5HRFA

The crystal structure of asfvpolx: dna5: dgtp ternary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
SGGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrfA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrfA01
4DO9A 4AT7A 4YD1A 3ISBA 1ZQSA 1JMSA 4KLSA 1TVAA 4EBKA 2DR7A 4I29A 5D46A 5DB8A 3UQ0A 5IIOA 7ICRA 8ICZA 5HRLA 1VFGA 5DB6A 4X4TA 1MQ3A 4DOAA 4UB2A 3OVBA 3UXPA 1BPXA 5J0OA 1ZQTA 4KLEA 2W9MA 4M9JA 3JPQA 3C5FA 5CWRA 4WC4A 8ICLA 4WC0A 4FHWA 8ICAA 3ISDA 5D4BA 4AT9A 4EBJA 1ZQAA 1Q79A 4PH5A 1MQ2A 9ICEA 4E8FA 2BCSA 2DRBA 3C18A 9ICUA 4PHAA 4WC3A 4KLGA 5J2KA 4PHDA 4RWPA 5CR0A 1ZQMA 4F5OA 4M47A 1Q78A 4RPZA 4WCWA 3AQLA 5DEDA 1JAJA 1V4AA 3B0XA 9ICFA 1R8BA 1BPDA 4NLZA 7ICTA 2PXIA 4KLDA 4X5VA 3WFOA 4YMNA 3OVAA 8ICUA 4WC1A 4UBCA 1BPZA 1RPLA 4S3NA 5EOZA 9ICRA 1TFWA 1NO5A 8ICSA 3RH6A 3V72A 5BOLA 4M9LA 2VANA 4F5PA 4UB1A 4NM1A 4NLKA 8ICXA 5DDYA 1OU5A 3HJ1A 8ICPA 5J0QA 4NM2A 4ATBB 4TURA 1KNYA 4LZGA 8ICIA 4E80A 2M2WA 8ICRA 1ZQJA 4IG8A 3MGHA 4XQ7A 3LQCB 4FH5A 4O5EA 3WFRE 5F2VO 4R64A 1ZJNA 4RWQA 3HW8A 1ZQQA 3C2KA 4UB3A 3H3AA 4WBZA 4FHXA 4RQ3A 3TFSA 8ICHA 4X0BA 2M2UA 1XSPA 3L9DA 5DB9A 3RJFA 4JWMA 4LZDA 3RJHA 4I2GA 3UPQA 5HHHA 5J2GA 3UXNA 1ZQCA 5DECA 4AT9B 4UB4A 3AUOA 5HREA 2FMSA 1WOTA 3C66A 3OV7A 1RZTA 4P4MA 4R65A 4RPXA 9ICSA 3UQ2A 4IQUA 4I2FA 8ICFA 2FMQA 3UXOA 1ZQFA 9ICPA 1TV9A 2I9GA 2ZH1A 4M9GA 3PMLA 4KLMA 4ATBA 4IQTA 4PGXA 4NLNA 4I27A 9ICJA 4X4PA 4DOBA 7ICQA 3K75D 1ZQNA 3HWTA 5DBCA 3RJEA 2M2TA 5BPCA 4NY8A 5HRBA 1ZQXA 4YN4A 4GXIA 2BCUA 4WC6A 5J0SA 4RQ8A 1UEUA 2RFFA 5HHIA 4TUPA 7ICNA 2O5AA 4X4RA 3H38A 4UBBA 4LT6A 8ICTA 5DB7A 3WFPA 4QZDA 4RPYA 1ZQGA 5HRKA 4I2AA 4R66A 4WC7A 4I28A 3HX0A 1UEVA 4P4PA 1YLQA 3RJIA 3JPOA 3GDXA 4YCXA 4M2YA 1HUZA 3AQMA 8ICBA 3UPSA 8ICYA 9ICCA 4MF8A 4UAWA 4M0AA 1ZQOA 5J2JA 4KLJA 1ZQVA 2ZHBA 4X4NA 4X4OA 9ICLA 4O5CA 4QZHA 9ICNA 3RH4A 8ICQA 4P4OA 1ZQRA 4I2CA 1ZQEA 7ICOA 5J0RA 4IQVA 4RQ0A 4RT2A 7ICFA 4QZFA 4QZEA 4MF2A 3V7JA 1MIWA 9ICVA 4KLOA 3JPPA 3OGUA 4GXJA 3JPNA 5IIKA 2FMPA 1ZQIA 5CA7A 4I2HA 7ICJA 3JPSA 8ICKA 3C2MA 3RJKA 4JWNA 1XSLA 3MGIA 5J2EA 5DBBA 4TUSA 4QZ8A 1BPBA 5D49A 1ZQDA 5DKWA 4I2IA 1KDHA 2BPCA 7ICHA 1XSNA 3WFQE 4KLHA 1ZQKA 2ZH9A 4FHYA 2BCQA 9ICQA 4I2EA 5J2CA 5HR9A 3NYBA 5HRHA 3HIYA 3JPTA 4X0AA 4AT8A 5CJ7A 2NRKA 4NKTA 4X4SA 4FHVA 4RQ4A 3MDAA 4QZ9A 4QZGA 3OVSA 1MIYA 7ICUA 4DOCA 5HRGA 4UD4A 4XRHA 4RQ6A 3ISCA 2ID1A 4EP7A 2ISOA 4NKUA 1ZQUA 5J0XA 1PX5A 4Z6CA 5IIMA 4RQ7A 8ICEA 5J0TA 5CB1A 2ZH5A 3V7KA 4WBYA 4XA5A 4RQ5A 8ICVA 1TFYA 4TUQA 3JZ0A 9ICHA 4PGYA 4I2JA 4X4UA 2DVIA 4Z6DA 4R63A 1ZQYA 7ICLA 4I2DA 2ISPA 5J0UA 4Z6EA 2BE3A 3PMNA 2ZH6A 5IIIA 4KLQA 4RQ2A 2DR5A 4QZIA 2PFQA 2PBEA 2DR8A 1R89A 1VJ7A 3B0YA 9ICTA 4O9MA 8ICWA 4NXZA 2PFOA 4K4HA 1ZQLA 3WFSC 4QZBA 4FHPA 3LK9A 4E7XA 5J2FA 3PNCA 1NOMA 4PHPA 4UD5A 4UB5A 2DRAA 5J2DA 3OUYA 2ZH7A 5DDMA 4XUSA 1BPYA 5J2HA 2PFNA 4K4GA 4KLIA 4KLUA 4GXKA 2BCVA 2BPFA 9ICGA 2BPGA 8ICGA 8ICMA 3MDCA 2PFPA 4WC5A 5DBAA 3RH5A 4RT3A 4AT8B 5IILA 1BPEA 7ICPA 5J0PA 5BOMA 4F5RA 1F5AA 2HHPA 1ZQHA 4IQWA 2ZHAA 5HRIA 1ZQBA 2Q66A 4PPXA 5J0YA 4UAZA 8ICNA 3MBYA 4UAYA 5J29A 3RJGA 5J2BA 3TFRA 4M04A 3AU2A 3V7LA 4P2HA 8ICOA 2P66A 5HRDA 9ICIA 2ZH3A 4FH3A 3H37A 3AQNA 4KLTA 1UETA 4M9HA 4YD2A 2GWSA 5CP2A 7ICMA 5HRFA 4K4IA 4YMMA 4FO6A 1JN3A 5TZVA 1R8CA 4LVSA 5IINA 4MFAA 7ICVA 1R8AA 4PGQA 4WC2A 7ICSA 4KLFA 9ICWA 4AT7B 3HJ4A 9ICKA 8ICCA 4Z6FA 2M2VA 9ICOA 4X4QA 3JYYA 4O5KA 1FA0A 4RWNA 1ZQZA 1JQRA 9ICMA 8ICJA 1HUOA 4MFCA 2IHMA 1ZQPA 3JPRA 1ZQWA 7ICGA 7ICEA 1MIVA 4QZAA 5IIJA 5CHGA 3OUYB 4I2BA 4M5DA 9ICAA 7ICIA 5J2AA 4PHEA 4RQ1A 4F5QA 3AQKA 2DR9A 2ZH2A 4F5NA 3H39A 9ICBA 4XQ8A 1KEJA 4RWOA 2ZH4A 2ZH8A 5HC9A 7ICKA 3C2LA 2BCRA 4X4VA 2O1PA 4QZCA 3RJJA 4YMOA 3AU6A 3C5GA 5J0WA 9ICXA 1ZJMA 4KLLA 5J2IA 4M9NA 4MFFA
chains in the Genus database with same CATH superfamily
4DO9A 4AT7A 4YD1A 3ISBA 3CK6A 1ZQSA 1JMSA 4KLSA 4NXTA 1TVAA 4EBKA 2DR7A 4I29A 5D46A 5DB8A 3UQ0A 5IIOA 5CFTA 2GAFD 7ICRA 8ICZA 5HRLA 1VFGA 5DB6A 4X4TA 1MQ3A 4DOAA 4UB2A 3OVBA 3UXPA 1BPXA 5B3PA 5J0OA 1ZQTA 4KLEA 2GA9D 2W9MA 4M9JA 4N7RA 3JPQA 3C5FA 5CWRA 4WC4A 8ICLA 3K7DA 4OAFA 4WC0A 4FHWA 8ICAA 3ISDA 5D4BA 4AT9A 4EBJA 4XJEA 1ZQAA 3MCRA 1Q79A 4PH5A 1MQ2A 9ICEA 4E8FA 2BCSA 2DRBA 3C18A 9ICUA 4PHAA 4WC3A 4KLGA 5J2KA 4PHDA 4O69A 4RWPA 5CR0A 1ZQMA 4F5OA 4M47A 1Q78A 4RPZA 4WCWA 3AQLA 5DEDA 1JAJA 1V4AA 3B0XA 9ICFA 1R8BA 1BPDA 4NLZA 7ICTA 2PXIA 4KLDA 4X5VA 3WFOA 4YMNA 3NWIA 3OVAA 8ICUA 4WC1A 4UBCA 1BPZA 2B56A 1RPLA 4S3NA 5EOZA 9ICRA 1TFWA 1NO5A 8ICSA 3RH6A 3V72A 5BOLA 4M9LA 2VANA 4F5PA 4UB1A 4NM1A 4NLKA 8ICXA 5DDYA 1OU5A 3HJ1A 8ICPA 5J0QA 4NM2A 4ATBB 4TURA 1KNYA 4LZGA 8ICIA 4E80A 2M2WA 8ICRA 1ZQJA 4IG8A 3MGHA 4XQ7A 3LQCB 4FH5A 4O5EA 3WFRE 5F2VO 4R64A 4K96A 1ZJNA 4RWQA 3HW8A 1ZQQA 3C2KA 4UB3A 3H3AA 4WBZA 4FHXA 3NKUA 4RQ3A 3TFSA 8ICHA 4X0BA 2M2UA 1XSPA 4JLZA 4K97A 3L9DA 5CHEA 5DB9A 3RJFA 4JWMA 4O6AA 4LZDA 3RJHA 4I2GA 3UPQA 5HHHA 5J2GA 3UXNA 4KM5A 1ZQCA 5DECA 4AT9B 4UB4A 3AUOA 5HREA 2FMSA 1WOTA 3C66A 3OV7A 4K98A 1RZTA 4P4MA 4R65A 4RPXA 9ICSA 3UQ2A 4IQUA 4I2FA 8ICFA 2FMQA 3UXOA 1ZQFA 9ICPA 4MKPA 1TV9A 2I9GA 2ZH1A 4M9GA 3PMLA 4KLMA 4NXWA 4IQTA 4PGXA 4NLNA 4ATBA 4LEZA 4K99A 4I27A 9ICJA 4X4PA 4DOBA 7ICQA 3K75D 1ZQNA 4NXXA 3HWTA 5DBCA 3RJEA 2M2TA 5BPCA 4NY8A 5HRBA 1ZQXA 4YN4A 4GXIA 2BCUA 4WC6A 5J0SA 4RQ8A 1UEUA 2RFFA 5HHIA 4TUPA 7ICNA 2O5AA 4X4RA 3H38A 4UBBA 4LT6A 8ICTA 5DB7A 3WFPA 4QZDA 4RPYA 1ZQGA 5HRKA 4I2AA 4R66A 4WC7A 4I28A 3HX0A 2EWRA 1UEVA 4P4PA 1YLQA 3RJIA 3JPOA 3GDXA 4YCXA 4M2YA 1HUZA 3AQMA 8ICBA 3UPSA 8ICYA 9ICCA 4MF8A 4EEDA 4UAWA 4M0AA 4KB6A 1ZQOA 4OAGA 5J2JA 4KLJA 1ZQVA 2ZHBA 4X4NA 4X4OA 9ICLA 4O5CA 5D62A 4K8VA 4QZHA 9ICNA 3RH4A 8ICQA 2B51A 4P4OA 1ZQRA 4I2CA 1ZQEA 7ICOA 5J0RA 4IQVA 4RQ0A 4RT2A 7ICFA 4QZFA 4QZEA 4MF2A 3V7JA 1MIWA 9ICVA 4KLOA 3JPPA 3OGUA 2B4VA 4GXJA 3JPNA 5IIKA 2FMPA 1ZQIA 5CA7A 4I2HA 7ICJA 3JPSA 8ICKA 3C2MA 3RJKA 4JWNA 4K9AA 1XSLA 3MGIA 5J2EA 5DBBA 4TUSA 4QZ8A 1BPBA 5D49A 1ZQDA 5DKWA 4I2IA 1KDHA 2BPCA 7ICHA 1XSNA 3WFQE 4K9BA 4KLHA 1ZQKA 2ZH9A 4FHYA 2BCQA 2BBJA 9ICQA 4NXUA 2IUBA 4I2EA 5J2CA 5HR9A 3NYBA 5HRHA 3HIYA 4EGWA 3JPTA 4X0AA 4AT8A 5CJ7A 2NRKA 4NKTA 4X4SA 4NXVA 4O67A 4FHVA 4RQ4A 3MDAA 4QZ9A 4QZGA 3OVSA 1MIYA 7ICUA 4DOCA 5HRGA 4UD4A 4XRHA 4RQ6A 3ISCA 2ID1A 4EP7A 4EEBA 2ISOA 4NKUA 1ZQUA 5D61A 5JTGA 5J0XA 4HX0A 1PX5A 4Z6CA 5IIMA 4RQ7A 8ICEA 5J0TA 5CB1A 2ZH5A 3V7KA 4WBYA 4XA5A 4RQ5A 8ICVA 1TFYA 4TUQA 3JZ0A 9ICHA 4PGYA 4I2JA 4X4UA 2DVIA 4Z6DA 4R63A 3PHZA 1ZQYA 7ICLA 4I2DA 2ISPA 5J0UA 4Z6EA 2BE3A 4I0UA 3PMNA 2ZH6A 5IIIA 4OAHA 4KLQA 4RQ2A 2DR5A 4QZIA 2PFQA 5CFUA 2PBEA 2DR8A 1R89A 1VJ7A 3B0YA 2BBHA 9ICTA 2IHOA 4O9MA 8ICWA 4NXZA 2PFOA 4K4HA 1ZQLA 3ERCC 3WFSC 4QZBA 4FHPA 3LK9A 4E7XA 5J2FA 3PNCA 1NOMA 4PHPA 4UD5A 4FO1A 4UB5A 2DRAA 5J2DA 3OUYA 2ZH7A 5DDMA 5B3QA 4XUSA 1BPYA 5J2HA 2PFNA 4K4GA 4KLIA 4KLUA 4GXKA 4O68A 2BCVA 2HN2A 2BPFA 3ER9B 9ICGA 2BPGA 8ICGA 8ICMA 3MDCA 2PFPA 2FCLA 4WC5A 4LEYA 5DBAA 3RH5A 4RT3A 2HN1A 3OWGA 5IILA 4AT8B 1BPEA 7ICPA 5J0PA 5BOMA 4F5RA 1F5AA 2HHPA 1ZQHA 4IQWA 2ZHAA 5HRIA 1ZQBA 2Q66A 3ER8C 4PPXA 5J0YA 4UAZA 8ICNA 3MBYA 4UAYA 5J29A 3RJGA 5J2BA 3TFRA 4M04A 4EV6A 3AU2A 3V7LA 4WH5A 4P2HA 8ICOA 2P66A 5HRDA 9ICIA 2ZH3A 4FH3A 4WQLA 3H37A 3AQNA 4KLTA 1UETA 4M9HA 4YD2A 2GWSA 5CP2A 7ICMA 5HRFA 4K4IA 4YMMA 4JLXA 4FO6A 1JN3A 5TZVA 1R8CA 4LEWA 4LVSA 5IINA 3NVOA 4MFAA 4WOYA 7ICVA 1R8AA 4OAIZ 4PGQA 1GPJA 4WC2A 7ICSA 4KLFA 9ICWA 4AT7B 3HJ4A 9ICKA 8ICCA 4Z6FA 2M2VA 9ICOA 4X4QA 3JYYA 4O5KA 1FA0A 4RWNA 1ZQZA 1JQRA 4LEVA 3EF2A 9ICMA 8ICJA 1HUOA 4MFCA 2IHMA 1ZQPA 3JPRA 1ZQWA 7ICGA 7ICEA 1MIVA 4QZAA 5IIJA 5CHGA 3OUYB 4I2BA 4M5DA 9ICAA 7ICIA 5J2AA 4PHEA 4RQ1A 4F5QA 3AQKA 2DR9A 2ZH2A 4F5NA 3H39A 9ICBA 4XQ8A 1KEJA 4RWOA 2ZH4A 2ZH8A 5HC9A 7ICKA 3C2LA 2BCRA 5CFSA 4X4VA 2O1PA 4QZCA 3RJJA 4YMOA 3AU6A 3C5GA 5J0WA 9ICXA 4WQKA 1ZJMA 3JCFA 5D63A 4KLLA 5J2IA 4M9NA 4MFFA
chains in the Genus database with same CATH topology
4DO9A 4AT7A 4YD1A 3ISBA 1ZQSA 1JMSA 4KLSA 1TVAA 4EBKA 2DR7A 4I29A 5D46A 5DB8A 3UQ0A 5IIOA 7ICRA 8ICZA 5HRLA 1VFGA 5DB6A 4X4TA 1MQ3A 4DOAA 4UB2A 3OVBA 3UXPA 1BPXA 5J0OA 1ZQTA 4KLEA 2W9MA 4M9JA 3JPQA 3C5FA 5CWRA 4WC4A 8ICLA 4WC0A 4FHWA 8ICAA 3ISDA 5D4BA 4AT9A 4EBJA 1ZQAA 1Q79A 4PH5A 1MQ2A 9ICEA 4E8FA 2BCSA 2DRBA 3C18A 9ICUA 4PHAA 4WC3A 4KLGA 5J2KA 4PHDA 4RWPA 5CR0A 1ZQMA 4F5OA 4M47A 1Q78A 4RPZA 4WCWA 3AQLA 5DEDA 1JAJA 1V4AA 3B0XA 9ICFA 1R8BA 1BPDA 4NLZA 7ICTA 2PXIA 4KLDA 4X5VA 3WFOA 4YMNA 3OVAA 8ICUA 4WC1A 4UBCA 1BPZA 1RPLA 4S3NA 5EOZA 9ICRA 1TFWA 1NO5A 8ICSA 3RH6A 3V72A 5BOLA 4M9LA 2VANA 4F5PA 4UB1A 4NM1A 4NLKA 8ICXA 5DDYA 1OU5A 3HJ1A 8ICPA 5J0QA 4NM2A 4ATBB 4TURA 1KNYA 4LZGA 8ICIA 4E80A 2M2WA 8ICRA 1ZQJA 4IG8A 3MGHA 4XQ7A 3LQCB 4FH5A 4O5EA 3WFRE 5F2VO 4R64A 1ZJNA 4RWQA 3HW8A 1ZQQA 3C2KA 4UB3A 3H3AA 4WBZA 4FHXA 4RQ3A 3TFSA 8ICHA 4X0BA 2M2UA 1XSPA 3L9DA 5DB9A 3RJFA 4JWMA 4LZDA 3RJHA 4I2GA 3UPQA 5HHHA 5J2GA 3UXNA 1ZQCA 5DECA 4AT9B 4UB4A 3AUOA 5HREA 2FMSA 1WOTA 3C66A 3OV7A 1RZTA 4P4MA 4R65A 4RPXA 9ICSA 3UQ2A 4IQUA 4I2FA 8ICFA 2FMQA 3UXOA 1ZQFA 9ICPA 1TV9A 2I9GA 2ZH1A 4M9GA 3PMLA 4KLMA 4ATBA 4IQTA 4PGXA 4NLNA 4I27A 9ICJA 4X4PA 4DOBA 7ICQA 3K75D 1ZQNA 3HWTA 5DBCA 3RJEA 2M2TA 5BPCA 4NY8A 5HRBA 1ZQXA 4YN4A 4GXIA 2BCUA 4WC6A 5J0SA 4RQ8A 1UEUA 2RFFA 5HHIA 4TUPA 7ICNA 2O5AA 4X4RA 3H38A 4UBBA 4LT6A 8ICTA 5DB7A 3WFPA 4QZDA 4RPYA 1ZQGA 5HRKA 4I2AA 4R66A 4WC7A 4I28A 3HX0A 1UEVA 4P4PA 1YLQA 3RJIA 3JPOA 3GDXA 4YCXA 4M2YA 1HUZA 3AQMA 8ICBA 3UPSA 8ICYA 9ICCA 4MF8A 4UAWA 4M0AA 1ZQOA 5J2JA 4KLJA 1ZQVA 2ZHBA 4X4NA 4X4OA 9ICLA 4O5CA 4QZHA 9ICNA 3RH4A 8ICQA 4P4OA 1ZQRA 4I2CA 1ZQEA 7ICOA 5J0RA 4IQVA 4RQ0A 4RT2A 7ICFA 4QZFA 4QZEA 4MF2A 3V7JA 1MIWA 9ICVA 4KLOA 3JPPA 3OGUA 4GXJA 3JPNA 5IIKA 2FMPA 1ZQIA 5CA7A 4I2HA 7ICJA 3JPSA 8ICKA 3C2MA 3RJKA 4JWNA 1XSLA 3MGIA 5J2EA 5DBBA 4TUSA 4QZ8A 1BPBA 5D49A 1ZQDA 5DKWA 4I2IA 1KDHA 2BPCA 7ICHA 1XSNA 3WFQE 4KLHA 1ZQKA 2ZH9A 4FHYA 2BCQA 9ICQA 4I2EA 5J2CA 5HR9A 3NYBA 5HRHA 3HIYA 3JPTA 4X0AA 4AT8A 5CJ7A 2NRKA 4NKTA 4X4SA 4FHVA 4RQ4A 3MDAA 4QZ9A 4QZGA 3OVSA 1MIYA 7ICUA 4DOCA 5HRGA 4UD4A 4XRHA 4RQ6A 3ISCA 2ID1A 4EP7A 2ISOA 4NKUA 1ZQUA 5J0XA 1PX5A 4Z6CA 5IIMA 4RQ7A 8ICEA 5J0TA 5CB1A 2ZH5A 3V7KA 4WBYA 4XA5A 4RQ5A 8ICVA 1TFYA 4TUQA 3JZ0A 9ICHA 4PGYA 4I2JA 4X4UA 2DVIA 4Z6DA 4R63A 1ZQYA 7ICLA 4I2DA 2ISPA 5J0UA 4Z6EA 2BE3A 3PMNA 2ZH6A 5IIIA 4KLQA 4RQ2A 2DR5A 4QZIA 2PFQA 2PBEA 2DR8A 1R89A 1VJ7A 3B0YA 9ICTA 4O9MA 8ICWA 4NXZA 2PFOA 4K4HA 1ZQLA 3WFSC 4QZBA 4FHPA 3LK9A 4E7XA 5J2FA 3PNCA 1NOMA 4PHPA 4UD5A 4UB5A 2DRAA 5J2DA 3OUYA 2ZH7A 5DDMA 4XUSA 1BPYA 5J2HA 2PFNA 4K4GA 4KLIA 4KLUA 4GXKA 2BCVA 2BPFA 9ICGA 2BPGA 8ICGA 8ICMA 3MDCA 2PFPA 4WC5A 5DBAA 3RH5A 4RT3A 4AT8B 5IILA 1BPEA 7ICPA 5J0PA 5BOMA 4F5RA 1F5AA 2HHPA 1ZQHA 4IQWA 2ZHAA 5HRIA 1ZQBA 2Q66A 4PPXA 5J0YA 4UAZA 8ICNA 3MBYA 4UAYA 5J29A 3RJGA 5J2BA 3TFRA 4M04A 3AU2A 3V7LA 4P2HA 8ICOA 2P66A 5HRDA 9ICIA 2ZH3A 4FH3A 3H37A 3AQNA 4KLTA 1UETA 4M9HA 4YD2A 2GWSA 5CP2A 7ICMA 5HRFA 4K4IA 4YMMA 4FO6A 1JN3A 5TZVA 1R8CA 4LVSA 5IINA 4MFAA 7ICVA 1R8AA 4PGQA 4WC2A 7ICSA 4KLFA 9ICWA 4AT7B 3HJ4A 9ICKA 8ICCA 4Z6FA 2M2VA 9ICOA 4X4QA 3JYYA 4O5KA 1FA0A 4RWNA 1ZQZA 1JQRA 9ICMA 8ICJA 1HUOA 4MFCA 2IHMA 1ZQPA 3JPRA 1ZQWA 7ICGA 7ICEA 1MIVA 4QZAA 5IIJA 5CHGA 3OUYB 4I2BA 4M5DA 9ICAA 7ICIA 5J2AA 4PHEA 4RQ1A 4F5QA 3AQKA 2DR9A 2ZH2A 4F5NA 3H39A 9ICBA 4XQ8A 1KEJA 4RWOA 2ZH4A 2ZH8A 5HC9A 7ICKA 3C2LA 2BCRA 4X4VA 2O1PA 4QZCA 3RJJA 4YMOA 3AU6A 3C5GA 5J0WA 9ICXA 1ZJMA 4KLLA 5J2IA 4M9NA 4MFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO9 A;  4AT7 A;  4YD1 A;  3ISB A;  1ZQS A;  1JMS A;  4KLS A;  1TVA A;  4EBK A;  2DR7 A;  4I29 A;  5D46 A;  5DB8 A;  3UQ0 A;  5IIO A;  7ICR A;  8ICZ A;  5HRL A;  1VFG A;  5DB6 A;  4X4T A;  1MQ3 A;  4DOA A;  4UB2 A;  3OVB A;  3UXP A;  1BPX A;  5J0O A;  1ZQT A;  4KLE A;  2W9M A;  4M9J A;  3JPQ A;  3C5F A;  5CWR A;  4WC4 A;  8ICL A;  4WC0 A;  4FHW A;  8ICA A;  3ISD A;  5D4B A;  4AT9 A;  4EBJ A;  1ZQA A;  1Q79 A;  4PH5 A;  1MQ2 A;  9ICE A;  4E8F A;  2BCS A;  2DRB A;  3C18 A;  9ICU A;  4PHA A;  4WC3 A;  4KLG A;  5J2K A;  4PHD A;  4RWP A;  5CR0 A;  1ZQM A;  4F5O A;  4M47 A;  1Q78 A;  4RPZ A;  4WCW A;  3AQL A;  5DED A;  1JAJ A;  1V4A A;  3B0X A;  9ICF A;  1R8B A;  1BPD A;  4NLZ A;  7ICT A;  2PXI A;  4KLD A;  4X5V A;  3WFO A;  4YMN A;  3OVA A;  8ICU A;  4WC1 A;  4UBC A;  1BPZ A;  1RPL A;  4S3N A;  5EOZ A;  9ICR A;  1TFW A;  1NO5 A;  8ICS A;  3RH6 A;  3V72 A;  5BOL A;  4M9L A;  2VAN A;  4F5P A;  4UB1 A;  4NM1 A;  4NLK A;  8ICX A;  5DDY A;  1OU5 A;  3HJ1 A;  8ICP A;  5J0Q A;  4NM2 A;  4ATB B;  4TUR A;  1KNY A;  4LZG A;  8ICI A;  4E80 A;  2M2W A;  8ICR A;  1ZQJ A;  4IG8 A;  3MGH A;  4XQ7 A;  3LQC B;  4FH5 A;  4O5E A;  3WFR E;  5F2V O;  4R64 A;  1ZJN A;  4RWQ A;  3HW8 A;  1ZQQ A;  3C2K A;  4UB3 A;  3H3A A;  4WBZ A;  4FHX A;  4RQ3 A;  3TFS A;  8ICH A;  4X0B A;  2M2U A;  1XSP A;  3L9D A;  5DB9 A;  3RJF A;  4JWM A;  4LZD A;  3RJH A;  4I2G A;  3UPQ A;  5HHH A;  5J2G A;  3UXN A;  1ZQC A;  5DEC A;  4AT9 B;  4UB4 A;  3AUO A;  5HRE A;  2FMS A;  1WOT A;  3C66 A;  3OV7 A;  1RZT A;  4P4M A;  4R65 A;  4RPX A;  9ICS A;  3UQ2 A;  4IQU A;  4I2F A;  8ICF A;  2FMQ A;  3UXO A;  1ZQF A;  9ICP A;  1TV9 A;  2I9G A;  2ZH1 A;  4M9G A;  3PML A;  4KLM A;  4ATB A;  4IQT A;  4PGX A;  4NLN A;  4I27 A;  9ICJ A;  4X4P A;  4DOB A;  7ICQ A;  3K75 D;  1ZQN A;  3HWT A;  5DBC A;  3RJE A;  2M2T A;  5BPC A;  4NY8 A;  5HRB A;  1ZQX A;  4YN4 A;  4GXI A;  2BCU A;  4WC6 A;  5J0S A;  4RQ8 A;  1UEU A;  2RFF A;  5HHI A;  4TUP A;  7ICN A;  2O5A A;  4X4R A;  3H38 A;  4UBB A;  4LT6 A;  8ICT A;  5DB7 A;  3WFP A;  4QZD A;  4RPY A;  1ZQG A;  5HRK A;  4I2A A;  4R66 A;  4WC7 A;  4I28 A;  3HX0 A;  1UEV A;  4P4P A;  1YLQ A;  3RJI A;  3JPO A;  3GDX A;  4YCX A;  4M2Y A;  1HUZ A;  3AQM A;  8ICB A;  3UPS A;  8ICY A;  9ICC A;  4MF8 A;  4UAW A;  4M0A A;  1ZQO A;  5J2J A;  4KLJ A;  1ZQV A;  2ZHB A;  4X4N A;  4X4O A;  9ICL A;  4O5C A;  4QZH A;  9ICN A;  3RH4 A;  8ICQ A;  4P4O A;  1ZQR A;  4I2C A;  1ZQE A;  7ICO A;  5J0R A;  4IQV A;  4RQ0 A;  4RT2 A;  7ICF A;  4QZF A;  4QZE A;  4MF2 A;  3V7J A;  1MIW A;  9ICV A;  4KLO A;  3JPP A;  3OGU A;  4GXJ A;  3JPN A;  5IIK A;  2FMP A;  1ZQI A;  5CA7 A;  4I2H A;  7ICJ A;  3JPS A;  8ICK A;  3C2M A;  3RJK A;  4JWN A;  1XSL A;  3MGI A;  5J2E A;  5DBB A;  4TUS A;  4QZ8 A;  1BPB A;  5D49 A;  1ZQD A;  5DKW A;  4I2I A;  1KDH A;  2BPC A;  7ICH A;  1XSN A;  3WFQ E;  4KLH A;  1ZQK A;  2ZH9 A;  4FHY A;  2BCQ A;  9ICQ A;  4I2E A;  5J2C A;  5HR9 A;  3NYB A;  5HRH A;  3HIY A;  3JPT A;  4X0A A;  4AT8 A;  5CJ7 A;  2NRK A;  4NKT A;  4X4S A;  4FHV A;  4RQ4 A;  3MDA A;  4QZ9 A;  4QZG A;  3OVS A;  1MIY A;  7ICU A;  4DOC A;  5HRG A;  4UD4 A;  4XRH A;  4RQ6 A;  3ISC A;  2ID1 A;  4EP7 A;  2ISO A;  4NKU A;  1ZQU A;  5J0X A;  1PX5 A;  4Z6C A;  5IIM A;  4RQ7 A;  8ICE A;  5J0T A;  5CB1 A;  2ZH5 A;  3V7K A;  4WBY A;  4XA5 A;  4RQ5 A;  8ICV A;  1TFY A;  4TUQ A;  3JZ0 A;  9ICH A;  4PGY A;  4I2J A;  4X4U A;  2DVI A;  4Z6D A;  4R63 A;  1ZQY A;  7ICL A;  4I2D A;  2ISP A;  5J0U A;  4Z6E A;  2BE3 A;  3PMN A;  2ZH6 A;  5III A;  4KLQ A;  4RQ2 A;  2DR5 A;  4QZI A;  2PFQ A;  2PBE A;  2DR8 A;  1R89 A;  1VJ7 A;  3B0Y A;  9ICT A;  4O9M A;  8ICW A;  4NXZ A;  2PFO A;  4K4H A;  1ZQL A;  3WFS C;  4QZB A;  4FHP A;  3LK9 A;  4E7X A;  5J2F A;  3PNC A;  1NOM A;  4PHP A;  4UD5 A;  4UB5 A;  2DRA A;  5J2D A;  3OUY A;  2ZH7 A;  5DDM A;  4XUS A;  1BPY A;  5J2H A;  2PFN A;  4K4G A;  4KLI A;  4KLU A;  4GXK A;  2BCV A;  2BPF A;  9ICG A;  2BPG A;  8ICG A;  8ICM A;  3MDC A;  2PFP A;  4WC5 A;  5DBA A;  3RH5 A;  4RT3 A;  4AT8 B;  5IIL A;  1BPE A;  7ICP A;  5J0P A;  5BOM A;  4F5R A;  1F5A A;  2HHP A;  1ZQH A;  4IQW A;  2ZHA A;  5HRI A;  1ZQB A;  2Q66 A;  4PPX A;  5J0Y A;  4UAZ A;  8ICN A;  3MBY A;  4UAY A;  5J29 A;  3RJG A;  5J2B A;  3TFR A;  4M04 A;  3AU2 A;  3V7L A;  4P2H A;  8ICO A;  2P66 A;  5HRD A;  9ICI A;  2ZH3 A;  4FH3 A;  3H37 A;  3AQN A;  4KLT A;  1UET A;  4M9H A;  4YD2 A;  2GWS A;  5CP2 A;  7ICM A;  5HRF A;  4K4I A;  4YMM A;  4FO6 A;  1JN3 A;  5TZV A;  1R8C A;  4LVS A;  5IIN A;  4MFA A;  7ICV A;  1R8A A;  4PGQ A;  4WC2 A;  7ICS A;  4KLF A;  9ICW A;  4AT7 B;  3HJ4 A;  9ICK A;  8ICC A;  4Z6F A;  2M2V A;  9ICO A;  4X4Q A;  3JYY A;  4O5K A;  1FA0 A;  4RWN A;  1ZQZ A;  1JQR A;  9ICM A;  8ICJ A;  1HUO A;  4MFC A;  2IHM A;  1ZQP A;  3JPR A;  1ZQW A;  7ICG A;  7ICE A;  1MIV A;  4QZA A;  5IIJ A;  5CHG A;  3OUY B;  4I2B A;  4M5D A;  9ICA A;  7ICI A;  5J2A A;  4PHE A;  4RQ1 A;  4F5Q A;  3AQK A;  2DR9 A;  2ZH2 A;  4F5N A;  3H39 A;  9ICB A;  4XQ8 A;  1KEJ A;  4RWO A;  2ZH4 A;  2ZH8 A;  5HC9 A;  7ICK A;  3C2L A;  2BCR A;  4X4V A;  2O1P A;  4QZC A;  3RJJ A;  4YMO A;  3AU6 A;  3C5G A;  5J0W A;  9ICX A;  1ZJM A;  4KLL A;  5J2I A;  4M9N A;  4MFF A; 
#chains in the Genus database with same CATH topology
 4DO9 A;  4AT7 A;  4YD1 A;  3ISB A;  3CK6 A;  1ZQS A;  1JMS A;  4KLS A;  4NXT A;  1TVA A;  4EBK A;  2DR7 A;  4I29 A;  5D46 A;  5DB8 A;  3UQ0 A;  5IIO A;  5CFT A;  2GAF D;  7ICR A;  8ICZ A;  5HRL A;  1VFG A;  5DB6 A;  4X4T A;  1MQ3 A;  4DOA A;  4UB2 A;  3OVB A;  3UXP A;  1BPX A;  5B3P A;  5J0O A;  1ZQT A;  4KLE A;  2GA9 D;  2W9M A;  4M9J A;  4N7R A;  3JPQ A;  3C5F A;  5CWR A;  4WC4 A;  8ICL A;  3K7D A;  4OAF A;  4WC0 A;  4FHW A;  8ICA A;  3ISD A;  5D4B A;  4AT9 A;  4EBJ A;  4XJE A;  1ZQA A;  3MCR A;  1Q79 A;  4PH5 A;  1MQ2 A;  9ICE A;  4E8F A;  2BCS A;  2DRB A;  3C18 A;  9ICU A;  4PHA A;  4WC3 A;  4KLG A;  5J2K A;  4PHD A;  4O69 A;  4RWP A;  5CR0 A;  1ZQM A;  4F5O A;  4M47 A;  1Q78 A;  4RPZ A;  4WCW A;  3AQL A;  5DED A;  1JAJ A;  1V4A A;  3B0X A;  9ICF A;  1R8B A;  1BPD A;  4NLZ A;  7ICT A;  2PXI A;  4KLD A;  4X5V A;  3WFO A;  4YMN A;  3NWI A;  3OVA A;  8ICU A;  4WC1 A;  4UBC A;  1BPZ A;  2B56 A;  1RPL A;  4S3N A;  5EOZ A;  9ICR A;  1TFW A;  1NO5 A;  8ICS A;  3RH6 A;  3V72 A;  5BOL A;  4M9L A;  2VAN A;  4F5P A;  4UB1 A;  4NM1 A;  4NLK A;  8ICX A;  5DDY A;  1OU5 A;  3HJ1 A;  8ICP A;  5J0Q A;  4NM2 A;  4ATB B;  4TUR A;  1KNY A;  4LZG A;  8ICI A;  4E80 A;  2M2W A;  8ICR A;  1ZQJ A;  4IG8 A;  3MGH A;  4XQ7 A;  3LQC B;  4FH5 A;  4O5E A;  3WFR E;  5F2V O;  4R64 A;  4K96 A;  1ZJN A;  4RWQ A;  3HW8 A;  1ZQQ A;  3C2K A;  4UB3 A;  3H3A A;  4WBZ A;  4FHX A;  3NKU A;  4RQ3 A;  3TFS A;  8ICH A;  4X0B A;  2M2U A;  1XSP A;  4JLZ A;  4K97 A;  3L9D A;  5CHE A;  5DB9 A;  3RJF A;  4JWM A;  4O6A A;  4LZD A;  3RJH A;  4I2G A;  3UPQ A;  5HHH A;  5J2G A;  3UXN A;  4KM5 A;  1ZQC A;  5DEC A;  4AT9 B;  4UB4 A;  3AUO A;  5HRE A;  2FMS A;  1WOT A;  3C66 A;  3OV7 A;  4K98 A;  1RZT A;  4P4M A;  4R65 A;  4RPX A;  9ICS A;  3UQ2 A;  4IQU A;  4I2F A;  8ICF A;  2FMQ A;  3UXO A;  1ZQF A;  9ICP A;  4MKP A;  1TV9 A;  2I9G A;  2ZH1 A;  4M9G A;  3PML A;  4KLM A;  4NXW A;  4IQT A;  4PGX A;  4NLN A;  4ATB A;  4LEZ A;  4K99 A;  4I27 A;  9ICJ A;  4X4P A;  4DOB A;  7ICQ A;  3K75 D;  1ZQN A;  4NXX A;  3HWT A;  5DBC A;  3RJE A;  2M2T A;  5BPC A;  4NY8 A;  5HRB A;  1ZQX A;  4YN4 A;  4GXI A;  2BCU A;  4WC6 A;  5J0S A;  4RQ8 A;  1UEU A;  2RFF A;  5HHI A;  4TUP A;  7ICN A;  2O5A A;  4X4R A;  3H38 A;  4UBB A;  4LT6 A;  8ICT A;  5DB7 A;  3WFP A;  4QZD A;  4RPY A;  1ZQG A;  5HRK A;  4I2A A;  4R66 A;  4WC7 A;  4I28 A;  3HX0 A;  2EWR A;  1UEV A;  4P4P A;  1YLQ A;  3RJI A;  3JPO A;  3GDX A;  4YCX A;  4M2Y A;  1HUZ A;  3AQM A;  8ICB A;  3UPS A;  8ICY A;  9ICC A;  4MF8 A;  4EED A;  4UAW A;  4M0A A;  4KB6 A;  1ZQO A;  4OAG A;  5J2J A;  4KLJ A;  1ZQV A;  2ZHB A;  4X4N A;  4X4O A;  9ICL A;  4O5C A;  5D62 A;  4K8V A;  4QZH A;  9ICN A;  3RH4 A;  8ICQ A;  2B51 A;  4P4O A;  1ZQR A;  4I2C A;  1ZQE A;  7ICO A;  5J0R A;  4IQV A;  4RQ0 A;  4RT2 A;  7ICF A;  4QZF A;  4QZE A;  4MF2 A;  3V7J A;  1MIW A;  9ICV A;  4KLO A;  3JPP A;  3OGU A;  2B4V A;  4GXJ A;  3JPN A;  5IIK A;  2FMP A;  1ZQI A;  5CA7 A;  4I2H A;  7ICJ A;  3JPS A;  8ICK A;  3C2M A;  3RJK A;  4JWN A;  4K9A A;  1XSL A;  3MGI A;  5J2E A;  5DBB A;  4TUS A;  4QZ8 A;  1BPB A;  5D49 A;  1ZQD A;  5DKW A;  4I2I A;  1KDH A;  2BPC A;  7ICH A;  1XSN A;  3WFQ E;  4K9B A;  4KLH A;  1ZQK A;  2ZH9 A;  4FHY A;  2BCQ A;  2BBJ A;  9ICQ A;  4NXU A;  2IUB A;  4I2E A;  5J2C A;  5HR9 A;  3NYB A;  5HRH A;  3HIY A;  4EGW A;  3JPT A;  4X0A A;  4AT8 A;  5CJ7 A;  2NRK A;  4NKT A;  4X4S A;  4NXV A;  4O67 A;  4FHV A;  4RQ4 A;  3MDA A;  4QZ9 A;  4QZG A;  3OVS A;  1MIY A;  7ICU A;  4DOC A;  5HRG A;  4UD4 A;  4XRH A;  4RQ6 A;  3ISC A;  2ID1 A;  4EP7 A;  4EEB A;  2ISO A;  4NKU A;  1ZQU A;  5D61 A;  5JTG A;  5J0X A;  4HX0 A;  1PX5 A;  4Z6C A;  5IIM A;  4RQ7 A;  8ICE A;  5J0T A;  5CB1 A;  2ZH5 A;  3V7K A;  4WBY A;  4XA5 A;  4RQ5 A;  8ICV A;  1TFY A;  4TUQ A;  3JZ0 A;  9ICH A;  4PGY A;  4I2J A;  4X4U A;  2DVI A;  4Z6D A;  4R63 A;  3PHZ A;  1ZQY A;  7ICL A;  4I2D A;  2ISP A;  5J0U A;  4Z6E A;  2BE3 A;  4I0U A;  3PMN A;  2ZH6 A;  5III A;  4OAH A;  4KLQ A;  4RQ2 A;  2DR5 A;  4QZI A;  2PFQ A;  5CFU A;  2PBE A;  2DR8 A;  1R89 A;  1VJ7 A;  3B0Y A;  2BBH A;  9ICT A;  2IHO A;  4O9M A;  8ICW A;  4NXZ A;  2PFO A;  4K4H A;  1ZQL A;  3ERC C;  3WFS C;  4QZB A;  4FHP A;  3LK9 A;  4E7X A;  5J2F A;  3PNC A;  1NOM A;  4PHP A;  4UD5 A;  4FO1 A;  4UB5 A;  2DRA A;  5J2D A;  3OUY A;  2ZH7 A;  5DDM A;  5B3Q A;  4XUS A;  1BPY A;  5J2H A;  2PFN A;  4K4G A;  4KLI A;  4KLU A;  4GXK A;  4O68 A;  2BCV A;  2HN2 A;  2BPF A;  3ER9 B;  9ICG A;  2BPG A;  8ICG A;  8ICM A;  3MDC A;  2PFP A;  2FCL A;  4WC5 A;  4LEY A;  5DBA A;  3RH5 A;  4RT3 A;  2HN1 A;  3OWG A;  5IIL A;  4AT8 B;  1BPE A;  7ICP A;  5J0P A;  5BOM A;  4F5R A;  1F5A A;  2HHP A;  1ZQH A;  4IQW A;  2ZHA A;  5HRI A;  1ZQB A;  2Q66 A;  3ER8 C;  4PPX A;  5J0Y A;  4UAZ A;  8ICN A;  3MBY A;  4UAY A;  5J29 A;  3RJG A;  5J2B A;  3TFR A;  4M04 A;  4EV6 A;  3AU2 A;  3V7L A;  4WH5 A;  4P2H A;  8ICO A;  2P66 A;  5HRD A;  9ICI A;  2ZH3 A;  4FH3 A;  4WQL A;  3H37 A;  3AQN A;  4KLT A;  1UET A;  4M9H A;  4YD2 A;  2GWS A;  5CP2 A;  7ICM A;  5HRF A;  4K4I A;  4YMM A;  4JLX A;  4FO6 A;  1JN3 A;  5TZV A;  1R8C A;  4LEW A;  4LVS A;  5IIN A;  3NVO A;  4MFA A;  4WOY A;  7ICV A;  1R8A A;  4OAI Z;  4PGQ A;  1GPJ A;  4WC2 A;  7ICS A;  4KLF A;  9ICW A;  4AT7 B;  3HJ4 A;  9ICK A;  8ICC A;  4Z6F A;  2M2V A;  9ICO A;  4X4Q A;  3JYY A;  4O5K A;  1FA0 A;  4RWN A;  1ZQZ A;  1JQR A;  4LEV A;  3EF2 A;  9ICM A;  8ICJ A;  1HUO A;  4MFC A;  2IHM A;  1ZQP A;  3JPR A;  1ZQW A;  7ICG A;  7ICE A;  1MIV A;  4QZA A;  5IIJ A;  5CHG A;  3OUY B;  4I2B A;  4M5D A;  9ICA A;  7ICI A;  5J2A A;  4PHE A;  4RQ1 A;  4F5Q A;  3AQK A;  2DR9 A;  2ZH2 A;  4F5N A;  3H39 A;  9ICB A;  4XQ8 A;  1KEJ A;  4RWO A;  2ZH4 A;  2ZH8 A;  5HC9 A;  7ICK A;  3C2L A;  2BCR A;  5CFS A;  4X4V A;  2O1P A;  4QZC A;  3RJJ A;  4YMO A;  3AU6 A;  3C5G A;  5J0W A;  9ICX A;  4WQK A;  1ZJM A;  3JCF A;  5D63 A;  4KLL A;  5J2I A;  4M9N A;  4MFF A; 
#chains in the Genus database with same CATH homology
 4DO9 A;  4AT7 A;  4YD1 A;  3ISB A;  1ZQS A;  1JMS A;  4KLS A;  1TVA A;  4EBK A;  2DR7 A;  4I29 A;  5D46 A;  5DB8 A;  3UQ0 A;  5IIO A;  7ICR A;  8ICZ A;  5HRL A;  1VFG A;  5DB6 A;  4X4T A;  1MQ3 A;  4DOA A;  4UB2 A;  3OVB A;  3UXP A;  1BPX A;  5J0O A;  1ZQT A;  4KLE A;  2W9M A;  4M9J A;  3JPQ A;  3C5F A;  5CWR A;  4WC4 A;  8ICL A;  4WC0 A;  4FHW A;  8ICA A;  3ISD A;  5D4B A;  4AT9 A;  4EBJ A;  1ZQA A;  1Q79 A;  4PH5 A;  1MQ2 A;  9ICE A;  4E8F A;  2BCS A;  2DRB A;  3C18 A;  9ICU A;  4PHA A;  4WC3 A;  4KLG A;  5J2K A;  4PHD A;  4RWP A;  5CR0 A;  1ZQM A;  4F5O A;  4M47 A;  1Q78 A;  4RPZ A;  4WCW A;  3AQL A;  5DED A;  1JAJ A;  1V4A A;  3B0X A;  9ICF A;  1R8B A;  1BPD A;  4NLZ A;  7ICT A;  2PXI A;  4KLD A;  4X5V A;  3WFO A;  4YMN A;  3OVA A;  8ICU A;  4WC1 A;  4UBC A;  1BPZ A;  1RPL A;  4S3N A;  5EOZ A;  9ICR A;  1TFW A;  1NO5 A;  8ICS A;  3RH6 A;  3V72 A;  5BOL A;  4M9L A;  2VAN A;  4F5P A;  4UB1 A;  4NM1 A;  4NLK A;  8ICX A;  5DDY A;  1OU5 A;  3HJ1 A;  8ICP A;  5J0Q A;  4NM2 A;  4ATB B;  4TUR A;  1KNY A;  4LZG A;  8ICI A;  4E80 A;  2M2W A;  8ICR A;  1ZQJ A;  4IG8 A;  3MGH A;  4XQ7 A;  3LQC B;  4FH5 A;  4O5E A;  3WFR E;  5F2V O;  4R64 A;  1ZJN A;  4RWQ A;  3HW8 A;  1ZQQ A;  3C2K A;  4UB3 A;  3H3A A;  4WBZ A;  4FHX A;  4RQ3 A;  3TFS A;  8ICH A;  4X0B A;  2M2U A;  1XSP A;  3L9D A;  5DB9 A;  3RJF A;  4JWM A;  4LZD A;  3RJH A;  4I2G A;  3UPQ A;  5HHH A;  5J2G A;  3UXN A;  1ZQC A;  5DEC A;  4AT9 B;  4UB4 A;  3AUO A;  5HRE A;  2FMS A;  1WOT A;  3C66 A;  3OV7 A;  1RZT A;  4P4M A;  4R65 A;  4RPX A;  9ICS A;  3UQ2 A;  4IQU A;  4I2F A;  8ICF A;  2FMQ A;  3UXO A;  1ZQF A;  9ICP A;  1TV9 A;  2I9G A;  2ZH1 A;  4M9G A;  3PML A;  4KLM A;  4ATB A;  4IQT A;  4PGX A;  4NLN A;  4I27 A;  9ICJ A;  4X4P A;  4DOB A;  7ICQ A;  3K75 D;  1ZQN A;  3HWT A;  5DBC A;  3RJE A;  2M2T A;  5BPC A;  4NY8 A;  5HRB A;  1ZQX A;  4YN4 A;  4GXI A;  2BCU A;  4WC6 A;  5J0S A;  4RQ8 A;  1UEU A;  2RFF A;  5HHI A;  4TUP A;  7ICN A;  2O5A A;  4X4R A;  3H38 A;  4UBB A;  4LT6 A;  8ICT A;  5DB7 A;  3WFP A;  4QZD A;  4RPY A;  1ZQG A;  5HRK A;  4I2A A;  4R66 A;  4WC7 A;  4I28 A;  3HX0 A;  1UEV A;  4P4P A;  1YLQ A;  3RJI A;  3JPO A;  3GDX A;  4YCX A;  4M2Y A;  1HUZ A;  3AQM A;  8ICB A;  3UPS A;  8ICY A;  9ICC A;  4MF8 A;  4UAW A;  4M0A A;  1ZQO A;  5J2J A;  4KLJ A;  1ZQV A;  2ZHB A;  4X4N A;  4X4O A;  9ICL A;  4O5C A;  4QZH A;  9ICN A;  3RH4 A;  8ICQ A;  4P4O A;  1ZQR A;  4I2C A;  1ZQE A;  7ICO A;  5J0R A;  4IQV A;  4RQ0 A;  4RT2 A;  7ICF A;  4QZF A;  4QZE A;  4MF2 A;  3V7J A;  1MIW A;  9ICV A;  4KLO A;  3JPP A;  3OGU A;  4GXJ A;  3JPN A;  5IIK A;  2FMP A;  1ZQI A;  5CA7 A;  4I2H A;  7ICJ A;  3JPS A;  8ICK A;  3C2M A;  3RJK A;  4JWN A;  1XSL A;  3MGI A;  5J2E A;  5DBB A;  4TUS A;  4QZ8 A;  1BPB A;  5D49 A;  1ZQD A;  5DKW A;  4I2I A;  1KDH A;  2BPC A;  7ICH A;  1XSN A;  3WFQ E;  4KLH A;  1ZQK A;  2ZH9 A;  4FHY A;  2BCQ A;  9ICQ A;  4I2E A;  5J2C A;  5HR9 A;  3NYB A;  5HRH A;  3HIY A;  3JPT A;  4X0A A;  4AT8 A;  5CJ7 A;  2NRK A;  4NKT A;  4X4S A;  4FHV A;  4RQ4 A;  3MDA A;  4QZ9 A;  4QZG A;  3OVS A;  1MIY A;  7ICU A;  4DOC A;  5HRG A;  4UD4 A;  4XRH A;  4RQ6 A;  3ISC A;  2ID1 A;  4EP7 A;  2ISO A;  4NKU A;  1ZQU A;  5J0X A;  1PX5 A;  4Z6C A;  5IIM A;  4RQ7 A;  8ICE A;  5J0T A;  5CB1 A;  2ZH5 A;  3V7K A;  4WBY A;  4XA5 A;  4RQ5 A;  8ICV A;  1TFY A;  4TUQ A;  3JZ0 A;  9ICH A;  4PGY A;  4I2J A;  4X4U A;  2DVI A;  4Z6D A;  4R63 A;  1ZQY A;  7ICL A;  4I2D A;  2ISP A;  5J0U A;  4Z6E A;  2BE3 A;  3PMN A;  2ZH6 A;  5III A;  4KLQ A;  4RQ2 A;  2DR5 A;  4QZI A;  2PFQ A;  2PBE A;  2DR8 A;  1R89 A;  1VJ7 A;  3B0Y A;  9ICT A;  4O9M A;  8ICW A;  4NXZ A;  2PFO A;  4K4H A;  1ZQL A;  3WFS C;  4QZB A;  4FHP A;  3LK9 A;  4E7X A;  5J2F A;  3PNC A;  1NOM A;  4PHP A;  4UD5 A;  4UB5 A;  2DRA A;  5J2D A;  3OUY A;  2ZH7 A;  5DDM A;  4XUS A;  1BPY A;  5J2H A;  2PFN A;  4K4G A;  4KLI A;  4KLU A;  4GXK A;  2BCV A;  2BPF A;  9ICG A;  2BPG A;  8ICG A;  8ICM A;  3MDC A;  2PFP A;  4WC5 A;  5DBA A;  3RH5 A;  4RT3 A;  4AT8 B;  5IIL A;  1BPE A;  7ICP A;  5J0P A;  5BOM A;  4F5R A;  1F5A A;  2HHP A;  1ZQH A;  4IQW A;  2ZHA A;  5HRI A;  1ZQB A;  2Q66 A;  4PPX A;  5J0Y A;  4UAZ A;  8ICN A;  3MBY A;  4UAY A;  5J29 A;  3RJG A;  5J2B A;  3TFR A;  4M04 A;  3AU2 A;  3V7L A;  4P2H A;  8ICO A;  2P66 A;  5HRD A;  9ICI A;  2ZH3 A;  4FH3 A;  3H37 A;  3AQN A;  4KLT A;  1UET A;  4M9H A;  4YD2 A;  2GWS A;  5CP2 A;  7ICM A;  5HRF A;  4K4I A;  4YMM A;  4FO6 A;  1JN3 A;  5TZV A;  1R8C A;  4LVS A;  5IIN A;  4MFA A;  7ICV A;  1R8A A;  4PGQ A;  4WC2 A;  7ICS A;  4KLF A;  9ICW A;  4AT7 B;  3HJ4 A;  9ICK A;  8ICC A;  4Z6F A;  2M2V A;  9ICO A;  4X4Q A;  3JYY A;  4O5K A;  1FA0 A;  4RWN A;  1ZQZ A;  1JQR A;  9ICM A;  8ICJ A;  1HUO A;  4MFC A;  2IHM A;  1ZQP A;  3JPR A;  1ZQW A;  7ICG A;  7ICE A;  1MIV A;  4QZA A;  5IIJ A;  5CHG A;  3OUY B;  4I2B A;  4M5D A;  9ICA A;  7ICI A;  5J2A A;  4PHE A;  4RQ1 A;  4F5Q A;  3AQK A;  2DR9 A;  2ZH2 A;  4F5N A;  3H39 A;  9ICB A;  4XQ8 A;  1KEJ A;  4RWO A;  2ZH4 A;  2ZH8 A;  5HC9 A;  7ICK A;  3C2L A;  2BCR A;  4X4V A;  2O1P A;  4QZC A;  3RJJ A;  4YMO A;  3AU6 A;  3C5G A;  5J0W A;  9ICX A;  1ZJM A;  4KLL A;  5J2I A;  4M9N A;  4MFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...