4WC7A

Structure of trna-processing enzyme complex 5
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc7A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc7A01
5J2JA 3OVSA 5J0WA 5HR9A 3RH5A 3TFRA 8ICZA 4IQUA 1MQ2A 4YMMA 4RQ4A 3V7LA 4LVSA 4RT2A 4I2BA 3JPTA 8ICRA 4FHPA 9ICSA 9ICAA 2ZH2A 1BPYA 4JWMA 5DBBA 1ZQQA 3WFPA 4PHAA 3HJ1A 1ZJNA 4QZAA 1HUOA 2FMQA 4NKTA 4WBZA 4M0AA 4WC5A 7ICOA 1YLQA 9ICHA 4QZ9A 1BPXA 3C5FA 2ZHAA 2HHPA 3OVAA 2O5AA 4I2DA 2M2WA 5CA7A 9ICIA 2ISOA 4NM1A 9ICMA 3PNCA 3HW8A 4Z6FA 4O5EA 4XQ7A 2M2VA 4EP7A 3RJJA 4LZGA 4MFFA 8ICUA 4WC3A 1MQ3A 5HRIA 4K4IA 1R8CA 4WC0A 4K4GA 1VJ7A 5J0TA 2PFQA 1UEVA 4NKUA 2ZH3A 4WC7A 2PFOA 1KNYA 4KLHA 5IIMA 3LK9A 1MIVA 5HREA 4M9HA 4UD4A 4WCWA 7ICTA 7ICPA 3OUYA 1ZQYA 8ICQA 3UXNA 9ICXA 3RH4A 4Z6CA 1HUZA 4RQ0A 4RT3A 1RPLA 3JZ0A 1KDHA 4RQ5A 1OU5A 5HRKA 5J0OA 9ICUA 9ICWA 1R8BA 3GDXA 8ICGA 4QZCA 4EBKA 5J2HA 3JPRA 1BPDA 2M2TA 4WC4A 4X4PA 8ICNA 1KEJA 3RJGA 4X4OA 3C5GA 4GXIA 1MIYA 3MBYA 2O1PA 2DRBA 5DBAA 3V7KA 3JPQA 2BPFA 8ICBA 4RWOA 5DDYA 1ZQAA 4RQ6A 4X4SA 4I2EA 1ZQUA 3AU2A 5DB7A 3MGHA 4I2GA 1Q79A 4X4NA 1V4AA 8ICPA 1BPEA 3H37A 4KLLA 3H3AA 5HRLA 4X4VA 2BCUA 7ICGA 1TFYA 3ISCA 4X4QA 1ZQWA 2BCRA 1PX5A 4KLMA 4KLGA 4QZHA 4QZFA 2ID1A 4PPXA 3ISDA 4I2FA 1NOMA 1Q78A 2ISPA 3UXOA 4R63A 2BCSA 2DR9A 3OUYB 5HHIA 1R8AA 3UPQA 9ICCA 5J0SA 3JYYA 4RPYA 4M9GA 7ICKA 7ICRA 3AU6A 4X5VA 5J0PA 8ICYA 4FHWA 4O5CA 9ICKA 3WFOA 2PXIA 5IINA 2ZH5A 9ICRA 2PFPA 5HC9A 4WC6A 1ZQSA 9ICBA 9ICGA 4R66A 4NLZA 7ICQA 4GXKA 3C18A 7ICHA 5CJ7A 4ATBA 1ZQVA 2DRAA 4FH5A 5J2BA 2ZH1A 5IILA 4QZIA 1XSLA 9ICJA 8ICMA 4M04A 4LZDA 5DB8A 4AT9A 5CWRA 4RQ8A 3L9DA 4UAYA 4IQVA 4UD5A 3MDAA 4XQ8A 4F5NA 2PBEA 3RJKA 5D46A 4P4MA 3AQNA 4X4RA 3OVBA 4F5QA 4FH3A 4X4UA 2RFFA 5DBCA 4UBCA 7ICSA 4KLOA 5BOLA 3UQ2A 4KLIA 4MF2A 4PHPA 5HHHA 1ZQBA 3PMNA 1ZQIA 2BCVA 4RWQA 1ZQPA 4E80A 2BCQA 3JPSA 4MF8A 4Z6EA 4O9MA 4YN4A 4RQ1A 7ICLA 4RQ2A 4DOAA 7ICVA 5DEDA 1ZQOA 7ICUA 3WFQE 3HIYA 2FMPA 1FA0A 5CP2A 5DDMA 5CR0A 5J0YA 3C2LA 3AQKA 1JN3A 2NRKA 4X0AA 4UAZA 3UQ0A 1ZJMA 4QZEA 4I28A 4RPXA 1R89A 4P2HA 4I2IA 5HRHA 3TFSA 1MIWA 3B0YA 5BOMA 9ICVA 1ZQKA 3JPPA 4ATBB 5TZVA 4I2HA 4FHYA 8ICKA 4PGQA 2ZH6A 4R64A 4F5RA 5CHGA 4M9LA 7ICJA 3LQCB 4AT9B 3HX0A 4KLQA 4GXJA 4WC1A 4RWPA 8ICTA 3RJEA 9ICEA 4IQWA 4K4HA 4M5DA 7ICEA 2M2UA 5CB1A 4YMOA 4NLNA 8ICWA 3NYBA 5HRDA 7ICNA 2ZH9A 5HRGA 1F5AA 3PMLA 5J2CA 5J2KA 8ICSA 5BPCA 5J2EA 5J0RA 4UB2A 5DKWA 4KLTA 2W9MA 8ICOA 3RJFA 1UEUA 4I2AA 4F5OA 2ZH8A 1ZQJA 4KLUA 9ICOA 1ZQDA 4DO9A 8ICVA 9ICLA 9ICPA 2DR5A 3ISBA 3C66A 5J2DA 4UB3A 1ZQMA 4MFCA 3JPNA 5HRFA 1BPBA 4TUQA 3JPOA 4NM2A 4PHEA 3MGIA 4AT7A 2ZHBA 1ZQXA 2BE3A 4QZBA 5J0QA 4M9JA 5J2FA 1ZQEA 2BPCA 1WOTA 8ICLA 8ICAA 4E7XA 4KLJA 4QZGA 4P4PA 1XSPA 1TV9A 4IQTA 2Q66A 5J29A 8ICHA 4FO6A 2FMSA 5DB6A 5D4BA 4YD2A 4I2JA 8ICJA 4NY8A 4TUSA 5HRBA 4AT8A 4I27A 4XUSA 4QZDA 3HJ4A 2I9GA 4LT6A 3V7JA 4KLDA 5DB9A 1NO5A 4NLKA 4YMNA 8ICXA 4X0BA 4KLSA 3RJHA 1ZQCA 1TVAA 4XRHA 2P66A 4I29A 3MDCA 3HWTA 2ZH7A 5IIIA 3UXPA 4UAWA 4RQ3A 4JWNA 3C2MA 3OV7A 1JAJA 3UPSA 5IIKA 3C2KA 5J2IA 5EOZA 1ZQFA 4FHXA 4F5PA 5DECA 4UBBA 1ZQGA 1ZQZA 8ICIA 2DR7A 4YCXA 3H39A 4NXZA 5J2AA 8ICEA 5J0XA 4AT7B 4MFAA 4R65A 1ZQRA 4M2YA 5D49A 2DR8A 4X4TA 4PGXA 3OGUA 4KLEA 9ICQA 1BPZA 4M9NA 3B0XA 9ICTA 4E8FA 4UB1A 4DOBA 5J2GA 2BPGA 4PH5A 1RZTA 4RPZA 3V72A 7ICMA 3RH6A 1JQRA 4O5KA 3WFRE 1VFGA 9ICNA 4KLFA 4AT8B 3K75D 1XSNA 4YD1A 1ZQNA 7ICIA 3AQLA 4S3NA 5J0UA 1UETA 4I2CA 7ICFA 8ICFA 4UB5A 1ZQTA 4XA5A 4IG8A 4UB4A 4RWNA 3RJIA 2GWSA 4RQ7A 2ZH4A 2DVIA 3AUOA 5IIJA 4Z6DA 4PHDA 1JMSA 4QZ8A 1ZQLA 4WC2A 4WBYA 5IIOA 3WFSC 9ICFA 1ZQHA 4TURA 4P4OA 4DOCA 2PFNA 8ICCA 4PGYA 4FHVA 2IHMA 4TUPA 4EBJA 2VANA 5F2VO 3H38A 3AQMA 4M47A 1TFWA
chains in the Genus database with same CATH superfamily
5J2JA 3OVSA 5J0WA 5HR9A 3RH5A 4EV6A 3TFRA 5D61A 8ICZA 4IQUA 1MQ2A 4YMMA 4RQ4A 3V7LA 4LVSA 4RT2A 4I2BA 3JPTA 8ICRA 4FHPA 9ICSA 9ICAA 2ZH2A 1BPYA 4JWMA 5DBBA 1ZQQA 2IUBA 3WFPA 4PHAA 3HJ1A 1ZJNA 4QZAA 1HUOA 2FMQA 4NKTA 4WBZA 4M0AA 4WC5A 7ICOA 4OAHA 4O69A 1YLQA 9ICHA 4QZ9A 1BPXA 2GA9D 3C5FA 2ZHAA 2HHPA 3OVAA 2O5AA 4I2DA 2M2WA 5CA7A 2B4VA 9ICIA 2ISOA 4NM1A 9ICMA 3PNCA 3HW8A 4Z6FA 4O5EA 4XQ7A 2M2VA 4EP7A 4K96A 3RJJA 4LZGA 4MFFA 8ICUA 4WC3A 4WOYA 1MQ3A 5HRIA 2HN2A 4K4IA 1R8CA 3NWIA 4WC0A 4K4GA 1VJ7A 5J0TA 2PFQA 1UEVA 4NKUA 4NXXA 2ZH3A 4WC7A 2PFOA 1KNYA 3JCFA 4KLHA 5IIMA 2B51A 3LK9A 1MIVA 4NXWA 5HREA 4M9HA 4UD4A 4WCWA 7ICTA 7ICPA 3OUYA 1ZQYA 4HX0A 8ICQA 3ERCC 3UXNA 9ICXA 3RH4A 4Z6CA 1HUZA 4RQ0A 4RT3A 1RPLA 3JZ0A 1KDHA 4RQ5A 1OU5A 5HRKA 5J0OA 9ICUA 9ICWA 1R8BA 3GDXA 8ICGA 4QZCA 4EBKA 5J2HA 3JPRA 1BPDA 4WQKA 2M2TA 4WC4A 4X4PA 8ICNA 4NXUA 1KEJA 3RJGA 4X4OA 2GAFD 3C5GA 4LEZA 4GXIA 5B3QA 1MIYA 3MBYA 2O1PA 2DRBA 5DBAA 3V7KA 4JLZA 5CHEA 4NXTA 3JPQA 2BPFA 8ICBA 4RWOA 5DDYA 1ZQAA 4RQ6A 4X4SA 4I2EA 1ZQUA 3AU2A 5DB7A 3MGHA 4I2GA 1Q79A 4X4NA 1V4AA 8ICPA 1BPEA 3H37A 3MCRA 4KLLA 4KM5A 3H3AA 5HRLA 4X4VA 2BCUA 7ICGA 1TFYA 3ISCA 4X4QA 1ZQWA 2BCRA 1PX5A 4KLMA 4KLGA 4QZHA 4QZFA 2ID1A 4PPXA 3ISDA 3PHZA 4I2FA 1NOMA 1Q78A 2ISPA 3UXOA 4R63A 2BCSA 2DR9A 3OUYB 5HHIA 1R8AA 3UPQA 9ICCA 5J0SA 5CFUA 3JYYA 4RPYA 4M9GA 7ICKA 2FCLA 7ICRA 4NXVA 3AU6A 4X5VA 5J0PA 8ICYA 4FHWA 4O5CA 9ICKA 2IHOA 4WQLA 3WFOA 2PXIA 5IINA 2ZH5A 9ICRA 2PFPA 5HC9A 4WC6A 1ZQSA 9ICBA 9ICGA 4R66A 4NLZA 7ICQA 3ER8C 4GXKA 3C18A 7ICHA 5CJ7A 4ATBA 1ZQVA 2DRAA 4FH5A 5J2BA 2ZH1A 5IILA 4QZIA 1XSLA 9ICJA 8ICMA 4M04A 4LZDA 5DB8A 4AT9A 5CWRA 4RQ8A 3L9DA 4UAYA 4IQVA 4UD5A 4K99A 3MDAA 4XQ8A 4F5NA 4OAFA 2PBEA 3RJKA 5D46A 4EEDA 4P4MA 3AQNA 4N7RA 4WH5A 4X4RA 3OVBA 4F5QA 4FH3A 4X4UA 2RFFA 5DBCA 4UBCA 7ICSA 4KLOA 5BOLA 3UQ2A 4KLIA 4MF2A 4PHPA 5HHHA 1ZQBA 3PMNA 3OWGA 1ZQIA 2BCVA 4RWQA 1ZQPA 4FO1A 4E80A 4K98A 5B3PA 2BCQA 3JPSA 4MF8A 4Z6EA 4O9MA 4YN4A 4RQ1A 7ICLA 4RQ2A 4DOAA 7ICVA 5DEDA 1ZQOA 7ICUA 3WFQE 3CK6A 3HIYA 2FMPA 1FA0A 5CP2A 5DDMA 5CR0A 5J0YA 3C2LA 3AQKA 1JN3A 2NRKA 4X0AA 4UAZA 3UQ0A 1ZJMA 4QZEA 4I28A 4RPXA 3NKUA 1R89A 4P2HA 4I2IA 5HRHA 3TFSA 2EWRA 1MIWA 3B0YA 5BOMA 9ICVA 1ZQKA 3JPPA 4ATBB 5TZVA 4I2HA 4FHYA 4EGWA 8ICKA 4PGQA 2ZH6A 4R64A 4F5RA 5CHGA 4M9LA 7ICJA 3LQCB 4AT9B 3HX0A 4KLQA 4I0UA 4GXJA 4WC1A 4RWPA 8ICTA 3RJEA 9ICEA 4IQWA 4K4HA 4M5DA 7ICEA 2M2UA 5CB1A 4YMOA 4NLNA 8ICWA 3NYBA 3NVOA 5HRDA 7ICNA 2ZH9A 5HRGA 1F5AA 3PMLA 5J2CA 5J2KA 8ICSA 4EEBA 5BPCA 5J2EA 5J0RA 4UB2A 5DKWA 4KLTA 2W9MA 8ICOA 3RJFA 1UEUA 4I2AA 4F5OA 3K7DA 2ZH8A 1ZQJA 4KLUA 9ICOA 1ZQDA 4DO9A 8ICVA 9ICLA 9ICPA 2DR5A 3ISBA 3C66A 5J2DA 4UB3A 1ZQMA 4MFCA 3JPNA 5HRFA 1BPBA 4K9AA 5CFSA 4TUQA 3JPOA 4NM2A 4PHEA 3MGIA 4AT7A 2ZHBA 1ZQXA 2BE3A 4QZBA 5J0QA 4M9JA 5J2FA 1ZQEA 2BPCA 5JTGA 1WOTA 2B56A 4K97A 4LEWA 8ICLA 5D63A 4E7XA 4KLJA 8ICAA 4QZGA 4P4PA 1XSPA 1TV9A 4IQTA 4KB6A 2Q66A 5J29A 8ICHA 4FO6A 2FMSA 5DB6A 5D4BA 4YD2A 4I2JA 8ICJA 4NY8A 4TUSA 5HRBA 4AT8A 4I27A 4XUSA 2BBHA 3HJ4A 5CFTA 4QZDA 4LT6A 2I9GA 3V7JA 4KLDA 5DB9A 1NO5A 4NLKA 4YMNA 8ICXA 4X0BA 4KLSA 4K8VA 3RJHA 4LEVA 1ZQCA 1TVAA 4XRHA 2P66A 4I29A 3MDCA 3HWTA 2ZH7A 5IIIA 3UXPA 4UAWA 4RQ3A 4JWNA 3C2MA 3OV7A 1JAJA 3UPSA 5IIKA 3C2KA 5J2IA 5EOZA 1ZQFA 4MKPA 4FHXA 4F5PA 5DECA 4UBBA 1ZQGA 1ZQZA 4LEYA 8ICIA 2DR7A 4YCXA 3H39A 4NXZA 5J2AA 8ICEA 5J0XA 4AT7B 4MFAA 4R65A 1ZQRA 4M2YA 5D49A 2DR8A 4X4TA 4PGXA 3OGUA 4KLEA 9ICQA 1BPZA 4M9NA 3B0XA 4O68A 9ICTA 4K9BA 3EF2A 4E8FA 4UB1A 4DOBA 5J2GA 2BPGA 4PH5A 1RZTA 4RPZA 3V72A 7ICMA 3RH6A 1JQRA 4O5KA 3WFRE 1VFGA 9ICNA 4XJEA 4KLFA 4AT8B 3K75D 4OAGA 1XSNA 4YD1A 1ZQNA 7ICIA 3AQLA 5D62A 4S3NA 5J0UA 1UETA 4O6AA 4I2CA 7ICFA 1GPJA 8ICFA 4UB5A 1ZQTA 4XA5A 4IG8A 4O67A 4OAIZ 4UB4A 4RWNA 3ER9B 3RJIA 2GWSA 4RQ7A 2ZH4A 2DVIA 3AUOA 5IIJA 4Z6DA 4PHDA 1JMSA 4QZ8A 1ZQLA 4WC2A 4JLXA 4WBYA 5IIOA 3WFSC 9ICFA 1ZQHA 2HN1A 2BBJA 4TURA 4P4OA 4DOCA 2PFNA 8ICCA 4PGYA 4FHVA 2IHMA 4TUPA 4EBJA 2VANA 5F2VO 3H38A 3AQMA 4M47A 1TFWA
chains in the Genus database with same CATH topology
5J2JA 3OVSA 5J0WA 5HR9A 3RH5A 3TFRA 8ICZA 4IQUA 1MQ2A 4YMMA 4RQ4A 3V7LA 4LVSA 4RT2A 4I2BA 3JPTA 8ICRA 4FHPA 9ICSA 9ICAA 2ZH2A 1BPYA 4JWMA 5DBBA 1ZQQA 3WFPA 4PHAA 3HJ1A 1ZJNA 4QZAA 1HUOA 2FMQA 4NKTA 4WBZA 4M0AA 4WC5A 7ICOA 1YLQA 9ICHA 4QZ9A 1BPXA 3C5FA 2ZHAA 2HHPA 3OVAA 2O5AA 4I2DA 2M2WA 5CA7A 9ICIA 2ISOA 4NM1A 9ICMA 3PNCA 3HW8A 4Z6FA 4O5EA 4XQ7A 2M2VA 4EP7A 3RJJA 4LZGA 4MFFA 8ICUA 4WC3A 1MQ3A 5HRIA 4K4IA 1R8CA 4WC0A 4K4GA 1VJ7A 5J0TA 2PFQA 1UEVA 4NKUA 2ZH3A 4WC7A 2PFOA 1KNYA 4KLHA 5IIMA 3LK9A 1MIVA 5HREA 4M9HA 4UD4A 4WCWA 7ICTA 7ICPA 3OUYA 1ZQYA 8ICQA 3UXNA 9ICXA 3RH4A 4Z6CA 1HUZA 4RQ0A 4RT3A 1RPLA 3JZ0A 1KDHA 4RQ5A 1OU5A 5HRKA 5J0OA 9ICUA 9ICWA 1R8BA 3GDXA 8ICGA 4QZCA 4EBKA 5J2HA 3JPRA 1BPDA 2M2TA 4WC4A 4X4PA 8ICNA 1KEJA 3RJGA 4X4OA 3C5GA 4GXIA 1MIYA 3MBYA 2O1PA 2DRBA 5DBAA 3V7KA 3JPQA 2BPFA 8ICBA 4RWOA 5DDYA 1ZQAA 4RQ6A 4X4SA 4I2EA 1ZQUA 3AU2A 5DB7A 3MGHA 4I2GA 1Q79A 4X4NA 1V4AA 8ICPA 1BPEA 3H37A 4KLLA 3H3AA 5HRLA 4X4VA 2BCUA 7ICGA 1TFYA 3ISCA 4X4QA 1ZQWA 2BCRA 1PX5A 4KLMA 4KLGA 4QZHA 4QZFA 2ID1A 4PPXA 3ISDA 4I2FA 1NOMA 1Q78A 2ISPA 3UXOA 4R63A 2BCSA 2DR9A 3OUYB 5HHIA 1R8AA 3UPQA 9ICCA 5J0SA 3JYYA 4RPYA 4M9GA 7ICKA 7ICRA 3AU6A 4X5VA 5J0PA 8ICYA 4FHWA 4O5CA 9ICKA 3WFOA 2PXIA 5IINA 2ZH5A 9ICRA 2PFPA 5HC9A 4WC6A 1ZQSA 9ICBA 9ICGA 4R66A 4NLZA 7ICQA 4GXKA 3C18A 7ICHA 5CJ7A 4ATBA 1ZQVA 2DRAA 4FH5A 5J2BA 2ZH1A 5IILA 4QZIA 1XSLA 9ICJA 8ICMA 4M04A 4LZDA 5DB8A 4AT9A 5CWRA 4RQ8A 3L9DA 4UAYA 4IQVA 4UD5A 3MDAA 4XQ8A 4F5NA 2PBEA 3RJKA 5D46A 4P4MA 3AQNA 4X4RA 3OVBA 4F5QA 4FH3A 4X4UA 2RFFA 5DBCA 4UBCA 7ICSA 4KLOA 5BOLA 3UQ2A 4KLIA 4MF2A 4PHPA 5HHHA 1ZQBA 3PMNA 1ZQIA 2BCVA 4RWQA 1ZQPA 4E80A 2BCQA 3JPSA 4MF8A 4Z6EA 4O9MA 4YN4A 4RQ1A 7ICLA 4RQ2A 4DOAA 7ICVA 5DEDA 1ZQOA 7ICUA 3WFQE 3HIYA 2FMPA 1FA0A 5CP2A 5DDMA 5CR0A 5J0YA 3C2LA 3AQKA 1JN3A 2NRKA 4X0AA 4UAZA 3UQ0A 1ZJMA 4QZEA 4I28A 4RPXA 1R89A 4P2HA 4I2IA 5HRHA 3TFSA 1MIWA 3B0YA 5BOMA 9ICVA 1ZQKA 3JPPA 4ATBB 5TZVA 4I2HA 4FHYA 8ICKA 4PGQA 2ZH6A 4R64A 4F5RA 5CHGA 4M9LA 7ICJA 3LQCB 4AT9B 3HX0A 4KLQA 4GXJA 4WC1A 4RWPA 8ICTA 3RJEA 9ICEA 4IQWA 4K4HA 4M5DA 7ICEA 2M2UA 5CB1A 4YMOA 4NLNA 8ICWA 3NYBA 5HRDA 7ICNA 2ZH9A 5HRGA 1F5AA 3PMLA 5J2CA 5J2KA 8ICSA 5BPCA 5J2EA 5J0RA 4UB2A 5DKWA 4KLTA 2W9MA 8ICOA 3RJFA 1UEUA 4I2AA 4F5OA 2ZH8A 1ZQJA 4KLUA 9ICOA 1ZQDA 4DO9A 8ICVA 9ICLA 9ICPA 2DR5A 3ISBA 3C66A 5J2DA 4UB3A 1ZQMA 4MFCA 3JPNA 5HRFA 1BPBA 4TUQA 3JPOA 4NM2A 4PHEA 3MGIA 4AT7A 2ZHBA 1ZQXA 2BE3A 4QZBA 5J0QA 4M9JA 5J2FA 1ZQEA 2BPCA 1WOTA 8ICLA 8ICAA 4E7XA 4KLJA 4QZGA 4P4PA 1XSPA 1TV9A 4IQTA 2Q66A 5J29A 8ICHA 4FO6A 2FMSA 5DB6A 5D4BA 4YD2A 4I2JA 8ICJA 4NY8A 4TUSA 5HRBA 4AT8A 4I27A 4XUSA 4QZDA 3HJ4A 2I9GA 4LT6A 3V7JA 4KLDA 5DB9A 1NO5A 4NLKA 4YMNA 8ICXA 4X0BA 4KLSA 3RJHA 1ZQCA 1TVAA 4XRHA 2P66A 4I29A 3MDCA 3HWTA 2ZH7A 5IIIA 3UXPA 4UAWA 4RQ3A 4JWNA 3C2MA 3OV7A 1JAJA 3UPSA 5IIKA 3C2KA 5J2IA 5EOZA 1ZQFA 4FHXA 4F5PA 5DECA 4UBBA 1ZQGA 1ZQZA 8ICIA 2DR7A 4YCXA 3H39A 4NXZA 5J2AA 8ICEA 5J0XA 4AT7B 4MFAA 4R65A 1ZQRA 4M2YA 5D49A 2DR8A 4X4TA 4PGXA 3OGUA 4KLEA 9ICQA 1BPZA 4M9NA 3B0XA 9ICTA 4E8FA 4UB1A 4DOBA 5J2GA 2BPGA 4PH5A 1RZTA 4RPZA 3V72A 7ICMA 3RH6A 1JQRA 4O5KA 3WFRE 1VFGA 9ICNA 4KLFA 4AT8B 3K75D 1XSNA 4YD1A 1ZQNA 7ICIA 3AQLA 4S3NA 5J0UA 1UETA 4I2CA 7ICFA 8ICFA 4UB5A 1ZQTA 4XA5A 4IG8A 4UB4A 4RWNA 3RJIA 2GWSA 4RQ7A 2ZH4A 2DVIA 3AUOA 5IIJA 4Z6DA 4PHDA 1JMSA 4QZ8A 1ZQLA 4WC2A 4WBYA 5IIOA 3WFSC 9ICFA 1ZQHA 4TURA 4P4OA 4DOCA 2PFNA 8ICCA 4PGYA 4FHVA 2IHMA 4TUPA 4EBJA 2VANA 5F2VO 3H38A 3AQMA 4M47A 1TFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2J A;  3OVS A;  5J0W A;  5HR9 A;  3RH5 A;  3TFR A;  8ICZ A;  4IQU A;  1MQ2 A;  4YMM A;  4RQ4 A;  3V7L A;  4LVS A;  4RT2 A;  4I2B A;  3JPT A;  8ICR A;  4FHP A;  9ICS A;  9ICA A;  2ZH2 A;  1BPY A;  4JWM A;  5DBB A;  1ZQQ A;  3WFP A;  4PHA A;  3HJ1 A;  1ZJN A;  4QZA A;  1HUO A;  2FMQ A;  4NKT A;  4WBZ A;  4M0A A;  4WC5 A;  7ICO A;  1YLQ A;  9ICH A;  4QZ9 A;  1BPX A;  3C5F A;  2ZHA A;  2HHP A;  3OVA A;  2O5A A;  4I2D A;  2M2W A;  5CA7 A;  9ICI A;  2ISO A;  4NM1 A;  9ICM A;  3PNC A;  3HW8 A;  4Z6F A;  4O5E A;  4XQ7 A;  2M2V A;  4EP7 A;  3RJJ A;  4LZG A;  4MFF A;  8ICU A;  4WC3 A;  1MQ3 A;  5HRI A;  4K4I A;  1R8C A;  4WC0 A;  4K4G A;  1VJ7 A;  5J0T A;  2PFQ A;  1UEV A;  4NKU A;  2ZH3 A;  4WC7 A;  2PFO A;  1KNY A;  4KLH A;  5IIM A;  3LK9 A;  1MIV A;  5HRE A;  4M9H A;  4UD4 A;  4WCW A;  7ICT A;  7ICP A;  3OUY A;  1ZQY A;  8ICQ A;  3UXN A;  9ICX A;  3RH4 A;  4Z6C A;  1HUZ A;  4RQ0 A;  4RT3 A;  1RPL A;  3JZ0 A;  1KDH A;  4RQ5 A;  1OU5 A;  5HRK A;  5J0O A;  9ICU A;  9ICW A;  1R8B A;  3GDX A;  8ICG A;  4QZC A;  4EBK A;  5J2H A;  3JPR A;  1BPD A;  2M2T A;  4WC4 A;  4X4P A;  8ICN A;  1KEJ A;  3RJG A;  4X4O A;  3C5G A;  4GXI A;  1MIY A;  3MBY A;  2O1P A;  2DRB A;  5DBA A;  3V7K A;  3JPQ A;  2BPF A;  8ICB A;  4RWO A;  5DDY A;  1ZQA A;  4RQ6 A;  4X4S A;  4I2E A;  1ZQU A;  3AU2 A;  5DB7 A;  3MGH A;  4I2G A;  1Q79 A;  4X4N A;  1V4A A;  8ICP A;  1BPE A;  3H37 A;  4KLL A;  3H3A A;  5HRL A;  4X4V A;  2BCU A;  7ICG A;  1TFY A;  3ISC A;  4X4Q A;  1ZQW A;  2BCR A;  1PX5 A;  4KLM A;  4KLG A;  4QZH A;  4QZF A;  2ID1 A;  4PPX A;  3ISD A;  4I2F A;  1NOM A;  1Q78 A;  2ISP A;  3UXO A;  4R63 A;  2BCS A;  2DR9 A;  3OUY B;  5HHI A;  1R8A A;  3UPQ A;  9ICC A;  5J0S A;  3JYY A;  4RPY A;  4M9G A;  7ICK A;  7ICR A;  3AU6 A;  4X5V A;  5J0P A;  8ICY A;  4FHW A;  4O5C A;  9ICK A;  3WFO A;  2PXI A;  5IIN A;  2ZH5 A;  9ICR A;  2PFP A;  5HC9 A;  4WC6 A;  1ZQS A;  9ICB A;  9ICG A;  4R66 A;  4NLZ A;  7ICQ A;  4GXK A;  3C18 A;  7ICH A;  5CJ7 A;  4ATB A;  1ZQV A;  2DRA A;  4FH5 A;  5J2B A;  2ZH1 A;  5IIL A;  4QZI A;  1XSL A;  9ICJ A;  8ICM A;  4M04 A;  4LZD A;  5DB8 A;  4AT9 A;  5CWR A;  4RQ8 A;  3L9D A;  4UAY A;  4IQV A;  4UD5 A;  3MDA A;  4XQ8 A;  4F5N A;  2PBE A;  3RJK A;  5D46 A;  4P4M A;  3AQN A;  4X4R A;  3OVB A;  4F5Q A;  4FH3 A;  4X4U A;  2RFF A;  5DBC A;  4UBC A;  7ICS A;  4KLO A;  5BOL A;  3UQ2 A;  4KLI A;  4MF2 A;  4PHP A;  5HHH A;  1ZQB A;  3PMN A;  1ZQI A;  2BCV A;  4RWQ A;  1ZQP A;  4E80 A;  2BCQ A;  3JPS A;  4MF8 A;  4Z6E A;  4O9M A;  4YN4 A;  4RQ1 A;  7ICL A;  4RQ2 A;  4DOA A;  7ICV A;  5DED A;  1ZQO A;  7ICU A;  3WFQ E;  3HIY A;  2FMP A;  1FA0 A;  5CP2 A;  5DDM A;  5CR0 A;  5J0Y A;  3C2L A;  3AQK A;  1JN3 A;  2NRK A;  4X0A A;  4UAZ A;  3UQ0 A;  1ZJM A;  4QZE A;  4I28 A;  4RPX A;  1R89 A;  4P2H A;  4I2I A;  5HRH A;  3TFS A;  1MIW A;  3B0Y A;  5BOM A;  9ICV A;  1ZQK A;  3JPP A;  4ATB B;  5TZV A;  4I2H A;  4FHY A;  8ICK A;  4PGQ A;  2ZH6 A;  4R64 A;  4F5R A;  5CHG A;  4M9L A;  7ICJ A;  3LQC B;  4AT9 B;  3HX0 A;  4KLQ A;  4GXJ A;  4WC1 A;  4RWP A;  8ICT A;  3RJE A;  9ICE A;  4IQW A;  4K4H A;  4M5D A;  7ICE A;  2M2U A;  5CB1 A;  4YMO A;  4NLN A;  8ICW A;  3NYB A;  5HRD A;  7ICN A;  2ZH9 A;  5HRG A;  1F5A A;  3PML A;  5J2C A;  5J2K A;  8ICS A;  5BPC A;  5J2E A;  5J0R A;  4UB2 A;  5DKW A;  4KLT A;  2W9M A;  8ICO A;  3RJF A;  1UEU A;  4I2A A;  4F5O A;  2ZH8 A;  1ZQJ A;  4KLU A;  9ICO A;  1ZQD A;  4DO9 A;  8ICV A;  9ICL A;  9ICP A;  2DR5 A;  3ISB A;  3C66 A;  5J2D A;  4UB3 A;  1ZQM A;  4MFC A;  3JPN A;  5HRF A;  1BPB A;  4TUQ A;  3JPO A;  4NM2 A;  4PHE A;  3MGI A;  4AT7 A;  2ZHB A;  1ZQX A;  2BE3 A;  4QZB A;  5J0Q A;  4M9J A;  5J2F A;  1ZQE A;  2BPC A;  1WOT A;  8ICL A;  8ICA A;  4E7X A;  4KLJ A;  4QZG A;  4P4P A;  1XSP A;  1TV9 A;  4IQT A;  2Q66 A;  5J29 A;  8ICH A;  4FO6 A;  2FMS A;  5DB6 A;  5D4B A;  4YD2 A;  4I2J A;  8ICJ A;  4NY8 A;  4TUS A;  5HRB A;  4AT8 A;  4I27 A;  4XUS A;  4QZD A;  3HJ4 A;  2I9G A;  4LT6 A;  3V7J A;  4KLD A;  5DB9 A;  1NO5 A;  4NLK A;  4YMN A;  8ICX A;  4X0B A;  4KLS A;  3RJH A;  1ZQC A;  1TVA A;  4XRH A;  2P66 A;  4I29 A;  3MDC A;  3HWT A;  2ZH7 A;  5III A;  3UXP A;  4UAW A;  4RQ3 A;  4JWN A;  3C2M A;  3OV7 A;  1JAJ A;  3UPS A;  5IIK A;  3C2K A;  5J2I A;  5EOZ A;  1ZQF A;  4FHX A;  4F5P A;  5DEC A;  4UBB A;  1ZQG A;  1ZQZ A;  8ICI A;  2DR7 A;  4YCX A;  3H39 A;  4NXZ A;  5J2A A;  8ICE A;  5J0X A;  4AT7 B;  4MFA A;  4R65 A;  1ZQR A;  4M2Y A;  5D49 A;  2DR8 A;  4X4T A;  4PGX A;  3OGU A;  4KLE A;  9ICQ A;  1BPZ A;  4M9N A;  3B0X A;  9ICT A;  4E8F A;  4UB1 A;  4DOB A;  5J2G A;  2BPG A;  4PH5 A;  1RZT A;  4RPZ A;  3V72 A;  7ICM A;  3RH6 A;  1JQR A;  4O5K A;  3WFR E;  1VFG A;  9ICN A;  4KLF A;  4AT8 B;  3K75 D;  1XSN A;  4YD1 A;  1ZQN A;  7ICI A;  3AQL A;  4S3N A;  5J0U A;  1UET A;  4I2C A;  7ICF A;  8ICF A;  4UB5 A;  1ZQT A;  4XA5 A;  4IG8 A;  4UB4 A;  4RWN A;  3RJI A;  2GWS A;  4RQ7 A;  2ZH4 A;  2DVI A;  3AUO A;  5IIJ A;  4Z6D A;  4PHD A;  1JMS A;  4QZ8 A;  1ZQL A;  4WC2 A;  4WBY A;  5IIO A;  3WFS C;  9ICF A;  1ZQH A;  4TUR A;  4P4O A;  4DOC A;  2PFN A;  8ICC A;  4PGY A;  4FHV A;  2IHM A;  4TUP A;  4EBJ A;  2VAN A;  5F2V O;  3H38 A;  3AQM A;  4M47 A;  1TFW A; 
#chains in the Genus database with same CATH topology
 5J2J A;  3OVS A;  5J0W A;  5HR9 A;  3RH5 A;  4EV6 A;  3TFR A;  5D61 A;  8ICZ A;  4IQU A;  1MQ2 A;  4YMM A;  4RQ4 A;  3V7L A;  4LVS A;  4RT2 A;  4I2B A;  3JPT A;  8ICR A;  4FHP A;  9ICS A;  9ICA A;  2ZH2 A;  1BPY A;  4JWM A;  5DBB A;  1ZQQ A;  2IUB A;  3WFP A;  4PHA A;  3HJ1 A;  1ZJN A;  4QZA A;  1HUO A;  2FMQ A;  4NKT A;  4WBZ A;  4M0A A;  4WC5 A;  7ICO A;  4OAH A;  4O69 A;  1YLQ A;  9ICH A;  4QZ9 A;  1BPX A;  2GA9 D;  3C5F A;  2ZHA A;  2HHP A;  3OVA A;  2O5A A;  4I2D A;  2M2W A;  5CA7 A;  2B4V A;  9ICI A;  2ISO A;  4NM1 A;  9ICM A;  3PNC A;  3HW8 A;  4Z6F A;  4O5E A;  4XQ7 A;  2M2V A;  4EP7 A;  4K96 A;  3RJJ A;  4LZG A;  4MFF A;  8ICU A;  4WC3 A;  4WOY A;  1MQ3 A;  5HRI A;  2HN2 A;  4K4I A;  1R8C A;  3NWI A;  4WC0 A;  4K4G A;  1VJ7 A;  5J0T A;  2PFQ A;  1UEV A;  4NKU A;  4NXX A;  2ZH3 A;  4WC7 A;  2PFO A;  1KNY A;  3JCF A;  4KLH A;  5IIM A;  2B51 A;  3LK9 A;  1MIV A;  4NXW A;  5HRE A;  4M9H A;  4UD4 A;  4WCW A;  7ICT A;  7ICP A;  3OUY A;  1ZQY A;  4HX0 A;  8ICQ A;  3ERC C;  3UXN A;  9ICX A;  3RH4 A;  4Z6C A;  1HUZ A;  4RQ0 A;  4RT3 A;  1RPL A;  3JZ0 A;  1KDH A;  4RQ5 A;  1OU5 A;  5HRK A;  5J0O A;  9ICU A;  9ICW A;  1R8B A;  3GDX A;  8ICG A;  4QZC A;  4EBK A;  5J2H A;  3JPR A;  1BPD A;  4WQK A;  2M2T A;  4WC4 A;  4X4P A;  8ICN A;  4NXU A;  1KEJ A;  3RJG A;  4X4O A;  2GAF D;  3C5G A;  4LEZ A;  4GXI A;  5B3Q A;  1MIY A;  3MBY A;  2O1P A;  2DRB A;  5DBA A;  3V7K A;  4JLZ A;  5CHE A;  4NXT A;  3JPQ A;  2BPF A;  8ICB A;  4RWO A;  5DDY A;  1ZQA A;  4RQ6 A;  4X4S A;  4I2E A;  1ZQU A;  3AU2 A;  5DB7 A;  3MGH A;  4I2G A;  1Q79 A;  4X4N A;  1V4A A;  8ICP A;  1BPE A;  3H37 A;  3MCR A;  4KLL A;  4KM5 A;  3H3A A;  5HRL A;  4X4V A;  2BCU A;  7ICG A;  1TFY A;  3ISC A;  4X4Q A;  1ZQW A;  2BCR A;  1PX5 A;  4KLM A;  4KLG A;  4QZH A;  4QZF A;  2ID1 A;  4PPX A;  3ISD A;  3PHZ A;  4I2F A;  1NOM A;  1Q78 A;  2ISP A;  3UXO A;  4R63 A;  2BCS A;  2DR9 A;  3OUY B;  5HHI A;  1R8A A;  3UPQ A;  9ICC A;  5J0S A;  5CFU A;  3JYY A;  4RPY A;  4M9G A;  7ICK A;  2FCL A;  7ICR A;  4NXV A;  3AU6 A;  4X5V A;  5J0P A;  8ICY A;  4FHW A;  4O5C A;  9ICK A;  2IHO A;  4WQL A;  3WFO A;  2PXI A;  5IIN A;  2ZH5 A;  9ICR A;  2PFP A;  5HC9 A;  4WC6 A;  1ZQS A;  9ICB A;  9ICG A;  4R66 A;  4NLZ A;  7ICQ A;  3ER8 C;  4GXK A;  3C18 A;  7ICH A;  5CJ7 A;  4ATB A;  1ZQV A;  2DRA A;  4FH5 A;  5J2B A;  2ZH1 A;  5IIL A;  4QZI A;  1XSL A;  9ICJ A;  8ICM A;  4M04 A;  4LZD A;  5DB8 A;  4AT9 A;  5CWR A;  4RQ8 A;  3L9D A;  4UAY A;  4IQV A;  4UD5 A;  4K99 A;  3MDA A;  4XQ8 A;  4F5N A;  4OAF A;  2PBE A;  3RJK A;  5D46 A;  4EED A;  4P4M A;  3AQN A;  4N7R A;  4WH5 A;  4X4R A;  3OVB A;  4F5Q A;  4FH3 A;  4X4U A;  2RFF A;  5DBC A;  4UBC A;  7ICS A;  4KLO A;  5BOL A;  3UQ2 A;  4KLI A;  4MF2 A;  4PHP A;  5HHH A;  1ZQB A;  3PMN A;  3OWG A;  1ZQI A;  2BCV A;  4RWQ A;  1ZQP A;  4FO1 A;  4E80 A;  4K98 A;  5B3P A;  2BCQ A;  3JPS A;  4MF8 A;  4Z6E A;  4O9M A;  4YN4 A;  4RQ1 A;  7ICL A;  4RQ2 A;  4DOA A;  7ICV A;  5DED A;  1ZQO A;  7ICU A;  3WFQ E;  3CK6 A;  3HIY A;  2FMP A;  1FA0 A;  5CP2 A;  5DDM A;  5CR0 A;  5J0Y A;  3C2L A;  3AQK A;  1JN3 A;  2NRK A;  4X0A A;  4UAZ A;  3UQ0 A;  1ZJM A;  4QZE A;  4I28 A;  4RPX A;  3NKU A;  1R89 A;  4P2H A;  4I2I A;  5HRH A;  3TFS A;  2EWR A;  1MIW A;  3B0Y A;  5BOM A;  9ICV A;  1ZQK A;  3JPP A;  4ATB B;  5TZV A;  4I2H A;  4FHY A;  4EGW A;  8ICK A;  4PGQ A;  2ZH6 A;  4R64 A;  4F5R A;  5CHG A;  4M9L A;  7ICJ A;  3LQC B;  4AT9 B;  3HX0 A;  4KLQ A;  4I0U A;  4GXJ A;  4WC1 A;  4RWP A;  8ICT A;  3RJE A;  9ICE A;  4IQW A;  4K4H A;  4M5D A;  7ICE A;  2M2U A;  5CB1 A;  4YMO A;  4NLN A;  8ICW A;  3NYB A;  3NVO A;  5HRD A;  7ICN A;  2ZH9 A;  5HRG A;  1F5A A;  3PML A;  5J2C A;  5J2K A;  8ICS A;  4EEB A;  5BPC A;  5J2E A;  5J0R A;  4UB2 A;  5DKW A;  4KLT A;  2W9M A;  8ICO A;  3RJF A;  1UEU A;  4I2A A;  4F5O A;  3K7D A;  2ZH8 A;  1ZQJ A;  4KLU A;  9ICO A;  1ZQD A;  4DO9 A;  8ICV A;  9ICL A;  9ICP A;  2DR5 A;  3ISB A;  3C66 A;  5J2D A;  4UB3 A;  1ZQM A;  4MFC A;  3JPN A;  5HRF A;  1BPB A;  4K9A A;  5CFS A;  4TUQ A;  3JPO A;  4NM2 A;  4PHE A;  3MGI A;  4AT7 A;  2ZHB A;  1ZQX A;  2BE3 A;  4QZB A;  5J0Q A;  4M9J A;  5J2F A;  1ZQE A;  2BPC A;  5JTG A;  1WOT A;  2B56 A;  4K97 A;  4LEW A;  8ICL A;  5D63 A;  4E7X A;  4KLJ A;  8ICA A;  4QZG A;  4P4P A;  1XSP A;  1TV9 A;  4IQT A;  4KB6 A;  2Q66 A;  5J29 A;  8ICH A;  4FO6 A;  2FMS A;  5DB6 A;  5D4B A;  4YD2 A;  4I2J A;  8ICJ A;  4NY8 A;  4TUS A;  5HRB A;  4AT8 A;  4I27 A;  4XUS A;  2BBH A;  3HJ4 A;  5CFT A;  4QZD A;  4LT6 A;  2I9G A;  3V7J A;  4KLD A;  5DB9 A;  1NO5 A;  4NLK A;  4YMN A;  8ICX A;  4X0B A;  4KLS A;  4K8V A;  3RJH A;  4LEV A;  1ZQC A;  1TVA A;  4XRH A;  2P66 A;  4I29 A;  3MDC A;  3HWT A;  2ZH7 A;  5III A;  3UXP A;  4UAW A;  4RQ3 A;  4JWN A;  3C2M A;  3OV7 A;  1JAJ A;  3UPS A;  5IIK A;  3C2K A;  5J2I A;  5EOZ A;  1ZQF A;  4MKP A;  4FHX A;  4F5P A;  5DEC A;  4UBB A;  1ZQG A;  1ZQZ A;  4LEY A;  8ICI A;  2DR7 A;  4YCX A;  3H39 A;  4NXZ A;  5J2A A;  8ICE A;  5J0X A;  4AT7 B;  4MFA A;  4R65 A;  1ZQR A;  4M2Y A;  5D49 A;  2DR8 A;  4X4T A;  4PGX A;  3OGU A;  4KLE A;  9ICQ A;  1BPZ A;  4M9N A;  3B0X A;  4O68 A;  9ICT A;  4K9B A;  3EF2 A;  4E8F A;  4UB1 A;  4DOB A;  5J2G A;  2BPG A;  4PH5 A;  1RZT A;  4RPZ A;  3V72 A;  7ICM A;  3RH6 A;  1JQR A;  4O5K A;  3WFR E;  1VFG A;  9ICN A;  4XJE A;  4KLF A;  4AT8 B;  3K75 D;  4OAG A;  1XSN A;  4YD1 A;  1ZQN A;  7ICI A;  3AQL A;  5D62 A;  4S3N A;  5J0U A;  1UET A;  4O6A A;  4I2C A;  7ICF A;  1GPJ A;  8ICF A;  4UB5 A;  1ZQT A;  4XA5 A;  4IG8 A;  4O67 A;  4OAI Z;  4UB4 A;  4RWN A;  3ER9 B;  3RJI A;  2GWS A;  4RQ7 A;  2ZH4 A;  2DVI A;  3AUO A;  5IIJ A;  4Z6D A;  4PHD A;  1JMS A;  4QZ8 A;  1ZQL A;  4WC2 A;  4JLX A;  4WBY A;  5IIO A;  3WFS C;  9ICF A;  1ZQH A;  2HN1 A;  2BBJ A;  4TUR A;  4P4O A;  4DOC A;  2PFN A;  8ICC A;  4PGY A;  4FHV A;  2IHM A;  4TUP A;  4EBJ A;  2VAN A;  5F2V O;  3H38 A;  3AQM A;  4M47 A;  1TFW A; 
#chains in the Genus database with same CATH homology
 5J2J A;  3OVS A;  5J0W A;  5HR9 A;  3RH5 A;  3TFR A;  8ICZ A;  4IQU A;  1MQ2 A;  4YMM A;  4RQ4 A;  3V7L A;  4LVS A;  4RT2 A;  4I2B A;  3JPT A;  8ICR A;  4FHP A;  9ICS A;  9ICA A;  2ZH2 A;  1BPY A;  4JWM A;  5DBB A;  1ZQQ A;  3WFP A;  4PHA A;  3HJ1 A;  1ZJN A;  4QZA A;  1HUO A;  2FMQ A;  4NKT A;  4WBZ A;  4M0A A;  4WC5 A;  7ICO A;  1YLQ A;  9ICH A;  4QZ9 A;  1BPX A;  3C5F A;  2ZHA A;  2HHP A;  3OVA A;  2O5A A;  4I2D A;  2M2W A;  5CA7 A;  9ICI A;  2ISO A;  4NM1 A;  9ICM A;  3PNC A;  3HW8 A;  4Z6F A;  4O5E A;  4XQ7 A;  2M2V A;  4EP7 A;  3RJJ A;  4LZG A;  4MFF A;  8ICU A;  4WC3 A;  1MQ3 A;  5HRI A;  4K4I A;  1R8C A;  4WC0 A;  4K4G A;  1VJ7 A;  5J0T A;  2PFQ A;  1UEV A;  4NKU A;  2ZH3 A;  4WC7 A;  2PFO A;  1KNY A;  4KLH A;  5IIM A;  3LK9 A;  1MIV A;  5HRE A;  4M9H A;  4UD4 A;  4WCW A;  7ICT A;  7ICP A;  3OUY A;  1ZQY A;  8ICQ A;  3UXN A;  9ICX A;  3RH4 A;  4Z6C A;  1HUZ A;  4RQ0 A;  4RT3 A;  1RPL A;  3JZ0 A;  1KDH A;  4RQ5 A;  1OU5 A;  5HRK A;  5J0O A;  9ICU A;  9ICW A;  1R8B A;  3GDX A;  8ICG A;  4QZC A;  4EBK A;  5J2H A;  3JPR A;  1BPD A;  2M2T A;  4WC4 A;  4X4P A;  8ICN A;  1KEJ A;  3RJG A;  4X4O A;  3C5G A;  4GXI A;  1MIY A;  3MBY A;  2O1P A;  2DRB A;  5DBA A;  3V7K A;  3JPQ A;  2BPF A;  8ICB A;  4RWO A;  5DDY A;  1ZQA A;  4RQ6 A;  4X4S A;  4I2E A;  1ZQU A;  3AU2 A;  5DB7 A;  3MGH A;  4I2G A;  1Q79 A;  4X4N A;  1V4A A;  8ICP A;  1BPE A;  3H37 A;  4KLL A;  3H3A A;  5HRL A;  4X4V A;  2BCU A;  7ICG A;  1TFY A;  3ISC A;  4X4Q A;  1ZQW A;  2BCR A;  1PX5 A;  4KLM A;  4KLG A;  4QZH A;  4QZF A;  2ID1 A;  4PPX A;  3ISD A;  4I2F A;  1NOM A;  1Q78 A;  2ISP A;  3UXO A;  4R63 A;  2BCS A;  2DR9 A;  3OUY B;  5HHI A;  1R8A A;  3UPQ A;  9ICC A;  5J0S A;  3JYY A;  4RPY A;  4M9G A;  7ICK A;  7ICR A;  3AU6 A;  4X5V A;  5J0P A;  8ICY A;  4FHW A;  4O5C A;  9ICK A;  3WFO A;  2PXI A;  5IIN A;  2ZH5 A;  9ICR A;  2PFP A;  5HC9 A;  4WC6 A;  1ZQS A;  9ICB A;  9ICG A;  4R66 A;  4NLZ A;  7ICQ A;  4GXK A;  3C18 A;  7ICH A;  5CJ7 A;  4ATB A;  1ZQV A;  2DRA A;  4FH5 A;  5J2B A;  2ZH1 A;  5IIL A;  4QZI A;  1XSL A;  9ICJ A;  8ICM A;  4M04 A;  4LZD A;  5DB8 A;  4AT9 A;  5CWR A;  4RQ8 A;  3L9D A;  4UAY A;  4IQV A;  4UD5 A;  3MDA A;  4XQ8 A;  4F5N A;  2PBE A;  3RJK A;  5D46 A;  4P4M A;  3AQN A;  4X4R A;  3OVB A;  4F5Q A;  4FH3 A;  4X4U A;  2RFF A;  5DBC A;  4UBC A;  7ICS A;  4KLO A;  5BOL A;  3UQ2 A;  4KLI A;  4MF2 A;  4PHP A;  5HHH A;  1ZQB A;  3PMN A;  1ZQI A;  2BCV A;  4RWQ A;  1ZQP A;  4E80 A;  2BCQ A;  3JPS A;  4MF8 A;  4Z6E A;  4O9M A;  4YN4 A;  4RQ1 A;  7ICL A;  4RQ2 A;  4DOA A;  7ICV A;  5DED A;  1ZQO A;  7ICU A;  3WFQ E;  3HIY A;  2FMP A;  1FA0 A;  5CP2 A;  5DDM A;  5CR0 A;  5J0Y A;  3C2L A;  3AQK A;  1JN3 A;  2NRK A;  4X0A A;  4UAZ A;  3UQ0 A;  1ZJM A;  4QZE A;  4I28 A;  4RPX A;  1R89 A;  4P2H A;  4I2I A;  5HRH A;  3TFS A;  1MIW A;  3B0Y A;  5BOM A;  9ICV A;  1ZQK A;  3JPP A;  4ATB B;  5TZV A;  4I2H A;  4FHY A;  8ICK A;  4PGQ A;  2ZH6 A;  4R64 A;  4F5R A;  5CHG A;  4M9L A;  7ICJ A;  3LQC B;  4AT9 B;  3HX0 A;  4KLQ A;  4GXJ A;  4WC1 A;  4RWP A;  8ICT A;  3RJE A;  9ICE A;  4IQW A;  4K4H A;  4M5D A;  7ICE A;  2M2U A;  5CB1 A;  4YMO A;  4NLN A;  8ICW A;  3NYB A;  5HRD A;  7ICN A;  2ZH9 A;  5HRG A;  1F5A A;  3PML A;  5J2C A;  5J2K A;  8ICS A;  5BPC A;  5J2E A;  5J0R A;  4UB2 A;  5DKW A;  4KLT A;  2W9M A;  8ICO A;  3RJF A;  1UEU A;  4I2A A;  4F5O A;  2ZH8 A;  1ZQJ A;  4KLU A;  9ICO A;  1ZQD A;  4DO9 A;  8ICV A;  9ICL A;  9ICP A;  2DR5 A;  3ISB A;  3C66 A;  5J2D A;  4UB3 A;  1ZQM A;  4MFC A;  3JPN A;  5HRF A;  1BPB A;  4TUQ A;  3JPO A;  4NM2 A;  4PHE A;  3MGI A;  4AT7 A;  2ZHB A;  1ZQX A;  2BE3 A;  4QZB A;  5J0Q A;  4M9J A;  5J2F A;  1ZQE A;  2BPC A;  1WOT A;  8ICL A;  8ICA A;  4E7X A;  4KLJ A;  4QZG A;  4P4P A;  1XSP A;  1TV9 A;  4IQT A;  2Q66 A;  5J29 A;  8ICH A;  4FO6 A;  2FMS A;  5DB6 A;  5D4B A;  4YD2 A;  4I2J A;  8ICJ A;  4NY8 A;  4TUS A;  5HRB A;  4AT8 A;  4I27 A;  4XUS A;  4QZD A;  3HJ4 A;  2I9G A;  4LT6 A;  3V7J A;  4KLD A;  5DB9 A;  1NO5 A;  4NLK A;  4YMN A;  8ICX A;  4X0B A;  4KLS A;  3RJH A;  1ZQC A;  1TVA A;  4XRH A;  2P66 A;  4I29 A;  3MDC A;  3HWT A;  2ZH7 A;  5III A;  3UXP A;  4UAW A;  4RQ3 A;  4JWN A;  3C2M A;  3OV7 A;  1JAJ A;  3UPS A;  5IIK A;  3C2K A;  5J2I A;  5EOZ A;  1ZQF A;  4FHX A;  4F5P A;  5DEC A;  4UBB A;  1ZQG A;  1ZQZ A;  8ICI A;  2DR7 A;  4YCX A;  3H39 A;  4NXZ A;  5J2A A;  8ICE A;  5J0X A;  4AT7 B;  4MFA A;  4R65 A;  1ZQR A;  4M2Y A;  5D49 A;  2DR8 A;  4X4T A;  4PGX A;  3OGU A;  4KLE A;  9ICQ A;  1BPZ A;  4M9N A;  3B0X A;  9ICT A;  4E8F A;  4UB1 A;  4DOB A;  5J2G A;  2BPG A;  4PH5 A;  1RZT A;  4RPZ A;  3V72 A;  7ICM A;  3RH6 A;  1JQR A;  4O5K A;  3WFR E;  1VFG A;  9ICN A;  4KLF A;  4AT8 B;  3K75 D;  1XSN A;  4YD1 A;  1ZQN A;  7ICI A;  3AQL A;  4S3N A;  5J0U A;  1UET A;  4I2C A;  7ICF A;  8ICF A;  4UB5 A;  1ZQT A;  4XA5 A;  4IG8 A;  4UB4 A;  4RWN A;  3RJI A;  2GWS A;  4RQ7 A;  2ZH4 A;  2DVI A;  3AUO A;  5IIJ A;  4Z6D A;  4PHD A;  1JMS A;  4QZ8 A;  1ZQL A;  4WC2 A;  4WBY A;  5IIO A;  3WFS C;  9ICF A;  1ZQH A;  4TUR A;  4P4O A;  4DOC A;  2PFN A;  8ICC A;  4PGY A;  4FHV A;  2IHM A;  4TUP A;  4EBJ A;  2VAN A;  5F2V O;  3H38 A;  3AQM A;  4M47 A;  1TFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...