1VFGA

Crystal structure of trna nucleotidyltransferase complexed with a primer trna and an incoming atp analog
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
342
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETVEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (75-MER)
publication title Structural basis for template-independent RNA polymerization.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 104
structure length 342
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 1vfgA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1vfgA01
4TUPA 4KLIA 8ICYA 4RT2A 4NLNA 4DOAA 5D46A 5HRHA 4FO6A 9ICEA 4UD5A 4DO9A 2DVIA 3ISCA 9ICJA 4MFCA 3AQNA 2RFFA 1ZQDA 5BOMA 5IIMA 1V4AA 3OVSA 1TV9A 5HHHA 4AT7A 3H37A 1ZQTA 7ICRA 5HRFA 9ICKA 2BCUA 4X0BA 7ICJA 3OVAA 4FHVA 5J2FA 1ZQIA 3RJJA 3WFRE 9ICUA 3AQKA 2M2UA 1F5AA 5J2GA 2DR8A 2ZH9A 4R63A 1MIWA 4NM2A 1KEJA 2ISOA 3LK9A 2ID1A 9ICMA 3OUYA 5DECA 4QZ8A 9ICBA 7ICLA 5DB9A 7ICHA 4QZHA 4YD1A 5IILA 3UXPA 5D4BA 2O5AA 3HWTA 5CHGA 4RPXA 4GXKA 3JPRA 3WFQE 5IIJA 4YN4A 4WC1A 3WFSC 8ICHA 4O5EA 4X0AA 4GXIA 4KLGA 4AT8A 9ICQA 5IIOA 4NXZA 8ICGA 3B0XA 4EBKA 4MF8A 9ICFA 2BCQA 7ICIA 5DDMA 4TUSA 4M2YA 2ZH8A 4UB2A 8ICBA 7ICKA 4XUSA 2BPFA 3RJIA 1ZQCA 3OVBA 9ICHA 2BPGA 3V7JA 5J0UA 1ZQSA 4P2HA 4WCWA 1JN3A 3RJEA 4LT6A 2ZH7A 2I9GA 9ICPA 3OV7A 4XQ7A 4RQ1A 4R66A 2ZH4A 5J2HA 4MF2A 4QZAA 1JQRA 5CWRA 4IQTA 1MIVA 4F5OA 7ICSA 4I28A 3MGIA 4I2AA 5HHIA 9ICXA 2PBEA 1UEVA 4FHPA 8ICUA 1ZQUA 2P66A 3NYBA 5EOZA 4M04A 2M2TA 2BE3A 4F5QA 4YCXA 8ICIA 1ZQQA 7ICVA 9ICTA 1R8CA 4K4IA 4UB4A 5F2VO 4I27A 7ICOA 5J29A 4F5NA 5HRLA 1ZQFA 4IQWA 4RQ7A 5J2JA 4O5CA 1ZQXA 4QZBA 3C5FA 2DRBA 4QZ9A 5HC9A 5HRDA 4KLJA 1BPBA 1BPEA 4F5PA 2DR5A 8ICAA 1NO5A 1ZQVA 3JPPA 1ZQZA 4PHEA 4JWMA 8ICZA 4I2FA 2FMPA 4YMNA 4FHWA 4ATBB 3V72A 4XA5A 5J2CA 3JZ0A 5J0TA 1MIYA 4I2HA 4PH5A 1ZQPA 3AUOA 4KLTA 3OGUA 4EP7A 4DOCA 4RWNA 9ICNA 1ZQRA 4EBJA 4PHAA 4X4PA 7ICNA 1TFWA 4KLLA 2W9MA 2BCVA 8ICPA 2DRAA 5TZVA 4YMMA 9ICGA 5J2DA 3ISDA 5DDYA 3RH4A 3RJKA 5IINA 1BPZA 3JYYA 4MFFA 4PPXA 5J2KA 4RQ5A 5J0RA 4Z6EA 2ZH5A 4RQ8A 4P4OA 3C5GA 3C2LA 5HRBA 1TVAA 4KLUA 1MQ3A 1NOMA 4QZDA 4NLKA 4LZGA 5HR9A 4WC6A 4RWPA 4PGYA 4X4UA 2VANA 3RH6A 2GWSA 4K4GA 4M9JA 4QZEA 4JWNA 4K4HA 3JPSA 4QZFA 3JPNA 2ZHAA 3UQ2A 2DR7A 4WC7A 4RQ2A 3HX0A 2BCRA 5DBBA 9ICRA 4I2IA 3HIYA 3WFPA 5HRGA 2Q66A 4QZGA 1ZQWA 4MFAA 4WC5A 5J0SA 1R89A 8ICSA 4UAWA 3LQCB 4FH5A 4LVSA 1RZTA 1ZJNA 4X4VA 4FHXA 4UB3A 1XSPA 5D49A 8ICJA 1ZQYA 4FHYA 4I2DA 5J0PA 4NLZA 3UPQA 1ZQHA 1HUOA 9ICSA 4E80A 3AQMA 1Q78A 1FA0A 4QZIA 4WC3A 4X5VA 4KLFA 3K75D 2HHPA 8ICCA 1KNYA 4S3NA 4UBCA 3MGHA 1UETA 3C66A 5J2BA 8ICRA 4RWOA 4M47A 4AT9A 4IQUA 3AU2A 4E7XA 5DB7A 1ZQOA 4IQVA 5J2IA 1ZQMA 4WC0A 4KLHA 5DEDA 4RT3A 3PMLA 5HRIA 8ICTA 5J2EA 1XSLA 9ICWA 4UAYA 1VFGA 7ICEA 5BOLA 3MDAA 5CP2A 4O5KA 4I2JA 4WBZA 2PFPA 4M9HA 8ICOA 3TFSA 8ICWA 4Z6CA 4RQ6A 1ZQNA 4AT7B 9ICIA 4YD2A 4M9LA 3V7KA 4I2EA 8ICEA 1YLQA 2ZH6A 9ICAA 4M0AA 4WC4A 5HREA 2PFNA 1R8AA 3RJGA 4NY8A 5J0XA 3RJHA 4TURA 7ICMA 3JPQA 1ZJMA 4UB1A 5IIIA 3AU6A 4KLEA 4X4SA 4YMOA 3MBYA 4WC2A 3RH5A 4M9NA 3OUYB 5J0OA 5CA7A 3RJFA 2M2VA 3V7LA 5BPCA 4I2CA 4PHDA 5J2AA 2DR9A 5J0WA 2IHMA 4GXJA 1OU5A 4Z6DA 4PGQA 4RPYA 4RQ3A 4E8FA 3HW8A 3HJ1A 4RWQA 3AQLA 1ZQBA 4KLSA 1VJ7A 1ZQGA 3UQ0A 4ATBA 7ICUA 1ZQLA 4UAZA 8ICNA 4AT8B 4NKUA 3C2MA 4PGXA 1R8BA 4KLDA 5J0QA 4XQ8A 9ICVA 1MQ2A 5CB1A 1BPXA 2ZHBA 2FMSA 1JMSA 2ZH1A 4FH3A 4X4NA 4X4TA 2PFQA 2BPCA 5DB8A 1Q79A 4M5DA 4R64A 1WOTA 4NKTA 2ISPA 7ICGA 5DKWA 8ICMA 3L9DA 4KLQA 1ZQJA 4TUQA 4XRHA 8ICKA 8ICQA 4RQ4A 4LZDA 7ICQA 1HUZA 4Z6FA 1XSNA 3JPTA 5IIKA 3ISBA 3MDCA 4I2GA 4X4OA 4KLOA 9ICCA 5HRKA 4I29A 5DBCA 3UXOA 3H39A 3TFRA 4M9GA 8ICXA 3B0YA 1RPLA 7ICTA 3JPOA 2ZH3A 9ICOA 5DBAA 1BPDA 9ICLA 4AT9B 4WBYA 2NRKA 3WFOA 3UXNA 1PX5A 4F5RA 2O1PA 1BPYA 1KDHA 3C18A 2BCSA 4KLMA 4UB5A 7ICFA 3C2KA 5CR0A 5J0YA 8ICLA 4O9MA 5DB6A 4RQ0A 1ZQAA 4IG8A 3H38A 7ICPA 1ZQEA 4UBBA 2PXIA 4X4QA 1ZQKA 3PNCA 3GDXA 2ZH2A 2PFOA 2M2WA 4I2BA 1TFYA 4UD4A 4R65A 3PMNA 4DOBA 3HJ4A 4P4MA 3H3AA 8ICFA 4NM1A 4P4PA 4QZCA 4PHPA 5CJ7A 2FMQA 1JAJA 1UEUA 3UPSA 4RPZA 4X4RA 8ICVA
chains in the Genus database with same CATH superfamily
4TUPA 5D62A 4KLIA 8ICYA 4RT2A 4NLNA 4DOAA 5D46A 2B51A 5HRHA 4FO6A 9ICEA 4UD5A 4DO9A 2DVIA 3ISCA 9ICJA 2HN1A 4MFCA 3AQNA 2RFFA 1ZQDA 3ERCC 5BOMA 5IIMA 1V4AA 3OVSA 1TV9A 5HHHA 4AT7A 3H37A 1ZQTA 7ICRA 5HRFA 9ICKA 2BCUA 4X0BA 7ICJA 3OVAA 4FHVA 5J2FA 1ZQIA 3RJJA 3WFRE 4OAIZ 9ICUA 3AQKA 4NXVA 2M2UA 1F5AA 5J2GA 2DR8A 2ZH9A 4R63A 1MIWA 3JCFA 4NM2A 1KEJA 2ISOA 4FO1A 3LK9A 2ID1A 9ICMA 3OUYA 3MCRA 5DECA 4QZ8A 9ICBA 7ICLA 5DB9A 7ICHA 4QZHA 4YD1A 5IILA 4MKPA 3UXPA 5D4BA 2O5AA 3HWTA 5CHGA 4RPXA 4GXKA 4O69A 4KB6A 3JPRA 3WFQE 5IIJA 4YN4A 4WC1A 3WFSC 4K98A 3PHZA 8ICHA 4O5EA 4X0AA 4GXIA 4KLGA 4AT8A 9ICQA 4NXUA 5IIOA 4NXZA 8ICGA 3B0XA 4EBKA 4MF8A 9ICFA 2BCQA 7ICIA 5DDMA 4TUSA 4M2YA 2ZH8A 4K99A 4UB2A 8ICBA 7ICKA 4XUSA 2BPFA 3RJIA 1ZQCA 3OVBA 9ICHA 5CFUA 2BPGA 3V7JA 5J0UA 1ZQSA 4P2HA 4NXTA 4WCWA 1JN3A 4WQKA 3RJEA 4LT6A 2ZH7A 4WH5A 2I9GA 9ICPA 3OV7A 4XQ7A 4RQ1A 4R66A 2ZH4A 5J2HA 4MF2A 4QZAA 4OAFA 1JQRA 5CWRA 4IQTA 1MIVA 4F5OA 7ICSA 4I28A 3MGIA 4I2AA 5HHIA 9ICXA 5JTGA 2PBEA 1UEVA 4FHPA 8ICUA 1ZQUA 2P66A 3NYBA 5EOZA 4M04A 2M2TA 2BE3A 2BBJA 4F5QA 4YCXA 8ICIA 4EEBA 1ZQQA 7ICVA 9ICTA 1R8CA 4K4IA 4UB4A 5F2VO 4I27A 7ICOA 5J29A 4F5NA 5HRLA 1ZQFA 4IQWA 4RQ7A 5J2JA 4O5CA 1ZQXA 4JLXA 4QZBA 4OAGA 3C5FA 2DRBA 4QZ9A 5HC9A 5HRDA 4KLJA 4K97A 1BPBA 1BPEA 4F5PA 2DR5A 8ICAA 1NO5A 1ZQVA 2B4VA 3JPPA 2FCLA 1ZQZA 4PHEA 4JWMA 8ICZA 4NXXA 4I2FA 2FMPA 4YMNA 4FHWA 4K9AA 4ATBB 3V72A 4XA5A 5J2CA 3JZ0A 5J0TA 1MIYA 4I2HA 4PH5A 1ZQPA 2IHOA 3AUOA 4KLTA 4O67A 3OGUA 4EP7A 4DOCA 4RWNA 9ICNA 1ZQRA 4EBJA 4PHAA 4X4PA 3EF2A 7ICNA 1TFWA 4KLLA 2W9MA 2BCVA 8ICPA 2DRAA 5TZVA 4YMMA 9ICGA 4N7RA 5J2DA 3ISDA 5B3QA 5DDYA 3RH4A 2HN2A 3RJKA 5IINA 4O68A 3ER8C 1BPZA 3JYYA 4MFFA 4PPXA 5J2KA 4RQ5A 5J0RA 4Z6EA 2ZH5A 4RQ8A 4P4OA 3C5GA 3C2LA 5HRBA 1TVAA 4KLUA 1MQ3A 1NOMA 4QZDA 4NLKA 4LZGA 5HR9A 4WC6A 4RWPA 4PGYA 4X4UA 2VANA 3RH6A 2GWSA 4K4GA 5B3PA 4M9JA 4QZEA 4JWNA 4K4HA 3JPSA 4QZFA 3JPNA 2ZHAA 3UQ2A 2DR7A 4WC7A 4RQ2A 3HX0A 2BCRA 5DBBA 4EEDA 9ICRA 4I2IA 3HIYA 3WFPA 5HRGA 1GPJA 2Q66A 4QZGA 1ZQWA 4MFAA 4WC5A 5J0SA 1R89A 8ICSA 4UAWA 3LQCB 4FH5A 4LVSA 1RZTA 1ZJNA 4X4VA 4FHXA 4UB3A 1XSPA 5D49A 8ICJA 1ZQYA 4FHYA 4I2DA 5J0PA 4NLZA 3UPQA 1ZQHA 1HUOA 9ICSA 4E80A 3AQMA 1Q78A 1FA0A 4QZIA 4WC3A 4X5VA 4KLFA 3NKUA 3K75D 2HHPA 8ICCA 1KNYA 4S3NA 4UBCA 3MGHA 1UETA 3C66A 5J2BA 8ICRA 4RWOA 4M47A 4AT9A 4IQUA 3AU2A 4E7XA 5DB7A 1ZQOA 4IQVA 5J2IA 1ZQMA 4WC0A 4KLHA 5DEDA 4RT3A 3PMLA 5HRIA 8ICTA 5J2EA 1XSLA 9ICWA 4UAYA 1VFGA 7ICEA 5BOLA 4EV6A 3MDAA 2IUBA 5CP2A 2BBHA 4O5KA 4I2JA 4WBZA 2PFPA 4M9HA 8ICOA 4K96A 3NVOA 3TFSA 8ICWA 4Z6CA 4RQ6A 1ZQNA 4AT7B 9ICIA 4YD2A 4M9LA 3V7KA 4I2EA 8ICEA 1YLQA 2ZH6A 9ICAA 4M0AA 4WC4A 5HREA 2PFNA 1R8AA 3RJGA 4NY8A 5J0XA 3RJHA 4NXWA 4TURA 7ICMA 3JPQA 1ZJMA 4UB1A 5IIIA 3AU6A 4KLEA 4X4SA 4YMOA 3MBYA 4WC2A 3RH5A 4M9NA 3OUYB 5J0OA 5CA7A 3RJFA 2M2VA 3V7LA 5BPCA 4I2CA 4PHDA 5J2AA 2DR9A 5J0WA 2IHMA 4GXJA 1OU5A 4Z6DA 4PGQA 4RPYA 4RQ3A 4E8FA 3HW8A 3ER9B 3HJ1A 4KM5A 3AQLA 4RWQA 1ZQBA 4KLSA 1VJ7A 1ZQGA 3UQ0A 4ATBA 7ICUA 4O6AA 4LEVA 3NWIA 1ZQLA 4UAZA 8ICNA 4AT8B 4NKUA 4OAHA 3CK6A 3C2MA 4PGXA 4LEZA 1R8BA 4KLDA 5J0QA 4XQ8A 9ICVA 1MQ2A 5CB1A 1BPXA 2ZHBA 4EGWA 2FMSA 1JMSA 2ZH1A 4FH3A 4X4NA 4X4TA 2PFQA 2BPCA 5DB8A 1Q79A 4M5DA 4R64A 1WOTA 4NKTA 4K9BA 2ISPA 4LEYA 7ICGA 5DKWA 8ICMA 3L9DA 2GAFD 4I0UA 4WOYA 4KLQA 1ZQJA 4TUQA 4XRHA 8ICKA 8ICQA 4RQ4A 4LZDA 7ICQA 1HUZA 4Z6FA 3K7DA 1XSNA 4HX0A 5IIKA 3JPTA 3ISBA 3MDCA 4I2GA 4X4OA 4KLOA 9ICCA 5HRKA 4I29A 5DBCA 3UXOA 3H39A 4K8VA 3TFRA 4M9GA 8ICXA 3B0YA 1RPLA 7ICTA 3JPOA 2ZH3A 9ICOA 5DBAA 1BPDA 5CFSA 4AT9B 9ICLA 4WBYA 5D63A 2NRKA 3WFOA 4JLZA 3UXNA 1PX5A 4F5RA 2O1PA 1BPYA 1KDHA 3C18A 5D61A 2BCSA 4KLMA 4UB5A 7ICFA 3C2KA 5CR0A 5J0YA 8ICLA 2EWRA 4O9MA 5DB6A 4RQ0A 1ZQAA 4IG8A 3H38A 7ICPA 1ZQEA 4UBBA 4WQLA 2PXIA 4X4QA 1ZQKA 3PNCA 3GDXA 2ZH2A 2PFOA 2M2WA 4I2BA 1TFYA 4UD4A 4R65A 3PMNA 4DOBA 3HJ4A 4P4MA 3H3AA 5CHEA 3OWGA 4XJEA 2B56A 8ICFA 4NM1A 4P4PA 4QZCA 2GA9D 4PHPA 5CJ7A 2FMQA 1JAJA 1UEUA 3UPSA 4RPZA 4LEWA 4X4RA 8ICVA 5CFTA
chains in the Genus database with same CATH topology
4TUPA 4KLIA 8ICYA 4RT2A 4NLNA 4DOAA 5D46A 5HRHA 4FO6A 9ICEA 4UD5A 4DO9A 2DVIA 3ISCA 9ICJA 4MFCA 3AQNA 2RFFA 1ZQDA 5BOMA 5IIMA 1V4AA 3OVSA 1TV9A 5HHHA 4AT7A 3H37A 1ZQTA 7ICRA 5HRFA 9ICKA 2BCUA 4X0BA 7ICJA 3OVAA 4FHVA 5J2FA 1ZQIA 3RJJA 3WFRE 9ICUA 3AQKA 2M2UA 1F5AA 5J2GA 2DR8A 2ZH9A 4R63A 1MIWA 4NM2A 1KEJA 2ISOA 3LK9A 2ID1A 9ICMA 3OUYA 5DECA 4QZ8A 9ICBA 7ICLA 5DB9A 7ICHA 4QZHA 4YD1A 5IILA 3UXPA 5D4BA 2O5AA 3HWTA 5CHGA 4RPXA 4GXKA 3JPRA 3WFQE 5IIJA 4YN4A 4WC1A 3WFSC 8ICHA 4O5EA 4X0AA 4GXIA 4KLGA 4AT8A 9ICQA 5IIOA 4NXZA 8ICGA 3B0XA 4EBKA 4MF8A 9ICFA 2BCQA 7ICIA 5DDMA 4TUSA 4M2YA 2ZH8A 4UB2A 8ICBA 7ICKA 4XUSA 2BPFA 3RJIA 1ZQCA 3OVBA 9ICHA 2BPGA 3V7JA 5J0UA 1ZQSA 4P2HA 4WCWA 1JN3A 3RJEA 4LT6A 2ZH7A 2I9GA 9ICPA 3OV7A 4XQ7A 4RQ1A 4R66A 2ZH4A 5J2HA 4MF2A 4QZAA 1JQRA 5CWRA 4IQTA 1MIVA 4F5OA 7ICSA 4I28A 3MGIA 4I2AA 5HHIA 9ICXA 2PBEA 1UEVA 4FHPA 8ICUA 1ZQUA 2P66A 3NYBA 5EOZA 4M04A 2M2TA 2BE3A 4F5QA 4YCXA 8ICIA 1ZQQA 7ICVA 9ICTA 1R8CA 4K4IA 4UB4A 5F2VO 4I27A 7ICOA 5J29A 4F5NA 5HRLA 1ZQFA 4IQWA 4RQ7A 5J2JA 4O5CA 1ZQXA 4QZBA 3C5FA 2DRBA 4QZ9A 5HC9A 5HRDA 4KLJA 1BPBA 1BPEA 4F5PA 2DR5A 8ICAA 1NO5A 1ZQVA 3JPPA 1ZQZA 4PHEA 4JWMA 8ICZA 4I2FA 2FMPA 4YMNA 4FHWA 4ATBB 3V72A 4XA5A 5J2CA 3JZ0A 5J0TA 1MIYA 4I2HA 4PH5A 1ZQPA 3AUOA 4KLTA 3OGUA 4EP7A 4DOCA 4RWNA 9ICNA 1ZQRA 4EBJA 4PHAA 4X4PA 7ICNA 1TFWA 4KLLA 2W9MA 2BCVA 8ICPA 2DRAA 5TZVA 4YMMA 9ICGA 5J2DA 3ISDA 5DDYA 3RH4A 3RJKA 5IINA 1BPZA 3JYYA 4MFFA 4PPXA 5J2KA 4RQ5A 5J0RA 4Z6EA 2ZH5A 4RQ8A 4P4OA 3C5GA 3C2LA 5HRBA 1TVAA 4KLUA 1MQ3A 1NOMA 4QZDA 4NLKA 4LZGA 5HR9A 4WC6A 4RWPA 4PGYA 4X4UA 2VANA 3RH6A 2GWSA 4K4GA 4M9JA 4QZEA 4JWNA 4K4HA 3JPSA 4QZFA 3JPNA 2ZHAA 3UQ2A 2DR7A 4WC7A 4RQ2A 3HX0A 2BCRA 5DBBA 9ICRA 4I2IA 3HIYA 3WFPA 5HRGA 2Q66A 4QZGA 1ZQWA 4MFAA 4WC5A 5J0SA 1R89A 8ICSA 4UAWA 3LQCB 4FH5A 4LVSA 1RZTA 1ZJNA 4X4VA 4FHXA 4UB3A 1XSPA 5D49A 8ICJA 1ZQYA 4FHYA 4I2DA 5J0PA 4NLZA 3UPQA 1ZQHA 1HUOA 9ICSA 4E80A 3AQMA 1Q78A 1FA0A 4QZIA 4WC3A 4X5VA 4KLFA 3K75D 2HHPA 8ICCA 1KNYA 4S3NA 4UBCA 3MGHA 1UETA 3C66A 5J2BA 8ICRA 4RWOA 4M47A 4AT9A 4IQUA 3AU2A 4E7XA 5DB7A 1ZQOA 4IQVA 5J2IA 1ZQMA 4WC0A 4KLHA 5DEDA 4RT3A 3PMLA 5HRIA 8ICTA 5J2EA 1XSLA 9ICWA 4UAYA 1VFGA 7ICEA 5BOLA 3MDAA 5CP2A 4O5KA 4I2JA 4WBZA 2PFPA 4M9HA 8ICOA 3TFSA 8ICWA 4Z6CA 4RQ6A 1ZQNA 4AT7B 9ICIA 4YD2A 4M9LA 3V7KA 4I2EA 8ICEA 1YLQA 2ZH6A 9ICAA 4M0AA 4WC4A 5HREA 2PFNA 1R8AA 3RJGA 4NY8A 5J0XA 3RJHA 4TURA 7ICMA 3JPQA 1ZJMA 4UB1A 5IIIA 3AU6A 4KLEA 4X4SA 4YMOA 3MBYA 4WC2A 3RH5A 4M9NA 3OUYB 5J0OA 5CA7A 3RJFA 2M2VA 3V7LA 5BPCA 4I2CA 4PHDA 5J2AA 2DR9A 5J0WA 2IHMA 4GXJA 1OU5A 4Z6DA 4PGQA 4RPYA 4RQ3A 4E8FA 3HW8A 3HJ1A 4RWQA 3AQLA 1ZQBA 4KLSA 1VJ7A 1ZQGA 3UQ0A 4ATBA 7ICUA 1ZQLA 4UAZA 8ICNA 4AT8B 4NKUA 3C2MA 4PGXA 1R8BA 4KLDA 5J0QA 4XQ8A 9ICVA 1MQ2A 5CB1A 1BPXA 2ZHBA 2FMSA 1JMSA 2ZH1A 4FH3A 4X4NA 4X4TA 2PFQA 2BPCA 5DB8A 1Q79A 4M5DA 4R64A 1WOTA 4NKTA 2ISPA 7ICGA 5DKWA 8ICMA 3L9DA 4KLQA 1ZQJA 4TUQA 4XRHA 8ICKA 8ICQA 4RQ4A 4LZDA 7ICQA 1HUZA 4Z6FA 1XSNA 3JPTA 5IIKA 3ISBA 3MDCA 4I2GA 4X4OA 4KLOA 9ICCA 5HRKA 4I29A 5DBCA 3UXOA 3H39A 3TFRA 4M9GA 8ICXA 3B0YA 1RPLA 7ICTA 3JPOA 2ZH3A 9ICOA 5DBAA 1BPDA 9ICLA 4AT9B 4WBYA 2NRKA 3WFOA 3UXNA 1PX5A 4F5RA 2O1PA 1BPYA 1KDHA 3C18A 2BCSA 4KLMA 4UB5A 7ICFA 3C2KA 5CR0A 5J0YA 8ICLA 4O9MA 5DB6A 4RQ0A 1ZQAA 4IG8A 3H38A 7ICPA 1ZQEA 4UBBA 2PXIA 4X4QA 1ZQKA 3PNCA 3GDXA 2ZH2A 2PFOA 2M2WA 4I2BA 1TFYA 4UD4A 4R65A 3PMNA 4DOBA 3HJ4A 4P4MA 3H3AA 8ICFA 4NM1A 4P4PA 4QZCA 4PHPA 5CJ7A 2FMQA 1JAJA 1UEUA 3UPSA 4RPZA 4X4RA 8ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUP A;  4KLI A;  8ICY A;  4RT2 A;  4NLN A;  4DOA A;  5D46 A;  5HRH A;  4FO6 A;  9ICE A;  4UD5 A;  4DO9 A;  2DVI A;  3ISC A;  9ICJ A;  4MFC A;  3AQN A;  2RFF A;  1ZQD A;  5BOM A;  5IIM A;  1V4A A;  3OVS A;  1TV9 A;  5HHH A;  4AT7 A;  3H37 A;  1ZQT A;  7ICR A;  5HRF A;  9ICK A;  2BCU A;  4X0B A;  7ICJ A;  3OVA A;  4FHV A;  5J2F A;  1ZQI A;  3RJJ A;  3WFR E;  9ICU A;  3AQK A;  2M2U A;  1F5A A;  5J2G A;  2DR8 A;  2ZH9 A;  4R63 A;  1MIW A;  4NM2 A;  1KEJ A;  2ISO A;  3LK9 A;  2ID1 A;  9ICM A;  3OUY A;  5DEC A;  4QZ8 A;  9ICB A;  7ICL A;  5DB9 A;  7ICH A;  4QZH A;  4YD1 A;  5IIL A;  3UXP A;  5D4B A;  2O5A A;  3HWT A;  5CHG A;  4RPX A;  4GXK A;  3JPR A;  3WFQ E;  5IIJ A;  4YN4 A;  4WC1 A;  3WFS C;  8ICH A;  4O5E A;  4X0A A;  4GXI A;  4KLG A;  4AT8 A;  9ICQ A;  5IIO A;  4NXZ A;  8ICG A;  3B0X A;  4EBK A;  4MF8 A;  9ICF A;  2BCQ A;  7ICI A;  5DDM A;  4TUS A;  4M2Y A;  2ZH8 A;  4UB2 A;  8ICB A;  7ICK A;  4XUS A;  2BPF A;  3RJI A;  1ZQC A;  3OVB A;  9ICH A;  2BPG A;  3V7J A;  5J0U A;  1ZQS A;  4P2H A;  4WCW A;  1JN3 A;  3RJE A;  4LT6 A;  2ZH7 A;  2I9G A;  9ICP A;  3OV7 A;  4XQ7 A;  4RQ1 A;  4R66 A;  2ZH4 A;  5J2H A;  4MF2 A;  4QZA A;  1JQR A;  5CWR A;  4IQT A;  1MIV A;  4F5O A;  7ICS A;  4I28 A;  3MGI A;  4I2A A;  5HHI A;  9ICX A;  2PBE A;  1UEV A;  4FHP A;  8ICU A;  1ZQU A;  2P66 A;  3NYB A;  5EOZ A;  4M04 A;  2M2T A;  2BE3 A;  4F5Q A;  4YCX A;  8ICI A;  1ZQQ A;  7ICV A;  9ICT A;  1R8C A;  4K4I A;  4UB4 A;  5F2V O;  4I27 A;  7ICO A;  5J29 A;  4F5N A;  5HRL A;  1ZQF A;  4IQW A;  4RQ7 A;  5J2J A;  4O5C A;  1ZQX A;  4QZB A;  3C5F A;  2DRB A;  4QZ9 A;  5HC9 A;  5HRD A;  4KLJ A;  1BPB A;  1BPE A;  4F5P A;  2DR5 A;  8ICA A;  1NO5 A;  1ZQV A;  3JPP A;  1ZQZ A;  4PHE A;  4JWM A;  8ICZ A;  4I2F A;  2FMP A;  4YMN A;  4FHW A;  4ATB B;  3V72 A;  4XA5 A;  5J2C A;  3JZ0 A;  5J0T A;  1MIY A;  4I2H A;  4PH5 A;  1ZQP A;  3AUO A;  4KLT A;  3OGU A;  4EP7 A;  4DOC A;  4RWN A;  9ICN A;  1ZQR A;  4EBJ A;  4PHA A;  4X4P A;  7ICN A;  1TFW A;  4KLL A;  2W9M A;  2BCV A;  8ICP A;  2DRA A;  5TZV A;  4YMM A;  9ICG A;  5J2D A;  3ISD A;  5DDY A;  3RH4 A;  3RJK A;  5IIN A;  1BPZ A;  3JYY A;  4MFF A;  4PPX A;  5J2K A;  4RQ5 A;  5J0R A;  4Z6E A;  2ZH5 A;  4RQ8 A;  4P4O A;  3C5G A;  3C2L A;  5HRB A;  1TVA A;  4KLU A;  1MQ3 A;  1NOM A;  4QZD A;  4NLK A;  4LZG A;  5HR9 A;  4WC6 A;  4RWP A;  4PGY A;  4X4U A;  2VAN A;  3RH6 A;  2GWS A;  4K4G A;  4M9J A;  4QZE A;  4JWN A;  4K4H A;  3JPS A;  4QZF A;  3JPN A;  2ZHA A;  3UQ2 A;  2DR7 A;  4WC7 A;  4RQ2 A;  3HX0 A;  2BCR A;  5DBB A;  9ICR A;  4I2I A;  3HIY A;  3WFP A;  5HRG A;  2Q66 A;  4QZG A;  1ZQW A;  4MFA A;  4WC5 A;  5J0S A;  1R89 A;  8ICS A;  4UAW A;  3LQC B;  4FH5 A;  4LVS A;  1RZT A;  1ZJN A;  4X4V A;  4FHX A;  4UB3 A;  1XSP A;  5D49 A;  8ICJ A;  1ZQY A;  4FHY A;  4I2D A;  5J0P A;  4NLZ A;  3UPQ A;  1ZQH A;  1HUO A;  9ICS A;  4E80 A;  3AQM A;  1Q78 A;  1FA0 A;  4QZI A;  4WC3 A;  4X5V A;  4KLF A;  3K75 D;  2HHP A;  8ICC A;  1KNY A;  4S3N A;  4UBC A;  3MGH A;  1UET A;  3C66 A;  5J2B A;  8ICR A;  4RWO A;  4M47 A;  4AT9 A;  4IQU A;  3AU2 A;  4E7X A;  5DB7 A;  1ZQO A;  4IQV A;  5J2I A;  1ZQM A;  4WC0 A;  4KLH A;  5DED A;  4RT3 A;  3PML A;  5HRI A;  8ICT A;  5J2E A;  1XSL A;  9ICW A;  4UAY A;  1VFG A;  7ICE A;  5BOL A;  3MDA A;  5CP2 A;  4O5K A;  4I2J A;  4WBZ A;  2PFP A;  4M9H A;  8ICO A;  3TFS A;  8ICW A;  4Z6C A;  4RQ6 A;  1ZQN A;  4AT7 B;  9ICI A;  4YD2 A;  4M9L A;  3V7K A;  4I2E A;  8ICE A;  1YLQ A;  2ZH6 A;  9ICA A;  4M0A A;  4WC4 A;  5HRE A;  2PFN A;  1R8A A;  3RJG A;  4NY8 A;  5J0X A;  3RJH A;  4TUR A;  7ICM A;  3JPQ A;  1ZJM A;  4UB1 A;  5III A;  3AU6 A;  4KLE A;  4X4S A;  4YMO A;  3MBY A;  4WC2 A;  3RH5 A;  4M9N A;  3OUY B;  5J0O A;  5CA7 A;  3RJF A;  2M2V A;  3V7L A;  5BPC A;  4I2C A;  4PHD A;  5J2A A;  2DR9 A;  5J0W A;  2IHM A;  4GXJ A;  1OU5 A;  4Z6D A;  4PGQ A;  4RPY A;  4RQ3 A;  4E8F A;  3HW8 A;  3HJ1 A;  4RWQ A;  3AQL A;  1ZQB A;  4KLS A;  1VJ7 A;  1ZQG A;  3UQ0 A;  4ATB A;  7ICU A;  1ZQL A;  4UAZ A;  8ICN A;  4AT8 B;  4NKU A;  3C2M A;  4PGX A;  1R8B A;  4KLD A;  5J0Q A;  4XQ8 A;  9ICV A;  1MQ2 A;  5CB1 A;  1BPX A;  2ZHB A;  2FMS A;  1JMS A;  2ZH1 A;  4FH3 A;  4X4N A;  4X4T A;  2PFQ A;  2BPC A;  5DB8 A;  1Q79 A;  4M5D A;  4R64 A;  1WOT A;  4NKT A;  2ISP A;  7ICG A;  5DKW A;  8ICM A;  3L9D A;  4KLQ A;  1ZQJ A;  4TUQ A;  4XRH A;  8ICK A;  8ICQ A;  4RQ4 A;  4LZD A;  7ICQ A;  1HUZ A;  4Z6F A;  1XSN A;  3JPT A;  5IIK A;  3ISB A;  3MDC A;  4I2G A;  4X4O A;  4KLO A;  9ICC A;  5HRK A;  4I29 A;  5DBC A;  3UXO A;  3H39 A;  3TFR A;  4M9G A;  8ICX A;  3B0Y A;  1RPL A;  7ICT A;  3JPO A;  2ZH3 A;  9ICO A;  5DBA A;  1BPD A;  9ICL A;  4AT9 B;  4WBY A;  2NRK A;  3WFO A;  3UXN A;  1PX5 A;  4F5R A;  2O1P A;  1BPY A;  1KDH A;  3C18 A;  2BCS A;  4KLM A;  4UB5 A;  7ICF A;  3C2K A;  5CR0 A;  5J0Y A;  8ICL A;  4O9M A;  5DB6 A;  4RQ0 A;  1ZQA A;  4IG8 A;  3H38 A;  7ICP A;  1ZQE A;  4UBB A;  2PXI A;  4X4Q A;  1ZQK A;  3PNC A;  3GDX A;  2ZH2 A;  2PFO A;  2M2W A;  4I2B A;  1TFY A;  4UD4 A;  4R65 A;  3PMN A;  4DOB A;  3HJ4 A;  4P4M A;  3H3A A;  8ICF A;  4NM1 A;  4P4P A;  4QZC A;  4PHP A;  5CJ7 A;  2FMQ A;  1JAJ A;  1UEU A;  3UPS A;  4RPZ A;  4X4R A;  8ICV A; 
#chains in the Genus database with same CATH topology
 4TUP A;  5D62 A;  4KLI A;  8ICY A;  4RT2 A;  4NLN A;  4DOA A;  5D46 A;  2B51 A;  5HRH A;  4FO6 A;  9ICE A;  4UD5 A;  4DO9 A;  2DVI A;  3ISC A;  9ICJ A;  2HN1 A;  4MFC A;  3AQN A;  2RFF A;  1ZQD A;  3ERC C;  5BOM A;  5IIM A;  1V4A A;  3OVS A;  1TV9 A;  5HHH A;  4AT7 A;  3H37 A;  1ZQT A;  7ICR A;  5HRF A;  9ICK A;  2BCU A;  4X0B A;  7ICJ A;  3OVA A;  4FHV A;  5J2F A;  1ZQI A;  3RJJ A;  3WFR E;  4OAI Z;  9ICU A;  3AQK A;  4NXV A;  2M2U A;  1F5A A;  5J2G A;  2DR8 A;  2ZH9 A;  4R63 A;  1MIW A;  3JCF A;  4NM2 A;  1KEJ A;  2ISO A;  4FO1 A;  3LK9 A;  2ID1 A;  9ICM A;  3OUY A;  3MCR A;  5DEC A;  4QZ8 A;  9ICB A;  7ICL A;  5DB9 A;  7ICH A;  4QZH A;  4YD1 A;  5IIL A;  4MKP A;  3UXP A;  5D4B A;  2O5A A;  3HWT A;  5CHG A;  4RPX A;  4GXK A;  4O69 A;  4KB6 A;  3JPR A;  3WFQ E;  5IIJ A;  4YN4 A;  4WC1 A;  3WFS C;  4K98 A;  3PHZ A;  8ICH A;  4O5E A;  4X0A A;  4GXI A;  4KLG A;  4AT8 A;  9ICQ A;  4NXU A;  5IIO A;  4NXZ A;  8ICG A;  3B0X A;  4EBK A;  4MF8 A;  9ICF A;  2BCQ A;  7ICI A;  5DDM A;  4TUS A;  4M2Y A;  2ZH8 A;  4K99 A;  4UB2 A;  8ICB A;  7ICK A;  4XUS A;  2BPF A;  3RJI A;  1ZQC A;  3OVB A;  9ICH A;  5CFU A;  2BPG A;  3V7J A;  5J0U A;  1ZQS A;  4P2H A;  4NXT A;  4WCW A;  1JN3 A;  4WQK A;  3RJE A;  4LT6 A;  2ZH7 A;  4WH5 A;  2I9G A;  9ICP A;  3OV7 A;  4XQ7 A;  4RQ1 A;  4R66 A;  2ZH4 A;  5J2H A;  4MF2 A;  4QZA A;  4OAF A;  1JQR A;  5CWR A;  4IQT A;  1MIV A;  4F5O A;  7ICS A;  4I28 A;  3MGI A;  4I2A A;  5HHI A;  9ICX A;  5JTG A;  2PBE A;  1UEV A;  4FHP A;  8ICU A;  1ZQU A;  2P66 A;  3NYB A;  5EOZ A;  4M04 A;  2M2T A;  2BE3 A;  2BBJ A;  4F5Q A;  4YCX A;  8ICI A;  4EEB A;  1ZQQ A;  7ICV A;  9ICT A;  1R8C A;  4K4I A;  4UB4 A;  5F2V O;  4I27 A;  7ICO A;  5J29 A;  4F5N A;  5HRL A;  1ZQF A;  4IQW A;  4RQ7 A;  5J2J A;  4O5C A;  1ZQX A;  4JLX A;  4QZB A;  4OAG A;  3C5F A;  2DRB A;  4QZ9 A;  5HC9 A;  5HRD A;  4KLJ A;  4K97 A;  1BPB A;  1BPE A;  4F5P A;  2DR5 A;  8ICA A;  1NO5 A;  1ZQV A;  2B4V A;  3JPP A;  2FCL A;  1ZQZ A;  4PHE A;  4JWM A;  8ICZ A;  4NXX A;  4I2F A;  2FMP A;  4YMN A;  4FHW A;  4K9A A;  4ATB B;  3V72 A;  4XA5 A;  5J2C A;  3JZ0 A;  5J0T A;  1MIY A;  4I2H A;  4PH5 A;  1ZQP A;  2IHO A;  3AUO A;  4KLT A;  4O67 A;  3OGU A;  4EP7 A;  4DOC A;  4RWN A;  9ICN A;  1ZQR A;  4EBJ A;  4PHA A;  4X4P A;  3EF2 A;  7ICN A;  1TFW A;  4KLL A;  2W9M A;  2BCV A;  8ICP A;  2DRA A;  5TZV A;  4YMM A;  9ICG A;  4N7R A;  5J2D A;  3ISD A;  5B3Q A;  5DDY A;  3RH4 A;  2HN2 A;  3RJK A;  5IIN A;  4O68 A;  3ER8 C;  1BPZ A;  3JYY A;  4MFF A;  4PPX A;  5J2K A;  4RQ5 A;  5J0R A;  4Z6E A;  2ZH5 A;  4RQ8 A;  4P4O A;  3C5G A;  3C2L A;  5HRB A;  1TVA A;  4KLU A;  1MQ3 A;  1NOM A;  4QZD A;  4NLK A;  4LZG A;  5HR9 A;  4WC6 A;  4RWP A;  4PGY A;  4X4U A;  2VAN A;  3RH6 A;  2GWS A;  4K4G A;  5B3P A;  4M9J A;  4QZE A;  4JWN A;  4K4H A;  3JPS A;  4QZF A;  3JPN A;  2ZHA A;  3UQ2 A;  2DR7 A;  4WC7 A;  4RQ2 A;  3HX0 A;  2BCR A;  5DBB A;  4EED A;  9ICR A;  4I2I A;  3HIY A;  3WFP A;  5HRG A;  1GPJ A;  2Q66 A;  4QZG A;  1ZQW A;  4MFA A;  4WC5 A;  5J0S A;  1R89 A;  8ICS A;  4UAW A;  3LQC B;  4FH5 A;  4LVS A;  1RZT A;  1ZJN A;  4X4V A;  4FHX A;  4UB3 A;  1XSP A;  5D49 A;  8ICJ A;  1ZQY A;  4FHY A;  4I2D A;  5J0P A;  4NLZ A;  3UPQ A;  1ZQH A;  1HUO A;  9ICS A;  4E80 A;  3AQM A;  1Q78 A;  1FA0 A;  4QZI A;  4WC3 A;  4X5V A;  4KLF A;  3NKU A;  3K75 D;  2HHP A;  8ICC A;  1KNY A;  4S3N A;  4UBC A;  3MGH A;  1UET A;  3C66 A;  5J2B A;  8ICR A;  4RWO A;  4M47 A;  4AT9 A;  4IQU A;  3AU2 A;  4E7X A;  5DB7 A;  1ZQO A;  4IQV A;  5J2I A;  1ZQM A;  4WC0 A;  4KLH A;  5DED A;  4RT3 A;  3PML A;  5HRI A;  8ICT A;  5J2E A;  1XSL A;  9ICW A;  4UAY A;  1VFG A;  7ICE A;  5BOL A;  4EV6 A;  3MDA A;  2IUB A;  5CP2 A;  2BBH A;  4O5K A;  4I2J A;  4WBZ A;  2PFP A;  4M9H A;  8ICO A;  4K96 A;  3NVO A;  3TFS A;  8ICW A;  4Z6C A;  4RQ6 A;  1ZQN A;  4AT7 B;  9ICI A;  4YD2 A;  4M9L A;  3V7K A;  4I2E A;  8ICE A;  1YLQ A;  2ZH6 A;  9ICA A;  4M0A A;  4WC4 A;  5HRE A;  2PFN A;  1R8A A;  3RJG A;  4NY8 A;  5J0X A;  3RJH A;  4NXW A;  4TUR A;  7ICM A;  3JPQ A;  1ZJM A;  4UB1 A;  5III A;  3AU6 A;  4KLE A;  4X4S A;  4YMO A;  3MBY A;  4WC2 A;  3RH5 A;  4M9N A;  3OUY B;  5J0O A;  5CA7 A;  3RJF A;  2M2V A;  3V7L A;  5BPC A;  4I2C A;  4PHD A;  5J2A A;  2DR9 A;  5J0W A;  2IHM A;  4GXJ A;  1OU5 A;  4Z6D A;  4PGQ A;  4RPY A;  4RQ3 A;  4E8F A;  3HW8 A;  3ER9 B;  3HJ1 A;  4KM5 A;  3AQL A;  4RWQ A;  1ZQB A;  4KLS A;  1VJ7 A;  1ZQG A;  3UQ0 A;  4ATB A;  7ICU A;  4O6A A;  4LEV A;  3NWI A;  1ZQL A;  4UAZ A;  8ICN A;  4AT8 B;  4NKU A;  4OAH A;  3CK6 A;  3C2M A;  4PGX A;  4LEZ A;  1R8B A;  4KLD A;  5J0Q A;  4XQ8 A;  9ICV A;  1MQ2 A;  5CB1 A;  1BPX A;  2ZHB A;  4EGW A;  2FMS A;  1JMS A;  2ZH1 A;  4FH3 A;  4X4N A;  4X4T A;  2PFQ A;  2BPC A;  5DB8 A;  1Q79 A;  4M5D A;  4R64 A;  1WOT A;  4NKT A;  4K9B A;  2ISP A;  4LEY A;  7ICG A;  5DKW A;  8ICM A;  3L9D A;  2GAF D;  4I0U A;  4WOY A;  4KLQ A;  1ZQJ A;  4TUQ A;  4XRH A;  8ICK A;  8ICQ A;  4RQ4 A;  4LZD A;  7ICQ A;  1HUZ A;  4Z6F A;  3K7D A;  1XSN A;  4HX0 A;  5IIK A;  3JPT A;  3ISB A;  3MDC A;  4I2G A;  4X4O A;  4KLO A;  9ICC A;  5HRK A;  4I29 A;  5DBC A;  3UXO A;  3H39 A;  4K8V A;  3TFR A;  4M9G A;  8ICX A;  3B0Y A;  1RPL A;  7ICT A;  3JPO A;  2ZH3 A;  9ICO A;  5DBA A;  1BPD A;  5CFS A;  4AT9 B;  9ICL A;  4WBY A;  5D63 A;  2NRK A;  3WFO A;  4JLZ A;  3UXN A;  1PX5 A;  4F5R A;  2O1P A;  1BPY A;  1KDH A;  3C18 A;  5D61 A;  2BCS A;  4KLM A;  4UB5 A;  7ICF A;  3C2K A;  5CR0 A;  5J0Y A;  8ICL A;  2EWR A;  4O9M A;  5DB6 A;  4RQ0 A;  1ZQA A;  4IG8 A;  3H38 A;  7ICP A;  1ZQE A;  4UBB A;  4WQL A;  2PXI A;  4X4Q A;  1ZQK A;  3PNC A;  3GDX A;  2ZH2 A;  2PFO A;  2M2W A;  4I2B A;  1TFY A;  4UD4 A;  4R65 A;  3PMN A;  4DOB A;  3HJ4 A;  4P4M A;  3H3A A;  5CHE A;  3OWG A;  4XJE A;  2B56 A;  8ICF A;  4NM1 A;  4P4P A;  4QZC A;  2GA9 D;  4PHP A;  5CJ7 A;  2FMQ A;  1JAJ A;  1UEU A;  3UPS A;  4RPZ A;  4LEW A;  4X4R A;  8ICV A;  5CFT A; 
#chains in the Genus database with same CATH homology
 4TUP A;  4KLI A;  8ICY A;  4RT2 A;  4NLN A;  4DOA A;  5D46 A;  5HRH A;  4FO6 A;  9ICE A;  4UD5 A;  4DO9 A;  2DVI A;  3ISC A;  9ICJ A;  4MFC A;  3AQN A;  2RFF A;  1ZQD A;  5BOM A;  5IIM A;  1V4A A;  3OVS A;  1TV9 A;  5HHH A;  4AT7 A;  3H37 A;  1ZQT A;  7ICR A;  5HRF A;  9ICK A;  2BCU A;  4X0B A;  7ICJ A;  3OVA A;  4FHV A;  5J2F A;  1ZQI A;  3RJJ A;  3WFR E;  9ICU A;  3AQK A;  2M2U A;  1F5A A;  5J2G A;  2DR8 A;  2ZH9 A;  4R63 A;  1MIW A;  4NM2 A;  1KEJ A;  2ISO A;  3LK9 A;  2ID1 A;  9ICM A;  3OUY A;  5DEC A;  4QZ8 A;  9ICB A;  7ICL A;  5DB9 A;  7ICH A;  4QZH A;  4YD1 A;  5IIL A;  3UXP A;  5D4B A;  2O5A A;  3HWT A;  5CHG A;  4RPX A;  4GXK A;  3JPR A;  3WFQ E;  5IIJ A;  4YN4 A;  4WC1 A;  3WFS C;  8ICH A;  4O5E A;  4X0A A;  4GXI A;  4KLG A;  4AT8 A;  9ICQ A;  5IIO A;  4NXZ A;  8ICG A;  3B0X A;  4EBK A;  4MF8 A;  9ICF A;  2BCQ A;  7ICI A;  5DDM A;  4TUS A;  4M2Y A;  2ZH8 A;  4UB2 A;  8ICB A;  7ICK A;  4XUS A;  2BPF A;  3RJI A;  1ZQC A;  3OVB A;  9ICH A;  2BPG A;  3V7J A;  5J0U A;  1ZQS A;  4P2H A;  4WCW A;  1JN3 A;  3RJE A;  4LT6 A;  2ZH7 A;  2I9G A;  9ICP A;  3OV7 A;  4XQ7 A;  4RQ1 A;  4R66 A;  2ZH4 A;  5J2H A;  4MF2 A;  4QZA A;  1JQR A;  5CWR A;  4IQT A;  1MIV A;  4F5O A;  7ICS A;  4I28 A;  3MGI A;  4I2A A;  5HHI A;  9ICX A;  2PBE A;  1UEV A;  4FHP A;  8ICU A;  1ZQU A;  2P66 A;  3NYB A;  5EOZ A;  4M04 A;  2M2T A;  2BE3 A;  4F5Q A;  4YCX A;  8ICI A;  1ZQQ A;  7ICV A;  9ICT A;  1R8C A;  4K4I A;  4UB4 A;  5F2V O;  4I27 A;  7ICO A;  5J29 A;  4F5N A;  5HRL A;  1ZQF A;  4IQW A;  4RQ7 A;  5J2J A;  4O5C A;  1ZQX A;  4QZB A;  3C5F A;  2DRB A;  4QZ9 A;  5HC9 A;  5HRD A;  4KLJ A;  1BPB A;  1BPE A;  4F5P A;  2DR5 A;  8ICA A;  1NO5 A;  1ZQV A;  3JPP A;  1ZQZ A;  4PHE A;  4JWM A;  8ICZ A;  4I2F A;  2FMP A;  4YMN A;  4FHW A;  4ATB B;  3V72 A;  4XA5 A;  5J2C A;  3JZ0 A;  5J0T A;  1MIY A;  4I2H A;  4PH5 A;  1ZQP A;  3AUO A;  4KLT A;  3OGU A;  4EP7 A;  4DOC A;  4RWN A;  9ICN A;  1ZQR A;  4EBJ A;  4PHA A;  4X4P A;  7ICN A;  1TFW A;  4KLL A;  2W9M A;  2BCV A;  8ICP A;  2DRA A;  5TZV A;  4YMM A;  9ICG A;  5J2D A;  3ISD A;  5DDY A;  3RH4 A;  3RJK A;  5IIN A;  1BPZ A;  3JYY A;  4MFF A;  4PPX A;  5J2K A;  4RQ5 A;  5J0R A;  4Z6E A;  2ZH5 A;  4RQ8 A;  4P4O A;  3C5G A;  3C2L A;  5HRB A;  1TVA A;  4KLU A;  1MQ3 A;  1NOM A;  4QZD A;  4NLK A;  4LZG A;  5HR9 A;  4WC6 A;  4RWP A;  4PGY A;  4X4U A;  2VAN A;  3RH6 A;  2GWS A;  4K4G A;  4M9J A;  4QZE A;  4JWN A;  4K4H A;  3JPS A;  4QZF A;  3JPN A;  2ZHA A;  3UQ2 A;  2DR7 A;  4WC7 A;  4RQ2 A;  3HX0 A;  2BCR A;  5DBB A;  9ICR A;  4I2I A;  3HIY A;  3WFP A;  5HRG A;  2Q66 A;  4QZG A;  1ZQW A;  4MFA A;  4WC5 A;  5J0S A;  1R89 A;  8ICS A;  4UAW A;  3LQC B;  4FH5 A;  4LVS A;  1RZT A;  1ZJN A;  4X4V A;  4FHX A;  4UB3 A;  1XSP A;  5D49 A;  8ICJ A;  1ZQY A;  4FHY A;  4I2D A;  5J0P A;  4NLZ A;  3UPQ A;  1ZQH A;  1HUO A;  9ICS A;  4E80 A;  3AQM A;  1Q78 A;  1FA0 A;  4QZI A;  4WC3 A;  4X5V A;  4KLF A;  3K75 D;  2HHP A;  8ICC A;  1KNY A;  4S3N A;  4UBC A;  3MGH A;  1UET A;  3C66 A;  5J2B A;  8ICR A;  4RWO A;  4M47 A;  4AT9 A;  4IQU A;  3AU2 A;  4E7X A;  5DB7 A;  1ZQO A;  4IQV A;  5J2I A;  1ZQM A;  4WC0 A;  4KLH A;  5DED A;  4RT3 A;  3PML A;  5HRI A;  8ICT A;  5J2E A;  1XSL A;  9ICW A;  4UAY A;  1VFG A;  7ICE A;  5BOL A;  3MDA A;  5CP2 A;  4O5K A;  4I2J A;  4WBZ A;  2PFP A;  4M9H A;  8ICO A;  3TFS A;  8ICW A;  4Z6C A;  4RQ6 A;  1ZQN A;  4AT7 B;  9ICI A;  4YD2 A;  4M9L A;  3V7K A;  4I2E A;  8ICE A;  1YLQ A;  2ZH6 A;  9ICA A;  4M0A A;  4WC4 A;  5HRE A;  2PFN A;  1R8A A;  3RJG A;  4NY8 A;  5J0X A;  3RJH A;  4TUR A;  7ICM A;  3JPQ A;  1ZJM A;  4UB1 A;  5III A;  3AU6 A;  4KLE A;  4X4S A;  4YMO A;  3MBY A;  4WC2 A;  3RH5 A;  4M9N A;  3OUY B;  5J0O A;  5CA7 A;  3RJF A;  2M2V A;  3V7L A;  5BPC A;  4I2C A;  4PHD A;  5J2A A;  2DR9 A;  5J0W A;  2IHM A;  4GXJ A;  1OU5 A;  4Z6D A;  4PGQ A;  4RPY A;  4RQ3 A;  4E8F A;  3HW8 A;  3HJ1 A;  4RWQ A;  3AQL A;  1ZQB A;  4KLS A;  1VJ7 A;  1ZQG A;  3UQ0 A;  4ATB A;  7ICU A;  1ZQL A;  4UAZ A;  8ICN A;  4AT8 B;  4NKU A;  3C2M A;  4PGX A;  1R8B A;  4KLD A;  5J0Q A;  4XQ8 A;  9ICV A;  1MQ2 A;  5CB1 A;  1BPX A;  2ZHB A;  2FMS A;  1JMS A;  2ZH1 A;  4FH3 A;  4X4N A;  4X4T A;  2PFQ A;  2BPC A;  5DB8 A;  1Q79 A;  4M5D A;  4R64 A;  1WOT A;  4NKT A;  2ISP A;  7ICG A;  5DKW A;  8ICM A;  3L9D A;  4KLQ A;  1ZQJ A;  4TUQ A;  4XRH A;  8ICK A;  8ICQ A;  4RQ4 A;  4LZD A;  7ICQ A;  1HUZ A;  4Z6F A;  1XSN A;  3JPT A;  5IIK A;  3ISB A;  3MDC A;  4I2G A;  4X4O A;  4KLO A;  9ICC A;  5HRK A;  4I29 A;  5DBC A;  3UXO A;  3H39 A;  3TFR A;  4M9G A;  8ICX A;  3B0Y A;  1RPL A;  7ICT A;  3JPO A;  2ZH3 A;  9ICO A;  5DBA A;  1BPD A;  9ICL A;  4AT9 B;  4WBY A;  2NRK A;  3WFO A;  3UXN A;  1PX5 A;  4F5R A;  2O1P A;  1BPY A;  1KDH A;  3C18 A;  2BCS A;  4KLM A;  4UB5 A;  7ICF A;  3C2K A;  5CR0 A;  5J0Y A;  8ICL A;  4O9M A;  5DB6 A;  4RQ0 A;  1ZQA A;  4IG8 A;  3H38 A;  7ICP A;  1ZQE A;  4UBB A;  2PXI A;  4X4Q A;  1ZQK A;  3PNC A;  3GDX A;  2ZH2 A;  2PFO A;  2M2W A;  4I2B A;  1TFY A;  4UD4 A;  4R65 A;  3PMN A;  4DOB A;  3HJ4 A;  4P4M A;  3H3A A;  8ICF A;  4NM1 A;  4P4P A;  4QZC A;  4PHP A;  5CJ7 A;  2FMQ A;  1JAJ A;  1UEU A;  3UPS A;  4RPZ A;  4X4R A;  8ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...