3UPSA

Crystal structure of iojap-like protein from zymomonas mobilis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
FDPEMLLKLVTDSLDDDQALEIATIPLAGKSSIADYMVIASGRSSRQVTAMAQKLADRIKAATGYVSKIEGLPAADWVLLDAGDIIIHLFRPEVRSFYNLERMWGFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iojap-like protein
publication title Crystal structure of iojap-like protein from Zymomonas mobilis
rcsb
source organism Zymomonas mobilis subsp. mobilis
molecule tags Structural genomics, unknown function
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3upsA00
4M47A 4DOBA 4TUQA 4F5NA 1Q78A 2NRKA 5HRLA 9ICSA 4DOAA 3TFRA 2PFQA 8ICPA 4I27A 4AT7A 2BPCA 4X4QA 3HJ4A 1KEJA 1JN3A 2ISPA 1ZQKA 2DVIA 5J0WA 3HWTA 1RZTA 4X0BA 3MGIA 4KLFA 2ZH2A 2PFOA 9ICCA 4FHVA 1JMSA 1TFYA 4XUSA 7ICKA 5CHGA 5CR0A 4GXJA 1UEUA 1ZQDA 8ICAA 1ZQHA 7ICRA 5IILA 5DEDA 9ICXA 7ICVA 3RH6A 1ZQZA 3AQKA 4UBBA 4MFFA 5DDMA 3RJJA 5J2AA 3RJIA 8ICCA 3C5FA 4KLHA 2BCUA 1KDHA 1FA0A 4UD5A 2HHPA 3AUOA 2M2WA 4NKUA 5HRFA 8ICWA 4XQ8A 4I2HA 4QZHA 1MQ2A 4QZEA 1JAJA 4UAYA 4I28A 8ICEA 8ICLA 4NM2A 4I29A 1ZQSA 2PBEA 2ZH4A 1BPZA 7ICTA 1XSPA 4NY8A 3UXOA 4QZCA 1MIYA 4WC2A 3AQMA 3RH4A 1R8CA 4RWPA 4QZ8A 4WC4A 1ZQFA 1OU5A 4EBJA 5IINA 1ZQQA 3LK9A 4F5PA 4RWNA 7ICMA 4X4PA 4IQVA 4QZ9A 1ZQUA 4NM1A 5DECA 4X4SA 5D46A 4UD4A 3RJKA 5HRKA 3RJFA 4P2HA 7ICQA 3B0YA 3JPOA 3UPSA 5DB8A 1MIWA 4O5KA 5CA7A 4KLEA 1R89A 3MGHA 3OGUA 4PHPA 5DKWA 2O5AA 5J2EA 4M9JA 8ICGA 4X4VA 4TUPA 4R63A 3UQ2A 1BPEA 4UAZA 3JPPA 4Z6FA 3AU2A 3L9DA 4FHPA 4WCWA 3H39A 3WFSC 4YMNA 2M2TA 9ICNA 3OV7A 5HRHA 4KLQA 7ICFA 8ICSA 4WBZA 4ATBB 4UB2A 2I9GA 4WBYA 5J2FA 4WC5A 2ZHBA 5HRIA 4UAWA 3MDAA 2ZH7A 4LZDA 4F5OA 8ICNA 4XQ7A 9ICRA 4M5DA 4LZGA 4MF2A 4X4OA 8ICUA 3OVBA 5BPCA 4NKTA 1ZJNA 3RJEA 3JPNA 2BCQA 4DO9A 1ZQJA 3OVSA 5HHIA 5HC9A 9ICWA 8ICTA 2BPGA 9ICBA 9ICTA 2O1PA 4I2FA 4XA5A 5J2GA 9ICKA 5TZVA 2BPFA 2FMPA 5EOZA 1VFGA 5HHHA 5DBCA 4X4TA 2ZHAA 4PH5A 4RWOA 4PGQA 4PGYA 1R8BA 5IIKA 1ZQCA 9ICJA 4DOCA 5J2DA 5DB6A 9ICFA 4I2IA 3MBYA 1JQRA 3H38A 1ZQNA 5CP2A 5J29A 4YMOA 3GDXA 3H37A 4LVSA 4QZAA 4PHEA 1HUZA 2DRBA 4GXIA 4YD1A 8ICFA 8ICRA 3TFSA 5J2CA 4QZIA 1KNYA 3OUYB 2BE3A 1ZQBA 4KLLA 4I2DA 3MDCA 1BPYA 8ICOA 9ICQA 7ICUA 2VANA 4E80A 4NLKA 4Z6CA 1HUOA 4YN4A 3HX0A 3K75D 5J0TA 2GWSA 8ICXA 4I2GA 3UPQA 1V4AA 5J0YA 3JYYA 1ZQRA 8ICJA 4P4OA 4K4GA 4KLMA 4R64A 9ICPA 1TFWA 1ZQGA 4RQ6A 4M0AA 1BPBA 1ZQTA 1ZQPA 3B0XA 1ZQLA 3V7LA 1XSNA 5J2BA 1ZJMA 4RWQA 4QZBA 1YLQA 4TURA 3AQNA 2DR5A 3ISDA 8ICQA 5D4BA 4M04A 7ICEA 2DR7A 4S3NA 4X0AA 4YCXA 4UB4A 4AT9B 4KLJA 3V7KA 4ATBA 3JPSA 1ZQVA 5IIIA 9ICVA 4PGXA 9ICEA 3AU6A 1F5AA 1NO5A 5CJ7A 1Q79A 2W9MA 4RQ8A 3WFQE 2ZH5A 4RT3A 4IG8A 9ICLA 4M9NA 3C5GA 1ZQWA 1UEVA 4AT8B 3RJHA 4PPXA 1BPDA 4KLSA 4I2JA 4EP7A 4WC6A 1R8AA 1WOTA 2FMSA 4X4RA 4Z6EA 2P66A 4RQ4A 9ICHA 4F5QA 4E7XA 4WC7A 4IQTA 4Z6DA 4RPYA 5HRDA 3C2MA 4MFCA 5DDYA 3PMNA 4FHWA 2ISOA 3JPTA 4RQ3A 1ZQEA 7ICIA 5DB9A 1ZQXA 3RH5A 7ICJA 4JWMA 8ICMA 4KLGA 2PFNA 5D49A 7ICHA 4WC1A 7ICGA 3V72A 5DBAA 2RFFA 3C2LA 4FHXA 4RQ1A 9ICMA 4P4PA 4XRHA 2BCRA 5J2IA 4KLUA 4X4UA 4YD2A 3UXPA 4O5EA 5DB7A 4RPXA 5F2VO 5IIJA 3C66A 4AT7B 4IQWA 1VJ7A 3OUYA 4RPZA 1TV9A 1MIVA 5CB1A 4F5RA 4IQUA 2ZH3A 2DR9A 4KLIA 4RT2A 4MFAA 4M9LA 4UB1A 4JWNA 9ICAA 4UBCA 3NYBA 4FHYA 4YMMA 3C18A 4UB3A 5HREA 5HRBA 1RPLA 9ICGA 3HW8A 2ZH1A 5IIMA 4I2CA 1ZQIA 4I2BA 2PFPA 4P4MA 2BCVA 8ICYA 1MQ3A 3OVAA 2ZH8A 4GXKA 4O9MA 3HJ1A 4RQ2A 8ICKA 5J0PA 3JPRA 5HR9A 5J0UA 7ICPA 2Q66A 3LQCB 3ISCA 2FMQA 4LT6A 5J0RA 3HIYA 3JZ0A 4MF8A 5J2HA 8ICHA 2ID1A 2M2VA 4AT9A 4I2EA 5J0XA 4QZDA 2DRAA 3V7JA 4KLDA 4NXZA 3UQ0A 8ICZA 4X5VA 4FH5A 5J2JA 3C2KA 4E8FA 3ISBA 1ZQYA 4PHAA 4FH3A 4M9HA 1ZQAA 4PHDA 5J0OA 4X4NA 1UETA 4QZGA 3WFPA 8ICBA 4AT8A 5CWRA 2ZH9A 4I2AA 4NLZA 2DR8A 4RQ7A 3WFRE 1NOMA 5BOMA 4TUSA 2IHMA 1PX5A 1TVAA 4RQ5A 5IIOA 8ICVA 9ICUA 4EBKA 4UB5A 1ZQOA 7ICSA 4K4IA 8ICIA 2M2UA 4KLOA 3JPQA 4KLTA 5J2KA 3H3AA 4FO6A 5DBBA 5J0QA 3RJGA 1XSLA 4WC0A 3PMLA 4R66A 3PNCA 2ZH6A 4O5CA 9ICIA 3AQLA 4NLNA 4R65A 5HRGA 2PXIA 4K4HA 2BCSA 4RQ0A 4QZFA 3WFOA 5J0SA 1BPXA 3UXNA 7ICLA 9ICOA 5BOLA 4M2YA 4M9GA 1ZQMA 7ICNA 4WC3A 7ICOA
chains in the Genus database with same CATH superfamily
4M47A 4DOBA 4TUQA 4F5NA 1Q78A 2NRKA 5B3PA 5HRLA 4O69A 9ICSA 4DOAA 4LEVA 3TFRA 2PFQA 8ICPA 4I27A 4AT7A 2BPCA 4X4QA 3HJ4A 1KEJA 1JN3A 2ISPA 1ZQKA 2DVIA 5J0WA 3HWTA 1RZTA 4X0BA 3MCRA 3MGIA 4KLFA 2ZH2A 4K9AA 2PFOA 9ICCA 4FHVA 1JMSA 1TFYA 4XUSA 7ICKA 5CHGA 5CR0A 4GXJA 1UEUA 1ZQDA 8ICAA 1ZQHA 7ICRA 5IILA 5DEDA 9ICXA 7ICVA 3RH6A 1ZQZA 3AQKA 4UBBA 4MFFA 4NXVA 5DDMA 3RJJA 5J2AA 3RJIA 4OAHA 8ICCA 3C5FA 4KLHA 2BCUA 1KDHA 1FA0A 4UD5A 4FO1A 2HHPA 3AUOA 2M2WA 4NKUA 5HRFA 8ICWA 4XQ8A 4I2HA 4QZHA 1MQ2A 4QZEA 1JAJA 4UAYA 4I28A 8ICEA 8ICLA 4NM2A 4I29A 1ZQSA 2PBEA 2ZH4A 1BPZA 7ICTA 4K8VA 1XSPA 4NY8A 3UXOA 4QZCA 4JLZA 1MIYA 4WC2A 3AQMA 3RH4A 1R8CA 4RWPA 3JCFA 4QZ8A 4WC4A 2FCLA 1ZQFA 1OU5A 4EBJA 5IINA 1ZQQA 3LK9A 4F5PA 4RWNA 7ICMA 2GAFD 4IQVA 4X4PA 4QZ9A 1ZQUA 4NM1A 5DECA 2EWRA 5D46A 4UD4A 4X4SA 4K9BA 3RJKA 5HRKA 4OAFA 3RJFA 4P2HA 7ICQA 4NXUA 3B0YA 3JPOA 3UPSA 5DB8A 1MIWA 4O5KA 5CA7A 4KLEA 1R89A 3MGHA 1GPJA 3OGUA 4PHPA 5DKWA 2O5AA 5J2EA 4M9JA 8ICGA 4X4VA 4TUPA 2BBJA 4R63A 3UQ2A 1BPEA 4UAZA 3JPPA 4Z6FA 2BBHA 3AU2A 3L9DA 4FHPA 3H39A 4WCWA 3CK6A 4YMNA 3WFSC 2M2TA 9ICNA 3OV7A 5HRHA 4I0UA 4KLQA 7ICFA 8ICSA 4WBZA 4ATBB 4UB2A 2I9GA 4WBYA 5J2FA 4WC5A 2ZHBA 2HN2A 5CHEA 5HRIA 4O68A 4UAWA 3MDAA 2ZH7A 4LZDA 4F5OA 8ICNA 4XQ7A 9ICRA 4M5DA 4LZGA 4EEDA 4MF2A 4X4OA 8ICUA 3OVBA 5BPCA 4NKTA 1ZJNA 4K98A 3RJEA 3JPNA 2BCQA 4DO9A 1ZQJA 4NXXA 3OVSA 4N7RA 5HHIA 5HC9A 9ICWA 8ICTA 2IHOA 5D61A 2BPGA 9ICBA 9ICTA 2O1PA 4I2FA 4XA5A 5J2GA 9ICKA 5TZVA 2BPFA 2FMPA 5EOZA 1VFGA 5HHHA 5DBCA 4X4TA 2ZHAA 4PH5A 4LEZA 4RWOA 3NWIA 5B3QA 4PGQA 4NXWA 4PGYA 1R8BA 4OAIZ 5IIKA 1ZQCA 9ICJA 4DOCA 4EEBA 5J2DA 5DB6A 9ICFA 4I2IA 3MBYA 1JQRA 3H38A 1ZQNA 5CP2A 5J29A 4EV6A 4YMOA 3GDXA 3H37A 4LVSA 4QZAA 4PHEA 1HUZA 2DRBA 4GXIA 4YD1A 8ICFA 8ICRA 3TFSA 5J2CA 4QZIA 1KNYA 3OUYB 2BE3A 4O67A 4K96A 1ZQBA 4KLLA 4I2DA 3MDCA 1BPYA 8ICOA 9ICQA 7ICUA 2VANA 2B56A 4E80A 4NLKA 4Z6CA 1HUOA 4YN4A 3HX0A 3K75D 5J0TA 2GWSA 8ICXA 4I2GA 3UPQA 1V4AA 5J0YA 3JYYA 1ZQRA 8ICJA 4P4OA 4MKPA 4K4GA 4KLMA 4R64A 9ICPA 1TFWA 1ZQGA 4RQ6A 4M0AA 1BPBA 4WH5A 1ZQTA 1ZQPA 3B0XA 3K7DA 4WQLA 3V7LA 1XSNA 5J2BA 1ZQLA 1ZJMA 4RWQA 4KM5A 4QZBA 1YLQA 4TURA 4LEYA 3AQNA 2DR5A 3ISDA 8ICQA 5D4BA 4M04A 7ICEA 2DR7A 4S3NA 5D62A 4X0AA 4YCXA 4UB4A 4AT9B 2B51A 4KLJA 3PHZA 3V7KA 4ATBA 3JPSA 1ZQVA 5IIIA 9ICVA 4PGXA 4XJEA 9ICEA 3AU6A 1F5AA 1NO5A 5CJ7A 1Q79A 2W9MA 4RQ8A 3WFQE 2ZH5A 4RT3A 4IG8A 9ICLA 5CFTA 4M9NA 3C5GA 1ZQWA 1UEVA 4AT8B 3RJHA 4KB6A 4PPXA 1BPDA 4KLSA 4I2JA 4EP7A 4WC6A 1R8AA 1WOTA 4K97A 4HX0A 4X4RA 2FMSA 4LEWA 4Z6EA 2P66A 4RQ4A 9ICHA 4F5QA 4E7XA 4WC7A 5CFUA 3ER8C 4IQTA 4Z6DA 4RPYA 5HRDA 3C2MA 4MFCA 5DDYA 3PMNA 4FHWA 2ISOA 3JPTA 4RQ3A 1ZQEA 7ICIA 5DB9A 1ZQXA 3EF2A 3RH5A 7ICJA 4JWMA 8ICMA 4KLGA 2PFNA 5D49A 7ICHA 4WC1A 7ICGA 2HN1A 3V72A 5DBAA 2RFFA 3C2LA 4FHXA 4RQ1A 9ICMA 4P4PA 4XRHA 2BCRA 5J2IA 4KLUA 4X4UA 4YD2A 3UXPA 4O5EA 4RPXA 5DB7A 4WOYA 5F2VO 5IIJA 3C66A 4AT7B 4IQWA 1VJ7A 3OUYA 4RPZA 1TV9A 1MIVA 5CB1A 4F5RA 4EGWA 4IQUA 2ZH3A 2DR9A 4KLIA 4RT2A 4MFAA 4M9LA 3NVOA 4UB1A 4JWNA 9ICAA 4UBCA 3NYBA 4FHYA 4YMMA 3C18A 4UB3A 5JTGA 5HREA 5HRBA 1RPLA 9ICGA 3HW8A 2ZH1A 5IIMA 4I2CA 1ZQIA 4I2BA 2PFPA 3ERCC 4P4MA 2BCVA 8ICYA 1MQ3A 3OVAA 2ZH8A 4GXKA 4O9MA 3HJ1A 3OWGA 4RQ2A 4WQKA 8ICKA 5J0PA 3JPRA 4OAGA 3NKUA 5HR9A 5J0UA 4NXTA 7ICPA 5CFSA 2Q66A 3LQCB 3ISCA 2FMQA 4LT6A 5J0RA 3HIYA 3JZ0A 4MF8A 5J2HA 8ICHA 2ID1A 2M2VA 4AT9A 4I2EA 5J0XA 3ER9B 4QZDA 2DRAA 3V7JA 4KLDA 2B4VA 5D63A 4NXZA 3UQ0A 8ICZA 4O6AA 4X5VA 4FH5A 5J2JA 3C2KA 4E8FA 3ISBA 1ZQYA 4PHAA 4FH3A 4M9HA 1ZQAA 4PHDA 5J0OA 4X4NA 1UETA 4QZGA 3WFPA 8ICBA 4AT8A 5CWRA 2ZH9A 4I2AA 4NLZA 2DR8A 4RQ7A 3WFRE 1NOMA 5BOMA 4TUSA 2IHMA 1PX5A 1TVAA 4RQ5A 5IIOA 8ICVA 9ICUA 4EBKA 4UB5A 1ZQOA 7ICSA 4K4IA 8ICIA 2M2UA 4KLOA 3JPQA 4KLTA 5J2KA 3H3AA 4FO6A 5DBBA 5J0QA 3RJGA 1XSLA 4WC0A 3PMLA 4R66A 3PNCA 2ZH6A 4O5CA 9ICIA 3AQLA 4NLNA 4R65A 5HRGA 2PXIA 4K4HA 2IUBA 4K99A 4RQ0A 2BCSA 2GA9D 4JLXA 3WFOA 5J0SA 4QZFA 3UXNA 1BPXA 7ICLA 9ICOA 5BOLA 4M2YA 4M9GA 1ZQMA 7ICNA 4WC3A 7ICOA
chains in the Genus database with same CATH topology
4M47A 4DOBA 4TUQA 4F5NA 1Q78A 2NRKA 5HRLA 9ICSA 4DOAA 3TFRA 2PFQA 8ICPA 4I27A 4AT7A 2BPCA 4X4QA 3HJ4A 1KEJA 1JN3A 2ISPA 1ZQKA 2DVIA 5J0WA 3HWTA 1RZTA 4X0BA 3MGIA 4KLFA 2ZH2A 2PFOA 9ICCA 4FHVA 1JMSA 1TFYA 4XUSA 7ICKA 5CHGA 5CR0A 4GXJA 1UEUA 1ZQDA 8ICAA 1ZQHA 7ICRA 5IILA 5DEDA 9ICXA 7ICVA 3RH6A 1ZQZA 3AQKA 4UBBA 4MFFA 5DDMA 3RJJA 5J2AA 3RJIA 8ICCA 3C5FA 4KLHA 2BCUA 1KDHA 1FA0A 4UD5A 2HHPA 3AUOA 2M2WA 4NKUA 5HRFA 8ICWA 4XQ8A 4I2HA 4QZHA 1MQ2A 4QZEA 1JAJA 4UAYA 4I28A 8ICEA 8ICLA 4NM2A 4I29A 1ZQSA 2PBEA 2ZH4A 1BPZA 7ICTA 1XSPA 4NY8A 3UXOA 4QZCA 1MIYA 4WC2A 3AQMA 3RH4A 1R8CA 4RWPA 4QZ8A 4WC4A 1ZQFA 1OU5A 4EBJA 5IINA 1ZQQA 3LK9A 4F5PA 4RWNA 7ICMA 4X4PA 4IQVA 4QZ9A 1ZQUA 4NM1A 5DECA 4X4SA 5D46A 4UD4A 3RJKA 5HRKA 3RJFA 4P2HA 7ICQA 3B0YA 3JPOA 3UPSA 5DB8A 1MIWA 4O5KA 5CA7A 4KLEA 1R89A 3MGHA 3OGUA 4PHPA 5DKWA 2O5AA 5J2EA 4M9JA 8ICGA 4X4VA 4TUPA 4R63A 3UQ2A 1BPEA 4UAZA 3JPPA 4Z6FA 3AU2A 3L9DA 4FHPA 4WCWA 3H39A 3WFSC 4YMNA 2M2TA 9ICNA 3OV7A 5HRHA 4KLQA 7ICFA 8ICSA 4WBZA 4ATBB 4UB2A 2I9GA 4WBYA 5J2FA 4WC5A 2ZHBA 5HRIA 4UAWA 3MDAA 2ZH7A 4LZDA 4F5OA 8ICNA 4XQ7A 9ICRA 4M5DA 4LZGA 4MF2A 4X4OA 8ICUA 3OVBA 5BPCA 4NKTA 1ZJNA 3RJEA 3JPNA 2BCQA 4DO9A 1ZQJA 3OVSA 5HHIA 5HC9A 9ICWA 8ICTA 2BPGA 9ICBA 9ICTA 2O1PA 4I2FA 4XA5A 5J2GA 9ICKA 5TZVA 2BPFA 2FMPA 5EOZA 1VFGA 5HHHA 5DBCA 4X4TA 2ZHAA 4PH5A 4RWOA 4PGQA 4PGYA 1R8BA 5IIKA 1ZQCA 9ICJA 4DOCA 5J2DA 5DB6A 9ICFA 4I2IA 3MBYA 1JQRA 3H38A 1ZQNA 5CP2A 5J29A 4YMOA 3GDXA 3H37A 4LVSA 4QZAA 4PHEA 1HUZA 2DRBA 4GXIA 4YD1A 8ICFA 8ICRA 3TFSA 5J2CA 4QZIA 1KNYA 3OUYB 2BE3A 1ZQBA 4KLLA 4I2DA 3MDCA 1BPYA 8ICOA 9ICQA 7ICUA 2VANA 4E80A 4NLKA 4Z6CA 1HUOA 4YN4A 3HX0A 3K75D 5J0TA 2GWSA 8ICXA 4I2GA 3UPQA 1V4AA 5J0YA 3JYYA 1ZQRA 8ICJA 4P4OA 4K4GA 4KLMA 4R64A 9ICPA 1TFWA 1ZQGA 4RQ6A 4M0AA 1BPBA 1ZQTA 1ZQPA 3B0XA 1ZQLA 3V7LA 1XSNA 5J2BA 1ZJMA 4RWQA 4QZBA 1YLQA 4TURA 3AQNA 2DR5A 3ISDA 8ICQA 5D4BA 4M04A 7ICEA 2DR7A 4S3NA 4X0AA 4YCXA 4UB4A 4AT9B 4KLJA 3V7KA 4ATBA 3JPSA 1ZQVA 5IIIA 9ICVA 4PGXA 9ICEA 3AU6A 1F5AA 1NO5A 5CJ7A 1Q79A 2W9MA 4RQ8A 3WFQE 2ZH5A 4RT3A 4IG8A 9ICLA 4M9NA 3C5GA 1ZQWA 1UEVA 4AT8B 3RJHA 4PPXA 1BPDA 4KLSA 4I2JA 4EP7A 4WC6A 1R8AA 1WOTA 2FMSA 4X4RA 4Z6EA 2P66A 4RQ4A 9ICHA 4F5QA 4E7XA 4WC7A 4IQTA 4Z6DA 4RPYA 5HRDA 3C2MA 4MFCA 5DDYA 3PMNA 4FHWA 2ISOA 3JPTA 4RQ3A 1ZQEA 7ICIA 5DB9A 1ZQXA 3RH5A 7ICJA 4JWMA 8ICMA 4KLGA 2PFNA 5D49A 7ICHA 4WC1A 7ICGA 3V72A 5DBAA 2RFFA 3C2LA 4FHXA 4RQ1A 9ICMA 4P4PA 4XRHA 2BCRA 5J2IA 4KLUA 4X4UA 4YD2A 3UXPA 4O5EA 5DB7A 4RPXA 5F2VO 5IIJA 3C66A 4AT7B 4IQWA 1VJ7A 3OUYA 4RPZA 1TV9A 1MIVA 5CB1A 4F5RA 4IQUA 2ZH3A 2DR9A 4KLIA 4RT2A 4MFAA 4M9LA 4UB1A 4JWNA 9ICAA 4UBCA 3NYBA 4FHYA 4YMMA 3C18A 4UB3A 5HREA 5HRBA 1RPLA 9ICGA 3HW8A 2ZH1A 5IIMA 4I2CA 1ZQIA 4I2BA 2PFPA 4P4MA 2BCVA 8ICYA 1MQ3A 3OVAA 2ZH8A 4GXKA 4O9MA 3HJ1A 4RQ2A 8ICKA 5J0PA 3JPRA 5HR9A 5J0UA 7ICPA 2Q66A 3LQCB 3ISCA 2FMQA 4LT6A 5J0RA 3HIYA 3JZ0A 4MF8A 5J2HA 8ICHA 2ID1A 2M2VA 4AT9A 4I2EA 5J0XA 4QZDA 2DRAA 3V7JA 4KLDA 4NXZA 3UQ0A 8ICZA 4X5VA 4FH5A 5J2JA 3C2KA 4E8FA 3ISBA 1ZQYA 4PHAA 4FH3A 4M9HA 1ZQAA 4PHDA 5J0OA 4X4NA 1UETA 4QZGA 3WFPA 8ICBA 4AT8A 5CWRA 2ZH9A 4I2AA 4NLZA 2DR8A 4RQ7A 3WFRE 1NOMA 5BOMA 4TUSA 2IHMA 1PX5A 1TVAA 4RQ5A 5IIOA 8ICVA 9ICUA 4EBKA 4UB5A 1ZQOA 7ICSA 4K4IA 8ICIA 2M2UA 4KLOA 3JPQA 4KLTA 5J2KA 3H3AA 4FO6A 5DBBA 5J0QA 3RJGA 1XSLA 4WC0A 3PMLA 4R66A 3PNCA 2ZH6A 4O5CA 9ICIA 3AQLA 4NLNA 4R65A 5HRGA 2PXIA 4K4HA 2BCSA 4RQ0A 4QZFA 3WFOA 5J0SA 1BPXA 3UXNA 7ICLA 9ICOA 5BOLA 4M2YA 4M9GA 1ZQMA 7ICNA 4WC3A 7ICOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M47 A;  4DOB A;  4TUQ A;  4F5N A;  1Q78 A;  2NRK A;  5HRL A;  9ICS A;  4DOA A;  3TFR A;  2PFQ A;  8ICP A;  4I27 A;  4AT7 A;  2BPC A;  4X4Q A;  3HJ4 A;  1KEJ A;  1JN3 A;  2ISP A;  1ZQK A;  2DVI A;  5J0W A;  3HWT A;  1RZT A;  4X0B A;  3MGI A;  4KLF A;  2ZH2 A;  2PFO A;  9ICC A;  4FHV A;  1JMS A;  1TFY A;  4XUS A;  7ICK A;  5CHG A;  5CR0 A;  4GXJ A;  1UEU A;  1ZQD A;  8ICA A;  1ZQH A;  7ICR A;  5IIL A;  5DED A;  9ICX A;  7ICV A;  3RH6 A;  1ZQZ A;  3AQK A;  4UBB A;  4MFF A;  5DDM A;  3RJJ A;  5J2A A;  3RJI A;  8ICC A;  3C5F A;  4KLH A;  2BCU A;  1KDH A;  1FA0 A;  4UD5 A;  2HHP A;  3AUO A;  2M2W A;  4NKU A;  5HRF A;  8ICW A;  4XQ8 A;  4I2H A;  4QZH A;  1MQ2 A;  4QZE A;  1JAJ A;  4UAY A;  4I28 A;  8ICE A;  8ICL A;  4NM2 A;  4I29 A;  1ZQS A;  2PBE A;  2ZH4 A;  1BPZ A;  7ICT A;  1XSP A;  4NY8 A;  3UXO A;  4QZC A;  1MIY A;  4WC2 A;  3AQM A;  3RH4 A;  1R8C A;  4RWP A;  4QZ8 A;  4WC4 A;  1ZQF A;  1OU5 A;  4EBJ A;  5IIN A;  1ZQQ A;  3LK9 A;  4F5P A;  4RWN A;  7ICM A;  4X4P A;  4IQV A;  4QZ9 A;  1ZQU A;  4NM1 A;  5DEC A;  4X4S A;  5D46 A;  4UD4 A;  3RJK A;  5HRK A;  3RJF A;  4P2H A;  7ICQ A;  3B0Y A;  3JPO A;  3UPS A;  5DB8 A;  1MIW A;  4O5K A;  5CA7 A;  4KLE A;  1R89 A;  3MGH A;  3OGU A;  4PHP A;  5DKW A;  2O5A A;  5J2E A;  4M9J A;  8ICG A;  4X4V A;  4TUP A;  4R63 A;  3UQ2 A;  1BPE A;  4UAZ A;  3JPP A;  4Z6F A;  3AU2 A;  3L9D A;  4FHP A;  4WCW A;  3H39 A;  3WFS C;  4YMN A;  2M2T A;  9ICN A;  3OV7 A;  5HRH A;  4KLQ A;  7ICF A;  8ICS A;  4WBZ A;  4ATB B;  4UB2 A;  2I9G A;  4WBY A;  5J2F A;  4WC5 A;  2ZHB A;  5HRI A;  4UAW A;  3MDA A;  2ZH7 A;  4LZD A;  4F5O A;  8ICN A;  4XQ7 A;  9ICR A;  4M5D A;  4LZG A;  4MF2 A;  4X4O A;  8ICU A;  3OVB A;  5BPC A;  4NKT A;  1ZJN A;  3RJE A;  3JPN A;  2BCQ A;  4DO9 A;  1ZQJ A;  3OVS A;  5HHI A;  5HC9 A;  9ICW A;  8ICT A;  2BPG A;  9ICB A;  9ICT A;  2O1P A;  4I2F A;  4XA5 A;  5J2G A;  9ICK A;  5TZV A;  2BPF A;  2FMP A;  5EOZ A;  1VFG A;  5HHH A;  5DBC A;  4X4T A;  2ZHA A;  4PH5 A;  4RWO A;  4PGQ A;  4PGY A;  1R8B A;  5IIK A;  1ZQC A;  9ICJ A;  4DOC A;  5J2D A;  5DB6 A;  9ICF A;  4I2I A;  3MBY A;  1JQR A;  3H38 A;  1ZQN A;  5CP2 A;  5J29 A;  4YMO A;  3GDX A;  3H37 A;  4LVS A;  4QZA A;  4PHE A;  1HUZ A;  2DRB A;  4GXI A;  4YD1 A;  8ICF A;  8ICR A;  3TFS A;  5J2C A;  4QZI A;  1KNY A;  3OUY B;  2BE3 A;  1ZQB A;  4KLL A;  4I2D A;  3MDC A;  1BPY A;  8ICO A;  9ICQ A;  7ICU A;  2VAN A;  4E80 A;  4NLK A;  4Z6C A;  1HUO A;  4YN4 A;  3HX0 A;  3K75 D;  5J0T A;  2GWS A;  8ICX A;  4I2G A;  3UPQ A;  1V4A A;  5J0Y A;  3JYY A;  1ZQR A;  8ICJ A;  4P4O A;  4K4G A;  4KLM A;  4R64 A;  9ICP A;  1TFW A;  1ZQG A;  4RQ6 A;  4M0A A;  1BPB A;  1ZQT A;  1ZQP A;  3B0X A;  1ZQL A;  3V7L A;  1XSN A;  5J2B A;  1ZJM A;  4RWQ A;  4QZB A;  1YLQ A;  4TUR A;  3AQN A;  2DR5 A;  3ISD A;  8ICQ A;  5D4B A;  4M04 A;  7ICE A;  2DR7 A;  4S3N A;  4X0A A;  4YCX A;  4UB4 A;  4AT9 B;  4KLJ A;  3V7K A;  4ATB A;  3JPS A;  1ZQV A;  5III A;  9ICV A;  4PGX A;  9ICE A;  3AU6 A;  1F5A A;  1NO5 A;  5CJ7 A;  1Q79 A;  2W9M A;  4RQ8 A;  3WFQ E;  2ZH5 A;  4RT3 A;  4IG8 A;  9ICL A;  4M9N A;  3C5G A;  1ZQW A;  1UEV A;  4AT8 B;  3RJH A;  4PPX A;  1BPD A;  4KLS A;  4I2J A;  4EP7 A;  4WC6 A;  1R8A A;  1WOT A;  2FMS A;  4X4R A;  4Z6E A;  2P66 A;  4RQ4 A;  9ICH A;  4F5Q A;  4E7X A;  4WC7 A;  4IQT A;  4Z6D A;  4RPY A;  5HRD A;  3C2M A;  4MFC A;  5DDY A;  3PMN A;  4FHW A;  2ISO A;  3JPT A;  4RQ3 A;  1ZQE A;  7ICI A;  5DB9 A;  1ZQX A;  3RH5 A;  7ICJ A;  4JWM A;  8ICM A;  4KLG A;  2PFN A;  5D49 A;  7ICH A;  4WC1 A;  7ICG A;  3V72 A;  5DBA A;  2RFF A;  3C2L A;  4FHX A;  4RQ1 A;  9ICM A;  4P4P A;  4XRH A;  2BCR A;  5J2I A;  4KLU A;  4X4U A;  4YD2 A;  3UXP A;  4O5E A;  5DB7 A;  4RPX A;  5F2V O;  5IIJ A;  3C66 A;  4AT7 B;  4IQW A;  1VJ7 A;  3OUY A;  4RPZ A;  1TV9 A;  1MIV A;  5CB1 A;  4F5R A;  4IQU A;  2ZH3 A;  2DR9 A;  4KLI A;  4RT2 A;  4MFA A;  4M9L A;  4UB1 A;  4JWN A;  9ICA A;  4UBC A;  3NYB A;  4FHY A;  4YMM A;  3C18 A;  4UB3 A;  5HRE A;  5HRB A;  1RPL A;  9ICG A;  3HW8 A;  2ZH1 A;  5IIM A;  4I2C A;  1ZQI A;  4I2B A;  2PFP A;  4P4M A;  2BCV A;  8ICY A;  1MQ3 A;  3OVA A;  2ZH8 A;  4GXK A;  4O9M A;  3HJ1 A;  4RQ2 A;  8ICK A;  5J0P A;  3JPR A;  5HR9 A;  5J0U A;  7ICP A;  2Q66 A;  3LQC B;  3ISC A;  2FMQ A;  4LT6 A;  5J0R A;  3HIY A;  3JZ0 A;  4MF8 A;  5J2H A;  8ICH A;  2ID1 A;  2M2V A;  4AT9 A;  4I2E A;  5J0X A;  4QZD A;  2DRA A;  3V7J A;  4KLD A;  4NXZ A;  3UQ0 A;  8ICZ A;  4X5V A;  4FH5 A;  5J2J A;  3C2K A;  4E8F A;  3ISB A;  1ZQY A;  4PHA A;  4FH3 A;  4M9H A;  1ZQA A;  4PHD A;  5J0O A;  4X4N A;  1UET A;  4QZG A;  3WFP A;  8ICB A;  4AT8 A;  5CWR A;  2ZH9 A;  4I2A A;  4NLZ A;  2DR8 A;  4RQ7 A;  3WFR E;  1NOM A;  5BOM A;  4TUS A;  2IHM A;  1PX5 A;  1TVA A;  4RQ5 A;  5IIO A;  8ICV A;  9ICU A;  4EBK A;  4UB5 A;  1ZQO A;  7ICS A;  4K4I A;  8ICI A;  2M2U A;  4KLO A;  3JPQ A;  4KLT A;  5J2K A;  3H3A A;  4FO6 A;  5DBB A;  5J0Q A;  3RJG A;  1XSL A;  4WC0 A;  3PML A;  4R66 A;  3PNC A;  2ZH6 A;  4O5C A;  9ICI A;  3AQL A;  4NLN A;  4R65 A;  5HRG A;  2PXI A;  4K4H A;  2BCS A;  4RQ0 A;  4QZF A;  3WFO A;  5J0S A;  1BPX A;  3UXN A;  7ICL A;  9ICO A;  5BOL A;  4M2Y A;  4M9G A;  1ZQM A;  7ICN A;  4WC3 A;  7ICO A; 
#chains in the Genus database with same CATH topology
 4M47 A;  4DOB A;  4TUQ A;  4F5N A;  1Q78 A;  2NRK A;  5B3P A;  5HRL A;  4O69 A;  9ICS A;  4DOA A;  4LEV A;  3TFR A;  2PFQ A;  8ICP A;  4I27 A;  4AT7 A;  2BPC A;  4X4Q A;  3HJ4 A;  1KEJ A;  1JN3 A;  2ISP A;  1ZQK A;  2DVI A;  5J0W A;  3HWT A;  1RZT A;  4X0B A;  3MCR A;  3MGI A;  4KLF A;  2ZH2 A;  4K9A A;  2PFO A;  9ICC A;  4FHV A;  1JMS A;  1TFY A;  4XUS A;  7ICK A;  5CHG A;  5CR0 A;  4GXJ A;  1UEU A;  1ZQD A;  8ICA A;  1ZQH A;  7ICR A;  5IIL A;  5DED A;  9ICX A;  7ICV A;  3RH6 A;  1ZQZ A;  3AQK A;  4UBB A;  4MFF A;  4NXV A;  5DDM A;  3RJJ A;  5J2A A;  3RJI A;  4OAH A;  8ICC A;  3C5F A;  4KLH A;  2BCU A;  1KDH A;  1FA0 A;  4UD5 A;  4FO1 A;  2HHP A;  3AUO A;  2M2W A;  4NKU A;  5HRF A;  8ICW A;  4XQ8 A;  4I2H A;  4QZH A;  1MQ2 A;  4QZE A;  1JAJ A;  4UAY A;  4I28 A;  8ICE A;  8ICL A;  4NM2 A;  4I29 A;  1ZQS A;  2PBE A;  2ZH4 A;  1BPZ A;  7ICT A;  4K8V A;  1XSP A;  4NY8 A;  3UXO A;  4QZC A;  4JLZ A;  1MIY A;  4WC2 A;  3AQM A;  3RH4 A;  1R8C A;  4RWP A;  3JCF A;  4QZ8 A;  4WC4 A;  2FCL A;  1ZQF A;  1OU5 A;  4EBJ A;  5IIN A;  1ZQQ A;  3LK9 A;  4F5P A;  4RWN A;  7ICM A;  2GAF D;  4IQV A;  4X4P A;  4QZ9 A;  1ZQU A;  4NM1 A;  5DEC A;  2EWR A;  5D46 A;  4UD4 A;  4X4S A;  4K9B A;  3RJK A;  5HRK A;  4OAF A;  3RJF A;  4P2H A;  7ICQ A;  4NXU A;  3B0Y A;  3JPO A;  3UPS A;  5DB8 A;  1MIW A;  4O5K A;  5CA7 A;  4KLE A;  1R89 A;  3MGH A;  1GPJ A;  3OGU A;  4PHP A;  5DKW A;  2O5A A;  5J2E A;  4M9J A;  8ICG A;  4X4V A;  4TUP A;  2BBJ A;  4R63 A;  3UQ2 A;  1BPE A;  4UAZ A;  3JPP A;  4Z6F A;  2BBH A;  3AU2 A;  3L9D A;  4FHP A;  3H39 A;  4WCW A;  3CK6 A;  4YMN A;  3WFS C;  2M2T A;  9ICN A;  3OV7 A;  5HRH A;  4I0U A;  4KLQ A;  7ICF A;  8ICS A;  4WBZ A;  4ATB B;  4UB2 A;  2I9G A;  4WBY A;  5J2F A;  4WC5 A;  2ZHB A;  2HN2 A;  5CHE A;  5HRI A;  4O68 A;  4UAW A;  3MDA A;  2ZH7 A;  4LZD A;  4F5O A;  8ICN A;  4XQ7 A;  9ICR A;  4M5D A;  4LZG A;  4EED A;  4MF2 A;  4X4O A;  8ICU A;  3OVB A;  5BPC A;  4NKT A;  1ZJN A;  4K98 A;  3RJE A;  3JPN A;  2BCQ A;  4DO9 A;  1ZQJ A;  4NXX A;  3OVS A;  4N7R A;  5HHI A;  5HC9 A;  9ICW A;  8ICT A;  2IHO A;  5D61 A;  2BPG A;  9ICB A;  9ICT A;  2O1P A;  4I2F A;  4XA5 A;  5J2G A;  9ICK A;  5TZV A;  2BPF A;  2FMP A;  5EOZ A;  1VFG A;  5HHH A;  5DBC A;  4X4T A;  2ZHA A;  4PH5 A;  4LEZ A;  4RWO A;  3NWI A;  5B3Q A;  4PGQ A;  4NXW A;  4PGY A;  1R8B A;  4OAI Z;  5IIK A;  1ZQC A;  9ICJ A;  4DOC A;  4EEB A;  5J2D A;  5DB6 A;  9ICF A;  4I2I A;  3MBY A;  1JQR A;  3H38 A;  1ZQN A;  5CP2 A;  5J29 A;  4EV6 A;  4YMO A;  3GDX A;  3H37 A;  4LVS A;  4QZA A;  4PHE A;  1HUZ A;  2DRB A;  4GXI A;  4YD1 A;  8ICF A;  8ICR A;  3TFS A;  5J2C A;  4QZI A;  1KNY A;  3OUY B;  2BE3 A;  4O67 A;  4K96 A;  1ZQB A;  4KLL A;  4I2D A;  3MDC A;  1BPY A;  8ICO A;  9ICQ A;  7ICU A;  2VAN A;  2B56 A;  4E80 A;  4NLK A;  4Z6C A;  1HUO A;  4YN4 A;  3HX0 A;  3K75 D;  5J0T A;  2GWS A;  8ICX A;  4I2G A;  3UPQ A;  1V4A A;  5J0Y A;  3JYY A;  1ZQR A;  8ICJ A;  4P4O A;  4MKP A;  4K4G A;  4KLM A;  4R64 A;  9ICP A;  1TFW A;  1ZQG A;  4RQ6 A;  4M0A A;  1BPB A;  4WH5 A;  1ZQT A;  1ZQP A;  3B0X A;  3K7D A;  4WQL A;  3V7L A;  1XSN A;  5J2B A;  1ZQL A;  1ZJM A;  4RWQ A;  4KM5 A;  4QZB A;  1YLQ A;  4TUR A;  4LEY A;  3AQN A;  2DR5 A;  3ISD A;  8ICQ A;  5D4B A;  4M04 A;  7ICE A;  2DR7 A;  4S3N A;  5D62 A;  4X0A A;  4YCX A;  4UB4 A;  4AT9 B;  2B51 A;  4KLJ A;  3PHZ A;  3V7K A;  4ATB A;  3JPS A;  1ZQV A;  5III A;  9ICV A;  4PGX A;  4XJE A;  9ICE A;  3AU6 A;  1F5A A;  1NO5 A;  5CJ7 A;  1Q79 A;  2W9M A;  4RQ8 A;  3WFQ E;  2ZH5 A;  4RT3 A;  4IG8 A;  9ICL A;  5CFT A;  4M9N A;  3C5G A;  1ZQW A;  1UEV A;  4AT8 B;  3RJH A;  4KB6 A;  4PPX A;  1BPD A;  4KLS A;  4I2J A;  4EP7 A;  4WC6 A;  1R8A A;  1WOT A;  4K97 A;  4HX0 A;  4X4R A;  2FMS A;  4LEW A;  4Z6E A;  2P66 A;  4RQ4 A;  9ICH A;  4F5Q A;  4E7X A;  4WC7 A;  5CFU A;  3ER8 C;  4IQT A;  4Z6D A;  4RPY A;  5HRD A;  3C2M A;  4MFC A;  5DDY A;  3PMN A;  4FHW A;  2ISO A;  3JPT A;  4RQ3 A;  1ZQE A;  7ICI A;  5DB9 A;  1ZQX A;  3EF2 A;  3RH5 A;  7ICJ A;  4JWM A;  8ICM A;  4KLG A;  2PFN A;  5D49 A;  7ICH A;  4WC1 A;  7ICG A;  2HN1 A;  3V72 A;  5DBA A;  2RFF A;  3C2L A;  4FHX A;  4RQ1 A;  9ICM A;  4P4P A;  4XRH A;  2BCR A;  5J2I A;  4KLU A;  4X4U A;  4YD2 A;  3UXP A;  4O5E A;  4RPX A;  5DB7 A;  4WOY A;  5F2V O;  5IIJ A;  3C66 A;  4AT7 B;  4IQW A;  1VJ7 A;  3OUY A;  4RPZ A;  1TV9 A;  1MIV A;  5CB1 A;  4F5R A;  4EGW A;  4IQU A;  2ZH3 A;  2DR9 A;  4KLI A;  4RT2 A;  4MFA A;  4M9L A;  3NVO A;  4UB1 A;  4JWN A;  9ICA A;  4UBC A;  3NYB A;  4FHY A;  4YMM A;  3C18 A;  4UB3 A;  5JTG A;  5HRE A;  5HRB A;  1RPL A;  9ICG A;  3HW8 A;  2ZH1 A;  5IIM A;  4I2C A;  1ZQI A;  4I2B A;  2PFP A;  3ERC C;  4P4M A;  2BCV A;  8ICY A;  1MQ3 A;  3OVA A;  2ZH8 A;  4GXK A;  4O9M A;  3HJ1 A;  3OWG A;  4RQ2 A;  4WQK A;  8ICK A;  5J0P A;  3JPR A;  4OAG A;  3NKU A;  5HR9 A;  5J0U A;  4NXT A;  7ICP A;  5CFS A;  2Q66 A;  3LQC B;  3ISC A;  2FMQ A;  4LT6 A;  5J0R A;  3HIY A;  3JZ0 A;  4MF8 A;  5J2H A;  8ICH A;  2ID1 A;  2M2V A;  4AT9 A;  4I2E A;  5J0X A;  3ER9 B;  4QZD A;  2DRA A;  3V7J A;  4KLD A;  2B4V A;  5D63 A;  4NXZ A;  3UQ0 A;  8ICZ A;  4O6A A;  4X5V A;  4FH5 A;  5J2J A;  3C2K A;  4E8F A;  3ISB A;  1ZQY A;  4PHA A;  4FH3 A;  4M9H A;  1ZQA A;  4PHD A;  5J0O A;  4X4N A;  1UET A;  4QZG A;  3WFP A;  8ICB A;  4AT8 A;  5CWR A;  2ZH9 A;  4I2A A;  4NLZ A;  2DR8 A;  4RQ7 A;  3WFR E;  1NOM A;  5BOM A;  4TUS A;  2IHM A;  1PX5 A;  1TVA A;  4RQ5 A;  5IIO A;  8ICV A;  9ICU A;  4EBK A;  4UB5 A;  1ZQO A;  7ICS A;  4K4I A;  8ICI A;  2M2U A;  4KLO A;  3JPQ A;  4KLT A;  5J2K A;  3H3A A;  4FO6 A;  5DBB A;  5J0Q A;  3RJG A;  1XSL A;  4WC0 A;  3PML A;  4R66 A;  3PNC A;  2ZH6 A;  4O5C A;  9ICI A;  3AQL A;  4NLN A;  4R65 A;  5HRG A;  2PXI A;  4K4H A;  2IUB A;  4K99 A;  4RQ0 A;  2BCS A;  2GA9 D;  4JLX A;  3WFO A;  5J0S A;  4QZF A;  3UXN A;  1BPX A;  7ICL A;  9ICO A;  5BOL A;  4M2Y A;  4M9G A;  1ZQM A;  7ICN A;  4WC3 A;  7ICO A; 
#chains in the Genus database with same CATH homology
 4M47 A;  4DOB A;  4TUQ A;  4F5N A;  1Q78 A;  2NRK A;  5HRL A;  9ICS A;  4DOA A;  3TFR A;  2PFQ A;  8ICP A;  4I27 A;  4AT7 A;  2BPC A;  4X4Q A;  3HJ4 A;  1KEJ A;  1JN3 A;  2ISP A;  1ZQK A;  2DVI A;  5J0W A;  3HWT A;  1RZT A;  4X0B A;  3MGI A;  4KLF A;  2ZH2 A;  2PFO A;  9ICC A;  4FHV A;  1JMS A;  1TFY A;  4XUS A;  7ICK A;  5CHG A;  5CR0 A;  4GXJ A;  1UEU A;  1ZQD A;  8ICA A;  1ZQH A;  7ICR A;  5IIL A;  5DED A;  9ICX A;  7ICV A;  3RH6 A;  1ZQZ A;  3AQK A;  4UBB A;  4MFF A;  5DDM A;  3RJJ A;  5J2A A;  3RJI A;  8ICC A;  3C5F A;  4KLH A;  2BCU A;  1KDH A;  1FA0 A;  4UD5 A;  2HHP A;  3AUO A;  2M2W A;  4NKU A;  5HRF A;  8ICW A;  4XQ8 A;  4I2H A;  4QZH A;  1MQ2 A;  4QZE A;  1JAJ A;  4UAY A;  4I28 A;  8ICE A;  8ICL A;  4NM2 A;  4I29 A;  1ZQS A;  2PBE A;  2ZH4 A;  1BPZ A;  7ICT A;  1XSP A;  4NY8 A;  3UXO A;  4QZC A;  1MIY A;  4WC2 A;  3AQM A;  3RH4 A;  1R8C A;  4RWP A;  4QZ8 A;  4WC4 A;  1ZQF A;  1OU5 A;  4EBJ A;  5IIN A;  1ZQQ A;  3LK9 A;  4F5P A;  4RWN A;  7ICM A;  4X4P A;  4IQV A;  4QZ9 A;  1ZQU A;  4NM1 A;  5DEC A;  4X4S A;  5D46 A;  4UD4 A;  3RJK A;  5HRK A;  3RJF A;  4P2H A;  7ICQ A;  3B0Y A;  3JPO A;  3UPS A;  5DB8 A;  1MIW A;  4O5K A;  5CA7 A;  4KLE A;  1R89 A;  3MGH A;  3OGU A;  4PHP A;  5DKW A;  2O5A A;  5J2E A;  4M9J A;  8ICG A;  4X4V A;  4TUP A;  4R63 A;  3UQ2 A;  1BPE A;  4UAZ A;  3JPP A;  4Z6F A;  3AU2 A;  3L9D A;  4FHP A;  4WCW A;  3H39 A;  3WFS C;  4YMN A;  2M2T A;  9ICN A;  3OV7 A;  5HRH A;  4KLQ A;  7ICF A;  8ICS A;  4WBZ A;  4ATB B;  4UB2 A;  2I9G A;  4WBY A;  5J2F A;  4WC5 A;  2ZHB A;  5HRI A;  4UAW A;  3MDA A;  2ZH7 A;  4LZD A;  4F5O A;  8ICN A;  4XQ7 A;  9ICR A;  4M5D A;  4LZG A;  4MF2 A;  4X4O A;  8ICU A;  3OVB A;  5BPC A;  4NKT A;  1ZJN A;  3RJE A;  3JPN A;  2BCQ A;  4DO9 A;  1ZQJ A;  3OVS A;  5HHI A;  5HC9 A;  9ICW A;  8ICT A;  2BPG A;  9ICB A;  9ICT A;  2O1P A;  4I2F A;  4XA5 A;  5J2G A;  9ICK A;  5TZV A;  2BPF A;  2FMP A;  5EOZ A;  1VFG A;  5HHH A;  5DBC A;  4X4T A;  2ZHA A;  4PH5 A;  4RWO A;  4PGQ A;  4PGY A;  1R8B A;  5IIK A;  1ZQC A;  9ICJ A;  4DOC A;  5J2D A;  5DB6 A;  9ICF A;  4I2I A;  3MBY A;  1JQR A;  3H38 A;  1ZQN A;  5CP2 A;  5J29 A;  4YMO A;  3GDX A;  3H37 A;  4LVS A;  4QZA A;  4PHE A;  1HUZ A;  2DRB A;  4GXI A;  4YD1 A;  8ICF A;  8ICR A;  3TFS A;  5J2C A;  4QZI A;  1KNY A;  3OUY B;  2BE3 A;  1ZQB A;  4KLL A;  4I2D A;  3MDC A;  1BPY A;  8ICO A;  9ICQ A;  7ICU A;  2VAN A;  4E80 A;  4NLK A;  4Z6C A;  1HUO A;  4YN4 A;  3HX0 A;  3K75 D;  5J0T A;  2GWS A;  8ICX A;  4I2G A;  3UPQ A;  1V4A A;  5J0Y A;  3JYY A;  1ZQR A;  8ICJ A;  4P4O A;  4K4G A;  4KLM A;  4R64 A;  9ICP A;  1TFW A;  1ZQG A;  4RQ6 A;  4M0A A;  1BPB A;  1ZQT A;  1ZQP A;  3B0X A;  1ZQL A;  3V7L A;  1XSN A;  5J2B A;  1ZJM A;  4RWQ A;  4QZB A;  1YLQ A;  4TUR A;  3AQN A;  2DR5 A;  3ISD A;  8ICQ A;  5D4B A;  4M04 A;  7ICE A;  2DR7 A;  4S3N A;  4X0A A;  4YCX A;  4UB4 A;  4AT9 B;  4KLJ A;  3V7K A;  4ATB A;  3JPS A;  1ZQV A;  5III A;  9ICV A;  4PGX A;  9ICE A;  3AU6 A;  1F5A A;  1NO5 A;  5CJ7 A;  1Q79 A;  2W9M A;  4RQ8 A;  3WFQ E;  2ZH5 A;  4RT3 A;  4IG8 A;  9ICL A;  4M9N A;  3C5G A;  1ZQW A;  1UEV A;  4AT8 B;  3RJH A;  4PPX A;  1BPD A;  4KLS A;  4I2J A;  4EP7 A;  4WC6 A;  1R8A A;  1WOT A;  2FMS A;  4X4R A;  4Z6E A;  2P66 A;  4RQ4 A;  9ICH A;  4F5Q A;  4E7X A;  4WC7 A;  4IQT A;  4Z6D A;  4RPY A;  5HRD A;  3C2M A;  4MFC A;  5DDY A;  3PMN A;  4FHW A;  2ISO A;  3JPT A;  4RQ3 A;  1ZQE A;  7ICI A;  5DB9 A;  1ZQX A;  3RH5 A;  7ICJ A;  4JWM A;  8ICM A;  4KLG A;  2PFN A;  5D49 A;  7ICH A;  4WC1 A;  7ICG A;  3V72 A;  5DBA A;  2RFF A;  3C2L A;  4FHX A;  4RQ1 A;  9ICM A;  4P4P A;  4XRH A;  2BCR A;  5J2I A;  4KLU A;  4X4U A;  4YD2 A;  3UXP A;  4O5E A;  5DB7 A;  4RPX A;  5F2V O;  5IIJ A;  3C66 A;  4AT7 B;  4IQW A;  1VJ7 A;  3OUY A;  4RPZ A;  1TV9 A;  1MIV A;  5CB1 A;  4F5R A;  4IQU A;  2ZH3 A;  2DR9 A;  4KLI A;  4RT2 A;  4MFA A;  4M9L A;  4UB1 A;  4JWN A;  9ICA A;  4UBC A;  3NYB A;  4FHY A;  4YMM A;  3C18 A;  4UB3 A;  5HRE A;  5HRB A;  1RPL A;  9ICG A;  3HW8 A;  2ZH1 A;  5IIM A;  4I2C A;  1ZQI A;  4I2B A;  2PFP A;  4P4M A;  2BCV A;  8ICY A;  1MQ3 A;  3OVA A;  2ZH8 A;  4GXK A;  4O9M A;  3HJ1 A;  4RQ2 A;  8ICK A;  5J0P A;  3JPR A;  5HR9 A;  5J0U A;  7ICP A;  2Q66 A;  3LQC B;  3ISC A;  2FMQ A;  4LT6 A;  5J0R A;  3HIY A;  3JZ0 A;  4MF8 A;  5J2H A;  8ICH A;  2ID1 A;  2M2V A;  4AT9 A;  4I2E A;  5J0X A;  4QZD A;  2DRA A;  3V7J A;  4KLD A;  4NXZ A;  3UQ0 A;  8ICZ A;  4X5V A;  4FH5 A;  5J2J A;  3C2K A;  4E8F A;  3ISB A;  1ZQY A;  4PHA A;  4FH3 A;  4M9H A;  1ZQA A;  4PHD A;  5J0O A;  4X4N A;  1UET A;  4QZG A;  3WFP A;  8ICB A;  4AT8 A;  5CWR A;  2ZH9 A;  4I2A A;  4NLZ A;  2DR8 A;  4RQ7 A;  3WFR E;  1NOM A;  5BOM A;  4TUS A;  2IHM A;  1PX5 A;  1TVA A;  4RQ5 A;  5IIO A;  8ICV A;  9ICU A;  4EBK A;  4UB5 A;  1ZQO A;  7ICS A;  4K4I A;  8ICI A;  2M2U A;  4KLO A;  3JPQ A;  4KLT A;  5J2K A;  3H3A A;  4FO6 A;  5DBB A;  5J0Q A;  3RJG A;  1XSL A;  4WC0 A;  3PML A;  4R66 A;  3PNC A;  2ZH6 A;  4O5C A;  9ICI A;  3AQL A;  4NLN A;  4R65 A;  5HRG A;  2PXI A;  4K4H A;  2BCS A;  4RQ0 A;  4QZF A;  3WFO A;  5J0S A;  1BPX A;  3UXN A;  7ICL A;  9ICO A;  5BOL A;  4M2Y A;  4M9G A;  1ZQM A;  7ICN A;  4WC3 A;  7ICO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...