4EGWA

The structure of the soluble domain of cora from methanocaldococcus jannaschii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
MITVIAIAKDGSIVEPKLDEISFEDYRLIWIDCYDPKDEELYKLSKKIGISVSDLQIGLDEQEIPRVEEDEDFYLIIYKAPLFEEDITTTSLGIYIKNNLLLTIHSDKIKAIGRLHKLISTKKPRIVFERGIGFLLYHILNEITRSYSRILMNLEDELEELEDKLLAGYDREVMEKILGLRKTLVYFHKSLIANRDVLVLLKRKYLPITTKEDRENFEDLYYDTLQLIDMSATYREVLTSMMDITLSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the mechanisms of Mg2+ uptake, transport, and gating by CorA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4egwA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4egwA01
4EGWA 2HN2A 2IUBA 3NVOA 4I0UA 3NWIA 2HN1A 3CK6A 3RKGA 4EEDA 4EV6A 5JTGA 2BBJA 2BBHA 4EEBA 3JCFA
chains in the Genus database with same CATH superfamily
1ZQTA 4KMCA 4AKIA 3ZYLA 2V7MA 3B57A 3QUJA 4KLTA 2KXPB 2BG9B 3I9YA 3CMLA 2WWVA 9ICLA 2XM1A 2WCAA 4YLHA 8ICSA 3RRWA 2ZH7A 1N33T 3M65A 2X0HA 4M0AA 4ATBB 4EYUA 4HFIA 3C2MA 4JV5T 4X1KE 5ABGA 4CI1B 3UTKA 4I2DA 4XQ7A 4I28A 3Q5EA 4GK0E 4YHJA 4DVDA 4YSXA 2J62A 4WBNE 3D0TA 1ZQPA 1O3XA 3MJXA 5J1GA 4ZI2C 3KV9A 1KDHA 4L0RA 4NUVA 4IDOA 2LSIA 4K4IA 2UUCT 4KHPT 3N2OA 3HW8A 4ZS3A 4DMVA 3Q5DA 2XM2A 2Q9QC 7ICMA 1ZQFA 4AKHA 2QRXA 1TVAA 3RKGA 2W9MA 4QZHA 9ICKA 1VJ7A 3PMNA 4UD5A 3UXNA 3T8OA 4IREA 5AQJB 2BKOA 2LSKA 4DV3T 1VFGA 4XRHA 1WR0A 4E8FA 4LEVA 2WSSV 4ZXLA 5ADXL 4DV4T 4ZOLE 2CXLA 3ZJ2A 1KEJA 4TWFA 2FJBA 1YQ4A 2BS4A 1KF6A 4TUSA 3OYXA 5EOZA 4NXZA 1HNXT 1HUOA 3B0YA 3TLVA 3C64A 5EZYE 2DR9A 9ICBA 5AQVB 2BCVA 5LA6E 1BPXA 4LMJA 4X62T 5LG4A 4CQIA 4PGYA 4U7YA 4KLFA 1R8IA 5LB7B 2PFNA 2MPKA 5J29A 7ICQA 5HRGA 4YSZA 4H9QC 3AE6A 1R8BA 4LMKA 1JNRA 1QSDA 1MIWA 2BS2A 7ICRA 3RQWA 5EK3A 9ICOA 3J7Yq 4U33A 2LE8A 4ZI3C 4H63V 5FXXA 1JNZA 3HR0A 3PU8A 1IJ5A 2DR8A 5DQVA 1HS7A 3QK6A 5LHGB 4JLZA 2ZM2A 5M4YA 4AQYT 5CA0E 1UUSA 4YJ3E 3KDSE 1HCIA 4AT8A 5D49A 5HWXA 4ZZBA 3V5UA 2QGSA 4X64T 2ZH6A 2J47A 4IG8A 2X0YA 2XASB 4CXYA 2A72A 1VOMA 1KNYA 2X9HA 4FH3A 4IIJE 2GWSA 4EIWA 4OAHA 5IIMA 4HN9A 4X1YE 4DOAA 3AQNA 3C66A 4PGXA 4JI7T 3AU2A 3TLTA 3C51A 3ZSTA 4CN4A 9ICPA 4IDZA 2C5JA 4DV7T 5JDFA 4HGAA 3IA3A 1YQ3A 4B3MT 2FMSA 4P1NA 5CA7A 1EZ3A 4LZGA 4PFOA 2O5AA 4RQ4A 4DR1T 2BVLA 2KSRA 4ASKA 4UXNB 1U4QA 2ZH1A 3K3QC 3AEGA 3LK9A 1XWMA 1VCSA 3PUZF 1CUNA 4NY8A 4RQ7A 3N9PA 5J0UA 4DBQA 3PJAA 4X5TA 5IIKA 5JR9B 5LBMA 2E9XB 1HNWT 2NW8A 4UELA 1NENA 5JDQA 4TWHA 2VKDA 4ILAA 5LG3A 1WLXA 1BPYA 4WBZA 1NAFA 3WAKA 3E0ZA 4NXVA 3AEBA 3P4WA 2EWRA 4LEZA 2XHEB 3OKQA 1Z0PA 4WOYA 4COFA 3OYZA 2XQ7A 5JDLA 2BS3A 2KWIB 3I0OA 5CHGA 3P4SA 3MK7C 4H9OC 1YKEB 5J2JA 4WC7A 3RI5A 1HNZT 3IF8B 5CGMA 2YDRA 1OU5A 2LLYA 4I55E 4EBJA 1UCUA 3AVRA 5FXVA 3AQLA 2EHOC 4B3ST 4EP7A 2VB6A 2W61A 4I2CA 1MIVA 4KLUA 2EHOD 4RWQA 3GDXA 1ZQWA 2XUEA 5J0OA 4YY3T 2MTQA 1JQRA 2CXFA 3U3IA 2IHR1 2E9XD 9ICAA 4ILUA 5LCYA 5DB6A 5L4HA 4E7XA 4K97A 4I2FA 3QC9A 3RH5A 2IUBA 4F5RA 3B0XA 3SFDA 8ICQA 2RP4A 4WBYA 5F3JA 5DBBA 2CPTA 4YTPA 4DR6T 2V6XA 2NTYA 3OWGA 4JI0T 5L3GB 4GXIA 3RC3A 4LFCT 2X67A 1LVKA 4WH5A 3P4RA 5DB9A 1HUZA 2XAHB 4LF5T 4QH4A 3ZCIA 3TKLB 4DMWA 3TFSA 4UIGA 2ODUA 9ICJA 4M47A 4M9LA 1LRZA 3RLFF 4BAYB 4MFRA 3PJAJ 2WWUA 2IIUA 4WQKA 4AXPA 4TNVA 3PTRB 1UETA 3AQKA 1NWMX 2X51A 4O67A 1ZOYA 3HJ1A 2BZBA 1FMWA 4HWHA 1IBMT 3CQGB 3AE3A 1XNQT 2XAFB 5JR9A 5HYAA 4O5KA 1XMQT 2UXXB 4P0BA 2LKGA 4FI5A 2BG9C 4C90A 1FA0A 2A2FX 4AISA 4UB2A 1ZQYA 4L5GA 1RPLA 2HH7A 3X1DA 4WC1A 3P8CD 5C8YE 4JI1T 2IDOB 3RX6A 3EI0A 3PUSA 2Q9QA 4AQFC 1UK5A 5CFTA 4O68A 1BPDA 4JI8T 8ICCA 2Q9QD 7ICVA 5IWAT 3IHRA 4AI6A 2V7JA 4UB4A 4LF9T 8ICBA 1F5AA 3QNUA 2NTXA 4WW0A 4U2ZA 2C0SA 4ZHQE 3UU6A 4BJMA 3AE7A 2DRAA 2ES0A 1UGOA 1IAPA 8ICFA 4AQFA 2Q66A 4HFVA 4RPXA 1CHUA 4P09A 2O1PA 2XSBA 1I94T 5LMNT 9ICXA 4CXXA 1ZQVA 4X4NA 3LG7A 3GMIA 4O5EA 4Z6DA 3RJJA 1HX8A 5F5WA 4M9JA 2XSAA 4KLQA 8ICLA 4FO6A 4NXNT 3RYFE 2V5CA 2F4VT 3C5GA 3DJBA 5HR9A 5LOVE 3CWZB 4LVSA 3ANWB 1YKHB 4MFFA 3AAIA 3KBTA 3NRXA 3RIUA 4RQ0A 2NW9A 4RQ6A 4Z6CA 2UXBT 3AEFA 4I2AA 3VHLA 2KMFA 4O8SA 5FY1A 3RHWA 2ZH5A 1HFAA 5DECA 4P4MA 2VWAA 4M9GA 3OJAA 7ICPA 4PK5A 5AQUB 5TAOA 4EZ4A 2ACZA 3ZYKA 3RPUA 1OXZA 3K3OA 4YXDA 4PK6A 2E2AA 2NP9A 4HTEA 4EBKA 2FJAA 4F5NA 5HRKA 5CFSA 5JTGA 4AKLA 5JH7E 3AAAB 5HRIA 4YT0A 3NKZA 4YHHT 4PJLA 1BPEA 4OHFA 2D9DA 5HEGA 3GN5B 5DBAA 1WCRA 1B7TA 2X9WA 2XJ7A 4IT4A 4N78D 4LEYA 1VRBA 3JC6C 3VKHA 4YD2A 1H7CA 9ICGA 3ZYMA 4R64A 4MHCA 1FEWA 2DWGA 3G06A 2YKSA 7ICHA 4WBOA 4PJMA 3SS1A 5J2FA 4NIQA 3ER9B 5CFBA 4X65T 4KUMB 4UB1A 5AQTB 3OUYA 2DLRA 2K9AA 3RYHE 2XQ8A 3ABVA 1R8AA 4LF7T 4NLKA 2XPKA 4K4HA 2YOEA 2CCQA 3ZN0B 1UURA 2VASA 2V5DA 1GPJA 3KBUA 2I59A 1SE7A 1QLBA 4X0AA 4K4GA 3ZLIA 4A5XA 4G63A 3N5LA 7ICNA 2Z6EA 1HG5A 4P4PA 7ICUA 4U2YA 4FHPA 1XMOT 3CIRA 4X5VA 4UB5A 4RT2A 3A8YC 5HXEA 2R6GF 9ICNA 3R84B 3UUMA 4NXTA 2FJEA 4Z6FA 4F5QA 3KV5A 5JREA 4LMLA 5IHYA 1MQ3A 4NKTA 2OLTA 2WQYA 2PFQA 1PX5A 4KI0F 2KWHA 2X0LB 2ACXA 3UQ2A 3TLWA 3JZ0A 8ICWA 2H7OA 4UF0B 3WAJA 4M1PA 4HWFA 4O2AE 3EDVA 2NW7A 2WDQA 4TUPA 2ZHBA 9ICUA 4O4LE 4H9SE 3K8PC 2AE9A 3O4XE 2BCUA 5LGTB 1Y01A 4PK4A 4MF2A 1TFWA 5AQQB 3AE1A 1U5PA 5J2BA 2V6YB 8ICRA 4DR4T 2IHOA 3MBYA 4LF6T 4NKUA 4PPXA 5HHHA 3K1SA 8ICJA 4FH5A 4KLMA 4X0BA 5HEOA 2FMPA 2GAFD 3P7IA 4ISTA 5HREA 4RWNA 2V7KA 3C2LA 1OEDA 1HG2A 1IBKT 4OFZA 4GXJA 4X4OA 4JI6T 2XQ4A 2JQ9A 5J0QA 2ZMAA 4TWDA 5AQHB 5HRHA 4QZFA 4UAWA 2VKOA 3MGHA 4R65A 2NRKA 4IE5A 5J2AA 3PURA 2YU1A 4WC6A 2NOXA 4MLKA 3F31A 8ICKA 4TX5A 3UPSA 1ZHCA 2BKPA 3C4WA 1UX4A 4KB6A 2GA9D 3RIUC 3HX0A 4ISSA 2DI4A 9ICEA 4EAHA 4PHDA 3ANWA 5AQKB 4M9HA 4XAXB 3MDAA 2ZLYA 2H89A 3UPQA 5DBCA 4N7RA 3MDCA 2WDRA 5FL0A 2XAJB 3UQ7A 4X66T 4PH5A 4UEMA 3N9MA 2BCQA 3CVRA 4FHWA 4JI3T 1MNEA 4FHXA 2YDQA 3RJFA 4DR3T 2ZH4A 5FNVE 2BVMA 2N1GA 3HI2A 4IQUA 2X9YA 3R6NA 1W0BA 2WBLA 3UU8A 4RWPA 3AUOA 1J5WA 4H63H 1VCTA 3CQXC 4K9AA 4M5DA 2PTFA 2VANA 2BBJA 1N32T 1ZV4X 5J2HA 2PFPA 8ICEA 2LHRA 4WQLA 5IIIA 5J0SA 4QWNB 1ZQZA 5AQNB 9ICMA 5HRFA 4I4TE 2HN2A 2XAGB 4U3CA 3UUNA 3CPZA 5IINA 4KLDA 3FXEB 3ONJA 5IIOA 2KT9A 5HXRA 5ETWA 1ZQHA 2VKHA 3ETVA 3NKUA 4G2AA 3EHZA 5HCMA 3AE9A 3UUXB 4MBQA 4I2GA 3SOLA 3GN5A 3W15B 5DDMA 1HX1B 4JWMA 4H9NC 4Z8XA 1OEDE 1ZQBA 4B3RT 2E5VA 3QOFA 1LKXA 4GKJT 5D63A 2JMHA 3VRBA 9ICQA 5D62A 4MFCA 4GYRA 5IILA 3EF2A 5FYMA 4FHYA 2UUBT 1FIOA 4YFSA 5JRCA 3AE4A 1D0YA 1FMVA 8ICGA 3ZMUB 4NLNA 2OA5A 5IUXA 4QXBB 3AXJA 1L0VA 4DR2T 3WFSC 2UXNB 3PDYA 9ICCA 5FVLA 3VU7H 4U31A 1MMNA 4ADZA 5LMUT 1SUMB 2LM2A 3HA4A 5L3CB 4PGQA 4YCXA 3H3MA 5CHEA 4DO9A 3U78A 4M2YA 2NWBA 2CA5A 4LF8T 5TZVA 5J0ZA 2W62A 4IL4A 1ZJMA 1WR6A 3N2KE 3H39A 3JPOA 2WU2A 9ICIA 2KINB 5J2KA 5AFUL 4YSYA 4M9NA 4TUQA 2DCFA 3RIFA 4ILBA 2DVIA 1KFYA 5AQIB 3FZKB 1X9BA 3OVBA 3O1IA 4HFHA 3AQMA 3PUYF 5J2UE 2VVNA 3J9X1 3RH3A 4HWDA 2N2NA 1ZQIA 2XAQB 2BE3A 3MXZA 4KBMB 3Q9DA 5KX5E 4DBRA 1WYBA 1IZNB 3ISBA 5CWRA 2B56A 1KNZA 1BPBA 4LZDA 2RA1A 4UVCB 5BOMA 4HFBA 5HWYA 2LKHA 4GIWA 1UEUA 1G73A 4WZXA 3I0QA 5LHHB 1ZQLA 3SRZA 5KXJA 3VRAA 5D46A 2OV9A 2CM0A 1Y64B 5HHIA 2L3LA 5HEHA 3F57A 5L3BB 2KZ7B 1Q79A 2B1EA 5FXZA 4QXCB 5H6RB 2I0MA 3PUXF 3SWHA 2VQET 5J0YA 2ZM0A 3SFEA 3N9OA 5L3DB 4K9BA 4A97A 5JR9C 3OVAA 1Z8UA 4EYYR 7ICTA 4AT7A 4IE4A 3LDQB 3MACA 4PAGA 1D0ZA 4JYAT 1V4AA 2JQKA 2E9XA 4F5OA 3NZQA 4O2BE 2CEAA 3JPNA 5DEDA 2IAKA 3IBPA 3UULA 3PUGA 4JEHB 4KLIA 4I2EA 4X4VA 3AA0B 4PFPA 4CXWA 1S94A 2CBIA 4RT3A 3ZMTB 7ICGA 2EHOA 5FMNA 3AAEB 4IHJE 2JRKA 2V7LA 2FJDA 3C98B 4TV9E 3JYYA 3RJIA 3JCFA 3NZPA 4HWIB 4UV8B 4I2IA 4ZEYA 4DV6T 3JAEA 2BPGA 5JQGE 3KV6A 2BPCA 1JMSA 5CFUA 4I29A 4ZZCA 4LFBT 3LFMA 3OV7A 2ZHAA 3OVUA 4CZZB 4UV9B 4HKAA 3AA7B 2RPAA 4EB6E 5DB7A 4AIUA 8ICMA 2YU2A 2E9XC 4O4JE 4EEBA 3FBZA 2IMLA 4IQWA 8ICUA 1WRDA 3PHZA 4HFEA 5IYZE 2G0UA 2XY8B 2M2TA 3N2GE 2BG9E 2WAUA 3AE8A 3AU6A 3AA6B 4QZCA 4AT9A 2XQ3A 4HEAA 3EDUA 3CKDA 4JI2T 4K96A 4UAZA 1BR0A 2WB5A 3ZT6A 5J0RA 4R66A 3WFOA 2B4VA 5HRBA 2W00A 4CI2B 5HXHA 5CR0A 4OK0A 3UFGA 3HWTA 5AQFB 4ILCA 3Q5XA 1ZQSA 7ICFA 2B76A 4HE8A 2FMQA 5F8PA 2GK9A 3KFWX 4OAIZ 3ERCC 5DB8A 3MGIA 4RQ5A 2W66A 4UAYA 4EXTA 4KHZF 1ZP0A 3GA8A 3KINB 4E80A 3H3AA 3NVOA 4P0AA 2C5IT 1ZKEA 9ICVA 4WC3A 4YN4A 4F5PA 4JI4T 5J2GA 4Z6EA 4XA5A 4QZEA 1KNRA 1N36T 7ICOA 4TV8E 2BDEA 2K5BB 1XDPA 4IE7A 3PV0F 2WMNA 4LF4T 3OBVE 3PU3A 3C4ZA 3I9WA 4ZS2A 7ICKA 5LJMA 3H38A 2PBIA 2MOZA 5D4BA 3PUQA 2DNXA 9ICHA 3T1HT 4IE0A 4UVAB 2K24A 8ICIA 4KLHA 3LK42 2X9XA 5HAXA 3MCRA 4JBWF 3JPTA 2BCRA 4MFAA 5LGUB 3N9NA 1E2AA 3JPRA 3ZMSB 3Q5WA 4DV5T 2D2SA 5CA1E 3OGUA 9ICWA 3A7MA 3RJHA 1AJ3A 4UB3A 1YXRA 3V7LA 2ISOA 4O9MA 4PNIA 2L9QA 4O6AA 3PE0A 5EK4A 4QKNA 5L3FB 3UUBA 3K75D 2XTLA 5BPCA 2MBGA 3BQIA 5JDNA 1QUUA 3ZKRA 2BCSA 2B51A 5FY0A 3OPCA 5AQRB 2D0UA 3O1JA 3RYIE 4JI5T 5FL1A 2D5UA 2IC9A 3WI3A 2WS3A 4JUYA 2LM9A 3C4XA 2CRBA 1DU2A 4DNDA 1R8CA 1UX5A 4TZ4C 4KLLA 3RJEA 2RFFA 3ETUA 5AQSB 1IJ6A 4IDPA 4F8HA 4K8VA 3FZHB 3LK3B 2HPLA 2VK9A 4CN6A 1ZQQA 2K48A 3HJ4A 2BBHA 3UU4A 4IE6A 2LJLA 2M6BA 1JN3A 2I9GA 3S4UA 1M62A 4ZI2D 4IGUA 4O69A 3JPPA 2V8SV 2HPJA 2MYSA 4Z91A 2JMKA 4P2HA 2XQ9A 2JQQA 1WFDA 5J0XA 3HKBE 4UBBA 2I6HA 1JAJA 2C5KT 3B13A 2MAWA 4WC4A 3HL6A 1ZQAA 4MALA 4QH1A 2JPFA 1MIYA 4EV6A 2HHPA 1OWAA 3FB2A 1T7SA 2WZHA 4UD4A 3JAFA 4WC2A 8ICZA 8ICHA 2CHOA 3UXPA 1T72A 2E8IA 3RC8A 1D1AA 4EEDA 5J2CA 4Q25A 3LJCA 1J5ET 3MA9A 1V9DA 4PHAA 5J2EA 2N9DA 3EAMA 4UF0A 3JPQA 5HCJA 3ONXA 4F6RC 4NXXA 5FVKA 1R89A 2DL1A 4LEWA 2CE7A 5AQOB 4WNKA 5B3QA 3CQCB 1LVFA 1ZQOA 3ER8C 5FXWA 3RJGA 2VURA 3LK2B 3TFRA 2M6IA 2WY2A 4TNWA 1MMAA 5AQPB 5GONE 4E7ZA 4HX0A 4ANJA 4DUYT 1KK7A 2VVSA 4H9RC 2J1DG 1W9RA 2H7VC 1OEDC 4GKKT 2BG9A 1NEKA 5CJ5A 2LSJA 5IIJA 3B5MA 4KLEA 4U7IA 5AQGB 4IDQA 2HN1A 4GOUA 2UXDT 3ZMZB 1ZQDA 8ICOA 4FO1A 3TLSA 3UQ0A 4OAGA 3KVAA 3OUYB 4OX9T 3BQLA 4QZIA 3C18A 3EABA 2YK0A 8ICNA 4HWCA 3CX8B 3C2KA 4O5CA 2WMOA 4O4IE 5DDYA 3P4PA 3ZCJA 5LYJE 2ISPA 2BKNA 8ICVA 3CK6A 2QVAA 3V7JA 7ICLA 3K3NA 4QH5A 2J4GA 4X20E 4I50E 3H37A 2X68A 3N9LA 3E08A 4XZCA 5LP6E 1X79A 1Q78A 3C5FA 8ICPA 2XQAA 4KLSA 4GK5E 2W67A 5J0TA 4RPZA 2H88A 4XJEA 4U74A 3I1AA 2W2UA 2E5LT 2IHMA 5KDMC 3UU5A 5L3EB 8ICAA 2ZH8A 1ZQEA 4TN7B 4BA9A 4DV2T 4LFAT 3C50A 1D0XA 1MQ2A 2PFOA 3RYCE 5J0PA 3UFEA 4JLXA 1SA0E 3WFRE 2ZM6T 3LQCB 3HKEE 3PUWF 4YJ2E 7ICIA 4NLZA 5L47A 2DHRA 4AKGA 9ICTA 3VR9A 3VKGA 5FY7A 2FCLA 4I2HA 5CB1A 3HKCE 2SPCA 3V5SA 5ABFA 5J2DA 4PJJA 3MKDA 2XZEA 1TV9A 2Y6XA 4JLEA 1KEYA 1T98A 3RKOA 4RPYA 2H3RA 5DABA 1XSNA 3ISCA 4QZ9A 3UXOA 4I43B 4OYKA 4NXMT 2FUPA 4X1IE 4B3TT 3FXDB 1UEVA 4AT9B 5A1LA 5EK2A 3JC6D 5AQLB 2JQHA 2WP9A 4QZBA 5JDGA 5JDHA 1NOMA 2WDVA 4AQGA 2V7IA 3BQKA 3IEEA 2QA7A 2XQ6A 3RH4A 4HFDA 4RQ1A 3CX7B 4CN1A 2UUAT 1MMDA 3RRCA 2WM9A 1W0AA 2PFVA 2Q9QB 5CB4E 4CI3B 3LBXA 4KLOA 4EZHA 5CJ7A 4TURA 2V26A 4IQVA 3QB5K 2LRLA 4OYJA 4X4PA 2Y8DA 5FP3A 4DUZT 3WFQE 3Q2MA 1RZTA 4QZ8A 2VL8A 3AECA 1GQEA 4IDNA 4EOZB 3JADA 4HFCA 4QZAA 5B3PA 4XUSA 3FBLA 2EHOB 4UVBB 2ZM8A 4YMMA 3DTOA 1YLQA 3RIAA 5LBQB 3ZMVB 9ICSA 3AB3B 9ICFA 4DOBA 5D61A 1T8BA 2PBEA 1BPZA 4KP3C 4XBFB 2LRKA 3DP7A 2L8KA 3OTOT 1XNRT 3UU3A 3RQUA 5LHIB 4AT7B 1W09A 4WC5A 5DQWA 3TLUA 4KLGA 2UU9T 4DR5T 4B6XA 7ICEA 3LSVA 5ABHA 2PJQA 4KM5A 2ZH9A 3FZFB 4IL9A 5LJNA 1ZQGA 7ICSA 2VL0A 3CX6B 2ZH2A 4X4TA 8ICXA 4JEUB 3PNCA 3RH6A 4QXHB 2CWYA 5HRDA 5HXSA 3QB5A 1N34T 4U72A 4DO0A 3MZKB 3NWIA 4QZGA 4K98A 3HKDE 1WOTA 3ONLC 4QZDA 2CLYC 5JDMA 2CLYB 4YMNA 7ICJA 4AKRB 4X4SA 4C91A 8ICYA 2YDSA 8ICTA 3ZT7A 5J2IA 2DR7A 3ISDA 5CP2A 3KV4A 2QYWA 5E0OA 2FBWA 4RQ8A 4QHOA 2P66A 2CBJA 9ICRA 3HIYA 5H6QB 4TUYE 5ABFB 5LXTE 2IC6A 5L2LA 4I0UA 3NYBA 2CMRA 2P9BA 2YEVC 2DRBA 4PJNA 3UT5E 4V1Av 2VQFT 2LOPA 1ZQKA 4UR9A 1D1CA 3N9QA 4NM2A 3O9XA 4L9IA 3ZC1A 4WC0A 2XQYA 2WU5A 5HRLA 5J2TE 4ZI7E 2AXDS 3AEDA 1YD8G 5DJQC 4ZI3D 4OAFA 2PG8A 3PUVF 4PHPA 3AXJB 1S35A 4MF8A 3L3PA 3RGLA 3OVSA 1ZQJA 5JRCB 3L09A 5BOLA 4RWOA 4FJOA 2LSYA 4FHVA 5DKWA 2LHNA 1M7KA 4YD1A 4DV0T 2LSGA 4I2JA 3UQ4A 3NBXX 4DV1T 3KVBA 4DR7T 2M67A 2ZH3A 1YW0A 4KX6A 4NPPA 3AA1B 3LBXB 4R63A 4GYSA 4ERRA 3AE2A 3FHNA 4A56A 2W0GA 2DWKA 2IW5B 3FZMB 3A5XA 2W4XA 5J0WA 3T1YT 1HR0T 4X4QA 2VKJA 4A98A 2CXDA 1J1JA 1E7PA 3ZT5A 1E1HB 3P50A 4DIDB 4YMOA 2XQ5A 5JVDE 4PW8A 3RJKA 5C3JA 4AT8B 2D0TA 2JIWA 3AVSA 1WYCA 2W63A 1ZQXA 3JPSA 4K0KT 1ZQRA 4LT6A 3ZN1B 2DR5A 2CWOA 3RF1A 4WCWA 2A9UA 1KNPA 3V7KA 3EUHA 4O4HE 1XDOA 5LNKA 1ZQUA 5F2VO 3ZPOA 1BR1A 4EGWA 1BR4A 4H9PC 1TFYA 3PUAA 2BPFA 2NR4A 3ESLA 2M2VA 4NXUA 4JWNA 1MMGA 2KNDA 3VR8A 3ZSSA 4NUUA 4K0UA 4YTMA 2Y48B 3GWHA 1IBLT 4UBCA 2K3WA 5HEUA 1HTJF 4YTNA 1SHZC 3NRYA 1ZJNA 2LT3A 3M3ZB 2PXIA 3V72A 3ZEFB 4GXKA 3L39A 3AEAA 3EVYA 5HXCA 1ZQNA 5C2TA 2LEHA 4WYVA 1ZQMA 4X4UA 3O1HA 4QX8B 3WFPA 4KLJA 1MNDA 3L8RA 4X4RA 2KLQA 4DOCA 4BJNA 5FKYA 3K7DA 4J2CA 4RQ2A 3L9DA 3AEEA 3BK9A 3ZC0A 4I27A 2HHHT 2V1DB 5HC9A 4NM1A 1OEDB 2M2WA 5ABEA 5LGNB 1ZQCA 4E7SA 4RQ3A 2YINA 2CHNA 5HEJA 3F2EA 1NO5A 4M04A 1D1BA 1XZYA 4QX7B 4IQTA 2V6YA 5KMGP 3PMLA 1FJGT 5AQMB 4K99A 2YN6A 4I2BA 1G8XA 4P4OA 3E22E 1ZEEA 2A3DA 2X66A 1XSLA 2JJ9A 2ID1A 1BR2A 1I6ZA 4MKPA 4PHEA 5BMVE 1XSPA 4Z90A 4XQ8A 4S3NA 3FZLB 3AE5A 3P4QA 2LOSA 2ODVA 4NXWA 2UXCT 3ZJ1A 4ATBA 2WZIA 5L4EA 1US7B 2M2UA 5BR8T 1HF8A
chains in the Genus database with same CATH topology
4EGWA 2HN2A 2IUBA 3NVOA 4I0UA 3NWIA 2HN1A 3CK6A 3RKGA 4EEDA 4EV6A 5JTGA 2BBJA 2BBHA 4EEBA 3JCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EGW A;  2HN2 A;  2IUB A;  3NVO A;  4I0U A;  3NWI A;  2HN1 A;  3CK6 A;  3RKG A;  4EED A;  4EV6 A;  5JTG A;  2BBJ A;  2BBH A;  4EEB A;  3JCF A; 
#chains in the Genus database with same CATH topology
 1ZQT A;  4KMC A;  4AKI A;  3ZYL A;  2V7M A;  3B57 A;  3QUJ A;  4KLT A;  2KXP B;  2BG9 B;  3I9Y A;  3CML A;  2WWV A;  9ICL A;  2XM1 A;  2WCA A;  4YLH A;  8ICS A;  3RRW A;  2ZH7 A;  1N33 T;  3M65 A;  2X0H A;  4M0A A;  4ATB B;  4EYU A;  4HFI A;  3C2M A;  4JV5 T;  4X1K E;  5ABG A;  4CI1 B;  3UTK A;  4I2D A;  4XQ7 A;  4I28 A;  3Q5E A;  4GK0 E;  4YHJ A;  4DVD A;  4YSX A;  2J62 A;  4WBN E;  3D0T A;  1ZQP A;  1O3X A;  3MJX A;  5J1G A;  4ZI2 C;  3KV9 A;  1KDH A;  4L0R A;  4NUV A;  4IDO A;  2LSI A;  4K4I A;  2UUC T;  4KHP T;  3N2O A;  3HW8 A;  4ZS3 A;  4DMV A;  3Q5D A;  2XM2 A;  2Q9Q C;  7ICM A;  1ZQF A;  4AKH A;  2QRX A;  1TVA A;  3RKG A;  2W9M A;  4QZH A;  9ICK A;  1VJ7 A;  3PMN A;  4UD5 A;  3UXN A;  3T8O A;  4IRE A;  5AQJ B;  2BKO A;  2LSK A;  4DV3 T;  1VFG A;  4XRH A;  1WR0 A;  4E8F A;  4LEV A;  2WSS V;  4ZXL A;  5ADX L;  4DV4 T;  4ZOL E;  2CXL A;  3ZJ2 A;  1KEJ A;  4TWF A;  2FJB A;  1YQ4 A;  2BS4 A;  1KF6 A;  4TUS A;  3OYX A;  5EOZ A;  4NXZ A;  1HNX T;  1HUO A;  3B0Y A;  3TLV A;  3C64 A;  5EZY E;  2DR9 A;  9ICB A;  5AQV B;  2BCV A;  5LA6 E;  1BPX A;  4LMJ A;  4X62 T;  5LG4 A;  4CQI A;  4PGY A;  4U7Y A;  4KLF A;  1R8I A;  5LB7 B;  2PFN A;  2MPK A;  5J29 A;  7ICQ A;  5HRG A;  4YSZ A;  4H9Q C;  3AE6 A;  1R8B A;  4LMK A;  1JNR A;  1QSD A;  1MIW A;  2BS2 A;  7ICR A;  3RQW A;  5EK3 A;  9ICO A;  3J7Y q;  4U33 A;  2LE8 A;  4ZI3 C;  4H63 V;  5FXX A;  1JNZ A;  3HR0 A;  3PU8 A;  1IJ5 A;  2DR8 A;  5DQV A;  1HS7 A;  3QK6 A;  5LHG B;  4JLZ A;  2ZM2 A;  5M4Y A;  4AQY T;  5CA0 E;  1UUS A;  4YJ3 E;  3KDS E;  1HCI A;  4AT8 A;  5D49 A;  5HWX A;  4ZZB A;  3V5U A;  2QGS A;  4X64 T;  2ZH6 A;  2J47 A;  4IG8 A;  2X0Y A;  2XAS B;  4CXY A;  2A72 A;  1VOM A;  1KNY A;  2X9H A;  4FH3 A;  4IIJ E;  2GWS A;  4EIW A;  4OAH A;  5IIM A;  4HN9 A;  4X1Y E;  4DOA A;  3AQN A;  3C66 A;  4PGX A;  4JI7 T;  3AU2 A;  3TLT A;  3C51 A;  3ZST A;  4CN4 A;  9ICP A;  4IDZ A;  2C5J A;  4DV7 T;  5JDF A;  4HGA A;  3IA3 A;  1YQ3 A;  4B3M T;  2FMS A;  4P1N A;  5CA7 A;  1EZ3 A;  4LZG A;  4PFO A;  2O5A A;  4RQ4 A;  4DR1 T;  2BVL A;  2KSR A;  4ASK A;  4UXN B;  1U4Q A;  2ZH1 A;  3K3Q C;  3AEG A;  3LK9 A;  1XWM A;  1VCS A;  3PUZ F;  1CUN A;  4NY8 A;  4RQ7 A;  3N9P A;  5J0U A;  4DBQ A;  3PJA A;  4X5T A;  5IIK A;  5JR9 B;  5LBM A;  2E9X B;  1HNW T;  2NW8 A;  4UEL A;  1NEN A;  5JDQ A;  4TWH A;  2VKD A;  4ILA A;  5LG3 A;  1WLX A;  1BPY A;  4WBZ A;  1NAF A;  3WAK A;  3E0Z A;  4NXV A;  3AEB A;  3P4W A;  2EWR A;  4LEZ A;  2XHE B;  3OKQ A;  1Z0P A;  4WOY A;  4COF A;  3OYZ A;  2XQ7 A;  5JDL A;  2BS3 A;  2KWI B;  3I0O A;  5CHG A;  3P4S A;  3MK7 C;  4H9O C;  1YKE B;  5J2J A;  4WC7 A;  3RI5 A;  1HNZ T;  3IF8 B;  5CGM A;  2YDR A;  1OU5 A;  2LLY A;  4I55 E;  4EBJ A;  1UCU A;  3AVR A;  5FXV A;  3AQL A;  2EHO C;  4B3S T;  4EP7 A;  2VB6 A;  2W61 A;  4I2C A;  1MIV A;  4KLU A;  2EHO D;  4RWQ A;  3GDX A;  1ZQW A;  2XUE A;  5J0O A;  4YY3 T;  2MTQ A;  1JQR A;  2CXF A;  3U3I A;  2IHR 1;  2E9X D;  9ICA A;  4ILU A;  5LCY A;  5DB6 A;  5L4H A;  4E7X A;  4K97 A;  4I2F A;  3QC9 A;  3RH5 A;  2IUB A;  4F5R A;  3B0X A;  3SFD A;  8ICQ A;  2RP4 A;  4WBY A;  5F3J A;  5DBB A;  2CPT A;  4YTP A;  4DR6 T;  2V6X A;  2NTY A;  3OWG A;  4JI0 T;  5L3G B;  4GXI A;  3RC3 A;  4LFC T;  2X67 A;  1LVK A;  4WH5 A;  3P4R A;  5DB9 A;  1HUZ A;  2XAH B;  4LF5 T;  4QH4 A;  3ZCI A;  3TKL B;  4DMW A;  3TFS A;  4UIG A;  2ODU A;  9ICJ A;  4M47 A;  4M9L A;  1LRZ A;  3RLF F;  4BAY B;  4MFR A;  3PJA J;  2WWU A;  2IIU A;  4WQK A;  4AXP A;  4TNV A;  3PTR B;  1UET A;  3AQK A;  1NWM X;  2X51 A;  4O67 A;  1ZOY A;  3HJ1 A;  2BZB A;  1FMW A;  4HWH A;  1IBM T;  3CQG B;  3AE3 A;  1XNQ T;  2XAF B;  5JR9 A;  5HYA A;  4O5K A;  1XMQ T;  2UXX B;  4P0B A;  2LKG A;  4FI5 A;  2BG9 C;  4C90 A;  1FA0 A;  2A2F X;  4AIS A;  4UB2 A;  1ZQY A;  4L5G A;  1RPL A;  2HH7 A;  3X1D A;  4WC1 A;  3P8C D;  5C8Y E;  4JI1 T;  2IDO B;  3RX6 A;  3EI0 A;  3PUS A;  2Q9Q A;  4AQF C;  1UK5 A;  5CFT A;  4O68 A;  1BPD A;  4JI8 T;  8ICC A;  2Q9Q D;  7ICV A;  5IWA T;  3IHR A;  4AI6 A;  2V7J A;  4UB4 A;  4LF9 T;  8ICB A;  1F5A A;  3QNU A;  2NTX A;  4WW0 A;  4U2Z A;  2C0S A;  4ZHQ E;  3UU6 A;  4BJM A;  3AE7 A;  2DRA A;  2ES0 A;  1UGO A;  1IAP A;  8ICF A;  4AQF A;  2Q66 A;  4HFV A;  4RPX A;  1CHU A;  4P09 A;  2O1P A;  2XSB A;  1I94 T;  5LMN T;  9ICX A;  4CXX A;  1ZQV A;  4X4N A;  3LG7 A;  3GMI A;  4O5E A;  4Z6D A;  3RJJ A;  1HX8 A;  5F5W A;  4M9J A;  2XSA A;  4KLQ A;  8ICL A;  4FO6 A;  4NXN T;  3RYF E;  2V5C A;  2F4V T;  3C5G A;  3DJB A;  5HR9 A;  5LOV E;  3CWZ B;  4LVS A;  3ANW B;  1YKH B;  4MFF A;  3AAI A;  3KBT A;  3NRX A;  3RIU A;  4RQ0 A;  2NW9 A;  4RQ6 A;  4Z6C A;  2UXB T;  3AEF A;  4I2A A;  3VHL A;  2KMF A;  4O8S A;  5FY1 A;  3RHW A;  2ZH5 A;  1HFA A;  5DEC A;  4P4M A;  2VWA A;  4M9G A;  3OJA A;  7ICP A;  4PK5 A;  5AQU B;  5TAO A;  4EZ4 A;  2ACZ A;  3ZYK A;  3RPU A;  1OXZ A;  3K3O A;  4YXD A;  4PK6 A;  2E2A A;  2NP9 A;  4HTE A;  4EBK A;  2FJA A;  4F5N A;  5HRK A;  5CFS A;  5JTG A;  4AKL A;  5JH7 E;  3AAA B;  5HRI A;  4YT0 A;  3NKZ A;  4YHH T;  4PJL A;  1BPE A;  4OHF A;  2D9D A;  5HEG A;  3GN5 B;  5DBA A;  1WCR A;  1B7T A;  2X9W A;  2XJ7 A;  4IT4 A;  4N78 D;  4LEY A;  1VRB A;  3JC6 C;  3VKH A;  4YD2 A;  1H7C A;  9ICG A;  3ZYM A;  4R64 A;  4MHC A;  1FEW A;  2DWG A;  3G06 A;  2YKS A;  7ICH A;  4WBO A;  4PJM A;  3SS1 A;  5J2F A;  4NIQ A;  3ER9 B;  5CFB A;  4X65 T;  4KUM B;  4UB1 A;  5AQT B;  3OUY A;  2DLR A;  2K9A A;  3RYH E;  2XQ8 A;  3ABV A;  1R8A A;  4LF7 T;  4NLK A;  2XPK A;  4K4H A;  2YOE A;  2CCQ A;  3ZN0 B;  1UUR A;  2VAS A;  2V5D A;  1GPJ A;  3KBU A;  2I59 A;  1SE7 A;  1QLB A;  4X0A A;  4K4G A;  3ZLI A;  4A5X A;  4G63 A;  3N5L A;  7ICN A;  2Z6E A;  1HG5 A;  4P4P A;  7ICU A;  4U2Y A;  4FHP A;  1XMO T;  3CIR A;  4X5V A;  4UB5 A;  4RT2 A;  3A8Y C;  5HXE A;  2R6G F;  9ICN A;  3R84 B;  3UUM A;  4NXT A;  2FJE A;  4Z6F A;  4F5Q A;  3KV5 A;  5JRE A;  4LML A;  5IHY A;  1MQ3 A;  4NKT A;  2OLT A;  2WQY A;  2PFQ A;  1PX5 A;  4KI0 F;  2KWH A;  2X0L B;  2ACX A;  3UQ2 A;  3TLW A;  3JZ0 A;  8ICW A;  2H7O A;  4UF0 B;  3WAJ A;  4M1P A;  4HWF A;  4O2A E;  3EDV A;  2NW7 A;  2WDQ A;  4TUP A;  2ZHB A;  9ICU A;  4O4L E;  4H9S E;  3K8P C;  2AE9 A;  3O4X E;  2BCU A;  5LGT B;  1Y01 A;  4PK4 A;  4MF2 A;  1TFW A;  5AQQ B;  3AE1 A;  1U5P A;  5J2B A;  2V6Y B;  8ICR A;  4DR4 T;  2IHO A;  3MBY A;  4LF6 T;  4NKU A;  4PPX A;  5HHH A;  3K1S A;  8ICJ A;  4FH5 A;  4KLM A;  4X0B A;  5HEO A;  2FMP A;  2GAF D;  3P7I A;  4IST A;  5HRE A;  4RWN A;  2V7K A;  3C2L A;  1OED A;  1HG2 A;  1IBK T;  4OFZ A;  4GXJ A;  4X4O A;  4JI6 T;  2XQ4 A;  2JQ9 A;  5J0Q A;  2ZMA A;  4TWD A;  5AQH B;  5HRH A;  4QZF A;  4UAW A;  2VKO A;  3MGH A;  4R65 A;  2NRK A;  4IE5 A;  5J2A A;  3PUR A;  2YU1 A;  4WC6 A;  2NOX A;  4MLK A;  3F31 A;  8ICK A;  4TX5 A;  3UPS A;  1ZHC A;  2BKP A;  3C4W A;  1UX4 A;  4KB6 A;  2GA9 D;  3RIU C;  3HX0 A;  4ISS A;  2DI4 A;  9ICE A;  4EAH A;  4PHD A;  3ANW A;  5AQK B;  4M9H A;  4XAX B;  3MDA A;  2ZLY A;  2H89 A;  3UPQ A;  5DBC A;  4N7R A;  3MDC A;  2WDR A;  5FL0 A;  2XAJ B;  3UQ7 A;  4X66 T;  4PH5 A;  4UEM A;  3N9M A;  2BCQ A;  3CVR A;  4FHW A;  4JI3 T;  1MNE A;  4FHX A;  2YDQ A;  3RJF A;  4DR3 T;  2ZH4 A;  5FNV E;  2BVM A;  2N1G A;  3HI2 A;  4IQU A;  2X9Y A;  3R6N A;  1W0B A;  2WBL A;  3UU8 A;  4RWP A;  3AUO A;  1J5W A;  4H63 H;  1VCT A;  3CQX C;  4K9A A;  4M5D A;  2PTF A;  2VAN A;  2BBJ A;  1N32 T;  1ZV4 X;  5J2H A;  2PFP A;  8ICE A;  2LHR A;  4WQL A;  5III A;  5J0S A;  4QWN B;  1ZQZ A;  5AQN B;  9ICM A;  5HRF A;  4I4T E;  2HN2 A;  2XAG B;  4U3C A;  3UUN A;  3CPZ A;  5IIN A;  4KLD A;  3FXE B;  3ONJ A;  5IIO A;  2KT9 A;  5HXR A;  5ETW A;  1ZQH A;  2VKH A;  3ETV A;  3NKU A;  4G2A A;  3EHZ A;  5HCM A;  3AE9 A;  3UUX B;  4MBQ A;  4I2G A;  3SOL A;  3GN5 A;  3W15 B;  5DDM A;  1HX1 B;  4JWM A;  4H9N C;  4Z8X A;  1OED E;  1ZQB A;  4B3R T;  2E5V A;  3QOF A;  1LKX A;  4GKJ T;  5D63 A;  2JMH A;  3VRB A;  9ICQ A;  5D62 A;  4MFC A;  4GYR A;  5IIL A;  3EF2 A;  5FYM A;  4FHY A;  2UUB T;  1FIO A;  4YFS A;  5JRC A;  3AE4 A;  1D0Y A;  1FMV A;  8ICG A;  3ZMU B;  4NLN A;  2OA5 A;  5IUX A;  4QXB B;  3AXJ A;  1L0V A;  4DR2 T;  3WFS C;  2UXN B;  3PDY A;  9ICC A;  5FVL A;  3VU7 H;  4U31 A;  1MMN A;  4ADZ A;  5LMU T;  1SUM B;  2LM2 A;  3HA4 A;  5L3C B;  4PGQ A;  4YCX A;  3H3M A;  5CHE A;  4DO9 A;  3U78 A;  4M2Y A;  2NWB A;  2CA5 A;  4LF8 T;  5TZV A;  5J0Z A;  2W62 A;  4IL4 A;  1ZJM A;  1WR6 A;  3N2K E;  3H39 A;  3JPO A;  2WU2 A;  9ICI A;  2KIN B;  5J2K A;  5AFU L;  4YSY A;  4M9N A;  4TUQ A;  2DCF A;  3RIF A;  4ILB A;  2DVI A;  1KFY A;  5AQI B;  3FZK B;  1X9B A;  3OVB A;  3O1I A;  4HFH A;  3AQM A;  3PUY F;  5J2U E;  2VVN A;  3J9X 1;  3RH3 A;  4HWD A;  2N2N A;  1ZQI A;  2XAQ B;  2BE3 A;  3MXZ A;  4KBM B;  3Q9D A;  5KX5 E;  4DBR A;  1WYB A;  1IZN B;  3ISB A;  5CWR A;  2B56 A;  1KNZ A;  1BPB A;  4LZD A;  2RA1 A;  4UVC B;  5BOM A;  4HFB A;  5HWY A;  2LKH A;  4GIW A;  1UEU A;  1G73 A;  4WZX A;  3I0Q A;  5LHH B;  1ZQL A;  3SRZ A;  5KXJ A;  3VRA A;  5D46 A;  2OV9 A;  2CM0 A;  1Y64 B;  5HHI A;  2L3L A;  5HEH A;  3F57 A;  5L3B B;  2KZ7 B;  1Q79 A;  2B1E A;  5FXZ A;  4QXC B;  5H6R B;  2I0M A;  3PUX F;  3SWH A;  2VQE T;  5J0Y A;  2ZM0 A;  3SFE A;  3N9O A;  5L3D B;  4K9B A;  4A97 A;  5JR9 C;  3OVA A;  1Z8U A;  4EYY R;  7ICT A;  4AT7 A;  4IE4 A;  3LDQ B;  3MAC A;  4PAG A;  1D0Z A;  4JYA T;  1V4A A;  2JQK A;  2E9X A;  4F5O A;  3NZQ A;  4O2B E;  2CEA A;  3JPN A;  5DED A;  2IAK A;  3IBP A;  3UUL A;  3PUG A;  4JEH B;  4KLI A;  4I2E A;  4X4V A;  3AA0 B;  4PFP A;  4CXW A;  1S94 A;  2CBI A;  4RT3 A;  3ZMT B;  7ICG A;  2EHO A;  5FMN A;  3AAE B;  4IHJ E;  2JRK A;  2V7L A;  2FJD A;  3C98 B;  4TV9 E;  3JYY A;  3RJI A;  3JCF A;  3NZP A;  4HWI B;  4UV8 B;  4I2I A;  4ZEY A;  4DV6 T;  3JAE A;  2BPG A;  5JQG E;  3KV6 A;  2BPC A;  1JMS A;  5CFU A;  4I29 A;  4ZZC A;  4LFB T;  3LFM A;  3OV7 A;  2ZHA A;  3OVU A;  4CZZ B;  4UV9 B;  4HKA A;  3AA7 B;  2RPA A;  4EB6 E;  5DB7 A;  4AIU A;  8ICM A;  2YU2 A;  2E9X C;  4O4J E;  4EEB A;  3FBZ A;  2IML A;  4IQW A;  8ICU A;  1WRD A;  3PHZ A;  4HFE A;  5IYZ E;  2G0U A;  2XY8 B;  2M2T A;  3N2G E;  2BG9 E;  2WAU A;  3AE8 A;  3AU6 A;  3AA6 B;  4QZC A;  4AT9 A;  2XQ3 A;  4HEA A;  3EDU A;  3CKD A;  4JI2 T;  4K96 A;  4UAZ A;  1BR0 A;  2WB5 A;  3ZT6 A;  5J0R A;  4R66 A;  3WFO A;  2B4V A;  5HRB A;  2W00 A;  4CI2 B;  5HXH A;  5CR0 A;  4OK0 A;  3UFG A;  3HWT A;  5AQF B;  4ILC A;  3Q5X A;  1ZQS A;  7ICF A;  2B76 A;  4HE8 A;  2FMQ A;  5F8P A;  2GK9 A;  3KFW X;  4OAI Z;  3ERC C;  5DB8 A;  3MGI A;  4RQ5 A;  2W66 A;  4UAY A;  4EXT A;  4KHZ F;  1ZP0 A;  3GA8 A;  3KIN B;  4E80 A;  3H3A A;  3NVO A;  4P0A A;  2C5I T;  1ZKE A;  9ICV A;  4WC3 A;  4YN4 A;  4F5P A;  4JI4 T;  5J2G A;  4Z6E A;  4XA5 A;  4QZE A;  1KNR A;  1N36 T;  7ICO A;  4TV8 E;  2BDE A;  2K5B B;  1XDP A;  4IE7 A;  3PV0 F;  2WMN A;  4LF4 T;  3OBV E;  3PU3 A;  3C4Z A;  3I9W A;  4ZS2 A;  7ICK A;  5LJM A;  3H38 A;  2PBI A;  2MOZ A;  5D4B A;  3PUQ A;  2DNX A;  9ICH A;  3T1H T;  4IE0 A;  4UVA B;  2K24 A;  8ICI A;  4KLH A;  3LK4 2;  2X9X A;  5HAX A;  3MCR A;  4JBW F;  3JPT A;  2BCR A;  4MFA A;  5LGU B;  3N9N A;  1E2A A;  3JPR A;  3ZMS B;  3Q5W A;  4DV5 T;  2D2S A;  5CA1 E;  3OGU A;  9ICW A;  3A7M A;  3RJH A;  1AJ3 A;  4UB3 A;  1YXR A;  3V7L A;  2ISO A;  4O9M A;  4PNI A;  2L9Q A;  4O6A A;  3PE0 A;  5EK4 A;  4QKN A;  5L3F B;  3UUB A;  3K75 D;  2XTL A;  5BPC A;  2MBG A;  3BQI A;  5JDN A;  1QUU A;  3ZKR A;  2BCS A;  2B51 A;  5FY0 A;  3OPC A;  5AQR B;  2D0U A;  3O1J A;  3RYI E;  4JI5 T;  5FL1 A;  2D5U A;  2IC9 A;  3WI3 A;  2WS3 A;  4JUY A;  2LM9 A;  3C4X A;  2CRB A;  1DU2 A;  4DND A;  1R8C A;  1UX5 A;  4TZ4 C;  4KLL A;  3RJE A;  2RFF A;  3ETU A;  5AQS B;  1IJ6 A;  4IDP A;  4F8H A;  4K8V A;  3FZH B;  3LK3 B;  2HPL A;  2VK9 A;  4CN6 A;  1ZQQ A;  2K48 A;  3HJ4 A;  2BBH A;  3UU4 A;  4IE6 A;  2LJL A;  2M6B A;  1JN3 A;  2I9G A;  3S4U A;  1M62 A;  4ZI2 D;  4IGU A;  4O69 A;  3JPP A;  2V8S V;  2HPJ A;  2MYS A;  4Z91 A;  2JMK A;  4P2H A;  2XQ9 A;  2JQQ A;  1WFD A;  5J0X A;  3HKB E;  4UBB A;  2I6H A;  1JAJ A;  2C5K T;  3B13 A;  2MAW A;  4WC4 A;  3HL6 A;  1ZQA A;  4MAL A;  4QH1 A;  2JPF A;  1MIY A;  4EV6 A;  2HHP A;  1OWA A;  3FB2 A;  1T7S A;  2WZH A;  4UD4 A;  3JAF A;  4WC2 A;  8ICZ A;  8ICH A;  2CHO A;  3UXP A;  1T72 A;  2E8I A;  3RC8 A;  1D1A A;  4EED A;  5J2C A;  4Q25 A;  3LJC A;  1J5E T;  3MA9 A;  1V9D A;  4PHA A;  5J2E A;  2N9D A;  3EAM A;  4UF0 A;  3JPQ A;  5HCJ A;  3ONX A;  4F6R C;  4NXX A;  5FVK A;  1R89 A;  2DL1 A;  4LEW A;  2CE7 A;  5AQO B;  4WNK A;  5B3Q A;  3CQC B;  1LVF A;  1ZQO A;  3ER8 C;  5FXW A;  3RJG A;  2VUR A;  3LK2 B;  3TFR A;  2M6I A;  2WY2 A;  4TNW A;  1MMA A;  5AQP B;  5GON E;  4E7Z A;  4HX0 A;  4ANJ A;  4DUY T;  1KK7 A;  2VVS A;  4H9R C;  2J1D G;  1W9R A;  2H7V C;  1OED C;  4GKK T;  2BG9 A;  1NEK A;  5CJ5 A;  2LSJ A;  5IIJ A;  3B5M A;  4KLE A;  4U7I A;  5AQG B;  4IDQ A;  2HN1 A;  4GOU A;  2UXD T;  3ZMZ B;  1ZQD A;  8ICO A;  4FO1 A;  3TLS A;  3UQ0 A;  4OAG A;  3KVA A;  3OUY B;  4OX9 T;  3BQL A;  4QZI A;  3C18 A;  3EAB A;  2YK0 A;  8ICN A;  4HWC A;  3CX8 B;  3C2K A;  4O5C A;  2WMO A;  4O4I E;  5DDY A;  3P4P A;  3ZCJ A;  5LYJ E;  2ISP A;  2BKN A;  8ICV A;  3CK6 A;  2QVA A;  3V7J A;  7ICL A;  3K3N A;  4QH5 A;  2J4G A;  4X20 E;  4I50 E;  3H37 A;  2X68 A;  3N9L A;  3E08 A;  4XZC A;  5LP6 E;  1X79 A;  1Q78 A;  3C5F A;  8ICP A;  2XQA A;  4KLS A;  4GK5 E;  2W67 A;  5J0T A;  4RPZ A;  2H88 A;  4XJE A;  4U74 A;  3I1A A;  2W2U A;  2E5L T;  2IHM A;  5KDM C;  3UU5 A;  5L3E B;  8ICA A;  2ZH8 A;  1ZQE A;  4TN7 B;  4BA9 A;  4DV2 T;  4LFA T;  3C50 A;  1D0X A;  1MQ2 A;  2PFO A;  3RYC E;  5J0P A;  3UFE A;  4JLX A;  1SA0 E;  3WFR E;  2ZM6 T;  3LQC B;  3HKE E;  3PUW F;  4YJ2 E;  7ICI A;  4NLZ A;  5L47 A;  2DHR A;  4AKG A;  9ICT A;  3VR9 A;  3VKG A;  5FY7 A;  2FCL A;  4I2H A;  5CB1 A;  3HKC E;  2SPC A;  3V5S A;  5ABF A;  5J2D A;  4PJJ A;  3MKD A;  2XZE A;  1TV9 A;  2Y6X A;  4JLE A;  1KEY A;  1T98 A;  3RKO A;  4RPY A;  2H3R A;  5DAB A;  1XSN A;  3ISC A;  4QZ9 A;  3UXO A;  4I43 B;  4OYK A;  4NXM T;  2FUP A;  4X1I E;  4B3T T;  3FXD B;  1UEV A;  4AT9 B;  5A1L A;  5EK2 A;  3JC6 D;  5AQL B;  2JQH A;  2WP9 A;  4QZB A;  5JDG A;  5JDH A;  1NOM A;  2WDV A;  4AQG A;  2V7I A;  3BQK A;  3IEE A;  2QA7 A;  2XQ6 A;  3RH4 A;  4HFD A;  4RQ1 A;  3CX7 B;  4CN1 A;  2UUA T;  1MMD A;  3RRC A;  2WM9 A;  1W0A A;  2PFV A;  2Q9Q B;  5CB4 E;  4CI3 B;  3LBX A;  4KLO A;  4EZH A;  5CJ7 A;  4TUR A;  2V26 A;  4IQV A;  3QB5 K;  2LRL A;  4OYJ A;  4X4P A;  2Y8D A;  5FP3 A;  4DUZ T;  3WFQ E;  3Q2M A;  1RZT A;  4QZ8 A;  2VL8 A;  3AEC A;  1GQE A;  4IDN A;  4EOZ B;  3JAD A;  4HFC A;  4QZA A;  5B3P A;  4XUS A;  3FBL A;  2EHO B;  4UVB B;  2ZM8 A;  4YMM A;  3DTO A;  1YLQ A;  3RIA A;  5LBQ B;  3ZMV B;  9ICS A;  3AB3 B;  9ICF A;  4DOB A;  5D61 A;  1T8B A;  2PBE A;  1BPZ A;  4KP3 C;  4XBF B;  2LRK A;  3DP7 A;  2L8K A;  3OTO T;  1XNR T;  3UU3 A;  3RQU A;  5LHI B;  4AT7 B;  1W09 A;  4WC5 A;  5DQW A;  3TLU A;  4KLG A;  2UU9 T;  4DR5 T;  4B6X A;  7ICE A;  3LSV A;  5ABH A;  2PJQ A;  4KM5 A;  2ZH9 A;  3FZF B;  4IL9 A;  5LJN A;  1ZQG A;  7ICS A;  2VL0 A;  3CX6 B;  2ZH2 A;  4X4T A;  8ICX A;  4JEU B;  3PNC A;  3RH6 A;  4QXH B;  2CWY A;  5HRD A;  5HXS A;  3QB5 A;  1N34 T;  4U72 A;  4DO0 A;  3MZK B;  3NWI A;  4QZG A;  4K98 A;  3HKD E;  1WOT A;  3ONL C;  4QZD A;  2CLY C;  5JDM A;  2CLY B;  4YMN A;  7ICJ A;  4AKR B;  4X4S A;  4C91 A;  8ICY A;  2YDS A;  8ICT A;  3ZT7 A;  5J2I A;  2DR7 A;  3ISD A;  5CP2 A;  3KV4 A;  2QYW A;  5E0O A;  2FBW A;  4RQ8 A;  4QHO A;  2P66 A;  2CBJ A;  9ICR A;  3HIY A;  5H6Q B;  4TUY E;  5ABF B;  5LXT E;  2IC6 A;  5L2L A;  4I0U A;  3NYB A;  2CMR A;  2P9B A;  2YEV C;  2DRB A;  4PJN A;  3UT5 E;  4V1A v;  2VQF T;  2LOP A;  1ZQK A;  4UR9 A;  1D1C A;  3N9Q A;  4NM2 A;  3O9X A;  4L9I A;  3ZC1 A;  4WC0 A;  2XQY A;  2WU5 A;  5HRL A;  5J2T E;  4ZI7 E;  2AXD S;  3AED A;  1YD8 G;  5DJQ C;  4ZI3 D;  4OAF A;  2PG8 A;  3PUV F;  4PHP A;  3AXJ B;  1S35 A;  4MF8 A;  3L3P A;  3RGL A;  3OVS A;  1ZQJ A;  5JRC B;  3L09 A;  5BOL A;  4RWO A;  4FJO A;  2LSY A;  4FHV A;  5DKW A;  2LHN A;  1M7K A;  4YD1 A;  4DV0 T;  2LSG A;  4I2J A;  3UQ4 A;  3NBX X;  4DV1 T;  3KVB A;  4DR7 T;  2M67 A;  2ZH3 A;  1YW0 A;  4KX6 A;  4NPP A;  3AA1 B;  3LBX B;  4R63 A;  4GYS A;  4ERR A;  3AE2 A;  3FHN A;  4A56 A;  2W0G A;  2DWK A;  2IW5 B;  3FZM B;  3A5X A;  2W4X A;  5J0W A;  3T1Y T;  1HR0 T;  4X4Q A;  2VKJ A;  4A98 A;  2CXD A;  1J1J A;  1E7P A;  3ZT5 A;  1E1H B;  3P50 A;  4DID B;  4YMO A;  2XQ5 A;  5JVD E;  4PW8 A;  3RJK A;  5C3J A;  4AT8 B;  2D0T A;  2JIW A;  3AVS A;  1WYC A;  2W63 A;  1ZQX A;  3JPS A;  4K0K T;  1ZQR A;  4LT6 A;  3ZN1 B;  2DR5 A;  2CWO A;  3RF1 A;  4WCW A;  2A9U A;  1KNP A;  3V7K A;  3EUH A;  4O4H E;  1XDO A;  5LNK A;  1ZQU A;  5F2V O;  3ZPO A;  1BR1 A;  4EGW A;  1BR4 A;  4H9P C;  1TFY A;  3PUA A;  2BPF A;  2NR4 A;  3ESL A;  2M2V A;  4NXU A;  4JWN A;  1MMG A;  2KND A;  3VR8 A;  3ZSS A;  4NUU A;  4K0U A;  4YTM A;  2Y48 B;  3GWH A;  1IBL T;  4UBC A;  2K3W A;  5HEU A;  1HTJ F;  4YTN A;  1SHZ C;  3NRY A;  1ZJN A;  2LT3 A;  3M3Z B;  2PXI A;  3V72 A;  3ZEF B;  4GXK A;  3L39 A;  3AEA A;  3EVY A;  5HXC A;  1ZQN A;  5C2T A;  2LEH A;  4WYV A;  1ZQM A;  4X4U A;  3O1H A;  4QX8 B;  3WFP A;  4KLJ A;  1MND A;  3L8R A;  4X4R A;  2KLQ A;  4DOC A;  4BJN A;  5FKY A;  3K7D A;  4J2C A;  4RQ2 A;  3L9D A;  3AEE A;  3BK9 A;  3ZC0 A;  4I27 A;  2HHH T;  2V1D B;  5HC9 A;  4NM1 A;  1OED B;  2M2W A;  5ABE A;  5LGN B;  1ZQC A;  4E7S A;  4RQ3 A;  2YIN A;  2CHN A;  5HEJ A;  3F2E A;  1NO5 A;  4M04 A;  1D1B A;  1XZY A;  4QX7 B;  4IQT A;  2V6Y A;  5KMG P;  3PML A;  1FJG T;  5AQM B;  4K99 A;  2YN6 A;  4I2B A;  1G8X A;  4P4O A;  3E22 E;  1ZEE A;  2A3D A;  2X66 A;  1XSL A;  2JJ9 A;  2ID1 A;  1BR2 A;  1I6Z A;  4MKP A;  4PHE A;  5BMV E;  1XSP A;  4Z90 A;  4XQ8 A;  4S3N A;  3FZL B;  3AE5 A;  3P4Q A;  2LOS A;  2ODV A;  4NXW A;  2UXC T;  3ZJ1 A;  4ATB A;  2WZI A;  5L4E A;  1US7 B;  2M2U A;  5BR8 T;  1HF8 A; 
#chains in the Genus database with same CATH homology
 4EGW A;  2HN2 A;  2IUB A;  3NVO A;  4I0U A;  3NWI A;  2HN1 A;  3CK6 A;  3RKG A;  4EED A;  4EV6 A;  5JTG A;  2BBJ A;  2BBH A;  4EEB A;  3JCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...