3C18A

Crystal structure of nucleotidyltransferase-like protein (zp_00538802.1) from exiguobacterium sibiricum 255-15 at 1.90 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
GMEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQMSLSFAKLLRRFQDGRNLFSRGNYYDAYTHVHHALHHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQSKVLSGGKYLFEVMRERDRPWTMHELMEESRLTELKVDLGSLVDFFIRKGLIRISYQRTKGLGVELVTYEPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotidyltransferase-like protein
publication title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
total genus 107
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14540 NTF-like Nucleotidyltransferase-like
A PF18576 HTH_52 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c18A03
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3c18A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3c18A01
4MTEA 4GCVA 1KQ9A 3T0YA 4ZZLA 5D5VB 9ICSA 4IJAA 5CVJA 1G3YA 3T5XA 1ZARA 9ICAA 2Q0OA 4KLLA 2IT0A 1OW8A 4A2UA 3MZHA 4WC4A 1UEVA 3K7DA 1ZQVA 1BC8C 4WBZA 2Q66A 1UHMA 2GXBA 1GXPA 4KLSA 5ICCA 4G7OF 2RGVA 9ICIA 1KQ0A 1ZH5A 1JXSA 3J81Z 3SFZA 4UB1A 1JN3A 3BWGA 2HKOA 5IT9K 4BHCA 3E6DA 1BI2A 4I2EA 2ZH4A 4PCQA 1BIBA 2STTA 4EJVA 2STWA 3HHHA 5JI6A 1U8RA 9ICFA 1FA0A 1XCVA 2W85A 1QVXA 3W6KB 4HF1A 4AT8B 1YO5C 1FBQA 3RPQA 4WC1A 3SZTA 4M9SA 5J8FA 1ZLJA 2YPRA 4H0EA 3ZMZA 1HBXG 3E3VA 4NKUA 5D5WB 3EDPA 3J80K 3QP5A 5CVVA 4MTDA 2GAUA 1LEAA 2PBEA 3ABUA 3ZMTA 3MQ0A 3M8EA 3DPTA 2EK5A 2A3SA 5J0TA 4X4OA 4UAWA 1SD5A 5L3EA 4OIOF 3HRTA 2HYGD 4L0YB 2JX0A 1ZQXA 5J2AA 2J5PA 5DYMA 2E7WA 4X4QA 4KLDA 5DBBA 3MEXA 2HDCA 4M6XA 1ZN2A 4M74A 5H20A 4KLHA 1RZ4A 4RB0A 2P7VB 1W5SA 4CXFA 4P9FA 4LLGF 3TOBA 3OUYA 4E8FA 1JQRA 1LDKB 3ISCA 4MHGA 1K05A 4R32A 4Z6CA 1GHCA 8ICUA 4LZGA 3C8GB 2HKXA 2EFNA 3BZ6A 5JHUA 3GM2A 2UZKA 1MKMA 5J0UA 3UQ0A 2KJCA 4MFAA 4IVNA 3WU0A 1R8CA 1MZBA 4TURA 5CJ9A 4YFNF 1T2KA 2BV6A 4XA5A 4NB5A 4I01A 9ICBA 3L00A 2FNPA 2JPCA 1VJ7A 3KLOA 3K9TA 3RJPA 4ZYHA 2P5KA 4HBLA 3RI4A 3LQQA 5F2VO 4LD5A 8ICXA 3PQJA 1Z7UA 1LB2A 1QGPA 3FXQA 2RQPA 3C1DA 3H37A 7ICEA 4FT8A 4RQ8A 2EV5A 3KFWX 5L3CA 3TO9A 2ESNA 1DDNA 3F6VA 1P4XA 4A6EA 1ON1A 4IPAA 3FXUA 4HX8A 2XAJA 1D3YA 4I29A 9ICOA 3GX4X 7ICHA 7ICQA 1YFHA 3NQOA 3KEQA 3TFSA 8ICSA 3I4PA 5DDGA 1KNYA 4MF2A 1SMYF 3W6JB 3GFIA 3AQMA 5A2QZ 4Q47A 7ICFA 3T1BA 3WFPA 4PGGA 1L3LA 3R6SA 1J59A 3SQNA 3E5UA 4YMNA 1KU3A 1TNTA 4A6DA 4EM0B 1ZQRA 4QWQA 1BN5A 5LGNA 1XSXA 3RH5A 4MQVA 1ZQKA 4I28A 2DLLA 4MEYF 3AU2A 1BIAA 4NM1A 5L3GA 4UBCA 2ZHBA 4YCXA 1KU7A 2C6YA 5ICFA 1CGPA 2OBPA 2XAGA 5TZVA 5DBCA 4I2HA 3TQNA 3U0CA 3I59B 1PP7U 3ELKA 1XSNA 3G3ZA 1WRJA 4M6YA 3MFNA 1XSPA 1ODDA 3IWFA 3KLNA 1YLFA 2WTEA 3S9OA 1RUNA 2DR5A 4R64A 1FT9A 2W24A 1G4DA 3DXJF 3PMLA 1Z9CA 1MJBA 1HXDA 1TV9A 4M9ZA 2QBYB 2L4MA 3U1DA 1S8NA 2XKOA 2OA4A 2X0LA 2UXXA 1IN4A 1AWCA 2PFOA 2R3SA 4U0VA 1YG2A 4FH3A 2ISPA 3FX3A 1R1UA 4P4MA 2VONA 5ILUA 1ZQBA 3MDCA 4WXDA 2FF4A 1ZZPA 1PDNC 2D2WA 4KA4A 4ATBB 3R0AA 2W9MA 3GXOA 3BPVA 3LSTA 4L9JA 3BJ6A 1NO5A 2ZXJA 2Z3YA 1WSUA 2IW5A 4P4PA 5H6QA 2D1HA 3WE3A 2CQKA 2ZO4A 1QNTA 4I2OA 1NOMA 1I6XA 2XHKA 2YWAA 2BYVE 1YW8A 1OW6A 1OMIA 1JE8A 4XQ7A 1HW5A 1CF7A 5HS7A 5DCMA 5CLSA 4HYEA 1BI1A 1BPYA 2XV4S 4ENJA 4RPZA 2FMPA 3GVAA 4Z6EA 4R79A 4KLIA 3JPNA 2K86A 1R8AA 2VXZA 3HX0A 4KIBA 1HKTA 3H38A 1BC7C 5J2KA 3IHUA 8ICAA 1W7PA 4RWPA 2H09A 2YR2A 4ZYGA 3HSFA 4G8XA 4G6QA 3RYPA 1RPLA 4KNYA 2IA0A 2GIVA 3D0SA 3TOAA 3KP7A 2UXNA 2P66A 2VT2A 2W57A 1TNSA 3DF8A 1MDMA 4M0AA 3R60A 1ZQDA 4M9LA 1F5TA 1ZQJA 3CUOA 4TUSA 3ZMUA 4LLNA 3UQ2A 4FX0A 4RGUA 1MJ9A 3ECHA 2L6HA 5J2HA 4KLTA 1DPRA 3WTSC 3ISBA 2MH9A 9ICQA 9ICGA 3GFLA 1SD7A 2V1DA 2RV8A 4X4UA 4FHVA 1JHHA 5F6FA 1EH6A 1IRFA 5CA7A 2V1UA 3K2ZA 4LB6B 1FOKA 3JYYA 1J5YA 4P4OA 3CTAA 3CO6C 2FRHA 2DO7A 4NLZA 3OUYB 8ICHA 4YFKF 4ZH4F 1ZQLA 5KK1A 4K4IA 4U88A 2D1VA 4EJUA 4KLMA 4HDVA 2A07F 5HHIA 1FSHA 2ZNYA 1FPQA 1BM9A 4DOCA 4HOBA 4M5DA 2DRAA 3Q5FA 1ZRCA 1S29A 3HTSB 3F8FA 3EETA 2BBYA 4BYYA 1IN5A 2VBXA 1MQ2A 2RNJA 2ZHAA 5IILA 2XAQA 4ENNA 1FWZA 5BPDA 3AQKA 8ICQA 5DD8A 4GYGA 4LG0A 3WFRE 4NLKA 3KE2A 1C0WA 3RYRA 4F5OA 3LAJA 1PUEE 5LBQA 4I0AA 1K78A 8ICBA 3JPTA 1R1VA 4WX9A 2OQGA 5J0XA 2YU3A 3B71A 1O3RA 5DB8A 2L6GA 4M2YA 2LF8A 3K1MA 3KP3A 4PGYA 1STZA 1OR7A 2UWMA 1IXRC 2RN7A 4UVAA 4Q48A 2ZKZA 4RS8A 3F3XA 2MLGA 2BEOA 1DP7P 1ZQCA 1SD4A 1ZG5A 4EVIA 4U0YA 1Y0UA 3MWMA 1JHFA 4KMFA 3JPOA 5CJ7A 2MC3A 8ICCA 4F5RA 2PFBA 2AS5F 2OZ6A 1HKSA 4UVBA 6PAXA 1KYWA 4L5IA 4PGHA 2K7LA 4MQ9F 2HQNA 4AT9A 3OV8A 2V6CA 2XIGA 9ICJA 1YW9A 2Q8KA 3KEOA 2VODA 2XAHA 2FSWA 4IRGA 2A6HF 1RUOA 2HR3A 4KN4X 3P7NA 2XASA 4BAYA 4RPXA 1KYZA 3WG9A 4XQ8A 2GQQA 4A5MA 3L2CA 4I2BA 4F5PA 4RQ4A 3JTGA 3HJ1A 4E7XA 7ICJA 2F5FA 4O5CA 2QYOA 2D45A 5LRSA 4QZFA 4TV7A 2IPQX 1RZTA 3RKXA 4YG2F 2XAFA 2M8EA 4KLUA 3RH6A 2RDPA 2ZBKA 2ZH1A 2DR8A 1TW2A 4WCGA 1B9NA 1SAXA 1ZRFA 3NYBA 5LGUA 3GFJA 5K1YA 1X3UA 4FO6A 1ZQEA 1W5TA 2PBIA 3ZMDA 4LMYA 5IIOA 1J9IA 1R8BA 2GWRA 2M2TA 1HSTA 3LWFA 4N9HA 2L6FA 5BOMA 5FO5A 4Y17A 3GUDA 3BY6A 3JPQA 2CO5A 1QZYA 2DK5A 4LK1F 4UD4A 2CFXA 1BBYA 4UVCA 4QZ9A 4X0AA 4IQUA 1UEUA 2BPCA 3TO7A 2PFQA 3LA3A 1JGSA 4LLLA 4UB4A 2IHMA 4Y13A 4OIPF 1FNNA 5FLXK 2JSCA 4QZHA 4M72A 2BPGA 1KQ8A 1O7FA 1LDJA 2LNBA 3FF5A 4L9VA 3V7CA 1TFWA 1I1GA 1WKMA 1UHWA 1U5TC 4HLXA 1FYLA 3MFKA 4WC5A 3MAJA 1BI0A 5D5XB 2ESHA 3LAPA 1XN7A 4NQWA 5CR0A 5HDGA 4WC2A 1ZQWA 4KLGA 2QUFA 4UNOA 4WK8F 3F8BA 3COAC 2E7XA 4UHTA 3WTZA 5DECA 2F5CA 2L01A 4P5OA 4PDKA 1W7PB 1XGSA 3S2WA 2IJLA 2YX4A 1ZQNA 5J6XA 2RFFA 1ZQZA 3JPSA 1YLQA 5D4RA 4PPXA 2M45A 4JWNA 4O9MA 4I98B 4NQFA 3HUGA 4XRFA 5FD6A 3V8KA 1F4KA 2P5LC 3V7LA 5J0WA 5ERIA 5DKWA 5HC9A 2L4AA 4AT7B 4EQQA 2CYYA 3BRJA 2PLYA 5J0OA 1V3FA 2O8XA 1MDMB 3HYIA 4RPYA 4I7HA 1YTYA 4ON0A 1QBJA 4FHXA 5J0SA 4UUVA 1ZG1A 2ISZA 1P92A 4Q5SF 4A0ZA 1K79A 5K5OA 7ICUA 4EMSA 3WGHA 1OPCA 1ZAOA 3E5XA 5DD4A 4QZAA 3H3UA 3MGIA 1S7AA 5K5QA 5J0RA 3F23A 5D8LB 3OV7A 1FZPB 4KIGA 5HRIA 5A2QK 4M71A 3VOEA 2P6SA 3V72A 2P7CB 5HLGA 5HRFA 3F8CA 4K4HA 1IW7F 1BPBA 5F64A 2KK1A 2M30A 3BJOA 1EV7A 3J80Z 4NLNA 2FU4A 2DPDA 9ICEA 1OU5A 1IAWA 4RQ2A 2LK4A 4FH5A 4DNCA 5D6EA 4XSZF 4L18B 2PFNA 2IA1A 4JQFA 1ZQOA 2NRKA 1PV3A 4IQWA 9ICWA 4FHYA 4WCWA 2H27A 3TDZC 4EGYA 4HV5A 2OQRA 4JK1X 4HQEA 8ICJA 1ZGAA 4K2EA 5L3BA 4IHTA 4KYWA 4LG0B 1H0MA 5FD5A 4ZYEA 3WGGA 5E18F 3LA7A 1HKQA 2O3FA 3WFOA 1K78B 2PMHA 5IINA 2VE9A 2VBWA 3ZP5A 2DR7A 4FX4A 2DW4A 3IWZA 2O0YA 1HW2A 1T98A 1LNWA 3DQVC 1TVAA 1KDHA 5ILSA 5CHGA 4WC0A 1EH7A 4ESJA 4BXUA 4UV9A 3GYHX 3REOA 3I5UA 4S05A 1E2XA 3RIRA 5HDNA 4AD9A 3WGIA 3RJJA 1EH8A 1TQIA 4KFCA 1IN8A 1PP8F 1YYVA 4RQ7A 1BJAA 1OYWA 2OD5A 4UAYA 5J0QA 4P55A 2M2WA 4I02A 3LK9A 2XKPA 3L8JA 1U78A 1SFUA 2CG4A 2E1NA 3UPQA 4KN7X 3LA2A 3KETA 1F5AA 1XSLA 5BPIA 1IRGA 3C8GD 3JSPA 3FXRA 1KGSA 1S3JA 2ZH3A 3ZN0A 1Q79A 3RDIA 2ZH2A 2DBBA 8ICRA 2ADUA 4PHPA 3EUHA 1ZJMA 3CUQA 1ZQSA 2NYXA 1ZQHA 4G7HF 2VC1A 3FHZA 1SD6A 5J2JA 4QLCU 5D5UB 3G73A 5CVRA 2Z5UA 4LJZF 7ICPA 4IG8A 3BOQA 1K7AA 3I0TA 3JTHA 3V7RA 4X4RA 1NHAA 1XGNA 2WWYA 4GXJA 2FOKA 1JAJA 3AQNA 5IIKA 2A61A 1B6AA 2F5DA 5HRHA 1XGOA 2BCUA 3R61A 2MD5A 4HAMA 2JPUA 2EV0A 4U0WA 1Q1HA 1U5TB 4QZBA 2FMLA 4HQMA 2DTRA 4KICA 3TFRA 2EJRA 3KP4A 4ESBA 2EWNA 9ICTA 3JPRA 1WOTA 1ZQYA 4ZYDA 7ICRA 1ULYA 4RQ1A 4HF0A 8ICIA 4RQ3A 3N97A 4I09A 4IF4A 2MA3A 4NHJA 2DAOA 5D8KB 2KIUA 1B59A 2EB7A 1ZQFA 2PI0A 3HIFA 4XEVA 4U7BA 4F5NA 2G7HA 3HOSA 4I2JA 4B8XA 1F1ZA 2FMQA 2ZCWA 9ICKA 4RT2A 3T8RA 5HS9A 2GA2A 3L9FA 4OIQF 4Z6DA 2X4HA 1O57A 1R00A 2FE3A 4G7ZF 1DUXC 5BOLA 9ICLA 2Q00A 2RC4A 2ZMEA 2R7DA 3EQLF 1Q78A 2FBIA 4HF2A 1U2WA 1D8JA 3IC7A 3JZ0A 3OVBA 4EBJA 4FHWA 2VC0A 8ICFA 1BPDA 2BCSA 1KU2A 1KU9A 2ISYA 3B73A 2Z33A 3ZPLA 5E1WA 2BGCA 2WC2A 1ZJNA 1XD7A 3KP2A 1UFMA 4HX4A 5ICGA 1KA8A 3VODA 1RI7A 4MGRA 4I2GA 4Z6FA 4Y15A 3GZ6A 4M73A 1QZZA 2BCQA 2XROA 3UXOA 3CJNA 2VANA 4NY8A 4RAZA 4WC3A 2DU9A 4Z2YA 5AIQA 1RIOH 5FFZA 3WTXC 4RT3A 1P2FA 2A68F 4HA8A 1JOGA 8ICEA 2GWSA 4IQTA 2ZNZA 4PHAA 4LK0F 1W4MA 4YD1A 3QP6A 1UFBA 3K69A 4GXIA 5DBAA 3C8GA 3GO5A 2B0LA 3OVSA 2VT3A 3I71A 3NRVA 1ON2A 3QPHA 2K4BA 2PQ8A 2K02A 4LZDA 3U3FA 2VOPA 8ICWA 4EM1A 3RJIA 3HRUA 2M2UA 2R7FA 2YX7A 3TKYA 2MLKA 4YIFA 2EFWA 5JR3A 4YFXF 1HUZA 4P96A 5DDYA 8ICYA 3E6CC 5K5RA 1WI9A 5J2FA 3BROA 4A0YA 3K75D 4IRHA 2M2VA 2FNAA 5H6RA 2P6TA 3O10A 1G3SA 4L9TA 4E80A 1T6SA 5LEKA 2EV6A 2TDXA 2HHPA 2BCRA 3D5LA 4AVPA 1P4WA 4MEXF 2M87A 3HIYA 4RQ0A 5HLIA 2L3DA 2FMSA 4X0BA 3ML6A 4DOAA 4WBYA 4RWQA 5LEJA 3CLOA 3GDXA 2F5EA 4GYIA 2V9VA 2H6CA 5HOOA 1OW7A 2A6EF 2JPBA 4GO1A 5J2BA 3UXNA 2ZJ2A 1O3SA 3GWZA 2O03A 2VE8A 1UCRA 3RQGA 3RQEA 2EFQA 3JAMK 3T8TA 5BMZA 4X4PA 1R23A 2ACJA 2VBZA 1Z05A 3QOPA 2NAZA 1YS7A 4MFCA 9ICRA 5DCFA 1U3EM 3R0JA 1XB4A 2PXIA 1BOAA 5DEDA 2HGCA 4F7ZA 1G6NA 8ICMA 4UB2A 1S7OA 3MGHA 3F22A 7ICLA 2P8TA 4KLQA 1TBXA 3HRMA 1J0RA 2COMA 3WTYC 3DV8A 1B9MA 3P9CA 1ZYRF 5HRBA 4G94A 1OKRA 1ZQTA 4LVSA 4R8HA 4L5JA 1VFGA 5DB6A 1QO0D 2G7UA 3J81K 2NNYA 2HZTA 3AQLA 2A69F 1H9TA 4XEFA 4CZZA 2CWEA 2BE5F 2QBYA 4UBBA 1XCBA 4I2AA 1BI3A 4R65A 2LDUA 7ICNA 3HRSA 2FMYA 3H3ZA 3ZQ7A 4OIRF 3L8IA 2NNNA 5BPCA 4HX7A 3AUOA 1MQ3A 4WC7A 3E6BA 2AXLA 3IKTA 3CUQB 1YS6A 4KLJA 5IIMA 4G9YA 4NM2A 4N9IA 4RGSA 3BJAA 4O5EA 1R7JA 4ATBA 2DVIA 5E1XA 2J5OA 3PMNA 4OOIA 3FZVA 3QU3A 1ZQQA 4M9GA 2ZH7A 2P4WA 1AOYA 2HYFA 4WXCA 4QZEA 1IZ1A 3ERED 1FYKA 3RQFA 3ISDA 5HR9A 5LHIA 5AONA 8ICLA 5J2CA 8ICPA 4RGXA 3WTWC 4I27A 3LQCB 2FA5A 3HSRA 4R1HA 4O5VA 2GZWA 2HTSA 2PFPA 3AAFA 1O7LA 4UB5A 1O3TA 2A5YB 3N4MA 3KP5A 1FSEA 1ZREA 3C2MA 3AU6A 4U7DA 8ICZA 1FYMA 1TFYA 3M1EA 1FP2A 9ICNA 2FEZA 8ICOA 1CF7B 5E8GA 1T38A 7ICIA 5DCMB 3V7JA 4JBAA 3B02A 1D8KA 4E70A 2CGPA 1T39A 7ICOA 4R66A 2MBFA 3RJFA 1YIOA 3L09A 3C2KA 3U9GA 4KLFA 5HRGA 3WFSC 1MD0A 4ETSA 1UETA 5IIJA 1R22A 2ZMEB 2XGXA 1XMAA 5DEQA 2HWVA 3F21A 2HTJA 3O3KA 1WQ2A 3RJKA 2ISOA 4P2HA 4L9NA 4OU0A 3V7KA 2F2EA 3FMRA 3MCZA 4RAYA 3KCCA 3MDAA 3C66A 1Z1DA 2DT5A 2DI3A 1S6LA 3F72A 4IXAA 1R5HA 2O61A 4XEKA 3V8JA 5J0YA 5D46A 1QPMA 4WXHA 2Y0MA 5CYVA 5HS8A 2VN2A 3VFZA 4IHSA 4CDGA 3VEPA 2XRNA 1R58A 3C7JA 5FFXA 5CB1A 3DP7A 3QPTA 4D0PA 1R5GA 5IT3A 4TUQA 3C5FA 5CVUA 5IT9Z 2QQAA 4AIKA 5FLXZ 2Q2EA 3O6BB 1XSDA 2OU2A 4RB1A 5HVQC 4O3MA 4KMUX 3GM3A 1Z6RA 3WFQE 3E97A 4OINF 4CGZA 7ICMA 4JWMA 5BQTA 7ICSA 4ASNA 4QZDA 1YW7A 3GM1A 2H94A 1ZQIA 9ICUA 5LHGA 4EBKA 5DUKA 4XUSA 3C3WA 4EJWA 1HUOA 2M1BA 3QAHA 3HW8A 5E17F 5LLQA 2VOOA 2EFOA 1LEBA 5FGMA 3RH4A 1WTYA 5CP2A 4I0BA 1GXQA 3V4GA 5E8IA 3MZYA 2JT1A 2HSBA 1I5ZA 3FWEA 1ZG3A 3TO6A 5DB7A 1LDDA 2DQLA 1HW1A 2O6GE 4X4TA 1ZRDA 4PHDA 5DDMA 8ICNA 3CO7C 5CWRA 4CICA 5LGTA 5J2EA 5HRLA 1QQIA 4HLYA 5D49A 2QVOA 1SFEA 2YSRA 1XDUA 5E1ZB 1ZHFA 4BNCA 4CO8A 2IP2A 5EOZA 2ZH9A 2KRFA 1O3QA 4X4VA 3IRQA 4LGWA 7ICGA 2DFIA 4RGRA 1XMKA 5J2GA 5HHHA 2ZH6A 3FM3A 1W7PD 4QZCA 2KIFA 4IQVA 2Y75A 2ZH8A 3OVAA 4BQAA 4I2DA 5FB2A 3L7WA 4ZZDA 2KIMA 1BPEA 3AJMA 2L54A 3R4KA 2GXGA 4DO9A 1REPC 1Z6TA 4KLEA 4KT5C 3JSOA 3WE2A 3V7SA 3Q9VA 1FC3A 4HZFA 3M9AA 1TQMA 3ULQB 5J8CA 4YIIA 2KJBA 3P9KA 3GZ5A 1I27A 2QM3A 1O3UA 4R63A 4HV6A 1IN6A 1OYYA 4WF2A 3TULA 2DPUA 2QQBA 1HQCA 2OZUA 7ICKA 3PNCA 3IKVA 2L02A 3H3AA 1RNLA 4M9XA 4RB3C 4AIHA 4EJTA 4AT9B 2K27A 8ICKA 3GW2A 4O6JA 4ENKA 2FQ3A 4I2IA 2HOEA 4ESFA 2PJPA 1WWXA 2MH2A 4NXZA 3EYIA 7ICVA 1SFXA 4DQ2A 3ISPA 4LB5A 2ZH5A 2BPFA 2FBKA 5BS6A 4M04A 1YQAA 5ED4A 1K40A 3I58A 4RQ5A 3DPLC 3PQKA 4EGZA 3J7AO 4RWOA 1ZQPA 4N0BA 4F5QA 1OYIA 4XLNF 4PGXA 4EM2A 1KEJA 2V1XA 5HRDA 4A0XA 4QZIA 3LFKA 1IXSB 4GGGA 4PHEA 4CHUA 2NRAC 4Q4ZF 2LF7A 3O2PE 3P9IA 5DUIA 1MJAA 2DRBA 4X4SA 1WWPA 1V4RA 5J29A 3F8MA 1XGMA 2Y48A 2Z99A 4XRHA 3C18A 9ICXA 1FBUA 3GEZA 2EFPA 4K4GA 1FY7A 2CW0F 4LT6A 2RVCA 1ZLKA 3GLXA 3HSEA 2PG4A 3FMSA 3CUQC 4UXNA 2BE3A 4EV0A 3VB2A 4L0ZB 3DKWA 3RJGA 5HDKA 3K1PA 3JPPA 3H39A 3FM5A 5ICEA 4M9NA 1LQ1A 3TDUC 8ICGA 4KUMA 3RJEA 5CVIA 1PX5A 3C5GA 1G3TA 3DEUA 4AT8A 1HSJA 2LKPA 4FHPA 2QZ8A 2CSOA 5LHHA 3HTUA 4EJOA 1H9GA 4G6DA 4YD2A 4M9HA 1ONVA 3SZPA 4RWNA 1K04A 4DOBA 3ZN1A 2QWWA 9ICMA 5F1RA 4YMMA 2K4JA 4M47A 4IRIA 2VBYA 4FHTA 2NS0A 5JVTA 3KZYA 2E1CA 1G3WA 1XDSA 2G9WA 4BH9A 3RPUA 3WTUC 5AIPA 2PEXA 8ICVA 3ZMSA 3M7GA 2PN6A 4YN4A 5L3FA 2W25A 1B4AA 4OMYA 4YMOA 3B0YA 1XSVA 3L9DA 5E20A 4AT7A 4MF8A 5HRKA 3SHFA 4UV8A 1FX7A 1A04A 1VTNC 1USTA 3GFMA 4PGQA 1FP1D 1SMTA 3IL2A 2W84A 1T0FA 3OOPA 1ZQAA 3I54A 4BHPA 4EP7A 9ICHA 3Q9SA 3PFIA 4HDUA 4ENMA 2JTVA 4TUPA 3TGNA 3B0XA 2ZFWA 3U2RA 3QRFF 2O1PA 2EA4A 3BPXA 2DK8A 3RJHA 4WWCA 4KLOA 4GXOA 4KIFA 2JRTA 4PH5A 2HFHA 3LQRA 7ICTA 5J2IA 3ZMVA 2ETHA 4UD5A 3SXYA 1JMSA 4UB3A 3I64A 1J75A 5D6FA 9ICPA 2QENA 1ZQMA 1IF1A 5D4SA 4XLPF 2FBHA 4S3NA 3K0LA 3RKWA 2P5VA 5LRRA 3HOTA 1IXCA 3HWTA 3K1NA 2HQRA 4XBFA 1J7KA 2HS5A 4AWXB 5EEGA 4A5NA 3ECOA 9ICCA 4O5KA 1IN7A 4QZGA 4LFUA 3WTVC 5F28E 2IA2A 3I53A 5TRDA 5L3DA 3HJ4A 2QQ9A 2RKHA 5ILVA 5DB9A 3BDDA 2ELHA 4GXKA 3WODF 1KTMA 1TQPA 4X5VA 4AIJA 1UB9A 1I1SA 1E17A 1MIYA 3UXPA 3IRRA 9ICVA 2V79A 1MIVA 4RQ6A 4S04A 5HREA 4OMZA 1V4AA 4P9UA 2IRFG 1FBSA 4I2CA 1USSA 1K6OA 2OAZA 4I2FA 1LVAA 3KP6A 3HHGA 5J2DA 4XSXF 4B09A 1F9NA 1BPZA 4WC6A 2M5WA 5D4BA 1DPUA 4MFFA 2BCVA 3RKYA 3I59A 2GA1A 5DV5A 4X4NA 2QLZA 4KDPA 4BHBA 3C2LA 2XVCA 1TTYA 5JFRA 5TJJA 4UAZA 2WV0A 1ZQGA 1LJ9A 1WOLA 3CDHA 1FLIA 1R1TA 3RTRA 1TW3A 1ZQUA 2H6BA 4NKTA 3F8NA 5BOXA 3DFGA 2FXAA 1BPXA 3QU6A 5J0PA 4PZJA 1P4AA 3KZZA 5IIIA 1GVJA 3E6MA 1J2XA 2KKOA 3WU1B 2DR9A 5EEHA 3NEUA 2EA2A 2XUBA 3BP8A 2O5AA 2JZYA 1MGTA 1P6RA 4RB2C 4M9JA 4CYDA 3F6OA 4A12A 3MBYA 2PMUA 3FMQA 4HW0A 1L0OC 1TLHB 2IVMA 4QZ8A 3WTTC 2LSOA 3ABTA 3GF2A 2I9GA 5KVRA 1R89A 2Z9OA 3OGUA 3E5QA 3M8FA 3V8LA 3JAMZ 3JW4A 3EYYA 2ID1A 2HEOA 3UPSA 1R36A 3ROUA 1MIWA 2DQRA 1D5VA 1IUYA 5HLHA 1U5TA 3H92A 4MNUA 1Z91A 1B1BA 1ZGJA 8ICTA 1U6GA
chains in the Genus database with same CATH superfamily
1C03A 4MTEA 2P61A 3JSEO 4GCVA 1KQ9A 3JRAA 3T0YA 4ZZLA 5D5VB 3PNYA 3K10A 4NC3A 3S15J 2F6CA 9ICSA 2HOAA 3LFUA 4IJAA 5CVJA 3SXMA 2LBFA 1YJGA 1G3YA 1MNDA 3T5XA 4UB8C 3M15A 2DODA 1ZARA 9ICAA 2Q0OA 4G78A 4KLLA 2IT0A 3CESA 2KW3C 3KYLA 1OW8A 1GVDA 3BTCA 5FKOA 4A2UA 3MZHA 4YT4A 1UEVA 4WC4A 3EG9A 3K7DA 2EZIA 1NTCA 1ZQVA 1BC8C 4WBZA 3W2AA 3ITFA 5EGOB 4N7RA 2Q66A 1UHMA 2R7UA 2GXBA 1GXPA 3F46A 3FAJA 3I3LA 4KLSA 5ICCA 4G7OF 2RGVA 2XGEA 9ICIA 1KQ0A 1ZH5A 3PNTA 3G50A 3O6XA 1JXSA 3J81Z 2XLMA 3TW6A 2AWYA 3SFZA 3MKYB 4NBQA 1X1CA 2HMQA 4YL3A 2R7ZJ 4CSAA 1LKXA 2J9WA 1LIHA 1YZCA 4UB1A 1P7IA 4KISA 1JN3A 3BWGA 5J47A 2HKOA 5EEAA 5IT9K 2XL4A 4BHCA 4U5BE 1Y6DA 3E6DA 1NK2P 1BI2A 1N77A 4I2EA 2ZH4A 4PCQA 3SDBA 1BIBA 3E0JB 1H7IA 5HLTA 3GTMJ 2STTA 4EJVA 2STWA 2YLIA 3HHHA 5JI6A 3O8GA 1U8RA 9ICFA 1OR3A 2RREA 2RD9A 3G1MA 1XCVA 2W85A 5GTHC 1K61A 1QVXA 3DPUA 3W6KB 1YYJA 1FA0A 4BE1A 4HF1A 4AT8B 4A3DJ 1ZQZA 1YO5C 1FBQA 3KYCB 3RPQA 4BBSJ 4WC1A 1DQUA 3SZTA 1RKEB 3L1PA 3S1QJ 3FKJA 4M9SA 5J8FA 2PX3A 3NVOA 4J19A 4HSTA 1RR8C 1ZLJA 1LS4A 2YPRA 4H0EA 2R5ZB 4JEBA 3ZMZA 1HBXG 4F4BA 3E3VA 4NKUA 5D5WB 1X58A 2DDAA 3EDPA 3J80K 2A05A 4KBLA 3QP5A 5CVVA 2NUTA 1Z23A 3Q3SA 4MTDA 4BJ1A 4FWVA 5D91A 2GAUA 1LEAA 4CJOA 2PBEA 3ABUA 2KRHA 3ZMTA 3L1MA 3HG9A 3MQ0A 3TP0A 4J01A 2XLHA 3M8EA 3DPTA 1T95A 2EK5A 2VH3A 4U5DE 2A3SA 4Z9JA 3JRFA 5J0TA 2LYCA 2LD5A 4X4OA 2JA7J 1AKHB 1UAAA 4UAWA 1A6QA 3TJ5A 1DGWY 1SD5A 5L3EA 4OIOF 3HRTA 2NPUA 2HYGD 4L0YB 2JX0A 1ZQXA 5J2AA 2J5PA 5DYMA 2E7WA 1U0JA 3CF2A 1BW5A 4X4QA 2B63J 4KLDA 1HE9A 4A4AA 4IB4A 3Q7LA 2VQCA 5DBBA 3MEXA 2HDCA 4M6XA 4X6AJ 1ZN2A 2KNHA 2LP4A 5D92A 4M74A 5H20A 4KLHA 5EG0A 5L0JA 1RZ4A 3QW1A 4M3FA 5JVEA 4F92B 3KYIA 4ZLDA 4RB0A 2P7VB 1XS9A 1W5SA 2RQQA 4P9FA 1T33A 4LLGF 3TOBA 4CXFA 3OUYA 1T6UA 2R7XA 4CJGA 4E8FA 1JQRA 4JTAB 1LDKB 3ISCA 1GQAA 4DYQA 2J45A 4XTKA 4MHGA 5J4VA 1K05A 3RQIA 4R32A 3HNJA 4Z6CA 3LSMA 2XLEA 1GHCA 5F5HA 3DD7A 5FCLA 8ICUA 4A3IJ 4LZGA 3JRMO 5KYXA 3C8GB 3B6AA 2YUSA 5E3CA 2HKXA 2EFNA 1IDZA 3JSZA 3BZ6A 5JHUA 4E7JA 3GM2A 2UZKA 4KT6A 1MKMA 2V26A 5JSLA 2ID3A 1Y4CA 2BW3B 2OEXA 5J0UA 2J0WA 4O68A 3UQ0A 1I3QJ 2KJCA 4MFAA 4IVNA 3WU0A 3O55A 5L0FA 1R8CA 1MZBA 3OYNA 1DOWA 4TURA 4K97A 4PJNA 2GOMA 3CQZA 1I6HJ 2XLOA 5EHHA 2HPMA 5CJ9A 3ZQHA 3EPZA 4DGWB 4YFNF 1T2KA 2BV6A 4GYTA 3U9MA 4XA5A 4NB5A 4I01A 3JRTA 9ICBA 3L00A 5F08A 3W2WA 4A3MJ 2R05A 2FNPA 1JUSA 2JPCA 1VJ7A 2BVMA 2WY7Q 2QKMB 3KLOA 3K9TA 1A7VA 5GAHJ 3RF3A 2L9VA 3RJPA 4ZYHA 2P5KA 4NCQA 4HBLA 2ZJRF 3RI4A 2KL4A 3LQQA 4GQHA 5F2VO 4LD5A 8ICXA 5IP6A 3K6BA 3PQJA 2VIXA 3OS0A 3RIPA 1Z7UA 4PJMA 1LB2A 3ASNH 3ZQLA 1BA5A 1WN0A 1IDYA 1QGPA 3FXQA 4F3QA 1UELB 3KIOA 4DYRA 2RQPA 1FTZA 1GS9A 3S28A 3EF2A 3C1DA 3H37A 7ICEA 2I10A 4X1EA 3RSNA 2F4IA 2LC2A 4IQJA 1ORJA 4FT8A 4RQ8A 2EV5A 3KFWX 5L3CA 1AUEA 3TO9A 1KDHA 2ESNA 1J8YF 4I6ZA 1OCOH 3HOYJ 3VWBA 3DAFA 3EH2A 1MMAA 3NWSA 1DDNA 5DVWA 3F6VA 1P4XA 4OAFA 3E9VA 4IEJA 4A6EA 1ON1A 1V5GA 4IPAA 3FXUA 4PJ0C 4BPMA 5C4XJ 4HX8A 4C7OA 2CRGA 2XAJA 4JX4A 1D3YA 4I29A 9ICOA 3GX4X 7ICHA 7ICQA 2R0QC 1YFHA 2VPLA 1LUJB 3NQOA 2LFDA 1E86A 3KEQA 4DVYP 3TFSA 3I4PA 3LLIA 8ICSA 5DDGA 3CCVI 3HOZJ 4K1OA 1KNYA 1BR1A 1FR0A 4MF2A 1SMYF 2VXDA 5KAFC 5D62A 3W6JB 3GFIA 1G4WR 3OIOA 3IQ6A 4CDVA 5A2QZ 3AQMA 4Q47A 7ICFA 3T1BA 3WFPA 2JUGA 1QPIA 2LY9A 4PGGA 2CDQA 2OG2A 2CQQA 2OC6A 3R6SA 1L3LA 1J59A 3SQNA 3HM5A 4LLCA 3E5UA 4YMNA 2CNWD 4B3AA 1VQKI 1KU3A 1TNTA 4B3XA 1WHUA 4A6DA 2E71A 1OCCH 4EM0B 1MBEA 4QWQA 1ZQRA 1BN5A 3PSFA 1XSXA 3TMOA 4A69C 1YX3A 5LGNA 3RH5A 3J06A 1NK3P 5FJ8J 4MQVA 3NYLA 1ZQKA 3AG3C 4I28A 2DLLA 4MEYF 3AU2A 1BIAA 3H65A 4NM1A 3LESA 4IGGA 5L3GA 4V2FA 4J00A 3K4JA 2LQGA 1SZIA 4ZC3A 4UBCA 2ZHBA 4YCXA 4KJZA 2DA5A 1KU7A 2C6YA 3ZWIA 3G71I 2XLVA 4BL0B 2QGUA 5ICFA 1CGPA 2OBPA 4MTFA 2XAGA 5TZVA 2O8KA 5DBCA 4I2HA 3TQNA 1VQ5I 4JYKA 1Q0GA 4JVSA 3I59B 3OYAA 3ZVRA 1G8XA 1PP7U 3U0CA 1OQCA 3ELKA 1XSNA 3G3ZA 2MFZA 1WRJA 1WJFA 3OR2C 1OXKA 3ABKC 4M6YA 3MFNA 1MMDA 2R92J 2PFDA 3QVYA 1XSPA 2VPRA 1ODDA 3A01A 3HPGA 1OCZH 4PSWA 3EGDB 1QHGA 2DTZA 3IWFA 1YLFA 2CFOA 1XMXA 2WTEA 3KLNA 4GEHA 4JKVA 5B1AC 4AM3A 3S9OA 1RUNA 4LEYA 3DE8A 2DR5A 2VJIA 1R4NB 1WGWA 2YRFA 3PO3J 4N6HA 2BBJA 4R64A 1FT9A 2W24A 2NVQJ 1G4DA 4HFFB 3MKLA 3DXJF 3KMIA 3PMLA 2FAPB 2YL0A 4DBRA 1Z9CA 1MJBA 1HXDA 3HBLA 2WB1N 1TV9A 2DA7A 5KYWA 4M9ZA 2QBYB 3EUAA 2L4MA 2K40A 3U1DA 1S8NA 2XKOA 2OA4A 3AG2C 2X0LA 1KONA 3Q7GA 2UXXA 1IN4A 1LFBA 1AWCA 2PJRA 2PFOA 2XPUA 3V42A 2R3SA 4U0VA 1YG2A 2OEVA 3QOEA 1ORSC 3JRCA 4FH3A 2ISPA 1TWHA 4A3FJ 3FX3A 1HMOA 1W2WA 5GAEJ 2YVKA 2JVHA 3U8PA 2W1OA 2IGOA 2M9HA 3U21A 1R1UA 3DM9B 3TBIA 1G59A 2E36A 2VONA 4P4MA 4S0HB 5ILUA 4QTRA 4KC9A 1OCPA 3MDCA 1ZQBA 2Y9YA 2Y30A 3VYWA 4WXDA 2FF4A 3AL0B 4CCKA 4G0HA 3NWIA 2KZGA 1PDNC 1ZZPA 1PUFA 3N2ZB 1GPJA 2FD5A 3AG1H 2D2WA 5DM6F 4KA4A 3S0XA 3HTKC 2AU5A 2EIJH 1X4OA 1NG7A 4ATBB 1VI0A 3R0AA 4QI0A 3GXOA 1NLXA 4XN3A 2W9MA 3BPVA 3LSTA 4L9JA 3BJ6A 3Q0UA 1NO5A 2ZXJA 3BTJA 1W0TA 3JT1A 2Q3TA 2Z3YA 1WSUA 4UDVA 1ETOA 1V5EA 1EF4A 3ZQVA 2IW5A 4AVZA 3QYFA 2WY8Q 1JTXA 3I4MJ 4P4PA 2I5UA 5H6QA 2D1HA 4MS2A 3WE3A 2JSPA 2W4BA 2CQKA 3NMKA 3GZNB 2BXYA 2ZO4A 1QNTA 4FCYA 4I2OA 1NOMA 1I6XA 2CUJA 3H0DA 2XHKA 2YWAA 2BYVE 4O79A 2LBFB 5KYUB 3DCFA 1YW8A 2X6YA 1OW6A 1OMIA 1JE8A 4XQ7A 1HW5A 3PL8A 1CF7A 5HS7A 4F93B 4XICA 4LEWA 5DCMA 2M2EA 3PHF2 1Y0NA 4C3HJ 3MLGA 1ZU5A 4A3CJ 5CLSA 2UV1A 1BI1A 4HYEA 2XV4S 1BPYA 4ENJA 4RPZA 2HQAA 2FMPA 2C04A 1QU3A 3GVAA 4Z6EA 4R79A 3TQOA 4KLIA 2YU9J 2M64A 2KP6A 2Q4FA 3JPNA 1MMNA 2K86A 3O8HA 1R8AA 2VXZA 3FXLA 1CGOA 1Y1WJ 3HX0A 4KIBA 1HKTA 1Z63A 2J0XA 4MTGA 1XC5A 3H38A 1BC7C 3Q0VA 3NMJA 3JCFA 5J2KA 1D5YA 3IHUA 3PSIA 4HE8D 3RH3A 1W7PA 8ICAA 1GDTA 2J7PD 1ZR2A 3U5SA 4RWPA 2H09A 4IOAF 2YR2A 4ZYGA 3HSFA 2VKHA 5M3MJ 4G8XA 4G6QA 1M6TA 4CYCA 3RYPA 2WA0A 1RPLA 2B9SA 3ZGKA 2YKZA 5F1JA 4KNYA 4RAFA 3ASOC 2IA0A 4IQ4A 2GIVA 2JA2A 1NFNA 3D0SA 1DOVA 3TOAA 2Y3DA 2CQNA 2UXNA 3KP7A 5C4JJ 2L7AA 5AC4A 2P66A 2IS2A 1Y8RB 2VT2A 2W57A 3DKYA 3HC7A 1TNSA 4XKBA 2G62A 4BQNA 3DF8A 3GTLJ 4IJJA 3ZQFA 2E2JJ 2P0NA 2ZFUA 1NSGB 3H2UA 3ER9B 2LK2A 2DOAA 3US6A 4U5FE 1RMVA 2AQEA 2ID6A 4ZYAA 1MDMA 1JT0A 4IOCF 3R60A 1YRNA 4M0AA 1ZQDA 2CNWA 1GLNA 2QCOA 4M9LA 1W0UA 2NUTB 3A2KA 1D0YA 2XLDA 4F55A 2W7NA 2EIMC 2B4VA 1F1MA 2DOFA 3ZXSA 1F5TA 1ZQJA 3CUOA 4TUSA 3CAXA 4D4XA 3ZMUA 2L9RA 4LLNA 5B3QA 2DMTA 4E7ZA 3UQ2A 2HVRA 4FX0A 4RGUA 1MJ9A 2EIKC 3ECHA 1TC3C 3CCQI 2L6HA 4G6TB 1D0ZA 5J2HA 3UGPA 4KLTA 1DPRA 2LOOA 3WTSC 3GORA 3ISBA 2MH9A 1TQGA 9ICGA 9ICQA 3GFLA 1JKQC 1SD7A 3CCYA 2V1DA 1HDDC 1UZCA 2RV8A 4X4UA 4EUKB 4FHVA 1JHHA 5F6FA 3HKZA 3MKWB 2A1DD 1EH6A 4O6YA 3F47A 2W82A 2H1LA 1IRFA 5CA7A 3K7AJ 2V1UA 1SAUA 3K2ZA 4LB6B 4BJ5C 1OCTC 1FOKA 1MQVA 3JYYA 5EG0B 1J5YA 4AE4A 1WJCA 4P4OA 3CTAA 5F27A 3VDXA 3CO6C 1VLSA 4XQFA 2FRHA 1VQPI 2DO7A 1X1PA 2VL8A 4NLZA 2UUZA 3FDYA 3OUYB 1R4MB 8ICHA 4M3EA 3BR2A 4YFKF 3W8IA 2BL2A 1MBGA 4ZH4F 1ZQLA 4F52A 1Z3XA 4HG2A 5KK1A 1JMWA 2YL7A 1VK5A 1DGRM 3CCLI 4K4IA 4U88A 2D1VA 4EJUA 3ZRGA 4ANJA 4HDVA 2A07F 5A69A 4FAPB 3NKUA 5HHIA 5KYXB 1FSHA 1MSFC 2ZNYA 1FPQA 1BM9A 2EZKA 4ER9A 4DOCA 4HOBA 4M5DA 3S2DJ 3G4XA 3Q5FA 4E6KG 3E7LA 2EPNA 2DRAA 1ZRCA 1S29A 3HTSB 3N05A 2A5WA 3F8FA 3EETA 1AU7A 4C3EA 3DU6A 2BBYA 4BYYA 4A3JJ 1IN5A 5CI9A 2VBXA 1MQ2A 2RNJA 4PUSA 2E87A 1T0FC 3ZQIA 4C3DA 2ZHAA 2DCEA 2L5QA 4DJAA 3AGTA 1UHSA 2NVTJ 2R03A 5IILA 2XAQA 2IEKA 4ENNA 1FWZA 1WPKA 3G2BA 1Z5ZA 5FROA 5BPDA 2NUPA 4QI2A 3AQKA 4ZJZA 4X0RA 8ICQA 3ZOBA 4LG3A 5DD8A 4YJWA 1TWGA 4GFBA 4NXVA 4GYGA 5EYRA 4LG0A 3DJUB 1EI7A 3WFRE 2KRCA 2XSDC 1M57C 1T9KA 2HOSA 3KE2A 1C0WA 3C62A 3OWGA 4NLKA 3RYRA 4DJ9A 4F5OA 3VSLA 3LAJA 1PUEE 5LBQA 1A6IA 1WJDA 4I0AA 5KAIC 1K78A 1TFKB 3JPTA 1R1VA 8ICBA 4WX9A 2OCCH 2OQGA 1BBHA 2YU3A 3MCRA 5J0XA 3HGGA 3B71A 3FKIJ 3LSIA 2HJMA 1O3RA 1Z3YA 4EEFG 5DB8A 2ICWG 1SVOA 2EH3A 5BNGA 1LVKA 4BUPA 2L6GA 3EZIA 4M2YA 2XXAA 3L2UA 1JKRC 1SYQA 2LF8A 2DJIA 3K1MA 4ZDPA 3KP3A 4PGYA 1STZA 3IH4A 1OR7A 4XIDA 4BXFA 2UWMA 1IXRC 1VQNI 3HKZN 2RN7A 3MZ8A 4UVAA 4Q48A 2K3FA 2XGDA 1ZR4A 4BEMJ 2ZKZA 4RS8A 1ZU4A 3F3XA 2J9BA 5B3IA 4E7HA 2MLGA 3W3CA 4LDQA 2BEOA 1I4ZA 1DP7P 2BBHA 4YRVA 1ZQCA 3A0BC 1SD4A 1ZG5A 5F0CA 4EVIA 1A36A 4U0YA 1Y0UA 4JC7A 2HU9A 3MWMA 2X9DA 3CCSI 1XZPA 2B0JA 1C17M 2IHOA 1JHFA 4KMFA 3CLQA 1ITYA 2TMVP 1U9OA 3JPOA 3DU5A 5CJ7A 3ABMC 4IWBA 2IGMA 2LREA 2MC3A 2XL8A 2MABA 1UMQA 1A7EA 8ICCA 2BZTA 5DQTA 2PFBA 3ECSA 4F5RA 3U8VA 3CZ6A 2OZ6A 3KX2A 1WH5A 4BKXA 2L2OA 5FKLA 5F0HA 1HKSA 4UVBA 1OXBA 5TGTA 6PAXA 2R4GA 3PIOF 2DYRC 3H2VA 4OAZA 1KYWA 1U8BA 1FFTC 4L5IA 4PGHA 2J7PA 5B3SC 3KYDB 5A6JA 2K7LA 4MQ9F 2HQNA 2G3KA 4CS9C 4AT9A 3OV8A 2BVLA 5J2EA 2V6CA 2XS8A 2XIGA 3M4BA 9ICJA 1YW9A 2Q8KA 5TJ5E 1D1CA 3KEOA 2XAHA 4ABZA 1LFUP 2VODA 3I4UA 1RETA 2FSWA 5DQZA 4IRGA 2A6HF 1RUOA 1UG0A 2HR3A 3FXJA 4KN4X 1V55C 3P7NA 3FIWA 2XASA 3K70D 4BAYA 3K66A 4RPXA 1KYZA 3NRHA 3WG9A 4XQ8A 2GQQA 1RXQA 1JGGA 5EDNA 4A5MA 5IOYA 1I4YA 1ZK8A 2LP0A 3L2CA 4BXXJ 4I2BA 4F5PA 4IZZA 3SEOA 4RQ4A 1SEUA 3JTGA 3HJ1A 4E7XA 7ICJA 2HSQA 2F5FA 3KYJA 3POVA 2QYOA 2D45A 5LRSA 3IEEA 4QZFA 4O5CA 4TV7A 2DGJA 3F0CA 3OYCA 2IPQX 3H5RA 3U2MA 1BZ4A 1RZTA 3RKXA 3IH3A 2YZSA 3IV5A 4YG2F 2XAFA 2M8EA 2F4OB 1M1EB 4KLUA 2ZXWC 3WHCA 2EZHA 5KNLA 5FRNA 2R7TA 1BR4A 3RH6A 2RDPA 2ZBKA 5E79C 2ZH1A 2DR8A 1BDJB 1TW2A 4WCGA 4NDLA 4RMNA 1B9NA 1SAXA 1ZRFA 3NYBA 1GUUA 1MNMC 3OYBA 1IRZA 5LGUA 3GFJA 5K1YA 1X3UA 4O69A 1JTYA 5KYWB 4FO6A 1ZQEA 1W5TA 2PBIA 1IGNA 3JTLO 4ULVA 2KZVA 2XF7A 4HPQA 2W4MA 4MVMA 4YEJA 3ZMDA 4CCLA 1VMAA 4E0HA 1OQYA 4LMYA 4MIMA 2PJRB 2GWRA 1J9IA 2IXNA 1R8BA 4NXXA 5IIOA 4Y3OA 2M2TA 1HSTA 3CDIA 3SXZA 3LWFA 3BLYA 4N9HA 2L6FA 5BQHA 4ONSA 5BOMA 2V7FA 3S1RJ 2QEXI 2OV7A 5FO5A 3BEHA 1RC9A 4Y17A 3GUDA 5T3WA 3BY6A 3LUTB 3FAPB 4XR6A 1XWJA 3JPQA 2CO5A 1QZYA 2PMZA 2YHSA 2K9NA 3S1NJ 2IS4A 2L7MP 2A0UA 2DK5A 4LK1F 3QYEA 3FHDA 2CFXA 2XPVA 3G1LA 1BBYA 3B6CA 4UD4A 1TWAJ 2FUG2 2QA4I 1Z7LA 4UVCA 4A3BJ 1I5NA 4QZ9A 4X0AA 1VQ7I 3SP1A 4IQUA 2IBFA 3NARA 4OD5A 1ETQA 1UEUA 2BPCA 3TO7A 1VQMI 2PFQA 3V5XA 5IYCJ 2X51A 3LA3A 1JGSA 4LLLA 2ZPAA 4UB4A 2IHMA 3S17J 3GEIA 3AL0C 1SANA 3FXMA 4Y13A 2KIQA 1GM5A 1D0XA 4OIPF 1FNNA 3H9JA 2JSCA 5GPCA 4M72A 5FLXK 4CCMA 5COMA 1KQ8A 4QZHA 1O7FA 1LDJA 2BPGA 1S5LC 2LNBA 4LEZA 3FF5A 3SZGA 4L9VA 3S14J 2IUBA 1FOWA 5DB9A 3V7CA 3LOCA 1TFWA 1I1GA 1U9NA 3A4CA 4FISA 4RDAA 1WKMA 3DBHB 1UHWA 1U5TC 4HLXA 2ZJQF 2J9UA 1FYLA 4K9BA 3MFKA 3F9KA 1HC8A 3GWLA 4WC5A 2NVXJ 2HV6A 2ZXRA 3MAJA 1BI0A 5D5XB 2ESHA 3LAPA 2Y69H 1XN7A 4NQWA 2H1KA 4PJLA 5HDGA 4ULWA 3GEHA 5CR0A 3W4YA 1ZQWA 4WC2A 1QQ3A 5E33A 5GP9A 4KLGA 3DMDA 5LD2C 2QUFA 2H8WA 4UNOA 2YS9A 4WK8F 3F8BA 1P9QC 4C9YA 3X2QC 3PJRA 2QSGX 1TWFJ 2E7XA 3COAC 3JRBA 2BY0A 1B8IB 4UHTA 3NMIA 4AK9A 3WTZA 2NVYJ 2Y3HA 1VNDA 5DECA 2F5CA 2L01A 4P5OA 4PDKA 1IC8A 1W7PB 1XGSA 2MC4A 2IJLA 2YX4A 3S2WA 4RBNA 2VCBA 4QPOA 2WZFA 1ZQNA 5J6XA 1F36A 3RZOJ 3K33A 1Y8QB 4BJ6A 2RFFA 3OYMA 1YARO 1RKCA 1TWCA 4XMYA 2XL6A 1YLQA 3JRGA 4CYCB 5BUOA 4C3BA 4CSAC 5D4RA 3SNHA 4PPXA 1QSPA 1T56A 2M45A 2H8RA 5IYDJ 1R49A 2I15A 1MBKA 3C2HA 3BQYA 4JWNA 2VLAA 4O9MA 2LIGA 4I98B 4NQFA 4P9TA 4CDYA 3HUGA 4XRFA 5FD6A 3V8KA 1F4KA 2P5LC 3V7LA 2K5CA 5GAGJ 5J0WA 5DS6A 3NKDA 3OWTA 5ERIA 3PDMP 5DKWA 2L4AA 3X1OA 5HC9A 4AT7B 2HNHA 4EQQA 2CYYA 3BRJA 2LTPA 2GXAA 2LFFA 2PLYA 5J0OA 1V3FA 2O8XA 1MDMB 1YDIA 3ER8C 3HYIA 2M3AA 2NVUB 3T6BA 4RPYA 4G12A 1ZHYA 4I7HA 1YTYA 5CHEA 2CQ7A 3HJCA 3VM6A 4ON0A 3FDQA 1QBJA 4FHXA 2BOLA 5K7FA 5J0SA 4UUVA 3O39A 5J1UA 1XG1A 1OCRH 1ZG1A 1H8AC 2ISZA 1PD1A 3LAYA 1P92A 4Q5SF 4EATA 2HXIA 4A0ZA 1K79A 5KYNA 2QKLB 1QRYA 3DTIA 5K5OA 1Z7Qc 7ICUA 4P1WA 4EMSA 5J40A 2L9JA 3WGHA 2P1AA 1VB5A 1OPCA 1ZAOA 3E5XA 5DD4A 4RBOA 4XQ1A 2VJJA 3DTEA 2QE9A 3H3UA 4QZAA 3MGIA 1S7AA 3CMAI 5K5QA 3CCMI 2HN1A 5J0RA 5K7ZA 1A7DA 3F23A 5D8LB 5CFTA 4LEVA 3OV7A 1FZPB 1UG2A 4KIGA 4I3MA 3HOXJ 4PHAA 5HRIA 4DVZA 5A2QK 3SDGA 4M71A 3VOEA 2P6SA 4AE4B 3L2WA 1A41A 3VF0A 2L0KA 3V72A 3OS2A 2P7CB 5HLGA 4MKPA 2L7ZA 2ZC2A 3F8CA 5HRFA 4UUSA 4K4HA 1IW7F 2X6OA 1K4SA 4A93J 1BPBA 4B43A 5F64A 2ASRA 2TRTA 3MVPA 2M30A 3BJOA 1E0EA 1EV7A 2KK1A 3FK7A 3J80Z 4IHYA 9ICXA 4I99C 1W36C 1VQ8I 4NLNA 3N24A 2FU4A 2KDZA 2DPDA 2DYSC 3CD6I 3CEXA 4K4GA 9ICEA 2ME6A 2Y2ZA 2BY2A 2M8GX 2ME0A 2XAUA 1IAWA 1OU5A 4RQ2A 2LK4A 1YOVB 5D61A 1Z67A 2V1NA 5FRMA 4LACB 2E2IJ 4FH5A 4DNCA 4JCHA 5D6EA 2MW8A 1YIJI 4AX2A 4XSZF 1W5CC 4L18B 3AG4C 2B51A 4HX0A 2IA1A 2B7EA 3QQAA 4OAYA 5GPAA 4JQFA 3TP3A 3JRIA 4XM3A 3NWTA 2XSEA 1ETVA 1CPRA 1A31A 1RR7A 2KFDA 4UY8I 1V74B 2YLGA 3BR3A 3IP4B 2DXIA 1PV3A 1S05A 3OYGA 4EBBA 2NRKA 1ZQOA 4IQWA 9ICWA 4IKFA 4CS7A 4FHYA 2XC7A 4WCWA 1YVIA 3AQCA 2H27A 3MKZA 1LE8A 2NUPB 4RD9A 3TDZC 1PJRA 4EGYA 4HV5A 2CW8A 2OQRA 4JK1X 4HQEA 1YA9A 8ICJA 4JE9A 1ZGAA 4K2EA 5L3BA 4IHTA 4KYWA 4LG0B 3JRDA 2CU7A 1H0MA 3BQZA 5FD5A 3WGGA 4ZYEA 5E18F 3CJTB 3LA7A 2FJ1A 1HKQA 2O3FA 1SFOJ 3WFOA 2WAQA 2WZGA 1K78B 2PMHA 5IINA 4DZJA 3TW7A 2VE9A 2VBWA 2IXPA 3ZP5A 2K9MA 2DR7A 4FX4A 2DA2A 2HVSA 2DW4A 4JEAA 3GTGJ 3IWZA 3RKQA 2DMQA 4LIVA 1QPUA 2Z16A 2O0YA 4I1MA 1HW2A 2E35A 2OPTA 1T98A 2M7BA 5JRAA 1LNWA 2XXAB 3LSKA 3CMYA 3DQVC 3PM1A 1TVAA 2EINC 1SR2A 5ILSA 2JA6J 1NG1A 4O6MA 2EWRA 1S9HA 2EPOA 4WC0A 4A2NB 5CHGA 1EH7A 3RPUD 4ESJA 2GA0A 2OKUA 1VLTA 4BXUA 4E0IA 4UV9A 1BL0A 4IHVA 3GYHX 3REOA 3I5UA 4S05A 3LSPA 2KSFA 2IGNA 4K8VA 1E2XA 3RIRA 1ZKGA 4HNVA 4B6IA 5HDNA 1M2VA 4J7YA 2DT7B 3WG7C 3WHNA 4AD9A 5IY5H 3K2AA 3WGIA 4E7KA 2JA8J 1IZMA 3RJJA 1EH8A 1TQIA 4KFCA 2PFNA 1IN8A 3A11A 2E1MC 3QODA 1JKOC 1PP8F 2LD6A 2Q9CA 3HNKA 1B72B 1YYVA 3RCOA 4U9EA 4AU7A 3S93A 3PFYA 1LPEA 4RQ7A 5GTIC 1BJAA 1OYWA 2F5VA 2OD5A 1HCRA 4JURI 1JUMA 4UAYA 2F48A 1RCPA 5J0QA 3I9V2 4P55A 5EK0A 2M2WA 4I02A 4YT2A 4XOTA 3LK9A 5B5EC 4HEA2 1G4US 2IAIA 2XKPA 2ZXIA 1U78A 2LLKA 3GWNA 1SFUA 2CG4A 1Z77A 3L8JA 2E1NA 2GA9D 3UPQA 4KN7X 3LA2A 3KETA 1F5AA 1XSLA 3ZC4A 4XLHA 1QVUA 5K7HA 3CCJI 2OU6A 3OL4A 5BPIA 1IRGA 3C8GD 1OISA 3JSPA 2XSJC 3FXRA 4JCZA 3U1KA 2CW7A 1KGSA 1S3JA 2B56A 2ZH3A 1VTMP 1HMDA 3ZN0A 3H9QA 2UUHA 1NZEA 1Q79A 3RDIA 2VB6A 2ZH2A 2DBBA 8ICRA 2ADUA 4PHPA 3EUHA 1LFPA 2IXSA 1ZJMA 3CUQA 4L6RA 4NC8A 1ZQSA 2NYXA 1ZQHA 4G7HF 4BY7J 256BA 2VC1A 3FHZA 2NXNB 4J32B 1SVLA 1SD6A 5B1BH 4JTCB 1JPJA 5J2JA 3CJRB 4QLCU 5D5UB 3G73A 5CVRA 4ZDLA 2Z5UA 2Z1DA 4LJZF 2R5YA 4IG8A 7ICPA 5CI8A 3BOQA 3OMYA 1K7AA 3GTQJ 3I0TA 3JTHA 3NG1A 3V7RA 2RAEA 2CUZA 5L0CA 2HFIA 2PNOA 2BY1A 5E3OA 1NHAA 4ZTJA 5A6BD 4X4RA 1XGNA 2WWYA 3ATPA 2V3CC 4GXJA 1LE2A 4XONA 2FOKA 5M3FJ 2JD3A 1LM3B 2ZXOA 1JAJA 4MVOA 4YK5A 1X1AA 2A61A 3AQNA 1B6AA 5IIKA 2F5DA 3ABLH 1YYXA 5HRHA 3QPLA 3BR1A 1XGOA 4CS8A 4XPYA 3TJ6A 3A0HC 2HJ3A 3R61A 2MD5A 3S1MJ 2IM8A 2BCUA 1MH3A 4M3BA 5F04A 4BE0A 4HAMA 4W1UA 2JPUA 2EV0A 2V9KA 1NU7D 4U0WA 4PACA 1Q1HA 1U5TB 3ZQQA 1V54H 2FMLA 3FHNA 4XL9A 4HNTA 4HQMA 4QZBA 2DTRA 1XTAA 4KICA 3TFRA 2Y0SA 2EJRA 2R02A 3KP4A 5J4YA 4ESBA 3S3OA 2ZXPA 3ESWB 2EWNA 2IBDA 4FE7A 1JJ8C 3ZSUA 9ICTA 1LE8B 3JPRA 1WOTA 1ZQYA 1OLTA 4ZYDA 4X0GA 1ULYA 2OCEA 3I4NJ 7ICRA 2CCYA 2QLAA 4RQ1A 4MVZA 3CQZJ 4HF0A 8ICIA 1MBHA 3QMKA 4RQ3A 3N97A 3H0GJ 4QPQA 2ECBA 4I09A 2WVOA 1D1BA 3EUHC 4IF4A 2MA3A 4NHJA 2DAOA 3KH2A 5D8KB 4DOZA 4XLFA 2KIUA 4MFDA 4B44A 1B59A 2EB7A 1ZQFA 2XPWA 3G4ZA 2PI0A 4XKVA 3EG9B 2CMPA 3TK0A 3CCUI 3HIFA 4XEVA 4U7BA 2EPLX 1FIAA 4F5NA 2DMUA 2G7HA 3GLLA 1WCMJ 4CUGA 3HOSA 4I2JA 2RNGA 4B8XA 1F1ZA 4UUTA 4H54A 4Z9HA 2ZCWA 2FMQA 4LOCA 4DW6A 4RT2A 9ICKA 2ZD9A 3T8RA 5HS9A 2GA2A 3L9FA 4OIQF 3OA1A 2X4HA 4Z6DA 3M1CA 1O57A 1R00A 2FE3A 3K4MA 1MMGA 4G7ZF 1DUXC 5BOLA 4IHXA 5HSWA 1ETWA 9ICLA 1AEPA 3H36A 2EILH 3M07A 2Q00A 2RC4A 3EFOA 3EH1A 2ZMEA 2R7DA 2G3VA 3EQLF 4BU2A 1Q78A 2DA3A 1I3AA 1RKEA 2FBIA 2GBYA 5FKNA 1MMSA 4HF2A 3EPVA 1DU0A 1U2WA 2J8WA 1NH3A 2QQ8A 2IXOA 1H88C 1CQTA 2R5ZA 1J09A 3IC7A 1D8JA 3J7AY 4CIPA 2K3PA 3JZ0A 2DFFA 2EZLA 3OVBA 3S8PA 4EBJA 4FHWA 2VC0A 8ICFA 4M6VA 1BPDA 2LSEA 3RW0A 2HZDA 4C30A 2BCSA 1KU2A 1KU9A 2ISYA 2R7OA 3B73A 2Z33A 2Q1ZB 3ZPLA 3K4LA 4A3GJ 1K6YA 4NQWB 3UKGA 5E1WA 2Y39A 2BGCA 2WC2A 4XOPA 4LDRA 3CP2A 1ZJNA 1XD7A 3KP2A 3PMRA 1UFMA 2LMDA 1ERDA 4HX4A 5ICGA 1KA8A 5DTDA 1UG7A 3VODA 1RI7A 3P5JA 3G6EI 2HQ5A 4MGRA 3K1IA 3L2RA 2WB7A 2Y0SN 3Q6MA 4XKWA 4I2GA 4D5FA 4Z6FA 2E19A 3V5YA 4XLAA 4Y15A 3GZ6A 4M73A 1QZZA 2BCQA 2EQRA 2O5RA 2Y3GA 2O7OA 4II3A 2XROA 5FKMA 3UXOA 1YITI 1HDPA 3CJNA 2AS5F 2VANA 2X48A 4RAZA 1RJ9A 4NY8A 1T6IA 4WC3A 4KITB 2DU9A 3DTKA 4Z2YA 5AIQA 1RIOH 5FFZA 2P7VA 4CCNA 3WTXC 3G4SI 3CF5F 1YE9A 4RT3A 1P2FA 2A68F 4HA8A 1JOGA 3GODA 8ICEA 2GWSA 3ZQCA 1ETKA 1BR2A 2VKDA 2ZNZA 4DBQA 3HUGB 4LK0F 3CC7I 4IQTA 4N4WA 3OOUA 1WJ5A 1W4MA 1U89A 4CIHA 1WZ2A 3ASNC 2P81A 4YD1A 3DE9A 3QP6A 1UFBA 4MVUA 3K69A 4GXIA 1K4TA 5DBAA 5KYYA 1Z21A 1YHQI 1BOBA 3C8GA 3GO5A 2JJ7A 2B0LA 3OVSA 2VT3A 3I71A 1ZHZA 3LSGA 1Y39A 3NRVA 1ON2A 1OCOC 2BW3A 3QPHA 3C63A 2K4BA 2PQ8A 2QNLA 2K02A 4LZDA 2GDCA 3UNGC 4BGDA 2NOJB 5J1YA 2ZB9A 2VOPA 1X19A 3U3FA 3I5PA 8ICWA 3VYTB 1E83A 2D5RB 2H7VC 4EM1A 3AOUA 5JS5A 3RJIA 4BJTA 3HRUA 2M2UA 2OOCA 1WASA 2R7FA 4JW1A 3BG9A 1G2HA 2VJ4A 3CCRI 1IUFA 2MYSA 3OYFA 2YX7A 4RA2A 2XM0A 3TKYA 2MLKA 3IAM2 4YIFA 5JR3A 5E3MA 4YFXF 2LKSA 2EFWA 3DI5A 1HUZA 4P96A 2A6TA 5DDYA 3W2VA 5K5RA 1IRXA 3E6CC 2W00A 8ICYA 1WI9A 5J2FA 2IXMA 3BROA 4A0YA 5A6BA 4BBRJ 3K75D 4IRHA 1TWAA 2M2VA 3JREA 1TWHJ 2FNAA 4BEHA 4JJGA 5H6RA 2P6TA 4WQLA 2HN2A 3TD7A 3O10A 1G3SA 2JMWA 4L9TA 4DRHB 4E80A 3ZQYA 1T6SA 3GCMA 3V5ZA 5LEKA 9ANTA 2KDOA 2EV6A 4D7NA 3ZTMA 2QF7A 3BG6A 4UUSB 1U0BB 5CFUA 2TDXA 1OCCC 4HFKB 4PSXA 4QDLA 3SFIA 4W8KA 2JRMA 3S2HJ 2H7BA 2HHPA 2BCRA 1W1WE 2KJGA 1ORYA 3D5LA 4AVPA 1P4WA 4MEXF 2M87A 3Q6NA 3HIYA 4RQ0A 1FTSA 5HLIA 2L3DA 2PP4A 3WAQA 2FMSA 5E3NA 4X0BA 3ML6A 4WQKA 4WBYA 4DOAA 4RWQA 5LEJA 1R9TJ 2VKEA 1QZEA 2M0MA 3KL4A 2Q7RA 1VQ6I 3CLOA 4KLMA 3GDXA 3CMEI 2F5EA 2LR8A 4GYIA 1LI5A 2V9VA 2H6CA 3QWLA 5HOOA 1OW7A 5AGFA 2A6EF 2JPBA 4GO1A 5J2BA 2E1MB 1MH4A 4I1OB 4DZPA 3HLZA 1HE1A 3UXNA 2DB4A 2ZJ2A 2E5NA 3KPHA 2Y31A 1O3SA 3GWZA 1XPXA 2CH0A 2O03A 2VE8A 5JHFA 4ZTFA 2R7WA 2OTJI 1UCRA 2DMNA 1OCZC 1SVMA 1Z3IX 2HDWA 3CSKA 4MFEA 3RQGA 1PYVA 3RQEA 2EFQA 3JAMK 3T8TA 5BMZA 1YJ9I 2KGOA 4X4PA 2COBA 1R23A 1E3HA 2ACJA 4C7OB 2B0HA 3B0VC 2VBZA 1Z05A 3QOPA 2NAZA 5CKTA 2I8BA 3RKOF 3U9JA 1YS7A 1R6RA 4BEJA 4MFCA 9ICRA 4BS9A 5DCFA 1U3EM 1FMVA 4YIRX 4RLQA 3R0JA 1XB4A 3DLLF 1BOAA 2PXIA 1E3OC 4MTOA 5DEDA 5L0DA 3G1OA 3CCEI 2HGCA 4F7ZA 5LFAA 1G6NA 2M4KA 8ICMA 3ZG1A 4UB2A 2IS6A 2NSFA 2HPIA 1S7OA 3H5AA 3PO2J 3MGHA 3F22A 7ICLA 2P8TA 5JT4A 4KLQA 3BZKA 4LLEA 1TBXA 3HRMA 1ZVZA 3SJMA 1Y56A 2DA6A 2NS8A 1J0RA 2COMA 4YN0B 4O67A 2GLOA 2PX0A 2XM4A 2XS1A 3WTYC 3M4CA 3DV8A 1MBFA 1B9MA 3FK6A 1ZYRF 3P9CA 4G94A 1M2VB 3AG1C 3HGYA 5HRBA 1OKRA 5F0FA 1W36D 1ZQTA 3HDDA 4M63A 2EIJC 4YWQA 4LVSA 3M4OJ 3OIPA 3UMHA 4R8HA 3CJQB 5FKKA 2W45A 1HY5A 4HRIA 4L5JA 4E4HA 2WBMA 1VFGA 2AWCA 2CGEA 3OEOA 4YELA 1OR7C 2GOXB 5T1DB 2Z15A 5DB6A 1QO0D 2G7UA 3J81K 2NNYA 2K9QA 2HZTA 3I56I 4MVSA 3AQLA 2M0CA 2A69F 1H9TA 3RVZA 4XEFA 2P6VA 2M7AA 2VQLA 4CZZA 1WFXA 3GMEA 2M4GA 2W4SA 4IL6C 2CWEA 3QYBA 4F91B 2RSEB 2R7RA 2BE5F 2QBYA 1O5HA 4RM3A 4UBBA 3A01B 1XCBA 4I2AA 1BI3A 2R7QA 4R65A 2CUFA 3ZCOA 1VFCA 2LDUA 7ICNA 3HRSA 3VSKA 2H7OA 2FMYA 3H3ZA 3ZQ7A 4XRMA 4OIRF 3L8IA 2DA1A 2NNNA 3ZQGA 3S3MA 5BPCA 4HX7A 3MD2A 1RRJA 3AUOA 1MQ3A 1M2OA 3DEEA 4WC7A 2WAFA 2HUJA 3E6BA 2AXLA 3IKTA 3CUQB 1YS6A 4U9DA 4EEDA 2PF4E 4KLJA 5GPGB 3HJEA 5IIMA 4G9YA 1VZ0A 2X6XA 2LFBA 3VYRB 3AG3H 4NM2A 4N9IA 4JJFA 4RGSA 3BJAA 4O5EA 3K4NA 1R7JA 2QUPA 2R5YB 5FLMJ 5A6AA 3T6JA 4ATBA 1EA8A 2DVIA 1FFHA 5E1XA 5EJCA 3I5QA 2J5OA 4CDAA 3W8HA 3PMNA 4OOIA 4DXWA 5HV9A 3FZVA 3QU3A 4OAGA 1ZQQA 1ZW3A 2FQ4A 3L2VA 4M9GA 2JA5J 5L3VA 2VC9A 2ZH7A 2P4WA 5GADJ 3LSRA 4MVQA 2AHQA 1AOYA 1Q1VA 2HYFA 4WXCA 2ZSHB 4QZEA 2VI6A 1PUFB 1IZ1A 1AVOB 3ERED 3ABKH 1L7CA 1FYKA 3GTKJ 3RQFA 3ISDA 5HR9A 1EJ9A 5LHIA 5AONA 3D1NI 1X3WB 2AQFA 5A6KA 5B1AH 5J2CA 8ICLA 4RGXA 8ICPA 3WTWC 3BC8A 2DFHA 3HOWJ 2OF7A 4JTDB 4DRJB 3T4RA 4I27A 3LQCB 1TZLA 2FA5A 2JVGA 3HSRA 3DBLB 4O5VA 4R1HA 4ZDOA 3FXHA 5KYUA 2GZWA 2HTSA 2L7KA 3ONQA 2PFPA 3NKEA 3AAFA 3B0PA 3FVYA 1O7LA 4UB5A 2JWTA 1O3TA 2A5YB 4EHPA 3N4MA 3FISA 3KP5A 3GEEA 1FSEA 5L0HA 5M5XJ 1ZREA 4XWJA 3AG2H 3C2MA 2WV1A 5CPRB 3AQBA 3EUKL 3AU6A 1QVTA 3JPSA 4U7DA 2IOQA 3MYFA 1FYMA 4NXTA 3M1EA 1TFYA 8ICZA 3K6GA 4NXUA 1FP2A 1TWGJ 9ICNA 3TL4X 1ORKA 2FEZA 1GGQA 8ICOA 4AC0A 2I8DA 1CF7B 3QZCA 3T6GB 5E8GA 1T38A 3B9QA 3CC2I 5DCMB 7ICIA 2KLOA 3OR1C 3V7JA 4JBAA 3B02A 9ICUA 1D8KA 4E70A 2CGPA 1T39A 2QY9A 4IARA 4R66A 3S27A 7ICOA 2MBFA 4CSWA 1Y6IA 4Z9IA 1EQ1A 3RJFA 1YIOA 3L09A 7ICTA 2KYHA 3FBNB 3M1CB 1T08B 3C2KA 2ECCA 3U9GA 3U3BA 1NG6A 3DBRB 4I0UA 3R7CA 4KLFA 1WJEA 4BDZA 3B0UX 3A02A 4NNJA 4C2UA 5HRGA 1MD0A 4ETSA 1UETA 2OJQA 3EFOB 5IIJA 4EEBA 1R22A 2ZMEB 3A9CA 2XGXA 2L9NA 3LEOA 1XMAA 5DEQA 2HWVA 5T3TA 3F21A 2NOGA 2HTJA 2ZXHA 3O3KA 2HV7A 1LS1A 1JUPA 1WQ2A 1QLEC 1KZHA 5E3LA 1TT5B 4C2MJ 5COFA 4JRZA 3RJKA 2ISOA 4P2HA 2BXZA 4L9NA 4OU0A 1PVEA 2MSYA 3MMYB 1PCXA 4U5HA 3SYNA 3QVZA 3V7KA 1NU9C 3KEYA 2H8AA 3DAGA 2F2EA 2PMZN 2TCTA 3FMRA 2X6WA 2KT0A 3MCZA 4RAGA 4RAYA 2V6EA 4N06A 4I44A 3BR6A 3KCCA 4RM2A 3BCAA 4D4NA 3C66A 3MDAA 1Z1DA 1LE4A 3UMIA 2J9VA 4DRIB 4WH5A 2DJNA 2DI3A 2DT5A 1S6LA 2X0CA 1CPQA 3F72A 4IXAA 4MNDA 1ZHTA 1WGXA 1R5HA 2O61A 4XEKA 3V8JA 5J0YA 3HXLA 4JIOA 5D46A 1QPMA 4WXHA 4JX6A 4PR9A 2Y0MA 1YRNB 4YL1A 4XK4A 1K83J 1ACIA 2XB0X 1HF0A 4IAQA 2CS3A 5CYVA 5HS8A 1N25A 3RQ4A 2OQMA 3LJBA 2VN2A 3VFZA 4BQOA 4E7LA 4IHSA 5JP7A 4K7BA 4CDGA 3VEPA 1Z6AA 2XRNA 1B68A 1R58A 3C7JA 5FFXA 3DLAA 4B1RA 5IPAA 4B47A 3DP7A 5CB1A 3QPTA 4D0PA 1R5GA 5IT3A 4AL0A 2KPMA 4TUQA 4K96A 3E70C 4XPXA 1S7EA 3C5FA 2HVQA 5CVUA 5IT9Z 2QQAA 1RJ9B 3EGXA 3S84A 5FLXZ 1X2MA 4RDUA 4AIKA 2Q2EA 3O6BB 5DS9A 1XSDA 2L9SA 2OU2A 2LG4A 4RB1A 4PK4A 1FJLA 5HVQC 2AO9A 2W48A 1S72I 2OCCC 4O3MA 4KMUX 4CH7A 3GM3A 3TEDA 2CYDA 1Z6RA 1AHDP 3ZIBA 1A35A 3WFQE 3E97A 4OINF 5TISC 4CGZA 5DM7F 4NTFA 1NFOA 4UB6C 5BQTA 4JWMA 7ICMA 1H89C 4LIUA 3ASOH 4ASNA 3OSGA 7ICSA 4QZDA 1YW7A 3GM1A 4QSHA 2H94A 1E3PA 2MG4A 1ZQIA 5LHGA 5JLXA 4BJ6C 4EBKA 5KYYB 2K85A 5DUKA 3LSJA 4XUSA 3OYKA 3SZRA 3C2BA 3SEQA 4Y52J 2CV0A 5DS5A 4WGYA 3C3WA 4EJWA 3H5NA 1HUOA 2M1BA 3JYHA 3QAHA 3HW8A 5E17F 1LI7A 5LLQA 2QSFX 1BJZA 2VOOA 2EFOA 1LEBA 5FGMA 4I76A 4PFOA 2M4EA 4YT8A 3RH4A 1WTYA 4WGZA 5CP2A 4BQQA 3GTPJ 2BC5A 4I0BA 1GXQA 3V4GA 4MVRA 3ZDLA 5E8IA 4W97A 2EIMH 3MZYA 2X85A 2JT1A 2HSBA 1FAPB 1I5ZA 3FWEA 5IOZA 3OYDA 3S3NA 3H1CA 1ZG3A 3TO6A 1WJBA 3BR0A 1LDDA 5DB7A 1SFKA 2DQLA 1HW1A 3U2LA 2O6GE 2HXOA 4X4TA 2ETSA 1ZRDA 3AGUA 2EIKH 2GIZA 1IG7A 5CIVA 5EZGA 4PHDA 3OSFA 5DDMA 1ZHXA 2HZ8A 8ICNA 3SXKA 3HKKA 3CO7C 3K70C 1RESA 4BEHB 4CICA 5LGTA 5CWRA 2VJ5A 5HRLA 1QQIA 1X1BA 2K9SA 4J30B 4YL0A 4IAOA 2VASA 4Y7NJ 4HLYA 2Y9ZA 5EGYA 5D49A 4V2GA 2NS7A 2QVOA 1O4XA 3RYLA 1FMWA 2ELKA 1SFEA 3DKXA 1DU6A 2YSRA 1XDUA 5E1ZB 1ZHFA 3ZTZA 4BNCA 2ZJPF 5B3PA 4CO8A 1JAFA 2IP2A 5EOZA 2ZH9A 2KRFA 1OFCX 3A03A 4MO7A 5HODA 3LNQA 3HOUJ 1O3QA 4OAIZ 3OYEA 4X4VA 3IRQA 4U5GA 4LGWA 4XPWA 2FCLA 7ICGA 2DFIA 3S16J 4RGRA 3D5RC 1XMKA 4Y33A 3FOPA 3BTLA 4D1QA 2X1DA 3IQTA 3PHZA 5HHHA 5J2GA 2WB1A 2ZH6A 2DA4A 1MNEA 3FM3A 1W7PD 1EKEA 1T6QA 4QZCA 2KIFA 4WJ0A 2KMUA 4EV6A 4IQVA 4CCOA 2Y75A 2E34A 2ZH8A 3OVAA 3H9GA 4BQAA 3JR9A 2R93J 3QW0A 3CMMA 5EF6A 4I2DA 5FB2A 4IO9F 3L7WA 4ZZDA 1WH7A 2KIMA 1BPEA 3AJMA 2L54A 1WI3A 3R4KA 1DP3A 2GXGA 4NXWA 3C8ZA 4YT5A 4DO9A 3K1HA 1REPC 1Z6TA 4KLEA 4KT5C 3JSOA 3WE2A 3V7SA 3Q9VA 1FC3A 3DJNB 4HZFA 3M9AA 1TQMA 3ULQB 2D4UA 5J8CA 4YIIA 4PFPA 2KJBA 2AP3A 3P9KA 3GZ5A 4GRIA 4O6AA 1I27A 2QM3A 1O3UA 4R63A 2R7VA 2UUIA 4HV6A 1IN6A 4NTAA 1OYYA 4II2A 2K9LA 4WF2A 2HDDA 2MHRA 1MW7A 3TULA 1AA7A 4IX7A 2DPUA 1XZQA 2MGQA 2QQBA 3IQCA 1HQCA 2OZUA 2HI3A 3L2QA 7ICKA 2Y3BA 4B48A 3PNCA 3IKVA 4K0DA 2L02A 3H3AA 1FIPA 1RNLA 4M9XA 1WATA 4RB3C 4AIHA 1GT0C 1X4PA 3BTIA 3N0TA 4EJTA 4AT9B 2K27A 1I39A 3CK6A 1FOXA 8ICKA 4AIDA 3GW2A 4O6JA 1MSEC 5J3LA 2FQ3A 4ENKA 1VYIA 4I2IA 4JOMA 2HOEA 3LMMA 4D5CA 4ESFA 4P6IC 4CA0A 2PJPA 2OTLI 4N4OB 1JR8A 5L0IA 1LPQA 1WWXA 1YZAA 2ZSIB 3GBGA 1TWCJ 4Z6YA 5KCMA 2KQ9A 2MH2A 5C3EJ 4NXZA 3EYIA 2N8GA 7ICVA 1SFXA 1N75A 4DQ2A 3ISPA 3DWLE 4LB5A 1N78A 3IQ5A 3VAYA 2ZH5A 4A3KJ 2BPFA 1YLMA 2FBKA 2WAQN 5BS6A 4M04A 3NYJA 1YQAA 3BCBA 5ED4A 4HEAJ 3HZJA 1QA6A 3PCVA 1K40A 3I58A 4RQ5A 3DPLC 3PQKA 4EGZA 1ZGWA 3J7AO 3M3YJ 1PD0A 3LNMB 4RWOA 1ZQPA 4N0BA 4FESA 4F5QA 1OYIA 2DMPA 4XLNF 3UMKA 3ABMH 4PGXA 4EM2A 5HNHA 4U5CE 2V1XA 1KEJA 2F4MB 5HNFA 1VOMA 5HRDA 2KHMA 3CP8A 4O7GA 2DDBA 3S29A 4JLZA 3IUOA 4A0XA 4QZIA 3LFKA 3PUFA 1IXSB 4GGGA 2DYRH 4PHEA 5IP9J 2VQHA 1R71A 4PJJA 1WJAA 4CHUA 2NRAC 1RKTA 3HL2A 3JCUQ 5CQGA 5KHDA 5BQGA 3FBIB 5B3SH 4Q4ZF 4XORA 3S90A 4K98A 2LF7A 1RKWA 3O2PE 3QPSA 3P9IA 4XN0A 5DUIA 2O9LA 1FTTA 1TP4A 1O87A 5E2QA 4LITA 4C2TA 2W9YA 1MJAA 2DRBA 4X4SA 2Y69C 3TOLA 1WWPA 4ITVA 1V4RA 4D7MA 4JZAA 5AC5A 3TOMA 5J29A 2VKVA 3HEFA 5FZTA 2X1CA 3F8MA 2NSGA 1XGMA 1S7ZA 1JRAA 4O6NA 2Y48A 2Z99A 2D5VA 4XRHA 3C18A 5EZHA 1FBUA 3BR5A 1V55H 2EFPA 3GEZA 3AKZA 1JPNA 2XRHA 1IV8A 5EGOA 2BHZA 3L34A 5JUAA 3JRHA 1FY7A 1ETYA 2JQ7A 2LKXA 1VF9A 1ZQ3P 2CW0F 4LT6A 2RVCA 2V4JC 4AYBA 5B66C 3OIQA 2KQRA 3FOOA 1ZLKA 3LEVA 3GLXA 3HSEA 2PG4A 3SYTA 3FMSA 3CUQC 5E3AA 2R7SA 3WU2C 4UXNA 3NAUA 2WVNA 3WHBA 4NUBA 3K4CA 4EV0A 2BE3A 2WAEA 4MW3A 3IAS2 4FTHA 3RFYA 3VB2A 4L0ZB 3DKWA 4HSRA 4XJEA 5HDKA 3K1PA 3RJGA 4BACA 3JPPA 1IV6A 3H39A 4FO1A 1CGNA 5JTGA 2WADA 3FM5A 5ICEA 2CV1A 1BW6A 1LQ1A 3TDUC 3M79A 2ZXWH 4KUMA 8ICGA 4LDKA 1Q0KA 3RJEA 5BQIA 5CVIA 3B29A 2E1OA 1CGME 1G3TA 1PX5A 1R5ID 3C5GA 3DEUA 2EBIA 4WOYA 5CFSA 4AT8A 3LS1A 1HSJA 2LKPA 2LY2A 2Q9AA 4DIQA 4FHPA 1APCA 2QZ8A 2CSOA 5LHHA 3RZDJ 3HTUA 4CS8C 2AVKA 2XDVA 1FNTc 2FX0A 2E5ZA 4EJOA 5K0IA 4KB6A 2MWQA 3EJNA 2V9PA 2EPMX 1T8IA 1Q0DA 1H9GA 4G6DA 3HNLA 4EIYA 1J8MF 3OYLA 4YD2A 4M9HA 1ONVA 3K4KA 3SZPA 4RWNA 1K04A 4AL1A 3JCUC 4DOBA 4CCJA 1JI8A 2X1EA 3ZN1A 4CBEA 2QWWA 9ICMA 2EPFA 4M3GA 5F1RA 3H35A 1OCRC 2XLWA 2ELJA 2K4JA 3VYSB 1YI2I 4YMMA 2DR9A 1B8IA 4IRIA 4M47A 2YEVA 1A0BA 1EKYA 1VQ9I 2VBYA 4FHTA 4XNFA 2NS0A 5JVTA 1APLC 3KZYA 4OWRB 2E1CA 4FX5A 1G3WA 5F5FA 4BJ5A 1XDSA 2G9WA 2BY3A 1MBJA 1QZXA 1X2NA 4QIWN 4BDYA 3CC4I 4BH9A 3UGOA 3RPUA 1AKHA 3WTUC 5AIPA 3PNVA 2PEXA 3MBGA 8ICVA 3ZMSA 3M7GA 1D1AA 1GV2A 3EHNA 1ZELA 2PN6A 3UR3C 4YN4A 5L3FA 5FLVA 1FOYA 2W25A 1B4AA 2DN0A 4OMYA 4YMOA 3LL7A 1E84A 3B0YA 2YLDA 1XSVA 1MIJA 3L9DA 3H3VK 5JLWA 1HLVA 4H4KC 3CDLA 5E20A 2VCAA 2IGKA 4AT7A 1POGA 4MF8A 5HRKA 3SHFA 4AYBN 4KI2A 4UV8A 1FX7A 4N4NB 2HKVA 2XB5A 1A04A 1OKKD 1GV5A 5COGA 1VTNC 1USTA 2DT6A 3GFMA 3OL3A 1Q0MA 4PGQA 1X3ZB 1FP1D 2ZMEC 3A1YA 2FOWA 1SMTA 2GAQA 4W8PA 2OJED 3IL2A 3E1SA 4AUXA 2W84A 1T0FA 3OOPA 5D63A 1ZQAA 3I54A 4BHPA 5L0GA 1TKNA 4EP7A 9ICHA 3Q9SA 3PFIA 4HDUA 4K99A 4ENMA 2JTVA 4TUPA 3TGNA 3B0XA 4XKCA 2ZFWA 3U2RA 3QRFF 3ERMA 3VRCA 2O1PA 1OJLA 2VUMJ 4FE4A 1X1DA 2EA4A 3BPXA 2DK8A 5DS4A 3RJHA 1YJNI 5M5YJ 4WWCA 3EHMA 2J46A 3L0IA 4KLOA 4KM5A 3QTHA 2MD0A 3M8JA 4GXOA 4CX9A 4KIFA 5J1RA 1TL8A 4ZLCA 3X2QH 2JRTA 3PIPF 4PH5A 1YJWI 2HFHA 1I50J 2L7FP 3LQRA 4IRUA 3ZR8X 3ZMVA 1WVRA 3HB9A 3LNRA 4Q7CA 5J2IA 2ETHA 4A3LJ 4UD5A 3EGXB 3HPHA 1TFOB 2Q2EB 3OS1A 3SXYA 1VQOI 1YAUO 3MX3A 1JMSA 1IJWC 1RPWA 4UB3A 3I64A 1J75A 1ZW2A 3NDBB 2CV2A 3K1IC 5D6FA 1QKRA 4C3JJ 2E2HJ 2LCHA 3BZCA 4BG0A 3AFHA 9ICPA 2QENA 4N6CA 1YA7O 3GTOJ 1M56C 1TR2A 1ZQMA 1IF1A 2DOEA 5D4SA 2YL3A 1ZTRA 4XLPF 2FBHA 1A5JA 3K0LA 4S3NA 2XF5A 4E7IA 2KISA 4B4CA 3DEWA 2P5VA 4RLFA 5LRRA 3RKWA 2EPKX 3HOTA