3ISBA

Binary complex of human dna polymerase beta with a gapped dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title DNA polymerase beta substrate specificity: side chain modulation of the "A-rule".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3isbA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 3isbA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 3isbA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3isbA03
4QWDA 4JV0A 1NKEA 5HRHA 1XSPA 4DL3A 2VA3A 4MEYA 2BQRA 1ZQMA 4PH5A 4RQ5A 4YXJA 4JWNA 2ALZA 3PW2A 3HT3A 3GIKA 8ICQA 1TVAA 5J0UA 3T5HA 4KLGA 2P66A 1JXLA 2V9WA 4KLTA 2ZUBA 2PBEA 4QWBA 5CHGA 8ICWA 4QZGA 4KN7A 3HJ4A 4IQWA 2AU0A 4C8MA 4I2DA 3HP6A 4RNOA 3PX6A 1ZQPA 2KZMA 7ICVA 5KFQA 1DK3A 2M2VA 1B22A 2W8KA 5HMLA 4J9RA 5HP4A 1NJXA 8ICKA 4M9LA 1MSWD 4I2HA 2HHWA 1SKWA 3HPOA 3MFHA 1SKRA 5KFZA 4M04A 4ED7A 5HNKA 5KG1A 4BDPA 9ICFA 1JQRA 2HVHA 3M8RA 4NXZA 2ZTEA 4BWMA 2BR0A 5DBAA 4X5VA 3NYBA 5IIJA 3PW0A 2R8KA 4M0AA 4M5DA 1R8AA 3HJ1A 5DLGA 4F92B 4KLQA 4DL6A 4M47A 4EYHB 3ZDDA 1TFWA 2FPMA 3PW4A 2PFNA 4RUAA 1RXWA 3UQ2A 3K75D 4O3OA 2W9CB 4DSLA 9ICPA 1K1QA 4RT3A 4O5CA 3H37A 9ICHA 3ZDCA 4KLDA 1ZQQA 4DSFA 4B9VA 1SL1A 4YQWA 4J9QA 1S0MA 5KG6A 4JV2A 4MFAA 1X2IA 2W9BB 3BJYA 2KP7A 4YCXA 4O9MA 5HR9A 4YD2A 3PVXA 2I9GA 1D8LA 1JX4A 2ASJA 3SV4A 1NK5A 5KFLA 4EZ9A 5DKWA 8ICOA 3WFPA 1U49A 8ICXA 3H4BA 1NJYA 4EBKA 1T7PA 4B9SA 1ZQDA 5HC9A 4UBCA 4Q44A 3EYZA 3GIJA 4RNNA 4DQQA 3RH4A 3L9DA 3JPTA 3RBDA 4PGXA 4QWCA 5IIOA 3GDXA 3OSNA 3Q8MA 3OVBA 3QZ7A 4R66A 1H38A 4PPXA 4BGDA 2HHXA 1Q79A 3JYYA 4ATBA 5HHIA 4QWAA 1Y88A 2R8HA 1XC9A 4WBZA 2DRAA 5KFIA 3OJSA 9ICLA 4IQVA 4X0BA 5DBCA 4F4YA 4PGYA 3MR6A 4ECUA 2UVRA 4O5EA 4J9MA 3TAQA 4FHYA 3E2EA 1CUKA 3IHQB 5KTQA 4ED6A 1UEUA 5CR0A 5J2GA 5J0XA 4AT8B 2V4RA 1U4BA 4TUQA 4P4PA 4O3RA 4ECVA 7ICNA 4ZH4A 4DFKA 2P6RA 2BDPA 4C8KA 1S0VA 4F50A 4ECQA 4UD4A 4YN4A 1NK4A 2XGQA 3B0YA 2W9AA 3C5GA 4DS5A 1L5UA 5KFAA 4ED8A 1T8EA 2IA6A 5J29A 1ZQHA 1BPDA 4DWIA 4I27A 8ICSA 2BCVA 1S9FA 2W8LA 2NRTA 1TV9A 1R8CA 4I2JA 4DSIA 4EBEA 3Q8KA 3T5LA 1WCNA 7ICLA 1D8YA 5KFRA 2JEJA 4FO6A 5DG9A 5DB9A 1KTQA 3JPNA 2AGQA 3PR4A 2J6UA 4X0AA 4KITB 4MFFA 5KFXA 5CP2A 2BCQA 2BHNA 5KT3A 2ZJ5A 3PW5A 3MR5A 2BPFA 5KG3A 1KRPA 2JEIA 4RQ6A 3V7LA 2C28A 4CCHA 3ZD8A 5HRIA 1UETA 3RJJA 4YP3A 5J0WA 2IHMA 4AT7B 3KHGA 4RWOA 4J9LA 4C8LA 1V4AA 4EBJA 4F5RA 5KFKA 1JIHA 4DS4A 2HHTA 1BPZA 9ICUA 2NRVA 5KG5A 4I2BA 3OGUA 4KLIA 1UT5A 3V6JA 1MIVA 1Z00B 4J9NA 2BQUA 2XY5A 2ZH1A 1D9DA 1X9SA 3ISCA 4WC4A 4DF4A 1SL0A 4KLHA 4JV1A 4MF8A 3TQ1A 5KFHA 4S3NA 4Z6DA 5DQHA 9ICJA 2ID1A 3NGDA 2FLNA 1ZQGA 2VA8A 1TKDA 2ZH9A 1JN3A 3ISBA 3EZ5A 4XQ8A 3T3FA 3QEBZ 5J0PA 9ICXA 4UB2A 2M2TA 2NRXA 1JXEA 3Q8SB 2F1HA 1QTMA 4B9UA 3GILA 4X4SA 2MUTA 3KHRA 4WC7A 4R63A 2FMPA 5EWFA 3AUOA 8ICCA 3KHHA 3PV8A 4M6WB 5DECA 1MIWA 4DOBA 2RDJA 3UPQA 4EZ6A 4M2YA 4YG2A 4EYIB 5KFCA 4LZGA 5J0QA 3V7JA 4PHAA 3RJFA 5L1IA 3V6HA 3PY8A 1UEVA 5J2CA 3PR5B 4FHPA 4O3QA 1VJ7A 1NK7A 2NRWA 3RJIA 2HHQA 3SI8A 9ICRA 4YR3A 4RPYA 1L3VA 3G6XA 5KFVA 3TANA 2H5XA 4KN4A 5CJ7A 1V9PA 3GV8B 3MR2A 4I2FA 4QZ9A 2HHUA 1DGSA 2B21A 3BQ1A 4RWQA 3OV7A 9ICTA 2PFOA 3V7KA 4BWJA 3RTVA 4FH5A 2FMQA 4M9JA 5J2AA 1HUZA 4YMMA 4O3NA 2I1QA 3BQTA 3EPIA 3QEAZ 3RJGA 4B9TA 5J2EA 2RFFA 2LYHA 2DR8A 5BOMA 4UAZA 3M8SA 3PW7A 2ASDA 2IHNA 2IMWP 4X4UA 3M9OB 3TI0A 5J2KA 4DOAA 2R8GA 4J9KA 5C5JA 1ZQXA 3M9MB 1S0NA 4E0DA 4ECRA 1ZQVA 4C8OA 4IR1A 2ASLA 3T5KA 4TQRA 1DK2A 8ICEA 2W9MA 3EW9A 5KG0A 4UB3A 4DOCA 3AQLA 1S77D 4KLEA 1NKBA 5IIKA 4PHEA 5KT5A 4UB5A 1NK0A 4K4HA 3WFOA 3C2MA 3H8JA 3N4MB 4I2AA 8ICAA 3ZD9A 1XU4A 2PFPA 3WFQE 1S97A 1ZQZA 4UBBA 4QWEA 5J2IA 7ICUA 5KFOA 4QZBA 5HREA 8ICMA 4NY8A 1IXRA 4RQ1A 4GLXA 2JZBB 3PNCA 3TARA 3RAXA 2P6UA 2ZH5A 2UVVA 5EWGA 3H40A 2DRBA 2BE3A 4X4TA 2XCPA 1NK6A 4F5NA 9ICGA 4KLOA 7ICTA 3OUYB 2ZH8A 2ZH4A 4RQ3A 1TFRA 3GQCA 2O5AA 4XUSA 2HVIA 4F5QA 3OJUA 5HRLA 4YR2A 2ZHAA 2UVUA 3ZDEA 4FBTA 2W9CA 5L1KA 1N56A 1NO5A 4Q45A 3TAPA 1ZQRA 3OVAA 3PO5A 2O1PA 1JMSA 5DB7A 4DF8A 4I2CA 4XA5A 3RB3A 3G6YA 3WFSC 9ICAA 4I2EA 2W9BA 1QLNA 3AQNA 1MQ3A 4QZEA 4R8UB 2DPJA 1VFGA 2DR7A 1PZNA 3NTUA 1NKCA 2F1JA 4YFKA 4RUCA 1HUOA 9ICEA 5BOLA 2ZH6A 2UVWA 5KFNA 3H38A 3MDAA 3RH5A 1ZQBA 3ZDAA 3JPQA 4IRDA 5F2VO 4GXIA 2JEFA 2AJQA 3UXNA 1XO1A 5J0YA 2XC9A 4GXKA 5HMMA 2FPKA 1ZQIA 4QZCA 2PI4A 4I2GA 4DL5A 3C1YA 2V4QA 4K4GA 8ICYA 4I29A 1COOA 1MC8A 4PHPA 5DBBA 1KFTA 2ZJ8A 4YMOA 1TK0A 2C22A 3EWAA 1WOTA 5IILA 4FHVA 2VANA 4TUPA 5IIMA 5KG4A 4B9NA 4I28A 1F5AA 2KTQA 1PX5A 3C18A 1WCLA 3JPSA 3C2LA 1BNOA 3LK9A 5DGBA 9ICBA 5DDMA 3RR8A 4NM1A 5HRFA 4FH3A 5L1LA 1BPBA 9ICOA 4IRCA 1RYSA 2M9NA 7ICRA 1R8BA 4J9SA 4ED2A 4WC3A 3UPSA 5TZVA 3AU6A 4PGQA 1DOQA 3C5FA 1FA0A 1ZQCA 1QSSA 4O3PA 5KG2A 3UXOA 4DEZA 2XY7A 2BPCA 4EEYA 2FLLA 5KFBA 4UB1A 4RQ7A 4BXOA 4AT9B 5DB6A 4DL7A 4P2HA 5DQGA 3C23A 7ICFA 1TAQA 5KT4A 7ICEA 5D4BA 4XQ7A 4DQPA 4F4ZA 4NKTA 2A1JB 4GC7A 5KFEA 1ZQLA 2C2RA 4QZAA 1BPXA 2R8IA 5DDYA 4KMUA 3RJHA 4DL2A 4MF2A 4DFMA 2ATLA 3LWMA 4QW9A 1HJPA 5KFDA 2FMSA 4AT7A 5HRKA 4ECZA 7ICKA 3RJKA 4ECTA 3N97B 3H3AA 2J6TA 7ICSA 1L3SA 4UB4A 3KTQA 3RAQA 2HW3A 4RPXA 4WBYA 3HX0A 3T5JA 3TFSA 2XY6A 2KFNA 4BXOB 2BKEA 2M2WA 4WC6A 1Z00A 4IR9A 3JPOA 1ZQKA 4RPZA 2XO7A 4TUSA 4QZ8A 5IIIA 4LVSA 5KFGA 7ICMA 1UA1A 3RB0A 4ELUA 4NM2A 3BQ2A 4RQ4A 3OHBA 4JWMA 1YLQA 2Y1IA 3Q8LA 2ZJAA 3GIMA 4P4MA 4KLFA 5DQIA 1BNPA 4IG8A 3GFKB 1T3NA 1KSPA 4P4OA 2C2EA 1ZYQA 3H7IA 5CB1A 4F2RA 3C66A 5CWRA 1ZJMA 4E7XA 4M6WA 4JUZA 3GV5B 4J9PA 5F9NA 1SL2A 4K4IA 2DR5A 3KHLA 1U45A 5KT6A 1OU5A 4EBCA 1RXVA 3PX0A 2KN7A 3RBEA 3M9NB 3C2KA 2ISPA 2FPLA 9ICVA 4KTQA 8ICUA 3MABA 4Z6EA 5CA7A 5KFPA 3HW8A 4RZRA 8ICPA 4WC2A 4M9NA 5KFUA 1SKSA 3RRGA 4O3SA 5D46A 7ICOA 4C8NA 2R8JA 4RT2A 4UD5A 4AT8A 5J2BA 4DSKA 4PHDA 4EBDA 1U47A 4F5PA 2PI5A 2ZH2A 9ICCA 4ECWA 1UA0A 1D9FA 4ECYA 4XRHA 4DFJA 1RYRA 1LB2B 1KNYA 4YXMA 3UXPA 4FS2A 4QZHA 4YMNA 4RQ2A 5J2DA 5J0SA 4UQGA 3MFIA 1U48A 1ZQNA 5KFJA 5J0OA 4M9HA 5EWEA 3OSPA 5HRDA 7ICQA 2M2UA 3HIYA 3Q8PB 3JPPA 3MGHA 1SZPA 5J0RA 3K4GA 4DQRA 1RZTA 4F8RA 4F93B 4NLGA 3C21A 2Q66A 4X4QA 1ZQFA 1TK8A 3IM1A 3MDCA 2DPIA 1KFDA 7ICGA 1ZQJA 2OWOA 1ZQUA 2BGWA 4FHWA 2Q0ZX 2DR9A 5KT2A 4QZIA 4FBUA 4X4OA 3H39A 2XGPA 1NZPA 5JUMA 8ICGA 5KFYA 2WTFA 3PO4A 1L3UA 5DB8A 4RNMA 5J0TA 5KFFA 1QSLA 1X9MA 2JZBA 2F1IA 1XSLA 1BPYA 2ISOA 4F4XA 2KZZA 1NK8A 3OUYA 4Q8FA 9ICSA 4RWPA 2C2DA 5HRBA 4FHXA 8ICLA 4ELTA 4FS1A 1C7YA 2BCRA 4F91B 2AQ4A 3G6VA 4NLNA 1NJWA 4WC0A 8ICTA 5J2FA 4RQ8A 2PXIA 1ZQSA 5L1JA 3BDPA 4ELVA 8ICHA 3OVSA 4E8FA 1ZETA 3OHAA 3BQ0A 1MQ2A 2BPGA 8ICBA 4YVZA 8ICIA 2ZHBA 4J9OA 3V72A 1ZQAA 3LQCB 1R89A 2HHPA 4B9LA 2HHSA 4R65A 2AGPA 2IBKA 3JPRA 2AQ0A 1MIYA 4DSEA 4YR0A 2J6SA 1S76D 4TURA 4EP7A 9ICMA 1KLNA 1Q78A 4R8UA 3ZDBA 4ATBB 2BQ3A 4B9MA 1CEZA 3ISDA 3RB6A 4MFCA 4GXJA 3RRHA 1JAJA 4JK1A 8ICVA 4QZFA 3RR7A 2KZ3A 4LT6A 4Q8EA 1T4GA 3H8SA 4F4KA 1EXNA 4KLSA 2ZH3A 2RDIA 4IQTA 1Z3EB 3GV7B 1BPEA 3PMNA 2AGOA 2JEGA 4YD1A 4R64A 7ICIA 2NRKA 2MAXA 4ED0A 1ZQWA 1XS9D 4F2SA 4NLKA 9ICQA 4QZDA 4X4RA 4G3IA 3B0XA 1TK5A 2BCUA 4ECSA 5KFWA 3H4DA 3MGIA 3EPGA 4RWNA 4DSJA 2GWSA 4UAWA 4F4WA 3QZ8A 5KFSA 8ICZA 4ECXA 4DQIA 3AQMA 2DVIA 3V6KA 2KFZA 1XWLA 1UT8A 1IM4A 1AROP 3RH6A 2ZTCA 5KT7A 4NKUA 1TFYA 4TQSA 1L3TA 4RU9A 8ICFA 1NJZA 4Q43A 1B43A 1LV5A 3ORYA 1S0OA 9ICIA 4O5KA 4KLJA 4KLLA 4KLMA 5IINA 4DFPA 5KG7A 4Z6FA 3C1ZA 4DLEA 5DGAA 4AT9A 4X4NA 3Q8QB 3MR3A 5KFMA 4M9GA 3FYHA 2BCSA 5D49A 5DLFA 4DO9A 1ZJNA 2A1JA 1ZQYA 2DFLA 3LWLA 4GC6A 4DLGA 9ICKA 1BGXT 1RPLA 3LDAA 3Q8RB 1ZQEA 1A76A 4LZDA 4F3OA 4WC1A 5BPCA 2ZH7A 3TFRA 1N48A 5KFTA 7ICJA 1KDHA 5HRGA 3PX4A 4QW8A 4UAYA 2XCAA 1ZQOA 4E80A 3AU2A 4DQSA 4DL4A 8ICJA 9ICWA 2ZUDA 4X4PA 4O0IA 4WCWA 4HYKA 2PFQA 3GIIA 4ED1A 5EOZA 4Z6CA 1KEJA 4MEXA 4IRKA 1TAUA 1NK9A 8ICRA 4ED3A 2MUTB 4IQUA 2Y1JA 2FLPA 1K1SA 1BVSA 3HWTA 1ZQTA 2ZUCA 4WC5A 3WFRE 7ICHA 5DG8A 7ICPA 3SYZA 2NRZA 1KFSA 3AQKA 3THVA 3ETLA 3SZ2A 3RJEA 5HHHA 3H8WA 4I2IA 3UQ0A 3PMLA 1XSNA 1U9LA 3FDSA 3RB4A 5J2HA 8ICNA 5J2JA 1X9WA 5DEDA 5DG7A 4NLZA 2ZTDA 3SV3A 1QSYA 2HHVA 4X4VA 3QE9Y 4KLUA 4RQ0A 5L9XA 4F5OA 3JZ0A 3MBYA 5F9LA 9ICNA 1NOMA 2VA2A 1A77A 1S10A
chains in the Genus database with same CATH superfamily
4QWDA 1NKEA 4U7CA 2F3NA 4DL3A 1XSPA 5B5EU 2ALZA 3GIKA 1TVAA 1KKXA 2GAFD 4F72A 2Z7JA 3QUCA 5CHGA 2RP5A 4KN7A 4C80A 2AU0A 4I2DA 4RNOA 3PX6A 2QARA 2ZIVA 2DF4B 3MFHA 3WK5A 4NWIA 4FE3A 1JQRA 1NNLA 2ZTEA 2OM6A 2YB1A 4BWMA 2BR0A 1OW5A 1QQ7A 3KKAC 5ALQA 3PW0A 4M0AA 3HJ1A 1X42A 4F92B 4KLQA 2KK0A 4M47A 1TFWA 1RXWA 4OJLA 2H3VA 3H37A 9ICHA 3M6KA 1SL1A 1S0MA 1X2IA 3PVXA 1D8LA 4EZ9A 3SV4A 5KFLA 5DKWA 8ICXA 2F44A 2F77X 5HC9A 3GIJA 3L9DA 2Y9UA 4QWCA 4CRXA 3F53A 3Q8MA 3OVBA 2D3DA 4ATBA 5HHIA 4QWAA 1Y88A 2DRAA 5KFIA 4IQVA 5DBCA 4F4YA 2WF7A 3IHQB 4ED6A 7ICNA 3D2SA 2BDPA 3BQ7A 4F50A 2LI6A 5ALVA 2W43A 3MCRA 4ED8A 2DQNB 5AM4A 1T8EA 1ZQHA 1BPDA 2NRTA 3PHZA 4I2JA 1D8YA 4FO6A 4P0QB 1KTQA 3PR4A 4X0AA 2BCQA 4OAGA 2JEIA 3V7LA 5HRIA 1YZ7A 4QIWC 4YP3A 4AT7B 3BZCA 4RWOA 2NO4A 4J9LA 4C8LA 4F5RA 1DXSA 3E0FA 2ZIWB 2HHTA 2QB0A 2XY5A 1X9SA 3ISCA 1SGGA 1SL0A 3TQ1A 5KFHA 4S3NA 2ID1A 2FLNA 2VA8A 1TKDA 3IDWA 5J0PA 2JGAA 1N2XA 4M6WB 5ALLA 3U26A 5KFCA 1S8OA 2LM4A 5AHXA 5D61A 1VJ7A 2NRWA 3RJIA 2HHVA 1V9PA 2WAQC 2B21A 9ICTA 3RTVA 4K97A 4M9JA 3ER8C 3RJGA 5ALFA 5J2EA 2LYHA 3M8SA 1WYGA 3N7RC 1ZQXA 4C8OA 1ZQVA 2ASLA 4TQRA 8ICEA 3EW9A 4DOCA 5AKKA 1Q46A 2GLEA 2E1EA 1S77D 1NKBA 5IIKA 1QH9A 4K4HA 3C2MA 2IOFK 8ICAA 3F2DA 2F2AB 1XU4A 4CF3A 3WFQE 1S97A 2HBLA 2G09A 2EH9A 4PJ0U 3PNCA 2UVVA 2DRBA 1ZD5A 4KLOA 1Q8KA 2O5AA 4F5QA 3ZDEA 2K8BB 3PO5A 1JMSA 5CFSA 1KL9A 5AKIA 9ICAA 4I2EA 3ICXA 3AQNA 5AK6A 3WKBA 3CRXA 4R8UB 2DPJA 2O6KA 2F1JA 1HUOA 2HOFA 4EEBA 3RH5A 5F2VO 1P7DA 3OWGA 2IUBA 3C1YA 4I0UA 5HR7A 8ICYA 3QUBA 3K1RB 1COOA 4FZLA 2BBHA 1WOTA 5ALDA 2XICA 1JUDA 3K1ZA 5IIMA 5KG4A 2DBYA 4B9NA 3C18A 2IOFA 3TKAA 3HJEA 1BNOA 5DGBA 5DDMA 2HBJA 2W54A 3RR8A 4KB6A 1BPBA 5KL1B 1R8BA 4C7ZA 7ICRA 3M7DA 4J9SA 4OO1J 5TZVA 2K8CB 3C5FA 2VJ4A 4O3PA 5KG2A 4K9BA 4DEZA 4LEWA 5ALRA 5KFBA 4UB1A 2FLLA 4EV6A 2ES6A 4P0QA 7ICFA 5ALHA 5D4BA 4F4ZA 2A1JB 4QZAA 2BBJA 4BX9C 3FAHA 4QW9A 2FMSA 5KFDA 4AT7A 3H3AA 2KHVA 3ERCC 4UB4A 2ZIWA 3RAQA 2M2WA 2XY6A 1M6YA 4BXOB 2KEYA 3KBBA 1ZQKA 4QZ8A 5IIIA 2ESEA 3E58A 4NM2A 4US8A 4PZNA 3NS1A 5G5GA 3ONNA 4KLFA 2G5HB 5CB1A 4JLXA 2YQEA 4M6WA 1CRXA 3SAFA 1OU5A 2Y0SF 1VLBA 1RXVA 2FPLA 2W3RA 3HW8A 1WWUA 4RZRA 1KQQA 4M9NA 2XIDA 5D46A 1IG6A 2R18A 2ZH2A 3FM9A 2WB1C 3ETRA 4YXMA 3UXPA 5J2DA 4UQGA 3MFIA 4AP9A 5J0OA 4M9HA 4OD0A 3N7PD 1RZTA 4F8RA 5B3QA 4F93B 4NLGA 1ZQFA 1TK8A 1ZQJA 1ZQUA 4BJQA 2BGWA 2Q0ZX 1O03A 3IG8A 4QZIA 1JI7A 3H39A 3J81j 2YY6A 3PO4A 4Y2QA 1X9MA 3I28A 4NLCA 1C20A 5AI8A 4UASA 3NVOA 3KKAA 4FS1A 4F91B 2I6XA 3G6VA 2DKXA 2W7OA 1O08A 4ELVA 2PXIA 1ZQSA 4E8FA 1ZETA 2BPGA 3HKZC 4B9LA 4R65A 4YR0A 4TURA 9ICMA 1KLNA 1Q78A 4R8UA 1CEZA 3RB6A 3RRHA 4UB8U 4C7YA 4A8EA 4QZFA 3PSIA 4LT6A 1L6NA 1BPEA 1ZQWA 1XS9D 5AKGA 4NLKA 4BUGA 2B4VA 9ICQA 5KFWA 4DSJA 1F5SA 3SAGA 2G06A 5KFSA 1DRGA 1ZXIA 4DCCA 4MHVA 3V6KA 1XWLA 1SV4A 1X40A 3N28A 4NKUA 4IS7A 1NJZA 4Q43A 4OJ6A 4O5KA 2LKYA 3I1YA 2A3VA 3TADC 4Y2VA 5DGAA 4X4NA 4M9GA 1NI3A 4ZOHC 3SMVA 1ZJNA 2A1JA 4GC6A 3LWLA 9ICKA 1L7NA 4LJXA 1L7OA 7ICJA 4UAYA 4DQSA 5AICA 9ICWA 4X4PA 4HYKA 2PFQA 4O3MA 4Z6CA 1KEJA 4ED3A 4BXOA 1K1SA 1BVSA 3HWTA 5DG8A 1S5LU 2NRZA 1KFSA 3SZ2A 5HHHA 1XSNA 5J2HA 1X9WA 5DEDA 4NLZA 5AI6A 4KLUA 3JZ0A 4F5OA 3NVYA 5F9LA 2K4HA 1NOMA 4O67A 1V38A 5HRHA 4LEZA 1ZQMA 2K60A 4YXJA 3AM9A 3PW2A 3HT3A 4CF4A 4USAA 5AK4A 3T5HA 3MC1A 1JXLA 5JRTA 4KLTA 2XVTA 2PBEA 8ICWA 4IQWA 1ZQPA 7ICVA 1PK3A 5KAFU 5HP4A 3IG5A 1MSWD 4I2HA 1SKRA 5KFZA 4ED7A 3WK4A 2HVHA 3M8RA 4ACOA 2F8KA 5DBAA 3ER9B 3NYBA 4ICAA 1R8AA 1FIQA 4DL6A 2FPMA 2KOBA 2PFNA 3EF2A 4RUAA 3K75D 4DSLA 9ICPA 1N60A 5AM5A 2KKPA 4UW9A 1ZQQA 3N7SC 4MFAA 3BJYA 5FP0A 1PVRA 5HR9A 1J2MA 1JX4A 1NK5A 2VJ5A 1U49A 3WFPA 3H4BA 3C28A 4Q44A 4DQQA 3JPTA 5IIOA 4FZMA 4EELA 3QZ7A 1Q79A 3JYYA 2R8HA 1XC9A 2Y0SC 2WFAA 9ICLA 4O5EA 4PGYA 3MR6A 4FHYA 1CUKA 4UARA 5J2GA 2V4RA 3K7DA 1U4BA 4TUQA 4P4PA 4ZH4A 2P6RA 4C8KA 2D6FC 1Z1VA 2DL0A 2K4IA 1RM6C 4YN4A 1NK4A 3B0YA 2HN1A 1L5UA 5KFAA 4I27A 7ICLA 1GPJA 4UAUA 5DG9A 2KSOB 5DB9A 4UAVA 2EZZA 4KITB 5KFXA 2H3QA 5KT3A 2ZJ5A 3PW5A 2RHFA 4UATA 2C28A 4PL2A 1HIWA 3WK7A 2IHMA 3KHGA 2VKQA 4EBJA 1JIHA 3DV9A 1BPZA 9ICUA 4O6AA 3OGUA 5D63A 3V6JA 4J9NA 2BQUA 2ZH1A 1D9DA 5AKEA 1HEKA 4Z6DA 5DQHA 3NGDA 4JB3A 3ISBA 3EZ5A 4XQ8A 1GO3F 2NRXA 2F1HA 4B9UA 1Z19A 3GILA 4X4SA 2LHTA 2YMPA 3AUOA 8ICCA 4US9A 5AI9A 3KHHA 5DECA 5AIBA 4DOBA 1VDVA 5CRXA 4EYIB 1TAMA 3RJFA 4P0PB 3V6HA 3PY8A 1NK7A 3SI8A 3G6XA 4KN4A 3KD3A 1DGSA 3EUB2 3OPXA 2FMQA 3BQTA 2A19A 3WK9A 5BOMA 3PW7A 2IMWP 3AQFA 3TI0A 5J2KA 2R8GA 3M9MB 3T5KA 1DK2A 4UB3A 3NKUA 1NK0A 3N4MB 3ZD9A 3O0FA 2PFPA 3ED5A 3L3FX 5KFOA 4QZBA 3SQIA 5HREA 5G5HA 1IXRA 2ZH5A 2LM1A 1Q3UA 1NK6A 4F5NA 7ICTA 4FO1A 3OUYB 2ZH8A 2ZH4A 1TFRA 2HVIA 2ZHAA 2UVUA 1NO5A 5AI4A 2HBMA 3TAPA 3OVAA 2FE9A 4DF8A 4I2CA 4XA5A 2MRLA 2G08A 4QZEA 1VFGA 1NKCA 2HBKA 2OCEA 3D6JA 2ZH6A 2H3FA 2UVWA 4OAIZ 1ZQBA 2AJQA 1ZQIA 4I2GA 5HMMA 2FCLA 4QZCA 4DL5A 4I29A 1L8LA 1F5AA 2KTQA 1L7MA 3SAHA 2JH7A 3UMBA 2EQYA 3NRWA 4IRCA 1RYSA 2M9NA 2HOQA 1JALA 2KD1A 3UPSA 4WC3A 3AU6A 4PGQA 1FA0A 2IOHA 1QSSA 1AQ6A 2KKVA 2MA1A 4EEYA 1NZBA 5EE1A 2RQ5A 4RQ7A 2KSOA 4DL7A 2HN2A 2KVCA 4C4TA 2C2RA 4KMUA 4MF2A 5GTHU 2ATLA 3LWMA 1ZRNA 3KTQA 3TADA 3HX0A 4Y2XA 4IR9A 1QQ6A 3H0LB 2MSNA 2XO7A 4TUSA 5KFGA 7ICMA 3RB0A 3BQ2A 4JWMA 5ALZA 1N5XA 2Y1IA 1FFUA 2CXYA 3GFKB 3WKCA 2FI1A 3C66A 1ZJMA 4J9PA 5F9NA 2MU2A 4K4IA 1QCKA 4EBCA 3PX0A 2KN7A 3RBEA 3M9NB 3C2KA 4P0PA 3WU2U 4KTQA 8ICUA 4Z6EA 4WC2A 4OCZA 4O3SA 4C8NA 4UD5A 4RT2A 4PHDA 9ICCA 2AHOB 4Y2SA 1RYRA 4QZHA 2QLTA 5J0SA 2EAPA 3WK6A 1U48A 3HIYA 5GTIU 1ZQ1C 5J0RA 4DQRA 1F0MA 2Q66A 4X4QA 3IM1A 3MDCA 4CGZA 1KFDA 7ICGA 2OWOA 3GZFA 3M1YA 2DR9A 3UMGA 5KT2A 2CN1A 5ALOA 5JUMA 8ICGA 5ALTA 1A6SA 3CP8A 2ISOA 4F4XA 2YTUA 2KZZA 1NK8A 3OUYA 3VC8A 4ELTA 2BCRA 2AQ4A 1NJWA 4WC0A 8ICTA 3OVSA 3IRUA 3BDPA 8ICHA 3OHAA 8ICBA 3BS7A 1ZQAA 1R89A 2AGPA 2AQ0A 4EP7A 3ZDBA 1WWVA 1PUZA 4GXJA 1JAJA 1SB3C 2KZ3A 4FZNA 2JRZA 1T4GA 4KLSA 1CI4A 2JEGA 1Z3EB 2NRKA 4YD1A 4R64A 3I76A 4F2SA 4QZDA 4X4RA 2LMRA 4G3IA 5AM0A 4CNQA 3H4DA 3MGIA 4UAWA 3L4PA 4F4WA 3QZ8A 3AQMA 2EZYA 2CPRA 3RH6A 1AROP 2JXJA 1DGJA 2HDOA 3ORYA 4KLMA 4Z6FA 4DLEA 1UPHA 3Q8QB 3MR3A 5KFMA 1WUDA 3FYHA 4DO9A 4DLGA 3D2QA 2F8LA 1BGXT 3Q8RB 5ALXA 4WC1A 4QNLA 1KDHA 3PSTA 1ZQOA 2XCAA 3AU2A 8ICJA 2JR5A 2ZUDA 1L7PA 4O0IA 5EOZA 2KNJA 4WOYA 2MUTB 2WF5A 3WFRE 1FEZA 4WC5A 2ZUCA 7ICHA 3SYZA 2B6GA 4OJPA 5AKJA 3PMLA 8ICNA 1U9LA 3FDSA 5J2JA 5DG7A 2YN4A 3MBYA 2OXOA 1SXDA 9ICNA 3RF9A 2VA2A 1S10A 4JV0A 2VA3A 4PH5A 3NASA 2ZIUB 2W3SA 3KFUF 2P66A 1PVQA 2V9WA 2ZUBA 4QZGA 2NYVA 2M2VA 2LYBA 1DK3A 5KFQA 2W8KA 5J8YC 1NJXA 8ICKA 2HHWA 4OJ5A 1SKWA 3HPOA 4M04A 5HNKA 5KG1A 4BDPA 9ICFA 5AKXA 4NXZA 3ALRA 4X5VA 5IIJA 2R8KA 3MGVA 1PK1B 4KX3A 1N5WA 3NRZA 4AYBF 4DFDA 2W9CB 1K1QA 4O5CA 1SIJA 4UB6U 5JU5A 4NXWA 4J9QA 2W9BB 2KHQA 4YCXA 2I9GA 5AI0A 4EBKA 2HSZA 1ZQDA 3PZPA 4UBCA 3EYZA 1X6IA 4RNNA 4PGXA 5ALMA 4EX6A 5CFUA 5KAIU 4PPXA 5H2FU 4WQKA 2HHXA 3OJSA 2NO5A 3NVWA 4ECUA 3E2EA 1XNSA 5CR0A 4O3RA 4ECVA 1RQNA 2EAOA 4F71A 2EWRA 2W9AA 3C5GA 4DS5A 2B56A 2IA6A 4DWIA 5J29A 3S6JA 8ICSA 2BCVA 1TV9A 1R8CA 3T5LA 1WCNA 2K4PA 2BDUA 3GU3A 2AGQA 3CW2C 1RYUA 4MFFA 2BHNA 3MR5A 2BPFA 2OEHA 4RQ6A 3IV6A 3RJJA 1L8OA 1KBUA 1V4AA 4DS4A 2NRVA 4I2BA 1UT5A 1Z00B 2YMLA 2VIXA 5ALGA 4KLHA 4JV1A 1ZD2P 4MF8A 2K89A 1ZQGA 3HRDD 1JN3A 3T3FA 2M2TA 2DKZA 4UB2A 3WKDA 1QTMA 2ZIXB 2ODGA 2MUTA 3KHRA 4WC7A 1V85A 4R63A 2FMPA 2HMXA 4IL6U 3PV8A 1MIWA 4J03A 2RDJA 3UPQA 4EZ6A 4M2YA 4YG2A 5J0QA 2OYYA 5L1IA 1B0XA 4OAHA 2D8CA 4FHPA 2HHQA 4YR3A 3GV8B 4AT8B 3MR2A 4QZ9A 3QU9A 3BQ1A 3OV7A 1ED1A 3V7KA 4BWJA 1T3QA 2ZIUA 1QQ5A 2YX8A 3CNHA 5J2AA 4O3NA 2I1QA 2RFFA 4UAZA 3NVVA 2IHNA 1SV0C 1X66A 2W55A 4X4UA 1UHUA 3FC4A 4J9KA 5C5JA 4E0DA 4ECRA 4Y2RA 3AQLA 4KM5A 4KLEA 3WFOA 5ALSA 1X9XA 3H8JA 1IIPA 4K99A 4UBBA 4QWEA 2ZXHA 3M6ZA 5AK5A 3RAXA 4GLXA 3TARA 2G5IB 3H40A 4X4TA 9ICGA 1PK1A 1ZD3A 4QIWF 4XUSA 3OJUA 2B0CA 4YR2A 4FBTA 2W9CA 4EENA 1N56A 4Q45A 1ZQRA 2PKEA 2O1PA 5DB7A 3TACB 3RB3A 3G6YA 4Y2UA 2W9BA 2DR7A 3NTUA 4RUCA 9ICEA 3ZDAA 3JPQA 4IRDA 2JEFA 5AI5A 2FPKA 2PI4A 4CE6A 1COKA 5DBBA 2KJ8A 2ZJ8A 2LBOA 1Z1BA 1KFTA 1TK0A 2C22A 3EWAA 3L5KA 5ALNA 4TUPA 1PX5A 3C2LA 3LK9A 2WAQF 9ICBA 5HRFA 4FH3A 5ALEA 1ZOLA 5L1LA 2YMQA 3T79A 1DOQA 2HOIA 2BPCA 2KG5A 3AL0B 5TISU 3SD7A 3F2BA 5DB6A 2GH1A 5DQGA 4P2HA 5KT4A 7ICEA 4NKTA 4GC7A 5KFEA 1BPXA 5DDYA 3RJHA 2E8PA 3ZI4A 5HRKA 7ICKA 3N97B 2BZFA 2J6TA 2WHEA 5E79U 1L3SA 4WBYA 4O69A 4RPXA 2W7PA 3T5JA 3TFSA 3AN1A 2KFNA 3IP4B 2BKEA 1Z00A 3JPOA 3QU7A 2P35A 4RPZA 1WG8A 2KICA 1UA1A 4RQ4A 1N63A 3OHBA 2DGZA 1JROA 2WF9A 2W11A 4IG8A 1VJ5A 2JHDA 1T3NA 2ZIXA 4P4OA 1ZYQA 3H7IA 4E7XA 2QB1A 3GV5B 2DR5A 3KHLA 3QUQA 1U45A 5KT6A 9ICVA 3MABA 4JMUA 8ICPA 1SKSA 3H8MA 2DWQA 4AT8A 5J2BA 4DSKA 4Y2JA 4EEDA 2PI5A 4ECWA 2KJ9A 1UA0A 4XRHA 4DFJA 1SWVA 5L1MA 4RQ2A 3OSPA 2K8AA 2M2UA 3Q8PB 3JPPA 1SZPA 1N61A 1UETA 1Q3VA 2DPIA 4RQMA 5J8YA 4FBUA 2K4EA 4X4OA 3QU5A 2XGPA 1NZPA 4Y2TA 2WTFA 2DUYA 5C0YA 5J0TA 5KFFA 3NWIA 5F3XB 1XSLA 1BPYA 5EE0A 4MKPA 3SENA 2HI0A 4Q8FA 9ICSA 2C2DA 1D8BA 1C7YA 3SEIA 4NLNA 3A0HU 5J2FA 8ICIA 4YVZA 4J9OA 3V72A 2HHPA 2A1AA 1MIYA 4DSEA 2BQ3A 4MFCA 4JK1A 5KNIA 4Q8EA 2L5YA 2ZH3A 2RDIA 4X0BA 7ICIA 3PMNA 4ED0A 3HILA 3WK8A 4NXUA 5EE9A 3CYMA 3EPGA 4RWNA 1MA7A 2EAMA 4ECXA 2WB1F 2DVIA 2KFZA 4NJ8A 4WQLA 1UT8A 4JLZA 2ZTCA 1TFYA 4RU9A 2KJ5A 3KZXA 1B43A 1LV5A 1S0OA 2ZG6A 4KLJA 4KLLA 5KG7A 4LEVA 5D49A 1RG6A 2DFLA 2KVSA 1ZQEA 4F3OA 1A76A 4LZDA 3TFRA 5AM1A 3PX4A 4QW8A 2AH5A 2KMDA 4WCWA 4MEXA 2G07A 4IQUA 2Y1JA 2FLPA 7ICPA 2H3IA 3C29A 3AQKA 3THVA 5K4LA 3ETLA 5CFTA 3H8WA 3UQ0A 2EDUA 3RB4A 4NXTA 3HKZF 2ZTDA 3SV3A 4K96A 4X4VA 3QE9Y 1RQLA 1JRPA 3A0BU 4PL1A 5B66U 4MEYA 2BQRA 4RQ5A 4JWNA 2WF6A 8ICQA 1SZHA 5J0UA 4KLGA 3F5AA 4QWBA 5JTIA 5AK3A 3HJ4A 2GOLA 4C8MA 3HP6A 2KZMA 4FHVA 5CHEA 1B22A 3CK6A 5HMLA 4J9RA 4M9LA 2OH2A 2YMMA 1LKYB 5B3PA 4N7RA 1SV0A 3B9JA 4M5DA 3RFAA 5DLGA 4XJEA 4EYHB 3ZDDA 3PW4A 3QYPA 3UQ2A 4O3OA 4RT3A 4GIBA 3ZDCA 4KLDA 4DSFA 4B9VA 4YQWA 2KP7A 5KG6A 4JV2A 3QNMA 4O9MA 4YD2A 8ICOA 2ASJA 4K98A 1NJYA 1T7PA 4B9SA 2GO7A 3RH4A 2PMZF 1A0PA 3RBDA 2E8MA 3GDXA 3OSNA 2E8NA 4R66A 1H38A 4BGDA 1YT3A 3KZIU 4WBZA 3H0MB 1F44A 2UVRA 4J9MA 3TAQA 5KTQA 2KE7A 1UEUA 5J0XA 5JTGA 3QX7A 1SXEA 2W04A 4DFKA 1S0VA 2JV3A 4UD4A 4ECQA 2CRXA 2XGQA 5AM3A 2I5HA 1S9FA 2W8LA 4HX0A 4NL9C 4DSIA 4EBEA 3Q8KA 2JH1A 5KFRA 2JEJA 3JPNA 2J6UA 5CP2A 4O68A 1K5OA 5KG3A 1KRPA 4CCHA 3ZD8A 3BS5B 5ALJA 5J0WA 2FDRA 4Y2YA 2Y9TA 2ZXIA 5KFKA 5KG5A 4KLIA 3QXGA 1MIVA 1J2NA 4WC4A 4DF4A 5A0LA 1KN5A 1YZ6A 9ICJA 2ZH9A 3QEBZ 2RLTA 3QUTA 9ICXA 1JXEA 3Q8SB 1B4FA 4PZOA 5EWFA 4U6PA 2WF8A 5AKZA 2HCFA 4CF5A 3NVZA 3V7JA 4LZGA 4PHAA 3KOOA 1UEVA 5J2CA 3PR5B 4O3QA 5AKHA 9ICRA 1N62A 4RPYA 1OUQA 1L3VA 5KFVA 3TANA 2H5XA 4I2FA 5CJ7A 2HHUA 4C4RA 4GFJA 4RWQA 3VCBA 2PFOA 4FH5A 1HUZA 4YMMA 3EPIA 3QEAZ 4B9TA 2FJ6A 2DR8A 1LVHA 2ASDA 2RRDA 2EZXA 3M9OB 4DOAA 1S0NA 4IR1A 2W9MA 5KG0A 3PSFA 4PHEA 5KT5A 4UB5A 1LKYA 4I2AA 5CEHA 1FFVA 1ZQZA 5J2IA 7ICUA 1ECWA 2NV3A 8ICMA 4NY8A 4RQ1A 1ZRMA 2JZBB 2P6UA 4RQNA 3H0RB 5EWGA 4K9AA 2BE3A 2XCPA 4RQ3A 3GQCA 5HRLA 4QJFB 5L1KA 5D62A 1X6JA 3WFSC 2AXTU 1QLNA 1MQ3A 1Z4OA 1T94A 3IN5A 1PZNA 4YFKA 2YB4A 3NUQA 5BOLA 5KFNA 4K8VA 3H38A 3DDHA 3MDAA 4KMOB 1UQVA 4GXIA 3UXNA 1XO1A 5J0YA 2KIWA 2XC9A 4GXKA 4OJOA 3JCFA 2W03A 2V4QA 4K4GA 1MC8A 3LYSA 4PHPA 4YMOA 5IILA 2G0AA 2VANA 3BZKA 4I28A 1WCLA 3JPSA 1FO4A 5ALKA 4NM1A 2OHFA 9ICOA 1MN8A 1SWWA 1J97A 4ED2A 3AMZA 1ZQCA 3UXOA 4C4SA 2XY7A 4EX7A 3F2CA 3WKAA 3LVVA 4AT9B 4XQ7A 3C23A 1TAQA 4DQPA 2Q4TA 1ZQLA 5ALPA 2R8IA 5KL8B 4DL2A 4DFMA 3BS5A 1HJPA 4ECZA 3RJKA 4ECTA 7ICSA 2HW3A 4WC6A 4B6JA 1V97A 4LVSA 4KX5A 4ELUA 1YLQA 3WKEA 3Q8LA 5ALUA 2ZJAA 3GIMA 4P4MA 3DEEA 5DQIA 1BNPA 1KSPA 4LEYA 2B51A 2C2EA 2PMZC 4F2RA 5CWRA 4EGWA 2KIVA 3QU4A 4OAFA 4JUZA 1SL2A 5AIAA 2ISPA 1UCVA 4HAIA 5CA7A 4IC9A 5KFPA 5KFUA 3RRGA 1IV8A 7ICOA 2R8JA 3UMCA 2QARB 4EBDA 2LPEA 1U47A 4F5PA 2IHOA 1D9FA 4ECYA 1LB2B 2ZIVB 1KNYA 4FS2A 4G9BA 4YMNA 2KV2A 1ZQNA 5KFJA 5EWEA 5HRDA 7ICQA 3MGHA 4C0ZA 3K4GA 3C21A 3F5EA 2XI9A 4WJ3B 3AQEA 4NXVA 4FHWA 3LVWA 4Y2PA 2E5SA 4NLBA 2E8OA 5KFYA 1L3UA 5DB8A 5T14A 4RNMA 2M0NA 1QSLA 2JZBA 2F1IA 1XO0A 2N1RA 4RWPA 5HRBA 4FHXA 8ICLA 2H3ZA 5AM2A 5ALWA 4RQ8A 5L1JA 4NXXA 2ZHBA 1RDFA 3BQ0A 1MQ2A 2GA9D 3LQCB 2HHSA 2IBKA 3JPRA 2J6SA 1S76D 4ATBB 5ALYA 4B9MA 3ISDA 4WH5A 1TE2A 8ICVA 3RR7A 2JMGA 3H8SA 4F4KA 1EXNA 1KW4A 4IQTA 1OXJA 3GV7B 2AGOA 5EE3A 2MAXA 3PSPA 4FFDA 1Z4NA 1PVPA 3B0XA 1TK5A 2BCUA 4ECSA 2LYAA 2GWSA 2E1FA 8ICZA 5AKLA 4DQIA 3AEVA 2F76X 1IM4A 5KT7A 4TQSA 1L3TA 8ICFA 2E3TA 9ICIA 5IINA 4DFPA 3C1ZA 4AT9A 4AYBC 3UM9A 3D2NA 4NL9A 2BCSA 5DLFA 1ZQYA 2QB0B 1RPLA 3LDAA 2ZH7A 5BPCA 1ZD4A 1N48A 5KFTA 5HRGA 5HR6A 4E80A 3R9KA 4DL4A 5ALIA 4IRKA 3GIIA 4ED1A 1TAUA 1NK9A 3QU2A 5AKYA 8ICRA 2QKQA 4NV0A 1ZQTA 2EANA 4EEKA 3RJEA 4CDGA 4I2IA 3OTQA 1QSYA 3SR6A 4RQ0A 5L9XA 1URJA 1A77A
chains in the Genus database with same CATH topology
4QWDA 4JV0A 1NKEA 5HRHA 1XSPA 4DL3A 2VA3A 4MEYA 2BQRA 1ZQMA 4PH5A 4RQ5A 4YXJA 4JWNA 2ALZA 3PW2A 3HT3A 3GIKA 8ICQA 1TVAA 5J0UA 3T5HA 4KLGA 2P66A 1JXLA 2V9WA 4KLTA 2ZUBA 2PBEA 4QWBA 5CHGA 8ICWA 4QZGA 4KN7A 3HJ4A 4IQWA 2AU0A 4C8MA 4I2DA 3HP6A 4RNOA 3PX6A 1ZQPA 2KZMA 7ICVA 5KFQA 1DK3A 2M2VA 1B22A 2W8KA 5HMLA 4J9RA 5HP4A 1NJXA 8ICKA 4M9LA 1MSWD 4I2HA 2HHWA 1SKWA 3HPOA 3MFHA 1SKRA 5KFZA 4M04A 4ED7A 5HNKA 5KG1A 4BDPA 9ICFA 1JQRA 2HVHA 3M8RA 4NXZA 2ZTEA 4BWMA 2BR0A 5DBAA 4X5VA 3NYBA 5IIJA 3PW0A 2R8KA 4M0AA 4M5DA 1R8AA 3HJ1A 5DLGA 4F92B 4KLQA 4DL6A 4M47A 4EYHB 3ZDDA 1TFWA 2FPMA 3PW4A 2PFNA 4RUAA 1RXWA 3UQ2A 3K75D 4O3OA 2W9CB 4DSLA 9ICPA 1K1QA 4RT3A 4O5CA 3H37A 9ICHA 3ZDCA 4KLDA 1ZQQA 4DSFA 4B9VA 1SL1A 4YQWA 4J9QA 1S0MA 5KG6A 4JV2A 4MFAA 1X2IA 2W9BB 3BJYA 2KP7A 4YCXA 4O9MA 5HR9A 4YD2A 3PVXA 2I9GA 1D8LA 1JX4A 2ASJA 3SV4A 1NK5A 5KFLA 4EZ9A 5DKWA 8ICOA 3WFPA 1U49A 8ICXA 3H4BA 1NJYA 4EBKA 1T7PA 4B9SA 1ZQDA 5HC9A 4UBCA 4Q44A 3EYZA 3GIJA 4RNNA 4DQQA 3RH4A 3L9DA 3JPTA 3RBDA 4PGXA 4QWCA 5IIOA 3GDXA 3OSNA 3Q8MA 3OVBA 3QZ7A 4R66A 1H38A 4PPXA 4BGDA 2HHXA 1Q79A 3JYYA 4ATBA 5HHIA 4QWAA 1Y88A 2R8HA 1XC9A 4WBZA 2DRAA 5KFIA 3OJSA 9ICLA 4IQVA 4X0BA 5DBCA 4F4YA 4PGYA 3MR6A 4ECUA 2UVRA 4O5EA 4J9MA 3TAQA 4FHYA 3E2EA 1CUKA 3IHQB 5KTQA 4ED6A 1UEUA 5CR0A 5J2GA 5J0XA 4AT8B 2V4RA 1U4BA 4TUQA 4P4PA 4O3RA 4ECVA 7ICNA 4ZH4A 4DFKA 2P6RA 2BDPA 4C8KA 1S0VA 4F50A 4ECQA 4UD4A 4YN4A 1NK4A 2XGQA 3B0YA 2W9AA 3C5GA 4DS5A 1L5UA 5KFAA 4ED8A 1T8EA 2IA6A 5J29A 1ZQHA 1BPDA 4DWIA 4I27A 8ICSA 2BCVA 1S9FA 2W8LA 2NRTA 1TV9A 1R8CA 4I2JA 4DSIA 4EBEA 3Q8KA 3T5LA 1WCNA 7ICLA 1D8YA 5KFRA 2JEJA 4FO6A 5DG9A 5DB9A 1KTQA 3JPNA 2AGQA 3PR4A 2J6UA 4X0AA 4KITB 4MFFA 5KFXA 5CP2A 2BCQA 2BHNA 5KT3A 2ZJ5A 3PW5A 3MR5A 2BPFA 5KG3A 1KRPA 2JEIA 4RQ6A 3V7LA 2C28A 4CCHA 3ZD8A 5HRIA 1UETA 3RJJA 4YP3A 5J0WA 2IHMA 4AT7B 3KHGA 4RWOA 4J9LA 4C8LA 1V4AA 4EBJA 4F5RA 5KFKA 1JIHA 4DS4A 2HHTA 1BPZA 9ICUA 2NRVA 5KG5A 4I2BA 3OGUA 4KLIA 1UT5A 3V6JA 1MIVA 1Z00B 4J9NA 2BQUA 2XY5A 2ZH1A 1D9DA 1X9SA 3ISCA 4WC4A 4DF4A 1SL0A 4KLHA 4JV1A 4MF8A 3TQ1A 5KFHA 4S3NA 4Z6DA 5DQHA 9ICJA 2ID1A 3NGDA 2FLNA 1ZQGA 2VA8A 1TKDA 2ZH9A 1JN3A 3ISBA 3EZ5A 4XQ8A 3T3FA 3QEBZ 5J0PA 9ICXA 4UB2A 2M2TA 2NRXA 1JXEA 3Q8SB 2F1HA 1QTMA 4B9UA 3GILA 4X4SA 2MUTA 3KHRA 4WC7A 4R63A 2FMPA 5EWFA 3AUOA 8ICCA 3KHHA 3PV8A 4M6WB 5DECA 1MIWA 4DOBA 2RDJA 3UPQA 4EZ6A 4M2YA 4YG2A 4EYIB 5KFCA 4LZGA 5J0QA 3V7JA 4PHAA 3RJFA 5L1IA 3V6HA 3PY8A 1UEVA 5J2CA 3PR5B 4FHPA 4O3QA 1VJ7A 1NK7A 2NRWA 3RJIA 2HHQA 3SI8A 9ICRA 4YR3A 4RPYA 1L3VA 3G6XA 5KFVA 3TANA 2H5XA 4KN4A 5CJ7A 1V9PA 3GV8B 3MR2A 4I2FA 4QZ9A 2HHUA 1DGSA 2B21A 3BQ1A 4RWQA 3OV7A 9ICTA 2PFOA 3V7KA 4BWJA 3RTVA 4FH5A 2FMQA 4M9JA 5J2AA 1HUZA 4YMMA 4O3NA 2I1QA 3BQTA 3EPIA 3QEAZ 3RJGA 4B9TA 5J2EA 2RFFA 2LYHA 2DR8A 5BOMA 4UAZA 3M8SA 3PW7A 2ASDA 2IHNA 2IMWP 4X4UA 3M9OB 3TI0A 5J2KA 4DOAA 2R8GA 4J9KA 5C5JA 1ZQXA 3M9MB 1S0NA 4E0DA 4ECRA 1ZQVA 4C8OA 4IR1A 2ASLA 3T5KA 4TQRA 1DK2A 8ICEA 2W9MA 3EW9A 5KG0A 4UB3A 4DOCA 3AQLA 1S77D 4KLEA 1NKBA 5IIKA 4PHEA 5KT5A 4UB5A 1NK0A 4K4HA 3WFOA 3C2MA 3H8JA 3N4MB 4I2AA 8ICAA 3ZD9A 1XU4A 2PFPA 3WFQE 1S97A 1ZQZA 4UBBA 4QWEA 5J2IA 7ICUA 5KFOA 4QZBA 5HREA 8ICMA 4NY8A 1IXRA 4RQ1A 4GLXA 2JZBB 3PNCA 3TARA 3RAXA 2P6UA 2ZH5A 2UVVA 5EWGA 3H40A 2DRBA 2BE3A 4X4TA 2XCPA 1NK6A 4F5NA 9ICGA 4KLOA 7ICTA 3OUYB 2ZH8A 2ZH4A 4RQ3A 1TFRA 3GQCA 2O5AA 4XUSA 2HVIA 4F5QA 3OJUA 5HRLA 4YR2A 2ZHAA 2UVUA 3ZDEA 4FBTA 2W9CA 5L1KA 1N56A 1NO5A 4Q45A 3TAPA 1ZQRA 3OVAA 3PO5A 2O1PA 1JMSA 5DB7A 4DF8A 4I2CA 4XA5A 3RB3A 3G6YA 3WFSC 9ICAA 4I2EA 2W9BA 1QLNA 3AQNA 1MQ3A 4QZEA 4R8UB 2DPJA 1VFGA 2DR7A 1PZNA 3NTUA 1NKCA 2F1JA 4YFKA 4RUCA 1HUOA 9ICEA 5BOLA 2ZH6A 2UVWA 5KFNA 3H38A 3MDAA 3RH5A 1ZQBA 3ZDAA 3JPQA 4IRDA 5F2VO 4GXIA 2JEFA 2AJQA 3UXNA 1XO1A 5J0YA 2XC9A 4GXKA 5HMMA 2FPKA 1ZQIA 4QZCA 2PI4A 4I2GA 4DL5A 3C1YA 2V4QA 4K4GA 8ICYA 4I29A 1COOA 1MC8A 4PHPA 5DBBA 1KFTA 2ZJ8A 4YMOA 1TK0A 2C22A 3EWAA 1WOTA 5IILA 4FHVA 2VANA 4TUPA 5IIMA 5KG4A 4B9NA 4I28A 1F5AA 2KTQA 1PX5A 3C18A 1WCLA 3JPSA 3C2LA 1BNOA 3LK9A 5DGBA 9ICBA 5DDMA 3RR8A 4NM1A 5HRFA 4FH3A 5L1LA 1BPBA 9ICOA 4IRCA 1RYSA 2M9NA 7ICRA 1R8BA 4J9SA 4ED2A 4WC3A 3UPSA 5TZVA 3AU6A 4PGQA 1DOQA 3C5FA 1FA0A 1ZQCA 1QSSA 4O3PA 5KG2A 3UXOA 4DEZA 2XY7A 2BPCA 4EEYA 2FLLA 5KFBA 4UB1A 4RQ7A 4BXOA 4AT9B 5DB6A 4DL7A 4P2HA 5DQGA 3C23A 7ICFA 1TAQA 5KT4A 7ICEA 5D4BA 4XQ7A 4DQPA 4F4ZA 4NKTA 2A1JB 4GC7A 5KFEA 1ZQLA 2C2RA 4QZAA 1BPXA 2R8IA 5DDYA 4KMUA 3RJHA 4DL2A 4MF2A 4DFMA 2ATLA 3LWMA 4QW9A 1HJPA 5KFDA 2FMSA 4AT7A 5HRKA 4ECZA 7ICKA 3RJKA 4ECTA 3N97B 3H3AA 2J6TA 7ICSA 1L3SA 4UB4A 3KTQA 3RAQA 2HW3A 4RPXA 4WBYA 3HX0A 3T5JA 3TFSA 2XY6A 2KFNA 4BXOB 2BKEA 2M2WA 4WC6A 1Z00A 4IR9A 3JPOA 1ZQKA 4RPZA 2XO7A 4TUSA 4QZ8A 5IIIA 4LVSA 5KFGA 7ICMA 1UA1A 3RB0A 4ELUA 4NM2A 3BQ2A 4RQ4A 3OHBA 4JWMA 1YLQA 2Y1IA 3Q8LA 2ZJAA 3GIMA 4P4MA 4KLFA 5DQIA 1BNPA 4IG8A 3GFKB 1T3NA 1KSPA 4P4OA 2C2EA 1ZYQA 3H7IA 5CB1A 4F2RA 3C66A 5CWRA 1ZJMA 4E7XA 4M6WA 4JUZA 3GV5B 4J9PA 5F9NA 1SL2A 4K4IA 2DR5A 3KHLA 1U45A 5KT6A 1OU5A 4EBCA 1RXVA 3PX0A 2KN7A 3RBEA 3M9NB 3C2KA 2ISPA 2FPLA 9ICVA 4KTQA 8ICUA 3MABA 4Z6EA 5CA7A 5KFPA 3HW8A 4RZRA 8ICPA 4WC2A 4M9NA 5KFUA 1SKSA 3RRGA 4O3SA 5D46A 7ICOA 4C8NA 2R8JA 4RT2A 4UD5A 4AT8A 5J2BA 4DSKA 4PHDA 4EBDA 1U47A 4F5PA 2PI5A 2ZH2A 9ICCA 4ECWA 1UA0A 1D9FA 4ECYA 4XRHA 4DFJA 1RYRA 1LB2B 1KNYA 4YXMA 3UXPA 4FS2A 4QZHA 4YMNA 4RQ2A 5J2DA 5J0SA 4UQGA 3MFIA 1U48A 1ZQNA 5KFJA 5J0OA 4M9HA 5EWEA 3OSPA 5HRDA 7ICQA 2M2UA 3HIYA 3Q8PB 3JPPA 3MGHA 1SZPA 5J0RA 3K4GA 4DQRA 1RZTA 4F8RA 4F93B 4NLGA 3C21A 2Q66A 4X4QA 1ZQFA 1TK8A 3IM1A 3MDCA 2DPIA 1KFDA 7ICGA 1ZQJA 2OWOA 1ZQUA 2BGWA 4FHWA 2Q0ZX 2DR9A 5KT2A 4QZIA 4FBUA 4X4OA 3H39A 2XGPA 1NZPA 5JUMA 8ICGA 5KFYA 2WTFA 3PO4A 1L3UA 5DB8A 4RNMA 5J0TA 5KFFA 1QSLA 1X9MA 2JZBA 2F1IA 1XSLA 1BPYA 2ISOA 4F4XA 2KZZA 1NK8A 3OUYA 4Q8FA 9ICSA 4RWPA 2C2DA 5HRBA 4FHXA 8ICLA 4ELTA 4FS1A 1C7YA 2BCRA 4F91B 2AQ4A 3G6VA 4NLNA 1NJWA 4WC0A 8ICTA 5J2FA 4RQ8A 2PXIA 1ZQSA 5L1JA 3BDPA 4ELVA 8ICHA 3OVSA 4E8FA 1ZETA 3OHAA 3BQ0A 1MQ2A 2BPGA 8ICBA 4YVZA 8ICIA 2ZHBA 4J9OA 3V72A 1ZQAA 3LQCB 1R89A 2HHPA 4B9LA 2HHSA 4R65A 2AGPA 2IBKA 3JPRA 2AQ0A 1MIYA 4DSEA 4YR0A 2J6SA 1S76D 4TURA 4EP7A 9ICMA 1KLNA 1Q78A 4R8UA 3ZDBA 4ATBB 2BQ3A 4B9MA 1CEZA 3ISDA 3RB6A 4MFCA 4GXJA 3RRHA 1JAJA 4JK1A 8ICVA 4QZFA 3RR7A 2KZ3A 4LT6A 4Q8EA 1T4GA 3H8SA 4F4KA 1EXNA 4KLSA 2ZH3A 2RDIA 4IQTA 1Z3EB 3GV7B 1BPEA 3PMNA 2AGOA 2JEGA 4YD1A 4R64A 7ICIA 2NRKA 2MAXA 4ED0A 1ZQWA 1XS9D 4F2SA 4NLKA 9ICQA 4QZDA 4X4RA 4G3IA 3B0XA 1TK5A 2BCUA 4ECSA 5KFWA 3H4DA 3MGIA 3EPGA 4RWNA 4DSJA 2GWSA 4UAWA 4F4WA 3QZ8A 5KFSA 8ICZA 4ECXA 4DQIA 3AQMA 2DVIA 3V6KA 2KFZA 1XWLA 1UT8A 1IM4A 1AROP 3RH6A 2ZTCA 5KT7A 4NKUA 1TFYA 4TQSA 1L3TA 4RU9A 8ICFA 1NJZA 4Q43A 1B43A 1LV5A 3ORYA 1S0OA 9ICIA 4O5KA 4KLJA 4KLLA 4KLMA 5IINA 4DFPA 5KG7A 4Z6FA 3C1ZA 4DLEA 5DGAA 4AT9A 4X4NA 3Q8QB 3MR3A 5KFMA 4M9GA 3FYHA 2BCSA 5D49A 5DLFA 4DO9A 1ZJNA 2A1JA 1ZQYA 2DFLA 3LWLA 4GC6A 4DLGA 9ICKA 1BGXT 1RPLA 3LDAA 3Q8RB 1ZQEA 1A76A 4LZDA 4F3OA 4WC1A 5BPCA 2ZH7A 3TFRA 1N48A 5KFTA 7ICJA 1KDHA 5HRGA 3PX4A 4QW8A 4UAYA 2XCAA 1ZQOA 4E80A 3AU2A 4DQSA 4DL4A 8ICJA 9ICWA 2ZUDA 4X4PA 4O0IA 4WCWA 4HYKA 2PFQA 3GIIA 4ED1A 5EOZA 4Z6CA 1KEJA 4MEXA 4IRKA 1TAUA 1NK9A 8ICRA 4ED3A 2MUTB 4IQUA 2Y1JA 2FLPA 1K1SA 1BVSA 3HWTA 1ZQTA 2ZUCA 4WC5A 3WFRE 7ICHA 5DG8A 7ICPA 3SYZA 2NRZA 1KFSA 3AQKA 3THVA 3ETLA 3SZ2A 3RJEA 5HHHA 3H8WA 4I2IA 3UQ0A 3PMLA 1XSNA 1U9LA 3FDSA 3RB4A 5J2HA 8ICNA 5J2JA 1X9WA 5DEDA 5DG7A 4NLZA 2ZTDA 3SV3A 1QSYA 2HHVA 4X4VA 3QE9Y 4KLUA 4RQ0A 5L9XA 4F5OA 3JZ0A 3MBYA 5F9LA 9ICNA 1NOMA 2VA2A 1A77A 1S10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWD A;  4JV0 A;  1NKE A;  5HRH A;  1XSP A;  4DL3 A;  2VA3 A;  4MEY A;  2BQR A;  1ZQM A;  4PH5 A;  4RQ5 A;  4YXJ A;  4JWN A;  2ALZ A;  3PW2 A;  3HT3 A;  3GIK A;  8ICQ A;  1TVA A;  5J0U A;  3T5H A;  4KLG A;  2P66 A;  1JXL A;  2V9W A;  4KLT A;  2ZUB A;  2PBE A;  4QWB A;  5CHG A;  8ICW A;  4QZG A;  4KN7 A;  3HJ4 A;  4IQW A;  2AU0 A;  4C8M A;  4I2D A;  3HP6 A;  4RNO A;  3PX6 A;  1ZQP A;  2KZM A;  7ICV A;  5KFQ A;  1DK3 A;  2M2V A;  1B22 A;  2W8K A;  5HML A;  4J9R A;  5HP4 A;  1NJX A;  8ICK A;  4M9L A;  1MSW D;  4I2H A;  2HHW A;  1SKW A;  3HPO A;  3MFH A;  1SKR A;  5KFZ A;  4M04 A;  4ED7 A;  5HNK A;  5KG1 A;  4BDP A;  9ICF A;  1JQR A;  2HVH A;  3M8R A;  4NXZ A;  2ZTE A;  4BWM A;  2BR0 A;  5DBA A;  4X5V A;  3NYB A;  5IIJ A;  3PW0 A;  2R8K A;  4M0A A;  4M5D A;  1R8A A;  3HJ1 A;  5DLG A;  4F92 B;  4KLQ A;  4DL6 A;  4M47 A;  4EYH B;  3ZDD A;  1TFW A;  2FPM A;  3PW4 A;  2PFN A;  4RUA A;  1RXW A;  3UQ2 A;  3K75 D;  4O3O A;  2W9C B;  4DSL A;  9ICP A;  1K1Q A;  4RT3 A;  4O5C A;  3H37 A;  9ICH A;  3ZDC A;  4KLD A;  1ZQQ A;  4DSF A;  4B9V A;  1SL1 A;  4YQW A;  4J9Q A;  1S0M A;  5KG6 A;  4JV2 A;  4MFA A;  1X2I A;  2W9B B;  3BJY A;  2KP7 A;  4YCX A;  4O9M A;  5HR9 A;  4YD2 A;  3PVX A;  2I9G A;  1D8L A;  1JX4 A;  2ASJ A;  3SV4 A;  1NK5 A;  5KFL A;  4EZ9 A;  5DKW A;  8ICO A;  3WFP A;  1U49 A;  8ICX A;  3H4B A;  1NJY A;  4EBK A;  1T7P A;  4B9S A;  1ZQD A;  5HC9 A;  4UBC A;  4Q44 A;  3EYZ A;  3GIJ A;  4RNN A;  4DQQ A;  3RH4 A;  3L9D A;  3JPT A;  3RBD A;  4PGX A;  4QWC A;  5IIO A;  3GDX A;  3OSN A;  3Q8M A;  3OVB A;  3QZ7 A;  4R66 A;  1H38 A;  4PPX A;  4BGD A;  2HHX A;  1Q79 A;  3JYY A;  4ATB A;  5HHI A;  4QWA A;  1Y88 A;  2R8H A;  1XC9 A;  4WBZ A;  2DRA A;  5KFI A;  3OJS A;  9ICL A;  4IQV A;  4X0B A;  5DBC A;  4F4Y A;  4PGY A;  3MR6 A;  4ECU A;  2UVR A;  4O5E A;  4J9M A;  3TAQ A;  4FHY A;  3E2E A;  1CUK A;  3IHQ B;  5KTQ A;  4ED6 A;  1UEU A;  5CR0 A;  5J2G A;  5J0X A;  4AT8 B;  2V4R A;  1U4B A;  4TUQ A;  4P4P A;  4O3R A;  4ECV A;  7ICN A;  4ZH4 A;  4DFK A;  2P6R A;  2BDP A;  4C8K A;  1S0V A;  4F50 A;  4ECQ A;  4UD4 A;  4YN4 A;  1NK4 A;  2XGQ A;  3B0Y A;  2W9A A;  3C5G A;  4DS5 A;  1L5U A;  5KFA A;  4ED8 A;  1T8E A;  2IA6 A;  5J29 A;  1ZQH A;  1BPD A;  4DWI A;  4I27 A;  8ICS A;  2BCV A;  1S9F A;  2W8L A;  2NRT A;  1TV9 A;  1R8C A;  4I2J A;  4DSI A;  4EBE A;  3Q8K A;  3T5L A;  1WCN A;  7ICL A;  1D8Y A;  5KFR A;  2JEJ A;  4FO6 A;  5DG9 A;  5DB9 A;  1KTQ A;  3JPN A;  2AGQ A;  3PR4 A;  2J6U A;  4X0A A;  4KIT B;  4MFF A;  5KFX A;  5CP2 A;  2BCQ A;  2BHN A;  5KT3 A;  2ZJ5 A;  3PW5 A;  3MR5 A;  2BPF A;  5KG3 A;  1KRP A;  2JEI A;  4RQ6 A;  3V7L A;  2C28 A;  4CCH A;  3ZD8 A;  5HRI A;  1UET A;  3RJJ A;  4YP3 A;  5J0W A;  2IHM A;  4AT7 B;  3KHG A;  4RWO A;  4J9L A;  4C8L A;  1V4A A;  4EBJ A;  4F5R A;  5KFK A;  1JIH A;  4DS4 A;  2HHT A;  1BPZ A;  9ICU A;  2NRV A;  5KG5 A;  4I2B A;  3OGU A;  4KLI A;  1UT5 A;  3V6J A;  1MIV A;  1Z00 B;  4J9N A;  2BQU A;  2XY5 A;  2ZH1 A;  1D9D A;  1X9S A;  3ISC A;  4WC4 A;  4DF4 A;  1SL0 A;  4KLH A;  4JV1 A;  4MF8 A;  3TQ1 A;  5KFH A;  4S3N A;  4Z6D A;  5DQH A;  9ICJ A;  2ID1 A;  3NGD A;  2FLN A;  1ZQG A;  2VA8 A;  1TKD A;  2ZH9 A;  1JN3 A;  3ISB A;  3EZ5 A;  4XQ8 A;  3T3F A;  3QEB Z;  5J0P A;  9ICX A;  4UB2 A;  2M2T A;  2NRX A;  1JXE A;  3Q8S B;  2F1H A;  1QTM A;  4B9U A;  3GIL A;  4X4S A;  2MUT A;  3KHR A;  4WC7 A;  4R63 A;  2FMP A;  5EWF A;  3AUO A;  8ICC A;  3KHH A;  3PV8 A;  4M6W B;  5DEC A;  1MIW A;  4DOB A;  2RDJ A;  3UPQ A;  4EZ6 A;  4M2Y A;  4YG2 A;  4EYI B;  5KFC A;  4LZG A;  5J0Q A;  3V7J A;  4PHA A;  3RJF A;  5L1I A;  3V6H A;  3PY8 A;  1UEV A;  5J2C A;  3PR5 B;  4FHP A;  4O3Q A;  1VJ7 A;  1NK7 A;  2NRW A;  3RJI A;  2HHQ A;  3SI8 A;  9ICR A;  4YR3 A;  4RPY A;  1L3V A;  3G6X A;  5KFV A;  3TAN A;  2H5X A;  4KN4 A;  5CJ7 A;  1V9P A;  3GV8 B;  3MR2 A;  4I2F A;  4QZ9 A;  2HHU A;  1DGS A;  2B21 A;  3BQ1 A;  4RWQ A;  3OV7 A;  9ICT A;  2PFO A;  3V7K A;  4BWJ A;  3RTV A;  4FH5 A;  2FMQ A;  4M9J A;  5J2A A;  1HUZ A;  4YMM A;  4O3N A;  2I1Q A;  3BQT A;  3EPI A;  3QEA Z;  3RJG A;  4B9T A;  5J2E A;  2RFF A;  2LYH A;  2DR8 A;  5BOM A;  4UAZ A;  3M8S A;  3PW7 A;  2ASD A;  2IHN A;  2IMW P;  4X4U A;  3M9O B;  3TI0 A;  5J2K A;  4DOA A;  2R8G A;  4J9K A;  5C5J A;  1ZQX A;  3M9M B;  1S0N A;  4E0D A;  4ECR A;  1ZQV A;  4C8O A;  4IR1 A;  2ASL A;  3T5K A;  4TQR A;  1DK2 A;  8ICE A;  2W9M A;  3EW9 A;  5KG0 A;  4UB3 A;  4DOC A;  3AQL A;  1S77 D;  4KLE A;  1NKB A;  5IIK A;  4PHE A;  5KT5 A;  4UB5 A;  1NK0 A;  4K4H A;  3WFO A;  3C2M A;  3H8J A;  3N4M B;  4I2A A;  8ICA A;  3ZD9 A;  1XU4 A;  2PFP A;  3WFQ E;  1S97 A;  1ZQZ A;  4UBB A;  4QWE A;  5J2I A;  7ICU A;  5KFO A;  4QZB A;  5HRE A;  8ICM A;  4NY8 A;  1IXR A;  4RQ1 A;  4GLX A;  2JZB B;  3PNC A;  3TAR A;  3RAX A;  2P6U A;  2ZH5 A;  2UVV A;  5EWG A;  3H40 A;  2DRB A;  2BE3 A;  4X4T A;  2XCP A;  1NK6 A;  4F5N A;  9ICG A;  4KLO A;  7ICT A;  3OUY B;  2ZH8 A;  2ZH4 A;  4RQ3 A;  1TFR A;  3GQC A;  2O5A A;  4XUS A;  2HVI A;  4F5Q A;  3OJU A;  5HRL A;  4YR2 A;  2ZHA A;  2UVU A;  3ZDE A;  4FBT A;  2W9C A;  5L1K A;  1N56 A;  1NO5 A;  4Q45 A;  3TAP A;  1ZQR A;  3OVA A;  3PO5 A;  2O1P A;  1JMS A;  5DB7 A;  4DF8 A;  4I2C A;  4XA5 A;  3RB3 A;  3G6Y A;  3WFS C;  9ICA A;  4I2E A;  2W9B A;  1QLN A;  3AQN A;  1MQ3 A;  4QZE A;  4R8U B;  2DPJ A;  1VFG A;  2DR7 A;  1PZN A;  3NTU A;  1NKC A;  2F1J A;  4YFK A;  4RUC A;  1HUO A;  9ICE A;  5BOL A;  2ZH6 A;  2UVW A;  5KFN A;  3H38 A;  3MDA A;  3RH5 A;  1ZQB A;  3ZDA A;  3JPQ A;  4IRD A;  5F2V O;  4GXI A;  2JEF A;  2AJQ A;  3UXN A;  1XO1 A;  5J0Y A;  2XC9 A;  4GXK A;  5HMM A;  2FPK A;  1ZQI A;  4QZC A;  2PI4 A;  4I2G A;  4DL5 A;  3C1Y A;  2V4Q A;  4K4G A;  8ICY A;  4I29 A;  1COO A;  1MC8 A;  4PHP A;  5DBB A;  1KFT A;  2ZJ8 A;  4YMO A;  1TK0 A;  2C22 A;  3EWA A;  1WOT A;  5IIL A;  4FHV A;  2VAN A;  4TUP A;  5IIM A;  5KG4 A;  4B9N A;  4I28 A;  1F5A A;  2KTQ A;  1PX5 A;  3C18 A;  1WCL A;  3JPS A;  3C2L A;  1BNO A;  3LK9 A;  5DGB A;  9ICB A;  5DDM A;  3RR8 A;  4NM1 A;  5HRF A;  4FH3 A;  5L1L A;  1BPB A;  9ICO A;  4IRC A;  1RYS A;  2M9N A;  7ICR A;  1R8B A;  4J9S A;  4ED2 A;  4WC3 A;  3UPS A;  5TZV A;  3AU6 A;  4PGQ A;  1DOQ A;  3C5F A;  1FA0 A;  1ZQC A;  1QSS A;  4O3P A;  5KG2 A;  3UXO A;  4DEZ A;  2XY7 A;  2BPC A;  4EEY A;  2FLL A;  5KFB A;  4UB1 A;  4RQ7 A;  4BXO A;  4AT9 B;  5DB6 A;  4DL7 A;  4P2H A;  5DQG A;  3C23 A;  7ICF A;  1TAQ A;  5KT4 A;  7ICE A;  5D4B A;  4XQ7 A;  4DQP A;  4F4Z A;  4NKT A;  2A1J B;  4GC7 A;  5KFE A;  1ZQL A;  2C2R A;  4QZA A;  1BPX A;  2R8I A;  5DDY A;  4KMU A;  3RJH A;  4DL2 A;  4MF2 A;  4DFM A;  2ATL A;  3LWM A;  4QW9 A;  1HJP A;  5KFD A;  2FMS A;  4AT7 A;  5HRK A;  4ECZ A;  7ICK A;  3RJK A;  4ECT A;  3N97 B;  3H3A A;  2J6T A;  7ICS A;  1L3S A;  4UB4 A;  3KTQ A;  3RAQ A;  2HW3 A;  4RPX A;  4WBY A;  3HX0 A;  3T5J A;  3TFS A;  2XY6 A;  2KFN A;  4BXO B;  2BKE A;  2M2W A;  4WC6 A;  1Z00 A;  4IR9 A;  3JPO A;  1ZQK A;  4RPZ A;  2XO7 A;  4TUS A;  4QZ8 A;  5III A;  4LVS A;  5KFG A;  7ICM A;  1UA1 A;  3RB0 A;  4ELU A;  4NM2 A;  3BQ2 A;  4RQ4 A;  3OHB A;  4JWM A;  1YLQ A;  2Y1I A;  3Q8L A;  2ZJA A;  3GIM A;  4P4M A;  4KLF A;  5DQI A;  1BNP A;  4IG8 A;  3GFK B;  1T3N A;  1KSP A;  4P4O A;  2C2E A;  1ZYQ A;  3H7I A;  5CB1 A;  4F2R A;  3C66 A;  5CWR A;  1ZJM A;  4E7X A;  4M6W A;  4JUZ A;  3GV5 B;  4J9P A;  5F9N A;  1SL2 A;  4K4I A;  2DR5 A;  3KHL A;  1U45 A;  5KT6 A;  1OU5 A;  4EBC A;  1RXV A;  3PX0 A;  2KN7 A;  3RBE A;  3M9N B;  3C2K A;  2ISP A;  2FPL A;  9ICV A;  4KTQ A;  8ICU A;  3MAB A;  4Z6E A;  5CA7 A;  5KFP A;  3HW8 A;  4RZR A;  8ICP A;  4WC2 A;  4M9N A;  5KFU A;  1SKS A;  3RRG A;  4O3S A;  5D46 A;  7ICO A;  4C8N A;  2R8J A;  4RT2 A;  4UD5 A;  4AT8 A;  5J2B A;  4DSK A;  4PHD A;  4EBD A;  1U47 A;  4F5P A;  2PI5 A;  2ZH2 A;  9ICC A;  4ECW A;  1UA0 A;  1D9F A;  4ECY A;  4XRH A;  4DFJ A;  1RYR A;  1LB2 B;  1KNY A;  4YXM A;  3UXP A;  4FS2 A;  4QZH A;  4YMN A;  4RQ2 A;  5J2D A;  5J0S A;  4UQG A;  3MFI A;  1U48 A;  1ZQN A;  5KFJ A;  5J0O A;  4M9H A;  5EWE A;  3OSP A;  5HRD A;  7ICQ A;  2M2U A;  3HIY A;  3Q8P B;  3JPP A;  3MGH A;  1SZP A;  5J0R A;  3K4G A;  4DQR A;  1RZT A;  4F8R A;  4F93 B;  4NLG A;  3C21 A;  2Q66 A;  4X4Q A;  1ZQF A;  1TK8 A;  3IM1 A;  3MDC A;  2DPI A;  1KFD A;  7ICG A;  1ZQJ A;  2OWO A;  1ZQU A;  2BGW A;  4FHW A;  2Q0Z X;  2DR9 A;  5KT2 A;  4QZI A;  4FBU A;  4X4O A;  3H39 A;  2XGP A;  1NZP A;  5JUM A;  8ICG A;  5KFY A;  2WTF A;  3PO4 A;  1L3U A;  5DB8 A;  4RNM A;  5J0T A;  5KFF A;  1QSL A;  1X9M A;  2JZB A;  2F1I A;  1XSL A;  1BPY A;  2ISO A;  4F4X A;  2KZZ A;  1NK8 A;  3OUY A;  4Q8F A;  9ICS A;  4RWP A;  2C2D A;  5HRB A;  4FHX A;  8ICL A;  4ELT A;  4FS1 A;  1C7Y A;  2BCR A;  4F91 B;  2AQ4 A;  3G6V A;  4NLN A;  1NJW A;  4WC0 A;  8ICT A;  5J2F A;  4RQ8 A;  2PXI A;  1ZQS A;  5L1J A;  3BDP A;  4ELV A;  8ICH A;  3OVS A;  4E8F A;  1ZET A;  3OHA A;  3BQ0 A;  1MQ2 A;  2BPG A;  8ICB A;  4YVZ A;  8ICI A;  2ZHB A;  4J9O A;  3V72 A;  1ZQA A;  3LQC B;  1R89 A;  2HHP A;  4B9L A;  2HHS A;  4R65 A;  2AGP A;  2IBK A;  3JPR A;  2AQ0 A;  1MIY A;  4DSE A;  4YR0 A;  2J6S A;  1S76 D;  4TUR A;  4EP7 A;  9ICM A;  1KLN A;  1Q78 A;  4R8U A;  3ZDB A;  4ATB B;  2BQ3 A;  4B9M A;  1CEZ A;  3ISD A;  3RB6 A;  4MFC A;  4GXJ A;  3RRH A;  1JAJ A;  4JK1 A;  8ICV A;  4QZF A;  3RR7 A;  2KZ3 A;  4LT6 A;  4Q8E A;  1T4G A;  3H8S A;  4F4K A;  1EXN A;  4KLS A;  2ZH3 A;  2RDI A;  4IQT A;  1Z3E B;  3GV7 B;  1BPE A;  3PMN A;  2AGO A;  2JEG A;  4YD1 A;  4R64 A;  7ICI A;  2NRK A;  2MAX A;  4ED0 A;  1ZQW A;  1XS9 D;  4F2S A;  4NLK A;  9ICQ A;  4QZD A;  4X4R A;  4G3I A;  3B0X A;  1TK5 A;  2BCU A;  4ECS A;  5KFW A;  3H4D A;  3MGI A;  3EPG A;  4RWN A;  4DSJ A;  2GWS A;  4UAW A;  4F4W A;  3QZ8 A;  5KFS A;  8ICZ A;  4ECX A;  4DQI A;  3AQM A;  2DVI A;  3V6K A;  2KFZ A;  1XWL A;  1UT8 A;  1IM4 A;  1ARO P;  3RH6 A;  2ZTC A;  5KT7 A;  4NKU A;  1TFY A;  4TQS A;  1L3T A;  4RU9 A;  8ICF A;  1NJZ A;  4Q43 A;  1B43 A;  1LV5 A;  3ORY A;  1S0O A;  9ICI A;  4O5K A;  4KLJ A;  4KLL A;  4KLM A;  5IIN A;  4DFP A;  5KG7 A;  4Z6F A;  3C1Z A;  4DLE A;  5DGA A;  4AT9 A;  4X4N A;  3Q8Q B;  3MR3 A;  5KFM A;  4M9G A;  3FYH A;  2BCS A;  5D49 A;  5DLF A;  4DO9 A;  1ZJN A;  2A1J A;  1ZQY A;  2DFL A;  3LWL A;  4GC6 A;  4DLG A;  9ICK A;  1BGX T;  1RPL A;  3LDA A;  3Q8R B;  1ZQE A;  1A76 A;  4LZD A;  4F3O A;  4WC1 A;  5BPC A;  2ZH7 A;  3TFR A;  1N48 A;  5KFT A;  7ICJ A;  1KDH A;  5HRG A;  3PX4 A;  4QW8 A;  4UAY A;  2XCA A;  1ZQO A;  4E80 A;  3AU2 A;  4DQS A;  4DL4 A;  8ICJ A;  9ICW A;  2ZUD A;  4X4P A;  4O0I A;  4WCW A;  4HYK A;  2PFQ A;  3GII A;  4ED1 A;  5EOZ A;  4Z6C A;  1KEJ A;  4MEX A;  4IRK A;  1TAU A;  1NK9 A;  8ICR A;  4ED3 A;  2MUT B;  4IQU A;  2Y1J A;  2FLP A;  1K1S A;  1BVS A;  3HWT A;  1ZQT A;  2ZUC A;  4WC5 A;  3WFR E;  7ICH A;  5DG8 A;  7ICP A;  3SYZ A;  2NRZ A;  1KFS A;  3AQK A;  3THV A;  3ETL A;  3SZ2 A;  3RJE A;  5HHH A;  3H8W A;  4I2I A;  3UQ0 A;  3PML A;  1XSN A;  1U9L A;  3FDS A;  3RB4 A;  5J2H A;  8ICN A;  5J2J A;  1X9W A;  5DED A;  5DG7 A;  4NLZ A;  2ZTD A;  3SV3 A;  1QSY A;  2HHV A;  4X4V A;  3QE9 Y;  4KLU A;  4RQ0 A;  5L9X A;  4F5O A;  3JZ0 A;  3MBY A;  5F9L A;  9ICN A;  1NOM A;  2VA2 A;  1A77 A;  1S10 A; 
#chains in the Genus database with same CATH topology
 4QWD A;  1NKE A;  4U7C A;  2F3N A;  4DL3 A;  1XSP A;  5B5E U;  2ALZ A;  3GIK A;  1TVA A;  1KKX A;  2GAF D;  4F72 A;  2Z7J A;  3QUC A;  5CHG A;  2RP5 A;  4KN7 A;  4C80 A;  2AU0 A;  4I2D A;  4RNO A;  3PX6 A;  2QAR A;  2ZIV A;  2DF4 B;  3MFH A;  3WK5 A;  4NWI A;  4FE3 A;  1JQR A;  1NNL A;  2ZTE A;  2OM6 A;  2YB1 A;  4BWM A;  2BR0 A;  1OW5 A;  1QQ7 A;  3KKA C;  5ALQ A;  3PW0 A;  4M0A A;  3HJ1 A;  1X42 A;  4F92 B;  4KLQ A;  2KK0 A;  4M47 A;  1TFW A;  1RXW A;  4OJL A;  2H3V A;  3H37 A;  9ICH A;  3M6K A;  1SL1 A;  1S0M A;  1X2I A;  3PVX A;  1D8L A;  4EZ9 A;  3SV4 A;  5KFL A;  5DKW A;  8ICX A;  2F44 A;  2F77 X;  5HC9 A;  3GIJ A;  3L9D A;  2Y9U A;  4QWC A;  4CRX A;  3F53 A;  3Q8M A;  3OVB A;  2D3D A;  4ATB A;  5HHI A;  4QWA A;  1Y88 A;  2DRA A;  5KFI A;  4IQV A;  5DBC A;  4F4Y A;  2WF7 A;  3IHQ B;  4ED6 A;  7ICN A;  3D2S A;  2BDP A;  3BQ7 A;  4F50 A;  2LI6 A;  5ALV A;  2W43 A;  3MCR A;  4ED8 A;  2DQN B;  5AM4 A;  1T8E A;  1ZQH A;  1BPD A;  2NRT A;  3PHZ A;  4I2J A;  1D8Y A;  4FO6 A;  4P0Q B;  1KTQ A;  3PR4 A;  4X0A A;  2BCQ A;  4OAG A;  2JEI A;  3V7L A;  5HRI A;  1YZ7 A;  4QIW C;  4YP3 A;  4AT7 B;  3BZC A;  4RWO A;  2NO4 A;  4J9L A;  4C8L A;  4F5R A;  1DXS A;  3E0F A;  2ZIW B;  2HHT A;  2QB0 A;  2XY5 A;  1X9S A;  3ISC A;  1SGG A;  1SL0 A;  3TQ1 A;  5KFH A;  4S3N A;  2ID1 A;  2FLN A;  2VA8 A;  1TKD A;  3IDW A;  5J0P A;  2JGA A;  1N2X A;  4M6W B;  5ALL A;  3U26 A;  5KFC A;  1S8O A;  2LM4 A;  5AHX A;  5D61 A;  1VJ7 A;  2NRW A;  3RJI A;  2HHV A;  1V9P A;  2WAQ C;  2B21 A;  9ICT A;  3RTV A;  4K97 A;  4M9J A;  3ER8 C;  3RJG A;  5ALF A;  5J2E A;  2LYH A;  3M8S A;  1WYG A;  3N7R C;  1ZQX A;  4C8O A;  1ZQV A;  2ASL A;  4TQR A;  8ICE A;  3EW9 A;  4DOC A;  5AKK A;  1Q46 A;  2GLE A;  2E1E A;  1S77 D;  1NKB A;  5IIK A;  1QH9 A;  4K4H A;  3C2M A;  2IOF K;  8ICA A;  3F2D A;  2F2A B;  1XU4 A;  4CF3 A;  3WFQ E;  1S97 A;  2HBL A;  2G09 A;  2EH9 A;  4PJ0 U;  3PNC A;  2UVV A;  2DRB A;  1ZD5 A;  4KLO A;  1Q8K A;  2O5A A;  4F5Q A;  3ZDE A;  2K8B B;  3PO5 A;  1JMS A;  5CFS A;  1KL9 A;  5AKI A;  9ICA A;  4I2E A;  3ICX A;  3AQN A;  5AK6 A;  3WKB A;  3CRX A;  4R8U B;  2DPJ A;  2O6K A;  2F1J A;  1HUO A;  2HOF A;  4EEB A;  3RH5 A;  5F2V O;  1P7D A;  3OWG A;  2IUB A;  3C1Y A;  4I0U A;  5HR7 A;  8ICY A;  3QUB A;  3K1R B;  1COO A;  4FZL A;  2BBH A;  1WOT A;  5ALD A;  2XIC A;  1JUD A;  3K1Z A;  5IIM A;  5KG4 A;  2DBY A;  4B9N A;  3C18 A;  2IOF A;  3TKA A;  3HJE A;  1BNO A;  5DGB A;  5DDM A;  2HBJ A;  2W54 A;  3RR8 A;  4KB6 A;  1BPB A;  5KL1 B;  1R8B A;  4C7Z A;  7ICR A;  3M7D A;  4J9S A;  4OO1 J;  5TZV A;  2K8C B;  3C5F A;  2VJ4 A;  4O3P A;  5KG2 A;  4K9B A;  4DEZ A;  4LEW A;  5ALR A;  5KFB A;  4UB1 A;  2FLL A;  4EV6 A;  2ES6 A;  4P0Q A;  7ICF A;  5ALH A;  5D4B A;  4F4Z A;  2A1J B;  4QZA A;  2BBJ A;  4BX9 C;  3FAH A;  4QW9 A;  2FMS A;  5KFD A;  4AT7 A;  3H3A A;  2KHV A;  3ERC C;  4UB4 A;  2ZIW A;  3RAQ A;  2M2W A;  2XY6 A;  1M6Y A;  4BXO B;  2KEY A;  3KBB A;  1ZQK A;  4QZ8 A;  5III A;  2ESE A;  3E58 A;  4NM2 A;  4US8 A;  4PZN A;  3NS1 A;  5G5G A;  3ONN A;  4KLF A;  2G5H B;  5CB1 A;  4JLX A;  2YQE A;  4M6W A;  1CRX A;  3SAF A;  1OU5 A;  2Y0S F;  1VLB A;  1RXV A;  2FPL A;  2W3R A;  3HW8 A;  1WWU A;  4RZR A;  1KQQ A;  4M9N A;  2XID A;  5D46 A;  1IG6 A;  2R18 A;  2ZH2 A;  3FM9 A;  2WB1 C;  3ETR A;  4YXM A;  3UXP A;  5J2D A;  4UQG A;  3MFI A;  4AP9 A;  5J0O A;  4M9H A;  4OD0 A;  3N7P D;  1RZT A;  4F8R A;  5B3Q A;  4F93 B;  4NLG A;  1ZQF A;  1TK8 A;  1ZQJ A;  1ZQU A;  4BJQ A;  2BGW A;  2Q0Z X;  1O03 A;  3IG8 A;  4QZI A;  1JI7 A;  3H39 A;  3J81 j;  2YY6 A;  3PO4 A;  4Y2Q A;  1X9M A;  3I28 A;  4NLC A;  1C20 A;  5AI8 A;  4UAS A;  3NVO A;  3KKA A;  4FS1 A;  4F91 B;  2I6X A;  3G6V A;  2DKX A;  2W7O A;  1O08 A;  4ELV A;  2PXI A;  1ZQS A;  4E8F A;  1ZET A;  2BPG A;  3HKZ C;  4B9L A;  4R65 A;  4YR0 A;  4TUR A;  9ICM A;  1KLN A;  1Q78 A;  4R8U A;  1CEZ A;  3RB6 A;  3RRH A;  4UB8 U;  4C7Y A;  4A8E A;  4QZF A;  3PSI A;  4LT6 A;  1L6N A;  1BPE A;  1ZQW A;  1XS9 D;  5AKG A;  4NLK A;  4BUG A;  2B4V A;  9ICQ A;  5KFW A;  4DSJ A;  1F5S A;  3SAG A;  2G06 A;  5KFS A;  1DRG A;  1ZXI A;  4DCC A;  4MHV A;  3V6K A;  1XWL A;  1SV4 A;  1X40 A;  3N28 A;  4NKU A;  4IS7 A;  1NJZ A;  4Q43 A;  4OJ6 A;  4O5K A;  2LKY A;  3I1Y A;  2A3V A;  3TAD C;  4Y2V A;  5DGA A;  4X4N A;  4M9G A;  1NI3 A;  4ZOH C;  3SMV A;  1ZJN A;  2A1J A;  4GC6 A;  3LWL A;  9ICK A;  1L7N A;  4LJX A;  1L7O A;  7ICJ A;  4UAY A;  4DQS A;  5AIC A;  9ICW A;  4X4P A;  4HYK A;  2PFQ A;  4O3M A;  4Z6C A;  1KEJ A;  4ED3 A;  4BXO A;  1K1S A;  1BVS A;  3HWT A;  5DG8 A;  1S5L U;  2NRZ A;  1KFS A;  3SZ2 A;  5HHH A;  1XSN A;  5J2H A;  1X9W A;  5DED A;  4NLZ A;  5AI6 A;  4KLU A;  3JZ0 A;  4F5O A;  3NVY A;  5F9L A;  2K4H A;  1NOM A;  4O67 A;  1V38 A;  5HRH A;  4LEZ A;  1ZQM A;  2K60 A;  4YXJ A;  3AM9 A;  3PW2 A;  3HT3 A;  4CF4 A;  4USA A;  5AK4 A;  3T5H A;  3MC1 A;  1JXL A;  5JRT A;  4KLT A;  2XVT A;  2PBE A;  8ICW A;  4IQW A;  1ZQP A;  7ICV A;  1PK3 A;  5KAF U;  5HP4 A;  3IG5 A;  1MSW D;  4I2H A;  1SKR A;  5KFZ A;  4ED7 A;  3WK4 A;  2HVH A;  3M8R A;  4ACO A;  2F8K A;  5DBA A;  3ER9 B;  3NYB A;  4ICA A;  1R8A A;  1FIQ A;  4DL6 A;  2FPM A;  2KOB A;  2PFN A;  3EF2 A;  4RUA A;  3K75 D;  4DSL A;  9ICP A;  1N60 A;  5AM5 A;  2KKP A;  4UW9 A;  1ZQQ A;  3N7S C;  4MFA A;  3BJY A;  5FP0 A;  1PVR A;  5HR9 A;  1J2M A;  1JX4 A;  1NK5 A;  2VJ5 A;  1U49 A;  3WFP A;  3H4B A;  3C28 A;  4Q44 A;  4DQQ A;  3JPT A;  5IIO A;  4FZM A;  4EEL A;  3QZ7 A;  1Q79 A;  3JYY A;  2R8H A;  1XC9 A;  2Y0S C;  2WFA A;  9ICL A;  4O5E A;  4PGY A;  3MR6 A;  4FHY A;  1CUK A;  4UAR A;  5J2G A;  2V4R A;  3K7D A;  1U4B A;  4TUQ A;  4P4P A;  4ZH4 A;  2P6R A;  4C8K A;  2D6F C;  1Z1V A;  2DL0 A;  2K4I A;  1RM6 C;  4YN4 A;  1NK4 A;  3B0Y A;  2HN1 A;  1L5U A;  5KFA A;  4I27 A;  7ICL A;  1GPJ A;  4UAU A;  5DG9 A;  2KSO B;  5DB9 A;  4UAV A;  2EZZ A;  4KIT B;  5KFX A;  2H3Q A;  5KT3 A;  2ZJ5 A;  3PW5 A;  2RHF A;  4UAT A;  2C28 A;  4PL2 A;  1HIW A;  3WK7 A;  2IHM A;  3KHG A;  2VKQ A;  4EBJ A;  1JIH A;  3DV9 A;  1BPZ A;  9ICU A;  4O6A A;  3OGU A;  5D63 A;  3V6J A;  4J9N A;  2BQU A;  2ZH1 A;  1D9D A;  5AKE A;  1HEK A;  4Z6D A;  5DQH A;  3NGD A;  4JB3 A;  3ISB A;  3EZ5 A;  4XQ8 A;  1GO3 F;  2NRX A;  2F1H A;  4B9U A;  1Z19 A;  3GIL A;  4X4S A;  2LHT A;  2YMP A;  3AUO A;  8ICC A;  4US9 A;  5AI9 A;  3KHH A;  5DEC A;  5AIB A;  4DOB A;  1VDV A;  5CRX A;  4EYI B;  1TAM A;  3RJF A;  4P0P B;  3V6H A;  3PY8 A;  1NK7 A;  3SI8 A;  3G6X A;  4KN4 A;  3KD3 A;  1DGS A;  3EUB 2;  3OPX A;  2FMQ A;  3BQT A;  2A19 A;  3WK9 A;  5BOM A;  3PW7 A;  2IMW P;  3AQF A;  3TI0 A;  5J2K A;  2R8G A;  3M9M B;  3T5K A;  1DK2 A;  4UB3 A;  3NKU A;  1NK0 A;  3N4M B;  3ZD9 A;  3O0F A;  2PFP A;  3ED5 A;  3L3F X;  5KFO A;  4QZB A;  3SQI A;  5HRE A;  5G5H A;  1IXR A;  2ZH5 A;  2LM1 A;  1Q3U A;  1NK6 A;  4F5N A;  7ICT A;  4FO1 A;  3OUY B;  2ZH8 A;  2ZH4 A;  1TFR A;  2HVI A;  2ZHA A;  2UVU A;  1NO5 A;  5AI4 A;  2HBM A;  3TAP A;  3OVA A;  2FE9 A;  4DF8 A;  4I2C A;  4XA5 A;  2MRL A;  2G08 A;  4QZE A;  1VFG A;  1NKC A;  2HBK A;  2OCE A;  3D6J A;  2ZH6 A;  2H3F A;  2UVW A;  4OAI Z;  1ZQB A;  2AJQ A;  1ZQI A;  4I2G A;  5HMM A;  2FCL A;  4QZC A;  4DL5 A;  4I29 A;  1L8L A;  1F5A A;  2KTQ A;  1L7M A;  3SAH A;  2JH7 A;  3UMB A;  2EQY A;  3NRW A;  4IRC A;  1RYS A;  2M9N A;  2HOQ A;  1JAL A;  2KD1 A;  3UPS A;  4WC3 A;  3AU6 A;  4PGQ A;  1FA0 A;  2IOH A;  1QSS A;  1AQ6 A;  2KKV A;  2MA1 A;  4EEY A;  1NZB A;  5EE1 A;  2RQ5 A;  4RQ7 A;  2KSO A;  4DL7 A;  2HN2 A;  2KVC A;  4C4T A;  2C2R A;  4KMU A;  4MF2 A;  5GTH U;  2ATL A;  3LWM A;  1ZRN A;  3KTQ A;  3TAD A;  3HX0 A;  4Y2X A;  4IR9 A;  1QQ6 A;  3H0L B;  2MSN A;  2XO7 A;  4TUS A;  5KFG A;  7ICM A;  3RB0 A;  3BQ2 A;  4JWM A;  5ALZ A;  1N5X A;  2Y1I A;  1FFU A;  2CXY A;  3GFK B;  3WKC A;  2FI1 A;  3C66 A;  1ZJM A;  4J9P A;  5F9N A;  2MU2 A;  4K4I A;  1QCK A;  4EBC A;  3PX0 A;  2KN7 A;  3RBE A;  3M9N B;  3C2K A;  4P0P A;  3WU2 U;  4KTQ A;  8ICU A;  4Z6E A;  4WC2 A;  4OCZ A;  4O3S A;  4C8N A;  4UD5 A;  4RT2 A;  4PHD A;  9ICC A;  2AHO B;  4Y2S A;  1RYR A;  4QZH A;  2QLT A;  5J0S A;  2EAP A;  3WK6 A;  1U48 A;  3HIY A;  5GTI U;  1ZQ1 C;  5J0R A;  4DQR A;  1F0M A;  2Q66 A;  4X4Q A;  3IM1 A;  3MDC A;  4CGZ A;  1KFD A;  7ICG A;  2OWO A;  3GZF A;  3M1Y A;  2DR9 A;  3UMG A;  5KT2 A;  2CN1 A;  5ALO A;  5JUM A;  8ICG A;  5ALT A;  1A6S A;  3CP8 A;  2ISO A;  4F4X A;  2YTU A;  2KZZ A;  1NK8 A;  3OUY A;  3VC8 A;  4ELT A;  2BCR A;  2AQ4 A;  1NJW A;  4WC0 A;  8ICT A;  3OVS A;  3IRU A;  3BDP A;  8ICH A;  3OHA A;  8ICB A;  3BS7 A;  1ZQA A;  1R89 A;  2AGP A;  2AQ0 A;  4EP7 A;  3ZDB A;  1WWV A;  1PUZ A;  4GXJ A;  1JAJ A;  1SB3 C;  2KZ3 A;  4FZN A;  2JRZ A;  1T4G A;  4KLS A;  1CI4 A;  2JEG A;  1Z3E B;  2NRK A;  4YD1 A;  4R64 A;  3I76 A;  4F2S A;  4QZD A;  4X4R A;  2LMR A;  4G3I A;  5AM0 A;  4CNQ A;  3H4D A;  3MGI A;  4UAW A;  3L4P A;  4F4W A;  3QZ8 A;  3AQM A;  2EZY A;  2CPR A;  3RH6 A;  1ARO P;  2JXJ A;  1DGJ A;  2HDO A;  3ORY A;  4KLM A;  4Z6F A;  4DLE A;  1UPH A;  3Q8Q B;  3MR3 A;  5KFM A;  1WUD A;  3FYH A;  4DO9 A;  4DLG A;  3D2Q A;  2F8L A;  1BGX T;  3Q8R B;  5ALX A;  4WC1 A;  4QNL A;  1KDH A;  3PST A;  1ZQO A;  2XCA A;  3AU2 A;  8ICJ A;  2JR5 A;  2ZUD A;  1L7P A;  4O0I A;  5EOZ A;  2KNJ A;  4WOY A;  2MUT B;  2WF5 A;  3WFR E;  1FEZ A;  4WC5 A;  2ZUC A;  7ICH A;  3SYZ A;  2B6G A;  4OJP A;  5AKJ A;  3PML A;  8ICN A;  1U9L A;  3FDS A;  5J2J A;  5DG7 A;  2YN4 A;  3MBY A;  2OXO A;  1SXD A;  9ICN A;  3RF9 A;  2VA2 A;  1S10 A;  4JV0 A;  2VA3 A;  4PH5 A;  3NAS A;  2ZIU B;  2W3S A;  3KFU F;  2P66 A;  1PVQ A;  2V9W A;  2ZUB A;  4QZG A;  2NYV A;  2M2V A;  2LYB A;  1DK3 A;  5KFQ A;  2W8K A;  5J8Y C;  1NJX A;  8ICK A;  2HHW A;  4OJ5 A;  1SKW A;  3HPO A;  4M04 A;  5HNK A;  5KG1 A;  4BDP A;  9ICF A;  5AKX A;  4NXZ A;  3ALR A;  4X5V A;  5IIJ A;  2R8K A;  3MGV A;  1PK1 B;  4KX3 A;  1N5W A;  3NRZ A;  4AYB F;  4DFD A;  2W9C B;  1K1Q A;  4O5C A;  1SIJ A;  4UB6 U;  5JU5 A;  4NXW A;  4J9Q A;  2W9B B;  2KHQ A;  4YCX A;  2I9G A;  5AI0 A;  4EBK A;  2HSZ A;  1ZQD A;  3PZP A;  4UBC A;  3EYZ A;  1X6I A;  4RNN A;  4PGX A;  5ALM A;  4EX6 A;  5CFU A;  5KAI U;  4PPX A;  5H2F U;  4WQK A;  2HHX A;  3OJS A;  2NO5 A;  3NVW A;  4ECU A;  3E2E A;  1XNS A;  5CR0 A;  4O3R A;  4ECV A;  1RQN A;  2EAO A;  4F71 A;  2EWR A;  2W9A A;  3C5G A;  4DS5 A;  2B56 A;  2IA6 A;  4DWI A;  5J29 A;  3S6J A;  8ICS A;  2BCV A;  1TV9 A;  1R8C A;  3T5L A;  1WCN A;  2K4P A;  2BDU A;  3GU3 A;  2AGQ A;  3CW2 C;  1RYU A;  4MFF A;  2BHN A;  3MR5 A;  2BPF A;  2OEH A;  4RQ6 A;  3IV6 A;  3RJJ A;  1L8O A;  1KBU A;  1V4A A;  4DS4 A;  2NRV A;  4I2B A;  1UT5 A;  1Z00 B;  2YML A;  2VIX A;  5ALG A;  4KLH A;  4JV1 A;  1ZD2 P;  4MF8 A;  2K89 A;  1ZQG A;  3HRD D;  1JN3 A;  3T3F A;  2M2T A;  2DKZ A;  4UB2 A;  3WKD A;  1QTM A;  2ZIX B;  2ODG A;  2MUT A;  3KHR A;  4WC7 A;  1V85 A;  4R63 A;  2FMP A;  2HMX A;  4IL6 U;  3PV8 A;  1MIW A;  4J03 A;  2RDJ A;  3UPQ A;  4EZ6 A;  4M2Y A;  4YG2 A;  5J0Q A;  2OYY A;  5L1I A;  1B0X A;  4OAH A;  2D8C A;  4FHP A;  2HHQ A;  4YR3 A;  3GV8 B;  4AT8 B;  3MR2 A;  4QZ9 A;  3QU9 A;  3BQ1 A;  3OV7 A;  1ED1 A;  3V7K A;  4BWJ A;  1T3Q A;  2ZIU A;  1QQ5 A;  2YX8 A;  3CNH A;  5J2A A;  4O3N A;  2I1Q A;  2RFF A;  4UAZ A;  3NVV A;  2IHN A;  1SV0 C;  1X66 A;  2W55 A;  4X4U A;  1UHU A;  3FC4 A;  4J9K A;  5C5J A;  4E0D A;  4ECR A;  4Y2R A;  3AQL A;  4KM5 A;  4KLE A;  3WFO A;  5ALS A;  1X9X A;  3H8J A;  1IIP A;  4K99 A;  4UBB A;  4QWE A;  2ZXH A;  3M6Z A;  5AK5 A;  3RAX A;  4GLX A;  3TAR A;  2G5I B;  3H40 A;  4X4T A;  9ICG A;  1PK1 A;  1ZD3 A;  4QIW F;  4XUS A;  3OJU A;  2B0C A;  4YR2 A;  4FBT A;  2W9C A;  4EEN A;  1N56 A;  4Q45 A;  1ZQR A;  2PKE A;  2O1P A;  5DB7 A;  3TAC B;  3RB3 A;  3G6Y A;  4Y2U A;  2W9B A;  2DR7 A;  3NTU A;  4RUC A;  9ICE A;  3ZDA A;  3JPQ A;  4IRD A;  2JEF A;  5AI5 A;  2FPK A;  2PI4 A;  4CE6 A;  1COK A;  5DBB A;  2KJ8 A;  2ZJ8 A;  2LBO A;  1Z1B A;  1KFT A;  1TK0 A;  2C22 A;  3EWA A;  3L5K A;  5ALN A;  4TUP A;  1PX5 A;  3C2L A;  3LK9 A;  2WAQ F;  9ICB A;  5HRF A;  4FH3 A;  5ALE A;  1ZOL A;  5L1L A;  2YMQ A;  3T79 A;  1DOQ A;  2HOI A;  2BPC A;  2KG5 A;  3AL0 B;  5TIS U;  3SD7 A;  3F2B A;  5DB6 A;  2GH1 A;  5DQG A;  4P2H A;  5KT4 A;  7ICE A;  4NKT A;  4GC7 A;  5KFE A;  1BPX A;  5DDY A;  3RJH A;  2E8P A;  3ZI4 A;  5HRK A;  7ICK A;  3N97 B;  2BZF A;  2J6T A;  2WHE A;  5E79 U;  1L3S A;  4WBY A;  4O69 A;  4RPX A;  2W7P A;  3T5J A;  3TFS A;  3AN1 A;  2KFN A;  3IP4 B;  2BKE A;  1Z00 A;  3JPO A;  3QU7 A;  2P35 A;  4RPZ A;  1WG8 A;  2KIC A;  1UA1 A;  4RQ4 A;  1N63 A;  3OHB A;  2DGZ A;  1JRO A;  2WF9 A;  2W11 A;  4IG8 A;  1VJ5 A;  2JHD A;  1T3N A;  2ZIX A;  4P4O A;  1ZYQ A;  3H7I A;  4E7X A;  2QB1 A;  3GV5 B;  2DR5 A;  3KHL A;  3QUQ A;  1U45 A;  5KT6 A;  9ICV A;  3MAB A;  4JMU A;  8ICP A;  1SKS A;  3H8M A;  2DWQ A;  4AT8 A;  5J2B A;  4DSK A;  4Y2J A;  4EED A;  2PI5 A;  4ECW A;  2KJ9 A;  1UA0 A;  4XRH A;  4DFJ A;  1SWV A;  5L1M A;  4RQ2 A;  3OSP A;  2K8A A;  2M2U A;  3Q8P B;  3JPP A;  1SZP A;  1N61 A;  1UET A;  1Q3V A;  2DPI A;  4RQM A;  5J8Y A;  4FBU A;  2K4E A;  4X4O A;  3QU5 A;  2XGP A;  1NZP A;  4Y2T A;  2WTF A;  2DUY A;  5C0Y A;  5J0T A;  5KFF A;  3NWI A;  5F3X B;  1XSL A;  1BPY A;  5EE0 A;  4MKP A;  3SEN A;  2HI0 A;  4Q8F A;  9ICS A;  2C2D A;  1D8B A;  1C7Y A;  3SEI A;  4NLN A;  3A0H U;  5J2F A;  8ICI A;  4YVZ A;  4J9O A;  3V72 A;  2HHP A;  2A1A A;  1MIY A;  4DSE A;  2BQ3 A;  4MFC A;  4JK1 A;  5KNI A;  4Q8E A;  2L5Y A;  2ZH3 A;  2RDI A;  4X0B A;  7ICI A;  3PMN A;  4ED0 A;  3HIL A;  3WK8 A;  4NXU A;  5EE9 A;  3CYM A;  3EPG A;  4RWN A;  1MA7 A;  2EAM A;  4ECX A;  2WB1 F;  2DVI A;  2KFZ A;  4NJ8 A;  4WQL A;  1UT8 A;  4JLZ A;  2ZTC A;  1TFY A;  4RU9 A;  2KJ5 A;  3KZX A;  1B43 A;  1LV5 A;  1S0O A;  2ZG6 A;  4KLJ A;  4KLL A;  5KG7 A;  4LEV A;  5D49 A;  1RG6 A;  2DFL A;  2KVS A;  1ZQE A;  4F3O A;  1A76 A;  4LZD A;  3TFR A;  5AM1 A;  3PX4 A;  4QW8 A;  2AH5 A;  2KMD A;  4WCW A;  4MEX A;  2G07 A;  4IQU A;  2Y1J A;  2FLP A;  7ICP A;  2H3I A;  3C29 A;  3AQK A;  3THV A;  5K4L A;  3ETL A;  5CFT A;  3H8W A;  3UQ0 A;  2EDU A;  3RB4 A;  4NXT A;  3HKZ F;  2ZTD A;  3SV3 A;  4K96 A;  4X4V A;  3QE9 Y;  1RQL A;  1JRP A;  3A0B U;  4PL1 A;  5B66 U;  4MEY A;  2BQR A;  4RQ5 A;  4JWN A;  2WF6 A;  8ICQ A;  1SZH A;  5J0U A;  4KLG A;  3F5A A;  4QWB A;  5JTI A;  5AK3 A;  3HJ4 A;  2GOL A;  4C8M A;  3HP6 A;  2KZM A;  4FHV A;  5CHE A;  1B22 A;  3CK6 A;  5HML A;  4J9R A;  4M9L A;  2OH2 A;  2YMM A;  1LKY B;  5B3P A;  4N7R A;  1SV0 A;  3B9J A;  4M5D A;  3RFA A;  5DLG A;  4XJE A;  4EYH B;  3ZDD A;  3PW4 A;  3QYP A;  3UQ2 A;  4O3O A;  4RT3 A;  4GIB A;  3ZDC A;  4KLD A;  4DSF A;  4B9V A;  4YQW A;  2KP7 A;  5KG6 A;  4JV2 A;  3QNM A;  4O9M A;  4YD2 A;  8ICO A;  2ASJ A;  4K98 A;  1NJY A;  1T7P A;  4B9S A;  2GO7 A;  3RH4 A;  2PMZ F;  1A0P A;  3RBD A;  2E8M A;  3GDX A;  3OSN A;  2E8N A;  4R66 A;  1H38 A;  4BGD A;  1YT3 A;  3KZI U;  4WBZ A;  3H0M B;  1F44 A;  2UVR A;  4J9M A;  3TAQ A;  5KTQ A;  2KE7 A;  1UEU A;  5J0X A;  5JTG A;  3QX7 A;  1SXE A;  2W04 A;  4DFK A;  1S0V A;  2JV3 A;  4UD4 A;  4ECQ A;  2CRX A;  2XGQ A;  5AM3 A;  2I5H A;  1S9F A;  2W8L A;  4HX0 A;  4NL9 C;  4DSI A;  4EBE A;  3Q8K A;  2JH1 A;  5KFR A;  2JEJ A;  3JPN A;  2J6U A;  5CP2 A;  4O68 A;  1K5O A;  5KG3 A;  1KRP A;  4CCH A;  3ZD8 A;  3BS5 B;  5ALJ A;  5J0W A;  2FDR A;  4Y2Y A;  2Y9T A;  2ZXI A;  5KFK A;  5KG5 A;  4KLI A;  3QXG A;  1MIV A;  1J2N A;  4WC4 A;  4DF4 A;  5A0L A;  1KN5 A;  1YZ6 A;  9ICJ A;  2ZH9 A;  3QEB Z;  2RLT A;  3QUT A;  9ICX A;  1JXE A;  3Q8S B;  1B4F A;  4PZO A;  5EWF A;  4U6P A;  2WF8 A;  5AKZ A;  2HCF A;  4CF5 A;  3NVZ A;  3V7J A;  4LZG A;  4PHA A;  3KOO A;  1UEV A;  5J2C A;  3PR5 B;  4O3Q A;  5AKH A;  9ICR A;  1N62 A;  4RPY A;  1OUQ A;  1L3V A;  5KFV A;  3TAN A;  2H5X A;  4I2F A;  5CJ7 A;  2HHU A;  4C4R A;  4GFJ A;  4RWQ A;  3VCB A;  2PFO A;  4FH5 A;  1HUZ A;  4YMM A;  3EPI A;  3QEA Z;  4B9T A;  2FJ6 A;  2DR8 A;  1LVH A;  2ASD A;  2RRD A;  2EZX A;  3M9O B;  4DOA A;  1S0N A;  4IR1 A;  2W9M A;  5KG0 A;  3PSF A;  4PHE A;  5KT5 A;  4UB5 A;  1LKY A;  4I2A A;  5CEH A;  1FFV A;  1ZQZ A;  5J2I A;  7ICU A;  1ECW A;  2NV3 A;  8ICM A;  4NY8 A;  4RQ1 A;  1ZRM A;  2JZB B;  2P6U A;  4RQN A;  3H0R B;  5EWG A;  4K9A A;  2BE3 A;  2XCP A;  4RQ3 A;  3GQC A;  5HRL A;  4QJF B;  5L1K A;  5D62 A;  1X6J A;  3WFS C;  2AXT U;  1QLN A;  1MQ3 A;  1Z4O A;  1T94 A;  3IN5 A;  1PZN A;  4YFK A;  2YB4 A;  3NUQ A;  5BOL A;  5KFN A;  4K8V A;  3H38 A;  3DDH A;  3MDA A;  4KMO B;  1UQV A;  4GXI A;  3UXN A;  1XO1 A;  5J0Y A;  2KIW A;  2XC9 A;  4GXK A;  4OJO A;  3JCF A;  2W03 A;  2V4Q A;  4K4G A;  1MC8 A;  3LYS A;  4PHP A;  4YMO A;  5IIL A;  2G0A A;  2VAN A;  3BZK A;  4I28 A;  1WCL A;  3JPS A;  1FO4 A;  5ALK A;  4NM1 A;  2OHF A;  9ICO A;  1MN8 A;  1SWW A;  1J97 A;  4ED2 A;  3AMZ A;  1ZQC A;  3UXO A;  4C4S A;  2XY7 A;  4EX7 A;  3F2C A;  3WKA A;  3LVV A;  4AT9 B;  4XQ7 A;  3C23 A;  1TAQ A;  4DQP A;  2Q4T A;  1ZQL A;  5ALP A;  2R8I A;  5KL8 B;  4DL2 A;  4DFM A;  3BS5 A;  1HJP A;  4ECZ A;  3RJK A;  4ECT A;  7ICS A;  2HW3 A;  4WC6 A;  4B6J A;  1V97 A;  4LVS A;  4KX5 A;  4ELU A;  1YLQ A;  3WKE A;  3Q8L A;  5ALU A;  2ZJA A;  3GIM A;  4P4M A;  3DEE A;  5DQI A;  1BNP A;  1KSP A;  4LEY A;  2B51 A;  2C2E A;  2PMZ C;  4F2R A;  5CWR A;  4EGW A;  2KIV A;  3QU4 A;  4OAF A;  4JUZ A;  1SL2 A;  5AIA A;  2ISP A;  1UCV A;  4HAI A;  5CA7 A;  4IC9 A;  5KFP A;  5KFU A;  3RRG A;  1IV8 A;  7ICO A;  2R8J A;  3UMC A;  2QAR B;  4EBD A;  2LPE A;  1U47 A;  4F5P A;  2IHO A;  1D9F A;  4ECY A;  1LB2 B;  2ZIV B;  1KNY A;  4FS2 A;  4G9B A;  4YMN A;  2KV2 A;  1ZQN A;  5KFJ A;  5EWE A;  5HRD A;  7ICQ A;  3MGH A;  4C0Z A;  3K4G A;  3C21 A;  3F5E A;  2XI9 A;  4WJ3 B;  3AQE A;  4NXV A;  4FHW A;  3LVW A;  4Y2P A;  2E5S A;  4NLB A;  2E8O A;  5KFY A;  1L3U A;  5DB8 A;  5T14 A;  4RNM A;  2M0N A;  1QSL A;  2JZB A;  2F1I A;  1XO0 A;  2N1R A;  4RWP A;  5HRB A;  4FHX A;  8ICL A;  2H3Z A;  5AM2 A;  5ALW A;  4RQ8 A;  5L1J A;  4NXX A;  2ZHB A;  1RDF A;  3BQ0 A;  1MQ2 A;  2GA9 D;  3LQC B;  2HHS A;  2IBK A;  3JPR A;  2J6S A;  1S76 D;  4ATB B;  5ALY A;  4B9M A;  3ISD A;  4WH5 A;  1TE2 A;  8ICV A;  3RR7 A;  2JMG A;  3H8S A;  4F4K A;  1EXN A;  1KW4 A;  4IQT A;  1OXJ A;  3GV7 B;  2AGO A;  5EE3 A;  2MAX A;  3PSP A;  4FFD A;  1Z4N A;  1PVP A;  3B0X A;  1TK5 A;  2BCU A;  4ECS A;  2LYA A;  2GWS A;  2E1F A;  8ICZ A;  5AKL A;  4DQI A;  3AEV A;  2F76 X;  1IM4 A;  5KT7 A;  4TQS A;  1L3T A;  8ICF A;  2E3T A;  9ICI A;  5IIN A;  4DFP A;  3C1Z A;  4AT9 A;  4AYB C;  3UM9 A;  3D2N A;  4NL9 A;  2BCS A;  5DLF A;  1ZQY A;  2QB0 B;  1RPL A;  3LDA A;  2ZH7 A;  5BPC A;  1ZD4 A;  1N48 A;  5KFT A;  5HRG A;  5HR6 A;  4E80 A;  3R9K A;  4DL4 A;  5ALI A;  4IRK A;  3GII A;  4ED1 A;  1TAU A;  1NK9 A;  3QU2 A;  5AKY A;  8ICR A;  2QKQ A;  4NV0 A;  1ZQT A;  2EAN A;  4EEK A;  3RJE A;  4CDG A;  4I2I A;  3OTQ A;  1QSY A;  3SR6 A;  4RQ0 A;  5L9X A;  1URJ A;  1A77 A; 
#chains in the Genus database with same CATH homology
 4QWD A;  4JV0 A;  1NKE A;  5HRH A;  1XSP A;  4DL3 A;  2VA3 A;  4MEY A;  2BQR A;  1ZQM A;  4PH5 A;  4RQ5 A;  4YXJ A;  4JWN A;  2ALZ A;  3PW2 A;  3HT3 A;  3GIK A;  8ICQ A;  1TVA A;  5J0U A;  3T5H A;  4KLG A;  2P66 A;  1JXL A;  2V9W A;  4KLT A;  2ZUB A;  2PBE A;  4QWB A;  5CHG A;  8ICW A;  4QZG A;  4KN7 A;  3HJ4 A;  4IQW A;  2AU0 A;  4C8M A;  4I2D A;  3HP6 A;  4RNO A;  3PX6 A;  1ZQP A;  2KZM A;  7ICV A;  5KFQ A;  1DK3 A;  2M2V A;  1B22 A;  2W8K A;  5HML A;  4J9R A;  5HP4 A;  1NJX A;  8ICK A;  4M9L A;  1MSW D;  4I2H A;  2HHW A;  1SKW A;  3HPO A;  3MFH A;  1SKR A;  5KFZ A;  4M04 A;  4ED7 A;  5HNK A;  5KG1 A;  4BDP A;  9ICF A;  1JQR A;  2HVH A;  3M8R A;  4NXZ A;  2ZTE A;  4BWM A;  2BR0 A;  5DBA A;  4X5V A;  3NYB A;  5IIJ A;  3PW0 A;  2R8K A;  4M0A A;  4M5D A;  1R8A A;  3HJ1 A;  5DLG A;  4F92 B;  4KLQ A;  4DL6 A;  4M47 A;  4EYH B;  3ZDD A;  1TFW A;  2FPM A;  3PW4 A;  2PFN A;  4RUA A;  1RXW A;  3UQ2 A;  3K75 D;  4O3O A;  2W9C B;  4DSL A;  9ICP A;  1K1Q A;  4RT3 A;  4O5C A;  3H37 A;  9ICH A;  3ZDC A;  4KLD A;  1ZQQ A;  4DSF A;  4B9V A;  1SL1 A;  4YQW A;  4J9Q A;  1S0M A;  5KG6 A;  4JV2 A;  4MFA A;  1X2I A;  2W9B B;  3BJY A;  2KP7 A;  4YCX A;  4O9M A;  5HR9 A;  4YD2 A;  3PVX A;  2I9G A;  1D8L A;  1JX4 A;  2ASJ A;  3SV4 A;  1NK5 A;  5KFL A;  4EZ9 A;  5DKW A;  8ICO A;  3WFP A;  1U49 A;  8ICX A;  3H4B A;  1NJY A;  4EBK A;  1T7P A;  4B9S A;  1ZQD A;  5HC9 A;  4UBC A;  4Q44 A;  3EYZ A;  3GIJ A;  4RNN A;  4DQQ A;  3RH4 A;  3L9D A;  3JPT A;  3RBD A;  4PGX A;  4QWC A;  5IIO A;  3GDX A;  3OSN A;  3Q8M A;  3OVB A;  3QZ7 A;  4R66 A;  1H38 A;  4PPX A;  4BGD A;  2HHX A;  1Q79 A;  3JYY A;  4ATB A;  5HHI A;  4QWA A;  1Y88 A;  2R8H A;  1XC9 A;  4WBZ A;  2DRA A;  5KFI A;  3OJS A;  9ICL A;  4IQV A;  4X0B A;  5DBC A;  4F4Y A;  4PGY A;  3MR6 A;  4ECU A;  2UVR A;  4O5E A;  4J9M A;  3TAQ A;  4FHY A;  3E2E A;  1CUK A;  3IHQ B;  5KTQ A;  4ED6 A;  1UEU A;  5CR0 A;  5J2G A;  5J0X A;  4AT8 B;  2V4R A;  1U4B A;  4TUQ A;  4P4P A;  4O3R A;  4ECV A;  7ICN A;  4ZH4 A;  4DFK A;  2P6R A;  2BDP A;  4C8K A;  1S0V A;  4F50 A;  4ECQ A;  4UD4 A;  4YN4 A;  1NK4 A;  2XGQ A;  3B0Y A;  2W9A A;  3C5G A;  4DS5 A;  1L5U A;  5KFA A;  4ED8 A;  1T8E A;  2IA6 A;  5J29 A;  1ZQH A;  1BPD A;  4DWI A;  4I27 A;  8ICS A;  2BCV A;  1S9F A;  2W8L A;  2NRT A;  1TV9 A;  1R8C A;  4I2J A;  4DSI A;  4EBE A;  3Q8K A;  3T5L A;  1WCN A;  7ICL A;  1D8Y A;  5KFR A;  2JEJ A;  4FO6 A;  5DG9 A;  5DB9 A;  1KTQ A;  3JPN A;  2AGQ A;  3PR4 A;  2J6U A;  4X0A A;  4KIT B;  4MFF A;  5KFX A;  5CP2 A;  2BCQ A;  2BHN A;  5KT3 A;  2ZJ5 A;  3PW5 A;  3MR5 A;  2BPF A;  5KG3 A;  1KRP A;  2JEI A;  4RQ6 A;  3V7L A;  2C28 A;  4CCH A;  3ZD8 A;  5HRI A;  1UET A;  3RJJ A;  4YP3 A;  5J0W A;  2IHM A;  4AT7 B;  3KHG A;  4RWO A;  4J9L A;  4C8L A;  1V4A A;  4EBJ A;  4F5R A;  5KFK A;  1JIH A;  4DS4 A;  2HHT A;  1BPZ A;  9ICU A;  2NRV A;  5KG5 A;  4I2B A;  3OGU A;  4KLI A;  1UT5 A;  3V6J A;  1MIV A;  1Z00 B;  4J9N A;  2BQU A;  2XY5 A;  2ZH1 A;  1D9D A;  1X9S A;  3ISC A;  4WC4 A;  4DF4 A;  1SL0 A;  4KLH A;  4JV1 A;  4MF8 A;  3TQ1 A;  5KFH A;  4S3N A;  4Z6D A;  5DQH A;  9ICJ A;  2ID1 A;  3NGD A;  2FLN A;  1ZQG A;  2VA8 A;  1TKD A;  2ZH9 A;  1JN3 A;  3ISB A;  3EZ5 A;  4XQ8 A;  3T3F A;  3QEB Z;  5J0P A;  9ICX A;  4UB2 A;  2M2T A;  2NRX A;  1JXE A;  3Q8S B;  2F1H A;  1QTM A;  4B9U A;  3GIL A;  4X4S A;  2MUT A;  3KHR A;  4WC7 A;  4R63 A;  2FMP A;  5EWF A;  3AUO A;  8ICC A;  3KHH A;  3PV8 A;  4M6W B;  5DEC A;  1MIW A;  4DOB A;  2RDJ A;  3UPQ A;  4EZ6 A;  4M2Y A;  4YG2 A;  4EYI B;  5KFC A;  4LZG A;  5J0Q A;  3V7J A;  4PHA A;  3RJF A;  5L1I A;  3V6H A;  3PY8 A;  1UEV A;  5J2C A;  3PR5 B;  4FHP A;  4O3Q A;  1VJ7 A;  1NK7 A;  2NRW A;  3RJI A;  2HHQ A;  3SI8 A;  9ICR A;  4YR3 A;  4RPY A;  1L3V A;  3G6X A;  5KFV A;  3TAN A;  2H5X A;  4KN4 A;  5CJ7 A;  1V9P A;  3GV8 B;  3MR2 A;  4I2F A;  4QZ9 A;  2HHU A;  1DGS A;  2B21 A;  3BQ1 A;  4RWQ A;  3OV7 A;  9ICT A;  2PFO A;  3V7K A;  4BWJ A;  3RTV A;  4FH5 A;  2FMQ A;  4M9J A;  5J2A A;  1HUZ A;  4YMM A;  4O3N A;  2I1Q A;  3BQT A;  3EPI A;  3QEA Z;  3RJG A;  4B9T A;  5J2E A;  2RFF A;  2LYH A;  2DR8 A;  5BOM A;  4UAZ A;  3M8S A;  3PW7 A;  2ASD A;  2IHN A;  2IMW P;  4X4U A;  3M9O B;  3TI0 A;  5J2K A;  4DOA A;  2R8G A;  4J9K A;  5C5J A;  1ZQX A;  3M9M B;  1S0N A;  4E0D A;  4ECR A;  1ZQV A;  4C8O A;  4IR1 A;  2ASL A;  3T5K A;  4TQR A;  1DK2 A;  8ICE A;  2W9M A;  3EW9 A;  5KG0 A;  4UB3 A;  4DOC A;  3AQL A;  1S77 D;  4KLE A;  1NKB A;  5IIK A;  4PHE A;  5KT5 A;  4UB5 A;  1NK0 A;  4K4H A;  3WFO A;  3C2M A;  3H8J A;  3N4M B;  4I2A A;  8ICA A;  3ZD9 A;  1XU4 A;  2PFP A;  3WFQ E;  1S97 A;  1ZQZ A;  4UBB A;  4QWE A;  5J2I A;  7ICU A;  5KFO A;  4QZB A;  5HRE A;  8ICM A;  4NY8 A;  1IXR A;  4RQ1 A;  4GLX A;  2JZB B;  3PNC A;  3TAR A;  3RAX A;  2P6U A;  2ZH5 A;  2UVV A;  5EWG A;  3H40 A;  2DRB A;  2BE3 A;  4X4T A;  2XCP A;  1NK6 A;  4F5N A;  9ICG A;  4KLO A;  7ICT A;  3OUY B;  2ZH8 A;  2ZH4 A;  4RQ3 A;  1TFR A;  3GQC A;  2O5A A;  4XUS A;  2HVI A;  4F5Q A;  3OJU A;  5HRL A;  4YR2 A;  2ZHA A;  2UVU A;  3ZDE A;  4FBT A;  2W9C A;  5L1K A;  1N56 A;  1NO5 A;  4Q45 A;  3TAP A;  1ZQR A;  3OVA A;  3PO5 A;  2O1P A;  1JMS A;  5DB7 A;  4DF8 A;  4I2C A;  4XA5 A;  3RB3 A;  3G6Y A;  3WFS C;  9ICA A;  4I2E A;  2W9B A;  1QLN A;  3AQN A;  1MQ3 A;  4QZE A;  4R8U B;  2DPJ A;  1VFG A;  2DR7 A;  1PZN A;  3NTU A;  1NKC A;  2F1J A;  4YFK A;  4RUC A;  1HUO A;  9ICE A;  5BOL A;  2ZH6 A;  2UVW A;  5KFN A;  3H38 A;  3MDA A;  3RH5 A;  1ZQB A;  3ZDA A;  3JPQ A;  4IRD A;  5F2V O;  4GXI A;  2JEF A;  2AJQ A;  3UXN A;  1XO1 A;  5J0Y A;  2XC9 A;  4GXK A;  5HMM A;  2FPK A;  1ZQI A;  4QZC A;  2PI4 A;  4I2G A;  4DL5 A;  3C1Y A;  2V4Q A;  4K4G A;  8ICY A;  4I29 A;  1COO A;  1MC8 A;  4PHP A;  5DBB A;  1KFT A;  2ZJ8 A;  4YMO A;  1TK0 A;  2C22 A;  3EWA A;  1WOT A;  5IIL A;  4FHV A;  2VAN A;  4TUP A;  5IIM A;  5KG4 A;  4B9N A;  4I28 A;  1F5A A;  2KTQ A;  1PX5 A;  3C18 A;  1WCL A;  3JPS A;  3C2L A;  1BNO A;  3LK9 A;  5DGB A;  9ICB A;  5DDM A;  3RR8 A;  4NM1 A;  5HRF A;  4FH3 A;  5L1L A;  1BPB A;  9ICO A;  4IRC A;  1RYS A;  2M9N A;  7ICR A;  1R8B A;  4J9S A;  4ED2 A;  4WC3 A;  3UPS A;  5TZV A;  3AU6 A;  4PGQ A;  1DOQ A;  3C5F A;  1FA0 A;  1ZQC A;  1QSS A;  4O3P A;  5KG2 A;  3UXO A;  4DEZ A;  2XY7 A;  2BPC A;  4EEY A;  2FLL A;  5KFB A;  4UB1 A;  4RQ7 A;  4BXO A;  4AT9 B;  5DB6 A;  4DL7 A;  4P2H A;  5DQG A;  3C23 A;  7ICF A;  1TAQ A;  5KT4 A;  7ICE A;  5D4B A;  4XQ7 A;  4DQP A;  4F4Z A;  4NKT A;  2A1J B;  4GC7 A;  5KFE A;  1ZQL A;  2C2R A;  4QZA A;  1BPX A;  2R8I A;  5DDY A;  4KMU A;  3RJH A;  4DL2 A;  4MF2 A;  4DFM A;  2ATL A;  3LWM A;  4QW9 A;  1HJP A;  5KFD A;  2FMS A;  4AT7 A;  5HRK A;  4ECZ A;  7ICK A;  3RJK A;  4ECT A;  3N97 B;  3H3A A;  2J6T A;  7ICS A;  1L3S A;  4UB4 A;  3KTQ A;  3RAQ A;  2HW3 A;  4RPX A;  4WBY A;  3HX0 A;  3T5J A;  3TFS A;  2XY6 A;  2KFN A;  4BXO B;  2BKE A;  2M2W A;  4WC6 A;  1Z00 A;  4IR9 A;  3JPO A;  1ZQK A;  4RPZ A;  2XO7 A;  4TUS A;  4QZ8 A;  5III A;  4LVS A;  5KFG A;  7ICM A;  1UA1 A;  3RB0 A;  4ELU A;  4NM2 A;  3BQ2 A;  4RQ4 A;  3OHB A;  4JWM A;  1YLQ A;  2Y1I A;  3Q8L A;  2ZJA A;  3GIM A;  4P4M A;  4KLF A;  5DQI A;  1BNP A;  4IG8 A;  3GFK B;  1T3N A;  1KSP A;  4P4O A;  2C2E A;  1ZYQ A;  3H7I A;  5CB1 A;  4F2R A;  3C66 A;  5CWR A;  1ZJM A;  4E7X A;  4M6W A;  4JUZ A;  3GV5 B;  4J9P A;  5F9N A;  1SL2 A;  4K4I A;  2DR5 A;  3KHL A;  1U45 A;  5KT6 A;  1OU5 A;  4EBC A;  1RXV A;  3PX0 A;  2KN7 A;  3RBE A;  3M9N B;  3C2K A;  2ISP A;  2FPL A;  9ICV A;  4KTQ A;  8ICU A;  3MAB A;  4Z6E A;  5CA7 A;  5KFP A;  3HW8 A;  4RZR A;  8ICP A;  4WC2 A;  4M9N A;  5KFU A;  1SKS A;  3RRG A;  4O3S A;  5D46 A;  7ICO A;  4C8N A;  2R8J A;  4RT2 A;  4UD5 A;  4AT8 A;  5J2B A;  4DSK A;  4PHD A;  4EBD A;  1U47 A;  4F5P A;  2PI5 A;  2ZH2 A;  9ICC A;  4ECW A;  1UA0 A;  1D9F A;  4ECY A;  4XRH A;  4DFJ A;  1RYR A;  1LB2 B;  1KNY A;  4YXM A;  3UXP A;  4FS2 A;  4QZH A;  4YMN A;  4RQ2 A;  5J2D A;  5J0S A;  4UQG A;  3MFI A;  1U48 A;  1ZQN A;  5KFJ A;  5J0O A;  4M9H A;  5EWE A;  3OSP A;  5HRD A;  7ICQ A;  2M2U A;  3HIY A;  3Q8P B;  3JPP A;  3MGH A;  1SZP A;  5J0R A;  3K4G A;  4DQR A;  1RZT A;  4F8R A;  4F93 B;  4NLG A;  3C21 A;  2Q66 A;  4X4Q A;  1ZQF A;  1TK8 A;  3IM1 A;  3MDC A;  2DPI A;  1KFD A;  7ICG A;  1ZQJ A;  2OWO A;  1ZQU A;  2BGW A;  4FHW A;  2Q0Z X;  2DR9 A;  5KT2 A;  4QZI A;  4FBU A;  4X4O A;  3H39 A;  2XGP A;  1NZP A;  5JUM A;  8ICG A;  5KFY A;  2WTF A;  3PO4 A;  1L3U A;  5DB8 A;  4RNM A;  5J0T A;  5KFF A;  1QSL A;  1X9M A;  2JZB A;  2F1I A;  1XSL A;  1BPY A;  2ISO A;  4F4X A;  2KZZ A;  1NK8 A;  3OUY A;  4Q8F A;  9ICS A;  4RWP A;  2C2D A;  5HRB A;  4FHX A;  8ICL A;  4ELT A;  4FS1 A;  1C7Y A;  2BCR A;  4F91 B;  2AQ4 A;  3G6V A;  4NLN A;  1NJW A;  4WC0 A;  8ICT A;  5J2F A;  4RQ8 A;  2PXI A;  1ZQS A;  5L1J A;  3BDP A;  4ELV A;  8ICH A;  3OVS A;  4E8F A;  1ZET A;  3OHA A;  3BQ0 A;  1MQ2 A;  2BPG A;  8ICB A;  4YVZ A;  8ICI A;  2ZHB A;  4J9O A;  3V72 A;  1ZQA A;  3LQC B;  1R89 A;  2HHP A;  4B9L A;  2HHS A;  4R65 A;  2AGP A;  2IBK A;  3JPR A;  2AQ0 A;  1MIY A;  4DSE A;  4YR0 A;  2J6S A;  1S76 D;  4TUR A;  4EP7 A;  9ICM A;  1KLN A;  1Q78 A;  4R8U A;  3ZDB A;  4ATB B;  2BQ3 A;  4B9M A;  1CEZ A;  3ISD A;  3RB6 A;  4MFC A;  4GXJ A;  3RRH A;  1JAJ A;  4JK1 A;  8ICV A;  4QZF A;  3RR7 A;  2KZ3 A;  4LT6 A;  4Q8E A;  1T4G A;  3H8S A;  4F4K A;  1EXN A;  4KLS A;  2ZH3 A;  2RDI A;  4IQT A;  1Z3E B;  3GV7 B;  1BPE A;  3PMN A;  2AGO A;  2JEG A;  4YD1 A;  4R64 A;  7ICI A;  2NRK A;  2MAX A;  4ED0 A;  1ZQW A;  1XS9 D;  4F2S A;  4NLK A;  9ICQ A;  4QZD A;  4X4R A;  4G3I A;  3B0X A;  1TK5 A;  2BCU A;  4ECS A;  5KFW A;  3H4D A;  3MGI A;  3EPG A;  4RWN A;  4DSJ A;  2GWS A;  4UAW A;  4F4W A;  3QZ8 A;  5KFS A;  8ICZ A;  4ECX A;  4DQI A;  3AQM A;  2DVI A;  3V6K A;  2KFZ A;  1XWL A;  1UT8 A;  1IM4 A;  1ARO P;  3RH6 A;  2ZTC A;  5KT7 A;  4NKU A;  1TFY A;  4TQS A;  1L3T A;  4RU9 A;  8ICF A;  1NJZ A;  4Q43 A;  1B43 A;  1LV5 A;  3ORY A;  1S0O A;  9ICI A;  4O5K A;  4KLJ A;  4KLL A;  4KLM A;  5IIN A;  4DFP A;  5KG7 A;  4Z6F A;  3C1Z A;  4DLE A;  5DGA A;  4AT9 A;  4X4N A;  3Q8Q B;  3MR3 A;  5KFM A;  4M9G A;  3FYH A;  2BCS A;  5D49 A;  5DLF A;  4DO9 A;  1ZJN A;  2A1J A;  1ZQY A;  2DFL A;  3LWL A;  4GC6 A;  4DLG A;  9ICK A;  1BGX T;  1RPL A;  3LDA A;  3Q8R B;  1ZQE A;  1A76 A;  4LZD A;  4F3O A;  4WC1 A;  5BPC A;  2ZH7 A;  3TFR A;  1N48 A;  5KFT A;  7ICJ A;  1KDH A;  5HRG A;  3PX4 A;  4QW8 A;  4UAY A;  2XCA A;  1ZQO A;  4E80 A;  3AU2 A;  4DQS A;  4DL4 A;  8ICJ A;  9ICW A;  2ZUD A;  4X4P A;  4O0I A;  4WCW A;  4HYK A;  2PFQ A;  3GII A;  4ED1 A;  5EOZ A;  4Z6C A;  1KEJ A;  4MEX A;  4IRK A;  1TAU A;  1NK9 A;  8ICR A;  4ED3 A;  2MUT B;  4IQU A;  2Y1J A;  2FLP A;  1K1S A;  1BVS A;  3HWT A;  1ZQT A;  2ZUC A;  4WC5 A;  3WFR E;  7ICH A;  5DG8 A;  7ICP A;  3SYZ A;  2NRZ A;  1KFS A;  3AQK A;  3THV A;  3ETL A;  3SZ2 A;  3RJE A;  5HHH A;  3H8W A;  4I2I A;  3UQ0 A;  3PML A;  1XSN A;  1U9L A;  3FDS A;  3RB4 A;  5J2H A;  8ICN A;  5J2J A;  1X9W A;  5DED A;  5DG7 A;  4NLZ A;  2ZTD A;  3SV3 A;  1QSY A;  2HHV A;  4X4V A;  3QE9 Y;  4KLU A;  4RQ0 A;  5L9X A;  4F5O A;  3JZ0 A;  3MBY A;  5F9L A;  9ICN A;  1NOM A;  2VA2 A;  1A77 A;  1S10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...