2ID1A

X-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
b'MEIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVLVDAGDVVVHVMLPAVRDYYDIEALWGGQKPSFAVGAAKPWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2id1A01
5HRFA 1BPYA 4QZGA 8ICPA 1ZQLA 4QZHA 4YMNA 3L9DA 1ZQKA 1JMSA 1V4AA 2DRAA 4I2HA 3H39A 3LK9A 1BPXA 1ZQEA 8ICAA 1ZQDA 1MIWA 4WC6A 5J2DA 4RWPA 3RH4A 7ICVA 5IIJA 4K4GA 5DKWA 2ZH7A 4TUQA 4M04A 4K4IA 3RJGA 4ATBB 2ZH5A 5J2EA 4RQ0A 4LVSA 5J0OA 9ICVA 4RWQA 4X4TA 2IHMA 4KLGA 4WC5A 7ICMA 2PFQA 5BPCA 7ICQA 4F5OA 4QZ9A 3JZ0A 3C66A 5J0RA 4P2HA 3C5GA 3RH5A 8ICBA 4WC7A 3OUYB 4F5PA 1ZJMA 5DEDA 3RJKA 7ICUA 4O5KA 3OVSA 5DBAA 8ICFA 5J2HA 4UB4A 8ICOA 7ICRA 7ICJA 5CP2A 4X4VA 4UD4A 1KEJA 4FH5A 4FO6A 4IQWA 1BPDA 4WC1A 5BOLA 3AQKA 4MFFA 9ICJA 2FMSA 5J2JA 3OVBA 4F5RA 1MQ3A 4DOAA 3LQCB 3JPRA 4RQ8A 4PHDA 4R63A 3WFPA 4QZFA 4I2CA 4DOCA 9ICEA 2BPFA 9ICLA 3OGUA 3JPOA 3UXNA 4R64A 3OV7A 4YD2A 1ZQVA 4UB1A 3JYYA 4KLIA 4YD1A 3C2KA 4RQ7A 4AT9B 4I2AA 1BPBA 9ICNA 3AU2A 2BCUA 1ZQHA 1ZQMA 2ZHAA 1MIYA 1FA0A 5J0TA 4P4MA 1ZQRA 1F5AA 4X0AA 4FH3A 8ICQA 1ZQWA 3RH6A 1KDHA 3RJJA 4KLEA 4R66A 4X4UA 2ZH3A 8ICKA 4X4OA 2DR8A 5CA7A 4KLFA 4KLQA 3JPQA 2ISOA 9ICWA 8ICMA 1ZQOA 9ICIA 4GXJA 4XRHA 4IQUA 4NLNA 4I2IA 4K4HA 1Q79A 1R8BA 5HRGA 3HJ4A 5DB9A 4IQTA 4TUPA 4RWNA 5DB7A 4MF8A 4PHAA 5HRDA 4QZCA 4GXIA 3TFRA 3H38A 4X0BA 4UBBA 2PFPA 9ICMA 2BCQA 2ID1A 3AQNA 4Z6FA 3MDCA 3UPSA 7ICNA 2BE3A 2PBEA 5HHIA 4M9JA 9ICHA 3AQLA 1NO5A 4I2EA 2M2UA 5J0SA 3C2MA 2BCSA 5CHGA 3MGHA 5DB8A 4WCWA 5BOMA 3HX0A 3UQ2A 1KNYA 9ICSA 4YMMA 4F5NA 4IQVA 4KLMA 3WFRE 5D49A 1ZQSA 4AT8A 1ZQJA 2ZH8A 5DECA 4P4PA 9ICKA 1ZQTA 2PFOA 4JWMA 4UAWA 5J2FA 4X4QA 5J2AA 4DOBA 8ICTA 4KLJA 5J0XA 5HREA 1ZQIA 5HRBA 3RJFA 3JPNA 2NRKA 4EBJA 3JPSA 5IIIA 4PGYA 4UBCA 5J2IA 4KLOA 3H37A 3V7JA 4RWOA 4RPYA 2ZHBA 4QZAA 9ICPA 5D46A 8ICSA 4O9MA 3B0YA 5DBCA 9ICRA 4P4OA 1JQRA 2ZH4A 2DRBA 3HW8A 4XQ7A 4RQ3A 4PHEA 1ZQYA 5J2KA 4RQ6A 4MFAA 7ICIA 4M0AA 2DR9A 4I2GA 3MBYA 3ISBA 2GWSA 3HWTA 3UQ0A 3WFSC 8ICCA 8ICLA 4FHYA 4GXKA 1ZQCA 3RJIA 7ICPA 4EBKA 4UD5A 4M9LA 2RFFA 2Q66A 4XUSA 3GDXA 1ZQGA 9ICAA 4IG8A 4NLKA 3ISCA 4YMOA 4QZ8A 4I2JA 5HRHA 4M9GA 5J0YA 4X4RA 9ICBA 3C5FA 1TFYA 2O1PA 1XSPA 8ICWA 5HRKA 5J0PA 2BPGA 4WC4A 5J0QA 4S3NA 1R8CA 8ICYA 4Z6DA 4RQ2A 4QZDA 4I2FA 4KLTA 2ZH9A 4RQ4A 5J0UA 4KLUA 3AU6A 4FHVA 5J2BA 3UXPA 4X5VA 1RZTA 4I27A 4AT7A 4WC3A 8ICEA 1TV9A 4UB5A 4NLZA 4E7XA 1XSLA 4M47A 1UEUA 4F5QA 5HHHA 3HJ1A 2M2WA 7ICHA 8ICGA 2PFNA 5CJ7A 9ICGA 4I2DA 5CR0A 5CB1A 4LZDA 1OU5A 7ICSA 7ICOA 4X4NA 4DO9A 4AT8B 4E80A 5HC9A 4NKTA 2I9GA 1WOTA 7ICTA 4O5EA 3TFSA 5IINA 5DB6A 3V7KA 2M2TA 1TFWA 1YLQA 9ICUA 9ICCA 4X4SA 4Z6EA 1BPZA 4LZGA 1JAJA 4I28A 4RPZA 4WC2A 2ZH2A 3PNCA 1UETA 5EOZA 3PMLA 4E8FA 5HR9A 2O5AA 9ICFA 8ICJA 3NYBA 4UAYA 3V72A 8ICRA 3UXOA 4RT2A 4QZEA 1NOMA 1ZQFA 3MGIA 3AUOA 1VFGA 4WBZA 8ICIA 1PX5A 9ICXA 3RJEA 1Q78A 4M9NA 4PGQA 4WC0A 3ISDA 3C18A 4XQ8A 5DBBA 5CWRA 1BPEA 9ICQA 2BCVA 4QZBA 1HUZA 4Z6CA 3HIYA 5D4BA 5HRIA 2HHPA 4M9HA 5DDYA 4R65A 8ICUA 9ICOA 5TZVA 1ZJNA 2W9MA 4RQ5A 2BCRA 2P66A 8ICNA 5DDMA 4QZIA 2BPCA 4YN4A 4UAZA 4RPXA 3C2LA 4ATBA 4PGXA 5F2VO 5IILA 1ZQZA 5IIOA 4XA5A 1UEVA 1ZQAA 4MFCA 1ZQQA 9ICTA 4NM2A 7ICGA 5J2CA 1MIVA 3UPQA 4TURA 7ICLA 4RT3A 4AT7B 4RQ1A 2PXIA 4FHXA 4O5CA 3PMNA 3B0XA 2M2VA 1JN3A 4KLDA 4EP7A 3OUYA 8ICZA 5J2GA 8ICHA 4UB3A 4M5DA 1MQ2A 2ZH1A 2FMPA 4NXZA 4JWNA 7ICKA 1R8AA 3AQMA 4NKUA 4NY8A 4X4PA 1VJ7A 4PHPA 3JPPA 4FHWA 3JPTA 2VANA 4YCXA 3RJHA 1XSNA 3WFQE 4M2YA 3H3AA 1ZQXA 5IIKA 7ICFA 4WBYA 1HUOA 4LT6A 4I2BA 1R89A 1ZQUA 8ICXA 3V7LA 4KLSA 5J0WA 4MF2A 8ICVA 4PH5A 7ICEA 4PPXA 1ZQBA 2ZH6A 4I29A 2ISPA 4AT9A 2FMQA 5IIMA 5HRLA 4UB2A 4KLLA 2DR7A 5J29A 4KLHA 1RPLA 3K75D 2DVIA 1ZQPA 1ZQNA 4TUSA 4NM1A 3MDAA 3OVAA 4FHPA 2DR5A 3WFOA 1TVAA
chains in the Genus database with same CATH superfamily
5HRFA 2GA9D 5D63A 1BPYA 4QZGA 8ICPA 1ZQLA 4QZHA 4YMNA 3L9DA 1ZQKA 2GAFD 1JMSA 1V4AA 2DRAA 4I2HA 3H39A 3LK9A 1BPXA 1ZQEA 8ICAA 1ZQDA 1MIWA 4WC6A 4OAIZ 5J2DA 4RWPA 3RH4A 7ICVA 5IIJA 4K4GA 5DKWA 2ZH7A 4TUQA 4M04A 4K4IA 3CK6A 3RJGA 4ATBB 2ZH5A 3MCRA 5J2EA 4RQ0A 4LVSA 5J0OA 9ICVA 4RWQA 4X4TA 2IHMA 4KLGA 4WC5A 4KB6A 4K98A 7ICMA 2PFQA 5BPCA 7ICQA 4F5OA 4QZ9A 2HN1A 3JZ0A 3C66A 4JLXA 5J0RA 4P2HA 3C5GA 3RH5A 8ICBA 4WC7A 3OUYB 4F5PA 1ZJMA 5DEDA 3RJKA 7ICUA 4O5KA 3OVSA 4LEWA 5DBAA 8ICFA 5J2HA 4UB4A 8ICOA 7ICRA 7ICJA 5CP2A 4X4VA 4UD4A 1KEJA 4FH5A 4FO6A 4IQWA 2EWRA 1BPDA 4WC1A 5BOLA 3AQKA 4MFFA 9ICJA 2FMSA 5J2JA 3OVBA 4F5RA 1MQ3A 4DOAA 3LQCB 3JPRA 4RQ8A 4PHDA 4R63A 3WFPA 4QZFA 4I2CA 4DOCA 9ICEA 2BPFA 2FCLA 3OGUA 9ICLA 3JPOA 3UXNA 4R64A 3OV7A 4YD2A 1ZQVA 4UB1A 3JYYA 4KLIA 4YD1A 3C2KA 4NXXA 4RQ7A 4AT9B 4I2AA 1BPBA 9ICNA 3AU2A 2BCUA 1ZQHA 1ZQMA 2ZHAA 1MIYA 3EF2A 1FA0A 5J0TA 4P4MA 1ZQRA 1F5AA 4EGWA 4X0AA 4FH3A 8ICQA 1ZQWA 3OWGA 3RH6A 1KDHA 3RJJA 4KLEA 4NXUA 4R66A 4X4UA 2ZH3A 8ICKA 4MKPA 4X4OA 2DR8A 5CA7A 4KLFA 4KLQA 3JPQA 2ISOA 9ICWA 8ICMA 1ZQOA 9ICIA 4GXJA 4XRHA 4IQUA 4NLNA 4I2IA 4EEDA 4K4HA 4FO1A 1Q79A 1R8BA 5HRGA 3HJ4A 5DB9A 4IQTA 4TUPA 2BBJA 4RWNA 5DB7A 4MF8A 4WQLA 4PHAA 5HRDA 4QZCA 4GXIA 3TFRA 4JLZA 3H38A 4X0BA 4UBBA 2PFPA 2IHOA 9ICMA 2BCQA 2ID1A 3AQNA 4Z6FA 3MDCA 3UPSA 7ICNA 2BE3A 2PBEA 5HHIA 4M9JA 9ICHA 3AQLA 1NO5A 4I2EA 2M2UA 5J0SA 3C2MA 2BCSA 5CHGA 3MGHA 5DB8A 4WCWA 5BOMA 3HX0A 3UQ2A 1KNYA 9ICSA 4YMMA 4F5NA 4IQVA 4KLMA 3WFRE 5D49A 1ZQSA 4AT8A 1ZQJA 2ZH8A 5DECA 4P4PA 9ICKA 1ZQTA 2PFOA 4JWMA 4UAWA 5J2FA 4I0UA 4X4QA 5J2AA 4DOBA 8ICTA 4KLJA 5J0XA 5HREA 1ZQIA 5HRBA 3RJFA 3PHZA 5CFTA 3JPNA 2NRKA 4EBJA 3JPSA 4EEBA 5IIIA 4PGYA 4UBCA 5J2IA 4KLOA 3H37A 3V7JA 4RWOA 4RPYA 4O68A 4QZAA 2ZHBA 9ICPA 5D46A 3JCFA 4O69A 8ICSA 4O9MA 3B0YA 5DBCA 9ICRA 4N7RA 4P4OA 4K9BA 1JQRA 2ZH4A 2DRBA 3HW8A 4XQ7A 4K99A 4RQ3A 4PHEA 1ZQYA 5J2KA 4RQ6A 4MFAA 7ICIA 4M0AA 2DR9A 4NXVA 4I2GA 3MBYA 2B51A 3ISBA 2GWSA 3HWTA 3UQ0A 3ER8C 3WFSC 8ICCA 8ICLA 4FHYA 4GXKA 2HN2A 3RJIA 1ZQCA 7ICPA 4EBKA 4UD5A 4NXTA 4M9LA 2RFFA 2Q66A 4XUSA 3GDXA 1ZQGA 9ICAA 4IG8A 4O67A 4NLKA 3ISCA 4YMOA 4QZ8A 4I2JA 5HRHA 4M9GA 4LEVA 5J0YA 4X4RA 9ICBA 3C5FA 1TFYA 4OAGA 2O1PA 1XSPA 3ER9B 8ICWA 5HRKA 5J0PA 2BPGA 4WC4A 5J0QA 4S3NA 1R8CA 3NVOA 8ICYA 4WH5A 4Z6DA 4RQ2A 4QZDA 4I2FA 4KLTA 2ZH9A 4RQ4A 5J0UA 4KLUA 3AU6A 4FHVA 4KM5A 5J2BA 4NXWA 4LEZA 3UXPA 4X5VA 1RZTA 4I27A 4AT7A 4WC3A 8ICEA 1TV9A 4UB5A 4NLZA 4E7XA 1XSLA 4M47A 1UEUA 4F5QA 5HHHA 3HJ1A 2M2WA 7ICHA 8ICGA 2PFNA 5CJ7A 9ICGA 3ERCC 4I2DA 2IUBA 5CR0A 5CB1A 4LZDA 1OU5A 7ICSA 7ICOA 4X4NA 4DO9A 4AT8B 4E80A 4K9AA 5HC9A 4NKTA 2B56A 2I9GA 1WOTA 7ICTA 4O5EA 5JTGA 3TFSA 5IINA 5DB6A 3V7KA 2M2TA 1TFWA 1YLQA 9ICUA 4WQKA 9ICCA 4X4SA 4Z6EA 4WOYA 1BPZA 5D61A 4LZGA 1JAJA 4XJEA 4I28A 4RPZA 4WC2A 2ZH2A 3PNCA 1UETA 4O6AA 5EOZA 3PMLA 4E8FA 5HR9A 2O5AA 4HX0A 9ICFA 8ICJA 3NYBA 4UAYA 3V72A 8ICRA 3UXOA 4RT2A 4QZEA 1NOMA 1ZQFA 3MGIA 3AUOA 1VFGA 4WBZA 8ICIA 1PX5A 9ICXA 5CHEA 3RJEA 1Q78A 4M9NA 4PGQA 4WC0A 3ISDA 3C18A 4XQ8A 5DBBA 5CWRA 1BPEA 9ICQA 2BCVA 4QZBA 1HUZA 4Z6CA 3HIYA 5D4BA 5CFUA 5HRIA 2HHPA 4M9HA 5DDYA 4R65A 4LEYA 8ICUA 9ICOA 5B3PA 5TZVA 1ZJNA 2W9MA 4RQ5A 2BCRA 2P66A 8ICNA 3NWIA 5DDMA 4QZIA 2BPCA 4YN4A 4UAZA 4RPXA 3C2LA 4ATBA 4PGXA 5F2VO 5IILA 1ZQZA 5IIOA 4XA5A 1UEVA 1ZQAA 5CFSA 4MFCA 1ZQQA 9ICTA 4NM2A 7ICGA 4EV6A 5J2CA 1MIVA 3UPQA 4OAHA 4TURA 7ICLA 4RT3A 4AT7B 3NKUA 4RQ1A 2PXIA 4FHXA 4OAFA 4O5CA 3PMNA 3B0XA 2M2VA 1JN3A 4KLDA 4EP7A 3OUYA 8ICZA 5J2GA 8ICHA 4UB3A 4M5DA 1MQ2A 2ZH1A 2FMPA 4NXZA 4JWNA 7ICKA 1R8AA 3AQMA 5D62A 4NKUA 4NY8A 4X4PA 1VJ7A 4PHPA 3JPPA 4FHWA 3JPTA 2VANA 4YCXA 3RJHA 1XSNA 3WFQE 4M2YA 3H3AA 1ZQXA 5IIKA 7ICFA 4WBYA 1HUOA 4LT6A 4I2BA 1R89A 1ZQUA 8ICXA 3V7LA 5B3QA 4KLSA 5J0WA 4MF2A 3K7DA 8ICVA 4PH5A 7ICEA 4PPXA 2B4VA 1ZQBA 2ZH6A 4I29A 2ISPA 4AT9A 2FMQA 5IIMA 5HRLA 4UB2A 4KLLA 2BBHA 2DR7A 5J29A 4KLHA 1RPLA 3K75D 2DVIA 1ZQPA 1ZQNA 4K97A 4TUSA 4K8VA 1GPJA 4NM1A 3MDAA 3OVAA 4FHPA 4K96A 2DR5A 3WFOA 1TVAA
chains in the Genus database with same CATH topology
5HRFA 1BPYA 4QZGA 8ICPA 1ZQLA 4QZHA 4YMNA 3L9DA 1ZQKA 1JMSA 1V4AA 2DRAA 4I2HA 3H39A 3LK9A 1BPXA 1ZQEA 8ICAA 1ZQDA 1MIWA 4WC6A 5J2DA 4RWPA 3RH4A 7ICVA 5IIJA 4K4GA 5DKWA 2ZH7A 4TUQA 4M04A 4K4IA 3RJGA 4ATBB 2ZH5A 5J2EA 4RQ0A 4LVSA 5J0OA 9ICVA 4RWQA 4X4TA 2IHMA 4KLGA 4WC5A 7ICMA 2PFQA 5BPCA 7ICQA 4F5OA 4QZ9A 3JZ0A 3C66A 5J0RA 4P2HA 3C5GA 3RH5A 8ICBA 4WC7A 3OUYB 4F5PA 1ZJMA 5DEDA 3RJKA 7ICUA 4O5KA 3OVSA 5DBAA 8ICFA 5J2HA 4UB4A 8ICOA 7ICRA 7ICJA 5CP2A 4X4VA 4UD4A 1KEJA 4FH5A 4FO6A 4IQWA 1BPDA 4WC1A 5BOLA 3AQKA 4MFFA 9ICJA 2FMSA 5J2JA 3OVBA 4F5RA 1MQ3A 4DOAA 3LQCB 3JPRA 4RQ8A 4PHDA 4R63A 3WFPA 4QZFA 4I2CA 4DOCA 9ICEA 2BPFA 9ICLA 3OGUA 3JPOA 3UXNA 4R64A 3OV7A 4YD2A 1ZQVA 4UB1A 3JYYA 4KLIA 4YD1A 3C2KA 4RQ7A 4AT9B 4I2AA 1BPBA 9ICNA 3AU2A 2BCUA 1ZQHA 1ZQMA 2ZHAA 1MIYA 1FA0A 5J0TA 4P4MA 1ZQRA 1F5AA 4X0AA 4FH3A 8ICQA 1ZQWA 3RH6A 1KDHA 3RJJA 4KLEA 4R66A 4X4UA 2ZH3A 8ICKA 4X4OA 2DR8A 5CA7A 4KLFA 4KLQA 3JPQA 2ISOA 9ICWA 8ICMA 1ZQOA 9ICIA 4GXJA 4XRHA 4IQUA 4NLNA 4I2IA 4K4HA 1Q79A 1R8BA 5HRGA 3HJ4A 5DB9A 4IQTA 4TUPA 4RWNA 5DB7A 4MF8A 4PHAA 5HRDA 4QZCA 4GXIA 3TFRA 3H38A 4X0BA 4UBBA 2PFPA 9ICMA 2BCQA 2ID1A 3AQNA 4Z6FA 3MDCA 3UPSA 7ICNA 2BE3A 2PBEA 5HHIA 4M9JA 9ICHA 3AQLA 1NO5A 4I2EA 2M2UA 5J0SA 3C2MA 2BCSA 5CHGA 3MGHA 5DB8A 4WCWA 5BOMA 3HX0A 3UQ2A 1KNYA 9ICSA 4YMMA 4F5NA 4IQVA 4KLMA 3WFRE 5D49A 1ZQSA 4AT8A 1ZQJA 2ZH8A 5DECA 4P4PA 9ICKA 1ZQTA 2PFOA 4JWMA 4UAWA 5J2FA 4X4QA 5J2AA 4DOBA 8ICTA 4KLJA 5J0XA 5HREA 1ZQIA 5HRBA 3RJFA 3JPNA 2NRKA 4EBJA 3JPSA 5IIIA 4PGYA 4UBCA 5J2IA 4KLOA 3H37A 3V7JA 4RWOA 4RPYA 2ZHBA 4QZAA 9ICPA 5D46A 8ICSA 4O9MA 3B0YA 5DBCA 9ICRA 4P4OA 1JQRA 2ZH4A 2DRBA 3HW8A 4XQ7A 4RQ3A 4PHEA 1ZQYA 5J2KA 4RQ6A 4MFAA 7ICIA 4M0AA 2DR9A 4I2GA 3MBYA 3ISBA 2GWSA 3HWTA 3UQ0A 3WFSC 8ICCA 8ICLA 4FHYA 4GXKA 1ZQCA 3RJIA 7ICPA 4EBKA 4UD5A 4M9LA 2RFFA 2Q66A 4XUSA 3GDXA 1ZQGA 9ICAA 4IG8A 4NLKA 3ISCA 4YMOA 4QZ8A 4I2JA 5HRHA 4M9GA 5J0YA 4X4RA 9ICBA 3C5FA 1TFYA 2O1PA 1XSPA 8ICWA 5HRKA 5J0PA 2BPGA 4WC4A 5J0QA 4S3NA 1R8CA 8ICYA 4Z6DA 4RQ2A 4QZDA 4I2FA 4KLTA 2ZH9A 4RQ4A 5J0UA 4KLUA 3AU6A 4FHVA 5J2BA 3UXPA 4X5VA 1RZTA 4I27A 4AT7A 4WC3A 8ICEA 1TV9A 4UB5A 4NLZA 4E7XA 1XSLA 4M47A 1UEUA 4F5QA 5HHHA 3HJ1A 2M2WA 7ICHA 8ICGA 2PFNA 5CJ7A 9ICGA 4I2DA 5CR0A 5CB1A 4LZDA 1OU5A 7ICSA 7ICOA 4X4NA 4DO9A 4AT8B 4E80A 5HC9A 4NKTA 2I9GA 1WOTA 7ICTA 4O5EA 3TFSA 5IINA 5DB6A 3V7KA 2M2TA 1TFWA 1YLQA 9ICUA 9ICCA 4X4SA 4Z6EA 1BPZA 4LZGA 1JAJA 4I28A 4RPZA 4WC2A 2ZH2A 3PNCA 1UETA 5EOZA 3PMLA 4E8FA 5HR9A 2O5AA 9ICFA 8ICJA 3NYBA 4UAYA 3V72A 8ICRA 3UXOA 4RT2A 4QZEA 1NOMA 1ZQFA 3MGIA 3AUOA 1VFGA 4WBZA 8ICIA 1PX5A 9ICXA 3RJEA 1Q78A 4M9NA 4PGQA 4WC0A 3ISDA 3C18A 4XQ8A 5DBBA 5CWRA 1BPEA 9ICQA 2BCVA 4QZBA 1HUZA 4Z6CA 3HIYA 5D4BA 5HRIA 2HHPA 4M9HA 5DDYA 4R65A 8ICUA 9ICOA 5TZVA 1ZJNA 2W9MA 4RQ5A 2BCRA 2P66A 8ICNA 5DDMA 4QZIA 2BPCA 4YN4A 4UAZA 4RPXA 3C2LA 4ATBA 4PGXA 5F2VO 5IILA 1ZQZA 5IIOA 4XA5A 1UEVA 1ZQAA 4MFCA 1ZQQA 9ICTA 4NM2A 7ICGA 5J2CA 1MIVA 3UPQA 4TURA 7ICLA 4RT3A 4AT7B 4RQ1A 2PXIA 4FHXA 4O5CA 3PMNA 3B0XA 2M2VA 1JN3A 4KLDA 4EP7A 3OUYA 8ICZA 5J2GA 8ICHA 4UB3A 4M5DA 1MQ2A 2ZH1A 2FMPA 4NXZA 4JWNA 7ICKA 1R8AA 3AQMA 4NKUA 4NY8A 4X4PA 1VJ7A 4PHPA 3JPPA 4FHWA 3JPTA 2VANA 4YCXA 3RJHA 1XSNA 3WFQE 4M2YA 3H3AA 1ZQXA 5IIKA 7ICFA 4WBYA 1HUOA 4LT6A 4I2BA 1R89A 1ZQUA 8ICXA 3V7LA 4KLSA 5J0WA 4MF2A 8ICVA 4PH5A 7ICEA 4PPXA 1ZQBA 2ZH6A 4I29A 2ISPA 4AT9A 2FMQA 5IIMA 5HRLA 4UB2A 4KLLA 2DR7A 5J29A 4KLHA 1RPLA 3K75D 2DVIA 1ZQPA 1ZQNA 4TUSA 4NM1A 3MDAA 3OVAA 4FHPA 2DR5A 3WFOA 1TVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRF A;  1BPY A;  4QZG A;  8ICP A;  1ZQL A;  4QZH A;  4YMN A;  3L9D A;  1ZQK A;  1JMS A;  1V4A A;  2DRA A;  4I2H A;  3H39 A;  3LK9 A;  1BPX A;  1ZQE A;  8ICA A;  1ZQD A;  1MIW A;  4WC6 A;  5J2D A;  4RWP A;  3RH4 A;  7ICV A;  5IIJ A;  4K4G A;  5DKW A;  2ZH7 A;  4TUQ A;  4M04 A;  4K4I A;  3RJG A;  4ATB B;  2ZH5 A;  5J2E A;  4RQ0 A;  4LVS A;  5J0O A;  9ICV A;  4RWQ A;  4X4T A;  2IHM A;  4KLG A;  4WC5 A;  7ICM A;  2PFQ A;  5BPC A;  7ICQ A;  4F5O A;  4QZ9 A;  3JZ0 A;  3C66 A;  5J0R A;  4P2H A;  3C5G A;  3RH5 A;  8ICB A;  4WC7 A;  3OUY B;  4F5P A;  1ZJM A;  5DED A;  3RJK A;  7ICU A;  4O5K A;  3OVS A;  5DBA A;  8ICF A;  5J2H A;  4UB4 A;  8ICO A;  7ICR A;  7ICJ A;  5CP2 A;  4X4V A;  4UD4 A;  1KEJ A;  4FH5 A;  4FO6 A;  4IQW A;  1BPD A;  4WC1 A;  5BOL A;  3AQK A;  4MFF A;  9ICJ A;  2FMS A;  5J2J A;  3OVB A;  4F5R A;  1MQ3 A;  4DOA A;  3LQC B;  3JPR A;  4RQ8 A;  4PHD A;  4R63 A;  3WFP A;  4QZF A;  4I2C A;  4DOC A;  9ICE A;  2BPF A;  9ICL A;  3OGU A;  3JPO A;  3UXN A;  4R64 A;  3OV7 A;  4YD2 A;  1ZQV A;  4UB1 A;  3JYY A;  4KLI A;  4YD1 A;  3C2K A;  4RQ7 A;  4AT9 B;  4I2A A;  1BPB A;  9ICN A;  3AU2 A;  2BCU A;  1ZQH A;  1ZQM A;  2ZHA A;  1MIY A;  1FA0 A;  5J0T A;  4P4M A;  1ZQR A;  1F5A A;  4X0A A;  4FH3 A;  8ICQ A;  1ZQW A;  3RH6 A;  1KDH A;  3RJJ A;  4KLE A;  4R66 A;  4X4U A;  2ZH3 A;  8ICK A;  4X4O A;  2DR8 A;  5CA7 A;  4KLF A;  4KLQ A;  3JPQ A;  2ISO A;  9ICW A;  8ICM A;  1ZQO A;  9ICI A;  4GXJ A;  4XRH A;  4IQU A;  4NLN A;  4I2I A;  4K4H A;  1Q79 A;  1R8B A;  5HRG A;  3HJ4 A;  5DB9 A;  4IQT A;  4TUP A;  4RWN A;  5DB7 A;  4MF8 A;  4PHA A;  5HRD A;  4QZC A;  4GXI A;  3TFR A;  3H38 A;  4X0B A;  4UBB A;  2PFP A;  9ICM A;  2BCQ A;  2ID1 A;  3AQN A;  4Z6F A;  3MDC A;  3UPS A;  7ICN A;  2BE3 A;  2PBE A;  5HHI A;  4M9J A;  9ICH A;  3AQL A;  1NO5 A;  4I2E A;  2M2U A;  5J0S A;  3C2M A;  2BCS A;  5CHG A;  3MGH A;  5DB8 A;  4WCW A;  5BOM A;  3HX0 A;  3UQ2 A;  1KNY A;  9ICS A;  4YMM A;  4F5N A;  4IQV A;  4KLM A;  3WFR E;  5D49 A;  1ZQS A;  4AT8 A;  1ZQJ A;  2ZH8 A;  5DEC A;  4P4P A;  9ICK A;  1ZQT A;  2PFO A;  4JWM A;  4UAW A;  5J2F A;  4X4Q A;  5J2A A;  4DOB A;  8ICT A;  4KLJ A;  5J0X A;  5HRE A;  1ZQI A;  5HRB A;  3RJF A;  3JPN A;  2NRK A;  4EBJ A;  3JPS A;  5III A;  4PGY A;  4UBC A;  5J2I A;  4KLO A;  3H37 A;  3V7J A;  4RWO A;  4RPY A;  2ZHB A;  4QZA A;  9ICP A;  5D46 A;  8ICS A;  4O9M A;  3B0Y A;  5DBC A;  9ICR A;  4P4O A;  1JQR A;  2ZH4 A;  2DRB A;  3HW8 A;  4XQ7 A;  4RQ3 A;  4PHE A;  1ZQY A;  5J2K A;  4RQ6 A;  4MFA A;  7ICI A;  4M0A A;  2DR9 A;  4I2G A;  3MBY A;  3ISB A;  2GWS A;  3HWT A;  3UQ0 A;  3WFS C;  8ICC A;  8ICL A;  4FHY A;  4GXK A;  1ZQC A;  3RJI A;  7ICP A;  4EBK A;  4UD5 A;  4M9L A;  2RFF A;  2Q66 A;  4XUS A;  3GDX A;  1ZQG A;  9ICA A;  4IG8 A;  4NLK A;  3ISC A;  4YMO A;  4QZ8 A;  4I2J A;  5HRH A;  4M9G A;  5J0Y A;  4X4R A;  9ICB A;  3C5F A;  1TFY A;  2O1P A;  1XSP A;  8ICW A;  5HRK A;  5J0P A;  2BPG A;  4WC4 A;  5J0Q A;  4S3N A;  1R8C A;  8ICY A;  4Z6D A;  4RQ2 A;  4QZD A;  4I2F A;  4KLT A;  2ZH9 A;  4RQ4 A;  5J0U A;  4KLU A;  3AU6 A;  4FHV A;  5J2B A;  3UXP A;  4X5V A;  1RZT A;  4I27 A;  4AT7 A;  4WC3 A;  8ICE A;  1TV9 A;  4UB5 A;  4NLZ A;  4E7X A;  1XSL A;  4M47 A;  1UEU A;  4F5Q A;  5HHH A;  3HJ1 A;  2M2W A;  7ICH A;  8ICG A;  2PFN A;  5CJ7 A;  9ICG A;  4I2D A;  5CR0 A;  5CB1 A;  4LZD A;  1OU5 A;  7ICS A;  7ICO A;  4X4N A;  4DO9 A;  4AT8 B;  4E80 A;  5HC9 A;  4NKT A;  2I9G A;  1WOT A;  7ICT A;  4O5E A;  3TFS A;  5IIN A;  5DB6 A;  3V7K A;  2M2T A;  1TFW A;  1YLQ A;  9ICU A;  9ICC A;  4X4S A;  4Z6E A;  1BPZ A;  4LZG A;  1JAJ A;  4I28 A;  4RPZ A;  4WC2 A;  2ZH2 A;  3PNC A;  1UET A;  5EOZ A;  3PML A;  4E8F A;  5HR9 A;  2O5A A;  9ICF A;  8ICJ A;  3NYB A;  4UAY A;  3V72 A;  8ICR A;  3UXO A;  4RT2 A;  4QZE A;  1NOM A;  1ZQF A;  3MGI A;  3AUO A;  1VFG A;  4WBZ A;  8ICI A;  1PX5 A;  9ICX A;  3RJE A;  1Q78 A;  4M9N A;  4PGQ A;  4WC0 A;  3ISD A;  3C18 A;  4XQ8 A;  5DBB A;  5CWR A;  1BPE A;  9ICQ A;  2BCV A;  4QZB A;  1HUZ A;  4Z6C A;  3HIY A;  5D4B A;  5HRI A;  2HHP A;  4M9H A;  5DDY A;  4R65 A;  8ICU A;  9ICO A;  5TZV A;  1ZJN A;  2W9M A;  4RQ5 A;  2BCR A;  2P66 A;  8ICN A;  5DDM A;  4QZI A;  2BPC A;  4YN4 A;  4UAZ A;  4RPX A;  3C2L A;  4ATB A;  4PGX A;  5F2V O;  5IIL A;  1ZQZ A;  5IIO A;  4XA5 A;  1UEV A;  1ZQA A;  4MFC A;  1ZQQ A;  9ICT A;  4NM2 A;  7ICG A;  5J2C A;  1MIV A;  3UPQ A;  4TUR A;  7ICL A;  4RT3 A;  4AT7 B;  4RQ1 A;  2PXI A;  4FHX A;  4O5C A;  3PMN A;  3B0X A;  2M2V A;  1JN3 A;  4KLD A;  4EP7 A;  3OUY A;  8ICZ A;  5J2G A;  8ICH A;  4UB3 A;  4M5D A;  1MQ2 A;  2ZH1 A;  2FMP A;  4NXZ A;  4JWN A;  7ICK A;  1R8A A;  3AQM A;  4NKU A;  4NY8 A;  4X4P A;  1VJ7 A;  4PHP A;  3JPP A;  4FHW A;  3JPT A;  2VAN A;  4YCX A;  3RJH A;  1XSN A;  3WFQ E;  4M2Y A;  3H3A A;  1ZQX A;  5IIK A;  7ICF A;  4WBY A;  1HUO A;  4LT6 A;  4I2B A;  1R89 A;  1ZQU A;  8ICX A;  3V7L A;  4KLS A;  5J0W A;  4MF2 A;  8ICV A;  4PH5 A;  7ICE A;  4PPX A;  1ZQB A;  2ZH6 A;  4I29 A;  2ISP A;  4AT9 A;  2FMQ A;  5IIM A;  5HRL A;  4UB2 A;  4KLL A;  2DR7 A;  5J29 A;  4KLH A;  1RPL A;  3K75 D;  2DVI A;  1ZQP A;  1ZQN A;  4TUS A;  4NM1 A;  3MDA A;  3OVA A;  4FHP A;  2DR5 A;  3WFO A;  1TVA A; 
#chains in the Genus database with same CATH topology
 5HRF A;  2GA9 D;  5D63 A;  1BPY A;  4QZG A;  8ICP A;  1ZQL A;  4QZH A;  4YMN A;  3L9D A;  1ZQK A;  2GAF D;  1JMS A;  1V4A A;  2DRA A;  4I2H A;  3H39 A;  3LK9 A;  1BPX A;  1ZQE A;  8ICA A;  1ZQD A;  1MIW A;  4WC6 A;  4OAI Z;  5J2D A;  4RWP A;  3RH4 A;  7ICV A;  5IIJ A;  4K4G A;  5DKW A;  2ZH7 A;  4TUQ A;  4M04 A;  4K4I A;  3CK6 A;  3RJG A;  4ATB B;  2ZH5 A;  3MCR A;  5J2E A;  4RQ0 A;  4LVS A;  5J0O A;  9ICV A;  4RWQ A;  4X4T A;  2IHM A;  4KLG A;  4WC5 A;  4KB6 A;  4K98 A;  7ICM A;  2PFQ A;  5BPC A;  7ICQ A;  4F5O A;  4QZ9 A;  2HN1 A;  3JZ0 A;  3C66 A;  4JLX A;  5J0R A;  4P2H A;  3C5G A;  3RH5 A;  8ICB A;  4WC7 A;  3OUY B;  4F5P A;  1ZJM A;  5DED A;  3RJK A;  7ICU A;  4O5K A;  3OVS A;  4LEW A;  5DBA A;  8ICF A;  5J2H A;  4UB4 A;  8ICO A;  7ICR A;  7ICJ A;  5CP2 A;  4X4V A;  4UD4 A;  1KEJ A;  4FH5 A;  4FO6 A;  4IQW A;  2EWR A;  1BPD A;  4WC1 A;  5BOL A;  3AQK A;  4MFF A;  9ICJ A;  2FMS A;  5J2J A;  3OVB A;  4F5R A;  1MQ3 A;  4DOA A;  3LQC B;  3JPR A;  4RQ8 A;  4PHD A;  4R63 A;  3WFP A;  4QZF A;  4I2C A;  4DOC A;  9ICE A;  2BPF A;  2FCL A;  3OGU A;  9ICL A;  3JPO A;  3UXN A;  4R64 A;  3OV7 A;  4YD2 A;  1ZQV A;  4UB1 A;  3JYY A;  4KLI A;  4YD1 A;  3C2K A;  4NXX A;  4RQ7 A;  4AT9 B;  4I2A A;  1BPB A;  9ICN A;  3AU2 A;  2BCU A;  1ZQH A;  1ZQM A;  2ZHA A;  1MIY A;  3EF2 A;  1FA0 A;  5J0T A;  4P4M A;  1ZQR A;  1F5A A;  4EGW A;  4X0A A;  4FH3 A;  8ICQ A;  1ZQW A;  3OWG A;  3RH6 A;  1KDH A;  3RJJ A;  4KLE A;  4NXU A;  4R66 A;  4X4U A;  2ZH3 A;  8ICK A;  4MKP A;  4X4O A;  2DR8 A;  5CA7 A;  4KLF A;  4KLQ A;  3JPQ A;  2ISO A;  9ICW A;  8ICM A;  1ZQO A;  9ICI A;  4GXJ A;  4XRH A;  4IQU A;  4NLN A;  4I2I A;  4EED A;  4K4H A;  4FO1 A;  1Q79 A;  1R8B A;  5HRG A;  3HJ4 A;  5DB9 A;  4IQT A;  4TUP A;  2BBJ A;  4RWN A;  5DB7 A;  4MF8 A;  4WQL A;  4PHA A;  5HRD A;  4QZC A;  4GXI A;  3TFR A;  4JLZ A;  3H38 A;  4X0B A;  4UBB A;  2PFP A;  2IHO A;  9ICM A;  2BCQ A;  2ID1 A;  3AQN A;  4Z6F A;  3MDC A;  3UPS A;  7ICN A;  2BE3 A;  2PBE A;  5HHI A;  4M9J A;  9ICH A;  3AQL A;  1NO5 A;  4I2E A;  2M2U A;  5J0S A;  3C2M A;  2BCS A;  5CHG A;  3MGH A;  5DB8 A;  4WCW A;  5BOM A;  3HX0 A;  3UQ2 A;  1KNY A;  9ICS A;  4YMM A;  4F5N A;  4IQV A;  4KLM A;  3WFR E;  5D49 A;  1ZQS A;  4AT8 A;  1ZQJ A;  2ZH8 A;  5DEC A;  4P4P A;  9ICK A;  1ZQT A;  2PFO A;  4JWM A;  4UAW A;  5J2F A;  4I0U A;  4X4Q A;  5J2A A;  4DOB A;  8ICT A;  4KLJ A;  5J0X A;  5HRE A;  1ZQI A;  5HRB A;  3RJF A;  3PHZ A;  5CFT A;  3JPN A;  2NRK A;  4EBJ A;  3JPS A;  4EEB A;  5III A;  4PGY A;  4UBC A;  5J2I A;  4KLO A;  3H37 A;  3V7J A;  4RWO A;  4RPY A;  4O68 A;  4QZA A;  2ZHB A;  9ICP A;  5D46 A;  3JCF A;  4O69 A;  8ICS A;  4O9M A;  3B0Y A;  5DBC A;  9ICR A;  4N7R A;  4P4O A;  4K9B A;  1JQR A;  2ZH4 A;  2DRB A;  3HW8 A;  4XQ7 A;  4K99 A;  4RQ3 A;  4PHE A;  1ZQY A;  5J2K A;  4RQ6 A;  4MFA A;  7ICI A;  4M0A A;  2DR9 A;  4NXV A;  4I2G A;  3MBY A;  2B51 A;  3ISB A;  2GWS A;  3HWT A;  3UQ0 A;  3ER8 C;  3WFS C;  8ICC A;  8ICL A;  4FHY A;  4GXK A;  2HN2 A;  3RJI A;  1ZQC A;  7ICP A;  4EBK A;  4UD5 A;  4NXT A;  4M9L A;  2RFF A;  2Q66 A;  4XUS A;  3GDX A;  1ZQG A;  9ICA A;  4IG8 A;  4O67 A;  4NLK A;  3ISC A;  4YMO A;  4QZ8 A;  4I2J A;  5HRH A;  4M9G A;  4LEV A;  5J0Y A;  4X4R A;  9ICB A;  3C5F A;  1TFY A;  4OAG A;  2O1P A;  1XSP A;  3ER9 B;  8ICW A;  5HRK A;  5J0P A;  2BPG A;  4WC4 A;  5J0Q A;  4S3N A;  1R8C A;  3NVO A;  8ICY A;  4WH5 A;  4Z6D A;  4RQ2 A;  4QZD A;  4I2F A;  4KLT A;  2ZH9 A;  4RQ4 A;  5J0U A;  4KLU A;  3AU6 A;  4FHV A;  4KM5 A;  5J2B A;  4NXW A;  4LEZ A;  3UXP A;  4X5V A;  1RZT A;  4I27 A;  4AT7 A;  4WC3 A;  8ICE A;  1TV9 A;  4UB5 A;  4NLZ A;  4E7X A;  1XSL A;  4M47 A;  1UEU A;  4F5Q A;  5HHH A;  3HJ1 A;  2M2W A;  7ICH A;  8ICG A;  2PFN A;  5CJ7 A;  9ICG A;  3ERC C;  4I2D A;  2IUB A;  5CR0 A;  5CB1 A;  4LZD A;  1OU5 A;  7ICS A;  7ICO A;  4X4N A;  4DO9 A;  4AT8 B;  4E80 A;  4K9A A;  5HC9 A;  4NKT A;  2B56 A;  2I9G A;  1WOT A;  7ICT A;  4O5E A;  5JTG A;  3TFS A;  5IIN A;  5DB6 A;  3V7K A;  2M2T A;  1TFW A;  1YLQ A;  9ICU A;  4WQK A;  9ICC A;  4X4S A;  4Z6E A;  4WOY A;  1BPZ A;  5D61 A;  4LZG A;  1JAJ A;  4XJE A;  4I28 A;  4RPZ A;  4WC2 A;  2ZH2 A;  3PNC A;  1UET A;  4O6A A;  5EOZ A;  3PML A;  4E8F A;  5HR9 A;  2O5A A;  4HX0 A;  9ICF A;  8ICJ A;  3NYB A;  4UAY A;  3V72 A;  8ICR A;  3UXO A;  4RT2 A;  4QZE A;  1NOM A;  1ZQF A;  3MGI A;  3AUO A;  1VFG A;  4WBZ A;  8ICI A;  1PX5 A;  9ICX A;  5CHE A;  3RJE A;  1Q78 A;  4M9N A;  4PGQ A;  4WC0 A;  3ISD A;  3C18 A;  4XQ8 A;  5DBB A;  5CWR A;  1BPE A;  9ICQ A;  2BCV A;  4QZB A;  1HUZ A;  4Z6C A;  3HIY A;  5D4B A;  5CFU A;  5HRI A;  2HHP A;  4M9H A;  5DDY A;  4R65 A;  4LEY A;  8ICU A;  9ICO A;  5B3P A;  5TZV A;  1ZJN A;  2W9M A;  4RQ5 A;  2BCR A;  2P66 A;  8ICN A;  3NWI A;  5DDM A;  4QZI A;  2BPC A;  4YN4 A;  4UAZ A;  4RPX A;  3C2L A;  4ATB A;  4PGX A;  5F2V O;  5IIL A;  1ZQZ A;  5IIO A;  4XA5 A;  1UEV A;  1ZQA A;  5CFS A;  4MFC A;  1ZQQ A;  9ICT A;  4NM2 A;  7ICG A;  4EV6 A;  5J2C A;  1MIV A;  3UPQ A;  4OAH A;  4TUR A;  7ICL A;  4RT3 A;  4AT7 B;  3NKU A;  4RQ1 A;  2PXI A;  4FHX A;  4OAF A;  4O5C A;  3PMN A;  3B0X A;  2M2V A;  1JN3 A;  4KLD A;  4EP7 A;  3OUY A;  8ICZ A;  5J2G A;  8ICH A;  4UB3 A;  4M5D A;  1MQ2 A;  2ZH1 A;  2FMP A;  4NXZ A;  4JWN A;  7ICK A;  1R8A A;  3AQM A;  5D62 A;  4NKU A;  4NY8 A;  4X4P A;  1VJ7 A;  4PHP A;  3JPP A;  4FHW A;  3JPT A;  2VAN A;  4YCX A;  3RJH A;  1XSN A;  3WFQ E;  4M2Y A;  3H3A A;  1ZQX A;  5IIK A;  7ICF A;  4WBY A;  1HUO A;  4LT6 A;  4I2B A;  1R89 A;  1ZQU A;  8ICX A;  3V7L A;  5B3Q A;  4KLS A;  5J0W A;  4MF2 A;  3K7D A;  8ICV A;  4PH5 A;  7ICE A;  4PPX A;  2B4V A;  1ZQB A;  2ZH6 A;  4I29 A;  2ISP A;  4AT9 A;  2FMQ A;  5IIM A;  5HRL A;  4UB2 A;  4KLL A;  2BBH A;  2DR7 A;  5J29 A;  4KLH A;  1RPL A;  3K75 D;  2DVI A;  1ZQP A;  1ZQN A;  4K97 A;  4TUS A;  4K8V A;  1GPJ A;  4NM1 A;  3MDA A;  3OVA A;  4FHP A;  4K96 A;  2DR5 A;  3WFO A;  1TVA A; 
#chains in the Genus database with same CATH homology
 5HRF A;  1BPY A;  4QZG A;  8ICP A;  1ZQL A;  4QZH A;  4YMN A;  3L9D A;  1ZQK A;  1JMS A;  1V4A A;  2DRA A;  4I2H A;  3H39 A;  3LK9 A;  1BPX A;  1ZQE A;  8ICA A;  1ZQD A;  1MIW A;  4WC6 A;  5J2D A;  4RWP A;  3RH4 A;  7ICV A;  5IIJ A;  4K4G A;  5DKW A;  2ZH7 A;  4TUQ A;  4M04 A;  4K4I A;  3RJG A;  4ATB B;  2ZH5 A;  5J2E A;  4RQ0 A;  4LVS A;  5J0O A;  9ICV A;  4RWQ A;  4X4T A;  2IHM A;  4KLG A;  4WC5 A;  7ICM A;  2PFQ A;  5BPC A;  7ICQ A;  4F5O A;  4QZ9 A;  3JZ0 A;  3C66 A;  5J0R A;  4P2H A;  3C5G A;  3RH5 A;  8ICB A;  4WC7 A;  3OUY B;  4F5P A;  1ZJM A;  5DED A;  3RJK A;  7ICU A;  4O5K A;  3OVS A;  5DBA A;  8ICF A;  5J2H A;  4UB4 A;  8ICO A;  7ICR A;  7ICJ A;  5CP2 A;  4X4V A;  4UD4 A;  1KEJ A;  4FH5 A;  4FO6 A;  4IQW A;  1BPD A;  4WC1 A;  5BOL A;  3AQK A;  4MFF A;  9ICJ A;  2FMS A;  5J2J A;  3OVB A;  4F5R A;  1MQ3 A;  4DOA A;  3LQC B;  3JPR A;  4RQ8 A;  4PHD A;  4R63 A;  3WFP A;  4QZF A;  4I2C A;  4DOC A;  9ICE A;  2BPF A;  9ICL A;  3OGU A;  3JPO A;  3UXN A;  4R64 A;  3OV7 A;  4YD2 A;  1ZQV A;  4UB1 A;  3JYY A;  4KLI A;  4YD1 A;  3C2K A;  4RQ7 A;  4AT9 B;  4I2A A;  1BPB A;  9ICN A;  3AU2 A;  2BCU A;  1ZQH A;  1ZQM A;  2ZHA A;  1MIY A;  1FA0 A;  5J0T A;  4P4M A;  1ZQR A;  1F5A A;  4X0A A;  4FH3 A;  8ICQ A;  1ZQW A;  3RH6 A;  1KDH A;  3RJJ A;  4KLE A;  4R66 A;  4X4U A;  2ZH3 A;  8ICK A;  4X4O A;  2DR8 A;  5CA7 A;  4KLF A;  4KLQ A;  3JPQ A;  2ISO A;  9ICW A;  8ICM A;  1ZQO A;  9ICI A;  4GXJ A;  4XRH A;  4IQU A;  4NLN A;  4I2I A;  4K4H A;  1Q79 A;  1R8B A;  5HRG A;  3HJ4 A;  5DB9 A;  4IQT A;  4TUP A;  4RWN A;  5DB7 A;  4MF8 A;  4PHA A;  5HRD A;  4QZC A;  4GXI A;  3TFR A;  3H38 A;  4X0B A;  4UBB A;  2PFP A;  9ICM A;  2BCQ A;  2ID1 A;  3AQN A;  4Z6F A;  3MDC A;  3UPS A;  7ICN A;  2BE3 A;  2PBE A;  5HHI A;  4M9J A;  9ICH A;  3AQL A;  1NO5 A;  4I2E A;  2M2U A;  5J0S A;  3C2M A;  2BCS A;  5CHG A;  3MGH A;  5DB8 A;  4WCW A;  5BOM A;  3HX0 A;  3UQ2 A;  1KNY A;  9ICS A;  4YMM A;  4F5N A;  4IQV A;  4KLM A;  3WFR E;  5D49 A;  1ZQS A;  4AT8 A;  1ZQJ A;  2ZH8 A;  5DEC A;  4P4P A;  9ICK A;  1ZQT A;  2PFO A;  4JWM A;  4UAW A;  5J2F A;  4X4Q A;  5J2A A;  4DOB A;  8ICT A;  4KLJ A;  5J0X A;  5HRE A;  1ZQI A;  5HRB A;  3RJF A;  3JPN A;  2NRK A;  4EBJ A;  3JPS A;  5III A;  4PGY A;  4UBC A;  5J2I A;  4KLO A;  3H37 A;  3V7J A;  4RWO A;  4RPY A;  2ZHB A;  4QZA A;  9ICP A;  5D46 A;  8ICS A;  4O9M A;  3B0Y A;  5DBC A;  9ICR A;  4P4O A;  1JQR A;  2ZH4 A;  2DRB A;  3HW8 A;  4XQ7 A;  4RQ3 A;  4PHE A;  1ZQY A;  5J2K A;  4RQ6 A;  4MFA A;  7ICI A;  4M0A A;  2DR9 A;  4I2G A;  3MBY A;  3ISB A;  2GWS A;  3HWT A;  3UQ0 A;  3WFS C;  8ICC A;  8ICL A;  4FHY A;  4GXK A;  1ZQC A;  3RJI A;  7ICP A;  4EBK A;  4UD5 A;  4M9L A;  2RFF A;  2Q66 A;  4XUS A;  3GDX A;  1ZQG A;  9ICA A;  4IG8 A;  4NLK A;  3ISC A;  4YMO A;  4QZ8 A;  4I2J A;  5HRH A;  4M9G A;  5J0Y A;  4X4R A;  9ICB A;  3C5F A;  1TFY A;  2O1P A;  1XSP A;  8ICW A;  5HRK A;  5J0P A;  2BPG A;  4WC4 A;  5J0Q A;  4S3N A;  1R8C A;  8ICY A;  4Z6D A;  4RQ2 A;  4QZD A;  4I2F A;  4KLT A;  2ZH9 A;  4RQ4 A;  5J0U A;  4KLU A;  3AU6 A;  4FHV A;  5J2B A;  3UXP A;  4X5V A;  1RZT A;  4I27 A;  4AT7 A;  4WC3 A;  8ICE A;  1TV9 A;  4UB5 A;  4NLZ A;  4E7X A;  1XSL A;  4M47 A;  1UEU A;  4F5Q A;  5HHH A;  3HJ1 A;  2M2W A;  7ICH A;  8ICG A;  2PFN A;  5CJ7 A;  9ICG A;  4I2D A;  5CR0 A;  5CB1 A;  4LZD A;  1OU5 A;  7ICS A;  7ICO A;  4X4N A;  4DO9 A;  4AT8 B;  4E80 A;  5HC9 A;  4NKT A;  2I9G A;  1WOT A;  7ICT A;  4O5E A;  3TFS A;  5IIN A;  5DB6 A;  3V7K A;  2M2T A;  1TFW A;  1YLQ A;  9ICU A;  9ICC A;  4X4S A;  4Z6E A;  1BPZ A;  4LZG A;  1JAJ A;  4I28 A;  4RPZ A;  4WC2 A;  2ZH2 A;  3PNC A;  1UET A;  5EOZ A;  3PML A;  4E8F A;  5HR9 A;  2O5A A;  9ICF A;  8ICJ A;  3NYB A;  4UAY A;  3V72 A;  8ICR A;  3UXO A;  4RT2 A;  4QZE A;  1NOM A;  1ZQF A;  3MGI A;  3AUO A;  1VFG A;  4WBZ A;  8ICI A;  1PX5 A;  9ICX A;  3RJE A;  1Q78 A;  4M9N A;  4PGQ A;  4WC0 A;  3ISD A;  3C18 A;  4XQ8 A;  5DBB A;  5CWR A;  1BPE A;  9ICQ A;  2BCV A;  4QZB A;  1HUZ A;  4Z6C A;  3HIY A;  5D4B A;  5HRI A;  2HHP A;  4M9H A;  5DDY A;  4R65 A;  8ICU A;  9ICO A;  5TZV A;  1ZJN A;  2W9M A;  4RQ5 A;  2BCR A;  2P66 A;  8ICN A;  5DDM A;  4QZI A;  2BPC A;  4YN4 A;  4UAZ A;  4RPX A;  3C2L A;  4ATB A;  4PGX A;  5F2V O;  5IIL A;  1ZQZ A;  5IIO A;  4XA5 A;  1UEV A;  1ZQA A;  4MFC A;  1ZQQ A;  9ICT A;  4NM2 A;  7ICG A;  5J2C A;  1MIV A;  3UPQ A;  4TUR A;  7ICL A;  4RT3 A;  4AT7 B;  4RQ1 A;  2PXI A;  4FHX A;  4O5C A;  3PMN A;  3B0X A;  2M2V A;  1JN3 A;  4KLD A;  4EP7 A;  3OUY A;  8ICZ A;  5J2G A;  8ICH A;  4UB3 A;  4M5D A;  1MQ2 A;  2ZH1 A;  2FMP A;  4NXZ A;  4JWN A;  7ICK A;  1R8A A;  3AQM A;  4NKU A;  4NY8 A;  4X4P A;  1VJ7 A;  4PHP A;  3JPP A;  4FHW A;  3JPT A;  2VAN A;  4YCX A;  3RJH A;  1XSN A;  3WFQ E;  4M2Y A;  3H3A A;  1ZQX A;  5IIK A;  7ICF A;  4WBY A;  1HUO A;  4LT6 A;  4I2B A;  1R89 A;  1ZQU A;  8ICX A;  3V7L A;  4KLS A;  5J0W A;  4MF2 A;  8ICV A;  4PH5 A;  7ICE A;  4PPX A;  1ZQB A;  2ZH6 A;  4I29 A;  2ISP A;  4AT9 A;  2FMQ A;  5IIM A;  5HRL A;  4UB2 A;  4KLL A;  2DR7 A;  5J29 A;  4KLH A;  1RPL A;  3K75 D;  2DVI A;  1ZQP A;  1ZQN A;  4TUS A;  4NM1 A;  3MDA A;  3OVA A;  4FHP A;  2DR5 A;  3WFO A;  1TVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...