3C18A

Crystal structure of nucleotidyltransferase-like protein (zp_00538802.1) from exiguobacterium sibiricum 255-15 at 1.90 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
GMEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQMSLSFAKLLRRFQDGRNLFSRGNYYDAYTHVHHALHHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQSKVLSGGKYLFEVMRERDRPWTMHELMEESRLTELKVDLGSLVDFFIRKGLIRISYQRTKGLGVELVTYEPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
molecule keywords Nucleotidyltransferase-like protein
total genus 107
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14540 NTF-like Nucleotidyltransferase-like
A PF18576 HTH_52 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c18A03
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3c18A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3c18A01
4K4GA 1SD4A 3WG9A 4E70A 4S05A 2L4AA 3U0CA 5IINA 3OV8A 1BPEA 2FU4A 5J0WA 4KUMA 4M9SA 2YR2A 4OIQF 1BIAA 2RV8A 4ZYDA 3UQ0A 1XSXA 1K7AA 1SMYF 5J2BA 3E3VA 5K5OA 4IJAA 5J0UA 1UFBA 5J2KA 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 4KLQA 1OKRA 1Y0UA 1MZBA 2Q66A 2IPQX 5DUKA 4QZDA 4X0AA 7ICQA 4PGQA 4HDVA 2BBYA 3NRVA 4XQ8A 3TO6A 1CF7B 5BOXA 2ISPA 4M73A 3J7AO 2M87A 2D1VA 2QQAA 4IPAA 1YO5C 7ICLA 1E17A 2D2WA 4Q47A 4HF1A 5J2FA 1I1SA 8ICZA 2DLLA 2Z3YA 3JAMZ 2ESHA 3BOQA 4ATBB 2Y48A 4NM1A 4P9UA 3OVBA 4PGGA 2PFQA 1KU7A 3KEQA 2W85A 4A6DA 4EJOA 3GM1A 4I01A 4YFKF 2Z9OA 2STWA 1GXQA 2RVCA 3HX0A 2R7FA 2B0LA 2ID1A 2FMPA 3HSFA 2CFXA 3WFSC 2HOEA 9ICHA 2ISZA 4A5NA 9ICTA 1G3SA 2BCRA 5EOZA 3KZYA 3ECHA 1XSPA 4GYIA 3HYIA 1TQMA 5IILA 1YLFA 2Y0MA 4EP7A 3ZQ7A 1XCBA 2ZH2A 1MGTA 4YD1A 3ISPA 1STZA 3C66A 2CW0F 2DR8A 9ICBA 3P9IA 1FOKA 5L3DA 4HBLA 3ROUA 3L9FA 4LMYA 4L18B 4RQ6A 1IF1A 5HS8A 2JZYA 2AS5F 3TGNA 9ICNA 4YG2F 3K0LA 4MQVA 3QU6A 1ZQOA 4Z2YA 4ESFA 3DPLC 1WSUA 5IIKA 1I27A 3BY6A 4QZ9A 4ENMA 2P66A 4PCQA 1OMIA 2NYXA 2IJLA 5FLXZ 1MIYA 5CWRA 3EYIA 8ICIA 4WC1A 5EEGA 3WTSC 1OYYA 3GZ6A 8ICPA 4AT7A 1ZG1A 3B0YA 2P5KA 2ZNZA 4OMZA 2XKOA 4EM0B 1IUYA 9ICLA 4I28A 3JAMK 1ZQNA 3HRUA 2UZKA 4AIKA 4I2BA 4Z6EA 9ICRA 2FOKA 3F6VA 4EJVA 1R7JA 4F5NA 2LNBA 1BI0A 2HYFA 1R00A 4XLNF 1W4MA 3SXYA 1XSLA 3PNCA 1OW7A 2HWVA 4EJTA 3DV8A 4RQ3A 5DDMA 3CUOA 2BPCA 1ZQVA 4F5QA 4BXUA 5D4RA 1I5ZA 4NLKA 1XN7A 3FMRA 4F7ZA 3ZMUA 2ETHA 4G7ZF 4L9VA 4LK1F 3F22A 9ICUA 1IXCA 4X0BA 5LEJA 2E1NA 3RTRA 4EJUA 3HOSA 3DP7A 4X4UA 3VOEA 4BQAA 4RQ7A 4IQVA 1ZQWA 4KA4A 4O5CA 9ICVA 2BCQA 4LLNA 4X4QA 1XGMA 5BOLA 1TQPA 2KIMA 5AIPA 3WTWC 1ZQUA 4KLDA 1QGPA 1B6AA 3P9KA 3V8LA 2PMHA 4E80A 3D5LA 1YYVA 4MTDA 4UD5A 3RH4A 3BRJA 4OIRF 2IA0A 2DRAA 2GWRA 2NAZA 1U8RA 4HQEA 2Q0OA 4M6XA 1UEUA 3LQCB 2JPCA 2KIFA 3R61A 3WTYC 4QZFA 3KP7A 1G4DA 4AT7B 5DBAA 2MD5A 2V1XA 4FHWA 1R23A 4ZYEA 1B1BA 4EBJA 3LK9A 4PHAA 5HOOA 3BJAA 4NB5A 5DCMA 5JI6A 4WC7A 2A6EF 2FMLA 4X4NA 2DFIA 4WCWA 4WBYA 4GGGA 4L9NA 4CO8A 3ISBA 5LRSA 9ICOA 1F4KA 5A2QZ 2KKOA 3GX4X 2XIGA 5L3FA 3JPNA 3TULA 8ICUA 4FH5A 3MZYA 1FYMA 4MFAA 4LT6A 8ICJA 4DOAA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 2FF4A 1K78A 4XUSA 2VXZA 4EM2A 1D3YA 4I98B 1ZRFA 3GVAA 4M9GA 3FWEA 5IIIA 2VC0A 4KIFA 1ZARA 8ICYA 4N0BA 9ICPA 4YCXA 3K69A 1NOMA 4QZ8A 2L6HA 3QP6A 9ICGA 2O1PA 3Q9SA 2NRKA 3JPRA 1BBYA 2GAUA 3TKYA 3V72A 2OZ6A 3AQMA 9ICJA 1XCVA 2ZFWA 2LK4A 3WGIA 2RKHA 5J2DA 2XUBA 1VFGA 3KCCA 2HQRA 2K86A 7ICIA 2P6TA 5J2IA 1ZHFA 4BAYA 4BHPA 1MQ2A 3FXUA 2O5AA 8ICBA 4MNUA 4KNYA 4I2IA 5JR3A 1O3RA 4HX8A 1KQ0A 2M1BA 4WBZA 4UB4A 1BPYA 1JHFA 2HDCA 3KEOA 4PH5A 1RZ4A 3T1BA 4IQUA 1XD7A 4RB1A 1IZ1A 3R0AA 2CGPA 2M2TA 1ONVA 3DPTA 2A69F 4MEYF 2DR5A 4NHJA 2XAQA 1MJAA 1R58A 2E1CA 2ZMEB 3H39A 9ICEA 2F5CA 5DUIA 4G7OF 3E6MA 4A2UA 4Y15A 4QZBA 4ENNA 1Z91A 3FM3A 1FY7A 4LK0F 2FQ3A 2H6CA 1E2XA 2BYVE 1FX7A 4TV7A 3BROA 5DDGA 3HW8A 3N4MA 4UVAA 2PFNA 3FHZA 3QP5A 4TUQA 2EJRA 1UETA 4YMNA 1HQCA 1XMKA 3SZPA 2A07F 5DBBA 3WU0A 4P2HA 2PFBA 2YU3A 3J81K 3RKXA 1ZAOA 1HW5A 2HYGD 2QQ9A 1R5GA 2ZMEA 1YIOA 2PN6A 3DKWA 1WOTA 4HLXA 3ISDA 4P96A 2OU2A 3GXOA 4HDUA 4PGYA 3MZHA 2F5EA 4HZFA 5CYVA 3VODA 2P5LC 4PPXA 4WC3A 4KLEA 8ICSA 1BPZA 2MC3A 2W57A 1JAJA 4H0EA 3K1PA 5J0PA 1RUNA 3ZMSA 4IHSA 5D5UB 2JRTA 1OR7A 4ZZLA 3Q5FA 3JSPA 1ZRDA 4CDGA 5HC9A 4MFCA 1Z9CA 1U2WA 2DR9A 3KE2A 4ESJA 3PQKA 3RJPA 2DRBA 5J0OA 4LB5A 4U88A 1CGPA 5J2AA 5BOMA 4CGZA 1KYZA 3U2RA 7ICTA 3R60A 4HLYA 2JSCA 1R5HA 3VFZA 3I59A 4MEXF 3J80Z 2GIVA 1TW2A 5J2HA 4A5MA 1ZQKA 1QNTA 1HSTA 4KLIA 3H3UA 4RWPA 4D0PA 2BPFA 4L0YB 5DD8A 5DYMA 1Z6TA 3TOBA 2O8XA 5HVQC 3IRQA 1J5YA 1C0WA 4KLHA 3L09A 4P9FA 3GF2A 1TBXA 4LG0B 1ZQZA 4XBFA 1IAWA 3KZZA 2F2EA 2ZO4A 4IQWA 4O3MA 4X4PA 4A6EA 2QBYB 4K4HA 1PP7U 3WFOA 3S2WA 1J9IA 2QWWA 4I2HA 1HUOA 5BPCA 1ZQSA 4KIGA 7ICMA 4RGXA 1F5AA 3QOPA 5D5XB 5CR0A 1HKTA 5HHHA 1G6NA 4RB0A 1QVXA 5E8IA 1SAXA 3F21A 3OVSA 1FSHA 2L01A 7ICKA 3HUGA 1IXSB 3ERED 4MGRA 3PMLA 3FZVA 9ICIA 3RPQA 1ON2A 5J2JA 4IF4A 4RT3A 2XAHA 4OOIA 5ICFA 2XASA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 3G73A 4UD4A 4M6YA 4X4OA 5D8KB 2E7XA 2KK1A 3KP3A 1ZQTA 4JWNA 3R0JA 3F3XA 4UHTA 3E6DA 2GQQA 4F5OA 5CJ9A 2ZXJA 4IRGA 2VE8A 3M7GA 2GZWA 2DI3A 2V6CA 2XAGA 3WTUC 4RQ8A 5LBQA 2DQLA 4JQFA 5LHGA 4IG8A 4WC5A 5BQTA 1UFMA 4M9LA 7ICEA 1T38A 1TFWA 4EMSA 4YFNF 2DR7A 1H9TA 5IIMA 7ICJA 4ZZDA 3WTVC 3GM3A 3OUYA 1RZTA 3O2PE 1KA8A 5HRDA 1R8BA 4S04A 1BOAA 2VC1A 3U9GA 4QWQA 1ZQEA 1H9GA 5E20A 2D45A 4UB3A 3RJHA 3LSTA 1FLIA 5CB1A 3KP4A 3GM2A 5HLHA 5D6FA 1ZG5A 1WOLA 3KETA 2PXIA 4AVPA 4E8FA 4N9IA 2A3SA 1AOYA 4X4SA 1OW8A 1MIVA 4L9TA 5ILSA 4RQ5A 4B09A 1EH7A 4KLTA 1T0FA 3ZPLA 7ICVA 1U6GA 4RAYA 3UPSA 3QAHA 3GLXA 4DOBA 1YQAA 1S7OA 4KMFA 3HIFA 2EFNA 4KLSA 1ZQYA 3TFSA 4GCVA 2VANA 5DBCA 1JXSA 2FSWA 2VODA 1D8KA 1TLHB 4AT9A 3GW2A 3RQGA 1TFYA 2M2WA 4UXNA 1HBXG 1R89A 4RQ4A 1ZLJA 3JZ0A 1S29A 2ELHA 4X4TA 4UUVA 1P4WA 5J0QA 4JWMA 4MFFA 3MWMA 2UWMA 1B9MA 4I0AA 4UV8A 3TDUC 5FD5A 1WWPA 1O57A 5FFZA 3S9OA 2QM3A 3GYHX 4CYDA 3GDXA 2DQRA 4A0YA 2IHMA 1VJ7A 2KRFA 2EFOA 2E7WA 3KP2A 3ABTA 1T39A 3N97A 2ZNYA 3MBYA 2Q8KA 5EEHA 4EM1A 2F5DA 3HHHA 4QZGA 3KFWX 3DQVC 1FBSA 9ICQA 5J0SA 4UB1A 1LNWA 1MDMB 4RQ1A 2X0LA 5D5WB 1R1VA 1U78A 2VOPA 1K40A 1QZZA 4R63A 1YS6A 2MH9A 3CTAA 5J2CA 2VONA 3MGHA 2XVCA 2GWSA 4KLOA 4DO9A 5L3CA 4RQ0A 1ZQPA 3GO5A 4LVSA 4R1HA 2CWEA 3LWFA 1MKMA 2XHKA 5D49A 3ZN0A 4WF2A 3F8BA 3Q9VA 4DQ2A 7ICOA 3WFRE 2O03A 3JW4A 8ICHA 1ZZPA 5CA7A 4GXIA 2VT3A 1BM9A 8ICVA 4KICA 3LQRA 1ZG3A 3VB2A 5D6EA 3C8GD 9ICKA 4UAZA 3L8IA 4P4OA 4UVBA 4M72A 2FBIA 1SFEA 4RGRA 2HKOA 2NS0A 2D1HA 3HOTA 2HQNA 2MLGA 4ETSA 1S7AA 1B4AA 5H6RA 4RPYA 1W7PD 4R65A 3ZN1A 2O61A 2FBHA 2Z99A 3M1EA 1IN4A 3TO9A 1LEBA 4YMOA 2DVIA 1S8NA 1U5TB 2ISOA 9ICXA 1FYLA 1ZQFA 3V7CA 1K04A 4UB5A 5IT9Z 3AQKA 3LQQA 1ZQJA 1FP2A 5DEDA 3HTSB 3WTXC 5D5VB 1ZREA 3E6BA 3C2LA 1OYIA 8ICWA 4HQMA 5FD6A 4RAZA 4M9NA 3WU1B 5LGTA 3ZMTA 3EQLF 1UEVA 4G6DA 3T8TA 5DB7A 5ICCA 3E5QA 5CVJA 3F23A 2QQBA 4RPZA 4EBKA 1WRJA 1GHCA 4PHDA 4I02A 4NXZA 4HYEA 4CXFA 2RDPA 1ZQAA 4KLFA 4G8XA 2DTRA 1Q1HA 5LGUA 7ICPA 3OOPA 4MHGA 3IL2A 3GEZA 3H38A 2DPDA 1ZQHA 2CSOA 3HTUA 1BN5A 2QUFA 1K6OA 3ZMZA 3R6SA 5A2QK 2P7VB 3KLOA 1RPLA 2KJCA 2WTEA 2ZHAA 4KFCA 2EFPA 2A5YB 3K1NA 3PQJA 3GFLA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 5CHGA 2IW5A 4ON0A 3IC7A 4HF2A 3M9AA 2UXXA 2GXBA 4KLGA 2DK8A 4UNOA 1K78B 2H09A 5IIJA 5HRBA 1O3TA 4AIHA 4E7XA 2ADUA 4I2GA 1KU3A 1DP7P 4Z6DA 4KLMA 4XSZF 1D5VA 5F64A 3JYYA 4O5EA 2G7UA 1Z1DA 9ICCA 3K75D 2OQGA 3BJ6A 1F9NA 3B02A 2ZHBA 2RC4A 4XQ7A 3OV7A 4GXKA 1LQ1A 1K79A 3DF8A 4OIOF 1WTYA 4R66A 4NLNA 4LJZF 2TDXA 5ICGA 3L8JA 3I59B 2EK5A 4UAWA 2MA3A 1NO5A 1Q79A 1D8JA 4RPXA 2EV6A 2VE9A 3RKWA 1RNLA 2L54A 3F8MA 7ICHA 4AT9B 3ZMDA 3W6JB 2AXLA 3RI4A 3QRFF 4IRHA 1R1TA 4KLUA 3I53A 1TNTA 4L9JA 2PBEA 5K1YA 3V4GA 4ENKA 4WK8F 4FHYA 4I2OA 4BYYA 1DUXC 2P4WA 4QLCU 3HRSA 1TW3A 3M8EA 1LDDA 2XAFA 3TQNA 4FHXA 2COMA 2W9MA 1ZYRF 4G7HF 3WODF 2MBFA 1V3FA 1ZJNA 4NKUA 4EGZA 4NM2A 3CUQB 4P55A 8ICQA 5J6XA 5F28E 1FA0A 3E5XA 1KNYA 2RGVA 1JGSA 1DPUA 5J0XA 1SFXA 3MAJA 3RYRA 3HWTA 3B0XA 2XROA 4QZAA 4FHPA 1Z6RA 3U1DA 3IKTA 2WC2A 3JPSA 5F6FA 5E1ZB 3F72A 3RQEA 5DCFA 2PQ8A 4F5RA 2RNJA 2CQKA 2HZTA 4I0BA 1W5TA 2FA5A 4KIBA 3RKYA 2P8TA 2EB7A 1ZQQA 4X4VA 3FXRA 1G3WA 3FMQA 3JTHA 5K5RA 1XGNA 1KU9A 4EV0A 7ICUA 3E5UA 2EWNA 2PFOA 2M30A 3RQFA 5CJ7A 1UHMA 3LAJA 1FWZA 2M45A 4GXJA 3AAFA 1KU2A 4O5VA 1ZQIA 5J0YA 1ZQBA 3ML6A 1ZQCA 2IRFG 1O7LA 4LFUA 1ZLKA 2K4JA 3IKVA 2YPRA 2IA2A 3QPHA 3ZMVA 5L3EA 5LHIA 1A04A 3RH5A 3K9TA 3FM5A 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3TO7A 3V7SA 4I2JA 4PGHA 1O3QA 7ICNA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 1LDKB 4RT2A 5DECA 4DOCA 5D4BA 3AU6A 1IW7F 1JE8A 1YLQA 9ICAA 1NHAA 1ZQGA 4RB3C 1J7KA 2YSRA 1SMTA 5ERIA 1YW8A 4UBBA 3OUYB 1ZQRA 1HKSA 2FEZA 3JPOA 2IP2A 3L00A 4I29A 4LLGF 1YTYA 3GFIA 5L3BA 3RJEA 5E17F 2FE3A 2MH2A 2OZUA 4LZGA 5DDYA 3EDPA 1L3LA 3K2ZA 5J2GA 4XA5A 2ACJA 3WE3A 4R79A 1WQ2A 3I71A 1DPRA 3T8RA 3UXOA 4XRFA 2OBPA 5HLGA 2QYOA 1ZQLA 4AT8B 1JHHA 4DNCA 3V7JA 4EJWA 1BPDA 1XDUA 5BMZA 7ICFA 4U0VA 2RN7A 3SQNA 4WC6A 3JSOA 3U3FA 1W7PB 1T98A 3SFZA 2K7LA 2HKXA 3I4PA 3HSRA 4IVNA 3VEPA 4M9ZA 3C5GA 4RGUA 4ZYGA 3FF5A 6PAXA 3L2CA 5E8GA 4BHBA 2LKPA 1QPMA 4O9MA 5D8LB 3K1MA 4OIPF 4NQWA 3UXNA 2DO7A 4I7HA 4CICA 3GWZA 4TURA 5ICEA 8ICMA 2HHPA 5F2VO 5D46A 4RWOA 4XRHA 4ZYHA 3OVAA 3WTZA 4CHUA 4A0XA 2EV0A 4Z6CA 5HS7A 2MLKA 4TUPA 2LSOA 2UXNA 2XKPA 5BPDA 5DKWA 4HOBA 9ICFA 4EQQA 4KN4X 3ELKA 2ZH3A 1PP8F 3IHUA 4OINF 4CZZA 4N9HA 4G9YA 8ICOA 1HW1A 4M47A 2LF7A 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 2ZH4A 3C8GA 3LFKA 3C3WA 1J75A 3LA2A 3V8JA 4LLLA 1XMAA 1P6RA 4WXCA 1KEJA 5CVIA 4NQFA 2V1DA 7ICRA 3ECOA 2BE5F 3JPPA 5E1XA 2W24A 1R8CA 2PG4A 1SD5A 2L6FA 1ZQXA 1GXPA 3EUHA 3COAC 2O0YA 2HTJA 2NRAC 2NNNA 4O6JA 1FP1D 1WI9A 3HJ4A 5HRIA 8ICCA 3HSEA 1FC3A 3LA7A 1ZGJA 3F6OA 2ISYA 1OU5A 4RWNA 2DT5A 9ICMA 1PV3A 1BI2A 1IN6A 4UBCA 1J2XA 1WKMA 3IWZA 2K27A 3H92A 5IT9K 3J80K 2HSBA 1HSJA 3UXPA 2CO5A 2IA1A 1I1GA 3RJFA 3KP5A 1EH6A 3RPUA 1O3SA 3REOA 2OQRA 3MDCA 4P5OA 4U7DA 3C2MA 2BEOA 2O6GE 1MJ9A 2DAOA 4HAMA 3MQ0A 4KN7X 2BCVA 5HDKA 4R64A 4M0AA 1EV7A 4WC2A 1J0RA 1EH8A 5CP2A 4K2EA 4IXAA 2PJPA 3V7RA 2GXGA 4F5PA 2P5VA 1ULYA 3DFGA 2P6SA 2VBXA 4MQ9F 1ZN2A 3V7LA 4PDKA 4NKTA 1USTA 2ZCWA 2ZH6A 1JQRA 5TJJA 4MTEA 1IN7A 5JVTA 1SFUA 2ZH9A 4HX4A 3EYYA 2V1UA 1FZPB 1UB9A 3ISCA 4ASNA 4RGSA 4XEFA 1ZQDA 3F8FA 1PUEE 1L0OC 4FX4A 1P2FA 1HW2A 2VBZA 1LDJA 2W25A 1Z7UA 3IWFA 1X3UA 1TVAA 2WWYA 7ICGA 5TZVA 2W84A 3CLOA 4B8XA 2K02A 3RJGA 1QQIA 1FYKA 2IT0A 5AIQA 1IRFA 1O3UA 2ZH8A 1FT9A 2VBWA 1U5TC 1W5SA 7ICSA 3UQ2A 3ZP5A 4RB2C 3KLNA 2IVMA 3GFMA 2BE3A 1KDHA 3C7JA 5HRHA 2YWAA 3PMNA 5FFXA 4QZEA 2GA1A 5IIOA 4FT8A 5ILVA 2ZKZA 2Y75A 1IRGA 3R4KA 5IT3A 3O3KA 4NY8A 2GA2A 2H6BA 5E18F 1JN3A 4X4RA 2Q00A 5AONA 1I6XA 4UVCA 3NEUA 5HR9A 5J0TA 1R22A 5HRFA 1RI7A 4R32A 1R1UA 4ESBA 2R3SA 5ED4A 3LAPA 1WWXA 1BPBA 1W7PA 2PFPA 2JT1A 1BC7C 2Q2EA 5JHUA 3HJ1A 2CYYA 2X4HA 3QPTA 2H27A 3CDHA 2VOOA 3BPVA 4EVIA 2JTVA 4WXHA 2PLYA 3P9CA 4IHTA 1HXDA 5E1WA 1IN8A 4X5VA 3BZ6A 2QLZA 9ICWA 1V4AA 3MCZA 3RJIA 3JPQA 2WV0A 1P92A 2M2UA 4PHEA 3JPTA 1OPCA 1ON1A 1MIWA 4Y17A 4WC0A 1HUZA 8ICRA 1O7FA 4LZDA 2A68F 3I58A 4TUSA 4IQTA 4HV5A 5KK1A 1REPC 4I2FA 3NYBA 3MDAA 2FRHA 3FX3A 1JOGA 2HGCA 2ZH5A 4L5IA 2DPUA 8ICXA 2DW4A 4R8HA 4AD9A 4WWCA 3F8NA 1G3TA 1XGSA 5K5QA 2VN2A 3BP8A 1BC8C 3I54A 4M2YA 4PHPA 2HEOA 2FMSA 3T0YA 5HRLA 4JK1X 2L02A 2ESNA 4GYGA 1TQIA 2HFHA 4GXOA 1BJAA 3O10A 2Z5UA 3H3ZA 4M9XA 3WTTC 5DB8A 3AU2A 3IRRA 4QZIA 3TFRA 3MGIA 3AUOA 2PMUA 5D4SA 5LRRA 5J0RA 4BH9A 5H6QA 1HKQA 1FSEA 8ICNA 2I9GA 5DD4A 1ZQMA 4FO6A 2FMYA 4FHTA 2V79A 4IRIA 1ZGAA 5LGNA 1ZRCA 3CUQC 2KIUA 2JPUA 2PBIA 5J8FA 3KP6A 4LG0A 3MFNA 4P4MA 4BHCA 3GUDA 4UV9A 4KT5C 1LVAA 1ODDA 3OGUA 2RFFA 3I5UA 2EA4A 2ZH7A 8ICKA 3BJOA 3SHFA 4I27A 3GZ5A 1PX5A 2VT2A 3RJJA 3GFJA 1MDMA 4HW0A 3H37A 5FO5A 1CF7A 5HHIA 2BCSA 4YMMA 4S3NA 1B9NA 3MFKA 2OAZA 3CO6C 5FB2A 1FBUA 1FPQA 1KTMA 5BPIA 4WXDA 4Q4ZF 4ZH4F 1T2KA 2NNYA 2A61A 3HRMA 4UAYA 2YX7A 1AWCA 4I2EA 3UPQA 1FBQA 4JBAA 1OW6A 1KQ8A 1F1ZA 3SZTA 8ICTA 3WFQE 1RIOH 1OYWA 5J8CA 3BWGA 4M74A 1USSA 3BPXA 1BI1A 1QBJA 5JFRA 4OU0A 4Z6FA 4P4PA 3T5XA 4FHVA 4FH3A 2Z33A 5HDGA 3C18A 4XEKA 4LB6B 4AT8A 2G7HA 4WC4A 4ENJA 1TV9A 5ILUA 2DBBA 3AQNA 1YW7A 5CLSA 1LJ9A 4KMUX 3RJKA 4PZJA 3V7KA 1P4AA 4L0ZB 2KJBA 2F5FA 3BDDA 4YIFA 2M8EA 2P7CB 4O5KA 4I09A 1T6SA 1R36A 2XAJA 2EFQA 1MJBA 2CG4A 3C2KA 2RQPA 4QZCA 2M5WA 3HHGA 1R8AA 4MF2A 4YD2A 2ZBKA 2ZH1A 1JMSA 1Q78A 5CVUA 2VBYA 1KGSA 4PGXA 5BS6A 1IXRC 4NLZA 4I2AA 4K4IA 2FMQA 2XRNA 2J5OA 3ULQB 1GVJA 2A6HF 3I64A 3AJMA 4KLJA 4Q48A 3FXQA 5LEKA 2DK5A 2FBKA 3RYPA 8ICLA 5H20A 4EGYA 4L5JA 3O6BB 4KYWA 4RWQA 3B73A 4U0WA 4ATBA 4A12A 3EETA 4XLPF 3CO7C 5FLXK 1RUOA 5DCMB 2L6GA 1S3JA 4MF8A 4M71A 3I0TA 4UB2A 8ICGA 4M04A 3B71A 3FMSA 4HV6A 1FNNA 4WX9A 8ICAA 5LHHA 2HS5A 3NQOA 3MEXA 8ICEA 2J5PA 5KVRA 1YG2A 4M9JA 1ZJMA 1LEAA 4GO1A 1VTNC 1H0MA 2QVOA 4YIIA 1XSVA 3TDZC 4I2CA 2O3FA 4G6QA 4YN4A 1SD6A 2JPBA 5HDNA 1XGOA 3F8CA 3E6CC 1B59A 1LB2A 5LLQA 3QU3A 2EA2A 4Y13A 3G3ZA 1IN5A 4M9HA 2QENA 4A0ZA 3RDIA 3AQLA 2FNPA 4LD5A 3P7NA 1QZYA 3J81Z 1J59A 1XSNA 5DV5A 3C1DA 4HX7A 8ICFA 4XEVA 1BIBA 4RQ2A 3HRTA 3JTGA 2STTA 3DXJF 1F5TA 5DEQA 3V8KA 1QO0D 1UCRA 2XGXA 2XV4S 4LGWA 3K7DA 5FGMA 1PDNC 4AWXB 4G94A 2BCUA 1Z05A 2HR3A 3LA3A 5TRDA 5CVVA 3M8FA 2K4BA 9ICSA 1YS7A 3H3AA 1KQ9A 5HREA 1UHWA 1DDNA 1BI3A 3PFIA 1TNSA 3WE2A 2OD5A 4I2DA 5J29A 5J2EA 2LF8A 1MD0A 1TTYA 1SD7A 4YFXF 2EV5A 5DB9A 4KLLA 2PI0A 3E97A 2YX4A 2G9WA 4QZHA 1K05A 2EFWA 5DB6A 1XSDA 2L4MA 3WFPA 3HIYA 2FXAA 5L3GA 2C6YA 1XDSA 4HF0A 2BPGA 1BPXA 5CVRA 2JX0A 4Q5SF 2L3DA 1ZH5A 3DEUA 2M2VA 1S6LA 2FNAA 3C5FA 5HRGA 3RH6A 3WGHA 1YFHA 1G3YA 3C8GB 2V9VA 3L9DA 5HRKA 3TOAA 4U0YA 4FX0A 4U7BA 3RIRA 1MQ3A 4M5DA
chains in the Genus database with same CATH superfamily
4YELA 4AYBA 2R93J 4XLAA 4K4GA 2Y2ZA 1Z3YA 4MVUA 3PUFA 3QOEA 2DOAA 1SD4A 3IAS2 3OWTA 4NNJA 3WG9A 2L4AA 3ZQHA 4E70A 3OV8A 4S05A 1DU0A 3U0CA 1BPEA 5IINA 2FU4A 3JREA 5J0WA 4MNDA 2L9SA 1IV8A 2L7FP 2YR2A 4KUMA 4M9SA 2DXIA 4OIQF 4JKVA 1BIAA 4JLXA 2KQRA 3X1OA 2RV8A 3CCVI 2JA7J 4ZYDA 2GXAA 2EZLA 3UQ0A 2Q2EB 1XSXA 5COMA 1OCOH 1PVEA 1K7AA 1SMYF 3HOZJ 5J2BA 2IGMA 3E3VA 3Q0VA 5K5OA 4IJAA 2Y69C 2YL7A 3RVZA 5J0UA 4I6ZA 1JR8A 1UFBA 5J2KA 4I76A 1U3EM 1KYWA 2BV6A 2LDUA 3HNLA 2H94A 2V6EA 1OKRA 1Y0UA 3A0BC 4KLQA 2ZXHA 1MZBA 2Q66A 4FCYA 1QZEA 2IPQX 5DUKA 4CH7A 1ST6A 2GDCA 2J46A 2Y3DA 2L7KA 2YLIA 4J30B 3TJ6A 2CQQA 4X0AA 7ICQA 4PGQA 2OJED 5J1RA 1JUSA 2BBYA 3NRVA 2WA0A 4HDVA 2OTLI 2OTJI 4XQ8A 2DYRH 3TO6A 4BDYA 3CESA 4E7IA 5BOXA 3X2QH 1CF7B 3LSRA 3M1CB 2GA9D 1A7VA 4HFKB 2ISPA 4M73A 2ID6A 3J7AO 2M87A 2D1VA 2MC4A 4F92B 5IYDJ 1ZHYA 2QQAA 3DJNB 2B4VA 2XF5A 3J7ZI 4IPAA 2QA4I 1YO5C 1VK5A 7ICLA 1E17A 2D2WA 3LEOA 3UMKA 1Y0NA 4Q47A 4HF1A 5J2FA 2WAQN 1I1SA 3T6GB 8ICZA 2DLLA 1CGME 3ZR8X 1VFCA 1MNMC 2OC6A 2Z3YA 3JAMZ 2ESHA 2VJIA 3BOQA 2R25A 3MYIA 3G71I 4ATBB 2Y48A 4HSRA 1TFKB 4P9UA 4NM1A 3ZDLA 3TD7A 2MGQA 3LSMA 2H1LA 4PGGA 3OVBA 2PFQA 1KU7A 2ELKA 3KEQA 1WN0A 3VYUB 3OYGA 2W85A 4A6DA 4BJ5A 1IO2A 4EJOA 1JT6A 2EPMX 3GM1A 3LS1A 4I01A 4WQLA 4YFKF 2J0XA 2EILH 2Z9OA 3EZIA 4HEAJ 3Q6NA 2STWA 1GXQA 1NTCA 2RVCA 2R7FA 2B0LA 2FFHA 1WH5A 4RA2A 2ID1A 3HX0A 3BG9A 2LY1A 2FMPA 3HSFA 2CFXA 3WFSC 1YA9A 2HOEA 4QDLA 2ELJA 9ICHA 4E7SA 4A5NA 2ISZA 2ETSA 2WZGA 9ICTA 1G3SA 1VQKI 4HFFB 3GTKJ 3H65A 2LBFA 2BCRA 5EOZA 2D5RB 3DU5A 1E0EA 3KZYA 3ECHA 2E5ZA 2Z16A 1MH4A 4GYIA 4ULVA 3HYIA 3AG3H 1XSPA 1TQMA 1YLMA 2FGYA 5IILA 4IARA 3LSGA 1Q0MA 1YLFA 2Y0MA 2F48A 2J9BA 2GOMA 2UV1A 4EP7A 3ZQ7A 2AP3A 1OR7C 1XCBA 1K6YA 5EEAA 5BQHA 5KYWB 1IRXA 5BNGA 2DMTA 2ZH2A 1MGTA 4YD1A 3DMDA 1U6HA 4M3GA 2KPMA 3ISPA 3ZCOA 2R7UA 1STZA 1YVIA 3MBGA 3C66A 2ZSIB 2CW0F 2DR8A 9ICBA 3P9IA 5L0CA 1FOKA 3S90A 1VI0A 5L3DA 4HBLA 4HNUA 2JJ7A 3ROUA 1JJ6C 3L9FA 3AG1C 2MABA 3OYAA 2V4JC 4LMYA 4L18B 1IF1A 2H7VC 5HS8A 2JZYA 4OAHA 4RQ6A 2AS5F 2ZSHB 3TGNA 2ASRA 5L0HA 1MBFA 9ICNA 4YG2F 1TL8A 3K0LA 4MQVA 5DS6A 2ZXIA 3QU6A 2EPOA 1ZQOA 4Z2YA 3FXLA 1ORJA 1ZTRA 2L0KA 3HM5A 4ESFA 3RCOA 3DPLC 4BL0B 1WSUA 5IIKA 4BXXJ 1I27A 3BY6A 2DA2A 4QZ9A 4ENMA 2P66A 2CW7A 4PCQA 5J1YA 1T8IA 1OMIA 2NYXA 2IJLA 3RSNA 1NFOA 2VJ5A 4J32B 5FLXZ 1MIYA 2KW3C 3SFIA 5D61A 5CWRA 1MMDA 1T33A 3EYIA 1B68A 8ICIA 4WC1A 2BY0A 4BBRJ 1RESA 5EEGA 3WTSC 2BL2A 1OYYA 3GZ6A 4RD9A 3KYCB 4DIQA 1UZCA 8ICPA 4AT7A 1ZG1A 3AG4C 4C3HJ 3B0YA 2P5KA 1YI2I 2ZNZA 4OMZA 1W2WA 4L5EA 2CGEA 4C3BA 2XKOA 1U8BA 4EM0B 4EHPA 4MKPA 1RKCA 1IUYA 4CS9A 3JTLO 9ICLA 4I28A 3JAMK 1I4YA 3HRUA 1ZQNA 2UZKA 4AIKA 1D1CA 2YL1A 4Z6EA 2J9WA 4I2BA 4IAQA 9ICRA 1YJNI 3TL4X 2FOKA 3MKLA 2XLEA 3FVYA 3F6VA 4OAFA 4EJVA 2W82A 2IXOA 1XZPA 1R7JA 1SANA 4F5NA 2LNBA 2AQEA 1BI0A 2HYFA 1Z67A 1R00A 4XLNF 4Y7NJ 1W4MA 3H9JA 1K4SA 2J0WA 4LEVA 2HXOA 4BU2A 3SXYA 5KAFC 2RSEB 1XSLA 2VKDA 3PNCA 1OW7A 2HWVA 2QF7A 4PK4A 4EJTA 3BG7A 2QKLB 3DV8A 4U87A 1SF8A 1X2NA 3EGDB 5DS5A 4RQ3A 5DDMA 3CUOA 3LJBA 2IS4A 3A2KA 3OS2A 1RKWA 1HA8A 3H9GA 4B3AA 2W1OA 4XN0A 3VSKA 2DMUA 3RZOJ 1QQ3A 4BG0A 2BPCA 1ZQVA 3K4NA 4XMYA 4F5QA 5J1UA 1RJ9A 2EPLX 4KT6A 3SDBA 4BXUA 4IOAF 2Z2SB 2NS7A 1LE2A 3ZG1A 5D4RA 1I5ZA 5KYNA 5C3EJ 4IWBA 4NLKA 2AWYA 1XPXA 2LY9A 1XN7A 2BHZA 3FMRA 4F7ZA 3I4UA 3Q7GA 3ZMUA 3CC2I 2ETHA 2EIMH 2JA5J 4G7ZF 3JRCA 2CDQA 4L9VA 4LK1F 3EFOA 5A6BA 3OUYA 1T0FC 4JURI 5B3QA 3PSIA 1I50J 3F22A 1G2HA 9ICUA 1IXCA 4X0BA 5DB7A 4CCNA 2E1NA 3RTRA 4EJUA 5LEJA 4AIDA 2V9KA 3HOSA 1LPQA 3DP7A 4FX5A 4X4UA 3VOEA 2FX0A 1F36A 4BQAA 4RQ7A 4PSXA 3W2AA 3PO3J 3S3NA 4IQVA 2HFIA 1ZQWA 2CYDA 1X3ZB 4KA4A 4O5CA 5DLJA 3M4BA 5GTIC 2JN6A 1VQ9I 9ICVA 4GRIA 5C4XJ 3TQOA 3IV5A 4C30A 2BCQA 4LLNA 2NOGA 2B56A 2CV2A 4X4QA 1XGMA 5BOLA 3BTCA 1APLC 2ZMEC 5B3SH 1TQPA 1VB5A 3K4MA 2FD5A 2KIMA 5AIPA 3WTWC 2KISA 1ZVZA 1ZQUA 4EEBA 4KLDA 1QGPA 1B6AA 3P9KA 3V8LA 2PMHA 4E80A 1G59A 4I99C 1FFHA 4H4KC 2K9NA 3D5LA 1YYVA 4MTDA 4UD5A 3RH4A 3BRJA 4OIRF 3BT9A 3DJUB 3SP1A 2IA0A 2NUTA 2LBFB 1UELB 1F43A 2HZ8A 2DRAA 5FRMA 3K4CA 2GWRA 1U0BB 1BZ4A 2NAZA 1U8RA 5KAIC 3OYBA 4HQEA 2Q0OA 4M6XA 1UEUA 2HU9A 1TWCA 3LQCB 2JPCA 3K70D 2KIFA 3R61A 3WTYC 3IQ6A 2CRGA 4JTAB 2IXSA 3V5ZA 5B3SC 1UG2A 4QZFA 3I3LA 1WCMJ 3KP7A 1MBEA 3CCRI 3HJCA 1G4DA 1TKNA 4CBEA 4AT7B 4EBBA 3EFOB 1MMAA 5DBAA 2CUFA 2C04A 2MD5A 2V1XA 1E84A 3OIPA 4II2A 3SEZA 1EQ1A 4FHWA 1C03A 1R23A 4ZYEA 5F0HA 4E7JA 1B1BA 5IP7J 4WQKA 4X1EA 4EBJA 3LK9A 3PNTA 4GDFA 2JD3A 5HOOA 5EJCA 4PHAA 1UG0A 3BJAA 4NB5A 1OCCC 3KX2A 3K70C 5DCMA 2KLOA 5JI6A 1WJAA 1TT0A 4WC7A 2A6EF 2FMLA 4U5HA 4X4NA 1V55C 3QYEA 2KDZA 2ZXWC 2DFIA 4MW3A 3R7CA 4WCWA 1D0XA 2HV6A 4WBYA 2UUIA 1QRYA 2DYSH 2N8GA 1B8IA 2J7PA 4GGGA 4L9NA 4CO8A 2VPRA 3ISBA 3H2VA 2R7VA 3HOUJ 3NMJA 5LRSA 4ITVA 9ICOA 2EZHA 2YL3A 1F4KA 5A2QZ 1Z77A 2UUZA 2BHYA 4JVSA 2KKOA 2JK3A 3GX4X 2PX3A 3FXMA 2XIGA 5L3FA 2CQ7A 1Y39A 2KZGA 4JRZA 2KJGA 3JPNA 4PFPA 1I6HJ 3TULA 8ICUA 1Y56A 2YL0A 3DM9B 3MZYA 2R7ZJ 3AG2C 4MVSA 1FYMA 5KYXB 4FH5A 2LR8A 3DKYA 3HKZA 4MFAA 4LLEA 1YRNB 1WJDA 1E3OC 2KSFA 4RLFA 4AYBN 4LT6A 4HEA2 3OSGA 4HPQA 8ICJA 3DU6A 4DOAA 2HNHA 1NZEA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 2FF4A 4RDUA 4A3GJ 1K78A 1PJRA 2R03A 4XUSA 3H36A 2VXZA 3HOVJ 2R9RB 3GWLA 1DU6A 2Y39A 1R5ID 2J9UA 5J47A 2X1CA 3NKEA 2GBYA 5CPRB 4EM2A 4K7BA 3UMIA 1D3YA 3A01A 1XWJA 2M64A 4YT4A 4EEDA 4I98B 2Q9BA 1ZRFA 3GVAA 3BQYA 4M9GA 3FWEA 5IIIA 2VC0A 4KIFA 1FOWA 1ZARA 4N0BA 5EGOA 1ZW2A 8ICYA 4XJEA 5F0CA 3AG2H 9ICPA 4YCXA 3K69A 4ZDLA 1NOMA 4YJWA 4K1OA 2QNLA 2ICWG 3BR6A 4QZ8A 2L6HA 3QP6A 4UY8I 4E7LA 2BBHA 9ICGA 2JMWA 3CQZJ 2CQXA 1B72B 1MSEC 3J7AY 2O1PA 4JLZA 3Q9SA 3RYLA 3A9CA 1BBYA 2NRKA 3JPRA 4A3LJ 3S8PA 2FOWA 1YIJI 3U21A 3E9VA 4CJGA 2GAUA 3TKYA 2XLDA 3V72A 1WJ5A 2M4GA 2OZ6A 2Y9YA 4NXXA 4FAPB 3AGUA 3T4RA 4BJ5C 2Z1DA 3AQMA 2HOSA 9ICJA 1XCVA 2ZFWA 1Y4CA 4LIVA 5HLTA 2KT0A 5B1BC 5IPAA 1YA7O 4IQJA 2LK4A 1VYKA 3HTKC 5KYUA 2P6VA 1OCCH 3IH3A 3WGIA 2RKHA 2XLHA 5J2DA 2XUBA 4BQQA 1HCRA 4G0HA 4PUSA 1J8MF 3KCCA 4LDRA 1VFGA 2HQRA 2K86A 4BQNA 4DJ9A 4E18A 4EATA 4IRUA 3MD2A 7ICIA 3QQAA 2M8GX 4KBLA 2P6TA 4WABA 5CI9A 5J2IA 2R7SA 3Q6MA 2Y30A 4OWRB 1ZGWA 1ZHFA 4BAYA 4BHPA 1MQ2A 3FXUA 3CCJI 4NTFA 2O5AA 4N06A 8ICBA 2VJ4A 2MD0A 4MNUA 2B0HA 4KNYA 4I2IA 5JR3A 1O3RA 2NVTJ 4HX8A 3DE8A 1KQ0A 2M1BA 4WBZA 1YZAA 1X4PA 2WAEA 1A36A 5D92A 4UB4A 1FOYA 1BPYA 1JHFA 3HOWJ 4LLCA 3GBGA 2K3FA 3KEOA 2HDCA 4PH5A 1RZ4A 3T1BA 3L2WA 5B1BH 4IQUA 1XD7A 3L2VA 4B4CA 2E2HJ 3JRAA 1HE1A 2XPWA 4RB1A 2R7RA 5HSWA 1IZ1A 3R0AA 1VQMI 2CGPA 2W4BA 1ONVA 3DPTA 2A69F 2WVQA 4HE8D 2M2TA 2LKSA 4MEYF 2DR5A 3KYIA 4NHJA 3ESWB 2XAQA 1MJAA 2LMDA 1R58A 1RC9A 2CH0A 2HVQA 3FISA 1VQOI 2E1CA 5BQGA 2ZMEB 1ZR2A 3H39A 5E2QA 2KGOA 9ICEA 5FCLA 1S5LC 4RDAA 3EPVA 2F5CA 5DUIA 1JPJA 4F4BA 4O69A 1Y8QB 4G7OF 3FXKA 1T6QA 2PP4A 3E6MA 4A2UA 4A4AA 3H35A 3LSKA 4Y15A 4N4WA 4QZBA 1FTTA 1R4MB 2BXZA 4HG2A 4ENNA 2LFFA 1Z91A 3FM3A 4JCHA 2R5YB 2AO9A 3K6GA 2B9SA 3O6XA 1FY7A 2DA3A 2FQ3A 4LK0F 1T9KA 2H6CA 1ZHTA 1E2XA 2BYVE 4QZDA 1FX7A 4TV7A 3BROA 5DDGA 2L9RA 4CIHA 3N4MA 3HW8A 3WHNA 2I5UA 4PJ0C 4UVAA 4A3IJ 1SFKA 2BW3B 5L3VA 2VQHA 2PFNA 3CSKA 2R7TA 3S27A 3FHZA 2IGKA 4CYCB 5C4JJ 3QP5A 1AU7A 4TUQA 3PSFA 2EJRA 2OOCA 4DRJB 2HJ3A 1UETA 4YMNA 5CIVA 1QVTA 3NKUA 2OF7A 1HQCA 1XMKA 3SZPA 2O5RA 2XC7A 5FKOA 1IZMA 2A07F 4O7GA 5DBBA 3WU0A 4P2HA 4A3JJ 2PFBA 4BEHA 4NY3A 2YU3A 3J81K 1PCXA 1ZAOA 1HW5A 3RKXA 3CC7I 2HYGD 3E70C 2PNOA 2QQ9A 2XGDA 3AG4H 1R5GA 2ZMEA 3OYKA 2XF7A 1YIOA 2PN6A 3DKWA 4NC7A 1FIAA 5FLMJ 1WOTA 4HLXA 3ISDA 3AL0B 4P96A 4W1UA 2OU2A 1SZIA 3GXOA 4HDUA 4PGYA 3MZHA 1TR2A 4HX0A 2XL4A 1F1MA 2F5EA 2X1EA 3BR3A 4HZFA 2A05A 4MIMA 2HYJA 3BTJA 3LMMA 5CYVA 3VODA 4BJTA 2P5LC 4PPXA 4WC3A 4KLEA 8ICSA 3TMOA 1BPZA 2BVMA 2MC3A 2W57A 2PX0A 4I1OB 1JAJA 3DEEA 3CMYA 3QYFA 2JVHA 4H0EA 3K1PA 5J0PA 1RUNA 3GMEA 4XM3A 3ZMSA 4IHSA 5D5UB 5CHEA 2DJIA 4NXTA 2JRTA 2OU6A 2ME6A 2FQ4A 1OR7A 4ZZLA 4MVZA 3I55I 2VCAA 3AG1H 3Q5FA 3CJRB 4NXWA 1YJGA 3JSPA 2HI3A 2XDVA 1ZRDA 4O6YA 3PIOF 4CDGA 5HC9A 4MFCA 1Z9CA 1U2WA 1QLEC 2YVKA 2DR9A 2X48A 3KE2A 4ESJA 3PQKA 3RJPA 5JLXA 1RRJA 1VLSA 2DRBA 4O68A 4LB5A 5J0OA 3ASOH 4XOTA 3BLYA 1Y6IA 3FHDA 4DW6A 2DFEA 1MSFC 1S05A 3T6JA 4AK9A 4U88A 1CGPA 5J2AA 3S29A 5BOMA 2EIJH 2R0QC 4CGZA 1M56C 1KYZA 3U2RA 1PD1A 5JLIA 3HBLA 7ICTA 5KYYB 2V1NA 3R60A 4HLYA 2JSCA 2CW8A 1R5HA 3H5NA 3VFZA 3I59A 3LSIA 4MEXF 3ZQYA 3J80Z 5FRNA 1IUFA 2GIVA 1TW2A 3OYNA 5F0FA 1XZQA 2CUJA 5J2HA 5GAGJ 3OYIA 4N6CA 4A5MA 2ZXRA 4J01A 1QNTA 1HSTA 3DZAA 1ZQKA 3GLLA 1EA3A 3ASNH 3ERMA 2CS3A 3H3UA 1QKRA 3PMRA 4PACA 2GOXB 4KLIA 4RWPA 5A6BD 5COFA 3PM1A 3BG3A 4D0PA 1LKXA 3WU2C 3E7LA 3QYBA 4YT8A 4ATBA 3K4LA 2F6CA 4XPYA 2BPFA 2IGOA 3TEDA 4L0YB 5DD8A 2DTZA 5DYMA 5IP6A 5TJ5E 3DCFA 1Z6TA 3TOBA 1GM5A 1BOBA 1O87A 2O8XA 2LFDA 5HVQC 3IRQA 1J5YA 2DA4A 4BACA 1C0WA 3I5QA 2Y0SN 4D5CA 4V2GA 4KLHA 2OCEA 4U5EE 5GPAA 3L09A 4NC6A 4P9FA 3GF2A 1TBXA 4LG0B 2WZLA 4K0DA 1U9OA 1ZQZA 4XBFA 3EUAA 3IP4B 1IAWA 3KZZA 4BEHB 2F2EA 2XPVA 4ZDOA 3TK0A 2ZO4A 4IQWA 4S0HB 4O3MA 4X4PA 3FXOA 4A6EA 2QBYB 4K4HA 1V5GA 1PP7U 3M79A 3S2WA 1J9IA 3WFOA 2QWWA 2HOTA 3RKOF 4I2HA 1HUOA 5LFAA 5JSLA 5BPCA 1ZQSA 4KIGA 3A02A 3NRHA 4RGXA 7ICMA 4LG3A 1F5AA 2L7ZA 1X1CA 3GTMJ 3QOPA 1P9QC 1Z7LA 5D5XB 4LDKA 3MYFA 2FUG2 5CR0A 1HKTA 5E3OA 5HHHA 1G6NA 4RB0A 3S2DJ 1QVXA 5CQGA 5FKMA 5E8IA 1SAXA 3F21A 1SVLA 1NK2P 2P7VA 3G4XA 1FSHA 2L01A 3OVSA 3HUGA 1IXSB 1TWAJ 3ERED 7ICKA 1SVMA 1B72A 5L0DA 4MGRA 4MVRA 3FZVA 3OWGA 1E85A 2DODA 3RPQA 1ON2A 5J2JA 4IF4A 3OY9A 2K40A 4RT3A 2XAHA 4OOIA 5ICFA 1T08B 4CJOA 2XASA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 2WAQA 3G73A 5A6JA 4UD4A 4M6YA 3EZHA 4XOPA 3S1RJ 4NTBA 1JRAA 2CCYA 1Z21A 4LIUA 1KZHA 5D8KB 2E7XA 4X4OA 2HZDA 3FXJA 2KK1A 3KP3A 1UG7A 1GT0C 4MVMA 1ZQTA 3CF2A 1Z5ZA 3LUTB 4JWNA 3R0JA 3F3XA 4UHTA 3E6DA 2AHQA 2GQQA 3ABKC 4F5OA 5CJ9A 2M0MA 2ZXJA 3DTKA 4IHYA 4IRGA 2TMVP 3UR3C 4BJ1A 2VE8A 3M7GA 4MTGA 2GZWA 3PDMP 2DI3A 2V6CA 2XAGA 3WTUC 5JUAA 4RQ8A 1T56A 3EUHC 2DQLA 4JQFA 5LBQA 4BY1J 2VJJA 2F5VA 5LHGA 2J8WA 2OQMA 2XLOA 2WV1A 4AL0A 4IG8A 3VF0A 3M1CA 4WC5A 5BQTA 3KL4A 2QTVA 1UFMA 3AKZA 2WVNA 4M9LA 7ICEA 4UDVA 1T38A 1WJBA 4AM3A 1TFWA 1IGNA 2OV7A 1V74B 2Q1ZB 4EMSA 4YFNF 1A0BA 4M63A 2DR7A 2VCBA 5JRAA 3QODA 3I5PA 2HQAA 4MVOA 1JUPA 3IQ5A 1H9TA 5IIMA 3DTIA 7ICJA 4ZZDA 2IEKA 4Q7CA 2NSGA 4RM2A 3WTVC 3ZQFA 1OCZC 3GM3A 3O2PE 2MFZA 1KA8A 3SZRA 5JS5A 3PO2J 5L3QA 5HRDA 3CCMI 2GWWA 3G4ZA 1R8BA 3ABLH 3G50A 5FKLA 1NG1A 3EG9B 2K9MA 4ZJZA 4S04A 1BOAA 4ONSA 4BE2A 2VC1A 3U9GA 1A6IA 4QWQA 1TQGA 3FIWA 1H9GA 5E20A 3K10A 3VSLA 4XLCA 3B0VC 2D45A 4UB3A 4YT2A 3RJHA 3ZQQA 3G4SI 3LSTA 2M7AA 3AL0C 1FLIA 5CB1A 3BR0A 3KP4A 3GM2A 1Z63A 3LFUA 5HLHA 5D6FA 1ZG5A 1EI7A 3KETA 1WOLA 3FOOA 1GPJA 1JGGA 2PXIA 4AVPA 1Z3XA 4N9IA 4E8FA 2A3SA 4QSHA 4F91B 3DTEA 1XX5A 1AOYA 4X4SA 1OW8A 2W4SA 1MIVA 4WH5A 4L9TA 5ILSA 1SFOJ 2Y3HA 4RQ5A 3OL4A 4B44A 1D1BA 4B09A 1EH7A 2HXIA 2XRLA 4KLTA 1T0FA 3ZPLA 7ICVA 1U6GA 4RAYA 3UPSA 3QAHA 4X0RA 3GLXA 3D5RC 3PFYA 4DOBA 4K98A 3MKYB 3GTQJ 4UUSA 1K83J 1YQAA 1JAFA 2J45A 5KYYA 3S28A 1S7OA 4KMFA 1JKOC 3HIFA 2EFNA 2LG4A 4KLSA 2WY7Q 2G62A 2XM4A 3C62A 3ZIBA 1ZQYA 3TFSA 2H1KA 4XRSA 3W2WA 4XPXA 4GCVA 2IM8A 2VANA 1JXSA 1OCZH 5DBCA 2FSWA 5GP9A 5K7ZA 4IHXA 1ORSC 2VODA 1TWAA 1D8KA 4XRSG 1AVOB 3QW1A 4XN3A 1TLHB 4AT9A 4WGYA 3GW2A 3J7YJ 3LAYA 3RQGA 1TFYA 3N24A 2M2WA 1I4ZA 1M2VA 4QPQA 4UXNA 3NYJA 1HBXG 1R89A 4RQ4A 1ZLJA 3JZ0A 1BW5A 1S29A 5FKNA 3UGOA 2XXAB 1A7EA 2ELHA 5FZTA 4X4TA 4UUVA 2XL8A 1P4WA 3V5XA 5J0QA 1VNDA 3D1NI 4JWMA 4D9JA 2WBMA 3MWMA 2LKXA 1B9MA 3K4BA 2UWMA 4Z9HA 4IGGA 4I0AA 4UV8A 3TDUC 3Q0WA 3Q0UA 5FD5A 1WWPA 3B0PA 3IEEA 1O57A 2EIJC 4CDYA 1OKKA 4K97A 4BJ6C 2QGUA 5FFZA 2BBJA 4GYTA 1HF0A 2B0JA 2V3CC 3J06A 4EIYA 1OQYA 3S9OA 2HMZA 1VQNI 4K8VA 3DE9A 2NUPB 4JEAA 2O9XA 2QM3A 1UAAA 3GYHX 1W1WE 4CYDA 2J9VA 2Q4FA 3IUOA 2L7AA 2DQRA 4A0YA 4O6MA 5D63A 1YITI 2BOLA 3U8VA 2IHMA 1VJ7A 2LC2A 3GORA 2KRFA 2EFOA 5A6AA 4FTHA 2HN1A 1CGNA 2E7WA 1Q0GA 3WG7C 5EZHA 2VCCA 3NVOA 3SZGA 5DVWA 3KP2A 3ABTA 1T39A 3JSEO 3N97A 2ZNYA 2PMZA 2Q8KA 3K33A 3VYTB 3MBYA 5EEHA 4EM1A 2WZFA 2F5DA 3HHHA 4QZGA 1U9NA 4HNTA 3KFWX 3O39A 1S7ZA 1VQ7I 3CD6I 3DQVC 4E17A 1FBSA 9ICQA 2YKZA 1AA7A 5J0SA 4UB1A 1LNWA 1MDMB 4AU7A 4RQ1A 2X0LA 4N7RA 5D5WB 2G3KA 3ZOBA 1R1VA 4IQ4A 2VL8A 2KIQA 1YE9A 1U78A 2VOPA 1K40A 1QZZA 5KYXA 3F46A 4E0IA 4IB4A 3A03A 4D4NA 4R63A 3PHZA 1V5FA 2W7NA 1YS6A 3NYMA 1E3HA 2MH9A 3EH2A 3U2LA 1ZELA 3CTAA 3RQ4A 4AC0A 5J2CA 1G5ZA 2VONA 2WB7A 1MW7A 3MGHA 2XVCA 3A4CA 1YOVB 2BY1A 1TP4A 2GWSA 2I8DA 3ASOC 3K7AJ 4KLOA 2G3VA 3SDGA 4DO9A 4D1QA 1IV6A 1Z3IX 3ZSUA 4NXVA 4QIWN 4C3JJ 5L3CA 2F22A 4DZPA 4RQ0A 1ZQPA 1YYXA 2DA5A 3FOPA 2X85A 2P61A 4XTKA 1VTMP 3GO5A 4LVSA 3U9MA 1H7IA 3HOXJ 1M2VB 4J00A 4R1HA 3W3CA 1OXKA 2CWEA 2JVGA 4XLFA 1NH3A 4MFEA 3LWFA 1MKMA 1JUMA 1RR7A 2XHKA 3OIQA 5D49A 1AKHA 3ZN0A 4LEYA 4WF2A 3F8BA 4YWQA 1Z0XA 3Q9VA 1FFTC 3Q3SA 4DQ2A 2A0UA 7ICOA 5AC5A 3WFRE 4XLHA 2O03A 3JW4A 2LRDA 8ICHA 1ZZPA 5JHFA 5CA7A 2VT3A 2HVSA 4GXIA 1BM9A 4JEBA 8ICVA 4KICA 3LQRA 1EKYA 1ZG3A 4YEJA 2L7MP 1FEXA 2COBA 2RNGA 1DP3A 3VB2A 2EQRA 5D6EA 1MBHA 2YLGA 3HOYJ 3C8GD 9ICKA 4PSWA 4UAZA 3L8IA 4P4OA 4UVBA 4M72A 2FBIA 1H8AC 1SFEA 4MO7A 4RGRA 2HKOA 4UB6C 4C7OA 2NS0A 1I39A 4BDZA 2D1HA 3GZNB 3BG5A 3HOTA 1R9TJ 4HRIA 1OKKD 2HQNA 4ZYAA 2MLGA 2PX9A 4ETSA 1VLTA 1S7AA 1B4AA 3IH4A 5H6RA 1HOMA 4RPYA 1W7PD 4R65A 1QHHD 3B6CA 3ZN1A 2O61A 4KISA 1NFNA 3JRDA 2FBHA 2Z99A 3M1EA 2XRHA 3I56I 3P5JA 2LK2A 1JJ8C 1IN4A 3TO9A 1LEBA 1JI8A 4YMOA 1S8NA 2DVIA 1U5TB 3JSZA 1T5OA 4HSTA 2E35A 2ISOA 2LIGA 3UMHA 1SC7A 1XG1A 2KYHA 9ICXA 1FYLA 5IOZA 1ZQFA 1QSPA 2Y3BA 2ZXOA 5K7FA 3V7CA 1K04A 4UB5A 5IT9Z 2YZSA 5CFSA 3AQKA 1IC8A 1QHGA 2VIXA 4PR9A 2IS6A 2MYSA 2EPNA 3LQQA 2LP4A 2OEXA 3ABMC 5AGFA 1I3QJ 3BR2A 4BS9A 3WAQA 5L0GA 4WOYA 1ZQJA 2LQGA 4V2FA 1FP2A 1WGXA 1WJFA 3AG3C 3ASNC 3HTSB 1ETOA 4YN0B 3ZTZA 1X1DA 3SJMA 5DEDA 4RAGA 3WTXC 4BJ6A 5D5VB 2K3PA 1ZR4A 2KHMA 1QA6A 3E6BA 1ZREA 1A41A 4RBOA 3GDXA 2PF4E 3C2LA 1OYIA 1X1BA 4DJAA 1A5JA 3LNMB 8ICWA 2CFOA 4HQMA 5FD6A 4YL3A 4RAZA 1MQVA 4YRVA 4M9NA 2IXNA 3WU1B 5LGTA 3A01B 1M6TA 3ZMTA 3EQLF 1UEVA 4G6DA 3T8TA 5C44J 3MKZA 3NAUA 3IH2A 3L2QA 5ICCA 2IUBA 3E5QA 5CVJA 3F23A 3HKKA 2QQBA 2YLDA 4RPZA 3FK6A 1WRJA 1GHCA 4EBKA 3U2MA 2EH3A 4PHDA 2FCLA 3OL3A 4I02A 4NXZA 4HYEA 4CXFA 2RDPA 1ZQAA 4KLFA 1JPNA 4LEZA 4G8XA 2DTRA 3OYLA 1Q1HA 5LGUA 7ICPA 2TCTA 2R7OA 3OOPA 3L1PA 4A3DJ 2IXMA 2AQFA 1VQLI 3GEHA 4MHGA 3JRMO 3M4OJ 3IL2A 3CZ6A 3GEZA 3H38A 2DPDA 1ZQHA 1M57C 2CSOA 2WAFA 3HTUA 1BN5A 2QUFA 4DBQA 3CCQI 1K6OA 3ZMZA 1OCTC 3R6SA 1W36D 3M8JA 5A2QK 2P7VB 1VQ8I 3O8HA 3KLOA 1RPLA 2KJCA 5B3PA 2WTEA 3OR2C 2ZHAA 5DQTA 4KFCA 2EFPA 5KCMA 2A5YB 3K1NA 4XKCA 3PQJA 3GFLA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 2EILC 3LEVA 4YK5A 1NG7A 5CHGA 1W5CC 2IW5A 4ON0A 3IC7A 3ZC4A 4HF2A 1X2MA 3M9AA 2B63J 2UXXA 2GXBA 4KLGA 4XKBA 1RXQA 4C7OB 2VQLA 3HJEA 2D4UA 2DK8A 3HGGA 4UNOA 1K78B 2H09A 5IIJA 4BKXA 3MZ8A 2ECCA 5HRBA 1O3TA 3HUGB 4AIHA 4F3QA 4E7XA 2ADUA 4I2GA 2R5ZB 3WHBA 1GLNA 1D5YA 1KU3A 3HLZA 1DP7P 5BUOA 4Z6DA 2ID3A 4KLMA 1LFPA 4XSZF 1LE4A 2P1AA 2IGNA 1D5VA 2HDDA 5F5FA 5F64A 3JYYA 2CUEA 4O5EA 4IZZA 3UGPA 3G1LA 3QMKA 2G7UA 1Z1DA 3CCEI 4V19K 9ICCA 1YJ9I 3K75D 3LSPA 2E2IJ 2OQGA 3BJ6A 1F9NA 3B02A 1NBBA 4U5DE 3G2BA 2RC4A 4U5FE 4XQ7A 2ZHBA 3OS1A 3OV7A 1LQ1A 2VASA 3EGXB 1K79A 2R7XA 3RIPA 4GXKA 4MFFA 4E4HA 5EDNA 2QQ8A 2XLVA 3DPUA 4O6AA 1A35A 2CNWD 3DF8A 4OIOF 1WTYA 4UUTA 4R66A 3PMLA 2GAQA 2BY3A 3NKDA 2NOJB 4NLNA 4LJZF 2TDXA 1N77A 5ICGA 4XPWA 3BG6A 5EG0A 2O8KA 1N1CA 5EK0A 3L8JA 1YDIA 3I59B 2EK5A 4XNFA 4UAWA 1ZQEA 2MA3A 1JKRC 2X6OA 4W8PA 2OPTA 2ZB9A 3ZQCA 1TWHA 1NO5A 3KEYA 3RF3A 1Q79A 1D8JA 1Y8RB 2QSHX 1ZHWA 2EV6A 2NXNB 2VE9A 4RPXA 3RKWA 1SYQA 3L34A 4M3FA 1RNLA 2L54A 3F8MA 1NG6A 4C3IJ 3ZMDA 1FR0A 4AT9B 7ICHA 3W6JB 3QTHA 1FTZA 2QY9A 2AXLA 3RI4A 3QRFF 4IRHA 1R1TA 1GVDA 1ZKGA 1X1AA 3BZKA 4FE7A 3I53A 4NC8A 1MMSA 4RAFA 1C02A 2YHSA 4KLUA 1TNTA 4L9JA 2PBEA 5E3LA 5K1YA 3V4GA 3KZIC 3OS0A 4ENKA 4WK8F 1RR8C 4FHYA 4I2OA 2X6XA 4BYYA 3LESA 4O67A 1DUXC 2P4WA 4BE0A 4QLCU 3HRSA 1TW3A 3M8EA 2B7EA 1LDDA 2XAFA 5B5EC 3GEIA 3TQNA 4FHXA 3OYHA 2COMA 2EWRA 4FISA 2BZTA 2W9MA 5HNFA 5FROA 3MN2A 1ZYRF 4EWCA 4G7HF 3WODF 1ZU4A 2MBFA 1V3FA 3EUKL 2IS1A 3ZQLA 1ZJNA 3I4NJ 4NKUA 4EGZA 4NM2A 3CUQB 4YIRX 4P55A 8ICQA 5J6XA 2DA6A 5J4VA 5F28E 1FA0A 1U89A 3E5XA 4XIDA 4U9DA 9ICIA 2Q9CA 1KNYA 1VYIA 2LSEA 2RGVA 1JGSA 1DPUA 3K1IC 3W4YA 5J0XA 1LVKA 1SFXA 3MAJA 3BR1A 2ZJQF 1BW6A 2QCOA 2HQ5A 3MVPA 3RYRA 2OEVA 3KYJA 3HWTA 1QPUA 3B0XA 2ZD9A 2XROA 2L5QA 3IAM2 3SEQA 1RETA 1Z6RA 4JW1A 4FHPA 4QZAA 4AX2A 2PJRA 3U1DA 3IKTA 2WC2A 2EZIA 3BQZA 5F6FA 4LEWA 3JPSA 3I4MJ 4ANJA 5E1ZB 3F72A 3RQEA 5DCFA 2PQ8A 4F5RA 3B29A 2RNJA 4BGDA 2CQKA 3A0HC 1W0TA 2HZTA 3OEOA 4I0BA 4A2NB 5FKKA 1W5TA 2FA5A 4KIBA 3RKYA 1CPQA 4I1MA 2P8TA 2EB7A 1X1PA 1ZQQA 3FXRA 4X4VA 2X9DA 3H2UA 1G3WA 3FMQA 3JTHA 5K5RA 1XGNA 4M3BA 1KU9A 2LTPA 4EV0A 1SR2A 2QSFX 7ICUA 1FTSA 1D1AA 3E5UA 3HG9A 2EWNA 2PFOA 2M30A 3TJ5A 4U9EA 2HVRA 2IOQA 4C2UA 1J8YF 3RQFA 2E2JJ 5CJ7A 2F4MB 1UHMA 2LD5A 4MW8A 3VM6A 2HOAA 4Y33A 4LDQA 4RWQA 3C2HA 3LAJA 1FWZA 3O55A 5A69A 2M45A 4GXJA 3AAFA 1KU2A 3ZWIA 2DB4A 2Y0SA 2YUSA 4O5VA 1ZQIA 5J0YA 3B6AA 4DGWB 1ZQBA 3ML6A 3VRCA 1ZQCA 2IRFG 1O7LA 5COGA 4LFUA 2HDWA 1ZLKA 2K4JA 3IKVA 2A1DD 1AEPA 2YPRA 2IA2A 3QPHA 1W0UA 2HN2A 3ZMVA 1I5NA 5L3EA 2KC3A 5LHIA 1A04A 2P0WA 2OCCC 1G4WR 3RH5A 3K9TA 1YX5A 3FM5A 5CKTA 3ZTMA 5IY5C 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3O8GA 3TO7A 2WADA 3V7SA 4FO1A 4I2JA 1HC8A 4PGHA 3PUBA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 3G6EI 4F52A 1QPIA 1EKEA 4E7ZA 3NWTA 1LDKB 2EIKC 1UHSA 4RT2A 3CJTB 5DECA 4DOCA 3SYNA 4YT5A 5B1AH 5D4BA 2ZJRF 1O4XA 1IW7F 3AU6A 1APCA 2XSDC 3OYFA 1JE8A 3GTGJ 1V54H 5DQZA 1VF9A 1YLQA 3LNRA 1NHAA 9ICAA 4CSAA 1ZQGA 4RB3C 4CS8C 1ACIA 1J7KA 2CUZA 4PJMA 2YSRA 1SMTA 5ERIA 1YW8A 4UBBA 3OUYB 2R5YA 1ZQRA 4IKFA 3C8ZA 1HKSA 2FEZA 3JPOA 2IP2A 3L00A 2PFDA 4I29A 4LLGF 4O79A 2I10A 3WG7H 1YTYA 3GFIA 2M2EA 5L3BA 3RJEA 5E17F 2FE3A 2MH2A 2OZUA 1QZXA 4LZGA 5DDYA 3EDPA 1L3LA 1OCOC 3K2ZA 1LUJB 5J2GA 2OUMA 2QLAA 4KNWA 4XA5A 2ACJA 2X6YA 4II3A 1IJWC 3WE3A 4R79A 4IEJA 1M2OA 3TP3A 2WL8A 1WQ2A 1VQPI 3K4JA 3I71A 1DPRA 3T8RA 1FNTc 1ETXA 1NLXA 1C17M 2KDOA 1RPWA 2E34A 3RVYA 4XRFA 3US6A 2KL4A 3UXOA 2OBPA 1WASA 2RREA 5HV9A 5GADJ 5HLGA 2QYOA 4CCOA 3PJRA 4LERA 1RZTA 1ZQLA 4AT8B 1JHHA 4DNCA 3V7JA 4EJWA 1BPDA 1XDUA 5BMZA 7ICFA 1ERDA 3S0XA 2ME0A 3FBNB 4U0VA 1FJLA 2RN7A 3SQNA 4WC6A 3JSOA 3U3FA 4N4OB 1JMWA 4DOZA 1NSGB 3EH1A 2WB1A 1W7PB 1T98A 3SFZA 2K7LA 1X19A 3K66A 1IDYA 1FAPB 2HKXA 2XLMA 1GUUA 3I4PA 1H88C 3ZQGA 1EJ9A 3HSRA 2DCEA 4IVNA 3VEPA 4K9BA 2DT6A 4M9ZA 4ABZA 3C5GA 5KYWA 2KRCA 4RGUA 3ABLC 2LYCA 4ZYGA 4QPOA 1ETVA 3FF5A 3H5AA 6PAXA 3L2CA 1OCRH 5E8GA 4BHBA 2LKPA 1QPMA 4O9MA 5B66C 5D8LB 3K1MA 5FJ8J 3VYSB 5EYRA 3HPGA 1GDTA 4OIPF 4NQWA 5BQIA 3ATPA 3UXNA 2DO7A 2KNHA 4I7HA 4CICA 3GWZA 4TURA 3BEHA 2LFBA 2JRMA 1LI5A 3S3OA 5ICEA 4EKWA 1YZCA 4N4NB 8ICMA 3PNVA 2HHPA 4MLOA 3SNHA 4RWOA 5F2VO 4ZYHA 5D46A 4C2TA 4XRHA 3OVAA 4E0HA 3WTZA 4CCJA 4CHUA 4A0XA 3KKBA 2EV0A 4Z6CA 5HS7A 2MLKA 1GQAA 3K1HA 4TUPA 2LSOA 4JP0A 2UXNA 2VQGA 2LREA 2XKPA 5BPDA 5DKWA 2M34A 5F1JA 2TRTA 1CGOA 4HOBA 3ER8C 9ICFA 4EQQA 1ZHZA 4MTOA 2HSQA 4KN4X 2IHOA 3VAYA 3ELKA 1ETKA 2ZH3A 3CMEI 1PP8F 1G4US 3IHUA 1R4NB 2L9JA 4OINF 4FQGA 1ETQA 2VKHA 4CZZA 4KB6A 3OYJA 3SEOA 3FBIB 4JJGA 4N9HA 3TW6A 4G9YA 4RMNA 3UNGC 8ICOA 1HW1A 4M47A 4OAZA 3V42A 2DFFA 2LF7A 3LSJA 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 1OXBA 5GPGB 2NVUB 2ZH4A 1XC5A 4CSWA 3C8GA 3LFKA 3C3WA 1J75A 2CMPA 3LA2A 3V8JA 4LLLA 1MNDA 1XMAA 3NG1A 3H0GJ 5T1DB 3K6BA 1P6RA 4WXCA 1KEJA 5CVIA 4NQFA 1AKHB 3V5YA 2V1DA 4CIPA 4ZDPA 7ICRA 3S17J 1XS9A 4PJNA 1PUFB 1E83A 4A93J 3ECOA 2BE5F 2Q7RA 3JPPA 1ORYA 5E1XA 2W24A 4ZC3A 2PG4A 1BR1A 1R8CA 1SD5A 2Y69H 2VKEA 2L6FA 5M3FJ 2HUJA 1GXPA 1K61A 3T9OA 1ZQXA 3EUHA 3COAC 1EA8A 2KQ9A 3DKAA 2O0YA 2HTJA 2XB5A 2NRAC 2NNNA 3JRBA 2QUPA 4O6JA 1FP1D 1WI9A 3HJ4A 5HRIA 8ICCA 3M4CA 2VB6A 4AVZA 3HSEA 1ZW3A 1ORKA 1FC3A 3LA7A 3OYMA 1ZGJA 3F6OA 2ISYA 3BTLA 3FKJA 2D5VA 1OU5A 3K1IA 2DT5A 2CNWA 4RWNA 3ZGKA 4PFOA 4DBRA 4ZLCA 1PV3A 9ICMA 1BI2A 1WPKA 3K4KA 4UB8C 3TBIA 3B9QA 4GQHA 1IN6A 3EJNA 4UBCA 5J4YA 1J2XA 4E6KG 3ZRGA 1WKMA 1X58A 1H89C 3IWZA 2ZJPF 2K27A 3H92A 4BEJA 5IT9K 3J80K 1SVOA 2HSBA 2YRFA 1HSJA 4JTDB 3UXPA 4B1RA 2CO5A 2IA1A 4DYRA 2P81A 2DMNA 1WVRA 3AGTA 5B1AC 1I1GA 4XKVA 4I44A 2F4OB 3RJFA 3KP5A 1EH6A 3DM5A 3C2BA 2W4MA 4CDVA 1J09A 4DVYP 4W8KA 3PCVA 3RPUA 1O3SA 3REOA 4IHWA 3SXKA 3EG9A 3FKIJ 1WHUA 2OQRA 2ECBA 1L3PA 2XS8A 3QVZA 3U8PA 4P5OA 3MDCA 4U7DA 3VPRA 2KZVA 1A7DA 3C2MA 2BEOA 3BZCA 3HB9A 2O6GE 1MJ9A 2DAOA 4HAMA 2GM4A 5DM7F 4BBSJ 2Y3GA 1GGQA 2BXYA 3MQ0A 5E3CA 2M9HA 4KN7X 3M07A 3GTPJ 2DA7A 4C9YA 5HDKA 2BCVA 3HNJA 1IG7A 2AU5A 3CDIA 2QSGX 3U3BA 1E86A 2NVYJ 4CZCA 4A3CJ 4R64A 3S1QJ 4M0AA 1EV7A 5GAHJ 1H6GA 5CI8A 4WC2A 1J0RA 4OAIZ 4OD4A 1EH8A 3BCAA 5CP2A 2BW3A 2E60A 4K2EA 2XSEA 1N25A 1NU7D 4IXAA 3W8IA 4NXUA 2PJPA 4CUGA 3V7RA 5IYCJ 2GXGA 3VYRB 2OJQA 2CQNA 4F5PA 1Z23A 2P5VA 1ULYA 3DFGA 2X6WA 2P6SA 2VBXA 4C2MJ 4MQ9F 2A6TA 4JCZA 2LD6A 1ZN2A 2GAFD 3V7LA 2Q3TA 1Y6DA 4U5BE 2K5CA 3NMKA 2QE9A 4PDKA 4NKTA 1USTA 2ZCWA 2ZH6A 1JQRA 5TJJA 4MTEA 1QVUA 1IN7A 5JVTA 3ZXSA 2XPUA 1SFUA 2EPKX 5K0IA 2ZH9A 3Q7LA 2DA1A 4HX4A 3EYYA 2V1UA 1VQ5I 1FZPB 1MIJA 1UB9A 2DDAA 4ZLDA 3PHF2 4BXFA 2VH3A 3F9KA 3HDDA 4DZJA 3ISCA 4ASNA 4RGSA 3EHMA 2XLWA 4XEFA 3RQIA 1MMGA 3H5RA 1ZQDA 1FMWA 3GTOJ 4NBQA 3F8FA 1PUEE 1L0OC 1S7EA 2W9YA 4NQWB 1P2FA 4FX4A 3AQBA 1HW2A 2VBZA 1LDJA 2RAEA 2W25A 4G12A 3DEWA 1Z7UA 2AXTC 2X1DA 4FESA 3N0TA 3IWFA 1X3UA 1TVAA 2WWYA 7ICGA 5TISC 2VQCA 5TZVA 3FDQA 1RKTA 5KYUB 1TWHJ 4JC7A 5GPCA 3A1YA 4IOCF 1HDDC 3LS0A 2KMUA 2W84A 3CLOA 1NU9C 3VYWA 2NSFA 4B8XA 2K02A 3RJGA 1QQIA 1FYKA 3KPHA 2YS9A 2P0NA 2MW8A 3OIOA 2IT0A 2X51A 1LFUP 4MS2A 5AIQA 1IRFA 1O3UA 1HY5A 5EG0B 1BL0A 1FT9A 3DBLB 1VOMA 2VBWA 2ZH8A 4KJZA 1U5TC 1UJ8A 1W5SA 4RM3A 3CMAI 2ZXPA 7ICSA 3UQ2A 1ZHXA 2CU7A 4XRMA 1LE8B 2DMPA 4U5CE 4A3FJ 3ZP5A 4RB2C 3KLNA 2IVMA 3DBHB 3GFMA 1I3AA 2BE3A 1KDHA 5B3IA 1OCRC 2EINH 2XGEA 5E3NA 3C7JA 3R2PA 5HRHA 2H8WA 2YWAA 2NUPA 2R7QA 1YYJA 1CQTA 3NYLA 4ULWA 4OAGA 3PMNA 5FFXA 1YJWI 2KFDA 2HPMA 1YARO 4QZEA 5CQEA 2GA1A 3TOLA 1XTAA 2JQ7A 4BY7J 1Z6AA 2DN0A 4YL0A 5IIOA 4FT8A 5ILVA 2ZKZA 3HGYA 2Y75A 1GV5A 4GFBA 1IRGA 3S16J 2Y31A 4CCKA 5KNLA 3R4KA 1LS1A 1T6IA 3GCMA 5IT3A 2PMZN 3O3KA 1W36C 1TZLA 2YU9J 1YX3A 2GA2A 2BC5A 1RMVA 4NY8A 5M3MJ 4MTFA 2H6BA 5E18F 4Y52J 1JN3A 4B47A 3S1NJ 2MWQA 5J3LA 4QI2A 1DQUA 3N2ZB 4X4RA 2Q00A 1HE9A 2E1OA 2VC9A 2L9NA 3DLAA 1A6QA 5AONA 4IO9F 1VQ4I 1I6XA 4FETA 4UVCA 3NEUA 5HR9A 2IBFA 2X0CA 2R4GA 4XLEA 1X3WB 2A0BA 5J0TA 4DRHB 1R22A 4CX9A 1Q1VA 4E7KA 1ITYA 3TOMA 2CJJA 2XAUA 3G1OA 4ZTFA 1RI7A 1DOWA 3W6VA 1HMOA 1SAUA 4R32A 4CS9C 1HDPA 5HRFA 1R1UA 4ESBA 3AFHA 5K7HA 5DTDA 2R3SA 1BR2A 5D62A 5ED4A 4M3EA 3LAPA 1WWXA 2XM0A 1W7PA 4XWJA 1BPBA 2JT1A 1BC7C 2JA6J 2PFPA 1Y1WJ 2Q2EA 5JHUA 4CCLA 3CEXA 2CYYA 2X4HA 3OOUA 3QPTA 5J40A 1IDZA 1RCPA 3ITFA 5TGTA 2H27A 2BVLA 1NK3P 5CFUA 3CDHA 1LM3B 2RQQA 2VOOA 4Z9JA 3BPVA 4EVIA 2DJNA 2JTVA 4J7TA 4WXHA 3TW7A 1TC3C 2PLYA 5EGOB 3CCSI 3RW0A 2W48A 3P9CA 4JYKA 3OR1C 5DM6F 9ANTA 4IHTA 4L6RA 1HXDA 1P7IA 3CDLA 5E1WA 1IN8A 4C3DA 4X5VA 1FMVA 2EPFA 3BZ6A 4A3KJ 2QLZA 1OCPA 9ICWA 5DS4A 1V4AA 3MCZA 4IL6C 2ZXWH 3U1KA 1HMDA 3NDBB 3JPQA 3RJIA 3DKXA 4N6HA 4Z9IA 4QTRA 2WV0A 4JE9A 1GV2A 2DOFA 1POGA 1S72I 1P92A 2M2UA 4PHEA 4D4XA 4LITA 3H9QA 3AOUA 4JX6A 4LACB 3JCFA 3JPTA 1ZK8A 3EPZA 1OPCA 1OFCX 1ON1A 1MIWA 4Y17A 4MVQA 1T95A 4EEFG 4WC0A 1YHQI 1HUZA 3HC7A 1BA5A 8ICRA 1O5HA 1O7FA 3BTIA 5HODA 2A68F 3I58A 4LZDA 3UKGA 2M4EA 5E3AA 1A31A 4IQTA 4TUSA 4D7MA 4A3EJ 5JLWA 2NUTB 4HV5A 2R02A 2NVQJ 5KK1A 2V7FA 1REPC 1HLVA 4PJLA 4I2FA 2VXDA 3NYBA 3L0IA 3FAJA 4BPMA 3MDAA 2FRHA 2IAIA 3CP8A 2DYRC 1N78A 2OCCH 3FX3A 1N75A 1JOGA 2HGCA 1DOVA 2H7OA 4NUBA 4WJ0A 2ZH5A 4L5IA 4K9AA 3JR9A 3JRGA 2DPUA 8ICXA 1PD0A 5EHHA 1X4OA 2DW4A 4R8HA 4AD9A 3C63A 3U9JA 4WWCA 3F8NA 1PYVA 3OMYA 3S15J 1G3TA 3GTJJ 1XGSA 3QPSA 4C3EA 2Z15A 1DGWY 4K99A 5K5QA 2VN2A 3BP8A 1BC8C 1BR4A 3I54A 4M2YA 4PHPA 2NVXJ 5F04A 3JYHA 2DMQA 4DYQA 2HEOA 5HNHA 1B8IB 1QU3A 2FMSA 2L81A 3T0YA 5HRLA 4JK1X 2L02A 3NARA 2ESNA 4P6IC 1TFOB 4NTAA 4GYGA 1TQIA 2HFHA 4GXOA 1BJAA 2ZC2A 4A69C 3O10A 2Z5UA 3H3ZA 4M9XA 4JIOA 1WJCA 3HZJA 3WTTC 2M0CA 5DB8A 3AU2A 3IRRA 2GA0A 4QZIA 1R4TA 2JWTA 2I15A 2AWCA 3TFRA 3MGIA 3AUOA 2PMUA 3NWSA 4UUSB 2ZPAA 3JCUC 5D4SA 2O7OA 2EBIA 2LH9A 5LRRA 5LD2C 2NG1A 5J0RA 4BH9A 5H6QA 1HKQA 1FSEA 1Q0DA 4RBNA 4CS7A 8ICNA 4GEHA 4JTCB 1MBJA 3CJQB 3TP0A 3CLQA 5DD4A 2UUHA 5JP7A 1ZQMA 2I9GA 4FO6A 2R92J 3SXZA 2FMYA 4FHTA 2V79A 1P7JA 2E36A 4IRIA 1YRNA 3U5SA 3L2UA 1ZGAA 5LGNA 2I8BA 1ZRCA 3OSFA 3DWLE 5F08A 5DS9A 3CUQC 2KIUA 3LL7A 2JPUA 1R71A 3MKWB 2PBIA 1EF4A 5J8FA 2CV1A 3KP6A 4AL1A 4Y3OA 4LG0A 3MFNA 4CDAA 4Z6YA 2HPIA 3S93A 3EGDA 4BHCA 1TWGA 3GANA 3JT1A 4KI2A 4P4MA 3GUDA 1LI7A 4UV9A 4KT5C 3PIPF 1LVAA 1ODDA 4RLQA 3MCRA 4DVZA 3OGUA 3DWWA 3IQCA 2RFFA 3I5UA 2EA4A 2ZH7A 2JA8J 2VLAA 3AQCA 8ICKA 3BJOA 3SHFA 4I27A 3GZ5A 5EZGA 2AVKA 1PX5A 2VT2A 3L2RA 3RJJA 3OYDA 4ER9A 4F55A 3GFJA 3KIOA 1MDMA 3S1MJ 3BR5A 3CP2A 2LOOA 4HW0A 3RZDJ 1ZQ3P 3H37A 5FO5A 4EGWA 5JTGA 1CF7A 4XICA 1KONA 2V26A 3H1CA 5HHIA 2BCSA 3S2HJ 1M1EB 1Q0KA 4EV6A 4YMMA 4S3NA 4AE4B 1B9NA 3MFKA 4FASD 2EIKH 4MFDA 1DGRM 2XF6A 4BQOA 1FOXA 1WI3A 3RFYA 4BEMJ 1IRZA 1CPRA 2OAZA 3CO6C 5IOYA 1FBUA 3WHCA 1FPQA 5FB2A 3NMIA 3ZQIA 3CCLI 1KTMA 3ERCC 5BPIA 1JKQC 4U5GA 3RH3A 1T01A 2XXAA 5M5XJ 4NDLA 3CCYA 3BC8A 4WXDA 4Q4ZF 4ZH4F 1ETWA 1G8XA 3DAFA 4CA0A 5E33A 2H8RA 1T2KA 2NS8A 2NNYA 1BJZA 2A61A 2V9PA 2E1MC 3HRMA 2YX7A 1AWCA 1RKEB 4UAYA 4I2EA 2R5ZA 3T6BA 3UPQA 2C03A 1FBQA 3A11A 4JBAA 1VQ6I 4M6VA 4CYCA 1KQ8A 1OW6A 4LOCA 1V55H 2E19A 1F1ZA 3F0CA 3SZTA 1FIPA 4CCMA 5M5YJ 1RIOH 2HMQA 3HNIA 3FK7A 3WFQE 8ICTA 3H0DA 3DD7A 1OYWA 5J8CA 3BWGA 3VWBA 4M74A 1USSA 4DXWA 1D0ZA 3BPXA 1BI1A 1V5EA 1QBJA 1ETYA 2WY8Q 3W8HA 2MG4A 4OU0A 5JFRA 4Z6FA 4P4PA 3T5XA 2PJRB 4FHVA 4FH3A 2CV0A 2Z33A 3GEEA 4G6TB 5CFTA 3JRHA 4EUKB 4OD5A 5HDGA 3C18A 3FHNA 4XEKA 4LB6B 4AT8A 2G7HA 4B6IA 3FDYA 2HKVA 4A3BJ 4ENJA 1GS9A 5ILUA 4WC4A 2DBBA 1SEUA 4JJFA 3AQNA 1TV9A 1YW7A 2K9LA 3RKQA 5T3TA 2JA2A 4XORA 5CLSA 1LJ9A 4KMUX 3RJKA 4PZJA 3H3VK 3V7KA 1JT0A 1P4AA 1WH7A 2ZFUA 4BE1A 4L0ZB 2DFHA 2KJBA 5F5HA 3HJ1A 2F5FA 3BDDA 4XONA 4YIFA 4OAYA 3CQZA 4CSAC 1T6UA 2L2OA 2Q9AA 2M8EA 5H2FC 2P7CB 4O5KA 4I09A 1T6SA 5AC4A 1R36A 2XAJA 4KNVA 2EFQA 1MJBA 3VDXA 2CG4A 3C2KA 2RQPA 4QZCA 3ZQVA 4I0UA 4X6AJ 2M5WA 3HHGA 1R8AA 4IX7A 4YD2A 2ZBKA 2ZH1A 4D7NA 4MF2A 1JMSA 3ABMH 3QPLA 1Q78A 4IJJA 3POVA 1L7CA 4K96A 5CVUA 2VBYA 1KGSA 4PGXA 5EGYA 2XB0X 3ABKH 1YAUO 5JVGF 1Z7Qc 1AHDP 3ER9B 5BS6A 3S3MA 3HKZN 4AE4A 2R05A 3E0JB 1IXRC 2GIZA 3HXLA 1D0YA 2HJMA 4I2AA 2FMQA 4K4IA 4NLZA 4HNVA 4H54A 2E1MB 3DAGA 1OLTA 2XRNA 2J5OA 3ULQB 1BBHA 5JVEA 1GVJA 2YEVA 2A6HF 3I64A 3K2AA 3HL2A 3DLLF 3AJMA 4Q48A 4KLJA 3FXQA 3LOCA 4A3MJ 1MH3A 5LEKA 2DK5A 4YL1A 2FBKA 3G1MA 3RYPA 1LS4A 2VKVA 8ICLA 5H20A 2QEXI 2DOEA 3IPMO 2A5WA 2E71A 2R7WA 4L5JA 3O6BB 4EGYA 4KYWA 1Q0FA 1WGWA 2NPUA 3B73A 4U0WA 2IS2A 4XQ1A 4A12A 3EETA 4XLPF 3CO7C 3ONQA 5DCMB 1RUOA 5FLXK 1S3JA 2HV7A 2L6GA 4MF8A 4M71A 3I0TA 4ZTJA 3NWIA 2M7BA 4P9TA 1R49A 4UB2A 4J19A 1WZ2A 8ICGA 4M04A 2EIMC 3N05A 3B71A 3FMSA