3L9DA

The crystal structure of smu.1046c from streptococcus mutans ua159
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
198
Chain Sequence
MNWEEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINNKPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of smu.1046c from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords Putative GTP pyrophosphokinase
total genus 69
structure length 198
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 3l9dA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3l9dA01
4WC7A 4DOAA 4NKTA 3JPTA 4F5OA 4FO6A 1PX5A 1XSPA 4I29A 4YD2A 3OVSA 4RQ6A 4PGYA 5J2DA 4RT2A 4RQ3A 1KNYA 7ICEA 2DR8A 4MFCA 4P4PA 5IILA 4R66A 5J2HA 3C2MA 4K4HA 4O5KA 3HJ1A 1ZQDA 3C5GA 8ICKA 5DBCA 1ZQEA 3LQCB 4X5VA 5CWRA 4M04A 5J0WA 5J0PA 4PHAA 3JZ0A 4X4VA 4KLTA 3AQLA 4LZDA 4KLOA 3PMLA 4UB2A 5F2VO 2ZH8A 3C5FA 2ISPA 5DB7A 4UAYA 2PBEA 4IG8A 1BPEA 1BPDA 4TUSA 4WBYA 1YLQA 4Z6EA 5J2KA 4PHEA 4KLHA 7ICRA 2W9MA 5BPCA 4FH5A 1UEUA 1ZQZA 4WC0A 5BOLA 5J0XA 3RJIA 4IQVA 8ICTA 4WBZA 1ZQCA 2PFOA 2ZHBA 7ICTA 5DB8A 4RQ1A 4PGQA 1ZQQA 2M2VA 2DRAA 3RH5A 2FMSA 4NLKA 4KLUA 4XQ8A 5J2IA 4AT9B 2BCRA 4QZDA 5DECA 1F5AA 3AU6A 4O5CA 1BPYA 4UB4A 7ICNA 3UQ0A 7ICUA 4UAWA 9ICCA 5IIIA 3WFOA 4FHPA 1NO5A 2P66A 4FHWA 1MIYA 3V7JA 8ICMA 5HRLA 3H39A 4WC6A 5HRGA 4EBKA 2BCUA 5DEDA 5J2JA 1ZQWA 4XA5A 8ICYA 4M0AA 3UPSA 5HREA 3B0XA 1TVAA 4E7XA 2DR7A 4I2FA 4UB5A 4NM2A 2BPCA 4QZBA 4QZAA 8ICRA 3HJ4A 1ZQMA 4NLNA 3OVAA 4UBCA 9ICRA 4MF2A 3JPRA 4MFFA 4RQ2A 4F5PA 4RPYA 3HW8A 3OUYA 2O1PA 1ZQSA 4I27A 4I2DA 4WCWA 4KLDA 1ZJNA 3OV7A 1ZQHA 5IIKA 9ICNA 4DO9A 4YD1A 8ICQA 3H38A 5CP2A 2PXIA 1KDHA 4X4PA 4I2EA 7ICFA 2ZH3A 8ICGA 1MQ2A 4WC3A 4KLEA 2I9GA 8ICXA 4X4OA 3AUOA 4NLZA 4UD5A 1TV9A 4GXIA 4XQ7A 4ATBB 3RJEA 5HR9A 7ICQA 4FHXA 1HUZA 5HRIA 3JPSA 5J0QA 2NRKA 2M2UA 7ICJA 3HIYA 3RH6A 1ZQFA 7ICVA 9ICHA 2DRBA 4KLQA 1ZQJA 2DR5A 1WOTA 3ISBA 1BPXA 1ZQIA 4K4IA 4X4UA 4RQ7A 4P2HA 2HHPA 5J29A 3AQNA 2ZH5A 5IIMA 3RJJA 9ICKA 4UD4A 5DB6A 5IIOA 4WC4A 4QZHA 1R8AA 4WC5A 2FMPA 5EOZA 1ZQRA 8ICJA 3C2LA 3H3AA 4I2AA 1R8BA 1JMSA 4XUSA 2DVIA 3LK9A 3JPPA 4I2GA 4NM1A 5DDYA 3AU2A 3HX0A 5IINA 4I28A 4JWMA 1Q79A 4UB1A 4IQWA 4AT9A 2ZH1A 2ZH4A 3C2KA 3OUYB 4F5QA 8ICHA 2PFPA 1R8CA 1VJ7A 3RJHA 8ICWA 1HUOA 1Q78A 9ICEA 9ICIA 4LT6A 4I2CA 4NKUA 8ICAA 2FMQA 2M2TA 4PHPA 1UEVA 9ICQA 3C18A 4M9JA 4QZFA 5J2CA 4PHDA 2ZH6A 4GXJA 5IIJA 4QZCA 4F5RA 2BPFA 4UBBA 2ZHAA 8ICUA 9ICPA 5HHHA 2BCQA 4AT7A 5CJ7A 1KEJA 2RFFA 4AT8A 8ICBA 4WC1A 1ZQBA 5J0YA 4R65A 1TFWA 4X4NA 1FA0A 5D49A 4KLMA 4M9NA 8ICVA 4I2IA 3OGUA 3MGIA 1ZQOA 4KLLA 4WC2A 4X0AA 5J2GA 3WFQE 5DBAA 4QZEA 3PMNA 4S3NA 7ICKA 1OU5A 3OVBA 4TUQA 7ICLA 4RWOA 5CB1A 4Z6CA 4I2HA 4I2BA 5J2BA 4QZIA 3H37A 1ZQAA 9ICMA 4LZGA 9ICUA 2ISOA 3UPQA 3WFSC 4RPXA 5DKWA 3K75D 1MIWA 9ICLA 4RQ5A 4K4GA 1JAJA 4Z6FA 5DB9A 4F5NA 9ICVA 4X4SA 8ICNA 4KLIA 7ICGA 5D46A 4ATBA 4M47A 2VANA 4RWQA 1ZQVA 3JYYA 4NY8A 8ICEA 1V4AA 9ICAA 3L9DA 2ZH2A 8ICSA 1MIVA 1TFYA 9ICGA 2Q66A 8ICOA 3UXOA 1MQ3A 3RJFA 4GXKA 4X4QA 4AT8B 4PGXA 3UXPA 4M9GA 4RQ4A 3WFPA 3AQKA 3HWTA 4FHVA 4MFAA 8ICLA 5DBBA 5HHIA 4O9MA 8ICFA 4PH5A 1ZQUA 5J2FA 3C66A 4JWNA 4YMMA 1ZJMA 5CA7A 1ZQYA 3PNCA 9ICTA 4X4RA 3GDXA 1ZQLA 4KLJA 4IQTA 3MGHA 3TFSA 5HC9A 4M5DA 4P4MA 4RQ0A 1XSLA 4E8FA 4NXZA 4KLFA 3B0YA 3ISDA 4QZGA 4PPXA 2BPGA 3MBYA 4E80A 5J0TA 4P4OA 9ICBA 4DOCA 4EBJA 3V72A 4I2JA 4UAZA 9ICJA 4YCXA 4M9LA 3ISCA 5J2AA 2IHMA 3JPNA 8ICIA 9ICXA 4FH3A 1XSNA 4EP7A 1NOMA 5HRFA 7ICIA 4RPZA 4M2YA 2ZH7A 5CR0A 8ICZA 4TURA 4LVSA 1R89A 1RZTA 3WFRE 4X0BA 4TUPA 4KLGA 9ICWA 4QZ9A 1JQRA 1UETA 4X4TA 3JPQA 1ZQTA 5HRHA 4UB3A 9ICSA 4R64A 5J0RA 4Z6DA 1JN3A 4M9HA 1RPLA 3JPOA 2GWSA 4RQ8A 5CHGA 4AT7B 4IQUA 4KLSA 4R63A 5HRDA 3RJKA 4YMNA 4O5EA 5BOMA 4YMOA 3UQ2A 2ZH9A 1ZQXA 5HRBA 2BCVA 3V7KA 3NYBA 4RWNA 9ICOA 3UXNA 7ICSA 2BCSA 3RJGA 4XRHA 3MDCA 3AQMA 8ICPA 4QZ8A 4DOBA 4FHYA 3RH4A 5J2EA 2M2WA 7ICPA 2O5AA 5J0OA 8ICCA 5HRKA 5DDMA 4YN4A 5D4BA 3V7LA 1BPZA 2PFQA 1ZQKA 7ICHA 5J0SA 1ZQPA 1ZQNA 2PFNA 4MF8A 3MDAA 5J0UA 5TZVA 2BE3A 9ICFA 2ID1A 7ICOA 4RT3A 7ICMA 1ZQGA 3TFRA 2DR9A 1VFGA 1BPBA 4RWPA
chains in the Genus database with same CATH superfamily
4F5OA 3K3WA 4DR4B 1R1BA 3D36A 2ZNIA 1BS3A 3F5WC 4LWSA 3RW0A 1I94B 3K59A 1X59A 4RQ6A 5EBWC 4FLWA 5J2DA 3HKEA 1H8HG 4LNUA 3K04A 3ZRWA 1F23A 4BIOA 3CC4V 2ZM6O 4H13B 5IILA 4YJ2A 1YTFD 4QIWF 4K4HA 4O5KA 1MMMA 2K1EA 1M1KW 3NR7A 2PI4A 3TCUA 1KKDA 1Q82W 3HJ1A 1XNQO 3RBZA 5CB4A 1ZQDA 3E35A 3C5GA 2LW1A 4UCVA 8ICKA 2WPDG 4Z1MG 1V9PA 2GV9A 3EHBB 4X1YB 5HFMA 3ABLC 1JFFA 3HKCA 4M04A 5CN0A 5EZYB 3E8BA 4J7ZA 3AEIA 4LH6A 3QO8A 4KLOA 4FM0A 2IHOA 3PMLA 5B1BC 2V4DA 5F2VO 2ZH8A 5L3GA 5EIBC 3FB8C 2ZR3A 4IG8A 1FFXB 3ETDA 1BPDA 3H1JH 4JYAB 4WBYA 1NI8A 3KZIZ 3QF7A 4O2AB 5KHJA 1B6QA 4I7ZB 3J80N 4PHEA 1IDSA 1R3JC 1SC5B 2A3QA 4PDLA 1KECA 5C8YA 1M93A 3B2EE 3MHHC 5J2UA 1UEUA 3FYIB 4WC0A 5BOLA 2W6JG 2A79B 4QE7A 1US6A 4FK5C 2CH7B 3LDCA 7ICTA 1FXHA 2CTPA 4RQ1A 2X0LA 4PGQA 3JAKB 3DC5A 3JALB 2DRAA 1JOYA 2AGAA 3RH5A 1LUVA 4NLKA 4TUYB 5DECA 1BPYA 2ZIOA 4CBCA 5LP6C 4UAWA 2CTQA 3JYCA 2E76B 3CB2A 3FB7C 4FHPA 5IYZA 8ICMA 3HKDA 3FYEB 4EGWA 4J80A 3K5OA 1VIBA 3ZRWB 3T1YO 2Z3YA 1ZQWA 3L71H 4TT3G 4MTGA 4E7XA 4NM2A 3ABMC 2BPCA 1JR9A 4WH5A 4QZBA 5CB4B 2KQXA 2ATKC 1D2DA 3HJ4A 3OWGA 3OVAA 1NKDA 1FXVA 1NQTA 1S3JA 9ICRA 3B4SA 2UUAB 4MF2A 4WF9V 4RQ2A 4F5PA 3UKMA 4KP4A 3N27A 4UCSA 1BT8A 4B3SO 4I2DA 3CP1A 1IXBA 1ZJNA 5IIKA 1XREA 4ZBMA 3ERCC 3H38A 5CP2A 1KDHA 4I2EA 3SDLA 4JYAO 4X1IB 3VQYA 2ZH3A 1GKFA 4WC3A 1VF6C 2HG5C 3CHXA 4KLEA 2ZNJA 4JASA 8ICXA 3T4DA 3JD1A 4X8AA 3ZCCA 4UD5A 2LW7A 4ASUG 4O4LB 5FNVB 3SR2C 4O68A 4HBNA 4FHXA 2HJDA 5LP6B 1MABG 4MVZA 1WNSA 3B09A 5C93A 2NRKA 4J9YB 1WLEA 3JARA 3ZHSA 1HNWB 2OCCB 5KX5A 4MT8A 2DRBA 4HX0A 5IJ9A 2A06H 3SJCC 1F4NA 1WOTA 3ISBA 4O4HA 3CS5A 4LF7B 1V55B 2GDSA 3CCSV 2HHPA 5IIMA 2ZH5A 9ICKA 4FMTA 3CCLV 5DB6A 2IUBA 1R73A 4FZ1A 3C3SA 2FMPA 1NTMH 3HR0A 3BFRA 1ZQRA 3ETEA 1VF7A 2RMKB 3CCUV 4XUSA 4TV9B 1Q3EA 2EBOA 2OIEA 4KHPO 5DDYA 3WU2Z 5FPOA 2QM7A 3AU2A 3ZBHA 2Y69B 1Q79A 3G4SV 2JGDB 4YIPA 4DV1O 5JVDB 4PELA 4WBNB 3G71V 4I9QA 2ZH4A 3THOA 5KHIA 1BGYH 3AG4C 2QM8A 3CJHA 3RJHA 4B7KA 4CS2A 1IZ3A 2CGNA 9ICEA 9ICIA 2EIJC 8ICAA 1I5YA 1R6NA 4CC5A 2FMQA 4X1IA 2M2TA 1QVGU 1UEVA 3LNMB 1SS3A 3T2MA 4PA9A 4OGQB 4MVOA 5AG2A 3VOUA 1SZXA 5J2CA 2GUZB 2VQFB 1KP2A 3ZRXA 4GXJA 4QZCA 3EVKA 3QNEA 2UUCB 4N7RA 3LDEA 2N04A 1YXBA 2OIGA 5LA6B 2BSKB 3TETA 3CYOA 2BCQA 2Q8VA 2PTMA 1Z5WA 2RFFA 3LDDA 4R65A 4DV3B 5LBQA 2EIKC 4JF3A 4P30A 2Q6AA 4TOIA 4X4NA 1FA0A 3AG2C 3MGIA 4KLLA 4YHHO 4WC2A 4X0AA 4J42A 1SQBH 4LF7O 2CTWA 3PJSK 4YJ3B 4TV8B 4B3SB 5J2GA 3PMNA 5CBHA 4QZEA 4I50A 4S3NA 3GWOA 2EULA 4RWOA 2LGWA 4I2HA 1IBMB 1UFIA 4I2BA 3SYOA 4FZ0A 4DK1A 1WB8A 2YIDA 1OCOB 5IWAB 2JVDA 3BEHA 2HP8A 3P30A 4MVMA 4X65O 2EIJB 4J41A 1S72V 3U0ZA 9ICLA 2HVKC 3O65A 5BMVB 1AJNA 4F5NA 9ICVA 4X64O 1VARA 1D5AA 3G67A 4GLXA 2XAHA 4NXNB 2EIMB 5D46A 4B3TB 3ICXA 4O2BB 1K4CC 1ZQVA 4F6RA 3LNNA 4DR4O 2ZH2A 1S5LZ 2EINC 5LL6Y 4LP8A 3SYPA 8ICSA 3STLC 4R50A 1DF4A 3K0GA 9ICGA 4P9PA 2WSSG 2EIMC 4JI7B 5JQGB 4PGXA 4IHJA 4LC1A 5LMNO 2GTAA 4RQ4A 4LEWA 3AQKA 3G80A 4O9MA 2RCVA 1ZQUA 2L6LA 2Q68A 4X66O 2EINB 5J2FA 2XAGA 5EYPA 4YMMA 1ZQYA 5E79Z 9ICTA 2P6JA 5H2FZ 5B66Z 4TUYA 4Z2WA 2YI9A 4JLZA 1ZQLA 5JCOC 3KCYA 1T5EA 2QTOA 3F5TA 4O67A 4RQ0A 1XSLA 4E8FA 4NXMB 5J2TA 2P22C 4NXZA 4KLFA 1KKCA 5B5EZ 5IWAO 1X4TA 2PGGA 1GM7A 2BTOA 3JD0A 5J0TA 2BTQB 5BZBA 1IBLB 4MW8A 4X62O 2DQ0A 4EBJA 1Q90D 4LFCO 5FL7G 4OX9B 9ICJA 4I4TB 1OHHG 3ISCA 5IT9N 1NTZH 2WA4A 3BHPA 2F1MA 2XOKG 1AP6A 5J2UB 3OMIB 4EP7A 2EX3A 2Y4TA 3ASOC 2VQEB 1VQNV 4M2YA 2R9IA 3WB1A 2D3OW 3W7TA 1R89A 3OE7G 2LJ2A 3WFRE 3DC6A 4X0BA 2JEUA 1FXKA 1Q8IA 1ZQTA 4AQYO 4UB3A 4DR5B 4Z6DA 4E4EA 4UVBA 2Z0AA 1RPLA 1YJWV 1MZFA 4QPJA 4RQ8A 4LBEC 5CHGA 4DW1A 2X6AA 1GMGA 2Z5UA 2EZOA 2G38A 5LGNA 1P7BA 3CRCA 4NXVA 2QJ1A 1AB3A 3STZC 1SRYA 3NXSA 3K5LA 2B5UA 1RP3B 4U7NA 5KHKA 4UCTA 5HRBA 1FJGO 4DUZO 1AI7A 3NYBA 4RWNA 4RQEA 2ADQB 3RJGA 3H1LH 1I08A 4EKWA 3OFNG 8ICPA 4DV2B 2GA9D 5BY1A 4I55B 4K9BA 4DOBA 2KKWA 1SQPH 1S77D 3JAWB 2K9PA 1K8AW 2O5AA 1DF5A 4DR3O 3VQVA 1VQ8V 2BBJA 8ICCA 4B3MB 1N34O 5IY5B 3K5NA 1K73W 1H2NA 2XNDG 3FKSG 3RGBA 5K1XA 3AK2A 1VQLV 3CCQV 2IJJA 4K9AA 2PFQA 1UJWB 2A9HA 3SJBC 1ZQNA 4EFEA 5A9GA 1N36O 5K1PA 2JJ2G 1Z5VA 4G28B 2E5LB 1V54C 3HB3B 7ICOA 9ICFA 4LF6O 3IC7A 4UB8Z 1FPOA 1EM1A 1Q6HA 1WAZA 4DV5O 4FLZA 2W0FC 1R3LC 4RWPA 4WC7A 4DOAA 1XSPA 3UO3A 4MW3A 1K92A 4K8VA 1J5EO 3JARB 4YD2A 2LFRA 2UXDB 2Y0IA 4O69A 4PGYA 1KNYA 7ICEA 3I5DA 2W0XA 1UPGA 5J2HA 3C2MA 1XILA 3JSLA 3G6EV 1IBLO 4RWUA 2A0LA 2ZCEA 2H94A 5LHHA 4OX9O 1WPXA 3HPLC 1EN6A 3LQCB 1ZQEA 1OZ0A 1N32O 4X5VA 1D5NA 4JAVA 4LZDA 4YJ2B 3CD6V 3JD3A 5DB7A 3MDSA 4I50B 3DGEA 1BPEA 4DR3B 4TUSA 1G8MA 3JD4A 1S0VA 3A8TA 3LSQA 1AR4A 2M6YA 1HDJA 1JFFB 2V1DA 1QQCA 2UXBO 2WLHA 7ICRA 3CXCU 3ZHUA 3CCJV 1YIJV 4O4IB 1Y76B 4FH5A 4PDMA 4ICGA 5BXZA 3RJIA 1MNGA 2PFOA 3BRCA 3OR7C 4NXUA 2OT5A 3U11A 5LGUA 3E89A 4BIUA 1XUQA 4DV5B 4U3FH 4HYOA 1K7DA 3OW2U 4LF8B 4AT9B 2Q0AA 3AU6A 2XAJA 2UXCO 2F66C 1BHAA 1FS0G 4JZGA 1O9GA 1XBLA 4WFFA 1NO5A 2P66A 3J81N 3V7JA 1R3KC 1XQ8A 1FKAO 4WC6A 2CDYA 2OCCC 5EK0A 4EEBA 2YIAA 5J2JA 2UXDO 5CBGA 4XA5A 4IT5A 5B3PA 3GVMA 4DXWA 4JV5O 2YXLA 3RYFA 5ITZB 3B0XA 3UPSA 5HREA 1TVAA 4I2FA 1MG1A 3JCUZ 3RYHB 3CC2V 1K33A 5FLXN 1TUBB 4H44B 2LQTA 1N32B 1AJPA 3T1CA 4UBCA 3IFXA 3JPRA 4MFFA 2Q7GA 1ENVA 3CK6A 1JPXA 3OUYA 2O1PA 2QA4V 4I27A 2IJKA 1NTKH 2UXNA 4KLDA 3CE2A 4TQDA 9ICNA 2CTRA 4X66B 4X4PA 2CE4A 1FAFA 1MQ2A 8ICGA 2I9GA 2UUAO 4X4OA 3AUOA 3OT7A 3ABKC 4XQ7A 3RJEA 3D3QA 4K3AA 3CCRV 1YSCA 1VQOV 2GAFD 1TA8A 3OUFA 4JPRA 4OAIZ 1N0NA 4X1YA 2M2UA 5B3SB 2Q7EA 2D2CB 4LF5B 3PHZA 4IYHA 1WA8A 9ICHA 4KLQA 4DV7B 2JS3A 1P49A 4JAAA 1ZQJA 4LFCB 4ZHQA 2DR5A 1FYJA 4K4IA 4GZRB 4RQ7A 1E1QG 4P2ZA 2XHBA 3AQNA 4E2LA 1Q7YW 4UD4A 2BBHA 3FD9A 3SGIA 2ZM6B 2XAQA 3UM7A 1LUWA 5CFTA 1HNWO 5GTHZ 3C2LA 1FXKB 3H3AA 4RQFA 4JI2O 1W59A 1R8BA 2DVIA 3LK9A 2IM9A 5L3FA 1YEWA 3H1KH 1LR1A 3OM3B 5L3DA 3W7XA 3VBBA 1CEZA 1K97A 1XL6A 1K4DC 4BAYA 3OTFA 4IQWA 5JH7A 3A2FA 1GH6A 3B8MA 1OCOC 2KG7A 2Q67A 4ZOLB 3OUYB 2Q7HA 1NVPD 3BAAA 3QVNA 1R8CA 4WFEA 1YTFB 3L70H 4TV9A 1VJ7A 3M7MX 4W4KA 1HUOA 4LT6A 3OMAB 3RVYA 2KB1A 2NN4A 4J7KA 1PL4A 1OJHA 4M9JA 2EIKB 3AG1C 1CXZB 3TXQA 5CA0A 4DR6O 1ORQC 5IIJA 3AG2B 4BW5A 1MSWD 4DK0A 4DV2O 4BIZA 2ZHAA 1AR1B 1GTOA 4ZI7B 5LHGA 3RYCA 3S3WA 3ETGA 3F7YC 4GYCB 5HHHA 1XNRO 1QR9A 4RAIA 4AT7A 1KEJA 1RM1B 4AT8A 1ZQBA 5J0YA 3AG7A 3SYCA 1FFTB 4R7CA 3AG1B 5D49A 1RPOA 4M9NA 4LFBO 3E8FA 1HWYA 2HN2A 2X6BA 1ZQOA 5KAIZ 5IJ0A 2UUCO 2ZT9B 3Q4HA 4GUNA 1DK1A 5CA1B 2EJRA 1F7YA 2PZSA 1SQFA 1Y6XA 2Y69C 2QKCA 1HNXB 1XDCA 3NVOA 4QZIA 4K96A 5TISZ 2QEXV 1L0NH 4LZGA 1R6TA 1GM9A 3W7UA 3UPQA 4X1KB 3WFSC 3A0BZ 4JI2B 5DKWA 4I0UA 1AVMA 1GM8A 1KUQA 3SPCA 4DV6O 4J11A 2RN9A 3J7AU 2E5LO 3OEHG 4DV7O 1EN4A 2ZE7A 2BSKA 4JTCB 4ATBA 1V4AA 4Z1VA 4YXWG 5B1NA 3IC9A 1BSMA 1XMOO 3H01A 3MCRA 1MIVA 4FLVA 3K5MA 4L8JA 3ASOB 3JALA 3TGUH 1XL4A 1F51A 2EILC 4FJCC 4TV8A 3RJFA 3BCCH 1VQ4V 4AT8B 2HR3A 4JYCA 4X89A 4B3TO 4O2BA 4X4QA 3ER9B 5L3BA 3QG5A 3RFRA 1BQ0A 8ICLA 5DBBA 1NBMG 4PH5A 1JVMA 4JI7O 5IYZB 2UUBO 5LMUB 2QWQB 2VWKA 4JWNA 5IJ0B 4QNHB 4DV0O 5CA7A 2ZIMA 3P3NA 2UXBB 4XDJA 2ZQMA 3GDXA 4U7OA 3BY6A 2R9AA 3TFSA 5HC9A 1GN4A 1HNXO 5LA6A 3ISDA 3ZJZA 1YDXA 4AHCA 3CRMA 1Q6UA 5C8YB 3X2QC 5CHEA 9ICBA 1XMQB 4DOCA 1PPJH 1G1XB 1GN3A 2WLKA 3V72A 5J2AA 5GONB 5BR8O 4JV5B 3EF2A 8ICIA 4K0KB 4QGPA 9ICXA 2QWRB 2YXHA 1Y76A 3FB5C 3T1HO 2RDCA 1I94O 1NOMA 3SPJA 3PN1A 5HRFA 1EZVH 2IW5A 2WLMA 4DV6B 1P84F 3WB2A 1QU7A 5CR0A 4TURA 5EC1C 4JI4O 3L74H 1K5QA 2YDEA 1HP8A 1XMOB 2N05A 2VWJA 3OMNB 4H0LB 1JQ0A 9ICSA 2PYLA 5J0RA 1AROP 1GAXA 3AG3C 5KHHA 3JPOA 2GWSA 3SJAC 3ZRVA 1NJIW 3I55V 4O4HB 4MTFA 3FX7A 2FKXA 2JK5C 5EBMC 4YMOA 2ZH9A 2BCVA 3P3PA 1JA8A 4XBFA 9ICOA 3RYHA 3UXNA 7ICSA 4KL1A 1MZEA 4PI2A 3AQMA 1IBMO 1BZKA 4XDLA 4KXRA 2HVJC 3ZMZA 4FHYA 3RH4A 5J2EA 4FLUA 3C3TA 4FO1A 4D7TA 1QLNA 3LSUA 4FPPA 5J0OA 3CRRA 5JQGA 5DDMA 4YN4A 4IIJA 4IL6Z 1FJGB 1RPRA 3V7LA 3UT5B 1BPZA 1ZQKA 5J0SA 3RN4A 2PFNA 4MF8A 5DM6V 3B40A 1WJZA 5EYPB 1N4CA 1Y74A 1QLEB 5EC2C 5TZVA 4U3JB 3ZN1A 2B1GA 4PDVA 4K0KO 2YSUB 4FVMA 5IY5C 2ITCC 1N34B 1ZQGA 1WN7A 1EZJA 3GB7C 1G6UA 4DR2B 4AI8A 2A7WA 4JI4B 4I29A 4O6AA 2ODMA 1HNZO 4B3RO 5KUMA 4K35A 3ABUA 1AI5A 1XEQA 3FB6C 2LO1A 4KM5A 1M56C 4RQ3A 1IX9A 2ARHA 3ZHQA 2DR8A 4MFCA 1J5EB 1TUEB 4X20B 4R66A 3OEEG 1BHBA 3QO7A 3E86A 5B1AC 5JCOA 4HZ3A 2Q73A 1XMQO 3JAWA 3I56V 1K34A 2XTAA 4LCUC 1M56B 3OTOO 1BQZA 3SPGA 5J0PA 3FAVB 2F93B 4PHAA 4KLTA 1EBOA 1QR8A 3K08A 3Q4HB 4KB6A 5H6QA 1VQKV 2ZXWB 1JJ2U 2X7RB 4LFBB 2ZD9A 2P5OA 2HKOA 1NR1A 1SA0B 1YLQA 2BCCH 1V54B 5J2KA 3E22A 4DUYB 4NTXA 2GSMB 3ZMTA 4KLHA 5L3CA 3H1HH 1Y67A 4I5SA 5BPCA 2DYSB 4BR6A 1ZQZA 4ABMA 4X1KA 1H38A 1GN6A 3CCEV 8ICTA 1M9NA 3K7DA 1J95A 1QCEA 5CA0B 5DB8A 4U3JA 2E75B 3CRQA 1ZQQA 1CPYA 4F4LA 5FPRA 1CP9A 1SQVH 5J2IA 2BCRA 5LGTA 4GX0A 4QZDA 4MSWC 2ZR2A 7ICNA 1OCZC 4NXTA 2YEVB 1KP3A 3APQA 9ICCA 5IIIA 2DYSC 1RSOB 3WFOA 4MS2A 4EEDA 1HNZB 1S5JA 5JWPA 4FHWA 1MIYA 5HRLA 2B51A 2CK3G 5HRGA 3RVZA 3OGIB 2BCUA 1TVKA 5LHIA 4M0AA 1DLBA 2YIBD 1VQMV 4UB5A 2QE7G 5B1BB 4QZAA 8ICRA 1PKXA 4NLNA 2P4VA 4HNAB 1NVPB 1H8EG 4PA6A 4CS4A 1SZTA 1ROPA 3OTOB 4DV4O 4DR1O 2UU9B 5CFSA 2F43G 1I5XA 3CPWU 3OV7A 4K98A 1ZQHA 3ABMB 8ICQA 4UFZA 2JIZG 1E79G 2CUGA 1OCCB 3BPZA 4WFGA 4I4TA 3A0RA 1TV9A 4GXIA 4ATBB 4UV8A 5B1OA 5HR9A 7ICQA 2FB5A 4MKPA 2O57A 4N23A 5LYJA 3ZS8C 5E1AC 5J0QA 4JYBA 2X6CA 3HIYA 2ILMA 3L75H 2VRZA 3RH6A 7ICVA 1SQGA 5A2QN 2EZPA 4LF9O 3ABKB 3ABTA 2AHZA 2DWEC 2NR5A 2FL4A 4P2HA 3WG7C 4ZIBA 5J29A 4JZ2A 5IIOA 1O9HA 5J2TB 4QZHA 4GX2A 3ZMUA 3T1HB 5EOZA 4G27B 8ICJA 3N2KB 3KG2A 4DUYO 4I2AA 4I0XA 1NS1A 3JASB 4LF6B 4QJFB 3JPPA 4I2GA 4NM1A 3CC7V 3HKBA 3WG7B 3ZEDA 4I28A 4OXSA 4JWMA 1VEWA 4AT9A 2ZH1A 4K8ZA 4FLTA 1Q81W 4J7JA 8ICHA 4HAMA 5IYDO 1AP5A 4WFAV 8ICWA 1Q78A 4NKUA 3E83A 2DWDC 3B77A 1RM1C 4PHPA 9ICQA 3D36C 2N74A 4QZFA 3TXSA 4PD4F 2CGOA 4PHDA 2PYJA 2OCHA 2V7QG 1N33O 2NLJC 1WA8B 1AJQA 4UBBA 2GBOA 4ZHQB 4EV6A 3ZMVA 8ICUA 4IIJB 9ICPA 3LSSA 1W2BU 2Q4PA 2F4VO 2VS0A 4JI8O 3HKEB 4LNUB 2YXYA 1VF6A 3OAAG 2P90A 2YUAA 2QWOB 4JI0O 4KLMA 4MVUA 1DTOA 4I2IA 3K58A 4CH6A 2UU9O 4EB6A 2H3OA 2AZ0A 3WFQE 2DYRC 4FFBB 1OU5A 4TUQA 7ICLA 2B56A 1DGSA 4I9WA 5CB1A 3W7SA 4Z6CA 1Q86W 3L73H 4FIPC 5EZYA 3ASNB 4LEVA 2NNUA 4DR7O 5J2BA 3H37A 1YI2V 1WPBA 2LP7A 2DQ3A 3JASA 3RWRD 5KMGA 2F23A 1GN2A 5CA1A 1R6KA 2Q69A 4RPXA 4UV9A 4IYIA 4YIOA 5D5PA 5JJJB 3K75D 2UXCB 1MIWA 3L72H 2AZ2A 4UUJC 4FM1A 4K4GA 5GW7A 1WB7A 4LFAO 4X4SA 4DUZB 4K99A 4PI0A 4B08A 2ZDIA 4LF9B 4R8CA 1RFYA 4GKJB 1K3EA 3RYCB 1COWG 4NKGB 4RWQA 3RT3C 8ICEA 2ZE5A 4O4IA 3JATB 2WLLA 3BABA 1XOUA 4WFHA 1XHZA 1H2MA 3CX5F 1NT2B 1I7FA 3ETQA 1NR7A 4AQYB 8ICOA 5FNVA 2YIBA 2QGNA 5LMUO 4WQLA 3E2EA 3VQWA 1K9MW 4NB5A 2EWRA 4D6TH 3UXPA 4M9GA 5H6RA 2HLDG 4ZOLA 3WFPA 2KG7B 3HWTA 4FHVA 4MFAA 2IU0A 4PV1B 4JTDB 4DV1B 1ZX3A 1PV0A 4OPHA 1ZJMA 3PNCA 4X4RA 5KA6A 3CWBH 4GT1A 2UUBB 3BA9A 5KHGA 2IBZH 5EBLC 4P4MA 5BR8B 3OD4A 5JTGA 4LF4B 3B0YA 4R6ZA 1THZA 4ZI7A 3APOA 1TUBA 4KFMA 4QZGA 2H8PC 2VQFO 4UCOA 4KUMA 2BPGA 3MBYA 5D62A 2DJVA 1WP8A 5KMGB 4P4OA 5D61A 2B1IA 1OCRB 2EJ7A 2AHYA 2RNBA 2WLNA 4UAZA 4RUFA 1SQQH 2YS8A 4M9LA 4X9QA 1VQ9V 5H9CA 2IHMA 3JPNA 1KMIZ 3E8GA 4JI0B 4P9OA 5LP6A 4NXNO 1PP9H 4FH3A 2Y0PA 7ICIA 1NH2D 2ZH7A 2FYUH 4DV4B 1ZAUA 4LVSA 1AR5A 1HW7A 1RZTA 2DOSA 4UVAA 1M90W 4JI1O 5LXTB 4KLGA 1YF2A 1SKVA 1G4YB 4NVPA 5GONA 5IJ9B 4X4TA 4DW0A 1FFXA 3JPQA 5LOVA 5HRHA 2R9RB 4H37A 4R64A 4O4JA 1JN3A 3RYFB 5ITZA 4JLXA 4N21A 4CH4A 1VP7A 5LYJB 3JCZA 4KLSA 2QWPB 4R63A 2BOCC 3RJKA 4YMNA 1HR0O 4O5EA 1TAEA 3UQ2A 3UCSC 4NTYA 1ZQXA 3V7KA 2ZE8A 4X64B 2YI8A 1GK9A 3WB0A 2XASA 2BCSA 1PNMA 2ITDC 3AG3B 4MTOA 4GKJO 3H1IH 2YICA 4JI5O 4QZ8A 2OTJV 3SYAA 1AILA 1P4RA 2DE0X 5KAFZ 3D8CA 1JMKC 3CJHB 4JAUA 1H2LA 1U96A 2QWNB 1MOFA 4WQKA 2DW4A 3K9SA 4LF4O 3WFVA 2B4VA 4CZZA 5D4BA 1KQSU 4ZKIA 4I0XB 2ZXWC 5CMUA 1VQ7V 2FMLA 1ZQPA 4LWSB 1H2GA 1LNQA 3HKBB 2W6IG 4FLXA 3MDAA 1W0JG 2M7WA 5J0UA 2BE3A 2MW2B 4KHPB 7ICMA 3IAYA 3M99B 5D63A 1H2SB 3TFRA 1VFGA 2DR9A 4NKTA 3CCVV 5EIBD 3JPTA 4FO6A 1PX5A 2WLIB 5CFUA 1PNLA 5JJEB 4WCEV 4OAFA 1VQ5V 4DYLA 3OVSA 2FTKA 4JI6B 1Y74B 1NH2B 2QTSA 3JAKA 2LFSA 4MTXA 4RT2A 3HKCB 3ABLB 5KA5A 1Q5OA 1SF9A 4P4PA 1OCZB 1MA1A 2QDOA 3BA8A 1H2KA 4XJEA 3IGAC 3K9AA 2R70A 4X62B 1HR0B 4MVSA 1B06A 5DBCA 4AILC 3N2GA 5JH7B 4O2AA 5D5QA 1Y66A 1R3IC 1M5IA 5CWRA 2LGQA 1KYOF 2R72A 1Y4MA 5J0WA 4OPAA 1QBZA 4X4VA 3JZ0A 5KX5B 4JI8B 4Q20A 3AQLA 2ZE6A 4UB2A 3C5FA 2ISPA 1M57B 3KCXA 2ZDIC 4UAYA 3ZN0A 2PBEA 5B1AB 2JS5A 4FLYA 5L3EA 1S76D 3E8HA 1Q43A 3ZHTA 4JI3O 4Z6EA 3TJTA 2RQ6A 1QVFU 3D3IA 1WP7A 2W9MA 3QO5A 4EEQA 4WFBV 5IE9A 1JX9A 5J0XA 2GHYA 4IQVA 2WLJA 2IJHA 1TGOA 3LUTB 4WBZA 1N0JA 5HFLA 1ZQCA 3F7VC 2ZHBA 1EN5A 2Q5ZA 3DXRB 2M2VA 2FMSA 4KLUA 2KSDA 4XQ8A 4PA7A 4WBNA 5JVDA 4H33A 4K97A 4J9ZB 1ZTEA 1F5AA 4O5CA 3EXAA 4UB4A 3UQ0A 7ICUA 1B04A 2XAFA 4TQFA 1ZLZA 1GRJA 4MVQA 4K8XA 3H39A 3O9OA 2L35A 4EBKA 3JAMN 3DTUB 5DEDA 4JI6O 2E3CA 2RJZA 2GUZA 8ICYA 1V55C 2DR7A 4NYKA 1PM9A 1ZUQA 4CH5A 1ZQMA 1GPJA 2Y48A 1AI4A 3ZHVA 1IVSA 4X88A 4CH3A 1OCCC 4YY3O 4RPYA 3CCMV 4JYYA 4WOYA 3HW8A 2JRIA 4LH7A 3E22B 3C90A 1ZQSA 4WCWA 4FM2A 4LFAB 4DO9A 3UO2A 4YD1A 2PXIA 1IBKB 5B3SC 4CS3A 7ICFA 3R66A 5LMNB 4EFBA 1OV9A 2XUMA 1GO3F 4X20A 3JD2A 4NLZA 4DR6B 2B9ZA 3AG4B 4DRXA 2FCLA 1KB9F 3ZX6A 4LR3A 2QKAA 2IH3C 4W4LA 2WA3A 1HUZA 2Q9LA 1XHXA 5HRIA 3JATA 4XDKA 3JPSA 1XNRB 2QKSA 4MVRA 7ICJA 3CSXA 1VF5B 1PD3A 3DXRA 4NTWA 1ZQFA 3FFQA 4LF8O 3S3XA 1KC8W 4CC6A 2JJ1G 4IGGA 3TK1A 3EFFK 1VQPV 1BPXA 1ZQIA 4X4UA 4PA4A 1BE3H 3RJJA 2CAZC 4WC4A 3K0DA 1R8AA 4WC5A 5LXTA 3MHSC 4OAGA 3QTCA 5LOVB 1JMSA 2AXTZ 1FD9A 2AW9A 1I0HA 1BL8A 3HX0A 5IINA 3H9VA 3NWIA 1YITV 4UB1A 4DR2O 3RYIA 2HN1A 5JJNB 3C2KA 4F5QA 2PFPA 4F6EA 1FXKC 5B3QA 2P06A 4TSFG 4B7EA 1ZL8A 4PJ0Z 3VQXA 1L8DA 4I2CA 1YZBA 1QNMA 3ZMSA 2Y4UA 3C18A 4UVCA 2VQEO 1IURA 2CH7A 1TVKB 2F4VB 2OWOA 1XNQB 2ZH6A 4F5RA 2BPFA 1MSDA 1SERA 4YJ3A 1E1RG 4GX1A 2DYRB 4HNAA 1NU1H 4UB6Z 3ML0A 5CJ7A 3SPIA 4B3MO 8ICBA 4WC1A 1AI6A 1BMFG 1TFWA 2JDIG 1URFA 3ASNC 4PDRA 1SQXH 3R65A 4O4JB 8ICVA 5KLVH 3OGUA 2ETNA 1L1FA 4DV0B 2GTSA 2DMXA 5DBAA 3CRAA 7ICKA 3OVBA 3OGCC 3CEIA 4JGSA 1IBKO 4DV3O 3BVOA 4JI5B 5IDJA 1P7GA 1B3QA 3CXHF 1ZQAA 9ICMA 2HHHB 9ICUA 4RUEA 2ISOA 3K57A 3UT5A 2OYQA 5CA3A 2HFEC 4F6RB 1U97A 4PA3A 3JSNA 3RYIB 5GTIZ 3UQ8A 3K06A 2P7TC 3B8NA 4RQ5A 1JAJA 4Z6FA 5DB9A 1YVWA 3N2GB 4DR7B 1SA0A 1YJNV 4KLIA 2BOBC 4UXNA 1W0KG 3X2QB 2BTQA 1ZWIC 8ICNA 1JJOA 1ZL8B 3K03A 7ICGA 4M47A 2VANA 4O4LA 3T1YB 4GX5A 2QM4A 4IHJB 3HKDB 1YJ9V 3JYYA 4NY8A 2QR4A 1YCIA 3N2KA 9ICAA 3L9DA 4NR1A 3A0HZ 3SJQC 3ZHRA 1TFYA 2HJFC 2UXXA 5CBFA 3CMAV 2Q66A 2WLIA 3UXOA 1MQ3A 1N8RW 4DR1B 4GXKA 1XI1A 3ER8C 2DN9A 4FFBA 3G6BA 2ZINA 1RSOA 3JCFA 8ICFA 5HHIA 3C66A 4BWAA 4JI3B 4LEZA 1S5HC 2P67A 3FAVA 4PHZA 3AK1A 1L0LH 4JTAB 1A32A 4GKKB 4UCUA 1OCRC 4KLJA 1Z2GA 4IQTA 1NZ6A 3MGHA 4QPKA 2WAMA 5H5NA 4M5DA 2PF4E 1Q6IA 1PL0A 4FFKA 1KD1W 3SPHA 4BW9A 3KKYA 1M4UA 2JGDA 3MD0A 2MK3A 4UCRA 4PPXA 1SESA 1F4MA 4GCZA 5DN6G 4E80A 3CMEV 4NXMO 5IYBO 2IU3A 3GWKC 4D7SA 1VMGA 2IJIA 4I2JA 3U10A 4YCXA 1SETA 2WLLB 4EB6B 1PNKA 1EFRG 1K5SA 2PI5A 1XSNA 4G2KA 2QSAA 4B3RB 2JGUA 2YEVA 3NKUA 4DO2A 4RPZA 2EILB 4DR5O 3ZRSA 8ICZA 3K79A 1QHTA 5IYCO 1N33B 2WWWA 1QLEC 2YC0A 2P4KA 3M8AA 2IH1C 4TUPA 9ICWA 4QZ9A 4LEYA 1UETA 1JQRA 5J9PC 2F95B 2C2AA 4YY3B 2HHHO 4M9HA 4JI1B 1KU9A 4OAHA 4RO2A 4I55A 4J10A 4AT7B 4TWKA 4IQUA 4C7UA 5HRDA 5BOMA 3IJ4A 2ADPA 1KBHA 2XT9A 4NXWA 4NXXA 2OTLV 4GKKO 3W7WA 4A5UB 3DSQA 4QE9A 4XRHA 3MDCA 1ZSPA 1N36B 2PUSA 1IXMA 2M2WA 7ICPA 2ZKOA 3ZIAG 3OUSA 5BMVA 1YHQV 2E74B 4LF5O 4X65B 5HRKA 2Q0OC 3SYQA 1M57C 3OR6C 2HEPA 7ICHA 1VQ6V 4YHHB 4L87A 3P32A 3T4ZA 2JEXA 3AK3A 3MAQA 5KUKA 2ID1A 4Q6GA 4DRXB 4RT3A 1JCHA 1BCCH 2PY5A 1BPBA
chains in the Genus database with same CATH topology
4WC7A 4DOAA 4NKTA 3JPTA 4F5OA 4FO6A 1PX5A 1XSPA 4I29A 4YD2A 3OVSA 4RQ6A 4PGYA 5J2DA 4RT2A 4RQ3A 1KNYA 7ICEA 2DR8A 4MFCA 4P4PA 5IILA 4R66A 5J2HA 3C2MA 4K4HA 4O5KA 3HJ1A 1ZQDA 3C5GA 8ICKA 5DBCA 1ZQEA 3LQCB 4X5VA 5CWRA 4M04A 5J0WA 5J0PA 4PHAA 3JZ0A 4X4VA 4KLTA 3AQLA 4LZDA 4KLOA 3PMLA 4UB2A 5F2VO 2ZH8A 3C5FA 2ISPA 5DB7A 4UAYA 2PBEA 4IG8A 1BPEA 1BPDA 4TUSA 4WBYA 1YLQA 4Z6EA 5J2KA 4PHEA 4KLHA 7ICRA 2W9MA 5BPCA 4FH5A 1UEUA 1ZQZA 4WC0A 5BOLA 5J0XA 3RJIA 4IQVA 8ICTA 4WBZA 1ZQCA 2PFOA 2ZHBA 7ICTA 5DB8A 4RQ1A 4PGQA 1ZQQA 2M2VA 2DRAA 3RH5A 2FMSA 4NLKA 4KLUA 4XQ8A 5J2IA 4AT9B 2BCRA 4QZDA 5DECA 1F5AA 3AU6A 4O5CA 1BPYA 4UB4A 7ICNA 3UQ0A 7ICUA 4UAWA 9ICCA 5IIIA 3WFOA 4FHPA 1NO5A 2P66A 4FHWA 1MIYA 3V7JA 8ICMA 5HRLA 3H39A 4WC6A 5HRGA 4EBKA 2BCUA 5DEDA 5J2JA 1ZQWA 4XA5A 8ICYA 4M0AA 3UPSA 5HREA 3B0XA 1TVAA 4E7XA 2DR7A 4I2FA 4UB5A 4NM2A 2BPCA 4QZBA 4QZAA 8ICRA 3HJ4A 1ZQMA 4NLNA 3OVAA 4UBCA 9ICRA 4MF2A 3JPRA 4MFFA 4RQ2A 4F5PA 4RPYA 3HW8A 3OUYA 2O1PA 1ZQSA 4I27A 4I2DA 4WCWA 4KLDA 1ZJNA 3OV7A 1ZQHA 5IIKA 9ICNA 4DO9A 4YD1A 8ICQA 3H38A 5CP2A 2PXIA 1KDHA 4X4PA 4I2EA 7ICFA 2ZH3A 8ICGA 1MQ2A 4WC3A 4KLEA 2I9GA 8ICXA 4X4OA 3AUOA 4NLZA 4UD5A 1TV9A 4GXIA 4XQ7A 4ATBB 3RJEA 5HR9A 7ICQA 4FHXA 1HUZA 5HRIA 3JPSA 5J0QA 2NRKA 2M2UA 7ICJA 3HIYA 3RH6A 1ZQFA 7ICVA 9ICHA 2DRBA 4KLQA 1ZQJA 2DR5A 1WOTA 3ISBA 1BPXA 1ZQIA 4K4IA 4X4UA 4RQ7A 4P2HA 2HHPA 5J29A 3AQNA 2ZH5A 5IIMA 3RJJA 9ICKA 4UD4A 5DB6A 5IIOA 4WC4A 4QZHA 1R8AA 4WC5A 2FMPA 5EOZA 1ZQRA 8ICJA 3C2LA 3H3AA 4I2AA 1R8BA 1JMSA 4XUSA 2DVIA 3LK9A 3JPPA 4I2GA 4NM1A 5DDYA 3AU2A 3HX0A 5IINA 4I28A 4JWMA 1Q79A 4UB1A 4IQWA 4AT9A 2ZH1A 2ZH4A 3C2KA 3OUYB 4F5QA 8ICHA 2PFPA 1R8CA 1VJ7A 3RJHA 8ICWA 1HUOA 1Q78A 9ICEA 9ICIA 4LT6A 4I2CA 4NKUA 8ICAA 2FMQA 2M2TA 4PHPA 1UEVA 9ICQA 3C18A 4M9JA 4QZFA 5J2CA 4PHDA 2ZH6A 4GXJA 5IIJA 4QZCA 4F5RA 2BPFA 4UBBA 2ZHAA 8ICUA 9ICPA 5HHHA 2BCQA 4AT7A 5CJ7A 1KEJA 2RFFA 4AT8A 8ICBA 4WC1A 1ZQBA 5J0YA 4R65A 1TFWA 4X4NA 1FA0A 5D49A 4KLMA 4M9NA 8ICVA 4I2IA 3OGUA 3MGIA 1ZQOA 4KLLA 4WC2A 4X0AA 5J2GA 3WFQE 5DBAA 4QZEA 3PMNA 4S3NA 7ICKA 1OU5A 3OVBA 4TUQA 7ICLA 4RWOA 5CB1A 4Z6CA 4I2HA 4I2BA 5J2BA 4QZIA 3H37A 1ZQAA 9ICMA 4LZGA 9ICUA 2ISOA 3UPQA 3WFSC 4RPXA 5DKWA 3K75D 1MIWA 9ICLA 4RQ5A 4K4GA 1JAJA 4Z6FA 5DB9A 4F5NA 9ICVA 4X4SA 8ICNA 4KLIA 7ICGA 5D46A 4ATBA 4M47A 2VANA 4RWQA 1ZQVA 3JYYA 4NY8A 8ICEA 1V4AA 9ICAA 3L9DA 2ZH2A 8ICSA 1MIVA 1TFYA 9ICGA 2Q66A 8ICOA 3UXOA 1MQ3A 3RJFA 4GXKA 4X4QA 4AT8B 4PGXA 3UXPA 4M9GA 4RQ4A 3WFPA 3AQKA 3HWTA 4FHVA 4MFAA 8ICLA 5DBBA 5HHIA 4O9MA 8ICFA 4PH5A 1ZQUA 5J2FA 3C66A 4JWNA 4YMMA 1ZJMA 5CA7A 1ZQYA 3PNCA 9ICTA 4X4RA 3GDXA 1ZQLA 4KLJA 4IQTA 3MGHA 3TFSA 5HC9A 4M5DA 4P4MA 4RQ0A 1XSLA 4E8FA 4NXZA 4KLFA 3B0YA 3ISDA 4QZGA 4PPXA 2BPGA 3MBYA 4E80A 5J0TA 4P4OA 9ICBA 4DOCA 4EBJA 3V72A 4I2JA 4UAZA 9ICJA 4YCXA 4M9LA 3ISCA 5J2AA 2IHMA 3JPNA 8ICIA 9ICXA 4FH3A 1XSNA 4EP7A 1NOMA 5HRFA 7ICIA 4RPZA 4M2YA 2ZH7A 5CR0A 8ICZA 4TURA 4LVSA 1R89A 1RZTA 3WFRE 4X0BA 4TUPA 4KLGA 9ICWA 4QZ9A 1JQRA 1UETA 4X4TA 3JPQA 1ZQTA 5HRHA 4UB3A 9ICSA 4R64A 5J0RA 4Z6DA 1JN3A 4M9HA 1RPLA 3JPOA 2GWSA 4RQ8A 5CHGA 4AT7B 4IQUA 4KLSA 4R63A 5HRDA 3RJKA 4YMNA 4O5EA 5BOMA 4YMOA 3UQ2A 2ZH9A 1ZQXA 5HRBA 2BCVA 3V7KA 3NYBA 4RWNA 9ICOA 3UXNA 7ICSA 2BCSA 3RJGA 4XRHA 3MDCA 3AQMA 8ICPA 4QZ8A 4DOBA 4FHYA 3RH4A 5J2EA 2M2WA 7ICPA 2O5AA 5J0OA 8ICCA 5HRKA 5DDMA 4YN4A 5D4BA 3V7LA 1BPZA 2PFQA 1ZQKA 7ICHA 5J0SA 1ZQPA 1ZQNA 2PFNA 4MF8A 3MDAA 5J0UA 5TZVA 2BE3A 9ICFA 2ID1A 7ICOA 4RT3A 7ICMA 1ZQGA 3TFRA 2DR9A 1VFGA 1BPBA 4RWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC7 A;  4DOA A;  4NKT A;  3JPT A;  4F5O A;  4FO6 A;  1PX5 A;  1XSP A;  4I29 A;  4YD2 A;  3OVS A;  4RQ6 A;  4PGY A;  5J2D A;  4RT2 A;  4RQ3 A;  1KNY A;  7ICE A;  2DR8 A;  4MFC A;  4P4P A;  5IIL A;  4R66 A;  5J2H A;  3C2M A;  4K4H A;  4O5K A;  3HJ1 A;  1ZQD A;  3C5G A;  8ICK A;  5DBC A;  1ZQE A;  3LQC B;  4X5V A;  5CWR A;  4M04 A;  5J0W A;  5J0P A;  4PHA A;  3JZ0 A;  4X4V A;  4KLT A;  3AQL A;  4LZD A;  4KLO A;  3PML A;  4UB2 A;  5F2V O;  2ZH8 A;  3C5F A;  2ISP A;  5DB7 A;  4UAY A;  2PBE A;  4IG8 A;  1BPE A;  1BPD A;  4TUS A;  4WBY A;  1YLQ A;  4Z6E A;  5J2K A;  4PHE A;  4KLH A;  7ICR A;  2W9M A;  5BPC A;  4FH5 A;  1UEU A;  1ZQZ A;  4WC0 A;  5BOL A;  5J0X A;  3RJI A;  4IQV A;  8ICT A;  4WBZ A;  1ZQC A;  2PFO A;  2ZHB A;  7ICT A;  5DB8 A;  4RQ1 A;  4PGQ A;  1ZQQ A;  2M2V A;  2DRA A;  3RH5 A;  2FMS A;  4NLK A;  4KLU A;  4XQ8 A;  5J2I A;  4AT9 B;  2BCR A;  4QZD A;  5DEC A;  1F5A A;  3AU6 A;  4O5C A;  1BPY A;  4UB4 A;  7ICN A;  3UQ0 A;  7ICU A;  4UAW A;  9ICC A;  5III A;  3WFO A;  4FHP A;  1NO5 A;  2P66 A;  4FHW A;  1MIY A;  3V7J A;  8ICM A;  5HRL A;  3H39 A;  4WC6 A;  5HRG A;  4EBK A;  2BCU A;  5DED A;  5J2J A;  1ZQW A;  4XA5 A;  8ICY A;  4M0A A;  3UPS A;  5HRE A;  3B0X A;  1TVA A;  4E7X A;  2DR7 A;  4I2F A;  4UB5 A;  4NM2 A;  2BPC A;  4QZB A;  4QZA A;  8ICR A;  3HJ4 A;  1ZQM A;  4NLN A;  3OVA A;  4UBC A;  9ICR A;  4MF2 A;  3JPR A;  4MFF A;  4RQ2 A;  4F5P A;  4RPY A;  3HW8 A;  3OUY A;  2O1P A;  1ZQS A;  4I27 A;  4I2D A;  4WCW A;  4KLD A;  1ZJN A;  3OV7 A;  1ZQH A;  5IIK A;  9ICN A;  4DO9 A;  4YD1 A;  8ICQ A;  3H38 A;  5CP2 A;  2PXI A;  1KDH A;  4X4P A;  4I2E A;  7ICF A;  2ZH3 A;  8ICG A;  1MQ2 A;  4WC3 A;  4KLE A;  2I9G A;  8ICX A;  4X4O A;  3AUO A;  4NLZ A;  4UD5 A;  1TV9 A;  4GXI A;  4XQ7 A;  4ATB B;  3RJE A;  5HR9 A;  7ICQ A;  4FHX A;  1HUZ A;  5HRI A;  3JPS A;  5J0Q A;  2NRK A;  2M2U A;  7ICJ A;  3HIY A;  3RH6 A;  1ZQF A;  7ICV A;  9ICH A;  2DRB A;  4KLQ A;  1ZQJ A;  2DR5 A;  1WOT A;  3ISB A;  1BPX A;  1ZQI A;  4K4I A;  4X4U A;  4RQ7 A;  4P2H A;  2HHP A;  5J29 A;  3AQN A;  2ZH5 A;  5IIM A;  3RJJ A;  9ICK A;  4UD4 A;  5DB6 A;  5IIO A;  4WC4 A;  4QZH A;  1R8A A;  4WC5 A;  2FMP A;  5EOZ A;  1ZQR A;  8ICJ A;  3C2L A;  3H3A A;  4I2A A;  1R8B A;  1JMS A;  4XUS A;  2DVI A;  3LK9 A;  3JPP A;  4I2G A;  4NM1 A;  5DDY A;  3AU2 A;  3HX0 A;  5IIN A;  4I28 A;  4JWM A;  1Q79 A;  4UB1 A;  4IQW A;  4AT9 A;  2ZH1 A;  2ZH4 A;  3C2K A;  3OUY B;  4F5Q A;  8ICH A;  2PFP A;  1R8C A;  1VJ7 A;  3RJH A;  8ICW A;  1HUO A;  1Q78 A;  9ICE A;  9ICI A;  4LT6 A;  4I2C A;  4NKU A;  8ICA A;  2FMQ A;  2M2T A;  4PHP A;  1UEV A;  9ICQ A;  3C18 A;  4M9J A;  4QZF A;  5J2C A;  4PHD A;  2ZH6 A;  4GXJ A;  5IIJ A;  4QZC A;  4F5R A;  2BPF A;  4UBB A;  2ZHA A;  8ICU A;  9ICP A;  5HHH A;  2BCQ A;  4AT7 A;  5CJ7 A;  1KEJ A;  2RFF A;  4AT8 A;  8ICB A;  4WC1 A;  1ZQB A;  5J0Y A;  4R65 A;  1TFW A;  4X4N A;  1FA0 A;  5D49 A;  4KLM A;  4M9N A;  8ICV A;  4I2I A;  3OGU A;  3MGI A;  1ZQO A;  4KLL A;  4WC2 A;  4X0A A;  5J2G A;  3WFQ E;  5DBA A;  4QZE A;  3PMN A;  4S3N A;  7ICK A;  1OU5 A;  3OVB A;  4TUQ A;  7ICL A;  4RWO A;  5CB1 A;  4Z6C A;  4I2H A;  4I2B A;  5J2B A;  4QZI A;  3H37 A;  1ZQA A;  9ICM A;  4LZG A;  9ICU A;  2ISO A;  3UPQ A;  3WFS C;  4RPX A;  5DKW A;  3K75 D;  1MIW A;  9ICL A;  4RQ5 A;  4K4G A;  1JAJ A;  4Z6F A;  5DB9 A;  4F5N A;  9ICV A;  4X4S A;  8ICN A;  4KLI A;  7ICG A;  5D46 A;  4ATB A;  4M47 A;  2VAN A;  4RWQ A;  1ZQV A;  3JYY A;  4NY8 A;  8ICE A;  1V4A A;  9ICA A;  3L9D A;  2ZH2 A;  8ICS A;  1MIV A;  1TFY A;  9ICG A;  2Q66 A;  8ICO A;  3UXO A;  1MQ3 A;  3RJF A;  4GXK A;  4X4Q A;  4AT8 B;  4PGX A;  3UXP A;  4M9G A;  4RQ4 A;  3WFP A;  3AQK A;  3HWT A;  4FHV A;  4MFA A;  8ICL A;  5DBB A;  5HHI A;  4O9M A;  8ICF A;  4PH5 A;  1ZQU A;  5J2F A;  3C66 A;  4JWN A;  4YMM A;  1ZJM A;  5CA7 A;  1ZQY A;  3PNC A;  9ICT A;  4X4R A;  3GDX A;  1ZQL A;  4KLJ A;  4IQT A;  3MGH A;  3TFS A;  5HC9 A;  4M5D A;  4P4M A;  4RQ0 A;  1XSL A;  4E8F A;  4NXZ A;  4KLF A;  3B0Y A;  3ISD A;  4QZG A;  4PPX A;  2BPG A;  3MBY A;  4E80 A;  5J0T A;  4P4O A;  9ICB A;  4DOC A;  4EBJ A;  3V72 A;  4I2J A;  4UAZ A;  9ICJ A;  4YCX A;  4M9L A;  3ISC A;  5J2A A;  2IHM A;  3JPN A;  8ICI A;  9ICX A;  4FH3 A;  1XSN A;  4EP7 A;  1NOM A;  5HRF A;  7ICI A;  4RPZ A;  4M2Y A;  2ZH7 A;  5CR0 A;  8ICZ A;  4TUR A;  4LVS A;  1R89 A;  1RZT A;  3WFR E;  4X0B A;  4TUP A;  4KLG A;  9ICW A;  4QZ9 A;  1JQR A;  1UET A;  4X4T A;  3JPQ A;  1ZQT A;  5HRH A;  4UB3 A;  9ICS A;  4R64 A;  5J0R A;  4Z6D A;  1JN3 A;  4M9H A;  1RPL A;  3JPO A;  2GWS A;  4RQ8 A;  5CHG A;  4AT7 B;  4IQU A;  4KLS A;  4R63 A;  5HRD A;  3RJK A;  4YMN A;  4O5E A;  5BOM A;  4YMO A;  3UQ2 A;  2ZH9 A;  1ZQX A;  5HRB A;  2BCV A;  3V7K A;  3NYB A;  4RWN A;  9ICO A;  3UXN A;  7ICS A;  2BCS A;  3RJG A;  4XRH A;  3MDC A;  3AQM A;  8ICP A;  4QZ8 A;  4DOB A;  4FHY A;  3RH4 A;  5J2E A;  2M2W A;  7ICP A;  2O5A A;  5J0O A;  8ICC A;  5HRK A;  5DDM A;  4YN4 A;  5D4B A;  3V7L A;  1BPZ A;  2PFQ A;  1ZQK A;  7ICH A;  5J0S A;  1ZQP A;  1ZQN A;  2PFN A;  4MF8 A;  3MDA A;  5J0U A;  5TZV A;  2BE3 A;  9ICF A;  2ID1 A;  7ICO A;  4RT3 A;  7ICM A;  1ZQG A;  3TFR A;  2DR9 A;  1VFG A;  1BPB A;  4RWP A; 
#chains in the Genus database with same CATH topology
 4F5O A;  3K3W A;  4DR4 B;  1R1B A;  3D36 A;  2ZNI A;  1BS3 A;  3F5W C;  4LWS A;  3RW0 A;  1I94 B;  3K59 A;  1X59 A;  4RQ6 A;  5EBW C;  4FLW A;  5J2D A;  3HKE A;  1H8H G;  4LNU A;  3K04 A;  3ZRW A;  1F23 A;  4BIO A;  3CC4 V;  2ZM6 O;  4H13 B;  5IIL A;  4YJ2 A;  1YTF D;  4QIW F;  4K4H A;  4O5K A;  1MMM A;  2K1E A;  1M1K W;  3NR7 A;  2PI4 A;  3TCU A;  1KKD A;  1Q82 W;  3HJ1 A;  1XNQ O;  3RBZ A;  5CB4 A;  1ZQD A;  3E35 A;  3C5G A;  2LW1 A;  4UCV A;  8ICK A;  2WPD G;  4Z1M G;  1V9P A;  2GV9 A;  3EHB B;  4X1Y B;  5HFM A;  3ABL C;  1JFF A;  3HKC A;  4M04 A;  5CN0 A;  5EZY B;  3E8B A;  4J7Z A;  3AEI A;  4LH6 A;  3QO8 A;  4KLO A;  4FM0 A;  2IHO A;  3PML A;  5B1B C;  2V4D A;  5F2V O;  2ZH8 A;  5L3G A;  5EIB C;  3FB8 C;  2ZR3 A;  4IG8 A;  1FFX B;  3ETD A;  1BPD A;  3H1J H;  4JYA B;  4WBY A;  1NI8 A;  3KZI Z;  3QF7 A;  4O2A B;  5KHJ A;  1B6Q A;  4I7Z B;  3J80 N;  4PHE A;  1IDS A;  1R3J C;  1SC5 B;  2A3Q A;  4PDL A;  1KEC A;  5C8Y A;  1M93 A;  3B2E E;  3MHH C;  5J2U A;  1UEU A;  3FYI B;  4WC0 A;  5BOL A;  2W6J G;  2A79 B;  4QE7 A;  1US6 A;  4FK5 C;  2CH7 B;  3LDC A;  7ICT A;  1FXH A;  2CTP A;  4RQ1 A;  2X0L A;  4PGQ A;  3JAK B;  3DC5 A;  3JAL B;  2DRA A;  1JOY A;  2AGA A;  3RH5 A;  1LUV A;  4NLK A;  4TUY B;  5DEC A;  1BPY A;  2ZIO A;  4CBC A;  5LP6 C;  4UAW A;  2CTQ A;  3JYC A;  2E76 B;  3CB2 A;  3FB7 C;  4FHP A;  5IYZ A;  8ICM A;  3HKD A;  3FYE B;  4EGW A;  4J80 A;  3K5O A;  1VIB A;  3ZRW B;  3T1Y O;  2Z3Y A;  1ZQW A;  3L71 H;  4TT3 G;  4MTG A;  4E7X A;  4NM2 A;  3ABM C;  2BPC A;  1JR9 A;  4WH5 A;  4QZB A;  5CB4 B;  2KQX A;  2ATK C;  1D2D A;  3HJ4 A;  3OWG A;  3OVA A;  1NKD A;  1FXV A;  1NQT A;  1S3J A;  9ICR A;  3B4S A;  2UUA B;  4MF2 A;  4WF9 V;  4RQ2 A;  4F5P A;  3UKM A;  4KP4 A;  3N27 A;  4UCS A;  1BT8 A;  4B3S O;  4I2D A;  3CP1 A;  1IXB A;  1ZJN A;  5IIK A;  1XRE A;  4ZBM A;  3ERC C;  3H38 A;  5CP2 A;  1KDH A;  4I2E A;  3SDL A;  4JYA O;  4X1I B;  3VQY A;  2ZH3 A;  1GKF A;  4WC3 A;  1VF6 C;  2HG5 C;  3CHX A;  4KLE A;  2ZNJ A;  4JAS A;  8ICX A;  3T4D A;  3JD1 A;  4X8A A;  3ZCC A;  4UD5 A;  2LW7 A;  4ASU G;  4O4L B;  5FNV B;  3SR2 C;  4O68 A;  4HBN A;  4FHX A;  2HJD A;  5LP6 B;  1MAB G;  4MVZ A;  1WNS A;  3B09 A;  5C93 A;  2NRK A;  4J9Y B;  1WLE A;  3JAR A;  3ZHS A;  1HNW B;  2OCC B;  5KX5 A;  4MT8 A;  2DRB A;  4HX0 A;  5IJ9 A;  2A06 H;  3SJC C;  1F4N A;  1WOT A;  3ISB A;  4O4H A;  3CS5 A;  4LF7 B;  1V55 B;  2GDS A;  3CCS V;  2HHP A;  5IIM A;  2ZH5 A;  9ICK A;  4FMT A;  3CCL V;  5DB6 A;  2IUB A;  1R73 A;  4FZ1 A;  3C3S A;  2FMP A;  1NTM H;  3HR0 A;  3BFR A;  1ZQR A;  3ETE A;  1VF7 A;  2RMK B;  3CCU V;  4XUS A;  4TV9 B;  1Q3E A;  2EBO A;  2OIE A;  4KHP O;  5DDY A;  3WU2 Z;  5FPO A;  2QM7 A;  3AU2 A;  3ZBH A;  2Y69 B;  1Q79 A;  3G4S V;  2JGD B;  4YIP A;  4DV1 O;  5JVD B;  4PEL A;  4WBN B;  3G71 V;  4I9Q A;  2ZH4 A;  3THO A;  5KHI A;  1BGY H;  3AG4 C;  2QM8 A;  3CJH A;  3RJH A;  4B7K A;  4CS2 A;  1IZ3 A;  2CGN A;  9ICE A;  9ICI A;  2EIJ C;  8ICA A;  1I5Y A;  1R6N A;  4CC5 A;  2FMQ A;  4X1I A;  2M2T A;  1QVG U;  1UEV A;  3LNM B;  1SS3 A;  3T2M A;  4PA9 A;  4OGQ B;  4MVO A;  5AG2 A;  3VOU A;  1SZX A;  5J2C A;  2GUZ B;  2VQF B;  1KP2 A;  3ZRX A;  4GXJ A;  4QZC A;  3EVK A;  3QNE A;  2UUC B;  4N7R A;  3LDE A;  2N04 A;  1YXB A;  2OIG A;  5LA6 B;  2BSK B;  3TET A;  3CYO A;  2BCQ A;  2Q8V A;  2PTM A;  1Z5W A;  2RFF A;  3LDD A;  4R65 A;  4DV3 B;  5LBQ A;  2EIK C;  4JF3 A;  4P30 A;  2Q6A A;  4TOI A;  4X4N A;  1FA0 A;  3AG2 C;  3MGI A;  4KLL A;  4YHH O;  4WC2 A;  4X0A A;  4J42 A;  1SQB H;  4LF7 O;  2CTW A;  3PJS K;  4YJ3 B;  4TV8 B;  4B3S B;  5J2G A;  3PMN A;  5CBH A;  4QZE A;  4I50 A;  4S3N A;  3GWO A;  2EUL A;  4RWO A;  2LGW A;  4I2H A;  1IBM B;  1UFI A;  4I2B A;  3SYO A;  4FZ0 A;  4DK1 A;  1WB8 A;  2YID A;  1OCO B;  5IWA B;  2JVD A;  3BEH A;  2HP8 A;  3P30 A;  4MVM A;  4X65 O;  2EIJ B;  4J41 A;  1S72 V;  3U0Z A;  9ICL A;  2HVK C;  3O65 A;  5BMV B;  1AJN A;  4F5N A;  9ICV A;  4X64 O;  1VAR A;  1D5A A;  3G67 A;  4GLX A;  2XAH A;  4NXN B;  2EIM B;  5D46 A;  4B3T B;  3ICX A;  4O2B B;  1K4C C;  1ZQV A;  4F6R A;  3LNN A;  4DR4 O;  2ZH2 A;  1S5L Z;  2EIN C;  5LL6 Y;  4LP8 A;  3SYP A;  8ICS A;  3STL C;  4R50 A;  1DF4 A;  3K0G A;  9ICG A;  4P9P A;  2WSS G;  2EIM C;  4JI7 B;  5JQG B;  4PGX A;  4IHJ A;  4LC1 A;  5LMN O;  2GTA A;  4RQ4 A;  4LEW A;  3AQK A;  3G80 A;  4O9M A;  2RCV A;  1ZQU A;  2L6L A;  2Q68 A;  4X66 O;  2EIN B;  5J2F A;  2XAG A;  5EYP A;  4YMM A;  1ZQY A;  5E79 Z;  9ICT A;  2P6J A;  5H2F Z;  5B66 Z;  4TUY A;  4Z2W A;  2YI9 A;  4JLZ A;  1ZQL A;  5JCO C;  3KCY A;  1T5E A;  2QTO A;  3F5T A;  4O67 A;  4RQ0 A;  1XSL A;  4E8F A;  4NXM B;  5J2T A;  2P22 C;  4NXZ A;  4KLF A;  1KKC A;  5B5E Z;  5IWA O;  1X4T A;  2PGG A;  1GM7 A;  2BTO A;  3JD0 A;  5J0T A;  2BTQ B;  5BZB A;  1IBL B;  4MW8 A;  4X62 O;  2DQ0 A;  4EBJ A;  1Q90 D;  4LFC O;  5FL7 G;  4OX9 B;  9ICJ A;  4I4T B;  1OHH G;  3ISC A;  5IT9 N;  1NTZ H;  2WA4 A;  3BHP A;  2F1M A;  2XOK G;  1AP6 A;  5J2U B;  3OMI B;  4EP7 A;  2EX3 A;  2Y4T A;  3ASO C;  2VQE B;  1VQN V;  4M2Y A;  2R9I A;  3WB1 A;  2D3O W;  3W7T A;  1R89 A;  3OE7 G;  2LJ2 A;  3WFR E;  3DC6 A;  4X0B A;  2JEU A;  1FXK A;  1Q8I A;  1ZQT A;  4AQY O;  4UB3 A;  4DR5 B;  4Z6D A;  4E4E A;  4UVB A;  2Z0A A;  1RPL A;  1YJW V;  1MZF A;  4QPJ A;  4RQ8 A;  4LBE C;  5CHG A;  4DW1 A;  2X6A A;  1GMG A;  2Z5U A;  2EZO A;  2G38 A;  5LGN A;  1P7B A;  3CRC A;  4NXV A;  2QJ1 A;  1AB3 A;  3STZ C;  1SRY A;  3NXS A;  3K5L A;  2B5U A;  1RP3 B;  4U7N A;  5KHK A;  4UCT A;  5HRB A;  1FJG O;  4DUZ O;  1AI7 A;  3NYB A;  4RWN A;  4RQE A;  2ADQ B;  3RJG A;  3H1L H;  1I08 A;  4EKW A;  3OFN G;  8ICP A;  4DV2 B;  2GA9 D;  5BY1 A;  4I55 B;  4K9B A;  4DOB A;  2KKW A;  1SQP H;  1S77 D;  3JAW B;  2K9P A;  1K8A W;  2O5A A;  1DF5 A;  4DR3 O;  3VQV A;  1VQ8 V;  2BBJ A;  8ICC A;  4B3M B;  1N34 O;  5IY5 B;  3K5N A;  1K73 W;  1H2N A;  2XND G;  3FKS G;  3RGB A;  5K1X A;  3AK2 A;  1VQL V;  3CCQ V;  2IJJ A;  4K9A A;  2PFQ A;  1UJW B;  2A9H A;  3SJB C;  1ZQN A;  4EFE A;  5A9G A;  1N36 O;  5K1P A;  2JJ2 G;  1Z5V A;  4G28 B;  2E5L B;  1V54 C;  3HB3 B;  7ICO A;  9ICF A;  4LF6 O;  3IC7 A;  4UB8 Z;  1FPO A;  1EM1 A;  1Q6H A;  1WAZ A;  4DV5 O;  4FLZ A;  2W0F C;  1R3L C;  4RWP A;  4WC7 A;  4DOA A;  1XSP A;  3UO3 A;  4MW3 A;  1K92 A;  4K8V A;  1J5E O;  3JAR B;  4YD2 A;  2LFR A;  2UXD B;  2Y0I A;  4O69 A;  4PGY A;  1KNY A;  7ICE A;  3I5D A;  2W0X A;  1UPG A;  5J2H A;  3C2M A;  1XIL A;  3JSL A;  3G6E V;  1IBL O;  4RWU A;  2A0L A;  2ZCE A;  2H94 A;  5LHH A;  4OX9 O;  1WPX A;  3HPL C;  1EN6 A;  3LQC B;  1ZQE A;  1OZ0 A;  1N32 O;  4X5V A;  1D5N A;  4JAV A;  4LZD A;  4YJ2 B;  3CD6 V;  3JD3 A;  5DB7 A;  3MDS A;  4I50 B;  3DGE A;  1BPE A;  4DR3 B;  4TUS A;  1G8M A;  3JD4 A;  1S0V A;  3A8T A;  3LSQ A;  1AR4 A;  2M6Y A;  1HDJ A;  1JFF B;  2V1D A;  1QQC A;  2UXB O;  2WLH A;  7ICR A;  3CXC U;  3ZHU A;  3CCJ V;  1YIJ V;  4O4I B;  1Y76 B;  4FH5 A;  4PDM A;  4ICG A;  5BXZ A;  3RJI A;  1MNG A;  2PFO A;  3BRC A;  3OR7 C;  4NXU A;  2OT5 A;  3U11 A;  5LGU A;  3E89 A;  4BIU A;  1XUQ A;  4DV5 B;  4U3F H;  4HYO A;  1K7D A;  3OW2 U;  4LF8 B;  4AT9 B;  2Q0A A;  3AU6 A;  2XAJ A;  2UXC O;  2F66 C;  1BHA A;  1FS0 G;  4JZG A;  1O9G A;  1XBL A;  4WFF A;  1NO5 A;  2P66 A;  3J81 N;  3V7J A;  1R3K C;  1XQ8 A;  1FKA O;  4WC6 A;  2CDY A;  2OCC C;  5EK0 A;  4EEB A;  2YIA A;  5J2J A;  2UXD O;  5CBG A;  4XA5 A;  4IT5 A;  5B3P A;  3GVM A;  4DXW A;  4JV5 O;  2YXL A;  3RYF A;  5ITZ B;  3B0X A;  3UPS A;  5HRE A;  1TVA A;  4I2F A;  1MG1 A;  3JCU Z;  3RYH B;  3CC2 V;  1K33 A;  5FLX N;  1TUB B;  4H44 B;  2LQT A;  1N32 B;  1AJP A;  3T1C A;  4UBC A;  3IFX A;  3JPR A;  4MFF A;  2Q7G A;  1ENV A;  3CK6 A;  1JPX A;  3OUY A;  2O1P A;  2QA4 V;  4I27 A;  2IJK A;  1NTK H;  2UXN A;  4KLD A;  3CE2 A;  4TQD A;  9ICN A;  2CTR A;  4X66 B;  4X4P A;  2CE4 A;  1FAF A;  1MQ2 A;  8ICG A;  2I9G A;  2UUA O;  4X4O A;  3AUO A;  3OT7 A;  3ABK C;  4XQ7 A;  3RJE A;  3D3Q A;  4K3A A;  3CCR V;  1YSC A;  1VQO V;  2GAF D;  1TA8 A;  3OUF A;  4JPR A;  4OAI Z;  1N0N A;  4X1Y A;  2M2U A;  5B3S B;  2Q7E A;  2D2C B;  4LF5 B;  3PHZ A;  4IYH A;  1WA8 A;  9ICH A;  4KLQ A;  4DV7 B;  2JS3 A;  1P49 A;  4JAA A;  1ZQJ A;  4LFC B;  4ZHQ A;  2DR5 A;  1FYJ A;  4K4I A;  4GZR B;  4RQ7 A;  1E1Q G;  4P2Z A;  2XHB A;  3AQN A;  4E2L A;  1Q7Y W;  4UD4 A;  2BBH A;  3FD9 A;  3SGI A;  2ZM6 B;  2XAQ A;  3UM7 A;  1LUW A;  5CFT A;  1HNW O;  5GTH Z;  3C2L A;  1FXK B;  3H3A A;  4RQF A;  4JI2 O;  1W59 A;  1R8B A;  2DVI A;  3LK9 A;  2IM9 A;  5L3F A;  1YEW A;  3H1K H;  1LR1 A;  3OM3 B;  5L3D A;  3W7X A;  3VBB A;  1CEZ A;  1K97 A;  1XL6 A;  1K4D C;  4BAY A;  3OTF A;  4IQW A;  5JH7 A;  3A2F A;  1GH6 A;  3B8M A;  1OCO C;  2KG7 A;  2Q67 A;  4ZOL B;  3OUY B;  2Q7H A;  1NVP D;  3BAA A;  3QVN A;  1R8C A;  4WFE A;  1YTF B;  3L70 H;  4TV9 A;  1VJ7 A;  3M7M X;  4W4K A;  1HUO A;  4LT6 A;  3OMA B;  3RVY A;  2KB1 A;  2NN4 A;  4J7K A;  1PL4 A;  1OJH A;  4M9J A;  2EIK B;  3AG1 C;  1CXZ B;  3TXQ A;  5CA0 A;  4DR6 O;  1ORQ C;  5IIJ A;  3AG2 B;  4BW5 A;  1MSW D;  4DK0 A;  4DV2 O;  4BIZ A;  2ZHA A;  1AR1 B;  1GTO A;  4ZI7 B;  5LHG A;  3RYC A;  3S3W A;  3ETG A;  3F7Y C;  4GYC B;  5HHH A;  1XNR O;  1QR9 A;  4RAI A;  4AT7 A;  1KEJ A;  1RM1 B;  4AT8 A;  1ZQB A;  5J0Y A;  3AG7 A;  3SYC A;  1FFT B;  4R7C A;  3AG1 B;  5D49 A;  1RPO A;  4M9N A;  4LFB O;  3E8F A;  1HWY A;  2HN2 A;  2X6B A;  1ZQO A;  5KAI Z;  5IJ0 A;  2UUC O;  2ZT9 B;  3Q4H A;  4GUN A;  1DK1 A;  5CA1 B;  2EJR A;  1F7Y A;  2PZS A;  1SQF A;  1Y6X A;  2Y69 C;  2QKC A;  1HNX B;  1XDC A;  3NVO A;  4QZI A;  4K96 A;  5TIS Z;  2QEX V;  1L0N H;  4LZG A;  1R6T A;  1GM9 A;  3W7U A;  3UPQ A;  4X1K B;  3WFS C;  3A0B Z;  4JI2 B;  5DKW A;  4I0U A;  1AVM A;  1GM8 A;  1KUQ A;  3SPC A;  4DV6 O;  4J11 A;  2RN9 A;  3J7A U;  2E5L O;  3OEH G;  4DV7 O;  1EN4 A;  2ZE7 A;  2BSK A;  4JTC B;  4ATB A;  1V4A A;  4Z1V A;  4YXW G;  5B1N A;  3IC9 A;  1BSM A;  1XMO O;  3H01 A;  3MCR A;  1MIV A;  4FLV A;  3K5M A;  4L8J A;  3ASO B;  3JAL A;  3TGU H;  1XL4 A;  1F51 A;  2EIL C;  4FJC C;  4TV8 A;  3RJF A;  3BCC H;  1VQ4 V;  4AT8 B;  2HR3 A;  4JYC A;  4X89 A;  4B3T O;  4O2B A;  4X4Q A;  3ER9 B;  5L3B A;  3QG5 A;  3RFR A;  1BQ0 A;  8ICL A;  5DBB A;  1NBM G;  4PH5 A;  1JVM A;  4JI7 O;  5IYZ B;  2UUB O;  5LMU B;  2QWQ B;  2VWK A;  4JWN A;  5IJ0 B;  4QNH B;  4DV0 O;  5CA7 A;  2ZIM A;  3P3N A;  2UXB B;  4XDJ A;  2ZQM A;  3GDX A;  4U7O A;  3BY6 A;  2R9A A;  3TFS A;  5HC9 A;  1GN4 A;  1HNX O;  5LA6 A;  3ISD A;  3ZJZ A;  1YDX A;  4AHC A;  3CRM A;  1Q6U A;  5C8Y B;  3X2Q C;  5CHE A;  9ICB A;  1XMQ B;  4DOC A;  1PPJ H;  1G1X B;  1GN3 A;  2WLK A;  3V72 A;  5J2A A;  5GON B;  5BR8 O;  4JV5 B;  3EF2 A;  8ICI A;  4K0K B;  4QGP A;  9ICX A;  2QWR B;  2YXH A;  1Y76 A;  3FB5 C;  3T1H O;  2RDC A;  1I94 O;  1NOM A;  3SPJ A;  3PN1 A;  5HRF A;  1EZV H;  2IW5 A;  2WLM A;  4DV6 B;  1P84 F;  3WB2 A;  1QU7 A;  5CR0 A;  4TUR A;  5EC1 C;  4JI4 O;  3L74 H;  1K5Q A;  2YDE A;  1HP8 A;  1XMO B;  2N05 A;  2VWJ A;  3OMN B;  4H0L B;  1JQ0 A;  9ICS A;  2PYL A;  5J0R A;  1ARO P;  1GAX A;  3AG3 C;  5KHH A;  3JPO A;  2GWS A;  3SJA C;  3ZRV A;  1NJI W;  3I55 V;  4O4H B;  4MTF A;  3FX7 A;  2FKX A;  2JK5 C;  5EBM C;  4YMO A;  2ZH9 A;  2BCV A;  3P3P A;  1JA8 A;  4XBF A;  9ICO A;  3RYH A;  3UXN A;  7ICS A;  4KL1 A;  1MZE A;  4PI2 A;  3AQM A;  1IBM O;  1BZK A;  4XDL A;  4KXR A;  2HVJ C;  3ZMZ A;  4FHY A;  3RH4 A;  5J2E A;  4FLU A;  3C3T A;  4FO1 A;  4D7T A;  1QLN A;  3LSU A;  4FPP A;  5J0O A;  3CRR A;  5JQG A;  5DDM A;  4YN4 A;  4IIJ A;  4IL6 Z;  1FJG B;  1RPR A;  3V7L A;  3UT5 B;  1BPZ A;  1ZQK A;  5J0S A;  3RN4 A;  2PFN A;  4MF8 A;  5DM6 V;  3B40 A;  1WJZ A;  5EYP B;  1N4C A;  1Y74 A;  1QLE B;  5EC2 C;  5TZV A;  4U3J B;  3ZN1 A;  2B1G A;  4PDV A;  4K0K O;  2YSU B;  4FVM A;  5IY5 C;  2ITC C;  1N34 B;  1ZQG A;  1WN7 A;  1EZJ A;  3GB7 C;  1G6U A;  4DR2 B;  4AI8 A;  2A7W A;  4JI4 B;  4I29 A;  4O6A A;  2ODM A;  1HNZ O;  4B3R O;  5KUM A;  4K35 A;  3ABU A;  1AI5 A;  1XEQ A;  3FB6 C;  2LO1 A;  4KM5 A;  1M56 C;  4RQ3 A;  1IX9 A;  2ARH A;  3ZHQ A;  2DR8 A;  4MFC A;  1J5E B;  1TUE B;  4X20 B;  4R66 A;  3OEE G;  1BHB A;  3QO7 A;  3E86 A;  5B1A C;  5JCO A;  4HZ3 A;  2Q73 A;  1XMQ O;  3JAW A;  3I56 V;  1K34 A;  2XTA A;  4LCU C;  1M56 B;  3OTO O;  1BQZ A;  3SPG A;  5J0P A;  3FAV B;  2F93 B;  4PHA A;  4KLT A;  1EBO A;  1QR8 A;  3K08 A;  3Q4H B;  4KB6 A;  5H6Q A;  1VQK V;  2ZXW B;  1JJ2 U;  2X7R B;  4LFB B;  2ZD9 A;  2P5O A;  2HKO A;  1NR1 A;  1SA0 B;  1YLQ A;  2BCC H;  1V54 B;  5J2K A;  3E22 A;  4DUY B;  4NTX A;  2GSM B;  3ZMT A;  4KLH A;  5L3C A;  3H1H H;  1Y67 A;  4I5S A;  5BPC A;  2DYS B;  4BR6 A;  1ZQZ A;  4ABM A;  4X1K A;  1H38 A;  1GN6 A;  3CCE V;  8ICT A;  1M9N A;  3K7D A;  1J95 A;  1QCE A;  5CA0 B;  5DB8 A;  4U3J A;  2E75 B;  3CRQ A;  1ZQQ A;  1CPY A;  4F4L A;  5FPR A;  1CP9 A;  1SQV H;  5J2I A;  2BCR A;  5LGT A;  4GX0 A;  4QZD A;  4MSW C;  2ZR2 A;  7ICN A;  1OCZ C;  4NXT A;  2YEV B;  1KP3 A;  3APQ A;  9ICC A;  5III A;  2DYS C;  1RSO B;  3WFO A;  4MS2 A;  4EED A;  1HNZ B;  1S5J A;  5JWP A;  4FHW A;  1MIY A;  5HRL A;  2B51 A;  2CK3 G;  5HRG A;  3RVZ A;  3OGI B;  2BCU A;  1TVK A;  5LHI A;  4M0A A;  1DLB A;  2YIB D;  1VQM V;  4UB5 A;  2QE7 G;  5B1B B;  4QZA A;  8ICR A;  1PKX A;  4NLN A;  2P4V A;  4HNA B;  1NVP B;  1H8E G;  4PA6 A;  4CS4 A;  1SZT A;  1ROP A;  3OTO B;  4DV4 O;  4DR1 O;  2UU9 B;  5CFS A;  2F43 G;  1I5X A;  3CPW U;  3OV7 A;  4K98 A;  1ZQH A;  3ABM B;  8ICQ A;  4UFZ A;  2JIZ G;  1E79 G;  2CUG A;  1OCC B;  3BPZ A;  4WFG A;  4I4T A;  3A0R A;  1TV9 A;  4GXI A;  4ATB B;  4UV8 A;  5B1O A;  5HR9 A;  7ICQ A;  2FB5 A;  4MKP A;  2O57 A;  4N23 A;  5LYJ A;  3ZS8 C;  5E1A C;  5J0Q A;  4JYB A;  2X6C A;  3HIY A;  2ILM A;  3L75 H;  2VRZ A;  3RH6 A;  7ICV A;  1SQG A;  5A2Q N;  2EZP A;  4LF9 O;  3ABK B;  3ABT A;  2AHZ A;  2DWE C;  2NR5 A;  2FL4 A;  4P2H A;  3WG7 C;  4ZIB A;  5J29 A;  4JZ2 A;  5IIO A;  1O9H A;  5J2T B;  4QZH A;  4GX2 A;  3ZMU A;  3T1H B;  5EOZ A;  4G27 B;  8ICJ A;  3N2K B;  3KG2 A;  4DUY O;  4I2A A;  4I0X A;  1NS1 A;  3JAS B;  4LF6 B;  4QJF B;  3JPP A;  4I2G A;  4NM1 A;  3CC7 V;  3HKB A;  3WG7 B;  3ZED A;  4I28 A;  4OXS A;  4JWM A;  1VEW A;  4AT9 A;  2ZH1 A;  4K8Z A;  4FLT A;  1Q81 W;  4J7J A;  8ICH A;  4HAM A;  5IYD O;  1AP5 A;  4WFA V;  8ICW A;  1Q78 A;  4NKU A;  3E83 A;  2DWD C;  3B77 A;  1RM1 C;  4PHP A;  9ICQ A;  3D36 C;  2N74 A;  4QZF A;  3TXS A;  4PD4 F;  2CGO A;  4PHD A;  2PYJ A;  2OCH A;  2V7Q G;  1N33 O;  2NLJ C;  1WA8 B;  1AJQ A;  4UBB A;  2GBO A;  4ZHQ B;  4EV6 A;  3ZMV A;  8ICU A;  4IIJ B;  9ICP A;  3LSS A;  1W2B U;  2Q4P A;  2F4V O;  2VS0 A;  4JI8 O;  3HKE B;  4LNU B;  2YXY A;  1VF6 A;  3OAA G;  2P90 A;  2YUA A;  2QWO B;  4JI0 O;  4KLM A;  4MVU A;  1DTO A;  4I2I A;  3K58 A;  4CH6 A;  2UU9 O;  4EB6 A;  2H3O A;  2AZ0 A;  3WFQ E;  2DYR C;  4FFB B;  1OU5 A;  4TUQ A;  7ICL A;  2B56 A;  1DGS A;  4I9W A;  5CB1 A;  3W7S A;  4Z6C A;  1Q86 W;  3L73 H;  4FIP C;  5EZY A;  3ASN B;  4LEV A;  2NNU A;  4DR7 O;  5J2B A;  3H37 A;  1YI2 V;  1WPB A;  2LP7 A;  2DQ3 A;  3JAS A;  3RWR D;  5KMG A;  2F23 A;  1GN2 A;  5CA1 A;  1R6K A;  2Q69 A;  4RPX A;  4UV9 A;  4IYI A;  4YIO A;  5D5P A;  5JJJ B;  3K75 D;  2UXC B;  1MIW A;  3L72 H;  2AZ2 A;  4UUJ C;  4FM1 A;  4K4G A;  5GW7 A;  1WB7 A;  4LFA O;  4X4S A;  4DUZ B;  4K99 A;  4PI0 A;  4B08 A;  2ZDI A;  4LF9 B;  4R8C A;  1RFY A;  4GKJ B;  1K3E A;  3RYC B;  1COW G;  4NKG B;  4RWQ A;  3RT3 C;  8ICE A;  2ZE5 A;  4O4I A;  3JAT B;  2WLL A;  3BAB A;  1XOU A;  4WFH A;  1XHZ A;  1H2M A;  3CX5 F;  1NT2 B;  1I7F A;  3ETQ A;  1NR7 A;  4AQY B;  8ICO A;  5FNV A;  2YIB A;  2QGN A;  5LMU O;  4WQL A;  3E2E A;  3VQW A;  1K9M W;  4NB5 A;  2EWR A;  4D6T H;  3UXP A;  4M9G A;  5H6R A;  2HLD G;  4ZOL A;  3WFP A;  2KG7 B;  3HWT A;  4FHV A;  4MFA A;  2IU0 A;  4PV1 B;  4JTD B;  4DV1 B;  1ZX3 A;  1PV0 A;  4OPH A;  1ZJM A;  3PNC A;  4X4R A;  5KA6 A;  3CWB H;  4GT1 A;  2UUB B;  3BA9 A;  5KHG A;  2IBZ H;  5EBL C;  4P4M A;  5BR8 B;  3OD4 A;  5JTG A;  4LF4 B;  3B0Y A;  4R6Z A;  1THZ A;  4ZI7 A;  3APO A;  1TUB A;  4KFM A;  4QZG A;  2H8P C;  2VQF O;  4UCO A;  4KUM A;  2BPG A;  3MBY A;  5D62 A;  2DJV A;  1WP8 A;  5KMG B;  4P4O A;  5D61 A;  2B1I A;  1OCR B;  2EJ7 A;  2AHY A;  2RNB A;  2WLN A;  4UAZ A;  4RUF A;  1SQQ H;  2YS8 A;  4M9L A;  4X9Q A;  1VQ9 V;  5H9C A;  2IHM A;  3JPN A;  1KMI Z;  3E8G A;  4JI0 B;  4P9O A;  5LP6 A;  4NXN O;  1PP9 H;  4FH3 A;  2Y0P A;  7ICI A;  1NH2 D;  2ZH7 A;  2FYU H;  4DV4 B;  1ZAU A;  4LVS A;  1AR5 A;  1HW7 A;  1RZT A;  2DOS A;  4UVA A;  1M90 W;  4JI1 O;  5LXT B;  4KLG A;  1YF2 A;  1SKV A;  1G4Y B;  4NVP A;  5GON A;  5IJ9 B;  4X4T A;  4DW0 A;  1FFX A;  3JPQ A;  5LOV A;  5HRH A;  2R9R B;  4H37 A;  4R64 A;  4O4J A;  1JN3 A;  3RYF B;  5ITZ A;  4JLX A;  4N21 A;  4CH4 A;  1VP7 A;  5LYJ B;  3JCZ A;  4KLS A;  2QWP B;  4R63 A;  2BOC C;  3RJK A;  4YMN A;  1HR0 O;  4O5E A;  1TAE A;  3UQ2 A;  3UCS C;  4NTY A;  1ZQX A;  3V7K A;  2ZE8 A;  4X64 B;  2YI8 A;  1GK9 A;  3WB0 A;  2XAS A;  2BCS A;  1PNM A;  2ITD C;  3AG3 B;  4MTO A;  4GKJ O;  3H1I H;  2YIC A;  4JI5 O;  4QZ8 A;  2OTJ V;  3SYA A;  1AIL A;  1P4R A;  2DE0 X;  5KAF Z;  3D8C A;  1JMK C;  3CJH B;  4JAU A;  1H2L A;  1U96 A;  2QWN B;  1MOF A;  4WQK A;  2DW4 A;  3K9S A;  4LF4 O;  3WFV A;  2B4V A;  4CZZ A;  5D4B A;  1KQS U;  4ZKI A;  4I0X B;  2ZXW C;  5CMU A;  1VQ7 V;  2FML A;  1ZQP A;  4LWS B;  1H2G A;  1LNQ A;  3HKB B;  2W6I G;  4FLX A;  3MDA A;  1W0J G;  2M7W A;  5J0U A;  2BE3 A;  2MW2 B;  4KHP B;  7ICM A;  3IAY A;  3M99 B;  5D63 A;  1H2S B;  3TFR A;  1VFG A;  2DR9 A;  4NKT A;  3CCV V;  5EIB D;  3JPT A;  4FO6 A;  1PX5 A;  2WLI B;  5CFU A;  1PNL A;  5JJE B;  4WCE V;  4OAF A;  1VQ5 V;  4DYL A;  3OVS A;  2FTK A;  4JI6 B;  1Y74 B;  1NH2 B;  2QTS A;  3JAK A;  2LFS A;  4MTX A;  4RT2 A;  3HKC B;  3ABL B;  5KA5 A;  1Q5O A;  1SF9 A;  4P4P A;  1OCZ B;  1MA1 A;  2QDO A;  3BA8 A;  1H2K A;  4XJE A;  3IGA C;  3K9A A;  2R70 A;  4X62 B;  1HR0 B;  4MVS A;  1B06 A;  5DBC A;  4AIL C;  3N2G A;  5JH7 B;  4O2A A;  5D5Q A;  1Y66 A;  1R3I C;  1M5I A;  5CWR A;  2LGQ A;  1KYO F;  2R72 A;  1Y4M A;  5J0W A;  4OPA A;  1QBZ A;  4X4V A;  3JZ0 A;  5KX5 B;  4JI8 B;  4Q20 A;  3AQL A;  2ZE6 A;  4UB2 A;  3C5F A;  2ISP A;  1M57 B;  3KCX A;  2ZDI C;  4UAY A;  3ZN0 A;  2PBE A;  5B1A B;  2JS5 A;  4FLY A;  5L3E A;  1S76 D;  3E8H A;  1Q43 A;  3ZHT A;  4JI3 O;  4Z6E A;  3TJT A;  2RQ6 A;  1QVF U;  3D3I A;  1WP7 A;  2W9M A;  3QO5 A;  4EEQ A;  4WFB V;  5IE9 A;  1JX9 A;  5J0X A;  2GHY A;  4IQV A;  2WLJ A;  2IJH A;  1TGO A;  3LUT B;  4WBZ A;  1N0J A;  5HFL A;  1ZQC A;  3F7V C;  2ZHB A;  1EN5 A;  2Q5Z A;  3DXR B;  2M2V A;  2FMS A;  4KLU A;  2KSD A;  4XQ8 A;  4PA7 A;  4WBN A;  5JVD A;  4H33 A;  4K97 A;  4J9Z B;  1ZTE A;  1F5A A;  4O5C A;  3EXA A;  4UB4 A;  3UQ0 A;  7ICU A;  1B04 A;  2XAF A;  4TQF A;  1ZLZ A;  1GRJ A;  4MVQ A;  4K8X A;  3H39 A;  3O9O A;  2L35 A;  4EBK A;  3JAM N;  3DTU B;  5DED A;  4JI6 O;  2E3C A;  2RJZ A;  2GUZ A;  8ICY A;  1V55 C;  2DR7 A;  4NYK A;  1PM9 A;  1ZUQ A;  4CH5 A;  1ZQM A;  1GPJ A;  2Y48 A;  1AI4 A;  3ZHV A;  1IVS A;  4X88 A;  4CH3 A;  1OCC C;  4YY3 O;  4RPY A;  3CCM V;  4JYY A;  4WOY A;  3HW8 A;  2JRI A;  4LH7 A;  3E22 B;  3C90 A;  1ZQS A;  4WCW A;  4FM2 A;  4LFA B;  4DO9 A;  3UO2 A;  4YD1 A;  2PXI A;  1IBK B;  5B3S C;  4CS3 A;  7ICF A;  3R66 A;  5LMN B;  4EFB A;  1OV9 A;  2XUM A;  1GO3 F;  4X20 A;  3JD2 A;  4NLZ A;  4DR6 B;  2B9Z A;  3AG4 B;  4DRX A;  2FCL A;  1KB9 F;  3ZX6 A;  4LR3 A;  2QKA A;  2IH3 C;  4W4L A;  2WA3 A;  1HUZ A;  2Q9L A;  1XHX A;  5HRI A;  3JAT A;  4XDK A;  3JPS A;  1XNR B;  2QKS A;  4MVR A;  7ICJ A;  3CSX A;  1VF5 B;  1PD3 A;  3DXR A;  4NTW A;  1ZQF A;  3FFQ A;  4LF8 O;  3S3X A;  1KC8 W;  4CC6 A;  2JJ1 G;  4IGG A;  3TK1 A;  3EFF K;  1VQP V;  1BPX A;  1ZQI A;  4X4U A;  4PA4 A;  1BE3 H;  3RJJ A;  2CAZ C;  4WC4 A;  3K0D A;  1R8A A;  4WC5 A;  5LXT A;  3MHS C;  4OAG A;  3QTC A;  5LOV B;  1JMS A;  2AXT Z;  1FD9 A;  2AW9 A;  1I0H A;  1BL8 A;  3HX0 A;  5IIN A;  3H9V A;  3NWI A;  1YIT V;  4UB1 A;  4DR2 O;  3RYI A;  2HN1 A;  5JJN B;  3C2K A;  4F5Q A;  2PFP A;  4F6E A;  1FXK C;  5B3Q A;  2P06 A;  4TSF G;  4B7E A;  1ZL8 A;  4PJ0 Z;  3VQX A;  1L8D A;  4I2C A;  1YZB A;  1QNM A;  3ZMS A;  2Y4U A;  3C18 A;  4UVC A;  2VQE O;  1IUR A;  2CH7 A;  1TVK B;  2F4V B;  2OWO A;  1XNQ B;  2ZH6 A;  4F5R A;  2BPF A;  1MSD A;  1SER A;  4YJ3 A;  1E1R G;  4GX1 A;  2DYR B;  4HNA A;  1NU1 H;  4UB6 Z;  3ML0 A;  5CJ7 A;  3SPI A;  4B3M O;  8ICB A;  4WC1 A;  1AI6 A;  1BMF G;  1TFW A;  2JDI G;  1URF A;  3ASN C;  4PDR A;  1SQX H;  3R65 A;  4O4J B;  8ICV A;  5KLV H;  3OGU A;  2ETN A;  1L1F A;  4DV0 B;  2GTS A;  2DMX A;  5DBA A;  3CRA A;  7ICK A;  3OVB A;  3OGC C;  3CEI A;  4JGS A;  1IBK O;  4DV3 O;  3BVO A;  4JI5 B;  5IDJ A;  1P7G A;  1B3Q A;  3CXH F;  1ZQA A;  9ICM A;  2HHH B;  9ICU A;  4RUE A;  2ISO A;  3K57 A;  3UT5 A;  2OYQ A;  5CA3 A;  2HFE C;  4F6R B;  1U97 A;  4PA3 A;  3JSN A;  3RYI B;  5GTI Z;  3UQ8 A;  3K06 A;  2P7T C;  3B8N A;  4RQ5 A;  1JAJ A;  4Z6F A;  5DB9 A;  1YVW A;  3N2G B;  4DR7 B;  1SA0 A;  1YJN V;  4KLI A;  2BOB C;  4UXN A;  1W0K G;  3X2Q B;  2BTQ A;  1ZWI C;  8ICN A;  1JJO A;  1ZL8 B;  3K03 A;  7ICG A;  4M47 A;  2VAN A;  4O4L A;  3T1Y B;  4GX5 A;  2QM4 A;  4IHJ B;  3HKD B;  1YJ9 V;  3JYY A;  4NY8 A;  2QR4 A;  1YCI A;  3N2K A;  9ICA A;  3L9D A;  4NR1 A;  3A0H Z;  3SJQ C;  3ZHR A;  1TFY A;  2HJF C;  2UXX A;  5CBF A;  3CMA V;  2Q66 A;  2WLI A;  3UXO A;  1MQ3 A;  1N8R W;  4DR1 B;  4GXK A;  1XI1 A;  3ER8 C;  2DN9 A;  4FFB A;  3G6B A;  2ZIN A;  1RSO A;  3JCF A;  8ICF A;  5HHI A;  3C66 A;  4BWA A;  4JI3 B;  4LEZ A;  1S5H C;  2P67 A;  3FAV A;  4PHZ A;  3AK1 A;  1L0L H;  4JTA B;  1A32 A;  4GKK B;  4UCU A;  1OCR C;  4KLJ A;  1Z2G A;  4IQT A;  1NZ6 A;  3MGH A;  4QPK A;  2WAM A;  5H5N A;  4M5D A;  2PF4 E;  1Q6I A;  1PL0 A;  4FFK A;  1KD1 W;  3SPH A;  4BW9 A;  3KKY A;  1M4U A;  2JGD A;  3MD0 A;  2MK3 A;  4UCR A;  4PPX A;  1SES A;  1F4M A;  4GCZ A;  5DN6 G;  4E80 A;  3CME V;  4NXM O;  5IYB O;  2IU3 A;  3GWK C;  4D7S A;  1VMG A;  2IJI A;  4I2J A;  3U10 A;  4YCX A;  1SET A;  2WLL B;  4EB6 B;  1PNK A;  1EFR G;  1K5S A;  2PI5 A;  1XSN A;  4G2K A;  2QSA A;  4B3R B;  2JGU A;  2YEV A;  3NKU A;  4DO2 A;  4RPZ A;  2EIL B;  4DR5 O;  3ZRS A;  8ICZ A;  3K79 A;  1QHT A;  5IYC O;  1N33 B;  2WWW A;  1QLE C;  2YC0 A;  2P4K A;  3M8A A;  2IH1 C;  4TUP A;  9ICW A;  4QZ9 A;  4LEY A;  1UET A;  1JQR A;  5J9P C;  2F95 B;  2C2A A;  4YY3 B;  2HHH O;  4M9H A;  4JI1 B;  1KU9 A;  4OAH A;  4RO2 A;  4I55 A;  4J10 A;  4AT7 B;  4TWK A;  4IQU A;  4C7U A;  5HRD A;  5BOM A;  3IJ4 A;  2ADP A;  1KBH A;  2XT9 A;  4NXW A;  4NXX A;  2OTL V;  4GKK O;  3W7W A;  4A5U B;  3DSQ A;  4QE9 A;  4XRH A;  3MDC A;  1ZSP A;  1N36 B;  2PUS A;  1IXM A;  2M2W A;  7ICP A;  2ZKO A;  3ZIA G;  3OUS A;  5BMV A;  1YHQ V;  2E74 B;  4LF5 O;  4X65 B;  5HRK A;  2Q0O C;  3SYQ A;  1M57 C;  3OR6 C;  2HEP A;  7ICH A;  1VQ6 V;  4YHH B;  4L87 A;  3P32 A;  3T4Z A;  2JEX A;  3AK3 A;  3MAQ A;  5KUK A;  2ID1 A;  4Q6G A;  4DRX B;  4RT3 A;  1JCH A;  1BCC H;  2PY5 A;  1BPB A; 
#chains in the Genus database with same CATH homology
 4WC7 A;  4DOA A;  4NKT A;  3JPT A;  4F5O A;  4FO6 A;  1PX5 A;  1XSP A;  4I29 A;  4YD2 A;  3OVS A;  4RQ6 A;  4PGY A;  5J2D A;  4RT2 A;  4RQ3 A;  1KNY A;  7ICE A;  2DR8 A;  4MFC A;  4P4P A;  5IIL A;  4R66 A;  5J2H A;  3C2M A;  4K4H A;  4O5K A;  3HJ1 A;  1ZQD A;  3C5G A;  8ICK A;  5DBC A;  1ZQE A;  3LQC B;  4X5V A;  5CWR A;  4M04 A;  5J0W A;  5J0P A;  4PHA A;  3JZ0 A;  4X4V A;  4KLT A;  3AQL A;  4LZD A;  4KLO A;  3PML A;  4UB2 A;  5F2V O;  2ZH8 A;  3C5F A;  2ISP A;  5DB7 A;  4UAY A;  2PBE A;  4IG8 A;  1BPE A;  1BPD A;  4TUS A;  4WBY A;  1YLQ A;  4Z6E A;  5J2K A;  4PHE A;  4KLH A;  7ICR A;  2W9M A;  5BPC A;  4FH5 A;  1UEU A;  1ZQZ A;  4WC0 A;  5BOL A;  5J0X A;  3RJI A;  4IQV A;  8ICT A;  4WBZ A;  1ZQC A;  2PFO A;  2ZHB A;  7ICT A;  5DB8 A;  4RQ1 A;  4PGQ A;  1ZQQ A;  2M2V A;  2DRA A;  3RH5 A;  2FMS A;  4NLK A;  4KLU A;  4XQ8 A;  5J2I A;  4AT9 B;  2BCR A;  4QZD A;  5DEC A;  1F5A A;  3AU6 A;  4O5C A;  1BPY A;  4UB4 A;  7ICN A;  3UQ0 A;  7ICU A;  4UAW A;  9ICC A;  5III A;  3WFO A;  4FHP A;  1NO5 A;  2P66 A;  4FHW A;  1MIY A;  3V7J A;  8ICM A;  5HRL A;  3H39 A;  4WC6 A;  5HRG A;  4EBK A;  2BCU A;  5DED A;  5J2J A;  1ZQW A;  4XA5 A;  8ICY A;  4M0A A;  3UPS A;  5HRE A;  3B0X A;  1TVA A;  4E7X A;  2DR7 A;  4I2F A;  4UB5 A;  4NM2 A;  2BPC A;  4QZB A;  4QZA A;  8ICR A;  3HJ4 A;  1ZQM A;  4NLN A;  3OVA A;  4UBC A;  9ICR A;  4MF2 A;  3JPR A;  4MFF A;  4RQ2 A;  4F5P A;  4RPY A;  3HW8 A;  3OUY A;  2O1P A;  1ZQS A;  4I27 A;  4I2D A;  4WCW A;  4KLD A;  1ZJN A;  3OV7 A;  1ZQH A;  5IIK A;  9ICN A;  4DO9 A;  4YD1 A;  8ICQ A;  3H38 A;  5CP2 A;  2PXI A;  1KDH A;  4X4P A;  4I2E A;  7ICF A;  2ZH3 A;  8ICG A;  1MQ2 A;  4WC3 A;  4KLE A;  2I9G A;  8ICX A;  4X4O A;  3AUO A;  4NLZ A;  4UD5 A;  1TV9 A;  4GXI A;  4XQ7 A;  4ATB B;  3RJE A;  5HR9 A;  7ICQ A;  4FHX A;  1HUZ A;  5HRI A;  3JPS A;  5J0Q A;  2NRK A;  2M2U A;  7ICJ A;  3HIY A;  3RH6 A;  1ZQF A;  7ICV A;  9ICH A;  2DRB A;  4KLQ A;  1ZQJ A;  2DR5 A;  1WOT A;  3ISB A;  1BPX A;  1ZQI A;  4K4I A;  4X4U A;  4RQ7 A;  4P2H A;  2HHP A;  5J29 A;  3AQN A;  2ZH5 A;  5IIM A;  3RJJ A;  9ICK A;  4UD4 A;  5DB6 A;  5IIO A;  4WC4 A;  4QZH A;  1R8A A;  4WC5 A;  2FMP A;  5EOZ A;  1ZQR A;  8ICJ A;  3C2L A;  3H3A A;  4I2A A;  1R8B A;  1JMS A;  4XUS A;  2DVI A;  3LK9 A;  3JPP A;  4I2G A;  4NM1 A;  5DDY A;  3AU2 A;  3HX0 A;  5IIN A;  4I28 A;  4JWM A;  1Q79 A;  4UB1 A;  4IQW A;  4AT9 A;  2ZH1 A;  2ZH4 A;  3C2K A;  3OUY B;  4F5Q A;  8ICH A;  2PFP A;  1R8C A;  1VJ7 A;  3RJH A;  8ICW A;  1HUO A;  1Q78 A;  9ICE A;  9ICI A;  4LT6 A;  4I2C A;  4NKU A;  8ICA A;  2FMQ A;  2M2T A;  4PHP A;  1UEV A;  9ICQ A;  3C18 A;  4M9J A;  4QZF A;  5J2C A;  4PHD A;  2ZH6 A;  4GXJ A;  5IIJ A;  4QZC A;  4F5R A;  2BPF A;  4UBB A;  2ZHA A;  8ICU A;  9ICP A;  5HHH A;  2BCQ A;  4AT7 A;  5CJ7 A;  1KEJ A;  2RFF A;  4AT8 A;  8ICB A;  4WC1 A;  1ZQB A;  5J0Y A;  4R65 A;  1TFW A;  4X4N A;  1FA0 A;  5D49 A;  4KLM A;  4M9N A;  8ICV A;  4I2I A;  3OGU A;  3MGI A;  1ZQO A;  4KLL A;  4WC2 A;  4X0A A;  5J2G A;  3WFQ E;  5DBA A;  4QZE A;  3PMN A;  4S3N A;  7ICK A;  1OU5 A;  3OVB A;  4TUQ A;  7ICL A;  4RWO A;  5CB1 A;  4Z6C A;  4I2H A;  4I2B A;  5J2B A;  4QZI A;  3H37 A;  1ZQA A;  9ICM A;  4LZG A;  9ICU A;  2ISO A;  3UPQ A;  3WFS C;  4RPX A;  5DKW A;  3K75 D;  1MIW A;  9ICL A;  4RQ5 A;  4K4G A;  1JAJ A;  4Z6F A;  5DB9 A;  4F5N A;  9ICV A;  4X4S A;  8ICN A;  4KLI A;  7ICG A;  5D46 A;  4ATB A;  4M47 A;  2VAN A;  4RWQ A;  1ZQV A;  3JYY A;  4NY8 A;  8ICE A;  1V4A A;  9ICA A;  3L9D A;  2ZH2 A;  8ICS A;  1MIV A;  1TFY A;  9ICG A;  2Q66 A;  8ICO A;  3UXO A;  1MQ3 A;  3RJF A;  4GXK A;  4X4Q A;  4AT8 B;  4PGX A;  3UXP A;  4M9G A;  4RQ4 A;  3WFP A;  3AQK A;  3HWT A;  4FHV A;  4MFA A;  8ICL A;  5DBB A;  5HHI A;  4O9M A;  8ICF A;  4PH5 A;  1ZQU A;  5J2F A;  3C66 A;  4JWN A;  4YMM A;  1ZJM A;  5CA7 A;  1ZQY A;  3PNC A;  9ICT A;  4X4R A;  3GDX A;  1ZQL A;  4KLJ A;  4IQT A;  3MGH A;  3TFS A;  5HC9 A;  4M5D A;  4P4M A;  4RQ0 A;  1XSL A;  4E8F A;  4NXZ A;  4KLF A;  3B0Y A;  3ISD A;  4QZG A;  4PPX A;  2BPG A;  3MBY A;  4E80 A;  5J0T A;  4P4O A;  9ICB A;  4DOC A;  4EBJ A;  3V72 A;  4I2J A;  4UAZ A;  9ICJ A;  4YCX A;  4M9L A;  3ISC A;  5J2A A;  2IHM A;  3JPN A;  8ICI A;  9ICX A;  4FH3 A;  1XSN A;  4EP7 A;  1NOM A;  5HRF A;  7ICI A;  4RPZ A;  4M2Y A;  2ZH7 A;  5CR0 A;  8ICZ A;  4TUR A;  4LVS A;  1R89 A;  1RZT A;  3WFR E;  4X0B A;  4TUP A;  4KLG A;  9ICW A;  4QZ9 A;  1JQR A;  1UET A;  4X4T A;  3JPQ A;  1ZQT A;  5HRH A;  4UB3 A;  9ICS A;  4R64 A;  5J0R A;  4Z6D A;  1JN3 A;  4M9H A;  1RPL A;  3JPO A;  2GWS A;  4RQ8 A;  5CHG A;  4AT7 B;  4IQU A;  4KLS A;  4R63 A;  5HRD A;  3RJK A;  4YMN A;  4O5E A;  5BOM A;  4YMO A;  3UQ2 A;  2ZH9 A;  1ZQX A;  5HRB A;  2BCV A;  3V7K A;  3NYB A;  4RWN A;  9ICO A;  3UXN A;  7ICS A;  2BCS A;  3RJG A;  4XRH A;  3MDC A;  3AQM A;  8ICP A;  4QZ8 A;  4DOB A;  4FHY A;  3RH4 A;  5J2E A;  2M2W A;  7ICP A;  2O5A A;  5J0O A;  8ICC A;  5HRK A;  5DDM A;  4YN4 A;  5D4B A;  3V7L A;  1BPZ A;  2PFQ A;  1ZQK A;  7ICH A;  5J0S A;  1ZQP A;  1ZQN A;  2PFN A;  4MF8 A;  3MDA A;  5J0U A;  5TZV A;  2BE3 A;  9ICF A;  2ID1 A;  7ICO A;  4RT3 A;  7ICM A;  1ZQG A;  3TFR A;  2DR9 A;  1VFG A;  1BPB A;  4RWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...