1VFGA

Crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
342
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETVEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (75-MER)
publication title Structural basis for template-independent RNA polymerization.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 104
structure length 342
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 1vfgA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1vfgA01
5DB6A 1UETA 2ZH3A 8ICAA 2ID1A 3C5FA 3K75D 4O5EA 4UB5A 5IINA 1ZQCA 8ICIA 4RQ3A 5DB9A 4AT7A 5J2HA 2PFOA 5BPCA 4RWPA 5IILA 1ZQNA 2DR7A 4JWNA 3AQNA 4UAWA 4UB3A 2ZHAA 4WCWA 4LVSA 4PHAA 5CHGA 4K4GA 2DR9A 9ICRA 3C5GA 1JQRA 1MIVA 4X4OA 3JPNA 1ZQJA 4QZIA 3V72A 1JAJA 5CWRA 8ICQA 5J2EA 5J2IA 4NM1A 4TUPA 3C2KA 3RH5A 4I2CA 1F5AA 3JPSA 4AT7B 5J2KA 1BPDA 5IIOA 1HUOA 9ICHA 5IIIA 4X4QA 5CB1A 9ICEA 4O9MA 3ISCA 7ICNA 3AQKA 3UQ0A 4M5DA 7ICMA 1ZQVA 5BOLA 4WC0A 4RWOA 2O5AA 5CA7A 3HIYA 9ICCA 3H38A 3LK9A 1BPEA 1V4AA 2ZH5A 3RJJA 4AT9A 2DRBA 5J2CA 4I2BA 4IQTA 1KDHA 9ICLA 2HHPA 1KEJA 2I9GA 3OV7A 4KLQA 5HRHA 1ZQZA 2FMSA 4I29A 4R66A 3AU2A 2FMPA 8ICGA 4RQ4A 2DRAA 3H3AA 5IIJA 4TUQA 1TFYA 4X4SA 3UPSA 7ICPA 1VJ7A 3RJGA 1ZQIA 1BPXA 4QZ8A 1BPBA 3WFPA 4I27A 3JPRA 4KLIA 4M9LA 4E7XA 4P4PA 3UXPA 4UAYA 1ZQQA 4KLMA 2PBEA 1ZQOA 4QZHA 4E8FA 7ICTA 2ZH7A 3OVBA 4XRHA 5J0OA 3PMLA 3UXOA 4QZCA 4X4RA 4RQ1A 5J2GA 5J0QA 5HHIA 3B0YA 4NKTA 5D4BA 3MGIA 5DB7A 4NLZA 5DBCA 7ICSA 1ZQBA 9ICXA 1UEVA 8ICPA 1NOMA 5CR0A 7ICRA 4O5KA 4PHPA 4X4UA 3JZ0A 4KLDA 3JYYA 3MDCA 4XA5A 4M9HA 2ZH4A 4RQ2A 1UEUA 3WFRE 3L9DA 4IQVA 4S3NA 1MQ2A 9ICJA 5BOMA 9ICFA 5DDMA 1ZQLA 4FHWA 3C18A 3OGUA 4I2DA 4RQ0A 3NYBA 5HR9A 4RQ7A 5DB8A 4P4MA 4NLNA 5DDYA 2BCVA 4IQWA 4LZDA 4RWNA 2O1PA 1FA0A 1ZQHA 4I2EA 4KLGA 4IG8A 4MF8A 4M47A 1RZTA 2BCSA 4MFAA 4M2YA 5D46A 9ICNA 1ZQGA 8ICJA 4FH5A 4RQ5A 4KLEA 1TFWA 8ICKA 4EBJA 3OUYA 4PGYA 3B0XA 4PHDA 4KLTA 5J0WA 5IIMA 2ISPA 3OVSA 4NLKA 2PXIA 3UPQA 4R64A 4DOCA 5D49A 4X0BA 4TUSA 4UBBA 9ICBA 3MGHA 1BPYA 5HRDA 3MBYA 1ZQMA 2M2VA 4RQ8A 4E80A 2DR5A 4UD4A 2IHMA 4O5CA 4DOAA 4QZGA 7ICKA 5CP2A 3AU6A 8ICMA 4RPXA 4AT8A 3JPOA 1BPZA 7ICQA 1MIYA 3RH6A 5HRGA 4RT3A 4RPYA 3OUYB 2FMQA 3RJKA 9ICAA 4YCXA 5HHHA 1R8AA 4I2HA 4MF2A 5TZVA 2BPCA 1R89A 4WC2A 4X4VA 4YMNA 3ISBA 4Z6FA 3PNCA 4GXIA 3UXNA 4JWMA 4I2GA 1ZQWA 3V7LA 5HC9A 2ZH6A 4F5PA 4X4PA 4QZFA 4EBKA 3C66A 3JPPA 8ICVA 4AT8B 1YLQA 2ZH2A 5J2FA 4YN4A 4KLSA 7ICFA 1Q78A 2PFQA 4WC6A 4QZAA 5J0XA 4NY8A 4PGXA 2PFNA 9ICKA 2DVIA 1NO5A 4UD5A 1ZQYA 3C2LA 9ICOA 8ICXA 2Q66A 7ICUA 3C2MA 5HRIA 9ICIA 3AUOA 3HJ1A 4FHYA 5J2AA 1ZQRA 4F5OA 4IQUA 4PGQA 8ICWA 3MDAA 8ICHA 4WBZA 2VANA 4F5RA 5DBAA 2GWSA 1OU5A 1ZQEA 4K4HA 7ICLA 4QZDA 3GDXA 8ICFA 4F5NA 4DO9A 7ICIA 4X5VA 2PFPA 4FHPA 9ICGA 3H39A 4M0AA 2ZH1A 5HREA 4PH5A 3V7JA 4UB4A 9ICTA 4PHEA 4UAZA 3V7KA 2DR8A 4RWQA 4KLOA 4Z6CA 4RQ6A 1ZJNA 4I2AA 4F5QA 3TFSA 3RJEA 2NRKA 4QZBA 5J2JA 7ICOA 1R8BA 7ICGA 4GXJA 8ICCA 1VFGA 5DECA 1RPLA 4FH3A 3ISDA 2ZH8A 4KLLA 4KLFA 4P4OA 1HUZA 7ICVA 4WC3A 5J0PA 1PX5A 4RT2A 2BCUA 3RJFA 2ISOA 1Q79A 8ICNA 4UB2A 1XSNA 1ZQPA 5F2VO 4I2JA 4QZEA 1WOTA 2W9MA 4PPXA 4LT6A 5J29A 2ZH9A 5J0TA 3H37A 9ICMA 5J2DA 4KLHA 5J0RA 4EP7A 4M9JA 9ICPA 4MFCA 8ICUA 4NXZA 4R65A 4WC5A 3UQ2A 4FHXA 1ZQTA 9ICWA 4WC1A 4LZGA 3HW8A 8ICRA 1XSPA 5IIKA 5HRLA 2RFFA 3RJHA 1MIWA 5J2BA 3JPTA 3RH4A 2ZHBA 3AQMA 9ICUA 4R63A 1JN3A 9ICQA 4KLJA 4UB1A 4I2FA 4YD1A 4ATBA 9ICSA 3RJIA 8ICEA 4X0AA 4YD2A 3WFOA 5HRFA 9ICVA 5J0YA 4FO6A 8ICOA 2BPGA 8ICBA 2BPFA 4DOBA 3OVAA 5DBBA 1ZQUA 4M9GA 1TVAA 3HJ4A 4UBCA 2BCQA 4XQ7A 1ZQXA 4X4TA 4KLUA 4RPZA 5DKWA 1JMSA 5EOZA 8ICZA 8ICTA 4P2HA 4NKUA 1MQ3A 1TV9A 2P66A 1ZQDA 5J0UA 3WFQE 4WBYA 4ATBB 7ICEA 1ZQFA 2M2WA 4XUSA 4YMMA 5CJ7A 3JPQA 5DEDA 4MFFA 1ZQKA 8ICSA 5J0SA 3AQLA 4AT9B 4M04A 3HWTA 8ICYA 1KNYA 4I28A 1ZQSA 8ICLA 4M9NA 3PMNA 3HX0A 3WFSC 3LQCB 4GXKA 1XSLA 1ZQAA 4TURA 2BE3A 1R8CA 4Z6DA 3TFRA 2BCRA 5HRBA 4XQ8A 4WC7A 2M2TA 1ZJMA 4X4NA 7ICJA 4I2IA 2M2UA 4QZ9A 4K4IA 7ICHA 4FHVA 4NM2A 4Z6EA 4WC4A 5HRKA 4YMOA
chains in the Genus database with same CATH superfamily
5DB6A 1UETA 2ZH3A 8ICAA 2ID1A 3C5FA 3K75D 4O5EA 3JCFA 4UB5A 5IINA 1ZQCA 8ICIA 4RQ3A 5DB9A 4AT7A 2HN1A 5J2HA 2PFOA 5BPCA 4RWPA 5IILA 1ZQNA 4K97A 2DR7A 4JWNA 3AQNA 4UAWA 4UB3A 3NVOA 2ZHAA 4WCWA 4LVSA 4PHAA 2GAFD 5CHGA 4K4GA 2DR9A 9ICRA 3C5GA 1JQRA 1MIVA 4X4OA 4K9BA 3JPNA 1ZQJA 4QZIA 3V72A 1JAJA 5CWRA 8ICQA 5J2EA 5J2IA 4NM1A 4TUPA 3C2KA 3RH5A 4I2CA 1F5AA 5B3QA 4AT7B 5J2KA 3JPSA 3ERCC 1BPDA 5IIOA 1HUOA 9ICHA 5IIIA 4X4QA 5CB1A 4WOYA 9ICEA 4O9MA 3ISCA 7ICNA 3AQKA 3UQ0A 4M5DA 4EEBA 7ICMA 1ZQVA 5BOLA 4WC0A 4RWOA 2O5AA 5CA7A 4LEZA 3HIYA 9ICCA 3H38A 3LK9A 4NXTA 1BPEA 4O69A 1V4AA 4N7RA 4NXUA 2ZH5A 4AT9A 3RJJA 4K99A 2DRBA 5J2CA 4EGWA 4I2BA 4IQTA 1KDHA 2B4VA 9ICLA 2HHPA 1KEJA 2I9GA 3OV7A 4KLQA 5HRHA 1ZQZA 2FMSA 2BBJA 4R66A 3AU2A 2FMPA 4I29A 8ICGA 4RQ4A 4OAFA 2DRAA 3H3AA 5IIJA 4TUQA 1TFYA 4X4SA 3UPSA 7ICPA 4WQKA 4LEVA 5D61A 1VJ7A 5CFTA 3RJGA 1ZQIA 4OAIZ 4OAGA 3ER8C 1BPXA 4QZ8A 1BPBA 3WFPA 4FO1A 4I27A 4O6AA 3JPRA 4KLIA 4M9LA 4E7XA 4P4PA 3UXPA 4UAYA 1ZQQA 4KLMA 2PBEA 1ZQOA 4QZHA 4E8FA 7ICTA 2ZH7A 3OVBA 4XRHA 5J0OA 3PMLA 3UXOA 4QZCA 4X4RA 4RQ1A 5J2GA 5J0QA 5HHIA 3B0YA 4NKTA 5D4BA 3MGIA 5DB7A 4NLZA 5DBCA 7ICSA 1ZQBA 9ICXA 1UEVA 8ICPA 1NOMA 4JLXA 5CR0A 7ICRA 2BBHA 4O5KA 4PHPA 4KM5A 4X4UA 3JZ0A 4KLDA 3JYYA 3MDCA 4XA5A 4M9HA 2ZH4A 4RQ2A 1UEUA 3WFRE 3L9DA 4IQVA 4S3NA 1MQ2A 9ICJA 5BOMA 4K8VA 9ICFA 5DDMA 1ZQLA 4FHWA 3C18A 3OGUA 4I2DA 4RQ0A 4I0UA 3NYBA 5D63A 5HR9A 4RQ7A 5DB8A 4P4MA 4NLNA 5DDYA 5CFUA 2BCVA 4IQWA 4LZDA 4RWNA 2O1PA 1FA0A 4K96A 1ZQHA 4I2EA 4KLGA 4IG8A 4MF8A 4M47A 1RZTA 2BCSA 4MFAA 4M2YA 4O67A 5D46A 9ICNA 1ZQGA 8ICJA 4FH5A 4RQ5A 4KLEA 1TFWA 8ICKA 4O68A 4EBJA 3OUYA 4PGYA 3B0XA 4PHDA 4KLTA 5J0WA 5IIMA 2ISPA 3OVSA 4OAHA 2PXIA 3UPQA 4NXVA 4NLKA 4R64A 4DOCA 5D49A 4X0BA 4TUSA 4UBBA 9ICBA 3MGHA 1BPYA 5HRDA 3MBYA 1ZQMA 2M2VA 4RQ8A 4E80A 2DR5A 4UD4A 2IHMA 4O5CA 3OWGA 4DOAA 4QZGA 7ICKA 5CP2A 3AU6A 8ICMA 4RPXA 4AT8A 3JPOA 1BPZA 7ICQA 1MIYA 3RH6A 5HRGA 4RT3A 4RPYA 3OUYB 5CFSA 4HX0A 2FMQA 3RJKA 9ICAA 4YCXA 5HHHA 1R8AA 4I2HA 4MF2A 5TZVA 4JLZA 2BPCA 1R89A 4WC2A 4NXWA 4X4VA 4YMNA 3ISBA 4Z6FA 3PNCA 4GXIA 3UXNA 4K9AA 4JWMA 4I2GA 1ZQWA 3V7LA 5HC9A 2ZH6A 4F5PA 4X4PA 4QZFA 4EBKA 3C66A 3JPPA 8ICVA 4AT8B 1YLQA 2FCLA 2ZH2A 5J2FA 4YN4A 4KLSA 2B51A 1Q78A 7ICFA 2GA9D 2PFQA 5JTGA 4WC6A 4QZAA 5J0XA 4NY8A 4PGXA 2PFNA 9ICKA 2DVIA 1NO5A 4UD5A 1ZQYA 3C2LA 3PHZA 9ICOA 8ICXA 2Q66A 3NWIA 7ICUA 3C2MA 5HRIA 9ICIA 3AUOA 3HJ1A 3K7DA 4FHYA 5J2AA 1ZQRA 2HN2A 4F5OA 4IQUA 4PGQA 3ER9B 8ICWA 3MDAA 8ICHA 4WBZA 2VANA 4F5RA 5DBAA 2IUBA 2GWSA 1OU5A 1ZQEA 4K4HA 7ICLA 4QZDA 3GDXA 8ICFA 4F5NA 4DO9A 7ICIA 4X5VA 2PFPA 2IHOA 4FHPA 9ICGA 4NXXA 5B3PA 3H39A 4M0AA 4EV6A 2ZH1A 5HREA 4PH5A 3V7JA 4UB4A 9ICTA 4PHEA 4UAZA 3V7KA 2DR8A 4RWQA 4KLOA 4Z6CA 4RQ6A 1ZJNA 4I2AA 4F5QA 3TFSA 3RJEA 2NRKA 4QZBA 4XJEA 5J2JA 7ICOA 1R8BA 7ICGA 4GXJA 8ICCA 1VFGA 5DECA 1RPLA 4FH3A 3ISDA 2ZH8A 4LEYA 4KLLA 4KLFA 4MKPA 4P4OA 1HUZA 5D62A 7ICVA 4WC3A 5J0PA 1PX5A 4RT2A 2BCUA 3RJFA 2ISOA 1Q79A 8ICNA 4UB2A 3EF2A 1XSNA 1ZQPA 5F2VO 4I2JA 4QZEA 1WOTA 2W9MA 4PPXA 4LT6A 5J29A 2ZH9A 5J0TA 3H37A 2EWRA 9ICMA 5J2DA 4KLHA 5J0RA 4EP7A 4M9JA 9ICPA 3NKUA 4MFCA 8ICUA 4NXZA 4WC5A 4R65A 3UQ2A 4FHXA 1ZQTA 9ICWA 4WC1A 4LZGA 3HW8A 8ICRA 1XSPA 5IIKA 5HRLA 2RFFA 3RJHA 1MIWA 5J2BA 3JPTA 3RH4A 2ZHBA 3AQMA 9ICUA 4R63A 1JN3A 9ICQA 4KLJA 4UB1A 4I2FA 4YD1A 4ATBA 9ICSA 3RJIA 8ICEA 4X0AA 4YD2A 3WFOA 5HRFA 9ICVA 5J0YA 4FO6A 8ICOA 2BPGA 8ICBA 4EEDA 2BPFA 4DOBA 2B56A 5DBBA 3OVAA 1ZQUA 4M9GA 1TVAA 3HJ4A 4UBCA 4K98A 2BCQA 4XQ7A 4LEWA 1ZQXA 4X4TA 4KLUA 5CHEA 4RPZA 5DKWA 1JMSA 5EOZA 8ICZA 8ICTA 4P2HA 4NKUA 1MQ3A 1TV9A 2P66A 1ZQDA 3MCRA 5J0UA 3WFQE 4WBYA 4ATBB 7ICEA 1ZQFA 3CK6A 2M2WA 4XUSA 4YMMA 5CJ7A 3JPQA 5DEDA 4MFFA 1ZQKA 8ICSA 5J0SA 4KB6A 3AQLA 4AT9B 4M04A 3HWTA 8ICYA 1KNYA 4I28A 1ZQSA 8ICLA 4M9NA 3PMNA 3HX0A 3WFSC 3LQCB 4WQLA 4GXKA 1XSLA 1ZQAA 4TURA 4WH5A 2BE3A 1R8CA 4Z6DA 3TFRA 2BCRA 5HRBA 4XQ8A 4WC7A 2M2TA 1ZJMA 4X4NA 7ICJA 4I2IA 2M2UA 4QZ9A 4K4IA 7ICHA 4FHVA 4NM2A 4Z6EA 1GPJA 4WC4A 5HRKA 4YMOA
chains in the Genus database with same CATH topology
5DB6A 1UETA 2ZH3A 8ICAA 2ID1A 3C5FA 3K75D 4O5EA 4UB5A 5IINA 1ZQCA 8ICIA 4RQ3A 5DB9A 4AT7A 5J2HA 2PFOA 5BPCA 4RWPA 5IILA 1ZQNA 2DR7A 4JWNA 3AQNA 4UAWA 4UB3A 2ZHAA 4WCWA 4LVSA 4PHAA 5CHGA 4K4GA 2DR9A 9ICRA 3C5GA 1JQRA 1MIVA 4X4OA 3JPNA 1ZQJA 4QZIA 3V72A 1JAJA 5CWRA 8ICQA 5J2EA 5J2IA 4NM1A 4TUPA 3C2KA 3RH5A 4I2CA 1F5AA 3JPSA 4AT7B 5J2KA 1BPDA 5IIOA 1HUOA 9ICHA 5IIIA 4X4QA 5CB1A 9ICEA 4O9MA 3ISCA 7ICNA 3AQKA 3UQ0A 4M5DA 7ICMA 1ZQVA 5BOLA 4WC0A 4RWOA 2O5AA 5CA7A 3HIYA 9ICCA 3H38A 3LK9A 1BPEA 1V4AA 2ZH5A 3RJJA 4AT9A 2DRBA 5J2CA 4I2BA 4IQTA 1KDHA 9ICLA 2HHPA 1KEJA 2I9GA 3OV7A 4KLQA 5HRHA 1ZQZA 2FMSA 4I29A 4R66A 3AU2A 2FMPA 8ICGA 4RQ4A 2DRAA 3H3AA 5IIJA 4TUQA 1TFYA 4X4SA 3UPSA 7ICPA 1VJ7A 3RJGA 1ZQIA 1BPXA 4QZ8A 1BPBA 3WFPA 4I27A 3JPRA 4KLIA 4M9LA 4E7XA 4P4PA 3UXPA 4UAYA 1ZQQA 4KLMA 2PBEA 1ZQOA 4QZHA 4E8FA 7ICTA 2ZH7A 3OVBA 4XRHA 5J0OA 3PMLA 3UXOA 4QZCA 4X4RA 4RQ1A 5J2GA 5J0QA 5HHIA 3B0YA 4NKTA 5D4BA 3MGIA 5DB7A 4NLZA 5DBCA 7ICSA 1ZQBA 9ICXA 1UEVA 8ICPA 1NOMA 5CR0A 7ICRA 4O5KA 4PHPA 4X4UA 3JZ0A 4KLDA 3JYYA 3MDCA 4XA5A 4M9HA 2ZH4A 4RQ2A 1UEUA 3WFRE 3L9DA 4IQVA 4S3NA 1MQ2A 9ICJA 5BOMA 9ICFA 5DDMA 1ZQLA 4FHWA 3C18A 3OGUA 4I2DA 4RQ0A 3NYBA 5HR9A 4RQ7A 5DB8A 4P4MA 4NLNA 5DDYA 2BCVA 4IQWA 4LZDA 4RWNA 2O1PA 1FA0A 1ZQHA 4I2EA 4KLGA 4IG8A 4MF8A 4M47A 1RZTA 2BCSA 4MFAA 4M2YA 5D46A 9ICNA 1ZQGA 8ICJA 4FH5A 4RQ5A 4KLEA 1TFWA 8ICKA 4EBJA 3OUYA 4PGYA 3B0XA 4PHDA 4KLTA 5J0WA 5IIMA 2ISPA 3OVSA 4NLKA 2PXIA 3UPQA 4R64A 4DOCA 5D49A 4X0BA 4TUSA 4UBBA 9ICBA 3MGHA 1BPYA 5HRDA 3MBYA 1ZQMA 2M2VA 4RQ8A 4E80A 2DR5A 4UD4A 2IHMA 4O5CA 4DOAA 4QZGA 7ICKA 5CP2A 3AU6A 8ICMA 4RPXA 4AT8A 3JPOA 1BPZA 7ICQA 1MIYA 3RH6A 5HRGA 4RT3A 4RPYA 3OUYB 2FMQA 3RJKA 9ICAA 4YCXA 5HHHA 1R8AA 4I2HA 4MF2A 5TZVA 2BPCA 1R89A 4WC2A 4X4VA 4YMNA 3ISBA 4Z6FA 3PNCA 4GXIA 3UXNA 4JWMA 4I2GA 1ZQWA 3V7LA 5HC9A 2ZH6A 4F5PA 4X4PA 4QZFA 4EBKA 3C66A 3JPPA 8ICVA 4AT8B 1YLQA 2ZH2A 5J2FA 4YN4A 4KLSA 7ICFA 1Q78A 2PFQA 4WC6A 4QZAA 5J0XA 4NY8A 4PGXA 2PFNA 9ICKA 2DVIA 1NO5A 4UD5A 1ZQYA 3C2LA 9ICOA 8ICXA 2Q66A 7ICUA 3C2MA 5HRIA 9ICIA 3AUOA 3HJ1A 4FHYA 5J2AA 1ZQRA 4F5OA 4IQUA 4PGQA 8ICWA 3MDAA 8ICHA 4WBZA 2VANA 4F5RA 5DBAA 2GWSA 1OU5A 1ZQEA 4K4HA 7ICLA 4QZDA 3GDXA 8ICFA 4F5NA 4DO9A 7ICIA 4X5VA 2PFPA 4FHPA 9ICGA 3H39A 4M0AA 2ZH1A 5HREA 4PH5A 3V7JA 4UB4A 9ICTA 4PHEA 4UAZA 3V7KA 2DR8A 4RWQA 4KLOA 4Z6CA 4RQ6A 1ZJNA 4I2AA 4F5QA 3TFSA 3RJEA 2NRKA 4QZBA 5J2JA 7ICOA 1R8BA 7ICGA 4GXJA 8ICCA 1VFGA 5DECA 1RPLA 4FH3A 3ISDA 2ZH8A 4KLLA 4KLFA 4P4OA 1HUZA 7ICVA 4WC3A 5J0PA 1PX5A 4RT2A 2BCUA 3RJFA 2ISOA 1Q79A 8ICNA 4UB2A 1XSNA 1ZQPA 5F2VO 4I2JA 4QZEA 1WOTA 2W9MA 4PPXA 4LT6A 5J29A 2ZH9A 5J0TA 3H37A 9ICMA 5J2DA 4KLHA 5J0RA 4EP7A 4M9JA 9ICPA 4MFCA 8ICUA 4NXZA 4R65A 4WC5A 3UQ2A 4FHXA 1ZQTA 9ICWA 4WC1A 4LZGA 3HW8A 8ICRA 1XSPA 5IIKA 5HRLA 2RFFA 3RJHA 1MIWA 5J2BA 3JPTA 3RH4A 2ZHBA 3AQMA 9ICUA 4R63A 1JN3A 9ICQA 4KLJA 4UB1A 4I2FA 4YD1A 4ATBA 9ICSA 3RJIA 8ICEA 4X0AA 4YD2A 3WFOA 5HRFA 9ICVA 5J0YA 4FO6A 8ICOA 2BPGA 8ICBA 2BPFA 4DOBA 3OVAA 5DBBA 1ZQUA 4M9GA 1TVAA 3HJ4A 4UBCA 2BCQA 4XQ7A 1ZQXA 4X4TA 4KLUA 4RPZA 5DKWA 1JMSA 5EOZA 8ICZA 8ICTA 4P2HA 4NKUA 1MQ3A 1TV9A 2P66A 1ZQDA 5J0UA 3WFQE 4WBYA 4ATBB 7ICEA 1ZQFA 2M2WA 4XUSA 4YMMA 5CJ7A 3JPQA 5DEDA 4MFFA 1ZQKA 8ICSA 5J0SA 3AQLA 4AT9B 4M04A 3HWTA 8ICYA 1KNYA 4I28A 1ZQSA 8ICLA 4M9NA 3PMNA 3HX0A 3WFSC 3LQCB 4GXKA 1XSLA 1ZQAA 4TURA 2BE3A 1R8CA 4Z6DA 3TFRA 2BCRA 5HRBA 4XQ8A 4WC7A 2M2TA 1ZJMA 4X4NA 7ICJA 4I2IA 2M2UA 4QZ9A 4K4IA 7ICHA 4FHVA 4NM2A 4Z6EA 4WC4A 5HRKA 4YMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DB6 A;  1UET A;  2ZH3 A;  8ICA A;  2ID1 A;  3C5F A;  3K75 D;  4O5E A;  4UB5 A;  5IIN A;  1ZQC A;  8ICI A;  4RQ3 A;  5DB9 A;  4AT7 A;  5J2H A;  2PFO A;  5BPC A;  4RWP A;  5IIL A;  1ZQN A;  2DR7 A;  4JWN A;  3AQN A;  4UAW A;  4UB3 A;  2ZHA A;  4WCW A;  4LVS A;  4PHA A;  5CHG A;  4K4G A;  2DR9 A;  9ICR A;  3C5G A;  1JQR A;  1MIV A;  4X4O A;  3JPN A;  1ZQJ A;  4QZI A;  3V72 A;  1JAJ A;  5CWR A;  8ICQ A;  5J2E A;  5J2I A;  4NM1 A;  4TUP A;  3C2K A;  3RH5 A;  4I2C A;  1F5A A;  3JPS A;  4AT7 B;  5J2K A;  1BPD A;  5IIO A;  1HUO A;  9ICH A;  5III A;  4X4Q A;  5CB1 A;  9ICE A;  4O9M A;  3ISC A;  7ICN A;  3AQK A;  3UQ0 A;  4M5D A;  7ICM A;  1ZQV A;  5BOL A;  4WC0 A;  4RWO A;  2O5A A;  5CA7 A;  3HIY A;  9ICC A;  3H38 A;  3LK9 A;  1BPE A;  1V4A A;  2ZH5 A;  3RJJ A;  4AT9 A;  2DRB A;  5J2C A;  4I2B A;  4IQT A;  1KDH A;  9ICL A;  2HHP A;  1KEJ A;  2I9G A;  3OV7 A;  4KLQ A;  5HRH A;  1ZQZ A;  2FMS A;  4I29 A;  4R66 A;  3AU2 A;  2FMP A;  8ICG A;  4RQ4 A;  2DRA A;  3H3A A;  5IIJ A;  4TUQ A;  1TFY A;  4X4S A;  3UPS A;  7ICP A;  1VJ7 A;  3RJG A;  1ZQI A;  1BPX A;  4QZ8 A;  1BPB A;  3WFP A;  4I27 A;  3JPR A;  4KLI A;  4M9L A;  4E7X A;  4P4P A;  3UXP A;  4UAY A;  1ZQQ A;  4KLM A;  2PBE A;  1ZQO A;  4QZH A;  4E8F A;  7ICT A;  2ZH7 A;  3OVB A;  4XRH A;  5J0O A;  3PML A;  3UXO A;  4QZC A;  4X4R A;  4RQ1 A;  5J2G A;  5J0Q A;  5HHI A;  3B0Y A;  4NKT A;  5D4B A;  3MGI A;  5DB7 A;  4NLZ A;  5DBC A;  7ICS A;  1ZQB A;  9ICX A;  1UEV A;  8ICP A;  1NOM A;  5CR0 A;  7ICR A;  4O5K A;  4PHP A;  4X4U A;  3JZ0 A;  4KLD A;  3JYY A;  3MDC A;  4XA5 A;  4M9H A;  2ZH4 A;  4RQ2 A;  1UEU A;  3WFR E;  3L9D A;  4IQV A;  4S3N A;  1MQ2 A;  9ICJ A;  5BOM A;  9ICF A;  5DDM A;  1ZQL A;  4FHW A;  3C18 A;  3OGU A;  4I2D A;  4RQ0 A;  3NYB A;  5HR9 A;  4RQ7 A;  5DB8 A;  4P4M A;  4NLN A;  5DDY A;  2BCV A;  4IQW A;  4LZD A;  4RWN A;  2O1P A;  1FA0 A;  1ZQH A;  4I2E A;  4KLG A;  4IG8 A;  4MF8 A;  4M47 A;  1RZT A;  2BCS A;  4MFA A;  4M2Y A;  5D46 A;  9ICN A;  1ZQG A;  8ICJ A;  4FH5 A;  4RQ5 A;  4KLE A;  1TFW A;  8ICK A;  4EBJ A;  3OUY A;  4PGY A;  3B0X A;  4PHD A;  4KLT A;  5J0W A;  5IIM A;  2ISP A;  3OVS A;  4NLK A;  2PXI A;  3UPQ A;  4R64 A;  4DOC A;  5D49 A;  4X0B A;  4TUS A;  4UBB A;  9ICB A;  3MGH A;  1BPY A;  5HRD A;  3MBY A;  1ZQM A;  2M2V A;  4RQ8 A;  4E80 A;  2DR5 A;  4UD4 A;  2IHM A;  4O5C A;  4DOA A;  4QZG A;  7ICK A;  5CP2 A;  3AU6 A;  8ICM A;  4RPX A;  4AT8 A;  3JPO A;  1BPZ A;  7ICQ A;  1MIY A;  3RH6 A;  5HRG A;  4RT3 A;  4RPY A;  3OUY B;  2FMQ A;  3RJK A;  9ICA A;  4YCX A;  5HHH A;  1R8A A;  4I2H A;  4MF2 A;  5TZV A;  2BPC A;  1R89 A;  4WC2 A;  4X4V A;  4YMN A;  3ISB A;  4Z6F A;  3PNC A;  4GXI A;  3UXN A;  4JWM A;  4I2G A;  1ZQW A;  3V7L A;  5HC9 A;  2ZH6 A;  4F5P A;  4X4P A;  4QZF A;  4EBK A;  3C66 A;  3JPP A;  8ICV A;  4AT8 B;  1YLQ A;  2ZH2 A;  5J2F A;  4YN4 A;  4KLS A;  7ICF A;  1Q78 A;  2PFQ A;  4WC6 A;  4QZA A;  5J0X A;  4NY8 A;  4PGX A;  2PFN A;  9ICK A;  2DVI A;  1NO5 A;  4UD5 A;  1ZQY A;  3C2L A;  9ICO A;  8ICX A;  2Q66 A;  7ICU A;  3C2M A;  5HRI A;  9ICI A;  3AUO A;  3HJ1 A;  4FHY A;  5J2A A;  1ZQR A;  4F5O A;  4IQU A;  4PGQ A;  8ICW A;  3MDA A;  8ICH A;  4WBZ A;  2VAN A;  4F5R A;  5DBA A;  2GWS A;  1OU5 A;  1ZQE A;  4K4H A;  7ICL A;  4QZD A;  3GDX A;  8ICF A;  4F5N A;  4DO9 A;  7ICI A;  4X5V A;  2PFP A;  4FHP A;  9ICG A;  3H39 A;  4M0A A;  2ZH1 A;  5HRE A;  4PH5 A;  3V7J A;  4UB4 A;  9ICT A;  4PHE A;  4UAZ A;  3V7K A;  2DR8 A;  4RWQ A;  4KLO A;  4Z6C A;  4RQ6 A;  1ZJN A;  4I2A A;  4F5Q A;  3TFS A;  3RJE A;  2NRK A;  4QZB A;  5J2J A;  7ICO A;  1R8B A;  7ICG A;  4GXJ A;  8ICC A;  1VFG A;  5DEC A;  1RPL A;  4FH3 A;  3ISD A;  2ZH8 A;  4KLL A;  4KLF A;  4P4O A;  1HUZ A;  7ICV A;  4WC3 A;  5J0P A;  1PX5 A;  4RT2 A;  2BCU A;  3RJF A;  2ISO A;  1Q79 A;  8ICN A;  4UB2 A;  1XSN A;  1ZQP A;  5F2V O;  4I2J A;  4QZE A;  1WOT A;  2W9M A;  4PPX A;  4LT6 A;  5J29 A;  2ZH9 A;  5J0T A;  3H37 A;  9ICM A;  5J2D A;  4KLH A;  5J0R A;  4EP7 A;  4M9J A;  9ICP A;  4MFC A;  8ICU A;  4NXZ A;  4R65 A;  4WC5 A;  3UQ2 A;  4FHX A;  1ZQT A;  9ICW A;  4WC1 A;  4LZG A;  3HW8 A;  8ICR A;  1XSP A;  5IIK A;  5HRL A;  2RFF A;  3RJH A;  1MIW A;  5J2B A;  3JPT A;  3RH4 A;  2ZHB A;  3AQM A;  9ICU A;  4R63 A;  1JN3 A;  9ICQ A;  4KLJ A;  4UB1 A;  4I2F A;  4YD1 A;  4ATB A;  9ICS A;  3RJI A;  8ICE A;  4X0A A;  4YD2 A;  3WFO A;  5HRF A;  9ICV A;  5J0Y A;  4FO6 A;  8ICO A;  2BPG A;  8ICB A;  2BPF A;  4DOB A;  3OVA A;  5DBB A;  1ZQU A;  4M9G A;  1TVA A;  3HJ4 A;  4UBC A;  2BCQ A;  4XQ7 A;  1ZQX A;  4X4T A;  4KLU A;  4RPZ A;  5DKW A;  1JMS A;  5EOZ A;  8ICZ A;  8ICT A;  4P2H A;  4NKU A;  1MQ3 A;  1TV9 A;  2P66 A;  1ZQD A;  5J0U A;  3WFQ E;  4WBY A;  4ATB B;  7ICE A;  1ZQF A;  2M2W A;  4XUS A;  4YMM A;  5CJ7 A;  3JPQ A;  5DED A;  4MFF A;  1ZQK A;  8ICS A;  5J0S A;  3AQL A;  4AT9 B;  4M04 A;  3HWT A;  8ICY A;  1KNY A;  4I28 A;  1ZQS A;  8ICL A;  4M9N A;  3PMN A;  3HX0 A;  3WFS C;  3LQC B;  4GXK A;  1XSL A;  1ZQA A;  4TUR A;  2BE3 A;  1R8C A;  4Z6D A;  3TFR A;  2BCR A;  5HRB A;  4XQ8 A;  4WC7 A;  2M2T A;  1ZJM A;  4X4N A;  7ICJ A;  4I2I A;  2M2U A;  4QZ9 A;  4K4I A;  7ICH A;  4FHV A;  4NM2 A;  4Z6E A;  4WC4 A;  5HRK A;  4YMO A; 
#chains in the Genus database with same CATH topology
 5DB6 A;  1UET A;  2ZH3 A;  8ICA A;  2ID1 A;  3C5F A;  3K75 D;  4O5E A;  3JCF A;  4UB5 A;  5IIN A;  1ZQC A;  8ICI A;  4RQ3 A;  5DB9 A;  4AT7 A;  2HN1 A;  5J2H A;  2PFO A;  5BPC A;  4RWP A;  5IIL A;  1ZQN A;  4K97 A;  2DR7 A;  4JWN A;  3AQN A;  4UAW A;  4UB3 A;  3NVO A;  2ZHA A;  4WCW A;  4LVS A;  4PHA A;  2GAF D;  5CHG A;  4K4G A;  2DR9 A;  9ICR A;  3C5G A;  1JQR A;  1MIV A;  4X4O A;  4K9B A;  3JPN A;  1ZQJ A;  4QZI A;  3V72 A;  1JAJ A;  5CWR A;  8ICQ A;  5J2E A;  5J2I A;  4NM1 A;  4TUP A;  3C2K A;  3RH5 A;  4I2C A;  1F5A A;  5B3Q A;  4AT7 B;  5J2K A;  3JPS A;  3ERC C;  1BPD A;  5IIO A;  1HUO A;  9ICH A;  5III A;  4X4Q A;  5CB1 A;  4WOY A;  9ICE A;  4O9M A;  3ISC A;  7ICN A;  3AQK A;  3UQ0 A;  4M5D A;  4EEB A;  7ICM A;  1ZQV A;  5BOL A;  4WC0 A;  4RWO A;  2O5A A;  5CA7 A;  4LEZ A;  3HIY A;  9ICC A;  3H38 A;  3LK9 A;  4NXT A;  1BPE A;  4O69 A;  1V4A A;  4N7R A;  4NXU A;  2ZH5 A;  4AT9 A;  3RJJ A;  4K99 A;  2DRB A;  5J2C A;  4EGW A;  4I2B A;  4IQT A;  1KDH A;  2B4V A;  9ICL A;  2HHP A;  1KEJ A;  2I9G A;  3OV7 A;  4KLQ A;  5HRH A;  1ZQZ A;  2FMS A;  2BBJ A;  4R66 A;  3AU2 A;  2FMP A;  4I29 A;  8ICG A;  4RQ4 A;  4OAF A;  2DRA A;  3H3A A;  5IIJ A;  4TUQ A;  1TFY A;  4X4S A;  3UPS A;  7ICP A;  4WQK A;  4LEV A;  5D61 A;  1VJ7 A;  5CFT A;  3RJG A;  1ZQI A;  4OAI Z;  4OAG A;  3ER8 C;  1BPX A;  4QZ8 A;  1BPB A;  3WFP A;  4FO1 A;  4I27 A;  4O6A A;  3JPR A;  4KLI A;  4M9L A;  4E7X A;  4P4P A;  3UXP A;  4UAY A;  1ZQQ A;  4KLM A;  2PBE A;  1ZQO A;  4QZH A;  4E8F A;  7ICT A;  2ZH7 A;  3OVB A;  4XRH A;  5J0O A;  3PML A;  3UXO A;  4QZC A;  4X4R A;  4RQ1 A;  5J2G A;  5J0Q A;  5HHI A;  3B0Y A;  4NKT A;  5D4B A;  3MGI A;  5DB7 A;  4NLZ A;  5DBC A;  7ICS A;  1ZQB A;  9ICX A;  1UEV A;  8ICP A;  1NOM A;  4JLX A;  5CR0 A;  7ICR A;  2BBH A;  4O5K A;  4PHP A;  4KM5 A;  4X4U A;  3JZ0 A;  4KLD A;  3JYY A;  3MDC A;  4XA5 A;  4M9H A;  2ZH4 A;  4RQ2 A;  1UEU A;  3WFR E;  3L9D A;  4IQV A;  4S3N A;  1MQ2 A;  9ICJ A;  5BOM A;  4K8V A;  9ICF A;  5DDM A;  1ZQL A;  4FHW A;  3C18 A;  3OGU A;  4I2D A;  4RQ0 A;  4I0U A;  3NYB A;  5D63 A;  5HR9 A;  4RQ7 A;  5DB8 A;  4P4M A;  4NLN A;  5DDY A;  5CFU A;  2BCV A;  4IQW A;  4LZD A;  4RWN A;  2O1P A;  1FA0 A;  4K96 A;  1ZQH A;  4I2E A;  4KLG A;  4IG8 A;  4MF8 A;  4M47 A;  1RZT A;  2BCS A;  4MFA A;  4M2Y A;  4O67 A;  5D46 A;  9ICN A;  1ZQG A;  8ICJ A;  4FH5 A;  4RQ5 A;  4KLE A;  1TFW A;  8ICK A;  4O68 A;  4EBJ A;  3OUY A;  4PGY A;  3B0X A;  4PHD A;  4KLT A;  5J0W A;  5IIM A;  2ISP A;  3OVS A;  4OAH A;  2PXI A;  3UPQ A;  4NXV A;  4NLK A;  4R64 A;  4DOC A;  5D49 A;  4X0B A;  4TUS A;  4UBB A;  9ICB A;  3MGH A;  1BPY A;  5HRD A;  3MBY A;  1ZQM A;  2M2V A;  4RQ8 A;  4E80 A;  2DR5 A;  4UD4 A;  2IHM A;  4O5C A;  3OWG A;  4DOA A;  4QZG A;  7ICK A;  5CP2 A;  3AU6 A;  8ICM A;  4RPX A;  4AT8 A;  3JPO A;  1BPZ A;  7ICQ A;  1MIY A;  3RH6 A;  5HRG A;  4RT3 A;  4RPY A;  3OUY B;  5CFS A;  4HX0 A;  2FMQ A;  3RJK A;  9ICA A;  4YCX A;  5HHH A;  1R8A A;  4I2H A;  4MF2 A;  5TZV A;  4JLZ A;  2BPC A;  1R89 A;  4WC2 A;  4NXW A;  4X4V A;  4YMN A;  3ISB A;  4Z6F A;  3PNC A;  4GXI A;  3UXN A;  4K9A A;  4JWM A;  4I2G A;  1ZQW A;  3V7L A;  5HC9 A;  2ZH6 A;  4F5P A;  4X4P A;  4QZF A;  4EBK A;  3C66 A;  3JPP A;  8ICV A;  4AT8 B;  1YLQ A;  2FCL A;  2ZH2 A;  5J2F A;  4YN4 A;  4KLS A;  2B51 A;  1Q78 A;  7ICF A;  2GA9 D;  2PFQ A;  5JTG A;  4WC6 A;  4QZA A;  5J0X A;  4NY8 A;  4PGX A;  2PFN A;  9ICK A;  2DVI A;  1NO5 A;  4UD5 A;  1ZQY A;  3C2L A;  3PHZ A;  9ICO A;  8ICX A;  2Q66 A;  3NWI A;  7ICU A;  3C2M A;  5HRI A;  9ICI A;  3AUO A;  3HJ1 A;  3K7D A;  4FHY A;  5J2A A;  1ZQR A;  2HN2 A;  4F5O A;  4IQU A;  4PGQ A;  3ER9 B;  8ICW A;  3MDA A;  8ICH A;  4WBZ A;  2VAN A;  4F5R A;  5DBA A;  2IUB A;  2GWS A;  1OU5 A;  1ZQE A;  4K4H A;  7ICL A;  4QZD A;  3GDX A;  8ICF A;  4F5N A;  4DO9 A;  7ICI A;  4X5V A;  2PFP A;  2IHO A;  4FHP A;  9ICG A;  4NXX A;  5B3P A;  3H39 A;  4M0A A;  4EV6 A;  2ZH1 A;  5HRE A;  4PH5 A;  3V7J A;  4UB4 A;  9ICT A;  4PHE A;  4UAZ A;  3V7K A;  2DR8 A;  4RWQ A;  4KLO A;  4Z6C A;  4RQ6 A;  1ZJN A;  4I2A A;  4F5Q A;  3TFS A;  3RJE A;  2NRK A;  4QZB A;  4XJE A;  5J2J A;  7ICO A;  1R8B A;  7ICG A;  4GXJ A;  8ICC A;  1VFG A;  5DEC A;  1RPL A;  4FH3 A;  3ISD A;  2ZH8 A;  4LEY A;  4KLL A;  4KLF A;  4MKP A;  4P4O A;  1HUZ A;  5D62 A;  7ICV A;  4WC3 A;  5J0P A;  1PX5 A;  4RT2 A;  2BCU A;  3RJF A;  2ISO A;  1Q79 A;  8ICN A;  4UB2 A;  3EF2 A;  1XSN A;  1ZQP A;  5F2V O;  4I2J A;  4QZE A;  1WOT A;  2W9M A;  4PPX A;  4LT6 A;  5J29 A;  2ZH9 A;  5J0T A;  3H37 A;  2EWR A;  9ICM A;  5J2D A;  4KLH A;  5J0R A;  4EP7 A;  4M9J A;  9ICP A;  3NKU A;  4MFC A;  8ICU A;  4NXZ A;  4WC5 A;  4R65 A;  3UQ2 A;  4FHX A;  1ZQT A;  9ICW A;  4WC1 A;  4LZG A;  3HW8 A;  8ICR A;  1XSP A;  5IIK A;  5HRL A;  2RFF A;  3RJH A;  1MIW A;  5J2B A;  3JPT A;  3RH4 A;  2ZHB A;  3AQM A;  9ICU A;  4R63 A;  1JN3 A;  9ICQ A;  4KLJ A;  4UB1 A;  4I2F A;  4YD1 A;  4ATB A;  9ICS A;  3RJI A;  8ICE A;  4X0A A;  4YD2 A;  3WFO A;  5HRF A;  9ICV A;  5J0Y A;  4FO6 A;  8ICO A;  2BPG A;  8ICB A;  4EED A;  2BPF A;  4DOB A;  2B56 A;  5DBB A;  3OVA A;  1ZQU A;  4M9G A;  1TVA A;  3HJ4 A;  4UBC A;  4K98 A;  2BCQ A;  4XQ7 A;  4LEW A;  1ZQX A;  4X4T A;  4KLU A;  5CHE A;  4RPZ A;  5DKW A;  1JMS A;  5EOZ A;  8ICZ A;  8ICT A;  4P2H A;  4NKU A;  1MQ3 A;  1TV9 A;  2P66 A;  1ZQD A;  3MCR A;  5J0U A;  3WFQ E;  4WBY A;  4ATB B;  7ICE A;  1ZQF A;  3CK6 A;  2M2W A;  4XUS A;  4YMM A;  5CJ7 A;  3JPQ A;  5DED A;  4MFF A;  1ZQK A;  8ICS A;  5J0S A;  4KB6 A;  3AQL A;  4AT9 B;  4M04 A;  3HWT A;  8ICY A;  1KNY A;  4I28 A;  1ZQS A;  8ICL A;  4M9N A;  3PMN A;  3HX0 A;  3WFS C;  3LQC B;  4WQL A;  4GXK A;  1XSL A;  1ZQA A;  4TUR A;  4WH5 A;  2BE3 A;  1R8C A;  4Z6D A;  3TFR A;  2BCR A;  5HRB A;  4XQ8 A;  4WC7 A;  2M2T A;  1ZJM A;  4X4N A;  7ICJ A;  4I2I A;  2M2U A;  4QZ9 A;  4K4I A;  7ICH A;  4FHV A;  4NM2 A;  4Z6E A;  1GPJ A;  4WC4 A;  5HRK A;  4YMO A; 
#chains in the Genus database with same CATH homology
 5DB6 A;  1UET A;  2ZH3 A;  8ICA A;  2ID1 A;  3C5F A;  3K75 D;  4O5E A;  4UB5 A;  5IIN A;  1ZQC A;  8ICI A;  4RQ3 A;  5DB9 A;  4AT7 A;  5J2H A;  2PFO A;  5BPC A;  4RWP A;  5IIL A;  1ZQN A;  2DR7 A;  4JWN A;  3AQN A;  4UAW A;  4UB3 A;  2ZHA A;  4WCW A;  4LVS A;  4PHA A;  5CHG A;  4K4G A;  2DR9 A;  9ICR A;  3C5G A;  1JQR A;  1MIV A;  4X4O A;  3JPN A;  1ZQJ A;  4QZI A;  3V72 A;  1JAJ A;  5CWR A;  8ICQ A;  5J2E A;  5J2I A;  4NM1 A;  4TUP A;  3C2K A;  3RH5 A;  4I2C A;  1F5A A;  3JPS A;  4AT7 B;  5J2K A;  1BPD A;  5IIO A;  1HUO A;  9ICH A;  5III A;  4X4Q A;  5CB1 A;  9ICE A;  4O9M A;  3ISC A;  7ICN A;  3AQK A;  3UQ0 A;  4M5D A;  7ICM A;  1ZQV A;  5BOL A;  4WC0 A;  4RWO A;  2O5A A;  5CA7 A;  3HIY A;  9ICC A;  3H38 A;  3LK9 A;  1BPE A;  1V4A A;  2ZH5 A;  3RJJ A;  4AT9 A;  2DRB A;  5J2C A;  4I2B A;  4IQT A;  1KDH A;  9ICL A;  2HHP A;  1KEJ A;  2I9G A;  3OV7 A;  4KLQ A;  5HRH A;  1ZQZ A;  2FMS A;  4I29 A;  4R66 A;  3AU2 A;  2FMP A;  8ICG A;  4RQ4 A;  2DRA A;  3H3A A;  5IIJ A;  4TUQ A;  1TFY A;  4X4S A;  3UPS A;  7ICP A;  1VJ7 A;  3RJG A;  1ZQI A;  1BPX A;  4QZ8 A;  1BPB A;  3WFP A;  4I27 A;  3JPR A;  4KLI A;  4M9L A;  4E7X A;  4P4P A;  3UXP A;  4UAY A;  1ZQQ A;  4KLM A;  2PBE A;  1ZQO A;  4QZH A;  4E8F A;  7ICT A;  2ZH7 A;  3OVB A;  4XRH A;  5J0O A;  3PML A;  3UXO A;  4QZC A;  4X4R A;  4RQ1 A;  5J2G A;  5J0Q A;  5HHI A;  3B0Y A;  4NKT A;  5D4B A;  3MGI A;  5DB7 A;  4NLZ A;  5DBC A;  7ICS A;  1ZQB A;  9ICX A;  1UEV A;  8ICP A;  1NOM A;  5CR0 A;  7ICR A;  4O5K A;  4PHP A;  4X4U A;  3JZ0 A;  4KLD A;  3JYY A;  3MDC A;  4XA5 A;  4M9H A;  2ZH4 A;  4RQ2 A;  1UEU A;  3WFR E;  3L9D A;  4IQV A;  4S3N A;  1MQ2 A;  9ICJ A;  5BOM A;  9ICF A;  5DDM A;  1ZQL A;  4FHW A;  3C18 A;  3OGU A;  4I2D A;  4RQ0 A;  3NYB A;  5HR9 A;  4RQ7 A;  5DB8 A;  4P4M A;  4NLN A;  5DDY A;  2BCV A;  4IQW A;  4LZD A;  4RWN A;  2O1P A;  1FA0 A;  1ZQH A;  4I2E A;  4KLG A;  4IG8 A;  4MF8 A;  4M47 A;  1RZT A;  2BCS A;  4MFA A;  4M2Y A;  5D46 A;  9ICN A;  1ZQG A;  8ICJ A;  4FH5 A;  4RQ5 A;  4KLE A;  1TFW A;  8ICK A;  4EBJ A;  3OUY A;  4PGY A;  3B0X A;  4PHD A;  4KLT A;  5J0W A;  5IIM A;  2ISP A;  3OVS A;  4NLK A;  2PXI A;  3UPQ A;  4R64 A;  4DOC A;  5D49 A;  4X0B A;  4TUS A;  4UBB A;  9ICB A;  3MGH A;  1BPY A;  5HRD A;  3MBY A;  1ZQM A;  2M2V A;  4RQ8 A;  4E80 A;  2DR5 A;  4UD4 A;  2IHM A;  4O5C A;  4DOA A;  4QZG A;  7ICK A;  5CP2 A;  3AU6 A;  8ICM A;  4RPX A;  4AT8 A;  3JPO A;  1BPZ A;  7ICQ A;  1MIY A;  3RH6 A;  5HRG A;  4RT3 A;  4RPY A;  3OUY B;  2FMQ A;  3RJK A;  9ICA A;  4YCX A;  5HHH A;  1R8A A;  4I2H A;  4MF2 A;  5TZV A;  2BPC A;  1R89 A;  4WC2 A;  4X4V A;  4YMN A;  3ISB A;  4Z6F A;  3PNC A;  4GXI A;  3UXN A;  4JWM A;  4I2G A;  1ZQW A;  3V7L A;  5HC9 A;  2ZH6 A;  4F5P A;  4X4P A;  4QZF A;  4EBK A;  3C66 A;  3JPP A;  8ICV A;  4AT8 B;  1YLQ A;  2ZH2 A;  5J2F A;  4YN4 A;  4KLS A;  7ICF A;  1Q78 A;  2PFQ A;  4WC6 A;  4QZA A;  5J0X A;  4NY8 A;  4PGX A;  2PFN A;  9ICK A;  2DVI A;  1NO5 A;  4UD5 A;  1ZQY A;  3C2L A;  9ICO A;  8ICX A;  2Q66 A;  7ICU A;  3C2M A;  5HRI A;  9ICI A;  3AUO A;  3HJ1 A;  4FHY A;  5J2A A;  1ZQR A;  4F5O A;  4IQU A;  4PGQ A;  8ICW A;  3MDA A;  8ICH A;  4WBZ A;  2VAN A;  4F5R A;  5DBA A;  2GWS A;  1OU5 A;  1ZQE A;  4K4H A;  7ICL A;  4QZD A;  3GDX A;  8ICF A;  4F5N A;  4DO9 A;  7ICI A;  4X5V A;  2PFP A;  4FHP A;  9ICG A;  3H39 A;  4M0A A;  2ZH1 A;  5HRE A;  4PH5 A;  3V7J A;  4UB4 A;  9ICT A;  4PHE A;  4UAZ A;  3V7K A;  2DR8 A;  4RWQ A;  4KLO A;  4Z6C A;  4RQ6 A;  1ZJN A;  4I2A A;  4F5Q A;  3TFS A;  3RJE A;  2NRK A;  4QZB A;  5J2J A;  7ICO A;  1R8B A;  7ICG A;  4GXJ A;  8ICC A;  1VFG A;  5DEC A;  1RPL A;  4FH3 A;  3ISD A;  2ZH8 A;  4KLL A;  4KLF A;  4P4O A;  1HUZ A;  7ICV A;  4WC3 A;  5J0P A;  1PX5 A;  4RT2 A;  2BCU A;  3RJF A;  2ISO A;  1Q79 A;  8ICN A;  4UB2 A;  1XSN A;  1ZQP A;  5F2V O;  4I2J A;  4QZE A;  1WOT A;  2W9M A;  4PPX A;  4LT6 A;  5J29 A;  2ZH9 A;  5J0T A;  3H37 A;  9ICM A;  5J2D A;  4KLH A;  5J0R A;  4EP7 A;  4M9J A;  9ICP A;  4MFC A;  8ICU A;  4NXZ A;  4R65 A;  4WC5 A;  3UQ2 A;  4FHX A;  1ZQT A;  9ICW A;  4WC1 A;  4LZG A;  3HW8 A;  8ICR A;  1XSP A;  5IIK A;  5HRL A;  2RFF A;  3RJH A;  1MIW A;  5J2B A;  3JPT A;  3RH4 A;  2ZHB A;  3AQM A;  9ICU A;  4R63 A;  1JN3 A;  9ICQ A;  4KLJ A;  4UB1 A;  4I2F A;  4YD1 A;  4ATB A;  9ICS A;  3RJI A;  8ICE A;  4X0A A;  4YD2 A;  3WFO A;  5HRF A;  9ICV A;  5J0Y A;  4FO6 A;  8ICO A;  2BPG A;  8ICB A;  2BPF A;  4DOB A;  3OVA A;  5DBB A;  1ZQU A;  4M9G A;  1TVA A;  3HJ4 A;  4UBC A;  2BCQ A;  4XQ7 A;  1ZQX A;  4X4T A;  4KLU A;  4RPZ A;  5DKW A;  1JMS A;  5EOZ A;  8ICZ A;  8ICT A;  4P2H A;  4NKU A;  1MQ3 A;  1TV9 A;  2P66 A;  1ZQD A;  5J0U A;  3WFQ E;  4WBY A;  4ATB B;  7ICE A;  1ZQF A;  2M2W A;  4XUS A;  4YMM A;  5CJ7 A;  3JPQ A;  5DED A;  4MFF A;  1ZQK A;  8ICS A;  5J0S A;  3AQL A;  4AT9 B;  4M04 A;  3HWT A;  8ICY A;  1KNY A;  4I28 A;  1ZQS A;  8ICL A;  4M9N A;  3PMN A;  3HX0 A;  3WFS C;  3LQC B;  4GXK A;  1XSL A;  1ZQA A;  4TUR A;  2BE3 A;  1R8C A;  4Z6D A;  3TFR A;  2BCR A;  5HRB A;  4XQ8 A;  4WC7 A;  2M2T A;  1ZJM A;  4X4N A;  7ICJ A;  4I2I A;  2M2U A;  4QZ9 A;  4K4I A;  7ICH A;  4FHV A;  4NM2 A;  4Z6E A;  4WC4 A;  5HRK A;  4YMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...