4NXTA

Crystal structure of the cytosolic domain of human mid51
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
337
Chain Sequence
DLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxtA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxtA02
4K9AA 4JLXA 4WOYA 4K96A 4K9BA 4K99A 4NXVA 4KM5A 4LEYA 4K97A 4OAHA 4O68A 4ATBB 4AT9A 4AT8A 4AT7A 4K98A 4OAIZ 4LEWA 4AT9B 4LEVA 4O6AA 4AT8B 4OAFA 4AT7B 4KB6A 4JLZA 4NXXA 4LEZA 4MKPA 4NXTA 4O69A 4K8VA 4NXUA 4OAGA 4ATBA 4O67A 4NXWA
chains in the Genus database with same CATH superfamily
2VANA 4WH5A 5J2JA 3TFSA 5DECA 1BPYA 4YN4A 3UQ2A 1TFWA 5CP2A 9ICFA 3LK9A 4WC6A 9ICEA 4TURA 8ICPA 5HRGA 8ICFA 4WBZA 4S3NA 4RWOA 1ZQZA 4WC5A 5DB8A 3ISBA 4O5EA 2DR7A 5IINA 4AT9B 4NLKA 1ZQWA 5B3PA 3JYYA 3UXPA 4UB5A 5DDMA 4MKPA 3PHZA 4ATBA 4QZAA 3WFPA 1Q78A 4M04A 3AUOA 1ZQJA 4RWPA 4EBJA 1HUOA 9ICBA 4QZIA 3MGHA 5DB7A 4UAZA 1RPLA 3H38A 4WC0A 4IQTA 4QZDA 9ICPA 2DVIA 2P66A 3JPPA 1ZQBA 4M0AA 3OVAA 1UETA 8ICIA 4YD2A 4KLIA 2ISOA 3OVBA 2IUBA 2GWSA 2W9MA 2GAFD 2DR8A 3NKUA 4NXTA 4Z6DA 4M47A 4WCWA 4I2GA 4WOYA 4X4RA 2FMPA 4I27A 9ICTA 3OUYB 4NXVA 4GXJA 2EWRA 1ZQSA 3HJ1A 1TV9A 4OAHA 4QZHA 4QZCA 4NM1A 4AT8A 4X4SA 8ICJA 5DBCA 3UPSA 4DOBA 4UBCA 5HRBA 5IILA 4RPZA 3RH6A 4FHWA 4UB4A 4PGQA 2HN2A 1ZQGA 4I2HA 4X4PA 2B56A 4KLLA 3EF2A 2Q66A 8ICAA 4DO9A 3C5GA 4NXWA 1ZQXA 5D4BA 3NVOA 4RQ1A 3WFQE 3H37A 4RQ5A 4GXIA 4F5NA 5DBAA 5HHHA 5D62A 5J2DA 4RQ3A 4FHXA 4XQ7A 3AQLA 1R8AA 7ICEA 4NKUA 1BPBA 7ICQA 4K4IA 1PX5A 2PFNA 2PFOA 4X4QA 3PMLA 2PFQA 4P4MA 5HRLA 1VJ7A 1XSLA 4P2HA 2ZHAA 4YD1A 5HRHA 4MF8A 1XSNA 4AT7B 4KB6A 1VFGA 1OU5A 9ICHA 9ICRA 4X4UA 4XRHA 8ICSA 2ZH7A 4N7RA 5J0RA 4RWNA 4PHEA 3ERCC 2PBEA 8ICEA 4XUSA 5JTGA 3UPQA 3JPNA 5J0OA 3RJGA 4KLHA 3K75D 2HN1A 7ICSA 5DEDA 1ZQFA 1KNYA 4WC4A 8ICTA 4X4OA 5DB9A 2BPGA 9ICXA 3AU2A 2ZH5A 1GPJA 8ICVA 4WBYA 4XJEA 5J2BA 4I29A 1ZQCA 4WQKA 4IQWA 2O5AA 7ICIA 4HX0A 4O69A 3MBYA 5CHGA 5F2VO 4R63A 4NXZA 5DB6A 2ZH1A 1JMSA 4FH5A 4KLQA 4PHDA 1ZQDA 4I2BA 4M5DA 2ISPA 4P4OA 5J2CA 2BCVA 3K7DA 5J0PA 2M2VA 2DRAA 2B4VA 7ICFA 4O6AA 4UB1A 2ID1A 3V7LA 3CK6A 3NYBA 9ICGA 4PGYA 3JZ0A 3V7JA 7ICNA 3MDCA 4LEYA 3AQKA 4UB3A 8ICHA 3ISCA 5EOZA 5HRDA 2RFFA 5BPCA 4WC7A 5J2FA 5J0QA 1UEVA 1Q79A 7ICJA 8ICQA 1ZQTA 1ZQRA 7ICRA 5IIKA 4LEVA 3ER8C 3WFSC 4RQ4A 2BCSA 4QZFA 4NXXA 5HRIA 8ICLA 5D61A 5J2GA 5CA7A 7ICMA 9ICKA 9ICUA 1ZQUA 8ICUA 2ZHBA 4LZGA 4X4NA 3HWTA 9ICLA 4X5VA 2DR5A 2IHOA 7ICLA 4WC2A 5TZVA 7ICGA 4M9HA 1MQ3A 4MFAA 7ICPA 1HUZA 4K98A 1BPEA 3JPRA 5DKWA 3RH5A 3OWGA 4KLFA 3RJKA 5CFUA 2HHPA 4R66A 3OUYA 4EEDA 1ZQIA 9ICWA 3RH4A 9ICJA 7ICKA 4EGWA 4E80A 1RZTA 4K96A 4K9BA 2B51A 3C2KA 1ZJMA 3HJ4A 4KLMA 4FO1A 4XQ8A 1UEUA 2I9GA 4WC3A 3HW8A 4KLDA 9ICVA 4M9GA 4KLJA 1JAJA 2IHMA 8ICYA 4KLOA 4LEWA 1TFYA 2BE3A 5CR0A 4O9MA 1NOMA 1MQ2A 8ICMA 3RJHA 1MIWA 4RT3A 2NRKA 3JPSA 4OAGA 2M2TA 2PXIA 1YLQA 4O67A 9ICQA 9ICSA 4X0AA 4QZ9A 2FCLA 2FMQA 4UD4A 3AQNA 5IIMA 4RQ2A 4KLGA 4RQ7A 4KLTA 4IQUA 3V7KA 2ZH8A 4RQ8A 5J0TA 4GXKA 7ICVA 3MCRA 4UAYA 2ZH3A 4AT7A 5BOLA 4OAIZ 5CFTA 5J0SA 4I2AA 3OVSA 4E7XA 4UB2A 1ZQLA 4RQ0A 2BCQA 8ICNA 4MFFA 4O5CA 4K4GA 7ICOA 1BPDA 4EEBA 4LVSA 3UXNA 4RQ6A 3C66A 3C18A 1JN3A 4NM2A 4E8FA 5D49A 5IIOA 2ZH9A 4PPXA 1ZQHA 3WFRE 4F5OA 2BPCA 4DOCA 2FMSA 4I2CA 4WC1A 8ICZA 3LQCB 4YMMA 1ZQEA 3MGIA 8ICCA 3RJEA 5J2AA 9ICMA 4LEZA 1MIYA 5J2IA 3JPOA 4EBKA 3B0XA 3B0YA 4JLXA 3H3AA 5J2EA 7ICTA 4TUQA 1V4AA 5CWRA 8ICOA 7ICHA 4M9JA 5CHEA 4XA5A 4ATBB 4AT9A 4X4TA 3AQMA 1ZQPA 4Z6EA 3OV7A 4FHVA 4R65A 8ICRA 4YCXA 4I2DA 1KEJA 5D46A 4UBBA 8ICGA 4O5KA 2ZH6A 1MIVA 3MDAA 1TVAA 2DR9A 4IQVA 1BPZA 2BCUA 4QZBA 4K9AA 5IIJA 8ICXA 5J0WA 1R89A 2M2UA 3HX0A 4EV6A 5B3QA 4FHPA 4Z6CA 3PMNA 4KM5A 2M2WA 5J2HA 2BCRA 4R64A 4YMNA 4O68A 2BBHA 4YMOA 3ER9B 3NWIA 8ICKA 4NLZA 4I2JA 1KDHA 2BBJA 5J0YA 1ZQNA 5CFSA 4UD5A 4DOAA 4AT8B 5IIIA 4M9NA 4QZEA 3RJIA 3AU6A 4PH5A 4NXUA 4X4VA 4NLNA 4EP7A 4IG8A 3HIYA 4KLUA 3WFOA 4K99A 1F5AA 4RT2A 9ICCA 4FHYA 5J2KA 1WOTA 2ZH4A 4TUSA 4QZ8A 4JWMA 5HHIA 7ICUA 1R8CA 4F5QA 4NKTA 4KLSA 4I2EA 9ICOA 4K4HA 8ICWA 9ICIA 4M2YA 4MF2A 5J29A 4OAFA 4JLZA 4TUPA 1R8BA 4I2FA 5HR9A 4RPXA 4WQLA 3RJFA 3UQ0A 4F5RA 3C2MA 4P4PA 4Z6FA 5CJ7A 5HRKA 1ZQMA 1XSPA 4K97A 1BPXA 3V72A 3PNCA 3OGUA 4LT6A 3UXOA 4MFCA 4PGXA 3L9DA 5J0UA 2GA9D 1ZQKA 1ZQAA 4I2IA 3TFRA 4F5PA 1ZQYA 9ICNA 5HREA 3C2LA 3RJJA 5CB1A 3GDXA 4UAWA 2PFPA 4I0UA 4RWQA 5BOMA 4QZGA 8ICBA 4PHAA 1ZQVA 3ISDA 5DDYA 4PHPA 9ICAA 4FH3A 3JPTA 1FA0A 4FO6A 3JPQA 5HRFA 3JCFA 4RPYA 4NY8A 4M9LA 4X0BA 4I28A 4JWNA 3H39A 1NO5A 4KLEA 5D63A 1ZQQA 1JQRA 2BPFA 2ZH2A 1ZJNA 5HC9A 5DBBA 3C5FA 4K8VA 5J0XA 1ZQOA 4LZDA 2O1PA 2DRBA
chains in the Genus database with same CATH topology
4K9AA 2ZH7A 1R89A 4K96A 4K9BA 2B51A 4N7RA 4WH5A 5B3QA 4FHPA 3HJ4A 3ERCC 4KM5A 4FO1A 1TFWA 1UEUA 4O68A 3ER9B 2DRBA 4X4OA 4LEWA 2DR7A 4AT9B 1TFYA 5CFSA 2ZH5A 4UD5A 1GPJA 4XJEA 4AT8B 5B3PA 4WQKA 4MKPA 4HX0A 4O69A 4OAGA 4NXUA 4X4VA 3PHZA 4EP7A 4ATBA 4O67A 1Q78A 3HIYA 2ZH1A 2FCLA 4K99A 4UD4A 1F5AA 4FHYA 4FH5A 2ZH8A 2ZH4A 4M5DA 1R8CA 3MCRA 2ZH3A 4AT7A 2DVIA 4OAIZ 5CFTA 3K7DA 4NKTA 3OVSA 4E7XA 3OVAA 2DRAA 1UETA 2B4VA 4O6AA 4OAFA 3OVBA 4JLZA 2GAFD 1R8BA 2DR8A 3NKUA 4NXTA 3NYBA 4WQLA 3C66A 4E8FA 4WOYA 4X4RA 2ZH9A 3OUYB 4NXVA 4LEYA 2EWRA 3HJ1A 4K97A 4OAHA 4LT6A 4AT8A 1UEVA 4X4SA 1Q79A 2GA9D 4FHWA 4LEVA 3ER8C 4X4PA 2B56A 4NXXA 4LEZA 3EF2A 2Q66A 5D61A 4JLXA 5CHEA 2ZHBA 4X4NA 5D62A 4FH3A 4FHXA 1FA0A 2DR5A 2IHOA 4ATBB 1R8AA 4AT9A 4NKUA 4X4TA 4K98A 4X4QA 3OWGA 3OV7A 4FHVA 5D63A 2ZHAA 5CFUA 2HHPA 2ZH6A 3OUYA 4AT7B 2ZH2A 4KB6A 2DR9A 4K8VA 4E80A 4X4UA 2O1PA 4NXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K9A A;  4JLX A;  4WOY A;  4K96 A;  4K9B A;  4K99 A;  4NXV A;  4KM5 A;  4LEY A;  4K97 A;  4OAH A;  4O68 A;  4ATB B;  4AT9 A;  4AT8 A;  4AT7 A;  4K98 A;  4OAI Z;  4LEW A;  4AT9 B;  4LEV A;  4O6A A;  4AT8 B;  4OAF A;  4AT7 B;  4KB6 A;  4JLZ A;  4NXX A;  4LEZ A;  4MKP A;  4NXT A;  4O69 A;  4K8V A;  4NXU A;  4OAG A;  4ATB A;  4O67 A;  4NXW A; 
#chains in the Genus database with same CATH topology
 2VAN A;  4WH5 A;  5J2J A;  3TFS A;  5DEC A;  1BPY A;  4YN4 A;  3UQ2 A;  1TFW A;  5CP2 A;  9ICF A;  3LK9 A;  4WC6 A;  9ICE A;  4TUR A;  8ICP A;  5HRG A;  8ICF A;  4WBZ A;  4S3N A;  4RWO A;  1ZQZ A;  4WC5 A;  5DB8 A;  3ISB A;  4O5E A;  2DR7 A;  5IIN A;  4AT9 B;  4NLK A;  1ZQW A;  5B3P A;  3JYY A;  3UXP A;  4UB5 A;  5DDM A;  4MKP A;  3PHZ A;  4ATB A;  4QZA A;  3WFP A;  1Q78 A;  4M04 A;  3AUO A;  1ZQJ A;  4RWP A;  4EBJ A;  1HUO A;  9ICB A;  4QZI A;  3MGH A;  5DB7 A;  4UAZ A;  1RPL A;  3H38 A;  4WC0 A;  4IQT A;  4QZD A;  9ICP A;  2DVI A;  2P66 A;  3JPP A;  1ZQB A;  4M0A A;  3OVA A;  1UET A;  8ICI A;  4YD2 A;  4KLI A;  2ISO A;  3OVB A;  2IUB A;  2GWS A;  2W9M A;  2GAF D;  2DR8 A;  3NKU A;  4NXT A;  4Z6D A;  4M47 A;  4WCW A;  4I2G A;  4WOY A;  4X4R A;  2FMP A;  4I27 A;  9ICT A;  3OUY B;  4NXV A;  4GXJ A;  2EWR A;  1ZQS A;  3HJ1 A;  1TV9 A;  4OAH A;  4QZH A;  4QZC A;  4NM1 A;  4AT8 A;  4X4S A;  8ICJ A;  5DBC A;  3UPS A;  4DOB A;  4UBC A;  5HRB A;  5IIL A;  4RPZ A;  3RH6 A;  4FHW A;  4UB4 A;  4PGQ A;  2HN2 A;  1ZQG A;  4I2H A;  4X4P A;  2B56 A;  4KLL A;  3EF2 A;  2Q66 A;  8ICA A;  4DO9 A;  3C5G A;  4NXW A;  1ZQX A;  5D4B A;  3NVO A;  4RQ1 A;  3WFQ E;  3H37 A;  4RQ5 A;  4GXI A;  4F5N A;  5DBA A;  5HHH A;  5D62 A;  5J2D A;  4RQ3 A;  4FHX A;  4XQ7 A;  3AQL A;  1R8A A;  7ICE A;  4NKU A;  1BPB A;  7ICQ A;  4K4I A;  1PX5 A;  2PFN A;  2PFO A;  4X4Q A;  3PML A;  2PFQ A;  4P4M A;  5HRL A;  1VJ7 A;  1XSL A;  4P2H A;  2ZHA A;  4YD1 A;  5HRH A;  4MF8 A;  1XSN A;  4AT7 B;  4KB6 A;  1VFG A;  1OU5 A;  9ICH A;  9ICR A;  4X4U A;  4XRH A;  8ICS A;  2ZH7 A;  4N7R A;  5J0R A;  4RWN A;  4PHE A;  3ERC C;  2PBE A;  8ICE A;  4XUS A;  5JTG A;  3UPQ A;  3JPN A;  5J0O A;  3RJG A;  4KLH A;  3K75 D;  2HN1 A;  7ICS A;  5DED A;  1ZQF A;  1KNY A;  4WC4 A;  8ICT A;  4X4O A;  5DB9 A;  2BPG A;  9ICX A;  3AU2 A;  2ZH5 A;  1GPJ A;  8ICV A;  4WBY A;  4XJE A;  5J2B A;  4I29 A;  1ZQC A;  4WQK A;  4IQW A;  2O5A A;  7ICI A;  4HX0 A;  4O69 A;  3MBY A;  5CHG A;  5F2V O;  4R63 A;  4NXZ A;  5DB6 A;  2ZH1 A;  1JMS A;  4FH5 A;  4KLQ A;  4PHD A;  1ZQD A;  4I2B A;  4M5D A;  2ISP A;  4P4O A;  5J2C A;  2BCV A;  3K7D A;  5J0P A;  2M2V A;  2DRA A;  2B4V A;  7ICF A;  4O6A A;  4UB1 A;  2ID1 A;  3V7L A;  3CK6 A;  3NYB A;  9ICG A;  4PGY A;  3JZ0 A;  3V7J A;  7ICN A;  3MDC A;  4LEY A;  3AQK A;  4UB3 A;  8ICH A;  3ISC A;  5EOZ A;  5HRD A;  2RFF A;  5BPC A;  4WC7 A;  5J2F A;  5J0Q A;  1UEV A;  1Q79 A;  7ICJ A;  8ICQ A;  1ZQT A;  1ZQR A;  7ICR A;  5IIK A;  4LEV A;  3ER8 C;  3WFS C;  4RQ4 A;  2BCS A;  4QZF A;  4NXX A;  5HRI A;  8ICL A;  5D61 A;  5J2G A;  5CA7 A;  7ICM A;  9ICK A;  9ICU A;  1ZQU A;  8ICU A;  2ZHB A;  4LZG A;  4X4N A;  3HWT A;  9ICL A;  4X5V A;  2DR5 A;  2IHO A;  7ICL A;  4WC2 A;  5TZV A;  7ICG A;  4M9H A;  1MQ3 A;  4MFA A;  7ICP A;  1HUZ A;  4K98 A;  1BPE A;  3JPR A;  5DKW A;  3RH5 A;  3OWG A;  4KLF A;  3RJK A;  5CFU A;  2HHP A;  4R66 A;  3OUY A;  4EED A;  1ZQI A;  9ICW A;  3RH4 A;  9ICJ A;  7ICK A;  4EGW A;  4E80 A;  1RZT A;  4K96 A;  4K9B A;  2B51 A;  3C2K A;  1ZJM A;  3HJ4 A;  4KLM A;  4FO1 A;  4XQ8 A;  1UEU A;  2I9G A;  4WC3 A;  3HW8 A;  4KLD A;  9ICV A;  4M9G A;  4KLJ A;  1JAJ A;  2IHM A;  8ICY A;  4KLO A;  4LEW A;  1TFY A;  2BE3 A;  5CR0 A;  4O9M A;  1NOM A;  1MQ2 A;  8ICM A;  3RJH A;  1MIW A;  4RT3 A;  2NRK A;  3JPS A;  4OAG A;  2M2T A;  2PXI A;  1YLQ A;  4O67 A;  9ICQ A;  9ICS A;  4X0A A;  4QZ9 A;  2FCL A;  2FMQ A;  4UD4 A;  3AQN A;  5IIM A;  4RQ2 A;  4KLG A;  4RQ7 A;  4KLT A;  4IQU A;  3V7K A;  2ZH8 A;  4RQ8 A;  5J0T A;  4GXK A;  7ICV A;  3MCR A;  4UAY A;  2ZH3 A;  4AT7 A;  5BOL A;  4OAI Z;  5CFT A;  5J0S A;  4I2A A;  3OVS A;  4E7X A;  4UB2 A;  1ZQL A;  4RQ0 A;  2BCQ A;  8ICN A;  4MFF A;  4O5C A;  4K4G A;  7ICO A;  1BPD A;  4EEB A;  4LVS A;  3UXN A;  4RQ6 A;  3C66 A;  3C18 A;  1JN3 A;  4NM2 A;  4E8F A;  5D49 A;  5IIO A;  2ZH9 A;  4PPX A;  1ZQH A;  3WFR E;  4F5O A;  2BPC A;  4DOC A;  2FMS A;  4I2C A;  4WC1 A;  8ICZ A;  3LQC B;  4YMM A;  1ZQE A;  3MGI A;  8ICC A;  3RJE A;  5J2A A;  9ICM A;  4LEZ A;  1MIY A;  5J2I A;  3JPO A;  4EBK A;  3B0X A;  3B0Y A;  4JLX A;  3H3A A;  5J2E A;  7ICT A;  4TUQ A;  1V4A A;  5CWR A;  8ICO A;  7ICH A;  4M9J A;  5CHE A;  4XA5 A;  4ATB B;  4AT9 A;  4X4T A;  3AQM A;  1ZQP A;  4Z6E A;  3OV7 A;  4FHV A;  4R65 A;  8ICR A;  4YCX A;  4I2D A;  1KEJ A;  5D46 A;  4UBB A;  8ICG A;  4O5K A;  2ZH6 A;  1MIV A;  3MDA A;  1TVA A;  2DR9 A;  4IQV A;  1BPZ A;  2BCU A;  4QZB A;  4K9A A;  5IIJ A;  8ICX A;  5J0W A;  1R89 A;  2M2U A;  3HX0 A;  4EV6 A;  5B3Q A;  4FHP A;  4Z6C A;  3PMN A;  4KM5 A;  2M2W A;  5J2H A;  2BCR A;  4R64 A;  4YMN A;  4O68 A;  2BBH A;  4YMO A;  3ER9 B;  3NWI A;  8ICK A;  4NLZ A;  4I2J A;  1KDH A;  2BBJ A;  5J0Y A;  1ZQN A;  5CFS A;  4UD5 A;  4DOA A;  4AT8 B;  5III A;  4M9N A;  4QZE A;  3RJI A;  3AU6 A;  4PH5 A;  4NXU A;  4X4V A;  4NLN A;  4EP7 A;  4IG8 A;  3HIY A;  4KLU A;  3WFO A;  4K99 A;  1F5A A;  4RT2 A;  9ICC A;  4FHY A;  5J2K A;  1WOT A;  2ZH4 A;  4TUS A;  4QZ8 A;  4JWM A;  5HHI A;  7ICU A;  1R8C A;  4F5Q A;  4NKT A;  4KLS A;  4I2E A;  9ICO A;  4K4H A;  8ICW A;  9ICI A;  4M2Y A;  4MF2 A;  5J29 A;  4OAF A;  4JLZ A;  4TUP A;  1R8B A;  4I2F A;  5HR9 A;  4RPX A;  4WQL A;  3RJF A;  3UQ0 A;  4F5R A;  3C2M A;  4P4P A;  4Z6F A;  5CJ7 A;  5HRK A;  1ZQM A;  1XSP A;  4K97 A;  1BPX A;  3V72 A;  3PNC A;  3OGU A;  4LT6 A;  3UXO A;  4MFC A;  4PGX A;  3L9D A;  5J0U A;  2GA9 D;  1ZQK A;  1ZQA A;  4I2I A;  3TFR A;  4F5P A;  1ZQY A;  9ICN A;  5HRE A;  3C2L A;  3RJJ A;  5CB1 A;  3GDX A;  4UAW A;  2PFP A;  4I0U A;  4RWQ A;  5BOM A;  4QZG A;  8ICB A;  4PHA A;  1ZQV A;  3ISD A;  5DDY A;  4PHP A;  9ICA A;  4FH3 A;  3JPT A;  1FA0 A;  4FO6 A;  3JPQ A;  5HRF A;  3JCF A;  4RPY A;  4NY8 A;  4M9L A;  4X0B A;  4I28 A;  4JWN A;  3H39 A;  1NO5 A;  4KLE A;  5D63 A;  1ZQQ A;  1JQR A;  2BPF A;  2ZH2 A;  1ZJN A;  5HC9 A;  5DBB A;  3C5F A;  4K8V A;  5J0X A;  1ZQO A;  4LZD A;  2O1P A;  2DRB A; 
#chains in the Genus database with same CATH homology
 4K9A A;  2ZH7 A;  1R89 A;  4K96 A;  4K9B A;  2B51 A;  4N7R A;  4WH5 A;  5B3Q A;  4FHP A;  3HJ4 A;  3ERC C;  4KM5 A;  4FO1 A;  1TFW A;  1UEU A;  4O68 A;  3ER9 B;  2DRB A;  4X4O A;  4LEW A;  2DR7 A;  4AT9 B;  1TFY A;  5CFS A;  2ZH5 A;  4UD5 A;  1GPJ A;  4XJE A;  4AT8 B;  5B3P A;  4WQK A;  4MKP A;  4HX0 A;  4O69 A;  4OAG A;  4NXU A;  4X4V A;  3PHZ A;  4EP7 A;  4ATB A;  4O67 A;  1Q78 A;  3HIY A;  2ZH1 A;  2FCL A;  4K99 A;  4UD4 A;  1F5A A;  4FHY A;  4FH5 A;  2ZH8 A;  2ZH4 A;  4M5D A;  1R8C A;  3MCR A;  2ZH3 A;  4AT7 A;  2DVI A;  4OAI Z;  5CFT A;  3K7D A;  4NKT A;  3OVS A;  4E7X A;  3OVA A;  2DRA A;  1UET A;  2B4V A;  4O6A A;  4OAF A;  3OVB A;  4JLZ A;  2GAF D;  1R8B A;  2DR8 A;  3NKU A;  4NXT A;  3NYB A;  4WQL A;  3C66 A;  4E8F A;  4WOY A;  4X4R A;  2ZH9 A;  3OUY B;  4NXV A;  4LEY A;  2EWR A;  3HJ1 A;  4K97 A;  4OAH A;  4LT6 A;  4AT8 A;  1UEV A;  4X4S A;  1Q79 A;  2GA9 D;  4FHW A;  4LEV A;  3ER8 C;  4X4P A;  2B56 A;  4NXX A;  4LEZ A;  3EF2 A;  2Q66 A;  5D61 A;  4JLX A;  5CHE A;  2ZHB A;  4X4N A;  5D62 A;  4FH3 A;  4FHX A;  1FA0 A;  2DR5 A;  2IHO A;  4ATB B;  1R8A A;  4AT9 A;  4NKU A;  4X4T A;  4K98 A;  4X4Q A;  3OWG A;  3OV7 A;  4FHV A;  5D63 A;  2ZHA A;  5CFU A;  2HHP A;  2ZH6 A;  3OUY A;  4AT7 B;  2ZH2 A;  4KB6 A;  2DR9 A;  4K8V A;  4E80 A;  4X4U A;  2O1P A;  4NXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...