4EGWA

The structure of the soluble domain of cora from methanocaldococcus jannaschii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
b'MITVIAIAKDGSIVEPKLDEISFEDYRLIWIDCYDPKDEELYKLSKKIGISVSDLQIGLDEQEIPRVEEDEDFYLIIYKAPLFEEDITTTSLGIYIKNNLLLTIHSDKIKAIGRLHKLISTKKPRIVFERGIGFLLYHILNEITRSYSRILMNLEDELEELEDKLLAGYDREVMEKILGLRKTLVYFHKSLIANRDVLVLLKRKYLPITTKEDRENFEDLYYDTLQLIDMSATYREVLTSMMDITLSLEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural insights into the mechanisms of Mg2+ uptake, transport, and gating by CorA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4egwA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4egwA01
3NVOA 4EEDA 3CK6A 2BBJA 4EEBA 4EV6A 2BBHA 2IUBA 4EGWA 2HN2A 3JCFA 3NWIA 3RKGA 5JTGA 4I0UA 2HN1A
chains in the Genus database with same CATH superfamily
2ZLYA 4UBBA 5J0UA 4B3TT 2L8KA 2X67A 3IBPA 3ZMVB 3AA6B 4YTPA 3VR8A 1W09A 1ZV4X 2WAUA 4LZDA 3P4PA 1F5AA 2EWRA 4QZAA 2PFNA 4UEMA 3SFEA 4JWNA 2PFOA 2D2SA 2CWYA 4QX7B 5KX5E 2XQ4A 2V7LA 3P4QA 2DCFA 3KV5A 3ZYKA 4RQ1A 1QLBA 2WU2A 8ICTA 2ZH8A 2VURA 4KLUA 3HW8A 1ZOYA 3EABA 8ICQA 4IDOA 3D0TA 3RKGA 3RPUA 4M9LA 2BPGA 3HI2A 3AE6A 4LFBT 2MTQA 2CLYB 1XSPA 2LSJA 4DOBA 2JMHA 3QOFA 9ICWA 5C2TA 2IHR1 2LKGA 4X1IE 3B5MA 5F8PA 1ZKEA 5FVLA 4TNVA 3UULA 2VL8A 4XZCA 3JPQA 4PGYA 5HAXA 1ZQEA 1HG2A 4JI5T 4ZS2A 4I29A 2YOEA 3TFSA 2PBIA 1R89A 5D62A 3EDVA 4LVSA 2WM9A 4QZDA 5KMGP 4KLGA 4AI6A 5HWXA 3V7JA 5DDYA 4UELA 1HF8A 5HCJA 3N2KE 5LGTB 3RLFF 3MGIA 3FXEB 3LK2B 4UVBB 4PAGA 4X4VA 2VL0A 2Y8DA 3Q5EA 2H89A 2XSBA 1N34T 4XQ8A 2HN1A 5J2CA 5C8YE 2BBHA 1MQ3A 4TWHA 2CXLA 2XASB 4ZI3D 4X4TA 3C50A 4FH3A 2NW8A 7ICMA 3AXJA 3MA9A 4WC3A 3HR0A 3J7Yq 1XSLA 4V1Av 2B4VA 3MDAA 3MK7C 2CCQA 2LSKA 1YD8G 3AUOA 3AAIA 3B57A 2WCAA 2M6IA 4DO9A 3AVRA 4NM1A 2XM2A 5J2HA 3UU5A 4KUMB 5D63A 4HTEA 5HRBA 4Q25A 3VRBA 3ONLC 4Z6CA 3BQIA 2PFPA 5C3JA 3HJ4A 5JTGA 2E2AA 5AQQB 3AEEA 3K7DA 5CWRA 4BJMA 1TVAA 3CQXC 1SUMB 2UXXB 1UCUA 4NLZA 1WLXA 3QB5K 2UXBT 2YDQA 3J9X1 2VQFT 5AQFB 1XDOA 1YKHB 2X9WA 2YK0A 5FL0A 3KVAA 3QNUA 1FEWA 2M2VA 3C4WA 1W9RA 3C18A 4ISTA 4Z8XA 2BG9E 2K24A 4LMJA 1UK5A 2BCSA 5ABHA 4DMVA 2CLYC 2HN2A 3ZT5A 2G0UA 1KEYA 4PHEA 4I2DA 2W00A 4ILUA 3ZN1B 4HFHA 4YTMA 5F3JA 4MLKA 4EYYR 4CN6A 3NVOA 4AXPA 4ATBA 4JI6T 4PK5A 4E8FA 4JWMA 2DLRA 5J0TA 4NXXA 5H6QB 1VJ7A 3ETUA 1QSDA 3FZHB 4JUYA 4RQ4A 1MMNA 2K5BB 5LHIB 3PTRB 1L0VA 1T8BA 2ZH3A 4AKIA 1BR0A 5L47A 1TV9A 2V8SV 2XSAA 4KM5A 5HCMA 2LOSA 4GXIA 5EK2A 2WDRA 4GKJT 2CBIA 5DQWA 2LHNA 3PV0F 3TLTA 4EZ4A 5IIIA 1IAPA 2IAKA 1VRBA 1XMQT 4P4MA 5J2DA 1NO5A 2DWGA 4MF8A 4RWQA 2YEVC 3NRXA 4DV4T 2DNXA 2CM0A 2BG9C 3HX0A 4P09A 5CA0E 1HFAA 4AQFC 2ISOA 4X0BA 4UV9B 1UETA 2DRAA 3P4SA 5BPCA 5DB7A 3RQUA 2NP9A 5ADXL 1BPZA 3RGLA 3PMNA 3UUMA 2GA9D 4GYSA 7ICNA 4PH5A 4TWFA 3DTOA 4X65T 8ICRA 4RQ6A 5F2VO 3W15B 2ZHBA 5JDQA 5HXHA 1ZQMA 2CWOA 4KLIA 4M1PA 1XNRT 2CA5A 4DV7T 2BS2A 3P50A 2LKHA 3UQ4A 3ER9B 4DR5T 2UUCT 5DDMA 1HG5A 4BAYB 5J2UE 2XAHB 2VWAA 3MJXA 2A9UA 3RI5A 2ZH2A 4FHPA 5JDMA 3NZPA 4HN9A 3KV6A 1U4QA 4DV2T 2WWUA 4PPXA 3GDXA 5L3CB 3AU2A 4IG8A 1UX4A 4B6XA 3JCFA 3WFQE 4CXWA 5IINA 4WC1A 1JMSA 4NLNA 5CJ5A 1US7B 4DV3T 4JI3T 4WZXA 2X0LB 5JDGA 5HXCA 5LGUB 2M2TA 2X51A 4AT9A 3ETVA 4TURA 2JQQA 4MBQA 4X62T 4IL4A 4DOCA 4DV6T 4K9AA 5IIMA 4YJ2E 2CHOA 5LG3A 3NYBA 3AEFA 5JDNA 2L9QA 2ZH1A 3HIYA 5CA7A 5LXTE 2XQ8A 5DKWA 4PFPA 1B7TA 3FHNA 2BPCA 2FUPA 3C51A 4TX5A 3H37A 1M7KA 3I9WA 5HEHA 4DR3T 3VKHA 5J2JA 4YT0A 1IZNB 3CQGB 1ZQHA 1PX5A 7ICSA 2XUEA 2ZM2A 3AVSA 3C4ZA 5LHGB 3ZEFB 3O9XA 2LM2A 5EK4A 3N9OA 4O6AA 1LRZA 3CPZA 3Q2MA 2CXFA 1ZQQA 4EOZB 4O8SA 3LG7A 1KNZA 7ICIA 2QYWA 4WC7A 4HFCA 4E7SA 3UUNA 9ICHA 3UU4A 3ZT6A 5AQHB 1MNDA 1KEJA 4WOYA 4K4GA 3OPCA 2BG9A 3ZJ1A 2QRXA 3AEDA 1OEDE 1ZQSA 1LKXA 1IJ5A 2ZM8A 5JREA 4EAHA 5LG4A 3K8PC 7ICOA 5IUXA 2WSSV 3IEEA 4YN4A 2E9XB 5J0SA 2V1DB 5DECA 1ZQIA 3H38A 5HXRA 5J2EA 3UQ0A 3HJ1A 2YN6A 4QZGA 4UB2A 1HNXT 2DHRA 2HHHT 2RA1A 3AEGA 3UXOA 2ZH6A 4R66A 4M47A 9ICUA 4MFRA 1J5ET 3AE5A 4B3ST 2A3DA 4P4OA 9ICOA 2MYSA 3MACA 3UFGA 4ZHQE 4DV0T 1ZQKA 3JPSA 4OAHA 2M2WA 4YD1A 2N9DA 3SOLA 5DB6A 2IHMA 2VVSA 1MNEA 5BMVE 4O2AE 3EI0A 1MMGA 3AE9A 4PGQA 1ZQGA 2NTYA 2ODUA 4X1YE 1NENA 3T8OA 5LOVE 2HHPA 3QK6A 4O4IE 1YW0A 4AKHA 3BK9A 2XAFB 4U3CA 3UU3A 4RQ0A 3FZMB 4JYAT 4X5TA 2W2UA 4H63H 4ANJA 9ICSA 1KDHA 5FKYA 5HC9A 4M9HA 5HWYA 3ZYLA 1LVKA 4PJMA 1KNRA 3ZPOA 5CFUA 4HFVA 2LHRA 2N2NA 5FP3A 3MDCA 5L2LA 4EZHA 1CHUA 1T72A 3FBZA 4I0UA 4AT7B 4I2JA 2JRKA 4NUVA 2BE3A 4M9GA 3BQLA 4TV8E 3B13A 4NXZA 5J0WA 4IQWA 2WY2A 2ZM0A 3Q5XA 1JAJA 3JC6C 4X0AA 3AE8A 4U2YA 2HH7A 3OJAA 4IL9A 4LEYA 3PDYA 4JI8T 4LF9T 2VANA 8ICEA 4QZEA 4YSXA 2BZBA 2VKHA 5HRHA 4E7ZA 5CR0A 2JQHA 4UV8B 1UX5A 4QX8B 5FY1A 2M2UA 3X1DA 1SHZC 2LM9A 2P9BA 5IHYA 4JI0T 5D46A 4LMKA 2QVAA 9ICGA 5CFTA 1HNWT 2VKOA 8ICPA 4A97A 1R8CA 3JAEA 3RH3A 4F6RC 4QZBA 5CA1E 3GN5B 2IIUA 2KZ7B 2XAGB 3Q9DA 2K48A 4AT8B 2NOXA 1FIOA 5AQMB 2BS4A 4LF6T 4I28A 4HFBA 3UXPA 1TFWA 5AQIB 4O67A 5IIKA 1HUZA 4QKNA 1ZQYA 8ICKA 3ZC0A 4IQTA 4MALA 3N9NA 1H7CA 4CXYA 3ONJA 3RC3A 4I27A 3ABVA 3AAEB 4UD4A 2MPKA 1ZQDA 3V5SA 3ZCIA 3T1YT 5L3FB 4IE0A 5AFUL 5J0XA 4DBQA 5F5WA 5AQLB 3C5GA 3ZSTA 4HWIB 5L4EA 2LRKA 3OVAA 2WMOA 3B0YA 4KP3C 4ASKA 2JPFA 5JR9B 9ICJA 1ZQLA 4YLHA 1G8XA 2HPLA 4HWHA 4IGUA 5EK3A 4CN4A 2O5AA 4LFCT 2W4XA 3ZMZB 5JRCB 9ICAA 5LJMA 4ILCA 2MAWA 2X9XA 3E08A 3L8RA 2WBLA 2QA7A 1OEDA 2Q9QB 3AEBA 2I9GA 1D1CA 2W0GA 4LFAT 3JZ0A 5CB4E 1MIWA 5AQVB 5LJNA 4QH4A 2DR5A 2VKJA 4UIGA 4CZZB 2OA5A 5J2IA 2IUBA 2XAJB 1UURA 2Q66A 2XQ9A 1E2AA 4G63A 1HX1B 2A72A 4H9PC 2W66A 3TLWA 4B3RT 2C5JA 2C5KT 4F5QA 3AAAB 4UAZA 4ZI7E 1OU5A 5LBMA 4H9NC 1ZQWA 4IDQA 5LNKA 3N9LA 3LK42 1V9DA 2VK9A 4LMLA 3TLUA 2D0UA 3HL6A 4R63A 4I2EA 1NEKA 4TN7B 3OUYB 2ES0A 5FXVA 1JQRA 1XZYA 3U78A 4HWDA 2PXIA 4XJEA 3AQKA 2PFQA 1ZQZA 4HE8A 4RQ3A 4XQ7A 2LEHA 3UPSA 3ANWB 4NXTA 2F4VT 2UUAT 7ICTA 3MCRA 4YY3T 2KMFA 4QXBB 4AKLA 8ICLA 3SS1A 3LK3B 2FJEA 4EEDA 2CPTA 2WQYA 2I0MA 3RH4A 3UPQA 3RIAA 4CN1A 3BQKA 4AISA 3ERCC 1QUUA 1V4AA 2FJDA 4DUZT 4OK0A 3WFOA 8ICJA 2YDRA 3PUWF 3C2LA 4I43B 2WMNA 3L09A 5DJQC 4YMNA 4K97A 4GOUA 2M6BA 4M9NA 4CQIA 2KSRA 4LEZA 4IE6A 3ISDA 4OHFA 1KNPA 2E5VA 3TKLB 3KV9A 4HX0A 8ICUA 4YTNA 4UF0B 3T1HT 3IHRA 4M0AA 4DR1T 4WYVA 5JDLA 5HRDA 4HGAA 3UT5E 5J0OA 1IJ6A 3LDQB 2V5CA 3KDSE 2RFFA 2XQAA 1JNRA 4DUYT 2KNDA 8ICGA 2XTLA 4H63V 5ABFB 2Q9QC 4XBFB 2OLTA 4FO6A 3ZJ2A 3ZT7A 4LF8T 3OVUA 3ER8C 4IDZA 2C5IT 1FMWA 2EHOB 4WC6A 3L9DA 4CI1B 3LBXB 4X4QA 5HYAA 4U72A 4DR7T 4Z6FA 1I94T 3TLVA 3VU7H 4IE7A 8ICIA 3P7IA 3QB5A 4IE4A 2W61A 3V5UA 1U5PA 3PUQA 3FZFB 4A56A 3RJHA 3AECA 3FXDB 2V6YA 3N2GE 4PHAA 9ICEA 3E0ZA 3RJEA 3A5XA 5J0QA 4YD2A 4L0RA 2LE8A 3F2EA 5BR8T 5AQTB 5FYMA 5CJ7A 3OKQA 4XA5A 2PJQA 4H9SE 2KWHA 3PUSA 2LLYA 3O1JA 3AA0B 3NBXX 5ABEA 3RJKA 1Y64B 2CXDA 4GK5E 1WRDA 1VFGA 3C64A 4DBRA 2ZH5A 3TLSA 4YCXA 5BOLA 3EHZA 2VQET 3OGUA 2NWBA 4CI3B 4NXWA 4H9OC 3OVSA 4KLOA 4O4LE 8ICOA 4DR2T 5ABGA 2XPKA 5AQKB 3CX6B 1HNZT 4QZCA 4IDPA 4EYUA 1T7SA 3KBTA 3AE7A 3ISCA 1IBLT 1D0XA 4ZI3C 3AE3A 2NR4A 2WZIA 3JADA 1IBMT 4TV9E 2DL1A 5FL1A 2W9MA 1ZQOA 9ICRA 3UTKA 4UBCA 4AKGA 4HFEA 3CK6A 5KDMC 2X9YA 4ISSA 4U2ZA 2V5DA 8ICYA 4O5CA 5AQSB 4UR9A 3JC6D 4RQ2A 1X79A 1M62A 2H88A 4EEBA 4FHYA 2DWKA 4KLQA 4HWFA 8ICVA 3F31A 1VCSA 2D5UA 4E80A 3PHZA 4PK4A 3PNCA 3FZKB 2EHOC 1ZJNA 4KX6A 3KV4A 4UB4A 2K3WA 7ICQA 5FNVE 2PFVA 2VKDA 1YQ4A 4WCWA 4IQUA 2SPCA 5JDFA 5HEGA 3JPPA 4DNDA 3C2KA 4OX9T 2BVLA 5EZYE 4I2FA 4KLSA 3C5FA 4RPYA 3DJBA 3R84B 4KLEA 1Q78A 4X4OA 4JLZA 3GA8A 5L3EB 2UXCT 3IF8B 4WNKA 2WS3A 5DB8A 1Z8UA 5J2BA 5LMUT 2LRLA 4XAXB 5E0OA 1SE7A 4GIWA 4J2CA 3PUGA 2ZM6T 2X66A 4KLHA 2CEAA 4X20E 4M9JA 2JQ9A 3I0OA 1KFYA 1WR0A 4PJJA 3ZC1A 2DVIA 4M04A 4DO0A 1GQEA 4S3NA 5B3PA 2B1EA 2ODVA 4UD5A 1BR4A 4MFCA 4AQFA 3AE4A 1HR0T 2BKOA 3C4XA 5BOMA 7ICLA 5J2KA 4PFOA 3UXNA 2VASA 3AXJB 3M3ZB 2UUBT 3AE2A 3ONXA 4ILAA 3E22E 3OWGA 5EOZA 3VKGA 4X66T 4MFFA 8ICBA 9ICNA 1VCTA 1XMOT 3HA4A 4NXVA 4JLEA 3AQLA 1R8AA 8ICNA 5HHIA 1BR1A 3C2MA 4NXNT 3PUAA 4LF4T 4KHZF 4U74A 5JQGE 3RC8A 2IMLA 2BS3A 2I6HA 4I2GA 5JDHA 3HKEE 3OBVE 2LSIA 4I2IA 5CP2A 5AQJB 5L3DB 4KLTA 3ZKRA 3RYCE 4LT6A 4E7XA 4R65A 2AXDS 3RYHE 7ICFA 2OV9A 2LT3A 3NKUA 2KWIB 2A2FX 5CFBA 3I9YA 4I2HA 5DBAA 3V72A 4FH5A 4KLDA 4DVDA 3RKOA 2V7JA 4N7RA 4YMOA 2JJ9A 3JPNA 3K3QC 5LBQB 3RQWA 2V6XA 3PJAJ 4COFA 4AQGA 1NAFA 4DIDB 5HEOA 1S94A 4IDNA 9ICXA 5LYJE 1RPLA 3JPTA 4H9RC 3HKCE 9ICQA 4X4UA 4HEAA 4K98A 2DR9A 1HCIA 2IDOB 2MOZA 4WC4A 4FHXA 2H3RA 1BPYA 2XY8B 4PHDA 2ZHAA 4ATBB 3PE0A 2ID1A 2B56A 4OAIZ 3SWHA 5HEJA 2XJ7A 4QH1A 8ICXA 3RH5A 2X0YA 2WWVA 2X68A 4X4NA 3V7KA 4F5NA 2RP4A 3JAFA 4PHPA 4WC5A 3UQ7A 4JEHB 4K0UA 4JI1T 3RJFA 4OYJA 4QXCB 3Q5WA 3KINB 3NKZA 4NXUA 1ZJMA 4ZI2C 4FO1A 4JBWF 1Z0PA 1ZQUA 8ICCA 4UVCB 2CRBA 7ICUA 4EB6E 1E7PA 4G2AA 5JH7E 2GWSA 3JPRA 1MMAA 2E9XC 5D61A 4NIQA 1JNZA 3OTOT 2MBGA 4K4HA 5HRLA 3RJGA 3AE1A 3C98B 1N32T 3WAKA 5FXXA 4YMMA 4P1NA 4QZ8A 3LK9A 2WU5A 4HWCA 3OYXA 3CQCB 4TZ4C 9ICKA 2IC6A 3G06A 5H6RB 4K9BA 2FJAA 2WDQA 1CUNA 4K4IA 4P0AA 1W0AA 2Q9QD 3A8YC 2XHEB 4YXDA 2ZH4A 2JIWA 5DEDA 3ZSSA 4TWDA 4YHJA 3ZN0B 2CMRA 8ICWA 3H39A 5LCYA 5HR9A 2NRKA 3L39A 2LSGA 2W67A 5FY7A 3RJIA 2HPJA 2KINB 4YFSA 4LF7T 1ZHCA 3WI3A 3HKBE 4WC2A 3MXZA 1I6ZA 2J4GA 4FHWA 4AT9B 5J2TE 3WFPA 3I0QA 4PNIA 1UEUA 3RIFA 4RPZA 4RQ8A 3ZYMA 3EAMA 4BJNA 2YU2A 4UB5A 5DABA 4TNWA 4KHPT 1WCRA 3R6NA 2B51A 1ZQAA 8ICAA 3IA3A 4O5EA 2O1PA 5D4BA 4Z6EA 4X64T 7ICPA 3SRZA 4R64A 2LOPA 8ICHA 2FJBA 4PJLA 4O5KA 5DB9A 5AQRB 2P66A 4JEUB 4ZXLA 5HRFA 4A98A 2JMKA 4X4PA 4GYRA 3PUVF 2LSYA 4WQKA 4KLLA 3MKDA 2PG8A 1NWMX 2VVNA 4KI0F 2YDSA 1UGOA 3UU6A 3ZMTB 5L4HA 4O4JE 1XDPA 4PW8A 4UAWA 5CHEA 2B76A 3CKDA 4I4TE 2PTFA 3HWTA 4F5OA 3AB3B 3ZMUB 4AIUA 4JV5T 1ZQVA 4RWNA 4GK0E 3S4UA 2E8IA 5IIJA 3F57A 4UXNB 3WFRE 4HFIA 1ZQJA 1OXZA 2XZEA 4KMCA 3CX8B 5DBBA 2BG9B 3UUXB 1Y01A 2UXNB 3FBLA 5J0ZA 7ICVA 7ICJA 4EV6A 4RQ5A 3LQCB 2UXDT 2E9XA 2XQ3A 3KFWX 2H7VC 4ZZBA 2IC9A 4I2AA 2I59A 3O4XE 4H9QC 4QH5A 4U31A 3UFEA 2NW7A 3RYFE 3AQNA 2BCRA 4P2HA 5J2AA 7ICHA 2V26A 7ICEA 4O9MA 9ICPA 2BKPA 3MBYA 4JI4T 5HXSA 7ICRA 4OAFA 1X9BA 5IIOA 2EHOD 4MF2A 3AEAA 3WAJA 2YKSA 2PBEA 4M2YA 1HX8A 2ACXA 1R8IA 1T98A 5IILA 1ZP0A 1ZQPA 4U7YA 2DRBA 5JR9C 2BKNA 4C90A 1MQ2A 2XQYA 3B0XA 4QWNB 4ZOLE 3RYIE 1N33T 4UB3A 5AQGB 4WBYA 4X5VA 1ZQTA 1KNYA 4RQ7A 2ZMAA 3CWZB 1D0ZA 1Q79A 4N78D 4RT3A 2KLQA 4PGXA 4P4PA 2CHNA 3H3MA 1HUOA 3DP7A 4HFDA 4I55E 5TZVA 2J62A 4C91A 5KXJA 1XNQT 5CGMA 4P0BA 2BBJA 1JN3A 3N9QA 4K0KT 4AT7A 2QGSA 5A1LA 5M4YA 2CE7A 5LP6E 3K1SA 3PUXF 4DR6T 4JI7T 4LEWA 1LVFA 2WZHA 1G73A 4OFZA 5FXZA 2VB6A 1W0BA 4FHVA 2WB5A 4U7IA 1BR2A 3ESLA 2BCQA 3RIUC 1YLQA 4ADZA 4NKUA 2ACZA 5J2GA 2Z6EA 1MMDA 3KBUA 5L3GB 2FBWA 3AA7B 4IT4A 2J47A 4LF5T 4RPXA 2LJLA 4KBMB 5JVDE 4B3MT 3GMIA 3CIRA 1ZQBA 3HKDE 4GKKT 4X1KE 3ZLIA 2X0HA 4WC0A 4IREA 4GXKA 4MFAA 4WBOA 4O4HE 3VR9A 2GAFD 4TUQA 3FZLB 2FMQA 5AQPB 4YSYA 1RZTA 9ICVA 4RT2A 3GWHA 4TUYE 4O2BE 3PURA 7ICKA 4U33A 1HS7A 3MGHA 4JLXA 3GN5A 5J0RA 4WH5A 5LGNB 3PUZF 5IYZE 4AT8A 2FCLA 3SFDA 4EBJA 1BPDA 4X4RA 5LA6E 3RX6A 2KT9A 4A5XA 1WR6A 5HRIA 4QHOA 4WBZA 3U3IA 5HRKA 4RWPA 3EF2A 4L9IA 3EUHA 1ZQNA 3KVBA 4GXJA 2D0TA 1OWAA 3AQMA 4UB1A 1NOMA 1IBKT 3MZKB 1E1HB 1BPEA 5FMNA 4XRHA 3CX7B 2ISPA 2XQ7A 9ICFA 5AQNB 2K9AA 1GPJA 1ZQCA 4ILBA 4UVAB 2XQ5A 3K3NA 4UAYA 3NRYA 1KK7A 1XSNA 3N9PA 2FMPA 1ZQRA 2V7MA 5JR9A 4MKPA 2DI4A 2NW9A 4DMWA 3LJCA 1MIYA 3PU8A 4K99A 1MIVA 5JRCA 1WOTA 3N5LA 2AE9A 3WFSC 1YQ3A 2Q9QA 5TAOA 3LSVA 3H3AA 4ZI2D 4QZHA 2DR7A 1OEDB 1WYBA 8ICSA 1FA0A 3CMLA 4Z6DA 8ICZA 4K96A 2BPFA 5FXWA 2GK9A 3OVBA 2NTXA 4PK6A 4AKRB 4EBKA 2E9XD 3ZMSB 3OV7A 3I1AA 5DBCA 3VHLA 2RPAA 2V7KA 3AA1B 4ZZCA 4HKAA 4NM2A 4WQLA 8ICMA 3PMLA 2FMSA 4LZGA 4NXMT 1UUSA 4BA9A 4YSZA 4F8HA 3EVYA 3RIUA 4DV1T 4OAGA 3UQ2A 2ZH7A 1J5WA 9ICIA 4NLKA 3OUYA 1SA0E 1EZ3A 1FMVA 2YINA 1R8BA 5IWAT 4PJNA 4NUUA 4L5GA 2WP9A 3RHWA 3P4WA 1KF6A 4QZ9A 3ANWA 4FJOA 2JQKA 9ICBA 4KLJA 3UU8A 5LHHB 4I50E 3TFRA 3K75D 4QZIA 4KLFA 5DQVA 3Q5DA 1DU2A 2W63A 4IQVA 4EGWA 5CFSA 3QC9A 3P8CD 4QXHB 5LB7B 3PUYF 1D1AA 3FB2A 3QUJA 1FJGT 2L3LA 4FI5A 1ZQFA 9ICLA 4I2CA 1WFDA 4Z90A 4F5PA 4JI2T 4EIWA 9ICMA 3RRWA 5J1GA 5ETWA 1N36T 2X9HA 1HTJF 2H7OA 4KB6A 5HREA 5CHGA 2W62A 1YKEB 4IHJE 3JYYA 4XUSA 4TUSA 5HXEA 3RRCA 5AQUB 4YJ3E 5J0PA 3ISBA 4UF0A 4KLMA 2BCUA 3V7LA 4WW0A 3NWIA 4ERRA 4F5RA 2YU1A 4EXTA 1BPXA 3A7MA 1J1JA 1ZEEA 3CVRA 4ZS3A 4DR4T 2IW5B 1WYCA 3AU6A 3M65A 5J0YA 4WBNE 2J1DG 2XAQB 5ABFA 3NZQA 5L3BB 3OYZA 4IE5A 7ICGA 3ZCJA 4NKTA 4M5DA 1OEDC 5LMNT 2BCVA 1D1BA 4O68A 3JPOA 5GONE 3LFMA 1YXRA 2EHOA 9ICCA 5D49A 4I2BA 3LBXA 3N9MA 3EDUA 4TUPA 3O1IA 3C66A 4IIJE 4ZEYA 2WDVA 3RF1A 4LEVA 3UUBA 1D0YA 2Y6XA 4CXXA 2R6GF 5FY0A 4CI2B 2ZH9A 2KXPB 4Z91A 5FVKA 4YHHT 2V6YB 2Y48B 4K8VA 1VOMA 2C0SA 3O1HA 1XWMA 5J2FA 5HRGA 1UEVA 2IHOA 3VRAA 3PU3A 2BDEA 5AQOB 4DOAA 1ZQXA 5CB1A 2E5LT 9ICTA 2CBJA 5HHHA 1TFYA 3RJJA 2XQ6A 3P4RA 3N2OA 1AJ3A 4MHCA 2BVMA 2N1GA 4OYKA 1O3XA 4QZFA 2V7IA 3K3OA 2D9DA 2DR8A 2UU9T 1BPBA 5B3QA 4NPPA 4EP7A 4AQYT 1S35A 2M67A 2XM1A 3PJAA 3RH6A 8ICFA 4DV5T 4NY8A 5HEUA 4X4SA 5J29A 3L3PA 4RWOA 4O69A
chains in the Genus database with same CATH topology
3NVOA 4EEDA 3CK6A 2BBJA 4EEBA 4EV6A 2BBHA 2IUBA 4EGWA 2HN2A 3JCFA 3NWIA 3RKGA 5JTGA 4I0UA 2HN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVO A;  4EED A;  3CK6 A;  2BBJ A;  4EEB A;  4EV6 A;  2BBH A;  2IUB A;  4EGW A;  2HN2 A;  3JCF A;  3NWI A;  3RKG A;  5JTG A;  4I0U A;  2HN1 A; 
#chains in the Genus database with same CATH topology
 2ZLY A;  4UBB A;  5J0U A;  4B3T T;  2L8K A;  2X67 A;  3IBP A;  3ZMV B;  3AA6 B;  4YTP A;  3VR8 A;  1W09 A;  1ZV4 X;  2WAU A;  4LZD A;  3P4P A;  1F5A A;  2EWR A;  4QZA A;  2PFN A;  4UEM A;  3SFE A;  4JWN A;  2PFO A;  2D2S A;  2CWY A;  4QX7 B;  5KX5 E;  2XQ4 A;  2V7L A;  3P4Q A;  2DCF A;  3KV5 A;  3ZYK A;  4RQ1 A;  1QLB A;  2WU2 A;  8ICT A;  2ZH8 A;  2VUR A;  4KLU A;  3HW8 A;  1ZOY A;  3EAB A;  8ICQ A;  4IDO A;  3D0T A;  3RKG A;  3RPU A;  4M9L A;  2BPG A;  3HI2 A;  3AE6 A;  4LFB T;  2MTQ A;  2CLY B;  1XSP A;  2LSJ A;  4DOB A;  2JMH A;  3QOF A;  9ICW A;  5C2T A;  2IHR 1;  2LKG A;  4X1I E;  3B5M A;  5F8P A;  1ZKE A;  5FVL A;  4TNV A;  3UUL A;  2VL8 A;  4XZC A;  3JPQ A;  4PGY A;  5HAX A;  1ZQE A;  1HG2 A;  4JI5 T;  4ZS2 A;  4I29 A;  2YOE A;  3TFS A;  2PBI A;  1R89 A;  5D62 A;  3EDV A;  4LVS A;  2WM9 A;  4QZD A;  5KMG P;  4KLG A;  4AI6 A;  5HWX A;  3V7J A;  5DDY A;  4UEL A;  1HF8 A;  5HCJ A;  3N2K E;  5LGT B;  3RLF F;  3MGI A;  3FXE B;  3LK2 B;  4UVB B;  4PAG A;  4X4V A;  2VL0 A;  2Y8D A;  3Q5E A;  2H89 A;  2XSB A;  1N34 T;  4XQ8 A;  2HN1 A;  5J2C A;  5C8Y E;  2BBH A;  1MQ3 A;  4TWH A;  2CXL A;  2XAS B;  4ZI3 D;  4X4T A;  3C50 A;  4FH3 A;  2NW8 A;  7ICM A;  3AXJ A;  3MA9 A;  4WC3 A;  3HR0 A;  3J7Y q;  1XSL A;  4V1A v;  2B4V A;  3MDA A;  3MK7 C;  2CCQ A;  2LSK A;  1YD8 G;  3AUO A;  3AAI A;  3B57 A;  2WCA A;  2M6I A;  4DO9 A;  3AVR A;  4NM1 A;  2XM2 A;  5J2H A;  3UU5 A;  4KUM B;  5D63 A;  4HTE A;  5HRB A;  4Q25 A;  3VRB A;  3ONL C;  4Z6C A;  3BQI A;  2PFP A;  5C3J A;  3HJ4 A;  5JTG A;  2E2A A;  5AQQ B;  3AEE A;  3K7D A;  5CWR A;  4BJM A;  1TVA A;  3CQX C;  1SUM B;  2UXX B;  1UCU A;  4NLZ A;  1WLX A;  3QB5 K;  2UXB T;  2YDQ A;  3J9X 1;  2VQF T;  5AQF B;  1XDO A;  1YKH B;  2X9W A;  2YK0 A;  5FL0 A;  3KVA A;  3QNU A;  1FEW A;  2M2V A;  3C4W A;  1W9R A;  3C18 A;  4IST A;  4Z8X A;  2BG9 E;  2K24 A;  4LMJ A;  1UK5 A;  2BCS A;  5ABH A;  4DMV A;  2CLY C;  2HN2 A;  3ZT5 A;  2G0U A;  1KEY A;  4PHE A;  4I2D A;  2W00 A;  4ILU A;  3ZN1 B;  4HFH A;  4YTM A;  5F3J A;  4MLK A;  4EYY R;  4CN6 A;  3NVO A;  4AXP A;  4ATB A;  4JI6 T;  4PK5 A;  4E8F A;  4JWM A;  2DLR A;  5J0T A;  4NXX A;  5H6Q B;  1VJ7 A;  3ETU A;  1QSD A;  3FZH B;  4JUY A;  4RQ4 A;  1MMN A;  2K5B B;  5LHI B;  3PTR B;  1L0V A;  1T8B A;  2ZH3 A;  4AKI A;  1BR0 A;  5L47 A;  1TV9 A;  2V8S V;  2XSA A;  4KM5 A;  5HCM A;  2LOS A;  4GXI A;  5EK2 A;  2WDR A;  4GKJ T;  2CBI A;  5DQW A;  2LHN A;  3PV0 F;  3TLT A;  4EZ4 A;  5III A;  1IAP A;  2IAK A;  1VRB A;  1XMQ T;  4P4M A;  5J2D A;  1NO5 A;  2DWG A;  4MF8 A;  4RWQ A;  2YEV C;  3NRX A;  4DV4 T;  2DNX A;  2CM0 A;  2BG9 C;  3HX0 A;  4P09 A;  5CA0 E;  1HFA A;  4AQF C;  2ISO A;  4X0B A;  4UV9 B;  1UET A;  2DRA A;  3P4S A;  5BPC A;  5DB7 A;  3RQU A;  2NP9 A;  5ADX L;  1BPZ A;  3RGL A;  3PMN A;  3UUM A;  2GA9 D;  4GYS A;  7ICN A;  4PH5 A;  4TWF A;  3DTO A;  4X65 T;  8ICR A;  4RQ6 A;  5F2V O;  3W15 B;  2ZHB A;  5JDQ A;  5HXH A;  1ZQM A;  2CWO A;  4KLI A;  4M1P A;  1XNR T;  2CA5 A;  4DV7 T;  2BS2 A;  3P50 A;  2LKH A;  3UQ4 A;  3ER9 B;  4DR5 T;  2UUC T;  5DDM A;  1HG5 A;  4BAY B;  5J2U E;  2XAH B;  2VWA A;  3MJX A;  2A9U A;  3RI5 A;  2ZH2 A;  4FHP A;  5JDM A;  3NZP A;  4HN9 A;  3KV6 A;  1U4Q A;  4DV2 T;  2WWU A;  4PPX A;  3GDX A;  5L3C B;  3AU2 A;  4IG8 A;  1UX4 A;  4B6X A;  3JCF A;  3WFQ E;  4CXW A;  5IIN A;  4WC1 A;  1JMS A;  4NLN A;  5CJ5 A;  1US7 B;  4DV3 T;  4JI3 T;  4WZX A;  2X0L B;  5JDG A;  5HXC A;  5LGU B;  2M2T A;  2X51 A;  4AT9 A;  3ETV A;  4TUR A;  2JQQ A;  4MBQ A;  4X62 T;  4IL4 A;  4DOC A;  4DV6 T;  4K9A A;  5IIM A;  4YJ2 E;  2CHO A;  5LG3 A;  3NYB A;  3AEF A;  5JDN A;  2L9Q A;  2ZH1 A;  3HIY A;  5CA7 A;  5LXT E;  2XQ8 A;  5DKW A;  4PFP A;  1B7T A;  3FHN A;  2BPC A;  2FUP A;  3C51 A;  4TX5 A;  3H37 A;  1M7K A;  3I9W A;  5HEH A;  4DR3 T;  3VKH A;  5J2J A;  4YT0 A;  1IZN B;  3CQG B;  1ZQH A;  1PX5 A;  7ICS A;  2XUE A;  2ZM2 A;  3AVS A;  3C4Z A;  5LHG B;  3ZEF B;  3O9X A;  2LM2 A;  5EK4 A;  3N9O A;  4O6A A;  1LRZ A;  3CPZ A;  3Q2M A;  2CXF A;  1ZQQ A;  4EOZ B;  4O8S A;  3LG7 A;  1KNZ A;  7ICI A;  2QYW A;  4WC7 A;  4HFC A;  4E7S A;  3UUN A;  9ICH A;  3UU4 A;  3ZT6 A;  5AQH B;  1MND A;  1KEJ A;  4WOY A;  4K4G A;  3OPC A;  2BG9 A;  3ZJ1 A;  2QRX A;  3AED A;  1OED E;  1ZQS A;  1LKX A;  1IJ5 A;  2ZM8 A;  5JRE A;  4EAH A;  5LG4 A;  3K8P C;  7ICO A;  5IUX A;  2WSS V;  3IEE A;  4YN4 A;  2E9X B;  5J0S A;  2V1D B;  5DEC A;  1ZQI A;  3H38 A;  5HXR A;  5J2E A;  3UQ0 A;  3HJ1 A;  2YN6 A;  4QZG A;  4UB2 A;  1HNX T;  2DHR A;  2HHH T;  2RA1 A;  3AEG A;  3UXO A;  2ZH6 A;  4R66 A;  4M47 A;  9ICU A;  4MFR A;  1J5E T;  3AE5 A;  4B3S T;  2A3D A;  4P4O A;  9ICO A;  2MYS A;  3MAC A;  3UFG A;  4ZHQ E;  4DV0 T;  1ZQK A;  3JPS A;  4OAH A;  2M2W A;  4YD1 A;  2N9D A;  3SOL A;  5DB6 A;  2IHM A;  2VVS A;  1MNE A;  5BMV E;  4O2A E;  3EI0 A;  1MMG A;  3AE9 A;  4PGQ A;  1ZQG A;  2NTY A;  2ODU A;  4X1Y E;  1NEN A;  3T8O A;  5LOV E;  2HHP A;  3QK6 A;  4O4I E;  1YW0 A;  4AKH A;  3BK9 A;  2XAF B;  4U3C A;  3UU3 A;  4RQ0 A;  3FZM B;  4JYA T;  4X5T A;  2W2U A;  4H63 H;  4ANJ A;  9ICS A;  1KDH A;  5FKY A;  5HC9 A;  4M9H A;  5HWY A;  3ZYL A;  1LVK A;  4PJM A;  1KNR A;  3ZPO A;  5CFU A;  4HFV A;  2LHR A;  2N2N A;  5FP3 A;  3MDC A;  5L2L A;  4EZH A;  1CHU A;  1T72 A;  3FBZ A;  4I0U A;  4AT7 B;  4I2J A;  2JRK A;  4NUV A;  2BE3 A;  4M9G A;  3BQL A;  4TV8 E;  3B13 A;  4NXZ A;  5J0W A;  4IQW A;  2WY2 A;  2ZM0 A;  3Q5X A;  1JAJ A;  3JC6 C;  4X0A A;  3AE8 A;  4U2Y A;  2HH7 A;  3OJA A;  4IL9 A;  4LEY A;  3PDY A;  4JI8 T;  4LF9 T;  2VAN A;  8ICE A;  4QZE A;  4YSX A;  2BZB A;  2VKH A;  5HRH A;  4E7Z A;  5CR0 A;  2JQH A;  4UV8 B;  1UX5 A;  4QX8 B;  5FY1 A;  2M2U A;  3X1D A;  1SHZ C;  2LM9 A;  2P9B A;  5IHY A;  4JI0 T;  5D46 A;  4LMK A;  2QVA A;  9ICG A;  5CFT A;  1HNW T;  2VKO A;  8ICP A;  4A97 A;  1R8C A;  3JAE A;  3RH3 A;  4F6R C;  4QZB A;  5CA1 E;  3GN5 B;  2IIU A;  2KZ7 B;  2XAG B;  3Q9D A;  2K48 A;  4AT8 B;  2NOX A;  1FIO A;  5AQM B;  2BS4 A;  4LF6 T;  4I28 A;  4HFB A;  3UXP A;  1TFW A;  5AQI B;  4O67 A;  5IIK A;  1HUZ A;  4QKN A;  1ZQY A;  8ICK A;  3ZC0 A;  4IQT A;  4MAL A;  3N9N A;  1H7C A;  4CXY A;  3ONJ A;  3RC3 A;  4I27 A;  3ABV A;  3AAE B;  4UD4 A;  2MPK A;  1ZQD A;  3V5S A;  3ZCI A;  3T1Y T;  5L3F B;  4IE0 A;  5AFU L;  5J0X A;  4DBQ A;  5F5W A;  5AQL B;  3C5G A;  3ZST A;  4HWI B;  5L4E A;  2LRK A;  3OVA A;  2WMO A;  3B0Y A;  4KP3 C;  4ASK A;  2JPF A;  5JR9 B;  9ICJ A;  1ZQL A;  4YLH A;  1G8X A;  2HPL A;  4HWH A;  4IGU A;  5EK3 A;  4CN4 A;  2O5A A;  4LFC T;  2W4X A;  3ZMZ B;  5JRC B;  9ICA A;  5LJM A;  4ILC A;  2MAW A;  2X9X A;  3E08 A;  3L8R A;  2WBL A;  2QA7 A;  1OED A;  2Q9Q B;  3AEB A;  2I9G A;  1D1C A;  2W0G A;  4LFA T;  3JZ0 A;  5CB4 E;  1MIW A;  5AQV B;  5LJN A;  4QH4 A;  2DR5 A;  2VKJ A;  4UIG A;  4CZZ B;  2OA5 A;  5J2I A;  2IUB A;  2XAJ B;  1UUR A;  2Q66 A;  2XQ9 A;  1E2A A;  4G63 A;  1HX1 B;  2A72 A;  4H9P C;  2W66 A;  3TLW A;  4B3R T;  2C5J A;  2C5K T;  4F5Q A;  3AAA B;  4UAZ A;  4ZI7 E;  1OU5 A;  5LBM A;  4H9N C;  1ZQW A;  4IDQ A;  5LNK A;  3N9L A;  3LK4 2;  1V9D A;  2VK9 A;  4LML A;  3TLU A;  2D0U A;  3HL6 A;  4R63 A;  4I2E A;  1NEK A;  4TN7 B;  3OUY B;  2ES0 A;  5FXV A;  1JQR A;  1XZY A;  3U78 A;  4HWD A;  2PXI A;  4XJE A;  3AQK A;  2PFQ A;  1ZQZ A;  4HE8 A;  4RQ3 A;  4XQ7 A;  2LEH A;  3UPS A;  3ANW B;  4NXT A;  2F4V T;  2UUA T;  7ICT A;  3MCR A;  4YY3 T;  2KMF A;  4QXB B;  4AKL A;  8ICL A;  3SS1 A;  3LK3 B;  2FJE A;  4EED A;  2CPT A;  2WQY A;  2I0M A;  3RH4 A;  3UPQ A;  3RIA A;  4CN1 A;  3BQK A;  4AIS A;  3ERC C;  1QUU A;  1V4A A;  2FJD A;  4DUZ T;  4OK0 A;  3WFO A;  8ICJ A;  2YDR A;  3PUW F;  3C2L A;  4I43 B;  2WMN A;  3L09 A;  5DJQ C;  4YMN A;  4K97 A;  4GOU A;  2M6B A;  4M9N A;  4CQI A;  2KSR A;  4LEZ A;  4IE6 A;  3ISD A;  4OHF A;  1KNP A;  2E5V A;  3TKL B;  3KV9 A;  4HX0 A;  8ICU A;  4YTN A;  4UF0 B;  3T1H T;  3IHR A;  4M0A A;  4DR1 T;  4WYV A;  5JDL A;  5HRD A;  4HGA A;  3UT5 E;  5J0O A;  1IJ6 A;  3LDQ B;  2V5C A;  3KDS E;  2RFF A;  2XQA A;  1JNR A;  4DUY T;  2KND A;  8ICG A;  2XTL A;  4H63 V;  5ABF B;  2Q9Q C;  4XBF B;  2OLT A;  4FO6 A;  3ZJ2 A;  3ZT7 A;  4LF8 T;  3OVU A;  3ER8 C;  4IDZ A;  2C5I T;  1FMW A;  2EHO B;  4WC6 A;  3L9D A;  4CI1 B;  3LBX B;  4X4Q A;  5HYA A;  4U72 A;  4DR7 T;  4Z6F A;  1I94 T;  3TLV A;  3VU7 H;  4IE7 A;  8ICI A;  3P7I A;  3QB5 A;  4IE4 A;  2W61 A;  3V5U A;  1U5P A;  3PUQ A;  3FZF B;  4A56 A;  3RJH A;  3AEC A;  3FXD B;  2V6Y A;  3N2G E;  4PHA A;  9ICE A;  3E0Z A;  3RJE A;  3A5X A;  5J0Q A;  4YD2 A;  4L0R A;  2LE8 A;  3F2E A;  5BR8 T;  5AQT B;  5FYM A;  5CJ7 A;  3OKQ A;  4XA5 A;  2PJQ A;  4H9S E;  2KWH A;  3PUS A;  2LLY A;  3O1J A;  3AA0 B;  3NBX X;  5ABE A;  3RJK A;  1Y64 B;  2CXD A;  4GK5 E;  1WRD A;  1VFG A;  3C64 A;  4DBR A;  2ZH5 A;  3TLS A;  4YCX A;  5BOL A;  3EHZ A;  2VQE T;  3OGU A;  2NWB A;  4CI3 B;  4NXW A;  4H9O C;  3OVS A;  4KLO A;  4O4L E;  8ICO A;  4DR2 T;  5ABG A;  2XPK A;  5AQK B;  3CX6 B;  1HNZ T;  4QZC A;  4IDP A;  4EYU A;  1T7S A;  3KBT A;  3AE7 A;  3ISC A;  1IBL T;  1D0X A;  4ZI3 C;  3AE3 A;  2NR4 A;  2WZI A;  3JAD A;  1IBM T;  4TV9 E;  2DL1 A;  5FL1 A;  2W9M A;  1ZQO A;  9ICR A;  3UTK A;  4UBC A;  4AKG A;  4HFE A;  3CK6 A;  5KDM C;  2X9Y A;  4ISS A;  4U2Z A;  2V5D A;  8ICY A;  4O5C A;  5AQS B;  4UR9 A;  3JC6 D;  4RQ2 A;  1X79 A;  1M62 A;  2H88 A;  4EEB A;  4FHY A;  2DWK A;  4KLQ A;  4HWF A;  8ICV A;  3F31 A;  1VCS A;  2D5U A;  4E80 A;  3PHZ A;  4PK4 A;  3PNC A;  3FZK B;  2EHO C;  1ZJN A;  4KX6 A;  3KV4 A;  4UB4 A;  2K3W A;  7ICQ A;  5FNV E;  2PFV A;  2VKD A;  1YQ4 A;  4WCW A;  4IQU A;  2SPC A;  5JDF A;  5HEG A;  3JPP A;  4DND A;  3C2K A;  4OX9 T;  2BVL A;  5EZY E;  4I2F A;  4KLS A;  3C5F A;  4RPY A;  3DJB A;  3R84 B;  4KLE A;  1Q78 A;  4X4O A;  4JLZ A;  3GA8 A;  5L3E B;  2UXC T;  3IF8 B;  4WNK A;  2WS3 A;  5DB8 A;  1Z8U A;  5J2B A;  5LMU T;  2LRL A;  4XAX B;  5E0O A;  1SE7 A;  4GIW A;  4J2C A;  3PUG A;  2ZM6 T;  2X66 A;  4KLH A;  2CEA A;  4X20 E;  4M9J A;  2JQ9 A;  3I0O A;  1KFY A;  1WR0 A;  4PJJ A;  3ZC1 A;  2DVI A;  4M04 A;  4DO0 A;  1GQE A;  4S3N A;  5B3P A;  2B1E A;  2ODV A;  4UD5 A;  1BR4 A;  4MFC A;  4AQF A;  3AE4 A;  1HR0 T;  2BKO A;  3C4X A;  5BOM A;  7ICL A;  5J2K A;  4PFO A;  3UXN A;  2VAS A;  3AXJ B;  3M3Z B;  2UUB T;  3AE2 A;  3ONX A;  4ILA A;  3E22 E;  3OWG A;  5EOZ A;  3VKG A;  4X66 T;  4MFF A;  8ICB A;  9ICN A;  1VCT A;  1XMO T;  3HA4 A;  4NXV A;  4JLE A;  3AQL A;  1R8A A;  8ICN A;  5HHI A;  1BR1 A;  3C2M A;  4NXN T;  3PUA A;  4LF4 T;  4KHZ F;  4U74 A;  5JQG E;  3RC8 A;  2IML A;  2BS3 A;  2I6H A;  4I2G A;  5JDH A;  3HKE E;  3OBV E;  2LSI A;  4I2I A;  5CP2 A;  5AQJ B;  5L3D B;  4KLT A;  3ZKR A;  3RYC E;  4LT6 A;  4E7X A;  4R65 A;  2AXD S;  3RYH E;  7ICF A;  2OV9 A;  2LT3 A;  3NKU A;  2KWI B;  2A2F X;  5CFB A;  3I9Y A;  4I2H A;  5DBA A;  3V72 A;  4FH5 A;  4KLD A;  4DVD A;  3RKO A;  2V7J A;  4N7R A;  4YMO A;  2JJ9 A;  3JPN A;  3K3Q C;  5LBQ B;  3RQW A;  2V6X A;  3PJA J;  4COF A;  4AQG A;  1NAF A;  4DID B;  5HEO A;  1S94 A;  4IDN A;  9ICX A;  5LYJ E;  1RPL A;  3JPT A;  4H9R C;  3HKC E;  9ICQ A;  4X4U A;  4HEA A;  4K98 A;  2DR9 A;  1HCI A;  2IDO B;  2MOZ A;  4WC4 A;  4FHX A;  2H3R A;  1BPY A;  2XY8 B;  4PHD A;  2ZHA A;  4ATB B;  3PE0 A;  2ID1 A;  2B56 A;  4OAI Z;  3SWH A;  5HEJ A;  2XJ7 A;  4QH1 A;  8ICX A;  3RH5 A;  2X0Y A;  2WWV A;  2X68 A;  4X4N A;  3V7K A;  4F5N A;  2RP4 A;  3JAF A;  4PHP A;  4WC5 A;  3UQ7 A;  4JEH B;  4K0U A;  4JI1 T;  3RJF A;  4OYJ A;  4QXC B;  3Q5W A;  3KIN B;  3NKZ A;  4NXU A;  1ZJM A;  4ZI2 C;  4FO1 A;  4JBW F;  1Z0P A;  1ZQU A;  8ICC A;  4UVC B;  2CRB A;  7ICU A;  4EB6 E;  1E7P A;  4G2A A;  5JH7 E;  2GWS A;  3JPR A;  1MMA A;  2E9X C;  5D61 A;  4NIQ A;  1JNZ A;  3OTO T;  2MBG A;  4K4H A;  5HRL A;  3RJG A;  3AE1 A;  3C98 B;  1N32 T;  3WAK A;  5FXX A;  4YMM A;  4P1N A;  4QZ8 A;  3LK9 A;  2WU5 A;  4HWC A;  3OYX A;  3CQC B;  4TZ4 C;  9ICK A;  2IC6 A;  3G06 A;  5H6R B;  4K9B A;  2FJA A;  2WDQ A;  1CUN A;  4K4I A;  4P0A A;  1W0A A;  2Q9Q D;  3A8Y C;  2XHE B;  4YXD A;  2ZH4 A;  2JIW A;  5DED A;  3ZSS A;  4TWD A;  4YHJ A;  3ZN0 B;  2CMR A;  8ICW A;  3H39 A;  5LCY A;  5HR9 A;  2NRK A;  3L39 A;  2LSG A;  2W67 A;  5FY7 A;  3RJI A;  2HPJ A;  2KIN B;  4YFS A;  4LF7 T;  1ZHC A;  3WI3 A;  3HKB E;  4WC2 A;  3MXZ A;  1I6Z A;  2J4G A;  4FHW A;  4AT9 B;  5J2T E;  3WFP A;  3I0Q A;  4PNI A;  1UEU A;  3RIF A;  4RPZ A;  4RQ8 A;  3ZYM A;  3EAM A;  4BJN A;  2YU2 A;  4UB5 A;  5DAB A;  4TNW A;  4KHP T;  1WCR A;  3R6N A;  2B51 A;  1ZQA A;  8ICA A;  3IA3 A;  4O5E A;  2O1P A;  5D4B A;  4Z6E A;  4X64 T;  7ICP A;  3SRZ A;  4R64 A;  2LOP A;  8ICH A;  2FJB A;  4PJL A;  4O5K A;  5DB9 A;  5AQR B;  2P66 A;  4JEU B;  4ZXL A;  5HRF A;  4A98 A;  2JMK A;  4X4P A;  4GYR A;  3PUV F;  2LSY A;  4WQK A;  4KLL A;  3MKD A;  2PG8 A;  1NWM X;  2VVN A;  4KI0 F;  2YDS A;  1UGO A;  3UU6 A;  3ZMT B;  5L4H A;  4O4J E;  1XDP A;  4PW8 A;  4UAW A;  5CHE A;  2B76 A;  3CKD A;  4I4T E;  2PTF A;  3HWT A;  4F5O A;  3AB3 B;  3ZMU B;  4AIU A;  4JV5 T;  1ZQV A;  4RWN A;  4GK0 E;  3S4U A;  2E8I A;  5IIJ A;  3F57 A;  4UXN B;  3WFR E;  4HFI A;  1ZQJ A;  1OXZ A;  2XZE A;  4KMC A;  3CX8 B;  5DBB A;  2BG9 B;  3UUX B;  1Y01 A;  2UXN B;  3FBL A;  5J0Z A;  7ICV A;  7ICJ A;  4EV6 A;  4RQ5 A;  3LQC B;  2UXD T;  2E9X A;  2XQ3 A;  3KFW X;  2H7V C;  4ZZB A;  2IC9 A;  4I2A A;  2I59 A;  3O4X E;  4H9Q C;  4QH5 A;  4U31 A;  3UFE A;  2NW7 A;  3RYF E;  3AQN A;  2BCR A;  4P2H A;  5J2A A;  7ICH A;  2V26 A;  7ICE A;  4O9M A;  9ICP A;  2BKP A;  3MBY A;  4JI4 T;  5HXS A;  7ICR A;  4OAF A;  1X9B A;  5IIO A;  2EHO D;  4MF2 A;  3AEA A;  3WAJ A;  2YKS A;  2PBE A;  4M2Y A;  1HX8 A;  2ACX A;  1R8I A;  1T98 A;  5IIL A;  1ZP0 A;  1ZQP A;  4U7Y A;  2DRB A;  5JR9 C;  2BKN A;  4C90 A;  1MQ2 A;  2XQY A;  3B0X A;  4QWN B;  4ZOL E;  3RYI E;  1N33 T;  4UB3 A;  5AQG B;  4WBY A;  4X5V A;  1ZQT A;  1KNY A;  4RQ7 A;  2ZMA A;  3CWZ B;  1D0Z A;  1Q79 A;  4N78 D;  4RT3 A;  2KLQ A;  4PGX A;  4P4P A;  2CHN A;  3H3M A;  1HUO A;  3DP7 A;  4HFD A;  4I55 E;  5TZV A;  2J62 A;  4C91 A;  5KXJ A;  1XNQ T;  5CGM A;  4P0B A;  2BBJ A;  1JN3 A;  3N9Q A;  4K0K T;  4AT7 A;  2QGS A;  5A1L A;  5M4Y A;  2CE7 A;  5LP6 E;  3K1S A;  3PUX F;  4DR6 T;  4JI7 T;  4LEW A;  1LVF A;  2WZH A;  1G73 A;  4OFZ A;  5FXZ A;  2VB6 A;  1W0B A;  4FHV A;  2WB5 A;  4U7I A;  1BR2 A;  3ESL A;  2BCQ A;  3RIU C;  1YLQ A;  4ADZ A;  4NKU A;  2ACZ A;  5J2G A;  2Z6E A;  1MMD A;  3KBU A;  5L3G B;  2FBW A;  3AA7 B;  4IT4 A;  2J47 A;  4LF5 T;  4RPX A;  2LJL A;  4KBM B;  5JVD E;  4B3M T;  3GMI A;  3CIR A;  1ZQB A;  3HKD E;  4GKK T;  4X1K E;  3ZLI A;  2X0H A;  4WC0 A;  4IRE A;  4GXK A;  4MFA A;  4WBO A;  4O4H E;  3VR9 A;  2GAF D;  4TUQ A;  3FZL B;  2FMQ A;  5AQP B;  4YSY A;  1RZT A;  9ICV A;  4RT2 A;  3GWH A;  4TUY E;  4O2B E;  3PUR A;  7ICK A;  4U33 A;  1HS7 A;  3MGH A;  4JLX A;  3GN5 A;  5J0R A;  4WH5 A;  5LGN B;  3PUZ F;  5IYZ E;  4AT8 A;  2FCL A;  3SFD A;  4EBJ A;  1BPD A;  4X4R A;  5LA6 E;  3RX6 A;  2KT9 A;  4A5X A;  1WR6 A;  5HRI A;  4QHO A;  4WBZ A;  3U3I A;  5HRK A;  4RWP A;  3EF2 A;  4L9I A;  3EUH A;  1ZQN A;  3KVB A;  4GXJ A;  2D0T A;  1OWA A;  3AQM A;  4UB1 A;  1NOM A;  1IBK T;  3MZK B;  1E1H B;  1BPE A;  5FMN A;  4XRH A;  3CX7 B;  2ISP A;  2XQ7 A;  9ICF A;  5AQN B;  2K9A A;  1GPJ A;  1ZQC A;  4ILB A;  4UVA B;  2XQ5 A;  3K3N A;  4UAY A;  3NRY A;  1KK7 A;  1XSN A;  3N9P A;  2FMP A;  1ZQR A;  2V7M A;  5JR9 A;  4MKP A;  2DI4 A;  2NW9 A;  4DMW A;  3LJC A;  1MIY A;  3PU8 A;  4K99 A;  1MIV A;  5JRC A;  1WOT A;  3N5L A;  2AE9 A;  3WFS C;  1YQ3 A;  2Q9Q A;  5TAO A;  3LSV A;  3H3A A;  4ZI2 D;  4QZH A;  2DR7 A;  1OED B;  1WYB A;  8ICS A;  1FA0 A;  3CML A;  4Z6D A;  8ICZ A;  4K96 A;  2BPF A;  5FXW A;  2GK9 A;  3OVB A;  2NTX A;  4PK6 A;  4AKR B;  4EBK A;  2E9X D;  3ZMS B;  3OV7 A;  3I1A A;  5DBC A;  3VHL A;  2RPA A;  2V7K A;  3AA1 B;  4ZZC A;  4HKA A;  4NM2 A;  4WQL A;  8ICM A;  3PML A;  2FMS A;  4LZG A;  4NXM T;  1UUS A;  4BA9 A;  4YSZ A;  4F8H A;  3EVY A;  3RIU A;  4DV1 T;  4OAG A;  3UQ2 A;  2ZH7 A;  1J5W A;  9ICI A;  4NLK A;  3OUY A;  1SA0 E;  1EZ3 A;  1FMV A;  2YIN A;  1R8B A;  5IWA T;  4PJN A;  4NUU A;  4L5G A;  2WP9 A;  3RHW A;  3P4W A;  1KF6 A;  4QZ9 A;  3ANW A;  4FJO A;  2JQK A;  9ICB A;  4KLJ A;  3UU8 A;  5LHH B;  4I50 E;  3TFR A;  3K75 D;  4QZI A;  4KLF A;  5DQV A;  3Q5D A;  1DU2 A;  2W63 A;  4IQV A;  4EGW A;  5CFS A;  3QC9 A;  3P8C D;  4QXH B;  5LB7 B;  3PUY F;  1D1A A;  3FB2 A;  3QUJ A;  1FJG T;  2L3L A;  4FI5 A;  1ZQF A;  9ICL A;  4I2C A;  1WFD A;  4Z90 A;  4F5P A;  4JI2 T;  4EIW A;  9ICM A;  3RRW A;  5J1G A;  5ETW A;  1N36 T;  2X9H A;  1HTJ F;  2H7O A;  4KB6 A;  5HRE A;  5CHG A;  2W62 A;  1YKE B;  4IHJ E;  3JYY A;  4XUS A;  4TUS A;  5HXE A;  3RRC A;  5AQU B;  4YJ3 E;  5J0P A;  3ISB A;  4UF0 A;  4KLM A;  2BCU A;  3V7L A;  4WW0 A;  3NWI A;  4ERR A;  4F5R A;  2YU1 A;  4EXT A;  1BPX A;  3A7M A;  1J1J A;  1ZEE A;  3CVR A;  4ZS3 A;  4DR4 T;  2IW5 B;  1WYC A;  3AU6 A;  3M65 A;  5J0Y A;  4WBN E;  2J1D G;  2XAQ B;  5ABF A;  3NZQ A;  5L3B B;  3OYZ A;  4IE5 A;  7ICG A;  3ZCJ A;  4NKT A;  4M5D A;  1OED C;  5LMN T;  2BCV A;  1D1B A;  4O68 A;  3JPO A;  5GON E;  3LFM A;  1YXR A;  2EHO A;  9ICC A;  5D49 A;  4I2B A;  3LBX A;  3N9M A;  3EDU A;  4TUP A;  3O1I A;  3C66 A;  4IIJ E;  4ZEY A;  2WDV A;  3RF1 A;  4LEV A;  3UUB A;  1D0Y A;  2Y6X A;  4CXX A;  2R6G F;  5FY0 A;  4CI2 B;  2ZH9 A;  2KXP B;  4Z91 A;  5FVK A;  4YHH T;  2V6Y B;  2Y48 B;  4K8V A;  1VOM A;  2C0S A;  3O1H A;  1XWM A;  5J2F A;  5HRG A;  1UEV A;  2IHO A;  3VRA A;  3PU3 A;  2BDE A;  5AQO B;  4DOA A;  1ZQX A;  5CB1 A;  2E5L T;  9ICT A;  2CBJ A;  5HHH A;  1TFY A;  3RJJ A;  2XQ6 A;  3P4R A;  3N2O A;  1AJ3 A;  4MHC A;  2BVM A;  2N1G A;  4OYK A;  1O3X A;  4QZF A;  2V7I A;  3K3O A;  2D9D A;  2DR8 A;  2UU9 T;  1BPB A;  5B3Q A;  4NPP A;  4EP7 A;  4AQY T;  1S35 A;  2M67 A;  2XM1 A;  3PJA A;  3RH6 A;  8ICF A;  4DV5 T;  4NY8 A;  5HEU A;  4X4S A;  5J29 A;  3L3P A;  4RWO A;  4O69 A; 
#chains in the Genus database with same CATH homology
 3NVO A;  4EED A;  3CK6 A;  2BBJ A;  4EEB A;  4EV6 A;  2BBH A;  2IUB A;  4EGW A;  2HN2 A;  3JCF A;  3NWI A;  3RKG A;  5JTG A;  4I0U A;  2HN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...