1F A;  4KMO B;  4PZO A;  1D9D A;  4O3N A;  1QCK A;  5EE9 A;  2JH7 A;  1TV9 A;  4OJL A;  1ZQO A;  5KFZ A;  5AKG A;  4RPY A;  5KL1 B;  1HJP A;  4UAZ A;  5J8Y C;  4IR1 A;  2KKV A;  4MF8 A;  2H3Q A;  2F76 X;  3BQT A;  2PBE A;  1ZQI A;  8ICS A;  4US8 A;  3PSI A;  2CRX A;  4EBE A;  5KFV A;  4NM1 A;  2M2V A;  2NRV A;  3WFR E;  4F2S A;  2HN1 A;  4BJQ A;  2B56 A;  9ICU A;  3TAD C;  2DF4 B;  1S0O A;  3MR6 A;  5C0Y A;  2A1A A;  1NJY A;  2H3I A;  5J2J A;  4UB5 A;  1SKR A;  2KSO A;  1MQ3 A;  3QU4 A;  1X40 A;  1JX4 A;  2KNJ A;  3OVS A;  3PX6 A;  3PST A;  3IHQ B;  2ZH6 A;  4KN7 A;  5EE0 A;  4F71 A;  1JAL A;  1UA1 A;  2BE3 A;  5HR7 A;  4RWQ A;  2V4Q A;  4GIB A;  3SAG A;  1NKE A;  4DEZ A;  3U26 A;  4DFJ A;  8ICT A;  4QZD A;  2I6X A;  2JEI A;  2RLT A;  4F2R A;  1NJX A;  2FPM A;  8ICP A;  9ICM A;  3FM9 A;  1N5X A;  3H38 A;  1NKB A;  4KLE A;  3L4P A;  2EZY A;  4UAU A;  2ISO A;  3Q8S B;  4TQS A;  3ZDC A;  1T7P A;  5CHG A;  3TAN A;  2F77 X;  4Y2Y A;  3LQC B;  1NKC A;  3FAH A;  3RAX A;  3DDH A;  4AP9 A;  1JQR A;  2YY6 A;  5EOZ A;  4EYI B;  2HBM A;  3EWA A;  4R8U A;  2P66 A;  1L3V A;  3Q8P B;  4XQ7 A;  4YR0 A;  1LKY B;  5AKK A;  1TK8 A;  4QZH A;  9ICA A;  1XU4 A;  2XGQ A;  5AM5 A;  4EBJ A;  2GLE A;  4RQ4 A;  4ECX A;  4DOC A;  4XQ8 A;  5HR6 A;  2WAQ C;  2XGP A;  4GC7 A;  1B43 A;  3OVB A;  4KMU A;  4UB8 U;  1N56 A;  1XSN A;  3OJS A;  4AYB F;  4F4Y A;  9ICJ A;  5F9L A;  2M2W A;  3NAS A;  3F2C A;  1DGS A;  1XSP A;  1R8C A;  4MF2 A;  3WKB A;  4FFD A;  4K9A A;  1ZD3 A;  2BQU A;  2YB4 A;  4XJE A;  4DFM A;  3LWM A;  2GWS A;  4RNN A;  4WC6 A;  5KFO A;  3PO5 A;  8ICC A;  1UPH A;  2HHT A;  1BNP A;  7ICT A;  4X4T A;  5ALP A;  2ALZ A;  5DB9 A;  2DPI A;  4E0D A;  4CCH A;  2C2E A;  2IOF A;  4Z6C A;  3LWL A;  1IV8 A;  2HBJ A;  3NUQ A;  4I2E A;  2EWR A;  4O0I A;  4RWO A;  2W54 A;  7ICM A;  4X4N A;  1N60 A;  1KW4 A;  1XS9 D;  3NWI A;  2QB0 A;  1JMS A;  1UET A;  4RNO A;  3GDX A;  1BPE A;  3PW7 A;  1QQ6 A;  2ZIV B;  1NK5 A;  3PW0 A;  2BBJ A;  1PX5 A;  4KM5 A;  2WF7 A;  1CUK A;  1SL2 A;  2KHV A;  2ASD A;  2O1P A;  4IRK A;  4LEW A;  3WFO A;  4QZA A;  2DFL A;  9ICH A;  3NVY A;  2YMM A;  2ZTC A;  4MFA A;  2KVS A;  7ICN A;  4MFC A;  2ZXH A;  2WF5 A;  1TKD A;  4ATB B;  5ALU A;  2V4R A;  4IRD A;  1RYR A;  3KOO A;  2W43 A;  1RM6 C;  3K1Z A;  4JLX A;  2HOI A;  9ICB A;  1QLN A;  2F1I A;  2UVV A;  2IOH A;  1KL9 A;  3H8M A;  2AGQ A;  1ZQW A;  5CFS A;  4NLK A;  2WF9 A;  4RQ8 A;  3QYP A;  4Y2Q A;  1SV4 A;  4KLI A;  5ALL A;  2IHM A;  3QE9 Y;  2KVC A;  1A76 A;  1J2M A;  2FE9 A;  3EPG A;  4YXM A;  4DFD A;  4UD4 A;  4JB3 A;  1KFD A;  2HHW A;  4LZG A;  5HML A;  1FA0 A;  2K4E A;  4Y2V A;  2D6F C;  3JZ0 A;  1KEJ A;  3D2Q A;  5KT5 A;  2ZIV A;  3SQI A;  1RZT A;  4DS5 A;  3GV7 B;  1F44 A;  2ZUD A;  5H2F U;  2M2T A;  4UQG A;  4E8F A;  1S5L U;  4OCZ A;  3PVX A;  3LYS A;  3C21 A;  4EX7 A; 
#chains in the Genus database with same CATH homology
 3Q8L A;  5CR0 A;  3C2L A;  3V6H A;  3GII A;  3L9D A;  2BPC A;  5KG7 A;  3LK9 A;  3RR7 A;  1BPD A;  2FPK A;  1T8E A;  4F5Q A;  2C2D A;  4B9U A;  2F1J A;  4R65 A;  1X9W A;  4KTQ A;  3PX0 A;  4KLD A;  2HHV A;  3C2M A;  2HW3 A;  3H37 A;  4FHV A;  1NOM A;  7ICU A;  4ED0 A;  4NKT A;  1JAJ A;  7ICP A;  1NK6 A;  3Q8K A;  4FHX A;  5DQH A;  3V6K A;  1RXV A;  4ATB A;  3PR4 A;  3V6J A;  3WFS C;  3AQK A;  1WCL A;  3IM1 A;  4B9S A;  4PPX A;  5KT2 A;  1ZQB A;  2A1J B;  9ICI A;  2VA2 A;  3SZ2 A;  2P6U A;  1ZQJ A;  5HRG A;  3HIY A;  1ZQS A;  1UEU A;  4WCW A;  2XY7 A;  2BCS A;  4GXK A;  5J2K A;  1NO5 A;  3OGU A;  4YQW A;  2BCQ A;  3V72 A;  1T4G A;  4Z6F A;  5KFK A;  3GQC A;  3RJK A;  3MGH A;  3RJE A;  4IQT A;  4LT6 A;  4KLQ A;  5HRF A;  3JPS A;  4QZF A;  5J0O A;  4YVZ A;  1ZQA A;  3UXO A;  4E7X A;  3RB6 A;  8ICF A;  4P4P A;  4DSJ A;  2AU0 A;  2ZUB A;  2JEG A;  2HVH A;  5KFF A;  7ICR A;  2IA6 A;  3EPI A;  4K4G A;  5HHI A;  1ZQQ A;  4TQR A;  5HRI A;  3E2E A;  5KFA A;  4ELT A;  1HUO A;  4O3Q A;  8ICO A;  3M9O B;  3ORY A;  4BGD A;  3ISD A;  3AQM A;  2P6R A;  1UT8 A;  2PXI A;  1V4A A;  7ICI A;  4BXO B;  3PML A;  4P4O A;  4FHW A;  4YXJ A;  4O3P A;  4X5V A;  8ICW A;  4F5N A;  1SZP A;  1VJ7 A;  4F91 B;  4UB4 A;  1WCN A;  4NKU A;  4RUA A;  3PW4 A;  3QEA Z;  4UB2 A;  3UPQ A;  2ZH3 A;  1MQ2 A;  2DPJ A;  3C18 A;  1KTQ A;  4E80 A;  7ICF A;  4DLE A;  2JEJ A;  9ICX A;  3OVA A;  4F3O A;  3BJY A;  4B9T A;  5HNK A;  3G6Y A;  4DF4 A;  4RQ0 A;  4Q8E A;  2C2R A;  4UBB A;  2NRX A;  4UAY A;  4GXI A;  4EZ9 A;  3OSN A;  5III A;  4UAW A;  3PW2 A;  2FPL A;  3MR3 A;  1TFW A;  2PFQ A;  3OHB A;  3BQ1 A;  3M8S A;  2FLP A;  3M8R A;  5DGB A;  1SL0 A;  3THV A;  2PFN A;  4I27 A;  4ED1 A;  8ICN A;  1ZQY A;  5L1J A;  2DRA A;  4I2I A;  4YMN A;  4M2Y A;  4EEY A;  9ICV A;  1N48 A;  1U45 A;  2PI5 A;  4DQI A;  4PHE A;  4FBU A;  4RUC A;  4JWM A;  7ICG A;  2XY5 A;  2UVU A;  3G6X A;  2HHQ A;  5F2V O;  4X4S A;  3RJG A;  1JN3 A;  4BDP A;  5HRL A;  2I1Q A;  2MUT B;  4B9M A;  5KFM A;  1U49 A;  2J6S A;  3BDP A;  4J9O A;  1DOQ A;  5IIO A;  3UQ0 A;  5HHH A;  4KLT A;  4EBK A;  2J6U A;  8ICH A;  4PHD A;  1RYS A;  4G3I A;  4BWM A;  9ICK A;  1HUZ A;  2DR8 A;  4I2C A;  4ED2 A;  4F5P A;  1NK7 A;  1MIY A;  4P2H A;  1TFR A;  4YD1 A;  1DK2 A;  5JUM A;  2W9B B;  1NK9 A;  4KLH A;  4C8K A;  1D8Y A;  1U48 A;  5J2A A;  4DL3 A;  3H40 A;  3GFK B;  4TUR A;  3RBE A;  2W8L A;  5DLG A;  2RDJ A;  4I2B A;  1U9L A;  9ICL A;  5KTQ A;  3KHH A;  7ICQ A;  2MUT A;  1BGX T;  1L3S A;  5KFP A;  4R8U B;  4O5E A;  5DG9 A;  4JV1 A;  4RZR A;  2W9C B;  4NLG A;  4WC1 A;  4O9M A;  3ZDA A;  7ICL A;  2VA3 A;  1ZQE A;  2ISP A;  3JYY A;  1SL1 A;  4WBZ A;  2XCA A;  3N97 B;  4M9G A;  4PHA A;  4KIT B;  5L1K A;  4IQW A;  4C8N A;  2ZJ8 A;  4I2D A;  1Z3E B;  5J0U A;  1JXE A;  3PNC A;  4DQS A;  4DL4 A;  2ZTE A;  5KFR A;  5J0R A;  2AGO A;  4YMM A;  1ZQH A;  4Z6E A;  5DBA A;  3RJF A;  3H8J A;  1SKW A;  4I29 A;  4KLU A;  2VAN A;  3K75 D;  3ZDE A;  2ASJ A;  3HX0 A;  5BOM A;  2BKE A;  1TFY A;  5CJ7 A;  4YR2 A;  1ZQF A;  2BGW A;  5KFS A;  4PGQ A;  2OWO A;  3MFI A;  2ZH9 A;  4YP3 A;  4QWB A;  4QWE A;  2W9B A;  3ZDD A;  1NK8 A;  5HP4 A;  3Q8M A;  4Z6D A;  5J2B A;  4XA5 A;  5C5J A;  1SKS A;  1S76 D;  1X2I A;  4ECT A;  1C7Y A;  4WC3 A;  4O3S A;  5KT7 A;  2ZJ5 A;  1RXW A;  4B9N A;  1S77 D;  2KFN A;  4TUQ A;  7ICS A;  5HRE A;  1MIW A;  1TK5 A;  4TUS A;  1XC9 A;  4M5D A;  4DLG A;  1XWL A;  4PHP A;  3RTV A;  3T5J A;  1KFT A;  2JZB B;  1JIH A;  2ZUC A;  4LZD A;  4FBT A;  5KFT A;  2IBK A;  4FHY A;  4KLM A;  3UPS A;  3JPT A;  5CP2 A;  5KFW A;  3H4B A;  4YFK A;  3G6V A;  4F5O A;  4ECY A;  4DL5 A;  3B0Y A;  3JPP A;  3RRG A;  4KLG A;  3KHG A;  2KN7 A;  5J0W A;  5IIL A;  1KLN A;  2ZH5 A;  1TK0 A;  4RWP A;  4I2F A;  8ICZ A;  9ICW A;  3OSP A;  3C1Z A;  2Q0Z X;  4RQ5 A;  4DL7 A;  1JXL A;  2HHX A;  1OU5 A;  1ZQU A;  4QZE A;  3EYZ A;  3JPN A;  2XY6 A;  3AUO A;  4WC4 A;  1VFG A;  4R64 A;  2V9W A;  2W9M A;  3EZ5 A;  1S0M A;  4KN4 A;  1QSS A;  4KLJ A;  4ED8 A;  1B22 A;  5KFC A;  5KFX A;  4F50 A;  1QSL A;  4WC7 A;  2XC9 A;  1L3T A;  3V7J A;  1TAU A;  4YCX A;  3OUY B;  4ECS A;  3AQN A;  4WBY A;  3PX4 A;  1ZQT A;  5DG8 A;  5D4B A;  2M9N A;  5DB7 A;  5J0P A;  3GIM A;  3T3F A;  1KDH A;  4M9N A;  8ICY A;  8ICR A;  4UB3 A;  2F1H A;  2KZ3 A;  2XO7 A;  1ZQL A;  4DL6 A;  4ECZ A;  4X4R A;  5DLF A;  4NY8 A;  2H5X A;  2DVI A;  4NLN A;  4X4Q A;  3MAB A;  4F4X A;  5IIM A;  4M9L A;  2R8K A;  3OUY A;  5KG6 A;  1DK3 A;  3BQ0 A;  3TFS A;  4DQQ A;  1UA0 A;  2KZM A;  1TVA A;  3Q8Q B;  4DSL A;  4KLL A;  3MR2 A;  4JUZ A;  9ICF A;  3RR8 A;  5HRK A;  2ZHB A;  4IRC A;  4MFF A;  2KP7 A;  2IHN A;  3MBY A;  3T5H A;  4DSE A;  5DBC A;  8ICX A;  1KFS A;  2HVI A;  4FHP A;  2R8I A;  4JV2 A;  4C8M A;  3RB0 A;  4DSI A;  3WFP A;  2ZH1 A;  4QWA A;  2FMQ A;  4UD5 A;  4EBD A;  2BPF A;  2XCP A;  1ZET A;  2NRW A;  5D49 A;  2C22 A;  4Q8F A;  3RJJ A;  2NRT A;  3ZDB A;  1D9D A;  4O3N A;  1BPY A;  3C66 A;  8ICL A;  4QZG A;  1YLQ A;  1QSY A;  4F4W A;  3KHL A;  5DB8 A;  1TV9 A;  5BPC A;  2KZZ A;  1Q78 A;  1ZQX A;  2JZB A;  3T5L A;  5KFZ A;  1ZQO A;  4RPY A;  2R8J A;  3WFQ E;  3UXN A;  4QZI A;  4ED6 A;  1D9F A;  3H8W A;  1HJP A;  3ZD8 A;  4UAZ A;  2J6T A;  4IR1 A;  9ICT A;  1KSP A;  2ATL A;  4FH3 A;  1X9M A;  4MF8 A;  2NRZ A;  8ICE A;  1D8L A;  4JK1 A;  2BCR A;  5DDY A;  4EZ6 A;  5L1L A;  4XUS A;  5KG2 A;  1WOT A;  3BQT A;  2PBE A;  5KFQ A;  3PR5 B;  1ZQI A;  2KFZ A;  4LVS A;  4NLZ A;  3N4M B;  1ZQR A;  1PZN A;  8ICS A;  4EBE A;  5KFV A;  5J0T A;  4NM1 A;  2ZH7 A;  5DEC A;  4WC5 A;  4HYK A;  2M2V A;  2NRV A;  2ZTD A;  3ISB A;  2WTF A;  4DFK A;  3BQ2 A;  4J9Q A;  3TAQ A;  4F2S A;  3EW9 A;  4RPZ A;  3JPQ A;  1COO A;  2R8H A;  4M9J A;  2PI4 A;  9ICU A;  2DR5 A;  4XRH A;  1S0O A;  4IQV A;  7ICH A;  2AQ4 A;  4RQ1 A;  9ICE A;  3TQ1 A;  3MR6 A;  3ZD9 A;  3OHA A;  1NJY A;  9ICC A;  4UB5 A;  5J2J A;  3FDS A;  2KTQ A;  5J2H A;  2BR0 A;  5IIN A;  1SKR A;  3V7K A;  4R63 A;  1MQ3 A;  9ICP A;  3M9M B;  2W9C A;  2DR7 A;  1ZYQ A;  5KG1 A;  1ARO P;  2ID1 A;  1UEV A;  3FYH A;  3HJ1 A;  3RH4 A;  1JX4 A;  1KRP A;  4B9V A;  4X4O A;  3RJH A;  1ZQP A;  4S3N A;  5HRB A;  3OVS A;  3SYZ A;  4F93 B;  3PX6 A;  3SV3 A;  3IHQ B;  1LV5 A;  1ZQN A;  1BNO A;  2ZH6 A;  4KN7 A;  3TAP A;  3GIK A;  1UA1 A;  2PFP A;  2BE3 A;  4ECV A;  1T3N A;  4KLS A;  4RWQ A;  2V4Q A;  3MDC A;  4AT7 A;  3HW8 A;  1BPB A;  1NKE A;  4C8O A;  4DEZ A;  4IR9 A;  4TUP A;  4DFJ A;  8ICB A;  4QZD A;  8ICT A;  2W9A A;  2AJQ A;  3C5F A;  2ZJA A;  2JEI A;  3RB4 A;  4F2R A;  1NJX A;  2UVW A;  2FPM A;  3RRH A;  3TI0 A;  4M04 A;  8ICP A;  3C2K A;  1NJZ A;  3WFR E;  2Q66 A;  9ICM A;  4QWD A;  4F8R A;  2IMW P;  5EWG A;  2UVR A;  4I28 A;  4J9L A;  3H38 A;  1NKB A;  4Q45 A;  3RJI A;  4KLE A;  3MR5 A;  4YG2 A;  5J2C A;  4DQR A;  2BDP A;  3TFR A;  2JEF A;  5HRH A;  4J9P A;  1ZQZ A;  4RQ7 A;  2ISO A;  3Q8S B;  4TQS A;  3ZDC A;  2M2U A;  3MDA A;  7ICE A;  1T7P A;  4KLF A;  2O5A A;  3RB3 A;  5CHG A;  3TAN A;  3LQC B;  1NKC A;  8ICJ A;  7ICO A;  1UT5 A;  5KG0 A;  3RAX A;  1NK0 A;  3M9N B;  4FS1 A;  4F92 B;  3H7I A;  1S97 A;  1JQR A;  3OJU A;  4J9S A;  3HJ4 A;  1ZQD A;  4DS4 A;  5EOZ A;  4EYI B;  4O5K A;  4R8U A;  3EWA A;  5EWE A;  2P66 A;  1L3V A;  4QWC A;  3Q8P B;  7ICJ A;  7ICV A;  5J2G A;  1V9P A;  4ED3 A;  4I2G A;  4XQ7 A;  3PY8 A;  2RDI A;  4YR0 A;  5DDM A;  1Z00 A;  4M6W B;  5KFB A;  4YMO A;  1XSL A;  1TK8 A;  4QZH A;  9ICA A;  1RPL A;  4I2J A;  1QTM A;  1XU4 A;  5J2E A;  1NZP A;  4GXJ A;  2XGQ A;  1F5A A;  4EBJ A;  5J2D A;  4RT3 A;  4RQ4 A;  4AT9 A;  1A77 A;  4AT8 B;  3GIL A;  4ECX A;  4R66 A;  1S0V A;  4DOC A;  4XQ8 A;  2FLL A;  4RQ2 A;  4YN4 A;  4QZ9 A;  3MFH A;  3K4G A;  5CB1 A;  3RH6 A;  2XGP A;  4GC7 A;  1B43 A;  3GV8 B;  4KLO A;  4J9K A;  1XO1 A;  4ECR A;  2BQR A;  3H39 A;  3OVB A;  2BCV A;  4KMU A;  1ZQC A;  4PGX A;  3H3A A;  8ICG A;  1N56 A;  4MEX A;  3QEB Z;  4ELV A;  1XSN A;  2BCU A;  2BQ3 A;  4C8L A;  1K1Q A;  1BPZ A;  4ECU A;  3OJS A;  4F4Y A;  4X0B A;  2ZH8 A;  9ICJ A;  5F9L A;  3JPO A;  1L3U A;  5J0Y A;  2M2W A;  2ZHA A;  4GC6 A;  1MC8 A;  3GV5 B;  4ED7 A;  2FMP A;  5DGA A;  5KFI A;  1DGS A;  1XSP A;  1U47 A;  1R8C A;  5HC9 A;  4ECW A;  4MF2 A;  3C23 A;  1L5U A;  4Q44 A;  1ZJM A;  1KNY A;  3C5G A;  5DKW A;  5HRD A;  4AT9 B;  4QZC A;  5KFU A;  5J0Q A;  2BQU A;  2HHP A;  4RNM A;  3PMN A;  4O3R A;  4WC2 A;  4DFM A;  3AU2 A;  5TZV A;  3LWM A;  4B9L A;  4X4U A;  1TAQ A;  5KT4 A;  2A1J A;  1Z00 B;  4RNN A;  5KFE A;  3UQ2 A;  2GWS A;  4ELU A;  1EXN A;  2Y1J A;  2AGP A;  4K4H A;  2NRK A;  3OV7 A;  4WC6 A;  4M47 A;  1Y88 A;  5KFO A;  3PO5 A;  8ICC A;  2HHS A;  4F4K A;  4QZ8 A;  5HMM A;  5KG4 A;  5J0S A;  2HHT A;  4MEY A;  3GIJ A;  5CA7 A;  3RAQ A;  4BXO A;  3RBD A;  1K1S A;  2AQ0 A;  1BNP A;  7ICT A;  5L9X A;  3KTQ A;  4X4T A;  3AU6 A;  2ALZ A;  4O5C A;  5DQI A;  8ICU A;  3HPO A;  5DB9 A;  4UB1 A;  3HP6 A;  3H4D A;  4GLX A;  2DPI A;  4E0D A;  4CCH A;  8ICQ A;  8ICK A;  2C2E A;  4IG8 A;  5KG3 A;  1ZJN A;  2R8G A;  5DBB A;  1CEZ A;  2Y1I A;  4Z6C A;  3LWL A;  4F5R A;  4QZB A;  3B0X A;  3MGI A;  4I2E A;  3ETL A;  4O0I A;  3Q8R B;  4RWO A;  2RFF A;  2ZH2 A;  4F4Z A;  7ICM A;  2HHU A;  2DR9 A;  4X4N A;  1LB2 B;  1IXR A;  3T5K A;  3C1Y A;  4P4M A;  5DED A;  4RT2 A;  4DOA A;  1XS9 D;  4E8F A;  4FO6 A;  5KFH A;  1JMS A;  1UET A;  4RNO A;  1ZQG A;  5KT3 A;  3GDX A;  1BPE A;  1NJW A;  4RQ6 A;  3PW7 A;  4IQU A;  1NK5 A;  3PW0 A;  5DG7 A;  9ICO A;  4ECQ A;  1PX5 A;  3NTU A;  4K4I A;  1U4B A;  5J0X A;  9ICR A;  3NYB A;  3UXP A;  1S0N A;  3HWT A;  1CUK A;  4AT8 A;  1SL2 A;  2ASD A;  5IIJ A;  4O3O A;  4IRK A;  5IIK A;  2LYH A;  2O1P A;  4RWN A;  1S9F A;  4PGY A;  3TAR A;  3AQL A;  3WFO A;  4BWJ A;  3HT3 A;  3RH5 A;  4QZA A;  4M6W A;  2DFL A;  4ZH4 A;  9ICH A;  2ZTC A;  5BOL A;  4MFA A;  4JWN A;  2DRB A;  5J2F A;  8ICV A;  7ICN A;  9ICQ A;  4MFC A;  2ASL A;  1TKD A;  4EP7 A;  4FS2 A;  5J29 A;  3NGD A;  4J9R A;  1R8B A;  2I9G A;  4RQ3 A;  4DSF A;  4ATB B;  5KT6 A;  2V4R A;  5HR9 A;  1H38 A;  4M9H A;  5KFG A;  5DB6 A;  4IRD A;  4I2H A;  1RYR A;  1MSW D;  4YD2 A;  3PW5 A;  8ICA A;  4DL2 A;  4J9N A;  4PH5 A;  9ICB A;  1QLN A;  2F1I A;  2UVV A;  3H8S A;  4DWI A;  9ICN A;  2C28 A;  4I2A A;  3V7L A;  2W8K A;  3LDA A;  3PV8 A;  5F9N A;  4FH5 A;  4DO9 A;  2AGQ A;  4DF8 A;  4M0A A;  1ZQW A;  2BPG A;  1IM4 A;  2VA8 A;  4YR3 A;  4UBC A;  5J2I A;  4NLK A;  4X4V A;  1ZQV A;  3ISC A;  1R89 A;  4X4P A;  4RQ8 A;  7ICK A;  9ICS A;  3QZ8 A;  1R8A A;  4KLI A;  1NK4 A;  8ICM A;  2IHM A;  4WC0 A;  4QW8 A;  2B21 A;  3QE9 Y;  2ZH4 A;  5D46 A;  1A76 A;  8ICI A;  4QW9 A;  4AT7 B;  4Q43 A;  1ZQK A;  3EPG A;  4DSK A;  4DFP A;  2FMS A;  4DQP A;  1MIV A;  4YXM A;  1S10 A;  3PO4 A;  3KHR A;  4UD4 A;  4DOB A;  2FLN A;  1KFD A;  2HHW A;  4NXZ A;  3QZ7 A;  4LZG A;  2MAX A;  5HML A;  9ICG A;  1FA0 A;  1BVS A;  5DQG A;  2PFO A;  4NM2 A;  3JZ0 A;  5EWF A;  1KEJ A;  4EYH B;  4J9M A;  5KFL A;  5KT5 A;  1BPX A;  5KFY A;  5L1I A;  1RZT A;  1ZQM A;  4DS5 A;  4RPX A;  4X0A A;  3GV7 B;  1X9S A;  5KFJ A;  3JPR A;  2ZUD A;  5CWR A;  5KFN A;  4RU9 A;  3C21 A;  4UQG A;  3SV4 A;  4EBC A;  2M2T A;  2BHN A;  5KG5 A;  1Q79 A;  4JV0 A;  3SI8 A;  3PVX A;  5KFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...