4EGWA

The structure of the soluble domain of cora from methanocaldococcus jannaschii
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
MITVIAIAKDGSIVEPKLDEISFEDYRLIWIDCYDPKDEELYKLSKKIGISVSDLQIGLDEQEIPRVEEDEDFYLIIYKAPLFEEDITTTSLGIYIKNNLLLTIHSDKIKAIGRLHKLISTKKPRIVFERGIGFLLYHILNEITRSYSRILMNLEDELEELEDKLLAGYDREVMEKILGLRKTLVYFHKSLIANRDVLVLLKRKYLPITTKEDRENFEDLYYDTLQLIDMSATYREVLTSMMDITLSLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural insights into the mechanisms of Mg2+ uptake, transport, and gating by CorA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4egwA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4egwA01
4I0UA 4EGWA 4EEDA 3RKGA 3JCFA 2BBJA 2IUBA 5JTGA 2HN2A 2HN1A 4EV6A 4EEBA 3CK6A 3NVOA 2BBHA 3NWIA
chains in the Genus database with same CATH superfamily
2ZM6T 3LBXB 2XQ9A 3PUWF 4YN4A 3ZMZB 2BBHA 4ZI3D 1ZQOA 2HPJA 3EAMA 1HUZA 3LBXA 1ZQIA 2H7VC 4GK0E 2DR7A 1D1CA 3ZT6A 5AQMB 4M47A 4PFOA 4X5TA 4C90A 4DOCA 4FHYA 9ICXA 2CPTA 2OLTA 4DV4T 1JAJA 1KNPA 8ICVA 2ACZA 4F5NA 3K3NA 4U2YA 4QZ9A 3AQNA 2WB5A 4DMVA 5J0YA 5AQJB 3CWZB 2VWAA 3OYXA 4JI5T 2QYWA 4DNDA 4TWFA 3ISDA 3TLUA 2YU1A 1E7PA 3CKDA 3WFQE 2XAJB 3PV0F 3CK6A 4K98A 2X68A 5HRHA 1BR2A 1Q79A 5FXXA 3M3ZB 3RJJA 1U5PA 4DV7T 2LSKA 2CXDA 4RWOA 4Z8XA 9ICEA 2BCRA 4JLEA 4GXKA 2XAFB 2NWBA 3LSVA 1MMAA 3N9NA 1XMOT 4KP3C 3OKQA 4UIGA 4LEYA 1YKHB 3RI5A 3GA8A 1US7B 1N34T 5HWXA 1ZQVA 3AVSA 4K9AA 2BPGA 2ID1A 3V7JA 5LG3A 5HRKA 5LHGB 2CHNA 5LB7B 4R66A 2Q9QD 4MF2A 4WBYA 9ICWA 3JPOA 3HJ1A 4K9BA 3PMNA 1E2AA 4FH5A 4UEMA 3LDQB 3ZJ2A 3K7DA 3MDAA 8ICGA 1HX1B 4PJMA 4LFBT 4ZS2A 4YD1A 1V9DA 4QKNA 3PUYF 4CZZB 4M9HA 3PHZA 3NZQA 3ISCA 4IREA 1Y64B 2ACXA 3RH5A 2LT3A 3MK7C 2Y6XA 4HWHA 3QOFA 2PBEA 2VKJA 3UQ7A 2GK9A 3PDYA 3Q5WA 1UK5A 1XNQT 3ZN1B 3NRXA 3KVBA 5FKYA 2W62A 4HFBA 1LKXA 3ZMTB 4HFCA 1D1BA 3DTOA 3FHNA 2M2UA 4IDOA 5IWAT 5L3DB 4XRHA 2KWHA 1XSNA 1HR0T 4OAIZ 4KLOA 4B3RT 3MCRA 2WBLA 3HW8A 5KMGP 4I2IA 1UEUA 1SUMB 3OPCA 4O5CA 2Q66A 3UUNA 2JMKA 4TN7B 4LEZA 4UD5A 5EK4A 1HNWT 2ZHBA 3P4QA 4MF8A 4PHAA 7ICOA 4DV0T 3QNUA 5HEJA 1ZQHA 2LJLA 3ONXA 2E5VA 3W15B 8ICLA 3BQLA 4XA5A 2L8KA 5HREA 4PAGA 5HC9A 3AEFA 3WFSC 3IA3A 5D62A 3AU2A 2MBGA 4HE8A 3KDSE 3UUXB 4LF9T 3N9QA 3PJAA 5J2BA 3LK42 5CGMA 5JQGE 2O1PA 2CXFA 3ZYKA 3E22E 3MXZA 4NXVA 1T7SA 3IHRA 5J0ZA 4IQWA 3KFWX 1MNDA 8ICTA 2YN6A 3HJ4A 3C98B 5DB8A 5JH7E 3ZCIA 5DABA 2IAKA 4JLZA 2XY8B 4XUSA 1AJ3A 5J2KA 2DRBA 3R84B 5HHHA 2W66A 4UAZA 1ZV4X 5F8PA 4O67A 4K96A 1XDPA 7ICMA 3ZC1A 2C5KT 2D0UA 4GKKT 3DP7A 4PK4A 4O68A 4PPXA 4U72A 4NKUA 4LEWA 3HKDE 3P7IA 4G63A 4AT8B 4WQLA 2CBIA 2K3WA 5IIOA 4Z6EA 3I9YA 2D9DA 4EV6A 3VKHA 2MTQA 4YSYA 4AT8A 4KHPT 4R63A 5DB9A 3ETVA 3RYCE 3KV5A 2BKOA 4M5DA 2W9MA 4EXTA 2YKSA 5LA6E 4KLSA 2LRLA 5J2UE 2WDQA 4ERRA 5FVKA 3AAAB 5IHYA 4OHFA 5DBAA 4QX7B 3TFSA 1VJ7A 3UT5E 9ICSA 2J4GA 3L8RA 5FP3A 2KLQA 2X9HA 3FBLA 4UV8B 4MFFA 2V5DA 4DR7T 3FZFB 3H38A 4H9RC 3PE0A 3EUHA 4ILUA 4QZIA 2K24A 4KI0F 2XAHB 2A72A 1JQRA 5CJ7A 4LFCT 1ZQXA 2X0HA 4K97A 4YMOA 1WFDA 7ICFA 4E7XA 2YOEA 4LZGA 4NXXA 4JI8T 3PUQA 2XAQB 4EBJA 3A8YC 1MIWA 2BVMA 2I59A 8ICNA 3UUBA 5EK3A 5IYZE 3AQLA 4P0BA 2VURA 1ZKEA 5CB1A 4V1Av 1VCTA 1W0AA 3PURA 4LF6T 3AE3A 5FL0A 4A98A 4DV3T 1XMQT 4I2BA 5LNKA 2IHMA 3C50A 2WCAA 2UUAT 4X1YE 1WRDA 4O4JE 2LSJA 2F4VT 3TLTA 3U78A 3NBXX 4IT4A 1ZQKA 7ICIA 9ICBA 1O3XA 2LSYA 1BR1A 5HEOA 3N9LA 2V8SV 4O2AE 2X66A 1UX5A 3P4PA 5KDMC 4ZI2C 2EHOC 4HEAA 4OAHA 1HNXT 5M4YA 1ZQDA 1ZQFA 1SHZC 4AQFA 2BVLA 5CJ5A 1BPYA 5HRGA 2FJAA 1XSLA 4DO0A 4X64T 1XSPA 5E0OA 4JEUB 2JQQA 3EVYA 2NW8A 1ZQUA 1GQEA 1MMNA 4AT7B 3C18A 3WAJA 1OU5A 3JAEA 4AT7A 2J47A 4LF4T 2QA7A 4UVAB 4RWNA 2CRBA 1KFYA 3RJFA 4NUVA 3HKBE 5FYMA 4MBQA 4HGAA 4DVDA 4YD2A 1DU2A 4DV5T 1SE7A 5JDMA 4EZ4A 4U3CA 3ZMUB 4O5EA 2WMOA 4DR4T 1E1HB 5JDLA 4RQ0A 5JR9C 2WU5A 4PJNA 4RQ6A 3NWIA 2J1DG 2B1EA 1WLXA 4K99A 2ISPA 4JYAT 1FEWA 3RKGA 3KVAA 3RIUA 1IJ5A 2LM2A 2CLYC 3ZEFB 5DEDA 3UXOA 1T98A 4HFHA 5L3EB 1NO5A 3N2KE 3TLVA 3CQCB 3H3MA 4ZXLA 2WDRA 4WC7A 4LF7T 1ZQAA 1Q78A 5LXTE 5CHEA 4FJOA 4U31A 3AA6B 4PNIA 4UXNB 8ICZA 4YTPA 9ICMA 4O5KA 1QSDA 5L3CB 2LHRA 4ZI2D 2EHOD 3CIRA 2M67A 2VQFT 4TWDA 2A2FX 3UQ4A 4UAWA 2JIWA 4HX0A 3MKDA 4HFIA 2L3LA 4ISSA 3VHLA 1JNZA 3OJAA 4QXBB 4ILCA 3AQMA 1YW0A 5HRIA 8ICQA 5BOLA 5J2EA 8ICCA 5BPCA 2XQ7A 2N9DA 3RQUA 4NPPA 2RFFA 4WC3A 3AVRA 3CVRA 4I28A 4PGXA 2L9QA 4KLIA 1UCUA 2VKOA 4IG8A 1Z8UA 5IIMA 2IMLA 1I6ZA 4GKJT 2IUBA 3AXJB 2BCSA 3HL6A 5HCJA 9ICUA 3AXJA 2HH7A 4IGUA 4WW0A 1WYBA 5AQHB 1YLQA 5LMUT 3ZT7A 2YK0A 2Q9QC 4A56A 3ZLIA 4X5VA 2KSRA 2LSGA 4M2YA 2XQ4A 1S94A 3SRZA 3AE7A 1ZQEA 2WZIA 3ZKRA 3B0YA 4TV9E 2XQ5A 4I2DA 3QB5K 5CFBA 4ZHQE 5FXZA 4K4IA 3L9DA 5HRFA 1J5WA 4I2JA 1X9BA 9ICNA 4FHPA 5LHHB 1FMVA 4K0UA 4L5GA 2CEAA 2ZHAA 1UURA 3Q5XA 5CA7A 4TURA 2W4XA 2HHPA 1R89A 3J7Yq 3RYIE 3RJGA 4TUYE 4JLXA 5AQKB 3BK9A 4F5OA 1HUOA 3PUXF 2EWRA 3UU6A 5J0RA 4X4RA 2BCUA 3AA1B 1D0YA 5HRBA 5L4EA 4GXJA 7ICVA 4X4PA 4PGQA 2CM0A 2CHOA 1BPBA 4X4UA 5LP6E 3VU7H 3HI2A 1LVFA 2BKNA 3M65A 9ICIA 4DR6T 1RPLA 4QZGA 9ICRA 2X9WA 4AKGA 3OGUA 4UAYA 3AA7B 4H9NC 4MFCA 4RT2A 4ZZBA 2UUBT 3NYBA 1ZHCA 2WWUA 1G73A 4RQ1A 4KLLA 4TZ4C 3OYZA 2FBWA 3MDCA 1MMGA 4H63V 4EIWA 2X9XA 3AE2A 2ZH1A 2BCQA 2XM1A 3FXEB 4FHVA 1UUSA 2I9GA 4PHEA 4IDZA 2J62A 2K9AA 2WWVA 4AISA 3LG7A 4MALA 4GK5E 1OEDE 2XAGB 1XWMA 2BG9E 1XZYA 2B56A 1MIVA 3WFPA 4HWDA 2KWIB 1VCSA 2V6XA 4WBZA 4YCXA 5AQTB 2M2VA 5J2FA 4UVBB 1D0XA 5JDHA 4DIDB 3RKOA 5HXRA 1ZQLA 9ICJA 4F5QA 5AFUL 4NXTA 1YD8G 1ZOYA 3UFEA 2G0UA 3K3QC 2BS3A 5AQFB 1ZQRA 3EF2A 4NLZA 3AE4A 1H7CA 4TWHA 4EAHA 3PTRB 4OYKA 3VKGA 3RF1A 4BA9A 3AUOA 4U7IA 3UULA 3PU8A 4QHOA 4FHXA 4I27A 2B76A 3O4XE 1XNRT 2JPFA 3I0QA 9ICFA 3Q5EA 1HG2A 5CWRA 4DOAA 2DHRA 4PJLA 3ZMSB 4I2AA 2QGSA 4CXWA 2YEVC 3LQCB 4LT6A 2DLRA 4IE7A 4RQ7A 3RGLA 7ICGA 2DR8A 4XQ8A 4EZHA 3LK2B 1R8AA 3AEGA 2BS4A 3AEEA 5LG4A 5LCYA 2CA5A 4UB5A 2H88A 1W09A 5C8YE 5AQLB 4A97A 2QRXA 5AQNB 4WBNE 1KEJA 1S35A 3H37A 2LSIA 5LJNA 4KLQA 4I0UA 4NXMT 5D46A 5L3GB 5AQVB 2C0SA 5FMNA 4E8FA 8ICWA 4X4SA 5IINA 4L0RA 2N1GA 2PFNA 2LEHA 3UFGA 4ILBA 3ONJA 1OXZA 2A3DA 2ODVA 7ICPA 3PUGA 2CWOA 4DR1T 2V7KA 4IDNA 1TV9A 4Z6DA 3N9MA 8ICYA 2VVSA 2LKGA 3KBTA 4JBWF 2WSSV 1ZQSA 4M9JA 5J2GA 5FNVE 3P4SA 2ZH7A 2WMNA 2GWSA 5L47A 4PGYA 2C5JA 4AI6A 1ZQPA 9ICKA 1G8XA 2D5UA 4RQ3A 3JPTA 2P9BA 3L3PA 1KDHA 3C66A 4M9NA 4X4TA 2V1DB 2E8IA 2JRKA 2W2UA 5IIJA 3O1JA 3HIYA 2X67A 8ICJA 2E9XC 4EYUA 4MHCA 4IE0A 4M0AA 4FH3A 3AE1A 5DQVA 4OK0A 7ICKA 4QH4A 3WFOA 4PHDA 4LFAT 4IDQA 1R8BA 5FY1A 1IZNB 2XM2A 4H9OC 3TLSA 1Z0PA 4X4VA 2IC9A 2X0YA 3D0TA 3RLFF 3R6NA 2FJEA 4DR2T 3NZPA 3VR9A 4JV5T 5D4BA 3L09A 5L2LA 2ODUA 2PXIA 3OBVE 4PJJA 4P1NA 4J2CA 5FL1A 8ICKA 4R64A 3I9WA 2H3RA 5JTGA 2KXPB 4MFRA 5D49A 2VQET 5JREA 5LBQB 1KF6A 4WC5A 1BR0A 3E0ZA 2XQYA 2V7IA 3N5LA 3ERCC 2JQ9A 2H7OA 4FO6A 3RC3A 1R8CA 5B3PA 3CX8B 4NLKA 5CHGA 4UVCB 2NW7A 2XUEA 5C2TA 3ER8C 1ZQGA 2ZH3A 2XZEA 5H6RB 4DMWA 3P4RA 4BJMA 2DVIA 8ICFA 3UQ2A 3HWTA 1MQ2A 4IQVA 4AIUA 5HXEA 4RPYA 4NXNT 5DBCA 2BPFA 1GPJA 5CA0E 2XJ7A 5AQIB 4HWIB 2DWGA 8ICXA 4S3NA 4K4GA 1OEDC 2BG9C 3Q5DA 4I2CA 4EB6E 3JYYA 3CMLA 3AU6A 2E9XD 4MFAA 1KEYA 2C5IT 4KLHA 5CB4E 2E5LT 5DB6A 2ISOA 4EYYR 3EI0A 1NAFA 2I6HA 2P66A 4DV6T 3F57A 5F5WA 3V7LA 2UUCT 1HS7A 3ISBA 4HKAA 4EEDA 3N2OA 2D0TA 4K4HA 3TFRA 4X20E 3WFRE 3VRAA 2ZM0A 4LF5T 4HWFA 1EZ3A 1HG5A 3ZJ1A 3TKLB 3ZCJA 5J2HA 3H3AA 4KX6A 4B3ST 4YLHA 4X66T 4AKHA 1UGOA 2ZM8A 4DR3T 4DUYT 2FMQA 4KLDA 4K0KT 4NM2A 3AE6A 1JMSA 5TZVA 7ICLA 4KBMB 3LJCA 4FO1A 2LOSA 4Z90A 3GMIA 4CI1B 4WC2A 2EHOB 5AQPB 4I2FA 3K3OA 2RA1A 1LRZA 4E7ZA 5HWYA 4GYSA 4N7RA 2FJDA 5DECA 4ILAA 4CXXA 4C91A 3EDUA 4X4NA 4NLNA 5IIIA 3NRYA 1KNYA 7ICHA 3C4WA 5J1GA 4AQGA 4YSZA 3MGIA 3N9PA 1YQ3A 4Z91A 2PFOA 2WY2A 3ANWB 4AQYT 3RJEA 2BS2A 5BR8T 4LVSA 4I55E 3A5XA 3ANWA 2MOZA 3UPSA 2W0GA 2WZHA 7ICSA 5ETWA 3JZ0A 2WDVA 2LRKA 4CI2B 5JDQA 5FXWA 2HN1A 5DKWA 4KLEA 1D0ZA 5J2TE 4WC6A 3K8PC 3ZMVB 4QX8B 1TFYA 1U4QA 4P2HA 3EHZA 1J1JA 2DR5A 1L0VA 3V5SA 4KLUA 3OTOT 3AE8A 5JR9B 3QC9A 4I50E 4JUYA 3KINB 1UX4A 4IDPA 3PMLA 4CXYA 5JR9A 9ICCA 3PUVF 3N2GE 2W63A 4OAGA 2UU9T 3JPQA 1IBMT 4KM5A 2NOXA 2CLYB 4IQTA 4ZZCA 4U74A 2W61A 5LYJE 3JPRA 3AAEB 7ICTA 2R6GF 2M2TA 5DDYA 3EDVA 9ICVA 4JI3T 4E80A 2IIUA 3V5UA 3T8OA 4Z6FA 3C5FA 4KUMB 2BKPA 3C4ZA 4Q25A 2V5CA 3AE9A 5CFSA 4COFA 1ZJMA 5J2IA 3HKEE 3AQKA 1IBLT 2A9UA 4GOUA 5J2CA 3CX7B 4JEHB 4QZBA 4DV1T 3MJXA 7ICEA 4X0BA 2DI4A 4BAYB 3RHWA 3B57A 2LM9A 2YU2A 8ICOA 3HKCE 4YTMA 5L3FB 5HEHA 1QUUA 3ESLA 4QZCA 1WOTA 3OUYB 1JNRA 2KZ7B 2X0LB 1ZEEA 3OUYA 4H9SE 4RQ4A 3OV7A 3UU3A 4IE6A 5IIKA 3RJIA 3JADA 5LOVE 1NWMX 4ASKA 4CN1A 2K48A 1V4AA 3JC6C 2VVNA 4X0AA 3SS1A 4NM1A 5H6QB 5L3BB 3AB3B 4CN4A 5DQWA 4YFSA 4X1IE 2Q9QB 8ICMA 4WYVA 4MKPA 4P4MA 4XBFB 4F5RA 3ZYMA 3E08A 2Q9QA 2BCVA 1ZQNA 3C51A 2KMFA 4RQ2A 1ZQMA 4PK6A 4UD4A 9ICQA 3C64A 2MYSA 2NW9A 4U2ZA 3ZPOA 4I2GA 2DWKA 3JCFA 3UTKA 2XQ8A 4QZ8A 4HN9A 1HF8A 4YT0A 3UXPA 2B4VA 1NENA 1ZQJA 5J2JA 2DRAA 5JDNA 4U7YA 2XSAA 3O9XA 2MAWA 4XAXB 2ZM2A 4QZEA 3RH6A 4UF0B 2PJQA 3L39A 5FY7A 4F5PA 4WOYA 1OWAA 2XASB 4UF0A 5ABFB 3NKZA 1JN3A 3OVSA 4O8SA 5ABFA 1RZTA 2FCLA 4UB4A 5EK2A 4WZXA 4YHHT 2MPKA 2X51A 2FMSA 1BPEA 1W9RA 4EBKA 5J0QA 3O1HA 4P0AA 2XQ3A 4LZDA 2DCFA 5DBBA 3Q9DA 1ZQCA 4UB1A 2Y8DA 4WBOA 5ABGA 9ICGA 4UR9A 3RH4A 7ICQA 3T1HT 3DJBA 8ICUA 5CFUA 4X4QA 4L9IA 3HX0A 3FZMB 1BR4A 2LLYA 2RP4A 3C2KA 1IAPA 4IHJE 4B6XA 2DR9A 3PUAA 3JC6D 3P50A 5HR9A 4UV9B 2VK9A 4OFZA 4WC4A 1ZQTA 2BDEA 4WCWA 4QZDA 3UQ0A 4M9LA 5TAOA 3CQGB 1TVAA 4ANJA 4M1PA 2AE9A 1ZP0A 3RC8A 5AQUB 2IDOB 5ABHA 4CN6A 2YDSA 1ZQQA 3U3IA 3ONLC 3JPSA 5KX5E 3P8CD 3PU3A 4RWPA 3OVAA 3AAIA 5KXJA 1KNRA 2XPKA 4NXWA 3ZYLA 3RYHE 3BQIA 5ADXL 8ICAA 2UXBT 3FXDB 4TNWA 2I0MA 4ZS3A 5AQGB 5F2VO 4RPZA 2GA9D 3BQKA 2VASA 2PBIA 4X62T 2ZH4A 4KLJA 5F3JA 4JI4T 1F5AA 1KK7A 4H63H 4I2HA 4LMLA 4IL4A 4UBBA 2IHR1 4HFVA 4WH5A 8ICBA 4WC0A 1HNZT 4ZOLE 5LHIB 8ICEA 1M7KA 5CA1E 4FI5A 4EEBA 1HFAA 4AKRB 5J2DA 2VL0A 2WAUA 5AQOB 4CQIA 2LOPA 2JQKA 3RJHA 2WP9A 4O4LE 4PHPA 3NKUA 2K5BB 1M62A 2CCQA 4X1KE 1T72A 4JI7T 4RQ5A 4Z6CA 2M6BA 3IEEA 4B3TT 4DBRA 4QWNB 5FXVA 1ZQZA 1ZQWA 3F2EA 3Q2MA 3QK6A 4YTNA 4JI0T 4JI2T 5JDGA 2BBJA 2LHNA 5LMNT 5DB7A 2ZH2A 5JDFA 4YMNA 4HWCA 4M04A 4NXZA 4LF8T 1KNZA 3VR8A 4QZAA 2UXDT 2H89A 3TLWA 4O69A 5HHIA 2ZH9A 5J0TA 4GXIA 2NR4A 4DV2T 9ICAA 4DBQA 3G06A 3RRWA 3FB2A 2YINA 2DL1A 2NTYA 1QLBA 5LGTB 4K8VA 3K1SA 4I2EA 3B0XA 1N32T 4QXHB 3QB5A 1UETA 5DDMA 3J9X1 2V26A 2O5AA 4NY8A 4KHZF 3SFDA 1HTJF 3B5MA 2PFPA 5L4HA 3ZC0A 2E9XB 3JPPA 3WI3A 4G2AA 2FUPA 3B13A 2E9XA 5B3QA 4DOBA 4YHJA 9ICLA 3AEDA 2VB6A 4DR5T 5GONE 1MIYA 4HFDA 5HRDA 4QH5A 1FMWA 4KLTA 5HXCA 1BPZA 4I43B 9ICOA 2XQAA 2CE7A 3PUSA 5LJMA 4YJ3E 5HYAA 1LVKA 4E7SA 2XHEB 4EGWA 4AT9B 4IE5A 1CUNA 3AECA 3UU5A 4TV8E 4AT9A 3RPUA 2UXCT 2M2WA 5HXSA 4ZI7E 2JQHA 3C4XA 2PTFA 9ICHA 3CQXC 4TUSA 4P09A 5AQQB 3UU4A 5LBMA 2D2SA 4DUZT 5A1LA 2PG8A 3MGHA 3SWHA 4ISTA 3N9OA 1IJ6A 3A7MA 1J5ET 4P4OA 3C2MA 4O9MA 2IC6A 2WM9A 5D61A 5JRCB 1IBKT 4M9GA 3KV6A 2YDQA 2KT9A 3T1YT 1VRBA 5JRCA 2OV9A 2LE8A 2XTLA 8ICSA 3PUZF 2CWYA 5HEGA 2ZMAA 2UXXB 1MNEA 1YKEB 2W00A 4FHWA 2ZH8A 3V72A 4JWMA 5J29A 4ATBB 3GWHA 4B3MT 5C3JA 2SPCA 3CPZA 1FJGT 2Z6EA 5IILA 4ATBA 4EOZB 2E2AA 3GDXA 3AE5A 3O1IA 1N33T 1OEDB 2V6YB 2BG9B 4U33A 8ICIA 4LMKA 2OA5A 1UEVA 4F6RC 1OEDA 5HEUA 2V6YA 2BG9A 5EOZA 1D1AA 4NKTA 4KMCA 4KLGA 4NXUA 3MBYA 4I29A 5EZYE 5J0WA 2B51A 2NRKA 2NTXA 4TUQA 2HHHT 3LK3B 5FVLA 4PK5A 3ZSTA 5HAXA 3K75D 3CX6B 3NVOA 3GN5B 5BOMA 2IW5B 5IUXA 3GN5A 1ZJNA 3PNCA 3VRBA 2VKHA 5CFTA 4MLKA 4I4TE 1R8IA 3JAFA 4RPXA 4KLFA 5HXHA 1BPXA 3X1DA 1ZQYA 7ICNA 4HTEA 4LEVA 5J0SA 4UB3A 4JI1T 2LKHA 4NUUA 4YXDA 2GAFD 1HCIA 5BMVE 3ABVA 1WCRA 5AQSB 3SFEA 3RIAA 5J0XA 3LK9A 2ZH5A 2VKDA 4TX5A 2XQ6A 1B7TA 4OX9T 4O4IE 2RPAA 2Y48B 5HCMA 4XJEA 1WYCA 3RQWA 3F31A 3UUMA 4AKLA 1Y01A 3C2LA 5JVDE 5CR0A 2EHOA 1X79A 4LMJA 4QZFA 2ZLYA 3HR0A 2V7MA 1WR0A 4PFPA 5DJQC 4KB6A 4F8HA 3ZSSA 3MA9A 3EABA 3UXNA 4YMMA 9ICPA 3FZHB 4IE4A 1N36T 5J2AA 4AQFC 8ICRA 4O6AA 4GIWA 4KLMA 1NEKA 5LGNB 1ZQBA 3FBZA 4XQ7A 8ICHA 2HPLA 3HA4A 4HFEA 2VANA 4YJ2E 4EP7A 3AEBA 1WR6A 2CMRA 1VOMA 3ZT5A 3I0OA 1XDOA 4RQ8A 2WU2A 3C5GA 4WNKA 5J0OA 3WAKA 3ER9B 3ETUA 3IBPA 2FMPA 1FIOA 1I94T 5J0PA 2WS3A 4O2BE 2AXDS 4O4HE 2W67A 5D63A 1VFGA 4P4PA 3RH3A 2FJBA 3SOLA 4YY3T 2BPCA 3OVBA 4X65T 2JJ9A 2IHOA 4JWNA 4IIJE 2KNDA 4ZI3C 4IL9A 4A5XA 7ICUA 3RIFA 4R65A 4TUPA 2PFVA 4WC1A 3KV9A 3V7KA 3H39A 3UPQA 2X9YA 2PFQA 2VL8A 3RIUC 2WQYA 5HRLA 4UB2A 2V7JA 4AKIA 2ZH6A 1FA0A 1HX8A 3RX6A 1YXRA 3OVUA 4H9QC 5LGUB 3KV4A 4JI6T 4BJNA 2ES0A 3AA0B 3PJAJ 3IF8B 4NIQA 4QXCB 4OYJA 2XSBA 4GYRA 4X4OA 1YQ4A 3RRCA 7ICRA 3FZLB 5J0UA 4ZEYA 1PX5A 1W0BA 4WQKA 5ABEA 3KBUA 4XZCA 3MZKB 3I1AA 4H9PC 1CHUA 4AXPA 3MACA 3UU8A 1TFWA 3FZKB 1NOMA 3OWGA 5AQRB 4QZHA 2DNXA 2V7LA 1MQ3A 5CP2A 3QUJA 2BZBA 4PW8A 3AEAA 3LFMA 4PH5A 3RJKA 4IQUA 2BE3A 2JMHA 4DO9A 2UXNB 4UBCA 1SA0E 4QH1A 1T8BA 4ADZA 3JPNA 4OAFA 7ICJA 1BPDA 2QVAA 1MMDA 2YDRA 2NP9A 3RYFE 2CXLA 2CBJA 2HN2A 3P4WA 2KINB 4N78D 4RWQA 4UELA 4TNVA 3S4UA 8ICPA 5FY0A 2M6IA 2N2NA 3ZN0B 4RT3A 9ICTA 4CI3B 4YSXA
chains in the Genus database with same CATH topology
4I0UA 4EGWA 4EEDA 3RKGA 3JCFA 2BBJA 2IUBA 5JTGA 2HN2A 2HN1A 4EV6A 4EEBA 3CK6A 3NVOA 2BBHA 3NWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0U A;  4EGW A;  4EED A;  3RKG A;  3JCF A;  2BBJ A;  2IUB A;  5JTG A;  2HN2 A;  2HN1 A;  4EV6 A;  4EEB A;  3CK6 A;  3NVO A;  2BBH A;  3NWI A; 
#chains in the Genus database with same CATH topology
 2ZM6 T;  3LBX B;  2XQ9 A;  3PUW F;  4YN4 A;  3ZMZ B;  2BBH A;  4ZI3 D;  1ZQO A;  2HPJ A;  3EAM A;  1HUZ A;  3LBX A;  1ZQI A;  2H7V C;  4GK0 E;  2DR7 A;  1D1C A;  3ZT6 A;  5AQM B;  4M47 A;  4PFO A;  4X5T A;  4C90 A;  4DOC A;  4FHY A;  9ICX A;  2CPT A;  2OLT A;  4DV4 T;  1JAJ A;  1KNP A;  8ICV A;  2ACZ A;  4F5N A;  3K3N A;  4U2Y A;  4QZ9 A;  3AQN A;  2WB5 A;  4DMV A;  5J0Y A;  5AQJ B;  3CWZ B;  2VWA A;  3OYX A;  4JI5 T;  2QYW A;  4DND A;  4TWF A;  3ISD A;  3TLU A;  2YU1 A;  1E7P A;  3CKD A;  3WFQ E;  2XAJ B;  3PV0 F;  3CK6 A;  4K98 A;  2X68 A;  5HRH A;  1BR2 A;  1Q79 A;  5FXX A;  3M3Z B;  3RJJ A;  1U5P A;  4DV7 T;  2LSK A;  2CXD A;  4RWO A;  4Z8X A;  9ICE A;  2BCR A;  4JLE A;  4GXK A;  2XAF B;  2NWB A;  3LSV A;  1MMA A;  3N9N A;  1XMO T;  4KP3 C;  3OKQ A;  4UIG A;  4LEY A;  1YKH B;  3RI5 A;  3GA8 A;  1US7 B;  1N34 T;  5HWX A;  1ZQV A;  3AVS A;  4K9A A;  2BPG A;  2ID1 A;  3V7J A;  5LG3 A;  5HRK A;  5LHG B;  2CHN A;  5LB7 B;  4R66 A;  2Q9Q D;  4MF2 A;  4WBY A;  9ICW A;  3JPO A;  3HJ1 A;  4K9B A;  3PMN A;  1E2A A;  4FH5 A;  4UEM A;  3LDQ B;  3ZJ2 A;  3K7D A;  3MDA A;  8ICG A;  1HX1 B;  4PJM A;  4LFB T;  4ZS2 A;  4YD1 A;  1V9D A;  4QKN A;  3PUY F;  4CZZ B;  4M9H A;  3PHZ A;  3NZQ A;  3ISC A;  4IRE A;  1Y64 B;  2ACX A;  3RH5 A;  2LT3 A;  3MK7 C;  2Y6X A;  4HWH A;  3QOF A;  2PBE A;  2VKJ A;  3UQ7 A;  2GK9 A;  3PDY A;  3Q5W A;  1UK5 A;  1XNQ T;  3ZN1 B;  3NRX A;  3KVB A;  5FKY A;  2W62 A;  4HFB A;  1LKX A;  3ZMT B;  4HFC A;  1D1B A;  3DTO A;  3FHN A;  2M2U A;  4IDO A;  5IWA T;  5L3D B;  4XRH A;  2KWH A;  1XSN A;  1HR0 T;  4OAI Z;  4KLO A;  4B3R T;  3MCR A;  2WBL A;  3HW8 A;  5KMG P;  4I2I A;  1UEU A;  1SUM B;  3OPC A;  4O5C A;  2Q66 A;  3UUN A;  2JMK A;  4TN7 B;  4LEZ A;  4UD5 A;  5EK4 A;  1HNW T;  2ZHB A;  3P4Q A;  4MF8 A;  4PHA A;  7ICO A;  4DV0 T;  3QNU A;  5HEJ A;  1ZQH A;  2LJL A;  3ONX A;  2E5V A;  3W15 B;  8ICL A;  3BQL A;  4XA5 A;  2L8K A;  5HRE A;  4PAG A;  5HC9 A;  3AEF A;  3WFS C;  3IA3 A;  5D62 A;  3AU2 A;  2MBG A;  4HE8 A;  3KDS E;  3UUX B;  4LF9 T;  3N9Q A;  3PJA A;  5J2B A;  3LK4 2;  5CGM A;  5JQG E;  2O1P A;  2CXF A;  3ZYK A;  3E22 E;  3MXZ A;  4NXV A;  1T7S A;  3IHR A;  5J0Z A;  4IQW A;  3KFW X;  1MND A;  8ICT A;  2YN6 A;  3HJ4 A;  3C98 B;  5DB8 A;  5JH7 E;  3ZCI A;  5DAB A;  2IAK A;  4JLZ A;  2XY8 B;  4XUS A;  1AJ3 A;  5J2K A;  2DRB A;  3R84 B;  5HHH A;  2W66 A;  4UAZ A;  1ZV4 X;  5F8P A;  4O67 A;  4K96 A;  1XDP A;  7ICM A;  3ZC1 A;  2C5K T;  2D0U A;  4GKK T;  3DP7 A;  4PK4 A;  4O68 A;  4PPX A;  4U72 A;  4NKU A;  4LEW A;  3HKD E;  3P7I A;  4G63 A;  4AT8 B;  4WQL A;  2CBI A;  2K3W A;  5IIO A;  4Z6E A;  3I9Y A;  2D9D A;  4EV6 A;  3VKH A;  2MTQ A;  4YSY A;  4AT8 A;  4KHP T;  4R63 A;  5DB9 A;  3ETV A;  3RYC E;  3KV5 A;  2BKO A;  4M5D A;  2W9M A;  4EXT A;  2YKS A;  5LA6 E;  4KLS A;  2LRL A;  5J2U E;  2WDQ A;  4ERR A;  5FVK A;  3AAA B;  5IHY A;  4OHF A;  5DBA A;  4QX7 B;  3TFS A;  1VJ7 A;  3UT5 E;  9ICS A;  2J4G A;  3L8R A;  5FP3 A;  2KLQ A;  2X9H A;  3FBL A;  4UV8 B;  4MFF A;  2V5D A;  4DR7 T;  3FZF B;  3H38 A;  4H9R C;  3PE0 A;  3EUH A;  4ILU A;  4QZI A;  2K24 A;  4KI0 F;  2XAH B;  2A72 A;  1JQR A;  5CJ7 A;  4LFC T;  1ZQX A;  2X0H A;  4K97 A;  4YMO A;  1WFD A;  7ICF A;  4E7X A;  2YOE A;  4LZG A;  4NXX A;  4JI8 T;  3PUQ A;  2XAQ B;  4EBJ A;  3A8Y C;  1MIW A;  2BVM A;  2I59 A;  8ICN A;  3UUB A;  5EK3 A;  5IYZ E;  3AQL A;  4P0B A;  2VUR A;  1ZKE A;  5CB1 A;  4V1A v;  1VCT A;  1W0A A;  3PUR A;  4LF6 T;  3AE3 A;  5FL0 A;  4A98 A;  4DV3 T;  1XMQ T;  4I2B A;  5LNK A;  2IHM A;  3C50 A;  2WCA A;  2UUA T;  4X1Y E;  1WRD A;  4O4J E;  2LSJ A;  2F4V T;  3TLT A;  3U78 A;  3NBX X;  4IT4 A;  1ZQK A;  7ICI A;  9ICB A;  1O3X A;  2LSY A;  1BR1 A;  5HEO A;  3N9L A;  2V8S V;  4O2A E;  2X66 A;  1UX5 A;  3P4P A;  5KDM C;  4ZI2 C;  2EHO C;  4HEA A;  4OAH A;  1HNX T;  5M4Y A;  1ZQD A;  1ZQF A;  1SHZ C;  4AQF A;  2BVL A;  5CJ5 A;  1BPY A;  5HRG A;  2FJA A;  1XSL A;  4DO0 A;  4X64 T;  1XSP A;  5E0O A;  4JEU B;  2JQQ A;  3EVY A;  2NW8 A;  1ZQU A;  1GQE A;  1MMN A;  4AT7 B;  3C18 A;  3WAJ A;  1OU5 A;  3JAE A;  4AT7 A;  2J47 A;  4LF4 T;  2QA7 A;  4UVA B;  4RWN A;  2CRB A;  1KFY A;  3RJF A;  4NUV A;  3HKB E;  5FYM A;  4MBQ A;  4HGA A;  4DVD A;  4YD2 A;  1DU2 A;  4DV5 T;  1SE7 A;  5JDM A;  4EZ4 A;  4U3C A;  3ZMU B;  4O5E A;  2WMO A;  4DR4 T;  1E1H B;  5JDL A;  4RQ0 A;  5JR9 C;  2WU5 A;  4PJN A;  4RQ6 A;  3NWI A;  2J1D G;  2B1E A;  1WLX A;  4K99 A;  2ISP A;  4JYA T;  1FEW A;  3RKG A;  3KVA A;  3RIU A;  1IJ5 A;  2LM2 A;  2CLY C;  3ZEF B;  5DED A;  3UXO A;  1T98 A;  4HFH A;  5L3E B;  1NO5 A;  3N2K E;  3TLV A;  3CQC B;  3H3M A;  4ZXL A;  2WDR A;  4WC7 A;  4LF7 T;  1ZQA A;  1Q78 A;  5LXT E;  5CHE A;  4FJO A;  4U31 A;  3AA6 B;  4PNI A;  4UXN B;  8ICZ A;  4YTP A;  9ICM A;  4O5K A;  1QSD A;  5L3C B;  2LHR A;  4ZI2 D;  2EHO D;  3CIR A;  2M67 A;  2VQF T;  4TWD A;  2A2F X;  3UQ4 A;  4UAW A;  2JIW A;  4HX0 A;  3MKD A;  4HFI A;  2L3L A;  4ISS A;  3VHL A;  1JNZ A;  3OJA A;  4QXB B;  4ILC A;  3AQM A;  1YW0 A;  5HRI A;  8ICQ A;  5BOL A;  5J2E A;  8ICC A;  5BPC A;  2XQ7 A;  2N9D A;  3RQU A;  4NPP A;  2RFF A;  4WC3 A;  3AVR A;  3CVR A;  4I28 A;  4PGX A;  2L9Q A;  4KLI A;  1UCU A;  2VKO A;  4IG8 A;  1Z8U A;  5IIM A;  2IML A;  1I6Z A;  4GKJ T;  2IUB A;  3AXJ B;  2BCS A;  3HL6 A;  5HCJ A;  9ICU A;  3AXJ A;  2HH7 A;  4IGU A;  4WW0 A;  1WYB A;  5AQH B;  1YLQ A;  5LMU T;  3ZT7 A;  2YK0 A;  2Q9Q C;  4A56 A;  3ZLI A;  4X5V A;  2KSR A;  2LSG A;  4M2Y A;  2XQ4 A;  1S94 A;  3SRZ A;  3AE7 A;  1ZQE A;  2WZI A;  3ZKR A;  3B0Y A;  4TV9 E;  2XQ5 A;  4I2D A;  3QB5 K;  5CFB A;  4ZHQ E;  5FXZ A;  4K4I A;  3L9D A;  5HRF A;  1J5W A;  4I2J A;  1X9B A;  9ICN A;  4FHP A;  5LHH B;  1FMV A;  4K0U A;  4L5G A;  2CEA A;  2ZHA A;  1UUR A;  3Q5X A;  5CA7 A;  4TUR A;  2W4X A;  2HHP A;  1R89 A;  3J7Y q;  3RYI E;  3RJG A;  4TUY E;  4JLX A;  5AQK B;  3BK9 A;  4F5O A;  1HUO A;  3PUX F;  2EWR A;  3UU6 A;  5J0R A;  4X4R A;  2BCU A;  3AA1 B;  1D0Y A;  5HRB A;  5L4E A;  4GXJ A;  7ICV A;  4X4P A;  4PGQ A;  2CM0 A;  2CHO A;  1BPB A;  4X4U A;  5LP6 E;  3VU7 H;  3HI2 A;  1LVF A;  2BKN A;  3M65 A;  9ICI A;  4DR6 T;  1RPL A;  4QZG A;  9ICR A;  2X9W A;  4AKG A;  3OGU A;  4UAY A;  3AA7 B;  4H9N C;  4MFC A;  4RT2 A;  4ZZB A;  2UUB T;  3NYB A;  1ZHC A;  2WWU A;  1G73 A;  4RQ1 A;  4KLL A;  4TZ4 C;  3OYZ A;  2FBW A;  3MDC A;  1MMG A;  4H63 V;  4EIW A;  2X9X A;  3AE2 A;  2ZH1 A;  2BCQ A;  2XM1 A;  3FXE B;  4FHV A;  1UUS A;  2I9G A;  4PHE A;  4IDZ A;  2J62 A;  2K9A A;  2WWV A;  4AIS A;  3LG7 A;  4MAL A;  4GK5 E;  1OED E;  2XAG B;  1XWM A;  2BG9 E;  1XZY A;  2B56 A;  1MIV A;  3WFP A;  4HWD A;  2KWI B;  1VCS A;  2V6X A;  4WBZ A;  4YCX A;  5AQT B;  2M2V A;  5J2F A;  4UVB B;  1D0X A;  5JDH A;  4DID B;  3RKO A;  5HXR A;  1ZQL A;  9ICJ A;  4F5Q A;  5AFU L;  4NXT A;  1YD8 G;  1ZOY A;  3UFE A;  2G0U A;  3K3Q C;  2BS3 A;  5AQF B;  1ZQR A;  3EF2 A;  4NLZ A;  3AE4 A;  1H7C A;  4TWH A;  4EAH A;  3PTR B;  4OYK A;  3VKG A;  3RF1 A;  4BA9 A;  3AUO A;  4U7I A;  3UUL A;  3PU8 A;  4QHO A;  4FHX A;  4I27 A;  2B76 A;  3O4X E;  1XNR T;  2JPF A;  3I0Q A;  9ICF A;  3Q5E A;  1HG2 A;  5CWR A;  4DOA A;  2DHR A;  4PJL A;  3ZMS B;  4I2A A;  2QGS A;  4CXW A;  2YEV C;  3LQC B;  4LT6 A;  2DLR A;  4IE7 A;  4RQ7 A;  3RGL A;  7ICG A;  2DR8 A;  4XQ8 A;  4EZH A;  3LK2 B;  1R8A A;  3AEG A;  2BS4 A;  3AEE A;  5LG4 A;  5LCY A;  2CA5 A;  4UB5 A;  2H88 A;  1W09 A;  5C8Y E;  5AQL B;  4A97 A;  2QRX A;  5AQN B;  4WBN E;  1KEJ A;  1S35 A;  3H37 A;  2LSI A;  5LJN A;  4KLQ A;  4I0U A;  4NXM T;  5D46 A;  5L3G B;  5AQV B;  2C0S A;  5FMN A;  4E8F A;  8ICW A;  4X4S A;  5IIN A;  4L0R A;  2N1G A;  2PFN A;  2LEH A;  3UFG A;  4ILB A;  3ONJ A;  1OXZ A;  2A3D A;  2ODV A;  7ICP A;  3PUG A;  2CWO A;  4DR1 T;  2V7K A;  4IDN A;  1TV9 A;  4Z6D A;  3N9M A;  8ICY A;  2VVS A;  2LKG A;  3KBT A;  4JBW F;  2WSS V;  1ZQS A;  4M9J A;  5J2G A;  5FNV E;  3P4S A;  2ZH7 A;  2WMN A;  2GWS A;  5L47 A;  4PGY A;  2C5J A;  4AI6 A;  1ZQP A;  9ICK A;  1G8X A;  2D5U A;  4RQ3 A;  3JPT A;  2P9B A;  3L3P A;  1KDH A;  3C66 A;  4M9N A;  4X4T A;  2V1D B;  2E8I A;  2JRK A;  2W2U A;  5IIJ A;  3O1J A;  3HIY A;  2X67 A;  8ICJ A;  2E9X C;  4EYU A;  4MHC A;  4IE0 A;  4M0A A;  4FH3 A;  3AE1 A;  5DQV A;  4OK0 A;  7ICK A;  4QH4 A;  3WFO A;  4PHD A;  4LFA T;  4IDQ A;  1R8B A;  5FY1 A;  1IZN B;  2XM2 A;  4H9O C;  3TLS A;  1Z0P A;  4X4V A;  2IC9 A;  2X0Y A;  3D0T A;  3RLF F;  3R6N A;  2FJE A;  4DR2 T;  3NZP A;  3VR9 A;  4JV5 T;  5D4B A;  3L09 A;  5L2L A;  2ODU A;  2PXI A;  3OBV E;  4PJJ A;  4P1N A;  4J2C A;  5FL1 A;  8ICK A;  4R64 A;  3I9W A;  2H3R A;  5JTG A;  2KXP B;  4MFR A;  5D49 A;  2VQE T;  5JRE A;  5LBQ B;  1KF6 A;  4WC5 A;  1BR0 A;  3E0Z A;  2XQY A;  2V7I A;  3N5L A;  3ERC C;  2JQ9 A;  2H7O A;  4FO6 A;  3RC3 A;  1R8C A;  5B3P A;  3CX8 B;  4NLK A;  5CHG A;  4UVC B;  2NW7 A;  2XUE A;  5C2T A;  3ER8 C;  1ZQG A;  2ZH3 A;  2XZE A;  5H6R B;  4DMW A;  3P4R A;  4BJM A;  2DVI A;  8ICF A;  3UQ2 A;  3HWT A;  1MQ2 A;  4IQV A;  4AIU A;  5HXE A;  4RPY A;  4NXN T;  5DBC A;  2BPF A;  1GPJ A;  5CA0 E;  2XJ7 A;  5AQI B;  4HWI B;  2DWG A;  8ICX A;  4S3N A;  4K4G A;  1OED C;  2BG9 C;  3Q5D A;  4I2C A;  4EB6 E;  3JYY A;  3CML A;  3AU6 A;  2E9X D;  4MFA A;  1KEY A;  2C5I T;  4KLH A;  5CB4 E;  2E5L T;  5DB6 A;  2ISO A;  4EYY R;  3EI0 A;  1NAF A;  2I6H A;  2P66 A;  4DV6 T;  3F57 A;  5F5W A;  3V7L A;  2UUC T;  1HS7 A;  3ISB A;  4HKA A;  4EED A;  3N2O A;  2D0T A;  4K4H A;  3TFR A;  4X20 E;  3WFR E;  3VRA A;  2ZM0 A;  4LF5 T;  4HWF A;  1EZ3 A;  1HG5 A;  3ZJ1 A;  3TKL B;  3ZCJ A;  5J2H A;  3H3A A;  4KX6 A;  4B3S T;  4YLH A;  4X66 T;  4AKH A;  1UGO A;  2ZM8 A;  4DR3 T;  4DUY T;  2FMQ A;  4KLD A;  4K0K T;  4NM2 A;  3AE6 A;  1JMS A;  5TZV A;  7ICL A;  4KBM B;  3LJC A;  4FO1 A;  2LOS A;  4Z90 A;  3GMI A;  4CI1 B;  4WC2 A;  2EHO B;  5AQP B;  4I2F A;  3K3O A;  2RA1 A;  1LRZ A;  4E7Z A;  5HWY A;  4GYS A;  4N7R A;  2FJD A;  5DEC A;  4ILA A;  4CXX A;  4C91 A;  3EDU A;  4X4N A;  4NLN A;  5III A;  3NRY A;  1KNY A;  7ICH A;  3C4W A;  5J1G A;  4AQG A;  4YSZ A;  3MGI A;  3N9P A;  1YQ3 A;  4Z91 A;  2PFO A;  2WY2 A;  3ANW B;  4AQY T;  3RJE A;  2BS2 A;  5BR8 T;  4LVS A;  4I55 E;  3A5X A;  3ANW A;  2MOZ A;  3UPS A;  2W0G A;  2WZH A;  7ICS A;  5ETW A;  3JZ0 A;  2WDV A;  2LRK A;  4CI2 B;  5JDQ A;  5FXW A;  2HN1 A;  5DKW A;  4KLE A;  1D0Z A;  5J2T E;  4WC6 A;  3K8P C;  3ZMV B;  4QX8 B;  1TFY A;  1U4Q A;  4P2H A;  3EHZ A;  1J1J A;  2DR5 A;  1L0V A;  3V5S A;  4KLU A;  3OTO T;  3AE8 A;  5JR9 B;  3QC9 A;  4I50 E;  4JUY A;  3KIN B;  1UX4 A;  4IDP A;  3PML A;  4CXY A;  5JR9 A;  9ICC A;  3PUV F;  3N2G E;  2W63 A;  4OAG A;  2UU9 T;  3JPQ A;  1IBM T;  4KM5 A;  2NOX A;  2CLY B;  4IQT A;  4ZZC A;  4U74 A;  2W61 A;  5LYJ E;  3JPR A;  3AAE B;  7ICT A;  2R6G F;  2M2T A;  5DDY A;  3EDV A;  9ICV A;  4JI3 T;  4E80 A;  2IIU A;  3V5U A;  3T8O A;  4Z6F A;  3C5F A;  4KUM B;  2BKP A;  3C4Z A;  4Q25 A;  2V5C A;  3AE9 A;  5CFS A;  4COF A;  1ZJM A;  5J2I A;  3HKE E;  3AQK A;  1IBL T;  2A9U A;  4GOU A;  5J2C A;  3CX7 B;  4JEH B;  4QZB A;  4DV1 T;  3MJX A;  7ICE A;  4X0B A;  2DI4 A;  4BAY B;  3RHW A;  3B57 A;  2LM9 A;  2YU2 A;  8ICO A;  3HKC E;  4YTM A;  5L3F B;  5HEH A;  1QUU A;  3ESL A;  4QZC A;  1WOT A;  3OUY B;  1JNR A;  2KZ7 B;  2X0L B;  1ZEE A;  3OUY A;  4H9S E;  4RQ4 A;  3OV7 A;  3UU3 A;  4IE6 A;  5IIK A;  3RJI A;  3JAD A;  5LOV E;  1NWM X;  4ASK A;  4CN1 A;  2K48 A;  1V4A A;  3JC6 C;  2VVN A;  4X0A A;  3SS1 A;  4NM1 A;  5H6Q B;  5L3B B;  3AB3 B;  4CN4 A;  5DQW A;  4YFS A;  4X1I E;  2Q9Q B;  8ICM A;  4WYV A;  4MKP A;  4P4M A;  4XBF B;  4F5R A;  3ZYM A;  3E08 A;  2Q9Q A;  2BCV A;  1ZQN A;  3C51 A;  2KMF A;  4RQ2 A;  1ZQM A;  4PK6 A;  4UD4 A;  9ICQ A;  3C64 A;  2MYS A;  2NW9 A;  4U2Z A;  3ZPO A;  4I2G A;  2DWK A;  3JCF A;  3UTK A;  2XQ8 A;  4QZ8 A;  4HN9 A;  1HF8 A;  4YT0 A;  3UXP A;  2B4V A;  1NEN A;  1ZQJ A;  5J2J A;  2DRA A;  5JDN A;  4U7Y A;  2XSA A;  3O9X A;  2MAW A;  4XAX B;  2ZM2 A;  4QZE A;  3RH6 A;  4UF0 B;  2PJQ A;  3L39 A;  5FY7 A;  4F5P A;  4WOY A;  1OWA A;  2XAS B;  4UF0 A;  5ABF B;  3NKZ A;  1JN3 A;  3OVS A;  4O8S A;  5ABF A;  1RZT A;  2FCL A;  4UB4 A;  5EK2 A;  4WZX A;  4YHH T;  2MPK A;  2X51 A;  2FMS A;  1BPE A;  1W9R A;  4EBK A;  5J0Q A;  3O1H A;  4P0A A;  2XQ3 A;  4LZD A;  2DCF A;  5DBB A;  3Q9D A;  1ZQC A;  4UB1 A;  2Y8D A;  4WBO A;  5ABG A;  9ICG A;  4UR9 A;  3RH4 A;  7ICQ A;  3T1H T;  3DJB A;  8ICU A;  5CFU A;  4X4Q A;  4L9I A;  3HX0 A;  3FZM B;  1BR4 A;  2LLY A;  2RP4 A;  3C2K A;  1IAP A;  4IHJ E;  4B6X A;  2DR9 A;  3PUA A;  3JC6 D;  3P50 A;  5HR9 A;  4UV9 B;  2VK9 A;  4OFZ A;  4WC4 A;  1ZQT A;  2BDE A;  4WCW A;  4QZD A;  3UQ0 A;  4M9L A;  5TAO A;  3CQG B;  1TVA A;  4ANJ A;  4M1P A;  2AE9 A;  1ZP0 A;  3RC8 A;  5AQU B;  2IDO B;  5ABH A;  4CN6 A;  2YDS A;  1ZQQ A;  3U3I A;  3ONL C;  3JPS A;  5KX5 E;  3P8C D;  3PU3 A;  4RWP A;  3OVA A;  3AAI A;  5KXJ A;  1KNR A;  2XPK A;  4NXW A;  3ZYL A;  3RYH E;  3BQI A;  5ADX L;  8ICA A;  2UXB T;  3FXD B;  4TNW A;  2I0M A;  4ZS3 A;  5AQG B;  5F2V O;  4RPZ A;  2GA9 D;  3BQK A;  2VAS A;  2PBI A;  4X62 T;  2ZH4 A;  4KLJ A;  5F3J A;  4JI4 T;  1F5A A;  1KK7 A;  4H63 H;  4I2H A;  4LML A;  4IL4 A;  4UBB A;  2IHR 1;  4HFV A;  4WH5 A;  8ICB A;  4WC0 A;  1HNZ T;  4ZOL E;  5LHI B;  8ICE A;  1M7K A;  5CA1 E;  4FI5 A;  4EEB A;  1HFA A;  4AKR B;  5J2D A;  2VL0 A;  2WAU A;  5AQO B;  4CQI A;  2LOP A;  2JQK A;  3RJH A;  2WP9 A;  4O4L E;  4PHP A;  3NKU A;  2K5B B;  1M62 A;  2CCQ A;  4X1K E;  1T72 A;  4JI7 T;  4RQ5 A;  4Z6C A;  2M6B A;  3IEE A;  4B3T T;  4DBR A;  4QWN B;  5FXV A;  1ZQZ A;  1ZQW A;  3F2E A;  3Q2M A;  3QK6 A;  4YTN A;  4JI0 T;  4JI2 T;  5JDG A;  2BBJ A;  2LHN A;  5LMN T;  5DB7 A;  2ZH2 A;  5JDF A;  4YMN A;  4HWC A;  4M04 A;  4NXZ A;  4LF8 T;  1KNZ A;  3VR8 A;  4QZA A;  2UXD T;  2H89 A;  3TLW A;  4O69 A;  5HHI A;  2ZH9 A;  5J0T A;  4GXI A;  2NR4 A;  4DV2 T;  9ICA A;  4DBQ A;  3G06 A;  3RRW A;  3FB2 A;  2YIN A;  2DL1 A;  2NTY A;  1QLB A;  5LGT B;  4K8V A;  3K1S A;  4I2E A;  3B0X A;  1N32 T;  4QXH B;  3QB5 A;  1UET A;  5DDM A;  3J9X 1;  2V26 A;  2O5A A;  4NY8 A;  4KHZ F;  3SFD A;  1HTJ F;  3B5M A;  2PFP A;  5L4H A;  3ZC0 A;  2E9X B;  3JPP A;  3WI3 A;  4G2A A;  2FUP A;  3B13 A;  2E9X A;  5B3Q A;  4DOB A;  4YHJ A;  9ICL A;  3AED A;  2VB6 A;  4DR5 T;  5GON E;  1MIY A;  4HFD A;  5HRD A;  4QH5 A;  1FMW A;  4KLT A;  5HXC A;  1BPZ A;  4I43 B;  9ICO A;  2XQA A;  2CE7 A;  3PUS A;  5LJM A;  4YJ3 E;  5HYA A;  1LVK A;  4E7S A;  2XHE B;  4EGW A;  4AT9 B;  4IE5 A;  1CUN A;  3AEC A;  3UU5 A;  4TV8 E;  4AT9 A;  3RPU A;  2UXC T;  2M2W A;  5HXS A;  4ZI7 E;  2JQH A;  3C4X A;  2PTF A;  9ICH A;  3CQX C;  4TUS A;  4P09 A;  5AQQ B;  3UU4 A;  5LBM A;  2D2S A;  4DUZ T;  5A1L A;  2PG8 A;  3MGH A;  3SWH A;  4IST A;  3N9O A;  1IJ6 A;  3A7M A;  1J5E T;  4P4O A;  3C2M A;  4O9M A;  2IC6 A;  2WM9 A;  5D61 A;  5JRC B;  1IBK T;  4M9G A;  3KV6 A;  2YDQ A;  2KT9 A;  3T1Y T;  1VRB A;  5JRC A;  2OV9 A;  2LE8 A;  2XTL A;  8ICS A;  3PUZ F;  2CWY A;  5HEG A;  2ZMA A;  2UXX B;  1MNE A;  1YKE B;  2W00 A;  4FHW A;  2ZH8 A;  3V72 A;  4JWM A;  5J29 A;  4ATB B;  3GWH A;  4B3M T;  5C3J A;  2SPC A;  3CPZ A;  1FJG T;  2Z6E A;  5IIL A;  4ATB A;  4EOZ B;  2E2A A;  3GDX A;  3AE5 A;  3O1I A;  1N33 T;  1OED B;  2V6Y B;  2BG9 B;  4U33 A;  8ICI A;  4LMK A;  2OA5 A;  1UEV A;  4F6R C;  1OED A;  5HEU A;  2V6Y A;  2BG9 A;  5EOZ A;  1D1A A;  4NKT A;  4KMC A;  4KLG A;  4NXU A;  3MBY A;  4I29 A;  5EZY E;  5J0W A;  2B51 A;  2NRK A;  2NTX A;  4TUQ A;  2HHH T;  3LK3 B;  5FVL A;  4PK5 A;  3ZST A;  5HAX A;  3K75 D;  3CX6 B;  3NVO A;  3GN5 B;  5BOM A;  2IW5 B;  5IUX A;  3GN5 A;  1ZJN A;  3PNC A;  3VRB A;  2VKH A;  5CFT A;  4MLK A;  4I4T E;  1R8I A;  3JAF A;  4RPX A;  4KLF A;  5HXH A;  1BPX A;  3X1D A;  1ZQY A;  7ICN A;  4HTE A;  4LEV A;  5J0S A;  4UB3 A;  4JI1 T;  2LKH A;  4NUU A;  4YXD A;  2GAF D;  1HCI A;  5BMV E;  3ABV A;  1WCR A;  5AQS B;  3SFE A;  3RIA A;  5J0X A;  3LK9 A;  2ZH5 A;  2VKD A;  4TX5 A;  2XQ6 A;  1B7T A;  4OX9 T;  4O4I E;  2RPA A;  2Y48 B;  5HCM A;  4XJE A;  1WYC A;  3RQW A;  3F31 A;  3UUM A;  4AKL A;  1Y01 A;  3C2L A;  5JVD E;  5CR0 A;  2EHO A;  1X79 A;  4LMJ A;  4QZF A;  2ZLY A;  3HR0 A;  2V7M A;  1WR0 A;  4PFP A;  5DJQ C;  4KB6 A;  4F8H A;  3ZSS A;  3MA9 A;  3EAB A;  3UXN A;  4YMM A;  9ICP A;  3FZH B;  4IE4 A;  1N36 T;  5J2A A;  4AQF C;  8ICR A;  4O6A A;  4GIW A;  4KLM A;  1NEK A;  5LGN B;  1ZQB A;  3FBZ A;  4XQ7 A;  8ICH A;  2HPL A;  3HA4 A;  4HFE A;  2VAN A;  4YJ2 E;  4EP7 A;  3AEB A;  1WR6 A;  2CMR A;  1VOM A;  3ZT5 A;  3I0O A;  1XDO A;  4RQ8 A;  2WU2 A;  3C5G A;  4WNK A;  5J0O A;  3WAK A;  3ER9 B;  3ETU A;  3IBP A;  2FMP A;  1FIO A;  1I94 T;  5J0P A;  2WS3 A;  4O2B E;  2AXD S;  4O4H E;  2W67 A;  5D63 A;  1VFG A;  4P4P A;  3RH3 A;  2FJB A;  3SOL A;  4YY3 T;  2BPC A;  3OVB A;  4X65 T;  2JJ9 A;  2IHO A;  4JWN A;  4IIJ E;  2KND A;  4ZI3 C;  4IL9 A;  4A5X A;  7ICU A;  3RIF A;  4R65 A;  4TUP A;  2PFV A;  4WC1 A;  3KV9 A;  3V7K A;  3H39 A;  3UPQ A;  2X9Y A;  2PFQ A;  2VL8 A;  3RIU C;  2WQY A;  5HRL A;  4UB2 A;  2V7J A;  4AKI A;  2ZH6 A;  1FA0 A;  1HX8 A;  3RX6 A;  1YXR A;  3OVU A;  4H9Q C;  5LGU B;  3KV4 A;  4JI6 T;  4BJN A;  2ES0 A;  3AA0 B;  3PJA J;  3IF8 B;  4NIQ A;  4QXC B;  4OYJ A;  2XSB A;  4GYR A;  4X4O A;  1YQ4 A;  3RRC A;  7ICR A;  3FZL B;  5J0U A;  4ZEY A;  1PX5 A;  1W0B A;  4WQK A;  5ABE A;  3KBU A;  4XZC A;  3MZK B;  3I1A A;  4H9P C;  1CHU A;  4AXP A;  3MAC A;  3UU8 A;  1TFW A;  3FZK B;  1NOM A;  3OWG A;  5AQR B;  4QZH A;  2DNX A;  2V7L A;  1MQ3 A;  5CP2 A;  3QUJ A;  2BZB A;  4PW8 A;  3AEA A;  3LFM A;  4PH5 A;  3RJK A;  4IQU A;  2BE3 A;  2JMH A;  4DO9 A;  2UXN B;  4UBC A;  1SA0 E;  4QH1 A;  1T8B A;  4ADZ A;  3JPN A;  4OAF A;  7ICJ A;  1BPD A;  2QVA A;  1MMD A;  2YDR A;  2NP9 A;  3RYF E;  2CXL A;  2CBJ A;  2HN2 A;  3P4W A;  2KIN B;  4N78 D;  4RWQ A;  4UEL A;  4TNV A;  3S4U A;  8ICP A;  5FY0 A;  2M6I A;  2N2N A;  3ZN0 B;  4RT3 A;  9ICT A;  4CI3 B;  4YSX A; 
#chains in the Genus database with same CATH homology
 4I0U A;  4EGW A;  4EED A;  3RKG A;  3JCF A;  2BBJ A;  2IUB A;  5JTG A;  2HN2 A;  2HN1 A;  4EV6 A;  4EEB A;  3CK6 A;  3NVO A;  2BBH A;  3NWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...