3C18A

Crystal structure of nucleotidyltransferase-like protein (zp_00538802.1) from exiguobacterium sibiricum 255-15 at 1.90 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
GMEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQMSLSFAKLLRRFQDGRNLFSRGNYYDAYTHVHHALHHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQSKVLSGGKYLFEVMRERDRPWTMHELMEESRLTELKVDLGSLVDFFIRKGLIRISYQRTKGLGVELVTYEPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
molecule keywords Nucleotidyltransferase-like protein
total genus 107
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14540 NTF-like Nucleotidyltransferase-like
A PF18576 HTH_52 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c18A03
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3c18A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3c18A01
2Q0OA 1Y0UA 2FRHA 3JYYA 4R63A 4X4UA 2VBXA 4BHPA 1GXPA 3HTUA 4I2BA 1K7AA 5D8LB 3O10A 1IXCA 4I27A 1ZYRF 4Y13A 3FX3A 4RGXA 3M8EA 4MTDA 9ICCA 3V7RA 4ZZDA 2DPUA 3I59B 2CWEA 4KT5C 1E17A 2R7DA 4KA4A 1KU3A 3WG9A 2YX4A 1I5ZA 3MZHA 5HRHA 5CA7A 4EBKA 4UNOA 2J5PA 1HQCA 3HUGA 3DF8A 5TRDA 4ZYHA 1IXRC 4XSXF 4OU0A 2QZ8A 4PDKA 3HJ4A 2KIMA 4FHYA 2IPQX 3ULQB 4Z6CA 3ZMVA 4WC6A 3TOBA 2L6FA 2A6EF 3WTWC 1PV3A 2RFFA 1VJ7A 2IA0A 4AWXB 1AOYA 4UBBA 3TDZC 1D3YA 3E6DA 4M9JA 1IUYA 4LGWA 4AT8B 3UXOA 5DBAA 2RVCA 2UZKA 1HKQA 2QQAA 4A0ZA 1IN8A 4Z6EA 1BI3A 5HLIA 3WTVC 3JPRA 4EM1A 3RJFA 1C0WA 9ICPA 3RYRA 1SAXA 2XKPA 3D0SA 2JPBA 2XUBA 1FSEA 8ICVA 2DU9A 1ULYA 2A07F 2V6CA 1TQPA 4NKTA 5E1ZB 4RQ0A 4LJZF 4O5EA 8ICQA 5F2VO 3VODA 2Q66A 1YLFA 3DPLC 5LLQA 2VE8A 3OVAA 1LEBA 3RQEA 9ICSA 1JQRA 4WXHA 3WTXC 4U0YA 4NM2A 5HDKA 4IF4A 4F5QA 8ICLA 4R8HA 3FXQA 4R32A 4KLGA 1IN4A 1PP7U 3C8GB 2FBIA 2L4AA 5HRFA 4GXKA 2V79A 2MBFA 1T2KA 3ZMUA 3HSEA 2BCUA 3ML6A 2M2TA 3F8BA 3F6OA 5DD8A 3L09A 2Z99A 3TGNA 4M9LA 4EGZA 1B1BA 3KEOA 4H0EA 5IIIA 2A61A 1MIWA 3V7JA 4LLNA 2M45A 2D45A 2A5YB 1L0OC 3RJEA 1R1VA 5D5XB 3M7GA 2XV4S 5ICCA 1J9IA 1TFYA 1WI9A 2HWVA 4HZFA 1G3SA 2EFNA 4YCXA 8ICEA 1JMSA 4KLDA 4AT9A 1ZQYA 3KFWX 4M9XA 1I1SA 2GA1A 3R6SA 2HKXA 1Z7UA 5J0XA 3N97A 2OZ6A 3HJ1A 4BXUA 1BM9A 1UHWA 2VT3A 1CGPA 5IILA 3H3AA 3RH4A 4OINF 5J2HA 3VOEA 3FM3A 3I0TA 3IKTA 2PFPA 7ICOA 4P55A 2DR7A 1UFBA 3GWZA 2DAOA 2D1HA 1TW2A 2H94A 4LK1F 4G8XA 4BHCA 2FQ3A 4O9MA 3VFZA 4WC4A 2CYYA 3EYYA 4IRIA 1WTYA 5HS9A 4M9GA 3K1MA 5IIMA 2R7FA 3DQVC 3SZPA 5ICFA 5JI6A 5HRDA 5LEKA 4LT6A 2VANA 3S2WA 2IA1A 1F1ZA 5J8FA 1USTA 2H09A 9ICAA 2ZH9A 2PN6A 4AT9B 4X4QA 2FA5A 5DKWA 1USSA 5J29A 3CDHA 2RN7A 4Z2YA 2VN2A 4KIBA 4P2HA 4WBZA 4M71A 3Q5FA 9ICWA 4IJAA 1NHAA 4XBFA 4FHTA 1QVXA 4NKUA 4D0PA 1XSXA 2L3DA 2ACJA 2JPUA 2VBYA 3WE2A 1WRJA 1R58A 3L8JA 2R3SA 3HOSA 2BPFA 3RTRA 4K2EA 4M9ZA 4HF1A 2FMSA 1JXSA 2KJBA 4RGRA 3WFOA 5ILSA 1R7JA 7ICIA 8ICOA 5HRGA 4YIIA 2RDPA 4FH5A 4M74A 5DYMA 2M2WA 3V8JA 1B6AA 3EUHA 5DB7A 4WWCA 4HV6A 4UB5A 4MEYF 2QYOA 3PMNA 9ICGA 1V3FA 3RJGA 2BE3A 5FLXK 2H6CA 5HRIA 3K1NA 1ZJNA 4NLZA 3RKXA 5LHIA 1K79A 2ESNA 4PHPA 1Z1DA 3ISDA 2W85A 1WSUA 4Q48A 4XLPF 3PQJA 4KYWA 1BI0A 1FP1D 1MJAA 3F21A 3S9OA 3GFJA 5J0OA 5CJ9A 4KLOA 2OU2A 4XEFA 4ENNA 3MEXA 3PQKA 2HS5A 4FT8A 1LDKB 1XGOA 1ZLKA 4I2CA 2H6BA 5D49A 3EQLF 2M2UA 1BI1A 8ICTA 4Q4ZF 2B0LA 3WFPA 5LHHA 2Z9OA 4CXFA 1ON1A 2IRFG 1UEUA 4AVPA 4ENKA 2M30A 2PI0A 1OW8A 3ERED 3H3UA 2EJRA 3LQCB 2P5KA 3WFQE 2W25A 4GXJA 3RJIA 1ZQJA 1WQ2A 3SQNA 2FMPA 2KIUA 4JBAA 4M9HA 3N4MA 3KP4A 1ZRFA 2XRNA 3F72A 8ICFA 1G6NA 2XVCA 5ERIA 9ICBA 2M5WA 3WTSC 2EV6A 1DDNA 3B0YA 4XEKA 1MIYA 3GZ6A 1GVJA 1TVAA 1EH6A 4EM2A 2A3SA 1EH8A 9ICTA 4GCVA 4HLXA 1DUXC 5HC9A 3L8IA 2XAHA 3NRVA 2IA2A 4KMFA 3GO5A 8ICZA 3GZ5A 4TV7A 2UXNA 1R8CA 3QAHA 4O6JA 1PP8F 2GAUA 4MGRA 5DV5A 1FBUA 5L3GA 4ZH4F 2ADUA 8ICBA 1CF7A 4QZDA 5AONA 3L9FA 3W6KB 2JZYA 4WF2A 4KMUX 4RPZA 4TUQA 2IT0A 1D8KA 4UD5A 2RQPA 2L02A 4RPXA 2GQQA 1V4AA 4O5CA 2ZXJA 4FHWA 2RC4A 4I0AA 2XAFA 1T39A 8ICCA 5E20A 4B8XA 3H92A 1S7OA 5K1YA 3B02A 2EV0A 2BBYA 3JPNA 3O3KA 4P9FA 5E1WA 4LLLA 3NYBA 1RUNA 2HDCA 5E8GA 5HHHA 3MQ0A 1KQ9A 5BOMA 1P4XA 2L4MA 3O2PE 1LVAA 4IRHA 4ESFA 7ICHA 5EEGA 2O03A 3WTYC 2EFQA 2LF8A 3CUQB 3HSFA 5E8IA 4E7XA 4KLEA 7ICQA 4XQ8A 2E1CA 3HRUA 2PQ8A 3OGUA 4A2UA 5DBCA 2HSBA 2PXIA 5HHIA 4UHTA 2BCQA 2NS0A 4M6YA 1LDDA 4QZFA 3DFGA 2G9WA 1R36A 1F5TA 3RJPA 4PZJA 3UXNA 1XMAA 5JVTA 3I4PA 1G3WA 5F1RA 3JZ0A 5J2FA 4G7HF 4QZHA 2JSCA 3QU3A 4F7ZA 3RJKA 1RZTA 1FT9A 5J0TA 4MFAA 4NLNA 3DKWA 4EJUA 3CUQA 4QZCA 4NM1A 1OYIA 3T0YA 8ICNA 8ICUA 5ICEA 1XN7A 1HW5A 4M2YA 3UPSA 3CJNA 1ZQLA 5DB6A 4M9NA 5DECA 4IQWA 2JT1A 1SFEA 2A69F 2VBWA 4BYYA 2DR9A 3WTUC 1XGSA 4A5MA 2P6TA 5LBQA 5IIOA 1JOGA 1W7PA 2YPRA 3GYHX 1T0FA 2FSWA 3P7NA 3GFMA 4XRHA 1ZQBA 3CO6C 4WCWA 5F6FA 5HLGA 4HQEA 1D8JA 4UB1A 2NAZA 1B9MA 2IHMA 2EFPA 5BOXA 3OV7A 1KDHA 1BPDA 5ED4A 1KU7A 2CSOA 4EVIA 3MDAA 1HUZA 2P7VB 4XRFA 2VOPA 4L9NA 3B73A 4DO9A 4L5JA 3TDUC 5CWRA 4F5NA 2VBZA 3FMSA 4A6EA 2HHPA 2ZO4A 9ICFA 4G7OF 4X4OA 3SXYA 3FMRA 1YG2A 4M72A 2HOEA 1RI7A 1PUEE 2PMUA 1LDJA 1STZA 1P2FA 1KYWA 3BJOA 4ZYEA 1ZQEA 3OVSA 1Z91A 2X0LA 4HDUA 2GZWA 1ZQKA 1KU2A 4ATBA 1FYKA 2CFXA 5EEHA 1YO5C 2STWA 4TUPA 1BC7C 2ZH1A 3QP6A 3R4KA 5LGNA 3NQOA 2L6HA 1FLIA 1R1UA 4PHEA 1XDSA 2HQNA 4QZAA 2L6GA 2VOOA 5DEDA 4RQ5A 3WTZA 4S04A 3CO7C 2Z3YA 3F3XA 5HR9A 3ISPA 5DB9A 3ZMZA 2DTRA 4MQ9F 4ASNA 2GWRA 5DD4A 2O1PA 4Q5SF 2FOKA 2DR8A 5CVUA 1WOTA 3V72A 1MZBA 3QP5A 4X4PA 1MJ9A 1ZQGA 4WXCA 1K04A 4YMNA 1ZQCA 2OA4A 2K02A 4P4MA 4R65A 1Z9CA 4X0BA 2ZMEB 5IINA 1JN3A 1IN7A 4KN4X 5D5UB 1QQIA 3G3ZA 7ICRA 3C2LA 2M1BA 1AWCA 9ICXA 3HOTA 1LNWA 2HTSA 2AS5F 3GXOA 4U7DA 5IT9Z 4PGYA 2XAGA 4A6DA 1LB2A 3RI4A 3T8RA 3LQQA 1OR7A 3MWMA 4AD9A 3H39A 3Q9SA 3BDDA 4DNCA 4Z6FA 4BAYA 2P8TA 1GXQA 2L01A 5K5QA 5HRLA 7ICMA 4RWNA 1IXSB 1F9NA 4P9UA 1TQMA 2V9VA 4EQQA 4CGZA 1R5GA 3GM2A 4MEXF 4BHBA 1O3QA 1IRGA 2JX0A 5LRSA 3DP7A 2LF7A 2VT2A 1RIOH 3ROUA 2ZBKA 1ZHFA 1O3RA 1R8BA 1UFMA 3HHGA 4PGGA 1I1GA 1O57A 2MLGA 3QPHA 2XIGA 4RB2C 1ZQSA 2BPGA 3TO7A 5DB8A 4Z6DA 3I53A 3QPTA 5L3CA 4A0YA 1SD4A 4GXOA 1EH7A 3COAC 1ZGAA 4I28A 2ZJ2A 3QOPA 4NLKA 3OV8A 2WV0A 9ICJA 4X4RA 9ICRA 4MTEA 2ZNYA 2K7LA 3AQLA 2PG4A 4HV5A 5DEQA 4M0AA 2Z33A 3KCCA 3JPSA 5HDNA 2TDXA 1J0RA 3ISCA 2W84A 2ZH2A 2ISYA 4I2FA 1UCRA 1KU9A 4KICA 4QZ8A 4ESBA 3E5XA 1NO5A 1WOLA 4K4IA 1RPLA 3RKWA 4I02A 1XD7A 4PHAA 2AXLA 5JFRA 4L18B 3LA3A 1BPBA 2ZHAA 1F4KA 4X4VA 1FYLA 1ZQRA 3ZN1A 5LGUA 3AQKA 1Z6RA 1BBYA 4I01A 1R1TA 3KLNA 4IHTA 1W5SA 2GIVA 7ICGA 1YS6A 1OKRA 4QZBA 4A0XA 1YW9A 3EETA 2FEZA 2LSOA 5L3DA 5A2QK 4FX4A 3BPXA 4KNYA 4LLGF 3FZVA 2Y75A 2NYXA 2LNBA 4CDGA 1S6LA 5D46A 4KLUA 1B4AA 3GX4X 1KYZA 4LG0B 5CVJA 2ISZA 3KZZA 5L3EA 1TLHB 3KP5A 4YFXF 4KLHA 4CZZA 2I9GA 5FFXA 3DV8A 4RQ2A 2O5AA 2OQRA 4L0ZB 4CHUA 2DQLA 2FNPA 4IQTA 1FBSA 4HOBA 2EA2A 4ETSA 1WKMA 4A12A 4YD2A 4U88A 3ZMSA 1HXDA 3PFIA 1BIAA 4NHJA 4EM0B 3E5QA 2DT5A 4I2OA 1MIVA 2BEOA 1IAWA 1Q1HA 4QZGA 1QGPA 2HR3A 4MNUA 5D6FA 4M6XA 3B71A 1ZRCA 4HX7A 5F64A 1U5TB 3BWGA 2PBIA 3KLOA 5K5RA 4LZDA 2EFWA 9ICKA 4N9IA 2KJCA 3JSOA 4U0WA 3SFZA 7ICEA 5DCMB 5D4RA 1G4DA 2BCSA 1UETA 4XEVA 3TFSA 9ICMA 3LWFA 9ICIA 2PEXA 4Y15A 9ICEA 2OD5A 5HVQC 4HF2A 1FY7A 4F5RA 2G7UA 4DOBA 1Z05A 1ZQTA 2D2WA 2Z5UA 3I71A 5J2IA 4JWMA 5H6RA 2MA3A 4RB3C 3CLOA 1YS7A 4JWNA 4LMYA 2ZHBA 2HQRA 2DRBA 4ESJA 3RPQA 4MF8A 2F5EA 1HKTA 5F28E 4RQ8A 3UQ2A 4LVSA 4IHSA 2Q00A 3MFKA 2COMA 4OIRF 2UWMA 2O61A 3R61A 4IRGA 4GO1A 3BPVA 3GLXA 3WTTC 3JPPA 4UVAA 4RAYA 5E17F 9ICVA 2HZTA 4BH9A 2M87A 3T5XA 2O3FA 1VTNC 1TBXA 1ZQQA 1HUOA 1FWZA 4K4GA 1XB4A 3BJ6A 4OIOF 4PH5A 1ZG5A 3UXPA 4LB5A 1BPZA 2HFHA 1BI2A 2GXGA 5FO5A 3J81K 3U0CA 3EDPA 3MAJA 4UV9A 2RGVA 2M2VA 2BGCA 1B59A 3HIFA 2YR2A 3GF2A 2PFNA 5AIQA 1U2WA 3OVBA 2ID1A 1TW3A 2GXBA 4WXDA 4XSZF 4B09A 3CUQC 1K78B 5K5OA 3J80K 1RZ4A 5D4BA 1LQ1A 5FGMA 3ZPLA 2PFOA 1H9TA 1J7KA 1I27A 2YWAA 1ZQPA 2PBEA 1ZN2A 1U78A 2O6GE 4R79A 2XHKA 4HBLA 4YIFA 3HW8A 1SMTA 2DW4A 3ELKA 5FD5A 3RH5A 2ZKZA 2YU3A 1FPQA 4WC7A 3NEUA 2LDUA 3IRRA 4NY8A 3H3ZA 5LEJA 4RQ4A 1ZQHA 5HRKA 1ZQZA 1BIBA 3KP6A 4EGYA 4S05A 4MFCA 3LQRA 5J2JA 1TNSA 5A2QZ 2HKOA 4GXIA 3DPTA 4G6DA 3C18A 3ECHA 2F5CA 3ZQ7A 4WBYA 5DDYA 1BC8C 3B0XA 3I54A 4MHGA 2F5DA 2FU4A 2IW5A 2K27A 4X4SA 1ZH5A 3TO6A 3AU2A 2PMHA 1YIOA 1JE8A 4RWOA 1G3TA 4I29A 3GFIA 4MQVA 3JPOA 1FX7A 3KEQA 2DRAA 5FB2A 1TV9A 8ICPA 4I2JA 1HSTA 2WWYA 1QZYA 2Q2EA 4RB1A 4I0BA 2OQGA 5IIKA 4RQ6A 3REOA 3E6MA 3HRTA 2BV6A 1LEAA 3K69A 1KA8A 4WX9A 2JTVA 2NRKA 3RDIA 5HLHA 5D5VB 5CVRA 2QQBA 1RNLA 3KE2A 1IN6A 1YW8A 1DPUA 1W7PB 5DDMA 1XCVA 2L54A 3FXUA 1XSDA 1JHFA 2UXXA 5ILUA 3V7CA 1KGSA 4DOCA 1YLQA 2W24A 1XSVA 4YMMA 4O5KA 1U5TA 4M5DA 3E6BA 4M9SA 4RS8A 3F8MA 3WE3A 2EB7A 3LFKA 3UQ0A 5E1XA 4LG0A 4XA5A 3I59A 4I2HA 4UVBA 1YTYA 2KIFA 1H0MA 5DDGA 2BYVE 4IPAA 8ICMA 3R60A 4P5OA 1ZQMA 3Q9VA 2ETHA 2QLZA 2OBPA 4KN7X 4KLJA 2JPCA 3L7WA 5CVIA 9ICLA 3BZ6A 3IWFA 1XCBA 3T8TA 3FMQA 4O3MA 1ZRDA 4ATBB 2OAZA 2K4JA 2EV5A 4HW0A 4QZIA 2P5VA 3U1DA 5HOOA 1QPMA 5D5WB 4RT3A 3F8CA 1YW7A 2QVOA 2P66A 1EV7A 3FF5A 3K2ZA 4UB2A 1MQ2A 3LAJA 1MD0A 4NXZA 4U7BA 1ZG3A 2QUFA 4EJWA 4HQMA 5HS8A 5FD6A 1W7PD 1SFUA 4KLMA 1UHMA 2RV8A 4R64A 4E70A 4QLCU 5LGTA 4AIHA 2STTA 4NQWA 2MH2A 4AT8A 1QBJA 1J5YA 2O8XA 5D6EA 1R23A 2DO7A 4OOIA 7ICTA 2GA2A 5HS7A 8ICGA 3V4GA 1Q79A 4X4TA 4EV0A 2PFQA 4E8FA 2IVMA 1XSNA 4X4NA 2ZCWA 1SMYF 2YSRA 2BCRA 3GEZA 4WK8F 1K40A 3F22A 1FZPB 2IJLA 5FLXZ 2ISOA 7ICPA 1VFGA 1K78A 8ICSA 1MGTA 3F23A 1W5TA 4G94A 1P92A 4HX8A 5H20A 2FMYA 5EOZA 1ZQVA 2Y0MA 4I2AA 5D8KB 3HTSB 3OUYB 4QZ9A 2E7WA 2M8EA 3L00A 1P4WA 2Q8KA 3M1EA 5BPDA 1ONVA 2MH9A 2XAQA 4KDPA 4RGSA 3C8GD 5E18F 2KRFA 4Q47A 2FF4A 1H9GA 3VEPA 1HKSA 2LKPA 4N9HA 3ZN0A 1XGMA 4BNCA 5LRRA 3BP8A 4FHXA 4UBCA 3RJJA 3AU6A 4P96A 3C2MA 4UAWA 3RQFA 3J7AO 5JR3A 8ICIA 4OIPF 3F6VA 3TKYA 4O5VA 5TJJA 3U9GA 2A68F 4XQ7A 2VE9A 2D1VA 4HLYA 3OUYA 3KP3A 5H6QA 5BQTA 2KKOA 5HREA 2FBHA 4OMZA 5D4SA 1K6OA 4AIKA 2E1NA 4L9JA 3H37A 4MFFA 5J2KA 2LK4A 4EJTA 3WGGA 3VB2A 4EMSA 2JRTA 3HSRA 2EFOA 1WWPA 1ZQWA 4YMOA 3HRMA 3JTHA 1HBXG 3K75D 3CTAA 1ZARA 2EK5A 4XLNF 3FHZA 3ZP5A 2DK5A 2DPDA 1I6XA 2WC2A 4X5VA 7ICKA 5HRBA 3TO9A 1P4AA 5J2GA 5FFZA 3C5FA 1O3SA 3WFRE 4UB4A 4ON0A 4L9VA 3RKYA 3M8FA 3KP2A 2BE5F 4CYDA 2HGCA 3IL2A 3K7DA 3WGHA 3LK9A 1REPC 1XMKA 4HYEA 2G7HA 4I2IA 4HDVA 2V1UA 1OYWA 1RUOA 1F5AA 1HW1A 1FA0A 5CB1A 5DBBA 9ICUA 4I2GA 4A5NA 3HX0A 1O3UA 1JGSA 5BS6A 1U5TC 5DCMA 4AT7B 4HAMA 1QO0D 4MF2A 4RWPA 1JAJA 4HA8A 1NOMA 2V1XA 3FXRA 3PMLA 2H27A 5J2AA 1FC3A 2X4HA 2CGPA 2ZH8A 4R1HA 3L9DA 4EP7A 3MCZA 4I2DA 3V8LA 3RPUA 1W4MA 2Y48A 2VXZA 1HW2A 1R00A 2GWSA 1ZREA 4FX0A 1B9NA 3IKVA 2ISPA 4RQ1A 1S7AA 2CG4A 1KEJA 4IQVA 4NQFA 5JHUA 4PGQA 8ICJA 4HF0A 3BOQA 4WCGA 1Q78A 1ZQUA 2ZH5A 3V7KA 4KLLA 2ZH6A 1IN5A 4TURA 2CO5A 3G73A 1XDUA 3EYIA 5J0PA 2ZMEA 3R0AA 2P7CB 3I5UA 1FYMA 4LFUA 4AT7A 3ZMDA 8ICKA 5J8CA 3RH6A 1S8NA 4RT2A 3HRSA 4ZYGA 4IVNA 1R22A 8ICHA 5IIJA 5DUIA 2W57A 1ZLJA 3K1PA 2HYFA 1TTYA 1ZQDA 4KLSA 3C5GA 3GVAA 1WWXA 1R5HA 2VODA 1J59A 1U3EM 3C8GA 3MDCA 1FSHA 5DCFA 2J5OA 3GM1A 2MC3A 3H38A 5CP2A 2K86A 3K0LA 1SD7A 4YN4A 5J0RA 4E80A 1BN5A 9ICNA 1OYYA 3ABUA 5J0YA 2EA4A 1Z6TA 5BMZA 4ENJA 1P6RA 3E97A 4GGGA 3C1DA 4TUSA 1MQ3A 2DLLA 1YFHA 3RYPA 8ICWA 3AJMA 2ZNZA 5CYVA 4G6QA 5BOLA 2NNYA 4WC3A 4GYIA 1R89A 1PDNC 4RQ3A 4L5IA 3LAPA 2ZH3A 2C6YA 1MDMA 4I7HA 4OIQF 1ZQFA 1JHHA 2IP2A 2WTEA 3JSPA 5IT3A 7ICLA 2XAJA 2FMQA 3KETA 4X0AA 2DBBA 2MD5A 2ZH4A 3GDXA 2NRAC 1XSPA 5J6XA 4JK1X 1T38A 5CJ7A 3MGHA 4YFKF 3AUOA 3IRQA 4UV8A 1KTMA 3QRFF 1GHCA 1L3LA 2V1DA 1S3JA 3T1BA 1MJBA 1T6SA 5HDGA 4N0BA 2VONA 2QM3A 3F8NA 3LA7A 3C66A 5CHGA 3JAMK 3MGIA 1DP7P 4FHVA 4KIFA 1J75A 2P6SA 9ICHA 2BPCA 4UUVA 2ELHA 1YQAA 1SD5A 3IHUA 4R66A 4JQFA 1PX5A 1O3TA 2FE3A 2FXAA 7ICUA 2RKHA 1BPYA 2DR5A 4KFCA 3C3WA 4HX4A 3J81Z 4L0YB 5J2EA 1TQIA 4EBJA 4YG2F 3GUDA 4P4PA 3E6CC 2ESHA 3DXJF 2EWNA 2PFBA 3DEUA 1IF1A 1X3UA 2XASA 2P5LC 1BOAA 3TFRA 3I58A 3U2RA 9ICQA 5KK1A 5DUKA 1R8AA 4M47A 3E5UA 1TNTA 4ENMA 4FO6A 1A04A 3C2KA 1OW6A 4I98B 3SZTA 3ECOA 2VC0A 8ICXA 4RWQA 3V7SA 4KLQA 4K4HA 2HTJA 7ICFA 1BJAA 2F2EA 3P9IA 2DVIA 2VC1A 2O0YA 4UAYA 5IT9K 1QNTA 3L2CA 4LZGA 3KZYA 4PGHA 3W6JB 8ICAA 3RQGA 4GYGA 1OW7A 1KQ0A 6PAXA 1ODDA 4IG8A 4YFNF 3JW4A 3SHFA 1XGNA 1O7FA 1QZZA 4FH3A 4IXAA 7ICVA 2OZUA 5CR0A 3ZMTA 5J2BA 2QBYB 1ON2A 2E7XA 3V7LA 1BPEA 3TQNA 1SD6A 4LD5A 4PGXA 3P9CA 3AAFA 3GM3A 4KLTA 1ZAOA 3HYIA 3I64A 2ZFWA 4KUMA 2PJPA 5J2DA 1U6GA 3AQNA 3K9TA 3PNCA 2W9MA 3LSTA 4RB0A 2XROA 1D5VA 1ZJMA 7ICNA 5ICGA 1IZ1A 4AIJA 3E3VA 5AIPA 2QENA 1MKMA 3QU6A 3J80Z 1CF7B 3JPTA 4I2EA 2XGXA 3WU1B 2QBYA 2QWWA 1T98A 4EJVA 3JTGA 2XKOA 4UVCA 4KLIA 8ICYA 3BY6A 4ZZLA 3TULA 4UXNA 1KNYA 4XUSA 3D5LA 1HSJA 1J2XA 4KIGA 4G7ZF 3CUOA 4RQ7A 2KK1A 4CICA 3JAMZ 5ILVA 1SFXA 4U0VA 1U8RA 1ZZPA 3UPQA 4DOAA 4WC2A 2DQRA 2FNAA 2DK8A 4QWQA 2F5FA 3MZYA 3R0JA 3IWZA 1FP2A 4KLFA 1FNNA 3AQMA 1ZQIA 1LJ9A 4IQUA 2DFIA 4G9YA 2CQKA 2RNJA 5CVVA 2FBKA 1MDMB 3ISBA 2HYGD 4M73A 3KP7A 4PHDA 1IW7F 3FM5A 4RGUA 1ZGJA 3OOPA 5J0UA 3GFLA 2YX7A 4QZEA 2CW0F 3LA2A 4F5PA 1IRFA 5J0WA 2FMLA 4UAZA 1K05A 1KQ8A 4WC0A 3IC7A 4WC1A 9ICOA 3FWEA 4OMYA 5J2CA 2QQ9A 4RAZA 4I09A 5BPCA 3MFNA 1TFWA 1OU5A 5J0QA 1YYVA 1UB9A 3HHHA 3O6BB 2DI3A 3M9AA 5LHGA 3RJHA 7ICJA 3HWTA 1BPXA 4UB3A 1ZQAA 2NNNA 4EJOA 4L9TA 3HIYA 3WGIA 3TOAA 4LB6B 4WC5A 3BROA 8ICRA 1G3YA 3F8FA 3V8KA 3JPQA 2A6HF 4PPXA 3C7JA 3MBYA 3RIRA 1XSLA 3GW2A 1FOKA 5L3BA 1ZG1A 3WU0A 4Y17A 4RPYA 4FHPA 5J0SA 4PCQA 7ICSA 3U3FA 2P4WA 3BJAA 3BRJA 2PLYA 3P9KA 2K4BA 5KVRA 4ZYDA 1UEVA 4NB5A 1FBQA 4BQAA 4CO8A 4M04A 2BCVA 5BPIA 1DPRA 4LK0F 3WFSC 3WODF 3ABTA 4F5OA 4S3NA 1ZQOA 1E2XA 4YD1A 1OMIA 4UD4A 1OPCA 1ZQNA 2MLKA 1V4RA 4P4OA 2HEOA 1S29A 5TZVA 5CLSA 2ZH7A 5L3FA 4DQ2A 1ZQXA 1O7LA
chains in the Genus database with same CATH superfamily
2Q0OA 4YL0A 1Y0UA 2FRHA 3JYYA 4R63A 4KI2A 3JRTA 1OCPA 2UV1A 4X4UA 2VBXA 3CDLA 4BHPA 3HTUA 1GXPA 4I2BA 1K7AA 5D8LB 3MKWB 2BHZA 3O10A 1IXCA 4I27A 1ZYRF 1VLTA 4Y13A 1UMQA 3FX3A 4RGXA 2XC7A 3LS1A 1SVOA 5F0CA 4FCYA 2HOAA 1T33A 3M8EA 4MTDA 9ICCA 1FFHA 2OEVA 3V7RA 3QQAA 3GORA 4ZZDA 2ZMEC 3TOMA 1IV6A 1QLEC 2DPUA 1N25A 3I59B 3ZSUA 1UAAA 4C2MJ 3T6GB 3NWIA 2CWEA 4KT5C 1E17A 2M4GA 2G3VA 1WCMJ 3A01B 2R7DA 5EGOB 2CQXA 2R7QA 1WATA 4KA4A 4V19K 1KU3A 5KYWA 3WG9A 2P61A 3V5YA 1YA9A 2YX4A 1I5ZA 3J7ZI 2KT0A 4OWRB 4II2A 3MZHA 4PACA 4EBKA 5HRHA 5CA7A 4UNOA 1ZQGA 2F48A 2J5PA 2JVHA 1HQCA 3HUGA 4D4NA 3PMRA 3DF8A 1LS4A 3AG2H 4MFDA 1GS9A 3EPZA 3VYSB 5TRDA 3M4CA 4WQLA 1BZ4A 5B3PA 2V1NA 4YIRX 5KYNA 4ZYHA 4F52A 1QPIA 1IXRC 4XSXF 1OCRH 4OU0A 4WABA 2QZ8A 5F5FA 4PDKA 1U9NA 1A7DA 1Q0FA 3HJ4A 2KIMA 3CC7I 2EILC 4FHYA 2XGCA 2IPQX 2XGDA 1WFXA 3ULQB 4Z6CA 1V5GA 2KQ9A 1NH3A 2L9SA 3IEEA 3PIOF 3GTLJ 4M3FA 4XQ1A 3ZMVA 4WC6A 1VQ4I 3TOBA 3FDYA 2ZJQF 3FHNA 3NAUA 1Z7LA 4YL3A 2L6FA 1ZGWA 2A6EF 5GP9A 3ASOC 2P81A 3WTWC 1H6GA 1PV3A 2OTJI 2RFFA 1TWGJ 4QI0A 3ONQA 1Y8RB 1VZ0A 1MQVA 1VJ7A 2KMUA 5A6JA 2KQRA 3A01A 2IA0A 4AWXB 2DMPA 3G71I 4DXWA 1AOYA 3S16J 3Q0UA 2VQCA 4UBBA 3TDZC 4BJ1A 1D3YA 1ENHA 1YDIA 3W4YA 2VI6A 2ZXIA 3E6DA 4M9JA 1IUYA 1Y0NA 4LGWA 4AT8B 3HJCA 3CEXA 1UG2A 2LQGA 4JTDB 3UXOA 1GQAA 5DBAA 2LMDA 2RVCA 1JR8A 2BY3A 2WZLA 2UZKA 1HKQA 1YZCA 4BACA 2D5RB 2QQAA 4A0ZA 4NXTA 1IN8A 4XL9A 1NTCA 4Z6EA 1BI3A 5HLIA 2R7XA 3WTVC 2R7ZJ 1G4WR 3JPRA 5FKKA 4EM1A 3RJFA 3C2BA 1C0WA 3P5JA 9ANTA 9ICPA 2IAIA 3RYRA 1RKEB 3JRBA 1SAXA 1F43A 3NMKA 2XKPA 3D0SA 4XR6A 1SANA 1NBBA 2JPBA 3W2AA 3IQTA 2XUBA 1FSEA 2HDDA 8ICVA 3LL7A 3ZQQA 2DU9A 1ORJA 1ULYA 2Q9BA 2A07F 4JEBA 1YX3A 2V6CA 1TQPA 1IG7A 3BZKA 5E1ZB 2E36A 4LJZF 4MIMA 3ZQHA 5CKTA 4EATA 2HVRA 5F2VO 8ICQA 3VODA 3C8ZA 3QW0A 4DRJB 2Q66A 4P9TA 1YLFA 4O79A 3U9MA 4CIPA 4A3MJ 3QPSA 3DPLC 5LLQA 2H1KA 4MS2A 1K6YA 2VE8A 5JHFA 3OVAA 1LEBA 3RQEA 9ICSA 2VC9A 1JQRA 4QPOA 3C63A 2CMPA 4I0UA 4WXHA 3WTXC 4U0YA 3LESA 4NM2A 5HDKA 4IF4A 4F5QA 3BR0A 4DZPA 2ZXHA 3JRMO 8ICLA 2L5QA 4R8HA 3FXQA 4R32A 4KLGA 1IN4A 3S32A 4IOCF 1PP7U 3C8GB 3DU6A 2FBIA 2L4AA 5HRFA 4GXKA 2V79A 2MBFA 1T2KA 3ZMUA 3LSJA 2YUSA 3HSEA 3ML6A 2M2TA 2BCUA 1E3OC 3US6A 3F8BA 3F6OA 5DD8A 1RKCA 4KB6A 3L09A 2Z99A 3MKYB 3TGNA 2ZJRF 3RPUD 4M9LA 3V7OA 4FAPB 2BXYA 3DTEA 2IYLD 4EGZA 1B1BA 3KEOA 4H0EA 1T6IA 1IV8A 2ECCA 1K83J 2LSEA 1X19A 3ZVRA 3VRCA 5IIIA 3G6EI 3CZ6A 1JKPC 2A61A 3EGXA 1MIWA 4PFPA 3HOXJ 1NG1A 3V7JA 4LLNA 2M45A 2D45A 2A5YB 1GDTA 1L0OC 3RJEA 1R1VA 3DI5A 5D5XB 2XRHA 3M7GA 2XV4S 5ICCA 2BXZA 1PCXA 5B3QA 5JLXA 1Z3YA 2XB5A 3H9JA 3JRGA 1J9IA 5M5YJ 4CS8C 256BA 3DWLE 1TFYA 1EI7A 4NC7A 1WI9A 2HWVA 4HZFA 2NVUB 3N0TA 5TJ5E 1G3SA 2FD5A 2EFNA 4YCXA 2Y30A 4AYBN 1XZPA 1JMSA 4KLDA 8ICEA 4AT9A 1ZQYA 3KFWX 1E85A 2KDOA 2V7FA 4M9XA 1I1SA 2GA1A 2CFOA 3R6SA 5J2DA 3N05A 2HKXA 1Z7UA 5J0XA 4A3CJ 2QCOA 3A0HC 2E1OA 3N97A 2OZ6A 3U1KA 3V5ZA 3HJ1A 3CCUI 1UHSA 4BXUA 1BM9A 1UHWA 2VT3A 1CGPA 5IILA 3H3AA 3RH4A 5F27A 4K0DA 1AU7A 4KC9A 2JN6A 2ZXOA 4KITB 3ZGKA 2VXDA 2V4JC 3K7AJ 5AGFA 4OINF 5J2HA 4JKVA 3VOEA 3FM3A 3I0TA 3IKTA 1EF4A 1T6QA 4G6TB 4C7OB 3LSPA 2PFPA 7ICOA 4P55A 2R7TA 2BW3A 2R7WA 2XM4A 3S2DJ 5DQZA 2HQ5A 3JRDA 1UFBA 3GWZA 2HKVA 1LI5A 3QVZA 2DAOA 2D1HA 2XAUA 1TW2A 2A1DD 2H94A 4LG3A 5DQTA 1AUEA 4LK1F 1ZHYA 4G8XA 4BHCA 2D4UA 2FQ3A 4O9MA 2YVKA 3GTGJ 1YOVB 3VFZA 4WC4A 3NARA 3BC8A 2CYYA 3EYYA 4ITVA 4IRIA 1NZEA 5HS9A 1WTYA 3GANA 4M9GA 2DGJA 3K1MA 2AVKA 3LJBA 2R7FA 3DQVC 3SZPA 3NYJA 5ICFA 3TK0A 5JI6A 3SDBA 1RCPA 5HRDA 5LEKA 3GWLA 2R0QC 4LT6A 3BG9A 4A3FJ 2NUPB 3S2WA 2IA1A 4E6KG 1F1ZA 5J8FA 1USTA 3GODA 4LDKA 3PHF2 2H09A 9ICXA 3OMYA 9ICAA 3CESA 3SEZA 5DM6F 2ZH9A 2PN6A 4AT9B 4X4QA 2ETSA 2FA5A 5DKWA 2O9XA 1USSA 5J29A 3CDHA 2RN7A 4I76A 4LERA 1A36A 1V5FA 4Z2YA 1DOVA 2VN2A 4KIBA 4P2HA 4WBZA 4M71A 2HVQA 4I1OB 2YKZA 2DXIA 3Q5FA 5IP6A 3GWNA 3CCJI 9ICWA 1VQ8I 4IJAA 1NHAA 4XBFA 4FHTA 5K7HA 1QVXA 4NKUA 4EGWA 1HDPA 2X1DA 4D0PA 1VNDA 2G0EA 1XSXA 2L3DA 2ACJA 3PUBA 4EEBA 4K9BA 3G1OA 2JPUA 5EJCA 3W6VA 3ER8C 4BJ6C 2EZKA 2VBYA 3MBGA 4YL1A 3WE2A 1WRJA 2W9YA 4UUTA 1R58A 3L8JA 1XPXA 4YRVA 4WH5A 2R3SA 3DZAA 3ABMH 3HOSA 2BPFA 3RTRA 4K2EA 2A05A 4M9ZA 1T6UA 4HF1A 2FMSA 3U9JA 1JXSA 2KJBA 2I15A 4RGRA 3WFOA 5ILSA 1PVEA 3GTQJ 1R7JA 1MMGA 2ME6A 1A7VA 7ICIA 8ICOA 4E7KA 5HRGA 4YIIA 3NYLA 2WVQA 1POGA 5E3AA 1JKRC 2RDPA 4FH5A 4QTRA 4M74A 4DVYP 5DYMA 2M2WA 2W48A 3V8JA 1FAPB 3JTLO 1B6AA 3EUHA 2E35A 1Y1VJ 4WWCA 5DB7A 4HV6A 2HN1A 4C3HJ 4WGYA 2Y3HA 4UB5A 4WGZA 2K9NA 2EZIA 4MEYF 3VYRB 4XKVA 3PHZA 1OCOH 1P9QC 2QYOA 3M3YJ 3LMMA 4RAFA 2XB0X 2HOTA 2GA9D 3PMNA 5KNLA 2P1AA 9ICGA 1V3FA 3H36A 4CJOA 1RRJA 1OCTC 5EDNA 3RJGA 2BE3A 5FLXK 2H6CA 5HRIA 3DAFA 3K1NA 3JCFA 1ZJNA 4NLZA 3RKXA 5LHIA 4XONA 2J9UA 2ID3A 3OIPA 1K79A 2A5WA 2ESNA 1Z1DA 4PHPA 3CLQA 2W85A 2GOXB 4O69A 3ISDA 2ZXPA 1OISA 1WSUA 2A0BA 2MW8A 3D5RC 4Q48A 4XLPF 4FQGA 3PQJA 4PJMA 3CCLI 3H5AA 4KYWA 4K99A 1BI0A 2PFDA 1FP1D 1MJAA 2XGEA 5F0FA 3F21A 3S9OA 3GFJA 2OPTA 3PO2J 3BR1A 2Y0SN 2ZXRA 4ZTFA 2B51A 4K98A 5J0OA 2DOEA 5CJ9A 1ZHTA 3AGUA 5L0IA 4KLOA 1JAFA 2OU2A 4XEFA 4ENNA 3MEXA 3UNGC 4IZZA 1OCRC 3PQKA 2HS5A 5D91A 4FT8A 3BG6A 1JTXA 3HNLA 1LDKB 2PJRA 4N06A 3J7YJ 4E7JA 1XGOA 1ZLKA 4XICA 2XLOA 3CK6A 4I2CA 2R4GA 2H6BA 2R9RB 5D49A 3EQLF 2M64A 1BI1A 2M2UA 3QVYA 1FMVA 4Q4ZF 1MIJA 2B0LA 3OYDA 4IHWA 2EQRA 3WFPA 4IHVA 5LHHA 2Z9OA 3AKZA 2VJ4A 3DKAA 2K3PA 4CXFA 1ON1A 2IRFG 4FESA 4F92B 4AVPA 1UEUA 4ENKA 2M30A 4D5CA 2PI0A 2OOCA 3U2LA 1OW8A 3OOUA 2GWWA 3L2WA 3ERED 3H3UA 4U5DE 3FISA 3GTMJ 2EJRA 2VPRA 2P5KA 3I5PA 3CCMI 3LQCB 3LSRA 4A2NB 4MTFA 3WFQE 1QZEA 4FTHA 3T9OA 2W25A 4GXJA 3RJIA 1ZQJA 3S93A 1WQ2A 2YLIA 4MVMA 2FUG2 3S1MJ 5L3QA 3SQNA 4ZDPA 2FMPA 2KIUA 4XLHA 1ZVZA 2EPFA 3TP3A 1S72I 2HXOA 4JBAA 1QPUA 4M9HA 2VKHA 3TW7A 1YVIA 4UB8C 3N4MA 3KP4A 2LFDA 4XORA 1ZRFA 2XRNA 3F72A 2BC5A 8ICFA 1G6NA 2XVCA 2NOJB 5ERIA 2JQ7A 1PUFA 9ICBA 2M5WA 3WTSC 3S15J 2EV6A 2OEXA 3H35A 1DDNA 4XEKA 1MIYA 3B0YA 1MW7A 5DS4A 4Y4RA 3GZ6A 3AG1C 4NCQA 2HN2A 4RMNA 1GVJA 1TVAA 1LVKA 1EH6A 4E7ZA 1WJFA 4A3DJ 3HXLA 4EM2A 3H2VA 2A3SA 3HOWJ 1EH8A 9ICTA 2I8DA 4GCVA 3K4KA 3BZCA 4HLXA 4XOTA 4C30A 1DUXC 5HC9A 3L8IA 5JRAA 2XAHA 3NRVA 3EHMA 2IA2A 3HBLA 4UY8I 4KMFA 1AKHA 3GO5A 4M6VA 8ICZA 1MMDA 3H0GJ 3EJNA 3GZ5A 3DM9B 4TV7A 2UXNA 1R8CA 3QAHA 1YA7O 4O6JA 1PP8F 2GAUA 4MGRA 5DV5A 1VQOI 2IS1A 1H7IA 3FOOA 1FBUA 3MYFA 3M07A 3X2QC 3HZJA 2OU6A 4XJEA 4Q7CA 1MH3A 1WH5A 5L3GA 4ZH4F 1ZK8A 2DA4A 2ADUA 4DYRA 1HE9A 4JJFA 8ICBA 2W4MA 2OKUA 3DLLF 1CF7A 4QZDA 5AONA 3DD7A 3L9FA 3W6KB 2JZYA 1XTAA 3AG3H 4KMUX 4WF2A 2IT0A 1X1BA 3BLYA 3TQOA 1D8KA 3OWGA 4TUQA 4UD5A 2RQPA 4HG2A 5COFA 2L02A 4RPXA 1BA5A 5IP7J 2GQQA 1V4AA 3QYEA 3K4NA 2CGEA 4O5CA 1GGQA 2ZXJA 5J1UA 1YHQI 2XS8A 4FHWA 4X0GA 2RC4A 4I0AA 4MO7A 4C3BA 4CIHA 1Z67A 4AE4B 2XAFA 4BL0B 1T39A 8ICCA 5E20A 2COBA 2P6VA 4B8XA 3H92A 4B1RA 1S7OA 1KONA 5K1YA 3B02A 1VTMP 2EV0A 2BBYA 3JPNA 1OLTA 1RJ9B 2AXTC 3O3KA 3S3NA 1Y6DA 3K33A 2LRDA 5AC4A 3H65A 4P9FA 5E1WA 4LDQA 3GTKJ 2NG1A 1VI0A 2ZPAA 2MHRA 4LLLA 4CH7A 1R71A 3NYBA 4HRIA 1RUNA 2HDCA 2ZFUA 5E8GA 2X6WA 3MQ0A 1KQ9A 4HNUA 1YRNA 5HHHA 5BOMA 4RPZA 1P4XA 2Y9ZA 4OAYA 2L4MA 3O2PE 4RDAA 2GBYA 1LVAA 4IRHA 4CCJA 4ESFA 2NS8A 3FK6A 2DMUA 5EEGA 2O03A 4CYCB 1U0BB 7ICHA 4DBRA 3WTYC 1K4TA 2EFQA 2LF8A 3CUQB 1VQ9I 3HSFA 2OQMA 2DDAA 5E8IA 1LUJB 3K1IC 2VCBA 4E7XA 3EG9B 3ZCOA 4KLEA 2RD9A 7ICQA 2NUTB 4XQ8A 2E1CA 3M15A 5D62A 1W0TA 2DJNA 1TWHJ 2DT6A 3CJRB 3B6AA 5HNFA 3HRUA 1VQLI 3PCVA 1Y39A 4MVUA 3J06A 2DR7A 2PQ8A 3OGUA 3O39A 4A2UA 3CJTB 2F22A 2IXNA 1MSEC 2GM4A 4BPMA 2JJ7A 2HSBA 4BJ5A 5DBCA 2PXIA 5HHIA 4UHTA 2BCQA 2HFIA 2NS0A 4M6YA 4CCOA 1LDDA 3JT1A 1ETKA 2OJED 2X6YA 4QZFA 5FKOA 1YIJI 3DFGA 2G9WA 1R36A 1SFKA 1F5TA 1XS9A 3RJPA 4D9JA 2P0WA 2Y69C 4DRIB 4PZJA 3W2VA 5EZGA 3I4NJ 3UXNA 4P6IC 1XMAA 5JVTA 1LFUP 2BVLA 3RYLA 2JD3A 5CPRB 3I4PA 1WJBA 1G3WA 4CCLA 5F1RA 3JZ0A 3OYFA 1RMVA 5J2FA 3RSNA 4G7HF 4QZHA 2HUJA 2JSCA 3A4CA 3QU3A 4F7ZA 4M3BA 4EV6A 3RJKA 1X1DA 4JLZA 2YL0A 1RZTA 1T0FC 4CDAA 1FT9A 1M2VA 3R7CA 1MBGA 5DS5A 2F5VA 4W8KA 5J0TA 3HM5A 4QPQA 3DKWA 4EJUA 3CUQA 5EG0A 1IC8A 1OYIA 4ZDOA 4QZCA 3T0YA 1LI7A 2OG2A 3EZIA 4E17A 1A6QA 3ITFA 4XTKA 2E5ZA 1BR4A 8ICNA 5ICEA 8ICUA 1XN7A 3QPLA 3DE8A 2MABA 2VJJA 4ZC3A 3SEOA 1HW5A 1AEPA 4M2YA 4C9YA 3UPSA 3CJNA 3IAM2 4EKWA 5DB6A 4UDVA 1ZQLA 2WZFA 4M9NA 4Y3OA 2XF6A 5DECA 4IQWA 4GDFA 4PSXA 2JT1A 3A03A 1SFEA 1GVDA 2A69F 2VBWA 4BYYA 3NDBB 2DR9A 1ETXA 3BEHA 3WTUC 1XGSA 4A5MA 1E83A 2P6TA 1X4PA 5LBQA 5IIOA 4A3JJ 3PO3J 4F93B 1W7PA 1JOGA 2VB6A 2YPRA 3ZQCA 1MH4A 3GYHX 2V9KA 1YJ9I 2NVQJ 1T0FA 2FSWA 3P7NA 3VSKA 3GFMA 4XRHA 1ZQBA 3CO6C 1JGGA 2F4MB 5J1RA 2XXAB 4WCWA 5F6FA 3FK7A 5HLGA 5J47A 4HQEA 1D8JA 4UB1A 2NAZA 1B9MA 2E1MC 3BTCA 1TR2A 2DFFA 4Z9JA 2EFPA 5BOXA 3OV7A 2IHMA 1KDHA 1BPDA 5ED4A 3RKQA 1KU7A 3BR5A 2CSOA 3B6CA 5FKLA 2CU7A 4EVIA 4AM3A 2L7KA 3MDAA 1HUZA 2P7VB 4XRFA 2VOPA 4L9NA 3B73A 5C4XJ 4DO9A 4L5JA 3TDUC 4XKBA 3ABKH 1LFBA 3FAPB 5CWRA 2VBZA 1T56A 3FMSA 4A6EA 4XIDA 2ZO4A 2WY7Q 5EEAA 3JRFA 2JA8J 1OJLA 4G7OF 3CQZA 3G4ZA 4X4OA 1R49A 3SXYA 3FMRA 1YG2A 4M72A 2HOEA 1RI7A 1PD1A 1VQKI 4U9DA 2M0MA 1PUEE 2PMUA 1LDJA 4JTAB 1STZA 1P2FA 1KYWA 3BJOA 3G2BA 4ZYEA 5CHEA 1ZQEA 3OVSA 4Z6YA 3NMIA 3RKOF 3KYLA 3K70D 1VQ6I 2DCEA 1Z91A 2YEVA 1M57C 1WVRA 2X0LA 4DZJA 4HDUA 1HY5A 4HPQA 3L2RA 3MD2A 2RNGA 5IYBJ 4E0HA 1N78A 2GZWA 1ZQKA 1KU2A 3CJQB 4ATBA 4IQ4A 2HPMA 1N77A 1QSPA 2WB7A 2QEXI 3EG9A 1FYKA 2ELKA 2CFXA 3JCUQ 5EEHA 1YO5C 4B4CA 2STWA 3PDMP 4TUPA 1BC7C 2ZH1A 3SEQA 1GV2A 3QP6A 3R4KA 5LGNA 3OSGA 3NQOA 1W36D 1T9KA 2ID6A 1IUFA 2KC3A 1HF0A 2L6HA 4ZDLA 1FLIA 1R1UA 2IGKA 4PHEA 1XDSA 2HQNA 4QZAA 5GPGB 2L6GA 2VOOA 3BR3A 4ANJA 1HE1A 2QLAA 1FFTC 4IL6C 4MNDA 3WTZA 5DEDA 4RQ5A 4S04A 3J7AY 3KYJA 2NVXJ 3LNQA 4JWMA 3CO7C 2L7AA 3S90A 1PUFB 2J7PD 2Z3YA 3PNVA 3F3XA 2KLOA 5FKMA 1J09A 5HR9A 3ISPA 4EHPA 4CCKA 5DB9A 4CS7A 2BHYA 3L34A 3ZMZA 1LE4A 2VQHA 4QI2A 5A69A 2DTRA 1WN0A 4MQ9F 4ASNA 3L2UA 2GWRA 5DD4A 1JPJA 3ZQLA 1HDDC 4HEAJ 5KYYB 2O1PA 3H3VK 1S7EA 5F1JA 4Q5SF 2FOKA 3LNRA 1YE9A 2YL1A 2DR8A 5CVUA 3JR9A 4CSWA 4LLEA 1WOTA 1LE8A 4M3EA 3V72A 1MZBA 2LY9A 3QP5A 3UR3C 5GTHC 2VL8A 3DTKA 1MJ9A 1WJDA 4X4PA 3CCSI 1AA7A 4WXCA 1K04A 4YMNA 2NVTJ 1ZQCA 3CMMA 2XLHA 4O7GA 4K96A 2OA4A 2K02A 4DYCA 2E71A 2CNWA 4IQTA 2M2EA 2B7EA 2VCCA 4P4MA 3BG3A 4R65A 4FWVA 1Z9CA 3ZXSA 4X0BA 2QSFX 2ZMEB 4ULWA 1JN3A 5IINA 1IN7A 4KN4X 5D5UB 2Y3DA 3Q6MA 3BT9A 4L5EA 3Q6NA 1LM3B 1QQIA 3G3ZA 2O8KA 4BJ5C 2MGQA 7ICRA 3S1NJ 3C2LA 4DBQA 2E19A 2LBFB 2LY2A 1YI2I 2M1BA 1FIPA 1AWCA 4F91B 3HOTA 2YHSA 4CDYA 1LNWA 4RQ0A 1TWFJ 3CC2I 2HTSA 2AS5F 3GXOA 1S9HA 3S28A 4U7DA 4BKXA 5IT9Z 5CFUA 2OV7A 4KBLA 2NXNB 2XAGA 4PGYA 1OCCH 3HGYA 3ZQFA 4PK4A 4A6DA 1LB2A 3ZOBA 1WZ2A 3V5XA 3RI4A 3T8RA 4XPWA 2KPMA 3G1LA 3LQQA 1OR7A 2RREA 3HL2A 3MWMA 4AD9A 3H39A 3Q9SA 3HPGA 1Z3XA 3BDDA 4JRZA 1D1AA 3GMEA 2ELJA 1QKRA 1YJGA 1EKEA 1R4TA 4JLXA 1UJ8A 4DNCA 4NXWA 4BAYA 4Z6FA 5TGTA 4E18A 3ABMC 2CUJA 2PF4E 3A2KA 2P8TA 4NLNA 3DCFA 3CDIA 3CMYA 1GXQA 2L01A 5K5QA 4D1QA 1XWJA 1A41A 3U8PA 5HRLA 3C2HA 7ICMA 3EZHA 4RWNA 1IXSB 1F9NA 4P9UA 4OAFA 1TT5B 5EF6A 3H0DA 3LEOA 1GLNA 1TQMA 2V9VA 3DBHB 1QA6A 4EQQA 4CGZA 3B0UX 1R5GA 3SXKA 3GM2A 4MEXF 5B1AH 1VQMI 3HNKA 4AK9A 4BHBA 1Y8QB 1O3QA 1IRGA 2JX0A 5LRSA 1W36C 3DP7A 2LF7A 1VLSA 2VT2A 1RIOH 3ROUA 1LPEA 2ZBKA 2W1OA 2XLVA 4FO1A 1ZHFA 4R66A 2HV6A 1O3RA 3QYFA 4IOAF 1UFMA 3HHGA 4PGGA 1R8BA 1I1GA 3LNMB 3ASNH 4Z9IA 4MVOA 1O57A 2MLGA 3QPHA 2XIGA 3A0BC 4ER9A 4RB2C 5KYUB 1ZQSA 2BPGA 1K61A 3TO7A 1SC7A 5DB8A 4Z6DA 3AQCA 4BUPA 3I53A 1N1CA 4LLCA 4M63A 3QPTA 1XMXA 5L3CA 2K9MA 3GTJJ 4FX5A 1XG1A 2OTLI 4A0YA 4LDRA 1SD4A 4GXOA 2X1EA 4RLQA 2M7BA 1EH7A 3COAC 1ERDA 1ZGAA 4XRSA 2VQLA 3AOUA 3M1CB 4I3MA 2ZJ2A 4N4NB 4I28A 1I4YA 3KX2A 3QOPA 4NLKA 2LYCA 3OV8A 5GAGJ 1WJ5A 5CFSA 9ICFA 2WV0A 1JT6A 9ICJA 4YK5A 3ZG1A 4X4RA 9ICRA 4MTEA 3JRAA 3T6BA 4B48A 2ZNYA 2K7LA 3AQLA 2PG4A 4HV5A 5DEQA 3SXZA 2DA6A 2Z33A 4M0AA 3KCCA 3JPSA 5HDNA 4JZAA 1O87A 5E3NA 4LEVA 3IH2A 2DYSH 2TDXA 2R92J 5M5XJ 2BVMA 4RBOA 1J0RA 2W00A 3ISCA 3KKBA 2W84A 3JRHA 4X1EA 2ZH2A 3LLIA 2ISYA 4I2FA 3G1MA 2MC4A 1UCRA 1KU9A 4XPYA 1RKWA 4KICA 1SR2A 4QZ8A 3TOLA 4ESBA 3E5XA 5F04A 1NO5A 1WOLA 1FIAA 2A0UA 3EGDA 1UZCA 2NUTA 3W8HA 4CDVA 1RPLA 2HZ8A 3NKUA 4K4IA 5JVEA 4P1WA 1IDZA 1BR2A 3GZNB 4J7TA 3RKWA 4I02A 1XD7A 2ZSHB 1OXBA 2AXLA 5JFRA 3CF2A 4PHAA 3OL3A 3TBIA 4L18B 1IRZA 3LA3A 1BPBA 2ZHAA 1F4KA 4X4VA 2FJ1A 1FYLA 1Q1VA 2K40A 2Y9YA 1ZQRA 3ZN1A 5LGUA 3L2QA 3AQKA 1Z6RA 1BBYA 4I01A 1R1TA 3KLNA 3Q3SA 5DM7F 1W5SA 1W1WE 2H1LA 2XDVA 2GIVA 2K9SA 4IHTA 1JI8A 4O6MA 1YS6A 7ICGA 2IM8A 4CSAC 4WQKA 1OKRA 3SYTA 2H7BA 1CPRA 1IJWC 4QZBA 2O5RA 1E84A 3AFHA 4A0XA 1YW9A 3EETA 3FDQA 1S5LC 2FEZA 2LSOA 2LTPA 5L3DA 5A2QK 1LIHA 1YYJA 1G59A 4FX4A 3BPXA 2Y3GA 4KNYA 4LLGF 3FZVA 2W4BA 2Y75A 2NYXA 1OCOC 5KYWB 2ICWG 3A02A 5B66C 2LNBA 4MLOA 1JJ6C 4CDGA 1S6LA 3RIPA 5D46A 1T01A 5EG0B 4KLUA 1B4AA 3GX4X 1KYZA 5CVJA 4LG0B 2ISZA 3HOUJ 3KZZA 5L3EA 5JLIA 1TLHB 3KP5A 4YFXF 3EGDB 3EH1A 3H5NA 4KLHA 4CZZA 1OXKA 3K4CA 1UELB 2I9GA 5FFXA 3DV8A 1LFPA 2K85A 3H1CA 5B5EC 3AL0B 2XL4A 3B0PA 3Q7LA 2OQRA 4EBBA 2O5AA 2GXAA 4L0ZB 4CHUA 2DQLA 1FOYA 2JA2A 2FNPA 2IBFA 4BY7J 1T95A 1E3PA 1FBSA 2XPUA 4HOBA 2EA2A 2HJMA 2J46A 2XSEA 4ETSA 4JCZA 4XLEA 3I55I 1ETQA 3FAJA 3MMYB 1IZMA 4YJWA 1YAUO 1WKMA 4XMYA 5M3FJ 4A12A 4YD2A 4U88A 4G0HA 1WJAA 3ZMSA 1Y6IA 3HB9A 3KYDB 3SP1A 1HXDA 3PFIA 1BIAA 2LFBA 4NHJA 2CCYA 5FZTA 4EM0B 5HODA 2HMZA 3Q0WA 3E5QA 1OKKA 2DT5A 3BTJA 4I2OA 1MIVA 2BEOA 1IAWA 5FROA 2EIMH 4E0IA 1Q1HA 4QZGA 5C4JJ 1QGPA 2HR3A 3KEYA 4MNUA 1LE2A 5D6FA 3DJUB 5F08A 2J9BA 2UUHA 4M6XA 3OIOA 4BS9A 1RC9A 2YQYA 4DRHB 1LE8B 3B71A 1ZRCA 1RR8C 3K4LA 4HX7A 5F64A 1U5TB 3BWGA 4KJZA 2M0CA 4HNVA 5EGOA 2PBIA 5FKNA 4BJ6A 3KLOA 4A3KJ 2W4SA 5K5RA 1YJNI 2EFWA 1JRAA 1X2NA 3IQCA 4W8PA 5J40A 4LZDA 2L9RA 2VPLA 2KRHA 9ICKA 4JURI 4N9IA 3ECSA 1AVOB 2KJCA 3ZRGA 3CF5F 3JSOA 1GT0C 1A0BA 1B8IB 4U0WA 3SFZA 7ICEA 5DCMB 4JC7A 2ZXWH 1ETVA 5D4RA 1G4DA 3SZRA 3K6GA 3O6XA 3A11A 1UETA 2BCSA 1ZHXA 4XEVA 3TFSA 2VQGA 9ICMA 5CQEA 3LWFA 1MBEA 9ICIA 2R7OA 3CP2A 2PEXA 1JKOC 2WADA 4Y15A 4PUSA 9ICEA 2VLAA 2OD5A 1T5OA 3F46A 3NG1A 1NSGB 2K9QA 2R5ZA 2QQ8A 3PSFA 1I3AA 5HVQC 3RCOA 1YLMA 3LSHA 1TL8A 4YEJA 4HF2A 1FY7A 4F5RA 2G7UA 2B63J 3HKZN 4O5EA 4DOBA 1Z05A 1ZQTA 2D2WA 2Z5UA 3I71A 1R6RA 2WVNA 5J2IA 3FXLA 3HKKA 1FNTc 5H6RA 2MA3A 4RB3C 4A93J 3PFYA 3CLOA 3ZR8X 2LP4A 3WAQA 4CBEA 5E33A 5AC5A 2Z1DA 1YS7A 4JWNA 4LMYA 2ZHBA 2HQRA 3HJEA 2DRBA 4HE8D 4ESJA 1DGWY 4LITA 3RPQA 1B72A 4MF8A 2F5EA 5E79C 1D5YA 1HKTA 3FXOA 5F28E 1Y56A 2QA4I 4RQ8A 3K1IA 3UQ2A 4RLFA 2XLWA 4LVSA 4IQJA 1WASA 4IHSA 1ORSC 1WH7A 2I5UA 2Q00A 2EH3A 1D1BA 2IXMA 4I6ZA 3MFKA 3M4OJ 3OYNA 4NTBA 2COMA 4OIRF 1B8IA 2UWMA 2O61A 2FQ4A 2N8GA 3R61A 2XM0A 4IRGA 4GO1A 3S0XA 3A9CA 3BPVA 3GLXA 3POVA 3FXKA 1MBFA 3WTTC 3ZIBA 4UVAA 3JPPA 3CCYA 4RAYA 3RQ4A 5C44J 5E17F 9ICVA 2HZTA 3CP8A 2DODA 1WGXA 4BH9A 1OCCC 1ZHWA 1JUSA 2M87A 4AIDA 3T5XA 2RAEA 3CMAI 4GEHA 1FTZA 2O3FA 1MNEA 1VTNC 3BR2A 1TBXA 4BXFA 1CGOA 4JJGA 5J1YA 1ZQQA 1HUOA 5DVWA 5C3EJ 1FWZA 1BDJB 4K4GA 4LIVA 1XB4A 3BJ6A 4OIOF 4PH5A 2DDBA 1ZG5A 4E7IA 3UXPA 1F36A 4LB5A 4K1OA 1BPZA 4JVSA 2HFHA 1BI2A 2GXGA 5FO5A 1HMDA 3FXMA 3J81K 3VPRA 2V9PA 5K7FA 3U0CA 3EDPA 3MAJA 4UV9A 2VKVA 1TWCA 2RGVA 1E3HA 2M2VA 3H5RA 2LH9A 4D4XA 2BGCA 1B59A 3HIFA 4GQHA 3H9GA 3JRCA 1EA3A 2YR2A 3GF2A 4NC3A 2PFNA 5AIQA 2MWQA 2GOMA 1U2WA 2VKDA 1JUPA 3OVBA 5KAIC 1TW3A 2GXBA 3RZOJ 2ZD9A 3DWWA 4MVRA 2ID1A 4FASD 2C04A 4WXDA 4XSZF 4B09A 5IPAA 3CUQC 1K78B 5K5OA 3J80K 4JCHA 2G62A 3EH2A 2NSFA 4L6RA 3UMKA 3B0XA 1RZ4A 2LOOA 5D4BA 4IHXA 1LQ1A 4KNWA 2CUEA 1RPWA 3S84A 4V2FA 5FGMA 3CC4I 2XSDC 3PNYA 2M9HA 2L9JA 3ZPLA 3M4BA 4IJJA 2PFOA 2JA5J 1H9TA 1J7KA 1I27A 3VYTB 2YWAA 1ZQPA 2PBEA 1ZN2A 2LK2A 3DEEA 1U78A 5CI8A 2O6GE 4R79A 2XHKA 4HBLA 4YIFA 3HW8A 3DTIA 1SMTA 2DW4A 3ELKA 5FD5A 3SJMA 4YT5A 3RH5A 2ZKZA 2YU3A 1FPQA 3RH3A 4WC7A 1Z77A 3NEUA 2LDUA 1NU7D 2EINC 3NKEA 3IRRA 4IAOA 3T6JA 1FR0A 3H3ZA 5A6KA 3CCVI 4NY8A 4A3GJ 5LEJA 4RQ4A 5KHDA 2HPIA 1ZQHA 1JMWA 2GLOA 1HOMA 3FXHA 5HRKA 3K66A 5GPCA 1DU6A 1ZQZA 1BIBA 5IYDJ 3OS0A 2OJQA 2GDCA 1LKXA 3KP6A 1VK5A 3OYGA 4EGYA 4S05A 4MFCA 5DLJA 3LQRA 4U5FE 4Y52J 4E7HA 2DB4A 1TNSA 5A2QZ 2HKOA 3HDDA 4XNFA 2R05A 4BEJA 3DPTA 3G4XA 1E0EA 2L9NA 3BR6A 3S2HJ 4G6DA 3C18A 3ECHA 4IO9F 2M8GX 2F5CA 1QHHD 3ZQ7A 1I5NA 4WBYA 5DDYA 1BC8C 3H2UA 1PYVA 1R4MB 2UUZA 3OA1A 1I4ZA 3I54A 4MHGA 2O7OA 2DYSC 5FCLA 3M79A 2F5DA 2FU4A 2IW5A 2K27A 1XZQA 2IUBA 3AG1H 4X4SA 1YJWI 1ZH5A 3UMHA 3TO6A 3AU2A 2EZLA 1XC5A 2PMHA 1YIOA 4MVSA 1K4SA 3GTPJ 3R2PA 2IXOA 2M34A 1JE8A 3IP4B 2DA3A 2ZSIB 1G3TA 5TISC 3FOPA 4RWOA 4I29A 3GFIA 2BL2A 4MQVA 3JPOA 5CFTA 5DS9A 1FX7A 1FOXA 2IGMA 3KEQA 2OCCH 1MBJA 2DRAA 5FB2A 3AL0C 1TV9A 8ICPA 4I2JA 3SXMA 1HSTA 5E3OA 2WWYA 4BY1J 1IO2A 1QZYA 2Q2EA 5A6BA 4RB1A 4I0BA 1DP3A 1S05A 4IGGA 4N7RA 2CJJA 3MZ8A 3E0JB 1ZR4A 1VYIA 1HMOA 4NXVA 4OD5A 3SZGA 2R7UA 2OQGA 4HEA2 4DJ9A 5IIKA 2TCTA 4XPXA 4RQ6A 2KZVA 3CD6I 4U5BE 3REOA 3E6MA 2LP0A 5E3CA 3HRTA 2QSHX 2BV6A 1LEAA 3K69A 1KA8A 2LY1A 2LLKA 3I4UA 4B3XA 3BG7A 1DQUA 2JTVA 4WX9A 1YYXA 1W0UA 1OR7C 2E2IJ 2E60A 2LVSA 2IXPA 3S1RJ 3RDIA 3T4RA 2NRKA 3VSLA 4UUSB 5HLHA 3DEWA 5D5VB 5CVRA 2QQBA 1RNLA 5T3TA 3EUAA 3KE2A 4JP0A 1IN6A 1TT0A 1YW8A 2E34A 1DPUA 2J8WA 1W7PB 5DDMA 1XCVA 2L54A 3FXUA 3CCEI 2IGOA 2PX9A 1U8BA 1XSDA 1JHFA 3HOYJ 3DM5A 5IY5H 3KL4A 5M5WJ 2UXXA 5T3WA 1E86A 5ILUA 3CCQI 3CQZJ 3V7CA 4IAQA 1KGSA 4YN0B 3QWLA 1MMNA 2XXAA 2CUFA 3L2VA 4DOCA 4JOMA 1YLQA 2W24A 1XSVA 2KZGA 4YMMA 2QKMB 4O5KA 2X48A 1RESA 3W3CA 3GTOJ 1U5TA 4G78A 1Z23A 3KH2A 2CQNA 4M5DA 3E6BA 2WAFA 4M9SA 1TWHA 2VCAA 3QMKA 4RS8A 5BQIA 3F8MA 3WE3A 1JT0A 1V5EA 2EB7A 2DMQA 2GIZA 4OAIZ 3LFKA 5CQGA 3UQ0A 5JSLA 4AC0A 5E1XA 4LG0A 5JP7A 4XA5A 2XF7A 3I59A 2CW8A 3BTIA 4I2HA 4IRUA 4UVBA 4MKPA 1YTYA 3OYEA 5IIMA 2KIFA 5DDGA 3ABLH 1H0MA 2PP4A 2BYVE 4IPAA 1ZU5A 4MW8A 3WG7C 1X58A 3R60A 4LIUA 2JUGA 4P5OA 1DOWA 8ICMA 8ICTA 1B68A 2JA7J 5EGYA 5JS5A 1ZQMA 3Q9VA 2ETHA 2QLZA 2OBPA 2YRFA 4KN7X 3MLGA 3ZC4A 3ASNC 3TEDA 4KLJA 2JPCA 3L7WA 5CVIA 2KP6A 1U6HA 1UG7A 2R02A 4ULVA 9ICLA 3BZ6A 3IWFA 1XCBA 3T8TA 1FTTA 1YARO 2BZTA 3FMQA 4UB6C 3IV5A 4O3MA 1ZRDA 4FETA 1EQ1A 4ATBB 1ZTRA 3OIQA 1X1CA 4AUXA 2J9VA 2OAZA 2K4JA 2HU9A 2WA0A 2EV5A 4HW0A 3RZDJ 2Q4FA 1YZAA 2HDWA 2YLDA 2B56A 4QZIA 2P5VA 1FJLA 3U1DA 5HOOA 3JRIA 2CUZA 5KYXB 1QPMA 5D5WB 4RT3A 3QYBA 1VOMA 3F8CA 3ERMA 2B0JA 1YW7A 1TC3C 2QVOA 4BGDA 2P66A 3DMDA 3U5SA 1EV7A 4E4HA 3BCBA 2IEKA 3FF5A 5EZHA 5F0HA 3K2ZA 2HOSA 4UB2A 2ZXWC 1MQ2A 5CI9A 3JSZA 3LAJA 1MD0A 2E2JJ 3QODA 4U7BA 2XS1A 4NXZA 1ZG3A 2QUFA 2W45A 4EJWA 4X6AJ 4HQMA 3RW0A 4ZLDA 5HS8A 5FD6A 1W7PD 1Z7Qc 1D0ZA 1SFUA 2DFHA 1TP4A 4KLMA 1UHMA 4B6IA 2RV8A 3K2AA 5E3LA 3X1OA 4I1MA 3V42A 4YT4A 4R64A 2HZDA 4E70A 2H8RA 4QLCU 5LGTA 4AIHA 5EYRA 2STTA 4N6CA 4NQWA 2B4VA 2MH2A 1L7CA 4AT8A 1QBJA 1J5YA 4IKFA 3QTHA 2XPVA 4EWCA 2O8XA 2Y0SA 1W2WA 5D6EA 2OCEA 3RVZA 1Y1WJ 1R23A 4JEAA 2WAQA 2DO7A 4OOIA 4CCNA 7ICTA 2GA2A 5HS7A 8ICGA 3V4GA 2Q3TA 1A35A 1Q79A 4F5NA 2WV1A 1J8MF 4X4TA 4X0RA 3U8VA 2JVGA 4EV0A 3NKDA 2PFQA 3LFUA 4IX7A 5B3SH 4E8FA 4QIWN 2IVMA 2NS7A 1VB5A 1XSNA 2ZCWA 3FBNB 4X4NA 1SMYF 2YSRA 2FX0A 1I3QJ 2BCRA 3GEZA 4WK8F 2I10A 1K40A 2Z15A 3F22A 1FZPB 2IJLA 1JPNA 4CJGA 5FLXZ 3ZWIA 2ISOA 7ICPA 2VKEA 2CV1A 1VFGA 1I39A 1Z21A 2FAPB 3S27A 1M1EB 2K5CA 1K78A 8ICSA 1A6IA 4XK4A 1MGTA 3LSMA 4XOPA 3ABKC 3K10A 3F23A 1VYKA 1C03A 1I50J 2AWYA 1W5TA 4G94A 1P92A 4O67A 4HX8A 5H20A 3S17J 2FMYA 2HV7A 4JTCB 5EOZA 4DOZA 1QRYA 1Y4CA 1ZQVA 3CAXA 2Y0MA 2RSEB 4I2AA 5D8KB 2Q1ZB 1R9TJ 1SEUA 3HTSB 2CQ7A 1ETWA 5FRNA 5LD2C 4C7OA 4E7LA 2CV2A 5FRMA 3OUYB 4QZ9A 1NFNA 2E7WA 2M8EA 3E1SA 4JYKA 3L00A 1P4WA 1V54H 2QNLA 3FKIJ 2R5YB 3HOVJ 5FLMJ 2Q8KA 3M1EA 4M3DA 5BPDA 1ONVA 2MH9A 2XAQA 4KDPA 4XLAA 5BQGA 4RGSA 2J7PA 3C8GD 5E18F 1OFCX 2KHMA 2LBFA 3VYWA 2KRFA 3M8JA 3IUOA 3CMEI 4Q47A 1O4XA 2FF4A 1Z5ZA 2YL7A 1H9GA 3VEPA 3PIPF 2DA1A 4CSAA 1HKSA 2LKPA 5JVGF 3OYLA 1BL0A 2EIKC 4N9HA 3WHBA 1V55C 2AO9A 4CZCA 4B47A 3OY9A 2EIJC 3ZN0A 1XGMA 4C2TA 3O8HA 5LRRA 2WAQN 4BNCA 3UGOA 3K70C 4RAGA 1SFOJ 1ZQ3P 5EHHA 3BP8A 4N4OB 1G8XA 1IDYA 4U5EE 3S29A 4FHXA 4UBCA 3HNJA 3RJJA 2L81A 3AU6A 3QOEA 3SDGA 2V6EA 4P96A 3OSFA 3K4BA 1D0YA 2J0WA 3RQFA 4UAWA 4O6NA 3C2MA 1F1MA 3TMOA 5A6BD 3J7AO 4MFAA 1VMAA 1ZELA 5JR3A 1WGWA 2XLMA 5KYUA 2Z2SB 8ICIA 3L1MA 2CNWD 4NM1A 4OIPF 4GRIA 1G4US 3F6VA 3TKYA 3VDXA 1SF8A 4O5VA 5TJJA 3U9GA 2A68F 4BDYA 1MNMC 1VQ5I 4XQ7A 2HYJA 5FJ8J 1MNDA 1HCRA 2VE9A 4XN0A 4G12A 3DJNB 3ASOH 4MVQA 1OCZH 2D1VA 4HLYA 5B3IA 3OUYA 4KISA 3KP3A 2AQFA 4Y33A 1H89C 5H6QA 4B44A 1LS1A 5BQTA 2IOQA 2KKOA 1YRNB 3GEIA 5HREA 2FBHA 2DT7B 4OMZA 1TWGA 5D4SA 4D5FA 1K6OA 4XKCA 1GUUA 4AIKA 2E1NA 3BQYA 4PFOA 1H88C 2Y39A 4WOYA 4L9JA 5L0DA 4JW1A 3EPVA 3H37A 2MYSA 1BJZA 4MFFA 4CS9A 1TFKB 2R7RA 2J0XA 2LK4A 3ZDLA 4EJTA 4V2GA 5J2KA 3WGGA 2CW7A 3VB2A 4I99C 2JRTA 4EMSA 2E5NA 3HSRA 1M6TA 4PR9A 2YS9A 4NC6A 3EFOB 4LACB 2EFOA 1WWPA 1ZQWA 4RA2A 4YMOA 2JSPA 1BW5A 3HRMA 1KZHA 1SYQA 2BOLA 2L2OA 2AWCA 2G3KA 4U9EA 2IS2A 3JTHA 2PNOA 1HBXG 2HHPA 3K75D 2NUPA 5COGA 2VANA 2HSQA 4IB4A 3JCUC 2X6OA 2VH3A 1WHUA 4U5CE 3EF2A 1HC8A 3CTAA 3HG9A 4FISA 2OCCC 3I5QA 1ZARA 2EK5A 3BQZA 4XLNF 1JKQC 4B43A 2P7VA 2UUIA 3FHDA 3FHZA 2DA7A 2CQQA 4XQFA 3ZP5A 3B9QA 4H4KC 4D7NA 2DK5A 1I6XA 2WC2A 2DPDA 2EPOA 4X5VA 7ICKA 1BW6A 4KT6A 1WJEA 2KW3C 3LLKA 4PJ0C 3EUHC 1OR3A 2GFHA 5D61A 5HRBA 2CV0A 3TO9A 1P4AA 4NY3A 3E7LA 2DA5A 5J2GA 2GAQA 2EWRA 1S7ZA 3ZQVA 5FFZA 2DYRC 3C5FA 1O3SA 3B0VC 3WFRE 3RVYA 4UB4A 4ON0A 4L9VA 3FKJA 3BCAA 3RKYA 3M8FA 3KP2A 2BE5F 3C2GA 2M3AA 4CYDA 2HGCA 4EEFG 2PMZA 3IL2A 3K7DA 2MG4A 5GADJ 2LKSA 3WGHA 3LK9A 3AG4H 1REPC 4K9AA 4ZLCA 1XMKA 1A31A 4HYEA 2G7HA 3JREA 5B1AC 4I2IA 4HDVA 2V1UA 1OYWA 1RUOA 1F5AA 1HW1A 2M4EA 1FA0A 5CB1A 5DBBA 9ICUA 4I2GA 4A5NA 4XRMA 3HX0A 1O3UA 1OQCA 2KRCA 1NK3P 1JGSA 2KISA 5BS6A 1U5TC 5BNGA 5DCMA 4H54A 1ZU4A 4ABZA 5J4VA 4JE9A 4AT7B 4HAMA 1QO0D 4ZTJA 4BE1A 3UMIA 5IY5C 4RWPA 1V74B 4MF2A 4HA8A 1JAJA 3H9QA 2R7SA 1NOMA 4E7SA 2V1XA 2IBDA 3FXRA 4NUBA 3PMLA 2H27A 5DS6A 2HQAA 5J2AA 1FC3A 2X4HA 2CGPA 2ZH8A 4R1HA 5IOYA 3L9DA 4EP7A 3VM6A 3K4MA 3MCZA 4I2DA 3V8LA 3RPUA 1G5ZA 4UUSA 3G50A 1W4MA 2Y48A 4OAZA 2VXZA 1HW2A 4YT8A 1R00A 4BXXJ 1NFOA 2XL6A 3KMIA 2GWSA 1ZREA 5HLTA 2I8BA 4FE7A 3HGGA 4FX0A 4YT2A 1B9NA 1SAUA 3IKVA 5L0GA 2ISPA 1CQTA 1ORYA 4RQ1A 1S7AA 2CG4A 1KEJA 4IQVA 2DOFA 5JHUA 4NQFA 4RM2A 3LSIA 5GTIC 4MFEA 4J19A 4PGQA 8ICJA 4HF0A 4RD9A 3BOQA 1ZW2A 2HI3A 3RFYA 4EIYA 3HKZA 4XKWA 4WCGA 3KIOA 3DLAA 1DU0A 1Q78A 1ZQUA 1L3PA 5J2JA 2ZH5A 3V7KA 4KLLA 2JWTA 2ZH6A 2KNHA 1IN5A 3I9V2 4TURA 2X9DA 2CO5A 4C3JJ 1XDUA 3G73A 3EYIA 1OQYA 3OS1A 1RXQA 3GEEA 5J0PA 2ZMEA 3R0AA 2P7CB 2JRMA 4GFBA 2QY9A 4W97A 3I5UA 3BTLA 4LFUA 1FYMA 4IHYA 3F47A 4AT7A 3ZMDA 4K7BA 8ICKA 5J8CA 2PJRB 3RH6A 1RR7A 4J32B 1S8NA 2EBIA 4RT2A 2CH0A 3HRSA 1EJ9A 4ZYGA 4IVNA 2KGOA 1QZXA 1R22A 8ICHA 3IH4A 5IIJA 5DUIA 2W57A 3C62A 1ZLJA 3S14J 3K1PA 2HYFA 5BUOA 1TTYA 1ORKA 1ZQDA 5H2FC 4YWQA 3SYNA 4KLSA 2CS3A 4A3LJ 3OYJA 2WB1A 3WHCA 4QSHA 3GVAA 3C5GA 1WWXA 1R5HA 4C3IJ 3KPHA 2VODA 4BEHA 3SNHA 1J59A 4KM5A 3ZTZA 1ZHZA 2Q9AA 1U3EM 2LCHA 3C8GA 5KYXA 1A7EA 3MDCA 1FSHA 5DCFA 2J5OA 1D0XA 3GM1A 4BQQA 2MC3A 2HMQA 4EUKB 4F4BA 1WI3A 4HSTA 1BOBA 4CUGA 2NPUA 1R5ID 3H38A 5CP2A 4K97A 2K86A 1OR2A 4N6HA 5M3MJ 2BBHA 2IS6A 3K0LA 1SD7A 4YN4A 5J0RA 4E80A 2X0CA 4O6AA 2AHQA 3LUTB 5JTGA 4Y7NJ 2KJGA 1SVMA 1Z0XA 3AQBA 1BN5A 9ICNA 1X3ZB 1OYYA 2Q9CA 3ABUA 2B9SA 4CX9A 5J0YA 2EA4A 1Z6TA 1X1PA 4CYCA 5BMZA 2QTVA 1P7IA 5FLVA 4ENJA 1P6RA 1NG7A 4BG0A 4HX0A 1EA8A 3E97A 4GGGA 1HA8A 3O55A 5K7ZA 3C1DA 2BW3B 3VYUB 2K9LA 1OKKD 4TUSA 2IS4A 3GEHA 1RKEA 1RKTA 2YU9J 1MQ3A 1IRXA 4A3BJ 2DN0A 3U21A 3LOCA 2DLLA 4A3EJ 5IP9J 1YFHA 3S1QJ 2CDQA 3RYPA 2KIQA 4A4AA 2JUCA 4O68A 5K0IA 8ICWA 3AJMA 2ZNZA 1QVTA 4J7YA 5CYVA 2EILH 4G6QA 5BOLA 4OAGA 4MW3A 2AU5A 2NNYA 4WC3A 4GYIA 1R89A 1PDNC 3MCRA 4BQOA 2H7VC 4RQ3A 4L5IA 3U2MA 3LAPA 2J45A 2ZH3A 2O9LA 3Q0VA 3D5SC 2KDZA 1U0JA 4XM3A 2C6YA 4D7MA 2VJ5A 3PJRA 1A5JA 1MDMA 1TQGA 2E87A 2PX0A 2QE9A 2EIMC 4HNTA 4WJ0A 4I7HA 4OIQF 4AL0A 2WB1N 1ZQFA 1JHHA 2IP2A 2WTEA 3JSPA 5IT3A 3VAYA 4B3AA 4J00A 7ICLA 2XAJA 2FMQA 4AE4A 3BG5A 4KNVA 3KETA 4X0AA 2DBBA 1J8YF 2MD5A 3OEOA 4DGWB 1X1AA 2A6TA 1TKNA 3TD7A 3JYHA 3OR1C 1IGNA 5B1BC 5JT4A 1U89A 2XL8A 3GDXA 2ZH4A 4BJTA 1NK2P 2NRAC 4C2UA 3LSGA 5J6XA 4JK1X 4AYBA 4F3QA 5LFAA 1T38A 4YFKF 2R03A 5CJ7A 3MGHA 2EIJH 3AUOA 1C17M 1ZW3A 3IRQA 5BQHA 4UV8A 1KTMA 2NSGA 3QRFF 3E9VA 1GHCA 4MVZA 1QVUA 4PJNA 1L3LA 2AP3A 4U5GA 2QSGX 1O5HA 2V1DA 2JK3A 2EPNA 1S3JA 1MBHA 1MMSA 1R4NB 4HFFB 2M4KA 3T1BA 1MJBA 3S8PA 4NTFA 4RQ2A 1T6SA 5HDGA 3OYAA 2CYDA 4IARA 4XLFA 4N0BA 3FXJA 3O8GA 2VONA 3MN2A 1X2MA 2QM3A 3RF3A 1QHGA 3GLLA 2L9VA 5IYCJ 3MKZA 3F8NA 3LA7A 3C66A 5CHGA 3JAMK 4NXXA 3MGIA 1DP7P 2YZSA 3U3BA 4FHVA 4AVZA 4CCMA 4KIFA 3NVOA 1MMAA 5HV9A 1J75A 3HNIA 2P6SA 4JX4A 4Z9HA 4UUVA 2BPCA 9ICHA 2ELHA 3OYBA 3S3OA 5HSWA 1YQAA 1SD5A 3IHUA 4BE2A 1T8IA 4JQFA 1Q0MA 2DA2A 1O3TA 2H8AA 1PX5A 2FE3A 1DGRM 3MKLA 2FXAA 4A69C 4AU7A 4BU2A 1WJCA 2H8WA 3PNTA 2R93J 2RKHA 7ICUA 1BPYA 4CS8A 4OAHA 4NBQA 2DR5A 5KAFC 4F55A 1YITI 2H7OA 4NC8A 4KFCA 3C3WA 4HX4A 3J81Z 4L0YB 3DKXA 5J2EA 2L7ZA 4ZJZA 1TQIA 4EBJA 4YG2F 3GUDA 4P4PA 2KFDA 2F4IA 3E6CC 2ESHA 2E2HJ 3DXJF 2EWNA 4DIQA 2PFBA 3DEUA 3CSKA 2JA6J 2KSFA 2XRLA 5JLWA 4JX5A 2JMWA 2X6XA 3KZIC 1IF1A 3L0IA 1X3UA 2XASA 2P5LC 3TW6A 1BOAA 4CA0A 2TRTA 1W5CC 4PJLA 3TP0A 1JJ8C 2DJIA 3TFRA 3I58A 3U2RA 2MD0A 3PM1A 9ICQA 5KK1A 5DUKA 1R8AA 3OYIA 3E5UA 2WVOA 3EHNA 4M47A 1TWCJ 1TNTA 4GYTA 5D92A 4ENMA 4LEYA 1C02A 4FO6A 5L3VA 1A04A 4IEJA 2DMTA 3C2KA 2NVYJ 1OW6A 4I98B 3SZTA 3FVYA 3EFOA 5JUAA 3ECOA 1QQ3A 2VC0A 2P0NA 8ICXA 1ZKGA 3W8IA 4RWQA 2FOWA 3V7SA 4KLQA 4K4HA 3ESWB 2HJ3A 2HTJA 7ICFA 4U5HA 1BJAA 2F2EA 2IXSA 3P9IA 1GPJA 2DVIA 2AQEA 5B3SC 2VC1A 2O0YA 4UAYA 5IT9K 4YELA 1JTYA 1QNTA 3L2CA 4LZGA 1ZR2A 3KZYA 2QKLB 4PGHA 3W6JB 2ZJPF 8ICAA 3JSEO 3RQGA 3AG4C 4DYQA 2WAEA 3AG2C 3G4SI 4GYGA 1BR1A 3KYIA 1OW7A 5HNHA 3OL4A 2KYHA 1I6HJ 4IWBA 1KQ0A 6PAXA 3AGTA 1ODDA 2XF5A 1EKYA 4YFNF 4IG8A 4J01A 3JW4A 3DPUA 4ZYAA 1XGNA 3RQIA 3SHFA 1O7FA 1QZZA 3HOZJ 3GBGA 4FH3A 4IXAA 7ICVA 2OZUA 5CR0A 2QF7A 3ERCC 1HLVA 3ATPA 2Q2EB 2OC6A 3ZMTA 5KCMA 2QBYB 2VUMJ 4BBSJ 4RBNA 3I4MJ 1PJRA 5E2QA 1ON2A 3PUFA 2E7XA 3TJ6A 2K3FA 3MYIA 3V7LA 1BPEA 3IPMO 2VASA 2OF7A 4JX6A 3TQNA 1SD6A 4LD5A 1TFOB 4MTGA 3NRHA 3P9CA 1GM5A 4PGXA 3AAFA 3W2WA 1V54C 3GM3A 1FOWA 4KLTA 1ZAOA 3HYIA 3I64A 2EINH 2ZFWA 4KUMA 4S0HB 2PJPA 3TJ5A 1U6GA 4J30B 1ETYA 2HNHA 1ACIA 2MSYA 3K9TA 3LAYA 2VJIA 1VQNI 2W9MA 3AQNA 3PNCA 3LSTA 4RB0A 2XROA 3E70C 2F6CA 1D5VA 3OWTA 2WZGA 1RETA 1ZJMA 4NQWB 3D1NI 1MSFC 2R5ZB 4BEMJ 4QDLA 1LPQA 5CIVA 3ER9B 7ICNA 2XPWA 5ICGA 5T1DB 3NYMA 1IZ1A 4AIJA 2FCLA 2BY2A 2LKXA 2L7MP 3B29A 3OYKA 1N75A 2LREA 3E3VA 3TL4X 4NTAA 4BDZA 5AIPA 2QENA 1MKMA 3QU6A 2BBJA 2V26A 1CGNA 3ZTMA 3J80Z 3N2ZB 1U9OA 2X51A 4JIOA 1TWAJ 1CF7B 1TZLA 4PSWA 4XRSG 5E3MA 1M2OA 3LEVA 4W1UA 3JPTA 4I2EA 2DFEA 3OS2A 3CCRI 4NXUA 1PD0A 2XGXA 4XLCA 3WU1B 2DOAA 2WY8Q 1ETOA 2QBYA 2QWWA 1T98A 3QZCA 5EK0A 3DAGA 4EJVA 3JTGA 2XKOA 2HVSA 3VWBA 3I56I 1ITYA 4UVCA 4NKTA 3DU5A 2DMNA 4KLIA 8ICYA 1SZIA 1AKHB 1AHDP 3HEFA 2Y2ZA 3BY6A 1CPQA 2MFZA 5GAHJ 4ZZLA 2HXIA 3L1PA 1RJ9A 1ST6A 5L0FA 3TULA 4UXNA 1KNYA 4XUSA 4BQNA 5KYYA 2VIXA 4BE0A 4I44A 3D5LA 3F9KA 2XLEA