3L9DA

The crystal structure of smu.1046c from streptococcus mutans ua159
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
198
Chain Sequence
b'MNWEEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINNKPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GTP pyrophosphokinase
publication title The Crystal Structure of smu.1046c from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 69
structure length 198
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 3l9dA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3l9dA01
4QZFA 2FMPA 2DR8A 3RH6A 4NKUA 4M04A 2BE3A 3ISBA 5DBBA 1TFYA 7ICUA 4Z6FA 4P4MA 4FHXA 4E8FA 4UD4A 4JWMA 4UAWA 4MFAA 3RJJA 4WC3A 8ICHA 5IIIA 1JMSA 4FH3A 1ZQIA 9ICPA 9ICUA 4UAZA 1WOTA 4UAYA 2BCUA 3AUOA 7ICJA 4LT6A 3H38A 1MQ2A 5J0OA 1BPDA 5J2JA 5DBAA 4RPYA 1ZQFA 4R64A 9ICGA 3RJFA 3K75D 1MQ3A 9ICVA 4KLEA 7ICKA 4WC4A 1ZJNA 4M5DA 3WFRE 5J2GA 5HRLA 4UB5A 1RZTA 1PX5A 3B0YA 7ICEA 2I9GA 3MDCA 5J2DA 2DR7A 3RJHA 3UQ2A 4KLGA 8ICIA 4M9HA 4QZDA 5CP2A 1ZQZA 1XSPA 3ISDA 2GWSA 5DDMA 7ICHA 4Z6CA 1ZQXA 3C18A 5J29A 1TV9A 1ZQHA 9ICJA 4KLLA 2DRBA 8ICLA 4RT2A 3JPSA 1ZJMA 4TUPA 7ICFA 4QZGA 1ZQPA 3H39A 4S3NA 4I2FA 4XQ7A 5BOMA 3C2KA 2NRKA 3JYYA 4X4OA 4R63A 9ICBA 1KDHA 4KLHA 4M47A 1ZQRA 8ICBA 5HRHA 4QZHA 5HRDA 9ICXA 7ICVA 9ICHA 3V7LA 3WFSC 2ZH4A 3RJGA 4PGQA 5D4BA 7ICPA 8ICXA 1NOMA 3JPQA 4KLIA 7ICRA 2HHPA 5J2CA 4M9GA 4WC6A 4YD1A 4UB3A 4M2YA 3C2MA 4R66A 4K4IA 1V4AA 2ID1A 5J0WA 2P66A 9ICAA 3L9DA 4I28A 3WFOA 5J0RA 8ICJA 2BCVA 4XUSA 3V72A 7ICNA 1ZQNA 1UETA 1ZQCA 1ZQQA 1R89A 1ZQYA 9ICLA 3TFSA 1NO5A 3JPNA 4AT9B 2O1PA 1JAJA 9ICOA 4WBZA 3UXPA 3WFPA 4RQ2A 4DO9A 4KLFA 3AQKA 5EOZA 5DB7A 4M9LA 3TFRA 4FH5A 2RFFA 3UPQA 4I2EA 3JPOA 3OVBA 8ICOA 5D49A 4I2DA 3UQ0A 4KLSA 1RPLA 2DVIA 1UEUA 5DDYA 1YLQA 3MDAA 1HUOA 3JPRA 2ZH2A 8ICFA 8ICRA 4EBKA 1ZQEA 4I29A 4YN4A 5IIOA 4PGYA 4WC7A 3RH4A 9ICSA 5J0QA 3RJKA 5J2FA 2ISPA 4MF2A 1R8CA 4RWNA 1ZQAA 5F2VO 4YMMA 5J0UA 2ZH3A 3NYBA 2M2TA 2ZH8A 3C2LA 3HJ4A 4JWNA 3OVAA 1BPBA 4KLTA 3H37A 4WBYA 4NLNA 3HJ1A 4AT7B 3RJEA 4NKTA 1ZQTA 2DRAA 4RT3A 5CA7A 4PHEA 4FHWA 4MF8A 1R8AA 4PHAA 4X4QA 5HC9A 1VJ7A 7ICLA 8ICNA 4O9MA 2PFOA 3B0XA 5J0PA 4I2CA 1VFGA 9ICEA 2VANA 9ICRA 8ICZA 5CHGA 4NM1A 4KLMA 4X0AA 5CR0A 8ICCA 4I2HA 4M0AA 1BPZA 4NY8A 3JZ0A 5DB8A 2ZH6A 4PGXA 9ICMA 4K4HA 2PFQA 5DKWA 5J2IA 5IIMA 4TUSA 5BOLA 2FMQA 5HHIA 2W9MA 3AQLA 1BPEA 4RWPA 4PPXA 1ZQGA 7ICSA 5J0SA 5DECA 4KLOA 5HRFA 4QZCA 4QZ8A 5HRIA 8ICSA 3AQMA 1TVAA 2PXIA 8ICUA 5IILA 3HWTA 4FO6A 4O5EA 2M2VA 1ZQDA 5HREA 1MIVA 4UB4A 5J2BA 2BPFA 5CJ7A 1Q79A 5CB1A 5HR9A 4UBCA 5J2KA 1ZQBA 3AU2A 3JPTA 3OGUA 3C5FA 5HRKA 3AU6A 2ZH7A 3WFQE 4QZ9A 1XSLA 4ATBB 4IQVA 4TUQA 3V7JA 4X4VA 7ICTA 1ZQSA 4IQUA 9ICKA 3OVSA 9ICWA 4MFCA 4IG8A 9ICQA 3AQNA 4RQ1A 4AT8B 4YD2A 4I2JA 2BCSA 3UXNA 2DR5A 7ICOA 4NLKA 5IIJA 3C66A 3MBYA 4F5RA 2BPGA 8ICYA 4KLJA 4NLZA 8ICMA 4K4GA 4O5CA 4WC2A 5IINA 1JQRA 4DOCA 5BPCA 1TFWA 4LZDA 4RQ6A 4PH5A 4DOBA 8ICVA 4X4PA 8ICKA 5IIKA 4XQ8A 8ICWA 5J0TA 3ISCA 3RH5A 4UD5A 4XRHA 4GXIA 1ZQWA 1ZQVA 1OU5A 4EP7A 4I2GA 3PNCA 5DEDA 1XSNA 3HX0A 4DOAA 4X0BA 4QZIA 4R65A 4NM2A 4YMOA 4KLDA 4XA5A 4UBBA 4GXJA 4QZBA 1ZQMA 4I27A 4WCWA 4KLUA 5J0YA 4F5NA 4X4NA 2BCRA 4RPZA 4AT9A 4ATBA 5J0XA 3OV7A 5HRGA 2DR9A 2PFPA 4PHPA 9ICFA 4RQ3A 3OUYB 3H3AA 5D46A 1FA0A 1UEVA 4RPXA 4QZAA 4I2AA 2ZH1A 4AT8A 9ICTA 5J2AA 4PHDA 4E7XA 3MGHA 7ICMA 2BPCA 8ICEA 4FHVA 3UXOA 4NXZA 1ZQOA 1BPXA 1BPYA 5DBCA 1HUZA 4P4OA 5DB6A 2FMSA 2PFNA 8ICTA 4RWQA 3PMNA 3LK9A 3C5GA 4UB1A 9ICCA 4X4RA 4I2IA 1KNYA 4O5KA 2M2UA 4LZGA 4LVSA 5CWRA 1F5AA 1ZQJA 1MIYA 4RQ8A 2BCQA 4P4PA 3HIYA 4QZEA 4KLQA 4F5QA 4I2BA 4EBJA 3RJIA 3GDXA 2ZHAA 4P2HA 7ICGA 4RQ7A 4AT7A 4M9NA 4RQ5A 4WC0A 1MIWA 2PBEA 1ZQLA 4M9JA 5HHHA 4YMNA 3PMLA 4X5VA 3UPSA 7ICIA 4UB2A 4FHYA 3LQCB 4RWOA 4X4SA 4F5PA 5DB9A 1ZQUA 2ZH9A 4X4TA 2IHMA 3V7KA 4MFFA 4WC5A 2Q66A 8ICQA 4X4UA 3OUYA 9ICIA 4YCXA 5J2EA 4E80A 7ICQA 1R8BA 4RQ0A 4IQTA 2ZH5A 1ZQKA 9ICNA 4WC1A 4Z6EA 5HRBA 2M2WA 4F5OA 4TURA 4IQWA 4FHPA 4GXKA 1Q78A 8ICGA 3JPPA 8ICPA 3HW8A 5TZVA 8ICAA 1KEJA 2ZHBA 1JN3A 2ISOA 4RQ4A 4Z6DA 2O5AA 5J2HA 3MGIA
chains in the Genus database with same CATH superfamily
5IY5B 1JOYA 4QZFA 5CA0A 3RH6A 4NKUA 2EIMC 2KG7A 4O4LA 3OM3B 5DBBA 3RBZA 7ICUA 3X2QB 3SPJA 5IJ0B 2F4VO 2NNUA 3ZRWB 2OTJV 3OEHG 4UAWA 1RM1B 3LSQA 4K99A 3RJJA 4MS2A 4JI7B 4FH3A 3BABA 3FB7C 1K4DC 4K0KB 4J9ZB 5CFTA 1KKCA 1K33A 4UAYA 5BMVB 2B9ZA 1FFXA 2RNBA 2IH1C 1PP9H 3AG4B 4OX9B 4YJ2B 1MQ2A 4UCVA 1GRJA 2IU3A 1ZQFA 4O2BB 1ZJNA 3RVZA 4XBFA 3RVYA 2Q4PA 4UB5A 4LF5B 3OGIB 2YUAA 1URFA 2CTRA 5K1XA 4ZKIA 4KLGA 3DSQA 3JCZA 4JI1B 4UB8Z 3ABMC 5CP2A 1P4RA 3CMEV 5EBWC 1SS3A 1ZQZA 1DF5A 2GWSA 4I50A 4JI7O 5EYPB 3TJTA 4Z6CA 2UXBB 4K0KO 4MVOA 2BTQB 1D5AA 3JAKB 2Q0OC 5J29A 3NR7A 4OX9O 1QBZA 4PELA 4S3NA 3ML0A 4UV8A 5IJ0A 5BOMA 3HKEB 5LXTA 4DXWA 4LF6B 2JDIG 2OT5A 4X1IB 4LF5O 1BSMA 4DV6O 4JV5B 4X4OA 3ZRWA 1YSCA 5EC2C 1IURA 4HYOA 2IJIA 2LQTA 4JI1O 8ICBA 4ABMA 2JGUA 3EVKA 3K5LA 1M57B 9ICXA 2PF4E 2KSDA 3DTUB 3CCJV 1N8RW 5BMVA 4H44B 5LP6A 1M5IA 2UXBO 2ZH4A 4G28B 8ICXA 2DYRC 3E8GA 2EINC 4O4JB 4YD1A 4WC6A 4WFHA 2QEXV 1Q7YW 2F1MA 2FYUH 2Q68A 9ICAA 3G6EV 1AR4A 2A06H 3WFOA 5J0RA 1P49A 4CH3A 2PYLA 1VQNV 8ICJA 1FFTB 5H5NA 7ICNA 3ZMZA 4J80A 2W6IG 1BHBA 4JAUA 1G6UA 1R89A 3N2KB 2L35A 1NI8A 3JAKA 4I7ZB 9ICLA 3TFSA 1NO5A 1BZKA 2RMKB 2ARHA 3CP1A 4WFFA 1ZTEA 1YIJV 3WFPA 1FXHA 4WFBV 3CK6A 1ZX3A 4FZ0A 5DB7A 3TFRA 3EF2A 4CS3A 3UPQA 3JPOA 3VQXA 5D49A 1GN6A 5J2TB 4ICGA 3E8FA 1M56C 5CMUA 4DR3B 1YLQA 3JPRA 2R72A 1TVKB 4X1KA 3ZMUA 5LL6Y 1H2NA 1JA8A 1G4YB 4EBKA 2XOKG 4I29A 4YN4A 4DUYB 5IIOA 1PNKA 5KAIZ 4PGYA 4CS4A 4WC7A 4TV8A 3UO3A 4O4JA 4H13B 3CC4V 5J2FA 3ZJZA 4RWNA 3CCVV 4YMMA 5J0UA 2LFSA 3C2LA 4I0XB 2UUCO 3ZMTA 4LBEC 3HJ1A 4JI2B 3U11A 4KB6A 4DR3O 2DRAA 1F23A 3SR2C 2EILC 5CA7A 3M99B 3IGAC 4C7UA 2VRZA 4FK5C 4MF8A 4QIWF 3H9VA 3OMNB 2D2CB 3ASNC 4NVPA 3SJBC 4DUYO 7ICLA 4AHCA 8ICNA 5IT9N 4O9MA 4DUZO 4FLWA 3A0RA 3ZX6A 1YEWA 1B6QA 9ICRA 8ICZA 5CHGA 3J7AU 1XI1A 2BBJA 4X0AA 4I2HA 2LGQA 5J2TA 3QO5A 3UCSC 2FKXA 1W59A 2CH7B 1FJGB 2Y4UA 4NY8A 1QLEC 3QF7A 2CK3G 4Q6GA 5DB8A 1TVKA 3CEIA 4KL1A 9ICMA 4NXTA 4K4HA 1H2GA 4LNUA 1SA0A 3RFRA 1H2KA 5IYZA 5LOVB 2C2AA 1O9GA 5BOLA 1KECA 2ZKOA 2CGOA 4GYCB 2LFRA 2YIBA 2Q9LA 4OPAA 2W9MA 1BPEA 2VQEB 4FZ1A 4J7JA 4TV9B 5J0SA 4JZ2A 5LP6C 2Y0PA 4L8JA 1DTOA 5HFMA 4UUJC 4EEQA 4ZHQB 5CA3A 5IJ9B 3AQMA 3STLC 2CAZC 4F6RB 4K8ZA 3JSNA 1RPOA 3HWTA 1ZQDA 4OAHA 3WG7C 2KKWA 3CMAV 1P7BA 3HKCB 4WH5A 1N0JA 4XDKA 2ZIMA 1Q3EA 4UBCA 1SETA 3N2GB 5L3FA 4MVUA 1ZQBA 3JPTA 2ETNA 1F51A 2QWRB 4FJCC 1EM1A 2HVKC 1B3QA 2CTPA 4IL6Z 2FB5A 4LF8B 2AZ0A 2VQEO 4ATBB 3LDDA 4IQVA 4LFAO 1NKDA 2ZQMA 2F23A 1XNQB 7ICTA 3ABTA 3L70H 3OTFA 4IIJB 2K9PA 9ICKA 9ICWA 5D63A 3JSLA 1NH2B 4MFCA 1GO3F 2P67A 1N0NA 4RQ1A 1TUEB 1SESA 4I2JA 4U3FH 7ICOA 1AI5A 4EB6B 1W2BU 2HFEC 5LMNO 4F5RA 8ICYA 2LW7A 1OCOB 3OMAB 2ZINA 4J41A 3EXAA 3FFQA 4DOCA 1VARA 4TV9A 4OXSA 4RQ6A 3DC5A 8ICKA 2ZR2A 4UCRA 5IJ9A 4BWAA 1AJPA 1XNQO 4Z2WA 1WB7A 1V55B 4F6RA 4OAGA 2GUZB 4BIZA 1ZQWA 4EEBA 5EZYB 1OU5A 2HR3A 1DLBA 2WAMA 2YXHA 1M93A 3HKCA 3HX0A 1WAZA 3N2GA 4RWUA 3APQA 4YMOA 5KA6A 3K3WA 1ZQMA 4I27A 2Y69B 5J0YA 2B51A 4NXVA 4RPZA 4OGQB 4AT9A 4NXUA 3OUSA 4ATBA 2DR9A 4JI5B 2EZPA 2X6BA 2AHYA 3ZS8C 9ICFA 3QVNA 1I08A 3VBBA 4IIJA 1RFYA 1BCCH 2MW2B 3CJHB 4RPXA 1NH2D 2ZM6B 1R3IC 3HR0A 2QTOA 3R66A 1FS0G 2QM8A 4B7EA 4I2AA 4FFBB 4B3RO 4W4LA 4DR5B 3FAVB 4E7XA 3UKMA 2CE4A 1G1XB 4FHVA 3UXOA 3BRCA 1Q6UA 3OR7C 2GAFD 2RQ6A 2UU9B 4KHPB 3GB7C 3A0HZ 4GT1A 5FLXN 4O4IB 1DF4A 2N74A 2WA4A 8ICTA 3PMNA 3LK9A 5B5EZ 4I2IA 4DV5B 2WLLB 3ZHVA 4O5KA 5B1BC 2M2UA 4LZGA 4JI5O 3SJCC 2P7TC 3K0GA 1Y74B 1H8EG 3TETA 2VWKA 4FLTA 4QZEA 4KLQA 5EZYA 1PL4A 2EIMB 4DR5O 4WQLA 4M9NA 4PI0A 4TSFG 4WBNB 2PBEA 3UPSA 7ICIA 4UB2A 2X0LA 4QPKA 1HW7A 2UU9O 2ZR3A 3LQCB 4KHPO 3I5DA 4X20B 5DB9A 1ENVA 5GW7A 2ZH9A 3SPGA 3K5OA 4GKJB 1VIBA 1HNZB 4PA9A 4CH6A 4DV5O 2A9HA 1S0VA 1FXKB 4E80A 1U96A 3CJHA 1R8BA 4JI3B 5JWPA 4DR4O 3CC7V 4FFBA 1I94O 3FAVA 2IW5A 5B1NA 4Z6EA 1Q5OA 5JQGB 5CA1B 4F5OA 1EBOA 5DN6G 3E89A 3CRQA 3IAYA 4DYLA 8ICGA 1R3KC 3JPPA 4GZRB 4MSWC 4DK0A 1Y4MA 4DV4B 3SYCA 4O4IA 5J2HA 1I0HA 2EIKC 4GX1A 2HN2A 4JZGA 2A79B 2X6CA 1VF7A 1WP7A 1YITV 4LWSB 1HNZO 4D7TA 1GK9A 1BS3A 5B1AB 5IDJA 4EV6A 4FM1A 4UXNA 4MFAA 1MSDA 1SERA 5IIIA 4FLXA 1ZQIA 2HLDG 3K06A 1MSWD 4NXXA 2BCUA 5JH7B 3AUOA 4KM5A 2JGDB 5J0OA 3NVOA 1I7FA 2ADQB 1AI6A 1LNQA 2ADPA 5FNVB 1MQ3A 9ICVA 4KLEA 4WC4A 3WFRE 2EBOA 2L6LA 4FFKA 2VQFO 1YXBA 3MDCA 1RSOB 2DR7A 2CTWA 1NU1H 3MD0A 4H0LB 3SYPA 8ICIA 1G8MA 2DYRB 4M9HA 4B3SB 2H8PC 3ABUA 5JQGA 4QZDA 2EINB 3CCUV 2K1EA 5CN0A 1UPGA 2EWRA 7ICHA 1ZQXA 5JVDB 1HNWB 2DYSC 3JAMN 3GWOA 5FL7G 4I55A 1TV9A 2GTSA 4R7CA 2DRBA 2XASA 1SQXH 3JPSA 1DK1A 4NXMB 1D2DA 1ZJMA 3H01A 4JPRA 1ZQPA 1VF6C 3ZMVA 1Q8IA 3CCSV 4X89A 3O65A 1K5SA 2H94A 3JYYA 2XHBA 1YTFB 1ZLZA 2AHZA 1FXVA 2BSKB 4B3SO 3UT5B 4UCSA 4Z1VA 7ICVA 1E1RG 1WP8A 2DWEC 3WFSC 5JH7A 4PDVA 2JGDA 4MTOA 1HNWO 4JLZA 3RJGA 1I5YA 5D4BA 1K4CC 4PA6A 1WN7A 4LH6A 4X66O 4LF9B 3JPQA 3OT7A 5FNVA 2HHPA 4EEDA 5IE9A 4UB3A 2ZCEA 3C2MA 2ID1A 1SZTA 4LFCB 2Q67A 5A9GA 1S77D 5J0WA 2P66A 1RSOA 3E22B 4HX0A 4D6TH 3FYEB 3APOA 1QU7A 1NJIW 4XUSA 3V72A 1XL6A 1ZQNA 2QKAA 3J80N 1VP7A 1ZQYA 2EZOA 5AG2A 3FX7A 1PL0A 5BXZA 4MKPA 1CEZA 2O1PA 1H38A 1IBLB 1JAJA 2N04A 1OCCB 4WBZA 4RQ2A 3HKDA 4LF9O 1JFFA 4KLFA 4DV2O 5EOZA 5JTGA 2OCCB 1PD3A 3TXSA 3SJAC 4FH5A 3QG5A 1S5LZ 2RFFA 2FTKA 3UQ0A 1YTFD 4JYCA 4R6ZA 2IH3C 5A2QN 2BSKA 4MVSA 4NYKA 1N32O 5DDYA 1HUOA 3HKBB 4JGSA 1ZWIC 2ZH2A 8ICRA 4X9QA 4IGGA 4MW8A 4W4KA 1ZQEA 4K3AA 2ZDIC 4DRXB 4TUYB 4X1YB 1QLNA 4WFEA 2H3OA 1SQPH 2ISPA 1R8CA 1RPRA 1ZQAA 5GTHZ 2P06A 2ZH3A 1JQ0A 3NYBA 3EFFK 2HKOA 2M2TA 3HJ4A 3BY6A 4KLTA 1YDXA 3H37A 4WBYA 4NLNA 1VQPV 4Q20A 1ZQTA 1JJOA 1HP8A 3K9AA 1P84F 2X6AA 4LF7B 2P4VA 2YXYA 3WG7B 4LFBB 1Q82W 3B0XA 2XAFA 2QDOA 2CUGA 3MAQA 4I2CA 5KUKA 1EN5A 2LW1A 1GAXA 1XEQA 1NTMH 4B3TB 3K57A 1K97A 1K34A 1KKDA 3UQ8A 2O57A 4PGXA 2YIAA 2EJRA 4PJ0Z 5DKWA 4TUSA 3W7SA 4LF7O 3ICXA 5HHIA 4TUYA 4X1YA 2VS0A 5H9CA 4YJ2A 3B8NA 4IHJB 4MTGA 2Q6AA 4ZOLB 4RWPA 4PPXA 3ABLC 4CBCA 3NWIA 3L72H 7ICSA 4O2BA 3FYIB 2KQXA 5LMUB 5KHKA 3AG1B 3JASB 4PV1B 3CWBH 5HRFA 4DR1B 4QZ8A 1TVAA 2PXIA 4R50A 3QO7A 5LGTA 4B3TO 3K9SA 2ITDC 2RJZA 3CHXA 5IYDO 4LF6O 4JV5O 4UB4A 5J2BA 2ODMA 1VQ6V 1LUVA 5CB1A 5J2KA 4DW1A 3AU2A 5CB4B 5EYPA 3OGUA 5EIBC 5HRKA 1FD9A 2BTQA 2XAHA 3AU6A 4CS2A 2F95B 2ZH7A 3WFQE 5FPOA 3MHHC 4QZ9A 1XSLA 2EIJC 1BMFG 5B3SC 5EBLC 5C8YB 4I9WA 2CDYA 4X4VA 2QKCA 5LMUO 1JMKC 1ZQSA 1VQ5V 3VQVA 4HNAB 3F7YC 3HKEA 2BOBC 1Q86W 2WA3A 3OVSA 4X1IA 4O68A 3AQNA 4ZBMA 3SGIA 4AT8B 4YD2A 3TGUH 2IHOA 4CC5A 1KB9F 4RUFA 1AVMA 1SQBH 5CHEA 1N36B 2BPGA 5BR8B 4NLZA 2FCLA 1GTOA 3UM7A 4WC2A 2AGAA 4JF3A 4IHJA 2E3CA 4ZOLA 1K7DA 1JQRA 3FB8C 1XMOB 3CX5F 1TFWA 3RYCB 4LZDA 1V54C 3JASA 2D3OW 4MTXA 3OMIB 5IIKA 8ICWA 5J0TA 3ISCA 4UVBA 4XRHA 1ORQC 3AG7A 1ZQVA 4EP7A 4I2GA 3ABKB 3PNCA 2JEXA 2JS3A 4UCUA 3PHZA 1WNSA 1K73W 3RT3C 3K0DA 4NM2A 1ZUQA 3ETDA 4XA5A 3IC7A 3N2KA 1N36O 4WCWA 2OCHA 3D36A 2P5OA 5BR8O 2BCRA 5L3BA 1BQ0A 3KG2A 2F93B 4JYYA 1OCZB 3I55V 2P4KA 5HRGA 1XMOO 5IYBO 2Y48A 3OUYB 3STZC 3H3AA 2DN9A 4LCUC 1UEVA 1M1KW 2PI5A 4EGWA 5D5PA 1NVPB 2ZH1A 5LHGA 4AT8A 3TK1A 4PHDA 1NBMG 2HJFC 8ICEA 4MVRA 5J2UB 2YXLA 2BBHA 4WQKA 3X2QC 1OV9A 3SPIA 4NXZA 5KHHA 1FKAO 1ZQOA 1YJ9V 5D61A 4JI2O 3RYFB 4I5SA 2YI8A 1BPYA 5DBCA 1HUZA 1QQCA 4P4OA 3JALB 4O6AA 1NS1A 1RM1C 2DJVA 3B8MA 4XDJA 1WJZA 1E79G 1XOUA 4BAYA 2AZ2A 4ZI7B 2XAJA 1SKVA 3ZHRA 5KMGB 4K9AA 1VQMV 4JI4B 4J7ZA 3P32A 1SQQH 2YICA 4DK1A 1MG1A 1MIYA 4RQ8A 4FLVA 2BCQA 3AG4C 5JJNB 1Q6IA 3AG2B 4P4PA 2WLMA 4I0XA 1TA8A 4EBJA 2UXCB 1T5EA 1SQVH 3HPLC 1YJWV 1YZBA 2ZHAA 1K9MW 4JAVA 1FJGO 4WC0A 4ASUG 1MIWA 1GH6A 2V1DA 3PMLA 2PTMA 1AI4A 4GX2A 3TXQA 1SQGA 2EX3A 1VQ4V 2ZXWB 3FD9A 4RWOA 1O9HA 2GDSA 3L71H 2R9RB 1AJNA 5EBMC 2IHMA 4UFZA 1EN6A 4MFFA 4GUNA 4WC5A 2Q66A 8ICQA 1KYOF 4JI6B 4X62B 4I4TB 3OUYA 1YF2A 5J2EA 7ICQA 2NR5A 1TGOA 4RQ0A 4FLUA 5L3EA 1NVPD 1MZFA 5LHIA 4FM2A 2CH7A 4WC1A 2HEPA 2QWQB 3B77A 2M2WA 4TURA 4IQWA 2UXCO 3J81N 4GXKA 1KP2A 3T1HB 1Q78A 3LNMB 4D7SA 3ERCC 3HW8A 8ICAA 4U7OA 3JALA 3IJ4A 2ZHBA 1ROPA 5LOVA 2OIEA 1JN3A 4RQ4A 4Z6DA 2ISOA 1NTZH 4BW9A 2Q7GA 1GM8A 1M57C 2OYQA 2DR8A 2FMPA 2BE3A 3ISBA 5FPRA 4JTCB 1XREA 2W0XA 3L75H 2YS8A 4LF8O 4ZHQA 4P4MA 2WLNA 1BHAA 2P22C 5E1AC 4E8FA 4JWMA 3SYQA 1THZA 4LR3A 1BE3H 4WC3A 4FLYA 8ICHA 1JMSA 1CXZB 1R6TA 4F6EA 4A5UB 3W7XA 9ICUA 3T1HO 2BCCH 2DOSA 7ICJA 3C90A 4LT6A 3KCYA 3ETGA 3K58A 3E86A 9ICGA 3K75D 7ICKA 5J2GA 1FAFA 5HRLA 1RZTA 4IYHA 3D36C 2R9AA 1PX5A 3B0YA 3VOUA 7ICEA 2I9GA 3RJHA 4TQDA 1TAEA 3BA9A 5LA6B 3ZN0A 3Q4HA 4DV1B 2YEVB 5GONB 4JYBA 1XSPA 3MHSC 3DGEA 5DDMA 5IWAB 3D3QA 1J5EB 4EB6A 5KHJA 1Q90D 1ZQHA 3ASOC 3OR6C 4QZGA 2GBOA 2Q0AA 3H39A 1VQKV 4MT8A 4I2FA 4XQ7A 2LGWA 2QWOB 3FKSG 2NRKA 3QO8A 5K1PA 1W0KG 4R63A 4WFGA 9ICBA 1F4NA 3BVOA 4KLHA 4O2AB 4M47A 3WB1A 2GUZA 1ZQRA 1HWYA 5HRHA 5JCOA 2ZM6O 4NXWA 3JD2A 4DV1O 5HRDA 1QVGU 4JLXA 3V7LA 1BT8A 3E8BA 1J5EO 4QJFB 5L3CA 2ZE6A 2UXDB 4AQYB 3F5TA 7ICPA 2DQ0A 3T1YB 7ICRA 2WSSG 1R1BA 5J2CA 3P30A 2YDEA 5B66Z 1PV0A 3ZBHA 4M9GA 3CD6V 4M2YA 1N33B 4R66A 2ZE5A 2WPDG 1QHTA 2JRIA 3L9DA 2G38A 5KHGA 2BCVA 5LA6A 3NKUA 3DXRB 5B3QA 5GONA 1IXMA 4K8VA 3BAAA 3G4SV 3A8TA 4X65B 4UB6Z 4NTWA 1PNLA 3JPNA 2UXDO 1L0LH 4K97A 5EC1C 4DO9A 3T1YO 3ABMB 1NTKH 3AQKA 2WLLA 4MVQA 3H1JH 1N33O 4GKJO 3SYOA 3OVBA 3C3TA 1AI7A 2QR4A 2R9IA 3K04A 4PA3A 2XT9A 1Y74A 3K03A 1HNXB 3E2EA 3OD4A 4O2AA 2DVIA 1M90W 1UEUA 2ATKC 4JI3O 1TUBB 1VMGA 1W0JG 2ZT9B 5JJEB 1WLEA 4TQFA 4U3JB 4WBNA 1KC8W 1JVMA 4X65O 9ICSA 1K3EA 4EFEA 1EZVH 2F66C 3THOA 5JJJB 5J0QA 3BPZA 4X20A 3GVMA 3FB6C 5LYJB 4DV4O 4B3MB 1Z5VA 3OFNG 5TISZ 5LGNA 1OCRC 4JWNA 3OVAA 1J95A 1FXKA 4K96A 3VQWA 2WLHA 3ABLB 3CRCA 4AT7B 4RAIA 4NKTA 5CA1A 4YJ3B 4RT3A 4PHEA 4JI0B 2UUBB 3A2FA 3F5WC 3ZMSA 2Q73A 4B08A 4LF4B 4PHAA 1VJ7A 1QCEA 2AW9A 2QA4V 2Q7HA 2PFOA 4I9QA 3RYIB 4QE7A 1Y67A 1CP9A 1VFGA 2A0LA 2VANA 4U7NA 4B3MO 1WB8A 4LWSA 4P9OA 2ZD9A 4KLMA 5CR0A 3AG3C 4PDLA 5LGUA 1OCOC 1U97A 3F7VC 2A7WA 4I0UA 1KMIZ 5KA5A 1NT2B 1XUQA 2EIJB 3KKYA 5B3SB 2WWWA 2ZH6A 4B7KA 5DM6V 4AILC 4RO2A 2PFQA 1GPJA 5J2IA 1BL8A 5IIMA 1V55C 4JI0O 4LP8A 2UUBO 4NTXA 2GSMB 1UFIA 2QE7G 3AQLA 3H1IH 1M56B 4P2ZA 3UO2A 5LYJA 2ZIOA 1MA1A 2JS5A 3RYHB 5DECA 4NXMO 1LR1A 4KLOA 3ZN1A 2PYJA 3RWRD 1OHHG 3MDSA 3OWGA 5HRIA 4X88A 2RDCA 2Y69C 1AR1B 4FO6A 1AJQA 4O5EA 5HREA 1MIVA 5KHIA 4YY3B 5CJ7A 4YJ3A 4CH5A 3EHBB 5HR9A 1FFXB 4K8XA 1Z2GA 5JVDA 3CPWU 1IVSA 3HB3B 2NLJC 1QVFU 4PDMA 2Q5ZA 3AK3A 4TUQA 3A0BZ 1I5XA 1R3LC 1K5QA 2F4VB 2Q69A 2EILB 4DV7B 5EIBD 4IQUA 3ASNB 9ICQA 4IG8A 1B04A 4LFCO 3H1HH 3H1LH 3M7MX 4KFMA 1H2LA 2E74B 2BCSA 3WB0A 3T1CA 3UXNA 2DR5A 3ER8C 3UT5A 1US6A 2GA9D 4NLKA 3SDLA 1XHZA 1KD1W 1IBKB 2B56A 3MBYA 2B1IA 1YHQV 3LSUA 1WA8B 2QKSA 4K4GA 4O5CA 5H6QA 1BGYH 4PA7A 2QJ1A 3KCXA 5IINA 4JTDB 1QLEB 2QM4A 3RYHA 1BQZA 4N23A 5LXTB 1IBLO 3R65A 1A32A 3JD0A 5BZBA 1SF9A 1JCHA 4P9PA 4J7KA 2IUBA 2Y0IA 2YC0A 4K35A 4DV7O 3E22A 2Z3YA 3ZRSA 2PGGA 3WB2A 1KP3A 1KUQA 1CPYA 1KU9A 5DEDA 4X0BA 3VQYA 4QZIA 5LP6B 1FXKC 4KLDA 4QZBA 3SJQC 4FMTA 4O69A 1IBKO 1GN2A 4KLUA 1FPOA 4F5NA 4X4NA 3ZCCA 3OW2U 4DW0A 4DV6B 2XAGA 1JJ2U 5KLVH 4RQ3A 1PKXA 2LP7A 2OTLV 3LDCA 5D46A 1VQOV 4QZAA 1XILA 2GHYA 3RGBA 9ICTA 5J2AA 4FVMA 1EZJA 7ICMA 3HKBA 4GKKB 2DQ3A 5B1AC 2FMLA 3CS5A 3CE2A 1BPXA 3W7WA 3CB2A 1K8AW 1YCIA 5E79Z 1P7GA 1WA8A 4TOIA 4DRXA 4PA4A 3ZHTA 4RWQA 3C5GA 4X4RA 1XHXA 1KNYA 1JX9A 2QTSA 4LFBO 1GKFA 2W0FC 1F5AA 1ZQJA 1VQ8V 5C93A 4FPPA 2QGNA 3LSSA 4LEYA 3HIYA 4F5QA 4I2BA 1S3JA 1S5JA 3OGCC 1XBLA 4X1KB 4RQEA 3RJIA 1COWG 3RN4A 4P2HA 7ICGA 1ZSPA 1Z5WA 1HR0B 4JAAA 4X5VA 1IDSA 1B06A 1F7YA 4GKKO 4DV3B 2ZNJA 5CBGA 3CXCU 5CFSA 4TV8B 3K5MA 4DO2A 1Y76B 4WCEV 3I56V 1ZQUA 3V7KA 2IJKA 2EJ7A 5B3PA 4X4UA 4PD4F 3OTOB 2F43G 9ICIA 2LJ2A 4YCXA 4NB5A 4YHHB 1KQSU 3CCMV 4IQTA 1AILA 4DR1O 2ZH5A 1SC5B 1SZXA 4X64B 1XNRB 1L8DA 4P30A 1X59A 2IJHA 2AXTZ 1HR0O 8ICPA 1KEJA 2GTAA 2HN1A 4OPHA 4DV3O 3CCRV 3RW0A 3CRAA 2O5AA 4DR2B 2CTQA 2Y4TA 5J0PA 1R3JC 2HJDA 1GM9A 4M04A 1RP3B 1QNMA 3BEHA 1TFYA 2JJ1G 3G80A 2UUCB 4Z6FA 1PM9A 4TT3G 2W6JG 3OTOO 3ASOB 3G6BA 2YI9A 3JARB 3PJSK 3WFVA 4FHXA 4UD4A 4YHHO 3BFRA 2P90A 4X64O 2B4VA 2KB1A 1XNRO 4LNUB 1SA0B 1S72V 9ICPA 5B1BB 1Y66A 5IYZB 4UAZA 4DUZB 1WOTA 5CB4A 1R73A 3H38A 1Y76A 3BCCH 4PHZA 1BPDA 5J2JA 5DBAA 4RPYA 4R64A 3K08A 4DR2O 3RJFA 3U10A 2QWNB 4NTYA 4M5DA 4HAMA 3ZHSA 5C8YA 2UXXA 4NKGB 5J2DA 3UQ2A 4HNAA 1OCCC 4BIUA 5IY5C 4GX0A 3MGIA 1L1FA 1WPXA 2OCCC 3ISDA 3ZRVA 1XMQB 2FL4A 3C18A 1R6KA 3TCUA 9ICJA 4KLLA 8ICLA 4RT2A 2IBZH 4TUPA 7ICFA 4L87A 3S3WA 4R8CA 4TWKA 3RYCA 2V7QG 3C2KA 4KP4A 3L74H 2PI4A 3JARA 5LHHA 2A3QA 1S5HC 4BIOA 1KDHA 3ZEDA 4NR1A 5HFLA 2EIKB 4FO1A 4QZHA 4MVMA 4J42A 2PY5A 9ICHA 4CH4A 4BR6A 1XMQO 2YIBD 4PGQA 2QWPB 3JD1A 4LFAB 4LEZA 4GCZA 1NOMA 4KLIA 2GV9A 2ITCC 3P3PA 3D8CA 4K4IA 1XQ8A 1V4AA 3JD3A 3S3XA 1M4UA 3E35A 1GN3A 3K7DA 1N4CA 4JI4O 4I28A 3IFXA 5GTIZ 1NZ6A 2HP8A 4LC1A 3B40A 2IJJA 3P3NA 5BY1A 3ETQA 5LMNB 1YVWA 1Q6HA 4UCTA 5J2UA 1UETA 1ZQCA 1ZQQA 4EFBA 2RCVA 4G27B 1OCRB 1LUWA 4QGPA 1AB3A 3RYFA 4IT5A 4AT9B 4OAFA 5IYCO 9ICOA 3UXPA 3JD4A 3ETEA 5J9PC 3AK2A 4ZI7A 5KMGA 2E75B 4M9LA 4PDRA 1GN4A 4I2EA 8ICOA 1VEWA 1YI2V 2DYSB 4I2DA 4X8AA 2IU0A 4KLSA 4X62O 4JI6O 1RPLA 2Z5UA 4DR6B 4GLXA 3MDAA 3AG1C 8ICFA 3ZHUA 1Q81W 1AROP 3AG3B 3RH4A 3IC9A 4K98A 1Q43A 1F4MA 4EKWA 3RJKA 5LBQA 1IX9A 4MF2A 1PNMA 3G67A 5F2VO 3N27A 4UVAA 4RUEA 2ZH8A 4GX5A 4I4TA 4B3RB 2MK3A 4F4LA 1BPBA 3JCFA 2ZE7A 5CBFA 1SQFA 5KAFZ 2XAQA 4DR6O 3RJEA 2WLJA 1EFRG 1N34B 3CYOA 1E1QG 4Z1MG 1V9PA 4FHWA 1AP5A 1R8AA 4X4QA 5HC9A 1H2SB 4XDLA 2HG5C 2ZNIA 4H37A 1WPBA 3T2MA 1OZ0A 9ICEA 1QR9A 4NM1A 1MNGA 2ZE8A 4LEWA 5CBHA 8ICCA 1VF5B 2B1GA 2UUAB 4KXRA 4M0AA 1BPZA 2VWJA 1Y6XA 3JZ0A 2JIZG 3BA8A 1N34O 2P6JA 1VF6A 3JAWB 5B1OA 3CRRA 5ITZB 3K5NA 2DWDC 2FMQA 2HVJC 2Z0AA 3T4ZA 5IWAO 1S76D 3ABKC 2LO1A 4MTFA 1ZQGA 1XDCA 2BOCC 4DR4B 3W7UA 4QZCA 3QTCA 1VQ9V 8ICSA 8ICUA 1I94B 4CZZA 2HHHB 2ILMA 5IILA 2M2VA 2UUAO 1FYJA 1OCZC 2BPFA 2DMXA 4O67A 2B5UA 2QSAA 1Q79A 2YEVA 3E8HA 4LEVA 2E5LB 3C5FA 4O4HB 1IXBA 3JATB 2CGNA 4UVCA 3U0ZA 4FLZA 2M7WA 1DGSA 1H8HG 4AQYO 4WFAV 3V7JA 3ZRXA 2V4DA 4JI8B 4DV0B 3JCUZ 2UXNA 3DC6A 1NQTA 2HHHO 3MCRA 2XTAA 1R6NA 1AP6A 2DE0X 5CFUA 2EULA 3SYAA 4FM0A 3SPHA 3D3IA 2OIGA 5L3GA 3JAWA 2BTOA 3SPCA 3ER9B 2DW4A 3PN1A 5IIJA 4QNHB 3H1KH 5ITZA 4I55B 3C66A 3AG2C 4KLJA 2E5LO 4BW5A 1H2MA 8ICMA 4J9YB 1HDJA 3W7TA 3B2EE 2JJ2G 2VQFB 5BPCA 3E83A 1MZEA 2Q7EA 4PH5A 4UV9A 4DOBA 8ICVA 2YIDA 4X4PA 3QNEA 5L3DA 4XQ8A 2ZXWC 4H33A 1MMMA 3RH5A 4JI8O 4DV0O 2ZDIA 4UD5A 4GXIA 4QE9A 1HNXO 3CRMA 1XSNA 1MABG 3DXRA 4DOAA 4HZ3A 1GM7A 4R65A 3T4DA 4O4HA 4UBBA 4GXJA 3OAAG 1JPXA 3JATA 4KUMA 4FIPC 4NXNB 3G71V 4DR7B 2R70A 1MOFA 4RQFA 2WLKA 5J0XA 3OV7A 5H6RA 2PFPA 4PHPA 2WLIB 4E4EA 1UJWB 3AEIA 1IBMB 3CSXA 2PZSA 5KUMA 2M6YA 4YIPA 1FA0A 3ZIAG 4JTAB 5KX5B 3OUFA 2OWOA 3K79A 3MGHA 2XNDG 2BPCA 4QPJA 1TUBA 4PI2A 3GWKC 1AR5A 3B09A 4N21A 3ZHQA 1IZ3A 3CCLV 4CC6A 4X66B 4U3JA 4E2LA 5DB6A 1ZL8B 4K9BA 3CXHF 4ZIBA 4OAIZ 4WF9V 2FMSA 3HKDB 4LF4O 2PFNA 1JFFB 3Q4HB 9ICCA 1NR1A 4NXNO 5JCOC 4DR7O 4UB1A 5CA0B 4G2KA 5H2FZ 2JVDA 3M8AA 2KG7B 4O4LB 5D5QA 1SRYA 1JR9A 3JYCA 5CWRA 4JYAB 1VQ7V 1ZAUA 2NN4A 4LVSA 2IM9A 1IBMO 3WU2Z 4WOYA 1L0NH 3LNNA 4UCOA 2YSUB 2JEUA 4IYIA 1EN4A 4MW3A 3LUTB 3GDXA 3OE7G 2XUMA 3BHPA 4AT7A 2QM7A 4RQ7A 4RQ5A 2E76B 4M9JA 4XJEA 1ZQLA 1V54B 4YMNA 5HHHA 2PUSA 1XL4A 3L73H 3K59A 4AI8A 4J10A 3B4SA 3OEEG 4LH7A 4FHYA 3CCQV 4X4SA 2N05A 4F5PA 1KBHA 1OJHA 3LDEA 4DV2B 4X4TA 5EK0A 3NXSA 1D5NA 3RYIA 2WLIA 1PPJH 1VQLV 3O9OA 3C3SA 4JYAO 1N32B 5KX5A 1YJNV 4N7RA 2Q8VA 1ZQKA 9ICNA 2X7RB 1QR8A 4HBNA 5HRBA 4JASA 1M9NA 5D62A 4FHPA 3CC2V 4I50B 4MVZA 3FB5C 4YY3O 5TZVA 1GMGA 3AK1A 1ZL8A 1K92A 2RN9A 2JK5C 1NR7A 3KZIZ 4YIOA 4J11A 4YXWG 3CCEV 1X4TA
chains in the Genus database with same CATH topology
4QZFA 2FMPA 2DR8A 3RH6A 4NKUA 4M04A 2BE3A 3ISBA 5DBBA 1TFYA 7ICUA 4Z6FA 4P4MA 4FHXA 4E8FA 4UD4A 4JWMA 4UAWA 4MFAA 3RJJA 4WC3A 8ICHA 5IIIA 1JMSA 4FH3A 1ZQIA 9ICPA 9ICUA 4UAZA 1WOTA 4UAYA 2BCUA 3AUOA 7ICJA 4LT6A 3H38A 1MQ2A 5J0OA 1BPDA 5J2JA 5DBAA 4RPYA 1ZQFA 4R64A 9ICGA 3RJFA 3K75D 1MQ3A 9ICVA 4KLEA 7ICKA 4WC4A 1ZJNA 4M5DA 3WFRE 5J2GA 5HRLA 4UB5A 1RZTA 1PX5A 3B0YA 7ICEA 2I9GA 3MDCA 5J2DA 2DR7A 3RJHA 3UQ2A 4KLGA 8ICIA 4M9HA 4QZDA 5CP2A 1ZQZA 1XSPA 3ISDA 2GWSA 5DDMA 7ICHA 4Z6CA 1ZQXA 3C18A 5J29A 1TV9A 1ZQHA 9ICJA 4KLLA 2DRBA 8ICLA 4RT2A 3JPSA 1ZJMA 4TUPA 7ICFA 4QZGA 1ZQPA 3H39A 4S3NA 4I2FA 4XQ7A 5BOMA 3C2KA 2NRKA 3JYYA 4X4OA 4R63A 9ICBA 1KDHA 4KLHA 4M47A 1ZQRA 8ICBA 5HRHA 4QZHA 5HRDA 9ICXA 7ICVA 9ICHA 3V7LA 3WFSC 2ZH4A 3RJGA 4PGQA 5D4BA 7ICPA 8ICXA 1NOMA 3JPQA 4KLIA 7ICRA 2HHPA 5J2CA 4M9GA 4WC6A 4YD1A 4UB3A 4M2YA 3C2MA 4R66A 4K4IA 1V4AA 2ID1A 5J0WA 2P66A 9ICAA 3L9DA 4I28A 3WFOA 5J0RA 8ICJA 2BCVA 4XUSA 3V72A 7ICNA 1ZQNA 1UETA 1ZQCA 1ZQQA 1R89A 1ZQYA 9ICLA 3TFSA 1NO5A 3JPNA 4AT9B 2O1PA 1JAJA 9ICOA 4WBZA 3UXPA 3WFPA 4RQ2A 4DO9A 4KLFA 3AQKA 5EOZA 5DB7A 4M9LA 3TFRA 4FH5A 2RFFA 3UPQA 4I2EA 3JPOA 3OVBA 8ICOA 5D49A 4I2DA 3UQ0A 4KLSA 1RPLA 2DVIA 1UEUA 5DDYA 1YLQA 3MDAA 1HUOA 3JPRA 2ZH2A 8ICFA 8ICRA 4EBKA 1ZQEA 4I29A 4YN4A 5IIOA 4PGYA 4WC7A 3RH4A 9ICSA 5J0QA 3RJKA 5J2FA 2ISPA 4MF2A 1R8CA 4RWNA 1ZQAA 5F2VO 4YMMA 5J0UA 2ZH3A 3NYBA 2M2TA 2ZH8A 3C2LA 3HJ4A 4JWNA 3OVAA 1BPBA 4KLTA 3H37A 4WBYA 4NLNA 3HJ1A 4AT7B 3RJEA 4NKTA 1ZQTA 2DRAA 4RT3A 5CA7A 4PHEA 4FHWA 4MF8A 1R8AA 4PHAA 4X4QA 5HC9A 1VJ7A 7ICLA 8ICNA 4O9MA 2PFOA 3B0XA 5J0PA 4I2CA 1VFGA 9ICEA 2VANA 9ICRA 8ICZA 5CHGA 4NM1A 4KLMA 4X0AA 5CR0A 8ICCA 4I2HA 4M0AA 1BPZA 4NY8A 3JZ0A 5DB8A 2ZH6A 4PGXA 9ICMA 4K4HA 2PFQA 5DKWA 5J2IA 5IIMA 4TUSA 5BOLA 2FMQA 5HHIA 2W9MA 3AQLA 1BPEA 4RWPA 4PPXA 1ZQGA 7ICSA 5J0SA 5DECA 4KLOA 5HRFA 4QZCA 4QZ8A 5HRIA 8ICSA 3AQMA 1TVAA 2PXIA 8ICUA 5IILA 3HWTA 4FO6A 4O5EA 2M2VA 1ZQDA 5HREA 1MIVA 4UB4A 5J2BA 2BPFA 5CJ7A 1Q79A 5CB1A 5HR9A 4UBCA 5J2KA 1ZQBA 3AU2A 3JPTA 3OGUA 3C5FA 5HRKA 3AU6A 2ZH7A 3WFQE 4QZ9A 1XSLA 4ATBB 4IQVA 4TUQA 3V7JA 4X4VA 7ICTA 1ZQSA 4IQUA 9ICKA 3OVSA 9ICWA 4MFCA 4IG8A 9ICQA 3AQNA 4RQ1A 4AT8B 4YD2A 4I2JA 2BCSA 3UXNA 2DR5A 7ICOA 4NLKA 5IIJA 3C66A 3MBYA 4F5RA 2BPGA 8ICYA 4KLJA 4NLZA 8ICMA 4K4GA 4O5CA 4WC2A 5IINA 1JQRA 4DOCA 5BPCA 1TFWA 4LZDA 4RQ6A 4PH5A 4DOBA 8ICVA 4X4PA 8ICKA 5IIKA 4XQ8A 8ICWA 5J0TA 3ISCA 3RH5A 4UD5A 4XRHA 4GXIA 1ZQWA 1ZQVA 1OU5A 4EP7A 4I2GA 3PNCA 5DEDA 1XSNA 3HX0A 4DOAA 4X0BA 4QZIA 4R65A 4NM2A 4YMOA 4KLDA 4XA5A 4UBBA 4GXJA 4QZBA 1ZQMA 4I27A 4WCWA 4KLUA 5J0YA 4F5NA 4X4NA 2BCRA 4RPZA 4AT9A 4ATBA 5J0XA 3OV7A 5HRGA 2DR9A 2PFPA 4PHPA 9ICFA 4RQ3A 3OUYB 3H3AA 5D46A 1FA0A 1UEVA 4RPXA 4QZAA 4I2AA 2ZH1A 4AT8A 9ICTA 5J2AA 4PHDA 4E7XA 3MGHA 7ICMA 2BPCA 8ICEA 4FHVA 3UXOA 4NXZA 1ZQOA 1BPXA 1BPYA 5DBCA 1HUZA 4P4OA 5DB6A 2FMSA 2PFNA 8ICTA 4RWQA 3PMNA 3LK9A 3C5GA 4UB1A 9ICCA 4X4RA 4I2IA 1KNYA 4O5KA 2M2UA 4LZGA 4LVSA 5CWRA 1F5AA 1ZQJA 1MIYA 4RQ8A 2BCQA 4P4PA 3HIYA 4QZEA 4KLQA 4F5QA 4I2BA 4EBJA 3RJIA 3GDXA 2ZHAA 4P2HA 7ICGA 4RQ7A 4AT7A 4M9NA 4RQ5A 4WC0A 1MIWA 2PBEA 1ZQLA 4M9JA 5HHHA 4YMNA 3PMLA 4X5VA 3UPSA 7ICIA 4UB2A 4FHYA 3LQCB 4RWOA 4X4SA 4F5PA 5DB9A 1ZQUA 2ZH9A 4X4TA 2IHMA 3V7KA 4MFFA 4WC5A 2Q66A 8ICQA 4X4UA 3OUYA 9ICIA 4YCXA 5J2EA 4E80A 7ICQA 1R8BA 4RQ0A 4IQTA 2ZH5A 1ZQKA 9ICNA 4WC1A 4Z6EA 5HRBA 2M2WA 4F5OA 4TURA 4IQWA 4FHPA 4GXKA 1Q78A 8ICGA 3JPPA 8ICPA 3HW8A 5TZVA 8ICAA 1KEJA 2ZHBA 1JN3A 2ISOA 4RQ4A 4Z6DA 2O5AA 5J2HA 3MGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZF A;  2FMP A;  2DR8 A;  3RH6 A;  4NKU A;  4M04 A;  2BE3 A;  3ISB A;  5DBB A;  1TFY A;  7ICU A;  4Z6F A;  4P4M A;  4FHX A;  4E8F A;  4UD4 A;  4JWM A;  4UAW A;  4MFA A;  3RJJ A;  4WC3 A;  8ICH A;  5III A;  1JMS A;  4FH3 A;  1ZQI A;  9ICP A;  9ICU A;  4UAZ A;  1WOT A;  4UAY A;  2BCU A;  3AUO A;  7ICJ A;  4LT6 A;  3H38 A;  1MQ2 A;  5J0O A;  1BPD A;  5J2J A;  5DBA A;  4RPY A;  1ZQF A;  4R64 A;  9ICG A;  3RJF A;  3K75 D;  1MQ3 A;  9ICV A;  4KLE A;  7ICK A;  4WC4 A;  1ZJN A;  4M5D A;  3WFR E;  5J2G A;  5HRL A;  4UB5 A;  1RZT A;  1PX5 A;  3B0Y A;  7ICE A;  2I9G A;  3MDC A;  5J2D A;  2DR7 A;  3RJH A;  3UQ2 A;  4KLG A;  8ICI A;  4M9H A;  4QZD A;  5CP2 A;  1ZQZ A;  1XSP A;  3ISD A;  2GWS A;  5DDM A;  7ICH A;  4Z6C A;  1ZQX A;  3C18 A;  5J29 A;  1TV9 A;  1ZQH A;  9ICJ A;  4KLL A;  2DRB A;  8ICL A;  4RT2 A;  3JPS A;  1ZJM A;  4TUP A;  7ICF A;  4QZG A;  1ZQP A;  3H39 A;  4S3N A;  4I2F A;  4XQ7 A;  5BOM A;  3C2K A;  2NRK A;  3JYY A;  4X4O A;  4R63 A;  9ICB A;  1KDH A;  4KLH A;  4M47 A;  1ZQR A;  8ICB A;  5HRH A;  4QZH A;  5HRD A;  9ICX A;  7ICV A;  9ICH A;  3V7L A;  3WFS C;  2ZH4 A;  3RJG A;  4PGQ A;  5D4B A;  7ICP A;  8ICX A;  1NOM A;  3JPQ A;  4KLI A;  7ICR A;  2HHP A;  5J2C A;  4M9G A;  4WC6 A;  4YD1 A;  4UB3 A;  4M2Y A;  3C2M A;  4R66 A;  4K4I A;  1V4A A;  2ID1 A;  5J0W A;  2P66 A;  9ICA A;  3L9D A;  4I28 A;  3WFO A;  5J0R A;  8ICJ A;  2BCV A;  4XUS A;  3V72 A;  7ICN A;  1ZQN A;  1UET A;  1ZQC A;  1ZQQ A;  1R89 A;  1ZQY A;  9ICL A;  3TFS A;  1NO5 A;  3JPN A;  4AT9 B;  2O1P A;  1JAJ A;  9ICO A;  4WBZ A;  3UXP A;  3WFP A;  4RQ2 A;  4DO9 A;  4KLF A;  3AQK A;  5EOZ A;  5DB7 A;  4M9L A;  3TFR A;  4FH5 A;  2RFF A;  3UPQ A;  4I2E A;  3JPO A;  3OVB A;  8ICO A;  5D49 A;  4I2D A;  3UQ0 A;  4KLS A;  1RPL A;  2DVI A;  1UEU A;  5DDY A;  1YLQ A;  3MDA A;  1HUO A;  3JPR A;  2ZH2 A;  8ICF A;  8ICR A;  4EBK A;  1ZQE A;  4I29 A;  4YN4 A;  5IIO A;  4PGY A;  4WC7 A;  3RH4 A;  9ICS A;  5J0Q A;  3RJK A;  5J2F A;  2ISP A;  4MF2 A;  1R8C A;  4RWN A;  1ZQA A;  5F2V O;  4YMM A;  5J0U A;  2ZH3 A;  3NYB A;  2M2T A;  2ZH8 A;  3C2L A;  3HJ4 A;  4JWN A;  3OVA A;  1BPB A;  4KLT A;  3H37 A;  4WBY A;  4NLN A;  3HJ1 A;  4AT7 B;  3RJE A;  4NKT A;  1ZQT A;  2DRA A;  4RT3 A;  5CA7 A;  4PHE A;  4FHW A;  4MF8 A;  1R8A A;  4PHA A;  4X4Q A;  5HC9 A;  1VJ7 A;  7ICL A;  8ICN A;  4O9M A;  2PFO A;  3B0X A;  5J0P A;  4I2C A;  1VFG A;  9ICE A;  2VAN A;  9ICR A;  8ICZ A;  5CHG A;  4NM1 A;  4KLM A;  4X0A A;  5CR0 A;  8ICC A;  4I2H A;  4M0A A;  1BPZ A;  4NY8 A;  3JZ0 A;  5DB8 A;  2ZH6 A;  4PGX A;  9ICM A;  4K4H A;  2PFQ A;  5DKW A;  5J2I A;  5IIM A;  4TUS A;  5BOL A;  2FMQ A;  5HHI A;  2W9M A;  3AQL A;  1BPE A;  4RWP A;  4PPX A;  1ZQG A;  7ICS A;  5J0S A;  5DEC A;  4KLO A;  5HRF A;  4QZC A;  4QZ8 A;  5HRI A;  8ICS A;  3AQM A;  1TVA A;  2PXI A;  8ICU A;  5IIL A;  3HWT A;  4FO6 A;  4O5E A;  2M2V A;  1ZQD A;  5HRE A;  1MIV A;  4UB4 A;  5J2B A;  2BPF A;  5CJ7 A;  1Q79 A;  5CB1 A;  5HR9 A;  4UBC A;  5J2K A;  1ZQB A;  3AU2 A;  3JPT A;  3OGU A;  3C5F A;  5HRK A;  3AU6 A;  2ZH7 A;  3WFQ E;  4QZ9 A;  1XSL A;  4ATB B;  4IQV A;  4TUQ A;  3V7J A;  4X4V A;  7ICT A;  1ZQS A;  4IQU A;  9ICK A;  3OVS A;  9ICW A;  4MFC A;  4IG8 A;  9ICQ A;  3AQN A;  4RQ1 A;  4AT8 B;  4YD2 A;  4I2J A;  2BCS A;  3UXN A;  2DR5 A;  7ICO A;  4NLK A;  5IIJ A;  3C66 A;  3MBY A;  4F5R A;  2BPG A;  8ICY A;  4KLJ A;  4NLZ A;  8ICM A;  4K4G A;  4O5C A;  4WC2 A;  5IIN A;  1JQR A;  4DOC A;  5BPC A;  1TFW A;  4LZD A;  4RQ6 A;  4PH5 A;  4DOB A;  8ICV A;  4X4P A;  8ICK A;  5IIK A;  4XQ8 A;  8ICW A;  5J0T A;  3ISC A;  3RH5 A;  4UD5 A;  4XRH A;  4GXI A;  1ZQW A;  1ZQV A;  1OU5 A;  4EP7 A;  4I2G A;  3PNC A;  5DED A;  1XSN A;  3HX0 A;  4DOA A;  4X0B A;  4QZI A;  4R65 A;  4NM2 A;  4YMO A;  4KLD A;  4XA5 A;  4UBB A;  4GXJ A;  4QZB A;  1ZQM A;  4I27 A;  4WCW A;  4KLU A;  5J0Y A;  4F5N A;  4X4N A;  2BCR A;  4RPZ A;  4AT9 A;  4ATB A;  5J0X A;  3OV7 A;  5HRG A;  2DR9 A;  2PFP A;  4PHP A;  9ICF A;  4RQ3 A;  3OUY B;  3H3A A;  5D46 A;  1FA0 A;  1UEV A;  4RPX A;  4QZA A;  4I2A A;  2ZH1 A;  4AT8 A;  9ICT A;  5J2A A;  4PHD A;  4E7X A;  3MGH A;  7ICM A;  2BPC A;  8ICE A;  4FHV A;  3UXO A;  4NXZ A;  1ZQO A;  1BPX A;  1BPY A;  5DBC A;  1HUZ A;  4P4O A;  5DB6 A;  2FMS A;  2PFN A;  8ICT A;  4RWQ A;  3PMN A;  3LK9 A;  3C5G A;  4UB1 A;  9ICC A;  4X4R A;  4I2I A;  1KNY A;  4O5K A;  2M2U A;  4LZG A;  4LVS A;  5CWR A;  1F5A A;  1ZQJ A;  1MIY A;  4RQ8 A;  2BCQ A;  4P4P A;  3HIY A;  4QZE A;  4KLQ A;  4F5Q A;  4I2B A;  4EBJ A;  3RJI A;  3GDX A;  2ZHA A;  4P2H A;  7ICG A;  4RQ7 A;  4AT7 A;  4M9N A;  4RQ5 A;  4WC0 A;  1MIW A;  2PBE A;  1ZQL A;  4M9J A;  5HHH A;  4YMN A;  3PML A;  4X5V A;  3UPS A;  7ICI A;  4UB2 A;  4FHY A;  3LQC B;  4RWO A;  4X4S A;  4F5P A;  5DB9 A;  1ZQU A;  2ZH9 A;  4X4T A;  2IHM A;  3V7K A;  4MFF A;  4WC5 A;  2Q66 A;  8ICQ A;  4X4U A;  3OUY A;  9ICI A;  4YCX A;  5J2E A;  4E80 A;  7ICQ A;  1R8B A;  4RQ0 A;  4IQT A;  2ZH5 A;  1ZQK A;  9ICN A;  4WC1 A;  4Z6E A;  5HRB A;  2M2W A;  4F5O A;  4TUR A;  4IQW A;  4FHP A;  4GXK A;  1Q78 A;  8ICG A;  3JPP A;  8ICP A;  3HW8 A;  5TZV A;  8ICA A;  1KEJ A;  2ZHB A;  1JN3 A;  2ISO A;  4RQ4 A;  4Z6D A;  2O5A A;  5J2H A;  3MGI A; 
#chains in the Genus database with same CATH topology
 5IY5 B;  1JOY A;  4QZF A;  5CA0 A;  3RH6 A;  4NKU A;  2EIM C;  2KG7 A;  4O4L A;  3OM3 B;  5DBB A;  3RBZ A;  7ICU A;  3X2Q B;  3SPJ A;  5IJ0 B;  2F4V O;  2NNU A;  3ZRW B;  2OTJ V;  3OEH G;  4UAW A;  1RM1 B;  3LSQ A;  4K99 A;  3RJJ A;  4MS2 A;  4JI7 B;  4FH3 A;  3BAB A;  3FB7 C;  1K4D C;  4K0K B;  4J9Z B;  5CFT A;  1KKC A;  1K33 A;  4UAY A;  5BMV B;  2B9Z A;  1FFX A;  2RNB A;  2IH1 C;  1PP9 H;  3AG4 B;  4OX9 B;  4YJ2 B;  1MQ2 A;  4UCV A;  1GRJ A;  2IU3 A;  1ZQF A;  4O2B B;  1ZJN A;  3RVZ A;  4XBF A;  3RVY A;  2Q4P A;  4UB5 A;  4LF5 B;  3OGI B;  2YUA A;  1URF A;  2CTR A;  5K1X A;  4ZKI A;  4KLG A;  3DSQ A;  3JCZ A;  4JI1 B;  4UB8 Z;  3ABM C;  5CP2 A;  1P4R A;  3CME V;  5EBW C;  1SS3 A;  1ZQZ A;  1DF5 A;  2GWS A;  4I50 A;  4JI7 O;  5EYP B;  3TJT A;  4Z6C A;  2UXB B;  4K0K O;  4MVO A;  2BTQ B;  1D5A A;  3JAK B;  2Q0O C;  5J29 A;  3NR7 A;  4OX9 O;  1QBZ A;  4PEL A;  4S3N A;  3ML0 A;  4UV8 A;  5IJ0 A;  5BOM A;  3HKE B;  5LXT A;  4DXW A;  4LF6 B;  2JDI G;  2OT5 A;  4X1I B;  4LF5 O;  1BSM A;  4DV6 O;  4JV5 B;  4X4O A;  3ZRW A;  1YSC A;  5EC2 C;  1IUR A;  4HYO A;  2IJI A;  2LQT A;  4JI1 O;  8ICB A;  4ABM A;  2JGU A;  3EVK A;  3K5L A;  1M57 B;  9ICX A;  2PF4 E;  2KSD A;  3DTU B;  3CCJ V;  1N8R W;  5BMV A;  4H44 B;  5LP6 A;  1M5I A;  2UXB O;  2ZH4 A;  4G28 B;  8ICX A;  2DYR C;  3E8G A;  2EIN C;  4O4J B;  4YD1 A;  4WC6 A;  4WFH A;  2QEX V;  1Q7Y W;  2F1M A;  2FYU H;  2Q68 A;  9ICA A;  3G6E V;  1AR4 A;  2A06 H;  3WFO A;  5J0R A;  1P49 A;  4CH3 A;  2PYL A;  1VQN V;  8ICJ A;  1FFT B;  5H5N A;  7ICN A;  3ZMZ A;  4J80 A;  2W6I G;  1BHB A;  4JAU A;  1G6U A;  1R89 A;  3N2K B;  2L35 A;  1NI8 A;  3JAK A;  4I7Z B;  9ICL A;  3TFS A;  1NO5 A;  1BZK A;  2RMK B;  2ARH A;  3CP1 A;  4WFF A;  1ZTE A;  1YIJ V;  3WFP A;  1FXH A;  4WFB V;  3CK6 A;  1ZX3 A;  4FZ0 A;  5DB7 A;  3TFR A;  3EF2 A;  4CS3 A;  3UPQ A;  3JPO A;  3VQX A;  5D49 A;  1GN6 A;  5J2T B;  4ICG A;  3E8F A;  1M56 C;  5CMU A;  4DR3 B;  1YLQ A;  3JPR A;  2R72 A;  1TVK B;  4X1K A;  3ZMU A;  5LL6 Y;  1H2N A;  1JA8 A;  1G4Y B;  4EBK A;  2XOK G;  4I29 A;  4YN4 A;  4DUY B;  5IIO A;  1PNK A;  5KAI Z;  4PGY A;  4CS4 A;  4WC7 A;  4TV8 A;  3UO3 A;  4O4J A;  4H13 B;  3CC4 V;  5J2F A;  3ZJZ A;  4RWN A;  3CCV V;  4YMM A;  5J0U A;  2LFS A;  3C2L A;  4I0X B;  2UUC O;  3ZMT A;  4LBE C;  3HJ1 A;  4JI2 B;  3U11 A;  4KB6 A;  4DR3 O;  2DRA A;  1F23 A;  3SR2 C;  2EIL C;  5CA7 A;  3M99 B;  3IGA C;  4C7U A;  2VRZ A;  4FK5 C;  4MF8 A;  4QIW F;  3H9V A;  3OMN B;  2D2C B;  3ASN C;  4NVP A;  3SJB C;  4DUY O;  7ICL A;  4AHC A;  8ICN A;  5IT9 N;  4O9M A;  4DUZ O;  4FLW A;  3A0R A;  3ZX6 A;  1YEW A;  1B6Q A;  9ICR A;  8ICZ A;  5CHG A;  3J7A U;  1XI1 A;  2BBJ A;  4X0A A;  4I2H A;  2LGQ A;  5J2T A;  3QO5 A;  3UCS C;  2FKX A;  1W59 A;  2CH7 B;  1FJG B;  2Y4U A;  4NY8 A;  1QLE C;  3QF7 A;  2CK3 G;  4Q6G A;  5DB8 A;  1TVK A;  3CEI A;  4KL1 A;  9ICM A;  4NXT A;  4K4H A;  1H2G A;  4LNU A;  1SA0 A;  3RFR A;  1H2K A;  5IYZ A;  5LOV B;  2C2A A;  1O9G A;  5BOL A;  1KEC A;  2ZKO A;  2CGO A;  4GYC B;  2LFR A;  2YIB A;  2Q9L A;  4OPA A;  2W9M A;  1BPE A;  2VQE B;  4FZ1 A;  4J7J A;  4TV9 B;  5J0S A;  4JZ2 A;  5LP6 C;  2Y0P A;  4L8J A;  1DTO A;  5HFM A;  4UUJ C;  4EEQ A;  4ZHQ B;  5CA3 A;  5IJ9 B;  3AQM A;  3STL C;  2CAZ C;  4F6R B;  4K8Z A;  3JSN A;  1RPO A;  3HWT A;  1ZQD A;  4OAH A;  3WG7 C;  2KKW A;  3CMA V;  1P7B A;  3HKC B;  4WH5 A;  1N0J A;  4XDK A;  2ZIM A;  1Q3E A;  4UBC A;  1SET A;  3N2G B;  5L3F A;  4MVU A;  1ZQB A;  3JPT A;  2ETN A;  1F51 A;  2QWR B;  4FJC C;  1EM1 A;  2HVK C;  1B3Q A;  2CTP A;  4IL6 Z;  2FB5 A;  4LF8 B;  2AZ0 A;  2VQE O;  4ATB B;  3LDD A;  4IQV A;  4LFA O;  1NKD A;  2ZQM A;  2F23 A;  1XNQ B;  7ICT A;  3ABT A;  3L70 H;  3OTF A;  4IIJ B;  2K9P A;  9ICK A;  9ICW A;  5D63 A;  3JSL A;  1NH2 B;  4MFC A;  1GO3 F;  2P67 A;  1N0N A;  4RQ1 A;  1TUE B;  1SES A;  4I2J A;  4U3F H;  7ICO A;  1AI5 A;  4EB6 B;  1W2B U;  2HFE C;  5LMN O;  4F5R A;  8ICY A;  2LW7 A;  1OCO B;  3OMA B;  2ZIN A;  4J41 A;  3EXA A;  3FFQ A;  4DOC A;  1VAR A;  4TV9 A;  4OXS A;  4RQ6 A;  3DC5 A;  8ICK A;  2ZR2 A;  4UCR A;  5IJ9 A;  4BWA A;  1AJP A;  1XNQ O;  4Z2W A;  1WB7 A;  1V55 B;  4F6R A;  4OAG A;  2GUZ B;  4BIZ A;  1ZQW A;  4EEB A;  5EZY B;  1OU5 A;  2HR3 A;  1DLB A;  2WAM A;  2YXH A;  1M93 A;  3HKC A;  3HX0 A;  1WAZ A;  3N2G A;  4RWU A;  3APQ A;  4YMO A;  5KA6 A;  3K3W A;  1ZQM A;  4I27 A;  2Y69 B;  5J0Y A;  2B51 A;  4NXV A;  4RPZ A;  4OGQ B;  4AT9 A;  4NXU A;  3OUS A;  4ATB A;  2DR9 A;  4JI5 B;  2EZP A;  2X6B A;  2AHY A;  3ZS8 C;  9ICF A;  3QVN A;  1I08 A;  3VBB A;  4IIJ A;  1RFY A;  1BCC H;  2MW2 B;  3CJH B;  4RPX A;  1NH2 D;  2ZM6 B;  1R3I C;  3HR0 A;  2QTO A;  3R66 A;  1FS0 G;  2QM8 A;  4B7E A;  4I2A A;  4FFB B;  4B3R O;  4W4L A;  4DR5 B;  3FAV B;  4E7X A;  3UKM A;  2CE4 A;  1G1X B;  4FHV A;  3UXO A;  3BRC A;  1Q6U A;  3OR7 C;  2GAF D;  2RQ6 A;  2UU9 B;  4KHP B;  3GB7 C;  3A0H Z;  4GT1 A;  5FLX N;  4O4I B;  1DF4 A;  2N74 A;  2WA4 A;  8ICT A;  3PMN A;  3LK9 A;  5B5E Z;  4I2I A;  4DV5 B;  2WLL B;  3ZHV A;  4O5K A;  5B1B C;  2M2U A;  4LZG A;  4JI5 O;  3SJC C;  2P7T C;  3K0G A;  1Y74 B;  1H8E G;  3TET A;  2VWK A;  4FLT A;  4QZE A;  4KLQ A;  5EZY A;  1PL4 A;  2EIM B;  4DR5 O;  4WQL A;  4M9N A;  4PI0 A;  4TSF G;  4WBN B;  2PBE A;  3UPS A;  7ICI A;  4UB2 A;  2X0L A;  4QPK A;  1HW7 A;  2UU9 O;  2ZR3 A;  3LQC B;  4KHP O;  3I5D A;  4X20 B;  5DB9 A;  1ENV A;  5GW7 A;  2ZH9 A;  3SPG A;  3K5O A;  4GKJ B;  1VIB A;  1HNZ B;  4PA9 A;  4CH6 A;  4DV5 O;  2A9H A;  1S0V A;  1FXK B;  4E80 A;  1U96 A;  3CJH A;  1R8B A;  4JI3 B;  5JWP A;  4DR4 O;  3CC7 V;  4FFB A;  1I94 O;  3FAV A;  2IW5 A;  5B1N A;  4Z6E A;  1Q5O A;  5JQG B;  5CA1 B;  4F5O A;  1EBO A;  5DN6 G;  3E89 A;  3CRQ A;  3IAY A;  4DYL A;  8ICG A;  1R3K C;  3JPP A;  4GZR B;  4MSW C;  4DK0 A;  1Y4M A;  4DV4 B;  3SYC A;  4O4I A;  5J2H A;  1I0H A;  2EIK C;  4GX1 A;  2HN2 A;  4JZG A;  2A79 B;  2X6C A;  1VF7 A;  1WP7 A;  1YIT V;  4LWS B;  1HNZ O;  4D7T A;  1GK9 A;  1BS3 A;  5B1A B;  5IDJ A;  4EV6 A;  4FM1 A;  4UXN A;  4MFA A;  1MSD A;  1SER A;  5III A;  4FLX A;  1ZQI A;  2HLD G;  3K06 A;  1MSW D;  4NXX A;  2BCU A;  5JH7 B;  3AUO A;  4KM5 A;  2JGD B;  5J0O A;  3NVO A;  1I7F A;  2ADQ B;  1AI6 A;  1LNQ A;  2ADP A;  5FNV B;  1MQ3 A;  9ICV A;  4KLE A;  4WC4 A;  3WFR E;  2EBO A;  2L6L A;  4FFK A;  2VQF O;  1YXB A;  3MDC A;  1RSO B;  2DR7 A;  2CTW A;  1NU1 H;  3MD0 A;  4H0L B;  3SYP A;  8ICI A;  1G8M A;  2DYR B;  4M9H A;  4B3S B;  2H8P C;  3ABU A;  5JQG A;  4QZD A;  2EIN B;  3CCU V;  2K1E A;  5CN0 A;  1UPG A;  2EWR A;  7ICH A;  1ZQX A;  5JVD B;  1HNW B;  2DYS C;  3JAM N;  3GWO A;  5FL7 G;  4I55 A;  1TV9 A;  2GTS A;  4R7C A;  2DRB A;  2XAS A;  1SQX H;  3JPS A;  1DK1 A;  4NXM B;  1D2D A;  1ZJM A;  3H01 A;  4JPR A;  1ZQP A;  1VF6 C;  3ZMV A;  1Q8I A;  3CCS V;  4X89 A;  3O65 A;  1K5S A;  2H94 A;  3JYY A;  2XHB A;  1YTF B;  1ZLZ A;  2AHZ A;  1FXV A;  2BSK B;  4B3S O;  3UT5 B;  4UCS A;  4Z1V A;  7ICV A;  1E1R G;  1WP8 A;  2DWE C;  3WFS C;  5JH7 A;  4PDV A;  2JGD A;  4MTO A;  1HNW O;  4JLZ A;  3RJG A;  1I5Y A;  5D4B A;  1K4C C;  4PA6 A;  1WN7 A;  4LH6 A;  4X66 O;  4LF9 B;  3JPQ A;  3OT7 A;  5FNV A;  2HHP A;  4EED A;  5IE9 A;  4UB3 A;  2ZCE A;  3C2M A;  2ID1 A;  1SZT A;  4LFC B;  2Q67 A;  5A9G A;  1S77 D;  5J0W A;  2P66 A;  1RSO A;  3E22 B;  4HX0 A;  4D6T H;  3FYE B;  3APO A;  1QU7 A;  1NJI W;  4XUS A;  3V72 A;  1XL6 A;  1ZQN A;  2QKA A;  3J80 N;  1VP7 A;  1ZQY A;  2EZO A;  5AG2 A;  3FX7 A;  1PL0 A;  5BXZ A;  4MKP A;  1CEZ A;  2O1P A;  1H38 A;  1IBL B;  1JAJ A;  2N04 A;  1OCC B;  4WBZ A;  4RQ2 A;  3HKD A;  4LF9 O;  1JFF A;  4KLF A;  4DV2 O;  5EOZ A;  5JTG A;  2OCC B;  1PD3 A;  3TXS A;  3SJA C;  4FH5 A;  3QG5 A;  1S5L Z;  2RFF A;  2FTK A;  3UQ0 A;  1YTF D;  4JYC A;  4R6Z A;  2IH3 C;  5A2Q N;  2BSK A;  4MVS A;  4NYK A;  1N32 O;  5DDY A;  1HUO A;  3HKB B;  4JGS A;  1ZWI C;  2ZH2 A;  8ICR A;  4X9Q A;  4IGG A;  4MW8 A;  4W4K A;  1ZQE A;  4K3A A;  2ZDI C;  4DRX B;  4TUY B;  4X1Y B;  1QLN A;  4WFE A;  2H3O A;  1SQP H;  2ISP A;  1R8C A;  1RPR A;  1ZQA A;  5GTH Z;  2P06 A;  2ZH3 A;  1JQ0 A;  3NYB A;  3EFF K;  2HKO A;  2M2T A;  3HJ4 A;  3BY6 A;  4KLT A;  1YDX A;  3H37 A;  4WBY A;  4NLN A;  1VQP V;  4Q20 A;  1ZQT A;  1JJO A;  1HP8 A;  3K9A A;  1P84 F;  2X6A A;  4LF7 B;  2P4V A;  2YXY A;  3WG7 B;  4LFB B;  1Q82 W;  3B0X A;  2XAF A;  2QDO A;  2CUG A;  3MAQ A;  4I2C A;  5KUK A;  1EN5 A;  2LW1 A;  1GAX A;  1XEQ A;  1NTM H;  4B3T B;  3K57 A;  1K97 A;  1K34 A;  1KKD A;  3UQ8 A;  2O57 A;  4PGX A;  2YIA A;  2EJR A;  4PJ0 Z;  5DKW A;  4TUS A;  3W7S A;  4LF7 O;  3ICX A;  5HHI A;  4TUY A;  4X1Y A;  2VS0 A;  5H9C A;  4YJ2 A;  3B8N A;  4IHJ B;  4MTG A;  2Q6A A;  4ZOL B;  4RWP A;  4PPX A;  3ABL C;  4CBC A;  3NWI A;  3L72 H;  7ICS A;  4O2B A;  3FYI B;  2KQX A;  5LMU B;  5KHK A;  3AG1 B;  3JAS B;  4PV1 B;  3CWB H;  5HRF A;  4DR1 B;  4QZ8 A;  1TVA A;  2PXI A;  4R50 A;  3QO7 A;  5LGT A;  4B3T O;  3K9S A;  2ITD C;  2RJZ A;  3CHX A;  5IYD O;  4LF6 O;  4JV5 O;  4UB4 A;  5J2B A;  2ODM A;  1VQ6 V;  1LUV A;  5CB1 A;  5J2K A;  4DW1 A;  3AU2 A;  5CB4 B;  5EYP A;  3OGU A;  5EIB C;  5HRK A;  1FD9 A;  2BTQ A;  2XAH A;  3AU6 A;  4CS2 A;  2F95 B;  2ZH7 A;  3WFQ E;  5FPO A;  3MHH C;  4QZ9 A;  1XSL A;  2EIJ C;  1BMF G;  5B3S C;  5EBL C;  5C8Y B;  4I9W A;  2CDY A;  4X4V A;  2QKC A;  5LMU O;  1JMK C;  1ZQS A;  1VQ5 V;  3VQV A;  4HNA B;  3F7Y C;  3HKE A;  2BOB C;  1Q86 W;  2WA3 A;  3OVS A;  4X1I A;  4O68 A;  3AQN A;  4ZBM A;  3SGI A;  4AT8 B;  4YD2 A;  3TGU H;  2IHO A;  4CC5 A;  1KB9 F;  4RUF A;  1AVM A;  1SQB H;  5CHE A;  1N36 B;  2BPG A;  5BR8 B;  4NLZ A;  2FCL A;  1GTO A;  3UM7 A;  4WC2 A;  2AGA A;  4JF3 A;  4IHJ A;  2E3C A;  4ZOL A;  1K7D A;  1JQR A;  3FB8 C;  1XMO B;  3CX5 F;  1TFW A;  3RYC B;  4LZD A;  1V54 C;  3JAS A;  2D3O W;  4MTX A;  3OMI B;  5IIK A;  8ICW A;  5J0T A;  3ISC A;  4UVB A;  4XRH A;  1ORQ C;  3AG7 A;  1ZQV A;  4EP7 A;  4I2G A;  3ABK B;  3PNC A;  2JEX A;  2JS3 A;  4UCU A;  3PHZ A;  1WNS A;  1K73 W;  3RT3 C;  3K0D A;  4NM2 A;  1ZUQ A;  3ETD A;  4XA5 A;  3IC7 A;  3N2K A;  1N36 O;  4WCW A;  2OCH A;  3D36 A;  2P5O A;  5BR8 O;  2BCR A;  5L3B A;  1BQ0 A;  3KG2 A;  2F93 B;  4JYY A;  1OCZ B;  3I55 V;  2P4K A;  5HRG A;  1XMO O;  5IYB O;  2Y48 A;  3OUY B;  3STZ C;  3H3A A;  2DN9 A;  4LCU C;  1UEV A;  1M1K W;  2PI5 A;  4EGW A;  5D5P A;  1NVP B;  2ZH1 A;  5LHG A;  4AT8 A;  3TK1 A;  4PHD A;  1NBM G;  2HJF C;  8ICE A;  4MVR A;  5J2U B;  2YXL A;  2BBH A;  4WQK A;  3X2Q C;  1OV9 A;  3SPI A;  4NXZ A;  5KHH A;  1FKA O;  1ZQO A;  1YJ9 V;  5D61 A;  4JI2 O;  3RYF B;  4I5S A;  2YI8 A;  1BPY A;  5DBC A;  1HUZ A;  1QQC A;  4P4O A;  3JAL B;  4O6A A;  1NS1 A;  1RM1 C;  2DJV A;  3B8M A;  4XDJ A;  1WJZ A;  1E79 G;  1XOU A;  4BAY A;  2AZ2 A;  4ZI7 B;  2XAJ A;  1SKV A;  3ZHR A;  5KMG B;  4K9A A;  1VQM V;  4JI4 B;  4J7Z A;  3P32 A;  1SQQ H;  2YIC A;  4DK1 A;  1MG1 A;  1MIY A;  4RQ8 A;  4FLV A;  2BCQ A;  3AG4 C;  5JJN B;  1Q6I A;  3AG2 B;  4P4P A;  2WLM A;  4I0X A;  1TA8 A;  4EBJ A;  2UXC B;  1T5E A;  1SQV H;  3HPL C;  1YJW V;  1YZB A;  2ZHA A;  1K9M W;  4JAV A;  1FJG O;  4WC0 A;  4ASU G;  1MIW A;  1GH6 A;  2V1D A;  3PML A;  2PTM A;  1AI4 A;  4GX2 A;  3TXQ A;  1SQG A;  2EX3 A;  1VQ4 V;  2ZXW B;  3FD9 A;  4RWO A;  1O9H A;  2GDS A;  3L71 H;  2R9R B;  1AJN A;  5EBM C;  2IHM A;  4UFZ A;  1EN6 A;  4MFF A;  4GUN A;  4WC5 A;  2Q66 A;  8ICQ A;  1KYO F;  4JI6 B;  4X62 B;  4I4T B;  3OUY A;  1YF2 A;  5J2E A;  7ICQ A;  2NR5 A;  1TGO A;  4RQ0 A;  4FLU A;  5L3E A;  1NVP D;  1MZF A;  5LHI A;  4FM2 A;  2CH7 A;  4WC1 A;  2HEP A;  2QWQ B;  3B77 A;  2M2W A;  4TUR A;  4IQW A;  2UXC O;  3J81 N;  4GXK A;  1KP2 A;  3T1H B;  1Q78 A;  3LNM B;  4D7S A;  3ERC C;  3HW8 A;  8ICA A;  4U7O A;  3JAL A;  3IJ4 A;  2ZHB A;  1ROP A;  5LOV A;  2OIE A;  1JN3 A;  4RQ4 A;  4Z6D A;  2ISO A;  1NTZ H;  4BW9 A;  2Q7G A;  1GM8 A;  1M57 C;  2OYQ A;  2DR8 A;  2FMP A;  2BE3 A;  3ISB A;  5FPR A;  4JTC B;  1XRE A;  2W0X A;  3L75 H;  2YS8 A;  4LF8 O;  4ZHQ A;  4P4M A;  2WLN A;  1BHA A;  2P22 C;  5E1A C;  4E8F A;  4JWM A;  3SYQ A;  1THZ A;  4LR3 A;  1BE3 H;  4WC3 A;  4FLY A;  8ICH A;  1JMS A;  1CXZ B;  1R6T A;  4F6E A;  4A5U B;  3W7X A;  9ICU A;  3T1H O;  2BCC H;  2DOS A;  7ICJ A;  3C90 A;  4LT6 A;  3KCY A;  3ETG A;  3K58 A;  3E86 A;  9ICG A;  3K75 D;  7ICK A;  5J2G A;  1FAF A;  5HRL A;  1RZT A;  4IYH A;  3D36 C;  2R9A A;  1PX5 A;  3B0Y A;  3VOU A;  7ICE A;  2I9G A;  3RJH A;  4TQD A;  1TAE A;  3BA9 A;  5LA6 B;  3ZN0 A;  3Q4H A;  4DV1 B;  2YEV B;  5GON B;  4JYB A;  1XSP A;  3MHS C;  3DGE A;  5DDM A;  5IWA B;  3D3Q A;  1J5E B;  4EB6 A;  5KHJ A;  1Q90 D;  1ZQH A;  3ASO C;  3OR6 C;  4QZG A;  2GBO A;  2Q0A A;  3H39 A;  1VQK V;  4MT8 A;  4I2F A;  4XQ7 A;  2LGW A;  2QWO B;  3FKS G;  2NRK A;  3QO8 A;  5K1P A;  1W0K G;  4R63 A;  4WFG A;  9ICB A;  1F4N A;  3BVO A;  4KLH A;  4O2A B;  4M47 A;  3WB1 A;  2GUZ A;  1ZQR A;  1HWY A;  5HRH A;  5JCO A;  2ZM6 O;  4NXW A;  3JD2 A;  4DV1 O;  5HRD A;  1QVG U;  4JLX A;  3V7L A;  1BT8 A;  3E8B A;  1J5E O;  4QJF B;  5L3C A;  2ZE6 A;  2UXD B;  4AQY B;  3F5T A;  7ICP A;  2DQ0 A;  3T1Y B;  7ICR A;  2WSS G;  1R1B A;  5J2C A;  3P30 A;  2YDE A;  5B66 Z;  1PV0 A;  3ZBH A;  4M9G A;  3CD6 V;  4M2Y A;  1N33 B;  4R66 A;  2ZE5 A;  2WPD G;  1QHT A;  2JRI A;  3L9D A;  2G38 A;  5KHG A;  2BCV A;  5LA6 A;  3NKU A;  3DXR B;  5B3Q A;  5GON A;  1IXM A;  4K8V A;  3BAA A;  3G4S V;  3A8T A;  4X65 B;  4UB6 Z;  4NTW A;  1PNL A;  3JPN A;  2UXD O;  1L0L H;  4K97 A;  5EC1 C;  4DO9 A;  3T1Y O;  3ABM B;  1NTK H;  3AQK A;  2WLL A;  4MVQ A;  3H1J H;  1N33 O;  4GKJ O;  3SYO A;  3OVB A;  3C3T A;  1AI7 A;  2QR4 A;  2R9I A;  3K04 A;  4PA3 A;  2XT9 A;  1Y74 A;  3K03 A;  1HNX B;  3E2E A;  3OD4 A;  4O2A A;  2DVI A;  1M90 W;  1UEU A;  2ATK C;  4JI3 O;  1TUB B;  1VMG A;  1W0J G;  2ZT9 B;  5JJE B;  1WLE A;  4TQF A;  4U3J B;  4WBN A;  1KC8 W;  1JVM A;  4X65 O;  9ICS A;  1K3E A;  4EFE A;  1EZV H;  2F66 C;  3THO A;  5JJJ B;  5J0Q A;  3BPZ A;  4X20 A;  3GVM A;  3FB6 C;  5LYJ B;  4DV4 O;  4B3M B;  1Z5V A;  3OFN G;  5TIS Z;  5LGN A;  1OCR C;  4JWN A;  3OVA A;  1J95 A;  1FXK A;  4K96 A;  3VQW A;  2WLH A;  3ABL B;  3CRC A;  4AT7 B;  4RAI A;  4NKT A;  5CA1 A;  4YJ3 B;  4RT3 A;  4PHE A;  4JI0 B;  2UUB B;  3A2F A;  3F5W C;  3ZMS A;  2Q73 A;  4B08 A;  4LF4 B;  4PHA A;  1VJ7 A;  1QCE A;  2AW9 A;  2QA4 V;  2Q7H A;  2PFO A;  4I9Q A;  3RYI B;  4QE7 A;  1Y67 A;  1CP9 A;  1VFG A;  2A0L A;  2VAN A;  4U7N A;  4B3M O;  1WB8 A;  4LWS A;  4P9O A;  2ZD9 A;  4KLM A;  5CR0 A;  3AG3 C;  4PDL A;  5LGU A;  1OCO C;  1U97 A;  3F7V C;  2A7W A;  4I0U A;  1KMI Z;  5KA5 A;  1NT2 B;  1XUQ A;  2EIJ B;  3KKY A;  5B3S B;  2WWW A;  2ZH6 A;  4B7K A;  5DM6 V;  4AIL C;  4RO2 A;  2PFQ A;  1GPJ A;  5J2I A;  1BL8 A;  5IIM A;  1V55 C;  4JI0 O;  4LP8 A;  2UUB O;  4NTX A;  2GSM B;  1UFI A;  2QE7 G;  3AQL A;  3H1I H;  1M56 B;  4P2Z A;  3UO2 A;  5LYJ A;  2ZIO A;  1MA1 A;  2JS5 A;  3RYH B;  5DEC A;  4NXM O;  1LR1 A;  4KLO A;  3ZN1 A;  2PYJ A;  3RWR D;  1OHH G;  3MDS A;  3OWG A;  5HRI A;  4X88 A;  2RDC A;  2Y69 C;  1AR1 B;  4FO6 A;  1AJQ A;  4O5E A;  5HRE A;  1MIV A;  5KHI A;  4YY3 B;  5CJ7 A;  4YJ3 A;  4CH5 A;  3EHB B;  5HR9 A;  1FFX B;  4K8X A;  1Z2G A;  5JVD A;  3CPW U;  1IVS A;  3HB3 B;  2NLJ C;  1QVF U;  4PDM A;  2Q5Z A;  3AK3 A;  4TUQ A;  3A0B Z;  1I5X A;  1R3L C;  1K5Q A;  2F4V B;  2Q69 A;  2EIL B;  4DV7 B;  5EIB D;  4IQU A;  3ASN B;  9ICQ A;  4IG8 A;  1B04 A;  4LFC O;  3H1H H;  3H1L H;  3M7M X;  4KFM A;  1H2L A;  2E74 B;  2BCS A;  3WB0 A;  3T1C A;  3UXN A;  2DR5 A;  3ER8 C;  3UT5 A;  1US6 A;  2GA9 D;  4NLK A;  3SDL A;  1XHZ A;  1KD1 W;  1IBK B;  2B56 A;  3MBY A;  2B1I A;  1YHQ V;  3LSU A;  1WA8 B;  2QKS A;  4K4G A;  4O5C A;  5H6Q A;  1BGY H;  4PA7 A;  2QJ1 A;  3KCX A;  5IIN A;  4JTD B;  1QLE B;  2QM4 A;  3RYH A;  1BQZ A;  4N23 A;  5LXT B;  1IBL O;  3R65 A;  1A32 A;  3JD0 A;  5BZB A;  1SF9 A;  1JCH A;  4P9P A;  4J7K A;  2IUB A;  2Y0I A;  2YC0 A;  4K35 A;  4DV7 O;  3E22 A;  2Z3Y A;  3ZRS A;  2PGG A;  3WB2 A;  1KP3 A;  1KUQ A;  1CPY A;  1KU9 A;  5DED A;  4X0B A;  3VQY A;  4QZI A;  5LP6 B;  1FXK C;  4KLD A;  4QZB A;  3SJQ C;  4FMT A;  4O69 A;  1IBK O;  1GN2 A;  4KLU A;  1FPO A;  4F5N A;  4X4N A;  3ZCC A;  3OW2 U;  4DW0 A;  4DV6 B;  2XAG A;  1JJ2 U;  5KLV H;  4RQ3 A;  1PKX A;  2LP7 A;  2OTL V;  3LDC A;  5D46 A;  1VQO V;  4QZA A;  1XIL A;  2GHY A;  3RGB A;  9ICT A;  5J2A A;  4FVM A;  1EZJ A;  7ICM A;  3HKB A;  4GKK B;  2DQ3 A;  5B1A C;  2FML A;  3CS5 A;  3CE2 A;  1BPX A;  3W7W A;  3CB2 A;  1K8A W;  1YCI A;  5E79 Z;  1P7G A;  1WA8 A;  4TOI A;  4DRX A;  4PA4 A;  3ZHT A;  4RWQ A;  3C5G A;  4X4R A;  1XHX A;  1KNY A;  1JX9 A;  2QTS A;  4LFB O;  1GKF A;  2W0F C;  1F5A A;  1ZQJ A;  1VQ8 V;  5C93 A;  4FPP A;  2QGN A;  3LSS A;  4LEY A;  3HIY A;  4F5Q A;  4I2B A;  1S3J A;  1S5J A;  3OGC C;  1XBL A;  4X1K B;  4RQE A;  3RJI A;  1COW G;  3RN4 A;  4P2H A;  7ICG A;  1ZSP A;  1Z5W A;  1HR0 B;  4JAA A;  4X5V A;  1IDS A;  1B06 A;  1F7Y A;  4GKK O;  4DV3 B;  2ZNJ A;  5CBG A;  3CXC U;  5CFS A;  4TV8 B;  3K5M A;  4DO2 A;  1Y76 B;  4WCE V;  3I56 V;  1ZQU A;  3V7K A;  2IJK A;  2EJ7 A;  5B3P A;  4X4U A;  4PD4 F;  3OTO B;  2F43 G;  9ICI A;  2LJ2 A;  4YCX A;  4NB5 A;  4YHH B;  1KQS U;  3CCM V;  4IQT A;  1AIL A;  4DR1 O;  2ZH5 A;  1SC5 B;  1SZX A;  4X64 B;  1XNR B;  1L8D A;  4P30 A;  1X59 A;  2IJH A;  2AXT Z;  1HR0 O;  8ICP A;  1KEJ A;  2GTA A;  2HN1 A;  4OPH A;  4DV3 O;  3CCR V;  3RW0 A;  3CRA A;  2O5A A;  4DR2 B;  2CTQ A;  2Y4T A;  5J0P A;  1R3J C;  2HJD A;  1GM9 A;  4M04 A;  1RP3 B;  1QNM A;  3BEH A;  1TFY A;  2JJ1 G;  3G80 A;  2UUC B;  4Z6F A;  1PM9 A;  4TT3 G;  2W6J G;  3OTO O;  3ASO B;  3G6B A;  2YI9 A;  3JAR B;  3PJS K;  3WFV A;  4FHX A;  4UD4 A;  4YHH O;  3BFR A;  2P90 A;  4X64 O;  2B4V A;  2KB1 A;  1XNR O;  4LNU B;  1SA0 B;  1S72 V;  9ICP A;  5B1B B;  1Y66 A;  5IYZ B;  4UAZ A;  4DUZ B;  1WOT A;  5CB4 A;  1R73 A;  3H38 A;  1Y76 A;  3BCC H;  4PHZ A;  1BPD A;  5J2J A;  5DBA A;  4RPY A;  4R64 A;  3K08 A;  4DR2 O;  3RJF A;  3U10 A;  2QWN B;  4NTY A;  4M5D A;  4HAM A;  3ZHS A;  5C8Y A;  2UXX A;  4NKG B;  5J2D A;  3UQ2 A;  4HNA A;  1OCC C;  4BIU A;  5IY5 C;  4GX0 A;  3MGI A;  1L1F A;  1WPX A;  2OCC C;  3ISD A;  3ZRV A;  1XMQ B;  2FL4 A;  3C18 A;  1R6K A;  3TCU A;  9ICJ A;  4KLL A;  8ICL A;  4RT2 A;  2IBZ H;  4TUP A;  7ICF A;  4L87 A;  3S3W A;  4R8C A;  4TWK A;  3RYC A;  2V7Q G;  3C2K A;  4KP4 A;  3L74 H;  2PI4 A;  3JAR A;  5LHH A;  2A3Q A;  1S5H C;  4BIO A;  1KDH A;  3ZED A;  4NR1 A;  5HFL A;  2EIK B;  4FO1 A;  4QZH A;  4MVM A;  4J42 A;  2PY5 A;  9ICH A;  4CH4 A;  4BR6 A;  1XMQ O;  2YIB D;  4PGQ A;  2QWP B;  3JD1 A;  4LFA B;  4LEZ A;  4GCZ A;  1NOM A;  4KLI A;  2GV9 A;  2ITC C;  3P3P A;  3D8C A;  4K4I A;  1XQ8 A;  1V4A A;  3JD3 A;  3S3X A;  1M4U A;  3E35 A;  1GN3 A;  3K7D A;  1N4C A;  4JI4 O;  4I28 A;  3IFX A;  5GTI Z;  1NZ6 A;  2HP8 A;  4LC1 A;  3B40 A;  2IJJ A;  3P3N A;  5BY1 A;  3ETQ A;  5LMN B;  1YVW A;  1Q6H A;  4UCT A;  5J2U A;  1UET A;  1ZQC A;  1ZQQ A;  4EFB A;  2RCV A;  4G27 B;  1OCR B;  1LUW A;  4QGP A;  1AB3 A;  3RYF A;  4IT5 A;  4AT9 B;  4OAF A;  5IYC O;  9ICO A;  3UXP A;  3JD4 A;  3ETE A;  5J9P C;  3AK2 A;  4ZI7 A;  5KMG A;  2E75 B;  4M9L A;  4PDR A;  1GN4 A;  4I2E A;  8ICO A;  1VEW A;  1YI2 V;  2DYS B;  4I2D A;  4X8A A;  2IU0 A;  4KLS A;  4X62 O;  4JI6 O;  1RPL A;  2Z5U A;  4DR6 B;  4GLX A;  3MDA A;  3AG1 C;  8ICF A;  3ZHU A;  1Q81 W;  1ARO P;  3AG3 B;  3RH4 A;  3IC9 A;  4K98 A;  1Q43 A;  1F4M A;  4EKW A;  3RJK A;  5LBQ A;  1IX9 A;  4MF2 A;  1PNM A;  3G67 A;  5F2V O;  3N27 A;  4UVA A;  4RUE A;  2ZH8 A;  4GX5 A;  4I4T A;  4B3R B;  2MK3 A;  4F4L A;  1BPB A;  3JCF A;  2ZE7 A;  5CBF A;  1SQF A;  5KAF Z;  2XAQ A;  4DR6 O;  3RJE A;  2WLJ A;  1EFR G;  1N34 B;  3CYO A;  1E1Q G;  4Z1M G;  1V9P A;  4FHW A;  1AP5 A;  1R8A A;  4X4Q A;  5HC9 A;  1H2S B;  4XDL A;  2HG5 C;  2ZNI A;  4H37 A;  1WPB A;  3T2M A;  1OZ0 A;  9ICE A;  1QR9 A;  4NM1 A;  1MNG A;  2ZE8 A;  4LEW A;  5CBH A;  8ICC A;  1VF5 B;  2B1G A;  2UUA B;  4KXR A;  4M0A A;  1BPZ A;  2VWJ A;  1Y6X A;  3JZ0 A;  2JIZ G;  3BA8 A;  1N34 O;  2P6J A;  1VF6 A;  3JAW B;  5B1O A;  3CRR A;  5ITZ B;  3K5N A;  2DWD C;  2FMQ A;  2HVJ C;  2Z0A A;  3T4Z A;  5IWA O;  1S76 D;  3ABK C;  2LO1 A;  4MTF A;  1ZQG A;  1XDC A;  2BOC C;  4DR4 B;  3W7U A;  4QZC A;  3QTC A;  1VQ9 V;  8ICS A;  8ICU A;  1I94 B;  4CZZ A;  2HHH B;  2ILM A;  5IIL A;  2M2V A;  2UUA O;  1FYJ A;  1OCZ C;  2BPF A;  2DMX A;  4O67 A;  2B5U A;  2QSA A;  1Q79 A;  2YEV A;  3E8H A;  4LEV A;  2E5L B;  3C5F A;  4O4H B;  1IXB A;  3JAT B;  2CGN A;  4UVC A;  3U0Z A;  4FLZ A;  2M7W A;  1DGS A;  1H8H G;  4AQY O;  4WFA V;  3V7J A;  3ZRX A;  2V4D A;  4JI8 B;  4DV0 B;  3JCU Z;  2UXN A;  3DC6 A;  1NQT A;  2HHH O;  3MCR A;  2XTA A;  1R6N A;  1AP6 A;  2DE0 X;  5CFU A;  2EUL A;  3SYA A;  4FM0 A;  3SPH A;  3D3I A;  2OIG A;  5L3G A;  3JAW A;  2BTO A;  3SPC A;  3ER9 B;  2DW4 A;  3PN1 A;  5IIJ A;  4QNH B;  3H1K H;  5ITZ A;  4I55 B;  3C66 A;  3AG2 C;  4KLJ A;  2E5L O;  4BW5 A;  1H2M A;  8ICM A;  4J9Y B;  1HDJ A;  3W7T A;  3B2E E;  2JJ2 G;  2VQF B;  5BPC A;  3E83 A;  1MZE A;  2Q7E A;  4PH5 A;  4UV9 A;  4DOB A;  8ICV A;  2YID A;  4X4P A;  3QNE A;  5L3D A;  4XQ8 A;  2ZXW C;  4H33 A;  1MMM A;  3RH5 A;  4JI8 O;  4DV0 O;  2ZDI A;  4UD5 A;  4GXI A;  4QE9 A;  1HNX O;  3CRM A;  1XSN A;  1MAB G;  3DXR A;  4DOA A;  4HZ3 A;  1GM7 A;  4R65 A;  3T4D A;  4O4H A;  4UBB A;  4GXJ A;  3OAA G;  1JPX A;  3JAT A;  4KUM A;  4FIP C;  4NXN B;  3G71 V;  4DR7 B;  2R70 A;  1MOF A;  4RQF A;  2WLK A;  5J0X A;  3OV7 A;  5H6R A;  2PFP A;  4PHP A;  2WLI B;  4E4E A;  1UJW B;  3AEI A;  1IBM B;  3CSX A;  2PZS A;  5KUM A;  2M6Y A;  4YIP A;  1FA0 A;  3ZIA G;  4JTA B;  5KX5 B;  3OUF A;  2OWO A;  3K79 A;  3MGH A;  2XND G;  2BPC A;  4QPJ A;  1TUB A;  4PI2 A;  3GWK C;  1AR5 A;  3B09 A;  4N21 A;  3ZHQ A;  1IZ3 A;  3CCL V;  4CC6 A;  4X66 B;  4U3J A;  4E2L A;  5DB6 A;  1ZL8 B;  4K9B A;  3CXH F;  4ZIB A;  4OAI Z;  4WF9 V;  2FMS A;  3HKD B;  4LF4 O;  2PFN A;  1JFF B;  3Q4H B;  9ICC A;  1NR1 A;  4NXN O;  5JCO C;  4DR7 O;  4UB1 A;  5CA0 B;  4G2K A;  5H2F Z;  2JVD A;  3M8A A;  2KG7 B;  4O4L B;  5D5Q A;  1SRY A;  1JR9 A;  3JYC A;  5CWR A;  4JYA B;  1VQ7 V;  1ZAU A;  2NN4 A;  4LVS A;  2IM9 A;  1IBM O;  3WU2 Z;  4WOY A;  1L0N H;  3LNN A;  4UCO A;  2YSU B;  2JEU A;  4IYI A;  1EN4 A;  4MW3 A;  3LUT B;  3GDX A;  3OE7 G;  2XUM A;  3BHP A;  4AT7 A;  2QM7 A;  4RQ7 A;  4RQ5 A;  2E76 B;  4M9J A;  4XJE A;  1ZQL A;  1V54 B;  4YMN A;  5HHH A;  2PUS A;  1XL4 A;  3L73 H;  3K59 A;  4AI8 A;  4J10 A;  3B4S A;  3OEE G;  4LH7 A;  4FHY A;  3CCQ V;  4X4S A;  2N05 A;  4F5P A;  1KBH A;  1OJH A;  3LDE A;  4DV2 B;  4X4T A;  5EK0 A;  3NXS A;  1D5N A;  3RYI A;  2WLI A;  1PPJ H;  1VQL V;  3O9O A;  3C3S A;  4JYA O;  1N32 B;  5KX5 A;  1YJN V;  4N7R A;  2Q8V A;  1ZQK A;  9ICN A;  2X7R B;  1QR8 A;  4HBN A;  5HRB A;  4JAS A;  1M9N A;  5D62 A;  4FHP A;  3CC2 V;  4I50 B;  4MVZ A;  3FB5 C;  4YY3 O;  5TZV A;  1GMG A;  3AK1 A;  1ZL8 A;  1K92 A;  2RN9 A;  2JK5 C;  1NR7 A;  3KZI Z;  4YIO A;  4J11 A;  4YXW G;  3CCE V;  1X4T A; 
#chains in the Genus database with same CATH homology
 4QZF A;  2FMP A;  2DR8 A;  3RH6 A;  4NKU A;  4M04 A;  2BE3 A;  3ISB A;  5DBB A;  1TFY A;  7ICU A;  4Z6F A;  4P4M A;  4FHX A;  4E8F A;  4UD4 A;  4JWM A;  4UAW A;  4MFA A;  3RJJ A;  4WC3 A;  8ICH A;  5III A;  1JMS A;  4FH3 A;  1ZQI A;  9ICP A;  9ICU A;  4UAZ A;  1WOT A;  4UAY A;  2BCU A;  3AUO A;  7ICJ A;  4LT6 A;  3H38 A;  1MQ2 A;  5J0O A;  1BPD A;  5J2J A;  5DBA A;  4RPY A;  1ZQF A;  4R64 A;  9ICG A;  3RJF A;  3K75 D;  1MQ3 A;  9ICV A;  4KLE A;  7ICK A;  4WC4 A;  1ZJN A;  4M5D A;  3WFR E;  5J2G A;  5HRL A;  4UB5 A;  1RZT A;  1PX5 A;  3B0Y A;  7ICE A;  2I9G A;  3MDC A;  5J2D A;  2DR7 A;  3RJH A;  3UQ2 A;  4KLG A;  8ICI A;  4M9H A;  4QZD A;  5CP2 A;  1ZQZ A;  1XSP A;  3ISD A;  2GWS A;  5DDM A;  7ICH A;  4Z6C A;  1ZQX A;  3C18 A;  5J29 A;  1TV9 A;  1ZQH A;  9ICJ A;  4KLL A;  2DRB A;  8ICL A;  4RT2 A;  3JPS A;  1ZJM A;  4TUP A;  7ICF A;  4QZG A;  1ZQP A;  3H39 A;  4S3N A;  4I2F A;  4XQ7 A;  5BOM A;  3C2K A;  2NRK A;  3JYY A;  4X4O A;  4R63 A;  9ICB A;  1KDH A;  4KLH A;  4M47 A;  1ZQR A;  8ICB A;  5HRH A;  4QZH A;  5HRD A;  9ICX A;  7ICV A;  9ICH A;  3V7L A;  3WFS C;  2ZH4 A;  3RJG A;  4PGQ A;  5D4B A;  7ICP A;  8ICX A;  1NOM A;  3JPQ A;  4KLI A;  7ICR A;  2HHP A;  5J2C A;  4M9G A;  4WC6 A;  4YD1 A;  4UB3 A;  4M2Y A;  3C2M A;  4R66 A;  4K4I A;  1V4A A;  2ID1 A;  5J0W A;  2P66 A;  9ICA A;  3L9D A;  4I28 A;  3WFO A;  5J0R A;  8ICJ A;  2BCV A;  4XUS A;  3V72 A;  7ICN A;  1ZQN A;  1UET A;  1ZQC A;  1ZQQ A;  1R89 A;  1ZQY A;  9ICL A;  3TFS A;  1NO5 A;  3JPN A;  4AT9 B;  2O1P A;  1JAJ A;  9ICO A;  4WBZ A;  3UXP A;  3WFP A;  4RQ2 A;  4DO9 A;  4KLF A;  3AQK A;  5EOZ A;  5DB7 A;  4M9L A;  3TFR A;  4FH5 A;  2RFF A;  3UPQ A;  4I2E A;  3JPO A;  3OVB A;  8ICO A;  5D49 A;  4I2D A;  3UQ0 A;  4KLS A;  1RPL A;  2DVI A;  1UEU A;  5DDY A;  1YLQ A;  3MDA A;  1HUO A;  3JPR A;  2ZH2 A;  8ICF A;  8ICR A;  4EBK A;  1ZQE A;  4I29 A;  4YN4 A;  5IIO A;  4PGY A;  4WC7 A;  3RH4 A;  9ICS A;  5J0Q A;  3RJK A;  5J2F A;  2ISP A;  4MF2 A;  1R8C A;  4RWN A;  1ZQA A;  5F2V O;  4YMM A;  5J0U A;  2ZH3 A;  3NYB A;  2M2T A;  2ZH8 A;  3C2L A;  3HJ4 A;  4JWN A;  3OVA A;  1BPB A;  4KLT A;  3H37 A;  4WBY A;  4NLN A;  3HJ1 A;  4AT7 B;  3RJE A;  4NKT A;  1ZQT A;  2DRA A;  4RT3 A;  5CA7 A;  4PHE A;  4FHW A;  4MF8 A;  1R8A A;  4PHA A;  4X4Q A;  5HC9 A;  1VJ7 A;  7ICL A;  8ICN A;  4O9M A;  2PFO A;  3B0X A;  5J0P A;  4I2C A;  1VFG A;  9ICE A;  2VAN A;  9ICR A;  8ICZ A;  5CHG A;  4NM1 A;  4KLM A;  4X0A A;  5CR0 A;  8ICC A;  4I2H A;  4M0A A;  1BPZ A;  4NY8 A;  3JZ0 A;  5DB8 A;  2ZH6 A;  4PGX A;  9ICM A;  4K4H A;  2PFQ A;  5DKW A;  5J2I A;  5IIM A;  4TUS A;  5BOL A;  2FMQ A;  5HHI A;  2W9M A;  3AQL A;  1BPE A;  4RWP A;  4PPX A;  1ZQG A;  7ICS A;  5J0S A;  5DEC A;  4KLO A;  5HRF A;  4QZC A;  4QZ8 A;  5HRI A;  8ICS A;  3AQM A;  1TVA A;  2PXI A;  8ICU A;  5IIL A;  3HWT A;  4FO6 A;  4O5E A;  2M2V A;  1ZQD A;  5HRE A;  1MIV A;  4UB4 A;  5J2B A;  2BPF A;  5CJ7 A;  1Q79 A;  5CB1 A;  5HR9 A;  4UBC A;  5J2K A;  1ZQB A;  3AU2 A;  3JPT A;  3OGU A;  3C5F A;  5HRK A;  3AU6 A;  2ZH7 A;  3WFQ E;  4QZ9 A;  1XSL A;  4ATB B;  4IQV A;  4TUQ A;  3V7J A;  4X4V A;  7ICT A;  1ZQS A;  4IQU A;  9ICK A;  3OVS A;  9ICW A;  4MFC A;  4IG8 A;  9ICQ A;  3AQN A;  4RQ1 A;  4AT8 B;  4YD2 A;  4I2J A;  2BCS A;  3UXN A;  2DR5 A;  7ICO A;  4NLK A;  5IIJ A;  3C66 A;  3MBY A;  4F5R A;  2BPG A;  8ICY A;  4KLJ A;  4NLZ A;  8ICM A;  4K4G A;  4O5C A;  4WC2 A;  5IIN A;  1JQR A;  4DOC A;  5BPC A;  1TFW A;  4LZD A;  4RQ6 A;  4PH5 A;  4DOB A;  8ICV A;  4X4P A;  8ICK A;  5IIK A;  4XQ8 A;  8ICW A;  5J0T A;  3ISC A;  3RH5 A;  4UD5 A;  4XRH A;  4GXI A;  1ZQW A;  1ZQV A;  1OU5 A;  4EP7 A;  4I2G A;  3PNC A;  5DED A;  1XSN A;  3HX0 A;  4DOA A;  4X0B A;  4QZI A;  4R65 A;  4NM2 A;  4YMO A;  4KLD A;  4XA5 A;  4UBB A;  4GXJ A;  4QZB A;  1ZQM A;  4I27 A;  4WCW A;  4KLU A;  5J0Y A;  4F5N A;  4X4N A;  2BCR A;  4RPZ A;  4AT9 A;  4ATB A;  5J0X A;  3OV7 A;  5HRG A;  2DR9 A;  2PFP A;  4PHP A;  9ICF A;  4RQ3 A;  3OUY B;  3H3A A;  5D46 A;  1FA0 A;  1UEV A;  4RPX A;  4QZA A;  4I2A A;  2ZH1 A;  4AT8 A;  9ICT A;  5J2A A;  4PHD A;  4E7X A;  3MGH A;  7ICM A;  2BPC A;  8ICE A;  4FHV A;  3UXO A;  4NXZ A;  1ZQO A;  1BPX A;  1BPY A;  5DBC A;  1HUZ A;  4P4O A;  5DB6 A;  2FMS A;  2PFN A;  8ICT A;  4RWQ A;  3PMN A;  3LK9 A;  3C5G A;  4UB1 A;  9ICC A;  4X4R A;  4I2I A;  1KNY A;  4O5K A;  2M2U A;  4LZG A;  4LVS A;  5CWR A;  1F5A A;  1ZQJ A;  1MIY A;  4RQ8 A;  2BCQ A;  4P4P A;  3HIY A;  4QZE A;  4KLQ A;  4F5Q A;  4I2B A;  4EBJ A;  3RJI A;  3GDX A;  2ZHA A;  4P2H A;  7ICG A;  4RQ7 A;  4AT7 A;  4M9N A;  4RQ5 A;  4WC0 A;  1MIW A;  2PBE A;  1ZQL A;  4M9J A;  5HHH A;  4YMN A;  3PML A;  4X5V A;  3UPS A;  7ICI A;  4UB2 A;  4FHY A;  3LQC B;  4RWO A;  4X4S A;  4F5P A;  5DB9 A;  1ZQU A;  2ZH9 A;  4X4T A;  2IHM A;  3V7K A;  4MFF A;  4WC5 A;  2Q66 A;  8ICQ A;  4X4U A;  3OUY A;  9ICI A;  4YCX A;  5J2E A;  4E80 A;  7ICQ A;  1R8B A;  4RQ0 A;  4IQT A;  2ZH5 A;  1ZQK A;  9ICN A;  4WC1 A;  4Z6E A;  5HRB A;  2M2W A;  4F5O A;  4TUR A;  4IQW A;  4FHP A;  4GXK A;  1Q78 A;  8ICG A;  3JPP A;  8ICP A;  3HW8 A;  5TZV A;  8ICA A;  1KEJ A;  2ZHB A;  1JN3 A;  2ISO A;  4RQ4 A;  4Z6D A;  2O5A A;  5J2H A;  3MGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...