5HRFA

The crystal structure of asfvpolx: dna5: dgtp ternary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
SGGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrfA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrfA01
3V7JA 5BOMA 5TZVA 4F5PA 3HJ4A 1UETA 5CB1A 5IIOA 2PFQA 2ZHBA 7ICFA 5DB9A 3UPSA 4M0AA 4S3NA 5IIJA 5J2CA 9ICBA 5IIMA 7ICQA 4TUPA 4QZBA 3UQ2A 4RQ7A 1ZQOA 5DECA 4FHWA 3AU6A 5HRGA 4M9JA 9ICXA 3C2KA 8ICYA 1ZQVA 4I2EA 5J0YA 5J2GA 1ZQUA 9ICLA 7ICIA 4QZEA 1ZQJA 4WC7A 5HREA 7ICTA 1RZTA 5BOLA 1Q79A 4UAWA 2PFOA 2BPFA 3JPQA 3OUYB 9ICIA 4O5KA 1ZQPA 3RJEA 3H38A 3AU2A 1HUZA 4LZDA 2I9GA 1ZQRA 8ICAA 5CR0A 3UXPA 5EOZA 4QZGA 4MFAA 2DR7A 4NY8A 5J0WA 1MIYA 4QZ9A 4F5NA 3TFSA 4UAZA 4UBBA 3WFPA 9ICTA 2M2UA 4UB1A 1ZQQA 4IQTA 7ICHA 3ISBA 5DB7A 4UD5A 5J2FA 2ZH2A 4I2HA 1OU5A 4NKTA 3MBYA 1XSPA 5DKWA 5D4BA 4IQWA 2BCUA 7ICLA 4KLJA 2PBEA 4RWQA 2BCRA 5J2JA 8ICBA 8ICOA 4RT3A 2HHPA 4DOAA 3JPNA 1TV9A 4XUSA 3C2LA 1KEJA 8ICEA 3OVBA 1ZQWA 4PHPA 3RJKA 4NM2A 2FMSA 5DB8A 4RQ2A 2NRKA 1KNYA 1ZQBA 8ICTA 4MFFA 4WC4A 4YCXA 3AUOA 1XSLA 3HWTA 4AT8B 4UAYA 4RWNA 4Z6CA 4TUSA 3AQLA 1ZQEA 3WFRE 8ICIA 1R8BA 3HW8A 3AQKA 4K4GA 4RQ1A 3H37A 4RPYA 3UPQA 3WFQE 4O9MA 5J2KA 4I2FA 9ICCA 1ZQMA 2ISPA 5J0TA 7ICPA 4UD4A 4EBJA 4KLEA 4UB5A 4PPXA 2P66A 4FHVA 4WC3A 3RJHA 2DR5A 1MQ2A 8ICWA 4RQ4A 9ICPA 2Q66A 4NLKA 8ICQA 8ICKA 4YD2A 4XRHA 7ICNA 3WFOA 5DBCA 4NM1A 2BCVA 4X4TA 4R66A 5HR9A 4O5EA 5CWRA 5HRFA 3RH5A 3UXNA 1UEVA 4R64A 4RPXA 2M2WA 4YMOA 4QZCA 1TVAA 8ICGA 5CJ7A 5DB6A 4PHEA 5HRKA 4M47A 1PX5A 3C66A 3L9DA 4XQ8A 4P4MA 4X4NA 1Q78A 8ICHA 3JYYA 2FMPA 2BCQA 3RH6A 5DEDA 9ICMA 4K4HA 1UEUA 5DBAA 5IIIA 4WC5A 2ZH9A 2ZH4A 4KLSA 3MGHA 1BPYA 1MQ3A 4YMMA 3RH4A 4KLIA 3H3AA 1YLQA 9ICEA 4QZAA 1BPXA 1VFGA 1XSNA 4AT9A 2FMQA 4PGQA 1KDHA 4AT9B 4UB4A 4ATBA 7ICJA 4FHPA 4O5CA 4AT8A 4X4OA 7ICOA 3AQMA 4M04A 4FH5A 3RJFA 9ICJA 3UQ0A 4QZ8A 4I2JA 4QZIA 8ICMA 1BPEA 5DDYA 1FA0A 4UBCA 4KLFA 5J2HA 3B0XA 4X4QA 5J0RA 3V72A 3PNCA 2GWSA 2DR9A 3NYBA 5J0SA 1ZQXA 9ICGA 2M2TA 8ICVA 4JWMA 2BPGA 5F2VO 3MDCA 3TFRA 3V7LA 4DOCA 3JPOA 1ZQDA 4KLOA 1V4AA 1MIWA 4PGXA 4I2AA 1NOMA 2ZH5A 7ICRA 9ICUA 4I2BA 4FO6A 3AQNA 4X5VA 4X4RA 4RQ5A 3LK9A 8ICXA 4PGYA 4I2DA 5IIKA 4YMNA 4P4PA 9ICWA 4KLDA 4M9GA 2ID1A 9ICQA 4X0BA 3B0YA 4E7XA 1RPLA 5BPCA 2BCSA 4F5RA 2ZH1A 4IG8A 3GDXA 5IILA 2ZH7A 5J2BA 4GXKA 4NLNA 8ICRA 4LZGA 5HHHA 7ICMA 4GXIA 3OGUA 8ICZA 2VANA 4X4SA 4GXJA 5J0PA 4NXZA 1ZQIA 2ZH8A 2M2VA 5HRBA 4NLZA 4UB2A 4PHAA 5J2AA 5J2IA 4RWPA 3WFSC 4KLUA 7ICKA 4X4PA 4KLHA 7ICVA 7ICEA 1ZQNA 3RJIA 7ICGA 5HRIA 1ZQCA 4M5DA 4RQ8A 4AT7B 4I27A 4Z6FA 1ZJMA 3C2MA 3JPPA 2W9MA 1ZQYA 3OVSA 4I28A 4WBZA 3UXOA 4RQ0A 2DVIA 1BPBA 4KLTA 2ZH6A 4K4IA 3MDAA 4FHXA 4IQUA 2PFNA 4KLQA 1JAJA 8ICCA 3ISCA 9ICKA 1R8AA 1BPZA 4F5QA 4M9NA 3MGIA 4TURA 3JPRA 4PHDA 9ICFA 4PH5A 3JPTA 9ICNA 4EBKA 1JN3A 5HC9A 3HJ1A 1JMSA 1BPDA 4ATBB 3RJGA 4P2HA 4RPZA 1ZQTA 9ICSA 3HX0A 1ZQSA 3HIYA 3JPSA 1JQRA 5J0UA 4KLLA 4WC0A 4MF8A 5IINA 3V7KA 5J0XA 4M2YA 2DRBA 3ISDA 3RJJA 2DR8A 4UB3A 4P4OA 3PMNA 5HRLA 5HRHA 4I29A 4RT2A 1ZQGA 4I2IA 4RWOA 4Z6DA 4XA5A 3OVAA 4IQVA 7ICUA 4FH3A 2ZHAA 4QZDA 4XQ7A 4MF2A 1R8CA 2DRAA 4I2CA 1R89A 4YN4A 1ZQFA 5D46A 4YD1A 2ZH3A 1ZQZA 2ISOA 2PXIA 4KLGA 5DDMA 5DBBA 3OUYA 4X4VA 3C5GA 8ICPA 5D49A 4R63A 4TUQA 9ICVA 4RQ3A 4WC1A 4X4UA 8ICFA 4E8FA 4NKUA 3JZ0A 1WOTA 2O1PA 4AT7A 3K75D 9ICHA 2BPCA 4WC6A 4DO9A 5J2DA 3C18A 1ZQLA 2O5AA 4E80A 5J0OA 5HHIA 4RQ6A 4JWNA 4DOBA 1ZJNA 4QZHA 9ICAA 3OV7A 5HRDA 4QZFA 5CA7A 4R65A 8ICLA 4EP7A 2PFPA 4I2GA 1MIVA 2BE3A 2IHMA 1ZQHA 5J29A 4FHYA 4Z6EA 3H39A 8ICSA 7ICSA 4WBYA 4MFCA 1TFWA 1TFYA 1NO5A 4LVSA 1F5AA 4WCWA 1VJ7A 4M9LA 4WC2A 9ICRA 4KLMA 5CP2A 3LQCB 9ICOA 3PMLA 4LT6A 8ICJA 8ICNA 5CHGA 5J0QA 4F5OA 3C5FA 5J2EA 1HUOA 4M9HA 8ICUA 1ZQKA 1ZQAA 2RFFA 4X0AA
chains in the Genus database with same CATH superfamily
3V7JA 5BOMA 5TZVA 4F5PA 4XJEA 3HJ4A 1UETA 5CB1A 5IIOA 2PFQA 2ZHBA 7ICFA 5DB9A 3UPSA 4M0AA 4S3NA 5IIJA 5J2CA 9ICBA 5IIMA 7ICQA 4K97A 4TUPA 4QZBA 3UQ2A 4RQ7A 1ZQOA 5DECA 4FHWA 3AU6A 5HRGA 4M9JA 9ICXA 3C2KA 8ICYA 1ZQVA 4I2EA 3ER8C 5J0YA 5J2GA 1ZQUA 3JCFA 9ICLA 7ICIA 4LEVA 4QZEA 1ZQJA 4WC7A 5HREA 7ICTA 1RZTA 5BOLA 1Q79A 4UAWA 2PFOA 2BPFA 3JPQA 3OUYB 4WOYA 9ICIA 4O5KA 4NXXA 1ZQPA 3RJEA 3H38A 3NVOA 4K96A 3AU2A 1HUZA 4LZDA 2I9GA 1ZQRA 8ICAA 5CR0A 3UXPA 5EOZA 4QZGA 4MFAA 2DR7A 4NY8A 5J0WA 1MIYA 3OWGA 4QZ9A 4F5NA 4OAFA 3TFSA 4UAZA 4UBBA 3WFPA 9ICTA 2M2UA 1GPJA 4UB1A 1ZQQA 4IQTA 7ICHA 3ISBA 5DB7A 4UD5A 5J2FA 2ZH2A 4I2HA 1OU5A 4NKTA 3MBYA 4N7RA 1XSPA 5DKWA 5D4BA 4IQWA 3NKUA 2BCUA 7ICLA 4KLJA 2PBEA 4RWQA 2BCRA 5J2JA 8ICBA 3NWIA 8ICOA 4RT3A 2HHPA 4DOAA 3JPNA 1TV9A 4XUSA 3C2LA 1KEJA 8ICEA 3OVBA 1ZQWA 5JTGA 4PHPA 3RJKA 4NM2A 2FMSA 2B4VA 5DB8A 4RQ2A 2NRKA 1KNYA 3PHZA 1ZQBA 8ICTA 4MFFA 4WC4A 4YCXA 3AUOA 1XSLA 4EV6A 2EWRA 3HWTA 4AT8B 4UAYA 4RWNA 4Z6CA 4TUSA 3AQLA 1ZQEA 3WFRE 8ICIA 1R8BA 3HW8A 3AQKA 4K4GA 4KM5A 4RQ1A 3H37A 4RPYA 3UPQA 3WFQE 4O9MA 5J2KA 4I2FA 9ICCA 1ZQMA 2ISPA 5J0TA 7ICPA 4UD4A 4WQLA 4EBJA 4KLEA 4UB5A 4PPXA 4K9AA 2P66A 4FHVA 4WC3A 3RJHA 4KB6A 2DR5A 1MQ2A 8ICWA 4RQ4A 9ICPA 2Q66A 4NLKA 8ICQA 8ICKA 4YD2A 4XRHA 7ICNA 3WFOA 5DBCA 4NM1A 2BCVA 4X4TA 4NXUA 4R66A 5HR9A 4LEZA 4O5EA 5CWRA 5HRFA 3RH5A 4MKPA 3UXNA 1UEVA 4R64A 4RPXA 2M2WA 4YMOA 4QZCA 1TVAA 8ICGA 5CJ7A 5DB6A 4PHEA 5HRKA 4M47A 1PX5A 3C66A 3L9DA 3MCRA 4XQ8A 4P4MA 4X4NA 1Q78A 8ICHA 4I0UA 3JYYA 2FMPA 2BCQA 3RH6A 5DEDA 9ICMA 4K4HA 1UEUA 5DBAA 5IIIA 4WC5A 2ZH9A 2ZH4A 4KLSA 3MGHA 1BPYA 1MQ3A 4YMMA 3RH4A 4KLIA 3H3AA 1YLQA 9ICEA 4QZAA 1BPXA 4O69A 1VFGA 1XSNA 4AT9A 2FMQA 4PGQA 1KDHA 4AT9B 4UB4A 4ATBA 7ICJA 2HN1A 4FHPA 4O5CA 4AT8A 4K9BA 4X4OA 7ICOA 3AQMA 4OAGA 4M04A 4FH5A 3RJFA 9ICJA 3UQ0A 4QZ8A 4I2JA 4QZIA 8ICMA 4O6AA 1BPEA 5DDYA 5D62A 1FA0A 4UBCA 4KLFA 5J2HA 3B0XA 4OAHA 5J0RA 4X4QA 3V72A 3PNCA 2GWSA 2DR9A 4OAIZ 3NYBA 5J0SA 1ZQXA 9ICGA 2M2TA 8ICVA 4JWMA 2BPGA 4EEBA 5F2VO 3MDCA 2IUBA 3TFRA 3V7LA 4DOCA 3JPOA 1ZQDA 4KLOA 5CHEA 1V4AA 1MIWA 4PGXA 4I2AA 1NOMA 2ZH5A 7ICRA 9ICUA 2FCLA 4I2BA 4FO6A 3AQNA 4X5VA 4NXWA 4X4RA 4RQ5A 3LK9A 8ICXA 4PGYA 4I2DA 5IIKA 4YMNA 4P4PA 9ICWA 4HX0A 4KLDA 4M9GA 2ID1A 9ICQA 4X0BA 3B0YA 4E7XA 1RPLA 5BPCA 2BCSA 4F5RA 2ZH1A 4IG8A 3GDXA 5IILA 2ZH7A 5J2BA 4GXKA 4NLNA 8ICRA 2BBJA 2B51A 4LZGA 5HHHA 7ICMA 4GXIA 3OGUA 8ICZA 2VANA 4X4SA 4GXJA 5J0PA 4NXZA 1ZQIA 2ZH8A 2M2VA 5HRBA 4NLZA 4UB2A 4PHAA 5J2AA 5J2IA 5D63A 4RWPA 3WFSC 4KLUA 7ICKA 4LEWA 4X4PA 4KLHA 2GA9D 7ICVA 7ICEA 1ZQNA 3RJIA 7ICGA 5HRIA 1ZQCA 4M5DA 4RQ8A 4AT7B 4LEYA 4I27A 4Z6FA 1ZJMA 3C2MA 4JLXA 3JPPA 2W9MA 1ZQYA 3OVSA 4I28A 4WBZA 3UXOA 4RQ0A 4K8VA 4EEDA 2DVIA 1BPBA 3EF2A 4KLTA 2ZH6A 4K4IA 5B3QA 3MDAA 4FHXA 4IQUA 2PFNA 4KLQA 1JAJA 8ICCA 3ISCA 9ICKA 1R8AA 1BPZA 4F5QA 4M9NA 3MGIA 4TURA 3JPRA 4PHDA 3K7DA 9ICFA 4PH5A 3JPTA 9ICNA 4EBKA 4WQKA 1JN3A 5HC9A 3HJ1A 1JMSA 5CFTA 4NXVA 1BPDA 4ATBB 3RJGA 4P2HA 4RPZA 4FO1A 2GAFD 1ZQTA 9ICSA 3HX0A 1ZQSA 3HIYA 3JPSA 1JQRA 5J0UA 4KLLA 4WC0A 4MF8A 5IINA 3V7KA 2HN2A 5J0XA 4M2YA 4K98A 2DRBA 3ISDA 3RJJA 2DR8A 4UB3A 4P4OA 3PMNA 5HRLA 5HRHA 4I29A 4RT2A 3ERCC 1ZQGA 5D61A 4I2IA 4RWOA 4Z6DA 4XA5A 3OVAA 4IQVA 7ICUA 4FH3A 2ZHAA 4QZDA 4XQ7A 4NXTA 4MF2A 1R8CA 2DRAA 4I2CA 1R89A 4YN4A 1ZQFA 5D46A 4YD1A 2ZH3A 4EGWA 1ZQZA 2ISOA 2PXIA 4KLGA 5DDMA 5DBBA 3OUYA 4X4VA 3C5GA 8ICPA 5D49A 4R63A 4TUQA 9ICVA 4RQ3A 4WC1A 4X4UA 8ICFA 4E8FA 4JLZA 4NKUA 3JZ0A 1WOTA 2O1PA 4AT7A 3K75D 5B3PA 9ICHA 2BPCA 5CFSA 4WC6A 4DO9A 5J2DA 5CFUA 3C18A 1ZQLA 2O5AA 4E80A 5J0OA 5HHIA 4WH5A 4RQ6A 4JWNA 4DOBA 1ZJNA 4QZHA 9ICAA 3OV7A 5HRDA 4QZFA 5CA7A 4R65A 8ICLA 4EP7A 2PFPA 4I2GA 1MIVA 2BE3A 2IHMA 1ZQHA 5J29A 4FHYA 4Z6EA 3H39A 8ICSA 7ICSA 4WBYA 4MFCA 1TFWA 1TFYA 2IHOA 1NO5A 4LVSA 1F5AA 4WCWA 1VJ7A 4M9LA 4WC2A 9ICRA 4KLMA 3CK6A 5CP2A 3LQCB 3ER9B 9ICOA 3PMLA 4LT6A 8ICJA 4O67A 8ICNA 5CHGA 5J0QA 4K99A 4F5OA 3C5FA 5J2EA 1HUOA 4M9HA 8ICUA 1ZQKA 1ZQAA 2RFFA 2B56A 4O68A 4X0AA 2BBHA
chains in the Genus database with same CATH topology
3V7JA 5BOMA 5TZVA 4F5PA 3HJ4A 1UETA 5CB1A 5IIOA 2PFQA 2ZHBA 7ICFA 5DB9A 3UPSA 4M0AA 4S3NA 5IIJA 5J2CA 9ICBA 5IIMA 7ICQA 4TUPA 4QZBA 3UQ2A 4RQ7A 1ZQOA 5DECA 4FHWA 3AU6A 5HRGA 4M9JA 9ICXA 3C2KA 8ICYA 1ZQVA 4I2EA 5J0YA 5J2GA 1ZQUA 9ICLA 7ICIA 4QZEA 1ZQJA 4WC7A 5HREA 7ICTA 1RZTA 5BOLA 1Q79A 4UAWA 2PFOA 2BPFA 3JPQA 3OUYB 9ICIA 4O5KA 1ZQPA 3RJEA 3H38A 3AU2A 1HUZA 4LZDA 2I9GA 1ZQRA 8ICAA 5CR0A 3UXPA 5EOZA 4QZGA 4MFAA 2DR7A 4NY8A 5J0WA 1MIYA 4QZ9A 4F5NA 3TFSA 4UAZA 4UBBA 3WFPA 9ICTA 2M2UA 4UB1A 1ZQQA 4IQTA 7ICHA 3ISBA 5DB7A 4UD5A 5J2FA 2ZH2A 4I2HA 1OU5A 4NKTA 3MBYA 1XSPA 5DKWA 5D4BA 4IQWA 2BCUA 7ICLA 4KLJA 2PBEA 4RWQA 2BCRA 5J2JA 8ICBA 8ICOA 4RT3A 2HHPA 4DOAA 3JPNA 1TV9A 4XUSA 3C2LA 1KEJA 8ICEA 3OVBA 1ZQWA 4PHPA 3RJKA 4NM2A 2FMSA 5DB8A 4RQ2A 2NRKA 1KNYA 1ZQBA 8ICTA 4MFFA 4WC4A 4YCXA 3AUOA 1XSLA 3HWTA 4AT8B 4UAYA 4RWNA 4Z6CA 4TUSA 3AQLA 1ZQEA 3WFRE 8ICIA 1R8BA 3HW8A 3AQKA 4K4GA 4RQ1A 3H37A 4RPYA 3UPQA 3WFQE 4O9MA 5J2KA 4I2FA 9ICCA 1ZQMA 2ISPA 5J0TA 7ICPA 4UD4A 4EBJA 4KLEA 4UB5A 4PPXA 2P66A 4FHVA 4WC3A 3RJHA 2DR5A 1MQ2A 8ICWA 4RQ4A 9ICPA 2Q66A 4NLKA 8ICQA 8ICKA 4YD2A 4XRHA 7ICNA 3WFOA 5DBCA 4NM1A 2BCVA 4X4TA 4R66A 5HR9A 4O5EA 5CWRA 5HRFA 3RH5A 3UXNA 1UEVA 4R64A 4RPXA 2M2WA 4YMOA 4QZCA 1TVAA 8ICGA 5CJ7A 5DB6A 4PHEA 5HRKA 4M47A 1PX5A 3C66A 3L9DA 4XQ8A 4P4MA 4X4NA 1Q78A 8ICHA 3JYYA 2FMPA 2BCQA 3RH6A 5DEDA 9ICMA 4K4HA 1UEUA 5DBAA 5IIIA 4WC5A 2ZH9A 2ZH4A 4KLSA 3MGHA 1BPYA 1MQ3A 4YMMA 3RH4A 4KLIA 3H3AA 1YLQA 9ICEA 4QZAA 1BPXA 1VFGA 1XSNA 4AT9A 2FMQA 4PGQA 1KDHA 4AT9B 4UB4A 4ATBA 7ICJA 4FHPA 4O5CA 4AT8A 4X4OA 7ICOA 3AQMA 4M04A 4FH5A 3RJFA 9ICJA 3UQ0A 4QZ8A 4I2JA 4QZIA 8ICMA 1BPEA 5DDYA 1FA0A 4UBCA 4KLFA 5J2HA 3B0XA 4X4QA 5J0RA 3V72A 3PNCA 2GWSA 2DR9A 3NYBA 5J0SA 1ZQXA 9ICGA 2M2TA 8ICVA 4JWMA 2BPGA 5F2VO 3MDCA 3TFRA 3V7LA 4DOCA 3JPOA 1ZQDA 4KLOA 1V4AA 1MIWA 4PGXA 4I2AA 1NOMA 2ZH5A 7ICRA 9ICUA 4I2BA 4FO6A 3AQNA 4X5VA 4X4RA 4RQ5A 3LK9A 8ICXA 4PGYA 4I2DA 5IIKA 4YMNA 4P4PA 9ICWA 4KLDA 4M9GA 2ID1A 9ICQA 4X0BA 3B0YA 4E7XA 1RPLA 5BPCA 2BCSA 4F5RA 2ZH1A 4IG8A 3GDXA 5IILA 2ZH7A 5J2BA 4GXKA 4NLNA 8ICRA 4LZGA 5HHHA 7ICMA 4GXIA 3OGUA 8ICZA 2VANA 4X4SA 4GXJA 5J0PA 4NXZA 1ZQIA 2ZH8A 2M2VA 5HRBA 4NLZA 4UB2A 4PHAA 5J2AA 5J2IA 4RWPA 3WFSC 4KLUA 7ICKA 4X4PA 4KLHA 7ICVA 7ICEA 1ZQNA 3RJIA 7ICGA 5HRIA 1ZQCA 4M5DA 4RQ8A 4AT7B 4I27A 4Z6FA 1ZJMA 3C2MA 3JPPA 2W9MA 1ZQYA 3OVSA 4I28A 4WBZA 3UXOA 4RQ0A 2DVIA 1BPBA 4KLTA 2ZH6A 4K4IA 3MDAA 4FHXA 4IQUA 2PFNA 4KLQA 1JAJA 8ICCA 3ISCA 9ICKA 1R8AA 1BPZA 4F5QA 4M9NA 3MGIA 4TURA 3JPRA 4PHDA 9ICFA 4PH5A 3JPTA 9ICNA 4EBKA 1JN3A 5HC9A 3HJ1A 1JMSA 1BPDA 4ATBB 3RJGA 4P2HA 4RPZA 1ZQTA 9ICSA 3HX0A 1ZQSA 3HIYA 3JPSA 1JQRA 5J0UA 4KLLA 4WC0A 4MF8A 5IINA 3V7KA 5J0XA 4M2YA 2DRBA 3ISDA 3RJJA 2DR8A 4UB3A 4P4OA 3PMNA 5HRLA 5HRHA 4I29A 4RT2A 1ZQGA 4I2IA 4RWOA 4Z6DA 4XA5A 3OVAA 4IQVA 7ICUA 4FH3A 2ZHAA 4QZDA 4XQ7A 4MF2A 1R8CA 2DRAA 4I2CA 1R89A 4YN4A 1ZQFA 5D46A 4YD1A 2ZH3A 1ZQZA 2ISOA 2PXIA 4KLGA 5DDMA 5DBBA 3OUYA 4X4VA 3C5GA 8ICPA 5D49A 4R63A 4TUQA 9ICVA 4RQ3A 4WC1A 4X4UA 8ICFA 4E8FA 4NKUA 3JZ0A 1WOTA 2O1PA 4AT7A 3K75D 9ICHA 2BPCA 4WC6A 4DO9A 5J2DA 3C18A 1ZQLA 2O5AA 4E80A 5J0OA 5HHIA 4RQ6A 4JWNA 4DOBA 1ZJNA 4QZHA 9ICAA 3OV7A 5HRDA 4QZFA 5CA7A 4R65A 8ICLA 4EP7A 2PFPA 4I2GA 1MIVA 2BE3A 2IHMA 1ZQHA 5J29A 4FHYA 4Z6EA 3H39A 8ICSA 7ICSA 4WBYA 4MFCA 1TFWA 1TFYA 1NO5A 4LVSA 1F5AA 4WCWA 1VJ7A 4M9LA 4WC2A 9ICRA 4KLMA 5CP2A 3LQCB 9ICOA 3PMLA 4LT6A 8ICJA 8ICNA 5CHGA 5J0QA 4F5OA 3C5FA 5J2EA 1HUOA 4M9HA 8ICUA 1ZQKA 1ZQAA 2RFFA 4X0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7J A;  5BOM A;  5TZV A;  4F5P A;  3HJ4 A;  1UET A;  5CB1 A;  5IIO A;  2PFQ A;  2ZHB A;  7ICF A;  5DB9 A;  3UPS A;  4M0A A;  4S3N A;  5IIJ A;  5J2C A;  9ICB A;  5IIM A;  7ICQ A;  4TUP A;  4QZB A;  3UQ2 A;  4RQ7 A;  1ZQO A;  5DEC A;  4FHW A;  3AU6 A;  5HRG A;  4M9J A;  9ICX A;  3C2K A;  8ICY A;  1ZQV A;  4I2E A;  5J0Y A;  5J2G A;  1ZQU A;  9ICL A;  7ICI A;  4QZE A;  1ZQJ A;  4WC7 A;  5HRE A;  7ICT A;  1RZT A;  5BOL A;  1Q79 A;  4UAW A;  2PFO A;  2BPF A;  3JPQ A;  3OUY B;  9ICI A;  4O5K A;  1ZQP A;  3RJE A;  3H38 A;  3AU2 A;  1HUZ A;  4LZD A;  2I9G A;  1ZQR A;  8ICA A;  5CR0 A;  3UXP A;  5EOZ A;  4QZG A;  4MFA A;  2DR7 A;  4NY8 A;  5J0W A;  1MIY A;  4QZ9 A;  4F5N A;  3TFS A;  4UAZ A;  4UBB A;  3WFP A;  9ICT A;  2M2U A;  4UB1 A;  1ZQQ A;  4IQT A;  7ICH A;  3ISB A;  5DB7 A;  4UD5 A;  5J2F A;  2ZH2 A;  4I2H A;  1OU5 A;  4NKT A;  3MBY A;  1XSP A;  5DKW A;  5D4B A;  4IQW A;  2BCU A;  7ICL A;  4KLJ A;  2PBE A;  4RWQ A;  2BCR A;  5J2J A;  8ICB A;  8ICO A;  4RT3 A;  2HHP A;  4DOA A;  3JPN A;  1TV9 A;  4XUS A;  3C2L A;  1KEJ A;  8ICE A;  3OVB A;  1ZQW A;  4PHP A;  3RJK A;  4NM2 A;  2FMS A;  5DB8 A;  4RQ2 A;  2NRK A;  1KNY A;  1ZQB A;  8ICT A;  4MFF A;  4WC4 A;  4YCX A;  3AUO A;  1XSL A;  3HWT A;  4AT8 B;  4UAY A;  4RWN A;  4Z6C A;  4TUS A;  3AQL A;  1ZQE A;  3WFR E;  8ICI A;  1R8B A;  3HW8 A;  3AQK A;  4K4G A;  4RQ1 A;  3H37 A;  4RPY A;  3UPQ A;  3WFQ E;  4O9M A;  5J2K A;  4I2F A;  9ICC A;  1ZQM A;  2ISP A;  5J0T A;  7ICP A;  4UD4 A;  4EBJ A;  4KLE A;  4UB5 A;  4PPX A;  2P66 A;  4FHV A;  4WC3 A;  3RJH A;  2DR5 A;  1MQ2 A;  8ICW A;  4RQ4 A;  9ICP A;  2Q66 A;  4NLK A;  8ICQ A;  8ICK A;  4YD2 A;  4XRH A;  7ICN A;  3WFO A;  5DBC A;  4NM1 A;  2BCV A;  4X4T A;  4R66 A;  5HR9 A;  4O5E A;  5CWR A;  5HRF A;  3RH5 A;  3UXN A;  1UEV A;  4R64 A;  4RPX A;  2M2W A;  4YMO A;  4QZC A;  1TVA A;  8ICG A;  5CJ7 A;  5DB6 A;  4PHE A;  5HRK A;  4M47 A;  1PX5 A;  3C66 A;  3L9D A;  4XQ8 A;  4P4M A;  4X4N A;  1Q78 A;  8ICH A;  3JYY A;  2FMP A;  2BCQ A;  3RH6 A;  5DED A;  9ICM A;  4K4H A;  1UEU A;  5DBA A;  5III A;  4WC5 A;  2ZH9 A;  2ZH4 A;  4KLS A;  3MGH A;  1BPY A;  1MQ3 A;  4YMM A;  3RH4 A;  4KLI A;  3H3A A;  1YLQ A;  9ICE A;  4QZA A;  1BPX A;  1VFG A;  1XSN A;  4AT9 A;  2FMQ A;  4PGQ A;  1KDH A;  4AT9 B;  4UB4 A;  4ATB A;  7ICJ A;  4FHP A;  4O5C A;  4AT8 A;  4X4O A;  7ICO A;  3AQM A;  4M04 A;  4FH5 A;  3RJF A;  9ICJ A;  3UQ0 A;  4QZ8 A;  4I2J A;  4QZI A;  8ICM A;  1BPE A;  5DDY A;  1FA0 A;  4UBC A;  4KLF A;  5J2H A;  3B0X A;  4X4Q A;  5J0R A;  3V72 A;  3PNC A;  2GWS A;  2DR9 A;  3NYB A;  5J0S A;  1ZQX A;  9ICG A;  2M2T A;  8ICV A;  4JWM A;  2BPG A;  5F2V O;  3MDC A;  3TFR A;  3V7L A;  4DOC A;  3JPO A;  1ZQD A;  4KLO A;  1V4A A;  1MIW A;  4PGX A;  4I2A A;  1NOM A;  2ZH5 A;  7ICR A;  9ICU A;  4I2B A;  4FO6 A;  3AQN A;  4X5V A;  4X4R A;  4RQ5 A;  3LK9 A;  8ICX A;  4PGY A;  4I2D A;  5IIK A;  4YMN A;  4P4P A;  9ICW A;  4KLD A;  4M9G A;  2ID1 A;  9ICQ A;  4X0B A;  3B0Y A;  4E7X A;  1RPL A;  5BPC A;  2BCS A;  4F5R A;  2ZH1 A;  4IG8 A;  3GDX A;  5IIL A;  2ZH7 A;  5J2B A;  4GXK A;  4NLN A;  8ICR A;  4LZG A;  5HHH A;  7ICM A;  4GXI A;  3OGU A;  8ICZ A;  2VAN A;  4X4S A;  4GXJ A;  5J0P A;  4NXZ A;  1ZQI A;  2ZH8 A;  2M2V A;  5HRB A;  4NLZ A;  4UB2 A;  4PHA A;  5J2A A;  5J2I A;  4RWP A;  3WFS C;  4KLU A;  7ICK A;  4X4P A;  4KLH A;  7ICV A;  7ICE A;  1ZQN A;  3RJI A;  7ICG A;  5HRI A;  1ZQC A;  4M5D A;  4RQ8 A;  4AT7 B;  4I27 A;  4Z6F A;  1ZJM A;  3C2M A;  3JPP A;  2W9M A;  1ZQY A;  3OVS A;  4I28 A;  4WBZ A;  3UXO A;  4RQ0 A;  2DVI A;  1BPB A;  4KLT A;  2ZH6 A;  4K4I A;  3MDA A;  4FHX A;  4IQU A;  2PFN A;  4KLQ A;  1JAJ A;  8ICC A;  3ISC A;  9ICK A;  1R8A A;  1BPZ A;  4F5Q A;  4M9N A;  3MGI A;  4TUR A;  3JPR A;  4PHD A;  9ICF A;  4PH5 A;  3JPT A;  9ICN A;  4EBK A;  1JN3 A;  5HC9 A;  3HJ1 A;  1JMS A;  1BPD A;  4ATB B;  3RJG A;  4P2H A;  4RPZ A;  1ZQT A;  9ICS A;  3HX0 A;  1ZQS A;  3HIY A;  3JPS A;  1JQR A;  5J0U A;  4KLL A;  4WC0 A;  4MF8 A;  5IIN A;  3V7K A;  5J0X A;  4M2Y A;  2DRB A;  3ISD A;  3RJJ A;  2DR8 A;  4UB3 A;  4P4O A;  3PMN A;  5HRL A;  5HRH A;  4I29 A;  4RT2 A;  1ZQG A;  4I2I A;  4RWO A;  4Z6D A;  4XA5 A;  3OVA A;  4IQV A;  7ICU A;  4FH3 A;  2ZHA A;  4QZD A;  4XQ7 A;  4MF2 A;  1R8C A;  2DRA A;  4I2C A;  1R89 A;  4YN4 A;  1ZQF A;  5D46 A;  4YD1 A;  2ZH3 A;  1ZQZ A;  2ISO A;  2PXI A;  4KLG A;  5DDM A;  5DBB A;  3OUY A;  4X4V A;  3C5G A;  8ICP A;  5D49 A;  4R63 A;  4TUQ A;  9ICV A;  4RQ3 A;  4WC1 A;  4X4U A;  8ICF A;  4E8F A;  4NKU A;  3JZ0 A;  1WOT A;  2O1P A;  4AT7 A;  3K75 D;  9ICH A;  2BPC A;  4WC6 A;  4DO9 A;  5J2D A;  3C18 A;  1ZQL A;  2O5A A;  4E80 A;  5J0O A;  5HHI A;  4RQ6 A;  4JWN A;  4DOB A;  1ZJN A;  4QZH A;  9ICA A;  3OV7 A;  5HRD A;  4QZF A;  5CA7 A;  4R65 A;  8ICL A;  4EP7 A;  2PFP A;  4I2G A;  1MIV A;  2BE3 A;  2IHM A;  1ZQH A;  5J29 A;  4FHY A;  4Z6E A;  3H39 A;  8ICS A;  7ICS A;  4WBY A;  4MFC A;  1TFW A;  1TFY A;  1NO5 A;  4LVS A;  1F5A A;  4WCW A;  1VJ7 A;  4M9L A;  4WC2 A;  9ICR A;  4KLM A;  5CP2 A;  3LQC B;  9ICO A;  3PML A;  4LT6 A;  8ICJ A;  8ICN A;  5CHG A;  5J0Q A;  4F5O A;  3C5F A;  5J2E A;  1HUO A;  4M9H A;  8ICU A;  1ZQK A;  1ZQA A;  2RFF A;  4X0A A; 
#chains in the Genus database with same CATH topology
 3V7J A;  5BOM A;  5TZV A;  4F5P A;  4XJE A;  3HJ4 A;  1UET A;  5CB1 A;  5IIO A;  2PFQ A;  2ZHB A;  7ICF A;  5DB9 A;  3UPS A;  4M0A A;  4S3N A;  5IIJ A;  5J2C A;  9ICB A;  5IIM A;  7ICQ A;  4K97 A;  4TUP A;  4QZB A;  3UQ2 A;  4RQ7 A;  1ZQO A;  5DEC A;  4FHW A;  3AU6 A;  5HRG A;  4M9J A;  9ICX A;  3C2K A;  8ICY A;  1ZQV A;  4I2E A;  3ER8 C;  5J0Y A;  5J2G A;  1ZQU A;  3JCF A;  9ICL A;  7ICI A;  4LEV A;  4QZE A;  1ZQJ A;  4WC7 A;  5HRE A;  7ICT A;  1RZT A;  5BOL A;  1Q79 A;  4UAW A;  2PFO A;  2BPF A;  3JPQ A;  3OUY B;  4WOY A;  9ICI A;  4O5K A;  4NXX A;  1ZQP A;  3RJE A;  3H38 A;  3NVO A;  4K96 A;  3AU2 A;  1HUZ A;  4LZD A;  2I9G A;  1ZQR A;  8ICA A;  5CR0 A;  3UXP A;  5EOZ A;  4QZG A;  4MFA A;  2DR7 A;  4NY8 A;  5J0W A;  1MIY A;  3OWG A;  4QZ9 A;  4F5N A;  4OAF A;  3TFS A;  4UAZ A;  4UBB A;  3WFP A;  9ICT A;  2M2U A;  1GPJ A;  4UB1 A;  1ZQQ A;  4IQT A;  7ICH A;  3ISB A;  5DB7 A;  4UD5 A;  5J2F A;  2ZH2 A;  4I2H A;  1OU5 A;  4NKT A;  3MBY A;  4N7R A;  1XSP A;  5DKW A;  5D4B A;  4IQW A;  3NKU A;  2BCU A;  7ICL A;  4KLJ A;  2PBE A;  4RWQ A;  2BCR A;  5J2J A;  8ICB A;  3NWI A;  8ICO A;  4RT3 A;  2HHP A;  4DOA A;  3JPN A;  1TV9 A;  4XUS A;  3C2L A;  1KEJ A;  8ICE A;  3OVB A;  1ZQW A;  5JTG A;  4PHP A;  3RJK A;  4NM2 A;  2FMS A;  2B4V A;  5DB8 A;  4RQ2 A;  2NRK A;  1KNY A;  3PHZ A;  1ZQB A;  8ICT A;  4MFF A;  4WC4 A;  4YCX A;  3AUO A;  1XSL A;  4EV6 A;  2EWR A;  3HWT A;  4AT8 B;  4UAY A;  4RWN A;  4Z6C A;  4TUS A;  3AQL A;  1ZQE A;  3WFR E;  8ICI A;  1R8B A;  3HW8 A;  3AQK A;  4K4G A;  4KM5 A;  4RQ1 A;  3H37 A;  4RPY A;  3UPQ A;  3WFQ E;  4O9M A;  5J2K A;  4I2F A;  9ICC A;  1ZQM A;  2ISP A;  5J0T A;  7ICP A;  4UD4 A;  4WQL A;  4EBJ A;  4KLE A;  4UB5 A;  4PPX A;  4K9A A;  2P66 A;  4FHV A;  4WC3 A;  3RJH A;  4KB6 A;  2DR5 A;  1MQ2 A;  8ICW A;  4RQ4 A;  9ICP A;  2Q66 A;  4NLK A;  8ICQ A;  8ICK A;  4YD2 A;  4XRH A;  7ICN A;  3WFO A;  5DBC A;  4NM1 A;  2BCV A;  4X4T A;  4NXU A;  4R66 A;  5HR9 A;  4LEZ A;  4O5E A;  5CWR A;  5HRF A;  3RH5 A;  4MKP A;  3UXN A;  1UEV A;  4R64 A;  4RPX A;  2M2W A;  4YMO A;  4QZC A;  1TVA A;  8ICG A;  5CJ7 A;  5DB6 A;  4PHE A;  5HRK A;  4M47 A;  1PX5 A;  3C66 A;  3L9D A;  3MCR A;  4XQ8 A;  4P4M A;  4X4N A;  1Q78 A;  8ICH A;  4I0U A;  3JYY A;  2FMP A;  2BCQ A;  3RH6 A;  5DED A;  9ICM A;  4K4H A;  1UEU A;  5DBA A;  5III A;  4WC5 A;  2ZH9 A;  2ZH4 A;  4KLS A;  3MGH A;  1BPY A;  1MQ3 A;  4YMM A;  3RH4 A;  4KLI A;  3H3A A;  1YLQ A;  9ICE A;  4QZA A;  1BPX A;  4O69 A;  1VFG A;  1XSN A;  4AT9 A;  2FMQ A;  4PGQ A;  1KDH A;  4AT9 B;  4UB4 A;  4ATB A;  7ICJ A;  2HN1 A;  4FHP A;  4O5C A;  4AT8 A;  4K9B A;  4X4O A;  7ICO A;  3AQM A;  4OAG A;  4M04 A;  4FH5 A;  3RJF A;  9ICJ A;  3UQ0 A;  4QZ8 A;  4I2J A;  4QZI A;  8ICM A;  4O6A A;  1BPE A;  5DDY A;  5D62 A;  1FA0 A;  4UBC A;  4KLF A;  5J2H A;  3B0X A;  4OAH A;  5J0R A;  4X4Q A;  3V72 A;  3PNC A;  2GWS A;  2DR9 A;  4OAI Z;  3NYB A;  5J0S A;  1ZQX A;  9ICG A;  2M2T A;  8ICV A;  4JWM A;  2BPG A;  4EEB A;  5F2V O;  3MDC A;  2IUB A;  3TFR A;  3V7L A;  4DOC A;  3JPO A;  1ZQD A;  4KLO A;  5CHE A;  1V4A A;  1MIW A;  4PGX A;  4I2A A;  1NOM A;  2ZH5 A;  7ICR A;  9ICU A;  2FCL A;  4I2B A;  4FO6 A;  3AQN A;  4X5V A;  4NXW A;  4X4R A;  4RQ5 A;  3LK9 A;  8ICX A;  4PGY A;  4I2D A;  5IIK A;  4YMN A;  4P4P A;  9ICW A;  4HX0 A;  4KLD A;  4M9G A;  2ID1 A;  9ICQ A;  4X0B A;  3B0Y A;  4E7X A;  1RPL A;  5BPC A;  2BCS A;  4F5R A;  2ZH1 A;  4IG8 A;  3GDX A;  5IIL A;  2ZH7 A;  5J2B A;  4GXK A;  4NLN A;  8ICR A;  2BBJ A;  2B51 A;  4LZG A;  5HHH A;  7ICM A;  4GXI A;  3OGU A;  8ICZ A;  2VAN A;  4X4S A;  4GXJ A;  5J0P A;  4NXZ A;  1ZQI A;  2ZH8 A;  2M2V A;  5HRB A;  4NLZ A;  4UB2 A;  4PHA A;  5J2A A;  5J2I A;  5D63 A;  4RWP A;  3WFS C;  4KLU A;  7ICK A;  4LEW A;  4X4P A;  4KLH A;  2GA9 D;  7ICV A;  7ICE A;  1ZQN A;  3RJI A;  7ICG A;  5HRI A;  1ZQC A;  4M5D A;  4RQ8 A;  4AT7 B;  4LEY A;  4I27 A;  4Z6F A;  1ZJM A;  3C2M A;  4JLX A;  3JPP A;  2W9M A;  1ZQY A;  3OVS A;  4I28 A;  4WBZ A;  3UXO A;  4RQ0 A;  4K8V A;  4EED A;  2DVI A;  1BPB A;  3EF2 A;  4KLT A;  2ZH6 A;  4K4I A;  5B3Q A;  3MDA A;  4FHX A;  4IQU A;  2PFN A;  4KLQ A;  1JAJ A;  8ICC A;  3ISC A;  9ICK A;  1R8A A;  1BPZ A;  4F5Q A;  4M9N A;  3MGI A;  4TUR A;  3JPR A;  4PHD A;  3K7D A;  9ICF A;  4PH5 A;  3JPT A;  9ICN A;  4EBK A;  4WQK A;  1JN3 A;  5HC9 A;  3HJ1 A;  1JMS A;  5CFT A;  4NXV A;  1BPD A;  4ATB B;  3RJG A;  4P2H A;  4RPZ A;  4FO1 A;  2GAF D;  1ZQT A;  9ICS A;  3HX0 A;  1ZQS A;  3HIY A;  3JPS A;  1JQR A;  5J0U A;  4KLL A;  4WC0 A;  4MF8 A;  5IIN A;  3V7K A;  2HN2 A;  5J0X A;  4M2Y A;  4K98 A;  2DRB A;  3ISD A;  3RJJ A;  2DR8 A;  4UB3 A;  4P4O A;  3PMN A;  5HRL A;  5HRH A;  4I29 A;  4RT2 A;  3ERC C;  1ZQG A;  5D61 A;  4I2I A;  4RWO A;  4Z6D A;  4XA5 A;  3OVA A;  4IQV A;  7ICU A;  4FH3 A;  2ZHA A;  4QZD A;  4XQ7 A;  4NXT A;  4MF2 A;  1R8C A;  2DRA A;  4I2C A;  1R89 A;  4YN4 A;  1ZQF A;  5D46 A;  4YD1 A;  2ZH3 A;  4EGW A;  1ZQZ A;  2ISO A;  2PXI A;  4KLG A;  5DDM A;  5DBB A;  3OUY A;  4X4V A;  3C5G A;  8ICP A;  5D49 A;  4R63 A;  4TUQ A;  9ICV A;  4RQ3 A;  4WC1 A;  4X4U A;  8ICF A;  4E8F A;  4JLZ A;  4NKU A;  3JZ0 A;  1WOT A;  2O1P A;  4AT7 A;  3K75 D;  5B3P A;  9ICH A;  2BPC A;  5CFS A;  4WC6 A;  4DO9 A;  5J2D A;  5CFU A;  3C18 A;  1ZQL A;  2O5A A;  4E80 A;  5J0O A;  5HHI A;  4WH5 A;  4RQ6 A;  4JWN A;  4DOB A;  1ZJN A;  4QZH A;  9ICA A;  3OV7 A;  5HRD A;  4QZF A;  5CA7 A;  4R65 A;  8ICL A;  4EP7 A;  2PFP A;  4I2G A;  1MIV A;  2BE3 A;  2IHM A;  1ZQH A;  5J29 A;  4FHY A;  4Z6E A;  3H39 A;  8ICS A;  7ICS A;  4WBY A;  4MFC A;  1TFW A;  1TFY A;  2IHO A;  1NO5 A;  4LVS A;  1F5A A;  4WCW A;  1VJ7 A;  4M9L A;  4WC2 A;  9ICR A;  4KLM A;  3CK6 A;  5CP2 A;  3LQC B;  3ER9 B;  9ICO A;  3PML A;  4LT6 A;  8ICJ A;  4O67 A;  8ICN A;  5CHG A;  5J0Q A;  4K99 A;  4F5O A;  3C5F A;  5J2E A;  1HUO A;  4M9H A;  8ICU A;  1ZQK A;  1ZQA A;  2RFF A;  2B56 A;  4O68 A;  4X0A A;  2BBH A; 
#chains in the Genus database with same CATH homology
 3V7J A;  5BOM A;  5TZV A;  4F5P A;  3HJ4 A;  1UET A;  5CB1 A;  5IIO A;  2PFQ A;  2ZHB A;  7ICF A;  5DB9 A;  3UPS A;  4M0A A;  4S3N A;  5IIJ A;  5J2C A;  9ICB A;  5IIM A;  7ICQ A;  4TUP A;  4QZB A;  3UQ2 A;  4RQ7 A;  1ZQO A;  5DEC A;  4FHW A;  3AU6 A;  5HRG A;  4M9J A;  9ICX A;  3C2K A;  8ICY A;  1ZQV A;  4I2E A;  5J0Y A;  5J2G A;  1ZQU A;  9ICL A;  7ICI A;  4QZE A;  1ZQJ A;  4WC7 A;  5HRE A;  7ICT A;  1RZT A;  5BOL A;  1Q79 A;  4UAW A;  2PFO A;  2BPF A;  3JPQ A;  3OUY B;  9ICI A;  4O5K A;  1ZQP A;  3RJE A;  3H38 A;  3AU2 A;  1HUZ A;  4LZD A;  2I9G A;  1ZQR A;  8ICA A;  5CR0 A;  3UXP A;  5EOZ A;  4QZG A;  4MFA A;  2DR7 A;  4NY8 A;  5J0W A;  1MIY A;  4QZ9 A;  4F5N A;  3TFS A;  4UAZ A;  4UBB A;  3WFP A;  9ICT A;  2M2U A;  4UB1 A;  1ZQQ A;  4IQT A;  7ICH A;  3ISB A;  5DB7 A;  4UD5 A;  5J2F A;  2ZH2 A;  4I2H A;  1OU5 A;  4NKT A;  3MBY A;  1XSP A;  5DKW A;  5D4B A;  4IQW A;  2BCU A;  7ICL A;  4KLJ A;  2PBE A;  4RWQ A;  2BCR A;  5J2J A;  8ICB A;  8ICO A;  4RT3 A;  2HHP A;  4DOA A;  3JPN A;  1TV9 A;  4XUS A;  3C2L A;  1KEJ A;  8ICE A;  3OVB A;  1ZQW A;  4PHP A;  3RJK A;  4NM2 A;  2FMS A;  5DB8 A;  4RQ2 A;  2NRK A;  1KNY A;  1ZQB A;  8ICT A;  4MFF A;  4WC4 A;  4YCX A;  3AUO A;  1XSL A;  3HWT A;  4AT8 B;  4UAY A;  4RWN A;  4Z6C A;  4TUS A;  3AQL A;  1ZQE A;  3WFR E;  8ICI A;  1R8B A;  3HW8 A;  3AQK A;  4K4G A;  4RQ1 A;  3H37 A;  4RPY A;  3UPQ A;  3WFQ E;  4O9M A;  5J2K A;  4I2F A;  9ICC A;  1ZQM A;  2ISP A;  5J0T A;  7ICP A;  4UD4 A;  4EBJ A;  4KLE A;  4UB5 A;  4PPX A;  2P66 A;  4FHV A;  4WC3 A;  3RJH A;  2DR5 A;  1MQ2 A;  8ICW A;  4RQ4 A;  9ICP A;  2Q66 A;  4NLK A;  8ICQ A;  8ICK A;  4YD2 A;  4XRH A;  7ICN A;  3WFO A;  5DBC A;  4NM1 A;  2BCV A;  4X4T A;  4R66 A;  5HR9 A;  4O5E A;  5CWR A;  5HRF A;  3RH5 A;  3UXN A;  1UEV A;  4R64 A;  4RPX A;  2M2W A;  4YMO A;  4QZC A;  1TVA A;  8ICG A;  5CJ7 A;  5DB6 A;  4PHE A;  5HRK A;  4M47 A;  1PX5 A;  3C66 A;  3L9D A;  4XQ8 A;  4P4M A;  4X4N A;  1Q78 A;  8ICH A;  3JYY A;  2FMP A;  2BCQ A;  3RH6 A;  5DED A;  9ICM A;  4K4H A;  1UEU A;  5DBA A;  5III A;  4WC5 A;  2ZH9 A;  2ZH4 A;  4KLS A;  3MGH A;  1BPY A;  1MQ3 A;  4YMM A;  3RH4 A;  4KLI A;  3H3A A;  1YLQ A;  9ICE A;  4QZA A;  1BPX A;  1VFG A;  1XSN A;  4AT9 A;  2FMQ A;  4PGQ A;  1KDH A;  4AT9 B;  4UB4 A;  4ATB A;  7ICJ A;  4FHP A;  4O5C A;  4AT8 A;  4X4O A;  7ICO A;  3AQM A;  4M04 A;  4FH5 A;  3RJF A;  9ICJ A;  3UQ0 A;  4QZ8 A;  4I2J A;  4QZI A;  8ICM A;  1BPE A;  5DDY A;  1FA0 A;  4UBC A;  4KLF A;  5J2H A;  3B0X A;  4X4Q A;  5J0R A;  3V72 A;  3PNC A;  2GWS A;  2DR9 A;  3NYB A;  5J0S A;  1ZQX A;  9ICG A;  2M2T A;  8ICV A;  4JWM A;  2BPG A;  5F2V O;  3MDC A;  3TFR A;  3V7L A;  4DOC A;  3JPO A;  1ZQD A;  4KLO A;  1V4A A;  1MIW A;  4PGX A;  4I2A A;  1NOM A;  2ZH5 A;  7ICR A;  9ICU A;  4I2B A;  4FO6 A;  3AQN A;  4X5V A;  4X4R A;  4RQ5 A;  3LK9 A;  8ICX A;  4PGY A;  4I2D A;  5IIK A;  4YMN A;  4P4P A;  9ICW A;  4KLD A;  4M9G A;  2ID1 A;  9ICQ A;  4X0B A;  3B0Y A;  4E7X A;  1RPL A;  5BPC A;  2BCS A;  4F5R A;  2ZH1 A;  4IG8 A;  3GDX A;  5IIL A;  2ZH7 A;  5J2B A;  4GXK A;  4NLN A;  8ICR A;  4LZG A;  5HHH A;  7ICM A;  4GXI A;  3OGU A;  8ICZ A;  2VAN A;  4X4S A;  4GXJ A;  5J0P A;  4NXZ A;  1ZQI A;  2ZH8 A;  2M2V A;  5HRB A;  4NLZ A;  4UB2 A;  4PHA A;  5J2A A;  5J2I A;  4RWP A;  3WFS C;  4KLU A;  7ICK A;  4X4P A;  4KLH A;  7ICV A;  7ICE A;  1ZQN A;  3RJI A;  7ICG A;  5HRI A;  1ZQC A;  4M5D A;  4RQ8 A;  4AT7 B;  4I27 A;  4Z6F A;  1ZJM A;  3C2M A;  3JPP A;  2W9M A;  1ZQY A;  3OVS A;  4I28 A;  4WBZ A;  3UXO A;  4RQ0 A;  2DVI A;  1BPB A;  4KLT A;  2ZH6 A;  4K4I A;  3MDA A;  4FHX A;  4IQU A;  2PFN A;  4KLQ A;  1JAJ A;  8ICC A;  3ISC A;  9ICK A;  1R8A A;  1BPZ A;  4F5Q A;  4M9N A;  3MGI A;  4TUR A;  3JPR A;  4PHD A;  9ICF A;  4PH5 A;  3JPT A;  9ICN A;  4EBK A;  1JN3 A;  5HC9 A;  3HJ1 A;  1JMS A;  1BPD A;  4ATB B;  3RJG A;  4P2H A;  4RPZ A;  1ZQT A;  9ICS A;  3HX0 A;  1ZQS A;  3HIY A;  3JPS A;  1JQR A;  5J0U A;  4KLL A;  4WC0 A;  4MF8 A;  5IIN A;  3V7K A;  5J0X A;  4M2Y A;  2DRB A;  3ISD A;  3RJJ A;  2DR8 A;  4UB3 A;  4P4O A;  3PMN A;  5HRL A;  5HRH A;  4I29 A;  4RT2 A;  1ZQG A;  4I2I A;  4RWO A;  4Z6D A;  4XA5 A;  3OVA A;  4IQV A;  7ICU A;  4FH3 A;  2ZHA A;  4QZD A;  4XQ7 A;  4MF2 A;  1R8C A;  2DRA A;  4I2C A;  1R89 A;  4YN4 A;  1ZQF A;  5D46 A;  4YD1 A;  2ZH3 A;  1ZQZ A;  2ISO A;  2PXI A;  4KLG A;  5DDM A;  5DBB A;  3OUY A;  4X4V A;  3C5G A;  8ICP A;  5D49 A;  4R63 A;  4TUQ A;  9ICV A;  4RQ3 A;  4WC1 A;  4X4U A;  8ICF A;  4E8F A;  4NKU A;  3JZ0 A;  1WOT A;  2O1P A;  4AT7 A;  3K75 D;  9ICH A;  2BPC A;  4WC6 A;  4DO9 A;  5J2D A;  3C18 A;  1ZQL A;  2O5A A;  4E80 A;  5J0O A;  5HHI A;  4RQ6 A;  4JWN A;  4DOB A;  1ZJN A;  4QZH A;  9ICA A;  3OV7 A;  5HRD A;  4QZF A;  5CA7 A;  4R65 A;  8ICL A;  4EP7 A;  2PFP A;  4I2G A;  1MIV A;  2BE3 A;  2IHM A;  1ZQH A;  5J29 A;  4FHY A;  4Z6E A;  3H39 A;  8ICS A;  7ICS A;  4WBY A;  4MFC A;  1TFW A;  1TFY A;  1NO5 A;  4LVS A;  1F5A A;  4WCW A;  1VJ7 A;  4M9L A;  4WC2 A;  9ICR A;  4KLM A;  5CP2 A;  3LQC B;  9ICO A;  3PML A;  4LT6 A;  8ICJ A;  8ICN A;  5CHG A;  5J0Q A;  4F5O A;  3C5F A;  5J2E A;  1HUO A;  4M9H A;  8ICU A;  1ZQK A;  1ZQA A;  2RFF A;  4X0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...