4PHAA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phaA03
3OGUA 3MFHA 2DRAA 3C21A 9ICPA 1SL1A 4XUSA 5J0RA 4YR2A 3RJJA 4DL7A 9ICVA 3FYHA 2HHVA 2JEGA 2KFNA 2ZUBA 4WC6A 3BQ0A 3NTUA 5KG7A 1KFSA 4WCWA 5DECA 2ZH8A 1NOMA 4J9QA 2DVIA 4JV0A 5KFAA 2VA8A 3BQTA 4F91B 1HUOA 2PFQA 3WFSC 1XSNA 4DOBA 5KT4A 4FHXA 4RUAA 3MR3A 2PI5A 1SKRA 2BCQA 4I2GA 4O0IA 4PPXA 5J2HA 2ZHBA 4DQSA 4RQ8A 4DSLA 3FDSA 4RT2A 4DSIA 5KFLA 1BPXA 2R8JA 3C5FA 4KLEA 9ICEA 2DR7A 1NKCA 9ICOA 9ICSA 4IR9A 2HHSA 3UXNA 1JXLA 4M9HA 3RBEA 4MEXA 1KFTA 1L3UA 1BPZA 4WC3A 4WC5A 3EPIA 5J0WA 3M8SA 3TANA 2BGWA 1D9DA 9ICUA 1K1QA 1TV9A 3HT3A 5TZVA 2IA6A 9ICGA 2NRVA 5DBAA 5J0XA 4B9SA 3UPQA 3H8SA 9ICLA 4TQSA 8ICZA 8ICOA 4EBJA 1UEVA 3JPNA 4RQ6A 1MC8A 5KFTA 5CB1A 7ICQA 2BDPA 5EOZA 8ICTA 1QSSA 2H5XA 4YN4A 3ZD8A 5J2AA 4UBBA 2ZTCA 3Q8SB 4ED6A 5IIJA 3RJKA 3PY8A 1PZNA 2M2UA 4I27A 5HRGA 1S97A 2BHNA 3UPSA 4FHVA 3C1YA 1WCNA 3UQ2A 3OSNA 1JX4A 4F50A 4QWCA 2FPKA 1S76D 1R8AA 4DLEA 3L9DA 1UA1A 2DFLA 4GXIA 2ZJ5A 3MFIA 4ELVA 2ASJA 1JAJA 4J9PA 2P6RA 9ICKA 4ATBA 2HVIA 1MIWA 4LZGA 5DBCA 4X4PA 4KN7A 5KTQA 5L1KA 2KTQA 4QZDA 4JK1A 2Q66A 3E2EA 4QZGA 4E8FA 5EWEA 3PO4A 4RPXA 4ED7A 3KHGA 5DQHA 2BCVA 4RT3A 5HRLA 4AT9B 4F5OA 5KFSA 4ELUA 4IG8A 4DL6A 1NK0A 1HJPA 3GV8B 7ICOA 2P6UA 4TURA 2KP7A 1R8BA 1DK3A 4NM2A 5DG9A 3RAXA 2FMQA 5KG5A 5F9LA 4AT8B 4WC2A 3EYZA 2ATLA 3THVA 2A1JA 2BPCA 5HMMA 2NRWA 4BWJA 3JPOA 3KHLA 1DGSA 1COOA 5KFEA 4J9KA 3QEAZ 2ALZA 1KFDA 3G6VA 5IIMA 2ZJ8A 1BPBA 2Q0ZX 5J2KA 4MF2A 1JQRA 3B0YA 2RFFA 2BPFA 2R8GA 5J2IA 4DQPA 4IRKA 4KLLA 4B9MA 4UD5A 5KFZA 3JPQA 4QW8A 4E7XA 2ZHAA 4KTQA 4J9SA 4WC4A 2HHQA 1EXNA 9ICTA 5DLFA 4O5KA 2XGQA 5IINA 4X0AA 5J2EA 4EYIB 1ZQYA 4ED1A 4DEZA 4F3OA 9ICQA 4NM1A 4J9LA 5L1LA 1RZTA 8ICKA 5HRFA 4XQ8A 4QZIA 1S0MA 1KTQA 1ZQHA 4RQ7A 2DPIA 3ZDBA 2NRKA 1XWLA 3RB6A 4NLKA 4RU9A 4FHWA 4EP7A 4M9NA 4WBZA 2ZH3A 3KHHA 2ZH2A 2MUTB 1RYSA 2AGOA 2VA3A 4RNOA 2ZTDA 3PV8A 2ISOA 4F5NA 5DGAA 1QLNA 2J6TA 4GXJA 4NXZA 9ICJA 5KT5A 3GQCA 1S0NA 4M04A 1MIYA 1CEZA 3C2KA 4LT6A 1Z00B 5KG3A 5KFJA 4C8NA 3V6HA 3QEBZ 5J2FA 4F2RA 1XS9D 4F93B 2R8IA 5KT2A 3TFSA 9ICHA 2AQ4A 2JEJA 2VANA 5KFFA 3TARA 1RYRA 3HJ1A 3OVBA 3HW8A 5HRIA 4QZEA 5CA7A 2W9BA 4O3PA 3H4DA 3RJEA 2MAXA 4NLGA 1TAUA 4TQRA 4I2EA 5J2DA 5HRKA 2IBKA 1BPEA 4I2JA 3H7IA 4ED8A 4DSEA 1XSLA 5KFVA 3PR5B 3OHBA 5HHHA 4PHDA 1ZQGA 3PW7A 2HW3A 4YP3A 1N56A 5DBBA 3ETLA 4GC6A 8ICEA 4RQ4A 2C2RA 8ICYA 2FMPA 3KTQA 4F5PA 4C8OA 3H38A 4UAZA 4WBYA 4UAWA 1TAQA 4ECSA 1FA0A 3LQCB 8ICUA 3RBDA 5L9XA 4ELTA 4DF4A 4S3NA 1TK5A 2XCPA 2Y1JA 2RDIA 4UB3A 8ICWA 1ZQLA 3WFQE 3GILA 4GC7A 2JEFA 4X4NA 1KLNA 5DDMA 4UB2A 2AJQA 2C22A 1ZQVA 3SV4A 4M9JA 4E80A 3T5HA 2ZUDA 4QZFA 2UVWA 4F8RA 4RQ2A 4RQ1A 5HHIA 4Q44A 5J0UA 4YR0A 4DQQA 1S10A 3RR7A 5DQIA 8ICIA 3MDAA 3AQNA 4X4SA 4YCXA 1XC9A 4X4QA 5HNKA 5BOLA 4UB1A 3RB0A 3OSPA 5DB8A 5BPCA 3PW0A 2DPJA 5CP2A 4GXKA 1MSWD 4QZ9A 1UEUA 2BE3A 9ICAA 5J0YA 1RPLA 3GDXA 1VJ7A 4WC0A 5KFOA 3K75D 2IHMA 4XA5A 9ICIA 4BXOB 2PFOA 1XU4A 1ZQWA 3HP6A 4DSFA 1T3NA 1NKEA 4I28A 4M6WB 3QZ7A 5HC9A 1ZQKA 3H8JA 7ICHA 4UAYA 3UQ0A 3ISBA 4RZRA 2ID1A 4ED3A 4X4UA 2R8KA 2KZ3A 4QWEA 3V6KA 1TFRA 2ZJAA 4EBEA 5DQGA 1BGXT 4R63A 3RAQA 1WCLA 4RQ5A 4EBDA 1RXVA 1PX5A 1KEJA 4YQWA 2P66A 2W8KA 5D4BA 7ICFA 4I2BA 4EBKA 4F5RA 5JUMA 2HHXA 2M2WA 4DOCA 4XRHA 2VA2A 4RWNA 4KLIA 4F92B 3EPGA 5HMLA 1ZQCA 4WC1A 4M6WA 7ICKA 1JMSA 1SL0A 1R89A 3GFKB 1KRPA 4KLFA 3Q8QB 5CJ7A 1ZYQA 4RWQA 4O9MA 4AT7A 4FHYA 2ASLA 5J2CA 4ED0A 8ICMA 5HREA 2XC9A 1Q79A 4YD2A 1ZQNA 1ZQDA 4KLSA 3H37A 7ICMA 5J29A 4O3RA 2W9MA 3MR2A 1ZQIA 7ICJA 2XGPA 9ICNA 3ZDEA 2AGPA 2J6UA 3Q8RB 1NK8A 5J2GA 4KLQA 3PX0A 3WFRE 3B0XA 7ICSA 2W9AA 3N97B 3MABA 3V6JA 1KDHA 1ZETA 1NK5A 1X9MA 4B9TA 1L5UA 1NJWA 8ICSA 5DB6A 2FPLA 4YD1A 4ED2A 2Y1IA 1UETA 3RR8A 3MGIA 2BQ3A 3MDCA 3EZ5A 2KN7A 5IIOA 4LVSA 2KZMA 1UT8A 4F4XA 4F2SA 4Z6DA 3T3FA 4O3OA 4PGQA 4FHPA 4IR1A 1ZQEA 5L1IA 3PMLA 3TAPA 4QWBA 3ZDCA 1V9PA 2XY7A 2PXIA 2I9GA 3PW2A 5F9NA 2KZZA 4M2YA 8ICRA 1D9FA 4WC7A 1NJZA 1NJXA 4EBCA 4ECUA 7ICEA 4I2FA 4FS2A 4DS5A 4DSKA 2PFPA 4O5CA 1NO5A 2BQUA 4QZCA 4NLNA 9ICWA 4ECTA 5J0PA 4P4MA 3MBYA 3G6YA 5J0SA 5KFBA 4YFKA 2W9BB 3UXPA 3QE9Y 4I29A 4ECYA 8ICPA 4PGXA 3ISDA 2B21A 3RTVA 3PW4A 3RJHA 2M2TA 4F5QA 1ZQXA 4RQ0A 5EWFA 1T7PA 2W9CB 5KG1A 2HVHA 2ZH7A 4X4RA 4M47A 1BPDA 5KT7A 3PW5A 5KFRA 1LV5A 1KSPA 1MIVA 4R65A 1QTMA 3V7JA 4IRDA 1YLQA 4XQ7A 3M9OB 2ZH1A 3PO5A 4M5DA 4FH3A 3GIJA 2HHTA 3Q8MA 2HHPA 2I1QA 5KFDA 4MF8A 3HPOA 4Z6CA 1S77D 4B9NA 3JPRA 2HHUA 4PHPA 1ZQAA 1TK8A 3C2LA 3RB4A 7ICTA 1Q78A 1TVAA 1BVSA 2BPGA 4DLGA 4BWMA 4I2HA 2HHWA 4DFJA 4QW9A 4HYKA 3AU2A 3H8WA 4Q43A 3SYZA 1BNOA 1F5AA 4GLXA 1B43A 5KFPA 3OJSA 4J9OA 1A77A 4YR3A 4IRCA 1SZPA 1WOTA 3AU6A 2OWOA 4DS4A 4KLOA 5KT6A 3HWTA 2XY6A 1NK4A 2UVVA 1HUZA 2XY5A 1U45A 5KFCA 1SKWA 7ICRA 5C5JA 4I2AA 4O5EA 3HJ4A 3JYYA 3ZD9A 4X4TA 4QZBA 3C5GA 1NJYA 4UQGA 1X9WA 4TUPA 1S0OA 1X2IA 1XO1A 1UA0A 3OV7A 2A1JB 2DR8A 3Q8KA 4FO6A 1L3TA 5DEDA 3OVSA 2FMSA 4O3NA 3JPPA 3M9NB 2FPMA 2LYHA 1ZQUA 4KLTA 2F1IA 1NK6A 4MEYA 4R8UB 3C2MA 4FS1A 4FH5A 3K4GA 3T5KA 2ZH6A 4R8UA 4MFAA 3PR4A 2ZH5A 5DLGA 3HIYA 4ECRA 9ICXA 5KG6A 1Z00A 4BDPA 3OHAA 3BJYA 3RJIA 5J2JA 1AROP 3TI0A 1H38A 4BXOA 4QZ8A 4YXJA 3V7LA 3G6XA 4ECQA 3RH4A 1T8EA 4Q8EA 1VFGA 7ICUA 5IIIA 4YMNA 1ZQFA 2F1HA 5BOMA 4IQTA 2V4RA 9ICMA 2PBEA 5J0QA 1ZQJA 4J9RA 3C18A 1SL2A 2PFNA 4ATBB 4MFFA 4X4VA 4X0BA 3H4BA 9ICCA 4DFPA 3RJGA 1DOQA 4DFKA 1Z3EB 5IIKA 4RWOA 3BQ1A 5KFWA 2XO7A 8ICVA 4RUCA 3PX4A 5DGBA 2ZUCA 1B22A 1UT5A 2NRTA 4PHAA 5KT3A 3GV5B 5DB7A 4P4OA 4M0AA 5DDYA 5KFXA 4B9VA 2C2DA 2O1PA 1ZQRA 3ORYA 2BCUA 4LZDA 4M9LA 4RPZA 3HX0A 4KN4A 4RNMA 2ISPA 3GIMA 8ICNA 3M9MB 2KFZA 1OU5A 5CHGA 3JPSA 2ASDA 3SZ2A 4KMUA 4PH5A 1JN3A 5D49A 2AGQA 1D8LA 4B9UA 4C8MA 2BCRA 3PMNA 2O5AA 3AQKA 3RRGA 3WFOA 1TFWA 1D8YA 1NK9A 7ICGA 1R8CA 4DOAA 2IMWP 4QWDA 4YMMA 5DB9A 4F4ZA 8ICAA 5HRHA 4PGYA 4RNNA 1ZQOA 5IILA 2GWSA 1JXEA 4IQUA 5KFIA 3OJUA 1T4GA 3MR5A 3H3AA 3RH5A 3LWMA 4DL4A 3PX6A 4KLDA 4Q8FA 4QWAA 3NYBA 3WFPA 8ICQA 2M9NA 4RQ3A 3RB3A 4I2CA 4KLGA 4YXMA 3EW9A 1C7YA 4UBCA 5HP4A 3ZDDA 4O3QA 8ICJA 2FLLA 1NKBA 4QZAA 5J0OA 3ZDAA 4JWNA 4DWIA 1NZPA 3SI8A 4KLMA 5HR9A 5KFQA 1TFYA 4YMOA 4JWMA 2FLNA 2M2VA 1KNYA 1U9LA 4TUSA 4BGDA 4UB4A 3T5LA 1QSYA 2FLPA 5EWGA 1ZQBA 2MUTA 3LWLA 2W8LA 4ECVA 3PVXA 1BNPA 2DR5A 3AQMA 4G3IA 3BDPA 1ZQSA 4EYHB 4C8KA 8ICGA 1MQ2A 1ZQTA 3GIIA 1U48A 4C8LA 5L1JA 3TQ1A 3Q8LA 3GV7B 2BR0A 8ICFA 4X4OA 1V4AA 4NKTA 2JZBA 3IM1A 5KFUA 5KFMA 4R64A 3N4MB 4K4GA 3OVAA 4J9NA 1DK2A 1ZQPA 3MR6A 2WTFA 4O3SA 4UD4A 4JUZA 4I2DA 2IHNA 7ICIA 3H39A 4RPYA 4EZ9A 5DG8A 4Q45A 3LK9A 3RH6A 3T5JA 7ICNA 4TUQA 2C2EA 2PI4A 3M8RA 5KFHA 3NGDA 4R66A 5HRBA 3LDAA 3SV3A 5CWRA 3QZ8A 5D46A 4DO9A 4AT7B 4Z6EA 3AUOA 1QSLA 4AT8A 2V9WA 1IM4A 4PHEA 5DKWA 4E0DA 1NK7A 5KFGA 4DFMA 9ICFA 9ICRA 3AQLA 1U4BA 4CCHA 4KITB 5F2VO 4P4PA 5J2BA 2W9CA 4DL5A 3UXOA 3RRHA 1Y88A 1ZQMA 5KG0A 4DQRA 4AT9A 8ICCA 4DL3A 4NY8A 4ECZA 4NKUA 3H40A 3RJFA 5KFNA 1TK0A 4K4HA 4F4KA 4Z6FA 3GIKA 4ECWA 4F4YA 3C23A 2NRZA 4ECXA 2UVRA 4EZ6A 4KLJA 8ICBA 5KFYA 2AQ0A 3PNCA 3TAQA 8ICXA 4ZH4A 4J9MA 3C66A 5DG7A 5J0TA 1TKDA 5KG2A 4DQIA 4JV1A 3JZ0A 1K1SA 1S0VA 1ZQZA 2DRBA 2V4QA 5KFKA 4DF8A 4B9LA 7ICPA 9ICBA 1X9SA 4NLZA 5CR0A 4MFCA 3C1ZA 1BPYA 7ICVA 4YVZA 1L3SA 2F1JA 4IQWA 1U49A 4DL2A 2UVUA 3ISCA 1XSPA 4DSJA 1ZQQA 4M9GA 4IQVA 4QZHA 5KG4A 3BQ2A 4F4WA 3OUYA 1A76A 3JPTA 2AU0A 4YG2A 2BCSA 1S9FA 2NRXA 3EWAA 3MGHA 1JIHA 1ZJMA 2J6SA 4KLUA 4FBTA 1CUKA 1LB2B 4K4IA 3Q8PB 8ICHA 5HRDA 3V72A 1U47A 2R8HA 4FBUA 4P2HA 2JZBB 1N48A 4UB5A 2ZTEA 1IXRA 2C28A 4KLHA 4RWPA 2JEIA 2ZH9A 4EEYA 4X5VA 8ICLA 3OUYB 1MQ3A 2DR9A 3IHQB 3TFRA 3KHRA 1L3VA 2XCAA 1ZJNA 4JV2A 4I2IA 2BQRA 2ZH4A 7ICLA 2RDJA 3V7KA 1SKSA 2BKEA 1RXWA
chains in the Genus database with same CATH superfamily
2DRAA 3C21A 3ER9B 3WKCA 5J0RA 5ALUA 3UMGA 3RJJA 9ICVA 2HHVA 2CXYA 5ALEA 3BQ0A 5DECA 2ZH8A 5EE9A 2W54A 3WFSC 4DOBA 4FE3A 4O0IA 4C7ZA 4DSLA 3FDSA 2DR7A 4DSIA 3ZI4A 5TISU 2EANA 9ICOA 1K1QA 1TV9A 3HT3A 2IA6A 2QB1A 2ODGA 2NRVA 3RFAA 8ICZA 3NKUA 2ZIWB 2JXJA 3DDHA 5EOZA 2H5XA 4ED6A 4I27A 1S97A 2ZIXB 3UPSA 4FHVA 1JX4A 4F50A 4QWCA 2FDRA 3B9JA 1N5WA 4J9PA 3WK7A 4KN7A 2D3DA 5EWEA 5ALFA 4RT3A 5HRLA 4QIWF 5KFSA 1SXDA 1HJPA 2KP7A 5B3PA 4OAHA 5DG9A 3AM9A 1SB3C 1JI7A 5L1MA 2ZXIA 4WC2A 4C4SA 3N7RC 3G6VA 3C66A 4MF2A 2IHOA 5KFZA 3JPQA 3L3FX 4X0AA 9ICQA 5HRFA 4NM1A 4QZIA 3ZDBA 3RB6A 1O08A 4A8EA 3KHHA 4AYBF 2ISOA 4F5NA 1QLNA 5J8YC 4GXJA 1S0NA 1ZD2P 4QIWC 1Z00B 4PZOA 3V6HA 4F2RA 5GTHU 9ICHA 5KFFA 1RYRA 1F5SA 1KBUA 1TAUA 3FAHA 2MAXA 4HAIA 4TQRA 4BUGA 4ED8A 4DSEA 1ZQGA 4OJOA 4BX9C 8ICEA 1OUQA 4RQ4A 3SD7A 2C2RA 2BBJA 1KN5A 4NJ8A 3H38A 3M6ZA 3WU2U 4ECSA 4CF4A 8ICUA 3RBDA 5L9XA 8ICWA 1X40A 4EEKA 5DDMA 5JTGA 5H2FU 2WFAA 1ZQVA 2K60A 4NXUA 3J81j 2ZIVA 8ICIA 4YR0A 5DQIA 5EE3A 1XC9A 5HNKA 3F5AA 4QZ9A 9ICAA 4QNLA 2R18A 1VJ7A 4IC9A 4I28A 1XU4A 5KAIU 4DSFA 5HC9A 2K89A 3WKAA 1T3NA 4M6WB 3L4PA 2XICA 3H8JA 3KKAC 3UQ0A 1QH9A 3L5KA 4ED3A 1M6YA 2YB1A 1VLBA 3OPXA 4QWEA 1WCLA 4RQ5A 4RQMA 4EBDA 4YQWA 5D4BA 2RHFA 4EBKA 4F5RA 5AKKA 5JUMA 2M2WA 2MA1A 2VA2A 3OWGA 3Q8QB 5CJ7A 5JTIA 2ASLA 2XC9A 1ZQDA 3BS5A 4O3RA 1ZQIA 7ICJA 3ZDEA 2J6UA 3WFRE 3PX0A 5AK4A 1KDHA 5HR7A 1X9MA 3HKZC 5G5GA 2G08A 2Y1IA 1UETA 3AQEA 3WK4A 3MDCA 2KN7A 4F4XA 3IV6A 3WKEA 4PGQA 2HCFA 4IR1A 1ZQEA 4QWBA 4P0QA 3ZDCA 2PXIA 1Z19A 8ICRA 3SAHA 4FS2A 4DS5A 4DSKA 4O5CA 4QZCA 9ICWA 5J0PA 4NLCA 5GTIU 2ZIUB 4I29A 2W9BB 8ICPA 3ISDA 3RJHA 3PW4A 1ZQXA 5EWFA 4HX0A 5KG1A 4M47A 5KFRA 1MIVA 2F3NA 1A6SA 4XQ7A 1YLQA 3SR6A 4Y2SA 2ZH1A 4M5DA 4FH3A 3GIJA 3EF2A 2I1QA 4UARA 4Z6CA 4AYBC 3JPRA 5CHEA 2EDUA 1TK8A 7ICTA 1TVAA 1BVSA 4DLGA 1IIPA 3NVOA 1P7DA 2OEHA 4CNQA 1F5AA 4J9OA 3WK8A 4YR3A 4IRCA 2EQYA 2EAMA 4X4TA 7ICRA 3JYYA 4O5EA 3C5GA 1X9WA 4TUPA 1XO1A 2A1JB 2E1FA 1L3TA 3IG5A 2FMSA 4O3NA 3JPPA 2FPMA 2GAFD 3T5KA 1Q3VA 4R8UA 2ZH5A 3RJIA 3BJYA 1S5LU 1H38A 4BXOA 4Q8EA 1IG6A 1V97A 3ED5A 4J9RA 1SL2A 4ATBB 2K8BB 9ICCA 4DFKA 2HDOA 1DGJA 1DRGA 2NRTA 4PHAA 2WAQC 4P4OA 5DDYA 2FI1A 2BCUA 4RPZA 4BJQA 2ISPA 2AXTU 2KFZA 2ASDA 4KMUA 4PH5A 4C8MA 2DBYA 3RRGA 1NK9A 3KKAA 1R8CA 4YMMA 3K7DA 5DB9A 4LEVA 1O03A 5IILA 4IQUA 5KFIA 3OJUA 1ED1A 2F8LA 2Y0SC 5HP4A 2Y9TA 2LI6A 5J0OA 3QUBA 1CRXA 2GA9D 3M6KA 4WOYA 5KFQA 1TFYA 4TUSA 4BGDA 2FLPA 3E0FA 2W8LA 2DR5A 4EX6A 4G3IA 1MQ2A 2KKVA 1U48A 4C8LA 1LVHA 3TQ1A 1SGGA 4PL1A 3GV7B 2BR0A 1L6NA 1SV0C 4NKTA 3IM1A 4R64A 4J9NA 1DK2A 3MR6A 2WTFA 4JUZA 4I2DA 2IHNA 2E5SA 4Q45A 7ICNA 2PI4A 2QB0B 2JH7A 4PJ0U 2HN1A 4AT7B 9ICFA 1NK7A 1U4BA 5F2VO 4P4PA 1Z4NA 4DL5A 2M0NA 3QUQA 3RRHA 1ZQMA 4DL3A 4ECZA 4NKUA 1URJA 4F4KA 3A0BU 3GIKA 2UVRA 4KLJA 2NRZA 8ICBA 3EUB2 2AQ0A 3PNCA 3TAQA 2G5IB 3FC4A 4J9MA 2H3VA 5KG2A 3BQ7A 1ZQZA 4DF8A 7ICPA 1X9SA 4FO1A 2DWQA 1KW4A 1C20A 4DL2A 2UVUA 1XSPA 1N61A 1ZQQA 1AQ6A 3JPTA 4YG2A 4FBTA 1LB2B 2QLTA 8ICHA 4K98A 1N48A 1IXRA 3VC8A 3TFRA 3KHRA 3BS5B 1ZJNA 1JUDA 4WJ3B 3ICXA 2ZH4A 2RDJA 4K8VA 9ICPA 4XUSA 4DL7A 3FYHA 5KNIA 1JRPA 2WF7A 3NTUA 5KG7A 4JV0A 4F91B 2VA8A 4CE6A 5KT4A 5D62A 5D63A 5J2HA 2YN4A 3MCRA 1BPXA 2R8JA 3C5FA 4KLEA 1NKCA 3PHZA 2GH1A 4M9HA 1BPZA 4WC5A 3M8SA 1L7OA 2BGWA 3IDWA 9ICGA 3UPQA 3H8SA 4TQSA 8ICOA 3D2SA 4RQ6A 1MC8A 3U26A 1QSSA 2LKYA 4X4SA 2ZTCA 3PY8A 3I1YA 3I76A 5FP0A 2M2UA 5HRGA 1HIWA 3OSNA 1R8AA 4DLEA 1UA1A 2DFLA 2ZJ5A 3MFIA 1FO4A 4ATBA 2Y0SF 4LZGA 4X4PA 3QNMA 3E2EA 5ALSA 4E8FA 3CW2C 3KHGA 1F44A 4ELUA 5AM2A 7ICOA 4TURA 1DK3A 2CRXA 3RAXA 2FMQA 2YQEA 1A0PA 5F9LA 2ATLA 4UB8U 2W43A 2A1JA 5HMMA 1RYUA 2NRWA 3JPOA 4O6AA 1DGSA 2O6KA 4Y2JA 1KFDA 1BPBA 2KHQA 3B0YA 2AHOB 2LBOA 2R8GA 2RFFA 4IRKA 4UD5A 2KSOB 4E7XA 2ZHAA 4NV0A 4J9SA 4WC4A 2HHQA 2OCEA 5DLFA 2HOIA 2A19A 5J2EA 4F3OA 2MU2A 5JU5A 4EP7A 4M9NA 1V38A 5AI8A 1T94A 3IN5A 2HOQA 5ALLA 4NXZA 5KT5A 3GQCA 1CEZA 3C2KA 5KG3A 4C8NA 5J2FA 2R8IA 2NYVA 5KT2A 3IP4B 3TFSA 1XNSA 4K9AA 5F3XB 3HJ1A 3HW8A 4QZEA 2W9BA 3H4DA 2EZXA 3QU2A 3WKBA 4I2JA 5AI5A 2AH5A 4J03A 3PR5B 4CF5A 3PW7A 2W3RA 3ETLA 2FMPA 4C8OA 3KBBA 2G09A 3DEEA 4UAZA 4WBYA 1TAQA 1Q3UA 1FA0A 4DF4A 5HR6A 4S3NA 4ZOHC 2XCPA 2KICA 3H0MB 3GILA 4GC7A 4UB2A 3NWIA 3AMZA 3SV4A 2OM6A 3T5HA 4QZFA 4F8RA 4EX7A 5HHIA 4WH5A 2OH2A 4YCXA 4X4QA 4UB1A 5DB8A 2DUYA 4FZNA 1N62A 2BE3A 5J0YA 4WC0A 2IHMA 9ICIA 4BXOB 9ICXA 1ZQWA 3MGVA 1NKEA 2ID1A 3NUQA 3V6KA 1TFRA 1BGXT 1PX5A 1KEJA 4AP9A 3LYSA 5A0LA 4DOCA 4JLXA 4RWNA 4KLIA 5HMLA 4WC1A 4M6WA 4QJFB 4WQLA 4OJ6A 4KLFA 1ZYQA 5J2CA 3AEVA 2KVCA 1ZQNA 2W9MA 2KMDA 2EH9A 3ER8C 3B0XA 7ICSA 3D2NA 2W9AA 3N97B 1ECWA 3MABA 8ICSA 1NK5A 1NJWA 4JLZA 1RQLA 3RR8A 2W11A 3MGIA 2B4VA 2BQ3A 3EZ5A 2E3TA 4UASA 1KL9A 4O3OA 2KZZA 4M2YA 3QU5A 3CNHA 2WB1C 1NJXA 4I2FA 2PFPA 2ZIUA 2H3FA 3MBYA 3G6YA 5J0SA 3R9KA 5KFBA 2DGZA 4FHYA 5AK3A 2H3QA 4NXTA 2JH1A 4X4RA 1BPDA 5KT7A 2WF5A 2D8CA 1QTMA 3V7JA 1J97A 3M9OB 2HN2A 2BDUA 1S77D 4B9NA 5JRTA 2IOFK 5B5EU 1ZQAA 3C2LA 2FJ6A 3N28A 2F77X 4F72A 2BPGA 2HHWA 4QW9A 3SYZA 3H8WA 2DVIA 4Q43A 2K4EA 1B43A 3OJSA 1A77A 2OWOA 4DS4A 1WUDA 1HUZA 1U45A 5C5JA 1NJYA 5KL1B 1UA0A 2DR8A 3Q8KA 3ERCC 3OVSA 5DEDA 3UM9A 3M9NB 1ZQUA 1OW5A 4EELA 4FS1A 2VJ4A 3C2MA 2ZH6A 2H3IA 5KG6A 2RP5A 3TI0A 1AROP 5AM0A 4QZ8A 3G6XA 4ECQA 1T8EA 2VKQA 7ICUA 1ZQFA 2F1HA 5BOMA 2V4RA 9ICMA 2PBEA 5J0QA 1ZQJA 4X4VA 4MFFA 3RJGA 5KFWA 2XO7A 8ICVA 3SQIA 1VDVA 1B22A 3GV5B 1OXJA 5KFXA 4B9VA 4M9LA 3HX0A 4KN4A 2KVSA 3GIMA 8ICNA 2DKXA 1SV4A 5E79U 4KB6A 1OU5A 2LMRA 2E8PA 5CHGA 3JPSA 2OYYA 2AGQA 1JN3A 4OJPA 2O5AA 2KE7A 3WFOA 1D8YA 7ICGA 4DOAA 2YMMA 4NL9A 5HRHA 4PGYA 3H3AA 1T4GA 4DL4A 5EE1A 4KLDA 4Q8FA 4QWAA 2M9NA 4RQ3A 3QXGA 1T3QA 4YXMA 4O3QA 1SIJA 2FLLA 1NKBA 2G5HB 1NZPA 3UMCA 3SI8A 4KLMA 4OAFA 4KMOB 5HR9A 4EEDA 2DQNB 2FLNA 2DF4B 4UB4A 5AI4A 5AM3A 1ZQBA 5EE0A 4NL9C 3BDPA 4LJXA 2EZZA 3GIIA 8ICFA 2LYAA 5KFUA 3OVAA 4K4GA 2W04A 2WHEA 3LVVA 7ICIA 1TE2A 2F8KA 1ZRMA 5DG8A 3T5JA 4TUQA 1PK3A 5KFHA 3NGDA 5J8YA 4R66A 4UW9A 5D46A 3AUOA 2MSNA 4PHEA 1JROA 4E0DA 5KFGA 4CCHA 2W9CA 1Z1BA 1Y88A 8ICCA 5KFNA 2G07A 4K4HA 4ECWA 3C23A 4ECXA 2YMLA 5KFYA 3NVZA 1TKDA 1J2MA 2N1RA 1QQ7A 4N7RA 2E8NA 2DRBA 4P0PA 5KFKA 4B9LA 3ALRA 2G0AA 2VIXA 7ICVA 4WBZA 1L3SA 4IQWA 2E8OA 5AKHA 1UHUA 4IQVA 3QX7A 1NI3A 5KG4A 3BQ2A 2AU0A 4NWIA 3EWAA 1JIHA 2J6SA 3Q8PB 3V72A 4C0ZA 4FBUA 2JZBB 2ZH9A 2C28A 2ZTEA 4EEYA 8ICLA 1MQ3A 4JV2A 4P0PB 2BQRA 2BBHA 3V7KA 5KAFU 5G5HA 2KFNA 1KFSA 5AI0A 3A0HU 2PFQA 3BQTA 1XSNA 4FHXA 3MR3A 2PI5A 1SKRA 2BCQA 2ZHBA 4RQ8A 5KFLA 1Q8KA 9ICEA 5ALXA 1ZD5A 4Y2QA 3UXNA 1JXLA 4WC3A 5ALIA 1D9DA 5TZVA 5DBAA 5J0XA 4B9SA 4EBJA 2ZG6A 1UEVA 5CB1A 7ICQA 2BDPA 4IS7A 3TACB 8ICTA 3PSFA 5J2AA 3ZD8A 5AIAA 5IIJA 1PZNA 2BHNA 1S76D 1YZ6A 3L9DA 2IOFA 4GXIA 5AKEA 1JAJA 2P6RA 9ICKA 1MIWA 5KTQA 5ALOA 4IL6U 4QZGA 4LEWA 4RPXA 4ED7A 4EV6A 3PSIA 1SWVA 4NXWA 5AHXA 4F5OA 4IG8A 2OHFA 4DL6A 2P6UA 3IRUA 4C7YA 4NM2A 5KG5A 2BPCA 4KX5A 1COOA 5KFEA 4J9KA 3QEAZ 1COKA 4UD4A 2ZJ8A 2HBLA 3PZPA 2BPFA 4QW8A 4KTQA 1EXNA 4EYIB 4ED1A 4J9LA 1RZTA 8ICKA 3HILA 4XQ8A 2NRKA 1XWLA 5AKLA 4K9BA 2ZH3A 2ZH2A 2LYBA 2MUTB 2NV3A 2AGOA 5ALTA 4RNOA 5DGAA 2JHDA 5ALGA 1ZQ1C 4LT6A 1YT3A 5KFJA 4NLKA 2AQ4A 1RQNA 3TARA 2QARA 4LEYA 3RJEA 4NLGA 4XJEA 3H7IA 4KM5A 5KFVA 1YZ7A 1N56A 3KTQA 4F5PA 1RM6C 2XI9A 4UAWA 3LQCB 2YY6A 4ELTA 1N60A 2LM1A 5CFSA 1ZQLA 1WWVA 4C80A 3WFQE 1KLNA 2GOLA 3TADC 4M9JA 2UVWA 4RQ1A 1S10A 3RR7A 4K99A 2Q4TA 5ALYA 3AQNA 2NO5A 2HOFA 5AM4A 5BOLA 4RQNA 3PW0A 2DPJA 5CP2A 4GXKA 1MSWD 2K4PA 1RPLA 3GDXA 5KFOA 3K75D 9ICUA 4XA5A 2W7PA 2JRZA 2A1AA 4UAYA 4RZRA 3O0FA 4X4UA 2KZ3A 4OJLA 4ACOA 2ZJAA 3T79A 3RAQA 2FE9A 3KFUF 2P66A 2W8KA 7ICFA 1FEZA 2KNJA 1FFUA 2HHXA 4F92B 3EPGA 2I6XA 4U7CA 4U6PA 1SL0A 3GFKB 4UATA 4P0QB 4AT7A 4RWQA 3NVWA 2LHTA 8ICMA 2QKQA 5J29A 7ICMA 5ALRA 5ALMA 1PK1A 5CFTA 3Q8RB 4KLQA 3SMVA 2CPRA 1N5XA 2YMQA 3V6JA 4B9TA 1ZETA 1L5UA 5DB6A 2FPLA 4ED2A 1DXSA 3TKAA 5ALWA 4OAGA 4LVSA 5IIOA 4F2SA 3T3FA 4FHPA 5L1IA 3TAPA 2XY7A 1SWWA 5F9NA 3RF9A 1V85A 1NO5A 4NLNA 3WK5A 4MHVA 4K96A 4ECTA 4P4MA 3UXPA 4YFKA 2M2TA 4ECYA 2Y9UA 3RTVA 2B21A 4F5QA 3F2CA 4RQ0A 5ALHA 1T7PA 1ZD4A 2ZH7A 1B4FA 2ESEA 3PW5A 1LV5A 4FZLA 4R65A 3PO5A 2HHTA 3Q8MA 2HHPA 5KFDA 3QUCA 2HHUA 4Y2PA 2DKZA 4I2HA 4DFJA 5CRXA 2WAQF 4GIBA 3AU2A 1BNOA 2WF9A 4GLXA 5KFPA 2VJ5A 3AU6A 4KLOA 5KT6A 2D6FC 4Y2YA 3HWTA 2UVVA 5KFCA 4I2AA 4WQKA 4K97A 3OV7A 1UQVA 1X9XA 3F2BA 4I0UA 2LYHA 4KLTA 4MEYA 4R8UB 3MC1A 3K4GA 1L8LA 3PR4A 4MFAA 4EEBA 3HIYA 4ECRA 4BDPA 3OHAA 5J2JA 4FH5A 4YXJA 3RH4A 1VFGA 5IIIA 3JCFA 4YMNA 2KOBA 4IQTA 3C18A 2PFNA 3E58A 2QB0A 4X0BA 3F5EA 2E1EA 4DFPA 1LKYB 2KJ5A 5IIKA 4RWOA 2WB1F 3PX4A 2C2DA 1L8OA 3ORYA 2KSOA 4RNMA 3H0RB 1NNLA 1LKYA 4B9UA 1QCKA 1D8LA 1HEKA 3PMNA 2IMWP 1TAMA 8ICAA 1S8OA 4RNNA 1WG8A 4FFDA 5AKYA 3MR5A 3LWMA 2RRDA 1UCVA 8ICQA 4I2CA 3EW9A 4UBCA 4CF3A 3ZDDA 8ICJA 2E8MA 3ZDAA 4JWNA 4QZAA 4DWIA 2JR5A 2RQ5A 4US8A 3BZCA 4YMOA 4JWMA 1KNYA 4O67A 5EWGA 3LWLA 2PMZC 3PVXA 1BNPA 3AQMA 3IG8A 3HKZF 4EYHB 4C8KA 8ICGA 1ZQTA 3LVWA 5L1JA 2K4HA 5KFMA 3N4MB 4O3SA 2YX8A 3LK9A 3RH6A 2KD1A 3QZ8A 3D2QA 3CP8A 4DO9A 1QSLA 4AT8A 2V9WA 1IM4A 4KITB 2HMXA 5J2BA 3UXOA 5ALPA 1MN8A 5KG0A 4DQRA 4AT9A 4NY8A 3RJFA 1TK0A 2HBJA 4UAUA 1ZXIA 4F4YA 8ICXA 4Y2RA 5DG7A 5J0TA 4JV1A 3JZ0A 2V4QA 4PL2A 2MRLA 2PKEA 2PMZF 3HJEA 2KKPA 4YVZA 3QU7A 4M9GA 5AKXA 4B6JA 4QZHA 4F4WA 3OUYA 2BCSA 3QU4A 3MGHA 4KLUA 2JV3A 3WK6A 1U47A 2R8HA 5C0YA 4UB5A 3FM9A 4RWPA 4KLHA 2JEIA 2CN1A 3M7DA 1L3VA 5D61A 5AKIA 4I2IA 7ICLA 1SKSA 2BKEA 1PVRA 3OGUA 3MFHA 1J2NA 2W03A 1SL1A 3AL0B 3QYPA 4YR2A 3NS1A 2JEGA 4WC6A 2ZUBA 4WCWA 1NOMA 4J9QA 5KFAA 3TADA 1HUOA 5ALNA 3KZIU 4RUAA 2W3SA 4I2GA 4PPXA 3NRZA 4DQSA 4PZNA 4RT2A 2KJ9A 9ICSA 4IR9A 2HHSA 1KKXA 2Z7JA 3RBEA 4MEXA 1KFTA 1L3UA 2K8AA 3NVYA 3EPIA 5J0WA 3TANA 4F71A 1XO0A 2WF8A 9ICLA 1X66A 3N7PD 3ONNA 3HRDD 3JPNA 2P35A 2EAPA 5KFTA 1QQ5A 5ALZA 1RDFA 2NO4A 3KZXA 4YN4A 4UBBA 3Q8SB 3RJKA 4C4RA 1FFVA 2KIVA 3C1YA 1WCNA 3UQ2A 2FPKA 4ELVA 2ASJA 2HVIA 5DBCA 5L1KA 2KTQA 1WYGA 4QZDA 4JK1A 2Q66A 5B3QA 3C29A 3PO4A 5DQHA 4USAA 2BCVA 4AT9B 4Y2TA 1NK0A 3GV8B 1R8BA 1Q46A 3K1RB 3K1ZA 1GO3F 2HI0A 4AT8B 3EYZA 3THVA 4UB6U 4BWJA 5ALQA 3N7SC 3QUTA 3KHLA 2ES6A 5ALDA 2ALZA 4WC7A 5IIMA 5J2KA 2Q0ZX 1JQRA 4DQPA 5J2IA 4KLLA 5KL8B 4B9MA 3CYMA 1K5OA 2ZIXA 9ICTA 4O5KA 2KHVA 2XGQA 5IINA 4LEZA 1ZQYA 4DEZA 5L1LA 1S0MA 3SEIA 3F2DA 1KTQA 1ZQHA 4RQ7A 2DPIA 2KG5A 4FHWA 4RU9A 5AIBA 2IOHA 2F2AB 4US9A 3NRWA 1RYSA 2VA3A 2ZTDA 3PV8A 2J6TA 4OCZA 4CRXA 9ICJA 2LPEA 1MIYA 4M04A 3QEBZ 1XS9D 4F93B 5AK5A 3F53A 2VANA 2JEJA 3OVBA 2KJ8A 5HRIA 1PUZA 1X6JA 3OTQA 5CA7A 1CI4A 4O3PA 4I2EA 5J2DA 5HRKA 2IBKA 4EGWA 1BPEA 1SXEA 1XSLA 3OHBA 2LM4A 5HHHA 4PHDA 2HW3A 4YP3A 5DBBA 4GC6A 8ICYA 4O69A 1UPHA 4MKPA 3NVVA 3WK9A 1TK5A 2Y1JA 2RDIA 4UB3A 2JEFA 4X4NA 2KK0A 2C22A 4FZMA 4E80A 2ZUDA 4RQ2A 4Q44A 2DL0A 5J0UA 4DQQA 3MDAA 3SENA 3RB0A 3OSPA 5BPCA 4JB3A 2ZXHA 1UEUA 3D6JA 2PFOA 3HP6A 3QZ7A 1ZQKA 2A3VA 5CFUA 3H0LB 7ICHA 3ISBA 1L7PA 2BZFA 2R8KA 2B51A 4EBEA 5DQGA 4R63A 3M1YA 1ZOLA 1X42A 1RXVA 4ICAA 4I2BA 2EWRA 4XRHA 1ZQCA 3C28A 1JMSA 1ZD3A 1R89A 1KRPA 4O9MA 4ED0A 5HREA 1Q79A 4YD2A 4KLSA 3H37A 2EAOA 5AKGA 3MR2A 3BS7A 2W55A 4Y2XA 2XGPA 4G9BA 9ICNA 2AGPA 1NK8A 5J2GA 2YTUA 1QQ6A 3CRXA 2ZIWA 1KQQA 4YD1A 2YMPA 2F76X 2KZMA 3VCBA 1UT8A 3NASA 2EZYA 4Z6DA 1NZBA 3PMLA 1V9PA 3GZFA 3PW2A 2I9GA 1D9FA 1NJZA 4EBCA 2XVTA 4ECUA 7ICEA 3DV9A 2BQUA 1RG6A 1Z4OA 4CDGA 2W7OA 3QE9Y 2RLTA 4PGXA 2QARB 2W9CB 2HVHA 5CEHA 1MA7A 5AI6A 4OO1J 1KSPA 2JMGA 5AICA 4IRDA 4NXXA 1L7MA 2ZIVB 1Z1VA 4MF8A 3HPOA 4PHPA 2GO7A 3SAGA 1GPJA 3RB4A 1PVQA 1Q78A 1ZRNA 4BWMA 1PK1B 3BZKA 4HYKA 5AK6A 1WOTA 1SZPA 2HBKA 2XY6A 1NK4A 4JMUA 2KIWA 3GU3A 4OD0A 2XY5A 1SKWA 3HJ4A 1X6IA 3ZD9A 4QZBA 2XIDA 4UQGA 3I28A 3WKDA 5T14A 1X2IA 1N2XA 1S0OA 2L5YA 5AM1A 4FO6A 5ALJA 2I5HA 2F1IA 1NK6A 2B0CA 4OJ5A 3CK6A 2JGAA 5ALKA 5DLGA 1Z00A 1D8BA 2HBMA 3ETRA 3V7LA 1WWUA 2IUBA 5AI9A 3H4BA 1SV0A 4O3MA 1DOQA 1Z3EB 4NLBA 3PSTA 1F0MA 3BQ1A 4RUCA 5DGBA 2ZUCA 1UT5A 5KT3A 5DB7A 4M0AA 2F44A 2O1PA 1ZQRA 4LZDA 1PVPA 3M9MB 3SZ2A 7ICKA 5D49A 4C4TA 2FCLA 2BCRA 2YB4A 3AQKA 2G06A 1TFWA 4QWDA 4F4ZA 2WF6A 3UMBA 1ZQOA 2GWSA 1JXEA 3RH5A 3PX6A 3NYBA 3WFPA 3RB3A 4KLGA 1C7YA 2B56A 4KX3A 3S6JA 1B0XA 2M2VA 1U9LA 1QSYA 3T5LA 4GFJA 4Y2UA 2MUTA 4ECVA 5AKZA 1ZQSA 3Q8LA 2B6GA 3KOOA 2H3ZA 4X4OA 1V4AA 3KD3A 2JZBA 5AKJA 1SZHA 1ZQPA 3H39A 4RPYA 5B66U 4EZ9A 3SAFA 4DFDA 2C2EA 3M8RA 5HRBA 3LDAA 3SV3A 4EENA 5CWRA 2KV2A 4Z6EA 5DKWA 3AQLA 4DFMA 1VJ5A 9ICRA 5AM5A 3H40A 4O68A 4Z6FA 2HSZA 5K4LA 4EZ6A 3H8MA 4ZH4A 2KEYA 4DQIA 5ALVA 1IV8A 1K1SA 4CGZA 1S0VA 9ICBA 4NLZA 5CR0A 4MFCA 3C1ZA 4UAVA 1BPYA 2GLEA 4OAIZ 2F1JA 2K4IA 1U49A 1L7NA 4DCCA 3ISCA 4DSJA 3AN1A 1A76A 1FIQA 1S9FA 2NRXA 4NXVA 1ZJMA 1CUKA 4K4IA 1N63A 5HRDA 2AJQA 4P2HA 3QU9A 4X5VA 3OUYB 2DR9A 3AQFA 3IHQB 3PSPA 2XCAA 4Y2VA 2K8CB 2OXOA 1RXWA 1JALA
chains in the Genus database with same CATH topology
3OGUA 3MFHA 2DRAA 3C21A 9ICPA 1SL1A 4XUSA 5J0RA 4YR2A 3RJJA 4DL7A 9ICVA 3FYHA 2HHVA 2JEGA 2KFNA 2ZUBA 4WC6A 3BQ0A 3NTUA 5KG7A 1KFSA 4WCWA 5DECA 2ZH8A 1NOMA 4J9QA 2DVIA 4JV0A 5KFAA 2VA8A 3BQTA 4F91B 1HUOA 2PFQA 3WFSC 1XSNA 4DOBA 5KT4A 4FHXA 4RUAA 3MR3A 2PI5A 1SKRA 2BCQA 4I2GA 4O0IA 4PPXA 5J2HA 2ZHBA 4DQSA 4RQ8A 4DSLA 3FDSA 4RT2A 4DSIA 5KFLA 1BPXA 2R8JA 3C5FA 4KLEA 9ICEA 2DR7A 1NKCA 9ICOA 9ICSA 4IR9A 2HHSA 3UXNA 1JXLA 4M9HA 3RBEA 4MEXA 1KFTA 1L3UA 1BPZA 4WC3A 4WC5A 3EPIA 5J0WA 3M8SA 3TANA 2BGWA 1D9DA 9ICUA 1K1QA 1TV9A 3HT3A 5TZVA 2IA6A 9ICGA 2NRVA 5DBAA 5J0XA 4B9SA 3UPQA 3H8SA 9ICLA 4TQSA 8ICZA 8ICOA 4EBJA 1UEVA 3JPNA 4RQ6A 1MC8A 5KFTA 5CB1A 7ICQA 2BDPA 5EOZA 8ICTA 1QSSA 2H5XA 4YN4A 3ZD8A 5J2AA 4UBBA 2ZTCA 3Q8SB 4ED6A 5IIJA 3RJKA 3PY8A 1PZNA 2M2UA 4I27A 5HRGA 1S97A 2BHNA 3UPSA 4FHVA 3C1YA 1WCNA 3UQ2A 3OSNA 1JX4A 4F50A 4QWCA 2FPKA 1S76D 1R8AA 4DLEA 3L9DA 1UA1A 2DFLA 4GXIA 2ZJ5A 3MFIA 4ELVA 2ASJA 1JAJA 4J9PA 2P6RA 9ICKA 4ATBA 2HVIA 1MIWA 4LZGA 5DBCA 4X4PA 4KN7A 5KTQA 5L1KA 2KTQA 4QZDA 4JK1A 2Q66A 3E2EA 4QZGA 4E8FA 5EWEA 3PO4A 4RPXA 4ED7A 3KHGA 5DQHA 2BCVA 4RT3A 5HRLA 4AT9B 4F5OA 5KFSA 4ELUA 4IG8A 4DL6A 1NK0A 1HJPA 3GV8B 7ICOA 2P6UA 4TURA 2KP7A 1R8BA 1DK3A 4NM2A 5DG9A 3RAXA 2FMQA 5KG5A 5F9LA 4AT8B 4WC2A 3EYZA 2ATLA 3THVA 2A1JA 2BPCA 5HMMA 2NRWA 4BWJA 3JPOA 3KHLA 1DGSA 1COOA 5KFEA 4J9KA 3QEAZ 2ALZA 1KFDA 3G6VA 5IIMA 2ZJ8A 1BPBA 2Q0ZX 5J2KA 4MF2A 1JQRA 3B0YA 2RFFA 2BPFA 2R8GA 5J2IA 4DQPA 4IRKA 4KLLA 4B9MA 4UD5A 5KFZA 3JPQA 4QW8A 4E7XA 2ZHAA 4KTQA 4J9SA 4WC4A 2HHQA 1EXNA 9ICTA 5DLFA 4O5KA 2XGQA 5IINA 4X0AA 5J2EA 4EYIB 1ZQYA 4ED1A 4DEZA 4F3OA 9ICQA 4NM1A 4J9LA 5L1LA 1RZTA 8ICKA 5HRFA 4XQ8A 4QZIA 1S0MA 1KTQA 1ZQHA 4RQ7A 2DPIA 3ZDBA 2NRKA 1XWLA 3RB6A 4NLKA 4RU9A 4FHWA 4EP7A 4M9NA 4WBZA 2ZH3A 3KHHA 2ZH2A 2MUTB 1RYSA 2AGOA 2VA3A 4RNOA 2ZTDA 3PV8A 2ISOA 4F5NA 5DGAA 1QLNA 2J6TA 4GXJA 4NXZA 9ICJA 5KT5A 3GQCA 1S0NA 4M04A 1MIYA 1CEZA 3C2KA 4LT6A 1Z00B 5KG3A 5KFJA 4C8NA 3V6HA 3QEBZ 5J2FA 4F2RA 1XS9D 4F93B 2R8IA 5KT2A 3TFSA 9ICHA 2AQ4A 2JEJA 2VANA 5KFFA 3TARA 1RYRA 3HJ1A 3OVBA 3HW8A 5HRIA 4QZEA 5CA7A 2W9BA 4O3PA 3H4DA 3RJEA 2MAXA 4NLGA 1TAUA 4TQRA 4I2EA 5J2DA 5HRKA 2IBKA 1BPEA 4I2JA 3H7IA 4ED8A 4DSEA 1XSLA 5KFVA 3PR5B 3OHBA 5HHHA 4PHDA 1ZQGA 3PW7A 2HW3A 4YP3A 1N56A 5DBBA 3ETLA 4GC6A 8ICEA 4RQ4A 2C2RA 8ICYA 2FMPA 3KTQA 4F5PA 4C8OA 3H38A 4UAZA 4WBYA 4UAWA 1TAQA 4ECSA 1FA0A 3LQCB 8ICUA 3RBDA 5L9XA 4ELTA 4DF4A 4S3NA 1TK5A 2XCPA 2Y1JA 2RDIA 4UB3A 8ICWA 1ZQLA 3WFQE 3GILA 4GC7A 2JEFA 4X4NA 1KLNA 5DDMA 4UB2A 2AJQA 2C22A 1ZQVA 3SV4A 4M9JA 4E80A 3T5HA 2ZUDA 4QZFA 2UVWA 4F8RA 4RQ2A 4RQ1A 5HHIA 4Q44A 5J0UA 4YR0A 4DQQA 1S10A 3RR7A 5DQIA 8ICIA 3MDAA 3AQNA 4X4SA 4YCXA 1XC9A 4X4QA 5HNKA 5BOLA 4UB1A 3RB0A 3OSPA 5DB8A 5BPCA 3PW0A 2DPJA 5CP2A 4GXKA 1MSWD 4QZ9A 1UEUA 2BE3A 9ICAA 5J0YA 1RPLA 3GDXA 1VJ7A 4WC0A 5KFOA 3K75D 2IHMA 4XA5A 9ICIA 4BXOB 2PFOA 1XU4A 1ZQWA 3HP6A 4DSFA 1T3NA 1NKEA 4I28A 4M6WB 3QZ7A 5HC9A 1ZQKA 3H8JA 7ICHA 4UAYA 3UQ0A 3ISBA 4RZRA 2ID1A 4ED3A 4X4UA 2R8KA 2KZ3A 4QWEA 3V6KA 1TFRA 2ZJAA 4EBEA 5DQGA 1BGXT 4R63A 3RAQA 1WCLA 4RQ5A 4EBDA 1RXVA 1PX5A 1KEJA 4YQWA 2P66A 2W8KA 5D4BA 7ICFA 4I2BA 4EBKA 4F5RA 5JUMA 2HHXA 2M2WA 4DOCA 4XRHA 2VA2A 4RWNA 4KLIA 4F92B 3EPGA 5HMLA 1ZQCA 4WC1A 4M6WA 7ICKA 1JMSA 1SL0A 1R89A 3GFKB 1KRPA 4KLFA 3Q8QB 5CJ7A 1ZYQA 4RWQA 4O9MA 4AT7A 4FHYA 2ASLA 5J2CA 4ED0A 8ICMA 5HREA 2XC9A 1Q79A 4YD2A 1ZQNA 1ZQDA 4KLSA 3H37A 7ICMA 5J29A 4O3RA 2W9MA 3MR2A 1ZQIA 7ICJA 2XGPA 9ICNA 3ZDEA 2AGPA 2J6UA 3Q8RB 1NK8A 5J2GA 4KLQA 3PX0A 3WFRE 3B0XA 7ICSA 2W9AA 3N97B 3MABA 3V6JA 1KDHA 1ZETA 1NK5A 1X9MA 4B9TA 1L5UA 1NJWA 8ICSA 5DB6A 2FPLA 4YD1A 4ED2A 2Y1IA 1UETA 3RR8A 3MGIA 2BQ3A 3MDCA 3EZ5A 2KN7A 5IIOA 4LVSA 2KZMA 1UT8A 4F4XA 4F2SA 4Z6DA 3T3FA 4O3OA 4PGQA 4FHPA 4IR1A 1ZQEA 5L1IA 3PMLA 3TAPA 4QWBA 3ZDCA 1V9PA 2XY7A 2PXIA 2I9GA 3PW2A 5F9NA 2KZZA 4M2YA 8ICRA 1D9FA 4WC7A 1NJZA 1NJXA 4EBCA 4ECUA 7ICEA 4I2FA 4FS2A 4DS5A 4DSKA 2PFPA 4O5CA 1NO5A 2BQUA 4QZCA 4NLNA 9ICWA 4ECTA 5J0PA 4P4MA 3MBYA 3G6YA 5J0SA 5KFBA 4YFKA 2W9BB 3UXPA 3QE9Y 4I29A 4ECYA 8ICPA 4PGXA 3ISDA 2B21A 3RTVA 3PW4A 3RJHA 2M2TA 4F5QA 1ZQXA 4RQ0A 5EWFA 1T7PA 2W9CB 5KG1A 2HVHA 2ZH7A 4X4RA 4M47A 1BPDA 5KT7A 3PW5A 5KFRA 1LV5A 1KSPA 1MIVA 4R65A 1QTMA 3V7JA 4IRDA 1YLQA 4XQ7A 3M9OB 2ZH1A 3PO5A 4M5DA 4FH3A 3GIJA 2HHTA 3Q8MA 2HHPA 2I1QA 5KFDA 4MF8A 3HPOA 4Z6CA 1S77D 4B9NA 3JPRA 2HHUA 4PHPA 1ZQAA 1TK8A 3C2LA 3RB4A 7ICTA 1Q78A 1TVAA 1BVSA 2BPGA 4DLGA 4BWMA 4I2HA 2HHWA 4DFJA 4QW9A 4HYKA 3AU2A 3H8WA 4Q43A 3SYZA 1BNOA 1F5AA 4GLXA 1B43A 5KFPA 3OJSA 4J9OA 1A77A 4YR3A 4IRCA 1SZPA 1WOTA 3AU6A 2OWOA 4DS4A 4KLOA 5KT6A 3HWTA 2XY6A 1NK4A 2UVVA 1HUZA 2XY5A 1U45A 5KFCA 1SKWA 7ICRA 5C5JA 4I2AA 4O5EA 3HJ4A 3JYYA 3ZD9A 4X4TA 4QZBA 3C5GA 1NJYA 4UQGA 1X9WA 4TUPA 1S0OA 1X2IA 1XO1A 1UA0A 3OV7A 2A1JB 2DR8A 3Q8KA 4FO6A 1L3TA 5DEDA 3OVSA 2FMSA 4O3NA 3JPPA 3M9NB 2FPMA 2LYHA 1ZQUA 4KLTA 2F1IA 1NK6A 4MEYA 4R8UB 3C2MA 4FS1A 4FH5A 3K4GA 3T5KA 2ZH6A 4R8UA 4MFAA 3PR4A 2ZH5A 5DLGA 3HIYA 4ECRA 9ICXA 5KG6A 1Z00A 4BDPA 3OHAA 3BJYA 3RJIA 5J2JA 1AROP 3TI0A 1H38A 4BXOA 4QZ8A 4YXJA 3V7LA 3G6XA 4ECQA 3RH4A 1T8EA 4Q8EA 1VFGA 7ICUA 5IIIA 4YMNA 1ZQFA 2F1HA 5BOMA 4IQTA 2V4RA 9ICMA 2PBEA 5J0QA 1ZQJA 4J9RA 3C18A 1SL2A 2PFNA 4ATBB 4MFFA 4X4VA 4X0BA 3H4BA 9ICCA 4DFPA 3RJGA 1DOQA 4DFKA 1Z3EB 5IIKA 4RWOA 3BQ1A 5KFWA 2XO7A 8ICVA 4RUCA 3PX4A 5DGBA 2ZUCA 1B22A 1UT5A 2NRTA 4PHAA 5KT3A 3GV5B 5DB7A 4P4OA 4M0AA 5DDYA 5KFXA 4B9VA 2C2DA 2O1PA 1ZQRA 3ORYA 2BCUA 4LZDA 4M9LA 4RPZA 3HX0A 4KN4A 4RNMA 2ISPA 3GIMA 8ICNA 3M9MB 2KFZA 1OU5A 5CHGA 3JPSA 2ASDA 3SZ2A 4KMUA 4PH5A 1JN3A 5D49A 2AGQA 1D8LA 4B9UA 4C8MA 2BCRA 3PMNA 2O5AA 3AQKA 3RRGA 3WFOA 1TFWA 1D8YA 1NK9A 7ICGA 1R8CA 4DOAA 2IMWP 4QWDA 4YMMA 5DB9A 4F4ZA 8ICAA 5HRHA 4PGYA 4RNNA 1ZQOA 5IILA 2GWSA 1JXEA 4IQUA 5KFIA 3OJUA 1T4GA 3MR5A 3H3AA 3RH5A 3LWMA 4DL4A 3PX6A 4KLDA 4Q8FA 4QWAA 3NYBA 3WFPA 8ICQA 2M9NA 4RQ3A 3RB3A 4I2CA 4KLGA 4YXMA 3EW9A 1C7YA 4UBCA 5HP4A 3ZDDA 4O3QA 8ICJA 2FLLA 1NKBA 4QZAA 5J0OA 3ZDAA 4JWNA 4DWIA 1NZPA 3SI8A 4KLMA 5HR9A 5KFQA 1TFYA 4YMOA 4JWMA 2FLNA 2M2VA 1KNYA 1U9LA 4TUSA 4BGDA 4UB4A 3T5LA 1QSYA 2FLPA 5EWGA 1ZQBA 2MUTA 3LWLA 2W8LA 4ECVA 3PVXA 1BNPA 2DR5A 3AQMA 4G3IA 3BDPA 1ZQSA 4EYHB 4C8KA 8ICGA 1MQ2A 1ZQTA 3GIIA 1U48A 4C8LA 5L1JA 3TQ1A 3Q8LA 3GV7B 2BR0A 8ICFA 4X4OA 1V4AA 4NKTA 2JZBA 3IM1A 5KFUA 5KFMA 4R64A 3N4MB 4K4GA 3OVAA 4J9NA 1DK2A 1ZQPA 3MR6A 2WTFA 4O3SA 4UD4A 4JUZA 4I2DA 2IHNA 7ICIA 3H39A 4RPYA 4EZ9A 5DG8A 4Q45A 3LK9A 3RH6A 3T5JA 7ICNA 4TUQA 2C2EA 2PI4A 3M8RA 5KFHA 3NGDA 4R66A 5HRBA 3LDAA 3SV3A 5CWRA 3QZ8A 5D46A 4DO9A 4AT7B 4Z6EA 3AUOA 1QSLA 4AT8A 2V9WA 1IM4A 4PHEA 5DKWA 4E0DA 1NK7A 5KFGA 4DFMA 9ICFA 9ICRA 3AQLA 1U4BA 4CCHA 4KITB 5F2VO 4P4PA 5J2BA 2W9CA 4DL5A 3UXOA 3RRHA 1Y88A 1ZQMA 5KG0A 4DQRA 4AT9A 8ICCA 4DL3A 4NY8A 4ECZA 4NKUA 3H40A 3RJFA 5KFNA 1TK0A 4K4HA 4F4KA 4Z6FA 3GIKA 4ECWA 4F4YA 3C23A 2NRZA 4ECXA 2UVRA 4EZ6A 4KLJA 8ICBA 5KFYA 2AQ0A 3PNCA 3TAQA 8ICXA 4ZH4A 4J9MA 3C66A 5DG7A 5J0TA 1TKDA 5KG2A 4DQIA 4JV1A 3JZ0A 1K1SA 1S0VA 1ZQZA 2DRBA 2V4QA 5KFKA 4DF8A 4B9LA 7ICPA 9ICBA 1X9SA 4NLZA 5CR0A 4MFCA 3C1ZA 1BPYA 7ICVA 4YVZA 1L3SA 2F1JA 4IQWA 1U49A 4DL2A 2UVUA 3ISCA 1XSPA 4DSJA 1ZQQA 4M9GA 4IQVA 4QZHA 5KG4A 3BQ2A 4F4WA 3OUYA 1A76A 3JPTA 2AU0A 4YG2A 2BCSA 1S9FA 2NRXA 3EWAA 3MGHA 1JIHA 1ZJMA 2J6SA 4KLUA 4FBTA 1CUKA 1LB2B 4K4IA 3Q8PB 8ICHA 5HRDA 3V72A 1U47A 2R8HA 4FBUA 4P2HA 2JZBB 1N48A 4UB5A 2ZTEA 1IXRA 2C28A 4KLHA 4RWPA 2JEIA 2ZH9A 4EEYA 4X5VA 8ICLA 3OUYB 1MQ3A 2DR9A 3IHQB 3TFRA 3KHRA 1L3VA 2XCAA 1ZJNA 4JV2A 4I2IA 2BQRA 2ZH4A 7ICLA 2RDJA 3V7KA 1SKSA 2BKEA 1RXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGU A;  3MFH A;  2DRA A;  3C21 A;  9ICP A;  1SL1 A;  4XUS A;  5J0R A;  4YR2 A;  3RJJ A;  4DL7 A;  9ICV A;  3FYH A;  2HHV A;  2JEG A;  2KFN A;  2ZUB A;  4WC6 A;  3BQ0 A;  3NTU A;  5KG7 A;  1KFS A;  4WCW A;  5DEC A;  2ZH8 A;  1NOM A;  4J9Q A;  2DVI A;  4JV0 A;  5KFA A;  2VA8 A;  3BQT A;  4F91 B;  1HUO A;  2PFQ A;  3WFS C;  1XSN A;  4DOB A;  5KT4 A;  4FHX A;  4RUA A;  3MR3 A;  2PI5 A;  1SKR A;  2BCQ A;  4I2G A;  4O0I A;  4PPX A;  5J2H A;  2ZHB A;  4DQS A;  4RQ8 A;  4DSL A;  3FDS A;  4RT2 A;  4DSI A;  5KFL A;  1BPX A;  2R8J A;  3C5F A;  4KLE A;  9ICE A;  2DR7 A;  1NKC A;  9ICO A;  9ICS A;  4IR9 A;  2HHS A;  3UXN A;  1JXL A;  4M9H A;  3RBE A;  4MEX A;  1KFT A;  1L3U A;  1BPZ A;  4WC3 A;  4WC5 A;  3EPI A;  5J0W A;  3M8S A;  3TAN A;  2BGW A;  1D9D A;  9ICU A;  1K1Q A;  1TV9 A;  3HT3 A;  5TZV A;  2IA6 A;  9ICG A;  2NRV A;  5DBA A;  5J0X A;  4B9S A;  3UPQ A;  3H8S A;  9ICL A;  4TQS A;  8ICZ A;  8ICO A;  4EBJ A;  1UEV A;  3JPN A;  4RQ6 A;  1MC8 A;  5KFT A;  5CB1 A;  7ICQ A;  2BDP A;  5EOZ A;  8ICT A;  1QSS A;  2H5X A;  4YN4 A;  3ZD8 A;  5J2A A;  4UBB A;  2ZTC A;  3Q8S B;  4ED6 A;  5IIJ A;  3RJK A;  3PY8 A;  1PZN A;  2M2U A;  4I27 A;  5HRG A;  1S97 A;  2BHN A;  3UPS A;  4FHV A;  3C1Y A;  1WCN A;  3UQ2 A;  3OSN A;  1JX4 A;  4F50 A;  4QWC A;  2FPK A;  1S76 D;  1R8A A;  4DLE A;  3L9D A;  1UA1 A;  2DFL A;  4GXI A;  2ZJ5 A;  3MFI A;  4ELV A;  2ASJ A;  1JAJ A;  4J9P A;  2P6R A;  9ICK A;  4ATB A;  2HVI A;  1MIW A;  4LZG A;  5DBC A;  4X4P A;  4KN7 A;  5KTQ A;  5L1K A;  2KTQ A;  4QZD A;  4JK1 A;  2Q66 A;  3E2E A;  4QZG A;  4E8F A;  5EWE A;  3PO4 A;  4RPX A;  4ED7 A;  3KHG A;  5DQH A;  2BCV A;  4RT3 A;  5HRL A;  4AT9 B;  4F5O A;  5KFS A;  4ELU A;  4IG8 A;  4DL6 A;  1NK0 A;  1HJP A;  3GV8 B;  7ICO A;  2P6U A;  4TUR A;  2KP7 A;  1R8B A;  1DK3 A;  4NM2 A;  5DG9 A;  3RAX A;  2FMQ A;  5KG5 A;  5F9L A;  4AT8 B;  4WC2 A;  3EYZ A;  2ATL A;  3THV A;  2A1J A;  2BPC A;  5HMM A;  2NRW A;  4BWJ A;  3JPO A;  3KHL A;  1DGS A;  1COO A;  5KFE A;  4J9K A;  3QEA Z;  2ALZ A;  1KFD A;  3G6V A;  5IIM A;  2ZJ8 A;  1BPB A;  2Q0Z X;  5J2K A;  4MF2 A;  1JQR A;  3B0Y A;  2RFF A;  2BPF A;  2R8G A;  5J2I A;  4DQP A;  4IRK A;  4KLL A;  4B9M A;  4UD5 A;  5KFZ A;  3JPQ A;  4QW8 A;  4E7X A;  2ZHA A;  4KTQ A;  4J9S A;  4WC4 A;  2HHQ A;  1EXN A;  9ICT A;  5DLF A;  4O5K A;  2XGQ A;  5IIN A;  4X0A A;  5J2E A;  4EYI B;  1ZQY A;  4ED1 A;  4DEZ A;  4F3O A;  9ICQ A;  4NM1 A;  4J9L A;  5L1L A;  1RZT A;  8ICK A;  5HRF A;  4XQ8 A;  4QZI A;  1S0M A;  1KTQ A;  1ZQH A;  4RQ7 A;  2DPI A;  3ZDB A;  2NRK A;  1XWL A;  3RB6 A;  4NLK A;  4RU9 A;  4FHW A;  4EP7 A;  4M9N A;  4WBZ A;  2ZH3 A;  3KHH A;  2ZH2 A;  2MUT B;  1RYS A;  2AGO A;  2VA3 A;  4RNO A;  2ZTD A;  3PV8 A;  2ISO A;  4F5N A;  5DGA A;  1QLN A;  2J6T A;  4GXJ A;  4NXZ A;  9ICJ A;  5KT5 A;  3GQC A;  1S0N A;  4M04 A;  1MIY A;  1CEZ A;  3C2K A;  4LT6 A;  1Z00 B;  5KG3 A;  5KFJ A;  4C8N A;  3V6H A;  3QEB Z;  5J2F A;  4F2R A;  1XS9 D;  4F93 B;  2R8I A;  5KT2 A;  3TFS A;  9ICH A;  2AQ4 A;  2JEJ A;  2VAN A;  5KFF A;  3TAR A;  1RYR A;  3HJ1 A;  3OVB A;  3HW8 A;  5HRI A;  4QZE A;  5CA7 A;  2W9B A;  4O3P A;  3H4D A;  3RJE A;  2MAX A;  4NLG A;  1TAU A;  4TQR A;  4I2E A;  5J2D A;  5HRK A;  2IBK A;  1BPE A;  4I2J A;  3H7I A;  4ED8 A;  4DSE A;  1XSL A;  5KFV A;  3PR5 B;  3OHB A;  5HHH A;  4PHD A;  1ZQG A;  3PW7 A;  2HW3 A;  4YP3 A;  1N56 A;  5DBB A;  3ETL A;  4GC6 A;  8ICE A;  4RQ4 A;  2C2R A;  8ICY A;  2FMP A;  3KTQ A;  4F5P A;  4C8O A;  3H38 A;  4UAZ A;  4WBY A;  4UAW A;  1TAQ A;  4ECS A;  1FA0 A;  3LQC B;  8ICU A;  3RBD A;  5L9X A;  4ELT A;  4DF4 A;  4S3N A;  1TK5 A;  2XCP A;  2Y1J A;  2RDI A;  4UB3 A;  8ICW A;  1ZQL A;  3WFQ E;  3GIL A;  4GC7 A;  2JEF A;  4X4N A;  1KLN A;  5DDM A;  4UB2 A;  2AJQ A;  2C22 A;  1ZQV A;  3SV4 A;  4M9J A;  4E80 A;  3T5H A;  2ZUD A;  4QZF A;  2UVW A;  4F8R A;  4RQ2 A;  4RQ1 A;  5HHI A;  4Q44 A;  5J0U A;  4YR0 A;  4DQQ A;  1S10 A;  3RR7 A;  5DQI A;  8ICI A;  3MDA A;  3AQN A;  4X4S A;  4YCX A;  1XC9 A;  4X4Q A;  5HNK A;  5BOL A;  4UB1 A;  3RB0 A;  3OSP A;  5DB8 A;  5BPC A;  3PW0 A;  2DPJ A;  5CP2 A;  4GXK A;  1MSW D;  4QZ9 A;  1UEU A;  2BE3 A;  9ICA A;  5J0Y A;  1RPL A;  3GDX A;  1VJ7 A;  4WC0 A;  5KFO A;  3K75 D;  2IHM A;  4XA5 A;  9ICI A;  4BXO B;  2PFO A;  1XU4 A;  1ZQW A;  3HP6 A;  4DSF A;  1T3N A;  1NKE A;  4I28 A;  4M6W B;  3QZ7 A;  5HC9 A;  1ZQK A;  3H8J A;  7ICH A;  4UAY A;  3UQ0 A;  3ISB A;  4RZR A;  2ID1 A;  4ED3 A;  4X4U A;  2R8K A;  2KZ3 A;  4QWE A;  3V6K A;  1TFR A;  2ZJA A;  4EBE A;  5DQG A;  1BGX T;  4R63 A;  3RAQ A;  1WCL A;  4RQ5 A;  4EBD A;  1RXV A;  1PX5 A;  1KEJ A;  4YQW A;  2P66 A;  2W8K A;  5D4B A;  7ICF A;  4I2B A;  4EBK A;  4F5R A;  5JUM A;  2HHX A;  2M2W A;  4DOC A;  4XRH A;  2VA2 A;  4RWN A;  4KLI A;  4F92 B;  3EPG A;  5HML A;  1ZQC A;  4WC1 A;  4M6W A;  7ICK A;  1JMS A;  1SL0 A;  1R89 A;  3GFK B;  1KRP A;  4KLF A;  3Q8Q B;  5CJ7 A;  1ZYQ A;  4RWQ A;  4O9M A;  4AT7 A;  4FHY A;  2ASL A;  5J2C A;  4ED0 A;  8ICM A;  5HRE A;  2XC9 A;  1Q79 A;  4YD2 A;  1ZQN A;  1ZQD A;  4KLS A;  3H37 A;  7ICM A;  5J29 A;  4O3R A;  2W9M A;  3MR2 A;  1ZQI A;  7ICJ A;  2XGP A;  9ICN A;  3ZDE A;  2AGP A;  2J6U A;  3Q8R B;  1NK8 A;  5J2G A;  4KLQ A;  3PX0 A;  3WFR E;  3B0X A;  7ICS A;  2W9A A;  3N97 B;  3MAB A;  3V6J A;  1KDH A;  1ZET A;  1NK5 A;  1X9M A;  4B9T A;  1L5U A;  1NJW A;  8ICS A;  5DB6 A;  2FPL A;  4YD1 A;  4ED2 A;  2Y1I A;  1UET A;  3RR8 A;  3MGI A;  2BQ3 A;  3MDC A;  3EZ5 A;  2KN7 A;  5IIO A;  4LVS A;  2KZM A;  1UT8 A;  4F4X A;  4F2S A;  4Z6D A;  3T3F A;  4O3O A;  4PGQ A;  4FHP A;  4IR1 A;  1ZQE A;  5L1I A;  3PML A;  3TAP A;  4QWB A;  3ZDC A;  1V9P A;  2XY7 A;  2PXI A;  2I9G A;  3PW2 A;  5F9N A;  2KZZ A;  4M2Y A;  8ICR A;  1D9F A;  4WC7 A;  1NJZ A;  1NJX A;  4EBC A;  4ECU A;  7ICE A;  4I2F A;  4FS2 A;  4DS5 A;  4DSK A;  2PFP A;  4O5C A;  1NO5 A;  2BQU A;  4QZC A;  4NLN A;  9ICW A;  4ECT A;  5J0P A;  4P4M A;  3MBY A;  3G6Y A;  5J0S A;  5KFB A;  4YFK A;  2W9B B;  3UXP A;  3QE9 Y;  4I29 A;  4ECY A;  8ICP A;  4PGX A;  3ISD A;  2B21 A;  3RTV A;  3PW4 A;  3RJH A;  2M2T A;  4F5Q A;  1ZQX A;  4RQ0 A;  5EWF A;  1T7P A;  2W9C B;  5KG1 A;  2HVH A;  2ZH7 A;  4X4R A;  4M47 A;  1BPD A;  5KT7 A;  3PW5 A;  5KFR A;  1LV5 A;  1KSP A;  1MIV A;  4R65 A;  1QTM A;  3V7J A;  4IRD A;  1YLQ A;  4XQ7 A;  3M9O B;  2ZH1 A;  3PO5 A;  4M5D A;  4FH3 A;  3GIJ A;  2HHT A;  3Q8M A;  2HHP A;  2I1Q A;  5KFD A;  4MF8 A;  3HPO A;  4Z6C A;  1S77 D;  4B9N A;  3JPR A;  2HHU A;  4PHP A;  1ZQA A;  1TK8 A;  3C2L A;  3RB4 A;  7ICT A;  1Q78 A;  1TVA A;  1BVS A;  2BPG A;  4DLG A;  4BWM A;  4I2H A;  2HHW A;  4DFJ A;  4QW9 A;  4HYK A;  3AU2 A;  3H8W A;  4Q43 A;  3SYZ A;  1BNO A;  1F5A A;  4GLX A;  1B43 A;  5KFP A;  3OJS A;  4J9O A;  1A77 A;  4YR3 A;  4IRC A;  1SZP A;  1WOT A;  3AU6 A;  2OWO A;  4DS4 A;  4KLO A;  5KT6 A;  3HWT A;  2XY6 A;  1NK4 A;  2UVV A;  1HUZ A;  2XY5 A;  1U45 A;  5KFC A;  1SKW A;  7ICR A;  5C5J A;  4I2A A;  4O5E A;  3HJ4 A;  3JYY A;  3ZD9 A;  4X4T A;  4QZB A;  3C5G A;  1NJY A;  4UQG A;  1X9W A;  4TUP A;  1S0O A;  1X2I A;  1XO1 A;  1UA0 A;  3OV7 A;  2A1J B;  2DR8 A;  3Q8K A;  4FO6 A;  1L3T A;  5DED A;  3OVS A;  2FMS A;  4O3N A;  3JPP A;  3M9N B;  2FPM A;  2LYH A;  1ZQU A;  4KLT A;  2F1I A;  1NK6 A;  4MEY A;  4R8U B;  3C2M A;  4FS1 A;  4FH5 A;  3K4G A;  3T5K A;  2ZH6 A;  4R8U A;  4MFA A;  3PR4 A;  2ZH5 A;  5DLG A;  3HIY A;  4ECR A;  9ICX A;  5KG6 A;  1Z00 A;  4BDP A;  3OHA A;  3BJY A;  3RJI A;  5J2J A;  1ARO P;  3TI0 A;  1H38 A;  4BXO A;  4QZ8 A;  4YXJ A;  3V7L A;  3G6X A;  4ECQ A;  3RH4 A;  1T8E A;  4Q8E A;  1VFG A;  7ICU A;  5III A;  4YMN A;  1ZQF A;  2F1H A;  5BOM A;  4IQT A;  2V4R A;  9ICM A;  2PBE A;  5J0Q A;  1ZQJ A;  4J9R A;  3C18 A;  1SL2 A;  2PFN A;  4ATB B;  4MFF A;  4X4V A;  4X0B A;  3H4B A;  9ICC A;  4DFP A;  3RJG A;  1DOQ A;  4DFK A;  1Z3E B;  5IIK A;  4RWO A;  3BQ1 A;  5KFW A;  2XO7 A;  8ICV A;  4RUC A;  3PX4 A;  5DGB A;  2ZUC A;  1B22 A;  1UT5 A;  2NRT A;  4PHA A;  5KT3 A;  3GV5 B;  5DB7 A;  4P4O A;  4M0A A;  5DDY A;  5KFX A;  4B9V A;  2C2D A;  2O1P A;  1ZQR A;  3ORY A;  2BCU A;  4LZD A;  4M9L A;  4RPZ A;  3HX0 A;  4KN4 A;  4RNM A;  2ISP A;  3GIM A;  8ICN A;  3M9M B;  2KFZ A;  1OU5 A;  5CHG A;  3JPS A;  2ASD A;  3SZ2 A;  4KMU A;  4PH5 A;  1JN3 A;  5D49 A;  2AGQ A;  1D8L A;  4B9U A;  4C8M A;  2BCR A;  3PMN A;  2O5A A;  3AQK A;  3RRG A;  3WFO A;  1TFW A;  1D8Y A;  1NK9 A;  7ICG A;  1R8C A;  4DOA A;  2IMW P;  4QWD A;  4YMM A;  5DB9 A;  4F4Z A;  8ICA A;  5HRH A;  4PGY A;  4RNN A;  1ZQO A;  5IIL A;  2GWS A;  1JXE A;  4IQU A;  5KFI A;  3OJU A;  1T4G A;  3MR5 A;  3H3A A;  3RH5 A;  3LWM A;  4DL4 A;  3PX6 A;  4KLD A;  4Q8F A;  4QWA A;  3NYB A;  3WFP A;  8ICQ A;  2M9N A;  4RQ3 A;  3RB3 A;  4I2C A;  4KLG A;  4YXM A;  3EW9 A;  1C7Y A;  4UBC A;  5HP4 A;  3ZDD A;  4O3Q A;  8ICJ A;  2FLL A;  1NKB A;  4QZA A;  5J0O A;  3ZDA A;  4JWN A;  4DWI A;  1NZP A;  3SI8 A;  4KLM A;  5HR9 A;  5KFQ A;  1TFY A;  4YMO A;  4JWM A;  2FLN A;  2M2V A;  1KNY A;  1U9L A;  4TUS A;  4BGD A;  4UB4 A;  3T5L A;  1QSY A;  2FLP A;  5EWG A;  1ZQB A;  2MUT A;  3LWL A;  2W8L A;  4ECV A;  3PVX A;  1BNP A;  2DR5 A;  3AQM A;  4G3I A;  3BDP A;  1ZQS A;  4EYH B;  4C8K A;  8ICG A;  1MQ2 A;  1ZQT A;  3GII A;  1U48 A;  4C8L A;  5L1J A;  3TQ1 A;  3Q8L A;  3GV7 B;  2BR0 A;  8ICF A;  4X4O A;  1V4A A;  4NKT A;  2JZB A;  3IM1 A;  5KFU A;  5KFM A;  4R64 A;  3N4M B;  4K4G A;  3OVA A;  4J9N A;  1DK2 A;  1ZQP A;  3MR6 A;  2WTF A;  4O3S A;  4UD4 A;  4JUZ A;  4I2D A;  2IHN A;  7ICI A;  3H39 A;  4RPY A;  4EZ9 A;  5DG8 A;  4Q45 A;  3LK9 A;  3RH6 A;  3T5J A;  7ICN A;  4TUQ A;  2C2E A;  2PI4 A;  3M8R A;  5KFH A;  3NGD A;  4R66 A;  5HRB A;  3LDA A;  3SV3 A;  5CWR A;  3QZ8 A;  5D46 A;  4DO9 A;  4AT7 B;  4Z6E A;  3AUO A;  1QSL A;  4AT8 A;  2V9W A;  1IM4 A;  4PHE A;  5DKW A;  4E0D A;  1NK7 A;  5KFG A;  4DFM A;  9ICF A;  9ICR A;  3AQL A;  1U4B A;  4CCH A;  4KIT B;  5F2V O;  4P4P A;  5J2B A;  2W9C A;  4DL5 A;  3UXO A;  3RRH A;  1Y88 A;  1ZQM A;  5KG0 A;  4DQR A;  4AT9 A;  8ICC A;  4DL3 A;  4NY8 A;  4ECZ A;  4NKU A;  3H40 A;  3RJF A;  5KFN A;  1TK0 A;  4K4H A;  4F4K A;  4Z6F A;  3GIK A;  4ECW A;  4F4Y A;  3C23 A;  2NRZ A;  4ECX A;  2UVR A;  4EZ6 A;  4KLJ A;  8ICB A;  5KFY A;  2AQ0 A;  3PNC A;  3TAQ A;  8ICX A;  4ZH4 A;  4J9M A;  3C66 A;  5DG7 A;  5J0T A;  1TKD A;  5KG2 A;  4DQI A;  4JV1 A;  3JZ0 A;  1K1S A;  1S0V A;  1ZQZ A;  2DRB A;  2V4Q A;  5KFK A;  4DF8 A;  4B9L A;  7ICP A;  9ICB A;  1X9S A;  4NLZ A;  5CR0 A;  4MFC A;  3C1Z A;  1BPY A;  7ICV A;  4YVZ A;  1L3S A;  2F1J A;  4IQW A;  1U49 A;  4DL2 A;  2UVU A;  3ISC A;  1XSP A;  4DSJ A;  1ZQQ A;  4M9G A;  4IQV A;  4QZH A;  5KG4 A;  3BQ2 A;  4F4W A;  3OUY A;  1A76 A;  3JPT A;  2AU0 A;  4YG2 A;  2BCS A;  1S9F A;  2NRX A;  3EWA A;  3MGH A;  1JIH A;  1ZJM A;  2J6S A;  4KLU A;  4FBT A;  1CUK A;  1LB2 B;  4K4I A;  3Q8P B;  8ICH A;  5HRD A;  3V72 A;  1U47 A;  2R8H A;  4FBU A;  4P2H A;  2JZB B;  1N48 A;  4UB5 A;  2ZTE A;  1IXR A;  2C28 A;  4KLH A;  4RWP A;  2JEI A;  2ZH9 A;  4EEY A;  4X5V A;  8ICL A;  3OUY B;  1MQ3 A;  2DR9 A;  3IHQ B;  3TFR A;  3KHR A;  1L3V A;  2XCA A;  1ZJN A;  4JV2 A;  4I2I A;  2BQR A;  2ZH4 A;  7ICL A;  2RDJ A;  3V7K A;  1SKS A;  2BKE A;  1RXW A; 
#chains in the Genus database with same CATH topology
 2DRA A;  3C21 A;  3ER9 B;  3WKC A;  5J0R A;  5ALU A;  3UMG A;  3RJJ A;  9ICV A;  2HHV A;  2CXY A;  5ALE A;  3BQ0 A;  5DEC A;  2ZH8 A;  5EE9 A;  2W54 A;  3WFS C;  4DOB A;  4FE3 A;  4O0I A;  4C7Z A;  4DSL A;  3FDS A;  2DR7 A;  4DSI A;  3ZI4 A;  5TIS U;  2EAN A;  9ICO A;  1K1Q A;  1TV9 A;  3HT3 A;  2IA6 A;  2QB1 A;  2ODG A;  2NRV A;  3RFA A;  8ICZ A;  3NKU A;  2ZIW B;  2JXJ A;  3DDH A;  5EOZ A;  2H5X A;  4ED6 A;  4I27 A;  1S97 A;  2ZIX B;  3UPS A;  4FHV A;  1JX4 A;  4F50 A;  4QWC A;  2FDR A;  3B9J A;  1N5W A;  4J9P A;  3WK7 A;  4KN7 A;  2D3D A;  5EWE A;  5ALF A;  4RT3 A;  5HRL A;  4QIW F;  5KFS A;  1SXD A;  1HJP A;  2KP7 A;  5B3P A;  4OAH A;  5DG9 A;  3AM9 A;  1SB3 C;  1JI7 A;  5L1M A;  2ZXI A;  4WC2 A;  4C4S A;  3N7R C;  3G6V A;  3C66 A;  4MF2 A;  2IHO A;  5KFZ A;  3JPQ A;  3L3F X;  4X0A A;  9ICQ A;  5HRF A;  4NM1 A;  4QZI A;  3ZDB A;  3RB6 A;  1O08 A;  4A8E A;  3KHH A;  4AYB F;  2ISO A;  4F5N A;  1QLN A;  5J8Y C;  4GXJ A;  1S0N A;  1ZD2 P;  4QIW C;  1Z00 B;  4PZO A;  3V6H A;  4F2R A;  5GTH U;  9ICH A;  5KFF A;  1RYR A;  1F5S A;  1KBU A;  1TAU A;  3FAH A;  2MAX A;  4HAI A;  4TQR A;  4BUG A;  4ED8 A;  4DSE A;  1ZQG A;  4OJO A;  4BX9 C;  8ICE A;  1OUQ A;  4RQ4 A;  3SD7 A;  2C2R A;  2BBJ A;  1KN5 A;  4NJ8 A;  3H38 A;  3M6Z A;  3WU2 U;  4ECS A;  4CF4 A;  8ICU A;  3RBD A;  5L9X A;  8ICW A;  1X40 A;  4EEK A;  5DDM A;  5JTG A;  5H2F U;  2WFA A;  1ZQV A;  2K60 A;  4NXU A;  3J81 j;  2ZIV A;  8ICI A;  4YR0 A;  5DQI A;  5EE3 A;  1XC9 A;  5HNK A;  3F5A A;  4QZ9 A;  9ICA A;  4QNL A;  2R18 A;  1VJ7 A;  4IC9 A;  4I28 A;  1XU4 A;  5KAI U;  4DSF A;  5HC9 A;  2K89 A;  3WKA A;  1T3N A;  4M6W B;  3L4P A;  2XIC A;  3H8J A;  3KKA C;  3UQ0 A;  1QH9 A;  3L5K A;  4ED3 A;  1M6Y A;  2YB1 A;  1VLB A;  3OPX A;  4QWE A;  1WCL A;  4RQ5 A;  4RQM A;  4EBD A;  4YQW A;  5D4B A;  2RHF A;  4EBK A;  4F5R A;  5AKK A;  5JUM A;  2M2W A;  2MA1 A;  2VA2 A;  3OWG A;  3Q8Q B;  5CJ7 A;  5JTI A;  2ASL A;  2XC9 A;  1ZQD A;  3BS5 A;  4O3R A;  1ZQI A;  7ICJ A;  3ZDE A;  2J6U A;  3WFR E;  3PX0 A;  5AK4 A;  1KDH A;  5HR7 A;  1X9M A;  3HKZ C;  5G5G A;  2G08 A;  2Y1I A;  1UET A;  3AQE A;  3WK4 A;  3MDC A;  2KN7 A;  4F4X A;  3IV6 A;  3WKE A;  4PGQ A;  2HCF A;  4IR1 A;  1ZQE A;  4QWB A;  4P0Q A;  3ZDC A;  2PXI A;  1Z19 A;  8ICR A;  3SAH A;  4FS2 A;  4DS5 A;  4DSK A;  4O5C A;  4QZC A;  9ICW A;  5J0P A;  4NLC A;  5GTI U;  2ZIU B;  4I29 A;  2W9B B;  8ICP A;  3ISD A;  3RJH A;  3PW4 A;  1ZQX A;  5EWF A;  4HX0 A;  5KG1 A;  4M47 A;  5KFR A;  1MIV A;  2F3N A;  1A6S A;  4XQ7 A;  1YLQ A;  3SR6 A;  4Y2S A;  2ZH1 A;  4M5D A;  4FH3 A;  3GIJ A;  3EF2 A;  2I1Q A;  4UAR A;  4Z6C A;  4AYB C;  3JPR A;  5CHE A;  2EDU A;  1TK8 A;  7ICT A;  1TVA A;  1BVS A;  4DLG A;  1IIP A;  3NVO A;  1P7D A;  2OEH A;  4CNQ A;  1F5A A;  4J9O A;  3WK8 A;  4YR3 A;  4IRC A;  2EQY A;  2EAM A;  4X4T A;  7ICR A;  3JYY A;  4O5E A;  3C5G A;  1X9W A;  4TUP A;  1XO1 A;  2A1J B;  2E1F A;  1L3T A;  3IG5 A;  2FMS A;  4O3N A;  3JPP A;  2FPM A;  2GAF D;  3T5K A;  1Q3V A;  4R8U A;  2ZH5 A;  3RJI A;  3BJY A;  1S5L U;  1H38 A;  4BXO A;  4Q8E A;  1IG6 A;  1V97 A;  3ED5 A;  4J9R A;  1SL2 A;  4ATB B;  2K8B B;  9ICC A;  4DFK A;  2HDO A;  1DGJ A;  1DRG A;  2NRT A;  4PHA A;  2WAQ C;  4P4O A;  5DDY A;  2FI1 A;  2BCU A;  4RPZ A;  4BJQ A;  2ISP A;  2AXT U;  2KFZ A;  2ASD A;  4KMU A;  4PH5 A;  4C8M A;  2DBY A;  3RRG A;  1NK9 A;  3KKA A;  1R8C A;  4YMM A;  3K7D A;  5DB9 A;  4LEV A;  1O03 A;  5IIL A;  4IQU A;  5KFI A;  3OJU A;  1ED1 A;  2F8L A;  2Y0S C;  5HP4 A;  2Y9T A;  2LI6 A;  5J0O A;  3QUB A;  1CRX A;  2GA9 D;  3M6K A;  4WOY A;  5KFQ A;  1TFY A;  4TUS A;  4BGD A;  2FLP A;  3E0F A;  2W8L A;  2DR5 A;  4EX6 A;  4G3I A;  1MQ2 A;  2KKV A;  1U48 A;  4C8L A;  1LVH A;  3TQ1 A;  1SGG A;  4PL1 A;  3GV7 B;  2BR0 A;  1L6N A;  1SV0 C;  4NKT A;  3IM1 A;  4R64 A;  4J9N A;  1DK2 A;  3MR6 A;  2WTF A;  4JUZ A;  4I2D A;  2IHN A;  2E5S A;  4Q45 A;  7ICN A;  2PI4 A;  2QB0 B;  2JH7 A;  4PJ0 U;  2HN1 A;  4AT7 B;  9ICF A;  1NK7 A;  1U4B A;  5F2V O;  4P4P A;  1Z4N A;  4DL5 A;  2M0N A;  3QUQ A;  3RRH A;  1ZQM A;  4DL3 A;  4ECZ A;  4NKU A;  1URJ A;  4F4K A;  3A0B U;  3GIK A;  2UVR A;  4KLJ A;  2NRZ A;  8ICB A;  3EUB 2;  2AQ0 A;  3PNC A;  3TAQ A;  2G5I B;  3FC4 A;  4J9M A;  2H3V A;  5KG2 A;  3BQ7 A;  1ZQZ A;  4DF8 A;  7ICP A;  1X9S A;  4FO1 A;  2DWQ A;  1KW4 A;  1C20 A;  4DL2 A;  2UVU A;  1XSP A;  1N61 A;  1ZQQ A;  1AQ6 A;  3JPT A;  4YG2 A;  4FBT A;  1LB2 B;  2QLT A;  8ICH A;  4K98 A;  1N48 A;  1IXR A;  3VC8 A;  3TFR A;  3KHR A;  3BS5 B;  1ZJN A;  1JUD A;  4WJ3 B;  3ICX A;  2ZH4 A;  2RDJ A;  4K8V A;  9ICP A;  4XUS A;  4DL7 A;  3FYH A;  5KNI A;  1JRP A;  2WF7 A;  3NTU A;  5KG7 A;  4JV0 A;  4F91 B;  2VA8 A;  4CE6 A;  5KT4 A;  5D62 A;  5D63 A;  5J2H A;  2YN4 A;  3MCR A;  1BPX A;  2R8J A;  3C5F A;  4KLE A;  1NKC A;  3PHZ A;  2GH1 A;  4M9H A;  1BPZ A;  4WC5 A;  3M8S A;  1L7O A;  2BGW A;  3IDW A;  9ICG A;  3UPQ A;  3H8S A;  4TQS A;  8ICO A;  3D2S A;  4RQ6 A;  1MC8 A;  3U26 A;  1QSS A;  2LKY A;  4X4S A;  2ZTC A;  3PY8 A;  3I1Y A;  3I76 A;  5FP0 A;  2M2U A;  5HRG A;  1HIW A;  3OSN A;  1R8A A;  4DLE A;  1UA1 A;  2DFL A;  2ZJ5 A;  3MFI A;  1FO4 A;  4ATB A;  2Y0S F;  4LZG A;  4X4P A;  3QNM A;  3E2E A;  5ALS A;  4E8F A;  3CW2 C;  3KHG A;  1F44 A;  4ELU A;  5AM2 A;  7ICO A;  4TUR A;  1DK3 A;  2CRX A;  3RAX A;  2FMQ A;  2YQE A;  1A0P A;  5F9L A;  2ATL A;  4UB8 U;  2W43 A;  2A1J A;  5HMM A;  1RYU A;  2NRW A;  3JPO A;  4O6A A;  1DGS A;  2O6K A;  4Y2J A;  1KFD A;  1BPB A;  2KHQ A;  3B0Y A;  2AHO B;  2LBO A;  2R8G A;  2RFF A;  4IRK A;  4UD5 A;  2KSO B;  4E7X A;  2ZHA A;  4NV0 A;  4J9S A;  4WC4 A;  2HHQ A;  2OCE A;  5DLF A;  2HOI A;  2A19 A;  5J2E A;  4F3O A;  2MU2 A;  5JU5 A;  4EP7 A;  4M9N A;  1V38 A;  5AI8 A;  1T94 A;  3IN5 A;  2HOQ A;  5ALL A;  4NXZ A;  5KT5 A;  3GQC A;  1CEZ A;  3C2K A;  5KG3 A;  4C8N A;  5J2F A;  2R8I A;  2NYV A;  5KT2 A;  3IP4 B;  3TFS A;  1XNS A;  4K9A A;  5F3X B;  3HJ1 A;  3HW8 A;  4QZE A;  2W9B A;  3H4D A;  2EZX A;  3QU2 A;  3WKB A;  4I2J A;  5AI5 A;  2AH5 A;  4J03 A;  3PR5 B;  4CF5 A;  3PW7 A;  2W3R A;  3ETL A;  2FMP A;  4C8O A;  3KBB A;  2G09 A;  3DEE A;  4UAZ A;  4WBY A;  1TAQ A;  1Q3U A;  1FA0 A;  4DF4 A;  5HR6 A;  4S3N A;  4ZOH C;  2XCP A;  2KIC A;  3H0M B;  3GIL A;  4GC7 A;  4UB2 A;  3NWI A;  3AMZ A;  3SV4 A;  2OM6 A;  3T5H A;  4QZF A;  4F8R A;  4EX7 A;  5HHI A;  4WH5 A;  2OH2 A;  4YCX A;  4X4Q A;  4UB1 A;  5DB8 A;  2DUY A;  4FZN A;  1N62 A;  2BE3 A;  5J0Y A;  4WC0 A;  2IHM A;  9ICI A;  4BXO B;  9ICX A;  1ZQW A;  3MGV A;  1NKE A;  2ID1 A;  3NUQ A;  3V6K A;  1TFR A;  1BGX T;  1PX5 A;  1KEJ A;  4AP9 A;  3LYS A;  5A0L A;  4DOC A;  4JLX A;  4RWN A;  4KLI A;  5HML A;  4WC1 A;  4M6W A;  4QJF B;  4WQL A;  4OJ6 A;  4KLF A;  1ZYQ A;  5J2C A;  3AEV A;  2KVC A;  1ZQN A;  2W9M A;  2KMD A;  2EH9 A;  3ER8 C;  3B0X A;  7ICS A;  3D2N A;  2W9A A;  3N97 B;  1ECW A;  3MAB A;  8ICS A;  1NK5 A;  1NJW A;  4JLZ A;  1RQL A;  3RR8 A;  2W11 A;  3MGI A;  2B4V A;  2BQ3 A;  3EZ5 A;  2E3T A;  4UAS A;  1KL9 A;  4O3O A;  2KZZ A;  4M2Y A;  3QU5 A;  3CNH A;  2WB1 C;  1NJX A;  4I2F A;  2PFP A;  2ZIU A;  2H3F A;  3MBY A;  3G6Y A;  5J0S A;  3R9K A;  5KFB A;  2DGZ A;  4FHY A;  5AK3 A;  2H3Q A;  4NXT A;  2JH1 A;  4X4R A;  1BPD A;  5KT7 A;  2WF5 A;  2D8C A;  1QTM A;  3V7J A;  1J97 A;  3M9O B;  2HN2 A;  2BDU A;  1S77 D;  4B9N A;  5JRT A;  2IOF K;  5B5E U;  1ZQA A;  3C2L A;  2FJ6 A;  3N28 A;  2F77 X;  4F72 A;  2BPG A;  2HHW A;  4QW9 A;  3SYZ A;  3H8W A;  2DVI A;  4Q43 A;  2K4E A;  1B43 A;  3OJS A;  1A77 A;  2OWO A;  4DS4 A;  1WUD A;  1HUZ A;  1U45 A;  5C5J A;  1NJY A;  5KL1 B;  1UA0 A;  2DR8 A;  3Q8K A;  3ERC C;  3OVS A;  5DED A;  3UM9 A;  3M9N B;  1ZQU A;  1OW5 A;  4EEL A;  4FS1 A;  2VJ4 A;  3C2M A;  2ZH6 A;  2H3I A;  5KG6 A;  2RP5 A;  3TI0 A;  1ARO P;  5AM0 A;  4QZ8 A;  3G6X A;  4ECQ A;  1T8E A;  2VKQ A;  7ICU A;  1ZQF A;  2F1H A;  5BOM A;  2V4R A;  9ICM A;  2PBE A;  5J0Q A;  1ZQJ A;  4X4V A;  4MFF A;  3RJG A;  5KFW A;  2XO7 A;  8ICV A;  3SQI A;  1VDV A;  1B22 A;  3GV5 B;  1OXJ A;  5KFX A;  4B9V A;  4M9L A;  3HX0 A;  4KN4 A;  2KVS A;  3GIM A;  8ICN A;  2DKX A;  1SV4 A;  5E79 U;  4KB6 A;  1OU5 A;  2LMR A;  2E8P A;  5CHG A;  3JPS A;  2OYY A;  2AGQ A;  1JN3 A;  4OJP A;  2O5A A;  2KE7 A;  3WFO A;  1D8Y A;  7ICG A;  4DOA A;  2YMM A;  4NL9 A;  5HRH A;  4PGY A;  3H3A A;  1T4G A;  4DL4 A;  5EE1 A;  4KLD A;  4Q8F A;  4QWA A;  2M9N A;  4RQ3 A;  3QXG A;  1T3Q A;  4YXM A;  4O3Q A;  1SIJ A;  2FLL A;  1NKB A;  2G5H B;  1NZP A;  3UMC A;  3SI8 A;  4KLM A;  4OAF A;  4KMO B;  5HR9 A;  4EED A;  2DQN B;  2FLN A;  2DF4 B;  4UB4 A;  5AI4 A;  5AM3 A;  1ZQB A;  5EE0 A;  4NL9 C;  3BDP A;  4LJX A;  2EZZ A;  3GII A;  8ICF A;  2LYA A;  5KFU A;  3OVA A;  4K4G A;  2W04 A;  2WHE A;  3LVV A;  7ICI A;  1TE2 A;  2F8K A;  1ZRM A;  5DG8 A;  3T5J A;  4TUQ A;  1PK3 A;  5KFH A;  3NGD A;  5J8Y A;  4R66 A;  4UW9 A;  5D46 A;  3AUO A;  2MSN A;  4PHE A;  1JRO A;  4E0D A;  5KFG A;  4CCH A;  2W9C A;  1Z1B A;  1Y88 A;  8ICC A;  5KFN A;  2G07 A;  4K4H A;  4ECW A;  3C23 A;  4ECX A;  2YML A;  5KFY A;  3NVZ A;  1TKD A;  1J2M A;  2N1R A;  1QQ7 A;  4N7R A;  2E8N A;  2DRB A;  4P0P A;  5KFK A;  4B9L A;  3ALR A;  2G0A A;  2VIX A;  7ICV A;  4WBZ A;  1L3S A;  4IQW A;  2E8O A;  5AKH A;  1UHU A;  4IQV A;  3QX7 A;  1NI3 A;  5KG4 A;  3BQ2 A;  2AU0 A;  4NWI A;  3EWA A;  1JIH A;  2J6S A;  3Q8P B;  3V72 A;  4C0Z A;  4FBU A;  2JZB B;  2ZH9 A;  2C28 A;  2ZTE A;  4EEY A;  8ICL A;  1MQ3 A;  4JV2 A;  4P0P B;  2BQR A;  2BBH A;  3V7K A;  5KAF U;  5G5H A;  2KFN A;  1KFS A;  5AI0 A;  3A0H U;  2PFQ A;  3BQT A;  1XSN A;  4FHX A;  3MR3 A;  2PI5 A;  1SKR A;  2BCQ A;  2ZHB A;  4RQ8 A;  5KFL A;  1Q8K A;  9ICE A;  5ALX A;  1ZD5 A;  4Y2Q A;  3UXN A;  1JXL A;  4WC3 A;  5ALI A;  1D9D A;  5TZV A;  5DBA A;  5J0X A;  4B9S A;  4EBJ A;  2ZG6 A;  1UEV A;  5CB1 A;  7ICQ A;  2BDP A;  4IS7 A;  3TAC B;  8ICT A;  3PSF A;  5J2A A;  3ZD8 A;  5AIA A;  5IIJ A;  1PZN A;  2BHN A;  1S76 D;  1YZ6 A;  3L9D A;  2IOF A;  4GXI A;  5AKE A;  1JAJ A;  2P6R A;  9ICK A;  1MIW A;  5KTQ A;  5ALO A;  4IL6 U;  4QZG A;  4LEW A;  4RPX A;  4ED7 A;  4EV6 A;  3PSI A;  1SWV A;  4NXW A;  5AHX A;  4F5O A;  4IG8 A;  2OHF A;  4DL6 A;  2P6U A;  3IRU A;  4C7Y A;  4NM2 A;  5KG5 A;  2BPC A;  4KX5 A;  1COO A;  5KFE A;  4J9K A;  3QEA Z;  1COK A;  4UD4 A;  2ZJ8 A;  2HBL A;  3PZP A;  2BPF A;  4QW8 A;  4KTQ A;  1EXN A;  4EYI B;  4ED1 A;  4J9L A;  1RZT A;  8ICK A;  3HIL A;  4XQ8 A;  2NRK A;  1XWL A;  5AKL A;  4K9B A;  2ZH3 A;  2ZH2 A;  2LYB A;  2MUT B;  2NV3 A;  2AGO A;  5ALT A;  4RNO A;  5DGA A;  2JHD A;  5ALG A;  1ZQ1 C;  4LT6 A;  1YT3 A;  5KFJ A;  4NLK A;  2AQ4 A;  1RQN A;  3TAR A;  2QAR A;  4LEY A;  3RJE A;  4NLG A;  4XJE A;  3H7I A;  4KM5 A;  5KFV A;  1YZ7 A;  1N56 A;  3KTQ A;  4F5P A;  1RM6 C;  2XI9 A;  4UAW A;  3LQC B;  2YY6 A;  4ELT A;  1N60 A;  2LM1 A;  5CFS A;  1ZQL A;  1WWV A;  4C80 A;  3WFQ E;  1KLN A;  2GOL A;  3TAD C;  4M9J A;  2UVW A;  4RQ1 A;  1S10 A;  3RR7 A;  4K99 A;  2Q4T A;  5ALY A;  3AQN A;  2NO5 A;  2HOF A;  5AM4 A;  5BOL A;  4RQN A;  3PW0 A;  2DPJ A;  5CP2 A;  4GXK A;  1MSW D;  2K4P A;  1RPL A;  3GDX A;  5KFO A;  3K75 D;  9ICU A;  4XA5 A;  2W7P A;  2JRZ A;  2A1A A;  4UAY A;  4RZR A;  3O0F A;  4X4U A;  2KZ3 A;  4OJL A;  4ACO A;  2ZJA A;  3T79 A;  3RAQ A;  2FE9 A;  3KFU F;  2P66 A;  2W8K A;  7ICF A;  1FEZ A;  2KNJ A;  1FFU A;  2HHX A;  4F92 B;  3EPG A;  2I6X A;  4U7C A;  4U6P A;  1SL0 A;  3GFK B;  4UAT A;  4P0Q B;  4AT7 A;  4RWQ A;  3NVW A;  2LHT A;  8ICM A;  2QKQ A;  5J29 A;  7ICM A;  5ALR A;  5ALM A;  1PK1 A;  5CFT A;  3Q8R B;  4KLQ A;  3SMV A;  2CPR A;  1N5X A;  2YMQ A;  3V6J A;  4B9T A;  1ZET A;  1L5U A;  5DB6 A;  2FPL A;  4ED2 A;  1DXS A;  3TKA A;  5ALW A;  4OAG A;  4LVS A;  5IIO A;  4F2S A;  3T3F A;  4FHP A;  5L1I A;  3TAP A;  2XY7 A;  1SWW A;  5F9N A;  3RF9 A;  1V85 A;  1NO5 A;  4NLN A;  3WK5 A;  4MHV A;  4K96 A;  4ECT A;  4P4M A;  3UXP A;  4YFK A;  2M2T A;  4ECY A;  2Y9U A;  3RTV A;  2B21 A;  4F5Q A;  3F2C A;  4RQ0 A;  5ALH A;  1T7P A;  1ZD4 A;  2ZH7 A;  1B4F A;  2ESE A;  3PW5 A;  1LV5 A;  4FZL A;  4R65 A;  3PO5 A;  2HHT A;  3Q8M A;  2HHP A;  5KFD A;  3QUC A;  2HHU A;  4Y2P A;  2DKZ A;  4I2H A;  4DFJ A;  5CRX A;  2WAQ F;  4GIB A;  3AU2 A;  1BNO A;  2WF9 A;  4GLX A;  5KFP A;  2VJ5 A;  3AU6 A;  4KLO A;  5KT6 A;  2D6F C;  4Y2Y A;  3HWT A;  2UVV A;  5KFC A;  4I2A A;  4WQK A;  4K97 A;  3OV7 A;  1UQV A;  1X9X A;  3F2B A;  4I0U A;  2LYH A;  4KLT A;  4MEY A;  4R8U B;  3MC1 A;  3K4G A;  1L8L A;  3PR4 A;  4MFA A;  4EEB A;  3HIY A;  4ECR A;  4BDP A;  3OHA A;  5J2J A;  4FH5 A;  4YXJ A;  3RH4 A;  1VFG A;  5III A;  3JCF A;  4YMN A;  2KOB A;  4IQT A;  3C18 A;  2PFN A;  3E58 A;  2QB0 A;  4X0B A;  3F5E A;  2E1E A;  4DFP A;  1LKY B;  2KJ5 A;  5IIK A;  4RWO A;  2WB1 F;  3PX4 A;  2C2D A;  1L8O A;  3ORY A;  2KSO A;  4RNM A;  3H0R B;  1NNL A;  1LKY A;  4B9U A;  1QCK A;  1D8L A;  1HEK A;  3PMN A;  2IMW P;  1TAM A;  8ICA A;  1S8O A;  4RNN A;  1WG8 A;  4FFD A;  5AKY A;  3MR5 A;  3LWM A;  2RRD A;  1UCV A;  8ICQ A;  4I2C A;  3EW9 A;  4UBC A;  4CF3 A;  3ZDD A;  8ICJ A;  2E8M A;  3ZDA A;  4JWN A;  4QZA A;  4DWI A;  2JR5 A;  2RQ5 A;  4US8 A;  3BZC A;  4YMO A;  4JWM A;  1KNY A;  4O67 A;  5EWG A;  3LWL A;  2PMZ C;  3PVX A;  1BNP A;  3AQM A;  3IG8 A;  3HKZ F;  4EYH B;  4C8K A;  8ICG A;  1ZQT A;  3LVW A;  5L1J A;  2K4H A;  5KFM A;  3N4M B;  4O3S A;  2YX8 A;  3LK9 A;  3RH6 A;  2KD1 A;  3QZ8 A;  3D2Q A;  3CP8 A;  4DO9 A;  1QSL A;  4AT8 A;  2V9W A;  1IM4 A;  4KIT B;  2HMX A;  5J2B A;  3UXO A;  5ALP A;  1MN8 A;  5KG0 A;  4DQR A;  4AT9 A;  4NY8 A;  3RJF A;  1TK0 A;  2HBJ A;  4UAU A;  1ZXI A;  4F4Y A;  8ICX A;  4Y2R A;  5DG7 A;  5J0T A;  4JV1 A;  3JZ0 A;  2V4Q A;  4PL2 A;  2MRL A;  2PKE A;  2PMZ F;  3HJE A;  2KKP A;  4YVZ A;  3QU7 A;  4M9G A;  5AKX A;  4B6J A;  4QZH A;  4F4W A;  3OUY A;  2BCS A;  3QU4 A;  3MGH A;  4KLU A;  2JV3 A;  3WK6 A;  1U47 A;  2R8H A;  5C0Y A;  4UB5 A;  3FM9 A;  4RWP A;  4KLH A;  2JEI A;  2CN1 A;  3M7D A;  1L3V A;  5D61 A;  5AKI A;  4I2I A;  7ICL A;  1SKS A;  2BKE A;  1PVR A;  3OGU A;  3MFH A;  1J2N A;  2W03 A;  1SL1 A;  3AL0 B;  3QYP A;  4YR2 A;  3NS1 A;  2JEG A;  4WC6 A;  2ZUB A;  4WCW A;  1NOM A;  4J9Q A;  5KFA A;  3TAD A;  1HUO A;  5ALN A;  3KZI U;  4RUA A;  2W3S A;  4I2G A;  4PPX A;  3NRZ A;  4DQS A;  4PZN A;  4RT2 A;  2KJ9 A;  9ICS A;  4IR9 A;  2HHS A;  1KKX A;  2Z7J A;  3RBE A;  4MEX A;  1KFT A;  1L3U A;  2K8A A;  3NVY A;  3EPI A;  5J0W A;  3TAN A;  4F71 A;  1XO0 A;  2WF8 A;  9ICL A;  1X66 A;  3N7P D;  3ONN A;  3HRD D;  3JPN A;  2P35 A;  2EAP A;  5KFT A;  1QQ5 A;  5ALZ A;  1RDF A;  2NO4 A;  3KZX A;  4YN4 A;  4UBB A;  3Q8S B;  3RJK A;  4C4R A;  1FFV A;  2KIV A;  3C1Y A;  1WCN A;  3UQ2 A;  2FPK A;  4ELV A;  2ASJ A;  2HVI A;  5DBC A;  5L1K A;  2KTQ A;  1WYG A;  4QZD A;  4JK1 A;  2Q66 A;  5B3Q A;  3C29 A;  3PO4 A;  5DQH A;  4USA A;  2BCV A;  4AT9 B;  4Y2T A;  1NK0 A;  3GV8 B;  1R8B A;  1Q46 A;  3K1R B;  3K1Z A;  1GO3 F;  2HI0 A;  4AT8 B;  3EYZ A;  3THV A;  4UB6 U;  4BWJ A;  5ALQ A;  3N7S C;  3QUT A;  3KHL A;  2ES6 A;  5ALD A;  2ALZ A;  4WC7 A;  5IIM A;  5J2K A;  2Q0Z X;  1JQR A;  4DQP A;  5J2I A;  4KLL A;  5KL8 B;  4B9M A;  3CYM A;  1K5O A;  2ZIX A;  9ICT A;  4O5K A;  2KHV A;  2XGQ A;  5IIN A;  4LEZ A;  1ZQY A;  4DEZ A;  5L1L A;  1S0M A;  3SEI A;  3F2D A;  1KTQ A;  1ZQH A;  4RQ7 A;  2DPI A;  2KG5 A;  4FHW A;  4RU9 A;  5AIB A;  2IOH A;  2F2A B;  4US9 A;  3NRW A;  1RYS A;  2VA3 A;  2ZTD A;  3PV8 A;  2J6T A;  4OCZ A;  4CRX A;  9ICJ A;  2LPE A;  1MIY A;  4M04 A;  3QEB Z;  1XS9 D;  4F93 B;  5AK5 A;  3F53 A;  2VAN A;  2JEJ A;  3OVB A;  2KJ8 A;  5HRI A;  1PUZ A;  1X6J A;  3OTQ A;  5CA7 A;  1CI4 A;  4O3P A;  4I2E A;  5J2D A;  5HRK A;  2IBK A;  4EGW A;  1BPE A;  1SXE A;  1XSL A;  3OHB A;  2LM4 A;  5HHH A;  4PHD A;  2HW3 A;  4YP3 A;  5DBB A;  4GC6 A;  8ICY A;  4O69 A;  1UPH A;  4MKP A;  3NVV A;  3WK9 A;  1TK5 A;  2Y1J A;  2RDI A;  4UB3 A;  2JEF A;  4X4N A;  2KK0 A;  2C22 A;  4FZM A;  4E80 A;  2ZUD A;  4RQ2 A;  4Q44 A;  2DL0 A;  5J0U A;  4DQQ A;  3MDA A;  3SEN A;  3RB0 A;  3OSP A;  5BPC A;  4JB3 A;  2ZXH A;  1UEU A;  3D6J A;  2PFO A;  3HP6 A;  3QZ7 A;  1ZQK A;  2A3V A;  5CFU A;  3H0L B;  7ICH A;  3ISB A;  1L7P A;  2BZF A;  2R8K A;  2B51 A;  4EBE A;  5DQG A;  4R63 A;  3M1Y A;  1ZOL A;  1X42 A;  1RXV A;  4ICA A;  4I2B A;  2EWR A;  4XRH A;  1ZQC A;  3C28 A;  1JMS A;  1ZD3 A;  1R89 A;  1KRP A;  4O9M A;  4ED0 A;  5HRE A;  1Q79 A;  4YD2 A;  4KLS A;  3H37 A;  2EAO A;  5AKG A;  3MR2 A;  3BS7 A;  2W55 A;  4Y2X A;  2XGP A;  4G9B A;  9ICN A;  2AGP A;  1NK8 A;  5J2G A;  2YTU A;  1QQ6 A;  3CRX A;  2ZIW A;  1KQQ A;  4YD1 A;  2YMP A;  2F76 X;  2KZM A;  3VCB A;  1UT8 A;  3NAS A;  2EZY A;  4Z6D A;  1NZB A;  3PML A;  1V9P A;  3GZF A;  3PW2 A;  2I9G A;  1D9F A;  1NJZ A;  4EBC A;  2XVT A;  4ECU A;  7ICE A;  3DV9 A;  2BQU A;  1RG6 A;  1Z4O A;  4CDG A;  2W7O A;  3QE9 Y;  2RLT A;  4PGX A;  2QAR B;  2W9C B;  2HVH A;  5CEH A;  1MA7 A;  5AI6 A;  4OO1 J;  1KSP A;  2JMG A;  5AIC A;  4IRD A;  4NXX A;  1L7M A;  2ZIV B;  1Z1V A;  4MF8 A;  3HPO A;  4PHP A;  2GO7 A;  3SAG A;  1GPJ A;  3RB4 A;  1PVQ A;  1Q78 A;  1ZRN A;  4BWM A;  1PK1 B;  3BZK A;  4HYK A;  5AK6 A;  1WOT A;  1SZP A;  2HBK A;  2XY6 A;  1NK4 A;  4JMU A;  2KIW A;  3GU3 A;  4OD0 A;  2XY5 A;  1SKW A;  3HJ4 A;  1X6I A;  3ZD9 A;  4QZB A;  2XID A;  4UQG A;  3I28 A;  3WKD A;  5T14 A;  1X2I A;  1N2X A;  1S0O A;  2L5Y A;  5AM1 A;  4FO6 A;  5ALJ A;  2I5H A;  2F1I A;  1NK6 A;  2B0C A;  4OJ5 A;  3CK6 A;  2JGA A;  5ALK A;  5DLG A;  1Z00 A;  1D8B A;  2HBM A;  3ETR A;  3V7L A;  1WWU A;  2IUB A;  5AI9 A;  3H4B A;  1SV0 A;  4O3M A;  1DOQ A;  1Z3E B;  4NLB A;  3PST A;  1F0M A;  3BQ1 A;  4RUC A;  5DGB A;  2ZUC A;  1UT5 A;  5KT3 A;  5DB7 A;  4M0A A;  2F44 A;  2O1P A;  1ZQR A;  4LZD A;  1PVP A;  3M9M B;  3SZ2 A;  7ICK A;  5D49 A;  4C4T A;  2FCL A;  2BCR A;  2YB4 A;  3AQK A;  2G06 A;  1TFW A;  4QWD A;  4F4Z A;  2WF6 A;  3UMB A;  1ZQO A;  2GWS A;  1JXE A;  3RH5 A;  3PX6 A;  3NYB A;  3WFP A;  3RB3 A;  4KLG A;  1C7Y A;  2B56 A;  4KX3 A;  3S6J A;  1B0X A;  2M2V A;  1U9L A;  1QSY A;  3T5L A;  4GFJ A;  4Y2U A;  2MUT A;  4ECV A;  5AKZ A;  1ZQS A;  3Q8L A;  2B6G A;  3KOO A;  2H3Z A;  4X4O A;  1V4A A;  3KD3 A;  2JZB A;  5AKJ A;  1SZH A;  1ZQP A;  3H39 A;  4RPY A;  5B66 U;  4EZ9 A;  3SAF A;  4DFD A;  2C2E A;  3M8R A;  5HRB A;  3LDA A;  3SV3 A;  4EEN A;  5CWR A;  2KV2 A;  4Z6E A;  5DKW A;  3AQL A;  4DFM A;  1VJ5 A;  9ICR A;  5AM5 A;  3H40 A;  4O68 A;  4Z6F A;  2HSZ A;  5K4L A;  4EZ6 A;  3H8M A;  4ZH4 A;  2KEY A;  4DQI A;  5ALV A;  1IV8 A;  1K1S A;  4CGZ A;  1S0V A;  9ICB A;  4NLZ A;  5CR0 A;  4MFC A;  3C1Z A;  4UAV A;  1BPY A;  2GLE A;  4OAI Z;  2F1J A;  2K4I A;  1U49 A;  1L7N A;  4DCC A;  3ISC A;  4DSJ A;  3AN1 A;  1A76 A;  1FIQ A;  1S9F A;  2NRX A;  4NXV A;  1ZJM A;  1CUK A;  4K4I A;  1N63 A;  5HRD A;  2AJQ A;  4P2H A;  3QU9 A;  4X5V A;  3OUY B;  2DR9 A;  3AQF A;  3IHQ B;  3PSP A;  2XCA A;  4Y2V A;  2K8C B;  2OXO A;  1RXW A;  1JAL A; 
#chains in the Genus database with same CATH homology
 3OGU A;  3MFH A;  2DRA A;  3C21 A;  9ICP A;  1SL1 A;  4XUS A;  5J0R A;  4YR2 A;  3RJJ A;  4DL7 A;  9ICV A;  3FYH A;  2HHV A;  2JEG A;  2KFN A;  2ZUB A;  4WC6 A;  3BQ0 A;  3NTU A;  5KG7 A;  1KFS A;  4WCW A;  5DEC A;  2ZH8 A;  1NOM A;  4J9Q A;  2DVI A;  4JV0 A;  5KFA A;  2VA8 A;  3BQT A;  4F91 B;  1HUO A;  2PFQ A;  3WFS C;  1XSN A;  4DOB A;  5KT4 A;  4FHX A;  4RUA A;  3MR3 A;  2PI5 A;  1SKR A;  2BCQ A;  4I2G A;  4O0I A;  4PPX A;  5J2H A;  2ZHB A;  4DQS A;  4RQ8 A;  4DSL A;  3FDS A;  4RT2 A;  4DSI A;  5KFL A;  1BPX A;  2R8J A;  3C5F A;  4KLE A;  9ICE A;  2DR7 A;  1NKC A;  9ICO A;  9ICS A;  4IR9 A;  2HHS A;  3UXN A;  1JXL A;  4M9H A;  3RBE A;  4MEX A;  1KFT A;  1L3U A;  1BPZ A;  4WC3 A;  4WC5 A;  3EPI A;  5J0W A;  3M8S A;  3TAN A;  2BGW A;  1D9D A;  9ICU A;  1K1Q A;  1TV9 A;  3HT3 A;  5TZV A;  2IA6 A;  9ICG A;  2NRV A;  5DBA A;  5J0X A;  4B9S A;  3UPQ A;  3H8S A;  9ICL A;  4TQS A;  8ICZ A;  8ICO A;  4EBJ A;  1UEV A;  3JPN A;  4RQ6 A;  1MC8 A;  5KFT A;  5CB1 A;  7ICQ A;  2BDP A;  5EOZ A;  8ICT A;  1QSS A;  2H5X A;  4YN4 A;  3ZD8 A;  5J2A A;  4UBB A;  2ZTC A;  3Q8S B;  4ED6 A;  5IIJ A;  3RJK A;  3PY8 A;  1PZN A;  2M2U A;  4I27 A;  5HRG A;  1S97 A;  2BHN A;  3UPS A;  4FHV A;  3C1Y A;  1WCN A;  3UQ2 A;  3OSN A;  1JX4 A;  4F50 A;  4QWC A;  2FPK A;  1S76 D;  1R8A A;  4DLE A;  3L9D A;  1UA1 A;  2DFL A;  4GXI A;  2ZJ5 A;  3MFI A;  4ELV A;  2ASJ A;  1JAJ A;  4J9P A;  2P6R A;  9ICK A;  4ATB A;  2HVI A;  1MIW A;  4LZG A;  5DBC A;  4X4P A;  4KN7 A;  5KTQ A;  5L1K A;  2KTQ A;  4QZD A;  4JK1 A;  2Q66 A;  3E2E A;  4QZG A;  4E8F A;  5EWE A;  3PO4 A;  4RPX A;  4ED7 A;  3KHG A;  5DQH A;  2BCV A;  4RT3 A;  5HRL A;  4AT9 B;  4F5O A;  5KFS A;  4ELU A;  4IG8 A;  4DL6 A;  1NK0 A;  1HJP A;  3GV8 B;  7ICO A;  2P6U A;  4TUR A;  2KP7 A;  1R8B A;  1DK3 A;  4NM2 A;  5DG9 A;  3RAX A;  2FMQ A;  5KG5 A;  5F9L A;  4AT8 B;  4WC2 A;  3EYZ A;  2ATL A;  3THV A;  2A1J A;  2BPC A;  5HMM A;  2NRW A;  4BWJ A;  3JPO A;  3KHL A;  1DGS A;  1COO A;  5KFE A;  4J9K A;  3QEA Z;  2ALZ A;  1KFD A;  3G6V A;  5IIM A;  2ZJ8 A;  1BPB A;  2Q0Z X;  5J2K A;  4MF2 A;  1JQR A;  3B0Y A;  2RFF A;  2BPF A;  2R8G A;  5J2I A;  4DQP A;  4IRK A;  4KLL A;  4B9M A;  4UD5 A;  5KFZ A;  3JPQ A;  4QW8 A;  4E7X A;  2ZHA A;  4KTQ A;  4J9S A;  4WC4 A;  2HHQ A;  1EXN A;  9ICT A;  5DLF A;  4O5K A;  2XGQ A;  5IIN A;  4X0A A;  5J2E A;  4EYI B;  1ZQY A;  4ED1 A;  4DEZ A;  4F3O A;  9ICQ A;  4NM1 A;  4J9L A;  5L1L A;  1RZT A;  8ICK A;  5HRF A;  4XQ8 A;  4QZI A;  1S0M A;  1KTQ A;  1ZQH A;  4RQ7 A;  2DPI A;  3ZDB A;  2NRK A;  1XWL A;  3RB6 A;  4NLK A;  4RU9 A;  4FHW A;  4EP7 A;  4M9N A;  4WBZ A;  2ZH3 A;  3KHH A;  2ZH2 A;  2MUT B;  1RYS A;  2AGO A;  2VA3 A;  4RNO A;  2ZTD A;  3PV8 A;  2ISO A;  4F5N A;  5DGA A;  1QLN A;  2J6T A;  4GXJ A;  4NXZ A;  9ICJ A;  5KT5 A;  3GQC A;  1S0N A;  4M04 A;  1MIY A;  1CEZ A;  3C2K A;  4LT6 A;  1Z00 B;  5KG3 A;  5KFJ A;  4C8N A;  3V6H A;  3QEB Z;  5J2F A;  4F2R A;  1XS9 D;  4F93 B;  2R8I A;  5KT2 A;  3TFS A;  9ICH A;  2AQ4 A;  2JEJ A;  2VAN A;  5KFF A;  3TAR A;  1RYR A;  3HJ1 A;  3OVB A;  3HW8 A;  5HRI A;  4QZE A;  5CA7 A;  2W9B A;  4O3P A;  3H4D A;  3RJE A;  2MAX A;  4NLG A;  1TAU A;  4TQR A;  4I2E A;  5J2D A;  5HRK A;  2IBK A;  1BPE A;  4I2J A;  3H7I A;  4ED8 A;  4DSE A;  1XSL A;  5KFV A;  3PR5 B;  3OHB A;  5HHH A;  4PHD A;  1ZQG A;  3PW7 A;  2HW3 A;  4YP3 A;  1N56 A;  5DBB A;  3ETL A;  4GC6 A;  8ICE A;  4RQ4 A;  2C2R A;  8ICY A;  2FMP A;  3KTQ A;  4F5P A;  4C8O A;  3H38 A;  4UAZ A;  4WBY A;  4UAW A;  1TAQ A;  4ECS A;  1FA0 A;  3LQC B;  8ICU A;  3RBD A;  5L9X A;  4ELT A;  4DF4 A;  4S3N A;  1TK5 A;  2XCP A;  2Y1J A;  2RDI A;  4UB3 A;  8ICW A;  1ZQL A;  3WFQ E;  3GIL A;  4GC7 A;  2JEF A;  4X4N A;  1KLN A;  5DDM A;  4UB2 A;  2AJQ A;  2C22 A;  1ZQV A;  3SV4 A;  4M9J A;  4E80 A;  3T5H A;  2ZUD A;  4QZF A;  2UVW A;  4F8R A;  4RQ2 A;  4RQ1 A;  5HHI A;  4Q44 A;  5J0U A;  4YR0 A;  4DQQ A;  1S10 A;  3RR7 A;  5DQI A;  8ICI A;  3MDA A;  3AQN A;  4X4S A;  4YCX A;  1XC9 A;  4X4Q A;  5HNK A;  5BOL A;  4UB1 A;  3RB0 A;  3OSP A;  5DB8 A;  5BPC A;  3PW0 A;  2DPJ A;  5CP2 A;  4GXK A;  1MSW D;  4QZ9 A;  1UEU A;  2BE3 A;  9ICA A;  5J0Y A;  1RPL A;  3GDX A;  1VJ7 A;  4WC0 A;  5KFO A;  3K75 D;  2IHM A;  4XA5 A;  9ICI A;  4BXO B;  2PFO A;  1XU4 A;  1ZQW A;  3HP6 A;  4DSF A;  1T3N A;  1NKE A;  4I28 A;  4M6W B;  3QZ7 A;  5HC9 A;  1ZQK A;  3H8J A;  7ICH A;  4UAY A;  3UQ0 A;  3ISB A;  4RZR A;  2ID1 A;  4ED3 A;  4X4U A;  2R8K A;  2KZ3 A;  4QWE A;  3V6K A;  1TFR A;  2ZJA A;  4EBE A;  5DQG A;  1BGX T;  4R63 A;  3RAQ A;  1WCL A;  4RQ5 A;  4EBD A;  1RXV A;  1PX5 A;  1KEJ A;  4YQW A;  2P66 A;  2W8K A;  5D4B A;  7ICF A;  4I2B A;  4EBK A;  4F5R A;  5JUM A;  2HHX A;  2M2W A;  4DOC A;  4XRH A;  2VA2 A;  4RWN A;  4KLI A;  4F92 B;  3EPG A;  5HML A;  1ZQC A;  4WC1 A;  4M6W A;  7ICK A;  1JMS A;  1SL0 A;  1R89 A;  3GFK B;  1KRP A;  4KLF A;  3Q8Q B;  5CJ7 A;  1ZYQ A;  4RWQ A;  4O9M A;  4AT7 A;  4FHY A;  2ASL A;  5J2C A;  4ED0 A;  8ICM A;  5HRE A;  2XC9 A;  1Q79 A;  4YD2 A;  1ZQN A;  1ZQD A;  4KLS A;  3H37 A;  7ICM A;  5J29 A;  4O3R A;  2W9M A;  3MR2 A;  1ZQI A;  7ICJ A;  2XGP A;  9ICN A;  3ZDE A;  2AGP A;  2J6U A;  3Q8R B;  1NK8 A;  5J2G A;  4KLQ A;  3PX0 A;  3WFR E;  3B0X A;  7ICS A;  2W9A A;  3N97 B;  3MAB A;  3V6J A;  1KDH A;  1ZET A;  1NK5 A;  1X9M A;  4B9T A;  1L5U A;  1NJW A;  8ICS A;  5DB6 A;  2FPL A;  4YD1 A;  4ED2 A;  2Y1I A;  1UET A;  3RR8 A;  3MGI A;  2BQ3 A;  3MDC A;  3EZ5 A;  2KN7 A;  5IIO A;  4LVS A;  2KZM A;  1UT8 A;  4F4X A;  4F2S A;  4Z6D A;  3T3F A;  4O3O A;  4PGQ A;  4FHP A;  4IR1 A;  1ZQE A;  5L1I A;  3PML A;  3TAP A;  4QWB A;  3ZDC A;  1V9P A;  2XY7 A;  2PXI A;  2I9G A;  3PW2 A;  5F9N A;  2KZZ A;  4M2Y A;  8ICR A;  1D9F A;  4WC7 A;  1NJZ A;  1NJX A;  4EBC A;  4ECU A;  7ICE A;  4I2F A;  4FS2 A;  4DS5 A;  4DSK A;  2PFP A;  4O5C A;  1NO5 A;  2BQU A;  4QZC A;  4NLN A;  9ICW A;  4ECT A;  5J0P A;  4P4M A;  3MBY A;  3G6Y A;  5J0S A;  5KFB A;  4YFK A;  2W9B B;  3UXP A;  3QE9 Y;  4I29 A;  4ECY A;  8ICP A;  4PGX A;  3ISD A;  2B21 A;  3RTV A;  3PW4 A;  3RJH A;  2M2T A;  4F5Q A;  1ZQX A;  4RQ0 A;  5EWF A;  1T7P A;  2W9C B;  5KG1 A;  2HVH A;  2ZH7 A;  4X4R A;  4M47 A;  1BPD A;  5KT7 A;  3PW5 A;  5KFR A;  1LV5 A;  1KSP A;  1MIV A;  4R65 A;  1QTM A;  3V7J A;  4IRD A;  1YLQ A;  4XQ7 A;  3M9O B;  2ZH1 A;  3PO5 A;  4M5D A;  4FH3 A;  3GIJ A;  2HHT A;  3Q8M A;  2HHP A;  2I1Q A;  5KFD A;  4MF8 A;  3HPO A;  4Z6C A;  1S77 D;  4B9N A;  3JPR A;  2HHU A;  4PHP A;  1ZQA A;  1TK8 A;  3C2L A;  3RB4 A;  7ICT A;  1Q78 A;  1TVA A;  1BVS A;  2BPG A;  4DLG A;  4BWM A;  4I2H A;  2HHW A;  4DFJ A;  4QW9 A;  4HYK A;  3AU2 A;  3H8W A;  4Q43 A;  3SYZ A;  1BNO A;  1F5A A;  4GLX A;  1B43 A;  5KFP A;  3OJS A;  4J9O A;  1A77 A;  4YR3 A;  4IRC A;  1SZP A;  1WOT A;  3AU6 A;  2OWO A;  4DS4 A;  4KLO A;  5KT6 A;  3HWT A;  2XY6 A;  1NK4 A;  2UVV A;  1HUZ A;  2XY5 A;  1U45 A;  5KFC A;  1SKW A;  7ICR A;  5C5J A;  4I2A A;  4O5E A;  3HJ4 A;  3JYY A;  3ZD9 A;  4X4T A;  4QZB A;  3C5G A;  1NJY A;  4UQG A;  1X9W A;  4TUP A;  1S0O A;  1X2I A;  1XO1 A;  1UA0 A;  3OV7 A;  2A1J B;  2DR8 A;  3Q8K A;  4FO6 A;  1L3T A;  5DED A;  3OVS A;  2FMS A;  4O3N A;  3JPP A;  3M9N B;  2FPM A;  2LYH A;  1ZQU A;  4KLT A;  2F1I A;  1NK6 A;  4MEY A;  4R8U B;  3C2M A;  4FS1 A;  4FH5 A;  3K4G A;  3T5K A;  2ZH6 A;  4R8U A;  4MFA A;  3PR4 A;  2ZH5 A;  5DLG A;  3HIY A;  4ECR A;  9ICX A;  5KG6 A;  1Z00 A;  4BDP A;  3OHA A;  3BJY A;  3RJI A;  5J2J A;  1ARO P;  3TI0 A;  1H38 A;  4BXO A;  4QZ8 A;  4YXJ A;  3V7L A;  3G6X A;  4ECQ A;  3RH4 A;  1T8E A;  4Q8E A;  1VFG A;  7ICU A;  5III A;  4YMN A;  1ZQF A;  2F1H A;  5BOM A;  4IQT A;  2V4R A;  9ICM A;  2PBE A;  5J0Q A;  1ZQJ A;  4J9R A;  3C18 A;  1SL2 A;  2PFN A;  4ATB B;  4MFF A;  4X4V A;  4X0B A;  3H4B A;  9ICC A;  4DFP A;  3RJG A;  1DOQ A;  4DFK A;  1Z3E B;  5IIK A;  4RWO A;  3BQ1 A;  5KFW A;  2XO7 A;  8ICV A;  4RUC A;  3PX4 A;  5DGB A;  2ZUC A;  1B22 A;  1UT5 A;  2NRT A;  4PHA A;  5KT3 A;  3GV5 B;  5DB7 A;  4P4O A;  4M0A A;  5DDY A;  5KFX A;  4B9V A;  2C2D A;  2O1P A;  1ZQR A;  3ORY A;  2BCU A;  4LZD A;  4M9L A;  4RPZ A;  3HX0 A;  4KN4 A;  4RNM A;  2ISP A;  3GIM A;  8ICN A;  3M9M B;  2KFZ A;  1OU5 A;  5CHG A;  3JPS A;  2ASD A;  3SZ2 A;  4KMU A;  4PH5 A;  1JN3 A;  5D49 A;  2AGQ A;  1D8L A;  4B9U A;  4C8M A;  2BCR A;  3PMN A;  2O5A A;  3AQK A;  3RRG A;  3WFO A;  1TFW A;  1D8Y A;  1NK9 A;  7ICG A;  1R8C A;  4DOA A;  2IMW P;  4QWD A;  4YMM A;  5DB9 A;  4F4Z A;  8ICA A;  5HRH A;  4PGY A;  4RNN A;  1ZQO A;  5IIL A;  2GWS A;  1JXE A;  4IQU A;  5KFI A;  3OJU A;  1T4G A;  3MR5 A;  3H3A A;  3RH5 A;  3LWM A;  4DL4 A;  3PX6 A;  4KLD A;  4Q8F A;  4QWA A;  3NYB A;  3WFP A;  8ICQ A;  2M9N A;  4RQ3 A;  3RB3 A;  4I2C A;  4KLG A;  4YXM A;  3EW9 A;  1C7Y A;  4UBC A;  5HP4 A;  3ZDD A;  4O3Q A;  8ICJ A;  2FLL A;  1NKB A;  4QZA A;  5J0O A;  3ZDA A;  4JWN A;  4DWI A;  1NZP A;  3SI8 A;  4KLM A;  5HR9 A;  5KFQ A;  1TFY A;  4YMO A;  4JWM A;  2FLN A;  2M2V A;  1KNY A;  1U9L A;  4TUS A;  4BGD A;  4UB4 A;  3T5L A;  1QSY A;  2FLP A;  5EWG A;  1ZQB A;  2MUT A;  3LWL A;  2W8L A;  4ECV A;  3PVX A;  1BNP A;  2DR5 A;  3AQM A;  4G3I A;  3BDP A;  1ZQS A;  4EYH B;  4C8K A;  8ICG A;  1MQ2 A;  1ZQT A;  3GII A;  1U48 A;  4C8L A;  5L1J A;  3TQ1 A;  3Q8L A;  3GV7 B;  2BR0 A;  8ICF A;  4X4O A;  1V4A A;  4NKT A;  2JZB A;  3IM1 A;  5KFU A;  5KFM A;  4R64 A;  3N4M B;  4K4G A;  3OVA A;  4J9N A;  1DK2 A;  1ZQP A;  3MR6 A;  2WTF A;  4O3S A;  4UD4 A;  4JUZ A;  4I2D A;  2IHN A;  7ICI A;  3H39 A;  4RPY A;  4EZ9 A;  5DG8 A;  4Q45 A;  3LK9 A;  3RH6 A;  3T5J A;  7ICN A;  4TUQ A;  2C2E A;  2PI4 A;  3M8R A;  5KFH A;  3NGD A;  4R66 A;  5HRB A;  3LDA A;  3SV3 A;  5CWR A;  3QZ8 A;  5D46 A;  4DO9 A;  4AT7 B;  4Z6E A;  3AUO A;  1QSL A;  4AT8 A;  2V9W A;  1IM4 A;  4PHE A;  5DKW A;  4E0D A;  1NK7 A;  5KFG A;  4DFM A;  9ICF A;  9ICR A;  3AQL A;  1U4B A;  4CCH A;  4KIT B;  5F2V O;  4P4P A;  5J2B A;  2W9C A;  4DL5 A;  3UXO A;  3RRH A;  1Y88 A;  1ZQM A;  5KG0 A;  4DQR A;  4AT9 A;  8ICC A;  4DL3 A;  4NY8 A;  4ECZ A;  4NKU A;  3H40 A;  3RJF A;  5KFN A;  1TK0 A;  4K4H A;  4F4K A;  4Z6F A;  3GIK A;  4ECW A;  4F4Y A;  3C23 A;  2NRZ A;  4ECX A;  2UVR A;  4EZ6 A;  4KLJ A;  8ICB A;  5KFY A;  2AQ0 A;  3PNC A;  3TAQ A;  8ICX A;  4ZH4 A;  4J9M A;  3C66 A;  5DG7 A;  5J0T A;  1TKD A;  5KG2 A;  4DQI A;  4JV1 A;  3JZ0 A;  1K1S A;  1S0V A;  1ZQZ A;  2DRB A;  2V4Q A;  5KFK A;  4DF8 A;  4B9L A;  7ICP A;  9ICB A;  1X9S A;  4NLZ A;  5CR0 A;  4MFC A;  3C1Z A;  1BPY A;  7ICV A;  4YVZ A;  1L3S A;  2F1J A;  4IQW A;  1U49 A;  4DL2 A;  2UVU A;  3ISC A;  1XSP A;  4DSJ A;  1ZQQ A;  4M9G A;  4IQV A;  4QZH A;  5KG4 A;  3BQ2 A;  4F4W A;  3OUY A;  1A76 A;  3JPT A;  2AU0 A;  4YG2 A;  2BCS A;  1S9F A;  2NRX A;  3EWA A;  3MGH A;  1JIH A;  1ZJM A;  2J6S A;  4KLU A;  4FBT A;  1CUK A;  1LB2 B;  4K4I A;  3Q8P B;  8ICH A;  5HRD A;  3V72 A;  1U47 A;  2R8H A;  4FBU A;  4P2H A;  2JZB B;  1N48 A;  4UB5 A;  2ZTE A;  1IXR A;  2C28 A;  4KLH A;  4RWP A;  2JEI A;  2ZH9 A;  4EEY A;  4X5V A;  8ICL A;  3OUY B;  1MQ3 A;  2DR9 A;  3IHQ B;  3TFR A;  3KHR A;  1L3V A;  2XCA A;  1ZJN A;  4JV2 A;  4I2I A;  2BQR A;  2ZH4 A;  7ICL A;  2RDJ A;  3V7K A;  1SKS A;  2BKE A;  1RXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...