4EGWA

The structure of the soluble domain of cora from methanocaldococcus jannaschii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
MITVIAIAKDGSIVEPKLDEISFEDYRLIWIDCYDPKDEELYKLSKKIGISVSDLQIGLDEQEIPRVEEDEDFYLIIYKAPLFEEDITTTSLGIYIKNNLLLTIHSDKIKAIGRLHKLISTKKPRIVFERGIGFLLYHILNEITRSYSRILMNLEDELEELEDKLLAGYDREVMEKILGLRKTLVYFHKSLIANRDVLVLLKRKYLPITTKEDRENFEDLYYDTLQLIDMSATYREVLTSMMDITLSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
publication title Structural insights into the mechanisms of Mg2+ uptake, transport, and gating by CorA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4egwA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4egwA01
2BBJA 2BBHA 2IUBA 3RKGA 4EGWA 4EEDA 3NVOA 2HN2A 5JTGA 3NWIA 4EEBA 4I0UA 3CK6A 3JCFA 4EV6A 2HN1A
chains in the Genus database with same CATH superfamily
4JI2T 3WFQE 4JEUB 4CN1A 4ZI3D 3RJEA 3RJIA 5DABA 5CB1A 4BAYB 4PNIA 2ZH5A 5JR9B 4CZZB 2CEAA 4YTNA 5L2LA 4ZZCA 3GA8A 1XSPA 5HXEA 3JPNA 2LSYA 5HEHA 7ICMA 2PJQA 3UQ4A 2C0SA 4YSYA 3AU6A 3RC8A 3JAFA 4OYKA 5DDMA 2FJBA 3FZKB 2GAFD 1ZQQA 4IDPA 4X65T 5LHGB 2Z6EA 4Z91A 2E9XD 3CKDA 4WC7A 8ICLA 4FI5A 4HFCA 2MYSA 4ZOLE 1VOMA 4DOBA 4EEBA 4M9NA 9ICIA 4PHDA 9ICXA 4JI3T 3AE3A 2SPCA 4I27A 4OYJA 4EGWA 2KLQA 3VHLA 5DB8A 1MQ2A 3QNUA 2WB5A 4JI0T 4LF8T 3E0ZA 4CI1B 3K3OA 4WBYA 3Q2MA 1WFDA 1Z0PA 2V7LA 4TWFA 5J0QA 2V5CA 2LSGA 4XQ7A 8ICIA 2W0GA 3KBTA 5ABFB 3HKDE 4EOZB 4X4SA 4OHFA 4I2CA 3HI2A 3VRAA 4Z6EA 1T72A 7ICFA 5AQVB 4WBZA 4I2AA 3MA9A 2JQKA 5HXHA 3UUNA 9ICSA 9ICPA 1OWAA 3L8RA 2B76A 2W4XA 5HC9A 3OKQA 4ZI3C 4QXBB 4B3MT 2ZH9A 4EAHA 4FHXA 4PH5A 4PK4A 3IEEA 3C50A 3P4SA 4X1IE 3ETVA 4LEYA 3UFGA 1HR0T 4KLTA 3ZPOA 2XQ4A 5JDNA 8ICFA 4BJMA 4IGUA 3PUSA 4RPYA 1HTJF 2UXDT 1ZQLA 4ILUA 2XM1A 1I6ZA 3OWGA 2BS2A 2Q66A 2WZIA 4X62T 4QH4A 4E7ZA 3NKZA 4EZHA 4KLJA 2E9XC 3JZ0A 4I2DA 3FXEB 3PUYF 4DOAA 1VCTA 2LT3A 3J7Yq 1WOTA 3UXOA 1OEDB 1U4QA 5FKYA 4F5RA 4K97A 4LMLA 3NRYA 5LGUB 4LVSA 3AE2A 3MJXA 3V7LA 3RC3A 3AA6B 5DB6A 2EHOD 9ICCA 2JQHA 5J0ZA 4H9PC 3PUZF 4PFOA 2H7VC 4BA9A 3I9YA 4YSXA 2PBEA 3UXNA 1ZQTA 3FB2A 3WFOA 3CQGB 2WDQA 2LKGA 1HFAA 4PHEA 4O5KA 5L3EB 2NP9A 4KLEA 2XAJB 2XQ6A 2K24A 9ICMA 3PUXF 4HFVA 4NM2A 3WFRE 5HRFA 3T8OA 5CFSA 4KUMB 1CUNA 5FL1A 4O6AA 5AQRB 1KDHA 4TZ4C 5IIIA 3OYXA 2BG9E 1T8BA 2ZM0A 4KLSA 4M9HA 3P4RA 4U7YA 3FXDB 3ZT6A 4MFRA 4FH3A 5J0OA 9ICUA 1D0XA 2FBWA 5HXRA 4PJJA 2V6XA 3L9DA 3L09A 5J2JA 3PE0A 4RQ3A 3MK7C 4JEHB 4M9LA 1KFYA 4U7IA 8ICCA 3OYZA 2VASA 4WOYA 5LJMA 5DDYA 4UBBA 1J5ET 1BPYA 2UUBT 2QRXA 3LK2B 1BR4A 4DR2T 2WWUA 3ONXA 5ABEA 4IQTA 3QOFA 2WU5A 4LF5T 3H3MA 2NW8A 3C2MA 4O4LE 4IE7A 4K8VA 1ZQAA 3E22E 4MFAA 4NIQA 1WYCA 4GYSA 2IUBA 4LF9T 9ICOA 1MNEA 3AE7A 3ZMVB 5LHIB 2UUAT 5HEJA 1WR6A 4QZGA 2N1GA 2EHOC 2JQ9A 4U72A 2YU1A 2V6YB 1J5WA 5HYAA 2D9DA 4M1PA 5HHHA 3RF1A 2ES0A 4O4HE 2WS3A 4JI1T 4ZI2D 2MPKA 4UB2A 1N34T 2CPTA 5IYZE 5AQGB 1O3XA 1BR1A 4L9IA 7ICEA 1MMGA 3IF8B 3FHNA 7ICUA 4O2AE 4YD2A 1ZQOA 5LXTE 4KLGA 4QZ8A 3ZYLA 1WR0A 3OBVE 2NR4A 2LEHA 3I0QA 5HEOA 4I2EA 3K75D 4L5GA 4JLXA 1XSNA 4NXVA 3A5XA 1HG5A 3OGUA 4KI0F 2PFOA 2LLYA 4UVAB 4PW8A 8ICXA 5JDFA 4AQFC 3MGHA 4KMCA 4JLZA 3C5FA 3RHWA 1XNQT 3AE5A 2VKHA 5HEGA 4O5EA 1ZQPA 4WH5A 3KDSE 4UAYA 2PFQA 5B3PA 4QZEA 5CA7A 5CFTA 5D4BA 4FHYA 1VFGA 2G0UA 4YHJA 1D1CA 2DCFA 4ADZA 3N9NA 9ICBA 3BK9A 2FCLA 3UU3A 2UXNB 2V7JA 4YLHA 3HR0A 1YQ3A 2WZHA 3LK9A 1OEDC 4XAXB 2VVSA 4WC0A 1W9RA 3X1DA 4CI3B 5B3QA 2K9AA 3UQ2A 4ZI2C 1X9BA 3ZLIA 5KMGP 5J2KA 4HEAA 2K5BB 3ZJ1A 4S3NA 4X4QA 2M2VA 2X0HA 4HTEA 1VCSA 1OXZA 2XHEB 3SWHA 2IC9A 4YFSA 3AUOA 2XPKA 2CBIA 3VKGA 4KX6A 4Z8XA 5DB7A 4H9SE 3TLVA 4IDQA 2Y6XA 3HKEE 2NTXA 2WSSV 5LJNA 4DV7T 1ZJNA 1CHUA 3C5GA 3NVOA 5AQJB 3DTOA 3ESLA 4ISSA 4JI5T 7ICPA 1Q78A 5J2CA 5ETWA 5FY0A 1W0AA 5CWRA 2EHOA 4K9AA 2HPJA 4WC5A 4DV4T 4DV5T 3HIYA 2XM2A 7ICGA 2BE3A 3KINB 5CP2A 3UU4A 4NY8A 2GK9A 4P4MA 3CVRA 5M4YA 5FVLA 2HHHT 2D0UA 4UB3A 2ZM8A 1JNRA 5HAXA 4AISA 5J2BA 2CMRA 2V7MA 4H9QC 4K0UA 5AQKB 3ZMUB 5IHYA 4P2HA 2DLRA 5HHIA 4TUYE 4YD1A 5AQIB 5LP6E 1G73A 2NWBA 4AQGA 5D49A 2O1PA 1MIWA 3AQLA 2XUEA 3UULA 3TFSA 4LF4T 3I0OA 4JI7T 4JLEA 3G06A 3FBLA 5FXVA 1TFYA 2PTFA 5J1GA 2VB6A 4U74A 4YSZA 2PXIA 2C5JA 4WBNE 4M5DA 3RH4A 2E9XB 3ZMSB 2RFFA 4AQFA 1ZQMA 3LK42 1BPEA 4UELA 4UXNB 5J2IA 5CFBA 2BCQA 2WM9A 3N2GE 5H6QB 4JI4T 4KHPT 5HRGA 5AQQB 4DR1T 1BPZA 3C4ZA 2XQ8A 3H37A 2J47A 4X1YE 3AB3B 2A9UA 2VKOA 3OJAA 5LB7B 3M3ZB 4X20E 2KWHA 1KNYA 4IG8A 2BCUA 3ER8C 4GIWA 2VKDA 4U3CA 4QX8B 4KM5A 9ICNA 3UQ7A 7ICOA 4PGYA 2J4GA 2KZ7B 4UEMA 1V4AA 4EBJA 4IHJE 8ICEA 3F2EA 1OEDA 4P4PA 1DU2A 3AA0B 3B0YA 4X4UA 3H3AA 4PJLA 3OVSA 3UTKA 5F2VO 4MALA 3K8PC 1BR0A 2V26A 4NXNT 2IHR1 2W9MA 5DBCA 2FUPA 4PFPA 3ZN0B 4N7RA 4AKGA 5L3GB 2I59A 3PUGA 5KDMC 4NLNA 4F5NA 1NENA 4KLHA 5F5WA 4C90A 2D5UA 4IE6A 5J2UE 2B56A 4O68A 3RIAA 2UXCT 1F5AA 2BBHA 5HWXA 5J0SA 3RKOA 4WYVA 1GPJA 4QXCB 5LYJE 4ILCA 1KNRA 3PHZA 3C64A 4LFBT 1TV9A 4Z6CA 5JDHA 4YTMA 1RZTA 1XMOT 4AI6A 2FMQA 4GK5E 5FXXA 2IMLA 4RWOA 4HKAA 4PPXA 2UXXB 4GK0E 5BPCA 2BCRA 2WMNA 4JI8T 3SFEA 3Q5XA 4O8SA 3ANWA 4B3ST 4NUUA 4ILAA 2EHOB 5F8PA 3AXJB 5LOVE 4ZS3A 5IUXA 2MBGA 1QLBA 3T1HT 2ODUA 3HJ4A 8ICBA 2ID1A 3MDCA 2ZH4A 2LKHA 1WLXA 2DR5A 4PGXA 2O5AA 1E2AA 4KLUA 8ICGA 4P09A 5C8YE 1G8XA 4I55E 4JUYA 4K4IA 5J2DA 2V7KA 2Y48B 5A1LA 4U2ZA 4GXJA 1ZV4X 2ZM2A 2VURA 4QZAA 4HGAA 4M47A 1BR2A 2IAKA 5CHGA 4PGQA 2JMKA 3RH5A 1N32T 4P0AA 5AQPB 4K9BA 3NWIA 4WC1A 5L47A 2V6YA 3AECA 4EEDA 1D1AA 4FJOA 4HWDA 2UUCT 5CFUA 4IQWA 4WBOA 5HRKA 2ZH2A 5L3DB 5KXJA 2OA5A 3LFMA 4X64T 1FA0A 3FBZA 4AKIA 5AQNB 4WW0A 1E1HB 3HJ1A 4I2JA 4O5CA 7ICHA 2QGSA 3Q5DA 1ZQIA 3PMLA 1ZQHA 4RWQA 2UU9T 1MIVA 3JPPA 4WQLA 3QC9A 4M2YA 1QUUA 3R6NA 4IDOA 4X66T 2RP4A 4M0AA 4I4TE 5LHHB 3KVBA 2XAFB 3V7JA 8ICZA 3ISBA 4YMNA 3OVBA 4H63V 4NXZA 1JNZA 4AQYT 1WRDA 2J62A 4RQ2A 2LE8A 5J0TA 4KLIA 1HUOA 1N36T 1L0VA 2M2TA 4E8FA 2YN6A 3PJAJ 3QK6A 4IL9A 4OAFA 4TN7B 1LVKA 2RPAA 1HCIA 2XZEA 2Y8DA 3JCFA 5FP3A 4UB4A 2KSRA 2JQQA 4HX0A 3L39A 3EUHA 4XRHA 8ICWA 4HN9A 2W00A 4IE5A 4UIGA 3SOLA 3Q5WA 2GWSA 1ZQWA 1W0BA 4AT8A 2H3RA 1IBMT 3AA7B 5AFUL 3OTOT 4YXDA 1YD8G 3PUWF 4LF6T 2YINA 5LBMA 4TUQA 4NKUA 1YW0A 4MF2A 2W66A 2P66A 5J2EA 3RJJA 5H6RB 1BPBA 1HNXT 2YOEA 1FIOA 4ATBB 4X4VA 1HS7A 4YN4A 4DR6T 5L4HA 5BOLA 4GXKA 3PDYA 4DV3T 2LM2A 3ANWB 3H38A 2B4VA 5HRHA 2LSKA 3P8CD 5CB4E 3JPTA 4OFZA 4RT2A 3HKBE 4GOUA 1ZQSA 2X9XA 1ZQDA 1JQRA 3O1JA 2QYWA 4EXTA 3A7MA 2NTYA 4X1KE 5CHEA 2BG9C 1SUMB 2M2UA 2ACZA 3EDVA 4EYUA 3PV0F 3AVSA 3RPUA 1D0YA 3UQ0A 9ICAA 2K48A 8ICTA 2LRKA 5HCJA 4QKNA 5J0UA 4GXIA 3CPZA 2HHPA 2X9WA 2YK0A 3N9MA 4JWNA 5ABHA 4QH1A 1D0ZA 4TWHA 2XQ9A 5J0WA 9ICWA 3RRWA 7ICJA 2VVNA 3MBYA 4QZBA 4UB1A 3RJHA 1GQEA 5CJ5A 4RPZA 2JMHA 1R8AA 1QSDA 5HRLA 3KVAA 1UETA 4RQ4A 5HEUA 4QZ9A 3ZCIA 4DBQA 1R8CA 4NPPA 3FZLB 3K3QC 4ZEYA 1SA0E 3TLWA 1ZQRA 2LJLA 4H9OC 4YJ3E 2YDSA 4PHPA 2BZBA 4AIUA 1MNDA 3HKCE 4E7SA 4TV8E 5FL0A 5J0RA 3P4QA 4ANJA 4O69A 4I2IA 4QZDA 2YDRA 4RQ1A 1XWMA 3UXPA 1AJ3A 4TURA 3JAEA 2E9XA 3PUQA 3F57A 4RQ6A 2Q9QD 2ZH6A 3ER9B 3K1SA 2M6BA 7ICRA 3ZYKA 1S94A 3AA1B 9ICKA 2FJAA 4CQIA 4CXYA 4JV5T 3OVUA 3GMIA 2WCAA 4X4PA 4F5QA 3CQCB 5L3FB 4OAGA 4IT4A 2CBJA 3PU3A 5CGMA 3C18A 3JYYA 3QUJA 2A72A 2VKJA 3ZN1B 5BOMA 3RYFE 5JVDE 4PK6A 9ICEA 4CXWA 3ZSSA 2YDQA 3MKDA 3NKUA 2LSJA 5C2TA 3IHRA 5J2HA 4DV2T 3IA3A 2D0TA 4AT8B 3V5SA 4OK0A 4UB5A 4DUZT 4UVBB 4DR5T 3ZYMA 1UCUA 8ICAA 2KMFA 4Z6DA 3O9XA 3AEFA 3N2OA 2K3WA 3EAMA 4LEVA 4LEZA 3A8YC 3JPSA 4YJ2E 3AE9A 4QWNB 4IDZA 1KNPA 1MMNA 4X4OA 4X4TA 5DEDA 3RIUC 2X51A 4A98A 3MCRA 2IC6A 5LCYA 4DVDA 3B5MA 1HG2A 3SS1A 2RA1A 2B1EA 4FO1A 3VR9A 4LT6A 5D61A 4U33A 1ZQZA 4ASKA 5DBBA 4PK5A 3ERCC 4ZS2A 4NUVA 2AE9A 2CA5A 1B7TA 1FMWA 3N9OA 3RH6A 3LSVA 4HE8A 4H63H 4Z6FA 2BG9A 4LF7T 4GYRA 1ZQKA 2Q9QC 5AQSB 4P4OA 4QXHB 5J0PA 2I9GA 4WC3A 9ICLA 3BQLA 3C98B 2UXBT 3UPSA 4WC4A 2DRBA 8ICOA 2CHNA 5KX5E 4WCWA 2I0MA 3BQKA 4QZIA 3AXJA 3MZKB 3EVYA 5LG3A 1UURA 2CXFA 3ZJ2A 3PUVF 1ZJMA 3C4XA 5JRCA 4KLMA 4LEWA 3AE4A 5E0OA 4QZFA 4Q25A 3C66A 4YHHT 4KBMB 4ZI7E 4XZCA 1Q79A 8ICHA 2XQ7A 3ZC1A 4MBQA 4JBWF 2BKPA 1M7KA 2XQ3A 4YY3T 3PURA 3CX6B 4UBCA 2E8IA 5FYMA 4OAHA 4CN4A 1NEKA 3WI3A 3SRZA 4NLZA 3N9LA 4B3TT 4L0RA 2H7OA 3AAAB 2DI4A 5DBAA 3AAIA 4NXMT 2M67A 3RH3A 2H88A 5IIJA 1E7PA 5EK2A 2NRKA 4MKPA 1VRBA 4DV1T 1JN3A 3V5UA 1MQ3A 2V1DB 2BS3A 3ONLC 3RQUA 3DP7A 1J1JA 4TNVA 9ICFA 1Z8UA 3KFWX 2DR8A 1IBKT 2ZH8A 3I9WA 2KNDA 2VK9A 2XSBA 3UUXB 4KB6A 4HFEA 2D2SA 4P1NA 4DR7T 3PNCA 1ZQUA 2ACXA 1UEVA 3AQKA 5AQHB 3AEEA 3AEDA 1ZQEA 1XDOA 3RYIE 4V1Av 3VU7H 3NRXA 2BS4A 4DR4T 3ONJA 4G2AA 4AKHA 2M2WA 3K3NA 4GKKT 1UEUA 8ICKA 3CX8B 3CIRA 5EK4A 3LG7A 4O2BE 5HXCA 3UU6A 2ZHBA 2ISOA 3PMNA 3CX7B 3KBUA 2MAWA 9ICRA 4LFCT 9ICVA 2VQET 3UUBA 5CR0A 1ZQVA 5D46A 4ILBA 5FY7A 2WU2A 3RKGA 5J2GA 1SE7A 2XJ7A 3V72A 3AEAA 2P9BA 1LVFA 4K4HA 3TLUA 4AKLA 4R65A 3RIUA 4WQKA 4HWCA 2L8KA 2B51A 3ZMTB 4F5PA 3WAKA 3C2KA 5AQUB 1ZQFA 4MF8A 4UR9A 4ERRA 4HFDA 2HN2A 1EZ3A 4TX5A 2BPGA 2BPFA 3NZQA 4AXPA 2LOPA 2WQYA 8ICVA 4IDNA 1ZOYA 3HX0A 5AQLB 1YLQA 2XAQB 3D0TA 2DR7A 4HWIB 5C3JA 3O4XE 1ZP0A 3ISDA 5AQTB 2BG9B 2DR9A 3JADA 3IBPA 3ABVA 1SHZC 1ZQBA 2XAGB 5J0YA 2Q9QA 4OX9T 2IHOA 4FO6A 3RIFA 4ATBA 1LKXA 2ZH1A 2DL1A 1KK7A 2W62A 2CRBA 3J9X1 3RYCE 1WYBA 2MOZA 2CXLA 5AQOB 2E2AA 3RJGA 1HNZT 4NLKA 4NM1A 1ZQCA 3JPOA 3AVRA 4CN6A 4I2GA 1IBLT 2XQYA 4TUSA 4MHCA 4K99A 5JRCB 4H9RC 1ZKEA 3EF2A 1YQ4A 3UU5A 5DECA 4F8HA 2F4VT 1W09A 3O1IA 2PG8A 4UD4A 2WMOA 4YTPA 1ZHCA 4U2YA 7ICIA 2OV9A 9ICJA 2HN1A 5TZVA 3R84B 8ICPA 2AXDS 1BPXA 3P7IA 3AE1A 1U5PA 3RGLA 4DMWA 4GKJT 2MTQA 3KV6A 3LQCB 8ICJA 2LRLA 4KLQA 1TVAA 1NWMX 2JRKA 4QZCA 2OLTA 5LG4A 3P4WA 2W63A 2A3DA 1ZQGA 3WAJA 8ICRA 2KINB 2X9YA 3GDXA 1R8IA 8ICNA 4C91A 4FHPA 4I2FA 4XJEA 3RJFA 1ZEEA 4DO0A 1Y01A 4KLLA 2N9DA 4NXXA 5JDGA 4EP7A 2ZH7A 4ZXLA 5IIKA 3RI5A 4EBKA 4X0BA 4M9GA 3OPCA 4MFFA 1NO5A 3GN5B 5HWYA 4XBFB 5J0XA 3U78A 4FHWA 5DKWA 4AT7A 4HWFA 2DNXA 3TKLB 3OVAA 3LDQB 3Q5EA 4TUPA 5JH7E 4KLOA 4EB6E 2A2FX 3HWTA 7ICSA 3EDUA 4MFCA 3ZC0A 5J2AA 5L3BB 4UAZA 5FNVE 4RQ7A 3OUYA 2NW7A 5LGNB 4RWNA 1UX5A 1ZQNA 3AE8A 3LBXA 4DUYT 2CLYB 2C5KT 2PFPA 4I50E 4HFIA 1KF6A 3P4PA 4XA5A 1YXRA 5LGTB 3EHZA 4UV8B 4IQUA 3CWZB 2EWRA 4FH5A 1XDPA 2ZLYA 5GONE 2FJEA 4DMVA 7ICLA 1BPDA 3RYHE 3HL6A 3RX6A 3EABA 4I29A 2L3LA 2PFVA 3JPQA 2BKNA 4O67A 4PJNA 4WC6A 2X9HA 1JAJA 4AKRB 2BCSA 1KEYA 2I6HA 2CHOA 1HUZA 2E5VA 4O4IE 1ZQXA 3LJCA 3KV4A 5CJ7A 3AU2A 2DHRA 2Q9QB 3C4WA 2LM9A 2JIWA 3B0XA 4YMOA 2DVIA 3MDAA 2XTLA 2ODVA 4DIDB 3BQIA 1H7CA 5HR9A 3HA4A 3NBXX 3TLSA 1V9DA 3PTRB 1MMDA 1N33T 3F31A 4J2CA 5DQWA 5L3CB 2FMPA 4X5TA 2BVMA 3S4UA 4WZXA 2XASB 3UU8A 2YU2A 4I2HA 4R66A 5HXSA 3WFSC 1RPLA 4AT9A 1HX1B 3UFEA 1VJ7A 3OV7A 4IQVA 4X4RA 2V8SV 4UF0A 3FZHB 2H89A 1NAFA 1UK5A 5D62A 4IE0A 4TNWA 5JR9C 4ZZBA 4XQ8A 2XAHB 5HREA 4EIWA 2LOSA 1X79A 4E7XA 3JPRA 4QH5A 3GWHA 2WBLA 5LMUT 3FZMB 3DJBA 5FMNA 4NXUA 3MGIA 4F6RC 2WP9A 4KLFA 8ICYA 7ICVA 3VKHA 5IIMA 4O4JE 2GA9D 3U3IA 4LMKA 2JJ9A 5F3JA 3C51A 4CI2B 4IIJE 2X67A 2KXPB 2LHRA 4MLKA 3UT5E 2ZHAA 2BCVA 4K0KT 4UV9B 4HFBA 2CXDA 2R6GF 3B13A 4IE4A 1US7B 1KEJA 4WNKA 4G63A 2WY2A 2NW9A 5HCMA 5IILA 4JYAT 4K96A 4RPXA 5LA6E 4R64A 1ZQYA 4PHAA 4AT7B 1R8BA 1Y64B 5ABGA 3TLTA 1MMAA 4PJMA 5CA0E 1IAPA 1JMSA 7ICNA 3P50A 4HFHA 2V7IA 3N2KE 4X0AA 2XQ5A 3OUYB 5JDQA 2IW5B 4I43B 8ICMA 3LBXB 2BPCA 5J2TE 2DWGA 2QVAA 1LRZA 3SFDA 8ICSA 1ZQJA 1OEDE 1FJGT 2WDVA 2VWAA 4QZHA 1XMQT 2W2UA 3N5LA 3W15B 3JC6D 3N9QA 7ICKA 2YEVC 4R63A 5J29A 4TV9E 5J2FA 2FJDA 3VR8A 5LBQB 2WAUA 2LHNA 1OU5A 2CLYC 5JQGE 2BVLA 5ADXL 5BR8T 3MXZA 1IJ5A 3UPQA 1HX8A 3CMLA 2IHMA 4QX7B 4XUSA 4DBRA 2ZH3A 3QB5A 4I0UA 5AQMB 9ICHA 2BBJA 5L4EA 2BDEA 4FHVA 3PJAA 3L3PA 3UUMA 5FY1A 2VL8A 5IINA 3RJKA 3WFPA 3HW8A 4IL4A 4H9NC 4DOCA 1IZNB 1UUSA 4YT0A 1KNZA 4NXWA 3CK6A 4NXTA 4UVCB 3O1HA 2W61A 5IWAT 4N78D 2M6IA 2JPFA 4AT9B 3ETUA 5LMNT 2KT9A 5JTGA 4JWMA 4UF0B 5HRDA 1NOMA 4UD5A 4X5VA 3I1AA 3B57A 5HRBA 3ZCJA 1MIYA 5JR9A 4RQ5A 1T98A 2PBIA 4DO9A 1R89A 4K4GA 4I28A 2CCQA 3ZMZB 3RLFF 4RWPA 4RT3A 4QHOA 3K7DA 4LMJA 2PFNA 4OAIZ 4E80A 1T7SA 3ZT5A 4A56A 4RQ8A 4TWDA 2XQAA 2L9QA 2CWOA 1FMVA 5HRIA 9ICGA 3QB5K 9ICQA 3PU8A 2E5LT 3JC6C 1YKEB 2CE7A 3H39A 2CWYA 3E08A 2WWVA 2N2NA 4O9MA 4LZGA 2DRAA 3RQWA 5BMVE 4CXXA 5AQFB 5JDMA 4X4NA 2XSAA 4UAWA 5FVKA 4KHZF 4DNDA 2ZM6T 1IJ6A 2XY8B 4NKTA 5FXWA 5IIOA 1PX5A 5EOZA 1D1BA 4KLDA 3AQMA 5JDLA 7ICTA 3N9PA 3KV5A 3AE6A 1XZYA 4EV6A 9ICTA 4M04A 5D63A 2C5IT 4LFAT 2VANA 3V7KA 1FEWA 2X0LB 2V5DA 5ABFA 3ZEFB 4PAGA 3Q9DA 3KV9A 5LNKA 4A97A 4COFA 2WDRA 2ZMAA 3TFRA 4EYYR 3GN5A 4JI6T 8ICUA 3VRBA 3ZKRA 3CQXC 2J1DG 5TAOA 4M9JA 4K98A 3AAEB 4B6XA 3PUAA 4HWHA 4YMMA 3ZT7A 2LSIA 4U31A 3AQNA 2X68A 4ZHQE 1M62A 4ISTA 2X0YA 1UGOA 4DV0T 5EK3A 2NOXA 4DR3T 3ZSTA 2IIUA 5EZYE 3MACA 1HNWT 3RRCA 4YCXA 1XSLA 4B3RT 2IDOB 5JREA 2ISPA 1YKHB 4KP3C 1UX4A 4DV6T 2W67A 1HF8A 3NZPA 2DWKA 4LZDA 2KWIB 4Z90A 1XNRT 4BJNA 4EZ4A 3M65A 2HPLA 1I94T 4P0BA 2BKOA 8ICQA 5DJQC 4A5XA 2HH7A 2CM0A 3AEBA 1S35A 2FMSA 7ICQA 3NYBA 5DB9A 3EI0A 3C2LA 1WCRA 3LK3B 5CA1E 3ISCA 3FZFB 5FXZA 2X66A 2QA7A 5DQVA 3AEGA 4I2BA 4WC2A 2YKSA 4RQ0A 4IREA 2VL0A 4F5OA 1TFWA 3T1YT 2VQFT
chains in the Genus database with same CATH topology
2BBJA 2BBHA 2IUBA 3RKGA 4EGWA 4EEDA 3NVOA 2HN2A 5JTGA 3NWIA 4EEBA 4I0UA 3CK6A 3JCFA 4EV6A 2HN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBJ A;  2BBH A;  2IUB A;  3RKG A;  4EGW A;  4EED A;  3NVO A;  2HN2 A;  5JTG A;  3NWI A;  4EEB A;  4I0U A;  3CK6 A;  3JCF A;  4EV6 A;  2HN1 A; 
#chains in the Genus database with same CATH topology
 4JI2 T;  3WFQ E;  4JEU B;  4CN1 A;  4ZI3 D;  3RJE A;  3RJI A;  5DAB A;  5CB1 A;  4BAY B;  4PNI A;  2ZH5 A;  5JR9 B;  4CZZ B;  2CEA A;  4YTN A;  5L2L A;  4ZZC A;  3GA8 A;  1XSP A;  5HXE A;  3JPN A;  2LSY A;  5HEH A;  7ICM A;  2PJQ A;  3UQ4 A;  2C0S A;  4YSY A;  3AU6 A;  3RC8 A;  3JAF A;  4OYK A;  5DDM A;  2FJB A;  3FZK B;  2GAF D;  1ZQQ A;  4IDP A;  4X65 T;  5LHG B;  2Z6E A;  4Z91 A;  2E9X D;  3CKD A;  4WC7 A;  8ICL A;  4FI5 A;  4HFC A;  2MYS A;  4ZOL E;  1VOM A;  4DOB A;  4EEB A;  4M9N A;  9ICI A;  4PHD A;  9ICX A;  4JI3 T;  3AE3 A;  2SPC A;  4I27 A;  4OYJ A;  4EGW A;  2KLQ A;  3VHL A;  5DB8 A;  1MQ2 A;  3QNU A;  2WB5 A;  4JI0 T;  4LF8 T;  3E0Z A;  4CI1 B;  3K3O A;  4WBY A;  3Q2M A;  1WFD A;  1Z0P A;  2V7L A;  4TWF A;  5J0Q A;  2V5C A;  2LSG A;  4XQ7 A;  8ICI A;  2W0G A;  3KBT A;  5ABF B;  3HKD E;  4EOZ B;  4X4S A;  4OHF A;  4I2C A;  3HI2 A;  3VRA A;  4Z6E A;  1T72 A;  7ICF A;  5AQV B;  4WBZ A;  4I2A A;  3MA9 A;  2JQK A;  5HXH A;  3UUN A;  9ICS A;  9ICP A;  1OWA A;  3L8R A;  2B76 A;  2W4X A;  5HC9 A;  3OKQ A;  4ZI3 C;  4QXB B;  4B3M T;  2ZH9 A;  4EAH A;  4FHX A;  4PH5 A;  4PK4 A;  3IEE A;  3C50 A;  3P4S A;  4X1I E;  3ETV A;  4LEY A;  3UFG A;  1HR0 T;  4KLT A;  3ZPO A;  2XQ4 A;  5JDN A;  8ICF A;  4BJM A;  4IGU A;  3PUS A;  4RPY A;  1HTJ F;  2UXD T;  1ZQL A;  4ILU A;  2XM1 A;  1I6Z A;  3OWG A;  2BS2 A;  2Q66 A;  2WZI A;  4X62 T;  4QH4 A;  4E7Z A;  3NKZ A;  4EZH A;  4KLJ A;  2E9X C;  3JZ0 A;  4I2D A;  3FXE B;  3PUY F;  4DOA A;  1VCT A;  2LT3 A;  3J7Y q;  1WOT A;  3UXO A;  1OED B;  1U4Q A;  5FKY A;  4F5R A;  4K97 A;  4LML A;  3NRY A;  5LGU B;  4LVS A;  3AE2 A;  3MJX A;  3V7L A;  3RC3 A;  3AA6 B;  5DB6 A;  2EHO D;  9ICC A;  2JQH A;  5J0Z A;  4H9P C;  3PUZ F;  4PFO A;  2H7V C;  4BA9 A;  3I9Y A;  4YSX A;  2PBE A;  3UXN A;  1ZQT A;  3FB2 A;  3WFO A;  3CQG B;  2WDQ A;  2LKG A;  1HFA A;  4PHE A;  4O5K A;  5L3E B;  2NP9 A;  4KLE A;  2XAJ B;  2XQ6 A;  2K24 A;  9ICM A;  3PUX F;  4HFV A;  4NM2 A;  3WFR E;  5HRF A;  3T8O A;  5CFS A;  4KUM B;  1CUN A;  5FL1 A;  4O6A A;  5AQR B;  1KDH A;  4TZ4 C;  5III A;  3OYX A;  2BG9 E;  1T8B A;  2ZM0 A;  4KLS A;  4M9H A;  3P4R A;  4U7Y A;  3FXD B;  3ZT6 A;  4MFR A;  4FH3 A;  5J0O A;  9ICU A;  1D0X A;  2FBW A;  5HXR A;  4PJJ A;  2V6X A;  3L9D A;  3L09 A;  5J2J A;  3PE0 A;  4RQ3 A;  3MK7 C;  4JEH B;  4M9L A;  1KFY A;  4U7I A;  8ICC A;  3OYZ A;  2VAS A;  4WOY A;  5LJM A;  5DDY A;  4UBB A;  1J5E T;  1BPY A;  2UUB T;  2QRX A;  3LK2 B;  1BR4 A;  4DR2 T;  2WWU A;  3ONX A;  5ABE A;  4IQT A;  3QOF A;  2WU5 A;  4LF5 T;  3H3M A;  2NW8 A;  3C2M A;  4O4L E;  4IE7 A;  4K8V A;  1ZQA A;  3E22 E;  4MFA A;  4NIQ A;  1WYC A;  4GYS A;  2IUB A;  4LF9 T;  9ICO A;  1MNE A;  3AE7 A;  3ZMV B;  5LHI B;  2UUA T;  5HEJ A;  1WR6 A;  4QZG A;  2N1G A;  2EHO C;  2JQ9 A;  4U72 A;  2YU1 A;  2V6Y B;  1J5W A;  5HYA A;  2D9D A;  4M1P A;  5HHH A;  3RF1 A;  2ES0 A;  4O4H E;  2WS3 A;  4JI1 T;  4ZI2 D;  2MPK A;  4UB2 A;  1N34 T;  2CPT A;  5IYZ E;  5AQG B;  1O3X A;  1BR1 A;  4L9I A;  7ICE A;  1MMG A;  3IF8 B;  3FHN A;  7ICU A;  4O2A E;  4YD2 A;  1ZQO A;  5LXT E;  4KLG A;  4QZ8 A;  3ZYL A;  1WR0 A;  3OBV E;  2NR4 A;  2LEH A;  3I0Q A;  5HEO A;  4I2E A;  3K75 D;  4L5G A;  4JLX A;  1XSN A;  4NXV A;  3A5X A;  1HG5 A;  3OGU A;  4KI0 F;  2PFO A;  2LLY A;  4UVA B;  4PW8 A;  8ICX A;  5JDF A;  4AQF C;  3MGH A;  4KMC A;  4JLZ A;  3C5F A;  3RHW A;  1XNQ T;  3AE5 A;  2VKH A;  5HEG A;  4O5E A;  1ZQP A;  4WH5 A;  3KDS E;  4UAY A;  2PFQ A;  5B3P A;  4QZE A;  5CA7 A;  5CFT A;  5D4B A;  4FHY A;  1VFG A;  2G0U A;  4YHJ A;  1D1C A;  2DCF A;  4ADZ A;  3N9N A;  9ICB A;  3BK9 A;  2FCL A;  3UU3 A;  2UXN B;  2V7J A;  4YLH A;  3HR0 A;  1YQ3 A;  2WZH A;  3LK9 A;  1OED C;  4XAX B;  2VVS A;  4WC0 A;  1W9R A;  3X1D A;  4CI3 B;  5B3Q A;  2K9A A;  3UQ2 A;  4ZI2 C;  1X9B A;  3ZLI A;  5KMG P;  5J2K A;  4HEA A;  2K5B B;  3ZJ1 A;  4S3N A;  4X4Q A;  2M2V A;  2X0H A;  4HTE A;  1VCS A;  1OXZ A;  2XHE B;  3SWH A;  2IC9 A;  4YFS A;  3AUO A;  2XPK A;  2CBI A;  3VKG A;  4KX6 A;  4Z8X A;  5DB7 A;  4H9S E;  3TLV A;  4IDQ A;  2Y6X A;  3HKE E;  2NTX A;  2WSS V;  5LJN A;  4DV7 T;  1ZJN A;  1CHU A;  3C5G A;  3NVO A;  5AQJ B;  3DTO A;  3ESL A;  4ISS A;  4JI5 T;  7ICP A;  1Q78 A;  5J2C A;  5ETW A;  5FY0 A;  1W0A A;  5CWR A;  2EHO A;  4K9A A;  2HPJ A;  4WC5 A;  4DV4 T;  4DV5 T;  3HIY A;  2XM2 A;  7ICG A;  2BE3 A;  3KIN B;  5CP2 A;  3UU4 A;  4NY8 A;  2GK9 A;  4P4M A;  3CVR A;  5M4Y A;  5FVL A;  2HHH T;  2D0U A;  4UB3 A;  2ZM8 A;  1JNR A;  5HAX A;  4AIS A;  5J2B A;  2CMR A;  2V7M A;  4H9Q C;  4K0U A;  5AQK B;  3ZMU B;  5IHY A;  4P2H A;  2DLR A;  5HHI A;  4TUY E;  4YD1 A;  5AQI B;  5LP6 E;  1G73 A;  2NWB A;  4AQG A;  5D49 A;  2O1P A;  1MIW A;  3AQL A;  2XUE A;  3UUL A;  3TFS A;  4LF4 T;  3I0O A;  4JI7 T;  4JLE A;  3G06 A;  3FBL A;  5FXV A;  1TFY A;  2PTF A;  5J1G A;  2VB6 A;  4U74 A;  4YSZ A;  2PXI A;  2C5J A;  4WBN E;  4M5D A;  3RH4 A;  2E9X B;  3ZMS B;  2RFF A;  4AQF A;  1ZQM A;  3LK4 2;  1BPE A;  4UEL A;  4UXN B;  5J2I A;  5CFB A;  2BCQ A;  2WM9 A;  3N2G E;  5H6Q B;  4JI4 T;  4KHP T;  5HRG A;  5AQQ B;  4DR1 T;  1BPZ A;  3C4Z A;  2XQ8 A;  3H37 A;  2J47 A;  4X1Y E;  3AB3 B;  2A9U A;  2VKO A;  3OJA A;  5LB7 B;  3M3Z B;  4X20 E;  2KWH A;  1KNY A;  4IG8 A;  2BCU A;  3ER8 C;  4GIW A;  2VKD A;  4U3C A;  4QX8 B;  4KM5 A;  9ICN A;  3UQ7 A;  7ICO A;  4PGY A;  2J4G A;  2KZ7 B;  4UEM A;  1V4A A;  4EBJ A;  4IHJ E;  8ICE A;  3F2E A;  1OED A;  4P4P A;  1DU2 A;  3AA0 B;  3B0Y A;  4X4U A;  3H3A A;  4PJL A;  3OVS A;  3UTK A;  5F2V O;  4MAL A;  3K8P C;  1BR0 A;  2V26 A;  4NXN T;  2IHR 1;  2W9M A;  5DBC A;  2FUP A;  4PFP A;  3ZN0 B;  4N7R A;  4AKG A;  5L3G B;  2I59 A;  3PUG A;  5KDM C;  4NLN A;  4F5N A;  1NEN A;  4KLH A;  5F5W A;  4C90 A;  2D5U A;  4IE6 A;  5J2U E;  2B56 A;  4O68 A;  3RIA A;  2UXC T;  1F5A A;  2BBH A;  5HWX A;  5J0S A;  3RKO A;  4WYV A;  1GPJ A;  4QXC B;  5LYJ E;  4ILC A;  1KNR A;  3PHZ A;  3C64 A;  4LFB T;  1TV9 A;  4Z6C A;  5JDH A;  4YTM A;  1RZT A;  1XMO T;  4AI6 A;  2FMQ A;  4GK5 E;  5FXX A;  2IML A;  4RWO A;  4HKA A;  4PPX A;  2UXX B;  4GK0 E;  5BPC A;  2BCR A;  2WMN A;  4JI8 T;  3SFE A;  3Q5X A;  4O8S A;  3ANW A;  4B3S T;  4NUU A;  4ILA A;  2EHO B;  5F8P A;  3AXJ B;  5LOV E;  4ZS3 A;  5IUX A;  2MBG A;  1QLB A;  3T1H T;  2ODU A;  3HJ4 A;  8ICB A;  2ID1 A;  3MDC A;  2ZH4 A;  2LKH A;  1WLX A;  2DR5 A;  4PGX A;  2O5A A;  1E2A A;  4KLU A;  8ICG A;  4P09 A;  5C8Y E;  1G8X A;  4I55 E;  4JUY A;  4K4I A;  5J2D A;  2V7K A;  2Y48 B;  5A1L A;  4U2Z A;  4GXJ A;  1ZV4 X;  2ZM2 A;  2VUR A;  4QZA A;  4HGA A;  4M47 A;  1BR2 A;  2IAK A;  5CHG A;  4PGQ A;  2JMK A;  3RH5 A;  1N32 T;  4P0A A;  5AQP B;  4K9B A;  3NWI A;  4WC1 A;  5L47 A;  2V6Y A;  3AEC A;  4EED A;  1D1A A;  4FJO A;  4HWD A;  2UUC T;  5CFU A;  4IQW A;  4WBO A;  5HRK A;  2ZH2 A;  5L3D B;  5KXJ A;  2OA5 A;  3LFM A;  4X64 T;  1FA0 A;  3FBZ A;  4AKI A;  5AQN B;  4WW0 A;  1E1H B;  3HJ1 A;  4I2J A;  4O5C A;  7ICH A;  2QGS A;  3Q5D A;  1ZQI A;  3PML A;  1ZQH A;  4RWQ A;  2UU9 T;  1MIV A;  3JPP A;  4WQL A;  3QC9 A;  4M2Y A;  1QUU A;  3R6N A;  4IDO A;  4X66 T;  2RP4 A;  4M0A A;  4I4T E;  5LHH B;  3KVB A;  2XAF B;  3V7J A;  8ICZ A;  3ISB A;  4YMN A;  3OVB A;  4H63 V;  4NXZ A;  1JNZ A;  4AQY T;  1WRD A;  2J62 A;  4RQ2 A;  2LE8 A;  5J0T A;  4KLI A;  1HUO A;  1N36 T;  1L0V A;  2M2T A;  4E8F A;  2YN6 A;  3PJA J;  3QK6 A;  4IL9 A;  4OAF A;  4TN7 B;  1LVK A;  2RPA A;  1HCI A;  2XZE A;  2Y8D A;  3JCF A;  5FP3 A;  4UB4 A;  2KSR A;  2JQQ A;  4HX0 A;  3L39 A;  3EUH A;  4XRH A;  8ICW A;  4HN9 A;  2W00 A;  4IE5 A;  4UIG A;  3SOL A;  3Q5W A;  2GWS A;  1ZQW A;  1W0B A;  4AT8 A;  2H3R A;  1IBM T;  3AA7 B;  5AFU L;  3OTO T;  4YXD A;  1YD8 G;  3PUW F;  4LF6 T;  2YIN A;  5LBM A;  4TUQ A;  4NKU A;  1YW0 A;  4MF2 A;  2W66 A;  2P66 A;  5J2E A;  3RJJ A;  5H6R B;  1BPB A;  1HNX T;  2YOE A;  1FIO A;  4ATB B;  4X4V A;  1HS7 A;  4YN4 A;  4DR6 T;  5L4H A;  5BOL A;  4GXK A;  3PDY A;  4DV3 T;  2LM2 A;  3ANW B;  3H38 A;  2B4V A;  5HRH A;  2LSK A;  3P8C D;  5CB4 E;  3JPT A;  4OFZ A;  4RT2 A;  3HKB E;  4GOU A;  1ZQS A;  2X9X A;  1ZQD A;  1JQR A;  3O1J A;  2QYW A;  4EXT A;  3A7M A;  2NTY A;  4X1K E;  5CHE A;  2BG9 C;  1SUM B;  2M2U A;  2ACZ A;  3EDV A;  4EYU A;  3PV0 F;  3AVS A;  3RPU A;  1D0Y A;  3UQ0 A;  9ICA A;  2K48 A;  8ICT A;  2LRK A;  5HCJ A;  4QKN A;  5J0U A;  4GXI A;  3CPZ A;  2HHP A;  2X9W A;  2YK0 A;  3N9M A;  4JWN A;  5ABH A;  4QH1 A;  1D0Z A;  4TWH A;  2XQ9 A;  5J0W A;  9ICW A;  3RRW A;  7ICJ A;  2VVN A;  3MBY A;  4QZB A;  4UB1 A;  3RJH A;  1GQE A;  5CJ5 A;  4RPZ A;  2JMH A;  1R8A A;  1QSD A;  5HRL A;  3KVA A;  1UET A;  4RQ4 A;  5HEU A;  4QZ9 A;  3ZCI A;  4DBQ A;  1R8C A;  4NPP A;  3FZL B;  3K3Q C;  4ZEY A;  1SA0 E;  3TLW A;  1ZQR A;  2LJL A;  4H9O C;  4YJ3 E;  2YDS A;  4PHP A;  2BZB A;  4AIU A;  1MND A;  3HKC E;  4E7S A;  4TV8 E;  5FL0 A;  5J0R A;  3P4Q A;  4ANJ A;  4O69 A;  4I2I A;  4QZD A;  2YDR A;  4RQ1 A;  1XWM A;  3UXP A;  1AJ3 A;  4TUR A;  3JAE A;  2E9X A;  3PUQ A;  3F57 A;  4RQ6 A;  2Q9Q D;  2ZH6 A;  3ER9 B;  3K1S A;  2M6B A;  7ICR A;  3ZYK A;  1S94 A;  3AA1 B;  9ICK A;  2FJA A;  4CQI A;  4CXY A;  4JV5 T;  3OVU A;  3GMI A;  2WCA A;  4X4P A;  4F5Q A;  3CQC B;  5L3F B;  4OAG A;  4IT4 A;  2CBJ A;  3PU3 A;  5CGM A;  3C18 A;  3JYY A;  3QUJ A;  2A72 A;  2VKJ A;  3ZN1 B;  5BOM A;  3RYF E;  5JVD E;  4PK6 A;  9ICE A;  4CXW A;  3ZSS A;  2YDQ A;  3MKD A;  3NKU A;  2LSJ A;  5C2T A;  3IHR A;  5J2H A;  4DV2 T;  3IA3 A;  2D0T A;  4AT8 B;  3V5S A;  4OK0 A;  4UB5 A;  4DUZ T;  4UVB B;  4DR5 T;  3ZYM A;  1UCU A;  8ICA A;  2KMF A;  4Z6D A;  3O9X A;  3AEF A;  3N2O A;  2K3W A;  3EAM A;  4LEV A;  4LEZ A;  3A8Y C;  3JPS A;  4YJ2 E;  3AE9 A;  4QWN B;  4IDZ A;  1KNP A;  1MMN A;  4X4O A;  4X4T A;  5DED A;  3RIU C;  2X51 A;  4A98 A;  3MCR A;  2IC6 A;  5LCY A;  4DVD A;  3B5M A;  1HG2 A;  3SS1 A;  2RA1 A;  2B1E A;  4FO1 A;  3VR9 A;  4LT6 A;  5D61 A;  4U33 A;  1ZQZ A;  4ASK A;  5DBB A;  4PK5 A;  3ERC C;  4ZS2 A;  4NUV A;  2AE9 A;  2CA5 A;  1B7T A;  1FMW A;  3N9O A;  3RH6 A;  3LSV A;  4HE8 A;  4H63 H;  4Z6F A;  2BG9 A;  4LF7 T;  4GYR A;  1ZQK A;  2Q9Q C;  5AQS B;  4P4O A;  4QXH B;  5J0P A;  2I9G A;  4WC3 A;  9ICL A;  3BQL A;  3C98 B;  2UXB T;  3UPS A;  4WC4 A;  2DRB A;  8ICO A;  2CHN A;  5KX5 E;  4WCW A;  2I0M A;  3BQK A;  4QZI A;  3AXJ A;  3MZK B;  3EVY A;  5LG3 A;  1UUR A;  2CXF A;  3ZJ2 A;  3PUV F;  1ZJM A;  3C4X A;  5JRC A;  4KLM A;  4LEW A;  3AE4 A;  5E0O A;  4QZF A;  4Q25 A;  3C66 A;  4YHH T;  4KBM B;  4ZI7 E;  4XZC A;  1Q79 A;  8ICH A;  2XQ7 A;  3ZC1 A;  4MBQ A;  4JBW F;  2BKP A;  1M7K A;  2XQ3 A;  4YY3 T;  3PUR A;  3CX6 B;  4UBC A;  2E8I A;  5FYM A;  4OAH A;  4CN4 A;  1NEK A;  3WI3 A;  3SRZ A;  4NLZ A;  3N9L A;  4B3T T;  4L0R A;  2H7O A;  3AAA B;  2DI4 A;  5DBA A;  3AAI A;  4NXM T;  2M67 A;  3RH3 A;  2H88 A;  5IIJ A;  1E7P A;  5EK2 A;  2NRK A;  4MKP A;  1VRB A;  4DV1 T;  1JN3 A;  3V5U A;  1MQ3 A;  2V1D B;  2BS3 A;  3ONL C;  3RQU A;  3DP7 A;  1J1J A;  4TNV A;  9ICF A;  1Z8U A;  3KFW X;  2DR8 A;  1IBK T;  2ZH8 A;  3I9W A;  2KND A;  2VK9 A;  2XSB A;  3UUX B;  4KB6 A;  4HFE A;  2D2S A;  4P1N A;  4DR7 T;  3PNC A;  1ZQU A;  2ACX A;  1UEV A;  3AQK A;  5AQH B;  3AEE A;  3AED A;  1ZQE A;  1XDO A;  3RYI E;  4V1A v;  3VU7 H;  3NRX A;  2BS4 A;  4DR4 T;  3ONJ A;  4G2A A;  4AKH A;  2M2W A;  3K3N A;  4GKK T;  1UEU A;  8ICK A;  3CX8 B;  3CIR A;  5EK4 A;  3LG7 A;  4O2B E;  5HXC A;  3UU6 A;  2ZHB A;  2ISO A;  3PMN A;  3CX7 B;  3KBU A;  2MAW A;  9ICR A;  4LFC T;  9ICV A;  2VQE T;  3UUB A;  5CR0 A;  1ZQV A;  5D46 A;  4ILB A;  5FY7 A;  2WU2 A;  3RKG A;  5J2G A;  1SE7 A;  2XJ7 A;  3V72 A;  3AEA A;  2P9B A;  1LVF A;  4K4H A;  3TLU A;  4AKL A;  4R65 A;  3RIU A;  4WQK A;  4HWC A;  2L8K A;  2B51 A;  3ZMT B;  4F5P A;  3WAK A;  3C2K A;  5AQU B;  1ZQF A;  4MF8 A;  4UR9 A;  4ERR A;  4HFD A;  2HN2 A;  1EZ3 A;  4TX5 A;  2BPG A;  2BPF A;  3NZQ A;  4AXP A;  2LOP A;  2WQY A;  8ICV A;  4IDN A;  1ZOY A;  3HX0 A;  5AQL B;  1YLQ A;  2XAQ B;  3D0T A;  2DR7 A;  4HWI B;  5C3J A;  3O4X E;  1ZP0 A;  3ISD A;  5AQT B;  2BG9 B;  2DR9 A;  3JAD A;  3IBP A;  3ABV A;  1SHZ C;  1ZQB A;  2XAG B;  5J0Y A;  2Q9Q A;  4OX9 T;  2IHO A;  4FO6 A;  3RIF A;  4ATB A;  1LKX A;  2ZH1 A;  2DL1 A;  1KK7 A;  2W62 A;  2CRB A;  3J9X 1;  3RYC E;  1WYB A;  2MOZ A;  2CXL A;  5AQO B;  2E2A A;  3RJG A;  1HNZ T;  4NLK A;  4NM1 A;  1ZQC A;  3JPO A;  3AVR A;  4CN6 A;  4I2G A;  1IBL T;  2XQY A;  4TUS A;  4MHC A;  4K99 A;  5JRC B;  4H9R C;  1ZKE A;  3EF2 A;  1YQ4 A;  3UU5 A;  5DEC A;  4F8H A;  2F4V T;  1W09 A;  3O1I A;  2PG8 A;  4UD4 A;  2WMO A;  4YTP A;  1ZHC A;  4U2Y A;  7ICI A;  2OV9 A;  9ICJ A;  2HN1 A;  5TZV A;  3R84 B;  8ICP A;  2AXD S;  1BPX A;  3P7I A;  3AE1 A;  1U5P A;  3RGL A;  4DMW A;  4GKJ T;  2MTQ A;  3KV6 A;  3LQC B;  8ICJ A;  2LRL A;  4KLQ A;  1TVA A;  1NWM X;  2JRK A;  4QZC A;  2OLT A;  5LG4 A;  3P4W A;  2W63 A;  2A3D A;  1ZQG A;  3WAJ A;  8ICR A;  2KIN B;  2X9Y A;  3GDX A;  1R8I A;  8ICN A;  4C91 A;  4FHP A;  4I2F A;  4XJE A;  3RJF A;  1ZEE A;  4DO0 A;  1Y01 A;  4KLL A;  2N9D A;  4NXX A;  5JDG A;  4EP7 A;  2ZH7 A;  4ZXL A;  5IIK A;  3RI5 A;  4EBK A;  4X0B A;  4M9G A;  3OPC A;  4MFF A;  1NO5 A;  3GN5 B;  5HWY A;  4XBF B;  5J0X A;  3U78 A;  4FHW A;  5DKW A;  4AT7 A;  4HWF A;  2DNX A;  3TKL B;  3OVA A;  3LDQ B;  3Q5E A;  4TUP A;  5JH7 E;  4KLO A;  4EB6 E;  2A2F X;  3HWT A;  7ICS A;  3EDU A;  4MFC A;  3ZC0 A;  5J2A A;  5L3B B;  4UAZ A;  5FNV E;  4RQ7 A;  3OUY A;  2NW7 A;  5LGN B;  4RWN A;  1UX5 A;  1ZQN A;  3AE8 A;  3LBX A;  4DUY T;  2CLY B;  2C5K T;  2PFP A;  4I50 E;  4HFI A;  1KF6 A;  3P4P A;  4XA5 A;  1YXR A;  5LGT B;  3EHZ A;  4UV8 B;  4IQU A;  3CWZ B;  2EWR A;  4FH5 A;  1XDP A;  2ZLY A;  5GON E;  2FJE A;  4DMV A;  7ICL A;  1BPD A;  3RYH E;  3HL6 A;  3RX6 A;  3EAB A;  4I29 A;  2L3L A;  2PFV A;  3JPQ A;  2BKN A;  4O67 A;  4PJN A;  4WC6 A;  2X9H A;  1JAJ A;  4AKR B;  2BCS A;  1KEY A;  2I6H A;  2CHO A;  1HUZ A;  2E5V A;  4O4I E;  1ZQX A;  3LJC A;  3KV4 A;  5CJ7 A;  3AU2 A;  2DHR A;  2Q9Q B;  3C4W A;  2LM9 A;  2JIW A;  3B0X A;  4YMO A;  2DVI A;  3MDA A;  2XTL A;  2ODV A;  4DID B;  3BQI A;  1H7C A;  5HR9 A;  3HA4 A;  3NBX X;  3TLS A;  1V9D A;  3PTR B;  1MMD A;  1N33 T;  3F31 A;  4J2C A;  5DQW A;  5L3C B;  2FMP A;  4X5T A;  2BVM A;  3S4U A;  4WZX A;  2XAS B;  3UU8 A;  2YU2 A;  4I2H A;  4R66 A;  5HXS A;  3WFS C;  1RPL A;  4AT9 A;  1HX1 B;  3UFE A;  1VJ7 A;  3OV7 A;  4IQV A;  4X4R A;  2V8S V;  4UF0 A;  3FZH B;  2H89 A;  1NAF A;  1UK5 A;  5D62 A;  4IE0 A;  4TNW A;  5JR9 C;  4ZZB A;  4XQ8 A;  2XAH B;  5HRE A;  4EIW A;  2LOS A;  1X79 A;  4E7X A;  3JPR A;  4QH5 A;  3GWH A;  2WBL A;  5LMU T;  3FZM B;  3DJB A;  5FMN A;  4NXU A;  3MGI A;  4F6R C;  2WP9 A;  4KLF A;  8ICY A;  7ICV A;  3VKH A;  5IIM A;  4O4J E;  2GA9 D;  3U3I A;  4LMK A;  2JJ9 A;  5F3J A;  3C51 A;  4CI2 B;  4IIJ E;  2X67 A;  2KXP B;  2LHR A;  4MLK A;  3UT5 E;  2ZHA A;  2BCV A;  4K0K T;  4UV9 B;  4HFB A;  2CXD A;  2R6G F;  3B13 A;  4IE4 A;  1US7 B;  1KEJ A;  4WNK A;  4G63 A;  2WY2 A;  2NW9 A;  5HCM A;  5IIL A;  4JYA T;  4K96 A;  4RPX A;  5LA6 E;  4R64 A;  1ZQY A;  4PHA A;  4AT7 B;  1R8B A;  1Y64 B;  5ABG A;  3TLT A;  1MMA A;  4PJM A;  5CA0 E;  1IAP A;  1JMS A;  7ICN A;  3P50 A;  4HFH A;  2V7I A;  3N2K E;  4X0A A;  2XQ5 A;  3OUY B;  5JDQ A;  2IW5 B;  4I43 B;  8ICM A;  3LBX B;  2BPC A;  5J2T E;  2DWG A;  2QVA A;  1LRZ A;  3SFD A;  8ICS A;  1ZQJ A;  1OED E;  1FJG T;  2WDV A;  2VWA A;  4QZH A;  1XMQ T;  2W2U A;  3N5L A;  3W15 B;  3JC6 D;  3N9Q A;  7ICK A;  2YEV C;  4R63 A;  5J29 A;  4TV9 E;  5J2F A;  2FJD A;  3VR8 A;  5LBQ B;  2WAU A;  2LHN A;  1OU5 A;  2CLY C;  5JQG E;  2BVL A;  5ADX L;  5BR8 T;  3MXZ A;  1IJ5 A;  3UPQ A;  1HX8 A;  3CML A;  2IHM A;  4QX7 B;  4XUS A;  4DBR A;  2ZH3 A;  3QB5 A;  4I0U A;  5AQM B;  9ICH A;  2BBJ A;  5L4E A;  2BDE A;  4FHV A;  3PJA A;  3L3P A;  3UUM A;  5FY1 A;  2VL8 A;  5IIN A;  3RJK A;  3WFP A;  3HW8 A;  4IL4 A;  4H9N C;  4DOC A;  1IZN B;  1UUS A;  4YT0 A;  1KNZ A;  4NXW A;  3CK6 A;  4NXT A;  4UVC B;  3O1H A;  2W61 A;  5IWA T;  4N78 D;  2M6I A;  2JPF A;  4AT9 B;  3ETU A;  5LMN T;  2KT9 A;  5JTG A;  4JWM A;  4UF0 B;  5HRD A;  1NOM A;  4UD5 A;  4X5V A;  3I1A A;  3B57 A;  5HRB A;  3ZCJ A;  1MIY A;  5JR9 A;  4RQ5 A;  1T98 A;  2PBI A;  4DO9 A;  1R89 A;  4K4G A;  4I28 A;  2CCQ A;  3ZMZ B;  3RLF F;  4RWP A;  4RT3 A;  4QHO A;  3K7D A;  4LMJ A;  2PFN A;  4OAI Z;  4E80 A;  1T7S A;  3ZT5 A;  4A56 A;  4RQ8 A;  4TWD A;  2XQA A;  2L9Q A;  2CWO A;  1FMV A;  5HRI A;  9ICG A;  3QB5 K;  9ICQ A;  3PU8 A;  2E5L T;  3JC6 C;  1YKE B;  2CE7 A;  3H39 A;  2CWY A;  3E08 A;  2WWV A;  2N2N A;  4O9M A;  4LZG A;  2DRA A;  3RQW A;  5BMV E;  4CXX A;  5AQF B;  5JDM A;  4X4N A;  2XSA A;  4UAW A;  5FVK A;  4KHZ F;  4DND A;  2ZM6 T;  1IJ6 A;  2XY8 B;  4NKT A;  5FXW A;  5IIO A;  1PX5 A;  5EOZ A;  1D1B A;  4KLD A;  3AQM A;  5JDL A;  7ICT A;  3N9P A;  3KV5 A;  3AE6 A;  1XZY A;  4EV6 A;  9ICT A;  4M04 A;  5D63 A;  2C5I T;  4LFA T;  2VAN A;  3V7K A;  1FEW A;  2X0L B;  2V5D A;  5ABF A;  3ZEF B;  4PAG A;  3Q9D A;  3KV9 A;  5LNK A;  4A97 A;  4COF A;  2WDR A;  2ZMA A;  3TFR A;  4EYY R;  3GN5 A;  4JI6 T;  8ICU A;  3VRB A;  3ZKR A;  3CQX C;  2J1D G;  5TAO A;  4M9J A;  4K98 A;  3AAE B;  4B6X A;  3PUA A;  4HWH A;  4YMM A;  3ZT7 A;  2LSI A;  4U31 A;  3AQN A;  2X68 A;  4ZHQ E;  1M62 A;  4IST A;  2X0Y A;  1UGO A;  4DV0 T;  5EK3 A;  2NOX A;  4DR3 T;  3ZST A;  2IIU A;  5EZY E;  3MAC A;  1HNW T;  3RRC A;  4YCX A;  1XSL A;  4B3R T;  2IDO B;  5JRE A;  2ISP A;  1YKH B;  4KP3 C;  1UX4 A;  4DV6 T;  2W67 A;  1HF8 A;  3NZP A;  2DWK A;  4LZD A;  2KWI B;  4Z90 A;  1XNR T;  4BJN A;  4EZ4 A;  3M65 A;  2HPL A;  1I94 T;  4P0B A;  2BKO A;  8ICQ A;  5DJQ C;  4A5X A;  2HH7 A;  2CM0 A;  3AEB A;  1S35 A;  2FMS A;  7ICQ A;  3NYB A;  5DB9 A;  3EI0 A;  3C2L A;  1WCR A;  3LK3 B;  5CA1 E;  3ISC A;  3FZF B;  5FXZ A;  2X66 A;  2QA7 A;  5DQV A;  3AEG A;  4I2B A;  4WC2 A;  2YKS A;  4RQ0 A;  4IRE A;  2VL0 A;  4F5O A;  1TFW A;  3T1Y T;  2VQF T; 
#chains in the Genus database with same CATH homology
 2BBJ A;  2BBH A;  2IUB A;  3RKG A;  4EGW A;  4EED A;  3NVO A;  2HN2 A;  5JTG A;  3NWI A;  4EEB A;  4I0U A;  3CK6 A;  3JCF A;  4EV6 A;  2HN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...