5HRFA

The crystal structure of asfvpolx: dna5: dgtp ternary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
b'SGGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrfA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrfA01
4K4IA 2ZH2A 4K4HA 1ZQPA 4FHWA 4P4OA 4NLKA 4WBZA 4M2YA 2IHMA 5HRKA 1ZQLA 3ISBA 4EP7A 1RZTA 5IILA 4RQ2A 9ICRA 3RJJA 2O1PA 1ZQSA 4NY8A 4P2HA 4ATBB 4I2AA 1ZQFA 1ZQAA 5CP2A 4DOCA 2PFOA 4FHVA 4R66A 4I2JA 3LK9A 4Z6DA 4KLLA 2ZH7A 4NXZA 5DKWA 1TVAA 1YLQA 3C18A 5HRLA 7ICMA 2I9GA 4X5VA 3V7KA 2PFQA 4NM1A 4LVSA 4F5NA 1R8CA 4AT9B 3K75D 4WCWA 9ICVA 7ICRA 2ISPA 5D4BA 1BPDA 2P66A 2FMQA 4X4QA 4QZDA 4TUSA 4ATBA 2BCVA 3JPRA 2ZH3A 4E80A 4UBCA 2DR7A 1ZQRA 4YMOA 5DDMA 1MQ2A 5DBCA 4FHPA 1ZQWA 2FMSA 7ICGA 1RPLA 8ICNA 4X4PA 3JPTA 1NOMA 5J2FA 5J0PA 3JPOA 4AT9A 5J0XA 4K4GA 3MBYA 2NRKA 3TFRA 3PMLA 4NLZA 3JPPA 1BPXA 8ICZA 4WC2A 4AT8B 1KNYA 2RFFA 5J2BA 5IIOA 9ICAA 9ICHA 5CWRA 5D49A 2PXIA 1TFWA 4YMNA 1ZQYA 4M47A 4QZAA 4LZDA 5IINA 4WC7A 1JN3A 4YCXA 4M9LA 2GWSA 3L9DA 5J2GA 4RQ5A 3WFOA 4RQ7A 5HC9A 3OGUA 4QZHA 1ZQOA 7ICJA 4KLIA 4PHDA 8ICQA 3UXNA 4RT2A 9ICXA 3H38A 4KLSA 4O9MA 4RPYA 4UB3A 5J2CA 8ICRA 7ICTA 9ICTA 3OVAA 5J2KA 1ZJMA 4UB1A 2DRAA 4EBKA 2ZHBA 3HJ1A 4XUSA 4PGYA 3UXPA 4M9JA 3V7JA 2Q66A 1BPYA 1XSLA 3WFRE 1ZQIA 4PHPA 1Q78A 5DB9A 3OUYA 8ICOA 4RWOA 4QZ9A 3JPQA 5HRGA 5BPCA 3HJ4A 1ZQTA 1ZQUA 4UB5A 1TFYA 5J2EA 3MDAA 4XQ8A 2DRBA 8ICIA 3ISDA 9ICCA 5CR0A 5TZVA 3NYBA 4I2IA 4F5QA 4UAYA 8ICHA 7ICUA 4PGQA 4NKUA 3TFSA 4LT6A 3RJKA 5J0WA 4WC6A 4MF8A 1ZQQA 4M9GA 3B0XA 4MFAA 1ZQVA 2BPGA 4FO6A 2M2VA 5D46A 4WC0A 3WFPA 3RJFA 1KDHA 3AQNA 3MDCA 9ICNA 4R64A 9ICMA 4I2FA 2O5AA 2ZH4A 2DR5A 4KLFA 4KLJA 1UEVA 2M2UA 5J0RA 9ICBA 5J0QA 8ICXA 4X4VA 5HRDA 4R63A 4RWPA 8ICLA 3V72A 4XA5A 5CB1A 5HHHA 3UQ0A 5J0TA 3WFQE 1NO5A 1V4AA 4TURA 1HUOA 4TUPA 7ICSA 3JZ0A 3H3AA 4RPZA 3UPQA 4IG8A 4UB4A 4JWNA 4PPXA 4P4PA 2M2TA 5J0OA 1JQRA 4GXKA 5DBAA 7ICEA 4RQ6A 4UB2A 4UBBA 5CA7A 4QZGA 3C2LA 2BCRA 1OU5A 7ICNA 4M04A 4I2BA 3C66A 9ICEA 4KLMA 3OVBA 8ICUA 4IQUA 4AT8A 4O5CA 3H37A 2BE3A 3JPSA 4PH5A 2FMPA 4AT7B 1ZQZA 5DB8A 1BPEA 4I28A 4I2HA 7ICVA 4X0AA 5J2HA 2PBEA 3RJHA 1MIWA 4RQ3A 1BPZA 4GXIA 1R8AA 4RQ4A 9ICQA 8ICJA 5J2AA 4O5EA 5HRFA 7ICPA 1KEJA 4WBYA 4QZEA 4AT7A 8ICGA 4FHYA 3GDXA 4X4NA 3OVSA 8ICEA 4X4RA 4F5OA 7ICLA 4RQ0A 3C2MA 1MIVA 1JAJA 5IIKA 3AQKA 5J0UA 3RH4A 1ZJNA 4RWQA 5J2JA 2ZH8A 2W9MA 9ICIA 4GXJA 1PX5A 4KLTA 3AUOA 4X4SA 3C5GA 4F5RA 7ICIA 4PGXA 4IQWA 4IQTA 7ICFA 4KLEA 3C2KA 4RQ8A 4QZFA 5HHIA 7ICQA 1ZQNA 4O5KA 5F2VO 3AU2A 1ZQGA 5HRBA 5BOMA 2BCSA 4QZIA 4MFCA 2ZH6A 4I2CA 5HREA 4WC3A 7ICHA 5CJ7A 1WOTA 2BPCA 4FH3A 5DBBA 3RJGA 4I2GA 9ICLA 2BPFA 5DB6A 2BCUA 4M5DA 4LZGA 3AQLA 8ICBA 3RH5A 5IIMA 1ZQCA 2ZH5A 5J29A 4E7XA 5CHGA 3RH6A 4M0AA 1ZQXA 3V7LA 4PHEA 9ICFA 2ZHAA 2ZH1A 3B0YA 4KLQA 8ICVA 1BPBA 8ICYA 3MGIA 4Z6CA 5HRIA 3UPSA 4RWNA 4I2DA 4DO9A 3ISCA 2HHPA 4QZCA 4X0BA 4RQ1A 4YMMA 1XSPA 3AQMA 1VJ7A 4YN4A 5HR9A 5DEDA 3H39A 5J0SA 4I2EA 2ISOA 9ICGA 4YD2A 8ICKA 9ICSA 1TV9A 4UD4A 4YD1A 1ZQHA 9ICWA 5HRHA 9ICUA 5DECA 4NM2A 4X4TA 1JMSA 3HX0A 4XRHA 1XSNA 3UXOA 8ICWA 4FHXA 4WC1A 2DVIA 1MIYA 4R65A 2BCQA 1ZQJA 8ICMA 8ICAA 4WC4A 1UEUA 2DR8A 5J2IA 3JPNA 4M9HA 1UETA 4FH5A 4KLUA 5EOZA 1ZQEA 7ICKA 4F5PA 1FA0A 5J0YA 7ICOA 9ICPA 1ZQMA 1MQ3A 3JYYA 1HUZA 4TUQA 3PMNA 3UQ2A 4RT3A 4UAWA 4DOBA 5IIJA 3C5FA 4XQ7A 3OV7A 3RJEA 5J2DA 5DB7A 4EBJA 2PFPA 9ICKA 3AU6A 4JWMA 4MFFA 4Z6FA 2ID1A 3OUYB 1Q79A 2VANA 5DDYA 4QZBA 9ICJA 8ICPA 4I27A 4M9NA 1F5AA 2ZH9A 3MGHA 4X4UA 1ZQBA 8ICTA 4KLDA 2M2WA 2PFNA 3HIYA 1R89A 4I29A 3RJIA 4KLGA 3HWTA 4KLHA 4DOAA 4Z6EA 4E8FA 4NLNA 1ZQDA 4QZ8A 2DR9A 4IQVA 1ZQKA 8ICSA 5IIIA 3HW8A 4UAZA 5BOLA 8ICFA 4NKTA 3WFSC 3LQCB 4P4MA 4MF2A 1VFGA 3PNCA 4X4OA 8ICCA 4KLOA 9ICOA 4UD5A 4S3NA 4PHAA 4WC5A 4RPXA 1R8BA
chains in the Genus database with same CATH superfamily
4K4IA 2ZH2A 4K4HA 1ZQPA 4FHWA 4P4OA 4NLKA 4WBZA 4M2YA 2IHMA 5HRKA 3NVOA 1ZQLA 3ISBA 4NXUA 1RZTA 4EP7A 5IILA 4RQ2A 4WQLA 9ICRA 3RJJA 2O1PA 1ZQSA 4NY8A 4P2HA 4ATBB 4I2AA 1ZQFA 1ZQAA 2GA9D 5CP2A 4DOCA 2PFOA 4FHVA 4R66A 4I2JA 3LK9A 4Z6DA 4KLLA 2ZH7A 4NXZA 5DKWA 1TVAA 1YLQA 3C18A 5HRLA 7ICMA 2I9GA 4X5VA 3V7KA 2PFQA 4NM1A 4LVSA 4F5NA 5D61A 1R8CA 4AT9B 3K75D 4WCWA 5B3PA 9ICVA 7ICRA 2ISPA 5D4BA 1BPDA 2P66A 2FMQA 4X4QA 4QZDA 4TUSA 4ATBA 4HX0A 2BCVA 3JPRA 2ZH3A 4WH5A 4E80A 4UBCA 2DR7A 1ZQRA 4YMOA 5DDMA 1MQ2A 5DBCA 4FHPA 1ZQWA 2FMSA 7ICGA 1RPLA 8ICNA 4X4PA 3JPTA 1NOMA 5J2FA 5J0PA 3JPOA 4AT9A 5J0XA 2B51A 4K4GA 3MBYA 2NRKA 3TFRA 4NXXA 3PMLA 4NLZA 3JPPA 1BPXA 8ICZA 4WC2A 2B4VA 4AT8B 1KNYA 2RFFA 5J2BA 5IIOA 9ICAA 9ICHA 5CWRA 5D49A 2PXIA 1TFWA 4YMNA 5JTGA 1ZQYA 4M47A 4QZAA 4LZDA 5IINA 4WC7A 1JN3A 4YCXA 4M9LA 2GWSA 3L9DA 4EEBA 5J2GA 4RQ5A 3WFOA 4RQ7A 5HC9A 3OGUA 4QZHA 1ZQOA 7ICJA 4KLIA 4PHDA 4NXTA 8ICQA 3UXNA 4RT2A 9ICXA 3H38A 4KLSA 4O9MA 4RPYA 4UB3A 5J2CA 8ICRA 7ICTA 3CK6A 5CFUA 9ICTA 3OVAA 5J2KA 1ZJMA 4UB1A 2DRAA 4EBKA 2ZHBA 3HJ1A 4XUSA 4PGYA 3UXPA 4M9JA 3V7JA 3NWIA 4N7RA 2Q66A 1BPYA 1XSLA 3WFRE 1ZQIA 4PHPA 1Q78A 5DB9A 3OUYA 4K9AA 8ICOA 4XJEA 2IHOA 4RWOA 4QZ9A 3JPQA 5HRGA 5BPCA 3HJ4A 1ZQTA 1ZQUA 4UB5A 1TFYA 5J2EA 3MDAA 4XQ8A 2DRBA 8ICIA 3ISDA 9ICCA 5CR0A 5TZVA 3NYBA 4I2IA 4F5QA 4UAYA 8ICHA 7ICUA 4PGQA 4NKUA 3TFSA 4LT6A 3RJKA 5J0WA 4WC6A 4MF8A 1ZQQA 4M9GA 3B0XA 4MFAA 1ZQVA 2BPGA 4FO6A 3ER9B 2M2VA 5D62A 5D46A 4WC0A 3WFPA 4JLZA 3RJFA 1KDHA 3AQNA 3MDCA 9ICNA 4LEWA 4R64A 9ICMA 4I2FA 2O5AA 2ZH4A 2DR5A 4KLFA 4KLJA 1UEVA 2M2UA 5J0RA 9ICBA 5J0QA 8ICXA 4X4VA 5HRDA 4R63A 4RWPA 8ICLA 3V72A 4XA5A 5CB1A 4K96A 5HHHA 3UQ0A 5J0TA 4K98A 3WFQE 1NO5A 1V4AA 5D63A 4TURA 1HUOA 4TUPA 7ICSA 3JZ0A 3H3AA 4RPZA 3UPQA 4OAIZ 4EV6A 4IG8A 4UB4A 2B56A 4O67A 4OAHA 4K9BA 4JWNA 4PPXA 4P4PA 2M2TA 5J0OA 1JQRA 4GXKA 4O68A 5DBAA 7ICEA 4RQ6A 4UB2A 4UBBA 5CA7A 4QZGA 3C2LA 2BCRA 1OU5A 7ICNA 4M04A 4I2BA 4KB6A 3C66A 9ICEA 4KLMA 2BBJA 3OVBA 8ICUA 4IQUA 4AT8A 4O5CA 3H37A 2BE3A 3JPSA 4PH5A 2FMPA 4AT7B 1ZQZA 5DB8A 1BPEA 4EGWA 4I28A 4I2HA 7ICVA 4WQKA 4O6AA 4X0AA 5J2HA 2PBEA 3RJHA 1MIWA 4RQ3A 1BPZA 4GXIA 1R8AA 5CFSA 4RQ4A 2FCLA 9ICQA 8ICJA 5J2AA 4O5EA 5HRFA 7ICPA 1KEJA 4WBYA 4QZEA 4AT7A 8ICGA 4FHYA 3GDXA 4X4NA 3OVSA 8ICEA 4X4RA 4F5OA 7ICLA 4RQ0A 3C2MA 1MIVA 1JAJA 5IIKA 3AQKA 4K99A 2EWRA 4EEDA 5J0UA 3RH4A 2GAFD 1ZJNA 4RWQA 5J2JA 2ZH8A 2W9MA 9ICIA 4GXJA 1PX5A 4KLTA 4LEYA 3AUOA 4X4SA 3C5GA 4F5RA 7ICIA 4PGXA 4IQWA 4IQTA 7ICFA 4KLEA 3C2KA 4RQ8A 4QZFA 5HHIA 7ICQA 1GPJA 1ZQNA 4O5KA 5F2VO 3AU2A 1ZQGA 5HRBA 5BOMA 2BCSA 4QZIA 4MFCA 4K8VA 2ZH6A 4I2CA 5HREA 4WC3A 7ICHA 5CJ7A 1WOTA 2BPCA 4LEZA 4FH3A 3K7DA 5DBBA 3RJGA 4I2GA 9ICLA 2BPFA 5DB6A 2BCUA 4M5DA 4LZGA 3AQLA 8ICBA 4LEVA 3RH5A 5IIMA 1ZQCA 2ZH5A 5J29A 4E7XA 5CHGA 3RH6A 4M0AA 2BBHA 4K97A 4MKPA 1ZQXA 3V7LA 4PHEA 9ICFA 2ZHAA 2ZH1A 3B0YA 4KLQA 8ICVA 1BPBA 8ICYA 3MGIA 4Z6CA 5HRIA 3UPSA 4RWNA 4I2DA 4DO9A 3ISCA 2HHPA 4QZCA 4X0BA 3JCFA 4RQ1A 4YMMA 1XSPA 3AQMA 1VJ7A 4YN4A 5HR9A 4FO1A 5DEDA 3H39A 5B3QA 5J0SA 4I2EA 3MCRA 2ISOA 9ICGA 4YD2A 8ICKA 9ICSA 1TV9A 4UD4A 4YD1A 1ZQHA 4KM5A 9ICWA 2HN1A 3ER8C 5HRHA 9ICUA 5DECA 4NM2A 4X4TA 1JMSA 3HX0A 4XRHA 1XSNA 3UXOA 8ICWA 4FHXA 4WC1A 4JLXA 1MIYA 2DVIA 4R65A 2BCQA 1ZQJA 8ICMA 8ICAA 3NKUA 1UEUA 4WC4A 3EF2A 2DR8A 5J2IA 3JPNA 4M9HA 1UETA 4FH5A 4KLUA 5EOZA 4I0UA 4OAGA 1ZQEA 7ICKA 4F5PA 4WOYA 1FA0A 5J0YA 7ICOA 9ICPA 1ZQMA 1MQ3A 3JYYA 1HUZA 4TUQA 3PMNA 5CFTA 3UQ2A 4RT3A 4UAWA 4DOBA 4O69A 5IIJA 3C5FA 4XQ7A 3OV7A 3RJEA 5J2DA 5DB7A 4EBJA 2PFPA 9ICKA 3AU6A 4JWMA 4MFFA 4Z6FA 2ID1A 3OUYB 1Q79A 2VANA 5DDYA 4QZBA 9ICJA 8ICPA 4NXVA 4I27A 4M9NA 1F5AA 2ZH9A 3MGHA 4X4UA 1ZQBA 8ICTA 4KLDA 2M2WA 2PFNA 3HIYA 2HN2A 1R89A 4I29A 2IUBA 3RJIA 4KLGA 3HWTA 4KLHA 3OWGA 4DOAA 4Z6EA 4E8FA 4NLNA 1ZQDA 3ERCC 4QZ8A 2DR9A 4IQVA 4NXWA 1ZQKA 8ICSA 5IIIA 3HW8A 4UAZA 5BOLA 8ICFA 4NKTA 3WFSC 3LQCB 4P4MA 4MF2A 1VFGA 3PNCA 4X4OA 8ICCA 4KLOA 4OAFA 9ICOA 4UD5A 4S3NA 4PHAA 3PHZA 5CHEA 4WC5A 4RPXA 1R8BA
chains in the Genus database with same CATH topology
4K4IA 2ZH2A 4K4HA 1ZQPA 4FHWA 4P4OA 4NLKA 4WBZA 4M2YA 2IHMA 5HRKA 1ZQLA 3ISBA 4EP7A 1RZTA 5IILA 4RQ2A 9ICRA 3RJJA 2O1PA 1ZQSA 4NY8A 4P2HA 4ATBB 4I2AA 1ZQFA 1ZQAA 5CP2A 4DOCA 2PFOA 4FHVA 4R66A 4I2JA 3LK9A 4Z6DA 4KLLA 2ZH7A 4NXZA 5DKWA 1TVAA 1YLQA 3C18A 5HRLA 7ICMA 2I9GA 4X5VA 3V7KA 2PFQA 4NM1A 4LVSA 4F5NA 1R8CA 4AT9B 3K75D 4WCWA 9ICVA 7ICRA 2ISPA 5D4BA 1BPDA 2P66A 2FMQA 4X4QA 4QZDA 4TUSA 4ATBA 2BCVA 3JPRA 2ZH3A 4E80A 4UBCA 2DR7A 1ZQRA 4YMOA 5DDMA 1MQ2A 5DBCA 4FHPA 1ZQWA 2FMSA 7ICGA 1RPLA 8ICNA 4X4PA 3JPTA 1NOMA 5J2FA 5J0PA 3JPOA 4AT9A 5J0XA 4K4GA 3MBYA 2NRKA 3TFRA 3PMLA 4NLZA 3JPPA 1BPXA 8ICZA 4WC2A 4AT8B 1KNYA 2RFFA 5J2BA 5IIOA 9ICAA 9ICHA 5CWRA 5D49A 2PXIA 1TFWA 4YMNA 1ZQYA 4M47A 4QZAA 4LZDA 5IINA 4WC7A 1JN3A 4YCXA 4M9LA 2GWSA 3L9DA 5J2GA 4RQ5A 3WFOA 4RQ7A 5HC9A 3OGUA 4QZHA 1ZQOA 7ICJA 4KLIA 4PHDA 8ICQA 3UXNA 4RT2A 9ICXA 3H38A 4KLSA 4O9MA 4RPYA 4UB3A 5J2CA 8ICRA 7ICTA 9ICTA 3OVAA 5J2KA 1ZJMA 4UB1A 2DRAA 4EBKA 2ZHBA 3HJ1A 4XUSA 4PGYA 3UXPA 4M9JA 3V7JA 2Q66A 1BPYA 1XSLA 3WFRE 1ZQIA 4PHPA 1Q78A 5DB9A 3OUYA 8ICOA 4RWOA 4QZ9A 3JPQA 5HRGA 5BPCA 3HJ4A 1ZQTA 1ZQUA 4UB5A 1TFYA 5J2EA 3MDAA 4XQ8A 2DRBA 8ICIA 3ISDA 9ICCA 5CR0A 5TZVA 3NYBA 4I2IA 4F5QA 4UAYA 8ICHA 7ICUA 4PGQA 4NKUA 3TFSA 4LT6A 3RJKA 5J0WA 4WC6A 4MF8A 1ZQQA 4M9GA 3B0XA 4MFAA 1ZQVA 2BPGA 4FO6A 2M2VA 5D46A 4WC0A 3WFPA 3RJFA 1KDHA 3AQNA 3MDCA 9ICNA 4R64A 9ICMA 4I2FA 2O5AA 2ZH4A 2DR5A 4KLFA 4KLJA 1UEVA 2M2UA 5J0RA 9ICBA 5J0QA 8ICXA 4X4VA 5HRDA 4R63A 4RWPA 8ICLA 3V72A 4XA5A 5CB1A 5HHHA 3UQ0A 5J0TA 3WFQE 1NO5A 1V4AA 4TURA 1HUOA 4TUPA 7ICSA 3JZ0A 3H3AA 4RPZA 3UPQA 4IG8A 4UB4A 4JWNA 4PPXA 4P4PA 2M2TA 5J0OA 1JQRA 4GXKA 5DBAA 7ICEA 4RQ6A 4UB2A 4UBBA 5CA7A 4QZGA 3C2LA 2BCRA 1OU5A 7ICNA 4M04A 4I2BA 3C66A 9ICEA 4KLMA 3OVBA 8ICUA 4IQUA 4AT8A 4O5CA 3H37A 2BE3A 3JPSA 4PH5A 2FMPA 4AT7B 1ZQZA 5DB8A 1BPEA 4I28A 4I2HA 7ICVA 4X0AA 5J2HA 2PBEA 3RJHA 1MIWA 4RQ3A 1BPZA 4GXIA 1R8AA 4RQ4A 9ICQA 8ICJA 5J2AA 4O5EA 5HRFA 7ICPA 1KEJA 4WBYA 4QZEA 4AT7A 8ICGA 4FHYA 3GDXA 4X4NA 3OVSA 8ICEA 4X4RA 4F5OA 7ICLA 4RQ0A 3C2MA 1MIVA 1JAJA 5IIKA 3AQKA 5J0UA 3RH4A 1ZJNA 4RWQA 5J2JA 2ZH8A 2W9MA 9ICIA 4GXJA 1PX5A 4KLTA 3AUOA 4X4SA 3C5GA 4F5RA 7ICIA 4PGXA 4IQWA 4IQTA 7ICFA 4KLEA 3C2KA 4RQ8A 4QZFA 5HHIA 7ICQA 1ZQNA 4O5KA 5F2VO 3AU2A 1ZQGA 5HRBA 5BOMA 2BCSA 4QZIA 4MFCA 2ZH6A 4I2CA 5HREA 4WC3A 7ICHA 5CJ7A 1WOTA 2BPCA 4FH3A 5DBBA 3RJGA 4I2GA 9ICLA 2BPFA 5DB6A 2BCUA 4M5DA 4LZGA 3AQLA 8ICBA 3RH5A 5IIMA 1ZQCA 2ZH5A 5J29A 4E7XA 5CHGA 3RH6A 4M0AA 1ZQXA 3V7LA 4PHEA 9ICFA 2ZHAA 2ZH1A 3B0YA 4KLQA 8ICVA 1BPBA 8ICYA 3MGIA 4Z6CA 5HRIA 3UPSA 4RWNA 4I2DA 4DO9A 3ISCA 2HHPA 4QZCA 4X0BA 4RQ1A 4YMMA 1XSPA 3AQMA 1VJ7A 4YN4A 5HR9A 5DEDA 3H39A 5J0SA 4I2EA 2ISOA 9ICGA 4YD2A 8ICKA 9ICSA 1TV9A 4UD4A 4YD1A 1ZQHA 9ICWA 5HRHA 9ICUA 5DECA 4NM2A 4X4TA 1JMSA 3HX0A 4XRHA 1XSNA 3UXOA 8ICWA 4FHXA 4WC1A 2DVIA 1MIYA 4R65A 2BCQA 1ZQJA 8ICMA 8ICAA 4WC4A 1UEUA 2DR8A 5J2IA 3JPNA 4M9HA 1UETA 4FH5A 4KLUA 5EOZA 1ZQEA 7ICKA 4F5PA 1FA0A 5J0YA 7ICOA 9ICPA 1ZQMA 1MQ3A 3JYYA 1HUZA 4TUQA 3PMNA 3UQ2A 4RT3A 4UAWA 4DOBA 5IIJA 3C5FA 4XQ7A 3OV7A 3RJEA 5J2DA 5DB7A 4EBJA 2PFPA 9ICKA 3AU6A 4JWMA 4MFFA 4Z6FA 2ID1A 3OUYB 1Q79A 2VANA 5DDYA 4QZBA 9ICJA 8ICPA 4I27A 4M9NA 1F5AA 2ZH9A 3MGHA 4X4UA 1ZQBA 8ICTA 4KLDA 2M2WA 2PFNA 3HIYA 1R89A 4I29A 3RJIA 4KLGA 3HWTA 4KLHA 4DOAA 4Z6EA 4E8FA 4NLNA 1ZQDA 4QZ8A 2DR9A 4IQVA 1ZQKA 8ICSA 5IIIA 3HW8A 4UAZA 5BOLA 8ICFA 4NKTA 3WFSC 3LQCB 4P4MA 4MF2A 1VFGA 3PNCA 4X4OA 8ICCA 4KLOA 9ICOA 4UD5A 4S3NA 4PHAA 4WC5A 4RPXA 1R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K4I A;  2ZH2 A;  4K4H A;  1ZQP A;  4FHW A;  4P4O A;  4NLK A;  4WBZ A;  4M2Y A;  2IHM A;  5HRK A;  1ZQL A;  3ISB A;  4EP7 A;  1RZT A;  5IIL A;  4RQ2 A;  9ICR A;  3RJJ A;  2O1P A;  1ZQS A;  4NY8 A;  4P2H A;  4ATB B;  4I2A A;  1ZQF A;  1ZQA A;  5CP2 A;  4DOC A;  2PFO A;  4FHV A;  4R66 A;  4I2J A;  3LK9 A;  4Z6D A;  4KLL A;  2ZH7 A;  4NXZ A;  5DKW A;  1TVA A;  1YLQ A;  3C18 A;  5HRL A;  7ICM A;  2I9G A;  4X5V A;  3V7K A;  2PFQ A;  4NM1 A;  4LVS A;  4F5N A;  1R8C A;  4AT9 B;  3K75 D;  4WCW A;  9ICV A;  7ICR A;  2ISP A;  5D4B A;  1BPD A;  2P66 A;  2FMQ A;  4X4Q A;  4QZD A;  4TUS A;  4ATB A;  2BCV A;  3JPR A;  2ZH3 A;  4E80 A;  4UBC A;  2DR7 A;  1ZQR A;  4YMO A;  5DDM A;  1MQ2 A;  5DBC A;  4FHP A;  1ZQW A;  2FMS A;  7ICG A;  1RPL A;  8ICN A;  4X4P A;  3JPT A;  1NOM A;  5J2F A;  5J0P A;  3JPO A;  4AT9 A;  5J0X A;  4K4G A;  3MBY A;  2NRK A;  3TFR A;  3PML A;  4NLZ A;  3JPP A;  1BPX A;  8ICZ A;  4WC2 A;  4AT8 B;  1KNY A;  2RFF A;  5J2B A;  5IIO A;  9ICA A;  9ICH A;  5CWR A;  5D49 A;  2PXI A;  1TFW A;  4YMN A;  1ZQY A;  4M47 A;  4QZA A;  4LZD A;  5IIN A;  4WC7 A;  1JN3 A;  4YCX A;  4M9L A;  2GWS A;  3L9D A;  5J2G A;  4RQ5 A;  3WFO A;  4RQ7 A;  5HC9 A;  3OGU A;  4QZH A;  1ZQO A;  7ICJ A;  4KLI A;  4PHD A;  8ICQ A;  3UXN A;  4RT2 A;  9ICX A;  3H38 A;  4KLS A;  4O9M A;  4RPY A;  4UB3 A;  5J2C A;  8ICR A;  7ICT A;  9ICT A;  3OVA A;  5J2K A;  1ZJM A;  4UB1 A;  2DRA A;  4EBK A;  2ZHB A;  3HJ1 A;  4XUS A;  4PGY A;  3UXP A;  4M9J A;  3V7J A;  2Q66 A;  1BPY A;  1XSL A;  3WFR E;  1ZQI A;  4PHP A;  1Q78 A;  5DB9 A;  3OUY A;  8ICO A;  4RWO A;  4QZ9 A;  3JPQ A;  5HRG A;  5BPC A;  3HJ4 A;  1ZQT A;  1ZQU A;  4UB5 A;  1TFY A;  5J2E A;  3MDA A;  4XQ8 A;  2DRB A;  8ICI A;  3ISD A;  9ICC A;  5CR0 A;  5TZV A;  3NYB A;  4I2I A;  4F5Q A;  4UAY A;  8ICH A;  7ICU A;  4PGQ A;  4NKU A;  3TFS A;  4LT6 A;  3RJK A;  5J0W A;  4WC6 A;  4MF8 A;  1ZQQ A;  4M9G A;  3B0X A;  4MFA A;  1ZQV A;  2BPG A;  4FO6 A;  2M2V A;  5D46 A;  4WC0 A;  3WFP A;  3RJF A;  1KDH A;  3AQN A;  3MDC A;  9ICN A;  4R64 A;  9ICM A;  4I2F A;  2O5A A;  2ZH4 A;  2DR5 A;  4KLF A;  4KLJ A;  1UEV A;  2M2U A;  5J0R A;  9ICB A;  5J0Q A;  8ICX A;  4X4V A;  5HRD A;  4R63 A;  4RWP A;  8ICL A;  3V72 A;  4XA5 A;  5CB1 A;  5HHH A;  3UQ0 A;  5J0T A;  3WFQ E;  1NO5 A;  1V4A A;  4TUR A;  1HUO A;  4TUP A;  7ICS A;  3JZ0 A;  3H3A A;  4RPZ A;  3UPQ A;  4IG8 A;  4UB4 A;  4JWN A;  4PPX A;  4P4P A;  2M2T A;  5J0O A;  1JQR A;  4GXK A;  5DBA A;  7ICE A;  4RQ6 A;  4UB2 A;  4UBB A;  5CA7 A;  4QZG A;  3C2L A;  2BCR A;  1OU5 A;  7ICN A;  4M04 A;  4I2B A;  3C66 A;  9ICE A;  4KLM A;  3OVB A;  8ICU A;  4IQU A;  4AT8 A;  4O5C A;  3H37 A;  2BE3 A;  3JPS A;  4PH5 A;  2FMP A;  4AT7 B;  1ZQZ A;  5DB8 A;  1BPE A;  4I28 A;  4I2H A;  7ICV A;  4X0A A;  5J2H A;  2PBE A;  3RJH A;  1MIW A;  4RQ3 A;  1BPZ A;  4GXI A;  1R8A A;  4RQ4 A;  9ICQ A;  8ICJ A;  5J2A A;  4O5E A;  5HRF A;  7ICP A;  1KEJ A;  4WBY A;  4QZE A;  4AT7 A;  8ICG A;  4FHY A;  3GDX A;  4X4N A;  3OVS A;  8ICE A;  4X4R A;  4F5O A;  7ICL A;  4RQ0 A;  3C2M A;  1MIV A;  1JAJ A;  5IIK A;  3AQK A;  5J0U A;  3RH4 A;  1ZJN A;  4RWQ A;  5J2J A;  2ZH8 A;  2W9M A;  9ICI A;  4GXJ A;  1PX5 A;  4KLT A;  3AUO A;  4X4S A;  3C5G A;  4F5R A;  7ICI A;  4PGX A;  4IQW A;  4IQT A;  7ICF A;  4KLE A;  3C2K A;  4RQ8 A;  4QZF A;  5HHI A;  7ICQ A;  1ZQN A;  4O5K A;  5F2V O;  3AU2 A;  1ZQG A;  5HRB A;  5BOM A;  2BCS A;  4QZI A;  4MFC A;  2ZH6 A;  4I2C A;  5HRE A;  4WC3 A;  7ICH A;  5CJ7 A;  1WOT A;  2BPC A;  4FH3 A;  5DBB A;  3RJG A;  4I2G A;  9ICL A;  2BPF A;  5DB6 A;  2BCU A;  4M5D A;  4LZG A;  3AQL A;  8ICB A;  3RH5 A;  5IIM A;  1ZQC A;  2ZH5 A;  5J29 A;  4E7X A;  5CHG A;  3RH6 A;  4M0A A;  1ZQX A;  3V7L A;  4PHE A;  9ICF A;  2ZHA A;  2ZH1 A;  3B0Y A;  4KLQ A;  8ICV A;  1BPB A;  8ICY A;  3MGI A;  4Z6C A;  5HRI A;  3UPS A;  4RWN A;  4I2D A;  4DO9 A;  3ISC A;  2HHP A;  4QZC A;  4X0B A;  4RQ1 A;  4YMM A;  1XSP A;  3AQM A;  1VJ7 A;  4YN4 A;  5HR9 A;  5DED A;  3H39 A;  5J0S A;  4I2E A;  2ISO A;  9ICG A;  4YD2 A;  8ICK A;  9ICS A;  1TV9 A;  4UD4 A;  4YD1 A;  1ZQH A;  9ICW A;  5HRH A;  9ICU A;  5DEC A;  4NM2 A;  4X4T A;  1JMS A;  3HX0 A;  4XRH A;  1XSN A;  3UXO A;  8ICW A;  4FHX A;  4WC1 A;  2DVI A;  1MIY A;  4R65 A;  2BCQ A;  1ZQJ A;  8ICM A;  8ICA A;  4WC4 A;  1UEU A;  2DR8 A;  5J2I A;  3JPN A;  4M9H A;  1UET A;  4FH5 A;  4KLU A;  5EOZ A;  1ZQE A;  7ICK A;  4F5P A;  1FA0 A;  5J0Y A;  7ICO A;  9ICP A;  1ZQM A;  1MQ3 A;  3JYY A;  1HUZ A;  4TUQ A;  3PMN A;  3UQ2 A;  4RT3 A;  4UAW A;  4DOB A;  5IIJ A;  3C5F A;  4XQ7 A;  3OV7 A;  3RJE A;  5J2D A;  5DB7 A;  4EBJ A;  2PFP A;  9ICK A;  3AU6 A;  4JWM A;  4MFF A;  4Z6F A;  2ID1 A;  3OUY B;  1Q79 A;  2VAN A;  5DDY A;  4QZB A;  9ICJ A;  8ICP A;  4I27 A;  4M9N A;  1F5A A;  2ZH9 A;  3MGH A;  4X4U A;  1ZQB A;  8ICT A;  4KLD A;  2M2W A;  2PFN A;  3HIY A;  1R89 A;  4I29 A;  3RJI A;  4KLG A;  3HWT A;  4KLH A;  4DOA A;  4Z6E A;  4E8F A;  4NLN A;  1ZQD A;  4QZ8 A;  2DR9 A;  4IQV A;  1ZQK A;  8ICS A;  5III A;  3HW8 A;  4UAZ A;  5BOL A;  8ICF A;  4NKT A;  3WFS C;  3LQC B;  4P4M A;  4MF2 A;  1VFG A;  3PNC A;  4X4O A;  8ICC A;  4KLO A;  9ICO A;  4UD5 A;  4S3N A;  4PHA A;  4WC5 A;  4RPX A;  1R8B A; 
#chains in the Genus database with same CATH topology
 4K4I A;  2ZH2 A;  4K4H A;  1ZQP A;  4FHW A;  4P4O A;  4NLK A;  4WBZ A;  4M2Y A;  2IHM A;  5HRK A;  3NVO A;  1ZQL A;  3ISB A;  4NXU A;  1RZT A;  4EP7 A;  5IIL A;  4RQ2 A;  4WQL A;  9ICR A;  3RJJ A;  2O1P A;  1ZQS A;  4NY8 A;  4P2H A;  4ATB B;  4I2A A;  1ZQF A;  1ZQA A;  2GA9 D;  5CP2 A;  4DOC A;  2PFO A;  4FHV A;  4R66 A;  4I2J A;  3LK9 A;  4Z6D A;  4KLL A;  2ZH7 A;  4NXZ A;  5DKW A;  1TVA A;  1YLQ A;  3C18 A;  5HRL A;  7ICM A;  2I9G A;  4X5V A;  3V7K A;  2PFQ A;  4NM1 A;  4LVS A;  4F5N A;  5D61 A;  1R8C A;  4AT9 B;  3K75 D;  4WCW A;  5B3P A;  9ICV A;  7ICR A;  2ISP A;  5D4B A;  1BPD A;  2P66 A;  2FMQ A;  4X4Q A;  4QZD A;  4TUS A;  4ATB A;  4HX0 A;  2BCV A;  3JPR A;  2ZH3 A;  4WH5 A;  4E80 A;  4UBC A;  2DR7 A;  1ZQR A;  4YMO A;  5DDM A;  1MQ2 A;  5DBC A;  4FHP A;  1ZQW A;  2FMS A;  7ICG A;  1RPL A;  8ICN A;  4X4P A;  3JPT A;  1NOM A;  5J2F A;  5J0P A;  3JPO A;  4AT9 A;  5J0X A;  2B51 A;  4K4G A;  3MBY A;  2NRK A;  3TFR A;  4NXX A;  3PML A;  4NLZ A;  3JPP A;  1BPX A;  8ICZ A;  4WC2 A;  2B4V A;  4AT8 B;  1KNY A;  2RFF A;  5J2B A;  5IIO A;  9ICA A;  9ICH A;  5CWR A;  5D49 A;  2PXI A;  1TFW A;  4YMN A;  5JTG A;  1ZQY A;  4M47 A;  4QZA A;  4LZD A;  5IIN A;  4WC7 A;  1JN3 A;  4YCX A;  4M9L A;  2GWS A;  3L9D A;  4EEB A;  5J2G A;  4RQ5 A;  3WFO A;  4RQ7 A;  5HC9 A;  3OGU A;  4QZH A;  1ZQO A;  7ICJ A;  4KLI A;  4PHD A;  4NXT A;  8ICQ A;  3UXN A;  4RT2 A;  9ICX A;  3H38 A;  4KLS A;  4O9M A;  4RPY A;  4UB3 A;  5J2C A;  8ICR A;  7ICT A;  3CK6 A;  5CFU A;  9ICT A;  3OVA A;  5J2K A;  1ZJM A;  4UB1 A;  2DRA A;  4EBK A;  2ZHB A;  3HJ1 A;  4XUS A;  4PGY A;  3UXP A;  4M9J A;  3V7J A;  3NWI A;  4N7R A;  2Q66 A;  1BPY A;  1XSL A;  3WFR E;  1ZQI A;  4PHP A;  1Q78 A;  5DB9 A;  3OUY A;  4K9A A;  8ICO A;  4XJE A;  2IHO A;  4RWO A;  4QZ9 A;  3JPQ A;  5HRG A;  5BPC A;  3HJ4 A;  1ZQT A;  1ZQU A;  4UB5 A;  1TFY A;  5J2E A;  3MDA A;  4XQ8 A;  2DRB A;  8ICI A;  3ISD A;  9ICC A;  5CR0 A;  5TZV A;  3NYB A;  4I2I A;  4F5Q A;  4UAY A;  8ICH A;  7ICU A;  4PGQ A;  4NKU A;  3TFS A;  4LT6 A;  3RJK A;  5J0W A;  4WC6 A;  4MF8 A;  1ZQQ A;  4M9G A;  3B0X A;  4MFA A;  1ZQV A;  2BPG A;  4FO6 A;  3ER9 B;  2M2V A;  5D62 A;  5D46 A;  4WC0 A;  3WFP A;  4JLZ A;  3RJF A;  1KDH A;  3AQN A;  3MDC A;  9ICN A;  4LEW A;  4R64 A;  9ICM A;  4I2F A;  2O5A A;  2ZH4 A;  2DR5 A;  4KLF A;  4KLJ A;  1UEV A;  2M2U A;  5J0R A;  9ICB A;  5J0Q A;  8ICX A;  4X4V A;  5HRD A;  4R63 A;  4RWP A;  8ICL A;  3V72 A;  4XA5 A;  5CB1 A;  4K96 A;  5HHH A;  3UQ0 A;  5J0T A;  4K98 A;  3WFQ E;  1NO5 A;  1V4A A;  5D63 A;  4TUR A;  1HUO A;  4TUP A;  7ICS A;  3JZ0 A;  3H3A A;  4RPZ A;  3UPQ A;  4OAI Z;  4EV6 A;  4IG8 A;  4UB4 A;  2B56 A;  4O67 A;  4OAH A;  4K9B A;  4JWN A;  4PPX A;  4P4P A;  2M2T A;  5J0O A;  1JQR A;  4GXK A;  4O68 A;  5DBA A;  7ICE A;  4RQ6 A;  4UB2 A;  4UBB A;  5CA7 A;  4QZG A;  3C2L A;  2BCR A;  1OU5 A;  7ICN A;  4M04 A;  4I2B A;  4KB6 A;  3C66 A;  9ICE A;  4KLM A;  2BBJ A;  3OVB A;  8ICU A;  4IQU A;  4AT8 A;  4O5C A;  3H37 A;  2BE3 A;  3JPS A;  4PH5 A;  2FMP A;  4AT7 B;  1ZQZ A;  5DB8 A;  1BPE A;  4EGW A;  4I28 A;  4I2H A;  7ICV A;  4WQK A;  4O6A A;  4X0A A;  5J2H A;  2PBE A;  3RJH A;  1MIW A;  4RQ3 A;  1BPZ A;  4GXI A;  1R8A A;  5CFS A;  4RQ4 A;  2FCL A;  9ICQ A;  8ICJ A;  5J2A A;  4O5E A;  5HRF A;  7ICP A;  1KEJ A;  4WBY A;  4QZE A;  4AT7 A;  8ICG A;  4FHY A;  3GDX A;  4X4N A;  3OVS A;  8ICE A;  4X4R A;  4F5O A;  7ICL A;  4RQ0 A;  3C2M A;  1MIV A;  1JAJ A;  5IIK A;  3AQK A;  4K99 A;  2EWR A;  4EED A;  5J0U A;  3RH4 A;  2GAF D;  1ZJN A;  4RWQ A;  5J2J A;  2ZH8 A;  2W9M A;  9ICI A;  4GXJ A;  1PX5 A;  4KLT A;  4LEY A;  3AUO A;  4X4S A;  3C5G A;  4F5R A;  7ICI A;  4PGX A;  4IQW A;  4IQT A;  7ICF A;  4KLE A;  3C2K A;  4RQ8 A;  4QZF A;  5HHI A;  7ICQ A;  1GPJ A;  1ZQN A;  4O5K A;  5F2V O;  3AU2 A;  1ZQG A;  5HRB A;  5BOM A;  2BCS A;  4QZI A;  4MFC A;  4K8V A;  2ZH6 A;  4I2C A;  5HRE A;  4WC3 A;  7ICH A;  5CJ7 A;  1WOT A;  2BPC A;  4LEZ A;  4FH3 A;  3K7D A;  5DBB A;  3RJG A;  4I2G A;  9ICL A;  2BPF A;  5DB6 A;  2BCU A;  4M5D A;  4LZG A;  3AQL A;  8ICB A;  4LEV A;  3RH5 A;  5IIM A;  1ZQC A;  2ZH5 A;  5J29 A;  4E7X A;  5CHG A;  3RH6 A;  4M0A A;  2BBH A;  4K97 A;  4MKP A;  1ZQX A;  3V7L A;  4PHE A;  9ICF A;  2ZHA A;  2ZH1 A;  3B0Y A;  4KLQ A;  8ICV A;  1BPB A;  8ICY A;  3MGI A;  4Z6C A;  5HRI A;  3UPS A;  4RWN A;  4I2D A;  4DO9 A;  3ISC A;  2HHP A;  4QZC A;  4X0B A;  3JCF A;  4RQ1 A;  4YMM A;  1XSP A;  3AQM A;  1VJ7 A;  4YN4 A;  5HR9 A;  4FO1 A;  5DED A;  3H39 A;  5B3Q A;  5J0S A;  4I2E A;  3MCR A;  2ISO A;  9ICG A;  4YD2 A;  8ICK A;  9ICS A;  1TV9 A;  4UD4 A;  4YD1 A;  1ZQH A;  4KM5 A;  9ICW A;  2HN1 A;  3ER8 C;  5HRH A;  9ICU A;  5DEC A;  4NM2 A;  4X4T A;  1JMS A;  3HX0 A;  4XRH A;  1XSN A;  3UXO A;  8ICW A;  4FHX A;  4WC1 A;  4JLX A;  1MIY A;  2DVI A;  4R65 A;  2BCQ A;  1ZQJ A;  8ICM A;  8ICA A;  3NKU A;  1UEU A;  4WC4 A;  3EF2 A;  2DR8 A;  5J2I A;  3JPN A;  4M9H A;  1UET A;  4FH5 A;  4KLU A;  5EOZ A;  4I0U A;  4OAG A;  1ZQE A;  7ICK A;  4F5P A;  4WOY A;  1FA0 A;  5J0Y A;  7ICO A;  9ICP A;  1ZQM A;  1MQ3 A;  3JYY A;  1HUZ A;  4TUQ A;  3PMN A;  5CFT A;  3UQ2 A;  4RT3 A;  4UAW A;  4DOB A;  4O69 A;  5IIJ A;  3C5F A;  4XQ7 A;  3OV7 A;  3RJE A;  5J2D A;  5DB7 A;  4EBJ A;  2PFP A;  9ICK A;  3AU6 A;  4JWM A;  4MFF A;  4Z6F A;  2ID1 A;  3OUY B;  1Q79 A;  2VAN A;  5DDY A;  4QZB A;  9ICJ A;  8ICP A;  4NXV A;  4I27 A;  4M9N A;  1F5A A;  2ZH9 A;  3MGH A;  4X4U A;  1ZQB A;  8ICT A;  4KLD A;  2M2W A;  2PFN A;  3HIY A;  2HN2 A;  1R89 A;  4I29 A;  2IUB A;  3RJI A;  4KLG A;  3HWT A;  4KLH A;  3OWG A;  4DOA A;  4Z6E A;  4E8F A;  4NLN A;  1ZQD A;  3ERC C;  4QZ8 A;  2DR9 A;  4IQV A;  4NXW A;  1ZQK A;  8ICS A;  5III A;  3HW8 A;  4UAZ A;  5BOL A;  8ICF A;  4NKT A;  3WFS C;  3LQC B;  4P4M A;  4MF2 A;  1VFG A;  3PNC A;  4X4O A;  8ICC A;  4KLO A;  4OAF A;  9ICO A;  4UD5 A;  4S3N A;  4PHA A;  3PHZ A;  5CHE A;  4WC5 A;  4RPX A;  1R8B A; 
#chains in the Genus database with same CATH homology
 4K4I A;  2ZH2 A;  4K4H A;  1ZQP A;  4FHW A;  4P4O A;  4NLK A;  4WBZ A;  4M2Y A;  2IHM A;  5HRK A;  1ZQL A;  3ISB A;  4EP7 A;  1RZT A;  5IIL A;  4RQ2 A;  9ICR A;  3RJJ A;  2O1P A;  1ZQS A;  4NY8 A;  4P2H A;  4ATB B;  4I2A A;  1ZQF A;  1ZQA A;  5CP2 A;  4DOC A;  2PFO A;  4FHV A;  4R66 A;  4I2J A;  3LK9 A;  4Z6D A;  4KLL A;  2ZH7 A;  4NXZ A;  5DKW A;  1TVA A;  1YLQ A;  3C18 A;  5HRL A;  7ICM A;  2I9G A;  4X5V A;  3V7K A;  2PFQ A;  4NM1 A;  4LVS A;  4F5N A;  1R8C A;  4AT9 B;  3K75 D;  4WCW A;  9ICV A;  7ICR A;  2ISP A;  5D4B A;  1BPD A;  2P66 A;  2FMQ A;  4X4Q A;  4QZD A;  4TUS A;  4ATB A;  2BCV A;  3JPR A;  2ZH3 A;  4E80 A;  4UBC A;  2DR7 A;  1ZQR A;  4YMO A;  5DDM A;  1MQ2 A;  5DBC A;  4FHP A;  1ZQW A;  2FMS A;  7ICG A;  1RPL A;  8ICN A;  4X4P A;  3JPT A;  1NOM A;  5J2F A;  5J0P A;  3JPO A;  4AT9 A;  5J0X A;  4K4G A;  3MBY A;  2NRK A;  3TFR A;  3PML A;  4NLZ A;  3JPP A;  1BPX A;  8ICZ A;  4WC2 A;  4AT8 B;  1KNY A;  2RFF A;  5J2B A;  5IIO A;  9ICA A;  9ICH A;  5CWR A;  5D49 A;  2PXI A;  1TFW A;  4YMN A;  1ZQY A;  4M47 A;  4QZA A;  4LZD A;  5IIN A;  4WC7 A;  1JN3 A;  4YCX A;  4M9L A;  2GWS A;  3L9D A;  5J2G A;  4RQ5 A;  3WFO A;  4RQ7 A;  5HC9 A;  3OGU A;  4QZH A;  1ZQO A;  7ICJ A;  4KLI A;  4PHD A;  8ICQ A;  3UXN A;  4RT2 A;  9ICX A;  3H38 A;  4KLS A;  4O9M A;  4RPY A;  4UB3 A;  5J2C A;  8ICR A;  7ICT A;  9ICT A;  3OVA A;  5J2K A;  1ZJM A;  4UB1 A;  2DRA A;  4EBK A;  2ZHB A;  3HJ1 A;  4XUS A;  4PGY A;  3UXP A;  4M9J A;  3V7J A;  2Q66 A;  1BPY A;  1XSL A;  3WFR E;  1ZQI A;  4PHP A;  1Q78 A;  5DB9 A;  3OUY A;  8ICO A;  4RWO A;  4QZ9 A;  3JPQ A;  5HRG A;  5BPC A;  3HJ4 A;  1ZQT A;  1ZQU A;  4UB5 A;  1TFY A;  5J2E A;  3MDA A;  4XQ8 A;  2DRB A;  8ICI A;  3ISD A;  9ICC A;  5CR0 A;  5TZV A;  3NYB A;  4I2I A;  4F5Q A;  4UAY A;  8ICH A;  7ICU A;  4PGQ A;  4NKU A;  3TFS A;  4LT6 A;  3RJK A;  5J0W A;  4WC6 A;  4MF8 A;  1ZQQ A;  4M9G A;  3B0X A;  4MFA A;  1ZQV A;  2BPG A;  4FO6 A;  2M2V A;  5D46 A;  4WC0 A;  3WFP A;  3RJF A;  1KDH A;  3AQN A;  3MDC A;  9ICN A;  4R64 A;  9ICM A;  4I2F A;  2O5A A;  2ZH4 A;  2DR5 A;  4KLF A;  4KLJ A;  1UEV A;  2M2U A;  5J0R A;  9ICB A;  5J0Q A;  8ICX A;  4X4V A;  5HRD A;  4R63 A;  4RWP A;  8ICL A;  3V72 A;  4XA5 A;  5CB1 A;  5HHH A;  3UQ0 A;  5J0T A;  3WFQ E;  1NO5 A;  1V4A A;  4TUR A;  1HUO A;  4TUP A;  7ICS A;  3JZ0 A;  3H3A A;  4RPZ A;  3UPQ A;  4IG8 A;  4UB4 A;  4JWN A;  4PPX A;  4P4P A;  2M2T A;  5J0O A;  1JQR A;  4GXK A;  5DBA A;  7ICE A;  4RQ6 A;  4UB2 A;  4UBB A;  5CA7 A;  4QZG A;  3C2L A;  2BCR A;  1OU5 A;  7ICN A;  4M04 A;  4I2B A;  3C66 A;  9ICE A;  4KLM A;  3OVB A;  8ICU A;  4IQU A;  4AT8 A;  4O5C A;  3H37 A;  2BE3 A;  3JPS A;  4PH5 A;  2FMP A;  4AT7 B;  1ZQZ A;  5DB8 A;  1BPE A;  4I28 A;  4I2H A;  7ICV A;  4X0A A;  5J2H A;  2PBE A;  3RJH A;  1MIW A;  4RQ3 A;  1BPZ A;  4GXI A;  1R8A A;  4RQ4 A;  9ICQ A;  8ICJ A;  5J2A A;  4O5E A;  5HRF A;  7ICP A;  1KEJ A;  4WBY A;  4QZE A;  4AT7 A;  8ICG A;  4FHY A;  3GDX A;  4X4N A;  3OVS A;  8ICE A;  4X4R A;  4F5O A;  7ICL A;  4RQ0 A;  3C2M A;  1MIV A;  1JAJ A;  5IIK A;  3AQK A;  5J0U A;  3RH4 A;  1ZJN A;  4RWQ A;  5J2J A;  2ZH8 A;  2W9M A;  9ICI A;  4GXJ A;  1PX5 A;  4KLT A;  3AUO A;  4X4S A;  3C5G A;  4F5R A;  7ICI A;  4PGX A;  4IQW A;  4IQT A;  7ICF A;  4KLE A;  3C2K A;  4RQ8 A;  4QZF A;  5HHI A;  7ICQ A;  1ZQN A;  4O5K A;  5F2V O;  3AU2 A;  1ZQG A;  5HRB A;  5BOM A;  2BCS A;  4QZI A;  4MFC A;  2ZH6 A;  4I2C A;  5HRE A;  4WC3 A;  7ICH A;  5CJ7 A;  1WOT A;  2BPC A;  4FH3 A;  5DBB A;  3RJG A;  4I2G A;  9ICL A;  2BPF A;  5DB6 A;  2BCU A;  4M5D A;  4LZG A;  3AQL A;  8ICB A;  3RH5 A;  5IIM A;  1ZQC A;  2ZH5 A;  5J29 A;  4E7X A;  5CHG A;  3RH6 A;  4M0A A;  1ZQX A;  3V7L A;  4PHE A;  9ICF A;  2ZHA A;  2ZH1 A;  3B0Y A;  4KLQ A;  8ICV A;  1BPB A;  8ICY A;  3MGI A;  4Z6C A;  5HRI A;  3UPS A;  4RWN A;  4I2D A;  4DO9 A;  3ISC A;  2HHP A;  4QZC A;  4X0B A;  4RQ1 A;  4YMM A;  1XSP A;  3AQM A;  1VJ7 A;  4YN4 A;  5HR9 A;  5DED A;  3H39 A;  5J0S A;  4I2E A;  2ISO A;  9ICG A;  4YD2 A;  8ICK A;  9ICS A;  1TV9 A;  4UD4 A;  4YD1 A;  1ZQH A;  9ICW A;  5HRH A;  9ICU A;  5DEC A;  4NM2 A;  4X4T A;  1JMS A;  3HX0 A;  4XRH A;  1XSN A;  3UXO A;  8ICW A;  4FHX A;  4WC1 A;  2DVI A;  1MIY A;  4R65 A;  2BCQ A;  1ZQJ A;  8ICM A;  8ICA A;  4WC4 A;  1UEU A;  2DR8 A;  5J2I A;  3JPN A;  4M9H A;  1UET A;  4FH5 A;  4KLU A;  5EOZ A;  1ZQE A;  7ICK A;  4F5P A;  1FA0 A;  5J0Y A;  7ICO A;  9ICP A;  1ZQM A;  1MQ3 A;  3JYY A;  1HUZ A;  4TUQ A;  3PMN A;  3UQ2 A;  4RT3 A;  4UAW A;  4DOB A;  5IIJ A;  3C5F A;  4XQ7 A;  3OV7 A;  3RJE A;  5J2D A;  5DB7 A;  4EBJ A;  2PFP A;  9ICK A;  3AU6 A;  4JWM A;  4MFF A;  4Z6F A;  2ID1 A;  3OUY B;  1Q79 A;  2VAN A;  5DDY A;  4QZB A;  9ICJ A;  8ICP A;  4I27 A;  4M9N A;  1F5A A;  2ZH9 A;  3MGH A;  4X4U A;  1ZQB A;  8ICT A;  4KLD A;  2M2W A;  2PFN A;  3HIY A;  1R89 A;  4I29 A;  3RJI A;  4KLG A;  3HWT A;  4KLH A;  4DOA A;  4Z6E A;  4E8F A;  4NLN A;  1ZQD A;  4QZ8 A;  2DR9 A;  4IQV A;  1ZQK A;  8ICS A;  5III A;  3HW8 A;  4UAZ A;  5BOL A;  8ICF A;  4NKT A;  3WFS C;  3LQC B;  4P4M A;  4MF2 A;  1VFG A;  3PNC A;  4X4O A;  8ICC A;  4KLO A;  9ICO A;  4UD5 A;  4S3N A;  4PHA A;  4WC5 A;  4RPX A;  1R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...