3UPSA

Crystal structure of iojap-like protein from zymomonas mobilis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
FDPEMLLKLVTDSLDDDQALEIATIPLAGKSSIADYMVIASGRSSRQVTAMAQKLADRIKAATGYVSKIEGLPAADWVLLDAGDIIIHLFRPEVRSFYNLERMWGFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Iojap-like protein
publication title Crystal structure of iojap-like protein from Zymomonas mobilis
rcsb
source organism Zymomonas mobilis subsp. mobilis
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3upsA00
2DRBA 5IIOA 3C2MA 2BE3A 8ICKA 4QZFA 5BOLA 4I2EA 3RH6A 5DEDA 4IQWA 1XSPA 3UXOA 4ATBB 9ICHA 4DOCA 4XQ7A 2M2TA 3JZ0A 4RPXA 4R64A 9ICFA 4QZ9A 2BCSA 1BPZA 1RZTA 5HC9A 4X0BA 3TFRA 4M9NA 4GXKA 3UQ2A 8ICVA 4WC2A 1Q78A 4KLFA 5HRLA 4UD4A 5BPCA 4E80A 1ZQLA 4PHPA 3AQLA 5IIMA 5DBCA 1ZQKA 3RH4A 4QZHA 2FMPA 2BPCA 4M9HA 5HHHA 3HIYA 1ZQWA 3AU6A 2BCUA 9ICVA 1FA0A 4R65A 3H37A 4KLQA 2ZH2A 4UBBA 4GXIA 8ICEA 3RJGA 4R66A 4RQ4A 5IIIA 3RJEA 3RJIA 7ICSA 3C5GA 4JWMA 3AQNA 4I2HA 4O5CA 8ICMA 2ZH8A 9ICNA 4RQ5A 4NKTA 5DB9A 7ICVA 4PGYA 4R63A 4KLLA 2BCRA 1ZQTA 1BPEA 1ZQYA 1F5AA 7ICTA 4X4UA 5HHIA 3AQKA 4QZBA 3WFQE 4XA5A 4M9JA 4PHAA 2ID1A 4MF2A 2DR5A 3V7JA 2O5AA 4TUPA 4I28A 5J0UA 4LZDA 2M2UA 8ICHA 4F5PA 4M9GA 4QZ8A 4NM2A 8ICWA 4XRHA 2PFNA 4ATBA 4KLHA 4MFCA 4K4HA 4PHEA 8ICYA 4LT6A 7ICIA 4Z6FA 4I2FA 1JMSA 1MIYA 3C66A 3JPNA 4NY8A 9ICQA 5J0YA 5J2HA 1ZJNA 4KLSA 4UB3A 3L9DA 1XSLA 4UB5A 3JPPA 5HRFA 2ZH1A 1ZQNA 3WFRE 1BPBA 3JYYA 4UD5A 8ICGA 9ICGA 5HRIA 4M47A 4I29A 1ZQFA 4MFFA 4WBZA 4WC7A 3V7KA 5HREA 5J29A 2ZHAA 4RWPA 3OVAA 5CJ7A 4UBCA 4UAYA 2DR8A 5HRKA 3UXPA 5J2JA 4AT7B 1V4AA 3JPQA 1R89A 5DDYA 4WC6A 1ZQOA 4RWQA 2DR7A 5J0TA 4QZCA 2FMQA 1MIVA 4PH5A 4O5EA 5D4BA 1ZQEA 1ZQDA 4X4QA 1ZQAA 4LVSA 9ICJA 1ZQSA 1TV9A 1JQRA 3C2LA 1ZQQA 4RT3A 5BOMA 4UB1A 1HUOA 1ZQZA 5IIJA 5J0QA 5J2GA 4QZIA 4F5RA 3AU2A 3ISDA 8ICPA 9ICLA 4UB4A 1VFGA 1NO5A 4EP7A 3NYBA 7ICFA 7ICHA 4RQ3A 3UQ0A 3HW8A 9ICPA 4EBJA 4DOBA 3MDCA 3TFSA 4I2DA 8ICOA 4PHDA 5HRBA 5CP2A 3UXNA 5HRGA 4IG8A 1ZQPA 2ISOA 9ICSA 2ZHBA 5DBBA 3C2KA 4X4RA 4UB2A 2FMSA 4I2BA 9ICTA 5F2VO 4FHXA 9ICXA 4PGQA 1XSNA 4RQ6A 4GXJA 4X5VA 4NKUA 5IILA 3MBYA 5J2DA 4AT8B 2HHPA 4WC0A 4FHVA 3B0YA 4X4PA 4EBKA 4I2CA 2P66A 4KLIA 4AT7A 3OUYB 5CA7A 3H3AA 4XQ8A 4PGXA 1BPXA 1KDHA 1BPDA 9ICRA 8ICTA 3RJFA 3HWTA 4O9MA 1ZQVA 4JWNA 3RH5A 9ICUA 4WC1A 2DRAA 4MFAA 1UETA 4TUQA 2M2VA 8ICJA 4KLTA 7ICUA 3B0XA 2Q66A 4RQ8A 4I2GA 4WCWA 7ICGA 1ZQHA 7ICEA 1KNYA 3JPTA 2PBEA 1JN3A 1R8CA 2ZH3A 1ZQGA 4M2YA 8ICIA 8ICFA 8ICQA 4P4OA 1MQ2A 7ICQA 4RQ2A 3ISBA 3C18A 4YMOA 5IINA 9ICEA 2BCVA 4YMMA 4TURA 1YLQA 4X4NA 1ZQXA 4IQVA 3LQCB 3MGHA 1MQ3A 4KLUA 4QZAA 5CR0A 4M5DA 4AT8A 4K4IA 3MDAA 4NM1A 9ICBA 9ICOA 4WC5A 9ICCA 4QZDA 5J0PA 2PFOA 3WFPA 4I2IA 4X4TA 3OUYA 4YD2A 5DECA 2BPGA 2BCQA 2DR9A 4LZGA 8ICUA 4KLDA 8ICBA 1MIWA 2M2WA 3V7LA 4F5NA 3UPSA 5J2KA 5HRDA 4YMNA 5IIKA 3PNCA 3OVSA 2PFPA 7ICRA 4M9LA 8ICXA 5J2IA 5HR9A 5DBAA 2ZH5A 5J0OA 3OV7A 5J2EA 4NXZA 2ZH4A 9ICMA 4O5KA 4MF8A 3OGUA 3H39A 5DKWA 4FHYA 5J0WA 4X4VA 8ICAA 4E8FA 4RPYA 1ZQBA 4P2HA 8ICRA 5J2FA 1WOTA 2NRKA 4M0AA 4FH3A 4P4MA 3OVBA 1RPLA 1UEUA 3H38A 1KEJA 2DVIA 7ICOA 5J0RA 8ICSA 4RQ1A 3PMNA 3PMLA 5CWRA 1Q79A 4NLKA 4X4OA 4KLMA 4AT9B 4RQ7A 2ZH7A 1BPYA 4QZEA 1ZQIA 4F5OA 4RWNA 8ICZA 1VJ7A 5J2AA 3RJHA 4FO6A 2W9MA 1ZQJA 4M04A 7ICMA 4X4SA 5J0SA 5TZVA 5DB6A 4X0AA 4Z6DA 4UAZA 5CB1A 1TFYA 3JPSA 7ICNA 4YCXA 1UEVA 4I27A 4K4GA 7ICKA 5J0XA 3HJ4A 9ICIA 3RJJA 5CHGA 4FHPA 2O1PA 7ICJA 1OU5A 2BPFA 7ICPA 5D49A 1PX5A 9ICKA 4NLZA 1JAJA 2RFFA 2ISPA 4KLJA 4WBYA 4TUSA 5EOZA 4WC4A 4P4PA 4I2JA 1ZQCA 1ZQUA 4RWOA 4RQ0A 8ICNA 9ICAA 4RPZA 4F5QA 5J2BA 7ICLA 4QZGA 4DOAA 3UPQA 4KLGA 9ICWA 4YN4A 3LK9A 2PXIA 4RT2A 3GDXA 3HJ1A 4KLEA 3ISCA 3C5FA 1R8AA 4FH5A 5J2CA 3MGIA 1TVAA 1HUZA 1ZJMA 3JPOA 3WFOA 5DDMA 4Z6CA 4AT9A 4KLOA 4PPXA 3AQMA 2IHMA 5DB7A 2VANA 3HX0A 5HRHA 3WFSC 2ZH9A 4S3NA 4I2AA 1ZQRA 4FHWA 5DB8A 4Z6EA 3RJKA 4YD1A 4XUSA 2PFQA 3AUOA 2I9GA 1TFWA 3JPRA 4IQTA 4E7XA 5D46A 3K75D 1R8BA 4UAWA 1ZQMA 8ICLA 4IQUA 4DO9A 8ICCA 2ZH6A 2GWSA 4NLNA 3V72A 4WC3A 1NOMA
chains in the Genus database with same CATH superfamily
2DRBA 5IIOA 3C2MA 2BE3A 8ICKA 3JCFA 3NWIA 4QZFA 5BOLA 4I2EA 3RH6A 5DEDA 4IQWA 1XSPA 3UXOA 4JLXA 4ATBB 9ICHA 4DOCA 4XQ7A 2M2TA 3JZ0A 5D62A 4LEWA 4RPXA 3ER9B 4K9AA 4R64A 9ICFA 4QZ9A 2BCSA 1BPZA 1RZTA 5HC9A 4X0BA 3TFRA 4M9NA 4NXVA 4GXKA 3UQ2A 8ICVA 4WC2A 1Q78A 4KLFA 5HRLA 4UD4A 5BPCA 4E80A 4EEBA 1ZQLA 4PHPA 3AQLA 5IIMA 5DBCA 1ZQKA 3RH4A 4QZHA 2FMPA 2BPCA 4M9HA 4HX0A 5HHHA 3HIYA 1ZQWA 3AU6A 2BCUA 5B3PA 4OAFA 9ICVA 1FA0A 4R65A 3H37A 4KLQA 2ZH2A 4LEZA 4UBBA 4GXIA 8ICEA 3RJGA 4EV6A 4R66A 4RQ4A 5IIIA 3RJEA 3RJIA 7ICSA 3C5GA 4JWMA 3AQNA 4I2HA 4O5CA 8ICMA 2ZH8A 9ICNA 4RQ5A 4NKTA 5DB9A 7ICVA 4PGYA 4R63A 4KLLA 4O6AA 2BCRA 1ZQTA 1BPEA 1ZQYA 1F5AA 4JLZA 3ERCC 4NXWA 7ICTA 4X4UA 5HHIA 3AQKA 4QZBA 3WFQE 4XA5A 4M9JA 4PHAA 2ID1A 4MF2A 2DR5A 3V7JA 2O5AA 4TUPA 4I28A 5J0UA 4LZDA 2EWRA 2M2UA 8ICHA 4F5PA 4M9GA 4I0UA 4QZ8A 5B3QA 4NM2A 8ICWA 4XRHA 2PFNA 4ATBA 4K99A 4KLHA 4MFCA 4K4HA 4PHEA 8ICYA 4LT6A 7ICIA 4Z6FA 4I2FA 3CK6A 1JMSA 1MIYA 3C66A 3JPNA 4NY8A 9ICQA 4WQLA 5J0YA 5J2HA 1ZJNA 4KLSA 4UB3A 3L9DA 1XSLA 4UB5A 3JPPA 5HRFA 2ZH1A 5JTGA 1ZQNA 3WFRE 3PHZA 1BPBA 3JYYA 4UD5A 4K8VA 8ICGA 9ICGA 5HRIA 4M47A 4I29A 1ZQFA 2B51A 4MFFA 4WBZA 4WC7A 3V7KA 5HREA 5J29A 2ZHAA 4O68A 4RWPA 3OVAA 5CJ7A 4UBCA 4UAYA 2DR8A 5HRKA 3UXPA 5J2JA 4AT7B 1V4AA 3JPQA 1R89A 5DDYA 4WC6A 1ZQOA 4RWQA 2DR7A 5J0TA 4QZCA 2FMQA 2HN2A 1MIVA 4OAHA 4PH5A 5CFSA 4LEYA 4O5EA 5D4BA 1ZQEA 1ZQDA 4X4QA 1ZQAA 4LVSA 5CFTA 3ER8C 9ICJA 1ZQSA 1TV9A 1JQRA 3C2LA 1ZQQA 4RT3A 5BOMA 4UB1A 1HUOA 1ZQZA 5IIJA 5J0QA 5J2GA 4QZIA 4WH5A 3AU2A 4F5RA 3ISDA 8ICPA 9ICLA 4UB4A 1VFGA 1NO5A 4EP7A 3NYBA 7ICFA 7ICHA 4RQ3A 3UQ0A 3HW8A 9ICPA 5D61A 4EBJA 4DOBA 3MDCA 3TFSA 4I2DA 8ICOA 4PHDA 5HRBA 5CP2A 3UXNA 5HRGA 4IG8A 1ZQPA 2ISOA 9ICSA 2ZHBA 5DBBA 3C2KA 4X4RA 4UB2A 2FMSA 4I2BA 9ICTA 5F2VO 4FHXA 9ICXA 4PGQA 1XSNA 4RQ6A 4GXJA 4X5VA 4NKUA 5IILA 3MBYA 5J2DA 2B4VA 4AT8B 2HHPA 4WC0A 4FHVA 3B0YA 4OAIZ 4X4PA 4EBKA 4I2CA 4WQKA 2P66A 4KLIA 4AT7A 3OUYB 5CA7A 3H3AA 4XQ8A 4PGXA 1BPXA 1KDHA 1BPDA 9ICRA 8ICTA 4OAGA 3RJFA 3HWTA 5CFUA 4O9MA 1ZQVA 3NVOA 3RH5A 4JWNA 9ICUA 4WC1A 2DRAA 4MFAA 1UETA 4TUQA 2M2VA 8ICJA 4KLTA 7ICUA 3B0XA 2Q66A 4RQ8A 4I2GA 4WCWA 7ICGA 1ZQHA 4O67A 7ICEA 1KNYA 3JPTA 2PBEA 4EGWA 1JN3A 1R8CA 2ZH3A 1ZQGA 4M2YA 8ICIA 8ICFA 8ICQA 2GAFD 4P4OA 1MQ2A 2FCLA 7ICQA 4RQ2A 3ISBA 3C18A 4YMOA 5IINA 9ICEA 2BCVA 4YMMA 4TURA 1YLQA 4X4NA 1ZQXA 4IQVA 3LQCB 3MGHA 1MQ3A 4KLUA 4QZAA 5CR0A 4M5DA 4AT8A 4K4IA 3MDAA 4NM1A 9ICBA 9ICOA 4WC5A 9ICCA 4QZDA 4K96A 5J0PA 2PFOA 3WFPA 4MKPA 4I2IA 2BBJA 4X4TA 3OUYA 4YD2A 5DECA 2BPGA 2BCQA 2DR9A 4LZGA 8ICUA 4KLDA 4N7RA 8ICBA 1MIWA 2M2WA 2GA9D 2HN1A 3V7LA 4F5NA 3UPSA 5J2KA 5HRDA 4YMNA 5IIKA 3PNCA 3OVSA 4NXUA 2PFPA 4FO1A 7ICRA 4M9LA 2BBHA 8ICXA 5J2IA 5HR9A 5DBAA 3NKUA 2ZH5A 5J0OA 3OV7A 5J2EA 4NXZA 2ZH4A 9ICMA 4O5KA 4MF8A 3OGUA 3H39A 5DKWA 2IUBA 4FHYA 4LEVA 5J0WA 4X4VA 8ICAA 4E8FA 4RPYA 1ZQBA 4P2HA 8ICRA 5J2FA 1WOTA 2NRKA 5D63A 4FH3A 4M0AA 4P4MA 3OVBA 1RPLA 1UEUA 3H38A 1KEJA 2DVIA 7ICOA 4EEDA 5J0RA 8ICSA 4RQ1A 3PMNA 5CHEA 3PMLA 5CWRA 1Q79A 4NLKA 4X4OA 4KLMA 4AT9B 4RQ7A 2ZH7A 1BPYA 4QZEA 1ZQIA 4F5OA 4NXXA 4RWNA 8ICZA 1VJ7A 3EF2A 5J2AA 3RJHA 4FO6A 2W9MA 1ZQJA 4M04A 7ICMA 4X4SA 5J0SA 5TZVA 5DB6A 4X0AA 4Z6DA 4UAZA 5CB1A 1TFYA 3JPSA 7ICNA 4YCXA 1UEVA 4I27A 4K4GA 7ICKA 5J0XA 3HJ4A 9ICIA 3RJJA 5CHGA 4FHPA 2O1PA 7ICJA 1OU5A 2BPFA 7ICPA 5D49A 1PX5A 9ICKA 4NLZA 1JAJA 2RFFA 2ISPA 4KLJA 4WBYA 4TUSA 5EOZA 4KM5A 4WC4A 4P4PA 4I2JA 1ZQCA 1ZQUA 4RWOA 4RQ0A 8ICNA 9ICAA 4RPZA 4F5QA 5J2BA 4K9BA 7ICLA 4QZGA 4DOAA 3UPQA 4K98A 4KLGA 9ICWA 4YN4A 3LK9A 2B56A 2PXIA 4RT2A 3GDXA 3HJ1A 4KLEA 3ISCA 3C5FA 1R8AA 4FH5A 5J2CA 3MGIA 4K97A 4NXTA 1TVAA 1HUZA 1ZJMA 3JPOA 2IHOA 3WFOA 5DDMA 4Z6CA 4AT9A 4KB6A 4KLOA 4XJEA 3AQMA 4PPXA 2IHMA 5DB7A 2VANA 3HX0A 5HRHA 3WFSC 2ZH9A 3OWGA 4S3NA 4I2AA 1ZQRA 4FHWA 5DB8A 4Z6EA 3RJKA 4YD1A 4XUSA 2PFQA 4WOYA 3AUOA 4O69A 2I9GA 1TFWA 3JPRA 4IQTA 4E7XA 5D46A 3K75D 1R8BA 4UAWA 1ZQMA 8ICLA 4IQUA 4DO9A 8ICCA 1GPJA 2ZH6A 3MCRA 2GWSA 3K7DA 4NLNA 3V72A 4WC3A 1NOMA
chains in the Genus database with same CATH topology
2DRBA 5IIOA 3C2MA 2BE3A 8ICKA 4QZFA 5BOLA 4I2EA 3RH6A 5DEDA 4IQWA 1XSPA 3UXOA 4ATBB 9ICHA 4DOCA 4XQ7A 2M2TA 3JZ0A 4RPXA 4R64A 9ICFA 4QZ9A 2BCSA 1BPZA 1RZTA 5HC9A 4X0BA 3TFRA 4M9NA 4GXKA 3UQ2A 8ICVA 4WC2A 1Q78A 4KLFA 5HRLA 4UD4A 5BPCA 4E80A 1ZQLA 4PHPA 3AQLA 5IIMA 5DBCA 1ZQKA 3RH4A 4QZHA 2FMPA 2BPCA 4M9HA 5HHHA 3HIYA 1ZQWA 3AU6A 2BCUA 9ICVA 1FA0A 4R65A 3H37A 4KLQA 2ZH2A 4UBBA 4GXIA 8ICEA 3RJGA 4R66A 4RQ4A 5IIIA 3RJEA 3RJIA 7ICSA 3C5GA 4JWMA 3AQNA 4I2HA 4O5CA 8ICMA 2ZH8A 9ICNA 4RQ5A 4NKTA 5DB9A 7ICVA 4PGYA 4R63A 4KLLA 2BCRA 1ZQTA 1BPEA 1ZQYA 1F5AA 7ICTA 4X4UA 5HHIA 3AQKA 4QZBA 3WFQE 4XA5A 4M9JA 4PHAA 2ID1A 4MF2A 2DR5A 3V7JA 2O5AA 4TUPA 4I28A 5J0UA 4LZDA 2M2UA 8ICHA 4F5PA 4M9GA 4QZ8A 4NM2A 8ICWA 4XRHA 2PFNA 4ATBA 4KLHA 4MFCA 4K4HA 4PHEA 8ICYA 4LT6A 7ICIA 4Z6FA 4I2FA 1JMSA 1MIYA 3C66A 3JPNA 4NY8A 9ICQA 5J0YA 5J2HA 1ZJNA 4KLSA 4UB3A 3L9DA 1XSLA 4UB5A 3JPPA 5HRFA 2ZH1A 1ZQNA 3WFRE 1BPBA 3JYYA 4UD5A 8ICGA 9ICGA 5HRIA 4M47A 4I29A 1ZQFA 4MFFA 4WBZA 4WC7A 3V7KA 5HREA 5J29A 2ZHAA 4RWPA 3OVAA 5CJ7A 4UBCA 4UAYA 2DR8A 5HRKA 3UXPA 5J2JA 4AT7B 1V4AA 3JPQA 1R89A 5DDYA 4WC6A 1ZQOA 4RWQA 2DR7A 5J0TA 4QZCA 2FMQA 1MIVA 4PH5A 4O5EA 5D4BA 1ZQEA 1ZQDA 4X4QA 1ZQAA 4LVSA 9ICJA 1ZQSA 1TV9A 1JQRA 3C2LA 1ZQQA 4RT3A 5BOMA 4UB1A 1HUOA 1ZQZA 5IIJA 5J0QA 5J2GA 4QZIA 4F5RA 3AU2A 3ISDA 8ICPA 9ICLA 4UB4A 1VFGA 1NO5A 4EP7A 3NYBA 7ICFA 7ICHA 4RQ3A 3UQ0A 3HW8A 9ICPA 4EBJA 4DOBA 3MDCA 3TFSA 4I2DA 8ICOA 4PHDA 5HRBA 5CP2A 3UXNA 5HRGA 4IG8A 1ZQPA 2ISOA 9ICSA 2ZHBA 5DBBA 3C2KA 4X4RA 4UB2A 2FMSA 4I2BA 9ICTA 5F2VO 4FHXA 9ICXA 4PGQA 1XSNA 4RQ6A 4GXJA 4X5VA 4NKUA 5IILA 3MBYA 5J2DA 4AT8B 2HHPA 4WC0A 4FHVA 3B0YA 4X4PA 4EBKA 4I2CA 2P66A 4KLIA 4AT7A 3OUYB 5CA7A 3H3AA 4XQ8A 4PGXA 1BPXA 1KDHA 1BPDA 9ICRA 8ICTA 3RJFA 3HWTA 4O9MA 1ZQVA 4JWNA 3RH5A 9ICUA 4WC1A 2DRAA 4MFAA 1UETA 4TUQA 2M2VA 8ICJA 4KLTA 7ICUA 3B0XA 2Q66A 4RQ8A 4I2GA 4WCWA 7ICGA 1ZQHA 7ICEA 1KNYA 3JPTA 2PBEA 1JN3A 1R8CA 2ZH3A 1ZQGA 4M2YA 8ICIA 8ICFA 8ICQA 4P4OA 1MQ2A 7ICQA 4RQ2A 3ISBA 3C18A 4YMOA 5IINA 9ICEA 2BCVA 4YMMA 4TURA 1YLQA 4X4NA 1ZQXA 4IQVA 3LQCB 3MGHA 1MQ3A 4KLUA 4QZAA 5CR0A 4M5DA 4AT8A 4K4IA 3MDAA 4NM1A 9ICBA 9ICOA 4WC5A 9ICCA 4QZDA 5J0PA 2PFOA 3WFPA 4I2IA 4X4TA 3OUYA 4YD2A 5DECA 2BPGA 2BCQA 2DR9A 4LZGA 8ICUA 4KLDA 8ICBA 1MIWA 2M2WA 3V7LA 4F5NA 3UPSA 5J2KA 5HRDA 4YMNA 5IIKA 3PNCA 3OVSA 2PFPA 7ICRA 4M9LA 8ICXA 5J2IA 5HR9A 5DBAA 2ZH5A 5J0OA 3OV7A 5J2EA 4NXZA 2ZH4A 9ICMA 4O5KA 4MF8A 3OGUA 3H39A 5DKWA 4FHYA 5J0WA 4X4VA 8ICAA 4E8FA 4RPYA 1ZQBA 4P2HA 8ICRA 5J2FA 1WOTA 2NRKA 4M0AA 4FH3A 4P4MA 3OVBA 1RPLA 1UEUA 3H38A 1KEJA 2DVIA 7ICOA 5J0RA 8ICSA 4RQ1A 3PMNA 3PMLA 5CWRA 1Q79A 4NLKA 4X4OA 4KLMA 4AT9B 4RQ7A 2ZH7A 1BPYA 4QZEA 1ZQIA 4F5OA 4RWNA 8ICZA 1VJ7A 5J2AA 3RJHA 4FO6A 2W9MA 1ZQJA 4M04A 7ICMA 4X4SA 5J0SA 5TZVA 5DB6A 4X0AA 4Z6DA 4UAZA 5CB1A 1TFYA 3JPSA 7ICNA 4YCXA 1UEVA 4I27A 4K4GA 7ICKA 5J0XA 3HJ4A 9ICIA 3RJJA 5CHGA 4FHPA 2O1PA 7ICJA 1OU5A 2BPFA 7ICPA 5D49A 1PX5A 9ICKA 4NLZA 1JAJA 2RFFA 2ISPA 4KLJA 4WBYA 4TUSA 5EOZA 4WC4A 4P4PA 4I2JA 1ZQCA 1ZQUA 4RWOA 4RQ0A 8ICNA 9ICAA 4RPZA 4F5QA 5J2BA 7ICLA 4QZGA 4DOAA 3UPQA 4KLGA 9ICWA 4YN4A 3LK9A 2PXIA 4RT2A 3GDXA 3HJ1A 4KLEA 3ISCA 3C5FA 1R8AA 4FH5A 5J2CA 3MGIA 1TVAA 1HUZA 1ZJMA 3JPOA 3WFOA 5DDMA 4Z6CA 4AT9A 4KLOA 4PPXA 3AQMA 2IHMA 5DB7A 2VANA 3HX0A 5HRHA 3WFSC 2ZH9A 4S3NA 4I2AA 1ZQRA 4FHWA 5DB8A 4Z6EA 3RJKA 4YD1A 4XUSA 2PFQA 3AUOA 2I9GA 1TFWA 3JPRA 4IQTA 4E7XA 5D46A 3K75D 1R8BA 4UAWA 1ZQMA 8ICLA 4IQUA 4DO9A 8ICCA 2ZH6A 2GWSA 4NLNA 3V72A 4WC3A 1NOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRB A;  5IIO A;  3C2M A;  2BE3 A;  8ICK A;  4QZF A;  5BOL A;  4I2E A;  3RH6 A;  5DED A;  4IQW A;  1XSP A;  3UXO A;  4ATB B;  9ICH A;  4DOC A;  4XQ7 A;  2M2T A;  3JZ0 A;  4RPX A;  4R64 A;  9ICF A;  4QZ9 A;  2BCS A;  1BPZ A;  1RZT A;  5HC9 A;  4X0B A;  3TFR A;  4M9N A;  4GXK A;  3UQ2 A;  8ICV A;  4WC2 A;  1Q78 A;  4KLF A;  5HRL A;  4UD4 A;  5BPC A;  4E80 A;  1ZQL A;  4PHP A;  3AQL A;  5IIM A;  5DBC A;  1ZQK A;  3RH4 A;  4QZH A;  2FMP A;  2BPC A;  4M9H A;  5HHH A;  3HIY A;  1ZQW A;  3AU6 A;  2BCU A;  9ICV A;  1FA0 A;  4R65 A;  3H37 A;  4KLQ A;  2ZH2 A;  4UBB A;  4GXI A;  8ICE A;  3RJG A;  4R66 A;  4RQ4 A;  5III A;  3RJE A;  3RJI A;  7ICS A;  3C5G A;  4JWM A;  3AQN A;  4I2H A;  4O5C A;  8ICM A;  2ZH8 A;  9ICN A;  4RQ5 A;  4NKT A;  5DB9 A;  7ICV A;  4PGY A;  4R63 A;  4KLL A;  2BCR A;  1ZQT A;  1BPE A;  1ZQY A;  1F5A A;  7ICT A;  4X4U A;  5HHI A;  3AQK A;  4QZB A;  3WFQ E;  4XA5 A;  4M9J A;  4PHA A;  2ID1 A;  4MF2 A;  2DR5 A;  3V7J A;  2O5A A;  4TUP A;  4I28 A;  5J0U A;  4LZD A;  2M2U A;  8ICH A;  4F5P A;  4M9G A;  4QZ8 A;  4NM2 A;  8ICW A;  4XRH A;  2PFN A;  4ATB A;  4KLH A;  4MFC A;  4K4H A;  4PHE A;  8ICY A;  4LT6 A;  7ICI A;  4Z6F A;  4I2F A;  1JMS A;  1MIY A;  3C66 A;  3JPN A;  4NY8 A;  9ICQ A;  5J0Y A;  5J2H A;  1ZJN A;  4KLS A;  4UB3 A;  3L9D A;  1XSL A;  4UB5 A;  3JPP A;  5HRF A;  2ZH1 A;  1ZQN A;  3WFR E;  1BPB A;  3JYY A;  4UD5 A;  8ICG A;  9ICG A;  5HRI A;  4M47 A;  4I29 A;  1ZQF A;  4MFF A;  4WBZ A;  4WC7 A;  3V7K A;  5HRE A;  5J29 A;  2ZHA A;  4RWP A;  3OVA A;  5CJ7 A;  4UBC A;  4UAY A;  2DR8 A;  5HRK A;  3UXP A;  5J2J A;  4AT7 B;  1V4A A;  3JPQ A;  1R89 A;  5DDY A;  4WC6 A;  1ZQO A;  4RWQ A;  2DR7 A;  5J0T A;  4QZC A;  2FMQ A;  1MIV A;  4PH5 A;  4O5E A;  5D4B A;  1ZQE A;  1ZQD A;  4X4Q A;  1ZQA A;  4LVS A;  9ICJ A;  1ZQS A;  1TV9 A;  1JQR A;  3C2L A;  1ZQQ A;  4RT3 A;  5BOM A;  4UB1 A;  1HUO A;  1ZQZ A;  5IIJ A;  5J0Q A;  5J2G A;  4QZI A;  4F5R A;  3AU2 A;  3ISD A;  8ICP A;  9ICL A;  4UB4 A;  1VFG A;  1NO5 A;  4EP7 A;  3NYB A;  7ICF A;  7ICH A;  4RQ3 A;  3UQ0 A;  3HW8 A;  9ICP A;  4EBJ A;  4DOB A;  3MDC A;  3TFS A;  4I2D A;  8ICO A;  4PHD A;  5HRB A;  5CP2 A;  3UXN A;  5HRG A;  4IG8 A;  1ZQP A;  2ISO A;  9ICS A;  2ZHB A;  5DBB A;  3C2K A;  4X4R A;  4UB2 A;  2FMS A;  4I2B A;  9ICT A;  5F2V O;  4FHX A;  9ICX A;  4PGQ A;  1XSN A;  4RQ6 A;  4GXJ A;  4X5V A;  4NKU A;  5IIL A;  3MBY A;  5J2D A;  4AT8 B;  2HHP A;  4WC0 A;  4FHV A;  3B0Y A;  4X4P A;  4EBK A;  4I2C A;  2P66 A;  4KLI A;  4AT7 A;  3OUY B;  5CA7 A;  3H3A A;  4XQ8 A;  4PGX A;  1BPX A;  1KDH A;  1BPD A;  9ICR A;  8ICT A;  3RJF A;  3HWT A;  4O9M A;  1ZQV A;  4JWN A;  3RH5 A;  9ICU A;  4WC1 A;  2DRA A;  4MFA A;  1UET A;  4TUQ A;  2M2V A;  8ICJ A;  4KLT A;  7ICU A;  3B0X A;  2Q66 A;  4RQ8 A;  4I2G A;  4WCW A;  7ICG A;  1ZQH A;  7ICE A;  1KNY A;  3JPT A;  2PBE A;  1JN3 A;  1R8C A;  2ZH3 A;  1ZQG A;  4M2Y A;  8ICI A;  8ICF A;  8ICQ A;  4P4O A;  1MQ2 A;  7ICQ A;  4RQ2 A;  3ISB A;  3C18 A;  4YMO A;  5IIN A;  9ICE A;  2BCV A;  4YMM A;  4TUR A;  1YLQ A;  4X4N A;  1ZQX A;  4IQV A;  3LQC B;  3MGH A;  1MQ3 A;  4KLU A;  4QZA A;  5CR0 A;  4M5D A;  4AT8 A;  4K4I A;  3MDA A;  4NM1 A;  9ICB A;  9ICO A;  4WC5 A;  9ICC A;  4QZD A;  5J0P A;  2PFO A;  3WFP A;  4I2I A;  4X4T A;  3OUY A;  4YD2 A;  5DEC A;  2BPG A;  2BCQ A;  2DR9 A;  4LZG A;  8ICU A;  4KLD A;  8ICB A;  1MIW A;  2M2W A;  3V7L A;  4F5N A;  3UPS A;  5J2K A;  5HRD A;  4YMN A;  5IIK A;  3PNC A;  3OVS A;  2PFP A;  7ICR A;  4M9L A;  8ICX A;  5J2I A;  5HR9 A;  5DBA A;  2ZH5 A;  5J0O A;  3OV7 A;  5J2E A;  4NXZ A;  2ZH4 A;  9ICM A;  4O5K A;  4MF8 A;  3OGU A;  3H39 A;  5DKW A;  4FHY A;  5J0W A;  4X4V A;  8ICA A;  4E8F A;  4RPY A;  1ZQB A;  4P2H A;  8ICR A;  5J2F A;  1WOT A;  2NRK A;  4M0A A;  4FH3 A;  4P4M A;  3OVB A;  1RPL A;  1UEU A;  3H38 A;  1KEJ A;  2DVI A;  7ICO A;  5J0R A;  8ICS A;  4RQ1 A;  3PMN A;  3PML A;  5CWR A;  1Q79 A;  4NLK A;  4X4O A;  4KLM A;  4AT9 B;  4RQ7 A;  2ZH7 A;  1BPY A;  4QZE A;  1ZQI A;  4F5O A;  4RWN A;  8ICZ A;  1VJ7 A;  5J2A A;  3RJH A;  4FO6 A;  2W9M A;  1ZQJ A;  4M04 A;  7ICM A;  4X4S A;  5J0S A;  5TZV A;  5DB6 A;  4X0A A;  4Z6D A;  4UAZ A;  5CB1 A;  1TFY A;  3JPS A;  7ICN A;  4YCX A;  1UEV A;  4I27 A;  4K4G A;  7ICK A;  5J0X A;  3HJ4 A;  9ICI A;  3RJJ A;  5CHG A;  4FHP A;  2O1P A;  7ICJ A;  1OU5 A;  2BPF A;  7ICP A;  5D49 A;  1PX5 A;  9ICK A;  4NLZ A;  1JAJ A;  2RFF A;  2ISP A;  4KLJ A;  4WBY A;  4TUS A;  5EOZ A;  4WC4 A;  4P4P A;  4I2J A;  1ZQC A;  1ZQU A;  4RWO A;  4RQ0 A;  8ICN A;  9ICA A;  4RPZ A;  4F5Q A;  5J2B A;  7ICL A;  4QZG A;  4DOA A;  3UPQ A;  4KLG A;  9ICW A;  4YN4 A;  3LK9 A;  2PXI A;  4RT2 A;  3GDX A;  3HJ1 A;  4KLE A;  3ISC A;  3C5F A;  1R8A A;  4FH5 A;  5J2C A;  3MGI A;  1TVA A;  1HUZ A;  1ZJM A;  3JPO A;  3WFO A;  5DDM A;  4Z6C A;  4AT9 A;  4KLO A;  4PPX A;  3AQM A;  2IHM A;  5DB7 A;  2VAN A;  3HX0 A;  5HRH A;  3WFS C;  2ZH9 A;  4S3N A;  4I2A A;  1ZQR A;  4FHW A;  5DB8 A;  4Z6E A;  3RJK A;  4YD1 A;  4XUS A;  2PFQ A;  3AUO A;  2I9G A;  1TFW A;  3JPR A;  4IQT A;  4E7X A;  5D46 A;  3K75 D;  1R8B A;  4UAW A;  1ZQM A;  8ICL A;  4IQU A;  4DO9 A;  8ICC A;  2ZH6 A;  2GWS A;  4NLN A;  3V72 A;  4WC3 A;  1NOM A; 
#chains in the Genus database with same CATH topology
 2DRB A;  5IIO A;  3C2M A;  2BE3 A;  8ICK A;  3JCF A;  3NWI A;  4QZF A;  5BOL A;  4I2E A;  3RH6 A;  5DED A;  4IQW A;  1XSP A;  3UXO A;  4JLX A;  4ATB B;  9ICH A;  4DOC A;  4XQ7 A;  2M2T A;  3JZ0 A;  5D62 A;  4LEW A;  4RPX A;  3ER9 B;  4K9A A;  4R64 A;  9ICF A;  4QZ9 A;  2BCS A;  1BPZ A;  1RZT A;  5HC9 A;  4X0B A;  3TFR A;  4M9N A;  4NXV A;  4GXK A;  3UQ2 A;  8ICV A;  4WC2 A;  1Q78 A;  4KLF A;  5HRL A;  4UD4 A;  5BPC A;  4E80 A;  4EEB A;  1ZQL A;  4PHP A;  3AQL A;  5IIM A;  5DBC A;  1ZQK A;  3RH4 A;  4QZH A;  2FMP A;  2BPC A;  4M9H A;  4HX0 A;  5HHH A;  3HIY A;  1ZQW A;  3AU6 A;  2BCU A;  5B3P A;  4OAF A;  9ICV A;  1FA0 A;  4R65 A;  3H37 A;  4KLQ A;  2ZH2 A;  4LEZ A;  4UBB A;  4GXI A;  8ICE A;  3RJG A;  4EV6 A;  4R66 A;  4RQ4 A;  5III A;  3RJE A;  3RJI A;  7ICS A;  3C5G A;  4JWM A;  3AQN A;  4I2H A;  4O5C A;  8ICM A;  2ZH8 A;  9ICN A;  4RQ5 A;  4NKT A;  5DB9 A;  7ICV A;  4PGY A;  4R63 A;  4KLL A;  4O6A A;  2BCR A;  1ZQT A;  1BPE A;  1ZQY A;  1F5A A;  4JLZ A;  3ERC C;  4NXW A;  7ICT A;  4X4U A;  5HHI A;  3AQK A;  4QZB A;  3WFQ E;  4XA5 A;  4M9J A;  4PHA A;  2ID1 A;  4MF2 A;  2DR5 A;  3V7J A;  2O5A A;  4TUP A;  4I28 A;  5J0U A;  4LZD A;  2EWR A;  2M2U A;  8ICH A;  4F5P A;  4M9G A;  4I0U A;  4QZ8 A;  5B3Q A;  4NM2 A;  8ICW A;  4XRH A;  2PFN A;  4ATB A;  4K99 A;  4KLH A;  4MFC A;  4K4H A;  4PHE A;  8ICY A;  4LT6 A;  7ICI A;  4Z6F A;  4I2F A;  3CK6 A;  1JMS A;  1MIY A;  3C66 A;  3JPN A;  4NY8 A;  9ICQ A;  4WQL A;  5J0Y A;  5J2H A;  1ZJN A;  4KLS A;  4UB3 A;  3L9D A;  1XSL A;  4UB5 A;  3JPP A;  5HRF A;  2ZH1 A;  5JTG A;  1ZQN A;  3WFR E;  3PHZ A;  1BPB A;  3JYY A;  4UD5 A;  4K8V A;  8ICG A;  9ICG A;  5HRI A;  4M47 A;  4I29 A;  1ZQF A;  2B51 A;  4MFF A;  4WBZ A;  4WC7 A;  3V7K A;  5HRE A;  5J29 A;  2ZHA A;  4O68 A;  4RWP A;  3OVA A;  5CJ7 A;  4UBC A;  4UAY A;  2DR8 A;  5HRK A;  3UXP A;  5J2J A;  4AT7 B;  1V4A A;  3JPQ A;  1R89 A;  5DDY A;  4WC6 A;  1ZQO A;  4RWQ A;  2DR7 A;  5J0T A;  4QZC A;  2FMQ A;  2HN2 A;  1MIV A;  4OAH A;  4PH5 A;  5CFS A;  4LEY A;  4O5E A;  5D4B A;  1ZQE A;  1ZQD A;  4X4Q A;  1ZQA A;  4LVS A;  5CFT A;  3ER8 C;  9ICJ A;  1ZQS A;  1TV9 A;  1JQR A;  3C2L A;  1ZQQ A;  4RT3 A;  5BOM A;  4UB1 A;  1HUO A;  1ZQZ A;  5IIJ A;  5J0Q A;  5J2G A;  4QZI A;  4WH5 A;  3AU2 A;  4F5R A;  3ISD A;  8ICP A;  9ICL A;  4UB4 A;  1VFG A;  1NO5 A;  4EP7 A;  3NYB A;  7ICF A;  7ICH A;  4RQ3 A;  3UQ0 A;  3HW8 A;  9ICP A;  5D61 A;  4EBJ A;  4DOB A;  3MDC A;  3TFS A;  4I2D A;  8ICO A;  4PHD A;  5HRB A;  5CP2 A;  3UXN A;  5HRG A;  4IG8 A;  1ZQP A;  2ISO A;  9ICS A;  2ZHB A;  5DBB A;  3C2K A;  4X4R A;  4UB2 A;  2FMS A;  4I2B A;  9ICT A;  5F2V O;  4FHX A;  9ICX A;  4PGQ A;  1XSN A;  4RQ6 A;  4GXJ A;  4X5V A;  4NKU A;  5IIL A;  3MBY A;  5J2D A;  2B4V A;  4AT8 B;  2HHP A;  4WC0 A;  4FHV A;  3B0Y A;  4OAI Z;  4X4P A;  4EBK A;  4I2C A;  4WQK A;  2P66 A;  4KLI A;  4AT7 A;  3OUY B;  5CA7 A;  3H3A A;  4XQ8 A;  4PGX A;  1BPX A;  1KDH A;  1BPD A;  9ICR A;  8ICT A;  4OAG A;  3RJF A;  3HWT A;  5CFU A;  4O9M A;  1ZQV A;  3NVO A;  3RH5 A;  4JWN A;  9ICU A;  4WC1 A;  2DRA A;  4MFA A;  1UET A;  4TUQ A;  2M2V A;  8ICJ A;  4KLT A;  7ICU A;  3B0X A;  2Q66 A;  4RQ8 A;  4I2G A;  4WCW A;  7ICG A;  1ZQH A;  4O67 A;  7ICE A;  1KNY A;  3JPT A;  2PBE A;  4EGW A;  1JN3 A;  1R8C A;  2ZH3 A;  1ZQG A;  4M2Y A;  8ICI A;  8ICF A;  8ICQ A;  2GAF D;  4P4O A;  1MQ2 A;  2FCL A;  7ICQ A;  4RQ2 A;  3ISB A;  3C18 A;  4YMO A;  5IIN A;  9ICE A;  2BCV A;  4YMM A;  4TUR A;  1YLQ A;  4X4N A;  1ZQX A;  4IQV A;  3LQC B;  3MGH A;  1MQ3 A;  4KLU A;  4QZA A;  5CR0 A;  4M5D A;  4AT8 A;  4K4I A;  3MDA A;  4NM1 A;  9ICB A;  9ICO A;  4WC5 A;  9ICC A;  4QZD A;  4K96 A;  5J0P A;  2PFO A;  3WFP A;  4MKP A;  4I2I A;  2BBJ A;  4X4T A;  3OUY A;  4YD2 A;  5DEC A;  2BPG A;  2BCQ A;  2DR9 A;  4LZG A;  8ICU A;  4KLD A;  4N7R A;  8ICB A;  1MIW A;  2M2W A;  2GA9 D;  2HN1 A;  3V7L A;  4F5N A;  3UPS A;  5J2K A;  5HRD A;  4YMN A;  5IIK A;  3PNC A;  3OVS A;  4NXU A;  2PFP A;  4FO1 A;  7ICR A;  4M9L A;  2BBH A;  8ICX A;  5J2I A;  5HR9 A;  5DBA A;  3NKU A;  2ZH5 A;  5J0O A;  3OV7 A;  5J2E A;  4NXZ A;  2ZH4 A;  9ICM A;  4O5K A;  4MF8 A;  3OGU A;  3H39 A;  5DKW A;  2IUB A;  4FHY A;  4LEV A;  5J0W A;  4X4V A;  8ICA A;  4E8F A;  4RPY A;  1ZQB A;  4P2H A;  8ICR A;  5J2F A;  1WOT A;  2NRK A;  5D63 A;  4FH3 A;  4M0A A;  4P4M A;  3OVB A;  1RPL A;  1UEU A;  3H38 A;  1KEJ A;  2DVI A;  7ICO A;  4EED A;  5J0R A;  8ICS A;  4RQ1 A;  3PMN A;  5CHE A;  3PML A;  5CWR A;  1Q79 A;  4NLK A;  4X4O A;  4KLM A;  4AT9 B;  4RQ7 A;  2ZH7 A;  1BPY A;  4QZE A;  1ZQI A;  4F5O A;  4NXX A;  4RWN A;  8ICZ A;  1VJ7 A;  3EF2 A;  5J2A A;  3RJH A;  4FO6 A;  2W9M A;  1ZQJ A;  4M04 A;  7ICM A;  4X4S A;  5J0S A;  5TZV A;  5DB6 A;  4X0A A;  4Z6D A;  4UAZ A;  5CB1 A;  1TFY A;  3JPS A;  7ICN A;  4YCX A;  1UEV A;  4I27 A;  4K4G A;  7ICK A;  5J0X A;  3HJ4 A;  9ICI A;  3RJJ A;  5CHG A;  4FHP A;  2O1P A;  7ICJ A;  1OU5 A;  2BPF A;  7ICP A;  5D49 A;  1PX5 A;  9ICK A;  4NLZ A;  1JAJ A;  2RFF A;  2ISP A;  4KLJ A;  4WBY A;  4TUS A;  5EOZ A;  4KM5 A;  4WC4 A;  4P4P A;  4I2J A;  1ZQC A;  1ZQU A;  4RWO A;  4RQ0 A;  8ICN A;  9ICA A;  4RPZ A;  4F5Q A;  5J2B A;  4K9B A;  7ICL A;  4QZG A;  4DOA A;  3UPQ A;  4K98 A;  4KLG A;  9ICW A;  4YN4 A;  3LK9 A;  2B56 A;  2PXI A;  4RT2 A;  3GDX A;  3HJ1 A;  4KLE A;  3ISC A;  3C5F A;  1R8A A;  4FH5 A;  5J2C A;  3MGI A;  4K97 A;  4NXT A;  1TVA A;  1HUZ A;  1ZJM A;  3JPO A;  2IHO A;  3WFO A;  5DDM A;  4Z6C A;  4AT9 A;  4KB6 A;  4KLO A;  4XJE A;  3AQM A;  4PPX A;  2IHM A;  5DB7 A;  2VAN A;  3HX0 A;  5HRH A;  3WFS C;  2ZH9 A;  3OWG A;  4S3N A;  4I2A A;  1ZQR A;  4FHW A;  5DB8 A;  4Z6E A;  3RJK A;  4YD1 A;  4XUS A;  2PFQ A;  4WOY A;  3AUO A;  4O69 A;  2I9G A;  1TFW A;  3JPR A;  4IQT A;  4E7X A;  5D46 A;  3K75 D;  1R8B A;  4UAW A;  1ZQM A;  8ICL A;  4IQU A;  4DO9 A;  8ICC A;  1GPJ A;  2ZH6 A;  3MCR A;  2GWS A;  3K7D A;  4NLN A;  3V72 A;  4WC3 A;  1NOM A; 
#chains in the Genus database with same CATH homology
 2DRB A;  5IIO A;  3C2M A;  2BE3 A;  8ICK A;  4QZF A;  5BOL A;  4I2E A;  3RH6 A;  5DED A;  4IQW A;  1XSP A;  3UXO A;  4ATB B;  9ICH A;  4DOC A;  4XQ7 A;  2M2T A;  3JZ0 A;  4RPX A;  4R64 A;  9ICF A;  4QZ9 A;  2BCS A;  1BPZ A;  1RZT A;  5HC9 A;  4X0B A;  3TFR A;  4M9N A;  4GXK A;  3UQ2 A;  8ICV A;  4WC2 A;  1Q78 A;  4KLF A;  5HRL A;  4UD4 A;  5BPC A;  4E80 A;  1ZQL A;  4PHP A;  3AQL A;  5IIM A;  5DBC A;  1ZQK A;  3RH4 A;  4QZH A;  2FMP A;  2BPC A;  4M9H A;  5HHH A;  3HIY A;  1ZQW A;  3AU6 A;  2BCU A;  9ICV A;  1FA0 A;  4R65 A;  3H37 A;  4KLQ A;  2ZH2 A;  4UBB A;  4GXI A;  8ICE A;  3RJG A;  4R66 A;  4RQ4 A;  5III A;  3RJE A;  3RJI A;  7ICS A;  3C5G A;  4JWM A;  3AQN A;  4I2H A;  4O5C A;  8ICM A;  2ZH8 A;  9ICN A;  4RQ5 A;  4NKT A;  5DB9 A;  7ICV A;  4PGY A;  4R63 A;  4KLL A;  2BCR A;  1ZQT A;  1BPE A;  1ZQY A;  1F5A A;  7ICT A;  4X4U A;  5HHI A;  3AQK A;  4QZB A;  3WFQ E;  4XA5 A;  4M9J A;  4PHA A;  2ID1 A;  4MF2 A;  2DR5 A;  3V7J A;  2O5A A;  4TUP A;  4I28 A;  5J0U A;  4LZD A;  2M2U A;  8ICH A;  4F5P A;  4M9G A;  4QZ8 A;  4NM2 A;  8ICW A;  4XRH A;  2PFN A;  4ATB A;  4KLH A;  4MFC A;  4K4H A;  4PHE A;  8ICY A;  4LT6 A;  7ICI A;  4Z6F A;  4I2F A;  1JMS A;  1MIY A;  3C66 A;  3JPN A;  4NY8 A;  9ICQ A;  5J0Y A;  5J2H A;  1ZJN A;  4KLS A;  4UB3 A;  3L9D A;  1XSL A;  4UB5 A;  3JPP A;  5HRF A;  2ZH1 A;  1ZQN A;  3WFR E;  1BPB A;  3JYY A;  4UD5 A;  8ICG A;  9ICG A;  5HRI A;  4M47 A;  4I29 A;  1ZQF A;  4MFF A;  4WBZ A;  4WC7 A;  3V7K A;  5HRE A;  5J29 A;  2ZHA A;  4RWP A;  3OVA A;  5CJ7 A;  4UBC A;  4UAY A;  2DR8 A;  5HRK A;  3UXP A;  5J2J A;  4AT7 B;  1V4A A;  3JPQ A;  1R89 A;  5DDY A;  4WC6 A;  1ZQO A;  4RWQ A;  2DR7 A;  5J0T A;  4QZC A;  2FMQ A;  1MIV A;  4PH5 A;  4O5E A;  5D4B A;  1ZQE A;  1ZQD A;  4X4Q A;  1ZQA A;  4LVS A;  9ICJ A;  1ZQS A;  1TV9 A;  1JQR A;  3C2L A;  1ZQQ A;  4RT3 A;  5BOM A;  4UB1 A;  1HUO A;  1ZQZ A;  5IIJ A;  5J0Q A;  5J2G A;  4QZI A;  4F5R A;  3AU2 A;  3ISD A;  8ICP A;  9ICL A;  4UB4 A;  1VFG A;  1NO5 A;  4EP7 A;  3NYB A;  7ICF A;  7ICH A;  4RQ3 A;  3UQ0 A;  3HW8 A;  9ICP A;  4EBJ A;  4DOB A;  3MDC A;  3TFS A;  4I2D A;  8ICO A;  4PHD A;  5HRB A;  5CP2 A;  3UXN A;  5HRG A;  4IG8 A;  1ZQP A;  2ISO A;  9ICS A;  2ZHB A;  5DBB A;  3C2K A;  4X4R A;  4UB2 A;  2FMS A;  4I2B A;  9ICT A;  5F2V O;  4FHX A;  9ICX A;  4PGQ A;  1XSN A;  4RQ6 A;  4GXJ A;  4X5V A;  4NKU A;  5IIL A;  3MBY A;  5J2D A;  4AT8 B;  2HHP A;  4WC0 A;  4FHV A;  3B0Y A;  4X4P A;  4EBK A;  4I2C A;  2P66 A;  4KLI A;  4AT7 A;  3OUY B;  5CA7 A;  3H3A A;  4XQ8 A;  4PGX A;  1BPX A;  1KDH A;  1BPD A;  9ICR A;  8ICT A;  3RJF A;  3HWT A;  4O9M A;  1ZQV A;  4JWN A;  3RH5 A;  9ICU A;  4WC1 A;  2DRA A;  4MFA A;  1UET A;  4TUQ A;  2M2V A;  8ICJ A;  4KLT A;  7ICU A;  3B0X A;  2Q66 A;  4RQ8 A;  4I2G A;  4WCW A;  7ICG A;  1ZQH A;  7ICE A;  1KNY A;  3JPT A;  2PBE A;  1JN3 A;  1R8C A;  2ZH3 A;  1ZQG A;  4M2Y A;  8ICI A;  8ICF A;  8ICQ A;  4P4O A;  1MQ2 A;  7ICQ A;  4RQ2 A;  3ISB A;  3C18 A;  4YMO A;  5IIN A;  9ICE A;  2BCV A;  4YMM A;  4TUR A;  1YLQ A;  4X4N A;  1ZQX A;  4IQV A;  3LQC B;  3MGH A;  1MQ3 A;  4KLU A;  4QZA A;  5CR0 A;  4M5D A;  4AT8 A;  4K4I A;  3MDA A;  4NM1 A;  9ICB A;  9ICO A;  4WC5 A;  9ICC A;  4QZD A;  5J0P A;  2PFO A;  3WFP A;  4I2I A;  4X4T A;  3OUY A;  4YD2 A;  5DEC A;  2BPG A;  2BCQ A;  2DR9 A;  4LZG A;  8ICU A;  4KLD A;  8ICB A;  1MIW A;  2M2W A;  3V7L A;  4F5N A;  3UPS A;  5J2K A;  5HRD A;  4YMN A;  5IIK A;  3PNC A;  3OVS A;  2PFP A;  7ICR A;  4M9L A;  8ICX A;  5J2I A;  5HR9 A;  5DBA A;  2ZH5 A;  5J0O A;  3OV7 A;  5J2E A;  4NXZ A;  2ZH4 A;  9ICM A;  4O5K A;  4MF8 A;  3OGU A;  3H39 A;  5DKW A;  4FHY A;  5J0W A;  4X4V A;  8ICA A;  4E8F A;  4RPY A;  1ZQB A;  4P2H A;  8ICR A;  5J2F A;  1WOT A;  2NRK A;  4M0A A;  4FH3 A;  4P4M A;  3OVB A;  1RPL A;  1UEU A;  3H38 A;  1KEJ A;  2DVI A;  7ICO A;  5J0R A;  8ICS A;  4RQ1 A;  3PMN A;  3PML A;  5CWR A;  1Q79 A;  4NLK A;  4X4O A;  4KLM A;  4AT9 B;  4RQ7 A;  2ZH7 A;  1BPY A;  4QZE A;  1ZQI A;  4F5O A;  4RWN A;  8ICZ A;  1VJ7 A;  5J2A A;  3RJH A;  4FO6 A;  2W9M A;  1ZQJ A;  4M04 A;  7ICM A;  4X4S A;  5J0S A;  5TZV A;  5DB6 A;  4X0A A;  4Z6D A;  4UAZ A;  5CB1 A;  1TFY A;  3JPS A;  7ICN A;  4YCX A;  1UEV A;  4I27 A;  4K4G A;  7ICK A;  5J0X A;  3HJ4 A;  9ICI A;  3RJJ A;  5CHG A;  4FHP A;  2O1P A;  7ICJ A;  1OU5 A;  2BPF A;  7ICP A;  5D49 A;  1PX5 A;  9ICK A;  4NLZ A;  1JAJ A;  2RFF A;  2ISP A;  4KLJ A;  4WBY A;  4TUS A;  5EOZ A;  4WC4 A;  4P4P A;  4I2J A;  1ZQC A;  1ZQU A;  4RWO A;  4RQ0 A;  8ICN A;  9ICA A;  4RPZ A;  4F5Q A;  5J2B A;  7ICL A;  4QZG A;  4DOA A;  3UPQ A;  4KLG A;  9ICW A;  4YN4 A;  3LK9 A;  2PXI A;  4RT2 A;  3GDX A;  3HJ1 A;  4KLE A;  3ISC A;  3C5F A;  1R8A A;  4FH5 A;  5J2C A;  3MGI A;  1TVA A;  1HUZ A;  1ZJM A;  3JPO A;  3WFO A;  5DDM A;  4Z6C A;  4AT9 A;  4KLO A;  4PPX A;  3AQM A;  2IHM A;  5DB7 A;  2VAN A;  3HX0 A;  5HRH A;  3WFS C;  2ZH9 A;  4S3N A;  4I2A A;  1ZQR A;  4FHW A;  5DB8 A;  4Z6E A;  3RJK A;  4YD1 A;  4XUS A;  2PFQ A;  3AUO A;  2I9G A;  1TFW A;  3JPR A;  4IQT A;  4E7X A;  5D46 A;  3K75 D;  1R8B A;  4UAW A;  1ZQM A;  8ICL A;  4IQU A;  4DO9 A;  8ICC A;  2ZH6 A;  2GWS A;  4NLN A;  3V72 A;  4WC3 A;  1NOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...