3L9DA

The crystal structure of smu.1046c from streptococcus mutans ua159
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
199
structure length
198
Chain Sequence
MNWEEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINNKPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative GTP pyrophosphokinase
publication title The Crystal Structure of smu.1046c from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
total genus 69
structure length 198
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 3l9dA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3l9dA01
4FHYA 4YN4A 3MBYA 4KLGA 8ICPA 4PHPA 4UB2A 4I2GA 1RZTA 1Q79A 1TFYA 9ICJA 1ZQKA 4K4GA 4X4RA 1ZQFA 4AT9B 2DR7A 3UQ2A 1UETA 2ZH2A 7ICNA 4YMNA 1ZQIA 4MFAA 2ZH8A 2FMSA 4P4OA 1XSNA 9ICBA 7ICEA 1UEUA 1KNYA 2FMQA 7ICOA 4PGQA 1Q78A 3HJ1A 4DO9A 9ICEA 8ICTA 8ICOA 4QZCA 5J2DA 2BPGA 1R8CA 4F5QA 5DKWA 2BPFA 4F5PA 4UAWA 3RJFA 9ICWA 1ZQHA 3WFRE 5J0TA 4E80A 5J2IA 4NKTA 4M2YA 4FHXA 5CJ7A 5J0SA 9ICVA 3PMNA 4P2HA 3OVSA 5J0PA 4M5DA 5HRBA 3HWTA 9ICCA 5DDMA 4RT2A 4YCXA 9ICAA 4WC0A 1ZQQA 4R66A 9ICIA 1ZQDA 3RJJA 4X4TA 4IG8A 1FA0A 4NY8A 4QZ9A 4S3NA 1ZQGA 9ICGA 4UB5A 5J0UA 2PFPA 4M9GA 4NKUA 5J2BA 7ICIA 4R64A 4UAZA 1TFWA 4I29A 1MIYA 4FHVA 4AT7A 1BPBA 5J0YA 4IQTA 4E8FA 4ATBA 4UB3A 5D4BA 5DB8A 3H38A 2ZHAA 2ZHBA 8ICVA 4UD4A 5HHHA 5F2VO 5DB9A 8ICZA 3RH4A 2M2UA 4AT7B 4WC3A 4RWQA 4O5KA 5HRHA 3MGIA 5DBAA 2DRAA 4XRHA 5J2JA 5IIOA 1ZQZA 1ZQUA 2VANA 7ICJA 3MDAA 4QZGA 3JPSA 8ICWA 1ZQXA 4NM1A 4RQ3A 4I2FA 4RQ1A 4YMMA 4RQ7A 2PXIA 2W9MA 3MGHA 3ISDA 9ICUA 5HRIA 4UB1A 3C5GA 1JN3A 3C18A 1ZQCA 4IQUA 9ICSA 4PPXA 4YMOA 5DDYA 4RWPA 5IIMA 5EOZA 3V7LA 4E7XA 1ZJMA 2DRBA 2IHMA 4GXIA 4QZBA 3C5FA 5J29A 4Z6CA 8ICMA 3WFOA 1TVAA 5IIIA 3JPNA 8ICQA 3H3AA 4FHWA 4RPZA 3C2LA 2ZH7A 5BOMA 2DR9A 5J2GA 5HRKA 1F5AA 1ZQLA 4UAYA 1UEVA 2DR5A 3RJGA 4X0AA 4DOCA 2ID1A 3JPTA 4KLFA 3TFSA 5HHIA 4PHEA 4MF2A 3OVBA 2BCQA 4XQ8A 2O1PA 3ISBA 2DR8A 1XSLA 3C2MA 3HW8A 4NLZA 2ZH6A 8ICFA 1ZQAA 4X4QA 4RT3A 4NM2A 5CA7A 4KLDA 7ICGA 7ICMA 1OU5A 8ICCA 4M9HA 3C66A 5J2CA 4Z6FA 4QZIA 1BPYA 3AQMA 4UBBA 4P4PA 3AQLA 4I2BA 3K75D 3H39A 4UBCA 4NXZA 4WCWA 8ICBA 2BE3A 5HRLA 4FH3A 4TUQA 3RH5A 8ICJA 4WC4A 4F5NA 1BPDA 4I2DA 4FO6A 1MQ3A 1MIVA 4MF8A 4X0BA 1ZQSA 4X4SA 2ISOA 4WBYA 3HJ4A 3HX0A 3OUYA 8ICAA 5J0QA 3JPOA 4LVSA 4QZHA 4KLSA 7ICTA 1V4AA 2BCRA 1ZJNA 4FHPA 5HRGA 5HC9A 4X4NA 1ZQBA 1TV9A 1HUZA 4QZEA 4KLHA 5IIKA 2BCUA 8ICKA 4ATBB 5J2AA 3UXPA 9ICPA 4I2HA 4KLTA 5IIJA 5HREA 1R8AA 8ICIA 3RJHA 4M04A 1HUOA 3RJEA 5HR9A 4TUPA 2GWSA 4UB4A 4R63A 2RFFA 3JPRA 8ICGA 4RQ5A 4K4IA 4O5EA 3UXNA 7ICPA 5D46A 4AT8A 4WC1A 4JWNA 4M0AA 4LZGA 4M9JA 8ICUA 2M2TA 4UD5A 1BPXA 4QZDA 2ISPA 3RJIA 2Q66A 1VJ7A 4PHDA 3LK9A 4KLOA 4XA5A 4PGXA 7ICVA 5DB7A 3JPQA 4NLNA 3AQNA 2BPCA 1KDHA 2HHPA 4F5RA 1ZQOA 4AT8B 4NLKA 4P4MA 8ICNA 5CB1A 4M47A 1BPEA 2PFQA 7ICSA 3H37A 1R8BA 4LT6A 7ICRA 4O9MA 8ICEA 3JYYA 3TFRA 4X4OA 4AT9A 3JZ0A 4RWNA 5TZVA 3LQCB 4RPYA 7ICFA 4QZ8A 5CHGA 1R89A 5J0RA 4DOAA 5CR0A 2ZH4A 1WOTA 4X4UA 9ICXA 3C2KA 4M9LA 4RQ6A 1ZQVA 3WFQE 3B0YA 9ICHA 4I2AA 4I2JA 9ICMA 2P66A 5J0XA 3UQ0A 7ICKA 5DB6A 4KLEA 4R65A 3ISCA 2ZH9A 5DEDA 1ZQNA 1PX5A 3B0XA 3OGUA 4WC2A 4X4VA 5BPCA 3PNCA 9ICNA 4XQ7A 3V7JA 5DBCA 4XUSA 4O5CA 1JAJA 1NO5A 4GXJA 1BPZA 1ZQEA 8ICXA 4X5VA 4EBKA 7ICQA 1ZQJA 8ICHA 5CP2A 4RQ0A 3AU6A 4MFCA 1JMSA 8ICRA 5J2HA 3PMLA 4MFFA 4PGYA 2FMPA 7ICHA 4I27A 4I2EA 4WC6A 3OVAA 2ZH3A 2O5AA 7ICLA 2I9GA 8ICYA 3UPQA 5DBBA 1ZQMA 2BCVA 2PBEA 2ZH1A 4LZDA 1MQ2A 5IINA 2PFNA 3V7KA 4KLLA 3UPSA 7ICUA 4M9NA 9ICRA 4F5OA 3AQKA 5CWRA 4RQ2A 1VFGA 5J2FA 4RQ4A 3MDCA 4IQWA 8ICSA 4KLQA 5J2EA 4I28A 4K4HA 2BCSA 3AUOA 4GXKA 1ZQTA 1YLQA 1ZQWA 5J0OA 3OUYB 1JQRA 4EBJA 4PH5A 1MIWA 4KLIA 5DECA 4QZAA 2DVIA 4EP7A 3NYBA 9ICOA 4KLUA 4Z6EA 3OV7A 3UXOA 2ZH5A 4I2CA 4KLJA 4Z6DA 5J0WA 8ICLA 9ICTA 3WFPA 3RH6A 3L9DA 4PHAA 4WBZA 4IQVA 5J2KA 5IILA 4YD1A 3V72A 4X4PA 4WC5A 4RPXA 5HRDA 4FH5A 9ICLA 4I2IA 1ZQYA 4YD2A 3WFSC 2M2VA 1RPLA 9ICKA 4WC7A 4JWMA 2NRKA 4TURA 1KEJA 9ICQA 4TUSA 4QZFA 5D49A 3JPPA 3AU2A 1ZQRA 3RJKA 2M2WA 1XSPA 4DOBA 5HRFA 4KLMA 1ZQPA 5BOLA 1NOMA 9ICFA 3GDXA 2PFOA 4RWOA 4RQ8A 3HIYA
chains in the Genus database with same CATH superfamily
1N4CA 4J7JA 4NXXA 3R65A 3ZMZA 4IIJB 4LFAB 3OR6C 3OEEG 1ZQKA 3WG7B 2JVDA 4AT9B 4MS2A 2DR7A 4K3AA 2Y0IA 1I0HA 7ICNA 2PY5A 2ZNJA 1ZQIA 1I94B 4OPHA 4C7UA 1DGSA 5B1NA 4P4OA 5IYCO 1JFFA 5FPRA 1AI6A 3ABMB 2YIBD 1OHHG 3OEHG 1XQ8A 4PGQA 2JEXA 5L3GA 9ICEA 2IJJA 3E89A 1VQ6V 3CCSV 1KU9A 1BQ0A 1R8CA 2BPFA 4TUYA 5EC1C 3RJFA 3JCUZ 4DR3O 4O2AB 3CWBH 2Y48A 1SQFA 3ZN1A 5BZBA 4CZZA 1ZSPA 4X1IA 3BCCH 4YY3O 3JSNA 4DR3B 3RBZA 1K7DA 4MKPA 4WC0A 2UUAO 4U3JB 1Q7YW 1XNRO 2XOKG 1FXVA 4S3NA 1OCOC 4WFFA 5KHHA 4MVQA 1YHQV 1HP8A 3RYCA 1YI2V 3ER9B 1MOFA 4Z1VA 3IFXA 4NKUA 7ICIA 1TFWA 5EIBD 1AJPA 2KQXA 2HN2A 4MTXA 2ITCC 5J0YA 3C90A 1WN7A 2HKOA 2BTOA 4EV6A 3ZMUA 1FXKB 3ABLB 1WA8A 3H38A 3M7MX 4FZ1A 8ICVA 3DC6A 4O4IB 4YJ2B 1V54B 4TQDA 8ICZA 2QKSA 1UJWB 4YJ3A 1JQ0A 3JYCA 1R6NA 3CRQA 1JR9A 5CN0A 4X62O 4JYBA 3ZRWB 4I9QA 2VWJA 1VQNV 1DF4A 4YY3B 4CS4A 1WB8A 2DYRC 1NTKH 2LO1A 2WLJA 1ZQZA 3T2MA 1NI8A 2UUAB 4HNAB 3DSQA 4NM1A 4I2FA 2DW4A 1XNRB 4RQEA 4RQ1A 1G6UA 1KD1W 3EXAA 4DW1A 2PYLA 9ICUA 5HRIA 4HX0A 4J9YB 2R9IA 1IBKO 1ZQCA 2R70A 2EWRA 4EFBA 4IQUA 1PV0A 4FIPC 2WLHA 3JCZA 5IIMA 3AG1B 4K97A 3T4ZA 2IHMA 2JDIG 1SESA 2PZSA 4DXWA 4FM1A 2B56A 3ZBHA 5J29A 2A3QA 1XMOO 1M9NA 1RP3B 4FHWA 4CC6A 4RUEA 3J7AU 4ZHQB 4NTXA 1OV9A 1AVMA 5BOMA 5J2GA 4X62B 4OXSA 3ZCCA 1JOYA 4I50A 3ZHRA 1BL8A 3ETDA 1UEVA 3RJGA 3ZIAG 1YF2A 3RYIB 4CS3A 4KLFA 4MF2A 1VQ5V 2EZOA 4O69A 3G80A 4UV8A 1XSLA 3AG7A 2ZINA 2WPDG 2ZH6A 8ICFA 2CTPA 3CRAA 3SDLA 2QTSA 2V4DA 1I5XA 3SYCA 1SQGA 2DN9A 4O2BB 7ICMA 4QPKA 5EYPA 3AG3B 1IBKB 3U0ZA 3OD4A 3C66A 1WNSA 1XREA 3RYFB 1SRYA 4B7EA 4QZIA 3AG2B 4O4LA 4FLYA 5C8YB 3K5MA 3KG2A 4X1KB 3H39A 2PI5A 4DV5O 2Q7HA 5CHEA 2CTRA 3MAQA 8ICBA 1N0NA 4TUQA 3RH5A 8ICJA 4WC4A 3APQA 2P5OA 4K9AA 1BPDA 2E5LO 3CHXA 1GM9A 3PHZA 1MQ3A 3N2GA 2CTWA 2HVKC 2JIZG 4MF8A 1P84F 4X0BA 5IJ0A 4X4SA 2QKCA 2ISOA 3OGCC 4OPAA 4LCUC 2PUSA 3OUYA 1Y66A 5CMUA 3BFRA 8ICAA 1QQCA 3JPOA 1RSOA 4PA6A 3ZMVA 4J11A 2ZXWB 3JAWA 7ICTA 1BCCH 2YIDA 3OMNB 5ITZB 4QJFB 1S76D 4NXTA 4LEZA 2QM7A 1B04A 3LDCA 4X4NA 1ZQBA 1KYOF 5EBWC 2BSKB 4KLHA 3S3XA 4BIUA 4XJEA 3R66A 2CH7B 5KHGA 1ZLZA 3UM7A 3ZHTA 5J2AA 9ICPA 2LW1A 2DOSA 4K8VA 3CCVV 2IU3A 3BABA 3OGIB 3RJHA 5H6QA 1HUOA 3RJEA 4TUPA 2GWSA 4X88A 4UB4A 2F23A 2DE0X 4DV5B 2HLDG 2Q7GA 4X1YA 7ICPA 5D46A 1T5EA 2ZE6A 4O6AA 3U11A 4DR6O 1KP3A 4M9JA 2M2TA 1V55C 5K1XA 3BAAA 2Q66A 4KLOA 4WFHA 4XA5A 2EIMC 3JD4A 5KX5A 1QU7A 5DB7A 3MCRA 4NLNA 1YITV 3KCYA 2Q6AA 4DR1O 2HHPA 4TT3G 1ZQOA 4JI5B 8ICNA 2Z5UA 3APOA 7ICSA 3C3TA 2Q4PA 3K04A 3H37A 1M93A 4LF7O 4IIJA 1M5IA 8ICEA 1H2SB 1VMGA 1WB7A 4YHHO 4H0LB 4I4TA 4X4OA 1Q82W 4NYKA 4AT9A 2DQ0A 1US6A 1TVKB 1XHZA 2QKAA 2MK3A 5IDJA 4DOAA 5CR0A 5IYDO 2ZH4A 1WOTA 1ZTEA 3QO8A 4LH7A 3OM3B 4UVCA 4JI1B 2WA4A 4JI7O 3LUTB 3CSXA 4ZI7B 3K3WA 5DB6A 4OAHA 3ISCA 1P7BA 5CFTA 1SC5B 1LR1A 1Q6IA 1D5AA 3OGUA 3SJBC 4DR6B 5JVDA 4D7TA 4NB5A 4E2LA 2JEUA 1TUEB 4XQ7A 4O2AA 5DBCA 4KXRA 2P7TC 2BOBC 4Q20A 5KUMA 8ICXA 4DR1B 5D62A 3E8GA 3ASNC 5CP2A 3AU6A 3B8MA 1SZXA 1VQ7V 2L35A 2AZ2A 3D8CA 3L70H 4DV2O 4HBNA 4MFFA 4YHHB 4U3JA 4I27A 4I2EA 3ZHQA 3OVAA 3L74H 4DW0A 1S5JA 5BY1A 2N74A 2ILMA 1M56C 2CDYA 1HNWO 3H1LH 5IJ9B 3EVKA 1P49A 1MQ2A 3V7KA 3WU2Z 9ICRA 3QG5A 1ZWIC 2RQ6A 2QEXV 3MDCA 4BAYA 1FXKA 4IQWA 3BHPA 4JASA 5LP6A 4GZRB 1ZQTA 1AR5A 4O4IA 3GB7C 4CBCA 2ZDIC 4N7RA 5J0OA 4EBJA 4NTYA 3VOUA 1JJOA 1MIWA 5L3FA 3ZRWA 3E2EA 4KLIA 3ETEA 2Y69B 2EX3A 3G67A 4O4HA 9ICOA 3ZN0A 5LYJB 5CBHA 3DC5A 4KLJA 2ZD9A 3FB8C 2XAGA 1K5SA 4F4LA 2YC0A 3ZRXA 2OTLV 2RNBA 2XAFA 1VIBA 4HNAA 4EFEA 5GONB 1IBMB 5LOVA 3L9DA 2EIJB 1SS3A 4ZKIA 1SA0B 2AHYA 2CK3G 5B1OA 3NVOA 3WFSC 1HNWB 1VQPV 4DRXB 2F95B 3RGBA 2K9PA 4DV3O 1XI1A 4QZFA 4KL1A 1ZQRA 2NN4A 1AJQA 1PKXA 5BOLA 3GVMA 2FYUH 1VQ4V 2YIAA 4J80A 5J2UA 1N32O 3AG4C 2OWOA 4ZHQA 2B1GA 3FYEB 1Z5WA 4KLGA 2GUZB 4PHPA 4I2GA 1K4DC 1TAEA 3UCSC 4X4RA 4K4GA 2E74B 1L1FA 3UQ2A 3G4SV 4DV4B 4MFAA 2ZH8A 1Q81W 3CXCU 1DTOA 3HKEB 2IUBA 2WLLA 1GMGA 3D3IA 3I5DA 9ICBA 4D7SA 3NWIA 4O2BA 1K97A 1KNYA 2QM8A 2LGQA 1Q78A 4DO9A 4I9WA 8ICTA 3RYFA 3RFRA 4B3RO 3SYOA 4QZCA 4F5QA 4F5PA 3SYPA 4UAWA 4EGWA 4HAMA 5C8YA 9ICWA 4QNHB 4X1KA 3WFRE 4E80A 3N27A 1IXBA 1M57B 5J2IA 4M2YA 1N32B 3T1YO 9ICVA 2YUAA 3PMNA 3CRMA 4GX2A 1Y76B 5JH7B 5J2TB 5J0PA 5HRBA 4P2HA 3HWTA 3F5TA 9ICCA 3X2QB 4ABMA 4LF9O 3N2KA 2OYQA 4PJ0Z 1OCRC 2QSAA 1ENVA 1ZQDA 1AP5A 1OJHA 2A9HA 2BTQB 1YIJV 4IG8A 1OCZC 3T1HB 2LW7A 4JTAB 4UB5A 2EJ7A 2KG7B 5CBGA 5J2BA 4R64A 4UAZA 2PI4A 4I29A 3JD1A 4MVSA 4BW9A 1MIYA 2FKXA 1F4NA 4IQTA 2CH7A 4UCSA 2CE4A 3ZEDA 2RMKB 5B1BB 4UCVA 5KUKA 4UB3A 4UCRA 2XHBA 2ZHAA 1GRJA 3AK1A 4TSFG 2FTKA 3CC4V 2DWDC 4K9BA 4JZ2A 3A0HZ 4TQFA 3L75H 4AT7B 1S72V 1OCCC 4JI8O 2EINC 3JARB 4WC3A 2F93B 4PI2A 2P4KA 1M1KW 2N05A 1L0LH 3T1YB 5HRHA 2CGOA 3AK2A 4MVOA 4LF9B 4XRHA 5J2JA 1ZQUA 7ICJA 3BY6A 4QZGA 8ICWA 4FLZA 2EILC 4F6RA 2Q68A 4AQYB 4RQ7A 4U7OA 2W9MA 3MGHA 1OCOB 2R9RB 3JAKB 1WPBA 4UB1A 3S3WA 5EZYB 3ABUA 5B3SC 4JLZA 5DDYA 3L72H 4E7XA 1ZJMA 4TWKA 4X65O 1TVKA 2DRBA 1CP9A 4GXIA 4QZBA 1AILA 8ICMA 4Z6CA 2QJ1A 5TISZ 3WB1A 3WFOA 5IIIA 1ZL8B 2B51A 1PNMA 4TV8B 4FK5C 4DR5O 4PA7A 2F4VO 3H3AA 1K5QA 2DR9A 5HRKA 4JI8B 4ZI7A 1NR7A 1VARA 5E79Z 2VQFO 2IJKA 4X0AA 4FZ0A 3JPTA 5HHIA 1EZVH 2DYRB 1DLBA 1AI5A 1FKAO 1FXHA 1RPRA 4X64O 1SQXH 4XQ8A 3HKBB 2DR8A 4RUFA 4JV5O 2X6CA 4NLZA 4DYLA 5KMGB 3OAAG 1XMQO 4W4KA 4KLDA 7ICGA 1VP7A 3ABKC 4M9HA 3MHSC 4EB6A 4MSWC 1VF7A 4P4PA 3K03A 4B3TO 4L8JA 4X65B 4NKGB 3K75D 3FKSG 3SPJA 3JCFA 4JLXA 3SR2C 1SQPH 5IJ9A 3EHBB 3L73H 5HRLA 4JF3A 4DR5B 2F4VB 5IE9A 4I2DA 3TJTA 4FO6A 1IXMA 4TV9B 1CXZB 3BA8A 4CH4A 4X66O 2ZCEA 4FMTA 1ZQSA 4LNUB 2VQFB 1QNMA 1QLEB 5CA0B 1Z2GA 5LMNO 1J95A 3OUFA 5GTIZ 4LVSA 1PPJH 4X64B 4D6TH 3M99B 4J9ZB 4JV5B 4O4JB 1FFXB 1W0JG 5LYJA 1VF5B 1FPOA 1XMQB 1HUZA 2A06H 4QZEA 5IIKA 4XDLA 4FJCC 3UQ8A 1HW7A 3UXPA 4NXNO 2LFSA 4I2HA 2OTJV 3IJ4A 5IIJA 1GN4A 3LSSA 4B3TB 1SA0A 4M04A 3DGEA 1TA8A 1QVFU 1IURA 1R73A 3WG7C 2YDEA 2DQ3A 2Y4TA 4J7KA 2YEVB 4DRXA 4O5EA 3O65A 1THZA 4JWNA 1H8HG 4IHJB 1XDCA 3KZIZ 8ICUA 4UD5A 2ZIMA 3A0RA 1SQVH 1BPXA 4QZDA 4PHDA 1S5HC 5J9PC 4X66B 3LK9A 1JVMA 1KKCA 4LP8A 3BA9A 3NXSA 5LMNB 4F5RA 2P67A 4AT8B 2FCLA 2PFQA 5H2FZ 1P7GA 2GUZA 1GK9A 1AP6A 5FL7G 4LT6A 2GTSA 7ICRA 4A5UB 3ER8C 3FAVB 5CBFA 2Q5ZA 1QVGU 3E22A 2AZ0A 5IWAO 5CFSA 3TXSA 5D5QA 4NXWA 5TZVA 3A8TA 4NXNB 2X0LA 5AG2A 1ZX3A 5KHKA 4YXWG 4X4UA 3HKEA 4WFEA 3K58A 4RQ6A 1U96A 3WFQE 2XUMA 9ICHA 4I55B 4I2JA 9ICMA 4LBEC 3ZX6A 1EN5A 3UT5B 7ICKA 1XILA 3H1JH 3P3NA 4PV1B 3UO2A 4R65A 4KLEA 1ZQNA 4JYCA 2Q0OC 1KB9F 2LJ2A 4JAAA 3GWOA 1N33O 4K8XA 3HKCB 5EBLC 5DN6G 5LGNA 4WC2A 1GM7A 4X4VA 4J42A 3CCMV 5BPCA 1AB3A 4CS2A 1V55B 4GKKO 5IYZB 1FXKC 4YIPA 4B08A 2EIMB 5H6RA 1BPZA 1ZQEA 5LP6C 4X5VA 2GHYA 4B7KA 5JH7A 1Y76A 5J2TA 4PHZA 1L0NH 5KAFZ 1EN6A 1NVPD 3UKMA 1N36O 1QBZA 2A79B 4FLXA 5B3PA 8ICRA 5J2HA 3EF2A 3G6BA 1Q5OA 2HFEC 2KSDA 2FMPA 7ICHA 2ETNA 2BTQA 4CH5A 2ZH3A 5IWAB 7ICLA 1I5YA 4X20B 3RVZA 4NTWA 3A0BZ 5JWPA 2UXCO 2ADPA 2KG7A 1X59A 4GCZA 3VQYA 4JI5O 4M9NA 2DYSB 4F5OA 5CWRA 2D3OW 4IGGA 1Q86W 1VFGA 1VQMV 1K34A 2RJZA 5LA6B 3K9AA 2XAQA 3HPLC 1YLQA 1EZJA 1N33B 1B06A 1G8MA 1ZQWA 3TXQA 2LFRA 4GYCB 4PH5A 4FFBA 3B8NA 3JALA 4GKKB 4GX1A 1YVWA 3JARA 5DECA 4QZAA 3IAYA 5HFLA 4Z6EA 1BT8A 2CTQA 3IGAC 3UXOA 2Q67A 4I2CA 4JI1O 4LFBO 4PD4F 5LXTB 3ASNB 1PL0A 1MZFA 2ZIOA 1N36B 1JX9A 4WQKA 5IY5C 2EJRA 4WBZA 1Z5VA 4YD1A 3V72A 4JGSA 1VQKV 2ZR2A 4WC5A 4TOIA 3EFFK 3K5LA 3JAKA 3T4DA 2UXCB 3DXRB 5HRDA 4YD2A 1M56B 3CK6A 4LFCO 5EZYA 2XT9A 4WC7A 3RW0A 2EIKC 3CCJV 4R6ZA 1KEJA 9ICQA 4TUSA 4FPPA 3B77A 3OFNG 4XDKA 3RJKA 1BHAA 2M2WA 4UXNA 1VQ9V 5HRFA 2HEPA 1XHXA 1ZQPA 2Y4UA 3E83A 3B40A 3CXHF 1ZL8A 4DV6O 2UXBO 4FM0A 4P9PA 4TV8A 4DUZO 3GDXA 4U7NA 3K9SA 4RQ8A 2L6LA 3HIYA 4Z1MG 3AEIA 4FHYA 1GPJA 4YN4A 4HYOA 8ICPA 4UB2A 2WWWA 1N8RW 3ASOC 1HR0O 3K79A 4WFGA 4ZIBA 5BR8O 4LFBB 1ZQFA 2CUGA 1JCHA 2HHHO 2ZH2A 4NXUA 1JA8A 3HKBA 2AW9A 2A7WA 1H38A 4LEVA 1VEWA 3CEIA 1VQLV 2HR3A 3K5OA 1XSNA 4JZGA 2JS3A 1ZAUA 2ZQMA 3D36A 1UEUA 2P22C 1NKDA 5A2QN 3HJ1A 1CPYA 5KA5A 4LFCB 1YDXA 4WF9V 8ICOA 5FNVB 2V7QG 3CX5F 5J2DA 2BPGA 2E75B 5DKWA 2OIGA 2QDOA 2YSUB 2Q69A 1JFFB 2PYJA 4CC5A 1NTMH 1SQBH 2QTOA 4BIOA 1IBMO 1H2LA 4B3MO 1H8EG 4DV6B 2UXBB 3JASB 4DUZB 4NKTA 3AK3A 1ROPA 3KKYA 4FHXA 5CJ7A 3AG4B 4K98A 2YS8A 4M5DA 4DK1A 5DDMA 4RT2A 3LNNA 4TV9A 4NR1A 4YCXA 5D61A 9ICAA 4JAUA 2QGNA 4ASUG 4LNUA 3BPZA 1HR0B 5CA0A 2WLIB 3RJJA 4X4TA 4GUNA 5BR8B 1FA0A 1MSDA 1RM1C 4QZ9A 1ZQGA 1SETA 4P30A 2HHHB 9ICGA 1K8AW 3ETGA 1B3QA 1GN3A 4YJ2A 4O4JA 4EEBA 1FFXA 3CJHB 4XBFA 1NU1H 4FHVA 1BPBA 1H2NA 1YTFD 3QO5A 4LF5O 2GSMB 4H44B 5D4BA 2QWOB 5DB8A 2ZHBA 4IYIA 5HHHA 4PDMA 5F2VO 1D5NA 2JJ2G 4MW8A 2BOCC 5DB9A 4JAVA 1YZBA 3RH4A 2M2UA 3LSQA 3K0DA 3OT7A 4KFMA 4DV4O 2M7WA 2H8PC 1KC8W 2YEVA 4B3MB 2YI9A 1QLNA 2ITDC 5LL6Y 4PI0A 2JK5C 2CGNA 3NR7A 4IHJA 3MGIA 2DRAA 5FLXN 5IIOA 5LGTA 3FB5C 2VANA 4Z2WA 5JJEB 2WLKA 3W7TA 4DK0A 2ODMA 5IT9N 4YMMA 2EBOA 1DF5A 2MW2B 2UXDO 1OCZB 3VQXA 3ISDA 3F7YC 2ZM6B 3C5GA 1JN3A 1O9HA 5BMVB 4RWUA 3TK1A 3F7VC 1URFA 4JI2O 4XDJA 3FAVA 4WH5A 4RWPA 5L3CA 1XNQO 3V7LA 4QE9A 5CB4B 2JRIA 4LF5B 4OX9B 1HNXO 2JGUA 3ETQA 5JJNB 4JI0O 3JPNA 3RYIA 8ICQA 3TGUH 3FB6C 3T1HO 4I55A 3C2LA 1IZ3A 3UT5A 3OUSA 1F5AA 1ZQLA 2YICA 2EINB 1IX9A 2A0LA 2BBHA 2YI8A 5LHIA 4FM2A 4DOCA 2ZR3A 1DK1A 1PL4A 1YCIA 3VQWA 1GN6A 2QWQB 3TFSA 2HG5C 2O1PA 4PA9A 1HNZO 3ISBA 3FD9A 1PNKA 3STZC 5IYBO 3C2MA 3HW8A 1A32A 4NVPA 4PA3A 3ZHVA 2LP7A 2UXDB 4I0XB 4RT3A 4NM2A 8ICCA 1W59A 2K1EA 2IJIA 1S0VA 1TGOA 4Z6FA 1BPYA 4JI2B 5B3SB 1XNQB 3JD2A 3QNEA 1KQSU 2E3CA 4X20A 1H2GA 1HNXB 2E76B 2Z0AA 2UU9O 3JD0A 4UBCA 4JI0B 1MMMA 5EYPB 2YXHA 2BE3A 4AQYO 5BXZA 2IH3C 4F5NA 3CC2V 2VRZA 4JTCB 5LA6A 2C2AA 5ITZA 1MABG 2BSKA 3HJ4A 5JQGB 1AR4A 4N23A 3SPIA 3HX0A 2WLMA 1E1RG 1R3LC 2QR4A 2OIEA 4ZOLB 3LDEA 1PP9H 1FFTB 5LBQA 4BIZA 1NVPB 1HNZB 3CD6V 4JYAO 4QZHA 1V4AA 1VF6A 4UB8Z 5EK0A 5JCOA 3CCLV 1TV9A 2Z3YA 5LXTA 3G71V 1XUQA 5FPOA 2WA3A 4LH6A 1N0JA 8ICKA 4ATBB 3ABKB 1Q6UA 2QWRB 2VQEO 1GN2A 1N34O 2IW5A 3SJAC 1AI7A 4OGQB 4R63A 2UU9B 2RFFA 1R3IC 8ICGA 1TUBB 2NLJC 1P4RA 1KKDA 3B09A 4X89A 3UXNA 4AHCA 2JGDB 4M0AA 4KP4A 4LZGA 1YJ9V 1COWG 2UUBO 4WQLA 1VJ7A 3W7UA 5B66Z 1UFIA 3ZJZA 3LDDA 3K08A 4W4LA 1AROP 3IC9A 2F1MA 4OAFA 3K06A 2B9ZA 3ZMTA 2BPCA 4H33A 3PJSK 4NLKA 4P4MA 5CB1A 4M47A 1BPEA 4JYAB 3E8BA 2ZT9B 2HVJC 3P32A 1BGYH 4ICGA 1M4UA 3JYYA 3MDSA 1FAFA 1KECA 1X4TA 2Q73A 3JZ0A 3CCEV 5L3EA 3X2QC 5CHGA 2W6IG 5H9CA 2VQEB 3C2KA 1N34B 3B0YA 3CS5A 4I4TB 3UQ0A 2P66A 2OCCC 3SPCA 2ZNIA 3T1CA 2ZH9A 5FNVA 5D5PA 1XL4A 2WSSG 3B0XA 3RT3C 1J5EB 2UUBB 9ICNA 3V7JA 2DWEC 4FLVA 4NXVA 2NNUA 5B1BC 4XUSA 2R9AA 1QR9A 1WAZA 3PN1A 1JAJA 3JASA 1NO5A 3CC7V 5B3QA 4GXJA 2ADQB 3BVOA 2YIBA 4K99A 4EBKA 4K96A 7ICQA 3CMAV 3VQVA 1ZQJA 1BQZA 8ICHA 2QA4V 1YJNV 4MVMA 4KM5A 5JVDB 4MFCA 4PDLA 3CE2A 3PMLA 3CMEV 2WLIA 2ZE8A 2GV9A 3JD3A 3VBBA 4JI4O 8ICYA 3UPQA 5DBBA 4DV7O 1ZQMA 2X6AA 3SYQA 5K1PA 2BCVA 2PBEA 2ZH1A 3CJHA 1EBOA 2PFNA 4KLLA 2PF4E 2IJHA 4G27B 4RQ4A 4EEQA 4OAGA 2ARHA 5J2EA 3SGIA 2BCSA 3AUOA 5B1AC 1YXBA 3CRCA 3CPWU 3H1HH 2GA9D 2CAZC 3JATB 4QIWF 1JQRA 3W7XA 1XBLA 5GONA 1F4MA 2JS5A 4JYYA 4Q6GA 1EN4A 1PNLA 3TETA 3RYHB 5CA3A 1BS3A 2P90A 4EP7A 3NYBA 2W6JG 4KLUA 2XNDG 3THOA 4B3SO 5LP6B 4DR2O 3OV7A 3C3SA 2ZH5A 4JI3O 1KMIZ 1F51A 2B5UA 5H5NA 1ORQC 1NR1A 3RH6A 2B1IA 4LC1A 4PHAA 4IQVA 5J2KA 3QO7A 1FYJA 4U3FH 1Y67A 3ABMC 2XAHA 4O4HB 4J10A 4JI4B 1E1QG 4IT5A 1YTFB 9ICLA 4DV7B 3ZMSA 1ZQYA 5KA6A 2M2VA 1RPLA 5BMVA 2NRKA 3ZHUA 3CYOA 4TURA 5LOVB 4R8CA 3AU2A 5CB4A 2YXLA 4QPJA 1CEZA 3D36C 4KLMA 1BHBA 4CH3A 3LNMB 4BR6A 4WCEV 9ICFA 4RO2A 2PFOA 4I7ZB 4RWOA 4MW3A 3Q4HB 3G6EV 4UB6Z 1KBHA 3MBYA 4LWSB 3H01A 1JPXA 1LUWA 1RZTA 1Q79A 1TFYA 4B3SB 1GH6A 4DR2B 9ICJA 3E35A 1F23A 1D2DA 1K3EA 4PA4A 4JI3B 5J2UB 1Y6XA 1UETA 2AXTZ 4YMNA 2FMSA 5CA1B 5IY5B 4MTOA 4MT8A 1QLEC 4L87A 2AGAA 3JSLA 1XEQA 4I0XA 7ICEA 1YEWA 4BWAA 1NT2B 4MVRA 2FMQA 7ICOA 1Q90D 4PDVA 3ABLC 3OMIB 4FLWA 4FVMA 3K7DA 2DJVA 2DMXA 1BZKA 3SJCC 2EIKB 1K4CC 3L71H 2H94A 1V54C 2WLLB 3OR7C 1XOUA 5DM6V 2F43G 5HFMA 1ZQHA 5J0TA 3OTOO 2IBZH 1GM8A 3MD0A 3QF7A 5L3DA 4GT1A 5J0SA 1WP8A 2R72A 3OVSA 1FS0G 2FMLA 4FO1A 1ZQQA 4R66A 4WBNB 9ICIA 1XMOB 2HJDA 3ASOB 5JQGA 4WFBV 4NY8A 4ZOLA 1NH2D 5JTGA 1EM1A 5J0UA 2GTAA 1NQTA 2PFPA 2G38A 4M9GA 1Q6HA 3N2KB 4GX0A 4YIOA 1WPXA 3AG1C 1R3JC 2GBOA 4AT7A 4JPRA 4E8FA 4ATBA 2AHZA 1BE3H 1IDSA 1R1BA 4UD4A 3QTCA 5KLVH 2XASA 3FYIB 4PDRA 4KHPO 5KHIA 3OTOB 2ATKC 1TUBA 2UXNA 4RWQA 5D63A 3BRCA 1M90W 3HKDB 2VS0A 2HJFC 2JGDA 4O5KA 5CFUA 2EZPA 5DBAA 2JJ1G 3CCUV 3M8AA 1K9MW 3STLC 4FLUA 3ML0A 3MDAA 3JPSA 4KB6A 1ZQXA 1KP2A 3RVYA 4RQ3A 3UO3A 1AR1B 2PXIA 1RM1B 2E5LB 1MG1A 3AG3C 3C18A 1BMFG 4UCUA 4WOYA 2GDSA 3K5NA 9ICSA 2PTMA 2X6BA 4PPXA 1SQQH 2P6JA 3AG2C 4I0UA 3WFVA 4LF6O 1I08A 1QR8A 4YMOA 1LUVA 4F6RB 2BBJA 5EOZA 3LSUA 1S77D 2UUCO 3C5FA 2D2CB 1TVAA 4K0KO 4MVZA 4QGPA 1GTOA 1W0KG 3NKUA 4RPZA 1Y74B 4KHPB 1Q3EA 2ZH7A 1S3JA 5GTHZ 1JMKC 4HZ3A 3FB7C 1LNQA 2UXXA 1SF9A 5KMGA 4NXMO 4UAYA 4OAIZ 4GKJO 2BCCH 1XL6A 2DR5A 2YXYA 2IM9A 4RAIA 4DR4O 2ID1A 2DYSC 4JTDB 1L8DA 4MTGA 4PHEA 2ZXWC 2BCQA 3OVBA 5GW7A 3ZHSA 3W7WA 2F66C 5LHHA 2Q0AA 1OZ0A 2W0XA 1ZQAA 4X4QA 2B4VA 3QVNA 1MZEA 4EEDA 5CA7A 4G2KA 4PELA 1OU5A 1NBMG 1G1XB 4LF8O 2RCVA 1VF6C 5J2CA 3OTFA 2ZE7A 3O9OA 3AQMA 4LF6B 4UBBA 5JCOC 3J80N 3AQLA 4TUYB 1QCEA 2UUCB 4I2BA 3WB2A 2QE7G 3H1KH 2X7RB 2FL4A 3CB2A 2O57A 4NXZA 4GLXA 4I5SA 4K0KB 3MHHC 4WCWA 2LQTA 1NS1A 4MVUA 4FH3A 4EB6B 4X1IB 4LF7B 1YSCA 1FD9A 2IH1C 4KUMA 4DV0O 2ZM6O 1AI4A 4MTFA 4R7CA 1MIVA 1IBLO 4NXMB 4UCOA 4GKJB 5KHJA 5JJJB 4WBYA 3ABTA 4DR4B 3JATA 5A9GA 4LR3A 1G4YB 4OX9O 1K73W 4DR7O 3D3QA 1PD3A 3SJQC 5J0QA 4JI7B 2P4VA 4KLSA 3RYCB 2BCRA 2HP8A 1ZJNA 4UVAA 3RYHA 4FHPA 5HRGA 5HC9A 1GO3F 1WLEA 1Q43A 3P3PA 1R3KC 1S5LZ 2BCUA 1K92A 3E8HA 2WLNA 4LF8B 5LMUO 1NJIW 4KLTA 1WA8B 3B2EE 1VQOV 3CCRV 5HREA 4AILC 1R8AA 8ICIA 4CH6A 1FJGO 5HR9A 4UUJC 4YJ3B 4J7ZA 5KAIZ 3H1IH 3JPRA 1OCRB 4K35A 4O68A 4RQ5A 2EULA 5L3BA 4K4IA 2KKWA 3OMAB 4N21A 3CRRA 3WB0A 1WJZA 1UPGA 4DV2B 4AT8A 2XTAA 2GAFD 3ICXA 4WC1A 4QE7A 1SERA 2PGGA 4DV0B 1Y4MA 2ISPA 1IBLB 2IHOA 3RJIA 4EKWA 3K57A 2QWPB 4PGXA 4AI8A 4GX5A 4RQFA 7ICVA 3RWRD 4LEWA 3JPQA 3AQNA 4JI6O 1KDHA 4DR7B 3Q4HA 5EC2C 2IU0A 3HB3B 4LWSA 1R6KA 2OT5A 1R8BA 4O9MA 3OE7G 3TFRA 2ZE5A 3SPGA 2KB1A 4FFKA 4RWNA 2NR5A 1OCCB 1JJ2U 3LQCB 4RPYA 7ICFA 4QZ8A 3SPHA 5LMUB 3ZRSA 2Y0PA 3RN4A 1F7YA 1R89A 1K33A 5J0RA 5CA1A 3HKCA 9ICXA 3TCUA 4M9LA 1ZQVA 3U10A 4I2AA 1FJGB 2Q9LA 5IYZA 4DUYO 5J0XA 3E22B 1SZTA 3IC7A 4FLTA 1B6QA 5DEDA 2EILB 4I50B 4K8ZA 2Q8VA 1MA1A 1PX5A 2RDCA 4LEYA 2V1DA 3OWGA 3H9VA 3BEHA 3P30A 3PNCA 2RN9A 2M6YA 3FX7A 4O5CA 4X9QA 1H2KA 4IL6Z 3I56V 4DV1O 4P2ZA 2Y69C 3E86A 1Q8IA 4JI6B 3A2FA 1V9PA 4IYHA 4DV3B 2WAMA 4RQ0A 4H13B 5LHGA 1JMSA 1WP7A 2HN1A 4LF4O 2EIJC 4G28B 5EIBC 4WBNA 1W2BU 4PGYA 4R50A 3FFQA 4WC6A 1H2MA 4O4LB 2O5AA 2XAJA 2I9GA 4P9OA 4H37A 4UVBA 3GWKC 5E1AC 1RPOA 4X8AA 2LGWA 4E4EA 4LZDA 1GKFA 1NTZH 5EBMC 1MSWD 5IINA 2H3OA 2QM4A 3UPSA 7ICUA 3AQKA 2VWKA 4RQ2A 5J2FA 4DUYB 1O9GA 2ZKOA 3N2GB 8ICSA 2OCCB 4KLQA 5B5EZ 4I28A 5IJ0B 1I7FA 3F5WC 4K4HA 4GXKA 2P06A 4ZBMA 4O67A 3JAMN 2FB5A 2N04A 3CCQV 3E8FA 3OUYB 1R6TA 1RSOB 3JAWB 4DV1B 1AJNA 1ZUQA 2DVIA 3HKDA 3ERCC 1KUQA 3J81N 4LFAO 4B3RB 1EFRG 3DXRA 4Z6DA 1QHTA 1NH2B 5J0WA 8ICLA 3K0GA 1SKVA 9ICTA 4FFBB 2W0FC 4LF4B 3JALB 1I94O 3WFPA 3KCXA 5IILA 1J5EO 3OW2U 4X4PA 3CP1A 1E79G 1YJWV 4RPXA 1BSMA 1MNGA 4FH5A 4I2IA 1GAXA 9ICKA 4JWMA 4X1YB 3W7SA 2ZDIA 1RFYA 1U97A 5D49A 2OCHA 3JPPA 4UCTA 4UV9A 1XSPA 4WFAV 4DOBA 4J41A 1VQ8V 2QWNB 2Q7EA 1HWYA 3K59A 3I55V 5LGUA 3ZRVA 1PM9A 1M57C 1NOMA 3B4SA 5KX5B 1IVSA 3SYAA 5B1AB 4DO2A 4F6EA 3DTUB 1NZ6A 1Y74A 1HDJA 5C93A 3HR0A 4BW5A 3ZS8C 4UFZA
chains in the Genus database with same CATH topology
4FHYA 4YN4A 3MBYA 4KLGA 8ICPA 4PHPA 4UB2A 4I2GA 1RZTA 1Q79A 1TFYA 9ICJA 1ZQKA 4K4GA 4X4RA 1ZQFA 4AT9B 2DR7A 3UQ2A 1UETA 2ZH2A 7ICNA 4YMNA 1ZQIA 4MFAA 2ZH8A 2FMSA 4P4OA 1XSNA 9ICBA 7ICEA 1UEUA 1KNYA 2FMQA 7ICOA 4PGQA 1Q78A 3HJ1A 4DO9A 9ICEA 8ICTA 8ICOA 4QZCA 5J2DA 2BPGA 1R8CA 4F5QA 5DKWA 2BPFA 4F5PA 4UAWA 3RJFA 9ICWA 1ZQHA 3WFRE 5J0TA 4E80A 5J2IA 4NKTA 4M2YA 4FHXA 5CJ7A 5J0SA 9ICVA 3PMNA 4P2HA 3OVSA 5J0PA 4M5DA 5HRBA 3HWTA 9ICCA 5DDMA 4RT2A 4YCXA 9ICAA 4WC0A 1ZQQA 4R66A 9ICIA 1ZQDA 3RJJA 4X4TA 4IG8A 1FA0A 4NY8A 4QZ9A 4S3NA 1ZQGA 9ICGA 4UB5A 5J0UA 2PFPA 4M9GA 4NKUA 5J2BA 7ICIA 4R64A 4UAZA 1TFWA 4I29A 1MIYA 4FHVA 4AT7A 1BPBA 5J0YA 4IQTA 4E8FA 4ATBA 4UB3A 5D4BA 5DB8A 3H38A 2ZHAA 2ZHBA 8ICVA 4UD4A 5HHHA 5F2VO 5DB9A 8ICZA 3RH4A 2M2UA 4AT7B 4WC3A 4RWQA 4O5KA 5HRHA 3MGIA 5DBAA 2DRAA 4XRHA 5J2JA 5IIOA 1ZQZA 1ZQUA 2VANA 7ICJA 3MDAA 4QZGA 3JPSA 8ICWA 1ZQXA 4NM1A 4RQ3A 4I2FA 4RQ1A 4YMMA 4RQ7A 2PXIA 2W9MA 3MGHA 3ISDA 9ICUA 5HRIA 4UB1A 3C5GA 1JN3A 3C18A 1ZQCA 4IQUA 9ICSA 4PPXA 4YMOA 5DDYA 4RWPA 5IIMA 5EOZA 3V7LA 4E7XA 1ZJMA 2DRBA 2IHMA 4GXIA 4QZBA 3C5FA 5J29A 4Z6CA 8ICMA 3WFOA 1TVAA 5IIIA 3JPNA 8ICQA 3H3AA 4FHWA 4RPZA 3C2LA 2ZH7A 5BOMA 2DR9A 5J2GA 5HRKA 1F5AA 1ZQLA 4UAYA 1UEVA 2DR5A 3RJGA 4X0AA 4DOCA 2ID1A 3JPTA 4KLFA 3TFSA 5HHIA 4PHEA 4MF2A 3OVBA 2BCQA 4XQ8A 2O1PA 3ISBA 2DR8A 1XSLA 3C2MA 3HW8A 4NLZA 2ZH6A 8ICFA 1ZQAA 4X4QA 4RT3A 4NM2A 5CA7A 4KLDA 7ICGA 7ICMA 1OU5A 8ICCA 4M9HA 3C66A 5J2CA 4Z6FA 4QZIA 1BPYA 3AQMA 4UBBA 4P4PA 3AQLA 4I2BA 3K75D 3H39A 4UBCA 4NXZA 4WCWA 8ICBA 2BE3A 5HRLA 4FH3A 4TUQA 3RH5A 8ICJA 4WC4A 4F5NA 1BPDA 4I2DA 4FO6A 1MQ3A 1MIVA 4MF8A 4X0BA 1ZQSA 4X4SA 2ISOA 4WBYA 3HJ4A 3HX0A 3OUYA 8ICAA 5J0QA 3JPOA 4LVSA 4QZHA 4KLSA 7ICTA 1V4AA 2BCRA 1ZJNA 4FHPA 5HRGA 5HC9A 4X4NA 1ZQBA 1TV9A 1HUZA 4QZEA 4KLHA 5IIKA 2BCUA 8ICKA 4ATBB 5J2AA 3UXPA 9ICPA 4I2HA 4KLTA 5IIJA 5HREA 1R8AA 8ICIA 3RJHA 4M04A 1HUOA 3RJEA 5HR9A 4TUPA 2GWSA 4UB4A 4R63A 2RFFA 3JPRA 8ICGA 4RQ5A 4K4IA 4O5EA 3UXNA 7ICPA 5D46A 4AT8A 4WC1A 4JWNA 4M0AA 4LZGA 4M9JA 8ICUA 2M2TA 4UD5A 1BPXA 4QZDA 2ISPA 3RJIA 2Q66A 1VJ7A 4PHDA 3LK9A 4KLOA 4XA5A 4PGXA 7ICVA 5DB7A 3JPQA 4NLNA 3AQNA 2BPCA 1KDHA 2HHPA 4F5RA 1ZQOA 4AT8B 4NLKA 4P4MA 8ICNA 5CB1A 4M47A 1BPEA 2PFQA 7ICSA 3H37A 1R8BA 4LT6A 7ICRA 4O9MA 8ICEA 3JYYA 3TFRA 4X4OA 4AT9A 3JZ0A 4RWNA 5TZVA 3LQCB 4RPYA 7ICFA 4QZ8A 5CHGA 1R89A 5J0RA 4DOAA 5CR0A 2ZH4A 1WOTA 4X4UA 9ICXA 3C2KA 4M9LA 4RQ6A 1ZQVA 3WFQE 3B0YA 9ICHA 4I2AA 4I2JA 9ICMA 2P66A 5J0XA 3UQ0A 7ICKA 5DB6A 4KLEA 4R65A 3ISCA 2ZH9A 5DEDA 1ZQNA 1PX5A 3B0XA 3OGUA 4WC2A 4X4VA 5BPCA 3PNCA 9ICNA 4XQ7A 3V7JA 5DBCA 4XUSA 4O5CA 1JAJA 1NO5A 4GXJA 1BPZA 1ZQEA 8ICXA 4X5VA 4EBKA 7ICQA 1ZQJA 8ICHA 5CP2A 4RQ0A 3AU6A 4MFCA 1JMSA 8ICRA 5J2HA 3PMLA 4MFFA 4PGYA 2FMPA 7ICHA 4I27A 4I2EA 4WC6A 3OVAA 2ZH3A 2O5AA 7ICLA 2I9GA 8ICYA 3UPQA 5DBBA 1ZQMA 2BCVA 2PBEA 2ZH1A 4LZDA 1MQ2A 5IINA 2PFNA 3V7KA 4KLLA 3UPSA 7ICUA 4M9NA 9ICRA 4F5OA 3AQKA 5CWRA 4RQ2A 1VFGA 5J2FA 4RQ4A 3MDCA 4IQWA 8ICSA 4KLQA 5J2EA 4I28A 4K4HA 2BCSA 3AUOA 4GXKA 1ZQTA 1YLQA 1ZQWA 5J0OA 3OUYB 1JQRA 4EBJA 4PH5A 1MIWA 4KLIA 5DECA 4QZAA 2DVIA 4EP7A 3NYBA 9ICOA 4KLUA 4Z6EA 3OV7A 3UXOA 2ZH5A 4I2CA 4KLJA 4Z6DA 5J0WA 8ICLA 9ICTA 3WFPA 3RH6A 3L9DA 4PHAA 4WBZA 4IQVA 5J2KA 5IILA 4YD1A 3V72A 4X4PA 4WC5A 4RPXA 5HRDA 4FH5A 9ICLA 4I2IA 1ZQYA 4YD2A 3WFSC 2M2VA 1RPLA 9ICKA 4WC7A 4JWMA 2NRKA 4TURA 1KEJA 9ICQA 4TUSA 4QZFA 5D49A 3JPPA 3AU2A 1ZQRA 3RJKA 2M2WA 1XSPA 4DOBA 5HRFA 4KLMA 1ZQPA 5BOLA 1NOMA 9ICFA 3GDXA 2PFOA 4RWOA 4RQ8A 3HIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHY A;  4YN4 A;  3MBY A;  4KLG A;  8ICP A;  4PHP A;  4UB2 A;  4I2G A;  1RZT A;  1Q79 A;  1TFY A;  9ICJ A;  1ZQK A;  4K4G A;  4X4R A;  1ZQF A;  4AT9 B;  2DR7 A;  3UQ2 A;  1UET A;  2ZH2 A;  7ICN A;  4YMN A;  1ZQI A;  4MFA A;  2ZH8 A;  2FMS A;  4P4O A;  1XSN A;  9ICB A;  7ICE A;  1UEU A;  1KNY A;  2FMQ A;  7ICO A;  4PGQ A;  1Q78 A;  3HJ1 A;  4DO9 A;  9ICE A;  8ICT A;  8ICO A;  4QZC A;  5J2D A;  2BPG A;  1R8C A;  4F5Q A;  5DKW A;  2BPF A;  4F5P A;  4UAW A;  3RJF A;  9ICW A;  1ZQH A;  3WFR E;  5J0T A;  4E80 A;  5J2I A;  4NKT A;  4M2Y A;  4FHX A;  5CJ7 A;  5J0S A;  9ICV A;  3PMN A;  4P2H A;  3OVS A;  5J0P A;  4M5D A;  5HRB A;  3HWT A;  9ICC A;  5DDM A;  4RT2 A;  4YCX A;  9ICA A;  4WC0 A;  1ZQQ A;  4R66 A;  9ICI A;  1ZQD A;  3RJJ A;  4X4T A;  4IG8 A;  1FA0 A;  4NY8 A;  4QZ9 A;  4S3N A;  1ZQG A;  9ICG A;  4UB5 A;  5J0U A;  2PFP A;  4M9G A;  4NKU A;  5J2B A;  7ICI A;  4R64 A;  4UAZ A;  1TFW A;  4I29 A;  1MIY A;  4FHV A;  4AT7 A;  1BPB A;  5J0Y A;  4IQT A;  4E8F A;  4ATB A;  4UB3 A;  5D4B A;  5DB8 A;  3H38 A;  2ZHA A;  2ZHB A;  8ICV A;  4UD4 A;  5HHH A;  5F2V O;  5DB9 A;  8ICZ A;  3RH4 A;  2M2U A;  4AT7 B;  4WC3 A;  4RWQ A;  4O5K A;  5HRH A;  3MGI A;  5DBA A;  2DRA A;  4XRH A;  5J2J A;  5IIO A;  1ZQZ A;  1ZQU A;  2VAN A;  7ICJ A;  3MDA A;  4QZG A;  3JPS A;  8ICW A;  1ZQX A;  4NM1 A;  4RQ3 A;  4I2F A;  4RQ1 A;  4YMM A;  4RQ7 A;  2PXI A;  2W9M A;  3MGH A;  3ISD A;  9ICU A;  5HRI A;  4UB1 A;  3C5G A;  1JN3 A;  3C18 A;  1ZQC A;  4IQU A;  9ICS A;  4PPX A;  4YMO A;  5DDY A;  4RWP A;  5IIM A;  5EOZ A;  3V7L A;  4E7X A;  1ZJM A;  2DRB A;  2IHM A;  4GXI A;  4QZB A;  3C5F A;  5J29 A;  4Z6C A;  8ICM A;  3WFO A;  1TVA A;  5III A;  3JPN A;  8ICQ A;  3H3A A;  4FHW A;  4RPZ A;  3C2L A;  2ZH7 A;  5BOM A;  2DR9 A;  5J2G A;  5HRK A;  1F5A A;  1ZQL A;  4UAY A;  1UEV A;  2DR5 A;  3RJG A;  4X0A A;  4DOC A;  2ID1 A;  3JPT A;  4KLF A;  3TFS A;  5HHI A;  4PHE A;  4MF2 A;  3OVB A;  2BCQ A;  4XQ8 A;  2O1P A;  3ISB A;  2DR8 A;  1XSL A;  3C2M A;  3HW8 A;  4NLZ A;  2ZH6 A;  8ICF A;  1ZQA A;  4X4Q A;  4RT3 A;  4NM2 A;  5CA7 A;  4KLD A;  7ICG A;  7ICM A;  1OU5 A;  8ICC A;  4M9H A;  3C66 A;  5J2C A;  4Z6F A;  4QZI A;  1BPY A;  3AQM A;  4UBB A;  4P4P A;  3AQL A;  4I2B A;  3K75 D;  3H39 A;  4UBC A;  4NXZ A;  4WCW A;  8ICB A;  2BE3 A;  5HRL A;  4FH3 A;  4TUQ A;  3RH5 A;  8ICJ A;  4WC4 A;  4F5N A;  1BPD A;  4I2D A;  4FO6 A;  1MQ3 A;  1MIV A;  4MF8 A;  4X0B A;  1ZQS A;  4X4S A;  2ISO A;  4WBY A;  3HJ4 A;  3HX0 A;  3OUY A;  8ICA A;  5J0Q A;  3JPO A;  4LVS A;  4QZH A;  4KLS A;  7ICT A;  1V4A A;  2BCR A;  1ZJN A;  4FHP A;  5HRG A;  5HC9 A;  4X4N A;  1ZQB A;  1TV9 A;  1HUZ A;  4QZE A;  4KLH A;  5IIK A;  2BCU A;  8ICK A;  4ATB B;  5J2A A;  3UXP A;  9ICP A;  4I2H A;  4KLT A;  5IIJ A;  5HRE A;  1R8A A;  8ICI A;  3RJH A;  4M04 A;  1HUO A;  3RJE A;  5HR9 A;  4TUP A;  2GWS A;  4UB4 A;  4R63 A;  2RFF A;  3JPR A;  8ICG A;  4RQ5 A;  4K4I A;  4O5E A;  3UXN A;  7ICP A;  5D46 A;  4AT8 A;  4WC1 A;  4JWN A;  4M0A A;  4LZG A;  4M9J A;  8ICU A;  2M2T A;  4UD5 A;  1BPX A;  4QZD A;  2ISP A;  3RJI A;  2Q66 A;  1VJ7 A;  4PHD A;  3LK9 A;  4KLO A;  4XA5 A;  4PGX A;  7ICV A;  5DB7 A;  3JPQ A;  4NLN A;  3AQN A;  2BPC A;  1KDH A;  2HHP A;  4F5R A;  1ZQO A;  4AT8 B;  4NLK A;  4P4M A;  8ICN A;  5CB1 A;  4M47 A;  1BPE A;  2PFQ A;  7ICS A;  3H37 A;  1R8B A;  4LT6 A;  7ICR A;  4O9M A;  8ICE A;  3JYY A;  3TFR A;  4X4O A;  4AT9 A;  3JZ0 A;  4RWN A;  5TZV A;  3LQC B;  4RPY A;  7ICF A;  4QZ8 A;  5CHG A;  1R89 A;  5J0R A;  4DOA A;  5CR0 A;  2ZH4 A;  1WOT A;  4X4U A;  9ICX A;  3C2K A;  4M9L A;  4RQ6 A;  1ZQV A;  3WFQ E;  3B0Y A;  9ICH A;  4I2A A;  4I2J A;  9ICM A;  2P66 A;  5J0X A;  3UQ0 A;  7ICK A;  5DB6 A;  4KLE A;  4R65 A;  3ISC A;  2ZH9 A;  5DED A;  1ZQN A;  1PX5 A;  3B0X A;  3OGU A;  4WC2 A;  4X4V A;  5BPC A;  3PNC A;  9ICN A;  4XQ7 A;  3V7J A;  5DBC A;  4XUS A;  4O5C A;  1JAJ A;  1NO5 A;  4GXJ A;  1BPZ A;  1ZQE A;  8ICX A;  4X5V A;  4EBK A;  7ICQ A;  1ZQJ A;  8ICH A;  5CP2 A;  4RQ0 A;  3AU6 A;  4MFC A;  1JMS A;  8ICR A;  5J2H A;  3PML A;  4MFF A;  4PGY A;  2FMP A;  7ICH A;  4I27 A;  4I2E A;  4WC6 A;  3OVA A;  2ZH3 A;  2O5A A;  7ICL A;  2I9G A;  8ICY A;  3UPQ A;  5DBB A;  1ZQM A;  2BCV A;  2PBE A;  2ZH1 A;  4LZD A;  1MQ2 A;  5IIN A;  2PFN A;  3V7K A;  4KLL A;  3UPS A;  7ICU A;  4M9N A;  9ICR A;  4F5O A;  3AQK A;  5CWR A;  4RQ2 A;  1VFG A;  5J2F A;  4RQ4 A;  3MDC A;  4IQW A;  8ICS A;  4KLQ A;  5J2E A;  4I28 A;  4K4H A;  2BCS A;  3AUO A;  4GXK A;  1ZQT A;  1YLQ A;  1ZQW A;  5J0O A;  3OUY B;  1JQR A;  4EBJ A;  4PH5 A;  1MIW A;  4KLI A;  5DEC A;  4QZA A;  2DVI A;  4EP7 A;  3NYB A;  9ICO A;  4KLU A;  4Z6E A;  3OV7 A;  3UXO A;  2ZH5 A;  4I2C A;  4KLJ A;  4Z6D A;  5J0W A;  8ICL A;  9ICT A;  3WFP A;  3RH6 A;  3L9D A;  4PHA A;  4WBZ A;  4IQV A;  5J2K A;  5IIL A;  4YD1 A;  3V72 A;  4X4P A;  4WC5 A;  4RPX A;  5HRD A;  4FH5 A;  9ICL A;  4I2I A;  1ZQY A;  4YD2 A;  3WFS C;  2M2V A;  1RPL A;  9ICK A;  4WC7 A;  4JWM A;  2NRK A;  4TUR A;  1KEJ A;  9ICQ A;  4TUS A;  4QZF A;  5D49 A;  3JPP A;  3AU2 A;  1ZQR A;  3RJK A;  2M2W A;  1XSP A;  4DOB A;  5HRF A;  4KLM A;  1ZQP A;  5BOL A;  1NOM A;  9ICF A;  3GDX A;  2PFO A;  4RWO A;  4RQ8 A;  3HIY A; 
#chains in the Genus database with same CATH topology
 1N4C A;  4J7J A;  4NXX A;  3R65 A;  3ZMZ A;  4IIJ B;  4LFA B;  3OR6 C;  3OEE G;  1ZQK A;  3WG7 B;  2JVD A;  4AT9 B;  4MS2 A;  2DR7 A;  4K3A A;  2Y0I A;  1I0H A;  7ICN A;  2PY5 A;  2ZNJ A;  1ZQI A;  1I94 B;  4OPH A;  4C7U A;  1DGS A;  5B1N A;  4P4O A;  5IYC O;  1JFF A;  5FPR A;  1AI6 A;  3ABM B;  2YIB D;  1OHH G;  3OEH G;  1XQ8 A;  4PGQ A;  2JEX A;  5L3G A;  9ICE A;  2IJJ A;  3E89 A;  1VQ6 V;  3CCS V;  1KU9 A;  1BQ0 A;  1R8C A;  2BPF A;  4TUY A;  5EC1 C;  3RJF A;  3JCU Z;  4DR3 O;  4O2A B;  3CWB H;  2Y48 A;  1SQF A;  3ZN1 A;  5BZB A;  4CZZ A;  1ZSP A;  4X1I A;  3BCC H;  4YY3 O;  3JSN A;  4DR3 B;  3RBZ A;  1K7D A;  4MKP A;  4WC0 A;  2UUA O;  4U3J B;  1Q7Y W;  1XNR O;  2XOK G;  1FXV A;  4S3N A;  1OCO C;  4WFF A;  5KHH A;  4MVQ A;  1YHQ V;  1HP8 A;  3RYC A;  1YI2 V;  3ER9 B;  1MOF A;  4Z1V A;  3IFX A;  4NKU A;  7ICI A;  1TFW A;  5EIB D;  1AJP A;  2KQX A;  2HN2 A;  4MTX A;  2ITC C;  5J0Y A;  3C90 A;  1WN7 A;  2HKO A;  2BTO A;  4EV6 A;  3ZMU A;  1FXK B;  3ABL B;  1WA8 A;  3H38 A;  3M7M X;  4FZ1 A;  8ICV A;  3DC6 A;  4O4I B;  4YJ2 B;  1V54 B;  4TQD A;  8ICZ A;  2QKS A;  1UJW B;  4YJ3 A;  1JQ0 A;  3JYC A;  1R6N A;  3CRQ A;  1JR9 A;  5CN0 A;  4X62 O;  4JYB A;  3ZRW B;  4I9Q A;  2VWJ A;  1VQN V;  1DF4 A;  4YY3 B;  4CS4 A;  1WB8 A;  2DYR C;  1NTK H;  2LO1 A;  2WLJ A;  1ZQZ A;  3T2M A;  1NI8 A;  2UUA B;  4HNA B;  3DSQ A;  4NM1 A;  4I2F A;  2DW4 A;  1XNR B;  4RQE A;  4RQ1 A;  1G6U A;  1KD1 W;  3EXA A;  4DW1 A;  2PYL A;  9ICU A;  5HRI A;  4HX0 A;  4J9Y B;  2R9I A;  1IBK O;  1ZQC A;  2R70 A;  2EWR A;  4EFB A;  4IQU A;  1PV0 A;  4FIP C;  2WLH A;  3JCZ A;  5IIM A;  3AG1 B;  4K97 A;  3T4Z A;  2IHM A;  2JDI G;  1SES A;  2PZS A;  4DXW A;  4FM1 A;  2B56 A;  3ZBH A;  5J29 A;  2A3Q A;  1XMO O;  1M9N A;  1RP3 B;  4FHW A;  4CC6 A;  4RUE A;  3J7A U;  4ZHQ B;  4NTX A;  1OV9 A;  1AVM A;  5BOM A;  5J2G A;  4X62 B;  4OXS A;  3ZCC A;  1JOY A;  4I50 A;  3ZHR A;  1BL8 A;  3ETD A;  1UEV A;  3RJG A;  3ZIA G;  1YF2 A;  3RYI B;  4CS3 A;  4KLF A;  4MF2 A;  1VQ5 V;  2EZO A;  4O69 A;  3G80 A;  4UV8 A;  1XSL A;  3AG7 A;  2ZIN A;  2WPD G;  2ZH6 A;  8ICF A;  2CTP A;  3CRA A;  3SDL A;  2QTS A;  2V4D A;  1I5X A;  3SYC A;  1SQG A;  2DN9 A;  4O2B B;  7ICM A;  4QPK A;  5EYP A;  3AG3 B;  1IBK B;  3U0Z A;  3OD4 A;  3C66 A;  1WNS A;  1XRE A;  3RYF B;  1SRY A;  4B7E A;  4QZI A;  3AG2 B;  4O4L A;  4FLY A;  5C8Y B;  3K5M A;  3KG2 A;  4X1K B;  3H39 A;  2PI5 A;  4DV5 O;  2Q7H A;  5CHE A;  2CTR A;  3MAQ A;  8ICB A;  1N0N A;  4TUQ A;  3RH5 A;  8ICJ A;  4WC4 A;  3APQ A;  2P5O A;  4K9A A;  1BPD A;  2E5L O;  3CHX A;  1GM9 A;  3PHZ A;  1MQ3 A;  3N2G A;  2CTW A;  2HVK C;  2JIZ G;  4MF8 A;  1P84 F;  4X0B A;  5IJ0 A;  4X4S A;  2QKC A;  2ISO A;  3OGC C;  4OPA A;  4LCU C;  2PUS A;  3OUY A;  1Y66 A;  5CMU A;  3BFR A;  8ICA A;  1QQC A;  3JPO A;  1RSO A;  4PA6 A;  3ZMV A;  4J11 A;  2ZXW B;  3JAW A;  7ICT A;  1BCC H;  2YID A;  3OMN B;  5ITZ B;  4QJF B;  1S76 D;  4NXT A;  4LEZ A;  2QM7 A;  1B04 A;  3LDC A;  4X4N A;  1ZQB A;  1KYO F;  5EBW C;  2BSK B;  4KLH A;  3S3X A;  4BIU A;  4XJE A;  3R66 A;  2CH7 B;  5KHG A;  1ZLZ A;  3UM7 A;  3ZHT A;  5J2A A;  9ICP A;  2LW1 A;  2DOS A;  4K8V A;  3CCV V;  2IU3 A;  3BAB A;  3OGI B;  3RJH A;  5H6Q A;  1HUO A;  3RJE A;  4TUP A;  2GWS A;  4X88 A;  4UB4 A;  2F23 A;  2DE0 X;  4DV5 B;  2HLD G;  2Q7G A;  4X1Y A;  7ICP A;  5D46 A;  1T5E A;  2ZE6 A;  4O6A A;  3U11 A;  4DR6 O;  1KP3 A;  4M9J A;  2M2T A;  1V55 C;  5K1X A;  3BAA A;  2Q66 A;  4KLO A;  4WFH A;  4XA5 A;  2EIM C;  3JD4 A;  5KX5 A;  1QU7 A;  5DB7 A;  3MCR A;  4NLN A;  1YIT V;  3KCY A;  2Q6A A;  4DR1 O;  2HHP A;  4TT3 G;  1ZQO A;  4JI5 B;  8ICN A;  2Z5U A;  3APO A;  7ICS A;  3C3T A;  2Q4P A;  3K04 A;  3H37 A;  1M93 A;  4LF7 O;  4IIJ A;  1M5I A;  8ICE A;  1H2S B;  1VMG A;  1WB7 A;  4YHH O;  4H0L B;  4I4T A;  4X4O A;  1Q82 W;  4NYK A;  4AT9 A;  2DQ0 A;  1US6 A;  1TVK B;  1XHZ A;  2QKA A;  2MK3 A;  5IDJ A;  4DOA A;  5CR0 A;  5IYD O;  2ZH4 A;  1WOT A;  1ZTE A;  3QO8 A;  4LH7 A;  3OM3 B;  4UVC A;  4JI1 B;  2WA4 A;  4JI7 O;  3LUT B;  3CSX A;  4ZI7 B;  3K3W A;  5DB6 A;  4OAH A;  3ISC A;  1P7B A;  5CFT A;  1SC5 B;  1LR1 A;  1Q6I A;  1D5A A;  3OGU A;  3SJB C;  4DR6 B;  5JVD A;  4D7T A;  4NB5 A;  4E2L A;  2JEU A;  1TUE B;  4XQ7 A;  4O2A A;  5DBC A;  4KXR A;  2P7T C;  2BOB C;  4Q20 A;  5KUM A;  8ICX A;  4DR1 B;  5D62 A;  3E8G A;  3ASN C;  5CP2 A;  3AU6 A;  3B8M A;  1SZX A;  1VQ7 V;  2L35 A;  2AZ2 A;  3D8C A;  3L70 H;  4DV2 O;  4HBN A;  4MFF A;  4YHH B;  4U3J A;  4I27 A;  4I2E A;  3ZHQ A;  3OVA A;  3L74 H;  4DW0 A;  1S5J A;  5BY1 A;  2N74 A;  2ILM A;  1M56 C;  2CDY A;  1HNW O;  3H1L H;  5IJ9 B;  3EVK A;  1P49 A;  1MQ2 A;  3V7K A;  3WU2 Z;  9ICR A;  3QG5 A;  1ZWI C;  2RQ6 A;  2QEX V;  3MDC A;  4BAY A;  1FXK A;  4IQW A;  3BHP A;  4JAS A;  5LP6 A;  4GZR B;  1ZQT A;  1AR5 A;  4O4I A;  3GB7 C;  4CBC A;  2ZDI C;  4N7R A;  5J0O A;  4EBJ A;  4NTY A;  3VOU A;  1JJO A;  1MIW A;  5L3F A;  3ZRW A;  3E2E A;  4KLI A;  3ETE A;  2Y69 B;  2EX3 A;  3G67 A;  4O4H A;  9ICO A;  3ZN0 A;  5LYJ B;  5CBH A;  3DC5 A;  4KLJ A;  2ZD9 A;  3FB8 C;  2XAG A;  1K5S A;  4F4L A;  2YC0 A;  3ZRX A;  2OTL V;  2RNB A;  2XAF A;  1VIB A;  4HNA A;  4EFE A;  5GON B;  1IBM B;  5LOV A;  3L9D A;  2EIJ B;  1SS3 A;  4ZKI A;  1SA0 B;  2AHY A;  2CK3 G;  5B1O A;  3NVO A;  3WFS C;  1HNW B;  1VQP V;  4DRX B;  2F95 B;  3RGB A;  2K9P A;  4DV3 O;  1XI1 A;  4QZF A;  4KL1 A;  1ZQR A;  2NN4 A;  1AJQ A;  1PKX A;  5BOL A;  3GVM A;  2FYU H;  1VQ4 V;  2YIA A;  4J80 A;  5J2U A;  1N32 O;  3AG4 C;  2OWO A;  4ZHQ A;  2B1G A;  3FYE B;  1Z5W A;  4KLG A;  2GUZ B;  4PHP A;  4I2G A;  1K4D C;  1TAE A;  3UCS C;  4X4R A;  4K4G A;  2E74 B;  1L1F A;  3UQ2 A;  3G4S V;  4DV4 B;  4MFA A;  2ZH8 A;  1Q81 W;  3CXC U;  1DTO A;  3HKE B;  2IUB A;  2WLL A;  1GMG A;  3D3I A;  3I5D A;  9ICB A;  4D7S A;  3NWI A;  4O2B A;  1K97 A;  1KNY A;  2QM8 A;  2LGQ A;  1Q78 A;  4DO9 A;  4I9W A;  8ICT A;  3RYF A;  3RFR A;  4B3R O;  3SYO A;  4QZC A;  4F5Q A;  4F5P A;  3SYP A;  4UAW A;  4EGW A;  4HAM A;  5C8Y A;  9ICW A;  4QNH B;  4X1K A;  3WFR E;  4E80 A;  3N27 A;  1IXB A;  1M57 B;  5J2I A;  4M2Y A;  1N32 B;  3T1Y O;  9ICV A;  2YUA A;  3PMN A;  3CRM A;  4GX2 A;  1Y76 B;  5JH7 B;  5J2T B;  5J0P A;  5HRB A;  4P2H A;  3HWT A;  3F5T A;  9ICC A;  3X2Q B;  4ABM A;  4LF9 O;  3N2K A;  2OYQ A;  4PJ0 Z;  1OCR C;  2QSA A;  1ENV A;  1ZQD A;  1AP5 A;  1OJH A;  2A9H A;  2BTQ B;  1YIJ V;  4IG8 A;  1OCZ C;  3T1H B;  2LW7 A;  4JTA B;  4UB5 A;  2EJ7 A;  2KG7 B;  5CBG A;  5J2B A;  4R64 A;  4UAZ A;  2PI4 A;  4I29 A;  3JD1 A;  4MVS A;  4BW9 A;  1MIY A;  2FKX A;  1F4N A;  4IQT A;  2CH7 A;  4UCS A;  2CE4 A;  3ZED A;  2RMK B;  5B1B B;  4UCV A;  5KUK A;  4UB3 A;  4UCR A;  2XHB A;  2ZHA A;  1GRJ A;  3AK1 A;  4TSF G;  2FTK A;  3CC4 V;  2DWD C;  4K9B A;  4JZ2 A;  3A0H Z;  4TQF A;  3L75 H;  4AT7 B;  1S72 V;  1OCC C;  4JI8 O;  2EIN C;  3JAR B;  4WC3 A;  2F93 B;  4PI2 A;  2P4K A;  1M1K W;  2N05 A;  1L0L H;  3T1Y B;  5HRH A;  2CGO A;  3AK2 A;  4MVO A;  4LF9 B;  4XRH A;  5J2J A;  1ZQU A;  7ICJ A;  3BY6 A;  4QZG A;  8ICW A;  4FLZ A;  2EIL C;  4F6R A;  2Q68 A;  4AQY B;  4RQ7 A;  4U7O A;  2W9M A;  3MGH A;  1OCO B;  2R9R B;  3JAK B;  1WPB A;  4UB1 A;  3S3W A;  5EZY B;  3ABU A;  5B3S C;  4JLZ A;  5DDY A;  3L72 H;  4E7X A;  1ZJM A;  4TWK A;  4X65 O;  1TVK A;  2DRB A;  1CP9 A;  4GXI A;  4QZB A;  1AIL A;  8ICM A;  4Z6C A;  2QJ1 A;  5TIS Z;  3WB1 A;  3WFO A;  5III A;  1ZL8 B;  2B51 A;  1PNM A;  4TV8 B;  4FK5 C;  4DR5 O;  4PA7 A;  2F4V O;  3H3A A;  1K5Q A;  2DR9 A;  5HRK A;  4JI8 B;  4ZI7 A;  1NR7 A;  1VAR A;  5E79 Z;  2VQF O;  2IJK A;  4X0A A;  4FZ0 A;  3JPT A;  5HHI A;  1EZV H;  2DYR B;  1DLB A;  1AI5 A;  1FKA O;  1FXH A;  1RPR A;  4X64 O;  1SQX H;  4XQ8 A;  3HKB B;  2DR8 A;  4RUF A;  4JV5 O;  2X6C A;  4NLZ A;  4DYL A;  5KMG B;  3OAA G;  1XMQ O;  4W4K A;  4KLD A;  7ICG A;  1VP7 A;  3ABK C;  4M9H A;  3MHS C;  4EB6 A;  4MSW C;  1VF7 A;  4P4P A;  3K03 A;  4B3T O;  4L8J A;  4X65 B;  4NKG B;  3K75 D;  3FKS G;  3SPJ A;  3JCF A;  4JLX A;  3SR2 C;  1SQP H;  5IJ9 A;  3EHB B;  3L73 H;  5HRL A;  4JF3 A;  4DR5 B;  2F4V B;  5IE9 A;  4I2D A;  3TJT A;  4FO6 A;  1IXM A;  4TV9 B;  1CXZ B;  3BA8 A;  4CH4 A;  4X66 O;  2ZCE A;  4FMT A;  1ZQS A;  4LNU B;  2VQF B;  1QNM A;  1QLE B;  5CA0 B;  1Z2G A;  5LMN O;  1J95 A;  3OUF A;  5GTI Z;  4LVS A;  1PPJ H;  4X64 B;  4D6T H;  3M99 B;  4J9Z B;  4JV5 B;  4O4J B;  1FFX B;  1W0J G;  5LYJ A;  1VF5 B;  1FPO A;  1XMQ B;  1HUZ A;  2A06 H;  4QZE A;  5IIK A;  4XDL A;  4FJC C;  3UQ8 A;  1HW7 A;  3UXP A;  4NXN O;  2LFS A;  4I2H A;  2OTJ V;  3IJ4 A;  5IIJ A;  1GN4 A;  3LSS A;  4B3T B;  1SA0 A;  4M04 A;  3DGE A;  1TA8 A;  1QVF U;  1IUR A;  1R73 A;  3WG7 C;  2YDE A;  2DQ3 A;  2Y4T A;  4J7K A;  2YEV B;  4DRX A;  4O5E A;  3O65 A;  1THZ A;  4JWN A;  1H8H G;  4IHJ B;  1XDC A;  3KZI Z;  8ICU A;  4UD5 A;  2ZIM A;  3A0R A;  1SQV H;  1BPX A;  4QZD A;  4PHD A;  1S5H C;  5J9P C;  4X66 B;  3LK9 A;  1JVM A;  1KKC A;  4LP8 A;  3BA9 A;  3NXS A;  5LMN B;  4F5R A;  2P67 A;  4AT8 B;  2FCL A;  2PFQ A;  5H2F Z;  1P7G A;  2GUZ A;  1GK9 A;  1AP6 A;  5FL7 G;  4LT6 A;  2GTS A;  7ICR A;  4A5U B;  3ER8 C;  3FAV B;  5CBF A;  2Q5Z A;  1QVG U;  3E22 A;  2AZ0 A;  5IWA O;  5CFS A;  3TXS A;  5D5Q A;  4NXW A;  5TZV A;  3A8T A;  4NXN B;  2X0L A;  5AG2 A;  1ZX3 A;  5KHK A;  4YXW G;  4X4U A;  3HKE A;  4WFE A;  3K58 A;  4RQ6 A;  1U96 A;  3WFQ E;  2XUM A;  9ICH A;  4I55 B;  4I2J A;  9ICM A;  4LBE C;  3ZX6 A;  1EN5 A;  3UT5 B;  7ICK A;  1XIL A;  3H1J H;  3P3N A;  4PV1 B;  3UO2 A;  4R65 A;  4KLE A;  1ZQN A;  4JYC A;  2Q0O C;  1KB9 F;  2LJ2 A;  4JAA A;  3GWO A;  1N33 O;  4K8X A;  3HKC B;  5EBL C;  5DN6 G;  5LGN A;  4WC2 A;  1GM7 A;  4X4V A;  4J42 A;  3CCM V;  5BPC A;  1AB3 A;  4CS2 A;  1V55 B;  4GKK O;  5IYZ B;  1FXK C;  4YIP A;  4B08 A;  2EIM B;  5H6R A;  1BPZ A;  1ZQE A;  5LP6 C;  4X5V A;  2GHY A;  4B7K A;  5JH7 A;  1Y76 A;  5J2T A;  4PHZ A;  1L0N H;  5KAF Z;  1EN6 A;  1NVP D;  3UKM A;  1N36 O;  1QBZ A;  2A79 B;  4FLX A;  5B3P A;  8ICR A;  5J2H A;  3EF2 A;  3G6B A;  1Q5O A;  2HFE C;  2KSD A;  2FMP A;  7ICH A;  2ETN A;  2BTQ A;  4CH5 A;  2ZH3 A;  5IWA B;  7ICL A;  1I5Y A;  4X20 B;  3RVZ A;  4NTW A;  3A0B Z;  5JWP A;  2UXC O;  2ADP A;  2KG7 A;  1X59 A;  4GCZ A;  3VQY A;  4JI5 O;  4M9N A;  2DYS B;  4F5O A;  5CWR A;  2D3O W;  4IGG A;  1Q86 W;  1VFG A;  1VQM V;  1K34 A;  2RJZ A;  5LA6 B;  3K9A A;  2XAQ A;  3HPL C;  1YLQ A;  1EZJ A;  1N33 B;  1B06 A;  1G8M A;  1ZQW A;  3TXQ A;  2LFR A;  4GYC B;  4PH5 A;  4FFB A;  3B8N A;  3JAL A;  4GKK B;  4GX1 A;  1YVW A;  3JAR A;  5DEC A;  4QZA A;  3IAY A;  5HFL A;  4Z6E A;  1BT8 A;  2CTQ A;  3IGA C;  3UXO A;  2Q67 A;  4I2C A;  4JI1 O;  4LFB O;  4PD4 F;  5LXT B;  3ASN B;  1PL0 A;  1MZF A;  2ZIO A;  1N36 B;  1JX9 A;  4WQK A;  5IY5 C;  2EJR A;  4WBZ A;  1Z5V A;  4YD1 A;  3V72 A;  4JGS A;  1VQK V;  2ZR2 A;  4WC5 A;  4TOI A;  3EFF K;  3K5L A;  3JAK A;  3T4D A;  2UXC B;  3DXR B;  5HRD A;  4YD2 A;  1M56 B;  3CK6 A;  4LFC O;  5EZY A;  2XT9 A;  4WC7 A;  3RW0 A;  2EIK C;  3CCJ V;  4R6Z A;  1KEJ A;  9ICQ A;  4TUS A;  4FPP A;  3B77 A;  3OFN G;  4XDK A;  3RJK A;  1BHA A;  2M2W A;  4UXN A;  1VQ9 V;  5HRF A;  2HEP A;  1XHX A;  1ZQP A;  2Y4U A;  3E83 A;  3B40 A;  3CXH F;  1ZL8 A;  4DV6 O;  2UXB O;  4FM0 A;  4P9P A;  4TV8 A;  4DUZ O;  3GDX A;  4U7N A;  3K9S A;  4RQ8 A;  2L6L A;  3HIY A;  4Z1M G;  3AEI A;  4FHY A;  1GPJ A;  4YN4 A;  4HYO A;  8ICP A;  4UB2 A;  2WWW A;  1N8R W;  3ASO C;  1HR0 O;  3K79 A;  4WFG A;  4ZIB A;  5BR8 O;  4LFB B;  1ZQF A;  2CUG A;  1JCH A;  2HHH O;  2ZH2 A;  4NXU A;  1JA8 A;  3HKB A;  2AW9 A;  2A7W A;  1H38 A;  4LEV A;  1VEW A;  3CEI A;  1VQL V;  2HR3 A;  3K5O A;  1XSN A;  4JZG A;  2JS3 A;  1ZAU A;  2ZQM A;  3D36 A;  1UEU A;  2P22 C;  1NKD A;  5A2Q N;  3HJ1 A;  1CPY A;  5KA5 A;  4LFC B;  1YDX A;  4WF9 V;  8ICO A;  5FNV B;  2V7Q G;  3CX5 F;  5J2D A;  2BPG A;  2E75 B;  5DKW A;  2OIG A;  2QDO A;  2YSU B;  2Q69 A;  1JFF B;  2PYJ A;  4CC5 A;  1NTM H;  1SQB H;  2QTO A;  4BIO A;  1IBM O;  1H2L A;  4B3M O;  1H8E G;  4DV6 B;  2UXB B;  3JAS B;  4DUZ B;  4NKT A;  3AK3 A;  1ROP A;  3KKY A;  4FHX A;  5CJ7 A;  3AG4 B;  4K98 A;  2YS8 A;  4M5D A;  4DK1 A;  5DDM A;  4RT2 A;  3LNN A;  4TV9 A;  4NR1 A;  4YCX A;  5D61 A;  9ICA A;  4JAU A;  2QGN A;  4ASU G;  4LNU A;  3BPZ A;  1HR0 B;  5CA0 A;  2WLI B;  3RJJ A;  4X4T A;  4GUN A;  5BR8 B;  1FA0 A;  1MSD A;  1RM1 C;  4QZ9 A;  1ZQG A;  1SET A;  4P30 A;  2HHH B;  9ICG A;  1K8A W;  3ETG A;  1B3Q A;  1GN3 A;  4YJ2 A;  4O4J A;  4EEB A;  1FFX A;  3CJH B;  4XBF A;  1NU1 H;  4FHV A;  1BPB A;  1H2N A;  1YTF D;  3QO5 A;  4LF5 O;  2GSM B;  4H44 B;  5D4B A;  2QWO B;  5DB8 A;  2ZHB A;  4IYI A;  5HHH A;  4PDM A;  5F2V O;  1D5N A;  2JJ2 G;  4MW8 A;  2BOC C;  5DB9 A;  4JAV A;  1YZB A;  3RH4 A;  2M2U A;  3LSQ A;  3K0D A;  3OT7 A;  4KFM A;  4DV4 O;  2M7W A;  2H8P C;  1KC8 W;  2YEV A;  4B3M B;  2YI9 A;  1QLN A;  2ITD C;  5LL6 Y;  4PI0 A;  2JK5 C;  2CGN A;  3NR7 A;  4IHJ A;  3MGI A;  2DRA A;  5FLX N;  5IIO A;  5LGT A;  3FB5 C;  2VAN A;  4Z2W A;  5JJE B;  2WLK A;  3W7T A;  4DK0 A;  2ODM A;  5IT9 N;  4YMM A;  2EBO A;  1DF5 A;  2MW2 B;  2UXD O;  1OCZ B;  3VQX A;  3ISD A;  3F7Y C;  2ZM6 B;  3C5G A;  1JN3 A;  1O9H A;  5BMV B;  4RWU A;  3TK1 A;  3F7V C;  1URF A;  4JI2 O;  4XDJ A;  3FAV A;  4WH5 A;  4RWP A;  5L3C A;  1XNQ O;  3V7L A;  4QE9 A;  5CB4 B;  2JRI A;  4LF5 B;  4OX9 B;  1HNX O;  2JGU A;  3ETQ A;  5JJN B;  4JI0 O;  3JPN A;  3RYI A;  8ICQ A;  3TGU H;  3FB6 C;  3T1H O;  4I55 A;  3C2L A;  1IZ3 A;  3UT5 A;  3OUS A;  1F5A A;  1ZQL A;  2YIC A;  2EIN B;  1IX9 A;  2A0L A;  2BBH A;  2YI8 A;  5LHI A;  4FM2 A;  4DOC A;  2ZR3 A;  1DK1 A;  1PL4 A;  1YCI A;  3VQW A;  1GN6 A;  2QWQ B;  3TFS A;  2HG5 C;  2O1P A;  4PA9 A;  1HNZ O;  3ISB A;  3FD9 A;  1PNK A;  3STZ C;  5IYB O;  3C2M A;  3HW8 A;  1A32 A;  4NVP A;  4PA3 A;  3ZHV A;  2LP7 A;  2UXD B;  4I0X B;  4RT3 A;  4NM2 A;  8ICC A;  1W59 A;  2K1E A;  2IJI A;  1S0V A;  1TGO A;  4Z6F A;  1BPY A;  4JI2 B;  5B3S B;  1XNQ B;  3JD2 A;  3QNE A;  1KQS U;  2E3C A;  4X20 A;  1H2G A;  1HNX B;  2E76 B;  2Z0A A;  2UU9 O;  3JD0 A;  4UBC A;  4JI0 B;  1MMM A;  5EYP B;  2YXH A;  2BE3 A;  4AQY O;  5BXZ A;  2IH3 C;  4F5N A;  3CC2 V;  2VRZ A;  4JTC B;  5LA6 A;  2C2A A;  5ITZ A;  1MAB G;  2BSK A;  3HJ4 A;  5JQG B;  1AR4 A;  4N23 A;  3SPI A;  3HX0 A;  2WLM A;  1E1R G;  1R3L C;  2QR4 A;  2OIE A;  4ZOL B;  3LDE A;  1PP9 H;  1FFT B;  5LBQ A;  4BIZ A;  1NVP B;  1HNZ B;  3CD6 V;  4JYA O;  4QZH A;  1V4A A;  1VF6 A;  4UB8 Z;  5EK0 A;  5JCO A;  3CCL V;  1TV9 A;  2Z3Y A;  5LXT A;  3G71 V;  1XUQ A;  5FPO A;  2WA3 A;  4LH6 A;  1N0J A;  8ICK A;  4ATB B;  3ABK B;  1Q6U A;  2QWR B;  2VQE O;  1GN2 A;  1N34 O;  2IW5 A;  3SJA C;  1AI7 A;  4OGQ B;  4R63 A;  2UU9 B;  2RFF A;  1R3I C;  8ICG A;  1TUB B;  2NLJ C;  1P4R A;  1KKD A;  3B09 A;  4X89 A;  3UXN A;  4AHC A;  2JGD B;  4M0A A;  4KP4 A;  4LZG A;  1YJ9 V;  1COW G;  2UUB O;  4WQL A;  1VJ7 A;  3W7U A;  5B66 Z;  1UFI A;  3ZJZ A;  3LDD A;  3K08 A;  4W4L A;  1ARO P;  3IC9 A;  2F1M A;  4OAF A;  3K06 A;  2B9Z A;  3ZMT A;  2BPC A;  4H33 A;  3PJS K;  4NLK A;  4P4M A;  5CB1 A;  4M47 A;  1BPE A;  4JYA B;  3E8B A;  2ZT9 B;  2HVJ C;  3P32 A;  1BGY H;  4ICG A;  1M4U A;  3JYY A;  3MDS A;  1FAF A;  1KEC A;  1X4T A;  2Q73 A;  3JZ0 A;  3CCE V;  5L3E A;  3X2Q C;  5CHG A;  2W6I G;  5H9C A;  2VQE B;  3C2K A;  1N34 B;  3B0Y A;  3CS5 A;  4I4T B;  3UQ0 A;  2P66 A;  2OCC C;  3SPC A;  2ZNI A;  3T1C A;  2ZH9 A;  5FNV A;  5D5P A;  1XL4 A;  2WSS G;  3B0X A;  3RT3 C;  1J5E B;  2UUB B;  9ICN A;  3V7J A;  2DWE C;  4FLV A;  4NXV A;  2NNU A;  5B1B C;  4XUS A;  2R9A A;  1QR9 A;  1WAZ A;  3PN1 A;  1JAJ A;  3JAS A;  1NO5 A;  3CC7 V;  5B3Q A;  4GXJ A;  2ADQ B;  3BVO A;  2YIB A;  4K99 A;  4EBK A;  4K96 A;  7ICQ A;  3CMA V;  3VQV A;  1ZQJ A;  1BQZ A;  8ICH A;  2QA4 V;  1YJN V;  4MVM A;  4KM5 A;  5JVD B;  4MFC A;  4PDL A;  3CE2 A;  3PML A;  3CME V;  2WLI A;  2ZE8 A;  2GV9 A;  3JD3 A;  3VBB A;  4JI4 O;  8ICY A;  3UPQ A;  5DBB A;  4DV7 O;  1ZQM A;  2X6A A;  3SYQ A;  5K1P A;  2BCV A;  2PBE A;  2ZH1 A;  3CJH A;  1EBO A;  2PFN A;  4KLL A;  2PF4 E;  2IJH A;  4G27 B;  4RQ4 A;  4EEQ A;  4OAG A;  2ARH A;  5J2E A;  3SGI A;  2BCS A;  3AUO A;  5B1A C;  1YXB A;  3CRC A;  3CPW U;  3H1H H;  2GA9 D;  2CAZ C;  3JAT B;  4QIW F;  1JQR A;  3W7X A;  1XBL A;  5GON A;  1F4M A;  2JS5 A;  4JYY A;  4Q6G A;  1EN4 A;  1PNL A;  3TET A;  3RYH B;  5CA3 A;  1BS3 A;  2P90 A;  4EP7 A;  3NYB A;  2W6J G;  4KLU A;  2XND G;  3THO A;  4B3S O;  5LP6 B;  4DR2 O;  3OV7 A;  3C3S A;  2ZH5 A;  4JI3 O;  1KMI Z;  1F51 A;  2B5U A;  5H5N A;  1ORQ C;  1NR1 A;  3RH6 A;  2B1I A;  4LC1 A;  4PHA A;  4IQV A;  5J2K A;  3QO7 A;  1FYJ A;  4U3F H;  1Y67 A;  3ABM C;  2XAH A;  4O4H B;  4J10 A;  4JI4 B;  1E1Q G;  4IT5 A;  1YTF B;  9ICL A;  4DV7 B;  3ZMS A;  1ZQY A;  5KA6 A;  2M2V A;  1RPL A;  5BMV A;  2NRK A;  3ZHU A;  3CYO A;  4TUR A;  5LOV B;  4R8C A;  3AU2 A;  5CB4 A;  2YXL A;  4QPJ A;  1CEZ A;  3D36 C;  4KLM A;  1BHB A;  4CH3 A;  3LNM B;  4BR6 A;  4WCE V;  9ICF A;  4RO2 A;  2PFO A;  4I7Z B;  4RWO A;  4MW3 A;  3Q4H B;  3G6E V;  4UB6 Z;  1KBH A;  3MBY A;  4LWS B;  3H01 A;  1JPX A;  1LUW A;  1RZT A;  1Q79 A;  1TFY A;  4B3S B;  1GH6 A;  4DR2 B;  9ICJ A;  3E35 A;  1F23 A;  1D2D A;  1K3E A;  4PA4 A;  4JI3 B;  5J2U B;  1Y6X A;  1UET A;  2AXT Z;  4YMN A;  2FMS A;  5CA1 B;  5IY5 B;  4MTO A;  4MT8 A;  1QLE C;  4L87 A;  2AGA A;  3JSL A;  1XEQ A;  4I0X A;  7ICE A;  1YEW A;  4BWA A;  1NT2 B;  4MVR A;  2FMQ A;  7ICO A;  1Q90 D;  4PDV A;  3ABL C;  3OMI B;  4FLW A;  4FVM A;  3K7D A;  2DJV A;  2DMX A;  1BZK A;  3SJC C;  2EIK B;  1K4C C;  3L71 H;  2H94 A;  1V54 C;  2WLL B;  3OR7 C;  1XOU A;  5DM6 V;  2F43 G;  5HFM A;  1ZQH A;  5J0T A;  3OTO O;  2IBZ H;  1GM8 A;  3MD0 A;  3QF7 A;  5L3D A;  4GT1 A;  5J0S A;  1WP8 A;  2R72 A;  3OVS A;  1FS0 G;  2FML A;  4FO1 A;  1ZQQ A;  4R66 A;  4WBN B;  9ICI A;  1XMO B;  2HJD A;  3ASO B;  5JQG A;  4WFB V;  4NY8 A;  4ZOL A;  1NH2 D;  5JTG A;  1EM1 A;  5J0U A;  2GTA A;  1NQT A;  2PFP A;  2G38 A;  4M9G A;  1Q6H A;  3N2K B;  4GX0 A;  4YIO A;  1WPX A;  3AG1 C;  1R3J C;  2GBO A;  4AT7 A;  4JPR A;  4E8F A;  4ATB A;  2AHZ A;  1BE3 H;  1IDS A;  1R1B A;  4UD4 A;  3QTC A;  5KLV H;  2XAS A;  3FYI B;  4PDR A;  4KHP O;  5KHI A;  3OTO B;  2ATK C;  1TUB A;  2UXN A;  4RWQ A;  5D63 A;  3BRC A;  1M90 W;  3HKD B;  2VS0 A;  2HJF C;  2JGD A;  4O5K A;  5CFU A;  2EZP A;  5DBA A;  2JJ1 G;  3CCU V;  3M8A A;  1K9M W;  3STL C;  4FLU A;  3ML0 A;  3MDA A;  3JPS A;  4KB6 A;  1ZQX A;  1KP2 A;  3RVY A;  4RQ3 A;  3UO3 A;  1AR1 B;  2PXI A;  1RM1 B;  2E5L B;  1MG1 A;  3AG3 C;  3C18 A;  1BMF G;  4UCU A;  4WOY A;  2GDS A;  3K5N A;  9ICS A;  2PTM A;  2X6B A;  4PPX A;  1SQQ H;  2P6J A;  3AG2 C;  4I0U A;  3WFV A;  4LF6 O;  1I08 A;  1QR8 A;  4YMO A;  1LUV A;  4F6R B;  2BBJ A;  5EOZ A;  3LSU A;  1S77 D;  2UUC O;  3C5F A;  2D2C B;  1TVA A;  4K0K O;  4MVZ A;  4QGP A;  1GTO A;  1W0K G;  3NKU A;  4RPZ A;  1Y74 B;  4KHP B;  1Q3E A;  2ZH7 A;  1S3J A;  5GTH Z;  1JMK C;  4HZ3 A;  3FB7 C;  1LNQ A;  2UXX A;  1SF9 A;  5KMG A;  4NXM O;  4UAY A;  4OAI Z;  4GKJ O;  2BCC H;  1XL6 A;  2DR5 A;  2YXY A;  2IM9 A;  4RAI A;  4DR4 O;  2ID1 A;  2DYS C;  4JTD B;  1L8D A;  4MTG A;  4PHE A;  2ZXW C;  2BCQ A;  3OVB A;  5GW7 A;  3ZHS A;  3W7W A;  2F66 C;  5LHH A;  2Q0A A;  1OZ0 A;  2W0X A;  1ZQA A;  4X4Q A;  2B4V A;  3QVN A;  1MZE A;  4EED A;  5CA7 A;  4G2K A;  4PEL A;  1OU5 A;  1NBM G;  1G1X B;  4LF8 O;  2RCV A;  1VF6 C;  5J2C A;  3OTF A;  2ZE7 A;  3O9O A;  3AQM A;  4LF6 B;  4UBB A;  5JCO C;  3J80 N;  3AQL A;  4TUY B;  1QCE A;  2UUC B;  4I2B A;  3WB2 A;  2QE7 G;  3H1K H;  2X7R B;  2FL4 A;  3CB2 A;  2O57 A;  4NXZ A;  4GLX A;  4I5S A;  4K0K B;  3MHH C;  4WCW A;  2LQT A;  1NS1 A;  4MVU A;  4FH3 A;  4EB6 B;  4X1I B;  4LF7 B;  1YSC A;  1FD9 A;  2IH1 C;  4KUM A;  4DV0 O;  2ZM6 O;  1AI4 A;  4MTF A;  4R7C A;  1MIV A;  1IBL O;  4NXM B;  4UCO A;  4GKJ B;  5KHJ A;  5JJJ B;  4WBY A;  3ABT A;  4DR4 B;  3JAT A;  5A9G A;  4LR3 A;  1G4Y B;  4OX9 O;  1K73 W;  4DR7 O;  3D3Q A;  1PD3 A;  3SJQ C;  5J0Q A;  4JI7 B;  2P4V A;  4KLS A;  3RYC B;  2BCR A;  2HP8 A;  1ZJN A;  4UVA A;  3RYH A;  4FHP A;  5HRG A;  5HC9 A;  1GO3 F;  1WLE A;  1Q43 A;  3P3P A;  1R3K C;  1S5L Z;  2BCU A;  1K92 A;  3E8H A;  2WLN A;  4LF8 B;  5LMU O;  1NJI W;  4KLT A;  1WA8 B;  3B2E E;  1VQO V;  3CCR V;  5HRE A;  4AIL C;  1R8A A;  8ICI A;  4CH6 A;  1FJG O;  5HR9 A;  4UUJ C;  4YJ3 B;  4J7Z A;  5KAI Z;  3H1I H;  3JPR A;  1OCR B;  4K35 A;  4O68 A;  4RQ5 A;  2EUL A;  5L3B A;  4K4I A;  2KKW A;  3OMA B;  4N21 A;  3CRR A;  3WB0 A;  1WJZ A;  1UPG A;  4DV2 B;  4AT8 A;  2XTA A;  2GAF D;  3ICX A;  4WC1 A;  4QE7 A;  1SER A;  2PGG A;  4DV0 B;  1Y4M A;  2ISP A;  1IBL B;  2IHO A;  3RJI A;  4EKW A;  3K57 A;  2QWP B;  4PGX A;  4AI8 A;  4GX5 A;  4RQF A;  7ICV A;  3RWR D;  4LEW A;  3JPQ A;  3AQN A;  4JI6 O;  1KDH A;  4DR7 B;  3Q4H A;  5EC2 C;  2IU0 A;  3HB3 B;  4LWS A;  1R6K A;  2OT5 A;  1R8B A;  4O9M A;  3OE7 G;  3TFR A;  2ZE5 A;  3SPG A;  2KB1 A;  4FFK A;  4RWN A;  2NR5 A;  1OCC B;  1JJ2 U;  3LQC B;  4RPY A;  7ICF A;  4QZ8 A;  3SPH A;  5LMU B;  3ZRS A;  2Y0P A;  3RN4 A;  1F7Y A;  1R89 A;  1K33 A;  5J0R A;  5CA1 A;  3HKC A;  9ICX A;  3TCU A;  4M9L A;  1ZQV A;  3U10 A;  4I2A A;  1FJG B;  2Q9L A;  5IYZ A;  4DUY O;  5J0X A;  3E22 B;  1SZT A;  3IC7 A;  4FLT A;  1B6Q A;  5DED A;  2EIL B;  4I50 B;  4K8Z A;  2Q8V A;  1MA1 A;  1PX5 A;  2RDC A;  4LEY A;  2V1D A;  3OWG A;  3H9V A;  3BEH A;  3P30 A;  3PNC A;  2RN9 A;  2M6Y A;  3FX7 A;  4O5C A;  4X9Q A;  1H2K A;  4IL6 Z;  3I56 V;  4DV1 O;  4P2Z A;  2Y69 C;  3E86 A;  1Q8I A;  4JI6 B;  3A2F A;  1V9P A;  4IYH A;  4DV3 B;  2WAM A;  4RQ0 A;  4H13 B;  5LHG A;  1JMS A;  1WP7 A;  2HN1 A;  4LF4 O;  2EIJ C;  4G28 B;  5EIB C;  4WBN A;  1W2B U;  4PGY A;  4R50 A;  3FFQ A;  4WC6 A;  1H2M A;  4O4L B;  2O5A A;  2XAJ A;  2I9G A;  4P9O A;  4H37 A;  4UVB A;  3GWK C;  5E1A C;  1RPO A;  4X8A A;  2LGW A;  4E4E A;  4LZD A;  1GKF A;  1NTZ H;  5EBM C;  1MSW D;  5IIN A;  2H3O A;  2QM4 A;  3UPS A;  7ICU A;  3AQK A;  2VWK A;  4RQ2 A;  5J2F A;  4DUY B;  1O9G A;  2ZKO A;  3N2G B;  8ICS A;  2OCC B;  4KLQ A;  5B5E Z;  4I28 A;  5IJ0 B;  1I7F A;  3F5W C;  4K4H A;  4GXK A;  2P06 A;  4ZBM A;  4O67 A;  3JAM N;  2FB5 A;  2N04 A;  3CCQ V;  3E8F A;  3OUY B;  1R6T A;  1RSO B;  3JAW B;  4DV1 B;  1AJN A;  1ZUQ A;  2DVI A;  3HKD A;  3ERC C;  1KUQ A;  3J81 N;  4LFA O;  4B3R B;  1EFR G;  3DXR A;  4Z6D A;  1QHT A;  1NH2 B;  5J0W A;  8ICL A;  3K0G A;  1SKV A;  9ICT A;  4FFB B;  2W0F C;  4LF4 B;  3JAL B;  1I94 O;  3WFP A;  3KCX A;  5IIL A;  1J5E O;  3OW2 U;  4X4P A;  3CP1 A;  1E79 G;  1YJW V;  4RPX A;  1BSM A;  1MNG A;  4FH5 A;  4I2I A;  1GAX A;  9ICK A;  4JWM A;  4X1Y B;  3W7S A;  2ZDI A;  1RFY A;  1U97 A;  5D49 A;  2OCH A;  3JPP A;  4UCT A;  4UV9 A;  1XSP A;  4WFA V;  4DOB A;  4J41 A;  1VQ8 V;  2QWN B;  2Q7E A;  1HWY A;  3K59 A;  3I55 V;  5LGU A;  3ZRV A;  1PM9 A;  1M57 C;  1NOM A;  3B4S A;  5KX5 B;  1IVS A;  3SYA A;  5B1A B;  4DO2 A;  4F6E A;  3DTU B;  1NZ6 A;  1Y74 A;  1HDJ A;  5C93 A;  3HR0 A;  4BW5 A;  3ZS8 C;  4UFZ A; 
#chains in the Genus database with same CATH homology
 4FHY A;  4YN4 A;  3MBY A;  4KLG A;  8ICP A;  4PHP A;  4UB2 A;  4I2G A;  1RZT A;  1Q79 A;  1TFY A;  9ICJ A;  1ZQK A;  4K4G A;  4X4R A;  1ZQF A;  4AT9 B;  2DR7 A;  3UQ2 A;  1UET A;  2ZH2 A;  7ICN A;  4YMN A;  1ZQI A;  4MFA A;  2ZH8 A;  2FMS A;  4P4O A;  1XSN A;  9ICB A;  7ICE A;  1UEU A;  1KNY A;  2FMQ A;  7ICO A;  4PGQ A;  1Q78 A;  3HJ1 A;  4DO9 A;  9ICE A;  8ICT A;  8ICO A;  4QZC A;  5J2D A;  2BPG A;  1R8C A;  4F5Q A;  5DKW A;  2BPF A;  4F5P A;  4UAW A;  3RJF A;  9ICW A;  1ZQH A;  3WFR E;  5J0T A;  4E80 A;  5J2I A;  4NKT A;  4M2Y A;  4FHX A;  5CJ7 A;  5J0S A;  9ICV A;  3PMN A;  4P2H A;  3OVS A;  5J0P A;  4M5D A;  5HRB A;  3HWT A;  9ICC A;  5DDM A;  4RT2 A;  4YCX A;  9ICA A;  4WC0 A;  1ZQQ A;  4R66 A;  9ICI A;  1ZQD A;  3RJJ A;  4X4T A;  4IG8 A;  1FA0 A;  4NY8 A;  4QZ9 A;  4S3N A;  1ZQG A;  9ICG A;  4UB5 A;  5J0U A;  2PFP A;  4M9G A;  4NKU A;  5J2B A;  7ICI A;  4R64 A;  4UAZ A;  1TFW A;  4I29 A;  1MIY A;  4FHV A;  4AT7 A;  1BPB A;  5J0Y A;  4IQT A;  4E8F A;  4ATB A;  4UB3 A;  5D4B A;  5DB8 A;  3H38 A;  2ZHA A;  2ZHB A;  8ICV A;  4UD4 A;  5HHH A;  5F2V O;  5DB9 A;  8ICZ A;  3RH4 A;  2M2U A;  4AT7 B;  4WC3 A;  4RWQ A;  4O5K A;  5HRH A;  3MGI A;  5DBA A;  2DRA A;  4XRH A;  5J2J A;  5IIO A;  1ZQZ A;  1ZQU A;  2VAN A;  7ICJ A;  3MDA A;  4QZG A;  3JPS A;  8ICW A;  1ZQX A;  4NM1 A;  4RQ3 A;  4I2F A;  4RQ1 A;  4YMM A;  4RQ7 A;  2PXI A;  2W9M A;  3MGH A;  3ISD A;  9ICU A;  5HRI A;  4UB1 A;  3C5G A;  1JN3 A;  3C18 A;  1ZQC A;  4IQU A;  9ICS A;  4PPX A;  4YMO A;  5DDY A;  4RWP A;  5IIM A;  5EOZ A;  3V7L A;  4E7X A;  1ZJM A;  2DRB A;  2IHM A;  4GXI A;  4QZB A;  3C5F A;  5J29 A;  4Z6C A;  8ICM A;  3WFO A;  1TVA A;  5III A;  3JPN A;  8ICQ A;  3H3A A;  4FHW A;  4RPZ A;  3C2L A;  2ZH7 A;  5BOM A;  2DR9 A;  5J2G A;  5HRK A;  1F5A A;  1ZQL A;  4UAY A;  1UEV A;  2DR5 A;  3RJG A;  4X0A A;  4DOC A;  2ID1 A;  3JPT A;  4KLF A;  3TFS A;  5HHI A;  4PHE A;  4MF2 A;  3OVB A;  2BCQ A;  4XQ8 A;  2O1P A;  3ISB A;  2DR8 A;  1XSL A;  3C2M A;  3HW8 A;  4NLZ A;  2ZH6 A;  8ICF A;  1ZQA A;  4X4Q A;  4RT3 A;  4NM2 A;  5CA7 A;  4KLD A;  7ICG A;  7ICM A;  1OU5 A;  8ICC A;  4M9H A;  3C66 A;  5J2C A;  4Z6F A;  4QZI A;  1BPY A;  3AQM A;  4UBB A;  4P4P A;  3AQL A;  4I2B A;  3K75 D;  3H39 A;  4UBC A;  4NXZ A;  4WCW A;  8ICB A;  2BE3 A;  5HRL A;  4FH3 A;  4TUQ A;  3RH5 A;  8ICJ A;  4WC4 A;  4F5N A;  1BPD A;  4I2D A;  4FO6 A;  1MQ3 A;  1MIV A;  4MF8 A;  4X0B A;  1ZQS A;  4X4S A;  2ISO A;  4WBY A;  3HJ4 A;  3HX0 A;  3OUY A;  8ICA A;  5J0Q A;  3JPO A;  4LVS A;  4QZH A;  4KLS A;  7ICT A;  1V4A A;  2BCR A;  1ZJN A;  4FHP A;  5HRG A;  5HC9 A;  4X4N A;  1ZQB A;  1TV9 A;  1HUZ A;  4QZE A;  4KLH A;  5IIK A;  2BCU A;  8ICK A;  4ATB B;  5J2A A;  3UXP A;  9ICP A;  4I2H A;  4KLT A;  5IIJ A;  5HRE A;  1R8A A;  8ICI A;  3RJH A;  4M04 A;  1HUO A;  3RJE A;  5HR9 A;  4TUP A;  2GWS A;  4UB4 A;  4R63 A;  2RFF A;  3JPR A;  8ICG A;  4RQ5 A;  4K4I A;  4O5E A;  3UXN A;  7ICP A;  5D46 A;  4AT8 A;  4WC1 A;  4JWN A;  4M0A A;  4LZG A;  4M9J A;  8ICU A;  2M2T A;  4UD5 A;  1BPX A;  4QZD A;  2ISP A;  3RJI A;  2Q66 A;  1VJ7 A;  4PHD A;  3LK9 A;  4KLO A;  4XA5 A;  4PGX A;  7ICV A;  5DB7 A;  3JPQ A;  4NLN A;  3AQN A;  2BPC A;  1KDH A;  2HHP A;  4F5R A;  1ZQO A;  4AT8 B;  4NLK A;  4P4M A;  8ICN A;  5CB1 A;  4M47 A;  1BPE A;  2PFQ A;  7ICS A;  3H37 A;  1R8B A;  4LT6 A;  7ICR A;  4O9M A;  8ICE A;  3JYY A;  3TFR A;  4X4O A;  4AT9 A;  3JZ0 A;  4RWN A;  5TZV A;  3LQC B;  4RPY A;  7ICF A;  4QZ8 A;  5CHG A;  1R89 A;  5J0R A;  4DOA A;  5CR0 A;  2ZH4 A;  1WOT A;  4X4U A;  9ICX A;  3C2K A;  4M9L A;  4RQ6 A;  1ZQV A;  3WFQ E;  3B0Y A;  9ICH A;  4I2A A;  4I2J A;  9ICM A;  2P66 A;  5J0X A;  3UQ0 A;  7ICK A;  5DB6 A;  4KLE A;  4R65 A;  3ISC A;  2ZH9 A;  5DED A;  1ZQN A;  1PX5 A;  3B0X A;  3OGU A;  4WC2 A;  4X4V A;  5BPC A;  3PNC A;  9ICN A;  4XQ7 A;  3V7J A;  5DBC A;  4XUS A;  4O5C A;  1JAJ A;  1NO5 A;  4GXJ A;  1BPZ A;  1ZQE A;  8ICX A;  4X5V A;  4EBK A;  7ICQ A;  1ZQJ A;  8ICH A;  5CP2 A;  4RQ0 A;  3AU6 A;  4MFC A;  1JMS A;  8ICR A;  5J2H A;  3PML A;  4MFF A;  4PGY A;  2FMP A;  7ICH A;  4I27 A;  4I2E A;  4WC6 A;  3OVA A;  2ZH3 A;  2O5A A;  7ICL A;  2I9G A;  8ICY A;  3UPQ A;  5DBB A;  1ZQM A;  2BCV A;  2PBE A;  2ZH1 A;  4LZD A;  1MQ2 A;  5IIN A;  2PFN A;  3V7K A;  4KLL A;  3UPS A;  7ICU A;  4M9N A;  9ICR A;  4F5O A;  3AQK A;  5CWR A;  4RQ2 A;  1VFG A;  5J2F A;  4RQ4 A;  3MDC A;  4IQW A;  8ICS A;  4KLQ A;  5J2E A;  4I28 A;  4K4H A;  2BCS A;  3AUO A;  4GXK A;  1ZQT A;  1YLQ A;  1ZQW A;  5J0O A;  3OUY B;  1JQR A;  4EBJ A;  4PH5 A;  1MIW A;  4KLI A;  5DEC A;  4QZA A;  2DVI A;  4EP7 A;  3NYB A;  9ICO A;  4KLU A;  4Z6E A;  3OV7 A;  3UXO A;  2ZH5 A;  4I2C A;  4KLJ A;  4Z6D A;  5J0W A;  8ICL A;  9ICT A;  3WFP A;  3RH6 A;  3L9D A;  4PHA A;  4WBZ A;  4IQV A;  5J2K A;  5IIL A;  4YD1 A;  3V72 A;  4X4P A;  4WC5 A;  4RPX A;  5HRD A;  4FH5 A;  9ICL A;  4I2I A;  1ZQY A;  4YD2 A;  3WFS C;  2M2V A;  1RPL A;  9ICK A;  4WC7 A;  4JWM A;  2NRK A;  4TUR A;  1KEJ A;  9ICQ A;  4TUS A;  4QZF A;  5D49 A;  3JPP A;  3AU2 A;  1ZQR A;  3RJK A;  2M2W A;  1XSP A;  4DOB A;  5HRF A;  4KLM A;  1ZQP A;  5BOL A;  1NOM A;  9ICF A;  3GDX A;  2PFO A;  4RWO A;  4RQ8 A;  3HIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...