4NXTA

Crystal structure of the cytosolic domain of human mid51
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
337
Chain Sequence
DLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
total genus 112
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxtA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxtA02
4K99A 4ATBA 4AT8A 4NXVA 4LEVA 4JLXA 4KB6A 4O68A 4K9BA 4WOYA 4O6AA 4LEZA 4LEWA 4MKPA 4LEYA 4AT9B 4ATBB 4O67A 4OAGA 4NXTA 4AT9A 4OAHA 4O69A 4K96A 4K8VA 4JLZA 4K97A 4K9AA 4K98A 4AT7B 4NXWA 4OAFA 4NXXA 4AT7A 4KM5A 4NXUA 4AT8B 4OAIZ
chains in the Genus database with same CATH superfamily
3PMLA 7ICTA 1BPXA 8ICYA 2VANA 4QZIA 9ICJA 3V72A 5DB9A 4LEZA 5J0YA 8ICBA 3JPTA 3OVAA 5J2JA 9ICOA 3RJHA 2HN1A 3RJJA 5HRBA 9ICUA 1UETA 2GA9D 3K75D 3OGUA 8ICMA 4AT7B 3ISCA 1ZQBA 8ICRA 7ICLA 9ICPA 1FA0A 2DR8A 4FO6A 1ZQJA 4WQKA 4GXJA 4EEBA 5F2VO 4XJEA 2Q66A 4R66A 2ZH2A 2IHMA 1UEUA 3RJKA 5IIMA 1ZQAA 5J2HA 9ICFA 1ZQWA 3UXOA 4YD2A 5B3QA 3HIYA 3OVSA 1JN3A 4WC5A 3HX0A 5HRHA 8ICAA 2GWSA 5J2EA 4UB3A 3AQMA 2P66A 4M9GA 4KLGA 3OUYA 4NXWA 9ICKA 4RPZA 4X0AA 7ICIA 4UAYA 1ZQQA 5B3PA 1BPYA 4YN4A 9ICEA 4YMNA 1JAJA 4PHPA 2M2UA 3MDAA 3RJGA 5J0QA 7ICQA 1XSLA 9ICVA 5J0OA 4X4VA 4PGYA 1ZQKA 1PX5A 1WOTA 4NLZA 4MKPA 4WC3A 3WFOA 4O5CA 1JQRA 2PBEA 1V4AA 1OU5A 4FHYA 1ZQXA 8ICWA 2DRBA 1BPZA 8ICNA 4X4UA 1RPLA 5DDYA 4I2CA 3C5FA 4NXXA 4PHAA 4M9JA 4I29A 5J0PA 3OWGA 4MF8A 2FCLA 4UD4A 3JPQA 2ZH6A 9ICSA 4EBKA 3AU6A 2FMPA 4JLXA 5DEDA 4F5OA 4RQ3A 3JPPA 8ICJA 4JWMA 4I2JA 4UAZA 1TV9A 5J0WA 1RZTA 4NY8A 3B0XA 4E7XA 4X4PA 4JLZA 8ICPA 1ZQEA 4K98A 5CP2A 4FH3A 4KLOA 1R8AA 4FH5A 2M2WA 3RH4A 3NYBA 4X0BA 5J2CA 2BCSA 4YD1A 2O5AA 4M9NA 3AU2A 2ZH5A 4KLIA 4UD5A 7ICKA 3C2KA 9ICWA 4K9BA 4WBZA 3PMNA 7ICHA 2FMSA 1HUZA 2FMQA 2PFOA 4IG8A 4XQ7A 3WFSC 2RFFA 4PGXA 4P2HA 5DB8A 4S3NA 4OAGA 3EF2A 2DRAA 8ICGA 4F5NA 1ZQHA 5CR0A 4QZAA 4UB4A 2BPGA 4TURA 3MBYA 4WH5A 4K97A 9ICBA 5J2AA 5EOZA 4QZHA 4DO9A 1Q79A 4KLDA 5HHHA 4NLNA 8ICFA 1BPEA 4RQ0A 5DDMA 4ATBA 4NM2A 5IIJA 4F5RA 1ZQVA 2BCQA 5IIIA 3V7KA 5DECA 1ZQGA 4M9LA 4P4OA 4QZBA 5DBAA 4I2EA 4MFAA 2IHOA 3C18A 3HWTA 1MQ2A 4Z6EA 3AUOA 4PHDA 4NLKA 3RH5A 2BCRA 2ZH9A 3H3AA 3L9DA 5D63A 1ZJMA 4NXZA 8ICIA 4FO1A 3H39A 5J2GA 3NVOA 1MIYA 4RWNA 1R8BA 5CFTA 4NXVA 4WQLA 5D46A 5HRIA 4M5DA 4QZ9A 4KLFA 4E8FA 4YMMA 3UXNA 9ICCA 4Z6CA 4I2GA 4AT9B 4X4QA 7ICPA 4XRHA 4NXTA 1VJ7A 4I2FA 2DR7A 3MGHA 3UPQA 3RH6A 4F5QA 4UBCA 8ICUA 7ICRA 5HHIA 3WFPA 4Z6FA 4X4RA 1ZQLA 3LK9A 4OAFA 2DR9A 2BCVA 2M2VA 1ZQSA 4IQUA 4RWQA 2I9GA 8ICLA 1ZQRA 1KEJA 9ICIA 3PHZA 4XQ8A 2PFNA 5BOMA 3C2MA 4RQ2A 4RQ1A 2DR5A 2BPFA 8ICQA 3ER9B 4LEYA 4O67A 3K7DA 3WFQE 4O5KA 5J0RA 4K8VA 1TFYA 5HR9A 5HC9A 4DOCA 7ICJA 4UB2A 2ISOA 5CHGA 2PXIA 4LZGA 3GDXA 4R65A 4WBYA 3JPNA 1ZQUA 9ICMA 1ZJNA 4O9MA 5BPCA 4RWPA 3RJIA 2ZHBA 4R64A 4QZ8A 3UXPA 2ID1A 5CJ7A 1ZQIA 3JPRA 3MCRA 5DBBA 2BBHA 5J2FA 5IILA 5J29A 8ICHA 4KLEA 3OVBA 3WFRE 4EP7A 4KLJA 5J2IA 3V7JA 2ZH4A 4NKUA 1MQ3A 2GAFD 4P4PA 1XSNA 8ICSA 4UBBA 2PFPA 5IIOA 4FHWA 5TZVA 3UPSA 4M0AA 7ICVA 1BPBA 4WCWA 4AT9A 4OAHA 4TUPA 7ICGA 5HRLA 2ISPA 1UEVA 1MIWA 7ICFA 1R89A 4LVSA 1ZQOA 5J0UA 4OAIZ 3HJ4A 5DKWA 4K99A 2B51A 9ICHA 4QZCA 4LEVA 4RQ4A 4FHXA 4X4SA 2IUBA 2BCUA 4M04A 1MIVA 5CHEA 5J2DA 4RQ6A 3NWIA 9ICNA 1KDHA 4K4GA 4WC7A 4O5EA 4JWNA 4K4IA 4I2HA 4KLMA 1NO5A 3AQLA 8ICZA 1GPJA 8ICOA 8ICKA 2M2TA 1ZQDA 1ZQTA 1JMSA 5J2KA 2EWRA 5CWRA 5DB7A 9ICAA 3RJEA 4WC1A 4GXKA 4LZDA 5J2BA 5BOLA 2ZH1A 5DB6A 4YCXA 4O68A 4WC2A 4KLSA 1ZQPA 3HJ1A 4PGQA 3LQCB 2O1PA 7ICSA 4ATBB 4X5VA 2HHPA 4QZFA 4WC6A 1R8CA 4I28A 4K96A 4M47A 4M9HA 5CFUA 4RPYA 1ZQMA 1F5AA 3PNCA 4I2AA 3V7LA 4IQVA 3H38A 4I2DA 3JCFA 4KLHA 4RPXA 4X4TA 3JYYA 2BPCA 4GXIA 4QZGA 1VFGA 4X4NA 5CB1A 3HW8A 4I27A 4I2IA 4IQTA 4KB6A 4XA5A 4UB1A 7ICEA 2ZHAA 1HUOA 5IIKA 4LEWA 9ICQA 5D4BA 9ICXA 4NM1A 3OV7A 4MF2A 1ZQNA 9ICTA 4DOAA 4KLUA 5J0XA 4PH5A 4UB5A 3JPSA 4TUSA 4XUSA 3NKUA 2HN2A 4EBJA 4EV6A 4PHEA 4NXUA 3OUYB 4N7RA 3RJFA 4AT8A 4E80A 4RT3A 7ICNA 1BPDA 4RQ5A 4KLQA 5CA7A 4WC0A 5HRGA 1ZQFA 4RT2A 9ICLA 3H37A 4MFFA 4KLTA 4R63A 8ICEA 5HRKA 3TFSA 5CFSA 1ZQYA 3UQ2A 8ICCA 2BE3A 5HRFA 2BBJA 4Z6DA 4UAWA 4AT8B 1ZQZA 7ICOA 2W9MA 2B4VA 5D61A 4TUQA 4NKTA 5D62A 5D49A 7ICUA 4O6AA 4WC4A 4F5PA 9ICRA 1Q78A 2PFQA 4IQWA 4MFCA 5JTGA 4FHVA 3C2LA 1YLQA 3ER8C 4O69A 4YMOA 1XSPA 3AQKA 3MDCA 3ISBA 4HX0A 3TFRA 3JZ0A 5DBCA 4QZDA 4RWOA 4P4MA 4KM5A 1TFWA 4M2YA 4EGWA 5J0TA 2B56A 4LT6A 2NRKA 8ICXA 2DVIA 8ICTA 1ZQCA 3B0YA 1TVAA 2ZH7A 4WOYA 5J0SA 4RQ8A 4KLLA 4X4OA 1NOMA 3C5GA 3UQ0A 5HREA 4QZEA 3C66A 2ZH3A 3CK6A 5IINA 4RQ7A 4PPXA 3ISDA 3AQNA 4K9AA 3MGIA 1KNYA 8ICVA 4I2BA 4DOBA 3ERCC 4AT7A 7ICMA 9ICGA 4K4HA 2ZH8A 4I0UA 4EEDA 3JPOA 4FHPA 5HRDA
chains in the Genus database with same CATH topology
4X4NA 4KB6A 2ZH5A 4UD5A 4K9BA 4LEZA 2ZHAA 2ZHBA 4LEWA 3OVAA 3MCRA 3EF2A 4OAGA 2DRAA 3OV7A 1UETA 3OVBA 2GA9D 4WH5A 4K97A 4EP7A 4AT7B 3NYBA 3NKUA 1Q79A 2ZH4A 4NKUA 1FA0A 2DR8A 2GAFD 4NXUA 3OUYB 4N7RA 4WQKA 4ATBA 4FHWA 4AT8A 4XJEA 2Q66A 2ZH2A 1UEUA 4E80A 5B3QA 3HIYA 3OVSA 2IHOA 4AT9A 4OAHA 2ZH9A 5D63A 1UEVA 5CFSA 4FO1A 3OUYA 4NXWA 1R89A 4AT8B 4OAIZ 2B4VA 3HJ4A 4K99A 1R8BA 5D61A 2B51A 4NKTA 5B3PA 5CFTA 4NXVA 4LEVA 4WQLA 5D62A 4FHXA 4M5DA 4X4SA 4O6AA 4E8FA 1Q78A 5CHEA 4X4VA 4MKPA 4FHVA 4AT9B 4X4QA 4NXTA 3ER8C 2DR7A 4FHYA 4O69A 1GPJA 2DRBA 4X4UA 4HX0A 4X4RA 2EWRA 4OAFA 2DR9A 4NXXA 4KM5A 1TFWA 3OWGA 2FCLA 4UD4A 2B56A 4LT6A 2ZH6A 2ZH1A 2DVIA 3PHZA 4JLXA 4O68A 2ZH7A 4WOYA 4X4OA 2DR5A 3HJ1A 2O1PA 3ER9B 4LEYA 4ATBB 4O67A 3K7DA 3C66A 2ZH3A 2HHPA 1R8CA 4K96A 4K8VA 1TFYA 4E7XA 5CFUA 4X4PA 1F5AA 4JLZA 4K9AA 4K98A 4FH3A 1R8AA 4FH5A 3ERCC 4AT7A 2ZH8A 4X4TA 4FHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K99 A;  4ATB A;  4AT8 A;  4NXV A;  4LEV A;  4JLX A;  4KB6 A;  4O68 A;  4K9B A;  4WOY A;  4O6A A;  4LEZ A;  4LEW A;  4MKP A;  4LEY A;  4AT9 B;  4ATB B;  4O67 A;  4OAG A;  4NXT A;  4AT9 A;  4OAH A;  4O69 A;  4K96 A;  4K8V A;  4JLZ A;  4K97 A;  4K9A A;  4K98 A;  4AT7 B;  4NXW A;  4OAF A;  4NXX A;  4AT7 A;  4KM5 A;  4NXU A;  4AT8 B;  4OAI Z; 
#chains in the Genus database with same CATH topology
 3PML A;  7ICT A;  1BPX A;  8ICY A;  2VAN A;  4QZI A;  9ICJ A;  3V72 A;  5DB9 A;  4LEZ A;  5J0Y A;  8ICB A;  3JPT A;  3OVA A;  5J2J A;  9ICO A;  3RJH A;  2HN1 A;  3RJJ A;  5HRB A;  9ICU A;  1UET A;  2GA9 D;  3K75 D;  3OGU A;  8ICM A;  4AT7 B;  3ISC A;  1ZQB A;  8ICR A;  7ICL A;  9ICP A;  1FA0 A;  2DR8 A;  4FO6 A;  1ZQJ A;  4WQK A;  4GXJ A;  4EEB A;  5F2V O;  4XJE A;  2Q66 A;  4R66 A;  2ZH2 A;  2IHM A;  1UEU A;  3RJK A;  5IIM A;  1ZQA A;  5J2H A;  9ICF A;  1ZQW A;  3UXO A;  4YD2 A;  5B3Q A;  3HIY A;  3OVS A;  1JN3 A;  4WC5 A;  3HX0 A;  5HRH A;  8ICA A;  2GWS A;  5J2E A;  4UB3 A;  3AQM A;  2P66 A;  4M9G A;  4KLG A;  3OUY A;  4NXW A;  9ICK A;  4RPZ A;  4X0A A;  7ICI A;  4UAY A;  1ZQQ A;  5B3P A;  1BPY A;  4YN4 A;  9ICE A;  4YMN A;  1JAJ A;  4PHP A;  2M2U A;  3MDA A;  3RJG A;  5J0Q A;  7ICQ A;  1XSL A;  9ICV A;  5J0O A;  4X4V A;  4PGY A;  1ZQK A;  1PX5 A;  1WOT A;  4NLZ A;  4MKP A;  4WC3 A;  3WFO A;  4O5C A;  1JQR A;  2PBE A;  1V4A A;  1OU5 A;  4FHY A;  1ZQX A;  8ICW A;  2DRB A;  1BPZ A;  8ICN A;  4X4U A;  1RPL A;  5DDY A;  4I2C A;  3C5F A;  4NXX A;  4PHA A;  4M9J A;  4I29 A;  5J0P A;  3OWG A;  4MF8 A;  2FCL A;  4UD4 A;  3JPQ A;  2ZH6 A;  9ICS A;  4EBK A;  3AU6 A;  2FMP A;  4JLX A;  5DED A;  4F5O A;  4RQ3 A;  3JPP A;  8ICJ A;  4JWM A;  4I2J A;  4UAZ A;  1TV9 A;  5J0W A;  1RZT A;  4NY8 A;  3B0X A;  4E7X A;  4X4P A;  4JLZ A;  8ICP A;  1ZQE A;  4K98 A;  5CP2 A;  4FH3 A;  4KLO A;  1R8A A;  4FH5 A;  2M2W A;  3RH4 A;  3NYB A;  4X0B A;  5J2C A;  2BCS A;  4YD1 A;  2O5A A;  4M9N A;  3AU2 A;  2ZH5 A;  4KLI A;  4UD5 A;  7ICK A;  3C2K A;  9ICW A;  4K9B A;  4WBZ A;  3PMN A;  7ICH A;  2FMS A;  1HUZ A;  2FMQ A;  2PFO A;  4IG8 A;  4XQ7 A;  3WFS C;  2RFF A;  4PGX A;  4P2H A;  5DB8 A;  4S3N A;  4OAG A;  3EF2 A;  2DRA A;  8ICG A;  4F5N A;  1ZQH A;  5CR0 A;  4QZA A;  4UB4 A;  2BPG A;  4TUR A;  3MBY A;  4WH5 A;  4K97 A;  9ICB A;  5J2A A;  5EOZ A;  4QZH A;  4DO9 A;  1Q79 A;  4KLD A;  5HHH A;  4NLN A;  8ICF A;  1BPE A;  4RQ0 A;  5DDM A;  4ATB A;  4NM2 A;  5IIJ A;  4F5R A;  1ZQV A;  2BCQ A;  5III A;  3V7K A;  5DEC A;  1ZQG A;  4M9L A;  4P4O A;  4QZB A;  5DBA A;  4I2E A;  4MFA A;  2IHO A;  3C18 A;  3HWT A;  1MQ2 A;  4Z6E A;  3AUO A;  4PHD A;  4NLK A;  3RH5 A;  2BCR A;  2ZH9 A;  3H3A A;  3L9D A;  5D63 A;  1ZJM A;  4NXZ A;  8ICI A;  4FO1 A;  3H39 A;  5J2G A;  3NVO A;  1MIY A;  4RWN A;  1R8B A;  5CFT A;  4NXV A;  4WQL A;  5D46 A;  5HRI A;  4M5D A;  4QZ9 A;  4KLF A;  4E8F A;  4YMM A;  3UXN A;  9ICC A;  4Z6C A;  4I2G A;  4AT9 B;  4X4Q A;  7ICP A;  4XRH A;  4NXT A;  1VJ7 A;  4I2F A;  2DR7 A;  3MGH A;  3UPQ A;  3RH6 A;  4F5Q A;  4UBC A;  8ICU A;  7ICR A;  5HHI A;  3WFP A;  4Z6F A;  4X4R A;  1ZQL A;  3LK9 A;  4OAF A;  2DR9 A;  2BCV A;  2M2V A;  1ZQS A;  4IQU A;  4RWQ A;  2I9G A;  8ICL A;  1ZQR A;  1KEJ A;  9ICI A;  3PHZ A;  4XQ8 A;  2PFN A;  5BOM A;  3C2M A;  4RQ2 A;  4RQ1 A;  2DR5 A;  2BPF A;  8ICQ A;  3ER9 B;  4LEY A;  4O67 A;  3K7D A;  3WFQ E;  4O5K A;  5J0R A;  4K8V A;  1TFY A;  5HR9 A;  5HC9 A;  4DOC A;  7ICJ A;  4UB2 A;  2ISO A;  5CHG A;  2PXI A;  4LZG A;  3GDX A;  4R65 A;  4WBY A;  3JPN A;  1ZQU A;  9ICM A;  1ZJN A;  4O9M A;  5BPC A;  4RWP A;  3RJI A;  2ZHB A;  4R64 A;  4QZ8 A;  3UXP A;  2ID1 A;  5CJ7 A;  1ZQI A;  3JPR A;  3MCR A;  5DBB A;  2BBH A;  5J2F A;  5IIL A;  5J29 A;  8ICH A;  4KLE A;  3OVB A;  3WFR E;  4EP7 A;  4KLJ A;  5J2I A;  3V7J A;  2ZH4 A;  4NKU A;  1MQ3 A;  2GAF D;  4P4P A;  1XSN A;  8ICS A;  4UBB A;  2PFP A;  5IIO A;  4FHW A;  5TZV A;  3UPS A;  4M0A A;  7ICV A;  1BPB A;  4WCW A;  4AT9 A;  4OAH A;  4TUP A;  7ICG A;  5HRL A;  2ISP A;  1UEV A;  1MIW A;  7ICF A;  1R89 A;  4LVS A;  1ZQO A;  5J0U A;  4OAI Z;  3HJ4 A;  5DKW A;  4K99 A;  2B51 A;  9ICH A;  4QZC A;  4LEV A;  4RQ4 A;  4FHX A;  4X4S A;  2IUB A;  2BCU A;  4M04 A;  1MIV A;  5CHE A;  5J2D A;  4RQ6 A;  3NWI A;  9ICN A;  1KDH A;  4K4G A;  4WC7 A;  4O5E A;  4JWN A;  4K4I A;  4I2H A;  4KLM A;  1NO5 A;  3AQL A;  8ICZ A;  1GPJ A;  8ICO A;  8ICK A;  2M2T A;  1ZQD A;  1ZQT A;  1JMS A;  5J2K A;  2EWR A;  5CWR A;  5DB7 A;  9ICA A;  3RJE A;  4WC1 A;  4GXK A;  4LZD A;  5J2B A;  5BOL A;  2ZH1 A;  5DB6 A;  4YCX A;  4O68 A;  4WC2 A;  4KLS A;  1ZQP A;  3HJ1 A;  4PGQ A;  3LQC B;  2O1P A;  7ICS A;  4ATB B;  4X5V A;  2HHP A;  4QZF A;  4WC6 A;  1R8C A;  4I28 A;  4K96 A;  4M47 A;  4M9H A;  5CFU A;  4RPY A;  1ZQM A;  1F5A A;  3PNC A;  4I2A A;  3V7L A;  4IQV A;  3H38 A;  4I2D A;  3JCF A;  4KLH A;  4RPX A;  4X4T A;  3JYY A;  2BPC A;  4GXI A;  4QZG A;  1VFG A;  4X4N A;  5CB1 A;  3HW8 A;  4I27 A;  4I2I A;  4IQT A;  4KB6 A;  4XA5 A;  4UB1 A;  7ICE A;  2ZHA A;  1HUO A;  5IIK A;  4LEW A;  9ICQ A;  5D4B A;  9ICX A;  4NM1 A;  3OV7 A;  4MF2 A;  1ZQN A;  9ICT A;  4DOA A;  4KLU A;  5J0X A;  4PH5 A;  4UB5 A;  3JPS A;  4TUS A;  4XUS A;  3NKU A;  2HN2 A;  4EBJ A;  4EV6 A;  4PHE A;  4NXU A;  3OUY B;  4N7R A;  3RJF A;  4AT8 A;  4E80 A;  4RT3 A;  7ICN A;  1BPD A;  4RQ5 A;  4KLQ A;  5CA7 A;  4WC0 A;  5HRG A;  1ZQF A;  4RT2 A;  9ICL A;  3H37 A;  4MFF A;  4KLT A;  4R63 A;  8ICE A;  5HRK A;  3TFS A;  5CFS A;  1ZQY A;  3UQ2 A;  8ICC A;  2BE3 A;  5HRF A;  2BBJ A;  4Z6D A;  4UAW A;  4AT8 B;  1ZQZ A;  7ICO A;  2W9M A;  2B4V A;  5D61 A;  4TUQ A;  4NKT A;  5D62 A;  5D49 A;  7ICU A;  4O6A A;  4WC4 A;  4F5P A;  9ICR A;  1Q78 A;  2PFQ A;  4IQW A;  4MFC A;  5JTG A;  4FHV A;  3C2L A;  1YLQ A;  3ER8 C;  4O69 A;  4YMO A;  1XSP A;  3AQK A;  3MDC A;  3ISB A;  4HX0 A;  3TFR A;  3JZ0 A;  5DBC A;  4QZD A;  4RWO A;  4P4M A;  4KM5 A;  1TFW A;  4M2Y A;  4EGW A;  5J0T A;  2B56 A;  4LT6 A;  2NRK A;  8ICX A;  2DVI A;  8ICT A;  1ZQC A;  3B0Y A;  1TVA A;  2ZH7 A;  4WOY A;  5J0S A;  4RQ8 A;  4KLL A;  4X4O A;  1NOM A;  3C5G A;  3UQ0 A;  5HRE A;  4QZE A;  3C66 A;  2ZH3 A;  3CK6 A;  5IIN A;  4RQ7 A;  4PPX A;  3ISD A;  3AQN A;  4K9A A;  3MGI A;  1KNY A;  8ICV A;  4I2B A;  4DOB A;  3ERC C;  4AT7 A;  7ICM A;  9ICG A;  4K4H A;  2ZH8 A;  4I0U A;  4EED A;  3JPO A;  4FHP A;  5HRD A; 
#chains in the Genus database with same CATH homology
 4X4N A;  4KB6 A;  2ZH5 A;  4UD5 A;  4K9B A;  4LEZ A;  2ZHA A;  2ZHB A;  4LEW A;  3OVA A;  3MCR A;  3EF2 A;  4OAG A;  2DRA A;  3OV7 A;  1UET A;  3OVB A;  2GA9 D;  4WH5 A;  4K97 A;  4EP7 A;  4AT7 B;  3NYB A;  3NKU A;  1Q79 A;  2ZH4 A;  4NKU A;  1FA0 A;  2DR8 A;  2GAF D;  4NXU A;  3OUY B;  4N7R A;  4WQK A;  4ATB A;  4FHW A;  4AT8 A;  4XJE A;  2Q66 A;  2ZH2 A;  1UEU A;  4E80 A;  5B3Q A;  3HIY A;  3OVS A;  2IHO A;  4AT9 A;  4OAH A;  2ZH9 A;  5D63 A;  1UEV A;  5CFS A;  4FO1 A;  3OUY A;  4NXW A;  1R89 A;  4AT8 B;  4OAI Z;  2B4V A;  3HJ4 A;  4K99 A;  1R8B A;  5D61 A;  2B51 A;  4NKT A;  5B3P A;  5CFT A;  4NXV A;  4LEV A;  4WQL A;  5D62 A;  4FHX A;  4M5D A;  4X4S A;  4O6A A;  4E8F A;  1Q78 A;  5CHE A;  4X4V A;  4MKP A;  4FHV A;  4AT9 B;  4X4Q A;  4NXT A;  3ER8 C;  2DR7 A;  4FHY A;  4O69 A;  1GPJ A;  2DRB A;  4X4U A;  4HX0 A;  4X4R A;  2EWR A;  4OAF A;  2DR9 A;  4NXX A;  4KM5 A;  1TFW A;  3OWG A;  2FCL A;  4UD4 A;  2B56 A;  4LT6 A;  2ZH6 A;  2ZH1 A;  2DVI A;  3PHZ A;  4JLX A;  4O68 A;  2ZH7 A;  4WOY A;  4X4O A;  2DR5 A;  3HJ1 A;  2O1P A;  3ER9 B;  4LEY A;  4ATB B;  4O67 A;  3K7D A;  3C66 A;  2ZH3 A;  2HHP A;  1R8C A;  4K96 A;  4K8V A;  1TFY A;  4E7X A;  5CFU A;  4X4P A;  1F5A A;  4JLZ A;  4K9A A;  4K98 A;  4FH3 A;  1R8A A;  4FH5 A;  3ERC C;  4AT7 A;  2ZH8 A;  4X4T A;  4FHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...