5HRLA

The crystal structure of asfvpolx: 1nt-gap(p) dna2: dgtp ternary complex.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
175
structure length
175
Chain Sequence
b'GMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 46
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrlA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrlA01
3AU2A 7ICFA 4XQ7A 8ICQA 4AT9B 4I2FA 2ZH2A 4GXJA 4RQ3A 3OVBA 1BPEA 2ISPA 4KLLA 5HR9A 4KLQA 5HHIA 4KLSA 5J2CA 1MIYA 4F5OA 5HC9A 3OUYA 2ZH3A 3MGIA 2RFFA 3RH4A 4WC1A 9ICUA 5DDYA 4YN4A 5IIIA 8ICRA 5HRKA 5BPCA 4WCWA 4AT8B 4RQ4A 5CA7A 4Z6EA 1TFWA 2Q66A 4RQ7A 4YD2A 4M9GA 4DOCA 1ZJMA 9ICKA 7ICMA 5J29A 3L9DA 5F2VO 4FO6A 4FHXA 7ICRA 5HRGA 2FMQA 3K75D 4UD5A 4YMNA 4I2GA 1UEVA 3JPPA 3V7LA 4KLUA 1TVAA 4LT6A 3C66A 4I2BA 1ZQOA 4MF8A 4TUQA 5IIMA 2DRBA 3JPTA 1RZTA 4YCXA 2NRKA 5CB1A 4Z6FA 3GDXA 7ICNA 1Q78A 4PHAA 8ICOA 1VJ7A 3RJIA 5DEDA 4K4GA 1ZQTA 3C2MA 3RJFA 4M47A 3LK9A 4KLFA 1ZQAA 7ICKA 4MF2A 7ICVA 8ICLA 3OVAA 4ATBB 9ICQA 9ICAA 4O5KA 2PFQA 5J2FA 3UPQA 4RQ8A 4GXIA 3AU6A 4X4QA 4RQ5A 4YD1A 1ZQMA 2BE3A 4FH3A 4WC3A 4X5VA 1R8AA 4K4HA 4UB1A 7ICJA 1ZQEA 1ZQHA 3UXOA 4IQVA 4M9HA 5HHHA 1NOMA 2HHPA 9ICPA 1FA0A 2DRAA 4LZDA 3JPQA 1ZQQA 3AQKA 5J2JA 2ZH6A 5IIOA 3AQLA 3OUYB 3C5GA 4DO9A 5IINA 1ZQCA 4UAZA 4E8FA 4UBCA 4FH5A 2ZH8A 9ICCA 3H38A 4RPYA 2ISOA 4EBKA 2BCVA 5D4BA 2BCQA 4QZBA 7ICLA 3AQMA 4X4PA 2ZH7A 9ICWA 4WC7A 4EP7A 7ICEA 1ZQDA 1ZQBA 3LQCB 9ICBA 4P2HA 4P4MA 1ZQNA 2VANA 4PHEA 5DB7A 8ICUA 1ZQVA 4UAWA 3C5FA 2PXIA 4X4TA 5CWRA 2O5AA 4KLHA 4R66A 5HRLA 5D49A 5DBBA 8ICHA 1ZQKA 2W9MA 9ICRA 3WFSC 2ZHAA 3WFQE 4M9NA 1TFYA 9ICJA 4RWNA 4FHYA 4F5PA 3UXPA 5J0WA 4NLZA 5J0QA 4QZHA 4X4VA 7ICPA 8ICKA 4RQ2A 4IQWA 3JPRA 4TURA 2PFPA 1OU5A 2BCRA 7ICTA 4NM2A 8ICAA 9ICSA 4UB4A 1ZQFA 3UXNA 2DR8A 4X4NA 1ZQUA 1KNYA 2M2UA 5J2IA 5J2AA 4X0BA 4XQ8A 3OGUA 3RJHA 4YMMA 2I9GA 4UB3A 8ICSA 2DR9A 4KLIA 9ICVA 4P4OA 2M2TA 9ICLA 4E80A 4NKTA 2DR5A 4RQ0A 4WC6A 5IIJA 2M2WA 1XSLA 1ZQXA 4O5EA 1JAJA 3WFRE 1NO5A 2PBEA 1JN3A 3PNCA 3HWTA 3ISBA 4RPXA 9ICNA 9ICXA 4GXKA 1R89A 4UBBA 4RWQA 3V7KA 4I2AA 1MQ2A 8ICTA 3NYBA 3V7JA 4AT9A 5BOMA 4F5RA 2PFOA 4WC0A 5J0SA 1HUZA 1ZQIA 2BPGA 4MFCA 4KLOA 4AT7B 4S3NA 3AQNA 1ZQPA 4PPXA 2IHMA 4PH5A 7ICIA 2ZH1A 1BPYA 4M9JA 4QZ9A 1ZQWA 5J2BA 4QZDA 4PHDA 3UQ2A 3TFSA 1ZQLA 4I2EA 9ICTA 5HRDA 4KLMA 8ICMA 9ICGA 4DOAA 4MFFA 3JPNA 2ZH9A 1KEJA 4RT3A 5J2KA 9ICHA 5DECA 1ZJNA 4KLDA 1MIVA 4PGYA 3AUOA 4R65A 3MDAA 7ICGA 4WC5A 2GWSA 5CR0A 4I2HA 5J0XA 2ZH4A 5DB8A 3JZ0A 1UETA 5DDMA 3H3AA 1ZQRA 4KLEA 8ICBA 5J2DA 1ZQZA 4PGXA 4WC2A 4ATBA 4QZFA 5DBCA 3UQ0A 4F5QA 8ICNA 8ICFA 4YMOA 8ICXA 3OVSA 5HRHA 4JWNA 3RH6A 4LVSA 4Z6DA 2DVIA 4X4SA 4QZ8A 3HIYA 3MGHA 5J0PA 7ICOA 4NY8A 1ZQYA 4FHWA 3C2KA 3ISDA 1V4AA 4NLKA 4KLTA 3HX0A 1BPXA 4FHPA 2M2VA 3TFRA 1R8CA 5HRBA 8ICWA 5CHGA 4IQTA 8ICEA 8ICPA 5J0TA 2BCUA 2O1PA 5HRFA 1UEUA 5J2HA 2ID1A 3C2LA 3C18A 1Q79A 3PMLA 5J0RA 9ICMA 2FMPA 4K4IA 3OV7A 4RWOA 1MQ3A 4I2CA 5D46A 4X4OA 4MFAA 1JMSA 3HJ1A 3UPSA 3H37A 4NM1A 3RJGA 3WFPA 4M04A 9ICIA 4PGQA 4I27A 4QZIA 4DOBA 4NKUA 4TUPA 5DB9A 1ZQJA 4X4RA 1WOTA 4RQ1A 3JPOA 1F5AA 4X4UA 3JPSA 5J0UA 3HW8A 4XRHA 4I2DA 4RWPA 4R63A 5HRIA 5J2EA 5DBAA 1RPLA 2BPFA 4IQUA 4NLNA 4F5NA 4LZGA 4QZAA 2ZHBA 3HJ4A 3RH5A 2FMSA 4PHPA 4O9MA 5HREA 4X0AA 3RJJA 5CJ7A 8ICVA 4I2IA 4AT8A 7ICSA 8ICGA 4WBZA 5BOLA 4XUSA 2BPCA 4R64A 3MBYA 5IILA 4QZCA 2P66A 4E7XA 1HUOA 5J0YA 8ICJA 3V72A 4M9LA 1TV9A 8ICYA 1ZQGA 7ICHA 4UAYA 4WC4A 1VFGA 1ZQSA 5EOZA 4KLJA 4UB2A 9ICOA 4I28A 7ICQA 9ICEA 7ICUA 4RT2A 4JWMA 5DB6A 8ICCA 4NXZA 1XSNA 4UD4A 3WFOA 2DR7A 4M0AA 1KDHA 4KLGA 4TUSA 3B0YA 3MDCA 4M2YA 4UB5A 3RJKA 9ICFA 1R8BA 4QZGA 5J0OA 2PFNA 8ICIA 2ZH5A 5IIKA 1BPDA 4IG8A 8ICZA 3B0XA 1YLQA 4I29A 4M5DA 4FHVA 3JYYA 4QZEA 5J2GA 5TZVA 3RJEA 1BPBA 3ISCA 4RPZA 4I2JA 3H39A 5DKWA 1MIWA 4RQ6A 4WBYA 4P4PA 2BCSA 1PX5A 4O5CA 3PMNA 1JQRA 1BPZA 4AT7A 4Z6CA 5CP2A 4EBJA 4XA5A 1XSPA
chains in the Genus database with same CATH superfamily
4KM5A 4I0UA 3AU2A 7ICFA 4XQ7A 8ICQA 4AT9B 4I2FA 2ZH2A 4GXJA 4RQ3A 3OVBA 1BPEA 2ISPA 4KLLA 5HR9A 4EEDA 4K9AA 4KLQA 5HHIA 4KLSA 5J2CA 1MIYA 4F5OA 5HC9A 3OUYA 2ZH3A 3MGIA 2RFFA 3RH4A 4WC1A 9ICUA 5DDYA 4NXVA 4LEZA 4YN4A 5IIIA 8ICRA 5HRKA 5BPCA 3NVOA 4WCWA 4AT8B 4RQ4A 5CA7A 4K8VA 4Z6EA 1TFWA 2Q66A 4RQ7A 4YD2A 4M9GA 4EEBA 4DOCA 1ZJMA 9ICKA 7ICMA 5J29A 4K98A 3L9DA 5F2VO 4FO6A 4FHXA 7ICRA 5HRGA 2FMQA 3K75D 4UD5A 4YMNA 3OWGA 4I2GA 1UEVA 3JPPA 3V7LA 4KLUA 1TVAA 4LT6A 3C66A 4I2BA 1ZQOA 4MF8A 4TUQA 5IIMA 2DRBA 3JPTA 1RZTA 4YCXA 2NRKA 5CB1A 4Z6FA 3GDXA 7ICNA 1Q78A 4PHAA 8ICOA 1VJ7A 3RJIA 5DEDA 4K4GA 1ZQTA 3C2MA 3RJFA 4M47A 3LK9A 4KLFA 1ZQAA 7ICKA 4MF2A 7ICVA 8ICLA 3OVAA 4ATBB 9ICQA 9ICAA 4O5KA 2IHOA 2PFQA 5J2FA 3UPQA 4RQ8A 4GXIA 3AU6A 4X4QA 2BBJA 4RQ5A 4YD1A 1ZQMA 2BE3A 4FH3A 4WC3A 4X5VA 1R8AA 4K4HA 4UB1A 7ICJA 1ZQEA 1ZQHA 3UXOA 4IQVA 4OAGA 4M9HA 5HHHA 1NOMA 2HHPA 9ICPA 1FA0A 4EV6A 2DRAA 4LZDA 3JPQA 1ZQQA 2BBHA 3AQKA 5J2JA 2ZH6A 5IIOA 3AQLA 3OUYB 3C5GA 4DO9A 5IINA 3EF2A 1ZQCA 3NWIA 4UAZA 4E8FA 4UBCA 4FH5A 4K99A 2ZH8A 9ICCA 3H38A 4RPYA 2ISOA 4EBKA 2BCVA 5D4BA 5CFUA 2BCQA 4MKPA 4QZBA 7ICLA 3AQMA 2EWRA 4X4PA 2ZH7A 9ICWA 4WC7A 4EP7A 7ICEA 1ZQDA 1ZQBA 4HX0A 3LQCB 9ICBA 5D62A 4P2HA 4WQLA 4P4MA 1ZQNA 4O67A 2VANA 4PHEA 5DB7A 8ICUA 1ZQVA 4UAWA 3C5FA 2PXIA 4X4TA 5CWRA 2O5AA 4KLHA 4R66A 5HRLA 5D49A 5DBBA 8ICHA 1ZQKA 2W9MA 9ICRA 3WFSC 2ZHAA 3WFQE 4M9NA 1TFYA 9ICJA 5CFSA 4RWNA 4FHYA 4F5PA 3UXPA 5J0WA 4NLZA 5J0QA 4QZHA 4OAFA 4X4VA 7ICPA 8ICKA 4NXWA 4RQ2A 4IQWA 3JPRA 4TURA 2PFPA 1OU5A 2BCRA 4XJEA 7ICTA 4NM2A 8ICAA 9ICSA 4UB4A 1ZQFA 3UXNA 5B3QA 2DR8A 4X4NA 1ZQUA 1KNYA 2M2UA 5J2IA 5J2AA 4X0BA 4XQ8A 3OGUA 3RJHA 3NKUA 4YMMA 2I9GA 4UB3A 8ICSA 2B56A 3ER9B 2DR9A 4KLIA 9ICVA 4P4OA 2M2TA 9ICLA 4E80A 4NKTA 2DR5A 4RQ0A 4WC6A 5IIJA 2M2WA 1XSLA 1ZQXA 4O5EA 1JAJA 3WFRE 1NO5A 2PBEA 1JN3A 3PNCA 3HWTA 2B51A 3ISBA 4RPXA 9ICNA 9ICXA 4GXKA 1R89A 4UBBA 4RWQA 4K97A 4NXTA 3V7KA 4I2AA 1MQ2A 8ICTA 3NYBA 3V7JA 4AT9A 5BOMA 4F5RA 2PFOA 4WC0A 5CHEA 2HN1A 5J0SA 1HUZA 1ZQIA 2BPGA 4MFCA 4JLZA 4KLOA 4AT7B 4S3NA 3AQNA 4WQKA 1ZQPA 4PPXA 2IHMA 4PH5A 7ICIA 4O69A 2ZH1A 1BPYA 4M9JA 4QZ9A 4EGWA 1ZQWA 5J2BA 4QZDA 4PHDA 3UQ2A 3TFSA 1ZQLA 4I2EA 9ICTA 5HRDA 4KLMA 8ICMA 9ICGA 4DOAA 4MFFA 3JPNA 2ZH9A 1KEJA 4RT3A 5J2KA 9ICHA 4NXXA 5DECA 3JCFA 1ZJNA 4KLDA 1MIVA 4PGYA 3MCRA 3AUOA 4R65A 3MDAA 4LEWA 4K96A 7ICGA 4WC5A 2GWSA 5CR0A 4I2HA 5J0XA 2ZH4A 5DB8A 3JZ0A 1UETA 5DDMA 3ER8C 3H3AA 1ZQRA 4JLXA 4KLEA 8ICBA 5J2DA 1ZQZA 4PGXA 4WC2A 4KB6A 4ATBA 4QZFA 5DBCA 3UQ0A 4F5QA 8ICNA 8ICFA 4YMOA 8ICXA 3OVSA 5HRHA 4JWNA 3RH6A 4LVSA 4Z6DA 3CK6A 4OAIZ 2DVIA 4X4SA 4QZ8A 3ERCC 3HIYA 1GPJA 3MGHA 5J0PA 7ICOA 4NY8A 5B3PA 1ZQYA 4FHWA 3C2KA 3ISDA 1V4AA 4NLKA 3K7DA 4KLTA 3HX0A 1BPXA 4FHPA 2M2VA 3TFRA 1R8CA 5HRBA 8ICWA 5CHGA 4IQTA 8ICEA 8ICPA 5J0TA 2BCUA 2O1PA 5HRFA 1UEUA 5J2HA 2ID1A 3C2LA 3C18A 1Q79A 3PMLA 5J0RA 4O6AA 9ICMA 2FMPA 4K4IA 5CFTA 3PHZA 3OV7A 4RWOA 1MQ3A 4I2CA 5D46A 4X4OA 4MFAA 4LEVA 1JMSA 3HJ1A 3UPSA 3H37A 4NM1A 4WOYA 3RJGA 5D61A 3WFPA 4M04A 9ICIA 4PGQA 4I27A 4QZIA 4DOBA 4NKUA 4TUPA 5DB9A 1ZQJA 4X4RA 2B4VA 1WOTA 4RQ1A 4WH5A 3JPOA 1F5AA 4X4UA 3JPSA 5J0UA 3HW8A 4XRHA 4I2DA 4RWPA 4R63A 5HRIA 5J2EA 5DBAA 1RPLA 2BPFA 4IQUA 4NLNA 4LEYA 4F5NA 4LZGA 4QZAA 4FO1A 2ZHBA 3HJ4A 3RH5A 2FMSA 4PHPA 4O9MA 5HREA 2FCLA 3RJJA 5CJ7A 8ICVA 4X0AA 4I2IA 4AT8A 2HN2A 7ICSA 8ICGA 4WBZA 5BOLA 4XUSA 2BPCA 4R64A 3MBYA 5IILA 4QZCA 2GAFD 2P66A 4E7XA 1HUOA 5J0YA 8ICJA 3V72A 4M9LA 1TV9A 8ICYA 1ZQGA 7ICHA 4UAYA 4WC4A 1VFGA 1ZQSA 5EOZA 4KLJA 5D63A 4UB2A 9ICOA 4I28A 7ICQA 9ICEA 5JTGA 7ICUA 2IUBA 4RT2A 4JWMA 5DB6A 4O68A 8ICCA 4OAHA 4NXZA 1XSNA 4UD4A 3WFOA 2DR7A 4M0AA 1KDHA 4KLGA 4TUSA 3B0YA 3MDCA 4M2YA 4UB5A 3RJKA 9ICFA 1R8BA 4K9BA 4QZGA 5J0OA 2PFNA 8ICIA 2ZH5A 5IIKA 4N7RA 1BPDA 2GA9D 8ICZA 3B0XA 1YLQA 4I29A 4M5DA 4IG8A 4FHVA 3JYYA 4QZEA 5J2GA 5TZVA 3RJEA 1BPBA 3ISCA 4RPZA 4I2JA 3H39A 5DKWA 1MIWA 4RQ6A 4WBYA 4P4PA 2BCSA 4NXUA 1PX5A 4O5CA 3PMNA 1JQRA 1BPZA 4AT7A 4Z6CA 5CP2A 4EBJA 4XA5A 1XSPA
chains in the Genus database with same CATH topology
3AU2A 7ICFA 4XQ7A 8ICQA 4AT9B 4I2FA 2ZH2A 4GXJA 4RQ3A 3OVBA 1BPEA 2ISPA 4KLLA 5HR9A 4KLQA 5HHIA 4KLSA 5J2CA 1MIYA 4F5OA 5HC9A 3OUYA 2ZH3A 3MGIA 2RFFA 3RH4A 4WC1A 9ICUA 5DDYA 4YN4A 5IIIA 8ICRA 5HRKA 5BPCA 4WCWA 4AT8B 4RQ4A 5CA7A 4Z6EA 1TFWA 2Q66A 4RQ7A 4YD2A 4M9GA 4DOCA 1ZJMA 9ICKA 7ICMA 5J29A 3L9DA 5F2VO 4FO6A 4FHXA 7ICRA 5HRGA 2FMQA 3K75D 4UD5A 4YMNA 4I2GA 1UEVA 3JPPA 3V7LA 4KLUA 1TVAA 4LT6A 3C66A 4I2BA 1ZQOA 4MF8A 4TUQA 5IIMA 2DRBA 3JPTA 1RZTA 4YCXA 2NRKA 5CB1A 4Z6FA 3GDXA 7ICNA 1Q78A 4PHAA 8ICOA 1VJ7A 3RJIA 5DEDA 4K4GA 1ZQTA 3C2MA 3RJFA 4M47A 3LK9A 4KLFA 1ZQAA 7ICKA 4MF2A 7ICVA 8ICLA 3OVAA 4ATBB 9ICQA 9ICAA 4O5KA 2PFQA 5J2FA 3UPQA 4RQ8A 4GXIA 3AU6A 4X4QA 4RQ5A 4YD1A 1ZQMA 2BE3A 4FH3A 4WC3A 4X5VA 1R8AA 4K4HA 4UB1A 7ICJA 1ZQEA 1ZQHA 3UXOA 4IQVA 4M9HA 5HHHA 1NOMA 2HHPA 9ICPA 1FA0A 2DRAA 4LZDA 3JPQA 1ZQQA 3AQKA 5J2JA 2ZH6A 5IIOA 3AQLA 3OUYB 3C5GA 4DO9A 5IINA 1ZQCA 4UAZA 4E8FA 4UBCA 4FH5A 2ZH8A 9ICCA 3H38A 4RPYA 2ISOA 4EBKA 2BCVA 5D4BA 2BCQA 4QZBA 7ICLA 3AQMA 4X4PA 2ZH7A 9ICWA 4WC7A 4EP7A 7ICEA 1ZQDA 1ZQBA 3LQCB 9ICBA 4P2HA 4P4MA 1ZQNA 2VANA 4PHEA 5DB7A 8ICUA 1ZQVA 4UAWA 3C5FA 2PXIA 4X4TA 5CWRA 2O5AA 4KLHA 4R66A 5HRLA 5D49A 5DBBA 8ICHA 1ZQKA 2W9MA 9ICRA 3WFSC 2ZHAA 3WFQE 4M9NA 1TFYA 9ICJA 4RWNA 4FHYA 4F5PA 3UXPA 5J0WA 4NLZA 5J0QA 4QZHA 4X4VA 7ICPA 8ICKA 4RQ2A 4IQWA 3JPRA 4TURA 2PFPA 1OU5A 2BCRA 7ICTA 4NM2A 8ICAA 9ICSA 4UB4A 1ZQFA 3UXNA 2DR8A 4X4NA 1ZQUA 1KNYA 2M2UA 5J2IA 5J2AA 4X0BA 4XQ8A 3OGUA 3RJHA 4YMMA 2I9GA 4UB3A 8ICSA 2DR9A 4KLIA 9ICVA 4P4OA 2M2TA 9ICLA 4E80A 4NKTA 2DR5A 4RQ0A 4WC6A 5IIJA 2M2WA 1XSLA 1ZQXA 4O5EA 1JAJA 3WFRE 1NO5A 2PBEA 1JN3A 3PNCA 3HWTA 3ISBA 4RPXA 9ICNA 9ICXA 4GXKA 1R89A 4UBBA 4RWQA 3V7KA 4I2AA 1MQ2A 8ICTA 3NYBA 3V7JA 4AT9A 5BOMA 4F5RA 2PFOA 4WC0A 5J0SA 1HUZA 1ZQIA 2BPGA 4MFCA 4KLOA 4AT7B 4S3NA 3AQNA 1ZQPA 4PPXA 2IHMA 4PH5A 7ICIA 2ZH1A 1BPYA 4M9JA 4QZ9A 1ZQWA 5J2BA 4QZDA 4PHDA 3UQ2A 3TFSA 1ZQLA 4I2EA 9ICTA 5HRDA 4KLMA 8ICMA 9ICGA 4DOAA 4MFFA 3JPNA 2ZH9A 1KEJA 4RT3A 5J2KA 9ICHA 5DECA 1ZJNA 4KLDA 1MIVA 4PGYA 3AUOA 4R65A 3MDAA 7ICGA 4WC5A 2GWSA 5CR0A 4I2HA 5J0XA 2ZH4A 5DB8A 3JZ0A 1UETA 5DDMA 3H3AA 1ZQRA 4KLEA 8ICBA 5J2DA 1ZQZA 4PGXA 4WC2A 4ATBA 4QZFA 5DBCA 3UQ0A 4F5QA 8ICNA 8ICFA 4YMOA 8ICXA 3OVSA 5HRHA 4JWNA 3RH6A 4LVSA 4Z6DA 2DVIA 4X4SA 4QZ8A 3HIYA 3MGHA 5J0PA 7ICOA 4NY8A 1ZQYA 4FHWA 3C2KA 3ISDA 1V4AA 4NLKA 4KLTA 3HX0A 1BPXA 4FHPA 2M2VA 3TFRA 1R8CA 5HRBA 8ICWA 5CHGA 4IQTA 8ICEA 8ICPA 5J0TA 2BCUA 2O1PA 5HRFA 1UEUA 5J2HA 2ID1A 3C2LA 3C18A 1Q79A 3PMLA 5J0RA 9ICMA 2FMPA 4K4IA 3OV7A 4RWOA 1MQ3A 4I2CA 5D46A 4X4OA 4MFAA 1JMSA 3HJ1A 3UPSA 3H37A 4NM1A 3RJGA 3WFPA 4M04A 9ICIA 4PGQA 4I27A 4QZIA 4DOBA 4NKUA 4TUPA 5DB9A 1ZQJA 4X4RA 1WOTA 4RQ1A 3JPOA 1F5AA 4X4UA 3JPSA 5J0UA 3HW8A 4XRHA 4I2DA 4RWPA 4R63A 5HRIA 5J2EA 5DBAA 1RPLA 2BPFA 4IQUA 4NLNA 4F5NA 4LZGA 4QZAA 2ZHBA 3HJ4A 3RH5A 2FMSA 4PHPA 4O9MA 5HREA 4X0AA 3RJJA 5CJ7A 8ICVA 4I2IA 4AT8A 7ICSA 8ICGA 4WBZA 5BOLA 4XUSA 2BPCA 4R64A 3MBYA 5IILA 4QZCA 2P66A 4E7XA 1HUOA 5J0YA 8ICJA 3V72A 4M9LA 1TV9A 8ICYA 1ZQGA 7ICHA 4UAYA 4WC4A 1VFGA 1ZQSA 5EOZA 4KLJA 4UB2A 9ICOA 4I28A 7ICQA 9ICEA 7ICUA 4RT2A 4JWMA 5DB6A 8ICCA 4NXZA 1XSNA 4UD4A 3WFOA 2DR7A 4M0AA 1KDHA 4KLGA 4TUSA 3B0YA 3MDCA 4M2YA 4UB5A 3RJKA 9ICFA 1R8BA 4QZGA 5J0OA 2PFNA 8ICIA 2ZH5A 5IIKA 1BPDA 4IG8A 8ICZA 3B0XA 1YLQA 4I29A 4M5DA 4FHVA 3JYYA 4QZEA 5J2GA 5TZVA 3RJEA 1BPBA 3ISCA 4RPZA 4I2JA 3H39A 5DKWA 1MIWA 4RQ6A 4WBYA 4P4PA 2BCSA 1PX5A 4O5CA 3PMNA 1JQRA 1BPZA 4AT7A 4Z6CA 5CP2A 4EBJA 4XA5A 1XSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU2 A;  7ICF A;  4XQ7 A;  8ICQ A;  4AT9 B;  4I2F A;  2ZH2 A;  4GXJ A;  4RQ3 A;  3OVB A;  1BPE A;  2ISP A;  4KLL A;  5HR9 A;  4KLQ A;  5HHI A;  4KLS A;  5J2C A;  1MIY A;  4F5O A;  5HC9 A;  3OUY A;  2ZH3 A;  3MGI A;  2RFF A;  3RH4 A;  4WC1 A;  9ICU A;  5DDY A;  4YN4 A;  5III A;  8ICR A;  5HRK A;  5BPC A;  4WCW A;  4AT8 B;  4RQ4 A;  5CA7 A;  4Z6E A;  1TFW A;  2Q66 A;  4RQ7 A;  4YD2 A;  4M9G A;  4DOC A;  1ZJM A;  9ICK A;  7ICM A;  5J29 A;  3L9D A;  5F2V O;  4FO6 A;  4FHX A;  7ICR A;  5HRG A;  2FMQ A;  3K75 D;  4UD5 A;  4YMN A;  4I2G A;  1UEV A;  3JPP A;  3V7L A;  4KLU A;  1TVA A;  4LT6 A;  3C66 A;  4I2B A;  1ZQO A;  4MF8 A;  4TUQ A;  5IIM A;  2DRB A;  3JPT A;  1RZT A;  4YCX A;  2NRK A;  5CB1 A;  4Z6F A;  3GDX A;  7ICN A;  1Q78 A;  4PHA A;  8ICO A;  1VJ7 A;  3RJI A;  5DED A;  4K4G A;  1ZQT A;  3C2M A;  3RJF A;  4M47 A;  3LK9 A;  4KLF A;  1ZQA A;  7ICK A;  4MF2 A;  7ICV A;  8ICL A;  3OVA A;  4ATB B;  9ICQ A;  9ICA A;  4O5K A;  2PFQ A;  5J2F A;  3UPQ A;  4RQ8 A;  4GXI A;  3AU6 A;  4X4Q A;  4RQ5 A;  4YD1 A;  1ZQM A;  2BE3 A;  4FH3 A;  4WC3 A;  4X5V A;  1R8A A;  4K4H A;  4UB1 A;  7ICJ A;  1ZQE A;  1ZQH A;  3UXO A;  4IQV A;  4M9H A;  5HHH A;  1NOM A;  2HHP A;  9ICP A;  1FA0 A;  2DRA A;  4LZD A;  3JPQ A;  1ZQQ A;  3AQK A;  5J2J A;  2ZH6 A;  5IIO A;  3AQL A;  3OUY B;  3C5G A;  4DO9 A;  5IIN A;  1ZQC A;  4UAZ A;  4E8F A;  4UBC A;  4FH5 A;  2ZH8 A;  9ICC A;  3H38 A;  4RPY A;  2ISO A;  4EBK A;  2BCV A;  5D4B A;  2BCQ A;  4QZB A;  7ICL A;  3AQM A;  4X4P A;  2ZH7 A;  9ICW A;  4WC7 A;  4EP7 A;  7ICE A;  1ZQD A;  1ZQB A;  3LQC B;  9ICB A;  4P2H A;  4P4M A;  1ZQN A;  2VAN A;  4PHE A;  5DB7 A;  8ICU A;  1ZQV A;  4UAW A;  3C5F A;  2PXI A;  4X4T A;  5CWR A;  2O5A A;  4KLH A;  4R66 A;  5HRL A;  5D49 A;  5DBB A;  8ICH A;  1ZQK A;  2W9M A;  9ICR A;  3WFS C;  2ZHA A;  3WFQ E;  4M9N A;  1TFY A;  9ICJ A;  4RWN A;  4FHY A;  4F5P A;  3UXP A;  5J0W A;  4NLZ A;  5J0Q A;  4QZH A;  4X4V A;  7ICP A;  8ICK A;  4RQ2 A;  4IQW A;  3JPR A;  4TUR A;  2PFP A;  1OU5 A;  2BCR A;  7ICT A;  4NM2 A;  8ICA A;  9ICS A;  4UB4 A;  1ZQF A;  3UXN A;  2DR8 A;  4X4N A;  1ZQU A;  1KNY A;  2M2U A;  5J2I A;  5J2A A;  4X0B A;  4XQ8 A;  3OGU A;  3RJH A;  4YMM A;  2I9G A;  4UB3 A;  8ICS A;  2DR9 A;  4KLI A;  9ICV A;  4P4O A;  2M2T A;  9ICL A;  4E80 A;  4NKT A;  2DR5 A;  4RQ0 A;  4WC6 A;  5IIJ A;  2M2W A;  1XSL A;  1ZQX A;  4O5E A;  1JAJ A;  3WFR E;  1NO5 A;  2PBE A;  1JN3 A;  3PNC A;  3HWT A;  3ISB A;  4RPX A;  9ICN A;  9ICX A;  4GXK A;  1R89 A;  4UBB A;  4RWQ A;  3V7K A;  4I2A A;  1MQ2 A;  8ICT A;  3NYB A;  3V7J A;  4AT9 A;  5BOM A;  4F5R A;  2PFO A;  4WC0 A;  5J0S A;  1HUZ A;  1ZQI A;  2BPG A;  4MFC A;  4KLO A;  4AT7 B;  4S3N A;  3AQN A;  1ZQP A;  4PPX A;  2IHM A;  4PH5 A;  7ICI A;  2ZH1 A;  1BPY A;  4M9J A;  4QZ9 A;  1ZQW A;  5J2B A;  4QZD A;  4PHD A;  3UQ2 A;  3TFS A;  1ZQL A;  4I2E A;  9ICT A;  5HRD A;  4KLM A;  8ICM A;  9ICG A;  4DOA A;  4MFF A;  3JPN A;  2ZH9 A;  1KEJ A;  4RT3 A;  5J2K A;  9ICH A;  5DEC A;  1ZJN A;  4KLD A;  1MIV A;  4PGY A;  3AUO A;  4R65 A;  3MDA A;  7ICG A;  4WC5 A;  2GWS A;  5CR0 A;  4I2H A;  5J0X A;  2ZH4 A;  5DB8 A;  3JZ0 A;  1UET A;  5DDM A;  3H3A A;  1ZQR A;  4KLE A;  8ICB A;  5J2D A;  1ZQZ A;  4PGX A;  4WC2 A;  4ATB A;  4QZF A;  5DBC A;  3UQ0 A;  4F5Q A;  8ICN A;  8ICF A;  4YMO A;  8ICX A;  3OVS A;  5HRH A;  4JWN A;  3RH6 A;  4LVS A;  4Z6D A;  2DVI A;  4X4S A;  4QZ8 A;  3HIY A;  3MGH A;  5J0P A;  7ICO A;  4NY8 A;  1ZQY A;  4FHW A;  3C2K A;  3ISD A;  1V4A A;  4NLK A;  4KLT A;  3HX0 A;  1BPX A;  4FHP A;  2M2V A;  3TFR A;  1R8C A;  5HRB A;  8ICW A;  5CHG A;  4IQT A;  8ICE A;  8ICP A;  5J0T A;  2BCU A;  2O1P A;  5HRF A;  1UEU A;  5J2H A;  2ID1 A;  3C2L A;  3C18 A;  1Q79 A;  3PML A;  5J0R A;  9ICM A;  2FMP A;  4K4I A;  3OV7 A;  4RWO A;  1MQ3 A;  4I2C A;  5D46 A;  4X4O A;  4MFA A;  1JMS A;  3HJ1 A;  3UPS A;  3H37 A;  4NM1 A;  3RJG A;  3WFP A;  4M04 A;  9ICI A;  4PGQ A;  4I27 A;  4QZI A;  4DOB A;  4NKU A;  4TUP A;  5DB9 A;  1ZQJ A;  4X4R A;  1WOT A;  4RQ1 A;  3JPO A;  1F5A A;  4X4U A;  3JPS A;  5J0U A;  3HW8 A;  4XRH A;  4I2D A;  4RWP A;  4R63 A;  5HRI A;  5J2E A;  5DBA A;  1RPL A;  2BPF A;  4IQU A;  4NLN A;  4F5N A;  4LZG A;  4QZA A;  2ZHB A;  3HJ4 A;  3RH5 A;  2FMS A;  4PHP A;  4O9M A;  5HRE A;  4X0A A;  3RJJ A;  5CJ7 A;  8ICV A;  4I2I A;  4AT8 A;  7ICS A;  8ICG A;  4WBZ A;  5BOL A;  4XUS A;  2BPC A;  4R64 A;  3MBY A;  5IIL A;  4QZC A;  2P66 A;  4E7X A;  1HUO A;  5J0Y A;  8ICJ A;  3V72 A;  4M9L A;  1TV9 A;  8ICY A;  1ZQG A;  7ICH A;  4UAY A;  4WC4 A;  1VFG A;  1ZQS A;  5EOZ A;  4KLJ A;  4UB2 A;  9ICO A;  4I28 A;  7ICQ A;  9ICE A;  7ICU A;  4RT2 A;  4JWM A;  5DB6 A;  8ICC A;  4NXZ A;  1XSN A;  4UD4 A;  3WFO A;  2DR7 A;  4M0A A;  1KDH A;  4KLG A;  4TUS A;  3B0Y A;  3MDC A;  4M2Y A;  4UB5 A;  3RJK A;  9ICF A;  1R8B A;  4QZG A;  5J0O A;  2PFN A;  8ICI A;  2ZH5 A;  5IIK A;  1BPD A;  4IG8 A;  8ICZ A;  3B0X A;  1YLQ A;  4I29 A;  4M5D A;  4FHV A;  3JYY A;  4QZE A;  5J2G A;  5TZV A;  3RJE A;  1BPB A;  3ISC A;  4RPZ A;  4I2J A;  3H39 A;  5DKW A;  1MIW A;  4RQ6 A;  4WBY A;  4P4P A;  2BCS A;  1PX5 A;  4O5C A;  3PMN A;  1JQR A;  1BPZ A;  4AT7 A;  4Z6C A;  5CP2 A;  4EBJ A;  4XA5 A;  1XSP A; 
#chains in the Genus database with same CATH topology
 4KM5 A;  4I0U A;  3AU2 A;  7ICF A;  4XQ7 A;  8ICQ A;  4AT9 B;  4I2F A;  2ZH2 A;  4GXJ A;  4RQ3 A;  3OVB A;  1BPE A;  2ISP A;  4KLL A;  5HR9 A;  4EED A;  4K9A A;  4KLQ A;  5HHI A;  4KLS A;  5J2C A;  1MIY A;  4F5O A;  5HC9 A;  3OUY A;  2ZH3 A;  3MGI A;  2RFF A;  3RH4 A;  4WC1 A;  9ICU A;  5DDY A;  4NXV A;  4LEZ A;  4YN4 A;  5III A;  8ICR A;  5HRK A;  5BPC A;  3NVO A;  4WCW A;  4AT8 B;  4RQ4 A;  5CA7 A;  4K8V A;  4Z6E A;  1TFW A;  2Q66 A;  4RQ7 A;  4YD2 A;  4M9G A;  4EEB A;  4DOC A;  1ZJM A;  9ICK A;  7ICM A;  5J29 A;  4K98 A;  3L9D A;  5F2V O;  4FO6 A;  4FHX A;  7ICR A;  5HRG A;  2FMQ A;  3K75 D;  4UD5 A;  4YMN A;  3OWG A;  4I2G A;  1UEV A;  3JPP A;  3V7L A;  4KLU A;  1TVA A;  4LT6 A;  3C66 A;  4I2B A;  1ZQO A;  4MF8 A;  4TUQ A;  5IIM A;  2DRB A;  3JPT A;  1RZT A;  4YCX A;  2NRK A;  5CB1 A;  4Z6F A;  3GDX A;  7ICN A;  1Q78 A;  4PHA A;  8ICO A;  1VJ7 A;  3RJI A;  5DED A;  4K4G A;  1ZQT A;  3C2M A;  3RJF A;  4M47 A;  3LK9 A;  4KLF A;  1ZQA A;  7ICK A;  4MF2 A;  7ICV A;  8ICL A;  3OVA A;  4ATB B;  9ICQ A;  9ICA A;  4O5K A;  2IHO A;  2PFQ A;  5J2F A;  3UPQ A;  4RQ8 A;  4GXI A;  3AU6 A;  4X4Q A;  2BBJ A;  4RQ5 A;  4YD1 A;  1ZQM A;  2BE3 A;  4FH3 A;  4WC3 A;  4X5V A;  1R8A A;  4K4H A;  4UB1 A;  7ICJ A;  1ZQE A;  1ZQH A;  3UXO A;  4IQV A;  4OAG A;  4M9H A;  5HHH A;  1NOM A;  2HHP A;  9ICP A;  1FA0 A;  4EV6 A;  2DRA A;  4LZD A;  3JPQ A;  1ZQQ A;  2BBH A;  3AQK A;  5J2J A;  2ZH6 A;  5IIO A;  3AQL A;  3OUY B;  3C5G A;  4DO9 A;  5IIN A;  3EF2 A;  1ZQC A;  3NWI A;  4UAZ A;  4E8F A;  4UBC A;  4FH5 A;  4K99 A;  2ZH8 A;  9ICC A;  3H38 A;  4RPY A;  2ISO A;  4EBK A;  2BCV A;  5D4B A;  5CFU A;  2BCQ A;  4MKP A;  4QZB A;  7ICL A;  3AQM A;  2EWR A;  4X4P A;  2ZH7 A;  9ICW A;  4WC7 A;  4EP7 A;  7ICE A;  1ZQD A;  1ZQB A;  4HX0 A;  3LQC B;  9ICB A;  5D62 A;  4P2H A;  4WQL A;  4P4M A;  1ZQN A;  4O67 A;  2VAN A;  4PHE A;  5DB7 A;  8ICU A;  1ZQV A;  4UAW A;  3C5F A;  2PXI A;  4X4T A;  5CWR A;  2O5A A;  4KLH A;  4R66 A;  5HRL A;  5D49 A;  5DBB A;  8ICH A;  1ZQK A;  2W9M A;  9ICR A;  3WFS C;  2ZHA A;  3WFQ E;  4M9N A;  1TFY A;  9ICJ A;  5CFS A;  4RWN A;  4FHY A;  4F5P A;  3UXP A;  5J0W A;  4NLZ A;  5J0Q A;  4QZH A;  4OAF A;  4X4V A;  7ICP A;  8ICK A;  4NXW A;  4RQ2 A;  4IQW A;  3JPR A;  4TUR A;  2PFP A;  1OU5 A;  2BCR A;  4XJE A;  7ICT A;  4NM2 A;  8ICA A;  9ICS A;  4UB4 A;  1ZQF A;  3UXN A;  5B3Q A;  2DR8 A;  4X4N A;  1ZQU A;  1KNY A;  2M2U A;  5J2I A;  5J2A A;  4X0B A;  4XQ8 A;  3OGU A;  3RJH A;  3NKU A;  4YMM A;  2I9G A;  4UB3 A;  8ICS A;  2B56 A;  3ER9 B;  2DR9 A;  4KLI A;  9ICV A;  4P4O A;  2M2T A;  9ICL A;  4E80 A;  4NKT A;  2DR5 A;  4RQ0 A;  4WC6 A;  5IIJ A;  2M2W A;  1XSL A;  1ZQX A;  4O5E A;  1JAJ A;  3WFR E;  1NO5 A;  2PBE A;  1JN3 A;  3PNC A;  3HWT A;  2B51 A;  3ISB A;  4RPX A;  9ICN A;  9ICX A;  4GXK A;  1R89 A;  4UBB A;  4RWQ A;  4K97 A;  4NXT A;  3V7K A;  4I2A A;  1MQ2 A;  8ICT A;  3NYB A;  3V7J A;  4AT9 A;  5BOM A;  4F5R A;  2PFO A;  4WC0 A;  5CHE A;  2HN1 A;  5J0S A;  1HUZ A;  1ZQI A;  2BPG A;  4MFC A;  4JLZ A;  4KLO A;  4AT7 B;  4S3N A;  3AQN A;  4WQK A;  1ZQP A;  4PPX A;  2IHM A;  4PH5 A;  7ICI A;  4O69 A;  2ZH1 A;  1BPY A;  4M9J A;  4QZ9 A;  4EGW A;  1ZQW A;  5J2B A;  4QZD A;  4PHD A;  3UQ2 A;  3TFS A;  1ZQL A;  4I2E A;  9ICT A;  5HRD A;  4KLM A;  8ICM A;  9ICG A;  4DOA A;  4MFF A;  3JPN A;  2ZH9 A;  1KEJ A;  4RT3 A;  5J2K A;  9ICH A;  4NXX A;  5DEC A;  3JCF A;  1ZJN A;  4KLD A;  1MIV A;  4PGY A;  3MCR A;  3AUO A;  4R65 A;  3MDA A;  4LEW A;  4K96 A;  7ICG A;  4WC5 A;  2GWS A;  5CR0 A;  4I2H A;  5J0X A;  2ZH4 A;  5DB8 A;  3JZ0 A;  1UET A;  5DDM A;  3ER8 C;  3H3A A;  1ZQR A;  4JLX A;  4KLE A;  8ICB A;  5J2D A;  1ZQZ A;  4PGX A;  4WC2 A;  4KB6 A;  4ATB A;  4QZF A;  5DBC A;  3UQ0 A;  4F5Q A;  8ICN A;  8ICF A;  4YMO A;  8ICX A;  3OVS A;  5HRH A;  4JWN A;  3RH6 A;  4LVS A;  4Z6D A;  3CK6 A;  4OAI Z;  2DVI A;  4X4S A;  4QZ8 A;  3ERC C;  3HIY A;  1GPJ A;  3MGH A;  5J0P A;  7ICO A;  4NY8 A;  5B3P A;  1ZQY A;  4FHW A;  3C2K A;  3ISD A;  1V4A A;  4NLK A;  3K7D A;  4KLT A;  3HX0 A;  1BPX A;  4FHP A;  2M2V A;  3TFR A;  1R8C A;  5HRB A;  8ICW A;  5CHG A;  4IQT A;  8ICE A;  8ICP A;  5J0T A;  2BCU A;  2O1P A;  5HRF A;  1UEU A;  5J2H A;  2ID1 A;  3C2L A;  3C18 A;  1Q79 A;  3PML A;  5J0R A;  4O6A A;  9ICM A;  2FMP A;  4K4I A;  5CFT A;  3PHZ A;  3OV7 A;  4RWO A;  1MQ3 A;  4I2C A;  5D46 A;  4X4O A;  4MFA A;  4LEV A;  1JMS A;  3HJ1 A;  3UPS A;  3H37 A;  4NM1 A;  4WOY A;  3RJG A;  5D61 A;  3WFP A;  4M04 A;  9ICI A;  4PGQ A;  4I27 A;  4QZI A;  4DOB A;  4NKU A;  4TUP A;  5DB9 A;  1ZQJ A;  4X4R A;  2B4V A;  1WOT A;  4RQ1 A;  4WH5 A;  3JPO A;  1F5A A;  4X4U A;  3JPS A;  5J0U A;  3HW8 A;  4XRH A;  4I2D A;  4RWP A;  4R63 A;  5HRI A;  5J2E A;  5DBA A;  1RPL A;  2BPF A;  4IQU A;  4NLN A;  4LEY A;  4F5N A;  4LZG A;  4QZA A;  4FO1 A;  2ZHB A;  3HJ4 A;  3RH5 A;  2FMS A;  4PHP A;  4O9M A;  5HRE A;  2FCL A;  3RJJ A;  5CJ7 A;  8ICV A;  4X0A A;  4I2I A;  4AT8 A;  2HN2 A;  7ICS A;  8ICG A;  4WBZ A;  5BOL A;  4XUS A;  2BPC A;  4R64 A;  3MBY A;  5IIL A;  4QZC A;  2GAF D;  2P66 A;  4E7X A;  1HUO A;  5J0Y A;  8ICJ A;  3V72 A;  4M9L A;  1TV9 A;  8ICY A;  1ZQG A;  7ICH A;  4UAY A;  4WC4 A;  1VFG A;  1ZQS A;  5EOZ A;  4KLJ A;  5D63 A;  4UB2 A;  9ICO A;  4I28 A;  7ICQ A;  9ICE A;  5JTG A;  7ICU A;  2IUB A;  4RT2 A;  4JWM A;  5DB6 A;  4O68 A;  8ICC A;  4OAH A;  4NXZ A;  1XSN A;  4UD4 A;  3WFO A;  2DR7 A;  4M0A A;  1KDH A;  4KLG A;  4TUS A;  3B0Y A;  3MDC A;  4M2Y A;  4UB5 A;  3RJK A;  9ICF A;  1R8B A;  4K9B A;  4QZG A;  5J0O A;  2PFN A;  8ICI A;  2ZH5 A;  5IIK A;  4N7R A;  1BPD A;  2GA9 D;  8ICZ A;  3B0X A;  1YLQ A;  4I29 A;  4M5D A;  4IG8 A;  4FHV A;  3JYY A;  4QZE A;  5J2G A;  5TZV A;  3RJE A;  1BPB A;  3ISC A;  4RPZ A;  4I2J A;  3H39 A;  5DKW A;  1MIW A;  4RQ6 A;  4WBY A;  4P4P A;  2BCS A;  4NXU A;  1PX5 A;  4O5C A;  3PMN A;  1JQR A;  1BPZ A;  4AT7 A;  4Z6C A;  5CP2 A;  4EBJ A;  4XA5 A;  1XSP A; 
#chains in the Genus database with same CATH homology
 3AU2 A;  7ICF A;  4XQ7 A;  8ICQ A;  4AT9 B;  4I2F A;  2ZH2 A;  4GXJ A;  4RQ3 A;  3OVB A;  1BPE A;  2ISP A;  4KLL A;  5HR9 A;  4KLQ A;  5HHI A;  4KLS A;  5J2C A;  1MIY A;  4F5O A;  5HC9 A;  3OUY A;  2ZH3 A;  3MGI A;  2RFF A;  3RH4 A;  4WC1 A;  9ICU A;  5DDY A;  4YN4 A;  5III A;  8ICR A;  5HRK A;  5BPC A;  4WCW A;  4AT8 B;  4RQ4 A;  5CA7 A;  4Z6E A;  1TFW A;  2Q66 A;  4RQ7 A;  4YD2 A;  4M9G A;  4DOC A;  1ZJM A;  9ICK A;  7ICM A;  5J29 A;  3L9D A;  5F2V O;  4FO6 A;  4FHX A;  7ICR A;  5HRG A;  2FMQ A;  3K75 D;  4UD5 A;  4YMN A;  4I2G A;  1UEV A;  3JPP A;  3V7L A;  4KLU A;  1TVA A;  4LT6 A;  3C66 A;  4I2B A;  1ZQO A;  4MF8 A;  4TUQ A;  5IIM A;  2DRB A;  3JPT A;  1RZT A;  4YCX A;  2NRK A;  5CB1 A;  4Z6F A;  3GDX A;  7ICN A;  1Q78 A;  4PHA A;  8ICO A;  1VJ7 A;  3RJI A;  5DED A;  4K4G A;  1ZQT A;  3C2M A;  3RJF A;  4M47 A;  3LK9 A;  4KLF A;  1ZQA A;  7ICK A;  4MF2 A;  7ICV A;  8ICL A;  3OVA A;  4ATB B;  9ICQ A;  9ICA A;  4O5K A;  2PFQ A;  5J2F A;  3UPQ A;  4RQ8 A;  4GXI A;  3AU6 A;  4X4Q A;  4RQ5 A;  4YD1 A;  1ZQM A;  2BE3 A;  4FH3 A;  4WC3 A;  4X5V A;  1R8A A;  4K4H A;  4UB1 A;  7ICJ A;  1ZQE A;  1ZQH A;  3UXO A;  4IQV A;  4M9H A;  5HHH A;  1NOM A;  2HHP A;  9ICP A;  1FA0 A;  2DRA A;  4LZD A;  3JPQ A;  1ZQQ A;  3AQK A;  5J2J A;  2ZH6 A;  5IIO A;  3AQL A;  3OUY B;  3C5G A;  4DO9 A;  5IIN A;  1ZQC A;  4UAZ A;  4E8F A;  4UBC A;  4FH5 A;  2ZH8 A;  9ICC A;  3H38 A;  4RPY A;  2ISO A;  4EBK A;  2BCV A;  5D4B A;  2BCQ A;  4QZB A;  7ICL A;  3AQM A;  4X4P A;  2ZH7 A;  9ICW A;  4WC7 A;  4EP7 A;  7ICE A;  1ZQD A;  1ZQB A;  3LQC B;  9ICB A;  4P2H A;  4P4M A;  1ZQN A;  2VAN A;  4PHE A;  5DB7 A;  8ICU A;  1ZQV A;  4UAW A;  3C5F A;  2PXI A;  4X4T A;  5CWR A;  2O5A A;  4KLH A;  4R66 A;  5HRL A;  5D49 A;  5DBB A;  8ICH A;  1ZQK A;  2W9M A;  9ICR A;  3WFS C;  2ZHA A;  3WFQ E;  4M9N A;  1TFY A;  9ICJ A;  4RWN A;  4FHY A;  4F5P A;  3UXP A;  5J0W A;  4NLZ A;  5J0Q A;  4QZH A;  4X4V A;  7ICP A;  8ICK A;  4RQ2 A;  4IQW A;  3JPR A;  4TUR A;  2PFP A;  1OU5 A;  2BCR A;  7ICT A;  4NM2 A;  8ICA A;  9ICS A;  4UB4 A;  1ZQF A;  3UXN A;  2DR8 A;  4X4N A;  1ZQU A;  1KNY A;  2M2U A;  5J2I A;  5J2A A;  4X0B A;  4XQ8 A;  3OGU A;  3RJH A;  4YMM A;  2I9G A;  4UB3 A;  8ICS A;  2DR9 A;  4KLI A;  9ICV A;  4P4O A;  2M2T A;  9ICL A;  4E80 A;  4NKT A;  2DR5 A;  4RQ0 A;  4WC6 A;  5IIJ A;  2M2W A;  1XSL A;  1ZQX A;  4O5E A;  1JAJ A;  3WFR E;  1NO5 A;  2PBE A;  1JN3 A;  3PNC A;  3HWT A;  3ISB A;  4RPX A;  9ICN A;  9ICX A;  4GXK A;  1R89 A;  4UBB A;  4RWQ A;  3V7K A;  4I2A A;  1MQ2 A;  8ICT A;  3NYB A;  3V7J A;  4AT9 A;  5BOM A;  4F5R A;  2PFO A;  4WC0 A;  5J0S A;  1HUZ A;  1ZQI A;  2BPG A;  4MFC A;  4KLO A;  4AT7 B;  4S3N A;  3AQN A;  1ZQP A;  4PPX A;  2IHM A;  4PH5 A;  7ICI A;  2ZH1 A;  1BPY A;  4M9J A;  4QZ9 A;  1ZQW A;  5J2B A;  4QZD A;  4PHD A;  3UQ2 A;  3TFS A;  1ZQL A;  4I2E A;  9ICT A;  5HRD A;  4KLM A;  8ICM A;  9ICG A;  4DOA A;  4MFF A;  3JPN A;  2ZH9 A;  1KEJ A;  4RT3 A;  5J2K A;  9ICH A;  5DEC A;  1ZJN A;  4KLD A;  1MIV A;  4PGY A;  3AUO A;  4R65 A;  3MDA A;  7ICG A;  4WC5 A;  2GWS A;  5CR0 A;  4I2H A;  5J0X A;  2ZH4 A;  5DB8 A;  3JZ0 A;  1UET A;  5DDM A;  3H3A A;  1ZQR A;  4KLE A;  8ICB A;  5J2D A;  1ZQZ A;  4PGX A;  4WC2 A;  4ATB A;  4QZF A;  5DBC A;  3UQ0 A;  4F5Q A;  8ICN A;  8ICF A;  4YMO A;  8ICX A;  3OVS A;  5HRH A;  4JWN A;  3RH6 A;  4LVS A;  4Z6D A;  2DVI A;  4X4S A;  4QZ8 A;  3HIY A;  3MGH A;  5J0P A;  7ICO A;  4NY8 A;  1ZQY A;  4FHW A;  3C2K A;  3ISD A;  1V4A A;  4NLK A;  4KLT A;  3HX0 A;  1BPX A;  4FHP A;  2M2V A;  3TFR A;  1R8C A;  5HRB A;  8ICW A;  5CHG A;  4IQT A;  8ICE A;  8ICP A;  5J0T A;  2BCU A;  2O1P A;  5HRF A;  1UEU A;  5J2H A;  2ID1 A;  3C2L A;  3C18 A;  1Q79 A;  3PML A;  5J0R A;  9ICM A;  2FMP A;  4K4I A;  3OV7 A;  4RWO A;  1MQ3 A;  4I2C A;  5D46 A;  4X4O A;  4MFA A;  1JMS A;  3HJ1 A;  3UPS A;  3H37 A;  4NM1 A;  3RJG A;  3WFP A;  4M04 A;  9ICI A;  4PGQ A;  4I27 A;  4QZI A;  4DOB A;  4NKU A;  4TUP A;  5DB9 A;  1ZQJ A;  4X4R A;  1WOT A;  4RQ1 A;  3JPO A;  1F5A A;  4X4U A;  3JPS A;  5J0U A;  3HW8 A;  4XRH A;  4I2D A;  4RWP A;  4R63 A;  5HRI A;  5J2E A;  5DBA A;  1RPL A;  2BPF A;  4IQU A;  4NLN A;  4F5N A;  4LZG A;  4QZA A;  2ZHB A;  3HJ4 A;  3RH5 A;  2FMS A;  4PHP A;  4O9M A;  5HRE A;  4X0A A;  3RJJ A;  5CJ7 A;  8ICV A;  4I2I A;  4AT8 A;  7ICS A;  8ICG A;  4WBZ A;  5BOL A;  4XUS A;  2BPC A;  4R64 A;  3MBY A;  5IIL A;  4QZC A;  2P66 A;  4E7X A;  1HUO A;  5J0Y A;  8ICJ A;  3V72 A;  4M9L A;  1TV9 A;  8ICY A;  1ZQG A;  7ICH A;  4UAY A;  4WC4 A;  1VFG A;  1ZQS A;  5EOZ A;  4KLJ A;  4UB2 A;  9ICO A;  4I28 A;  7ICQ A;  9ICE A;  7ICU A;  4RT2 A;  4JWM A;  5DB6 A;  8ICC A;  4NXZ A;  1XSN A;  4UD4 A;  3WFO A;  2DR7 A;  4M0A A;  1KDH A;  4KLG A;  4TUS A;  3B0Y A;  3MDC A;  4M2Y A;  4UB5 A;  3RJK A;  9ICF A;  1R8B A;  4QZG A;  5J0O A;  2PFN A;  8ICI A;  2ZH5 A;  5IIK A;  1BPD A;  4IG8 A;  8ICZ A;  3B0X A;  1YLQ A;  4I29 A;  4M5D A;  4FHV A;  3JYY A;  4QZE A;  5J2G A;  5TZV A;  3RJE A;  1BPB A;  3ISC A;  4RPZ A;  4I2J A;  3H39 A;  5DKW A;  1MIW A;  4RQ6 A;  4WBY A;  4P4P A;  2BCS A;  1PX5 A;  4O5C A;  3PMN A;  1JQR A;  1BPZ A;  4AT7 A;  4Z6C A;  5CP2 A;  4EBJ A;  4XA5 A;  1XSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...