4WC7A

Structure of trna-processing enzyme complex 5
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc7A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc7A01
1ZQWA 4EBKA 3LK9A 4PHAA 4RT3A 2RFFA 9ICMA 4YD1A 4X4SA 4O5CA 3C66A 8ICPA 3PMLA 3UPQA 9ICOA 5IILA 1XSPA 4NLZA 3OUYB 3MBYA 4PHEA 4KLFA 8ICTA 4MF2A 1OU5A 4UD5A 4KLHA 2M2UA 5HC9A 3JPPA 4KLJA 4IQVA 3UXPA 3V7KA 5J2HA 4UB2A 5CB1A 4MFFA 9ICKA 1ZQEA 2I9GA 2BCVA 3AUOA 1YLQA 4JWNA 2M2VA 4KLTA 3RJEA 1TFWA 3RH4A 8ICHA 1KNYA 4LT6A 4RWQA 4XUSA 4QZ9A 1KDHA 3WFRE 5D4BA 4M04A 4KLGA 7ICRA 4M9NA 4M9HA 7ICLA 2NRKA 4Z6CA 4Z6DA 4M0AA 5J0WA 2FMSA 3JYYA 4I29A 4RQ1A 5HRGA 7ICPA 3HWTA 4NM2A 2ZH8A 4XRHA 4I27A 4QZBA 1ZQJA 1BPEA 5CR0A 1ZQSA 3JPNA 8ICCA 4QZ8A 4LZGA 7ICKA 5DDMA 5IIKA 3UQ0A 1UEVA 2DR7A 1TVAA 4XQ8A 4AT9B 3OVSA 5J0XA 2Q66A 9ICQA 4LVSA 4PGXA 3C18A 3PMNA 2ZH6A 3PNCA 1R8BA 8ICNA 2ZH7A 3RJFA 2ZH2A 4WC7A 4F5NA 2PFQA 1ZQHA 2P66A 1FA0A 4FH5A 4AT7A 5D46A 4RWNA 4WCWA 3TFRA 1JN3A 9ICGA 4I2HA 4QZAA 8ICBA 7ICGA 3JZ0A 4XA5A 9ICSA 4YCXA 5IINA 4R65A 4RQ0A 1BPYA 1JQRA 4YD2A 4GXJA 1NOMA 3V7LA 1ZQLA 4F5OA 9ICBA 4JWMA 5J0OA 1TV9A 4I2EA 4KLDA 3OVBA 5DKWA 4M9JA 4NKUA 9ICXA 3GDXA 1XSNA 3WFOA 5HRFA 1MIVA 4QZIA 8ICLA 4UB5A 4UB3A 2ZHBA 4M2YA 5D49A 4P4MA 1ZQCA 2BPFA 4YMOA 5IIJA 4TUPA 3B0XA 1TFYA 3ISBA 2ISOA 4QZFA 4PH5A 4ATBB 2W9MA 5J0PA 1MIYA 4QZGA 3HIYA 4KLOA 3HX0A 4I2FA 8ICIA 8ICOA 5J2GA 5HHHA 4MFAA 5BOLA 4PGYA 4F5RA 3C2MA 4M47A 2HHPA 5DBCA 3HW8A 3UXOA 4FHWA 4DO9A 4P4OA 4R66A 4X4RA 8ICYA 5CP2A 4R63A 5CHGA 5HREA 9ICUA 9ICCA 4QZCA 3JPQA 4RQ7A 7ICEA 2BCRA 3HJ1A 4AT8B 4PPXA 1ZQOA 3RH6A 2BCQA 9ICAA 2GWSA 2PFOA 4IQTA 5DDYA 2O5AA 1BPDA 2DR8A 1VJ7A 8ICQA 4F5QA 4WC1A 4WBYA 1WOTA 3RJKA 3C2LA 1MQ2A 8ICRA 4M9GA 9ICHA 1BPXA 4UBBA 4NKTA 1ZQVA 3LQCB 4MF8A 1ZQPA 7ICSA 9ICVA 1ZQKA 4WC5A 4RQ4A 7ICMA 8ICGA 1JMSA 3MDCA 7ICFA 3JPRA 1MIWA 4UAZA 5J2AA 5J0YA 4R64A 3RJIA 7ICHA 2O1PA 3OUYA 1ZQNA 5J0RA 2M2TA 4RPXA 4X4QA 4TUQA 4EBJA 4E80A 3NYBA 2BPCA 4EP7A 4YMMA 4I2CA 3WFSC 7ICVA 5HRIA 4E8FA 1HUOA 7ICIA 4X5VA 1R89A 5J2DA 5HRLA 4DOAA 1NO5A 4I2BA 1JAJA 4I2AA 2ZH3A 3MGHA 4NM1A 4Z6EA 7ICTA 4X4UA 4E7XA 4I28A 3OGUA 5DB8A 4O5KA 4KLUA 4WC0A 4UBCA 5F2VO 8ICSA 1PX5A 8ICAA 4KLMA 4FH3A 2BE3A 4QZEA 5CWRA 4X4PA 8ICEA 8ICXA 9ICNA 1ZQQA 1R8CA 3AU2A 3RH5A 1UEUA 1XSLA 1ZJNA 3UXNA 1Q78A 4UB1A 3OVAA 2M2WA 2BPGA 1ZQTA 2PXIA 5J0UA 5HHIA 5DB6A 5HRBA 4UAYA 8ICJA 4TUSA 4IQWA 4YMNA 1ZQFA 4DOCA 5CA7A 1R8AA 4UD4A 2DVIA 2BCSA 4GXIA 4K4GA 4NXZA 2PBEA 7ICUA 5DEDA 3JPTA 5J0QA 3WFPA 2ID1A 4RQ6A 5DBAA 9ICJA 8ICZA 3L9DA 4RQ3A 3OV7A 4KLIA 2ZH5A 5J2BA 3MDAA 4KLLA 7ICJA 7ICOA 2ZH9A 2PFPA 4AT9A 1ZQUA 4O5EA 4TURA 3JPSA 3B0YA 4M5DA 2DR5A 4O9MA 1RPLA 4X4NA 1MQ3A 4WC6A 5J2CA 4IG8A 4X4OA 3JPOA 4NY8A 3RJHA 4UAWA 3V7JA 1V4AA 4K4HA 4QZHA 5HR9A 2ISPA 1HUZA 3H39A 4LZDA 4RQ2A 1ZQXA 1ZQZA 4RWPA 3V72A 4AT7B 5J0SA 1ZQRA 3RJGA 4P2HA 5DBBA 5IIIA 4WBZA 4X0BA 4M9LA 1ZQGA 4RT2A 3H3AA 1ZQIA 1BPZA 4FHPA 2DRBA 3RJJA 4I2JA 3AQLA 4RPYA 4MFCA 4Z6FA 9ICPA 2IHMA 4KLSA 8ICUA 4RPZA 5DECA 4X4VA 4F5PA 4X0AA 2ZHAA 4QZDA 2VANA 3K75D 5BOMA 5IIOA 9ICEA 1RZTA 9ICTA 1KEJA 5J29A 4GXKA 4WC3A 3ISCA 2PFNA 4RQ5A 4ATBA 2BCUA 4XQ7A 3AQMA 8ICKA 4RWOA 4NLKA 8ICFA 4PHPA 4PGQA 4K4IA 4I2GA 4IQUA 5EOZA 3UPSA 3AQKA 3C2KA 8ICVA 9ICIA 4WC2A 3HJ4A 5HRHA 4RQ8A 5HRKA 5CJ7A 8ICWA 5J2IA 4I2DA 5J2FA 3C5FA 1ZJMA 4KLEA 5J2KA 3TFSA 4FO6A 4FHXA 4AT8A 4S3NA 4UB4A 1VFGA 3ISDA 9ICRA 4P4PA 9ICWA 2ZH4A 3H37A 3H38A 4NLNA 3MGIA 3AU6A 1ZQAA 1ZQMA 3C5GA 5BPCA 1ZQDA 2FMPA 4I2IA 9ICLA 9ICFA 3AQNA 5J0TA 1BPBA 7ICNA 2ZH1A 2DRAA 5HRDA 1Q79A 2DR9A 5DB9A 1UETA 5J2EA 4PHDA 2FMQA 3UQ2A 5DB7A 8ICMA 3WFQE 1ZQYA 1F5AA 5IIMA 4FHVA 4FHYA 1ZQBA 4KLQA 7ICQA 4DOBA 4X4TA 4YN4A 4WC4A 5TZVA 5J2JA
chains in the Genus database with same CATH superfamily
1ZQWA 4EBKA 3LK9A 3CK6A 4PHAA 4RT3A 2RFFA 9ICMA 4YD1A 4X4SA 4O5CA 2B56A 3C66A 4EEBA 8ICPA 3PMLA 4K98A 3UPQA 9ICOA 3NWIA 4JLZA 5IILA 3OUYB 1XSPA 4NLZA 3MBYA 5B3QA 4PHEA 4KLFA 8ICTA 4MF2A 1OU5A 4UD5A 4KLHA 2M2UA 5HC9A 3JPPA 4KLJA 4IQVA 3UXPA 3V7KA 5J2HA 4UB2A 5CB1A 4MFFA 9ICKA 1ZQEA 2I9GA 2BCVA 3AUOA 1YLQA 4JWNA 2M2VA 4I0UA 4KLTA 3RJEA 1TFWA 3RH4A 8ICHA 4OAHA 1KNYA 4LT6A 4RWQA 4XUSA 4QZ9A 1KDHA 3WFRE 5D4BA 4M04A 4KLGA 7ICRA 4M9NA 4M9HA 7ICLA 2NRKA 4Z6CA 4M0AA 5J0WA 2FMSA 5CFUA 3JYYA 4I29A 4RQ1A 5HRGA 7ICPA 3HWTA 3NVOA 4NM2A 2ZH8A 4XRHA 4I27A 4QZBA 1ZQJA 1BPEA 5CR0A 1ZQSA 3JPNA 8ICCA 4QZ8A 4LZGA 4EEDA 4MKPA 7ICKA 5DDMA 5IIKA 3UQ0A 1UEVA 2DR7A 4EGWA 4K96A 1TVAA 4XQ8A 4AT9B 3OVSA 5J0XA 5CFTA 5B3PA 2Q66A 9ICQA 4LVSA 4PGXA 3C18A 3PMNA 2ZH6A 3PNCA 5D63A 1R8BA 8ICNA 2ZH7A 3RJFA 2ZH2A 4WC7A 4F5NA 2PFQA 1ZQHA 2P66A 1FA0A 4FH5A 4AT7A 5D46A 4RWNA 4WCWA 3TFRA 1JN3A 9ICGA 4I2HA 4QZAA 8ICBA 7ICGA 3JZ0A 4N7RA 4XA5A 9ICSA 4YCXA 5IINA 4R65A 4RQ0A 1BPYA 1JQRA 4YD2A 4GXJA 1NOMA 3V7LA 1ZQLA 4F5OA 9ICBA 4JWMA 5J0OA 1TV9A 4I2EA 4KLDA 3OVBA 5DKWA 4M9JA 4NKUA 9ICXA 3GDXA 1XSNA 2IUBA 3WFOA 5HRFA 1MIVA 4QZIA 2BBHA 8ICLA 4UB5A 4OAIZ 4UB3A 2ZHBA 4M2YA 5D49A 4P4MA 1ZQCA 2BBJA 3MCRA 4YMOA 2BPFA 5IIJA 4TUPA 2IHOA 3B0XA 1TFYA 2HN2A 3ISBA 2ISOA 4QZFA 4PH5A 4LEVA 4ATBB 4K9AA 2W9MA 5CFSA 5J0PA 1MIYA 4QZGA 3HIYA 4KLOA 3HX0A 4I2FA 8ICIA 8ICOA 5J2GA 5HHHA 4MFAA 5BOLA 3NKUA 4PGYA 4F5RA 3C2MA 4M47A 2HHPA 5DBCA 3HW8A 4KM5A 3UXOA 4FHWA 4DO9A 4P4OA 4R66A 4X4RA 8ICYA 5CP2A 4R63A 5CHGA 4OAFA 5HREA 9ICUA 9ICCA 4QZCA 3JPQA 4RQ7A 7ICEA 2BCRA 3HJ1A 4AT8B 4PPXA 4O69A 1ZQOA 3RH6A 2BCQA 9ICAA 2GWSA 2PFOA 4IQTA 5DDYA 2O5AA 1BPDA 2DR8A 1VJ7A 8ICQA 4F5QA 4NXVA 4WC1A 4WBYA 1WOTA 3RJKA 3C2LA 1MQ2A 8ICRA 4WQKA 4M9GA 9ICHA 1BPXA 4NXUA 4XJEA 4UBBA 4NKTA 1ZQVA 4NXXA 3LQCB 2HN1A 4MF8A 1ZQPA 7ICSA 4KB6A 9ICVA 1ZQKA 4WC5A 4RQ4A 7ICMA 8ICGA 4FO1A 1JMSA 3MDCA 7ICFA 3JPRA 1MIWA 4UAZA 5J2AA 5J0YA 4R64A 3RJIA 7ICHA 2O1PA 3OUYA 1ZQNA 5J0RA 4HX0A 2M2TA 4RPXA 4X4QA 4TUQA 4EBJA 4E80A 3NYBA 2BPCA 4EP7A 4YMMA 4I2CA 3WFSC 4O68A 7ICVA 5HRIA 5D61A 4E8FA 4LEYA 1HUOA 7ICIA 4X5VA 1R89A 4X4TA 5J2DA 5HRLA 4DOAA 1NO5A 4I2BA 1JAJA 4I2AA 1GPJA 2ZH3A 3MGHA 4NM1A 4Z6EA 7ICTA 4X4UA 4E7XA 4I28A 3OGUA 5DB8A 4O5KA 4KLUA 4WC0A 4UBCA 5F2VO 8ICSA 1PX5A 8ICAA 4KLMA 4FH3A 2BE3A 4QZEA 5CWRA 4X4PA 8ICEA 8ICXA 9ICNA 1ZQQA 1R8CA 3AU2A 3RH5A 1UEUA 1XSLA 1ZJNA 3ER8C 3UXNA 1Q78A 4UB1A 3OVAA 2M2WA 2BPGA 1ZQTA 2PXIA 5J0UA 5HHIA 4K97A 5DB6A 5HRBA 4UAYA 8ICJA 4TUSA 4IQWA 4YMNA 3EF2A 1ZQFA 4DOCA 5CA7A 1R8AA 4UD4A 2DVIA 2BCSA 4GXIA 4K4GA 4NXZA 2PBEA 7ICUA 5DEDA 3JPTA 5J0QA 3WFPA 2ID1A 4RQ6A 5DBAA 9ICJA 8ICZA 3L9DA 4RQ3A 3OV7A 4KLIA 2ZH5A 5J2BA 3MDAA 4KLLA 7ICJA 7ICOA 2ZH9A 2PFPA 4AT9A 1ZQUA 4O5EA 4TURA 3JPSA 3B0YA 4M5DA 2DR5A 4O9MA 1RPLA 4X4NA 1MQ3A 4WC6A 5J2CA 4IG8A 4X4OA 3JPOA 4NY8A 3RJHA 4UAWA 3V7JA 4WH5A 1V4AA 4K4HA 4QZHA 5HR9A 2ISPA 5CHEA 1HUZA 4EV6A 3H39A 2EWRA 4LZDA 4RQ2A 4NXTA 1ZQXA 1ZQZA 4RWPA 3V72A 4AT7B 5J0SA 1ZQRA 5D62A 3RJGA 4P2HA 4O67A 5DBBA 5IIIA 4WBZA 4X0BA 4M9LA 1ZQGA 4RT2A 3H3AA 1ZQIA 1BPZA 4FHPA 2DRBA 3RJJA 4I2JA 3AQLA 2B4VA 4RPYA 4MFCA 4Z6FA 9ICPA 2IHMA 4KLSA 8ICUA 4RPZA 5DECA 4X4VA 4F5PA 4X0AA 2ZHAA 4QZDA 2VANA 3K75D 4LEZA 4NXWA 5BOMA 5IIOA 9ICEA 4WOYA 1RZTA 9ICTA 1KEJA 5J29A 4GXKA 4WC3A 3ISCA 2PFNA 4RQ5A 4ATBA 3JCFA 4OAGA 4K9BA 5JTGA 2BCUA 4XQ7A 4LEWA 3AQMA 8ICKA 4RWOA 4NLKA 8ICFA 4PHPA 4PGQA 4K4IA 4JLXA 4I2GA 3OWGA 4IQUA 5EOZA 3UPSA 3AQKA 3C2KA 8ICVA 9ICIA 3ERCC 4WC2A 3HJ4A 5HRHA 4RQ8A 5HRKA 5CJ7A 8ICWA 2GA9D 5J2IA 4I2DA 5J2FA 3C5FA 3PHZA 1ZJMA 4KLEA 5J2KA 3TFSA 2B51A 4FO6A 4FHXA 4AT8A 4S3NA 4UB4A 1VFGA 3ISDA 3ER9B 9ICRA 4P4PA 9ICWA 2ZH4A 3H37A 3H38A 4NLNA 3MGIA 3AU6A 1ZQAA 3K7DA 1ZQMA 3C5GA 5BPCA 1ZQDA 2GAFD 2FMPA 4I2IA 9ICLA 9ICFA 3AQNA 5J0TA 1BPBA 4WQLA 7ICNA 2ZH1A 2DRAA 5HRDA 4K99A 1Q79A 2DR9A 5DB9A 1UETA 5J2EA 4K8VA 4PHDA 2FMQA 3UQ2A 5DB7A 8ICMA 3WFQE 1ZQYA 1F5AA 5IIMA 4FHVA 4FHYA 1ZQBA 4KLQA 4O6AA 2FCLA 7ICQA 4DOBA 4Z6DA 4YN4A 4WC4A 5TZVA 5J2JA
chains in the Genus database with same CATH topology
1ZQWA 4EBKA 3LK9A 4PHAA 4RT3A 2RFFA 9ICMA 4YD1A 4X4SA 4O5CA 3C66A 8ICPA 3PMLA 3UPQA 9ICOA 5IILA 1XSPA 4NLZA 3OUYB 3MBYA 4PHEA 4KLFA 8ICTA 4MF2A 1OU5A 4UD5A 4KLHA 2M2UA 5HC9A 3JPPA 4KLJA 4IQVA 3UXPA 3V7KA 5J2HA 4UB2A 5CB1A 4MFFA 9ICKA 1ZQEA 2I9GA 2BCVA 3AUOA 1YLQA 4JWNA 2M2VA 4KLTA 3RJEA 1TFWA 3RH4A 8ICHA 1KNYA 4LT6A 4RWQA 4XUSA 4QZ9A 1KDHA 3WFRE 5D4BA 4M04A 4KLGA 7ICRA 4M9NA 4M9HA 7ICLA 2NRKA 4Z6CA 4Z6DA 4M0AA 5J0WA 2FMSA 3JYYA 4I29A 4RQ1A 5HRGA 7ICPA 3HWTA 4NM2A 2ZH8A 4XRHA 4I27A 4QZBA 1ZQJA 1BPEA 5CR0A 1ZQSA 3JPNA 8ICCA 4QZ8A 4LZGA 7ICKA 5DDMA 5IIKA 3UQ0A 1UEVA 2DR7A 1TVAA 4XQ8A 4AT9B 3OVSA 5J0XA 2Q66A 9ICQA 4LVSA 4PGXA 3C18A 3PMNA 2ZH6A 3PNCA 1R8BA 8ICNA 2ZH7A 3RJFA 2ZH2A 4WC7A 4F5NA 2PFQA 1ZQHA 2P66A 1FA0A 4FH5A 4AT7A 5D46A 4RWNA 4WCWA 3TFRA 1JN3A 9ICGA 4I2HA 4QZAA 8ICBA 7ICGA 3JZ0A 4XA5A 9ICSA 4YCXA 5IINA 4R65A 4RQ0A 1BPYA 1JQRA 4YD2A 4GXJA 1NOMA 3V7LA 1ZQLA 4F5OA 9ICBA 4JWMA 5J0OA 1TV9A 4I2EA 4KLDA 3OVBA 5DKWA 4M9JA 4NKUA 9ICXA 3GDXA 1XSNA 3WFOA 5HRFA 1MIVA 4QZIA 8ICLA 4UB5A 4UB3A 2ZHBA 4M2YA 5D49A 4P4MA 1ZQCA 2BPFA 4YMOA 5IIJA 4TUPA 3B0XA 1TFYA 3ISBA 2ISOA 4QZFA 4PH5A 4ATBB 2W9MA 5J0PA 1MIYA 4QZGA 3HIYA 4KLOA 3HX0A 4I2FA 8ICIA 8ICOA 5J2GA 5HHHA 4MFAA 5BOLA 4PGYA 4F5RA 3C2MA 4M47A 2HHPA 5DBCA 3HW8A 3UXOA 4FHWA 4DO9A 4P4OA 4R66A 4X4RA 8ICYA 5CP2A 4R63A 5CHGA 5HREA 9ICUA 9ICCA 4QZCA 3JPQA 4RQ7A 7ICEA 2BCRA 3HJ1A 4AT8B 4PPXA 1ZQOA 3RH6A 2BCQA 9ICAA 2GWSA 2PFOA 4IQTA 5DDYA 2O5AA 1BPDA 2DR8A 1VJ7A 8ICQA 4F5QA 4WC1A 4WBYA 1WOTA 3RJKA 3C2LA 1MQ2A 8ICRA 4M9GA 9ICHA 1BPXA 4UBBA 4NKTA 1ZQVA 3LQCB 4MF8A 1ZQPA 7ICSA 9ICVA 1ZQKA 4WC5A 4RQ4A 7ICMA 8ICGA 1JMSA 3MDCA 7ICFA 3JPRA 1MIWA 4UAZA 5J2AA 5J0YA 4R64A 3RJIA 7ICHA 2O1PA 3OUYA 1ZQNA 5J0RA 2M2TA 4RPXA 4X4QA 4TUQA 4EBJA 4E80A 3NYBA 2BPCA 4EP7A 4YMMA 4I2CA 3WFSC 7ICVA 5HRIA 4E8FA 1HUOA 7ICIA 4X5VA 1R89A 5J2DA 5HRLA 4DOAA 1NO5A 4I2BA 1JAJA 4I2AA 2ZH3A 3MGHA 4NM1A 4Z6EA 7ICTA 4X4UA 4E7XA 4I28A 3OGUA 5DB8A 4O5KA 4KLUA 4WC0A 4UBCA 5F2VO 8ICSA 1PX5A 8ICAA 4KLMA 4FH3A 2BE3A 4QZEA 5CWRA 4X4PA 8ICEA 8ICXA 9ICNA 1ZQQA 1R8CA 3AU2A 3RH5A 1UEUA 1XSLA 1ZJNA 3UXNA 1Q78A 4UB1A 3OVAA 2M2WA 2BPGA 1ZQTA 2PXIA 5J0UA 5HHIA 5DB6A 5HRBA 4UAYA 8ICJA 4TUSA 4IQWA 4YMNA 1ZQFA 4DOCA 5CA7A 1R8AA 4UD4A 2DVIA 2BCSA 4GXIA 4K4GA 4NXZA 2PBEA 7ICUA 5DEDA 3JPTA 5J0QA 3WFPA 2ID1A 4RQ6A 5DBAA 9ICJA 8ICZA 3L9DA 4RQ3A 3OV7A 4KLIA 2ZH5A 5J2BA 3MDAA 4KLLA 7ICJA 7ICOA 2ZH9A 2PFPA 4AT9A 1ZQUA 4O5EA 4TURA 3JPSA 3B0YA 4M5DA 2DR5A 4O9MA 1RPLA 4X4NA 1MQ3A 4WC6A 5J2CA 4IG8A 4X4OA 3JPOA 4NY8A 3RJHA 4UAWA 3V7JA 1V4AA 4K4HA 4QZHA 5HR9A 2ISPA 1HUZA 3H39A 4LZDA 4RQ2A 1ZQXA 1ZQZA 4RWPA 3V72A 4AT7B 5J0SA 1ZQRA 3RJGA 4P2HA 5DBBA 5IIIA 4WBZA 4X0BA 4M9LA 1ZQGA 4RT2A 3H3AA 1ZQIA 1BPZA 4FHPA 2DRBA 3RJJA 4I2JA 3AQLA 4RPYA 4MFCA 4Z6FA 9ICPA 2IHMA 4KLSA 8ICUA 4RPZA 5DECA 4X4VA 4F5PA 4X0AA 2ZHAA 4QZDA 2VANA 3K75D 5BOMA 5IIOA 9ICEA 1RZTA 9ICTA 1KEJA 5J29A 4GXKA 4WC3A 3ISCA 2PFNA 4RQ5A 4ATBA 2BCUA 4XQ7A 3AQMA 8ICKA 4RWOA 4NLKA 8ICFA 4PHPA 4PGQA 4K4IA 4I2GA 4IQUA 5EOZA 3UPSA 3AQKA 3C2KA 8ICVA 9ICIA 4WC2A 3HJ4A 5HRHA 4RQ8A 5HRKA 5CJ7A 8ICWA 5J2IA 4I2DA 5J2FA 3C5FA 1ZJMA 4KLEA 5J2KA 3TFSA 4FO6A 4FHXA 4AT8A 4S3NA 4UB4A 1VFGA 3ISDA 9ICRA 4P4PA 9ICWA 2ZH4A 3H37A 3H38A 4NLNA 3MGIA 3AU6A 1ZQAA 1ZQMA 3C5GA 5BPCA 1ZQDA 2FMPA 4I2IA 9ICLA 9ICFA 3AQNA 5J0TA 1BPBA 7ICNA 2ZH1A 2DRAA 5HRDA 1Q79A 2DR9A 5DB9A 1UETA 5J2EA 4PHDA 2FMQA 3UQ2A 5DB7A 8ICMA 3WFQE 1ZQYA 1F5AA 5IIMA 4FHVA 4FHYA 1ZQBA 4KLQA 7ICQA 4DOBA 4X4TA 4YN4A 4WC4A 5TZVA 5J2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQW A;  4EBK A;  3LK9 A;  4PHA A;  4RT3 A;  2RFF A;  9ICM A;  4YD1 A;  4X4S A;  4O5C A;  3C66 A;  8ICP A;  3PML A;  3UPQ A;  9ICO A;  5IIL A;  1XSP A;  4NLZ A;  3OUY B;  3MBY A;  4PHE A;  4KLF A;  8ICT A;  4MF2 A;  1OU5 A;  4UD5 A;  4KLH A;  2M2U A;  5HC9 A;  3JPP A;  4KLJ A;  4IQV A;  3UXP A;  3V7K A;  5J2H A;  4UB2 A;  5CB1 A;  4MFF A;  9ICK A;  1ZQE A;  2I9G A;  2BCV A;  3AUO A;  1YLQ A;  4JWN A;  2M2V A;  4KLT A;  3RJE A;  1TFW A;  3RH4 A;  8ICH A;  1KNY A;  4LT6 A;  4RWQ A;  4XUS A;  4QZ9 A;  1KDH A;  3WFR E;  5D4B A;  4M04 A;  4KLG A;  7ICR A;  4M9N A;  4M9H A;  7ICL A;  2NRK A;  4Z6C A;  4Z6D A;  4M0A A;  5J0W A;  2FMS A;  3JYY A;  4I29 A;  4RQ1 A;  5HRG A;  7ICP A;  3HWT A;  4NM2 A;  2ZH8 A;  4XRH A;  4I27 A;  4QZB A;  1ZQJ A;  1BPE A;  5CR0 A;  1ZQS A;  3JPN A;  8ICC A;  4QZ8 A;  4LZG A;  7ICK A;  5DDM A;  5IIK A;  3UQ0 A;  1UEV A;  2DR7 A;  1TVA A;  4XQ8 A;  4AT9 B;  3OVS A;  5J0X A;  2Q66 A;  9ICQ A;  4LVS A;  4PGX A;  3C18 A;  3PMN A;  2ZH6 A;  3PNC A;  1R8B A;  8ICN A;  2ZH7 A;  3RJF A;  2ZH2 A;  4WC7 A;  4F5N A;  2PFQ A;  1ZQH A;  2P66 A;  1FA0 A;  4FH5 A;  4AT7 A;  5D46 A;  4RWN A;  4WCW A;  3TFR A;  1JN3 A;  9ICG A;  4I2H A;  4QZA A;  8ICB A;  7ICG A;  3JZ0 A;  4XA5 A;  9ICS A;  4YCX A;  5IIN A;  4R65 A;  4RQ0 A;  1BPY A;  1JQR A;  4YD2 A;  4GXJ A;  1NOM A;  3V7L A;  1ZQL A;  4F5O A;  9ICB A;  4JWM A;  5J0O A;  1TV9 A;  4I2E A;  4KLD A;  3OVB A;  5DKW A;  4M9J A;  4NKU A;  9ICX A;  3GDX A;  1XSN A;  3WFO A;  5HRF A;  1MIV A;  4QZI A;  8ICL A;  4UB5 A;  4UB3 A;  2ZHB A;  4M2Y A;  5D49 A;  4P4M A;  1ZQC A;  2BPF A;  4YMO A;  5IIJ A;  4TUP A;  3B0X A;  1TFY A;  3ISB A;  2ISO A;  4QZF A;  4PH5 A;  4ATB B;  2W9M A;  5J0P A;  1MIY A;  4QZG A;  3HIY A;  4KLO A;  3HX0 A;  4I2F A;  8ICI A;  8ICO A;  5J2G A;  5HHH A;  4MFA A;  5BOL A;  4PGY A;  4F5R A;  3C2M A;  4M47 A;  2HHP A;  5DBC A;  3HW8 A;  3UXO A;  4FHW A;  4DO9 A;  4P4O A;  4R66 A;  4X4R A;  8ICY A;  5CP2 A;  4R63 A;  5CHG A;  5HRE A;  9ICU A;  9ICC A;  4QZC A;  3JPQ A;  4RQ7 A;  7ICE A;  2BCR A;  3HJ1 A;  4AT8 B;  4PPX A;  1ZQO A;  3RH6 A;  2BCQ A;  9ICA A;  2GWS A;  2PFO A;  4IQT A;  5DDY A;  2O5A A;  1BPD A;  2DR8 A;  1VJ7 A;  8ICQ A;  4F5Q A;  4WC1 A;  4WBY A;  1WOT A;  3RJK A;  3C2L A;  1MQ2 A;  8ICR A;  4M9G A;  9ICH A;  1BPX A;  4UBB A;  4NKT A;  1ZQV A;  3LQC B;  4MF8 A;  1ZQP A;  7ICS A;  9ICV A;  1ZQK A;  4WC5 A;  4RQ4 A;  7ICM A;  8ICG A;  1JMS A;  3MDC A;  7ICF A;  3JPR A;  1MIW A;  4UAZ A;  5J2A A;  5J0Y A;  4R64 A;  3RJI A;  7ICH A;  2O1P A;  3OUY A;  1ZQN A;  5J0R A;  2M2T A;  4RPX A;  4X4Q A;  4TUQ A;  4EBJ A;  4E80 A;  3NYB A;  2BPC A;  4EP7 A;  4YMM A;  4I2C A;  3WFS C;  7ICV A;  5HRI A;  4E8F A;  1HUO A;  7ICI A;  4X5V A;  1R89 A;  5J2D A;  5HRL A;  4DOA A;  1NO5 A;  4I2B A;  1JAJ A;  4I2A A;  2ZH3 A;  3MGH A;  4NM1 A;  4Z6E A;  7ICT A;  4X4U A;  4E7X A;  4I28 A;  3OGU A;  5DB8 A;  4O5K A;  4KLU A;  4WC0 A;  4UBC A;  5F2V O;  8ICS A;  1PX5 A;  8ICA A;  4KLM A;  4FH3 A;  2BE3 A;  4QZE A;  5CWR A;  4X4P A;  8ICE A;  8ICX A;  9ICN A;  1ZQQ A;  1R8C A;  3AU2 A;  3RH5 A;  1UEU A;  1XSL A;  1ZJN A;  3UXN A;  1Q78 A;  4UB1 A;  3OVA A;  2M2W A;  2BPG A;  1ZQT A;  2PXI A;  5J0U A;  5HHI A;  5DB6 A;  5HRB A;  4UAY A;  8ICJ A;  4TUS A;  4IQW A;  4YMN A;  1ZQF A;  4DOC A;  5CA7 A;  1R8A A;  4UD4 A;  2DVI A;  2BCS A;  4GXI A;  4K4G A;  4NXZ A;  2PBE A;  7ICU A;  5DED A;  3JPT A;  5J0Q A;  3WFP A;  2ID1 A;  4RQ6 A;  5DBA A;  9ICJ A;  8ICZ A;  3L9D A;  4RQ3 A;  3OV7 A;  4KLI A;  2ZH5 A;  5J2B A;  3MDA A;  4KLL A;  7ICJ A;  7ICO A;  2ZH9 A;  2PFP A;  4AT9 A;  1ZQU A;  4O5E A;  4TUR A;  3JPS A;  3B0Y A;  4M5D A;  2DR5 A;  4O9M A;  1RPL A;  4X4N A;  1MQ3 A;  4WC6 A;  5J2C A;  4IG8 A;  4X4O A;  3JPO A;  4NY8 A;  3RJH A;  4UAW A;  3V7J A;  1V4A A;  4K4H A;  4QZH A;  5HR9 A;  2ISP A;  1HUZ A;  3H39 A;  4LZD A;  4RQ2 A;  1ZQX A;  1ZQZ A;  4RWP A;  3V72 A;  4AT7 B;  5J0S A;  1ZQR A;  3RJG A;  4P2H A;  5DBB A;  5III A;  4WBZ A;  4X0B A;  4M9L A;  1ZQG A;  4RT2 A;  3H3A A;  1ZQI A;  1BPZ A;  4FHP A;  2DRB A;  3RJJ A;  4I2J A;  3AQL A;  4RPY A;  4MFC A;  4Z6F A;  9ICP A;  2IHM A;  4KLS A;  8ICU A;  4RPZ A;  5DEC A;  4X4V A;  4F5P A;  4X0A A;  2ZHA A;  4QZD A;  2VAN A;  3K75 D;  5BOM A;  5IIO A;  9ICE A;  1RZT A;  9ICT A;  1KEJ A;  5J29 A;  4GXK A;  4WC3 A;  3ISC A;  2PFN A;  4RQ5 A;  4ATB A;  2BCU A;  4XQ7 A;  3AQM A;  8ICK A;  4RWO A;  4NLK A;  8ICF A;  4PHP A;  4PGQ A;  4K4I A;  4I2G A;  4IQU A;  5EOZ A;  3UPS A;  3AQK A;  3C2K A;  8ICV A;  9ICI A;  4WC2 A;  3HJ4 A;  5HRH A;  4RQ8 A;  5HRK A;  5CJ7 A;  8ICW A;  5J2I A;  4I2D A;  5J2F A;  3C5F A;  1ZJM A;  4KLE A;  5J2K A;  3TFS A;  4FO6 A;  4FHX A;  4AT8 A;  4S3N A;  4UB4 A;  1VFG A;  3ISD A;  9ICR A;  4P4P A;  9ICW A;  2ZH4 A;  3H37 A;  3H38 A;  4NLN A;  3MGI A;  3AU6 A;  1ZQA A;  1ZQM A;  3C5G A;  5BPC A;  1ZQD A;  2FMP A;  4I2I A;  9ICL A;  9ICF A;  3AQN A;  5J0T A;  1BPB A;  7ICN A;  2ZH1 A;  2DRA A;  5HRD A;  1Q79 A;  2DR9 A;  5DB9 A;  1UET A;  5J2E A;  4PHD A;  2FMQ A;  3UQ2 A;  5DB7 A;  8ICM A;  3WFQ E;  1ZQY A;  1F5A A;  5IIM A;  4FHV A;  4FHY A;  1ZQB A;  4KLQ A;  7ICQ A;  4DOB A;  4X4T A;  4YN4 A;  4WC4 A;  5TZV A;  5J2J A; 
#chains in the Genus database with same CATH topology
 1ZQW A;  4EBK A;  3LK9 A;  3CK6 A;  4PHA A;  4RT3 A;  2RFF A;  9ICM A;  4YD1 A;  4X4S A;  4O5C A;  2B56 A;  3C66 A;  4EEB A;  8ICP A;  3PML A;  4K98 A;  3UPQ A;  9ICO A;  3NWI A;  4JLZ A;  5IIL A;  3OUY B;  1XSP A;  4NLZ A;  3MBY A;  5B3Q A;  4PHE A;  4KLF A;  8ICT A;  4MF2 A;  1OU5 A;  4UD5 A;  4KLH A;  2M2U A;  5HC9 A;  3JPP A;  4KLJ A;  4IQV A;  3UXP A;  3V7K A;  5J2H A;  4UB2 A;  5CB1 A;  4MFF A;  9ICK A;  1ZQE A;  2I9G A;  2BCV A;  3AUO A;  1YLQ A;  4JWN A;  2M2V A;  4I0U A;  4KLT A;  3RJE A;  1TFW A;  3RH4 A;  8ICH A;  4OAH A;  1KNY A;  4LT6 A;  4RWQ A;  4XUS A;  4QZ9 A;  1KDH A;  3WFR E;  5D4B A;  4M04 A;  4KLG A;  7ICR A;  4M9N A;  4M9H A;  7ICL A;  2NRK A;  4Z6C A;  4M0A A;  5J0W A;  2FMS A;  5CFU A;  3JYY A;  4I29 A;  4RQ1 A;  5HRG A;  7ICP A;  3HWT A;  3NVO A;  4NM2 A;  2ZH8 A;  4XRH A;  4I27 A;  4QZB A;  1ZQJ A;  1BPE A;  5CR0 A;  1ZQS A;  3JPN A;  8ICC A;  4QZ8 A;  4LZG A;  4EED A;  4MKP A;  7ICK A;  5DDM A;  5IIK A;  3UQ0 A;  1UEV A;  2DR7 A;  4EGW A;  4K96 A;  1TVA A;  4XQ8 A;  4AT9 B;  3OVS A;  5J0X A;  5CFT A;  5B3P A;  2Q66 A;  9ICQ A;  4LVS A;  4PGX A;  3C18 A;  3PMN A;  2ZH6 A;  3PNC A;  5D63 A;  1R8B A;  8ICN A;  2ZH7 A;  3RJF A;  2ZH2 A;  4WC7 A;  4F5N A;  2PFQ A;  1ZQH A;  2P66 A;  1FA0 A;  4FH5 A;  4AT7 A;  5D46 A;  4RWN A;  4WCW A;  3TFR A;  1JN3 A;  9ICG A;  4I2H A;  4QZA A;  8ICB A;  7ICG A;  3JZ0 A;  4N7R A;  4XA5 A;  9ICS A;  4YCX A;  5IIN A;  4R65 A;  4RQ0 A;  1BPY A;  1JQR A;  4YD2 A;  4GXJ A;  1NOM A;  3V7L A;  1ZQL A;  4F5O A;  9ICB A;  4JWM A;  5J0O A;  1TV9 A;  4I2E A;  4KLD A;  3OVB A;  5DKW A;  4M9J A;  4NKU A;  9ICX A;  3GDX A;  1XSN A;  2IUB A;  3WFO A;  5HRF A;  1MIV A;  4QZI A;  2BBH A;  8ICL A;  4UB5 A;  4OAI Z;  4UB3 A;  2ZHB A;  4M2Y A;  5D49 A;  4P4M A;  1ZQC A;  2BBJ A;  3MCR A;  4YMO A;  2BPF A;  5IIJ A;  4TUP A;  2IHO A;  3B0X A;  1TFY A;  2HN2 A;  3ISB A;  2ISO A;  4QZF A;  4PH5 A;  4LEV A;  4ATB B;  4K9A A;  2W9M A;  5CFS A;  5J0P A;  1MIY A;  4QZG A;  3HIY A;  4KLO A;  3HX0 A;  4I2F A;  8ICI A;  8ICO A;  5J2G A;  5HHH A;  4MFA A;  5BOL A;  3NKU A;  4PGY A;  4F5R A;  3C2M A;  4M47 A;  2HHP A;  5DBC A;  3HW8 A;  4KM5 A;  3UXO A;  4FHW A;  4DO9 A;  4P4O A;  4R66 A;  4X4R A;  8ICY A;  5CP2 A;  4R63 A;  5CHG A;  4OAF A;  5HRE A;  9ICU A;  9ICC A;  4QZC A;  3JPQ A;  4RQ7 A;  7ICE A;  2BCR A;  3HJ1 A;  4AT8 B;  4PPX A;  4O69 A;  1ZQO A;  3RH6 A;  2BCQ A;  9ICA A;  2GWS A;  2PFO A;  4IQT A;  5DDY A;  2O5A A;  1BPD A;  2DR8 A;  1VJ7 A;  8ICQ A;  4F5Q A;  4NXV A;  4WC1 A;  4WBY A;  1WOT A;  3RJK A;  3C2L A;  1MQ2 A;  8ICR A;  4WQK A;  4M9G A;  9ICH A;  1BPX A;  4NXU A;  4XJE A;  4UBB A;  4NKT A;  1ZQV A;  4NXX A;  3LQC B;  2HN1 A;  4MF8 A;  1ZQP A;  7ICS A;  4KB6 A;  9ICV A;  1ZQK A;  4WC5 A;  4RQ4 A;  7ICM A;  8ICG A;  4FO1 A;  1JMS A;  3MDC A;  7ICF A;  3JPR A;  1MIW A;  4UAZ A;  5J2A A;  5J0Y A;  4R64 A;  3RJI A;  7ICH A;  2O1P A;  3OUY A;  1ZQN A;  5J0R A;  4HX0 A;  2M2T A;  4RPX A;  4X4Q A;  4TUQ A;  4EBJ A;  4E80 A;  3NYB A;  2BPC A;  4EP7 A;  4YMM A;  4I2C A;  3WFS C;  4O68 A;  7ICV A;  5HRI A;  5D61 A;  4E8F A;  4LEY A;  1HUO A;  7ICI A;  4X5V A;  1R89 A;  4X4T A;  5J2D A;  5HRL A;  4DOA A;  1NO5 A;  4I2B A;  1JAJ A;  4I2A A;  1GPJ A;  2ZH3 A;  3MGH A;  4NM1 A;  4Z6E A;  7ICT A;  4X4U A;  4E7X A;  4I28 A;  3OGU A;  5DB8 A;  4O5K A;  4KLU A;  4WC0 A;  4UBC A;  5F2V O;  8ICS A;  1PX5 A;  8ICA A;  4KLM A;  4FH3 A;  2BE3 A;  4QZE A;  5CWR A;  4X4P A;  8ICE A;  8ICX A;  9ICN A;  1ZQQ A;  1R8C A;  3AU2 A;  3RH5 A;  1UEU A;  1XSL A;  1ZJN A;  3ER8 C;  3UXN A;  1Q78 A;  4UB1 A;  3OVA A;  2M2W A;  2BPG A;  1ZQT A;  2PXI A;  5J0U A;  5HHI A;  4K97 A;  5DB6 A;  5HRB A;  4UAY A;  8ICJ A;  4TUS A;  4IQW A;  4YMN A;  3EF2 A;  1ZQF A;  4DOC A;  5CA7 A;  1R8A A;  4UD4 A;  2DVI A;  2BCS A;  4GXI A;  4K4G A;  4NXZ A;  2PBE A;  7ICU A;  5DED A;  3JPT A;  5J0Q A;  3WFP A;  2ID1 A;  4RQ6 A;  5DBA A;  9ICJ A;  8ICZ A;  3L9D A;  4RQ3 A;  3OV7 A;  4KLI A;  2ZH5 A;  5J2B A;  3MDA A;  4KLL A;  7ICJ A;  7ICO A;  2ZH9 A;  2PFP A;  4AT9 A;  1ZQU A;  4O5E A;  4TUR A;  3JPS A;  3B0Y A;  4M5D A;  2DR5 A;  4O9M A;  1RPL A;  4X4N A;  1MQ3 A;  4WC6 A;  5J2C A;  4IG8 A;  4X4O A;  3JPO A;  4NY8 A;  3RJH A;  4UAW A;  3V7J A;  4WH5 A;  1V4A A;  4K4H A;  4QZH A;  5HR9 A;  2ISP A;  5CHE A;  1HUZ A;  4EV6 A;  3H39 A;  2EWR A;  4LZD A;  4RQ2 A;  4NXT A;  1ZQX A;  1ZQZ A;  4RWP A;  3V72 A;  4AT7 B;  5J0S A;  1ZQR A;  5D62 A;  3RJG A;  4P2H A;  4O67 A;  5DBB A;  5III A;  4WBZ A;  4X0B A;  4M9L A;  1ZQG A;  4RT2 A;  3H3A A;  1ZQI A;  1BPZ A;  4FHP A;  2DRB A;  3RJJ A;  4I2J A;  3AQL A;  2B4V A;  4RPY A;  4MFC A;  4Z6F A;  9ICP A;  2IHM A;  4KLS A;  8ICU A;  4RPZ A;  5DEC A;  4X4V A;  4F5P A;  4X0A A;  2ZHA A;  4QZD A;  2VAN A;  3K75 D;  4LEZ A;  4NXW A;  5BOM A;  5IIO A;  9ICE A;  4WOY A;  1RZT A;  9ICT A;  1KEJ A;  5J29 A;  4GXK A;  4WC3 A;  3ISC A;  2PFN A;  4RQ5 A;  4ATB A;  3JCF A;  4OAG A;  4K9B A;  5JTG A;  2BCU A;  4XQ7 A;  4LEW A;  3AQM A;  8ICK A;  4RWO A;  4NLK A;  8ICF A;  4PHP A;  4PGQ A;  4K4I A;  4JLX A;  4I2G A;  3OWG A;  4IQU A;  5EOZ A;  3UPS A;  3AQK A;  3C2K A;  8ICV A;  9ICI A;  3ERC C;  4WC2 A;  3HJ4 A;  5HRH A;  4RQ8 A;  5HRK A;  5CJ7 A;  8ICW A;  2GA9 D;  5J2I A;  4I2D A;  5J2F A;  3C5F A;  3PHZ A;  1ZJM A;  4KLE A;  5J2K A;  3TFS A;  2B51 A;  4FO6 A;  4FHX A;  4AT8 A;  4S3N A;  4UB4 A;  1VFG A;  3ISD A;  3ER9 B;  9ICR A;  4P4P A;  9ICW A;  2ZH4 A;  3H37 A;  3H38 A;  4NLN A;  3MGI A;  3AU6 A;  1ZQA A;  3K7D A;  1ZQM A;  3C5G A;  5BPC A;  1ZQD A;  2GAF D;  2FMP A;  4I2I A;  9ICL A;  9ICF A;  3AQN A;  5J0T A;  1BPB A;  4WQL A;  7ICN A;  2ZH1 A;  2DRA A;  5HRD A;  4K99 A;  1Q79 A;  2DR9 A;  5DB9 A;  1UET A;  5J2E A;  4K8V A;  4PHD A;  2FMQ A;  3UQ2 A;  5DB7 A;  8ICM A;  3WFQ E;  1ZQY A;  1F5A A;  5IIM A;  4FHV A;  4FHY A;  1ZQB A;  4KLQ A;  4O6A A;  2FCL A;  7ICQ A;  4DOB A;  4Z6D A;  4YN4 A;  4WC4 A;  5TZV A;  5J2J A; 
#chains in the Genus database with same CATH homology
 1ZQW A;  4EBK A;  3LK9 A;  4PHA A;  4RT3 A;  2RFF A;  9ICM A;  4YD1 A;  4X4S A;  4O5C A;  3C66 A;  8ICP A;  3PML A;  3UPQ A;  9ICO A;  5IIL A;  1XSP A;  4NLZ A;  3OUY B;  3MBY A;  4PHE A;  4KLF A;  8ICT A;  4MF2 A;  1OU5 A;  4UD5 A;  4KLH A;  2M2U A;  5HC9 A;  3JPP A;  4KLJ A;  4IQV A;  3UXP A;  3V7K A;  5J2H A;  4UB2 A;  5CB1 A;  4MFF A;  9ICK A;  1ZQE A;  2I9G A;  2BCV A;  3AUO A;  1YLQ A;  4JWN A;  2M2V A;  4KLT A;  3RJE A;  1TFW A;  3RH4 A;  8ICH A;  1KNY A;  4LT6 A;  4RWQ A;  4XUS A;  4QZ9 A;  1KDH A;  3WFR E;  5D4B A;  4M04 A;  4KLG A;  7ICR A;  4M9N A;  4M9H A;  7ICL A;  2NRK A;  4Z6C A;  4Z6D A;  4M0A A;  5J0W A;  2FMS A;  3JYY A;  4I29 A;  4RQ1 A;  5HRG A;  7ICP A;  3HWT A;  4NM2 A;  2ZH8 A;  4XRH A;  4I27 A;  4QZB A;  1ZQJ A;  1BPE A;  5CR0 A;  1ZQS A;  3JPN A;  8ICC A;  4QZ8 A;  4LZG A;  7ICK A;  5DDM A;  5IIK A;  3UQ0 A;  1UEV A;  2DR7 A;  1TVA A;  4XQ8 A;  4AT9 B;  3OVS A;  5J0X A;  2Q66 A;  9ICQ A;  4LVS A;  4PGX A;  3C18 A;  3PMN A;  2ZH6 A;  3PNC A;  1R8B A;  8ICN A;  2ZH7 A;  3RJF A;  2ZH2 A;  4WC7 A;  4F5N A;  2PFQ A;  1ZQH A;  2P66 A;  1FA0 A;  4FH5 A;  4AT7 A;  5D46 A;  4RWN A;  4WCW A;  3TFR A;  1JN3 A;  9ICG A;  4I2H A;  4QZA A;  8ICB A;  7ICG A;  3JZ0 A;  4XA5 A;  9ICS A;  4YCX A;  5IIN A;  4R65 A;  4RQ0 A;  1BPY A;  1JQR A;  4YD2 A;  4GXJ A;  1NOM A;  3V7L A;  1ZQL A;  4F5O A;  9ICB A;  4JWM A;  5J0O A;  1TV9 A;  4I2E A;  4KLD A;  3OVB A;  5DKW A;  4M9J A;  4NKU A;  9ICX A;  3GDX A;  1XSN A;  3WFO A;  5HRF A;  1MIV A;  4QZI A;  8ICL A;  4UB5 A;  4UB3 A;  2ZHB A;  4M2Y A;  5D49 A;  4P4M A;  1ZQC A;  2BPF A;  4YMO A;  5IIJ A;  4TUP A;  3B0X A;  1TFY A;  3ISB A;  2ISO A;  4QZF A;  4PH5 A;  4ATB B;  2W9M A;  5J0P A;  1MIY A;  4QZG A;  3HIY A;  4KLO A;  3HX0 A;  4I2F A;  8ICI A;  8ICO A;  5J2G A;  5HHH A;  4MFA A;  5BOL A;  4PGY A;  4F5R A;  3C2M A;  4M47 A;  2HHP A;  5DBC A;  3HW8 A;  3UXO A;  4FHW A;  4DO9 A;  4P4O A;  4R66 A;  4X4R A;  8ICY A;  5CP2 A;  4R63 A;  5CHG A;  5HRE A;  9ICU A;  9ICC A;  4QZC A;  3JPQ A;  4RQ7 A;  7ICE A;  2BCR A;  3HJ1 A;  4AT8 B;  4PPX A;  1ZQO A;  3RH6 A;  2BCQ A;  9ICA A;  2GWS A;  2PFO A;  4IQT A;  5DDY A;  2O5A A;  1BPD A;  2DR8 A;  1VJ7 A;  8ICQ A;  4F5Q A;  4WC1 A;  4WBY A;  1WOT A;  3RJK A;  3C2L A;  1MQ2 A;  8ICR A;  4M9G A;  9ICH A;  1BPX A;  4UBB A;  4NKT A;  1ZQV A;  3LQC B;  4MF8 A;  1ZQP A;  7ICS A;  9ICV A;  1ZQK A;  4WC5 A;  4RQ4 A;  7ICM A;  8ICG A;  1JMS A;  3MDC A;  7ICF A;  3JPR A;  1MIW A;  4UAZ A;  5J2A A;  5J0Y A;  4R64 A;  3RJI A;  7ICH A;  2O1P A;  3OUY A;  1ZQN A;  5J0R A;  2M2T A;  4RPX A;  4X4Q A;  4TUQ A;  4EBJ A;  4E80 A;  3NYB A;  2BPC A;  4EP7 A;  4YMM A;  4I2C A;  3WFS C;  7ICV A;  5HRI A;  4E8F A;  1HUO A;  7ICI A;  4X5V A;  1R89 A;  5J2D A;  5HRL A;  4DOA A;  1NO5 A;  4I2B A;  1JAJ A;  4I2A A;  2ZH3 A;  3MGH A;  4NM1 A;  4Z6E A;  7ICT A;  4X4U A;  4E7X A;  4I28 A;  3OGU A;  5DB8 A;  4O5K A;  4KLU A;  4WC0 A;  4UBC A;  5F2V O;  8ICS A;  1PX5 A;  8ICA A;  4KLM A;  4FH3 A;  2BE3 A;  4QZE A;  5CWR A;  4X4P A;  8ICE A;  8ICX A;  9ICN A;  1ZQQ A;  1R8C A;  3AU2 A;  3RH5 A;  1UEU A;  1XSL A;  1ZJN A;  3UXN A;  1Q78 A;  4UB1 A;  3OVA A;  2M2W A;  2BPG A;  1ZQT A;  2PXI A;  5J0U A;  5HHI A;  5DB6 A;  5HRB A;  4UAY A;  8ICJ A;  4TUS A;  4IQW A;  4YMN A;  1ZQF A;  4DOC A;  5CA7 A;  1R8A A;  4UD4 A;  2DVI A;  2BCS A;  4GXI A;  4K4G A;  4NXZ A;  2PBE A;  7ICU A;  5DED A;  3JPT A;  5J0Q A;  3WFP A;  2ID1 A;  4RQ6 A;  5DBA A;  9ICJ A;  8ICZ A;  3L9D A;  4RQ3 A;  3OV7 A;  4KLI A;  2ZH5 A;  5J2B A;  3MDA A;  4KLL A;  7ICJ A;  7ICO A;  2ZH9 A;  2PFP A;  4AT9 A;  1ZQU A;  4O5E A;  4TUR A;  3JPS A;  3B0Y A;  4M5D A;  2DR5 A;  4O9M A;  1RPL A;  4X4N A;  1MQ3 A;  4WC6 A;  5J2C A;  4IG8 A;  4X4O A;  3JPO A;  4NY8 A;  3RJH A;  4UAW A;  3V7J A;  1V4A A;  4K4H A;  4QZH A;  5HR9 A;  2ISP A;  1HUZ A;  3H39 A;  4LZD A;  4RQ2 A;  1ZQX A;  1ZQZ A;  4RWP A;  3V72 A;  4AT7 B;  5J0S A;  1ZQR A;  3RJG A;  4P2H A;  5DBB A;  5III A;  4WBZ A;  4X0B A;  4M9L A;  1ZQG A;  4RT2 A;  3H3A A;  1ZQI A;  1BPZ A;  4FHP A;  2DRB A;  3RJJ A;  4I2J A;  3AQL A;  4RPY A;  4MFC A;  4Z6F A;  9ICP A;  2IHM A;  4KLS A;  8ICU A;  4RPZ A;  5DEC A;  4X4V A;  4F5P A;  4X0A A;  2ZHA A;  4QZD A;  2VAN A;  3K75 D;  5BOM A;  5IIO A;  9ICE A;  1RZT A;  9ICT A;  1KEJ A;  5J29 A;  4GXK A;  4WC3 A;  3ISC A;  2PFN A;  4RQ5 A;  4ATB A;  2BCU A;  4XQ7 A;  3AQM A;  8ICK A;  4RWO A;  4NLK A;  8ICF A;  4PHP A;  4PGQ A;  4K4I A;  4I2G A;  4IQU A;  5EOZ A;  3UPS A;  3AQK A;  3C2K A;  8ICV A;  9ICI A;  4WC2 A;  3HJ4 A;  5HRH A;  4RQ8 A;  5HRK A;  5CJ7 A;  8ICW A;  5J2I A;  4I2D A;  5J2F A;  3C5F A;  1ZJM A;  4KLE A;  5J2K A;  3TFS A;  4FO6 A;  4FHX A;  4AT8 A;  4S3N A;  4UB4 A;  1VFG A;  3ISD A;  9ICR A;  4P4P A;  9ICW A;  2ZH4 A;  3H37 A;  3H38 A;  4NLN A;  3MGI A;  3AU6 A;  1ZQA A;  1ZQM A;  3C5G A;  5BPC A;  1ZQD A;  2FMP A;  4I2I A;  9ICL A;  9ICF A;  3AQN A;  5J0T A;  1BPB A;  7ICN A;  2ZH1 A;  2DRA A;  5HRD A;  1Q79 A;  2DR9 A;  5DB9 A;  1UET A;  5J2E A;  4PHD A;  2FMQ A;  3UQ2 A;  5DB7 A;  8ICM A;  3WFQ E;  1ZQY A;  1F5A A;  5IIM A;  4FHV A;  4FHY A;  1ZQB A;  4KLQ A;  7ICQ A;  4DOB A;  4X4T A;  4YN4 A;  4WC4 A;  5TZV A;  5J2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...