3C18A

Crystal structure of nucleotidyltransferase-like protein (zp_00538802.1) from exiguobacterium sibiricum 255-15 at 1.90 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
GMEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLILNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFPETERCLQMSLSFAKLLRRFQDGRNLFSRGNYYDAYTHVHHALHHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQSKVLSGGKYLFEVMRERDRPWTMHELMEESRLTELKVDLGSLVDFFIRKGLIRISYQRTKGLGVELVTYEPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleotidyltransferase-like protein (ZP_00538802.1) from Exiguobacterium sibiricum 255-15 at 1.90 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
molecule keywords Nucleotidyltransferase-like protein
total genus 107
structure length 290
sequence length 290
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14540 NTF-like Nucleotidyltransferase-like
A PF18576 HTH_52 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c18A03
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3c18A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3c18A01
7ICEA 2K86A 1P92A 4RB2C 4KLTA 5JFRA 1KNYA 3AU6A 9ICTA 3W6JB 3DP7A 3HHGA 1XSLA 2OQGA 1P4XA 3ZN0A 3PFIA 4G7ZF 4E70A 3SFZA 1ZQGA 4A5NA 2Q00A 5DB7A 1BC8C 9ICNA 4LZGA 9ICVA 2P5LC 4U7BA 1Q1HA 1RNLA 4HDVA 3FM3A 2GWSA 4Z6EA 3UQ2A 1STZA 2V1DA 4PGQA 4TURA 2PFQA 1LJ9A 4NLNA 3CO6C 3R0AA 3CUQB 3IHUA 4LLLA 3RKXA 8ICRA 5J2GA 4ESJA 2ZMEA 1FNNA 5J8FA 5CHGA 5ICGA 2EJRA 1F1ZA 4AT8A 3AQLA 4O5VA 3WTWC 2VODA 5J2BA 3RKWA 3I71A 2E1NA 3BZ6A 3MGHA 4PGYA 4FT8A 4X0AA 3U2RA 1ON1A 2OZUA 5TJJA 3M1EA 1OW6A 2NYXA 5LGNA 5E17F 1QPMA 3EYIA 3WG9A 3OOPA 1ZLJA 2RC4A 2VOPA 8ICJA 4EM0B 4M9HA 3BJOA 1BPZA 1YFHA 4NXZA 3RH5A 4L9JA 2VT3A 1FZPB 3I58A 3HTSB 3GEZA 3ECOA 2NRAC 1I6XA 5CB1A 2L6FA 2PFOA 4MQVA 1F9NA 2NNYA 4WCWA 4I7HA 3GVAA 4MNUA 2A6EF 1ZQJA 2QM3A 1YLQA 3PNCA 4M9JA 3EETA 1SD7A 9ICFA 3Q5FA 2ISZA 1VJ7A 1P4WA 4UD5A 5HS9A 3RIRA 2K4BA 1ZG3A 3GM1A 4JWMA 1KA8A 3K69A 4LD5A 2KJCA 1HW2A 4PHEA 4AVPA 5HC9A 3H3ZA 2Z33A 1ZQIA 3DV8A 2DW4A 4PDKA 3CUOA 2P7VB 2EFNA 4UXNA 1ZH5A 2RN7A 1WSUA 4Y15A 3WTZA 4OIQF 1R36A 1OYWA 5HDGA 2XHKA 4S3NA 2L02A 5ILSA 3JYYA 4KLOA 2HSBA 3TGNA 4EJUA 4GGGA 1FP1D 4MFCA 1R89A 4RQ3A 4H0EA 2KIMA 1FWZA 3REOA 2DI3A 3QAHA 2VE8A 2GXBA 4UBCA 3TDUC 3ERED 1R58A 1TV9A 4NLZA 2DQLA 8ICYA 2W25A 4XRHA 4UB2A 2Y0MA 1XSDA 5FD6A 1ZQEA 4UB4A 4EJOA 3C2LA 1TTYA 2TDXA 1S6LA 5JI6A 4WBYA 1TNSA 1IRFA 3O10A 5FLXZ 3ROUA 2I9GA 1D3YA 1XGOA 3G3ZA 2IJLA 1J75A 5IT9K 3UXPA 2QVOA 4AT9A 4NKUA 2HYFA 2XAGA 3I4PA 4YN4A 3F6VA 5CA7A 3MZHA 4RT2A 2RNJA 1HQCA 4PCQA 1HUZA 2HTJA 3L9DA 5FFXA 2ZFWA 2O61A 4M9NA 1P6RA 2GA1A 1ZGAA 3QU3A 1YW7A 3HSRA 5HR9A 3NQOA 1IN7A 1JHFA 3L8IA 1ZG5A 3LQCB 1O3UA 4QZDA 3TOAA 1IXSB 3R6SA 3B0XA 2L01A 4I2OA 3F6OA 4FX4A 4U0YA 1SFEA 3E5QA 2EFOA 5DKWA 4YFKF 4YMMA 1K78A 4I2DA 1G4DA 2CO5A 3DF8A 1OW8A 3F22A 4LLNA 2L6HA 1E2XA 1UCRA 4G7OF 4IRIA 3F23A 3VOEA 3WGHA 4KMUX 4S04A 1ZQTA 2MH9A 2JT1A 4FH5A 2OAZA 5ERIA 1LVAA 1TVAA 2ZH2A 3V8LA 4FH3A 4I2BA 4GCVA 3H39A 5CP2A 3KP3A 3PMNA 1FY7A 2NAZA 5HRIA 2DT5A 4UV8A 1O3TA 1Z6RA 4L9TA 1O7LA 2DFIA 1J59A 1XSNA 2IT0A 4R63A 2RKHA 4TUSA 5AIQA 2DQRA 4LFUA 3LQRA 4M9SA 3LAJA 4FHPA 1I27A 9ICBA 4YMOA 5BOXA 5E8IA 3L00A 3BDDA 2DPDA 2ZKZA 4KLUA 3DFGA 1S3JA 1XCBA 2MA3A 1BN5A 3F21A 4WXHA 4LB5A 3HOTA 1HKTA 1HSJA 3K1MA 4KIGA 3JPQA 5DEDA 5CJ9A 4TUPA 4IRGA 3LA3A 2XV4S 3LA7A 2P5KA 4I0BA 2K7LA 3C7JA 3TO6A 4KLIA 2E7WA 4A5MA 3M7GA 1GVJA 5BOLA 1KTMA 1BI1A 3RJHA 3QPTA 1B4AA 2L3DA 2MLGA 3V7JA 1W7PA 2M87A 3MBYA 3WFPA 4LK1F 1XDSA 2BCRA 4MTEA 4Z6DA 2HTSA 3K2ZA 1ZGJA 1O3QA 1T2KA 3R0JA 4I0AA 3V7LA 5H6RA 2BE5F 4GXIA 5D8LB 3HX0A 5EEHA 1SFUA 2HQRA 2HKXA 1OW7A 4RS8A 4A2UA 5J8CA 2CYYA 2VBYA 4RWQA 1KEJA 4LVSA 3D5LA 4CICA 3FXRA 1S7AA 1KYWA 1L3LA 2M2UA 4F5NA 4M72A 4Q5SF 5D4SA 7ICUA 5EEGA 2BCVA 4WXCA 3P7NA 2KIFA 9ICQA 4IHSA 1FSEA 1QNTA 3I59B 5L3CA 2DR5A 5L3BA 4ENNA 1U3EM 1ON2A 2HEOA 3NRVA 4RB0A 4CO8A 4XEVA 1FX7A 1FLIA 5FB2A 3MDCA 4KLHA 4X4OA 4OMZA 2Q8KA 1XSXA 1B9NA 2LSOA 4KLMA 4L18B 3R60A 5CR0A 1BPDA 3OVSA 4L9VA 4LLGF 4YMNA 5TZVA 1OR7A 1LEBA 3KZYA 4CXFA 4RT3A 4B09A 4EBKA 5CWRA 2EV5A 8ICNA 4AD9A 5J2FA 1JQRA 2FSWA 1G3TA 1YS7A 4HQMA 1L0OC 3TOBA 4QZGA 1Q78A 3WE3A 4IG8A 5HLIA 2BBYA 2JTVA 4X5VA 2MLKA 4YCXA 3JTGA 1OYIA 1W4MA 1ZRDA 4XUSA 1K05A 3KEOA 5HS7A 1KQ0A 8ICXA 4YG2F 5J29A 2IPQX 2DO7A 1V4AA 2OD5A 4RWNA 1ZREA 2KIUA 5HLHA 3HW8A 4BQAA 8ICOA 1T39A 3GX4X 2FA5A 4BHBA 5L3GA 2DRBA 2XRNA 1ZQXA 4WC4A 3COAC 5F6FA 2IA2A 2R7FA 3I54A 2ZHAA 3T5XA 4L0ZB 1LDDA 5HRDA 3L2CA 3K1PA 2K02A 3LSTA 4IQVA 1A04A 4R79A 7ICLA 1RI7A 2IW5A 5ILUA 1OPCA 4EJTA 3E5XA 9ICHA 5LGUA 3AJMA 1BIAA 2HHPA 4BHPA 1G6NA 4KNYA 1XB4A 3K0LA 3GFIA 2DBBA 2BE3A 2BPCA 3RH4A 4PGGA 3WTSC 4I2AA 4NLKA 2BPFA 1SMYF 9ICWA 1S29A 3N4MA 4ZYDA 4QZIA 3V7SA 2VXZA 2FMYA 3AQNA 4ENJA 3C2MA 5DV5A 2M2WA 4KLJA 1J9IA 5CJ7A 4G9YA 2L6GA 3LWFA 4IRHA 1XGMA 1VTNC 2BV6A 1O7FA 3ZPLA 3QP5A 1D5VA 5EOZA 7ICOA 1YYVA 4EM1A 4ZYEA 1TLHB 4I2CA 1ULYA 2IP2A 2FBIA 2DR9A 1MQ2A 8ICEA 4EMSA 2K27A 1MD0A 4CHUA 5DBCA 2WTEA 2EA2A 3IC7A 4GO1A 2O5AA 4K4GA 1U78A 1BC7C 2NRKA 2G7HA 2FMQA 2ESHA 2JSCA 2D1VA 2CG4A 4UAZA 2HQNA 1UHMA 5K5OA 3HJ4A 2ZH5A 3EUHA 1RPLA 2IHMA 4L5JA 1UEUA 4OIPF 3K9TA 3LA2A 8ICZA 2PQ8A 3B71A 1WOTA 1ZQUA 4NY8A 2ZH4A 3J80K 4G6DA 3HJ1A 3RQGA 4M04A 1FBSA 5HDKA 3GLXA 8ICVA 5DD8A 5BOMA 4RPZA 2FU4A 1ZQBA 1IN6A 3HRSA 5J2EA 4RAZA 1I5ZA 4DOAA 1NOMA 3UPSA 5E1ZB 1BBYA 3J81Z 4YD1A 3OV8A 3TKYA 4FHVA 8ICMA 2L54A 5HVQC 1T0FA 1PP8F 1NO5A 3KCCA 4R64A 1IAWA 5LBQA 3U0CA 4FHWA 4EVIA 3GDXA 3H38A 4HX4A 2OBPA 2R7DA 1EH6A 4WC2A 1ZQQA 2BEOA 3E97A 3C8GA 2VOOA 2Z9OA 1ZYRF 1BPXA 5CVUA 1XN7A 4ZYHA 4HDUA 5HRGA 2FOKA 4ZZLA 3E6BA 3J80Z 4EQQA 1Z91A 3RI4A 4LJZF 3P9CA 2DK5A 4P9UA 2WC2A 8ICUA 2ZNZA 4HZFA 5AIPA 5A2QZ 3QRFF 2BCSA 2VANA 5BS6A 2M8EA 4LMYA 4KUMA 1VFGA 4NQFA 3S9OA 4UBBA 4CYDA 2PFBA 1H0MA 1ZHFA 8ICGA 1Z1DA 2KKOA 9ICSA 1Z6TA 4TUQA 2FF4A 2XAFA 1F4KA 3BJ6A 2W57A 1D8JA 2PLYA 5BPCA 3R4KA 3T8RA 1EH8A 1KDHA 8ICLA 4PPXA 2XAHA 5F2VO 4MGRA 4E80A 3OUYA 2CWEA 2ADUA 5K5QA 3ISCA 3UXNA 3VEPA 3MFKA 4AIHA 2QBYB 3TFRA 5E1WA 3LFKA 4MTDA 3HRMA 4XLNF 5BPDA 2W84A 2WV0A 3ELKA 4U0WA 1U8RA 4OU0A 2DPUA 4PHPA 1R8AA 3OVBA 2Z3YA 5J6XA 5J2DA 3KZZA 4MF8A 1KU9A 1KYZA 2H6CA 4M2YA 2V6CA 2FMSA 8ICBA 4PGXA 4MF2A 9ICOA 4IQTA 3N97A 3IWZA 4UHTA 1HKQA 5FD5A 2UZKA 3RYRA 3ISDA 2RV8A 4R66A 2ISPA 1R5HA 4OIRF 2CGPA 1WKMA 3SXYA 1GHCA 2MH2A 1YS6A 3VFZA 1ZRCA 5DBAA 8ICTA 2EFWA 2OZ6A 1ZQOA 5LHIA 4RQ0A 2L4MA 3KP4A 2PI0A 3S2WA 1REPC 2DVIA 1JMSA 5D6FA 4EBJA 3FF5A 2VBWA 3QPHA 1HUOA 1G3YA 3U1DA 2ZBKA 3F72A 1ZJNA 9ICAA 5D46A 2HDCA 1ZZPA 2M45A 2VC1A 1MQ3A 4IF4A 3FX3A 1UHWA 3BP8A 1GXPA 3KLNA 4M6YA 2J5PA 1JN3A 3RJJA 1ZLKA 3CUQC 4WC5A 1HBXG 3F8FA 3T1BA 3FXUA 2AXLA 5J0PA 2P6SA 3JPSA 2H27A 1MIWA 3T8TA 2D1HA 4M9XA 2HS5A 4WX9A 4ATBA 1XGSA 4AIJA 7ICQA 2V9VA 2MD5A 3HYIA 3FZVA 5E18F 1U6GA 5D5XB 2XIGA 1FT9A 4KN7X 1ZQCA 1FYMA 1F5TA 2RFFA 2E7XA 4WC6A 5D5UB 3EDPA 5FGMA 4HF0A 2MC3A 3V7CA 4UUVA 3ECHA 1YO5C 4K4IA 4N9IA 2PN6A 4NM2A 3GUDA 4UAYA 3WGGA 3T0YA 2VN2A 2VBZA 1LQ1A 3M9AA 4MFFA 4AT7A 4NB5A 2FNAA 5CVVA 3J81K 2ZH6A 2COMA 2HWVA 1HW5A 4HBLA 1R1VA 4IQWA 4YFNF 4QZ9A 1ZQRA 5IINA 2F5DA 1EV7A 5FO5A 3H37A 1O57A 4M74A 5IIJA 4A0XA 2D2WA 1XGNA 1ZQZA 2IA1A 1PX5A 4I01A 1DUXC 4XEFA 2QYOA 2BPGA 4I02A 4KLQA 3KP6A 1IW7F 4ENKA 1ZQLA 3ZP5A 3FMRA 7ICJA 1V3FA 1MIYA 1XDUA 3AUOA 4JWNA 3RJIA 2QENA 4UNOA 4A12A 3RPUA 1KQ8A 1RIOH 4EJWA 4P2HA 1W5TA 2F5FA 8ICIA 4MFAA 1MDMA 4X4RA 3HIYA 2A61A 5TRDA 1WTYA 4CGZA 1TFWA 3ISPA 4I29A 1T6SA 3JSOA 3KLOA 1XMKA 2EA4A 5D4RA 3MDAA 3MWMA 4XQ8A 3SZTA 2OU2A 3TO7A 5FFZA 4EGZA 4O9MA 2FQ3A 1BI2A 5HS8A 4HLYA 2ZXJA 2RGVA 4XRFA 3JTHA 4I2JA 2QUFA 4KLEA 3V8JA 2PBEA 1TFYA 3MGIA 3L8JA 2ZHBA 2Q66A 8ICPA 1R1TA 4RGSA 4KICA 1AWCA 1HSTA 3JPTA 1UFMA 4XSZF 4OIOF 4UD4A 5BPIA 3MCZA 3LAPA 4YIIA 3BY6A 3KEQA 4M0AA 3GFMA 1DDNA 4WC1A 3JPPA 5F1RA 1C0WA 4QZBA 4HW0A 4NQWA 3RJPA 4PZJA 9ICEA 2ZO4A 5J2JA 1U2WA 5HHIA 1YW9A 2EV0A 5A2QK 2CFXA 3LQQA 3JPOA 4RQ7A 5HRFA 4KIBA 1P4AA 9ICXA 4XQ7A 1ZRFA 3UXOA 1ZJMA 4ASNA 5E8GA 3HHHA 1Z05A 4R32A 9ICCA 3TQNA 4N9HA 1B6AA 3P9KA 3HUGA 2HZTA 3B73A 3NEUA 3L09A 4L9NA 4O5KA 4Z6FA 2RDPA 3OVAA 8ICHA 3C18A 4XBFA 5KK1A 3VB2A 3HWTA 1F5AA 3CO7C 3BPXA 4NHJA 3MFNA 1XSVA 3FMSA 3G73A 4RPYA 2ZNYA 3P9IA 2OQRA 4BAYA 1MDMB 4RPXA 2ZH7A 2JPCA 1OU5A 2QQAA 4WC7A 4I2GA 2UWMA 2OA4A 3AQKA 1IF1A 2ISOA 2H09A 2PFNA 1OYYA 4RWOA 1DPUA 1ZAOA 5LHGA 3IKVA 1MKMA 2KK1A 1SD5A 7ICTA 4FO6A 2P4WA 2CSOA 2LNBA 1IRGA 3D0SA 4UVCA 1Y0UA 3VODA 3ZQ7A 5ILVA 3HTUA 1DP7P 2P66A 2JX0A 3DEUA 4GXJA 2V79A 3HSEA 5J2AA 3BJAA 1PV3A 4Q48A 9ICKA 2VT2A 3E6DA 4LK0F 5DCMB 9ICLA 3C1DA 5DUIA 1ZQDA 2LDUA 2UXNA 1QZYA 4G6QA 2PEXA 2QQBA 4I28A 1XCVA 1U5TA 4KA4A 4WXDA 2DRAA 2H94A 4KIFA 1ONVA 1WQ2A 2NNNA 1FBUA 3WODF 4ESFA 2PMHA 2A07F 3KP2A 1ZARA 3KETA 2C6YA 2X0LA 4X4QA 5ED4A 2JZYA 2DLLA 1WOLA 5IIKA 3GM3A 2F5CA 3WFSC 3J7AO 5E1XA 4LB6B 9ICMA 1ZQYA 1PP7U 2ID1A 3I64A 2YWAA 4M9LA 2HGCA 4KN4X 4G94A 4UB3A 5HLGA 3WTYC 7ICGA 1HXDA 1J0RA 3NYBA 5JHUA 3F8BA 2DR8A 5D5VB 3PQJA 3L9FA 1R8CA 4Z2YA 4OOIA 1ZQMA 1JOGA 3JPRA 3F3XA 2YX7A 2W9MA 4RWPA 4O6JA 4JBAA 3ZMSA 3WTVC 2KRFA 1BPYA 1YQAA 3GW2A 4ESBA 3JZ0A 4RB3C 4X4SA 3KE2A 1BI3A 3AAFA 5E20A 2QZ8A 3JAMK 3GZ5A 4QZEA 2FMPA 2QBYA 3CUQA 2STWA 3V7KA 4LGWA 2P6TA 4F5RA 2ZMEB 4RQ4A 3F8NA 4A6DA 4CDGA 3GYHX 2PG4A 4WWCA 3I53A 4DOCA 4NM1A 2M2TA 3FHZA 1OKRA 5ICFA 2XKPA 1B1BA 2WWYA 4ON0A 2G7UA 3H3AA 4D0PA 1T98A 1JHHA 9ICGA 4MQ9F 1YIOA 1B59A 1FBQA 1AOYA 2ESNA 2W24A 2PXIA 3RDIA 1KU7A 4RQ2A 5LLQA 2VBXA 4XEKA 5HRLA 1R23A 2YX4A 9ICRA 1IN8A 5ICCA 4N0BA 3LK9A 1HW1A 2O1PA 9ICJA 3O3KA 4KT5C 3K7DA 4KYWA 4O5CA 1MJAA 3ZMVA 4WK8F 3HRTA 5DDYA 4EJVA 2EFQA 1ZQAA 4EV0A 1KQ9A 1KU3A 4A0YA 5J0XA 3FM5A 3IWFA 2EV6A 4YFXF 2Q2EA 1LNWA 5J2IA 1Q79A 2FE3A 1XD7A 1FC3A 3MZYA 2RVCA 1SFXA 2P8TA 3C5FA 4KMFA 4M6XA 2GQQA 3TDZC 4R65A 1E17A 1UFBA 4KDPA 3H92A 8ICWA 2M2VA 1R00A 4UVAA 5F64A 4R1HA 5J2HA 1X3UA 1Z9CA 1CGPA 1W7PD 2FBHA 2LKPA 3C8GD 4I27A 3WE2A 3PMLA 3WU1B 4O3MA 2HOEA 5JVTA 2O6GE 5CVRA 5IT3A 1EH7A 3RYPA 3PQKA 1JE8A 4P5OA 1BPEA 3HOSA 1WRJA 2EK5A 4MEYF 4U7DA 5IT9Z 4RAYA 2M1BA 2EFPA 4AIKA 4GYIA 5JR3A 3BWGA 1MIVA 1K79A 2GIVA 2ETHA 1LEAA 3AU2A 3DPTA 3U3FA 3WU0A 3F8MA 2KJBA 5DB6A 3ISBA 3ZMUA 5J0QA 2QWWA 1TQPA 7ICPA 4UB1A 1R22A 2DTRA 2ACJA 4E7XA 1R5GA 2AS5F 3WTXC 4ATBB 3ABUA 4DO9A 2PBIA 3C66A 5J2CA 3MAJA 1FYLA 4S05A 1ZQNA 1LDJA 5LRSA 4QZCA 4M73A 1R7JA 4P55A 5CVJA 1QQIA 2FMLA 1ZN2A 2B0LA 1D8KA 1YLFA 2ZH1A 1HKSA 5HRBA 5LEJA 3I5UA 3GFLA 2A68F 5DUKA 3DXJF 1QO0D 2V1UA 5HOOA 2GA2A 4LT6A 7ICNA 2FRHA 1RZTA 3M8EA 2Y48A 5LGTA 3ULQB 1K04A 4AT8B 5LEKA 4P4MA 1G3SA 4M9ZA 1BIBA 2A69F 2IRFG 4BYYA 3MQ0A 2JPBA 1FOKA 2FEZA 1JXSA 8ICAA 2IVMA 5DCFA 1YTYA 4F5QA 5L3FA 4XLPF 4IHTA 2Q0OA 4PGHA 3GFJA 7ICVA 3QOPA 3IKTA 1TNTA 4I2EA 4RQ5A 2EWNA 2F2EA 3GZ6A 3I0TA 3C2KA 5D5WB 1O3SA 2A6HF 4KFCA 4Q4ZF 1RUOA 1RZ4A 4I2FA 1USSA 2O8XA 4ETSA 2FXAA 2GZWA 4M5DA 1BM9A 3IRQA 1FA0A 4R8HA 4X4NA 1MJ9A 2PMUA 4JK1X 5DD4A 1BPBA 1IXCA 4BNCA 3QU6A 3ZMTA 5IIOA 1S8NA 2MBFA 1QZZA 1IN4A 2PFPA 4DNCA 2O3FA 2G9WA 2BGCA 4Y13A 4MEXF 4KLFA 1K40A 2ISYA 4QZHA 2V1XA 3K1NA 2LF7A 1TBXA 1S7OA 5HRKA 5D6EA 3OUYB 3JAMZ 4QLCU 4M9GA 3DKWA 3Q9SA 4BXUA 7ICSA 1KU2A 7ICIA 4IXAA 4IVNA 4HV6A 5H6QA 5IILA 3E3VA 1SD4A 4U0VA 1G3WA 1FP2A 4P96A 1NHAA 2F5EA 1ZQFA 1DPRA 4X4UA 1U5TC 5FLXK 3WTUC 5CLSA 4LG0B 4PHAA 3RJEA 3KP5A 1WWPA 4HF2A 3E5UA 2M30A 4MHGA 9ICUA 1LDKB 4XSXF 5DDGA 4FHXA 4DOBA 2IA0A 3IL2A 2VC0A 3C5GA 3RH6A 3C3WA 2HKOA 3QP6A 7ICKA 2YSRA 1K78B 5D4BA 2XAJA 2CQKA 4L0YB 4WC0A 3CDHA 1I1SA 3KFWX 4ENMA 5D49A 4KLGA 1JGSA 5CYVA 3SZPA 1IXRC 4GXOA 4Y17A 4F5PA 4OINF 2DR7A 3DPLC 8ICCA 3TFSA 3B02A 1R1UA 3Q9VA 4HOBA 1O3RA 5H20A 2K4JA 4I09A 2VONA 3C8GB 3U9GA 3HSFA 3V4GA 1FYKA 4WF2A 3GXOA 5L3EA 2JPUA 2PJPA 4E8FA 2STTA 4K4HA 4ZZDA 4O5EA 3RQFA 2RQPA 4L5IA 3ABTA 3V72A 1R8BA 3KP7A 7ICRA 2VE9A 4M71A 1YW8A 2DK8A 4KLSA 1YG2A 3F8CA 4UB5A 3O6BB 1MGTA 3FMQA 5J0WA 2XGXA 3GO5A 7ICFA 5J0RA 1ZQPA 4WBZA 1J5YA 1IUYA 4A6EA 3RJKA 2XASA 7ICMA 1J7KA 1U5TB 2CW0F 4KLLA 3EQLF 4FHTA 8ICFA 2XROA 5DCMA 5DB8A 4P4OA 4X4VA 3GWZA 4HA8A 1QBJA 4HLXA 5LHHA 1UB9A 3E6CC 4M47A 4HQEA 5IIIA 2UXXA 2LF8A 3ZMDA 1BI0A 1USTA 1J2XA 3RJFA 5K1YA 4CZZA 3RPQA 4P9FA 3V8KA 1V4RA 2M5WA 2XAQA 4EP7A 4K2EA 4P4PA 3H3UA 1ZQHA 4LG0A 2BCUA 4GYGA 5HREA 1K6OA 1IN5A 3MEXA 1CF7B 3RJGA 4U88A 3BPVA 2BCQA 3UPQA 4EM2A 2R3SA 2X4HA 5CVIA 2XVCA 1T38A 4AWXB 4BH9A 2Z99A 3RKYA 3CJNA 2W85A 3L7WA 2HYGD 1W7PB 1MJBA 2QLZA 1SMTA 1MZBA 1XSPA 3M8FA 3CTAA 5ICEA 4UV9A 3WFOA 1WI9A 3GF2A 4RQ8A 4RQ6A 5LRRA 8ICKA 3WFQE 1CF7A 2GAUA 4QZFA 2Z5UA 1BJAA 4X4TA 5J2KA 1H9GA 1GXQA 3SHFA 3JW4A 4PHDA 2A3SA 1ZG1A 5F28E 4FX0A 1QGPA 4ZYGA 3IRRA 1BOAA 3FWEA 2A5YB 2GWRA 3ML6A 4RB1A 2L4AA 3AQMA 1TQIA 1FPQA 4IPAA 5DB9A 4OMYA 1TW3A 4QWQA 4YIFA 4FHYA 1PDNC 1W5SA 5L3DA 3BROA 1I1GA 4WCGA 4B8XA 4UVBA 2E1CA 3OV7A 4AT7B 3BRJA 2ZH8A 4F7ZA 4IQUA 8ICQA 3ZMZA 5KVRA 3TULA 2HFHA 4UAWA 2DU9A 4KLDA 4G8XA 3SQNA 2QQ9A 1K7AA 5J0TA 2P5VA 4TV7A 2ZH9A 1WWXA 4A0ZA 2YR2A 1UEVA 3FXQA 5J0UA 4IJAA 4I98B 3V7RA 3CLOA 3E6MA 3UQ0A 4X0BA 1H9TA 5HDNA 3WGIA 1ZQKA 2EB7A 5J0SA 4DQ2A 1B9MA 3HRUA 4X4PA 5BQTA 2DAOA 4WC3A 1RUNA 3ZN1A 4RGXA 2YPRA 4GXKA 2O03A 4HX8A 5DDMA 3RTRA 2GXGA 3I59A 4RGUA 2XKOA 4NKTA 4RQ1A 4QZ8A 1SAXA 9ICIA 5K5RA 2XUBA 1ZQWA 4EGYA 1P2FA 2LK4A 1UETA 2YU3A 3R61A 4ZH4F 4PH5A 7ICHA 4YD2A 1QVXA 1ODDA 4Z6CA 2ZCWA 8ICSA 4AT9B 5BMZA 5HRHA 4HV5A 4F5OA 3K75D 4QZAA 9ICPA 1ZQVA 2JRTA 5DEQA 4JQFA 5DBBA 1ZQSA 1TW2A 3W6KB 3BOQA 4BHCA 2FBKA 1JAJA 4RGRA 3EYYA 1PUEE 2H6BA 1FSHA 3GM2A 4HX7A 3RQEA 1IZ1A 5J0OA 5IIMA 6PAXA 1TQMA 4I2HA 2P7CB 2D45A 5AONA 5DECA 2NS0A 4I2IA 2ELHA 3O2PE 3B0YA 2O0YA 4LZDA 2HR3A 3JSPA 4HAMA 2ZJ2A 1SD6A 5D8KB 4Q47A 3TO9A 3WTTC 5HHHA 2BYVE 2Y75A 4HYEA 1XMAA 2J5OA 3JPNA 2ZH3A 1KGSA 5DYMA 4XA5A 3OGUA 4G7HF 4HF1A 3HIFA 1Z7UA 2FNPA 1OMIA 1LB2A 3WFRE 3DQVC 5J0YA
chains in the Genus database with same CATH superfamily
1ZK8A 1MMGA 7ICEA 2K86A 1P92A 1RCPA 1VB5A 3M4BA 3DEEA 2BXYA 4RB2C 1O5HA 3K4NA 3FAPB 4YWQA 5JFRA 1KNYA 1QLEC 3AU6A 4BE0A 2XB5A 2QA4I 9ICTA 2L0KA 3W6JB 3DP7A 2ASRA 3HHGA 1XSLA 3DJNB 3VM6A 5CIVA 2M34A 1XMXA 2OQGA 4XRSG 1P4XA 2CFOA 3ZN0A 2TCTA 2K9NA 1MBEA 3PFIA 4G7ZF 4E70A 3SFZA 1ZQGA 3NAUA 4A5NA 2Q00A 4Q7CA 5EDNA 5DB7A 4D5FA 1BC8C 9ICNA 4LZGA 4M6VA 2DT7B 1DOWA 4IKFA 2P5LC 2YKZA 2V9PA 4U7BA 1Q1HA 3S15J 3U8PA 9ICVA 1RNLA 3FBNB 4HDVA 2Q1ZB 3FM3A 3PM1A 2GWSA 4Z6EA 2LTPA 2R7OA 3JCUC 1STZA 3UQ2A 2V1DA 4PGQA 4TURA 4O6NA 1LJ9A 2PFQA 3CO6C 3R0AA 4NLNA 4A4AA 3CUQB 3IHUA 3Q6MA 4LACB 4O68A 4LLLA 3RKXA 4M3DA 1TL8A 2VC9A 5J2GA 8ICRA 4ESJA 3ZTMA 3ZQYA 2ZMEA 1T6QA 2R7QA 4ZDPA 2YRFA 1FNNA 5J8FA 2R02A 3F46A 5CHGA 1GUUA 5ICGA 2CW8A 2EJRA 4CYCA 3LSKA 1F1ZA 4AT8A 3AQLA 4O5VA 2X1EA 3QMKA 3WTWC 2VODA 4ER9A 2R4GA 3L1PA 5J2BA 3RKWA 5B66C 1MBJA 4O6MA 3I71A 2E1NA 3BZ6A 1FTTA 1KONA 4LLCA 1TZLA 4MS2A 4W8PA 4PGYA 3MGHA 4FT8A 1W36C 4X0AA 2K9QA 2BVLA 3JCFA 4NQWB 3W2WA 3U2RA 1ON1A 2OZUA 1X1DA 5TJJA 3M1EA 3IQCA 5A6JA 1OW6A 2NYXA 5LGNA 5E17F 4JX4A 1QPMA 2NVTJ 3OYEA 3EYIA 4UB8C 1ZR4A 4A3DJ 3WG9A 1M56C 3OOPA 1ZLJA 1WJEA 2RC4A 2VOPA 4NXUA 8ICJA 4EM0B 4M9HA 3BJOA 2BHYA 1YFHA 1MMDA 3ZTZA 4NXZA 4L9JA 3RH5A 2VT3A 4UUTA 1BPZA 2VXDA 2Y3GA 1NH3A 1FZPB 3I58A 4JJFA 5C3EJ 3GEZA 3HTSB 5M5YJ 2L7ZA 4JKVA 3ECOA 2NRAC 1I6XA 5CB1A 2L6FA 3O8GA 4F92B 4B1RA 1NU9C 5HLTA 5DS5A 2PFOA 4MQVA 5BQHA 3JPOA 1F9NA 1QQ3A 2KT0A 2NNYA 4NC8A 3RZDJ 5D91A 4I7HA 4D4XA 3S1NJ 3GVAA 4WCWA 1OR2A 4MNUA 4P6IC 2A6EF 3BTCA 1J8YF 5GAGJ 2ZSIB 4CDVA 4WQLA 1ZQJA 2QM3A 4NC6A 1YLQA 2IOQA 5K0IA 4A69C 3PNCA 1G4US 4M9JA 3EETA 1SD7A 1T6UA 2ZXWC 9ICFA 3Q5FA 2ISZA 1VJ7A 3A4CA 2KGOA 1S7EA 1VQ9I 2CDQA 3X1OA 1IDYA 1NK3P 3B0UX 1P4WA 4UD5A 1VI0A 1OCCH 5HS9A 1E3PA 3J7AY 3RIRA 1LI7A 2E5ZA 4QDLA 3FHDA 2K4BA 3PUFA 4W8KA 4XLFA 3FISA 3S17J 8ICEA 1ZG3A 2EQRA 3GM1A 4JWMA 1KA8A 3K69A 4LD5A 5L0IA 2KJCA 1HW2A 4PHEA 4AVPA 2R03A 1LFBA 3H3ZA 2Z33A 5HC9A 1ZQIA 3JT1A 3DV8A 2DW4A 4PDKA 3HNKA 3CUOA 1BZ4A 2P7VB 2RNGA 2EFNA 2GAQA 3FVYA 4UXNA 4AUXA 1ZH5A 2RN7A 1XZQA 2VQCA 3FK7A 4B3XA 1WSUA 4Y15A 2A0UA 5JTGA 3WTZA 1TWAA 1FEXA 4BE2A 4OIQF 1R36A 1OYWA 3OR2C 3JCUQ 1OCRH 5HDGA 3GTJJ 2O9XA 3ZG1A 2XHKA 4I1MA 2WAEA 4ONSA 3AG1C 4S3NA 2H8AA 2L02A 3TQOA 5DLJA 5ILSA 3JYYA 4KLOA 2HSBA 1VQ4I 3TGNA 2R5YB 5FJ8J 2H8RA 4EJUA 2M0MA 4GGGA 1FP1D 2L9SA 4YT5A 3UGPA 3V5YA 4MFCA 1R89A 5GTIC 4RQ3A 4H0EA 2KIMA 1FWZA 3M8JA 2DI3A 3REOA 3BZCA 2JA7J 3QAHA 4KJZA 1YYJA 2VE8A 4NC7A 4N4NB 4HNVA 2GXBA 3ONQA 3TDUC 3ERED 1R58A 4UBCA 1NG6A 1UG0A 2DQLA 2VJJA 1TV9A 4NLZA 8ICYA 1DU0A 2W25A 1ZQOA 1ZHWA 4XRHA 3KYDB 2Y0MA 4UB2A 1XSDA 3ZR8X 3U1KA 5FD6A 2F22A 1LUJB 3OYIA 2WBMA 2XL8A 2J0XA 5A69A 1K83J 3SJMA 1ZQEA 2H1LA 4UB4A 1GV2A 4FAPB 3NWSA 4CDAA 2R7SA 2V1NA 3ER8C 2OUMA 4EJOA 3HDDA 4IHWA 3NARA 5A6KA 1BBHA 3C2LA 2KLOA 2MC4A 2NS8A 1TTYA 2HOSA 3K4KA 3FXHA 2DYSH 3IQTA 2TDXA 1S6LA 5JI6A 3H1CA 4WBYA 1WN0A 1TNSA 5KYYA 2X1CA 1IRFA 3AL0C 3JRBA 3O10A 5FLXZ 2B0HA 1QA6A 1BR2A 1G2HA 3MYFA 3OS2A 4L6RA 3ROUA 2I9GA 1D3YA 2YS9A 3DE8A 1XGOA 3G3ZA 2IJLA 1J75A 2HVRA 1JJ8C 5IT9K 3UXPA 1Y6DA 1X2NA 3W8HA 2QVOA 4AT9A 4NKUA 2AXTC 2X6WA 3ABMC 2HYFA 2KDOA 2XAGA 3I4PA 2LBFA 4AE4A 4YN4A 4RM3A 3EH1A 2GLOA 3OSFA 3F6VA 5E79C 5CA7A 3MZHA 2EPOA 3RVZA 4RT2A 3Q6NA 1V55H 2RNJA 1HQCA 4PCQA 2VH3A 3EG9A 1HUZA 2HTJA 2J9VA 3L9DA 5FFXA 2ZFWA 2R7ZJ 2O61A 1P6RA 1TKNA 2K9MA 4M9NA 2Q2EB 2GA1A 3S16J 4BUPA 2IUBA 1ZGAA 3QU3A 1YW7A 3HSRA 3OIQA 4A3BJ 2QTVA 1VQKI 3K4BA 1WJBA 1DOVA 2J9UA 5HR9A 3NQOA 1IN7A 1JHFA 2JQ7A 2EIKC 3L8IA 5COGA 1ZG5A 3LQCB 4YELA 1O3UA 2EWRA 1X3WB 4KT6A 2ZXWH 3M1CB 5T1DB 3TOAA 4QZDA 2WZGA 2B63J 5IP9J 1IXSB 1TWHJ 3R6SA 5EGOB 2TRTA 3B0XA 2L01A 3F6OA 4W1UA 5J1UA 3ZQHA 4FX4A 4I2OA 2VI6A 1OKKA 3PDMP 4BEMJ 4U0YA 1SFEA 3E5QA 2EFOA 3RCOA 2LKXA 2A1DD 5E2QA 5DKWA 4YFKF 4HX0A 1WH7A 4YMMA 4Y4RA 1K78A 3P5JA 5KYNA 3HNJA 3AG3H 2K40A 4BJ5C 2Y69H 2WAQN 3LFUA 1G4DA 4I2DA 2CO5A 3DF8A 2BW3A 1OW8A 1VOMA 3F22A 3MBGA 3OYCA 1SF8A 4LLNA 2L6HA 1E2XA 1E85A 3AQNA 2H7VC 4E4HA 4BJ1A 1SVMA 3S3MA 3PIOF 3W6VA 3ERCC 3CCQI 1UCRA 5EHHA 4G7OF 4IRIA 3F23A 3S27A 1FOYA 4MFEA 3HOUJ 1Z63A 3VOEA 4EWCA 4K9BA 2PMZN 3WGHA 4KMUX 4S04A 3DBLB 1ZQTA 2MH9A 1S9HA 5EG0B 2JT1A 4IARA 1S05A 4E0HA 4FH5A 2OAZA 2OC6A 2UUZA 2B9SA 1HC8A 3B0PA 5ERIA 1LVAA 5CFTA 1MSFC 4LOCA 1TVAA 4XKVA 2ZH2A 2OV7A 3V8LA 4CSAA 4FH3A 4I2BA 4GCVA 4BQNA 2LCHA 2ZH7A 1CGNA 3I4MJ 3H39A 5CP2A 5E3CA 3ASOH 3FOOA 1VQ8I 3GODA 1W5CC 3KP3A 3PMNA 1FY7A 2M7AA 2NAZA 2NUPA 3C2GA 4OAHA 3M15A 1NU7D 2DT5A 5HRIA 2WA0A 4UV8A 2BY3A 2EH3A 4WJ0A 1O3TA 1DQUA 2DT6A 3OWGA 2CH0A 1Z6RA 3H2UA 4L9TA 1O7LA 2DFIA 5LFAA 4BKXA 1J59A 1XSNA 2IT0A 5CI8A 4R63A 1ETWA 2RKHA 4K8VA 1JKOC 4TUSA 2LK2A 5AIQA 2DQRA 4JC7A 1DGWY 4LFUA 4J32B 3LQRA 3R7CA 3PNVA 4F93B 5GPGB 4M9SA 3LAJA 4U5HA 1YAUO 4FHPA 1I27A 4RLFA 9ICBA 4YMOA 2LD6A 3K70C 5BOXA 5E8IA 1FTSA 3RKOF 3L00A 3BDDA 2DPDA 3JRIA 2ZKZA 3K1IC 2AWYA 5KYXB 2E2JJ 4EBBA 5HSWA 3PSIA 4KLUA 1JUPA 1S3JA 3CJRB 3DFGA 2EZHA 4LEYA 1XCBA 3PSFA 4WQKA 2MA3A 1BN5A 3F21A 3KYJA 3QW1A 4OD4A 2IXOA 4WXHA 4LB5A 3HOTA 1HKTA 5B3PA 1HSJA 3K1MA 4KIGA 3CMEI 5FROA 1OCTC 2FAPB 3A9CA 3JPQA 5DEDA 5CJ9A 2OJQA 1ETQA 4TUPA 4JE9A 2CRGA 4IRGA 3LA3A 3SYNA 3PHF2 3GEIA 3EGXA 2CUFA 2XV4S 3LA7A 4EGWA 4PJJA 4DZJA 2P5KA 3DTIA 2K7LA 3C7JA 4HPQA 4I0BA 3TO6A 2E7WA 4A5MA 3N05A 1VYIA 1NFOA 3M7GA 5L0CA 1GVJA 3K1HA 5BOLA 4Z9JA 3L2VA 1KTMA 2TMVP 3S84A 1BI1A 4MLOA 3RJHA 3QPTA 3VYWA 1B4AA 2L3DA 5B1BC 2MLGA 2G62A 2P81A 1ERDA 3V7JA 1A5JA 3DTKA 1BW5A 1W7PA 3FBIB 1V5GA 2M87A 2M64A 2BOLA 3MBYA 2Y30A 1O87A 1M1EB 2JN6A 3WFPA 3LLIA 4LK1F 2MG4A 1APLC 3AOUA 1XDSA 3DU6A 2BCRA 4MTEA 4EEBA 2ZC2A 3TW7A 2FD5A 4Z6DA 2DCEA 2HTSA 3K2ZA 3V42A 1ZGJA 1O3QA 1T2KA 2WL8A 4NCQA 2VJ4A 3R0JA 4I0AA 3S29A 2H8WA 2I8BA 4XL9A 2LP0A 3V7LA 5H6RA 2BE5F 4GXIA 5D8LB 3HX0A 4IOAF 5EEHA 2EPMX 1SFUA 2HQRA 4ZDOA 2X85A 3H35A 2YZSA 2HKXA 4NTFA 2EIMH 2EZKA 3S3OA 1OW7A 2ETSA 2HMZA 4RS8A 1PYVA 4A2UA 5J8CA 4RBNA 3B29A 5DM7F 2CYYA 3EPZA 3GCMA 2KYHA 2VBYA 2PX3A 2IBFA 4J7YA 2H7BA 2WY8Q 3FDYA 3PJRA 4RWQA 2LYCA 2EPNA 2LLKA 2CV1A 1W36D 1KEJA 4LVSA 3MKWB 4NXXA 1K61A 4W97A 4J30B 3D5LA 2B0JA 3S90A 2OF7A 4CICA 1PD1A 3FXRA 1NG7A 1KYWA 1S7AA 4JP0A 4M3BA 1L3LA 3OOUA 2M2UA 3BR3A 5IOYA 1OR3A 4F5NA 5IYDJ 4M72A 2ZB9A 4QSHA 4Q5SF 2OQMA 5D4SA 4XTKA 7ICUA 5EEGA 3GLLA 3T9OA 4LIVA 4WXCA 2CQNA 3P7NA 2KIFA 2ZXOA 2JVHA 2NG1A 3WAQA 2RAEA 4IHSA 9ICQA 3BCAA 1FSEA 3CQZA 1QNTA 3I59B 3QZCA 2L5QA 2VB6A 3KH2A 1U9NA 2V4JC 3DLLF 1YJ9I 5L3CA 5CQEA 5L3BA 1PD0A 2DR5A 3LNMB 1SFOJ 4ENNA 1U3EM 4NC3A 2JUCA 1ON2A 3SYTA 2F4MB 2HEOA 3NRVA 4RB0A 4HFFB 2XLDA 1A6QA 4CO8A 4XEVA 1FX7A 1FLIA 5FB2A 2R7XA 3MDCA 4KLHA 1EI7A 3FXOA 1B8IA 1X3ZB 3DM9B 4X4OA 4OMZA 3JRCA 1ZGWA 2KZGA 2Q8KA 2LY2A 4H4KC 1A7VA 1XSXA 1B9NA 2LSOA 2WADA 1GQAA 4L18B 3G1MA 3R60A 1BPDA 5CR0A 3OVSA 4L9VA 5JS5A 4LLGF 1NK2P 3GTLJ 2X6YA 2GFHA 4LLEA 4YMNA 5TZVA 2J7PA 2Z16A 1OR7A 1LEBA 3KZYA 4CXFA 1HLVA 1IG7A 4CS9A 4RT3A 4B09A 4EBKA 2L7AA 4FETA 5CWRA 2EV5A 1SYQA 1A35A 3H9GA 4AD9A 5DS9A 1V55C 8ICNA 4O79A 2KISA 5J2FA 4IHYA 2FSWA 1JQRA 1G3TA 2XPVA 1YS7A 4HQMA 2XF5A 3MVPA 3NMIA 2HVQA 1L0OC 1APCA 3TMOA 3TOBA 1HF0A 1OCPA 4QZGA 2Q7RA 5DTDA 3WE3A 1Q78A 4IG8A 5HLIA 2BBYA 2JTVA 3HOYJ 4X5VA 2MLKA 2BY1A 2OCEA 2KQ9A 2XSEA 4O69A 1VQPI 4I6ZA 4YCXA 3JTGA 2VL8A 2ZXHA 1ORJA 4IQ4A 3SXKA 1OYIA 2IEKA 1Q0DA 3MCRA 1RKEB 3S28A 1W4MA 1ZRDA 4XUSA 1K05A 3KEOA 5HS7A 1KQ0A 8ICXA 3X2QH 1YX5A 4YG2F 4O6YA 3HZJA 1OCCC 1JAFA 2DYSC 3BTJA 5J29A 1E83A 2PJRA 4NXWA 2IPQX 1SC7A 2DO7A 1V4AA 3ASOC 2OD5A 3MN2A 4A3LJ 1ZREA 4RWNA 4RD9A 2HXOA 2KIUA 2CV0A 5HLHA 4FCYA 1YVIA 3HW8A 4C7OA 4BQAA 1Q0KA 5IY5H 2HVSA 1T39A 8ICOA 3GX4X 2FA5A 4DVZA 2MABA 2VQHA 2ME6A 4XM3A 5FKNA 5HNHA 4BHBA 5L3GA 2DRBA 2XRNA 4AYBN 1ZQXA 1Y56A 1TWCA 4WC4A 3OR1C 1YIJI 3COAC 5F6FA 4KITB 1JI8A 3JSEO 3HM5A 2IA2A 2R7FA 3M1CA 3QYFA 5KAFC 4E17A 1E84A 5KCMA 3I54A 1Z3IX 1YARO 1R4TA 2ZHAA 3T5XA 2PFDA 1TT5B 4L0ZB 1LDDA 5HRDA 1ETOA 2VQLA 4D1QA 4ZTJA 2CMPA 1X58A 3RQIA 3SP1A 3L2CA 3K1PA 2K02A 3LSTA 4IQVA 2QUPA 2KQRA 1A04A 4R79A 7ICLA 3VSLA 2BXZA 1RI7A 3E1SA 1C03A 1LIHA 3LEVA 2CGEA 4U9DA 2IW5A 5ILUA 1OPCA 4EJTA 4I44A 3E5XA 5GADJ 9ICHA 2VKHA 1LS4A 5JLXA 3A03A 3AGTA 5LGUA 3AJMA 1BIAA 2EPFA 4BHPA 2HHPA 1G6NA 4KNYA 3RW0A 2KMUA 1XB4A 3K0LA 3GFIA 3K1IA 2DBBA 2LBFB 2BE3A 4DRHB 1ZW2A 3VYRB 2BPCA 3RH4A 4HNTA 1LE2A 2E2IJ 4PGGA 5B3IA 2IGMA 3WTSC 4I2AA 4NLKA 1R71A 2BPFA 3SXMA 1SMYF 2XLWA 1IO2A 2ELJA 3CJTB 9ICWA 3HLZA 1S29A 1ZVZA 4PACA 3N4MA 4ZYDA 4QZIA 3V7SA 2VXZA 2FMYA 2M2EA 1I50J 2A05A 2ZFUA 5IYCJ 4ENJA 3DI5A 3K10A 2HDDA 2Q9CA 4MTFA 5DV5A 1CGME 1HMOA 1J9IA 4I0UA 2M2WA 4KLJA 5EYRA 2CYDA 4BQOA 5CJ7A 4G9YA 2L6GA 2F6CA 2EPKX 2XGDA 3LWFA 3DWLE 4IRHA 3JRDA 4MVZA 1XGMA 1VTNC 9ANTA 2BV6A 1O7FA 3ZPLA 3IH4A 3QP5A 4BBRJ 1D5VA 1UG7A 1L3PA 4DJ9A 5EOZA 2IYLD 4C3BA 7ICOA 1YYVA 4EM1A 3ZIBA 2DA4A 4D4NA 4Z6YA 2E36A 4ZYEA 3M07A 1FTZA 4IHVA 1TLHB 1K4TA 3SXZA 3U5SA 3DMDA 3LS1A 1ULYA 4I2CA 2IP2A 2KSFA 4NUBA 3K4CA 2LC2A 1X2MA 1EKYA 1U8BA 2FBIA 2P61A 5EG0A 3S14J 2YUSA 1Q0MA 2DR9A 2WB7A 1YHQI 1JUSA 2MW8A 2Y0SA 4XLHA 4KM5A 1MQ2A 3BQYA 4EMSA 3CQZJ 2K27A 2ICWG 3A02A 2VKEA 3QWLA 2LREA 1MD0A 4CHUA 4MIMA 2XS8A 2AP3A 4YK5A 5DBCA 2NXNB 2WTEA 2EA2A 1SEUA 3CC2I 1GPJA 2LH9A 2HU9A 3HGYA 3IC7A 4GO1A 1IUFA 3RH3A 2O5AA 3RZOJ 4K4GA 1U78A 5IPAA 1BC7C 2NRKA 4KLIA 2G7HA 2FMQA 2Z2SB 2WVNA 2B51A 2ZH5A 2ESHA 2EPLX 3ZRGA 2JSCA 2JA6J 4IEJA 2VJ5A 3E0JB 2D1VA 4LITA 2CG4A 4UAZA 2HQNA 1UHMA 5K5OA 2PF4E 2Y3HA 3BR1A 2KFDA 3EUHA 1QZXA 3HJ4A 1ZKGA 2F4IA 2HPMA 1RPLA 1Z6AA 2IHMA 4L5JA 4WOYA 1UEUA 1JGGA 4OIPF 3C63A 3K9TA 5C4JJ 3LA2A 3K4MA 3OL3A 3UGOA 2PQ8A 8ICZA 3B71A 1VQOI 1WOTA 1ZQUA 2UUIA 4P9TA 4NY8A 1MSEC 3J80K 4G6DA 4KBLA 2ZH4A 4Z9IA 3HJ1A 3RQGA 3QVZA 4M04A 3LSHA 1FBSA 5JLWA 5HDKA 1TWGJ 3GLXA 8ICVA 4J7TA 5DD8A 5BOMA 3CF5F 4RPZA 1R6RA 4N4OB 4JEAA 2FU4A 1JTYA 5CPRB 1ZQBA 1IN6A 2BC5A 4OAGA 2DA2A 3HRSA 4HEA2 3PO3J 4RAZA 4EKWA 1I5ZA 3B6AA 5J2EA 4DOAA 5EJCA 2IS1A 1Q0FA 2DOEA 1NOMA 4QPOA 3UPSA 4U5DE 5E1ZB 1JRAA 1BBYA 2QKLB 3J81Z 4YD1A 4RA2A 3OV8A 3TKYA 4FHVA 8ICMA 2L54A 1SFKA 4K98A 1WJFA 3H5AA 5HVQC 3JRFA 3H36A 3GTMJ 4A3CJ 3I5QA 1T0FA 1FJLA 3ZQGA 4G78A 1C02A 1PP8F 1NO5A 2XRLA 1OCOC 2Y9ZA 2Z15A 5EK0A 1SVOA 4N06A 3H65A 4WC0A 4X0GA 3KCCA 5JT4A 1IAWA 4R64A 5LBQA 4C3IJ 4CDYA 3U0CA 4FHWA 4EVIA 1K4SA 1NSGB 3GWLA 4MO7A 3TOLA 3H38A 3GDXA 4GEHA 4HX4A 2OBPA 4B47A 4ANJA 3RSNA 2FGYA 3B9QA 5KYYB 2R7DA 1Y6IA 1EH6A 3ESWB 4WC2A 2BEOA 3E97A 2JA5J 2VOOA 3C8GA 2R7VA 1RKTA 2Z9OA 1ZQQA 4KI2A 1M2OA 3GMEA 5K7HA 2XXAA 5FKOA 3IUOA 1ZU5A 1ZYRF 2X6XA 1BPXA 5CVUA 2Y31A 3SEZA 5F0HA 1XN7A 2WV1A 4ZYHA 1I4YA 4HDUA 1A36A 3HBLA 4M3GA 5HRGA 4BY1J 2QSHX 2KL4A 4HSRA 2LOOA 1ORYA 4RDUA 2FOKA 2L7KA 4C3HJ 4ZZLA 4YJWA 3E6BA 3J80Z 5E33A 4BG0A 2QQ8A 2VKVA 1RC9A 3ZQIA 4EQQA 2K9LA 1Z91A 3RI4A 4LJZF 5LD2C 3P9CA 2DK5A 2OCCC 1OCZH 2MYSA 4P9UA 3QPSA 1T6IA 2WC2A 2M4EA 2YLGA 2L7MP 3SDBA 4PK4A 2R7WA 3OA1A 8ICUA 2RD9A 2ZNZA 4HZFA 5AIPA 3F0CA 5A2QZ 3HL2A 3QRFF 2BCSA 4DXWA 5BS6A 2VANA 2M8EA 4LMYA 4KUMA 1M2VA 1VFGA 1G8XA 4IRUA 2W82A 4NBQA 4NQFA 1UELB 3ZQFA 4XOTA 2E2HJ 4CYDA 3S9OA 4MW3A 4UBBA 2PFBA 1H0MA 1ZHFA 8ICGA 1Z1DA 4A3IJ 2KKOA 9ICSA 3S1RJ 3L2WA 3ZQVA 1Z6TA 4TUQA 2CCYA 2FF4A 3K7AJ 2XAFA 1F4KA 1N78A 2XLMA 4JCHA 3BJ6A 3HPGA 2W57A 1D8JA 4E7JA 3S2HJ 2PLYA 1PJRA 5BPCA 5F5HA 3R4KA 2A6TA 3T8RA 1EH8A 3KPHA 4J00A 1KDHA 2AVKA 8ICLA 3JSZA 2NPUA 4ITVA 1K6YA 3KIOA 1BR1A 4CS8A 3IPMO 4PPXA 2QSGX 2XAHA 4DZPA 3HKZA 4LDRA 4E18A 5F2VO 3VAYA 4MGRA 4RAFA 4E80A 5J47A 3OUYA 4UUSA 5GPAA 2CWEA 4B4CA 2ADUA 5K5QA 1E3HA 1X19A 1V5FA 1TWGA 2J8WA 2PX0A 3DJUB 3ECSA 3VF0A 3PMRA 1BJZA 3ISCA 3UXNA 4NTBA 1SR2A 3VEPA 5CHEA 3MFKA 4AIHA 3AFHA 2QBYB 3TFRA 4O6AA 4OAZA 4BJ6A 3NG1A 5E1WA 3LFKA 1MQVA 3DZAA 2HQAA 2WB1A 2OTLI 4MTDA 3HRMA 4XLNF 3KZIC 2VCAA 3GTKJ 5BPDA 2W84A 2VIXA 2WV0A 5F27A 1RJ9B 3ELKA 1XZPA 4U0WA 2WVQA 1U8RA 3LS0A 4OU0A 2DPUA 1YLMA 4BL0B 4FISA 4PHPA 1R8AA 2P0WA 3OVBA 2X9DA 2Z3YA 5J6XA 5J2DA 3KZZA 4MF8A 1KU9A 1KYZA 2H6CA 3U21A 4M2YA 4RDAA 3CDLA 1TP4A 2V6CA 2PJRB 2E19A 2FMSA 2Y39A 5E3MA 1WJDA 8ICBA 3S2DJ 1QHHD 4PGXA 4MF2A 1FFTC 9ICOA 2OOCA 4IQTA 1YZAA 3N97A 2ZMEC 3M4CA 3IWZA 4UHTA 1HKQA 5FD5A 2UZKA 3RYRA 2K3FA 2RV8A 4R66A 3ISDA 1R5HA 4OIRF 2ISPA 2CGPA 2DGJA 4BEJA 2CQXA 1YI2I 1WKMA 3S0XA 3SXYA 1GHCA 1I6HJ 2MH2A 3FXLA 1YS6A 3VFZA 1ZRCA 5CI9A 3NWIA 2HZ8A 5DBAA 4XKCA 3C2MA 2EFWA 8ICTA 2OZ6A 1RETA 1V54H 5LHIA 4A2NB 1TWFJ 2HI3A 2L4MA 3OYNA 3KP4A 4RQ0A 2DA7A 2PI0A 2L7FP 8ICKA 2LY9A 1WVRA 3S2WA 1VTMP 3D5SC 5CFSA 3ISBA 1REPC 2DVIA 1EF4A 1JMSA 5D6FA 4U5BE 4EBJA 3EHMA 1VQLI 5JVEA 3FF5A 2VBWA 2WY7Q 3QPHA 1G3YA 1HUOA 3U1DA 3CLQA 2HN1A 5GAEJ 2ZBKA 3F72A 1ZJNA 9ICAA 5D46A 1JMWA 2HDCA 1ZZPA 4PJMA 2XLEA 2M45A 2VC1A 3H5RA 2QEXI 3ABLC 1MQ3A 3K6GA 4C3JJ 3A11A 4B43A 4IF4A 2XAUA 3V5XA 3FX3A 2HYJA 2DYRC 1UHWA 3BP8A 1GXPA 4FE7A 2AQFA 1R4MB 3KLNA 4WGYA 4AVZA 4M6YA 3K33A 2J5PA 1B8IB 5C4XJ 1ZHYA 1P7IA 3EJNA 2BBJA 1JN3A 1RR8C 3BR0A 1ZHXA 3RJJA 1ZLKA 2CQ7A 2XSDC 3DM5A 3CUQC 4WC5A 1HBXG 3F8FA 1X1AA 2OPTA 4II3A 3T1BA 2DA1A 3CCRI 3FXUA 2AXLA 2E87A 5J0PA 3T4RA 2L9RA 2P6SA 2H27A 1MIWA 3JPSA 3T8TA 2HSQA 4I3MA 2D1HA 1TFKB 1HA8A 3EH2A 3RYLA 1YJWI 4M9XA 3A0BC 2BZTA 1XX5A 1LFPA 4JLZA 2HS5A 1S5LC 3DPUA 3ZSUA 2Q9BA 4WX9A 4ATBA 1XGSA 4PSXA 1QSPA 2K9SA 4AIJA 7ICQA 2V9VA 2MD5A 3HYIA 3FZVA 4XLEA 5E18F 2Y9YA 1U6GA 1TWCJ 3A01B 1B72A 5D5XB 4BJTA 3CCUI 2XIGA 2R7UA 1FT9A 4KN7X 3M79A 1ZQCA 3R2PA 1FYMA 2EINC 5J4YA 1F5TA 2RFFA 2EIJH 4CCJA 2E7XA 4WC6A 4MFDA 5D5UB 3EDPA 3BZKA 5FGMA 3ZCOA 1YJGA 1Y1WJ 4DYQA 4HF0A 3OSGA 2MC3A 3HOVJ 3GORA 1YOVB 3FDQA 3V7CA 4UUVA 3ECHA 2E71A 1YO5C 4K4IA 3OYKA 1J09A 1FIPA 4BQQA 3VDXA 4N9IA 1QRYA 2PN6A 4NM2A 3GUDA 4UAYA 3WGGA 3T0YA 1AKHA 4WABA 2VN2A 2BCVA 1V5EA 2E1OA 2VBZA 2EZIA 5E3LA 1LQ1A 3M9AA 4MFFA 2IGKA 2R05A 3MYIA 3FHNA 1Y4CA 3V5ZA 5EZGA 4UDVA 4B3AA 4AT7A 4NB5A 2FNAA 5CVVA 3J81K 1N25A 2OTJI 2ZH6A 2COMA 2HWVA 3ERMA 4QTRA 3I5PA 2CW7A 3U9MA 2CNWD 1RKWA 4XPWA 2FOWA 1HW5A 4HBLA 2XPWA 1R1VA 2JVGA 2D4UA 1VMAA 3NYMA 4IQWA 3LSRA 4KLTA 4YFNF 4QZ9A 1ZQRA 5IINA 5FCLA 3H9QA 3IQ5A 2F5DA 1EV7A 2QGUA 5FO5A 1LE8B 3HNLA 1OJLA 4XKBA 3H37A 5B1AH 4A3GJ 1HE9A 1O57A 1HDDC 1OXBA 1FIAA 4M74A 4XLAA 2KHMA 5IIJA 2DN0A 4A0XA 2A5WA 2WVOA 3KKBA 2D2WA 1RKCA 1XGNA 1NTCA 1U6HA 1ZQZA 2IA1A 2MGQA 2ZXRA 5BNGA 4XNFA 1HOMA 1PX5A 2CU7A 1FAPB 4I01A 2VKDA 1DUXC 4XEFA 2R7RA 2QYOA 3KYLA 3FOPA 2BPGA 1MNDA 4I02A 4KLQA 3KP6A 1IW7F 3BTIA 4ENKA 2E35A 1ZQLA 2ZJQF 5B5EC 3ZP5A 1T08B 3AG2C 4NTAA 5L0HA 3O8HA 2PMZA 1Y8QB 3FMRA 7ICJA 1MNEA 1Y0NA 1V3FA 2R7TA 1MIYA 2XGCA 3MLGA 1XDUA 2JMWA 1LS1A 4EV6A 3AUOA 2GAFD 1VK5A 3LL7A 4JWNA 3RJIA 3ITFA 2LQGA 2JA2A 4KISA 3KYIA 1X1BA 2QENA 4UNOA 4XKWA 3RPUA 3G4SI 4A12A 1KQ8A 1Y39A 1RIOH 4EJWA 4P2HA 1W5TA 3G2BA 2D5VA 4XJEA 2BBHA 2F5FA 1IDZA 8ICIA 2HOTA 4MFAA 1MDMA 4X4RA 3HIYA 2A61A 5TRDA 2K85A 1WTYA 4I99C 4JEBA 2I10A 1N77A 4CGZA 1QKRA 2GA9D 1TFWA 4H54A 4N6CA 1VLTA 4PFPA 4D9JA 3ISPA 4A3JJ 2HJMA 3H9JA 2IXPA 2GIZA 3OWTA 3HOXJ 4I29A 1T6SA 4M3FA 3JSOA 1JPJA 3KLOA 2VLAA 1IZMA 1XMKA 2EA4A 5D4RA 5TGTA 2F48A 3MDAA 3MWMA 4XQ8A 3SZTA 1GV5A 1ZW3A 2OU2A 2OU6A 3TO7A 5FFZA 4EGZA 4O9MA 1RKEA 2FQ3A 1BI2A 5HS8A 4HLYA 2ZXJA 3TP3A 2RGVA 4XRFA 4DOZA 3K66A 3JTHA 4CCOA 1H6GA 3HUGB 4I2JA 3SFIA 4A3KJ 4MVRA 3QODA 1ETVA 5L0GA 2Q3TA 2QUFA 7ICKA 4KLEA 5BQIA 2OEVA 3V8JA 2PBEA 5E3OA 1TFYA 3MGIA 3QW0A 3L8JA 2ZHBA 2Q66A 2XRHA 1JPNA 1R1TA 3RVYA 4RGSA 4KICA 4U87A 1AWCA 1ZQ3P 4AL1A 1HSTA 1MNMC 1YRNB 4BDZA 3JPTA 4IOCF 1Z5ZA 1UFMA 4GDFA 4XSZF 4OIOF 4UD4A 5IP6A 3MCZA 5BPIA 3LAPA 4YIIA 4ULWA 2DJNA 3AG2H 2DFFA 4IZZA 4CH7A 4XN0A 3BY6A 4CS9C 3NKEA 3KEQA 1VQMI 4YT4A 4M0AA 5K7ZA 3GFMA 3W3CA 1DDNA 5COFA 2O5RA 3ZOBA 3PFYA 2M8GX 4XQFA 3IV5A 2AWCA 2G3VA 2P1AA 4FTHA 4WC1A 3JPPA 5F1RA 1C0WA 4QZBA 5EGOA 3GTOJ 2XSJC 1ZHTA 4HW0A 4NQWA 1G5ZA 3RJPA 1Q1VA 1YX3A 2HXIA 4PZJA 1A7EA 2G3KA 2GDCA 2DTZA 2NUTA 3TOMA 2XXAB 5DVWA 2ZO4A 5J2JA 9ICEA 1RESA 1U2WA 2QF7A 4U5EE 2V26A 3EF2A 4PJLA 5HHIA 1T0FC 1YW9A 2EV0A 5A2QK 1VQ7I 2JWTA 4YIRX 1MH3A 2CFXA 3LQQA 3DBHB 2BY2A 1ETXA 3LESA 3O55A 5KYUB 4RQ7A 2DOFA 1TT0A 1P4AA 4KIBA 5HRFA 9ICXA 4XQ7A 1ZRFA 4U5FE 3UXOA 4ASNA 1ZJMA 5E8GA 3HHHA 1Z05A 3AL0B 1GS9A 1YA7O 4R32A 1IGNA 2DFHA 2W45A 9ICCA 3TQNA 4N9HA 1B6AA 3P9KA 2DFEA 4XIDA 5DQTA 3HUGA 2GOMA 2HZTA 1GGQA 4M63A 4QI2A 2QSFX 2BL2A 4CX9A 3EUAA 4G12A 4AL0A 4F3QA 1OQYA 3B73A 3NEUA 2ZJRF 3L09A 4L9NA 4BDYA 1TR2A 4O5KA 2E34A 5DS6A 4Z6FA 2RDPA 3TK0A 3OVAA 8ICHA 2DMUA 3FXKA 3EHNA 1S72I 3C18A 3ZQCA 4XBFA 5KK1A 2LFDA 4RMNA 3VB2A 3HWTA 1F5AA 3CO7C 3OY9A 2F5VA 3BPXA 1AHDP 4NHJA 1XSVA 3FMSA 1BA5A 3MFNA 2DA3A 4HEAJ 3G73A 1L7CA 4RPYA 2Z1DA 4E7KA 2ZNYA 3P9IA 2ME0A 1ETYA 3TD7A 2OQRA 4BAYA 2M3AA 2VASA 1MDMB 2JPCA 4IX7A 3W2AA 2EIJC 2QQAA 2J0WA 3QVYA 1OU5A 4WC7A 4I2GA 4I2FA 2UWMA 2YL3A 2LRDA 3NVOA 2HV7A 3U2MA 2OA4A 2DB4A 2GBYA 2HPIA 3AQKA 1IF1A 2ISOA 4E7LA 2H09A 2XLOA 1VFCA 2IBDA 4CS7A 2PFNA 1OYYA 4RWOA 1DPUA 1ZAOA 3M4OJ 5LHGA 1AEPA 1EKEA 4IL6C 1RR7A 4CIHA 3IKVA 2W1OA 3FIWA 1MKMA 3ZQLA 1SD5A 5CQGA 1XWJA 2KK1A 2WZFA 4FO6A 7ICTA 2P4WA 2CSOA 2LNBA 3EPVA 1GDTA 1BL0A 3LJBA 3CZ6A 1IRGA 3D0SA 4UVCA 1Y0UA 3VODA 3ZQ7A 5ILVA 1YJNI 1PUFB 1WHUA 3GWNA 3HTUA 3N0TA 1DP7P 2KRHA 4G6TB 2P66A 1MBGA 1YE9A 3DEUA 3IAS2 3Q3SA 5M5XJ 2V79A 3HSEA 3JR9A 2JX0A 3NRHA 5J2AA 1A31A 2NVUB 4GXJA 5GAHJ 4LIUA 4K99A 3BJAA 1PV3A 4Q48A 3TL4X 3VRCA 2L9VA 1Z67A 2VCCA 4U9EA 4YRVA 9ICKA 2VT2A 3E6DA 4XRMA 4LK0F 2DYRH 3BCBA 5DCMB 2J9WA 4LEZA 9ICLA 3C1DA 5DUIA 1ZQDA 2ELKA 2H7OA 2LDUA 2UXNA 1QZYA 4G6QA 3I55I 5A6BD 2PEXA 2QQBA 3CK6A 1VYKA 4I28A 1XCVA 1U5TA 3CAXA 2HN2A 3N2ZB 4KA4A 4WXDA 3E7LA 3HB9A 3X2QC 4D7NA 2DRAA 2H94A 4KIFA 1ONVA 2AU5A 3NKDA 1WQ2A 3AGUA 2NNNA 1FBUA 3WODF 4ESFA 3PNYA 3GANA 2PMHA 2A07F 3KP2A 1ZARA 1D0XA 3KETA 2C6YA 1WCMJ 2X0LA 3IH3A 1ENHA 1AKHB 4X4QA 5ED4A 2JZYA 5CFUA 2DLLA 4E7HA 2Y69C 1VLSA 1WOLA 5IIKA 3GM3A 2JK3A 4A3MJ 2F5CA 3D5RC 3WFSC 2HQ5A 3J7AO 4X1EA 5TJ5E 3QOEA 3VYTB 3UR3C 3H0GJ 5IP7J 1WJCA 4C2TA 1OISA 2HOAA 2M9HA 4XONA 3HJEA 2MD0A 5E1XA 1X4PA 4LB6B 4LERA 9ICMA 1W1WE 3RPUD 3N24A 1PP7U 1ZQYA 2LVSA 2D5RB 1Z7LA 1LPQA 1JJ6C 3CDIA 3EGDA 3G4XA 5F5FA 1N1CA 3EUHC 2ID1A 4BXXJ 2VPRA 3I64A 2YWAA 4M9LA 2HGCA 4KN4X 2ZD9A 4XPXA 2M0CA 4G94A 4UB3A 5HLGA 3WTYC 4Y52J 7ICGA 4GQHA 1T01A 1HXDA 2YL7A 3HTKC 1J0RA 3AG1H 3I3LA 3CMYA 3NYBA 4OAIZ 2QKMB 5JHUA 2R5ZA 4K0DA 4K96A 2QY9A 3DD7A 1UAAA 5T3WA 3F8BA 4YEJA 1OR7C 3CSKA 5D5VB 3PQJA 2DR8A 3ZQQA 3L9FA 1R8CA 1N75A 4Z2YA 3OS1A 4GRIA 2F4OB 4OOIA 2YU9J 1Z23A 1ZQMA 1ST6A 1JOGA 3BR2A 3JPRA 3CMAI 4FQGA 4LDKA 4F55A 3F3XA 2YX7A 2W9MA 4RWPA 4O6JA 4JBAA 3ZMSA 4CCMA 3WTVC 2KRFA 1BPYA 2DJIA 4CCNA 1YQAA 3BEHA 3NKUA 3GW2A 3GTGJ 1MH4A 4ESBA 3JZ0A 1T33A 4RB3C 3IP4B 3KX2A 4X4SA 3KE2A 5D92A 4RAGA 1BI3A 3OYHA 2GA0A 4JX5A 3AAFA 2DOAA 5E20A 4MKPA 2QZ8A 4MNDA 2J46A 3AG3C 3JAMK 3J7YJ 3GZ5A 3BR6A 4QZEA 1H88C 3L1MA 2HUJA 3CCJI 2FMPA 1Z77A 3CUQA 1Z21A 2QBYA 1ORKA 2ECBA 3JRMO 3DCFA 4JYKA 2STWA 4IQJA 3DKAA 2GXAA 2RQQA 3EUKL 4LGWA 3TW6A 1TQGA 3V7KA 2P6TA 3ASNC 2V6EA 4F5RA 3MD2A 5F04A 1U89A 4UUSB 1MMAA 1CGOA 2R9RB 3IEEA 2ZMEB 4RQ4A 3F8NA 4A6DA 4CDGA 4NDLA 3GYHX 2PG4A 4WWCA 1VF9A 5BQGA 1FMVA 4AX2A 3SDGA 3I53A 5F1JA 2Y3DA 4DOCA 4V2GA 4NM1A 2M2TA 3FHZA 1OKRA 1C17M 4KC9A 1V74B 5ICFA 2XKPA 1B1BA 3FKJA 2WWYA 4X6AJ 2B56A 4ON0A 3SNHA 4DYRA 4MVMA 2G7UA 2LR8A 3H3AA 4D0PA 1T98A 1JHHA 9ICGA 1XTAA 1ZHZA 4MQ9F 2W4BA 1YIOA 2O9LA 1B59A 1FBQA 1AOYA 5JLIA 2ESNA 2W24A 2PXIA 2W7NA 3DLAA 3RDIA 4DRJB 1QPIA 1OCRC 1KU7A 3EZHA 5D62A 4JTAB 3Q0WA 5LLQA 4RQ2A 2VBXA 4XEKA 1QPUA 1R23A 1ACIA 2YX4A 5HRLA 1IN8A 9ICRA 4N0BA 5ICCA 3LK9A 4XR6A 1HW1A 2O1PA 1YZCA 3O3KA 4KT5C 2EIMC 1OLTA 9ICJA 4CCLA 2O8KA 3K7DA 1RJ9A 1YA9A 4JVSA 3SEOA 3W4YA 3VWBA 4KYWA 4GFBA 1MJAA 4LDQA 4O5CA 2LFFA 3IQ6A 5IY5C 5FKMA 3ZMVA 4WK8F 3HRTA 3IAM2 5DDYA 2IAIA 4EJVA 1G4WR 2EFQA 2JSPA 3H5NA 3IH2A 4B48A 4EV0A 1ZQAA 1KQ9A 1KU3A 4A0YA 2IS2A 5J0XA 2VPLA 2QCOA 2BVMA 2IXSA 2Y2ZA 3FM5A 3O6XA 1D1BA 3OYFA 4JJGA 3IWFA 2EV6A 2NVQJ 2VCBA 4YFXF 1T9KA 2OKUA 2Q9AA 2Q2EA 1LNWA 1F43A 5J2IA 2FX0A 2FE3A 1Q79A 3ER9B 1XD7A 1FC3A 2RVCA 3MZYA 1SFXA 2P8TA 5J3LA 2VUMJ 3C5FA 4PUSA 4KMFA 2XL4A 1EA3A 4M6XA 2GQQA 3Q0VA 3TDZC 4R65A 2V7FA 1E17A 4K1OA 5FKLA 2IGOA 2NOGA 3JRTA 2ZXIA 1UFBA 4KDPA 4XWJA 4AE4B 3PL8A 1FOXA 3L2QA 4PJ0C 3H92A 1D1CA 2IXMA 2M2VA 8ICWA 1R00A 3RQ4A 2ID3A 2MSYA 4UVAA 5F64A 5DS4A 4O7GA 4R1HA 5J2HA 1X3UA 1Z9CA 1CGPA 1W7PD 3EFOB 2PNOA 2FBHA 2LKPA 3S3NA 1JKQC 3C8GD 4I27A 2KDZA 3WE2A 2ZJPF 3PMLA 3WU1B 2LY1A 2HOEA 3BG5A 4O3MA 1I5NA 5JVTA 1R9TJ 4YT8A 4FO1A 2DXIA 2A0BA 3JYHA 3RF3A 4K9AA 4DBRA 5CVRA 4J19A 2O6GE 1T56A 5DM6F 5L3VA 1QU3A 2L9JA 2DA6A 5IT3A 1EH7A 3G6EI 2FFHA 3RYPA 3BQZA 3PQKA 1JE8A 5FLVA 4ULVA 4DRIB 4OWRB 1UZCA 2K3PA 4P5OA 4HRIA 1B68A 3NDBB 4QI0A 1VZ0A 3HOSA 5F08A 1BPEA 4HSTA 1WRJA 4AM3A 2EK5A 4MEYF 4F4BA 4U7DA 5IT9Z 3FXJA 4AU7A 2I5UA 4RAYA 1W2WA 2M1BA 2EFPA 3LSGA 4AIKA 2JJ7A 4GYIA 5JR3A 1F1MA 1WGWA 3BWGA 3C62A 4IAOA 4JCZA 2WZLA 2XF7A 3GTQJ 1K79A 2GIVA 2ETHA 1T5OA 1LEAA 2VQGA 1MIVA 2M4GA 4JX6A 3AU2A 3OYAA 2IXNA 5J1RA 3DPTA 4CJOA 3J7ZI 3U3FA 2BY0A 1WPKA 3QYEA 3WU0A 2GOXB 5B3SH 4BACA 5H2FC 2EBIA 2KJBA 3F8MA 3LOCA 4N4WA 3H0DA 5DB6A 4RPXA 1R5ID 3TP0A 3ZMUA 1XC5A 4HFKB 3BR5A 5J0QA 2QWWA 1TQPA 4IO9F 2NVXJ 1R22A 2DTRA 3QPLA 2OEXA 1QZEA 4ABZA 1BDJB 4UB1A 1VQ5I 1YDIA 3HPHA 2ACJA 2JRMA 4E7XA 5L0JA 1R5GA 4CSWA 4EUKB 2AS5F 3WTXC 4ATBB 3OEOA 3ABUA 4DO9A 3DE9A 2PBIA 2JA8J 2W4MA 3ZC4A 5KYXA 3C66A 5J2CA 2DMPA 3G1LA 3MAJA 1WATA 3OYDA 2XL6A 3OYLA 1FYLA 4S05A 4YL0A 3ZDLA 1ZQNA 1LDJA 5LRSA 3WHNA 1A7DA 1ITYA 4QZCA 2CUJA 4M73A 2NUTB 2YLDA 1R7JA 2MHRA 4P55A 1ZELA 5CVJA 3S8PA 1QQIA 4PR9A 2FMLA 1ZN2A 1WASA 2B0LA 1MBKA 1D8KA 3LSMA 1YLFA 5E3AA 2ZH1A 1MBFA 1HKSA 5HRBA 5LEJA 2X1DA 5HODA 3I5UA 3GFLA 2DMTA 2A68F 5DUKA 3VYSB 3L0IA 3DXJF 5AC4A 1QO0D 2V1UA 5HOOA 2GA2A 4FASD 3ZWIA 5L3QA 2IHOA 2FRHA 4LT6A 7ICNA 4AK9A 3B0VC 1RZTA 3JRAA 1LM3B 3M8EA 2Y48A 2W4SA 5LGTA 1QHGA 3CCEI 3ULQB 1UHSA 5J40A 3I4UA 3BG6A 1K04A 5LEKA 1NFNA 3E9VA 3KYCB 2P6VA 1WI3A 2I8DA 4AT8B 4P4MA 1G3SA 3Q0UA 1BIBA 2A69F 4M9ZA 5GP9A 2IRFG 4BYYA 4BJ5A 3MQ0A 3CCYA 2JPBA 5AGFA 3H3VK 4EATA 1FOKA 1HMDA 4OAYA 3FAJA 2FEZA 3BC8A 1JXSA 8ICAA 3HJCA 3UMKA 2M4KA 4XPYA 3UMIA 2IVMA 5DCFA 4II2A 1YTYA 4F5QA 5FKKA 5T3TA 5L3FA 4XLPF 4IHTA 2QE9A 3KMIA 5COMA 4WH5A 2Q0OA 3GFJA 4PGHA 7ICVA 3QOPA 3IKTA 4JRZA 1TNTA 4I2EA 1D0ZA 4E7IA 4RQ5A 3HOZJ 3CMMA 5KAIC 2CNWA 4E0IA 2EWNA 2F2EA 3OYBA 1ETKA 3GZ6A 3I0TA 3SZRA 3C2KA 3VYUB 5D5WB 2A6HF 1O3SA 4KFCA 4A93J 2ZXPA 4Q4ZF 1RUOA 5EEAA 3DWWA 4YL3A 1RZ4A 3UNGC 1WJ5A 4XICA 5EF6A 3HKKA 3T6JA 3BTLA 1USSA 2X51A 2CJJA 2O8XA 4ETSA 2XS1A 2YVKA 2V3CC 2LFBA 2FXAA 2GZWA 2R0QC 1TFOB 3BLYA 3CD6I 4M5DA 1BM9A 4E6KG 3HG9A 3LNQA 3KL4A 3IRQA 1FA0A 4R8HA 4X4NA 1I3QJ 1MJ9A 2KPMA 4FWVA 2PMUA 5HV9A 3EZIA 4JK1X 5DD4A 3GEEA 2HMQA 1IXCA 1BPBA 3WG7H 4BNCA 1UG2A 4HNUA 3SZGA 3QU6A 4DIQA 4MW8A 3ZMTA 1MW7A 4E7SA 1MMSA 4C3DA 5GTHC 4CZCA 1S8NA 5IIOA 3JTLO 4ZDLA 1E86A 3POVA 4MVSA 2MBFA 1QZZA 1IN4A 2COBA 2PFPA 2E1MC 4DNCA 2O3FA 2C04A 5JSLA 2G9WA 1QVUA 3NWTA 4PJNA 3S32A 2GM4A 2BGCA 4Y13A 1EA8A 1SZIA 4MEXF 4U5GA 3C2BA 2IM8A 4C2MJ 2ISYA 1K40A 4CS8C 5L0FA 4QZHA 4KLFA 2V1XA 3K1NA 2LF7A 5IYBJ 1O4XA 4JTDB 4ZJZA 7ICPA 1TBXA 1S7OA 4YL1A 2LG4A 2DDAA 4I76A 4A3FJ 5D6EA 4IJJA 4C7OB 5HRKA 3OUYB 3JAMZ 2FCLA 4QLCU 1XG1A 3DKWA 3Q9SA 4BXUA 5EGYA 4M9GA 4LEVA 4Y7NJ 2G0EA 5JUAA 7ICSA 1M57C 1H8AC 2XLVA 1KU2A 1X1CA 4RM2A 4IXAA 4IVNA 7ICIA 3OMYA 4HV6A 4BJ6C 3Q7GA 4FE4A 1LVKA 3FXMA 5H6QA 4EEFG 5IILA 4BPMA 3E3VA 4NXVA 1TC3C 3AKZA 1SD4A 4U0VA 1A6IA 1MMNA 2PX9A 1G3WA 1FP2A 3AG4H 4P96A 1NHAA 4OAFA 1M2VB 1EJ9A 2F5EA 1YITI 3F47A 4DBQA 1ZQFA 1DPRA 1MBHA 2O7OA 3ZGKA 4X4UA 1U5TC 5FLXK 4AC0A 3ASNH 5D63A 3WTUC 1M6TA 4KNWA 4KB6A 1WJAA 2FQ4A 5CLSA 4LG0B 3RFYA 3DKYA 4PHAA 4LG3A 4RBOA 4XQ1A 1BOBA 3RJEA 3LNRA 3US6A 3I56I 3KP5A 4K7BA 2EILH 1AUEA 1WWPA 4DW6A 4HF2A 3BG9A 3I9V2 3U8VA 4KLMA 3E5UA 5F0FA 2HZDA 2M30A 4MHGA 1HCRA 2AQEA 1OQCA 3CP8A 3CEXA 1LDKB 4XSXF 4FX5A 4OD5A 5DDGA 3B6CA 2XM0A 2B4VA 4FHXA 4JOMA 1DP3A 3NYLA 2IS6A 3CCMI 4DOBA 1Z3XA 2IA0A 3IL2A 3OYGA 2FUG2 2VC0A 3C5GA 3RH6A 3C3WA 2HKOA 3QP6A 2R5YA 3I4NJ 1J8MF 2YSRA 5K7FA 1PVEA 1K78B 1FFHA 3WG7C 5D4BA 2XAJA 2CQKA 4L0YB 3NMKA 3CDHA 2OG2A 4KNVA 4IGGA 3HOWJ 3KEYA 3ABKH 1D5YA 3AQBA 4DVYP 1I1SA 3KFWX 4ENMA 4N7RA 5D49A 4KLGA 1JGSA 1OCOH 5CYVA 1IXRC 1GVDA 3SZPA 4QPQA 1WH5A 4GXOA 4Y17A 1HY5A 4F5PA 4OINF 2DR7A 3DPLC 4DYCA 2YHSA 8ICCA 1R4NB 2LMDA 4S0HB 3B02A 3TFSA 1R1UA 3Q9VA 4HOBA 4BEHA 1O3RA 5H20A 2BHZA 2K4JA 4I09A 2VONA 3FK6A 3C8GB 2KIQA 3HC7A 2R5ZB 3U9GA 3F9KA 4ZYAA 4LEWA 1IJWC 1JTXA 3HSFA 3VPRA 3V4GA 1I39A 4N6HA 1FYKA 4WF2A 3GXOA 5L3EA 2JPUA 4UB6C 1T8IA 2PJPA 4E8FA 2STTA 2KP6A 4K4HA 5B1AC 2CUZA 4ZZDA 4O5EA 4Y3OA 3EG9B 1AA7A 3OYJA 3DU5A 8ICPA 3PO2J 3CCVI 1GT0C 2HKVA 1IV8A 5A6AA 3RQFA 2RQPA 4L5IA 3EGDB 2ECCA 3ABTA 1JKRC 4BBSJ 3V72A 1R8BA 3PIPF 5GPCA 3OS0A 4XK4A 3KP7A 1GM5A 1CPQA 7ICRA 5B1BH 2VE9A 4M71A 1YW8A 2DK8A 3K4LA 1YG2A 3F8CA 4UB5A 2Y3BA 1XPXA 3G4ZA 4KLSA 3O6BB 9ICUA 1MGTA 2FJ1A 3FMQA 1ORSC 1EQ1A 3TEDA 4MTGA 1HDPA 2L2OA 4YT2A 5J0WA 1RPWA 3LEOA 3CESA 2XGXA 3GO5A 3A01A 1B72B 3DAFA 4DGWB 5TISC 1JR8A 3JREA 7ICFA 2DMNA 1VQNI 5KYWB 5J0RA 1ZQPA 4WBZA 2HJ3A 1J5YA 3C8ZA 4XRSA 2HV6A 2KC3A 5L0DA 1IUYA 4F52A 3G50A 3QTHA 1FOWA 4A6EA 3RJKA 2XASA 2NVYJ 1DGRM 4CUGA 7ICMA 1J7KA 3PUBA 2R92J 2QNLA 1Z0XA 3G71I 1R49A 1U5TB 1GLNA 4MVUA 2YEVA 3A2KA 1OKKD 2CW0F 2M7BA 256BA 4KLLA 1JT6A 3EQLF 1CPRA 2WAQA 1LE4A 4FHTA 4PFOA 3PNTA 2X0CA 8ICFA 4ZC3A 2XB0X 2EINH 2XROA 3PCVA 5DCMA 1IV6A 4JIOA 4P4OA 5DB8A 4X4VA 3HEFA 4J01A 4CIPA 1SAUA 1W0TA 4EIYA 2P0NA 3GWZA 4HA8A 1QBJA 4HLXA 1Y8RB 5LHHA 2YLIA 1UB9A 3E6CC 4I1OB 4CJGA 2XPUA 4M47A 4HQEA 2UUHA 3DBRB 2UXXA 5IIIA 2LF8A 3ZMDA 4GYTA 1BI0A 1USTA 1J2XA 1YRNA 5A6BA 3RJFA 5K1YA 4CZZA 4ZLDA 3RPQA 4P9FA 4CBEA 1E3OC 3TJ5A 3V8KA 2R25A 1Z3YA 1V4RA 2M5WA 2XAQA 4EP7A 1H89C 1H7IA 4K2EA 4P4PA 3H3UA 1ZQHA 4LG0A 2BCUA 5CKTA 4GYGA 5HREA 3JRGA 1JT0A 2N8GA 4NNJA 1K6OA 2OJED 3WU2C 1HE1A 1IN5A 2HDWA 3MEXA 1CF7B 3NYJA 4G0HA 1I3AA 3RJGA 3K4JA 4U88A 3BPVA 2BCQA 3S1MJ 2E1MB 3UPQA 4B6IA 4EM2A 2R3SA 1LFUP 2HNHA 2X4HA 3L34A 2VJIA 5FRNA 5CVIA 1LPEA 2XVCA 1T38A 4AWXB 4BH9A 2KW3C 2LSEA 3TJ6A 1OFCX 2Z99A 3RKYA 2UV1A 3CJNA 3LAYA 1X1PA 4B44A 3HNIA 5DQZA 5M3MJ 4A3EJ 2W85A 3L7WA 3RKQA 4HG2A 2L81A 2J45A 2HYGD 1W7PB 1MJBA 4C9YA 2QLZA 3MX3A 1SMTA 2JD3A 5FRMA 1MZBA 2NUPB 2XM4A 5J4VA 1U0BB 1XSPA 3CC7I 5FLMJ 1D1AA 3M8FA 3CTAA 5ICEA 1NG1A 3LSIA 3QQAA 4IB4A 2NSFA 1OXKA 3CCSI 1IRXA 4UV9A 2NOJB 2J7PD 3WFOA 4RLQA 1LKXA 1WI9A 3GF2A 4RQ8A 4RQ6A 5LRRA 1BR4A 1Q0GA 4E7ZA 3EGXB 3BT9A 3A0HC 4BY7J 1CF7A 2GAUA 1VQ6I 2EILC 3AQCA 4QZFA 3WFQE 2Z5UA 1RRJA 1BJAA 1CQTA 2B7EA 3MKYB 5J2KA 4X4TA 3JRHA 3GBGA 1H9GA 1A41A 2I15A 5IOZA 1GXQA 1WZ2A 2DA5A 2DDBA 3SHFA 5F0CA 3BG3A 2DODA 2EIKH 3JW4A 1F36A 3OIOA 4CA0A 4PHDA 3HXLA 2A3SA 1NLXA 1ZG1A 5F28E 5KYUA 2W9YA 3LSPA 4FX0A 1QGPA 2AO9A 1AU7A 4ZYGA 1LI5A 2BW3B 3V7OA 3IRRA 1WGXA 3HGGA 1AVOB 1BOAA 5BUOA 3FWEA 2LKSA 2A5YB 2GWRA 2K5CA 3ML6A 4RB1A 1P9QC 2L4AA 4JZAA 2OCCH 3AQMA 1LE8A 1TQIA 4M3EA 1FPQA 4IPAA 5DB9A 4OMYA 1TW3A 4QWQA 4YIFA 2V9KA 4FHYA 3PHZA 5M3FJ 2R93J 1PDNC 5AC5A 4C30A 1SANA 1W5SA 2X6OA 3BROA 5L3DA 1I1GA 3TBIA 3ABMH 4BE1A 4JW1A 2GWWA 4WCGA 1MIJA 4UVBA 4B8XA 4F91B 3G1OA 2E1CA 2C03A 3GTPJ 2CS3A 4Y33A 4Z9HA 3WHBA 3OV7A 4L5EA 4AT7B 3BRJA 4DJAA 2ZH8A 2AHQA