4PHAA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phaA03
4YN4A 1K1SA 5F9LA 3T5HA 4UAZA 2ASJA 5J2IA 4J9SA 2J6TA 2F1JA 4BDPA 1ZQMA 4YD1A 3JYYA 2DRAA 2BE3A 4PHAA 1A77A 1DOQA 3LDAA 4PHPA 2AGOA 2BKEA 3PO4A 4R8UB 4I2EA 2O5AA 4MFAA 5BOLA 4JV1A 4RNNA 3NYBA 4Q43A 5L9XA 4YCXA 1SL1A 3PR5B 1TK0A 1NKBA 4UAYA 1LB2B 1RYSA 4K4IA 7ICMA 1ZQGA 4FHYA 3RR8A 5CA7A 5HRLA 3Q8LA 4RWQA 4F50A 4DL3A 2V4RA 3ZDAA 1UA1A 5DLGA 4B9TA 8ICAA 4Z6CA 1R8CA 3C18A 3OSNA 5KT6A 1L3SA 4QWCA 3SV4A 1QSLA 4GXIA 2O1PA 5KFWA 2J6SA 4J9MA 1S0MA 2P66A 4DSFA 4R64A 4KLLA 4X4UA 4O5EA 4F5NA 5DDYA 3M9NB 2DR5A 4P2HA 5KTQA 2ATLA 5KT2A 4DF4A 2UVUA 2M2UA 4RQ8A 3KHHA 1ZQVA 8ICNA 4E8FA 4K4HA 2RFFA 1UETA 1NK0A 1ZQFA 4WC3A 3RJGA 9ICAA 5HRDA 2FMSA 1ZQYA 4NXZA 5KFNA 3H4DA 3BQ0A 4RQ1A 1QLNA 5KFIA 3MGHA 4KTQA 4WC6A 3LWLA 2BPFA 8ICMA 5HMMA 2A1JA 1BPZA 5KG1A 2MUTB 3JPPA 3G6YA 4BWJA 4RU9A 5J0QA 1DGSA 2R8IA 1Z00B 2F1HA 5DBBA 3ISBA 2DR9A 5KFXA 5KFUA 5CWRA 4O5CA 1V4AA 4EBCA 5HRGA 4FS1A 1BVSA 1L3UA 3GIMA 3BDPA 4FBTA 4X4VA 3N4MB 3RB0A 5DG8A 2NRKA 4JV0A 5HMLA 4ECSA 3PO5A 4EBKA 4R8UA 1NK5A 1KNYA 4F5QA 3UPQA 3L9DA 7ICJA 4RWOA 4X4OA 4E0DA 4BXOA 4J9PA 1UEVA 1IXRA 1UT8A 2DFLA 3V72A 4J9QA 2KN7A 3H4BA 3V7JA 2IMWP 2ZTDA 5HRHA 9ICCA 9ICSA 4J9KA 2ZUDA 1T3NA 8ICPA 4YMNA 4KLDA 5J2JA 3PW7A 1NJZA 1B43A 1ZQWA 4TUQA 5KT7A 4ED0A 3ORYA 1NK6A 3PR4A 5F9NA 5DG7A 4IRCA 1S0VA 5KFLA 4YXJA 4F4ZA 4ECWA 4R63A 3FYHA 4R65A 5D49A 4S3NA 7ICPA 4RNMA 4MFFA 4KMUA 9ICEA 1TV9A 3H40A 1ZQOA 1ZQTA 1YLQA 4X4PA 4NLGA 4RWPA 4YR2A 2AQ4A 3C1YA 2Q66A 1ZQCA 2W9AA 4Q44A 5DB8A 5J0PA 3HIYA 4TURA 3V6KA 3RJEA 1PZNA 3WFOA 4J9OA 8ICHA 2R8JA 2ZHAA 2ZH4A 1UT5A 4I2JA 4P4OA 2LYHA 3QZ8A 4ECUA 4LVSA 2MUTA 1N56A 2NRVA 1L5UA 5IIJA 4KLGA 1NJXA 9ICWA 5KG2A 3Q8KA 1Z00A 4DSJA 5C5JA 3BQTA 5KFGA 1KRPA 4UBBA 2PXIA 4ECVA 5EWFA 1L3TA 4ED2A 7ICRA 4RQ4A 3PY8A 1NKCA 4DOAA 4NLZA 2HHUA 1NOMA 4QW8A 2ZTCA 2ZH9A 4F4XA 2JEFA 4M6WA 2AJQA 1ZETA 4Z6FA 3PW5A 3TAQA 4WC5A 4O3QA 5IIIA 3T5KA 1NK7A 2KZZA 3B0YA 4F93B 4QZDA 1KTQA 1KFSA 4C8KA 4AT9A 3OGUA 3RTVA 2ZHBA 3JPSA 2OWOA 5KFVA 2C22A 2VA8A 1ZQRA 9ICUA 2Y1JA 5KFTA 3Q8RB 1R89A 3MGIA 4X4NA 4C8OA 8ICKA 3JPRA 2Y1IA 3RH4A 5J2FA 2W9MA 1T8EA 2UVWA 4M47A 1D9DA 3HX0A 3PV8A 1DK3A 4E7XA 2ZH5A 3K4GA 1ZQLA 1R8AA 4ED1A 1C7YA 1D9FA 4QZFA 1MIVA 2A1JB 3Q8SB 4I29A 3BQ2A 1K1QA 4UB4A 2ZUBA 4QWDA 1TK8A 2IHMA 1NK4A 4LZGA 2HHQA 2ZH1A 2M2TA 1AROP 2NRWA 1T7PA 3OVBA 4F5PA 4QZ9A 3HPOA 2I9GA 5DGBA 4B9MA 4DFJA 4EZ9A 2UVRA 3M8SA 3ZD9A 5KFRA 4ECXA 7ICKA 7ICEA 4QZ8A 5KG7A 4DOCA 4KLEA 4WC1A 4JUZA 5J0OA 4UBCA 3RAQA 2KFZA 7ICOA 4M5DA 4XQ8A 5J0RA 4Q45A 1KDHA 4EP7A 3PX0A 4BXOB 4DSKA 8ICJA 2FPMA 1XSPA 7ICIA 1KFTA 4MEYA 1QSYA 4IQTA 9ICRA 3C2KA 4KLTA 4I2CA 2R8HA 9ICGA 1BPDA 3GILA 4MFCA 5KG0A 4JK1A 1ZJMA 3V6HA 2W8LA 1TFWA 3UPSA 2ZH8A 1WCLA 3OJUA 3TFSA 3RB4A 3OSPA 4RQ3A 9ICPA 4F5OA 4RWNA 4RUCA 1SL0A 3EW9A 1ZYQA 4Q8FA 4MF2A 4EBDA 4EZ6A 4ATBA 4ECYA 5CP2A 4C8MA 3H8SA 3H39A 1JIHA 1RYRA 1BPYA 3OHAA 5KFMA 5J0XA 4F92B 3Q8QB 1UA0A 2PBEA 1S9FA 4B9VA 4C8NA 5DB9A 8ICGA 4RZRA 5HREA 1XO1A 4O0IA 3JPQA 4R66A 4DS4A 4KLIA 4YR0A 4M9HA 4FHXA 3PW4A 4F3OA 1Z3EB 1ZQUA 3MDCA 4RPYA 5EOZA 2UVVA 2BDPA 1HUOA 2H5XA 1SKRA 5CR0A 5CB1A 2DPIA 4PH5A 1U49A 5HRFA 4DEZA 1S0NA 4F4WA 2HHPA 2ZH6A 4UB5A 1U4BA 2IBKA 3RJIA 2VANA 2DR7A 5DBAA 5HRIA 4YG2A 1HUZA 4AT7A 2XY7A 4M9JA 1KFDA 5KFJA 3PX4A 1SZPA 4X4QA 1JXEA 1ZQBA 2PFPA 1NJYA 1LV5A 4JWMA 1Q79A 3AQLA 7ICVA 3RBEA 4I2BA 2NRZA 4KITB 5DLFA 1ZQNA 2PFNA 3RJHA 1RXWA 3KTQA 1CEZA 1BNPA 3LWMA 5BPCA 3WFQE 2XGPA 1S76D 2BQ3A 2DVIA 3C2MA 3H8JA 3MR6A 4X4SA 4EBEA 2PI5A 3GV8B 4FH5A 2AQ0A 9ICLA 5DQIA 2C2RA 4M6WB 3WFSC 4O3OA 1ZQIA 4LZDA 3H38A 3V7LA 1BGXT 4AT9B 5HP4A 4TUSA 4JV2A 1WCNA 1TVAA 5J2AA 4GXJA 1BPEA 4WBYA 5KFZA 4RQ5A 4DS5A 4TQRA 5IIKA 4RUAA 4YVZA 3MR5A 3K75D 8ICCA 4I2AA 4GLXA 3EPGA 4FS2A 4FHWA 5J2KA 9ICFA 3JPOA 1X9SA 1JXLA 3G6XA 4QZIA 4DQSA 4YP3A 4DFPA 4M04A 3RR7A 8ICIA 2V9WA 4DL2A 4M2YA 1COOA 4BWMA 4RPXA 2C28A 2PI4A 2R8KA 3Q8MA 4IQVA 1TAQA 4JWNA 3M8RA 7ICSA 4EBJA 4X4TA 3V7KA 1HJPA 4KN4A 2NRXA 5KFSA 4NLKA 4KLSA 1JQRA 5L1KA 4BGDA 4DWIA 2ASDA 4O3RA 2HHXA 3GQCA 1RZTA 2F1IA 3HJ4A 4DFKA 3N97B 2ISPA 4Z6DA 9ICKA 2W9BB 4DSLA 3GDXA 1U48A 2FLLA 3KHRA 3SYZA 2BPCA 3RJFA 1F5AA 5KG6A 4FHPA 5J29A 4DO9A 4QZCA 2XY6A 4M9LA 1VFGA 4IG8A 3PX6A 9ICOA 1UEUA 4RQ6A 4GC7A 2XCAA 3SZ2A 3ZDCA 5KFDA 9ICVA 4ECTA 4DLGA 2R8GA 4RQ7A 1TAUA 4LT6A 4I28A 3Q8PB 3UQ2A 4AT8A 2XC9A 2RDJA 1L3VA 3FDSA 1XS9D 5HHIA 4KLHA 2FLNA 4ATBB 1QTMA 4YD2A 3THVA 4ED8A 1ZQQA 1TFYA 3MFHA 3UXOA 2W9CA 3EYZA 5DGAA 1S10A 3GFKB 5KFPA 2WTFA 2AU0A 2J6UA 1CUKA 4ZH4A 4RQ0A 1MIYA 4DF8A 3AU2A 4UB2A 4F4YA 1ZJNA 1NO5A 7ICFA 3GIKA 5IINA 1ZQDA 3WFPA 5KFOA 5DBCA 1U45A 2ISOA 2Q0ZX 1ZQHA 3UXNA 1DK2A 3C2LA 4XA5A 5HR9A 5J2DA 1BPBA 2KP7A 4O9MA 2ZJAA 3GV7B 4I2FA 3AQMA 4WCWA 5KT4A 2KFNA 7ICQA 1MQ3A 4NKTA 5EWGA 5BOMA 4AT7B 4UB1A 3EWAA 1JMSA 4MEXA 4HYKA 4Q8EA 4GXKA 4NLNA 1JAJA 3MR3A 5DB6A 4I27A 3OUYA 5KFBA 2XCPA 3GIJA 4IR1A 1TFRA 5DKWA 4TUPA 9ICHA 3JPTA 4QZBA 4RQ2A 8ICVA 4NM2A 4PHEA 8ICLA 2W9BA 1ZQPA 3M9MB 4KLUA 4M9NA 1JN3A 5D46A 2BCUA 7ICTA 1VJ7A 4O3PA 3H3AA 4K4GA 3AQNA 5KT5A 4F91B 7ICGA 3IHQB 4KLJA 4DFMA 4FHVA 4PGYA 5J2CA 2FPLA 2KZ3A 1S0OA 4I2GA 1RXVA 8ICBA 5JUMA 1OU5A 1ZQZA 9ICQA 1ZQKA 4J9LA 3MR2A 2RDIA 4YMOA 3TARA 1KSPA 2PFOA 2PFQA 2P6RA 2ZH7A 3C21A 3RRGA 1XWLA 9ICTA 4X0BA 4DL4A 1ZQEA 4F2RA 5KFHA 3RAXA 1EXNA 4IRDA 5D4BA 3PW0A 2AGPA 2DR8A 2ZJ8A 3QEBZ 2DRBA 2HW3A 3TAPA 1NZPA 1NJWA 4I2DA 4QZGA 5L1LA 3T5LA 4X5VA 4UQGA 5J2BA 1ZQSA 5DEDA 4WC4A 2BCQA 4PGXA 4QWAA 4B9SA 2JZBB 4O5KA 3B0XA 2BGWA 3H37A 2HHTA 4F8RA 2NRTA 1MQ2A 5KFQA 5KFYA 9ICBA 9ICXA 1TKDA 2JEJA 4QWBA 3MBYA 2BCRA 3C23A 8ICFA 3G6VA 4O3SA 3IM1A 5J2GA 3EZ5A 3RRHA 1V9PA 4ECQA 1ZQXA 5IILA 2ID1A 3HJ1A 1ZQAA 3RH6A 2FMQA 1U9LA 1N48A 3EPIA 4UAWA 3M9OB 4IRKA 2M2VA 4AT8B 4PHDA 3C5GA 4FO6A 2MAXA 2ZJ5A 4EEYA 1XC9A 4CCHA 4ELUA 3AUOA 4RT2A 4NY8A 7ICNA 8ICUA 8ICXA 4IR9A 3RBDA 4ELTA 1S77D 3OV7A 2W9CB 3T5JA 4UD5A 5KG5A 4ECZA 3RB6A 2KTQA 4FH3A 2ASLA 1TK5A 4X0AA 8ICYA 2ALZA 3KHLA 5KFCA 3RH5A 1MC8A 3GV5B 1JX4A 1BPXA 3SV3A 4QWEA 3V6JA 1KEJA 2IHNA 4UB3A 3GIIA 4ED7A 3SI8A 3ZDDA 3MDAA 4XQ7A 1A76A 2W8KA 4M0AA 4KLMA 4PGQA 4J9NA 1H38A 3C1ZA 3AU6A 3OVAA 1R8BA 3HP6A 4B9NA 2BQUA 5J0WA 4F5RA 2VA2A 8ICWA 4TQSA 3PW2A 4RNOA 1D8YA 3RB3A 4O3NA 2FLPA 8ICQA 4MF8A 1SL2A 7ICHA 4M9GA 1X9WA 2BCVA 3TI0A 3H8WA 4RT3A 5CJ7A 4RPZA 2HVIA 3UXPA 3OUYB 1XU4A 5HRBA 5DG9A 3ISCA 4QZEA 3PMLA 3T3FA 3UQ0A 4IQUA 3HWTA 4DL5A 4XUSA 2JEGA 3ZDBA 4DQPA 2JZBA 3ISDA 3OVSA 5TZVA 4YXMA 4UD4A 2XGQA 5KG3A 3HT3A 2BCSA 5DQHA 1FA0A 3H7IA 5J2HA 4DL6A 3PMNA 4C8LA 4PPXA 4NKUA 5KFEA 2HHVA 3C5FA 5KT3A 1U47A 2I1QA 4B9LA 4F2SA 3BJYA 4IQWA 4I2HA 3ETLA 5KFKA 4F4KA 8ICEA 1X2IA 4EYIB 2JEIA 4I2IA 4KLOA 9ICNA 1NK8A 3QZ7A 2FMPA 3E2EA 2HHWA 3TQ1A 3PNCA 2FPKA 8ICOA 4QW9A 4E80A 4DLEA 4WC7A 2ZUCA 4XRHA 8ICTA 4NM1A 2B21A 4ED3A 1MSWD 3ZDEA 4QZHA 1ZQJA 2ZH2A 5HC9A 9ICJA 8ICRA 1SKWA 5IIOA 3NGDA 4DQQA 3AQKA 2XY5A 5L1JA 2BPGA 4FBUA 5J0UA 2BR0A 5HRKA 1WOTA 4B9UA 5J2EA 4EYHB 3TFRA 3JPNA 4ED6A 5CHGA 2C2EA 4KLFA 1B22A 9ICMA 5F2VO 3WFRE 4YFKA 5DB7A 3RJJA 1BNOA 3MABA 4KN7A 2HHSA 2IA6A 1QSSA 4YQWA 2ZTEA 3BQ1A 1SKSA 1RPLA 4P4PA 1NKEA 4DSIA 3LQCB 3C66A 2ZH3A 5KFFA 4WC0A 1NK9A 7ICLA 1MIWA 3ZD8A 2M9NA 3OHBA 9ICIA 2M2WA 4GC6A 1Y88A 3TANA 2BQRA 4P4MA 4DQIA 3NTUA 4Z6EA 3QE9Y 5DQGA 3QEAZ 7ICUA 3PVXA 1Q78A 4WBZA 4DOBA 2AGQA 4ECRA 8ICSA 2DPJA 3JZ0A 5DDMA 1XSLA 2BHNA 3MFIA 1S97A 1T4GA 4WC2A 2C2DA 4YR3A 4QZAA 2V4QA 1KLNA 4DSEA 5L1IA 2HVHA 4ELVA 1IM4A 2GWSA 5HHHA 5IIMA 1D8LA 5KFAA 5HNKA 4KLQA 3LK9A 5EWEA 3KHGA 2P6UA 8ICZA 1X9MA 4X4RA 4J9RA 4YMMA 5J0SA 5J0TA 4DL7A 5KG4A 5DECA 4DQRA 3OJSA 5J0YA 3HW8A 3RJKA 2XO7A 2KZMA 4G3IA 2VA3A 1XSNA 1PX5A
chains in the Genus database with same CATH superfamily
1K1SA 5KNIA 5F9LA 2ASJA 4J9SA 2EZYA 2ZIWB 2BE3A 4PHAA 4PHPA 2O5AA 2BKEA 4R8UB 1WYGA 3J81j 4MFAA 3NYBA 2FDRA 5ALYA 1SL1A 1L6NA 1LB2B 1TK0A 1A0PA 2DKZA 4UAYA 1S5LU 3RR8A 5CA7A 4MKPA 3Q8LA 4RWQA 4F50A 4Z6CA 4QWCA 3SV4A 2O1PA 4J9MA 2F8KA 4DSFA 5AIAA 4R64A 5AM5A 5KT2A 2M2UA 4LEYA 2KJ5A 4E8FA 2RFFA 4FFDA 2VJ4A 2W7PA 3M1YA 5KFNA 1QLNA 4RQ1A 5KFIA 3MGHA 8ICMA 3G6YA 2HMXA 4BWJA 4RU9A 5J0QA 4EEDA 2F1HA 3ISBA 4EBCA 4FS1A 2QLTA 1Z1BA 4JV0A 1NK5A 4PL2A 1UEVA 2DFLA 4N7RA 4FZNA 3V7JA 8ICPA 4YMNA 5J2JA 1OXJA 4NL9C 4TUQA 5KT7A 3ORYA 4FHYA 5F2VO 5DG7A 2YMMA 5KFLA 4YXJA 2HN1A 5D49A 7ICPA 5AKHA 4RNMA 9ICEA 4EELA 2WAQF 3HRDD 4NLGA 2AQ4A 2HBMA 3C1YA 2Q66A 1ZXIA 2F76X 4Q44A 3AQEA 2W9AA 2G06A 3V6KA 2ZHAA 2R8JA 4ECUA 2MUTA 2NRVA 1L5UA 5IIJA 2KOBA 1NJXA 4FO1A 1Z00A 5ALQA 4DSJA 3WK8A 3HKZF 3WK9A 2DGZA 3RFAA 4QW8A 2ZTCA 2JEFA 2AJQA 3PW5A 4O3QA 4WOYA 1NK7A 4F93B 3SD7A 3C28A 2ZIXB 5AHXA 2OWOA 9ICUA 5KFTA 1AQ6A 4KX3A 4X4NA 3JPRA 4BUGA 1T8EA 1DK3A 1A6SA 2ZH5A 1R8AA 1D9FA 3BQ2A 2IHMA 4UB4A 2ZH1A 2O6KA 3F2DA 1KBUA 1AROP 2KE7A 2IOHA 1T7PA 1FEZA 4QZ9A 3HPOA 2I9GA 4WBYA 2UVRA 7ICKA 7ICEA 4QZ8A 4JUZA 5J0RA 1N5XA 2N1RA 4EP7A 3PX0A 1KFTA 7ICIA 4IQTA 3C2KA 4KLTA 4MFCA 1ZJMA 2ZH8A 1WCLA 2Z7JA 3EW9A 3NVZA 2IHOA 1ECWA 4MF2A 4ECYA 1JIHA 1BPYA 3OHAA 5KFMA 5J0XA 4UB8U 3Q8QB 1UA0A 2PBEA 1PUZA 4Y2SA 1S9FA 3PSFA 4C8NA 8ICGA 2XIDA 4O0IA 4R66A 1SXEA 4YR0A 1Z3EB 5EOZA 2BDPA 2H5XA 5D61A 4F4WA 5AKLA 2QB0B 3QU5A 1U4BA 2DR7A 1RQLA 4AT7A 2WB1C 2JV3A 4X4QA 2PFPA 7ICVA 3RBEA 1ZQNA 3KTQA 2XGPA 4C4RA 3C2MA 2PI5A 4FE3A 4QNLA 2ZXIA 3WFSC 4M6WB 3NS1A 4NWIA 5HP4A 2KSOB 4DS5A 4TQRA 2CPRA 4YVZA 4RUAA 1O08A 3EPGA 3IDWA 2CN1A 5J2KA 1DXSA 3G6XA 4M04A 4O68A 2C28A 2PI4A 2D3DA 2KVSA 4X4TA 4KN4A 2HBJA 2JXJA 3BS7A 3SENA 2CXYA 4BGDA 3HKZC 2HHXA 2ISPA 4Z6DA 9ICKA 1QCKA 3GDXA 1U48A 2FLLA 3KHRA 2XVTA 2YTUA 5J29A 1VFGA 4QZCA 5AK5A 3PX6A 9ICOA 4RQ6A 3SQIA 5B5EU 4LT6A 2RDJA 4JLXA 3FDSA 3MCRA 4ATBB 1ZQQA 2W9CA 1B4FA 3GFKB 2AU0A 4ZH4A 3AU2A 1ZJNA 5H2FU 3GIKA 1PK1A 5IINA 1ZQHA 1DK2A 4XA5A 1BPBA 5K4LA 4WCWA 5AM3A 3F2BA 4HYKA 4GXKA 1XO0A 4I27A 9ICHA 4PHEA 3GZFA 8ICLA 2WF9A 1V85A 4M9NA 5ALLA 4K96A 3I1YA 4F91B 2HI0A 4KLJA 4KB6A 4PZNA 1S0OA 1RXVA 1UHUA 9ICQA 2PFQA 3TARA 1XWLA 3F5AA 2Y0SC 1LKYA 4CF5A 2VIXA 2ZJ8A 1ZQSA 4X5VA 2A1AA 5DEDA 3ZI4A 5CHEA 4QWAA 2HHTA 2NRTA 1MQ2A 4K8VA 2JEJA 4OAIZ 2BCRA 2G5HB 4O3SA 3IM1A 5J2GA 3UMGA 1ZQXA 2ID1A 1ZQAA 1U9LA 1N48A 2K89A 3M9OB 4PHDA 5EE1A 4FO6A 4CCHA 5ALDA 3RBDA 1S77D 1FFVA 3T5JA 2KTQA 2ASLA 3F53A 1TK5A 3KHLA 5KFCA 1RM6C 2I5HA 2ZIVA 4NXXA 4XQ7A 4KLMA 2W8KA 2M0NA 4OD0A 3L4PA 1R8BA 4OJLA 2BQUA 4B6JA 4M9GA 3SAFA 2BCVA 5AM2A 2EZZA 2HVIA 3UXPA 3OUYB 5DG9A 4QZEA 3PMLA 2JEGA 4IQUA 5ALGA 3OVSA 2LM4A 1FFUA 3HT3A 1TE2A 4C8LA 3IG8A 3CNHA 5KFEA 1JALA 5KT3A 3BJYA 5KFKA 4EYIB 4LEWA 9ICNA 2FMPA 3TQ1A 3QUQA 4QW9A 4DLEA 2ZUCA 4XRHA 3SEIA 4ED3A 3WKAA 9ICJA 8ICRA 2BPGA 4FBUA 3TFRA 4EYHB 4KLFA 5CHGA 3N7PD 4YFKA 3NASA 2G08A 2HHSA 1QSSA 1NKEA 4DSIA 1QQ5A 4WC0A 2E1EA 1NK9A 2RLTA 1MIWA 4PL1A 3F5EA 5B66U 4LEZA 3TANA 4WBZA 2K8AA 4Z6EA 5DQGA 3QE9Y 3PVXA 4USAA 5EE3A 4O69A 1YZ6A 4ECRA 2DPJA 5AM0A 1XSLA 5C0YA 2HVHA 5L1IA 1D8LA 1SXDA 4KLQA 3PSPA 5EWEA 2B0CA 3KHGA 2K4PA 5J0TA 2KK0A 4DQRA 3QU7A 3OJSA 2KZMA 2HBKA 3H0RB 2XO7A 4G3IA 2VA3A 1XSNA 3JYYA 1V38A 4BDPA 1ZQMA 2DRAA 4WQLA 4EGWA 2BZFA 1X6JA 4I2EA 4JV1A 1Z4OA 4YCXA 2WHEA 4EEKA 3PR5B 7ICMA 3CK6A 4OCZA 2G0AA 1ZQGA 4DL3A 1UA1A 3C18A 3OSNA 5KT6A 1L3SA 3TACB 1QSLA 4GXIA 4AYBF 2J6SA 2NYVA 4Y2XA 3ICXA 2BDUA 2B4VA 4LEVA 4O5EA 5KAIU 3M9NB 1SWVA 2JH1A 4P2HA 2DR5A 2F3NA 2Y9UA 3LVWA 4K4HA 3PHZA 1ZQFA 5HRDA 2FMSA 2MRLA 5ALUA 4NXZA 4KTQA 5AKZA 2BPFA 5HMMA 3AN1A 2A1JA 5J8YA 2MUTB 1DGSA 1Z00B 5AKYA 2LPEA 5KFUA 1V4AA 4Y2PA 4FBTA 1ZQ1C 3BQ7A 3N4MB 5HMLA 4ECSA 4EBKA 3KZIU 2F2AB 4X4OA 2KHVA 4RWOA 7ICJA 2ESEA 2K60A 4E0DA 2RP5A 1IXRA 3QX7A 4J9QA 3H4BA 1V97A 4K9BA 4J9KA 4HX0A 2ZUDA 4O67A 1T3NA 4KLDA 1NJZA 1NK6A 4ED0A 2ES6A 9ICTA 4ECWA 4CNQA 3E58A 4R65A 4UW9A 3HILA 2VJ5A 1TV9A 1YLQA 4X4PA 1KN5A 2E5SA 1ZQCA 5DB8A 2W43A 2ZIUB 3RJEA 4Y2TA 4J9OA 8ICHA 2ZH4A 4P4OA 3BS5B 5D62A 2E8OA 1N56A 3H8MA 2GAFD 4U6PA 3S6JA 3BQTA 3QU4A 2KKVA 4UBBA 5EWFA 7ICRA 1NKCA 4NLZA 4P0QA 5AKKA 2FCLA 1ZETA 2L5YA 4Z6FA 2KICA 4WC5A 3T5KA 4QZDA 1KTQA 3RTVA 3JPSA 5KFVA 3Q8RB 2HCFA 2Y1IA 2W9MA 4F71A 1PVQA 2LYBA 3K4GA 3L3FX 5AM4A 3Q8SB 1VDVA 5FP0A 3KBBA 2RRDA 2EWRA 4B9MA 4ECXA 3ZD9A 5KFRA 4WC1A 2EH9A 4AYBC 4DOCA 4KLEA 7ICOA 3RAQA 2KFZA 4M5DA 4BXOB 3RF9A 4DSKA 8ICJA 1XSPA 1L8OA 1QSYA 2E8PA 2R8HA 4I2CA 1BPDA 4ICAA 3GILA 9ICGA 5KG0A 4JK1A 1TFWA 3OJUA 3RB4A 3OSPA 4RQ3A 4C0ZA 4FZMA 4C4TA 2R18A 4CDGA 1PVRA 4EBDA 4EZ6A 5CP2A 4C8MA 3H8SA 1HIWA 4RZRA 1IIPA 5HREA 4DS4A 3OTQA 4F3OA 1ZQUA 2UVVA 1SKRA 5CR0A 2DPIA 4DEZA 2HHPA 2IBKA 3RJIA 5GTHU 5DBAA 4P0PA 4Y2VA 3D2NA 3PX4A 3NVWA 2RQ5A 1LV5A 2NRZA 5DLFA 3RJHA 1BNPA 2WFAA 1S76D 2DVIA 9ICLA 4O3OA 1ZQIA 4O6AA 1TAMA 4OJ5A 4AT9B 2WB1F 4EX7A 4JV2A 5J2AA 5ALHA 2H3IA 3K75D 4BJQA 4I2AA 4GLXA 3BZCA 4FS2A 4FHWA 2W04A 1X9SA 8ICIA 3KKAA 4JMUA 2R8KA 1QH9A 3M8RA 4GFJA 4Y2JA 4O3RA 1RZTA 2F1IA 3HJ4A 4DFKA 3MGVA 1MN8A 3SYZA 2BPCA 3RJFA 1F5AA 1RG6A 2E8NA 2W54A 2GH1A 5KFDA 5GTIU 4AT8A 3UQ2A 4US9A 1L3VA 1XS9D 1N60A 2FLNA 1L7PA 2YN4A 3THVA 1TFYA 3UXOA 1R8CA 1ZD2P 2ISOA 2Q0ZX 4IC9A 5ALNA 1VJ5A 5HR9A 1OUQA 4O9MA 4K98A 5KT4A 2KFNA 2PMZC 5ALKA 5BOMA 4OAFA 4UB1A 3EWAA 4Q8EA 3QU2A 3MR3A 5DB6A 3H0LB 5KFBA 2XCPA 4IR1A 1TFRA 5ALOA 5DKWA 4TUPA 3JPTA 8ICVA 4WC7A 2W9BA 2OH2A 3M9MB 5D46A 7ICTA 7ICGA 3IHQB 2W3SA 4FHVA 5ALWA 2WF6A 5JUMA 3MR2A 2D6FC 2PFOA 5HR7A 3RRGA 4DL4A 5KFHA 3RAXA 4C7YA 1IV8A 3PW0A 2DRBA 4JB3A 1SZHA 4QZGA 3T5LA 4WC4A 1NNLA 2BCQA 4O5KA 4B9SA 3B0XA 2DF4B 5ALRA 2KJ9A 4F8RA 3HJEA 3MBYA 2K4EA 2ZG6A 5KL1B 3CYMA 2Y0SF 2GLEA 3BZKA 3AMZA 3EZ5A 5IILA 2M2VA 4EEYA 2ZJ5A 1FA0A 3AUOA 4RT2A 8ICXA 2DKXA 3OV7A 4ELTA 2OXOA 1L7OA 4UD5A 2YMLA 2WF8A 4X0AA 8ICYA 2ALZA 3RH5A 1MC8A 3K1ZA 3GV5B 1BPXA 2KMDA 4QWEA 1KEJA 3MDAA 3CRXA 2H3VA 3AU6A 2YMPA 3HP6A 1NZBA 1ZD3A 3F2CA 2ZIWA 2AH5A 1SL2A 5T14A 1X9XA 3KOOA 1X9WA 5AKEA 5CJ7A 1P7DA 3ISCA 2RHFA 4DL5A 3ZDBA 3HWTA 4DQPA 2Y9TA 2JZBA 4YXMA 4UD4A 2KIVA 4OAGA 2XGQA 2BCSA 5J2HA 2G07A 3C5FA 3ERCC 4NXTA 4F4KA 1X2IA 4KLOA 5J8YC 4K9AA 5JTIA 2HHWA 3PNCA 5ALZA 2B21A 5AK6A 4QZHA 2ZH2A 3D6JA 2GOLA 5HC9A 2ZXHA 1RDFA 4DQQA 2XY5A 3AEVA 5J2EA 4ED6A 9ICMA 2F44A 1BNOA 3RJJA 4KN7A 3NVOA 2H3FA 3IN5A 2IA6A 3B9JA 4YQWA 3BQ1A 3LQCB 4P4PA 3OHBA 4E80A 2AGQA 2BBHA 3JZ0A 2K4HA 5DDMA 1N62A 3MFIA 2KKPA 1T4GA 4YR3A 2V4QA 1KLNA 3QU9A 1WG8A 5HHHA 5IIMA 5HNKA 1C20A 2ODGA 3LK9A 1RYUA 3ER8C 4J9RA 2VKQA 2LYAA 3IP4B 1SV4A 5AI0A 5J0YA 3RJKA 3WU2U 1PX5A 4YN4A 3T5HA 3NUQA 2F1JA 4YD1A 5JRTA 4IL6U 1DOQA 1ZRNA 2AGOA 3E0FA 2HDOA 5ALEA 5BOLA 4Q43A 5L9XA 4K4IA 1RYSA 3SAGA 2V4RA 3ZDAA 8ICAA 5DLGA 5KFWA 1S0MA 2P66A 1RQNA 4X4UA 1HEKA 5DDYA 3NVVA 2W7OA 1WUDA 4DF4A 2UVUA 3D2QA 4RQ8A 2ZIXA 1KW4A 3R9KA 1UETA 1NK0A 3RJGA 9ICAA 4C80A 1ZQYA 4WC6A 3C29A 3LWLA 2BBJA 1BPZA 2EDUA 4OO1J 2R8IA 5G5GA 5KFXA 3KD3A 5HRGA 1L3UA 1JRPA 4X4VA 2K8BB 3SMVA 4US8A 1ED1A 3RB0A 2HOIA 2K4IA 1KNYA 4F5QA 3UPQA 3L9DA 3UM9A 4CRXA 2KIWA 2E8MA 3V72A 2KN7A 1N5WA 2ZTDA 9ICSA 3PW7A 2G5IB 1B43A 1ZQWA 4IRCA 3PR4A 5F9NA 1S0VA 4R63A 3FYHA 4HAIA 4KMUA 3H0MB 1SIJA 1ZQOA 1ZQTA 4RWPA 4NJ8A 4YR2A 1XNSA 3EF2A 3HIYA 5EE0A 4CE6A 2QB0A 2GA9D 1PVPA 1QQ7A 4KX5A 1N2XA 4KLGA 9ICWA 5KG2A 3Q8KA 2W55A 5KFGA 1KRPA 2PXIA 4UASA 4DFDA 4ECVA 1L3TA 5AI5A 4RQ4A 4DOAA 2HHUA 2MSNA 3KKAC 2ZH9A 4M6WA 4Y2YA 5IIIA 4EENA 3B0YA 4C8KA 1KFSA 4NXUA 4C4SA 2KSOA 2ZHBA 2C22A 2VA8A 2Y1JA 4ACOA 3MGIA 2NRKA 1X66A 3RH4A 2UVWA 5ALIA 1D9DA 4E7XA 1ZQLA 1GO3F 4QZFA 1MIVA 1TK8A 1K1QA 4QWDA 1NK4A 4LZGA 2M2TA 4F5PA 5DGBA 4DFJA 4EZ9A 3M8SA 2LKYA 5KG7A 4UBCA 5L1MA 2W03A 4XQ8A 2F8LA 2YY6A 3K7DA 1ZOLA 4MEYA 3V6HA 4BX9C 9ICPA 1WWVA 2KG5A 4RWNA 1SL0A 3U26A 1ZYQA 2AXTU 4Q8FA 3WKDA 4ATBA 1JROA 3H39A 4K97A 1RYRA 3D2SA 2XICA 4F92B 4B9VA 5DB9A 4QIWC 4M9HA 4FHXA 3PW4A 4RPYA 1HUOA 5CB1A 2ZH6A 1S0NA 1COKA 1IG6A 2VANA 5HRIA 3I28A 4YG2A 1HUZA 3FM9A 5KFJA 1SZPA 1JXEA 2OYYA 4J03A 1NJYA 1ZQBA 4JWMA 4I2BA 4KITB 2PFNA 1CEZA 1RXWA 1FIQA 3VC8A 3LWMA 3WFQE 3H8JA 3MR6A 4PJ0U 5A0LA 4EBEA 2AQ0A 5AK3A 2YB1A 5AI9A 2FE9A 4TUSA 1WCNA 1TVAA 4GXJA 1BPEA 5IIKA 2YB4A 4OJ6A 3JPOA 1JXLA 1KKXA 4DQSA 4YP3A 4DFPA 3RR7A 4M2YA 1COOA 4BWMA 4RPXA 4IQVA 7ICSA 3KFUF 4EBJA 2NRXA 1UCVA 4NLKA 2E1FA 4KLSA 1JQRA 1KL9A 1WWUA 4Y2UA 2ASDA 1FO4A 3GQCA 4EEBA 3TADA 3N97B 2KJ8A 2W9BB 2EQYA 4DSLA 5JTGA 2OEHA 4FHPA 4M9LA 1UEUA 2LM1A 2XCAA 3SZ2A 5F3XB 2R8GA 3IV6A 4RQ7A 1TAUA 2DL0A 2XC9A 2G09A 4UARA 5AICA 5HHIA 4KLHA 3MFHA 3EYZA 1S10A 1MIYA 5KFPA 1CUKA 2FI1A 4DF8A 2OCEA 4UB2A 4F4YA 3PSTA 7ICFA 3M6ZA 1ZQDA 3WFPA 3UXNA 5J2DA 4F72A 2OM6A 2ZJAA 4I2FA 2DQNB 7ICQA 4NLCA 1MQ3A 4GIBA 3LVVA 4AT7B 3MC1A 1JAJA 3OUYA 3GIJA 5B3PA 1L8LA 2Q4TA 4RQ2A 2HN2A 1ZQPA 2LHTA 3H3AA 2PMZF 5KT5A 1Q46A 4DFMA 4PGYA 5J2CA 3A0BU 2FPLA 4I2GA 5AI4A 8ICBA 3QXGA 2NO5A 2D8CA 4YMOA 1KSPA 2KD1A 3C21A 3UMCA 4K99A 3TKAA 3NWIA 2W11A 1ZQEA 1EXNA 1SWWA 1MA7A 2AGPA 3L5KA 4OJPA 1Z19A 4KM5A 3QEBZ 2HW3A 3TAPA 4I2DA 3NVYA 4PGXA 2JZBB 2E3TA 2DBYA 2BGWA 2KEYA 9ICXA 5KFYA 1TKDA 3RRHA 4ECQA 5EE9A 3HJ1A 1X6IA 3EPIA 4A8EA 4IRKA 3C5GA 4EV6A 3DV9A 1XC9A 8ICUA 7ICNA 2W9CB 4UB6U 3RB6A 4FH3A 1PK1B 1UPHA 3SV3A 3V6JA 2JR5A 2IHNA 4UB3A 4ED7A 1A76A 1T94A 4J9NA 1H38A 3C1ZA 3OVAA 4B9NA 8ICWA 5J0WA 2VA2A 4TQSA 3PW2A 4RNOA 2FLPA 3RB3A 8ICQA 7ICHA 4MF8A 2IUBA 3TI0A 3H8WA 2YX8A 4RT3A 4RPZA 1XU4A 3T3FA 2WF7A 3UQ0A 5KG3A 5DQHA 4AP9A 4NKUA 4DL6A 4PPXA 1SV0A 1U47A 2QB1A 3ETLA 8ICEA 2JEIA 4I2IA 1NK8A 2AHOB 3E2EA 4PZOA 2FPKA 8ICTA 5G5HA 4NM1A 1J2MA 1MSWD 1ZQJA 1SKWA 1LKYB 5J0UA 2BR0A 3WK7A 3JPNA 1B22A 5DB7A 3MABA 2HBLA 2ZTEA 1SKSA 1RPLA 3C66A 2ZH3A 3CW2C 5KFFA 2QKQA 2IOFA 3ZD8A 9ICIA 3IRUA 2M2WA 1Y88A 5ALVA 3QEAZ 4NLBA 8ICSA 2YQEA 4OJOA 4WC2A 2C2DA 4CGZA 4DSEA 3PZPA 2GWSA 5KFAA 2JMGA 8ICZA 2EAMA 4X4RA 5J0SA 4DL7A 1ZD4A 5KG4A 2ZIVB 3HW8A 4UAUA 4UAZA 5J2IA 2J6TA 1A77A 3LDAA 3OPXA 3PO4A 2ZIUA 4RNNA 3JCFA 3M7DA 1NKBA 3A0HU 3BS5A 3SR6A 3QUTA 5HRLA 1F0MA 4B9TA 4NXWA 5HR6A 2JHDA 4KLLA 4F5NA 5JU5A 5KTQA 2ATLA 2KV2A 1N63A 3KHHA 2KHQA 1ZQVA 1Q3VA 8ICNA 3ER9B 2YMQA 1OW5A 2A19A 4WC3A 5CFSA 3H4DA 3BQ0A 5AKIA 2DWQA 2KVCA 5KG1A 3JPPA 2QARA 4UATA 2DR9A 5DBBA 5CWRA 4O5CA 1BVSA 3BDPA 3GIMA 2IOFK 5DG8A 3CP8A 3PO5A 4R8UA 1O03A 4BXOA 4J9PA 1UT8A 1ZD5A 3N28A 2HSZA 3WK4A 2WAQC 2IMWP 5HRHA 9ICCA 4CF3A 5AI6A 1F5SA 5AI8A 3SAHA 4F4ZA 1X42A 3DDHA 1DGJA 3PSIA 4MFFA 1J2NA 3H40A 2NO4A 5J0PA 4WJ3B 4TURA 3WFOA 1GPJA 1PZNA 3AQFA 1UT5A 4I2JA 2LYHA 3QZ8A 1JI7A 3QUBA 5C5JA 4U7CA 2WF5A 4ZOHC 4ED2A 2HOQA 3T79A 5CFUA 3PY8A 1NOMA 2PKEA 4F4XA 3TAQA 2KZZA 4AT9A 3OGUA 2W3RA 1ZQRA 4Y2RA 1R89A 2LBOA 4C8OA 8ICKA 3UMBA 5ALFA 3TADC 3IG5A 5J2FA 4M47A 3HX0A 3PV8A 4ED1A 1C7YA 2A1JB 4I29A 2ZUBA 2HHQA 2NRWA 3OVBA 3ONNA 4S3NA 1SB3C 5J0OA 2F77X 4Q45A 1KDHA 4NXVA 2MA1A 2FPMA 5D63A 9ICRA 3GU3A 2W8LA 2B51A 5AKJA 3UPSA 3TFSA 4F5OA 4RUCA 4XJEA 5ALMA 4O3MA 4OAHA 1XO1A 4KLIA 3JPQA 3MDCA 5ALJA 5HRFA 4PH5A 1U49A 4NL9A 4UB5A 3VCBA 5KAFU 2XY7A 2CRXA 1KFDA 4M9JA 1Q79A 2EZXA 3AQLA 4QIWF 5BPCA 5ALPA 4EX6A 2BQ3A 4P0QB 1DRGA 3GV8B 1PK3A 3WK6A 4FH5A 5DQIA 2C2RA 4LZDA 3H38A 3V7LA 1BGXT 5KFZA 4RQ5A 3MR5A 8ICCA 4KMOB 2LI6A 4FZLA 9ICFA 1L7NA 4QZIA 2V9WA 4DL2A 3Q8MA 1TAQA 4JWNA 2A3VA 3V7KA 1HJPA 1UQVA 5KFSA 5L1KA 4DWIA 2LMRA 3EUB2 3N7RC 3N7SC 5AKGA 1QQ6A 3K1RB 5TISU 4NV0A 2DUYA 5KG6A 4DO9A 2XY6A 4IG8A 2KNJA 4GC7A 3ZDCA 3FAHA 9ICVA 1B0XA 1K5OA 4ECTA 1F44A 4DLGA 4I28A 3Q8PB 3WKEA 1SGGA 2EAPA 3WKCA 1QTMA 4YD2A 4ED8A 4C7ZA 4LVSA 5ALSA 5DGAA 2WTFA 1JUDA 1VLBA 2J6UA 4RQ0A 4WQKA 1NO5A 4G9BA 5CFTA 5KFOA 5DBCA 1U45A 2H3QA 4DCCA 3C2LA 2KP7A 3GV7B 3AQMA 4I0UA 4NKTA 4P0PB 5EWGA 1JMSA 4MEXA 1SV0C 4NLNA 5AM1A 4QJFB 3FC4A 4QZBA 4NM2A 2HOFA 1URJA 4UAVA 4KLUA 1JN3A 2B6GA 2BCUA 1VJ7A 4O3PA 4K4GA 3AQNA 3NRWA 5ALXA 1J97A 5ALTA 4WH5A 2KZ3A 2I6XA 1OU5A 1ZQZA 4RQNA 1ZQKA 4J9LA 3AM9A 2RDIA 3O0FA 2P6RA 2ZH7A 3M6KA 4X0BA 1T3QA 4F2RA 4LJXA 3I76A 4IRDA 5D4BA 4IS7A 2DR8A 1NZPA 1NJWA 5L1LA 4CF4A 5J2BA 4UQGA 3H37A 5E79U 5KFQA 9ICBA 1Z4NA 4QWBA 3C23A 8ICFA 5AK4A 3G6VA 1M6YA 1V9PA 2JRZA 3RH6A 3OWGA 2FMQA 4UAWA 2NV3A 4AT8B 2MAXA 4ELUA 4NY8A 3WKBA 4IR9A 1D8BA 5KG5A 4ECZA 5CEHA 1JX4A 3LYSA 3GIIA 3SI8A 1KQQA 3ZDDA 4M0AA 1CRXA 4PGQA 1X40A 4RQMA 4F5RA 3ALRA 1D8YA 4O3NA 1L7MA 1YZ7A 5AIBA 5AKXA 2H3ZA 2EANA 1N61A 5HRBA 2JH7A 1LVHA 4XUSA 3ISDA 1YT3A 2FJ6A 5TZVA 3NKUA 3QYPA 3QNMA 1CI4A 3H7IA 3PMNA 2HHVA 4F2SA 2I1QA 4B9LA 4IQWA 4I2HA 5CRXA 3QZ7A 2K8CB 5B3QA 8ICOA 3ED5A 2MU2A 3NRZA 3WK5A 3ZDEA 5IIOA 3NGDA 3AQKA 1ZRMA 5L1JA 1WOTA 5HRKA 4B9UA 4JLZA 2C2EA 3WFRE 2OHFA 2XI9A 1Z1VA 2JGAA 5KL8B 3ETRA 4Y2QA 7ICLA 1Q8KA 2M9NA 4GC6A 2B56A 2BQRA 3QUCA 4MHVA 4P4MA 3NTUA 4DQIA 3AL0B 7ICUA 4X4SA 1Q78A 4DOBA 2BHNA 1S97A 3KZXA 4QZAA 2P35A 1IM4A 4ELVA 1S8OA 2GO7A 2P6UA 1X9MA 4YMMA 5DECA 3DEEA 2QARB 1NI3A 1Q3UA 2EAOA
chains in the Genus database with same CATH topology
4YN4A 1K1SA 5F9LA 3T5HA 4UAZA 2ASJA 5J2IA 4J9SA 2J6TA 2F1JA 4BDPA 1ZQMA 4YD1A 3JYYA 2DRAA 2BE3A 4PHAA 1A77A 1DOQA 3LDAA 4PHPA 2AGOA 2BKEA 3PO4A 4R8UB 4I2EA 2O5AA 4MFAA 5BOLA 4JV1A 4RNNA 3NYBA 4Q43A 5L9XA 4YCXA 1SL1A 3PR5B 1TK0A 1NKBA 4UAYA 1LB2B 1RYSA 4K4IA 7ICMA 1ZQGA 4FHYA 3RR8A 5CA7A 5HRLA 3Q8LA 4RWQA 4F50A 4DL3A 2V4RA 3ZDAA 1UA1A 5DLGA 4B9TA 8ICAA 4Z6CA 1R8CA 3C18A 3OSNA 5KT6A 1L3SA 4QWCA 3SV4A 1QSLA 4GXIA 2O1PA 5KFWA 2J6SA 4J9MA 1S0MA 2P66A 4DSFA 4R64A 4KLLA 4X4UA 4O5EA 4F5NA 5DDYA 3M9NB 2DR5A 4P2HA 5KTQA 2ATLA 5KT2A 4DF4A 2UVUA 2M2UA 4RQ8A 3KHHA 1ZQVA 8ICNA 4E8FA 4K4HA 2RFFA 1UETA 1NK0A 1ZQFA 4WC3A 3RJGA 9ICAA 5HRDA 2FMSA 1ZQYA 4NXZA 5KFNA 3H4DA 3BQ0A 4RQ1A 1QLNA 5KFIA 3MGHA 4KTQA 4WC6A 3LWLA 2BPFA 8ICMA 5HMMA 2A1JA 1BPZA 5KG1A 2MUTB 3JPPA 3G6YA 4BWJA 4RU9A 5J0QA 1DGSA 2R8IA 1Z00B 2F1HA 5DBBA 3ISBA 2DR9A 5KFXA 5KFUA 5CWRA 4O5CA 1V4AA 4EBCA 5HRGA 4FS1A 1BVSA 1L3UA 3GIMA 3BDPA 4FBTA 4X4VA 3N4MB 3RB0A 5DG8A 2NRKA 4JV0A 5HMLA 4ECSA 3PO5A 4EBKA 4R8UA 1NK5A 1KNYA 4F5QA 3UPQA 3L9DA 7ICJA 4RWOA 4X4OA 4E0DA 4BXOA 4J9PA 1UEVA 1IXRA 1UT8A 2DFLA 3V72A 4J9QA 2KN7A 3H4BA 3V7JA 2IMWP 2ZTDA 5HRHA 9ICCA 9ICSA 4J9KA 2ZUDA 1T3NA 8ICPA 4YMNA 4KLDA 5J2JA 3PW7A 1NJZA 1B43A 1ZQWA 4TUQA 5KT7A 4ED0A 3ORYA 1NK6A 3PR4A 5F9NA 5DG7A 4IRCA 1S0VA 5KFLA 4YXJA 4F4ZA 4ECWA 4R63A 3FYHA 4R65A 5D49A 4S3NA 7ICPA 4RNMA 4MFFA 4KMUA 9ICEA 1TV9A 3H40A 1ZQOA 1ZQTA 1YLQA 4X4PA 4NLGA 4RWPA 4YR2A 2AQ4A 3C1YA 2Q66A 1ZQCA 2W9AA 4Q44A 5DB8A 5J0PA 3HIYA 4TURA 3V6KA 3RJEA 1PZNA 3WFOA 4J9OA 8ICHA 2R8JA 2ZHAA 2ZH4A 1UT5A 4I2JA 4P4OA 2LYHA 3QZ8A 4ECUA 4LVSA 2MUTA 1N56A 2NRVA 1L5UA 5IIJA 4KLGA 1NJXA 9ICWA 5KG2A 3Q8KA 1Z00A 4DSJA 5C5JA 3BQTA 5KFGA 1KRPA 4UBBA 2PXIA 4ECVA 5EWFA 1L3TA 4ED2A 7ICRA 4RQ4A 3PY8A 1NKCA 4DOAA 4NLZA 2HHUA 1NOMA 4QW8A 2ZTCA 2ZH9A 4F4XA 2JEFA 4M6WA 2AJQA 1ZETA 4Z6FA 3PW5A 3TAQA 4WC5A 4O3QA 5IIIA 3T5KA 1NK7A 2KZZA 3B0YA 4F93B 4QZDA 1KTQA 1KFSA 4C8KA 4AT9A 3OGUA 3RTVA 2ZHBA 3JPSA 2OWOA 5KFVA 2C22A 2VA8A 1ZQRA 9ICUA 2Y1JA 5KFTA 3Q8RB 1R89A 3MGIA 4X4NA 4C8OA 8ICKA 3JPRA 2Y1IA 3RH4A 5J2FA 2W9MA 1T8EA 2UVWA 4M47A 1D9DA 3HX0A 3PV8A 1DK3A 4E7XA 2ZH5A 3K4GA 1ZQLA 1R8AA 4ED1A 1C7YA 1D9FA 4QZFA 1MIVA 2A1JB 3Q8SB 4I29A 3BQ2A 1K1QA 4UB4A 2ZUBA 4QWDA 1TK8A 2IHMA 1NK4A 4LZGA 2HHQA 2ZH1A 2M2TA 1AROP 2NRWA 1T7PA 3OVBA 4F5PA 4QZ9A 3HPOA 2I9GA 5DGBA 4B9MA 4DFJA 4EZ9A 2UVRA 3M8SA 3ZD9A 5KFRA 4ECXA 7ICKA 7ICEA 4QZ8A 5KG7A 4DOCA 4KLEA 4WC1A 4JUZA 5J0OA 4UBCA 3RAQA 2KFZA 7ICOA 4M5DA 4XQ8A 5J0RA 4Q45A 1KDHA 4EP7A 3PX0A 4BXOB 4DSKA 8ICJA 2FPMA 1XSPA 7ICIA 1KFTA 4MEYA 1QSYA 4IQTA 9ICRA 3C2KA 4KLTA 4I2CA 2R8HA 9ICGA 1BPDA 3GILA 4MFCA 5KG0A 4JK1A 1ZJMA 3V6HA 2W8LA 1TFWA 3UPSA 2ZH8A 1WCLA 3OJUA 3TFSA 3RB4A 3OSPA 4RQ3A 9ICPA 4F5OA 4RWNA 4RUCA 1SL0A 3EW9A 1ZYQA 4Q8FA 4MF2A 4EBDA 4EZ6A 4ATBA 4ECYA 5CP2A 4C8MA 3H8SA 3H39A 1JIHA 1RYRA 1BPYA 3OHAA 5KFMA 5J0XA 4F92B 3Q8QB 1UA0A 2PBEA 1S9FA 4B9VA 4C8NA 5DB9A 8ICGA 4RZRA 5HREA 1XO1A 4O0IA 3JPQA 4R66A 4DS4A 4KLIA 4YR0A 4M9HA 4FHXA 3PW4A 4F3OA 1Z3EB 1ZQUA 3MDCA 4RPYA 5EOZA 2UVVA 2BDPA 1HUOA 2H5XA 1SKRA 5CR0A 5CB1A 2DPIA 4PH5A 1U49A 5HRFA 4DEZA 1S0NA 4F4WA 2HHPA 2ZH6A 4UB5A 1U4BA 2IBKA 3RJIA 2VANA 2DR7A 5DBAA 5HRIA 4YG2A 1HUZA 4AT7A 2XY7A 4M9JA 1KFDA 5KFJA 3PX4A 1SZPA 4X4QA 1JXEA 1ZQBA 2PFPA 1NJYA 1LV5A 4JWMA 1Q79A 3AQLA 7ICVA 3RBEA 4I2BA 2NRZA 4KITB 5DLFA 1ZQNA 2PFNA 3RJHA 1RXWA 3KTQA 1CEZA 1BNPA 3LWMA 5BPCA 3WFQE 2XGPA 1S76D 2BQ3A 2DVIA 3C2MA 3H8JA 3MR6A 4X4SA 4EBEA 2PI5A 3GV8B 4FH5A 2AQ0A 9ICLA 5DQIA 2C2RA 4M6WB 3WFSC 4O3OA 1ZQIA 4LZDA 3H38A 3V7LA 1BGXT 4AT9B 5HP4A 4TUSA 4JV2A 1WCNA 1TVAA 5J2AA 4GXJA 1BPEA 4WBYA 5KFZA 4RQ5A 4DS5A 4TQRA 5IIKA 4RUAA 4YVZA 3MR5A 3K75D 8ICCA 4I2AA 4GLXA 3EPGA 4FS2A 4FHWA 5J2KA 9ICFA 3JPOA 1X9SA 1JXLA 3G6XA 4QZIA 4DQSA 4YP3A 4DFPA 4M04A 3RR7A 8ICIA 2V9WA 4DL2A 4M2YA 1COOA 4BWMA 4RPXA 2C28A 2PI4A 2R8KA 3Q8MA 4IQVA 1TAQA 4JWNA 3M8RA 7ICSA 4EBJA 4X4TA 3V7KA 1HJPA 4KN4A 2NRXA 5KFSA 4NLKA 4KLSA 1JQRA 5L1KA 4BGDA 4DWIA 2ASDA 4O3RA 2HHXA 3GQCA 1RZTA 2F1IA 3HJ4A 4DFKA 3N97B 2ISPA 4Z6DA 9ICKA 2W9BB 4DSLA 3GDXA 1U48A 2FLLA 3KHRA 3SYZA 2BPCA 3RJFA 1F5AA 5KG6A 4FHPA 5J29A 4DO9A 4QZCA 2XY6A 4M9LA 1VFGA 4IG8A 3PX6A 9ICOA 1UEUA 4RQ6A 4GC7A 2XCAA 3SZ2A 3ZDCA 5KFDA 9ICVA 4ECTA 4DLGA 2R8GA 4RQ7A 1TAUA 4LT6A 4I28A 3Q8PB 3UQ2A 4AT8A 2XC9A 2RDJA 1L3VA 3FDSA 1XS9D 5HHIA 4KLHA 2FLNA 4ATBB 1QTMA 4YD2A 3THVA 4ED8A 1ZQQA 1TFYA 3MFHA 3UXOA 2W9CA 3EYZA 5DGAA 1S10A 3GFKB 5KFPA 2WTFA 2AU0A 2J6UA 1CUKA 4ZH4A 4RQ0A 1MIYA 4DF8A 3AU2A 4UB2A 4F4YA 1ZJNA 1NO5A 7ICFA 3GIKA 5IINA 1ZQDA 3WFPA 5KFOA 5DBCA 1U45A 2ISOA 2Q0ZX 1ZQHA 3UXNA 1DK2A 3C2LA 4XA5A 5HR9A 5J2DA 1BPBA 2KP7A 4O9MA 2ZJAA 3GV7B 4I2FA 3AQMA 4WCWA 5KT4A 2KFNA 7ICQA 1MQ3A 4NKTA 5EWGA 5BOMA 4AT7B 4UB1A 3EWAA 1JMSA 4MEXA 4HYKA 4Q8EA 4GXKA 4NLNA 1JAJA 3MR3A 5DB6A 4I27A 3OUYA 5KFBA 2XCPA 3GIJA 4IR1A 1TFRA 5DKWA 4TUPA 9ICHA 3JPTA 4QZBA 4RQ2A 8ICVA 4NM2A 4PHEA 8ICLA 2W9BA 1ZQPA 3M9MB 4KLUA 4M9NA 1JN3A 5D46A 2BCUA 7ICTA 1VJ7A 4O3PA 3H3AA 4K4GA 3AQNA 5KT5A 4F91B 7ICGA 3IHQB 4KLJA 4DFMA 4FHVA 4PGYA 5J2CA 2FPLA 2KZ3A 1S0OA 4I2GA 1RXVA 8ICBA 5JUMA 1OU5A 1ZQZA 9ICQA 1ZQKA 4J9LA 3MR2A 2RDIA 4YMOA 3TARA 1KSPA 2PFOA 2PFQA 2P6RA 2ZH7A 3C21A 3RRGA 1XWLA 9ICTA 4X0BA 4DL4A 1ZQEA 4F2RA 5KFHA 3RAXA 1EXNA 4IRDA 5D4BA 3PW0A 2AGPA 2DR8A 2ZJ8A 3QEBZ 2DRBA 2HW3A 3TAPA 1NZPA 1NJWA 4I2DA 4QZGA 5L1LA 3T5LA 4X5VA 4UQGA 5J2BA 1ZQSA 5DEDA 4WC4A 2BCQA 4PGXA 4QWAA 4B9SA 2JZBB 4O5KA 3B0XA 2BGWA 3H37A 2HHTA 4F8RA 2NRTA 1MQ2A 5KFQA 5KFYA 9ICBA 9ICXA 1TKDA 2JEJA 4QWBA 3MBYA 2BCRA 3C23A 8ICFA 3G6VA 4O3SA 3IM1A 5J2GA 3EZ5A 3RRHA 1V9PA 4ECQA 1ZQXA 5IILA 2ID1A 3HJ1A 1ZQAA 3RH6A 2FMQA 1U9LA 1N48A 3EPIA 4UAWA 3M9OB 4IRKA 2M2VA 4AT8B 4PHDA 3C5GA 4FO6A 2MAXA 2ZJ5A 4EEYA 1XC9A 4CCHA 4ELUA 3AUOA 4RT2A 4NY8A 7ICNA 8ICUA 8ICXA 4IR9A 3RBDA 4ELTA 1S77D 3OV7A 2W9CB 3T5JA 4UD5A 5KG5A 4ECZA 3RB6A 2KTQA 4FH3A 2ASLA 1TK5A 4X0AA 8ICYA 2ALZA 3KHLA 5KFCA 3RH5A 1MC8A 3GV5B 1JX4A 1BPXA 3SV3A 4QWEA 3V6JA 1KEJA 2IHNA 4UB3A 3GIIA 4ED7A 3SI8A 3ZDDA 3MDAA 4XQ7A 1A76A 2W8KA 4M0AA 4KLMA 4PGQA 4J9NA 1H38A 3C1ZA 3AU6A 3OVAA 1R8BA 3HP6A 4B9NA 2BQUA 5J0WA 4F5RA 2VA2A 8ICWA 4TQSA 3PW2A 4RNOA 1D8YA 3RB3A 4O3NA 2FLPA 8ICQA 4MF8A 1SL2A 7ICHA 4M9GA 1X9WA 2BCVA 3TI0A 3H8WA 4RT3A 5CJ7A 4RPZA 2HVIA 3UXPA 3OUYB 1XU4A 5HRBA 5DG9A 3ISCA 4QZEA 3PMLA 3T3FA 3UQ0A 4IQUA 3HWTA 4DL5A 4XUSA 2JEGA 3ZDBA 4DQPA 2JZBA 3ISDA 3OVSA 5TZVA 4YXMA 4UD4A 2XGQA 5KG3A 3HT3A 2BCSA 5DQHA 1FA0A 3H7IA 5J2HA 4DL6A 3PMNA 4C8LA 4PPXA 4NKUA 5KFEA 2HHVA 3C5FA 5KT3A 1U47A 2I1QA 4B9LA 4F2SA 3BJYA 4IQWA 4I2HA 3ETLA 5KFKA 4F4KA 8ICEA 1X2IA 4EYIB 2JEIA 4I2IA 4KLOA 9ICNA 1NK8A 3QZ7A 2FMPA 3E2EA 2HHWA 3TQ1A 3PNCA 2FPKA 8ICOA 4QW9A 4E80A 4DLEA 4WC7A 2ZUCA 4XRHA 8ICTA 4NM1A 2B21A 4ED3A 1MSWD 3ZDEA 4QZHA 1ZQJA 2ZH2A 5HC9A 9ICJA 8ICRA 1SKWA 5IIOA 3NGDA 4DQQA 3AQKA 2XY5A 5L1JA 2BPGA 4FBUA 5J0UA 2BR0A 5HRKA 1WOTA 4B9UA 5J2EA 4EYHB 3TFRA 3JPNA 4ED6A 5CHGA 2C2EA 4KLFA 1B22A 9ICMA 5F2VO 3WFRE 4YFKA 5DB7A 3RJJA 1BNOA 3MABA 4KN7A 2HHSA 2IA6A 1QSSA 4YQWA 2ZTEA 3BQ1A 1SKSA 1RPLA 4P4PA 1NKEA 4DSIA 3LQCB 3C66A 2ZH3A 5KFFA 4WC0A 1NK9A 7ICLA 1MIWA 3ZD8A 2M9NA 3OHBA 9ICIA 2M2WA 4GC6A 1Y88A 3TANA 2BQRA 4P4MA 4DQIA 3NTUA 4Z6EA 3QE9Y 5DQGA 3QEAZ 7ICUA 3PVXA 1Q78A 4WBZA 4DOBA 2AGQA 4ECRA 8ICSA 2DPJA 3JZ0A 5DDMA 1XSLA 2BHNA 3MFIA 1S97A 1T4GA 4WC2A 2C2DA 4YR3A 4QZAA 2V4QA 1KLNA 4DSEA 5L1IA 2HVHA 4ELVA 1IM4A 2GWSA 5HHHA 5IIMA 1D8LA 5KFAA 5HNKA 4KLQA 3LK9A 5EWEA 3KHGA 2P6UA 8ICZA 1X9MA 4X4RA 4J9RA 4YMMA 5J0SA 5J0TA 4DL7A 5KG4A 5DECA 4DQRA 3OJSA 5J0YA 3HW8A 3RJKA 2XO7A 2KZMA 4G3IA 2VA3A 1XSNA 1PX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YN4 A;  1K1S A;  5F9L A;  3T5H A;  4UAZ A;  2ASJ A;  5J2I A;  4J9S A;  2J6T A;  2F1J A;  4BDP A;  1ZQM A;  4YD1 A;  3JYY A;  2DRA A;  2BE3 A;  4PHA A;  1A77 A;  1DOQ A;  3LDA A;  4PHP A;  2AGO A;  2BKE A;  3PO4 A;  4R8U B;  4I2E A;  2O5A A;  4MFA A;  5BOL A;  4JV1 A;  4RNN A;  3NYB A;  4Q43 A;  5L9X A;  4YCX A;  1SL1 A;  3PR5 B;  1TK0 A;  1NKB A;  4UAY A;  1LB2 B;  1RYS A;  4K4I A;  7ICM A;  1ZQG A;  4FHY A;  3RR8 A;  5CA7 A;  5HRL A;  3Q8L A;  4RWQ A;  4F50 A;  4DL3 A;  2V4R A;  3ZDA A;  1UA1 A;  5DLG A;  4B9T A;  8ICA A;  4Z6C A;  1R8C A;  3C18 A;  3OSN A;  5KT6 A;  1L3S A;  4QWC A;  3SV4 A;  1QSL A;  4GXI A;  2O1P A;  5KFW A;  2J6S A;  4J9M A;  1S0M A;  2P66 A;  4DSF A;  4R64 A;  4KLL A;  4X4U A;  4O5E A;  4F5N A;  5DDY A;  3M9N B;  2DR5 A;  4P2H A;  5KTQ A;  2ATL A;  5KT2 A;  4DF4 A;  2UVU A;  2M2U A;  4RQ8 A;  3KHH A;  1ZQV A;  8ICN A;  4E8F A;  4K4H A;  2RFF A;  1UET A;  1NK0 A;  1ZQF A;  4WC3 A;  3RJG A;  9ICA A;  5HRD A;  2FMS A;  1ZQY A;  4NXZ A;  5KFN A;  3H4D A;  3BQ0 A;  4RQ1 A;  1QLN A;  5KFI A;  3MGH A;  4KTQ A;  4WC6 A;  3LWL A;  2BPF A;  8ICM A;  5HMM A;  2A1J A;  1BPZ A;  5KG1 A;  2MUT B;  3JPP A;  3G6Y A;  4BWJ A;  4RU9 A;  5J0Q A;  1DGS A;  2R8I A;  1Z00 B;  2F1H A;  5DBB A;  3ISB A;  2DR9 A;  5KFX A;  5KFU A;  5CWR A;  4O5C A;  1V4A A;  4EBC A;  5HRG A;  4FS1 A;  1BVS A;  1L3U A;  3GIM A;  3BDP A;  4FBT A;  4X4V A;  3N4M B;  3RB0 A;  5DG8 A;  2NRK A;  4JV0 A;  5HML A;  4ECS A;  3PO5 A;  4EBK A;  4R8U A;  1NK5 A;  1KNY A;  4F5Q A;  3UPQ A;  3L9D A;  7ICJ A;  4RWO A;  4X4O A;  4E0D A;  4BXO A;  4J9P A;  1UEV A;  1IXR A;  1UT8 A;  2DFL A;  3V72 A;  4J9Q A;  2KN7 A;  3H4B A;  3V7J A;  2IMW P;  2ZTD A;  5HRH A;  9ICC A;  9ICS A;  4J9K A;  2ZUD A;  1T3N A;  8ICP A;  4YMN A;  4KLD A;  5J2J A;  3PW7 A;  1NJZ A;  1B43 A;  1ZQW A;  4TUQ A;  5KT7 A;  4ED0 A;  3ORY A;  1NK6 A;  3PR4 A;  5F9N A;  5DG7 A;  4IRC A;  1S0V A;  5KFL A;  4YXJ A;  4F4Z A;  4ECW A;  4R63 A;  3FYH A;  4R65 A;  5D49 A;  4S3N A;  7ICP A;  4RNM A;  4MFF A;  4KMU A;  9ICE A;  1TV9 A;  3H40 A;  1ZQO A;  1ZQT A;  1YLQ A;  4X4P A;  4NLG A;  4RWP A;  4YR2 A;  2AQ4 A;  3C1Y A;  2Q66 A;  1ZQC A;  2W9A A;  4Q44 A;  5DB8 A;  5J0P A;  3HIY A;  4TUR A;  3V6K A;  3RJE A;  1PZN A;  3WFO A;  4J9O A;  8ICH A;  2R8J A;  2ZHA A;  2ZH4 A;  1UT5 A;  4I2J A;  4P4O A;  2LYH A;  3QZ8 A;  4ECU A;  4LVS A;  2MUT A;  1N56 A;  2NRV A;  1L5U A;  5IIJ A;  4KLG A;  1NJX A;  9ICW A;  5KG2 A;  3Q8K A;  1Z00 A;  4DSJ A;  5C5J A;  3BQT A;  5KFG A;  1KRP A;  4UBB A;  2PXI A;  4ECV A;  5EWF A;  1L3T A;  4ED2 A;  7ICR A;  4RQ4 A;  3PY8 A;  1NKC A;  4DOA A;  4NLZ A;  2HHU A;  1NOM A;  4QW8 A;  2ZTC A;  2ZH9 A;  4F4X A;  2JEF A;  4M6W A;  2AJQ A;  1ZET A;  4Z6F A;  3PW5 A;  3TAQ A;  4WC5 A;  4O3Q A;  5III A;  3T5K A;  1NK7 A;  2KZZ A;  3B0Y A;  4F93 B;  4QZD A;  1KTQ A;  1KFS A;  4C8K A;  4AT9 A;  3OGU A;  3RTV A;  2ZHB A;  3JPS A;  2OWO A;  5KFV A;  2C22 A;  2VA8 A;  1ZQR A;  9ICU A;  2Y1J A;  5KFT A;  3Q8R B;  1R89 A;  3MGI A;  4X4N A;  4C8O A;  8ICK A;  3JPR A;  2Y1I A;  3RH4 A;  5J2F A;  2W9M A;  1T8E A;  2UVW A;  4M47 A;  1D9D A;  3HX0 A;  3PV8 A;  1DK3 A;  4E7X A;  2ZH5 A;  3K4G A;  1ZQL A;  1R8A A;  4ED1 A;  1C7Y A;  1D9F A;  4QZF A;  1MIV A;  2A1J B;  3Q8S B;  4I29 A;  3BQ2 A;  1K1Q A;  4UB4 A;  2ZUB A;  4QWD A;  1TK8 A;  2IHM A;  1NK4 A;  4LZG A;  2HHQ A;  2ZH1 A;  2M2T A;  1ARO P;  2NRW A;  1T7P A;  3OVB A;  4F5P A;  4QZ9 A;  3HPO A;  2I9G A;  5DGB A;  4B9M A;  4DFJ A;  4EZ9 A;  2UVR A;  3M8S A;  3ZD9 A;  5KFR A;  4ECX A;  7ICK A;  7ICE A;  4QZ8 A;  5KG7 A;  4DOC A;  4KLE A;  4WC1 A;  4JUZ A;  5J0O A;  4UBC A;  3RAQ A;  2KFZ A;  7ICO A;  4M5D A;  4XQ8 A;  5J0R A;  4Q45 A;  1KDH A;  4EP7 A;  3PX0 A;  4BXO B;  4DSK A;  8ICJ A;  2FPM A;  1XSP A;  7ICI A;  1KFT A;  4MEY A;  1QSY A;  4IQT A;  9ICR A;  3C2K A;  4KLT A;  4I2C A;  2R8H A;  9ICG A;  1BPD A;  3GIL A;  4MFC A;  5KG0 A;  4JK1 A;  1ZJM A;  3V6H A;  2W8L A;  1TFW A;  3UPS A;  2ZH8 A;  1WCL A;  3OJU A;  3TFS A;  3RB4 A;  3OSP A;  4RQ3 A;  9ICP A;  4F5O A;  4RWN A;  4RUC A;  1SL0 A;  3EW9 A;  1ZYQ A;  4Q8F A;  4MF2 A;  4EBD A;  4EZ6 A;  4ATB A;  4ECY A;  5CP2 A;  4C8M A;  3H8S A;  3H39 A;  1JIH A;  1RYR A;  1BPY A;  3OHA A;  5KFM A;  5J0X A;  4F92 B;  3Q8Q B;  1UA0 A;  2PBE A;  1S9F A;  4B9V A;  4C8N A;  5DB9 A;  8ICG A;  4RZR A;  5HRE A;  1XO1 A;  4O0I A;  3JPQ A;  4R66 A;  4DS4 A;  4KLI A;  4YR0 A;  4M9H A;  4FHX A;  3PW4 A;  4F3O A;  1Z3E B;  1ZQU A;  3MDC A;  4RPY A;  5EOZ A;  2UVV A;  2BDP A;  1HUO A;  2H5X A;  1SKR A;  5CR0 A;  5CB1 A;  2DPI A;  4PH5 A;  1U49 A;  5HRF A;  4DEZ A;  1S0N A;  4F4W A;  2HHP A;  2ZH6 A;  4UB5 A;  1U4B A;  2IBK A;  3RJI A;  2VAN A;  2DR7 A;  5DBA A;  5HRI A;  4YG2 A;  1HUZ A;  4AT7 A;  2XY7 A;  4M9J A;  1KFD A;  5KFJ A;  3PX4 A;  1SZP A;  4X4Q A;  1JXE A;  1ZQB A;  2PFP A;  1NJY A;  1LV5 A;  4JWM A;  1Q79 A;  3AQL A;  7ICV A;  3RBE A;  4I2B A;  2NRZ A;  4KIT B;  5DLF A;  1ZQN A;  2PFN A;  3RJH A;  1RXW A;  3KTQ A;  1CEZ A;  1BNP A;  3LWM A;  5BPC A;  3WFQ E;  2XGP A;  1S76 D;  2BQ3 A;  2DVI A;  3C2M A;  3H8J A;  3MR6 A;  4X4S A;  4EBE A;  2PI5 A;  3GV8 B;  4FH5 A;  2AQ0 A;  9ICL A;  5DQI A;  2C2R A;  4M6W B;  3WFS C;  4O3O A;  1ZQI A;  4LZD A;  3H38 A;  3V7L A;  1BGX T;  4AT9 B;  5HP4 A;  4TUS A;  4JV2 A;  1WCN A;  1TVA A;  5J2A A;  4GXJ A;  1BPE A;  4WBY A;  5KFZ A;  4RQ5 A;  4DS5 A;  4TQR A;  5IIK A;  4RUA A;  4YVZ A;  3MR5 A;  3K75 D;  8ICC A;  4I2A A;  4GLX A;  3EPG A;  4FS2 A;  4FHW A;  5J2K A;  9ICF A;  3JPO A;  1X9S A;  1JXL A;  3G6X A;  4QZI A;  4DQS A;  4YP3 A;  4DFP A;  4M04 A;  3RR7 A;  8ICI A;  2V9W A;  4DL2 A;  4M2Y A;  1COO A;  4BWM A;  4RPX A;  2C28 A;  2PI4 A;  2R8K A;  3Q8M A;  4IQV A;  1TAQ A;  4JWN A;  3M8R A;  7ICS A;  4EBJ A;  4X4T A;  3V7K A;  1HJP A;  4KN4 A;  2NRX A;  5KFS A;  4NLK A;  4KLS A;  1JQR A;  5L1K A;  4BGD A;  4DWI A;  2ASD A;  4O3R A;  2HHX A;  3GQC A;  1RZT A;  2F1I A;  3HJ4 A;  4DFK A;  3N97 B;  2ISP A;  4Z6D A;  9ICK A;  2W9B B;  4DSL A;  3GDX A;  1U48 A;  2FLL A;  3KHR A;  3SYZ A;  2BPC A;  3RJF A;  1F5A A;  5KG6 A;  4FHP A;  5J29 A;  4DO9 A;  4QZC A;  2XY6 A;  4M9L A;  1VFG A;  4IG8 A;  3PX6 A;  9ICO A;  1UEU A;  4RQ6 A;  4GC7 A;  2XCA A;  3SZ2 A;  3ZDC A;  5KFD A;  9ICV A;  4ECT A;  4DLG A;  2R8G A;  4RQ7 A;  1TAU A;  4LT6 A;  4I28 A;  3Q8P B;  3UQ2 A;  4AT8 A;  2XC9 A;  2RDJ A;  1L3V A;  3FDS A;  1XS9 D;  5HHI A;  4KLH A;  2FLN A;  4ATB B;  1QTM A;  4YD2 A;  3THV A;  4ED8 A;  1ZQQ A;  1TFY A;  3MFH A;  3UXO A;  2W9C A;  3EYZ A;  5DGA A;  1S10 A;  3GFK B;  5KFP A;  2WTF A;  2AU0 A;  2J6U A;  1CUK A;  4ZH4 A;  4RQ0 A;  1MIY A;  4DF8 A;  3AU2 A;  4UB2 A;  4F4Y A;  1ZJN A;  1NO5 A;  7ICF A;  3GIK A;  5IIN A;  1ZQD A;  3WFP A;  5KFO A;  5DBC A;  1U45 A;  2ISO A;  2Q0Z X;  1ZQH A;  3UXN A;  1DK2 A;  3C2L A;  4XA5 A;  5HR9 A;  5J2D A;  1BPB A;  2KP7 A;  4O9M A;  2ZJA A;  3GV7 B;  4I2F A;  3AQM A;  4WCW A;  5KT4 A;  2KFN A;  7ICQ A;  1MQ3 A;  4NKT A;  5EWG A;  5BOM A;  4AT7 B;  4UB1 A;  3EWA A;  1JMS A;  4MEX A;  4HYK A;  4Q8E A;  4GXK A;  4NLN A;  1JAJ A;  3MR3 A;  5DB6 A;  4I27 A;  3OUY A;  5KFB A;  2XCP A;  3GIJ A;  4IR1 A;  1TFR A;  5DKW A;  4TUP A;  9ICH A;  3JPT A;  4QZB A;  4RQ2 A;  8ICV A;  4NM2 A;  4PHE A;  8ICL A;  2W9B A;  1ZQP A;  3M9M B;  4KLU A;  4M9N A;  1JN3 A;  5D46 A;  2BCU A;  7ICT A;  1VJ7 A;  4O3P A;  3H3A A;  4K4G A;  3AQN A;  5KT5 A;  4F91 B;  7ICG A;  3IHQ B;  4KLJ A;  4DFM A;  4FHV A;  4PGY A;  5J2C A;  2FPL A;  2KZ3 A;  1S0O A;  4I2G A;  1RXV A;  8ICB A;  5JUM A;  1OU5 A;  1ZQZ A;  9ICQ A;  1ZQK A;  4J9L A;  3MR2 A;  2RDI A;  4YMO A;  3TAR A;  1KSP A;  2PFO A;  2PFQ A;  2P6R A;  2ZH7 A;  3C21 A;  3RRG A;  1XWL A;  9ICT A;  4X0B A;  4DL4 A;  1ZQE A;  4F2R A;  5KFH A;  3RAX A;  1EXN A;  4IRD A;  5D4B A;  3PW0 A;  2AGP A;  2DR8 A;  2ZJ8 A;  3QEB Z;  2DRB A;  2HW3 A;  3TAP A;  1NZP A;  1NJW A;  4I2D A;  4QZG A;  5L1L A;  3T5L A;  4X5V A;  4UQG A;  5J2B A;  1ZQS A;  5DED A;  4WC4 A;  2BCQ A;  4PGX A;  4QWA A;  4B9S A;  2JZB B;  4O5K A;  3B0X A;  2BGW A;  3H37 A;  2HHT A;  4F8R A;  2NRT A;  1MQ2 A;  5KFQ A;  5KFY A;  9ICB A;  9ICX A;  1TKD A;  2JEJ A;  4QWB A;  3MBY A;  2BCR A;  3C23 A;  8ICF A;  3G6V A;  4O3S A;  3IM1 A;  5J2G A;  3EZ5 A;  3RRH A;  1V9P A;  4ECQ A;  1ZQX A;  5IIL A;  2ID1 A;  3HJ1 A;  1ZQA A;  3RH6 A;  2FMQ A;  1U9L A;  1N48 A;  3EPI A;  4UAW A;  3M9O B;  4IRK A;  2M2V A;  4AT8 B;  4PHD A;  3C5G A;  4FO6 A;  2MAX A;  2ZJ5 A;  4EEY A;  1XC9 A;  4CCH A;  4ELU A;  3AUO A;  4RT2 A;  4NY8 A;  7ICN A;  8ICU A;  8ICX A;  4IR9 A;  3RBD A;  4ELT A;  1S77 D;  3OV7 A;  2W9C B;  3T5J A;  4UD5 A;  5KG5 A;  4ECZ A;  3RB6 A;  2KTQ A;  4FH3 A;  2ASL A;  1TK5 A;  4X0A A;  8ICY A;  2ALZ A;  3KHL A;  5KFC A;  3RH5 A;  1MC8 A;  3GV5 B;  1JX4 A;  1BPX A;  3SV3 A;  4QWE A;  3V6J A;  1KEJ A;  2IHN A;  4UB3 A;  3GII A;  4ED7 A;  3SI8 A;  3ZDD A;  3MDA A;  4XQ7 A;  1A76 A;  2W8K A;  4M0A A;  4KLM A;  4PGQ A;  4J9N A;  1H38 A;  3C1Z A;  3AU6 A;  3OVA A;  1R8B A;  3HP6 A;  4B9N A;  2BQU A;  5J0W A;  4F5R A;  2VA2 A;  8ICW A;  4TQS A;  3PW2 A;  4RNO A;  1D8Y A;  3RB3 A;  4O3N A;  2FLP A;  8ICQ A;  4MF8 A;  1SL2 A;  7ICH A;  4M9G A;  1X9W A;  2BCV A;  3TI0 A;  3H8W A;  4RT3 A;  5CJ7 A;  4RPZ A;  2HVI A;  3UXP A;  3OUY B;  1XU4 A;  5HRB A;  5DG9 A;  3ISC A;  4QZE A;  3PML A;  3T3F A;  3UQ0 A;  4IQU A;  3HWT A;  4DL5 A;  4XUS A;  2JEG A;  3ZDB A;  4DQP A;  2JZB A;  3ISD A;  3OVS A;  5TZV A;  4YXM A;  4UD4 A;  2XGQ A;  5KG3 A;  3HT3 A;  2BCS A;  5DQH A;  1FA0 A;  3H7I A;  5J2H A;  4DL6 A;  3PMN A;  4C8L A;  4PPX A;  4NKU A;  5KFE A;  2HHV A;  3C5F A;  5KT3 A;  1U47 A;  2I1Q A;  4B9L A;  4F2S A;  3BJY A;  4IQW A;  4I2H A;  3ETL A;  5KFK A;  4F4K A;  8ICE A;  1X2I A;  4EYI B;  2JEI A;  4I2I A;  4KLO A;  9ICN A;  1NK8 A;  3QZ7 A;  2FMP A;  3E2E A;  2HHW A;  3TQ1 A;  3PNC A;  2FPK A;  8ICO A;  4QW9 A;  4E80 A;  4DLE A;  4WC7 A;  2ZUC A;  4XRH A;  8ICT A;  4NM1 A;  2B21 A;  4ED3 A;  1MSW D;  3ZDE A;  4QZH A;  1ZQJ A;  2ZH2 A;  5HC9 A;  9ICJ A;  8ICR A;  1SKW A;  5IIO A;  3NGD A;  4DQQ A;  3AQK A;  2XY5 A;  5L1J A;  2BPG A;  4FBU A;  5J0U A;  2BR0 A;  5HRK A;  1WOT A;  4B9U A;  5J2E A;  4EYH B;  3TFR A;  3JPN A;  4ED6 A;  5CHG A;  2C2E A;  4KLF A;  1B22 A;  9ICM A;  5F2V O;  3WFR E;  4YFK A;  5DB7 A;  3RJJ A;  1BNO A;  3MAB A;  4KN7 A;  2HHS A;  2IA6 A;  1QSS A;  4YQW A;  2ZTE A;  3BQ1 A;  1SKS A;  1RPL A;  4P4P A;  1NKE A;  4DSI A;  3LQC B;  3C66 A;  2ZH3 A;  5KFF A;  4WC0 A;  1NK9 A;  7ICL A;  1MIW A;  3ZD8 A;  2M9N A;  3OHB A;  9ICI A;  2M2W A;  4GC6 A;  1Y88 A;  3TAN A;  2BQR A;  4P4M A;  4DQI A;  3NTU A;  4Z6E A;  3QE9 Y;  5DQG A;  3QEA Z;  7ICU A;  3PVX A;  1Q78 A;  4WBZ A;  4DOB A;  2AGQ A;  4ECR A;  8ICS A;  2DPJ A;  3JZ0 A;  5DDM A;  1XSL A;  2BHN A;  3MFI A;  1S97 A;  1T4G A;  4WC2 A;  2C2D A;  4YR3 A;  4QZA A;  2V4Q A;  1KLN A;  4DSE A;  5L1I A;  2HVH A;  4ELV A;  1IM4 A;  2GWS A;  5HHH A;  5IIM A;  1D8L A;  5KFA A;  5HNK A;  4KLQ A;  3LK9 A;  5EWE A;  3KHG A;  2P6U A;  8ICZ A;  1X9M A;  4X4R A;  4J9R A;  4YMM A;  5J0S A;  5J0T A;  4DL7 A;  5KG4 A;  5DEC A;  4DQR A;  3OJS A;  5J0Y A;  3HW8 A;  3RJK A;  2XO7 A;  2KZM A;  4G3I A;  2VA3 A;  1XSN A;  1PX5 A; 
#chains in the Genus database with same CATH topology
 1K1S A;  5KNI A;  5F9L A;  2ASJ A;  4J9S A;  2EZY A;  2ZIW B;  2BE3 A;  4PHA A;  4PHP A;  2O5A A;  2BKE A;  4R8U B;  1WYG A;  3J81 j;  4MFA A;  3NYB A;  2FDR A;  5ALY A;  1SL1 A;  1L6N A;  1LB2 B;  1TK0 A;  1A0P A;  2DKZ A;  4UAY A;  1S5L U;  3RR8 A;  5CA7 A;  4MKP A;  3Q8L A;  4RWQ A;  4F50 A;  4Z6C A;  4QWC A;  3SV4 A;  2O1P A;  4J9M A;  2F8K A;  4DSF A;  5AIA A;  4R64 A;  5AM5 A;  5KT2 A;  2M2U A;  4LEY A;  2KJ5 A;  4E8F A;  2RFF A;  4FFD A;  2VJ4 A;  2W7P A;  3M1Y A;  5KFN A;  1QLN A;  4RQ1 A;  5KFI A;  3MGH A;  8ICM A;  3G6Y A;  2HMX A;  4BWJ A;  4RU9 A;  5J0Q A;  4EED A;  2F1H A;  3ISB A;  4EBC A;  4FS1 A;  2QLT A;  1Z1B A;  4JV0 A;  1NK5 A;  4PL2 A;  1UEV A;  2DFL A;  4N7R A;  4FZN A;  3V7J A;  8ICP A;  4YMN A;  5J2J A;  1OXJ A;  4NL9 C;  4TUQ A;  5KT7 A;  3ORY A;  4FHY A;  5F2V O;  5DG7 A;  2YMM A;  5KFL A;  4YXJ A;  2HN1 A;  5D49 A;  7ICP A;  5AKH A;  4RNM A;  9ICE A;  4EEL A;  2WAQ F;  3HRD D;  4NLG A;  2AQ4 A;  2HBM A;  3C1Y A;  2Q66 A;  1ZXI A;  2F76 X;  4Q44 A;  3AQE A;  2W9A A;  2G06 A;  3V6K A;  2ZHA A;  2R8J A;  4ECU A;  2MUT A;  2NRV A;  1L5U A;  5IIJ A;  2KOB A;  1NJX A;  4FO1 A;  1Z00 A;  5ALQ A;  4DSJ A;  3WK8 A;  3HKZ F;  3WK9 A;  2DGZ A;  3RFA A;  4QW8 A;  2ZTC A;  2JEF A;  2AJQ A;  3PW5 A;  4O3Q A;  4WOY A;  1NK7 A;  4F93 B;  3SD7 A;  3C28 A;  2ZIX B;  5AHX A;  2OWO A;  9ICU A;  5KFT A;  1AQ6 A;  4KX3 A;  4X4N A;  3JPR A;  4BUG A;  1T8E A;  1DK3 A;  1A6S A;  2ZH5 A;  1R8A A;  1D9F A;  3BQ2 A;  2IHM A;  4UB4 A;  2ZH1 A;  2O6K A;  3F2D A;  1KBU A;  1ARO P;  2KE7 A;  2IOH A;  1T7P A;  1FEZ A;  4QZ9 A;  3HPO A;  2I9G A;  4WBY A;  2UVR A;  7ICK A;  7ICE A;  4QZ8 A;  4JUZ A;  5J0R A;  1N5X A;  2N1R A;  4EP7 A;  3PX0 A;  1KFT A;  7ICI A;  4IQT A;  3C2K A;  4KLT A;  4MFC A;  1ZJM A;  2ZH8 A;  1WCL A;  2Z7J A;  3EW9 A;  3NVZ A;  2IHO A;  1ECW A;  4MF2 A;  4ECY A;  1JIH A;  1BPY A;  3OHA A;  5KFM A;  5J0X A;  4UB8 U;  3Q8Q B;  1UA0 A;  2PBE A;  1PUZ A;  4Y2S A;  1S9F A;  3PSF A;  4C8N A;  8ICG A;  2XID A;  4O0I A;  4R66 A;  1SXE A;  4YR0 A;  1Z3E B;  5EOZ A;  2BDP A;  2H5X A;  5D61 A;  4F4W A;  5AKL A;  2QB0 B;  3QU5 A;  1U4B A;  2DR7 A;  1RQL A;  4AT7 A;  2WB1 C;  2JV3 A;  4X4Q A;  2PFP A;  7ICV A;  3RBE A;  1ZQN A;  3KTQ A;  2XGP A;  4C4R A;  3C2M A;  2PI5 A;  4FE3 A;  4QNL A;  2ZXI A;  3WFS C;  4M6W B;  3NS1 A;  4NWI A;  5HP4 A;  2KSO B;  4DS5 A;  4TQR A;  2CPR A;  4YVZ A;  4RUA A;  1O08 A;  3EPG A;  3IDW A;  2CN1 A;  5J2K A;  1DXS A;  3G6X A;  4M04 A;  4O68 A;  2C28 A;  2PI4 A;  2D3D A;  2KVS A;  4X4T A;  4KN4 A;  2HBJ A;  2JXJ A;  3BS7 A;  3SEN A;  2CXY A;  4BGD A;  3HKZ C;  2HHX A;  2ISP A;  4Z6D A;  9ICK A;  1QCK A;  3GDX A;  1U48 A;  2FLL A;  3KHR A;  2XVT A;  2YTU A;  5J29 A;  1VFG A;  4QZC A;  5AK5 A;  3PX6 A;  9ICO A;  4RQ6 A;  3SQI A;  5B5E U;  4LT6 A;  2RDJ A;  4JLX A;  3FDS A;  3MCR A;  4ATB B;  1ZQQ A;  2W9C A;  1B4F A;  3GFK B;  2AU0 A;  4ZH4 A;  3AU2 A;  1ZJN A;  5H2F U;  3GIK A;  1PK1 A;  5IIN A;  1ZQH A;  1DK2 A;  4XA5 A;  1BPB A;  5K4L A;  4WCW A;  5AM3 A;  3F2B A;  4HYK A;  4GXK A;  1XO0 A;  4I27 A;  9ICH A;  4PHE A;  3GZF A;  8ICL A;  2WF9 A;  1V85 A;  4M9N A;  5ALL A;  4K96 A;  3I1Y A;  4F91 B;  2HI0 A;  4KLJ A;  4KB6 A;  4PZN A;  1S0O A;  1RXV A;  1UHU A;  9ICQ A;  2PFQ A;  3TAR A;  1XWL A;  3F5A A;  2Y0S C;  1LKY A;  4CF5 A;  2VIX A;  2ZJ8 A;  1ZQS A;  4X5V A;  2A1A A;  5DED A;  3ZI4 A;  5CHE A;  4QWA A;  2HHT A;  2NRT A;  1MQ2 A;  4K8V A;  2JEJ A;  4OAI Z;  2BCR A;  2G5H B;  4O3S A;  3IM1 A;  5J2G A;  3UMG A;  1ZQX A;  2ID1 A;  1ZQA A;  1U9L A;  1N48 A;  2K89 A;  3M9O B;  4PHD A;  5EE1 A;  4FO6 A;  4CCH A;  5ALD A;  3RBD A;  1S77 D;  1FFV A;  3T5J A;  2KTQ A;  2ASL A;  3F53 A;  1TK5 A;  3KHL A;  5KFC A;  1RM6 C;  2I5H A;  2ZIV A;  4NXX A;  4XQ7 A;  4KLM A;  2W8K A;  2M0N A;  4OD0 A;  3L4P A;  1R8B A;  4OJL A;  2BQU A;  4B6J A;  4M9G A;  3SAF A;  2BCV A;  5AM2 A;  2EZZ A;  2HVI A;  3UXP A;  3OUY B;  5DG9 A;  4QZE A;  3PML A;  2JEG A;  4IQU A;  5ALG A;  3OVS A;  2LM4 A;  1FFU A;  3HT3 A;  1TE2 A;  4C8L A;  3IG8 A;  3CNH A;  5KFE A;  1JAL A;  5KT3 A;  3BJY A;  5KFK A;  4EYI B;  4LEW A;  9ICN A;  2FMP A;  3TQ1 A;  3QUQ A;  4QW9 A;  4DLE A;  2ZUC A;  4XRH A;  3SEI A;  4ED3 A;  3WKA A;  9ICJ A;  8ICR A;  2BPG A;  4FBU A;  3TFR A;  4EYH B;  4KLF A;  5CHG A;  3N7P D;  4YFK A;  3NAS A;  2G08 A;  2HHS A;  1QSS A;  1NKE A;  4DSI A;  1QQ5 A;  4WC0 A;  2E1E A;  1NK9 A;  2RLT A;  1MIW A;  4PL1 A;  3F5E A;  5B66 U;  4LEZ A;  3TAN A;  4WBZ A;  2K8A A;  4Z6E A;  5DQG A;  3QE9 Y;  3PVX A;  4USA A;  5EE3 A;  4O69 A;  1YZ6 A;  4ECR A;  2DPJ A;  5AM0 A;  1XSL A;  5C0Y A;  2HVH A;  5L1I A;  1D8L A;  1SXD A;  4KLQ A;  3PSP A;  5EWE A;  2B0C A;  3KHG A;  2K4P A;  5J0T A;  2KK0 A;  4DQR A;  3QU7 A;  3OJS A;  2KZM A;  2HBK A;  3H0R B;  2XO7 A;  4G3I A;  2VA3 A;  1XSN A;  3JYY A;  1V38 A;  4BDP A;  1ZQM A;  2DRA A;  4WQL A;  4EGW A;  2BZF A;  1X6J A;  4I2E A;  4JV1 A;  1Z4O A;  4YCX A;  2WHE A;  4EEK A;  3PR5 B;  7ICM A;  3CK6 A;  4OCZ A;  2G0A A;  1ZQG A;  4DL3 A;  1UA1 A;  3C18 A;  3OSN A;  5KT6 A;  1L3S A;  3TAC B;  1QSL A;  4GXI A;  4AYB F;  2J6S A;  2NYV A;  4Y2X A;  3ICX A;  2BDU A;  2B4V A;  4LEV A;  4O5E A;  5KAI U;  3M9N B;  1SWV A;  2JH1 A;  4P2H A;  2DR5 A;  2F3N A;  2Y9U A;  3LVW A;  4K4H A;  3PHZ A;  1ZQF A;  5HRD A;  2FMS A;  2MRL A;  5ALU A;  4NXZ A;  4KTQ A;  5AKZ A;  2BPF A;  5HMM A;  3AN1 A;  2A1J A;  5J8Y A;  2MUT B;  1DGS A;  1Z00 B;  5AKY A;  2LPE A;  5KFU A;  1V4A A;  4Y2P A;  4FBT A;  1ZQ1 C;  3BQ7 A;  3N4M B;  5HML A;  4ECS A;  4EBK A;  3KZI U;  2F2A B;  4X4O A;  2KHV A;  4RWO A;  7ICJ A;  2ESE A;  2K60 A;  4E0D A;  2RP5 A;  1IXR A;  3QX7 A;  4J9Q A;  3H4B A;  1V97 A;  4K9B A;  4J9K A;  4HX0 A;  2ZUD A;  4O67 A;  1T3N A;  4KLD A;  1NJZ A;  1NK6 A;  4ED0 A;  2ES6 A;  9ICT A;  4ECW A;  4CNQ A;  3E58 A;  4R65 A;  4UW9 A;  3HIL A;  2VJ5 A;  1TV9 A;  1YLQ A;  4X4P A;  1KN5 A;  2E5S A;  1ZQC A;  5DB8 A;  2W43 A;  2ZIU B;  3RJE A;  4Y2T A;  4J9O A;  8ICH A;  2ZH4 A;  4P4O A;  3BS5 B;  5D62 A;  2E8O A;  1N56 A;  3H8M A;  2GAF D;  4U6P A;  3S6J A;  3BQT A;  3QU4 A;  2KKV A;  4UBB A;  5EWF A;  7ICR A;  1NKC A;  4NLZ A;  4P0Q A;  5AKK A;  2FCL A;  1ZET A;  2L5Y A;  4Z6F A;  2KIC A;  4WC5 A;  3T5K A;  4QZD A;  1KTQ A;  3RTV A;  3JPS A;  5KFV A;  3Q8R B;  2HCF A;  2Y1I A;  2W9M A;  4F71 A;  1PVQ A;  2LYB A;  3K4G A;  3L3F X;  5AM4 A;  3Q8S B;  1VDV A;  5FP0 A;  3KBB A;  2RRD A;  2EWR A;  4B9M A;  4ECX A;  3ZD9 A;  5KFR A;  4WC1 A;  2EH9 A;  4AYB C;  4DOC A;  4KLE A;  7ICO A;  3RAQ A;  2KFZ A;  4M5D A;  4BXO B;  3RF9 A;  4DSK A;  8ICJ A;  1XSP A;  1L8O A;  1QSY A;  2E8P A;  2R8H A;  4I2C A;  1BPD A;  4ICA A;  3GIL A;  9ICG A;  5KG0 A;  4JK1 A;  1TFW A;  3OJU A;  3RB4 A;  3OSP A;  4RQ3 A;  4C0Z A;  4FZM A;  4C4T A;  2R18 A;  4CDG A;  1PVR A;  4EBD A;  4EZ6 A;  5CP2 A;  4C8M A;  3H8S A;  1HIW A;  4RZR A;  1IIP A;  5HRE A;  4DS4 A;  3OTQ A;  4F3O A;  1ZQU A;  2UVV A;  1SKR A;  5CR0 A;  2DPI A;  4DEZ A;  2HHP A;  2IBK A;  3RJI A;  5GTH U;  5DBA A;  4P0P A;  4Y2V A;  3D2N A;  3PX4 A;  3NVW A;  2RQ5 A;  1LV5 A;  2NRZ A;  5DLF A;  3RJH A;  1BNP A;  2WFA A;  1S76 D;  2DVI A;  9ICL A;  4O3O A;  1ZQI A;  4O6A A;  1TAM A;  4OJ5 A;  4AT9 B;  2WB1 F;  4EX7 A;  4JV2 A;  5J2A A;  5ALH A;  2H3I A;  3K75 D;  4BJQ A;  4I2A A;  4GLX A;  3BZC A;  4FS2 A;  4FHW A;  2W04 A;  1X9S A;  8ICI A;  3KKA A;  4JMU A;  2R8K A;  1QH9 A;  3M8R A;  4GFJ A;  4Y2J A;  4O3R A;  1RZT A;  2F1I A;  3HJ4 A;  4DFK A;  3MGV A;  1MN8 A;  3SYZ A;  2BPC A;  3RJF A;  1F5A A;  1RG6 A;  2E8N A;  2W54 A;  2GH1 A;  5KFD A;  5GTI U;  4AT8 A;  3UQ2 A;  4US9 A;  1L3V A;  1XS9 D;  1N60 A;  2FLN A;  1L7P A;  2YN4 A;  3THV A;  1TFY A;  3UXO A;  1R8C A;  1ZD2 P;  2ISO A;  2Q0Z X;  4IC9 A;  5ALN A;  1VJ5 A;  5HR9 A;  1OUQ A;  4O9M A;  4K98 A;  5KT4 A;  2KFN A;  2PMZ C;  5ALK A;  5BOM A;  4OAF A;  4UB1 A;  3EWA A;  4Q8E A;  3QU2 A;  3MR3 A;  5DB6 A;  3H0L B;  5KFB A;  2XCP A;  4IR1 A;  1TFR A;  5ALO A;  5DKW A;  4TUP A;  3JPT A;  8ICV A;  4WC7 A;  2W9B A;  2OH2 A;  3M9M B;  5D46 A;  7ICT A;  7ICG A;  3IHQ B;  2W3S A;  4FHV A;  5ALW A;  2WF6 A;  5JUM A;  3MR2 A;  2D6F C;  2PFO A;  5HR7 A;  3RRG A;  4DL4 A;  5KFH A;  3RAX A;  4C7Y A;  1IV8 A;  3PW0 A;  2DRB A;  4JB3 A;  1SZH A;  4QZG A;  3T5L A;  4WC4 A;  1NNL A;  2BCQ A;  4O5K A;  4B9S A;  3B0X A;  2DF4 B;  5ALR A;  2KJ9 A;  4F8R A;  3HJE A;  3MBY A;  2K4E A;  2ZG6 A;  5KL1 B;  3CYM A;  2Y0S F;  2GLE A;  3BZK A;  3AMZ A;  3EZ5 A;  5IIL A;  2M2V A;  4EEY A;  2ZJ5 A;  1FA0 A;  3AUO A;  4RT2 A;  8ICX A;  2DKX A;  3OV7 A;  4ELT A;  2OXO A;  1L7O A;  4UD5 A;  2YML A;  2WF8 A;  4X0A A;  8ICY A;  2ALZ A;  3RH5 A;  1MC8 A;  3K1Z A;  3GV5 B;  1BPX A;  2KMD A;  4QWE A;  1KEJ A;  3MDA A;  3CRX A;  2H3V A;  3AU6 A;  2YMP A;  3HP6 A;  1NZB A;  1ZD3 A;  3F2C A;  2ZIW A;  2AH5 A;  1SL2 A;  5T14 A;  1X9X A;  3KOO A;  1X9W A;  5AKE A;  5CJ7 A;  1P7D A;  3ISC A;  2RHF A;  4DL5 A;  3ZDB A;  3HWT A;  4DQP A;  2Y9T A;  2JZB A;  4YXM A;  4UD4 A;  2KIV A;  4OAG A;  2XGQ A;  2BCS A;  5J2H A;  2G07 A;  3C5F A;  3ERC C;  4NXT A;  4F4K A;  1X2I A;  4KLO A;  5J8Y C;  4K9A A;  5JTI A;  2HHW A;  3PNC A;  5ALZ A;  2B21 A;  5AK6 A;  4QZH A;  2ZH2 A;  3D6J A;  2GOL A;  5HC9 A;  2ZXH A;  1RDF A;  4DQQ A;  2XY5 A;  3AEV A;  5J2E A;  4ED6 A;  9ICM A;  2F44 A;  1BNO A;  3RJJ A;  4KN7 A;  3NVO A;  2H3F A;  3IN5 A;  2IA6 A;  3B9J A;  4YQW A;  3BQ1 A;  3LQC B;  4P4P A;  3OHB A;  4E80 A;  2AGQ A;  2BBH A;  3JZ0 A;  2K4H A;  5DDM A;  1N62 A;  3MFI A;  2KKP A;  1T4G A;  4YR3 A;  2V4Q A;  1KLN A;  3QU9 A;  1WG8 A;  5HHH A;  5IIM A;  5HNK A;  1C20 A;  2ODG A;  3LK9 A;  1RYU A;  3ER8 C;  4J9R A;  2VKQ A;  2LYA A;  3IP4 B;  1SV4 A;  5AI0 A;  5J0Y A;  3RJK A;  3WU2 U;  1PX5 A;  4YN4 A;  3T5H A;  3NUQ A;  2F1J A;  4YD1 A;  5JRT A;  4IL6 U;  1DOQ A;  1ZRN A;  2AGO A;  3E0F A;  2HDO A;  5ALE A;  5BOL A;  4Q43 A;  5L9X A;  4K4I A;  1RYS A;  3SAG A;  2V4R A;  3ZDA A;  8ICA A;  5DLG A;  5KFW A;  1S0M A;  2P66 A;  1RQN A;  4X4U A;  1HEK A;  5DDY A;  3NVV A;  2W7O A;  1WUD A;  4DF4 A;  2UVU A;  3D2Q A;  4RQ8 A;  2ZIX A;  1KW4 A;  3R9K A;  1UET A;  1NK0 A;  3RJG A;  9ICA A;  4C80 A;  1ZQY A;  4WC6 A;  3C29 A;  3LWL A;  2BBJ A;  1BPZ A;  2EDU A;  4OO1 J;  2R8I A;  5G5G A;  5KFX A;  3KD3 A;  5HRG A;  1L3U A;  1JRP A;  4X4V A;  2K8B B;  3SMV A;  4US8 A;  1ED1 A;  3RB0 A;  2HOI A;  2K4I A;  1KNY A;  4F5Q A;  3UPQ A;  3L9D A;  3UM9 A;  4CRX A;  2KIW A;  2E8M A;  3V72 A;  2KN7 A;  1N5W A;  2ZTD A;  9ICS A;  3PW7 A;  2G5I B;  1B43 A;  1ZQW A;  4IRC A;  3PR4 A;  5F9N A;  1S0V A;  4R63 A;  3FYH A;  4HAI A;  4KMU A;  3H0M B;  1SIJ A;  1ZQO A;  1ZQT A;  4RWP A;  4NJ8 A;  4YR2 A;  1XNS A;  3EF2 A;  3HIY A;  5EE0 A;  4CE6 A;  2QB0 A;  2GA9 D;  1PVP A;  1QQ7 A;  4KX5 A;  1N2X A;  4KLG A;  9ICW A;  5KG2 A;  3Q8K A;  2W55 A;  5KFG A;  1KRP A;  2PXI A;  4UAS A;  4DFD A;  4ECV A;  1L3T A;  5AI5 A;  4RQ4 A;  4DOA A;  2HHU A;  2MSN A;  3KKA C;  2ZH9 A;  4M6W A;  4Y2Y A;  5III A;  4EEN A;  3B0Y A;  4C8K A;  1KFS A;  4NXU A;  4C4S A;  2KSO A;  2ZHB A;  2C22 A;  2VA8 A;  2Y1J A;  4ACO A;  3MGI A;  2NRK A;  1X66 A;  3RH4 A;  2UVW A;  5ALI A;  1D9D A;  4E7X A;  1ZQL A;  1GO3 F;  4QZF A;  1MIV A;  1TK8 A;  1K1Q A;  4QWD A;  1NK4 A;  4LZG A;  2M2T A;  4F5P A;  5DGB A;  4DFJ A;  4EZ9 A;  3M8S A;  2LKY A;  5KG7 A;  4UBC A;  5L1M A;  2W03 A;  4XQ8 A;  2F8L A;  2YY6 A;  3K7D A;  1ZOL A;  4MEY A;  3V6H A;  4BX9 C;  9ICP A;  1WWV A;  2KG5 A;  4RWN A;  1SL0 A;  3U26 A;  1ZYQ A;  2AXT U;  4Q8F A;  3WKD A;  4ATB A;  1JRO A;  3H39 A;  4K97 A;  1RYR A;  3D2S A;  2XIC A;  4F92 B;  4B9V A;  5DB9 A;  4QIW C;  4M9H A;  4FHX A;  3PW4 A;  4RPY A;  1HUO A;  5CB1 A;  2ZH6 A;  1S0N A;  1COK A;  1IG6 A;  2VAN A;  5HRI A;  3I28 A;  4YG2 A;  1HUZ A;  3FM9 A;  5KFJ A;  1SZP A;  1JXE A;  2OYY A;  4J03 A;  1NJY A;  1ZQB A;  4JWM A;  4I2B A;  4KIT B;  2PFN A;  1CEZ A;  1RXW A;  1FIQ A;  3VC8 A;  3LWM A;  3WFQ E;  3H8J A;  3MR6 A;  4PJ0 U;  5A0L A;  4EBE A;  2AQ0 A;  5AK3 A;  2YB1 A;  5AI9 A;  2FE9 A;  4TUS A;  1WCN A;  1TVA A;  4GXJ A;  1BPE A;  5IIK A;  2YB4 A;  4OJ6 A;  3JPO A;  1JXL A;  1KKX A;  4DQS A;  4YP3 A;  4DFP A;  3RR7 A;  4M2Y A;  1COO A;  4BWM A;  4RPX A;  4IQV A;  7ICS A;  3KFU F;  4EBJ A;  2NRX A;  1UCV A;  4NLK A;  2E1F A;  4KLS A;  1JQR A;  1KL9 A;  1WWU A;  4Y2U A;  2ASD A;  1FO4 A;  3GQC A;  4EEB A;  3TAD A;  3N97 B;  2KJ8 A;  2W9B B;  2EQY A;  4DSL A;  5JTG A;  2OEH A;  4FHP A;  4M9L A;  1UEU A;  2LM1 A;  2XCA A;  3SZ2 A;  5F3X B;  2R8G A;  3IV6 A;  4RQ7 A;  1TAU A;  2DL0 A;  2XC9 A;  2G09 A;  4UAR A;  5AIC A;  5HHI A;  4KLH A;  3MFH A;  3EYZ A;  1S10 A;  1MIY A;  5KFP A;  1CUK A;  2FI1 A;  4DF8 A;  2OCE A;  4UB2 A;  4F4Y A;  3PST A;  7ICF A;  3M6Z A;  1ZQD A;  3WFP A;  3UXN A;  5J2D A;  4F72 A;  2OM6 A;  2ZJA A;  4I2F A;  2DQN B;  7ICQ A;  4NLC A;  1MQ3 A;  4GIB A;  3LVV A;  4AT7 B;  3MC1 A;  1JAJ A;  3OUY A;  3GIJ A;  5B3P A;  1L8L A;  2Q4T A;  4RQ2 A;  2HN2 A;  1ZQP A;  2LHT A;  3H3A A;  2PMZ F;  5KT5 A;  1Q46 A;  4DFM A;  4PGY A;  5J2C A;  3A0B U;  2FPL A;  4I2G A;  5AI4 A;  8ICB A;  3QXG A;  2NO5 A;  2D8C A;  4YMO A;  1KSP A;  2KD1 A;  3C21 A;  3UMC A;  4K99 A;  3TKA A;  3NWI A;  2W11 A;  1ZQE A;  1EXN A;  1SWW A;  1MA7 A;  2AGP A;  3L5K A;  4OJP A;  1Z19 A;  4KM5 A;  3QEB Z;  2HW3 A;  3TAP A;  4I2D A;  3NVY A;  4PGX A;  2JZB B;  2E3T A;  2DBY A;  2BGW A;  2KEY A;  9ICX A;  5KFY A;  1TKD A;  3RRH A;  4ECQ A;  5EE9 A;  3HJ1 A;  1X6I A;  3EPI A;  4A8E A;  4IRK A;  3C5G A;  4EV6 A;  3DV9 A;  1XC9 A;  8ICU A;  7ICN A;  2W9C B;  4UB6 U;  3RB6 A;  4FH3 A;  1PK1 B;  1UPH A;  3SV3 A;  3V6J A;  2JR5 A;  2IHN A;  4UB3 A;  4ED7 A;  1A76 A;  1T94 A;  4J9N A;  1H38 A;  3C1Z A;  3OVA A;  4B9N A;  8ICW A;  5J0W A;  2VA2 A;  4TQS A;  3PW2 A;  4RNO A;  2FLP A;  3RB3 A;  8ICQ A;  7ICH A;  4MF8 A;  2IUB A;  3TI0 A;  3H8W A;  2YX8 A;  4RT3 A;  4RPZ A;  1XU4 A;  3T3F A;  2WF7 A;  3UQ0 A;  5KG3 A;  5DQH A;  4AP9 A;  4NKU A;  4DL6 A;  4PPX A;  1SV0 A;  1U47 A;  2QB1 A;  3ETL A;  8ICE A;  2JEI A;  4I2I A;  1NK8 A;  2AHO B;  3E2E A;  4PZO A;  2FPK A;  8ICT A;  5G5H A;  4NM1 A;  1J2M A;  1MSW D;  1ZQJ A;  1SKW A;  1LKY B;  5J0U A;  2BR0 A;  3WK7 A;  3JPN A;  1B22 A;  5DB7 A;  3MAB A;  2HBL A;  2ZTE A;  1SKS A;  1RPL A;  3C66 A;  2ZH3 A;  3CW2 C;  5KFF A;  2QKQ A;  2IOF A;  3ZD8 A;  9ICI A;  3IRU A;  2M2W A;  1Y88 A;  5ALV A;  3QEA Z;  4NLB A;  8ICS A;  2YQE A;  4OJO A;  4WC2 A;  2C2D A;  4CGZ A;  4DSE A;  3PZP A;  2GWS A;  5KFA A;  2JMG A;  8ICZ A;  2EAM A;  4X4R A;  5J0S A;  4DL7 A;  1ZD4 A;  5KG4 A;  2ZIV B;  3HW8 A;  4UAU A;  4UAZ A;  5J2I A;  2J6T A;  1A77 A;  3LDA A;  3OPX A;  3PO4 A;  2ZIU A;  4RNN A;  3JCF A;  3M7D A;  1NKB A;  3A0H U;  3BS5 A;  3SR6 A;  3QUT A;  5HRL A;  1F0M A;  4B9T A;  4NXW A;  5HR6 A;  2JHD A;  4KLL A;  4F5N A;  5JU5 A;  5KTQ A;  2ATL A;  2KV2 A;  1N63 A;  3KHH A;  2KHQ A;  1ZQV A;  1Q3V A;  8ICN A;  3ER9 B;  2YMQ A;  1OW5 A;  2A19 A;  4WC3 A;  5CFS A;  3H4D A;  3BQ0 A;  5AKI A;  2DWQ A;  2KVC A;  5KG1 A;  3JPP A;  2QAR A;  4UAT A;  2DR9 A;  5DBB A;  5CWR A;  4O5C A;  1BVS A;  3BDP A;  3GIM A;  2IOF K;  5DG8 A;  3CP8 A;  3PO5 A;  4R8U A;  1O03 A;  4BXO A;  4J9P A;  1UT8 A;  1ZD5 A;  3N28 A;  2HSZ A;  3WK4 A;  2WAQ C;  2IMW P;  5HRH A;  9ICC A;  4CF3 A;  5AI6 A;  1F5S A;  5AI8 A;  3SAH A;  4F4Z A;  1X42 A;  3DDH A;  1DGJ A;  3PSI A;  4MFF A;  1J2N A;  3H40 A;  2NO4 A;  5J0P A;  4WJ3 B;  4TUR A;  3WFO A;  1GPJ A;  1PZN A;  3AQF A;  1UT5 A;  4I2J A;  2LYH A;  3QZ8 A;  1JI7 A;  3QUB A;  5C5J A;  4U7C A;  2WF5 A;  4ZOH C;  4ED2 A;  2HOQ A;  3T79 A;  5CFU A;  3PY8 A;  1NOM A;  2PKE A;  4F4X A;  3TAQ A;  2KZZ A;  4AT9 A;  3OGU A;  2W3R A;  1ZQR A;  4Y2R A;  1R89 A;  2LBO A;  4C8O A;  8ICK A;  3UMB A;  5ALF A;  3TAD C;  3IG5 A;  5J2F A;  4M47 A;  3HX0 A;  3PV8 A;  4ED1 A;  1C7Y A;  2A1J B;  4I29 A;  2ZUB A;  2HHQ A;  2NRW A;  3OVB A;  3ONN A;  4S3N A;  1SB3 C;  5J0O A;  2F77 X;  4Q45 A;  1KDH A;  4NXV A;  2MA1 A;  2FPM A;  5D63 A;  9ICR A;  3GU3 A;  2W8L A;  2B51 A;  5AKJ A;  3UPS A;  3TFS A;  4F5O A;  4RUC A;  4XJE A;  5ALM A;  4O3M A;  4OAH A;  1XO1 A;  4KLI A;  3JPQ A;  3MDC A;  5ALJ A;  5HRF A;  4PH5 A;  1U49 A;  4NL9 A;  4UB5 A;  3VCB A;  5KAF U;  2XY7 A;  2CRX A;  1KFD A;  4M9J A;  1Q79 A;  2EZX A;  3AQL A;  4QIW F;  5BPC A;  5ALP A;  4EX6 A;  2BQ3 A;  4P0Q B;  1DRG A;  3GV8 B;  1PK3 A;  3WK6 A;  4FH5 A;  5DQI A;  2C2R A;  4LZD A;  3H38 A;  3V7L A;  1BGX T;  5KFZ A;  4RQ5 A;  3MR5 A;  8ICC A;  4KMO B;  2LI6 A;  4FZL A;  9ICF A;  1L7N A;  4QZI A;  2V9W A;  4DL2 A;  3Q8M A;  1TAQ A;  4JWN A;  2A3V A;  3V7K A;  1HJP A;  1UQV A;  5KFS A;  5L1K A;  4DWI A;  2LMR A;  3EUB 2;  3N7R C;  3N7S C;  5AKG A;  1QQ6 A;  3K1R B;  5TIS U;  4NV0 A;  2DUY A;  5KG6 A;  4DO9 A;  2XY6 A;  4IG8 A;  2KNJ A;  4GC7 A;  3ZDC A;  3FAH A;  9ICV A;  1B0X A;  1K5O A;  4ECT A;  1F44 A;  4DLG A;  4I28 A;  3Q8P B;  3WKE A;  1SGG A;  2EAP A;  3WKC A;  1QTM A;  4YD2 A;  4ED8 A;  4C7Z A;  4LVS A;  5ALS A;  5DGA A;  2WTF A;  1JUD A;  1VLB A;  2J6U A;  4RQ0 A;  4WQK A;  1NO5 A;  4G9B A;  5CFT A;  5KFO A;  5DBC A;  1U45 A;  2H3Q A;  4DCC A;  3C2L A;  2KP7 A;  3GV7 B;  3AQM A;  4I0U A;  4NKT A;  4P0P B;  5EWG A;  1JMS A;  4MEX A;  1SV0 C;  4NLN A;  5AM1 A;  4QJF B;  3FC4 A;  4QZB A;  4NM2 A;  2HOF A;  1URJ A;  4UAV A;  4KLU A;  1JN3 A;  2B6G A;  2BCU A;  1VJ7 A;  4O3P A;  4K4G A;  3AQN A;  3NRW A;  5ALX A;  1J97 A;  5ALT A;  4WH5 A;  2KZ3 A;  2I6X A;  1OU5 A;  1ZQZ A;  4RQN A;  1ZQK A;  4J9L A;  3AM9 A;  2RDI A;  3O0F A;  2P6R A;  2ZH7 A;  3M6K A;  4X0B A;  1T3Q A;  4F2R A;  4LJX A;  3I76 A;  4IRD A;  5D4B A;  4IS7 A;  2DR8 A;  1NZP A;  1NJW A;  5L1L A;  4CF4 A;  5J2B A;  4UQG A;  3H37 A;  5E79 U;  5KFQ A;  9ICB A;  1Z4N A;  4QWB A;  3C23 A;  8ICF A;  5AK4 A;  3G6V A;  1M6Y A;  1V9P A;  2JRZ A;  3RH6 A;  3OWG A;  2FMQ A;  4UAW A;  2NV3 A;  4AT8 B;  2MAX A;  4ELU A;  4NY8 A;  3WKB A;  4IR9 A;  1D8B A;  5KG5 A;  4ECZ A;  5CEH A;  1JX4 A;  3LYS A;  3GII A;  3SI8 A;  1KQQ A;  3ZDD A;  4M0A A;  1CRX A;  4PGQ A;  1X40 A;  4RQM A;  4F5R A;  3ALR A;  1D8Y A;  4O3N A;  1L7M A;  1YZ7 A;  5AIB A;  5AKX A;  2H3Z A;  2EAN A;  1N61 A;  5HRB A;  2JH7 A;  1LVH A;  4XUS A;  3ISD A;  1YT3 A;  2FJ6 A;  5TZV A;  3NKU A;  3QYP A;  3QNM A;  1CI4 A;  3H7I A;  3PMN A;  2HHV A;  4F2S A;  2I1Q A;  4B9L A;  4IQW A;  4I2H A;  5CRX A;  3QZ7 A;  2K8C B;  5B3Q A;  8ICO A;  3ED5 A;  2MU2 A;  3NRZ A;  3WK5 A;  3ZDE A;  5IIO A;  3NGD A;  3AQK A;  1ZRM A;  5L1J A;  1WOT A;  5HRK A;  4B9U A;  4JLZ A;  2C2E A;  3WFR E;  2OHF A;  2XI9 A;  1Z1V A;  2JGA A;  5KL8 B;  3ETR A;  4Y2Q A;  7ICL A;  1Q8K A;  2M9N A;  4GC6 A;  2B56 A;  2BQR A;  3QUC A;  4MHV A;  4P4M A;  3NTU A;  4DQI A;  3AL0 B;  7ICU A;  4X4S A;  1Q78 A;  4DOB A;  2BHN A;  1S97 A;  3KZX A;  4QZA A;  2P35 A;  1IM4 A;  4ELV A;  1S8O A;  2GO7 A;  2P6U A;  1X9M A;  4YMM A;  5DEC A;  3DEE A;  2QAR B;  1NI3 A;  1Q3U A;  2EAO A; 
#chains in the Genus database with same CATH homology
 4YN4 A;  1K1S A;  5F9L A;  3T5H A;  4UAZ A;  2ASJ A;  5J2I A;  4J9S A;  2J6T A;  2F1J A;  4BDP A;  1ZQM A;  4YD1 A;  3JYY A;  2DRA A;  2BE3 A;  4PHA A;  1A77 A;  1DOQ A;  3LDA A;  4PHP A;  2AGO A;  2BKE A;  3PO4 A;  4R8U B;  4I2E A;  2O5A A;  4MFA A;  5BOL A;  4JV1 A;  4RNN A;  3NYB A;  4Q43 A;  5L9X A;  4YCX A;  1SL1 A;  3PR5 B;  1TK0 A;  1NKB A;  4UAY A;  1LB2 B;  1RYS A;  4K4I A;  7ICM A;  1ZQG A;  4FHY A;  3RR8 A;  5CA7 A;  5HRL A;  3Q8L A;  4RWQ A;  4F50 A;  4DL3 A;  2V4R A;  3ZDA A;  1UA1 A;  5DLG A;  4B9T A;  8ICA A;  4Z6C A;  1R8C A;  3C18 A;  3OSN A;  5KT6 A;  1L3S A;  4QWC A;  3SV4 A;  1QSL A;  4GXI A;  2O1P A;  5KFW A;  2J6S A;  4J9M A;  1S0M A;  2P66 A;  4DSF A;  4R64 A;  4KLL A;  4X4U A;  4O5E A;  4F5N A;  5DDY A;  3M9N B;  2DR5 A;  4P2H A;  5KTQ A;  2ATL A;  5KT2 A;  4DF4 A;  2UVU A;  2M2U A;  4RQ8 A;  3KHH A;  1ZQV A;  8ICN A;  4E8F A;  4K4H A;  2RFF A;  1UET A;  1NK0 A;  1ZQF A;  4WC3 A;  3RJG A;  9ICA A;  5HRD A;  2FMS A;  1ZQY A;  4NXZ A;  5KFN A;  3H4D A;  3BQ0 A;  4RQ1 A;  1QLN A;  5KFI A;  3MGH A;  4KTQ A;  4WC6 A;  3LWL A;  2BPF A;  8ICM A;  5HMM A;  2A1J A;  1BPZ A;  5KG1 A;  2MUT B;  3JPP A;  3G6Y A;  4BWJ A;  4RU9 A;  5J0Q A;  1DGS A;  2R8I A;  1Z00 B;  2F1H A;  5DBB A;  3ISB A;  2DR9 A;  5KFX A;  5KFU A;  5CWR A;  4O5C A;  1V4A A;  4EBC A;  5HRG A;  4FS1 A;  1BVS A;  1L3U A;  3GIM A;  3BDP A;  4FBT A;  4X4V A;  3N4M B;  3RB0 A;  5DG8 A;  2NRK A;  4JV0 A;  5HML A;  4ECS A;  3PO5 A;  4EBK A;  4R8U A;  1NK5 A;  1KNY A;  4F5Q A;  3UPQ A;  3L9D A;  7ICJ A;  4RWO A;  4X4O A;  4E0D A;  4BXO A;  4J9P A;  1UEV A;  1IXR A;  1UT8 A;  2DFL A;  3V72 A;  4J9Q A;  2KN7 A;  3H4B A;  3V7J A;  2IMW P;  2ZTD A;  5HRH A;  9ICC A;  9ICS A;  4J9K A;  2ZUD A;  1T3N A;  8ICP A;  4YMN A;  4KLD A;  5J2J A;  3PW7 A;  1NJZ A;  1B43 A;  1ZQW A;  4TUQ A;  5KT7 A;  4ED0 A;  3ORY A;  1NK6 A;  3PR4 A;  5F9N A;  5DG7 A;  4IRC A;  1S0V A;  5KFL A;  4YXJ A;  4F4Z A;  4ECW A;  4R63 A;  3FYH A;  4R65 A;  5D49 A;  4S3N A;  7ICP A;  4RNM A;  4MFF A;  4KMU A;  9ICE A;  1TV9 A;  3H40 A;  1ZQO A;  1ZQT A;  1YLQ A;  4X4P A;  4NLG A;  4RWP A;  4YR2 A;  2AQ4 A;  3C1Y A;  2Q66 A;  1ZQC A;  2W9A A;  4Q44 A;  5DB8 A;  5J0P A;  3HIY A;  4TUR A;  3V6K A;  3RJE A;  1PZN A;  3WFO A;  4J9O A;  8ICH A;  2R8J A;  2ZHA A;  2ZH4 A;  1UT5 A;  4I2J A;  4P4O A;  2LYH A;  3QZ8 A;  4ECU A;  4LVS A;  2MUT A;  1N56 A;  2NRV A;  1L5U A;  5IIJ A;  4KLG A;  1NJX A;  9ICW A;  5KG2 A;  3Q8K A;  1Z00 A;  4DSJ A;  5C5J A;  3BQT A;  5KFG A;  1KRP A;  4UBB A;  2PXI A;  4ECV A;  5EWF A;  1L3T A;  4ED2 A;  7ICR A;  4RQ4 A;  3PY8 A;  1NKC A;  4DOA A;  4NLZ A;  2HHU A;  1NOM A;  4QW8 A;  2ZTC A;  2ZH9 A;  4F4X A;  2JEF A;  4M6W A;  2AJQ A;  1ZET A;  4Z6F A;  3PW5 A;  3TAQ A;  4WC5 A;  4O3Q A;  5III A;  3T5K A;  1NK7 A;  2KZZ A;  3B0Y A;  4F93 B;  4QZD A;  1KTQ A;  1KFS A;  4C8K A;  4AT9 A;  3OGU A;  3RTV A;  2ZHB A;  3JPS A;  2OWO A;  5KFV A;  2C22 A;  2VA8 A;  1ZQR A;  9ICU A;  2Y1J A;  5KFT A;  3Q8R B;  1R89 A;  3MGI A;  4X4N A;  4C8O A;  8ICK A;  3JPR A;  2Y1I A;  3RH4 A;  5J2F A;  2W9M A;  1T8E A;  2UVW A;  4M47 A;  1D9D A;  3HX0 A;  3PV8 A;  1DK3 A;  4E7X A;  2ZH5 A;  3K4G A;  1ZQL A;  1R8A A;  4ED1 A;  1C7Y A;  1D9F A;  4QZF A;  1MIV A;  2A1J B;  3Q8S B;  4I29 A;  3BQ2 A;  1K1Q A;  4UB4 A;  2ZUB A;  4QWD A;  1TK8 A;  2IHM A;  1NK4 A;  4LZG A;  2HHQ A;  2ZH1 A;  2M2T A;  1ARO P;  2NRW A;  1T7P A;  3OVB A;  4F5P A;  4QZ9 A;  3HPO A;  2I9G A;  5DGB A;  4B9M A;  4DFJ A;  4EZ9 A;  2UVR A;  3M8S A;  3ZD9 A;  5KFR A;  4ECX A;  7ICK A;  7ICE A;  4QZ8 A;  5KG7 A;  4DOC A;  4KLE A;  4WC1 A;  4JUZ A;  5J0O A;  4UBC A;  3RAQ A;  2KFZ A;  7ICO A;  4M5D A;  4XQ8 A;  5J0R A;  4Q45 A;  1KDH A;  4EP7 A;  3PX0 A;  4BXO B;  4DSK A;  8ICJ A;  2FPM A;  1XSP A;  7ICI A;  1KFT A;  4MEY A;  1QSY A;  4IQT A;  9ICR A;  3C2K A;  4KLT A;  4I2C A;  2R8H A;  9ICG A;  1BPD A;  3GIL A;  4MFC A;  5KG0 A;  4JK1 A;  1ZJM A;  3V6H A;  2W8L A;  1TFW A;  3UPS A;  2ZH8 A;  1WCL A;  3OJU A;  3TFS A;  3RB4 A;  3OSP A;  4RQ3 A;  9ICP A;  4F5O A;  4RWN A;  4RUC A;  1SL0 A;  3EW9 A;  1ZYQ A;  4Q8F A;  4MF2 A;  4EBD A;  4EZ6 A;  4ATB A;  4ECY A;  5CP2 A;  4C8M A;  3H8S A;  3H39 A;  1JIH A;  1RYR A;  1BPY A;  3OHA A;  5KFM A;  5J0X A;  4F92 B;  3Q8Q B;  1UA0 A;  2PBE A;  1S9F A;  4B9V A;  4C8N A;  5DB9 A;  8ICG A;  4RZR A;  5HRE A;  1XO1 A;  4O0I A;  3JPQ A;  4R66 A;  4DS4 A;  4KLI A;  4YR0 A;  4M9H A;  4FHX A;  3PW4 A;  4F3O A;  1Z3E B;  1ZQU A;  3MDC A;  4RPY A;  5EOZ A;  2UVV A;  2BDP A;  1HUO A;  2H5X A;  1SKR A;  5CR0 A;  5CB1 A;  2DPI A;  4PH5 A;  1U49 A;  5HRF A;  4DEZ A;  1S0N A;  4F4W A;  2HHP A;  2ZH6 A;  4UB5 A;  1U4B A;  2IBK A;  3RJI A;  2VAN A;  2DR7 A;  5DBA A;  5HRI A;  4YG2 A;  1HUZ A;  4AT7 A;  2XY7 A;  4M9J A;  1KFD A;  5KFJ A;  3PX4 A;  1SZP A;  4X4Q A;  1JXE A;  1ZQB A;  2PFP A;  1NJY A;  1LV5 A;  4JWM A;  1Q79 A;  3AQL A;  7ICV A;  3RBE A;  4I2B A;  2NRZ A;  4KIT B;  5DLF A;  1ZQN A;  2PFN A;  3RJH A;  1RXW A;  3KTQ A;  1CEZ A;  1BNP A;  3LWM A;  5BPC A;  3WFQ E;  2XGP A;  1S76 D;  2BQ3 A;  2DVI A;  3C2M A;  3H8J A;  3MR6 A;  4X4S A;  4EBE A;  2PI5 A;  3GV8 B;  4FH5 A;  2AQ0 A;  9ICL A;  5DQI A;  2C2R A;  4M6W B;  3WFS C;  4O3O A;  1ZQI A;  4LZD A;  3H38 A;  3V7L A;  1BGX T;  4AT9 B;  5HP4 A;  4TUS A;  4JV2 A;  1WCN A;  1TVA A;  5J2A A;  4GXJ A;  1BPE A;  4WBY A;  5KFZ A;  4RQ5 A;  4DS5 A;  4TQR A;  5IIK A;  4RUA A;  4YVZ A;  3MR5 A;  3K75 D;  8ICC A;  4I2A A;  4GLX A;  3EPG A;  4FS2 A;  4FHW A;  5J2K A;  9ICF A;  3JPO A;  1X9S A;  1JXL A;  3G6X A;  4QZI A;  4DQS A;  4YP3 A;  4DFP A;  4M04 A;  3RR7 A;  8ICI A;  2V9W A;  4DL2 A;  4M2Y A;  1COO A;  4BWM A;  4RPX A;  2C28 A;  2PI4 A;  2R8K A;  3Q8M A;  4IQV A;  1TAQ A;  4JWN A;  3M8R A;  7ICS A;  4EBJ A;  4X4T A;  3V7K A;  1HJP A;  4KN4 A;  2NRX A;  5KFS A;  4NLK A;  4KLS A;  1JQR A;  5L1K A;  4BGD A;  4DWI A;  2ASD A;  4O3R A;  2HHX A;  3GQC A;  1RZT A;  2F1I A;  3HJ4 A;  4DFK A;  3N97 B;  2ISP A;  4Z6D A;  9ICK A;  2W9B B;  4DSL A;  3GDX A;  1U48 A;  2FLL A;  3KHR A;  3SYZ A;  2BPC A;  3RJF A;  1F5A A;  5KG6 A;  4FHP A;  5J29 A;  4DO9 A;  4QZC A;  2XY6 A;  4M9L A;  1VFG A;  4IG8 A;  3PX6 A;  9ICO A;  1UEU A;  4RQ6 A;  4GC7 A;  2XCA A;  3SZ2 A;  3ZDC A;  5KFD A;  9ICV A;  4ECT A;  4DLG A;  2R8G A;  4RQ7 A;  1TAU A;  4LT6 A;  4I28 A;  3Q8P B;  3UQ2 A;  4AT8 A;  2XC9 A;  2RDJ A;  1L3V A;  3FDS A;  1XS9 D;  5HHI A;  4KLH A;  2FLN A;  4ATB B;  1QTM A;  4YD2 A;  3THV A;  4ED8 A;  1ZQQ A;  1TFY A;  3MFH A;  3UXO A;  2W9C A;  3EYZ A;  5DGA A;  1S10 A;  3GFK B;  5KFP A;  2WTF A;  2AU0 A;  2J6U A;  1CUK A;  4ZH4 A;  4RQ0 A;  1MIY A;  4DF8 A;  3AU2 A;  4UB2 A;  4F4Y A;  1ZJN A;  1NO5 A;  7ICF A;  3GIK A;  5IIN A;  1ZQD A;  3WFP A;  5KFO A;  5DBC A;  1U45 A;  2ISO A;  2Q0Z X;  1ZQH A;  3UXN A;  1DK2 A;  3C2L A;  4XA5 A;  5HR9 A;  5J2D A;  1BPB A;  2KP7 A;  4O9M A;  2ZJA A;  3GV7 B;  4I2F A;  3AQM A;  4WCW A;  5KT4 A;  2KFN A;  7ICQ A;  1MQ3 A;  4NKT A;  5EWG A;  5BOM A;  4AT7 B;  4UB1 A;  3EWA A;  1JMS A;  4MEX A;  4HYK A;  4Q8E A;  4GXK A;  4NLN A;  1JAJ A;  3MR3 A;  5DB6 A;  4I27 A;  3OUY A;  5KFB A;  2XCP A;  3GIJ A;  4IR1 A;  1TFR A;  5DKW A;  4TUP A;  9ICH A;  3JPT A;  4QZB A;  4RQ2 A;  8ICV A;  4NM2 A;  4PHE A;  8ICL A;  2W9B A;  1ZQP A;  3M9M B;  4KLU A;  4M9N A;  1JN3 A;  5D46 A;  2BCU A;  7ICT A;  1VJ7 A;  4O3P A;  3H3A A;  4K4G A;  3AQN A;  5KT5 A;  4F91 B;  7ICG A;  3IHQ B;  4KLJ A;  4DFM A;  4FHV A;  4PGY A;  5J2C A;  2FPL A;  2KZ3 A;  1S0O A;  4I2G A;  1RXV A;  8ICB A;  5JUM A;  1OU5 A;  1ZQZ A;  9ICQ A;  1ZQK A;  4J9L A;  3MR2 A;  2RDI A;  4YMO A;  3TAR A;  1KSP A;  2PFO A;  2PFQ A;  2P6R A;  2ZH7 A;  3C21 A;  3RRG A;  1XWL A;  9ICT A;  4X0B A;  4DL4 A;  1ZQE A;  4F2R A;  5KFH A;  3RAX A;  1EXN A;  4IRD A;  5D4B A;  3PW0 A;  2AGP A;  2DR8 A;  2ZJ8 A;  3QEB Z;  2DRB A;  2HW3 A;  3TAP A;  1NZP A;  1NJW A;  4I2D A;  4QZG A;  5L1L A;  3T5L A;  4X5V A;  4UQG A;  5J2B A;  1ZQS A;  5DED A;  4WC4 A;  2BCQ A;  4PGX A;  4QWA A;  4B9S A;  2JZB B;  4O5K A;  3B0X A;  2BGW A;  3H37 A;  2HHT A;  4F8R A;  2NRT A;  1MQ2 A;  5KFQ A;  5KFY A;  9ICB A;  9ICX A;  1TKD A;  2JEJ A;  4QWB A;  3MBY A;  2BCR A;  3C23 A;  8ICF A;  3G6V A;  4O3S A;  3IM1 A;  5J2G A;  3EZ5 A;  3RRH A;  1V9P A;  4ECQ A;  1ZQX A;  5IIL A;  2ID1 A;  3HJ1 A;  1ZQA A;  3RH6 A;  2FMQ A;  1U9L A;  1N48 A;  3EPI A;  4UAW A;  3M9O B;  4IRK A;  2M2V A;  4AT8 B;  4PHD A;  3C5G A;  4FO6 A;  2MAX A;  2ZJ5 A;  4EEY A;  1XC9 A;  4CCH A;  4ELU A;  3AUO A;  4RT2 A;  4NY8 A;  7ICN A;  8ICU A;  8ICX A;  4IR9 A;  3RBD A;  4ELT A;  1S77 D;  3OV7 A;  2W9C B;  3T5J A;  4UD5 A;  5KG5 A;  4ECZ A;  3RB6 A;  2KTQ A;  4FH3 A;  2ASL A;  1TK5 A;  4X0A A;  8ICY A;  2ALZ A;  3KHL A;  5KFC A;  3RH5 A;  1MC8 A;  3GV5 B;  1JX4 A;  1BPX A;  3SV3 A;  4QWE A;  3V6J A;  1KEJ A;  2IHN A;  4UB3 A;  3GII A;  4ED7 A;  3SI8 A;  3ZDD A;  3MDA A;  4XQ7 A;  1A76 A;  2W8K A;  4M0A A;  4KLM A;  4PGQ A;  4J9N A;  1H38 A;  3C1Z A;  3AU6 A;  3OVA A;  1R8B A;  3HP6 A;  4B9N A;  2BQU A;  5J0W A;  4F5R A;  2VA2 A;  8ICW A;  4TQS A;  3PW2 A;  4RNO A;  1D8Y A;  3RB3 A;  4O3N A;  2FLP A;  8ICQ A;  4MF8 A;  1SL2 A;  7ICH A;  4M9G A;  1X9W A;  2BCV A;  3TI0 A;  3H8W A;  4RT3 A;  5CJ7 A;  4RPZ A;  2HVI A;  3UXP A;  3OUY B;  1XU4 A;  5HRB A;  5DG9 A;  3ISC A;  4QZE A;  3PML A;  3T3F A;  3UQ0 A;  4IQU A;  3HWT A;  4DL5 A;  4XUS A;  2JEG A;  3ZDB A;  4DQP A;  2JZB A;  3ISD A;  3OVS A;  5TZV A;  4YXM A;  4UD4 A;  2XGQ A;  5KG3 A;  3HT3 A;  2BCS A;  5DQH A;  1FA0 A;  3H7I A;  5J2H A;  4DL6 A;  3PMN A;  4C8L A;  4PPX A;  4NKU A;  5KFE A;  2HHV A;  3C5F A;  5KT3 A;  1U47 A;  2I1Q A;  4B9L A;  4F2S A;  3BJY A;  4IQW A;  4I2H A;  3ETL A;  5KFK A;  4F4K A;  8ICE A;  1X2I A;  4EYI B;  2JEI A;  4I2I A;  4KLO A;  9ICN A;  1NK8 A;  3QZ7 A;  2FMP A;  3E2E A;  2HHW A;  3TQ1 A;  3PNC A;  2FPK A;  8ICO A;  4QW9 A;  4E80 A;  4DLE A;  4WC7 A;  2ZUC A;  4XRH A;  8ICT A;  4NM1 A;  2B21 A;  4ED3 A;  1MSW D;  3ZDE A;  4QZH A;  1ZQJ A;  2ZH2 A;  5HC9 A;  9ICJ A;  8ICR A;  1SKW A;  5IIO A;  3NGD A;  4DQQ A;  3AQK A;  2XY5 A;  5L1J A;  2BPG A;  4FBU A;  5J0U A;  2BR0 A;  5HRK A;  1WOT A;  4B9U A;  5J2E A;  4EYH B;  3TFR A;  3JPN A;  4ED6 A;  5CHG A;  2C2E A;  4KLF A;  1B22 A;  9ICM A;  5F2V O;  3WFR E;  4YFK A;  5DB7 A;  3RJJ A;  1BNO A;  3MAB A;  4KN7 A;  2HHS A;  2IA6 A;  1QSS A;  4YQW A;  2ZTE A;  3BQ1 A;  1SKS A;  1RPL A;  4P4P A;  1NKE A;  4DSI A;  3LQC B;  3C66 A;  2ZH3 A;  5KFF A;  4WC0 A;  1NK9 A;  7ICL A;  1MIW A;  3ZD8 A;  2M9N A;  3OHB A;  9ICI A;  2M2W A;  4GC6 A;  1Y88 A;  3TAN A;  2BQR A;  4P4M A;  4DQI A;  3NTU A;  4Z6E A;  3QE9 Y;  5DQG A;  3QEA Z;  7ICU A;  3PVX A;  1Q78 A;  4WBZ A;  4DOB A;  2AGQ A;  4ECR A;  8ICS A;  2DPJ A;  3JZ0 A;  5DDM A;  1XSL A;  2BHN A;  3MFI A;  1S97 A;  1T4G A;  4WC2 A;  2C2D A;  4YR3 A;  4QZA A;  2V4Q A;  1KLN A;  4DSE A;  5L1I A;  2HVH A;  4ELV A;  1IM4 A;  2GWS A;  5HHH A;  5IIM A;  1D8L A;  5KFA A;  5HNK A;  4KLQ A;  3LK9 A;  5EWE A;  3KHG A;  2P6U A;  8ICZ A;  1X9M A;  4X4R A;  4J9R A;  4YMM A;  5J0S A;  5J0T A;  4DL7 A;  5KG4 A;  5DEC A;  4DQR A;  3OJS A;  5J0Y A;  3HW8 A;  3RJK A;  2XO7 A;  2KZM A;  4G3I A;  2VA3 A;  1XSN A;  1PX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...