4PHAA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phaA03
3N4MB 3PO4A 5DDYA 1A77A 3BQ2A 4GC6A 3PW0A 1BVSA 2FLLA 4GC7A 2ZH9A 5DG7A 7ICVA 2ZH3A 4KLQA 1R8CA 4UBCA 1D9FA 4FBTA 3H8WA 5J2EA 2NRXA 5DQHA 2ASJA 4DL3A 1XSNA 4X4VA 5DGBA 4TUPA 2KZMA 1NO5A 3OVAA 1ZQJA 4KN7A 3QEAZ 3WFOA 5KFWA 1IM4A 1NJYA 4FH3A 2HHWA 4J9SA 3OVSA 4F3OA 2C2EA 1SL2A 4EBKA 2Q0ZX 9ICQA 1BNOA 5DBAA 3JPRA 3H40A 2W9AA 4AT8B 5J0YA 2UVRA 4XQ7A 1NK8A 2BCSA 9ICLA 3NYBA 4P4MA 3JPTA 5EOZA 1TK0A 2PFOA 4JV2A 4PHEA 4QW9A 8ICYA 1Z00A 1DOQA 2DFLA 4XQ8A 5KFPA 4ECXA 8ICRA 1BNPA 3MR5A 5J0WA 2UVWA 4X5VA 4I27A 4RWPA 1EXNA 4RNOA 1BGXT 2HVIA 1S97A 1UT8A 1L3VA 3RB6A 4ED7A 3RR7A 2W9BB 4QZBA 2W9BA 4J9NA 4FBUA 3NTUA 1X9WA 5KT3A 4KLHA 5HRFA 4EEYA 5DBBA 1MIYA 5J0XA 5DG8A 3WFQE 4IG8A 2ISPA 1BPYA 1Q79A 2AGQA 2IHMA 1Z00B 2W9CB 4IQTA 5KT5A 3Q8MA 4FO6A 5HRBA 3OJSA 1TVAA 2FLPA 3FDSA 4M9LA 3C18A 2IA6A 3MDCA 1NJZA 4AT8A 2FMPA 3C23A 4RQ8A 4PHAA 5KFJA 2J6TA 8ICEA 5KFVA 9ICMA 4R63A 3GIKA 4QZHA 2F1IA 3GV5B 5DBCA 9ICAA 5CP2A 2ZTCA 3Q8QB 4DS5A 9ICNA 2ZH2A 5HNKA 4YMOA 1VFGA 4YR3A 4RQ5A 1ZQQA 3V72A 2DRBA 5DEDA 2JEJA 4C8LA 4YMNA 4YVZA 2BDPA 2DVIA 5KFQA 5KFRA 3MDAA 2V9WA 7ICSA 2ID1A 3Q8LA 4NLNA 5KFXA 5L1KA 1IXRA 4DL6A 3OSPA 3ZDDA 5J2AA 2KTQA 7ICTA 5HRIA 4AT9A 4ATBA 5DDMA 4ECTA 4XA5A 1S0VA 2UVUA 1Y88A 1XC9A 3LQCB 4KN4A 4IQWA 2ZUBA 1BPDA 3KHGA 3QZ8A 3PW7A 3TANA 3ZD9A 4Z6EA 4ED0A 5J0RA 3UXNA 3ORYA 1N48A 2M9NA 2C28A 4IRCA 2O1PA 3Q8SB 1T3NA 2R8GA 4HYKA 3V6JA 3MGIA 4QZEA 1V4AA 3MBYA 5CJ7A 4B9NA 3MR2A 2XY7A 4M9HA 4WC0A 4DLGA 5KFUA 3M8RA 1D9DA 3PO5A 1AROP 5IIJA 5J0UA 4KLEA 4DOBA 3HIYA 3ZDBA 1LB2B 3HPOA 4IR9A 1H38A 3H38A 3PX4A 8ICNA 5HREA 4R8UA 4KITB 4R64A 2NRVA 4J9OA 1RXWA 2ZHBA 3UXOA 4RT2A 3Q8PB 4ECUA 1BPBA 4DL4A 2ATLA 1U47A 1S0NA 1S9FA 4JWMA 4I2CA 2ZH5A 1NK0A 4QWEA 1CEZA 4X4OA 9ICFA 4F92B 4O0IA 1NKBA 1NOMA 4GLXA 4UD5A 4RT3A 5KFZA 1ZQUA 5KG3A 5KFFA 1X2IA 3JPPA 3UQ0A 4EBDA 1TFWA 4ED8A 1KRPA 3RRGA 2PI4A 5DQIA 2MUTA 3B0YA 2XC9A 9ICXA 1NZPA 4S3NA 4F50A 2Y1JA 4Z6FA 3GV7B 3HJ4A 1V9PA 3JZ0A 1NKEA 4IQVA 1ZQMA 4O5CA 4R65A 4X4SA 2ZH1A 4YXJA 3GQCA 1R8BA 3TAQA 4X4PA 2ZHAA 4NXZA 3QZ7A 3MFHA 4B9TA 2ZUDA 3ETLA 3OJUA 3H39A 1UEUA 4KLJA 8ICUA 4WC1A 4QZGA 2NRZA 1SL1A 3PNCA 3AU2A 3OHAA 4YP3A 5KFIA 4GXIA 3PW5A 1JX4A 1QSLA 2ZH7A 5DB8A 4UB5A 1QSYA 1PZNA 2V4RA 4M9NA 1DGSA 4JUZA 4MFCA 5KFYA 7ICEA 3EYZA 5J2DA 3ZDCA 1D8YA 3TQ1A 1HUZA 5KG4A 8ICPA 5EWEA 3E2EA 4RQ3A 3THVA 4QW8A 9ICIA 4PH5A 5HHIA 3RRHA 4ECWA 5KT4A 2KP7A 4M6WA 4RU9A 3SYZA 4KLLA 3FYHA 4RQ1A 1UT5A 3H4BA 5HMLA 2XGPA 3GILA 4EYHB 3RBEA 3JPNA 3SZ2A 2AJQA 4O3PA 3JPQA 3LWLA 8ICXA 2ZH4A 5IIOA 5DLFA 2PXIA 2BPFA 4Z6CA 2HW3A 3BJYA 2AQ4A 3OHBA 7ICQA 1ZQHA 2XGQA 4KLMA 4YN4A 4YR2A 2C2RA 4JV1A 4KLIA 5KT2A 9ICUA 5J0OA 2ZJ5A 3V6KA 4WC2A 3HW8A 3M9MB 4DO9A 1R89A 2F1JA 4UQGA 5CR0A 3MFIA 4R8UB 5HP4A 4Z6DA 4F5OA 1MQ3A 2R8KA 3K4GA 2KZZA 4UAZA 3BQ0A 4DSFA 5F2VO 2XY5A 1NK7A 1QLNA 1ZJMA 4EBEA 4NY8A 4UBBA 4J9MA 9ICGA 4EP7A 3PR5B 4J9RA 4DQIA 1XU4A 4QWCA 4IRDA 3OUYA 4KLDA 3PMNA 4F4WA 1NJWA 7ICKA 5IIIA 3C66A 4FHYA 9ICHA 2J6SA 4RWQA 4QZCA 3TFSA 1ZQVA 4LT6A 1KNYA 4QZIA 3RJIA 3RB4A 3B0XA 3M8SA 3ISDA 5J29A 5EWFA 5BOLA 3EZ5A 5DLGA 4DL7A 3PX0A 2FMQA 1ZQDA 1Q78A 1UETA 1SZPA 5KFNA 1ZQLA 1JQRA 2NRTA 2H5XA 3C5FA 3RJJA 2PI5A 3C2LA 4B9UA 4BWJA 2A1JB 2DR7A 4Q8EA 1MSWD 4X4TA 4M6WB 5J2BA 2HHUA 1T4GA 3AQMA 1TFRA 1R8AA 1S77D 3HT3A 3UQ2A 4QZFA 4DEZA 4FHVA 3EPIA 1TKDA 1UEVA 5KFTA 2BE3A 4UD4A 2ASLA 4CCHA 2PFQA 5HRGA 1UA0A 4NM2A 4YD1A 3HP6A 2R8JA 3RJFA 4C8NA 4I2HA 7ICJA 5HRKA 3H7IA 4DQQA 1ZQWA 1TK8A 4AT7B 4ECYA 5KG2A 4KLTA 2W8KA 2HHXA 1ZQCA 2ZJAA 4YQWA 1S10A 3SV3A 5KFHA 1L3TA 3T5LA 2M2UA 4J9QA 3GIJA 2PFNA 1ZJNA 3KHRA 4C8KA 4PGQA 2BCUA 3ZDEA 2W9CA 1MQ2A 4E8FA 4F5PA 4X4RA 3OV7A 4BGDA 2I1QA 5J2GA 3GIIA 4ED6A 3C2MA 1T7PA 2J6UA 7ICGA 4IRKA 2FPLA 1F5AA 1WCNA 4K4IA 4GXJA 5IILA 1FA0A 2FMSA 5CB1A 4RUAA 5HMMA 1OU5A 3LK9A 1K1SA 3WFRE 2W8LA 2PFPA 4FH5A 3BDPA 5IINA 1A76A 1NK5A 3WFPA 4ATBB 8ICVA 2JEFA 4UAWA 8ICBA 4PGXA 1U4BA 4C8MA 4E80A 4I2IA 2BCQA 3GFKB 4DOCA 4ED2A 4I2BA 8ICJA 2BPGA 4KTQA 3RR8A 4I28A 4MEYA 2XY6A 4WBZA 3UPQA 1ZQAA 9ICSA 4P4PA 1T8EA 1DK2A 4DLEA 1QSSA 4F2SA 4DWIA 1MIVA 2DR9A 1HJPA 1CUKA 5J0SA 1MC8A 5BPCA 4ED3A 3AUOA 3BQTA 5KFAA 4M9GA 1BPEA 4NLKA 9ICCA 7ICLA 5KFOA 3PMLA 4DQRA 2BQRA 3Q8RB 1UA1A 1LV5A 1TAUA 5J2FA 5KFGA 3M9NB 3KHHA 4GXKA 1L3UA 4F2RA 7ICFA 4J9LA 4NLGA 5J2IA 2M2VA 4DF4A 1ZQIA 2M2WA 4QWBA 9ICTA 1JIHA 1SKSA 1MIWA 4QZDA 5CHGA 1ZQOA 5L9XA 1ZQEA 2HVHA 2HHQA 2JZBB 4DSLA 4K4GA 3H4DA 2JEGA 5L1JA 4RWNA 4AT9B 1S0MA 7ICOA 3C1YA 2M2TA 5HHHA 4UB4A 4DF8A 1TK5A 4O3OA 1NK9A 1KFSA 4C8OA 1KFTA 1TAQA 1U48A 3RJHA 1U45A 4F91B 2ASDA 4NLZA 3ZD8A 4YXMA 1NK4A 1YLQA 3RTVA 5KFKA 5L1IA 4M2YA 2C22A 3OGUA 4J9KA 3AU6A 4FHWA 4DL2A 2UVVA 2DRAA 1ZETA 2FPKA 2BKEA 4F4YA 4IQUA 3GIMA 4DQPA 5L1LA 4O5KA 5HRLA 4R66A 4YD2A 5TZVA 4DSEA 7ICRA 3ISCA 1SL0A 3T5JA 2P66A 3K75D 2DPJA 8ICTA 4WCWA 4WBYA 4M9JA 2HHSA 3IHQB 2I9GA 1WOTA 4NKTA 4MFFA 3MR6A 4M0AA 2B21A 3EW9A 3EPGA 2AGPA 3H3AA 8ICMA 4F93B 5J0PA 4NM1A 2JEIA 4DOAA 4QZAA 5BOMA 4RQ6A 3NGDA 4F4XA 3RB3A 1BPZA 2V4QA 4ELTA 8ICKA 4FHXA 4Q45A 1KLNA 3G6VA 2R8HA 2IBKA 4PHPA 1KTQA 1RPLA 5DG9A 5D4BA 4PHDA 5KG7A 4BDPA 2W9MA 3RJGA 9ICBA 4BWMA 1S0OA 1COOA 1XWLA 3RB0A 1XSLA 4KMUA 5KFCA 3PW4A 2O5AA 2ZH6A 4RNNA 2C2DA 1KFDA 3RJEA 9ICWA 4MFAA 4J9PA 4I29A 4ECSA 2HHTA 5DGAA 1WCLA 1S76D 2BPCA 4YR0A 1X9MA 1ZQBA 9ICKA 4DL5A 1ZQTA 9ICVA 5D46A 1SKRA 2VA3A 5JUMA 4AT7A 1K1QA 5DKWA 5KG6A 3OVBA 5J2CA 3V7JA 4ECRA 4XRHA 2P6RA 1ZQXA 2XCAA 4TUSA 4X4NA 2AU0A 5KFDA 1KDHA 4F5RA 4FS2A 7ICNA 5HRDA 8ICOA 4Q43A 8ICAA 2Q66A 4XUSA 5KT7A 1XS9D 4EZ9A 7ICHA 3ZDAA 3HWTA 3OSNA 1ZQKA 3GDXA 3RJKA 2VA2A 2BCVA 5EWGA 4F5NA 4F4ZA 3JPSA 5HR9A 3MR3A 2DR8A 1XO1A 4JK1A 3KTQA 1ZQSA 2ZH8A 5IIMA 4DSJA 4LVSA 3TARA 1KSPA 8ICCA 4DFJA 2BGWA 1N56A 3TI0A 9ICOA 3PVXA 4RUCA 4F5QA 4RQ2A 1RYSA 3G6YA 4B9LA 3HJ1A 1TV9A 4TURA 2VANA 2AGOA 4DFMA 5HRHA 2XO7A 5J2HA 1U49A 3C2KA 2WTFA 4ED1A 4RQ7A 3TFRA 2P6UA 1VJ7A 2A1JA 2RFFA 4WC4A 2R8IA 5KFMA 1NJXA 4JV0A 4FHPA 8ICFA 1KEJA 4I2FA 2ISOA 4E7XA 3MGHA 3SI8A 1BPXA 4LZGA 2IMWP 5HC9A 4RQ0A 4KLOA 4KLUA 2KFZA 2GWSA 3AQNA 3PY8A 4YMMA 4B9VA 3RAQA 4DSIA 3H37A 4I2JA 4O3NA 3PW2A 3TAPA 3WFSC 4RWOA 1NK6A 4ELUA 1ZQPA 3C21A 1L3SA 3C5GA 8ICWA 1PX5A 4O9MA 1U9LA 4X0BA 3T5HA 2KFNA 9ICPA 1JXLA 4BXOA 1JMSA 3IM1A 4EZ6A 4ZH4A 2HHVA 5J0QA 2BQ3A 7ICPA 1XSPA 8ICGA 2ZTDA 2OWOA 4WC7A 3EWAA 9ICJA 5DQGA 1D8LA 8ICHA 3BQ1A 4F4KA 1JAJA 4UB1A 2PBEA 4EBJA 4ECZA 2DPIA 4DFKA 5KT6A 1RYRA 4EYIB 9ICEA 3ISBA 4I2AA 5D49A 8ICIA 5C5JA 5CA7A 4ECQA 1JN3A 4QZ8A 3N97B 5DB9A 4ELVA 4O3RA 8ICQA 4TQRA 5KG1A 4MF8A 2VA8A 3Q8KA 4B9MA 8ICSA 2DR5A 3T5KA 2BHNA 2F1HA 2ZUCA 4YG2A 1ZQYA 1RZTA 7ICUA 3AQKA 4KLSA 1ZQNA 2Y1IA 2MUTB 4QWDA 1B22A 3H8SA 4B9SA 4X4QA 2FPMA 2BR0A 3UXPA 4PGYA 5KFEA 3RBDA 4X4UA 4UAYA 4MEXA 4RZRA 5KFBA 5IIKA 4ECVA 4X0AA 3GV8B 4RPXA 4IR1A 4P2HA 3G6XA 1ZQZA 9ICRA 2ZJ8A 1ZQFA 7ICMA 4RQ4A 1ZQGA 1QTMA 1NKCA 4KLGA 3MABA 2LYHA 4K4HA 4WC6A 4FS1A 2BQUA 1ZQRA 7ICIA 5DECA 3OUYB 3PR4A 4E0DA 3V7KA 4Q8FA 4PPXA 5KG5A 2KN7A 2NRWA 3AQLA 2AQ0A 2MAXA 5KTQA 3V6HA 3C1ZA 4RPYA 4WC3A 3RH5A 4NKUA 4F8RA 2RDJA 3PV8A 2KZ3A 2NRKA 4UB2A 4YFKA 2ALZA 1Z3EB 5F9NA 1L5UA 4DQSA 1ZYQA 4WC5A 3UPSA 4KLFA 4MF2A 3T3FA 4M47A 3LWMA 5DB6A 1SKWA 3KHLA 3LDAA 3JYYA 3JPOA 2ZTEA 4M04A 3V7LA 3L9DA 2HHPA 1TFYA 4UB3A 5KFSA 5CWRA 2BCRA 3H8JA 4LZDA 4DS4A 3PX6A 1DK3A 4O5EA 4DSKA 8ICLA 4I2EA 3M9OB 1B43A 4I2DA 4TQSA 3QEBZ 4YCXA 5J2KA 4P4OA 4TUQA 2RDIA 2XCPA 4JWNA 4G3IA 4RPZA 3RAXA 3QE9Y 4M5DA 1X9SA 4RNMA 5KG0A 4DFPA 3SV4A 1RXVA 1HUOA 4QZ9A 1C7YA 2IHNA 1JXEA 4O3SA 5KFLA 5F9LA 2FLNA 8ICZA 4QWAA 4EBCA 3RH4A 2JZBA 5DB7A 4O3QA 4BXOB 4Q44A 4I2GA 5J0TA 3RH6A 5J2JA 3HX0A
chains in the Genus database with same CATH superfamily
2LI6A 5ALWA 3PO4A 8ICUA 1A77A 5AI6A 2Z7JA 5DQHA 4DL3A 3EUB2 4KN7A 5KFWA 4Y2PA 3SEIA 2ZIUA 4FH3A 2C2EA 3H40A 4AT8B 2UVRA 5AKKA 1N2XA 1DOQA 2DFLA 4XQ8A 2W54A 3QU5A 4RWPA 1EXNA 1O08A 4DFDA 4ED7A 3QU2A 4FBUA 1X9WA 2ZIWA 3UMCA 2ISPA 3H0RB 2F3NA 1D8BA 3KKAA 5KT5A 2JGAA 5HRBA 2FDRA 3FDSA 5CHEA 4OJLA 2FMPA 4PHAA 8ICEA 4R63A 3GIKA 2F1IA 5CP2A 2ZH2A 4YR3A 5K4LA 3V72A 1RM6C 4YVZA 1MN8A 2V9WA 2ID1A 2KICA 5KFXA 1JI7A 7ICTA 4KN4A 1N5WA 4ED0A 2KHVA 2IHOA 4IRCA 1JUDA 3Q8SB 2HBKA 1T3NA 4QZEA 3NUQA 2XY7A 4DLGA 5KFUA 2YX8A 1D9DA 5J0UA 3HPOA 4C7ZA 1PVQA 3I1YA 3H38A 5D61A 2GOLA 4R64A 4NJ8A 4J9OA 4NLCA 2JH7A 3Q8PB 2ZH5A 4X4OA 2JXJA 1HEKA 3NASA 3UQ0A 1TFWA 4ED8A 9ICXA 2XC9A 2Y1JA 2EZYA 4Z6FA 2YMPA 1ECWA 3JZ0A 4Y2SA 1ZQMA 2ZH1A 4YXJA 1R8BA 5B3PA 1FEZA 2XIDA 4NXZA 2O6KA 2D8CA 4B9TA 2ZUDA 1WWVA 4LEWA 4QZGA 2NRZA 3SMVA 1KN5A 2HOQA 3PNCA 2ZH7A 3PW5A 4YP3A 1JX4A 5DB8A 4UB5A 3HJEA 2ESEA 4M9NA 4JUZA 3ZDCA 1D8YA 1HUZA 5AI9A 2ZG6A 9ICIA 2H3FA 5HHIA 2IOHA 4ECWA 4M6WA 3SYZA 1NNLA 4NV0A 1UT5A 5HMLA 3RBEA 5ALHA 3N7RC 5IIOA 5DLFA 3PSFA 7ICQA 2AQ4A 2XGQA 4YN4A 2C2RA 5KT2A 5EE0A 4IC9A 3MGVA 2MSNA 1R89A 5ALYA 2AH5A 3BQ0A 5AM4A 4DSFA 2XY5A 4EBEA 4NY8A 4UBBA 1TE2A 4QWCA 4F4WA 7ICKA 4FHYA 1Z4NA 3TFSA 3RB4A 3B0XA 3M8SA 4DL7A 5DLGA 3PX0A 1Q78A 2KVSA 3CRXA 2NRTA 1DGJA 3RJJA 2K89A 2H3IA 3BS7A 4BWJA 2EDUA 3CYMA 5ALQA 3D6JA 3HT3A 3PSPA 3EPIA 5KFTA 1B0XA 2ASLA 1T94A 5HRGA 2R8JA 4YD1A 4JMUA 2YB1A 2QKQA 5A0LA 4KLTA 1N63A 1ZQCA 4YQWA 2M2UA 2HSZA 4C8KA 3S6JA 3ZDEA 5C0YA 1KKXA 4E8FA 3LVWA 2KD1A 3OV7A 4MHVA 5J2GA 3GIIA 7ICGA 2WF9A 4IRKA 2EZXA 3M6KA 1FA0A 4UB8U 4RUAA 1OU5A 5HMMA 3LK9A 2PFPA 1V97A 1L8LA 4UAWA 4PGXA 1U4BA 1X9XA 4I2IA 3GFKB 2BPGA 4I28A 4MEYA 2EQYA 1ZQAA 9ICSA 2ODGA 4DLEA 5L1MA 1HJPA 4ED3A 2ES6A 4Y2RA 2DR8A 7ICLA 3BQTA 4M9GA 3K7DA 1S5LU 3RFAA 4DQRA 3PMLA 2BQRA 1FO4A 3KHHA 7ICFA 1L3UA 1VJ5A 4ZOHC 5J2IA 4QWBA 9ICTA 1ZXIA 4QZDA 4EELA 3U26A 4Y2QA 4K4GA 2XI9A 3KZXA 3RF9A 2WAQF 2XVTA 2M2TA 1TK5A 1KFSA 4YXMA 1NK4A 5KFKA 1UCVA 3AU6A 4DL2A 3D2SA 3GIMA 4YD2A 7ICRA 3ISCA 2W11A 8ICTA 2DPJA 2HHSA 2I9GA 1WOTA 5AHXA 3QU7A 4PL1A 1NZBA 4EEKA 8ICMA 4NM1A 4FHXA 2V4QA 4ELTA 2R8HA 2WB1C 1KTQA 1RPLA 5D4BA 2GA9D 1S0OA 1IG6A 4KMUA 1CI4A 2ZH6A 4RNNA 3WK8A 1KFDA 9ICWA 4I29A 1ZQ1C 2YMMA 4DCCA 1X9MA 9ICVA 5D46A 3DEEA 2VA3A 2ZIVA 5KG6A 5J2CA 3QX7A 4XRHA 4BJQA 2B51A 2AU0A 5KFDA 4FS2A 2KEYA 2LM1A 5HRDA 2KKVA 3HKZF 4Q43A 8ICOA 7ICHA 2F77X 3HWTA 5ALMA 2VA2A 4UW9A 3F2BA 2A3VA 2P35A 4NXXA 3IRUA 1ED1A 1SXEA 2YTUA 3SAHA 4B9LA 3A0BU 3HJ1A 1IIPA 2AGOA 4DFMA 2WFAA 2A1AA 2AXTU 2R18A 3OTQA 4JLXA 2WTFA 4RQ7A 3SAGA 4JV0A 8ICFA 1UHUA 3SI8A 1FIQA 1BPXA 4RQ0A 1DRGA 4WJ3B 3N7PD 1L7OA 3LVVA 2CRXA 1V85A 1L3SA 5JTGA 4BXOA 1XSPA 8ICGA 2ZTDA 2OWOA 3EWAA 4CF5A 3F2DA 4CRXA 3BS5B 3ONNA 2VJ5A 3WKDA 4GIBA 4EYIB 3ISBA 5AI0A 4QZ8A 4ELVA 5DB9A 4MF8A 4LEVA 4B9MA 3T5KA 1RZTA 2D6FC 1YZ6A 2Y1IA 4K99A 5KFEA 3WK4A 4ECVA 4RPXA 2F76X 3G6XA 4PZOA 1ZQZA 7ICMA 4RQ4A 1QTMA 1NKCA 2LYHA 4WC6A 4FS1A 2BQUA 1ZQRA 1F0MA 1XO0A 4PPXA 1S8OA 5EE3A 2NRWA 2MAXA 5GTHU 4IS7A 5D62A 1PVRA 4YFKA 3I76A 1Z3EB 4O69A 2OCEA 1RG6A 4KLFA 5AKYA 3LWMA 1PVPA 5ALUA 5KFSA 4C0ZA 3PX6A 4O68A 1X66A 1RYUA 4I2EA 4YCXA 2KE7A 5J2KA 4TUQA 2RDIA 2K4IA 1X9SA 1KL9A 3WKBA 3LYSA 3M7DA 1JAJA 4EBCA 4NXWA 2YB4A 4Q44A 4I2GA 5J0TA 2E8MA 2ZH3A 3UM9A 4CE6A 7ICVA 1TFYA 4UBCA 1OXJA 1XSNA 5AIBA 4CGZA 4Y2VA 2K4PA 3OVAA 5AKGA 1NJYA 4J9SA 1SL2A 4EBKA 2Q0ZX 9ICQA 2B4VA 2W9AA 5D63A 5J0YA 3GZFA 2M0NA 9ICLA 4LJXA 5AKLA 3WKAA 4P4MA 3JPTA 5EOZA 1TK0A 2PFOA 2DWQA 2QARA 4QW9A 5JRTA 8ICYA 5KFPA 2NO5A 4ECXA 1BNPA 2KMDA 1BGXT 3RR7A 2K8AA 3QYPA 5KAFU 2W9BB 4J9NA 5HRFA 3NTUA 3UPSA 4EEYA 3NRZA 5KL1B 5DBBA 5DG8A 5J0XA 5G5GA 4IG8A 1BPYA 4FO6A 3OJSA 2FLPA 5AIAA 1NJZA 3C23A 4RQ8A 4QZHA 4OD0A 4C4RA 1N61A 2ZTCA 3Q8QB 4DS5A 9ICNA 1VFGA 5HNKA 4YMOA 5AKHA 4RQ5A 1ZQQA 5EE1A 5DEDA 2JEJA 3VCBA 4YMNA 4C8LA 3OPXA 3L5KA 1OW5A 4NWIA 3Q8LA 1IXRA 4DL6A 3ZDDA 4AT9A 5J2AA 5DDMA 3K1ZA 4XA5A 5TISU 1Y88A 3AMZA 2ZUBA 1BPDA 3PW7A 3ZD9A 4Z6EA 5ALRA 2NYVA 3ORYA 2O1PA 2JMGA 2R8GA 4HYKA 3UMGA 1O03A 4QNLA 1V4AA 3H8MA 5CJ7A 5IIJA 4DOBA 1LB2B 4CF3A 8ICNA 2NRVA 1RXWA 1BPBA 1U47A 1NK0A 2IOFK 4QWEA 1CEZA 1UPHA 4F92B 1NKBA 5KFZA 5KG3A 5KFFA 4EBDA 1SXDA 3F53A 3L3FX 1V38A 1KRPA 4EGWA 1NZPA 2MUTA 3NVVA 3HJ4A 3QU4A 3QUQA 4Y2UA 4X4SA 3TAQA 2ZHAA 4JLZA 3EF2A 2DKXA 2LPEA 1WYGA 3OJUA 4KX5A 1UEUA 4K96A 1QSLA 5KFIA 1YT3A 1A6SA 4MFCA 5KFYA 3TQ1A 1P7DA 1FFUA 4PH5A 1Q8KA 3RRHA 4KLLA 4RQ1A 3SD7A 2KK0A 2AJQA 2ZH4A 8ICXA 3CW2C 2PXIA 2BPFA 4Z6CA 3OHBA 1ZQHA 4KLMA 1QQ6A 4EV6A 4KLIA 2ZJ5A 3V6KA 4WC2A 4DO9A 3IN5A 4UQGA 1VJ7A 2R8KA 5F2VO 1QLNA 9ICGA 4EP7A 4J9RA 4DQIA 1XU4A 4P0PB 3OUYA 3D2QA 4KLDA 5IIIA 2HN1A 9ICHA 1LVHA 4LT6A 4QZIA 3ISDA 5J29A 5BOLA 1JQRA 4QIWF 5AM2A 2H5XA 2PI5A 3C2LA 1MSWD 2HHUA 3AQMA 3UQ2A 5T14A 4QZFA 5G5HA 1IV8A 3N7SC 2BE3A 2PFQA 4NM2A 3HP6A 4C8NA 5ALNA 4ECYA 2W8KA 1S10A 3SV3A 5AKEA 1JROA 3GIJA 2PFNA 1ZJNA 2BCUA 4KX3A 3M6ZA 1MQ2A 1NI3A 2B0CA 2CXYA 2VJ4A 2YY6A 4ED6A 2J6UA 1WCNA 3GU3A 4GXJA 2FMSA 3WFRE 2ZIVB 5IINA 2BZFA 4QJFB 2RP5A 2G0AA 2E1EA 4DOCA 2LYBA 2XY6A 4WBZA 3UPQA 2ZH9A 1CRXA 3H39A 4NLKA 9ICCA 4K9AA 5KFOA 1LV5A 1LKYB 2HBLA 3IG8A 5J2FA 4F2RA 2M2VA 4DF4A 5F3XB 4FZNA 5AI5A 3SENA 1MIWA 5CHGA 2HHQA 2JZBB 3K1RB 3H4DA 2JEGA 3IP4B 1QQ5A 3C1YA 2HCFA 4UB4A 4O3OA 4HAIA 1J97A 2F44A 1TAQA 3RJHA 3ZD8A 1WWUA 5L1IA 4J9KA 4FHWA 2UVVA 3BZCA 1ZETA 2FPKA 4DQPA 4O5KA 2MRLA 5L1LA 4R66A 5TZVA 5AM1A 3K75D 4MFFA 3FAHA 4DOAA 4RQ6A 5ALJA 3AEVA 1KLNA 3G6VA 4PHPA 1X6JA 4BDPA 4BWMA 1COOA 1XWLA 4MFAA 2K60A 4J9PA 4AP9A 1GO3F 3KKAC 2BPCA 5ALEA 9ICKA 1ZQTA 5DKWA 5AM0A 3IG5A 1ZQXA 2CN1A 1KDHA 2KSOB 7ICNA 1N60A 2DGZA 2JH1A 4OJ5A 3AN1A 5KT7A 4EZ9A 2KG5A 3RJKA 2K8CB 4FZLA 5ALSA 3JPSA 1XO1A 4JK1A 3KTQA 1ZQSA 2EAOA 3TARA 4DFJA 2LKYA 1N56A 4RUCA 1RYSA 4MKPA 4K97A 2KKPA 5KNIA 2AHOB 5HRHA 2XO7A 5J2HA 1U49A 3TFRA 4WC4A 2N1RA 5KFMA 4LZGA 4KLUA 2KFZA 3TACB 3RAQA 2WF5A 4O3NA 2E8NA 4O67A 2G06A 4ELUA 1ZQPA 5FP0A 5AM3A 5HR7A 3T5HA 9ICPA 4EZ6A 4ZH4A 5J0QA 2BQ3A 7ICPA 5AK4A 3VC8A 4WC7A 2GLEA 9ICJA 5DQGA 8ICHA 3WKEA 4UB1A 3HKZC 4ECZA 5KT6A 2DUYA 1COKA 2OXOA 2FI1A 3NWIA 4XJEA 8ICIA 5C5JA 5CA7A 4O3RA 1A0PA 2BDUA 5AK3A 2VA8A 3Q8KA 5B66U 4K98A 2MUTB 1UQVA 2E8PA 5KAIU 4B9SA 2QLTA 2FPMA 2BR0A 4N7RA 3RBDA 4MEXA 4X0AA 4IR1A 2WF8A 2ZJ8A 1SB3C 4LEYA 3MABA 2WF6A 1PUZA 3TADC 4OAGA 5DECA 4Q8FA 3V7KA 1SV0C 2AQ0A 1Q3UA 4WC3A 4NKUA 4F8RA 2RDJA 4UB2A 4UASA 3FM9A 2WF7A 1ZYQA 4WC5A 4MF2A 5DB6A 3KD3A 3LDAA 3JYYA 2LM4A 1X40A 5CWRA 3C29A 1B43A 3QEBZ 4OJ6A 4G3IA 4RPZA 4NL9C 3QE9Y 3BS5A 2W04A 5KG0A 3SV4A 1HUOA 4QZ9A 1C7YA 2FLNA 4QWAA 2VKQA 4BXOB 3TADA 5KL8B 5DDYA 3C28A 3PW0A 1BVSA 4GC7A 1R8CA 2OM6A 4FBTA 5J2EA 2ASJA 2KJ8A 2KZMA 5AI4A 1NO5A 1ZQJA 3QEAZ 3WFOA 1IM4A 3OVSA 4F3OA 1BNOA 5DBAA 3JPRA 4XQ7A 2BCSA 2GH1A 5HR6A 3NYBA 3ICXA 2W3SA 2KIWA 4UATA 4C4SA 8ICRA 3MR5A 5J0WA 2UVWA 2HVIA 1S97A 1UT8A 1L3VA 5GTIU 4OCZA 4QZBA 2W9BA 3WFQE 3WK9A 2PMZF 2AGQA 2E8OA 2IHMA 4IQTA 1ZRMA 3NVOA 1TVAA 2KSOA 3MC1A 2WHEA 2J6TA 4UAUA 3GV5B 5DBCA 2DRBA 1GPJA 2BDPA 5KFRA 3MDAA 7ICSA 2KTQA 3OSPA 5HRIA 4ATBA 2DL0A 4LEZA 2LYAA 2XICA 1XC9A 3LQCB 4IQWA 4A8EA 3WU2U 3KHGA 3QZ8A 3TANA 5J0RA 3UXNA 1N48A 4IL6U 3V6JA 3MBYA 3CNHA 4B9NA 4WC0A 3M8RA 3HIYA 2MA1A 5AKJA 3UMBA 1N62A 3PX4A 1ZRNA 3BQ7A 4KITB 4ECUA 2ZIXB 3B9JA 4I2CA 9ICFA 1NOMA 3H0LB 2QB0B 4RT3A 2B6GA 1ZQUA 5DQIA 3B0YA 1KW4A 2KJ5A 2Y0SF 3GV7B 3TKAA 1V9PA 4O5CA 2KV2A 5CFSA 2LBOA 4R65A 3GQCA 4X4PA 3QZ7A 3ETLA 2OEHA 2OHFA 2DKZA 4KLJA 2W55A 1SL1A 4GXIA 1SWWA 1LKYA 4C7YA 4AYBC 1QSYA 2HN2A 2NV3A 2V4RA 1DGSA 2KOBA 2E1FA 5KG4A 1F44A 8ICPA 5EWEA 4RQ3A 4OAFA 2KP7A 3ER8C 3FYHA 3H4BA 2XGPA 3GILA 1T3QA 4EYHB 4O3PA 4US8A 2HW3A 3J81j 3BJYA 3QUTA 2F1JA 4OAIZ 1Z1BA 4Z6DA 3K4GA 1ZD5A 3L4PA 2JV3A 4QIWC 2J6SA 4RWQA 4QZCA 1KNYA 3RJIA 2OYYA 4WQLA 5KFNA 2A1JB 3AQEA 4Q8EA 3SR6A 1T4GA 2RQ5A 1R8AA 1S77D 4K9BA 1B4FA 1TKDA 2Y9UA 2A19A 4UD4A 1UA0A 7ICJA 2KVCA 4I2HA 5HRKA 3H7IA 4DQQA 5KG2A 2HHXA 4C80A 2GO7A 3T5LA 3N28A 2W9CA 5ALLA 4F5PA 4X4RA 2K4HA 1URJA 4BGDA 1RQNA 2I1QA 5ALDA 3E58A 3OWGA 4O6AA 5IILA 1K1SA 2W8LA 4FH5A 1A76A 5ALTA 1NK5A 3WFPA 4ATBB 8ICVA 2JEFA 4Y2JA 2ZIXA 4E80A 2IOFA 2DQNB 4KTQA 4P4PA 2DR9A 4DWIA 1MIVA 5BPCA 3AUOA 1CUKA 5KFAA 3Q8RB 1TAUA 4GXKA 2EANA 4J9LA 4NLGA 2EAPA 2M2WA 4US9A 1JIHA 3DV9A 4G9BA 1ZQOA 2HVHA 5L9XA 5CRXA 4NXTA 5L1JA 5AK5A 4DF8A 1NK9A 4C8OA 1U48A 4NLZA 2ASDA 4U6PA 1Q46A 3NRWA 4M2YA 3OGUA 2DRAA 2BKEA 4F4YA 4IQUA 4DSEA 3F5EA 1SL0A 3T5JA 4F71A 2P66A 4WCWA 5CFUA 4WBYA 4NKTA 4M0AA 2B21A 3EW9A 3EPGA 2AGPA 5J0PA 1SIJA 2JEIA 4QZAA 3NGDA 3NS1A 1BPZA 2BBJA 4P0QB 8ICKA 3PHZA 4Q45A 2IBKA 5DG9A 4PHDA 1ZOLA 5KG7A 4UB6U 2W9MA 9ICBA 2G09A 3RB0A 5KFCA 2QARB 2O5AA 1AQ6A 2WB1F 2C2DA 3RJEA 3WK6A 4OAHA 1Z19A 2HHTA 5DGAA 1WCLA 3SAFA 1ZQBA 4DL5A 3D2NA 1SKRA 1K1QA 3OVBA 4J03A 2P6RA 2XCAA 1VLBA 4X4NA 4F5RA 4WH5A 2KIVA 4KMOB 3OSNA 1ZQKA 2ZIWB 3GDXA 2BCVA 2WAQC 1KQQA 5EWGA 4F4ZA 4LVSA 1KSPA 8ICCA 3MCRA 2BGWA 3TI0A 4F5QA 4RQ2A 2RLTA 4TURA 2LMRA 1J2NA 5CEHA 3C2KA 4ED1A 2W7OA 2R8IA 4FHPA 1SGGA 1KEJA 4E7XA 2ISOA 3MGHA 3KFUF 4KLOA 1KBUA 3PY8A 4YMMA 4DSIA 3WFSC 4RWOA 1NK6A 3DDHA 3IM1A 5AKIA 5ALXA 2NO4A 4F4KA 2PBEA 4EBJA 9ICEA 4ICAA 4I2AA 4K8VA 1FFVA 3N97B 8ICQA 5KG1A 8ICSA 4KB6A 2DR5A 4OO1J 3HRDD 2BHNA 2F1HA 4YG2A 7ICUA 2E3TA 4QWDA 1B22A 3H8SA 5B3QA 2HDOA 4PGYA 4UAYA 4RZRA 5KFBA 1L6NA 5IIKA 2G08A 4P2HA 5JTIA 3R9KA 5AM5A 4K4HA 3PR4A 4E0DA 3KBBA 2HBJA 3AQLA 2KN7A 2CPRA 2K4EA 3FC4A 3V6HA 3C1ZA 1PK1A 4I0UA 4GFJA 2ALZA 5F9NA 1SV4A 2H3ZA 5ALOA 4M47A 3KHLA 2BBHA 3CK6A 3H8JA 5AKXA 4O5EA 5JU5A 8ICLA 3M9OB 4TQSA 4P4OA 3RAXA 2H3VA 4DFPA 4RNMA 5KFLA 3RH4A 3BZKA 3HX0A 3N4MB 3BQ2A 2FCLA 4GC6A 4NL9A 2FLLA 3AQFA 5DG7A 4KLQA 4ACOA 2K8BB 3T79A 3H8WA 1D9FA 2NRXA 3KOOA 4X4VA 4RQNA 3QUCA 5DGBA 1RDFA 4TUPA 4B6JA 2FE9A 2L5YA 2QB0A 2HHWA 5AICA 2G5HB 1NK8A 4JV2A 2ZIUB 4PHEA 1Z00A 1JRPA 4I27A 4X5VA 4RNOA 5ALIA 2F8KA 3RB6A 4KLHA 3ED5A 5KT3A 1MIYA 1DXSA 5ALGA 4F72A 1Q79A 2VIXA 1Z00B 2W9CB 3Q8MA 4M9LA 3C18A 2IA6A 3MDCA 3NVZA 3ETRA 1ZD2P 4AT8A 9ICMA 5KFJA 5KFVA 3O0FA 9ICAA 4BUGA 4WQKA 3I28A 2DVIA 5KFQA 4NLNA 2FJ6A 5L1KA 3H0MB 4ECTA 1S0VA 2UVUA 3A0HU 1MA7A 2ZXHA 3QXGA 2M9NA 2C28A 4NXUA 2DBYA 3MGIA 4EEBA 2Q4TA 3MR2A 4M9HA 1UETA 1Q3VA 3PO5A 1AROP 4KLEA 3ZDBA 4IR9A 1H38A 2YN4A 3KZIU 5HREA 1Z1VA 1SWVA 4R8UA 4FZMA 3UXOA 2ZHBA 4RT2A 4DL4A 2ATLA 1S0NA 1S9FA 4JWMA 2W7PA 4KM5A 1QH9A 4CNQA 4O0IA 4GLXA 4UD5A 1X2IA 3JPPA 1QCKA 5B5EU 3RRGA 2PI4A 4UAVA 4S3NA 1HIWA 4F50A 1NKEA 4IQVA 1PK1B 4CDGA 3MFHA 4WC1A 4CF4A 3AU2A 3OHAA 3QUBA 4NLBA 4USAA 1PZNA 4U7CA 7ICEA 3EYZA 5J2DA 4WOYA 3E2EA 3THVA 5ALKA 4QW8A 2D3DA 1PK3A 5KT4A 1YZ7A 3HILA 4RU9A 3ERCC 4AYBF 5E79U 3JPNA 3SZ2A 4NXVA 3JPQA 2KHQA 3LWLA 9ICOA 1L8OA 4YR2A 4JV1A 9ICUA 5J0OA 5AI8A 2B56A 3HW8A 3M9MB 2EZZA 5CR0A 4R8UB 3MFIA 4F5OA 5HP4A 1MQ3A 2KZZA 2Y0SC 4UAZA 1NK7A 1ZJMA 4O3MA 4J9MA 3PR5B 4IRDA 3PSTA 3PMNA 1NJWA 2W43A 3C66A 3NVYA 1ZQVA 2HBMA 5EWFA 3EZ5A 3ZI4A 1X6IA 2FMQA 1ZQDA 4EX7A 1SZPA 1ZQLA 3C5FA 4B9UA 2DR7A 4X4TA 4M6WB 5J2BA 1TFRA 4DEZA 4FHVA 3M1YA 2F8LA 2KNJA 1UEVA 2I5HA 4CCHA 2DF4B 3RJFA 2YMQA 4AT7B 1TK8A 1ZQWA 2ZJAA 1L3TA 5ALVA 5KFHA 4J9QA 3KHRA 2EH9A 4PGQA 2IUBA 1WUDA 2Y9TA 5EE9A 2RRDA 3F2CA 2I6XA 3C2MA 1T7PA 1OUQA 2FPLA 1F5AA 4K4IA 1N5XA 2LHTA 2JRZA 1M6YA 5CB1A 5J8YA 3BDPA 4PL2A 2H3QA 3IDWA 4FE3A 8ICBA 5J8YC 4C8MA 2BCQA 4ED2A 4I2BA 8ICJA 4Y2XA 3RR8A 1T8EA 1DK2A 1QSSA 4F2SA 5ALZA 5J0SA 1MC8A 5H2FU 1BPEA 1UA1A 4BX9C 5KFGA 3M9NB 1ZQIA 3AL0B 2JHDA 4UARA 2RHFA 2W3RA 4OJPA 1SKSA 2HOFA 1ZQEA 4Y2YA 4DSLA 1SV0A 4RWNA 4AT9B 2JR5A 1S0MA 7ICOA 5HHHA 1KFTA 3WKCA 1U45A 4F91B 1YLQA 3QNMA 4JB3A 3RTVA 2C22A 5HRLA 5ALPA 3QU9A 4Y2TA 4M9JA 3IHQB 3MR6A 3F5AA 2GAFD 3JCFA 3H3AA 4F93B 1VDVA 5BOMA 4F4XA 3RB3A 4P0QA 4RQMA 2G5IB 3RJGA 2KJ9A 2W03A 1XSLA 3ALRA 3PW4A 4ECSA 2MU2A 1S76D 1L7MA 1ZD3A 4YR0A 4AT7A 5ALFA 5JUMA 1C20A 4ECRA 3V7JA 2OH2A 4TUSA 8ICAA 2Q66A 4XUSA 1XS9D 3ZDAA 3AM9A 1X42A 2G07A 4F5NA 5HR9A 3MR3A 3CP8A 2ZH8A 5IIMA 4DSJA 1XNSA 3PZPA 2E5SA 4PZNA 3PVXA 1WG8A 1L7PA 4EENA 3G6YA 4FFDA 1TV9A 5AKZA 2VANA 2F2AB 3NVWA 2HOIA 2EAMA 2P6UA 2A1JA 2RFFA 1NJXA 2HI0A 4I2FA 3WK5A 4C4TA 5HC9A 2IMWP 3ER9B 3E0FA 2GWSA 2ZXIA 3AQNA 2PKEA 4B9VA 3H37A 4HX0A 4I2JA 3PW2A 3TAPA 3C21A 3C5GA 1JALA 2HMXA 8ICWA 1PX5A 4O9MA 1U9LA 4X0BA 2KFNA 3IV6A 1JXLA 1JMSA 2HHVA 2YMLA 2YQEA 1RQLA 4EX6A 4PJ0U 1D8LA 3BQ1A 5AK6A 2DPIA 4DFKA 1RYRA 4FO1A 5D49A 4ECQA 1JN3A 4TQRA 2EWRA 2ZUCA 3AQKA 1ZQYA 4KLSA 1ZQNA 4X4QA 3UXPA 3WK7A 4X4UA 1SZHA 1L7NA 3GV8B 3SQIA 9ICRA 1QQ7A 1ZQFA 1ZQGA 4KLGA 3PSIA 4OJOA 4P0PA 7ICIA 3OUYB 5KG5A 5KTQA 1K5OA 4RPYA 3RH5A 1Z4OA 3PV8A 2KZ3A 2NRKA 1TAMA 1L5UA 4DQSA 3T3FA 1SKWA 1J2MA 3JPOA 2ZTEA 4M04A 3V7LA 3L9DA 2HHPA 4UB3A 2BCRA 4LZDA 4DS4A 2QB1A 1DK3A 4DSKA 4I2DA 2PMZC 2XCPA 4JWNA 4EEDA 1F5SA 4M5DA 3NKUA 1ZD4A 1RXVA 2IHNA 4O3SA 8ICZA 1JXEA 5F9LA 2JZBA 5DB7A 4O3QA 3RH6A 5CFTA 5J2JA
chains in the Genus database with same CATH topology
3N4MB 3PO4A 5DDYA 1A77A 3BQ2A 4GC6A 3PW0A 1BVSA 2FLLA 4GC7A 2ZH9A 5DG7A 7ICVA 2ZH3A 4KLQA 1R8CA 4UBCA 1D9FA 4FBTA 3H8WA 5J2EA 2NRXA 5DQHA 2ASJA 4DL3A 1XSNA 4X4VA 5DGBA 4TUPA 2KZMA 1NO5A 3OVAA 1ZQJA 4KN7A 3QEAZ 3WFOA 5KFWA 1IM4A 1NJYA 4FH3A 2HHWA 4J9SA 3OVSA 4F3OA 2C2EA 1SL2A 4EBKA 2Q0ZX 9ICQA 1BNOA 5DBAA 3JPRA 3H40A 2W9AA 4AT8B 5J0YA 2UVRA 4XQ7A 1NK8A 2BCSA 9ICLA 3NYBA 4P4MA 3JPTA 5EOZA 1TK0A 2PFOA 4JV2A 4PHEA 4QW9A 8ICYA 1Z00A 1DOQA 2DFLA 4XQ8A 5KFPA 4ECXA 8ICRA 1BNPA 3MR5A 5J0WA 2UVWA 4X5VA 4I27A 4RWPA 1EXNA 4RNOA 1BGXT 2HVIA 1S97A 1UT8A 1L3VA 3RB6A 4ED7A 3RR7A 2W9BB 4QZBA 2W9BA 4J9NA 4FBUA 3NTUA 1X9WA 5KT3A 4KLHA 5HRFA 4EEYA 5DBBA 1MIYA 5J0XA 5DG8A 3WFQE 4IG8A 2ISPA 1BPYA 1Q79A 2AGQA 2IHMA 1Z00B 2W9CB 4IQTA 5KT5A 3Q8MA 4FO6A 5HRBA 3OJSA 1TVAA 2FLPA 3FDSA 4M9LA 3C18A 2IA6A 3MDCA 1NJZA 4AT8A 2FMPA 3C23A 4RQ8A 4PHAA 5KFJA 2J6TA 8ICEA 5KFVA 9ICMA 4R63A 3GIKA 4QZHA 2F1IA 3GV5B 5DBCA 9ICAA 5CP2A 2ZTCA 3Q8QB 4DS5A 9ICNA 2ZH2A 5HNKA 4YMOA 1VFGA 4YR3A 4RQ5A 1ZQQA 3V72A 2DRBA 5DEDA 2JEJA 4C8LA 4YMNA 4YVZA 2BDPA 2DVIA 5KFQA 5KFRA 3MDAA 2V9WA 7ICSA 2ID1A 3Q8LA 4NLNA 5KFXA 5L1KA 1IXRA 4DL6A 3OSPA 3ZDDA 5J2AA 2KTQA 7ICTA 5HRIA 4AT9A 4ATBA 5DDMA 4ECTA 4XA5A 1S0VA 2UVUA 1Y88A 1XC9A 3LQCB 4KN4A 4IQWA 2ZUBA 1BPDA 3KHGA 3QZ8A 3PW7A 3TANA 3ZD9A 4Z6EA 4ED0A 5J0RA 3UXNA 3ORYA 1N48A 2M9NA 2C28A 4IRCA 2O1PA 3Q8SB 1T3NA 2R8GA 4HYKA 3V6JA 3MGIA 4QZEA 1V4AA 3MBYA 5CJ7A 4B9NA 3MR2A 2XY7A 4M9HA 4WC0A 4DLGA 5KFUA 3M8RA 1D9DA 3PO5A 1AROP 5IIJA 5J0UA 4KLEA 4DOBA 3HIYA 3ZDBA 1LB2B 3HPOA 4IR9A 1H38A 3H38A 3PX4A 8ICNA 5HREA 4R8UA 4KITB 4R64A 2NRVA 4J9OA 1RXWA 2ZHBA 3UXOA 4RT2A 3Q8PB 4ECUA 1BPBA 4DL4A 2ATLA 1U47A 1S0NA 1S9FA 4JWMA 4I2CA 2ZH5A 1NK0A 4QWEA 1CEZA 4X4OA 9ICFA 4F92B 4O0IA 1NKBA 1NOMA 4GLXA 4UD5A 4RT3A 5KFZA 1ZQUA 5KG3A 5KFFA 1X2IA 3JPPA 3UQ0A 4EBDA 1TFWA 4ED8A 1KRPA 3RRGA 2PI4A 5DQIA 2MUTA 3B0YA 2XC9A 9ICXA 1NZPA 4S3NA 4F50A 2Y1JA 4Z6FA 3GV7B 3HJ4A 1V9PA 3JZ0A 1NKEA 4IQVA 1ZQMA 4O5CA 4R65A 4X4SA 2ZH1A 4YXJA 3GQCA 1R8BA 3TAQA 4X4PA 2ZHAA 4NXZA 3QZ7A 3MFHA 4B9TA 2ZUDA 3ETLA 3OJUA 3H39A 1UEUA 4KLJA 8ICUA 4WC1A 4QZGA 2NRZA 1SL1A 3PNCA 3AU2A 3OHAA 4YP3A 5KFIA 4GXIA 3PW5A 1JX4A 1QSLA 2ZH7A 5DB8A 4UB5A 1QSYA 1PZNA 2V4RA 4M9NA 1DGSA 4JUZA 4MFCA 5KFYA 7ICEA 3EYZA 5J2DA 3ZDCA 1D8YA 3TQ1A 1HUZA 5KG4A 8ICPA 5EWEA 3E2EA 4RQ3A 3THVA 4QW8A 9ICIA 4PH5A 5HHIA 3RRHA 4ECWA 5KT4A 2KP7A 4M6WA 4RU9A 3SYZA 4KLLA 3FYHA 4RQ1A 1UT5A 3H4BA 5HMLA 2XGPA 3GILA 4EYHB 3RBEA 3JPNA 3SZ2A 2AJQA 4O3PA 3JPQA 3LWLA 8ICXA 2ZH4A 5IIOA 5DLFA 2PXIA 2BPFA 4Z6CA 2HW3A 3BJYA 2AQ4A 3OHBA 7ICQA 1ZQHA 2XGQA 4KLMA 4YN4A 4YR2A 2C2RA 4JV1A 4KLIA 5KT2A 9ICUA 5J0OA 2ZJ5A 3V6KA 4WC2A 3HW8A 3M9MB 4DO9A 1R89A 2F1JA 4UQGA 5CR0A 3MFIA 4R8UB 5HP4A 4Z6DA 4F5OA 1MQ3A 2R8KA 3K4GA 2KZZA 4UAZA 3BQ0A 4DSFA 5F2VO 2XY5A 1NK7A 1QLNA 1ZJMA 4EBEA 4NY8A 4UBBA 4J9MA 9ICGA 4EP7A 3PR5B 4J9RA 4DQIA 1XU4A 4QWCA 4IRDA 3OUYA 4KLDA 3PMNA 4F4WA 1NJWA 7ICKA 5IIIA 3C66A 4FHYA 9ICHA 2J6SA 4RWQA 4QZCA 3TFSA 1ZQVA 4LT6A 1KNYA 4QZIA 3RJIA 3RB4A 3B0XA 3M8SA 3ISDA 5J29A 5EWFA 5BOLA 3EZ5A 5DLGA 4DL7A 3PX0A 2FMQA 1ZQDA 1Q78A 1UETA 1SZPA 5KFNA 1ZQLA 1JQRA 2NRTA 2H5XA 3C5FA 3RJJA 2PI5A 3C2LA 4B9UA 4BWJA 2A1JB 2DR7A 4Q8EA 1MSWD 4X4TA 4M6WB 5J2BA 2HHUA 1T4GA 3AQMA 1TFRA 1R8AA 1S77D 3HT3A 3UQ2A 4QZFA 4DEZA 4FHVA 3EPIA 1TKDA 1UEVA 5KFTA 2BE3A 4UD4A 2ASLA 4CCHA 2PFQA 5HRGA 1UA0A 4NM2A 4YD1A 3HP6A 2R8JA 3RJFA 4C8NA 4I2HA 7ICJA 5HRKA 3H7IA 4DQQA 1ZQWA 1TK8A 4AT7B 4ECYA 5KG2A 4KLTA 2W8KA 2HHXA 1ZQCA 2ZJAA 4YQWA 1S10A 3SV3A 5KFHA 1L3TA 3T5LA 2M2UA 4J9QA 3GIJA 2PFNA 1ZJNA 3KHRA 4C8KA 4PGQA 2BCUA 3ZDEA 2W9CA 1MQ2A 4E8FA 4F5PA 4X4RA 3OV7A 4BGDA 2I1QA 5J2GA 3GIIA 4ED6A 3C2MA 1T7PA 2J6UA 7ICGA 4IRKA 2FPLA 1F5AA 1WCNA 4K4IA 4GXJA 5IILA 1FA0A 2FMSA 5CB1A 4RUAA 5HMMA 1OU5A 3LK9A 1K1SA 3WFRE 2W8LA 2PFPA 4FH5A 3BDPA 5IINA 1A76A 1NK5A 3WFPA 4ATBB 8ICVA 2JEFA 4UAWA 8ICBA 4PGXA 1U4BA 4C8MA 4E80A 4I2IA 2BCQA 3GFKB 4DOCA 4ED2A 4I2BA 8ICJA 2BPGA 4KTQA 3RR8A 4I28A 4MEYA 2XY6A 4WBZA 3UPQA 1ZQAA 9ICSA 4P4PA 1T8EA 1DK2A 4DLEA 1QSSA 4F2SA 4DWIA 1MIVA 2DR9A 1HJPA 1CUKA 5J0SA 1MC8A 5BPCA 4ED3A 3AUOA 3BQTA 5KFAA 4M9GA 1BPEA 4NLKA 9ICCA 7ICLA 5KFOA 3PMLA 4DQRA 2BQRA 3Q8RB 1UA1A 1LV5A 1TAUA 5J2FA 5KFGA 3M9NB 3KHHA 4GXKA 1L3UA 4F2RA 7ICFA 4J9LA 4NLGA 5J2IA 2M2VA 4DF4A 1ZQIA 2M2WA 4QWBA 9ICTA 1JIHA 1SKSA 1MIWA 4QZDA 5CHGA 1ZQOA 5L9XA 1ZQEA 2HVHA 2HHQA 2JZBB 4DSLA 4K4GA 3H4DA 2JEGA 5L1JA 4RWNA 4AT9B 1S0MA 7ICOA 3C1YA 2M2TA 5HHHA 4UB4A 4DF8A 1TK5A 4O3OA 1NK9A 1KFSA 4C8OA 1KFTA 1TAQA 1U48A 3RJHA 1U45A 4F91B 2ASDA 4NLZA 3ZD8A 4YXMA 1NK4A 1YLQA 3RTVA 5KFKA 5L1IA 4M2YA 2C22A 3OGUA 4J9KA 3AU6A 4FHWA 4DL2A 2UVVA 2DRAA 1ZETA 2FPKA 2BKEA 4F4YA 4IQUA 3GIMA 4DQPA 5L1LA 4O5KA 5HRLA 4R66A 4YD2A 5TZVA 4DSEA 7ICRA 3ISCA 1SL0A 3T5JA 2P66A 3K75D 2DPJA 8ICTA 4WCWA 4WBYA 4M9JA 2HHSA 3IHQB 2I9GA 1WOTA 4NKTA 4MFFA 3MR6A 4M0AA 2B21A 3EW9A 3EPGA 2AGPA 3H3AA 8ICMA 4F93B 5J0PA 4NM1A 2JEIA 4DOAA 4QZAA 5BOMA 4RQ6A 3NGDA 4F4XA 3RB3A 1BPZA 2V4QA 4ELTA 8ICKA 4FHXA 4Q45A 1KLNA 3G6VA 2R8HA 2IBKA 4PHPA 1KTQA 1RPLA 5DG9A 5D4BA 4PHDA 5KG7A 4BDPA 2W9MA 3RJGA 9ICBA 4BWMA 1S0OA 1COOA 1XWLA 3RB0A 1XSLA 4KMUA 5KFCA 3PW4A 2O5AA 2ZH6A 4RNNA 2C2DA 1KFDA 3RJEA 9ICWA 4MFAA 4J9PA 4I29A 4ECSA 2HHTA 5DGAA 1WCLA 1S76D 2BPCA 4YR0A 1X9MA 1ZQBA 9ICKA 4DL5A 1ZQTA 9ICVA 5D46A 1SKRA 2VA3A 5JUMA 4AT7A 1K1QA 5DKWA 5KG6A 3OVBA 5J2CA 3V7JA 4ECRA 4XRHA 2P6RA 1ZQXA 2XCAA 4TUSA 4X4NA 2AU0A 5KFDA 1KDHA 4F5RA 4FS2A 7ICNA 5HRDA 8ICOA 4Q43A 8ICAA 2Q66A 4XUSA 5KT7A 1XS9D 4EZ9A 7ICHA 3ZDAA 3HWTA 3OSNA 1ZQKA 3GDXA 3RJKA 2VA2A 2BCVA 5EWGA 4F5NA 4F4ZA 3JPSA 5HR9A 3MR3A 2DR8A 1XO1A 4JK1A 3KTQA 1ZQSA 2ZH8A 5IIMA 4DSJA 4LVSA 3TARA 1KSPA 8ICCA 4DFJA 2BGWA 1N56A 3TI0A 9ICOA 3PVXA 4RUCA 4F5QA 4RQ2A 1RYSA 3G6YA 4B9LA 3HJ1A 1TV9A 4TURA 2VANA 2AGOA 4DFMA 5HRHA 2XO7A 5J2HA 1U49A 3C2KA 2WTFA 4ED1A 4RQ7A 3TFRA 2P6UA 1VJ7A 2A1JA 2RFFA 4WC4A 2R8IA 5KFMA 1NJXA 4JV0A 4FHPA 8ICFA 1KEJA 4I2FA 2ISOA 4E7XA 3MGHA 3SI8A 1BPXA 4LZGA 2IMWP 5HC9A 4RQ0A 4KLOA 4KLUA 2KFZA 2GWSA 3AQNA 3PY8A 4YMMA 4B9VA 3RAQA 4DSIA 3H37A 4I2JA 4O3NA 3PW2A 3TAPA 3WFSC 4RWOA 1NK6A 4ELUA 1ZQPA 3C21A 1L3SA 3C5GA 8ICWA 1PX5A 4O9MA 1U9LA 4X0BA 3T5HA 2KFNA 9ICPA 1JXLA 4BXOA 1JMSA 3IM1A 4EZ6A 4ZH4A 2HHVA 5J0QA 2BQ3A 7ICPA 1XSPA 8ICGA 2ZTDA 2OWOA 4WC7A 3EWAA 9ICJA 5DQGA 1D8LA 8ICHA 3BQ1A 4F4KA 1JAJA 4UB1A 2PBEA 4EBJA 4ECZA 2DPIA 4DFKA 5KT6A 1RYRA 4EYIB 9ICEA 3ISBA 4I2AA 5D49A 8ICIA 5C5JA 5CA7A 4ECQA 1JN3A 4QZ8A 3N97B 5DB9A 4ELVA 4O3RA 8ICQA 4TQRA 5KG1A 4MF8A 2VA8A 3Q8KA 4B9MA 8ICSA 2DR5A 3T5KA 2BHNA 2F1HA 2ZUCA 4YG2A 1ZQYA 1RZTA 7ICUA 3AQKA 4KLSA 1ZQNA 2Y1IA 2MUTB 4QWDA 1B22A 3H8SA 4B9SA 4X4QA 2FPMA 2BR0A 3UXPA 4PGYA 5KFEA 3RBDA 4X4UA 4UAYA 4MEXA 4RZRA 5KFBA 5IIKA 4ECVA 4X0AA 3GV8B 4RPXA 4IR1A 4P2HA 3G6XA 1ZQZA 9ICRA 2ZJ8A 1ZQFA 7ICMA 4RQ4A 1ZQGA 1QTMA 1NKCA 4KLGA 3MABA 2LYHA 4K4HA 4WC6A 4FS1A 2BQUA 1ZQRA 7ICIA 5DECA 3OUYB 3PR4A 4E0DA 3V7KA 4Q8FA 4PPXA 5KG5A 2KN7A 2NRWA 3AQLA 2AQ0A 2MAXA 5KTQA 3V6HA 3C1ZA 4RPYA 4WC3A 3RH5A 4NKUA 4F8RA 2RDJA 3PV8A 2KZ3A 2NRKA 4UB2A 4YFKA 2ALZA 1Z3EB 5F9NA 1L5UA 4DQSA 1ZYQA 4WC5A 3UPSA 4KLFA 4MF2A 3T3FA 4M47A 3LWMA 5DB6A 1SKWA 3KHLA 3LDAA 3JYYA 3JPOA 2ZTEA 4M04A 3V7LA 3L9DA 2HHPA 1TFYA 4UB3A 5KFSA 5CWRA 2BCRA 3H8JA 4LZDA 4DS4A 3PX6A 1DK3A 4O5EA 4DSKA 8ICLA 4I2EA 3M9OB 1B43A 4I2DA 4TQSA 3QEBZ 4YCXA 5J2KA 4P4OA 4TUQA 2RDIA 2XCPA 4JWNA 4G3IA 4RPZA 3RAXA 3QE9Y 4M5DA 1X9SA 4RNMA 5KG0A 4DFPA 3SV4A 1RXVA 1HUOA 4QZ9A 1C7YA 2IHNA 1JXEA 4O3SA 5KFLA 5F9LA 2FLNA 8ICZA 4QWAA 4EBCA 3RH4A 2JZBA 5DB7A 4O3QA 4BXOB 4Q44A 4I2GA 5J0TA 3RH6A 5J2JA 3HX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4M B;  3PO4 A;  5DDY A;  1A77 A;  3BQ2 A;  4GC6 A;  3PW0 A;  1BVS A;  2FLL A;  4GC7 A;  2ZH9 A;  5DG7 A;  7ICV A;  2ZH3 A;  4KLQ A;  1R8C A;  4UBC A;  1D9F A;  4FBT A;  3H8W A;  5J2E A;  2NRX A;  5DQH A;  2ASJ A;  4DL3 A;  1XSN A;  4X4V A;  5DGB A;  4TUP A;  2KZM A;  1NO5 A;  3OVA A;  1ZQJ A;  4KN7 A;  3QEA Z;  3WFO A;  5KFW A;  1IM4 A;  1NJY A;  4FH3 A;  2HHW A;  4J9S A;  3OVS A;  4F3O A;  2C2E A;  1SL2 A;  4EBK A;  2Q0Z X;  9ICQ A;  1BNO A;  5DBA A;  3JPR A;  3H40 A;  2W9A A;  4AT8 B;  5J0Y A;  2UVR A;  4XQ7 A;  1NK8 A;  2BCS A;  9ICL A;  3NYB A;  4P4M A;  3JPT A;  5EOZ A;  1TK0 A;  2PFO A;  4JV2 A;  4PHE A;  4QW9 A;  8ICY A;  1Z00 A;  1DOQ A;  2DFL A;  4XQ8 A;  5KFP A;  4ECX A;  8ICR A;  1BNP A;  3MR5 A;  5J0W A;  2UVW A;  4X5V A;  4I27 A;  4RWP A;  1EXN A;  4RNO A;  1BGX T;  2HVI A;  1S97 A;  1UT8 A;  1L3V A;  3RB6 A;  4ED7 A;  3RR7 A;  2W9B B;  4QZB A;  2W9B A;  4J9N A;  4FBU A;  3NTU A;  1X9W A;  5KT3 A;  4KLH A;  5HRF A;  4EEY A;  5DBB A;  1MIY A;  5J0X A;  5DG8 A;  3WFQ E;  4IG8 A;  2ISP A;  1BPY A;  1Q79 A;  2AGQ A;  2IHM A;  1Z00 B;  2W9C B;  4IQT A;  5KT5 A;  3Q8M A;  4FO6 A;  5HRB A;  3OJS A;  1TVA A;  2FLP A;  3FDS A;  4M9L A;  3C18 A;  2IA6 A;  3MDC A;  1NJZ A;  4AT8 A;  2FMP A;  3C23 A;  4RQ8 A;  4PHA A;  5KFJ A;  2J6T A;  8ICE A;  5KFV A;  9ICM A;  4R63 A;  3GIK A;  4QZH A;  2F1I A;  3GV5 B;  5DBC A;  9ICA A;  5CP2 A;  2ZTC A;  3Q8Q B;  4DS5 A;  9ICN A;  2ZH2 A;  5HNK A;  4YMO A;  1VFG A;  4YR3 A;  4RQ5 A;  1ZQQ A;  3V72 A;  2DRB A;  5DED A;  2JEJ A;  4C8L A;  4YMN A;  4YVZ A;  2BDP A;  2DVI A;  5KFQ A;  5KFR A;  3MDA A;  2V9W A;  7ICS A;  2ID1 A;  3Q8L A;  4NLN A;  5KFX A;  5L1K A;  1IXR A;  4DL6 A;  3OSP A;  3ZDD A;  5J2A A;  2KTQ A;  7ICT A;  5HRI A;  4AT9 A;  4ATB A;  5DDM A;  4ECT A;  4XA5 A;  1S0V A;  2UVU A;  1Y88 A;  1XC9 A;  3LQC B;  4KN4 A;  4IQW A;  2ZUB A;  1BPD A;  3KHG A;  3QZ8 A;  3PW7 A;  3TAN A;  3ZD9 A;  4Z6E A;  4ED0 A;  5J0R A;  3UXN A;  3ORY A;  1N48 A;  2M9N A;  2C28 A;  4IRC A;  2O1P A;  3Q8S B;  1T3N A;  2R8G A;  4HYK A;  3V6J A;  3MGI A;  4QZE A;  1V4A A;  3MBY A;  5CJ7 A;  4B9N A;  3MR2 A;  2XY7 A;  4M9H A;  4WC0 A;  4DLG A;  5KFU A;  3M8R A;  1D9D A;  3PO5 A;  1ARO P;  5IIJ A;  5J0U A;  4KLE A;  4DOB A;  3HIY A;  3ZDB A;  1LB2 B;  3HPO A;  4IR9 A;  1H38 A;  3H38 A;  3PX4 A;  8ICN A;  5HRE A;  4R8U A;  4KIT B;  4R64 A;  2NRV A;  4J9O A;  1RXW A;  2ZHB A;  3UXO A;  4RT2 A;  3Q8P B;  4ECU A;  1BPB A;  4DL4 A;  2ATL A;  1U47 A;  1S0N A;  1S9F A;  4JWM A;  4I2C A;  2ZH5 A;  1NK0 A;  4QWE A;  1CEZ A;  4X4O A;  9ICF A;  4F92 B;  4O0I A;  1NKB A;  1NOM A;  4GLX A;  4UD5 A;  4RT3 A;  5KFZ A;  1ZQU A;  5KG3 A;  5KFF A;  1X2I A;  3JPP A;  3UQ0 A;  4EBD A;  1TFW A;  4ED8 A;  1KRP A;  3RRG A;  2PI4 A;  5DQI A;  2MUT A;  3B0Y A;  2XC9 A;  9ICX A;  1NZP A;  4S3N A;  4F50 A;  2Y1J A;  4Z6F A;  3GV7 B;  3HJ4 A;  1V9P A;  3JZ0 A;  1NKE A;  4IQV A;  1ZQM A;  4O5C A;  4R65 A;  4X4S A;  2ZH1 A;  4YXJ A;  3GQC A;  1R8B A;  3TAQ A;  4X4P A;  2ZHA A;  4NXZ A;  3QZ7 A;  3MFH A;  4B9T A;  2ZUD A;  3ETL A;  3OJU A;  3H39 A;  1UEU A;  4KLJ A;  8ICU A;  4WC1 A;  4QZG A;  2NRZ A;  1SL1 A;  3PNC A;  3AU2 A;  3OHA A;  4YP3 A;  5KFI A;  4GXI A;  3PW5 A;  1JX4 A;  1QSL A;  2ZH7 A;  5DB8 A;  4UB5 A;  1QSY A;  1PZN A;  2V4R A;  4M9N A;  1DGS A;  4JUZ A;  4MFC A;  5KFY A;  7ICE A;  3EYZ A;  5J2D A;  3ZDC A;  1D8Y A;  3TQ1 A;  1HUZ A;  5KG4 A;  8ICP A;  5EWE A;  3E2E A;  4RQ3 A;  3THV A;  4QW8 A;  9ICI A;  4PH5 A;  5HHI A;  3RRH A;  4ECW A;  5KT4 A;  2KP7 A;  4M6W A;  4RU9 A;  3SYZ A;  4KLL A;  3FYH A;  4RQ1 A;  1UT5 A;  3H4B A;  5HML A;  2XGP A;  3GIL A;  4EYH B;  3RBE A;  3JPN A;  3SZ2 A;  2AJQ A;  4O3P A;  3JPQ A;  3LWL A;  8ICX A;  2ZH4 A;  5IIO A;  5DLF A;  2PXI A;  2BPF A;  4Z6C A;  2HW3 A;  3BJY A;  2AQ4 A;  3OHB A;  7ICQ A;  1ZQH A;  2XGQ A;  4KLM A;  4YN4 A;  4YR2 A;  2C2R A;  4JV1 A;  4KLI A;  5KT2 A;  9ICU A;  5J0O A;  2ZJ5 A;  3V6K A;  4WC2 A;  3HW8 A;  3M9M B;  4DO9 A;  1R89 A;  2F1J A;  4UQG A;  5CR0 A;  3MFI A;  4R8U B;  5HP4 A;  4Z6D A;  4F5O A;  1MQ3 A;  2R8K A;  3K4G A;  2KZZ A;  4UAZ A;  3BQ0 A;  4DSF A;  5F2V O;  2XY5 A;  1NK7 A;  1QLN A;  1ZJM A;  4EBE A;  4NY8 A;  4UBB A;  4J9M A;  9ICG A;  4EP7 A;  3PR5 B;  4J9R A;  4DQI A;  1XU4 A;  4QWC A;  4IRD A;  3OUY A;  4KLD A;  3PMN A;  4F4W A;  1NJW A;  7ICK A;  5III A;  3C66 A;  4FHY A;  9ICH A;  2J6S A;  4RWQ A;  4QZC A;  3TFS A;  1ZQV A;  4LT6 A;  1KNY A;  4QZI A;  3RJI A;  3RB4 A;  3B0X A;  3M8S A;  3ISD A;  5J29 A;  5EWF A;  5BOL A;  3EZ5 A;  5DLG A;  4DL7 A;  3PX0 A;  2FMQ A;  1ZQD A;  1Q78 A;  1UET A;  1SZP A;  5KFN A;  1ZQL A;  1JQR A;  2NRT A;  2H5X A;  3C5F A;  3RJJ A;  2PI5 A;  3C2L A;  4B9U A;  4BWJ A;  2A1J B;  2DR7 A;  4Q8E A;  1MSW D;  4X4T A;  4M6W B;  5J2B A;  2HHU A;  1T4G A;  3AQM A;  1TFR A;  1R8A A;  1S77 D;  3HT3 A;  3UQ2 A;  4QZF A;  4DEZ A;  4FHV A;  3EPI A;  1TKD A;  1UEV A;  5KFT A;  2BE3 A;  4UD4 A;  2ASL A;  4CCH A;  2PFQ A;  5HRG A;  1UA0 A;  4NM2 A;  4YD1 A;  3HP6 A;  2R8J A;  3RJF A;  4C8N A;  4I2H A;  7ICJ A;  5HRK A;  3H7I A;  4DQQ A;  1ZQW A;  1TK8 A;  4AT7 B;  4ECY A;  5KG2 A;  4KLT A;  2W8K A;  2HHX A;  1ZQC A;  2ZJA A;  4YQW A;  1S10 A;  3SV3 A;  5KFH A;  1L3T A;  3T5L A;  2M2U A;  4J9Q A;  3GIJ A;  2PFN A;  1ZJN A;  3KHR A;  4C8K A;  4PGQ A;  2BCU A;  3ZDE A;  2W9C A;  1MQ2 A;  4E8F A;  4F5P A;  4X4R A;  3OV7 A;  4BGD A;  2I1Q A;  5J2G A;  3GII A;  4ED6 A;  3C2M A;  1T7P A;  2J6U A;  7ICG A;  4IRK A;  2FPL A;  1F5A A;  1WCN A;  4K4I A;  4GXJ A;  5IIL A;  1FA0 A;  2FMS A;  5CB1 A;  4RUA A;  5HMM A;  1OU5 A;  3LK9 A;  1K1S A;  3WFR E;  2W8L A;  2PFP A;  4FH5 A;  3BDP A;  5IIN A;  1A76 A;  1NK5 A;  3WFP A;  4ATB B;  8ICV A;  2JEF A;  4UAW A;  8ICB A;  4PGX A;  1U4B A;  4C8M A;  4E80 A;  4I2I A;  2BCQ A;  3GFK B;  4DOC A;  4ED2 A;  4I2B A;  8ICJ A;  2BPG A;  4KTQ A;  3RR8 A;  4I28 A;  4MEY A;  2XY6 A;  4WBZ A;  3UPQ A;  1ZQA A;  9ICS A;  4P4P A;  1T8E A;  1DK2 A;  4DLE A;  1QSS A;  4F2S A;  4DWI A;  1MIV A;  2DR9 A;  1HJP A;  1CUK A;  5J0S A;  1MC8 A;  5BPC A;  4ED3 A;  3AUO A;  3BQT A;  5KFA A;  4M9G A;  1BPE A;  4NLK A;  9ICC A;  7ICL A;  5KFO A;  3PML A;  4DQR A;  2BQR A;  3Q8R B;  1UA1 A;  1LV5 A;  1TAU A;  5J2F A;  5KFG A;  3M9N B;  3KHH A;  4GXK A;  1L3U A;  4F2R A;  7ICF A;  4J9L A;  4NLG A;  5J2I A;  2M2V A;  4DF4 A;  1ZQI A;  2M2W A;  4QWB A;  9ICT A;  1JIH A;  1SKS A;  1MIW A;  4QZD A;  5CHG A;  1ZQO A;  5L9X A;  1ZQE A;  2HVH A;  2HHQ A;  2JZB B;  4DSL A;  4K4G A;  3H4D A;  2JEG A;  5L1J A;  4RWN A;  4AT9 B;  1S0M A;  7ICO A;  3C1Y A;  2M2T A;  5HHH A;  4UB4 A;  4DF8 A;  1TK5 A;  4O3O A;  1NK9 A;  1KFS A;  4C8O A;  1KFT A;  1TAQ A;  1U48 A;  3RJH A;  1U45 A;  4F91 B;  2ASD A;  4NLZ A;  3ZD8 A;  4YXM A;  1NK4 A;  1YLQ A;  3RTV A;  5KFK A;  5L1I A;  4M2Y A;  2C22 A;  3OGU A;  4J9K A;  3AU6 A;  4FHW A;  4DL2 A;  2UVV A;  2DRA A;  1ZET A;  2FPK A;  2BKE A;  4F4Y A;  4IQU A;  3GIM A;  4DQP A;  5L1L A;  4O5K A;  5HRL A;  4R66 A;  4YD2 A;  5TZV A;  4DSE A;  7ICR A;  3ISC A;  1SL0 A;  3T5J A;  2P66 A;  3K75 D;  2DPJ A;  8ICT A;  4WCW A;  4WBY A;  4M9J A;  2HHS A;  3IHQ B;  2I9G A;  1WOT A;  4NKT A;  4MFF A;  3MR6 A;  4M0A A;  2B21 A;  3EW9 A;  3EPG A;  2AGP A;  3H3A A;  8ICM A;  4F93 B;  5J0P A;  4NM1 A;  2JEI A;  4DOA A;  4QZA A;  5BOM A;  4RQ6 A;  3NGD A;  4F4X A;  3RB3 A;  1BPZ A;  2V4Q A;  4ELT A;  8ICK A;  4FHX A;  4Q45 A;  1KLN A;  3G6V A;  2R8H A;  2IBK A;  4PHP A;  1KTQ A;  1RPL A;  5DG9 A;  5D4B A;  4PHD A;  5KG7 A;  4BDP A;  2W9M A;  3RJG A;  9ICB A;  4BWM A;  1S0O A;  1COO A;  1XWL A;  3RB0 A;  1XSL A;  4KMU A;  5KFC A;  3PW4 A;  2O5A A;  2ZH6 A;  4RNN A;  2C2D A;  1KFD A;  3RJE A;  9ICW A;  4MFA A;  4J9P A;  4I29 A;  4ECS A;  2HHT A;  5DGA A;  1WCL A;  1S76 D;  2BPC A;  4YR0 A;  1X9M A;  1ZQB A;  9ICK A;  4DL5 A;  1ZQT A;  9ICV A;  5D46 A;  1SKR A;  2VA3 A;  5JUM A;  4AT7 A;  1K1Q A;  5DKW A;  5KG6 A;  3OVB A;  5J2C A;  3V7J A;  4ECR A;  4XRH A;  2P6R A;  1ZQX A;  2XCA A;  4TUS A;  4X4N A;  2AU0 A;  5KFD A;  1KDH A;  4F5R A;  4FS2 A;  7ICN A;  5HRD A;  8ICO A;  4Q43 A;  8ICA A;  2Q66 A;  4XUS A;  5KT7 A;  1XS9 D;  4EZ9 A;  7ICH A;  3ZDA A;  3HWT A;  3OSN A;  1ZQK A;  3GDX A;  3RJK A;  2VA2 A;  2BCV A;  5EWG A;  4F5N A;  4F4Z A;  3JPS A;  5HR9 A;  3MR3 A;  2DR8 A;  1XO1 A;  4JK1 A;  3KTQ A;  1ZQS A;  2ZH8 A;  5IIM A;  4DSJ A;  4LVS A;  3TAR A;  1KSP A;  8ICC A;  4DFJ A;  2BGW A;  1N56 A;  3TI0 A;  9ICO A;  3PVX A;  4RUC A;  4F5Q A;  4RQ2 A;  1RYS A;  3G6Y A;  4B9L A;  3HJ1 A;  1TV9 A;  4TUR A;  2VAN A;  2AGO A;  4DFM A;  5HRH A;  2XO7 A;  5J2H A;  1U49 A;  3C2K A;  2WTF A;  4ED1 A;  4RQ7 A;  3TFR A;  2P6U A;  1VJ7 A;  2A1J A;  2RFF A;  4WC4 A;  2R8I A;  5KFM A;  1NJX A;  4JV0 A;  4FHP A;  8ICF A;  1KEJ A;  4I2F A;  2ISO A;  4E7X A;  3MGH A;  3SI8 A;  1BPX A;  4LZG A;  2IMW P;  5HC9 A;  4RQ0 A;  4KLO A;  4KLU A;  2KFZ A;  2GWS A;  3AQN A;  3PY8 A;  4YMM A;  4B9V A;  3RAQ A;  4DSI A;  3H37 A;  4I2J A;  4O3N A;  3PW2 A;  3TAP A;  3WFS C;  4RWO A;  1NK6 A;  4ELU A;  1ZQP A;  3C21 A;  1L3S A;  3C5G A;  8ICW A;  1PX5 A;  4O9M A;  1U9L A;  4X0B A;  3T5H A;  2KFN A;  9ICP A;  1JXL A;  4BXO A;  1JMS A;  3IM1 A;  4EZ6 A;  4ZH4 A;  2HHV A;  5J0Q A;  2BQ3 A;  7ICP A;  1XSP A;  8ICG A;  2ZTD A;  2OWO A;  4WC7 A;  3EWA A;  9ICJ A;  5DQG A;  1D8L A;  8ICH A;  3BQ1 A;  4F4K A;  1JAJ A;  4UB1 A;  2PBE A;  4EBJ A;  4ECZ A;  2DPI A;  4DFK A;  5KT6 A;  1RYR A;  4EYI B;  9ICE A;  3ISB A;  4I2A A;  5D49 A;  8ICI A;  5C5J A;  5CA7 A;  4ECQ A;  1JN3 A;  4QZ8 A;  3N97 B;  5DB9 A;  4ELV A;  4O3R A;  8ICQ A;  4TQR A;  5KG1 A;  4MF8 A;  2VA8 A;  3Q8K A;  4B9M A;  8ICS A;  2DR5 A;  3T5K A;  2BHN A;  2F1H A;  2ZUC A;  4YG2 A;  1ZQY A;  1RZT A;  7ICU A;  3AQK A;  4KLS A;  1ZQN A;  2Y1I A;  2MUT B;  4QWD A;  1B22 A;  3H8S A;  4B9S A;  4X4Q A;  2FPM A;  2BR0 A;  3UXP A;  4PGY A;  5KFE A;  3RBD A;  4X4U A;  4UAY A;  4MEX A;  4RZR A;  5KFB A;  5IIK A;  4ECV A;  4X0A A;  3GV8 B;  4RPX A;  4IR1 A;  4P2H A;  3G6X A;  1ZQZ A;  9ICR A;  2ZJ8 A;  1ZQF A;  7ICM A;  4RQ4 A;  1ZQG A;  1QTM A;  1NKC A;  4KLG A;  3MAB A;  2LYH A;  4K4H A;  4WC6 A;  4FS1 A;  2BQU A;  1ZQR A;  7ICI A;  5DEC A;  3OUY B;  3PR4 A;  4E0D A;  3V7K A;  4Q8F A;  4PPX A;  5KG5 A;  2KN7 A;  2NRW A;  3AQL A;  2AQ0 A;  2MAX A;  5KTQ A;  3V6H A;  3C1Z A;  4RPY A;  4WC3 A;  3RH5 A;  4NKU A;  4F8R A;  2RDJ A;  3PV8 A;  2KZ3 A;  2NRK A;  4UB2 A;  4YFK A;  2ALZ A;  1Z3E B;  5F9N A;  1L5U A;  4DQS A;  1ZYQ A;  4WC5 A;  3UPS A;  4KLF A;  4MF2 A;  3T3F A;  4M47 A;  3LWM A;  5DB6 A;  1SKW A;  3KHL A;  3LDA A;  3JYY A;  3JPO A;  2ZTE A;  4M04 A;  3V7L A;  3L9D A;  2HHP A;  1TFY A;  4UB3 A;  5KFS A;  5CWR A;  2BCR A;  3H8J A;  4LZD A;  4DS4 A;  3PX6 A;  1DK3 A;  4O5E A;  4DSK A;  8ICL A;  4I2E A;  3M9O B;  1B43 A;  4I2D A;  4TQS A;  3QEB Z;  4YCX A;  5J2K A;  4P4O A;  4TUQ A;  2RDI A;  2XCP A;  4JWN A;  4G3I A;  4RPZ A;  3RAX A;  3QE9 Y;  4M5D A;  1X9S A;  4RNM A;  5KG0 A;  4DFP A;  3SV4 A;  1RXV A;  1HUO A;  4QZ9 A;  1C7Y A;  2IHN A;  1JXE A;  4O3S A;  5KFL A;  5F9L A;  2FLN A;  8ICZ A;  4QWA A;  4EBC A;  3RH4 A;  2JZB A;  5DB7 A;  4O3Q A;  4BXO B;  4Q44 A;  4I2G A;  5J0T A;  3RH6 A;  5J2J A;  3HX0 A; 
#chains in the Genus database with same CATH topology
 2LI6 A;  5ALW A;  3PO4 A;  8ICU A;  1A77 A;  5AI6 A;  2Z7J A;  5DQH A;  4DL3 A;  3EUB 2;  4KN7 A;  5KFW A;  4Y2P A;  3SEI A;  2ZIU A;  4FH3 A;  2C2E A;  3H40 A;  4AT8 B;  2UVR A;  5AKK A;  1N2X A;  1DOQ A;  2DFL A;  4XQ8 A;  2W54 A;  3QU5 A;  4RWP A;  1EXN A;  1O08 A;  4DFD A;  4ED7 A;  3QU2 A;  4FBU A;  1X9W A;  2ZIW A;  3UMC A;  2ISP A;  3H0R B;  2F3N A;  1D8B A;  3KKA A;  5KT5 A;  2JGA A;  5HRB A;  2FDR A;  3FDS A;  5CHE A;  4OJL A;  2FMP A;  4PHA A;  8ICE A;  4R63 A;  3GIK A;  2F1I A;  5CP2 A;  2ZH2 A;  4YR3 A;  5K4L A;  3V72 A;  1RM6 C;  4YVZ A;  1MN8 A;  2V9W A;  2ID1 A;  2KIC A;  5KFX A;  1JI7 A;  7ICT A;  4KN4 A;  1N5W A;  4ED0 A;  2KHV A;  2IHO A;  4IRC A;  1JUD A;  3Q8S B;  2HBK A;  1T3N A;  4QZE A;  3NUQ A;  2XY7 A;  4DLG A;  5KFU A;  2YX8 A;  1D9D A;  5J0U A;  3HPO A;  4C7Z A;  1PVQ A;  3I1Y A;  3H38 A;  5D61 A;  2GOL A;  4R64 A;  4NJ8 A;  4J9O A;  4NLC A;  2JH7 A;  3Q8P B;  2ZH5 A;  4X4O A;  2JXJ A;  1HEK A;  3NAS A;  3UQ0 A;  1TFW A;  4ED8 A;  9ICX A;  2XC9 A;  2Y1J A;  2EZY A;  4Z6F A;  2YMP A;  1ECW A;  3JZ0 A;  4Y2S A;  1ZQM A;  2ZH1 A;  4YXJ A;  1R8B A;  5B3P A;  1FEZ A;  2XID A;  4NXZ A;  2O6K A;  2D8C A;  4B9T A;  2ZUD A;  1WWV A;  4LEW A;  4QZG A;  2NRZ A;  3SMV A;  1KN5 A;  2HOQ A;  3PNC A;  2ZH7 A;  3PW5 A;  4YP3 A;  1JX4 A;  5DB8 A;  4UB5 A;  3HJE A;  2ESE A;  4M9N A;  4JUZ A;  3ZDC A;  1D8Y A;  1HUZ A;  5AI9 A;  2ZG6 A;  9ICI A;  2H3F A;  5HHI A;  2IOH A;  4ECW A;  4M6W A;  3SYZ A;  1NNL A;  4NV0 A;  1UT5 A;  5HML A;  3RBE A;  5ALH A;  3N7R C;  5IIO A;  5DLF A;  3PSF A;  7ICQ A;  2AQ4 A;  2XGQ A;  4YN4 A;  2C2R A;  5KT2 A;  5EE0 A;  4IC9 A;  3MGV A;  2MSN A;  1R89 A;  5ALY A;  2AH5 A;  3BQ0 A;  5AM4 A;  4DSF A;  2XY5 A;  4EBE A;  4NY8 A;  4UBB A;  1TE2 A;  4QWC A;  4F4W A;  7ICK A;  4FHY A;  1Z4N A;  3TFS A;  3RB4 A;  3B0X A;  3M8S A;  4DL7 A;  5DLG A;  3PX0 A;  1Q78 A;  2KVS A;  3CRX A;  2NRT A;  1DGJ A;  3RJJ A;  2K89 A;  2H3I A;  3BS7 A;  4BWJ A;  2EDU A;  3CYM A;  5ALQ A;  3D6J A;  3HT3 A;  3PSP A;  3EPI A;  5KFT A;  1B0X A;  2ASL A;  1T94 A;  5HRG A;  2R8J A;  4YD1 A;  4JMU A;  2YB1 A;  2QKQ A;  5A0L A;  4KLT A;  1N63 A;  1ZQC A;  4YQW A;  2M2U A;  2HSZ A;  4C8K A;  3S6J A;  3ZDE A;  5C0Y A;  1KKX A;  4E8F A;  3LVW A;  2KD1 A;  3OV7 A;  4MHV A;  5J2G A;  3GII A;  7ICG A;  2WF9 A;  4IRK A;  2EZX A;  3M6K A;  1FA0 A;  4UB8 U;  4RUA A;  1OU5 A;  5HMM A;  3LK9 A;  2PFP A;  1V97 A;  1L8L A;  4UAW A;  4PGX A;  1U4B A;  1X9X A;  4I2I A;  3GFK B;  2BPG A;  4I28 A;  4MEY A;  2EQY A;  1ZQA A;  9ICS A;  2ODG A;  4DLE A;  5L1M A;  1HJP A;  4ED3 A;  2ES6 A;  4Y2R A;  2DR8 A;  7ICL A;  3BQT A;  4M9G A;  3K7D A;  1S5L U;  3RFA A;  4DQR A;  3PML A;  2BQR A;  1FO4 A;  3KHH A;  7ICF A;  1L3U A;  1VJ5 A;  4ZOH C;  5J2I A;  4QWB A;  9ICT A;  1ZXI A;  4QZD A;  4EEL A;  3U26 A;  4Y2Q A;  4K4G A;  2XI9 A;  3KZX A;  3RF9 A;  2WAQ F;  2XVT A;  2M2T A;  1TK5 A;  1KFS A;  4YXM A;  1NK4 A;  5KFK A;  1UCV A;  3AU6 A;  4DL2 A;  3D2S A;  3GIM A;  4YD2 A;  7ICR A;  3ISC A;  2W11 A;  8ICT A;  2DPJ A;  2HHS A;  2I9G A;  1WOT A;  5AHX A;  3QU7 A;  4PL1 A;  1NZB A;  4EEK A;  8ICM A;  4NM1 A;  4FHX A;  2V4Q A;  4ELT A;  2R8H A;  2WB1 C;  1KTQ A;  1RPL A;  5D4B A;  2GA9 D;  1S0O A;  1IG6 A;  4KMU A;  1CI4 A;  2ZH6 A;  4RNN A;  3WK8 A;  1KFD A;  9ICW A;  4I29 A;  1ZQ1 C;  2YMM A;  4DCC A;  1X9M A;  9ICV A;  5D46 A;  3DEE A;  2VA3 A;  2ZIV A;  5KG6 A;  5J2C A;  3QX7 A;  4XRH A;  4BJQ A;  2B51 A;  2AU0 A;  5KFD A;  4FS2 A;  2KEY A;  2LM1 A;  5HRD A;  2KKV A;  3HKZ F;  4Q43 A;  8ICO A;  7ICH A;  2F77 X;  3HWT A;  5ALM A;  2VA2 A;  4UW9 A;  3F2B A;  2A3V A;  2P35 A;  4NXX A;  3IRU A;  1ED1 A;  1SXE A;  2YTU A;  3SAH A;  4B9L A;  3A0B U;  3HJ1 A;  1IIP A;  2AGO A;  4DFM A;  2WFA A;  2A1A A;  2AXT U;  2R18 A;  3OTQ A;  4JLX A;  2WTF A;  4RQ7 A;  3SAG A;  4JV0 A;  8ICF A;  1UHU A;  3SI8 A;  1FIQ A;  1BPX A;  4RQ0 A;  1DRG A;  4WJ3 B;  3N7P D;  1L7O A;  3LVV A;  2CRX A;  1V85 A;  1L3S A;  5JTG A;  4BXO A;  1XSP A;  8ICG A;  2ZTD A;  2OWO A;  3EWA A;  4CF5 A;  3F2D A;  4CRX A;  3BS5 B;  3ONN A;  2VJ5 A;  3WKD A;  4GIB A;  4EYI B;  3ISB A;  5AI0 A;  4QZ8 A;  4ELV A;  5DB9 A;  4MF8 A;  4LEV A;  4B9M A;  3T5K A;  1RZT A;  2D6F C;  1YZ6 A;  2Y1I A;  4K99 A;  5KFE A;  3WK4 A;  4ECV A;  4RPX A;  2F76 X;  3G6X A;  4PZO A;  1ZQZ A;  7ICM A;  4RQ4 A;  1QTM A;  1NKC A;  2LYH A;  4WC6 A;  4FS1 A;  2BQU A;  1ZQR A;  1F0M A;  1XO0 A;  4PPX A;  1S8O A;  5EE3 A;  2NRW A;  2MAX A;  5GTH U;  4IS7 A;  5D62 A;  1PVR A;  4YFK A;  3I76 A;  1Z3E B;  4O69 A;  2OCE A;  1RG6 A;  4KLF A;  5AKY A;  3LWM A;  1PVP A;  5ALU A;  5KFS A;  4C0Z A;  3PX6 A;  4O68 A;  1X66 A;  1RYU A;  4I2E A;  4YCX A;  2KE7 A;  5J2K A;  4TUQ A;  2RDI A;  2K4I A;  1X9S A;  1KL9 A;  3WKB A;  3LYS A;  3M7D A;  1JAJ A;  4EBC A;  4NXW A;  2YB4 A;  4Q44 A;  4I2G A;  5J0T A;  2E8M A;  2ZH3 A;  3UM9 A;  4CE6 A;  7ICV A;  1TFY A;  4UBC A;  1OXJ A;  1XSN A;  5AIB A;  4CGZ A;  4Y2V A;  2K4P A;  3OVA A;  5AKG A;  1NJY A;  4J9S A;  1SL2 A;  4EBK A;  2Q0Z X;  9ICQ A;  2B4V A;  2W9A A;  5D63 A;  5J0Y A;  3GZF A;  2M0N A;  9ICL A;  4LJX A;  5AKL A;  3WKA A;  4P4M A;  3JPT A;  5EOZ A;  1TK0 A;  2PFO A;  2DWQ A;  2QAR A;  4QW9 A;  5JRT A;  8ICY A;  5KFP A;  2NO5 A;  4ECX A;  1BNP A;  2KMD A;  1BGX T;  3RR7 A;  2K8A A;  3QYP A;  5KAF U;  2W9B B;  4J9N A;  5HRF A;  3NTU A;  3UPS A;  4EEY A;  3NRZ A;  5KL1 B;  5DBB A;  5DG8 A;  5J0X A;  5G5G A;  4IG8 A;  1BPY A;  4FO6 A;  3OJS A;  2FLP A;  5AIA A;  1NJZ A;  3C23 A;  4RQ8 A;  4QZH A;  4OD0 A;  4C4R A;  1N61 A;  2ZTC A;  3Q8Q B;  4DS5 A;  9ICN A;  1VFG A;  5HNK A;  4YMO A;  5AKH A;  4RQ5 A;  1ZQQ A;  5EE1 A;  5DED A;  2JEJ A;  3VCB A;  4YMN A;  4C8L A;  3OPX A;  3L5K A;  1OW5 A;  4NWI A;  3Q8L A;  1IXR A;  4DL6 A;  3ZDD A;  4AT9 A;  5J2A A;  5DDM A;  3K1Z A;  4XA5 A;  5TIS U;  1Y88 A;  3AMZ A;  2ZUB A;  1BPD A;  3PW7 A;  3ZD9 A;  4Z6E A;  5ALR A;  2NYV A;  3ORY A;  2O1P A;  2JMG A;  2R8G A;  4HYK A;  3UMG A;  1O03 A;  4QNL A;  1V4A A;  3H8M A;  5CJ7 A;  5IIJ A;  4DOB A;  1LB2 B;  4CF3 A;  8ICN A;  2NRV A;  1RXW A;  1BPB A;  1U47 A;  1NK0 A;  2IOF K;  4QWE A;  1CEZ A;  1UPH A;  4F92 B;  1NKB A;  5KFZ A;  5KG3 A;  5KFF A;  4EBD A;  1SXD A;  3F53 A;  3L3F X;  1V38 A;  1KRP A;  4EGW A;  1NZP A;  2MUT A;  3NVV A;  3HJ4 A;  3QU4 A;  3QUQ A;  4Y2U A;  4X4S A;  3TAQ A;  2ZHA A;  4JLZ A;  3EF2 A;  2DKX A;  2LPE A;  1WYG A;  3OJU A;  4KX5 A;  1UEU A;  4K96 A;  1QSL A;  5KFI A;  1YT3 A;  1A6S A;  4MFC A;  5KFY A;  3TQ1 A;  1P7D A;  1FFU A;  4PH5 A;  1Q8K A;  3RRH A;  4KLL A;  4RQ1 A;  3SD7 A;  2KK0 A;  2AJQ A;  2ZH4 A;  8ICX A;  3CW2 C;  2PXI A;  2BPF A;  4Z6C A;  3OHB A;  1ZQH A;  4KLM A;  1QQ6 A;  4EV6 A;  4KLI A;  2ZJ5 A;  3V6K A;  4WC2 A;  4DO9 A;  3IN5 A;  4UQG A;  1VJ7 A;  2R8K A;  5F2V O;  1QLN A;  9ICG A;  4EP7 A;  4J9R A;  4DQI A;  1XU4 A;  4P0P B;  3OUY A;  3D2Q A;  4KLD A;  5III A;  2HN1 A;  9ICH A;  1LVH A;  4LT6 A;  4QZI A;  3ISD A;  5J29 A;  5BOL A;  1JQR A;  4QIW F;  5AM2 A;  2H5X A;  2PI5 A;  3C2L A;  1MSW D;  2HHU A;  3AQM A;  3UQ2 A;  5T14 A;  4QZF A;  5G5H A;  1IV8 A;  3N7S C;  2BE3 A;  2PFQ A;  4NM2 A;  3HP6 A;  4C8N A;  5ALN A;  4ECY A;  2W8K A;  1S10 A;  3SV3 A;  5AKE A;  1JRO A;  3GIJ A;  2PFN A;  1ZJN A;  2BCU A;  4KX3 A;  3M6Z A;  1MQ2 A;  1NI3 A;  2B0C A;  2CXY A;  2VJ4 A;  2YY6 A;  4ED6 A;  2J6U A;  1WCN A;  3GU3 A;  4GXJ A;  2FMS A;  3WFR E;  2ZIV B;  5IIN A;  2BZF A;  4QJF B;  2RP5 A;  2G0A A;  2E1E A;  4DOC A;  2LYB A;  2XY6 A;  4WBZ A;  3UPQ A;  2ZH9 A;  1CRX A;  3H39 A;  4NLK A;  9ICC A;  4K9A A;  5KFO A;  1LV5 A;  1LKY B;  2HBL A;  3IG8 A;  5J2F A;  4F2R A;  2M2V A;  4DF4 A;  5F3X B;  4FZN A;  5AI5 A;  3SEN A;  1MIW A;  5CHG A;  2HHQ A;  2JZB B;  3K1R B;  3H4D A;  2JEG A;  3IP4 B;  1QQ5 A;  3C1Y A;  2HCF A;  4UB4 A;  4O3O A;  4HAI A;  1J97 A;  2F44 A;  1TAQ A;  3RJH A;  3ZD8 A;  1WWU A;  5L1I A;  4J9K A;  4FHW A;  2UVV A;  3BZC A;  1ZET A;  2FPK A;  4DQP A;  4O5K A;  2MRL A;  5L1L A;  4R66 A;  5TZV A;  5AM1 A;  3K75 D;  4MFF A;  3FAH A;  4DOA A;  4RQ6 A;  5ALJ A;  3AEV A;  1KLN A;  3G6V A;  4PHP A;  1X6J A;  4BDP A;  4BWM A;  1COO A;  1XWL A;  4MFA A;  2K60 A;  4J9P A;  4AP9 A;  1GO3 F;  3KKA C;  2BPC A;  5ALE A;  9ICK A;  1ZQT A;  5DKW A;  5AM0 A;  3IG5 A;  1ZQX A;  2CN1 A;  1KDH A;  2KSO B;  7ICN A;  1N60 A;  2DGZ A;  2JH1 A;  4OJ5 A;  3AN1 A;  5KT7 A;  4EZ9 A;  2KG5 A;  3RJK A;  2K8C B;  4FZL A;  5ALS A;  3JPS A;  1XO1 A;  4JK1 A;  3KTQ A;  1ZQS A;  2EAO A;  3TAR A;  4DFJ A;  2LKY A;  1N56 A;  4RUC A;  1RYS A;  4MKP A;  4K97 A;  2KKP A;  5KNI A;  2AHO B;  5HRH A;  2XO7 A;  5J2H A;  1U49 A;  3TFR A;  4WC4 A;  2N1R A;  5KFM A;  4LZG A;  4KLU A;  2KFZ A;  3TAC B;  3RAQ A;  2WF5 A;  4O3N A;  2E8N A;  4O67 A;  2G06 A;  4ELU A;  1ZQP A;  5FP0 A;  5AM3 A;  5HR7 A;  3T5H A;  9ICP A;  4EZ6 A;  4ZH4 A;  5J0Q A;  2BQ3 A;  7ICP A;  5AK4 A;  3VC8 A;  4WC7 A;  2GLE A;  9ICJ A;  5DQG A;  8ICH A;  3WKE A;  4UB1 A;  3HKZ C;  4ECZ A;  5KT6 A;  2DUY A;  1COK A;  2OXO A;  2FI1 A;  3NWI A;  4XJE A;  8ICI A;  5C5J A;  5CA7 A;  4O3R A;  1A0P A;  2BDU A;  5AK3 A;  2VA8 A;  3Q8K A;  5B66 U;  4K98 A;  2MUT B;  1UQV A;  2E8P A;  5KAI U;  4B9S A;  2QLT A;  2FPM A;  2BR0 A;  4N7R A;  3RBD A;  4MEX A;  4X0A A;  4IR1 A;  2WF8 A;  2ZJ8 A;  1SB3 C;  4LEY A;  3MAB A;  2WF6 A;  1PUZ A;  3TAD C;  4OAG A;  5DEC A;  4Q8F A;  3V7K A;  1SV0 C;  2AQ0 A;  1Q3U A;  4WC3 A;  4NKU A;  4F8R A;  2RDJ A;  4UB2 A;  4UAS A;  3FM9 A;  2WF7 A;  1ZYQ A;  4WC5 A;  4MF2 A;  5DB6 A;  3KD3 A;  3LDA A;  3JYY A;  2LM4 A;  1X40 A;  5CWR A;  3C29 A;  1B43 A;  3QEB Z;  4OJ6 A;  4G3I A;  4RPZ A;  4NL9 C;  3QE9 Y;  3BS5 A;  2W04 A;  5KG0 A;  3SV4 A;  1HUO A;  4QZ9 A;  1C7Y A;  2FLN A;  4QWA A;  2VKQ A;  4BXO B;  3TAD A;  5KL8 B;  5DDY A;  3C28 A;  3PW0 A;  1BVS A;  4GC7 A;  1R8C A;  2OM6 A;  4FBT A;  5J2E A;  2ASJ A;  2KJ8 A;  2KZM A;  5AI4 A;  1NO5 A;  1ZQJ A;  3QEA Z;  3WFO A;  1IM4 A;  3OVS A;  4F3O A;  1BNO A;  5DBA A;  3JPR A;  4XQ7 A;  2BCS A;  2GH1 A;  5HR6 A;  3NYB A;  3ICX A;  2W3S A;  2KIW A;  4UAT A;  4C4S A;  8ICR A;  3MR5 A;  5J0W A;  2UVW A;  2HVI A;  1S97 A;  1UT8 A;  1L3V A;  5GTI U;  4OCZ A;  4QZB A;  2W9B A;  3WFQ E;  3WK9 A;  2PMZ F;  2AGQ A;  2E8O A;  2IHM A;  4IQT A;  1ZRM A;  3NVO A;  1TVA A;  2KSO A;  3MC1 A;  2WHE A;  2J6T A;  4UAU A;  3GV5 B;  5DBC A;  2DRB A;  1GPJ A;  2BDP A;  5KFR A;  3MDA A;  7ICS A;  2KTQ A;  3OSP A;  5HRI A;  4ATB A;  2DL0 A;  4LEZ A;  2LYA A;  2XIC A;  1XC9 A;  3LQC B;  4IQW A;  4A8E A;  3WU2 U;  3KHG A;  3QZ8 A;  3TAN A;  5J0R A;  3UXN A;  1N48 A;  4IL6 U;  3V6J A;  3MBY A;  3CNH A;  4B9N A;  4WC0 A;  3M8R A;  3HIY A;  2MA1 A;  5AKJ A;  3UMB A;  1N62 A;  3PX4 A;  1ZRN A;  3BQ7 A;  4KIT B;  4ECU A;  2ZIX B;  3B9J A;  4I2C A;  9ICF A;  1NOM A;  3H0L B;  2QB0 B;  4RT3 A;  2B6G A;  1ZQU A;  5DQI A;  3B0Y A;  1KW4 A;  2KJ5 A;  2Y0S F;  3GV7 B;  3TKA A;  1V9P A;  4O5C A;  2KV2 A;  5CFS A;  2LBO A;  4R65 A;  3GQC A;  4X4P A;  3QZ7 A;  3ETL A;  2OEH A;  2OHF A;  2DKZ A;  4KLJ A;  2W55 A;  1SL1 A;  4GXI A;  1SWW A;  1LKY A;  4C7Y A;  4AYB C;  1QSY A;  2HN2 A;  2NV3 A;  2V4R A;  1DGS A;  2KOB A;  2E1F A;  5KG4 A;  1F44 A;  8ICP A;  5EWE A;  4RQ3 A;  4OAF A;  2KP7 A;  3ER8 C;  3FYH A;  3H4B A;  2XGP A;  3GIL A;  1T3Q A;  4EYH B;  4O3P A;  4US8 A;  2HW3 A;  3J81 j;  3BJY A;  3QUT A;  2F1J A;  4OAI Z;  1Z1B A;  4Z6D A;  3K4G A;  1ZD5 A;  3L4P A;  2JV3 A;  4QIW C;  2J6S A;  4RWQ A;  4QZC A;  1KNY A;  3RJI A;  2OYY A;  4WQL A;  5KFN A;  2A1J B;  3AQE A;  4Q8E A;  3SR6 A;  1T4G A;  2RQ5 A;  1R8A A;  1S77 D;  4K9B A;  1B4F A;  1TKD A;  2Y9U A;  2A19 A;  4UD4 A;  1UA0 A;  7ICJ A;  2KVC A;  4I2H A;  5HRK A;  3H7I A;  4DQQ A;  5KG2 A;  2HHX A;  4C80 A;  2GO7 A;  3T5L A;  3N28 A;  2W9C A;  5ALL A;  4F5P A;  4X4R A;  2K4H A;  1URJ A;  4BGD A;  1RQN A;  2I1Q A;  5ALD A;  3E58 A;  3OWG A;  4O6A A;  5IIL A;  1K1S A;  2W8L A;  4FH5 A;  1A76 A;  5ALT A;  1NK5 A;  3WFP A;  4ATB B;  8ICV A;  2JEF A;  4Y2J A;  2ZIX A;  4E80 A;  2IOF A;  2DQN B;  4KTQ A;  4P4P A;  2DR9 A;  4DWI A;  1MIV A;  5BPC A;  3AUO A;  1CUK A;  5KFA A;  3Q8R B;  1TAU A;  4GXK A;  2EAN A;  4J9L A;  4NLG A;  2EAP A;  2M2W A;  4US9 A;  1JIH A;  3DV9 A;  4G9B A;  1ZQO A;  2HVH A;  5L9X A;  5CRX A;  4NXT A;  5L1J A;  5AK5 A;  4DF8 A;  1NK9 A;  4C8O A;  1U48 A;  4NLZ A;  2ASD A;  4U6P A;  1Q46 A;  3NRW A;  4M2Y A;  3OGU A;  2DRA A;  2BKE A;  4F4Y A;  4IQU A;  4DSE A;  3F5E A;  1SL0 A;  3T5J A;  4F71 A;  2P66 A;  4WCW A;  5CFU A;  4WBY A;  4NKT A;  4M0A A;  2B21 A;  3EW9 A;  3EPG A;  2AGP A;  5J0P A;  1SIJ A;  2JEI A;  4QZA A;  3NGD A;  3NS1 A;  1BPZ A;  2BBJ A;  4P0Q B;  8ICK A;  3PHZ A;  4Q45 A;  2IBK A;  5DG9 A;  4PHD A;  1ZOL A;  5KG7 A;  4UB6 U;  2W9M A;  9ICB A;  2G09 A;  3RB0 A;  5KFC A;  2QAR B;  2O5A A;  1AQ6 A;  2WB1 F;  2C2D A;  3RJE A;  3WK6 A;  4OAH A;  1Z19 A;  2HHT A;  5DGA A;  1WCL A;  3SAF A;  1ZQB A;  4DL5 A;  3D2N A;  1SKR A;  1K1Q A;  3OVB A;  4J03 A;  2P6R A;  2XCA A;  1VLB A;  4X4N A;  4F5R A;  4WH5 A;  2KIV A;  4KMO B;  3OSN A;  1ZQK A;  2ZIW B;  3GDX A;  2BCV A;  2WAQ C;  1KQQ A;  5EWG A;  4F4Z A;  4LVS A;  1KSP A;  8ICC A;  3MCR A;  2BGW A;  3TI0 A;  4F5Q A;  4RQ2 A;  2RLT A;  4TUR A;  2LMR A;  1J2N A;  5CEH A;  3C2K A;  4ED1 A;  2W7O A;  2R8I A;  4FHP A;  1SGG A;  1KEJ A;  4E7X A;  2ISO A;  3MGH A;  3KFU F;  4KLO A;  1KBU A;  3PY8 A;  4YMM A;  4DSI A;  3WFS C;  4RWO A;  1NK6 A;  3DDH A;  3IM1 A;  5AKI A;  5ALX A;  2NO4 A;  4F4K A;  2PBE A;  4EBJ A;  9ICE A;  4ICA A;  4I2A A;  4K8V A;  1FFV A;  3N97 B;  8ICQ A;  5KG1 A;  8ICS A;  4KB6 A;  2DR5 A;  4OO1 J;  3HRD D;  2BHN A;  2F1H A;  4YG2 A;  7ICU A;  2E3T A;  4QWD A;  1B22 A;  3H8S A;  5B3Q A;  2HDO A;  4PGY A;  4UAY A;  4RZR A;  5KFB A;  1L6N A;  5IIK A;  2G08 A;  4P2H A;  5JTI A;  3R9K A;  5AM5 A;  4K4H A;  3PR4 A;  4E0D A;  3KBB A;  2HBJ A;  3AQL A;  2KN7 A;  2CPR A;  2K4E A;  3FC4 A;  3V6H A;  3C1Z A;  1PK1 A;  4I0U A;  4GFJ A;  2ALZ A;  5F9N A;  1SV4 A;  2H3Z A;  5ALO A;  4M47 A;  3KHL A;  2BBH A;  3CK6 A;  3H8J A;  5AKX A;  4O5E A;  5JU5 A;  8ICL A;  3M9O B;  4TQS A;  4P4O A;  3RAX A;  2H3V A;  4DFP A;  4RNM A;  5KFL A;  3RH4 A;  3BZK A;  3HX0 A;  3N4M B;  3BQ2 A;  2FCL A;  4GC6 A;  4NL9 A;  2FLL A;  3AQF A;  5DG7 A;  4KLQ A;  4ACO A;  2K8B B;  3T79 A;  3H8W A;  1D9F A;  2NRX A;  3KOO A;  4X4V A;  4RQN A;  3QUC A;  5DGB A;  1RDF A;  4TUP A;  4B6J A;  2FE9 A;  2L5Y A;  2QB0 A;  2HHW A;  5AIC A;  2G5H B;  1NK8 A;  4JV2 A;  2ZIU B;  4PHE A;  1Z00 A;  1JRP A;  4I27 A;  4X5V A;  4RNO A;  5ALI A;  2F8K A;  3RB6 A;  4KLH A;  3ED5 A;  5KT3 A;  1MIY A;  1DXS A;  5ALG A;  4F72 A;  1Q79 A;  2VIX A;  1Z00 B;  2W9C B;  3Q8M A;  4M9L A;  3C18 A;  2IA6 A;  3MDC A;  3NVZ A;  3ETR A;  1ZD2 P;  4AT8 A;  9ICM A;  5KFJ A;  5KFV A;  3O0F A;  9ICA A;  4BUG A;  4WQK A;  3I28 A;  2DVI A;  5KFQ A;  4NLN A;  2FJ6 A;  5L1K A;  3H0M B;  4ECT A;  1S0V A;  2UVU A;  3A0H U;  1MA7 A;  2ZXH A;  3QXG A;  2M9N A;  2C28 A;  4NXU A;  2DBY A;  3MGI A;  4EEB A;  2Q4T A;  3MR2 A;  4M9H A;  1UET A;  1Q3V A;  3PO5 A;  1ARO P;  4KLE A;  3ZDB A;  4IR9 A;  1H38 A;  2YN4 A;  3KZI U;  5HRE A;  1Z1V A;  1SWV A;  4R8U A;  4FZM A;  3UXO A;  2ZHB A;  4RT2 A;  4DL4 A;  2ATL A;  1S0N A;  1S9F A;  4JWM A;  2W7P A;  4KM5 A;  1QH9 A;  4CNQ A;  4O0I A;  4GLX A;  4UD5 A;  1X2I A;  3JPP A;  1QCK A;  5B5E U;  3RRG A;  2PI4 A;  4UAV A;  4S3N A;  1HIW A;  4F50 A;  1NKE A;  4IQV A;  1PK1 B;  4CDG A;  3MFH A;  4WC1 A;  4CF4 A;  3AU2 A;  3OHA A;  3QUB A;  4NLB A;  4USA A;  1PZN A;  4U7C A;  7ICE A;  3EYZ A;  5J2D A;  4WOY A;  3E2E A;  3THV A;  5ALK A;  4QW8 A;  2D3D A;  1PK3 A;  5KT4 A;  1YZ7 A;  3HIL A;  4RU9 A;  3ERC C;  4AYB F;  5E79 U;  3JPN A;  3SZ2 A;  4NXV A;  3JPQ A;  2KHQ A;  3LWL A;  9ICO A;  1L8O A;  4YR2 A;  4JV1 A;  9ICU A;  5J0O A;  5AI8 A;  2B56 A;  3HW8 A;  3M9M B;  2EZZ A;  5CR0 A;  4R8U B;  3MFI A;  4F5O A;  5HP4 A;  1MQ3 A;  2KZZ A;  2Y0S C;  4UAZ A;  1NK7 A;  1ZJM A;  4O3M A;  4J9M A;  3PR5 B;  4IRD A;  3PST A;  3PMN A;  1NJW A;  2W43 A;  3C66 A;  3NVY A;  1ZQV A;  2HBM A;  5EWF A;  3EZ5 A;  3ZI4 A;  1X6I A;  2FMQ A;  1ZQD A;  4EX7 A;  1SZP A;  1ZQL A;  3C5F A;  4B9U A;  2DR7 A;  4X4T A;  4M6W B;  5J2B A;  1TFR A;  4DEZ A;  4FHV A;  3M1Y A;  2F8L A;  2KNJ A;  1UEV A;  2I5H A;  4CCH A;  2DF4 B;  3RJF A;  2YMQ A;  4AT7 B;  1TK8 A;  1ZQW A;  2ZJA A;  1L3T A;  5ALV A;  5KFH A;  4J9Q A;  3KHR A;  2EH9 A;  4PGQ A;  2IUB A;  1WUD A;  2Y9T A;  5EE9 A;  2RRD A;  3F2C A;  2I6X A;  3C2M A;  1T7P A;  1OUQ A;  2FPL A;  1F5A A;  4K4I A;  1N5X A;  2LHT A;  2JRZ A;  1M6Y A;  5CB1 A;  5J8Y A;  3BDP A;  4PL2 A;  2H3Q A;  3IDW A;  4FE3 A;  8ICB A;  5J8Y C;  4C8M A;  2BCQ A;  4ED2 A;  4I2B A;  8ICJ A;  4Y2X A;  3RR8 A;  1T8E A;  1DK2 A;  1QSS A;  4F2S A;  5ALZ A;  5J0S A;  1MC8 A;  5H2F U;  1BPE A;  1UA1 A;  4BX9 C;  5KFG A;  3M9N B;  1ZQI A;  3AL0 B;  2JHD A;  4UAR A;  2RHF A;  2W3R A;  4OJP A;  1SKS A;  2HOF A;  1ZQE A;  4Y2Y A;  4DSL A;  1SV0 A;  4RWN A;  4AT9 B;  2JR5 A;  1S0M A;  7ICO A;  5HHH A;  1KFT A;  3WKC A;  1U45 A;  4F91 B;  1YLQ A;  3QNM A;  4JB3 A;  3RTV A;  2C22 A;  5HRL A;  5ALP A;  3QU9 A;  4Y2T A;  4M9J A;  3IHQ B;  3MR6 A;  3F5A A;  2GAF D;  3JCF A;  3H3A A;  4F93 B;  1VDV A;  5BOM A;  4F4X A;  3RB3 A;  4P0Q A;  4RQM A;  2G5I B;  3RJG A;  2KJ9 A;  2W03 A;  1XSL A;  3ALR A;  3PW4 A;  4ECS A;  2MU2 A;  1S76 D;  1L7M A;  1ZD3 A;  4YR0 A;  4AT7 A;  5ALF A;  5JUM A;  1C20 A;  4ECR A;  3V7J A;  2OH2 A;  4TUS A;  8ICA A;  2Q66 A;  4XUS A;  1XS9 D;  3ZDA A;  3AM9 A;  1X42 A;  2G07 A;  4F5N A;  5HR9 A;  3MR3 A;  3CP8 A;  2ZH8 A;  5IIM A;  4DSJ A;  1XNS A;  3PZP A;  2E5S A;  4PZN A;  3PVX A;  1WG8 A;  1L7P A;  4EEN A;  3G6Y A;  4FFD A;  1TV9 A;  5AKZ A;  2VAN A;  2F2A B;  3NVW A;  2HOI A;  2EAM A;  2P6U A;  2A1J A;  2RFF A;  1NJX A;  2HI0 A;  4I2F A;  3WK5 A;  4C4T A;  5HC9 A;  2IMW P;  3ER9 B;  3E0F A;  2GWS A;  2ZXI A;  3AQN A;  2PKE A;  4B9V A;  3H37 A;  4HX0 A;  4I2J A;  3PW2 A;  3TAP A;  3C21 A;  3C5G A;  1JAL A;  2HMX A;  8ICW A;  1PX5 A;  4O9M A;  1U9L A;  4X0B A;  2KFN A;  3IV6 A;  1JXL A;  1JMS A;  2HHV A;  2YML A;  2YQE A;  1RQL A;  4EX6 A;  4PJ0 U;  1D8L A;  3BQ1 A;  5AK6 A;  2DPI A;  4DFK A;  1RYR A;  4FO1 A;  5D49 A;  4ECQ A;  1JN3 A;  4TQR A;  2EWR A;  2ZUC A;  3AQK A;  1ZQY A;  4KLS A;  1ZQN A;  4X4Q A;  3UXP A;  3WK7 A;  4X4U A;  1SZH A;  1L7N A;  3GV8 B;  3SQI A;  9ICR A;  1QQ7 A;  1ZQF A;  1ZQG A;  4KLG A;  3PSI A;  4OJO A;  4P0P A;  7ICI A;  3OUY B;  5KG5 A;  5KTQ A;  1K5O A;  4RPY A;  3RH5 A;  1Z4O A;  3PV8 A;  2KZ3 A;  2NRK A;  1TAM A;  1L5U A;  4DQS A;  3T3F A;  1SKW A;  1J2M A;  3JPO A;  2ZTE A;  4M04 A;  3V7L A;  3L9D A;  2HHP A;  4UB3 A;  2BCR A;  4LZD A;  4DS4 A;  2QB1 A;  1DK3 A;  4DSK A;  4I2D A;  2PMZ C;  2XCP A;  4JWN A;  4EED A;  1F5S A;  4M5D A;  3NKU A;  1ZD4 A;  1RXV A;  2IHN A;  4O3S A;  8ICZ A;  1JXE A;  5F9L A;  2JZB A;  5DB7 A;  4O3Q A;  3RH6 A;  5CFT A;  5J2J A; 
#chains in the Genus database with same CATH homology
 3N4M B;  3PO4 A;  5DDY A;  1A77 A;  3BQ2 A;  4GC6 A;  3PW0 A;  1BVS A;  2FLL A;  4GC7 A;  2ZH9 A;  5DG7 A;  7ICV A;  2ZH3 A;  4KLQ A;  1R8C A;  4UBC A;  1D9F A;  4FBT A;  3H8W A;  5J2E A;  2NRX A;  5DQH A;  2ASJ A;  4DL3 A;  1XSN A;  4X4V A;  5DGB A;  4TUP A;  2KZM A;  1NO5 A;  3OVA A;  1ZQJ A;  4KN7 A;  3QEA Z;  3WFO A;  5KFW A;  1IM4 A;  1NJY A;  4FH3 A;  2HHW A;  4J9S A;  3OVS A;  4F3O A;  2C2E A;  1SL2 A;  4EBK A;  2Q0Z X;  9ICQ A;  1BNO A;  5DBA A;  3JPR A;  3H40 A;  2W9A A;  4AT8 B;  5J0Y A;  2UVR A;  4XQ7 A;  1NK8 A;  2BCS A;  9ICL A;  3NYB A;  4P4M A;  3JPT A;  5EOZ A;  1TK0 A;  2PFO A;  4JV2 A;  4PHE A;  4QW9 A;  8ICY A;  1Z00 A;  1DOQ A;  2DFL A;  4XQ8 A;  5KFP A;  4ECX A;  8ICR A;  1BNP A;  3MR5 A;  5J0W A;  2UVW A;  4X5V A;  4I27 A;  4RWP A;  1EXN A;  4RNO A;  1BGX T;  2HVI A;  1S97 A;  1UT8 A;  1L3V A;  3RB6 A;  4ED7 A;  3RR7 A;  2W9B B;  4QZB A;  2W9B A;  4J9N A;  4FBU A;  3NTU A;  1X9W A;  5KT3 A;  4KLH A;  5HRF A;  4EEY A;  5DBB A;  1MIY A;  5J0X A;  5DG8 A;  3WFQ E;  4IG8 A;  2ISP A;  1BPY A;  1Q79 A;  2AGQ A;  2IHM A;  1Z00 B;  2W9C B;  4IQT A;  5KT5 A;  3Q8M A;  4FO6 A;  5HRB A;  3OJS A;  1TVA A;  2FLP A;  3FDS A;  4M9L A;  3C18 A;  2IA6 A;  3MDC A;  1NJZ A;  4AT8 A;  2FMP A;  3C23 A;  4RQ8 A;  4PHA A;  5KFJ A;  2J6T A;  8ICE A;  5KFV A;  9ICM A;  4R63 A;  3GIK A;  4QZH A;  2F1I A;  3GV5 B;  5DBC A;  9ICA A;  5CP2 A;  2ZTC A;  3Q8Q B;  4DS5 A;  9ICN A;  2ZH2 A;  5HNK A;  4YMO A;  1VFG A;  4YR3 A;  4RQ5 A;  1ZQQ A;  3V72 A;  2DRB A;  5DED A;  2JEJ A;  4C8L A;  4YMN A;  4YVZ A;  2BDP A;  2DVI A;  5KFQ A;  5KFR A;  3MDA A;  2V9W A;  7ICS A;  2ID1 A;  3Q8L A;  4NLN A;  5KFX A;  5L1K A;  1IXR A;  4DL6 A;  3OSP A;  3ZDD A;  5J2A A;  2KTQ A;  7ICT A;  5HRI A;  4AT9 A;  4ATB A;  5DDM A;  4ECT A;  4XA5 A;  1S0V A;  2UVU A;  1Y88 A;  1XC9 A;  3LQC B;  4KN4 A;  4IQW A;  2ZUB A;  1BPD A;  3KHG A;  3QZ8 A;  3PW7 A;  3TAN A;  3ZD9 A;  4Z6E A;  4ED0 A;  5J0R A;  3UXN A;  3ORY A;  1N48 A;  2M9N A;  2C28 A;  4IRC A;  2O1P A;  3Q8S B;  1T3N A;  2R8G A;  4HYK A;  3V6J A;  3MGI A;  4QZE A;  1V4A A;  3MBY A;  5CJ7 A;  4B9N A;  3MR2 A;  2XY7 A;  4M9H A;  4WC0 A;  4DLG A;  5KFU A;  3M8R A;  1D9D A;  3PO5 A;  1ARO P;  5IIJ A;  5J0U A;  4KLE A;  4DOB A;  3HIY A;  3ZDB A;  1LB2 B;  3HPO A;  4IR9 A;  1H38 A;  3H38 A;  3PX4 A;  8ICN A;  5HRE A;  4R8U A;  4KIT B;  4R64 A;  2NRV A;  4J9O A;  1RXW A;  2ZHB A;  3UXO A;  4RT2 A;  3Q8P B;  4ECU A;  1BPB A;  4DL4 A;  2ATL A;  1U47 A;  1S0N A;  1S9F A;  4JWM A;  4I2C A;  2ZH5 A;  1NK0 A;  4QWE A;  1CEZ A;  4X4O A;  9ICF A;  4F92 B;  4O0I A;  1NKB A;  1NOM A;  4GLX A;  4UD5 A;  4RT3 A;  5KFZ A;  1ZQU A;  5KG3 A;  5KFF A;  1X2I A;  3JPP A;  3UQ0 A;  4EBD A;  1TFW A;  4ED8 A;  1KRP A;  3RRG A;  2PI4 A;  5DQI A;  2MUT A;  3B0Y A;  2XC9 A;  9ICX A;  1NZP A;  4S3N A;  4F50 A;  2Y1J A;  4Z6F A;  3GV7 B;  3HJ4 A;  1V9P A;  3JZ0 A;  1NKE A;  4IQV A;  1ZQM A;  4O5C A;  4R65 A;  4X4S A;  2ZH1 A;  4YXJ A;  3GQC A;  1R8B A;  3TAQ A;  4X4P A;  2ZHA A;  4NXZ A;  3QZ7 A;  3MFH A;  4B9T A;  2ZUD A;  3ETL A;  3OJU A;  3H39 A;  1UEU A;  4KLJ A;  8ICU A;  4WC1 A;  4QZG A;  2NRZ A;  1SL1 A;  3PNC A;  3AU2 A;  3OHA A;  4YP3 A;  5KFI A;  4GXI A;  3PW5 A;  1JX4 A;  1QSL A;  2ZH7 A;  5DB8 A;  4UB5 A;  1QSY A;  1PZN A;  2V4R A;  4M9N A;  1DGS A;  4JUZ A;  4MFC A;  5KFY A;  7ICE A;  3EYZ A;  5J2D A;  3ZDC A;  1D8Y A;  3TQ1 A;  1HUZ A;  5KG4 A;  8ICP A;  5EWE A;  3E2E A;  4RQ3 A;  3THV A;  4QW8 A;  9ICI A;  4PH5 A;  5HHI A;  3RRH A;  4ECW A;  5KT4 A;  2KP7 A;  4M6W A;  4RU9 A;  3SYZ A;  4KLL A;  3FYH A;  4RQ1 A;  1UT5 A;  3H4B A;  5HML A;  2XGP A;  3GIL A;  4EYH B;  3RBE A;  3JPN A;  3SZ2 A;  2AJQ A;  4O3P A;  3JPQ A;  3LWL A;  8ICX A;  2ZH4 A;  5IIO A;  5DLF A;  2PXI A;  2BPF A;  4Z6C A;  2HW3 A;  3BJY A;  2AQ4 A;  3OHB A;  7ICQ A;  1ZQH A;  2XGQ A;  4KLM A;  4YN4 A;  4YR2 A;  2C2R A;  4JV1 A;  4KLI A;  5KT2 A;  9ICU A;  5J0O A;  2ZJ5 A;  3V6K A;  4WC2 A;  3HW8 A;  3M9M B;  4DO9 A;  1R89 A;  2F1J A;  4UQG A;  5CR0 A;  3MFI A;  4R8U B;  5HP4 A;  4Z6D A;  4F5O A;  1MQ3 A;  2R8K A;  3K4G A;  2KZZ A;  4UAZ A;  3BQ0 A;  4DSF A;  5F2V O;  2XY5 A;  1NK7 A;  1QLN A;  1ZJM A;  4EBE A;  4NY8 A;  4UBB A;  4J9M A;  9ICG A;  4EP7 A;  3PR5 B;  4J9R A;  4DQI A;  1XU4 A;  4QWC A;  4IRD A;  3OUY A;  4KLD A;  3PMN A;  4F4W A;  1NJW A;  7ICK A;  5III A;  3C66 A;  4FHY A;  9ICH A;  2J6S A;  4RWQ A;  4QZC A;  3TFS A;  1ZQV A;  4LT6 A;  1KNY A;  4QZI A;  3RJI A;  3RB4 A;  3B0X A;  3M8S A;  3ISD A;  5J29 A;  5EWF A;  5BOL A;  3EZ5 A;  5DLG A;  4DL7 A;  3PX0 A;  2FMQ A;  1ZQD A;  1Q78 A;  1UET A;  1SZP A;  5KFN A;  1ZQL A;  1JQR A;  2NRT A;  2H5X A;  3C5F A;  3RJJ A;  2PI5 A;  3C2L A;  4B9U A;  4BWJ A;  2A1J B;  2DR7 A;  4Q8E A;  1MSW D;  4X4T A;  4M6W B;  5J2B A;  2HHU A;  1T4G A;  3AQM A;  1TFR A;  1R8A A;  1S77 D;  3HT3 A;  3UQ2 A;  4QZF A;  4DEZ A;  4FHV A;  3EPI A;  1TKD A;  1UEV A;  5KFT A;  2BE3 A;  4UD4 A;  2ASL A;  4CCH A;  2PFQ A;  5HRG A;  1UA0 A;  4NM2 A;  4YD1 A;  3HP6 A;  2R8J A;  3RJF A;  4C8N A;  4I2H A;  7ICJ A;  5HRK A;  3H7I A;  4DQQ A;  1ZQW A;  1TK8 A;  4AT7 B;  4ECY A;  5KG2 A;  4KLT A;  2W8K A;  2HHX A;  1ZQC A;  2ZJA A;  4YQW A;  1S10 A;  3SV3 A;  5KFH A;  1L3T A;  3T5L A;  2M2U A;  4J9Q A;  3GIJ A;  2PFN A;  1ZJN A;  3KHR A;  4C8K A;  4PGQ A;  2BCU A;  3ZDE A;  2W9C A;  1MQ2 A;  4E8F A;  4F5P A;  4X4R A;  3OV7 A;  4BGD A;  2I1Q A;  5J2G A;  3GII A;  4ED6 A;  3C2M A;  1T7P A;  2J6U A;  7ICG A;  4IRK A;  2FPL A;  1F5A A;  1WCN A;  4K4I A;  4GXJ A;  5IIL A;  1FA0 A;  2FMS A;  5CB1 A;  4RUA A;  5HMM A;  1OU5 A;  3LK9 A;  1K1S A;  3WFR E;  2W8L A;  2PFP A;  4FH5 A;  3BDP A;  5IIN A;  1A76 A;  1NK5 A;  3WFP A;  4ATB B;  8ICV A;  2JEF A;  4UAW A;  8ICB A;  4PGX A;  1U4B A;  4C8M A;  4E80 A;  4I2I A;  2BCQ A;  3GFK B;  4DOC A;  4ED2 A;  4I2B A;  8ICJ A;  2BPG A;  4KTQ A;  3RR8 A;  4I28 A;  4MEY A;  2XY6 A;  4WBZ A;  3UPQ A;  1ZQA A;  9ICS A;  4P4P A;  1T8E A;  1DK2 A;  4DLE A;  1QSS A;  4F2S A;  4DWI A;  1MIV A;  2DR9 A;  1HJP A;  1CUK A;  5J0S A;  1MC8 A;  5BPC A;  4ED3 A;  3AUO A;  3BQT A;  5KFA A;  4M9G A;  1BPE A;  4NLK A;  9ICC A;  7ICL A;  5KFO A;  3PML A;  4DQR A;  2BQR A;  3Q8R B;  1UA1 A;  1LV5 A;  1TAU A;  5J2F A;  5KFG A;  3M9N B;  3KHH A;  4GXK A;  1L3U A;  4F2R A;  7ICF A;  4J9L A;  4NLG A;  5J2I A;  2M2V A;  4DF4 A;  1ZQI A;  2M2W A;  4QWB A;  9ICT A;  1JIH A;  1SKS A;  1MIW A;  4QZD A;  5CHG A;  1ZQO A;  5L9X A;  1ZQE A;  2HVH A;  2HHQ A;  2JZB B;  4DSL A;  4K4G A;  3H4D A;  2JEG A;  5L1J A;  4RWN A;  4AT9 B;  1S0M A;  7ICO A;  3C1Y A;  2M2T A;  5HHH A;  4UB4 A;  4DF8 A;  1TK5 A;  4O3O A;  1NK9 A;  1KFS A;  4C8O A;  1KFT A;  1TAQ A;  1U48 A;  3RJH A;  1U45 A;  4F91 B;  2ASD A;  4NLZ A;  3ZD8 A;  4YXM A;  1NK4 A;  1YLQ A;  3RTV A;  5KFK A;  5L1I A;  4M2Y A;  2C22 A;  3OGU A;  4J9K A;  3AU6 A;  4FHW A;  4DL2 A;  2UVV A;  2DRA A;  1ZET A;  2FPK A;  2BKE A;  4F4Y A;  4IQU A;  3GIM A;  4DQP A;  5L1L A;  4O5K A;  5HRL A;  4R66 A;  4YD2 A;  5TZV A;  4DSE A;  7ICR A;  3ISC A;  1SL0 A;  3T5J A;  2P66 A;  3K75 D;  2DPJ A;  8ICT A;  4WCW A;  4WBY A;  4M9J A;  2HHS A;  3IHQ B;  2I9G A;  1WOT A;  4NKT A;  4MFF A;  3MR6 A;  4M0A A;  2B21 A;  3EW9 A;  3EPG A;  2AGP A;  3H3A A;  8ICM A;  4F93 B;  5J0P A;  4NM1 A;  2JEI A;  4DOA A;  4QZA A;  5BOM A;  4RQ6 A;  3NGD A;  4F4X A;  3RB3 A;  1BPZ A;  2V4Q A;  4ELT A;  8ICK A;  4FHX A;  4Q45 A;  1KLN A;  3G6V A;  2R8H A;  2IBK A;  4PHP A;  1KTQ A;  1RPL A;  5DG9 A;  5D4B A;  4PHD A;  5KG7 A;  4BDP A;  2W9M A;  3RJG A;  9ICB A;  4BWM A;  1S0O A;  1COO A;  1XWL A;  3RB0 A;  1XSL A;  4KMU A;  5KFC A;  3PW4 A;  2O5A A;  2ZH6 A;  4RNN A;  2C2D A;  1KFD A;  3RJE A;  9ICW A;  4MFA A;  4J9P A;  4I29 A;  4ECS A;  2HHT A;  5DGA A;  1WCL A;  1S76 D;  2BPC A;  4YR0 A;  1X9M A;  1ZQB A;  9ICK A;  4DL5 A;  1ZQT A;  9ICV A;  5D46 A;  1SKR A;  2VA3 A;  5JUM A;  4AT7 A;  1K1Q A;  5DKW A;  5KG6 A;  3OVB A;  5J2C A;  3V7J A;  4ECR A;  4XRH A;  2P6R A;  1ZQX A;  2XCA A;  4TUS A;  4X4N A;  2AU0 A;  5KFD A;  1KDH A;  4F5R A;  4FS2 A;  7ICN A;  5HRD A;  8ICO A;  4Q43 A;  8ICA A;  2Q66 A;  4XUS A;  5KT7 A;  1XS9 D;  4EZ9 A;  7ICH A;  3ZDA A;  3HWT A;  3OSN A;  1ZQK A;  3GDX A;  3RJK A;  2VA2 A;  2BCV A;  5EWG A;  4F5N A;  4F4Z A;  3JPS A;  5HR9 A;  3MR3 A;  2DR8 A;  1XO1 A;  4JK1 A;  3KTQ A;  1ZQS A;  2ZH8 A;  5IIM A;  4DSJ A;  4LVS A;  3TAR A;  1KSP A;  8ICC A;  4DFJ A;  2BGW A;  1N56 A;  3TI0 A;  9ICO A;  3PVX A;  4RUC A;  4F5Q A;  4RQ2 A;  1RYS A;  3G6Y A;  4B9L A;  3HJ1 A;  1TV9 A;  4TUR A;  2VAN A;  2AGO A;  4DFM A;  5HRH A;  2XO7 A;  5J2H A;  1U49 A;  3C2K A;  2WTF A;  4ED1 A;  4RQ7 A;  3TFR A;  2P6U A;  1VJ7 A;  2A1J A;  2RFF A;  4WC4 A;  2R8I A;  5KFM A;  1NJX A;  4JV0 A;  4FHP A;  8ICF A;  1KEJ A;  4I2F A;  2ISO A;  4E7X A;  3MGH A;  3SI8 A;  1BPX A;  4LZG A;  2IMW P;  5HC9 A;  4RQ0 A;  4KLO A;  4KLU A;  2KFZ A;  2GWS A;  3AQN A;  3PY8 A;  4YMM A;  4B9V A;  3RAQ A;  4DSI A;  3H37 A;  4I2J A;  4O3N A;  3PW2 A;  3TAP A;  3WFS C;  4RWO A;  1NK6 A;  4ELU A;  1ZQP A;  3C21 A;  1L3S A;  3C5G A;  8ICW A;  1PX5 A;  4O9M A;  1U9L A;  4X0B A;  3T5H A;  2KFN A;  9ICP A;  1JXL A;  4BXO A;  1JMS A;  3IM1 A;  4EZ6 A;  4ZH4 A;  2HHV A;  5J0Q A;  2BQ3 A;  7ICP A;  1XSP A;  8ICG A;  2ZTD A;  2OWO A;  4WC7 A;  3EWA A;  9ICJ A;  5DQG A;  1D8L A;  8ICH A;  3BQ1 A;  4F4K A;  1JAJ A;  4UB1 A;  2PBE A;  4EBJ A;  4ECZ A;  2DPI A;  4DFK A;  5KT6 A;  1RYR A;  4EYI B;  9ICE A;  3ISB A;  4I2A A;  5D49 A;  8ICI A;  5C5J A;  5CA7 A;  4ECQ A;  1JN3 A;  4QZ8 A;  3N97 B;  5DB9 A;  4ELV A;  4O3R A;  8ICQ A;  4TQR A;  5KG1 A;  4MF8 A;  2VA8 A;  3Q8K A;  4B9M A;  8ICS A;  2DR5 A;  3T5K A;  2BHN A;  2F1H A;  2ZUC A;  4YG2 A;  1ZQY A;  1RZT A;  7ICU A;  3AQK A;  4KLS A;  1ZQN A;  2Y1I A;  2MUT B;  4QWD A;  1B22 A;  3H8S A;  4B9S A;  4X4Q A;  2FPM A;  2BR0 A;  3UXP A;  4PGY A;  5KFE A;  3RBD A;  4X4U A;  4UAY A;  4MEX A;  4RZR A;  5KFB A;  5IIK A;  4ECV A;  4X0A A;  3GV8 B;  4RPX A;  4IR1 A;  4P2H A;  3G6X A;  1ZQZ A;  9ICR A;  2ZJ8 A;  1ZQF A;  7ICM A;  4RQ4 A;  1ZQG A;  1QTM A;  1NKC A;  4KLG A;  3MAB A;  2LYH A;  4K4H A;  4WC6 A;  4FS1 A;  2BQU A;  1ZQR A;  7ICI A;  5DEC A;  3OUY B;  3PR4 A;  4E0D A;  3V7K A;  4Q8F A;  4PPX A;  5KG5 A;  2KN7 A;  2NRW A;  3AQL A;  2AQ0 A;  2MAX A;  5KTQ A;  3V6H A;  3C1Z A;  4RPY A;  4WC3 A;  3RH5 A;  4NKU A;  4F8R A;  2RDJ A;  3PV8 A;  2KZ3 A;  2NRK A;  4UB2 A;  4YFK A;  2ALZ A;  1Z3E B;  5F9N A;  1L5U A;  4DQS A;  1ZYQ A;  4WC5 A;  3UPS A;  4KLF A;  4MF2 A;  3T3F A;  4M47 A;  3LWM A;  5DB6 A;  1SKW A;  3KHL A;  3LDA A;  3JYY A;  3JPO A;  2ZTE A;  4M04 A;  3V7L A;  3L9D A;  2HHP A;  1TFY A;  4UB3 A;  5KFS A;  5CWR A;  2BCR A;  3H8J A;  4LZD A;  4DS4 A;  3PX6 A;  1DK3 A;  4O5E A;  4DSK A;  8ICL A;  4I2E A;  3M9O B;  1B43 A;  4I2D A;  4TQS A;  3QEB Z;  4YCX A;  5J2K A;  4P4O A;  4TUQ A;  2RDI A;  2XCP A;  4JWN A;  4G3I A;  4RPZ A;  3RAX A;  3QE9 Y;  4M5D A;  1X9S A;  4RNM A;  5KG0 A;  4DFP A;  3SV4 A;  1RXV A;  1HUO A;  4QZ9 A;  1C7Y A;  2IHN A;  1JXE A;  4O3S A;  5KFL A;  5F9L A;  2FLN A;  8ICZ A;  4QWA A;  4EBC A;  3RH4 A;  2JZB A;  5DB7 A;  4O3Q A;  4BXO B;  4Q44 A;  4I2G A;  5J0T A;  3RH6 A;  5J2J A;  3HX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...