5HRFA

The crystal structure of asfvpolx: dna5: dgtp ternary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
SGGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrfA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrfA01
4RPZA 1KNYA 4WBZA 4M9JA 5DDMA 4MF8A 3OGUA 4X4TA 4TURA 4KLQA 3UQ0A 3JPTA 4TUSA 5DDYA 1WOTA 1V4AA 4XQ7A 3UXPA 4IQUA 3JYYA 5J2JA 3RJIA 8ICEA 5HRKA 4X4RA 5J2IA 7ICUA 3OVAA 5J0PA 8ICFA 3V7LA 1UEUA 2BCUA 4WC6A 7ICOA 2DR9A 2M2VA 4NLZA 4QZ8A 7ICJA 8ICOA 4UB3A 2ISPA 3WFRE 4FHPA 3RJFA 4PGYA 4UBBA 2BCVA 2Q66A 4I2EA 3AQNA 1ZQOA 2BPFA 8ICHA 4LVSA 7ICIA 4WBYA 4X4QA 4MFAA 5HHIA 4YCXA 3PNCA 3AUOA 3RJKA 8ICQA 2ZH6A 5J2FA 2BE3A 3MGHA 1ZQGA 2BPGA 5CJ7A 5J0YA 4QZDA 3RH4A 4I2CA 3OUYB 4YMNA 4PHDA 1R8BA 4S3NA 1ZQBA 4M9HA 4NM2A 1OU5A 1BPZA 4NM1A 4TUPA 4KLLA 9ICVA 1ZQQA 4IQWA 4UAYA 1XSNA 4RQ6A 1TVAA 3GDXA 1ZQWA 4M9GA 4RPYA 1ZQPA 5EOZA 3AQLA 2BCQA 5J0RA 4UAZA 5HRGA 4RQ5A 4EBJA 7ICVA 5DECA 3HX0A 1ZJMA 4X4OA 4X4SA 5BPCA 3H37A 4FH3A 2PBEA 9ICKA 4RQ1A 3C2MA 1KDHA 1TFWA 1R89A 4GXJA 1ZQDA 7ICNA 3L9DA 4WC4A 7ICTA 3C66A 2NRKA 3AU2A 5J0TA 4M47A 4F5NA 4YD1A 2I9GA 4F5RA 4MFCA 3MGIA 4KLMA 2DR8A 1ZQKA 4E80A 4E8FA 4WC2A 5BOMA 4P2HA 5J2HA 4UD4A 7ICQA 4I2AA 9ICEA 5BOLA 4EP7A 2DRBA 1ZQTA 1RPLA 9ICQA 1YLQA 2FMSA 4X5VA 4Z6FA 5IIMA 1PX5A 4RQ7A 3JPRA 2DRAA 4X0AA 8ICZA 3OVSA 3C5GA 8ICCA 1HUOA 1FA0A 4P4MA 2RFFA 5J0WA 2ZH3A 4RQ3A 5D46A 4X4PA 1BPDA 9ICSA 3C5FA 1ZQCA 5J2AA 2ZH1A 9ICPA 1Q78A 2PFNA 4XA5A 7ICMA 4RWNA 7ICLA 2ZH4A 4M9NA 4GXIA 4O5KA 1ZQIA 4NKUA 3V7KA 3ISCA 4AT7A 2VANA 5J2DA 1MQ3A 3V7JA 4JWMA 1BPYA 2O5AA 1NO5A 1ZQLA 7ICSA 4FHYA 1HUZA 3UXOA 5J0QA 4I2JA 3JPQA 7ICRA 3JZ0A 9ICAA 4KLSA 5IIKA 3C18A 8ICVA 4KLOA 4I27A 4WC5A 4PH5A 2BPCA 2ISOA 4M0AA 4I28A 1XSLA 4WC0A 4F5QA 4AT9A 1ZQMA 5CP2A 3HJ4A 4RQ0A 2M2TA 1JQRA 4PGXA 1ZQXA 4M9LA 5D49A 1ZQSA 1UETA 1JN3A 3JPPA 4UAWA 1MIVA 3ISDA 2FMPA 5DB6A 1BPEA 3H38A 4QZBA 1RZTA 1Q79A 4K4HA 2O1PA 1XSPA 2W9MA 4AT7B 3C2LA 8ICAA 1VFGA 4I2IA 5TZVA 8ICLA 3UPSA 4KLDA 4LZGA 3LK9A 1ZQVA 4PPXA 3B0YA 4FHVA 4RT2A 4DOAA 3MBYA 3RJEA 8ICUA 9ICXA 1ZQFA 8ICYA 3WFPA 2M2WA 2P66A 4WC7A 4R65A 4ATBA 7ICFA 5CB1A 3RH6A 4M2YA 4I2FA 4YD2A 4QZ9A 5J2EA 3AQKA 4FHWA 4QZCA 4YN4A 1R8CA 4EBKA 3K75D 3B0XA 5CR0A 2ZH9A 4RQ4A 4YMMA 4PGQA 4I2BA 4AT8A 9ICRA 8ICJA 8ICPA 4NKTA 4E7XA 1ZQJA 4X4NA 5J29A 4UB2A 3MDCA 1ZQEA 2M2UA 7ICKA 2BCRA 5IIOA 4KLIA 8ICGA 2PXIA 4P4PA 3JPNA 5DB8A 4FO6A 9ICTA 5J2BA 2PFOA 5HR9A 2BCSA 4RQ2A 3WFOA 4LT6A 9ICCA 4M5DA 1ZQHA 2ZH7A 1VJ7A 1MQ2A 4M04A 4RPXA 4RWQA 3UXNA 8ICSA 2ZH2A 4R63A 4QZFA 4FH5A 1ZQAA 4XUSA 3WFSC 3HW8A 3RJGA 5IILA 4KLUA 4PHEA 2HHPA 4O5EA 4I29A 5F2VO 4KLGA 4F5OA 9ICHA 9ICUA 1MIYA 7ICEA 3OVBA 4AT8B 4F5PA 4X0BA 4X4VA 5DKWA 4KLTA 4I2HA 4UBCA 4O5CA 1MIWA 5J2CA 4RT3A 4IG8A 3H39A 4QZAA 4XRHA 5J2GA 2DVIA 1BPBA 4NLKA 3TFRA 4KLHA 5DBAA 9ICMA 3OUYA 4YMOA 1JMSA 4X4UA 8ICNA 8ICIA 5CHGA 2DR7A 5D4BA 4QZIA 3RJHA 5J0SA 3HJ1A 1UEVA 3RH5A 5HC9A 5DB7A 4KLJA 4MFFA 5HRIA 7ICHA 9ICBA 8ICMA 9ICWA 4I2DA 2ZH8A 3C2KA 4WC3A 3V72A 4PHPA 9ICOA 4QZEA 2ZH5A 1TFYA 4MF2A 1ZQZA 5IINA 4RWOA 3NYBA 1ZQYA 3AQMA 5DEDA 3HWTA 4R66A 2GWSA 3JPSA 4DO9A 9ICNA 1F5AA 4P4OA 4IQVA 5HRHA 5IIJA 1ZQRA 5CA7A 4TUQA 5J0XA 4UB1A 3TFSA 8ICWA 4O9MA 5HRBA 4XQ8A 3PMLA 5DBCA 4I2GA 1ZJNA 2ZHBA 3UPQA 4Z6EA 2PFQA 1ZQNA 5J2KA 4NXZA 1TV9A 4AT9B 5HHHA 5J0OA 3JPOA 3HIYA 4Z6DA 4NY8A 4KLFA 4RQ8A 4KLEA 3UQ2A 4DOCA 5CWRA 3AU6A 4FHXA 7ICPA 8ICBA 4UB4A 9ICJA 9ICLA 9ICGA 1ZQUA 3H3AA 5DBBA 4IQTA 4LZDA 4K4IA 2PFPA 4NLNA 4WCWA 2FMQA 3WFQE 5HRDA 4WC1A 1KEJA 9ICFA 5HRFA 3LQCB 8ICRA 8ICTA 4RWPA 1BPXA 3PMNA 4DOBA 3RJJA 4K4GA 1R8AA 5HREA 5DB9A 1NOMA 5IIIA 4QZHA 4UB5A 2ID1A 4QZGA 4ATBB 3MDAA 4R64A 4UD5A 4GXKA 2DR5A 8ICXA 4PHAA 3ISBA 2IHMA 4JWNA 2ZHAA 5HRLA 1JAJA 8ICKA 4Z6CA 3OV7A 7ICGA 9ICIA 5J0UA
chains in the Genus database with same CATH superfamily
4RPZA 1KNYA 4O68A 4XJEA 4WBZA 4M9JA 5DDMA 4MF8A 3OGUA 4X4TA 4TURA 4KLQA 3UQ0A 3JPTA 4TUSA 5DDYA 1WOTA 1V4AA 4NXTA 4XQ7A 3UXPA 4IQUA 3JYYA 5J2JA 5D61A 3RJIA 8ICEA 4I0UA 5HRKA 4X4RA 5J2IA 7ICUA 4KM5A 3OVAA 5J0PA 8ICFA 3V7LA 1UEUA 2BCUA 4WC6A 4MKPA 7ICOA 2DR9A 2M2VA 4NLZA 4O69A 4QZ8A 7ICJA 8ICOA 4UB3A 2ISPA 3WFRE 4FHPA 3RJFA 4PGYA 4UBBA 2BCVA 5D62A 2Q66A 4I2EA 3AQNA 1ZQOA 2BPFA 2GA9D 8ICHA 4LVSA 7ICIA 4WBYA 4X4QA 4MFAA 5HHIA 4YCXA 3PNCA 3AUOA 3RJKA 8ICQA 4JLZA 2ZH6A 5J2FA 2BE3A 3MGHA 1ZQGA 2BPGA 5CJ7A 5J0YA 4QZDA 3PHZA 3RH4A 4I2CA 3OUYB 4YMNA 4PHDA 1R8BA 4NXWA 4S3NA 1ZQBA 4M9HA 4NM2A 1OU5A 1BPZA 4NM1A 4TUPA 3NVOA 4KLLA 9ICVA 1ZQQA 4IQWA 4UAYA 4WQLA 1XSNA 4RQ6A 1TVAA 4NXXA 3GDXA 1ZQWA 4M9GA 4RPYA 1ZQPA 5EOZA 3AQLA 2BCQA 5J0RA 4UAZA 5HRGA 4RQ5A 4EBJA 7ICVA 3CK6A 2IHOA 5DECA 3HX0A 1ZJMA 3NWIA 4X4OA 4X4SA 4LEVA 5BPCA 3H37A 4FH3A 2PBEA 9ICKA 3EF2A 4RQ1A 3C2MA 1KDHA 1TFWA 5B3QA 4K9BA 1R89A 4GXJA 1ZQDA 7ICNA 3L9DA 3ER9B 4WC4A 7ICTA 3C66A 4NXVA 4K8VA 2NRKA 3AU2A 5J0TA 4M47A 4F5NA 4YD1A 2I9GA 4F5RA 4MFCA 3MGIA 4KLMA 2DR8A 1ZQKA 4E80A 4E8FA 4WC2A 5BOMA 4P2HA 5J2HA 4UD4A 7ICQA 4I2AA 9ICEA 4OAFA 5BOLA 4EP7A 2DRBA 1ZQTA 1RPLA 9ICQA 1YLQA 2FMSA 4X5VA 4Z6FA 5IIMA 1PX5A 4WQKA 4RQ7A 3JPRA 2DRAA 5JTGA 4X0AA 8ICZA 3OVSA 3C5GA 8ICCA 1HUOA 1FA0A 4P4MA 2B51A 2RFFA 5J0WA 2ZH3A 4K96A 4LEZA 4RQ3A 5D46A 4X4PA 1BPDA 9ICSA 3C5FA 1ZQCA 5J2AA 2ZH1A 9ICPA 1Q78A 2PFNA 4XA5A 7ICMA 4RWNA 7ICLA 2ZH4A 4M9NA 4GXIA 4O5KA 1ZQIA 4NKUA 3V7KA 3ISCA 5CHEA 4AT7A 2VANA 5J2DA 4N7RA 1MQ3A 3V7JA 4JWMA 1BPYA 2O5AA 1NO5A 1ZQLA 7ICSA 5CFTA 4FHYA 1HUZA 3UXOA 5J0QA 4I2JA 3JPQA 7ICRA 3JZ0A 9ICAA 4KLSA 5IIKA 3C18A 4O67A 8ICVA 5B3PA 4KLOA 4I27A 4WC5A 4PH5A 2BPCA 5CFSA 2ISOA 4M0AA 4I28A 1XSLA 4WC0A 4F5QA 4AT9A 1ZQMA 5CP2A 3HJ4A 4RQ0A 2M2TA 1JQRA 4PGXA 1ZQXA 4M9LA 5D49A 1ZQSA 1UETA 5CFUA 1JN3A 3JPPA 4UAWA 2BBHA 1MIVA 3ISDA 4LEYA 2FMPA 5DB6A 2B4VA 1BPEA 3H38A 1GPJA 4EEDA 4QZBA 1RZTA 4WOYA 1Q79A 4K4HA 2O1PA 1XSPA 2W9MA 4AT7B 3C2LA 8ICAA 1VFGA 4I2IA 5TZVA 8ICLA 3UPSA 4KLDA 4LZGA 3LK9A 1ZQVA 4PPXA 3B0YA 4KB6A 4FHVA 4RT2A 4DOAA 4EGWA 3MBYA 3RJEA 8ICUA 9ICXA 1ZQFA 8ICYA 3WFPA 2M2WA 2P66A 4LEWA 4WC7A 4R65A 4ATBA 7ICFA 5CB1A 3MCRA 3RH6A 4M2YA 4I2FA 4YD2A 4QZ9A 5J2EA 3AQKA 5D63A 4FHWA 4QZCA 4YN4A 1R8CA 4OAGA 4EBKA 3K75D 3B0XA 5CR0A 2ZH9A 4RQ4A 4YMMA 4PGQA 4I2BA 4AT8A 4FO1A 9ICRA 8ICJA 8ICPA 4NKTA 4E7XA 2EWRA 1ZQJA 4X4NA 4WH5A 5J29A 4UB2A 3MDCA 1ZQEA 2M2UA 7ICKA 2BCRA 5IIOA 4KLIA 8ICGA 2PXIA 4P4PA 3JPNA 5DB8A 4FO6A 9ICTA 5J2BA 2PFOA 5HR9A 2BCSA 4RQ2A 3WFOA 4LT6A 9ICCA 4M5DA 1ZQHA 2ZH7A 1VJ7A 1MQ2A 4M04A 3ER8C 4RPXA 4RWQA 3UXNA 8ICSA 2ZH2A 4R63A 4QZFA 4FH5A 1ZQAA 4XUSA 3WFSC 3HW8A 3RJGA 5IILA 4KLUA 4PHEA 2HHPA 4O5EA 4I29A 5F2VO 4KLGA 4F5OA 4O6AA 9ICHA 9ICUA 4K97A 1MIYA 7ICEA 3OVBA 4AT8B 4F5PA 4X0BA 4X4VA 5DKWA 4KLTA 4I2HA 4UBCA 4O5CA 1MIWA 5J2CA 4RT3A 4IG8A 3H39A 4QZAA 4XRHA 5J2GA 2DVIA 1BPBA 4NLKA 3TFRA 4KLHA 5DBAA 9ICMA 3OUYA 4YMOA 1JMSA 4X4UA 4EEBA 8ICNA 8ICIA 5CHGA 4OAHA 2DR7A 5D4BA 4QZIA 3RJHA 5J0SA 3HJ1A 3K7DA 1UEVA 3RH5A 5HC9A 5DB7A 4KLJA 4MFFA 5HRIA 7ICHA 9ICBA 8ICMA 4K99A 9ICWA 4I2DA 2ZH8A 2HN1A 3C2KA 4WC3A 4NXUA 3V72A 4PHPA 9ICOA 4QZEA 2ZH5A 1TFYA 4MF2A 1ZQZA 5IINA 4RWOA 3NYBA 1ZQYA 3AQMA 5DEDA 3HWTA 4R66A 2GWSA 3JPSA 4DO9A 9ICNA 1F5AA 4P4OA 4IQVA 5HRHA 3NKUA 5IIJA 1ZQRA 5CA7A 4TUQA 5J0XA 4JLXA 4UB1A 3TFSA 8ICWA 4O9MA 5HRBA 3JCFA 4XQ8A 3PMLA 4K9AA 5DBCA 4I2GA 1ZJNA 2ZHBA 3UPQA 4Z6EA 2PFQA 1ZQNA 5J2KA 4NXZA 1TV9A 4AT9B 5HHHA 5J0OA 3JPOA 3HIYA 4Z6DA 4EV6A 4NY8A 4KLFA 4RQ8A 4KLEA 3UQ2A 4DOCA 5CWRA 3AU6A 4FHXA 7ICPA 8ICBA 4UB4A 9ICJA 9ICLA 9ICGA 1ZQUA 3H3AA 5DBBA 2HN2A 3ERCC 4OAIZ 4IQTA 2IUBA 4LZDA 4K4IA 2PFPA 4NLNA 2FCLA 4WCWA 2FMQA 2GAFD 3WFQE 5HRDA 4WC1A 1KEJA 9ICFA 5HRFA 3LQCB 8ICRA 8ICTA 3OWGA 1BPXA 3PMNA 4DOBA 3RJJA 4RWPA 4K4GA 1R8AA 5HREA 5DB9A 1NOMA 5IIIA 4QZHA 4UB5A 2ID1A 2B56A 4QZGA 4ATBB 3MDAA 4R64A 4UD5A 4GXKA 2DR5A 8ICXA 4PHAA 3ISBA 2IHMA 4JWNA 2ZHAA 5HRLA 1JAJA 8ICKA 4Z6CA 4K98A 3OV7A 2BBJA 7ICGA 4HX0A 9ICIA 5J0UA
chains in the Genus database with same CATH topology
4RPZA 1KNYA 4WBZA 4M9JA 5DDMA 4MF8A 3OGUA 4X4TA 4TURA 4KLQA 3UQ0A 3JPTA 4TUSA 5DDYA 1WOTA 1V4AA 4XQ7A 3UXPA 4IQUA 3JYYA 5J2JA 3RJIA 8ICEA 5HRKA 4X4RA 5J2IA 7ICUA 3OVAA 5J0PA 8ICFA 3V7LA 1UEUA 2BCUA 4WC6A 7ICOA 2DR9A 2M2VA 4NLZA 4QZ8A 7ICJA 8ICOA 4UB3A 2ISPA 3WFRE 4FHPA 3RJFA 4PGYA 4UBBA 2BCVA 2Q66A 4I2EA 3AQNA 1ZQOA 2BPFA 8ICHA 4LVSA 7ICIA 4WBYA 4X4QA 4MFAA 5HHIA 4YCXA 3PNCA 3AUOA 3RJKA 8ICQA 2ZH6A 5J2FA 2BE3A 3MGHA 1ZQGA 2BPGA 5CJ7A 5J0YA 4QZDA 3RH4A 4I2CA 3OUYB 4YMNA 4PHDA 1R8BA 4S3NA 1ZQBA 4M9HA 4NM2A 1OU5A 1BPZA 4NM1A 4TUPA 4KLLA 9ICVA 1ZQQA 4IQWA 4UAYA 1XSNA 4RQ6A 1TVAA 3GDXA 1ZQWA 4M9GA 4RPYA 1ZQPA 5EOZA 3AQLA 2BCQA 5J0RA 4UAZA 5HRGA 4RQ5A 4EBJA 7ICVA 5DECA 3HX0A 1ZJMA 4X4OA 4X4SA 5BPCA 3H37A 4FH3A 2PBEA 9ICKA 4RQ1A 3C2MA 1KDHA 1TFWA 1R89A 4GXJA 1ZQDA 7ICNA 3L9DA 4WC4A 7ICTA 3C66A 2NRKA 3AU2A 5J0TA 4M47A 4F5NA 4YD1A 2I9GA 4F5RA 4MFCA 3MGIA 4KLMA 2DR8A 1ZQKA 4E80A 4E8FA 4WC2A 5BOMA 4P2HA 5J2HA 4UD4A 7ICQA 4I2AA 9ICEA 5BOLA 4EP7A 2DRBA 1ZQTA 1RPLA 9ICQA 1YLQA 2FMSA 4X5VA 4Z6FA 5IIMA 1PX5A 4RQ7A 3JPRA 2DRAA 4X0AA 8ICZA 3OVSA 3C5GA 8ICCA 1HUOA 1FA0A 4P4MA 2RFFA 5J0WA 2ZH3A 4RQ3A 5D46A 4X4PA 1BPDA 9ICSA 3C5FA 1ZQCA 5J2AA 2ZH1A 9ICPA 1Q78A 2PFNA 4XA5A 7ICMA 4RWNA 7ICLA 2ZH4A 4M9NA 4GXIA 4O5KA 1ZQIA 4NKUA 3V7KA 3ISCA 4AT7A 2VANA 5J2DA 1MQ3A 3V7JA 4JWMA 1BPYA 2O5AA 1NO5A 1ZQLA 7ICSA 4FHYA 1HUZA 3UXOA 5J0QA 4I2JA 3JPQA 7ICRA 3JZ0A 9ICAA 4KLSA 5IIKA 3C18A 8ICVA 4KLOA 4I27A 4WC5A 4PH5A 2BPCA 2ISOA 4M0AA 4I28A 1XSLA 4WC0A 4F5QA 4AT9A 1ZQMA 5CP2A 3HJ4A 4RQ0A 2M2TA 1JQRA 4PGXA 1ZQXA 4M9LA 5D49A 1ZQSA 1UETA 1JN3A 3JPPA 4UAWA 1MIVA 3ISDA 2FMPA 5DB6A 1BPEA 3H38A 4QZBA 1RZTA 1Q79A 4K4HA 2O1PA 1XSPA 2W9MA 4AT7B 3C2LA 8ICAA 1VFGA 4I2IA 5TZVA 8ICLA 3UPSA 4KLDA 4LZGA 3LK9A 1ZQVA 4PPXA 3B0YA 4FHVA 4RT2A 4DOAA 3MBYA 3RJEA 8ICUA 9ICXA 1ZQFA 8ICYA 3WFPA 2M2WA 2P66A 4WC7A 4R65A 4ATBA 7ICFA 5CB1A 3RH6A 4M2YA 4I2FA 4YD2A 4QZ9A 5J2EA 3AQKA 4FHWA 4QZCA 4YN4A 1R8CA 4EBKA 3K75D 3B0XA 5CR0A 2ZH9A 4RQ4A 4YMMA 4PGQA 4I2BA 4AT8A 9ICRA 8ICJA 8ICPA 4NKTA 4E7XA 1ZQJA 4X4NA 5J29A 4UB2A 3MDCA 1ZQEA 2M2UA 7ICKA 2BCRA 5IIOA 4KLIA 8ICGA 2PXIA 4P4PA 3JPNA 5DB8A 4FO6A 9ICTA 5J2BA 2PFOA 5HR9A 2BCSA 4RQ2A 3WFOA 4LT6A 9ICCA 4M5DA 1ZQHA 2ZH7A 1VJ7A 1MQ2A 4M04A 4RPXA 4RWQA 3UXNA 8ICSA 2ZH2A 4R63A 4QZFA 4FH5A 1ZQAA 4XUSA 3WFSC 3HW8A 3RJGA 5IILA 4KLUA 4PHEA 2HHPA 4O5EA 4I29A 5F2VO 4KLGA 4F5OA 9ICHA 9ICUA 1MIYA 7ICEA 3OVBA 4AT8B 4F5PA 4X0BA 4X4VA 5DKWA 4KLTA 4I2HA 4UBCA 4O5CA 1MIWA 5J2CA 4RT3A 4IG8A 3H39A 4QZAA 4XRHA 5J2GA 2DVIA 1BPBA 4NLKA 3TFRA 4KLHA 5DBAA 9ICMA 3OUYA 4YMOA 1JMSA 4X4UA 8ICNA 8ICIA 5CHGA 2DR7A 5D4BA 4QZIA 3RJHA 5J0SA 3HJ1A 1UEVA 3RH5A 5HC9A 5DB7A 4KLJA 4MFFA 5HRIA 7ICHA 9ICBA 8ICMA 9ICWA 4I2DA 2ZH8A 3C2KA 4WC3A 3V72A 4PHPA 9ICOA 4QZEA 2ZH5A 1TFYA 4MF2A 1ZQZA 5IINA 4RWOA 3NYBA 1ZQYA 3AQMA 5DEDA 3HWTA 4R66A 2GWSA 3JPSA 4DO9A 9ICNA 1F5AA 4P4OA 4IQVA 5HRHA 5IIJA 1ZQRA 5CA7A 4TUQA 5J0XA 4UB1A 3TFSA 8ICWA 4O9MA 5HRBA 4XQ8A 3PMLA 5DBCA 4I2GA 1ZJNA 2ZHBA 3UPQA 4Z6EA 2PFQA 1ZQNA 5J2KA 4NXZA 1TV9A 4AT9B 5HHHA 5J0OA 3JPOA 3HIYA 4Z6DA 4NY8A 4KLFA 4RQ8A 4KLEA 3UQ2A 4DOCA 5CWRA 3AU6A 4FHXA 7ICPA 8ICBA 4UB4A 9ICJA 9ICLA 9ICGA 1ZQUA 3H3AA 5DBBA 4IQTA 4LZDA 4K4IA 2PFPA 4NLNA 4WCWA 2FMQA 3WFQE 5HRDA 4WC1A 1KEJA 9ICFA 5HRFA 3LQCB 8ICRA 8ICTA 4RWPA 1BPXA 3PMNA 4DOBA 3RJJA 4K4GA 1R8AA 5HREA 5DB9A 1NOMA 5IIIA 4QZHA 4UB5A 2ID1A 4QZGA 4ATBB 3MDAA 4R64A 4UD5A 4GXKA 2DR5A 8ICXA 4PHAA 3ISBA 2IHMA 4JWNA 2ZHAA 5HRLA 1JAJA 8ICKA 4Z6CA 3OV7A 7ICGA 9ICIA 5J0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPZ A;  1KNY A;  4WBZ A;  4M9J A;  5DDM A;  4MF8 A;  3OGU A;  4X4T A;  4TUR A;  4KLQ A;  3UQ0 A;  3JPT A;  4TUS A;  5DDY A;  1WOT A;  1V4A A;  4XQ7 A;  3UXP A;  4IQU A;  3JYY A;  5J2J A;  3RJI A;  8ICE A;  5HRK A;  4X4R A;  5J2I A;  7ICU A;  3OVA A;  5J0P A;  8ICF A;  3V7L A;  1UEU A;  2BCU A;  4WC6 A;  7ICO A;  2DR9 A;  2M2V A;  4NLZ A;  4QZ8 A;  7ICJ A;  8ICO A;  4UB3 A;  2ISP A;  3WFR E;  4FHP A;  3RJF A;  4PGY A;  4UBB A;  2BCV A;  2Q66 A;  4I2E A;  3AQN A;  1ZQO A;  2BPF A;  8ICH A;  4LVS A;  7ICI A;  4WBY A;  4X4Q A;  4MFA A;  5HHI A;  4YCX A;  3PNC A;  3AUO A;  3RJK A;  8ICQ A;  2ZH6 A;  5J2F A;  2BE3 A;  3MGH A;  1ZQG A;  2BPG A;  5CJ7 A;  5J0Y A;  4QZD A;  3RH4 A;  4I2C A;  3OUY B;  4YMN A;  4PHD A;  1R8B A;  4S3N A;  1ZQB A;  4M9H A;  4NM2 A;  1OU5 A;  1BPZ A;  4NM1 A;  4TUP A;  4KLL A;  9ICV A;  1ZQQ A;  4IQW A;  4UAY A;  1XSN A;  4RQ6 A;  1TVA A;  3GDX A;  1ZQW A;  4M9G A;  4RPY A;  1ZQP A;  5EOZ A;  3AQL A;  2BCQ A;  5J0R A;  4UAZ A;  5HRG A;  4RQ5 A;  4EBJ A;  7ICV A;  5DEC A;  3HX0 A;  1ZJM A;  4X4O A;  4X4S A;  5BPC A;  3H37 A;  4FH3 A;  2PBE A;  9ICK A;  4RQ1 A;  3C2M A;  1KDH A;  1TFW A;  1R89 A;  4GXJ A;  1ZQD A;  7ICN A;  3L9D A;  4WC4 A;  7ICT A;  3C66 A;  2NRK A;  3AU2 A;  5J0T A;  4M47 A;  4F5N A;  4YD1 A;  2I9G A;  4F5R A;  4MFC A;  3MGI A;  4KLM A;  2DR8 A;  1ZQK A;  4E80 A;  4E8F A;  4WC2 A;  5BOM A;  4P2H A;  5J2H A;  4UD4 A;  7ICQ A;  4I2A A;  9ICE A;  5BOL A;  4EP7 A;  2DRB A;  1ZQT A;  1RPL A;  9ICQ A;  1YLQ A;  2FMS A;  4X5V A;  4Z6F A;  5IIM A;  1PX5 A;  4RQ7 A;  3JPR A;  2DRA A;  4X0A A;  8ICZ A;  3OVS A;  3C5G A;  8ICC A;  1HUO A;  1FA0 A;  4P4M A;  2RFF A;  5J0W A;  2ZH3 A;  4RQ3 A;  5D46 A;  4X4P A;  1BPD A;  9ICS A;  3C5F A;  1ZQC A;  5J2A A;  2ZH1 A;  9ICP A;  1Q78 A;  2PFN A;  4XA5 A;  7ICM A;  4RWN A;  7ICL A;  2ZH4 A;  4M9N A;  4GXI A;  4O5K A;  1ZQI A;  4NKU A;  3V7K A;  3ISC A;  4AT7 A;  2VAN A;  5J2D A;  1MQ3 A;  3V7J A;  4JWM A;  1BPY A;  2O5A A;  1NO5 A;  1ZQL A;  7ICS A;  4FHY A;  1HUZ A;  3UXO A;  5J0Q A;  4I2J A;  3JPQ A;  7ICR A;  3JZ0 A;  9ICA A;  4KLS A;  5IIK A;  3C18 A;  8ICV A;  4KLO A;  4I27 A;  4WC5 A;  4PH5 A;  2BPC A;  2ISO A;  4M0A A;  4I28 A;  1XSL A;  4WC0 A;  4F5Q A;  4AT9 A;  1ZQM A;  5CP2 A;  3HJ4 A;  4RQ0 A;  2M2T A;  1JQR A;  4PGX A;  1ZQX A;  4M9L A;  5D49 A;  1ZQS A;  1UET A;  1JN3 A;  3JPP A;  4UAW A;  1MIV A;  3ISD A;  2FMP A;  5DB6 A;  1BPE A;  3H38 A;  4QZB A;  1RZT A;  1Q79 A;  4K4H A;  2O1P A;  1XSP A;  2W9M A;  4AT7 B;  3C2L A;  8ICA A;  1VFG A;  4I2I A;  5TZV A;  8ICL A;  3UPS A;  4KLD A;  4LZG A;  3LK9 A;  1ZQV A;  4PPX A;  3B0Y A;  4FHV A;  4RT2 A;  4DOA A;  3MBY A;  3RJE A;  8ICU A;  9ICX A;  1ZQF A;  8ICY A;  3WFP A;  2M2W A;  2P66 A;  4WC7 A;  4R65 A;  4ATB A;  7ICF A;  5CB1 A;  3RH6 A;  4M2Y A;  4I2F A;  4YD2 A;  4QZ9 A;  5J2E A;  3AQK A;  4FHW A;  4QZC A;  4YN4 A;  1R8C A;  4EBK A;  3K75 D;  3B0X A;  5CR0 A;  2ZH9 A;  4RQ4 A;  4YMM A;  4PGQ A;  4I2B A;  4AT8 A;  9ICR A;  8ICJ A;  8ICP A;  4NKT A;  4E7X A;  1ZQJ A;  4X4N A;  5J29 A;  4UB2 A;  3MDC A;  1ZQE A;  2M2U A;  7ICK A;  2BCR A;  5IIO A;  4KLI A;  8ICG A;  2PXI A;  4P4P A;  3JPN A;  5DB8 A;  4FO6 A;  9ICT A;  5J2B A;  2PFO A;  5HR9 A;  2BCS A;  4RQ2 A;  3WFO A;  4LT6 A;  9ICC A;  4M5D A;  1ZQH A;  2ZH7 A;  1VJ7 A;  1MQ2 A;  4M04 A;  4RPX A;  4RWQ A;  3UXN A;  8ICS A;  2ZH2 A;  4R63 A;  4QZF A;  4FH5 A;  1ZQA A;  4XUS A;  3WFS C;  3HW8 A;  3RJG A;  5IIL A;  4KLU A;  4PHE A;  2HHP A;  4O5E A;  4I29 A;  5F2V O;  4KLG A;  4F5O A;  9ICH A;  9ICU A;  1MIY A;  7ICE A;  3OVB A;  4AT8 B;  4F5P A;  4X0B A;  4X4V A;  5DKW A;  4KLT A;  4I2H A;  4UBC A;  4O5C A;  1MIW A;  5J2C A;  4RT3 A;  4IG8 A;  3H39 A;  4QZA A;  4XRH A;  5J2G A;  2DVI A;  1BPB A;  4NLK A;  3TFR A;  4KLH A;  5DBA A;  9ICM A;  3OUY A;  4YMO A;  1JMS A;  4X4U A;  8ICN A;  8ICI A;  5CHG A;  2DR7 A;  5D4B A;  4QZI A;  3RJH A;  5J0S A;  3HJ1 A;  1UEV A;  3RH5 A;  5HC9 A;  5DB7 A;  4KLJ A;  4MFF A;  5HRI A;  7ICH A;  9ICB A;  8ICM A;  9ICW A;  4I2D A;  2ZH8 A;  3C2K A;  4WC3 A;  3V72 A;  4PHP A;  9ICO A;  4QZE A;  2ZH5 A;  1TFY A;  4MF2 A;  1ZQZ A;  5IIN A;  4RWO A;  3NYB A;  1ZQY A;  3AQM A;  5DED A;  3HWT A;  4R66 A;  2GWS A;  3JPS A;  4DO9 A;  9ICN A;  1F5A A;  4P4O A;  4IQV A;  5HRH A;  5IIJ A;  1ZQR A;  5CA7 A;  4TUQ A;  5J0X A;  4UB1 A;  3TFS A;  8ICW A;  4O9M A;  5HRB A;  4XQ8 A;  3PML A;  5DBC A;  4I2G A;  1ZJN A;  2ZHB A;  3UPQ A;  4Z6E A;  2PFQ A;  1ZQN A;  5J2K A;  4NXZ A;  1TV9 A;  4AT9 B;  5HHH A;  5J0O A;  3JPO A;  3HIY A;  4Z6D A;  4NY8 A;  4KLF A;  4RQ8 A;  4KLE A;  3UQ2 A;  4DOC A;  5CWR A;  3AU6 A;  4FHX A;  7ICP A;  8ICB A;  4UB4 A;  9ICJ A;  9ICL A;  9ICG A;  1ZQU A;  3H3A A;  5DBB A;  4IQT A;  4LZD A;  4K4I A;  2PFP A;  4NLN A;  4WCW A;  2FMQ A;  3WFQ E;  5HRD A;  4WC1 A;  1KEJ A;  9ICF A;  5HRF A;  3LQC B;  8ICR A;  8ICT A;  4RWP A;  1BPX A;  3PMN A;  4DOB A;  3RJJ A;  4K4G A;  1R8A A;  5HRE A;  5DB9 A;  1NOM A;  5III A;  4QZH A;  4UB5 A;  2ID1 A;  4QZG A;  4ATB B;  3MDA A;  4R64 A;  4UD5 A;  4GXK A;  2DR5 A;  8ICX A;  4PHA A;  3ISB A;  2IHM A;  4JWN A;  2ZHA A;  5HRL A;  1JAJ A;  8ICK A;  4Z6C A;  3OV7 A;  7ICG A;  9ICI A;  5J0U A; 
#chains in the Genus database with same CATH topology
 4RPZ A;  1KNY A;  4O68 A;  4XJE A;  4WBZ A;  4M9J A;  5DDM A;  4MF8 A;  3OGU A;  4X4T A;  4TUR A;  4KLQ A;  3UQ0 A;  3JPT A;  4TUS A;  5DDY A;  1WOT A;  1V4A A;  4NXT A;  4XQ7 A;  3UXP A;  4IQU A;  3JYY A;  5J2J A;  5D61 A;  3RJI A;  8ICE A;  4I0U A;  5HRK A;  4X4R A;  5J2I A;  7ICU A;  4KM5 A;  3OVA A;  5J0P A;  8ICF A;  3V7L A;  1UEU A;  2BCU A;  4WC6 A;  4MKP A;  7ICO A;  2DR9 A;  2M2V A;  4NLZ A;  4O69 A;  4QZ8 A;  7ICJ A;  8ICO A;  4UB3 A;  2ISP A;  3WFR E;  4FHP A;  3RJF A;  4PGY A;  4UBB A;  2BCV A;  5D62 A;  2Q66 A;  4I2E A;  3AQN A;  1ZQO A;  2BPF A;  2GA9 D;  8ICH A;  4LVS A;  7ICI A;  4WBY A;  4X4Q A;  4MFA A;  5HHI A;  4YCX A;  3PNC A;  3AUO A;  3RJK A;  8ICQ A;  4JLZ A;  2ZH6 A;  5J2F A;  2BE3 A;  3MGH A;  1ZQG A;  2BPG A;  5CJ7 A;  5J0Y A;  4QZD A;  3PHZ A;  3RH4 A;  4I2C A;  3OUY B;  4YMN A;  4PHD A;  1R8B A;  4NXW A;  4S3N A;  1ZQB A;  4M9H A;  4NM2 A;  1OU5 A;  1BPZ A;  4NM1 A;  4TUP A;  3NVO A;  4KLL A;  9ICV A;  1ZQQ A;  4IQW A;  4UAY A;  4WQL A;  1XSN A;  4RQ6 A;  1TVA A;  4NXX A;  3GDX A;  1ZQW A;  4M9G A;  4RPY A;  1ZQP A;  5EOZ A;  3AQL A;  2BCQ A;  5J0R A;  4UAZ A;  5HRG A;  4RQ5 A;  4EBJ A;  7ICV A;  3CK6 A;  2IHO A;  5DEC A;  3HX0 A;  1ZJM A;  3NWI A;  4X4O A;  4X4S A;  4LEV A;  5BPC A;  3H37 A;  4FH3 A;  2PBE A;  9ICK A;  3EF2 A;  4RQ1 A;  3C2M A;  1KDH A;  1TFW A;  5B3Q A;  4K9B A;  1R89 A;  4GXJ A;  1ZQD A;  7ICN A;  3L9D A;  3ER9 B;  4WC4 A;  7ICT A;  3C66 A;  4NXV A;  4K8V A;  2NRK A;  3AU2 A;  5J0T A;  4M47 A;  4F5N A;  4YD1 A;  2I9G A;  4F5R A;  4MFC A;  3MGI A;  4KLM A;  2DR8 A;  1ZQK A;  4E80 A;  4E8F A;  4WC2 A;  5BOM A;  4P2H A;  5J2H A;  4UD4 A;  7ICQ A;  4I2A A;  9ICE A;  4OAF A;  5BOL A;  4EP7 A;  2DRB A;  1ZQT A;  1RPL A;  9ICQ A;  1YLQ A;  2FMS A;  4X5V A;  4Z6F A;  5IIM A;  1PX5 A;  4WQK A;  4RQ7 A;  3JPR A;  2DRA A;  5JTG A;  4X0A A;  8ICZ A;  3OVS A;  3C5G A;  8ICC A;  1HUO A;  1FA0 A;  4P4M A;  2B51 A;  2RFF A;  5J0W A;  2ZH3 A;  4K96 A;  4LEZ A;  4RQ3 A;  5D46 A;  4X4P A;  1BPD A;  9ICS A;  3C5F A;  1ZQC A;  5J2A A;  2ZH1 A;  9ICP A;  1Q78 A;  2PFN A;  4XA5 A;  7ICM A;  4RWN A;  7ICL A;  2ZH4 A;  4M9N A;  4GXI A;  4O5K A;  1ZQI A;  4NKU A;  3V7K A;  3ISC A;  5CHE A;  4AT7 A;  2VAN A;  5J2D A;  4N7R A;  1MQ3 A;  3V7J A;  4JWM A;  1BPY A;  2O5A A;  1NO5 A;  1ZQL A;  7ICS A;  5CFT A;  4FHY A;  1HUZ A;  3UXO A;  5J0Q A;  4I2J A;  3JPQ A;  7ICR A;  3JZ0 A;  9ICA A;  4KLS A;  5IIK A;  3C18 A;  4O67 A;  8ICV A;  5B3P A;  4KLO A;  4I27 A;  4WC5 A;  4PH5 A;  2BPC A;  5CFS A;  2ISO A;  4M0A A;  4I28 A;  1XSL A;  4WC0 A;  4F5Q A;  4AT9 A;  1ZQM A;  5CP2 A;  3HJ4 A;  4RQ0 A;  2M2T A;  1JQR A;  4PGX A;  1ZQX A;  4M9L A;  5D49 A;  1ZQS A;  1UET A;  5CFU A;  1JN3 A;  3JPP A;  4UAW A;  2BBH A;  1MIV A;  3ISD A;  4LEY A;  2FMP A;  5DB6 A;  2B4V A;  1BPE A;  3H38 A;  1GPJ A;  4EED A;  4QZB A;  1RZT A;  4WOY A;  1Q79 A;  4K4H A;  2O1P A;  1XSP A;  2W9M A;  4AT7 B;  3C2L A;  8ICA A;  1VFG A;  4I2I A;  5TZV A;  8ICL A;  3UPS A;  4KLD A;  4LZG A;  3LK9 A;  1ZQV A;  4PPX A;  3B0Y A;  4KB6 A;  4FHV A;  4RT2 A;  4DOA A;  4EGW A;  3MBY A;  3RJE A;  8ICU A;  9ICX A;  1ZQF A;  8ICY A;  3WFP A;  2M2W A;  2P66 A;  4LEW A;  4WC7 A;  4R65 A;  4ATB A;  7ICF A;  5CB1 A;  3MCR A;  3RH6 A;  4M2Y A;  4I2F A;  4YD2 A;  4QZ9 A;  5J2E A;  3AQK A;  5D63 A;  4FHW A;  4QZC A;  4YN4 A;  1R8C A;  4OAG A;  4EBK A;  3K75 D;  3B0X A;  5CR0 A;  2ZH9 A;  4RQ4 A;  4YMM A;  4PGQ A;  4I2B A;  4AT8 A;  4FO1 A;  9ICR A;  8ICJ A;  8ICP A;  4NKT A;  4E7X A;  2EWR A;  1ZQJ A;  4X4N A;  4WH5 A;  5J29 A;  4UB2 A;  3MDC A;  1ZQE A;  2M2U A;  7ICK A;  2BCR A;  5IIO A;  4KLI A;  8ICG A;  2PXI A;  4P4P A;  3JPN A;  5DB8 A;  4FO6 A;  9ICT A;  5J2B A;  2PFO A;  5HR9 A;  2BCS A;  4RQ2 A;  3WFO A;  4LT6 A;  9ICC A;  4M5D A;  1ZQH A;  2ZH7 A;  1VJ7 A;  1MQ2 A;  4M04 A;  3ER8 C;  4RPX A;  4RWQ A;  3UXN A;  8ICS A;  2ZH2 A;  4R63 A;  4QZF A;  4FH5 A;  1ZQA A;  4XUS A;  3WFS C;  3HW8 A;  3RJG A;  5IIL A;  4KLU A;  4PHE A;  2HHP A;  4O5E A;  4I29 A;  5F2V O;  4KLG A;  4F5O A;  4O6A A;  9ICH A;  9ICU A;  4K97 A;  1MIY A;  7ICE A;  3OVB A;  4AT8 B;  4F5P A;  4X0B A;  4X4V A;  5DKW A;  4KLT A;  4I2H A;  4UBC A;  4O5C A;  1MIW A;  5J2C A;  4RT3 A;  4IG8 A;  3H39 A;  4QZA A;  4XRH A;  5J2G A;  2DVI A;  1BPB A;  4NLK A;  3TFR A;  4KLH A;  5DBA A;  9ICM A;  3OUY A;  4YMO A;  1JMS A;  4X4U A;  4EEB A;  8ICN A;  8ICI A;  5CHG A;  4OAH A;  2DR7 A;  5D4B A;  4QZI A;  3RJH A;  5J0S A;  3HJ1 A;  3K7D A;  1UEV A;  3RH5 A;  5HC9 A;  5DB7 A;  4KLJ A;  4MFF A;  5HRI A;  7ICH A;  9ICB A;  8ICM A;  4K99 A;  9ICW A;  4I2D A;  2ZH8 A;  2HN1 A;  3C2K A;  4WC3 A;  4NXU A;  3V72 A;  4PHP A;  9ICO A;  4QZE A;  2ZH5 A;  1TFY A;  4MF2 A;  1ZQZ A;  5IIN A;  4RWO A;  3NYB A;  1ZQY A;  3AQM A;  5DED A;  3HWT A;  4R66 A;  2GWS A;  3JPS A;  4DO9 A;  9ICN A;  1F5A A;  4P4O A;  4IQV A;  5HRH A;  3NKU A;  5IIJ A;  1ZQR A;  5CA7 A;  4TUQ A;  5J0X A;  4JLX A;  4UB1 A;  3TFS A;  8ICW A;  4O9M A;  5HRB A;  3JCF A;  4XQ8 A;  3PML A;  4K9A A;  5DBC A;  4I2G A;  1ZJN A;  2ZHB A;  3UPQ A;  4Z6E A;  2PFQ A;  1ZQN A;  5J2K A;  4NXZ A;  1TV9 A;  4AT9 B;  5HHH A;  5J0O A;  3JPO A;  3HIY A;  4Z6D A;  4EV6 A;  4NY8 A;  4KLF A;  4RQ8 A;  4KLE A;  3UQ2 A;  4DOC A;  5CWR A;  3AU6 A;  4FHX A;  7ICP A;  8ICB A;  4UB4 A;  9ICJ A;  9ICL A;  9ICG A;  1ZQU A;  3H3A A;  5DBB A;  2HN2 A;  3ERC C;  4OAI Z;  4IQT A;  2IUB A;  4LZD A;  4K4I A;  2PFP A;  4NLN A;  2FCL A;  4WCW A;  2FMQ A;  2GAF D;  3WFQ E;  5HRD A;  4WC1 A;  1KEJ A;  9ICF A;  5HRF A;  3LQC B;  8ICR A;  8ICT A;  3OWG A;  1BPX A;  3PMN A;  4DOB A;  3RJJ A;  4RWP A;  4K4G A;  1R8A A;  5HRE A;  5DB9 A;  1NOM A;  5III A;  4QZH A;  4UB5 A;  2ID1 A;  2B56 A;  4QZG A;  4ATB B;  3MDA A;  4R64 A;  4UD5 A;  4GXK A;  2DR5 A;  8ICX A;  4PHA A;  3ISB A;  2IHM A;  4JWN A;  2ZHA A;  5HRL A;  1JAJ A;  8ICK A;  4Z6C A;  4K98 A;  3OV7 A;  2BBJ A;  7ICG A;  4HX0 A;  9ICI A;  5J0U A; 
#chains in the Genus database with same CATH homology
 4RPZ A;  1KNY A;  4WBZ A;  4M9J A;  5DDM A;  4MF8 A;  3OGU A;  4X4T A;  4TUR A;  4KLQ A;  3UQ0 A;  3JPT A;  4TUS A;  5DDY A;  1WOT A;  1V4A A;  4XQ7 A;  3UXP A;  4IQU A;  3JYY A;  5J2J A;  3RJI A;  8ICE A;  5HRK A;  4X4R A;  5J2I A;  7ICU A;  3OVA A;  5J0P A;  8ICF A;  3V7L A;  1UEU A;  2BCU A;  4WC6 A;  7ICO A;  2DR9 A;  2M2V A;  4NLZ A;  4QZ8 A;  7ICJ A;  8ICO A;  4UB3 A;  2ISP A;  3WFR E;  4FHP A;  3RJF A;  4PGY A;  4UBB A;  2BCV A;  2Q66 A;  4I2E A;  3AQN A;  1ZQO A;  2BPF A;  8ICH A;  4LVS A;  7ICI A;  4WBY A;  4X4Q A;  4MFA A;  5HHI A;  4YCX A;  3PNC A;  3AUO A;  3RJK A;  8ICQ A;  2ZH6 A;  5J2F A;  2BE3 A;  3MGH A;  1ZQG A;  2BPG A;  5CJ7 A;  5J0Y A;  4QZD A;  3RH4 A;  4I2C A;  3OUY B;  4YMN A;  4PHD A;  1R8B A;  4S3N A;  1ZQB A;  4M9H A;  4NM2 A;  1OU5 A;  1BPZ A;  4NM1 A;  4TUP A;  4KLL A;  9ICV A;  1ZQQ A;  4IQW A;  4UAY A;  1XSN A;  4RQ6 A;  1TVA A;  3GDX A;  1ZQW A;  4M9G A;  4RPY A;  1ZQP A;  5EOZ A;  3AQL A;  2BCQ A;  5J0R A;  4UAZ A;  5HRG A;  4RQ5 A;  4EBJ A;  7ICV A;  5DEC A;  3HX0 A;  1ZJM A;  4X4O A;  4X4S A;  5BPC A;  3H37 A;  4FH3 A;  2PBE A;  9ICK A;  4RQ1 A;  3C2M A;  1KDH A;  1TFW A;  1R89 A;  4GXJ A;  1ZQD A;  7ICN A;  3L9D A;  4WC4 A;  7ICT A;  3C66 A;  2NRK A;  3AU2 A;  5J0T A;  4M47 A;  4F5N A;  4YD1 A;  2I9G A;  4F5R A;  4MFC A;  3MGI A;  4KLM A;  2DR8 A;  1ZQK A;  4E80 A;  4E8F A;  4WC2 A;  5BOM A;  4P2H A;  5J2H A;  4UD4 A;  7ICQ A;  4I2A A;  9ICE A;  5BOL A;  4EP7 A;  2DRB A;  1ZQT A;  1RPL A;  9ICQ A;  1YLQ A;  2FMS A;  4X5V A;  4Z6F A;  5IIM A;  1PX5 A;  4RQ7 A;  3JPR A;  2DRA A;  4X0A A;  8ICZ A;  3OVS A;  3C5G A;  8ICC A;  1HUO A;  1FA0 A;  4P4M A;  2RFF A;  5J0W A;  2ZH3 A;  4RQ3 A;  5D46 A;  4X4P A;  1BPD A;  9ICS A;  3C5F A;  1ZQC A;  5J2A A;  2ZH1 A;  9ICP A;  1Q78 A;  2PFN A;  4XA5 A;  7ICM A;  4RWN A;  7ICL A;  2ZH4 A;  4M9N A;  4GXI A;  4O5K A;  1ZQI A;  4NKU A;  3V7K A;  3ISC A;  4AT7 A;  2VAN A;  5J2D A;  1MQ3 A;  3V7J A;  4JWM A;  1BPY A;  2O5A A;  1NO5 A;  1ZQL A;  7ICS A;  4FHY A;  1HUZ A;  3UXO A;  5J0Q A;  4I2J A;  3JPQ A;  7ICR A;  3JZ0 A;  9ICA A;  4KLS A;  5IIK A;  3C18 A;  8ICV A;  4KLO A;  4I27 A;  4WC5 A;  4PH5 A;  2BPC A;  2ISO A;  4M0A A;  4I28 A;  1XSL A;  4WC0 A;  4F5Q A;  4AT9 A;  1ZQM A;  5CP2 A;  3HJ4 A;  4RQ0 A;  2M2T A;  1JQR A;  4PGX A;  1ZQX A;  4M9L A;  5D49 A;  1ZQS A;  1UET A;  1JN3 A;  3JPP A;  4UAW A;  1MIV A;  3ISD A;  2FMP A;  5DB6 A;  1BPE A;  3H38 A;  4QZB A;  1RZT A;  1Q79 A;  4K4H A;  2O1P A;  1XSP A;  2W9M A;  4AT7 B;  3C2L A;  8ICA A;  1VFG A;  4I2I A;  5TZV A;  8ICL A;  3UPS A;  4KLD A;  4LZG A;  3LK9 A;  1ZQV A;  4PPX A;  3B0Y A;  4FHV A;  4RT2 A;  4DOA A;  3MBY A;  3RJE A;  8ICU A;  9ICX A;  1ZQF A;  8ICY A;  3WFP A;  2M2W A;  2P66 A;  4WC7 A;  4R65 A;  4ATB A;  7ICF A;  5CB1 A;  3RH6 A;  4M2Y A;  4I2F A;  4YD2 A;  4QZ9 A;  5J2E A;  3AQK A;  4FHW A;  4QZC A;  4YN4 A;  1R8C A;  4EBK A;  3K75 D;  3B0X A;  5CR0 A;  2ZH9 A;  4RQ4 A;  4YMM A;  4PGQ A;  4I2B A;  4AT8 A;  9ICR A;  8ICJ A;  8ICP A;  4NKT A;  4E7X A;  1ZQJ A;  4X4N A;  5J29 A;  4UB2 A;  3MDC A;  1ZQE A;  2M2U A;  7ICK A;  2BCR A;  5IIO A;  4KLI A;  8ICG A;  2PXI A;  4P4P A;  3JPN A;  5DB8 A;  4FO6 A;  9ICT A;  5J2B A;  2PFO A;  5HR9 A;  2BCS A;  4RQ2 A;  3WFO A;  4LT6 A;  9ICC A;  4M5D A;  1ZQH A;  2ZH7 A;  1VJ7 A;  1MQ2 A;  4M04 A;  4RPX A;  4RWQ A;  3UXN A;  8ICS A;  2ZH2 A;  4R63 A;  4QZF A;  4FH5 A;  1ZQA A;  4XUS A;  3WFS C;  3HW8 A;  3RJG A;  5IIL A;  4KLU A;  4PHE A;  2HHP A;  4O5E A;  4I29 A;  5F2V O;  4KLG A;  4F5O A;  9ICH A;  9ICU A;  1MIY A;  7ICE A;  3OVB A;  4AT8 B;  4F5P A;  4X0B A;  4X4V A;  5DKW A;  4KLT A;  4I2H A;  4UBC A;  4O5C A;  1MIW A;  5J2C A;  4RT3 A;  4IG8 A;  3H39 A;  4QZA A;  4XRH A;  5J2G A;  2DVI A;  1BPB A;  4NLK A;  3TFR A;  4KLH A;  5DBA A;  9ICM A;  3OUY A;  4YMO A;  1JMS A;  4X4U A;  8ICN A;  8ICI A;  5CHG A;  2DR7 A;  5D4B A;  4QZI A;  3RJH A;  5J0S A;  3HJ1 A;  1UEV A;  3RH5 A;  5HC9 A;  5DB7 A;  4KLJ A;  4MFF A;  5HRI A;  7ICH A;  9ICB A;  8ICM A;  9ICW A;  4I2D A;  2ZH8 A;  3C2K A;  4WC3 A;  3V72 A;  4PHP A;  9ICO A;  4QZE A;  2ZH5 A;  1TFY A;  4MF2 A;  1ZQZ A;  5IIN A;  4RWO A;  3NYB A;  1ZQY A;  3AQM A;  5DED A;  3HWT A;  4R66 A;  2GWS A;  3JPS A;  4DO9 A;  9ICN A;  1F5A A;  4P4O A;  4IQV A;  5HRH A;  5IIJ A;  1ZQR A;  5CA7 A;  4TUQ A;  5J0X A;  4UB1 A;  3TFS A;  8ICW A;  4O9M A;  5HRB A;  4XQ8 A;  3PML A;  5DBC A;  4I2G A;  1ZJN A;  2ZHB A;  3UPQ A;  4Z6E A;  2PFQ A;  1ZQN A;  5J2K A;  4NXZ A;  1TV9 A;  4AT9 B;  5HHH A;  5J0O A;  3JPO A;  3HIY A;  4Z6D A;  4NY8 A;  4KLF A;  4RQ8 A;  4KLE A;  3UQ2 A;  4DOC A;  5CWR A;  3AU6 A;  4FHX A;  7ICP A;  8ICB A;  4UB4 A;  9ICJ A;  9ICL A;  9ICG A;  1ZQU A;  3H3A A;  5DBB A;  4IQT A;  4LZD A;  4K4I A;  2PFP A;  4NLN A;  4WCW A;  2FMQ A;  3WFQ E;  5HRD A;  4WC1 A;  1KEJ A;  9ICF A;  5HRF A;  3LQC B;  8ICR A;  8ICT A;  4RWP A;  1BPX A;  3PMN A;  4DOB A;  3RJJ A;  4K4G A;  1R8A A;  5HRE A;  5DB9 A;  1NOM A;  5III A;  4QZH A;  4UB5 A;  2ID1 A;  4QZG A;  4ATB B;  3MDA A;  4R64 A;  4UD5 A;  4GXK A;  2DR5 A;  8ICX A;  4PHA A;  3ISB A;  2IHM A;  4JWN A;  2ZHA A;  5HRL A;  1JAJ A;  8ICK A;  4Z6C A;  3OV7 A;  7ICG A;  9ICI A;  5J0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...