4PHAA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phaA03
4PPXA 4NLGA 2RDJA 8ICJA 4DL5A 2V4QA 4EYIB 9ICGA 8ICSA 3H37A 3JPSA 5KFEA 3RJFA 8ICMA 5KG4A 5L1IA 4C8LA 2W9CA 5HMLA 1S77D 2P6RA 4EBCA 1PX5A 1SKSA 4WBYA 2ZTEA 4C8OA 1LV5A 3HX0A 4E7XA 1L3TA 2Q0ZX 4RUCA 3IM1A 5DB7A 1U49A 1KRPA 3ZDBA 5DKWA 2NRXA 3V7LA 4DL6A 4KTQA 8ICWA 1TFYA 5J0QA 3H8SA 4DQRA 4R8UA 2PI5A 2HHXA 1ZQVA 3RRGA 4UB4A 4GC6A 3FDSA 1ZQTA 8ICFA 3GIIA 3RJGA 4KLSA 2MAXA 8ICOA 3UXOA 4QZDA 3M9MB 3ZDEA 4DS4A 4GC7A 3PW7A 3M8RA 4J9RA 2PI4A 2ISPA 5KG3A 5L1LA 2JZBB 2FPMA 4TQRA 3PNCA 4ED1A 2ZHAA 4DSJA 5J2IA 3UPSA 4PGXA 1Y88A 4DL2A 2HHWA 4ECZA 4ED7A 2DPJA 4NXZA 3UQ2A 5KTQA 2PFOA 4ELVA 5DB9A 3H3AA 4RPXA 3MBYA 5J0XA 3RH4A 4O5CA 3PW4A 1PZNA 3C1ZA 4RQ6A 4WBZA 2XC9A 1NZPA 5J2DA 5HNKA 4E0DA 4AT9A 4I2CA 5KFHA 4XQ8A 1S97A 1KFTA 2FLPA 4WC0A 5KFWA 1V4AA 4KLJA 4ATBB 1D9FA 4BXOA 3C18A 3HJ4A 4UQGA 1KFDA 5KFYA 5J0OA 3Q8SB 2ZH7A 1R8CA 1NKEA 2HW3A 3C66A 2IBKA 3RAQA 2Y1IA 4DOAA 2AGPA 2LYHA 4F5OA 2ISOA 4IRCA 5KG1A 4DSFA 4DFKA 2I1QA 2KN7A 4JWMA 4KLIA 4P2HA 3JZ0A 2ZH5A 2W9MA 7ICOA 1S10A 2PFPA 3SV3A 2XGPA 4M9JA 4YQWA 4RWNA 3BDPA 1RXWA 4B9SA 5HRBA 4BGDA 3WFSC 9ICBA 3IHQB 5HMMA 2UVRA 1AROP 3OGUA 4M04A 4LZGA 3TARA 4DSIA 5HRIA 8ICQA 3HP6A 4DWIA 8ICAA 4RWOA 4RWQA 3EPIA 3GFKB 3AQKA 3NTUA 3ORYA 4JV2A 3G6YA 1L5UA 7ICHA 1EXNA 4AT7B 1KLNA 1RYSA 8ICEA 4CCHA 2WTFA 1K1QA 4Z6CA 5KFJA 3HW8A 3V7JA 4ED2A 3BJYA 4PHDA 3HJ1A 3V6KA 2DRBA 3GDXA 3PVXA 5F2VO 4WC7A 1ZQBA 1U47A 2KZMA 1ZQYA 2BGWA 3RJKA 5J2EA 4QWAA 2XCAA 1QSYA 1K1SA 4MFFA 5CJ7A 1Q79A 4EP7A 2C2RA 5BOLA 3AQNA 4RT3A 9ICJA 4J9MA 1DOQA 2BPCA 2W9BA 3RH6A 4M47A 1U4BA 2AJQA 5F9LA 3OHBA 3JPPA 1L3VA 4DQPA 3V72A 7ICVA 3C21A 3QE9Y 2NRWA 4I2IA 1ZYQA 4IQTA 4EZ9A 7ICMA 5DBBA 8ICKA 4I2JA 4M9GA 1S76D 2XY5A 1LB2B 4ED0A 1WCNA 4KLEA 4GLXA 3T5JA 4DLGA 5DG7A 4X4NA 4QZ9A 4GXIA 3H7IA 4NLKA 3RTVA 5KFUA 1U45A 4DSKA 3SZ2A 4WCWA 1KFSA 4ED8A 3GV8B 2R8GA 4B9NA 7ICSA 4F5NA 4IQWA 3JPQA 4UAZA 2KFNA 1TFWA 1KTQA 2M9NA 4KITB 7ICTA 8ICHA 5HRHA 4RZRA 2BQ3A 3PX0A 5F9NA 3OSPA 5KFQA 3LWLA 5IILA 1S9FA 2ZH9A 1TVAA 1JQRA 4WC3A 1SZPA 2FMQA 3QEAZ 3Q8RB 2M2WA 1D8YA 5HREA 4JK1A 1KEJA 5J2GA 3RB3A 1TK0A 3M9OB 2KFZA 5J2KA 2FLNA 8ICNA 1ZJNA 1UA1A 1Z00B 4M6WA 1ZQFA 5J2AA 1SL0A 1TKDA 4ELUA 5J0SA 1ZQGA 5HRDA 3AQLA 4PHAA 5DB8A 5KFVA 4EBEA 1MIWA 4IR9A 1JMSA 5DGBA 4X4UA 3JPRA 5KG7A 5DB6A 1XC9A 4YN4A 2J6TA 1NK7A 1R8BA 3GIKA 5HHIA 4YMNA 4YFKA 3ZDDA 2HHSA 4YXJA 3T3FA 3OUYB 1HUZA 3BQ0A 1SL2A 4F92B 5EWGA 1ZQZA 5CWRA 4J9SA 3C23A 4DFMA 3GIMA 2C2EA 3V7KA 1OU5A 5KT5A 4UD5A 2W8LA 1JXLA 1COOA 2BHNA 2BDPA 4F4KA 3K75D 2A1JA 2R8IA 4ED3A 3Q8LA 2P66A 1IM4A 5DEDA 3C2KA 1KSPA 3WFOA 1ZQMA 3WFRE 4F4XA 1X9SA 3C5GA 2BCSA 3ZDCA 3PW2A 1VFGA 3KHHA 3HWTA 1MSWD 2DR5A 5HRFA 4IQVA 1QTMA 2ALZA 3NGDA 3RJJA 8ICYA 9ICOA 5L9XA 2J6UA 3Q8PB 2FPKA 3GV7B 7ICGA 1WOTA 4DL4A 5KFGA 2JEFA 1ZQKA 2Y1JA 1NK4A 5J0WA 4ECSA 1A77A 5DG8A 4UD4A 3JPTA 5KFZA 4AT8A 4RQ2A 2RFFA 4FHPA 4QZIA 9ICHA 2M2VA 3RAXA 2DR7A 4UAWA 2BKEA 4RU9A 2AQ0A 1ZQXA 4RQ7A 4I2HA 4RNNA 4KLTA 4QW8A 2IHMA 4KLOA 5DDMA 1JX4A 1YLQA 1XSPA 3MR6A 2C28A 5KT2A 4QZHA 1VJ7A 1NKBA 4M9HA 3V6HA 2DFLA 3ZD9A 4MEYA 4I2FA 4DQIA 1HUOA 3AQMA 2NRVA 5CB1A 4MF8A 1NJYA 1NK8A 4BWJA 5J0PA 3QZ8A 8ICRA 2ZJAA 3PV8A 7ICEA 4DF8A 4ZH4A 4DO9A 4RPYA 1ZQDA 4M5DA 1Q78A 4QZEA 1ZQQA 3MABA 4R65A 4IR1A 8ICIA 2O1PA 3EW9A 4QZFA 4IQUA 2BPFA 2ASLA 3TAPA 5KFFA 4KLFA 1QLNA 1U48A 2NRKA 5DECA 2FMPA 1RYRA 2M2UA 3OJSA 5D49A 4R63A 3H8WA 5KFIA 2ZH1A 5J0UA 5KFKA 3ETLA 4FH5A 5HRLA 3JPOA 3PO5A 3OJUA 9ICXA 5IINA 3BQ2A 4DSEA 3RJHA 1NOMA 1XU4A 4DF4A 2XY6A 1QSLA 2OWOA 4FH3A 4M9LA 3N4MB 2C22A 3UPQA 4Z6FA 5KFXA 4QZCA 4B9VA 3MR3A 5KT3A 5KFLA 3UQ0A 3SI8A 4RQ0A 4C8NA 4DS5A 4YD1A 1NK0A 4M0AA 3RBDA 2ASJA 4FHWA 1NK5A 4B9TA 4RUAA 4ECQA 4EBJA 4EBDA 2IHNA 9ICSA 1ZQEA 2GWSA 2DRAA 1HJPA 4YD2A 4X4TA 3EPGA 1ZETA 5KFTA 1ZQLA 4WC2A 4MFCA 4ECRA 3MR5A 1ZQOA 4DOBA 4Q45A 4I2GA 3OVSA 2NRZA 2FPLA 4DL3A 4O3OA 5DQGA 4NKTA 7ICLA 1BPXA 4YP3A 1BPDA 3HT3A 3OV7A 4EYHB 4O5KA 1ZQJA 4YR2A 4IRKA 1XS9D 9ICMA 4JV0A 5J2JA 9ICPA 2B21A 4NKUA 5L1JA 1TAQA 2MUTB 5KFCA 2R8KA 4I29A 1X2IA 4IRDA 1ZJMA 5KT6A 2XGQA 4PH5A 1TAUA 4QZAA 5D46A 2JZBA 1XSNA 4KLQA 3NYBA 3RRHA 3KTQA 8ICLA 1NO5A 2VA3A 1DK2A 3MGIA 1JN3A 1KDHA 4Q44A 1BGXT 4XRHA 4R8UB 4R66A 4QZBA 2P6UA 9ICQA 2ZH2A 4YCXA 3Q8QB 3QZ7A 8ICUA 1UT5A 4QZGA 1UEVA 1D8LA 4S3NA 2W9AA 4NLNA 5KFPA 8ICTA 2ZH8A 4X4PA 5KFAA 1IXRA 3RJEA 4JUZA 1XSLA 2V9WA 1JIHA 4Z6DA 4O5EA 2HHVA 2I9GA 4ATBA 3OVAA 2BCUA 2ZUCA 4TQSA 1Z3EB 5BPCA 4F5RA 5HP4A 4YVZA 5DG9A 3C2MA 3PX4A 4DOCA 5CHGA 4UB5A 1UETA 1A76A 2XO7A 4LZDA 3PW5A 5BOMA 5EWFA 4O3PA 5CR0A 4B9UA 2BE3A 4DSLA 5HC9A 4P4OA 4FBUA 5KFDA 2W8KA 4Q43A 3MFHA 4YG2A 3RH5A 9ICFA 1B43A 5IIIA 4AT9B 4XA5A 4KLHA 4FBTA 3H40A 5J0YA 2JEGA 1U9LA 4XUSA 4F4WA 4TUQA 3EWAA 1UA0A 3C5FA 4DFJA 4BXOB 5DQHA 2V4RA 1ZQNA 3H38A 4NLZA 4C8KA 3BQTA 5CA7A 4I2EA 3OVBA 4P4PA 1BPZA 4KMUA 2VANA 3UXNA 4P4MA 4ECVA 4KLUA 3H8JA 2AU0A 4KLDA 4YR0A 4E80A 4KLLA 4J9PA 5KG5A 5JUMA 5DBAA 4FHXA 3ISDA 5KFSA 1S0NA 1ZQPA 4F93B 9ICLA 4AT7A 4RQ5A 3SV4A 1T3NA 4YMMA 2J6SA 2DPIA 4FO6A 1L3UA 2R8JA 4PGYA 3KHLA 3G6XA 4DL7A 2HHTA 9ICIA 3EYZA 3PMLA 3THVA 3Q8MA 2UVUA 2BCQA 5IIMA 4KLGA 4WC6A 3N97B 4K4IA 4EBKA 4I2AA 5J2BA 5CP2A 5C5JA 4I2DA 4O3SA 2BQRA 1XO1A 5KFMA 1NK6A 1JXEA 4QWEA 4WC5A 4UAYA 2ZTDA 5J2HA 5J29A 4RPZA 4QW9A 9ICCA 4DEZA 3ZDAA 9ICNA 3TFRA 7ICIA 8ICVA 3H4BA 7ICRA 1ZQWA 2F1IA 4YR3A 3B0YA 2HHUA 2F1HA 3MFIA 1ZQHA 2MUTA 4F91B 2IA6A 3C2LA 3UXPA 3PR4A 3AU6A 1NJXA 4FS1A 4E8FA 3L9DA 2H5XA 4Z6EA 2ZJ8A 3MDCA 2W9BB 3TQ1A 1C7YA 2BCVA 3OSNA 4ECUA 1V9PA 3RR7A 2R8HA 1X9WA 7ICQA 4RQ3A 3TFSA 4O9MA 4I2BA 1TFRA 3E2EA 3PX6A 3RB6A 4FHVA 2AGQA 4M9NA 4X4SA 2C2DA 2FLLA 1ZQSA 8ICZA 5L1KA 4RQ8A 5HHHA 1T8EA 1QSSA 4G3IA 4UB1A 4WC4A 1BVSA 4X5VA 3ZD8A 5D4BA 1L3SA 4K4HA 2ZHBA 4RQ1A 1BPEA 2BPGA 4DQSA 4F2SA 1R8AA 2PBEA 2KZZA 4UBCA 4C8MA 3LK9A 4DLEA 3T5LA 3H39A 1CEZA 9ICRA 2ZUDA 5IIKA 2BCRA 4JWNA 3EZ5A 1Z00A 5DLGA 4J9OA 5KG2A 5KFBA 4ED6A 1T7PA 3K4GA 4F8RA 1D9DA 1FA0A 5KFOA 4BWMA 4BDPA 4O3RA 3RJIA 2BQUA 4O3NA 4ECTA 3RB4A 1TV9A 1NJWA 5HR9A 2HHPA 4YMOA 2AQ4A 4IG8A 1BNPA 4FS2A 3PMNA 3HIYA 3T5HA 2ZH4A 5KFRA 7ICJA 4QWCA 3OUYA 4B9MA 4M6WB 1MQ2A 1ZQCA 4GXKA 1ZQAA 5DLFA 1BPYA 4X0AA 3FYHA 4UB2A 2XCPA 2VA8A 1TK5A 2HVIA 1T4GA 2KTQA 8ICXA 1KNYA 4EEYA 4NM2A 2VA2A 7ICUA 9ICEA 3JYYA 9ICAA 4M2YA 1UEUA 4DFPA 4TUPA 2XY7A 4ECXA 1SKRA 4KLMA 2IMWP 4FHYA 3TI0A 5DQIA 4J9NA 4J9QA 8ICPA 3WFQE 5DBCA 4UB3A 4TUSA 4F4YA 2ASDA 4JV1A 3TAQA 4MF2A 9ICUA 4Q8FA 2W9CB 4HYKA 1DGSA 5KT7A 3TANA 2A1JB 4WC1A 4RWPA 4KN7A 3OHAA 3MDAA 4RNOA 4F50A 1MQ3A 4UBBA 7ICKA 1SKWA 4PHPA 3SYZA 2F1JA 1R89A 3GILA 4B9LA 5KT4A 4RQ4A 1SL1A 1BNOA 2Q66A 9ICKA 4X4VA 3GV5B 2ZTCA 5IIOA 1MIYA 4RNMA 2ID1A 3WFPA 3AUOA 4GXJA 2DR9A 2NRTA 1ZQRA 1MC8A 4XQ7A 4X4OA 3KHGA 4AT8B 3T5KA 1X9MA 4LVSA 4YXMA 1BPBA 1RZTA 4PHEA 2PFQA 1N56A 2DVIA 1S0MA 4J9KA 4MEXA 2FMSA 2PFNA 4QWDA 1UT8A 1H38A 2UVWA 2KP7A 8ICCA 3PO4A 1NK9A 1NJZA 3M9NB 3Q8KA 2BR0A 8ICGA 3MGHA 4X4QA 4X0BA 3RB0A 1XWLA 3PR5B 2AGOA 7ICNA 3LWMA 3MR2A 4Q8EA 3ISBA 2JEJA 1JAJA 5J2FA 1ZQUA 2PXIA 3PW0A 4K4GA 5TZVA 5HRKA 2ZUBA 3RR8A 4I28A 4R64A 4J9LA 3ISCA 2M2TA 4ECYA 1ZQIA 4F4ZA 4I27A 4MFAA 4KN4A 1WCLA 4PGQA 3HPOA 8ICBA 3G6VA 5KFNA 4TURA 3BQ1A 5DGAA 1B22A 4F5QA 4LT6A 3GQCA 5DDYA 3V6JA 1S0VA 2HHQA 7ICPA 5HRGA 1N48A 4EZ6A 3B0XA 4RT2A 5KG6A 3M8SA 1CUKA 2JEIA 9ICTA 4O3QA 2HVHA 1DK3A 1RXVA 4ELTA 3LDAA 1MIVA 3GIJA 1TK8A 4DQQA 5KG0A 5J0RA 4X4RA 4F2RA 3AU2A 2ZH3A 1F5AA 3KHRA 3C1YA 4QZ8A 2ZJ5A 2RDIA 2KZ3A 3LQCB 3H4DA 2ATLA 2O5AA 2UVVA 4ECWA 1NKCA 1S0OA 4QWBA 3PY8A 4F3OA 4NM1A 9ICVA 4F5PA 7ICFA 5EWEA 5J0TA 5J2CA 3RBEA 2ZH6A 3JPNA 2DR8A 9ICWA 5IIJA 1RPLA 4O0IA 5EOZA 4NY8A 3QEBZ
chains in the Genus database with same CATH superfamily
2B51A 8ICJA 4EYIB 2Y9UA 8ICSA 3H37A 4UB8U 5KFEA 5L1IA 2YMMA 2YQEA 1HIWA 1RDFA 3V7LA 2KICA 1TFYA 5J0QA 4R8UA 2PI5A 2HHXA 3FDSA 8ICFA 3IV6A 1S5LU 2MA1A 4KLSA 2MAXA 4J9RA 5ALFA 2FPMA 1JROA 2YY6A 4DSJA 4EGWA 1Y88A 4DL2A 4NXZA 3UQ2A 5KTQA 3ETRA 3RH4A 3MBYA 4O5CA 3L5KA 4WBZA 5J2DA 2ZG6A 1ED1A 1S97A 2FLPA 5KFWA 1SZHA 4KLJA 3Q8SB 2ZH7A 1R8CA 2Y0SF 3C66A 1OW5A 4DOAA 2IHOA 4J03A 4B6JA 1QH9A 4P2HA 2ZH5A 4OAHA 7ICOA 1S10A 3SV3A 3BDPA 1RXWA 9ICBA 3IHQB 5HMMA 2UVRA 3OGUA 4LZGA 3TARA 8ICQA 3WKAA 3KKAC 1L8OA 1FEZA 2JH1A 7ICHA 2HBKA 5AM5A 1KLNA 3AL0B 8ICEA 2WTFA 4EEBA 4ED2A 3HJ1A 3PVXA 2JGAA 4WC7A 3D2NA 2KNJA 2AH5A 3NKUA 3BQ7A 5B5EU 1U4BA 3OHBA 3JPPA 4I2IA 1ZYQA 4OO1J 5JRTA 4DLGA 4X4NA 4GXIA 5KFUA 4ED8A 3GV8B 4B9NA 5JTGA 2KFNA 1KTQA 2K8CB 3PSTA 5AM2A 3WKBA 3OSPA 3B9JA 3LWLA 1S9FA 4CRXA 1JQRA 4WC3A 3Q8RB 4HAIA 1D8YA 4JK1A 1MA7A 5AIAA 1ZJNA 1UA1A 3SMVA 4NXWA 5J0SA 3J81j 4EBEA 3N7PD 1MIWA 1XC9A 1B0XA 4FFDA 5HHIA 4YFKA 3ZDDA 4YXJA 4CNQA 1HUZA 1SL2A 5CWRA 3C23A 3GIMA 2W8LA 1COOA 4LJXA 2EANA 4ED3A 5DEDA 1KSPA 3WFRE 1J2MA 1ZQMA 3ZDCA 5HRFA 4IQVA 3H0MB 5L9XA 3Q8PB 2FPKA 1WOTA 5KFGA 1ZQKA 5DG8A 1IIPA 1L8LA 3JPTA 4QZIA 4KB6A 3RAXA 2M2WA 2AQ0A 2P35A 4QW8A 2IHMA 1K5OA 1VJ7A 4QZHA 3ZD9A 4MEYA 4KM5A 5HR7A 1QQ6A 2I6XA 1Q3VA 4DQIA 1OUQA 1NJYA 8ICRA 3QZ8A 2GA9D 3BS5A 7ICEA 5ALOA 1PUZA 4IQUA 2BPFA 3S6JA 5KL8B 5DECA 1U48A 3OJSA 3E0FA 3H8WA 3A0HU 5HRLA 3JPOA 3BQ2A 4KMOB 1NOMA 1XU4A 2OH2A 2AHOB 2JHDA 5CFUA 3UPQA 4Z6FA 3QXGA 2OM6A 3SI8A 4YD1A 1NK0A 4FHWA 2G08A 4F72A 4B9TA 3ZI4A 2IHNA 2GWSA 2IOFA 4MFCA 2FI1A 4ECRA 4Q45A 1SV0A 1BPXA 4YP3A 5CRXA 9ICPA 5ALKA 4I29A 2R8KA 2QARA 4IRDA 5D46A 1X40A 2CXYA 1C20A 2F3NA 1DK2A 1JN3A 3AM9A 2ZH2A 4Y2VA 4YCXA 3QZ7A 1UEVA 2EZXA 5KFPA 3VCBA 5KFAA 1IXRA 2V9WA 4O5EA 1JIHA 4Z6DA 2I9GA 3OVAA 5HP4A 4YVZA 5DG9A 4UB5A 1F44A 3PW5A 4LZDA 2E1FA 4O3PA 5CR0A 2KJ5A 4DSLA 2W8KA 9ICFA 4AT9B 2JEGA 5J0YA 1U9LA 2BDUA 2O6KA 4F4WA 2DKZA 2XICA 5CA7A 2WB1F 4I2EA 4K8VA 4P4PA 1V38A 2K4EA 2VANA 3H8JA 2G5HB 1GO3F 4J9PA 3VC8A 2KVCA 9ICLA 4F93B 4OCZA 3SV4A 1T3NA 4YMMA 1N2XA 2DPIA 2R8JA 3G6XA 3EYZA 2G06A 2WB1C 4KLGA 1TAMA 2E8OA 3QU5A 2JXJA 5ALSA 5J2BA 5CP2A 2KG5A 4I2DA 1NK6A 4WC5A 1LKYA 2ZTDA 9ICNA 7ICIA 1ZQWA 2F1IA 4YR3A 2YMQA 2F1HA 4FS1A 1KW4A 4Z6EA 3TQ1A 4NV0A 3KZIU 1X9WA 3PX6A 4X4SA 4C80A 2YTUA 1PVRA 2FLLA 8ICZA 5L1KA 5HHHA 3UM9A 4G3IA 1ZD2P 2ZHBA 3WK8A 3I76A 2D6FC 4DLEA 4CF5A 9ICRA 5IIKA 3UMBA 1MN8A 2H3ZA 2EAOA 5KFOA 2LPEA 4BDPA 2KV2A 1PK1A 4O3NA 4ECTA 2HOQA 3HKZC 2HSZA 5ALVA 3T5HA 4ZOHC 2H3FA 1ZQAA 3LVVA 1RQLA 1Z1VA 1T4GA 2KTQA 1KNYA 4EEYA 5FP0A 4NM2A 5ALYA 2H3QA 1ZD3A 4TUPA 3FAHA 3M6KA 1SV0C 2IMWP 8ICPA 3WFQE 4KX3A 4CF3A 4TUSA 4Q8FA 1DGSA 5KT7A 4RWPA 4KN7A 1Z19A 5EE9A 1MQ3A 1N5XA 3NS1A 2F1JA 2GLEA 2N1RA 1BNOA 9ICKA 4OJ5A 1MIYA 1ZQRA 1MC8A 4X4OA 4AT8B 1X9MA 4YXMA 2YB4A 2FMSA 8ICCA 4X4QA 3RB0A 1XWLA 2AGOA 3ERCC 1JAJA 5HRKA 1ZD4A 3AQFA 4J9LA 1ZQIA 4F4ZA 3U26A 4I27A 4KN4A 4PGQA 3HPOA 3BQ1A 1B22A 3SR6A 2IOHA 4RT2A 5KG6A 5KNIA 4RQNA 4ELTA 3LDAA 2HCFA 5J0RA 1S8OA 1L7MA 4QZ8A 3EF2A 4EELA 1NKCA 4QWBA 3QUTA 2E5SA 5EWEA 4C4RA 2ZH6A 5IIJA 4NY8A 3QEBZ 3AQMA 3L4PA 3KD3A 8ICMA 4MKPA 1N62A 1SKSA 2ZTEA 3HX0A 4RUCA 1KRPA 4KTQA 3H8SA 3SAFA 3RRGA 3GIIA 3IP4B 3HRDD 2LYAA 3PW7A 2CPRA 2OEHA 2PI4A 2ISPA 2JZBB 2ZHAA 4PGXA 4OAFA 4ED7A 3H3AA 3MCRA 5J0XA 3K1RB 3PW4A 1PZNA 3C1ZA 2K8BB 2XC9A 2A3VA 4GFJA 5AK3A 5HNKA 1WWUA 4IL6U 2B6GA 3C18A 2ZIWB 1KFDA 5KFYA 2VKQA 5G5HA 4O68A 2ISOA 4F5OA 5AICA 2KN7A 4KLIA 2QLTA 2W9MA 3WU2U 3WFSC 5HRBA 5ALRA 5HRIA 1AROP 4DSIA 4P0PB 3QYPA 5C0YA 2KE7A 3AQKA 3NTUA 5ALQA 4JV2A 3G6YA 1L5UA 4P0QA 4CCHA 3BJYA 2QB0A 1U47A 3NRWA 2BGWA 3RJKA 4MFFA 1Q79A 2C2RA 5BOLA 4RT3A 9ICJA 1DOQA 2BPCA 3RH6A 5AKEA 4M47A 1JALA 3IDWA 2I5HA 1ZQ1C 1ZOLA 2NRWA 2RLTA 4EZ9A 5DBBA 4I2JA 1WWVA 1S76D 2XY5A 4ED0A 1WCNA 3UMGA 1YT3A 3T5JA 4QZ9A 4O6AA 4OAGA 4EV6A 1X9XA 3IN5A 4F5NA 4IQWA 4WQLA 2M9NA 4KITB 5HRHA 2E3TA 3PX0A 2ZH9A 4LEVA 3BS7A 2ZIWA 5HREA 1KEJA 3M9OB 5J2KA 2ZIXB 4ELUA 5HRDA 4PHAA 5DB8A 3WKEA 5AKJA 4X4UA 2EZZA 5KG7A 5DB6A 3JPRA 2J6TA 1NK7A 1R8BA 3GIKA 4A8EA 4YMNA 3T3FA 2LYBA 2C2EA 3PSIA 1V97A 4AP9A 4K96A 1FFUA 2BHNA 1QQ5A 2A1JA 3Q8LA 4ACOA 2P66A 1IM4A 3C2KA 2WF8A 1VFGA 4Y2RA 3KHHA 8ICYA 5AHXA 2J6UA 1L7PA 2QB1A 3D2SA 1T3QA 1ZRMA 5J0WA 3N28A 1A77A 4ECSA 4FHPA 2M2VA 2XI9A 4UAWA 4RU9A 1ZQXA 5DDMA 1L7NA 3LYSA 1NKBA 2DFLA 1NNLA 3QU2A 2NRVA 4MF8A 4DO9A 4I0UA 3QU4A 1RG6A 4QZEA 1ZQQA 3MABA 4QZFA 3IG8A 2AXTU 2ASLA 1QLNA 2FMPA 5D49A 5KFIA 5J0UA 4FH5A 3ETLA 2W03A 9ICXA 4FZLA 4DSEA 4DF4A 1DGJA 4FH3A 1J97A 5AK6A 4QZCA 3NASA 5KT3A 2ASJA 1NK5A 4EBDA 5H2FU 4YD2A 2LI6A 5KFTA 1ZQLA 4DOBA 3OVSA 3WK7A 4O3MA 2ZIUB 5ALPA 4O3OA 5DQGA 4NKTA 4EYHB 1ZQJA 2JV3A 4JV0A 5B3QA 2KD1A 2MUTB 1ZJMA 5AKZA 4PH5A 3NYBA 3KTQA 8ICLA 2RQ5A 5AKGA 4Q44A 1BGXT 2F77X 3NVVA 4NWIA 4XRHA 2P6UA 4R66A 3Q8QB 1UT5A 1ZRNA 2W9AA 8ICTA 4JUZA 5AI0A 3KBBA 1UCVA 2HOIA 4DOCA 1A76A 4B9UA 2BE3A 4K9BA 1YZ6A 5BOMA 4WQKA 4FBUA 5KFDA 3MFHA 1B43A 4XA5A 3H40A 4XUSA 1VLBA 3EWAA 3C5FA 4DFJA 4BXOB 4NLZA 4CGZA 4C8KA 3AQEA 1BPZA 4KMUA 4ECVA 4P4MA 4E80A 2LMRA 4C4TA 3OTQA 5KFSA 1S0NA 2J6SA 4PGYA 5JU5A 2BZFA 2BCQA 3N97B 4EBKA 2EAMA 1XO1A 5J29A 4NXUA 3ZDAA 3TFRA 3H4BA 7ICRA 4BUGA 3B0YA 2HHUA 1B4FA 4Y2UA 2MUTA 2KHVA 2IA6A 3C2LA 3UXPA 4O67A 2H5XA 2W43A 3MDCA 2W9BB 4Y2TA 3DV9A 2R8HA 3TADA 3TFSA 4I2BA 3RB6A 4M9NA 1Q3UA 1COKA 4UB1A 4K4HA 1L3SA 1IG6A 2PBEA 1T94A 5DLGA 3K4GA 5ALLA 4Y2QA 4O3RA 2BQUA 1TV9A 1NJWA 2BBHA 4YMOA 4FS2A 2KJ9A 2KMDA 7ICJA 4QWCA 1PVQA 2OHFA 5EE3A 2JR5A 4M6WB 5DLFA 2K89A 2XCPA 1PVPA 3A0BU 3RFAA 5AIBA 2VA2A 3FM9A 1UEUA 4DFPA 5AI4A 4ECXA 4KLMA 4OD0A 4WOYA 4UB3A 5ALEA 4F4YA 2ASDA 9ICUA 1ZXIA 2EH9A 3TAQA 1O03A 2W9CB 3D2QA 4RNOA 4F50A 2PMZC 4UARA 4JLZA 1R89A 3GILA 5ALIA 4X4VA 2DL0A 3GV5B 3WKDA 2ID1A 4GXJA 2NRTA 4XQ7A 4K98A 3T5KA 1BPBA 2PFQA 1RQNA 4J9KA 2F8KA 1H38A 2EWRA 2WF5A 1FFVA 5AKIA 4OJLA 3Q8KA 2BR0A 8ICGA 1X6JA 2G5IB 3ISBA 4ICAA 2JEJA 5J2FA 2ZH4A 3PW0A 3NVOA 3RR8A 4K97A 5F3XB 5D63A 3LVWA 4TURA 1Z1BA 4F5QA 5DDYA 7ICPA 2BBJA 3F2CA 4OJPA 2JEIA 2EQYA 9ICTA 4O3QA 3N7RC 4NXVA 1MIVA 5AM4A 3GIJA 2FE9A 3FC4A 4F2RA 3C1YA 3LQCB 2RDIA 4NLCA 2EDUA 2YN4A 3QU7A 2O5AA 3QX7A 4ECWA 2UVVA 4F3OA 2MU2A 3JCFA 7ICFA 1UHUA 3JPNA 1RPLA 4O0IA 4PPXA 4PZNA 4DL5A 2V4QA 3ER8C 3RJFA 5KG4A 1X42A 4C8LA 2W9CA 1S77D 1F5SA 1WUDA 1LV5A 3TKAA 3IM1A 5DB7A 1U49A 3ZDBA 4FE3A 4DL6A 1SXDA 8ICWA 5AI8A 4FZMA 4GC6A 3NRZA 8ICOA 3UXOA 3TADC 1M6YA 2YX8A 3M8RA 5L1LA 4TQRA 3PNCA 3HKZF 2NV3A 3UPSA 4ECZA 2PFOA 5DB9A 1NZPA 1L6NA 4AT9A 5KFHA 4RQMA 2CRXA 4WJ3B 1KFTA 1V4AA 4ATBB 1D9FA 4UQGA 4NXTA 2HW3A 4IRCA 3RAQA 2Y1IA 5KG1A 4DFKA 2I1QA 2ZXHA 2DBYA 1LVHA 4M9JA 2FDRA 4BGDA 1SB3C 2DR8A 2WF6A 2LHTA 4Y2PA 8ICAA 4DWIA 4RWOA 3EPIA 4AT7B 1RYSA 2LBOA 4PHDA 2DRBA 3V6KA 3GDXA 3T79A 1ZQBA 5J2EA 5AKYA 5CJ7A 4J9MA 2AJQA 5D62A 1L3VA 3V72A 2A19A 3C21A 3QE9Y 4M9GA 5ALXA 5KAIU 3H7IA 5AK5A 3RTVA 3SQIA 1KFSA 2DKXA 7ICSA 2XIDA 3JPQA 4UAZA 1TFWA 4RZRA 2BQ3A 4PL1A 5IILA 2HN2A 2NYVA 3QNMA 3QEAZ 1D8BA 3RB3A 1YZ7A 1TK0A 2KFZA 3KFUF 2HOFA 1Z00B 3QUBA 5J2AA 3CK6A 1ZQGA 4IR9A 1JMSA 2K4HA 5CFTA 3OUYB 4HX0A 1ZQZA 4J9SA 4LEZA 2ZIVB 4UASA 5KT5A 1JXLA 2BDPA 3K75D 2R8IA 4KX5A 2LM4A 1X9SA 2BCSA 5CHEA 2DR5A 3NVYA 4NLBA 3ER9B 2ALZA 3NGDA 2KKPA 5T14A 3PHZA 4EENA 7ICGA 1NK4A 4AT8A 5KFZA 4PJ0U 4RQ2A 9ICHA 5ALJA 2DF4B 4QNLA 3MR6A 2C28A 5KT2A 1IV8A 5HR6A 1HUOA 2ODGA 3PV8A 4DF8A 2E8PA 3PZPA 4M5DA 1JI7A 1Q78A 2HDOA 2O1PA 8ICIA 3EW9A 1NI3A 5KFFA 4KLFA 2NRKA 2M2UA 4U6PA 4R63A 2GO7A 4DFDA 3OJUA 2FCLA 1QSLA 2OWOA 3SAHA 4C7YA 2C22A 5CFSA 5KFXA 3ONNA 4EEDA 4RQ0A 4C8NA 4DS5A 2HN1A 5AM0A 4M0AA 2L5YA 3PSFA 2KSOB 4RUAA 5EE0A 4ECQA 5AI6A 1ZQEA 3EPGA 1ZETA 2KOBA 1ZQOA 4I2GA 2NRZA 2FPLA 5AI9A 7ICLA 2K4IA 1BPDA 4NJ8A 2MSNA 9ICMA 5J2JA 4AYBC 4NKUA 5L1JA 1TAQA 2R18A 2ES6A 4QZAA 1XSNA 2JZBA 2KJ8A 2HBMA 2NO5A 4KLQA 1O08A 5L1MA 3RRHA 2VA3A 3MGIA 4R8UB 5E79U 8ICUA 1UQVA 4QZGA 2H3VA 4NLNA 4US8A 4X4PA 4O69A 3RF9A 3RJEA 1XSLA 2M0NA 2HHVA 2WF9A 2ZUCA 4TQSA 5BPCA 3PX4A 1SV4A 2XO7A 4Q43A 2E8NA 4FBTA 2MRLA 5DQHA 1ZQNA 2LM1A 4P0PA 3OVBA 1JRPA 4US9A 1NZBA 4KLDA 4YR0A 4KLLA 4FHXA 4UB6U 3H8MA 5ALMA 4FO6A 1L3UA 2DQNB 3KHLA 1N5WA 4DL7A 9ICIA 4LEWA 4DCCA 3OPXA 3Q8MA 1L7OA 4K4IA 5B3PA 4I2AA 3CYMA 3ED5A 5C5JA 4O3SA 2BQRA 5KFMA 1JXEA 4UAYA 2VIXA 4QW9A 9ICCA 1JUDA 8ICVA 3CP8A 1FO4A 2F76X 1GPJA 3WK5A 4F91B 3PR4A 1NJXA 1Z4NA 4E8FA 1WG8A 2ZJ8A 4F71A 4Y2XA 1C7YA 3OSNA 4ECUA 1V9PA 3RR7A 4N7RA 7ICQA 2K8AA 4RQ3A 4O9MA 3E2EA 3KOOA 2AGQA 3NUQA 3SEIA 5J8YA 2C2DA 1ZQSA 4CDGA 2Q4TA 4RQ8A 1XO0A 2KK0A 2W04A 3ZD8A 1A0PA 1BPEA 4RQ1A 4DQSA 4F2SA 5TISU 4C0ZA 1R8AA 3H0LB 2E8MA 2KZZA 4C8MA 3LK9A 2B56A 3H39A 1CEZA 1SGGA 2ZUDA 4J9OA 2ESEA 5KG2A 1T7PA 1D9DA 3I1YA 2G07A 2ZIXA 4BWMA 5HR9A 2HHPA 5CEHA 2W3RA 3HIYA 5KFRA 5K4LA 4B9MA 4GIBA 1ZD5A 1CRXA 3FYHA 1V85A 2VA8A 1TK5A 2HVIA 8ICXA 5AI5A 2GH1A 3QUCA 3DEEA 5JTIA 3KZXA 2PKEA 2YMPA 2OXOA 2Y0SC 4M2YA 2XY7A 1SKRA 1WYGA 2DWQA 4JLXA 4FHYA 3M7DA 4J9NA 5DBCA 4JV1A 3BZCA 4HYKA 5AM1A 2F2AB 5ALDA 3MDAA 4UBBA 2OCEA 3SAGA 7ICKA 4PHPA 3SYZA 3L3FX 4B9LA 2Q66A 5KT4A 4RQ4A 1SL1A 1SWVA 4QIWF 5IIOA 4RNMA 3SENA 3WFPA 1QQ7A 3KHGA 4LVSA 1VJ5A 4PHEA 2DVIA 2PFNA 4MEXA 4QWDA 2UVWA 1XNSA 2JRZA 1NJZA 4QIWC 3M9NB 5ALGA 4X0BA 1KN5A 3AEVA 3MR2A 3NVZA 4PL2A 1ZQUA 4I28A 3BS5B 3ISCA 1WCLA 2VJ5A 3WK4A 4LT6A 3GQCA 2VJ4A 2HHQA 5AKLA 1KKXA 4EZ6A 3M8SA 1CUKA 1DK3A 1RXVA 4NL9A 2HBJA 1TK8A 4DQQA 2ZH3A 3AU2A 3I28A 4CF4A 1F5AA 2ZJ5A 3ALRA 2KZ3A 5AKXA 9ICVA 4F5PA 1X66A 2ZIUA 3WK9A 4NLGA 2RDJA 9ICGA 2IUBA 3H0RB 3SD7A 2K60A 3JPSA 5HMLA 3NWIA 2P6RA 4EBCA 1PX5A 4WBYA 1Q8KA 1RM6C 4C8OA 4E7XA 1L3TA 2Q0ZX 1X6IA 5DKWA 2NRXA 2LKYA 4DQRA 1ZQVA 4UB4A 1ZQTA 3GZFA 3RJGA 4QZDA 3M9MB 2QARB 3ZDEA 4DS4A 4GC7A 5KG3A 3QUQA 4ED1A 5J2IA 5J8YC 2HHWA 2DPJA 4ELVA 4Y2JA 4UW9A 4RPXA 4OJ6A 1N60A 4RQ6A 2HBLA 4E0DA 4K9AA 4I2CA 4XQ8A 4WC0A 5EE1A 2A1AA 4BXOA 3HJ4A 2W3SA 5J0OA 5GTHU 1NKEA 2IBKA 2AGPA 2LYHA 3C29A 2QKQA 4DSFA 2EAPA 2WFAA 4JWMA 3JZ0A 4C7ZA 1KBUA 2PFPA 2XGPA 4RWNA 4YQWA 1N63A 4B9SA 4M04A 4OAIZ 2PMZF 5ALZA 3HP6A 4NXXA 4RWQA 3GFKB 3AMZA 5G5GA 3ORYA 1EXNA 1K1QA 2WHEA 4Z6CA 5KFJA 3HW8A 3V7JA 3F5EA 4BJQA 5F2VO 2RRDA 2KZMA 1ZQYA 4QWAA 3D6JA 2XCAA 1QSYA 1K1SA 2JH7A 1F0MA 2E1EA 4EP7A 3AQNA 5ALUA 2W9BA 4EEKA 4UATA 1LKYB 4UAUA 5F9LA 2Z7JA 4DQPA 7ICVA 4IQTA 7ICMA 3AN1A 8ICKA 1LB2B 4KLEA 4GLXA 5DG7A 4WCWA 2XVTA 4NLKA 4DSKA 1U45A 3SZ2A 2R8GA 4CE6A 4U7CA 7ICTA 8ICHA 5ALNA 1N61A 2GAFD 1Q46A 5AKKA 5F9NA 5KFQA 3F53A 1TVAA 1SZPA 2FMQA 1ECWA 2EZYA 5J2GA 4FO1A 2FLNA 8ICNA 4M6WA 2KKVA 1ZQFA 4Y2YA 1SL0A 1TKDA 2G0AA 3AQLA 5KFVA 4BX9C 1PK1B 4NL9C 5DGBA 4YN4A 2HHSA 1P7DA 3BQ0A 4F92B 5EWGA 1OU5A 4DFMA 3V7KA 4UD5A 2KHQA 2H3IA 1AQ6A 2RHFA 4F4KA 3K7DA 3WFOA 4F4XA 3QU9A 3C5GA 3PW2A 1MSWD 3HWTA 1QTMA 2W7OA 3RJJA 2WAQF 9ICOA 2ZXIA 3GV7B 4DL4A 5GTIU 2JEFA 2Y1JA 4UD4A 4UAVA 2RFFA 3R9KA 4MHVA 2DR7A 3E58A 4OJOA 5A0LA 2BKEA 4RQ7A 4I2HA 4RNNA 4KLTA 4KLOA 2GOLA 1JX4A 1YLQA 1XSPA 2WAQC 1J2NA 4M9HA 3V6HA 4I2FA 5CB1A 1NK8A 4BWJA 5J0PA 4USAA 2ZJAA 1HEKA 4ZH4A 4RPYA 2WF7A 1ZQDA 4IR1A 2K4PA 4R65A 3TAPA 2W55A 1RYRA 2ZH1A 5KFKA 3PO5A 5IINA 3RJHA 2XY6A 3F5AA 1FIQA 4M9LA 3N4MB 2B4VA 4B9VA 3MR3A 1DRGA 5KFLA 5B66U 3UQ0A 3CRXA 3F2DA 3TACB 2IOFK 3RBDA 2F8LA 5AM3A 4WH5A 4JMUA 9ICSA 2DRAA 1HJPA 4X4TA 4WC2A 2KIVA 3MR5A 1RYUA 4DL3A 4C4SA 3OV7A 3HT3A 4O5KA 4YR2A 4IRKA 1XS9D 2B21A 2KVSA 5KFCA 1X2IA 4EX6A 1TAUA 5KT6A 2XGQA 1NO5A 3OWGA 3UMCA 1KDHA 4QZBA 9ICQA 2DGZA 1KQQA 4S3NA 2ZH8A 1D8LA 4IC9A 4ATBA 2BCUA 1Z3EB 4F5RA 3C2MA 5CHGA 4G9BA 1UETA 5HC9A 5EWFA 4P4OA 2HMXA 3NVWA 3RH5A 4YG2A 9ICWA 5IIIA 4KLHA 3EUB2 4TUQA 1UA0A 3O0FA 2V4RA 3H38A 3BQTA 3UXNA 4KLUA 2AU0A 5KG5A 5JUMA 5DBAA 1A6SA 4AT7A 3ISDA 1ZQPA 2KEYA 4RQ5A 4IS7A 2HHTA 3PMLA 3THVA 4Y2SA 2UVUA 5IIMA 1DXSA 4WC6A 3IRUA 4P0QB 4K99A 4QWEA 2QB0B 5J2HA 4RPZA 3GU3A 4DEZA 1SWWA 4EX7A 3MFIA 1ZQHA 2RP5A 3WKCA 2DUYA 3AU6A 4FZNA 3L9DA 2B0CA 3BZKA 5AKHA 2BCVA 3M1YA 2W54A 1TFRA 2HI0A 4FHVA 3MGVA 5D61A 1T8EA 1QSSA 4WC4A 1BVSA 4X5VA 5D4BA 2BPGA 3DDHA 1CI4A 3MC1A 5ALHA 4UBCA 3T5LA 2BCRA 4JWNA 3EZ5A 1PK3A 1Z00A 4ED6A 5KFBA 4F8RA 2D8CA 5KL1B 1FA0A 2D3DA 2KIWA 2CN1A 3RJIA 2G09A 3RB4A 2AQ4A 4IG8A 1BNPA 3PMNA 3CNHA 3OUYA 1MQ2A 1ZQCA 3M6ZA 1QCKA 4GXKA 1BPYA 1URJA 4AYBF 2ZIVA 5ALTA 3WK6A 4X0AA 3KKAA 4UB2A 4XJEA 5ALWA 2W7PA 2F44A 7ICUA 9ICEA 3JYYA 9ICAA 3N7SC 3TI0A 5DQIA 4PZOA 4J9QA 3HILA 4MF2A 3K1ZA 3PSPA 5KAFU 3C28A 3TANA 2JMGA 2A1JB 3CW2C 3IG5A 4WC1A 3OHAA 4LEYA 1SKWA 1SXEA 4JB3A 2ZTCA 2DR9A 1TE2A 3AUOA 1UPHA 2YMLA 1KL9A 1RZTA 1N56A 1S0MA 1UT8A 2KP7A 3PO4A 1NK9A 3MGHA 7ICNA 3PR5B 3LWMA 4Q8EA 2FJ6A 1Z4OA 2PXIA 5TZVA 4K4GA 2ZUBA 4R64A 2YB1A 3HJEA 4ECYA 2M2TA 1SIJA 4MFAA 8ICBA 3G6VA 5KFNA 5DGAA 3ICXA 1S0VA 3V6JA 4QJFB 5HRGA 1VDVA 1N48A 3B0XA 2NO4A 2HVHA 2KSOA 2OYYA 1OXJA 5KG0A 4X4RA 3F2BA 3KHRA 3H4DA 2ATLA 4NM1A 1S0OA 3PY8A 5J0TA 5J2CA 3RBEA 2W11A 5AK4A 4EBJA 2Y9TA 5EOZA
chains in the Genus database with same CATH topology
4PPXA 4NLGA 2RDJA 8ICJA 4DL5A 2V4QA 4EYIB 9ICGA 8ICSA 3H37A 3JPSA 5KFEA 3RJFA 8ICMA 5KG4A 5L1IA 4C8LA 2W9CA 5HMLA 1S77D 2P6RA 4EBCA 1PX5A 1SKSA 4WBYA 2ZTEA 4C8OA 1LV5A 3HX0A 4E7XA 1L3TA 2Q0ZX 4RUCA 3IM1A 5DB7A 1U49A 1KRPA 3ZDBA 5DKWA 2NRXA 3V7LA 4DL6A 4KTQA 8ICWA 1TFYA 5J0QA 3H8SA 4DQRA 4R8UA 2PI5A 2HHXA 1ZQVA 3RRGA 4UB4A 4GC6A 3FDSA 1ZQTA 8ICFA 3GIIA 3RJGA 4KLSA 2MAXA 8ICOA 3UXOA 4QZDA 3M9MB 3ZDEA 4DS4A 4GC7A 3PW7A 3M8RA 4J9RA 2PI4A 2ISPA 5KG3A 5L1LA 2JZBB 2FPMA 4TQRA 3PNCA 4ED1A 2ZHAA 4DSJA 5J2IA 3UPSA 4PGXA 1Y88A 4DL2A 2HHWA 4ECZA 4ED7A 2DPJA 4NXZA 3UQ2A 5KTQA 2PFOA 4ELVA 5DB9A 3H3AA 4RPXA 3MBYA 5J0XA 3RH4A 4O5CA 3PW4A 1PZNA 3C1ZA 4RQ6A 4WBZA 2XC9A 1NZPA 5J2DA 5HNKA 4E0DA 4AT9A 4I2CA 5KFHA 4XQ8A 1S97A 1KFTA 2FLPA 4WC0A 5KFWA 1V4AA 4KLJA 4ATBB 1D9FA 4BXOA 3C18A 3HJ4A 4UQGA 1KFDA 5KFYA 5J0OA 3Q8SB 2ZH7A 1R8CA 1NKEA 2HW3A 3C66A 2IBKA 3RAQA 2Y1IA 4DOAA 2AGPA 2LYHA 4F5OA 2ISOA 4IRCA 5KG1A 4DSFA 4DFKA 2I1QA 2KN7A 4JWMA 4KLIA 4P2HA 3JZ0A 2ZH5A 2W9MA 7ICOA 1S10A 2PFPA 3SV3A 2XGPA 4M9JA 4YQWA 4RWNA 3BDPA 1RXWA 4B9SA 5HRBA 4BGDA 3WFSC 9ICBA 3IHQB 5HMMA 2UVRA 1AROP 3OGUA 4M04A 4LZGA 3TARA 4DSIA 5HRIA 8ICQA 3HP6A 4DWIA 8ICAA 4RWOA 4RWQA 3EPIA 3GFKB 3AQKA 3NTUA 3ORYA 4JV2A 3G6YA 1L5UA 7ICHA 1EXNA 4AT7B 1KLNA 1RYSA 8ICEA 4CCHA 2WTFA 1K1QA 4Z6CA 5KFJA 3HW8A 3V7JA 4ED2A 3BJYA 4PHDA 3HJ1A 3V6KA 2DRBA 3GDXA 3PVXA 5F2VO 4WC7A 1ZQBA 1U47A 2KZMA 1ZQYA 2BGWA 3RJKA 5J2EA 4QWAA 2XCAA 1QSYA 1K1SA 4MFFA 5CJ7A 1Q79A 4EP7A 2C2RA 5BOLA 3AQNA 4RT3A 9ICJA 4J9MA 1DOQA 2BPCA 2W9BA 3RH6A 4M47A 1U4BA 2AJQA 5F9LA 3OHBA 3JPPA 1L3VA 4DQPA 3V72A 7ICVA 3C21A 3QE9Y 2NRWA 4I2IA 1ZYQA 4IQTA 4EZ9A 7ICMA 5DBBA 8ICKA 4I2JA 4M9GA 1S76D 2XY5A 1LB2B 4ED0A 1WCNA 4KLEA 4GLXA 3T5JA 4DLGA 5DG7A 4X4NA 4QZ9A 4GXIA 3H7IA 4NLKA 3RTVA 5KFUA 1U45A 4DSKA 3SZ2A 4WCWA 1KFSA 4ED8A 3GV8B 2R8GA 4B9NA 7ICSA 4F5NA 4IQWA 3JPQA 4UAZA 2KFNA 1TFWA 1KTQA 2M9NA 4KITB 7ICTA 8ICHA 5HRHA 4RZRA 2BQ3A 3PX0A 5F9NA 3OSPA 5KFQA 3LWLA 5IILA 1S9FA 2ZH9A 1TVAA 1JQRA 4WC3A 1SZPA 2FMQA 3QEAZ 3Q8RB 2M2WA 1D8YA 5HREA 4JK1A 1KEJA 5J2GA 3RB3A 1TK0A 3M9OB 2KFZA 5J2KA 2FLNA 8ICNA 1ZJNA 1UA1A 1Z00B 4M6WA 1ZQFA 5J2AA 1SL0A 1TKDA 4ELUA 5J0SA 1ZQGA 5HRDA 3AQLA 4PHAA 5DB8A 5KFVA 4EBEA 1MIWA 4IR9A 1JMSA 5DGBA 4X4UA 3JPRA 5KG7A 5DB6A 1XC9A 4YN4A 2J6TA 1NK7A 1R8BA 3GIKA 5HHIA 4YMNA 4YFKA 3ZDDA 2HHSA 4YXJA 3T3FA 3OUYB 1HUZA 3BQ0A 1SL2A 4F92B 5EWGA 1ZQZA 5CWRA 4J9SA 3C23A 4DFMA 3GIMA 2C2EA 3V7KA 1OU5A 5KT5A 4UD5A 2W8LA 1JXLA 1COOA 2BHNA 2BDPA 4F4KA 3K75D 2A1JA 2R8IA 4ED3A 3Q8LA 2P66A 1IM4A 5DEDA 3C2KA 1KSPA 3WFOA 1ZQMA 3WFRE 4F4XA 1X9SA 3C5GA 2BCSA 3ZDCA 3PW2A 1VFGA 3KHHA 3HWTA 1MSWD 2DR5A 5HRFA 4IQVA 1QTMA 2ALZA 3NGDA 3RJJA 8ICYA 9ICOA 5L9XA 2J6UA 3Q8PB 2FPKA 3GV7B 7ICGA 1WOTA 4DL4A 5KFGA 2JEFA 1ZQKA 2Y1JA 1NK4A 5J0WA 4ECSA 1A77A 5DG8A 4UD4A 3JPTA 5KFZA 4AT8A 4RQ2A 2RFFA 4FHPA 4QZIA 9ICHA 2M2VA 3RAXA 2DR7A 4UAWA 2BKEA 4RU9A 2AQ0A 1ZQXA 4RQ7A 4I2HA 4RNNA 4KLTA 4QW8A 2IHMA 4KLOA 5DDMA 1JX4A 1YLQA 1XSPA 3MR6A 2C28A 5KT2A 4QZHA 1VJ7A 1NKBA 4M9HA 3V6HA 2DFLA 3ZD9A 4MEYA 4I2FA 4DQIA 1HUOA 3AQMA 2NRVA 5CB1A 4MF8A 1NJYA 1NK8A 4BWJA 5J0PA 3QZ8A 8ICRA 2ZJAA 3PV8A 7ICEA 4DF8A 4ZH4A 4DO9A 4RPYA 1ZQDA 4M5DA 1Q78A 4QZEA 1ZQQA 3MABA 4R65A 4IR1A 8ICIA 2O1PA 3EW9A 4QZFA 4IQUA 2BPFA 2ASLA 3TAPA 5KFFA 4KLFA 1QLNA 1U48A 2NRKA 5DECA 2FMPA 1RYRA 2M2UA 3OJSA 5D49A 4R63A 3H8WA 5KFIA 2ZH1A 5J0UA 5KFKA 3ETLA 4FH5A 5HRLA 3JPOA 3PO5A 3OJUA 9ICXA 5IINA 3BQ2A 4DSEA 3RJHA 1NOMA 1XU4A 4DF4A 2XY6A 1QSLA 2OWOA 4FH3A 4M9LA 3N4MB 2C22A 3UPQA 4Z6FA 5KFXA 4QZCA 4B9VA 3MR3A 5KT3A 5KFLA 3UQ0A 3SI8A 4RQ0A 4C8NA 4DS5A 4YD1A 1NK0A 4M0AA 3RBDA 2ASJA 4FHWA 1NK5A 4B9TA 4RUAA 4ECQA 4EBJA 4EBDA 2IHNA 9ICSA 1ZQEA 2GWSA 2DRAA 1HJPA 4YD2A 4X4TA 3EPGA 1ZETA 5KFTA 1ZQLA 4WC2A 4MFCA 4ECRA 3MR5A 1ZQOA 4DOBA 4Q45A 4I2GA 3OVSA 2NRZA 2FPLA 4DL3A 4O3OA 5DQGA 4NKTA 7ICLA 1BPXA 4YP3A 1BPDA 3HT3A 3OV7A 4EYHB 4O5KA 1ZQJA 4YR2A 4IRKA 1XS9D 9ICMA 4JV0A 5J2JA 9ICPA 2B21A 4NKUA 5L1JA 1TAQA 2MUTB 5KFCA 2R8KA 4I29A 1X2IA 4IRDA 1ZJMA 5KT6A 2XGQA 4PH5A 1TAUA 4QZAA 5D46A 2JZBA 1XSNA 4KLQA 3NYBA 3RRHA 3KTQA 8ICLA 1NO5A 2VA3A 1DK2A 3MGIA 1JN3A 1KDHA 4Q44A 1BGXT 4XRHA 4R8UB 4R66A 4QZBA 2P6UA 9ICQA 2ZH2A 4YCXA 3Q8QB 3QZ7A 8ICUA 1UT5A 4QZGA 1UEVA 1D8LA 4S3NA 2W9AA 4NLNA 5KFPA 8ICTA 2ZH8A 4X4PA 5KFAA 1IXRA 3RJEA 4JUZA 1XSLA 2V9WA 1JIHA 4Z6DA 4O5EA 2HHVA 2I9GA 4ATBA 3OVAA 2BCUA 2ZUCA 4TQSA 1Z3EB 5BPCA 4F5RA 5HP4A 4YVZA 5DG9A 3C2MA 3PX4A 4DOCA 5CHGA 4UB5A 1UETA 1A76A 2XO7A 4LZDA 3PW5A 5BOMA 5EWFA 4O3PA 5CR0A 4B9UA 2BE3A 4DSLA 5HC9A 4P4OA 4FBUA 5KFDA 2W8KA 4Q43A 3MFHA 4YG2A 3RH5A 9ICFA 1B43A 5IIIA 4AT9B 4XA5A 4KLHA 4FBTA 3H40A 5J0YA 2JEGA 1U9LA 4XUSA 4F4WA 4TUQA 3EWAA 1UA0A 3C5FA 4DFJA 4BXOB 5DQHA 2V4RA 1ZQNA 3H38A 4NLZA 4C8KA 3BQTA 5CA7A 4I2EA 3OVBA 4P4PA 1BPZA 4KMUA 2VANA 3UXNA 4P4MA 4ECVA 4KLUA 3H8JA 2AU0A 4KLDA 4YR0A 4E80A 4KLLA 4J9PA 5KG5A 5JUMA 5DBAA 4FHXA 3ISDA 5KFSA 1S0NA 1ZQPA 4F93B 9ICLA 4AT7A 4RQ5A 3SV4A 1T3NA 4YMMA 2J6SA 2DPIA 4FO6A 1L3UA 2R8JA 4PGYA 3KHLA 3G6XA 4DL7A 2HHTA 9ICIA 3EYZA 3PMLA 3THVA 3Q8MA 2UVUA 2BCQA 5IIMA 4KLGA 4WC6A 3N97B 4K4IA 4EBKA 4I2AA 5J2BA 5CP2A 5C5JA 4I2DA 4O3SA 2BQRA 1XO1A 5KFMA 1NK6A 1JXEA 4QWEA 4WC5A 4UAYA 2ZTDA 5J2HA 5J29A 4RPZA 4QW9A 9ICCA 4DEZA 3ZDAA 9ICNA 3TFRA 7ICIA 8ICVA 3H4BA 7ICRA 1ZQWA 2F1IA 4YR3A 3B0YA 2HHUA 2F1HA 3MFIA 1ZQHA 2MUTA 4F91B 2IA6A 3C2LA 3UXPA 3PR4A 3AU6A 1NJXA 4FS1A 4E8FA 3L9DA 2H5XA 4Z6EA 2ZJ8A 3MDCA 2W9BB 3TQ1A 1C7YA 2BCVA 3OSNA 4ECUA 1V9PA 3RR7A 2R8HA 1X9WA 7ICQA 4RQ3A 3TFSA 4O9MA 4I2BA 1TFRA 3E2EA 3PX6A 3RB6A 4FHVA 2AGQA 4M9NA 4X4SA 2C2DA 2FLLA 1ZQSA 8ICZA 5L1KA 4RQ8A 5HHHA 1T8EA 1QSSA 4G3IA 4UB1A 4WC4A 1BVSA 4X5VA 3ZD8A 5D4BA 1L3SA 4K4HA 2ZHBA 4RQ1A 1BPEA 2BPGA 4DQSA 4F2SA 1R8AA 2PBEA 2KZZA 4UBCA 4C8MA 3LK9A 4DLEA 3T5LA 3H39A 1CEZA 9ICRA 2ZUDA 5IIKA 2BCRA 4JWNA 3EZ5A 1Z00A 5DLGA 4J9OA 5KG2A 5KFBA 4ED6A 1T7PA 3K4GA 4F8RA 1D9DA 1FA0A 5KFOA 4BWMA 4BDPA 4O3RA 3RJIA 2BQUA 4O3NA 4ECTA 3RB4A 1TV9A 1NJWA 5HR9A 2HHPA 4YMOA 2AQ4A 4IG8A 1BNPA 4FS2A 3PMNA 3HIYA 3T5HA 2ZH4A 5KFRA 7ICJA 4QWCA 3OUYA 4B9MA 4M6WB 1MQ2A 1ZQCA 4GXKA 1ZQAA 5DLFA 1BPYA 4X0AA 3FYHA 4UB2A 2XCPA 2VA8A 1TK5A 2HVIA 1T4GA 2KTQA 8ICXA 1KNYA 4EEYA 4NM2A 2VA2A 7ICUA 9ICEA 3JYYA 9ICAA 4M2YA 1UEUA 4DFPA 4TUPA 2XY7A 4ECXA 1SKRA 4KLMA 2IMWP 4FHYA 3TI0A 5DQIA 4J9NA 4J9QA 8ICPA 3WFQE 5DBCA 4UB3A 4TUSA 4F4YA 2ASDA 4JV1A 3TAQA 4MF2A 9ICUA 4Q8FA 2W9CB 4HYKA 1DGSA 5KT7A 3TANA 2A1JB 4WC1A 4RWPA 4KN7A 3OHAA 3MDAA 4RNOA 4F50A 1MQ3A 4UBBA 7ICKA 1SKWA 4PHPA 3SYZA 2F1JA 1R89A 3GILA 4B9LA 5KT4A 4RQ4A 1SL1A 1BNOA 2Q66A 9ICKA 4X4VA 3GV5B 2ZTCA 5IIOA 1MIYA 4RNMA 2ID1A 3WFPA 3AUOA 4GXJA 2DR9A 2NRTA 1ZQRA 1MC8A 4XQ7A 4X4OA 3KHGA 4AT8B 3T5KA 1X9MA 4LVSA 4YXMA 1BPBA 1RZTA 4PHEA 2PFQA 1N56A 2DVIA 1S0MA 4J9KA 4MEXA 2FMSA 2PFNA 4QWDA 1UT8A 1H38A 2UVWA 2KP7A 8ICCA 3PO4A 1NK9A 1NJZA 3M9NB 3Q8KA 2BR0A 8ICGA 3MGHA 4X4QA 4X0BA 3RB0A 1XWLA 3PR5B 2AGOA 7ICNA 3LWMA 3MR2A 4Q8EA 3ISBA 2JEJA 1JAJA 5J2FA 1ZQUA 2PXIA 3PW0A 4K4GA 5TZVA 5HRKA 2ZUBA 3RR8A 4I28A 4R64A 4J9LA 3ISCA 2M2TA 4ECYA 1ZQIA 4F4ZA 4I27A 4MFAA 4KN4A 1WCLA 4PGQA 3HPOA 8ICBA 3G6VA 5KFNA 4TURA 3BQ1A 5DGAA 1B22A 4F5QA 4LT6A 3GQCA 5DDYA 3V6JA 1S0VA 2HHQA 7ICPA 5HRGA 1N48A 4EZ6A 3B0XA 4RT2A 5KG6A 3M8SA 1CUKA 2JEIA 9ICTA 4O3QA 2HVHA 1DK3A 1RXVA 4ELTA 3LDAA 1MIVA 3GIJA 1TK8A 4DQQA 5KG0A 5J0RA 4X4RA 4F2RA 3AU2A 2ZH3A 1F5AA 3KHRA 3C1YA 4QZ8A 2ZJ5A 2RDIA 2KZ3A 3LQCB 3H4DA 2ATLA 2O5AA 2UVVA 4ECWA 1NKCA 1S0OA 4QWBA 3PY8A 4F3OA 4NM1A 9ICVA 4F5PA 7ICFA 5EWEA 5J0TA 5J2CA 3RBEA 2ZH6A 3JPNA 2DR8A 9ICWA 5IIJA 1RPLA 4O0IA 5EOZA 4NY8A 3QEBZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPX A;  4NLG A;  2RDJ A;  8ICJ A;  4DL5 A;  2V4Q A;  4EYI B;  9ICG A;  8ICS A;  3H37 A;  3JPS A;  5KFE A;  3RJF A;  8ICM A;  5KG4 A;  5L1I A;  4C8L A;  2W9C A;  5HML A;  1S77 D;  2P6R A;  4EBC A;  1PX5 A;  1SKS A;  4WBY A;  2ZTE A;  4C8O A;  1LV5 A;  3HX0 A;  4E7X A;  1L3T A;  2Q0Z X;  4RUC A;  3IM1 A;  5DB7 A;  1U49 A;  1KRP A;  3ZDB A;  5DKW A;  2NRX A;  3V7L A;  4DL6 A;  4KTQ A;  8ICW A;  1TFY A;  5J0Q A;  3H8S A;  4DQR A;  4R8U A;  2PI5 A;  2HHX A;  1ZQV A;  3RRG A;  4UB4 A;  4GC6 A;  3FDS A;  1ZQT A;  8ICF A;  3GII A;  3RJG A;  4KLS A;  2MAX A;  8ICO A;  3UXO A;  4QZD A;  3M9M B;  3ZDE A;  4DS4 A;  4GC7 A;  3PW7 A;  3M8R A;  4J9R A;  2PI4 A;  2ISP A;  5KG3 A;  5L1L A;  2JZB B;  2FPM A;  4TQR A;  3PNC A;  4ED1 A;  2ZHA A;  4DSJ A;  5J2I A;  3UPS A;  4PGX A;  1Y88 A;  4DL2 A;  2HHW A;  4ECZ A;  4ED7 A;  2DPJ A;  4NXZ A;  3UQ2 A;  5KTQ A;  2PFO A;  4ELV A;  5DB9 A;  3H3A A;  4RPX A;  3MBY A;  5J0X A;  3RH4 A;  4O5C A;  3PW4 A;  1PZN A;  3C1Z A;  4RQ6 A;  4WBZ A;  2XC9 A;  1NZP A;  5J2D A;  5HNK A;  4E0D A;  4AT9 A;  4I2C A;  5KFH A;  4XQ8 A;  1S97 A;  1KFT A;  2FLP A;  4WC0 A;  5KFW A;  1V4A A;  4KLJ A;  4ATB B;  1D9F A;  4BXO A;  3C18 A;  3HJ4 A;  4UQG A;  1KFD A;  5KFY A;  5J0O A;  3Q8S B;  2ZH7 A;  1R8C A;  1NKE A;  2HW3 A;  3C66 A;  2IBK A;  3RAQ A;  2Y1I A;  4DOA A;  2AGP A;  2LYH A;  4F5O A;  2ISO A;  4IRC A;  5KG1 A;  4DSF A;  4DFK A;  2I1Q A;  2KN7 A;  4JWM A;  4KLI A;  4P2H A;  3JZ0 A;  2ZH5 A;  2W9M A;  7ICO A;  1S10 A;  2PFP A;  3SV3 A;  2XGP A;  4M9J A;  4YQW A;  4RWN A;  3BDP A;  1RXW A;  4B9S A;  5HRB A;  4BGD A;  3WFS C;  9ICB A;  3IHQ B;  5HMM A;  2UVR A;  1ARO P;  3OGU A;  4M04 A;  4LZG A;  3TAR A;  4DSI A;  5HRI A;  8ICQ A;  3HP6 A;  4DWI A;  8ICA A;  4RWO A;  4RWQ A;  3EPI A;  3GFK B;  3AQK A;  3NTU A;  3ORY A;  4JV2 A;  3G6Y A;  1L5U A;  7ICH A;  1EXN A;  4AT7 B;  1KLN A;  1RYS A;  8ICE A;  4CCH A;  2WTF A;  1K1Q A;  4Z6C A;  5KFJ A;  3HW8 A;  3V7J A;  4ED2 A;  3BJY A;  4PHD A;  3HJ1 A;  3V6K A;  2DRB A;  3GDX A;  3PVX A;  5F2V O;  4WC7 A;  1ZQB A;  1U47 A;  2KZM A;  1ZQY A;  2BGW A;  3RJK A;  5J2E A;  4QWA A;  2XCA A;  1QSY A;  1K1S A;  4MFF A;  5CJ7 A;  1Q79 A;  4EP7 A;  2C2R A;  5BOL A;  3AQN A;  4RT3 A;  9ICJ A;  4J9M A;  1DOQ A;  2BPC A;  2W9B A;  3RH6 A;  4M47 A;  1U4B A;  2AJQ A;  5F9L A;  3OHB A;  3JPP A;  1L3V A;  4DQP A;  3V72 A;  7ICV A;  3C21 A;  3QE9 Y;  2NRW A;  4I2I A;  1ZYQ A;  4IQT A;  4EZ9 A;  7ICM A;  5DBB A;  8ICK A;  4I2J A;  4M9G A;  1S76 D;  2XY5 A;  1LB2 B;  4ED0 A;  1WCN A;  4KLE A;  4GLX A;  3T5J A;  4DLG A;  5DG7 A;  4X4N A;  4QZ9 A;  4GXI A;  3H7I A;  4NLK A;  3RTV A;  5KFU A;  1U45 A;  4DSK A;  3SZ2 A;  4WCW A;  1KFS A;  4ED8 A;  3GV8 B;  2R8G A;  4B9N A;  7ICS A;  4F5N A;  4IQW A;  3JPQ A;  4UAZ A;  2KFN A;  1TFW A;  1KTQ A;  2M9N A;  4KIT B;  7ICT A;  8ICH A;  5HRH A;  4RZR A;  2BQ3 A;  3PX0 A;  5F9N A;  3OSP A;  5KFQ A;  3LWL A;  5IIL A;  1S9F A;  2ZH9 A;  1TVA A;  1JQR A;  4WC3 A;  1SZP A;  2FMQ A;  3QEA Z;  3Q8R B;  2M2W A;  1D8Y A;  5HRE A;  4JK1 A;  1KEJ A;  5J2G A;  3RB3 A;  1TK0 A;  3M9O B;  2KFZ A;  5J2K A;  2FLN A;  8ICN A;  1ZJN A;  1UA1 A;  1Z00 B;  4M6W A;  1ZQF A;  5J2A A;  1SL0 A;  1TKD A;  4ELU A;  5J0S A;  1ZQG A;  5HRD A;  3AQL A;  4PHA A;  5DB8 A;  5KFV A;  4EBE A;  1MIW A;  4IR9 A;  1JMS A;  5DGB A;  4X4U A;  3JPR A;  5KG7 A;  5DB6 A;  1XC9 A;  4YN4 A;  2J6T A;  1NK7 A;  1R8B A;  3GIK A;  5HHI A;  4YMN A;  4YFK A;  3ZDD A;  2HHS A;  4YXJ A;  3T3F A;  3OUY B;  1HUZ A;  3BQ0 A;  1SL2 A;  4F92 B;  5EWG A;  1ZQZ A;  5CWR A;  4J9S A;  3C23 A;  4DFM A;  3GIM A;  2C2E A;  3V7K A;  1OU5 A;  5KT5 A;  4UD5 A;  2W8L A;  1JXL A;  1COO A;  2BHN A;  2BDP A;  4F4K A;  3K75 D;  2A1J A;  2R8I A;  4ED3 A;  3Q8L A;  2P66 A;  1IM4 A;  5DED A;  3C2K A;  1KSP A;  3WFO A;  1ZQM A;  3WFR E;  4F4X A;  1X9S A;  3C5G A;  2BCS A;  3ZDC A;  3PW2 A;  1VFG A;  3KHH A;  3HWT A;  1MSW D;  2DR5 A;  5HRF A;  4IQV A;  1QTM A;  2ALZ A;  3NGD A;  3RJJ A;  8ICY A;  9ICO A;  5L9X A;  2J6U A;  3Q8P B;  2FPK A;  3GV7 B;  7ICG A;  1WOT A;  4DL4 A;  5KFG A;  2JEF A;  1ZQK A;  2Y1J A;  1NK4 A;  5J0W A;  4ECS A;  1A77 A;  5DG8 A;  4UD4 A;  3JPT A;  5KFZ A;  4AT8 A;  4RQ2 A;  2RFF A;  4FHP A;  4QZI A;  9ICH A;  2M2V A;  3RAX A;  2DR7 A;  4UAW A;  2BKE A;  4RU9 A;  2AQ0 A;  1ZQX A;  4RQ7 A;  4I2H A;  4RNN A;  4KLT A;  4QW8 A;  2IHM A;  4KLO A;  5DDM A;  1JX4 A;  1YLQ A;  1XSP A;  3MR6 A;  2C28 A;  5KT2 A;  4QZH A;  1VJ7 A;  1NKB A;  4M9H A;  3V6H A;  2DFL A;  3ZD9 A;  4MEY A;  4I2F A;  4DQI A;  1HUO A;  3AQM A;  2NRV A;  5CB1 A;  4MF8 A;  1NJY A;  1NK8 A;  4BWJ A;  5J0P A;  3QZ8 A;  8ICR A;  2ZJA A;  3PV8 A;  7ICE A;  4DF8 A;  4ZH4 A;  4DO9 A;  4RPY A;  1ZQD A;  4M5D A;  1Q78 A;  4QZE A;  1ZQQ A;  3MAB A;  4R65 A;  4IR1 A;  8ICI A;  2O1P A;  3EW9 A;  4QZF A;  4IQU A;  2BPF A;  2ASL A;  3TAP A;  5KFF A;  4KLF A;  1QLN A;  1U48 A;  2NRK A;  5DEC A;  2FMP A;  1RYR A;  2M2U A;  3OJS A;  5D49 A;  4R63 A;  3H8W A;  5KFI A;  2ZH1 A;  5J0U A;  5KFK A;  3ETL A;  4FH5 A;  5HRL A;  3JPO A;  3PO5 A;  3OJU A;  9ICX A;  5IIN A;  3BQ2 A;  4DSE A;  3RJH A;  1NOM A;  1XU4 A;  4DF4 A;  2XY6 A;  1QSL A;  2OWO A;  4FH3 A;  4M9L A;  3N4M B;  2C22 A;  3UPQ A;  4Z6F A;  5KFX A;  4QZC A;  4B9V A;  3MR3 A;  5KT3 A;  5KFL A;  3UQ0 A;  3SI8 A;  4RQ0 A;  4C8N A;  4DS5 A;  4YD1 A;  1NK0 A;  4M0A A;  3RBD A;  2ASJ A;  4FHW A;  1NK5 A;  4B9T A;  4RUA A;  4ECQ A;  4EBJ A;  4EBD A;  2IHN A;  9ICS A;  1ZQE A;  2GWS A;  2DRA A;  1HJP A;  4YD2 A;  4X4T A;  3EPG A;  1ZET A;  5KFT A;  1ZQL A;  4WC2 A;  4MFC A;  4ECR A;  3MR5 A;  1ZQO A;  4DOB A;  4Q45 A;  4I2G A;  3OVS A;  2NRZ A;  2FPL A;  4DL3 A;  4O3O A;  5DQG A;  4NKT A;  7ICL A;  1BPX A;  4YP3 A;  1BPD A;  3HT3 A;  3OV7 A;  4EYH B;  4O5K A;  1ZQJ A;  4YR2 A;  4IRK A;  1XS9 D;  9ICM A;  4JV0 A;  5J2J A;  9ICP A;  2B21 A;  4NKU A;  5L1J A;  1TAQ A;  2MUT B;  5KFC A;  2R8K A;  4I29 A;  1X2I A;  4IRD A;  1ZJM A;  5KT6 A;  2XGQ A;  4PH5 A;  1TAU A;  4QZA A;  5D46 A;  2JZB A;  1XSN A;  4KLQ A;  3NYB A;  3RRH A;  3KTQ A;  8ICL A;  1NO5 A;  2VA3 A;  1DK2 A;  3MGI A;  1JN3 A;  1KDH A;  4Q44 A;  1BGX T;  4XRH A;  4R8U B;  4R66 A;  4QZB A;  2P6U A;  9ICQ A;  2ZH2 A;  4YCX A;  3Q8Q B;  3QZ7 A;  8ICU A;  1UT5 A;  4QZG A;  1UEV A;  1D8L A;  4S3N A;  2W9A A;  4NLN A;  5KFP A;  8ICT A;  2ZH8 A;  4X4P A;  5KFA A;  1IXR A;  3RJE A;  4JUZ A;  1XSL A;  2V9W A;  1JIH A;  4Z6D A;  4O5E A;  2HHV A;  2I9G A;  4ATB A;  3OVA A;  2BCU A;  2ZUC A;  4TQS A;  1Z3E B;  5BPC A;  4F5R A;  5HP4 A;  4YVZ A;  5DG9 A;  3C2M A;  3PX4 A;  4DOC A;  5CHG A;  4UB5 A;  1UET A;  1A76 A;  2XO7 A;  4LZD A;  3PW5 A;  5BOM A;  5EWF A;  4O3P A;  5CR0 A;  4B9U A;  2BE3 A;  4DSL A;  5HC9 A;  4P4O A;  4FBU A;  5KFD A;  2W8K A;  4Q43 A;  3MFH A;  4YG2 A;  3RH5 A;  9ICF A;  1B43 A;  5III A;  4AT9 B;  4XA5 A;  4KLH A;  4FBT A;  3H40 A;  5J0Y A;  2JEG A;  1U9L A;  4XUS A;  4F4W A;  4TUQ A;  3EWA A;  1UA0 A;  3C5F A;  4DFJ A;  4BXO B;  5DQH A;  2V4R A;  1ZQN A;  3H38 A;  4NLZ A;  4C8K A;  3BQT A;  5CA7 A;  4I2E A;  3OVB A;  4P4P A;  1BPZ A;  4KMU A;  2VAN A;  3UXN A;  4P4M A;  4ECV A;  4KLU A;  3H8J A;  2AU0 A;  4KLD A;  4YR0 A;  4E80 A;  4KLL A;  4J9P A;  5KG5 A;  5JUM A;  5DBA A;  4FHX A;  3ISD A;  5KFS A;  1S0N A;  1ZQP A;  4F93 B;  9ICL A;  4AT7 A;  4RQ5 A;  3SV4 A;  1T3N A;  4YMM A;  2J6S A;  2DPI A;  4FO6 A;  1L3U A;  2R8J A;  4PGY A;  3KHL A;  3G6X A;  4DL7 A;  2HHT A;  9ICI A;  3EYZ A;  3PML A;  3THV A;  3Q8M A;  2UVU A;  2BCQ A;  5IIM A;  4KLG A;  4WC6 A;  3N97 B;  4K4I A;  4EBK A;  4I2A A;  5J2B A;  5CP2 A;  5C5J A;  4I2D A;  4O3S A;  2BQR A;  1XO1 A;  5KFM A;  1NK6 A;  1JXE A;  4QWE A;  4WC5 A;  4UAY A;  2ZTD A;  5J2H A;  5J29 A;  4RPZ A;  4QW9 A;  9ICC A;  4DEZ A;  3ZDA A;  9ICN A;  3TFR A;  7ICI A;  8ICV A;  3H4B A;  7ICR A;  1ZQW A;  2F1I A;  4YR3 A;  3B0Y A;  2HHU A;  2F1H A;  3MFI A;  1ZQH A;  2MUT A;  4F91 B;  2IA6 A;  3C2L A;  3UXP A;  3PR4 A;  3AU6 A;  1NJX A;  4FS1 A;  4E8F A;  3L9D A;  2H5X A;  4Z6E A;  2ZJ8 A;  3MDC A;  2W9B B;  3TQ1 A;  1C7Y A;  2BCV A;  3OSN A;  4ECU A;  1V9P A;  3RR7 A;  2R8H A;  1X9W A;  7ICQ A;  4RQ3 A;  3TFS A;  4O9M A;  4I2B A;  1TFR A;  3E2E A;  3PX6 A;  3RB6 A;  4FHV A;  2AGQ A;  4M9N A;  4X4S A;  2C2D A;  2FLL A;  1ZQS A;  8ICZ A;  5L1K A;  4RQ8 A;  5HHH A;  1T8E A;  1QSS A;  4G3I A;  4UB1 A;  4WC4 A;  1BVS A;  4X5V A;  3ZD8 A;  5D4B A;  1L3S A;  4K4H A;  2ZHB A;  4RQ1 A;  1BPE A;  2BPG A;  4DQS A;  4F2S A;  1R8A A;  2PBE A;  2KZZ A;  4UBC A;  4C8M A;  3LK9 A;  4DLE A;  3T5L A;  3H39 A;  1CEZ A;  9ICR A;  2ZUD A;  5IIK A;  2BCR A;  4JWN A;  3EZ5 A;  1Z00 A;  5DLG A;  4J9O A;  5KG2 A;  5KFB A;  4ED6 A;  1T7P A;  3K4G A;  4F8R A;  1D9D A;  1FA0 A;  5KFO A;  4BWM A;  4BDP A;  4O3R A;  3RJI A;  2BQU A;  4O3N A;  4ECT A;  3RB4 A;  1TV9 A;  1NJW A;  5HR9 A;  2HHP A;  4YMO A;  2AQ4 A;  4IG8 A;  1BNP A;  4FS2 A;  3PMN A;  3HIY A;  3T5H A;  2ZH4 A;  5KFR A;  7ICJ A;  4QWC A;  3OUY A;  4B9M A;  4M6W B;  1MQ2 A;  1ZQC A;  4GXK A;  1ZQA A;  5DLF A;  1BPY A;  4X0A A;  3FYH A;  4UB2 A;  2XCP A;  2VA8 A;  1TK5 A;  2HVI A;  1T4G A;  2KTQ A;  8ICX A;  1KNY A;  4EEY A;  4NM2 A;  2VA2 A;  7ICU A;  9ICE A;  3JYY A;  9ICA A;  4M2Y A;  1UEU A;  4DFP A;  4TUP A;  2XY7 A;  4ECX A;  1SKR A;  4KLM A;  2IMW P;  4FHY A;  3TI0 A;  5DQI A;  4J9N A;  4J9Q A;  8ICP A;  3WFQ E;  5DBC A;  4UB3 A;  4TUS A;  4F4Y A;  2ASD A;  4JV1 A;  3TAQ A;  4MF2 A;  9ICU A;  4Q8F A;  2W9C B;  4HYK A;  1DGS A;  5KT7 A;  3TAN A;  2A1J B;  4WC1 A;  4RWP A;  4KN7 A;  3OHA A;  3MDA A;  4RNO A;  4F50 A;  1MQ3 A;  4UBB A;  7ICK A;  1SKW A;  4PHP A;  3SYZ A;  2F1J A;  1R89 A;  3GIL A;  4B9L A;  5KT4 A;  4RQ4 A;  1SL1 A;  1BNO A;  2Q66 A;  9ICK A;  4X4V A;  3GV5 B;  2ZTC A;  5IIO A;  1MIY A;  4RNM A;  2ID1 A;  3WFP A;  3AUO A;  4GXJ A;  2DR9 A;  2NRT A;  1ZQR A;  1MC8 A;  4XQ7 A;  4X4O A;  3KHG A;  4AT8 B;  3T5K A;  1X9M A;  4LVS A;  4YXM A;  1BPB A;  1RZT A;  4PHE A;  2PFQ A;  1N56 A;  2DVI A;  1S0M A;  4J9K A;  4MEX A;  2FMS A;  2PFN A;  4QWD A;  1UT8 A;  1H38 A;  2UVW A;  2KP7 A;  8ICC A;  3PO4 A;  1NK9 A;  1NJZ A;  3M9N B;  3Q8K A;  2BR0 A;  8ICG A;  3MGH A;  4X4Q A;  4X0B A;  3RB0 A;  1XWL A;  3PR5 B;  2AGO A;  7ICN A;  3LWM A;  3MR2 A;  4Q8E A;  3ISB A;  2JEJ A;  1JAJ A;  5J2F A;  1ZQU A;  2PXI A;  3PW0 A;  4K4G A;  5TZV A;  5HRK A;  2ZUB A;  3RR8 A;  4I28 A;  4R64 A;  4J9L A;  3ISC A;  2M2T A;  4ECY A;  1ZQI A;  4F4Z A;  4I27 A;  4MFA A;  4KN4 A;  1WCL A;  4PGQ A;  3HPO A;  8ICB A;  3G6V A;  5KFN A;  4TUR A;  3BQ1 A;  5DGA A;  1B22 A;  4F5Q A;  4LT6 A;  3GQC A;  5DDY A;  3V6J A;  1S0V A;  2HHQ A;  7ICP A;  5HRG A;  1N48 A;  4EZ6 A;  3B0X A;  4RT2 A;  5KG6 A;  3M8S A;  1CUK A;  2JEI A;  9ICT A;  4O3Q A;  2HVH A;  1DK3 A;  1RXV A;  4ELT A;  3LDA A;  1MIV A;  3GIJ A;  1TK8 A;  4DQQ A;  5KG0 A;  5J0R A;  4X4R A;  4F2R A;  3AU2 A;  2ZH3 A;  1F5A A;  3KHR A;  3C1Y A;  4QZ8 A;  2ZJ5 A;  2RDI A;  2KZ3 A;  3LQC B;  3H4D A;  2ATL A;  2O5A A;  2UVV A;  4ECW A;  1NKC A;  1S0O A;  4QWB A;  3PY8 A;  4F3O A;  4NM1 A;  9ICV A;  4F5P A;  7ICF A;  5EWE A;  5J0T A;  5J2C A;  3RBE A;  2ZH6 A;  3JPN A;  2DR8 A;  9ICW A;  5IIJ A;  1RPL A;  4O0I A;  5EOZ A;  4NY8 A;  3QEB Z; 
#chains in the Genus database with same CATH topology
 2B51 A;  8ICJ A;  4EYI B;  2Y9U A;  8ICS A;  3H37 A;  4UB8 U;  5KFE A;  5L1I A;  2YMM A;  2YQE A;  1HIW A;  1RDF A;  3V7L A;  2KIC A;  1TFY A;  5J0Q A;  4R8U A;  2PI5 A;  2HHX A;  3FDS A;  8ICF A;  3IV6 A;  1S5L U;  2MA1 A;  4KLS A;  2MAX A;  4J9R A;  5ALF A;  2FPM A;  1JRO A;  2YY6 A;  4DSJ A;  4EGW A;  1Y88 A;  4DL2 A;  4NXZ A;  3UQ2 A;  5KTQ A;  3ETR A;  3RH4 A;  3MBY A;  4O5C A;  3L5K A;  4WBZ A;  5J2D A;  2ZG6 A;  1ED1 A;  1S97 A;  2FLP A;  5KFW A;  1SZH A;  4KLJ A;  3Q8S B;  2ZH7 A;  1R8C A;  2Y0S F;  3C66 A;  1OW5 A;  4DOA A;  2IHO A;  4J03 A;  4B6J A;  1QH9 A;  4P2H A;  2ZH5 A;  4OAH A;  7ICO A;  1S10 A;  3SV3 A;  3BDP A;  1RXW A;  9ICB A;  3IHQ B;  5HMM A;  2UVR A;  3OGU A;  4LZG A;  3TAR A;  8ICQ A;  3WKA A;  3KKA C;  1L8O A;  1FEZ A;  2JH1 A;  7ICH A;  2HBK A;  5AM5 A;  1KLN A;  3AL0 B;  8ICE A;  2WTF A;  4EEB A;  4ED2 A;  3HJ1 A;  3PVX A;  2JGA A;  4WC7 A;  3D2N A;  2KNJ A;  2AH5 A;  3NKU A;  3BQ7 A;  5B5E U;  1U4B A;  3OHB A;  3JPP A;  4I2I A;  1ZYQ A;  4OO1 J;  5JRT A;  4DLG A;  4X4N A;  4GXI A;  5KFU A;  4ED8 A;  3GV8 B;  4B9N A;  5JTG A;  2KFN A;  1KTQ A;  2K8C B;  3PST A;  5AM2 A;  3WKB A;  3OSP A;  3B9J A;  3LWL A;  1S9F A;  4CRX A;  1JQR A;  4WC3 A;  3Q8R B;  4HAI A;  1D8Y A;  4JK1 A;  1MA7 A;  5AIA A;  1ZJN A;  1UA1 A;  3SMV A;  4NXW A;  5J0S A;  3J81 j;  4EBE A;  3N7P D;  1MIW A;  1XC9 A;  1B0X A;  4FFD A;  5HHI A;  4YFK A;  3ZDD A;  4YXJ A;  4CNQ A;  1HUZ A;  1SL2 A;  5CWR A;  3C23 A;  3GIM A;  2W8L A;  1COO A;  4LJX A;  2EAN A;  4ED3 A;  5DED A;  1KSP A;  3WFR E;  1J2M A;  1ZQM A;  3ZDC A;  5HRF A;  4IQV A;  3H0M B;  5L9X A;  3Q8P B;  2FPK A;  1WOT A;  5KFG A;  1ZQK A;  5DG8 A;  1IIP A;  1L8L A;  3JPT A;  4QZI A;  4KB6 A;  3RAX A;  2M2W A;  2AQ0 A;  2P35 A;  4QW8 A;  2IHM A;  1K5O A;  1VJ7 A;  4QZH A;  3ZD9 A;  4MEY A;  4KM5 A;  5HR7 A;  1QQ6 A;  2I6X A;  1Q3V A;  4DQI A;  1OUQ A;  1NJY A;  8ICR A;  3QZ8 A;  2GA9 D;  3BS5 A;  7ICE A;  5ALO A;  1PUZ A;  4IQU A;  2BPF A;  3S6J A;  5KL8 B;  5DEC A;  1U48 A;  3OJS A;  3E0F A;  3H8W A;  3A0H U;  5HRL A;  3JPO A;  3BQ2 A;  4KMO B;  1NOM A;  1XU4 A;  2OH2 A;  2AHO B;  2JHD A;  5CFU A;  3UPQ A;  4Z6F A;  3QXG A;  2OM6 A;  3SI8 A;  4YD1 A;  1NK0 A;  4FHW A;  2G08 A;  4F72 A;  4B9T A;  3ZI4 A;  2IHN A;  2GWS A;  2IOF A;  4MFC A;  2FI1 A;  4ECR A;  4Q45 A;  1SV0 A;  1BPX A;  4YP3 A;  5CRX A;  9ICP A;  5ALK A;  4I29 A;  2R8K A;  2QAR A;  4IRD A;  5D46 A;  1X40 A;  2CXY A;  1C20 A;  2F3N A;  1DK2 A;  1JN3 A;  3AM9 A;  2ZH2 A;  4Y2V A;  4YCX A;  3QZ7 A;  1UEV A;  2EZX A;  5KFP A;  3VCB A;  5KFA A;  1IXR A;  2V9W A;  4O5E A;  1JIH A;  4Z6D A;  2I9G A;  3OVA A;  5HP4 A;  4YVZ A;  5DG9 A;  4UB5 A;  1F44 A;  3PW5 A;  4LZD A;  2E1F A;  4O3P A;  5CR0 A;  2KJ5 A;  4DSL A;  2W8K A;  9ICF A;  4AT9 B;  2JEG A;  5J0Y A;  1U9L A;  2BDU A;  2O6K A;  4F4W A;  2DKZ A;  2XIC A;  5CA7 A;  2WB1 F;  4I2E A;  4K8V A;  4P4P A;  1V38 A;  2K4E A;  2VAN A;  3H8J A;  2G5H B;  1GO3 F;  4J9P A;  3VC8 A;  2KVC A;  9ICL A;  4F93 B;  4OCZ A;  3SV4 A;  1T3N A;  4YMM A;  1N2X A;  2DPI A;  2R8J A;  3G6X A;  3EYZ A;  2G06 A;  2WB1 C;  4KLG A;  1TAM A;  2E8O A;  3QU5 A;  2JXJ A;  5ALS A;  5J2B A;  5CP2 A;  2KG5 A;  4I2D A;  1NK6 A;  4WC5 A;  1LKY A;  2ZTD A;  9ICN A;  7ICI A;  1ZQW A;  2F1I A;  4YR3 A;  2YMQ A;  2F1H A;  4FS1 A;  1KW4 A;  4Z6E A;  3TQ1 A;  4NV0 A;  3KZI U;  1X9W A;  3PX6 A;  4X4S A;  4C80 A;  2YTU A;  1PVR A;  2FLL A;  8ICZ A;  5L1K A;  5HHH A;  3UM9 A;  4G3I A;  1ZD2 P;  2ZHB A;  3WK8 A;  3I76 A;  2D6F C;  4DLE A;  4CF5 A;  9ICR A;  5IIK A;  3UMB A;  1MN8 A;  2H3Z A;  2EAO A;  5KFO A;  2LPE A;  4BDP A;  2KV2 A;  1PK1 A;  4O3N A;  4ECT A;  2HOQ A;  3HKZ C;  2HSZ A;  5ALV A;  3T5H A;  4ZOH C;  2H3F A;  1ZQA A;  3LVV A;  1RQL A;  1Z1V A;  1T4G A;  2KTQ A;  1KNY A;  4EEY A;  5FP0 A;  4NM2 A;  5ALY A;  2H3Q A;  1ZD3 A;  4TUP A;  3FAH A;  3M6K A;  1SV0 C;  2IMW P;  8ICP A;  3WFQ E;  4KX3 A;  4CF3 A;  4TUS A;  4Q8F A;  1DGS A;  5KT7 A;  4RWP A;  4KN7 A;  1Z19 A;  5EE9 A;  1MQ3 A;  1N5X A;  3NS1 A;  2F1J A;  2GLE A;  2N1R A;  1BNO A;  9ICK A;  4OJ5 A;  1MIY A;  1ZQR A;  1MC8 A;  4X4O A;  4AT8 B;  1X9M A;  4YXM A;  2YB4 A;  2FMS A;  8ICC A;  4X4Q A;  3RB0 A;  1XWL A;  2AGO A;  3ERC C;  1JAJ A;  5HRK A;  1ZD4 A;  3AQF A;  4J9L A;  1ZQI A;  4F4Z A;  3U26 A;  4I27 A;  4KN4 A;  4PGQ A;  3HPO A;  3BQ1 A;  1B22 A;  3SR6 A;  2IOH A;  4RT2 A;  5KG6 A;  5KNI A;  4RQN A;  4ELT A;  3LDA A;  2HCF A;  5J0R A;  1S8O A;  1L7M A;  4QZ8 A;  3EF2 A;  4EEL A;  1NKC A;  4QWB A;  3QUT A;  2E5S A;  5EWE A;  4C4R A;  2ZH6 A;  5IIJ A;  4NY8 A;  3QEB Z;  3AQM A;  3L4P A;  3KD3 A;  8ICM A;  4MKP A;  1N62 A;  1SKS A;  2ZTE A;  3HX0 A;  4RUC A;  1KRP A;  4KTQ A;  3H8S A;  3SAF A;  3RRG A;  3GII A;  3IP4 B;  3HRD D;  2LYA A;  3PW7 A;  2CPR A;  2OEH A;  2PI4 A;  2ISP A;  2JZB B;  2ZHA A;  4PGX A;  4OAF A;  4ED7 A;  3H3A A;  3MCR A;  5J0X A;  3K1R B;  3PW4 A;  1PZN A;  3C1Z A;  2K8B B;  2XC9 A;  2A3V A;  4GFJ A;  5AK3 A;  5HNK A;  1WWU A;  4IL6 U;  2B6G A;  3C18 A;  2ZIW B;  1KFD A;  5KFY A;  2VKQ A;  5G5H A;  4O68 A;  2ISO A;  4F5O A;  5AIC A;  2KN7 A;  4KLI A;  2QLT A;  2W9M A;  3WU2 U;  3WFS C;  5HRB A;  5ALR A;  5HRI A;  1ARO P;  4DSI A;  4P0P B;  3QYP A;  5C0Y A;  2KE7 A;  3AQK A;  3NTU A;  5ALQ A;  4JV2 A;  3G6Y A;  1L5U A;  4P0Q A;  4CCH A;  3BJY A;  2QB0 A;  1U47 A;  3NRW A;  2BGW A;  3RJK A;  4MFF A;  1Q79 A;  2C2R A;  5BOL A;  4RT3 A;  9ICJ A;  1DOQ A;  2BPC A;  3RH6 A;  5AKE A;  4M47 A;  1JAL A;  3IDW A;  2I5H A;  1ZQ1 C;  1ZOL A;  2NRW A;  2RLT A;  4EZ9 A;  5DBB A;  4I2J A;  1WWV A;  1S76 D;  2XY5 A;  4ED0 A;  1WCN A;  3UMG A;  1YT3 A;  3T5J A;  4QZ9 A;  4O6A A;  4OAG A;  4EV6 A;  1X9X A;  3IN5 A;  4F5N A;  4IQW A;  4WQL A;  2M9N A;  4KIT B;  5HRH A;  2E3T A;  3PX0 A;  2ZH9 A;  4LEV A;  3BS7 A;  2ZIW A;  5HRE A;  1KEJ A;  3M9O B;  5J2K A;  2ZIX B;  4ELU A;  5HRD A;  4PHA A;  5DB8 A;  3WKE A;  5AKJ A;  4X4U A;  2EZZ A;  5KG7 A;  5DB6 A;  3JPR A;  2J6T A;  1NK7 A;  1R8B A;  3GIK A;  4A8E A;  4YMN A;  3T3F A;  2LYB A;  2C2E A;  3PSI A;  1V97 A;  4AP9 A;  4K96 A;  1FFU A;  2BHN A;  1QQ5 A;  2A1J A;  3Q8L A;  4ACO A;  2P66 A;  1IM4 A;  3C2K A;  2WF8 A;  1VFG A;  4Y2R A;  3KHH A;  8ICY A;  5AHX A;  2J6U A;  1L7P A;  2QB1 A;  3D2S A;  1T3Q A;  1ZRM A;  5J0W A;  3N28 A;  1A77 A;  4ECS A;  4FHP A;  2M2V A;  2XI9 A;  4UAW A;  4RU9 A;  1ZQX A;  5DDM A;  1L7N A;  3LYS A;  1NKB A;  2DFL A;  1NNL A;  3QU2 A;  2NRV A;  4MF8 A;  4DO9 A;  4I0U A;  3QU4 A;  1RG6 A;  4QZE A;  1ZQQ A;  3MAB A;  4QZF A;  3IG8 A;  2AXT U;  2ASL A;  1QLN A;  2FMP A;  5D49 A;  5KFI A;  5J0U A;  4FH5 A;  3ETL A;  2W03 A;  9ICX A;  4FZL A;  4DSE A;  4DF4 A;  1DGJ A;  4FH3 A;  1J97 A;  5AK6 A;  4QZC A;  3NAS A;  5KT3 A;  2ASJ A;  1NK5 A;  4EBD A;  5H2F U;  4YD2 A;  2LI6 A;  5KFT A;  1ZQL A;  4DOB A;  3OVS A;  3WK7 A;  4O3M A;  2ZIU B;  5ALP A;  4O3O A;  5DQG A;  4NKT A;  4EYH B;  1ZQJ A;  2JV3 A;  4JV0 A;  5B3Q A;  2KD1 A;  2MUT B;  1ZJM A;  5AKZ A;  4PH5 A;  3NYB A;  3KTQ A;  8ICL A;  2RQ5 A;  5AKG A;  4Q44 A;  1BGX T;  2F77 X;  3NVV A;  4NWI A;  4XRH A;  2P6U A;  4R66 A;  3Q8Q B;  1UT5 A;  1ZRN A;  2W9A A;  8ICT A;  4JUZ A;  5AI0 A;  3KBB A;  1UCV A;  2HOI A;  4DOC A;  1A76 A;  4B9U A;  2BE3 A;  4K9B A;  1YZ6 A;  5BOM A;  4WQK A;  4FBU A;  5KFD A;  3MFH A;  1B43 A;  4XA5 A;  3H40 A;  4XUS A;  1VLB A;  3EWA A;  3C5F A;  4DFJ A;  4BXO B;  4NLZ A;  4CGZ A;  4C8K A;  3AQE A;  1BPZ A;  4KMU A;  4ECV A;  4P4M A;  4E80 A;  2LMR A;  4C4T A;  3OTQ A;  5KFS A;  1S0N A;  2J6S A;  4PGY A;  5JU5 A;  2BZF A;  2BCQ A;  3N97 B;  4EBK A;  2EAM A;  1XO1 A;  5J29 A;  4NXU A;  3ZDA A;  3TFR A;  3H4B A;  7ICR A;  4BUG A;  3B0Y A;  2HHU A;  1B4F A;  4Y2U A;  2MUT A;  2KHV A;  2IA6 A;  3C2L A;  3UXP A;  4O67 A;  2H5X A;  2W43 A;  3MDC A;  2W9B B;  4Y2T A;  3DV9 A;  2R8H A;  3TAD A;  3TFS A;  4I2B A;  3RB6 A;  4M9N A;  1Q3U A;  1COK A;  4UB1 A;  4K4H A;  1L3S A;  1IG6 A;  2PBE A;  1T94 A;  5DLG A;  3K4G A;  5ALL A;  4Y2Q A;  4O3R A;  2BQU A;  1TV9 A;  1NJW A;  2BBH A;  4YMO A;  4FS2 A;  2KJ9 A;  2KMD A;  7ICJ A;  4QWC A;  1PVQ A;  2OHF A;  5EE3 A;  2JR5 A;  4M6W B;  5DLF A;  2K89 A;  2XCP A;  1PVP A;  3A0B U;  3RFA A;  5AIB A;  2VA2 A;  3FM9 A;  1UEU A;  4DFP A;  5AI4 A;  4ECX A;  4KLM A;  4OD0 A;  4WOY A;  4UB3 A;  5ALE A;  4F4Y A;  2ASD A;  9ICU A;  1ZXI A;  2EH9 A;  3TAQ A;  1O03 A;  2W9C B;  3D2Q A;  4RNO A;  4F50 A;  2PMZ C;  4UAR A;  4JLZ A;  1R89 A;  3GIL A;  5ALI A;  4X4V A;  2DL0 A;  3GV5 B;  3WKD A;  2ID1 A;  4GXJ A;  2NRT A;  4XQ7 A;  4K98 A;  3T5K A;  1BPB A;  2PFQ A;  1RQN A;  4J9K A;  2F8K A;  1H38 A;  2EWR A;  2WF5 A;  1FFV A;  5AKI A;  4OJL A;  3Q8K A;  2BR0 A;  8ICG A;  1X6J A;  2G5I B;  3ISB A;  4ICA A;  2JEJ A;  5J2F A;  2ZH4 A;  3PW0 A;  3NVO A;  3RR8 A;  4K97 A;  5F3X B;  5D63 A;  3LVW A;  4TUR A;  1Z1B A;  4F5Q A;  5DDY A;  7ICP A;  2BBJ A;  3F2C A;  4OJP A;  2JEI A;  2EQY A;  9ICT A;  4O3Q A;  3N7R C;  4NXV A;  1MIV A;  5AM4 A;  3GIJ A;  2FE9 A;  3FC4 A;  4F2R A;  3C1Y A;  3LQC B;  2RDI A;  4NLC A;  2EDU A;  2YN4 A;  3QU7 A;  2O5A A;  3QX7 A;  4ECW A;  2UVV A;  4F3O A;  2MU2 A;  3JCF A;  7ICF A;  1UHU A;  3JPN A;  1RPL A;  4O0I A;  4PPX A;  4PZN A;  4DL5 A;  2V4Q A;  3ER8 C;  3RJF A;  5KG4 A;  1X42 A;  4C8L A;  2W9C A;  1S77 D;  1F5S A;  1WUD A;  1LV5 A;  3TKA A;  3IM1 A;  5DB7 A;  1U49 A;  3ZDB A;  4FE3 A;  4DL6 A;  1SXD A;  8ICW A;  5AI8 A;  4FZM A;  4GC6 A;  3NRZ A;  8ICO A;  3UXO A;  3TAD C;  1M6Y A;  2YX8 A;  3M8R A;  5L1L A;  4TQR A;  3PNC A;  3HKZ F;  2NV3 A;  3UPS A;  4ECZ A;  2PFO A;  5DB9 A;  1NZP A;  1L6N A;  4AT9 A;  5KFH A;  4RQM A;  2CRX A;  4WJ3 B;  1KFT A;  1V4A A;  4ATB B;  1D9F A;  4UQG A;  4NXT A;  2HW3 A;  4IRC A;  3RAQ A;  2Y1I A;  5KG1 A;  4DFK A;  2I1Q A;  2ZXH A;  2DBY A;  1LVH A;  4M9J A;  2FDR A;  4BGD A;  1SB3 C;  2DR8 A;  2WF6 A;  2LHT A;  4Y2P A;  8ICA A;  4DWI A;  4RWO A;  3EPI A;  4AT7 B;  1RYS A;  2LBO A;  4PHD A;  2DRB A;  3V6K A;  3GDX A;  3T79 A;  1ZQB A;  5J2E A;  5AKY A;  5CJ7 A;  4J9M A;  2AJQ A;  5D62 A;  1L3V A;  3V72 A;  2A19 A;  3C21 A;  3QE9 Y;  4M9G A;  5ALX A;  5KAI U;  3H7I A;  5AK5 A;  3RTV A;  3SQI A;  1KFS A;  2DKX A;  7ICS A;  2XID A;  3JPQ A;  4UAZ A;  1TFW A;  4RZR A;  2BQ3 A;  4PL1 A;  5IIL A;  2HN2 A;  2NYV A;  3QNM A;  3QEA Z;  1D8B A;  3RB3 A;  1YZ7 A;  1TK0 A;  2KFZ A;  3KFU F;  2HOF A;  1Z00 B;  3QUB A;  5J2A A;  3CK6 A;  1ZQG A;  4IR9 A;  1JMS A;  2K4H A;  5CFT A;  3OUY B;  4HX0 A;  1ZQZ A;  4J9S A;  4LEZ A;  2ZIV B;  4UAS A;  5KT5 A;  1JXL A;  2BDP A;  3K75 D;  2R8I A;  4KX5 A;  2LM4 A;  1X9S A;  2BCS A;  5CHE A;  2DR5 A;  3NVY A;  4NLB A;  3ER9 B;  2ALZ A;  3NGD A;  2KKP A;  5T14 A;  3PHZ A;  4EEN A;  7ICG A;  1NK4 A;  4AT8 A;  5KFZ A;  4PJ0 U;  4RQ2 A;  9ICH A;  5ALJ A;  2DF4 B;  4QNL A;  3MR6 A;  2C28 A;  5KT2 A;  1IV8 A;  5HR6 A;  1HUO A;  2ODG A;  3PV8 A;  4DF8 A;  2E8P A;  3PZP A;  4M5D A;  1JI7 A;  1Q78 A;  2HDO A;  2O1P A;  8ICI A;  3EW9 A;  1NI3 A;  5KFF A;  4KLF A;  2NRK A;  2M2U A;  4U6P A;  4R63 A;  2GO7 A;  4DFD A;  3OJU A;  2FCL A;  1QSL A;  2OWO A;  3SAH A;  4C7Y A;  2C22 A;  5CFS A;  5KFX A;  3ONN A;  4EED A;  4RQ0 A;  4C8N A;  4DS5 A;  2HN1 A;  5AM0 A;  4M0A A;  2L5Y A;  3PSF A;  2KSO B;  4RUA A;  5EE0 A;  4ECQ A;  5AI6 A;  1ZQE A;  3EPG A;  1ZET A;  2KOB A;  1ZQO A;  4I2G A;  2NRZ A;  2FPL A;  5AI9 A;  7ICL A;  2K4I A;  1BPD A;  4NJ8 A;  2MSN A;  9ICM A;  5J2J A;  4AYB C;  4NKU A;  5L1J A;  1TAQ A;  2R18 A;  2ES6 A;  4QZA A;  1XSN A;  2JZB A;  2KJ8 A;  2HBM A;  2NO5 A;  4KLQ A;  1O08 A;  5L1M A;  3RRH A;  2VA3 A;  3MGI A;  4R8U B;  5E79 U;  8ICU A;  1UQV A;  4QZG A;  2H3V A;  4NLN A;  4US8 A;  4X4P A;  4O69 A;  3RF9 A;  3RJE A;  1XSL A;  2M0N A;  2HHV A;  2WF9 A;  2ZUC A;  4TQS A;  5BPC A;  3PX4 A;  1SV4 A;  2XO7 A;  4Q43 A;  2E8N A;  4FBT A;  2MRL A;  5DQH A;  1ZQN A;  2LM1 A;  4P0P A;  3OVB A;  1JRP A;  4US9 A;  1NZB A;  4KLD A;  4YR0 A;  4KLL A;  4FHX A;  4UB6 U;  3H8M A;  5ALM A;  4FO6 A;  1L3U A;  2DQN B;  3KHL A;  1N5W A;  4DL7 A;  9ICI A;  4LEW A;  4DCC A;  3OPX A;  3Q8M A;  1L7O A;  4K4I A;  5B3P A;  4I2A A;  3CYM A;  3ED5 A;  5C5J A;  4O3S A;  2BQR A;  5KFM A;  1JXE A;  4UAY A;  2VIX A;  4QW9 A;  9ICC A;  1JUD A;  8ICV A;  3CP8 A;  1FO4 A;  2F76 X;  1GPJ A;  3WK5 A;  4F91 B;  3PR4 A;  1NJX A;  1Z4N A;  4E8F A;  1WG8 A;  2ZJ8 A;  4F71 A;  4Y2X A;  1C7Y A;  3OSN A;  4ECU A;  1V9P A;  3RR7 A;  4N7R A;  7ICQ A;  2K8A A;  4RQ3 A;  4O9M A;  3E2E A;  3KOO A;  2AGQ A;  3NUQ A;  3SEI A;  5J8Y A;  2C2D A;  1ZQS A;  4CDG A;  2Q4T A;  4RQ8 A;  1XO0 A;  2KK0 A;  2W04 A;  3ZD8 A;  1A0P A;  1BPE A;  4RQ1 A;  4DQS A;  4F2S A;  5TIS U;  4C0Z A;  1R8A A;  3H0L B;  2E8M A;  2KZZ A;  4C8M A;  3LK9 A;  2B56 A;  3H39 A;  1CEZ A;  1SGG A;  2ZUD A;  4J9O A;  2ESE A;  5KG2 A;  1T7P A;  1D9D A;  3I1Y A;  2G07 A;  2ZIX A;  4BWM A;  5HR9 A;  2HHP A;  5CEH A;  2W3R A;  3HIY A;  5KFR A;  5K4L A;  4B9M A;  4GIB A;  1ZD5 A;  1CRX A;  3FYH A;  1V85 A;  2VA8 A;  1TK5 A;  2HVI A;  8ICX A;  5AI5 A;  2GH1 A;  3QUC A;  3DEE A;  5JTI A;  3KZX A;  2PKE A;  2YMP A;  2OXO A;  2Y0S C;  4M2Y A;  2XY7 A;  1SKR A;  1WYG A;  2DWQ A;  4JLX A;  4FHY A;  3M7D A;  4J9N A;  5DBC A;  4JV1 A;  3BZC A;  4HYK A;  5AM1 A;  2F2A B;  5ALD A;  3MDA A;  4UBB A;  2OCE A;  3SAG A;  7ICK A;  4PHP A;  3SYZ A;  3L3F X;  4B9L A;  2Q66 A;  5KT4 A;  4RQ4 A;  1SL1 A;  1SWV A;  4QIW F;  5IIO A;  4RNM A;  3SEN A;  3WFP A;  1QQ7 A;  3KHG A;  4LVS A;  1VJ5 A;  4PHE A;  2DVI A;  2PFN A;  4MEX A;  4QWD A;  2UVW A;  1XNS A;  2JRZ A;  1NJZ A;  4QIW C;  3M9N B;  5ALG A;  4X0B A;  1KN5 A;  3AEV A;  3MR2 A;  3NVZ A;  4PL2 A;  1ZQU A;  4I28 A;  3BS5 B;  3ISC A;  1WCL A;  2VJ5 A;  3WK4 A;  4LT6 A;  3GQC A;  2VJ4 A;  2HHQ A;  5AKL A;  1KKX A;  4EZ6 A;  3M8S A;  1CUK A;  1DK3 A;  1RXV A;  4NL9 A;  2HBJ A;  1TK8 A;  4DQQ A;  2ZH3 A;  3AU2 A;  3I28 A;  4CF4 A;  1F5A A;  2ZJ5 A;  3ALR A;  2KZ3 A;  5AKX A;  9ICV A;  4F5P A;  1X66 A;  2ZIU A;  3WK9 A;  4NLG A;  2RDJ A;  9ICG A;  2IUB A;  3H0R B;  3SD7 A;  2K60 A;  3JPS A;  5HML A;  3NWI A;  2P6R A;  4EBC A;  1PX5 A;  4WBY A;  1Q8K A;  1RM6 C;  4C8O A;  4E7X A;  1L3T A;  2Q0Z X;  1X6I A;  5DKW A;  2NRX A;  2LKY A;  4DQR A;  1ZQV A;  4UB4 A;  1ZQT A;  3GZF A;  3RJG A;  4QZD A;  3M9M B;  2QAR B;  3ZDE A;  4DS4 A;  4GC7 A;  5KG3 A;  3QUQ A;  4ED1 A;  5J2I A;  5J8Y C;  2HHW A;  2DPJ A;  4ELV A;  4Y2J A;  4UW9 A;  4RPX A;  4OJ6 A;  1N60 A;  4RQ6 A;  2HBL A;  4E0D A;  4K9A A;  4I2C A;  4XQ8 A;  4WC0 A;  5EE1 A;  2A1A A;  4BXO A;  3HJ4 A;  2W3S A;  5J0O A;  5GTH U;  1NKE A;  2IBK A;  2AGP A;  2LYH A;  3C29 A;  2QKQ A;  4DSF A;  2EAP A;  2WFA A;  4JWM A;  3JZ0 A;  4C7Z A;  1KBU A;  2PFP A;  2XGP A;  4RWN A;  4YQW A;  1N63 A;  4B9S A;  4M04 A;  4OAI Z;  2PMZ F;  5ALZ A;  3HP6 A;  4NXX A;  4RWQ A;  3GFK B;  3AMZ A;  5G5G A;  3ORY A;  1EXN A;  1K1Q A;  2WHE A;  4Z6C A;  5KFJ A;  3HW8 A;  3V7J A;  3F5E A;  4BJQ A;  5F2V O;  2RRD A;  2KZM A;  1ZQY A;  4QWA A;  3D6J A;  2XCA A;  1QSY A;  1K1S A;  2JH7 A;  1F0M A;  2E1E A;  4EP7 A;  3AQN A;  5ALU A;  2W9B A;  4EEK A;  4UAT A;  1LKY B;  4UAU A;  5F9L A;  2Z7J A;  4DQP A;  7ICV A;  4IQT A;  7ICM A;  3AN1 A;  8ICK A;  1LB2 B;  4KLE A;  4GLX A;  5DG7 A;  4WCW A;  2XVT A;  4NLK A;  4DSK A;  1U45 A;  3SZ2 A;  2R8G A;  4CE6 A;  4U7C A;  7ICT A;  8ICH A;  5ALN A;  1N61 A;  2GAF D;  1Q46 A;  5AKK A;  5F9N A;  5KFQ A;  3F53 A;  1TVA A;  1SZP A;  2FMQ A;  1ECW A;  2EZY A;  5J2G A;  4FO1 A;  2FLN A;  8ICN A;  4M6W A;  2KKV A;  1ZQF A;  4Y2Y A;  1SL0 A;  1TKD A;  2G0A A;  3AQL A;  5KFV A;  4BX9 C;  1PK1 B;  4NL9 C;  5DGB A;  4YN4 A;  2HHS A;  1P7D A;  3BQ0 A;  4F92 B;  5EWG A;  1OU5 A;  4DFM A;  3V7K A;  4UD5 A;  2KHQ A;  2H3I A;  1AQ6 A;  2RHF A;  4F4K A;  3K7D A;  3WFO A;  4F4X A;  3QU9 A;  3C5G A;  3PW2 A;  1MSW D;  3HWT A;  1QTM A;  2W7O A;  3RJJ A;  2WAQ F;  9ICO A;  2ZXI A;  3GV7 B;  4DL4 A;  5GTI U;  2JEF A;  2Y1J A;  4UD4 A;  4UAV A;  2RFF A;  3R9K A;  4MHV A;  2DR7 A;  3E58 A;  4OJO A;  5A0L A;  2BKE A;  4RQ7 A;  4I2H A;  4RNN A;  4KLT A;  4KLO A;  2GOL A;  1JX4 A;  1YLQ A;  1XSP A;  2WAQ C;  1J2N A;  4M9H A;  3V6H A;  4I2F A;  5CB1 A;  1NK8 A;  4BWJ A;  5J0P A;  4USA A;  2ZJA A;  1HEK A;  4ZH4 A;  4RPY A;  2WF7 A;  1ZQD A;  4IR1 A;  2K4P A;  4R65 A;  3TAP A;  2W55 A;  1RYR A;  2ZH1 A;  5KFK A;  3PO5 A;  5IIN A;  3RJH A;  2XY6 A;  3F5A A;  1FIQ A;  4M9L A;  3N4M B;  2B4V A;  4B9V A;  3MR3 A;  1DRG A;  5KFL A;  5B66 U;  3UQ0 A;  3CRX A;  3F2D A;  3TAC B;  2IOF K;  3RBD A;  2F8L A;  5AM3 A;  4WH5 A;  4JMU A;  9ICS A;  2DRA A;  1HJP A;  4X4T A;  4WC2 A;  2KIV A;  3MR5 A;  1RYU A;  4DL3 A;  4C4S A;  3OV7 A;  3HT3 A;  4O5K A;  4YR2 A;  4IRK A;  1XS9 D;  2B21 A;  2KVS A;  5KFC A;  1X2I A;  4EX6 A;  1TAU A;  5KT6 A;  2XGQ A;  1NO5 A;  3OWG A;  3UMC A;  1KDH A;  4QZB A;  9ICQ A;  2DGZ A;  1KQQ A;  4S3N A;  2ZH8 A;  1D8L A;  4IC9 A;  4ATB A;  2BCU A;  1Z3E B;  4F5R A;  3C2M A;  5CHG A;  4G9B A;  1UET A;  5HC9 A;  5EWF A;  4P4O A;  2HMX A;  3NVW A;  3RH5 A;  4YG2 A;  9ICW A;  5III A;  4KLH A;  3EUB 2;  4TUQ A;  1UA0 A;  3O0F A;  2V4R A;  3H38 A;  3BQT A;  3UXN A;  4KLU A;  2AU0 A;  5KG5 A;  5JUM A;  5DBA A;  1A6S A;  4AT7 A;  3ISD A;  1ZQP A;  2KEY A;  4RQ5 A;  4IS7 A;  2HHT A;  3PML A;  3THV A;  4Y2S A;  2UVU A;  5IIM A;  1DXS A;  4WC6 A;  3IRU A;  4P0Q B;  4K99 A;  4QWE A;  2QB0 B;  5J2H A;  4RPZ A;  3GU3 A;  4DEZ A;  1SWW A;  4EX7 A;  3MFI A;  1ZQH A;  2RP5 A;  3WKC A;  2DUY A;  3AU6 A;  4FZN A;  3L9D A;  2B0C A;  3BZK A;  5AKH A;  2BCV A;  3M1Y A;  2W54 A;  1TFR A;  2HI0 A;  4FHV A;  3MGV A;  5D61 A;  1T8E A;  1QSS A;  4WC4 A;  1BVS A;  4X5V A;  5D4B A;  2BPG A;  3DDH A;  1CI4 A;  3MC1 A;  5ALH A;  4UBC A;  3T5L A;  2BCR A;  4JWN A;  3EZ5 A;  1PK3 A;  1Z00 A;  4ED6 A;  5KFB A;  4F8R A;  2D8C A;  5KL1 B;  1FA0 A;  2D3D A;  2KIW A;  2CN1 A;  3RJI A;  2G09 A;  3RB4 A;  2AQ4 A;  4IG8 A;  1BNP A;  3PMN A;  3CNH A;  3OUY A;  1MQ2 A;  1ZQC A;  3M6Z A;  1QCK A;  4GXK A;  1BPY A;  1URJ A;  4AYB F;  2ZIV A;  5ALT A;  3WK6 A;  4X0A A;  3KKA A;  4UB2 A;  4XJE A;  5ALW A;  2W7P A;  2F44 A;  7ICU A;  9ICE A;  3JYY A;  9ICA A;  3N7S C;  3TI0 A;  5DQI A;  4PZO A;  4J9Q A;  3HIL A;  4MF2 A;  3K1Z A;  3PSP A;  5KAF U;  3C28 A;  3TAN A;  2JMG A;  2A1J B;  3CW2 C;  3IG5 A;  4WC1 A;  3OHA A;  4LEY A;  1SKW A;  1SXE A;  4JB3 A;  2ZTC A;  2DR9 A;  1TE2 A;  3AUO A;  1UPH A;  2YML A;  1KL9 A;  1RZT A;  1N56 A;  1S0M A;  1UT8 A;  2KP7 A;  3PO4 A;  1NK9 A;  3MGH A;  7ICN A;  3PR5 B;  3LWM A;  4Q8E A;  2FJ6 A;  1Z4O A;  2PXI A;  5TZV A;  4K4G A;  2ZUB A;  4R64 A;  2YB1 A;  3HJE A;  4ECY A;  2M2T A;  1SIJ A;  4MFA A;  8ICB A;  3G6V A;  5KFN A;  5DGA A;  3ICX A;  1S0V A;  3V6J A;  4QJF B;  5HRG A;  1VDV A;  1N48 A;  3B0X A;  2NO4 A;  2HVH A;  2KSO A;  2OYY A;  1OXJ A;  5KG0 A;  4X4R A;  3F2B A;  3KHR A;  3H4D A;  2ATL A;  4NM1 A;  1S0O A;  3PY8 A;  5J0T A;  5J2C A;  3RBE A;  2W11 A;  5AK4 A;  4EBJ A;  2Y9T A;  5EOZ A; 
#chains in the Genus database with same CATH homology
 4PPX A;  4NLG A;  2RDJ A;  8ICJ A;  4DL5 A;  2V4Q A;  4EYI B;  9ICG A;  8ICS A;  3H37 A;  3JPS A;  5KFE A;  3RJF A;  8ICM A;  5KG4 A;  5L1I A;  4C8L A;  2W9C A;  5HML A;  1S77 D;  2P6R A;  4EBC A;  1PX5 A;  1SKS A;  4WBY A;  2ZTE A;  4C8O A;  1LV5 A;  3HX0 A;  4E7X A;  1L3T A;  2Q0Z X;  4RUC A;  3IM1 A;  5DB7 A;  1U49 A;  1KRP A;  3ZDB A;  5DKW A;  2NRX A;  3V7L A;  4DL6 A;  4KTQ A;  8ICW A;  1TFY A;  5J0Q A;  3H8S A;  4DQR A;  4R8U A;  2PI5 A;  2HHX A;  1ZQV A;  3RRG A;  4UB4 A;  4GC6 A;  3FDS A;  1ZQT A;  8ICF A;  3GII A;  3RJG A;  4KLS A;  2MAX A;  8ICO A;  3UXO A;  4QZD A;  3M9M B;  3ZDE A;  4DS4 A;  4GC7 A;  3PW7 A;  3M8R A;  4J9R A;  2PI4 A;  2ISP A;  5KG3 A;  5L1L A;  2JZB B;  2FPM A;  4TQR A;  3PNC A;  4ED1 A;  2ZHA A;  4DSJ A;  5J2I A;  3UPS A;  4PGX A;  1Y88 A;  4DL2 A;  2HHW A;  4ECZ A;  4ED7 A;  2DPJ A;  4NXZ A;  3UQ2 A;  5KTQ A;  2PFO A;  4ELV A;  5DB9 A;  3H3A A;  4RPX A;  3MBY A;  5J0X A;  3RH4 A;  4O5C A;  3PW4 A;  1PZN A;  3C1Z A;  4RQ6 A;  4WBZ A;  2XC9 A;  1NZP A;  5J2D A;  5HNK A;  4E0D A;  4AT9 A;  4I2C A;  5KFH A;  4XQ8 A;  1S97 A;  1KFT A;  2FLP A;  4WC0 A;  5KFW A;  1V4A A;  4KLJ A;  4ATB B;  1D9F A;  4BXO A;  3C18 A;  3HJ4 A;  4UQG A;  1KFD A;  5KFY A;  5J0O A;  3Q8S B;  2ZH7 A;  1R8C A;  1NKE A;  2HW3 A;  3C66 A;  2IBK A;  3RAQ A;  2Y1I A;  4DOA A;  2AGP A;  2LYH A;  4F5O A;  2ISO A;  4IRC A;  5KG1 A;  4DSF A;  4DFK A;  2I1Q A;  2KN7 A;  4JWM A;  4KLI A;  4P2H A;  3JZ0 A;  2ZH5 A;  2W9M A;  7ICO A;  1S10 A;  2PFP A;  3SV3 A;  2XGP A;  4M9J A;  4YQW A;  4RWN A;  3BDP A;  1RXW A;  4B9S A;  5HRB A;  4BGD A;  3WFS C;  9ICB A;  3IHQ B;  5HMM A;  2UVR A;  1ARO P;  3OGU A;  4M04 A;  4LZG A;  3TAR A;  4DSI A;  5HRI A;  8ICQ A;  3HP6 A;  4DWI A;  8ICA A;  4RWO A;  4RWQ A;  3EPI A;  3GFK B;  3AQK A;  3NTU A;  3ORY A;  4JV2 A;  3G6Y A;  1L5U A;  7ICH A;  1EXN A;  4AT7 B;  1KLN A;  1RYS A;  8ICE A;  4CCH A;  2WTF A;  1K1Q A;  4Z6C A;  5KFJ A;  3HW8 A;  3V7J A;  4ED2 A;  3BJY A;  4PHD A;  3HJ1 A;  3V6K A;  2DRB A;  3GDX A;  3PVX A;  5F2V O;  4WC7 A;  1ZQB A;  1U47 A;  2KZM A;  1ZQY A;  2BGW A;  3RJK A;  5J2E A;  4QWA A;  2XCA A;  1QSY A;  1K1S A;  4MFF A;  5CJ7 A;  1Q79 A;  4EP7 A;  2C2R A;  5BOL A;  3AQN A;  4RT3 A;  9ICJ A;  4J9M A;  1DOQ A;  2BPC A;  2W9B A;  3RH6 A;  4M47 A;  1U4B A;  2AJQ A;  5F9L A;  3OHB A;  3JPP A;  1L3V A;  4DQP A;  3V72 A;  7ICV A;  3C21 A;  3QE9 Y;  2NRW A;  4I2I A;  1ZYQ A;  4IQT A;  4EZ9 A;  7ICM A;  5DBB A;  8ICK A;  4I2J A;  4M9G A;  1S76 D;  2XY5 A;  1LB2 B;  4ED0 A;  1WCN A;  4KLE A;  4GLX A;  3T5J A;  4DLG A;  5DG7 A;  4X4N A;  4QZ9 A;  4GXI A;  3H7I A;  4NLK A;  3RTV A;  5KFU A;  1U45 A;  4DSK A;  3SZ2 A;  4WCW A;  1KFS A;  4ED8 A;  3GV8 B;  2R8G A;  4B9N A;  7ICS A;  4F5N A;  4IQW A;  3JPQ A;  4UAZ A;  2KFN A;  1TFW A;  1KTQ A;  2M9N A;  4KIT B;  7ICT A;  8ICH A;  5HRH A;  4RZR A;  2BQ3 A;  3PX0 A;  5F9N A;  3OSP A;  5KFQ A;  3LWL A;  5IIL A;  1S9F A;  2ZH9 A;  1TVA A;  1JQR A;  4WC3 A;  1SZP A;  2FMQ A;  3QEA Z;  3Q8R B;  2M2W A;  1D8Y A;  5HRE A;  4JK1 A;  1KEJ A;  5J2G A;  3RB3 A;  1TK0 A;  3M9O B;  2KFZ A;  5J2K A;  2FLN A;  8ICN A;  1ZJN A;  1UA1 A;  1Z00 B;  4M6W A;  1ZQF A;  5J2A A;  1SL0 A;  1TKD A;  4ELU A;  5J0S A;  1ZQG A;  5HRD A;  3AQL A;  4PHA A;  5DB8 A;  5KFV A;  4EBE A;  1MIW A;  4IR9 A;  1JMS A;  5DGB A;  4X4U A;  3JPR A;  5KG7 A;  5DB6 A;  1XC9 A;  4YN4 A;  2J6T A;  1NK7 A;  1R8B A;  3GIK A;  5HHI A;  4YMN A;  4YFK A;  3ZDD A;  2HHS A;  4YXJ A;  3T3F A;  3OUY B;  1HUZ A;  3BQ0 A;  1SL2 A;  4F92 B;  5EWG A;  1ZQZ A;  5CWR A;  4J9S A;  3C23 A;  4DFM A;  3GIM A;  2C2E A;  3V7K A;  1OU5 A;  5KT5 A;  4UD5 A;  2W8L A;  1JXL A;  1COO A;  2BHN A;  2BDP A;  4F4K A;  3K75 D;  2A1J A;  2R8I A;  4ED3 A;  3Q8L A;  2P66 A;  1IM4 A;  5DED A;  3C2K A;  1KSP A;  3WFO A;  1ZQM A;  3WFR E;  4F4X A;  1X9S A;  3C5G A;  2BCS A;  3ZDC A;  3PW2 A;  1VFG A;  3KHH A;  3HWT A;  1MSW D;  2DR5 A;  5HRF A;  4IQV A;  1QTM A;  2ALZ A;  3NGD A;  3RJJ A;  8ICY A;  9ICO A;  5L9X A;  2J6U A;  3Q8P B;  2FPK A;  3GV7 B;  7ICG A;  1WOT A;  4DL4 A;  5KFG A;  2JEF A;  1ZQK A;  2Y1J A;  1NK4 A;  5J0W A;  4ECS A;  1A77 A;  5DG8 A;  4UD4 A;  3JPT A;  5KFZ A;  4AT8 A;  4RQ2 A;  2RFF A;  4FHP A;  4QZI A;  9ICH A;  2M2V A;  3RAX A;  2DR7 A;  4UAW A;  2BKE A;  4RU9 A;  2AQ0 A;  1ZQX A;  4RQ7 A;  4I2H A;  4RNN A;  4KLT A;  4QW8 A;  2IHM A;  4KLO A;  5DDM A;  1JX4 A;  1YLQ A;  1XSP A;  3MR6 A;  2C28 A;  5KT2 A;  4QZH A;  1VJ7 A;  1NKB A;  4M9H A;  3V6H A;  2DFL A;  3ZD9 A;  4MEY A;  4I2F A;  4DQI A;  1HUO A;  3AQM A;  2NRV A;  5CB1 A;  4MF8 A;  1NJY A;  1NK8 A;  4BWJ A;  5J0P A;  3QZ8 A;  8ICR A;  2ZJA A;  3PV8 A;  7ICE A;  4DF8 A;  4ZH4 A;  4DO9 A;  4RPY A;  1ZQD A;  4M5D A;  1Q78 A;  4QZE A;  1ZQQ A;  3MAB A;  4R65 A;  4IR1 A;  8ICI A;  2O1P A;  3EW9 A;  4QZF A;  4IQU A;  2BPF A;  2ASL A;  3TAP A;  5KFF A;  4KLF A;  1QLN A;  1U48 A;  2NRK A;  5DEC A;  2FMP A;  1RYR A;  2M2U A;  3OJS A;  5D49 A;  4R63 A;  3H8W A;  5KFI A;  2ZH1 A;  5J0U A;  5KFK A;  3ETL A;  4FH5 A;  5HRL A;  3JPO A;  3PO5 A;  3OJU A;  9ICX A;  5IIN A;  3BQ2 A;  4DSE A;  3RJH A;  1NOM A;  1XU4 A;  4DF4 A;  2XY6 A;  1QSL A;  2OWO A;  4FH3 A;  4M9L A;  3N4M B;  2C22 A;  3UPQ A;  4Z6F A;  5KFX A;  4QZC A;  4B9V A;  3MR3 A;  5KT3 A;  5KFL A;  3UQ0 A;  3SI8 A;  4RQ0 A;  4C8N A;  4DS5 A;  4YD1 A;  1NK0 A;  4M0A A;  3RBD A;  2ASJ A;  4FHW A;  1NK5 A;  4B9T A;  4RUA A;  4ECQ A;  4EBJ A;  4EBD A;  2IHN A;  9ICS A;  1ZQE A;  2GWS A;  2DRA A;  1HJP A;  4YD2 A;  4X4T A;  3EPG A;  1ZET A;  5KFT A;  1ZQL A;  4WC2 A;  4MFC A;  4ECR A;  3MR5 A;  1ZQO A;  4DOB A;  4Q45 A;  4I2G A;  3OVS A;  2NRZ A;  2FPL A;  4DL3 A;  4O3O A;  5DQG A;  4NKT A;  7ICL A;  1BPX A;  4YP3 A;  1BPD A;  3HT3 A;  3OV7 A;  4EYH B;  4O5K A;  1ZQJ A;  4YR2 A;  4IRK A;  1XS9 D;  9ICM A;  4JV0 A;  5J2J A;  9ICP A;  2B21 A;  4NKU A;  5L1J A;  1TAQ A;  2MUT B;  5KFC A;  2R8K A;  4I29 A;  1X2I A;  4IRD A;  1ZJM A;  5KT6 A;  2XGQ A;  4PH5 A;  1TAU A;  4QZA A;  5D46 A;  2JZB A;  1XSN A;  4KLQ A;  3NYB A;  3RRH A;  3KTQ A;  8ICL A;  1NO5 A;  2VA3 A;  1DK2 A;  3MGI A;  1JN3 A;  1KDH A;  4Q44 A;  1BGX T;  4XRH A;  4R8U B;  4R66 A;  4QZB A;  2P6U A;  9ICQ A;  2ZH2 A;  4YCX A;  3Q8Q B;  3QZ7 A;  8ICU A;  1UT5 A;  4QZG A;  1UEV A;  1D8L A;  4S3N A;  2W9A A;  4NLN A;  5KFP A;  8ICT A;  2ZH8 A;  4X4P A;  5KFA A;  1IXR A;  3RJE A;  4JUZ A;  1XSL A;  2V9W A;  1JIH A;  4Z6D A;  4O5E A;  2HHV A;  2I9G A;  4ATB A;  3OVA A;  2BCU A;  2ZUC A;  4TQS A;  1Z3E B;  5BPC A;  4F5R A;  5HP4 A;  4YVZ A;  5DG9 A;  3C2M A;  3PX4 A;  4DOC A;  5CHG A;  4UB5 A;  1UET A;  1A76 A;  2XO7 A;  4LZD A;  3PW5 A;  5BOM A;  5EWF A;  4O3P A;  5CR0 A;  4B9U A;  2BE3 A;  4DSL A;  5HC9 A;  4P4O A;  4FBU A;  5KFD A;  2W8K A;  4Q43 A;  3MFH A;  4YG2 A;  3RH5 A;  9ICF A;  1B43 A;  5III A;  4AT9 B;  4XA5 A;  4KLH A;  4FBT A;  3H40 A;  5J0Y A;  2JEG A;  1U9L A;  4XUS A;  4F4W A;  4TUQ A;  3EWA A;  1UA0 A;  3C5F A;  4DFJ A;  4BXO B;  5DQH A;  2V4R A;  1ZQN A;  3H38 A;  4NLZ A;  4C8K A;  3BQT A;  5CA7 A;  4I2E A;  3OVB A;  4P4P A;  1BPZ A;  4KMU A;  2VAN A;  3UXN A;  4P4M A;  4ECV A;  4KLU A;  3H8J A;  2AU0 A;  4KLD A;  4YR0 A;  4E80 A;  4KLL A;  4J9P A;  5KG5 A;  5JUM A;  5DBA A;  4FHX A;  3ISD A;  5KFS A;  1S0N A;  1ZQP A;  4F93 B;  9ICL A;  4AT7 A;  4RQ5 A;  3SV4 A;  1T3N A;  4YMM A;  2J6S A;  2DPI A;  4FO6 A;  1L3U A;  2R8J A;  4PGY A;  3KHL A;  3G6X A;  4DL7 A;  2HHT A;  9ICI A;  3EYZ A;  3PML A;  3THV A;  3Q8M A;  2UVU A;  2BCQ A;  5IIM A;  4KLG A;  4WC6 A;  3N97 B;  4K4I A;  4EBK A;  4I2A A;  5J2B A;  5CP2 A;  5C5J A;  4I2D A;  4O3S A;  2BQR A;  1XO1 A;  5KFM A;  1NK6 A;  1JXE A;  4QWE A;  4WC5 A;  4UAY A;  2ZTD A;  5J2H A;  5J29 A;  4RPZ A;  4QW9 A;  9ICC A;  4DEZ A;  3ZDA A;  9ICN A;  3TFR A;  7ICI A;  8ICV A;  3H4B A;  7ICR A;  1ZQW A;  2F1I A;  4YR3 A;  3B0Y A;  2HHU A;  2F1H A;  3MFI A;  1ZQH A;  2MUT A;  4F91 B;  2IA6 A;  3C2L A;  3UXP A;  3PR4 A;  3AU6 A;  1NJX A;  4FS1 A;  4E8F A;  3L9D A;  2H5X A;  4Z6E A;  2ZJ8 A;  3MDC A;  2W9B B;  3TQ1 A;  1C7Y A;  2BCV A;  3OSN A;  4ECU A;  1V9P A;  3RR7 A;  2R8H A;  1X9W A;  7ICQ A;  4RQ3 A;  3TFS A;  4O9M A;  4I2B A;  1TFR A;  3E2E A;  3PX6 A;  3RB6 A;  4FHV A;  2AGQ A;  4M9N A;  4X4S A;  2C2D A;  2FLL A;  1ZQS A;  8ICZ A;  5L1K A;  4RQ8 A;  5HHH A;  1T8E A;  1QSS A;  4G3I A;  4UB1 A;  4WC4 A;  1BVS A;  4X5V A;  3ZD8 A;  5D4B A;  1L3S A;  4K4H A;  2ZHB A;  4RQ1 A;  1BPE A;  2BPG A;  4DQS A;  4F2S A;  1R8A A;  2PBE A;  2KZZ A;  4UBC A;  4C8M A;  3LK9 A;  4DLE A;  3T5L A;  3H39 A;  1CEZ A;  9ICR A;  2ZUD A;  5IIK A;  2BCR A;  4JWN A;  3EZ5 A;  1Z00 A;  5DLG A;  4J9O A;  5KG2 A;  5KFB A;  4ED6 A;  1T7P A;  3K4G A;  4F8R A;  1D9D A;  1FA0 A;  5KFO A;  4BWM A;  4BDP A;  4O3R A;  3RJI A;  2BQU A;  4O3N A;  4ECT A;  3RB4 A;  1TV9 A;  1NJW A;  5HR9 A;  2HHP A;  4YMO A;  2AQ4 A;  4IG8 A;  1BNP A;  4FS2 A;  3PMN A;  3HIY A;  3T5H A;  2ZH4 A;  5KFR A;  7ICJ A;  4QWC A;  3OUY A;  4B9M A;  4M6W B;  1MQ2 A;  1ZQC A;  4GXK A;  1ZQA A;  5DLF A;  1BPY A;  4X0A A;  3FYH A;  4UB2 A;  2XCP A;  2VA8 A;  1TK5 A;  2HVI A;  1T4G A;  2KTQ A;  8ICX A;  1KNY A;  4EEY A;  4NM2 A;  2VA2 A;  7ICU A;  9ICE A;  3JYY A;  9ICA A;  4M2Y A;  1UEU A;  4DFP A;  4TUP A;  2XY7 A;  4ECX A;  1SKR A;  4KLM A;  2IMW P;  4FHY A;  3TI0 A;  5DQI A;  4J9N A;  4J9Q A;  8ICP A;  3WFQ E;  5DBC A;  4UB3 A;  4TUS A;  4F4Y A;  2ASD A;  4JV1 A;  3TAQ A;  4MF2 A;  9ICU A;  4Q8F A;  2W9C B;  4HYK A;  1DGS A;  5KT7 A;  3TAN A;  2A1J B;  4WC1 A;  4RWP A;  4KN7 A;  3OHA A;  3MDA A;  4RNO A;  4F50 A;  1MQ3 A;  4UBB A;  7ICK A;  1SKW A;  4PHP A;  3SYZ A;  2F1J A;  1R89 A;  3GIL A;  4B9L A;  5KT4 A;  4RQ4 A;  1SL1 A;  1BNO A;  2Q66 A;  9ICK A;  4X4V A;  3GV5 B;  2ZTC A;  5IIO A;  1MIY A;  4RNM A;  2ID1 A;  3WFP A;  3AUO A;  4GXJ A;  2DR9 A;  2NRT A;  1ZQR A;  1MC8 A;  4XQ7 A;  4X4O A;  3KHG A;  4AT8 B;  3T5K A;  1X9M A;  4LVS A;  4YXM A;  1BPB A;  1RZT A;  4PHE A;  2PFQ A;  1N56 A;  2DVI A;  1S0M A;  4J9K A;  4MEX A;  2FMS A;  2PFN A;  4QWD A;  1UT8 A;  1H38 A;  2UVW A;  2KP7 A;  8ICC A;  3PO4 A;  1NK9 A;  1NJZ A;  3M9N B;  3Q8K A;  2BR0 A;  8ICG A;  3MGH A;  4X4Q A;  4X0B A;  3RB0 A;  1XWL A;  3PR5 B;  2AGO A;  7ICN A;  3LWM A;  3MR2 A;  4Q8E A;  3ISB A;  2JEJ A;  1JAJ A;  5J2F A;  1ZQU A;  2PXI A;  3PW0 A;  4K4G A;  5TZV A;  5HRK A;  2ZUB A;  3RR8 A;  4I28 A;  4R64 A;  4J9L A;  3ISC A;  2M2T A;  4ECY A;  1ZQI A;  4F4Z A;  4I27 A;  4MFA A;  4KN4 A;  1WCL A;  4PGQ A;  3HPO A;  8ICB A;  3G6V A;  5KFN A;  4TUR A;  3BQ1 A;  5DGA A;  1B22 A;  4F5Q A;  4LT6 A;  3GQC A;  5DDY A;  3V6J A;  1S0V A;  2HHQ A;  7ICP A;  5HRG A;  1N48 A;  4EZ6 A;  3B0X A;  4RT2 A;  5KG6 A;  3M8S A;  1CUK A;  2JEI A;  9ICT A;  4O3Q A;  2HVH A;  1DK3 A;  1RXV A;  4ELT A;  3LDA A;  1MIV A;  3GIJ A;  1TK8 A;  4DQQ A;  5KG0 A;  5J0R A;  4X4R A;  4F2R A;  3AU2 A;  2ZH3 A;  1F5A A;  3KHR A;  3C1Y A;  4QZ8 A;  2ZJ5 A;  2RDI A;  2KZ3 A;  3LQC B;  3H4D A;  2ATL A;  2O5A A;  2UVV A;  4ECW A;  1NKC A;  1S0O A;  4QWB A;  3PY8 A;  4F3O A;  4NM1 A;  9ICV A;  4F5P A;  7ICF A;  5EWE A;  5J0T A;  5J2C A;  3RBE A;  2ZH6 A;  3JPN A;  2DR8 A;  9ICW A;  5IIJ A;  1RPL A;  4O0I A;  5EOZ A;  4NY8 A;  3QEB Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...