5HRLA

The crystal structure of asfvpolx: 1nt-gap(p) dna2: dgtp ternary complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
GMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
total genus 46
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrlA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrlA01
7ICGA 5J29A 1R89A 2ZH5A 4KLIA 4NKUA 5J0PA 1ZQVA 2ZH1A 3V72A 3RJFA 3OV7A 7ICIA 8ICAA 1ZJNA 4NXZA 1MQ2A 2NRKA 4RQ0A 8ICSA 9ICUA 4UAYA 1ZQDA 1ZQTA 4UD5A 1ZQYA 4Z6CA 1ZQXA 4I28A 1ZQAA 4WC6A 1ZQMA 3JPOA 4TUSA 1PX5A 1ZQKA 4AT8B 8ICMA 5HR9A 8ICIA 2ID1A 1ZQPA 2ZH7A 2DRBA 5J2DA 3GDXA 2RFFA 1ZQSA 4KLOA 3MDCA 3OUYA 4AT8A 4UB1A 5DKWA 1ZQBA 8ICGA 4RPXA 2BCRA 4R64A 8ICYA 2PBEA 4IQVA 5IIOA 4QZAA 3AQLA 2I9GA 4FH3A 4UB3A 4KLDA 4DO9A 3RJIA 4RPZA 4KLEA 1RPLA 3UXNA 5HRGA 3AU6A 4NKTA 2PFNA 4M47A 4YD2A 5J0SA 4WC3A 3WFQE 4QZEA 5J0RA 3AQKA 8ICFA 4R66A 9ICGA 4X0AA 4M9JA 1RZTA 9ICTA 5DDYA 2DR9A 3NYBA 4R63A 8ICNA 4GXKA 4MF2A 3K75D 9ICWA 3UPSA 2BPGA 9ICSA 5J0YA 9ICCA 4O5KA 1TV9A 4YCXA 2FMQA 3JZ0A 4DOAA 5HHHA 2GWSA 4S3NA 4XUSA 1WOTA 4WC1A 2W9MA 5HRIA 9ICRA 5TZVA 2VANA 5CR0A 4M9GA 2HHPA 5IIJA 4QZIA 4X4PA 5J2BA 8ICWA 5BOLA 2ZHBA 4RQ5A 4O5EA 4K4GA 1Q79A 1TFYA 4P4PA 3UXOA 3TFSA 3V7LA 2ZH8A 4WBYA 9ICMA 4I2AA 2FMPA 5HRKA 7ICOA 1ZQLA 3JPQA 1MQ3A 2ZH2A 4O9MA 5J0UA 4QZBA 1Q78A 3RJEA 2ZHAA 4UAZA 4UAWA 4PHEA 2BCUA 3UPQA 9ICIA 1ZQJA 4FHXA 2ZH9A 4RQ1A 8ICVA 2Q66A 1OU5A 4QZGA 4MF8A 5HRLA 2DR5A 4IQTA 8ICRA 3OGUA 4I2EA 4O5CA 3HIYA 5HRBA 4M9HA 3JPSA 5BOMA 2BPCA 3JYYA 9ICOA 8ICBA 4PGXA 4JWMA 5J0WA 4DOCA 4NY8A 9ICJA 3UQ2A 4KLSA 4MFAA 2BPFA 2DVIA 3MDAA 4UB4A 3OUYB 4F5PA 4IQWA 3MGIA 4PGQA 2M2WA 8ICHA 5J2KA 4M9NA 4IQUA 7ICEA 3HX0A 4M9LA 4RWQA 4YD1A 2M2UA 4QZ8A 5DB8A 2PFQA 5J0TA 2IHMA 4AT7B 4KLHA 3RH4A 4X4UA 2M2TA 4YMOA 1R8CA 4AT9B 5CHGA 2FMSA 4I2IA 2DR8A 5F2VO 4I29A 9ICKA 5HC9A 4AT7A 8ICPA 4I27A 4AT9A 4F5RA 3OVAA 5DEDA 3WFRE 4X4SA 8ICTA 1ZQOA 8ICEA 2BCVA 4RQ2A 3MGHA 4M0AA 4I2GA 4YMMA 4KLFA 4M2YA 4PH5A 5HHIA 4RQ3A 5IIKA 1ZQEA 3RJHA 1ZQHA 5CP2A 4I2JA 1NOMA 5IIMA 9ICNA 3C2LA 3PMNA 1BPEA 3H3AA 7ICSA 1UEVA 3JPPA 9ICBA 4E80A 4RPYA 5D4BA 4RWNA 4WC7A 2M2VA 4Z6FA 4F5NA 7ICNA 4KLJA 4ATBB 5IINA 3RJKA 3LQCB 5J2JA 4NLKA 5J2FA 4TUPA 1BPXA 4XQ7A 7ICRA 3B0XA 4FH5A 1ZQWA 4ATBA 5DB7A 5CB1A 4KLQA 2ISOA 4KLLA 8ICQA 4P4OA 4I2CA 4KLUA 2DRAA 3WFOA 3RH5A 4X0BA 3LK9A 5EOZA 5DB9A 5HRDA 7ICJA 4E7XA 5HRFA 3UQ0A 1JMSA 2O5AA 4XQ8A 4K4IA 5CWRA 4R65A 3PNCA 3AQNA 4FHVA 7ICKA 4WC0A 8ICZA 4I2FA 3OVSA 3AU2A 4RQ6A 1ZQRA 4TURA 1JN3A 1HUZA 1XSNA 1V4AA 8ICJA 3UXPA 3L9DA 4WCWA 7ICMA 3V7JA 5HRHA 3WFPA 1ZQFA 3RH6A 2PFOA 4LZGA 4KLGA 1UETA 3MBYA 3TFRA 1HUOA 4WC2A 1ZQUA 3C66A 4EP7A 1ZQQA 4X4RA 1MIYA 1ZQZA 1VFGA 1FA0A 1ZQIA 2ZH3A 4NLNA 9ICXA 1VJ7A 4RQ7A 4QZCA 4EBJA 4FHYA 5DBBA 8ICKA 4NM1A 5IILA 3RJJA 4X4OA 4PGYA 5CJ7A 4QZ9A 5J0XA 7ICQA 3WFSC 4PHDA 9ICEA 1KEJA 2ZH4A 4I2BA 4UB2A 8ICUA 8ICCA 3B0YA 5J2AA 4XA5A 4X4VA 2P66A 4RT3A 4GXJA 4M5DA 4X5VA 5DECA 5J0QA 4YN4A 1KNYA 1KDHA 5DBAA 7ICLA 4LVSA 4Z6EA 1MIWA 1ZQGA 9ICHA 1TVAA 4RT2A 4LT6A 4RWPA 1R8AA 4RWOA 5J2HA 2ZH6A 3C2KA 5CA7A 1BPZA 2ISPA 3AUOA 3V7KA 4LZDA 3C2MA 4E8FA 8ICLA 4FHPA 4WC5A 2PXIA 4F5OA 4X4QA 5D46A 3AQMA 1MIVA 4Z6DA 4WC4A 1NO5A 1R8BA 4WBZA 2BE3A 3HW8A 4MFCA 3JPTA 7ICPA 1ZJMA 9ICLA 5J2EA 4RQ4A 1UEUA 3C18A 9ICAA 4FO6A 4PHAA 3C5FA 4F5QA 5DBCA 1JAJA 4KLTA 3JPNA 3ISBA 4TUQA 4NM2A 7ICUA 4MFFA 3RJGA 4PHPA 5J2CA 1JQRA 1YLQA 7ICFA 4PPXA 8ICXA 2BCSA 3ISCA 5D49A 4UBCA 9ICQA 4QZHA 4YMNA 9ICFA 4K4HA 5J2GA 4UD4A 2O1PA 4P4MA 1ZQCA 1BPYA 4GXIA 4X4NA 4UB5A 1ZQNA 4RQ8A 7ICHA 4NLZA 3C5GA 4M04A 3H39A 4QZFA 2DR7A 4IG8A 5BPCA 4XRHA 4I2HA 4UBBA 4I2DA 3ISDA 4EBKA 1BPDA 8ICOA 2PFPA 5IIIA 1XSPA 9ICVA 3HJ1A 5HREA 3HWTA 4P2HA 1TFWA 3H37A 3JPRA 1XSLA 5J2IA 4QZDA 7ICTA 5DDMA 2BCQA 3H38A 5J0OA 3HJ4A 3PMLA 4FHWA 7ICVA 1F5AA 4KLMA 4X4TA 3OVBA 4DOBA 9ICPA 5DB6A 1BPBA 4JWNA
chains in the Genus database with same CATH superfamily
7ICGA 2FCLA 5J29A 2GA9D 1R89A 2ZH5A 4KLIA 4NKUA 4NXWA 5J0PA 4NXXA 1ZQVA 2ZH1A 3V72A 3RJFA 4EV6A 3OV7A 7ICIA 8ICAA 1ZJNA 4NXZA 1MQ2A 2NRKA 4JLZA 4RQ0A 8ICSA 9ICUA 4UAYA 1ZQDA 1ZQTA 4LEZA 4UD5A 1ZQYA 3EF2A 4Z6CA 4OAHA 1ZQXA 4I28A 1ZQAA 4WC6A 1ZQMA 3JPOA 4TUSA 1PX5A 4O6AA 1ZQKA 4OAGA 4WH5A 4AT8B 8ICMA 5HR9A 8ICIA 2ID1A 1ZQPA 2ZH7A 2DRBA 5J2DA 3GDXA 2RFFA 1ZQSA 4KLOA 3MDCA 3OUYA 4N7RA 4AT8A 4UB1A 5DKWA 1ZQBA 8ICGA 4RPXA 2BCRA 4R64A 8ICYA 2PBEA 4IQVA 5IIOA 4QZAA 3AQLA 2I9GA 4FH3A 4UB3A 4KLDA 4DO9A 3CK6A 3RJIA 4RPZA 5D62A 4KLEA 1RPLA 3UXNA 5HRGA 3AU6A 4NKTA 2PFNA 4M47A 4YD2A 5J0SA 4WC3A 3WFQE 4QZEA 5J0RA 3AQKA 8ICFA 4WQKA 4R66A 9ICGA 4X0AA 4M9JA 1RZTA 9ICTA 5DDYA 2DR9A 3NYBA 4R63A 8ICNA 4K9AA 4GXKA 2BBHA 4MF2A 3K75D 9ICWA 3UPSA 4JLXA 2BBJA 2BPGA 9ICSA 5J0YA 9ICCA 4O5KA 1TV9A 4YCXA 2FMQA 3JZ0A 4DOAA 5HHHA 2GWSA 4S3NA 4XUSA 1WOTA 4WC1A 2W9MA 5HRIA 9ICRA 5TZVA 2VANA 5CR0A 4M9GA 2GAFD 2HHPA 5IIJA 4QZIA 4X4PA 5J2BA 8ICWA 5BOLA 2ZHBA 4RQ5A 4O68A 4O5EA 4K4GA 1Q79A 1TFYA 4P4PA 3UXOA 5JTGA 4EEDA 3TFSA 3V7LA 2ZH8A 4WBYA 9ICMA 4I2AA 2FMPA 5HRKA 7ICOA 1ZQLA 3JPQA 1MQ3A 2ZH2A 4O9MA 5J0UA 4QZBA 1Q78A 3RJEA 2ZHAA 4UAZA 4UAWA 4PHEA 2BCUA 3UPQA 9ICIA 1ZQJA 4FHXA 2ZH9A 4RQ1A 8ICVA 2Q66A 1OU5A 4QZGA 4MF8A 4HX0A 5HRLA 2DR5A 4IQTA 8ICRA 3OGUA 3NVOA 5CFUA 4K8VA 4I2EA 4O5CA 2B51A 3HIYA 5HRBA 4M9HA 3JPSA 5BOMA 2BPCA 3JYYA 5B3PA 9ICOA 4K97A 4NXUA 4O69A 8ICBA 4PGXA 4JWMA 5J0WA 4DOCA 4NY8A 9ICJA 3UQ2A 4KLSA 4MFAA 2BPFA 2DVIA 3MDAA 2IHOA 4UB4A 3OUYB 4F5PA 4IQWA 3MGIA 4PGQA 2M2WA 8ICHA 5J2KA 4M9NA 4IQUA 7ICEA 3HX0A 4WQLA 4M9LA 4RWQA 4YD1A 2M2UA 4QZ8A 5DB8A 3K7DA 2PFQA 5J0TA 5CHEA 2IHMA 4AT7B 4KLHA 3RH4A 4X4UA 2M2TA 4YMOA 1R8CA 4AT9B 5CHGA 2FMSA 4I2IA 2DR8A 5F2VO 4I29A 9ICKA 5HC9A 4AT7A 8ICPA 4I27A 4K96A 4AT9A 4F5RA 3OVAA 5DEDA 3WFRE 4X4SA 8ICTA 4OAIZ 2B4VA 1ZQOA 8ICEA 2BCVA 4RQ2A 3MGHA 4M0AA 4I2GA 4YMMA 4KLFA 4M2YA 4PH5A 5HHIA 4RQ3A 5IIKA 1ZQEA 3RJHA 1ZQHA 5CP2A 4LEYA 4I2JA 1NOMA 5IIMA 9ICNA 3C2LA 3PMNA 1BPEA 3H3AA 7ICSA 1UEVA 3NWIA 3JPPA 9ICBA 4E80A 4RPYA 5D4BA 4RWNA 4WC7A 2M2VA 4NXTA 4Z6FA 4F5NA 7ICNA 4KLJA 4ATBB 5IINA 3RJKA 3LQCB 5J2JA 4NLKA 5J2FA 4TUPA 1BPXA 4XQ7A 7ICRA 3B0XA 4FH5A 1ZQWA 4ATBA 5DB7A 5CFTA 5CB1A 4KLQA 2ISOA 4KLLA 8ICQA 4P4OA 4I2CA 4KLUA 4KB6A 2DRAA 3WFOA 3RH5A 4X0BA 3LK9A 5EOZA 5DB9A 5HRDA 7ICJA 5CFSA 4E7XA 5HRFA 3UQ0A 5D61A 1JMSA 2O5AA 4XQ8A 4K4IA 5CWRA 4R65A 3PNCA 3AQNA 4FHVA 7ICKA 4WC0A 8ICZA 3JCFA 4I2FA 3OVSA 3AU2A 4RQ6A 4MKPA 1ZQRA 4TURA 1JN3A 1HUZA 1XSNA 1V4AA 8ICJA 4O67A 4EEBA 3UXPA 3L9DA 4WCWA 7ICMA 3V7JA 4OAFA 5HRHA 1GPJA 3ERCC 3WFPA 1ZQFA 3RH6A 2PFOA 4LZGA 4KLGA 1UETA 3MBYA 3TFRA 1HUOA 3OWGA 4WC2A 1ZQUA 3C66A 4EP7A 1ZQQA 4X4RA 1MIYA 1ZQZA 1VFGA 1FA0A 1ZQIA 2ZH3A 4NLNA 9ICXA 1VJ7A 4RQ7A 4QZCA 4EBJA 3ER9B 4FHYA 5DBBA 8ICKA 5D63A 4NM1A 5IILA 3RJJA 4X4OA 4PGYA 5CJ7A 4QZ9A 5J0XA 7ICQA 3WFSC 4PHDA 9ICEA 4K9BA 1KEJA 2ZH4A 4I2BA 4UB2A 8ICUA 8ICCA 3B0YA 5J2AA 4K99A 4XA5A 4X4VA 2P66A 4RT3A 4GXJA 4M5DA 4X5VA 5DECA 5J0QA 2HN2A 4NXVA 4YN4A 1KNYA 1KDHA 5DBAA 7ICLA 4LVSA 4Z6EA 1MIWA 1ZQGA 9ICHA 1TVAA 4RT2A 4LT6A 4RWPA 1R8AA 4RWOA 5J2HA 2ZH6A 3C2KA 5CA7A 4K98A 1BPZA 2ISPA 3AUOA 3V7KA 4LZDA 3C2MA 4E8FA 3MCRA 4I0UA 8ICLA 4FHPA 4WC5A 2PXIA 4F5OA 4X4QA 5D46A 3AQMA 1MIVA 4Z6DA 4WC4A 1NO5A 1R8BA 4WBZA 2IUBA 2BE3A 3HW8A 4MFCA 3JPTA 7ICPA 3PHZA 1ZJMA 9ICLA 5J2EA 4RQ4A 2EWRA 1UEUA 3C18A 9ICAA 4FO6A 4PHAA 3C5FA 4F5QA 5DBCA 1JAJA 4XJEA 4KLTA 3JPNA 3ISBA 4TUQA 4NM2A 7ICUA 4MFFA 3RJGA 4PHPA 5J2CA 1JQRA 1YLQA 7ICFA 4PPXA 8ICXA 2BCSA 3ISCA 5D49A 4UBCA 9ICQA 4QZHA 4YMNA 9ICFA 4K4HA 5J2GA 4UD4A 2O1PA 4P4MA 1ZQCA 1BPYA 4GXIA 3ER8C 4X4NA 4UB5A 1ZQNA 4RQ8A 7ICHA 2B56A 4NLZA 3C5GA 4M04A 3H39A 4QZFA 2DR7A 4IG8A 5BPCA 4EGWA 4XRHA 4I2HA 4UBBA 2HN1A 4I2DA 3ISDA 4EBKA 1BPDA 8ICOA 4FO1A 2PFPA 5IIIA 4LEVA 1XSPA 9ICVA 3HJ1A 5HREA 4LEWA 3HWTA 4P2HA 1TFWA 5B3QA 3H37A 3JPRA 1XSLA 5J2IA 4QZDA 7ICTA 5DDMA 2BCQA 3H38A 5J0OA 3HJ4A 3PMLA 4FHWA 7ICVA 1F5AA 4KLMA 4X4TA 3OVBA 4DOBA 9ICPA 4KM5A 5DB6A 1BPBA 4WOYA 4JWNA 3NKUA
chains in the Genus database with same CATH topology
7ICGA 5J29A 1R89A 2ZH5A 4KLIA 4NKUA 5J0PA 1ZQVA 2ZH1A 3V72A 3RJFA 3OV7A 7ICIA 8ICAA 1ZJNA 4NXZA 1MQ2A 2NRKA 4RQ0A 8ICSA 9ICUA 4UAYA 1ZQDA 1ZQTA 4UD5A 1ZQYA 4Z6CA 1ZQXA 4I28A 1ZQAA 4WC6A 1ZQMA 3JPOA 4TUSA 1PX5A 1ZQKA 4AT8B 8ICMA 5HR9A 8ICIA 2ID1A 1ZQPA 2ZH7A 2DRBA 5J2DA 3GDXA 2RFFA 1ZQSA 4KLOA 3MDCA 3OUYA 4AT8A 4UB1A 5DKWA 1ZQBA 8ICGA 4RPXA 2BCRA 4R64A 8ICYA 2PBEA 4IQVA 5IIOA 4QZAA 3AQLA 2I9GA 4FH3A 4UB3A 4KLDA 4DO9A 3RJIA 4RPZA 4KLEA 1RPLA 3UXNA 5HRGA 3AU6A 4NKTA 2PFNA 4M47A 4YD2A 5J0SA 4WC3A 3WFQE 4QZEA 5J0RA 3AQKA 8ICFA 4R66A 9ICGA 4X0AA 4M9JA 1RZTA 9ICTA 5DDYA 2DR9A 3NYBA 4R63A 8ICNA 4GXKA 4MF2A 3K75D 9ICWA 3UPSA 2BPGA 9ICSA 5J0YA 9ICCA 4O5KA 1TV9A 4YCXA 2FMQA 3JZ0A 4DOAA 5HHHA 2GWSA 4S3NA 4XUSA 1WOTA 4WC1A 2W9MA 5HRIA 9ICRA 5TZVA 2VANA 5CR0A 4M9GA 2HHPA 5IIJA 4QZIA 4X4PA 5J2BA 8ICWA 5BOLA 2ZHBA 4RQ5A 4O5EA 4K4GA 1Q79A 1TFYA 4P4PA 3UXOA 3TFSA 3V7LA 2ZH8A 4WBYA 9ICMA 4I2AA 2FMPA 5HRKA 7ICOA 1ZQLA 3JPQA 1MQ3A 2ZH2A 4O9MA 5J0UA 4QZBA 1Q78A 3RJEA 2ZHAA 4UAZA 4UAWA 4PHEA 2BCUA 3UPQA 9ICIA 1ZQJA 4FHXA 2ZH9A 4RQ1A 8ICVA 2Q66A 1OU5A 4QZGA 4MF8A 5HRLA 2DR5A 4IQTA 8ICRA 3OGUA 4I2EA 4O5CA 3HIYA 5HRBA 4M9HA 3JPSA 5BOMA 2BPCA 3JYYA 9ICOA 8ICBA 4PGXA 4JWMA 5J0WA 4DOCA 4NY8A 9ICJA 3UQ2A 4KLSA 4MFAA 2BPFA 2DVIA 3MDAA 4UB4A 3OUYB 4F5PA 4IQWA 3MGIA 4PGQA 2M2WA 8ICHA 5J2KA 4M9NA 4IQUA 7ICEA 3HX0A 4M9LA 4RWQA 4YD1A 2M2UA 4QZ8A 5DB8A 2PFQA 5J0TA 2IHMA 4AT7B 4KLHA 3RH4A 4X4UA 2M2TA 4YMOA 1R8CA 4AT9B 5CHGA 2FMSA 4I2IA 2DR8A 5F2VO 4I29A 9ICKA 5HC9A 4AT7A 8ICPA 4I27A 4AT9A 4F5RA 3OVAA 5DEDA 3WFRE 4X4SA 8ICTA 1ZQOA 8ICEA 2BCVA 4RQ2A 3MGHA 4M0AA 4I2GA 4YMMA 4KLFA 4M2YA 4PH5A 5HHIA 4RQ3A 5IIKA 1ZQEA 3RJHA 1ZQHA 5CP2A 4I2JA 1NOMA 5IIMA 9ICNA 3C2LA 3PMNA 1BPEA 3H3AA 7ICSA 1UEVA 3JPPA 9ICBA 4E80A 4RPYA 5D4BA 4RWNA 4WC7A 2M2VA 4Z6FA 4F5NA 7ICNA 4KLJA 4ATBB 5IINA 3RJKA 3LQCB 5J2JA 4NLKA 5J2FA 4TUPA 1BPXA 4XQ7A 7ICRA 3B0XA 4FH5A 1ZQWA 4ATBA 5DB7A 5CB1A 4KLQA 2ISOA 4KLLA 8ICQA 4P4OA 4I2CA 4KLUA 2DRAA 3WFOA 3RH5A 4X0BA 3LK9A 5EOZA 5DB9A 5HRDA 7ICJA 4E7XA 5HRFA 3UQ0A 1JMSA 2O5AA 4XQ8A 4K4IA 5CWRA 4R65A 3PNCA 3AQNA 4FHVA 7ICKA 4WC0A 8ICZA 4I2FA 3OVSA 3AU2A 4RQ6A 1ZQRA 4TURA 1JN3A 1HUZA 1XSNA 1V4AA 8ICJA 3UXPA 3L9DA 4WCWA 7ICMA 3V7JA 5HRHA 3WFPA 1ZQFA 3RH6A 2PFOA 4LZGA 4KLGA 1UETA 3MBYA 3TFRA 1HUOA 4WC2A 1ZQUA 3C66A 4EP7A 1ZQQA 4X4RA 1MIYA 1ZQZA 1VFGA 1FA0A 1ZQIA 2ZH3A 4NLNA 9ICXA 1VJ7A 4RQ7A 4QZCA 4EBJA 4FHYA 5DBBA 8ICKA 4NM1A 5IILA 3RJJA 4X4OA 4PGYA 5CJ7A 4QZ9A 5J0XA 7ICQA 3WFSC 4PHDA 9ICEA 1KEJA 2ZH4A 4I2BA 4UB2A 8ICUA 8ICCA 3B0YA 5J2AA 4XA5A 4X4VA 2P66A 4RT3A 4GXJA 4M5DA 4X5VA 5DECA 5J0QA 4YN4A 1KNYA 1KDHA 5DBAA 7ICLA 4LVSA 4Z6EA 1MIWA 1ZQGA 9ICHA 1TVAA 4RT2A 4LT6A 4RWPA 1R8AA 4RWOA 5J2HA 2ZH6A 3C2KA 5CA7A 1BPZA 2ISPA 3AUOA 3V7KA 4LZDA 3C2MA 4E8FA 8ICLA 4FHPA 4WC5A 2PXIA 4F5OA 4X4QA 5D46A 3AQMA 1MIVA 4Z6DA 4WC4A 1NO5A 1R8BA 4WBZA 2BE3A 3HW8A 4MFCA 3JPTA 7ICPA 1ZJMA 9ICLA 5J2EA 4RQ4A 1UEUA 3C18A 9ICAA 4FO6A 4PHAA 3C5FA 4F5QA 5DBCA 1JAJA 4KLTA 3JPNA 3ISBA 4TUQA 4NM2A 7ICUA 4MFFA 3RJGA 4PHPA 5J2CA 1JQRA 1YLQA 7ICFA 4PPXA 8ICXA 2BCSA 3ISCA 5D49A 4UBCA 9ICQA 4QZHA 4YMNA 9ICFA 4K4HA 5J2GA 4UD4A 2O1PA 4P4MA 1ZQCA 1BPYA 4GXIA 4X4NA 4UB5A 1ZQNA 4RQ8A 7ICHA 4NLZA 3C5GA 4M04A 3H39A 4QZFA 2DR7A 4IG8A 5BPCA 4XRHA 4I2HA 4UBBA 4I2DA 3ISDA 4EBKA 1BPDA 8ICOA 2PFPA 5IIIA 1XSPA 9ICVA 3HJ1A 5HREA 3HWTA 4P2HA 1TFWA 3H37A 3JPRA 1XSLA 5J2IA 4QZDA 7ICTA 5DDMA 2BCQA 3H38A 5J0OA 3HJ4A 3PMLA 4FHWA 7ICVA 1F5AA 4KLMA 4X4TA 3OVBA 4DOBA 9ICPA 5DB6A 1BPBA 4JWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICG A;  5J29 A;  1R89 A;  2ZH5 A;  4KLI A;  4NKU A;  5J0P A;  1ZQV A;  2ZH1 A;  3V72 A;  3RJF A;  3OV7 A;  7ICI A;  8ICA A;  1ZJN A;  4NXZ A;  1MQ2 A;  2NRK A;  4RQ0 A;  8ICS A;  9ICU A;  4UAY A;  1ZQD A;  1ZQT A;  4UD5 A;  1ZQY A;  4Z6C A;  1ZQX A;  4I28 A;  1ZQA A;  4WC6 A;  1ZQM A;  3JPO A;  4TUS A;  1PX5 A;  1ZQK A;  4AT8 B;  8ICM A;  5HR9 A;  8ICI A;  2ID1 A;  1ZQP A;  2ZH7 A;  2DRB A;  5J2D A;  3GDX A;  2RFF A;  1ZQS A;  4KLO A;  3MDC A;  3OUY A;  4AT8 A;  4UB1 A;  5DKW A;  1ZQB A;  8ICG A;  4RPX A;  2BCR A;  4R64 A;  8ICY A;  2PBE A;  4IQV A;  5IIO A;  4QZA A;  3AQL A;  2I9G A;  4FH3 A;  4UB3 A;  4KLD A;  4DO9 A;  3RJI A;  4RPZ A;  4KLE A;  1RPL A;  3UXN A;  5HRG A;  3AU6 A;  4NKT A;  2PFN A;  4M47 A;  4YD2 A;  5J0S A;  4WC3 A;  3WFQ E;  4QZE A;  5J0R A;  3AQK A;  8ICF A;  4R66 A;  9ICG A;  4X0A A;  4M9J A;  1RZT A;  9ICT A;  5DDY A;  2DR9 A;  3NYB A;  4R63 A;  8ICN A;  4GXK A;  4MF2 A;  3K75 D;  9ICW A;  3UPS A;  2BPG A;  9ICS A;  5J0Y A;  9ICC A;  4O5K A;  1TV9 A;  4YCX A;  2FMQ A;  3JZ0 A;  4DOA A;  5HHH A;  2GWS A;  4S3N A;  4XUS A;  1WOT A;  4WC1 A;  2W9M A;  5HRI A;  9ICR A;  5TZV A;  2VAN A;  5CR0 A;  4M9G A;  2HHP A;  5IIJ A;  4QZI A;  4X4P A;  5J2B A;  8ICW A;  5BOL A;  2ZHB A;  4RQ5 A;  4O5E A;  4K4G A;  1Q79 A;  1TFY A;  4P4P A;  3UXO A;  3TFS A;  3V7L A;  2ZH8 A;  4WBY A;  9ICM A;  4I2A A;  2FMP A;  5HRK A;  7ICO A;  1ZQL A;  3JPQ A;  1MQ3 A;  2ZH2 A;  4O9M A;  5J0U A;  4QZB A;  1Q78 A;  3RJE A;  2ZHA A;  4UAZ A;  4UAW A;  4PHE A;  2BCU A;  3UPQ A;  9ICI A;  1ZQJ A;  4FHX A;  2ZH9 A;  4RQ1 A;  8ICV A;  2Q66 A;  1OU5 A;  4QZG A;  4MF8 A;  5HRL A;  2DR5 A;  4IQT A;  8ICR A;  3OGU A;  4I2E A;  4O5C A;  3HIY A;  5HRB A;  4M9H A;  3JPS A;  5BOM A;  2BPC A;  3JYY A;  9ICO A;  8ICB A;  4PGX A;  4JWM A;  5J0W A;  4DOC A;  4NY8 A;  9ICJ A;  3UQ2 A;  4KLS A;  4MFA A;  2BPF A;  2DVI A;  3MDA A;  4UB4 A;  3OUY B;  4F5P A;  4IQW A;  3MGI A;  4PGQ A;  2M2W A;  8ICH A;  5J2K A;  4M9N A;  4IQU A;  7ICE A;  3HX0 A;  4M9L A;  4RWQ A;  4YD1 A;  2M2U A;  4QZ8 A;  5DB8 A;  2PFQ A;  5J0T A;  2IHM A;  4AT7 B;  4KLH A;  3RH4 A;  4X4U A;  2M2T A;  4YMO A;  1R8C A;  4AT9 B;  5CHG A;  2FMS A;  4I2I A;  2DR8 A;  5F2V O;  4I29 A;  9ICK A;  5HC9 A;  4AT7 A;  8ICP A;  4I27 A;  4AT9 A;  4F5R A;  3OVA A;  5DED A;  3WFR E;  4X4S A;  8ICT A;  1ZQO A;  8ICE A;  2BCV A;  4RQ2 A;  3MGH A;  4M0A A;  4I2G A;  4YMM A;  4KLF A;  4M2Y A;  4PH5 A;  5HHI A;  4RQ3 A;  5IIK A;  1ZQE A;  3RJH A;  1ZQH A;  5CP2 A;  4I2J A;  1NOM A;  5IIM A;  9ICN A;  3C2L A;  3PMN A;  1BPE A;  3H3A A;  7ICS A;  1UEV A;  3JPP A;  9ICB A;  4E80 A;  4RPY A;  5D4B A;  4RWN A;  4WC7 A;  2M2V A;  4Z6F A;  4F5N A;  7ICN A;  4KLJ A;  4ATB B;  5IIN A;  3RJK A;  3LQC B;  5J2J A;  4NLK A;  5J2F A;  4TUP A;  1BPX A;  4XQ7 A;  7ICR A;  3B0X A;  4FH5 A;  1ZQW A;  4ATB A;  5DB7 A;  5CB1 A;  4KLQ A;  2ISO A;  4KLL A;  8ICQ A;  4P4O A;  4I2C A;  4KLU A;  2DRA A;  3WFO A;  3RH5 A;  4X0B A;  3LK9 A;  5EOZ A;  5DB9 A;  5HRD A;  7ICJ A;  4E7X A;  5HRF A;  3UQ0 A;  1JMS A;  2O5A A;  4XQ8 A;  4K4I A;  5CWR A;  4R65 A;  3PNC A;  3AQN A;  4FHV A;  7ICK A;  4WC0 A;  8ICZ A;  4I2F A;  3OVS A;  3AU2 A;  4RQ6 A;  1ZQR A;  4TUR A;  1JN3 A;  1HUZ A;  1XSN A;  1V4A A;  8ICJ A;  3UXP A;  3L9D A;  4WCW A;  7ICM A;  3V7J A;  5HRH A;  3WFP A;  1ZQF A;  3RH6 A;  2PFO A;  4LZG A;  4KLG A;  1UET A;  3MBY A;  3TFR A;  1HUO A;  4WC2 A;  1ZQU A;  3C66 A;  4EP7 A;  1ZQQ A;  4X4R A;  1MIY A;  1ZQZ A;  1VFG A;  1FA0 A;  1ZQI A;  2ZH3 A;  4NLN A;  9ICX A;  1VJ7 A;  4RQ7 A;  4QZC A;  4EBJ A;  4FHY A;  5DBB A;  8ICK A;  4NM1 A;  5IIL A;  3RJJ A;  4X4O A;  4PGY A;  5CJ7 A;  4QZ9 A;  5J0X A;  7ICQ A;  3WFS C;  4PHD A;  9ICE A;  1KEJ A;  2ZH4 A;  4I2B A;  4UB2 A;  8ICU A;  8ICC A;  3B0Y A;  5J2A A;  4XA5 A;  4X4V A;  2P66 A;  4RT3 A;  4GXJ A;  4M5D A;  4X5V A;  5DEC A;  5J0Q A;  4YN4 A;  1KNY A;  1KDH A;  5DBA A;  7ICL A;  4LVS A;  4Z6E A;  1MIW A;  1ZQG A;  9ICH A;  1TVA A;  4RT2 A;  4LT6 A;  4RWP A;  1R8A A;  4RWO A;  5J2H A;  2ZH6 A;  3C2K A;  5CA7 A;  1BPZ A;  2ISP A;  3AUO A;  3V7K A;  4LZD A;  3C2M A;  4E8F A;  8ICL A;  4FHP A;  4WC5 A;  2PXI A;  4F5O A;  4X4Q A;  5D46 A;  3AQM A;  1MIV A;  4Z6D A;  4WC4 A;  1NO5 A;  1R8B A;  4WBZ A;  2BE3 A;  3HW8 A;  4MFC A;  3JPT A;  7ICP A;  1ZJM A;  9ICL A;  5J2E A;  4RQ4 A;  1UEU A;  3C18 A;  9ICA A;  4FO6 A;  4PHA A;  3C5F A;  4F5Q A;  5DBC A;  1JAJ A;  4KLT A;  3JPN A;  3ISB A;  4TUQ A;  4NM2 A;  7ICU A;  4MFF A;  3RJG A;  4PHP A;  5J2C A;  1JQR A;  1YLQ A;  7ICF A;  4PPX A;  8ICX A;  2BCS A;  3ISC A;  5D49 A;  4UBC A;  9ICQ A;  4QZH A;  4YMN A;  9ICF A;  4K4H A;  5J2G A;  4UD4 A;  2O1P A;  4P4M A;  1ZQC A;  1BPY A;  4GXI A;  4X4N A;  4UB5 A;  1ZQN A;  4RQ8 A;  7ICH A;  4NLZ A;  3C5G A;  4M04 A;  3H39 A;  4QZF A;  2DR7 A;  4IG8 A;  5BPC A;  4XRH A;  4I2H A;  4UBB A;  4I2D A;  3ISD A;  4EBK A;  1BPD A;  8ICO A;  2PFP A;  5III A;  1XSP A;  9ICV A;  3HJ1 A;  5HRE A;  3HWT A;  4P2H A;  1TFW A;  3H37 A;  3JPR A;  1XSL A;  5J2I A;  4QZD A;  7ICT A;  5DDM A;  2BCQ A;  3H38 A;  5J0O A;  3HJ4 A;  3PML A;  4FHW A;  7ICV A;  1F5A A;  4KLM A;  4X4T A;  3OVB A;  4DOB A;  9ICP A;  5DB6 A;  1BPB A;  4JWN A; 
#chains in the Genus database with same CATH topology
 7ICG A;  2FCL A;  5J29 A;  2GA9 D;  1R89 A;  2ZH5 A;  4KLI A;  4NKU A;  4NXW A;  5J0P A;  4NXX A;  1ZQV A;  2ZH1 A;  3V72 A;  3RJF A;  4EV6 A;  3OV7 A;  7ICI A;  8ICA A;  1ZJN A;  4NXZ A;  1MQ2 A;  2NRK A;  4JLZ A;  4RQ0 A;  8ICS A;  9ICU A;  4UAY A;  1ZQD A;  1ZQT A;  4LEZ A;  4UD5 A;  1ZQY A;  3EF2 A;  4Z6C A;  4OAH A;  1ZQX A;  4I28 A;  1ZQA A;  4WC6 A;  1ZQM A;  3JPO A;  4TUS A;  1PX5 A;  4O6A A;  1ZQK A;  4OAG A;  4WH5 A;  4AT8 B;  8ICM A;  5HR9 A;  8ICI A;  2ID1 A;  1ZQP A;  2ZH7 A;  2DRB A;  5J2D A;  3GDX A;  2RFF A;  1ZQS A;  4KLO A;  3MDC A;  3OUY A;  4N7R A;  4AT8 A;  4UB1 A;  5DKW A;  1ZQB A;  8ICG A;  4RPX A;  2BCR A;  4R64 A;  8ICY A;  2PBE A;  4IQV A;  5IIO A;  4QZA A;  3AQL A;  2I9G A;  4FH3 A;  4UB3 A;  4KLD A;  4DO9 A;  3CK6 A;  3RJI A;  4RPZ A;  5D62 A;  4KLE A;  1RPL A;  3UXN A;  5HRG A;  3AU6 A;  4NKT A;  2PFN A;  4M47 A;  4YD2 A;  5J0S A;  4WC3 A;  3WFQ E;  4QZE A;  5J0R A;  3AQK A;  8ICF A;  4WQK A;  4R66 A;  9ICG A;  4X0A A;  4M9J A;  1RZT A;  9ICT A;  5DDY A;  2DR9 A;  3NYB A;  4R63 A;  8ICN A;  4K9A A;  4GXK A;  2BBH A;  4MF2 A;  3K75 D;  9ICW A;  3UPS A;  4JLX A;  2BBJ A;  2BPG A;  9ICS A;  5J0Y A;  9ICC A;  4O5K A;  1TV9 A;  4YCX A;  2FMQ A;  3JZ0 A;  4DOA A;  5HHH A;  2GWS A;  4S3N A;  4XUS A;  1WOT A;  4WC1 A;  2W9M A;  5HRI A;  9ICR A;  5TZV A;  2VAN A;  5CR0 A;  4M9G A;  2GAF D;  2HHP A;  5IIJ A;  4QZI A;  4X4P A;  5J2B A;  8ICW A;  5BOL A;  2ZHB A;  4RQ5 A;  4O68 A;  4O5E A;  4K4G A;  1Q79 A;  1TFY A;  4P4P A;  3UXO A;  5JTG A;  4EED A;  3TFS A;  3V7L A;  2ZH8 A;  4WBY A;  9ICM A;  4I2A A;  2FMP A;  5HRK A;  7ICO A;  1ZQL A;  3JPQ A;  1MQ3 A;  2ZH2 A;  4O9M A;  5J0U A;  4QZB A;  1Q78 A;  3RJE A;  2ZHA A;  4UAZ A;  4UAW A;  4PHE A;  2BCU A;  3UPQ A;  9ICI A;  1ZQJ A;  4FHX A;  2ZH9 A;  4RQ1 A;  8ICV A;  2Q66 A;  1OU5 A;  4QZG A;  4MF8 A;  4HX0 A;  5HRL A;  2DR5 A;  4IQT A;  8ICR A;  3OGU A;  3NVO A;  5CFU A;  4K8V A;  4I2E A;  4O5C A;  2B51 A;  3HIY A;  5HRB A;  4M9H A;  3JPS A;  5BOM A;  2BPC A;  3JYY A;  5B3P A;  9ICO A;  4K97 A;  4NXU A;  4O69 A;  8ICB A;  4PGX A;  4JWM A;  5J0W A;  4DOC A;  4NY8 A;  9ICJ A;  3UQ2 A;  4KLS A;  4MFA A;  2BPF A;  2DVI A;  3MDA A;  2IHO A;  4UB4 A;  3OUY B;  4F5P A;  4IQW A;  3MGI A;  4PGQ A;  2M2W A;  8ICH A;  5J2K A;  4M9N A;  4IQU A;  7ICE A;  3HX0 A;  4WQL A;  4M9L A;  4RWQ A;  4YD1 A;  2M2U A;  4QZ8 A;  5DB8 A;  3K7D A;  2PFQ A;  5J0T A;  5CHE A;  2IHM A;  4AT7 B;  4KLH A;  3RH4 A;  4X4U A;  2M2T A;  4YMO A;  1R8C A;  4AT9 B;  5CHG A;  2FMS A;  4I2I A;  2DR8 A;  5F2V O;  4I29 A;  9ICK A;  5HC9 A;  4AT7 A;  8ICP A;  4I27 A;  4K96 A;  4AT9 A;  4F5R A;  3OVA A;  5DED A;  3WFR E;  4X4S A;  8ICT A;  4OAI Z;  2B4V A;  1ZQO A;  8ICE A;  2BCV A;  4RQ2 A;  3MGH A;  4M0A A;  4I2G A;  4YMM A;  4KLF A;  4M2Y A;  4PH5 A;  5HHI A;  4RQ3 A;  5IIK A;  1ZQE A;  3RJH A;  1ZQH A;  5CP2 A;  4LEY A;  4I2J A;  1NOM A;  5IIM A;  9ICN A;  3C2L A;  3PMN A;  1BPE A;  3H3A A;  7ICS A;  1UEV A;  3NWI A;  3JPP A;  9ICB A;  4E80 A;  4RPY A;  5D4B A;  4RWN A;  4WC7 A;  2M2V A;  4NXT A;  4Z6F A;  4F5N A;  7ICN A;  4KLJ A;  4ATB B;  5IIN A;  3RJK A;  3LQC B;  5J2J A;  4NLK A;  5J2F A;  4TUP A;  1BPX A;  4XQ7 A;  7ICR A;  3B0X A;  4FH5 A;  1ZQW A;  4ATB A;  5DB7 A;  5CFT A;  5CB1 A;  4KLQ A;  2ISO A;  4KLL A;  8ICQ A;  4P4O A;  4I2C A;  4KLU A;  4KB6 A;  2DRA A;  3WFO A;  3RH5 A;  4X0B A;  3LK9 A;  5EOZ A;  5DB9 A;  5HRD A;  7ICJ A;  5CFS A;  4E7X A;  5HRF A;  3UQ0 A;  5D61 A;  1JMS A;  2O5A A;  4XQ8 A;  4K4I A;  5CWR A;  4R65 A;  3PNC A;  3AQN A;  4FHV A;  7ICK A;  4WC0 A;  8ICZ A;  3JCF A;  4I2F A;  3OVS A;  3AU2 A;  4RQ6 A;  4MKP A;  1ZQR A;  4TUR A;  1JN3 A;  1HUZ A;  1XSN A;  1V4A A;  8ICJ A;  4O67 A;  4EEB A;  3UXP A;  3L9D A;  4WCW A;  7ICM A;  3V7J A;  4OAF A;  5HRH A;  1GPJ A;  3ERC C;  3WFP A;  1ZQF A;  3RH6 A;  2PFO A;  4LZG A;  4KLG A;  1UET A;  3MBY A;  3TFR A;  1HUO A;  3OWG A;  4WC2 A;  1ZQU A;  3C66 A;  4EP7 A;  1ZQQ A;  4X4R A;  1MIY A;  1ZQZ A;  1VFG A;  1FA0 A;  1ZQI A;  2ZH3 A;  4NLN A;  9ICX A;  1VJ7 A;  4RQ7 A;  4QZC A;  4EBJ A;  3ER9 B;  4FHY A;  5DBB A;  8ICK A;  5D63 A;  4NM1 A;  5IIL A;  3RJJ A;  4X4O A;  4PGY A;  5CJ7 A;  4QZ9 A;  5J0X A;  7ICQ A;  3WFS C;  4PHD A;  9ICE A;  4K9B A;  1KEJ A;  2ZH4 A;  4I2B A;  4UB2 A;  8ICU A;  8ICC A;  3B0Y A;  5J2A A;  4K99 A;  4XA5 A;  4X4V A;  2P66 A;  4RT3 A;  4GXJ A;  4M5D A;  4X5V A;  5DEC A;  5J0Q A;  2HN2 A;  4NXV A;  4YN4 A;  1KNY A;  1KDH A;  5DBA A;  7ICL A;  4LVS A;  4Z6E A;  1MIW A;  1ZQG A;  9ICH A;  1TVA A;  4RT2 A;  4LT6 A;  4RWP A;  1R8A A;  4RWO A;  5J2H A;  2ZH6 A;  3C2K A;  5CA7 A;  4K98 A;  1BPZ A;  2ISP A;  3AUO A;  3V7K A;  4LZD A;  3C2M A;  4E8F A;  3MCR A;  4I0U A;  8ICL A;  4FHP A;  4WC5 A;  2PXI A;  4F5O A;  4X4Q A;  5D46 A;  3AQM A;  1MIV A;  4Z6D A;  4WC4 A;  1NO5 A;  1R8B A;  4WBZ A;  2IUB A;  2BE3 A;  3HW8 A;  4MFC A;  3JPT A;  7ICP A;  3PHZ A;  1ZJM A;  9ICL A;  5J2E A;  4RQ4 A;  2EWR A;  1UEU A;  3C18 A;  9ICA A;  4FO6 A;  4PHA A;  3C5F A;  4F5Q A;  5DBC A;  1JAJ A;  4XJE A;  4KLT A;  3JPN A;  3ISB A;  4TUQ A;  4NM2 A;  7ICU A;  4MFF A;  3RJG A;  4PHP A;  5J2C A;  1JQR A;  1YLQ A;  7ICF A;  4PPX A;  8ICX A;  2BCS A;  3ISC A;  5D49 A;  4UBC A;  9ICQ A;  4QZH A;  4YMN A;  9ICF A;  4K4H A;  5J2G A;  4UD4 A;  2O1P A;  4P4M A;  1ZQC A;  1BPY A;  4GXI A;  3ER8 C;  4X4N A;  4UB5 A;  1ZQN A;  4RQ8 A;  7ICH A;  2B56 A;  4NLZ A;  3C5G A;  4M04 A;  3H39 A;  4QZF A;  2DR7 A;  4IG8 A;  5BPC A;  4EGW A;  4XRH A;  4I2H A;  4UBB A;  2HN1 A;  4I2D A;  3ISD A;  4EBK A;  1BPD A;  8ICO A;  4FO1 A;  2PFP A;  5III A;  4LEV A;  1XSP A;  9ICV A;  3HJ1 A;  5HRE A;  4LEW A;  3HWT A;  4P2H A;  1TFW A;  5B3Q A;  3H37 A;  3JPR A;  1XSL A;  5J2I A;  4QZD A;  7ICT A;  5DDM A;  2BCQ A;  3H38 A;  5J0O A;  3HJ4 A;  3PML A;  4FHW A;  7ICV A;  1F5A A;  4KLM A;  4X4T A;  3OVB A;  4DOB A;  9ICP A;  4KM5 A;  5DB6 A;  1BPB A;  4WOY A;  4JWN A;  3NKU A; 
#chains in the Genus database with same CATH homology
 7ICG A;  5J29 A;  1R89 A;  2ZH5 A;  4KLI A;  4NKU A;  5J0P A;  1ZQV A;  2ZH1 A;  3V72 A;  3RJF A;  3OV7 A;  7ICI A;  8ICA A;  1ZJN A;  4NXZ A;  1MQ2 A;  2NRK A;  4RQ0 A;  8ICS A;  9ICU A;  4UAY A;  1ZQD A;  1ZQT A;  4UD5 A;  1ZQY A;  4Z6C A;  1ZQX A;  4I28 A;  1ZQA A;  4WC6 A;  1ZQM A;  3JPO A;  4TUS A;  1PX5 A;  1ZQK A;  4AT8 B;  8ICM A;  5HR9 A;  8ICI A;  2ID1 A;  1ZQP A;  2ZH7 A;  2DRB A;  5J2D A;  3GDX A;  2RFF A;  1ZQS A;  4KLO A;  3MDC A;  3OUY A;  4AT8 A;  4UB1 A;  5DKW A;  1ZQB A;  8ICG A;  4RPX A;  2BCR A;  4R64 A;  8ICY A;  2PBE A;  4IQV A;  5IIO A;  4QZA A;  3AQL A;  2I9G A;  4FH3 A;  4UB3 A;  4KLD A;  4DO9 A;  3RJI A;  4RPZ A;  4KLE A;  1RPL A;  3UXN A;  5HRG A;  3AU6 A;  4NKT A;  2PFN A;  4M47 A;  4YD2 A;  5J0S A;  4WC3 A;  3WFQ E;  4QZE A;  5J0R A;  3AQK A;  8ICF A;  4R66 A;  9ICG A;  4X0A A;  4M9J A;  1RZT A;  9ICT A;  5DDY A;  2DR9 A;  3NYB A;  4R63 A;  8ICN A;  4GXK A;  4MF2 A;  3K75 D;  9ICW A;  3UPS A;  2BPG A;  9ICS A;  5J0Y A;  9ICC A;  4O5K A;  1TV9 A;  4YCX A;  2FMQ A;  3JZ0 A;  4DOA A;  5HHH A;  2GWS A;  4S3N A;  4XUS A;  1WOT A;  4WC1 A;  2W9M A;  5HRI A;  9ICR A;  5TZV A;  2VAN A;  5CR0 A;  4M9G A;  2HHP A;  5IIJ A;  4QZI A;  4X4P A;  5J2B A;  8ICW A;  5BOL A;  2ZHB A;  4RQ5 A;  4O5E A;  4K4G A;  1Q79 A;  1TFY A;  4P4P A;  3UXO A;  3TFS A;  3V7L A;  2ZH8 A;  4WBY A;  9ICM A;  4I2A A;  2FMP A;  5HRK A;  7ICO A;  1ZQL A;  3JPQ A;  1MQ3 A;  2ZH2 A;  4O9M A;  5J0U A;  4QZB A;  1Q78 A;  3RJE A;  2ZHA A;  4UAZ A;  4UAW A;  4PHE A;  2BCU A;  3UPQ A;  9ICI A;  1ZQJ A;  4FHX A;  2ZH9 A;  4RQ1 A;  8ICV A;  2Q66 A;  1OU5 A;  4QZG A;  4MF8 A;  5HRL A;  2DR5 A;  4IQT A;  8ICR A;  3OGU A;  4I2E A;  4O5C A;  3HIY A;  5HRB A;  4M9H A;  3JPS A;  5BOM A;  2BPC A;  3JYY A;  9ICO A;  8ICB A;  4PGX A;  4JWM A;  5J0W A;  4DOC A;  4NY8 A;  9ICJ A;  3UQ2 A;  4KLS A;  4MFA A;  2BPF A;  2DVI A;  3MDA A;  4UB4 A;  3OUY B;  4F5P A;  4IQW A;  3MGI A;  4PGQ A;  2M2W A;  8ICH A;  5J2K A;  4M9N A;  4IQU A;  7ICE A;  3HX0 A;  4M9L A;  4RWQ A;  4YD1 A;  2M2U A;  4QZ8 A;  5DB8 A;  2PFQ A;  5J0T A;  2IHM A;  4AT7 B;  4KLH A;  3RH4 A;  4X4U A;  2M2T A;  4YMO A;  1R8C A;  4AT9 B;  5CHG A;  2FMS A;  4I2I A;  2DR8 A;  5F2V O;  4I29 A;  9ICK A;  5HC9 A;  4AT7 A;  8ICP A;  4I27 A;  4AT9 A;  4F5R A;  3OVA A;  5DED A;  3WFR E;  4X4S A;  8ICT A;  1ZQO A;  8ICE A;  2BCV A;  4RQ2 A;  3MGH A;  4M0A A;  4I2G A;  4YMM A;  4KLF A;  4M2Y A;  4PH5 A;  5HHI A;  4RQ3 A;  5IIK A;  1ZQE A;  3RJH A;  1ZQH A;  5CP2 A;  4I2J A;  1NOM A;  5IIM A;  9ICN A;  3C2L A;  3PMN A;  1BPE A;  3H3A A;  7ICS A;  1UEV A;  3JPP A;  9ICB A;  4E80 A;  4RPY A;  5D4B A;  4RWN A;  4WC7 A;  2M2V A;  4Z6F A;  4F5N A;  7ICN A;  4KLJ A;  4ATB B;  5IIN A;  3RJK A;  3LQC B;  5J2J A;  4NLK A;  5J2F A;  4TUP A;  1BPX A;  4XQ7 A;  7ICR A;  3B0X A;  4FH5 A;  1ZQW A;  4ATB A;  5DB7 A;  5CB1 A;  4KLQ A;  2ISO A;  4KLL A;  8ICQ A;  4P4O A;  4I2C A;  4KLU A;  2DRA A;  3WFO A;  3RH5 A;  4X0B A;  3LK9 A;  5EOZ A;  5DB9 A;  5HRD A;  7ICJ A;  4E7X A;  5HRF A;  3UQ0 A;  1JMS A;  2O5A A;  4XQ8 A;  4K4I A;  5CWR A;  4R65 A;  3PNC A;  3AQN A;  4FHV A;  7ICK A;  4WC0 A;  8ICZ A;  4I2F A;  3OVS A;  3AU2 A;  4RQ6 A;  1ZQR A;  4TUR A;  1JN3 A;  1HUZ A;  1XSN A;  1V4A A;  8ICJ A;  3UXP A;  3L9D A;  4WCW A;  7ICM A;  3V7J A;  5HRH A;  3WFP A;  1ZQF A;  3RH6 A;  2PFO A;  4LZG A;  4KLG A;  1UET A;  3MBY A;  3TFR A;  1HUO A;  4WC2 A;  1ZQU A;  3C66 A;  4EP7 A;  1ZQQ A;  4X4R A;  1MIY A;  1ZQZ A;  1VFG A;  1FA0 A;  1ZQI A;  2ZH3 A;  4NLN A;  9ICX A;  1VJ7 A;  4RQ7 A;  4QZC A;  4EBJ A;  4FHY A;  5DBB A;  8ICK A;  4NM1 A;  5IIL A;  3RJJ A;  4X4O A;  4PGY A;  5CJ7 A;  4QZ9 A;  5J0X A;  7ICQ A;  3WFS C;  4PHD A;  9ICE A;  1KEJ A;  2ZH4 A;  4I2B A;  4UB2 A;  8ICU A;  8ICC A;  3B0Y A;  5J2A A;  4XA5 A;  4X4V A;  2P66 A;  4RT3 A;  4GXJ A;  4M5D A;  4X5V A;  5DEC A;  5J0Q A;  4YN4 A;  1KNY A;  1KDH A;  5DBA A;  7ICL A;  4LVS A;  4Z6E A;  1MIW A;  1ZQG A;  9ICH A;  1TVA A;  4RT2 A;  4LT6 A;  4RWP A;  1R8A A;  4RWO A;  5J2H A;  2ZH6 A;  3C2K A;  5CA7 A;  1BPZ A;  2ISP A;  3AUO A;  3V7K A;  4LZD A;  3C2M A;  4E8F A;  8ICL A;  4FHP A;  4WC5 A;  2PXI A;  4F5O A;  4X4Q A;  5D46 A;  3AQM A;  1MIV A;  4Z6D A;  4WC4 A;  1NO5 A;  1R8B A;  4WBZ A;  2BE3 A;  3HW8 A;  4MFC A;  3JPT A;  7ICP A;  1ZJM A;  9ICL A;  5J2E A;  4RQ4 A;  1UEU A;  3C18 A;  9ICA A;  4FO6 A;  4PHA A;  3C5F A;  4F5Q A;  5DBC A;  1JAJ A;  4KLT A;  3JPN A;  3ISB A;  4TUQ A;  4NM2 A;  7ICU A;  4MFF A;  3RJG A;  4PHP A;  5J2C A;  1JQR A;  1YLQ A;  7ICF A;  4PPX A;  8ICX A;  2BCS A;  3ISC A;  5D49 A;  4UBC A;  9ICQ A;  4QZH A;  4YMN A;  9ICF A;  4K4H A;  5J2G A;  4UD4 A;  2O1P A;  4P4M A;  1ZQC A;  1BPY A;  4GXI A;  4X4N A;  4UB5 A;  1ZQN A;  4RQ8 A;  7ICH A;  4NLZ A;  3C5G A;  4M04 A;  3H39 A;  4QZF A;  2DR7 A;  4IG8 A;  5BPC A;  4XRH A;  4I2H A;  4UBB A;  4I2D A;  3ISD A;  4EBK A;  1BPD A;  8ICO A;  2PFP A;  5III A;  1XSP A;  9ICV A;  3HJ1 A;  5HRE A;  3HWT A;  4P2H A;  1TFW A;  3H37 A;  3JPR A;  1XSL A;  5J2I A;  4QZD A;  7ICT A;  5DDM A;  2BCQ A;  3H38 A;  5J0O A;  3HJ4 A;  3PML A;  4FHW A;  7ICV A;  1F5A A;  4KLM A;  4X4T A;  3OVB A;  4DOB A;  9ICP A;  5DB6 A;  1BPB A;  4JWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...