5HRFA

The crystal structure of asfvpolx: dna5: dgtp ternary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
b'SGGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
molecule tags Transferase/dna
source organism African swine fever virus
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
total genus 47
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrfA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrfA01
3C2LA 9ICNA 4E8FA 4R65A 3PMLA 4GXJA 1ZQWA 3H37A 4QZFA 4DOCA 2DR8A 2ZHAA 4WBYA 9ICAA 5HRFA 2I9GA 3V7LA 4QZIA 8ICGA 2RFFA 3RJKA 4PHEA 1R8BA 9ICBA 5J2BA 4K4GA 4RWNA 1MIWA 4Z6DA 4I2HA 4IQWA 1ZQXA 9ICHA 9ICUA 3H38A 5F2VO 5EOZA 4I2IA 3UXNA 1ZQBA 4IQVA 4KLJA 3WFOA 4UBCA 4K4HA 2DR7A 7ICNA 4M9NA 4FO6A 1Q78A 8ICEA 3JPRA 5CJ7A 9ICKA 2DVIA 4I2EA 2BPFA 7ICTA 4XQ8A 4R64A 4I2BA 3WFSC 4FHPA 3JPTA 4WC6A 8ICJA 4WC4A 5IIKA 4KLSA 4KLDA 4NM1A 4AT9B 4PGQA 2ZH4A 5CB1A 4X5VA 5IIMA 1KNYA 4UB4A 4FHXA 5J0OA 4O5CA 3H3AA 4RQ0A 4LVSA 4RWOA 4KLHA 5J0TA 5HRIA 5IINA 5HC9A 8ICTA 4RQ6A 4X4RA 4WC5A 3HX0A 7ICSA 4RPZA 5CA7A 4MFCA 8ICFA 4UB2A 4MF2A 8ICOA 9ICTA 5CHGA 4WCWA 9ICVA 8ICVA 2ID1A 7ICJA 3WFQE 4DOBA 1TV9A 4RQ7A 4F5NA 4RPYA 1BPDA 2BCSA 8ICXA 4MF8A 1R8AA 4XQ7A 1BPZA 3RJHA 2Q66A 5J0YA 5CWRA 5D49A 4RQ1A 8ICLA 3HWTA 5HR9A 1ZQUA 2DR9A 9ICQA 1XSLA 2FMSA 4X4TA 4UB3A 4TUSA 5D46A 4F5OA 4NKTA 4QZCA 4FHYA 2BCRA 3GDXA 7ICUA 1F5AA 4KLEA 3MDAA 4AT7A 7ICLA 4RQ2A 3ISBA 4QZAA 1WOTA 4Z6CA 5BOMA 4KLGA 4RT3A 4QZ9A 3AUOA 4YCXA 4WC0A 9ICJA 2DRBA 8ICIA 5DECA 4MFAA 4X4OA 5J29A 4FH5A 8ICZA 4I2AA 2ZHBA 1JAJA 4PGYA 4GXIA 5HRBA 4RWQA 1ZQDA 4KLQA 5DEDA 4I28A 4R66A 1ZQNA 4NXZA 7ICEA 9ICWA 4M0AA 3AQMA 1ZQLA 4I2JA 3RH6A 4XUSA 2BCVA 3HJ4A 4M9HA 9ICSA 2PFQA 4NLZA 5J0QA 5BPCA 2BPGA 4O9MA 9ICXA 5DDYA 5IIIA 1R8CA 8ICHA 4YD2A 1XSPA 1BPEA 1ZQMA 4WC2A 2P66A 1ZQHA 8ICPA 3AQNA 4X0AA 2M2UA 3UQ0A 5J2GA 4KLFA 3HIYA 4WBZA 7ICOA 4FHWA 4YN4A 1ZQVA 5HRLA 4M47A 3RH5A 5J0UA 3MGHA 1UEUA 3OVSA 5HHIA 9ICIA 7ICGA 4YMNA 4I2GA 1UEVA 1YLQA 3C2KA 5J0XA 1NO5A 4XRHA 1KDHA 4X4QA 4P4PA 5J0SA 3V72A 2ISPA 3WFPA 1BPXA 5DB9A 4NY8A 1BPBA 4WC7A 8ICQA 3JPQA 1NOMA 2M2TA 2ZH5A 7ICFA 4FHVA 2PFNA 4M2YA 2DR5A 4K4IA 4WC1A 5J0PA 1BPYA 8ICSA 3RJGA 4I27A 5DB6A 4LZGA 3WFRE 1ZQPA 8ICUA 5DDMA 1PX5A 3C18A 7ICMA 3K75D 1ZQAA 4JWNA 3PMNA 3PNCA 3MGIA 3OVAA 3HW8A 9ICOA 3AQKA 1ZQFA 2BE3A 4UD4A 4RQ3A 3OV7A 4I2DA 3RJEA 8ICYA 4TUQA 5BOLA 4M9LA 4FH3A 4M04A 5D4BA 4EP7A 5HHHA 1TVAA 5J2DA 2BCQA 4F5PA 4NM2A 3JPOA 3TFRA 2BPCA 3AU6A 3H39A 4QZ8A 2ZH3A 1RPLA 4M9JA 3RJIA 2GWSA 2O5AA 4S3NA 4NLNA 4P4OA 4QZHA 4YD1A 2ZH7A 5J2EA 4QZDA 1HUZA 2ZH8A 3OVBA 3AQLA 4E80A 8ICCA 4RQ8A 4RQ4A 2W9MA 5DBAA 3ISDA 2M2VA 4UB1A 5HRDA 1JQRA 1ZQGA 9ICFA 4LZDA 1RZTA 4PHPA 4YMMA 3C66A 7ICPA 4F5RA 4DO9A 2ISOA 3C5GA 3LQCB 3B0XA 5CP2A 4F5QA 4UBBA 3HJ1A 4NLKA 7ICIA 8ICKA 4AT8A 1HUOA 8ICBA 2ZH6A 3JYYA 3UXOA 3OUYA 1ZQCA 4X4SA 4UAWA 2O1PA 4GXKA 4RPXA 1JMSA 4YMOA 4KLLA 9ICPA 5IIJA 4JWMA 1XSNA 7ICHA 2PFPA 3MBYA 2IHMA 4M9GA 3JPPA 5IIOA 5HRGA 1ZQYA 3UXPA 4KLOA 1ZQOA 9ICGA 4X0BA 3OUYB 2DRAA 1MIYA 2PFOA 4AT7B 7ICKA 9ICCA 4X4PA 1ZQSA 4X4VA 4PGXA 5HRHA 7ICQA 2VANA 4IQUA 4Z6EA 4O5KA 5J2AA 1ZJNA 3OGUA 1VFGA 2PBEA 4LT6A 4XA5A 4X4NA 2HHPA 3L9DA 5J2IA 5DKWA 4M5DA 4IQTA 4DOAA 3TFSA 4TUPA 1MQ2A 3MDCA 4RQ5A 4AT8B 1MQ3A 4PH5A 4KLIA 4R63A 2PXIA 1R89A 1ZQQA 4UD5A 5J2HA 4KLTA 7ICRA 1TFWA 1UETA 1VJ7A 5J0RA 3AU2A 8ICRA 4KLUA 1MIVA 4ATBA 4QZGA 4O5EA 3RJFA 4EBJA 5DB8A 5DB7A 1KEJA 4P4MA 1FA0A 4QZEA 4KLMA 3LK9A 4EBKA 9ICLA 4Z6FA 2ZH2A 3ISCA 5IILA 5CR0A 1JN3A 2BCUA 4UAYA 4PHAA 5J2CA 3JPNA 4I29A 4NKUA 5J0WA 1ZQIA 2ZH1A 4X4UA 1OU5A 3B0YA 3C2MA 8ICNA 1V4AA 4P2HA 9ICRA 4RWPA 4ATBB 3UQ2A 1ZQTA 4TURA 3V7KA 3UPSA 9ICEA 1ZQRA 5J2JA 5TZVA 4PPXA 2NRKA 4E7XA 1ZJMA 4PHDA 5J2FA 2FMQA 2FMPA 4I2FA 1TFYA 4I2CA 1Q79A 7ICVA 4WC3A 4UAZA 4IG8A 5J2KA 3JZ0A 3RJJA 8ICMA 3RH4A 5DBBA 2ZH9A 4MFFA 5DBCA 1ZQZA 4QZBA 4UB5A 3NYBA 5HRKA 3V7JA 3UPQA 9ICMA 3C5FA 1ZQKA 5HREA 4AT9A 1ZQEA 2M2WA 4RT2A 1ZQJA 3JPSA 8ICWA 8ICAA
chains in the Genus database with same CATH superfamily
3C2LA 9ICNA 4E8FA 4R65A 3PMLA 4GXJA 1ZQWA 3H37A 4QZFA 4DOCA 2DR8A 2ZHAA 4WBYA 9ICAA 5HRFA 4O69A 2I9GA 2BBJA 3V7LA 4QZIA 8ICGA 2RFFA 3JCFA 3RJKA 2B51A 4PHEA 1R8BA 9ICBA 5J2BA 4K4GA 4RWNA 1MIWA 4Z6DA 4I2HA 4IQWA 4K8VA 1ZQXA 9ICHA 9ICUA 3H38A 5F2VO 5EOZA 4K9BA 4I2IA 3UXNA 1ZQBA 4IQVA 4KLJA 3ER9B 3WFOA 4UBCA 4K4HA 2DR7A 7ICNA 4M9NA 4FO6A 1Q78A 8ICEA 3JPRA 5CJ7A 3OWGA 9ICKA 2DVIA 4I2EA 2BPFA 7ICTA 4XQ8A 4R64A 4I2BA 4EEBA 3WFSC 4FHPA 3JPTA 4WC6A 8ICJA 4WC4A 5IIKA 4KLSA 4KLDA 4NM1A 4OAHA 4AT9B 4PGQA 2ZH4A 2GAFD 5CB1A 4X5VA 5IIMA 1KNYA 4UB4A 4FHXA 5J0OA 4LEWA 4O5CA 3H3AA 4RQ0A 4LVSA 4RWOA 4KLHA 5J0TA 5HRIA 5IINA 5HC9A 4WH5A 8ICTA 4RQ6A 4X4RA 4WC5A 3HX0A 7ICSA 4RPZA 5CA7A 4MFCA 8ICFA 4UB2A 4MF2A 4WQLA 4EV6A 8ICOA 9ICTA 5CHGA 4WCWA 9ICVA 8ICVA 2HN2A 2BBHA 2ID1A 7ICJA 3WFQE 4DOBA 1TV9A 5B3QA 4RQ7A 4F5NA 4RPYA 1BPDA 2BCSA 4HX0A 8ICXA 4MF8A 1R8AA 4XQ7A 1BPZA 3RJHA 3CK6A 2Q66A 5J0YA 5CWRA 5D49A 4RQ1A 8ICLA 3HWTA 5HR9A 1ZQUA 2DR9A 9ICQA 1XSLA 2FMSA 4X4TA 4UB3A 4TUSA 5D46A 4F5OA 3NKUA 4NKTA 4QZCA 4FHYA 2BCRA 3GDXA 7ICUA 1F5AA 5D62A 4KLEA 3MDAA 4AT7A 7ICLA 4RQ2A 3ISBA 4QZAA 1WOTA 4Z6CA 5BOMA 4KLGA 3MCRA 4RT3A 4QZ9A 3AUOA 4YCXA 4WC0A 4K96A 9ICJA 2DRBA 8ICIA 5DECA 4MFAA 4X4OA 5J29A 4FH5A 4OAGA 8ICZA 4I2AA 2ZHBA 1JAJA 4PGYA 4GXIA 5HRBA 4RWQA 1ZQDA 4KLQA 5DEDA 4I28A 4R66A 1ZQNA 4NXZA 7ICEA 9ICWA 4M0AA 3AQMA 1ZQLA 4I2JA 3RH6A 4XUSA 2BCVA 3HJ4A 4K9AA 4M9HA 9ICSA 2PFQA 2B4VA 4NLZA 4WOYA 5J0QA 5BPCA 2BPGA 4O9MA 9ICXA 5DDYA 5IIIA 1R8CA 8ICHA 4YD2A 1XSPA 1BPEA 1ZQMA 4WC2A 2P66A 1ZQHA 8ICPA 3AQNA 4X0AA 2M2UA 3UQ0A 5J2GA 2FCLA 4KLFA 3HIYA 4WBZA 7ICOA 4FHWA 4YN4A 1ZQVA 5HRLA 4M47A 3RH5A 5J0UA 3MGHA 1UEUA 3OVSA 5HHIA 9ICIA 7ICGA 4YMNA 4NXVA 4I2GA 1UEVA 1YLQA 3C2KA 5J0XA 1NO5A 4XRHA 1KDHA 4X4QA 4P4PA 5J0SA 3V72A 2ISPA 3WFPA 4EGWA 1BPXA 5DB9A 4NY8A 1BPBA 4WC7A 8ICQA 3JPQA 1NOMA 2M2TA 2HN1A 4O67A 4JLZA 2ZH5A 7ICFA 4FHVA 3ER8C 2PFNA 4M2YA 2DR5A 4K4IA 2GA9D 4WC1A 5J0PA 1BPYA 8ICSA 3RJGA 4I27A 5DB6A 4LZGA 4LEVA 3WFRE 1ZQPA 8ICUA 5DDMA 1PX5A 3C18A 7ICMA 3K75D 1ZQAA 4JWNA 5CFSA 3PMNA 3PNCA 3MGIA 3OVAA 3HW8A 9ICOA 3AQKA 1ZQFA 2BE3A 4UD4A 4RQ3A 3OV7A 4I2DA 3RJEA 8ICYA 4TUQA 5BOLA 4M9LA 4FH3A 4M04A 5D4BA 4EP7A 5HHHA 1TVAA 5D63A 5J2DA 2BCQA 4F5PA 4NM2A 3JPOA 3TFRA 4NXTA 2BPCA 3AU6A 3NVOA 3H39A 4QZ8A 2ZH3A 1RPLA 4M9JA 3RJIA 2GWSA 4K99A 2O5AA 4S3NA 4NLNA 4P4OA 4QZHA 4YD1A 2ZH7A 5J2EA 4QZDA 1HUZA 5JTGA 2ZH8A 3AQLA 4K97A 4K98A 3OVBA 4E80A 8ICCA 4RQ8A 4RQ4A 4OAFA 2W9MA 5DBAA 3ISDA 2M2VA 4UB1A 5HRDA 1JQRA 1ZQGA 9ICFA 4I0UA 2IHOA 4LZDA 1RZTA 4PHPA 4YMMA 2IUBA 3C66A 7ICPA 4F5RA 4DO9A 2ISOA 3C5GA 3LQCB 3B0XA 4OAIZ 5CP2A 4F5QA 4UBBA 3HJ1A 4O68A 4NLKA 7ICIA 8ICKA 4AT8A 1HUOA 3NWIA 4NXWA 8ICBA 2ZH6A 3JYYA 3UXOA 3OUYA 1ZQCA 4X4SA 4UAWA 5CHEA 2O1PA 4GXKA 4RPXA 1JMSA 4YMOA 4NXXA 4KLLA 9ICPA 5IIJA 4JWMA 4XJEA 1XSNA 7ICHA 2EWRA 1GPJA 2PFPA 3MBYA 2IHMA 4M9GA 3JPPA 5IIOA 4KM5A 2B56A 5HRGA 1ZQYA 3UXPA 4KLOA 1ZQOA 9ICGA 4X0BA 3OUYB 2DRAA 1MIYA 2PFOA 4AT7B 7ICKA 9ICCA 4X4PA 1ZQSA 4X4VA 4PGXA 5HRHA 7ICQA 2VANA 4IQUA 4LEZA 4Z6EA 4O5KA 5J2AA 1ZJNA 3OGUA 4NXUA 5CFUA 4WQKA 1VFGA 2PBEA 4LT6A 4XA5A 4X4NA 2HHPA 3L9DA 5J2IA 5DKWA 4M5DA 4IQTA 4DOAA 4KB6A 3TFSA 4TUPA 1MQ2A 3MDCA 4RQ5A 3PHZA 4AT8B 1MQ3A 4PH5A 4N7RA 4KLIA 4R63A 2PXIA 1R89A 1ZQQA 4UD5A 5J2HA 4KLTA 7ICRA 1TFWA 1UETA 1VJ7A 5J0RA 3AU2A 8ICRA 4KLUA 1MIVA 4ATBA 4QZGA 4O5EA 3RJFA 4MKPA 4EBJA 5DB8A 5DB7A 5B3PA 1KEJA 4P4MA 1FA0A 4QZEA 4KLMA 3LK9A 4EBKA 9ICLA 4Z6FA 2ZH2A 3ISCA 5IILA 5CR0A 1JN3A 2BCUA 4UAYA 4PHAA 5J2CA 3JPNA 4I29A 4O6AA 4NKUA 5J0WA 1ZQIA 2ZH1A 4X4UA 1OU5A 3B0YA 3C2MA 8ICNA 1V4AA 4P2HA 9ICRA 4RWPA 5CFTA 3EF2A 3UQ2A 1ZQTA 4ATBB 4TURA 3V7KA 3UPSA 9ICEA 1ZQRA 5J2JA 5TZVA 4PPXA 2NRKA 5D61A 4E7XA 4LEYA 1ZJMA 4PHDA 5J2FA 2FMQA 2FMPA 4I2FA 1TFYA 4I2CA 1Q79A 7ICVA 4WC3A 4UAZA 4IG8A 5J2KA 3ERCC 3JZ0A 3RJJA 8ICMA 3RH4A 5DBBA 2ZH9A 4MFFA 5DBCA 3K7DA 1ZQZA 4QZBA 4JLXA 4EEDA 4UB5A 3NYBA 5HRKA 3V7JA 3UPQA 9ICMA 3C5FA 1ZQKA 5HREA 4AT9A 1ZQEA 2M2WA 4RT2A 1ZQJA 4FO1A 3JPSA 8ICWA 8ICAA
chains in the Genus database with same CATH topology
3C2LA 9ICNA 4E8FA 4R65A 3PMLA 4GXJA 1ZQWA 3H37A 4QZFA 4DOCA 2DR8A 2ZHAA 4WBYA 9ICAA 5HRFA 2I9GA 3V7LA 4QZIA 8ICGA 2RFFA 3RJKA 4PHEA 1R8BA 9ICBA 5J2BA 4K4GA 4RWNA 1MIWA 4Z6DA 4I2HA 4IQWA 1ZQXA 9ICHA 9ICUA 3H38A 5F2VO 5EOZA 4I2IA 3UXNA 1ZQBA 4IQVA 4KLJA 3WFOA 4UBCA 4K4HA 2DR7A 7ICNA 4M9NA 4FO6A 1Q78A 8ICEA 3JPRA 5CJ7A 9ICKA 2DVIA 4I2EA 2BPFA 7ICTA 4XQ8A 4R64A 4I2BA 3WFSC 4FHPA 3JPTA 4WC6A 8ICJA 4WC4A 5IIKA 4KLSA 4KLDA 4NM1A 4AT9B 4PGQA 2ZH4A 5CB1A 4X5VA 5IIMA 1KNYA 4UB4A 4FHXA 5J0OA 4O5CA 3H3AA 4RQ0A 4LVSA 4RWOA 4KLHA 5J0TA 5HRIA 5IINA 5HC9A 8ICTA 4RQ6A 4X4RA 4WC5A 3HX0A 7ICSA 4RPZA 5CA7A 4MFCA 8ICFA 4UB2A 4MF2A 8ICOA 9ICTA 5CHGA 4WCWA 9ICVA 8ICVA 2ID1A 7ICJA 3WFQE 4DOBA 1TV9A 4RQ7A 4F5NA 4RPYA 1BPDA 2BCSA 8ICXA 4MF8A 1R8AA 4XQ7A 1BPZA 3RJHA 2Q66A 5J0YA 5CWRA 5D49A 4RQ1A 8ICLA 3HWTA 5HR9A 1ZQUA 2DR9A 9ICQA 1XSLA 2FMSA 4X4TA 4UB3A 4TUSA 5D46A 4F5OA 4NKTA 4QZCA 4FHYA 2BCRA 3GDXA 7ICUA 1F5AA 4KLEA 3MDAA 4AT7A 7ICLA 4RQ2A 3ISBA 4QZAA 1WOTA 4Z6CA 5BOMA 4KLGA 4RT3A 4QZ9A 3AUOA 4YCXA 4WC0A 9ICJA 2DRBA 8ICIA 5DECA 4MFAA 4X4OA 5J29A 4FH5A 8ICZA 4I2AA 2ZHBA 1JAJA 4PGYA 4GXIA 5HRBA 4RWQA 1ZQDA 4KLQA 5DEDA 4I28A 4R66A 1ZQNA 4NXZA 7ICEA 9ICWA 4M0AA 3AQMA 1ZQLA 4I2JA 3RH6A 4XUSA 2BCVA 3HJ4A 4M9HA 9ICSA 2PFQA 4NLZA 5J0QA 5BPCA 2BPGA 4O9MA 9ICXA 5DDYA 5IIIA 1R8CA 8ICHA 4YD2A 1XSPA 1BPEA 1ZQMA 4WC2A 2P66A 1ZQHA 8ICPA 3AQNA 4X0AA 2M2UA 3UQ0A 5J2GA 4KLFA 3HIYA 4WBZA 7ICOA 4FHWA 4YN4A 1ZQVA 5HRLA 4M47A 3RH5A 5J0UA 3MGHA 1UEUA 3OVSA 5HHIA 9ICIA 7ICGA 4YMNA 4I2GA 1UEVA 1YLQA 3C2KA 5J0XA 1NO5A 4XRHA 1KDHA 4X4QA 4P4PA 5J0SA 3V72A 2ISPA 3WFPA 1BPXA 5DB9A 4NY8A 1BPBA 4WC7A 8ICQA 3JPQA 1NOMA 2M2TA 2ZH5A 7ICFA 4FHVA 2PFNA 4M2YA 2DR5A 4K4IA 4WC1A 5J0PA 1BPYA 8ICSA 3RJGA 4I27A 5DB6A 4LZGA 3WFRE 1ZQPA 8ICUA 5DDMA 1PX5A 3C18A 7ICMA 3K75D 1ZQAA 4JWNA 3PMNA 3PNCA 3MGIA 3OVAA 3HW8A 9ICOA 3AQKA 1ZQFA 2BE3A 4UD4A 4RQ3A 3OV7A 4I2DA 3RJEA 8ICYA 4TUQA 5BOLA 4M9LA 4FH3A 4M04A 5D4BA 4EP7A 5HHHA 1TVAA 5J2DA 2BCQA 4F5PA 4NM2A 3JPOA 3TFRA 2BPCA 3AU6A 3H39A 4QZ8A 2ZH3A 1RPLA 4M9JA 3RJIA 2GWSA 2O5AA 4S3NA 4NLNA 4P4OA 4QZHA 4YD1A 2ZH7A 5J2EA 4QZDA 1HUZA 2ZH8A 3OVBA 3AQLA 4E80A 8ICCA 4RQ8A 4RQ4A 2W9MA 5DBAA 3ISDA 2M2VA 4UB1A 5HRDA 1JQRA 1ZQGA 9ICFA 4LZDA 1RZTA 4PHPA 4YMMA 3C66A 7ICPA 4F5RA 4DO9A 2ISOA 3C5GA 3LQCB 3B0XA 5CP2A 4F5QA 4UBBA 3HJ1A 4NLKA 7ICIA 8ICKA 4AT8A 1HUOA 8ICBA 2ZH6A 3JYYA 3UXOA 3OUYA 1ZQCA 4X4SA 4UAWA 2O1PA 4GXKA 4RPXA 1JMSA 4YMOA 4KLLA 9ICPA 5IIJA 4JWMA 1XSNA 7ICHA 2PFPA 3MBYA 2IHMA 4M9GA 3JPPA 5IIOA 5HRGA 1ZQYA 3UXPA 4KLOA 1ZQOA 9ICGA 4X0BA 3OUYB 2DRAA 1MIYA 2PFOA 4AT7B 7ICKA 9ICCA 4X4PA 1ZQSA 4X4VA 4PGXA 5HRHA 7ICQA 2VANA 4IQUA 4Z6EA 4O5KA 5J2AA 1ZJNA 3OGUA 1VFGA 2PBEA 4LT6A 4XA5A 4X4NA 2HHPA 3L9DA 5J2IA 5DKWA 4M5DA 4IQTA 4DOAA 3TFSA 4TUPA 1MQ2A 3MDCA 4RQ5A 4AT8B 1MQ3A 4PH5A 4KLIA 4R63A 2PXIA 1R89A 1ZQQA 4UD5A 5J2HA 4KLTA 7ICRA 1TFWA 1UETA 1VJ7A 5J0RA 3AU2A 8ICRA 4KLUA 1MIVA 4ATBA 4QZGA 4O5EA 3RJFA 4EBJA 5DB8A 5DB7A 1KEJA 4P4MA 1FA0A 4QZEA 4KLMA 3LK9A 4EBKA 9ICLA 4Z6FA 2ZH2A 3ISCA 5IILA 5CR0A 1JN3A 2BCUA 4UAYA 4PHAA 5J2CA 3JPNA 4I29A 4NKUA 5J0WA 1ZQIA 2ZH1A 4X4UA 1OU5A 3B0YA 3C2MA 8ICNA 1V4AA 4P2HA 9ICRA 4RWPA 4ATBB 3UQ2A 1ZQTA 4TURA 3V7KA 3UPSA 9ICEA 1ZQRA 5J2JA 5TZVA 4PPXA 2NRKA 4E7XA 1ZJMA 4PHDA 5J2FA 2FMQA 2FMPA 4I2FA 1TFYA 4I2CA 1Q79A 7ICVA 4WC3A 4UAZA 4IG8A 5J2KA 3JZ0A 3RJJA 8ICMA 3RH4A 5DBBA 2ZH9A 4MFFA 5DBCA 1ZQZA 4QZBA 4UB5A 3NYBA 5HRKA 3V7JA 3UPQA 9ICMA 3C5FA 1ZQKA 5HREA 4AT9A 1ZQEA 2M2WA 4RT2A 1ZQJA 3JPSA 8ICWA 8ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2L A;  9ICN A;  4E8F A;  4R65 A;  3PML A;  4GXJ A;  1ZQW A;  3H37 A;  4QZF A;  4DOC A;  2DR8 A;  2ZHA A;  4WBY A;  9ICA A;  5HRF A;  2I9G A;  3V7L A;  4QZI A;  8ICG A;  2RFF A;  3RJK A;  4PHE A;  1R8B A;  9ICB A;  5J2B A;  4K4G A;  4RWN A;  1MIW A;  4Z6D A;  4I2H A;  4IQW A;  1ZQX A;  9ICH A;  9ICU A;  3H38 A;  5F2V O;  5EOZ A;  4I2I A;  3UXN A;  1ZQB A;  4IQV A;  4KLJ A;  3WFO A;  4UBC A;  4K4H A;  2DR7 A;  7ICN A;  4M9N A;  4FO6 A;  1Q78 A;  8ICE A;  3JPR A;  5CJ7 A;  9ICK A;  2DVI A;  4I2E A;  2BPF A;  7ICT A;  4XQ8 A;  4R64 A;  4I2B A;  3WFS C;  4FHP A;  3JPT A;  4WC6 A;  8ICJ A;  4WC4 A;  5IIK A;  4KLS A;  4KLD A;  4NM1 A;  4AT9 B;  4PGQ A;  2ZH4 A;  5CB1 A;  4X5V A;  5IIM A;  1KNY A;  4UB4 A;  4FHX A;  5J0O A;  4O5C A;  3H3A A;  4RQ0 A;  4LVS A;  4RWO A;  4KLH A;  5J0T A;  5HRI A;  5IIN A;  5HC9 A;  8ICT A;  4RQ6 A;  4X4R A;  4WC5 A;  3HX0 A;  7ICS A;  4RPZ A;  5CA7 A;  4MFC A;  8ICF A;  4UB2 A;  4MF2 A;  8ICO A;  9ICT A;  5CHG A;  4WCW A;  9ICV A;  8ICV A;  2ID1 A;  7ICJ A;  3WFQ E;  4DOB A;  1TV9 A;  4RQ7 A;  4F5N A;  4RPY A;  1BPD A;  2BCS A;  8ICX A;  4MF8 A;  1R8A A;  4XQ7 A;  1BPZ A;  3RJH A;  2Q66 A;  5J0Y A;  5CWR A;  5D49 A;  4RQ1 A;  8ICL A;  3HWT A;  5HR9 A;  1ZQU A;  2DR9 A;  9ICQ A;  1XSL A;  2FMS A;  4X4T A;  4UB3 A;  4TUS A;  5D46 A;  4F5O A;  4NKT A;  4QZC A;  4FHY A;  2BCR A;  3GDX A;  7ICU A;  1F5A A;  4KLE A;  3MDA A;  4AT7 A;  7ICL A;  4RQ2 A;  3ISB A;  4QZA A;  1WOT A;  4Z6C A;  5BOM A;  4KLG A;  4RT3 A;  4QZ9 A;  3AUO A;  4YCX A;  4WC0 A;  9ICJ A;  2DRB A;  8ICI A;  5DEC A;  4MFA A;  4X4O A;  5J29 A;  4FH5 A;  8ICZ A;  4I2A A;  2ZHB A;  1JAJ A;  4PGY A;  4GXI A;  5HRB A;  4RWQ A;  1ZQD A;  4KLQ A;  5DED A;  4I28 A;  4R66 A;  1ZQN A;  4NXZ A;  7ICE A;  9ICW A;  4M0A A;  3AQM A;  1ZQL A;  4I2J A;  3RH6 A;  4XUS A;  2BCV A;  3HJ4 A;  4M9H A;  9ICS A;  2PFQ A;  4NLZ A;  5J0Q A;  5BPC A;  2BPG A;  4O9M A;  9ICX A;  5DDY A;  5III A;  1R8C A;  8ICH A;  4YD2 A;  1XSP A;  1BPE A;  1ZQM A;  4WC2 A;  2P66 A;  1ZQH A;  8ICP A;  3AQN A;  4X0A A;  2M2U A;  3UQ0 A;  5J2G A;  4KLF A;  3HIY A;  4WBZ A;  7ICO A;  4FHW A;  4YN4 A;  1ZQV A;  5HRL A;  4M47 A;  3RH5 A;  5J0U A;  3MGH A;  1UEU A;  3OVS A;  5HHI A;  9ICI A;  7ICG A;  4YMN A;  4I2G A;  1UEV A;  1YLQ A;  3C2K A;  5J0X A;  1NO5 A;  4XRH A;  1KDH A;  4X4Q A;  4P4P A;  5J0S A;  3V72 A;  2ISP A;  3WFP A;  1BPX A;  5DB9 A;  4NY8 A;  1BPB A;  4WC7 A;  8ICQ A;  3JPQ A;  1NOM A;  2M2T A;  2ZH5 A;  7ICF A;  4FHV A;  2PFN A;  4M2Y A;  2DR5 A;  4K4I A;  4WC1 A;  5J0P A;  1BPY A;  8ICS A;  3RJG A;  4I27 A;  5DB6 A;  4LZG A;  3WFR E;  1ZQP A;  8ICU A;  5DDM A;  1PX5 A;  3C18 A;  7ICM A;  3K75 D;  1ZQA A;  4JWN A;  3PMN A;  3PNC A;  3MGI A;  3OVA A;  3HW8 A;  9ICO A;  3AQK A;  1ZQF A;  2BE3 A;  4UD4 A;  4RQ3 A;  3OV7 A;  4I2D A;  3RJE A;  8ICY A;  4TUQ A;  5BOL A;  4M9L A;  4FH3 A;  4M04 A;  5D4B A;  4EP7 A;  5HHH A;  1TVA A;  5J2D A;  2BCQ A;  4F5P A;  4NM2 A;  3JPO A;  3TFR A;  2BPC A;  3AU6 A;  3H39 A;  4QZ8 A;  2ZH3 A;  1RPL A;  4M9J A;  3RJI A;  2GWS A;  2O5A A;  4S3N A;  4NLN A;  4P4O A;  4QZH A;  4YD1 A;  2ZH7 A;  5J2E A;  4QZD A;  1HUZ A;  2ZH8 A;  3OVB A;  3AQL A;  4E80 A;  8ICC A;  4RQ8 A;  4RQ4 A;  2W9M A;  5DBA A;  3ISD A;  2M2V A;  4UB1 A;  5HRD A;  1JQR A;  1ZQG A;  9ICF A;  4LZD A;  1RZT A;  4PHP A;  4YMM A;  3C66 A;  7ICP A;  4F5R A;  4DO9 A;  2ISO A;  3C5G A;  3LQC B;  3B0X A;  5CP2 A;  4F5Q A;  4UBB A;  3HJ1 A;  4NLK A;  7ICI A;  8ICK A;  4AT8 A;  1HUO A;  8ICB A;  2ZH6 A;  3JYY A;  3UXO A;  3OUY A;  1ZQC A;  4X4S A;  4UAW A;  2O1P A;  4GXK A;  4RPX A;  1JMS A;  4YMO A;  4KLL A;  9ICP A;  5IIJ A;  4JWM A;  1XSN A;  7ICH A;  2PFP A;  3MBY A;  2IHM A;  4M9G A;  3JPP A;  5IIO A;  5HRG A;  1ZQY A;  3UXP A;  4KLO A;  1ZQO A;  9ICG A;  4X0B A;  3OUY B;  2DRA A;  1MIY A;  2PFO A;  4AT7 B;  7ICK A;  9ICC A;  4X4P A;  1ZQS A;  4X4V A;  4PGX A;  5HRH A;  7ICQ A;  2VAN A;  4IQU A;  4Z6E A;  4O5K A;  5J2A A;  1ZJN A;  3OGU A;  1VFG A;  2PBE A;  4LT6 A;  4XA5 A;  4X4N A;  2HHP A;  3L9D A;  5J2I A;  5DKW A;  4M5D A;  4IQT A;  4DOA A;  3TFS A;  4TUP A;  1MQ2 A;  3MDC A;  4RQ5 A;  4AT8 B;  1MQ3 A;  4PH5 A;  4KLI A;  4R63 A;  2PXI A;  1R89 A;  1ZQQ A;  4UD5 A;  5J2H A;  4KLT A;  7ICR A;  1TFW A;  1UET A;  1VJ7 A;  5J0R A;  3AU2 A;  8ICR A;  4KLU A;  1MIV A;  4ATB A;  4QZG A;  4O5E A;  3RJF A;  4EBJ A;  5DB8 A;  5DB7 A;  1KEJ A;  4P4M A;  1FA0 A;  4QZE A;  4KLM A;  3LK9 A;  4EBK A;  9ICL A;  4Z6F A;  2ZH2 A;  3ISC A;  5IIL A;  5CR0 A;  1JN3 A;  2BCU A;  4UAY A;  4PHA A;  5J2C A;  3JPN A;  4I29 A;  4NKU A;  5J0W A;  1ZQI A;  2ZH1 A;  4X4U A;  1OU5 A;  3B0Y A;  3C2M A;  8ICN A;  1V4A A;  4P2H A;  9ICR A;  4RWP A;  4ATB B;  3UQ2 A;  1ZQT A;  4TUR A;  3V7K A;  3UPS A;  9ICE A;  1ZQR A;  5J2J A;  5TZV A;  4PPX A;  2NRK A;  4E7X A;  1ZJM A;  4PHD A;  5J2F A;  2FMQ A;  2FMP A;  4I2F A;  1TFY A;  4I2C A;  1Q79 A;  7ICV A;  4WC3 A;  4UAZ A;  4IG8 A;  5J2K A;  3JZ0 A;  3RJJ A;  8ICM A;  3RH4 A;  5DBB A;  2ZH9 A;  4MFF A;  5DBC A;  1ZQZ A;  4QZB A;  4UB5 A;  3NYB A;  5HRK A;  3V7J A;  3UPQ A;  9ICM A;  3C5F A;  1ZQK A;  5HRE A;  4AT9 A;  1ZQE A;  2M2W A;  4RT2 A;  1ZQJ A;  3JPS A;  8ICW A;  8ICA A; 
#chains in the Genus database with same CATH topology
 3C2L A;  9ICN A;  4E8F A;  4R65 A;  3PML A;  4GXJ A;  1ZQW A;  3H37 A;  4QZF A;  4DOC A;  2DR8 A;  2ZHA A;  4WBY A;  9ICA A;  5HRF A;  4O69 A;  2I9G A;  2BBJ A;  3V7L A;  4QZI A;  8ICG A;  2RFF A;  3JCF A;  3RJK A;  2B51 A;  4PHE A;  1R8B A;  9ICB A;  5J2B A;  4K4G A;  4RWN A;  1MIW A;  4Z6D A;  4I2H A;  4IQW A;  4K8V A;  1ZQX A;  9ICH A;  9ICU A;  3H38 A;  5F2V O;  5EOZ A;  4K9B A;  4I2I A;  3UXN A;  1ZQB A;  4IQV A;  4KLJ A;  3ER9 B;  3WFO A;  4UBC A;  4K4H A;  2DR7 A;  7ICN A;  4M9N A;  4FO6 A;  1Q78 A;  8ICE A;  3JPR A;  5CJ7 A;  3OWG A;  9ICK A;  2DVI A;  4I2E A;  2BPF A;  7ICT A;  4XQ8 A;  4R64 A;  4I2B A;  4EEB A;  3WFS C;  4FHP A;  3JPT A;  4WC6 A;  8ICJ A;  4WC4 A;  5IIK A;  4KLS A;  4KLD A;  4NM1 A;  4OAH A;  4AT9 B;  4PGQ A;  2ZH4 A;  2GAF D;  5CB1 A;  4X5V A;  5IIM A;  1KNY A;  4UB4 A;  4FHX A;  5J0O A;  4LEW A;  4O5C A;  3H3A A;  4RQ0 A;  4LVS A;  4RWO A;  4KLH A;  5J0T A;  5HRI A;  5IIN A;  5HC9 A;  4WH5 A;  8ICT A;  4RQ6 A;  4X4R A;  4WC5 A;  3HX0 A;  7ICS A;  4RPZ A;  5CA7 A;  4MFC A;  8ICF A;  4UB2 A;  4MF2 A;  4WQL A;  4EV6 A;  8ICO A;  9ICT A;  5CHG A;  4WCW A;  9ICV A;  8ICV A;  2HN2 A;  2BBH A;  2ID1 A;  7ICJ A;  3WFQ E;  4DOB A;  1TV9 A;  5B3Q A;  4RQ7 A;  4F5N A;  4RPY A;  1BPD A;  2BCS A;  4HX0 A;  8ICX A;  4MF8 A;  1R8A A;  4XQ7 A;  1BPZ A;  3RJH A;  3CK6 A;  2Q66 A;  5J0Y A;  5CWR A;  5D49 A;  4RQ1 A;  8ICL A;  3HWT A;  5HR9 A;  1ZQU A;  2DR9 A;  9ICQ A;  1XSL A;  2FMS A;  4X4T A;  4UB3 A;  4TUS A;  5D46 A;  4F5O A;  3NKU A;  4NKT A;  4QZC A;  4FHY A;  2BCR A;  3GDX A;  7ICU A;  1F5A A;  5D62 A;  4KLE A;  3MDA A;  4AT7 A;  7ICL A;  4RQ2 A;  3ISB A;  4QZA A;  1WOT A;  4Z6C A;  5BOM A;  4KLG A;  3MCR A;  4RT3 A;  4QZ9 A;  3AUO A;  4YCX A;  4WC0 A;  4K96 A;  9ICJ A;  2DRB A;  8ICI A;  5DEC A;  4MFA A;  4X4O A;  5J29 A;  4FH5 A;  4OAG A;  8ICZ A;  4I2A A;  2ZHB A;  1JAJ A;  4PGY A;  4GXI A;  5HRB A;  4RWQ A;  1ZQD A;  4KLQ A;  5DED A;  4I28 A;  4R66 A;  1ZQN A;  4NXZ A;  7ICE A;  9ICW A;  4M0A A;  3AQM A;  1ZQL A;  4I2J A;  3RH6 A;  4XUS A;  2BCV A;  3HJ4 A;  4K9A A;  4M9H A;  9ICS A;  2PFQ A;  2B4V A;  4NLZ A;  4WOY A;  5J0Q A;  5BPC A;  2BPG A;  4O9M A;  9ICX A;  5DDY A;  5III A;  1R8C A;  8ICH A;  4YD2 A;  1XSP A;  1BPE A;  1ZQM A;  4WC2 A;  2P66 A;  1ZQH A;  8ICP A;  3AQN A;  4X0A A;  2M2U A;  3UQ0 A;  5J2G A;  2FCL A;  4KLF A;  3HIY A;  4WBZ A;  7ICO A;  4FHW A;  4YN4 A;  1ZQV A;  5HRL A;  4M47 A;  3RH5 A;  5J0U A;  3MGH A;  1UEU A;  3OVS A;  5HHI A;  9ICI A;  7ICG A;  4YMN A;  4NXV A;  4I2G A;  1UEV A;  1YLQ A;  3C2K A;  5J0X A;  1NO5 A;  4XRH A;  1KDH A;  4X4Q A;  4P4P A;  5J0S A;  3V72 A;  2ISP A;  3WFP A;  4EGW A;  1BPX A;  5DB9 A;  4NY8 A;  1BPB A;  4WC7 A;  8ICQ A;  3JPQ A;  1NOM A;  2M2T A;  2HN1 A;  4O67 A;  4JLZ A;  2ZH5 A;  7ICF A;  4FHV A;  3ER8 C;  2PFN A;  4M2Y A;  2DR5 A;  4K4I A;  2GA9 D;  4WC1 A;  5J0P A;  1BPY A;  8ICS A;  3RJG A;  4I27 A;  5DB6 A;  4LZG A;  4LEV A;  3WFR E;  1ZQP A;  8ICU A;  5DDM A;  1PX5 A;  3C18 A;  7ICM A;  3K75 D;  1ZQA A;  4JWN A;  5CFS A;  3PMN A;  3PNC A;  3MGI A;  3OVA A;  3HW8 A;  9ICO A;  3AQK A;  1ZQF A;  2BE3 A;  4UD4 A;  4RQ3 A;  3OV7 A;  4I2D A;  3RJE A;  8ICY A;  4TUQ A;  5BOL A;  4M9L A;  4FH3 A;  4M04 A;  5D4B A;  4EP7 A;  5HHH A;  1TVA A;  5D63 A;  5J2D A;  2BCQ A;  4F5P A;  4NM2 A;  3JPO A;  3TFR A;  4NXT A;  2BPC A;  3AU6 A;  3NVO A;  3H39 A;  4QZ8 A;  2ZH3 A;  1RPL A;  4M9J A;  3RJI A;  2GWS A;  4K99 A;  2O5A A;  4S3N A;  4NLN A;  4P4O A;  4QZH A;  4YD1 A;  2ZH7 A;  5J2E A;  4QZD A;  1HUZ A;  5JTG A;  2ZH8 A;  3AQL A;  4K97 A;  4K98 A;  3OVB A;  4E80 A;  8ICC A;  4RQ8 A;  4RQ4 A;  4OAF A;  2W9M A;  5DBA A;  3ISD A;  2M2V A;  4UB1 A;  5HRD A;  1JQR A;  1ZQG A;  9ICF A;  4I0U A;  2IHO A;  4LZD A;  1RZT A;  4PHP A;  4YMM A;  2IUB A;  3C66 A;  7ICP A;  4F5R A;  4DO9 A;  2ISO A;  3C5G A;  3LQC B;  3B0X A;  4OAI Z;  5CP2 A;  4F5Q A;  4UBB A;  3HJ1 A;  4O68 A;  4NLK A;  7ICI A;  8ICK A;  4AT8 A;  1HUO A;  3NWI A;  4NXW A;  8ICB A;  2ZH6 A;  3JYY A;  3UXO A;  3OUY A;  1ZQC A;  4X4S A;  4UAW A;  5CHE A;  2O1P A;  4GXK A;  4RPX A;  1JMS A;  4YMO A;  4NXX A;  4KLL A;  9ICP A;  5IIJ A;  4JWM A;  4XJE A;  1XSN A;  7ICH A;  2EWR A;  1GPJ A;  2PFP A;  3MBY A;  2IHM A;  4M9G A;  3JPP A;  5IIO A;  4KM5 A;  2B56 A;  5HRG A;  1ZQY A;  3UXP A;  4KLO A;  1ZQO A;  9ICG A;  4X0B A;  3OUY B;  2DRA A;  1MIY A;  2PFO A;  4AT7 B;  7ICK A;  9ICC A;  4X4P A;  1ZQS A;  4X4V A;  4PGX A;  5HRH A;  7ICQ A;  2VAN A;  4IQU A;  4LEZ A;  4Z6E A;  4O5K A;  5J2A A;  1ZJN A;  3OGU A;  4NXU A;  5CFU A;  4WQK A;  1VFG A;  2PBE A;  4LT6 A;  4XA5 A;  4X4N A;  2HHP A;  3L9D A;  5J2I A;  5DKW A;  4M5D A;  4IQT A;  4DOA A;  4KB6 A;  3TFS A;  4TUP A;  1MQ2 A;  3MDC A;  4RQ5 A;  3PHZ A;  4AT8 B;  1MQ3 A;  4PH5 A;  4N7R A;  4KLI A;  4R63 A;  2PXI A;  1R89 A;  1ZQQ A;  4UD5 A;  5J2H A;  4KLT A;  7ICR A;  1TFW A;  1UET A;  1VJ7 A;  5J0R A;  3AU2 A;  8ICR A;  4KLU A;  1MIV A;  4ATB A;  4QZG A;  4O5E A;  3RJF A;  4MKP A;  4EBJ A;  5DB8 A;  5DB7 A;  5B3P A;  1KEJ A;  4P4M A;  1FA0 A;  4QZE A;  4KLM A;  3LK9 A;  4EBK A;  9ICL A;  4Z6F A;  2ZH2 A;  3ISC A;  5IIL A;  5CR0 A;  1JN3 A;  2BCU A;  4UAY A;  4PHA A;  5J2C A;  3JPN A;  4I29 A;  4O6A A;  4NKU A;  5J0W A;  1ZQI A;  2ZH1 A;  4X4U A;  1OU5 A;  3B0Y A;  3C2M A;  8ICN A;  1V4A A;  4P2H A;  9ICR A;  4RWP A;  5CFT A;  3EF2 A;  3UQ2 A;  1ZQT A;  4ATB B;  4TUR A;  3V7K A;  3UPS A;  9ICE A;  1ZQR A;  5J2J A;  5TZV A;  4PPX A;  2NRK A;  5D61 A;  4E7X A;  4LEY A;  1ZJM A;  4PHD A;  5J2F A;  2FMQ A;  2FMP A;  4I2F A;  1TFY A;  4I2C A;  1Q79 A;  7ICV A;  4WC3 A;  4UAZ A;  4IG8 A;  5J2K A;  3ERC C;  3JZ0 A;  3RJJ A;  8ICM A;  3RH4 A;  5DBB A;  2ZH9 A;  4MFF A;  5DBC A;  3K7D A;  1ZQZ A;  4QZB A;  4JLX A;  4EED A;  4UB5 A;  3NYB A;  5HRK A;  3V7J A;  3UPQ A;  9ICM A;  3C5F A;  1ZQK A;  5HRE A;  4AT9 A;  1ZQE A;  2M2W A;  4RT2 A;  1ZQJ A;  4FO1 A;  3JPS A;  8ICW A;  8ICA A; 
#chains in the Genus database with same CATH homology
 3C2L A;  9ICN A;  4E8F A;  4R65 A;  3PML A;  4GXJ A;  1ZQW A;  3H37 A;  4QZF A;  4DOC A;  2DR8 A;  2ZHA A;  4WBY A;  9ICA A;  5HRF A;  2I9G A;  3V7L A;  4QZI A;  8ICG A;  2RFF A;  3RJK A;  4PHE A;  1R8B A;  9ICB A;  5J2B A;  4K4G A;  4RWN A;  1MIW A;  4Z6D A;  4I2H A;  4IQW A;  1ZQX A;  9ICH A;  9ICU A;  3H38 A;  5F2V O;  5EOZ A;  4I2I A;  3UXN A;  1ZQB A;  4IQV A;  4KLJ A;  3WFO A;  4UBC A;  4K4H A;  2DR7 A;  7ICN A;  4M9N A;  4FO6 A;  1Q78 A;  8ICE A;  3JPR A;  5CJ7 A;  9ICK A;  2DVI A;  4I2E A;  2BPF A;  7ICT A;  4XQ8 A;  4R64 A;  4I2B A;  3WFS C;  4FHP A;  3JPT A;  4WC6 A;  8ICJ A;  4WC4 A;  5IIK A;  4KLS A;  4KLD A;  4NM1 A;  4AT9 B;  4PGQ A;  2ZH4 A;  5CB1 A;  4X5V A;  5IIM A;  1KNY A;  4UB4 A;  4FHX A;  5J0O A;  4O5C A;  3H3A A;  4RQ0 A;  4LVS A;  4RWO A;  4KLH A;  5J0T A;  5HRI A;  5IIN A;  5HC9 A;  8ICT A;  4RQ6 A;  4X4R A;  4WC5 A;  3HX0 A;  7ICS A;  4RPZ A;  5CA7 A;  4MFC A;  8ICF A;  4UB2 A;  4MF2 A;  8ICO A;  9ICT A;  5CHG A;  4WCW A;  9ICV A;  8ICV A;  2ID1 A;  7ICJ A;  3WFQ E;  4DOB A;  1TV9 A;  4RQ7 A;  4F5N A;  4RPY A;  1BPD A;  2BCS A;  8ICX A;  4MF8 A;  1R8A A;  4XQ7 A;  1BPZ A;  3RJH A;  2Q66 A;  5J0Y A;  5CWR A;  5D49 A;  4RQ1 A;  8ICL A;  3HWT A;  5HR9 A;  1ZQU A;  2DR9 A;  9ICQ A;  1XSL A;  2FMS A;  4X4T A;  4UB3 A;  4TUS A;  5D46 A;  4F5O A;  4NKT A;  4QZC A;  4FHY A;  2BCR A;  3GDX A;  7ICU A;  1F5A A;  4KLE A;  3MDA A;  4AT7 A;  7ICL A;  4RQ2 A;  3ISB A;  4QZA A;  1WOT A;  4Z6C A;  5BOM A;  4KLG A;  4RT3 A;  4QZ9 A;  3AUO A;  4YCX A;  4WC0 A;  9ICJ A;  2DRB A;  8ICI A;  5DEC A;  4MFA A;  4X4O A;  5J29 A;  4FH5 A;  8ICZ A;  4I2A A;  2ZHB A;  1JAJ A;  4PGY A;  4GXI A;  5HRB A;  4RWQ A;  1ZQD A;  4KLQ A;  5DED A;  4I28 A;  4R66 A;  1ZQN A;  4NXZ A;  7ICE A;  9ICW A;  4M0A A;  3AQM A;  1ZQL A;  4I2J A;  3RH6 A;  4XUS A;  2BCV A;  3HJ4 A;  4M9H A;  9ICS A;  2PFQ A;  4NLZ A;  5J0Q A;  5BPC A;  2BPG A;  4O9M A;  9ICX A;  5DDY A;  5III A;  1R8C A;  8ICH A;  4YD2 A;  1XSP A;  1BPE A;  1ZQM A;  4WC2 A;  2P66 A;  1ZQH A;  8ICP A;  3AQN A;  4X0A A;  2M2U A;  3UQ0 A;  5J2G A;  4KLF A;  3HIY A;  4WBZ A;  7ICO A;  4FHW A;  4YN4 A;  1ZQV A;  5HRL A;  4M47 A;  3RH5 A;  5J0U A;  3MGH A;  1UEU A;  3OVS A;  5HHI A;  9ICI A;  7ICG A;  4YMN A;  4I2G A;  1UEV A;  1YLQ A;  3C2K A;  5J0X A;  1NO5 A;  4XRH A;  1KDH A;  4X4Q A;  4P4P A;  5J0S A;  3V72 A;  2ISP A;  3WFP A;  1BPX A;  5DB9 A;  4NY8 A;  1BPB A;  4WC7 A;  8ICQ A;  3JPQ A;  1NOM A;  2M2T A;  2ZH5 A;  7ICF A;  4FHV A;  2PFN A;  4M2Y A;  2DR5 A;  4K4I A;  4WC1 A;  5J0P A;  1BPY A;  8ICS A;  3RJG A;  4I27 A;  5DB6 A;  4LZG A;  3WFR E;  1ZQP A;  8ICU A;  5DDM A;  1PX5 A;  3C18 A;  7ICM A;  3K75 D;  1ZQA A;  4JWN A;  3PMN A;  3PNC A;  3MGI A;  3OVA A;  3HW8 A;  9ICO A;  3AQK A;  1ZQF A;  2BE3 A;  4UD4 A;  4RQ3 A;  3OV7 A;  4I2D A;  3RJE A;  8ICY A;  4TUQ A;  5BOL A;  4M9L A;  4FH3 A;  4M04 A;  5D4B A;  4EP7 A;  5HHH A;  1TVA A;  5J2D A;  2BCQ A;  4F5P A;  4NM2 A;  3JPO A;  3TFR A;  2BPC A;  3AU6 A;  3H39 A;  4QZ8 A;  2ZH3 A;  1RPL A;  4M9J A;  3RJI A;  2GWS A;  2O5A A;  4S3N A;  4NLN A;  4P4O A;  4QZH A;  4YD1 A;  2ZH7 A;  5J2E A;  4QZD A;  1HUZ A;  2ZH8 A;  3OVB A;  3AQL A;  4E80 A;  8ICC A;  4RQ8 A;  4RQ4 A;  2W9M A;  5DBA A;  3ISD A;  2M2V A;  4UB1 A;  5HRD A;  1JQR A;  1ZQG A;  9ICF A;  4LZD A;  1RZT A;  4PHP A;  4YMM A;  3C66 A;  7ICP A;  4F5R A;  4DO9 A;  2ISO A;  3C5G A;  3LQC B;  3B0X A;  5CP2 A;  4F5Q A;  4UBB A;  3HJ1 A;  4NLK A;  7ICI A;  8ICK A;  4AT8 A;  1HUO A;  8ICB A;  2ZH6 A;  3JYY A;  3UXO A;  3OUY A;  1ZQC A;  4X4S A;  4UAW A;  2O1P A;  4GXK A;  4RPX A;  1JMS A;  4YMO A;  4KLL A;  9ICP A;  5IIJ A;  4JWM A;  1XSN A;  7ICH A;  2PFP A;  3MBY A;  2IHM A;  4M9G A;  3JPP A;  5IIO A;  5HRG A;  1ZQY A;  3UXP A;  4KLO A;  1ZQO A;  9ICG A;  4X0B A;  3OUY B;  2DRA A;  1MIY A;  2PFO A;  4AT7 B;  7ICK A;  9ICC A;  4X4P A;  1ZQS A;  4X4V A;  4PGX A;  5HRH A;  7ICQ A;  2VAN A;  4IQU A;  4Z6E A;  4O5K A;  5J2A A;  1ZJN A;  3OGU A;  1VFG A;  2PBE A;  4LT6 A;  4XA5 A;  4X4N A;  2HHP A;  3L9D A;  5J2I A;  5DKW A;  4M5D A;  4IQT A;  4DOA A;  3TFS A;  4TUP A;  1MQ2 A;  3MDC A;  4RQ5 A;  4AT8 B;  1MQ3 A;  4PH5 A;  4KLI A;  4R63 A;  2PXI A;  1R89 A;  1ZQQ A;  4UD5 A;  5J2H A;  4KLT A;  7ICR A;  1TFW A;  1UET A;  1VJ7 A;  5J0R A;  3AU2 A;  8ICR A;  4KLU A;  1MIV A;  4ATB A;  4QZG A;  4O5E A;  3RJF A;  4EBJ A;  5DB8 A;  5DB7 A;  1KEJ A;  4P4M A;  1FA0 A;  4QZE A;  4KLM A;  3LK9 A;  4EBK A;  9ICL A;  4Z6F A;  2ZH2 A;  3ISC A;  5IIL A;  5CR0 A;  1JN3 A;  2BCU A;  4UAY A;  4PHA A;  5J2C A;  3JPN A;  4I29 A;  4NKU A;  5J0W A;  1ZQI A;  2ZH1 A;  4X4U A;  1OU5 A;  3B0Y A;  3C2M A;  8ICN A;  1V4A A;  4P2H A;  9ICR A;  4RWP A;  4ATB B;  3UQ2 A;  1ZQT A;  4TUR A;  3V7K A;  3UPS A;  9ICE A;  1ZQR A;  5J2J A;  5TZV A;  4PPX A;  2NRK A;  4E7X A;  1ZJM A;  4PHD A;  5J2F A;  2FMQ A;  2FMP A;  4I2F A;  1TFY A;  4I2C A;  1Q79 A;  7ICV A;  4WC3 A;  4UAZ A;  4IG8 A;  5J2K A;  3JZ0 A;  3RJJ A;  8ICM A;  3RH4 A;  5DBB A;  2ZH9 A;  4MFF A;  5DBC A;  1ZQZ A;  4QZB A;  4UB5 A;  3NYB A;  5HRK A;  3V7J A;  3UPQ A;  9ICM A;  3C5F A;  1ZQK A;  5HRE A;  4AT9 A;  1ZQE A;  2M2W A;  4RT2 A;  1ZQJ A;  3JPS A;  8ICW A;  8ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...