4WC7A

Structure of trna-processing enzyme complex 5
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
b'MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc7A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc7A01
5CB1A 1ZJMA 7ICLA 7ICTA 4RPYA 2ZH9A 5HRKA 4RWNA 3OGUA 8ICJA 4F5PA 4M9NA 4GXIA 4PHAA 3C2KA 1R8BA 7ICMA 2ZH5A 5DBAA 1ZQWA 2DRBA 1ZQMA 1JAJA 2BPGA 4LZGA 3V7KA 1R8CA 1ZQCA 4QZAA 4P4MA 4WBZA 4I2FA 3MGHA 1NOMA 9ICJA 1MIYA 8ICBA 4UBBA 3PMLA 4RPZA 7ICKA 7ICNA 2ZH2A 9ICNA 8ICOA 2PFPA 2ZH4A 4WC2A 2PFOA 4X5VA 4FHYA 5J2JA 3TFSA 4IQVA 3WFOA 3AQMA 5J0UA 1ZQAA 4EBJA 4RWPA 4AT7A 5CP2A 4UB3A 1MIWA 1HUOA 4QZEA 1ZQSA 1XSPA 3UQ0A 8ICGA 7ICSA 5TZVA 3UQ2A 4FH3A 4YMMA 9ICKA 4MFFA 4O5EA 1MQ3A 4IQTA 4F5OA 1BPEA 4LT6A 2M2VA 5DDYA 5HRDA 4X4UA 3OUYA 5IILA 2ID1A 5DEDA 3C2MA 3V7JA 1ZQRA 4Z6EA 3V72A 5DB7A 4RPXA 4R65A 2ISPA 4UB2A 4M47A 8ICPA 4YCXA 7ICGA 4I28A 3RJJA 3MDAA 4PH5A 4NLZA 8ICVA 4WC7A 4X4SA 4JWMA 4YMNA 3WFPA 4PHPA 3AU2A 5HHHA 5HRBA 4TUPA 4RQ2A 4KLSA 4KLDA 4WCWA 1Q79A 8ICHA 2BCSA 2BCUA 3HW8A 1TFWA 5DB8A 9ICGA 4RT3A 4AT7B 4I2CA 5CWRA 4EP7A 1XSLA 2DR5A 4E8FA 4WC3A 4RQ3A 3WFQE 4NKUA 1V4AA 5HHIA 1ZQVA 4NLNA 3K75D 4IQUA 1OU5A 3PMNA 9ICBA 4UAWA 4RWQA 3UPSA 4RQ4A 4UAZA 7ICRA 5HRIA 8ICSA 4R64A 5J2EA 3ISDA 9ICFA 4DOCA 2M2WA 1JN3A 4WC6A 5BOMA 8ICEA 5CR0A 4KLQA 5J0QA 1ZQXA 3HWTA 2ZH6A 9ICTA 3ISBA 2M2UA 1ZQTA 2RFFA 2BCQA 7ICFA 3RJFA 4QZFA 1RPLA 3RH4A 7ICIA 3ISCA 4E80A 2HHPA 5IINA 7ICQA 5J2HA 1VFGA 4ATBA 4X4RA 3WFSC 3HJ4A 2DR8A 3RJHA 4TUSA 4RT2A 8ICQA 3OVBA 1UEVA 3HX0A 4RQ8A 5EOZA 4M9JA 5CHGA 9ICIA 4X4VA 4I2BA 4YMOA 3JPTA 4KLJA 3JPSA 4TUQA 4O5CA 4XQ8A 4UD5A 3OVSA 3OVAA 3C5GA 5J0XA 2PFNA 1R8AA 4PPXA 2DR9A 1TV9A 4QZHA 9ICCA 5DECA 3AUOA 9ICXA 4M2YA 7ICVA 4DOAA 3AQNA 2PBEA 2ZH7A 4LZDA 1ZQIA 3JYYA 4NM1A 1KEJA 7ICUA 2I9GA 5IIJA 1ZQBA 4X0AA 1BPDA 4FHXA 2GWSA 2DVIA 4PHDA 4KLLA 4I2HA 4WC0A 2FMSA 1ZQQA 3TFRA 8ICWA 4YD1A 3AQLA 9ICRA 4FO6A 4JWNA 5J0RA 8ICUA 3C2LA 1ZJNA 8ICCA 4K4IA 4ATBB 5HRLA 4PGQA 4KLMA 3JPNA 5F2VO 1BPZA 3RJGA 2W9MA 5DDMA 1RZTA 9ICWA 8ICTA 3JPOA 4I2IA 4AT9B 1BPBA 5HRGA 1ZQKA 3C5FA 5D49A 3JPRA 4M04A 2NRKA 4NKTA 1ZQPA 5DBCA 5DB9A 2ZHAA 5J2AA 5D46A 5BPCA 4P4PA 4KLHA 8ICMA 4KLFA 5BOLA 1MIVA 5DB6A 2IHMA 4AT8B 3B0XA 3UXPA 4UBCA 4QZCA 2DRAA 4RWOA 4MF8A 4X0BA 1R89A 4XRHA 5DKWA 4X4TA 4KLIA 4FHWA 4RQ5A 5J0WA 4RQ1A 1ZQLA 1MQ2A 4P2HA 5J0YA 5HRHA 2BCVA 3UXNA 5J2DA 1JMSA 8ICRA 3PNCA 4M5DA 5J2BA 3RJKA 4I2GA 4P4OA 4KLTA 1ZQOA 4WC5A 3OV7A 5J2FA 5HRFA 4O9MA 4M0AA 5DBBA 1ZQJA 7ICEA 8ICFA 2BPCA 8ICKA 5J0SA 1TVAA 3WFRE 2DR7A 4K4HA 3LK9A 1JQRA 7ICOA 3C66A 4XQ7A 4PGYA 1ZQZA 4YD2A 1TFYA 4PGXA 3AU6A 4QZDA 3RH6A 4FHPA 4AT9A 4MFAA 3GDXA 3MBYA 4UAYA 4EBKA 2ZH8A 3HJ1A 4TURA 4DOBA 4Z6DA 2BCRA 3LQCB 8ICIA 5J2IA 2PXIA 2BE3A 3B0YA 4MF2A 4LVSA 4QZBA 4AT8A 5D4BA 3RJEA 1ZQHA 1BPYA 3JPPA 4UB5A 3V7LA 3JPQA 4I2JA 5J29A 4QZIA 8ICXA 4UD4A 1HUZA 4M9LA 4X4QA 9ICQA 4QZ8A 4M9GA 4O5KA 1KNYA 4X4OA 2PFQA 5IIMA 1VJ7A 4KLGA 5J2KA 4WC4A 4NXZA 4WC1A 5J2CA 3RJIA 9ICEA 4NLKA 4XA5A 9ICLA 9ICVA 2M2TA 9ICPA 4I2DA 1ZQEA 3UPQA 4GXKA 3MDCA 4K4GA 2FMPA 1BPXA 5HC9A 4F5NA 1YLQA 1ZQYA 4UB1A 4RQ0A 4I2EA 4QZ9A 5CA7A 4Z6FA 2FMQA 5IIKA 1UEUA 1UETA 4I29A 8ICYA 4DO9A 5J0OA 9ICUA 8ICZA 4I27A 3C18A 3UXOA 1NO5A 4X4NA 9ICOA 3NYBA 3RH5A 3HIYA 4RQ6A 4R66A 8ICAA 1WOTA 2ZHBA 4GXJA 2ZH3A 9ICHA 2O1PA 1ZQGA 4KLUA 4XUSA 1ZQUA 4X4PA 7ICJA 5HREA 9ICMA 4WBYA 2ZH1A 4KLOA 1ZQNA 4RQ7A 5CJ7A 3H39A 7ICPA 2VANA 9ICAA 4MFCA 2P66A 3MGIA 5IIOA 1F5AA 4E7XA 1ZQFA 4KLEA 4FH5A 1XSNA 8ICNA 4I2AA 5J0TA 2O5AA 4YN4A 4F5QA 4IG8A 4FHVA 2Q66A 2ISOA 4S3NA 3JZ0A 4NY8A 5HR9A 5J0PA 4NM2A 4QZGA 7ICHA 1KDHA 3L9DA 4M9HA 3AQKA 3OUYB 3H38A 4UB4A 4IQWA 1PX5A 1Q78A 2BPFA 4F5RA 1ZQDA 8ICLA 3H37A 4PHEA 5IIIA 3H3AA 4Z6CA 9ICSA 5J2GA 4R63A 1FA0A
chains in the Genus database with same CATH superfamily
5CB1A 1ZJMA 7ICLA 7ICTA 4RPYA 4OAFA 5D61A 2ZH9A 5HRKA 4RWNA 3OGUA 8ICJA 4F5PA 3K7DA 3ER9B 4M9NA 4O69A 4GXIA 4PHAA 3C2KA 1R8BA 2B51A 4NXTA 7ICMA 3ERCC 4NXWA 2ZH5A 5DBAA 1ZQWA 2DRBA 1ZQMA 1JAJA 2BPGA 4LZGA 3V7KA 1R8CA 1ZQCA 4QZAA 4P4MA 4WBZA 4I2FA 3MGHA 1NOMA 9ICJA 1MIYA 8ICBA 4UBBA 3PMLA 4RPZA 2BBJA 7ICKA 7ICNA 2ZH2A 9ICNA 4EEBA 8ICOA 4XJEA 2PFPA 2ZH4A 4WC2A 2PFOA 4X5VA 4FHYA 5J2JA 3TFSA 4IQVA 3WFOA 3AQMA 5J0UA 1ZQAA 4EBJA 4RWPA 4AT7A 5CP2A 4UB3A 1MIWA 1HUOA 4QZEA 1ZQSA 1XSPA 3UQ0A 8ICGA 7ICSA 5TZVA 3UQ2A 4FH3A 4YMMA 9ICKA 4MFFA 4O5EA 1MQ3A 4IQTA 4F5OA 1BPEA 4LT6A 4O67A 2M2VA 5DDYA 5HRDA 4X4UA 3OUYA 2GA9D 5CFSA 5IILA 2ID1A 5DEDA 3C2MA 3V7JA 1ZQRA 4Z6EA 3V72A 5DB7A 4RPXA 3NWIA 4R65A 2ISPA 4UB2A 4M47A 8ICPA 4YCXA 7ICGA 4I28A 3RJJA 3MDAA 4PH5A 4NLZA 8ICVA 4WC7A 4NXXA 4X4SA 4FO1A 4JWMA 4YMNA 3WFPA 4PHPA 3AU2A 5HHHA 5HRBA 4N7RA 4TUPA 4RQ2A 4KLSA 4KLDA 4WCWA 1Q79A 8ICHA 2BCSA 2HN1A 2BCUA 3HW8A 1TFWA 5DB8A 9ICGA 4RT3A 5D62A 4JLZA 4AT7B 4I2CA 5CWRA 4EP7A 1XSLA 2DR5A 4E8FA 4WC3A 4RQ3A 3WFQE 4NKUA 1V4AA 5HHIA 1ZQVA 4NLNA 3K75D 4LEWA 4IQUA 1OU5A 3PMNA 9ICBA 4UAWA 4RWQA 3UPSA 4RQ4A 4UAZA 7ICRA 5HRIA 5B3QA 3ER8C 8ICSA 2EWRA 4R64A 5J2EA 3ISDA 9ICFA 4O6AA 4DOCA 2M2WA 1JN3A 4WC6A 5BOMA 8ICEA 5CR0A 4KLQA 5J0QA 1ZQXA 3HWTA 2ZH6A 2GAFD 9ICTA 3ISBA 2M2UA 1ZQTA 2RFFA 2BCQA 7ICFA 3OWGA 3RJFA 4QZFA 1RPLA 3RH4A 7ICIA 3ISCA 4E80A 2HHPA 5IINA 7ICQA 5J2HA 1VFGA 4ATBA 4X4RA 3WFSC 3HJ4A 2DR8A 3RJHA 4RT2A 4TUSA 8ICQA 3OVBA 1UEVA 3HX0A 2FCLA 4RQ8A 5EOZA 4M9JA 5CHGA 9ICIA 4X4VA 4I2BA 1GPJA 4YMOA 3JPTA 4KLJA 2IHOA 3JPSA 4TUQA 4O5CA 3PHZA 4XQ8A 4UD5A 3OVSA 3OVAA 3C5GA 5J0XA 4EGWA 1R8AA 2PFNA 4PPXA 2DR9A 1TV9A 4QZHA 9ICCA 5DECA 3AUOA 3CK6A 9ICXA 4M2YA 7ICVA 4DOAA 3AQNA 4WOYA 2PBEA 2ZH7A 4LZDA 4K9AA 1ZQIA 3JYYA 4NM1A 1KEJA 7ICUA 2I9GA 5IIJA 1ZQBA 4X0AA 1BPDA 4FHXA 5CHEA 2GWSA 2DVIA 4PHDA 4KLLA 4I2HA 4WC0A 2FMSA 1ZQQA 3TFRA 8ICWA 4YD1A 3AQLA 9ICRA 4FO6A 4JWNA 5J0RA 8ICUA 3C2LA 1ZJNA 5CFUA 8ICCA 4K4IA 4ATBB 5HRLA 4PGQA 4KLMA 4OAIZ 3JPNA 5F2VO 1BPZA 3RJGA 2W9MA 5DDMA 1RZTA 9ICWA 8ICTA 3JPOA 4I2IA 4AT9B 1BPBA 5HRGA 1ZQKA 3C5FA 5D49A 3JPRA 4M04A 3EF2A 2NRKA 4NKTA 1ZQPA 5DBCA 5DB9A 2ZHAA 4LEZA 2HN2A 5D46A 5J2AA 5BPCA 4P4PA 4KLHA 8ICMA 4KLFA 5BOLA 1MIVA 5DB6A 2IHMA 4AT8B 3B0XA 3UXPA 4UBCA 4QZCA 2DRAA 4RWOA 4MF8A 4X0BA 1R89A 4XRHA 5DKWA 4X4TA 4KLIA 4I0UA 4FHWA 3JCFA 4RQ5A 5J0WA 4RQ1A 1ZQLA 1MQ2A 4P2HA 5J0YA 5HRHA 2BCVA 3UXNA 5J2DA 1JMSA 8ICRA 3PNCA 4M5DA 5J2BA 4LEYA 3RJKA 4I2GA 4P4OA 4KLTA 1ZQOA 2B4VA 4K97A 4KM5A 4NXVA 4WC5A 3OV7A 5J2FA 5HRFA 4O9MA 4M0AA 5DBBA 3MCRA 1ZQJA 7ICEA 2BPCA 8ICFA 8ICKA 5J0SA 1TVAA 3WFRE 4K9BA 2DR7A 4K4HA 4JLXA 3LK9A 1JQRA 7ICOA 3C66A 4XQ7A 4PGYA 1ZQZA 4YD2A 1TFYA 4PGXA 4LEVA 3AU6A 4QZDA 3RH6A 4FHPA 4AT9A 4MFAA 3GDXA 4WQKA 3MBYA 4UAYA 4EBKA 2ZH8A 3HJ1A 4TURA 4DOBA 4K99A 4Z6DA 2BCRA 3LQCB 5CFTA 8ICIA 5J2IA 2PXIA 2BE3A 4K96A 3B0YA 4MF2A 4LVSA 4QZBA 4AT8A 5D4BA 3RJEA 1ZQHA 1BPYA 4O68A 3JPPA 4UB5A 3V7LA 3JPQA 4I2JA 5J29A 4QZIA 8ICXA 4UD4A 1HUZA 4M9LA 4X4QA 9ICQA 4QZ8A 4M9GA 4O5KA 1KNYA 2BBHA 4X4OA 5IIMA 1VJ7A 2PFQA 5J2KA 4KLGA 5JTGA 4WC4A 4NXZA 4WC1A 5J2CA 3RJIA 4EEDA 9ICEA 4NLKA 2IUBA 4XA5A 9ICLA 2M2TA 9ICPA 4I2DA 9ICVA 1ZQEA 4WH5A 3UPQA 4GXKA 3MDCA 4K4GA 2FMPA 1BPXA 5HC9A 4F5NA 1YLQA 1ZQYA 4UB1A 4MKPA 4RQ0A 4I2EA 4QZ9A 5CA7A 4Z6FA 2FMQA 5IIKA 1UEUA 1UETA 4I29A 8ICYA 4DO9A 5J0OA 9ICUA 8ICZA 4NXUA 4I27A 4OAGA 4KB6A 3C18A 3UXOA 1NO5A 4X4NA 9ICOA 4K98A 3NYBA 3RH5A 3HIYA 4RQ6A 4R66A 8ICAA 1WOTA 2ZHBA 4GXJA 2ZH3A 3NVOA 9ICHA 2O1PA 1ZQGA 4KLUA 4XUSA 1ZQUA 4X4PA 7ICJA 5HREA 9ICMA 3NKUA 4HX0A 4K8VA 4WBYA 2ZH1A 4KLOA 1ZQNA 5D63A 4RQ7A 5CJ7A 3H39A 4OAHA 7ICPA 2VANA 9ICAA 4MFCA 2P66A 3MGIA 5IIOA 1F5AA 4E7XA 1ZQFA 4KLEA 4FH5A 1XSNA 8ICNA 4I2AA 5J0TA 2O5AA 4YN4A 4EV6A 4F5QA 4IG8A 4FHVA 2Q66A 4WQLA 2ISOA 4S3NA 3JZ0A 4NY8A 5HR9A 5J0PA 4NM2A 4QZGA 7ICHA 1KDHA 3L9DA 4M9HA 3AQKA 3OUYB 3H38A 4UB4A 4IQWA 1PX5A 1Q78A 2BPFA 4F5RA 5B3PA 1ZQDA 8ICLA 3H37A 2B56A 4PHEA 5IIIA 3H3AA 4Z6CA 9ICSA 5J2GA 4R63A 1FA0A
chains in the Genus database with same CATH topology
5CB1A 1ZJMA 7ICLA 7ICTA 4RPYA 2ZH9A 5HRKA 4RWNA 3OGUA 8ICJA 4F5PA 4M9NA 4GXIA 4PHAA 3C2KA 1R8BA 7ICMA 2ZH5A 5DBAA 1ZQWA 2DRBA 1ZQMA 1JAJA 2BPGA 4LZGA 3V7KA 1R8CA 1ZQCA 4QZAA 4P4MA 4WBZA 4I2FA 3MGHA 1NOMA 9ICJA 1MIYA 8ICBA 4UBBA 3PMLA 4RPZA 7ICKA 7ICNA 2ZH2A 9ICNA 8ICOA 2PFPA 2ZH4A 4WC2A 2PFOA 4X5VA 4FHYA 5J2JA 3TFSA 4IQVA 3WFOA 3AQMA 5J0UA 1ZQAA 4EBJA 4RWPA 4AT7A 5CP2A 4UB3A 1MIWA 1HUOA 4QZEA 1ZQSA 1XSPA 3UQ0A 8ICGA 7ICSA 5TZVA 3UQ2A 4FH3A 4YMMA 9ICKA 4MFFA 4O5EA 1MQ3A 4IQTA 4F5OA 1BPEA 4LT6A 2M2VA 5DDYA 5HRDA 4X4UA 3OUYA 5IILA 2ID1A 5DEDA 3C2MA 3V7JA 1ZQRA 4Z6EA 3V72A 5DB7A 4RPXA 4R65A 2ISPA 4UB2A 4M47A 8ICPA 4YCXA 7ICGA 4I28A 3RJJA 3MDAA 4PH5A 4NLZA 8ICVA 4WC7A 4X4SA 4JWMA 4YMNA 3WFPA 4PHPA 3AU2A 5HHHA 5HRBA 4TUPA 4RQ2A 4KLSA 4KLDA 4WCWA 1Q79A 8ICHA 2BCSA 2BCUA 3HW8A 1TFWA 5DB8A 9ICGA 4RT3A 4AT7B 4I2CA 5CWRA 4EP7A 1XSLA 2DR5A 4E8FA 4WC3A 4RQ3A 3WFQE 4NKUA 1V4AA 5HHIA 1ZQVA 4NLNA 3K75D 4IQUA 1OU5A 3PMNA 9ICBA 4UAWA 4RWQA 3UPSA 4RQ4A 4UAZA 7ICRA 5HRIA 8ICSA 4R64A 5J2EA 3ISDA 9ICFA 4DOCA 2M2WA 1JN3A 4WC6A 5BOMA 8ICEA 5CR0A 4KLQA 5J0QA 1ZQXA 3HWTA 2ZH6A 9ICTA 3ISBA 2M2UA 1ZQTA 2RFFA 2BCQA 7ICFA 3RJFA 4QZFA 1RPLA 3RH4A 7ICIA 3ISCA 4E80A 2HHPA 5IINA 7ICQA 5J2HA 1VFGA 4ATBA 4X4RA 3WFSC 3HJ4A 2DR8A 3RJHA 4TUSA 4RT2A 8ICQA 3OVBA 1UEVA 3HX0A 4RQ8A 5EOZA 4M9JA 5CHGA 9ICIA 4X4VA 4I2BA 4YMOA 3JPTA 4KLJA 3JPSA 4TUQA 4O5CA 4XQ8A 4UD5A 3OVSA 3OVAA 3C5GA 5J0XA 2PFNA 1R8AA 4PPXA 2DR9A 1TV9A 4QZHA 9ICCA 5DECA 3AUOA 9ICXA 4M2YA 7ICVA 4DOAA 3AQNA 2PBEA 2ZH7A 4LZDA 1ZQIA 3JYYA 4NM1A 1KEJA 7ICUA 2I9GA 5IIJA 1ZQBA 4X0AA 1BPDA 4FHXA 2GWSA 2DVIA 4PHDA 4KLLA 4I2HA 4WC0A 2FMSA 1ZQQA 3TFRA 8ICWA 4YD1A 3AQLA 9ICRA 4FO6A 4JWNA 5J0RA 8ICUA 3C2LA 1ZJNA 8ICCA 4K4IA 4ATBB 5HRLA 4PGQA 4KLMA 3JPNA 5F2VO 1BPZA 3RJGA 2W9MA 5DDMA 1RZTA 9ICWA 8ICTA 3JPOA 4I2IA 4AT9B 1BPBA 5HRGA 1ZQKA 3C5FA 5D49A 3JPRA 4M04A 2NRKA 4NKTA 1ZQPA 5DBCA 5DB9A 2ZHAA 5J2AA 5D46A 5BPCA 4P4PA 4KLHA 8ICMA 4KLFA 5BOLA 1MIVA 5DB6A 2IHMA 4AT8B 3B0XA 3UXPA 4UBCA 4QZCA 2DRAA 4RWOA 4MF8A 4X0BA 1R89A 4XRHA 5DKWA 4X4TA 4KLIA 4FHWA 4RQ5A 5J0WA 4RQ1A 1ZQLA 1MQ2A 4P2HA 5J0YA 5HRHA 2BCVA 3UXNA 5J2DA 1JMSA 8ICRA 3PNCA 4M5DA 5J2BA 3RJKA 4I2GA 4P4OA 4KLTA 1ZQOA 4WC5A 3OV7A 5J2FA 5HRFA 4O9MA 4M0AA 5DBBA 1ZQJA 7ICEA 8ICFA 2BPCA 8ICKA 5J0SA 1TVAA 3WFRE 2DR7A 4K4HA 3LK9A 1JQRA 7ICOA 3C66A 4XQ7A 4PGYA 1ZQZA 4YD2A 1TFYA 4PGXA 3AU6A 4QZDA 3RH6A 4FHPA 4AT9A 4MFAA 3GDXA 3MBYA 4UAYA 4EBKA 2ZH8A 3HJ1A 4TURA 4DOBA 4Z6DA 2BCRA 3LQCB 8ICIA 5J2IA 2PXIA 2BE3A 3B0YA 4MF2A 4LVSA 4QZBA 4AT8A 5D4BA 3RJEA 1ZQHA 1BPYA 3JPPA 4UB5A 3V7LA 3JPQA 4I2JA 5J29A 4QZIA 8ICXA 4UD4A 1HUZA 4M9LA 4X4QA 9ICQA 4QZ8A 4M9GA 4O5KA 1KNYA 4X4OA 2PFQA 5IIMA 1VJ7A 4KLGA 5J2KA 4WC4A 4NXZA 4WC1A 5J2CA 3RJIA 9ICEA 4NLKA 4XA5A 9ICLA 9ICVA 2M2TA 9ICPA 4I2DA 1ZQEA 3UPQA 4GXKA 3MDCA 4K4GA 2FMPA 1BPXA 5HC9A 4F5NA 1YLQA 1ZQYA 4UB1A 4RQ0A 4I2EA 4QZ9A 5CA7A 4Z6FA 2FMQA 5IIKA 1UEUA 1UETA 4I29A 8ICYA 4DO9A 5J0OA 9ICUA 8ICZA 4I27A 3C18A 3UXOA 1NO5A 4X4NA 9ICOA 3NYBA 3RH5A 3HIYA 4RQ6A 4R66A 8ICAA 1WOTA 2ZHBA 4GXJA 2ZH3A 9ICHA 2O1PA 1ZQGA 4KLUA 4XUSA 1ZQUA 4X4PA 7ICJA 5HREA 9ICMA 4WBYA 2ZH1A 4KLOA 1ZQNA 4RQ7A 5CJ7A 3H39A 7ICPA 2VANA 9ICAA 4MFCA 2P66A 3MGIA 5IIOA 1F5AA 4E7XA 1ZQFA 4KLEA 4FH5A 1XSNA 8ICNA 4I2AA 5J0TA 2O5AA 4YN4A 4F5QA 4IG8A 4FHVA 2Q66A 2ISOA 4S3NA 3JZ0A 4NY8A 5HR9A 5J0PA 4NM2A 4QZGA 7ICHA 1KDHA 3L9DA 4M9HA 3AQKA 3OUYB 3H38A 4UB4A 4IQWA 1PX5A 1Q78A 2BPFA 4F5RA 1ZQDA 8ICLA 3H37A 4PHEA 5IIIA 3H3AA 4Z6CA 9ICSA 5J2GA 4R63A 1FA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CB1 A;  1ZJM A;  7ICL A;  7ICT A;  4RPY A;  2ZH9 A;  5HRK A;  4RWN A;  3OGU A;  8ICJ A;  4F5P A;  4M9N A;  4GXI A;  4PHA A;  3C2K A;  1R8B A;  7ICM A;  2ZH5 A;  5DBA A;  1ZQW A;  2DRB A;  1ZQM A;  1JAJ A;  2BPG A;  4LZG A;  3V7K A;  1R8C A;  1ZQC A;  4QZA A;  4P4M A;  4WBZ A;  4I2F A;  3MGH A;  1NOM A;  9ICJ A;  1MIY A;  8ICB A;  4UBB A;  3PML A;  4RPZ A;  7ICK A;  7ICN A;  2ZH2 A;  9ICN A;  8ICO A;  2PFP A;  2ZH4 A;  4WC2 A;  2PFO A;  4X5V A;  4FHY A;  5J2J A;  3TFS A;  4IQV A;  3WFO A;  3AQM A;  5J0U A;  1ZQA A;  4EBJ A;  4RWP A;  4AT7 A;  5CP2 A;  4UB3 A;  1MIW A;  1HUO A;  4QZE A;  1ZQS A;  1XSP A;  3UQ0 A;  8ICG A;  7ICS A;  5TZV A;  3UQ2 A;  4FH3 A;  4YMM A;  9ICK A;  4MFF A;  4O5E A;  1MQ3 A;  4IQT A;  4F5O A;  1BPE A;  4LT6 A;  2M2V A;  5DDY A;  5HRD A;  4X4U A;  3OUY A;  5IIL A;  2ID1 A;  5DED A;  3C2M A;  3V7J A;  1ZQR A;  4Z6E A;  3V72 A;  5DB7 A;  4RPX A;  4R65 A;  2ISP A;  4UB2 A;  4M47 A;  8ICP A;  4YCX A;  7ICG A;  4I28 A;  3RJJ A;  3MDA A;  4PH5 A;  4NLZ A;  8ICV A;  4WC7 A;  4X4S A;  4JWM A;  4YMN A;  3WFP A;  4PHP A;  3AU2 A;  5HHH A;  5HRB A;  4TUP A;  4RQ2 A;  4KLS A;  4KLD A;  4WCW A;  1Q79 A;  8ICH A;  2BCS A;  2BCU A;  3HW8 A;  1TFW A;  5DB8 A;  9ICG A;  4RT3 A;  4AT7 B;  4I2C A;  5CWR A;  4EP7 A;  1XSL A;  2DR5 A;  4E8F A;  4WC3 A;  4RQ3 A;  3WFQ E;  4NKU A;  1V4A A;  5HHI A;  1ZQV A;  4NLN A;  3K75 D;  4IQU A;  1OU5 A;  3PMN A;  9ICB A;  4UAW A;  4RWQ A;  3UPS A;  4RQ4 A;  4UAZ A;  7ICR A;  5HRI A;  8ICS A;  4R64 A;  5J2E A;  3ISD A;  9ICF A;  4DOC A;  2M2W A;  1JN3 A;  4WC6 A;  5BOM A;  8ICE A;  5CR0 A;  4KLQ A;  5J0Q A;  1ZQX A;  3HWT A;  2ZH6 A;  9ICT A;  3ISB A;  2M2U A;  1ZQT A;  2RFF A;  2BCQ A;  7ICF A;  3RJF A;  4QZF A;  1RPL A;  3RH4 A;  7ICI A;  3ISC A;  4E80 A;  2HHP A;  5IIN A;  7ICQ A;  5J2H A;  1VFG A;  4ATB A;  4X4R A;  3WFS C;  3HJ4 A;  2DR8 A;  3RJH A;  4TUS A;  4RT2 A;  8ICQ A;  3OVB A;  1UEV A;  3HX0 A;  4RQ8 A;  5EOZ A;  4M9J A;  5CHG A;  9ICI A;  4X4V A;  4I2B A;  4YMO A;  3JPT A;  4KLJ A;  3JPS A;  4TUQ A;  4O5C A;  4XQ8 A;  4UD5 A;  3OVS A;  3OVA A;  3C5G A;  5J0X A;  2PFN A;  1R8A A;  4PPX A;  2DR9 A;  1TV9 A;  4QZH A;  9ICC A;  5DEC A;  3AUO A;  9ICX A;  4M2Y A;  7ICV A;  4DOA A;  3AQN A;  2PBE A;  2ZH7 A;  4LZD A;  1ZQI A;  3JYY A;  4NM1 A;  1KEJ A;  7ICU A;  2I9G A;  5IIJ A;  1ZQB A;  4X0A A;  1BPD A;  4FHX A;  2GWS A;  2DVI A;  4PHD A;  4KLL A;  4I2H A;  4WC0 A;  2FMS A;  1ZQQ A;  3TFR A;  8ICW A;  4YD1 A;  3AQL A;  9ICR A;  4FO6 A;  4JWN A;  5J0R A;  8ICU A;  3C2L A;  1ZJN A;  8ICC A;  4K4I A;  4ATB B;  5HRL A;  4PGQ A;  4KLM A;  3JPN A;  5F2V O;  1BPZ A;  3RJG A;  2W9M A;  5DDM A;  1RZT A;  9ICW A;  8ICT A;  3JPO A;  4I2I A;  4AT9 B;  1BPB A;  5HRG A;  1ZQK A;  3C5F A;  5D49 A;  3JPR A;  4M04 A;  2NRK A;  4NKT A;  1ZQP A;  5DBC A;  5DB9 A;  2ZHA A;  5J2A A;  5D46 A;  5BPC A;  4P4P A;  4KLH A;  8ICM A;  4KLF A;  5BOL A;  1MIV A;  5DB6 A;  2IHM A;  4AT8 B;  3B0X A;  3UXP A;  4UBC A;  4QZC A;  2DRA A;  4RWO A;  4MF8 A;  4X0B A;  1R89 A;  4XRH A;  5DKW A;  4X4T A;  4KLI A;  4FHW A;  4RQ5 A;  5J0W A;  4RQ1 A;  1ZQL A;  1MQ2 A;  4P2H A;  5J0Y A;  5HRH A;  2BCV A;  3UXN A;  5J2D A;  1JMS A;  8ICR A;  3PNC A;  4M5D A;  5J2B A;  3RJK A;  4I2G A;  4P4O A;  4KLT A;  1ZQO A;  4WC5 A;  3OV7 A;  5J2F A;  5HRF A;  4O9M A;  4M0A A;  5DBB A;  1ZQJ A;  7ICE A;  8ICF A;  2BPC A;  8ICK A;  5J0S A;  1TVA A;  3WFR E;  2DR7 A;  4K4H A;  3LK9 A;  1JQR A;  7ICO A;  3C66 A;  4XQ7 A;  4PGY A;  1ZQZ A;  4YD2 A;  1TFY A;  4PGX A;  3AU6 A;  4QZD A;  3RH6 A;  4FHP A;  4AT9 A;  4MFA A;  3GDX A;  3MBY A;  4UAY A;  4EBK A;  2ZH8 A;  3HJ1 A;  4TUR A;  4DOB A;  4Z6D A;  2BCR A;  3LQC B;  8ICI A;  5J2I A;  2PXI A;  2BE3 A;  3B0Y A;  4MF2 A;  4LVS A;  4QZB A;  4AT8 A;  5D4B A;  3RJE A;  1ZQH A;  1BPY A;  3JPP A;  4UB5 A;  3V7L A;  3JPQ A;  4I2J A;  5J29 A;  4QZI A;  8ICX A;  4UD4 A;  1HUZ A;  4M9L A;  4X4Q A;  9ICQ A;  4QZ8 A;  4M9G A;  4O5K A;  1KNY A;  4X4O A;  2PFQ A;  5IIM A;  1VJ7 A;  4KLG A;  5J2K A;  4WC4 A;  4NXZ A;  4WC1 A;  5J2C A;  3RJI A;  9ICE A;  4NLK A;  4XA5 A;  9ICL A;  9ICV A;  2M2T A;  9ICP A;  4I2D A;  1ZQE A;  3UPQ A;  4GXK A;  3MDC A;  4K4G A;  2FMP A;  1BPX A;  5HC9 A;  4F5N A;  1YLQ A;  1ZQY A;  4UB1 A;  4RQ0 A;  4I2E A;  4QZ9 A;  5CA7 A;  4Z6F A;  2FMQ A;  5IIK A;  1UEU A;  1UET A;  4I29 A;  8ICY A;  4DO9 A;  5J0O A;  9ICU A;  8ICZ A;  4I27 A;  3C18 A;  3UXO A;  1NO5 A;  4X4N A;  9ICO A;  3NYB A;  3RH5 A;  3HIY A;  4RQ6 A;  4R66 A;  8ICA A;  1WOT A;  2ZHB A;  4GXJ A;  2ZH3 A;  9ICH A;  2O1P A;  1ZQG A;  4KLU A;  4XUS A;  1ZQU A;  4X4P A;  7ICJ A;  5HRE A;  9ICM A;  4WBY A;  2ZH1 A;  4KLO A;  1ZQN A;  4RQ7 A;  5CJ7 A;  3H39 A;  7ICP A;  2VAN A;  9ICA A;  4MFC A;  2P66 A;  3MGI A;  5IIO A;  1F5A A;  4E7X A;  1ZQF A;  4KLE A;  4FH5 A;  1XSN A;  8ICN A;  4I2A A;  5J0T A;  2O5A A;  4YN4 A;  4F5Q A;  4IG8 A;  4FHV A;  2Q66 A;  2ISO A;  4S3N A;  3JZ0 A;  4NY8 A;  5HR9 A;  5J0P A;  4NM2 A;  4QZG A;  7ICH A;  1KDH A;  3L9D A;  4M9H A;  3AQK A;  3OUY B;  3H38 A;  4UB4 A;  4IQW A;  1PX5 A;  1Q78 A;  2BPF A;  4F5R A;  1ZQD A;  8ICL A;  3H37 A;  4PHE A;  5III A;  3H3A A;  4Z6C A;  9ICS A;  5J2G A;  4R63 A;  1FA0 A; 
#chains in the Genus database with same CATH topology
 5CB1 A;  1ZJM A;  7ICL A;  7ICT A;  4RPY A;  4OAF A;  5D61 A;  2ZH9 A;  5HRK A;  4RWN A;  3OGU A;  8ICJ A;  4F5P A;  3K7D A;  3ER9 B;  4M9N A;  4O69 A;  4GXI A;  4PHA A;  3C2K A;  1R8B A;  2B51 A;  4NXT A;  7ICM A;  3ERC C;  4NXW A;  2ZH5 A;  5DBA A;  1ZQW A;  2DRB A;  1ZQM A;  1JAJ A;  2BPG A;  4LZG A;  3V7K A;  1R8C A;  1ZQC A;  4QZA A;  4P4M A;  4WBZ A;  4I2F A;  3MGH A;  1NOM A;  9ICJ A;  1MIY A;  8ICB A;  4UBB A;  3PML A;  4RPZ A;  2BBJ A;  7ICK A;  7ICN A;  2ZH2 A;  9ICN A;  4EEB A;  8ICO A;  4XJE A;  2PFP A;  2ZH4 A;  4WC2 A;  2PFO A;  4X5V A;  4FHY A;  5J2J A;  3TFS A;  4IQV A;  3WFO A;  3AQM A;  5J0U A;  1ZQA A;  4EBJ A;  4RWP A;  4AT7 A;  5CP2 A;  4UB3 A;  1MIW A;  1HUO A;  4QZE A;  1ZQS A;  1XSP A;  3UQ0 A;  8ICG A;  7ICS A;  5TZV A;  3UQ2 A;  4FH3 A;  4YMM A;  9ICK A;  4MFF A;  4O5E A;  1MQ3 A;  4IQT A;  4F5O A;  1BPE A;  4LT6 A;  4O67 A;  2M2V A;  5DDY A;  5HRD A;  4X4U A;  3OUY A;  2GA9 D;  5CFS A;  5IIL A;  2ID1 A;  5DED A;  3C2M A;  3V7J A;  1ZQR A;  4Z6E A;  3V72 A;  5DB7 A;  4RPX A;  3NWI A;  4R65 A;  2ISP A;  4UB2 A;  4M47 A;  8ICP A;  4YCX A;  7ICG A;  4I28 A;  3RJJ A;  3MDA A;  4PH5 A;  4NLZ A;  8ICV A;  4WC7 A;  4NXX A;  4X4S A;  4FO1 A;  4JWM A;  4YMN A;  3WFP A;  4PHP A;  3AU2 A;  5HHH A;  5HRB A;  4N7R A;  4TUP A;  4RQ2 A;  4KLS A;  4KLD A;  4WCW A;  1Q79 A;  8ICH A;  2BCS A;  2HN1 A;  2BCU A;  3HW8 A;  1TFW A;  5DB8 A;  9ICG A;  4RT3 A;  5D62 A;  4JLZ A;  4AT7 B;  4I2C A;  5CWR A;  4EP7 A;  1XSL A;  2DR5 A;  4E8F A;  4WC3 A;  4RQ3 A;  3WFQ E;  4NKU A;  1V4A A;  5HHI A;  1ZQV A;  4NLN A;  3K75 D;  4LEW A;  4IQU A;  1OU5 A;  3PMN A;  9ICB A;  4UAW A;  4RWQ A;  3UPS A;  4RQ4 A;  4UAZ A;  7ICR A;  5HRI A;  5B3Q A;  3ER8 C;  8ICS A;  2EWR A;  4R64 A;  5J2E A;  3ISD A;  9ICF A;  4O6A A;  4DOC A;  2M2W A;  1JN3 A;  4WC6 A;  5BOM A;  8ICE A;  5CR0 A;  4KLQ A;  5J0Q A;  1ZQX A;  3HWT A;  2ZH6 A;  2GAF D;  9ICT A;  3ISB A;  2M2U A;  1ZQT A;  2RFF A;  2BCQ A;  7ICF A;  3OWG A;  3RJF A;  4QZF A;  1RPL A;  3RH4 A;  7ICI A;  3ISC A;  4E80 A;  2HHP A;  5IIN A;  7ICQ A;  5J2H A;  1VFG A;  4ATB A;  4X4R A;  3WFS C;  3HJ4 A;  2DR8 A;  3RJH A;  4RT2 A;  4TUS A;  8ICQ A;  3OVB A;  1UEV A;  3HX0 A;  2FCL A;  4RQ8 A;  5EOZ A;  4M9J A;  5CHG A;  9ICI A;  4X4V A;  4I2B A;  1GPJ A;  4YMO A;  3JPT A;  4KLJ A;  2IHO A;  3JPS A;  4TUQ A;  4O5C A;  3PHZ A;  4XQ8 A;  4UD5 A;  3OVS A;  3OVA A;  3C5G A;  5J0X A;  4EGW A;  1R8A A;  2PFN A;  4PPX A;  2DR9 A;  1TV9 A;  4QZH A;  9ICC A;  5DEC A;  3AUO A;  3CK6 A;  9ICX A;  4M2Y A;  7ICV A;  4DOA A;  3AQN A;  4WOY A;  2PBE A;  2ZH7 A;  4LZD A;  4K9A A;  1ZQI A;  3JYY A;  4NM1 A;  1KEJ A;  7ICU A;  2I9G A;  5IIJ A;  1ZQB A;  4X0A A;  1BPD A;  4FHX A;  5CHE A;  2GWS A;  2DVI A;  4PHD A;  4KLL A;  4I2H A;  4WC0 A;  2FMS A;  1ZQQ A;  3TFR A;  8ICW A;  4YD1 A;  3AQL A;  9ICR A;  4FO6 A;  4JWN A;  5J0R A;  8ICU A;  3C2L A;  1ZJN A;  5CFU A;  8ICC A;  4K4I A;  4ATB B;  5HRL A;  4PGQ A;  4KLM A;  4OAI Z;  3JPN A;  5F2V O;  1BPZ A;  3RJG A;  2W9M A;  5DDM A;  1RZT A;  9ICW A;  8ICT A;  3JPO A;  4I2I A;  4AT9 B;  1BPB A;  5HRG A;  1ZQK A;  3C5F A;  5D49 A;  3JPR A;  4M04 A;  3EF2 A;  2NRK A;  4NKT A;  1ZQP A;  5DBC A;  5DB9 A;  2ZHA A;  4LEZ A;  2HN2 A;  5D46 A;  5J2A A;  5BPC A;  4P4P A;  4KLH A;  8ICM A;  4KLF A;  5BOL A;  1MIV A;  5DB6 A;  2IHM A;  4AT8 B;  3B0X A;  3UXP A;  4UBC A;  4QZC A;  2DRA A;  4RWO A;  4MF8 A;  4X0B A;  1R89 A;  4XRH A;  5DKW A;  4X4T A;  4KLI A;  4I0U A;  4FHW A;  3JCF A;  4RQ5 A;  5J0W A;  4RQ1 A;  1ZQL A;  1MQ2 A;  4P2H A;  5J0Y A;  5HRH A;  2BCV A;  3UXN A;  5J2D A;  1JMS A;  8ICR A;  3PNC A;  4M5D A;  5J2B A;  4LEY A;  3RJK A;  4I2G A;  4P4O A;  4KLT A;  1ZQO A;  2B4V A;  4K97 A;  4KM5 A;  4NXV A;  4WC5 A;  3OV7 A;  5J2F A;  5HRF A;  4O9M A;  4M0A A;  5DBB A;  3MCR A;  1ZQJ A;  7ICE A;  2BPC A;  8ICF A;  8ICK A;  5J0S A;  1TVA A;  3WFR E;  4K9B A;  2DR7 A;  4K4H A;  4JLX A;  3LK9 A;  1JQR A;  7ICO A;  3C66 A;  4XQ7 A;  4PGY A;  1ZQZ A;  4YD2 A;  1TFY A;  4PGX A;  4LEV A;  3AU6 A;  4QZD A;  3RH6 A;  4FHP A;  4AT9 A;  4MFA A;  3GDX A;  4WQK A;  3MBY A;  4UAY A;  4EBK A;  2ZH8 A;  3HJ1 A;  4TUR A;  4DOB A;  4K99 A;  4Z6D A;  2BCR A;  3LQC B;  5CFT A;  8ICI A;  5J2I A;  2PXI A;  2BE3 A;  4K96 A;  3B0Y A;  4MF2 A;  4LVS A;  4QZB A;  4AT8 A;  5D4B A;  3RJE A;  1ZQH A;  1BPY A;  4O68 A;  3JPP A;  4UB5 A;  3V7L A;  3JPQ A;  4I2J A;  5J29 A;  4QZI A;  8ICX A;  4UD4 A;  1HUZ A;  4M9L A;  4X4Q A;  9ICQ A;  4QZ8 A;  4M9G A;  4O5K A;  1KNY A;  2BBH A;  4X4O A;  5IIM A;  1VJ7 A;  2PFQ A;  5J2K A;  4KLG A;  5JTG A;  4WC4 A;  4NXZ A;  4WC1 A;  5J2C A;  3RJI A;  4EED A;  9ICE A;  4NLK A;  2IUB A;  4XA5 A;  9ICL A;  2M2T A;  9ICP A;  4I2D A;  9ICV A;  1ZQE A;  4WH5 A;  3UPQ A;  4GXK A;  3MDC A;  4K4G A;  2FMP A;  1BPX A;  5HC9 A;  4F5N A;  1YLQ A;  1ZQY A;  4UB1 A;  4MKP A;  4RQ0 A;  4I2E A;  4QZ9 A;  5CA7 A;  4Z6F A;  2FMQ A;  5IIK A;  1UEU A;  1UET A;  4I29 A;  8ICY A;  4DO9 A;  5J0O A;  9ICU A;  8ICZ A;  4NXU A;  4I27 A;  4OAG A;  4KB6 A;  3C18 A;  3UXO A;  1NO5 A;  4X4N A;  9ICO A;  4K98 A;  3NYB A;  3RH5 A;  3HIY A;  4RQ6 A;  4R66 A;  8ICA A;  1WOT A;  2ZHB A;  4GXJ A;  2ZH3 A;  3NVO A;  9ICH A;  2O1P A;  1ZQG A;  4KLU A;  4XUS A;  1ZQU A;  4X4P A;  7ICJ A;  5HRE A;  9ICM A;  3NKU A;  4HX0 A;  4K8V A;  4WBY A;  2ZH1 A;  4KLO A;  1ZQN A;  5D63 A;  4RQ7 A;  5CJ7 A;  3H39 A;  4OAH A;  7ICP A;  2VAN A;  9ICA A;  4MFC A;  2P66 A;  3MGI A;  5IIO A;  1F5A A;  4E7X A;  1ZQF A;  4KLE A;  4FH5 A;  1XSN A;  8ICN A;  4I2A A;  5J0T A;  2O5A A;  4YN4 A;  4EV6 A;  4F5Q A;  4IG8 A;  4FHV A;  2Q66 A;  4WQL A;  2ISO A;  4S3N A;  3JZ0 A;  4NY8 A;  5HR9 A;  5J0P A;  4NM2 A;  4QZG A;  7ICH A;  1KDH A;  3L9D A;  4M9H A;  3AQK A;  3OUY B;  3H38 A;  4UB4 A;  4IQW A;  1PX5 A;  1Q78 A;  2BPF A;  4F5R A;  5B3P A;  1ZQD A;  8ICL A;  3H37 A;  2B56 A;  4PHE A;  5III A;  3H3A A;  4Z6C A;  9ICS A;  5J2G A;  4R63 A;  1FA0 A; 
#chains in the Genus database with same CATH homology
 5CB1 A;  1ZJM A;  7ICL A;  7ICT A;  4RPY A;  2ZH9 A;  5HRK A;  4RWN A;  3OGU A;  8ICJ A;  4F5P A;  4M9N A;  4GXI A;  4PHA A;  3C2K A;  1R8B A;  7ICM A;  2ZH5 A;  5DBA A;  1ZQW A;  2DRB A;  1ZQM A;  1JAJ A;  2BPG A;  4LZG A;  3V7K A;  1R8C A;  1ZQC A;  4QZA A;  4P4M A;  4WBZ A;  4I2F A;  3MGH A;  1NOM A;  9ICJ A;  1MIY A;  8ICB A;  4UBB A;  3PML A;  4RPZ A;  7ICK A;  7ICN A;  2ZH2 A;  9ICN A;  8ICO A;  2PFP A;  2ZH4 A;  4WC2 A;  2PFO A;  4X5V A;  4FHY A;  5J2J A;  3TFS A;  4IQV A;  3WFO A;  3AQM A;  5J0U A;  1ZQA A;  4EBJ A;  4RWP A;  4AT7 A;  5CP2 A;  4UB3 A;  1MIW A;  1HUO A;  4QZE A;  1ZQS A;  1XSP A;  3UQ0 A;  8ICG A;  7ICS A;  5TZV A;  3UQ2 A;  4FH3 A;  4YMM A;  9ICK A;  4MFF A;  4O5E A;  1MQ3 A;  4IQT A;  4F5O A;  1BPE A;  4LT6 A;  2M2V A;  5DDY A;  5HRD A;  4X4U A;  3OUY A;  5IIL A;  2ID1 A;  5DED A;  3C2M A;  3V7J A;  1ZQR A;  4Z6E A;  3V72 A;  5DB7 A;  4RPX A;  4R65 A;  2ISP A;  4UB2 A;  4M47 A;  8ICP A;  4YCX A;  7ICG A;  4I28 A;  3RJJ A;  3MDA A;  4PH5 A;  4NLZ A;  8ICV A;  4WC7 A;  4X4S A;  4JWM A;  4YMN A;  3WFP A;  4PHP A;  3AU2 A;  5HHH A;  5HRB A;  4TUP A;  4RQ2 A;  4KLS A;  4KLD A;  4WCW A;  1Q79 A;  8ICH A;  2BCS A;  2BCU A;  3HW8 A;  1TFW A;  5DB8 A;  9ICG A;  4RT3 A;  4AT7 B;  4I2C A;  5CWR A;  4EP7 A;  1XSL A;  2DR5 A;  4E8F A;  4WC3 A;  4RQ3 A;  3WFQ E;  4NKU A;  1V4A A;  5HHI A;  1ZQV A;  4NLN A;  3K75 D;  4IQU A;  1OU5 A;  3PMN A;  9ICB A;  4UAW A;  4RWQ A;  3UPS A;  4RQ4 A;  4UAZ A;  7ICR A;  5HRI A;  8ICS A;  4R64 A;  5J2E A;  3ISD A;  9ICF A;  4DOC A;  2M2W A;  1JN3 A;  4WC6 A;  5BOM A;  8ICE A;  5CR0 A;  4KLQ A;  5J0Q A;  1ZQX A;  3HWT A;  2ZH6 A;  9ICT A;  3ISB A;  2M2U A;  1ZQT A;  2RFF A;  2BCQ A;  7ICF A;  3RJF A;  4QZF A;  1RPL A;  3RH4 A;  7ICI A;  3ISC A;  4E80 A;  2HHP A;  5IIN A;  7ICQ A;  5J2H A;  1VFG A;  4ATB A;  4X4R A;  3WFS C;  3HJ4 A;  2DR8 A;  3RJH A;  4TUS A;  4RT2 A;  8ICQ A;  3OVB A;  1UEV A;  3HX0 A;  4RQ8 A;  5EOZ A;  4M9J A;  5CHG A;  9ICI A;  4X4V A;  4I2B A;  4YMO A;  3JPT A;  4KLJ A;  3JPS A;  4TUQ A;  4O5C A;  4XQ8 A;  4UD5 A;  3OVS A;  3OVA A;  3C5G A;  5J0X A;  2PFN A;  1R8A A;  4PPX A;  2DR9 A;  1TV9 A;  4QZH A;  9ICC A;  5DEC A;  3AUO A;  9ICX A;  4M2Y A;  7ICV A;  4DOA A;  3AQN A;  2PBE A;  2ZH7 A;  4LZD A;  1ZQI A;  3JYY A;  4NM1 A;  1KEJ A;  7ICU A;  2I9G A;  5IIJ A;  1ZQB A;  4X0A A;  1BPD A;  4FHX A;  2GWS A;  2DVI A;  4PHD A;  4KLL A;  4I2H A;  4WC0 A;  2FMS A;  1ZQQ A;  3TFR A;  8ICW A;  4YD1 A;  3AQL A;  9ICR A;  4FO6 A;  4JWN A;  5J0R A;  8ICU A;  3C2L A;  1ZJN A;  8ICC A;  4K4I A;  4ATB B;  5HRL A;  4PGQ A;  4KLM A;  3JPN A;  5F2V O;  1BPZ A;  3RJG A;  2W9M A;  5DDM A;  1RZT A;  9ICW A;  8ICT A;  3JPO A;  4I2I A;  4AT9 B;  1BPB A;  5HRG A;  1ZQK A;  3C5F A;  5D49 A;  3JPR A;  4M04 A;  2NRK A;  4NKT A;  1ZQP A;  5DBC A;  5DB9 A;  2ZHA A;  5J2A A;  5D46 A;  5BPC A;  4P4P A;  4KLH A;  8ICM A;  4KLF A;  5BOL A;  1MIV A;  5DB6 A;  2IHM A;  4AT8 B;  3B0X A;  3UXP A;  4UBC A;  4QZC A;  2DRA A;  4RWO A;  4MF8 A;  4X0B A;  1R89 A;  4XRH A;  5DKW A;  4X4T A;  4KLI A;  4FHW A;  4RQ5 A;  5J0W A;  4RQ1 A;  1ZQL A;  1MQ2 A;  4P2H A;  5J0Y A;  5HRH A;  2BCV A;  3UXN A;  5J2D A;  1JMS A;  8ICR A;  3PNC A;  4M5D A;  5J2B A;  3RJK A;  4I2G A;  4P4O A;  4KLT A;  1ZQO A;  4WC5 A;  3OV7 A;  5J2F A;  5HRF A;  4O9M A;  4M0A A;  5DBB A;  1ZQJ A;  7ICE A;  8ICF A;  2BPC A;  8ICK A;  5J0S A;  1TVA A;  3WFR E;  2DR7 A;  4K4H A;  3LK9 A;  1JQR A;  7ICO A;  3C66 A;  4XQ7 A;  4PGY A;  1ZQZ A;  4YD2 A;  1TFY A;  4PGX A;  3AU6 A;  4QZD A;  3RH6 A;  4FHP A;  4AT9 A;  4MFA A;  3GDX A;  3MBY A;  4UAY A;  4EBK A;  2ZH8 A;  3HJ1 A;  4TUR A;  4DOB A;  4Z6D A;  2BCR A;  3LQC B;  8ICI A;  5J2I A;  2PXI A;  2BE3 A;  3B0Y A;  4MF2 A;  4LVS A;  4QZB A;  4AT8 A;  5D4B A;  3RJE A;  1ZQH A;  1BPY A;  3JPP A;  4UB5 A;  3V7L A;  3JPQ A;  4I2J A;  5J29 A;  4QZI A;  8ICX A;  4UD4 A;  1HUZ A;  4M9L A;  4X4Q A;  9ICQ A;  4QZ8 A;  4M9G A;  4O5K A;  1KNY A;  4X4O A;  2PFQ A;  5IIM A;  1VJ7 A;  4KLG A;  5J2K A;  4WC4 A;  4NXZ A;  4WC1 A;  5J2C A;  3RJI A;  9ICE A;  4NLK A;  4XA5 A;  9ICL A;  9ICV A;  2M2T A;  9ICP A;  4I2D A;  1ZQE A;  3UPQ A;  4GXK A;  3MDC A;  4K4G A;  2FMP A;  1BPX A;  5HC9 A;  4F5N A;  1YLQ A;  1ZQY A;  4UB1 A;  4RQ0 A;  4I2E A;  4QZ9 A;  5CA7 A;  4Z6F A;  2FMQ A;  5IIK A;  1UEU A;  1UET A;  4I29 A;  8ICY A;  4DO9 A;  5J0O A;  9ICU A;  8ICZ A;  4I27 A;  3C18 A;  3UXO A;  1NO5 A;  4X4N A;  9ICO A;  3NYB A;  3RH5 A;  3HIY A;  4RQ6 A;  4R66 A;  8ICA A;  1WOT A;  2ZHB A;  4GXJ A;  2ZH3 A;  9ICH A;  2O1P A;  1ZQG A;  4KLU A;  4XUS A;  1ZQU A;  4X4P A;  7ICJ A;  5HRE A;  9ICM A;  4WBY A;  2ZH1 A;  4KLO A;  1ZQN A;  4RQ7 A;  5CJ7 A;  3H39 A;  7ICP A;  2VAN A;  9ICA A;  4MFC A;  2P66 A;  3MGI A;  5IIO A;  1F5A A;  4E7X A;  1ZQF A;  4KLE A;  4FH5 A;  1XSN A;  8ICN A;  4I2A A;  5J0T A;  2O5A A;  4YN4 A;  4F5Q A;  4IG8 A;  4FHV A;  2Q66 A;  2ISO A;  4S3N A;  3JZ0 A;  4NY8 A;  5HR9 A;  5J0P A;  4NM2 A;  4QZG A;  7ICH A;  1KDH A;  3L9D A;  4M9H A;  3AQK A;  3OUY B;  3H38 A;  4UB4 A;  4IQW A;  1PX5 A;  1Q78 A;  2BPF A;  4F5R A;  1ZQD A;  8ICL A;  3H37 A;  4PHE A;  5III A;  3H3A A;  4Z6C A;  9ICS A;  5J2G A;  4R63 A;  1FA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...