3L9DA

The crystal structure of smu.1046c from streptococcus mutans ua159
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
198
Chain Sequence
MNWEEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINNKPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GTP pyrophosphokinase
publication title The Crystal Structure of smu.1046c from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 69
structure length 198
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 3l9dA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3l9dA01
1XSPA 1ZQJA 2ISPA 4KLTA 3HIYA 4F5RA 3B0XA 4X0BA 1ZQTA 4PGXA 4I2IA 5J2GA 1ZQUA 4AT9B 4I2HA 1ZQDA 3AQLA 9ICTA 2DR7A 4MF8A 3OUYA 3OVBA 4AT7B 9ICAA 5IIMA 8ICLA 4UBBA 4NXZA 4PH5A 4NY8A 3WFSC 2ZH3A 4RWOA 2M2TA 8ICYA 5CP2A 3MDCA 4I29A 4FHYA 2BPCA 5HRLA 1ZQBA 4RQ1A 8ICRA 1FA0A 9ICNA 7ICGA 4R63A 7ICVA 4I2BA 5HHHA 3AUOA 2BCSA 2FMSA 4I2CA 9ICRA 4X0AA 1NOMA 3C2LA 4UBCA 2IHMA 3WFQE 4X4NA 4RWQA 1ZQHA 1R8BA 4Z6CA 4KLEA 4QZGA 7ICOA 4I2JA 4WC5A 1TFYA 4M9NA 2O5AA 1BPYA 2ZH9A 3WFOA 1WOTA 1Q78A 8ICOA 5HRGA 4WC6A 4FHPA 1MQ2A 5J2HA 3UQ2A 1OU5A 4YD1A 2ZH7A 4ATBA 5HRHA 9ICFA 4NKTA 2ZHAA 3RJKA 3MGIA 3RJFA 1ZQLA 3UXPA 5HC9A 4MFCA 1JQRA 2GWSA 4KLJA 7ICHA 4WCWA 4FHWA 5J2CA 2ZH6A 2NRKA 4X5VA 5J29A 4M47A 4UB1A 3RH5A 5DKWA 3H39A 4EP7A 2PBEA 2BCRA 1ZQIA 4E8FA 1ZQXA 1PX5A 4ATBB 9ICQA 5HRBA 3PNCA 4NLNA 8ICXA 3UPSA 5J2KA 3WFPA 3JPPA 4GXIA 1ZQFA 4X4OA 4P2HA 5J2BA 1ZQMA 5D4BA 8ICGA 5DEDA 4RWPA 3H38A 4RWNA 5CB1A 9ICBA 5J0TA 3JPTA 1R89A 1ZQYA 3C2MA 4YMNA 3C66A 4K4IA 7ICPA 1BPZA 4I2EA 4AT9A 5J0XA 4KLFA 4LT6A 4XQ7A 3HW8A 1F5AA 4I2DA 3AU6A 3L9DA 2PXIA 9ICMA 5J2EA 4UAWA 2ISOA 3V7JA 4WC7A 4DO9A 2DVIA 3RJHA 1HUOA 9ICKA 5J0OA 9ICVA 1VFGA 1MIWA 4IQUA 4TUPA 2ZH4A 4KLUA 3RJGA 4KLSA 3ISCA 2ID1A 3JZ0A 4PHAA 4Z6FA 5D46A 4RPZA 4XUSA 2PFNA 2PFOA 3JPNA 3OVSA 3ISDA 4JWNA 4QZAA 4RQ3A 4IQVA 1ZJNA 8ICTA 2DR5A 7ICUA 9ICIA 4M0AA 4F5NA 3OGUA 4P4OA 4FO6A 1ZQRA 2M2UA 2FMQA 5IIOA 9ICJA 4RQ6A 5J2FA 1R8AA 1Q79A 4PPXA 5DECA 2O1PA 2ZH8A 3UXOA 9ICHA 5J2IA 4UAZA 2VANA 2FMPA 2PFPA 8ICAA 4UB2A 3B0YA 5DB7A 2RFFA 4FHVA 2M2VA 1MIYA 4RQ2A 1TFWA 9ICCA 4RQ4A 3LQCB 3AQMA 5J2JA 5CA7A 1ZQPA 5HRKA 5CWRA 3V7KA 4P4PA 3AU2A 2ZH1A 4TUSA 2ZH5A 4M9JA 5D49A 4AT8A 8ICNA 3JPSA 4WC3A 1BPXA 5CHGA 4O5CA 5HREA 8ICMA 4LZDA 1TVAA 7ICEA 2P66A 3MGHA 1KNYA 8ICWA 4WC4A 2Q66A 5BOMA 1UETA 4UB3A 3PMLA 4KLOA 1RZTA 9ICGA 4RQ5A 4UD5A 4FHXA 5J0WA 4PGQA 7ICIA 4X4RA 5J0YA 4JWMA 3V7LA 3HX0A 3RJIA 1ZQGA 4AT8B 5DB6A 4O9MA 5DBBA 3TFSA 4RT3A 9ICLA 2BCQA 4F5QA 3K75D 4X4UA 5DB9A 4O5KA 8ICFA 4FH5A 4RQ8A 5J2DA 4XA5A 4MFFA 5DDMA 3WFRE 7ICMA 4R64A 4LVSA 8ICKA 2M2WA 7ICRA 3OV7A 5IIKA 4R66A 1V4AA 5IIJA 3TFRA 4KLMA 1JMSA 4YCXA 5EOZA 5CJ7A 4WC1A 5DDYA 4RPXA 2BPFA 3HJ4A 1ZQSA 4UD4A 4NM2A 4RQ7A 3AQNA 3UPQA 4YD2A 5IINA 4NM1A 7ICLA 9ICEA 4R65A 4KLLA 3JYYA 4XQ8A 4M2YA 4PHPA 3C2KA 4UB4A 4QZ9A 5HRFA 5J2AA 2BPGA 3PMNA 5HRDA 4S3NA 2ZHBA 4YMOA 4TUQA 3RH6A 4KLDA 4M5DA 4MFAA 4GXKA 4FH3A 9ICUA 1NO5A 4PHDA 7ICJA 2BCVA 3H37A 4M9GA 3ISBA 4E80A 5DBAA 1ZQZA 4E7XA 4QZFA 3H3AA 5BOLA 1KEJA 1ZQAA 2BE3A 4X4SA 4O5EA 8ICHA 1VJ7A 2DR8A 4F5PA 4IQTA 2DRAA 4MF2A 3JPRA 4WBZA 8ICJA 3MBYA 5HR9A 4PGYA 7ICTA 4M9HA 9ICXA 4IQWA 1ZQKA 5DBCA 7ICFA 4WC0A 5TZVA 3HWTA 1ZQCA 4I27A 4RPYA 4X4TA 4Z6DA 3OUYB 3JPOA 4GXJA 4I2GA 7ICKA 4QZIA 3GDXA 4YN4A 4QZHA 8ICCA 1MIVA 4P4MA 9ICSA 4QZEA 5J0QA 3C18A 4PHEA 1KDHA 2PFQA 4K4GA 4DOBA 1ZQOA 1YLQA 4QZDA 8ICVA 7ICSA 5DB8A 4X4PA 1R8CA 4RT2A 1XSNA 5IILA 2ZH2A 4QZBA 2DRBA 4KLQA 3RH4A 2I9GA 8ICZA 4XRHA 1BPBA 4IG8A 4EBKA 4M9LA 3MDAA 1RPLA 4QZ8A 8ICUA 4KLIA 4UAYA 5J0UA 3AQKA 1TV9A 4M04A 4KLGA 1BPEA 4NLKA 4Z6EA 5J0PA 3C5FA 2DR9A 4WBYA 4UB5A 4QZCA 3NYBA 5HRIA 3OVAA 1ZQNA 5F2VO 1ZQVA 1XSLA 4NLZA 5J0RA 9ICWA 5J0SA 9ICOA 3UQ0A 4NKUA 1JAJA 4I2AA 1JN3A 4DOCA 1UEUA 3HJ1A 3RJEA 3V72A 8ICPA 3JPQA 1MQ3A 2HHPA 4F5OA 4KLHA 4WC2A 9ICPA 4I28A 7ICQA 4I2FA 1BPDA 4K4HA 5HHIA 3C5GA 5IIIA 4EBJA 4DOAA 2BCUA 4RQ0A 2W9MA 1UEVA 5BPCA 3UXNA 4X4VA 8ICIA 8ICQA 1ZQQA 3RJJA 1ZQEA 3LK9A 8ICBA 1ZQWA 5CR0A 8ICSA 4X4QA 4LZGA 4AT7A 1HUZA 4TURA 8ICEA 1ZJMA 4YMMA 7ICNA
chains in the Genus database with same CATH superfamily
1CP9A 2F4VB 5B1OA 1ZQJA 1US6A 1URFA 3F5WC 1XL4A 3ABLB 3E22B 1H2MA 4JI1B 4UCSA 4DV5O 4JI7B 2HVKC 1ZQDA 5EIBC 2OIEA 3WB2A 5GTIZ 2DR7A 1R3LC 4AT7B 3G6BA 1I94O 2EX3A 8ICLA 4QE7A 2QKSA 3HB3B 5IJ0B 4UBBA 3G80A 1UFIA 2W0FC 1WA8A 2H3OA 3BY6A 1YJWV 1M93A 5KLVH 4DR4O 5CA0A 3CYOA 3RYCA 1S77D 3KG2A 4O67A 4X1IB 4RQ1A 3CRQA 4TQDA 1FA0A 4UXNA 2EZOA 5LHHA 3HKBB 4R7CA 7ICVA 4I2BA 2JRIA 3DXRA 2FMSA 1E1RG 1NOMA 2P4KA 3UM7A 4TV9A 2F23A 4JGSA 1YHQV 2O57A 4X4NA 1R8BA 4Z6CA 4KLEA 1N8RW 4WC5A 2O5AA 4FO1A 3K57A 2W6IG 2ZH9A 1XNRB 4D6TH 2B56A 3G4SV 4LWSA 4B7KA 4WC6A 1Q90D 4EEBA 1AJPA 5J2HA 2XTAA 1XMOB 1JX9A 2ZNJA 1DK1A 3OD4A 3RYHA 4NKTA 2ZCEA 3G6EV 5HC9A 2CE4A 2ZE5A 1JQRA 4B3MO 4KLJA 2Y0PA 4H13B 4WCWA 4KHPO 5J2CA 1FFTB 4OX9O 5B1BB 4X5VA 1ZL8B 1YIJV 5J29A 5ITZA 4O4IB 3RH5A 3H9VA 3H39A 1K3EA 2PBEA 2BCRA 1ZQIA 5LP6B 3MHHC 5GW7A 2YEVA 3CJHA 9ICQA 4NTWA 3AG1B 3SGIA 4J9ZB 5HRBA 3PNCA 5JCOA 1NS1A 3QO7A 4I50A 2KKWA 3OFNG 2GV9A 4GZRB 1ZQMA 1VQ4V 5EC1C 2LQTA 2UXDO 2CAZC 8ICGA 5BXZA 3SPCA 3OR6C 1XHZA 1Q81W 1NQTA 2ZKOA 1EZVH 2L6LA 1Y76A 2CGNA 1QU7A 3K7DA 3E22A 1R89A 4YMNA 2RCVA 4MSWC 1BPZA 5H6RA 1PKXA 1H2GA 1PNMA 2P4VA 3B8MA 3SPJA 1WPBA 2YIBA 4LEZA 2WLIA 4I2DA 9ICMA 3CK6A 5LL6Y 1KBHA 3ZMVA 5LMNO 4UAWA 2ISOA 4DO9A 2DVIA 3RJHA 1FXKB 3OMNB 4JZ2A 4N7RA 5IE9A 5FNVB 1NH2B 1VFGA 3ZMSA 4KLUA 5JJEB 4UFZA 2ID1A 3JZ0A 3A0BZ 1R3JC 4NXVA 3CHXA 2IUBA 1OZ0A 2Q0OC 2XAHA 4TSFG 2KB1A 3TXSA 1FD9A 2PFNA 4GKKO 3K9AA 3EFFK 4PI0A 5CN0A 3RGBA 4PA9A 2HJFC 2E75B 1EN4A 2DR5A 4OAHA 1HR0O 1VQ5V 3W7XA 3VQXA 4EEDA 2VS0A 3FAVA 4J9YB 4AI8A 4UVBA 1YXBA 3U11A 4B3TB 4FLTA 1AVMA 5EBLC 2P67A 3E2EA 4K8ZA 1EN5A 3NWIA 4UCRA 2HVJC 3ICXA 1LUVA 3L70H 1Q79A 4PPXA 1Z5WA 5DECA 4H44B 1Y4MA 1DF5A 3P30A 1G8MA 1VF7A 4UB2A 3K06A 4TV8A 5CA7A 2GSMB 1ZL8A 1ZQPA 4UCTA 3N2GB 2ZR2A 3JYCA 3I56V 3AU2A 3AG2C 4UB6Z 4YJ2A 3F5TA 2LW1A 2CTQA 5LP6A 2EZPA 5D49A 4AT8A 3OR7C 5E79Z 4O5CA 8ICMA 2HR3A 3T1HB 3JARA 4X1YB 4AILC 5CMUA 3MGHA 2Y69C 3E83A 4KLOA 3E8FA 3DC6A 4U3JB 4FHXA 4QPKA 5CFTA 1F23A 1NH2D 3E89A 2C2AA 1XEQA 4LF9B 3ZEDA 3RJIA 3HR0A 5DB6A 3EHBB 1CPYA 3TFSA 3ABTA 4GX1A 4J7ZA 4O68A 4F5QA 1B6QA 4F6RB 1J5EO 4OGQB 8ICFA 1WB8A 3AK2A 1ENVA 5D61A 4MFFA 4NTYA 1K97A 1OJHA 5DDMA 1IBKO 2LO1A 4MVSA 3CMAV 3CRMA 4DR6B 4I4TB 4WQLA 4IHJA 3JCUZ 4Q6GA 4DV7O 4LF6B 4DK0A 4KLMA 3FFQA 4X88A 3JSLA 3CEIA 4UD4A 2F1MA 1N33O 3PJSK 4KLLA 2V7QG 3ZRSA 1OHHG 2HN1A 4UB4A 3ABMB 4PA7A 4ZOLB 4EKWA 2K1EA 2ZHBA 4YMOA 5CA3A 3APOA 5GONB 1U96A 4MFAA 4CS2A 4JF3A 4K9BA 3ISBA 4UVCA 5EZYA 4TUYB 1P84F 4E7XA 4UV8A 3T2MA 2GTAA 3W7UA 1KP2A 1EZJA 4L87A 2P90A 8ICHA 4IYIA 2DR8A 2DRAA 4MF2A 3HKDB 1E1QG 3MBYA 2XAFA 2FTKA 3SPIA 4PGYA 4IQWA 1WLEA 5D62A 1ZQKA 5KHHA 4WFGA 4LF8B 2DYRC 3C3TA 5B5EZ 1R3IC 4DR2O 4KXRA 3CC2V 5J9PC 4RPYA 1YITV 4GXJA 4I2GA 2V4DA 4QZIA 3UO2A 8ICCA 4I0XB 4P4MA 3CCVV 4U3JA 2DYSC 3LDCA 5B1AC 4Z1VA 1YLQA 4X65O 4DV4O 4NXTA 4JI8B 5AG2A 4UCVA 2UXNA 3BRCA 4X4PA 1R8CA 2F4VO 2HHHB 3STLC 3RFRA 5CBGA 3APQA 3JASA 3TXQA 1ZSPA 4GYCB 2DW4A 1HWYA 4JI1O 4DR7B 4JI7O 1GN2A 3RH4A 3T4ZA 2CK3G 1RSOB 3H1KH 3ZCCA 8ICZA 4IG8A 1L8DA 1BPBA 2IH3C 1K33A 3SYQA 2JGDA 3K5LA 4EB6B 1MNGA 4UVAA 1VF6C 2Y4TA 2G38A 5J0PA 2JK5C 4GX2A 4QZCA 3M8AA 2B1IA 5HRIA 1F7YA 5F2VO 4TOIA 1QLEC 2Q7GA 4CH3A 4B3SB 2PUSA 3E8BA 2QTOA 2GUZB 2JJ1G 1JAJA 4WFEA 1UEUA 3HJ1A 1KMIZ 3AG2B 3F7VC 4FLVA 8ICPA 3VQWA 2M7WA 3S3XA 3GWOA 1FYJA 4BW5A 4JTCB 4MKPA 2IH1C 4K3AA 3DSQA 4DR5B 4MVZA 3CSXA 4LH6A 1K73W 3A8TA 1BQZA 5HHIA 3C5GA 5IIIA 4TUYA 4A5UB 4NXUA 4DOAA 1R73A 1VQOV 2UXBB 4DXWA 1XNRO 2WLLA 3AK3A 3UXNA 5BPCA 2Q0AA 5KHKA 3MDSA 5H9CA 3LK9A 5KHGA 1XMOO 2HFEC 2XOKG 4TURA 8ICEA 2BTQA 3BHPA 3UCSC 7ICNA 5KX5B 3HKDA 1ZUQA 3MCRA 2AXTZ 1XSPA 4KLTA 1LUWA 4IIJA 1TUBA 2XT9A 4X0BA 4MVMA 4J11A 1ZQUA 1IVSA 3BVOA 4WFAV 4K9AA 3D8CA 2OTLV 1OCOC 4TT3G 1M1KW 2HP8A 2VWKA 5IIMA 4NXZA 4JASA 4PH5A 1IZ3A 4NY8A 4X1KA 4J7KA 4ZHQB 2ZH3A 4WQKA 1JFFA 4RWOA 1KKDA 2M2TA 8ICYA 1XILA 2JEUA 5LOVB 4RAIA 3MDCA 4I29A 4HYOA 1FFXB 4FIPC 1QLNA 5HRLA 1JMKC 8ICRA 3CP1A 1GMGA 1YSCA 1BT8A 3IJ4A 1RSOA 1WA8B 2PY5A 5L3BA 4UBCA 3OM3B 4H0LB 4YIPA 1MOFA 5D5PA 2Q68A 1Y6XA 3RYCB 4QZGA 3JD3A 4DRXB 4MW8A 1TFYA 4M9NA 5LHGA 2N74A 3K5OA 4I0UA 5LBQA 1HW7A 4PA3A 1VQ7V 4FPPA 4JTAB 2R9AA 1Q78A 1K4DC 8ICOA 3IC9A 5H6QA 2EJRA 4OXSA 1ZLZA 3UQ2A 2GUZA 2WAMA 4YD1A 1XQ8A 4TV9B 2ZH7A 2ZHAA 1ZQLA 3UXPA 1FXVA 1P4RA 2IW5A 4FM2A 3SDLA 2DYRB 2ZH6A 1S3JA 4BIOA 2NRKA 1AJQA 4LWSB 1V55C 1BHBA 1O9HA 4PA6A 4EP7A 1QCEA 1GRJA 3BA9A 5CFUA 1DF4A 1ZQXA 3BAAA 3LDEA 3RYHB 4B3TO 4NLNA 1Z2GA 1DGSA 1EN6A 2ZDIC 2QWRB 5B1AB 1ZQFA 3KKYA 4XDLA 4DV0B 4P2HA 5J2BA 2WLKA 2OTJV 5DEDA 3H38A 3VQVA 4IT5A 2VQEB 4FM1A 1BHAA 5KX5A 2IU0A 3RW0A 5ITZB 3C2MA 5L3CA 2JJ2G 4EGWA 3CJHB 5J0XA 3IFXA 1PNKA 4JLZA 4LT6A 4O69A 4I50B 1M9NA 1F5AA 3RBZA 3CXCU 1KU9A 2OWOA 3NR7A 3T1HO 5B1NA 4BIUA 4ZHQA 1Y76B 2AGAA 3GWKC 4LR3A 5JVDA 1HNWB 4TUPA 4B7EA 1B06A 3ISCA 5LOVA 4PHAA 2ZXWC 1QLEB 2F95B 3R66A 1SKVA 1FAFA 1FFXA 2WLIB 4RPZA 4LF9O 4XUSA 1H2KA 4GUNA 2PFOA 3A0HZ 3ZHUA 1SA0B 3JD1A 4UUJC 4ZI7B 4WH5A 1AR5A 2Q67A 3L75H 1Q6UA 4PELA 1V9PA 4QPJA 5CBHA 5IT9N 3BABA 1SQQH 2P06A 5IYCO 1GK9A 3C90A 2LFRA 4DRXA 4WFHA 1JPXA 2DQ0A 1K7DA 4DR6O 5B3QA 1PL0A 1H8HG 1AP5A 3D36C 3E8GA 4U7OA 4LF6O 4NXXA 5IIOA 9ICJA 1NZ6A 2V1DA 1B3QA 4RQ6A 2QKAA 1KKCA 2QGNA 1JOYA 1L0LH 1VARA 1YI2V 1FPOA 2VANA 4LH7A 4NXMB 2FMPA 2PFPA 2BOBC 1G4YB 2XUMA 1PNLA 1XDCA 3FAVB 4X66B 5DB7A 5CHEA 2EIKB 5BZBA 2E5LB 1OCZB 3AQMA 3LQCB 2JIZG 3V7KA 4MVUA 4G2KA 2ZH1A 4UCUA 5KMGA 4O2AA 1XREA 4M9JA 4LFCB 8ICNA 1BSMA 2LP7A 4NKGB 1YF2A 5FL7G 2P66A 3U10A 1KNYA 4LNUB 3SYCA 3PMLA 2UXXA 3M7MX 4JAUA 1RZTA 9ICGA 4TV8B 1QVFU 2ZE8A 4YJ2B 3H1IH 3V7LA 1ZQGA 4U7NA 5CBFA 2W0XA 4AT8B 1IDSA 2YIBD 3JARB 1AI6A 2XHBA 5J2UA 4RT3A 2EIMB 4JYAB 3CS5A 3RVYA 3ZMZA 4XDJA 3DGEA 4FLYA 4LF8O 3K75D 1VQ6V 4O5KA 3DC5A 2QWQB 4XA5A 1VF6A 1JJOA 2QSAA 2A79B 2QDOA 2GDSA 4DK1A 5LYJB 2EJ7A 4R64A 5J2TA 3K0GA 4NYKA 4LVSA 2HEPA 3L71H 2RQ6A 1NBMG 2RDCA 1V4AA 5IIJA 3TFRA 1IURA 3JD4A 5EOZA 4JI8O 5CJ7A 2Z3YA 1N0NA 3D3QA 2F43G 2BPFA 1ZQSA 2JVDA 1WJZA 3RT3C 4ZI7A 1SA0A 3AQNA 4RQ7A 4NM1A 2HHHO 7ICLA 9ICEA 2PF4E 3JYYA 4ZKIA 4XQ8A 4M2YA 4PHPA 3C2KA 4DR7O 1MG1A 4RO2A 5J2AA 4IHJB 2GHYA 4DUYB 1PD3A 4LFAB 5KHIA 2ZR3A 4GXKA 2DE0X 4FH3A 7ICJA 3ZRVA 4M9GA 3BPZA 2OCCB 2P5OA 4H37A 3MHSC 1QR8A 1Y66A 2ARHA 4QGPA 1CXZB 1ZQZA 4E80A 1PL4A 2M6YA 1XBLA 4QNHB 4CH6A 1S76D 2QM4A 2QJ1A 1ZQAA 3ER9B 4W4LA 2BE3A 2DQ3A 3ASNC 2QKCA 4B3SO 2FMLA 1SQXH 4OPAA 4F5PA 1H2SB 2EIJC 4MS2A 4O4HB 4WBZA 4GLXA 1KECA 2DJVA 3OGIB 5EZYB 5HR9A 7ICTA 5FPRA 3ZMUA 1OCCC 4DV2B 4FFBB 2H94A 3ABKB 4DR5O 1B04A 2EWRA 5TZVA 3GB7C 1AI7A 1VQKV 1ZQCA 1R3KC 2EINC 4LF5B 4X4TA 3OUYB 3JPOA 1N32B 2ZXWB 2UXBO 4LNUA 1ZAUA 3P32A 3GDXA 4LEWA 4QZHA 3B77A 1MIVA 9ICSA 3BEHA 4TWKA 4FLZA 4PHEA 2E74B 4K4GA 1MABG 2A9HA 3K08A 3TGUH 3ZS8C 2X7RB 4I5SA 4JI2B 4R6ZA 3DTUB 2XAQA 3BFRA 4ASUG 1BS3A 3WB1A 3S3WA 3OE7G 4GT1A 2DRBA 1Y67A 1VEWA 1GAXA 3SR2C 3N2KB 4DV1B 1J95A 1XHXA 2UU9B 3NXSA 3T1CA 1AILA 5KHJA 5LYJA 4RQEA 1SRYA 2ZINA 3HKEA 2WLHA 5J0UA 1WN7A 3CD6V 1GPJA 3AQKA 3RYIB 1SS3A 5H5NA 4KLGA 3JASB 2GAFD 4O4JA 2MW2B 1WB7A 4QJFB 3J80N 5FLXN 1ZQNA 1FJGB 3NYBA 1JQ0A 1ZQVA 2GTSA 3CRCA 2XNDG 5EYPB 5J0SA 4I2AA 3UQ8A 2LFSA 2Y0IA 1M57C 1KQSU 2YICA 2JGDB 3JPQA 1X4TA 1MQ3A 1VF5B 2A7WA 1P7BA 2OT5A 2E76B 3OUSA 2ZDIA 1NR7A 1YZBA 1NTKH 3T1YB 4JZGA 4F6EA 2JS5A 4FZ0A 1K5SA 3CXHF 4FK5C 4GCZA 4D7SA 1UEVA 3ASOC 1SZTA 3ZMTA 3MAQA 3WB0A 3BA8A 4UV9A 1ZQEA 1ZQWA 5CR0A 5EIBD 4LFBB 2Y4UA 4YMMA 1VIBA 1BMFG 4O4HA 2R9IA 4JV5B 3H1LH 2ISPA 4F5RA 3B0XA 1ZQTA 4FFBA 4I2IA 1Q7YW 2WLLB 4UCOA 1MMMA 5J2GA 4AT9B 4I2HA 1BQ0A 3FB6C 3JD0A 4MF8A 3OUYA 3OVBA 4E4EA 4JI3B 3CCJV 9ICAA 1S0VA 4JI5B 2BTQB 3X2QC 2QWPB 2XASA 3UT5A 3WFSC 4DV0O 4IIJB 1TUBB 1JR9A 1IBMB 5HFMA 1Z5VA 4LF7B 1U97A 5IY5C 3JAWB 2BSKA 3ZHRA 1RM1C 1NU1H 3QG5A 4FHYA 2BPCA 1Q8IA 1ZQBA 1W0JG 2L35A 3N2KA 4X64B 9ICNA 3CB2A 2ZE7A 4JTDB 4LP8A 4QE9A 4X1KB 4YXWG 3AUOA 2BCSA 3VQYA 9ICRA 1JFFB 5KAFZ 4DUZB 1H2NA 1HP8A 4MTGA 1Y74A 1D2DA 5C8YA 1QVGU 2IHMA 3D36A 4DV6B 4WF9V 1S72V 1ROPA 1K5QA 3RYIA 1BPYA 1HNWO 2RJZA 2A3QA 5K1PA 1WOTA 4G28B 4CH5A 1KB9F 2ETNA 3HKCB 4NVPA 1QQCA 2PI5A 5HRGA 1MQ2A 5EYPA 1OU5A 3RN4A 2YUAA 4ATBA 9ICFA 3NVOA 4J80A 3RJKA 2ZQMA 5CA1B 4Q20A 4MFCA 2GWSA 1OCCB 4LC1A 2CTWA 7ICHA 4LEYA 3JALB 3ZBHA 1OCRC 1W0KG 4P9OA 1NVPB 3B8NA 1NJIW 1NT2B 2WA3A 2ZE6A 3OGCC 4DR1B 4E8FA 4JYYA 2QM8A 1PX5A 8ICXA 5J2KA 4D7TA 4KB6A 4I55B 3JPPA 1PM9A 4GXIA 5JJJB 1YEWA 4CC6A 4X9QA 3Q4HA 5CB4A 4R50A 3B09A 3FB8C 3TK1A 2IM9A 5D4BA 4RWPA 1SQFA 4F4LA 5CB1A 2Y69B 3LDDA 1VMGA 4NXMO 9ICBA 1P7GA 3K0DA 4X66O 4FLXA 1K8AW 1VP7A 2E5LO 3OUFA 1VQ8V 4K4IA 4I2EA 4AT9A 4PI2A 4WOYA 4XQ7A 1E79G 4KFMA 4K0KB 2ZM6B 3ERCC 3ZHVA 2FL4A 4LFCO 3CCMV 5J2EA 2QWNB 5LHIA 3T4DA 4I9WA 1VQNV 4WC7A 2MK3A 3SJAC 2PZSA 5L3EA 1Q86W 2ZH4A 4JI4B 4Z6FA 1N4CA 2QEXV 5B3PA 1M56C 5D46A 1RPOA 3JAWA 1EBOA 1MA1A 3ZN1A 3GVMA 3JAKB 2A06H 3K5MA 3E8HA 5EBMC 4K8XA 2CDYA 2ODMA 1RPRA 4JWNA 3O9OA 4QZAA 1ZJNA 2VQFB 4JYAO 2ITCC 1N36B 4X20A 5JVDB 5JH7B 5LGUA 3C3SA 4M0AA 1NTMH 2YIDA 2YIAA 3ASOB 3OGUA 1G1XB 1NVPD 4P4OA 1YJNV 3HKCA 5JQGA 3OTOB 3AG4C 1Q43A 2E3CA 1ORQC 5J2FA 4YHHB 1OV9A 1NI8A 3K79A 3VBBA 2O1PA 2R70A 3I55V 9ICHA 5CA1A 2FKXA 3CCRV 4K35A 2AHYA 2QWOB 1FXHA 3JALA 3B0YA 5IJ9B 2RFFA 1KD1W 2M2VA 3O65A 1TFWA 3QO8A 3WU2Z 3H1HH 5IWAB 5J2JA 4DUYO 5HRKA 2HN2A 3AG1C 5LA6B 4JI0B 4YY3B 2QE7G 2Q4PA 4LFAO 3G71V 1Q3EA 5LGTA 4TUSA 2ZH5A 2LW7A 1G6UA 2UUBB 3JPSA 4EEQA 1TGOA 1HNZB 5CHGA 4I55A 4LZDA 7ICEA 2B5UA 4K97A 1GN4A 3ZJZA 2R72A 2HG5C 2WLMA 3L72H 1N34B 3STZC 1MZFA 1UETA 4WC4A 4K98A 3ZRXA 4YJ3B 5IY5B 3B40A 2YXLA 3RWRD 4LEVA 5C93A 4UD5A 5J0WA 4HX0A 4PGQA 1T5EA 7ICIA 5KMGB 4O2AB 4JWMA 3LNNA 3HX0A 1SZXA 3OMAB 2DYSB 5LXTA 4O9MA 4U3FH 1SESA 3A2FA 2IHOA 3JAMN 1FXKC 4DV2O 2BCQA 4X4UA 4WFFA 5B3SC 4HAMA 4GKJB 1AR1B 1JA8A 4RQ8A 5J2DA 1LNQA 3OMIB 2Z5UA 2AZ2A 4LF5O 3PHZA 1EFRG 1N32O 3CE2A 3WFRE 2ZIMA 3FYEB 4J10A 2NN4A 2YC0A 8ICKA 3QNEA 1GN3A 4XJEA 2M2WA 1VQ9V 2DMXA 3CCQV 3JAKA 4PDRA 1K92A 3OV7A 5IIKA 4R66A 5J2UB 5B66Z 4ZBMA 4YCXA 4DW0A 4JI2O 1AJNA 5DDYA 3CC7V 3F7YC 3SYPA 4NM2A 3UPQA 3ZRWB 1YVWA 2YI9A 4DV3B 5A2QN 1OCRB 4R65A 2IJIA 2WPDG 5JH7A 3W7TA 3LUTB 2CH7A 1SQPH 5J2TB 5HRFA 4DV1O 2UU9O 3LNMB 5KAIZ 3PMNA 1AI4A 4RQFA 2Q73A 2PYLA 1WNSA 1NTZH 4KLDA 3AK1A 4BWAA 5IYDO 9ICUA 1NO5A 3TJTA 4PHDA 2BCVA 3QVNA 1YJ9V 3H37A 2JS3A 3CWBH 4GX5A 4MVQA 2PTMA 2WWWA 4QZFA 3H3AA 5BOLA 1FJGO 1KEJA 2OCHA 1TUEB 4CC5A 5BR8B 1AB3A 2YI8A 5KA5A 1V54C 1XMQB 4MTXA 1W2BU 5IJ9A 4X4SA 5KUMA 4MTFA 4O5EA 1XNQB 5EBWC 5LA6A 3K58A 1D5AA 1HNXB 4M9HA 9ICXA 4FMTA 2IBZH 5DM6V 7ICFA 4AQYB 5BMVA 4CBCA 4WC0A 5JTGA 3HWTA 3T1YO 2Q9LA 4I27A 4Z6DA 1FS0G 2IU3A 1GO3F 1M56B 4YN4A 4YJ3A 2EILC 4J7JA 1XL6A 5J0QA 3D3IA 4EFBA 4OAGA 3C18A 1OCOB 1KDHA 2PFQA 4DOBA 1ZQOA 4QZDA 2ADPA 4LFBO 4ZIBA 4NR1A 3AG7A 4RT2A 3RVZA 3TETA 4JV5O 3JATA 2ZH2A 5IILA 1SERA 4QZBA 2HJDA 2EULA 4H33A 4KUMA 1W59A 5L3DA 4WBNA 4ICGA 2B1GA 2UUAB 5H2FZ 1IBLB 1H8EG 2RMKB 1H38A 5D5QA 4JI3O 4EBKA 4JI5O 3AG4B 4CS4A 4KLIA 3L73H 2CGOA 4P2ZA 4UAYA 1TV9A 4M04A 4NLKA 4MVRA 4O2BA 2ILMA 1IBMO 4Z6EA 2P7TC 3C5FA 4E2LA 4WBYA 3OVAA 3K5NA 4LF7O 3ZRWA 4B3RB 4GX0A 1XSLA 3ABMC 2XAGA 9ICWA 3M99B 4NXNB 9ICOA 3WG7C 4X64O 1QHTA 1TVKB 1JN3A 4DOCA 1XUQA 3RYFA 3HKEB 3V72A 3OTFA 4PDMA 1WP8A 2HHPA 4KLHA 4J42A 4WC2A 2N04A 4DUZO 9ICPA 4I28A 2LJ2A 4O4JB 4O4LB 2Z0AA 3BCCH 4DV6O 2BBJA 4I2FA 5L3GA 3K03A 5GTHZ 1F4MA 2AHZA 4EBJA 2W9MA 2B4VA 1COWG 4WCEV 4X4VA 1V55B 1ZQQA 4L8JA 8ICBA 3ZX6A 1NR1A 3QTCA 5HFLA 3SYAA 3SJQC 4LZGA 4MTOA 4AT7A 3LSUA 4JI6B 1HUZA 3ZN0A 3ZHSA 3CMEV 5IJ0A 2YDEA 4B08A 1EM1A 3NKUA 3FD9A 3CCUV 3HIYA 4K96A 5B3SB 1FKAO 3FX7A 5LGNA 4PGXA 5IYBO 5DN6G 4IGGA 1YTFB 1GM8A 1SQGA 3AQLA 9ICTA 2WLNA 2UXCB 4X1IA 2F66C 3OAAG 4DR1O 4DR3B 2BTOA 1F4NA 3HKBA 2FCLA 3K3WA 3ETEA 1I08A 1K34A 4G27B 2H8PC 4J41A 3ABUA 5CP2A 2UUCB 4WFBV 4X62B 1VQMV 3VOUA 1QR9A 4P9PA 2NR5A 4RUFA 2X0LA 4LF4B 7ICGA 5LMUB 4R63A 2ATKC 3UT5B 2WA4A 1TAEA 4O6AA 2X6AA 2AW9A 4W4KA 5HHHA 2VWJA 3IAYA 2ZM6O 4K0KO 4X0AA 4I2CA 3C2LA 1UJWB 1LR1A 4I9QA 1A32A 4PHZA 1K9MW 3WFQE 3WFVA 4RWQA 1ZQHA 3JCFA 5D63A 1RFYA 3CCLV 7ICOA 2D2CB 2BSKB 4KM5A 4I2JA 2GA9D 1L0NH 3CCEV 3JD2A 4ABMA 4JI4O 3WFOA 3JCZA 1UPGA 3E35A 4CS3A 1V54B 4O4IA 4CH4A 4FHPA 1H2LA 5IYZB 4Z1MG 2X6BA 2KQXA 1TVKA 3ETQA 3ETGA 1Y74B 3H01A 5C8YB 1M5IA 5HRHA 4I7ZB 3MGIA 3RJFA 2BBHA 2DOSA 2GBOA 4FLUA 2VQFO 3K59A 3KZIZ 2PGGA 1N36O 4LCUC 4FHWA 3FKSG 2IJHA 4O4LA 3LSSA 4FFKA 3R65A 3ZHTA 2NLJC 3CX5F 4C7UA 4DV5B 4M47A 4UB1A 1BCCH 5DKWA 2EILB 1NKDA 1I94B 2LGQA 4ATBB 1YTFD 1BGYH 3UPSA 1R6KA 3KCXA 3OTOO 3WFPA 4X4OA 2WSSG 4IL6Z 4Z2WA 4YHHO 4DR4B 4JPRA 1SQBH 1M90W 4HBNA 4RWNA 5J0TA 1FXKA 3JPTA 1MSDA 5BY1A 5FNVA 3SPGA 1VQPV 1ZQYA 1KUQA 3C66A 3OT7A 3W7SA 7ICPA 4BAYA 5IWAO 5JWPA 4KLFA 2JDIG 1TA8A 1AR4A 3HW8A 4JI0O 4YY3O 1WAZA 3EVKA 4BW9A 3Q4HB 5CB4B 5KA6A 2HKOA 3L9DA 4OPHA 2PXIA 3AU6A 4BIZA 2UUBO 4FVMA 1HNZO 3V7JA 1HUOA 9ICKA 1YDXA 5J0OA 1N34O 9ICVA 3THOA 1MIWA 4IQUA 3RJGA 4KLSA 1ZWIC 3WG7B 1JJ2U 4CZZA 1F51A 1PP9H 3OEEG 1KC8W 3L74H 3FB5C 3JPNA 3OVSA 3ISDA 8ICTA 4RQ3A 4IQVA 5IDJA 3FB7C 3A0RA 4B3MB 3CRAA 4FM0A 7ICUA 1IXBA 1X59A 4KHPB 1K4CC 4UB8Z 4OX9B 9ICIA 2IJKA 4GKJO 4OAFA 2VQEO 4JYCA 4F5NA 3AG3C 3J7AU 2DWEC 3OW2U 2ADQB 2JGUA 4FO6A 3CRRA 2FYUH 1ZQRA 2M2UA 3CCSV 2ZT9B 3N2GA 2KG7B 1JVMA 2FMQA 5IYZA 2Q6AA 1M4UA 3QF7A 5L3FA 4IYHA 1Q5OA 4X20B 2D3OW 1MSWD 2UXDB 1R8AA 2AZ0A 1ZTEA 3OEHG 2ZH8A 2K9PA 1S5JA 4N21A 3UXOA 1VQLV 5J2IA 3K04A 4X1YA 4UAZA 1S5HC 4DV3O 3N27A 4HNAB 5JJNB 8ICAA 2YS8A 4FHVA 1MIYA 2B51A 4RQ2A 9ICCA 4RQ4A 1AROP 2P6JA 5CWRA 3ASNB 5JQGB 5EC2C 4DYLA 4P4PA 2IJJA 1IXMA 1QBZA 2X6CA 4JYBA 1P49A 2EIJB 3H1JH 4WC3A 4X89A 5LMNB 1BPXA 5HREA 4XBFA 2PYJA 1TVAA 5TISZ 3ZHQA 8ICWA 4MT8A 2Q66A 3J81N 5BOMA 4UB3A 4F6RA 4RQ5A 2F93B 2EINB 1YCIA 4FLWA 5BR8O 3IC7A 4PJ0Z 2OIGA 1XMQO 5JCOC 5E1AC 4X4RA 5J0YA 1XNQO 4KP4A 4MW3A 3EXAA 1D5NA 4I4TA 4GKKB 1Q6IA 3E86A 5DBBA 4NTXA 1HNXO 1KP3A 1Q82W 9ICLA 3ER8C 4QIWF 4AQYO 5DB9A 1HR0B 3ABLC 1GTOA 4FH5A 1XOUA 3SJCC 3LSQA 1GM9A 2CTRA 3CC4V 4DW1A 2QA4V 7ICMA 1RP3B 2DWDC 5LXTB 3SJBC 4ZOLA 4LBEC 4K8VA 7ICRA 1BL8A 2BOCC 5GONA 1Q6HA 1S5LZ 1PPJH 3IGAC 1JMSA 4WC1A 1XI1A 4RPXA 3HJ4A 3HPLC 5IINA 3JSNA 4YD2A 1JCHA 2WLJA 4K99A 1R6NA 4YIOA 2Y48A 2UUAO 4QZ9A 3PN1A 2BPGA 2HLDG 2KSDA 5HRDA 4S3NA 1IBLO 1R1BA 3TCUA 4TUQA 4PDVA 3RH6A 4M5DA 1SF9A 1M57B 3U0ZA 1I0HA 4P30A 3B2EE 1GKFA 3ZIAG 2KG7A 5DBAA 3B4SA 4OAIZ 2Q7HA 2CH7B 4FJCC 4PDLA 4B3RO 2EIKC 1OCZC 4AHCA 4X8AA 4JAAA 4HNAA 4NXNO 3I5DA 3EF2A 2ZD9A 1VJ7A 4I0XA 3W7WA 4IQTA 4NXWA 2A0LA 2Q69A 3ETDA 3JPRA 2CUGA 2QR4A 1DLBA 8ICJA 1CEZA 5A9GA 5DBCA 1J5EB 5B1BC 3AEIA 1IBKB 3UO3A 1O9GA 2LGWA 7ICKA 4MVOA 2YSUB 2QTSA 4TQFA 2NNUA 4HZ3A 4PD4F 5FPOA 5LP6C 1BE3H 1WPXA 2BCCH 3ML0A 4QZEA 1I5YA 2Q8VA 4DV7B 1N0JA 4NB5A 8ICVA 4JI6O 2EIMC 3X2QB 7ICSA 5BMVB 5DB8A 1GM7A 5CA0B 4XDKA 4JAVA 4RWUA 1I5XA 1N33B 1AI5A 1XSNA 4EB6A 1MZEA 1IX9A 4KL1A 2VRZA 4R8CA 4KLQA 3AG3B 2YXHA 3K9SA 1RM1B 1DTOA 1SC5B 2ZIOA 3CPWU 2RN9A 2FB5A 2PI4A 3FYIB 1R6TA 3DXRB 2UXCO 2I9GA 2R9RB 2YXYA 4DR3O 4XRHA 4M9LA 2W6JG 1PV0A 3MDAA 1RPLA 4QZ8A 8ICUA 4RUEA 1QNMA 4DO2A 3JATB 1BPEA 2DN9A 1L1FA 5EK0A 3KCYA 2QM7A 4WBNB 2DR9A 2EBOA 4UB5A 1WP7A 2UUCO 2CTPA 3P3NA 4X62O 5CFSA 4NLZA 5J0RA 1I7FA 1KYOF 3UQ0A 4NKUA 3OWGA 3SPHA 4LF4O 2RNBA 5LMUO 3RJEA 5K1XA 4EV6A 2ITDC 4F5OA 3MD0A 2JEXA 2OCCC 2OYQA 1BZKA 4EFEA 4O2BB 1HDJA 7ICQA 2N05A 4DR2B 4PV1B 1BPDA 4K4HA 1SETA 1THZA 3G67A 1AP6A 2P22C 2ZNIA 2XAJA 2B9ZA 2BCUA 2Q5ZA 1GH6A 5KUKA 4RQ0A 3UKMA 2YEVB 4BR6A 8ICIA 8ICQA 3RYFB 3P3PA 4FZ1A 3RJJA 2Q7EA 8ICSA 1SQVH 3QO5A 4JLXA 4X4QA 1GN6A 4X65B 4DV4B 4N23A 1ZX3A 4PA4A 1ZJMA 3SYOA 3ABKC
chains in the Genus database with same CATH topology
1XSPA 1ZQJA 2ISPA 4KLTA 3HIYA 4F5RA 3B0XA 4X0BA 1ZQTA 4PGXA 4I2IA 5J2GA 1ZQUA 4AT9B 4I2HA 1ZQDA 3AQLA 9ICTA 2DR7A 4MF8A 3OUYA 3OVBA 4AT7B 9ICAA 5IIMA 8ICLA 4UBBA 4NXZA 4PH5A 4NY8A 3WFSC 2ZH3A 4RWOA 2M2TA 8ICYA 5CP2A 3MDCA 4I29A 4FHYA 2BPCA 5HRLA 1ZQBA 4RQ1A 8ICRA 1FA0A 9ICNA 7ICGA 4R63A 7ICVA 4I2BA 5HHHA 3AUOA 2BCSA 2FMSA 4I2CA 9ICRA 4X0AA 1NOMA 3C2LA 4UBCA 2IHMA 3WFQE 4X4NA 4RWQA 1ZQHA 1R8BA 4Z6CA 4KLEA 4QZGA 7ICOA 4I2JA 4WC5A 1TFYA 4M9NA 2O5AA 1BPYA 2ZH9A 3WFOA 1WOTA 1Q78A 8ICOA 5HRGA 4WC6A 4FHPA 1MQ2A 5J2HA 3UQ2A 1OU5A 4YD1A 2ZH7A 4ATBA 5HRHA 9ICFA 4NKTA 2ZHAA 3RJKA 3MGIA 3RJFA 1ZQLA 3UXPA 5HC9A 4MFCA 1JQRA 2GWSA 4KLJA 7ICHA 4WCWA 4FHWA 5J2CA 2ZH6A 2NRKA 4X5VA 5J29A 4M47A 4UB1A 3RH5A 5DKWA 3H39A 4EP7A 2PBEA 2BCRA 1ZQIA 4E8FA 1ZQXA 1PX5A 4ATBB 9ICQA 5HRBA 3PNCA 4NLNA 8ICXA 3UPSA 5J2KA 3WFPA 3JPPA 4GXIA 1ZQFA 4X4OA 4P2HA 5J2BA 1ZQMA 5D4BA 8ICGA 5DEDA 4RWPA 3H38A 4RWNA 5CB1A 9ICBA 5J0TA 3JPTA 1R89A 1ZQYA 3C2MA 4YMNA 3C66A 4K4IA 7ICPA 1BPZA 4I2EA 4AT9A 5J0XA 4KLFA 4LT6A 4XQ7A 3HW8A 1F5AA 4I2DA 3AU6A 3L9DA 2PXIA 9ICMA 5J2EA 4UAWA 2ISOA 3V7JA 4WC7A 4DO9A 2DVIA 3RJHA 1HUOA 9ICKA 5J0OA 9ICVA 1VFGA 1MIWA 4IQUA 4TUPA 2ZH4A 4KLUA 3RJGA 4KLSA 3ISCA 2ID1A 3JZ0A 4PHAA 4Z6FA 5D46A 4RPZA 4XUSA 2PFNA 2PFOA 3JPNA 3OVSA 3ISDA 4JWNA 4QZAA 4RQ3A 4IQVA 1ZJNA 8ICTA 2DR5A 7ICUA 9ICIA 4M0AA 4F5NA 3OGUA 4P4OA 4FO6A 1ZQRA 2M2UA 2FMQA 5IIOA 9ICJA 4RQ6A 5J2FA 1R8AA 1Q79A 4PPXA 5DECA 2O1PA 2ZH8A 3UXOA 9ICHA 5J2IA 4UAZA 2VANA 2FMPA 2PFPA 8ICAA 4UB2A 3B0YA 5DB7A 2RFFA 4FHVA 2M2VA 1MIYA 4RQ2A 1TFWA 9ICCA 4RQ4A 3LQCB 3AQMA 5J2JA 5CA7A 1ZQPA 5HRKA 5CWRA 3V7KA 4P4PA 3AU2A 2ZH1A 4TUSA 2ZH5A 4M9JA 5D49A 4AT8A 8ICNA 3JPSA 4WC3A 1BPXA 5CHGA 4O5CA 5HREA 8ICMA 4LZDA 1TVAA 7ICEA 2P66A 3MGHA 1KNYA 8ICWA 4WC4A 2Q66A 5BOMA 1UETA 4UB3A 3PMLA 4KLOA 1RZTA 9ICGA 4RQ5A 4UD5A 4FHXA 5J0WA 4PGQA 7ICIA 4X4RA 5J0YA 4JWMA 3V7LA 3HX0A 3RJIA 1ZQGA 4AT8B 5DB6A 4O9MA 5DBBA 3TFSA 4RT3A 9ICLA 2BCQA 4F5QA 3K75D 4X4UA 5DB9A 4O5KA 8ICFA 4FH5A 4RQ8A 5J2DA 4XA5A 4MFFA 5DDMA 3WFRE 7ICMA 4R64A 4LVSA 8ICKA 2M2WA 7ICRA 3OV7A 5IIKA 4R66A 1V4AA 5IIJA 3TFRA 4KLMA 1JMSA 4YCXA 5EOZA 5CJ7A 4WC1A 5DDYA 4RPXA 2BPFA 3HJ4A 1ZQSA 4UD4A 4NM2A 4RQ7A 3AQNA 3UPQA 4YD2A 5IINA 4NM1A 7ICLA 9ICEA 4R65A 4KLLA 3JYYA 4XQ8A 4M2YA 4PHPA 3C2KA 4UB4A 4QZ9A 5HRFA 5J2AA 2BPGA 3PMNA 5HRDA 4S3NA 2ZHBA 4YMOA 4TUQA 3RH6A 4KLDA 4M5DA 4MFAA 4GXKA 4FH3A 9ICUA 1NO5A 4PHDA 7ICJA 2BCVA 3H37A 4M9GA 3ISBA 4E80A 5DBAA 1ZQZA 4E7XA 4QZFA 3H3AA 5BOLA 1KEJA 1ZQAA 2BE3A 4X4SA 4O5EA 8ICHA 1VJ7A 2DR8A 4F5PA 4IQTA 2DRAA 4MF2A 3JPRA 4WBZA 8ICJA 3MBYA 5HR9A 4PGYA 7ICTA 4M9HA 9ICXA 4IQWA 1ZQKA 5DBCA 7ICFA 4WC0A 5TZVA 3HWTA 1ZQCA 4I27A 4RPYA 4X4TA 4Z6DA 3OUYB 3JPOA 4GXJA 4I2GA 7ICKA 4QZIA 3GDXA 4YN4A 4QZHA 8ICCA 1MIVA 4P4MA 9ICSA 4QZEA 5J0QA 3C18A 4PHEA 1KDHA 2PFQA 4K4GA 4DOBA 1ZQOA 1YLQA 4QZDA 8ICVA 7ICSA 5DB8A 4X4PA 1R8CA 4RT2A 1XSNA 5IILA 2ZH2A 4QZBA 2DRBA 4KLQA 3RH4A 2I9GA 8ICZA 4XRHA 1BPBA 4IG8A 4EBKA 4M9LA 3MDAA 1RPLA 4QZ8A 8ICUA 4KLIA 4UAYA 5J0UA 3AQKA 1TV9A 4M04A 4KLGA 1BPEA 4NLKA 4Z6EA 5J0PA 3C5FA 2DR9A 4WBYA 4UB5A 4QZCA 3NYBA 5HRIA 3OVAA 1ZQNA 5F2VO 1ZQVA 1XSLA 4NLZA 5J0RA 9ICWA 5J0SA 9ICOA 3UQ0A 4NKUA 1JAJA 4I2AA 1JN3A 4DOCA 1UEUA 3HJ1A 3RJEA 3V72A 8ICPA 3JPQA 1MQ3A 2HHPA 4F5OA 4KLHA 4WC2A 9ICPA 4I28A 7ICQA 4I2FA 1BPDA 4K4HA 5HHIA 3C5GA 5IIIA 4EBJA 4DOAA 2BCUA 4RQ0A 2W9MA 1UEVA 5BPCA 3UXNA 4X4VA 8ICIA 8ICQA 1ZQQA 3RJJA 1ZQEA 3LK9A 8ICBA 1ZQWA 5CR0A 8ICSA 4X4QA 4LZGA 4AT7A 1HUZA 4TURA 8ICEA 1ZJMA 4YMMA 7ICNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSP A;  1ZQJ A;  2ISP A;  4KLT A;  3HIY A;  4F5R A;  3B0X A;  4X0B A;  1ZQT A;  4PGX A;  4I2I A;  5J2G A;  1ZQU A;  4AT9 B;  4I2H A;  1ZQD A;  3AQL A;  9ICT A;  2DR7 A;  4MF8 A;  3OUY A;  3OVB A;  4AT7 B;  9ICA A;  5IIM A;  8ICL A;  4UBB A;  4NXZ A;  4PH5 A;  4NY8 A;  3WFS C;  2ZH3 A;  4RWO A;  2M2T A;  8ICY A;  5CP2 A;  3MDC A;  4I29 A;  4FHY A;  2BPC A;  5HRL A;  1ZQB A;  4RQ1 A;  8ICR A;  1FA0 A;  9ICN A;  7ICG A;  4R63 A;  7ICV A;  4I2B A;  5HHH A;  3AUO A;  2BCS A;  2FMS A;  4I2C A;  9ICR A;  4X0A A;  1NOM A;  3C2L A;  4UBC A;  2IHM A;  3WFQ E;  4X4N A;  4RWQ A;  1ZQH A;  1R8B A;  4Z6C A;  4KLE A;  4QZG A;  7ICO A;  4I2J A;  4WC5 A;  1TFY A;  4M9N A;  2O5A A;  1BPY A;  2ZH9 A;  3WFO A;  1WOT A;  1Q78 A;  8ICO A;  5HRG A;  4WC6 A;  4FHP A;  1MQ2 A;  5J2H A;  3UQ2 A;  1OU5 A;  4YD1 A;  2ZH7 A;  4ATB A;  5HRH A;  9ICF A;  4NKT A;  2ZHA A;  3RJK A;  3MGI A;  3RJF A;  1ZQL A;  3UXP A;  5HC9 A;  4MFC A;  1JQR A;  2GWS A;  4KLJ A;  7ICH A;  4WCW A;  4FHW A;  5J2C A;  2ZH6 A;  2NRK A;  4X5V A;  5J29 A;  4M47 A;  4UB1 A;  3RH5 A;  5DKW A;  3H39 A;  4EP7 A;  2PBE A;  2BCR A;  1ZQI A;  4E8F A;  1ZQX A;  1PX5 A;  4ATB B;  9ICQ A;  5HRB A;  3PNC A;  4NLN A;  8ICX A;  3UPS A;  5J2K A;  3WFP A;  3JPP A;  4GXI A;  1ZQF A;  4X4O A;  4P2H A;  5J2B A;  1ZQM A;  5D4B A;  8ICG A;  5DED A;  4RWP A;  3H38 A;  4RWN A;  5CB1 A;  9ICB A;  5J0T A;  3JPT A;  1R89 A;  1ZQY A;  3C2M A;  4YMN A;  3C66 A;  4K4I A;  7ICP A;  1BPZ A;  4I2E A;  4AT9 A;  5J0X A;  4KLF A;  4LT6 A;  4XQ7 A;  3HW8 A;  1F5A A;  4I2D A;  3AU6 A;  3L9D A;  2PXI A;  9ICM A;  5J2E A;  4UAW A;  2ISO A;  3V7J A;  4WC7 A;  4DO9 A;  2DVI A;  3RJH A;  1HUO A;  9ICK A;  5J0O A;  9ICV A;  1VFG A;  1MIW A;  4IQU A;  4TUP A;  2ZH4 A;  4KLU A;  3RJG A;  4KLS A;  3ISC A;  2ID1 A;  3JZ0 A;  4PHA A;  4Z6F A;  5D46 A;  4RPZ A;  4XUS A;  2PFN A;  2PFO A;  3JPN A;  3OVS A;  3ISD A;  4JWN A;  4QZA A;  4RQ3 A;  4IQV A;  1ZJN A;  8ICT A;  2DR5 A;  7ICU A;  9ICI A;  4M0A A;  4F5N A;  3OGU A;  4P4O A;  4FO6 A;  1ZQR A;  2M2U A;  2FMQ A;  5IIO A;  9ICJ A;  4RQ6 A;  5J2F A;  1R8A A;  1Q79 A;  4PPX A;  5DEC A;  2O1P A;  2ZH8 A;  3UXO A;  9ICH A;  5J2I A;  4UAZ A;  2VAN A;  2FMP A;  2PFP A;  8ICA A;  4UB2 A;  3B0Y A;  5DB7 A;  2RFF A;  4FHV A;  2M2V A;  1MIY A;  4RQ2 A;  1TFW A;  9ICC A;  4RQ4 A;  3LQC B;  3AQM A;  5J2J A;  5CA7 A;  1ZQP A;  5HRK A;  5CWR A;  3V7K A;  4P4P A;  3AU2 A;  2ZH1 A;  4TUS A;  2ZH5 A;  4M9J A;  5D49 A;  4AT8 A;  8ICN A;  3JPS A;  4WC3 A;  1BPX A;  5CHG A;  4O5C A;  5HRE A;  8ICM A;  4LZD A;  1TVA A;  7ICE A;  2P66 A;  3MGH A;  1KNY A;  8ICW A;  4WC4 A;  2Q66 A;  5BOM A;  1UET A;  4UB3 A;  3PML A;  4KLO A;  1RZT A;  9ICG A;  4RQ5 A;  4UD5 A;  4FHX A;  5J0W A;  4PGQ A;  7ICI A;  4X4R A;  5J0Y A;  4JWM A;  3V7L A;  3HX0 A;  3RJI A;  1ZQG A;  4AT8 B;  5DB6 A;  4O9M A;  5DBB A;  3TFS A;  4RT3 A;  9ICL A;  2BCQ A;  4F5Q A;  3K75 D;  4X4U A;  5DB9 A;  4O5K A;  8ICF A;  4FH5 A;  4RQ8 A;  5J2D A;  4XA5 A;  4MFF A;  5DDM A;  3WFR E;  7ICM A;  4R64 A;  4LVS A;  8ICK A;  2M2W A;  7ICR A;  3OV7 A;  5IIK A;  4R66 A;  1V4A A;  5IIJ A;  3TFR A;  4KLM A;  1JMS A;  4YCX A;  5EOZ A;  5CJ7 A;  4WC1 A;  5DDY A;  4RPX A;  2BPF A;  3HJ4 A;  1ZQS A;  4UD4 A;  4NM2 A;  4RQ7 A;  3AQN A;  3UPQ A;  4YD2 A;  5IIN A;  4NM1 A;  7ICL A;  9ICE A;  4R65 A;  4KLL A;  3JYY A;  4XQ8 A;  4M2Y A;  4PHP A;  3C2K A;  4UB4 A;  4QZ9 A;  5HRF A;  5J2A A;  2BPG A;  3PMN A;  5HRD A;  4S3N A;  2ZHB A;  4YMO A;  4TUQ A;  3RH6 A;  4KLD A;  4M5D A;  4MFA A;  4GXK A;  4FH3 A;  9ICU A;  1NO5 A;  4PHD A;  7ICJ A;  2BCV A;  3H37 A;  4M9G A;  3ISB A;  4E80 A;  5DBA A;  1ZQZ A;  4E7X A;  4QZF A;  3H3A A;  5BOL A;  1KEJ A;  1ZQA A;  2BE3 A;  4X4S A;  4O5E A;  8ICH A;  1VJ7 A;  2DR8 A;  4F5P A;  4IQT A;  2DRA A;  4MF2 A;  3JPR A;  4WBZ A;  8ICJ A;  3MBY A;  5HR9 A;  4PGY A;  7ICT A;  4M9H A;  9ICX A;  4IQW A;  1ZQK A;  5DBC A;  7ICF A;  4WC0 A;  5TZV A;  3HWT A;  1ZQC A;  4I27 A;  4RPY A;  4X4T A;  4Z6D A;  3OUY B;  3JPO A;  4GXJ A;  4I2G A;  7ICK A;  4QZI A;  3GDX A;  4YN4 A;  4QZH A;  8ICC A;  1MIV A;  4P4M A;  9ICS A;  4QZE A;  5J0Q A;  3C18 A;  4PHE A;  1KDH A;  2PFQ A;  4K4G A;  4DOB A;  1ZQO A;  1YLQ A;  4QZD A;  8ICV A;  7ICS A;  5DB8 A;  4X4P A;  1R8C A;  4RT2 A;  1XSN A;  5IIL A;  2ZH2 A;  4QZB A;  2DRB A;  4KLQ A;  3RH4 A;  2I9G A;  8ICZ A;  4XRH A;  1BPB A;  4IG8 A;  4EBK A;  4M9L A;  3MDA A;  1RPL A;  4QZ8 A;  8ICU A;  4KLI A;  4UAY A;  5J0U A;  3AQK A;  1TV9 A;  4M04 A;  4KLG A;  1BPE A;  4NLK A;  4Z6E A;  5J0P A;  3C5F A;  2DR9 A;  4WBY A;  4UB5 A;  4QZC A;  3NYB A;  5HRI A;  3OVA A;  1ZQN A;  5F2V O;  1ZQV A;  1XSL A;  4NLZ A;  5J0R A;  9ICW A;  5J0S A;  9ICO A;  3UQ0 A;  4NKU A;  1JAJ A;  4I2A A;  1JN3 A;  4DOC A;  1UEU A;  3HJ1 A;  3RJE A;  3V72 A;  8ICP A;  3JPQ A;  1MQ3 A;  2HHP A;  4F5O A;  4KLH A;  4WC2 A;  9ICP A;  4I28 A;  7ICQ A;  4I2F A;  1BPD A;  4K4H A;  5HHI A;  3C5G A;  5III A;  4EBJ A;  4DOA A;  2BCU A;  4RQ0 A;  2W9M A;  1UEV A;  5BPC A;  3UXN A;  4X4V A;  8ICI A;  8ICQ A;  1ZQQ A;  3RJJ A;  1ZQE A;  3LK9 A;  8ICB A;  1ZQW A;  5CR0 A;  8ICS A;  4X4Q A;  4LZG A;  4AT7 A;  1HUZ A;  4TUR A;  8ICE A;  1ZJM A;  4YMM A;  7ICN A; 
#chains in the Genus database with same CATH topology
 1CP9 A;  2F4V B;  5B1O A;  1ZQJ A;  1US6 A;  1URF A;  3F5W C;  1XL4 A;  3ABL B;  3E22 B;  1H2M A;  4JI1 B;  4UCS A;  4DV5 O;  4JI7 B;  2HVK C;  1ZQD A;  5EIB C;  2OIE A;  3WB2 A;  5GTI Z;  2DR7 A;  1R3L C;  4AT7 B;  3G6B A;  1I94 O;  2EX3 A;  8ICL A;  4QE7 A;  2QKS A;  3HB3 B;  5IJ0 B;  4UBB A;  3G80 A;  1UFI A;  2W0F C;  1WA8 A;  2H3O A;  3BY6 A;  1YJW V;  1M93 A;  5KLV H;  4DR4 O;  5CA0 A;  3CYO A;  3RYC A;  1S77 D;  3KG2 A;  4O67 A;  4X1I B;  4RQ1 A;  3CRQ A;  4TQD A;  1FA0 A;  4UXN A;  2EZO A;  5LHH A;  3HKB B;  4R7C A;  7ICV A;  4I2B A;  2JRI A;  3DXR A;  2FMS A;  1E1R G;  1NOM A;  2P4K A;  3UM7 A;  4TV9 A;  2F23 A;  4JGS A;  1YHQ V;  2O57 A;  4X4N A;  1R8B A;  4Z6C A;  4KLE A;  1N8R W;  4WC5 A;  2O5A A;  4FO1 A;  3K57 A;  2W6I G;  2ZH9 A;  1XNR B;  4D6T H;  2B56 A;  3G4S V;  4LWS A;  4B7K A;  4WC6 A;  1Q90 D;  4EEB A;  1AJP A;  5J2H A;  2XTA A;  1XMO B;  1JX9 A;  2ZNJ A;  1DK1 A;  3OD4 A;  3RYH A;  4NKT A;  2ZCE A;  3G6E V;  5HC9 A;  2CE4 A;  2ZE5 A;  1JQR A;  4B3M O;  4KLJ A;  2Y0P A;  4H13 B;  4WCW A;  4KHP O;  5J2C A;  1FFT B;  4OX9 O;  5B1B B;  4X5V A;  1ZL8 B;  1YIJ V;  5J29 A;  5ITZ A;  4O4I B;  3RH5 A;  3H9V A;  3H39 A;  1K3E A;  2PBE A;  2BCR A;  1ZQI A;  5LP6 B;  3MHH C;  5GW7 A;  2YEV A;  3CJH A;  9ICQ A;  4NTW A;  3AG1 B;  3SGI A;  4J9Z B;  5HRB A;  3PNC A;  5JCO A;  1NS1 A;  3QO7 A;  4I50 A;  2KKW A;  3OFN G;  2GV9 A;  4GZR B;  1ZQM A;  1VQ4 V;  5EC1 C;  2LQT A;  2UXD O;  2CAZ C;  8ICG A;  5BXZ A;  3SPC A;  3OR6 C;  1XHZ A;  1Q81 W;  1NQT A;  2ZKO A;  1EZV H;  2L6L A;  1Y76 A;  2CGN A;  1QU7 A;  3K7D A;  3E22 A;  1R89 A;  4YMN A;  2RCV A;  4MSW C;  1BPZ A;  5H6R A;  1PKX A;  1H2G A;  1PNM A;  2P4V A;  3B8M A;  3SPJ A;  1WPB A;  2YIB A;  4LEZ A;  2WLI A;  4I2D A;  9ICM A;  3CK6 A;  5LL6 Y;  1KBH A;  3ZMV A;  5LMN O;  4UAW A;  2ISO A;  4DO9 A;  2DVI A;  3RJH A;  1FXK B;  3OMN B;  4JZ2 A;  4N7R A;  5IE9 A;  5FNV B;  1NH2 B;  1VFG A;  3ZMS A;  4KLU A;  5JJE B;  4UFZ A;  2ID1 A;  3JZ0 A;  3A0B Z;  1R3J C;  4NXV A;  3CHX A;  2IUB A;  1OZ0 A;  2Q0O C;  2XAH A;  4TSF G;  2KB1 A;  3TXS A;  1FD9 A;  2PFN A;  4GKK O;  3K9A A;  3EFF K;  4PI0 A;  5CN0 A;  3RGB A;  4PA9 A;  2HJF C;  2E75 B;  1EN4 A;  2DR5 A;  4OAH A;  1HR0 O;  1VQ5 V;  3W7X A;  3VQX A;  4EED A;  2VS0 A;  3FAV A;  4J9Y B;  4AI8 A;  4UVB A;  1YXB A;  3U11 A;  4B3T B;  4FLT A;  1AVM A;  5EBL C;  2P67 A;  3E2E A;  4K8Z A;  1EN5 A;  3NWI A;  4UCR A;  2HVJ C;  3ICX A;  1LUV A;  3L70 H;  1Q79 A;  4PPX A;  1Z5W A;  5DEC A;  4H44 B;  1Y4M A;  1DF5 A;  3P30 A;  1G8M A;  1VF7 A;  4UB2 A;  3K06 A;  4TV8 A;  5CA7 A;  2GSM B;  1ZL8 A;  1ZQP A;  4UCT A;  3N2G B;  2ZR2 A;  3JYC A;  3I56 V;  3AU2 A;  3AG2 C;  4UB6 Z;  4YJ2 A;  3F5T A;  2LW1 A;  2CTQ A;  5LP6 A;  2EZP A;  5D49 A;  4AT8 A;  3OR7 C;  5E79 Z;  4O5C A;  8ICM A;  2HR3 A;  3T1H B;  3JAR A;  4X1Y B;  4AIL C;  5CMU A;  3MGH A;  2Y69 C;  3E83 A;  4KLO A;  3E8F A;  3DC6 A;  4U3J B;  4FHX A;  4QPK A;  5CFT A;  1F23 A;  1NH2 D;  3E89 A;  2C2A A;  1XEQ A;  4LF9 B;  3ZED A;  3RJI A;  3HR0 A;  5DB6 A;  3EHB B;  1CPY A;  3TFS A;  3ABT A;  4GX1 A;  4J7Z A;  4O68 A;  4F5Q A;  1B6Q A;  4F6R B;  1J5E O;  4OGQ B;  8ICF A;  1WB8 A;  3AK2 A;  1ENV A;  5D61 A;  4MFF A;  4NTY A;  1K97 A;  1OJH A;  5DDM A;  1IBK O;  2LO1 A;  4MVS A;  3CMA V;  3CRM A;  4DR6 B;  4I4T B;  4WQL A;  4IHJ A;  3JCU Z;  4Q6G A;  4DV7 O;  4LF6 B;  4DK0 A;  4KLM A;  3FFQ A;  4X88 A;  3JSL A;  3CEI A;  4UD4 A;  2F1M A;  1N33 O;  3PJS K;  4KLL A;  2V7Q G;  3ZRS A;  1OHH G;  2HN1 A;  4UB4 A;  3ABM B;  4PA7 A;  4ZOL B;  4EKW A;  2K1E A;  2ZHB A;  4YMO A;  5CA3 A;  3APO A;  5GON B;  1U96 A;  4MFA A;  4CS2 A;  4JF3 A;  4K9B A;  3ISB A;  4UVC A;  5EZY A;  4TUY B;  1P84 F;  4E7X A;  4UV8 A;  3T2M A;  2GTA A;  3W7U A;  1KP2 A;  1EZJ A;  4L87 A;  2P90 A;  8ICH A;  4IYI A;  2DR8 A;  2DRA A;  4MF2 A;  3HKD B;  1E1Q G;  3MBY A;  2XAF A;  2FTK A;  3SPI A;  4PGY A;  4IQW A;  1WLE A;  5D62 A;  1ZQK A;  5KHH A;  4WFG A;  4LF8 B;  2DYR C;  3C3T A;  5B5E Z;  1R3I C;  4DR2 O;  4KXR A;  3CC2 V;  5J9P C;  4RPY A;  1YIT V;  4GXJ A;  4I2G A;  2V4D A;  4QZI A;  3UO2 A;  8ICC A;  4I0X B;  4P4M A;  3CCV V;  4U3J A;  2DYS C;  3LDC A;  5B1A C;  4Z1V A;  1YLQ A;  4X65 O;  4DV4 O;  4NXT A;  4JI8 B;  5AG2 A;  4UCV A;  2UXN A;  3BRC A;  4X4P A;  1R8C A;  2F4V O;  2HHH B;  3STL C;  3RFR A;  5CBG A;  3APQ A;  3JAS A;  3TXQ A;  1ZSP A;  4GYC B;  2DW4 A;  1HWY A;  4JI1 O;  4DR7 B;  4JI7 O;  1GN2 A;  3RH4 A;  3T4Z A;  2CK3 G;  1RSO B;  3H1K H;  3ZCC A;  8ICZ A;  4IG8 A;  1L8D A;  1BPB A;  2IH3 C;  1K33 A;  3SYQ A;  2JGD A;  3K5L A;  4EB6 B;  1MNG A;  4UVA A;  1VF6 C;  2Y4T A;  2G38 A;  5J0P A;  2JK5 C;  4GX2 A;  4QZC A;  3M8A A;  2B1I A;  5HRI A;  1F7Y A;  5F2V O;  4TOI A;  1QLE C;  2Q7G A;  4CH3 A;  4B3S B;  2PUS A;  3E8B A;  2QTO A;  2GUZ B;  2JJ1 G;  1JAJ A;  4WFE A;  1UEU A;  3HJ1 A;  1KMI Z;  3AG2 B;  3F7V C;  4FLV A;  8ICP A;  3VQW A;  2M7W A;  3S3X A;  3GWO A;  1FYJ A;  4BW5 A;  4JTC B;  4MKP A;  2IH1 C;  4K3A A;  3DSQ A;  4DR5 B;  4MVZ A;  3CSX A;  4LH6 A;  1K73 W;  3A8T A;  1BQZ A;  5HHI A;  3C5G A;  5III A;  4TUY A;  4A5U B;  4NXU A;  4DOA A;  1R73 A;  1VQO V;  2UXB B;  4DXW A;  1XNR O;  2WLL A;  3AK3 A;  3UXN A;  5BPC A;  2Q0A A;  5KHK A;  3MDS A;  5H9C A;  3LK9 A;  5KHG A;  1XMO O;  2HFE C;  2XOK G;  4TUR A;  8ICE A;  2BTQ A;  3BHP A;  3UCS C;  7ICN A;  5KX5 B;  3HKD A;  1ZUQ A;  3MCR A;  2AXT Z;  1XSP A;  4KLT A;  1LUW A;  4IIJ A;  1TUB A;  2XT9 A;  4X0B A;  4MVM A;  4J11 A;  1ZQU A;  1IVS A;  3BVO A;  4WFA V;  4K9A A;  3D8C A;  2OTL V;  1OCO C;  4TT3 G;  1M1K W;  2HP8 A;  2VWK A;  5IIM A;  4NXZ A;  4JAS A;  4PH5 A;  1IZ3 A;  4NY8 A;  4X1K A;  4J7K A;  4ZHQ B;  2ZH3 A;  4WQK A;  1JFF A;  4RWO A;  1KKD A;  2M2T A;  8ICY A;  1XIL A;  2JEU A;  5LOV B;  4RAI A;  3MDC A;  4I29 A;  4HYO A;  1FFX B;  4FIP C;  1QLN A;  5HRL A;  1JMK C;  8ICR A;  3CP1 A;  1GMG A;  1YSC A;  1BT8 A;  3IJ4 A;  1RSO A;  1WA8 B;  2PY5 A;  5L3B A;  4UBC A;  3OM3 B;  4H0L B;  4YIP A;  1MOF A;  5D5P A;  2Q68 A;  1Y6X A;  3RYC B;  4QZG A;  3JD3 A;  4DRX B;  4MW8 A;  1TFY A;  4M9N A;  5LHG A;  2N74 A;  3K5O A;  4I0U A;  5LBQ A;  1HW7 A;  4PA3 A;  1VQ7 V;  4FPP A;  4JTA B;  2R9A A;  1Q78 A;  1K4D C;  8ICO A;  3IC9 A;  5H6Q A;  2EJR A;  4OXS A;  1ZLZ A;  3UQ2 A;  2GUZ A;  2WAM A;  4YD1 A;  1XQ8 A;  4TV9 B;  2ZH7 A;  2ZHA A;  1ZQL A;  3UXP A;  1FXV A;  1P4R A;  2IW5 A;  4FM2 A;  3SDL A;  2DYR B;  2ZH6 A;  1S3J A;  4BIO A;  2NRK A;  1AJQ A;  4LWS B;  1V55 C;  1BHB A;  1O9H A;  4PA6 A;  4EP7 A;  1QCE A;  1GRJ A;  3BA9 A;  5CFU A;  1DF4 A;  1ZQX A;  3BAA A;  3LDE A;  3RYH B;  4B3T O;  4NLN A;  1Z2G A;  1DGS A;  1EN6 A;  2ZDI C;  2QWR B;  5B1A B;  1ZQF A;  3KKY A;  4XDL A;  4DV0 B;  4P2H A;  5J2B A;  2WLK A;  2OTJ V;  5DED A;  3H38 A;  3VQV A;  4IT5 A;  2VQE B;  4FM1 A;  1BHA A;  5KX5 A;  2IU0 A;  3RW0 A;  5ITZ B;  3C2M A;  5L3C A;  2JJ2 G;  4EGW A;  3CJH B;  5J0X A;  3IFX A;  1PNK A;  4JLZ A;  4LT6 A;  4O69 A;  4I50 B;  1M9N A;  1F5A A;  3RBZ A;  3CXC U;  1KU9 A;  2OWO A;  3NR7 A;  3T1H O;  5B1N A;  4BIU A;  4ZHQ A;  1Y76 B;  2AGA A;  3GWK C;  4LR3 A;  5JVD A;  1HNW B;  4TUP A;  4B7E A;  1B06 A;  3ISC A;  5LOV A;  4PHA A;  2ZXW C;  1QLE B;  2F95 B;  3R66 A;  1SKV A;  1FAF A;  1FFX A;  2WLI B;  4RPZ A;  4LF9 O;  4XUS A;  1H2K A;  4GUN A;  2PFO A;  3A0H Z;  3ZHU A;  1SA0 B;  3JD1 A;  4UUJ C;  4ZI7 B;  4WH5 A;  1AR5 A;  2Q67 A;  3L75 H;  1Q6U A;  4PEL A;  1V9P A;  4QPJ A;  5CBH A;  5IT9 N;  3BAB A;  1SQQ H;  2P06 A;  5IYC O;  1GK9 A;  3C90 A;  2LFR A;  4DRX A;  4WFH A;  1JPX A;  2DQ0 A;  1K7D A;  4DR6 O;  5B3Q A;  1PL0 A;  1H8H G;  1AP5 A;  3D36 C;  3E8G A;  4U7O A;  4LF6 O;  4NXX A;  5IIO A;  9ICJ A;  1NZ6 A;  2V1D A;  1B3Q A;  4RQ6 A;  2QKA A;  1KKC A;  2QGN A;  1JOY A;  1L0L H;  1VAR A;  1YI2 V;  1FPO A;  2VAN A;  4LH7 A;  4NXM B;  2FMP A;  2PFP A;  2BOB C;  1G4Y B;  2XUM A;  1PNL A;  1XDC A;  3FAV B;  4X66 B;  5DB7 A;  5CHE A;  2EIK B;  5BZB A;  2E5L B;  1OCZ B;  3AQM A;  3LQC B;  2JIZ G;  3V7K A;  4MVU A;  4G2K A;  2ZH1 A;  4UCU A;  5KMG A;  4O2A A;  1XRE A;  4M9J A;  4LFC B;  8ICN A;  1BSM A;  2LP7 A;  4NKG B;  1YF2 A;  5FL7 G;  2P66 A;  3U10 A;  1KNY A;  4LNU B;  3SYC A;  3PML A;  2UXX A;  3M7M X;  4JAU A;  1RZT A;  9ICG A;  4TV8 B;  1QVF U;  2ZE8 A;  4YJ2 B;  3H1I H;  3V7L A;  1ZQG A;  4U7N A;  5CBF A;  2W0X A;  4AT8 B;  1IDS A;  2YIB D;  3JAR B;  1AI6 A;  2XHB A;  5J2U A;  4RT3 A;  2EIM B;  4JYA B;  3CS5 A;  3RVY A;  3ZMZ A;  4XDJ A;  3DGE A;  4FLY A;  4LF8 O;  3K75 D;  1VQ6 V;  4O5K A;  3DC5 A;  2QWQ B;  4XA5 A;  1VF6 A;  1JJO A;  2QSA A;  2A79 B;  2QDO A;  2GDS A;  4DK1 A;  5LYJ B;  2EJ7 A;  4R64 A;  5J2T A;  3K0G A;  4NYK A;  4LVS A;  2HEP A;  3L71 H;  2RQ6 A;  1NBM G;  2RDC A;  1V4A A;  5IIJ A;  3TFR A;  1IUR A;  3JD4 A;  5EOZ A;  4JI8 O;  5CJ7 A;  2Z3Y A;  1N0N A;  3D3Q A;  2F43 G;  2BPF A;  1ZQS A;  2JVD A;  1WJZ A;  3RT3 C;  4ZI7 A;  1SA0 A;  3AQN A;  4RQ7 A;  4NM1 A;  2HHH O;  7ICL A;  9ICE A;  2PF4 E;  3JYY A;  4ZKI A;  4XQ8 A;  4M2Y A;  4PHP A;  3C2K A;  4DR7 O;  1MG1 A;  4RO2 A;  5J2A A;  4IHJ B;  2GHY A;  4DUY B;  1PD3 A;  4LFA B;  5KHI A;  2ZR3 A;  4GXK A;  2DE0 X;  4FH3 A;  7ICJ A;  3ZRV A;  4M9G A;  3BPZ A;  2OCC B;  2P5O A;  4H37 A;  3MHS C;  1QR8 A;  1Y66 A;  2ARH A;  4QGP A;  1CXZ B;  1ZQZ A;  4E80 A;  1PL4 A;  2M6Y A;  1XBL A;  4QNH B;  4CH6 A;  1S76 D;  2QM4 A;  2QJ1 A;  1ZQA A;  3ER9 B;  4W4L A;  2BE3 A;  2DQ3 A;  3ASN C;  2QKC A;  4B3S O;  2FML A;  1SQX H;  4OPA A;  4F5P A;  1H2S B;  2EIJ C;  4MS2 A;  4O4H B;  4WBZ A;  4GLX A;  1KEC A;  2DJV A;  3OGI B;  5EZY B;  5HR9 A;  7ICT A;  5FPR A;  3ZMU A;  1OCC C;  4DV2 B;  4FFB B;  2H94 A;  3ABK B;  4DR5 O;  1B04 A;  2EWR A;  5TZV A;  3GB7 C;  1AI7 A;  1VQK V;  1ZQC A;  1R3K C;  2EIN C;  4LF5 B;  4X4T A;  3OUY B;  3JPO A;  1N32 B;  2ZXW B;  2UXB O;  4LNU A;  1ZAU A;  3P32 A;  3GDX A;  4LEW A;  4QZH A;  3B77 A;  1MIV A;  9ICS A;  3BEH A;  4TWK A;  4FLZ A;  4PHE A;  2E74 B;  4K4G A;  1MAB G;  2A9H A;  3K08 A;  3TGU H;  3ZS8 C;  2X7R B;  4I5S A;  4JI2 B;  4R6Z A;  3DTU B;  2XAQ A;  3BFR A;  4ASU G;  1BS3 A;  3WB1 A;  3S3W A;  3OE7 G;  4GT1 A;  2DRB A;  1Y67 A;  1VEW A;  1GAX A;  3SR2 C;  3N2K B;  4DV1 B;  1J95 A;  1XHX A;  2UU9 B;  3NXS A;  3T1C A;  1AIL A;  5KHJ A;  5LYJ A;  4RQE A;  1SRY A;  2ZIN A;  3HKE A;  2WLH A;  5J0U A;  1WN7 A;  3CD6 V;  1GPJ A;  3AQK A;  3RYI B;  1SS3 A;  5H5N A;  4KLG A;  3JAS B;  2GAF D;  4O4J A;  2MW2 B;  1WB7 A;  4QJF B;  3J80 N;  5FLX N;  1ZQN A;  1FJG B;  3NYB A;  1JQ0 A;  1ZQV A;  2GTS A;  3CRC A;  2XND G;  5EYP B;  5J0S A;  4I2A A;  3UQ8 A;  2LFS A;  2Y0I A;  1M57 C;  1KQS U;  2YIC A;  2JGD B;  3JPQ A;  1X4T A;  1MQ3 A;  1VF5 B;  2A7W A;  1P7B A;  2OT5 A;  2E76 B;  3OUS A;  2ZDI A;  1NR7 A;  1YZB A;  1NTK H;  3T1Y B;  4JZG A;  4F6E A;  2JS5 A;  4FZ0 A;  1K5S A;  3CXH F;  4FK5 C;  4GCZ A;  4D7S A;  1UEV A;  3ASO C;  1SZT A;  3ZMT A;  3MAQ A;  3WB0 A;  3BA8 A;  4UV9 A;  1ZQE A;  1ZQW A;  5CR0 A;  5EIB D;  4LFB B;  2Y4U A;  4YMM A;  1VIB A;  1BMF G;  4O4H A;  2R9I A;  4JV5 B;  3H1L H;  2ISP A;  4F5R A;  3B0X A;  1ZQT A;  4FFB A;  4I2I A;  1Q7Y W;  2WLL B;  4UCO A;  1MMM A;  5J2G A;  4AT9 B;  4I2H A;  1BQ0 A;  3FB6 C;  3JD0 A;  4MF8 A;  3OUY A;  3OVB A;  4E4E A;  4JI3 B;  3CCJ V;  9ICA A;  1S0V A;  4JI5 B;  2BTQ B;  3X2Q C;  2QWP B;  2XAS A;  3UT5 A;  3WFS C;  4DV0 O;  4IIJ B;  1TUB B;  1JR9 A;  1IBM B;  5HFM A;  1Z5V A;  4LF7 B;  1U97 A;  5IY5 C;  3JAW B;  2BSK A;  3ZHR A;  1RM1 C;  1NU1 H;  3QG5 A;  4FHY A;  2BPC A;  1Q8I A;  1ZQB A;  1W0J G;  2L35 A;  3N2K A;  4X64 B;  9ICN A;  3CB2 A;  2ZE7 A;  4JTD B;  4LP8 A;  4QE9 A;  4X1K B;  4YXW G;  3AUO A;  2BCS A;  3VQY A;  9ICR A;  1JFF B;  5KAF Z;  4DUZ B;  1H2N A;  1HP8 A;  4MTG A;  1Y74 A;  1D2D A;  5C8Y A;  1QVG U;  2IHM A;  3D36 A;  4DV6 B;  4WF9 V;  1S72 V;  1ROP A;  1K5Q A;  3RYI A;  1BPY A;  1HNW O;  2RJZ A;  2A3Q A;  5K1P A;  1WOT A;  4G28 B;  4CH5 A;  1KB9 F;  2ETN A;  3HKC B;  4NVP A;  1QQC A;  2PI5 A;  5HRG A;  1MQ2 A;  5EYP A;  1OU5 A;  3RN4 A;  2YUA A;  4ATB A;  9ICF A;  3NVO A;  4J80 A;  3RJK A;  2ZQM A;  5CA1 B;  4Q20 A;  4MFC A;  2GWS A;  1OCC B;  4LC1 A;  2CTW A;  7ICH A;  4LEY A;  3JAL B;  3ZBH A;  1OCR C;  1W0K G;  4P9O A;  1NVP B;  3B8N A;  1NJI W;  1NT2 B;  2WA3 A;  2ZE6 A;  3OGC C;  4DR1 B;  4E8F A;  4JYY A;  2QM8 A;  1PX5 A;  8ICX A;  5J2K A;  4D7T A;  4KB6 A;  4I55 B;  3JPP A;  1PM9 A;  4GXI A;  5JJJ B;  1YEW A;  4CC6 A;  4X9Q A;  3Q4H A;  5CB4 A;  4R50 A;  3B09 A;  3FB8 C;  3TK1 A;  2IM9 A;  5D4B A;  4RWP A;  1SQF A;  4F4L A;  5CB1 A;  2Y69 B;  3LDD A;  1VMG A;  4NXM O;  9ICB A;  1P7G A;  3K0D A;  4X66 O;  4FLX A;  1K8A W;  1VP7 A;  2E5L O;  3OUF A;  1VQ8 V;  4K4I A;  4I2E A;  4AT9 A;  4PI2 A;  4WOY A;  4XQ7 A;  1E79 G;  4KFM A;  4K0K B;  2ZM6 B;  3ERC C;  3ZHV A;  2FL4 A;  4LFC O;  3CCM V;  5J2E A;  2QWN B;  5LHI A;  3T4D A;  4I9W A;  1VQN V;  4WC7 A;  2MK3 A;  3SJA C;  2PZS A;  5L3E A;  1Q86 W;  2ZH4 A;  4JI4 B;  4Z6F A;  1N4C A;  2QEX V;  5B3P A;  1M56 C;  5D46 A;  1RPO A;  3JAW A;  1EBO A;  1MA1 A;  3ZN1 A;  3GVM A;  3JAK B;  2A06 H;  3K5M A;  3E8H A;  5EBM C;  4K8X A;  2CDY A;  2ODM A;  1RPR A;  4JWN A;  3O9O A;  4QZA A;  1ZJN A;  2VQF B;  4JYA O;  2ITC C;  1N36 B;  4X20 A;  5JVD B;  5JH7 B;  5LGU A;  3C3S A;  4M0A A;  1NTM H;  2YID A;  2YIA A;  3ASO B;  3OGU A;  1G1X B;  1NVP D;  4P4O A;  1YJN V;  3HKC A;  5JQG A;  3OTO B;  3AG4 C;  1Q43 A;  2E3C A;  1ORQ C;  5J2F A;  4YHH B;  1OV9 A;  1NI8 A;  3K79 A;  3VBB A;  2O1P A;  2R70 A;  3I55 V;  9ICH A;  5CA1 A;  2FKX A;  3CCR V;  4K35 A;  2AHY A;  2QWO B;  1FXH A;  3JAL A;  3B0Y A;  5IJ9 B;  2RFF A;  1KD1 W;  2M2V A;  3O65 A;  1TFW A;  3QO8 A;  3WU2 Z;  3H1H H;  5IWA B;  5J2J A;  4DUY O;  5HRK A;  2HN2 A;  3AG1 C;  5LA6 B;  4JI0 B;  4YY3 B;  2QE7 G;  2Q4P A;  4LFA O;  3G71 V;  1Q3E A;  5LGT A;  4TUS A;  2ZH5 A;  2LW7 A;  1G6U A;  2UUB B;  3JPS A;  4EEQ A;  1TGO A;  1HNZ B;  5CHG A;  4I55 A;  4LZD A;  7ICE A;  2B5U A;  4K97 A;  1GN4 A;  3ZJZ A;  2R72 A;  2HG5 C;  2WLM A;  3L72 H;  1N34 B;  3STZ C;  1MZF A;  1UET A;  4WC4 A;  4K98 A;  3ZRX A;  4YJ3 B;  5IY5 B;  3B40 A;  2YXL A;  3RWR D;  4LEV A;  5C93 A;  4UD5 A;  5J0W A;  4HX0 A;  4PGQ A;  1T5E A;  7ICI A;  5KMG B;  4O2A B;  4JWM A;  3LNN A;  3HX0 A;  1SZX A;  3OMA B;  2DYS B;  5LXT A;  4O9M A;  4U3F H;  1SES A;  3A2F A;  2IHO A;  3JAM N;  1FXK C;  4DV2 O;  2BCQ A;  4X4U A;  4WFF A;  5B3S C;  4HAM A;  4GKJ B;  1AR1 B;  1JA8 A;  4RQ8 A;  5J2D A;  1LNQ A;  3OMI B;  2Z5U A;  2AZ2 A;  4LF5 O;  3PHZ A;  1EFR G;  1N32 O;  3CE2 A;  3WFR E;  2ZIM A;  3FYE B;  4J10 A;  2NN4 A;  2YC0 A;  8ICK A;  3QNE A;  1GN3 A;  4XJE A;  2M2W A;  1VQ9 V;  2DMX A;  3CCQ V;  3JAK A;  4PDR A;  1K92 A;  3OV7 A;  5IIK A;  4R66 A;  5J2U B;  5B66 Z;  4ZBM A;  4YCX A;  4DW0 A;  4JI2 O;  1AJN A;  5DDY A;  3CC7 V;  3F7Y C;  3SYP A;  4NM2 A;  3UPQ A;  3ZRW B;  1YVW A;  2YI9 A;  4DV3 B;  5A2Q N;  1OCR B;  4R65 A;  2IJI A;  2WPD G;  5JH7 A;  3W7T A;  3LUT B;  2CH7 A;  1SQP H;  5J2T B;  5HRF A;  4DV1 O;  2UU9 O;  3LNM B;  5KAI Z;  3PMN A;  1AI4 A;  4RQF A;  2Q73 A;  2PYL A;  1WNS A;  1NTZ H;  4KLD A;  3AK1 A;  4BWA A;  5IYD O;  9ICU A;  1NO5 A;  3TJT A;  4PHD A;  2BCV A;  3QVN A;  1YJ9 V;  3H37 A;  2JS3 A;  3CWB H;  4GX5 A;  4MVQ A;  2PTM A;  2WWW A;  4QZF A;  3H3A A;  5BOL A;  1FJG O;  1KEJ A;  2OCH A;  1TUE B;  4CC5 A;  5BR8 B;  1AB3 A;  2YI8 A;  5KA5 A;  1V54 C;  1XMQ B;  4MTX A;  1W2B U;  5IJ9 A;  4X4S A;  5KUM A;  4MTF A;  4O5E A;  1XNQ B;  5EBW C;  5LA6 A;  3K58 A;  1D5A A;  1HNX B;  4M9H A;  9ICX A;  4FMT A;  2IBZ H;  5DM6 V;  7ICF A;  4AQY B;  5BMV A;  4CBC A;  4WC0 A;  5JTG A;  3HWT A;  3T1Y O;  2Q9L A;  4I27 A;  4Z6D A;  1FS0 G;  2IU3 A;  1GO3 F;  1M56 B;  4YN4 A;  4YJ3 A;  2EIL C;  4J7J A;  1XL6 A;  5J0Q A;  3D3I A;  4EFB A;  4OAG A;  3C18 A;  1OCO B;  1KDH A;  2PFQ A;  4DOB A;  1ZQO A;  4QZD A;  2ADP A;  4LFB O;  4ZIB A;  4NR1 A;  3AG7 A;  4RT2 A;  3RVZ A;  3TET A;  4JV5 O;  3JAT A;  2ZH2 A;  5IIL A;  1SER A;  4QZB A;  2HJD A;  2EUL A;  4H33 A;  4KUM A;  1W59 A;  5L3D A;  4WBN A;  4ICG A;  2B1G A;  2UUA B;  5H2F Z;  1IBL B;  1H8E G;  2RMK B;  1H38 A;  5D5Q A;  4JI3 O;  4EBK A;  4JI5 O;  3AG4 B;  4CS4 A;  4KLI A;  3L73 H;  2CGO A;  4P2Z A;  4UAY A;  1TV9 A;  4M04 A;  4NLK A;  4MVR A;  4O2B A;  2ILM A;  1IBM O;  4Z6E A;  2P7T C;  3C5F A;  4E2L A;  4WBY A;  3OVA A;  3K5N A;  4LF7 O;  3ZRW A;  4B3R B;  4GX0 A;  1XSL A;  3ABM C;  2XAG A;  9ICW A;  3M99 B;  4NXN B;  9ICO A;  3WG7 C;  4X64 O;  1QHT A;  1TVK B;  1JN3 A;  4DOC A;  1XUQ A;  3RYF A;  3HKE B;  3V72 A;  3OTF A;  4PDM A;  1WP8 A;  2HHP A;  4KLH A;  4J42 A;  4WC2 A;  2N04 A;  4DUZ O;  9ICP A;  4I28 A;  2LJ2 A;  4O4J B;  4O4L B;  2Z0A A;  3BCC H;  4DV6 O;  2BBJ A;  4I2F A;  5L3G A;  3K03 A;  5GTH Z;  1F4M A;  2AHZ A;  4EBJ A;  2W9M A;  2B4V A;  1COW G;  4WCE V;  4X4V A;  1V55 B;  1ZQQ A;  4L8J A;  8ICB A;  3ZX6 A;  1NR1 A;  3QTC A;  5HFL A;  3SYA A;  3SJQ C;  4LZG A;  4MTO A;  4AT7 A;  3LSU A;  4JI6 B;  1HUZ A;  3ZN0 A;  3ZHS A;  3CME V;  5IJ0 A;  2YDE A;  4B08 A;  1EM1 A;  3NKU A;  3FD9 A;  3CCU V;  3HIY A;  4K96 A;  5B3S B;  1FKA O;  3FX7 A;  5LGN A;  4PGX A;  5IYB O;  5DN6 G;  4IGG A;  1YTF B;  1GM8 A;  1SQG A;  3AQL A;  9ICT A;  2WLN A;  2UXC B;  4X1I A;  2F66 C;  3OAA G;  4DR1 O;  4DR3 B;  2BTO A;  1F4N A;  3HKB A;  2FCL A;  3K3W A;  3ETE A;  1I08 A;  1K34 A;  4G27 B;  2H8P C;  4J41 A;  3ABU A;  5CP2 A;  2UUC B;  4WFB V;  4X62 B;  1VQM V;  3VOU A;  1QR9 A;  4P9P A;  2NR5 A;  4RUF A;  2X0L A;  4LF4 B;  7ICG A;  5LMU B;  4R63 A;  2ATK C;  3UT5 B;  2WA4 A;  1TAE A;  4O6A A;  2X6A A;  2AW9 A;  4W4K A;  5HHH A;  2VWJ A;  3IAY A;  2ZM6 O;  4K0K O;  4X0A A;  4I2C A;  3C2L A;  1UJW B;  1LR1 A;  4I9Q A;  1A32 A;  4PHZ A;  1K9M W;  3WFQ E;  3WFV A;  4RWQ A;  1ZQH A;  3JCF A;  5D63 A;  1RFY A;  3CCL V;  7ICO A;  2D2C B;  2BSK B;  4KM5 A;  4I2J A;  2GA9 D;  1L0N H;  3CCE V;  3JD2 A;  4ABM A;  4JI4 O;  3WFO A;  3JCZ A;  1UPG A;  3E35 A;  4CS3 A;  1V54 B;  4O4I A;  4CH4 A;  4FHP A;  1H2L A;  5IYZ B;  4Z1M G;  2X6B A;  2KQX A;  1TVK A;  3ETQ A;  3ETG A;  1Y74 B;  3H01 A;  5C8Y B;  1M5I A;  5HRH A;  4I7Z B;  3MGI A;  3RJF A;  2BBH A;  2DOS A;  2GBO A;  4FLU A;  2VQF O;  3K59 A;  3KZI Z;  2PGG A;  1N36 O;  4LCU C;  4FHW A;  3FKS G;  2IJH A;  4O4L A;  3LSS A;  4FFK A;  3R65 A;  3ZHT A;  2NLJ C;  3CX5 F;  4C7U A;  4DV5 B;  4M47 A;  4UB1 A;  1BCC H;  5DKW A;  2EIL B;  1NKD A;  1I94 B;  2LGQ A;  4ATB B;  1YTF D;  1BGY H;  3UPS A;  1R6K A;  3KCX A;  3OTO O;  3WFP A;  4X4O A;  2WSS G;  4IL6 Z;  4Z2W A;  4YHH O;  4DR4 B;  4JPR A;  1SQB H;  1M90 W;  4HBN A;  4RWN A;  5J0T A;  1FXK A;  3JPT A;  1MSD A;  5BY1 A;  5FNV A;  3SPG A;  1VQP V;  1ZQY A;  1KUQ A;  3C66 A;  3OT7 A;  3W7S A;  7ICP A;  4BAY A;  5IWA O;  5JWP A;  4KLF A;  2JDI G;  1TA8 A;  1AR4 A;  3HW8 A;  4JI0 O;  4YY3 O;  1WAZ A;  3EVK A;  4BW9 A;  3Q4H B;  5CB4 B;  5KA6 A;  2HKO A;  3L9D A;  4OPH A;  2PXI A;  3AU6 A;  4BIZ A;  2UUB O;  4FVM A;  1HNZ O;  3V7J A;  1HUO A;  9ICK A;  1YDX A;  5J0O A;  1N34 O;  9ICV A;  3THO A;  1MIW A;  4IQU A;  3RJG A;  4KLS A;  1ZWI C;  3WG7 B;  1JJ2 U;  4CZZ A;  1F51 A;  1PP9 H;  3OEE G;  1KC8 W;  3L74 H;  3FB5 C;  3JPN A;  3OVS A;  3ISD A;  8ICT A;  4RQ3 A;  4IQV A;  5IDJ A;  3FB7 C;  3A0R A;  4B3M B;  3CRA A;  4FM0 A;  7ICU A;  1IXB A;  1X59 A;  4KHP B;  1K4C C;  4UB8 Z;  4OX9 B;  9ICI A;  2IJK A;  4GKJ O;  4OAF A;  2VQE O;  4JYC A;  4F5N A;  3AG3 C;  3J7A U;  2DWE C;  3OW2 U;  2ADQ B;  2JGU A;  4FO6 A;  3CRR A;  2FYU H;  1ZQR A;  2M2U A;  3CCS V;  2ZT9 B;  3N2G A;  2KG7 B;  1JVM A;  2FMQ A;  5IYZ A;  2Q6A A;  1M4U A;  3QF7 A;  5L3F A;  4IYH A;  1Q5O A;  4X20 B;  2D3O W;  1MSW D;  2UXD B;  1R8A A;  2AZ0 A;  1ZTE A;  3OEH G;  2ZH8 A;  2K9P A;  1S5J A;  4N21 A;  3UXO A;  1VQL V;  5J2I A;  3K04 A;  4X1Y A;  4UAZ A;  1S5H C;  4DV3 O;  3N27 A;  4HNA B;  5JJN B;  8ICA A;  2YS8 A;  4FHV A;  1MIY A;  2B51 A;  4RQ2 A;  9ICC A;  4RQ4 A;  1ARO P;  2P6J A;  5CWR A;  3ASN B;  5JQG B;  5EC2 C;  4DYL A;  4P4P A;  2IJJ A;  1IXM A;  1QBZ A;  2X6C A;  4JYB A;  1P49 A;  2EIJ B;  3H1J H;  4WC3 A;  4X89 A;  5LMN B;  1BPX A;  5HRE A;  4XBF A;  2PYJ A;  1TVA A;  5TIS Z;  3ZHQ A;  8ICW A;  4MT8 A;  2Q66 A;  3J81 N;  5BOM A;  4UB3 A;  4F6R A;  4RQ5 A;  2F93 B;  2EIN B;  1YCI A;  4FLW A;  5BR8 O;  3IC7 A;  4PJ0 Z;  2OIG A;  1XMQ O;  5JCO C;  5E1A C;  4X4R A;  5J0Y A;  1XNQ O;  4KP4 A;  4MW3 A;  3EXA A;  1D5N A;  4I4T A;  4GKK B;  1Q6I A;  3E86 A;  5DBB A;  4NTX A;  1HNX O;  1KP3 A;  1Q82 W;  9ICL A;  3ER8 C;  4QIW F;  4AQY O;  5DB9 A;  1HR0 B;  3ABL C;  1GTO A;  4FH5 A;  1XOU A;  3SJC C;  3LSQ A;  1GM9 A;  2CTR A;  3CC4 V;  4DW1 A;  2QA4 V;  7ICM A;  1RP3 B;  2DWD C;  5LXT B;  3SJB C;  4ZOL A;  4LBE C;  4K8V A;  7ICR A;  1BL8 A;  2BOC C;  5GON A;  1Q6H A;  1S5L Z;  1PPJ H;  3IGA C;  1JMS A;  4WC1 A;  1XI1 A;  4RPX A;  3HJ4 A;  3HPL C;  5IIN A;  3JSN A;  4YD2 A;  1JCH A;  2WLJ A;  4K99 A;  1R6N A;  4YIO A;  2Y48 A;  2UUA O;  4QZ9 A;  3PN1 A;  2BPG A;  2HLD G;  2KSD A;  5HRD A;  4S3N A;  1IBL O;  1R1B A;  3TCU A;  4TUQ A;  4PDV A;  3RH6 A;  4M5D A;  1SF9 A;  1M57 B;  3U0Z A;  1I0H A;  4P30 A;  3B2E E;  1GKF A;  3ZIA G;  2KG7 A;  5DBA A;  3B4S A;  4OAI Z;  2Q7H A;  2CH7 B;  4FJC C;  4PDL A;  4B3R O;  2EIK C;  1OCZ C;  4AHC A;  4X8A A;  4JAA A;  4HNA A;  4NXN O;  3I5D A;  3EF2 A;  2ZD9 A;  1VJ7 A;  4I0X A;  3W7W A;  4IQT A;  4NXW A;  2A0L A;  2Q69 A;  3ETD A;  3JPR A;  2CUG A;  2QR4 A;  1DLB A;  8ICJ A;  1CEZ A;  5A9G A;  5DBC A;  1J5E B;  5B1B C;  3AEI A;  1IBK B;  3UO3 A;  1O9G A;  2LGW A;  7ICK A;  4MVO A;  2YSU B;  2QTS A;  4TQF A;  2NNU A;  4HZ3 A;  4PD4 F;  5FPO A;  5LP6 C;  1BE3 H;  1WPX A;  2BCC H;  3ML0 A;  4QZE A;  1I5Y A;  2Q8V A;  4DV7 B;  1N0J A;  4NB5 A;  8ICV A;  4JI6 O;  2EIM C;  3X2Q B;  7ICS A;  5BMV B;  5DB8 A;  1GM7 A;  5CA0 B;  4XDK A;  4JAV A;  4RWU A;  1I5X A;  1N33 B;  1AI5 A;  1XSN A;  4EB6 A;  1MZE A;  1IX9 A;  4KL1 A;  2VRZ A;  4R8C A;  4KLQ A;  3AG3 B;  2YXH A;  3K9S A;  1RM1 B;  1DTO A;  1SC5 B;  2ZIO A;  3CPW U;  2RN9 A;  2FB5 A;  2PI4 A;  3FYI B;  1R6T A;  3DXR B;  2UXC O;  2I9G A;  2R9R B;  2YXY A;  4DR3 O;  4XRH A;  4M9L A;  2W6J G;  1PV0 A;  3MDA A;  1RPL A;  4QZ8 A;  8ICU A;  4RUE A;  1QNM A;  4DO2 A;  3JAT B;  1BPE A;  2DN9 A;  1L1F A;  5EK0 A;  3KCY A;  2QM7 A;  4WBN B;  2DR9 A;  2EBO A;  4UB5 A;  1WP7 A;  2UUC O;  2CTP A;  3P3N A;  4X62 O;  5CFS A;  4NLZ A;  5J0R A;  1I7F A;  1KYO F;  3UQ0 A;  4NKU A;  3OWG A;  3SPH A;  4LF4 O;  2RNB A;  5LMU O;  3RJE A;  5K1X A;  4EV6 A;  2ITD C;  4F5O A;  3MD0 A;  2JEX A;  2OCC C;  2OYQ A;  1BZK A;  4EFE A;  4O2B B;  1HDJ A;  7ICQ A;  2N05 A;  4DR2 B;  4PV1 B;  1BPD A;  4K4H A;  1SET A;  1THZ A;  3G67 A;  1AP6 A;  2P22 C;  2ZNI A;  2XAJ A;  2B9Z A;  2BCU A;  2Q5Z A;  1GH6 A;  5KUK A;  4RQ0 A;  3UKM A;  2YEV B;  4BR6 A;  8ICI A;  8ICQ A;  3RYF B;  3P3P A;  4FZ1 A;  3RJJ A;  2Q7E A;  8ICS A;  1SQV H;  3QO5 A;  4JLX A;  4X4Q A;  1GN6 A;  4X65 B;  4DV4 B;  4N23 A;  1ZX3 A;  4PA4 A;  1ZJM A;  3SYO A;  3ABK C; 
#chains in the Genus database with same CATH homology
 1XSP A;  1ZQJ A;  2ISP A;  4KLT A;  3HIY A;  4F5R A;  3B0X A;  4X0B A;  1ZQT A;  4PGX A;  4I2I A;  5J2G A;  1ZQU A;  4AT9 B;  4I2H A;  1ZQD A;  3AQL A;  9ICT A;  2DR7 A;  4MF8 A;  3OUY A;  3OVB A;  4AT7 B;  9ICA A;  5IIM A;  8ICL A;  4UBB A;  4NXZ A;  4PH5 A;  4NY8 A;  3WFS C;  2ZH3 A;  4RWO A;  2M2T A;  8ICY A;  5CP2 A;  3MDC A;  4I29 A;  4FHY A;  2BPC A;  5HRL A;  1ZQB A;  4RQ1 A;  8ICR A;  1FA0 A;  9ICN A;  7ICG A;  4R63 A;  7ICV A;  4I2B A;  5HHH A;  3AUO A;  2BCS A;  2FMS A;  4I2C A;  9ICR A;  4X0A A;  1NOM A;  3C2L A;  4UBC A;  2IHM A;  3WFQ E;  4X4N A;  4RWQ A;  1ZQH A;  1R8B A;  4Z6C A;  4KLE A;  4QZG A;  7ICO A;  4I2J A;  4WC5 A;  1TFY A;  4M9N A;  2O5A A;  1BPY A;  2ZH9 A;  3WFO A;  1WOT A;  1Q78 A;  8ICO A;  5HRG A;  4WC6 A;  4FHP A;  1MQ2 A;  5J2H A;  3UQ2 A;  1OU5 A;  4YD1 A;  2ZH7 A;  4ATB A;  5HRH A;  9ICF A;  4NKT A;  2ZHA A;  3RJK A;  3MGI A;  3RJF A;  1ZQL A;  3UXP A;  5HC9 A;  4MFC A;  1JQR A;  2GWS A;  4KLJ A;  7ICH A;  4WCW A;  4FHW A;  5J2C A;  2ZH6 A;  2NRK A;  4X5V A;  5J29 A;  4M47 A;  4UB1 A;  3RH5 A;  5DKW A;  3H39 A;  4EP7 A;  2PBE A;  2BCR A;  1ZQI A;  4E8F A;  1ZQX A;  1PX5 A;  4ATB B;  9ICQ A;  5HRB A;  3PNC A;  4NLN A;  8ICX A;  3UPS A;  5J2K A;  3WFP A;  3JPP A;  4GXI A;  1ZQF A;  4X4O A;  4P2H A;  5J2B A;  1ZQM A;  5D4B A;  8ICG A;  5DED A;  4RWP A;  3H38 A;  4RWN A;  5CB1 A;  9ICB A;  5J0T A;  3JPT A;  1R89 A;  1ZQY A;  3C2M A;  4YMN A;  3C66 A;  4K4I A;  7ICP A;  1BPZ A;  4I2E A;  4AT9 A;  5J0X A;  4KLF A;  4LT6 A;  4XQ7 A;  3HW8 A;  1F5A A;  4I2D A;  3AU6 A;  3L9D A;  2PXI A;  9ICM A;  5J2E A;  4UAW A;  2ISO A;  3V7J A;  4WC7 A;  4DO9 A;  2DVI A;  3RJH A;  1HUO A;  9ICK A;  5J0O A;  9ICV A;  1VFG A;  1MIW A;  4IQU A;  4TUP A;  2ZH4 A;  4KLU A;  3RJG A;  4KLS A;  3ISC A;  2ID1 A;  3JZ0 A;  4PHA A;  4Z6F A;  5D46 A;  4RPZ A;  4XUS A;  2PFN A;  2PFO A;  3JPN A;  3OVS A;  3ISD A;  4JWN A;  4QZA A;  4RQ3 A;  4IQV A;  1ZJN A;  8ICT A;  2DR5 A;  7ICU A;  9ICI A;  4M0A A;  4F5N A;  3OGU A;  4P4O A;  4FO6 A;  1ZQR A;  2M2U A;  2FMQ A;  5IIO A;  9ICJ A;  4RQ6 A;  5J2F A;  1R8A A;  1Q79 A;  4PPX A;  5DEC A;  2O1P A;  2ZH8 A;  3UXO A;  9ICH A;  5J2I A;  4UAZ A;  2VAN A;  2FMP A;  2PFP A;  8ICA A;  4UB2 A;  3B0Y A;  5DB7 A;  2RFF A;  4FHV A;  2M2V A;  1MIY A;  4RQ2 A;  1TFW A;  9ICC A;  4RQ4 A;  3LQC B;  3AQM A;  5J2J A;  5CA7 A;  1ZQP A;  5HRK A;  5CWR A;  3V7K A;  4P4P A;  3AU2 A;  2ZH1 A;  4TUS A;  2ZH5 A;  4M9J A;  5D49 A;  4AT8 A;  8ICN A;  3JPS A;  4WC3 A;  1BPX A;  5CHG A;  4O5C A;  5HRE A;  8ICM A;  4LZD A;  1TVA A;  7ICE A;  2P66 A;  3MGH A;  1KNY A;  8ICW A;  4WC4 A;  2Q66 A;  5BOM A;  1UET A;  4UB3 A;  3PML A;  4KLO A;  1RZT A;  9ICG A;  4RQ5 A;  4UD5 A;  4FHX A;  5J0W A;  4PGQ A;  7ICI A;  4X4R A;  5J0Y A;  4JWM A;  3V7L A;  3HX0 A;  3RJI A;  1ZQG A;  4AT8 B;  5DB6 A;  4O9M A;  5DBB A;  3TFS A;  4RT3 A;  9ICL A;  2BCQ A;  4F5Q A;  3K75 D;  4X4U A;  5DB9 A;  4O5K A;  8ICF A;  4FH5 A;  4RQ8 A;  5J2D A;  4XA5 A;  4MFF A;  5DDM A;  3WFR E;  7ICM A;  4R64 A;  4LVS A;  8ICK A;  2M2W A;  7ICR A;  3OV7 A;  5IIK A;  4R66 A;  1V4A A;  5IIJ A;  3TFR A;  4KLM A;  1JMS A;  4YCX A;  5EOZ A;  5CJ7 A;  4WC1 A;  5DDY A;  4RPX A;  2BPF A;  3HJ4 A;  1ZQS A;  4UD4 A;  4NM2 A;  4RQ7 A;  3AQN A;  3UPQ A;  4YD2 A;  5IIN A;  4NM1 A;  7ICL A;  9ICE A;  4R65 A;  4KLL A;  3JYY A;  4XQ8 A;  4M2Y A;  4PHP A;  3C2K A;  4UB4 A;  4QZ9 A;  5HRF A;  5J2A A;  2BPG A;  3PMN A;  5HRD A;  4S3N A;  2ZHB A;  4YMO A;  4TUQ A;  3RH6 A;  4KLD A;  4M5D A;  4MFA A;  4GXK A;  4FH3 A;  9ICU A;  1NO5 A;  4PHD A;  7ICJ A;  2BCV A;  3H37 A;  4M9G A;  3ISB A;  4E80 A;  5DBA A;  1ZQZ A;  4E7X A;  4QZF A;  3H3A A;  5BOL A;  1KEJ A;  1ZQA A;  2BE3 A;  4X4S A;  4O5E A;  8ICH A;  1VJ7 A;  2DR8 A;  4F5P A;  4IQT A;  2DRA A;  4MF2 A;  3JPR A;  4WBZ A;  8ICJ A;  3MBY A;  5HR9 A;  4PGY A;  7ICT A;  4M9H A;  9ICX A;  4IQW A;  1ZQK A;  5DBC A;  7ICF A;  4WC0 A;  5TZV A;  3HWT A;  1ZQC A;  4I27 A;  4RPY A;  4X4T A;  4Z6D A;  3OUY B;  3JPO A;  4GXJ A;  4I2G A;  7ICK A;  4QZI A;  3GDX A;  4YN4 A;  4QZH A;  8ICC A;  1MIV A;  4P4M A;  9ICS A;  4QZE A;  5J0Q A;  3C18 A;  4PHE A;  1KDH A;  2PFQ A;  4K4G A;  4DOB A;  1ZQO A;  1YLQ A;  4QZD A;  8ICV A;  7ICS A;  5DB8 A;  4X4P A;  1R8C A;  4RT2 A;  1XSN A;  5IIL A;  2ZH2 A;  4QZB A;  2DRB A;  4KLQ A;  3RH4 A;  2I9G A;  8ICZ A;  4XRH A;  1BPB A;  4IG8 A;  4EBK A;  4M9L A;  3MDA A;  1RPL A;  4QZ8 A;  8ICU A;  4KLI A;  4UAY A;  5J0U A;  3AQK A;  1TV9 A;  4M04 A;  4KLG A;  1BPE A;  4NLK A;  4Z6E A;  5J0P A;  3C5F A;  2DR9 A;  4WBY A;  4UB5 A;  4QZC A;  3NYB A;  5HRI A;  3OVA A;  1ZQN A;  5F2V O;  1ZQV A;  1XSL A;  4NLZ A;  5J0R A;  9ICW A;  5J0S A;  9ICO A;  3UQ0 A;  4NKU A;  1JAJ A;  4I2A A;  1JN3 A;  4DOC A;  1UEU A;  3HJ1 A;  3RJE A;  3V72 A;  8ICP A;  3JPQ A;  1MQ3 A;  2HHP A;  4F5O A;  4KLH A;  4WC2 A;  9ICP A;  4I28 A;  7ICQ A;  4I2F A;  1BPD A;  4K4H A;  5HHI A;  3C5G A;  5III A;  4EBJ A;  4DOA A;  2BCU A;  4RQ0 A;  2W9M A;  1UEV A;  5BPC A;  3UXN A;  4X4V A;  8ICI A;  8ICQ A;  1ZQQ A;  3RJJ A;  1ZQE A;  3LK9 A;  8ICB A;  1ZQW A;  5CR0 A;  8ICS A;  4X4Q A;  4LZG A;  4AT7 A;  1HUZ A;  4TUR A;  8ICE A;  1ZJM A;  4YMM A;  7ICN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...