3ISBA

Binary complex of human dna polymerase beta with a gapped dna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title DNA polymerase beta substrate specificity: side chain modulation of the "A-rule".
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3isbA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 3isbA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 3isbA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3isbA03
4F91B 5KFLA 4WC1A 4C8MA 2DPJA 5J2BA 4PHEA 3RRHA 4X4RA 3QE9Y 1XSNA 4F3OA 4LZGA 3H3AA 4B9LA 2AGOA 4RQ2A 4WBZA 4FBTA 4QZGA 3K75D 4UB1A 5J0RA 3SYZA 4TQSA 1NKBA 2NRZA 4YVZA 4BWJA 5J2IA 2BCQA 2PFPA 4I2HA 3WFSC 4DSEA 5DBCA 4KLGA 4QZCA 3BQ0A 1JIHA 2HHVA 3AU6A 1D9DA 4EBJA 4X4NA 4NXZA 3TFSA 3Q8MA 1SKSA 2VA2A 2DR7A 2O5AA 4Q45A 4F50A 4EBCA 2W9AA 5J0PA 1R8BA 3SI8A 1TAUA 4B9MA 2MUTB 1Z00B 3HX0A 1D8LA 7ICTA 4QZIA 4YFKA 3H38A 4UD5A 2ZH2A 1JAJA 5J0WA 4JWMA 1S0NA 4YQWA 4F4ZA 2ZUBA 5DLFA 3EPGA 4Z6FA 4HYKA 1SL1A 2ISOA 4F4YA 4M0AA 2HHTA 5KT3A 1ZQFA 9ICTA 4KN4A 2BCUA 4YXJA 2BQRA 2FPLA 3SV3A 1ZQSA 2M2TA 3C1ZA 2XY7A 4KLUA 4ED7A 4DWIA 5DQHA 3Q8KA 7ICVA 4ECTA 4QZ8A 1BGXT 4YCXA 8ICCA 2HVHA 1ZQVA 1KFSA 5J2EA 4I29A 1Y88A 4RUAA 5KG1A 5CP2A 4QZEA 5J0OA 2UVUA 1NZPA 5KFRA 4NM1A 4BDPA 1S97A 4DS5A 1WCLA 4O3SA 2ZH5A 3ISBA 4DOCA 5KFEA 3K4GA 4RQ3A 2DRAA 4RPYA 5HMMA 4F5OA 1L5UA 4YXMA 5KFWA 4B9UA 3RJIA 1ZQQA 3H8WA 4DFKA 3RB4A 4XA5A 2FLPA 7ICUA 4Q43A 3C1YA 4G3IA 2ZH3A 4JV0A 5F9LA 1KDHA 4IQWA 9ICMA 1XU4A 3GDXA 4PHAA 3MR6A 3GIIA 8ICVA 3V6HA 1UT5A 2XCAA 5L1JA 4KLFA 1UEVA 1ZQUA 1SL0A 4QWBA 2RDJA 2ISPA 1KFTA 1NK0A 9ICIA 4EZ6A 3FDSA 3AU2A 4E0DA 5KFYA 3C2MA 2NRKA 2HHPA 4C8NA 4RT3A 7ICHA 1F5AA 4IRDA 1S9FA 4M9NA 4B9VA 3Q8PB 1BPEA 3UQ2A 3IHQB 4I27A 5BOLA 4TUPA 4UD4A 3BQTA 2ZTDA 2VA3A 3MGIA 3T5KA 4F5NA 1HUOA 2JEFA 1K1SA 2OWOA 1V4AA 5KTQA 3NTUA 5HRFA 2FMSA 3PO5A 4AT8B 4KLSA 5DG8A 3RJHA 4X4PA 1MIYA 3THVA 2R8JA 1BNPA 4KITB 3UPQA 4FH5A 4FHPA 3SV4A 3MDAA 2R8HA 5DGBA 3TAPA 1CEZA 4WC7A 4RQ8A 4DQIA 1ZQLA 4TQRA 5L9XA 3BDPA 3UXOA 2C2RA 4KLJA 4ED0A 4C8OA 4MFFA 3SZ2A 9ICNA 1Q78A 2F1HA 4I2BA 4F4XA 1ZQKA 3GIMA 2XY6A 1NK4A 5J2CA 2AU0A 1ZQGA 3ZDDA 3QEBZ 3PMNA 2F1IA 5KG4A 3JZ0A 5L1IA 4KTQA 2Q66A 4DQSA 4UB4A 4NKUA 3TAQA 5D4BA 7ICGA 5HRHA 1ZQWA 3C18A 4IR9A 1AROP 2XCPA 2XO7A 4B9SA 1NK6A 1U9LA 3OJSA 4EBKA 3C66A 3KHRA 8ICMA 5J2FA 1T3NA 1JX4A 4WC0A 4ATBB 4E80A 5KG0A 3LDAA 3GILA 4EEYA 1TAQA 1TVAA 4ED2A 2W9MA 2IMWP 5IIOA 3H40A 2BKEA 4O0IA 3JPOA 4UB5A 1SKWA 3EYZA 4EBDA 1BNOA 4NLZA 5J2HA 1MQ3A 1RXVA 4NLGA 2ZTEA 4I2CA 3G6XA 1RXWA 3M8RA 2F1JA 4PGQA 4ECUA 2W8LA 3JPNA 3JPSA 4X4SA 1NJXA 3UXNA 4NKTA 4I2JA 5DGAA 1BVSA 5KT5A 4QZHA 3RAQA 3GV8B 1QSSA 4KLMA 8ICHA 2ALZA 2ZH1A 5J29A 1K1QA 5C5JA 4UAYA 4FO6A 4YD2A 1QTMA 2NRTA 1ZJMA 5DB9A 4DFPA 4KLEA 1KFDA 1S0MA 4RWQA 9ICGA 3NYBA 4F5RA 3B0XA 3LWLA 8ICPA 4DSFA 3H8SA 5KFDA 4PGXA 5L1KA 1UA0A 1ZQAA 3OVBA 1FA0A 5DECA 3BQ1A 1Z3EB 4S3NA 3FYHA 3AQMA 5J2AA 8ICYA 3AQKA 5KFOA 3PV8A 4DSKA 4O3QA 7ICNA 4JWNA 2DRBA 4RNMA 5IIMA 4P4PA 3V6KA 3ZDCA 3JPQA 4R65A 8ICGA 4RU9A 9ICEA 4M5DA 1ZQXA 1UT8A 2KN7A 2ASJA 4F4KA 3OV7A 9ICWA 4RPZA 4WC6A 5D46A 4E8FA 5J0SA 2M2WA 1XS9D 2C28A 1H38A 3ZDAA 3HWTA 1X2IA 2GWSA 2ZH6A 3TARA 4QWDA 4ED3A 3RRGA 3V7LA 9ICJA 1XWLA 1X9SA 2HHSA 4F5PA 4EYIB 2HVIA 5J0XA 4AT8A 4ECXA 3GIJA 3H7IA 1T8EA 3L9DA 1XO1A 4YN4A 3C23A 3TI0A 2FMPA 4P2HA 1TKDA 1ZQHA 1ZQCA 1RPLA 3TFRA 2ZHBA 1LV5A 2DR5A 4DL2A 2Q0ZX 4E7XA 2XC9A 2R8IA 4YR0A 2BPCA 2LYHA 3MR3A 1ZJNA 2BCRA 2JZBB 1SZPA 4LZDA 3N97B 1D9FA 3OSNA 8ICXA 9ICAA 4QW8A 1JN3A 4I28A 1A76A 4DLEA 1NK9A 4Q8FA 4MEYA 3MGHA 5HRDA 5HHHA 5KFKA 5L1LA 3BQ2A 3V7JA 4J9KA 4M9HA 2BPFA 4QZDA 4I2FA 4Z6EA 4RT2A 2ZJ5A 1XSLA 3ZDBA 4ATBA 5DB8A 1MIWA 8ICSA 2XGPA 1U47A 2UVVA 5J0QA 4EZ9A 1NJYA 4XQ8A 4UAWA 3HP6A 4UAZA 4I2DA 5HC9A 4M6WB 3ISDA 3T3FA 5KFXA 1C7YA 4X0AA 4DSLA 3E2EA 4DS4A 3JYYA 2HHUA 3MR2A 4YG2A 2H5XA 5IILA 2BHNA 4JUZA 4DL3A 3EWAA 4LT6A 4WC3A 2ZH4A 2J6UA 4KMUA 7ICJA 4X4OA 4RQ7A 3QZ7A 4IRKA 4KN7A 4DL6A 8ICBA 2ZH8A 4P4OA 4DOBA 1JMSA 2MAXA 3ZD9A 5DBAA 1S76D 5KT7A 4Z6DA 1ZQTA 3M8SA 3Q8SB 1KTQA 9ICOA 4J9RA 2AQ4A 3RJGA 5CWRA 4YMOA 4J9SA 1NK5A 3C21A 3OUYB 1RZTA 7ICRA 5KFVA 5JUMA 8ICIA 3JPPA 1U48A 2XY5A 4DQRA 4RUCA 5J0UA 1A77A 5HNKA 4YMMA 3PR4A 3QZ8A 4DOAA 4XRHA 4DFJA 5CR0A 2P66A 4ECYA 1D8YA 2R8GA 3WFQE 1R89A 8ICTA 1NO5A 3RR8A 1UEUA 4I2AA 1NOMA 2ZJ8A 5EOZA 1DOQA 4F92B 1QSYA 3HIYA 3QEAZ 4YMNA 4I2EA 2BQ3A 8ICKA 3PX0A 2PI4A 5DEDA 4KLIA 2JEIA 1U49A 4RQ1A 5KFZA 3KHLA 4F93B 1L3VA 4JV1A 1MC8A 2ZUCA 5KFMA 8ICQA 4AT7B 2NRVA 5HHIA 2W9BB 3G6VA 2PXIA 4EYHB 4J9MA 3N4MB 4DQQA 4DSJA 4RWOA 9ICBA 3WFRE 5F9NA 3PR5B 2MUTA 1Z00A 5KT4A 5DDYA 3Q8QB 4J9NA 8ICWA 3RR7A 1OU5A 3RJJA 4NLNA 4PHDA 1WCNA 4B9NA 1CUKA 4PH5A 4X5VA 5HP4A 3PO4A 4F2SA 1S0VA 4ZH4A 5KT2A 5D49A 1EXNA 3ZDEA 7ICEA 2M2VA 3WFOA 4RWPA 5F2VO 2FLNA 3PW4A 1ZQDA 8ICEA 4GXIA 5IIIA 5CJ7A 4NY8A 4ELVA 5IIJA 5J2KA 4IG8A 4QZ9A 4FHVA 5IINA 4Q44A 3WFPA 4YD1A 3MFIA 1ZQBA 2ZUDA 4F4WA 1NKCA 3EPIA 2Y1JA 4KLLA 2JZBA 2RDIA 3H8JA 4QZAA 2PFOA 4IRCA 2KFZA 1QSLA 2HHWA 2BGWA 5J2JA 5J0YA 1HUZA 2DPIA 4X4UA 8ICNA 2BE3A 5EWFA 5KG7A 5HREA 3PW0A 4KLDA 5DDMA 2IA6A 4DEZA 2FMQA 2A1JB 2IHMA 4R64A 7ICMA 3RBDA 1LB2B 1U4BA 5KFCA 3TQ1A 4K4HA 4BXOB 9ICHA 4JK1A 4RQ4A 4K4IA 4ECRA 3PX4A 5KFTA 4RQ6A 2VANA 5J2GA 4ECSA 4M6WA 2C2EA 8ICZA 4YR3A 4IR1A 4IQVA 1NK7A 4LVSA 7ICOA 2M2UA 5HRLA 4BWMA 2W9CB 4R66A 2WTFA 1TFRA 2NRXA 3KHHA 2V9WA 3OHBA 5DLGA 3KTQA 3H37A 1ZQZA 4RQ0A 4Q8EA 4MF2A 4O5EA 4ELUA 1WOTA 3HJ1A 4WC5A 3V7KA 2V4RA 3T5LA 2IBKA 4NM2A 3RB3A 3Q8RB 4WC4A 7ICFA 4Z6CA 5KFFA 5BOMA 3TANA 3Q8LA 3RB0A 3MABA 4XUSA 4R8UB 3OHAA 4QWAA 1TFWA 1TFYA 3OUYA 1HJPA 4RWNA 2PFNA 5J2DA 3MBYA 8ICRA 2KZZA 2JEGA 1TK0A 3ZD8A 4FBUA 9ICVA 4O5KA 2HHXA 4I2GA 7ICQA 4DQPA 4BGDA 5EWEA 4ECZA 5DB6A 9ICKA 3UQ0A 2KFNA 4O3OA 4O3PA 4RZRA 4PPXA 5CHGA 4EBEA 4PHPA 3ISCA 1ZQRA 3GIKA 4DF8A 5KFSA 1UETA 3BJYA 4ELTA 4M04A 4R63A 2ZJAA 2FLLA 4O5CA 8ICJA 5HRIA 1UA1A 4C8KA 4AT9B 3G6YA 2UVWA 7ICLA 4AT7A 3OVAA 2W9BA 1TK5A 4GC7A 3AQLA 1TV9A 2IHNA 4ED6A 4TUSA 2AGQA 1B43A 3EZ5A 1NK8A 1JXEA 4K4GA 3RH4A 7ICIA 3OVSA 3LK9A 1DGSA 5KFBA 5CA7A 2NRWA 1BPYA 4GC6A 4ED8A 3RH6A 3GQCA 4F2RA 4F5QA 2BPGA 5DQGA 4F8RA 4KLHA 4FHXA 4GXJA 2ZTCA 4X0BA 2HW3A 5KG5A 2P6UA 3PW2A 3RTVA 4KLOA 3T5HA 3LQCB 5KFPA 3RB6A 1Q79A 4WCWA 5DKWA 5DQIA 3GFKB 3RAXA 4TUQA 2PI5A 1ZQPA 5HR9A 2AJQA 9ICXA 3RJFA 3GV5B 1S77D 1V9PA 2C22A 2B21A 1NJZA 2ATLA 5J0TA 1BPXA 1MIVA 4FHYA 4MEXA 1RYSA 3PNCA 1L3SA 5HRKA 3RBEA 2I1QA 2A1JA 4QWCA 4RNOA 1ZQJA 9ICQA 1S0OA 4J9QA 1X9MA 1DK2A 5KFIA 2DVIA 4BXOA 3LWMA 5EWGA 4PGYA 3C5FA 4ED1A 1R8CA 3PVXA 1KSPA 4RPXA 5HRGA 1IXRA 5KT6A 2W8KA 2BCSA 5TZVA 2FPKA 5HMLA 4UB2A 3V6JA 1XSPA 1COOA 3OGUA 2V4QA 2J6TA 4QWEA 5KFAA 1VFGA 2XGQA 2W9CA 3C5GA 3PW7A 5IIKA 5DG9A 1PZNA 4M9JA 4JV2A 4FHWA 2DR8A 4DFMA 4IQUA 8ICOA 2DR9A 2P6RA 3ORYA 4FS1A 3M9NB 3HJ4A 4XQ7A 5KG6A 2VA8A 4UQGA 2M9NA 1KRPA 1VJ7A 1KLNA 3H4BA 1L3UA 2KP7A 1SKRA 1DK3A 1MSWD 3V72A 2ZH9A 3MDCA 4MFAA 4DL4A 4O3RA 2ZHAA 1YLQA 3PMLA 3PY8A 4R8UA 1NJWA 5HRBA 4DF4A 3AUOA 2BQUA 3RJKA 2HHQA 3M9OB 1ZETA 3PW5A 2AGPA 3HW8A 5KFJA 4M2YA 4ECVA 9ICCA 1KEJA 3PX6A 4IQTA 4J9PA 4DLGA 1L3TA 2I9GA 3EW9A 1T4GA 4UBCA 4ECWA 3NGDA 9ICSA 5KFHA 4ECQA 1ZQEA 1BPBA 3H4DA 2O1PA 2JEJA 4FS2A 2KTQA 8ICFA 2ID1A 3B0YA 7ICPA 3HT3A 1N48A 3JPTA 1RYRA 8ICUA 4X4VA 3JPRA 4QZFA 3C2LA 4GXKA 1XC9A 3MFHA 1QLNA 3ETLA 1X9WA 4FH3A 9ICLA 4AT9A 1IM4A 5DG7A 4C8LA 4M9GA 2KZ3A 2AQ0A 3RH5A 1JQRA 4X4QA 3KHGA 3UPSA 4M9LA 5DB7A 4RNNA 3AQNA 8ICAA 2R8KA 5KFQA 2PFQA 4O9MA 3M9MB 9ICPA 4WBYA 1T7PA 3UXPA 2J6SA 4X4TA 2KZMA 3RJEA 9ICRA 4TURA 2PBEA 5KFGA 1ZQYA 5KG2A 4QW9A 1U45A 3OJUA 1ZQOA 2UVRA 1BPDA 5BPCA 4B9TA 4DSIA 3C2KA 9ICFA 7ICKA 4GLXA 1S10A 4NLKA 2ASDA 7ICSA 4CCHA 4YR2A 8ICLA 3GV7B 4YP3A 1PX5A 5DBBA 1N56A 1B22A 1ZQNA 4DL7A 3MR5A 2C2DA 4UB3A 1ZQIA 1BPZA 3IM1A 1TK8A 4J9LA 4KLQA 1JXLA 5CB1A 5KG3A 2BR0A 4EP7A 2ASLA 2FPMA 2Y1IA 1ZQMA 4M47A 2BDPA 4MF8A 4P4MA 4MFCA 4I2IA 4RQ5A 3H39A 4DO9A 4J9OA 4KLTA 2RFFA 9ICUA 2BCVA 1KNYA 4UBBA 1R8AA 4WC2A 2DFLA 3T5JA 1MQ2A 4DL5A 4QZBA 3OSPA 3HPOA 5KFUA 1ZYQA 1SL2A 2ZH7A 4O3NA 5KFNA 1NKEA
chains in the Genus database with same CATH superfamily
5HR6A 3QE9Y 1XSNA 4FBTA 1L7MA 5ALFA 5J0RA 4TQSA 4BWJA 4YVZA 5ALWA 2FDRA 5DBCA 4KLGA 3TKAA 1D9DA 4X4NA 1SKSA 2O5AA 4F50A 2YMMA 5J0PA 3SI8A 4B9MA 2XVTA 2ZIUB 1D8LA 3N7SC 1IIPA 3SAGA 4JWMA 2HBJA 2WF7A 3HJEA 3SMVA 4HYKA 2WF9A 2ISOA 1RDFA 2HHTA 2YB4A 2BCUA 2FPLA 2M2TA 1ZQSA 3D6JA 4CGZA 1J2NA 3Q8KA 2D6FC 1Y88A 5KG1A 2M0NA 1JALA 1S97A 4O3SA 2ZH5A 5C0YA 4LEZA 3RB4A 4XA5A 3H8MA 4G3IA 4JV0A 4IQWA 9ICMA 3OWGA 3V6HA 4O68A 1UEVA 1ZQUA 4QWBA 2RDJA 1DRGA 2YN4A 3AU2A 4IRDA 2LI6A 4B9VA 2ES6A 3BQTA 3IDWA 2ZTDA 2VA3A 3T5KA 4F5NA 1UCVA 3RJHA 1ZD2P 4KITB 4FH5A 3JCFA 2G08A 3SV4A 3MDAA 2R8HA 3TAPA 4WC7A 4RQ8A 1ZQLA 2EDUA 3UXOA 4PJ0U 4ZOHC 3SZ2A 3O0FA 3QUQA 2IHOA 4I2BA 2LHTA 1ZQKA 3NVOA 3GIMA 2XY6A 3EF2A 2AU0A 1ZQGA 3QEBZ 3JZ0A 2Q66A 2DWQA 5D4BA 4U7CA 5B66U 1ZQWA 7ICGA 5HRHA 3C18A 2JXJA 4CNQA 1NK6A 1U9LA 2HBLA 1SB3C 3SD7A 3KHRA 5J2FA 1L8OA 4FE3A 1TAQA 2W9MA 4PL1A 2IMWP 4UB5A 1SKWA 4EBDA 1MQ3A 2ZTEA 4I2CA 1RXWA 1NI3A 2F1JA 4Y2YA 2W8LA 3JPNA 2LMRA 1O03A 4K96A 5AI5A 3UXNA 4A8EA 4NKTA 4I2JA 2FE9A 5AI8A 5DGAA 8ICHA 3PSTA 4K8VA 5C5JA 2NRTA 4DFPA 4RWQA 3FM9A 8ICPA 5CFTA 4DSFA 3H8SA 4DFDA 4Y2RA 1UA0A 3AQMA 3AQKA 5KFOA 7ICNA 4O3QA 2MU2A 1KL9A 4CDGA 2DRBA 3JPQA 3F2DA 4M5DA 3ED5A 2WF6A 1ZQXA 2ASJA 4WC6A 5J0SA 2DL0A 3ZDAA 4KB6A 1FFUA 2ZH6A 3TARA 3RRGA 3KZXA 9ICJA 2HHSA 4F5PA 2H3IA 3L9DA 3D2SA 2W7OA 2R8IA 4YR0A 2BPCA 3MR3A 1N60A 5ALOA 1D9FA 8ICXA 3B9JA 4I28A 2Y9UA 3WKEA 5L1LA 3BQ2A 5D62A 4QZDA 3ER8C 2N1RA 1PK3A 2KVSA 4IS7A 3KFUF 5CFUA 4XQ8A 2EANA 3PSIA 4I2DA 1C7YA 4X0AA 5KFXA 4USAA 1DGJA 2Q4TA 3JYYA 2HHUA 5ALIA 7ICJA 4RQ7A 2XI9A 4X4OA 3QZ7A 4IRKA 4DL6A 8ICBA 4P4OA 2MAXA 2ZIVB 4WQLA 1Q46A 4XJEA 4J9RA 5JTGA 4J9SA 4WJ3B 1VDVA 1RG6A 7ICRA 2QB1A 2XY5A 4DQRA 4RUCA 3QZ8A 1D8YA 1R89A 4NJ8A 8ICTA 1UEUA 2NO5A 2GO7A 4I2AA 4NLBA 4EENA 1NOMA 5EOZA 4F92B 3HIYA 4YMNA 3H0RB 5J8YC 1U49A 5KFZA 1L3VA 2WFAA 4EYHB 2KKVA 4DSJA 3WFRE 2MUTA 1JROA 3Q8QB 3CNHA 1SV0A 2RP5A 4B9NA 1WCNA 1JAJA 1CUKA 5HP4A 4ZH4A 3WFOA 5D49A 1EXNA 2D3DA 2FLNA 5CJ7A 4IG8A 4ELVA 5J2KA 2H3FA 4Q44A 4YD1A 1ZQBA 4F4WA 1V85A 4KLLA 2JZBA 2RDIA 2EZXA 4UARA 2BGWA 2DPIA 2QB0B 3D2NA 2EAOA 4DEZA 2A1JB 7ICMA 4K4HA 9ICHA 4RQ4A 3PX4A 4RQ6A 4M6WA 2C2EA 4IQVA 1NK7A 4LVSA 7ICOA 1Z1BA 2M2UA 3NKUA 1TFRA 2WB1C 4P0PB 3KHHA 1ZXIA 3HJ1A 3V7KA 3RB3A 4BX9C 3SQIA 7ICFA 2QARA 3NVZA 3Q8LA 3MABA 1TFYA 1HJPA 4UAUA 1X42A 2JEGA 2LPEA 1SV0C 2YX8A 5EWEA 4Y2TA 4GFJA 4CF3A 5ALPA 3KBBA 1ZQRA 3GIKA 1UETA 4US9A 4ELTA 4R63A 2FLLA 4AT9B 1ED1A 7ICLA 1PK1A 4AT7A 2W9BA 4GC7A 1TV9A 4ED6A 3BQ7A 3LK9A 1DGSA 2NRWA 4GC6A 3GQCA 4F2RA 1NNLA 2ZTCA 2HW3A 3T5HA 5DKWA 5DQIA 3RAXA 5CEHA 3GV5B 1V9PA 2C22A 2B21A 1NJZA 3DDHA 1N2XA 3PNCA 1L3SA 1YZ6A 5KFIA 1KKXA 5AM5A 5EWGA 4PGYA 3PVXA 1IG6A 1L6NA 2FPKA 4UB2A 1COOA 2J6TA 3WFQE 4UAVA 5DG9A 3BZKA 4IQUA 4DFMA 3M9NB 3HJ4A 5KG6A 2DGZA 4C4SA 2M9NA 1KRPA 1KLNA 1L3UA 1MSWD 2CPRA 4LEVA 4MFAA 2H3VA 4O3RA 3PMLA 4R8UA 4DF4A 3AUOA 5ALKA 3RJKA 1ZETA 9ICCA 5ALZA 3U26A 4J9PA 3EW9A 4UBCA 9ICSA 1BPBA 2B51A 2O1PA 4FS2A 8ICFA 3B0YA 7ICPA 3JPTA 4QZFA 3C2LA 4FH3A 3ETLA 1X9WA 5GTHU 4C80A 1IM4A 2WHEA 2KZ3A 2ZXIA 4X4QA 3KHGA 3AQNA 3CK6A 2PFQA 9ICPA 3VCBA 1T7PA 2J6SA 3RJEA 4TURA 3ER9B 5KFGA 9ICFA 3QUBA 4DSIA 1BPDA 2A3VA 2LYAA 1J2MA 2ASDA 3GV7B 5AKZA 3IG5A 1BPZA 2JV3A 3PZPA 4EP7A 2G07A 1ZQMA 2Y1IA 4KMOB 3NVVA 2BDPA 4PZNA 4I2IA 4RQ5A 2BCVA 1KNYA 4WC2A 2DUYA 2K89A 4C7ZA 5KFUA 4X0BA 2ZH7A 3H37A 2AJQA 2E1EA 5KFLA 3I76A 4C8MA 4PHEA 3H3AA 4B9LA 4KX3A 2AGOA 2E8NA 4RQ2A 3SYZA 3HILA 4DSEA 3BQ0A 3Q8MA 4Q45A 2KV2A 4BJQA 2W9AA 3AQFA 2MUTB 2NV3A 3NRWA 2ZH2A 3IN5A 5ALVA 4Z6FA 3TADA 1IV8A 1Z1VA 4M0AA 2E8MA 1OXJA 4KN4A 2F76X 5JU5A 4ED7A 4DWIA 1FFVA 1BGXT 8ICCA 1ZQVA 1KFSA 5J2EA 5CP2A 4QZEA 1QCKA 2UVUA 5KFRA 1WCLA 3ISBA 4DOCA 2DRAA 4RPYA 5HMMA 4F5OA 5KFWA 1TE2A 3RJIA 3H8WA 7ICUA 4MKPA 1CRXA 5F9LA 1KDHA 8ICVA 1UT5A 2XCAA 3N28A 1SL0A 4OJOA 2ISPA 1LKYA 9ICIA 4EZ6A 3FDSA 4E0DA 3C2MA 2NRKA 3TACB 4RT3A 4M9NA 2G0AA 2K4PA 5KL8B 4UD4A 3SEIA 3MGIA 2OYYA 1K1SA 5KTQA 2D8CA 2FJ6A 3LVVA 3SR6A 4AT8B 3OTQA 5DG8A 1N5WA 3THVA 4LEWA 2DKXA 4FHPA 2KSOB 5DGBA 4K9AA 4DQIA 3QU5A 4OJ5A 1N5XA 5L9XA 3WFPA 2W54A 4KLJA 5ALJA 4MFFA 4O67A 2G5HB 2F1HA 3A0HU 2EAMA 4CF4A 5J2CA 4O6AA 3ZDDA 3PMNA 3HKZF 5AK3A 4DQSA 4UB4A 3TAQA 1FEZA 3M6ZA 5D61A 4IR9A 4WH5A 2DF4B 3C66A 4E80A 1T3NA 1TVAA 3KOOA 3H40A 5AM3A 5J2HA 3QU7A 2OEHA 4O69A 3M8RA 2P35A 2JHDA 3JPSA 4X4SA 1YT3A 3RAQA 5KT5A 4QZHA 2LYBA 1K1QA 2OCEA 4FO6A 5L1MA 3QNMA 3NASA 5DB9A 4KLEA 1WWVA 4F5RA 3LWLA 4EX6A 5KFDA 1GPJA 5L1KA 2IOFK 1FA0A 1Z3EB 8ICYA 5ALGA 1QQ5A 2KHQA 4F4KA 2DKZA 3E58A 3OV7A 4BUGA 4E8FA 2C28A 1H38A 1XWLA 2HVIA 5J0XA 4ECXA 3GIJA 1T8EA 3C29A 1XO1A 3C23A 4C4RA 1TKDA 1D8BA 3TFRA 2ZHBA 2DR5A 4DL2A 2XC9A 1AQ6A 2LYHA 1ZJNA 4C4TA 1SZPA 3N97B 9ICAA 1NK9A 4Q8FA 3MGHA 5HHHA 2A19A 4J9KA 4M9HA 4I2FA 2FCLA 4ATBA 3ZDBA 8ICSA 1U47A 5J0QA 1KBUA 3CYMA 5HC9A 1SIJA 3T3FA 1A6SA 3E2EA 4DS4A 2F77X 4JUZA 3EWAA 5AKKA 4KMUA 2HOFA 5DBAA 4Z6DA 3EUB2 5T14A 5CWRA 3I1YA 5CHEA 3OUYB 4CE6A 5KFVA 5JUMA 3JPPA 5HRFA 2UVVA 4DOAA 5CR0A 2P66A 2HDOA 2ZJ8A 5DEDA 4KLIA 2W11A 4JV1A 2ZUCA 8ICQA 4C0ZA 4PZOA 9ICBA 5KT4A 1OU5A 4NLNA 4PHDA 1S0VA 4PH5A 2M2VA 3NRZA 4Y2UA 1SV4A 5IIJA 5IINA 5ALEA 2LM1A 1V97A 2ESEA 3MFIA 1NKCA 4IRCA 4X4UA 5J2JA 1HUZA 8ICNA 4Y2PA 5KG7A 3PW0A 1ZD5A 2WAQF 2IA6A 3KKAA 2IHMA 4R64A 5EE0A 4BXOB 8ICZA 4YR3A 5HRLA 2B0CA 2W9CB 2WTFA 5AM1A 2ODGA 3AQEA 4RQ0A 4Q8EA 1WOTA 4ELUA 4WC5A 4FZNA 2IBKA 1RM6C 3Q8RB 5CRXA 5KFFA 5BOMA 3RB0A 2HBKA 4LJXA 2B56A 2ZIXA 5B5EU 3OHAA 1TFWA 8ICRA 2HMXA 4FBUA 9ICVA 3AMZA 3N7PD 3BS7A 4ECZA 5DB6A 2KFNA 4UATA 4P0QA 5CHGA 4PHPA 4JMUA 3BJYA 5HRIA 1UA1A 4C8KA 3WKAA 1ZRNA 2BBHA 1TK5A 1X66A 3AQLA 2IHNA 2IUBA 2LM4A 1B43A 1NZBA 4K4GA 3QUCA 7ICIA 3IG8A 5ALYA 1PVQA 2KVCA 5DQGA 4F8RA 4KLHA 4GXJA 2E5SA 3LQCB 2K4IA 1HEKA 1X6IA 3R9KA 2PI5A 1V38A 5AI6A 5HR9A 2KJ8A 2JGAA 2W43A 4FHYA 4MEXA 5HRKA 4Y2VA 5EE3A 4QWCA 4RNOA 1S0OA 4J9QA 1X9MA 3C5FA 3BS5A 5TISU 1KSPA 5AKLA 1XSPA 1VFGA 3PW7A 2KICA 1PZNA 2P6RA 4UQGA 5AK6A 3H4BA 4OJLA 4JLXA 1DK3A 4DL4A 1YLQA 1NJWA 4G9BA 2HHQA 2AGPA 3HW8A 4RQNA 3S6JA 3PX6A 5EE1A 2PMZF 4DLGA 2I9GA 4NXWA 1T4GA 2BDUA 5ALMA 1ZQEA 1ZD3A 2JEJA 2KTQA 1S8OA 4X4VA 2E8PA 4GXKA 1XC9A 2Z7JA 3GZFA 5DG7A 5B3PA 2AQ0A 3RH5A 4WOYA 4M9LA 5DB7A 4K99A 2KEYA 4RNNA 4I0UA 5KFQA 2W3RA 2PKEA 3UXPA 4X4TA 2KZMA 1URJA 2PBEA 5AKEA 1PUZA 2EH9A 1S10A 2EAPA 2MRLA 7ICSA 4CCHA 8ICLA 4YP3A 1N56A 1B22A 4DL7A 2KD1A 2E8OA 1Z4OA 2LBOA 1SXDA 3K1ZA 5KG3A 1VLBA 3A0BU 1N63A 4M47A 4MF8A 4Y2JA 3I28A 4KX5A 3H39A 4KLTA 2RFFA 5ALHA 4EEKA 2I6XA 1ZYQA 5KFNA 3NVYA 4F91B 4WC1A 2DPJA 5J2BA 4EV6A 3RRHA 4X4RA 3N7RC 4WBZA 1X6JA 4UB1A 1NKBA 2BCQA 2PFPA 3WFSC 2NRZA 5J2IA 5K4LA 4EBJA 4NXZA 1QQ6A 2EZZA 5AM2A 4EGWA 4AP9A 1R8BA 4UD5A 1FIQA 1MA7A 4QJFB 2HN1A 4NL9A 1S0NA 4F4ZA 5AK4A 3WKBA 1SL1A 4F4YA 4US8A 9ICTA 2HOIA 4YXJA 3C1ZA 2ZIWA 2XY7A 4KLUA 3ERCC 2AXTU 7ICVA 4ECTA 3AN1A 4QZ8A 4YCXA 2HVHA 2WF8A 4RUAA 5J0OA 5GTIU 4NM1A 2F3NA 1TAMA 4UASA 4RQ3A 2KNJA 1L5UA 3PHZA 4DFKA 2FLPA 4Q43A 3C1YA 5G5GA 4PHAA 3MR6A 3GIIA 5L1JA 2GAFD 5AIBA 1KFTA 1NK0A 2Y0SF 1F0MA 5KFYA 3AL0B 4C8NA 1F5AA 4OCZA 4I27A 2OXOA 5BOLA 2HOQA 1HUOA 2KK0A 4NXXA 3NTUA 1P7DA 4O3MA 2FMSA 4N7RA 2KKPA 4Y2XA 2K4HA 2R8JA 1SGGA 1Q8KA 3F53A 1CEZA 4FZLA 3WK6A 4NXVA 4FZMA 5KNIA 4ED0A 4C8OA 1Q78A 5B3QA 4HAIA 2F1IA 2K4EA 5EE9A 2ZIUA 2MSNA 2XO7A 4B9SA 3OJSA 5KG0A 3GILA 4EEYA 2NO4A 5IIOA 4O0IA 3EYZA 1BNOA 2F44A 2OM6A 3C28A 4NLZA 1RXVA 2DBYA 3G6XA 4PGQA 5E79U 1NJXA 1LVHA 1QSSA 1BVSA 4NLCA 5J29A 2W03A 2DQNB 4OAHA 5H2FU 3BS5B 1ZJMA 2B4VA 2OH2A 3WK4A 9ICGA 4PGXA 1ZQAA 3OVBA 5DECA 3BQ1A 4S3NA 2RRDA 1F5SA 3PV8A 4RNMA 5IIMA 4P4PA 3V6KA 9ICEA 4RU9A 1UT8A 4QNLA 2KN7A 3OPXA 1XS9D 3HWTA 2GWSA 4RQMA 4QWDA 3V7LA 3L5KA 1X9SA 1B0XA 2E3TA 2HI0A 2YTUA 1ZRMA 2JMGA 3MC1A 2FMPA 4P2HA 2KJ5A 1ZQCA 1LV5A 2Q0ZX 4E7XA 2OHFA 1A0PA 2BCRA 2JZBB 4LZDA 1RQLA 1A76A 5HRDA 3QUTA 5KFKA 1DXSA 2CN1A 3V7JA 2W3SA 4Z6EA 1XSLA 4OD0A 5DB8A 1MIWA 2XGPA 4EZ9A 1O08A 1NJYA 2WAQC 4UAZA 2ZXHA 4M6WB 4DSLA 2H5XA 1PVRA 2ZH8A 4KN7A 3WK7A 3ZD9A 4CF5A 2QARB 5KT7A 3M8SA 3RJGA 4YMOA 1NK5A 3C21A 5J0UA 3PR4A 5HNKA 4YMMA 1Z19A 1QSLA 4XRHA 4ECYA 2R8GA 2KJ9A 4UB8U 2QKQA 3F2BA 2VJ5A 3J81j 4I2EA 3PX0A 3TADC 4RQ1A 3KHLA 5KFMA 1PK1B 2NRVA 5HHIA 2W9BB 3G6VA 4AT7B 4RWOA 4DQQA 4K9BA 1RYUA 5F9NA 8ICWA 1Z00A 2IOFA 3RR7A 3RJJA 4F2SA 5KT2A 3ZDEA 1ZQDA 2HBMA 3WK5A 5IIIA 4NY8A 1SWWA 4FHVA 1K5OA 3ZI4A 2ZUDA 2KFZA 3H8JA 2PFOA 2HHWA 5J0YA 4K98A 2BE3A 2FI1A 4KLDA 5DDMA 2FMQA 1LB2B 1U4BA 3MGVA 3ONNA 5KFTA 3ALRA 3IP4B 4IR1A 4R66A 5A0LA 2NRXA 2V9WA 3H0MB 4OAIZ 4GIBA 1ZQZA 5AI9A 4O5EA 2EWRA 1OUQA 2ZIVA 4WC4A 3WK8A 4Z6CA 3TANA 4XUSA 4R8UB 4QWAA 3F5AA 2I5HA 4RWNA 3QU2A 5J2DA 3MBYA 1TK0A 3ZD8A 3PSPA 4O5KA 2HHXA 4I2GA 4DQPA 4BGDA 5AM4A 3UQ0A 3NUQA 4O3OA 4O3PA 2PMZC 2RLTA 4EBEA 1QQ7A 3ISCA 2RHFA 4DF8A 4M04A 2ZJAA 8ICJA 2JH7A 4TUSA 2AGQA 2BZFA 3RH4A 2NYVA 4UB6U 4ED8A 5AKGA 2XICA 2BPGA 4FHXA 1L8LA 1C20A 1HIWA 5KG5A 3RTVA 4KLOA 5KFPA 3RB6A 2GH1A 3GFKB 1ZQPA 1Z4NA 9ICXA 2QB0A 1S77D 2WF5A 4QIWF 3AM9A 3RBEA 2I1QA 2A1JA 3E0FA 5AHXA 2DVIA 1SZHA 1DK2A 4ED1A 4Y2QA 4JLZA 5HRGA 1IXRA 5KT6A 2W8KA 2BCSA 5TZVA 2KOBA 2VKQA 5HMLA 3V6JA 4QWEA 5KFAA 4K97A 2XGQA 3C5GA 5AICA 4FHWA 4P0PA 3ETRA 2DR8A 8ICOA 2DR9A 3ORYA 2IOHA 2KP7A 3VC8A 1SKRA 2ZH9A 3V72A 3MDCA 1JRPA 5HRBA 3UMBA 2BQUA 1L7PA 3M9OB 5KFJA 4M2YA 1KEJA 5ALTA 2W55A 3NGDA 5KFHA 4ECQA 2YB1A 3H4DA 1MN8A 5JRTA 2F8LA 3HRDD 1N48A 3F5EA 3M7DA 3JPRA 9ICLA 4AT9A 1L7NA 4M9GA 1JQRA 3UPSA 3LVWA 8ICAA 2R8KA 4O9MA 4WBYA 9ICRA 1ZQYA 1U45A 4B9TA 2UVRA 5BPCA 1RQNA 4NLKA 4YR2A 5AKIA 5DBBA 2O6KA 1ZQNA 2JH1A 4UB3A 1ZQIA 3DEEA 4KLQA 5CB1A 3KD3A 1LKYB 2FPMA 2EZYA 2YY6A 4J9OA 9ICUA 1R8AA 2DFLA 2Y0SC 3T5JA 4DL5A 5F3XB 3OSPA 1VJ7A 2YMPA 8ICGA 4LZGA 4F3OA 3D2QA 3K75D 5ALQA 4QZGA 4I2HA 3RF9A 4QZCA 1JIHA 2HHVA 3AU6A 2KMDA 3TFSA 2VA2A 4OJ6A 2DR7A 4EBCA 1UQVA 1TAUA 3HX0A 1Z00B 7ICTA 4QZIA 4YFKA 3H38A 3DV9A 5J0WA 3KKAC 3QX7A 4YQWA 2ZUBA 5DLFA 3EPGA 5J8YA 1FO4A 4EEDA 5KT3A 1ZQFA 2BQRA 3SV3A 2RQ5A 3NS1A 1N62A 5DQHA 1GO3F 4I29A 3SAHA 1L7OA 1NZPA 4BDPA 4DS5A 5AI0A 4AYBF 3K4GA 5KFEA 4YXMA 5ALNA 4B9UA 5HREA 1ZQQA 2K60A 2ZH3A 1XU4A 3GDXA 1WUDA 5AKYA 5G5HA 4KLFA 2CXYA 1F44A 5KAIU 4F72A 4NXUA 2HHPA 2JRZA 1M6YA 7ICHA 3WK9A 1S9FA 3Q8PB 1BPEA 3UQ2A 3IHQB 4U6PA 4KM5A 4TUPA 2OWOA 2LKYA 2JEFA 1V4AA 2HCFA 3PO5A 4KLSA 4X4PA 1MIYA 1BNPA 4PL2A 3UPQA 2XIDA 4TQRA 1UHUA 3BDPA 2C2RA 9ICNA 3UM9A 3CP8A 4HX0A 4F4XA 5ALSA 2EQYA 1NK4A 1T3QA 5KG4A 5L1IA 3FAHA 4KTQA 4OO1J 4NKUA 1AROP 2XCPA 4EBKA 8ICMA 1JX4A 4WC0A 4NV0A 1QH9A 4ATBB 3LDAA 2F2AB 4ED2A 2BKEA 3JPOA 1KW4A 4NLGA 2HSZA 5ALLA 2QLTA 4ECUA 3WKDA 2MA1A 3GV8B 4KLMA 2ALZA 2ZH1A 4UAYA 4CRXA 4YD2A 2VJ4A 1QTMA 4LEYA 4IL6U 1KFDA 1S0MA 3NYBA 3B0XA 2BBJA 2GA9D 2KG5A 4IC9A 3FYHA 5J2AA 4DSKA 3K1RB 4JWNA 3ZDCA 4R65A 4FFDA 9ICWA 4RPZA 4EX7A 5D46A 2M2WA 4J03A 4MHVA 5AKXA 1X2IA 4DCCA 1JI7A 4FO1A 4ED3A 1J97A 1WWUA 4AT8A 4EYIB 2KHVA 3GU3A 3H7IA 1N61A 3SENA 4YN4A 3TI0A 4EEBA 3HKZC 2GLEA 1ZQHA 2KSOA 1RPLA 5AI4A 1OW5A 3QU4A 5KL1B 1KN5A 3QU9A 3QXGA 2W04A 3OSNA 4QW8A 1JN3A 4DLEA 4MEYA 2BPFA 4RT2A 2ZJ5A 1WG8A 4UAWA 3HP6A 3ISDA 3MR2A 4YG2A 5IILA 1B4FA 2BHNA 4DL3A 4LT6A 4WC3A 2ZH4A 2J6UA 4OAGA 4DOBA 1CI4A 1JMSA 1S76D 1ZQTA 5JTIA 2ZIXB 3Q8SB 4WQKA 1KTQA 3LYSA 9ICOA 2AQ4A 2HN2A 1RZTA 3QYPA 8ICIA 4UW9A 1U48A 4OJPA 1A77A 4DFJA 1NO5A 3RR8A 4JB3A 2G09A 4NL9C 1QSYA 1DOQA 3QEAZ 4P0QB 2BQ3A 2H3ZA 2PI4A 8ICKA 1KQQA 4F93B 5HR7A 1MC8A 5ALRA 3N4MB 2PXIA 5AKHA 4J9MA 3PR5B 5DDYA 4J9NA 1XNSA 5AM0A 4X5VA 2JEIA 7ICEA 3PO4A 4RWPA 5F2VO 3PW4A 8ICEA 4GXIA 1YZ7A 4QZ9A 3EPIA 2Y1JA 3MCRA 4QZAA 3WKCA 2H3QA 5ALDA 5EWFA 2CRXA 2K8AA 2K8CB 3NVWA 3UMGA 3RBDA 5KFCA 3TQ1A 2E1FA 4JK1A 4QIWC 4K4IA 4ECRA 1Q3UA 2G06A 2VANA 1SXEA 5J2GA 4ECSA 1PVPA 2KIVA 4BWMA 2ZG6A 2A1AA 1T94A 3OHBA 5DLGA 3SAFA 3KTQA 2Y9TA 4MF2A 2F8KA 3T5LA 2V4RA 4NM2A 2G5IB 3AEVA 4EELA 3OUYA 3UMCA 2PFNA 2KZZA 1ECWA 5ALUA 7ICQA 9ICKA 2YMLA 4PPXA 4RZRA 2W7PA 5KFSA 3NWIA 4O5CA 4B6JA 3CW2C 3G6YA 2UVWA 4C7YA 2VIXA 3OVAA 1S5LU 3EZ5A 1NK8A 1WYGA 1JXEA 3OVSA 5AKJA 5KFBA 2KE7A 3KZIU 5CA7A 1BPYA 2JR5A 3RH6A 3WU2U 3L3FX 4F5QA 3K7DA 2P6UA 4Y2SA 3PW2A 5KAFU 1Q79A 1ZOLA 4WCWA 4TUQA 2GOLA 1UPHA 2AH5A 3RJFA 3M6KA 2ATLA 5AIAA 5J0TA 1BPXA 1MIVA 4NXTA 2KIWA 1RYSA 4OAFA 1ZQJA 3L4PA 9ICQA 3BZCA 4BXOA 3LWMA 2YMQA 2WB1F 2K8BB 1R8CA 2B6GA 4RPXA 2AHOB 2V4QA 3OGUA 1XO0A 3PSFA 2W9CA 4M9JA 5IIKA 4JV2A 4FS1A 4XQ7A 2VA8A 1Q3VA 3CRXA 3T79A 2L5YA 2ZHAA 2R18A 3PY8A 3F2CA 3PW5A 4ECVA 4IQTA 5AK5A 1L3TA 3RFAA 2YQEA 1ZD4A 5CFSA 1VJ5A 4ECWA 3IRUA 2ID1A 3HT3A 1RYRA 8ICUA 3MFHA 1QLNA 4C8LA 2ZIWB 3M9MB 4F71A 4ICAA 4NWIA 5KG2A 4QW9A 1ZQOA 3OJUA 3FC4A 3M1YA 5D63A 3C2KA 7ICKA 4GLXA 1ZQ1C 1X9XA 1PX5A 5FP0A 3MR5A 2C2DA 3IM1A 1TK8A 1X40A 4J9LA 4AYBC 1JXLA 2BR0A 5ALXA 4ACOA 2ASLA 1COKA 4P4MA 4MFCA 1JUDA 3IV6A 4DO9A 4UBBA 1SWVA 3H0LB 1MQ2A 4QZBA 3HPOA 1SL2A 3ICXA 4O3NA 1NKEA
chains in the Genus database with same CATH topology
4F91B 5KFLA 4WC1A 4C8MA 2DPJA 5J2BA 4PHEA 3RRHA 4X4RA 3QE9Y 1XSNA 4F3OA 4LZGA 3H3AA 4B9LA 2AGOA 4RQ2A 4WBZA 4FBTA 4QZGA 3K75D 4UB1A 5J0RA 3SYZA 4TQSA 1NKBA 2NRZA 4YVZA 4BWJA 5J2IA 2BCQA 2PFPA 4I2HA 3WFSC 4DSEA 5DBCA 4KLGA 4QZCA 3BQ0A 1JIHA 2HHVA 3AU6A 1D9DA 4EBJA 4X4NA 4NXZA 3TFSA 3Q8MA 1SKSA 2VA2A 2DR7A 2O5AA 4Q45A 4F50A 4EBCA 2W9AA 5J0PA 1R8BA 3SI8A 1TAUA 4B9MA 2MUTB 1Z00B 3HX0A 1D8LA 7ICTA 4QZIA 4YFKA 3H38A 4UD5A 2ZH2A 1JAJA 5J0WA 4JWMA 1S0NA 4YQWA 4F4ZA 2ZUBA 5DLFA 3EPGA 4Z6FA 4HYKA 1SL1A 2ISOA 4F4YA 4M0AA 2HHTA 5KT3A 1ZQFA 9ICTA 4KN4A 2BCUA 4YXJA 2BQRA 2FPLA 3SV3A 1ZQSA 2M2TA 3C1ZA 2XY7A 4KLUA 4ED7A 4DWIA 5DQHA 3Q8KA 7ICVA 4ECTA 4QZ8A 1BGXT 4YCXA 8ICCA 2HVHA 1ZQVA 1KFSA 5J2EA 4I29A 1Y88A 4RUAA 5KG1A 5CP2A 4QZEA 5J0OA 2UVUA 1NZPA 5KFRA 4NM1A 4BDPA 1S97A 4DS5A 1WCLA 4O3SA 2ZH5A 3ISBA 4DOCA 5KFEA 3K4GA 4RQ3A 2DRAA 4RPYA 5HMMA 4F5OA 1L5UA 4YXMA 5KFWA 4B9UA 3RJIA 1ZQQA 3H8WA 4DFKA 3RB4A 4XA5A 2FLPA 7ICUA 4Q43A 3C1YA 4G3IA 2ZH3A 4JV0A 5F9LA 1KDHA 4IQWA 9ICMA 1XU4A 3GDXA 4PHAA 3MR6A 3GIIA 8ICVA 3V6HA 1UT5A 2XCAA 5L1JA 4KLFA 1UEVA 1ZQUA 1SL0A 4QWBA 2RDJA 2ISPA 1KFTA 1NK0A 9ICIA 4EZ6A 3FDSA 3AU2A 4E0DA 5KFYA 3C2MA 2NRKA 2HHPA 4C8NA 4RT3A 7ICHA 1F5AA 4IRDA 1S9FA 4M9NA 4B9VA 3Q8PB 1BPEA 3UQ2A 3IHQB 4I27A 5BOLA 4TUPA 4UD4A 3BQTA 2ZTDA 2VA3A 3MGIA 3T5KA 4F5NA 1HUOA 2JEFA 1K1SA 2OWOA 1V4AA 5KTQA 3NTUA 5HRFA 2FMSA 3PO5A 4AT8B 4KLSA 5DG8A 3RJHA 4X4PA 1MIYA 3THVA 2R8JA 1BNPA 4KITB 3UPQA 4FH5A 4FHPA 3SV4A 3MDAA 2R8HA 5DGBA 3TAPA 1CEZA 4WC7A 4RQ8A 4DQIA 1ZQLA 4TQRA 5L9XA 3BDPA 3UXOA 2C2RA 4KLJA 4ED0A 4C8OA 4MFFA 3SZ2A 9ICNA 1Q78A 2F1HA 4I2BA 4F4XA 1ZQKA 3GIMA 2XY6A 1NK4A 5J2CA 2AU0A 1ZQGA 3ZDDA 3QEBZ 3PMNA 2F1IA 5KG4A 3JZ0A 5L1IA 4KTQA 2Q66A 4DQSA 4UB4A 4NKUA 3TAQA 5D4BA 7ICGA 5HRHA 1ZQWA 3C18A 4IR9A 1AROP 2XCPA 2XO7A 4B9SA 1NK6A 1U9LA 3OJSA 4EBKA 3C66A 3KHRA 8ICMA 5J2FA 1T3NA 1JX4A 4WC0A 4ATBB 4E80A 5KG0A 3LDAA 3GILA 4EEYA 1TAQA 1TVAA 4ED2A 2W9MA 2IMWP 5IIOA 3H40A 2BKEA 4O0IA 3JPOA 4UB5A 1SKWA 3EYZA 4EBDA 1BNOA 4NLZA 5J2HA 1MQ3A 1RXVA 4NLGA 2ZTEA 4I2CA 3G6XA 1RXWA 3M8RA 2F1JA 4PGQA 4ECUA 2W8LA 3JPNA 3JPSA 4X4SA 1NJXA 3UXNA 4NKTA 4I2JA 5DGAA 1BVSA 5KT5A 4QZHA 3RAQA 3GV8B 1QSSA 4KLMA 8ICHA 2ALZA 2ZH1A 5J29A 1K1QA 5C5JA 4UAYA 4FO6A 4YD2A 1QTMA 2NRTA 1ZJMA 5DB9A 4DFPA 4KLEA 1KFDA 1S0MA 4RWQA 9ICGA 3NYBA 4F5RA 3B0XA 3LWLA 8ICPA 4DSFA 3H8SA 5KFDA 4PGXA 5L1KA 1UA0A 1ZQAA 3OVBA 1FA0A 5DECA 3BQ1A 1Z3EB 4S3NA 3FYHA 3AQMA 5J2AA 8ICYA 3AQKA 5KFOA 3PV8A 4DSKA 4O3QA 7ICNA 4JWNA 2DRBA 4RNMA 5IIMA 4P4PA 3V6KA 3ZDCA 3JPQA 4R65A 8ICGA 4RU9A 9ICEA 4M5DA 1ZQXA 1UT8A 2KN7A 2ASJA 4F4KA 3OV7A 9ICWA 4RPZA 4WC6A 5D46A 4E8FA 5J0SA 2M2WA 1XS9D 2C28A 1H38A 3ZDAA 3HWTA 1X2IA 2GWSA 2ZH6A 3TARA 4QWDA 4ED3A 3RRGA 3V7LA 9ICJA 1XWLA 1X9SA 2HHSA 4F5PA 4EYIB 2HVIA 5J0XA 4AT8A 4ECXA 3GIJA 3H7IA 1T8EA 3L9DA 1XO1A 4YN4A 3C23A 3TI0A 2FMPA 4P2HA 1TKDA 1ZQHA 1ZQCA 1RPLA 3TFRA 2ZHBA 1LV5A 2DR5A 4DL2A 2Q0ZX 4E7XA 2XC9A 2R8IA 4YR0A 2BPCA 2LYHA 3MR3A 1ZJNA 2BCRA 2JZBB 1SZPA 4LZDA 3N97B 1D9FA 3OSNA 8ICXA 9ICAA 4QW8A 1JN3A 4I28A 1A76A 4DLEA 1NK9A 4Q8FA 4MEYA 3MGHA 5HRDA 5HHHA 5KFKA 5L1LA 3BQ2A 3V7JA 4J9KA 4M9HA 2BPFA 4QZDA 4I2FA 4Z6EA 4RT2A 2ZJ5A 1XSLA 3ZDBA 4ATBA 5DB8A 1MIWA 8ICSA 2XGPA 1U47A 2UVVA 5J0QA 4EZ9A 1NJYA 4XQ8A 4UAWA 3HP6A 4UAZA 4I2DA 5HC9A 4M6WB 3ISDA 3T3FA 5KFXA 1C7YA 4X0AA 4DSLA 3E2EA 4DS4A 3JYYA 2HHUA 3MR2A 4YG2A 2H5XA 5IILA 2BHNA 4JUZA 4DL3A 3EWAA 4LT6A 4WC3A 2ZH4A 2J6UA 4KMUA 7ICJA 4X4OA 4RQ7A 3QZ7A 4IRKA 4KN7A 4DL6A 8ICBA 2ZH8A 4P4OA 4DOBA 1JMSA 2MAXA 3ZD9A 5DBAA 1S76D 5KT7A 4Z6DA 1ZQTA 3M8SA 3Q8SB 1KTQA 9ICOA 4J9RA 2AQ4A 3RJGA 5CWRA 4YMOA 4J9SA 1NK5A 3C21A 3OUYB 1RZTA 7ICRA 5KFVA 5JUMA 8ICIA 3JPPA 1U48A 2XY5A 4DQRA 4RUCA 5J0UA 1A77A 5HNKA 4YMMA 3PR4A 3QZ8A 4DOAA 4XRHA 4DFJA 5CR0A 2P66A 4ECYA 1D8YA 2R8GA 3WFQE 1R89A 8ICTA 1NO5A 3RR8A 1UEUA 4I2AA 1NOMA 2ZJ8A 5EOZA 1DOQA 4F92B 1QSYA 3HIYA 3QEAZ 4YMNA 4I2EA 2BQ3A 8ICKA 3PX0A 2PI4A 5DEDA 4KLIA 2JEIA 1U49A 4RQ1A 5KFZA 3KHLA 4F93B 1L3VA 4JV1A 1MC8A 2ZUCA 5KFMA 8ICQA 4AT7B 2NRVA 5HHIA 2W9BB 3G6VA 2PXIA 4EYHB 4J9MA 3N4MB 4DQQA 4DSJA 4RWOA 9ICBA 3WFRE 5F9NA 3PR5B 2MUTA 1Z00A 5KT4A 5DDYA 3Q8QB 4J9NA 8ICWA 3RR7A 1OU5A 3RJJA 4NLNA 4PHDA 1WCNA 4B9NA 1CUKA 4PH5A 4X5VA 5HP4A 3PO4A 4F2SA 1S0VA 4ZH4A 5KT2A 5D49A 1EXNA 3ZDEA 7ICEA 2M2VA 3WFOA 4RWPA 5F2VO 2FLNA 3PW4A 1ZQDA 8ICEA 4GXIA 5IIIA 5CJ7A 4NY8A 4ELVA 5IIJA 5J2KA 4IG8A 4QZ9A 4FHVA 5IINA 4Q44A 3WFPA 4YD1A 3MFIA 1ZQBA 2ZUDA 4F4WA 1NKCA 3EPIA 2Y1JA 4KLLA 2JZBA 2RDIA 3H8JA 4QZAA 2PFOA 4IRCA 2KFZA 1QSLA 2HHWA 2BGWA 5J2JA 5J0YA 1HUZA 2DPIA 4X4UA 8ICNA 2BE3A 5EWFA 5KG7A 5HREA 3PW0A 4KLDA 5DDMA 2IA6A 4DEZA 2FMQA 2A1JB 2IHMA 4R64A 7ICMA 3RBDA 1LB2B 1U4BA 5KFCA 3TQ1A 4K4HA 4BXOB 9ICHA 4JK1A 4RQ4A 4K4IA 4ECRA 3PX4A 5KFTA 4RQ6A 2VANA 5J2GA 4ECSA 4M6WA 2C2EA 8ICZA 4YR3A 4IR1A 4IQVA 1NK7A 4LVSA 7ICOA 2M2UA 5HRLA 4BWMA 2W9CB 4R66A 2WTFA 1TFRA 2NRXA 3KHHA 2V9WA 3OHBA 5DLGA 3KTQA 3H37A 1ZQZA 4RQ0A 4Q8EA 4MF2A 4O5EA 4ELUA 1WOTA 3HJ1A 4WC5A 3V7KA 2V4RA 3T5LA 2IBKA 4NM2A 3RB3A 3Q8RB 4WC4A 7ICFA 4Z6CA 5KFFA 5BOMA 3TANA 3Q8LA 3RB0A 3MABA 4XUSA 4R8UB 3OHAA 4QWAA 1TFWA 1TFYA 3OUYA 1HJPA 4RWNA 2PFNA 5J2DA 3MBYA 8ICRA 2KZZA 2JEGA 1TK0A 3ZD8A 4FBUA 9ICVA 4O5KA 2HHXA 4I2GA 7ICQA 4DQPA 4BGDA 5EWEA 4ECZA 5DB6A 9ICKA 3UQ0A 2KFNA 4O3OA 4O3PA 4RZRA 4PPXA 5CHGA 4EBEA 4PHPA 3ISCA 1ZQRA 3GIKA 4DF8A 5KFSA 1UETA 3BJYA 4ELTA 4M04A 4R63A 2ZJAA 2FLLA 4O5CA 8ICJA 5HRIA 1UA1A 4C8KA 4AT9B 3G6YA 2UVWA 7ICLA 4AT7A 3OVAA 2W9BA 1TK5A 4GC7A 3AQLA 1TV9A 2IHNA 4ED6A 4TUSA 2AGQA 1B43A 3EZ5A 1NK8A 1JXEA 4K4GA 3RH4A 7ICIA 3OVSA 3LK9A 1DGSA 5KFBA 5CA7A 2NRWA 1BPYA 4GC6A 4ED8A 3RH6A 3GQCA 4F2RA 4F5QA 2BPGA 5DQGA 4F8RA 4KLHA 4FHXA 4GXJA 2ZTCA 4X0BA 2HW3A 5KG5A 2P6UA 3PW2A 3RTVA 4KLOA 3T5HA 3LQCB 5KFPA 3RB6A 1Q79A 4WCWA 5DKWA 5DQIA 3GFKB 3RAXA 4TUQA 2PI5A 1ZQPA 5HR9A 2AJQA 9ICXA 3RJFA 3GV5B 1S77D 1V9PA 2C22A 2B21A 1NJZA 2ATLA 5J0TA 1BPXA 1MIVA 4FHYA 4MEXA 1RYSA 3PNCA 1L3SA 5HRKA 3RBEA 2I1QA 2A1JA 4QWCA 4RNOA 1ZQJA 9ICQA 1S0OA 4J9QA 1X9MA 1DK2A 5KFIA 2DVIA 4BXOA 3LWMA 5EWGA 4PGYA 3C5FA 4ED1A 1R8CA 3PVXA 1KSPA 4RPXA 5HRGA 1IXRA 5KT6A 2W8KA 2BCSA 5TZVA 2FPKA 5HMLA 4UB2A 3V6JA 1XSPA 1COOA 3OGUA 2V4QA 2J6TA 4QWEA 5KFAA 1VFGA 2XGQA 2W9CA 3C5GA 3PW7A 5IIKA 5DG9A 1PZNA 4M9JA 4JV2A 4FHWA 2DR8A 4DFMA 4IQUA 8ICOA 2DR9A 2P6RA 3ORYA 4FS1A 3M9NB 3HJ4A 4XQ7A 5KG6A 2VA8A 4UQGA 2M9NA 1KRPA 1VJ7A 1KLNA 3H4BA 1L3UA 2KP7A 1SKRA 1DK3A 1MSWD 3V72A 2ZH9A 3MDCA 4MFAA 4DL4A 4O3RA 2ZHAA 1YLQA 3PMLA 3PY8A 4R8UA 1NJWA 5HRBA 4DF4A 3AUOA 2BQUA 3RJKA 2HHQA 3M9OB 1ZETA 3PW5A 2AGPA 3HW8A 5KFJA 4M2YA 4ECVA 9ICCA 1KEJA 3PX6A 4IQTA 4J9PA 4DLGA 1L3TA 2I9GA 3EW9A 1T4GA 4UBCA 4ECWA 3NGDA 9ICSA 5KFHA 4ECQA 1ZQEA 1BPBA 3H4DA 2O1PA 2JEJA 4FS2A 2KTQA 8ICFA 2ID1A 3B0YA 7ICPA 3HT3A 1N48A 3JPTA 1RYRA 8ICUA 4X4VA 3JPRA 4QZFA 3C2LA 4GXKA 1XC9A 3MFHA 1QLNA 3ETLA 1X9WA 4FH3A 9ICLA 4AT9A 1IM4A 5DG7A 4C8LA 4M9GA 2KZ3A 2AQ0A 3RH5A 1JQRA 4X4QA 3KHGA 3UPSA 4M9LA 5DB7A 4RNNA 3AQNA 8ICAA 2R8KA 5KFQA 2PFQA 4O9MA 3M9MB 9ICPA 4WBYA 1T7PA 3UXPA 2J6SA 4X4TA 2KZMA 3RJEA 9ICRA 4TURA 2PBEA 5KFGA 1ZQYA 5KG2A 4QW9A 1U45A 3OJUA 1ZQOA 2UVRA 1BPDA 5BPCA 4B9TA 4DSIA 3C2KA 9ICFA 7ICKA 4GLXA 1S10A 4NLKA 2ASDA 7ICSA 4CCHA 4YR2A 8ICLA 3GV7B 4YP3A 1PX5A 5DBBA 1N56A 1B22A 1ZQNA 4DL7A 3MR5A 2C2DA 4UB3A 1ZQIA 1BPZA 3IM1A 1TK8A 4J9LA 4KLQA 1JXLA 5CB1A 5KG3A 2BR0A 4EP7A 2ASLA 2FPMA 2Y1IA 1ZQMA 4M47A 2BDPA 4MF8A 4P4MA 4MFCA 4I2IA 4RQ5A 3H39A 4DO9A 4J9OA 4KLTA 2RFFA 9ICUA 2BCVA 1KNYA 4UBBA 1R8AA 4WC2A 2DFLA 3T5JA 1MQ2A 4DL5A 4QZBA 3OSPA 3HPOA 5KFUA 1ZYQA 1SL2A 2ZH7A 4O3NA 5KFNA 1NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F91 B;  5KFL A;  4WC1 A;  4C8M A;  2DPJ A;  5J2B A;  4PHE A;  3RRH A;  4X4R A;  3QE9 Y;  1XSN A;  4F3O A;  4LZG A;  3H3A A;  4B9L A;  2AGO A;  4RQ2 A;  4WBZ A;  4FBT A;  4QZG A;  3K75 D;  4UB1 A;  5J0R A;  3SYZ A;  4TQS A;  1NKB A;  2NRZ A;  4YVZ A;  4BWJ A;  5J2I A;  2BCQ A;  2PFP A;  4I2H A;  3WFS C;  4DSE A;  5DBC A;  4KLG A;  4QZC A;  3BQ0 A;  1JIH A;  2HHV A;  3AU6 A;  1D9D A;  4EBJ A;  4X4N A;  4NXZ A;  3TFS A;  3Q8M A;  1SKS A;  2VA2 A;  2DR7 A;  2O5A A;  4Q45 A;  4F50 A;  4EBC A;  2W9A A;  5J0P A;  1R8B A;  3SI8 A;  1TAU A;  4B9M A;  2MUT B;  1Z00 B;  3HX0 A;  1D8L A;  7ICT A;  4QZI A;  4YFK A;  3H38 A;  4UD5 A;  2ZH2 A;  1JAJ A;  5J0W A;  4JWM A;  1S0N A;  4YQW A;  4F4Z A;  2ZUB A;  5DLF A;  3EPG A;  4Z6F A;  4HYK A;  1SL1 A;  2ISO A;  4F4Y A;  4M0A A;  2HHT A;  5KT3 A;  1ZQF A;  9ICT A;  4KN4 A;  2BCU A;  4YXJ A;  2BQR A;  2FPL A;  3SV3 A;  1ZQS A;  2M2T A;  3C1Z A;  2XY7 A;  4KLU A;  4ED7 A;  4DWI A;  5DQH A;  3Q8K A;  7ICV A;  4ECT A;  4QZ8 A;  1BGX T;  4YCX A;  8ICC A;  2HVH A;  1ZQV A;  1KFS A;  5J2E A;  4I29 A;  1Y88 A;  4RUA A;  5KG1 A;  5CP2 A;  4QZE A;  5J0O A;  2UVU A;  1NZP A;  5KFR A;  4NM1 A;  4BDP A;  1S97 A;  4DS5 A;  1WCL A;  4O3S A;  2ZH5 A;  3ISB A;  4DOC A;  5KFE A;  3K4G A;  4RQ3 A;  2DRA A;  4RPY A;  5HMM A;  4F5O A;  1L5U A;  4YXM A;  5KFW A;  4B9U A;  3RJI A;  1ZQQ A;  3H8W A;  4DFK A;  3RB4 A;  4XA5 A;  2FLP A;  7ICU A;  4Q43 A;  3C1Y A;  4G3I A;  2ZH3 A;  4JV0 A;  5F9L A;  1KDH A;  4IQW A;  9ICM A;  1XU4 A;  3GDX A;  4PHA A;  3MR6 A;  3GII A;  8ICV A;  3V6H A;  1UT5 A;  2XCA A;  5L1J A;  4KLF A;  1UEV A;  1ZQU A;  1SL0 A;  4QWB A;  2RDJ A;  2ISP A;  1KFT A;  1NK0 A;  9ICI A;  4EZ6 A;  3FDS A;  3AU2 A;  4E0D A;  5KFY A;  3C2M A;  2NRK A;  2HHP A;  4C8N A;  4RT3 A;  7ICH A;  1F5A A;  4IRD A;  1S9F A;  4M9N A;  4B9V A;  3Q8P B;  1BPE A;  3UQ2 A;  3IHQ B;  4I27 A;  5BOL A;  4TUP A;  4UD4 A;  3BQT A;  2ZTD A;  2VA3 A;  3MGI A;  3T5K A;  4F5N A;  1HUO A;  2JEF A;  1K1S A;  2OWO A;  1V4A A;  5KTQ A;  3NTU A;  5HRF A;  2FMS A;  3PO5 A;  4AT8 B;  4KLS A;  5DG8 A;  3RJH A;  4X4P A;  1MIY A;  3THV A;  2R8J A;  1BNP A;  4KIT B;  3UPQ A;  4FH5 A;  4FHP A;  3SV4 A;  3MDA A;  2R8H A;  5DGB A;  3TAP A;  1CEZ A;  4WC7 A;  4RQ8 A;  4DQI A;  1ZQL A;  4TQR A;  5L9X A;  3BDP A;  3UXO A;  2C2R A;  4KLJ A;  4ED0 A;  4C8O A;  4MFF A;  3SZ2 A;  9ICN A;  1Q78 A;  2F1H A;  4I2B A;  4F4X A;  1ZQK A;  3GIM A;  2XY6 A;  1NK4 A;  5J2C A;  2AU0 A;  1ZQG A;  3ZDD A;  3QEB Z;  3PMN A;  2F1I A;  5KG4 A;  3JZ0 A;  5L1I A;  4KTQ A;  2Q66 A;  4DQS A;  4UB4 A;  4NKU A;  3TAQ A;  5D4B A;  7ICG A;  5HRH A;  1ZQW A;  3C18 A;  4IR9 A;  1ARO P;  2XCP A;  2XO7 A;  4B9S A;  1NK6 A;  1U9L A;  3OJS A;  4EBK A;  3C66 A;  3KHR A;  8ICM A;  5J2F A;  1T3N A;  1JX4 A;  4WC0 A;  4ATB B;  4E80 A;  5KG0 A;  3LDA A;  3GIL A;  4EEY A;  1TAQ A;  1TVA A;  4ED2 A;  2W9M A;  2IMW P;  5IIO A;  3H40 A;  2BKE A;  4O0I A;  3JPO A;  4UB5 A;  1SKW A;  3EYZ A;  4EBD A;  1BNO A;  4NLZ A;  5J2H A;  1MQ3 A;  1RXV A;  4NLG A;  2ZTE A;  4I2C A;  3G6X A;  1RXW A;  3M8R A;  2F1J A;  4PGQ A;  4ECU A;  2W8L A;  3JPN A;  3JPS A;  4X4S A;  1NJX A;  3UXN A;  4NKT A;  4I2J A;  5DGA A;  1BVS A;  5KT5 A;  4QZH A;  3RAQ A;  3GV8 B;  1QSS A;  4KLM A;  8ICH A;  2ALZ A;  2ZH1 A;  5J29 A;  1K1Q A;  5C5J A;  4UAY A;  4FO6 A;  4YD2 A;  1QTM A;  2NRT A;  1ZJM A;  5DB9 A;  4DFP A;  4KLE A;  1KFD A;  1S0M A;  4RWQ A;  9ICG A;  3NYB A;  4F5R A;  3B0X A;  3LWL A;  8ICP A;  4DSF A;  3H8S A;  5KFD A;  4PGX A;  5L1K A;  1UA0 A;  1ZQA A;  3OVB A;  1FA0 A;  5DEC A;  3BQ1 A;  1Z3E B;  4S3N A;  3FYH A;  3AQM A;  5J2A A;  8ICY A;  3AQK A;  5KFO A;  3PV8 A;  4DSK A;  4O3Q A;  7ICN A;  4JWN A;  2DRB A;  4RNM A;  5IIM A;  4P4P A;  3V6K A;  3ZDC A;  3JPQ A;  4R65 A;  8ICG A;  4RU9 A;  9ICE A;  4M5D A;  1ZQX A;  1UT8 A;  2KN7 A;  2ASJ A;  4F4K A;  3OV7 A;  9ICW A;  4RPZ A;  4WC6 A;  5D46 A;  4E8F A;  5J0S A;  2M2W A;  1XS9 D;  2C28 A;  1H38 A;  3ZDA A;  3HWT A;  1X2I A;  2GWS A;  2ZH6 A;  3TAR A;  4QWD A;  4ED3 A;  3RRG A;  3V7L A;  9ICJ A;  1XWL A;  1X9S A;  2HHS A;  4F5P A;  4EYI B;  2HVI A;  5J0X A;  4AT8 A;  4ECX A;  3GIJ A;  3H7I A;  1T8E A;  3L9D A;  1XO1 A;  4YN4 A;  3C23 A;  3TI0 A;  2FMP A;  4P2H A;  1TKD A;  1ZQH A;  1ZQC A;  1RPL A;  3TFR A;  2ZHB A;  1LV5 A;  2DR5 A;  4DL2 A;  2Q0Z X;  4E7X A;  2XC9 A;  2R8I A;  4YR0 A;  2BPC A;  2LYH A;  3MR3 A;  1ZJN A;  2BCR A;  2JZB B;  1SZP A;  4LZD A;  3N97 B;  1D9F A;  3OSN A;  8ICX A;  9ICA A;  4QW8 A;  1JN3 A;  4I28 A;  1A76 A;  4DLE A;  1NK9 A;  4Q8F A;  4MEY A;  3MGH A;  5HRD A;  5HHH A;  5KFK A;  5L1L A;  3BQ2 A;  3V7J A;  4J9K A;  4M9H A;  2BPF A;  4QZD A;  4I2F A;  4Z6E A;  4RT2 A;  2ZJ5 A;  1XSL A;  3ZDB A;  4ATB A;  5DB8 A;  1MIW A;  8ICS A;  2XGP A;  1U47 A;  2UVV A;  5J0Q A;  4EZ9 A;  1NJY A;  4XQ8 A;  4UAW A;  3HP6 A;  4UAZ A;  4I2D A;  5HC9 A;  4M6W B;  3ISD A;  3T3F A;  5KFX A;  1C7Y A;  4X0A A;  4DSL A;  3E2E A;  4DS4 A;  3JYY A;  2HHU A;  3MR2 A;  4YG2 A;  2H5X A;  5IIL A;  2BHN A;  4JUZ A;  4DL3 A;  3EWA A;  4LT6 A;  4WC3 A;  2ZH4 A;  2J6U A;  4KMU A;  7ICJ A;  4X4O A;  4RQ7 A;  3QZ7 A;  4IRK A;  4KN7 A;  4DL6 A;  8ICB A;  2ZH8 A;  4P4O A;  4DOB A;  1JMS A;  2MAX A;  3ZD9 A;  5DBA A;  1S76 D;  5KT7 A;  4Z6D A;  1ZQT A;  3M8S A;  3Q8S B;  1KTQ A;  9ICO A;  4J9R A;  2AQ4 A;  3RJG A;  5CWR A;  4YMO A;  4J9S A;  1NK5 A;  3C21 A;  3OUY B;  1RZT A;  7ICR A;  5KFV A;  5JUM A;  8ICI A;  3JPP A;  1U48 A;  2XY5 A;  4DQR A;  4RUC A;  5J0U A;  1A77 A;  5HNK A;  4YMM A;  3PR4 A;  3QZ8 A;  4DOA A;  4XRH A;  4DFJ A;  5CR0 A;  2P66 A;  4ECY A;  1D8Y A;  2R8G A;  3WFQ E;  1R89 A;  8ICT A;  1NO5 A;  3RR8 A;  1UEU A;  4I2A A;  1NOM A;  2ZJ8 A;  5EOZ A;  1DOQ A;  4F92 B;  1QSY A;  3HIY A;  3QEA Z;  4YMN A;  4I2E A;  2BQ3 A;  8ICK A;  3PX0 A;  2PI4 A;  5DED A;  4KLI A;  2JEI A;  1U49 A;  4RQ1 A;  5KFZ A;  3KHL A;  4F93 B;  1L3V A;  4JV1 A;  1MC8 A;  2ZUC A;  5KFM A;  8ICQ A;  4AT7 B;  2NRV A;  5HHI A;  2W9B B;  3G6V A;  2PXI A;  4EYH B;  4J9M A;  3N4M B;  4DQQ A;  4DSJ A;  4RWO A;  9ICB A;  3WFR E;  5F9N A;  3PR5 B;  2MUT A;  1Z00 A;  5KT4 A;  5DDY A;  3Q8Q B;  4J9N A;  8ICW A;  3RR7 A;  1OU5 A;  3RJJ A;  4NLN A;  4PHD A;  1WCN A;  4B9N A;  1CUK A;  4PH5 A;  4X5V A;  5HP4 A;  3PO4 A;  4F2S A;  1S0V A;  4ZH4 A;  5KT2 A;  5D49 A;  1EXN A;  3ZDE A;  7ICE A;  2M2V A;  3WFO A;  4RWP A;  5F2V O;  2FLN A;  3PW4 A;  1ZQD A;  8ICE A;  4GXI A;  5III A;  5CJ7 A;  4NY8 A;  4ELV A;  5IIJ A;  5J2K A;  4IG8 A;  4QZ9 A;  4FHV A;  5IIN A;  4Q44 A;  3WFP A;  4YD1 A;  3MFI A;  1ZQB A;  2ZUD A;  4F4W A;  1NKC A;  3EPI A;  2Y1J A;  4KLL A;  2JZB A;  2RDI A;  3H8J A;  4QZA A;  2PFO A;  4IRC A;  2KFZ A;  1QSL A;  2HHW A;  2BGW A;  5J2J A;  5J0Y A;  1HUZ A;  2DPI A;  4X4U A;  8ICN A;  2BE3 A;  5EWF A;  5KG7 A;  5HRE A;  3PW0 A;  4KLD A;  5DDM A;  2IA6 A;  4DEZ A;  2FMQ A;  2A1J B;  2IHM A;  4R64 A;  7ICM A;  3RBD A;  1LB2 B;  1U4B A;  5KFC A;  3TQ1 A;  4K4H A;  4BXO B;  9ICH A;  4JK1 A;  4RQ4 A;  4K4I A;  4ECR A;  3PX4 A;  5KFT A;  4RQ6 A;  2VAN A;  5J2G A;  4ECS A;  4M6W A;  2C2E A;  8ICZ A;  4YR3 A;  4IR1 A;  4IQV A;  1NK7 A;  4LVS A;  7ICO A;  2M2U A;  5HRL A;  4BWM A;  2W9C B;  4R66 A;  2WTF A;  1TFR A;  2NRX A;  3KHH A;  2V9W A;  3OHB A;  5DLG A;  3KTQ A;  3H37 A;  1ZQZ A;  4RQ0 A;  4Q8E A;  4MF2 A;  4O5E A;  4ELU A;  1WOT A;  3HJ1 A;  4WC5 A;  3V7K A;  2V4R A;  3T5L A;  2IBK A;  4NM2 A;  3RB3 A;  3Q8R B;  4WC4 A;  7ICF A;  4Z6C A;  5KFF A;  5BOM A;  3TAN A;  3Q8L A;  3RB0 A;  3MAB A;  4XUS A;  4R8U B;  3OHA A;  4QWA A;  1TFW A;  1TFY A;  3OUY A;  1HJP A;  4RWN A;  2PFN A;  5J2D A;  3MBY A;  8ICR A;  2KZZ A;  2JEG A;  1TK0 A;  3ZD8 A;  4FBU A;  9ICV A;  4O5K A;  2HHX A;  4I2G A;  7ICQ A;  4DQP A;  4BGD A;  5EWE A;  4ECZ A;  5DB6 A;  9ICK A;  3UQ0 A;  2KFN A;  4O3O A;  4O3P A;  4RZR A;  4PPX A;  5CHG A;  4EBE A;  4PHP A;  3ISC A;  1ZQR A;  3GIK A;  4DF8 A;  5KFS A;  1UET A;  3BJY A;  4ELT A;  4M04 A;  4R63 A;  2ZJA A;  2FLL A;  4O5C A;  8ICJ A;  5HRI A;  1UA1 A;  4C8K A;  4AT9 B;  3G6Y A;  2UVW A;  7ICL A;  4AT7 A;  3OVA A;  2W9B A;  1TK5 A;  4GC7 A;  3AQL A;  1TV9 A;  2IHN A;  4ED6 A;  4TUS A;  2AGQ A;  1B43 A;  3EZ5 A;  1NK8 A;  1JXE A;  4K4G A;  3RH4 A;  7ICI A;  3OVS A;  3LK9 A;  1DGS A;  5KFB A;  5CA7 A;  2NRW A;  1BPY A;  4GC6 A;  4ED8 A;  3RH6 A;  3GQC A;  4F2R A;  4F5Q A;  2BPG A;  5DQG A;  4F8R A;  4KLH A;  4FHX A;  4GXJ A;  2ZTC A;  4X0B A;  2HW3 A;  5KG5 A;  2P6U A;  3PW2 A;  3RTV A;  4KLO A;  3T5H A;  3LQC B;  5KFP A;  3RB6 A;  1Q79 A;  4WCW A;  5DKW A;  5DQI A;  3GFK B;  3RAX A;  4TUQ A;  2PI5 A;  1ZQP A;  5HR9 A;  2AJQ A;  9ICX A;  3RJF A;  3GV5 B;  1S77 D;  1V9P A;  2C22 A;  2B21 A;  1NJZ A;  2ATL A;  5J0T A;  1BPX A;  1MIV A;  4FHY A;  4MEX A;  1RYS A;  3PNC A;  1L3S A;  5HRK A;  3RBE A;  2I1Q A;  2A1J A;  4QWC A;  4RNO A;  1ZQJ A;  9ICQ A;  1S0O A;  4J9Q A;  1X9M A;  1DK2 A;  5KFI A;  2DVI A;  4BXO A;  3LWM A;  5EWG A;  4PGY A;  3C5F A;  4ED1 A;  1R8C A;  3PVX A;  1KSP A;  4RPX A;  5HRG A;  1IXR A;  5KT6 A;  2W8K A;  2BCS A;  5TZV A;  2FPK A;  5HML A;  4UB2 A;  3V6J A;  1XSP A;  1COO A;  3OGU A;  2V4Q A;  2J6T A;  4QWE A;  5KFA A;  1VFG A;  2XGQ A;  2W9C A;  3C5G A;  3PW7 A;  5IIK A;  5DG9 A;  1PZN A;  4M9J A;  4JV2 A;  4FHW A;  2DR8 A;  4DFM A;  4IQU A;  8ICO A;  2DR9 A;  2P6R A;  3ORY A;  4FS1 A;  3M9N B;  3HJ4 A;  4XQ7 A;  5KG6 A;  2VA8 A;  4UQG A;  2M9N A;  1KRP A;  1VJ7 A;  1KLN A;  3H4B A;  1L3U A;  2KP7 A;  1SKR A;  1DK3 A;  1MSW D;  3V72 A;  2ZH9 A;  3MDC A;  4MFA A;  4DL4 A;  4O3R A;  2ZHA A;  1YLQ A;  3PML A;  3PY8 A;  4R8U A;  1NJW A;  5HRB A;  4DF4 A;  3AUO A;  2BQU A;  3RJK A;  2HHQ A;  3M9O B;  1ZET A;  3PW5 A;  2AGP A;  3HW8 A;  5KFJ A;  4M2Y A;  4ECV A;  9ICC A;  1KEJ A;  3PX6 A;  4IQT A;  4J9P A;  4DLG A;  1L3T A;  2I9G A;  3EW9 A;  1T4G A;  4UBC A;  4ECW A;  3NGD A;  9ICS A;  5KFH A;  4ECQ A;  1ZQE A;  1BPB A;  3H4D A;  2O1P A;  2JEJ A;  4FS2 A;  2KTQ A;  8ICF A;  2ID1 A;  3B0Y A;  7ICP A;  3HT3 A;  1N48 A;  3JPT A;  1RYR A;  8ICU A;  4X4V A;  3JPR A;  4QZF A;  3C2L A;  4GXK A;  1XC9 A;  3MFH A;  1QLN A;  3ETL A;  1X9W A;  4FH3 A;  9ICL A;  4AT9 A;  1IM4 A;  5DG7 A;  4C8L A;  4M9G A;  2KZ3 A;  2AQ0 A;  3RH5 A;  1JQR A;  4X4Q A;  3KHG A;  3UPS A;  4M9L A;  5DB7 A;  4RNN A;  3AQN A;  8ICA A;  2R8K A;  5KFQ A;  2PFQ A;  4O9M A;  3M9M B;  9ICP A;  4WBY A;  1T7P A;  3UXP A;  2J6S A;  4X4T A;  2KZM A;  3RJE A;  9ICR A;  4TUR A;  2PBE A;  5KFG A;  1ZQY A;  5KG2 A;  4QW9 A;  1U45 A;  3OJU A;  1ZQO A;  2UVR A;  1BPD A;  5BPC A;  4B9T A;  4DSI A;  3C2K A;  9ICF A;  7ICK A;  4GLX A;  1S10 A;  4NLK A;  2ASD A;  7ICS A;  4CCH A;  4YR2 A;  8ICL A;  3GV7 B;  4YP3 A;  1PX5 A;  5DBB A;  1N56 A;  1B22 A;  1ZQN A;  4DL7 A;  3MR5 A;  2C2D A;  4UB3 A;  1ZQI A;  1BPZ A;  3IM1 A;  1TK8 A;  4J9L A;  4KLQ A;  1JXL A;  5CB1 A;  5KG3 A;  2BR0 A;  4EP7 A;  2ASL A;  2FPM A;  2Y1I A;  1ZQM A;  4M47 A;  2BDP A;  4MF8 A;  4P4M A;  4MFC A;  4I2I A;  4RQ5 A;  3H39 A;  4DO9 A;  4J9O A;  4KLT A;  2RFF A;  9ICU A;  2BCV A;  1KNY A;  4UBB A;  1R8A A;  4WC2 A;  2DFL A;  3T5J A;  1MQ2 A;  4DL5 A;  4QZB A;  3OSP A;  3HPO A;  5KFU A;  1ZYQ A;  1SL2 A;  2ZH7 A;  4O3N A;  5KFN A;  1NKE A; 
#chains in the Genus database with same CATH topology
 5HR6 A;  3QE9 Y;  1XSN A;  4FBT A;  1L7M A;  5ALF A;  5J0R A;  4TQS A;  4BWJ A;  4YVZ A;  5ALW A;  2FDR A;  5DBC A;  4KLG A;  3TKA A;  1D9D A;  4X4N A;  1SKS A;  2O5A A;  4F50 A;  2YMM A;  5J0P A;  3SI8 A;  4B9M A;  2XVT A;  2ZIU B;  1D8L A;  3N7S C;  1IIP A;  3SAG A;  4JWM A;  2HBJ A;  2WF7 A;  3HJE A;  3SMV A;  4HYK A;  2WF9 A;  2ISO A;  1RDF A;  2HHT A;  2YB4 A;  2BCU A;  2FPL A;  2M2T A;  1ZQS A;  3D6J A;  4CGZ A;  1J2N A;  3Q8K A;  2D6F C;  1Y88 A;  5KG1 A;  2M0N A;  1JAL A;  1S97 A;  4O3S A;  2ZH5 A;  5C0Y A;  4LEZ A;  3RB4 A;  4XA5 A;  3H8M A;  4G3I A;  4JV0 A;  4IQW A;  9ICM A;  3OWG A;  3V6H A;  4O68 A;  1UEV A;  1ZQU A;  4QWB A;  2RDJ A;  1DRG A;  2YN4 A;  3AU2 A;  4IRD A;  2LI6 A;  4B9V A;  2ES6 A;  3BQT A;  3IDW A;  2ZTD A;  2VA3 A;  3T5K A;  4F5N A;  1UCV A;  3RJH A;  1ZD2 P;  4KIT B;  4FH5 A;  3JCF A;  2G08 A;  3SV4 A;  3MDA A;  2R8H A;  3TAP A;  4WC7 A;  4RQ8 A;  1ZQL A;  2EDU A;  3UXO A;  4PJ0 U;  4ZOH C;  3SZ2 A;  3O0F A;  3QUQ A;  2IHO A;  4I2B A;  2LHT A;  1ZQK A;  3NVO A;  3GIM A;  2XY6 A;  3EF2 A;  2AU0 A;  1ZQG A;  3QEB Z;  3JZ0 A;  2Q66 A;  2DWQ A;  5D4B A;  4U7C A;  5B66 U;  1ZQW A;  7ICG A;  5HRH A;  3C18 A;  2JXJ A;  4CNQ A;  1NK6 A;  1U9L A;  2HBL A;  1SB3 C;  3SD7 A;  3KHR A;  5J2F A;  1L8O A;  4FE3 A;  1TAQ A;  2W9M A;  4PL1 A;  2IMW P;  4UB5 A;  1SKW A;  4EBD A;  1MQ3 A;  2ZTE A;  4I2C A;  1RXW A;  1NI3 A;  2F1J A;  4Y2Y A;  2W8L A;  3JPN A;  2LMR A;  1O03 A;  4K96 A;  5AI5 A;  3UXN A;  4A8E A;  4NKT A;  4I2J A;  2FE9 A;  5AI8 A;  5DGA A;  8ICH A;  3PST A;  4K8V A;  5C5J A;  2NRT A;  4DFP A;  4RWQ A;  3FM9 A;  8ICP A;  5CFT A;  4DSF A;  3H8S A;  4DFD A;  4Y2R A;  1UA0 A;  3AQM A;  3AQK A;  5KFO A;  7ICN A;  4O3Q A;  2MU2 A;  1KL9 A;  4CDG A;  2DRB A;  3JPQ A;  3F2D A;  4M5D A;  3ED5 A;  2WF6 A;  1ZQX A;  2ASJ A;  4WC6 A;  5J0S A;  2DL0 A;  3ZDA A;  4KB6 A;  1FFU A;  2ZH6 A;  3TAR A;  3RRG A;  3KZX A;  9ICJ A;  2HHS A;  4F5P A;  2H3I A;  3L9D A;  3D2S A;  2W7O A;  2R8I A;  4YR0 A;  2BPC A;  3MR3 A;  1N60 A;  5ALO A;  1D9F A;  8ICX A;  3B9J A;  4I28 A;  2Y9U A;  3WKE A;  5L1L A;  3BQ2 A;  5D62 A;  4QZD A;  3ER8 C;  2N1R A;  1PK3 A;  2KVS A;  4IS7 A;  3KFU F;  5CFU A;  4XQ8 A;  2EAN A;  3PSI A;  4I2D A;  1C7Y A;  4X0A A;  5KFX A;  4USA A;  1DGJ A;  2Q4T A;  3JYY A;  2HHU A;  5ALI A;  7ICJ A;  4RQ7 A;  2XI9 A;  4X4O A;  3QZ7 A;  4IRK A;  4DL6 A;  8ICB A;  4P4O A;  2MAX A;  2ZIV B;  4WQL A;  1Q46 A;  4XJE A;  4J9R A;  5JTG A;  4J9S A;  4WJ3 B;  1VDV A;  1RG6 A;  7ICR A;  2QB1 A;  2XY5 A;  4DQR A;  4RUC A;  3QZ8 A;  1D8Y A;  1R89 A;  4NJ8 A;  8ICT A;  1UEU A;  2NO5 A;  2GO7 A;  4I2A A;  4NLB A;  4EEN A;  1NOM A;  5EOZ A;  4F92 B;  3HIY A;  4YMN A;  3H0R B;  5J8Y C;  1U49 A;  5KFZ A;  1L3V A;  2WFA A;  4EYH B;  2KKV A;  4DSJ A;  3WFR E;  2MUT A;  1JRO A;  3Q8Q B;  3CNH A;  1SV0 A;  2RP5 A;  4B9N A;  1WCN A;  1JAJ A;  1CUK A;  5HP4 A;  4ZH4 A;  3WFO A;  5D49 A;  1EXN A;  2D3D A;  2FLN A;  5CJ7 A;  4IG8 A;  4ELV A;  5J2K A;  2H3F A;  4Q44 A;  4YD1 A;  1ZQB A;  4F4W A;  1V85 A;  4KLL A;  2JZB A;  2RDI A;  2EZX A;  4UAR A;  2BGW A;  2DPI A;  2QB0 B;  3D2N A;  2EAO A;  4DEZ A;  2A1J B;  7ICM A;  4K4H A;  9ICH A;  4RQ4 A;  3PX4 A;  4RQ6 A;  4M6W A;  2C2E A;  4IQV A;  1NK7 A;  4LVS A;  7ICO A;  1Z1B A;  2M2U A;  3NKU A;  1TFR A;  2WB1 C;  4P0P B;  3KHH A;  1ZXI A;  3HJ1 A;  3V7K A;  3RB3 A;  4BX9 C;  3SQI A;  7ICF A;  2QAR A;  3NVZ A;  3Q8L A;  3MAB A;  1TFY A;  1HJP A;  4UAU A;  1X42 A;  2JEG A;  2LPE A;  1SV0 C;  2YX8 A;  5EWE A;  4Y2T A;  4GFJ A;  4CF3 A;  5ALP A;  3KBB A;  1ZQR A;  3GIK A;  1UET A;  4US9 A;  4ELT A;  4R63 A;  2FLL A;  4AT9 B;  1ED1 A;  7ICL A;  1PK1 A;  4AT7 A;  2W9B A;  4GC7 A;  1TV9 A;  4ED6 A;  3BQ7 A;  3LK9 A;  1DGS A;  2NRW A;  4GC6 A;  3GQC A;  4F2R A;  1NNL A;  2ZTC A;  2HW3 A;  3T5H A;  5DKW A;  5DQI A;  3RAX A;  5CEH A;  3GV5 B;  1V9P A;  2C22 A;  2B21 A;  1NJZ A;  3DDH A;  1N2X A;  3PNC A;  1L3S A;  1YZ6 A;  5KFI A;  1KKX A;  5AM5 A;  5EWG A;  4PGY A;  3PVX A;  1IG6 A;  1L6N A;  2FPK A;  4UB2 A;  1COO A;  2J6T A;  3WFQ E;  4UAV A;  5DG9 A;  3BZK A;  4IQU A;  4DFM A;  3M9N B;  3HJ4 A;  5KG6 A;  2DGZ A;  4C4S A;  2M9N A;  1KRP A;  1KLN A;  1L3U A;  1MSW D;  2CPR A;  4LEV A;  4MFA A;  2H3V A;  4O3R A;  3PML A;  4R8U A;  4DF4 A;  3AUO A;  5ALK A;  3RJK A;  1ZET A;  9ICC A;  5ALZ A;  3U26 A;  4J9P A;  3EW9 A;  4UBC A;  9ICS A;  1BPB A;  2B51 A;  2O1P A;  4FS2 A;  8ICF A;  3B0Y A;  7ICP A;  3JPT A;  4QZF A;  3C2L A;  4FH3 A;  3ETL A;  1X9W A;  5GTH U;  4C80 A;  1IM4 A;  2WHE A;  2KZ3 A;  2ZXI A;  4X4Q A;  3KHG A;  3AQN A;  3CK6 A;  2PFQ A;  9ICP A;  3VCB A;  1T7P A;  2J6S A;  3RJE A;  4TUR A;  3ER9 B;  5KFG A;  9ICF A;  3QUB A;  4DSI A;  1BPD A;  2A3V A;  2LYA A;  1J2M A;  2ASD A;  3GV7 B;  5AKZ A;  3IG5 A;  1BPZ A;  2JV3 A;  3PZP A;  4EP7 A;  2G07 A;  1ZQM A;  2Y1I A;  4KMO B;  3NVV A;  2BDP A;  4PZN A;  4I2I A;  4RQ5 A;  2BCV A;  1KNY A;  4WC2 A;  2DUY A;  2K89 A;  4C7Z A;  5KFU A;  4X0B A;  2ZH7 A;  3H37 A;  2AJQ A;  2E1E A;  5KFL A;  3I76 A;  4C8M A;  4PHE A;  3H3A A;  4B9L A;  4KX3 A;  2AGO A;  2E8N A;  4RQ2 A;  3SYZ A;  3HIL A;  4DSE A;  3BQ0 A;  3Q8M A;  4Q45 A;  2KV2 A;  4BJQ A;  2W9A A;  3AQF A;  2MUT B;  2NV3 A;  3NRW A;  2ZH2 A;  3IN5 A;  5ALV A;  4Z6F A;  3TAD A;  1IV8 A;  1Z1V A;  4M0A A;  2E8M A;  1OXJ A;  4KN4 A;  2F76 X;  5JU5 A;  4ED7 A;  4DWI A;  1FFV A;  1BGX T;  8ICC A;  1ZQV A;  1KFS A;  5J2E A;  5CP2 A;  4QZE A;  1QCK A;  2UVU A;  5KFR A;  1WCL A;  3ISB A;  4DOC A;  2DRA A;  4RPY A;  5HMM A;  4F5O A;  5KFW A;  1TE2 A;  3RJI A;  3H8W A;  7ICU A;  4MKP A;  1CRX A;  5F9L A;  1KDH A;  8ICV A;  1UT5 A;  2XCA A;  3N28 A;  1SL0 A;  4OJO A;  2ISP A;  1LKY A;  9ICI A;  4EZ6 A;  3FDS A;  4E0D A;  3C2M A;  2NRK A;  3TAC B;  4RT3 A;  4M9N A;  2G0A A;  2K4P A;  5KL8 B;  4UD4 A;  3SEI A;  3MGI A;  2OYY A;  1K1S A;  5KTQ A;  2D8C A;  2FJ6 A;  3LVV A;  3SR6 A;  4AT8 B;  3OTQ A;  5DG8 A;  1N5W A;  3THV A;  4LEW A;  2DKX A;  4FHP A;  2KSO B;  5DGB A;  4K9A A;  4DQI A;  3QU5 A;  4OJ5 A;  1N5X A;  5L9X A;  3WFP A;  2W54 A;  4KLJ A;  5ALJ A;  4MFF A;  4O67 A;  2G5H B;  2F1H A;  3A0H U;  2EAM A;  4CF4 A;  5J2C A;  4O6A A;  3ZDD A;  3PMN A;  3HKZ F;  5AK3 A;  4DQS A;  4UB4 A;  3TAQ A;  1FEZ A;  3M6Z A;  5D61 A;  4IR9 A;  4WH5 A;  2DF4 B;  3C66 A;  4E80 A;  1T3N A;  1TVA A;  3KOO A;  3H40 A;  5AM3 A;  5J2H A;  3QU7 A;  2OEH A;  4O69 A;  3M8R A;  2P35 A;  2JHD A;  3JPS A;  4X4S A;  1YT3 A;  3RAQ A;  5KT5 A;  4QZH A;  2LYB A;  1K1Q A;  2OCE A;  4FO6 A;  5L1M A;  3QNM A;  3NAS A;  5DB9 A;  4KLE A;  1WWV A;  4F5R A;  3LWL A;  4EX6 A;  5KFD A;  1GPJ A;  5L1K A;  2IOF K;  1FA0 A;  1Z3E B;  8ICY A;  5ALG A;  1QQ5 A;  2KHQ A;  4F4K A;  2DKZ A;  3E58 A;  3OV7 A;  4BUG A;  4E8F A;  2C28 A;  1H38 A;  1XWL A;  2HVI A;  5J0X A;  4ECX A;  3GIJ A;  1T8E A;  3C29 A;  1XO1 A;  3C23 A;  4C4R A;  1TKD A;  1D8B A;  3TFR A;  2ZHB A;  2DR5 A;  4DL2 A;  2XC9 A;  1AQ6 A;  2LYH A;  1ZJN A;  4C4T A;  1SZP A;  3N97 B;  9ICA A;  1NK9 A;  4Q8F A;  3MGH A;  5HHH A;  2A19 A;  4J9K A;  4M9H A;  4I2F A;  2FCL A;  4ATB A;  3ZDB A;  8ICS A;  1U47 A;  5J0Q A;  1KBU A;  3CYM A;  5HC9 A;  1SIJ A;  3T3F A;  1A6S A;  3E2E A;  4DS4 A;  2F77 X;  4JUZ A;  3EWA A;  5AKK A;  4KMU A;  2HOF A;  5DBA A;  4Z6D A;  3EUB 2;  5T14 A;  5CWR A;  3I1Y A;  5CHE A;  3OUY B;  4CE6 A;  5KFV A;  5JUM A;  3JPP A;  5HRF A;  2UVV A;  4DOA A;  5CR0 A;  2P66 A;  2HDO A;  2ZJ8 A;  5DED A;  4KLI A;  2W11 A;  4JV1 A;  2ZUC A;  8ICQ A;  4C0Z A;  4PZO A;  9ICB A;  5KT4 A;  1OU5 A;  4NLN A;  4PHD A;  1S0V A;  4PH5 A;  2M2V A;  3NRZ A;  4Y2U A;  1SV4 A;  5IIJ A;  5IIN A;  5ALE A;  2LM1 A;  1V97 A;  2ESE A;  3MFI A;  1NKC A;  4IRC A;  4X4U A;  5J2J A;  1HUZ A;  8ICN A;  4Y2P A;  5KG7 A;  3PW0 A;  1ZD5 A;  2WAQ F;  2IA6 A;  3KKA A;  2IHM A;  4R64 A;  5EE0 A;  4BXO B;  8ICZ A;  4YR3 A;  5HRL A;  2B0C A;  2W9C B;  2WTF A;  5AM1 A;  2ODG A;  3AQE A;  4RQ0 A;  4Q8E A;  1WOT A;  4ELU A;  4WC5 A;  4FZN A;  2IBK A;  1RM6 C;  3Q8R B;  5CRX A;  5KFF A;  5BOM A;  3RB0 A;  2HBK A;  4LJX A;  2B56 A;  2ZIX A;  5B5E U;  3OHA A;  1TFW A;  8ICR A;  2HMX A;  4FBU A;  9ICV A;  3AMZ A;  3N7P D;  3BS7 A;  4ECZ A;  5DB6 A;  2KFN A;  4UAT A;  4P0Q A;  5CHG A;  4PHP A;  4JMU A;  3BJY A;  5HRI A;  1UA1 A;  4C8K A;  3WKA A;  1ZRN A;  2BBH A;  1TK5 A;  1X66 A;  3AQL A;  2IHN A;  2IUB A;  2LM4 A;  1B43 A;  1NZB A;  4K4G A;  3QUC A;  7ICI A;  3IG8 A;  5ALY A;  1PVQ A;  2KVC A;  5DQG A;  4F8R A;  4KLH A;  4GXJ A;  2E5S A;  3LQC B;  2K4I A;  1HEK A;  1X6I A;  3R9K A;  2PI5 A;  1V38 A;  5AI6 A;  5HR9 A;  2KJ8 A;  2JGA A;  2W43 A;  4FHY A;  4MEX A;  5HRK A;  4Y2V A;  5EE3 A;  4QWC A;  4RNO A;  1S0O A;  4J9Q A;  1X9M A;  3C5F A;  3BS5 A;  5TIS U;  1KSP A;  5AKL A;  1XSP A;  1VFG A;  3PW7 A;  2KIC A;  1PZN A;  2P6R A;  4UQG A;  5AK6 A;  3H4B A;  4OJL A;  4JLX A;  1DK3 A;  4DL4 A;  1YLQ A;  1NJW A;  4G9B A;  2HHQ A;  2AGP A;  3HW8 A;  4RQN A;  3S6J A;  3PX6 A;  5EE1 A;  2PMZ F;  4DLG A;  2I9G A;  4NXW A;  1T4G A;  2BDU A;  5ALM A;  1ZQE A;  1ZD3 A;  2JEJ A;  2KTQ A;  1S8O A;  4X4V A;  2E8P A;  4GXK A;  1XC9 A;  2Z7J A;  3GZF A;  5DG7 A;  5B3P A;  2AQ0 A;  3RH5 A;  4WOY A;  4M9L A;  5DB7 A;  4K99 A;  2KEY A;  4RNN A;  4I0U A;  5KFQ A;  2W3R A;  2PKE A;  3UXP A;  4X4T A;  2KZM A;  1URJ A;  2PBE A;  5AKE A;  1PUZ A;  2EH9 A;  1S10 A;  2EAP A;  2MRL A;  7ICS A;  4CCH A;  8ICL A;  4YP3 A;  1N56 A;  1B22 A;  4DL7 A;  2KD1 A;  2E8O A;  1Z4O A;  2LBO A;  1SXD A;  3K1Z A;  5KG3 A;  1VLB A;  3A0B U;  1N63 A;  4M47 A;  4MF8 A;  4Y2J A;  3I28 A;  4KX5 A;  3H39 A;  4KLT A;  2RFF A;  5ALH A;  4EEK A;  2I6X A;  1ZYQ A;  5KFN A;  3NVY A;  4F91 B;  4WC1 A;  2DPJ A;  5J2B A;  4EV6 A;  3RRH A;  4X4R A;  3N7R C;  4WBZ A;  1X6J A;  4UB1 A;  1NKB A;  2BCQ A;  2PFP A;  3WFS C;  2NRZ A;  5J2I A;  5K4L A;  4EBJ A;  4NXZ A;  1QQ6 A;  2EZZ A;  5AM2 A;  4EGW A;  4AP9 A;  1R8B A;  4UD5 A;  1FIQ A;  1MA7 A;  4QJF B;  2HN1 A;  4NL9 A;  1S0N A;  4F4Z A;  5AK4 A;  3WKB A;  1SL1 A;  4F4Y A;  4US8 A;  9ICT A;  2HOI A;  4YXJ A;  3C1Z A;  2ZIW A;  2XY7 A;  4KLU A;  3ERC C;  2AXT U;  7ICV A;  4ECT A;  3AN1 A;  4QZ8 A;  4YCX A;  2HVH A;  2WF8 A;  4RUA A;  5J0O A;  5GTI U;  4NM1 A;  2F3N A;  1TAM A;  4UAS A;  4RQ3 A;  2KNJ A;  1L5U A;  3PHZ A;  4DFK A;  2FLP A;  4Q43 A;  3C1Y A;  5G5G A;  4PHA A;  3MR6 A;  3GII A;  5L1J A;  2GAF D;  5AIB A;  1KFT A;  1NK0 A;  2Y0S F;  1F0M A;  5KFY A;  3AL0 B;  4C8N A;  1F5A A;  4OCZ A;  4I27 A;  2OXO A;  5BOL A;  2HOQ A;  1HUO A;  2KK0 A;  4NXX A;  3NTU A;  1P7D A;  4O3M A;  2FMS A;  4N7R A;  2KKP A;  4Y2X A;  2K4H A;  2R8J A;  1SGG A;  1Q8K A;  3F53 A;  1CEZ A;  4FZL A;  3WK6 A;  4NXV A;  4FZM A;  5KNI A;  4ED0 A;  4C8O A;  1Q78 A;  5B3Q A;  4HAI A;  2F1I A;  2K4E A;  5EE9 A;  2ZIU A;  2MSN A;  2XO7 A;  4B9S A;  3OJS A;  5KG0 A;  3GIL A;  4EEY A;  2NO4 A;  5IIO A;  4O0I A;  3EYZ A;  1BNO A;  2F44 A;  2OM6 A;  3C28 A;  4NLZ A;  1RXV A;  2DBY A;  3G6X A;  4PGQ A;  5E79 U;  1NJX A;  1LVH A;  1QSS A;  1BVS A;  4NLC A;  5J29 A;  2W03 A;  2DQN B;  4OAH A;  5H2F U;  3BS5 B;  1ZJM A;  2B4V A;  2OH2 A;  3WK4 A;  9ICG A;  4PGX A;  1ZQA A;  3OVB A;  5DEC A;  3BQ1 A;  4S3N A;  2RRD A;  1F5S A;  3PV8 A;  4RNM A;  5IIM A;  4P4P A;  3V6K A;  9ICE A;  4RU9 A;  1UT8 A;  4QNL A;  2KN7 A;  3OPX A;  1XS9 D;  3HWT A;  2GWS A;  4RQM A;  4QWD A;  3V7L A;  3L5K A;  1X9S A;  1B0X A;  2E3T A;  2HI0 A;  2YTU A;  1ZRM A;  2JMG A;  3MC1 A;  2FMP A;  4P2H A;  2KJ5 A;  1ZQC A;  1LV5 A;  2Q0Z X;  4E7X A;  2OHF A;  1A0P A;  2BCR A;  2JZB B;  4LZD A;  1RQL A;  1A76 A;  5HRD A;  3QUT A;  5KFK A;  1DXS A;  2CN1 A;  3V7J A;  2W3S A;  4Z6E A;  1XSL A;  4OD0 A;  5DB8 A;  1MIW A;  2XGP A;  4EZ9 A;  1O08 A;  1NJY A;  2WAQ C;  4UAZ A;  2ZXH A;  4M6W B;  4DSL A;  2H5X A;  1PVR A;  2ZH8 A;  4KN7 A;  3WK7 A;  3ZD9 A;  4CF5 A;  2QAR B;  5KT7 A;  3M8S A;  3RJG A;  4YMO A;  1NK5 A;  3C21 A;  5J0U A;  3PR4 A;  5HNK A;  4YMM A;  1Z19 A;  1QSL A;  4XRH A;  4ECY A;  2R8G A;  2KJ9 A;  4UB8 U;  2QKQ A;  3F2B A;  2VJ5 A;  3J81 j;  4I2E A;  3PX0 A;  3TAD C;  4RQ1 A;  3KHL A;  5KFM A;  1PK1 B;  2NRV A;  5HHI A;  2W9B B;  3G6V A;  4AT7 B;  4RWO A;  4DQQ A;  4K9B A;  1RYU A;  5F9N A;  8ICW A;  1Z00 A;  2IOF A;  3RR7 A;  3RJJ A;  4F2S A;  5KT2 A;  3ZDE A;  1ZQD A;  2HBM A;  3WK5 A;  5III A;  4NY8 A;  1SWW A;  4FHV A;  1K5O A;  3ZI4 A;  2ZUD A;  2KFZ A;  3H8J A;  2PFO A;  2HHW A;  5J0Y A;  4K98 A;  2BE3 A;  2FI1 A;  4KLD A;  5DDM A;  2FMQ A;  1LB2 B;  1U4B A;  3MGV A;  3ONN A;  5KFT A;  3ALR A;  3IP4 B;  4IR1 A;  4R66 A;  5A0L A;  2NRX A;  2V9W A;  3H0M B;  4OAI Z;  4GIB A;  1ZQZ A;  5AI9 A;  4O5E A;  2EWR A;  1OUQ A;  2ZIV A;  4WC4 A;  3WK8 A;  4Z6C A;  3TAN A;  4XUS A;  4R8U B;  4QWA A;  3F5A A;  2I5H A;  4RWN A;  3QU2 A;  5J2D A;  3MBY A;  1TK0 A;  3ZD8 A;  3PSP A;  4O5K A;  2HHX A;  4I2G A;  4DQP A;  4BGD A;  5AM4 A;  3UQ0 A;  3NUQ A;  4O3O A;  4O3P A;  2PMZ C;  2RLT A;  4EBE A;  1QQ7 A;  3ISC A;  2RHF A;  4DF8 A;  4M04 A;  2ZJA A;  8ICJ A;  2JH7 A;  4TUS A;  2AGQ A;  2BZF A;  3RH4 A;  2NYV A;  4UB6 U;  4ED8 A;  5AKG A;  2XIC A;  2BPG A;  4FHX A;  1L8L A;  1C20 A;  1HIW A;  5KG5 A;  3RTV A;  4KLO A;  5KFP A;  3RB6 A;  2GH1 A;  3GFK B;  1ZQP A;  1Z4N A;  9ICX A;  2QB0 A;  1S77 D;  2WF5 A;  4QIW F;  3AM9 A;  3RBE A;  2I1Q A;  2A1J A;  3E0F A;  5AHX A;  2DVI A;  1SZH A;  1DK2 A;  4ED1 A;  4Y2Q A;  4JLZ A;  5HRG A;  1IXR A;  5KT6 A;  2W8K A;  2BCS A;  5TZV A;  2KOB A;  2VKQ A;  5HML A;  3V6J A;  4QWE A;  5KFA A;  4K97 A;  2XGQ A;  3C5G A;  5AIC A;  4FHW A;  4P0P A;  3ETR A;  2DR8 A;  8ICO A;  2DR9 A;  3ORY A;  2IOH A;  2KP7 A;  3VC8 A;  1SKR A;  2ZH9 A;  3V72 A;  3MDC A;  1JRP A;  5HRB A;  3UMB A;  2BQU A;  1L7P A;  3M9O B;  5KFJ A;  4M2Y A;  1KEJ A;  5ALT A;  2W55 A;  3NGD A;  5KFH A;  4ECQ A;  2YB1 A;  3H4D A;  1MN8 A;  5JRT A;  2F8L A;  3HRD D;  1N48 A;  3F5E A;  3M7D A;  3JPR A;  9ICL A;  4AT9 A;  1L7N A;  4M9G A;  1JQR A;  3UPS A;  3LVW A;  8ICA A;  2R8K A;  4O9M A;  4WBY A;  9ICR A;  1ZQY A;  1U45 A;  4B9T A;  2UVR A;  5BPC A;  1RQN A;  4NLK A;  4YR2 A;  5AKI A;  5DBB A;  2O6K A;  1ZQN A;  2JH1 A;  4UB3 A;  1ZQI A;  3DEE A;  4KLQ A;  5CB1 A;  3KD3 A;  1LKY B;  2FPM A;  2EZY A;  2YY6 A;  4J9O A;  9ICU A;  1R8A A;  2DFL A;  2Y0S C;  3T5J A;  4DL5 A;  5F3X B;  3OSP A;  1VJ7 A;  2YMP A;  8ICG A;  4LZG A;  4F3O A;  3D2Q A;  3K75 D;  5ALQ A;  4QZG A;  4I2H A;  3RF9 A;  4QZC A;  1JIH A;  2HHV A;  3AU6 A;  2KMD A;  3TFS A;  2VA2 A;  4OJ6 A;  2DR7 A;  4EBC A;  1UQV A;  1TAU A;  3HX0 A;  1Z00 B;  7ICT A;  4QZI A;  4YFK A;  3H38 A;  3DV9 A;  5J0W A;  3KKA C;  3QX7 A;  4YQW A;  2ZUB A;  5DLF A;  3EPG A;  5J8Y A;  1FO4 A;  4EED A;  5KT3 A;  1ZQF A;  2BQR A;  3SV3 A;  2RQ5 A;  3NS1 A;  1N62 A;  5DQH A;  1GO3 F;  4I29 A;  3SAH A;  1L7O A;  1NZP A;  4BDP A;  4DS5 A;  5AI0 A;  4AYB F;  3K4G A;  5KFE A;  4YXM A;  5ALN A;  4B9U A;  5HRE A;  1ZQQ A;  2K60 A;  2ZH3 A;  1XU4 A;  3GDX A;  1WUD A;  5AKY A;  5G5H A;  4KLF A;  2CXY A;  1F44 A;  5KAI U;  4F72 A;  4NXU A;  2HHP A;  2JRZ A;  1M6Y A;  7ICH A;  3WK9 A;  1S9F A;  3Q8P B;  1BPE A;  3UQ2 A;  3IHQ B;  4U6P A;  4KM5 A;  4TUP A;  2OWO A;  2LKY A;  2JEF A;  1V4A A;  2HCF A;  3PO5 A;  4KLS A;  4X4P A;  1MIY A;  1BNP A;  4PL2 A;  3UPQ A;  2XID A;  4TQR A;  1UHU A;  3BDP A;  2C2R A;  9ICN A;  3UM9 A;  3CP8 A;  4HX0 A;  4F4X A;  5ALS A;  2EQY A;  1NK4 A;  1T3Q A;  5KG4 A;  5L1I A;  3FAH A;  4KTQ A;  4OO1 J;  4NKU A;  1ARO P;  2XCP A;  4EBK A;  8ICM A;  1JX4 A;  4WC0 A;  4NV0 A;  1QH9 A;  4ATB B;  3LDA A;  2F2A B;  4ED2 A;  2BKE A;  3JPO A;  1KW4 A;  4NLG A;  2HSZ A;  5ALL A;  2QLT A;  4ECU A;  3WKD A;  2MA1 A;  3GV8 B;  4KLM A;  2ALZ A;  2ZH1 A;  4UAY A;  4CRX A;  4YD2 A;  2VJ4 A;  1QTM A;  4LEY A;  4IL6 U;  1KFD A;  1S0M A;  3NYB A;  3B0X A;  2BBJ A;  2GA9 D;  2KG5 A;  4IC9 A;  3FYH A;  5J2A A;  4DSK A;  3K1R B;  4JWN A;  3ZDC A;  4R65 A;  4FFD A;  9ICW A;  4RPZ A;  4EX7 A;  5D46 A;  2M2W A;  4J03 A;  4MHV A;  5AKX A;  1X2I A;  4DCC A;  1JI7 A;  4FO1 A;  4ED3 A;  1J97 A;  1WWU A;  4AT8 A;  4EYI B;  2KHV A;  3GU3 A;  3H7I A;  1N61 A;  3SEN A;  4YN4 A;  3TI0 A;  4EEB A;  3HKZ C;  2GLE A;  1ZQH A;  2KSO A;  1RPL A;  5AI4 A;  1OW5 A;  3QU4 A;  5KL1 B;  1KN5 A;  3QU9 A;  3QXG A;  2W04 A;  3OSN A;  4QW8 A;  1JN3 A;  4DLE A;  4MEY A;  2BPF A;  4RT2 A;  2ZJ5 A;  1WG8 A;  4UAW A;  3HP6 A;  3ISD A;  3MR2 A;  4YG2 A;  5IIL A;  1B4F A;  2BHN A;  4DL3 A;  4LT6 A;  4WC3 A;  2ZH4 A;  2J6U A;  4OAG A;  4DOB A;  1CI4 A;  1JMS A;  1S76 D;  1ZQT A;  5JTI A;  2ZIX B;  3Q8S B;  4WQK A;  1KTQ A;  3LYS A;  9ICO A;  2AQ4 A;  2HN2 A;  1RZT A;  3QYP A;  8ICI A;  4UW9 A;  1U48 A;  4OJP A;  1A77 A;  4DFJ A;  1NO5 A;  3RR8 A;  4JB3 A;  2G09 A;  4NL9 C;  1QSY A;  1DOQ A;  3QEA Z;  4P0Q B;  2BQ3 A;  2H3Z A;  2PI4 A;  8ICK A;  1KQQ A;  4F93 B;  5HR7 A;  1MC8 A;  5ALR A;  3N4M B;  2PXI A;  5AKH A;  4J9M A;  3PR5 B;  5DDY A;  4J9N A;  1XNS A;  5AM0 A;  4X5V A;  2JEI A;  7ICE A;  3PO4 A;  4RWP A;  5F2V O;  3PW4 A;  8ICE A;  4GXI A;  1YZ7 A;  4QZ9 A;  3EPI A;  2Y1J A;  3MCR A;  4QZA A;  3WKC A;  2H3Q A;  5ALD A;  5EWF A;  2CRX A;  2K8A A;  2K8C B;  3NVW A;  3UMG A;  3RBD A;  5KFC A;  3TQ1 A;  2E1F A;  4JK1 A;  4QIW C;  4K4I A;  4ECR A;  1Q3U A;  2G06 A;  2VAN A;  1SXE A;  5J2G A;  4ECS A;  1PVP A;  2KIV A;  4BWM A;  2ZG6 A;  2A1A A;  1T94 A;  3OHB A;  5DLG A;  3SAF A;  3KTQ A;  2Y9T A;  4MF2 A;  2F8K A;  3T5L A;  2V4R A;  4NM2 A;  2G5I B;  3AEV A;  4EEL A;  3OUY A;  3UMC A;  2PFN A;  2KZZ A;  1ECW A;  5ALU A;  7ICQ A;  9ICK A;  2YML A;  4PPX A;  4RZR A;  2W7P A;  5KFS A;  3NWI A;  4O5C A;  4B6J A;  3CW2 C;  3G6Y A;  2UVW A;  4C7Y A;  2VIX A;  3OVA A;  1S5L U;  3EZ5 A;  1NK8 A;  1WYG A;  1JXE A;  3OVS A;  5AKJ A;  5KFB A;  2KE7 A;  3KZI U;  5CA7 A;  1BPY A;  2JR5 A;  3RH6 A;  3WU2 U;  3L3F X;  4F5Q A;  3K7D A;  2P6U A;  4Y2S A;  3PW2 A;  5KAF U;  1Q79 A;  1ZOL A;  4WCW A;  4TUQ A;  2GOL A;  1UPH A;  2AH5 A;  3RJF A;  3M6K A;  2ATL A;  5AIA A;  5J0T A;  1BPX A;  1MIV A;  4NXT A;  2KIW A;  1RYS A;  4OAF A;  1ZQJ A;  3L4P A;  9ICQ A;  3BZC A;  4BXO A;  3LWM A;  2YMQ A;  2WB1 F;  2K8B B;  1R8C A;  2B6G A;  4RPX A;  2AHO B;  2V4Q A;  3OGU A;  1XO0 A;  3PSF A;  2W9C A;  4M9J A;  5IIK A;  4JV2 A;  4FS1 A;  4XQ7 A;  2VA8 A;  1Q3V A;  3CRX A;  3T79 A;  2L5Y A;  2ZHA A;  2R18 A;  3PY8 A;  3F2C A;  3PW5 A;  4ECV A;  4IQT A;  5AK5 A;  1L3T A;  3RFA A;  2YQE A;  1ZD4 A;  5CFS A;  1VJ5 A;  4ECW A;  3IRU A;  2ID1 A;  3HT3 A;  1RYR A;  8ICU A;  3MFH A;  1QLN A;  4C8L A;  2ZIW B;  3M9M B;  4F71 A;  4ICA A;  4NWI A;  5KG2 A;  4QW9 A;  1ZQO A;  3OJU A;  3FC4 A;  3M1Y A;  5D63 A;  3C2K A;  7ICK A;  4GLX A;  1ZQ1 C;  1X9X A;  1PX5 A;  5FP0 A;  3MR5 A;  2C2D A;  3IM1 A;  1TK8 A;  1X40 A;  4J9L A;  4AYB C;  1JXL A;  2BR0 A;  5ALX A;  4ACO A;  2ASL A;  1COK A;  4P4M A;  4MFC A;  1JUD A;  3IV6 A;  4DO9 A;  4UBB A;  1SWV A;  3H0L B;  1MQ2 A;  4QZB A;  3HPO A;  1SL2 A;  3ICX A;  4O3N A;  1NKE A; 
#chains in the Genus database with same CATH homology
 4F91 B;  5KFL A;  4WC1 A;  4C8M A;  2DPJ A;  5J2B A;  4PHE A;  3RRH A;  4X4R A;  3QE9 Y;  1XSN A;  4F3O A;  4LZG A;  3H3A A;  4B9L A;  2AGO A;  4RQ2 A;  4WBZ A;  4FBT A;  4QZG A;  3K75 D;  4UB1 A;  5J0R A;  3SYZ A;  4TQS A;  1NKB A;  2NRZ A;  4YVZ A;  4BWJ A;  5J2I A;  2BCQ A;  2PFP A;  4I2H A;  3WFS C;  4DSE A;  5DBC A;  4KLG A;  4QZC A;  3BQ0 A;  1JIH A;  2HHV A;  3AU6 A;  1D9D A;  4EBJ A;  4X4N A;  4NXZ A;  3TFS A;  3Q8M A;  1SKS A;  2VA2 A;  2DR7 A;  2O5A A;  4Q45 A;  4F50 A;  4EBC A;  2W9A A;  5J0P A;  1R8B A;  3SI8 A;  1TAU A;  4B9M A;  2MUT B;  1Z00 B;  3HX0 A;  1D8L A;  7ICT A;  4QZI A;  4YFK A;  3H38 A;  4UD5 A;  2ZH2 A;  1JAJ A;  5J0W A;  4JWM A;  1S0N A;  4YQW A;  4F4Z A;  2ZUB A;  5DLF A;  3EPG A;  4Z6F A;  4HYK A;  1SL1 A;  2ISO A;  4F4Y A;  4M0A A;  2HHT A;  5KT3 A;  1ZQF A;  9ICT A;  4KN4 A;  2BCU A;  4YXJ A;  2BQR A;  2FPL A;  3SV3 A;  1ZQS A;  2M2T A;  3C1Z A;  2XY7 A;  4KLU A;  4ED7 A;  4DWI A;  5DQH A;  3Q8K A;  7ICV A;  4ECT A;  4QZ8 A;  1BGX T;  4YCX A;  8ICC A;  2HVH A;  1ZQV A;  1KFS A;  5J2E A;  4I29 A;  1Y88 A;  4RUA A;  5KG1 A;  5CP2 A;  4QZE A;  5J0O A;  2UVU A;  1NZP A;  5KFR A;  4NM1 A;  4BDP A;  1S97 A;  4DS5 A;  1WCL A;  4O3S A;  2ZH5 A;  3ISB A;  4DOC A;  5KFE A;  3K4G A;  4RQ3 A;  2DRA A;  4RPY A;  5HMM A;  4F5O A;  1L5U A;  4YXM A;  5KFW A;  4B9U A;  3RJI A;  1ZQQ A;  3H8W A;  4DFK A;  3RB4 A;  4XA5 A;  2FLP A;  7ICU A;  4Q43 A;  3C1Y A;  4G3I A;  2ZH3 A;  4JV0 A;  5F9L A;  1KDH A;  4IQW A;  9ICM A;  1XU4 A;  3GDX A;  4PHA A;  3MR6 A;  3GII A;  8ICV A;  3V6H A;  1UT5 A;  2XCA A;  5L1J A;  4KLF A;  1UEV A;  1ZQU A;  1SL0 A;  4QWB A;  2RDJ A;  2ISP A;  1KFT A;  1NK0 A;  9ICI A;  4EZ6 A;  3FDS A;  3AU2 A;  4E0D A;  5KFY A;  3C2M A;  2NRK A;  2HHP A;  4C8N A;  4RT3 A;  7ICH A;  1F5A A;  4IRD A;  1S9F A;  4M9N A;  4B9V A;  3Q8P B;  1BPE A;  3UQ2 A;  3IHQ B;  4I27 A;  5BOL A;  4TUP A;  4UD4 A;  3BQT A;  2ZTD A;  2VA3 A;  3MGI A;  3T5K A;  4F5N A;  1HUO A;  2JEF A;  1K1S A;  2OWO A;  1V4A A;  5KTQ A;  3NTU A;  5HRF A;  2FMS A;  3PO5 A;  4AT8 B;  4KLS A;  5DG8 A;  3RJH A;  4X4P A;  1MIY A;  3THV A;  2R8J A;  1BNP A;  4KIT B;  3UPQ A;  4FH5 A;  4FHP A;  3SV4 A;  3MDA A;  2R8H A;  5DGB A;  3TAP A;  1CEZ A;  4WC7 A;  4RQ8 A;  4DQI A;  1ZQL A;  4TQR A;  5L9X A;  3BDP A;  3UXO A;  2C2R A;  4KLJ A;  4ED0 A;  4C8O A;  4MFF A;  3SZ2 A;  9ICN A;  1Q78 A;  2F1H A;  4I2B A;  4F4X A;  1ZQK A;  3GIM A;  2XY6 A;  1NK4 A;  5J2C A;  2AU0 A;  1ZQG A;  3ZDD A;  3QEB Z;  3PMN A;  2F1I A;  5KG4 A;  3JZ0 A;  5L1I A;  4KTQ A;  2Q66 A;  4DQS A;  4UB4 A;  4NKU A;  3TAQ A;  5D4B A;  7ICG A;  5HRH A;  1ZQW A;  3C18 A;  4IR9 A;  1ARO P;  2XCP A;  2XO7 A;  4B9S A;  1NK6 A;  1U9L A;  3OJS A;  4EBK A;  3C66 A;  3KHR A;  8ICM A;  5J2F A;  1T3N A;  1JX4 A;  4WC0 A;  4ATB B;  4E80 A;  5KG0 A;  3LDA A;  3GIL A;  4EEY A;  1TAQ A;  1TVA A;  4ED2 A;  2W9M A;  2IMW P;  5IIO A;  3H40 A;  2BKE A;  4O0I A;  3JPO A;  4UB5 A;  1SKW A;  3EYZ A;  4EBD A;  1BNO A;  4NLZ A;  5J2H A;  1MQ3 A;  1RXV A;  4NLG A;  2ZTE A;  4I2C A;  3G6X A;  1RXW A;  3M8R A;  2F1J A;  4PGQ A;  4ECU A;  2W8L A;  3JPN A;  3JPS A;  4X4S A;  1NJX A;  3UXN A;  4NKT A;  4I2J A;  5DGA A;  1BVS A;  5KT5 A;  4QZH A;  3RAQ A;  3GV8 B;  1QSS A;  4KLM A;  8ICH A;  2ALZ A;  2ZH1 A;  5J29 A;  1K1Q A;  5C5J A;  4UAY A;  4FO6 A;  4YD2 A;  1QTM A;  2NRT A;  1ZJM A;  5DB9 A;  4DFP A;  4KLE A;  1KFD A;  1S0M A;  4RWQ A;  9ICG A;  3NYB A;  4F5R A;  3B0X A;  3LWL A;  8ICP A;  4DSF A;  3H8S A;  5KFD A;  4PGX A;  5L1K A;  1UA0 A;  1ZQA A;  3OVB A;  1FA0 A;  5DEC A;  3BQ1 A;  1Z3E B;  4S3N A;  3FYH A;  3AQM A;  5J2A A;  8ICY A;  3AQK A;  5KFO A;  3PV8 A;  4DSK A;  4O3Q A;  7ICN A;  4JWN A;  2DRB A;  4RNM A;  5IIM A;  4P4P A;  3V6K A;  3ZDC A;  3JPQ A;  4R65 A;  8ICG A;  4RU9 A;  9ICE A;  4M5D A;  1ZQX A;  1UT8 A;  2KN7 A;  2ASJ A;  4F4K A;  3OV7 A;  9ICW A;  4RPZ A;  4WC6 A;  5D46 A;  4E8F A;  5J0S A;  2M2W A;  1XS9 D;  2C28 A;  1H38 A;  3ZDA A;  3HWT A;  1X2I A;  2GWS A;  2ZH6 A;  3TAR A;  4QWD A;  4ED3 A;  3RRG A;  3V7L A;  9ICJ A;  1XWL A;  1X9S A;  2HHS A;  4F5P A;  4EYI B;  2HVI A;  5J0X A;  4AT8 A;  4ECX A;  3GIJ A;  3H7I A;  1T8E A;  3L9D A;  1XO1 A;  4YN4 A;  3C23 A;  3TI0 A;  2FMP A;  4P2H A;  1TKD A;  1ZQH A;  1ZQC A;  1RPL A;  3TFR A;  2ZHB A;  1LV5 A;  2DR5 A;  4DL2 A;  2Q0Z X;  4E7X A;  2XC9 A;  2R8I A;  4YR0 A;  2BPC A;  2LYH A;  3MR3 A;  1ZJN A;  2BCR A;  2JZB B;  1SZP A;  4LZD A;  3N97 B;  1D9F A;  3OSN A;  8ICX A;  9ICA A;  4QW8 A;  1JN3 A;  4I28 A;  1A76 A;  4DLE A;  1NK9 A;  4Q8F A;  4MEY A;  3MGH A;  5HRD A;  5HHH A;  5KFK A;  5L1L A;  3BQ2 A;  3V7J A;  4J9K A;  4M9H A;  2BPF A;  4QZD A;  4I2F A;  4Z6E A;  4RT2 A;  2ZJ5 A;  1XSL A;  3ZDB A;  4ATB A;  5DB8 A;  1MIW A;  8ICS A;  2XGP A;  1U47 A;  2UVV A;  5J0Q A;  4EZ9 A;  1NJY A;  4XQ8 A;  4UAW A;  3HP6 A;  4UAZ A;  4I2D A;  5HC9 A;  4M6W B;  3ISD A;  3T3F A;  5KFX A;  1C7Y A;  4X0A A;  4DSL A;  3E2E A;  4DS4 A;  3JYY A;  2HHU A;  3MR2 A;  4YG2 A;  2H5X A;  5IIL A;  2BHN A;  4JUZ A;  4DL3 A;  3EWA A;  4LT6 A;  4WC3 A;  2ZH4 A;  2J6U A;  4KMU A;  7ICJ A;  4X4O A;  4RQ7 A;  3QZ7 A;  4IRK A;  4KN7 A;  4DL6 A;  8ICB A;  2ZH8 A;  4P4O A;  4DOB A;  1JMS A;  2MAX A;  3ZD9 A;  5DBA A;  1S76 D;  5KT7 A;  4Z6D A;  1ZQT A;  3M8S A;  3Q8S B;  1KTQ A;  9ICO A;  4J9R A;  2AQ4 A;  3RJG A;  5CWR A;  4YMO A;  4J9S A;  1NK5 A;  3C21 A;  3OUY B;  1RZT A;  7ICR A;  5KFV A;  5JUM A;  8ICI A;  3JPP A;  1U48 A;  2XY5 A;  4DQR A;  4RUC A;  5J0U A;  1A77 A;  5HNK A;  4YMM A;  3PR4 A;  3QZ8 A;  4DOA A;  4XRH A;  4DFJ A;  5CR0 A;  2P66 A;  4ECY A;  1D8Y A;  2R8G A;  3WFQ E;  1R89 A;  8ICT A;  1NO5 A;  3RR8 A;  1UEU A;  4I2A A;  1NOM A;  2ZJ8 A;  5EOZ A;  1DOQ A;  4F92 B;  1QSY A;  3HIY A;  3QEA Z;  4YMN A;  4I2E A;  2BQ3 A;  8ICK A;  3PX0 A;  2PI4 A;  5DED A;  4KLI A;  2JEI A;  1U49 A;  4RQ1 A;  5KFZ A;  3KHL A;  4F93 B;  1L3V A;  4JV1 A;  1MC8 A;  2ZUC A;  5KFM A;  8ICQ A;  4AT7 B;  2NRV A;  5HHI A;  2W9B B;  3G6V A;  2PXI A;  4EYH B;  4J9M A;  3N4M B;  4DQQ A;  4DSJ A;  4RWO A;  9ICB A;  3WFR E;  5F9N A;  3PR5 B;  2MUT A;  1Z00 A;  5KT4 A;  5DDY A;  3Q8Q B;  4J9N A;  8ICW A;  3RR7 A;  1OU5 A;  3RJJ A;  4NLN A;  4PHD A;  1WCN A;  4B9N A;  1CUK A;  4PH5 A;  4X5V A;  5HP4 A;  3PO4 A;  4F2S A;  1S0V A;  4ZH4 A;  5KT2 A;  5D49 A;  1EXN A;  3ZDE A;  7ICE A;  2M2V A;  3WFO A;  4RWP A;  5F2V O;  2FLN A;  3PW4 A;  1ZQD A;  8ICE A;  4GXI A;  5III A;  5CJ7 A;  4NY8 A;  4ELV A;  5IIJ A;  5J2K A;  4IG8 A;  4QZ9 A;  4FHV A;  5IIN A;  4Q44 A;  3WFP A;  4YD1 A;  3MFI A;  1ZQB A;  2ZUD A;  4F4W A;  1NKC A;  3EPI A;  2Y1J A;  4KLL A;  2JZB A;  2RDI A;  3H8J A;  4QZA A;  2PFO A;  4IRC A;  2KFZ A;  1QSL A;  2HHW A;  2BGW A;  5J2J A;  5J0Y A;  1HUZ A;  2DPI A;  4X4U A;  8ICN A;  2BE3 A;  5EWF A;  5KG7 A;  5HRE A;  3PW0 A;  4KLD A;  5DDM A;  2IA6 A;  4DEZ A;  2FMQ A;  2A1J B;  2IHM A;  4R64 A;  7ICM A;  3RBD A;  1LB2 B;  1U4B A;  5KFC A;  3TQ1 A;  4K4H A;  4BXO B;  9ICH A;  4JK1 A;  4RQ4 A;  4K4I A;  4ECR A;  3PX4 A;  5KFT A;  4RQ6 A;  2VAN A;  5J2G A;  4ECS A;  4M6W A;  2C2E A;  8ICZ A;  4YR3 A;  4IR1 A;  4IQV A;  1NK7 A;  4LVS A;  7ICO A;  2M2U A;  5HRL A;  4BWM A;  2W9C B;  4R66 A;  2WTF A;  1TFR A;  2NRX A;  3KHH A;  2V9W A;  3OHB A;  5DLG A;  3KTQ A;  3H37 A;  1ZQZ A;  4RQ0 A;  4Q8E A;  4MF2 A;  4O5E A;  4ELU A;  1WOT A;  3HJ1 A;  4WC5 A;  3V7K A;  2V4R A;  3T5L A;  2IBK A;  4NM2 A;  3RB3 A;  3Q8R B;  4WC4 A;  7ICF A;  4Z6C A;  5KFF A;  5BOM A;  3TAN A;  3Q8L A;  3RB0 A;  3MAB A;  4XUS A;  4R8U B;  3OHA A;  4QWA A;  1TFW A;  1TFY A;  3OUY A;  1HJP A;  4RWN A;  2PFN A;  5J2D A;  3MBY A;  8ICR A;  2KZZ A;  2JEG A;  1TK0 A;  3ZD8 A;  4FBU A;  9ICV A;  4O5K A;  2HHX A;  4I2G A;  7ICQ A;  4DQP A;  4BGD A;  5EWE A;  4ECZ A;  5DB6 A;  9ICK A;  3UQ0 A;  2KFN A;  4O3O A;  4O3P A;  4RZR A;  4PPX A;  5CHG A;  4EBE A;  4PHP A;  3ISC A;  1ZQR A;  3GIK A;  4DF8 A;  5KFS A;  1UET A;  3BJY A;  4ELT A;  4M04 A;  4R63 A;  2ZJA A;  2FLL A;  4O5C A;  8ICJ A;  5HRI A;  1UA1 A;  4C8K A;  4AT9 B;  3G6Y A;  2UVW A;  7ICL A;  4AT7 A;  3OVA A;  2W9B A;  1TK5 A;  4GC7 A;  3AQL A;  1TV9 A;  2IHN A;  4ED6 A;  4TUS A;  2AGQ A;  1B43 A;  3EZ5 A;  1NK8 A;  1JXE A;  4K4G A;  3RH4 A;  7ICI A;  3OVS A;  3LK9 A;  1DGS A;  5KFB A;  5CA7 A;  2NRW A;  1BPY A;  4GC6 A;  4ED8 A;  3RH6 A;  3GQC A;  4F2R A;  4F5Q A;  2BPG A;  5DQG A;  4F8R A;  4KLH A;  4FHX A;  4GXJ A;  2ZTC A;  4X0B A;  2HW3 A;  5KG5 A;  2P6U A;  3PW2 A;  3RTV A;  4KLO A;  3T5H A;  3LQC B;  5KFP A;  3RB6 A;  1Q79 A;  4WCW A;  5DKW A;  5DQI A;  3GFK B;  3RAX A;  4TUQ A;  2PI5 A;  1ZQP A;  5HR9 A;  2AJQ A;  9ICX A;  3RJF A;  3GV5 B;  1S77 D;  1V9P A;  2C22 A;  2B21 A;  1NJZ A;  2ATL A;  5J0T A;  1BPX A;  1MIV A;  4FHY A;  4MEX A;  1RYS A;  3PNC A;  1L3S A;  5HRK A;  3RBE A;  2I1Q A;  2A1J A;  4QWC A;  4RNO A;  1ZQJ A;  9ICQ A;  1S0O A;  4J9Q A;  1X9M A;  1DK2 A;  5KFI A;  2DVI A;  4BXO A;  3LWM A;  5EWG A;  4PGY A;  3C5F A;  4ED1 A;  1R8C A;  3PVX A;  1KSP A;  4RPX A;  5HRG A;  1IXR A;  5KT6 A;  2W8K A;  2BCS A;  5TZV A;  2FPK A;  5HML A;  4UB2 A;  3V6J A;  1XSP A;  1COO A;  3OGU A;  2V4Q A;  2J6T A;  4QWE A;  5KFA A;  1VFG A;  2XGQ A;  2W9C A;  3C5G A;  3PW7 A;  5IIK A;  5DG9 A;  1PZN A;  4M9J A;  4JV2 A;  4FHW A;  2DR8 A;  4DFM A;  4IQU A;  8ICO A;  2DR9 A;  2P6R A;  3ORY A;  4FS1 A;  3M9N B;  3HJ4 A;  4XQ7 A;  5KG6 A;  2VA8 A;  4UQG A;  2M9N A;  1KRP A;  1VJ7 A;  1KLN A;  3H4B A;  1L3U A;  2KP7 A;  1SKR A;  1DK3 A;  1MSW D;  3V72 A;  2ZH9 A;  3MDC A;  4MFA A;  4DL4 A;  4O3R A;  2ZHA A;  1YLQ A;  3PML A;  3PY8 A;  4R8U A;  1NJW A;  5HRB A;  4DF4 A;  3AUO A;  2BQU A;  3RJK A;  2HHQ A;  3M9O B;  1ZET A;  3PW5 A;  2AGP A;  3HW8 A;  5KFJ A;  4M2Y A;  4ECV A;  9ICC A;  1KEJ A;  3PX6 A;  4IQT A;  4J9P A;  4DLG A;  1L3T A;  2I9G A;  3EW9 A;  1T4G A;  4UBC A;  4ECW A;  3NGD A;  9ICS A;  5KFH A;  4ECQ A;  1ZQE A;  1BPB A;  3H4D A;  2O1P A;  2JEJ A;  4FS2 A;  2KTQ A;  8ICF A;  2ID1 A;  3B0Y A;  7ICP A;  3HT3 A;  1N48 A;  3JPT A;  1RYR A;  8ICU A;  4X4V A;  3JPR A;  4QZF A;  3C2L A;  4GXK A;  1XC9 A;  3MFH A;  1QLN A;  3ETL A;  1X9W A;  4FH3 A;  9ICL A;  4AT9 A;  1IM4 A;  5DG7 A;  4C8L A;  4M9G A;  2KZ3 A;  2AQ0 A;  3RH5 A;  1JQR A;  4X4Q A;  3KHG A;  3UPS A;  4M9L A;  5DB7 A;  4RNN A;  3AQN A;  8ICA A;  2R8K A;  5KFQ A;  2PFQ A;  4O9M A;  3M9M B;  9ICP A;  4WBY A;  1T7P A;  3UXP A;  2J6S A;  4X4T A;  2KZM A;  3RJE A;  9ICR A;  4TUR A;  2PBE A;  5KFG A;  1ZQY A;  5KG2 A;  4QW9 A;  1U45 A;  3OJU A;  1ZQO A;  2UVR A;  1BPD A;  5BPC A;  4B9T A;  4DSI A;  3C2K A;  9ICF A;  7ICK A;  4GLX A;  1S10 A;  4NLK A;  2ASD A;  7ICS A;  4CCH A;  4YR2 A;  8ICL A;  3GV7 B;  4YP3 A;  1PX5 A;  5DBB A;  1N56 A;  1B22 A;  1ZQN A;  4DL7 A;  3MR5 A;  2C2D A;  4UB3 A;  1ZQI A;  1BPZ A;  3IM1 A;  1TK8 A;  4J9L A;  4KLQ A;  1JXL A;  5CB1 A;  5KG3 A;  2BR0 A;  4EP7 A;  2ASL A;  2FPM A;  2Y1I A;  1ZQM A;  4M47 A;  2BDP A;  4MF8 A;  4P4M A;  4MFC A;  4I2I A;  4RQ5 A;  3H39 A;  4DO9 A;  4J9O A;  4KLT A;  2RFF A;  9ICU A;  2BCV A;  1KNY A;  4UBB A;  1R8A A;  4WC2 A;  2DFL A;  3T5J A;  1MQ2 A;  4DL5 A;  4QZB A;  3OSP A;  3HPO A;  5KFU A;  1ZYQ A;  1SL2 A;  2ZH7 A;  4O3N A;  5KFN A;  1NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...