3C18A

Crystal structure of nucleotidyltransferase-like protein (zp_00538802.1) from exiguobacterium sibiricum 255-15 at 1.90 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
GMEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQMSLSFAKLLRRFQDGRNLFSRGNYYDAYTHVHHALHHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQSKVLSGGKYLFEVMRERDRPWTMHELMEESRLTELKVDLGSLVDFFIRKGLIRISYQRTKGLGVELVTYEPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleotidyltransferase-like protein
publication title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution
rcsb
source organism Exiguobacterium sibiricum
total genus 107
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14540 NTF-like Nucleotidyltransferase-like
A PF18576 HTH_52 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c18A03
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3c18A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3c18A01
3R4KA 3BRJA 3M1EA 3O3KA 3ROUA 3JPPA 1YLFA 2PMUA 4RQ8A 2JT1A 8ICEA 8ICOA 1RUNA 3V4GA 2KJCA 1J5YA 5J2JA 5IT9Z 4PCQA 1BI3A 4UBBA 2RV8A 2BCQA 2L02A 4F7ZA 2QWWA 4QLCU 2BCVA 1WI9A 2F5FA 2CW0F 4ZYGA 2XASA 3C8GB 4I2CA 4LLGF 2QQAA 1R1UA 3JPOA 1RZTA 1R1TA 2NYXA 4X4PA 3VEPA 4E7XA 4EJOA 1BN5A 3L9FA 4RB1A 8ICXA 4WC7A 1FSHA 4Q5SF 4ASNA 5ICFA 3H3ZA 2EA2A 3SZPA 2Q2EA 2ZH4A 1GVJA 1YS7A 5F28E 2XAQA 4HZFA 3ZMTA 3WFPA 5E8IA 3I54A 2ZH1A 1ZQSA 2RVCA 4CXFA 5F64A 5HVQC 1QBJA 5J2EA 2FBKA 3MZHA 4RT2A 3F8CA 1IRGA 1XCBA 3J80K 3RIRA 1UETA 3FXQA 3SHFA 3E5QA 3VFZA 4ZYDA 4XRFA 2OQGA 3ULQB 3RKXA 2IPQX 4P9FA 3ZMSA 8ICFA 3B71A 2K86A 3U0CA 9ICOA 2R7DA 4R66A 1V3FA 4RPYA 4KN4X 2ZXJA 3ISPA 4UB1A 2KIMA 2ZH8A 2HYFA 1MDMA 4M5DA 3BWGA 2FNPA 4F5OA 1D8KA 3E6MA 4EGYA 4YN4A 4M9SA 3HRSA 2M2TA 1G3TA 3VOEA 3TULA 1QGPA 4MFAA 3AQMA 3FMSA 1WKMA 1YW9A 5L3CA 4QZCA 4ENNA 1OPCA 3ML6A 1XSPA 3QAHA 3ERED 2COMA 1LDKB 3IKVA 1QZYA 4S05A 1ON1A 1HBXG 3OGUA 4KYWA 3FM5A 1HUZA 1ZG3A 3M8FA 3AU6A 8ICPA 5DUKA 1OU5A 1ZQZA 2HTJA 9ICHA 2BCSA 4I2BA 3ZQ7A 2EV0A 1YG2A 5J0OA 3C1DA 4PHPA 9ICPA 2A5YB 2O6GE 4YCXA 2DR9A 4HF1A 4HLXA 1BPXA 4RWOA 3LAJA 3ZMDA 2CFXA 1XGNA 2ZHAA 2BV6A 2GWRA 4G7ZF 1XGSA 4EMSA 6PAXA 1LDDA 2K7LA 3TQNA 4WXHA 3TGNA 4UXNA 4XQ8A 1P4AA 2X4HA 2V9VA 5CJ9A 3F22A 3F6OA 5J2HA 1JAJA 3RJFA 5HS9A 1HKQA 5D5VB 5DV5A 1MIVA 4LVSA 3JAMK 1ZQUA 2FMQA 1ON2A 4L9JA 4AT9A 1I1GA 1O57A 3TO7A 1SMTA 4M9XA 4BXUA 4ENJA 4XRHA 4R8HA 4AD9A 2H6BA 3DFGA 2GXBA 1KNYA 2V1UA 2VN2A 7ICFA 3FXRA 3DQVC 3FXUA 4ATBB 4NQWA 3J7AO 3QP6A 4NM1A 3MZYA 3SZTA 4K4HA 3T8RA 9ICXA 5TJJA 4KN7X 3J81Z 4A0YA 1W5SA 4X4VA 4AIHA 1TLHB 2MH2A 2PFBA 3MAJA 3P7NA 4IHTA 1ZQGA 3RI4A 4RWNA 3V8JA 2XAFA 5HLGA 4L9NA 3QRFF 2MLGA 2W85A 4KFCA 5K5RA 5J0SA 4RQ7A 2FXAA 5CA7A 2A6EF 4LGWA 1UFMA 3CJNA 5H6RA 2FMPA 2Z33A 3JYYA 9ICAA 1ULYA 5E8GA 4YFXF 2VOPA 3OUYA 5HLHA 3Q9VA 2MC3A 5HRGA 2IRFG 5ED4A 3ELKA 2ZNZA 2GXGA 2ELHA 2YU3A 4Z6FA 3L8JA 4FHWA 1F1ZA 2P5KA 3B73A 5DUIA 4HW0A 4WCGA 4U0WA 3GDXA 4KMFA 3QP5A 3UPQA 3M8EA 1QQIA 2PQ8A 1PP7U 1NOMA 4O5EA 5DBAA 4I2JA 1UCRA 4FH5A 1R7JA 3HSFA 2H94A 4NLNA 3V7LA 4I98B 3U2RA 4O5KA 3HW8A 1ZQHA 5HDNA 3M7GA 4ENMA 4P4OA 2L3DA 3C7JA 4HAMA 3GFJA 2CO5A 3RJJA 2P7VB 2STWA 4MEYF 1QZZA 3GVAA 3S2WA 3ISCA 5A2QZ 3C66A 4KDPA 4RQ2A 2GA2A 3ZMVA 1XGMA 1STZA 1ZQOA 1TV9A 1UB9A 3DV8A 1BI2A 1FBSA 1ZH5A 1FT9A 4A5MA 4X4QA 4HDUA 4KLJA 2A68F 2XAHA 2P8TA 2CQKA 3E6DA 2W57A 4LG0A 1BPEA 4M74A 4IQTA 2R7FA 3KP4A 1NHAA 4QZ9A 4YMOA 1YFHA 1ZQBA 2UXNA 4JWMA 3P9KA 4QZDA 2QM3A 4KICA 3L00A 4P2HA 5LRRA 4ON0A 7ICRA 3L9DA 2L6FA 2MBFA 1XN7A 4MTEA 3RH4A 5TRDA 3K1PA 4EGZA 2Z9OA 4JK1X 5HRIA 2Y75A 1SD6A 5ILUA 4EJTA 5DEDA 3MEXA 4I09A 1WOTA 3BPVA 3D5LA 2ACJA 5HR9A 1RI7A 1ZRDA 5D49A 5IIMA 4GYIA 3H3UA 4LLNA 3UPSA 3K9TA 2GA1A 5LRSA 5FFXA 9ICCA 4R63A 1FP1D 3AQLA 3WTYC 3COAC 3N4MA 3LA2A 2BPFA 1D8JA 2DBBA 3GZ6A 4AIJA 2YX4A 4EP7A 2Q8KA 4KIBA 2NNYA 3BOQA 4HQEA 5J29A 3IC7A 3IRRA 1IN4A 1FA0A 3B0YA 5HRHA 3H3AA 1SFXA 4MTDA 2CG4A 3FMRA 5KVRA 4KLTA 5FLXZ 3WFRE 3V7SA 1MDMB 8ICVA 5ILSA 5HDGA 2CWEA 1FPQA 3EYYA 1T38A 2XROA 1B1BA 3L09A 3FZVA 1ZLJA 1YQAA 4PGHA 2UWMA 4S04A 3TO9A 3WTXC 3T5XA 2JRTA 3WU0A 1BC7C 5IIOA 4O6JA 3WTVC 1T6SA 1NO5A 1DPUA 2YWAA 3ZN1A 2ETHA 2LF7A 1USSA 2P6SA 2BE5F 1IN8A 3BZ6A 2M2VA 1K05A 1S29A 3JPTA 2F5EA 2RQPA 1R58A 5LHGA 3JW4A 3RYRA 4QZHA 4EVIA 4BAYA 2QLZA 2JSCA 4Y13A 1JMSA 3V7CA 3BJOA 3UXNA 4UB5A 3PQJA 4EM1A 2WTEA 3PNCA 3DKWA 5D8LB 2F5CA 4RGUA 4M6YA 4CGZA 2ZCWA 2JTVA 1BPBA 1SAXA 2ZJ2A 4KLSA 2EWNA 1IRFA 3GEZA 1BIBA 4EJWA 3GZ5A 1O3RA 1U5TB 1J59A 1QVXA 3F8MA 5J2BA 2HQNA 1F5TA 8ICWA 5E1ZB 1G6NA 4X5VA 3E97A 5DD8A 2G9WA 2W84A 3HIYA 4QWQA 2HOEA 4HV6A 4BQAA 2DFIA 2QZ8A 1GXPA 4XQ7A 3EUHA 4KLEA 1DDNA 3LA7A 4UB3A 1TQPA 1S7OA 5FO5A 3T0YA 1ZQCA 5H6QA 4AWXB 5J8CA 3HRTA 1WTYA 2QBYA 3E6BA 2O8XA 1KDHA 3UXPA 1ZQAA 1J9IA 2YSRA 1AOYA 2PFPA 5L3GA 5HS8A 2AS5F 4M73A 2L6HA 5DDMA 4HF2A 1REPC 3I59A 4P55A 4I2AA 3U9GA 3OVAA 1KU2A 1S6LA 3IHUA 1S3JA 2ZNYA 8ICIA 5LHHA 2Y48A 3OUYB 2DRBA 3CUQB 3C3WA 4MHGA 3VB2A 1Z7UA 1XSXA 3FM3A 4UVAA 4KLFA 3V7KA 2VBXA 8ICNA 3BPXA 3FX3A 4OMYA 3R61A 2OD5A 4X4SA 1A04A 2J5OA 1Q78A 2ZH2A 3E6CC 2Z3YA 1OMIA 4U0VA 1R00A 3GFMA 3AQKA 1E2XA 2XUBA 4I29A 4FHYA 2QUFA 3SQNA 5BMZA 1ZZPA 1BI0A 5H20A 1USTA 1FYLA 3RPQA 4NQFA 4OIOF 1KU9A 4YD1A 4WX9A 2PBIA 1Z9CA 4L5JA 5LLQA 3QU3A 4ESJA 4O9MA 4NLZA 1XMAA 9ICVA 4YD2A 3TFRA 1K7AA 8ICQA 2QQ9A 5BOMA 4UV9A 2UZKA 2ESHA 1JXSA 3JPNA 4NM2A 2YX7A 4A6EA 3K69A 3LSTA 2BPCA 7ICSA 4OOIA 2ZH9A 2KKOA 3KETA 4AT8A 4XEKA 4PHEA 1S7AA 1LDJA 4LK1F 5LEJA 1I27A 2QYOA 4ESFA 2XAGA 1I1SA 8ICBA 4KLQA 4CHUA 4UVCA 4BHCA 3F8NA 1MQ3A 9ICTA 5EEGA 3H92A 3CTAA 4LG0B 5D5UB 1JOGA 3IKTA 2FMLA 8ICHA 4K2EA 4DOAA 3JSOA 2XV4S 4N9IA 1QNTA 4L5IA 3DPTA 4F5QA 4MQ9F 2DT5A 4X0AA 2EB7A 4IPAA 3PMNA 2LKPA 2KK1A 4XLPF 3ECOA 5AIPA 5HHIA 3RH5A 4NHJA 5J6XA 4UD4A 2IVMA 4KLOA 5ICEA 1U78A 1XSNA 1K78A 4WF2A 3B02A 3JTGA 4XSXF 4UAZA 3Q9SA 3WGIA 7ICKA 1B59A 3WGHA 1T2KA 2IA1A 1IN6A 1LVAA 2OU2A 9ICKA 1MJAA 3QPHA 5E17F 4WK8F 2M30A 2NRAC 1K79A 1R89A 3GYHX 1PX5A 2IW5A 4IQVA 3V8KA 1XSVA 2KIFA 3GO5A 1ZQNA 5ILVA 5BQTA 3TOAA 2DRAA 5BOLA 1FY7A 2H09A 2VBYA 3RQEA 4RQ5A 5LGUA 4RPXA 2K02A 3KP6A 2Z99A 2GIVA 4YMMA 1OKRA 4ZYEA 3HYIA 2HZTA 4FX4A 4IRIA 3MFNA 1ONVA 4I2FA 4GO1A 1YW8A 1DP7P 1UFBA 8ICLA 1K40A 7ICOA 2H6CA 4G6QA 4KA4A 3U3FA 4CDGA 3DP7A 1U5TC 5FB2A 4E70A 1H9TA 4WCWA 2TDXA 1L3LA 1OR7A 4DO9A 4F5NA 3DF8A 1MJ9A 2ISZA 4H0EA 4M9NA 2F2EA 2HGCA 5DCFA 1FWZA 2E7WA 1XB4A 2ZMEB 2XHKA 5BOXA 1UEVA 2ISOA 2BYVE 2CYYA 3FHZA 2HQRA 3V8LA 4EQQA 5BPIA 2ZH5A 3F6VA 1VFGA 3MGIA 4G94A 8ICMA 2L54A 1LEAA 4YFNF 3GM1A 5AIQA 2XAJA 5D46A 1HKSA 2OQRA 1BBYA 5IT9K 5J2GA 4LZGA 3MBYA 1CF7B 2ISPA 3HHGA 5AONA 2KRFA 5DDGA 5CWRA 1ZGAA 3E5XA 1PDNC 3FMQA 5FD5A 1FC3A 4TURA 8ICYA 5F2VO 2VE9A 3S9OA 3PQKA 2E7XA 3BY6A 1S8NA 4LD5A 5DB7A 4GCVA 4QZ8A 4M9GA 1TNTA 3QPTA 2QQBA 3RJGA 5HRBA 3KZZA 4KUMA 3CUQC 2DLLA 1B9NA 3MDCA 8ICAA 3GUDA 4WXDA 1PUEE 1W7PA 4YFKF 4UBCA 3OVSA 3NYBA 1FX7A 3JTHA 1TTYA 5D4SA 1G3WA 2JZYA 2MA3A 1JGSA 1P2FA 4JBAA 3RJPA 2JX0A 1ZQMA 4XLNF 1ZQIA 4P4PA 3DPLC 3W6KB 3V7JA 2FMYA 4RB2C 2NS0A 2KJBA 3KCCA 4ESBA 1G3SA 3L2CA 4DOBA 4Q47A 1JE8A 3AJMA 3WTZA 1RZ4A 4HV5A 3RH6A 5DCMB 2HEOA 1J7KA 2BBYA 4RGRA 4M0AA 2H27A 4X0BA 4AT7A 5BPCA 4OU0A 2ZBKA 1YLQA 3I59B 4JQFA 3WGGA 4RGXA 2GQQA 1T98A 2LSOA 3F21A 4KLGA 4PZJA 4GYGA 1FBQA 2D1VA 4MGRA 3WODF 3GF2A 1IN7A 3O10A 2K4JA 2NNNA 1U6GA 1AWCA 2O0YA 3I64A 5E1XA 1XCVA 2PN6A 4IRGA 4E8FA 4PH5A 3K0LA 2FQ3A 4Z6CA 2DR8A 2JPBA 5IINA 1RUOA 1SFUA 4LT6A 1HXDA 4HYEA 2J5PA 3WG9A 3R0JA 3DXJF 3HTUA 4LJZF 1OYYA 1XDSA 1IN5A 1TVAA 4I2DA 1BOAA 1WOLA 5CVRA 3HOTA 1U3EM 4Y17A 3C8GA 5HC9A 5E18F 1CGPA 4HX7A 3RJEA 3C18A 2ZH7A 3TFSA 5E20A 3KLOA 1VJ7A 1KQ0A 5J0TA 1Q79A 1Z6RA 5FD6A 3UQ2A 4I0BA 1LEBA 3I4PA 1YW7A 4MNUA 5LBQA 1MIYA 4TUPA 2XGXA 2LDUA 2HKOA 7ICTA 1F5AA 2DQLA 2W24A 5CP2A 1FYMA 4X4TA 3HSRA 1FLIA 9ICFA 2W9MA 4EJVA 4O5CA 3HIFA 1KGSA 3F8FA 3TDUC 1FZPB 2EV5A 2GAUA 4KLLA 3J81K 4IQWA 2PFOA 8ICUA 1V4RA 1ZRCA 9ICSA 3MDAA 2RC4A 5J2AA 1KYWA 2JPCA 4MF2A 4G6DA 1EH6A 7ICEA 1OW7A 4KIGA 1B6AA 4U88A 4RWPA 3E5UA 2RKHA 1TQMA 3G3ZA 4G9YA 5F6FA 4WBYA 3CUOA 5DBBA 5DB6A 1KA8A 3HSEA 1G4DA 2P6TA 1ZQQA 3OV7A 5ICGA 2FBHA 2KIUA 3RQGA 1R5GA 1WQ2A 4WBZA 4KT5C 3MGHA 1QPMA 4M9JA 1OYWA 3I5UA 2PI0A 3IWFA 2FNAA 3OVBA 5J0PA 4PHDA 3CO6C 2VANA 4RGSA 2IJLA 5HHHA 3R6SA 5D5WB 2D1HA 4I2HA 5CVIA 1RPLA 5J8FA 5J0QA 4MF8A 1XDUA 4EBJA 4MFFA 1OW8A 2GZWA 1FNNA 1EV7A 4AIKA 5HRLA 3KEQA 2DO7A 4EV0A 1R22A 4PGYA 5J0YA 3EDPA 2LK4A 3MFKA 2P5VA 2EFOA 4L0YB 4IJAA 2C6YA 3WFOA 4YMNA 5HS7A 3K7DA 3GFIA 4I7HA 4D0PA 5L3DA 3TDZC 1ZG1A 4UD5A 9ICRA 3DEUA 3LFKA 2YPRA 4CZZA 4QZBA 5D8KB 2VODA 2HS5A 3WFSC 2DVIA 2YR2A 3SFZA 2D2WA 1O3UA 4JWNA 3BP8A 1KYZA 4LMYA 2A07F 3F8BA 4RPZA 4FH3A 4XEVA 4ZYHA 4I2OA 3E3VA 2E1NA 3RJIA 1J2XA 1WRJA 1FOKA 8ICRA 3V72A 4A12A 1RNLA 1BM9A 2R3SA 2V79A 4AT9B 3SXYA 1MGTA 2HKXA 2L4AA 3OOPA 5J0RA 2ZH3A 3T8TA 5DB9A 1H9GA 1Z91A 4OIQF 5DB8A 1ODDA 4ZZLA 7ICMA 5K5QA 1LNWA 1KTMA 3J80Z 3ZPLA 4HBLA 4RWQA 1Z05A 2E1CA 4YIIA 3KFWX 5HLIA 1HUOA 4RT3A 2A6HF 4M9ZA 3LWFA 3P9IA 3HJ4A 2ZH6A 5EEHA 2ID1A 4F5RA 2PEXA 3GM3A 1YS6A 7ICIA 3I58A 4PPXA 3KP2A 3C5FA 2OZUA 4HLYA 1TFYA 1JHHA 2IHMA 4G7OF 2XRNA 1U2WA 5IIIA 1QO0D 4M9HA 4F5PA 2L6GA 1R5HA 2RFFA 3O6BB 3P9CA 4XUSA 5HRFA 1ZQDA 1MKMA 4UHTA 3V7RA 3WFQE 2L4MA 4U7BA 1O3TA 5K1YA 2Y0MA 5FLXK 4M6XA 3K1MA 2FOKA 4OIPF 1ZREA 4LLLA 2LNBA 4PGXA 2EFPA 1UHWA 3RTRA 3O2PE 1ZLKA 1J0RA 4L0ZB 1FBUA 2ADUA 4NB5A 1PP8F 2VOOA 3PMLA 2G7HA 1XD7A 4LB5A 5CVUA 1ZQFA 4CYDA 5L3FA 1W7PD 2V1DA 1O3QA 4EBKA 3RYPA 1YYVA 2O1PA 2DK8A 4NXZA 8ICZA 2AXLA 3H38A 2CSOA 1P6RA 5DEQA 4HA8A 1T39A 1IF1A 5L3EA 4RQ3A 1HSJA 2FBIA 4HOBA 5CVVA 3WTTC 4X4NA 4BHPA 4HF0A 4Z6DA 2FRHA 1IW7F 1EH8A 2G7UA 2X0LA 3GW2A 3JAMZ 1BPZA 2OAZA 9ICLA 2M2UA 4XBFA 2FE3A 5IILA 4R65A 2VXZA 4MEXF 1C0WA 4LFUA 3GM2A 4Q48A 2DR5A 2PG4A 2Z5UA 1HQCA 4I0AA 1TQIA 2DR7A 2P66A 1T0FA 3UXOA 1HKTA 2I9GA 4P9UA 2EV6A 2FMSA 3MWMA 1EH7A 4M9LA 2QENA 1ZQKA 7ICGA 4OMZA 4RQ1A 4TV7A 1Z1DA 4P5OA 2BEOA 3PFIA 3ABTA 4LB6B 4FO6A 1ZQEA 2WV0A 3C2MA 1KU3A 4I2EA 3JPSA 1SMYF 1ZN2A 2EK5A 4ZZDA 4WC2A 1MJBA 3LQQA 3QU6A 1YTYA 4FHXA 3HUGA 4IQUA 2V1XA 5J2DA 2XIGA 4UVBA 5DDYA 5J0XA 2ZKZA 1TFWA 1MQ2A 1B4AA 3C5GA 4FHPA 1HW2A 1K04A 1HW5A 3IL2A 1YO5C 3C8GD 5JHUA 2LF8A 3ZMUA 1IZ1A 2OBPA 5KK1A 4Q4ZF 8ICKA 3NEUA 3FWEA 2DAOA 2PMHA 1TBXA 5CR0A 2EFNA 4RAYA 3JZ0A 1ZQVA 4I27A 4IXAA 4Z2YA 4KIFA 5FFZA 5J2CA 4PHAA 3LA3A 1U8RA 3RQFA 1R8AA 5CVJA 4QZFA 4O3MA 3AQNA 1BPYA 9ICIA 4GXKA 4UUVA 4PGGA 5EOZA 4I28A 3I71A 4WWCA 4BNCA 4QZGA 5L3BA 3AU2A 8ICTA 9ICNA 3EYIA 4WC5A 1I5ZA 4UAWA 4MFCA 4R64A 5IIKA 3R60A 4P96A 8ICGA 5D6EA 4RQ6A 1LJ9A 3BDDA 2BGCA 1WSUA 3JSPA 4U0YA 4XA5A 4N0BA 1DUXC 2HR3A 3HRUA 2WC2A 2VONA 4WXCA 1W4MA 3K2ZA 4EJUA 4NY8A 4I2GA 2QVOA 5ERIA 9ICBA 1U5TA 4M47A 4GXJA 1D3YA 3K75D 3CDHA 1ZRFA 1ZQJA 2DU9A 4WC3A 1ZAOA 2FU4A 2EFWA 1BJAA 2VC0A 5J0WA 4G8XA 4O5VA 4CICA 1O7FA 1ZQRA 2IP2A 2K4BA 1RIOH 4OINF 1WWPA 3RPUA 4I02A 2RNJA 2HHPA 3UQ0A 3CO7C 1J75A 2O5AA 7ICHA 1FYKA 2WWYA 1ZJNA 1DPRA 3WTSC 1H0MA 1KU7A 3MCZA 3ISDA 4Z6EA 1BPDA 5E1WA 1IAWA 4I01A 4RB0A 2STTA 3WTUC 4GXIA 3RJKA 2BE3A 4IF4A 5BS6A 3GLXA 5DYMA 1FSEA 2NAZA 4KLMA 2QBYB 4FHVA 4U7DA 2VBZA 1Y0UA 4ENKA 2FA5A 4XSZF 2M5WA 1ZQLA 3N97A 5D5XB 1WWXA 3LK9A 3RJHA 5F1RA 4E80A 4TUSA 3H39A 3ZMZA 1R8BA 1P92A 2XKOA 3WU1B 3VODA 4KNYA 3CUQA 4ETSA 4EM0B 4HDVA 3HX0A 3WTWC 2O3FA 2Q0OA 2O03A 5DECA 1R8CA 2OZ6A 2F5DA 1MIWA 1X3UA 3D0SA 4DQ2A 2VT3A 3HRMA 5FGMA 3HTSB 5CHGA 4Y15A 5JR3A 5CB1A 4YIFA 9ICMA 4ZH4F 1KEJA 1F9NA 1O3SA 1ZQWA 4R79A 1KQ9A 1ZGJA 4G7HF 2PLYA 1SD7A 4KLDA 3HWTA 2FF4A 4DNCA 3JPRA 1SD5A 1P4XA 1MZBA 5K5OA 2M2WA 2ESNA 2RGVA 3FF5A 3MQ0A 1SFEA 2EFQA 2FSWA 4OIRF 5TZVA 3F23A 2B0LA 1R1VA 5ICCA 1P4WA 1XGOA 2VT2A 4L18B 1VTNC 1ZQYA 2HYGD 4NLKA 1Z6TA 3KE2A 3RKWA 1BIAA 2MLKA 5DD4A 3RKYA 9ICEA 4AVPA 3ECHA 4HQMA 1XSLA 3GX4X 4AT8B 1ZYRF 3ABUA 2VE8A 4PGQA 3GFLA 4X4UA 2DK5A 4A6DA 2P4WA 3Q5FA 1MD0A 5DBCA 4MQVA 1B9MA 4FHTA 1PV3A 1O7LA 2A3SA 2DQRA 2D45A 7ICUA 4DOCA 2V6CA 1IXRC 3M9AA 5J0UA 1LB2A 1JN3A 2GWSA 4QZAA 1W5TA 7ICJA 2IT0A 3KEOA 2FEZA 3C2LA 1ZQTA 2HSBA 3TO6A 1JHFA 4CO8A 3OV8A 5JVTA 3G73A 3TKYA 4RQ4A 4HX4A 5J2FA 2BCUA 3WE2A 1ZQXA 4WC4A 1K78B 3NQOA 2Q00A 4QZEA 1YIOA 2M1BA 3BJ6A 3W6JB 1GHCA 3T1BA 5JFRA 1FP2A 2XVCA 3HOSA 3KP3A 4P4MA 3AUOA 1V4AA 1Q1HA 4BH9A 3ZN0A 4KLIA 4UAYA 3HJ1A 4B09A 4A0XA 2O61A 7ICQA 4RQ0A 4UV8A 3KZYA 2HFHA 2M45A 1IXCA 2HDCA 3KP7A 5J2IA 5D6FA 3RDIA 3B0XA 5LEKA 3EETA 2DTRA 2M8EA 4M2YA 5BPDA 3CLOA 1IXSB 2EJRA 2ZFWA 1ZG5A 5D4BA 5HOOA 4FT8A 4RB3C 4WC6A 5HRKA 4YG2F 5HDKA 3L8IA 8ICJA 2CGPA 4RS8A 5D4RA 2ISYA 1SD4A 2P5LC 2IA2A 2PJPA 2ZMEA 3ISBA 3QOPA 1E17A 3K1NA 3NRVA 4N9HA 5JI6A 5A2QK 3IRQA 2JPUA 4A2UA 1ZQPA 1R23A 4B8XA 4RAZA 1GXQA 1BC8C 1IUYA 5IT3A 2NRKA 4I2IA 7ICLA 2EA4A 1OYIA 2XKPA 3BROA 4IHSA 1TW3A 1OW6A 4M71A 1CF7A 4TUQA 4PDKA 7ICNA 9ICQA 5IIJA 3C2KA 2DPDA 2K27A 2PFNA 4R1HA 3IWZA 4A0ZA 1R36A 3WE3A 3TOBA 5HREA 3ZP5A 2DPUA 2HWVA 3I0TA 7ICPA 1G3YA 3GWZA 1I6XA 4L9VA 1F4KA 2BPGA 1HSTA 9ICUA 3F3XA 4ATBA 3U1DA 4HX8A 4GGGA 4GXOA 1ZARA 4L9TA 2DI3A 1BI1A 1TW2A 1K6OA 3AAFA 3GXOA 3KP5A 1L0OC 5LGTA 3EQLF 2PXIA 4BYYA 2Q66A 4BHBA 4K4GA 4R32A 3LQRA 3LQCB 4KLUA 2ZHBA 9ICJA 4IVNA 1KQ8A 2L01A 4X4OA 3F72A 1LQ1A 5CJ7A 3R0AA 4X4RA 9ICWA 4UB2A 1W7PB 2VBWA 3L7WA 1D5VA 9ICGA 3H37A 4M04A 1JQRA 7ICVA 1HW1A 4EM2A 3LAPA 2P7CB 2RDPA 2DW4A 2PBEA 1UHMA 1XSDA 2HTSA 2OA4A 2A69F 4WC0A 5LGNA 5J2KA 5DCMA 5LHIA 4LZDA 3HHHA 3KLNA 3I53A 8ICCA 4M72A 1ZHFA 4A5NA 4IG8A 1XMKA 2PFQA 2W25A 4KMUX 2VC1A 4K4IA 8ICSA 1UEUA 2MH9A 5CYVA 4LK0F 4WC1A 2ZO4A 4AT7B 1TNSA 4NKTA 2IA0A 2A61A 4NKUA 4S3NA 4QZIA 5DKWA 2BCRA 4KLHA 5HRDA 5CLSA 4IRHA 4UB4A 2RN7A 3BJAA 2MD5A 3REOA 2UXXA 1ZJMA 4UNOA 2M87A 4FX0A 4XEFA 3JPQA
chains in the Genus database with same CATH superfamily
3R4KA 3BRJA 3M1EA 3O3KA 3ROUA 3CMMA 4RAGA 3DE8A 3JPPA 1S5LC 1YLFA 2PMUA 4RQ8A 1I5NA 1TR2A 3K1HA 5B5EC 3BR3A 2JT1A 2VASA 1APCA 8ICEA 8ICOA 5KAIC 1RUNA 3V4GA 1E3OC 4JJFA 2KJCA 2LY9A 1VLTA 1J5YA 4J19A 5J2JA 4PJ0C 3DCFA 2E35A 3HKZN 5IT9Z 4PCQA 1BI3A 4UBBA 2RV8A 2BL2A 4MIMA 5EDNA 2YL1A 4YL1A 2BCQA 2LREA 2L02A 4F7ZA 3TK0A 5C4XJ 3PMRA 1M2VB 2XLVA 4JX6A 2QWWA 4QLCU 1QA6A 4IGGA 3OWTA 2BCVA 1WI9A 2F5FA 3NKEA 2CW0F 2ID6A 4ZYGA 3VSKA 3W6VA 2XASA 2KDOA 4D1QA 3C8GB 4I2CA 5L0HA 4Z9IA 4LLGF 2QQAA 1JJ6C 1R1UA 2XSDC 2XRHA 3JPOA 2YU9J 1RZTA 1R1TA 2NYXA 3ZWIA 3VEPA 4X4PA 4Y7NJ 3S14J 1S7EA 4E7XA 4EJOA 3JRAA 3LLIA 1BN5A 3L9FA 4K9AA 4RB1A 8ICXA 4WC7A 1FSHA 4Q5SF 4KNVA 3TEDA 2I5UA 5ICFA 4ASNA 4PJLA 3H3ZA 2EA2A 3SZPA 1JGGA 8ICTA 2Q2EA 1F43A 3NMJA 1GVJA 4N06A 2ZH4A 1LKXA 2EIMH 1YS7A 3C2BA 4BXFA 2IS4A 2XAQA 4HZFA 4XKWA 1WASA 1E3PA 2J0XA 5F28E 3CDIA 3EUAA 3ZMTA 2DTZA 3QQAA 2PNOA 2E36A 1P7JA 3WFPA 5E8IA 3I54A 5EZHA 2ZH1A 1ZQSA 2RVCA 2CQXA 4CXFA 2OCCH 1YARO 5F64A 5HVQC 2DJNA 1QBJA 1T95A 1W2WA 3W4YA 5J2EA 1VQMI 2FBKA 4JCZA 3MZHA 4JYKA 4RT2A 3F8CA 1IRGA 2GOXB 3K1IA 1XCBA 3J80K 9ICBA 3RIRA 1UETA 3FXQA 3MX3A 2BPGA 3SHFA 3E5QA 3VFZA 4BU2A 4ZYDA 4XRFA 2OQGA 4M3BA 1MBEA 3ULQB 5KAFC 3RKXA 2IPQX 4P9FA 3ZMSA 1LFUP 3VYRB 1IZMA 1JPNA 1JT0A 2CCYA 3B71A 2K86A 3RKOF 3U0CA 4NBQA 9ICOA 2Y0SN 1A0BA 1MQVA 2R7DA 4FHPA 4R66A 4I0UA 1VLSA 2BBHA 5CFSA 1OR7C 1XSPA 1V3FA 4GQHA 4RPYA 2LBFB 4KN4X 2ZXJA 3ISPA 4U5FE 3TJ6A 2J7PA 1R6RA 2KIMA 1X1AA 2M4KA 4UB1A 2ZH8A 2HYFA 1HDPA 2J46A 4CCOA 5CFTA 2L7MP 1MDMA 2EZLA 3CP8A 2M0CA 4DYRA 3BWGA 2B0JA 2XL8A 2DA2A 2FNPA 4M5DA 4F5OA 1D8KA 1Y56A 3E6MA 4EGYA 2VJJA 3J7YJ 4YN4A 1FEXA 4ZJZA 4M9SA 2OJQA 3JSZA 3HRSA 1BA5A 3ZTMA 4DRJB 2M2TA 1G3TA 3DU5A 1RKEB 3VOEA 3NG1A 1QGPA 3LL7A 3Q0UA 3H5RA 2JVGA 3G4SI 1WZ2A 3GTPJ 1FTZA 3AQMA 5GPAA 1I3AA 3NKUA 4MFAA 3FMSA 3SXMA 1WKMA 2NUTB 1YW9A 5DTDA 5L3CA 4QZCA 1WJCA 4ENNA 1IDYA 1OPCA 3LMMA 3ML6A 1JKRC 3QAHA 3ERED 1OQYA 2COMA 4IHXA 4PJJA 2WVOA 3RH3A 2MYSA 3CMYA 1LDKB 3IKVA 1OKKA 1QZYA 4S05A 1ON1A 2VQGA 1HBXG 1OFCX 1YIJI 4WGYA 2E34A 3BTIA 5DS9A 1AEPA 3OGUA 2I8DA 1K6YA 3FM5A 5EGOA 4KYWA 2R5ZB 1ZG3A 3U2MA 3CDLA 1Q0KA 4ULWA 2GAFD 2Y3BA 3M8FA 3H9GA 3AU6A 8ICPA 1TP4A 5DUKA 4A3MJ 5M3FJ 3A03A 1OU5A 1ZQZA 2OTLI 2HTJA 4DBQA 9ICHA 2NSGA 2BCSA 2LYCA 4I2BA 2YRFA 5HNHA 3ABKC 3ZQ7A 5EHHA 3IQTA 2EV0A 3CC2I 1YG2A 2CUEA 1A7VA 5J0OA 2Q3TA 2R25A 3C1DA 4PHPA 3P5JA 9ICPA 3ZOBA 2LFFA 2A5YB 2O6GE 2O9LA 2JA8J 2Q9BA 5KYWA 4YCXA 1WJDA 2WZLA 3FHDA 4K9BA 2BBJA 2CQQA 4EEFG 2DR9A 3U9MA 3NARA 4HF1A 1RR7A 4DW6A 2V1NA 1YX3A 1RPWA 4HLXA 1N78A 1BPXA 3FDQA 4U5BE 4RWOA 3LAJA 3A01B 3ZMDA 3HL2A 2CFXA 2Q9AA 1XGNA 4Z9HA 2ZHAA 2BV6A 2GWRA 4G7ZF 3BC8A 3H3VK 1XGSA 3FXLA 4EMSA 6PAXA 4BXXJ 1LDDA 1GS9A 5GPGB 1VB5A 2K7LA 4DYQA 3TQNA 2LY2A 1TWGA 4WXHA 5CPRB 1U0JA 4MVUA 4EBBA 3TGNA 4UXNA 4XQ8A 3TP0A 1P4AA 2X4HA 3H65A 2V9VA 5CJ9A 3F22A 2NVTJ 1O5HA 1N25A 3BG7A 3F6OA 2GOMA 3L2VA 5J2HA 1JAJA 3RJFA 2L9JA 2Q4FA 2Y39A 4JW1A 1PD1A 5HS9A 1E83A 3QWLA 5GPCA 1HKQA 2A05A 2WY8Q 5D5VB 2Z16A 3M4BA 3OYAA 5DV5A 1MIVA 2XGDA 4LVSA 3AGTA 3JAMK 1ZQUA 5AC4A 2IXSA 2FMQA 1GV2A 1ON2A 4YWQA 4L9JA 5AGFA 3SZRA 4YT2A 4AT9A 2IXMA 1I1GA 1O57A 3TO7A 4LG3A 1SMTA 3LS1A 3EH1A 2DOFA 4M9XA 4EWCA 3BCAA 4BXUA 4AE4A 4ENJA 3F0CA 1AKHA 1OCCH 2LSEA 5JRAA 4QI2A 4R8HA 3HPGA 4EEDA 4XRHA 4AD9A 1EKEA 1LE8A 1YA7O 1ZHWA 2H6BA 2MHRA 2R7QA 3DFGA 1EA8A 3ASOC 2GXBA 1OXBA 1KNYA 2V1UA 2VN2A 7ICFA 2TMVP 3FXRA 2YVKA 3DQVC 3FXUA 4CS7A 4ATBB 4NQWA 2QE9A 3J7AO 2UUZA 2NOGA 3HB9A 2COBA 3QP6A 4NM1A 3MZYA 2Y3DA 3SZTA 4K4HA 3T8RA 3JPQA 9ICXA 5TJJA 4KN7X 3J81Z 2WB1N 4A0YA 4UB8C 4JP0A 5FLMJ 2BZTA 3V5ZA 1W5SA 1IO2A 2IM8A 2QSGX 4AIHA 2J9WA 4X4VA 1TLHB 2MH2A 2PFBA 3MAJA 3P7NA 4C7OB 2B7EA 3SFIA 4IHTA 4I44A 4DRHB 3RI4A 1ZQGA 4RWNA 3V8JA 3C2GA 2XAFA 4LIVA 1KZHA 5HLGA 4L9NA 3KZIC 2MLGA 5IYBJ 2W85A 2MFZA 2X1CA 3QRFF 3DM5A 1NH3A 5E3MA 4KFCA 5K5RA 4IL6C 5J0SA 2H7VC 2FXAA 1BW6A 4RQ7A 5CA7A 2A6EF 1VZ0A 4LGWA 4BPMA 1UFMA 3CJNA 4M3FA 5H6RA 1VQNI 3KL4A 4FETA 2Z33A 3JYYA 3ZIBA 2EINC 1ULYA 5E8GA 4YFXF 2E1OA 3ZQCA 4CH7A 2VOPA 4A4AA 3OUYA 5HLHA 4PUSA 5BQGA 2AO9A 1VYKA 2AWCA 3Q9VA 2MC3A 1G4US 5HRGA 2QLAA 3QTHA 5J1RA 4C3DA 2IRFG 3HNKA 5ED4A 3ELKA 5JVGF 2K9SA 4JC7A 2ZNZA 2GXGA 4H4KC 2ELHA 2YU3A 1R49A 4Z6FA 3L8JA 4FHWA 3B6AA 3W2AA 3PL8A 4F92B 1F1ZA 1ORJA 2DA7A 2P5KA 3T6GB 2KIQA 3CZ6A 3B73A 5DUIA 2R9RB 4HW0A 4WCGA 3EH2A 2XPVA 3K4KA 4U0WA 4KMFA 3QP5A 3GDXA 3UPQA 1OCRC 1A41A 2VC9A 3M8EA 3HOWJ 1QQIA 2PQ8A 4CZCA 3N2ZB 3ABLC 4MTFA 2LCHA 1PP7U 3M3YJ 3I3LA 1NOMA 4IARA 1VQ4I 3H9JA 2L7ZA 3FHNA 2PMZN 2PX9A 2OKUA 4O5EA 3BR6A 3BG9A 2XB0X 5DBAA 4I2JA 2QY9A 2VJ4A 4O6YA 1UCRA 2X51A 2WAQA 4XLCA 4FH5A 1R7JA 3HSFA 2H94A 3K4LA 2H1LA 1IG7A 3GANA 2HPMA 4NXUA 2KZGA 3V7LA 1YITI 4I98B 5L0JA 4IX7A 3U2RA 4BY1J 5J4VA 1CPQA 1MNMC 4O5KA 2YL0A 2EH3A 2R7WA 3WHNA 1PD0A 3HW8A 1ZQHA 5HDNA 2ELJA 4E7ZA 3TULA 3FK7A 3M7GA 4ENMA 4P4OA 3BEHA 2L3DA 3C7JA 4BJTA 2OOCA 4HAMA 3GFJA 2HQ5A 2CO5A 3RJJA 2P7VB 2STWA 2E19A 2E71A 4MEYF 1QZZA 3GVAA 1GM5A 3S2WA 2E1MB 3BR0A 4NXTA 3ISCA 5A2QZ 3C66A 1HY5A 4CBEA 4KDPA 4RQ2A 2L0KA 5A6BD 3OIPA 1BBHA 2GA2A 3LNRA 3ZMVA 1XGMA 4CCLA 1STZA 4CCKA 1ZQOA 1SVOA 2DA6A 5IINA 1UB9A 1TV9A 2FD5A 3DV8A 2DFHA 5E3NA 1H88C 3G50A 3DI5A 1BI2A 1FBSA 3OL4A 4XPWA 3AL0B 1ZH5A 2M2UA 1FT9A 4A5MA 1ZQ3P 3S1NJ 3A2KA 4BDYA 4X4QA 2EPMX 1S72I 4HDUA 4PFOA 2KRCA 2A68F 1OISA 2P8TA 2XAHA 4KLJA 2W9YA 1YJWI 2M4GA 2CQKA 3E6DA 2BW3B 4FX5A 2W57A 4LG0A 4KNWA 3QW1A 1BPEA 2RREA 4M74A 4IQTA 2R7FA 3KP4A 1NHAA 4QZ9A 4YMOA 1YFHA 2M64A 3BCBA 2UXNA 1ZQBA 3P9KA 1C03A 1HLVA 4QZDA 1ZU5A 2QM3A 2LC2A 4KICA 5K7FA 3L00A 2DYSC 2CQNA 4P2HA 2DT7B 3ZQGA 5LRRA 4ON0A 2YLGA 7ICRA 3AG3H 3L9DA 2CV1A 3OWGA 5FKOA 2HJMA 1ZW3A 2L6FA 2MBFA 1XN7A 4MTEA 2FUG2 4X0RA 3B9QA 5K7ZA 3W8HA 5CI8A 1UZCA 2CUFA 5FKMA 1CQTA 4BJ6A 1RMVA 3RH4A 5TRDA 3K1PA 4EGZA 4HPQA 4QIWN 1X4OA 2Z9OA 4JK1X 3MD2A 1W36D 5HRIA 2Y75A 4P9TA 2WZFA 2EILC 1ZW2A 1SD6A 5ILUA 3DKAA 1V5FA 3GTLJ 4EJTA 5DEDA 4IB4A 3MEXA 2NVYJ 4I09A 4YELA 1WOTA 4B44A 3BPVA 3D5LA 2ACJA 2OTJI 2FMPA 2HN1A 3FXMA 5HR9A 2Y69H 1M56C 1RI7A 3CMEI 1ZRDA 3OYKA 3JRBA 2WAEA 4ZTJA 5D49A 1APLC 4GYIA 2R7VA 5IIMA 2HXOA 3QYFA 3S1QJ 4W8KA 4IOAF 4XR6A 2X6XA 1NG7A 2HPIA 3H3UA 2F4MB 3CCLI 4LLNA 3CJQB 3MZ8A 3FAPB 3UPSA 5A6KA 2ZD9A 1AHDP 3K9TA 2GA1A 3M1CA 5FFXA 5LRSA 9ICCA 5EF6A 1A31A 4R63A 1ACIA 1LI5A 1FP1D 3AQLA 3WTYC 1SYQA 2DJIA 3K4CA 3COAC 5F08A 3N4MA 3LA2A 1MBFA 1NBBA 4E7LA 3UGPA 2EIJH 2DBBA 1D8JA 3GZ6A 4AIJA 2YX4A 3I4UA 3MLGA 2Q8KA 5F5FA 4EP7A 4B48A 4FAPB 4KIBA 1G8XA 4F52A 3HUGB 4BKXA 3H1CA 3BOQA 2NNYA 4HQEA 3ZVRA 3IC7A 3IRRA 1IN4A 1JI8A 1MSFC 2B0HA 3LAYA 1FA0A 2L9SA 1ZU4A 4BEHA 2CNWA 3B0YA 5HRHA 3H3AA 1SFXA 3T9OA 1JAFA 3SP1A 1G2HA 4MTDA 2CG4A 3VF0A 5DS4A 5B3PA 4NCQA 3FMRA 1G5ZA 5KVRA 2M3AA 2LG4A 2LKXA 4KLTA 2NS7A 5FLXZ 3AG4C 4HE8D 3T4RA 3WFRE 3V7SA 1MDMB 1Y0NA 3LLKA 3MYIA 5J47A 8ICVA 1K4TA 5ILSA 1BR1A 2CWEA 1FPQA 3EYYA 3KIOA 5HDGA 4N4NB 1T38A 2XROA 1B1BA 3L09A 3FZVA 1ZLJA 1YQAA 4PGHA 1QSPA 2UWMA 4S04A 3I4MJ 3TO9A 3WTXC 3T5XA 3GTGJ 2JRTA 2FCLA 4WQKA 3WU0A 1BC7C 3CSKA 2KRHA 5IIOA 4O6JA 4XRSG 4J7TA 3WTVC 2JA5J 1T6SA 5E3AA 1NO5A 1DPUA 2BXYA 2CRGA 2YWAA 4BJ1A 1ZKGA 3L2WA 1RJ9A 1BDJB 3U2LA 3ZN1A 4BEMJ 4D4NA 2ETHA 1FOXA 2HVRA 3ZRGA 2LF7A 4HSTA 4NC3A 3H36A 5FROA 1LPEA 1USSA 4JTDB 2P6SA 2DA3A 1S05A 2BE5F 1IN8A 2L7FP 3BZ6A 2M2VA 3E1SA 2XF7A 1TL8A 1K05A 4OD5A 4K7BA 1S29A 4PACA 3JPTA 2F5EA 2RQPA 1R58A 2MABA 5LHGA 4M63A 3JW4A 3RYRA 4QZHA 4V2GA 2QNLA 4X0GA 2P0WA 4EVIA 5DS5A 4BAYA 2QLZA 2JSCA 4Y13A 2GWWA 4DXWA 4A3CJ 1T9KA 2B63J 1JMSA 3V7CA 3BJOA 3UXNA 4UB5A 3PQJA 4U5EE 3HOUJ 4EM1A 2J45A 2WTEA 3UKGA 4E7IA 2YLIA 3DKWA 1FOWA 2YUSA 5D8LB 4WABA 2F5CA 3PNCA 1GGQA 4RGUA 2KC3A 3ZCOA 1Y4CA 3G2BA 3DPUA 3H0GJ 4M6YA 4CGZA 2ZCWA 1ITYA 1MMGA 2JTVA 2HOAA 5JLWA 2FFHA 1SAXA 2ZJ2A 4UUSB 3SYNA 5DLJA 5A6AA 1BPBA 4KLSA 2J7PD 3CEXA 2EWNA 4LITA 3FOOA 1IRFA 3CD6I 1Y8RB 3GEZA 1BIBA 4EJWA 3GZ5A 1XS9A 1U5TB 1O3RA 1J59A 3F8MA 1QVXA 3RQIA 3K10A 3POVA 4RBNA 4RAFA 3HJEA 2HQNA 5J2BA 1F5TA 8ICWA 5E1ZB 3H2UA 1G6NA 3JRHA 4X5VA 1PCXA 2IUBA 1P7IA 2BY0A 3C63A 1O4XA 3E97A 3L2RA 3RVYA 2XGEA 2FJ1A 3EJNA 2QTVA 3K4MA 1K83J 5DD8A 2G9WA 1HUZA 2W84A 3NWSA 4B1RA 3QVZA 3HIYA 5BQHA 4QWQA 2XLWA 2LLKA 3UR3C 2HOEA 4HV6A 3HOVJ 4BQAA 4W1UA 2DFIA 2QZ8A 4J7YA 1GXPA 4XQ7A 3EUHA 1ZR2A 4KLEA 2O9XA 3FAJA 3DAGA 3QW0A 5M5WJ 1J8MF 5A6BA 1OKKD 1HF0A 1DDNA 4DOZA 3LA7A 5F5HA 4N7RA 4UB3A 3NDBB 1TQPA 1S7OA 2ZB9A 5FO5A 3T0YA 1AKHB 2R92J 1ZQCA 2HMZA 1LE8B 3NRHA 3TL4X 5H6QA 2I10A 4AWXB 5J8CA 3HRTA 2DYRH 5M3MJ 3K70D 2QBYA 3E6BA 1WTYA 3LOCA 3RVZA 2O8XA 1KDHA 2LOOA 1RCPA 5FKLA 5IP9J 3UXPA 1UMQA 1ZQAA 1J9IA 2JA6J 2YSRA 3RZDJ 2L2OA 4NC6A 1AOYA 5JVEA 2PFPA 4MNDA 2XXAB 5L3GA 3ABMH 5HS8A 2AS5F 2Y30A 4M73A 2C04A 2L6HA 2M2EA 3K4JA 2V26A 2E2IJ 3JT1A 5DDMA 4HF2A 1REPC 3H2VA 3X1OA 1V54C 3I59A 4P55A 3ZXSA 2ME0A 5CFUA 4FQGA 2KISA 4XJEA 2JUGA 1YLMA 3EFOA 4I2AA 3U9GA 1MH4A 3OVAA 1JTYA 2E1MC 1KU2A 4XTKA 1S6LA 2NVQJ 1TFKB 3HG9A 1JMWA 3FXHA 1E86A 3IHUA 1S3JA 2Y9YA 3MCRA 2VXDA 4XLFA 2ZNYA 3G71I 1ZR4A 3TP3A 1D0ZA 4C2TA 2BVMA 8ICIA 4JX5A 1LS4A 3BZKA 2Y48A 5LHHA 3OUYB 3NYMA 2V4JC 2DRBA 4BY7J 4B6IA 4I76A 3CUQB 3HXLA 2RD9A 2BVLA 3C3WA 4MHGA 3VB2A 3AL0C 1R4TA 2R5YB 4IAQA 1Z7UA 2HNHA 1XSXA 4NXVA 2NUPA 3FM3A 4UVAA 4KLFA 3Q6NA 3V7KA 3BTCA 2VBXA 8ICNA 3BPXA 3FX3A 4OMYA 3R61A 2OD5A 1TWHJ 1A04A 2J5OA 1FAPB 2YQYA 4CDAA 1Q78A 4X4SA 3E6CC 2Z3YA 2ZH2A 1OMIA 4U0VA 3RZOJ 1R00A 3AFHA 1ETVA 3GFMA 3AOUA 3AQKA 1E2XA 3IAM2 3DEEA 2XUBA 4I29A 3BR5A 4FHYA 2QUFA 2DMTA 2HU9A 3SQNA 5BMZA 1IV6A 4QPOA 1ZZPA 1RXQA 4YK5A 5GAEJ 1BI0A 3OEOA 5H20A 1USTA 1FYLA 2AVKA 3OYIA 1TC3C 1D1CA 2KT0A 3DKXA 2BC5A 4PSWA 3RPQA 1ZGWA 3JRTA 5IPAA 1P9QC 2K85A 2KJGA 4NQFA 4OIOF 3C62A 5T3WA 1YA9A 2X6YA 5FRMA 4XRMA 3L2QA 1KU9A 2LTPA 3V42A 4YD1A 4WX9A 1A35A 2PBIA 1F36A 1Z9CA 4JIOA 3MKLA 4L5JA 2X6OA 5LLQA 3S2HJ 3QU3A 4ESJA 1UG0A 4I3MA 4O9MA 5EK0A 3ISDA 4NLZA 1T0FC 1XMAA 3ER8C 3PO2J 4ZDLA 3M8JA 1CGOA 4YD2A 9ICVA 3TFRA 1R4MB 1K7AA 8ICQA 5K0IA 2QQ9A 2WADA 2LQGA 1ORKA 1UJ8A 4UV9A 3WHBA 4CCMA 2FX0A 4Z6YA 3IV5A 2UZKA 4BE0A 2MWQA 2ESHA 5F0CA 1JXSA 1WCMJ 1LI7A 4NM2A 2YX7A 4A6EA 3JPNA 3K69A 3LSTA 2DDBA 1VOMA 2BPCA 4A69C 4EGWA 1OCOC 7ICSA 4OOIA 2XC7A 5JTGA 2ZH9A 2H8AA 3K2AA 2KKOA 3KETA 5JLXA 4AIDA 3OS2A 4AT8A 1R9TJ 4XEKA 4PHEA 3R7CA 2DN0A 4C2UA 1S7AA 2DMNA 1SEUA 4IHWA 1LDJA 3ZSUA 4HSRA 4LK1F 3HOYJ 4JTAB 5LEJA 3FXOA 1FMWA 1I27A 3CP2A 2QYOA 3TMOA 5KYYA 4ESFA 1Z63A 2QA4I 2XAGA 1I1SA 8ICBA 4KLQA 1U9NA 3RCOA 4CHUA 4UVCA 4BHCA 3F8NA 4GRIA 1SVLA 1FFHA 2EPLX 2VJIA 1MQ3A 9ICTA 4IOCF 3S90A 5EEGA 5E79C 1NG6A 3H92A 3PDMP 4A3EJ 3CTAA 5E3LA 4LG0B 5D5UB 4MLOA 2E5ZA 1JOGA 3IKTA 2FMLA 3PUBA 8ICHA 3EG9B 3ER9B 4RLFA 1WPKA 4K2EA 2VQCA 3FBNB 4DOAA 3JSOA 2XV4S 4N9IA 1QNTA 3RIPA 4L5IA 4F55A 2F6CA 3DPTA 4F5QA 3GMEA 4MQ9F 2DT5A 4X0AA 2EB7A 2HVQA 4IPAA 3CCQI 3PMNA 2LKPA 2WY7Q 2KK1A 4J30B 4XLPF 1NLXA 3ECOA 4XQ1A 4CJGA 4CIPA 5AIPA 1F1MA 5HHIA 3RH5A 4NHJA 5J6XA 3D5SC 1DOWA 2IVMA 4UD4A 2XGCA 4KLOA 5ICEA 1U78A 3CC4I 2R7XA 5DVWA 5HODA 3VRCA 1XSNA 1K78A 4WF2A 3G4ZA 3B02A 3JTGA 5KHDA 4XSXF 4QDLA 4UAZA 2NS8A 2W48A 3Q9SA 3WGIA 4N4OB 4O69A 7ICKA 1B59A 2D4UA 2Y3GA 3WGHA 1T2KA 2YL3A 2IA1A 4GFBA 3CESA 3HC7A 2OEVA 1IN6A 4ZLCA 1LVAA 2OU2A 4M3DA 1DU0A 2P1AA 1ZHZA 1MJAA 3QPHA 9ICKA 5E17F 2XM0A 4WK8F 2GAQA 1Z23A 1MBHA 2M30A 2CV0A 2NRAC 2IBFA 4NTAA 5GP9A 4H54A 2CS3A 4K98A 4B47A 1K79A 4IZZA 4BS9A 2WBMA 3OSFA 1R89A 3S3OA 3ABKH 3GYHX 4EUKB 3OS0A 2L9NA 3CJTB 1PX5A 2IW5A 1M57C 3ZQYA 5D62A 2HXIA 1IC8A 3S0XA 4IQVA 3V8KA 2EIKH 1XSVA 2KIFA 3OR1C 3HM5A 2VLAA 3GO5A 1ZQNA 5ILVA 4FTHA 5BQTA 5K7HA 2PP4A 3TOAA 4NC8A 2EQRA 2DRAA 3CQZA 4XL9A 3DZAA 1FY7A 2H09A 2VBYA 5BOLA 3RQEA 3U3BA 4RQ5A 5LGUA 1W1WE 3JYHA 2V3CC 2K02A 4RPXA 3KP6A 3C8ZA 2Z99A 4RDAA 2ICWG 3U9JA 2MGQA 2GIVA 4CYCA 2A1DD 2TRTA 3U8VA 3GZNB 1XPXA 3WU2C 1OKRA 2NG1A 4LLCA 1OCPA 4YMMA 1Z3YA 4ZYEA 2IYLD 1SF8A 2XLHA 5B3QA 4NNJA 1WHUA 3HYIA 1QHHD 1A6IA 2HZTA 4CS8C 4FX4A 4IRIA 5FLVA 3MFNA 1ONVA 4XM3A 3HNLA 4BEJA 5LD2C 4I2FA 4GO1A 4YIRX 1YW8A 1DP7P 1LE4A 2VKEA 1A36A 1UFBA 3E9VA 4GEHA 4BJ5A 2GBYA 5EJCA 3OYEA 1K40A 7ICOA 8ICLA 5HV9A 3PIOF 2H6CA 4G6QA 4KA4A 3U3FA 3GWNA 1BR4A 2W1OA 5J3LA 3DP7A 4CDGA 1A7DA 1U5TC 5FB2A 4E70A 1H9TA 4YT4A 4WCWA 3US6A 2TDXA 1L3LA 1OR7A 4DO9A 3ZQHA 2WAQN 4F5NA 1U8BA 4FE4A 3DF8A 1MJ9A 4W97A 2ISZA 4H0EA 4G0HA 4BACA 2R93J 4M9NA 2F2EA 2HGCA 5DCFA 1Z5ZA 4C9YA 1FWZA 3G6EI 2E7WA 1OR3A 3O6XA 5B1BC 1XB4A 2ZMEB 2XHKA 5BOXA 1UEVA 2ISOA 1DGWY 1BW5A 2E87A 2BYVE 2HJ3A 3QODA 3TJ5A 4ZC3A 2CYYA 1TWAA 4FESA 3FHZA 2HQRA 3V8LA 1W0TA 4EQQA 3ASOH 1RRJA 5BPIA 4OAZA 2ZH5A 3F6VA 2C03A 3OMYA 5B1AC 1VFGA 1SAUA 2VI6A 3LESA 3MGIA 1QZXA 3A02A 4G94A 8ICMA 2L54A 1LEAA 4YFNF 3GM1A 5J0QA 5AIQA 2XAJA 5D46A 2L9RA 3S32A 1HKSA 2OQRA 1YVIA 1BBYA 2X85A 1MMSA 5IT9K 3EGDA 3F47A 4JEAA 3BG6A 5J2GA 4LZGA 3CCEI 2LKSA 4N6HA 1CF7B 2LMDA 3GEIA 2V9KA 3MBYA 1Y1VJ 4RBOA 2ISPA 3HHGA 5AONA 2KRFA 1W5CC 1FJLA 256BA 3RW0A 1N1CA 1PUFA 2GLOA 5DDGA 5CWRA 1Q0DA 1ZGAA 3E5XA 1M6TA 1PDNC 2A0UA 3FMQA 2QF7A 1FC3A 5FD5A 1NU9C 2WVNA 2AQEA 4MKPA 4TURA 8ICYA 3WAQA 5F2VO 4YJWA 1Z67A 2EINH 2VE9A 2CNWD 3PQKA 3S9OA 5F1JA 2E7XA 3BY6A 3ZQQA 1S8NA 4MVZA 4LD5A 5DB7A 3DE9A 3GBGA 2LIGA 4GCVA 4QZ8A 4M9GA 1SC7A 1TNTA 2L5QA 3QPTA 3DJUB 1UAAA 1IRXA 3B29A 2BPFA 2QQBA 3X2QC 3RJGA 5F27A 1WATA 1U89A 2KMUA 5HRBA 3KZZA 4KUMA 3CUQC 2DLLA 1B9NA 2E2HJ 2BXZA 3MDCA 1JKOC 3OYDA 1SANA 1QKRA 4HFKB 8ICAA 1QPIA 3GUDA 4WXDA 1PUEE 1OCRH 1W7PA 3LNMB 2F4OB 4YFKF 2MC4A 3ABLH 2LFBA 4UBCA 3E70C 3KX2A 5BUOA 3OVSA 3FDYA 3NYBA 3B0VC 1FX7A 3JTHA 1TTYA 1V55C 4F3QA 4LEVA 5D4SA 1TWCJ 1G3WA 2ZXHA 2JZYA 2MA3A 5EGYA 1JGSA 1P2FA 4JBAA 4BJ5C 4O6MA 5KYXA 2LFDA 1QPUA 2YKZA 3RJPA 2JX0A 1ZQMA 4XLNF 3VYSB 5L3VA 4A2NB 2CW7A 1ZQIA 1B8IA 2LRDA 5DS6A 2HQAA 2R02A 1CGME 4P4PA 4II2A 3DPLC 3W6KB 3V7JA 2FMYA 2XB5A 4RB2C 5DM7F 2NS0A 2CW8A 2KJBA 2HOTA 3KCCA 4ESBA 1G3SA 3LSPA 3L2CA 4DOBA 4Q47A 1JE8A 1VQ6I 3AJMA 1FIPA 3DLAA 1QRYA 3WTZA 3A1YA 1RZ4A 1XX5A 4ANJA 1B72B 4HV5A 2PJRB 5DCMB 1NK2P 1J7KA 2HEOA 1H6GA 1Q0MA 3RH6A 2BBYA 4RGRA 1U0BB 4M0AA 2H27A 1VQPI 1ZK8A 5EEAA 2OU6A 4X0BA 4AT7A 5BPCA 4OU0A 1Z7LA 2ZBKA 1YLQA 3I59B 4JQFA 2JA7J 3S15J 2AXTC 3WGGA 4HX0A 2IEKA 3K66A 1X4PA 4RGXA 3JCFA 2GQQA 1RC9A 1T98A 2LSOA 3F21A 4IRUA 4KLGA 4PZJA 4GYGA 3L0IA 1FBQA 3BG5A 2D1VA 4MGRA 3WODF 3GF2A 1IN7A 5HNFA 5DQZA 4PJNA 3SJMA 4A3IJ 1RKTA 3O10A 4C2MJ 2K4JA 1JRAA 4EIYA 4MS2A 3CCJI 2IOQA 2NNNA 1U6GA 2KYHA 3EGXB 1C17M 4FASD 3ERCC 4IHYA 1TZLA 1GDTA 1AWCA 5FKNA 3PSIA 3A0BC 4G6TB 2O0YA 2OF7A 3OA1A 3RF3A 3I64A 5E1XA 3IP4B 5EG0B 1XCVA 2PN6A 4IRGA 1NG1A 5LFAA 3KEYA 2HYJA 1VK5A 2OQMA 4E8FA 2J9VA 1TWFJ 4Y33A 4PH5A 5J29A 1ZTRA 3K0LA 3KYDB 2IXPA 2FQ3A 4Z6CA 5BQIA 4ZDOA 3UMIA 2R7SA 4MVRA 2X0CA 2DR8A 3FISA 3ONQA 3ECSA 1ETWA 1MIJA 2KQRA 2JPBA 1WI3A 4FE7A 1LUJB 5CQEA 1RUOA 4KBLA 1SFUA 2CDQA 1HOMA 4Y3OA 1HXDA 4HYEA 3S8PA 4LT6A 2J5PA 3WG9A 1LVKA 9ICNA 2EILH 3R0JA 4AM3A 3DXJF 3SXKA 3HTUA 2CH0A 4LJZF 2PX3A 2KLOA 1OYYA 1XDSA 3GLLA 1IN5A 1TFOB 5IP7J 2P0NA 1TVAA 2G0EA 3A11A 1BOAA 4I2DA 2Y3HA 1WOLA 5CVRA 2XAUA 1YZAA 4NTFA 3HOTA 1U3EM 1H8AC 4I1MA 2XPWA 4I1OB 2CFOA 4Y17A 1YHQI 1Z3XA 3NKDA 4MW8A 5KYUA 1V5GA 3BR2A 3C8GA 1OCZH 3H5NA 5HC9A 1GVDA 2BOLA 5E18F 1CGPA 1VQKI 4HX7A 1D1BA 3RJEA 3C18A 2ZH7A 3GORA 1AVOB 5E20A 3TFSA 3WG7H 2M0MA 3KLOA 5L0IA 1VJ7A 1KQ0A 5J0TA 1YRNA 1Z6RA 5FD6A 1Q79A 3UQ2A 2YZSA 3LSRA 4I0BA 1LEBA 3HBLA 4BQNA 3I4PA 1YW7A 4MNUA 5LBQA 1MIYA 4TUPA 2V7FA 3KYCB 2IHOA 2XGXA 2LDUA 2XLEA 2HKOA 2VKVA 7ICTA 1HMDA 3ZDLA 1F5AA 2DQLA 2Z2SB 1AU7A 2L7AA 2W24A 2ZPAA 2W7NA 3TW6A 3LSHA 5J4YA 2E5NA 2J9BA 1FYMA 5E3CA 5CP2A 4X4TA 3HSRA 1FLIA 3CJRB 3Q0VA 1QZEA 9ICFA 2W9MA 4EJVA 4O5CA 3DTKA 1PVEA 1S9HA 4FISA 4A3FJ 3OSGA 4JE9A 3B6CA 1KONA 2P61A 4J00A 4BDZA 1I39A 3AG4H 4CSAC 3FIWA 2Q2EB 1KGSA 3HIFA 4IO9F 4NY3A 3F8FA 3JCUQ 2EZIA 4E17A 3KPHA 3Q3SA 2KQ9A 1IJWC 3TDUC 1FZPB 2EV5A 2GAUA 2ZJRF 4KLLA 3RFYA 3J81K 4IQWA 2PFOA 4YL3A 3GODA 8ICUA 1YOVB 1V4RA 1WH5A 1ZRCA 5AC5A 9ICSA 3E7LA 3MDAA 2RC4A 1MNEA 5J2AA 1KYWA 2JPCA 4XWJA 3ZGKA 2LBFA 3B0PA 4CS9C 4MF2A 4G6DA 4E6KG 2V9PA 1EH6A 4EKWA 7ICEA 1OW7A 1VNDA 4KIGA 3V5XA 1B6AA 4U88A 4RWPA 3LNQA 4GDFA 3E5UA 2RKHA 2WB7A 4CDVA 1TQMA 2A5WA 4HFFB 2ZMEC 3DD7A 4IAOA 3AG3C 3G3ZA 3ZQFA 4G9YA 4JOMA 3JSEO 3NAUA 3O55A 5F6FA 3AG1C 1ETOA 2IXNA 3PUFA 4WBYA 3CUOA 1RKEA 5JHFA 5IY5C 4RLQA 3F9KA 3ZC4A 5DBBA 5DB6A 2GIZA 3A4CA 1KA8A 3HSEA 1G4DA 2P6TA 1L3PA 5T3TA 3OV7A 5B66C 1NFNA 3PM1A 1ZQQA 3TOLA 5COGA 5ICGA 5L0CA 2FBHA 2KIUA 4RM2A 1R5GA 1WQ2A 4YRVA 2DMUA 4KT5C 1G4WR 3RQGA 4UDVA 5B3SC 4C7OA 3MGHA 1NTCA 1QPMA 4M9JA 1Q0GA 1OYWA 3I5UA 3TW7A 5GAHJ 2PI0A 3IWFA 1DOVA 2FNAA 1ZVZA 2QSFX 3OVBA 1EKYA 5J0PA 2VJ5A 2GXAA 4LLEA 3CO6C 4PHDA 2VANA 4RGSA 2KNHA 4HEAJ 2IJLA 4E7HA 5HHHA 4G78A 2MSYA 2DOAA 4WJ0A 2XF6A 2W00A 3R6SA 5D5WB 4X1EA 2D1HA 4I2HA 5CVIA 3V5YA 2DODA 1WJBA 4CYCB 1RPLA 4ZTFA 1VQ7I 3M79A 5J8FA 2X6WA 5F0HA 4JX4A 2O8KA 2OPTA 3HEFA 1T6UA 4FWVA 1XDUA 2R4GA 1LFBA 4KJZA 3PJRA 1JPJA 3OR2C 4Q7CA 4MF8A 3K6BA 4O6NA 4EBJA 4MFFA 1OW8A 2GZWA 3QVYA 3AG2C 1FNNA 1EV7A 5EGOB 4AIKA 2VUMJ 3KEQA 1HE9A 2DO7A 1I4ZA 4EV0A 5GTIC 1R22A 1ORSC 3FVYA 5M5YJ 3M15A 2HZDA 1E84A 4PGYA 5J0YA 3EDPA 2XSEA 2LK4A 3MFKA 3EHNA 2P5VA 4XNFA 2EFOA 4L0YB 4KB6A 4IJAA 4BGDA 4XLAA 2C6YA 1WGWA 3T6BA 3WFOA 2J0WA 4YMNA 2ECBA 3L1PA 3A01A 4IJJA 3HPHA 5HS7A 2L7KA 2FQ4A 3K7DA 1N77A 1R71A 1WJEA 4V2FA 2R7OA 3GFIA 4I7HA 5KYWB 1UG7A 1VQ9I 4K99A 4D0PA 1QVTA 2WA0A 3BG3A 5L3DA 2DXIA 3B0UX 3TDZC 1ZG1A 4UD5A 5J1UA 4NLNA 9ICRA 2DT6A 4CDYA 2HZ8A 2XLDA 3DEUA 2NVXJ 3LFKA 4O6AA 2YPRA 3OL3A 4CZZA 4QZBA 5D8KB 4OWRB 2VODA 1NK3P 3EUHC 4CIHA 4O67A 2HS5A 5C4JJ 3WFSC 2DVIA 4B3XA 2YR2A 3SFZA 2D2WA 1O3UA 4JWNA 3A9CA 3BP8A 1I3QJ 3U21A 4MVOA 1KYZA 4LMYA 4AC0A 2A07F 3F8BA 2H7BA 4RPZA 4FH3A 5C44J 5D92A 4XEVA 1JKQC 1VQ8I 4ZYHA 4I2OA 1JTXA 3E3VA 5TGTA 4D9JA 2E1NA 3KYIA 3RJIA 1V54H 1J2XA 2IGOA 2HOSA 1WRJA 1FOKA 8ICRA 3V72A 3VYUB 4A12A 2YL7A 1RNLA 1BM9A 2R3SA 1Y6IA 2KPMA 3W3CA 2N8GA 1LIHA 3DAFA 2V79A 4M3EA 2CQ7A 4AT9B 3SXYA 1MGTA 2HKXA 2L4AA 3OOPA 2VPRA 5J0RA 2R7UA 3T8TA 5IYDJ 2ZH3A 8ICFA 4MTOA 4WBZA 2B4VA 3CCUI 1JUMA 5DB9A 1H9GA 1TT0A 1Z91A 1WVRA 2JRMA 4XOTA 4OIQF 4AE4B 3JR9A 2NXNB 1T6IA 4XK4A 3PSFA 3MBGA 4JJGA 3M4CA 5DB8A 2Q7RA 5KNLA 1C02A 1ODDA 4XN3A 4ZZLA 7ICMA 5K5QA 1LNWA 2WV1A 3ZQIA 1KTMA 4NQWB 3J80Z 1W36C 3HGYA 4BQOA 3VWBA 3ZPLA 2K9LA 4HBLA 4RWQA 4L5EA 1ETYA 1MMAA 3OYLA 1Z05A 9ANTA 4A3KJ 2E1CA 4YIIA 3KFWX 2DA1A 5HLIA 1HUOA 1X19A 4RT3A 2A6HF 2ZSHB 1TWGJ 4M9ZA 3NWTA 1I50J 2E2JJ 5HRLA 3LWFA 3P9IA 3HJ4A 2ZH6A 5EEHA 2ID1A 4F5RA 2NOJB 2PEXA 3AKZA 1YS6A 2VCAA 3GM3A 4WH5A 5TISC 7ICIA 3I58A 4XORA 1X1CA 2XM4A 5H2FC 4PPXA 5DQTA 4PJMA 3KP2A 4KM5A 3MYFA 3C5FA 2QGUA 2OZUA 4HLYA 1TFYA 1JHHA 2K3PA 2IHMA 3UGOA 1B8IB 3U5SA 1DGRM 4G7OF 4X6AJ 4E0IA 1XTAA 2XRNA 4YT5A 3KYLA 1U2WA 2MD0A 4NTBA 5IIIA 1QO0D 4M9HA 1ETQA 4F5PA 2L6GA 1R5HA 2IBDA 3O6BB 2RFFA 3P9CA 2ZXWC 4BG0A 4XUSA 5HRFA 2M7BA 1ZQDA 1MKMA 4UHTA 2R7RA 4O7GA 3V7RA 4AK9A 3WFQE 2L4MA 4U7BA 1O3TA 1OCOH 2Y0MA 3UNGC 2DOEA 1UHSA 5K1YA 2JQ7A 4XN0A 5FLXK 4M6XA 1XWJA 2AQFA 3K1MA 4MVMA 2FOKA 4OIPF 1ZREA 4LLLA 2LNBA 4PGXA 2AP3A 2GM4A 2EFPA 4LACB 1Y8QB 3KKBA 5D61A 1UHWA 3JRDA 2KZVA 3CF5F 2D5VA 3VSLA 3RTRA 3O2PE 1ZLKA 3SNHA 4Y4RA 1R4NB 1J0RA 1FTSA 4ZDPA 4L0ZB 2YLDA 1LE2A 1X58A 1VFCA 3S1RJ 1FBUA 1J8YF 2ADUA 4NB5A 1PP8F 4PR9A 4XPYA 4JLZA 2VOOA 3PMLA 2P7VA 2G7HA 3ASNC 3ABMC 1XD7A 3CLQA 4LB5A 1Z7Qc 5CVUA 3QZCA 2F48A 4XLHA 1ZQFA 1X2MA 1QQ3A 4N4WA 3G1MA 3IH4A 4CYDA 4DVYP 1ORYA 3TD7A 1XZPA 3HDDA 5L3FA 1W7PD 2H8WA 2V1DA 4XLEA 3RYPA 1O3QA 4EBKA 1YYVA 2VIXA 3TBIA 2J9UA 3JTLO 4E18A 1UG2A 2JUCA 2O1PA 2DK8A 4NXZA 8ICZA 4JLXA 2AXLA 3H38A 3Q7LA 2CSOA 1P6RA 1KQ8A 5DEQA 4HA8A 1T39A 1IF1A 3DKYA 4HNVA 5L3EA 1VQLI 4RQ3A 1HSJA 2FBIA 4HOBA 5CVVA 2NPUA 2BW3A 4FCYA 2M4EA 3WTTC 3LJBA 4CJOA 1T8IA 3U8PA 4X4NA 3OYCA 3VYWA 1AA7A 1IDZA 2I15A 3QYEA 2OG2A 4BHPA 1T01A 4HF0A 2BY2A 3HOXJ 4Z6DA 1RETA 2FRHA 3PNTA 4C3IJ 1MBGA 2IXOA 3K1IC 1IW7F 1QHGA 1EH8A 2G7UA 2X0LA 3GW2A 3JAMZ 2K3FA 3W2WA 2B9SA 2OAZA 5KCMA 4P1WA 3HOZJ 1BPZA 5COMA 4JKVA 1EF4A 3ZR8X 2FAPB 2XS8A 4XBFA 4DVZA 2JMWA 2ASRA 1I4YA 2ZXRA 5J40A 3FK6A 1QLEC 5KYUB 2FE3A 2IS6A 4R65A 5IILA 1N75A 2EZHA 4NC7A 2VXZA 4MEXF 4HEA2 1C0WA 4LFUA 3NYLA 2WZGA 3GM2A 2L9VA 4Q48A 2DR5A 2PG4A 2Z5UA 1HQCA 1D1AA 1TQIA 4I0AA 4K0DA 2DR7A 2P66A 1T0FA 2JK3A 3IEEA 3UXOA 1VQOI 1JUPA 1K61A 1HKTA 2XF5A 1WH7A 4P9UA 1YRNB 2QEXI 4WGZA 3TOMA 2I9GA 2EV6A 3NWIA 4AYBA 2FMSA 3IUOA 3MWMA 2XDVA 5T1DB 1EH7A 5CQGA 4M9LA 1Y1WJ 1HMOA 3IH2A 1AUEA 2QENA 1ZQKA 7ICGA 1MBJA 2ELKA 3SZGA 1WJ5A 4OMZA 2CYDA 4RQ1A 3Q7GA 4TV7A 4BUPA 4XMYA 1HA8A 3CCMI 1Z1DA 2UV1A 4P5OA 2BEOA 4DZPA 1XMXA 1FTTA 3PFIA 3NVOA 1EJ9A 3ABTA 1BL0A 4LB6B 4FO6A 1U6HA 3S84A 1FNTc 2LVSA 3BT9A 4F4BA 3FOPA 1ZQEA 3N24A 2W4MA 3MN2A 4BBSJ 2WV0A 3C2MA 1KU3A 1MBKA 4LOCA 3DM9B 1VQ5I 4I2EA 1T6QA 3JPSA 2EPFA 1SMYF 3LSJA 3BLYA 1ZN2A 2GA9D 3JRFA 2EK5A 4A3BJ 4ZZDA 1NZEA 4WC2A 2IGMA 1MJBA 4LEWA 3LQQA 3QU6A 1YTYA 4FHXA 1CGNA 3K6GA 3K70C 3GTJJ 3HUGA 4BL0B 4IQ4A 1QU3A 3JRCA 3RSNA 3O8HA 2H1KA 4IQUA 2V1XA 4A3GJ 3V7OA 3M1CB 5J2DA 2XIGA 4UVBA 3ZTZA 1T5OA 4F91B 3FXJA 5DDYA 5J0XA 2BHYA 2ZKZA 1TFWA 1MQ2A 4IEJA 1UELB 1MH3A 5B1BH 3K33A 1B4AA 3C5GA 3LUTB 2RNGA 2Z1DA 3CMAI 3OIQA 2HDWA 4B43A 1OQCA 1HW2A 1ST6A 1XZQA 3L1MA 3LEOA 3D5RC 5JS5A 4NXWA 1K04A 2LK2A 2AHQA 1HW5A 2KP6A 2NVUB 2RAEA 2EIMC 3IL2A 4LIUA 2R7ZJ 1YO5C 2KGOA 2ZXPA 3C8GD 5JHUA 5B1AH 4II3A 1S7ZA 2LF8A 2X1DA 4RMNA 2FOWA 3ZMUA 4BEHB 3NMKA 4CCNA 1XG1A 3LFUA 2KFDA 1IZ1A 5JLIA 2ME6A 2OBPA 5KK1A 1BJZA 4Q4ZF 8ICKA 3NEUA 3FWEA 2OCCC 1D5YA 1DP3A 2DAOA 3Q6MA 2JSPA 2PMHA 1TBXA 2A0BA 2EFNA 4RAYA 3VAYA 3CF2A 2Q1ZB 5CR0A 5BOMA 3JZ0A 1ZQVA 4I27A 5F04A 3MKYB 4IXAA 2EZKA 3HJCA 4Z2YA 3IQ5A 9ICAA 4JCHA 1WJFA 3C2HA 4I6ZA 3KMIA 4KIFA 2DB4A 2H7OA 1Z77A 5FFZA 3LS0A 3EUKL 5J2CA 2ZC2A 4ULVA 3LA3A 1U8RA 5A6JA 2B51A 4PHAA 3QOEA 3RQFA 1R8AA 3NMIA 4QI0A 5CVJA 3DBRB 4GYTA 5L0FA 4QZFA 4OAFA 2V6EA 3KH2A 3BQZA 3AQBA 1SZIA 1WFXA 4O3MA 3AQNA 2RQQA 1BPYA 3I5PA 4GXKA 9ICIA 2VKHA 4UUVA 4PGGA 2PFDA 3F46A 3G4XA 2KL4A 1RJ9B 3EPZA 1HCRA 2YHSA 2W45A 3RYLA 5EOZA 4I28A 1BR2A 3I71A 1ZHTA 3OYJA 4WWCA 4BNCA 4QZGA 5L3BA 4C3JJ 4EHPA 3AU2A 3GTQJ 4K97A 3HKZA 3X2QH 4XIDA 2Y9ZA 3CAXA 3EYIA 2VCCA 4WC5A 2EIKC 1I5ZA 2HV6A 1DU6A 4UAWA 4MFCA 2HN2A 2MG4A 3SEQA 3H35A 5IIKA 3R60A 4R64A 4CX9A 4C30A 4P96A 1EQ1A 8ICGA 5D6EA 2WVQA 2HDDA 3I9V2 3OOUA 4RQ6A 5COFA 1LJ9A 2ZJPF 3BDDA 4YN0B 4G12A 3DLLF 1T56A 2BGCA 4CS8A 4OAIZ 1WSUA 1SFOJ 3JSPA 2DFFA 4U0YA 4XA5A 4N0BA 4JEBA 4NXXA 1ZELA 1DUXC 2HR3A 3HRUA 4UUSA 2WC2A 2X9DA 2VONA 3QMKA 4WXCA 1W4MA 1V55H 3K2ZA 3HGGA 4EJUA 4NY8A 5GAGJ 4I2GA 4E7SA 1Y39A 4HRIA 2QVOA 5ERIA 1Z6AA 1U5TA 1RR8C 3PHZA 1LS1A 4GXJA 2P81A 3HLZA 3EF2A 4M47A 1D3YA 2QSHX 3UMKA 3K75D 3CDHA 5D91A 1ZRFA 1FIAA 2IAIA 1ZQJA 2DU9A 4WC3A 2CMPA 4S0HB 2CUZA 1ZAOA 3J7ZI 2FU4A 3PCVA 3HZJA 2DMPA 3FXKA 2EFWA 3PFYA 5FZTA 1BJAA 2VC0A 5J0WA 4G8XA 4O5VA 4CICA 1O7FA 1SVMA 3GEHA 1BOBA 1ZQRA 2IP2A 2HV7A 2K4BA 1RIOH 2CU7A 5KYNA 2BY3A 4OINF 2OC6A 2GDCA 2HUJA 1WWPA 3LEVA 1Z21A 3RPUA 4I02A 2RNJA 1TQGA 4D7MA 2HHPA 4ITVA 1YYJA 4U87A 5E33A 2HI3A 4HNTA 3UQ0A 3CO7C 1J75A 2O5AA 2RSEB 3D1NI 1TWHA 7ICHA 1FYKA 2WWYA 1ZJNA 1DPRA 3A0HC 3J06A 3WTSC 1H0MA 1KU7A 3MCZA 1YJGA 2EBIA 2OEXA 5CIVA 2ZJQF 1BPDA 4Z6EA 5JSLA 1PJRA 5E1WA 1IAWA 2QUPA 2JA2A 4I01A 4CSWA 2D5RB 4A3JJ 4RB0A 2STTA 3WTUC 2KSFA 1ETXA 3PIPF 4GXIA 3RJKA 4D7NA 2BE3A 1R5ID 4IF4A 3ATPA 5BS6A 4B3AA 3GLXA 2XXAA 1A7EA 1ERDA 3OYNA 1WN0A 4JZAA 2Y0SA 5DYMA 2R7TA 1FSEA 2NAZA 2DGJA 1BZ4A 4KLMA 3CCYA 2QBYB 3LSIA 3JRIA 4C3BA 4FHVA 2ZSIB 4AVZA 3VPRA 4U7DA 4XKBA 2VBZA 1Y0UA 1MW7A 3CCVI 4ENKA 1DQUA 2FA5A 2VPLA 4XSZF 2M5WA 1IGNA 1ZQLA 3N97A 1POGA 2VKDA 5D5XB 1WWXA 1OCTC 4DBRA 5F1RA 3LK9A 3RJHA 4LEZA 2EPKX 5CHEA 2K9QA 3OYGA 4E80A 4YT8A 2LR8A 4TUSA 3H39A 2ECCA 2B56A 3ZMZA 3HKKA 3DMDA 1JT6A 5EYRA 1P92A 1R8BA 2XKOA 1IUFA 3WU1B 3VODA 2LD6A 1JUSA 4KNYA 1OCCC 3CUQA 4A3LJ 2HSQA 4ETSA 4A93J 2HFIA 3EFOB 1GLNA 4MVQA 4EM0B 4HDVA 2R5YA 4DRIB 3HX0A 4F93B 3WTWC 2O3FA 5E2QA 4JWMA 5FCLA 3BTJA 3O8GA 5GTHC 4I99C 2OCEA 2JD3A 2EWRA 2JWTA 4PFPA 1V5EA 4MFDA 2Q0OA 3BTLA 2O03A 4NUBA 2AU5A 2OZ6A 1R8CA 1H7IA 4O68A 5DECA 2F5DA 3DBLB 4MVSA 4U9EA 2DA5A 1X3UA 4JURI 3D0SA 4DQ2A 1MIWA 3AQCA 2J8WA 2M9HA 1X1PA 2VT3A 3HRMA 5FGMA 3HTSB 5IOYA 4P6IC 5CHGA 4Y15A 3L2UA 2OJED 3ERMA 5JR3A 2K9MA 3FKJA 3OYBA 3RKQA 2VQHA 2ZFUA 2NUPB 5CB1A 3ZQLA 2DYSH 3S28A 3SDGA 4YIFA 4O79A 9ICMA 4ZH4F 1KEJA 3DBHB 1F9NA 4QPQA 1O3SA 1ZQWA 4LDRA 1ZHYA 4R79A 1KQ9A 1ZGJA 3HNIA 4LDQA 5M5XJ 1FMVA 3QPSA 2JVHA 1OJLA 4G7HF 2PLYA 1SD7A 1Y6DA 3DTIA 3HWTA 4KLDA 2FF4A 3OYFA 4DNCA 3IQ6A 3JPRA 2IS2A 4JVSA 4D5CA 4IWBA 1SD5A 1P4XA 4BE2A 4EATA 3DEWA 1MZBA 2K9NA 4CUGA 2LP0A 5F0FA 5K5OA 2HVSA 3OYHA 2M2WA 2ESNA 4ZYAA 1YZCA 2RGVA 3FF5A 2R03A 3MQ0A 4BJ6C 1SFEA 2EFQA 3LSMA 2FSWA 1M2VA 4JRZA 5L3QA 4NDLA 3LSGA 4OIRF 3ZQVA 5TZVA 2F5VA 2B0LA 3F23A 4XQFA 4KI2A 1YDIA 4E7JA 1R1VA 5ICCA 1P4WA 5C3EJ 4BBRJ 1XGOA 2F4IA 2VB6A 3GTKJ 3BR1A 2VT2A 4L18B 1VTNC 1SFKA 2M34A 4IKFA 2DCEA 1ZQYA 4WQLA 2HYGD 4NLKA 1HC8A 1Z6TA 3KE2A 4AX2A 2H8RA 1B68A 3T6JA 3RKWA 3I55I 1D0YA 5FJ8J 2YS9A 1BIAA 2MLKA 4OAYA 5DD4A 3RKYA 4C3HJ 4J01A 4AVPA 4DGWB 4AL0A 3ECHA 4HQMA 9ICEA 1XSLA 3GX4X 4AT8B 4KT6A 1ZYRF 3ABUA 2VE8A 1XC5A 3IH3A 4PGQA 3GFLA 5HSWA 2I8BA 2DK5A 4A6DA 2P4WA 1MMDA 4X4UA 2A6TA 3Q5FA 1MD0A 3EG9A 5DBCA 3WHCA 2R05A 5KYYB 1YE9A 4MQVA 1B9MA 2AWYA 4U5CE 3CCRI 4FHTA 4B4CA 1PV3A 3BZCA 1O7LA 2A3SA 3FKIJ 2KW3C 4ZLDA 2DQRA 5L0GA 2D45A 7ICUA 2O5RA 3JRGA 5IP6A 2V6CA 4DOCA 1A6QA 1IXRC 3M9AA 4KISA 5J0UA 3AG1H 2ETSA 1LB2A 3SXZA 1G59A 1MSEC 1JN3A 1W5TA 2WAFA 5IY5H 4QZAA 2GWSA 2IT0A 7ICJA 3EHMA 2CGEA 2WB1A 4EV6A 3KEOA 2FEZA 3C2LA 1ZQTA 2HSBA 3TO6A 1JHFA 4CO8A 3OV8A 4Z9JA 5B3SH 1ZHXA 5JVTA 2G3VA 2DDAA 3EZHA 3DTEA 4XRSA 4CA0A 3G73A 4BE1A 3TKYA 3S17J 4RQ4A 4HX4A 1YX5A 4D5FA 5J2FA 1T08B 1YJNI 5FKKA 4HNUA 3KYJA 2BCUA 2LD5A 1ETKA 3ITFA 3WE2A 3M4OJ 4C3EA 3GCMA 1ZQXA 4LDKA 4WC4A 2E60A 2XLOA 3BQYA 2P6VA 1K78B 1OCZC 3NQOA 2Q00A 4U5GA 5L0DA 4QZEA 1X3ZB 1YIOA 3SYTA 2M1BA 3S3NA 3TQOA 3BJ6A 3W6JB 3OY9A 1GHCA 3T1BA 5JFRA 3WG7C 1FP2A 2XVCA 3FBIB 3HOSA 4K96A 4XONA 3AG2H 2W4SA 3KP3A 2GA0A 3CCSI 3JRMO 4P4MA 3AUOA 1Q1VA 2X1EA 1V4AA 5A69A 1Q1HA 3K7AJ 4BH9A 3VM6A 3ZN0A 4KLIA 1YAUO 4UAYA 3HJ1A 4DYCA 3DWLE 4B09A 4A0XA 3QPLA 3VYTB 2O61A 7ICQA 1X1BA 4RQ0A 4UY8I 4UV8A 2NUTA 3KZYA 2W82A 4DJAA 1TT5B 2HFHA 2M45A 1IXCA 2HDCA 3KP7A 1Z3IX 2TCTA 1EI7A 5D6FA 5J2IA 2Z15A 3RDIA 2XS1A 4CSAA 1YI2I 3VDXA 3DJNB 2PMZA 2JN6A 2LP4A 3B0XA 2MW8A 4LERA 4DIQA 5LEKA 3OS1A 1CPRA 3EETA 2DTRA 3HTKC 2M8EA 4M2YA 4DZJA 2R5ZA 5BPDA 2FGYA 3CLOA 4BQQA 2Y69C 1L7CA 1IXSB 2EJRA 2ZFWA 1HE1A 3AGUA 4ABZA 1ZG5A 5HOOA 4FT8A 5D4BA 1V74B 3S3MA 4D4XA 4RB3C 3S2DJ 1WGXA 4A3DJ 3GTMJ 4ER9A 1E85A 5HRKA 4WC6A 3I56I 4YG2F 1D0XA 1M1EB 5HDKA 3L8IA 1NFOA 2G3KA 2L81A 2K40A 2CGPA 4ONSA 8ICJA 2KHMA 5B3IA 4CS9A 4RS8A 4YL0A 5D4RA 3S1MJ 2ISYA 1SD4A 1GQAA 2EPOA 2P5LC 1NSGB 2IA2A 1LM3B 2M7AA 1Z0XA 3SEOA 1T33A 2ID3A 1YJ9I 2XL4A 3W8IA 4E4HA 1PYVA 2PJPA 3IPMO 4OD4A 3UMHA 2LH9A 4XOPA 3MMYB 4Y52J 3G1OA 2ZMEA 3J7AY 1GV5A 2GFHA 3ISBA 1EA3A 3QOPA 4HG2A 4YEJA 2EIJC 2VH3A 1U9OA 2IGKA 1E17A 2YEVA 3K1NA 3LSKA 2ZXIA 3DU6A 3NRVA 4N9HA 5BNGA 1OLTA 4EEBA 5JI6A 5A2QK 3IRQA 2JPUA 3OIOA 4A2UA 5J1YA 2KDZA 2PF4E 4MFEA 1ZQPA 1R23A