4NXTA

Crystal structure of the cytosolic domain of human mid51
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
337
Chain Sequence
b'DLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxtA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxtA02
4NXVA 4OAIZ 4LEVA 4JLZA 4K99A 4K96A 4AT8B 4AT7B 4OAFA 4AT9B 4O68A 4O6AA 4JLXA 4MKPA 4LEWA 4ATBA 4NXUA 4NXTA 4WOYA 4OAHA 4O67A 4KM5A 4AT8A 4AT7A 4K97A 4AT9A 4LEYA 4O69A 4K9AA 4OAGA 4NXXA 4K98A 4K9BA 4NXWA 4K8VA 4KB6A 4ATBB 4LEZA
chains in the Genus database with same CATH superfamily
5J29A 4TUQA 2DRAA 3B0XA 4EEDA 4YMNA 8ICLA 4NXZA 4M9NA 4M9HA 3MGIA 9ICSA 4XQ8A 1F5AA 4QZGA 3JPTA 4DOAA 3CK6A 1ZQEA 1ZQVA 4KM5A 1RZTA 4MFAA 5CFSA 4E7XA 4QZIA 4WC5A 5J0QA 3RJKA 2FMPA 4DOCA 5J0XA 4KLDA 4X4PA 5CP2A 4OAFA 5HC9A 4F5OA 3OUYA 2ZH8A 2ZH4A 4NXTA 3LQCB 5IIJA 1ZQDA 2DR5A 1JN3A 5CHGA 3UQ2A 1KNYA 8ICXA 8ICFA 4O69A 3H37A 4WBYA 1GPJA 4EP7A 2HHPA 3MBYA 3RJHA 4KB6A 9ICKA 5DBBA 3OVAA 9ICRA 1ZQRA 4NY8A 4OAIZ 1WOTA 2IUBA 3AQKA 4X4TA 2HN1A 8ICQA 2PXIA 2BCQA 2ZH3A 4RQ3A 3K7DA 4QZCA 5CHEA 2ZHAA 3TFRA 4UD5A 4NKTA 1BPYA 4TURA 4Z6DA 4XA5A 2BCUA 7ICMA 4XJEA 3RJIA 4WQKA 1ZQFA 2FMQA 3RH4A 3AU2A 3JPOA 4P2HA 3JPRA 2O5AA 4KLHA 4KLEA 8ICWA 3JYYA 5F2VO 1Q79A 3NKUA 4S3NA 2GA9D 4FO1A 9ICHA 5B3QA 3C66A 1JMSA 1Q78A 3AQMA 3JCFA 1JAJA 4RWQA 5D61A 1UETA 5DDMA 4UBCA 4AT9A 4KLIA 3ISBA 4K98A 4PGYA 1R8BA 4R66A 4X4SA 2ZH6A 3TFSA 4LEZA 4X0AA 3PMLA 3HJ4A 4WQLA 4I2HA 4AT7B 5IINA 2PFOA 5J0WA 4M0AA 4KLJA 4WH5A 1ZQLA 9ICNA 4UB1A 4M9LA 1ZQJA 5BPCA 5J2DA 1ZQXA 4WC7A 4X4RA 8ICNA 3OVSA 5IIMA 2DR9A 4WCWA 4YD1A 4K4IA 7ICFA 4I2CA 1RPLA 5HREA 4IQWA 4UB3A 1BPDA 4KLOA 5DEDA 8ICYA 7ICRA 4LEVA 4RQ1A 3ER9B 4Z6EA 4K96A 5D49A 4F5QA 4O5EA 2VANA 4I2BA 4NKUA 4QZHA 3AUOA 7ICKA 4I2GA 2ZH9A 3RH6A 4AT8A 5D4BA 2M2VA 8ICPA 3OGUA 8ICMA 1FA0A 2ISOA 8ICKA 5J0TA 3C2LA 3UPSA 2HN2A 5J0OA 4UB4A 3C5FA 5DBAA 4RQ2A 1R89A 5JTGA 4K99A 2W9MA 5HRKA 1ZQAA 4IQUA 2IHMA 4RT2A 4GXJA 4I2DA 4Z6FA 3HJ1A 8ICVA 2P66A 3GDXA 4RQ4A 5IIIA 4I2IA 4UAZA 5HRDA 5J2GA 3RJGA 4LEYA 4EBKA 3LK9A 9ICAA 3JPPA 5HHHA 1R8AA 4N7RA 5J2JA 4RT3A 4I2AA 4KLUA 4XUSA 2DR7A 4K8VA 4WBZA 5DB7A 5HR9A 5J2BA 1ZQYA 7ICIA 4RWPA 1ZQSA 3C2KA 3WFPA 4RQ7A 4P4OA 1TVAA 2DRBA 4QZAA 4X0BA 1XSLA 5J2IA 4O6AA 4QZDA 5HRHA 4MKPA 7ICLA 4NM1A 4UD4A 4NXUA 5J2HA 2I9GA 2DR8A 4PH5A 4I2FA 4X4NA 1HUOA 2Q66A 5J2EA 9ICEA 3ER8C 9ICLA 2GAFD 4FHVA 4M2YA 5J0YA 1NOMA 4R64A 2PFPA 3RJJA 4KLTA 3UXNA 5J0UA 4KLGA 7ICQA 5DBCA 9ICJA 4RQ5A 7ICTA 9ICOA 2BPCA 4I29A 8ICJA 7ICOA 3UPQA 2DVIA 1BPEA 1YLQA 2BBHA 3PHZA 1ZQCA 5HRIA 4LT6A 4ATBA 4I2JA 2BCVA 4I0UA 1ZQWA 4FH3A 4MFCA 1VJ7A 5CJ7A 4HX0A 5DDYA 4KLQA 4IQTA 4O5KA 4OAGA 4UAYA 2FMSA 3C18A 4YMMA 4UB2A 1MIVA 3NYBA 4KLFA 2ZH2A 1JQRA 3OUYB 4KLLA 3UXOA 3L9DA 4R63A 4I28A 3AQNA 1ZQKA 4PHEA 3PNCA 5D46A 1UEUA 3V7KA 8ICGA 4GXKA 4RWNA 3HW8A 4FHXA 8ICBA 4WOYA 9ICCA 4QZEA 4RQ8A 2IHOA 5D62A 4WC4A 3WFQE 2ZH5A 4K4GA 4IG8A 1V4AA 4IQVA 3HIYA 8ICTA 1ZJMA 5DECA 4QZ9A 5EOZA 4QZBA 4EV6A 1ZQIA 7ICPA 4YCXA 1R8CA 5DKWA 4JWMA 5D63A 1ZQHA 3NVOA 4PHPA 1MQ3A 4I2EA 1UEVA 1BPBA 4UB5A 8ICOA 4RPYA 5IILA 4X4QA 2M2TA 7ICSA 4R65A 4PHDA 4F5PA 4OAHA 4QZ8A 3RJFA 4O67A 2ID1A 5CB1A 3MCRA 2O1PA 1BPZA 4F5RA 4FHWA 4WC1A 3H3AA 4NXXA 1KEJA 5B3PA 4ATBB 4KLMA 5HRFA 9ICXA 3H38A 4NXVA 4PGQA 2BPGA 3C5GA 7ICEA 4RQ6A 2B4VA 3PMNA 4WC0A 3WFOA 4AT9B 4EGWA 5BOMA 8ICCA 4M9JA 4EBJA 3MDAA 3JPQA 1ZQNA 1TFYA 5DB8A 2FCLA 2PFQA 1TFWA 8ICZA 4RPZA 9ICQA 9ICPA 4NLKA 4KLSA 4GXIA 3ISDA 4E80A 4RWOA 5IIOA 3JPNA 5CA7A 4TUSA 3RJEA 3H39A 8ICRA 4X4VA 7ICHA 8ICHA 4YN4A 4JWNA 3NWIA 1HUZA 3UQ0A 4PPXA 3MDCA 3OV7A 3JPSA 1ZQQA 4WC3A 4MFFA 7ICGA 1XSNA 4XRHA 1MQ2A 4O9MA 4JLXA 3HX0A 5HRGA 5CFTA 4X4UA 5BOLA 2B51A 4XQ7A 5J2AA 2BCRA 3B0YA 4AT7A 5J2FA 4FHPA 1NO5A 2BE3A 4RPXA 2B56A 9ICIA 4M04A 4TUPA 4DOBA 4PGXA 4M9GA 2PBEA 3MGHA 3WFRE 1TV9A 9ICTA 4UAWA 4AT8B 4E8FA 4P4MA 4MF8A 4QZFA 9ICMA 8ICAA 3WFSC 4K4HA 4YD2A 4NLNA 3V7LA 5TZVA 5CR0A 2NRKA 5HRLA 3RH5A 3AU6A 9ICGA 4P4PA 1PX5A 1ZQPA 3C2MA 1ZQZA 9ICFA 1BPXA 4YMOA 4F5NA 8ICIA 8ICSA 4K9BA 4Z6CA 1ZQTA 5HRBA 2EWRA 5J2KA 2GWSA 4M47A 1KDHA 9ICUA 2RFFA 4FH5A 9ICWA 3JZ0A 5J0SA 1ZJNA 3ERCC 5J0RA 4RQ0A 4LZDA 3AQLA 5HHIA 4LEWA 4FO6A 3OVBA 5DB9A 7ICNA 1ZQOA 3V7JA 4FHYA 4EEBA 1MIYA 1ZQMA 4O5CA 1ZQGA 2ISPA 4M5DA 7ICJA 5CWRA 4NM2A 2PFNA 2BBJA 5J0PA 1XSPA 9ICBA 4X4OA 3K75D 2M2WA 7ICVA 3ISCA 5CFUA 4UBBA 4JLZA 4WC2A 5IIKA 1ZQUA 7ICUA 8ICUA 4WC6A 4LZGA 1MIWA 4O68A 4MF2A 9ICVA 1OU5A 4X5VA 8ICEA 3OWGA 2BCSA 4PHAA 3V72A 4LVSA 2ZH1A 2M2UA 2ZH7A 4K97A 1ZQBA 2BPFA 5J2CA 4I27A 3EF2A 4K9AA 5DB6A 4NLZA 4DO9A 3HWTA 4NXWA 2ZHBA 1VFGA 3UXPA
chains in the Genus database with same CATH topology
3OV7A 3HJ4A 2DRAA 4WQLA 4AT7B 4WH5A 2DVIA 4JLXA 3PHZA 4LT6A 4ATBA 5CFTA 1F5AA 4X4UA 2B51A 4FH3A 4KM5A 4AT7A 4HX0A 5CFSA 4E7XA 4FHPA 2B56A 4X4RA 4OAGA 3OVSA 2DR9A 3NYBA 2ZH2A 3OUYB 4LEVA 3ER9B 4X4PA 4AT8B 4E8FA 4K96A 4OAFA 1UEUA 3OUYA 4NKUA 2ZH8A 4FHXA 2ZH4A 4NXTA 4WOYA 2DR5A 2IHOA 2ZH9A 4AT8A 5D62A 4O69A 2ZH5A 1GPJA 1FA0A 4EP7A 2HHPA 4K9BA 4KB6A 2EWRA 3HIYA 3OVAA 1R89A 1R8CA 4OAIZ 4FH5A 4K99A 5D63A 3ERCC 4X4TA 1UEVA 2ZH3A 4LEWA 3K7DA 3HJ1A 4X4QA 5CHEA 2ZHAA 3OVBA 4UD5A 4NKTA 4OAHA 4O67A 4FHYA 3MCRA 2O1PA 4LEYA 4FHWA 4XJEA 4WQKA 4M5DA 1R8AA 4N7RA 4NXXA 2DR7A 4X4OA 5B3PA 4K8VA 4ATBB 1Q79A 3NKUA 4NXVA 2GA9D 4FO1A 5CFUA 2B4VA 4JLZA 2DRBA 5B3QA 3C66A 4AT9B 1Q78A 4O68A 4O6AA 4MKPA 1TFYA 4UD4A 4NXUA 2DR8A 2FCLA 1TFWA 4X4NA 3OWGA 5D61A 2Q66A 1UETA 2ZH1A 2ZH7A 4K97A 4E80A 4AT9A 3ER8C 3EF2A 4K9AA 2GAFD 4K98A 4FHVA 4X4VA 1R8BA 4NXWA 4X4SA 2ZH6A 2ZHBA 4LEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXV A;  4OAI Z;  4LEV A;  4JLZ A;  4K99 A;  4K96 A;  4AT8 B;  4AT7 B;  4OAF A;  4AT9 B;  4O68 A;  4O6A A;  4JLX A;  4MKP A;  4LEW A;  4ATB A;  4NXU A;  4NXT A;  4WOY A;  4OAH A;  4O67 A;  4KM5 A;  4AT8 A;  4AT7 A;  4K97 A;  4AT9 A;  4LEY A;  4O69 A;  4K9A A;  4OAG A;  4NXX A;  4K98 A;  4K9B A;  4NXW A;  4K8V A;  4KB6 A;  4ATB B;  4LEZ A; 
#chains in the Genus database with same CATH topology
 5J29 A;  4TUQ A;  2DRA A;  3B0X A;  4EED A;  4YMN A;  8ICL A;  4NXZ A;  4M9N A;  4M9H A;  3MGI A;  9ICS A;  4XQ8 A;  1F5A A;  4QZG A;  3JPT A;  4DOA A;  3CK6 A;  1ZQE A;  1ZQV A;  4KM5 A;  1RZT A;  4MFA A;  5CFS A;  4E7X A;  4QZI A;  4WC5 A;  5J0Q A;  3RJK A;  2FMP A;  4DOC A;  5J0X A;  4KLD A;  4X4P A;  5CP2 A;  4OAF A;  5HC9 A;  4F5O A;  3OUY A;  2ZH8 A;  2ZH4 A;  4NXT A;  3LQC B;  5IIJ A;  1ZQD A;  2DR5 A;  1JN3 A;  5CHG A;  3UQ2 A;  1KNY A;  8ICX A;  8ICF A;  4O69 A;  3H37 A;  4WBY A;  1GPJ A;  4EP7 A;  2HHP A;  3MBY A;  3RJH A;  4KB6 A;  9ICK A;  5DBB A;  3OVA A;  9ICR A;  1ZQR A;  4NY8 A;  4OAI Z;  1WOT A;  2IUB A;  3AQK A;  4X4T A;  2HN1 A;  8ICQ A;  2PXI A;  2BCQ A;  2ZH3 A;  4RQ3 A;  3K7D A;  4QZC A;  5CHE A;  2ZHA A;  3TFR A;  4UD5 A;  4NKT A;  1BPY A;  4TUR A;  4Z6D A;  4XA5 A;  2BCU A;  7ICM A;  4XJE A;  3RJI A;  4WQK A;  1ZQF A;  2FMQ A;  3RH4 A;  3AU2 A;  3JPO A;  4P2H A;  3JPR A;  2O5A A;  4KLH A;  4KLE A;  8ICW A;  3JYY A;  5F2V O;  1Q79 A;  3NKU A;  4S3N A;  2GA9 D;  4FO1 A;  9ICH A;  5B3Q A;  3C66 A;  1JMS A;  1Q78 A;  3AQM A;  3JCF A;  1JAJ A;  4RWQ A;  5D61 A;  1UET A;  5DDM A;  4UBC A;  4AT9 A;  4KLI A;  3ISB A;  4K98 A;  4PGY A;  1R8B A;  4R66 A;  4X4S A;  2ZH6 A;  3TFS A;  4LEZ A;  4X0A A;  3PML A;  3HJ4 A;  4WQL A;  4I2H A;  4AT7 B;  5IIN A;  2PFO A;  5J0W A;  4M0A A;  4KLJ A;  4WH5 A;  1ZQL A;  9ICN A;  4UB1 A;  4M9L A;  1ZQJ A;  5BPC A;  5J2D A;  1ZQX A;  4WC7 A;  4X4R A;  8ICN A;  3OVS A;  5IIM A;  2DR9 A;  4WCW A;  4YD1 A;  4K4I A;  7ICF A;  4I2C A;  1RPL A;  5HRE A;  4IQW A;  4UB3 A;  1BPD A;  4KLO A;  5DED A;  8ICY A;  7ICR A;  4LEV A;  4RQ1 A;  3ER9 B;  4Z6E A;  4K96 A;  5D49 A;  4F5Q A;  4O5E A;  2VAN A;  4I2B A;  4NKU A;  4QZH A;  3AUO A;  7ICK A;  4I2G A;  2ZH9 A;  3RH6 A;  4AT8 A;  5D4B A;  2M2V A;  8ICP A;  3OGU A;  8ICM A;  1FA0 A;  2ISO A;  8ICK A;  5J0T A;  3C2L A;  3UPS A;  2HN2 A;  5J0O A;  4UB4 A;  3C5F A;  5DBA A;  4RQ2 A;  1R89 A;  5JTG A;  4K99 A;  2W9M A;  5HRK A;  1ZQA A;  4IQU A;  2IHM A;  4RT2 A;  4GXJ A;  4I2D A;  4Z6F A;  3HJ1 A;  8ICV A;  2P66 A;  3GDX A;  4RQ4 A;  5III A;  4I2I A;  4UAZ A;  5HRD A;  5J2G A;  3RJG A;  4LEY A;  4EBK A;  3LK9 A;  9ICA A;  3JPP A;  5HHH A;  1R8A A;  4N7R A;  5J2J A;  4RT3 A;  4I2A A;  4KLU A;  4XUS A;  2DR7 A;  4K8V A;  4WBZ A;  5DB7 A;  5HR9 A;  5J2B A;  1ZQY A;  7ICI A;  4RWP A;  1ZQS A;  3C2K A;  3WFP A;  4RQ7 A;  4P4O A;  1TVA A;  2DRB A;  4QZA A;  4X0B A;  1XSL A;  5J2I A;  4O6A A;  4QZD A;  5HRH A;  4MKP A;  7ICL A;  4NM1 A;  4UD4 A;  4NXU A;  5J2H A;  2I9G A;  2DR8 A;  4PH5 A;  4I2F A;  4X4N A;  1HUO A;  2Q66 A;  5J2E A;  9ICE A;  3ER8 C;  9ICL A;  2GAF D;  4FHV A;  4M2Y A;  5J0Y A;  1NOM A;  4R64 A;  2PFP A;  3RJJ A;  4KLT A;  3UXN A;  5J0U A;  4KLG A;  7ICQ A;  5DBC A;  9ICJ A;  4RQ5 A;  7ICT A;  9ICO A;  2BPC A;  4I29 A;  8ICJ A;  7ICO A;  3UPQ A;  2DVI A;  1BPE A;  1YLQ A;  2BBH A;  3PHZ A;  1ZQC A;  5HRI A;  4LT6 A;  4ATB A;  4I2J A;  2BCV A;  4I0U A;  1ZQW A;  4FH3 A;  4MFC A;  1VJ7 A;  5CJ7 A;  4HX0 A;  5DDY A;  4KLQ A;  4IQT A;  4O5K A;  4OAG A;  4UAY A;  2FMS A;  3C18 A;  4YMM A;  4UB2 A;  1MIV A;  3NYB A;  4KLF A;  2ZH2 A;  1JQR A;  3OUY B;  4KLL A;  3UXO A;  3L9D A;  4R63 A;  4I28 A;  3AQN A;  1ZQK A;  4PHE A;  3PNC A;  5D46 A;  1UEU A;  3V7K A;  8ICG A;  4GXK A;  4RWN A;  3HW8 A;  4FHX A;  8ICB A;  4WOY A;  9ICC A;  4QZE A;  4RQ8 A;  2IHO A;  5D62 A;  4WC4 A;  3WFQ E;  2ZH5 A;  4K4G A;  4IG8 A;  1V4A A;  4IQV A;  3HIY A;  8ICT A;  1ZJM A;  5DEC A;  4QZ9 A;  5EOZ A;  4QZB A;  4EV6 A;  1ZQI A;  7ICP A;  4YCX A;  1R8C A;  5DKW A;  4JWM A;  5D63 A;  1ZQH A;  3NVO A;  4PHP A;  1MQ3 A;  4I2E A;  1UEV A;  1BPB A;  4UB5 A;  8ICO A;  4RPY A;  5IIL A;  4X4Q A;  2M2T A;  7ICS A;  4R65 A;  4PHD A;  4F5P A;  4OAH A;  4QZ8 A;  3RJF A;  4O67 A;  2ID1 A;  5CB1 A;  3MCR A;  2O1P A;  1BPZ A;  4F5R A;  4FHW A;  4WC1 A;  3H3A A;  4NXX A;  1KEJ A;  5B3P A;  4ATB B;  4KLM A;  5HRF A;  9ICX A;  3H38 A;  4NXV A;  4PGQ A;  2BPG A;  3C5G A;  7ICE A;  4RQ6 A;  2B4V A;  3PMN A;  4WC0 A;  3WFO A;  4AT9 B;  4EGW A;  5BOM A;  8ICC A;  4M9J A;  4EBJ A;  3MDA A;  3JPQ A;  1ZQN A;  1TFY A;  5DB8 A;  2FCL A;  2PFQ A;  1TFW A;  8ICZ A;  4RPZ A;  9ICQ A;  9ICP A;  4NLK A;  4KLS A;  4GXI A;  3ISD A;  4E80 A;  4RWO A;  5IIO A;  3JPN A;  5CA7 A;  4TUS A;  3RJE A;  3H39 A;  8ICR A;  4X4V A;  7ICH A;  8ICH A;  4YN4 A;  4JWN A;  3NWI A;  1HUZ A;  3UQ0 A;  4PPX A;  3MDC A;  3OV7 A;  3JPS A;  1ZQQ A;  4WC3 A;  4MFF A;  7ICG A;  1XSN A;  4XRH A;  1MQ2 A;  4O9M A;  4JLX A;  3HX0 A;  5HRG A;  5CFT A;  4X4U A;  5BOL A;  2B51 A;  4XQ7 A;  5J2A A;  2BCR A;  3B0Y A;  4AT7 A;  5J2F A;  4FHP A;  1NO5 A;  2BE3 A;  4RPX A;  2B56 A;  9ICI A;  4M04 A;  4TUP A;  4DOB A;  4PGX A;  4M9G A;  2PBE A;  3MGH A;  3WFR E;  1TV9 A;  9ICT A;  4UAW A;  4AT8 B;  4E8F A;  4P4M A;  4MF8 A;  4QZF A;  9ICM A;  8ICA A;  3WFS C;  4K4H A;  4YD2 A;  4NLN A;  3V7L A;  5TZV A;  5CR0 A;  2NRK A;  5HRL A;  3RH5 A;  3AU6 A;  9ICG A;  4P4P A;  1PX5 A;  1ZQP A;  3C2M A;  1ZQZ A;  9ICF A;  1BPX A;  4YMO A;  4F5N A;  8ICI A;  8ICS A;  4K9B A;  4Z6C A;  1ZQT A;  5HRB A;  2EWR A;  5J2K A;  2GWS A;  4M47 A;  1KDH A;  9ICU A;  2RFF A;  4FH5 A;  9ICW A;  3JZ0 A;  5J0S A;  1ZJN A;  3ERC C;  5J0R A;  4RQ0 A;  4LZD A;  3AQL A;  5HHI A;  4LEW A;  4FO6 A;  3OVB A;  5DB9 A;  7ICN A;  1ZQO A;  3V7J A;  4FHY A;  4EEB A;  1MIY A;  1ZQM A;  4O5C A;  1ZQG A;  2ISP A;  4M5D A;  7ICJ A;  5CWR A;  4NM2 A;  2PFN A;  2BBJ A;  5J0P A;  1XSP A;  9ICB A;  4X4O A;  3K75 D;  2M2W A;  7ICV A;  3ISC A;  5CFU A;  4UBB A;  4JLZ A;  4WC2 A;  5IIK A;  1ZQU A;  7ICU A;  8ICU A;  4WC6 A;  4LZG A;  1MIW A;  4O68 A;  4MF2 A;  9ICV A;  1OU5 A;  4X5V A;  8ICE A;  3OWG A;  2BCS A;  4PHA A;  3V72 A;  4LVS A;  2ZH1 A;  2M2U A;  2ZH7 A;  4K97 A;  1ZQB A;  2BPF A;  5J2C A;  4I27 A;  3EF2 A;  4K9A A;  5DB6 A;  4NLZ A;  4DO9 A;  3HWT A;  4NXW A;  2ZHB A;  1VFG A;  3UXP A; 
#chains in the Genus database with same CATH homology
 3OV7 A;  3HJ4 A;  2DRA A;  4WQL A;  4AT7 B;  4WH5 A;  2DVI A;  4JLX A;  3PHZ A;  4LT6 A;  4ATB A;  5CFT A;  1F5A A;  4X4U A;  2B51 A;  4FH3 A;  4KM5 A;  4AT7 A;  4HX0 A;  5CFS A;  4E7X A;  4FHP A;  2B56 A;  4X4R A;  4OAG A;  3OVS A;  2DR9 A;  3NYB A;  2ZH2 A;  3OUY B;  4LEV A;  3ER9 B;  4X4P A;  4AT8 B;  4E8F A;  4K96 A;  4OAF A;  1UEU A;  3OUY A;  4NKU A;  2ZH8 A;  4FHX A;  2ZH4 A;  4NXT A;  4WOY A;  2DR5 A;  2IHO A;  2ZH9 A;  4AT8 A;  5D62 A;  4O69 A;  2ZH5 A;  1GPJ A;  1FA0 A;  4EP7 A;  2HHP A;  4K9B A;  4KB6 A;  2EWR A;  3HIY A;  3OVA A;  1R89 A;  1R8C A;  4OAI Z;  4FH5 A;  4K99 A;  5D63 A;  3ERC C;  4X4T A;  1UEV A;  2ZH3 A;  4LEW A;  3K7D A;  3HJ1 A;  4X4Q A;  5CHE A;  2ZHA A;  3OVB A;  4UD5 A;  4NKT A;  4OAH A;  4O67 A;  4FHY A;  3MCR A;  2O1P A;  4LEY A;  4FHW A;  4XJE A;  4WQK A;  4M5D A;  1R8A A;  4N7R A;  4NXX A;  2DR7 A;  4X4O A;  5B3P A;  4K8V A;  4ATB B;  1Q79 A;  3NKU A;  4NXV A;  2GA9 D;  4FO1 A;  5CFU A;  2B4V A;  4JLZ A;  2DRB A;  5B3Q A;  3C66 A;  4AT9 B;  1Q78 A;  4O68 A;  4O6A A;  4MKP A;  1TFY A;  4UD4 A;  4NXU A;  2DR8 A;  2FCL A;  1TFW A;  4X4N A;  3OWG A;  5D61 A;  2Q66 A;  1UET A;  2ZH1 A;  2ZH7 A;  4K97 A;  4E80 A;  4AT9 A;  3ER8 C;  3EF2 A;  4K9A A;  2GAF D;  4K98 A;  4FHV A;  4X4V A;  1R8B A;  4NXW A;  4X4S A;  2ZH6 A;  2ZHB A;  4LEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...