3C18A

Crystal structure of nucleotidyltransferase-like protein (zp_00538802.1) from exiguobacterium sibiricum 255-15 at 1.90 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
b'GMEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQMSLSFAKLLRRFQDGRNLFSRGNYYDAYTHVHHALHHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQSKVLSGGKYLFEVMRERDRPWTMHELMEESRLTELKVDLGSLVDFFIRKGLIRISYQRTKGLGVELVTYEPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotidyltransferase-like protein
publication title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
total genus 107
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14540 NTF-like Nucleotidyltransferase-like
A PF18576 HTH_52 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c18A03
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3c18A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3c18A01
4P9FA 5LRRA 5J2GA 4G9YA 2OU2A 5DBCA 2XVCA 4DO9A 9ICAA 2DTRA 3BPVA 2IPQX 8ICOA 9ICMA 1OW6A 1LJ9A 3QPHA 4PGXA 4KLJA 3RKYA 1H9GA 1ZN2A 2BBYA 5DBBA 2XV4S 2ZCWA 3D0SA 3KP7A 2HTSA 2HKXA 3I59B 4GXJA 3MAJA 1LDJA 3FXQA 3WGIA 1TLHB 1OR7A 2WWYA 3O6BB 4MQ9F 5DCMA 2G7HA 4LD5A 4BAYA 3C2KA 1FBUA 1HKQA 1G3SA 2FRHA 1GXPA 1B1BA 2NYXA 2P7CB 3HIFA 5D6FA 3IWFA 2W84A 2A07F 1KQ8A 3KLNA 1Z6TA 2HYFA 7ICGA 1OMIA 3LK9A 3HX0A 5HREA 4YFXF 1RUNA 3IWZA 4RB0A 1JN3A 3T5XA 3F22A 2NAZA 1HUZA 1ON1A 1HUOA 2EFOA 1Z05A 3V72A 5HRLA 2PBIA 1JGSA 3C2LA 1FPQA 3T8RA 3V8KA 1AOYA 8ICAA 4KIBA 1IN7A 2WC2A 4IG8A 3RI4A 8ICGA 1O57A 5BPCA 1YG2A 1ZG1A 4FX4A 2GXGA 1FNNA 4X4TA 2PG4A 2DBBA 3WTWC 3EYYA 1J5YA 1WWXA 3FZVA 3RJHA 2RFFA 4NLZA 4ZYHA 7ICEA 9ICLA 4QZGA 1NOMA 4AT7A 1Z9CA 2UXXA 4NXZA 4IRIA 2YU3A 1ZQJA 4CO8A 2QUFA 2L01A 4ON0A 4HOBA 4UXNA 2KK1A 2VXZA 4I7HA 1D8JA 3WU1B 3F8NA 3B71A 3IRQA 4MQVA 2P6SA 5BS6A 9ICPA 4EVIA 4AIKA 5DB9A 5LHGA 1QO0D 1FP1D 2EFNA 5ICFA 3RYPA 5HRKA 3RPQA 1IN8A 1TW2A 3KLOA 1PV3A 1IRGA 3AQKA 2OA4A 3HRTA 3U3FA 2RGVA 1O3TA 3MEXA 1XSDA 4YFKF 4MEYF 4EJWA 3HYIA 4YIIA 4O3MA 4UVCA 3RPUA 2GA2A 4EJTA 3V8JA 4EBJA 1P2FA 2JX0A 3U1DA 3MWMA 4EJVA 4UB2A 2W57A 3HRSA 1KYWA 4NM1A 2R3SA 4I0AA 3C3WA 5CJ9A 4BHPA 4I2AA 1ZH5A 2K4BA 2Y48A 1S3JA 2MD5A 3MCZA 8ICFA 9ICHA 1TV9A 1UETA 2P5VA 2P7VB 2K86A 7ICTA 3NQOA 3F8BA 2OZ6A 3JPSA 1YS6A 1ODDA 1R5GA 2K02A 4U88A 1J7KA 1FYLA 3O2PE 3HTUA 1OU5A 5E17F 2QWWA 4P55A 4MFFA 4QZ8A 4LB6B 2HGCA 1J9IA 4QZHA 3HIYA 4L18B 2ESNA 2KKOA 2HR3A 3E5XA 3M7GA 1O7LA 4IRGA 3AQNA 1HSJA 4WWCA 3WFQE 1J0RA 3O3KA 1ZJNA 4XQ8A 1IN6A 1MD0A 4FH5A 2VT2A 1D8KA 2ZBKA 2QBYA 5ILSA 2O03A 5J0SA 4QZFA 4PCQA 2KRFA 3L9DA 2ESHA 2LF8A 3ML6A 4BH9A 3ISDA 4AT8B 4I2CA 9ICUA 2EFWA 9ICOA 3K1NA 5CYVA 4HX4A 3BROA 3CUQA 2A68F 1ZGAA 4EP7A 3V8LA 5J2IA 1SMYF 2M8EA 1Z91A 4I09A 1JAJA 3OOPA 1ZQTA 1K78A 4HDVA 4OMZA 1B6AA 5L3GA 5DB6A 1KU7A 4PZJA 4WXDA 2L6FA 1RPLA 5ICEA 3LFKA 3J80K 4G7HF 1QZZA 3FMQA 4RQ6A 2W85A 4LT6A 3JYYA 3HSRA 2DAOA 4YG2F 3ULQB 4X4SA 1TNTA 4KICA 2GIVA 5DDGA 2LDUA 4UAZA 5J0UA 5J0QA 4RGXA 4QZDA 3HHHA 4ENNA 1ZQUA 1IUYA 2ZH1A 2JPUA 1ZQAA 2VOPA 1NHAA 4RPYA 4IQTA 3F6OA 3FX3A 4IHSA 3EUHA 2A5YB 5IIIA 3IHUA 1ZQBA 2DLLA 1XD7A 4O6JA 5K1YA 3UXOA 4L9TA 4F5RA 4I01A 1W7PB 1SAXA 2PMUA 4AIJA 3RJEA 2KIFA 1EV7A 1R00A 2XAQA 1ZQCA 2X4HA 2L4MA 1OPCA 4UB1A 3C8GD 5IT9Z 4GCVA 3RH6A 1ZQYA 2L3DA 1BI1A 1XGNA 3E6BA 1YQAA 3E6MA 5DDMA 9ICCA 3O10A 4DNCA 4G7ZF 4ZYEA 4RWOA 5CR0A 3DPTA 3KEOA 4HQEA 1MIYA 2STTA 3SHFA 4FHXA 4LVSA 3MGIA 1KYZA 4M74A 4HF0A 2IA0A 4KLDA 5BOMA 2M45A 5J0OA 3GF2A 3KP5A 4ESFA 2R7DA 5J6XA 4HV5A 1KGSA 1SD5A 1F5TA 4Y17A 3GX4X 1BPXA 4LLGF 3TQNA 4X4VA 2XAJA 1ZQGA 4UD5A 3TFSA 2KJCA 3U9GA 2XKPA 9ICQA 3N97A 4RWNA 4EGZA 2OQRA 3WFSC 8ICMA 2ISZA 8ICYA 4ATBB 5DBAA 4PPXA 5J2CA 9ICGA 3E6DA 1KQ9A 3E3VA 2R7FA 7ICNA 2GXBA 1YLQA 4KLOA 4HX7A 1FY7A 9ICBA 2WTEA 1ZQEA 3DQVC 2ISPA 3AQLA 1R58A 1FP2A 1XSPA 3L7WA 1T6SA 4X4OA 1S7OA 1TFWA 8ICXA 4E8FA 5BOLA 1KA8A 1JQRA 4HW0A 1R1VA 4N9HA 2HWVA 5CB1A 8ICQA 3RH4A 3KFWX 5AIQA 5E1ZB 2BV6A 3RDIA 3MQ0A 2CWEA 2HTJA 4DQ2A 3WE3A 1U8RA 4UHTA 4UV8A 1B4AA 1R1UA 4XA5A 4WC3A 5IILA 4M73A 2BCQA 2BPCA 1LNWA 2FE3A 4HZFA 1SFUA 2JRTA 4CGZA 4WK8F 9ICNA 1FOKA 4NY8A 2V1XA 4XBFA 5J2EA 3OUYA 4P2HA 2IJLA 5CVUA 3RKWA 3V7KA 3WTUC 3F72A 2ZO4A 4X0AA 1B9NA 4A5MA 2Z33A 5D5VB 4M71A 3V7RA 4P4OA 1Q1HA 5LGTA 1R89A 3F6VA 4M2YA 1MDMA 3KZZA 5A2QK 3ISCA 4M6XA 7ICLA 4ZYDA 2K4JA 1PX5A 3I5UA 3TULA 1E17A 5ERIA 3L8JA 1RNLA 1ZQQA 3BY6A 5J0WA 4LB5A 3WFOA 3FWEA 4RQ4A 1WOLA 4IQVA 4F5PA 2QZ8A 1W4MA 3RJIA 3CO6C 4CXFA 2W9MA 1XMAA 2XRNA 2DU9A 4EJUA 1EH7A 5LLQA 2XAHA 2VBYA 3B02A 4L5IA 4KMUX 4ASNA 1FYKA 1MJBA 2E1NA 5J0TA 3F8FA 1XSXA 1BPZA 5HR9A 3CDHA 2D1HA 2WV0A 2UWMA 1G6NA 4EM2A 2X0LA 2PFOA 1K05A 5HRDA 2ZH4A 1U5TC 1ZAOA 5K5QA 3JPQA 7ICMA 5HDGA 4YIFA 4ESBA 3QU3A 4I2EA 4RGUA 2NRKA 3SZTA 2PFPA 4P4PA 1DP7P 3JTGA 1TFYA 5D4SA 2Z9OA 3PQJA 3T8TA 3TOBA 4Y15A 4TUPA 1S6LA 2L6HA 2CW0F 3E97A 2VE9A 1FYMA 3GZ6A 3RQEA 1ZQOA 4UBCA 5HC9A 2XAFA 1U5TB 4G7OF 3SFZA 3KP4A 3LWFA 2CYYA 2A6EF 5JHUA 2L6GA 2LSOA 1WTYA 1FX7A 2ELHA 3E6CC 5CWRA 4P9UA 4LZDA 5DDYA 4QZBA 1O3SA 3OV7A 1DDNA 1O7FA 1OYWA 2Z3YA 2BPFA 4MHGA 3F21A 3COAC 2VC1A 2AS5F 4I2JA 3WFPA 2F5CA 1JXSA 1UEVA 5IIKA 1ZZPA 1PP7U 5IIOA 1KTMA 2EFPA 4HLYA 4ENMA 1BPDA 4HF1A 2ZH5A 1LEAA 4X4QA 2BPGA 5ILUA 4L0YB 2A61A 3RH5A 3L9FA 3I4PA 3JTHA 4MFAA 1BC7C 3P7NA 3MFKA 1ZJMA 4KYWA 3K2ZA 3ZN1A 2K7LA 2L4AA 2PBEA 1QBJA 4R79A 1BJAA 3GYHX 4U7DA 2Z5UA 5HHIA 1WOTA 4FO6A 1O3QA 4F5NA 1MGTA 3JPOA 4XUSA 2PFNA 5LGUA 3MZYA 2VE8A 4M72A 3ABTA 3IKVA 5L3FA 1KU2A 5F1RA 4B8XA 3K75D 4WC4A 2JPBA 1G3WA 2CO5A 4WBZA 1GXQA 2PJPA 2FMPA 5DCMB 4A0XA 2MC3A 1F4KA 1DUXC 4U0YA 1OW8A 4HLXA 4HV6A 1RIOH 4XRHA 2Z99A 8ICKA 4OIQF 4N0BA 4X4UA 3ZMTA 1SFXA 4X0BA 2O61A 4P4MA 4IF4A 9ICEA 4XRFA 8ICJA 5HLHA 2H6BA 3HOSA 3ELKA 3WE2A 3TGNA 3HTSB 4EBKA 5L3EA 3GVAA 5IIMA 1A04A 4HA8A 2PLYA 3UQ2A 3I64A 2O6GE 3W6JB 2IP2A 2VBZA 3JSPA 2FBHA 4ZZDA 3FM3A 2FNAA 2J5PA 2FBKA 3C18A 2PMHA 4K4HA 3VOEA 2NNYA 2P8TA 4WX9A 3UXNA 3BRJA 2GQQA 4KT5C 4KLMA 1QQIA 3HJ1A 4WC0A 4P5OA 4O9MA 2HS5A 1R8CA 4S3NA 3R61A 4FHWA 3GDXA 1MJ9A 2BCRA 1BI0A 3DEUA 4QZAA 1ZG3A 4WC6A 3HSEA 4AT7B 4CYDA 1EH8A 4EJOA 5AIPA 4XLPF 2LKPA 1H0MA 4ENJA 3V7JA 4S04A 4YN4A 4FHYA 4I29A 2Q2EA 1CF7A 2FF4A 4NB5A 5LEKA 2HOEA 4ZYGA 4WCGA 3SXYA 2KIMA 3JW4A 4GYGA 4A6DA 1ZLKA 4AT9A 4M47A 5J2AA 2Q00A 2FNPA 1MIWA 4IPAA 4TUSA 4GGGA 3J80Z 4PHEA 8ICSA 2DI3A 2O0YA 4F5QA 2DK8A 3R0AA 3GUDA 3HW8A 2FSWA 1R1TA 3ECHA 5HRFA 2DR5A 2PQ8A 3WTVC 1DPRA 1BC8C 1FWZA 1UEUA 1Q79A 3AJMA 1BBYA 3K0LA 1Z7UA 5J8FA 1HKSA 4F7ZA 3NRVA 2HHPA 2M2WA 1V3FA 5FGMA 1JMSA 4XSXF 1XB4A 1FBSA 3VODA 2PFQA 4X4RA 2IRFG 3T0YA 4DOAA 4A0YA 2QM3A 4GXIA 1UHWA 1R5HA 3D5LA 5J0YA 2BCVA 4N9IA 2KIUA 4UAWA 1PP8F 3SZPA 3LAPA 3WGGA 1WRJA 4OU0A 4RQ5A 1USSA 3OGUA 9ICWA 1UFMA 2IA1A 3QPTA 2BCSA 4ZZLA 3IC7A 2M30A 9ICRA 3PFIA 4HF2A 1Y0UA 4M9NA 3E5UA 3DXJF 2P4WA 4IJAA 2VBXA 1TW3A 4MTEA 5L3CA 7ICRA 1XDSA 1YYVA 2OQGA 3S2WA 4OIRF 4IHTA 4UNOA 5IIJA 5J0RA 5D5XB 2YR2A 3G73A 1ZLJA 3ISBA 3RJJA 3PQKA 2IA2A 2GWSA 2RDPA 5DD4A 4YMNA 5D49A 5BOXA 2DR7A 4Z6CA 1YW7A 1UB9A 4M9HA 7ICJA 2ZMEA 4R64A 7ICOA 3WG9A 2D2WA 2QBYB 1WI9A 3K1MA 4I2DA 4EMSA 2HDCA 1JHHA 1Z1DA 1C0WA 4EV0A 2EV5A 4Q4ZF 3EDPA 1ZQSA 3I0TA 8ICTA 2VODA 1HXDA 5J8CA 4JK1X 4RS8A 2F5EA 1HBXG 3PMLA 2RV8A 3CUQB 2TDXA 3BJOA 1ZQIA 2QENA 2H09A 3PNCA 2FXAA 4JWNA 1ZQHA 1F5AA 2XHKA 5LHIA 1ON2A 2CGPA 1IN4A 4OIPF 3GFIA 2HYGD 3RYRA 3JSOA 3P9KA 1IXCA 4ZH4F 4M9XA 4XLNF 1W7PD 3WTZA 5AONA 1WSUA 8ICVA 2DRAA 2BE3A 3E5QA 3RKXA 2D45A 1REPC 4IXAA 3JAMK 1KQ0A 3GM3A 1UFBA 5HOOA 4RQ3A 2ETHA 4YMOA 4RPZA 3F23A 5HLGA 3GFMA 2Y0MA 2V79A 1BI3A 1HQCA 3L09A 3M9AA 4XQ7A 1JHFA 5D46A 1ZREA 3J81Z 1J75A 1AWCA 3ROUA 4O5VA 2I9GA 2M5WA 4OMYA 8ICUA 1XGOA 5A2QZ 1O3UA 3C8GA 2HZTA 3JZ0A 4LZGA 2DT5A 5JR3A 1KU3A 1YIOA 2FQ3A 3G3ZA 5J2BA 4RQ2A 5F2VO 3AUOA 5FD6A 3M1EA 4GXOA 1XSLA 4AIHA 1K6OA 5D6EA 2EFQA 2ZNZA 1IN5A 3IRRA 2UZKA 1ZRDA 4UB4A 4G8XA 3DKWA 3GZ5A 2MA3A 4KMFA 1XDUA 3M8FA 1T38A 2YWAA 4WC1A 1VTNC 5K5OA 2P6TA 5CP2A 3H3AA 4KN4X 4ATBA 1TBXA 1ZQRA 2XIGA 3WU0A 1B59A 5CVVA 5HDNA 5D8LB 4PGGA 3U2RA 4A6EA 4EM1A 3R60A 4E80A 3FHZA 5LEJA 1FA0A 2IW5A 4WC7A 1ZQFA 2O8XA 3TFRA 2VOOA 1HW1A 2BCUA 3NYBA 3C2MA 1QZYA 4TUQA 3UPSA 2PFBA 2IHMA 2JPCA 3TO9A 4RT2A 3LA7A 3K1PA 3RJPA 4EQQA 1PUEE 1XN7A 2BE5F 1P4AA 4A0ZA 4O5EA 3FXUA 3KP6A 4KIGA 3UXPA 3JPRA 7ICPA 1I1SA 1I6XA 4DOCA 2C6YA 1L0OC 3HJ4A 3NEUA 1BN5A 4BQAA 1OW7A 3ZMUA 1SMTA 2FEZA 4NM2A 1BIBA 4PGYA 3WODF 7ICHA 3LQRA 4RGRA 2YX7A 3LA2A 2PI0A 4BNCA 5DUIA 3UQ0A 5DEDA 4FHTA 4Q47A 1S8NA 4Z2YA 8ICWA 2DFIA 1RI7A 2W24A 5FD5A 1EH6A 3KETA 2A3SA 4PHDA 1F9NA 4M9SA 1NO5A 5BQTA 3KP2A 3J81K 3RQFA 1T0FA 1P6RA 2IVMA 3RJGA 1P4WA 3B0YA 3JPTA 5D4RA 1YW8A 2XASA 3MGHA 3I58A 1XMKA 5HS7A 1SD7A 1FSHA 3QRFF 3OVSA 4KFCA 5FFXA 2DW4A 3OUYB 5LHHA 4YD2A 4UVBA 4LG0A 5FLXK 2M2UA 1USTA 2D1VA 1QVXA 4KLUA 3I71A 4E70A 5HS8A 2XROA 1ZYRF 1MIVA 4FHPA 2DR9A 2ZXJA 3QP6A 3ZPLA 4PHAA 1MDMB 4A2UA 2FMLA 4I2HA 2BYVE 5E18F 2A69F 4CICA 2F2EA 4FX0A 1VJ7A 5F64A 3HHGA 2PEXA 2L02A 4BHBA 2V1DA 1BM9A 1I1GA 1KEJA 5L3DA 1P4XA 1W5TA 5FO5A 2RC4A 5TJJA 4I2GA 5H20A 4BYYA 1ZGJA 1ZARA 2H6CA 3TDZC 1IXSB 8ICPA 3TOAA 1ZQMA 4L9JA 1FLIA 4L0ZB 1TNSA 3RQGA 1VFGA 1D3YA 2BGCA 1T39A 2RVCA 4L9NA 1HW2A 1R8BA 5DB7A 4IRHA 3DP7A 2FA5A 2DRBA 1WKMA 4KDPA 4Q5SF 3C66A 2P66A 2CSOA 3MDCA 3H3UA 5DYMA 4HX8A 1MKMA 1ZQZA 4LK1F 9ICFA 1RUOA 3VFZA 2CG4A 1LDKB 5EEGA 3W6KB 1LB2A 4E7XA 3C1DA 4A12A 4XEKA 1IXRC 2Q8KA 3M8EA 4I2IA 4K4GA 2ZNYA 2VBWA 4OOIA 5JI6A 5LRSA 2LNBA 4OINF 1V4RA 4GO1A 1ULYA 5H6QA 1GHCA 2M87A 2CQKA 3R4KA 4R32A 1BPYA 5JFRA 2LF7A 3BZ6A 2M1BA 4RWQA 4D0PA 8ICHA 4RGSA 2MLGA 1BOAA 3I54A 4XEVA 4KLSA 5HRBA 1TQPA 3C5FA 3DF8A 4R63A 1YLFA 3TDUC 5HHHA 2EB7A 4RAZA 3ZMZA 3QAHA 5DB8A 1ZQNA 3I59A 2DVIA 1K7AA 2DQLA 7ICKA 4R1HA 4BHCA 4MF8A 2PN6A 4O5CA 3DV8A 4U0WA 1R36A 3OVBA 1FBQA 7ICUA 2QLZA 3FM5A 3RJKA 2XAGA 1MQ3A 3GXOA 2ZHAA 4KNYA 5J29A 2QQBA 1I5ZA 4ENKA 2RKHA 3BJAA 3AU2A 1U78A 4UV9A 3H39A 4PDKA 4R65A 4GYIA 5EEHA 2VANA 3WTXC 4FHVA 4PHPA 2FMQA 5HRIA 2GZWA 3TO7A 4LFUA 2Q0OA 5IINA 1ZQDA 3V7LA 3I53A 1MZBA 2CFXA 5ICGA 8ICEA 2UXNA 1H9TA 1JOGA 1ZQKA 4X4PA 2FBIA 2H94A 9ICVA 3MZHA 5H6RA 1XCVA 5DUKA 3KP3A 4WF2A 4LLLA 2JT1A 1ZQWA 5CJ7A 1ZRFA 3KE2A 1RZ4A 4L5JA 2HSBA 4RT3A 4I2FA 4FH3A 4KIFA 5CVJA 1LQ1A 3MBYA 4RB3C 4LK0F 9ICIA 4DOBA 5CA7A 4QZEA 4WXCA 2ZH2A 1WWPA 3P9CA 5J2HA 2VN2A 1KNYA 1ZRCA 3EQLF 1W5SA 2FMYA 4KLLA 1ZQPA 2G7UA 5L3BA 5K5RA 4KLQA 4NKTA 1SFEA 2XKOA 1UHMA 4NHJA 4QZCA 1R22A 5DECA 3AQMA 3KEQA 1OYYA 1QNTA 4NQWA 1LDDA 2JZYA 3GM1A 2OD5A 4G94A 3GO5A 1G3YA 1YFHA 2QYOA 3BP8A 2VONA 1MQ2A 2ZH6A 2F5FA 1S29A 3OVAA 4UVAA 3BOQA 3Q9VA 2O5AA 1STZA 5J2DA 4I2OA 5HS9A 2F5DA 4M5DA 2EWNA 3KCCA 4MTDA 1X3UA 2H27A 1CF7B 4RB1A 1SD4A 4JWMA 3GEZA 2NNNA 2STWA 5E1XA 4ESJA 4AT9B 5TRDA 2ID1A 2E7WA 4CZZA 1BPEA 5JVTA 1G4DA 1ZQVA 3LQCB 5ICCA 1WQ2A 4I98B 4K4IA 4A5NA 4G6DA 4S05A 4LGWA 4RQ1A 2HEOA 4KLHA 3LAJA 4U7BA 5DD8A 3B0XA 3GW2A 8ICCA 3CJNA 1ZG5A 1QGPA 2FOKA 1K04A 2RNJA 1HW5A 3JAMZ 1IZ1A 2DO7A 4K2EA 2DK5A 3L00A 3HWTA 1HSTA 1LVAA 3QU6A 2P5KA 2ADUA 5ED4A 3BJ6A 1FT9A 4M0AA 1Z6RA 4B09A 1XGSA 5TZVA 5J0PA 4M9GA 3CO7C 4M9LA 1U2WA 3CTAA 3S9OA 1HKTA 1TQMA 3DPLC 5HRHA 2HFHA 7ICFA 1FC3A 1KDHA 2E1CA 4M04A 4GXKA 3CUOA 3RTRA 4PGQA 3F8CA 4QLCU 3MFNA 4LJZF 8ICLA 2YSRA 4AT8A 3UPQA 4I27A 9ICSA 4HBLA 3BWGA 3B73A 4M9ZA 3CUQC 2XUBA 2NRAC 5J2KA 3K69A 3ZMDA 4L9VA 3HSFA 4X5VA 3SQNA 4U0VA 4HDUA 2ZH9A 4YFNF 6PAXA 1U3EM 3EETA 2B0LA 4KLIA 4BXUA 1OYIA 3IL2A 1K40A 3GLXA 2O1PA 1XGMA 2DQRA 8ICNA 1RZTA 1BI2A 1BIAA 4UAYA 4R8HA 4JQFA 4OIOF 2ZMEB 3ZMVA 2OAZA 4I28A 5DKWA 5BPDA 2ISYA 1LEBA 4HYEA 4TV7A 7ICQA 3WTTC 4X4NA 5CLSA 3K7DA 4IQUA 3R0JA 4YD1A 3RJFA 2DPDA 4KLTA 5HRGA 7ICIA 3WGHA 2A6HF 1K78B 3ZN0A 2O3FA 1PDNC 1TVAA 1XSNA 5HDKA 5E20A 1ZQLA 4Z6DA 5J0XA 4Z6FA 3H92A 2LK4A 3ISPA 2ISOA 3F3XA 4RPXA 3HRMA 1JE8A 4AD9A 4M9JA 4XEFA 3HUGA 4PH5A 3C5GA 4R66A 4WBYA 4H0EA 5E8IA 1XSVA 4AWXB 1W7PA 2YPRA 1L3LA 4XSZF 2M2VA 4KLFA 8ICZA 2IT0A 3LQQA 2Y75A 2VT3A 3OV8A 4IVNA 2DR8A 5CHGA 4RQ7A 1XCBA 3CLOA 4P96A 5FB2A 1IRFA 4UD4A 1J59A 4Q48A 1FSEA 5DV5A 3V4GA 3REOA 4WXHA 4CHUA 5F6FA 3QOPA 8ICIA 5LBQA 3L8IA 4MNUA 4CDGA 5LGNA 3TO6A 3EYIA 3JPNA 5FLXZ 2DPUA 2OBPA 3HRUA 3R6SA 4NKUA 1DPUA 1OKRA 3IKTA 4KLEA 5E1WA 4ETSA 2RQPA 1IF1A 4UBBA 8ICBA 3ZP5A 5DCFA 2AXLA 1KU9A 4HQMA 3FMSA 3TKYA 3C8GB 2PXIA 9ICJA 3LA3A 2HQRA 5D5WB 4QZIA 1O3RA 2KJBA 2ZH7A 1UCRA 4TURA 2W25A 2E7XA 5ILVA 2JTVA 4I02A 3GFJA 3GWZA 3VEPA 4F5OA 3V7SA 1G3TA 3ECOA 4YMMA 2JSCA 1B9MA 2ZHBA 3K9TA 2L54A 3Q5FA 1U6GA 1ZHFA 4I2BA 9ICKA 2P5LC 1IW7F 4UUVA 1QPMA 5F28E 3FF5A 2VC0A 3ZMSA 2ZH3A 2ZFWA 4FT8A 3HOTA 1R7JA 5E8GA 2COMA 5KK1A 2V9VA 1IAWA 1S7AA 3BPXA 4NLNA 1E2XA 4WC5A 3FMRA 5BMZA 2EA2A 4KLGA 2EA4A 2HKOA 4O5KA 4M6YA 2QVOA 2ZKZA 2EK5A 4HAMA 3H38A 5IT3A 1BPBA 3J7AO 8ICRA 5CVIA 3C7JA 1K79A 4RB2C 3MDAA 1TTYA 4MGRA 1P92A 3N4MA 1ONVA 4NLKA 2V1UA 3VB2A 5HLIA 1YTYA 3ZQ7A 4MF2A 3LSTA 2FU4A 1D5VA 5D5UB 2GAUA 4PGHA 1T98A 2MBFA 3FXRA 4Z6EA 1R8AA 5DEQA 2YX4A 1V4AA 5IT9K 3F8MA 4IQWA 2QQ9A 1YO5C 4RWPA 2M2TA 5FFZA 5J2JA 5BPIA 4RQ8A 5J2FA 5HVQC 4Y13A 4LMYA 3V7CA 4LLNA 2MLKA 4LG0B 4EGYA 2ZH8A 3WTSC 3H37A 3WTYC 3AAFA 3GFLA 2OZUA 4AVPA 2EV6A 1TQIA 3GM2A 2FMSA 3H3ZA 1T2KA 4QWQA 2QQAA 4UB3A 5KVRA 2ACJA 4JBAA 3BDDA 2NS0A 3ERED 1YW9A 1F1ZA 4YCXA 1R23A 3Q9SA 4KUMA 5CVRA 5EOZA 2HQNA 2RN7A 4WC2A 1ZQXA 3KZYA 2XGXA 2ZJ2A 4G6QA 3WFRE 3P9IA 2BEOA 1U5TA 9ICTA 4KA4A 7ICSA 3ABUA 2G9WA 4EM0B 1I27A 3PMNA 4KN7X 5D4BA 1MJAA 1J2XA 9ICXA 3JPPA 4I0BA 3T1BA 1GVJA 4RAYA 3L2CA 1FZPB 2EV0A 4MEXF 4RQ0A 2GA1A 2MH2A 2GWRA 5D8KB 2EJRA 1CGPA 3DFGA 3RIRA 2K27A 1YS7A 4MFCA 4NQFA 3QP5A 2V6CA 2Q66A 4WCWA 7ICVA 4QZ9A 1Q78A 3AU6A 2MH9A 4UB5A 1SD6A 2J5OA 3U0CA
chains in the Genus database with same CATH superfamily
3LSHA 4P9FA 1KZHA 5LRRA 1N78A 2VQCA 3N24A 3OR1C 4H4KC 3AG4C 5J2GA 3ABKH 2XSEA 4G9YA 1S9HA 2VKDA 1X1DA 3TJ5A 3O8HA 4DRIB 3TP0A 2OU2A 2XLMA 2XVCA 5DBCA 4FAPB 4XLHA 2HI3A 3S2DJ 3U9JA 4IHYA 2J0WA 1MBGA 3K6BA 1WZ2A 2J9VA 4DO9A 3CZ6A 9ICAA 2DTRA 3BPVA 2IPQX 3ABLH 2R9RB 5T1DB 8ICOA 3FVYA 9ICMA 2XGEA 1OW6A 2O9XA 2LTPA 1R9TJ 1RMVA 1LJ9A 1QZEA 3QPHA 4PGXA 3RKYA 5B5EC 4KLJA 3QOEA 2M4KA 3MN2A 3A01A 1H9GA 1ZN2A 2PMZN 1QU3A 2BBYA 5DBBA 4DVYP 1MW7A 2XV4S 2ZCWA 5DVWA 3BC8A 2DCEA 3D0SA 2ZXWH 3KP7A 1F43A 1Z23A 2HTSA 2BY0A 1RESA 2NXNB 4NNJA 1MMSA 2HKXA 3TW7A 3I59B 2R02A 4GXJA 1VZ0A 1FOXA 1QZXA 2XF6A 2EPLX 3MAJA 1VQMI 1LDJA 3FXQA 3WGIA 1TLHB 3AKZA 3OOUA 1OR7A 3BQZA 2WWYA 3O6BB 4MQ9F 1I3QJ 5DCMA 2G7HA 1LM3B 2P1AA 4LD5A 4WABA 4J7TA 3CF2A 4BAYA 2CS3A 4A3GJ 1RJ9B 1VB5A 2OOCA 3C2KA 4AE4A 1ACIA 4O67A 1FBUA 1HKQA 2WV1A 4BGDA 1VQ6I 1G3SA 3L2WA 1JUMA 2FRHA 1GXPA 1B1BA 4YRVA 5L3VA 2NYXA 2P7CB 1VLTA 3RIPA 1VLSA 3HIFA 2O8KA 2E2HJ 5D6FA 2JQ7A 3FBIB 3IWFA 2W84A 2A07F 1KQ8A 3KLNA 1NBBA 1Z6TA 2HYFA 3G6EI 3PUBA 7ICGA 4P9TA 1OMIA 2LG4A 4IQ4A 3LK9A 3HX0A 4KLOA 1IG7A 5HREA 3NWTA 3G4XA 2GBYA 4YFXF 2DOEA 1RUNA 3IWZA 4RB0A 2IGOA 1JN3A 1K4TA 3T5XA 3F22A 2NAZA 3LEOA 4XJEA 5DLJA 1HUZA 1ON1A 1HUOA 2EFOA 4ITVA 3NWIA 1Z05A 1APLC 1J09A 2F48A 1HMOA 1Q0MA 5FZTA 3V72A 5HRLA 2PBIA 1JGSA 3C2LA 1ETYA 2E36A 1FR0A 1FPQA 3T8RA 3S3NA 3V8KA 1AOYA 1BBHA 3B6CA 8ICAA 2JJ7A 2OV7A 4KIBA 1IN7A 2CJJA 2WC2A 3HC7A 4IG8A 1MQVA 3RI4A 8ICGA 4YT4A 1O57A 3LEVA 3L0IA 2JUCA 3B6AA 5BPCA 1YG2A 5IYCJ 1ZG1A 3ZTMA 4FX4A 2GXGA 4J7YA 1FNNA 4X4TA 2PG4A 2BXYA 2OCEA 1OR2A 2DBBA 3K4KA 3WTWC 1YARO 4MVUA 5EHHA 3EYYA 5KYWA 4HRIA 1J5YA 1WWXA 4IOAF 1FTSA 3FZVA 1BJZA 3RJHA 3U0CA 2RFFA 4PSXA 4RLQA 3F47A 4NLZA 4ZYHA 7ICEA 2JUGA 1CPRA 4U5FE 1JPNA 2WAQN 5TJ5E 9ICLA 2CNWA 4QZGA 4V2FA 4EIYA 1NOMA 2W1OA 4HSRA 3CCLI 4AT7A 4XPYA 4MVQA 1Z9CA 2UXXA 4NC6A 4NXZA 4B44A 3SYNA 4IRIA 2YU3A 1ZQJA 1NU9C 4CO8A 3ASNH 2QUFA 2X6WA 4QTRA 4AU7A 3Q0UA 2L01A 2L9NA 4ON0A 4HOBA 2HMQA 1SC7A 4UXNA 5DM7F 2KK1A 4B43A 2VXZA 4I7HA 4NUBA 4X6AJ 3WU1B 1D8JA 1HA8A 4M3EA 5J1YA 3F8NA 1RKTA 3B71A 3IRQA 4MQVA 2P6SA 5BS6A 9ICPA 4EVIA 4AIKA 3TJ6A 2RNGA 4I99C 3CCVI 1YOVB 1MNEA 1C02A 5LHGA 5DB9A 2GOMA 3G1OA 3PFYA 1QO0D 1FP1D 2EFNA 5ICFA 2DYSH 3RYPA 2W00A 4A3IJ 1MIJA 4NQWB 3J7AY 5HRKA 3RPQA 5EZGA 1IN8A 1TW2A 3KLOA 2CUZA 4HSTA 1PV3A 4QDLA 5GPGB 1IRGA 1I39A 2ZXWC 1V5EA 4Y52J 5DS4A 2VQLA 3AQKA 2OA4A 3HRTA 1YJNI 4ZTJA 3S27A 3H1CA 3U3FA 3UR3C 1X1PA 2RGVA 1O3TA 2KW3C 3MEXA 1XSDA 2X6YA 2ZXIA 4MEYF 4EJWA 3HYIA 4YIIA 4YFKF 1M6TA 4I1OB 2HYJA 4O3MA 3IQ5A 5L0DA 2PX3A 4UVCA 1Y1VJ 2GA2A 3RPUA 2KZVA 3V8JA 4EJTA 4MFDA 4EBJA 1S05A 4IAQA 4FE4A 1JJ6C 4UUTA 3NMKA 1P2FA 2IBFA 3OS2A 4BJ1A 4MLOA 3U1DA 2JX0A 3MWMA 4EJVA 2LREA 4MFEA 2W57A 5L0CA 4UB2A 3Q3SA 3W8HA 3S1RJ 3HRSA 1KYWA 2G3VA 4NM1A 2R3SA 4I0AA 3EGXA 3CSKA 3C3WA 5CJ9A 4BHPA 1B72B 1I5NA 2IAIA 4CS7A 4I2AA 1ZH5A 5BNGA 2K4BA 2L9VA 3FKJA 2Y48A 1HF0A 1S3JA 2MD5A 1BW5A 3LUTB 2A6TA 3AG3H 4OAFA 3MCZA 8ICFA 3HB9A 4Y4RA 5HNFA 9ICHA 3ZQGA 4OAGA 1TV9A 4LDRA 1UETA 4A69C 2LFFA 2P5VA 4CCKA 3CP2A 2P7VB 4F93B 4B47A 2K86A 3W8IA 5JHFA 7ICTA 3NQOA 3M07A 2VPLA 3F8BA 2DA6A 3ZQIA 2OZ6A 2EPOA 1V5FA 2XDVA 5C4XJ 3JPSA 1YS6A 1ODDA 2ETSA 1LUJB 1R5GA 3PNYA 3S15J 2K02A 4U88A 2MWQA 1J7KA 1J8YF 1FYLA 3O2PE 2DJIA 3HTUA 3SXZA 1OU5A 5E17F 3OYGA 2QWWA 3FAJA 3JYHA 4JTAB 2B63J 2RAEA 4CUGA 4AX2A 1N25A 4O6AA 2TRTA 2HXIA 3SFIA 2OCCC 4MNDA 1OCZC 5KYUA 3DLLF 4P55A 2LFDA 4MFFA 4QZ8A 3GEEA 1TWGA 2CW7A 4OAZA 2HGCA 3PSFA 4LB6B 1I4YA 1J9IA 3ZCOA 4QZHA 1GS9A 3BTJA 4L18B 3K66A 4XICA 2ESNA 3HIYA 2KKOA 3DE9A 5A6KA 2HR3A 3E5XA 1VFCA 2L2OA 3S0XA 3M7GA 1O7LA 3CMMA 3N2ZB 4IRGA 3AQNA 1HSJA 1HDPA 4WWCA 1JAFA 3WFQE 4N4WA 1JT6A 4HEA2 2VC9A 1J0RA 3O3KA 1ZJNA 3ASNC 4XQ8A 1IN6A 1V54H 1MD0A 2MG4A 2NUTB 4Z9IA 3FOOA 1P7JA 5A6AA 2VT2A 1D8KA 4FH5A 2ZBKA 1S5LC 3DBRB 1E3OC 2QBYA 5ILSA 5CFTA 2O03A 5J0SA 4QZFA 4PCQA 2KRFA 2WA0A 3L9DA 2ESHA 2LF8A 3H0DA 1Q0DA 2QA4I 3AG1H 1LS4A 2GAFD 5J3LA 5IPAA 3ML6A 2D5VA 1M57C 2JVHA 2KLOA 1U8BA 4BH9A 1ZVZA 3ISDA 1EJ9A 5TISC 1ZHTA 5EK0A 4AT8B 5EEAA 3I4NJ 2IXOA 4W8PA 4I2CA 4RMNA 3LS0A 3BTLA 2CDQA 3S1QJ 2BW3A 1WGWA 3DAGA 2XAUA 2L9RA 9ICUA 2EFWA 4WH5A 2DYSC 1MMGA 5DM6F 1N77A 3K1NA 5CYVA 9ICOA 4U9DA 3HGYA 3PHZA 4HX4A 3BROA 2DA5A 4ULVA 3CUQA 1A6QA 4XWJA 2A68F 1ZGAA 4EP7A 3ERMA 3V8LA 5J2IA 1SMYF 1ZK8A 2M8EA 1Z91A 4I09A 2BVLA 4FQGA 3CCMI 1JAJA 3OOPA 4RM2A 1ZQTA 1K78A 1SVMA 4HDVA 1JMWA 4OMZA 4J32B 3LSIA 1B6AA 5L3GA 1IV6A 5DB6A 5CKTA 1KU7A 4K96A 2J45A 4PZJA 4WXDA 1P9QC 2L6FA 1RPLA 3BG6A 5ICEA 5COMA 5HNHA 1D1CA 3LFKA 3C2GA 3CCQI 2PJRA 1TWCA 1YJ9I 3J80K 4G7HF 3Q0WA 1OCRH 1QZZA 1MBJA 3FMQA 3R7CA 4RQ6A 2W85A 3LNQA 1Z3IX 4K9AA 4LT6A 2A5WA 1VQPI 3JYYA 3HSRA 2BC5A 1YA7O 2DAOA 3RKQA 4PJJA 3M4BA 4YG2F 4C30A 4ER9A 3ULQB 1W36C 4E18A 4X4SA 2V7FA 1C17M 4EEFG 4UY8I 3AG3C 1TNTA 3DWWA 4KICA 1O87A 2GIVA 5DDGA 2B9SA 2LDUA 4UAZA 1Z3XA 3JRMO 5J0UA 2IGKA 5J0QA 5E3OA 2H8AA 4RGXA 1LKXA 4U5CE 4QZDA 3HHHA 2XL4A 5CQGA 4ENNA 2R7ZJ 1IUYA 4YT5A 1ZHWA 1ZQUA 1WH7A 2M4EA 4KNVA 5KHDA 4CYCB 2JPUA 2QNLA 2VOPA 1NHAA 1ZQAA 4RPYA 4IQTA 3VYSB 2DN0A 3F6OA 3FX3A 3DU6A 2E35A 4IHSA 1OJLA 3OY9A 3EUHA 4OAYA 1OKKA 3A11A 3HUGB 2A5YB 3OR2C 5KYXA 4W1UA 1A7VA 5IIIA 3IHUA 2CW8A 3S28A 1VI0A 1PVEA 1RKWA 3GTPJ 1ZQBA 2DLLA 1XD7A 4O6JA 2FAPB 1XG1A 5K1YA 4L9TA 3UXOA 5B3QA 2EZKA 2Z15A 4WQLA 4F5RA 4I01A 2L7KA 5B3SH 1W7PB 3DM9B 5FROA 4XN0A 1SAXA 4XN3A 2PMUA 2XSJC 4AIJA 3RJEA 2KIFA 2VPRA 5EG0A 1EV7A 1R00A 2XAQA 1ZQCA 1A7DA 2FQ4A 3LS1A 2X4HA 1E85A 2L4MA 1OPCA 1JKPC 4UB1A 4DOZA 3TW6A 3U3BA 3C8GD 3V7LA 4QIWN 2IXMA 5IT9Z 4GCVA 3RH6A 1ZQYA 1OCOC 4A2NB 2YU9J 2L3DA 2B7EA 1BI1A 1XGNA 4KT6A 3NYMA 3IPMO 3E6BA 2CQQA 1YQAA 3E6MA 4BJ5A 5DDMA 9ICCA 1NG7A 4DNCA 3O10A 4G7ZF 1W0UA 4ZYEA 4RWOA 1MBKA 2N8GA 3DPTA 3KEOA 2DDAA 5IYBJ 3GTGJ 3GTMJ 5CR0A 1JRAA 3AG1C 3K4LA 4HQEA 1MIYA 3PIOF 2STTA 3SHFA 4FHXA 4BKXA 4LVSA 3MGIA 3V42A 2ZH1A 1ETVA 2QY9A 1KYZA 1XS9A 4M74A 2PX0A 3RYLA 4HF0A 2IA0A 4KLDA 5BOMA 2M45A 4HEAJ 1AHDP 3FISA 4BEHB 3GF2A 3KP5A 4ESFA 5J0OA 2R7DA 5J6XA 4HV5A 5FLMJ 4N4NB 1KGSA 3T9OA 1SD5A 1F5TA 4Y17A 3GX4X 1BPXA 4LLGF 2BL2A 3BTCA 3TQNA 3CCJI 4X4VA 2XAJA 1G8XA 3OYCA 1GDTA 3CF5F 1ZQGA 4Q7CA 4UD5A 4NC7A 4HNUA 2HZDA 3TFSA 3A03A 1VNDA 2KJCA 3IP4B 3U9GA 3WAQA 2XKPA 4BPMA 3ZDLA 9ICQA 4BS9A 4E7KA 3N97A 4RWNA 5GPCA 2J8WA 4K7BA 2L7FP 4EGZA 2OQRA 2NS8A 3WFSC 8ICMA 4EATA 1H88C 2LH9A 2ISZA 1ZQDA 8ICYA 4ATBB 3QYFA 5DBAA 4PPXA 4ZJZA 1OCRC 5J2CA 9ICGA 3A4CA 3E6DA 5EF6A 3UNGC 3OSGA 1KQ9A 3E3VA 2R7FA 3NYJA 4E7LA 2GXBA 4JIOA 4HX7A 4Z9JA 1FY7A 5IOZA 4FTHA 1YLQA 2WTEA 9ICBA 3W3CA 4G78A 1ZQEA 3DQVC 2WZGA 2ISPA 3MMYB 3G71I 2JVGA 1ZW2A 1R58A 1FP2A 3AQLA 4PFPA 1A35A 3U8PA 1XSPA 3FXLA 4LIVA 3L7WA 1FTTA 3FHDA 1T6QA 1Y0NA 1T6SA 4X4OA 2NS7A 1N1CA 3M79A 1S7OA 3JCFA 1TFWA 8ICXA 3DTKA 2CV0A 4E8FA 5BOLA 1KA8A 2DMNA 1JQRA 4WQKA 4HW0A 1R1VA 4RAGA 2CV2A 4N9HA 2HWVA 1FEXA 1DU6A 5CB1A 1BW6A 4IZZA 8ICQA 5C44J 3RH4A 3KFWX 2KDOA 2MYSA 4JX4A 3C62A 5AIQA 4JKVA 2OTJI 5E1ZB 2BV6A 1T0FC 2H8WA 2FGYA 3RDIA 4J00A 5EGOA 2W4BA 4ZTFA 3MQ0A 2CWEA 2HTJA 4DQ2A 4E0HA 3WE3A 1AKHB 1U8RA 3CCEI 4UHTA 1U89A 4UV8A 1B4AA 3JRDA 1R1UA 4XA5A 1NG6A 4WC3A 1LFPA 5IILA 4M73A 3QTHA 1FOYA 3A9CA 2BPCA 2BCQA 1LNWA 2FE3A 1JR8A 4HZFA 1SFUA 2JRTA 4CGZA 2KRHA 4WK8F 2X1DA 2PFDA 5E3AA 4E17A 5B3SC 4GFBA 9ICNA 1FOKA 2LRDA 2Q9CA 2DMUA 2HFIA 1B68A 4NY8A 2TCTA 1FOWA 2L7MP 2V1XA 3SEQA 4XBFA 3DKYA 5J2EA 2Q9AA 3OUYA 4P2HA 2JMWA 2IJLA 2FUG2 5CVUA 3RKWA 4XQFA 3V7KA 3WTUC 3ZVRA 3F72A 2ZO4A 1SEUA 4ZLDA 4X0AA 1B9NA 3IH4A 3VAYA 4A5MA 2E2IJ 2DMQA 2ZD9A 4K9BA 2Z33A 5D5VB 4HFFB 1OCCH 4M71A 3V7RA 2X48A 4CS9C 4P4OA 1Q1HA 3LSRA 3AG4H 4OAHA 5LGTA 1R89A 3F6VA 4DBRA 1ZKGA 4X1EA 1E84A 4M2YA 3EG9A 1EQ1A 2VQGA 1MDMA 1VK5A 3DLAA 2LFBA 3HPGA 3KZZA 3ECSA 5A2QK 2F22A 2KPMA 1UAAA 3ISCA 3I4MJ 4M6XA 3F46A 2BHYA 4ZYDA 7ICLA 2K4JA 1PX5A 3I5UA 3TULA 1E17A 4GRIA 5ERIA 2WZFA 3L8JA 5IYDJ 1RNLA 1ZQQA 3KZIC 2JA8J 1GVDA 3HM5A 3ZQFA 4FESA 3BY6A 5J0WA 1G4US 4LB5A 3WFOA 2ECBA 2Y3DA 2OJED 2YHSA 3ZR8X 2YQYA 3FWEA 4E0IA 4IO9F 2IXNA 4RQ4A 1WOLA 1R71A 4BDYA 4IQVA 4F5PA 3H36A 2E5NA 2QZ8A 2I8BA 2KHMA 1W4MA 3RJIA 3CO6C 4CXFA 1RKCA 2W9MA 1XMAA 1X3ZB 7ICMA 2XRNA 4DYCA 2DU9A 4EJUA 1EH7A 2CQXA 5LLQA 2DXIA 3L1MA 4BE1A 2XAHA 2VBYA 3B02A 4L5IA 4GQHA 4KMUX 4ASNA 2Y2ZA 1FYKA 1MJBA 1YVIA 1WH5A 2E1NA 3HXLA 3AQCA 5J0TA 2QQ8A 2ZSHB 4A3BJ 3GBGA 3F8FA 3HL2A 1XSXA 3DTIA 2KC3A 1BPZA 5HR9A 3CDHA 2D1HA 2VUMJ 3IH2A 2WZLA 2WV0A 2UWMA 3S84A 1G6NA 3G4ZA 2L81A 3Q6NA 4EM2A 2X0LA 3M1CB 4IB4A 2M0CA 5J47A 4EEDA 1K05A 5IIJA 2PFOA 1T01A 5HRDA 4YWQA 4CA0A 2ZH4A 1U5TC 1ZAOA 2KFDA 3DZAA 2DT6A 5K5QA 2IOQA 2M3AA 2K3FA 5LFAA 1V74B 2R5ZB 1RKEA 3MLGA 3JPQA 5HDGA 4YIFA 2VH3A 2YLIA 4ESBA 3QU3A 3X1OA 4I2EA 4RGUA 2NRKA 2JSPA 3SZTA 3ESWB 4YL3A 4M3GA 4P4PA 2PFPA 4AUXA 2LP0A 1Y6IA 5FKLA 1DP7P 4OD5A 1FTZA 5EGYA 3JTGA 1P7IA 3N0TA 1TFYA 5D4SA 1OR3A 2Z9OA 2EIJC 3PQJA 3T8TA 2DA1A 3TOBA 4Y15A 4A93J 1EF4A 1TWFJ 2YVKA 4WGYA 4D4NA 2BY2A 1XPXA 4TUPA 3CC2I 1S6LA 2L6HA 1A41A 2E1MC 1GV5A 1EKYA 2CW0F 3PNVA 3ASOH 3VWBA 3CCRI 3E97A 2VE9A 1FYMA 3GZ6A 3RQEA 3H5AA 2CQNA 2COBA 1ZQOA 4UBCA 5HC9A 5F27A 1S7ZA 1OFCX 1YA9A 2XAFA 1U5TB 3LSPA 3QYBA 2ME6A 1VF9A 4G7OF 3NG1A 3BR1A 2DB4A 4O68A 3SFZA 2B51A 3KP4A 3HZJA 3AG2H 3LWFA 4CCOA 2BOLA 1A7EA 2XLOA 4CIHA 2CYYA 5CI8A 2IUBA 3MKYB 2A6EF 4PJMA 5JHUA 2L6GA 2QE9A 2CH0A 1CQTA 2LSOA 2DA3A 1WTYA 1FX7A 3CESA 4IRUA 2ELHA 3E6CC 5CWRA 3K4CA 2A0BA 4P9UA 2YL3A 4LZDA 3OSFA 5DDYA 4QZBA 1O3SA 3OV7A 4DBQA 3L2UA 3ITFA 1GM5A 4E7HA 1DDNA 1O7FA 1OYWA 2Z3YA 5JLIA 2E1MB 2BPFA 4MHGA 1TR2A 3F21A 2JK3A 3COAC 1LFBA 3U2MA 1LPEA 2VC1A 5KYYB 2AS5F 4I2JA 3WFPA 2FOWA 3EUKL 3QVZA 3AFHA 2F5CA 1JXSA 1WPKA 2HQ5A 1UEVA 2P81A 5IIKA 5HSWA 1O4XA 2YL0A 1D0YA 1Q1VA 1WCMJ 4BY7J 4CJOA 1ZZPA 2J7PD 3HNJA 1PP7U 1QRYA 2DOFA 2LQGA 3AOUA 1KTMA 5IIOA 2EFPA 4HLYA 1L3PA 1A5JA 1FAPB 4ONSA 4ENMA 2KYHA 4KISA 3TD7A 1BPDA 4HF1A 3CEXA 3LSKA 2ZH5A 4HNVA 3EGDB 2KSFA 1LEAA 2RQQA 1IRZA 4X4QA 5ILUA 4L0YB 4D9JA 3ZOBA 2BPGA 2A61A 2G0EA 2K85A 3A1YA 5F1JA 3RH5A 5JUAA 3L9FA 3VSKA 3I4PA 3JTHA 1Q0KA 2BHZA 1HY5A 3HNIA 4MFAA 1BC7C 1OR7C 3P7NA 3MFKA 3IUOA 4KYWA 3QMKA 1ZJMA 5CFSA 3K2ZA 1WGXA 2HJ3A 3LESA 3FDYA 2R7QA 3ZN1A 1T33A 2K7LA 2L4AA 5K7FA 2PBEA 1QBJA 1IV8A 2DT7B 2KZGA 3U1KA 4R79A 3ZRGA 1BJAA 3GYHX 4U7DA 2Z5UA 1PUFA 5JSLA 5JT4A 2EZLA 3HGGA 5COGA 1O3QA 5B1BC 1WOTA 5HHIA 4F5NA 2ELJA 2CUJA 4D7NA 3CC4I 1NSGB 5JS5A 1MGTA 4QI2A 3JPOA 4K99A 4L6RA 3EF2A 4XUSA 5LGUA 2PFNA 3MZYA 2VE8A 2CFOA 1WJEA 4M72A 4GEHA 3ABTA 3IKVA 5L3FA 1KU2A 1TT5B 1VYKA 2RD9A 3ZG1A 4XRSA 4CIPA 5F1RA 2V6EA 4JE9A 4IL6C 2DJNA 4B8XA 1WJCA 3K75D 3TL4X 2JPBA 4WC4A 1G3WA 2CO5A 4WBZA 4K98A 1GXQA 4CH7A 4MTGA 2CV1A 2PJPA 2FMPA 1HE9A 2KRCA 5DS6A 1K4SA 3DI5A 1X3WB 4DZPA 4II2A 5DCMB 1T5OA 1E83A 3DTEA 3K10A 3NKEA 4A0XA 3GCMA 2MC3A 4BDZA 2XM0A 4U5GA 1TWHJ 1F4KA 1ZTRA 1DUXC 4U0YA 1OW8A 1ENHA 4O5CA 4HLXA 4HV6A 1RIOH 3ASOC 4XRHA 1K6YA 4DRJB 2Z99A 4I76A 2WAEA 8ICKA 4OIQF 1M2VB 1X4OA 4N0BA 4X4UA 3ZMTA 1SFXA 3K4BA 1W0TA 2VXDA 2G3KA 2O61A 4X0BA 2VKVA 2RREA 4AVZA 4P4MA 5HLTA 2R7SA 4IF4A 9ICEA 3BT9A 3M4OJ 4XRFA 8ICJA 5HLHA 4CDVA 2H6BA 3HOSA 4I1MA 3T6GB 3ELKA 3VYUB 3WE2A 4YL1A 2OCCH 2HN2A 3TGNA 1OCZH 3HTSB 4EBKA 2P0NA 5L3EA 1YYJA 5E3LA 3ATPA 3WFRE 3KX2A 3GVAA 1I50J 3AG2C 3SXMA 3LSJA 5GPAA 5IIMA 1A04A 1ZQ3P 4KJZA 2IXPA 1DP3A 4HA8A 2PLYA 3UGPA 4D5CA 1H6GA 1Y1WJ 3UQ2A 1X58A 2I5UA 3I64A 2O6GE 3W6JB 1X4PA 5GAHJ 2IP2A 2VBZA 4M3FA 2FBHA 3JSPA 3QW1A 4CDYA 4N4OB 4RLFA 3FM3A 4ZZDA 4KC9A 2FNAA 4O6NA 2J5PA 3HOWJ 3SEZA 2MW8A 4XRSG 4KNWA 4EBBA 2FBKA 3C18A 2EZHA 4XMYA 2PMHA 2HU9A 4ANJA 4K4HA 3S3OA 3VOEA 2NNYA 3KEYA 2YLDA 3DKAA 3W2VA 2P8TA 4WX9A 2WVOA 3ZSUA 3UXNA 3BRJA 5KYWB 1ORJA 5C4JJ 2GQQA 4KT5C 4KLMA 1QQIA 1V55H 1HC8A 2BY3A 4DZJA 3PO3J 4IJJA 5L0GA 3HJ1A 4WC0A 4P5OA 4PACA 2HS5A 1ETOA 1FFHA 1M2OA 1NFNA 3AQBA 1T95A 1R8CA 4O9MA 4S3NA 3R61A 4BACA 1IZMA 1EI7A 2DA7A 1MJ9A 2XXAB 4FHWA 3GDXA 1BI0A 3DEUA 4AYBA 2BCRA 4QZAA 1ZG3A 4WC6A 3HSEA 3H2UA 3WHBA 3GLLA 3H5NA 4YELA 4BG0A 4AT7B 2NG1A 3PNTA 4CYDA 1EH8A 4BBSJ 4EJOA 5AIPA 4XLPF 4LDKA 1HE1A 2LKPA 4JCZA 4U5BE 5CIVA 2DODA 1H0MA 3JRTA 2LBFA 2FX0A 4BBRJ 4ENJA 2RSEB 3V7JA 4S04A 4IHXA 4YN4A 2Y3BA 3T6BA 4FHYA 4CCJA 3ZQYA 2Q2EA 4CCLA 1CF7A 3BR6A 3HPHA 4I29A 3RQ4A 2FF4A 4NB5A 5LEKA 3EFOA 4MS2A 2HOEA 4F52A 4ZYGA 4WCGA 3HJCA 3SXYA 3RZOJ 2KIMA 3JW4A 4GYGA 4A6DA 4YL0A 2X51A 1ZLKA 3PSIA 4AT9A 4M47A 5J2AA 2Q00A 5FKMA 5A6BD 2FNPA 1NK2P 1MIWA 4IPAA 2BVMA 2NUPA 3BG3A 2XC7A 4TUSA 4GGGA 3J80Z 4PHEA 8ICSA 1UELB 2DI3A 1QSPA 2O0YA 5K0IA 2H7OA 1CGOA 4JX5A 4PJ0C 4F5QA 3JRFA 2DK8A 3X2QC 1GV2A 3R0AA 3GUDA 3HW8A 1MH4A 2FSWA 2R0QC 4LACB 3UKGA 4JTDB 2DMPA 3NWSA 1R1TA 2Y0SA 2AVKA 2XS8A 3S29A 3ECHA 4B48A 4E7JA 2HV7A 2HPMA 5HRFA 3G1LA 2DR5A 2V26A 2PQ8A 3WTVC 1DPRA 1JJ8C 4NCQA 1Y6DA 4BE0A 1BC8C 1FWZA 1UEUA 5C3EJ 3U21A 3GWLA 1Q79A 3AJMA 1BBYA 3K0LA 3MD2A 1Z7UA 1R4NB 1HKSA 3KYCB 3NRVA 4F7ZA 5J8FA 2HHPA 2M2WA 1V3FA 2Y9YA 1Y56A 3HKKA 1FMWA 1D0XA 5FGMA 1JMSA 1X1AA 4LLEA 4M63A 4E7SA 4XSXF 1XB4A 256BA 1FBSA 5KAIC 3VODA 3MYFA 4CZCA 3SJMA 4X4RA 2PFQA 3H9GA 2IRFG 3T0YA 3EGXB 5J4YA 4F5OA 3DPUA 4DOAA 3OYEA 2HDWA 1SYQA 4A0YA 2QM3A 2H8RA 4GXIA 1UHWA 1R5HA 2MC4A 3D5LA 5EZHA 3M8JA 5J0YA 3B29A 2BCVA 2V4JC 2WL8A 4N9IA 2CQ7A 3H9QA 4ZDOA 1X1CA 2YZSA 2FD5A 3EZIA 2KIUA 3PL8A 1F36A 4UAWA 1PP8F 3SZPA 3WGGA 3LAPA 2PNOA 1WRJA 5M5XJ 3HKZA 3WHNA 3DE8A 4OU0A 4RQ5A 1USSA 2OJQA 3OGUA 9ICWA 3LNMB 1UFMA 2IA1A 3QPTA 4JP0A 4ZZLA 4MW8A 2BCSA 3RW0A 3IC7A 2M30A 2M9HA 4M3BA 9ICRA 3FK7A 3PFIA 4NBQA 2LD6A 5T3WA 4HF2A 4HFKB 1Y0UA 4M9NA 3E5UA 3DXJF 2ZJQF 2P4WA 4D7MA 4IJAA 1YI2I 2X6OA 2VBXA 3HEFA 1OCOH 1VQKI 2R5YA 4EWCA 1TW3A 4MTEA 5KYUB 5L3CA 7ICRA 1XDSA 1YYVA 2OQGA 3S2WA 2LMDA 4OIRF 4IHTA 4UNOA 4FCYA 2JA7J 2K9NA 1JTXA 5D5XB 4E4HA 1LE4A 4C3DA 5J0RA 2YR2A 3G73A 1JI8A 2OPTA 1ZLJA 3ISBA 3RJJA 3S93A 1WI3A 3U2LA 1AA7A 3PQKA 2IA2A 4B1RA 2GWSA 2GA9D 3DEEA 2RDPA 5DD4A 3MBGA 4YMNA 5D49A 2E19A 3A2KA 2BXZA 3K4NA 5BOXA 3NRHA 2VJ4A 4N7RA 1YW7A 1UB9A 4Z6CA 3NDBB 2ZMEA 4R64A 4M9HA 7ICJA 4DIQA 3E7LA 3GTOJ 4A3EJ 2XLWA 7ICOA 2NOJB 3M4CA 2R7OA 3OYAA 1AEPA 3WG9A 3DD7A 2CYDA 2D2WA 5BQGA 1V5GA 1VQOI 1K83J 3QYEA 2OF7A 3OIQA 1S72I 2KNHA 2PX9A 2QBYB 4HE8D 1WI9A 3PIPF 4NTBA 3K1MA 3BR2A 4I2DA 4EMSA 3OS0A 5F0HA 2K3PA 2HDCA 1JHHA 1XWJA 1Z1DA 1C0WA 3R2PA 4EV0A 2DGJA 2JN6A 3ZXSA 3CP8A 2BBJA 2OC6A 2ID6A 1YITI 4MIMA 2DDBA 2EV5A 4Q4ZF 3ZC4A 1VMAA 3EDPA 1MMNA 5J40A 4DJAA 5KAFC 4PJNA 1YJWI 3I0TA 2GM4A 1ZQSA 8ICTA 2VODA 3K4MA 1OQCA 2XL8A 1HXDA 2QKLB 2M0MA 5J8CA 2BW3B 4JK1X 4MW3A 4CDAA 4NC8A 4J30B 4RS8A 4ZDPA 2F5EA 5B3PA 1ETQA 1HBXG 2H1KA 3PMLA 5E3NA 2RV8A 3CUQB 4A3LJ 2TDXA 3BJOA 2ZJPF 1ZQIA 2QENA 4C2MJ 2H09A 2Y0SN 1IDZA 2FXAA 2GAQA 1EA3A 4MTFA 4AK9A 3PNCA 3OS1A 1ZQHA 1JUPA 4JWNA 3C63A 1F5AA 2XHKA 3G4SI 2I8DA 5LHIA 1QHHD 4IHWA 2E87A 5TGTA 4M3DA 4LDQA 3CAXA 1ON2A 3K33A 2CGPA 1IN4A 1YHQI 3JRBA 3DBLB 3GFIA 4OIPF 2HYGD 3RYRA 1LI5A 3JSOA 3LJBA 3P9KA 5GTHC 4CYCA 1IXCA 1TL8A 5J1RA 2PJRB 3EUHC 2IBDA 4QPOA 4M9XA 4ZH4F 1JTYA 2HDDA 1DOWA 4XLCA 4PSWA 3GANA 3WG7C 2V1NA 5K7HA 1R6RA 1W7PD 4XLNF 4F91B 4YK5A 3WTZA 1J8MF 2DR7A 1W36D 1X19A 2QCOA 5AONA 2EBIA 1WSUA 2DRAA 8ICVA 1IDYA 3S16J 2BE3A 3E5QA 3RKXA 4MVOA 2D45A 1REPC 4IXAA 1SFKA 3V5ZA 2WB7A 3FAPB 3JAMK 2W45A 1KQ0A 3GM3A 1UFBA 1FJLA 4JVSA 1ZU5A 5HOOA 4RQ3A 4DRHB 5CHEA 1IRXA 2Y31A 2ETHA 3K1IA 1DQUA 3F23A 5HLGA 4YMOA 3GFMA 4EEBA 3MCRA 1UHSA 4RPZA 3OIPA 1DGWY 2Y0MA 2V79A 2VCCA 3AGTA 1BI3A 3OYKA 1HQCA 2Z2SB 1A36A 3L09A 3M9AA 3GEHA 4XQ7A 5KYNA 2DYRC 1JHFA 3EHNA 1C03A 1BOBA 4BJ5C 3BQYA 2EIMC 3KYIA 3Q6MA 3U5SA 5IY5C 5D46A 1ZREA 3J81Z 1J75A 1AWCA 3ROUA 3S8PA 3HOXJ 5A6JA 2J9WA 3ER9B 4O5VA 2K40A 1MH3A 5FKKA 4O69A 2ZJRF 3FK6A 3ZQCA 5KNLA 2GOXB 2I9GA 4FASD 2F4OB 2M5WA 4OMYA 4HX0A 8ICUA 1XGOA 5A2QZ 1VQ5I 1O3UA 1Z5ZA 1PYVA 3C8GA 2HZTA 3HDDA 2XF7A 2DT5A 3JZ0A 1BA5A 5JR3A 4LZGA 1KU3A 3TOMA 2XLVA 1YIOA 2FQ3A 3G3ZA 5M5YJ 4OD4A 2OKUA 3B0UX 2W4SA 2HXOA 4LIUA 5EG0B 4RM3A 2R7XA 1B8IA 5T3TA 4EV6A 3LAYA 5J2BA 4RQ2A 2EILC 5F2VO 3LL7A 1BZ4A 1R4MB 5L0IA 3NYLA 3AUOA 2VIXA 5FD6A 3M1EA 4GXOA 1TKNA 1XSLA 4AIHA 3O8GA 5JLXA 1K6OA 1HDDC 3HNLA 5D6EA 1T08B 2EFQA 2Q7RA 2ZNZA 1IN5A 3IRRA 2UZKA 2Y3GA 1ZRDA 4UB4A 4G8XA 4IQJA 2X6XA 1ZELA 3DKWA 3GZ5A 2LKXA 1BR1A 3SXKA 2MA3A 1D1BA 4UUSA 2K9QA 1XDUA 3M8FA 1T38A 4KMFA 2DOAA 2KL4A 2YWAA 1A6IA 3UMIA 4WC1A 3DJNB 1VTNC 1PCXA 5K5OA 2P6TA 5CP2A 1NK3P 3H3AA 5DS9A 1S7EA 3LFUA 4KN4X 3A0BC 2MD0A 3EJNA 4ATBA 1TBXA 1ZQRA 2XIGA 2AP3A 3WU0A 3OYBA 1B59A 5CVVA 2A0UA 5HDNA 5D8LB 2NVXJ 2R7UA 5AC4A 4K1OA 3D5SC 5IOYA 4PGGA 1A31A 2M34A 3U2RA 4A6EA 4EM1A 3R60A 1YRNB 4E80A 3FHZA 1QQ3A 1T6IA 5LEJA 5CPRB 2IW5A 2LR8A 1FA0A 3Q0VA 2O8XA 2IM8A 5JVGF 3J06A 2Q3TA 4WC7A 3TFRA 2VOOA 1HW1A 2BCUA 4A3FJ 3NYBA 3DKXA 3ERCC 3C2MA 3QW0A 3ZTZA 1QZYA 2CUFA 3NKDA 1RC9A 1FIAA 3UPSA 2PFBA 4TUQA 2IHMA 2JPCA 7ICNA 3TO9A 2JRMA 3OL3A 4RT2A 2J9UA 1IC8A 2EIJH 3LA7A 2JA2A 3K1PA 1WN0A 2KISA 3JSEO 3PO2J 3RJPA 3DWLE 4EQQA 1PUEE 2YL1A 1XN7A 2BE5F 1P4AA 4A0ZA 3S3MA 4O5EA 3FXUA 3KP6A 4KIGA 5CI9A 3UXPA 4D1QA 3JPRA 2L7ZA 2EPKX 1I1SA 1D1AA 1I6XA 3V5XA 7ICPA 1R4TA 4V19K 3TOLA 2C6YA 4C7OA 4DOCA 1IUFA 1L0OC 2EIKH 3NEUA 4JURI 5BUOA 1M1EB 3HJ4A 1BN5A 4BQAA 2K9MA 3ZMUA 1OW7A 3P5JA 1SMTA 4BQQA 2FEZA 4NM2A 1BIBA 2QF7A 2E71A 3IQTA 5CFUA 2VLAA 3WODF 4PGYA 7ICHA 3LQRA 3EPVA 3K1HA 4RGRA 3OA1A 2YX7A 2LLKA 3LA2A 2PI0A 2R7TA 3W4YA 4BNCA 4KBLA 5DUIA 1L7CA 3KYDB 4F4BA 3UMHA 3UQ0A 5DEDA 3CJTB 1R5ID 4FHTA 3WU2C 5IP9J 4Q47A 1VOMA 1S8NA 1Z21A 4Z2YA 8ICWA 2DFIA 1RI7A 2VCAA 4X0GA 3CQZJ 1SD6A 2HN1A 4CS8C 2W24A 2XSDC 1UJ8A 5FD5A 1EH6A 3KETA 2A3SA 2B4VA 1QPIA 4PHDA 2CCYA 5EGOB 3HNKA 4JCHA 3VRCA 1F9NA 4M9SA 4XLAA 4BEJA 5BQTA 1NO5A 1HLVA 3KP2A 3J81K 3RQFA 4O6MA 1T0FA 1P6RA 2IVMA 3H2VA 3RJGA 4A3JJ 1P4WA 3B0YA 3JPTA 5D4RA 3GWNA 4JOMA 1U9NA 1YW8A 2XASA 3MGHA 3I58A 1XMKA 3PUFA 1SD7A 5HS7A 1FSHA 2H7BA 3QRFF 3OVSA 4KFCA 1MBFA 5FFXA 1E3PA 2DW4A 3KL4A 4HNTA 3RCOA 3OUYB 3GMEA 5LHHA 2QTVA 3FXMA 4YD2A 1OCPA 4UVBA 4LG0A 5FLXK 2M2UA 1USTA 3G50A 2D1VA 3H5RA 2LSEA 1QVXA 2J9BA 3GODA 3DCFA 3MKLA 3I71A 2LYCA 2OUMA 4E70A 2D5RB 4KLUA 4FO6A 1Z77A 5HS8A 1OXKA 2XROA 1ZYRF 1MIVA 4FHPA 2DR9A 2LK2A 1Y39A 2ZXJA 3QP6A 3ZPLA 4CX9A 4CS9A 4PHAA 2ASRA 3EG9B 1GUUA 4BUPA 1MDMB 1EKEA 5H2FC 3K2AA 1TWAA 2ELKA 1NZEA 4A2UA 3JRCA 2FMLA 4I2HA 2Q9BA 2ME0A 4AIDA 3ABMC 4P6IC 1U6HA 4GDFA 4YT2A 4KB6A 1UG2A 2R93J 2AWYA 1ETWA 2BYVE 3LMMA 2LIGA 5E18F 2A69F 4CICA 1GPJA 2F2EA 1VQ7I 4FX0A 1X2NA 5B1BH 5F64A 2EH3A 1U0BB 1VJ7A 3CCSI 3HHGA 5E3MA 4MVMA 2OEVA 1MBEA 3FIWA 4IKFA 1LFUP 2PEXA 2L02A 3N05A 4BHBA 2V1DA 1BM9A 1I1GA 5E33A 3FOPA 1KEJA 5L3DA 3VDXA 1P4XA 1SVOA 1AVOB 3RH3A 1W5TA 5L0FA 3QVYA 2P61A 2QGUA 1CGNA 5FO5A 5M3MJ 2RC4A 5TJJA 3KPHA 4I2GA 2VJJA 5H20A 4BYYA 1ZGJA 1NU7D 1ZARA 2H6CA 3TDZC 1IXSB 8ICPA 3TOAA 2UUZA 1ZHYA 1LE8A 1ZQMA 2HQAA 5KCMA 4JEBA 4L9JA 3T4RA 2O7OA 1FLIA 3JT1A 2GIZA 3MVPA 4L0ZB 1TNSA 1WJBA 3L2RA 3RQGA 1VFGA 1D3YA 2BGCA 3OMYA 4RBNA 1T39A 2RVCA 4L9NA 1HW2A 1R8BA 5DB7A 4IRHA 5D63A 3BTIA 2FA5A 3DP7A 1GT0C 2A1DD 2MHRA 4CBEA 2DRBA 1WKMA 1ST6A 2HZ8A 4KDPA 4Q5SF 3C66A 2F4MB 1W1WE 5GAEJ 2H7VC 1JT0A 3JR9A 5D91A 1HCRA 1NLXA 2P66A 3S14J 1RKEB 2VKHA 2CSOA 4KI2A 2DR8A 2EIKC 3MDCA 2V3CC 3E1SA 3H3UA 5DYMA 4HX8A 4CCNA 3FBNB 3AL0B 4C9YA 2E34A 1SR2A 1TFOB 3AGUA 3HTKC 1MKMA 1ZQZA 4LEZA 3BR0A 4LK1F 9ICFA 4CSAA 1RUOA 3VFZA 2CG4A 2WVQA 2W4MA 4XOPA 1LDKB 4BJ6A 2VQHA 5EEGA 3W6KB 3OYHA 1LB2A 3C1DA 4E7XA 2EPMX 4MTOA 3OYFA 4A12A 3W2WA 4XEKA 1X1BA 1IXRC 2Q8KA 3M8EA 3L2QA 1LPQA 2DA4A 4AL0A 4DJ9A 4A3KJ 4I2IA 2MSYA 3K4JA 4P1WA 2KIQA 2R7RA 4MKPA 4K4GA 2ZNYA 3H3VK 2VBWA 4OOIA 5JI6A 2C04A 1SAUA 5EYRA 5LRSA 3T6JA 5A69A 2LNBA 4OINF 3MKZA 2QSHX 3RKOF 4K8VA 1V4RA 3RSNA 4GO1A 1ULYA 2HOTA 2I10A 2PF4E 4JRZA 5H6QA 2HKVA 3NKUA 4UDVA 5L0JA 1GHCA 2M87A 2CQKA 2HVSA 3R4KA 1I6HJ 1ERDA 2M8GX 2P6VA 1VYIA 2XGDA 2ECCA 3H0GJ 1PJRA 1RR8C 2WAQA 4R32A 1BPYA 2O5RA 5JFRA 2LF7A 3H35A 2B0JA 3BZ6A 2M1BA 4RWQA 4D0PA 8ICHA 3K6GA 2X9DA 4RGSA 2MLGA 1BOAA 2ZFUA 2LY1A 3I54A 1G2HA 2UUIA 4XEVA 3MKWB 5HRBA 1TQPA 4KLSA 3C5FA 3DF8A 4R63A 1O5HA 5FRMA 2J7PA 1YLFA 1TP4A 3TDUC 5HHHA 2EB7A 4RAZA 3ZMZA 1VQ8I 3W6VA 3PHF2 2R25A 4RDUA 1ZR4A 3QAHA 4XLFA 4C2TA 5DB8A 1ZQNA 3I59A 3G2BA 5F08A 2DVIA 1YYXA 4BXFA 3BCBA 1K7AA 2DQLA 4LEYA 7ICKA 4R1HA 1SANA 4ZC3A 4BHCA 4MF8A 2PN6A 4W97A 3DV8A 4U0WA 1R36A 4DYQA 3L1PA 1OQYA 1RJ9A 2HSQA 5JRAA 4OAIZ 1Q0GA 5FJ8J 2EWRA 3OVBA 1UG7A 2M64A 1FBQA 1Z7LA 5GP9A 7ICUA 3SYTA 2QLZA 4C2UA 3FM5A 3OYIA 4BL0B 1ZGWA 3A01B 3RJKA 4MO7A 4XOTA 2AWCA 2XAGA 5B1AH 3HBLA 1MQ3A 3GXOA 1JKRC 3EUAA 3M3YJ 4I3MA 2ZHAA 4KNYA 3X2QH 4U87A 5J29A 2KT0A 3JREA 3UMKA 2QQBA 3TP3A 1I5ZA 4ENKA 2RKHA 3BJAA 1AU7A 3AU2A 4AC0A 1TWHA 5GTIC 1U78A 2XRHA 4UV9A 4XNFA 3S32A 1ETKA 1APCA 1I4ZA 1SFOJ 3H39A 4PDKA 4XR6A 4R65A 4GYIA 2HPIA 5EEHA 3C2BA 2VANA 3ZGKA 3WTXC 4FHVA 1PUFB 4PHPA 2FMQA 3VPRA 1EA8A 5HRIA 4AE4B 2LC2A 2B0HA 2WADA 2GZWA 3O55A 2Z16A 4LFUA 2Q0OA 2NOGA 3TO7A 2FFHA 3RQIA 3I53A 3EZHA 1MZBA 2CFXA 3BR3A 5ICGA 3NAUA 3HOVJ 1M2VA 4PFOA 2XF5A 3LOCA 4Z9HA 8ICEA 2UXNA 3OL4A 3FHNA 3KIOA 3G1MA 1H9TA 2YRFA 1JOGA 1ZQKA 3J7ZI 4X4PA 2FBIA 2H94A 3H9JA 9ICVA 3MZHA 1MNDA 2WAFA 2LD5A 1G59A 3PJRA 5H6RA 3IQ6A 3NMJA 2XLEA 3D1NI 1LS1A 1XCVA 3KP3A 5DUKA 4WF2A 2JA5J 5HV9A 4LLLA 1E3HA 2JT1A 3M15A 5D62A 4YN0B 1ZQWA 1ZRFA 3KE2A 5CJ7A 1RZ4A 2ZB9A 4L5JA 2HSBA 4MVRA 5DS5A 2XGCA 4RT3A 4I2FA 1NG1A 4KIFA 4FH3A 2WY7Q 1Y8RB 5CVJA 1LQ1A 4FX5A 1ZQFA 2I15A 2VJ5A 2D4UA 3MBYA 4RB3C 1SF8A 2KMUA 2IS1A 4LK0F 3FKIJ 3K7AJ 9ICIA 2LKSA 3SZGA 4DOBA 5CA7A 4QZEA 4WXCA 2XLHA 2GFHA 4U5DE 2ZH2A 5IP7J 4JX6A 1WWPA 3P9CA 5J2HA 2VN2A 3QPSA 1ZRCA 1KNYA 3EQLF 1W5SA 2FMYA 4KLLA 1E86A 1ZQPA 2G7UA 3CJQB 5DTDA 5IINA 1RPWA 2IGMA 2CNWD 3EH1A 4HPQA 1V55C 5JTGA 4UB8C 5L3BA 5K5RA 2NSFA 3IQCA 3W2AA 2K9LA 5L3QA 4NKTA 5F0CA 4KLQA 1SFEA 3I3LA 2XKOA 1UHMA 2XXAA 3BEHA 4NHJA 3IAS2 4QZCA 3I9V2 2EINC 1R22A 2X0CA 5DECA 3TEDA 3AQMA 1M56C 2HUJA 4M6VA 5JP7A 2IHOA 3KEQA 1OYYA 2XPUA 1NH3A 1QNTA 4BQOA 4NQWA 3I56I 2HV6A 1LDDA 3ABKC 2JZYA 3S17J 5M3FJ 3GM1A 4DGWB 2M7AA 3IH3A 4A4AA 2NVYJ 3QWLA 1FNTc 2V9KA 2OD5A 1UMQA 4G94A 3GO5A 1G3YA 4XKBA 2VCBA 2XL6A 1QVTA 2QYOA 3BP8A 3FXOA 1YFHA 2VONA 1MQ2A 4E7ZA 1BR4A 2ZH6A 2F5FA 1U9OA 3J7YJ 3ABLC 4RAFA 3JTLO 2W9YA 1S29A 3OVAA 4U9EA 3ZQHA 4UVAA 4YIRX 2LY9A 3BOQA 2F5VA 3Q9VA 4O7GA 2O5AA 2HVQA 1STZA 4UB6C 5J2DA 3HG9A 3DEWA 4I2OA 4JJGA 5HS9A 2AHQA 1A0BA 4XPXA 2F5DA 4M5DA 1Z6AA 2EWNA 1WJFA 3KCCA 5B1AC 2LBFB 2AXTC 3CJRB 4JLXA 1T6UA 4MTDA 3RPUD 5A6BA 5AC5A 1X3UA 1B72A 4IWBA 2Q2EB 4V2GA 1CF7B 2H27A 1PD1A 5GAGJ 1SD4A 4RB1A 4E7IA 4ULWA 3EFOB 2VJIA 4JWMA 2OTLI 3GEZA 3JCUQ 1FMVA 2NNNA 4XLEA 2STWA 1RETA 5E1XA 2HOSA 1YAUO 4XIDA 4ESJA 4AT9B 5TRDA 2KGOA 3BZKA 2ID1A 3JCUC 2LP4A 2E7WA 2ZC2A 3JRAA 2Y3HA 1H89C 4N6HA 4YT8A 4F55A 3PDMP 1LE2A 2P7VA 2NUPB 4CZZA 1BPEA 5JVTA 1G4DA 1ZQVA 3LQCB 5ICCA 1WQ2A 4I98B 4B6IA 4NXXA 4A5NA 4G6DA 1XC5A 5IP6A 4S05A 1TFKB 3CDLA 4Z6YA 4LGWA 1D5YA 4RQ1A 4PK4A 2HEOA 4KLHA 3LAJA 4U7BA 3PMRA 5DD8A 3WG7H 2AU5A 3NARA 2ICWG 2OG2A 3E70C 3B0XA 3GW2A 2F6CA 3JRHA 8ICCA 1YX5A 1QLEC 4G0HA 3CJNA 4BE2A 2VASA 3RVYA 2ZXPA 1WJAA 1ZG5A 1QGPA 5J1UA 2FOKA 4WJ0A 1K04A 2RNJA 1HW5A 3OYMA 2AQEA 3JAMZ 1IZ1A 2DO7A 4K2EA 4X0RA 2L9SA 2DK5A 3L00A 5AGFA 3HWTA 4C3EA 1FFTC 1HSTA 3MYIA 4K0DA 4K97A 1LVAA 3QU6A 2P5KA 2ADUA 5ED4A 3BJ6A 3BLYA 4PJLA 1FT9A 4M0AA 1Z6RA 4B09A 1GQAA 2G62A 1XGSA 3CMEI 3VF0A 1UG0A 1ZR2A 3ZQLA 2IS2A 2HMZA 4BJTA 4O79A 5BQHA 5TZVA 5J0PA 2DYRH 3DU5A 4M9GA 3GZNB 3CO7C 4M9LA 1U2WA 3GTJJ 3Q7LA 2EIMH 2NUTA 3CTAA 4QPQA 5IY5H 4JW1A 4JZAA 2LOOA 1HKTA 3S9OA 3VYRB 3EHMA 1TQMA 3DPLC 3LLIA 3DBHB 4EUKB 2NVUB 3POVA 5HRHA 2HFHA 4PR9A 1FC3A 7ICFA 1WATA 1KDHA 3KYLA 2E1CA 4M04A 1WJDA 3WHCA 2Y9ZA 3NMIA 4GXKA 3CUOA 3RTRA 2EPFA 1NFOA 1T56A 2ZMEC 2YLGA 3F8CA 4QLCU 4LITA 3MFNA 4NXWA 4LJZF 4PGQA 8ICLA 2YSRA 3CC7I 4AT8A 4XRMA 3UPQA 4I27A 9ICSA 1TWGJ 4HBLA 1MBHA 1DGRM 4CJGA 4AYBN 4KM5A 3CD6I 2GDCA 2EILH 3UGOA 3BWGA 1VTMP 3B73A 4M9ZA 3CUQC 4OWRB 2XUBA 2NRAC 4U5HA 5J2KA 3K69A 3ZMDA 4XKWA 4LEWA 4L9VA 4MVSA 3D5RC 5EJCA 3HSFA 4LEVA 4X5VA 2ZXOA 4C3HJ 3SQNA 5F04A 3EPZA 2R5YB 4U0VA 3OIOA 4HDUA 1DOVA 2ZH9A 4YFNF 6PAXA 1WASA 1KONA 1U3EM 3EETA 2B0LA 3US6A 3OWGA 4KLIA 4BXUA 1OYIA 3IL2A 4KITB 1MSFC 3GLXA 1K40A 2PP4A 2UUHA 1Z63A 2O1PA 1XGMA 2DQRA 1ORYA 8ICNA 1RZTA 1BI2A 4JC7A 3SZRA 1BIAA 1YZAA 1Y8QB 2EPNA 3GORA 2P0WA 3I55I 4R8HA 4JQFA 1G5ZA 2LCHA 4UAYA 4OIOF 2EQRA 2K9SA 2QSFX 2ZMEB 1POGA 3ZMVA 2OAZA 1R49A 4I28A 2YUSA 2WVNA 5DKWA 5BPDA 1JUSA 2ISYA 1LEBA 4HYEA 4TV7A 1D0ZA 2E5ZA 4H54A 7ICQA 1RXQA 3WTTC 2QEXI 1XTAA 4F3QA 4X4NA 5CLSA 3K7DA 4QI0A 4ABZA 4IQUA 3R0JA 3ZWIA 4YD1A 3RJFA 4AL1A 2DPDA 4KLTA 5HRGA 2DMTA 7ICIA 3WGHA 2A6HF 3OYLA 1K78B 4NXTA 4IGGA 1JGGA 2VL8A 3ZN0A 2O3FA 1PDNC 3B0PA 1TVAA 1XSNA 5HDKA 5JVEA 4J19A 5E20A 3CCUI 3RF3A 1ZQLA 4DYRA 4Z6DA 5J0XA 4Z6FA 3H92A 2LK4A 3ISPA 2ISOA 3F3XA 5E3CA 4RPXA 3HRMA 1JE8A 1VQ9I 4WGZA 3HOUJ 3S1NJ 4AD9A 5L0HA 4EGWA 3SNHA 1SZIA 4M9JA 3CK6A 3PCVA 4XEFA 2ZXHA 1TWCJ 3HUGA 5K7ZA 1VQ4I 4FE7A 4J01A 4PH5A 4JJFA 3C5GA 3TK0A 4R66A 1VQNI 3K70C 4II3A 1MMDA 4H0EA 1ZHXA 3K1IC 3B0VC 4WBYA 1YE9A 5E8IA 2J0XA 2IS6A 4XKCA 1H8AC 1MSEC 3HLZA 1YJGA 1XSVA 3E0JB 3LSMA 1W7PA 4AWXB 2YPRA 1L3LA 1XMXA 4XSZF 2M2VA 1OKKD 1BDJB 3HKZN 4KLFA 2TMVP 8ICZA 2W7NA 2HVRA 3V5YA 2E1OA 2IT0A 3LQQA 2Y75A 2XB5A 2VT3A 3JRIA 3OV8A 2E2JJ 5FKOA 1Z0XA 4XORA 2IYLD 3OYJA 3TBIA 4IVNA 1G4WR 3U8VA 1DU0A 5CHGA 2JWTA 2NVTJ 1XCBA 3CLOA 3K70D 1F1MA 4RQ7A 4P96A 5FB2A 1ORKA 3L2VA 2QUPA 1IRFA 1U0JA 4UD4A 1J59A 5KYXB 2XPVA 1FSEA 4Q48A 5DV5A 3V4GA 4C3IJ 4QSHA 3REOA 4WXHA 3DAFA 4CHUA 1AUEA 2OQMA 3QODA 3VYWA 2DFFA 3A02A 5F6FA 2NVQJ 2Q4FA 4NXVA 3QOPA 8ICIA 5LBQA 3L8IA 4MNUA 4CDGA 5LGNA 2GLOA 3FXHA 3MX3A 2JA6J 4NY3A 3QQAA 3TO6A 3EYIA 3JPNA 2HNHA 5FLXZ 2DPUA 2MABA 4XTKA 2OBPA 3HRUA 3R6SA 3QPLA 4B3AA 4NKUA 1T9KA 2DTZA 1DPUA 2B56A 4JEAA 5HODA 1OKRA 4BEHA 3LNRA 3IKTA 4KLEA 4RDAA 4FO1A 4LOCA 1V54C 3ZQQA 2E60A 5E1WA 1HOMA 1N75A 2KJGA 4ETSA 2RQPA 5J4VA 1IF1A 4UBBA 8ICBA 5DQTA 3BZCA 3ZP5A 4FETA 4B4CA 5DCFA 1VQLI 4IX7A 2AXLA 1ZU4A 3DJUB 3B9QA 1X2MA 1KU9A 3RFYA 2DA2A 4HQMA 5EDNA 3KMIA 3KH2A 3Q7GA 3FMSA 3TKYA 3C8GB 4I44A 1T8IA 4B3XA 2PXIA 1ITYA 2ZXRA 4XPWA 2WBMA 9ICJA 3ABMH 3LLKA 3QZCA 2BZTA 1GLNA 2HQRA 3LA3A 5D5WB 2Q1ZB 4O5KA 1RRJA 1B8IB 2GA0A 1O3RA 2KJBA 2R03A 2XLDA 4QZIA 2ZH7A 1UCRA 3CMAI 2FJ1A 3JSZA 4XQ1A 4S0HB 4TURA 2X1EA 2W25A 2C03A 3H65A 2E7XA 1YRNA 3BG5A 2JTVA 3LSGA 4F92B 2MGQA 5ILVA 3ZQVA 4I02A 3DMDA 3GFJA 3GWZA 5B66C 2OEXA 4C3JJ 2Y69H 2W48A 3VEPA 3V7SA 4C3BA 1G3TA 2YS9A 3NVOA 1YX3A 1YZCA 4LERA 3ECOA 4IHVA 4UUSB 4CCMA 1UZCA 2JSCA 2Y39A 3V7OA 4D4XA 1B9MA 5JLWA 3PM1A 4YMMA 3HOZJ 4XKVA 4DW6A 2ZHBA 2VB6A 3DM5A 3K9TA 2L54A 3Q5FA 1TT0A 1U6GA 1ZHFA 4I2BA 4XONA 1YDIA 3IAM2 1ZW3A 9ICKA 2P5LC 1IW7F 2MFZA 2NSGA 2K5CA 4UUVA 1QPMA 1ZHZA 5F28E 3FF5A 2VC0A 2R92J 3O39A 3ZMSA 1K61A 3L34A 4XM3A 2ZH3A 2ZFWA 2HOAA 4FT8A 3CMYA 2YKZA 3HOTA 1R7JA 5DQZA 5E8GA 2COMA 5KK1A 3MZ8A 5GADJ 2V9VA 1AKHA 1MNMC 1YLMA 4NTAA 2OU6A 1WJ5A 9ANTA 1IAWA 4W8KA 1FIPA 1S7AA 3BPXA 4NLNA 3TMOA 5E2QA 2QSGX 1E2XA 4LG3A 4O6YA 3S90A 2M7BA 1H7IA 1PD0A 2XB0X 4JLZA 1CPQA 2IEKA 4WC5A 2R7WA 2F4IA 3FMRA 5BMZA 3CQZA 2EA2A 4EHPA 4KLGA 2EA4A 1WVRA 2HKOA 2EZIA 4E6KG 2L7AA 4M6YA 2QVOA 2ZKZA 4RBOA 2EK5A 3CLQA 3RZDJ 4HAMA 5FLVA 2ID3A 4PUSA 3H38A 5IT3A 2XS1A 1Z7Qc 3J7AO 1QHGA <