4NXTA

Crystal structure of the cytosolic domain of human mid51
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
337
Chain Sequence
DLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxtA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxtA02
4NXUA 4OAGA 4K97A 4AT9A 4NXWA 4K99A 4OAIZ 4LEYA 4WOYA 4OAFA 4AT9B 4K9AA 4NXXA 4K98A 4OAHA 4ATBA 4K96A 4MKPA 4AT8A 4K9BA 4LEZA 4ATBB 4NXVA 4KM5A 4O68A 4AT8B 4K8VA 4NXTA 4AT7A 4JLZA 4KB6A 4O6AA 4O67A 4LEVA 4JLXA 4AT7B 4LEWA 4O69A
chains in the Genus database with same CATH superfamily
4RQ4A 2HN2A 1BPEA 4NXUA 2DR5A 4WC4A 3AQKA 8ICEA 3JPNA 4Z6EA 3C2LA 3AU2A 3JCFA 7ICSA 1KNYA 2DR8A 3HX0A 3WFOA 2IUBA 1ZQGA 4RQ0A 7ICJA 4X4PA 3H3AA 3NYBA 5BOMA 1ZQQA 4N7RA 4AT8A 4Z6DA 9ICFA 4IQUA 3JPQA 3RJHA 4KLIA 4HX0A 4RWOA 4WC2A 2B56A 5J2DA 8ICTA 3ISBA 3MBYA 4IQTA 5HHHA 9ICHA 9ICUA 4FH5A 5J0WA 5IINA 7ICTA 4YN4A 2BCRA 5B3QA 4MFCA 2ZH9A 3AQMA 2DRAA 4GXKA 4NM2A 4RQ7A 5B3PA 4NXXA 4I28A 3C2KA 5DEDA 2ZH4A 3RH5A 1MQ3A 8ICSA 4X4TA 4NLKA 1KEJA 4QZBA 5J2IA 4X4VA 4RQ8A 1ZQAA 4FHYA 3B0YA 3H39A 4I2GA 4RQ5A 1JMSA 4QZ9A 4RPZA 9ICWA 4RWPA 4FHVA 1XSLA 4M9JA 4WQKA 4IG8A 8ICQA 4Z6FA 3V7LA 5J0XA 4RPXA 4XA5A 7ICKA 4AT9B 5D62A 2GAFD 1VJ7A 3H38A 5DDYA 7ICOA 4O5EA 9ICSA 1MIYA 2ZH3A 3RJEA 4E7XA 4K8VA 1F5AA 3AU6A 4E80A 2DR7A 3HW8A 7ICFA 4AT7B 4WH5A 5DBBA 3HJ1A 4NY8A 3OVAA 8ICNA 1UETA 2BBJA 1ZQJA 4M9LA 9ICXA 4FHPA 4RQ2A 4EEDA 2M2WA 4X4RA 3MGHA 8ICLA 1NO5A 3WFSC 3AUOA 1FA0A 1WOTA 2IHMA 3TFSA 3RJJA 4K9AA 4RPYA 1ZQVA 2BCVA 4UD4A 2BCUA 7ICEA 4WC7A 4OAGA 4AT9A 4R64A 4KLGA 4UAYA 5IIMA 4LEYA 9ICKA 3C66A 3UXOA 3L9DA 5HC9A 4PH5A 3PNCA 5CHGA 4I2CA 4UB1A 3MDAA 4X0AA 5J0TA 4K4IA 3C5FA 2NRKA 1ZQSA 3WFRE 4NXVA 5HRFA 1MIWA 3MGIA 4XJEA 4KLSA 4NLNA 4XRHA 4GXIA 1BPYA 2DVIA 4QZCA 4TUPA 4XQ7A 4WBYA 3C5GA 3MDCA 3RJGA 4IQVA 4KLDA 3OVBA 5J2JA 4OAIZ 4OAFA 3UXPA 4WQLA 1RPLA 4MFFA 7ICNA 4DOAA 3C18A 2FMQA 2BPGA 8ICJA 1GPJA 4X4NA 4GXJA 4DOBA 1ZQTA 8ICIA 4K4GA 4EP7A 5IIOA 2PFNA 4ATBB 1KDHA 9ICPA 3B0XA 4Z6CA 4KLOA 1ZQCA 5D4BA 4EEBA 4MF8A 5DDMA 1ZQIA 3V72A 7ICQA 2RFFA 3TFRA 4P4OA 2B4VA 3H37A 2ZH2A 4KLMA 1V4AA 5HRKA 4E8FA 3K7DA 4PGYA 4DOCA 1MQ2A 4O9MA 4P2HA 4RWNA 5CP2A 4JWMA 4K9BA 9ICLA 4JLZA 5DBCA 7ICHA 1BPZA 4X4SA 5J0OA 9ICNA 9ICAA 3OVSA 1ZQEA 2BE3A 4JWNA 1TFWA 3RJIA 2M2UA 4QZFA 4I27A 2IHOA 5DB8A 4I29A 4YMMA 7ICRA 4LZGA 5J29A 4ATBA 8ICCA 5IIJA 5BPCA 4KLJA 4QZHA 3RJKA 4LEZA 4UB4A 8ICVA 1ZQFA 3NKUA 4PGXA 8ICMA 4P4PA 3ISCA 4LEVA 4XQ8A 4UAWA 1R89A 4NKUA 9ICIA 4M47A 1ZQBA 1ZQZA 4I2BA 2ZHAA 8ICUA 1ZQUA 1ZQXA 5HRIA 4M9NA 5J2FA 1ZJNA 1MIVA 4QZDA 4EGWA 9ICOA 4RT3A 4UBBA 1TFYA 2FCLA 7ICPA 1R8AA 3UQ0A 7ICGA 7ICUA 8ICYA 4PHAA 4M9HA 3NVOA 2EWRA 5HR9A 4EV6A 4X4QA 4M04A 1VFGA 9ICEA 5D63A 4UBCA 1BPDA 1JQRA 2I9GA 2M2TA 1HUOA 1JN3A 4PHPA 8ICWA 3EF2A 4YMOA 5CJ7A 2ISPA 4TURA 2ZH8A 5HHIA 4KLEA 4WC0A 4YCXA 4I2HA 3JPPA 5J2GA 4PHDA 1UEVA 2GWSA 5HRHA 2BPFA 4YD2A 4K98A 1TV9A 5J2BA 4OAHA 1Q78A 1NOMA 5CFSA 4LZDA 3ISDA 5TZVA 2O5AA 2BCSA 3HIYA 2ZH6A 8ICXA 2P66A 4QZAA 4O6AA 9ICGA 3ERCC 3OUYA 4X5VA 4O67A 1ZQDA 5CWRA 3UXNA 7ICVA 3UQ2A 4RQ6A 5F2VO 4X4OA 3V7KA 3JPTA 3PMLA 9ICBA 4X0BA 4YMNA 1ZQKA 5DB9A 4KLHA 5J0YA 3ER9B 5J0SA 3RH4A 7ICLA 4WCWA 4MKPA 5J2AA 3JPOA 3JZ0A 8ICHA 4RQ3A 3RH6A 7ICIA 4KB6A 2O1PA 8ICBA 1ZQWA 2FMPA 4WC6A 5J2HA 4F5NA 4JLXA 5J2KA 9ICQA 4LEWA 5CB1A 2GA9D 5D49A 2HN1A 4I2AA 4K97A 4MFAA 4K99A 3LQCB 4WC5A 3OGUA 5EOZA 2PBEA 4WBZA 4UB3A 5IILA 4UD5A 4I2IA 3RJFA 1JAJA 4XUSA 4I2JA 1PX5A 4LVSA 2ZH5A 5J0QA 2ZHBA 2DRBA 3NWIA 3AQNA 1ZQHA 3C2MA 3PMNA 3JPRA 9ICJA 5CA7A 4WC3A 4DO9A 4QZGA 5DKWA 1R8CA 4YD1A 8ICZA 4KLTA 5CR0A 1HUZA 4KLUA 3AQLA 7ICMA 4M5DA 4I0UA 4NXZA 2ZH7A 2PFOA 4TUQA 5HRLA 3OV7A 5HRDA 2B51A 4X4UA 5D61A 1UEUA 4M9GA 5CHEA 4NXTA 4NLZA 4RQ1A 8ICKA 2ID1A 2M2VA 5J0RA 8ICAA 2PFQA 5DECA 3MCRA 1ZQLA 4EBKA 3OUYB 2BPCA 3WFPA 3HWTA 4FO6A 1BPXA 4KLQA 2HHPA 5CFUA 4PHEA 1BPBA 4M0AA 2BCQA 4UB2A 3K75D 4F5RA 4O5KA 8ICPA 2FMSA 5IIKA 2DR9A 1R8BA 4M2YA 5HRGA 3WFQE 5IIIA 4RWQA 4LT6A 1OU5A 5J2CA 4PGQA 9ICCA 1ZQMA 1TVAA 3HJ4A 2BBHA 9ICTA 5DB6A 3PHZA 4KLFA 4F5PA 3UPQA 4I2EA 4I2FA 5BOLA 5J0UA 2Q66A 4NXWA 3LK9A 3JYYA 1RZTA 1ZQOA 4TUSA 1ZJMA 2PXIA 4R66A 5J2EA 3GDXA 4K4HA 1XSNA 4RT2A 4IQWA 1YLQA 5HRBA 5J0PA 1Q79A 2W9MA 4FO1A 4UAZA 2PFPA 8ICRA 3ER8C 4S3NA 8ICOA 4QZ8A 5DBAA 5DB7A 4KLLA 4O68A 4AT8B 4WC1A 4FHXA 5HREA 4R65A 5JTGA 1XSPA 4EBJA 4UB5A 2ISOA 2ZH1A 4MF2A 4O69A 8ICFA 5D46A 4R63A 4QZEA 1ZQNA 4FHWA 4NKTA 9ICMA 4WOYA 1ZQYA 4QZIA 9ICVA 3OWGA 1ZQPA 3V7JA 4P4MA 4F5OA 4K96A 4O5CA 4PPXA 4KM5A 5CFTA 4NM1A 4AT7A 3JPSA 3UPSA 2VANA 4FH3A 3CK6A 4I2DA 4F5QA 8ICGA 9ICRA 1ZQRA
chains in the Genus database with same CATH topology
4UD4A 4NXUA 2DR5A 4OAGA 4AT9A 2ZHAA 2DR8A 4LEYA 3C66A 1TFYA 2FCLA 4M5DA 1R8AA 2ZH7A 4X4PA 3NYBA 4N7RA 3OV7A 4AT8A 2B51A 4X4UA 4NXVA 4HX0A 5D61A 2B56A 2EWRA 1UEUA 5CHEA 4NXTA 4X4QA 4XJEA 5D63A 3EF2A 2DVIA 4FH5A 3MCRA 3OUYB 2ZH8A 2HHPA 5B3QA 2ZH9A 3OVBA 5CFUA 4OAIZ 2DRAA 4OAFA 1UEVA 4WQLA 5B3PA 4NXXA 4K98A 1GPJA 4OAHA 2ZH4A 1Q78A 4X4NA 2DR9A 5CFSA 1R8BA 4X4TA 4EP7A 4X4VA 4ATBB 3HIYA 4FHYA 2ZH6A 4LT6A 4O6AA 3ERCC 3OUYA 4O67A 3HJ4A 4FHVA 3PHZA 4WQKA 2B4VA 2Q66A 4NXWA 2ZH2A 4X4OA 4AT9B 5D62A 4E8FA 3K7DA 4K9AA 2GAFD 1Q79A 4FO1A 3ER9B 3ER8C 4MKPA 4K9BA 2ZH3A 4E7XA 4O68A 4AT8B 4K8VA 1F5AA 4FHXA 4JLZA 4KB6A 2O1PA 4E80A 2DR7A 4JLXA 4AT7B 2ZH1A 4WH5A 4LEWA 4O69A 3HJ1A 3OVAA 2GA9D 4X4SA 1UETA 4K97A 3OVSA 4K99A 4FHWA 4NKTA 4FHPA 1TFWA 4WOYA 4X4RA 4UD5A 2IHOA 3OWGA 4ATBA 2ZH5A 2ZHBA 4K96A 2DRBA 4LEZA 1FA0A 4KM5A 5CFTA 3NKUA 4AT7A 4FH3A 4LEVA 1R8CA 1R89A 4NKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXU A;  4OAG A;  4K97 A;  4AT9 A;  4NXW A;  4K99 A;  4OAI Z;  4LEY A;  4WOY A;  4OAF A;  4AT9 B;  4K9A A;  4NXX A;  4K98 A;  4OAH A;  4ATB A;  4K96 A;  4MKP A;  4AT8 A;  4K9B A;  4LEZ A;  4ATB B;  4NXV A;  4KM5 A;  4O68 A;  4AT8 B;  4K8V A;  4NXT A;  4AT7 A;  4JLZ A;  4KB6 A;  4O6A A;  4O67 A;  4LEV A;  4JLX A;  4AT7 B;  4LEW A;  4O69 A; 
#chains in the Genus database with same CATH topology
 4RQ4 A;  2HN2 A;  1BPE A;  4NXU A;  2DR5 A;  4WC4 A;  3AQK A;  8ICE A;  3JPN A;  4Z6E A;  3C2L A;  3AU2 A;  3JCF A;  7ICS A;  1KNY A;  2DR8 A;  3HX0 A;  3WFO A;  2IUB A;  1ZQG A;  4RQ0 A;  7ICJ A;  4X4P A;  3H3A A;  3NYB A;  5BOM A;  1ZQQ A;  4N7R A;  4AT8 A;  4Z6D A;  9ICF A;  4IQU A;  3JPQ A;  3RJH A;  4KLI A;  4HX0 A;  4RWO A;  4WC2 A;  2B56 A;  5J2D A;  8ICT A;  3ISB A;  3MBY A;  4IQT A;  5HHH A;  9ICH A;  9ICU A;  4FH5 A;  5J0W A;  5IIN A;  7ICT A;  4YN4 A;  2BCR A;  5B3Q A;  4MFC A;  2ZH9 A;  3AQM A;  2DRA A;  4GXK A;  4NM2 A;  4RQ7 A;  5B3P A;  4NXX A;  4I28 A;  3C2K A;  5DED A;  2ZH4 A;  3RH5 A;  1MQ3 A;  8ICS A;  4X4T A;  4NLK A;  1KEJ A;  4QZB A;  5J2I A;  4X4V A;  4RQ8 A;  1ZQA A;  4FHY A;  3B0Y A;  3H39 A;  4I2G A;  4RQ5 A;  1JMS A;  4QZ9 A;  4RPZ A;  9ICW A;  4RWP A;  4FHV A;  1XSL A;  4M9J A;  4WQK A;  4IG8 A;  8ICQ A;  4Z6F A;  3V7L A;  5J0X A;  4RPX A;  4XA5 A;  7ICK A;  4AT9 B;  5D62 A;  2GAF D;  1VJ7 A;  3H38 A;  5DDY A;  7ICO A;  4O5E A;  9ICS A;  1MIY A;  2ZH3 A;  3RJE A;  4E7X A;  4K8V A;  1F5A A;  3AU6 A;  4E80 A;  2DR7 A;  3HW8 A;  7ICF A;  4AT7 B;  4WH5 A;  5DBB A;  3HJ1 A;  4NY8 A;  3OVA A;  8ICN A;  1UET A;  2BBJ A;  1ZQJ A;  4M9L A;  9ICX A;  4FHP A;  4RQ2 A;  4EED A;  2M2W A;  4X4R A;  3MGH A;  8ICL A;  1NO5 A;  3WFS C;  3AUO A;  1FA0 A;  1WOT A;  2IHM A;  3TFS A;  3RJJ A;  4K9A A;  4RPY A;  1ZQV A;  2BCV A;  4UD4 A;  2BCU A;  7ICE A;  4WC7 A;  4OAG A;  4AT9 A;  4R64 A;  4KLG A;  4UAY A;  5IIM A;  4LEY A;  9ICK A;  3C66 A;  3UXO A;  3L9D A;  5HC9 A;  4PH5 A;  3PNC A;  5CHG A;  4I2C A;  4UB1 A;  3MDA A;  4X0A A;  5J0T A;  4K4I A;  3C5F A;  2NRK A;  1ZQS A;  3WFR E;  4NXV A;  5HRF A;  1MIW A;  3MGI A;  4XJE A;  4KLS A;  4NLN A;  4XRH A;  4GXI A;  1BPY A;  2DVI A;  4QZC A;  4TUP A;  4XQ7 A;  4WBY A;  3C5G A;  3MDC A;  3RJG A;  4IQV A;  4KLD A;  3OVB A;  5J2J A;  4OAI Z;  4OAF A;  3UXP A;  4WQL A;  1RPL A;  4MFF A;  7ICN A;  4DOA A;  3C18 A;  2FMQ A;  2BPG A;  8ICJ A;  1GPJ A;  4X4N A;  4GXJ A;  4DOB A;  1ZQT A;  8ICI A;  4K4G A;  4EP7 A;  5IIO A;  2PFN A;  4ATB B;  1KDH A;  9ICP A;  3B0X A;  4Z6C A;  4KLO A;  1ZQC A;  5D4B A;  4EEB A;  4MF8 A;  5DDM A;  1ZQI A;  3V72 A;  7ICQ A;  2RFF A;  3TFR A;  4P4O A;  2B4V A;  3H37 A;  2ZH2 A;  4KLM A;  1V4A A;  5HRK A;  4E8F A;  3K7D A;  4PGY A;  4DOC A;  1MQ2 A;  4O9M A;  4P2H A;  4RWN A;  5CP2 A;  4JWM A;  4K9B A;  9ICL A;  4JLZ A;  5DBC A;  7ICH A;  1BPZ A;  4X4S A;  5J0O A;  9ICN A;  9ICA A;  3OVS A;  1ZQE A;  2BE3 A;  4JWN A;  1TFW A;  3RJI A;  2M2U A;  4QZF A;  4I27 A;  2IHO A;  5DB8 A;  4I29 A;  4YMM A;  7ICR A;  4LZG A;  5J29 A;  4ATB A;  8ICC A;  5IIJ A;  5BPC A;  4KLJ A;  4QZH A;  3RJK A;  4LEZ A;  4UB4 A;  8ICV A;  1ZQF A;  3NKU A;  4PGX A;  8ICM A;  4P4P A;  3ISC A;  4LEV A;  4XQ8 A;  4UAW A;  1R89 A;  4NKU A;  9ICI A;  4M47 A;  1ZQB A;  1ZQZ A;  4I2B A;  2ZHA A;  8ICU A;  1ZQU A;  1ZQX A;  5HRI A;  4M9N A;  5J2F A;  1ZJN A;  1MIV A;  4QZD A;  4EGW A;  9ICO A;  4RT3 A;  4UBB A;  1TFY A;  2FCL A;  7ICP A;  1R8A A;  3UQ0 A;  7ICG A;  7ICU A;  8ICY A;  4PHA A;  4M9H A;  3NVO A;  2EWR A;  5HR9 A;  4EV6 A;  4X4Q A;  4M04 A;  1VFG A;  9ICE A;  5D63 A;  4UBC A;  1BPD A;  1JQR A;  2I9G A;  2M2T A;  1HUO A;  1JN3 A;  4PHP A;  8ICW A;  3EF2 A;  4YMO A;  5CJ7 A;  2ISP A;  4TUR A;  2ZH8 A;  5HHI A;  4KLE A;  4WC0 A;  4YCX A;  4I2H A;  3JPP A;  5J2G A;  4PHD A;  1UEV A;  2GWS A;  5HRH A;  2BPF A;  4YD2 A;  4K98 A;  1TV9 A;  5J2B A;  4OAH A;  1Q78 A;  1NOM A;  5CFS A;  4LZD A;  3ISD A;  5TZV A;  2O5A A;  2BCS A;  3HIY A;  2ZH6 A;  8ICX A;  2P66 A;  4QZA A;  4O6A A;  9ICG A;  3ERC C;  3OUY A;  4X5V A;  4O67 A;  1ZQD A;  5CWR A;  3UXN A;  7ICV A;  3UQ2 A;  4RQ6 A;  5F2V O;  4X4O A;  3V7K A;  3JPT A;  3PML A;  9ICB A;  4X0B A;  4YMN A;  1ZQK A;  5DB9 A;  4KLH A;  5J0Y A;  3ER9 B;  5J0S A;  3RH4 A;  7ICL A;  4WCW A;  4MKP A;  5J2A A;  3JPO A;  3JZ0 A;  8ICH A;  4RQ3 A;  3RH6 A;  7ICI A;  4KB6 A;  2O1P A;  8ICB A;  1ZQW A;  2FMP A;  4WC6 A;  5J2H A;  4F5N A;  4JLX A;  5J2K A;  9ICQ A;  4LEW A;  5CB1 A;  2GA9 D;  5D49 A;  2HN1 A;  4I2A A;  4K97 A;  4MFA A;  4K99 A;  3LQC B;  4WC5 A;  3OGU A;  5EOZ A;  2PBE A;  4WBZ A;  4UB3 A;  5IIL A;  4UD5 A;  4I2I A;  3RJF A;  1JAJ A;  4XUS A;  4I2J A;  1PX5 A;  4LVS A;  2ZH5 A;  5J0Q A;  2ZHB A;  2DRB A;  3NWI A;  3AQN A;  1ZQH A;  3C2M A;  3PMN A;  3JPR A;  9ICJ A;  5CA7 A;  4WC3 A;  4DO9 A;  4QZG A;  5DKW A;  1R8C A;  4YD1 A;  8ICZ A;  4KLT A;  5CR0 A;  1HUZ A;  4KLU A;  3AQL A;  7ICM A;  4M5D A;  4I0U A;  4NXZ A;  2ZH7 A;  2PFO A;  4TUQ A;  5HRL A;  3OV7 A;  5HRD A;  2B51 A;  4X4U A;  5D61 A;  1UEU A;  4M9G A;  5CHE A;  4NXT A;  4NLZ A;  4RQ1 A;  8ICK A;  2ID1 A;  2M2V A;  5J0R A;  8ICA A;  2PFQ A;  5DEC A;  3MCR A;  1ZQL A;  4EBK A;  3OUY B;  2BPC A;  3WFP A;  3HWT A;  4FO6 A;  1BPX A;  4KLQ A;  2HHP A;  5CFU A;  4PHE A;  1BPB A;  4M0A A;  2BCQ A;  4UB2 A;  3K75 D;  4F5R A;  4O5K A;  8ICP A;  2FMS A;  5IIK A;  2DR9 A;  1R8B A;  4M2Y A;  5HRG A;  3WFQ E;  5III A;  4RWQ A;  4LT6 A;  1OU5 A;  5J2C A;  4PGQ A;  9ICC A;  1ZQM A;  1TVA A;  3HJ4 A;  2BBH A;  9ICT A;  5DB6 A;  3PHZ A;  4KLF A;  4F5P A;  3UPQ A;  4I2E A;  4I2F A;  5BOL A;  5J0U A;  2Q66 A;  4NXW A;  3LK9 A;  3JYY A;  1RZT A;  1ZQO A;  4TUS A;  1ZJM A;  2PXI A;  4R66 A;  5J2E A;  3GDX A;  4K4H A;  1XSN A;  4RT2 A;  4IQW A;  1YLQ A;  5HRB A;  5J0P A;  1Q79 A;  2W9M A;  4FO1 A;  4UAZ A;  2PFP A;  8ICR A;  3ER8 C;  4S3N A;  8ICO A;  4QZ8 A;  5DBA A;  5DB7 A;  4KLL A;  4O68 A;  4AT8 B;  4WC1 A;  4FHX A;  5HRE A;  4R65 A;  5JTG A;  1XSP A;  4EBJ A;  4UB5 A;  2ISO A;  2ZH1 A;  4MF2 A;  4O69 A;  8ICF A;  5D46 A;  4R63 A;  4QZE A;  1ZQN A;  4FHW A;  4NKT A;  9ICM A;  4WOY A;  1ZQY A;  4QZI A;  9ICV A;  3OWG A;  1ZQP A;  3V7J A;  4P4M A;  4F5O A;  4K96 A;  4O5C A;  4PPX A;  4KM5 A;  5CFT A;  4NM1 A;  4AT7 A;  3JPS A;  3UPS A;  2VAN A;  4FH3 A;  3CK6 A;  4I2D A;  4F5Q A;  8ICG A;  9ICR A;  1ZQR A; 
#chains in the Genus database with same CATH homology
 4UD4 A;  4NXU A;  2DR5 A;  4OAG A;  4AT9 A;  2ZHA A;  2DR8 A;  4LEY A;  3C66 A;  1TFY A;  2FCL A;  4M5D A;  1R8A A;  2ZH7 A;  4X4P A;  3NYB A;  4N7R A;  3OV7 A;  4AT8 A;  2B51 A;  4X4U A;  4NXV A;  4HX0 A;  5D61 A;  2B56 A;  2EWR A;  1UEU A;  5CHE A;  4NXT A;  4X4Q A;  4XJE A;  5D63 A;  3EF2 A;  2DVI A;  4FH5 A;  3MCR A;  3OUY B;  2ZH8 A;  2HHP A;  5B3Q A;  2ZH9 A;  3OVB A;  5CFU A;  4OAI Z;  2DRA A;  4OAF A;  1UEV A;  4WQL A;  5B3P A;  4NXX A;  4K98 A;  1GPJ A;  4OAH A;  2ZH4 A;  1Q78 A;  4X4N A;  2DR9 A;  5CFS A;  1R8B A;  4X4T A;  4EP7 A;  4X4V A;  4ATB B;  3HIY A;  4FHY A;  2ZH6 A;  4LT6 A;  4O6A A;  3ERC C;  3OUY A;  4O67 A;  3HJ4 A;  4FHV A;  3PHZ A;  4WQK A;  2B4V A;  2Q66 A;  4NXW A;  2ZH2 A;  4X4O A;  4AT9 B;  5D62 A;  4E8F A;  3K7D A;  4K9A A;  2GAF D;  1Q79 A;  4FO1 A;  3ER9 B;  3ER8 C;  4MKP A;  4K9B A;  2ZH3 A;  4E7X A;  4O68 A;  4AT8 B;  4K8V A;  1F5A A;  4FHX A;  4JLZ A;  4KB6 A;  2O1P A;  4E80 A;  2DR7 A;  4JLX A;  4AT7 B;  2ZH1 A;  4WH5 A;  4LEW A;  4O69 A;  3HJ1 A;  3OVA A;  2GA9 D;  4X4S A;  1UET A;  4K97 A;  3OVS A;  4K99 A;  4FHW A;  4NKT A;  4FHP A;  1TFW A;  4WOY A;  4X4R A;  4UD5 A;  2IHO A;  3OWG A;  4ATB A;  2ZH5 A;  2ZHB A;  4K96 A;  2DRB A;  4LEZ A;  1FA0 A;  4KM5 A;  5CFT A;  3NKU A;  4AT7 A;  4FH3 A;  4LEV A;  1R8C A;  1R89 A;  4NKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...