4PHAA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phaA03
4K4IA 4KLFA 4JUZA 4I2FA 1MIYA 2PI4A 4RQ7A 5KFGA 1TFRA 3KHHA 1X9SA 2Y1JA 2ZJ8A 3H4BA 1BGXT 2ZH3A 3OHAA 3G6YA 5HMLA 1T8EA 1ZQAA 5DG9A 3PW5A 2BGWA 1S97A 2BQRA 4M9LA 5KFPA 5IIIA 4YR2A 1TK0A 2PXIA 4KMUA 5KFQA 4M9NA 3MGIA 3M9MB 5F2VO 3PX0A 4AT7B 3UXOA 1NZPA 1KSPA 4X0BA 1S10A 2R8GA 1PX5A 1KNYA 2BR0A 1OU5A 3M9NB 5JUMA 2DRBA 8ICSA 5J0UA 4F50A 2DVIA 3AU6A 3OUYA 2KZ3A 2HHUA 7ICVA 4G3IA 5HHIA 3ISBA 3LQCB 4GXJA 4EBKA 4MF8A 5CWRA 4C8NA 2UVVA 2Q0ZX 4I2JA 1BPXA 3MR6A 5KT5A 3V72A 2BQ3A 5DLFA 4JV2A 2ZJAA 1V4AA 4RPXA 3T5HA 4JV1A 4ECUA 1DOQA 4DQPA 4BDPA 1NJWA 2NRXA 2W9BA 3ZDCA 3H8WA 4UAWA 2NRZA 2ZTDA 4C8LA 2HW3A 4RWPA 4RWNA 1NK5A 5BOMA 3TARA 2HHPA 8ICBA 2FPMA 8ICVA 4YMNA 1BNOA 5J2CA 3M8RA 4O3NA 2AJQA 3LK9A 1FA0A 3OV7A 3PV8A 5HP4A 4LT6A 4O3OA 3FYHA 5J2GA 5J0YA 1TK5A 4J9NA 4UD4A 4DS4A 5J0WA 3KTQA 4QZAA 3TFSA 3T5KA 2NRTA 3ZD9A 2W9BB 3E2EA 4X0AA 5IINA 5KFJA 1S0VA 3EWAA 3TAPA 1ZQBA 9ICOA 3HJ1A 4RQ1A 1MQ3A 1X9WA 4RWQA 4DL5A 4I2AA 3NTUA 4F2SA 3HIYA 2KP7A 2F1IA 5C5JA 3RBDA 4RT3A 1NJYA 1B22A 1R8AA 9ICKA 5HMMA 4Q45A 3HT3A 4DFMA 1SL0A 4YQWA 1NK6A 4X4OA 4F4ZA 3T3FA 2ZHBA 2FMPA 1X2IA 5HRDA 3C2KA 4X4TA 2J6TA 1ZQTA 4YXMA 4F2RA 4GXKA 4J9MA 4F91B 4RQ3A 3TI0A 4TURA 1X9MA 4AT9A 9ICJA 4Z6EA 1DK3A 5KT7A 4QZFA 2C2EA 1WOTA 5CB1A 2W9AA 8ICMA 2JZBB 5IIMA 1TKDA 2M2UA 2UVWA 3RAXA 7ICKA 4DL6A 5J0PA 3V7LA 1D8LA 1PZNA 1BPEA 4X4NA 2RFFA 4E0DA 4Z6FA 1L3UA 3PX4A 5DDMA 4PHAA 2XO7A 1N56A 9ICEA 4AT9B 4RQ4A 4JV0A 3HP6A 3SV3A 4KLMA 8ICAA 5KG0A 1ZQHA 1S0OA 5J0OA 1KEJA 3EZ5A 1N48A 4UB3A 5EWFA 3NYBA 4E80A 3OVBA 3LDAA 3G6XA 1ZQLA 4I29A 3GIKA 2BCVA 3KHRA 3C5FA 2RDJA 3ZDAA 5HRIA 3ETLA 1COOA 1SL1A 1TVAA 4PH5A 3H4DA 4QZ8A 1UT5A 5EOZA 4Q44A 1NKBA 3C18A 1BPBA 1ZQXA 5KG7A 3C2MA 5EWEA 4I2HA 4MEXA 1NOMA 5KT3A 4XQ8A 1ZQUA 1ZQNA 4DWIA 1RZTA 3OVSA 5J2EA 3RH4A 3MDAA 2FLNA 2ZTCA 2FLPA 3PO4A 3RJFA 4RUCA 4F4YA 4B9MA 4K4GA 9ICBA 5HRGA 5D4BA 4F93B 4X4PA 1TAQA 2LYHA 2XCAA 1C7YA 2AGPA 4DSLA 4M9JA 4GLXA 4E8FA 2HVHA 5HRHA 3KHLA 4DQIA 4J9PA 3WFOA 5DBBA 1R8CA 5KFEA 4TUPA 3GQCA 4F5QA 2HHTA 1JQRA 2BCUA 3C23A 1ZQKA 1U49A 4DFKA 1ZQQA 4F4KA 1NK7A 4NLGA 2HHQA 4ED0A 3RAQA 4KLIA 4NKTA 8ICGA 7ICNA 1IXRA 3PVXA 4Z6CA 5KFRA 4ED1A 2KN7A 1JX4A 4EYIB 8ICJA 5KG3A 1KDHA 3JPOA 2A1JA 2NRWA 2DPJA 4MFAA 2PFPA 3ZDBA 4X4VA 4O3SA 4ELTA 1Z3EB 1T4GA 3Q8MA 1NK8A 2ZHAA 4RQ0A 4TUQA 4ECZA 4B9LA 9ICTA 4TUSA 1S0MA 2FMSA 3RJGA 5CHGA 1ZQSA 3RRGA 4DSKA 4S3NA 7ICQA 1VJ7A 2PFNA 3AQMA 3C66A 5HHHA 4LVSA 1NJXA 1HJPA 4DFPA 2XGPA 3MABA 4RU9A 3Q8LA 3Q8KA 4KLLA 2A1JB 4JWNA 5KFMA 4O5KA 5KFLA 4DOBA 1MIVA 3H38A 4AT7A 4P4MA 1R89A 5KFKA 5J2JA 2BDPA 2UVRA 4QZBA 4Z6DA 4F5PA 2BPCA 2GWSA 8ICXA 3V6JA 5DBCA 1KRPA 5IIKA 5KFYA 4YN4A 3TFRA 1XC9A 8ICQA 4FHPA 3RJIA 1AROP 2F1HA 2AU0A 5KG6A 1XS9D 4KLUA 5DQIA 4ECSA 3B0XA 4RQ8A 5KFSA 4FH3A 3WFQE 3SV4A 4Q43A 3TQ1A 4F5RA 5DG8A 7ICUA 3RJHA 4QZDA 4NLKA 1KFTA 2W9MA 2BPGA 4DF8A 3TAQA 8ICFA 3AQKA 1JXEA 5J2DA 4F5NA 3PO5A 4B9SA 3LWLA 5L1LA 1ZQRA 2M9NA 3HPOA 3C5GA 1U47A 3RRHA 1QSSA 4M2YA 4MEYA 1Q79A 3OSNA 1V9PA 3JPNA 2Q66A 2R8IA 3OVAA 3RJKA 3BQTA 3JYYA 4UBCA 2I1QA 1ZQPA 2IHMA 2OWOA 4F4WA 8ICLA 5KFBA 4YD1A 1JN3A 4DSIA 5HNKA 2PBEA 4DSJA 2NRVA 3PW4A 4M9GA 1RPLA 1CEZA 4FS2A 4KN4A 2ZH8A 1NKEA 1BPZA 4EZ9A 4WC1A 2DRAA 4EBJA 2FLLA 2W9CB 3MR2A 1HUZA 1HUOA 2HHSA 4DOAA 5BPCA 4PGXA 3WFRE 4YG2A 5J2IA 3C1YA 1U48A 1ZYQA 1SKRA 2KFZA 1ZQIA 1KFSA 3PW7A 4ED8A 1UT8A 1NO5A 4NLNA 5HC9A 4B9NA 4RNMA 2HHXA 5KFTA 1VFGA 2ATLA 2ZTEA 1NKCA 9ICAA 2O1PA 5J0XA 4R8UB 2BCRA 3T5LA 4WCWA 2WTFA 5F9LA 3EYZA 9ICWA 4NXZA 2MUTB 4J9RA 1XWLA 3T5JA 5KFAA 5HRLA 4FHVA 4WC4A 2JZBA 3JPPA 2P6UA 4ECYA 2VA3A 4O5EA 5J0SA 4ECTA 2BE3A 5IIJA 3PX6A 3AQNA 2ZH4A 4P2HA 3K4GA 3MFIA 4X4SA 1BVSA 2JEIA 3HW8A 4I2BA 4KLTA 4R63A 1ZJMA 2BKEA 5BOLA 5DQGA 5DECA 4YMOA 4R64A 2BHNA 2P66A 3OJUA 4B9UA 2DR9A 2ZH1A 8ICCA 5J2AA 4I2CA 4RQ5A 3SYZA 7ICLA 5DGBA 5J0TA 4QWAA 4J9SA 4EYHB 4X4RA 2M2TA 3NGDA 4RZRA 5DB6A 4QWCA 4FHXA 4EP7A 4RPZA 4KLOA 4LZGA 1UEVA 4Q8EA 4WBYA 2H5XA 3IM1A 5KG2A 1KFDA 4I27A 4EEYA 1K1SA 3PW2A 5CA7A 3RBEA 4O3PA 3MBYA 2C28A 2ZUCA 1ZQZA 3H8SA 5KFWA 2BQUA 1U4BA 2IA6A 4AT8A 5J2HA 4TQSA 5IILA 2V9WA 2DR5A 1XSPA 4KLSA 4ATBB 9ICFA 4EBDA 4ED3A 5KG1A 1JIHA 3ZD8A 5CR0A 4PHPA 4F3OA 7ICHA 3ISCA 1TFWA 3LWMA 3AQLA 2FMQA 1RXWA 3MGHA 5DB8A 4PPXA 5KFIA 1JAJA 1QSLA 1XO1A 3C1ZA 3Q8RB 8ICYA 5KFUA 1IM4A 4DL4A 2ALZA 5L9XA 5KFDA 8ICPA 4DFJA 7ICPA 2ZUDA 3BQ0A 4C8OA 3K75D 4MF2A 4IR1A 3UQ0A 3BQ1A 4I2IA 2J6SA 2O5AA 3AUOA 2C22A 1Y88A 5KFNA 4QWDA 5DB9A 2DFLA 4BXOA 4F8RA 3L9DA 4XQ7A 3PMLA 3MFHA 5L1JA 3OSPA 8ICOA 2R8KA 3UXPA 4ED7A 4WC7A 4E7XA 4X5VA 3FDSA 1UA0A 3UQ2A 4FS1A 1ZQJA 2V4RA 3PR5B 5DBAA 2KZZA 1D8YA 3QEAZ 2ZH6A 4IQTA 4BXOB 4QW9A 1SKWA 3H37A 9ICMA 5DB7A 3HX0A 1MQ2A 5DLGA 4O3RA 4RNNA 4DF4A 2KZMA 9ICNA 5KFFA 4KLJA 4PGYA 3TANA 1A77A 2AGQA 2ASLA 2JEJA 1L5UA 5KTQA 3BDPA 2NRKA 9ICSA 1TFYA 3EW9A 3UPQA 4DO9A 1Z00B 4PGQA 3OJSA 4DL2A 1S9FA 8ICNA 4B9VA 4X4QA 3PNCA 4ECQA 4WC3A 5L1IA 4F4XA 1TK8A 2AQ4A 3RJEA 9ICGA 4I2DA 7ICSA 2W8KA 3Q8SB 4DSEA 2ASDA 4WC5A 1LB2B 1K1QA 2R8HA 1L3TA 4WC2A 4M9HA 5CJ7A 2VANA 2UVUA 4WC0A 2M2VA 4M04A 3RH6A 4AT8B 4DL3A 1QSYA 1ZQEA 2ID1A 4M5DA 2AQ0A 5KFOA 1H38A 5KFVA 1ZQVA 1MC8A 9ICVA 4ZH4A 2I9GA 5DG7A 2XY7A 4C8KA 3QZ7A 4O5CA 8ICIA 5J0RA 3Q8QB 3MR5A 1XSLA 3H40A 4P4OA 5D46A 4IQWA 4QZGA 9ICQA 3JZ0A 4K4HA 2W8LA 4ECXA 3GILA 2C2RA 3OUYB 3EPIA 5J2BA 4DS5A 4C8MA 2W9CA 4IQUA 1ZQFA 3RR8A 7ICJA 4RWOA 4QZIA 4KN7A 1TV9A 3RR7A 1RXVA 1QLNA 4WC6A 2ZH2A 4UBBA 4FBTA 3RB6A 4M47A 1ZQOA 4PHEA 4EBCA 3H39A 9ICUA 1XU4A 3PW0A 4J9OA 4R8UA 4UB4A 5KG4A 4UB1A 2XC9A 4FO6A 2XY6A 2MUTA 4XRHA 4PHDA 3GIJA 2ZH7A 3G6VA 4DQRA 2HHVA 3AU2A 4M6WA 7ICEA 4FHWA 4JWMA 1KLNA 5L1KA 4DLEA 1WCLA 5DEDA 3H7IA 5J2KA 5KFCA 3Q8PB 1SZPA 4X4UA 4P4PA 2PI5A 4UAZA 7ICMA 8ICRA 5IIOA 5KT2A 1L3VA 2HVIA 5DDYA 4KTQA 4YP3A 4BWJA 4F5OA 4UB5A 1ZQDA 4NY8A 5CP2A 2IMWP 3WFSC 4JK1A 5J29A 3RTVA 3GIMA 4QWBA 4ELVA 8ICUA 2VA8A 4M6WB 4RPYA 1ZETA 2V4QA 2XY5A 2Y1IA 1L3SA 1BPYA 1UETA 4NM2A 4J9QA 4WBZA 1ZJNA 2ZH9A 4DQSA 5J2FA 1MIWA 1TAUA 1WCNA 9ICLA 3PR4A 4YR0A 4GC6A 4NLZA 3GFKB 4HYKA 1U45A 4IRKA 5KG5A 2M2WA 4YCXA 5HRBA 7ICGA 4R65A 1F5AA 3PY8A 1ZQYA 4DL7A 4UQGA 4J9LA 5HRFA 4ED6A 3MDCA 3SZ2A 2R8JA 8ICEA 1RYRA 4GC7A 4BWMA 2FPLA 3SI8A 3ZDEA 3ISDA 5DGAA 2DR8A 3JPSA 4B9TA 4DLGA 8ICKA 4NKUA 4QZHA 1DGSA 2AGOA 2BCSA 1UEUA 3GIIA 2PFOA 4ATBA 4ECWA 4IQVA 3H8JA 3GV5B 4ED2A 4BGDA 3MR3A 1R8BA 4RUAA 4YR3A 4RQ2A 4QWEA 4O9MA 3UPSA 1NK9A 4YMMA 1S0NA 5KT4A 3JPTA 3C2LA 3JPRA 9ICCA 9ICIA 3HJ4A 2BCQA 2B21A 1ZQWA 2F1JA 1T3NA 7ICIA 3HWTA 3RB4A 1QTMA 4MFFA 4EBEA 4YXJA 9ICHA 4FH5A 5KFHA 2DPIA 2IBKA 3QE9Y 2ISOA 3RB0A 4FBUA 3M8SA 3N97B 1BPDA 4DQQA 7ICOA 3GDXA 4KLHA 3KHGA 1JXLA 3PMNA 4F92B 1LV5A 2P6RA 2BPFA 3OHBA 3GV7B 1S77D 1MSWD 1D9FA 4I28A 4KLEA 2KTQA 3B0YA 8ICHA 4KITB 1S76D 1DK2A 4IG8A 4MFCA 4ECRA 4RNOA 4UD5A 3QZ8A 4YFKA 4UB2A 4IRCA 4O3QA 4TQRA 2IHNA 2FPKA 3H3AA 4FHYA 1KTQA 4O0IA 3WFPA 1BNPA 5TZVA 4QZ9A 1NK0A 1SKSA 4GXIA 3IHQB 4QZEA 2JEFA 5EWGA 4RT2A 4LZDA 3BJYA 3N4MB 3RH5A 7ICFA 4DSFA 2RDIA 2C2DA 4IR9A 1D9DA 9ICXA 3EPGA 3V6HA 1RYSA 1Z00A 4QW8A 8ICWA 4XA5A 1B43A 4YVZA 2ZJ5A 8ICTA 2JEGA 2ISPA 5KFXA 5DKWA 4I2GA 2ZUBA 2XCPA 1NK4A 1NJZA 2ASJA 5DQHA 5KT6A 4YD2A 4I2EA 8ICZA 3GV8B 3UXNA 4IRDA 4KLGA 1EXNA 4ELUA 1ZQGA 2ZH5A 3RB3A 7ICTA 4KLDA 1Q78A 4RQ6A 4Q8FA 2XGQA 5F9NA 1ZQCA 4ECVA 1ZQMA 4XUSA 1JMSA 3QEBZ 5HREA 1XSNA 3V7JA 3C21A 2VA2A 2PFQA 5KFZA 4R66A 1U9LA 3BQ2A 4DOCA 4NM1A 1SL2A 4M0AA 5HR9A 3THVA 3ZDDA 2KFNA 9ICPA 2DR7A 9ICRA 4QZCA 3RJJA 4UAYA 1CUKA 5D49A 3JPQA 1UA1A 2J6UA 4KLQA 2HHWA 1YLQA 5HRKA 1T7PA 2MAXA 4DEZA 7ICRA 3ORYA 4J9KA 3M9OB 3V7KA 3V6KA 3OGUA 4CCHA 5J0QA 1A76A 4EZ6A
chains in the Genus database with same CATH superfamily
4K4IA 4JUZA 2PI4A 2EAPA 1KL9A 5AK6A 2Y1JA 5ALDA 2Y0SF 5ALZA 2BQRA 1RQNA 3WKEA 4YR2A 1TK0A 3M9MB 3UXOA 2WFAA 1OU5A 3RF9A 2HSZA 3A0BU 5AM1A 5J0UA 2HHUA 2EDUA 3LQCB 4MF8A 2WB1F 4C8NA 4C80A 2Q0ZX 3HILA 3CP8A 4JV2A 4Y2VA 1N2XA 3ZDCA 2W9BA 4RWPA 2NRZA 1OUQA 8ICVA 4C4RA 4O3NA 4O3OA 5J2GA 4IL6U 1WUDA 2LMRA 3KTQA 1UCVA 2YMLA 5KFJA 5D62A 2EH9A 3LVVA 1KBUA 2HCFA 1MQ3A 3K1RB 3NTUA 3HIYA 2F1IA 5AK4A 2NYVA 3HT3A 4X4OA 3VCBA 2ZHBA 2F3NA 1ZQTA 4GXKA 4J9MA 4F91B 5KT7A 4QZFA 2C2EA 1WOTA 2W9AA 1M6YA 8ICMA 1TKDA 2UVWA 2KIVA 2NO4A 5J0PA 1PZNA 4X4NA 2RFFA 4E0DA 4Z6FA 3BQ7A 2IOFK 4AT9B 2YY6A 4JV0A 3HP6A 2FI1A 8ICAA 1ZQHA 5J0OA 3EZ5A 2HBJA 5EWFA 3C5FA 3ZDAA 3ETLA 4K99A 3HKZC 4MEXA 4XQ8A 5J2EA 3MDAA 4B9MA 2QLTA 2ZTCA 5AI5A 5CEHA 4F4YA 4K4GA 1SGGA 4DQIA 2AH5A 2XICA 4XJEA 3NKUA 2WAQF 1ZQKA 5L1MA 2OXOA 1ZQ1C 2JXJA 2P35A 2HOFA 2AXTU 4FZMA 3RAQA 1PVQA 8ICGA 7ICNA 4Z6CA 1JX4A 2W7PA 4NL9A 5KG3A 2NRWA 4MFAA 2K60A 4O3SA 1Z3EB 2ZHAA 3OTQA 4RQ0A 2FMSA 3RRGA 3AQMA 4LVSA 4DFPA 1PK1B 5KFLA 3H38A 1R89A 3AEVA 2GA9D 2B0CA 8ICXA 5AIBA 3V6JA 5DBCA 4BX9C 4KLUA 4ECSA 3B0XA 3LVWA 4J03A 3TQ1A 4F5RA 5DG8A 4NLKA 2BPGA 3SMVA 3AQKA 2EQYA 2EZXA 4F5NA 5L1LA 2AHOB 2K8AA 4M2YA 5EE1A 3JPNA 3IRUA 3JYYA 3BQTA 3DEEA 1N61A 2B6GA 1ZQPA 2OWOA 4P0PB 5HNKA 3KD3A 4FS2A 2A3VA 1BPZA 4EBJA 4UATA 2XIDA 5BPCA 4PGXA 1ZYQA 3NRWA 3PW7A 1NO5A 2HHXA 3E58A 2ZTEA 5J0XA 2F77X 3T5LA 9ICWA 2VA3A 4O5EA 3WKBA 3AN1A 4KLTA 2BKEA 5DECA 1J2NA 4JLXA 5AICA 2BHNA 4B9UA 1SIJA 2WF5A 2ZIWA 4EYHB 3NGDA 4QWCA 4RPZA 4KLOA 4LZGA 5KG2A 2OM6A 3RBEA 1K1SA 4O68A 5CA7A 4O3PA 3MBYA 7ICRA 1LKYB 1ZQZA 3H8SA 4NXWA 2V9WA 4ATBB 2H3VA 4EBDA 7ICHA 2DGZA 2FMQA 3C1ZA 2ALZA 2Z7JA 5JRTA 7ICPA 3KKAC 2KMDA 4MF2A 2C22A 5EE9A 5KFNA 4F8RA 4UAUA 8ICOA 2W11A 4E7XA 3FDSA 2HBKA 2KZZA 5AKHA 9ICMA 4RNNA 4DF4A 4CRXA 2ASLA 1L5UA 2NRKA 3WK7A 2E8PA 4DO9A 3OJSA 4DL2A 4X4QA 4ECQA 1UQVA 5L1IA 3Q8SB 2VIXA 4WC2A 1LVHA 2VANA 3DDHA 3RH6A 3O0FA 3F5AA 2W54A 1H38A 9ICVA 3QZ7A 2G5HB 3Q8QB 3MR5A 3AMZA 4NXVA 3EPIA 5J2BA 4DS5A 4KN7A 2ZH2A 3RB6A 4K9AA 3M6KA 3SENA 4UB4A 2XY6A 3GZFA 3T79A 2WF8A 5L1KA 3H7IA 3MGVA 5AKGA 8ICRA 1S8OA 4NY8A 3WFSC 2IMWP 1ED1A 4U7CA 2EWRA 4ELVA 2ZIUA 8ICUA 4M6WB 1ZETA 4Y2XA 1TAUA 4YR0A 4NLZA 1F5SA 4HYKA 4IRKA 5HR6A 4C0ZA 4CDGA 4DL7A 5J8YC 8ICEA 4GC7A 1B4FA 2FPLA 2K8CB 3SI8A 3ZDEA 5DGAA 1N60A 2D8CA 4AYBF 1RM6C 4B9TA 2AGOA 1RQLA 3GIIA 3D2SA 2QB0A 2G08A 3RFAA 4WH5A 5ALTA 5KAFU 5AI0A 1NK9A 4YMMA 1S0NA 9ICCA 2BCQA 2B21A 3BZKA 5ALMA 3RB4A 2WHEA 1QTMA 4FH5A 3ICXA 3PSTA 3UPSA 3RB0A 4FBUA 1PK3A 3M8SA 3IG5A 4ACOA 5E79U 1JXLA 1UPHA 3OHBA 3GV7B 8ICHA 4IG8A 3B0YA 4RNOA 2ZXIA 3K7DA 3H3AA 4FHYA 3NVYA 1L6NA 5TZVA 2G0AA 2YB4A 2IUBA 1HIWA 4QZEA 5EWGA 1FFUA 3RH5A 3MC1A 5ALJA 1Z00A 2OYYA 1B43A 8ICTA 3SAHA 1NJZA 3OV7A 4YD2A 2FDRA 1XNSA 4KLGA 3UXNA 2H3ZA 4IRDA 1EXNA 4ELUA 8ICZA 1Q78A 2GO7A 3I1YA 1L7MA 4RQ6A 2XGQA 1ZQMA 4ECVA 5HREA 3HRDD 4BJQA 3BQ2A 1U9LA 5HR9A 4EGWA 4QZCA 4USAA 2HHWA 5D49A 4KLQA 2Y9UA 2MAXA 4DEZA 1N5WA 4J9KA 3V7KA 5J0QA 2W3RA 2RLTA 5ALWA 5KFGA 1TFRA 4OJ6A 2ZJ8A 2I6XA 2IHOA 3ER9B 5HMLA 1ZQAA 1A6SA 2W03A 5F2VO 2PXIA 3MGIA 2LM1A 1NZPA 1KSPA 4QJFB 2KIWA 2BR0A 2HBMA 2DVIA 5C0YA 4G3IA 5ALVA 5ALFA 5CWRA 1BPXA 3MR6A 2BQ3A 1O03A 1V4AA 1NZBA 4ECUA 2JRZA 4BDPA 4C8LA 2ZTDA 3H0RB 1NK5A 1JROA 2HHPA 4C7ZA 4YMNA 4LT6A 4UD4A 5J0YA 1HEKA 4EELA 4QZAA 4X0AA 3TAPA 3BS7A 3KZIU 4KX3A 4NKUA 4I2AA 2KP7A 3RBDA 4F71A 3AM9A 1SL0A 4F4ZA 3T3FA 1X2IA 1WWUA 4F2RA 3TI0A 4AT9A 2G07A 1DK3A 4Z6EA 5CB1A 3F53A 4DL6A 2YQEA 1BPEA 1L3UA 5KNIA 1ECWA 5AI8A 1GPJA 4O6AA 3ZI4A 2A1AA 1S0OA 1KEJA 3NYBA 4E80A 1C20A 5D61A 3LDAA 3QNMA 1ZQLA 4I29A 3GIKA 5D63A 3D2NA 2HDOA 4CF4A 1COOA 1ZRMA 1SL1A 1BPBA 1ZQXA 3C2MA 1NOMA 3OVSA 1ZQUA 3RJFA 4NJ8A 2FLPA 9ICBA 4F93B 2E1FA 1TAQA 2AGPA 4DSLA 4GLXA 4E8FA 2B51A 3WFOA 5DBBA 4MKPA 4KMOB 4DFKA 2HHQA 4NKTA 4KLIA 1WYGA 1IXRA 4ED1A 5AI6A 8ICJA 3JPOA 2DPJA 2G5IB 3ZDBA 2GAFD 4X4VA 3Q8MA 1NK8A 3PZPA 4ECZA 4B9LA 1SV0C 4QIWC 1ZQSA 4NXTA 1VJ7A 2PFNA 4JB3A 1Z4NA 3MABA 2W55A 2A1JB 5KFMA 4NV0A 4AT7A 4EV6A 2BDPA 4PL2A 4QZBA 4F5PA 2BPCA 4K97A 1KRPA 3QYPA 8ICQA 1QQ6A 2AU0A 2LM4A 4RQ8A 4FH3A 3WFQE 3SV4A 4U6PA 4S3NA 7ICUA 1KFTA 4K9BA 2W9MA 4P0PA 3QU4A 3PO5A 3LWLA 3ED5A 3OSNA 3OVAA 2ZIXB 2IHMA 4F4WA 8ICLA 2PBEA 4CNQA 4P0QB 2ZH8A 2B4VA 4WC1A 2E3TA 3BS5B 4YG2A 1SKRA 1ZQIA 3TADA 4B9NA 4HX0A 1NKCA 9ICAA 4R8UB 3EYZA 1WG8A 4NXZA 2MUTB 1JRPA 1XWLA 5HRLA 5KFAA 2DWQA 4MHVA 2YTUA 4WC4A 2JZBA 3JPPA 4ECYA 4ECTA 2BE3A 5IIJA 3PX6A 3FAHA 3SR6A 2W04A 5AKJA 3K4GA 4P2HA 4X4SA 1O08A 4N7RA 4R63A 4BUGA 1ZJMA 3PSFA 2P66A 1L7PA 4OO1J 3NVOA 1S5LU 3SYZA 7ICLA 1LKYA 5J0TA 2M2TA 2KV2A 2DQNB 4JMUA 2OHFA 1CRXA 4Q8EA 3L4PA 4I27A 4EEYA 3M1YA 2IA6A 2ZUCA 3F2BA 3QU5A 5KFWA 1K5OA 4AT8A 5J2HA 4TQSA 5IILA 4KLSA 3N7PD 3L5KA 1JIHA 5AI4A 5CR0A 4F3OA 3ISCA 3AQLA 4G9BA 2WF6A 3AQEA 5CFUA 2YB1A 1ZXIA 5CFSA 1FEZA 4PPXA 5AKXA 1XO1A 5ALEA 3Q8RB 5KFUA 1IM4A 2KOBA 4C8OA 3UQ0A 3AUOA 1Y88A 1KQQA 5DB9A 5L1JA 4ED7A 4X5VA 2LYBA 4FS1A 5K4LA 1ZQJA 2V4RA 4UASA 3PR5B 1D8YA 2ZH6A 3OWGA 4PZOA 1SKWA 1MQ2A 5DLGA 4O3RA 2KZMA 5KFFA 4KLJA 4PGYA 3TANA 1A77A 5KTQA 1TFYA 3UPQA 1S9FA 8ICNA 4B9VA 4OJ5A 3QU9A 4WOYA 2AQ4A 1VDVA 2MU2A 1L3TA 4M9HA 5CJ7A 2M2VA 5A0LA 5KAIU 4DL3A 1QSYA 4Y2PA 2ID1A 4C7YA 2K8BB 5KFOA 5KFVA 2LHTA 4ZH4A 5J8YA 4O5CA 4IQWA 4P4OA 3TKAA 5D46A 2F8KA 2W9CA 1TV9A 1SZHA 4UBBA 4OCZA 2I5HA 2FE9A 3H39A 5AM5A 9ICUA 1Z19A 1XU4A 5KG4A 3GIJA 5AM3A 3G6VA 4DQRA 4M6WA 3WK6A 4FHWA 2R18A 4JWMA 4DLEA 5AKIA 1WCLA 1Q3UA 1SZPA 2PI5A 2PMZC 5IIOA 2HVIA 1ZD5A 1ZQDA 4Y2UA 5CP2A 5ALYA 5J29A 3GIMA 3A0HU 1UETA 2Y1IA 1L3SA 2VJ5A 4WQLA 4DQSA 9ICLA 5HRBA 4CGZA 7ICGA 1JI7A 4R65A 1F5AA 5HRFA 2R8JA 1RYRA 4US9A 4DLGA 8ICKA 2JMGA 1DGSA 2F8LA 1ZOLA 3SAGA 2PFOA 4IQVA 3H8JA 3GV5B 4ED2A 3MR3A 3H0LB 1L7NA 2H3IA 5KT4A 4OAGA 9ICIA 3HWTA 9ICHA 4MFFA 4YXJA 3J81j 2DPIA 2IBKA 2ISOA 4IC9A 3N97B 7ICOA 2YN4A 4KLHA 3C28A 2P6RA 1COKA 1MSWD 1SWWA 4I28A 4CF3A 3UMCA 2MSNA 4IRCA 4TQRA 3R9KA 1N5XA 2XI9A 1BNPA 4QZ9A 3IHQB 4FE3A 3BJYA 4RT2A 2RDIA 2KG5A 2LPEA 2N1RA 8ICWA 3AL0B 4YVZA 2ISPA 5DKWA 2ZUBA 1OW5A 5F9NA 1JMSA 2VA2A 2PFQA 4DOCA 2DR7A 3ZDDA 2ZH5A 4RWOA 1CUKA 1IIPA 1TAMA 2GH1A 3H0MB 4K98A 3M9OB 3V6KA 3FC4A 4EZ6A 5AM4A 5GTHU 4KLFA 4I2FA 1MIYA 1DXSA 2ZIVB 1X9SA 3H4BA 2ZH3A 3GU3A 5DG9A 1T3QA 5ALNA 2BGWA 3NVVA 5KFPA 5KFQA 2Y0SC 4CF5A 1GO3F 1NI3A 2QARB 3PX0A 4FO1A 3IDWA 4X0BA 2R8GA 1PX5A 3KFUF 3M9NB 2DRBA 8ICSA 3AU6A 3OUYA 2KKVA 2KZ3A 4I0UA 4EX6A 4EBKA 5ALRA 2XVTA 2UVVA 4I2JA 4KX5A 3V72A 5DLFA 2CN1A 3T5HA 2WB1C 4JV1A 4NXXA 1X40A 3H8WA 4UAWA 4NL9C 4RWNA 5BOMA 2FPMA 5FP0A 3M8RA 4B6JA 3PV8A 1TK5A 3FYHA 1TE2A 3SD7A 2DL0A 2ZXHA 3TFSA 5AK3A 4GFJA 3ZD9A 5IINA 3IP4B 2FCLA 2DBYA 4Y2TA 1X9WA 2L5YA 1R8AA 1B22A 4Q45A 2OEHA 2FMPA 3C2KA 2J6TA 4OJLA 4RQ3A 5KL1B 3M6ZA 5ALXA 3CNHA 3RAXA 2KKPA 1SV0A 4UARA 5ALGA 2XO7A 1N56A 9ICEA 4RQ4A 4KLMA 1PUZA 1CI4A 3G6XA 3HKZF 5ALPA 3KHRA 2RDJA 5HRIA 4K8VA 3H8MA 4PH5A 4QZ8A 5EOZA 4Q44A 1NKBA 5KG7A 5EWEA 4I2HA 3D6JA 5KT3A 4WJ3B 5HRGA 4X4PA 2RP5A 5D4BA 2LYHA 5EE0A 4M9JA 2HVHA 3KHLA 4J9PA 1R8CA 5KFEA 3IG8A 5AKLA 1ZQQA 1UHUA 2YMQA 4ED0A 2CXYA 5KFRA 2KN7A 4EYIB 2A1JA 5F3XB 3S6JA 5JTIA 4TUSA 2DUYA 1S0MA 3RJGA 5CHGA 7ICQA 1YZ7A 5HHHA 1NJXA 5B3PA 1HJPA 1IG6A 2XGPA 3Q8LA 4RU9A 3Q8KA 4KLLA 4JWNA 4DOBA 2QB1A 2EAOA 4P4MA 5KFKA 5J2JA 1QH9A 4Z6DA 2G09A 5IIKA 1XC9A 4YN4A 3TFRA 4FHPA 3RJIA 1AROP 1XS9D 1V38A 1ZD4A 2GOLA 3PSPA 5KFSA 1X6JA 4Y2JA 4QZDA 4DF8A 8ICFA 4O67A 2LYAA 4EENA 2EZYA 1JXEA 1X9XA 5J2DA 2JH1A 2JHDA 4B9SA 1ZQRA 3HPOA 3C5GA 1U47A 3WK8A 4OAFA 1QSSA 2Q66A 3RJKA 2I1QA 3BS5A 4YD1A 4DSJA 2NRVA 4ZOHC 4M9GA 4OJPA 4AP9A 1CEZA 1NKEA 2HBLA 4OD0A 2FLLA 2KD1A 5AKZA 1HUOA 5B5EU 4DOAA 4Y2SA 2KFZA 3C1YA 1U48A 1KFSA 4US8A 4ED8A 5KFTA 2CPRA 2ATLA 1ZRNA 2BCRA 1Z1VA 2WTFA 5F9LA 4WCWA 4FHVA 2P6UA 3AQNA 4K96A 2ZH4A 5ALOA 3NUQA 3MFIA 1BVSA 5ALLA 3HW8A 4I2BA 2RRDA 1J2MA 5BOLA 1X6IA 5AKKA 1Z1BA 3OJUA 2DR9A 2ZH1A 4RQ5A 5DGBA 3NS1A 5ALSA 4LEYA 5DB6A 1SXEA 2KICA 2YX8A 4KB6A 4KM5A 1UEVA 5AKEA 5TISU 2H5XA 3IM1A 1KFDA 1L8LA 1SV4A 3PW2A 2PFPA 1YT3A 2BQUA 5ALUA 3SQIA 1Z4OA 1XSPA 9ICFA 5T14A 5AM0A 4ED3A 2QB0B 4PHPA 1ZD2P 2E5SA 5KFIA 1X66A 1JAJA 2VJ4A 8ICYA 5L9XA 5KFDA 5ALKA 3BQ0A 3ETRA 2J6SA 2JV3A 2HOIA 4QWDA 4OAHA 5EE3A 3L9DA 3MFHA 1MN8A 4CE6A 4WC7A 3UXPA 1UA0A 4UAVA 2KNJA 4NLCA 5DBAA 1PK1A 3QEAZ 4IQTA 1YZ6A 4BXOB 3H37A 2WF9A 3HX0A 5GTIU 3K1ZA 9ICNA 4UB6U 2AGQA 3BDPA 1P7DA 9ICSA 3EW9A 1Z00B 4PGQA 4WC3A 1TK8A 3RJEA 7ICSA 4WC5A 4DSEA 3QUCA 1K1QA 4PZNA 2UVUA 2HOQA 3N7SC 1ZQEA 4M5DA 2RHFA 4PL1A 1ZQVA 1MC8A 2XY7A 8ICIA 5J0RA 1XSLA 3H40A 4ECXA 4C8MA 1Q3VA 4IQUA 1ZQFA 3RR8A 2K4HA 3RR7A 1RXVA 1QLNA 4WC6A 2KJ5A 4FBTA 1PVRA 2Q4TA 4M47A 4PHEA 2E8OA 1B0XA 4ICAA 4J9OA 4FO6A 4FFDA 4OAIZ 3AU2A 1KLNA 1FO4A 5J2KA 5KFCA 3Q8PB 4X4UA 4P4PA 4DCCA 2KE7A 4KTQA 3WKCA 4BWJA 3KKAA 1KKXA 4JK1A 4QWBA 2VA8A 2V4QA 2XY5A 4QNLA 4NM2A 4J9QA 2ZH9A 1ZJNA 1WCNA 3F2DA 3PR4A 4GC6A 3GFKB 2YMMA 5KG5A 2KHQA 1VJ5A 2KVSA 1RG6A 3PY8A 1ZQYA 4UQGA 4J9LA 4ED6A 3ONNA 1RYUA 2DR8A 3JPSA 3KBBA 2W7OA 2BCSA 1UEUA 4ATBA 5B66U 4IS7A 3F5EA 1N62A 4AYBC 1R8BA 4BGDA 4RUAA 4YR3A 4O9MA 3WK9A 3CW2C 3C2LA 2H3QA 2F1JA 4EBEA 4DQQA 2ESEA 1F0MA 2F2AB 4Y2QA 4A8EA 3KHGA 1LV5A 1ZD3A 2BPFA 1S77D 2KTQA 1DK2A 4KLEA 1S76D 2KSOB 1DGJA 3QZ8A 1V85A 2IHNA 2FPKA 3WFPA 1KTQA 4NXUA 1SKSA 3NRZA 5ALQA 2JEFA 4DSFA 3EPGA 3V6HA 1RYSA 1X42A 5JU5A 2Y9TA 1RDFA 2VKQA 4I2GA 2XCPA 5DQHA 5KT6A 1ZQGA 3RB3A 4KLDA 4Q8FA 1QQ7A 2KJ9A 2F44A 3KZXA 4XUSA 3QEBZ 1XSNA 4NWIA 3C21A 4NM1A 2KFNA 1A0PA 3RJJA 4UAYA 2ZIVA 2J6UA 4OJOA 3ORYA 2E8NA 4CCHA 3SEIA 1A76A 5AHXA 2M0NA 2QARA 2ODGA 4RQ7A 3KHHA 3QX7A 1BGXT 3OHAA 3G6YA 1T8EA 3PW5A 3BZCA 4EX7A 5AKYA 3DV9A 1S97A 3QXGA 4M9LA 5IIIA 4M9NA 4KMUA 4AT7B 2BDUA 4Y2RA 4RQNA 1S10A 1KNYA 5JUMA 4F50A 7ICVA 5HHIA 3ISBA 4GXJA 2JGAA 5KT5A 2ZJAA 4RPXA 4GIBA 3B9JA 1DOQA 4DQPA 1NJWA 2NRXA 2HW3A 1OXJA 2HI0A 3TARA 8ICBA 2K4PA 1BNOA 5J2CA 2AJQA 1FA0A 3LK9A 5HP4A 4J9NA 2G06A 4DS4A 5J0WA 3T5KA 2NRTA 2W9BB 3E2EA 1WWVA 1S0VA 3EWAA 1ZQBA 9ICOA 3HJ1A 4RQ1A 2RQ5A 3E0FA 4RWQA 4DL5A 4F2SA 1NJYA 2OCEA 5C5JA 4FZNA 4RT3A 2OH2A 4EEDA 9ICKA 5HMMA 4DFMA 4YQWA 1NK6A 3VC8A 5HRDA 4X4TA 4YXMA 1N63A 4TURA 1X9MA 9ICJA 1NNLA 3WK5A 2JZBB 5IIMA 3LYSA 2M2UA 7ICKA 2W3SA 3V7LA 1D8LA 3PX4A 5DDMA 4PHAA 5G5GA 3SV3A 5KG0A 1SXDA 2EANA 3OVBA 1N48A 4UB3A 1KW4A 2BCVA 2MRLA 1TVAA 3H4DA 1UT5A 2CRXA 3C18A 4WQKA 1FFVA 3TADC 4O3MA 1PVPA 1ZQNA 4DWIA 1URJA 1RZTA 3RH4A 3PO4A 2FLNA 1AQ6A 4AT8B 4RUCA 2XCAA 1C7YA 2ES6A 4O69A 5HRHA 4TUPA 3GQCA 2HHTA 4F5QA 1JQRA 1JALA 3EUB2 2BCUA 3C23A 2BBHA 1U49A 2DKZA 3WKDA 4F4KA 3N28A 1NK7A 4NLGA 3PSIA 2KVCA 3NVWA 3PVXA 3C29A 3OPXA 3QU7A 2NO5A 4QIWF 3WU2U 1KDHA 2IOFA 1VLBA 2LKYA 4ELTA 1T4GA 4TUQA 9ICTA 4DSKA 5AK5A 3C66A 3QU2A 5HR7A 1KN5A 4RQMA 2LI6A 2EAMA 4O5KA 1MIVA 4JLZA 2UVRA 1XO0A 1SB3C 2GWSA 3WK4A 5KFYA 2F1HA 4UW9A 5KG6A 5DQIA 4Q43A 3RJHA 3KOOA 3TAQA 2ZG6A 2HN2A 2M9NA 3RRHA 4MEYA 1Q79A 1V9PA 2R8IA 3F2CA 4UBCA 3CRXA 2D6FC 5H2FU 5KFBA 3SAFA 1JN3A 4DSIA 3WKAA 3PW4A 1RPLA 4KN4A 4EZ9A 2DRAA 2W9CB 3MR2A 1HUZA 2WF7A 1F44A 2HHSA 2K4IA 3WFRE 5J2IA 4C4TA 1FIQA 2MA1A 4PJ0U 1UT8A 4NLNA 5HC9A 4RNMA 1VFGA 2O1PA 2D3DA 4J9RA 2PKEA 3T5JA 2KK0A 5J0SA 3IV6A 3CYMA 5KL8B 3QUBA 1L8OA 1T94A 2JEIA 4NLBA 5DQGA 4YMOA 4R64A 8ICCA 5J2AA 3TACB 4I2CA 3PHZA 2O6KA 4QWAA 4J9SA 4X4RA 4RZRA 4FHXA 4EP7A 4LEZA 2B56A 4WBYA 5AM2A 2ZIWB 2HMXA 2C28A 1U4BA 1JUDA 2K4EA 2DR5A 4LEVA 5KG1A 3ZD8A 1TFWA 3LWMA 5B3QA 3UM9A 1RXWA 3MGHA 2F76X 5DB8A 5AIAA 4FZLA 1QSLA 4DL4A 8ICPA 3ERCC 4DFJA 2ZUDA 4Y2YA 4F72A 3K75D 4IR1A 3NASA 4I2IA 3BQ1A 4C4SA 2O5AA 2DFLA 4BXOA 1D8BA 4XQ7A 3PMLA 5JTGA 4EEBA 3OSPA 4LEWA 2R8KA 2WAQC 3FM9A 3EF2A 3ER8C 3UQ2A 4QW9A 3HJEA 5DB7A 2E8MA 2JEJA 1Q8KA 2E1EA 3PNCA 5CFTA 2JH7A 4F4XA 3L3FX 9ICGA 4I2DA 2W8KA 2ASDA 1LB2B 2R8HA 2A19A 3QUTA 4WC0A 2NV3A 4M04A 2FJ6A 2AQ0A 2BBJA 2ZIXA 5CRXA 2I9GA 5DG7A 4C8KA 3JZ0A 4QZGA 9ICQA 4K4HA 4P0QA 2W8LA 2C2RA 3GILA 2JR5A 1QCKA 7ICJA 4QZIA 1DRGA 1ZQOA 4EBCA 3PW0A 4R8UA 4UB1A 2XC9A 1J97A 2MUTA 4XRHA 4PHDA 2ZH7A 2HHVA 2PMZF 5DEDA 2DKXA 7ICMA 3CK6A 4UAZA 5KT2A 1L3VA 5DDYA 4YP3A 4F5OA 4UB5A 3OUYB 3RTVA 3I28A 2LBOA 4RPYA 1BPYA 1MA7A 4HAIA 5ALIA 4WBZA 3QUQA 5J2FA 1MIWA 2BZFA 1U45A 2M2WA 4YCXA 2KHVA 2H3FA 2ZIUB 3MDCA 3SZ2A 1V97A 4BWMA 3ISDA 2YMPA 1L7OA 4QZHA 3U26A 4ECWA 3N7RC 4QWEA 4RQ2A 3UMBA 3JPTA 3JPRA 3HJ4A 1SWVA 1ZQWA 2KSOA 1T3NA 7ICIA 5KFHA 3QE9Y 1BPDA 1QQ5A 3GDXA 4LJXA 3PMNA 4F92B 1D9FA 2GLEA 4KITB 3AQFA 4MFCA 4ECRA 4UD5A 4YFKA 4UB2A 4O3QA 3D2QA 4O0IA 2W43A 1NK0A 2EZZA 4GXIA 5CHEA 4LZDA 7ICFA 3N4MB 2KJ8A 2C2DA 4IR9A 2K89A 1D9DA 9ICXA 3NVZA 4QW8A 4XA5A 4EEKA 2ZJ5A 2JEGA 5KFXA 3JCFA 1NK4A 3I76A 4I2EA 2ASJA 3M7DA 3GV8B 3UMGA 1IV8A 7ICTA 2HN1A 3IN5A 1ZQCA 3MCRA 3ALRA 3V7JA 1Q46A 5KFZA 4UB8U 4R66A 2IOHA 3NWIA 4DFDA 1SL2A 4M0AA 3THVA 9ICPA 2DF4B 9ICRA 1YLQA 1UA1A 2KEYA 3JPQA 5HRKA 1T7PA 5AI9A 3OGUA 5ALHA 2QKQA 7ICEA 5G5HA
chains in the Genus database with same CATH topology
4K4IA 4KLFA 4JUZA 4I2FA 1MIYA 2PI4A 4RQ7A 5KFGA 1TFRA 3KHHA 1X9SA 2Y1JA 2ZJ8A 3H4BA 1BGXT 2ZH3A 3OHAA 3G6YA 5HMLA 1T8EA 1ZQAA 5DG9A 3PW5A 2BGWA 1S97A 2BQRA 4M9LA 5KFPA 5IIIA 4YR2A 1TK0A 2PXIA 4KMUA 5KFQA 4M9NA 3MGIA 3M9MB 5F2VO 3PX0A 4AT7B 3UXOA 1NZPA 1KSPA 4X0BA 1S10A 2R8GA 1PX5A 1KNYA 2BR0A 1OU5A 3M9NB 5JUMA 2DRBA 8ICSA 5J0UA 4F50A 2DVIA 3AU6A 3OUYA 2KZ3A 2HHUA 7ICVA 4G3IA 5HHIA 3ISBA 3LQCB 4GXJA 4EBKA 4MF8A 5CWRA 4C8NA 2UVVA 2Q0ZX 4I2JA 1BPXA 3MR6A 5KT5A 3V72A 2BQ3A 5DLFA 4JV2A 2ZJAA 1V4AA 4RPXA 3T5HA 4JV1A 4ECUA 1DOQA 4DQPA 4BDPA 1NJWA 2NRXA 2W9BA 3ZDCA 3H8WA 4UAWA 2NRZA 2ZTDA 4C8LA 2HW3A 4RWPA 4RWNA 1NK5A 5BOMA 3TARA 2HHPA 8ICBA 2FPMA 8ICVA 4YMNA 1BNOA 5J2CA 3M8RA 4O3NA 2AJQA 3LK9A 1FA0A 3OV7A 3PV8A 5HP4A 4LT6A 4O3OA 3FYHA 5J2GA 5J0YA 1TK5A 4J9NA 4UD4A 4DS4A 5J0WA 3KTQA 4QZAA 3TFSA 3T5KA 2NRTA 3ZD9A 2W9BB 3E2EA 4X0AA 5IINA 5KFJA 1S0VA 3EWAA 3TAPA 1ZQBA 9ICOA 3HJ1A 4RQ1A 1MQ3A 1X9WA 4RWQA 4DL5A 4I2AA 3NTUA 4F2SA 3HIYA 2KP7A 2F1IA 5C5JA 3RBDA 4RT3A 1NJYA 1B22A 1R8AA 9ICKA 5HMMA 4Q45A 3HT3A 4DFMA 1SL0A 4YQWA 1NK6A 4X4OA 4F4ZA 3T3FA 2ZHBA 2FMPA 1X2IA 5HRDA 3C2KA 4X4TA 2J6TA 1ZQTA 4YXMA 4F2RA 4GXKA 4J9MA 4F91B 4RQ3A 3TI0A 4TURA 1X9MA 4AT9A 9ICJA 4Z6EA 1DK3A 5KT7A 4QZFA 2C2EA 1WOTA 5CB1A 2W9AA 8ICMA 2JZBB 5IIMA 1TKDA 2M2UA 2UVWA 3RAXA 7ICKA 4DL6A 5J0PA 3V7LA 1D8LA 1PZNA 1BPEA 4X4NA 2RFFA 4E0DA 4Z6FA 1L3UA 3PX4A 5DDMA 4PHAA 2XO7A 1N56A 9ICEA 4AT9B 4RQ4A 4JV0A 3HP6A 3SV3A 4KLMA 8ICAA 5KG0A 1ZQHA 1S0OA 5J0OA 1KEJA 3EZ5A 1N48A 4UB3A 5EWFA 3NYBA 4E80A 3OVBA 3LDAA 3G6XA 1ZQLA 4I29A 3GIKA 2BCVA 3KHRA 3C5FA 2RDJA 3ZDAA 5HRIA 3ETLA 1COOA 1SL1A 1TVAA 4PH5A 3H4DA 4QZ8A 1UT5A 5EOZA 4Q44A 1NKBA 3C18A 1BPBA 1ZQXA 5KG7A 3C2MA 5EWEA 4I2HA 4MEXA 1NOMA 5KT3A 4XQ8A 1ZQUA 1ZQNA 4DWIA 1RZTA 3OVSA 5J2EA 3RH4A 3MDAA 2FLNA 2ZTCA 2FLPA 3PO4A 3RJFA 4RUCA 4F4YA 4B9MA 4K4GA 9ICBA 5HRGA 5D4BA 4F93B 4X4PA 1TAQA 2LYHA 2XCAA 1C7YA 2AGPA 4DSLA 4M9JA 4GLXA 4E8FA 2HVHA 5HRHA 3KHLA 4DQIA 4J9PA 3WFOA 5DBBA 1R8CA 5KFEA 4TUPA 3GQCA 4F5QA 2HHTA 1JQRA 2BCUA 3C23A 1ZQKA 1U49A 4DFKA 1ZQQA 4F4KA 1NK7A 4NLGA 2HHQA 4ED0A 3RAQA 4KLIA 4NKTA 8ICGA 7ICNA 1IXRA 3PVXA 4Z6CA 5KFRA 4ED1A 2KN7A 1JX4A 4EYIB 8ICJA 5KG3A 1KDHA 3JPOA 2A1JA 2NRWA 2DPJA 4MFAA 2PFPA 3ZDBA 4X4VA 4O3SA 4ELTA 1Z3EB 1T4GA 3Q8MA 1NK8A 2ZHAA 4RQ0A 4TUQA 4ECZA 4B9LA 9ICTA 4TUSA 1S0MA 2FMSA 3RJGA 5CHGA 1ZQSA 3RRGA 4DSKA 4S3NA 7ICQA 1VJ7A 2PFNA 3AQMA 3C66A 5HHHA 4LVSA 1NJXA 1HJPA 4DFPA 2XGPA 3MABA 4RU9A 3Q8LA 3Q8KA 4KLLA 2A1JB 4JWNA 5KFMA 4O5KA 5KFLA 4DOBA 1MIVA 3H38A 4AT7A 4P4MA 1R89A 5KFKA 5J2JA 2BDPA 2UVRA 4QZBA 4Z6DA 4F5PA 2BPCA 2GWSA 8ICXA 3V6JA 5DBCA 1KRPA 5IIKA 5KFYA 4YN4A 3TFRA 1XC9A 8ICQA 4FHPA 3RJIA 1AROP 2F1HA 2AU0A 5KG6A 1XS9D 4KLUA 5DQIA 4ECSA 3B0XA 4RQ8A 5KFSA 4FH3A 3WFQE 3SV4A 4Q43A 3TQ1A 4F5RA 5DG8A 7ICUA 3RJHA 4QZDA 4NLKA 1KFTA 2W9MA 2BPGA 4DF8A 3TAQA 8ICFA 3AQKA 1JXEA 5J2DA 4F5NA 3PO5A 4B9SA 3LWLA 5L1LA 1ZQRA 2M9NA 3HPOA 3C5GA 1U47A 3RRHA 1QSSA 4M2YA 4MEYA 1Q79A 3OSNA 1V9PA 3JPNA 2Q66A 2R8IA 3OVAA 3RJKA 3BQTA 3JYYA 4UBCA 2I1QA 1ZQPA 2IHMA 2OWOA 4F4WA 8ICLA 5KFBA 4YD1A 1JN3A 4DSIA 5HNKA 2PBEA 4DSJA 2NRVA 3PW4A 4M9GA 1RPLA 1CEZA 4FS2A 4KN4A 2ZH8A 1NKEA 1BPZA 4EZ9A 4WC1A 2DRAA 4EBJA 2FLLA 2W9CB 3MR2A 1HUZA 1HUOA 2HHSA 4DOAA 5BPCA 4PGXA 3WFRE 4YG2A 5J2IA 3C1YA 1U48A 1ZYQA 1SKRA 2KFZA 1ZQIA 1KFSA 3PW7A 4ED8A 1UT8A 1NO5A 4NLNA 5HC9A 4B9NA 4RNMA 2HHXA 5KFTA 1VFGA 2ATLA 2ZTEA 1NKCA 9ICAA 2O1PA 5J0XA 4R8UB 2BCRA 3T5LA 4WCWA 2WTFA 5F9LA 3EYZA 9ICWA 4NXZA 2MUTB 4J9RA 1XWLA 3T5JA 5KFAA 5HRLA 4FHVA 4WC4A 2JZBA 3JPPA 2P6UA 4ECYA 2VA3A 4O5EA 5J0SA 4ECTA 2BE3A 5IIJA 3PX6A 3AQNA 2ZH4A 4P2HA 3K4GA 3MFIA 4X4SA 1BVSA 2JEIA 3HW8A 4I2BA 4KLTA 4R63A 1ZJMA 2BKEA 5BOLA 5DQGA 5DECA 4YMOA 4R64A 2BHNA 2P66A 3OJUA 4B9UA 2DR9A 2ZH1A 8ICCA 5J2AA 4I2CA 4RQ5A 3SYZA 7ICLA 5DGBA 5J0TA 4QWAA 4J9SA 4EYHB 4X4RA 2M2TA 3NGDA 4RZRA 5DB6A 4QWCA 4FHXA 4EP7A 4RPZA 4KLOA 4LZGA 1UEVA 4Q8EA 4WBYA 2H5XA 3IM1A 5KG2A 1KFDA 4I27A 4EEYA 1K1SA 3PW2A 5CA7A 3RBEA 4O3PA 3MBYA 2C28A 2ZUCA 1ZQZA 3H8SA 5KFWA 2BQUA 1U4BA 2IA6A 4AT8A 5J2HA 4TQSA 5IILA 2V9WA 2DR5A 1XSPA 4KLSA 4ATBB 9ICFA 4EBDA 4ED3A 5KG1A 1JIHA 3ZD8A 5CR0A 4PHPA 4F3OA 7ICHA 3ISCA 1TFWA 3LWMA 3AQLA 2FMQA 1RXWA 3MGHA 5DB8A 4PPXA 5KFIA 1JAJA 1QSLA 1XO1A 3C1ZA 3Q8RB 8ICYA 5KFUA 1IM4A 4DL4A 2ALZA 5L9XA 5KFDA 8ICPA 4DFJA 7ICPA 2ZUDA 3BQ0A 4C8OA 3K75D 4MF2A 4IR1A 3UQ0A 3BQ1A 4I2IA 2J6SA 2O5AA 3AUOA 2C22A 1Y88A 5KFNA 4QWDA 5DB9A 2DFLA 4BXOA 4F8RA 3L9DA 4XQ7A 3PMLA 3MFHA 5L1JA 3OSPA 8ICOA 2R8KA 3UXPA 4ED7A 4WC7A 4E7XA 4X5VA 3FDSA 1UA0A 3UQ2A 4FS1A 1ZQJA 2V4RA 3PR5B 5DBAA 2KZZA 1D8YA 3QEAZ 2ZH6A 4IQTA 4BXOB 4QW9A 1SKWA 3H37A 9ICMA 5DB7A 3HX0A 1MQ2A 5DLGA 4O3RA 4RNNA 4DF4A 2KZMA 9ICNA 5KFFA 4KLJA 4PGYA 3TANA 1A77A 2AGQA 2ASLA 2JEJA 1L5UA 5KTQA 3BDPA 2NRKA 9ICSA 1TFYA 3EW9A 3UPQA 4DO9A 1Z00B 4PGQA 3OJSA 4DL2A 1S9FA 8ICNA 4B9VA 4X4QA 3PNCA 4ECQA 4WC3A 5L1IA 4F4XA 1TK8A 2AQ4A 3RJEA 9ICGA 4I2DA 7ICSA 2W8KA 3Q8SB 4DSEA 2ASDA 4WC5A 1LB2B 1K1QA 2R8HA 1L3TA 4WC2A 4M9HA 5CJ7A 2VANA 2UVUA 4WC0A 2M2VA 4M04A 3RH6A 4AT8B 4DL3A 1QSYA 1ZQEA 2ID1A 4M5DA 2AQ0A 5KFOA 1H38A 5KFVA 1ZQVA 1MC8A 9ICVA 4ZH4A 2I9GA 5DG7A 2XY7A 4C8KA 3QZ7A 4O5CA 8ICIA 5J0RA 3Q8QB 3MR5A 1XSLA 3H40A 4P4OA 5D46A 4IQWA 4QZGA 9ICQA 3JZ0A 4K4HA 2W8LA 4ECXA 3GILA 2C2RA 3OUYB 3EPIA 5J2BA 4DS5A 4C8MA 2W9CA 4IQUA 1ZQFA 3RR8A 7ICJA 4RWOA 4QZIA 4KN7A 1TV9A 3RR7A 1RXVA 1QLNA 4WC6A 2ZH2A 4UBBA 4FBTA 3RB6A 4M47A 1ZQOA 4PHEA 4EBCA 3H39A 9ICUA 1XU4A 3PW0A 4J9OA 4R8UA 4UB4A 5KG4A 4UB1A 2XC9A 4FO6A 2XY6A 2MUTA 4XRHA 4PHDA 3GIJA 2ZH7A 3G6VA 4DQRA 2HHVA 3AU2A 4M6WA 7ICEA 4FHWA 4JWMA 1KLNA 5L1KA 4DLEA 1WCLA 5DEDA 3H7IA 5J2KA 5KFCA 3Q8PB 1SZPA 4X4UA 4P4PA 2PI5A 4UAZA 7ICMA 8ICRA 5IIOA 5KT2A 1L3VA 2HVIA 5DDYA 4KTQA 4YP3A 4BWJA 4F5OA 4UB5A 1ZQDA 4NY8A 5CP2A 2IMWP 3WFSC 4JK1A 5J29A 3RTVA 3GIMA 4QWBA 4ELVA 8ICUA 2VA8A 4M6WB 4RPYA 1ZETA 2V4QA 2XY5A 2Y1IA 1L3SA 1BPYA 1UETA 4NM2A 4J9QA 4WBZA 1ZJNA 2ZH9A 4DQSA 5J2FA 1MIWA 1TAUA 1WCNA 9ICLA 3PR4A 4YR0A 4GC6A 4NLZA 3GFKB 4HYKA 1U45A 4IRKA 5KG5A 2M2WA 4YCXA 5HRBA 7ICGA 4R65A 1F5AA 3PY8A 1ZQYA 4DL7A 4UQGA 4J9LA 5HRFA 4ED6A 3MDCA 3SZ2A 2R8JA 8ICEA 1RYRA 4GC7A 4BWMA 2FPLA 3SI8A 3ZDEA 3ISDA 5DGAA 2DR8A 3JPSA 4B9TA 4DLGA 8ICKA 4NKUA 4QZHA 1DGSA 2AGOA 2BCSA 1UEUA 3GIIA 2PFOA 4ATBA 4ECWA 4IQVA 3H8JA 3GV5B 4ED2A 4BGDA 3MR3A 1R8BA 4RUAA 4YR3A 4RQ2A 4QWEA 4O9MA 3UPSA 1NK9A 4YMMA 1S0NA 5KT4A 3JPTA 3C2LA 3JPRA 9ICCA 9ICIA 3HJ4A 2BCQA 2B21A 1ZQWA 2F1JA 1T3NA 7ICIA 3HWTA 3RB4A 1QTMA 4MFFA 4EBEA 4YXJA 9ICHA 4FH5A 5KFHA 2DPIA 2IBKA 3QE9Y 2ISOA 3RB0A 4FBUA 3M8SA 3N97B 1BPDA 4DQQA 7ICOA 3GDXA 4KLHA 3KHGA 1JXLA 3PMNA 4F92B 1LV5A 2P6RA 2BPFA 3OHBA 3GV7B 1S77D 1MSWD 1D9FA 4I28A 4KLEA 2KTQA 3B0YA 8ICHA 4KITB 1S76D 1DK2A 4IG8A 4MFCA 4ECRA 4RNOA 4UD5A 3QZ8A 4YFKA 4UB2A 4IRCA 4O3QA 4TQRA 2IHNA 2FPKA 3H3AA 4FHYA 1KTQA 4O0IA 3WFPA 1BNPA 5TZVA 4QZ9A 1NK0A 1SKSA 4GXIA 3IHQB 4QZEA 2JEFA 5EWGA 4RT2A 4LZDA 3BJYA 3N4MB 3RH5A 7ICFA 4DSFA 2RDIA 2C2DA 4IR9A 1D9DA 9ICXA 3EPGA 3V6HA 1RYSA 1Z00A 4QW8A 8ICWA 4XA5A 1B43A 4YVZA 2ZJ5A 8ICTA 2JEGA 2ISPA 5KFXA 5DKWA 4I2GA 2ZUBA 2XCPA 1NK4A 1NJZA 2ASJA 5DQHA 5KT6A 4YD2A 4I2EA 8ICZA 3GV8B 3UXNA 4IRDA 4KLGA 1EXNA 4ELUA 1ZQGA 2ZH5A 3RB3A 7ICTA 4KLDA 1Q78A 4RQ6A 4Q8FA 2XGQA 5F9NA 1ZQCA 4ECVA 1ZQMA 4XUSA 1JMSA 3QEBZ 5HREA 1XSNA 3V7JA 3C21A 2VA2A 2PFQA 5KFZA 4R66A 1U9LA 3BQ2A 4DOCA 4NM1A 1SL2A 4M0AA 5HR9A 3THVA 3ZDDA 2KFNA 9ICPA 2DR7A 9ICRA 4QZCA 3RJJA 4UAYA 1CUKA 5D49A 3JPQA 1UA1A 2J6UA 4KLQA 2HHWA 1YLQA 5HRKA 1T7PA 2MAXA 4DEZA 7ICRA 3ORYA 4J9KA 3M9OB 3V7KA 3V6KA 3OGUA 4CCHA 5J0QA 1A76A 4EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K4I A;  4KLF A;  4JUZ A;  4I2F A;  1MIY A;  2PI4 A;  4RQ7 A;  5KFG A;  1TFR A;  3KHH A;  1X9S A;  2Y1J A;  2ZJ8 A;  3H4B A;  1BGX T;  2ZH3 A;  3OHA A;  3G6Y A;  5HML A;  1T8E A;  1ZQA A;  5DG9 A;  3PW5 A;  2BGW A;  1S97 A;  2BQR A;  4M9L A;  5KFP A;  5III A;  4YR2 A;  1TK0 A;  2PXI A;  4KMU A;  5KFQ A;  4M9N A;  3MGI A;  3M9M B;  5F2V O;  3PX0 A;  4AT7 B;  3UXO A;  1NZP A;  1KSP A;  4X0B A;  1S10 A;  2R8G A;  1PX5 A;  1KNY A;  2BR0 A;  1OU5 A;  3M9N B;  5JUM A;  2DRB A;  8ICS A;  5J0U A;  4F50 A;  2DVI A;  3AU6 A;  3OUY A;  2KZ3 A;  2HHU A;  7ICV A;  4G3I A;  5HHI A;  3ISB A;  3LQC B;  4GXJ A;  4EBK A;  4MF8 A;  5CWR A;  4C8N A;  2UVV A;  2Q0Z X;  4I2J A;  1BPX A;  3MR6 A;  5KT5 A;  3V72 A;  2BQ3 A;  5DLF A;  4JV2 A;  2ZJA A;  1V4A A;  4RPX A;  3T5H A;  4JV1 A;  4ECU A;  1DOQ A;  4DQP A;  4BDP A;  1NJW A;  2NRX A;  2W9B A;  3ZDC A;  3H8W A;  4UAW A;  2NRZ A;  2ZTD A;  4C8L A;  2HW3 A;  4RWP A;  4RWN A;  1NK5 A;  5BOM A;  3TAR A;  2HHP A;  8ICB A;  2FPM A;  8ICV A;  4YMN A;  1BNO A;  5J2C A;  3M8R A;  4O3N A;  2AJQ A;  3LK9 A;  1FA0 A;  3OV7 A;  3PV8 A;  5HP4 A;  4LT6 A;  4O3O A;  3FYH A;  5J2G A;  5J0Y A;  1TK5 A;  4J9N A;  4UD4 A;  4DS4 A;  5J0W A;  3KTQ A;  4QZA A;  3TFS A;  3T5K A;  2NRT A;  3ZD9 A;  2W9B B;  3E2E A;  4X0A A;  5IIN A;  5KFJ A;  1S0V A;  3EWA A;  3TAP A;  1ZQB A;  9ICO A;  3HJ1 A;  4RQ1 A;  1MQ3 A;  1X9W A;  4RWQ A;  4DL5 A;  4I2A A;  3NTU A;  4F2S A;  3HIY A;  2KP7 A;  2F1I A;  5C5J A;  3RBD A;  4RT3 A;  1NJY A;  1B22 A;  1R8A A;  9ICK A;  5HMM A;  4Q45 A;  3HT3 A;  4DFM A;  1SL0 A;  4YQW A;  1NK6 A;  4X4O A;  4F4Z A;  3T3F A;  2ZHB A;  2FMP A;  1X2I A;  5HRD A;  3C2K A;  4X4T A;  2J6T A;  1ZQT A;  4YXM A;  4F2R A;  4GXK A;  4J9M A;  4F91 B;  4RQ3 A;  3TI0 A;  4TUR A;  1X9M A;  4AT9 A;  9ICJ A;  4Z6E A;  1DK3 A;  5KT7 A;  4QZF A;  2C2E A;  1WOT A;  5CB1 A;  2W9A A;  8ICM A;  2JZB B;  5IIM A;  1TKD A;  2M2U A;  2UVW A;  3RAX A;  7ICK A;  4DL6 A;  5J0P A;  3V7L A;  1D8L A;  1PZN A;  1BPE A;  4X4N A;  2RFF A;  4E0D A;  4Z6F A;  1L3U A;  3PX4 A;  5DDM A;  4PHA A;  2XO7 A;  1N56 A;  9ICE A;  4AT9 B;  4RQ4 A;  4JV0 A;  3HP6 A;  3SV3 A;  4KLM A;  8ICA A;  5KG0 A;  1ZQH A;  1S0O A;  5J0O A;  1KEJ A;  3EZ5 A;  1N48 A;  4UB3 A;  5EWF A;  3NYB A;  4E80 A;  3OVB A;  3LDA A;  3G6X A;  1ZQL A;  4I29 A;  3GIK A;  2BCV A;  3KHR A;  3C5F A;  2RDJ A;  3ZDA A;  5HRI A;  3ETL A;  1COO A;  1SL1 A;  1TVA A;  4PH5 A;  3H4D A;  4QZ8 A;  1UT5 A;  5EOZ A;  4Q44 A;  1NKB A;  3C18 A;  1BPB A;  1ZQX A;  5KG7 A;  3C2M A;  5EWE A;  4I2H A;  4MEX A;  1NOM A;  5KT3 A;  4XQ8 A;  1ZQU A;  1ZQN A;  4DWI A;  1RZT A;  3OVS A;  5J2E A;  3RH4 A;  3MDA A;  2FLN A;  2ZTC A;  2FLP A;  3PO4 A;  3RJF A;  4RUC A;  4F4Y A;  4B9M A;  4K4G A;  9ICB A;  5HRG A;  5D4B A;  4F93 B;  4X4P A;  1TAQ A;  2LYH A;  2XCA A;  1C7Y A;  2AGP A;  4DSL A;  4M9J A;  4GLX A;  4E8F A;  2HVH A;  5HRH A;  3KHL A;  4DQI A;  4J9P A;  3WFO A;  5DBB A;  1R8C A;  5KFE A;  4TUP A;  3GQC A;  4F5Q A;  2HHT A;  1JQR A;  2BCU A;  3C23 A;  1ZQK A;  1U49 A;  4DFK A;  1ZQQ A;  4F4K A;  1NK7 A;  4NLG A;  2HHQ A;  4ED0 A;  3RAQ A;  4KLI A;  4NKT A;  8ICG A;  7ICN A;  1IXR A;  3PVX A;  4Z6C A;  5KFR A;  4ED1 A;  2KN7 A;  1JX4 A;  4EYI B;  8ICJ A;  5KG3 A;  1KDH A;  3JPO A;  2A1J A;  2NRW A;  2DPJ A;  4MFA A;  2PFP A;  3ZDB A;  4X4V A;  4O3S A;  4ELT A;  1Z3E B;  1T4G A;  3Q8M A;  1NK8 A;  2ZHA A;  4RQ0 A;  4TUQ A;  4ECZ A;  4B9L A;  9ICT A;  4TUS A;  1S0M A;  2FMS A;  3RJG A;  5CHG A;  1ZQS A;  3RRG A;  4DSK A;  4S3N A;  7ICQ A;  1VJ7 A;  2PFN A;  3AQM A;  3C66 A;  5HHH A;  4LVS A;  1NJX A;  1HJP A;  4DFP A;  2XGP A;  3MAB A;  4RU9 A;  3Q8L A;  3Q8K A;  4KLL A;  2A1J B;  4JWN A;  5KFM A;  4O5K A;  5KFL A;  4DOB A;  1MIV A;  3H38 A;  4AT7 A;  4P4M A;  1R89 A;  5KFK A;  5J2J A;  2BDP A;  2UVR A;  4QZB A;  4Z6D A;  4F5P A;  2BPC A;  2GWS A;  8ICX A;  3V6J A;  5DBC A;  1KRP A;  5IIK A;  5KFY A;  4YN4 A;  3TFR A;  1XC9 A;  8ICQ A;  4FHP A;  3RJI A;  1ARO P;  2F1H A;  2AU0 A;  5KG6 A;  1XS9 D;  4KLU A;  5DQI A;  4ECS A;  3B0X A;  4RQ8 A;  5KFS A;  4FH3 A;  3WFQ E;  3SV4 A;  4Q43 A;  3TQ1 A;  4F5R A;  5DG8 A;  7ICU A;  3RJH A;  4QZD A;  4NLK A;  1KFT A;  2W9M A;  2BPG A;  4DF8 A;  3TAQ A;  8ICF A;  3AQK A;  1JXE A;  5J2D A;  4F5N A;  3PO5 A;  4B9S A;  3LWL A;  5L1L A;  1ZQR A;  2M9N A;  3HPO A;  3C5G A;  1U47 A;  3RRH A;  1QSS A;  4M2Y A;  4MEY A;  1Q79 A;  3OSN A;  1V9P A;  3JPN A;  2Q66 A;  2R8I A;  3OVA A;  3RJK A;  3BQT A;  3JYY A;  4UBC A;  2I1Q A;  1ZQP A;  2IHM A;  2OWO A;  4F4W A;  8ICL A;  5KFB A;  4YD1 A;  1JN3 A;  4DSI A;  5HNK A;  2PBE A;  4DSJ A;  2NRV A;  3PW4 A;  4M9G A;  1RPL A;  1CEZ A;  4FS2 A;  4KN4 A;  2ZH8 A;  1NKE A;  1BPZ A;  4EZ9 A;  4WC1 A;  2DRA A;  4EBJ A;  2FLL A;  2W9C B;  3MR2 A;  1HUZ A;  1HUO A;  2HHS A;  4DOA A;  5BPC A;  4PGX A;  3WFR E;  4YG2 A;  5J2I A;  3C1Y A;  1U48 A;  1ZYQ A;  1SKR A;  2KFZ A;  1ZQI A;  1KFS A;  3PW7 A;  4ED8 A;  1UT8 A;  1NO5 A;  4NLN A;  5HC9 A;  4B9N A;  4RNM A;  2HHX A;  5KFT A;  1VFG A;  2ATL A;  2ZTE A;  1NKC A;  9ICA A;  2O1P A;  5J0X A;  4R8U B;  2BCR A;  3T5L A;  4WCW A;  2WTF A;  5F9L A;  3EYZ A;  9ICW A;  4NXZ A;  2MUT B;  4J9R A;  1XWL A;  3T5J A;  5KFA A;  5HRL A;  4FHV A;  4WC4 A;  2JZB A;  3JPP A;  2P6U A;  4ECY A;  2VA3 A;  4O5E A;  5J0S A;  4ECT A;  2BE3 A;  5IIJ A;  3PX6 A;  3AQN A;  2ZH4 A;  4P2H A;  3K4G A;  3MFI A;  4X4S A;  1BVS A;  2JEI A;  3HW8 A;  4I2B A;  4KLT A;  4R63 A;  1ZJM A;  2BKE A;  5BOL A;  5DQG A;  5DEC A;  4YMO A;  4R64 A;  2BHN A;  2P66 A;  3OJU A;  4B9U A;  2DR9 A;  2ZH1 A;  8ICC A;  5J2A A;  4I2C A;  4RQ5 A;  3SYZ A;  7ICL A;  5DGB A;  5J0T A;  4QWA A;  4J9S A;  4EYH B;  4X4R A;  2M2T A;  3NGD A;  4RZR A;  5DB6 A;  4QWC A;  4FHX A;  4EP7 A;  4RPZ A;  4KLO A;  4LZG A;  1UEV A;  4Q8E A;  4WBY A;  2H5X A;  3IM1 A;  5KG2 A;  1KFD A;  4I27 A;  4EEY A;  1K1S A;  3PW2 A;  5CA7 A;  3RBE A;  4O3P A;  3MBY A;  2C28 A;  2ZUC A;  1ZQZ A;  3H8S A;  5KFW A;  2BQU A;  1U4B A;  2IA6 A;  4AT8 A;  5J2H A;  4TQS A;  5IIL A;  2V9W A;  2DR5 A;  1XSP A;  4KLS A;  4ATB B;  9ICF A;  4EBD A;  4ED3 A;  5KG1 A;  1JIH A;  3ZD8 A;  5CR0 A;  4PHP A;  4F3O A;  7ICH A;  3ISC A;  1TFW A;  3LWM A;  3AQL A;  2FMQ A;  1RXW A;  3MGH A;  5DB8 A;  4PPX A;  5KFI A;  1JAJ A;  1QSL A;  1XO1 A;  3C1Z A;  3Q8R B;  8ICY A;  5KFU A;  1IM4 A;  4DL4 A;  2ALZ A;  5L9X A;  5KFD A;  8ICP A;  4DFJ A;  7ICP A;  2ZUD A;  3BQ0 A;  4C8O A;  3K75 D;  4MF2 A;  4IR1 A;  3UQ0 A;  3BQ1 A;  4I2I A;  2J6S A;  2O5A A;  3AUO A;  2C22 A;  1Y88 A;  5KFN A;  4QWD A;  5DB9 A;  2DFL A;  4BXO A;  4F8R A;  3L9D A;  4XQ7 A;  3PML A;  3MFH A;  5L1J A;  3OSP A;  8ICO A;  2R8K A;  3UXP A;  4ED7 A;  4WC7 A;  4E7X A;  4X5V A;  3FDS A;  1UA0 A;  3UQ2 A;  4FS1 A;  1ZQJ A;  2V4R A;  3PR5 B;  5DBA A;  2KZZ A;  1D8Y A;  3QEA Z;  2ZH6 A;  4IQT A;  4BXO B;  4QW9 A;  1SKW A;  3H37 A;  9ICM A;  5DB7 A;  3HX0 A;  1MQ2 A;  5DLG A;  4O3R A;  4RNN A;  4DF4 A;  2KZM A;  9ICN A;  5KFF A;  4KLJ A;  4PGY A;  3TAN A;  1A77 A;  2AGQ A;  2ASL A;  2JEJ A;  1L5U A;  5KTQ A;  3BDP A;  2NRK A;  9ICS A;  1TFY A;  3EW9 A;  3UPQ A;  4DO9 A;  1Z00 B;  4PGQ A;  3OJS A;  4DL2 A;  1S9F A;  8ICN A;  4B9V A;  4X4Q A;  3PNC A;  4ECQ A;  4WC3 A;  5L1I A;  4F4X A;  1TK8 A;  2AQ4 A;  3RJE A;  9ICG A;  4I2D A;  7ICS A;  2W8K A;  3Q8S B;  4DSE A;  2ASD A;  4WC5 A;  1LB2 B;  1K1Q A;  2R8H A;  1L3T A;  4WC2 A;  4M9H A;  5CJ7 A;  2VAN A;  2UVU A;  4WC0 A;  2M2V A;  4M04 A;  3RH6 A;  4AT8 B;  4DL3 A;  1QSY A;  1ZQE A;  2ID1 A;  4M5D A;  2AQ0 A;  5KFO A;  1H38 A;  5KFV A;  1ZQV A;  1MC8 A;  9ICV A;  4ZH4 A;  2I9G A;  5DG7 A;  2XY7 A;  4C8K A;  3QZ7 A;  4O5C A;  8ICI A;  5J0R A;  3Q8Q B;  3MR5 A;  1XSL A;  3H40 A;  4P4O A;  5D46 A;  4IQW A;  4QZG A;  9ICQ A;  3JZ0 A;  4K4H A;  2W8L A;  4ECX A;  3GIL A;  2C2R A;  3OUY B;  3EPI A;  5J2B A;  4DS5 A;  4C8M A;  2W9C A;  4IQU A;  1ZQF A;  3RR8 A;  7ICJ A;  4RWO A;  4QZI A;  4KN7 A;  1TV9 A;  3RR7 A;  1RXV A;  1QLN A;  4WC6 A;  2ZH2 A;  4UBB A;  4FBT A;  3RB6 A;  4M47 A;  1ZQO A;  4PHE A;  4EBC A;  3H39 A;  9ICU A;  1XU4 A;  3PW0 A;  4J9O A;  4R8U A;  4UB4 A;  5KG4 A;  4UB1 A;  2XC9 A;  4FO6 A;  2XY6 A;  2MUT A;  4XRH A;  4PHD A;  3GIJ A;  2ZH7 A;  3G6V A;  4DQR A;  2HHV A;  3AU2 A;  4M6W A;  7ICE A;  4FHW A;  4JWM A;  1KLN A;  5L1K A;  4DLE A;  1WCL A;  5DED A;  3H7I A;  5J2K A;  5KFC A;  3Q8P B;  1SZP A;  4X4U A;  4P4P A;  2PI5 A;  4UAZ A;  7ICM A;  8ICR A;  5IIO A;  5KT2 A;  1L3V A;  2HVI A;  5DDY A;  4KTQ A;  4YP3 A;  4BWJ A;  4F5O A;  4UB5 A;  1ZQD A;  4NY8 A;  5CP2 A;  2IMW P;  3WFS C;  4JK1 A;  5J29 A;  3RTV A;  3GIM A;  4QWB A;  4ELV A;  8ICU A;  2VA8 A;  4M6W B;  4RPY A;  1ZET A;  2V4Q A;  2XY5 A;  2Y1I A;  1L3S A;  1BPY A;  1UET A;  4NM2 A;  4J9Q A;  4WBZ A;  1ZJN A;  2ZH9 A;  4DQS A;  5J2F A;  1MIW A;  1TAU A;  1WCN A;  9ICL A;  3PR4 A;  4YR0 A;  4GC6 A;  4NLZ A;  3GFK B;  4HYK A;  1U45 A;  4IRK A;  5KG5 A;  2M2W A;  4YCX A;  5HRB A;  7ICG A;  4R65 A;  1F5A A;  3PY8 A;  1ZQY A;  4DL7 A;  4UQG A;  4J9L A;  5HRF A;  4ED6 A;  3MDC A;  3SZ2 A;  2R8J A;  8ICE A;  1RYR A;  4GC7 A;  4BWM A;  2FPL A;  3SI8 A;  3ZDE A;  3ISD A;  5DGA A;  2DR8 A;  3JPS A;  4B9T A;  4DLG A;  8ICK A;  4NKU A;  4QZH A;  1DGS A;  2AGO A;  2BCS A;  1UEU A;  3GII A;  2PFO A;  4ATB A;  4ECW A;  4IQV A;  3H8J A;  3GV5 B;  4ED2 A;  4BGD A;  3MR3 A;  1R8B A;  4RUA A;  4YR3 A;  4RQ2 A;  4QWE A;  4O9M A;  3UPS A;  1NK9 A;  4YMM A;  1S0N A;  5KT4 A;  3JPT A;  3C2L A;  3JPR A;  9ICC A;  9ICI A;  3HJ4 A;  2BCQ A;  2B21 A;  1ZQW A;  2F1J A;  1T3N A;  7ICI A;  3HWT A;  3RB4 A;  1QTM A;  4MFF A;  4EBE A;  4YXJ A;  9ICH A;  4FH5 A;  5KFH A;  2DPI A;  2IBK A;  3QE9 Y;  2ISO A;  3RB0 A;  4FBU A;  3M8S A;  3N97 B;  1BPD A;  4DQQ A;  7ICO A;  3GDX A;  4KLH A;  3KHG A;  1JXL A;  3PMN A;  4F92 B;  1LV5 A;  2P6R A;  2BPF A;  3OHB A;  3GV7 B;  1S77 D;  1MSW D;  1D9F A;  4I28 A;  4KLE A;  2KTQ A;  3B0Y A;  8ICH A;  4KIT B;  1S76 D;  1DK2 A;  4IG8 A;  4MFC A;  4ECR A;  4RNO A;  4UD5 A;  3QZ8 A;  4YFK A;  4UB2 A;  4IRC A;  4O3Q A;  4TQR A;  2IHN A;  2FPK A;  3H3A A;  4FHY A;  1KTQ A;  4O0I A;  3WFP A;  1BNP A;  5TZV A;  4QZ9 A;  1NK0 A;  1SKS A;  4GXI A;  3IHQ B;  4QZE A;  2JEF A;  5EWG A;  4RT2 A;  4LZD A;  3BJY A;  3N4M B;  3RH5 A;  7ICF A;  4DSF A;  2RDI A;  2C2D A;  4IR9 A;  1D9D A;  9ICX A;  3EPG A;  3V6H A;  1RYS A;  1Z00 A;  4QW8 A;  8ICW A;  4XA5 A;  1B43 A;  4YVZ A;  2ZJ5 A;  8ICT A;  2JEG A;  2ISP A;  5KFX A;  5DKW A;  4I2G A;  2ZUB A;  2XCP A;  1NK4 A;  1NJZ A;  2ASJ A;  5DQH A;  5KT6 A;  4YD2 A;  4I2E A;  8ICZ A;  3GV8 B;  3UXN A;  4IRD A;  4KLG A;  1EXN A;  4ELU A;  1ZQG A;  2ZH5 A;  3RB3 A;  7ICT A;  4KLD A;  1Q78 A;  4RQ6 A;  4Q8F A;  2XGQ A;  5F9N A;  1ZQC A;  4ECV A;  1ZQM A;  4XUS A;  1JMS A;  3QEB Z;  5HRE A;  1XSN A;  3V7J A;  3C21 A;  2VA2 A;  2PFQ A;  5KFZ A;  4R66 A;  1U9L A;  3BQ2 A;  4DOC A;  4NM1 A;  1SL2 A;  4M0A A;  5HR9 A;  3THV A;  3ZDD A;  2KFN A;  9ICP A;  2DR7 A;  9ICR A;  4QZC A;  3RJJ A;  4UAY A;  1CUK A;  5D49 A;  3JPQ A;  1UA1 A;  2J6U A;  4KLQ A;  2HHW A;  1YLQ A;  5HRK A;  1T7P A;  2MAX A;  4DEZ A;  7ICR A;  3ORY A;  4J9K A;  3M9O B;  3V7K A;  3V6K A;  3OGU A;  4CCH A;  5J0Q A;  1A76 A;  4EZ6 A; 
#chains in the Genus database with same CATH topology
 4K4I A;  4JUZ A;  2PI4 A;  2EAP A;  1KL9 A;  5AK6 A;  2Y1J A;  5ALD A;  2Y0S F;  5ALZ A;  2BQR A;  1RQN A;  3WKE A;  4YR2 A;  1TK0 A;  3M9M B;  3UXO A;  2WFA A;  1OU5 A;  3RF9 A;  2HSZ A;  3A0B U;  5AM1 A;  5J0U A;  2HHU A;  2EDU A;  3LQC B;  4MF8 A;  2WB1 F;  4C8N A;  4C80 A;  2Q0Z X;  3HIL A;  3CP8 A;  4JV2 A;  4Y2V A;  1N2X A;  3ZDC A;  2W9B A;  4RWP A;  2NRZ A;  1OUQ A;  8ICV A;  4C4R A;  4O3N A;  4O3O A;  5J2G A;  4IL6 U;  1WUD A;  2LMR A;  3KTQ A;  1UCV A;  2YML A;  5KFJ A;  5D62 A;  2EH9 A;  3LVV A;  1KBU A;  2HCF A;  1MQ3 A;  3K1R B;  3NTU A;  3HIY A;  2F1I A;  5AK4 A;  2NYV A;  3HT3 A;  4X4O A;  3VCB A;  2ZHB A;  2F3N A;  1ZQT A;  4GXK A;  4J9M A;  4F91 B;  5KT7 A;  4QZF A;  2C2E A;  1WOT A;  2W9A A;  1M6Y A;  8ICM A;  1TKD A;  2UVW A;  2KIV A;  2NO4 A;  5J0P A;  1PZN A;  4X4N A;  2RFF A;  4E0D A;  4Z6F A;  3BQ7 A;  2IOF K;  4AT9 B;  2YY6 A;  4JV0 A;  3HP6 A;  2FI1 A;  8ICA A;  1ZQH A;  5J0O A;  3EZ5 A;  2HBJ A;  5EWF A;  3C5F A;  3ZDA A;  3ETL A;  4K99 A;  3HKZ C;  4MEX A;  4XQ8 A;  5J2E A;  3MDA A;  4B9M A;  2QLT A;  2ZTC A;  5AI5 A;  5CEH A;  4F4Y A;  4K4G A;  1SGG A;  4DQI A;  2AH5 A;  2XIC A;  4XJE A;  3NKU A;  2WAQ F;  1ZQK A;  5L1M A;  2OXO A;  1ZQ1 C;  2JXJ A;  2P35 A;  2HOF A;  2AXT U;  4FZM A;  3RAQ A;  1PVQ A;  8ICG A;  7ICN A;  4Z6C A;  1JX4 A;  2W7P A;  4NL9 A;  5KG3 A;  2NRW A;  4MFA A;  2K60 A;  4O3S A;  1Z3E B;  2ZHA A;  3OTQ A;  4RQ0 A;  2FMS A;  3RRG A;  3AQM A;  4LVS A;  4DFP A;  1PK1 B;  5KFL A;  3H38 A;  1R89 A;  3AEV A;  2GA9 D;  2B0C A;  8ICX A;  5AIB A;  3V6J A;  5DBC A;  4BX9 C;  4KLU A;  4ECS A;  3B0X A;  3LVW A;  4J03 A;  3TQ1 A;  4F5R A;  5DG8 A;  4NLK A;  2BPG A;  3SMV A;  3AQK A;  2EQY A;  2EZX A;  4F5N A;  5L1L A;  2AHO B;  2K8A A;  4M2Y A;  5EE1 A;  3JPN A;  3IRU A;  3JYY A;  3BQT A;  3DEE A;  1N61 A;  2B6G A;  1ZQP A;  2OWO A;  4P0P B;  5HNK A;  3KD3 A;  4FS2 A;  2A3V A;  1BPZ A;  4EBJ A;  4UAT A;  2XID A;  5BPC A;  4PGX A;  1ZYQ A;  3NRW A;  3PW7 A;  1NO5 A;  2HHX A;  3E58 A;  2ZTE A;  5J0X A;  2F77 X;  3T5L A;  9ICW A;  2VA3 A;  4O5E A;  3WKB A;  3AN1 A;  4KLT A;  2BKE A;  5DEC A;  1J2N A;  4JLX A;  5AIC A;  2BHN A;  4B9U A;  1SIJ A;  2WF5 A;  2ZIW A;  4EYH B;  3NGD A;  4QWC A;  4RPZ A;  4KLO A;  4LZG A;  5KG2 A;  2OM6 A;  3RBE A;  1K1S A;  4O68 A;  5CA7 A;  4O3P A;  3MBY A;  7ICR A;  1LKY B;  1ZQZ A;  3H8S A;  4NXW A;  2V9W A;  4ATB B;  2H3V A;  4EBD A;  7ICH A;  2DGZ A;  2FMQ A;  3C1Z A;  2ALZ A;  2Z7J A;  5JRT A;  7ICP A;  3KKA C;  2KMD A;  4MF2 A;  2C22 A;  5EE9 A;  5KFN A;  4F8R A;  4UAU A;  8ICO A;  2W11 A;  4E7X A;  3FDS A;  2HBK A;  2KZZ A;  5AKH A;  9ICM A;  4RNN A;  4DF4 A;  4CRX A;  2ASL A;  1L5U A;  2NRK A;  3WK7 A;  2E8P A;  4DO9 A;  3OJS A;  4DL2 A;  4X4Q A;  4ECQ A;  1UQV A;  5L1I A;  3Q8S B;  2VIX A;  4WC2 A;  1LVH A;  2VAN A;  3DDH A;  3RH6 A;  3O0F A;  3F5A A;  2W54 A;  1H38 A;  9ICV A;  3QZ7 A;  2G5H B;  3Q8Q B;  3MR5 A;  3AMZ A;  4NXV A;  3EPI A;  5J2B A;  4DS5 A;  4KN7 A;  2ZH2 A;  3RB6 A;  4K9A A;  3M6K A;  3SEN A;  4UB4 A;  2XY6 A;  3GZF A;  3T79 A;  2WF8 A;  5L1K A;  3H7I A;  3MGV A;  5AKG A;  8ICR A;  1S8O A;  4NY8 A;  3WFS C;  2IMW P;  1ED1 A;  4U7C A;  2EWR A;  4ELV A;  2ZIU A;  8ICU A;  4M6W B;  1ZET A;  4Y2X A;  1TAU A;  4YR0 A;  4NLZ A;  1F5S A;  4HYK A;  4IRK A;  5HR6 A;  4C0Z A;  4CDG A;  4DL7 A;  5J8Y C;  8ICE A;  4GC7 A;  1B4F A;  2FPL A;  2K8C B;  3SI8 A;  3ZDE A;  5DGA A;  1N60 A;  2D8C A;  4AYB F;  1RM6 C;  4B9T A;  2AGO A;  1RQL A;  3GII A;  3D2S A;  2QB0 A;  2G08 A;  3RFA A;  4WH5 A;  5ALT A;  5KAF U;  5AI0 A;  1NK9 A;  4YMM A;  1S0N A;  9ICC A;  2BCQ A;  2B21 A;  3BZK A;  5ALM A;  3RB4 A;  2WHE A;  1QTM A;  4FH5 A;  3ICX A;  3PST A;  3UPS A;  3RB0 A;  4FBU A;  1PK3 A;  3M8S A;  3IG5 A;  4ACO A;  5E79 U;  1JXL A;  1UPH A;  3OHB A;  3GV7 B;  8ICH A;  4IG8 A;  3B0Y A;  4RNO A;  2ZXI A;  3K7D A;  3H3A A;  4FHY A;  3NVY A;  1L6N A;  5TZV A;  2G0A A;  2YB4 A;  2IUB A;  1HIW A;  4QZE A;  5EWG A;  1FFU A;  3RH5 A;  3MC1 A;  5ALJ A;  1Z00 A;  2OYY A;  1B43 A;  8ICT A;  3SAH A;  1NJZ A;  3OV7 A;  4YD2 A;  2FDR A;  1XNS A;  4KLG A;  3UXN A;  2H3Z A;  4IRD A;  1EXN A;  4ELU A;  8ICZ A;  1Q78 A;  2GO7 A;  3I1Y A;  1L7M A;  4RQ6 A;  2XGQ A;  1ZQM A;  4ECV A;  5HRE A;  3HRD D;  4BJQ A;  3BQ2 A;  1U9L A;  5HR9 A;  4EGW A;  4QZC A;  4USA A;  2HHW A;  5D49 A;  4KLQ A;  2Y9U A;  2MAX A;  4DEZ A;  1N5W A;  4J9K A;  3V7K A;  5J0Q A;  2W3R A;  2RLT A;  5ALW A;  5KFG A;  1TFR A;  4OJ6 A;  2ZJ8 A;  2I6X A;  2IHO A;  3ER9 B;  5HML A;  1ZQA A;  1A6S A;  2W03 A;  5F2V O;  2PXI A;  3MGI A;  2LM1 A;  1NZP A;  1KSP A;  4QJF B;  2KIW A;  2BR0 A;  2HBM A;  2DVI A;  5C0Y A;  4G3I A;  5ALV A;  5ALF A;  5CWR A;  1BPX A;  3MR6 A;  2BQ3 A;  1O03 A;  1V4A A;  1NZB A;  4ECU A;  2JRZ A;  4BDP A;  4C8L A;  2ZTD A;  3H0R B;  1NK5 A;  1JRO A;  2HHP A;  4C7Z A;  4YMN A;  4LT6 A;  4UD4 A;  5J0Y A;  1HEK A;  4EEL A;  4QZA A;  4X0A A;  3TAP A;  3BS7 A;  3KZI U;  4KX3 A;  4NKU A;  4I2A A;  2KP7 A;  3RBD A;  4F71 A;  3AM9 A;  1SL0 A;  4F4Z A;  3T3F A;  1X2I A;  1WWU A;  4F2R A;  3TI0 A;  4AT9 A;  2G07 A;  1DK3 A;  4Z6E A;  5CB1 A;  3F53 A;  4DL6 A;  2YQE A;  1BPE A;  1L3U A;  5KNI A;  1ECW A;  5AI8 A;  1GPJ A;  4O6A A;  3ZI4 A;  2A1A A;  1S0O A;  1KEJ A;  3NYB A;  4E80 A;  1C20 A;  5D61 A;  3LDA A;  3QNM A;  1ZQL A;  4I29 A;  3GIK A;  5D63 A;  3D2N A;  2HDO A;  4CF4 A;  1COO A;  1ZRM A;  1SL1 A;  1BPB A;  1ZQX A;  3C2M A;  1NOM A;  3OVS A;  1ZQU A;  3RJF A;  4NJ8 A;  2FLP A;  9ICB A;  4F93 B;  2E1F A;  1TAQ A;  2AGP A;  4DSL A;  4GLX A;  4E8F A;  2B51 A;  3WFO A;  5DBB A;  4MKP A;  4KMO B;  4DFK A;  2HHQ A;  4NKT A;  4KLI A;  1WYG A;  1IXR A;  4ED1 A;  5AI6 A;  8ICJ A;  3JPO A;  2DPJ A;  2G5I B;  3ZDB A;  2GAF D;  4X4V A;  3Q8M A;  1NK8 A;  3PZP A;  4ECZ A;  4B9L A;  1SV0 C;  4QIW C;  1ZQS A;  4NXT A;  1VJ7 A;  2PFN A;  4JB3 A;  1Z4N A;  3MAB A;  2W55 A;  2A1J B;  5KFM A;  4NV0 A;  4AT7 A;  4EV6 A;  2BDP A;  4PL2 A;  4QZB A;  4F5P A;  2BPC A;  4K97 A;  1KRP A;  3QYP A;  8ICQ A;  1QQ6 A;  2AU0 A;  2LM4 A;  4RQ8 A;  4FH3 A;  3WFQ E;  3SV4 A;  4U6P A;  4S3N A;  7ICU A;  1KFT A;  4K9B A;  2W9M A;  4P0P A;  3QU4 A;  3PO5 A;  3LWL A;  3ED5 A;  3OSN A;  3OVA A;  2ZIX B;  2IHM A;  4F4W A;  8ICL A;  2PBE A;  4CNQ A;  4P0Q B;  2ZH8 A;  2B4V A;  4WC1 A;  2E3T A;  3BS5 B;  4YG2 A;  1SKR A;  1ZQI A;  3TAD A;  4B9N A;  4HX0 A;  1NKC A;  9ICA A;  4R8U B;  3EYZ A;  1WG8 A;  4NXZ A;  2MUT B;  1JRP A;  1XWL A;  5HRL A;  5KFA A;  2DWQ A;  4MHV A;  2YTU A;  4WC4 A;  2JZB A;  3JPP A;  4ECY A;  4ECT A;  2BE3 A;  5IIJ A;  3PX6 A;  3FAH A;  3SR6 A;  2W04 A;  5AKJ A;  3K4G A;  4P2H A;  4X4S A;  1O08 A;  4N7R A;  4R63 A;  4BUG A;  1ZJM A;  3PSF A;  2P66 A;  1L7P A;  4OO1 J;  3NVO A;  1S5L U;  3SYZ A;  7ICL A;  1LKY A;  5J0T A;  2M2T A;  2KV2 A;  2DQN B;  4JMU A;  2OHF A;  1CRX A;  4Q8E A;  3L4P A;  4I27 A;  4EEY A;  3M1Y A;  2IA6 A;  2ZUC A;  3F2B A;  3QU5 A;  5KFW A;  1K5O A;  4AT8 A;  5J2H A;  4TQS A;  5IIL A;  4KLS A;  3N7P D;  3L5K A;  1JIH A;  5AI4 A;  5CR0 A;  4F3O A;  3ISC A;  3AQL A;  4G9B A;  2WF6 A;  3AQE A;  5CFU A;  2YB1 A;  1ZXI A;  5CFS A;  1FEZ A;  4PPX A;  5AKX A;  1XO1 A;  5ALE A;  3Q8R B;  5KFU A;  1IM4 A;  2KOB A;  4C8O A;  3UQ0 A;  3AUO A;  1Y88 A;  1KQQ A;  5DB9 A;  5L1J A;  4ED7 A;  4X5V A;  2LYB A;  4FS1 A;  5K4L A;  1ZQJ A;  2V4R A;  4UAS A;  3PR5 B;  1D8Y A;  2ZH6 A;  3OWG A;  4PZO A;  1SKW A;  1MQ2 A;  5DLG A;  4O3R A;  2KZM A;  5KFF A;  4KLJ A;  4PGY A;  3TAN A;  1A77 A;  5KTQ A;  1TFY A;  3UPQ A;  1S9F A;  8ICN A;  4B9V A;  4OJ5 A;  3QU9 A;  4WOY A;  2AQ4 A;  1VDV A;  2MU2 A;  1L3T A;  4M9H A;  5CJ7 A;  2M2V A;  5A0L A;  5KAI U;  4DL3 A;  1QSY A;  4Y2P A;  2ID1 A;  4C7Y A;  2K8B B;  5KFO A;  5KFV A;  2LHT A;  4ZH4 A;  5J8Y A;  4O5C A;  4IQW A;  4P4O A;  3TKA A;  5D46 A;  2F8K A;  2W9C A;  1TV9 A;  1SZH A;  4UBB A;  4OCZ A;  2I5H A;  2FE9 A;  3H39 A;  5AM5 A;  9ICU A;  1Z19 A;  1XU4 A;  5KG4 A;  3GIJ A;  5AM3 A;  3G6V A;  4DQR A;  4M6W A;  3WK6 A;  4FHW A;  2R18 A;  4JWM A;  4DLE A;  5AKI A;  1WCL A;  1Q3U A;  1SZP A;  2PI5 A;  2PMZ C;  5IIO A;  2HVI A;  1ZD5 A;  1ZQD A;  4Y2U A;  5CP2 A;  5ALY A;  5J29 A;  3GIM A;  3A0H U;  1UET A;  2Y1I A;  1L3S A;  2VJ5 A;  4WQL A;  4DQS A;  9ICL A;  5HRB A;  4CGZ A;  7ICG A;  1JI7 A;  4R65 A;  1F5A A;  5HRF A;  2R8J A;  1RYR A;  4US9 A;  4DLG A;  8ICK A;  2JMG A;  1DGS A;  2F8L A;  1ZOL A;  3SAG A;  2PFO A;  4IQV A;  3H8J A;  3GV5 B;  4ED2 A;  3MR3 A;  3H0L B;  1L7N A;  2H3I A;  5KT4 A;  4OAG A;  9ICI A;  3HWT A;  9ICH A;  4MFF A;  4YXJ A;  3J81 j;  2DPI A;  2IBK A;  2ISO A;  4IC9 A;  3N97 B;  7ICO A;  2YN4 A;  4KLH A;  3C28 A;  2P6R A;  1COK A;  1MSW D;  1SWW A;  4I28 A;  4CF3 A;  3UMC A;  2MSN A;  4IRC A;  4TQR A;  3R9K A;  1N5X A;  2XI9 A;  1BNP A;  4QZ9 A;  3IHQ B;  4FE3 A;  3BJY A;  4RT2 A;  2RDI A;  2KG5 A;  2LPE A;  2N1R A;  8ICW A;  3AL0 B;  4YVZ A;  2ISP A;  5DKW A;  2ZUB A;  1OW5 A;  5F9N A;  1JMS A;  2VA2 A;  2PFQ A;  4DOC A;  2DR7 A;  3ZDD A;  2ZH5 A;  4RWO A;  1CUK A;  1IIP A;  1TAM A;  2GH1 A;  3H0M B;  4K98 A;  3M9O B;  3V6K A;  3FC4 A;  4EZ6 A;  5AM4 A;  5GTH U;  4KLF A;  4I2F A;  1MIY A;  1DXS A;  2ZIV B;  1X9S A;  3H4B A;  2ZH3 A;  3GU3 A;  5DG9 A;  1T3Q A;  5ALN A;  2BGW A;  3NVV A;  5KFP A;  5KFQ A;  2Y0S C;  4CF5 A;  1GO3 F;  1NI3 A;  2QAR B;  3PX0 A;  4FO1 A;  3IDW A;  4X0B A;  2R8G A;  1PX5 A;  3KFU F;  3M9N B;  2DRB A;  8ICS A;  3AU6 A;  3OUY A;  2KKV A;  2KZ3 A;  4I0U A;  4EX6 A;  4EBK A;  5ALR A;  2XVT A;  2UVV A;  4I2J A;  4KX5 A;  3V72 A;  5DLF A;  2CN1 A;  3T5H A;  2WB1 C;  4JV1 A;  4NXX A;  1X40 A;  3H8W A;  4UAW A;  4NL9 C;  4RWN A;  5BOM A;  2FPM A;  5FP0 A;  3M8R A;  4B6J A;  3PV8 A;  1TK5 A;  3FYH A;  1TE2 A;  3SD7 A;  2DL0 A;  2ZXH A;  3TFS A;  5AK3 A;  4GFJ A;  3ZD9 A;  5IIN A;  3IP4 B;  2FCL A;  2DBY A;  4Y2T A;  1X9W A;  2L5Y A;  1R8A A;  1B22 A;  4Q45 A;  2OEH A;  2FMP A;  3C2K A;  2J6T A;  4OJL A;  4RQ3 A;  5KL1 B;  3M6Z A;  5ALX A;  3CNH A;  3RAX A;  2KKP A;  1SV0 A;  4UAR A;  5ALG A;  2XO7 A;  1N56 A;  9ICE A;  4RQ4 A;  4KLM A;  1PUZ A;  1CI4 A;  3G6X A;  3HKZ F;  5ALP A;  3KHR A;  2RDJ A;  5HRI A;  4K8V A;  3H8M A;  4PH5 A;  4QZ8 A;  5EOZ A;  4Q44 A;  1NKB A;  5KG7 A;  5EWE A;  4I2H A;  3D6J A;  5KT3 A;  4WJ3 B;  5HRG A;  4X4P A;  2RP5 A;  5D4B A;  2LYH A;  5EE0 A;  4M9J A;  2HVH A;  3KHL A;  4J9P A;  1R8C A;  5KFE A;  3IG8 A;  5AKL A;  1ZQQ A;  1UHU A;  2YMQ A;  4ED0 A;  2CXY A;  5KFR A;  2KN7 A;  4EYI B;  2A1J A;  5F3X B;  3S6J A;  5JTI A;  4TUS A;  2DUY A;  1S0M A;  3RJG A;  5CHG A;  7ICQ A;  1YZ7 A;  5HHH A;  1NJX A;  5B3P A;  1HJP A;  1IG6 A;  2XGP A;  3Q8L A;  4RU9 A;  3Q8K A;  4KLL A;  4JWN A;  4DOB A;  2QB1 A;  2EAO A;  4P4M A;  5KFK A;  5J2J A;  1QH9 A;  4Z6D A;  2G09 A;  5IIK A;  1XC9 A;  4YN4 A;  3TFR A;  4FHP A;  3RJI A;  1ARO P;  1XS9 D;  1V38 A;  1ZD4 A;  2GOL A;  3PSP A;  5KFS A;  1X6J A;  4Y2J A;  4QZD A;  4DF8 A;  8ICF A;  4O67 A;  2LYA A;  4EEN A;  2EZY A;  1JXE A;  1X9X A;  5J2D A;  2JH1 A;  2JHD A;  4B9S A;  1ZQR A;  3HPO A;  3C5G A;  1U47 A;  3WK8 A;  4OAF A;  1QSS A;  2Q66 A;  3RJK A;  2I1Q A;  3BS5 A;  4YD1 A;  4DSJ A;  2NRV A;  4ZOH C;  4M9G A;  4OJP A;  4AP9 A;  1CEZ A;  1NKE A;  2HBL A;  4OD0 A;  2FLL A;  2KD1 A;  5AKZ A;  1HUO A;  5B5E U;  4DOA A;  4Y2S A;  2KFZ A;  3C1Y A;  1U48 A;  1KFS A;  4US8 A;  4ED8 A;  5KFT A;  2CPR A;  2ATL A;  1ZRN A;  2BCR A;  1Z1V A;  2WTF A;  5F9L A;  4WCW A;  4FHV A;  2P6U A;  3AQN A;  4K96 A;  2ZH4 A;  5ALO A;  3NUQ A;  3MFI A;  1BVS A;  5ALL A;  3HW8 A;  4I2B A;  2RRD A;  1J2M A;  5BOL A;  1X6I A;  5AKK A;  1Z1B A;  3OJU A;  2DR9 A;  2ZH1 A;  4RQ5 A;  5DGB A;  3NS1 A;  5ALS A;  4LEY A;  5DB6 A;  1SXE A;  2KIC A;  2YX8 A;  4KB6 A;  4KM5 A;  1UEV A;  5AKE A;  5TIS U;  2H5X A;  3IM1 A;  1KFD A;  1L8L A;  1SV4 A;  3PW2 A;  2PFP A;  1YT3 A;  2BQU A;  5ALU A;  3SQI A;  1Z4O A;  1XSP A;  9ICF A;  5T14 A;  5AM0 A;  4ED3 A;  2QB0 B;  4PHP A;  1ZD2 P;  2E5S A;  5KFI A;  1X66 A;  1JAJ A;  2VJ4 A;  8ICY A;  5L9X A;  5KFD A;  5ALK A;  3BQ0 A;  3ETR A;  2J6S A;  2JV3 A;  2HOI A;  4QWD A;  4OAH A;  5EE3 A;  3L9D A;  3MFH A;  1MN8 A;  4CE6 A;  4WC7 A;  3UXP A;  1UA0 A;  4UAV A;  2KNJ A;  4NLC A;  5DBA A;  1PK1 A;  3QEA Z;  4IQT A;  1YZ6 A;  4BXO B;  3H37 A;  2WF9 A;  3HX0 A;  5GTI U;  3K1Z A;  9ICN A;  4UB6 U;  2AGQ A;  3BDP A;  1P7D A;  9ICS A;  3EW9 A;  1Z00 B;  4PGQ A;  4WC3 A;  1TK8 A;  3RJE A;  7ICS A;  4WC5 A;  4DSE A;  3QUC A;  1K1Q A;  4PZN A;  2UVU A;  2HOQ A;  3N7S C;  1ZQE A;  4M5D A;  2RHF A;  4PL1 A;  1ZQV A;  1MC8 A;  2XY7 A;  8ICI A;  5J0R A;  1XSL A;  3H40 A;  4ECX A;  4C8M A;  1Q3V A;  4IQU A;  1ZQF A;  3RR8 A;  2K4H A;  3RR7 A;  1RXV A;  1QLN A;  4WC6 A;  2KJ5 A;  4FBT A;  1PVR A;  2Q4T A;  4M47 A;  4PHE A;  2E8O A;  1B0X A;  4ICA A;  4J9O A;  4FO6 A;  4FFD A;  4OAI Z;  3AU2 A;  1KLN A;  1FO4 A;  5J2K A;  5KFC A;  3Q8P B;  4X4U A;  4P4P A;  4DCC A;  2KE7 A;  4KTQ A;  3WKC A;  4BWJ A;  3KKA A;  1KKX A;  4JK1 A;  4QWB A;  2VA8 A;  2V4Q A;  2XY5 A;  4QNL A;  4NM2 A;  4J9Q A;  2ZH9 A;  1ZJN A;  1WCN A;  3F2D A;  3PR4 A;  4GC6 A;  3GFK B;  2YMM A;  5KG5 A;  2KHQ A;  1VJ5 A;  2KVS A;  1RG6 A;  3PY8 A;  1ZQY A;  4UQG A;  4J9L A;  4ED6 A;  3ONN A;  1RYU A;  2DR8 A;  3JPS A;  3KBB A;  2W7O A;  2BCS A;  1UEU A;  4ATB A;  5B66 U;  4IS7 A;  3F5E A;  1N62 A;  4AYB C;  1R8B A;  4BGD A;  4RUA A;  4YR3 A;  4O9M A;  3WK9 A;  3CW2 C;  3C2L A;  2H3Q A;  2F1J A;  4EBE A;  4DQQ A;  2ESE A;  1F0M A;  2F2A B;  4Y2Q A;  4A8E A;  3KHG A;  1LV5 A;  1ZD3 A;  2BPF A;  1S77 D;  2KTQ A;  1DK2 A;  4KLE A;  1S76 D;  2KSO B;  1DGJ A;  3QZ8 A;  1V85 A;  2IHN A;  2FPK A;  3WFP A;  1KTQ A;  4NXU A;  1SKS A;  3NRZ A;  5ALQ A;  2JEF A;  4DSF A;  3EPG A;  3V6H A;  1RYS A;  1X42 A;  5JU5 A;  2Y9T A;  1RDF A;  2VKQ A;  4I2G A;  2XCP A;  5DQH A;  5KT6 A;  1ZQG A;  3RB3 A;  4KLD A;  4Q8F A;  1QQ7 A;  2KJ9 A;  2F44 A;  3KZX A;  4XUS A;  3QEB Z;  1XSN A;  4NWI A;  3C21 A;  4NM1 A;  2KFN A;  1A0P A;  3RJJ A;  4UAY A;  2ZIV A;  2J6U A;  4OJO A;  3ORY A;  2E8N A;  4CCH A;  3SEI A;  1A76 A;  5AHX A;  2M0N A;  2QAR A;  2ODG A;  4RQ7 A;  3KHH A;  3QX7 A;  1BGX T;  3OHA A;  3G6Y A;  1T8E A;  3PW5 A;  3BZC A;  4EX7 A;  5AKY A;  3DV9 A;  1S97 A;  3QXG A;  4M9L A;  5III A;  4M9N A;  4KMU A;  4AT7 B;  2BDU A;  4Y2R A;  4RQN A;  1S10 A;  1KNY A;  5JUM A;  4F50 A;  7ICV A;  5HHI A;  3ISB A;  4GXJ A;  2JGA A;  5KT5 A;  2ZJA A;  4RPX A;  4GIB A;  3B9J A;  1DOQ A;  4DQP A;  1NJW A;  2NRX A;  2HW3 A;  1OXJ A;  2HI0 A;  3TAR A;  8ICB A;  2K4P A;  1BNO A;  5J2C A;  2AJQ A;  1FA0 A;  3LK9 A;  5HP4 A;  4J9N A;  2G06 A;  4DS4 A;  5J0W A;  3T5K A;  2NRT A;  2W9B B;  3E2E A;  1WWV A;  1S0V A;  3EWA A;  1ZQB A;  9ICO A;  3HJ1 A;  4RQ1 A;  2RQ5 A;  3E0F A;  4RWQ A;  4DL5 A;  4F2S A;  1NJY A;  2OCE A;  5C5J A;  4FZN A;  4RT3 A;  2OH2 A;  4EED A;  9ICK A;  5HMM A;  4DFM A;  4YQW A;  1NK6 A;  3VC8 A;  5HRD A;  4X4T A;  4YXM A;  1N63 A;  4TUR A;  1X9M A;  9ICJ A;  1NNL A;  3WK5 A;  2JZB B;  5IIM A;  3LYS A;  2M2U A;  7ICK A;  2W3S A;  3V7L A;  1D8L A;  3PX4 A;  5DDM A;  4PHA A;  5G5G A;  3SV3 A;  5KG0 A;  1SXD A;  2EAN A;  3OVB A;  1N48 A;  4UB3 A;  1KW4 A;  2BCV A;  2MRL A;  1TVA A;  3H4D A;  1UT5 A;  2CRX A;  3C18 A;  4WQK A;  1FFV A;  3TAD C;  4O3M A;  1PVP A;  1ZQN A;  4DWI A;  1URJ A;  1RZT A;  3RH4 A;  3PO4 A;  2FLN A;  1AQ6 A;  4AT8 B;  4RUC A;  2XCA A;  1C7Y A;  2ES6 A;  4O69 A;  5HRH A;  4TUP A;  3GQC A;  2HHT A;  4F5Q A;  1JQR A;  1JAL A;  3EUB 2;  2BCU A;  3C23 A;  2BBH A;  1U49 A;  2DKZ A;  3WKD A;  4F4K A;  3N28 A;  1NK7 A;  4NLG A;  3PSI A;  2KVC A;  3NVW A;  3PVX A;  3C29 A;  3OPX A;  3QU7 A;  2NO5 A;  4QIW F;  3WU2 U;  1KDH A;  2IOF A;  1VLB A;  2LKY A;  4ELT A;  1T4G A;  4TUQ A;  9ICT A;  4DSK A;  5AK5 A;  3C66 A;  3QU2 A;  5HR7 A;  1KN5 A;  4RQM A;  2LI6 A;  2EAM A;  4O5K A;  1MIV A;  4JLZ A;  2UVR A;  1XO0 A;  1SB3 C;  2GWS A;  3WK4 A;  5KFY A;  2F1H A;  4UW9 A;  5KG6 A;  5DQI A;  4Q43 A;  3RJH A;  3KOO A;  3TAQ A;  2ZG6 A;  2HN2 A;  2M9N A;  3RRH A;  4MEY A;  1Q79 A;  1V9P A;  2R8I A;  3F2C A;  4UBC A;  3CRX A;  2D6F C;  5H2F U;  5KFB A;  3SAF A;  1JN3 A;  4DSI A;  3WKA A;  3PW4 A;  1RPL A;  4KN4 A;  4EZ9 A;  2DRA A;  2W9C B;  3MR2 A;  1HUZ A;  2WF7 A;  1F44 A;  2HHS A;  2K4I A;  3WFR E;  5J2I A;  4C4T A;  1FIQ A;  2MA1 A;  4PJ0 U;  1UT8 A;  4NLN A;  5HC9 A;  4RNM A;  1VFG A;  2O1P A;  2D3D A;  4J9R A;  2PKE A;  3T5J A;  2KK0 A;  5J0S A;  3IV6 A;  3CYM A;  5KL8 B;  3QUB A;  1L8O A;  1T94 A;  2JEI A;  4NLB A;  5DQG A;  4YMO A;  4R64 A;  8ICC A;  5J2A A;  3TAC B;  4I2C A;  3PHZ A;  2O6K A;  4QWA A;  4J9S A;  4X4R A;  4RZR A;  4FHX A;  4EP7 A;  4LEZ A;  2B56 A;  4WBY A;  5AM2 A;  2ZIW B;  2HMX A;  2C28 A;  1U4B A;  1JUD A;  2K4E A;  2DR5 A;  4LEV A;  5KG1 A;  3ZD8 A;  1TFW A;  3LWM A;  5B3Q A;  3UM9 A;  1RXW A;  3MGH A;  2F76 X;  5DB8 A;  5AIA A;  4FZL A;  1QSL A;  4DL4 A;  8ICP A;  3ERC C;  4DFJ A;  2ZUD A;  4Y2Y A;  4F72 A;  3K75 D;  4IR1 A;  3NAS A;  4I2I A;  3BQ1 A;  4C4S A;  2O5A A;  2DFL A;  4BXO A;  1D8B A;  4XQ7 A;  3PML A;  5JTG A;  4EEB A;  3OSP A;  4LEW A;  2R8K A;  2WAQ C;  3FM9 A;  3EF2 A;  3ER8 C;  3UQ2 A;  4QW9 A;  3HJE A;  5DB7 A;  2E8M A;  2JEJ A;  1Q8K A;  2E1E A;  3PNC A;  5CFT A;  2JH7 A;  4F4X A;  3L3F X;  9ICG A;  4I2D A;  2W8K A;  2ASD A;  1LB2 B;  2R8H A;  2A19 A;  3QUT A;  4WC0 A;  2NV3 A;  4M04 A;  2FJ6 A;  2AQ0 A;  2BBJ A;  2ZIX A;  5CRX A;  2I9G A;  5DG7 A;  4C8K A;  3JZ0 A;  4QZG A;  9ICQ A;  4K4H A;  4P0Q A;  2W8L A;  2C2R A;  3GIL A;  2JR5 A;  1QCK A;  7ICJ A;  4QZI A;  1DRG A;  1ZQO A;  4EBC A;  3PW0 A;  4R8U A;  4UB1 A;  2XC9 A;  1J97 A;  2MUT A;  4XRH A;  4PHD A;  2ZH7 A;  2HHV A;  2PMZ F;  5DED A;  2DKX A;  7ICM A;  3CK6 A;  4UAZ A;  5KT2 A;  1L3V A;  5DDY A;  4YP3 A;  4F5O A;  4UB5 A;  3OUY B;  3RTV A;  3I28 A;  2LBO A;  4RPY A;  1BPY A;  1MA7 A;  4HAI A;  5ALI A;  4WBZ A;  3QUQ A;  5J2F A;  1MIW A;  2BZF A;  1U45 A;  2M2W A;  4YCX A;  2KHV A;  2H3F A;  2ZIU B;  3MDC A;  3SZ2 A;  1V97 A;  4BWM A;  3ISD A;  2YMP A;  1L7O A;  4QZH A;  3U26 A;  4ECW A;  3N7R C;  4QWE A;  4RQ2 A;  3UMB A;  3JPT A;  3JPR A;  3HJ4 A;  1SWV A;  1ZQW A;  2KSO A;  1T3N A;  7ICI A;  5KFH A;  3QE9 Y;  1BPD A;  1QQ5 A;  3GDX A;  4LJX A;  3PMN A;  4F92 B;  1D9F A;  2GLE A;  4KIT B;  3AQF A;  4MFC A;  4ECR A;  4UD5 A;  4YFK A;  4UB2 A;  4O3Q A;  3D2Q A;  4O0I A;  2W43 A;  1NK0 A;  2EZZ A;  4GXI A;  5CHE A;  4LZD A;  7ICF A;  3N4M B;  2KJ8 A;  2C2D A;  4IR9 A;  2K89 A;  1D9D A;  9ICX A;  3NVZ A;  4QW8 A;  4XA5 A;  4EEK A;  2ZJ5 A;  2JEG A;  5KFX A;  3JCF A;  1NK4 A;  3I76 A;  4I2E A;  2ASJ A;  3M7D A;  3GV8 B;  3UMG A;  1IV8 A;  7ICT A;  2HN1 A;  3IN5 A;  1ZQC A;  3MCR A;  3ALR A;  3V7J A;  1Q46 A;  5KFZ A;  4UB8 U;  4R66 A;  2IOH A;  3NWI A;  4DFD A;  1SL2 A;  4M0A A;  3THV A;  9ICP A;  2DF4 B;  9ICR A;  1YLQ A;  1UA1 A;  2KEY A;  3JPQ A;  5HRK A;  1T7P A;  5AI9 A;  3OGU A;  5ALH A;  2QKQ A;  7ICE A;  5G5H A; 
#chains in the Genus database with same CATH homology
 4K4I A;  4KLF A;  4JUZ A;  4I2F A;  1MIY A;  2PI4 A;  4RQ7 A;  5KFG A;  1TFR A;  3KHH A;  1X9S A;  2Y1J A;  2ZJ8 A;  3H4B A;  1BGX T;  2ZH3 A;  3OHA A;  3G6Y A;  5HML A;  1T8E A;  1ZQA A;  5DG9 A;  3PW5 A;  2BGW A;  1S97 A;  2BQR A;  4M9L A;  5KFP A;  5III A;  4YR2 A;  1TK0 A;  2PXI A;  4KMU A;  5KFQ A;  4M9N A;  3MGI A;  3M9M B;  5F2V O;  3PX0 A;  4AT7 B;  3UXO A;  1NZP A;  1KSP A;  4X0B A;  1S10 A;  2R8G A;  1PX5 A;  1KNY A;  2BR0 A;  1OU5 A;  3M9N B;  5JUM A;  2DRB A;  8ICS A;  5J0U A;  4F50 A;  2DVI A;  3AU6 A;  3OUY A;  2KZ3 A;  2HHU A;  7ICV A;  4G3I A;  5HHI A;  3ISB A;  3LQC B;  4GXJ A;  4EBK A;  4MF8 A;  5CWR A;  4C8N A;  2UVV A;  2Q0Z X;  4I2J A;  1BPX A;  3MR6 A;  5KT5 A;  3V72 A;  2BQ3 A;  5DLF A;  4JV2 A;  2ZJA A;  1V4A A;  4RPX A;  3T5H A;  4JV1 A;  4ECU A;  1DOQ A;  4DQP A;  4BDP A;  1NJW A;  2NRX A;  2W9B A;  3ZDC A;  3H8W A;  4UAW A;  2NRZ A;  2ZTD A;  4C8L A;  2HW3 A;  4RWP A;  4RWN A;  1NK5 A;  5BOM A;  3TAR A;  2HHP A;  8ICB A;  2FPM A;  8ICV A;  4YMN A;  1BNO A;  5J2C A;  3M8R A;  4O3N A;  2AJQ A;  3LK9 A;  1FA0 A;  3OV7 A;  3PV8 A;  5HP4 A;  4LT6 A;  4O3O A;  3FYH A;  5J2G A;  5J0Y A;  1TK5 A;  4J9N A;  4UD4 A;  4DS4 A;  5J0W A;  3KTQ A;  4QZA A;  3TFS A;  3T5K A;  2NRT A;  3ZD9 A;  2W9B B;  3E2E A;  4X0A A;  5IIN A;  5KFJ A;  1S0V A;  3EWA A;  3TAP A;  1ZQB A;  9ICO A;  3HJ1 A;  4RQ1 A;  1MQ3 A;  1X9W A;  4RWQ A;  4DL5 A;  4I2A A;  3NTU A;  4F2S A;  3HIY A;  2KP7 A;  2F1I A;  5C5J A;  3RBD A;  4RT3 A;  1NJY A;  1B22 A;  1R8A A;  9ICK A;  5HMM A;  4Q45 A;  3HT3 A;  4DFM A;  1SL0 A;  4YQW A;  1NK6 A;  4X4O A;  4F4Z A;  3T3F A;  2ZHB A;  2FMP A;  1X2I A;  5HRD A;  3C2K A;  4X4T A;  2J6T A;  1ZQT A;  4YXM A;  4F2R A;  4GXK A;  4J9M A;  4F91 B;  4RQ3 A;  3TI0 A;  4TUR A;  1X9M A;  4AT9 A;  9ICJ A;  4Z6E A;  1DK3 A;  5KT7 A;  4QZF A;  2C2E A;  1WOT A;  5CB1 A;  2W9A A;  8ICM A;  2JZB B;  5IIM A;  1TKD A;  2M2U A;  2UVW A;  3RAX A;  7ICK A;  4DL6 A;  5J0P A;  3V7L A;  1D8L A;  1PZN A;  1BPE A;  4X4N A;  2RFF A;  4E0D A;  4Z6F A;  1L3U A;  3PX4 A;  5DDM A;  4PHA A;  2XO7 A;  1N56 A;  9ICE A;  4AT9 B;  4RQ4 A;  4JV0 A;  3HP6 A;  3SV3 A;  4KLM A;  8ICA A;  5KG0 A;  1ZQH A;  1S0O A;  5J0O A;  1KEJ A;  3EZ5 A;  1N48 A;  4UB3 A;  5EWF A;  3NYB A;  4E80 A;  3OVB A;  3LDA A;  3G6X A;  1ZQL A;  4I29 A;  3GIK A;  2BCV A;  3KHR A;  3C5F A;  2RDJ A;  3ZDA A;  5HRI A;  3ETL A;  1COO A;  1SL1 A;  1TVA A;  4PH5 A;  3H4D A;  4QZ8 A;  1UT5 A;  5EOZ A;  4Q44 A;  1NKB A;  3C18 A;  1BPB A;  1ZQX A;  5KG7 A;  3C2M A;  5EWE A;  4I2H A;  4MEX A;  1NOM A;  5KT3 A;  4XQ8 A;  1ZQU A;  1ZQN A;  4DWI A;  1RZT A;  3OVS A;  5J2E A;  3RH4 A;  3MDA A;  2FLN A;  2ZTC A;  2FLP A;  3PO4 A;  3RJF A;  4RUC A;  4F4Y A;  4B9M A;  4K4G A;  9ICB A;  5HRG A;  5D4B A;  4F93 B;  4X4P A;  1TAQ A;  2LYH A;  2XCA A;  1C7Y A;  2AGP A;  4DSL A;  4M9J A;  4GLX A;  4E8F A;  2HVH A;  5HRH A;  3KHL A;  4DQI A;  4J9P A;  3WFO A;  5DBB A;  1R8C A;  5KFE A;  4TUP A;  3GQC A;  4F5Q A;  2HHT A;  1JQR A;  2BCU A;  3C23 A;  1ZQK A;  1U49 A;  4DFK A;  1ZQQ A;  4F4K A;  1NK7 A;  4NLG A;  2HHQ A;  4ED0 A;  3RAQ A;  4KLI A;  4NKT A;  8ICG A;  7ICN A;  1IXR A;  3PVX A;  4Z6C A;  5KFR A;  4ED1 A;  2KN7 A;  1JX4 A;  4EYI B;  8ICJ A;  5KG3 A;  1KDH A;  3JPO A;  2A1J A;  2NRW A;  2DPJ A;  4MFA A;  2PFP A;  3ZDB A;  4X4V A;  4O3S A;  4ELT A;  1Z3E B;  1T4G A;  3Q8M A;  1NK8 A;  2ZHA A;  4RQ0 A;  4TUQ A;  4ECZ A;  4B9L A;  9ICT A;  4TUS A;  1S0M A;  2FMS A;  3RJG A;  5CHG A;  1ZQS A;  3RRG A;  4DSK A;  4S3N A;  7ICQ A;  1VJ7 A;  2PFN A;  3AQM A;  3C66 A;  5HHH A;  4LVS A;  1NJX A;  1HJP A;  4DFP A;  2XGP A;  3MAB A;  4RU9 A;  3Q8L A;  3Q8K A;  4KLL A;  2A1J B;  4JWN A;  5KFM A;  4O5K A;  5KFL A;  4DOB A;  1MIV A;  3H38 A;  4AT7 A;  4P4M A;  1R89 A;  5KFK A;  5J2J A;  2BDP A;  2UVR A;  4QZB A;  4Z6D A;  4F5P A;  2BPC A;  2GWS A;  8ICX A;  3V6J A;  5DBC A;  1KRP A;  5IIK A;  5KFY A;  4YN4 A;  3TFR A;  1XC9 A;  8ICQ A;  4FHP A;  3RJI A;  1ARO P;  2F1H A;  2AU0 A;  5KG6 A;  1XS9 D;  4KLU A;  5DQI A;  4ECS A;  3B0X A;  4RQ8 A;  5KFS A;  4FH3 A;  3WFQ E;  3SV4 A;  4Q43 A;  3TQ1 A;  4F5R A;  5DG8 A;  7ICU A;  3RJH A;  4QZD A;  4NLK A;  1KFT A;  2W9M A;  2BPG A;  4DF8 A;  3TAQ A;  8ICF A;  3AQK A;  1JXE A;  5J2D A;  4F5N A;  3PO5 A;  4B9S A;  3LWL A;  5L1L A;  1ZQR A;  2M9N A;  3HPO A;  3C5G A;  1U47 A;  3RRH A;  1QSS A;  4M2Y A;  4MEY A;  1Q79 A;  3OSN A;  1V9P A;  3JPN A;  2Q66 A;  2R8I A;  3OVA A;  3RJK A;  3BQT A;  3JYY A;  4UBC A;  2I1Q A;  1ZQP A;  2IHM A;  2OWO A;  4F4W A;  8ICL A;  5KFB A;  4YD1 A;  1JN3 A;  4DSI A;  5HNK A;  2PBE A;  4DSJ A;  2NRV A;  3PW4 A;  4M9G A;  1RPL A;  1CEZ A;  4FS2 A;  4KN4 A;  2ZH8 A;  1NKE A;  1BPZ A;  4EZ9 A;  4WC1 A;  2DRA A;  4EBJ A;  2FLL A;  2W9C B;  3MR2 A;  1HUZ A;  1HUO A;  2HHS A;  4DOA A;  5BPC A;  4PGX A;  3WFR E;  4YG2 A;  5J2I A;  3C1Y A;  1U48 A;  1ZYQ A;  1SKR A;  2KFZ A;  1ZQI A;  1KFS A;  3PW7 A;  4ED8 A;  1UT8 A;  1NO5 A;  4NLN A;  5HC9 A;  4B9N A;  4RNM A;  2HHX A;  5KFT A;  1VFG A;  2ATL A;  2ZTE A;  1NKC A;  9ICA A;  2O1P A;  5J0X A;  4R8U B;  2BCR A;  3T5L A;  4WCW A;  2WTF A;  5F9L A;  3EYZ A;  9ICW A;  4NXZ A;  2MUT B;  4J9R A;  1XWL A;  3T5J A;  5KFA A;  5HRL A;  4FHV A;  4WC4 A;  2JZB A;  3JPP A;  2P6U A;  4ECY A;  2VA3 A;  4O5E A;  5J0S A;  4ECT A;  2BE3 A;  5IIJ A;  3PX6 A;  3AQN A;  2ZH4 A;  4P2H A;  3K4G A;  3MFI A;  4X4S A;  1BVS A;  2JEI A;  3HW8 A;  4I2B A;  4KLT A;  4R63 A;  1ZJM A;  2BKE A;  5BOL A;  5DQG A;  5DEC A;  4YMO A;  4R64 A;  2BHN A;  2P66 A;  3OJU A;  4B9U A;  2DR9 A;  2ZH1 A;  8ICC A;  5J2A A;  4I2C A;  4RQ5 A;  3SYZ A;  7ICL A;  5DGB A;  5J0T A;  4QWA A;  4J9S A;  4EYH B;  4X4R A;  2M2T A;  3NGD A;  4RZR A;  5DB6 A;  4QWC A;  4FHX A;  4EP7 A;  4RPZ A;  4KLO A;  4LZG A;  1UEV A;  4Q8E A;  4WBY A;  2H5X A;  3IM1 A;  5KG2 A;  1KFD A;  4I27 A;  4EEY A;  1K1S A;  3PW2 A;  5CA7 A;  3RBE A;  4O3P A;  3MBY A;  2C28 A;  2ZUC A;  1ZQZ A;  3H8S A;  5KFW A;  2BQU A;  1U4B A;  2IA6 A;  4AT8 A;  5J2H A;  4TQS A;  5IIL A;  2V9W A;  2DR5 A;  1XSP A;  4KLS A;  4ATB B;  9ICF A;  4EBD A;  4ED3 A;  5KG1 A;  1JIH A;  3ZD8 A;  5CR0 A;  4PHP A;  4F3O A;  7ICH A;  3ISC A;  1TFW A;  3LWM A;  3AQL A;  2FMQ A;  1RXW A;  3MGH A;  5DB8 A;  4PPX A;  5KFI A;  1JAJ A;  1QSL A;  1XO1 A;  3C1Z A;  3Q8R B;  8ICY A;  5KFU A;  1IM4 A;  4DL4 A;  2ALZ A;  5L9X A;  5KFD A;  8ICP A;  4DFJ A;  7ICP A;  2ZUD A;  3BQ0 A;  4C8O A;  3K75 D;  4MF2 A;  4IR1 A;  3UQ0 A;  3BQ1 A;  4I2I A;  2J6S A;  2O5A A;  3AUO A;  2C22 A;  1Y88 A;  5KFN A;  4QWD A;  5DB9 A;  2DFL A;  4BXO A;  4F8R A;  3L9D A;  4XQ7 A;  3PML A;  3MFH A;  5L1J A;  3OSP A;  8ICO A;  2R8K A;  3UXP A;  4ED7 A;  4WC7 A;  4E7X A;  4X5V A;  3FDS A;  1UA0 A;  3UQ2 A;  4FS1 A;  1ZQJ A;  2V4R A;  3PR5 B;  5DBA A;  2KZZ A;  1D8Y A;  3QEA Z;  2ZH6 A;  4IQT A;  4BXO B;  4QW9 A;  1SKW A;  3H37 A;  9ICM A;  5DB7 A;  3HX0 A;  1MQ2 A;  5DLG A;  4O3R A;  4RNN A;  4DF4 A;  2KZM A;  9ICN A;  5KFF A;  4KLJ A;  4PGY A;  3TAN A;  1A77 A;  2AGQ A;  2ASL A;  2JEJ A;  1L5U A;  5KTQ A;  3BDP A;  2NRK A;  9ICS A;  1TFY A;  3EW9 A;  3UPQ A;  4DO9 A;  1Z00 B;  4PGQ A;  3OJS A;  4DL2 A;  1S9F A;  8ICN A;  4B9V A;  4X4Q A;  3PNC A;  4ECQ A;  4WC3 A;  5L1I A;  4F4X A;  1TK8 A;  2AQ4 A;  3RJE A;  9ICG A;  4I2D A;  7ICS A;  2W8K A;  3Q8S B;  4DSE A;  2ASD A;  4WC5 A;  1LB2 B;  1K1Q A;  2R8H A;  1L3T A;  4WC2 A;  4M9H A;  5CJ7 A;  2VAN A;  2UVU A;  4WC0 A;  2M2V A;  4M04 A;  3RH6 A;  4AT8 B;  4DL3 A;  1QSY A;  1ZQE A;  2ID1 A;  4M5D A;  2AQ0 A;  5KFO A;  1H38 A;  5KFV A;  1ZQV A;  1MC8 A;  9ICV A;  4ZH4 A;  2I9G A;  5DG7 A;  2XY7 A;  4C8K A;  3QZ7 A;  4O5C A;  8ICI A;  5J0R A;  3Q8Q B;  3MR5 A;  1XSL A;  3H40 A;  4P4O A;  5D46 A;  4IQW A;  4QZG A;  9ICQ A;  3JZ0 A;  4K4H A;  2W8L A;  4ECX A;  3GIL A;  2C2R A;  3OUY B;  3EPI A;  5J2B A;  4DS5 A;  4C8M A;  2W9C A;  4IQU A;  1ZQF A;  3RR8 A;  7ICJ A;  4RWO A;  4QZI A;  4KN7 A;  1TV9 A;  3RR7 A;  1RXV A;  1QLN A;  4WC6 A;  2ZH2 A;  4UBB A;  4FBT A;  3RB6 A;  4M47 A;  1ZQO A;  4PHE A;  4EBC A;  3H39 A;  9ICU A;  1XU4 A;  3PW0 A;  4J9O A;  4R8U A;  4UB4 A;  5KG4 A;  4UB1 A;  2XC9 A;  4FO6 A;  2XY6 A;  2MUT A;  4XRH A;  4PHD A;  3GIJ A;  2ZH7 A;  3G6V A;  4DQR A;  2HHV A;  3AU2 A;  4M6W A;  7ICE A;  4FHW A;  4JWM A;  1KLN A;  5L1K A;  4DLE A;  1WCL A;  5DED A;  3H7I A;  5J2K A;  5KFC A;  3Q8P B;  1SZP A;  4X4U A;  4P4P A;  2PI5 A;  4UAZ A;  7ICM A;  8ICR A;  5IIO A;  5KT2 A;  1L3V A;  2HVI A;  5DDY A;  4KTQ A;  4YP3 A;  4BWJ A;  4F5O A;  4UB5 A;  1ZQD A;  4NY8 A;  5CP2 A;  2IMW P;  3WFS C;  4JK1 A;  5J29 A;  3RTV A;  3GIM A;  4QWB A;  4ELV A;  8ICU A;  2VA8 A;  4M6W B;  4RPY A;  1ZET A;  2V4Q A;  2XY5 A;  2Y1I A;  1L3S A;  1BPY A;  1UET A;  4NM2 A;  4J9Q A;  4WBZ A;  1ZJN A;  2ZH9 A;  4DQS A;  5J2F A;  1MIW A;  1TAU A;  1WCN A;  9ICL A;  3PR4 A;  4YR0 A;  4GC6 A;  4NLZ A;  3GFK B;  4HYK A;  1U45 A;  4IRK A;  5KG5 A;  2M2W A;  4YCX A;  5HRB A;  7ICG A;  4R65 A;  1F5A A;  3PY8 A;  1ZQY A;  4DL7 A;  4UQG A;  4J9L A;  5HRF A;  4ED6 A;  3MDC A;  3SZ2 A;  2R8J A;  8ICE A;  1RYR A;  4GC7 A;  4BWM A;  2FPL A;  3SI8 A;  3ZDE A;  3ISD A;  5DGA A;  2DR8 A;  3JPS A;  4B9T A;  4DLG A;  8ICK A;  4NKU A;  4QZH A;  1DGS A;  2AGO A;  2BCS A;  1UEU A;  3GII A;  2PFO A;  4ATB A;  4ECW A;  4IQV A;  3H8J A;  3GV5 B;  4ED2 A;  4BGD A;  3MR3 A;  1R8B A;  4RUA A;  4YR3 A;  4RQ2 A;  4QWE A;  4O9M A;  3UPS A;  1NK9 A;  4YMM A;  1S0N A;  5KT4 A;  3JPT A;  3C2L A;  3JPR A;  9ICC A;  9ICI A;  3HJ4 A;  2BCQ A;  2B21 A;  1ZQW A;  2F1J A;  1T3N A;  7ICI A;  3HWT A;  3RB4 A;  1QTM A;  4MFF A;  4EBE A;  4YXJ A;  9ICH A;  4FH5 A;  5KFH A;  2DPI A;  2IBK A;  3QE9 Y;  2ISO A;  3RB0 A;  4FBU A;  3M8S A;  3N97 B;  1BPD A;  4DQQ A;  7ICO A;  3GDX A;  4KLH A;  3KHG A;  1JXL A;  3PMN A;  4F92 B;  1LV5 A;  2P6R A;  2BPF A;  3OHB A;  3GV7 B;  1S77 D;  1MSW D;  1D9F A;  4I28 A;  4KLE A;  2KTQ A;  3B0Y A;  8ICH A;  4KIT B;  1S76 D;  1DK2 A;  4IG8 A;  4MFC A;  4ECR A;  4RNO A;  4UD5 A;  3QZ8 A;  4YFK A;  4UB2 A;  4IRC A;  4O3Q A;  4TQR A;  2IHN A;  2FPK A;  3H3A A;  4FHY A;  1KTQ A;  4O0I A;  3WFP A;  1BNP A;  5TZV A;  4QZ9 A;  1NK0 A;  1SKS A;  4GXI A;  3IHQ B;  4QZE A;  2JEF A;  5EWG A;  4RT2 A;  4LZD A;  3BJY A;  3N4M B;  3RH5 A;  7ICF A;  4DSF A;  2RDI A;  2C2D A;  4IR9 A;  1D9D A;  9ICX A;  3EPG A;  3V6H A;  1RYS A;  1Z00 A;  4QW8 A;  8ICW A;  4XA5 A;  1B43 A;  4YVZ A;  2ZJ5 A;  8ICT A;  2JEG A;  2ISP A;  5KFX A;  5DKW A;  4I2G A;  2ZUB A;  2XCP A;  1NK4 A;  1NJZ A;  2ASJ A;  5DQH A;  5KT6 A;  4YD2 A;  4I2E A;  8ICZ A;  3GV8 B;  3UXN A;  4IRD A;  4KLG A;  1EXN A;  4ELU A;  1ZQG A;  2ZH5 A;  3RB3 A;  7ICT A;  4KLD A;  1Q78 A;  4RQ6 A;  4Q8F A;  2XGQ A;  5F9N A;  1ZQC A;  4ECV A;  1ZQM A;  4XUS A;  1JMS A;  3QEB Z;  5HRE A;  1XSN A;  3V7J A;  3C21 A;  2VA2 A;  2PFQ A;  5KFZ A;  4R66 A;  1U9L A;  3BQ2 A;  4DOC A;  4NM1 A;  1SL2 A;  4M0A A;  5HR9 A;  3THV A;  3ZDD A;  2KFN A;  9ICP A;  2DR7 A;  9ICR A;  4QZC A;  3RJJ A;  4UAY A;  1CUK A;  5D49 A;  3JPQ A;  1UA1 A;  2J6U A;  4KLQ A;  2HHW A;  1YLQ A;  5HRK A;  1T7P A;  2MAX A;  4DEZ A;  7ICR A;  3ORY A;  4J9K A;  3M9O B;  3V7K A;  3V6K A;  3OGU A;  4CCH A;  5J0Q A;  1A76 A;  4EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...