4EGWA

The structure of the soluble domain of cora from methanocaldococcus jannaschii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
MITVIAIAKDGSIVEPKLDEISFEDYRLIWIDCYDPKDEELYKLSKKIGISVSDLQIGLDEQEIPRVEEDEDFYLIIYKAPLFEEDITTTSLGIYIKNNLLLTIHSDKIKAIGRLHKLISTKKPRIVFERGIGFLLYHILNEITRSYSRILMNLEDELEELEDKLLAGYDREVMEKILGLRKTLVYFHKSLIANRDVLVLLKRKYLPITTKEDRENFEDLYYDTLQLIDMSATYREVLTSMMDITLSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural insights into the mechanisms of Mg2+ uptake, transport, and gating by CorA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4egwA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4egwA01
5JTGA 3NVOA 4EEBA 2HN1A 3CK6A 2BBHA 2IUBA 3NWIA 2HN2A 3RKGA 4EEDA 4EGWA 4EV6A 2BBJA 3JCFA 4I0UA
chains in the Genus database with same CATH superfamily
4O5EA 4UD4A 3O1JA 1Z0PA 7ICNA 2XAFB 5AQMB 2XZEA 4M9HA 2H3RA 2LSKA 4QZ8A 2CWOA 3O9XA 1T72A 3JC6D 7ICVA 4UVBB 9ICIA 1SE7A 2P66A 5AQHB 1ZKEA 4TUYE 2PFQA 3FB2A 3VKGA 4IE5A 1NAFA 1ZQNA 8ICAA 2M2TA 3RYFE 2BG9B 8ICFA 5JRCB 3TFRA 3RKGA 5BOLA 3UUXB 4NUUA 2YINA 3UXOA 2JIWA 4UV9B 4B3MT 3KV4A 3G06A 5AQFB 5LGTB 8ICPA 1ZQLA 2H7VC 3N2KE 4WCWA 2Y6XA 2W9MA 2A3DA 2XM1A 1SUMB 1E7PA 4UB4A 9ICHA 1D0ZA 2BZBA 3WAKA 5AQRB 2RP4A 1UK5A 3J9X1 5HXEA 1MIWA 2L8KA 4L9IA 5J2KA 8ICRA 2ZH4A 4RQ4A 3PJAJ 5FXZA 2CXFA 3KV5A 2FCLA 4J2CA 2K3WA 5FVKA 8ICLA 4R64A 2E2AA 7ICHA 4WW0A 1D1AA 5JREA 3E22E 4AT9A 2CMRA 3UU8A 3C98B 1HUZA 9ICLA 3OPCA 4WC7A 2H89A 4EAHA 4I43B 1HG2A 5DKWA 4FHYA 1YQ4A 4JLXA 4JEUB 2VKHA 4MF8A 3EVYA 3FZMB 5AQPB 1ZQIA 1HCIA 2Q9QC 1MMDA 4C90A 3AE8A 3LQCB 9ICQA 4ISSA 4XRHA 3LSVA 3C2MA 4A5XA 5J0YA 4X0AA 2I0MA 3AQNA 4B3TT 4UAWA 3HKDE 2MTQA 2CHNA 4ZHQE 4ILUA 2J62A 5F3JA 4PK6A 3Q5WA 1ZQVA 3CPZA 3RJFA 5B3QA 1US7B 3NRYA 9ICPA 3U78A 3FXEB 2ZM2A 2DRBA 4YY3T 5DB6A 5JVDE 5FY0A 3AVSA 4PFPA 4PJLA 5CWRA 1Y01A 3GA8A 3UXNA 4DVDA 2WDQA 4K8VA 4PJNA 2W62A 8ICUA 3RC3A 5J0PA 2BKOA 9ICKA 1OEDB 8ICNA 2SPCA 4K96A 2W00A 2OV9A 4I29A 3PHZA 2WU2A 2X66A 1W0BA 4FHPA 4JI0T 5TZVA 3EHZA 4GK5E 4KHZF 3ZT7A 3PUWF 1ZQZA 4DR6T 5IILA 1YQ3A 4RQ7A 3AEAA 5DDYA 4PNIA 4UR9A 4X4QA 3AA7B 2J1DG 3O4XE 2BG9C 2ISPA 2LKHA 2W0GA 1KDHA 4H9SE 3BQKA 7ICGA 1R8BA 2KSRA 4I0UA 3RIUA 4JI4T 3O1HA 3PUYF 4LF7T 2VK9A 4LF9T 3NBXX 4IIJE 4KX6A 3OVSA 3AE7A 5IIIA 9ICSA 4L0RA 4CZZB 4DO9A 3ZJ2A 3HWTA 3RGLA 4X66T 4CI2B 1N33T 3V7KA 1IBMT 3AU6A 1KNYA 3N9PA 2ZH5A 4MKPA 2CLYB 4YTMA 3ZN1B 5CFUA 1IAPA 4RQ6A 4UEMA 2IIUA 4O69A 5LHIB 4K99A 3IHRA 7ICPA 2WP9A 3RJEA 8ICEA 3SWHA 1BR4A 4F8HA 1TFYA 3FXDB 9ICVA 1KEYA 1R8CA 2FJBA 4M47A 7ICUA 4UXNB 5JR9A 4H63V 3EABA 4ZZBA 3RRCA 2EHOB 4UB1A 4EIWA 3B0XA 3GN5A 3QK6A 4QX8B 4EXTA 3PUVF 3OGUA 4DV6T 2DI4A 1WR0A 4I2FA 1EZ3A 4U72A 4YMMA 3FHNA 4BJNA 2AE9A 2W67A 1MQ2A 1ZQCA 4IL9A 4LF4T 1ZQUA 4HFEA 1FJGT 3N9MA 1JN3A 2C5JA 4ZI2C 1UGOA 4JI1T 2V7KA 5BMVE 5AQQB 4NXUA 4P4PA 3N5LA 5HRFA 1D0YA 2CXDA 3MDAA 1HR0T 2O5AA 9ICMA 3Q2MA 8ICBA 1J5ET 4JUYA 4YMOA 4EZ4A 2UXNB 1ZQDA 2W2UA 1YKEB 1YW0A 3UUBA 3AE2A 1OEDC 2CPTA 4OYKA 3VRBA 4NXVA 2DVIA 2CXLA 4IQVA 3CX6B 2DNXA 1SA0E 4EV6A 2V7IA 5FYMA 3NRXA 3UQ0A 2BCRA 8ICXA 3AA1B 3NWIA 4NXTA 3P4SA 4A97A 4CXXA 4HWIB 2LM9A 1GPJA 3I0OA 5KXJA 4RPYA 5B3PA 3QB5K 3GWHA 4I2BA 4BJMA 4R63A 2YKSA 8ICMA 2VQET 7ICOA 3AAIA 1ZP0A 5LG4A 2LSIA 5J2IA 3RYIE 1BR0A 5HRIA 2KNDA 2KINB 2WWUA 3UUMA 5FNVE 3ZPOA 3OVBA 1BR1A 2M2UA 4KLTA 5L3BB 4YSZA 5HWYA 3ZKRA 7ICLA 4FH5A 2XQ9A 5HYAA 2ZH7A 1X9BA 3RC8A 1YKHB 3OVUA 4JWMA 4K0UA 4X20E 4K4HA 4G63A 5LOVE 3H38A 3OWGA 5HHIA 8ICOA 2OA5A 4QX7B 4WC6A 3RI5A 3ANWA 2BVLA 3ZSTA 1QLBA 4R65A 2ACZA 4TURA 4QZIA 3KDSE 4S3NA 1N32T 4QZCA 2V1DB 2HPLA 2W61A 3ZJ1A 1MMGA 5L3GB 2M2WA 5ABGA 2IDOB 5J1GA 4KLMA 2K24A 2X67A 5EOZA 1ZQOA 8ICCA 5AQUB 1IBKT 3ZEFB 2NTXA 1BPEA 2LEHA 2KT9A 1BPYA 5CFBA 2XQ6A 2X68A 1M7KA 2RA1A 1UEVA 3WFOA 4JI5T 3V5SA 2XQ8A 2BS4A 4RT2A 4M9NA 3RIAA 4ZI3C 3UPQA 5IIOA 3AA6B 3MZKB 4CQIA 4WH5A 2VKDA 2H7OA 4AI6A 3TKLB 3LK2B 2X51A 5FL0A 5L47A 2FMQA 1Z8UA 1ZHCA 4V1Av 8ICGA 3I0QA 3V72A 3JCFA 1G8XA 5HAXA 4DR2T 2BKPA 3RH4A 8ICZA 4P1NA 3RJGA 3L9DA 1QSDA 4KLGA 3WAJA 3Q9DA 4EYUA 2KWHA 4AQFC 1CUNA 2KWIB 3V7LA 3NKUA 4U33A 1SHZC 3SS1A 2WWVA 2QRXA 1UCUA 2XPKA 4U31A 4DUZT 3HKBE 2HHHT 3PDYA 2ZHAA 3HJ4A 5D62A 1XNQT 1WYCA 4AQYT 3KBUA 4OAHA 4AT8B 5KX5E 1KEJA 4XA5A 3RKOA 3ZN0B 5HR9A 4TNVA 4AISA 2ZM6T 1I6ZA 3RX6A 1GQEA 3QC9A 3ZCIA 4GKKT 3K75D 2VQFT 3KINB 4LEWA 4AXPA 5AQGB 1IJ6A 5L4HA 4AT7B 2HPJA 3RPUA 4FHVA 3JPNA 2DHRA 5HRLA 4JI3T 2UXDT 3WFPA 4QZAA 3ZCJA 4ATBB 3OBVE 4YXDA 3W15B 1D1BA 3P50A 4ZS3A 4H63H 2WZHA 4QH4A 4F5RA 1ZQJA 3ZMSB 3UU4A 4KHPT 1Q78A 2BVMA 3QNUA 2ZH9A 3HIYA 4DMVA 5AQSB 4IE4A 4IDNA 3JAFA 9ICRA 3OVAA 9ICJA 1Y64B 2BS3A 2MYSA 2KXPB 5J2CA 1UEUA 4E80A 3LBXB 2CBJA 3CX8B 8ICKA 2X0HA 2HH7A 2DR5A 5HREA 4CN4A 2BPFA 3UULA 3PUQA 1I94T 4IDOA 4AQFA 3B0YA 3MCRA 5CA7A 2ISOA 2K5BB 4DR1T 3NVOA 5ABEA 4ZEYA 3CK6A 2BBJA 5JQGE 7ICSA 2XQ3A 5J2FA 3AQMA 4DV7T 4YLHA 3MBYA 5LHGB 1ZV4X 3N2GE 3C2KA 2GK9A 2B76A 1IJ5A 5HEOA 4NM1A 4WBNE 4QH5A 5AQJB 4H9RC 4HWHA 4F5OA 2WSSV 2LM2A 4KLUA 2ES0A 5HXSA 4X5TA 5DEDA 5ABFA 2DR9A 5EZYE 2NWBA 4WZXA 4QZ9A 3CX7B 1WOTA 2BCQA 4CI1B 1S94A 1E1HB 3QB5A 4E7XA 5HRBA 7ICEA 4UELA 3LK42 3SOLA 5JDMA 1ZQPA 2HN1A 3PUAA 3VKHA 3SFEA 1LRZA 2D2SA 4X4VA 2VANA 8ICJA 3BQIA 3DTOA 2LKGA 5LBMA 4O6AA 4PHAA 5HCJA 5FL1A 3KV9A 2DR8A 8ICVA 2DR7A 5JDQA 3J7Yq 4UIGA 2XJ7A 4LZDA 3GMIA 3RHWA 4B3ST 4K98A 5CFTA 4Z6DA 2ZLYA 5AQTB 3RLFF 2VURA 3AEEA 4F5PA 4N78D 4JLZA 4O4HE 3LG7A 4X4OA 1IBLT 3FBLA 2DCFA 1ZQGA 4E7ZA 4ZI2D 2UXXB 2X9WA 3N9LA 1JNZA 2FMPA 7ICRA 4H9PC 1XSLA 4QXCB 4F6RC 4NY8A 3OKQA 3PUSA 4B6XA 5LHHB 4I4TE 3ZMVB 5LBQB 4UBBA 5J2HA 1ZQAA 1ZJMA 1W0AA 2E8IA 5HRGA 4QWNB 3K3OA 3C2LA 2NR4A 4K4GA 4O4JE 5AQOB 2WZIA 5J0SA 3ONXA 4YJ2E 3ZLIA 4U2ZA 5J2AA 1VCTA 4HKAA 4I2GA 4H9QC 2FJDA 2P9BA 3C50A 2PG8A 5DQWA 2VASA 3NYBA 4YHHT 4TUPA 2YEVC 4ZI7E 4O5KA 1NO5A 2O1PA 4A56A 1HF8A 9ICBA 4FHWA 4HWCA 3UPSA 4HFCA 4DBRA 3BK9A 4JV5T 1ZQWA 3N9OA 4QXHB 1ZQTA 3K3NA 4GIWA 4WC2A 4LEZA 9ICFA 1NOMA 2LSJA 2AXDS 2ZM0A 3OYXA 4TWHA 2X0YA 4O68A 3FZLB 3HW8A 4A98A 1W9RA 4KLOA 2W66A 4UF0A 1N34T 3WFRE 7ICFA 1OU5A 4U2YA 1FA0A 3JYYA 3C66A 2GA9D 5F2VO 5DB8A 1QUUA 7ICIA 1H7CA 1KNZA 2N1GA 2Q9QA 2MPKA 3ESLA 4GXKA 3OYZA 1ZJNA 5CHGA 2FJAA 4DBQA 4DR4T 3RH6A 2CWYA 1J1JA 3TLTA 2IC6A 3WFQE 1HS7A 3JZ0A 1OEDE 3QUJA 4L5GA 3OUYA 1ZQYA 2DRAA 4QZHA 5D61A 5AQKB 2LJLA 3HKEE 3LK3B 3KVBA 4RWOA 3MGHA 5D63A 1JNRA 5LG3A 4KB6A 3UU5A 5AQVB 2V6YB 4K0KT 5HEGA 4I28A 4GXIA 4KM5A 1F5AA 4YMNA 1ZQKA 3AVRA 1R8AA 1V4AA 4EEBA 3PUGA 4HWFA 1KF6A 2JQQA 3RJKA 2BE3A 7ICKA 3JPOA 1UX4A 2PBIA 4E7SA 2EHOD 3C5GA 4KLIA 3OTOT 2LHNA 3AXJB 3CIRA 1LKXA 4QXBB 3KVAA 3MGIA 3MXZA 4TN7B 4WQKA 4MBQA 3A7MA 1WCRA 2K48A 1BPZA 4FI5A 2JMHA 4ZI3D 5LGUB 3AB3B 2V7LA 2MAWA 4WNKA 2M6IA 4LMLA 5IINA 4PPXA 4I2IA 3ISBA 5FXVA 3E08A 5KMGP 3RJIA 1V9DA 2BG9A 3P4WA 4CN1A 5JRCA 5IIJA 5LA6E 4B3RT 4XZCA 1N36T 4P0BA 5HEHA 1L0VA 3VR8A 5J0XA 4EYYR 3JPQA 5FXXA 3ER9B 3F31A 4G2AA 4BA9A 5C3JA 3P4QA 4UAYA 9ICGA 3AECA 5IWAT 2LRLA 2V6XA 5LCYA 1NENA 3MA9A 4GK0E 1AJ3A 2BCVA 2JPFA 2M6BA 3JPPA 4UVCB 2E9XB 4X64T 3ISCA 5FY7A 3ONLC 3UFGA 4DR5T 2NW7A 3RQWA 4LT6A 4LFCT 4X65T 3BQLA 1HUOA 3B5MA 5HEUA 4LF6T 3Q5DA 5CP2A 2WMNA 4FHXA 1U4QA 3PMLA 1HX8A 1HG5A 1OWAA 2BPGA 4DOCA 4UB3A 1YLQA 2LOSA 2IW5B 1G73A 1HTJF 3ZYKA 4IGUA 4PHDA 4PGQA 5BOMA 4EEDA 4AQGA 4GYSA 5CA0E 1ZEEA 4X1YE 5HHHA 4DNDA 2A9UA 3IBPA 4OAFA 1YXRA 5ADXL 4OYJA 3PTRB 9ICTA 2YU2A 4IQTA 5LJNA 2BCUA 4IDQA 4IHJE 5LYJE 3T8OA 2FJEA 4FJOA 3EF2A 3AA0B 4X4TA 1XMOT 4NXXA 3H39A 2BDEA 2V5DA 3H37A 3AE1A 3ONJA 3P8CD 4CXYA 4WC0A 4C91A 4I2HA 4UBCA 2LLYA 4DOAA 4EB6E 2XQ5A 4MFCA 2RPAA 3E0ZA 5HRDA 4YN4A 5JDHA 4WBZA 2I59A 1ZQMA 4KBMB 4LEYA 2CLYC 5FP3A 3MACA 2I6HA 4P09A 3C4WA 4M9LA 3I9YA 3QOFA 5HWXA 4EBJA 4P4OA 3IF8B 4AT9B 2WDRA 3EI0A 2IAKA 4AKLA 4HN9A 4HFDA 3EUHA 2VVSA 4TUSA 3ETUA 3AE3A 4AIUA 4OHFA 1OEDA 4CXWA 1IZNB 4NXMT 4FO1A 2B56A 3CKDA 2EHOC 4OFZA 2V26A 4PGYA 2JJ9A 4LF5T 5JH7E 4U7YA 1Q79A 9ICCA 3AUOA 4YHJA 4MHCA 4KLHA 2PTFA 4ASKA 1MMNA 4I50E 5DB9A 4I2JA 5IHYA 2NRKA 5LMNT 3UU6A 4BAYB 2XM2A 3L8RA 3L39A 1UURA 1ZQEA 3MJXA 3L3PA 4X4RA 5AQIB 4IDPA 3ZMUB 5EK3A 1WLXA 3HA4A 1HNXT 4JEHB 1ZQQA 5J2TE 4P4MA 2E9XC 5J29A 1WR6A 4YD1A 4M2YA 4PK5A 1DU2A 3V5UA 4YTNA 3TLSA 1VJ7A 3H3MA 3DJBA 4PFOA 1UX5A 1T8BA 5HEJA 5LP6E 4I2DA 5J2JA 2BPCA 1CHUA 2XUEA 2YU1A 1T7SA 4LF8T 4DMWA 2PXIA 2G0UA 2Q66A 2QYWA 5J0WA 2H88A 2N2NA 4MFFA 2A2FX 3ZC1A 4ERRA 2GWSA 1OXZA 4JI7T 4EBKA 4X4SA 4H9NC 4PK4A 3RF1A 4NPPA 9ICWA 2LSGA 1HX1B 4ZXLA 2YDQA 4WOYA 4UB2A 2EHOA 2WCAA 4M9GA 4TWDA 4OK0A 5LXTE 2FMSA 4KMCA 4QZBA 4UVAB 3PUZF 4ADZA 2PFOA 4X4PA 3HKCE 4QZFA 2W63A 5L3CB 5J0ZA 2L3LA 2YOEA 4M5DA 1T98A 2NW9A 4CI3B 2F4VT 4YT0A 5HRKA 1ZQBA 2V5CA 4HGAA 1FEWA 4O9MA 4LFAT 2XQ7A 4HFBA 5DBBA 5GONE 5J2UE 3ISDA 3AEDA 4QH1A 2XAHB 3AE6A 4IE6A 3UQ2A 3B57A 4YTPA 3I1AA 1ZQHA 2OLTA 4RQ2A 4RQ1A 1XZYA 2VL8A 3MKDA 3M65A 4NLNA 4YFSA 3NZQA 5JR9B 5J2BA 3UQ7A 4KLLA 4ILAA 2WAUA 2IMLA 2XQAA 4IG8A 3RJJA 9ICOA 3RRWA 2LT3A 4XAXB 4E8FA 3PV0F 1XMQT 3GN5B 1FMVA 2LRKA 4XUSA 4K4IA 2BCSA 4DV5T 4MALA 4Z6FA 4ZOLE 2WU5A 3DP7A 1ZQSA 3HX0A 3C64A 4NXNT 2PJQA 3EDVA 2WB5A 4NM2A 4AKHA 3SFDA 2EWRA 3PMNA 1MNDA 5CR0A 2X9HA 4I27A 4Q25A 3ZYMA 2PBEA 4PHEA 4IQWA 3IEEA 1W09A 4P2HA 3JAEA 1PX5A 1ZOYA 4X1KE 4LFBT 1XDPA 8ICHA 1HFAA 5L3FB 4XQ8A 2L9QA 3CWZB 2Z6EA 2XAJB 3I9WA 5J2EA 1NEKA 2BG9E 5DBCA 1MNEA 5KDMC 1UETA 4WC5A 2J47A 5LGNB 4RQ0A 4QZGA 8ICTA 4LVSA 5HXHA 4PAGA 4NLZA 2IHR1 2CA5A 5H6RB 2CM0A 3JPSA 3TLWA 4Z90A 4JBWF 3RH5A 3K1SA 7ICTA 5FVLA 3UFEA 2DWKA 5AQLB 4MFAA 1MIYA 2UUCT 3RQUA 3P4RA 4I55E 4Z8XA 4HEAA 3AEBA 5J0RA 4HWDA 4JI6T 2NW8A 2UXCT 3EDUA 5C2TA 5CHEA 3AEFA 2UU9T 3NKZA 1TV9A 1MQ3A 9ICXA 2V8SV 3K3QC 5AFUL 5BPCA 4K9BA 1JAJA 1VOMA 2XASB 2JQHA 1D1CA 1JMSA 3RIUC 2ZH6A 4RWNA 4TX5A 2NTYA 4KLEA 5HRHA 2B1EA 3ERCC 2JRKA 9ICEA 3ZMTB 4UV8B 3SRZA 4CN6A 2CRBA 5JTGA 4IREA 4WQLA 5H6QB 3AQLA 4TWFA 3FZHB 4NKTA 3AQKA 5FY1A 2YDSA 4GKJT 2E5LT 4RQ5A 2XAQB 4Z6EA 4QHOA 4QZDA 2DLRA 3PU8A 2ZH8A 5D46A 3JPRA 5IUXA 2VVNA 4FH3A 3NZPA 4O4IE 3ANWB 2J4GA 4UD5A 5LB7B 2ZMAA 1D0XA 5L4EA 9ICAA 3TLVA 5LJMA 5JR9C 4RQ8A 3N9QA 3M3ZB 3PUXF 4X0BA 3Q5EA 1X79A 2WBLA 2WQYA 2ODVA 4ZZCA 4WC4A 3ZT5A 3TFSA 2HN2A 7ICQA 2UUBT 4LMKA 5J0TA 3ZMZB 4TNWA 2D0UA 5JDGA 2D0TA 1VRBA 5L3DB 4AT8A 4QKNA 4KI0F 1JQRA 3ZYLA 4M0AA 4X5VA 3L09A 5L3EB 2YK0A 3ZT6A 2LE8A 4ILCA 3N9NA 4NLKA 2A72A 4ISTA 5DBAA 1XDOA 1MIVA 4AT7A 3MK7C 5DB7A 3JC6C 4ZS2A 3C4XA 1XSNA 4M1PA 4JYAT 1J5WA 8ICYA 5EK4A 1LVFA 5IIKA 4ATBA 2KZ7B 1BR2A 4Z6CA 5FXWA 5CB4E 3VHLA 2XTLA 3N2OA 1BPXA 4ILBA 4DV3T 4XQ7A 2Y48B 3UTKA 5TAOA 2B51A 5CGMA 4U74A 1B7TA 1R8IA 8ICSA 4KUMB 1KNPA 3FZKB 2E5VA 3PU3A 3MDCA 1FMWA 2LHRA 4DR7T 3K7DA 4MF2A 3A8YC 5DQVA 4FO6A 2C0SA 3LBXA 3ETVA 2Y8DA 2MOZA 5J2DA 8ICQA 5IYZE 3B13A 2C5IT 3KFWX 5LNKA 4LEVA 3CVRA 3JADA 4PHPA 4X4UA 2XAGB 4WBYA 4NIQA 4TUQA 4IE0A 3P7IA 4EOZB 3AAAB 1YD8G 7ICJA 2QVAA 4OAIZ 2N9DA 8ICWA 4PW8A 5IIMA 4OX9T 2UUAT 3RYCE 2E9XD 1ZQXA 3WFSC 4GOUA 3ZC0A 4RPXA 3UXPA 3AE4A 3PJAA 3LK9A 2X0LB 3AAEB 4KP3C 3PURA 2JMKA 1RZTA 1M62A 4H9OC 4COFA 2DL1A 3OV7A 5HXCA 5JDNA 4O67A 3ZSSA 2BKNA 3V7JA 2R6GF 5C8YE 3X1DA 3K8PC 4LMJA 2KLQA 3Q5XA 4U7IA 1XNRT 3O1IA 4RWQA 4JI8T 2UXBT 3C4ZA 5CA1E 3HL6A 4HFHA 4RT3A 3GDXA 2I9GA 5A1LA 2ID1A 4DV4T 1MMAA 2ACXA 1FIOA 4YSYA 4R66A 3H3AA 4IT4A 1O3XA 4NUVA 2WDVA 3RH3A 7ICMA 5FKYA 1UUSA 1VFGA 5F8PA 4M9JA 1ZQRA 4JLEA 4HE8A 4RWPA 4O8SA 4IE7A 4YJ3E 4K9AA 2CEAA 3PNCA 4JI2T 2NP9A 4KLDA 4PJJA 1VCSA 4I2CA 1KFYA 4AKRB 3CMLA 4AKGA 3FBZA 5DABA 3LJCA 4O5CA 2CCQA 9ICNA 3P4PA 1ZQFA 5J0QA 4Z91A 3WI3A 1BPDA 3D0TA 4JWNA 5ABFB 3AEGA 1HNWT 3PE0A 3IA3A 3CQCB 5CJ5A 4MFRA 4HFVA 2IUBA 3VU7H 4O2BE 2WMOA 1NWMX 4PGXA 5J0OA 4F5NA 2W4XA 3VR9A 4HTEA 3VRAA 4I2EA 5ABHA 4PH5A 2WM9A 1S35A 4DV2T 4O4LE 4DUYT 5D4BA 2CBIA 2YN6A 2PFVA 4N7RA 5BR8T 4IL4A 8ICIA 4NXZA 4DIDB 4QZEA 3RYHE 4UAZA 4KLJA 2LSYA 4K97A 2HHPA 4EGWA 4MLKA 4WYVA 4M04A 2DWGA 3UUNA 3CQGB 4X4NA 3S4UA 4P0AA 4XBFB 2VKOA 4LZGA 4YSXA 2X9XA 2V7JA 4GYRA 2VB6A 3T1YT 2XY8B 1WYBA 1XWMA 4WC1A 2IHMA 2VWAA 2WS3A 4RPZA 2KMFA 4X62T 3U3IA 2PFPA 2NOXA 4F5QA 2XSBA 9ICUA 3AU2A 3HJ1A 2RFFA 1WFDA 2IHOA 4XJEA 2M67A 5AQNB 4O2AE 2D5UA 1LVKA 2M2VA 2XSAA 5EK2A 3LDQB 2QA7A 2D9DA 1TFWA 5DDMA 3EAMA 2QGSA 4IDZA 3AE9A 2ZH1A 3C51A 4TV9E 4ANJA 4IQUA 3F57A 2BS2A 5F5WA 3HI2A 4HX0A 3ER8C 4GXJA 4OAGA 4WBOA 2JQKA 1KNRA 2V6YA 3AE5A 5HCMA 2GAFD 3R6NA 3R84B 4I2AA 3UQ4A 5D49A 2ODUA 4EZHA 2ZHBA 2CE7A 5JDFA 3A5XA 4NXWA 2IC9A 4U3CA 4X1IE 1U5PA 5CJ7A 1E2AA 2JQ9A 2ZH2A 5E0OA 2X9YA 2FUPA 4TZ4C 2ZM8A 2BBHA 4HFIA 2XHEB 4UB5A 5M4YA 2Q9QD 4WC3A 3AXJA 4YD2A 2C5KT 4PJMA 2V7MA 4UF0B 4YCXA 5HC9A 1KK7A 2B4VA 3C5FA 3KBTA 5J2GA 2VKJA 2Q9QB 5CFSA 2YDRA 2FBWA 4AKIA 2VL0A 5J0UA 3HR0A 4DO0A 4DR3T 1R89A 5DECA 1TVAA 4TV8E 2XQ4A 3JPTA 3C18A 4DOBA 4NKUA 2XQYA 3OUYB 5LMUT 3ABVA 3UU3A 2PFNA 1BPBA 2K9AA 5L2LA 5JDLA 1HNZT 3TLUA 5DJQC 3KV6A 1XSPA 5ETWA 2CHOA 3CQXC 3LFMA 5HXRA 5FMNA 5CB1A 2LOPA 4DV1T 4KLFA 2E9XA 3OJAA 1WRDA 3RIFA 4EP7A 1RPLA 3RJHA 4KLQA 3FZFB 3T1HT 2MBGA 2WY2A 2ZH3A 4RQ3A 3F2EA 4KLSA 4DV0T 3UT5E
chains in the Genus database with same CATH topology
5JTGA 3NVOA 4EEBA 2HN1A 3CK6A 2BBHA 2IUBA 3NWIA 2HN2A 3RKGA 4EEDA 4EGWA 4EV6A 2BBJA 3JCFA 4I0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JTG A;  3NVO A;  4EEB A;  2HN1 A;  3CK6 A;  2BBH A;  2IUB A;  3NWI A;  2HN2 A;  3RKG A;  4EED A;  4EGW A;  4EV6 A;  2BBJ A;  3JCF A;  4I0U A; 
#chains in the Genus database with same CATH topology
 4O5E A;  4UD4 A;  3O1J A;  1Z0P A;  7ICN A;  2XAF B;  5AQM B;  2XZE A;  4M9H A;  2H3R A;  2LSK A;  4QZ8 A;  2CWO A;  3O9X A;  1T72 A;  3JC6 D;  7ICV A;  4UVB B;  9ICI A;  1SE7 A;  2P66 A;  5AQH B;  1ZKE A;  4TUY E;  2PFQ A;  3FB2 A;  3VKG A;  4IE5 A;  1NAF A;  1ZQN A;  8ICA A;  2M2T A;  3RYF E;  2BG9 B;  8ICF A;  5JRC B;  3TFR A;  3RKG A;  5BOL A;  3UUX B;  4NUU A;  2YIN A;  3UXO A;  2JIW A;  4UV9 B;  4B3M T;  3KV4 A;  3G06 A;  5AQF B;  5LGT B;  8ICP A;  1ZQL A;  2H7V C;  3N2K E;  4WCW A;  2Y6X A;  2W9M A;  2A3D A;  2XM1 A;  1SUM B;  1E7P A;  4UB4 A;  9ICH A;  1D0Z A;  2BZB A;  3WAK A;  5AQR B;  2RP4 A;  1UK5 A;  3J9X 1;  5HXE A;  1MIW A;  2L8K A;  4L9I A;  5J2K A;  8ICR A;  2ZH4 A;  4RQ4 A;  3PJA J;  5FXZ A;  2CXF A;  3KV5 A;  2FCL A;  4J2C A;  2K3W A;  5FVK A;  8ICL A;  4R64 A;  2E2A A;  7ICH A;  4WW0 A;  1D1A A;  5JRE A;  3E22 E;  4AT9 A;  2CMR A;  3UU8 A;  3C98 B;  1HUZ A;  9ICL A;  3OPC A;  4WC7 A;  2H89 A;  4EAH A;  4I43 B;  1HG2 A;  5DKW A;  4FHY A;  1YQ4 A;  4JLX A;  4JEU B;  2VKH A;  4MF8 A;  3EVY A;  3FZM B;  5AQP B;  1ZQI A;  1HCI A;  2Q9Q C;  1MMD A;  4C90 A;  3AE8 A;  3LQC B;  9ICQ A;  4ISS A;  4XRH A;  3LSV A;  3C2M A;  4A5X A;  5J0Y A;  4X0A A;  2I0M A;  3AQN A;  4B3T T;  4UAW A;  3HKD E;  2MTQ A;  2CHN A;  4ZHQ E;  4ILU A;  2J62 A;  5F3J A;  4PK6 A;  3Q5W A;  1ZQV A;  3CPZ A;  3RJF A;  5B3Q A;  1US7 B;  3NRY A;  9ICP A;  3U78 A;  3FXE B;  2ZM2 A;  2DRB A;  4YY3 T;  5DB6 A;  5JVD E;  5FY0 A;  3AVS A;  4PFP A;  4PJL A;  5CWR A;  1Y01 A;  3GA8 A;  3UXN A;  4DVD A;  2WDQ A;  4K8V A;  4PJN A;  2W62 A;  8ICU A;  3RC3 A;  5J0P A;  2BKO A;  9ICK A;  1OED B;  8ICN A;  2SPC A;  4K96 A;  2W00 A;  2OV9 A;  4I29 A;  3PHZ A;  2WU2 A;  2X66 A;  1W0B A;  4FHP A;  4JI0 T;  5TZV A;  3EHZ A;  4GK5 E;  4KHZ F;  3ZT7 A;  3PUW F;  1ZQZ A;  4DR6 T;  5IIL A;  1YQ3 A;  4RQ7 A;  3AEA A;  5DDY A;  4PNI A;  4UR9 A;  4X4Q A;  3AA7 B;  2J1D G;  3O4X E;  2BG9 C;  2ISP A;  2LKH A;  2W0G A;  1KDH A;  4H9S E;  3BQK A;  7ICG A;  1R8B A;  2KSR A;  4I0U A;  3RIU A;  4JI4 T;  3O1H A;  3PUY F;  4LF7 T;  2VK9 A;  4LF9 T;  3NBX X;  4IIJ E;  4KX6 A;  3OVS A;  3AE7 A;  5III A;  9ICS A;  4L0R A;  4CZZ B;  4DO9 A;  3ZJ2 A;  3HWT A;  3RGL A;  4X66 T;  4CI2 B;  1N33 T;  3V7K A;  1IBM T;  3AU6 A;  1KNY A;  3N9P A;  2ZH5 A;  4MKP A;  2CLY B;  4YTM A;  3ZN1 B;  5CFU A;  1IAP A;  4RQ6 A;  4UEM A;  2IIU A;  4O69 A;  5LHI B;  4K99 A;  3IHR A;  7ICP A;  2WP9 A;  3RJE A;  8ICE A;  3SWH A;  1BR4 A;  4F8H A;  1TFY A;  3FXD B;  9ICV A;  1KEY A;  1R8C A;  2FJB A;  4M47 A;  7ICU A;  4UXN B;  5JR9 A;  4H63 V;  3EAB A;  4ZZB A;  3RRC A;  2EHO B;  4UB1 A;  4EIW A;  3B0X A;  3GN5 A;  3QK6 A;  4QX8 B;  4EXT A;  3PUV F;  3OGU A;  4DV6 T;  2DI4 A;  1WR0 A;  4I2F A;  1EZ3 A;  4U72 A;  4YMM A;  3FHN A;  4BJN A;  2AE9 A;  2W67 A;  1MQ2 A;  1ZQC A;  4IL9 A;  4LF4 T;  1ZQU A;  4HFE A;  1FJG T;  3N9M A;  1JN3 A;  2C5J A;  4ZI2 C;  1UGO A;  4JI1 T;  2V7K A;  5BMV E;  5AQQ B;  4NXU A;  4P4P A;  3N5L A;  5HRF A;  1D0Y A;  2CXD A;  3MDA A;  1HR0 T;  2O5A A;  9ICM A;  3Q2M A;  8ICB A;  1J5E T;  4JUY A;  4YMO A;  4EZ4 A;  2UXN B;  1ZQD A;  2W2U A;  1YKE B;  1YW0 A;  3UUB A;  3AE2 A;  1OED C;  2CPT A;  4OYK A;  3VRB A;  4NXV A;  2DVI A;  2CXL A;  4IQV A;  3CX6 B;  2DNX A;  1SA0 E;  4EV6 A;  2V7I A;  5FYM A;  3NRX A;  3UQ0 A;  2BCR A;  8ICX A;  3AA1 B;  3NWI A;  4NXT A;  3P4S A;  4A97 A;  4CXX A;  4HWI B;  2LM9 A;  1GPJ A;  3I0O A;  5KXJ A;  4RPY A;  5B3P A;  3QB5 K;  3GWH A;  4I2B A;  4BJM A;  4R63 A;  2YKS A;  8ICM A;  2VQE T;  7ICO A;  3AAI A;  1ZP0 A;  5LG4 A;  2LSI A;  5J2I A;  3RYI E;  1BR0 A;  5HRI A;  2KND A;  2KIN B;  2WWU A;  3UUM A;  5FNV E;  3ZPO A;  3OVB A;  1BR1 A;  2M2U A;  4KLT A;  5L3B B;  4YSZ A;  5HWY A;  3ZKR A;  7ICL A;  4FH5 A;  2XQ9 A;  5HYA A;  2ZH7 A;  1X9B A;  3RC8 A;  1YKH B;  3OVU A;  4JWM A;  4K0U A;  4X20 E;  4K4H A;  4G63 A;  5LOV E;  3H38 A;  3OWG A;  5HHI A;  8ICO A;  2OA5 A;  4QX7 B;  4WC6 A;  3RI5 A;  3ANW A;  2BVL A;  3ZST A;  1QLB A;  4R65 A;  2ACZ A;  4TUR A;  4QZI A;  3KDS E;  4S3N A;  1N32 T;  4QZC A;  2V1D B;  2HPL A;  2W61 A;  3ZJ1 A;  1MMG A;  5L3G B;  2M2W A;  5ABG A;  2IDO B;  5J1G A;  4KLM A;  2K24 A;  2X67 A;  5EOZ A;  1ZQO A;  8ICC A;  5AQU B;  1IBK T;  3ZEF B;  2NTX A;  1BPE A;  2LEH A;  2KT9 A;  1BPY A;  5CFB A;  2XQ6 A;  2X68 A;  1M7K A;  2RA1 A;  1UEV A;  3WFO A;  4JI5 T;  3V5S A;  2XQ8 A;  2BS4 A;  4RT2 A;  4M9N A;  3RIA A;  4ZI3 C;  3UPQ A;  5IIO A;  3AA6 B;  3MZK B;  4CQI A;  4WH5 A;  2VKD A;  2H7O A;  4AI6 A;  3TKL B;  3LK2 B;  2X51 A;  5FL0 A;  5L47 A;  2FMQ A;  1Z8U A;  1ZHC A;  4V1A v;  8ICG A;  3I0Q A;  3V72 A;  3JCF A;  1G8X A;  5HAX A;  4DR2 T;  2BKP A;  3RH4 A;  8ICZ A;  4P1N A;  3RJG A;  3L9D A;  1QSD A;  4KLG A;  3WAJ A;  3Q9D A;  4EYU A;  2KWH A;  4AQF C;  1CUN A;  2KWI B;  3V7L A;  3NKU A;  4U33 A;  1SHZ C;  3SS1 A;  2WWV A;  2QRX A;  1UCU A;  2XPK A;  4U31 A;  4DUZ T;  3HKB E;  2HHH T;  3PDY A;  2ZHA A;  3HJ4 A;  5D62 A;  1XNQ T;  1WYC A;  4AQY T;  3KBU A;  4OAH A;  4AT8 B;  5KX5 E;  1KEJ A;  4XA5 A;  3RKO A;  3ZN0 B;  5HR9 A;  4TNV A;  4AIS A;  2ZM6 T;  1I6Z A;  3RX6 A;  1GQE A;  3QC9 A;  3ZCI A;  4GKK T;  3K75 D;  2VQF T;  3KIN B;  4LEW A;  4AXP A;  5AQG B;  1IJ6 A;  5L4H A;  4AT7 B;  2HPJ A;  3RPU A;  4FHV A;  3JPN A;  2DHR A;  5HRL A;  4JI3 T;  2UXD T;  3WFP A;  4QZA A;  3ZCJ A;  4ATB B;  3OBV E;  4YXD A;  3W15 B;  1D1B A;  3P50 A;  4ZS3 A;  4H63 H;  2WZH A;  4QH4 A;  4F5R A;  1ZQJ A;  3ZMS B;  3UU4 A;  4KHP T;  1Q78 A;  2BVM A;  3QNU A;  2ZH9 A;  3HIY A;  4DMV A;  5AQS B;  4IE4 A;  4IDN A;  3JAF A;  9ICR A;  3OVA A;  9ICJ A;  1Y64 B;  2BS3 A;  2MYS A;  2KXP B;  5J2C A;  1UEU A;  4E80 A;  3LBX B;  2CBJ A;  3CX8 B;  8ICK A;  2X0H A;  2HH7 A;  2DR5 A;  5HRE A;  4CN4 A;  2BPF A;  3UUL A;  3PUQ A;  1I94 T;  4IDO A;  4AQF A;  3B0Y A;  3MCR A;  5CA7 A;  2ISO A;  2K5B B;  4DR1 T;  3NVO A;  5ABE A;  4ZEY A;  3CK6 A;  2BBJ A;  5JQG E;  7ICS A;  2XQ3 A;  5J2F A;  3AQM A;  4DV7 T;  4YLH A;  3MBY A;  5LHG B;  1ZV4 X;  3N2G E;  3C2K A;  2GK9 A;  2B76 A;  1IJ5 A;  5HEO A;  4NM1 A;  4WBN E;  4QH5 A;  5AQJ B;  4H9R C;  4HWH A;  4F5O A;  2WSS V;  2LM2 A;  4KLU A;  2ES0 A;  5HXS A;  4X5T A;  5DED A;  5ABF A;  2DR9 A;  5EZY E;  2NWB A;  4WZX A;  4QZ9 A;  3CX7 B;  1WOT A;  2BCQ A;  4CI1 B;  1S94 A;  1E1H B;  3QB5 A;  4E7X A;  5HRB A;  7ICE A;  4UEL A;  3LK4 2;  3SOL A;  5JDM A;  1ZQP A;  2HN1 A;  3PUA A;  3VKH A;  3SFE A;  1LRZ A;  2D2S A;  4X4V A;  2VAN A;  8ICJ A;  3BQI A;  3DTO A;  2LKG A;  5LBM A;  4O6A A;  4PHA A;  5HCJ A;  5FL1 A;  3KV9 A;  2DR8 A;  8ICV A;  2DR7 A;  5JDQ A;  3J7Y q;  4UIG A;  2XJ7 A;  4LZD A;  3GMI A;  3RHW A;  4B3S T;  4K98 A;  5CFT A;  4Z6D A;  2ZLY A;  5AQT B;  3RLF F;  2VUR A;  3AEE A;  4F5P A;  4N78 D;  4JLZ A;  4O4H E;  3LG7 A;  4X4O A;  1IBL T;  3FBL A;  2DCF A;  1ZQG A;  4E7Z A;  4ZI2 D;  2UXX B;  2X9W A;  3N9L A;  1JNZ A;  2FMP A;  7ICR A;  4H9P C;  1XSL A;  4QXC B;  4F6R C;  4NY8 A;  3OKQ A;  3PUS A;  4B6X A;  5LHH B;  4I4T E;  3ZMV B;  5LBQ B;  4UBB A;  5J2H A;  1ZQA A;  1ZJM A;  1W0A A;  2E8I A;  5HRG A;  4QWN B;  3K3O A;  3C2L A;  2NR4 A;  4K4G A;  4O4J E;  5AQO B;  2WZI A;  5J0S A;  3ONX A;  4YJ2 E;  3ZLI A;  4U2Z A;  5J2A A;  1VCT A;  4HKA A;  4I2G A;  4H9Q C;  2FJD A;  2P9B A;  3C50 A;  2PG8 A;  5DQW A;  2VAS A;  3NYB A;  4YHH T;  4TUP A;  2YEV C;  4ZI7 E;  4O5K A;  1NO5 A;  2O1P A;  4A56 A;  1HF8 A;  9ICB A;  4FHW A;  4HWC A;  3UPS A;  4HFC A;  4DBR A;  3BK9 A;  4JV5 T;  1ZQW A;  3N9O A;  4QXH B;  1ZQT A;  3K3N A;  4GIW A;  4WC2 A;  4LEZ A;  9ICF A;  1NOM A;  2LSJ A;  2AXD S;  2ZM0 A;  3OYX A;  4TWH A;  2X0Y A;  4O68 A;  3FZL B;  3HW8 A;  4A98 A;  1W9R A;  4KLO A;  2W66 A;  4UF0 A;  1N34 T;  3WFR E;  7ICF A;  1OU5 A;  4U2Y A;  1FA0 A;  3JYY A;  3C66 A;  2GA9 D;  5F2V O;  5DB8 A;  1QUU A;  7ICI A;  1H7C A;  1KNZ A;  2N1G A;  2Q9Q A;  2MPK A;  3ESL A;  4GXK A;  3OYZ A;  1ZJN A;  5CHG A;  2FJA A;  4DBQ A;  4DR4 T;  3RH6 A;  2CWY A;  1J1J A;  3TLT A;  2IC6 A;  3WFQ E;  1HS7 A;  3JZ0 A;  1OED E;  3QUJ A;  4L5G A;  3OUY A;  1ZQY A;  2DRA A;  4QZH A;  5D61 A;  5AQK B;  2LJL A;  3HKE E;  3LK3 B;  3KVB A;  4RWO A;  3MGH A;  5D63 A;  1JNR A;  5LG3 A;  4KB6 A;  3UU5 A;  5AQV B;  2V6Y B;  4K0K T;  5HEG A;  4I28 A;  4GXI A;  4KM5 A;  1F5A A;  4YMN A;  1ZQK A;  3AVR A;  1R8A A;  1V4A A;  4EEB A;  3PUG A;  4HWF A;  1KF6 A;  2JQQ A;  3RJK A;  2BE3 A;  7ICK A;  3JPO A;  1UX4 A;  2PBI A;  4E7S A;  2EHO D;  3C5G A;  4KLI A;  3OTO T;  2LHN A;  3AXJ B;  3CIR A;  1LKX A;  4QXB B;  3KVA A;  3MGI A;  3MXZ A;  4TN7 B;  4WQK A;  4MBQ A;  3A7M A;  1WCR A;  2K48 A;  1BPZ A;  4FI5 A;  2JMH A;  4ZI3 D;  5LGU B;  3AB3 B;  2V7L A;  2MAW A;  4WNK A;  2M6I A;  4LML A;  5IIN A;  4PPX A;  4I2I A;  3ISB A;  5FXV A;  3E08 A;  5KMG P;  3RJI A;  1V9D A;  2BG9 A;  3P4W A;  4CN1 A;  5JRC A;  5IIJ A;  5LA6 E;  4B3R T;  4XZC A;  1N36 T;  4P0B A;  5HEH A;  1L0V A;  3VR8 A;  5J0X A;  4EYY R;  3JPQ A;  5FXX A;  3ER9 B;  3F31 A;  4G2A A;  4BA9 A;  5C3J A;  3P4Q A;  4UAY A;  9ICG A;  3AEC A;  5IWA T;  2LRL A;  2V6X A;  5LCY A;  1NEN A;  3MA9 A;  4GK0 E;  1AJ3 A;  2BCV A;  2JPF A;  2M6B A;  3JPP A;  4UVC B;  2E9X B;  4X64 T;  3ISC A;  5FY7 A;  3ONL C;  3UFG A;  4DR5 T;  2NW7 A;  3RQW A;  4LT6 A;  4LFC T;  4X65 T;  3BQL A;  1HUO A;  3B5M A;  5HEU A;  4LF6 T;  3Q5D A;  5CP2 A;  2WMN A;  4FHX A;  1U4Q A;  3PML A;  1HX8 A;  1HG5 A;  1OWA A;  2BPG A;  4DOC A;  4UB3 A;  1YLQ A;  2LOS A;  2IW5 B;  1G73 A;  1HTJ F;  3ZYK A;  4IGU A;  4PHD A;  4PGQ A;  5BOM A;  4EED A;  4AQG A;  4GYS A;  5CA0 E;  1ZEE A;  4X1Y E;  5HHH A;  4DND A;  2A9U A;  3IBP A;  4OAF A;  1YXR A;  5ADX L;  4OYJ A;  3PTR B;  9ICT A;  2YU2 A;  4IQT A;  5LJN A;  2BCU A;  4IDQ A;  4IHJ E;  5LYJ E;  3T8O A;  2FJE A;  4FJO A;  3EF2 A;  3AA0 B;  4X4T A;  1XMO T;  4NXX A;  3H39 A;  2BDE A;  2V5D A;  3H37 A;  3AE1 A;  3ONJ A;  3P8C D;  4CXY A;  4WC0 A;  4C91 A;  4I2H A;  4UBC A;  2LLY A;  4DOA A;  4EB6 E;  2XQ5 A;  4MFC A;  2RPA A;  3E0Z A;  5HRD A;  4YN4 A;  5JDH A;  4WBZ A;  2I59 A;  1ZQM A;  4KBM B;  4LEY A;  2CLY C;  5FP3 A;  3MAC A;  2I6H A;  4P09 A;  3C4W A;  4M9L A;  3I9Y A;  3QOF A;  5HWX A;  4EBJ A;  4P4O A;  3IF8 B;  4AT9 B;  2WDR A;  3EI0 A;  2IAK A;  4AKL A;  4HN9 A;  4HFD A;  3EUH A;  2VVS A;  4TUS A;  3ETU A;  3AE3 A;  4AIU A;  4OHF A;  1OED A;  4CXW A;  1IZN B;  4NXM T;  4FO1 A;  2B56 A;  3CKD A;  2EHO C;  4OFZ A;  2V26 A;  4PGY A;  2JJ9 A;  4LF5 T;  5JH7 E;  4U7Y A;  1Q79 A;  9ICC A;  3AUO A;  4YHJ A;  4MHC A;  4KLH A;  2PTF A;  4ASK A;  1MMN A;  4I50 E;  5DB9 A;  4I2J A;  5IHY A;  2NRK A;  5LMN T;  3UU6 A;  4BAY B;  2XM2 A;  3L8R A;  3L39 A;  1UUR A;  1ZQE A;  3MJX A;  3L3P A;  4X4R A;  5AQI B;  4IDP A;  3ZMU B;  5EK3 A;  1WLX A;  3HA4 A;  1HNX T;  4JEH B;  1ZQQ A;  5J2T E;  4P4M A;  2E9X C;  5J29 A;  1WR6 A;  4YD1 A;  4M2Y A;  4PK5 A;  1DU2 A;  3V5U A;  4YTN A;  3TLS A;  1VJ7 A;  3H3M A;  3DJB A;  4PFO A;  1UX5 A;  1T8B A;  5HEJ A;  5LP6 E;  4I2D A;  5J2J A;  2BPC A;  1CHU A;  2XUE A;  2YU1 A;  1T7S A;  4LF8 T;  4DMW A;  2PXI A;  2G0U A;  2Q66 A;  2QYW A;  5J0W A;  2H88 A;  2N2N A;  4MFF A;  2A2F X;  3ZC1 A;  4ERR A;  2GWS A;  1OXZ A;  4JI7 T;  4EBK A;  4X4S A;  4H9N C;  4PK4 A;  3RF1 A;  4NPP A;  9ICW A;  2LSG A;  1HX1 B;  4ZXL A;  2YDQ A;  4WOY A;  4UB2 A;  2EHO A;  2WCA A;  4M9G A;  4TWD A;  4OK0 A;  5LXT E;  2FMS A;  4KMC A;  4QZB A;  4UVA B;  3PUZ F;  4ADZ A;  2PFO A;  4X4P A;  3HKC E;  4QZF A;  2W63 A;  5L3C B;  5J0Z A;  2L3L A;  2YOE A;  4M5D A;  1T98 A;  2NW9 A;  4CI3 B;  2F4V T;  4YT0 A;  5HRK A;  1ZQB A;  2V5C A;  4HGA A;  1FEW A;  4O9M A;  4LFA T;  2XQ7 A;  4HFB A;  5DBB A;  5GON E;  5J2U E;  3ISD A;  3AED A;  4QH1 A;  2XAH B;  3AE6 A;  4IE6 A;  3UQ2 A;  3B57 A;  4YTP A;  3I1A A;  1ZQH A;  2OLT A;  4RQ2 A;  4RQ1 A;  1XZY A;  2VL8 A;  3MKD A;  3M65 A;  4NLN A;  4YFS A;  3NZQ A;  5JR9 B;  5J2B A;  3UQ7 A;  4KLL A;  4ILA A;  2WAU A;  2IML A;  2XQA A;  4IG8 A;  3RJJ A;  9ICO A;  3RRW A;  2LT3 A;  4XAX B;  4E8F A;  3PV0 F;  1XMQ T;  3GN5 B;  1FMV A;  2LRK A;  4XUS A;  4K4I A;  2BCS A;  4DV5 T;  4MAL A;  4Z6F A;  4ZOL E;  2WU5 A;  3DP7 A;  1ZQS A;  3HX0 A;  3C64 A;  4NXN T;  2PJQ A;  3EDV A;  2WB5 A;  4NM2 A;  4AKH A;  3SFD A;  2EWR A;  3PMN A;  1MND A;  5CR0 A;  2X9H A;  4I27 A;  4Q25 A;  3ZYM A;  2PBE A;  4PHE A;  4IQW A;  3IEE A;  1W09 A;  4P2H A;  3JAE A;  1PX5 A;  1ZOY A;  4X1K E;  4LFB T;  1XDP A;  8ICH A;  1HFA A;  5L3F B;  4XQ8 A;  2L9Q A;  3CWZ B;  2Z6E A;  2XAJ B;  3I9W A;  5J2E A;  1NEK A;  2BG9 E;  5DBC A;  1MNE A;  5KDM C;  1UET A;  4WC5 A;  2J47 A;  5LGN B;  4RQ0 A;  4QZG A;  8ICT A;  4LVS A;  5HXH A;  4PAG A;  4NLZ A;  2IHR 1;  2CA5 A;  5H6R B;  2CM0 A;  3JPS A;  3TLW A;  4Z90 A;  4JBW F;  3RH5 A;  3K1S A;  7ICT A;  5FVL A;  3UFE A;  2DWK A;  5AQL B;  4MFA A;  1MIY A;  2UUC T;  3RQU A;  3P4R A;  4I55 E;  4Z8X A;  4HEA A;  3AEB A;  5J0R A;  4HWD A;  4JI6 T;  2NW8 A;  2UXC T;  3EDU A;  5C2T A;  5CHE A;  3AEF A;  2UU9 T;  3NKZ A;  1TV9 A;  1MQ3 A;  9ICX A;  2V8S V;  3K3Q C;  5AFU L;  5BPC A;  4K9B A;  1JAJ A;  1VOM A;  2XAS B;  2JQH A;  1D1C A;  1JMS A;  3RIU C;  2ZH6 A;  4RWN A;  4TX5 A;  2NTY A;  4KLE A;  5HRH A;  2B1E A;  3ERC C;  2JRK A;  9ICE A;  3ZMT B;  4UV8 B;  3SRZ A;  4CN6 A;  2CRB A;  5JTG A;  4IRE A;  4WQL A;  5H6Q B;  3AQL A;  4TWF A;  3FZH B;  4NKT A;  3AQK A;  5FY1 A;  2YDS A;  4GKJ T;  2E5L T;  4RQ5 A;  2XAQ B;  4Z6E A;  4QHO A;  4QZD A;  2DLR A;  3PU8 A;  2ZH8 A;  5D46 A;  3JPR A;  5IUX A;  2VVN A;  4FH3 A;  3NZP A;  4O4I E;  3ANW B;  2J4G A;  4UD5 A;  5LB7 B;  2ZMA A;  1D0X A;  5L4E A;  9ICA A;  3TLV A;  5LJM A;  5JR9 C;  4RQ8 A;  3N9Q A;  3M3Z B;  3PUX F;  4X0B A;  3Q5E A;  1X79 A;  2WBL A;  2WQY A;  2ODV A;  4ZZC A;  4WC4 A;  3ZT5 A;  3TFS A;  2HN2 A;  7ICQ A;  2UUB T;  4LMK A;  5J0T A;  3ZMZ B;  4TNW A;  2D0U A;  5JDG A;  2D0T A;  1VRB A;  5L3D B;  4AT8 A;  4QKN A;  4KI0 F;  1JQR A;  3ZYL A;  4M0A A;  4X5V A;  3L09 A;  5L3E B;  2YK0 A;  3ZT6 A;  2LE8 A;  4ILC A;  3N9N A;  4NLK A;  2A72 A;  4IST A;  5DBA A;  1XDO A;  1MIV A;  4AT7 A;  3MK7 C;  5DB7 A;  3JC6 C;  4ZS2 A;  3C4X A;  1XSN A;  4M1P A;  4JYA T;  1J5W A;  8ICY A;  5EK4 A;  1LVF A;  5IIK A;  4ATB A;  2KZ7 B;  1BR2 A;  4Z6C A;  5FXW A;  5CB4 E;  3VHL A;  2XTL A;  3N2O A;  1BPX A;  4ILB A;  4DV3 T;  4XQ7 A;  2Y48 B;  3UTK A;  5TAO A;  2B51 A;  5CGM A;  4U74 A;  1B7T A;  1R8I A;  8ICS A;  4KUM B;  1KNP A;  3FZK B;  2E5V A;  3PU3 A;  3MDC A;  1FMW A;  2LHR A;  4DR7 T;  3K7D A;  4MF2 A;  3A8Y C;  5DQV A;  4FO6 A;  2C0S A;  3LBX A;  3ETV A;  2Y8D A;  2MOZ A;  5J2D A;  8ICQ A;  5IYZ E;  3B13 A;  2C5I T;  3KFW X;  5LNK A;  4LEV A;  3CVR A;  3JAD A;  4PHP A;  4X4U A;  2XAG B;  4WBY A;  4NIQ A;  4TUQ A;  4IE0 A;  3P7I A;  4EOZ B;  3AAA B;  1YD8 G;  7ICJ A;  2QVA A;  4OAI Z;  2N9D A;  8ICW A;  4PW8 A;  5IIM A;  4OX9 T;  2UUA T;  3RYC E;  2E9X D;  1ZQX A;  3WFS C;  4GOU A;  3ZC0 A;  4RPX A;  3UXP A;  3AE4 A;  3PJA A;  3LK9 A;  2X0L B;  3AAE B;  4KP3 C;  3PUR A;  2JMK A;  1RZT A;  1M62 A;  4H9O C;  4COF A;  2DL1 A;  3OV7 A;  5HXC A;  5JDN A;  4O67 A;  3ZSS A;  2BKN A;  3V7J A;  2R6G F;  5C8Y E;  3X1D A;  3K8P C;  4LMJ A;  2KLQ A;  3Q5X A;  4U7I A;  1XNR T;  3O1I A;  4RWQ A;  4JI8 T;  2UXB T;  3C4Z A;  5CA1 E;  3HL6 A;  4HFH A;  4RT3 A;  3GDX A;  2I9G A;  5A1L A;  2ID1 A;  4DV4 T;  1MMA A;  2ACX A;  1FIO A;  4YSY A;  4R66 A;  3H3A A;  4IT4 A;  1O3X A;  4NUV A;  2WDV A;  3RH3 A;  7ICM A;  5FKY A;  1UUS A;  1VFG A;  5F8P A;  4M9J A;  1ZQR A;  4JLE A;  4HE8 A;  4RWP A;  4O8S A;  4IE7 A;  4YJ3 E;  4K9A A;  2CEA A;  3PNC A;  4JI2 T;  2NP9 A;  4KLD A;  4PJJ A;  1VCS A;  4I2C A;  1KFY A;  4AKR B;  3CML A;  4AKG A;  3FBZ A;  5DAB A;  3LJC A;  4O5C A;  2CCQ A;  9ICN A;  3P4P A;  1ZQF A;  5J0Q A;  4Z91 A;  3WI3 A;  1BPD A;  3D0T A;  4JWN A;  5ABF B;  3AEG A;  1HNW T;  3PE0 A;  3IA3 A;  3CQC B;  5CJ5 A;  4MFR A;  4HFV A;  2IUB A;  3VU7 H;  4O2B E;  2WMO A;  1NWM X;  4PGX A;  5J0O A;  4F5N A;  2W4X A;  3VR9 A;  4HTE A;  3VRA A;  4I2E A;  5ABH A;  4PH5 A;  2WM9 A;  1S35 A;  4DV2 T;  4O4L E;  4DUY T;  5D4B A;  2CBI A;  2YN6 A;  2PFV A;  4N7R A;  5BR8 T;  4IL4 A;  8ICI A;  4NXZ A;  4DID B;  4QZE A;  3RYH E;  4UAZ A;  4KLJ A;  2LSY A;  4K97 A;  2HHP A;  4EGW A;  4MLK A;  4WYV A;  4M04 A;  2DWG A;  3UUN A;  3CQG B;  4X4N A;  3S4U A;  4P0A A;  4XBF B;  2VKO A;  4LZG A;  4YSX A;  2X9X A;  2V7J A;  4GYR A;  2VB6 A;  3T1Y T;  2XY8 B;  1WYB A;  1XWM A;  4WC1 A;  2IHM A;  2VWA A;  2WS3 A;  4RPZ A;  2KMF A;  4X62 T;  3U3I A;  2PFP A;  2NOX A;  4F5Q A;  2XSB A;  9ICU A;  3AU2 A;  3HJ1 A;  2RFF A;  1WFD A;  2IHO A;  4XJE A;  2M67 A;  5AQN B;  4O2A E;  2D5U A;  1LVK A;  2M2V A;  2XSA A;  5EK2 A;  3LDQ B;  2QA7 A;  2D9D A;  1TFW A;  5DDM A;  3EAM A;  2QGS A;  4IDZ A;  3AE9 A;  2ZH1 A;  3C51 A;  4TV9 E;  4ANJ A;  4IQU A;  3F57 A;  2BS2 A;  5F5W A;  3HI2 A;  4HX0 A;  3ER8 C;  4GXJ A;  4OAG A;  4WBO A;  2JQK A;  1KNR A;  2V6Y A;  3AE5 A;  5HCM A;  2GAF D;  3R6N A;  3R84 B;  4I2A A;  3UQ4 A;  5D49 A;  2ODU A;  4EZH A;  2ZHB A;  2CE7 A;  5JDF A;  3A5X A;  4NXW A;  2IC9 A;  4U3C A;  4X1I E;  1U5P A;  5CJ7 A;  1E2A A;  2JQ9 A;  2ZH2 A;  5E0O A;  2X9Y A;  2FUP A;  4TZ4 C;  2ZM8 A;  2BBH A;  4HFI A;  2XHE B;  4UB5 A;  5M4Y A;  2Q9Q D;  4WC3 A;  3AXJ A;  4YD2 A;  2C5K T;  4PJM A;  2V7M A;  4UF0 B;  4YCX A;  5HC9 A;  1KK7 A;  2B4V A;  3C5F A;  3KBT A;  5J2G A;  2VKJ A;  2Q9Q B;  5CFS A;  2YDR A;  2FBW A;  4AKI A;  2VL0 A;  5J0U A;  3HR0 A;  4DO0 A;  4DR3 T;  1R89 A;  5DEC A;  1TVA A;  4TV8 E;  2XQ4 A;  3JPT A;  3C18 A;  4DOB A;  4NKU A;  2XQY A;  3OUY B;  5LMU T;  3ABV A;  3UU3 A;  2PFN A;  1BPB A;  2K9A A;  5L2L A;  5JDL A;  1HNZ T;  3TLU A;  5DJQ C;  3KV6 A;  1XSP A;  5ETW A;  2CHO A;  3CQX C;  3LFM A;  5HXR A;  5FMN A;  5CB1 A;  2LOP A;  4DV1 T;  4KLF A;  2E9X A;  3OJA A;  1WRD A;  3RIF A;  4EP7 A;  1RPL A;  3RJH A;  4KLQ A;  3FZF B;  3T1H T;  2MBG A;  2WY2 A;  2ZH3 A;  4RQ3 A;  3F2E A;  4KLS A;  4DV0 T;  3UT5 E; 
#chains in the Genus database with same CATH homology
 5JTG A;  3NVO A;  4EEB A;  2HN1 A;  3CK6 A;  2BBH A;  2IUB A;  3NWI A;  2HN2 A;  3RKG A;  4EED A;  4EGW A;  4EV6 A;  2BBJ A;  3JCF A;  4I0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...