2NRKA

Crystal structure of conserved protein grpb from enterococcus faecalis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
165
Chain Sequence
IVTEYQPAWVEQFEEEAQALKQILKENCLKVEHIGSTSVPNLAAKPIIDFLVIVEEIEKVDLLQWEFERIGYEYMGEFGLSGRRYLRKGPIKRTHHVHIYQFDNTQEILRHLAFRNYLRENPAIATTYGTLKKQLAQAHPDSIDKYMKDAFIKKIEKEALKKYWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein GrpB
publication title The structure of conserved protein GrpB from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 56
structure length 165
sequence length 167
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04229 GrpB GrpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2nrkA00
4IQUA 3OUYA 4EBJA 2P66A 3WFRE 4IG8A 4NLNA 8ICSA 3K75D 4X4TA 5IILA 4M9GA 4UB3A 4YMMA 1FA0A 2PXIA 4M9LA 5J2GA 4Z6DA 2ZH6A 8ICKA 9ICOA 1V4AA 8ICUA 4QZ9A 9ICPA 4X0BA 3JZ0A 3LQCB 2BE3A 4FHYA 4WC1A 1TFWA 1ZQGA 3OV7A 4UB5A 4UD4A 5J2HA 4M9NA 2BCVA 1KEJA 3H3AA 5J0YA 2ISOA 5J2JA 4PGQA 9ICTA 4JWMA 4QZEA 1YLQA 3AQMA 9ICEA 4FHXA 4MFAA 3C2MA 4EP7A 1ZQEA 4I27A 4P4PA 3H37A 5BOLA 1ZQFA 4UBBA 3UPQA 3UXOA 4O5EA 1ZQQA 2BPGA 8ICOA 3PNCA 3UXPA 3RJEA 3WFSC 4I2CA 4R63A 9ICVA 3OVBA 4WCWA 3OGUA 1BPDA 4NM1A 4JWNA 8ICHA 1F5AA 4KLDA 7ICLA 2FMPA 3C2LA 1MIVA 5IIKA 1BPYA 3RJHA 7ICQA 4R65A 1NOMA 3OUYB 8ICEA 4PHPA 4I2HA 2O5AA 4MF8A 5IINA 1RZTA 5J2AA 9ICQA 4PHAA 2PBEA 1XSNA 5J0TA 9ICSA 5DKWA 3UXNA 1ZQYA 3TFRA 4PPXA 4WBYA 3RH6A 4IQWA 1HUOA 3MDCA 3V7LA 8ICVA 4WC7A 1ZQVA 8ICTA 4P4MA 4PHDA 5J2FA 5DB8A 1JQRA 5DDYA 3RH5A 3JPPA 4F5RA 1Q78A 4NLKA 7ICOA 1UETA 5J2KA 4NM2A 7ICSA 9ICBA 3PMLA 5HHHA 8ICCA 5J0OA 4TUSA 4YD1A 2DVIA 4Z6CA 4XQ7A 7ICKA 4QZIA 4GXKA 4M47A 4KLOA 1ZQDA 9ICKA 4M9JA 1R89A 4WBZA 4KLQA 5DBAA 7ICJA 4E80A 1ZQSA 4O5KA 3WFQE 8ICPA 4X4QA 4AT7A 8ICIA 4XQ8A 7ICRA 4FH5A 8ICFA 2ZHBA 4RT2A 2BPCA 4NXZA 3RJGA 7ICHA 3JPQA 4I28A 4RQ6A 4X4RA 4LT6A 9ICUA 3H39A 4KLFA 1R8CA 1WOTA 1ZQCA 1JN3A 4KLIA 3AU6A 1KNYA 4UAYA 4MFCA 5CWRA 7ICTA 4I2AA 2BCRA 2DRBA 8ICXA 4TUQA 4XRHA 2M2TA 4PHEA 2Q66A 3OVAA 4EBKA 2BCUA 4I29A 9ICMA 4QZ8A 1ZQPA 2PFNA 2HHPA 9ICGA 4WC5A 4FH3A 7ICFA 4RQ5A 4UB2A 5HRGA 5BPCA 2BCQA 4DOCA 2ZH9A 5DECA 4M5DA 3JPRA 3HWTA 1KDHA 5HHIA 2FMQA 4KLSA 2GWSA 3ISCA 1MIYA 4XA5A 5HREA 1ZQRA 2M2UA 3B0YA 2BPFA 4F5NA 4WC3A 5CJ7A 4PH5A 3HX0A 8ICJA 1ZQXA 5BOMA 5HC9A 4M9HA 4F5QA 4DO9A 4AT7B 4F5PA 4KLUA 1ZJNA 2DR9A 4UB4A 5IIOA 1ZQLA 9ICNA 4FHWA 3HIYA 4UB1A 3JPSA 4O5CA 4AT9A 4KLTA 5DEDA 5EOZA 9ICJA 2W9MA 5IIJA 4RWNA 3JPNA 3AUOA 2I9GA 9ICLA 4WC0A 2PFPA 5D4BA 8ICYA 3V7KA 8ICGA 9ICCA 2FMSA 3C66A 3NYBA 5D46A 4NKTA 3RJKA 5F2VO 4KLHA 1R8AA 3UQ2A 2DRAA 2ZH1A 4NY8A 2M2WA 4RQ7A 4UAWA 4I2GA 3WFPA 5IIIA 5CHGA 5J0UA 9ICIA 3C2KA 4IQTA 1Q79A 4QZFA 2DR7A 4F5OA 2NRKA 9ICRA 5J2BA 4Z6FA 8ICLA 4P4OA 2DR5A 4UD5A 5HRBA 3MBYA 7ICGA 3JYYA 2PFQA 1ZQMA 1BPZA 2PFOA 4KLEA 4X4NA 3RJJA 9ICXA 5HRLA 1TFYA 7ICUA 2ZH7A 4NLZA 4R66A 3RJFA 5D49A 4RQ4A 8ICNA 3HJ1A 4GXIA 5J0QA 8ICRA 1UEUA 5HRFA 4RQ1A 7ICIA 2BCSA 1HUZA 4R64A 5J0RA 4M0AA 4I2JA 3AQKA 4AT8A 8ICWA 4AT9B 5HRDA 2ZH4A 4KLJA 5J0SA 4KLLA 4M2YA 3UQ0A 4FHVA 4RWQA 1XSPA 4RPYA 3HW8A 3L9DA 7ICVA 4RPXA 4RPZA 4KLMA 3C5GA 4MF2A 5HR9A 7ICPA 5HRKA 4QZDA 5CR0A 4PGYA 5HRIA 2ID1A 3GDXA 3JPTA 2ZH3A 4I2DA 5J2DA 3WFOA 8ICMA 5J2CA 4DOBA 3TFSA 1XSLA 1PX5A 4K4HA 4GXJA 4RQ8A 4QZBA 5DB7A 4KLGA 1UEVA 8ICBA 3H38A 4X4VA 3AQNA 4DOAA 2IHMA 4RWOA 1ZJMA 4FO6A 8ICZA 4TURA 3ISDA 4WC2A 2ZHAA 4RQ3A 4RQ2A 1ZQKA 5DB6A 1ZQTA 4ATBA 4X5VA 3MGHA 3V72A 4TUPA 5DDMA 1ZQIA 1NO5A 2M2VA 1VFGA 4Z6EA 4NKUA 3LK9A 3UPSA 5IIMA 4IQVA 4YD2A 1ZQJA 4K4GA 2ZH8A 5J0PA 4XUSA 9ICAA 1JMSA 4WC4A 4LZGA 4X4OA 4M04A 5J0WA 1ZQHA 4RT3A 9ICWA 1OU5A 3AQLA 4WC6A 4YN4A 2O1PA 3RJIA 1RPLA 3V7JA 1MQ3A 4AT8B 5CP2A 2ZH5A 2ZH2A 1ZQBA 1VJ7A 4LZDA 4QZHA 1MIWA 2DR8A 4I2EA 1ZQWA 3C5FA 1MQ2A 5HRHA 5J2IA 4X4PA 1BPBA 3MDAA 4QZGA 5J2EA 3ISBA 7ICNA 3HJ4A 7ICMA 4RQ0A 3C18A 4E8FA 5DBBA 5CB1A 1ZQNA 1TV9A 5DB9A 2ISPA 1JAJA 4I2FA 5CA7A 4LVSA 3OVSA 4P2HA 2VANA 3AU2A 4E7XA 1ZQUA 3MGIA 4O9MA 4I2IA 3PMNA 4UAZA 4MFFA 4X4UA 4PGXA 1BPEA 1TVAA 9ICFA 9ICHA 8ICAA 3JPOA 3B0XA 4YCXA 4ATBB 2RFFA 4S3NA 4QZCA 5J29A 4QZAA 1ZQAA 4I2BA 1ZQZA 4X4SA 4RWPA 4UBCA 3RH4A 7ICEA 4K4IA 4YMOA 5DBCA 1R8BA 4YMNA 4X0AA 5TZVA 1BPXA 5J0XA 4FHPA 1ZQOA 8ICQA
chains in the Genus database with same CATH superfamily
4IQUA 3OUYA 4EBJA 2P66A 3WFRE 4IG8A 4NLNA 8ICSA 3K75D 4X4TA 5IILA 4M9GA 4UB3A 4YMMA 1FA0A 2PXIA 4M9LA 5J2GA 4Z6DA 4XJEA 2ZH6A 8ICKA 9ICOA 1V4AA 8ICUA 4QZ9A 9ICPA 4X0BA 3JZ0A 3LQCB 2BE3A 4FHYA 4WC1A 1TFWA 1ZQGA 3OV7A 4UB5A 4UD4A 2HN2A 2B51A 5J2HA 2B56A 4M9NA 4NXTA 2BCVA 1KEJA 3H3AA 5J0YA 2ISOA 5J2JA 4PGQA 9ICTA 4JWMA 4QZEA 1YLQA 3AQMA 9ICEA 4FHXA 4MFAA 3C2MA 4K9BA 4EP7A 1ZQEA 4I27A 4P4PA 4LEZA 3H37A 5BOLA 1ZQFA 4UBBA 3UPQA 3UXOA 4O5EA 1ZQQA 2BPGA 8ICOA 3PNCA 3UXPA 3RJEA 3WFSC 4I2CA 5CFSA 4R63A 5CFTA 9ICVA 4K98A 3OVBA 4WCWA 3OGUA 1BPDA 4NM1A 4JWNA 8ICHA 1F5AA 4KLDA 7ICLA 2FMPA 3C2LA 1MIVA 5IIKA 1BPYA 3RJHA 7ICQA 4R65A 1NOMA 3OUYB 8ICEA 4PHPA 2EWRA 4I2HA 2O5AA 4MF8A 5IINA 1RZTA 4OAIZ 4NXUA 5J2AA 9ICQA 4PHAA 2PBEA 1XSNA 5J0TA 9ICSA 5DKWA 3UXNA 1ZQYA 3TFRA 4PPXA 4WBYA 3RH6A 4IQWA 2GAFD 1HUOA 3MDCA 3V7LA 5D61A 8ICVA 3ER8C 4WC7A 1ZQVA 8ICTA 4P4MA 4PHDA 5J2FA 5DB8A 1JQRA 5DDYA 3RH5A 4K96A 3JPPA 4F5RA 1Q78A 4NLKA 7ICOA 1UETA 5J2KA 4NM2A 7ICSA 9ICBA 3PMLA 5HHHA 8ICCA 1GPJA 5J0OA 4TUSA 4YD1A 2BBHA 2DVIA 4Z6CA 4XQ7A 7ICKA 4QZIA 4GXKA 3PHZA 5CFUA 4M47A 4KLOA 1ZQDA 9ICKA 4M9JA 1R89A 4WBZA 4JLZA 4KLQA 5DBAA 7ICJA 4E80A 4WH5A 1ZQSA 4O5KA 3WFQE 8ICPA 4X4QA 4AT7A 8ICIA 4XQ8A 7ICRA 4FH5A 2B4VA 3OWGA 5D62A 8ICFA 2ZHBA 3ERCC 4RT2A 2BPCA 4NXZA 3RJGA 7ICHA 3JPQA 4EEDA 4I28A 4RQ6A 4X4RA 4LT6A 9ICUA 3H39A 4KLFA 1R8CA 1WOTA 1ZQCA 1JN3A 4KLIA 3AU6A 1KNYA 4UAYA 4MFCA 5CWRA 7ICTA 4EEBA 4I2AA 2BCRA 2DRBA 8ICXA 4TUQA 4XRHA 2M2TA 4PHEA 2Q66A 3OVAA 4EBKA 2BCUA 4I29A 4KB6A 9ICMA 4QZ8A 1ZQPA 2PFNA 4EGWA 2HHPA 9ICGA 4WC5A 4K9AA 4FH3A 7ICFA 4I0UA 4RQ5A 4UB2A 5HRGA 5BPCA 2BCQA 4DOCA 2ZH9A 3NKUA 5DECA 4M5DA 3JPRA 3HWTA 1KDHA 5HHIA 2FMQA 4KLSA 2GWSA 3ISCA 1MIYA 4XA5A 5HREA 1ZQRA 4NXVA 2M2UA 3B0YA 4O67A 2BPFA 4F5NA 4WC3A 5CJ7A 4PH5A 3HX0A 8ICJA 1ZQXA 5BOMA 4OAGA 5HC9A 4M9HA 4F5QA 4DO9A 4AT7B 4F5PA 4KLUA 2FCLA 1ZJNA 2DR9A 4UB4A 5IIOA 4LEYA 1ZQLA 9ICNA 4FHWA 3HIYA 4UB1A 3JPSA 4O5CA 4AT9A 4KLTA 3ER9B 5DEDA 5EOZA 9ICJA 2W9MA 5IIJA 4WOYA 4RWNA 3JPNA 3AUOA 5D63A 2I9GA 9ICLA 4WC0A 2PFPA 5D4BA 4K8VA 8ICYA 3MCRA 3V7KA 8ICGA 9ICCA 2FMSA 3C66A 3NYBA 5D46A 4NKTA 3RJKA 5F2VO 4KLHA 1R8AA 3UQ2A 2DRAA 2ZH1A 4NY8A 2M2WA 4RQ7A 4UAWA 4I2GA 3WFPA 5IIIA 5B3PA 5CHGA 4WQLA 5J0UA 9ICIA 3C2KA 4IQTA 1Q79A 4QZFA 2DR7A 4F5OA 2HN1A 2NRKA 9ICRA 3NVOA 4LEVA 5J2BA 4Z6FA 4NXWA 8ICLA 4P4OA 2DR5A 4UD5A 5HRBA 3MBYA 7ICGA 3JYYA 2PFQA 1ZQMA 1BPZA 2PFOA 4KLEA 4X4NA 3RJJA 9ICXA 5HRLA 4N7RA 1TFYA 7ICUA 2ZH7A 4NLZA 4R66A 3RJFA 5D49A 4RQ4A 8ICNA 3HJ1A 4OAFA 4GXIA 5J0QA 8ICRA 1UEUA 5HRFA 4RQ1A 7ICIA 2BCSA 1HUZA 4R64A 5J0RA 4M0AA 4I2JA 3AQKA 4AT8A 8ICWA 4AT9B 5HRDA 2ZH4A 4KLJA 5J0SA 4KLLA 4M2YA 3UQ0A 4FHVA 4RWQA 1XSPA 4RPYA 3HW8A 3L9DA 7ICVA 4RPXA 3K7DA 4RPZA 4KLMA 2IUBA 3C5GA 4MF2A 5HR9A 4OAHA 7ICPA 5HRKA 4EV6A 4QZDA 5CHEA 5CR0A 4PGYA 5HRIA 2ID1A 3GDXA 4FO1A 3JPTA 2ZH3A 4I2DA 5J2DA 3WFOA 8ICMA 5J2CA 4DOBA 3TFSA 2GA9D 1XSLA 1PX5A 4K4HA 4GXJA 4RQ8A 4QZBA 5DB7A 4KLGA 1UEVA 8ICBA 3H38A 4X4VA 3AQNA 4DOAA 2IHMA 4RWOA 1ZJMA 4FO6A 8ICZA 4NXXA 4TURA 3ISDA 4WC2A 5B3QA 2ZHAA 4RQ3A 4RQ2A 1ZQKA 5DB6A 4WQKA 1ZQTA 4ATBA 4X5VA 3MGHA 3V72A 4TUPA 5DDMA 1ZQIA 1NO5A 2M2VA 1VFGA 4Z6EA 4NKUA 3LK9A 3UPSA 4O6AA 3NWIA 5IIMA 4IQVA 4YD2A 1ZQJA 4K4GA 2ZH8A 5J0PA 4XUSA 9ICAA 1JMSA 3EF2A 4K99A 4MKPA 4WC4A 4LZGA 4X4OA 2IHOA 4M04A 5J0WA 4HX0A 1ZQHA 4RT3A 9ICWA 1OU5A 3AQLA 4WC6A 4YN4A 2O1PA 3RJIA 3JCFA 1RPLA 3V7JA 3CK6A 1MQ3A 4AT8B 5CP2A 2ZH5A 2ZH2A 1ZQBA 1VJ7A 4LZDA 4QZHA 4K97A 1MIWA 2DR8A 4I2EA 1ZQWA 3C5FA 1MQ2A 5HRHA 5JTGA 4LEWA 5J2IA 4X4PA 1BPBA 3MDAA 4QZGA 5J2EA 3ISBA 7ICNA 3HJ4A 7ICMA 4RQ0A 3C18A 4E8FA 5DBBA 5CB1A 1ZQNA 1TV9A 5DB9A 2ISPA 1JAJA 4JLXA 4I2FA 5CA7A 4LVSA 3OVSA 4P2HA 2VANA 3AU2A 4E7XA 1ZQUA 4O68A 3MGIA 4O9MA 4I2IA 3PMNA 4UAZA 4MFFA 4X4UA 4PGXA 1BPEA 1TVAA 9ICFA 9ICHA 8ICAA 3JPOA 3B0XA 4YCXA 4ATBB 2RFFA 4S3NA 4QZCA 5J29A 4QZAA 1ZQAA 4I2BA 1ZQZA 4KM5A 4RWPA 4X4SA 4UBCA 3RH4A 7ICEA 4K4IA 4YMOA 5DBCA 4O69A 1R8BA 4YMNA 4X0AA 5TZVA 2BBJA 1BPXA 5J0XA 4FHPA 1ZQOA 8ICQA
chains in the Genus database with same CATH topology
4IQUA 3OUYA 4EBJA 2P66A 3WFRE 4IG8A 4NLNA 8ICSA 3K75D 4X4TA 5IILA 4M9GA 4UB3A 4YMMA 1FA0A 2PXIA 4M9LA 5J2GA 4Z6DA 2ZH6A 8ICKA 9ICOA 1V4AA 8ICUA 4QZ9A 9ICPA 4X0BA 3JZ0A 3LQCB 2BE3A 4FHYA 4WC1A 1TFWA 1ZQGA 3OV7A 4UB5A 4UD4A 5J2HA 4M9NA 2BCVA 1KEJA 3H3AA 5J0YA 2ISOA 5J2JA 4PGQA 9ICTA 4JWMA 4QZEA 1YLQA 3AQMA 9ICEA 4FHXA 4MFAA 3C2MA 4EP7A 1ZQEA 4I27A 4P4PA 3H37A 5BOLA 1ZQFA 4UBBA 3UPQA 3UXOA 4O5EA 1ZQQA 2BPGA 8ICOA 3PNCA 3UXPA 3RJEA 3WFSC 4I2CA 4R63A 9ICVA 3OVBA 4WCWA 3OGUA 1BPDA 4NM1A 4JWNA 8ICHA 1F5AA 4KLDA 7ICLA 2FMPA 3C2LA 1MIVA 5IIKA 1BPYA 3RJHA 7ICQA 4R65A 1NOMA 3OUYB 8ICEA 4PHPA 4I2HA 2O5AA 4MF8A 5IINA 1RZTA 5J2AA 9ICQA 4PHAA 2PBEA 1XSNA 5J0TA 9ICSA 5DKWA 3UXNA 1ZQYA 3TFRA 4PPXA 4WBYA 3RH6A 4IQWA 1HUOA 3MDCA 3V7LA 8ICVA 4WC7A 1ZQVA 8ICTA 4P4MA 4PHDA 5J2FA 5DB8A 1JQRA 5DDYA 3RH5A 3JPPA 4F5RA 1Q78A 4NLKA 7ICOA 1UETA 5J2KA 4NM2A 7ICSA 9ICBA 3PMLA 5HHHA 8ICCA 5J0OA 4TUSA 4YD1A 2DVIA 4Z6CA 4XQ7A 7ICKA 4QZIA 4GXKA 4M47A 4KLOA 1ZQDA 9ICKA 4M9JA 1R89A 4WBZA 4KLQA 5DBAA 7ICJA 4E80A 1ZQSA 4O5KA 3WFQE 8ICPA 4X4QA 4AT7A 8ICIA 4XQ8A 7ICRA 4FH5A 8ICFA 2ZHBA 4RT2A 2BPCA 4NXZA 3RJGA 7ICHA 3JPQA 4I28A 4RQ6A 4X4RA 4LT6A 9ICUA 3H39A 4KLFA 1R8CA 1WOTA 1ZQCA 1JN3A 4KLIA 3AU6A 1KNYA 4UAYA 4MFCA 5CWRA 7ICTA 4I2AA 2BCRA 2DRBA 8ICXA 4TUQA 4XRHA 2M2TA 4PHEA 2Q66A 3OVAA 4EBKA 2BCUA 4I29A 9ICMA 4QZ8A 1ZQPA 2PFNA 2HHPA 9ICGA 4WC5A 4FH3A 7ICFA 4RQ5A 4UB2A 5HRGA 5BPCA 2BCQA 4DOCA 2ZH9A 5DECA 4M5DA 3JPRA 3HWTA 1KDHA 5HHIA 2FMQA 4KLSA 2GWSA 3ISCA 1MIYA 4XA5A 5HREA 1ZQRA 2M2UA 3B0YA 2BPFA 4F5NA 4WC3A 5CJ7A 4PH5A 3HX0A 8ICJA 1ZQXA 5BOMA 5HC9A 4M9HA 4F5QA 4DO9A 4AT7B 4F5PA 4KLUA 1ZJNA 2DR9A 4UB4A 5IIOA 1ZQLA 9ICNA 4FHWA 3HIYA 4UB1A 3JPSA 4O5CA 4AT9A 4KLTA 5DEDA 5EOZA 9ICJA 2W9MA 5IIJA 4RWNA 3JPNA 3AUOA 2I9GA 9ICLA 4WC0A 2PFPA 5D4BA 8ICYA 3V7KA 8ICGA 9ICCA 2FMSA 3C66A 3NYBA 5D46A 4NKTA 3RJKA 5F2VO 4KLHA 1R8AA 3UQ2A 2DRAA 2ZH1A 4NY8A 2M2WA 4RQ7A 4UAWA 4I2GA 3WFPA 5IIIA 5CHGA 5J0UA 9ICIA 3C2KA 4IQTA 1Q79A 4QZFA 2DR7A 4F5OA 2NRKA 9ICRA 5J2BA 4Z6FA 8ICLA 4P4OA 2DR5A 4UD5A 5HRBA 3MBYA 7ICGA 3JYYA 2PFQA 1ZQMA 1BPZA 2PFOA 4KLEA 4X4NA 3RJJA 9ICXA 5HRLA 1TFYA 7ICUA 2ZH7A 4NLZA 4R66A 3RJFA 5D49A 4RQ4A 8ICNA 3HJ1A 4GXIA 5J0QA 8ICRA 1UEUA 5HRFA 4RQ1A 7ICIA 2BCSA 1HUZA 4R64A 5J0RA 4M0AA 4I2JA 3AQKA 4AT8A 8ICWA 4AT9B 5HRDA 2ZH4A 4KLJA 5J0SA 4KLLA 4M2YA 3UQ0A 4FHVA 4RWQA 1XSPA 4RPYA 3HW8A 3L9DA 7ICVA 4RPXA 4RPZA 4KLMA 3C5GA 4MF2A 5HR9A 7ICPA 5HRKA 4QZDA 5CR0A 4PGYA 5HRIA 2ID1A 3GDXA 3JPTA 2ZH3A 4I2DA 5J2DA 3WFOA 8ICMA 5J2CA 4DOBA 3TFSA 1XSLA 1PX5A 4K4HA 4GXJA 4RQ8A 4QZBA 5DB7A 4KLGA 1UEVA 8ICBA 3H38A 4X4VA 3AQNA 4DOAA 2IHMA 4RWOA 1ZJMA 4FO6A 8ICZA 4TURA 3ISDA 4WC2A 2ZHAA 4RQ3A 4RQ2A 1ZQKA 5DB6A 1ZQTA 4ATBA 4X5VA 3MGHA 3V72A 4TUPA 5DDMA 1ZQIA 1NO5A 2M2VA 1VFGA 4Z6EA 4NKUA 3LK9A 3UPSA 5IIMA 4IQVA 4YD2A 1ZQJA 4K4GA 2ZH8A 5J0PA 4XUSA 9ICAA 1JMSA 4WC4A 4LZGA 4X4OA 4M04A 5J0WA 1ZQHA 4RT3A 9ICWA 1OU5A 3AQLA 4WC6A 4YN4A 2O1PA 3RJIA 1RPLA 3V7JA 1MQ3A 4AT8B 5CP2A 2ZH5A 2ZH2A 1ZQBA 1VJ7A 4LZDA 4QZHA 1MIWA 2DR8A 4I2EA 1ZQWA 3C5FA 1MQ2A 5HRHA 5J2IA 4X4PA 1BPBA 3MDAA 4QZGA 5J2EA 3ISBA 7ICNA 3HJ4A 7ICMA 4RQ0A 3C18A 4E8FA 5DBBA 5CB1A 1ZQNA 1TV9A 5DB9A 2ISPA 1JAJA 4I2FA 5CA7A 4LVSA 3OVSA 4P2HA 2VANA 3AU2A 4E7XA 1ZQUA 3MGIA 4O9MA 4I2IA 3PMNA 4UAZA 4MFFA 4X4UA 4PGXA 1BPEA 1TVAA 9ICFA 9ICHA 8ICAA 3JPOA 3B0XA 4YCXA 4ATBB 2RFFA 4S3NA 4QZCA 5J29A 4QZAA 1ZQAA 4I2BA 1ZQZA 4X4SA 4RWPA 4UBCA 3RH4A 7ICEA 4K4IA 4YMOA 5DBCA 1R8BA 4YMNA 4X0AA 5TZVA 1BPXA 5J0XA 4FHPA 1ZQOA 8ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQU A;  3OUY A;  4EBJ A;  2P66 A;  3WFR E;  4IG8 A;  4NLN A;  8ICS A;  3K75 D;  4X4T A;  5IIL A;  4M9G A;  4UB3 A;  4YMM A;  1FA0 A;  2PXI A;  4M9L A;  5J2G A;  4Z6D A;  2ZH6 A;  8ICK A;  9ICO A;  1V4A A;  8ICU A;  4QZ9 A;  9ICP A;  4X0B A;  3JZ0 A;  3LQC B;  2BE3 A;  4FHY A;  4WC1 A;  1TFW A;  1ZQG A;  3OV7 A;  4UB5 A;  4UD4 A;  5J2H A;  4M9N A;  2BCV A;  1KEJ A;  3H3A A;  5J0Y A;  2ISO A;  5J2J A;  4PGQ A;  9ICT A;  4JWM A;  4QZE A;  1YLQ A;  3AQM A;  9ICE A;  4FHX A;  4MFA A;  3C2M A;  4EP7 A;  1ZQE A;  4I27 A;  4P4P A;  3H37 A;  5BOL A;  1ZQF A;  4UBB A;  3UPQ A;  3UXO A;  4O5E A;  1ZQQ A;  2BPG A;  8ICO A;  3PNC A;  3UXP A;  3RJE A;  3WFS C;  4I2C A;  4R63 A;  9ICV A;  3OVB A;  4WCW A;  3OGU A;  1BPD A;  4NM1 A;  4JWN A;  8ICH A;  1F5A A;  4KLD A;  7ICL A;  2FMP A;  3C2L A;  1MIV A;  5IIK A;  1BPY A;  3RJH A;  7ICQ A;  4R65 A;  1NOM A;  3OUY B;  8ICE A;  4PHP A;  4I2H A;  2O5A A;  4MF8 A;  5IIN A;  1RZT A;  5J2A A;  9ICQ A;  4PHA A;  2PBE A;  1XSN A;  5J0T A;  9ICS A;  5DKW A;  3UXN A;  1ZQY A;  3TFR A;  4PPX A;  4WBY A;  3RH6 A;  4IQW A;  1HUO A;  3MDC A;  3V7L A;  8ICV A;  4WC7 A;  1ZQV A;  8ICT A;  4P4M A;  4PHD A;  5J2F A;  5DB8 A;  1JQR A;  5DDY A;  3RH5 A;  3JPP A;  4F5R A;  1Q78 A;  4NLK A;  7ICO A;  1UET A;  5J2K A;  4NM2 A;  7ICS A;  9ICB A;  3PML A;  5HHH A;  8ICC A;  5J0O A;  4TUS A;  4YD1 A;  2DVI A;  4Z6C A;  4XQ7 A;  7ICK A;  4QZI A;  4GXK A;  4M47 A;  4KLO A;  1ZQD A;  9ICK A;  4M9J A;  1R89 A;  4WBZ A;  4KLQ A;  5DBA A;  7ICJ A;  4E80 A;  1ZQS A;  4O5K A;  3WFQ E;  8ICP A;  4X4Q A;  4AT7 A;  8ICI A;  4XQ8 A;  7ICR A;  4FH5 A;  8ICF A;  2ZHB A;  4RT2 A;  2BPC A;  4NXZ A;  3RJG A;  7ICH A;  3JPQ A;  4I28 A;  4RQ6 A;  4X4R A;  4LT6 A;  9ICU A;  3H39 A;  4KLF A;  1R8C A;  1WOT A;  1ZQC A;  1JN3 A;  4KLI A;  3AU6 A;  1KNY A;  4UAY A;  4MFC A;  5CWR A;  7ICT A;  4I2A A;  2BCR A;  2DRB A;  8ICX A;  4TUQ A;  4XRH A;  2M2T A;  4PHE A;  2Q66 A;  3OVA A;  4EBK A;  2BCU A;  4I29 A;  9ICM A;  4QZ8 A;  1ZQP A;  2PFN A;  2HHP A;  9ICG A;  4WC5 A;  4FH3 A;  7ICF A;  4RQ5 A;  4UB2 A;  5HRG A;  5BPC A;  2BCQ A;  4DOC A;  2ZH9 A;  5DEC A;  4M5D A;  3JPR A;  3HWT A;  1KDH A;  5HHI A;  2FMQ A;  4KLS A;  2GWS A;  3ISC A;  1MIY A;  4XA5 A;  5HRE A;  1ZQR A;  2M2U A;  3B0Y A;  2BPF A;  4F5N A;  4WC3 A;  5CJ7 A;  4PH5 A;  3HX0 A;  8ICJ A;  1ZQX A;  5BOM A;  5HC9 A;  4M9H A;  4F5Q A;  4DO9 A;  4AT7 B;  4F5P A;  4KLU A;  1ZJN A;  2DR9 A;  4UB4 A;  5IIO A;  1ZQL A;  9ICN A;  4FHW A;  3HIY A;  4UB1 A;  3JPS A;  4O5C A;  4AT9 A;  4KLT A;  5DED A;  5EOZ A;  9ICJ A;  2W9M A;  5IIJ A;  4RWN A;  3JPN A;  3AUO A;  2I9G A;  9ICL A;  4WC0 A;  2PFP A;  5D4B A;  8ICY A;  3V7K A;  8ICG A;  9ICC A;  2FMS A;  3C66 A;  3NYB A;  5D46 A;  4NKT A;  3RJK A;  5F2V O;  4KLH A;  1R8A A;  3UQ2 A;  2DRA A;  2ZH1 A;  4NY8 A;  2M2W A;  4RQ7 A;  4UAW A;  4I2G A;  3WFP A;  5III A;  5CHG A;  5J0U A;  9ICI A;  3C2K A;  4IQT A;  1Q79 A;  4QZF A;  2DR7 A;  4F5O A;  2NRK A;  9ICR A;  5J2B A;  4Z6F A;  8ICL A;  4P4O A;  2DR5 A;  4UD5 A;  5HRB A;  3MBY A;  7ICG A;  3JYY A;  2PFQ A;  1ZQM A;  1BPZ A;  2PFO A;  4KLE A;  4X4N A;  3RJJ A;  9ICX A;  5HRL A;  1TFY A;  7ICU A;  2ZH7 A;  4NLZ A;  4R66 A;  3RJF A;  5D49 A;  4RQ4 A;  8ICN A;  3HJ1 A;  4GXI A;  5J0Q A;  8ICR A;  1UEU A;  5HRF A;  4RQ1 A;  7ICI A;  2BCS A;  1HUZ A;  4R64 A;  5J0R A;  4M0A A;  4I2J A;  3AQK A;  4AT8 A;  8ICW A;  4AT9 B;  5HRD A;  2ZH4 A;  4KLJ A;  5J0S A;  4KLL A;  4M2Y A;  3UQ0 A;  4FHV A;  4RWQ A;  1XSP A;  4RPY A;  3HW8 A;  3L9D A;  7ICV A;  4RPX A;  4RPZ A;  4KLM A;  3C5G A;  4MF2 A;  5HR9 A;  7ICP A;  5HRK A;  4QZD A;  5CR0 A;  4PGY A;  5HRI A;  2ID1 A;  3GDX A;  3JPT A;  2ZH3 A;  4I2D A;  5J2D A;  3WFO A;  8ICM A;  5J2C A;  4DOB A;  3TFS A;  1XSL A;  1PX5 A;  4K4H A;  4GXJ A;  4RQ8 A;  4QZB A;  5DB7 A;  4KLG A;  1UEV A;  8ICB A;  3H38 A;  4X4V A;  3AQN A;  4DOA A;  2IHM A;  4RWO A;  1ZJM A;  4FO6 A;  8ICZ A;  4TUR A;  3ISD A;  4WC2 A;  2ZHA A;  4RQ3 A;  4RQ2 A;  1ZQK A;  5DB6 A;  1ZQT A;  4ATB A;  4X5V A;  3MGH A;  3V72 A;  4TUP A;  5DDM A;  1ZQI A;  1NO5 A;  2M2V A;  1VFG A;  4Z6E A;  4NKU A;  3LK9 A;  3UPS A;  5IIM A;  4IQV A;  4YD2 A;  1ZQJ A;  4K4G A;  2ZH8 A;  5J0P A;  4XUS A;  9ICA A;  1JMS A;  4WC4 A;  4LZG A;  4X4O A;  4M04 A;  5J0W A;  1ZQH A;  4RT3 A;  9ICW A;  1OU5 A;  3AQL A;  4WC6 A;  4YN4 A;  2O1P A;  3RJI A;  1RPL A;  3V7J A;  1MQ3 A;  4AT8 B;  5CP2 A;  2ZH5 A;  2ZH2 A;  1ZQB A;  1VJ7 A;  4LZD A;  4QZH A;  1MIW A;  2DR8 A;  4I2E A;  1ZQW A;  3C5F A;  1MQ2 A;  5HRH A;  5J2I A;  4X4P A;  1BPB A;  3MDA A;  4QZG A;  5J2E A;  3ISB A;  7ICN A;  3HJ4 A;  7ICM A;  4RQ0 A;  3C18 A;  4E8F A;  5DBB A;  5CB1 A;  1ZQN A;  1TV9 A;  5DB9 A;  2ISP A;  1JAJ A;  4I2F A;  5CA7 A;  4LVS A;  3OVS A;  4P2H A;  2VAN A;  3AU2 A;  4E7X A;  1ZQU A;  3MGI A;  4O9M A;  4I2I A;  3PMN A;  4UAZ A;  4MFF A;  4X4U A;  4PGX A;  1BPE A;  1TVA A;  9ICF A;  9ICH A;  8ICA A;  3JPO A;  3B0X A;  4YCX A;  4ATB B;  2RFF A;  4S3N A;  4QZC A;  5J29 A;  4QZA A;  1ZQA A;  4I2B A;  1ZQZ A;  4X4S A;  4RWP A;  4UBC A;  3RH4 A;  7ICE A;  4K4I A;  4YMO A;  5DBC A;  1R8B A;  4YMN A;  4X0A A;  5TZV A;  1BPX A;  5J0X A;  4FHP A;  1ZQO A;  8ICQ A; 
#chains in the Genus database with same CATH topology
 4IQU A;  3OUY A;  4EBJ A;  2P66 A;  3WFR E;  4IG8 A;  4NLN A;  8ICS A;  3K75 D;  4X4T A;  5IIL A;  4M9G A;  4UB3 A;  4YMM A;  1FA0 A;  2PXI A;  4M9L A;  5J2G A;  4Z6D A;  4XJE A;  2ZH6 A;  8ICK A;  9ICO A;  1V4A A;  8ICU A;  4QZ9 A;  9ICP A;  4X0B A;  3JZ0 A;  3LQC B;  2BE3 A;  4FHY A;  4WC1 A;  1TFW A;  1ZQG A;  3OV7 A;  4UB5 A;  4UD4 A;  2HN2 A;  2B51 A;  5J2H A;  2B56 A;  4M9N A;  4NXT A;  2BCV A;  1KEJ A;  3H3A A;  5J0Y A;  2ISO A;  5J2J A;  4PGQ A;  9ICT A;  4JWM A;  4QZE A;  1YLQ A;  3AQM A;  9ICE A;  4FHX A;  4MFA A;  3C2M A;  4K9B A;  4EP7 A;  1ZQE A;  4I27 A;  4P4P A;  4LEZ A;  3H37 A;  5BOL A;  1ZQF A;  4UBB A;  3UPQ A;  3UXO A;  4O5E A;  1ZQQ A;  2BPG A;  8ICO A;  3PNC A;  3UXP A;  3RJE A;  3WFS C;  4I2C A;  5CFS A;  4R63 A;  5CFT A;  9ICV A;  4K98 A;  3OVB A;  4WCW A;  3OGU A;  1BPD A;  4NM1 A;  4JWN A;  8ICH A;  1F5A A;  4KLD A;  7ICL A;  2FMP A;  3C2L A;  1MIV A;  5IIK A;  1BPY A;  3RJH A;  7ICQ A;  4R65 A;  1NOM A;  3OUY B;  8ICE A;  4PHP A;  2EWR A;  4I2H A;  2O5A A;  4MF8 A;  5IIN A;  1RZT A;  4OAI Z;  4NXU A;  5J2A A;  9ICQ A;  4PHA A;  2PBE A;  1XSN A;  5J0T A;  9ICS A;  5DKW A;  3UXN A;  1ZQY A;  3TFR A;  4PPX A;  4WBY A;  3RH6 A;  4IQW A;  2GAF D;  1HUO A;  3MDC A;  3V7L A;  5D61 A;  8ICV A;  3ER8 C;  4WC7 A;  1ZQV A;  8ICT A;  4P4M A;  4PHD A;  5J2F A;  5DB8 A;  1JQR A;  5DDY A;  3RH5 A;  4K96 A;  3JPP A;  4F5R A;  1Q78 A;  4NLK A;  7ICO A;  1UET A;  5J2K A;  4NM2 A;  7ICS A;  9ICB A;  3PML A;  5HHH A;  8ICC A;  1GPJ A;  5J0O A;  4TUS A;  4YD1 A;  2BBH A;  2DVI A;  4Z6C A;  4XQ7 A;  7ICK A;  4QZI A;  4GXK A;  3PHZ A;  5CFU A;  4M47 A;  4KLO A;  1ZQD A;  9ICK A;  4M9J A;  1R89 A;  4WBZ A;  4JLZ A;  4KLQ A;  5DBA A;  7ICJ A;  4E80 A;  4WH5 A;  1ZQS A;  4O5K A;  3WFQ E;  8ICP A;  4X4Q A;  4AT7 A;  8ICI A;  4XQ8 A;  7ICR A;  4FH5 A;  2B4V A;  3OWG A;  5D62 A;  8ICF A;  2ZHB A;  3ERC C;  4RT2 A;  2BPC A;  4NXZ A;  3RJG A;  7ICH A;  3JPQ A;  4EED A;  4I28 A;  4RQ6 A;  4X4R A;  4LT6 A;  9ICU A;  3H39 A;  4KLF A;  1R8C A;  1WOT A;  1ZQC A;  1JN3 A;  4KLI A;  3AU6 A;  1KNY A;  4UAY A;  4MFC A;  5CWR A;  7ICT A;  4EEB A;  4I2A A;  2BCR A;  2DRB A;  8ICX A;  4TUQ A;  4XRH A;  2M2T A;  4PHE A;  2Q66 A;  3OVA A;  4EBK A;  2BCU A;  4I29 A;  4KB6 A;  9ICM A;  4QZ8 A;  1ZQP A;  2PFN A;  4EGW A;  2HHP A;  9ICG A;  4WC5 A;  4K9A A;  4FH3 A;  7ICF A;  4I0U A;  4RQ5 A;  4UB2 A;  5HRG A;  5BPC A;  2BCQ A;  4DOC A;  2ZH9 A;  3NKU A;  5DEC A;  4M5D A;  3JPR A;  3HWT A;  1KDH A;  5HHI A;  2FMQ A;  4KLS A;  2GWS A;  3ISC A;  1MIY A;  4XA5 A;  5HRE A;  1ZQR A;  4NXV A;  2M2U A;  3B0Y A;  4O67 A;  2BPF A;  4F5N A;  4WC3 A;  5CJ7 A;  4PH5 A;  3HX0 A;  8ICJ A;  1ZQX A;  5BOM A;  4OAG A;  5HC9 A;  4M9H A;  4F5Q A;  4DO9 A;  4AT7 B;  4F5P A;  4KLU A;  2FCL A;  1ZJN A;  2DR9 A;  4UB4 A;  5IIO A;  4LEY A;  1ZQL A;  9ICN A;  4FHW A;  3HIY A;  4UB1 A;  3JPS A;  4O5C A;  4AT9 A;  4KLT A;  3ER9 B;  5DED A;  5EOZ A;  9ICJ A;  2W9M A;  5IIJ A;  4WOY A;  4RWN A;  3JPN A;  3AUO A;  5D63 A;  2I9G A;  9ICL A;  4WC0 A;  2PFP A;  5D4B A;  4K8V A;  8ICY A;  3MCR A;  3V7K A;  8ICG A;  9ICC A;  2FMS A;  3C66 A;  3NYB A;  5D46 A;  4NKT A;  3RJK A;  5F2V O;  4KLH A;  1R8A A;  3UQ2 A;  2DRA A;  2ZH1 A;  4NY8 A;  2M2W A;  4RQ7 A;  4UAW A;  4I2G A;  3WFP A;  5III A;  5B3P A;  5CHG A;  4WQL A;  5J0U A;  9ICI A;  3C2K A;  4IQT A;  1Q79 A;  4QZF A;  2DR7 A;  4F5O A;  2HN1 A;  2NRK A;  9ICR A;  3NVO A;  4LEV A;  5J2B A;  4Z6F A;  4NXW A;  8ICL A;  4P4O A;  2DR5 A;  4UD5 A;  5HRB A;  3MBY A;  7ICG A;  3JYY A;  2PFQ A;  1ZQM A;  1BPZ A;  2PFO A;  4KLE A;  4X4N A;  3RJJ A;  9ICX A;  5HRL A;  4N7R A;  1TFY A;  7ICU A;  2ZH7 A;  4NLZ A;  4R66 A;  3RJF A;  5D49 A;  4RQ4 A;  8ICN A;  3HJ1 A;  4OAF A;  4GXI A;  5J0Q A;  8ICR A;  1UEU A;  5HRF A;  4RQ1 A;  7ICI A;  2BCS A;  1HUZ A;  4R64 A;  5J0R A;  4M0A A;  4I2J A;  3AQK A;  4AT8 A;  8ICW A;  4AT9 B;  5HRD A;  2ZH4 A;  4KLJ A;  5J0S A;  4KLL A;  4M2Y A;  3UQ0 A;  4FHV A;  4RWQ A;  1XSP A;  4RPY A;  3HW8 A;  3L9D A;  7ICV A;  4RPX A;  3K7D A;  4RPZ A;  4KLM A;  2IUB A;  3C5G A;  4MF2 A;  5HR9 A;  4OAH A;  7ICP A;  5HRK A;  4EV6 A;  4QZD A;  5CHE A;  5CR0 A;  4PGY A;  5HRI A;  2ID1 A;  3GDX A;  4FO1 A;  3JPT A;  2ZH3 A;  4I2D A;  5J2D A;  3WFO A;  8ICM A;  5J2C A;  4DOB A;  3TFS A;  2GA9 D;  1XSL A;  1PX5 A;  4K4H A;  4GXJ A;  4RQ8 A;  4QZB A;  5DB7 A;  4KLG A;  1UEV A;  8ICB A;  3H38 A;  4X4V A;  3AQN A;  4DOA A;  2IHM A;  4RWO A;  1ZJM A;  4FO6 A;  8ICZ A;  4NXX A;  4TUR A;  3ISD A;  4WC2 A;  5B3Q A;  2ZHA A;  4RQ3 A;  4RQ2 A;  1ZQK A;  5DB6 A;  4WQK A;  1ZQT A;  4ATB A;  4X5V A;  3MGH A;  3V72 A;  4TUP A;  5DDM A;  1ZQI A;  1NO5 A;  2M2V A;  1VFG A;  4Z6E A;  4NKU A;  3LK9 A;  3UPS A;  4O6A A;  3NWI A;  5IIM A;  4IQV A;  4YD2 A;  1ZQJ A;  4K4G A;  2ZH8 A;  5J0P A;  4XUS A;  9ICA A;  1JMS A;  3EF2 A;  4K99 A;  4MKP A;  4WC4 A;  4LZG A;  4X4O A;  2IHO A;  4M04 A;  5J0W A;  4HX0 A;  1ZQH A;  4RT3 A;  9ICW A;  1OU5 A;  3AQL A;  4WC6 A;  4YN4 A;  2O1P A;  3RJI A;  3JCF A;  1RPL A;  3V7J A;  3CK6 A;  1MQ3 A;  4AT8 B;  5CP2 A;  2ZH5 A;  2ZH2 A;  1ZQB A;  1VJ7 A;  4LZD A;  4QZH A;  4K97 A;  1MIW A;  2DR8 A;  4I2E A;  1ZQW A;  3C5F A;  1MQ2 A;  5HRH A;  5JTG A;  4LEW A;  5J2I A;  4X4P A;  1BPB A;  3MDA A;  4QZG A;  5J2E A;  3ISB A;  7ICN A;  3HJ4 A;  7ICM A;  4RQ0 A;  3C18 A;  4E8F A;  5DBB A;  5CB1 A;  1ZQN A;  1TV9 A;  5DB9 A;  2ISP A;  1JAJ A;  4JLX A;  4I2F A;  5CA7 A;  4LVS A;  3OVS A;  4P2H A;  2VAN A;  3AU2 A;  4E7X A;  1ZQU A;  4O68 A;  3MGI A;  4O9M A;  4I2I A;  3PMN A;  4UAZ A;  4MFF A;  4X4U A;  4PGX A;  1BPE A;  1TVA A;  9ICF A;  9ICH A;  8ICA A;  3JPO A;  3B0X A;  4YCX A;  4ATB B;  2RFF A;  4S3N A;  4QZC A;  5J29 A;  4QZA A;  1ZQA A;  4I2B A;  1ZQZ A;  4KM5 A;  4RWP A;  4X4S A;  4UBC A;  3RH4 A;  7ICE A;  4K4I A;  4YMO A;  5DBC A;  4O69 A;  1R8B A;  4YMN A;  4X0A A;  5TZV A;  2BBJ A;  1BPX A;  5J0X A;  4FHP A;  1ZQO A;  8ICQ A; 
#chains in the Genus database with same CATH homology
 4IQU A;  3OUY A;  4EBJ A;  2P66 A;  3WFR E;  4IG8 A;  4NLN A;  8ICS A;  3K75 D;  4X4T A;  5IIL A;  4M9G A;  4UB3 A;  4YMM A;  1FA0 A;  2PXI A;  4M9L A;  5J2G A;  4Z6D A;  2ZH6 A;  8ICK A;  9ICO A;  1V4A A;  8ICU A;  4QZ9 A;  9ICP A;  4X0B A;  3JZ0 A;  3LQC B;  2BE3 A;  4FHY A;  4WC1 A;  1TFW A;  1ZQG A;  3OV7 A;  4UB5 A;  4UD4 A;  5J2H A;  4M9N A;  2BCV A;  1KEJ A;  3H3A A;  5J0Y A;  2ISO A;  5J2J A;  4PGQ A;  9ICT A;  4JWM A;  4QZE A;  1YLQ A;  3AQM A;  9ICE A;  4FHX A;  4MFA A;  3C2M A;  4EP7 A;  1ZQE A;  4I27 A;  4P4P A;  3H37 A;  5BOL A;  1ZQF A;  4UBB A;  3UPQ A;  3UXO A;  4O5E A;  1ZQQ A;  2BPG A;  8ICO A;  3PNC A;  3UXP A;  3RJE A;  3WFS C;  4I2C A;  4R63 A;  9ICV A;  3OVB A;  4WCW A;  3OGU A;  1BPD A;  4NM1 A;  4JWN A;  8ICH A;  1F5A A;  4KLD A;  7ICL A;  2FMP A;  3C2L A;  1MIV A;  5IIK A;  1BPY A;  3RJH A;  7ICQ A;  4R65 A;  1NOM A;  3OUY B;  8ICE A;  4PHP A;  4I2H A;  2O5A A;  4MF8 A;  5IIN A;  1RZT A;  5J2A A;  9ICQ A;  4PHA A;  2PBE A;  1XSN A;  5J0T A;  9ICS A;  5DKW A;  3UXN A;  1ZQY A;  3TFR A;  4PPX A;  4WBY A;  3RH6 A;  4IQW A;  1HUO A;  3MDC A;  3V7L A;  8ICV A;  4WC7 A;  1ZQV A;  8ICT A;  4P4M A;  4PHD A;  5J2F A;  5DB8 A;  1JQR A;  5DDY A;  3RH5 A;  3JPP A;  4F5R A;  1Q78 A;  4NLK A;  7ICO A;  1UET A;  5J2K A;  4NM2 A;  7ICS A;  9ICB A;  3PML A;  5HHH A;  8ICC A;  5J0O A;  4TUS A;  4YD1 A;  2DVI A;  4Z6C A;  4XQ7 A;  7ICK A;  4QZI A;  4GXK A;  4M47 A;  4KLO A;  1ZQD A;  9ICK A;  4M9J A;  1R89 A;  4WBZ A;  4KLQ A;  5DBA A;  7ICJ A;  4E80 A;  1ZQS A;  4O5K A;  3WFQ E;  8ICP A;  4X4Q A;  4AT7 A;  8ICI A;  4XQ8 A;  7ICR A;  4FH5 A;  8ICF A;  2ZHB A;  4RT2 A;  2BPC A;  4NXZ A;  3RJG A;  7ICH A;  3JPQ A;  4I28 A;  4RQ6 A;  4X4R A;  4LT6 A;  9ICU A;  3H39 A;  4KLF A;  1R8C A;  1WOT A;  1ZQC A;  1JN3 A;  4KLI A;  3AU6 A;  1KNY A;  4UAY A;  4MFC A;  5CWR A;  7ICT A;  4I2A A;  2BCR A;  2DRB A;  8ICX A;  4TUQ A;  4XRH A;  2M2T A;  4PHE A;  2Q66 A;  3OVA A;  4EBK A;  2BCU A;  4I29 A;  9ICM A;  4QZ8 A;  1ZQP A;  2PFN A;  2HHP A;  9ICG A;  4WC5 A;  4FH3 A;  7ICF A;  4RQ5 A;  4UB2 A;  5HRG A;  5BPC A;  2BCQ A;  4DOC A;  2ZH9 A;  5DEC A;  4M5D A;  3JPR A;  3HWT A;  1KDH A;  5HHI A;  2FMQ A;  4KLS A;  2GWS A;  3ISC A;  1MIY A;  4XA5 A;  5HRE A;  1ZQR A;  2M2U A;  3B0Y A;  2BPF A;  4F5N A;  4WC3 A;  5CJ7 A;  4PH5 A;  3HX0 A;  8ICJ A;  1ZQX A;  5BOM A;  5HC9 A;  4M9H A;  4F5Q A;  4DO9 A;  4AT7 B;  4F5P A;  4KLU A;  1ZJN A;  2DR9 A;  4UB4 A;  5IIO A;  1ZQL A;  9ICN A;  4FHW A;  3HIY A;  4UB1 A;  3JPS A;  4O5C A;  4AT9 A;  4KLT A;  5DED A;  5EOZ A;  9ICJ A;  2W9M A;  5IIJ A;  4RWN A;  3JPN A;  3AUO A;  2I9G A;  9ICL A;  4WC0 A;  2PFP A;  5D4B A;  8ICY A;  3V7K A;  8ICG A;  9ICC A;  2FMS A;  3C66 A;  3NYB A;  5D46 A;  4NKT A;  3RJK A;  5F2V O;  4KLH A;  1R8A A;  3UQ2 A;  2DRA A;  2ZH1 A;  4NY8 A;  2M2W A;  4RQ7 A;  4UAW A;  4I2G A;  3WFP A;  5III A;  5CHG A;  5J0U A;  9ICI A;  3C2K A;  4IQT A;  1Q79 A;  4QZF A;  2DR7 A;  4F5O A;  2NRK A;  9ICR A;  5J2B A;  4Z6F A;  8ICL A;  4P4O A;  2DR5 A;  4UD5 A;  5HRB A;  3MBY A;  7ICG A;  3JYY A;  2PFQ A;  1ZQM A;  1BPZ A;  2PFO A;  4KLE A;  4X4N A;  3RJJ A;  9ICX A;  5HRL A;  1TFY A;  7ICU A;  2ZH7 A;  4NLZ A;  4R66 A;  3RJF A;  5D49 A;  4RQ4 A;  8ICN A;  3HJ1 A;  4GXI A;  5J0Q A;  8ICR A;  1UEU A;  5HRF A;  4RQ1 A;  7ICI A;  2BCS A;  1HUZ A;  4R64 A;  5J0R A;  4M0A A;  4I2J A;  3AQK A;  4AT8 A;  8ICW A;  4AT9 B;  5HRD A;  2ZH4 A;  4KLJ A;  5J0S A;  4KLL A;  4M2Y A;  3UQ0 A;  4FHV A;  4RWQ A;  1XSP A;  4RPY A;  3HW8 A;  3L9D A;  7ICV A;  4RPX A;  4RPZ A;  4KLM A;  3C5G A;  4MF2 A;  5HR9 A;  7ICP A;  5HRK A;  4QZD A;  5CR0 A;  4PGY A;  5HRI A;  2ID1 A;  3GDX A;  3JPT A;  2ZH3 A;  4I2D A;  5J2D A;  3WFO A;  8ICM A;  5J2C A;  4DOB A;  3TFS A;  1XSL A;  1PX5 A;  4K4H A;  4GXJ A;  4RQ8 A;  4QZB A;  5DB7 A;  4KLG A;  1UEV A;  8ICB A;  3H38 A;  4X4V A;  3AQN A;  4DOA A;  2IHM A;  4RWO A;  1ZJM A;  4FO6 A;  8ICZ A;  4TUR A;  3ISD A;  4WC2 A;  2ZHA A;  4RQ3 A;  4RQ2 A;  1ZQK A;  5DB6 A;  1ZQT A;  4ATB A;  4X5V A;  3MGH A;  3V72 A;  4TUP A;  5DDM A;  1ZQI A;  1NO5 A;  2M2V A;  1VFG A;  4Z6E A;  4NKU A;  3LK9 A;  3UPS A;  5IIM A;  4IQV A;  4YD2 A;  1ZQJ A;  4K4G A;  2ZH8 A;  5J0P A;  4XUS A;  9ICA A;  1JMS A;  4WC4 A;  4LZG A;  4X4O A;  4M04 A;  5J0W A;  1ZQH A;  4RT3 A;  9ICW A;  1OU5 A;  3AQL A;  4WC6 A;  4YN4 A;  2O1P A;  3RJI A;  1RPL A;  3V7J A;  1MQ3 A;  4AT8 B;  5CP2 A;  2ZH5 A;  2ZH2 A;  1ZQB A;  1VJ7 A;  4LZD A;  4QZH A;  1MIW A;  2DR8 A;  4I2E A;  1ZQW A;  3C5F A;  1MQ2 A;  5HRH A;  5J2I A;  4X4P A;  1BPB A;  3MDA A;  4QZG A;  5J2E A;  3ISB A;  7ICN A;  3HJ4 A;  7ICM A;  4RQ0 A;  3C18 A;  4E8F A;  5DBB A;  5CB1 A;  1ZQN A;  1TV9 A;  5DB9 A;  2ISP A;  1JAJ A;  4I2F A;  5CA7 A;  4LVS A;  3OVS A;  4P2H A;  2VAN A;  3AU2 A;  4E7X A;  1ZQU A;  3MGI A;  4O9M A;  4I2I A;  3PMN A;  4UAZ A;  4MFF A;  4X4U A;  4PGX A;  1BPE A;  1TVA A;  9ICF A;  9ICH A;  8ICA A;  3JPO A;  3B0X A;  4YCX A;  4ATB B;  2RFF A;  4S3N A;  4QZC A;  5J29 A;  4QZA A;  1ZQA A;  4I2B A;  1ZQZ A;  4X4S A;  4RWP A;  4UBC A;  3RH4 A;  7ICE A;  4K4I A;  4YMO A;  5DBC A;  1R8B A;  4YMN A;  4X0A A;  5TZV A;  1BPX A;  5J0X A;  4FHP A;  1ZQO A;  8ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...