4NXTA

Crystal structure of the cytosolic domain of human mid51
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
337
Chain Sequence
DLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxtA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxtA02
4MKPA 4O67A 4LEVA 4AT9B 4NXXA 4LEYA 4KB6A 4K98A 4KM5A 4NXTA 4LEWA 4JLZA 4AT8B 4AT7B 4ATBB 4NXVA 4K99A 4NXUA 4O68A 4LEZA 4K9BA 4OAGA 4WOYA 4K97A 4AT9A 4K96A 4O6AA 4OAFA 4K9AA 4OAIZ 4NXWA 4K8VA 4JLXA 4AT8A 4AT7A 4OAHA 4ATBA 4O69A
chains in the Genus database with same CATH superfamily
2O1PA 4XUSA 4QZDA 4R65A 5J29A 4X4SA 5TZVA 3HJ1A 2PXIA 1UEUA 4YN4A 4GXJA 3MGIA 1JMSA 1BPDA 4LEWA 4FHVA 1ZQFA 4P4OA 1ZQYA 4I2EA 4K99A 4EEDA 4DO9A 8ICUA 3JYYA 4O68A 5J0SA 2RFFA 3LQCB 9ICQA 2DR9A 4FH5A 4FHXA 4PGYA 4YMMA 4PPXA 5BPCA 9ICNA 4M04A 4UD5A 4QZCA 4EEBA 1TFYA 5HRKA 4I2JA 9ICWA 7ICSA 3UXNA 3HW8A 1BPBA 4K98A 1FA0A 1BPXA 4RWQA 9ICKA 4NLNA 3ER8C 3NWIA 5CP2A 1NO5A 1YLQA 9ICCA 4PHAA 1ZQKA 5CR0A 5DDMA 4KLLA 2GA9D 1ZQRA 8ICCA 5J2AA 4PH5A 7ICIA 4AT9A 3UXOA 4WC1A 4WC0A 4KLIA 4PHDA 4M9JA 4QZIA 5J0YA 1ZQTA 4E80A 4RQ5A 8ICPA 3K7DA 4LEVA 3C18A 4I2DA 3K75D 8ICGA 4UB1A 4LZDA 5J2HA 8ICLA 2ZH7A 4X4OA 5J0XA 5D4BA 1V4AA 3JZ0A 4YMOA 3H37A 2ZH3A 8ICQA 7ICTA 4NM2A 5IIKA 5HRLA 5B3QA 4R64A 4FO6A 8ICVA 9ICTA 2ZH5A 4M9GA 5IINA 4RT3A 8ICOA 4UAWA 2DVIA 4RQ2A 3AU6A 4AT7A 3TFSA 5DBAA 5J2DA 3ER9B 4XJEA 3B0YA 1ZQPA 2BE3A 5HREA 5HRGA 4FHPA 4NM1A 2ISOA 1Q78A 5J0UA 1ZQDA 4RT2A 8ICNA 4X4QA 5J0OA 4E8FA 2M2WA 4O5CA 2B4VA 2ISPA 2BCSA 4X4TA 5J2BA 1KDHA 8ICKA 3RJEA 4O5EA 4K96A 5CWRA 1ZJNA 4LT6A 5J2JA 3AQLA 4FO1A 7ICNA 4X4RA 4I28A 4MF2A 4AT8A 2ZHAA 4JWNA 5HC9A 4KLOA 3ISCA 4KLDA 3C5GA 7ICPA 8ICIA 5DB6A 4TUQA 4RQ6A 3UPQA 4QZHA 5J2EA 3NYBA 4P2HA 4QZGA 4XQ8A 3MDCA 4WC7A 2BCQA 4MFFA 5IIIA 2VANA 2PBEA 3H38A 4M9NA 2O5AA 5HRDA 2IHMA 4QZ8A 4OAGA 5HHIA 4UB3A 3C5FA 2P66A 2B56A 3RJJA 4E7XA 4X0AA 4NKTA 2BBJA 4NXWA 3WFQE 2BBHA 4ATBA 3JPOA 5HR9A 4WC4A 7ICGA 4O67A 4X5VA 1Q79A 4M5DA 8ICXA 4KB6A 1ZQGA 3JPPA 4RWPA 4M9HA 9ICMA 4EGWA 4TUSA 3RH5A 5CB1A 3HX0A 3GDXA 4F5OA 4YD2A 7ICQA 1HUZA 4NKUA 4KLEA 4LEZA 3JPNA 4PGXA 4KLUA 2ZH8A 5J2GA 5J2CA 2ZH2A 4WC6A 3OV7A 3OVBA 4M0AA 2FCLA 8ICBA 4O5KA 4IQTA 4PHPA 1VFGA 5CHEA 5HRBA 5HRIA 1OU5A 4I2AA 1ZQNA 2IUBA 3L9DA 3HIYA 4X4NA 2HN2A 8ICYA 4EBKA 4XA5A 1R8BA 3WFSC 4LZGA 4RWOA 1PX5A 2PFPA 1KEJA 3OGUA 4PGQA 3H39A 3RH6A 4QZEA 5DB8A 4WOYA 5F2VO 4R63A 3B0XA 7ICKA 3JCFA 2I9GA 4NLKA 4YMNA 1MIWA 4I0UA 4OAHA 4QZBA 1ZQOA 1JAJA 4DOAA 4I27A 1ZQEA 4LEYA 4PHEA 9ICEA 4KM5A 8ICTA 4WC5A 9ICSA 2GAFD 3MDAA 4WBZA 4Z6EA 8ICJA 7ICRA 2M2TA 1XSLA 5D49A 4MFAA 1ZQSA 2NRKA 3V72A 4P4PA 5EOZA 9ICOA 3V7LA 4UB5A 4K9BA 4RQ3A 1ZQQA 4EV6A 4FHYA 5D46A 4QZFA 5J0RA 5J0PA 4UB2A 5CFTA 3WFRE 4I2IA 1JN3A 4FH3A 4MKPA 1ZQBA 4EBJA 2BCUA 4MFCA 4NXXA 4JWMA 2ID1A 4KLMA 3ISDA 4QZAA 8ICAA 2M2UA 3OVSA 3AUOA 3OVAA 4K4IA 1XSNA 3C66A 4RQ7A 5IIJA 9ICLA 4F5NA 3HJ4A 4UB4A 1ZJMA 8ICHA 3ISBA 4S3NA 5J0QA 4RPYA 8ICWA 4IQVA 3C2KA 4LVSA 3WFOA 1HUOA 2PFOA 5CFSA 1R8CA 5CA7A 4X4UA 3MGHA 3RJGA 5B3PA 4JLZA 8ICSA 1XSPA 2DRBA 3JPQA 4WQLA 9ICAA 4KLFA 9ICJA 4UBCA 2DR5A 4KLJA 4NXUA 9ICBA 4I2CA 2BCVA 5DECA 4P4MA 1ZQIA 9ICGA 2ZH6A 7ICEA 1MQ2A 4K4GA 3NKUA 5D63A 4K8VA 4IG8A 3JPTA 1MIVA 4RPXA 5J0WA 4IQWA 2DRAA 5DBBA 4I2GA 4Z6FA 9ICPA 1BPYA 4KLQA 8ICEA 5DBCA 2BPCA 4I2BA 1ZQLA 3PMLA 4UAZA 2EWRA 2PFNA 2DR8A 5CJ7A 1TVAA 4FHWA 5J2KA 5D62A 3AQMA 5CFUA 4XQ7A 3PHZA 4F5RA 4IQUA 4WQKA 4X0BA 3EF2A 2IHOA 2HN1A 3UQ2A 4AT9B 3PMNA 4Z6CA 4NXTA 1ZQMA 4RQ8A 5JTGA 4X4PA 5HRHA 1ZQCA 4F5PA 4I2FA 3TFRA 1ZQVA 2FMPA 3AQKA 4NXVA 1NOMA 5DDYA 5D61A 1ZQAA 1MIYA 2ZHBA 3UXPA 4RQ4A 4YCXA 4K97A 4M9LA 1ZQHA 3HWTA 5DB7A 3V7JA 4K9AA 4R66A 3RJKA 4OAIZ 3RJHA 1JQRA 2ZH4A 8ICRA 4M2YA 4O9MA 4UBBA 3PNCA 1WOTA 5DB9A 3MCRA 5J0TA 4HX0A 3RJIA 3UPSA 4KLSA 4AT7B 2BPGA 7ICOA 9ICUA 4DOBA 5J2IA 7ICVA 4MF8A 1R8AA 1ZQWA 4XRHA 3RJFA 1RPLA 5J2FA 4I2HA 7ICUA 2DR7A 4X4VA 4OAFA 3RH4A 4YD1A 4RQ0A 4N7RA 8ICZA 2GWSA 4WBYA 8ICFA 2FMQA 2HHPA 4UAYA 1MQ3A 9ICRA 5IIOA 5HHHA 5CHGA 3UQ0A 5HRFA 3MBYA 7ICJA 4AT8B 2W9MA 3AQNA 1BPEA 9ICFA 4M47A 9ICVA 4KLGA 8ICMA 4WC2A 4RQ1A 9ICXA 5BOMA 3ERCC 4WH5A 4NY8A 1ZQXA 4RPZA 4O69A 2FMSA 4EP7A 2BPFA 4I29A 3OUYB 5BOLA 3OWGA 4NLZA 4KLHA 1UEVA 1UETA 1TFWA 7ICLA 4ATBB 3WFPA 7ICMA 4F5QA 4GXKA 2BCRA 4Z6DA 9ICIA 4WC3A 1F5AA 4TURA 2ZH1A 7ICFA 9ICHA 2M2VA 3NVOA 3JPRA 7ICHA 4TUPA 4JLXA 3JPSA 4UD4A 5DKWA 1ZQJA 4KLTA 5DEDA 1GPJA 3C2MA 1KNYA 1ZQZA 3CK6A 2PFQA 1RZTA 4NXZA 3LK9A 2Q66A 4K4HA 3V7KA 2B51A 4GXIA 4QZ9A 4O6AA 3OUYA 1ZQUA 5IIMA 1VJ7A 3H3AA 1R89A 4WCWA 2ZH9A 1TV9A 4RWNA 3C2LA 4DOCA 5IILA 1BPZA 3AU2A
chains in the Genus database with same CATH topology
2O1PA 4MKPA 4X4SA 3MCRA 4NXXA 3HJ1A 1UEUA 4HX0A 4LEWA 4FHVA 3NYBA 4AT7B 3OVSA 3OVAA 4K99A 3C66A 4O68A 1R8AA 3HJ4A 4OAGA 2DR9A 4FH5A 2DR7A 4FHXA 4X4VA 4OAFA 2B56A 4E7XA 4NKTA 4UD5A 4NXWA 4N7RA 1TFYA 4ATBA 4O67A 1Q79A 4M5DA 1R8CA 5CFSA 4KB6A 4K98A 2HHPA 1FA0A 4X4UA 5B3PA 4JLZA 3ER8C 4AT8B 2DRBA 4WQLA 2DR5A 4NXUA 2GA9D 4NKUA 4LEZA 2ZH8A 4AT9A 2ZH2A 3OV7A 3OVBA 2FCLA 2ZH6A 3ERCC 3NKUA 5CHEA 5D63A 4K8VA 4WH5A 4E80A 4O69A 3K7DA 4LEVA 3HIYA 4X4NA 4EP7A 2DRAA 3OUYB 1R8BA 2ZH7A 4X4OA 3OWGA 1UEVA 1UETA 1TFWA 4ATBB 2EWRA 2ZH3A 2DR8A 5B3QA 4FHWA 1F5AA 4WOYA 2ZH1A 5D62A 5CFUA 2ZH5A 3PHZA 4WQKA 2DVIA 4JLXA 4AT7A 4OAHA 4UD4A 3EF2A 2IHOA 3ER9B 4XJEA 4AT9B 4LEYA 4FHPA 1Q78A 1GPJA 4KM5A 4NXTA 4X4PA 2GAFD 4X4QA 4E8FA 2B4VA 4NXVA 2Q66A 5D61A 4X4TA 2ZHBA 2B51A 4K9BA 4K97A 4K96A 4LT6A 4O6AA 3OUYA 4FO1A 4K9AA 1R89A 4X4RA 4FHYA 2ZH9A 4OAIZ 2ZH4A 4AT8A 2ZHAA 5CFTA 4FH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MKP A;  4O67 A;  4LEV A;  4AT9 B;  4NXX A;  4LEY A;  4KB6 A;  4K98 A;  4KM5 A;  4NXT A;  4LEW A;  4JLZ A;  4AT8 B;  4AT7 B;  4ATB B;  4NXV A;  4K99 A;  4NXU A;  4O68 A;  4LEZ A;  4K9B A;  4OAG A;  4WOY A;  4K97 A;  4AT9 A;  4K96 A;  4O6A A;  4OAF A;  4K9A A;  4OAI Z;  4NXW A;  4K8V A;  4JLX A;  4AT8 A;  4AT7 A;  4OAH A;  4ATB A;  4O69 A; 
#chains in the Genus database with same CATH topology
 2O1P A;  4XUS A;  4QZD A;  4R65 A;  5J29 A;  4X4S A;  5TZV A;  3HJ1 A;  2PXI A;  1UEU A;  4YN4 A;  4GXJ A;  3MGI A;  1JMS A;  1BPD A;  4LEW A;  4FHV A;  1ZQF A;  4P4O A;  1ZQY A;  4I2E A;  4K99 A;  4EED A;  4DO9 A;  8ICU A;  3JYY A;  4O68 A;  5J0S A;  2RFF A;  3LQC B;  9ICQ A;  2DR9 A;  4FH5 A;  4FHX A;  4PGY A;  4YMM A;  4PPX A;  5BPC A;  9ICN A;  4M04 A;  4UD5 A;  4QZC A;  4EEB A;  1TFY A;  5HRK A;  4I2J A;  9ICW A;  7ICS A;  3UXN A;  3HW8 A;  1BPB A;  4K98 A;  1FA0 A;  1BPX A;  4RWQ A;  9ICK A;  4NLN A;  3ER8 C;  3NWI A;  5CP2 A;  1NO5 A;  1YLQ A;  9ICC A;  4PHA A;  1ZQK A;  5CR0 A;  5DDM A;  4KLL A;  2GA9 D;  1ZQR A;  8ICC A;  5J2A A;  4PH5 A;  7ICI A;  4AT9 A;  3UXO A;  4WC1 A;  4WC0 A;  4KLI A;  4PHD A;  4M9J A;  4QZI A;  5J0Y A;  1ZQT A;  4E80 A;  4RQ5 A;  8ICP A;  3K7D A;  4LEV A;  3C18 A;  4I2D A;  3K75 D;  8ICG A;  4UB1 A;  4LZD A;  5J2H A;  8ICL A;  2ZH7 A;  4X4O A;  5J0X A;  5D4B A;  1V4A A;  3JZ0 A;  4YMO A;  3H37 A;  2ZH3 A;  8ICQ A;  7ICT A;  4NM2 A;  5IIK A;  5HRL A;  5B3Q A;  4R64 A;  4FO6 A;  8ICV A;  9ICT A;  2ZH5 A;  4M9G A;  5IIN A;  4RT3 A;  8ICO A;  4UAW A;  2DVI A;  4RQ2 A;  3AU6 A;  4AT7 A;  3TFS A;  5DBA A;  5J2D A;  3ER9 B;  4XJE A;  3B0Y A;  1ZQP A;  2BE3 A;  5HRE A;  5HRG A;  4FHP A;  4NM1 A;  2ISO A;  1Q78 A;  5J0U A;  1ZQD A;  4RT2 A;  8ICN A;  4X4Q A;  5J0O A;  4E8F A;  2M2W A;  4O5C A;  2B4V A;  2ISP A;  2BCS A;  4X4T A;  5J2B A;  1KDH A;  8ICK A;  3RJE A;  4O5E A;  4K96 A;  5CWR A;  1ZJN A;  4LT6 A;  5J2J A;  3AQL A;  4FO1 A;  7ICN A;  4X4R A;  4I28 A;  4MF2 A;  4AT8 A;  2ZHA A;  4JWN A;  5HC9 A;  4KLO A;  3ISC A;  4KLD A;  3C5G A;  7ICP A;  8ICI A;  5DB6 A;  4TUQ A;  4RQ6 A;  3UPQ A;  4QZH A;  5J2E A;  3NYB A;  4P2H A;  4QZG A;  4XQ8 A;  3MDC A;  4WC7 A;  2BCQ A;  4MFF A;  5III A;  2VAN A;  2PBE A;  3H38 A;  4M9N A;  2O5A A;  5HRD A;  2IHM A;  4QZ8 A;  4OAG A;  5HHI A;  4UB3 A;  3C5F A;  2P66 A;  2B56 A;  3RJJ A;  4E7X A;  4X0A A;  4NKT A;  2BBJ A;  4NXW A;  3WFQ E;  2BBH A;  4ATB A;  3JPO A;  5HR9 A;  4WC4 A;  7ICG A;  4O67 A;  4X5V A;  1Q79 A;  4M5D A;  8ICX A;  4KB6 A;  1ZQG A;  3JPP A;  4RWP A;  4M9H A;  9ICM A;  4EGW A;  4TUS A;  3RH5 A;  5CB1 A;  3HX0 A;  3GDX A;  4F5O A;  4YD2 A;  7ICQ A;  1HUZ A;  4NKU A;  4KLE A;  4LEZ A;  3JPN A;  4PGX A;  4KLU A;  2ZH8 A;  5J2G A;  5J2C A;  2ZH2 A;  4WC6 A;  3OV7 A;  3OVB A;  4M0A A;  2FCL A;  8ICB A;  4O5K A;  4IQT A;  4PHP A;  1VFG A;  5CHE A;  5HRB A;  5HRI A;  1OU5 A;  4I2A A;  1ZQN A;  2IUB A;  3L9D A;  3HIY A;  4X4N A;  2HN2 A;  8ICY A;  4EBK A;  4XA5 A;  1R8B A;  3WFS C;  4LZG A;  4RWO A;  1PX5 A;  2PFP A;  1KEJ A;  3OGU A;  4PGQ A;  3H39 A;  3RH6 A;  4QZE A;  5DB8 A;  4WOY A;  5F2V O;  4R63 A;  3B0X A;  7ICK A;  3JCF A;  2I9G A;  4NLK A;  4YMN A;  1MIW A;  4I0U A;  4OAH A;  4QZB A;  1ZQO A;  1JAJ A;  4DOA A;  4I27 A;  1ZQE A;  4LEY A;  4PHE A;  9ICE A;  4KM5 A;  8ICT A;  4WC5 A;  9ICS A;  2GAF D;  3MDA A;  4WBZ A;  4Z6E A;  8ICJ A;  7ICR A;  2M2T A;  1XSL A;  5D49 A;  4MFA A;  1ZQS A;  2NRK A;  3V72 A;  4P4P A;  5EOZ A;  9ICO A;  3V7L A;  4UB5 A;  4K9B A;  4RQ3 A;  1ZQQ A;  4EV6 A;  4FHY A;  5D46 A;  4QZF A;  5J0R A;  5J0P A;  4UB2 A;  5CFT A;  3WFR E;  4I2I A;  1JN3 A;  4FH3 A;  4MKP A;  1ZQB A;  4EBJ A;  2BCU A;  4MFC A;  4NXX A;  4JWM A;  2ID1 A;  4KLM A;  3ISD A;  4QZA A;  8ICA A;  2M2U A;  3OVS A;  3AUO A;  3OVA A;  4K4I A;  1XSN A;  3C66 A;  4RQ7 A;  5IIJ A;  9ICL A;  4F5N A;  3HJ4 A;  4UB4 A;  1ZJM A;  8ICH A;  3ISB A;  4S3N A;  5J0Q A;  4RPY A;  8ICW A;  4IQV A;  3C2K A;  4LVS A;  3WFO A;  1HUO A;  2PFO A;  5CFS A;  1R8C A;  5CA7 A;  4X4U A;  3MGH A;  3RJG A;  5B3P A;  4JLZ A;  8ICS A;  1XSP A;  2DRB A;  3JPQ A;  4WQL A;  9ICA A;  4KLF A;  9ICJ A;  4UBC A;  2DR5 A;  4KLJ A;  4NXU A;  9ICB A;  4I2C A;  2BCV A;  5DEC A;  4P4M A;  1ZQI A;  9ICG A;  2ZH6 A;  7ICE A;  1MQ2 A;  4K4G A;  3NKU A;  5D63 A;  4K8V A;  4IG8 A;  3JPT A;  1MIV A;  4RPX A;  5J0W A;  4IQW A;  2DRA A;  5DBB A;  4I2G A;  4Z6F A;  9ICP A;  1BPY A;  4KLQ A;  8ICE A;  5DBC A;  2BPC A;  4I2B A;  1ZQL A;  3PML A;  4UAZ A;  2EWR A;  2PFN A;  2DR8 A;  5CJ7 A;  1TVA A;  4FHW A;  5J2K A;  5D62 A;  3AQM A;  5CFU A;  4XQ7 A;  3PHZ A;  4F5R A;  4IQU A;  4WQK A;  4X0B A;  3EF2 A;  2IHO A;  2HN1 A;  3UQ2 A;  4AT9 B;  3PMN A;  4Z6C A;  4NXT A;  1ZQM A;  4RQ8 A;  5JTG A;  4X4P A;  5HRH A;  1ZQC A;  4F5P A;  4I2F A;  3TFR A;  1ZQV A;  2FMP A;  3AQK A;  4NXV A;  1NOM A;  5DDY A;  5D61 A;  1ZQA A;  1MIY A;  2ZHB A;  3UXP A;  4RQ4 A;  4YCX A;  4K97 A;  4M9L A;  1ZQH A;  3HWT A;  5DB7 A;  3V7J A;  4K9A A;  4R66 A;  3RJK A;  4OAI Z;  3RJH A;  1JQR A;  2ZH4 A;  8ICR A;  4M2Y A;  4O9M A;  4UBB A;  3PNC A;  1WOT A;  5DB9 A;  3MCR A;  5J0T A;  4HX0 A;  3RJI A;  3UPS A;  4KLS A;  4AT7 B;  2BPG A;  7ICO A;  9ICU A;  4DOB A;  5J2I A;  7ICV A;  4MF8 A;  1R8A A;  1ZQW A;  4XRH A;  3RJF A;  1RPL A;  5J2F A;  4I2H A;  7ICU A;  2DR7 A;  4X4V A;  4OAF A;  3RH4 A;  4YD1 A;  4RQ0 A;  4N7R A;  8ICZ A;  2GWS A;  4WBY A;  8ICF A;  2FMQ A;  2HHP A;  4UAY A;  1MQ3 A;  9ICR A;  5IIO A;  5HHH A;  5CHG A;  3UQ0 A;  5HRF A;  3MBY A;  7ICJ A;  4AT8 B;  2W9M A;  3AQN A;  1BPE A;  9ICF A;  4M47 A;  9ICV A;  4KLG A;  8ICM A;  4WC2 A;  4RQ1 A;  9ICX A;  5BOM A;  3ERC C;  4WH5 A;  4NY8 A;  1ZQX A;  4RPZ A;  4O69 A;  2FMS A;  4EP7 A;  2BPF A;  4I29 A;  3OUY B;  5BOL A;  3OWG A;  4NLZ A;  4KLH A;  1UEV A;  1UET A;  1TFW A;  7ICL A;  4ATB B;  3WFP A;  7ICM A;  4F5Q A;  4GXK A;  2BCR A;  4Z6D A;  9ICI A;  4WC3 A;  1F5A A;  4TUR A;  2ZH1 A;  7ICF A;  9ICH A;  2M2V A;  3NVO A;  3JPR A;  7ICH A;  4TUP A;  4JLX A;  3JPS A;  4UD4 A;  5DKW A;  1ZQJ A;  4KLT A;  5DED A;  1GPJ A;  3C2M A;  1KNY A;  1ZQZ A;  3CK6 A;  2PFQ A;  1RZT A;  4NXZ A;  3LK9 A;  2Q66 A;  4K4H A;  3V7K A;  2B51 A;  4GXI A;  4QZ9 A;  4O6A A;  3OUY A;  1ZQU A;  5IIM A;  1VJ7 A;  3H3A A;  1R89 A;  4WCW A;  2ZH9 A;  1TV9 A;  4RWN A;  3C2L A;  4DOC A;  5IIL A;  1BPZ A;  3AU2 A; 
#chains in the Genus database with same CATH homology
 2O1P A;  4MKP A;  4X4S A;  3MCR A;  4NXX A;  3HJ1 A;  1UEU A;  4HX0 A;  4LEW A;  4FHV A;  3NYB A;  4AT7 B;  3OVS A;  3OVA A;  4K99 A;  3C66 A;  4O68 A;  1R8A A;  3HJ4 A;  4OAG A;  2DR9 A;  4FH5 A;  2DR7 A;  4FHX A;  4X4V A;  4OAF A;  2B56 A;  4E7X A;  4NKT A;  4UD5 A;  4NXW A;  4N7R A;  1TFY A;  4ATB A;  4O67 A;  1Q79 A;  4M5D A;  1R8C A;  5CFS A;  4KB6 A;  4K98 A;  2HHP A;  1FA0 A;  4X4U A;  5B3P A;  4JLZ A;  3ER8 C;  4AT8 B;  2DRB A;  4WQL A;  2DR5 A;  4NXU A;  2GA9 D;  4NKU A;  4LEZ A;  2ZH8 A;  4AT9 A;  2ZH2 A;  3OV7 A;  3OVB A;  2FCL A;  2ZH6 A;  3ERC C;  3NKU A;  5CHE A;  5D63 A;  4K8V A;  4WH5 A;  4E80 A;  4O69 A;  3K7D A;  4LEV A;  3HIY A;  4X4N A;  4EP7 A;  2DRA A;  3OUY B;  1R8B A;  2ZH7 A;  4X4O A;  3OWG A;  1UEV A;  1UET A;  1TFW A;  4ATB B;  2EWR A;  2ZH3 A;  2DR8 A;  5B3Q A;  4FHW A;  1F5A A;  4WOY A;  2ZH1 A;  5D62 A;  5CFU A;  2ZH5 A;  3PHZ A;  4WQK A;  2DVI A;  4JLX A;  4AT7 A;  4OAH A;  4UD4 A;  3EF2 A;  2IHO A;  3ER9 B;  4XJE A;  4AT9 B;  4LEY A;  4FHP A;  1Q78 A;  1GPJ A;  4KM5 A;  4NXT A;  4X4P A;  2GAF D;  4X4Q A;  4E8F A;  2B4V A;  4NXV A;  2Q66 A;  5D61 A;  4X4T A;  2ZHB A;  2B51 A;  4K9B A;  4K97 A;  4K96 A;  4LT6 A;  4O6A A;  3OUY A;  4FO1 A;  4K9A A;  1R89 A;  4X4R A;  4FHY A;  2ZH9 A;  4OAI Z;  2ZH4 A;  4AT8 A;  2ZHA A;  5CFT A;  4FH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...