2ID1A

X-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
MEIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVLVDAGDVVVHVMLPAVRDYYDIEALWGGQKPSFAVGAAKPWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2id1A01
7ICJA 4X4UA 4Z6CA 5EOZA 1VJ7A 4WBYA 1BPYA 1UEVA 1OU5A 4RPXA 4WC4A 4I2GA 2BCRA 5D4BA 9ICAA 5J0WA 3WFSC 3H39A 2BCUA 2ZH4A 1MIVA 1ZQGA 5HR9A 5J0RA 2DRAA 3AU6A 3C18A 1RPLA 1MIYA 3C2KA 3NYBA 4M04A 5DB9A 5CR0A 5DBCA 2ZH1A 2BCQA 4GXJA 9ICTA 3OUYB 8ICIA 4NLZA 4X0AA 4F5PA 4IQUA 9ICNA 4UD4A 2BE3A 8ICOA 4K4GA 4LVSA 9ICJA 5DB6A 1XSLA 4RWNA 3V7LA 4F5NA 4XA5A 4X4VA 9ICPA 2HHPA 4KLFA 4M47A 5IINA 4NM2A 4M9GA 3JPQA 7ICKA 1ZJNA 3UXNA 4E80A 4PHPA 3LK9A 4EBJA 3UQ0A 2IHMA 4PH5A 4X0BA 2RFFA 7ICOA 4I2IA 8ICYA 3RJIA 4P2HA 4O5CA 9ICWA 4WC0A 4WC2A 4I2EA 1ZQHA 7ICRA 2ISPA 3AU2A 2BCVA 4M5DA 3UXOA 4PHDA 2PFOA 9ICMA 4M9LA 5HHIA 4M0AA 3JPSA 4YMMA 4UB5A 4MFAA 8ICVA 3PNCA 2DVIA 4M9JA 4X4SA 4MF8A 3OVSA 8ICZA 4IQTA 1RZTA 3UXPA 4TUSA 4KLGA 8ICFA 4XQ8A 4KLOA 3B0XA 3PMLA 2ZH3A 4FO6A 5CA7A 5HRGA 5J2CA 3C2LA 1KDHA 2ZHBA 4MFFA 4FH5A 4R65A 2ZH6A 4X4QA 1FA0A 2W9MA 1ZQCA 4YD2A 2M2WA 4NXZA 5DBAA 4DO9A 4X5VA 5DECA 7ICVA 4KLMA 4KLUA 5DDYA 3AQNA 4JWNA 9ICHA 2Q66A 5DB8A 9ICEA 4I2CA 3RJGA 4O9MA 4KLTA 9ICLA 4LT6A 4Z6EA 5BOMA 3HW8A 1MQ2A 3OVAA 3MDCA 2PXIA 4O5KA 4NLNA 3WFRE 7ICUA 5IIKA 4K4IA 4NLKA 7ICTA 4RT3A 8ICTA 2DR7A 4I27A 7ICQA 1ZQIA 4UB4A 5D49A 3HIYA 3MGIA 1TFWA 4YMNA 8ICRA 3AUOA 4RWQA 4FHYA 4Z6FA 4RQ1A 4FH3A 2P66A 4PPXA 9ICFA 1ZQRA 5DBBA 3K75D 3RH5A 4MF2A 2O1PA 5J0QA 4RQ6A 1ZQTA 2ID1A 4F5QA 5DEDA 5J0TA 7ICFA 4QZCA 4UAYA 2PFNA 4K4HA 1KEJA 8ICNA 8ICAA 4FHVA 3OGUA 7ICLA 4WCWA 4ATBB 4PHEA 4KLLA 2ZH2A 2FMPA 8ICEA 9ICCA 4I2JA 5CHGA 4TUPA 3JPRA 4FHPA 1BPBA 5HRBA 4S3NA 3AQMA 4RWOA 4I2BA 2FMSA 8ICSA 4AT8A 4KLJA 4ATBA 4E8FA 4XRHA 2BPGA 4O5EA 3JPNA 9ICKA 1R8AA 5HRFA 4F5OA 4M9HA 4RQ8A 1NOMA 3RJJA 4JWMA 5IIIA 3JZ0A 3UPSA 3JPTA 3TFRA 5HRLA 8ICWA 4UB1A 5J2JA 4RPYA 1BPXA 1JQRA 8ICMA 4QZFA 1PX5A 1ZQEA 4X4NA 3V7JA 5CWRA 8ICBA 4IQWA 3LQCB 9ICUA 2NRKA 4RQ5A 1UETA 1R89A 5J0SA 1ZQSA 5DDMA 8ICXA 4IQVA 4I2HA 2PBEA 4RQ2A 1ZQQA 2FMQA 3RJFA 1ZQKA 9ICRA 1ZQPA 4F5RA 4RQ7A 3HJ4A 5J0UA 4KLSA 9ICSA 2DRBA 9ICQA 1YLQA 4DOBA 4QZBA 3C5GA 5HHHA 2GWSA 1ZQDA 1Q79A 4PGQA 3JPOA 3OVBA 4QZGA 1VFGA 4I2DA 9ICXA 4QZ8A 5J0XA 3UPQA 4RT2A 1JMSA 4QZHA 3HJ1A 1TFYA 4UBBA 1UEUA 4WC5A 1ZQXA 2DR9A 4R66A 3WFPA 5J0YA 3JPPA 1HUZA 1WOTA 8ICUA 1ZQUA 4QZIA 4X4OA 4EP7A 5CJ7A 2ZH7A 4RQ0A 4UB3A 2BPFA 5BPCA 4WC6A 2DR8A 5BOLA 4WC3A 3MBYA 3AQKA 9ICGA 5J2FA 5IIOA 4PGXA 5J0OA 4KLEA 5IIMA 4I2AA 9ICVA 8ICJA 5HRKA 4I28A 3UQ2A 4UB2A 8ICCA 2I9GA 4UAZA 1ZQJA 5D46A 8ICGA 4M9NA 4IG8A 4P4PA 4AT8B 5CP2A 3C66A 4LZDA 4KLDA 3RJKA 4KLIA 4X4PA 7ICHA 3HX0A 4NKTA 1HUOA 5HRIA 2O5AA 4RQ4A 4X4RA 4QZAA 9ICBA 1ZQVA 5HREA 5J2GA 3MDAA 3RH4A 5J2AA 4WC7A 8ICKA 7ICPA 5DB7A 1XSPA 3GDXA 2M2UA 4KLQA 4Z6DA 4E7XA 1ZQAA 1NO5A 4LZGA 1Q78A 5J0PA 3OV7A 2ZH9A 3OUYA 8ICPA 3PMNA 3HWTA 5J2DA 4FHWA 5IIJA 2BPCA 4RPZA 4TURA 4GXKA 3H38A 2PFPA 5IILA 4AT7B 5CB1A 1KNYA 9ICIA 4YN4A 1TV9A 4YD1A 4YCXA 2DR5A 3WFQE 4UD5A 4P4MA 1ZQMA 3C2MA 3JYYA 4YMOA 2ISOA 7ICNA 2M2VA 4AT7A 5J29A 3ISBA 1BPZA 1MQ3A 3RJEA 4RQ3A 3ISDA 5J2EA 4QZDA 8ICQA 1ZQFA 4QZEA 3H37A 1JN3A 1BPEA 5J2HA 3RH6A 4MFCA 8ICHA 2ZH5A 4PHAA 1XSNA 1TVAA 5J2KA 1MIWA 5TZVA 4AT9B 2ZH8A 1ZJMA 4PGYA 5HRHA 5F2VO 5J2BA 1ZQLA 4R63A 1ZQNA 4NKUA 1F5AA 3H3AA 4WC1A 1V4AA 4UAWA 4UBCA 4FHXA 5HRDA 4AT9A 8ICLA 1R8CA 4RWPA 5DKWA 5J2IA 7ICEA 2M2TA 4EBKA 4DOCA 3RJHA 3AQLA 4NM1A 4X4TA 4M2YA 7ICMA 7ICIA 4TUQA 1ZQYA 2BCSA 4I29A 4WBZA 3C5FA 5HC9A 2PFQA 7ICSA 3ISCA 1BPDA 3WFOA 7ICGA 3TFSA 4R64A 3MGHA 4NY8A 3B0YA 4XQ7A 4KLHA 4DOAA 4P4OA 2VANA 4I2FA 1ZQBA 4QZ9A 1ZQOA 9ICOA 2ZHAA 1JAJA 3L9DA 3V7KA 3V72A 4GXIA 1ZQWA 1ZQZA 4XUSA 1R8BA
chains in the Genus database with same CATH superfamily
7ICJA 5B3QA 4X4UA 4Z6CA 5EOZA 1VJ7A 4OAHA 4WBYA 1BPYA 1UEVA 1OU5A 4RPXA 4WC4A 5CFSA 4I2GA 2BCRA 5D4BA 9ICAA 5J0WA 3WFSC 3H39A 4K8VA 2ZH4A 2BCUA 1MIVA 4HX0A 1ZQGA 4OAIZ 5HR9A 5J0RA 2DRAA 3AU6A 3C18A 1RPLA 1MIYA 3C2KA 4K99A 3NYBA 4M04A 5DB9A 5CR0A 5DBCA 4K9BA 2ZH1A 2BCQA 4GXJA 9ICTA 3OUYB 8ICIA 4NLZA 4X0AA 4F5PA 4IQUA 4LEZA 4K98A 9ICNA 3K7DA 4UD4A 4LEYA 2BE3A 8ICOA 4K4GA 4LVSA 9ICJA 5DB6A 2EWRA 1XSLA 4RWNA 3V7LA 4F5NA 4XA5A 4X4VA 4O6AA 9ICPA 2HHPA 4KLFA 4EEDA 4M47A 5IINA 4NM2A 4M9GA 3JPQA 7ICKA 1ZJNA 3UXNA 4PHPA 4E80A 3LK9A 4EBJA 4N7RA 3UQ0A 2IHMA 4PH5A 4X0BA 3CK6A 2RFFA 3NWIA 4NXUA 7ICOA 4I2IA 8ICYA 3RJIA 4P2HA 4NXTA 4O5CA 9ICWA 4WC0A 4WC2A 4I2EA 1ZQHA 7ICRA 2ISPA 3AU2A 3EF2A 2BCVA 4M5DA 3UXOA 4PHDA 2PFOA 9ICMA 4M9LA 5D62A 5HHIA 4M0AA 3JPSA 4YMMA 4UB5A 4MFAA 8ICVA 5JTGA 3PNCA 2DVIA 4M9JA 4X4SA 4MF8A 3OVSA 8ICZA 4IQTA 1RZTA 3UXPA 4TUSA 4KLGA 8ICFA 4XQ8A 4KLOA 3B0XA 3PMLA 2ZH3A 4WQKA 4FO6A 5CA7A 5HRGA 5J2CA 3C2LA 1KDHA 2ZHBA 4MFFA 4FH5A 4R65A 2ZH6A 4X4QA 2BBJA 1FA0A 2W9MA 1ZQCA 4YD2A 2M2WA 4NXZA 5DBAA 4DO9A 4X5VA 5DECA 7ICVA 4KLMA 4KLUA 5DDYA 2GA9D 4K9AA 2FCLA 3AQNA 4I0UA 4JWNA 9ICHA 2Q66A 2B51A 5DB8A 9ICEA 4I2CA 3RJGA 4O9MA 4KLTA 9ICLA 4LT6A 4KM5A 4Z6EA 5BOMA 3HW8A 1MQ2A 3OVAA 3MDCA 2PXIA 4O5KA 4NLNA 3WFRE 7ICUA 5IIKA 4K4IA 4NLKA 7ICTA 4RT3A 8ICTA 2DR7A 4I27A 7ICQA 1ZQIA 4UB4A 5D49A 3HIYA 3MGIA 1TFWA 4YMNA 8ICRA 3AUOA 4RWQA 4FHYA 4Z6FA 4KB6A 4RQ1A 4FH3A 2P66A 4K97A 4PPXA 9ICFA 5CFUA 1ZQRA 5DBBA 3K75D 3RH5A 4MF2A 2O1PA 5J0QA 4RQ6A 1ZQTA 2ID1A 4F5QA 5DEDA 5J0TA 7ICFA 4QZCA 4UAYA 2PFNA 4K4HA 1KEJA 8ICNA 8ICAA 4O68A 4FHVA 3OGUA 7ICLA 4WCWA 4ATBB 4PHEA 4KLLA 2ZH2A 2FMPA 8ICEA 9ICCA 4I2JA 5CHGA 4TUPA 3JPRA 3NVOA 4FHPA 1BPBA 5HRBA 4S3NA 3AQMA 4RWOA 4I2BA 2FMSA 5CFTA 8ICSA 4AT8A 4KLJA 4ATBA 4E8FA 4XRHA 2BPGA 4O5EA 3JPNA 9ICKA 1R8AA 5HRFA 4O69A 4F5OA 4MKPA 4M9HA 4RQ8A 4NXXA 1NOMA 3RJJA 4JWMA 5IIIA 3JZ0A 3UPSA 3JPTA 4K96A 3TFRA 5HRLA 8ICWA 4UB1A 5J2JA 4RPYA 1BPXA 1JQRA 8ICMA 2HN2A 4QZFA 1PX5A 1ZQEA 4X4NA 3V7JA 5CWRA 8ICBA 4IQWA 3LQCB 9ICUA 2NRKA 4RQ5A 1UETA 1R89A 5J0SA 1ZQSA 5DDMA 8ICXA 4IQVA 4I2HA 2PBEA 4RQ2A 1ZQQA 4JLZA 2FMQA 3RJFA 1ZQKA 9ICRA 1ZQPA 4F5RA 4RQ7A 3HJ4A 5J0UA 4KLSA 9ICSA 2BBHA 2DRBA 9ICQA 1YLQA 4DOBA 4QZBA 3C5GA 5HHHA 2GWSA 1ZQDA 1Q79A 4PGQA 3JPOA 3OVBA 4QZGA 1VFGA 4I2DA 9ICXA 4QZ8A 5J0XA 3UPQA 4RT2A 1JMSA 4QZHA 3HJ1A 1TFYA 4UBBA 1GPJA 1UEUA 4WC5A 1ZQXA 2DR9A 2IHOA 4R66A 3WFPA 5J0YA 3JPPA 4LEVA 1HUZA 3NKUA 4WOYA 1WOTA 8ICUA 1ZQUA 3OWGA 4QZIA 4FO1A 4EV6A 4X4OA 5D61A 4EP7A 5CJ7A 2ZH7A 4RQ0A 4UB3A 2BPFA 5CHEA 5BPCA 2IUBA 4NXVA 4WC6A 2DR8A 5BOLA 4WC3A 3MBYA 3AQKA 9ICGA 5J2FA 5IIOA 4PGXA 5J0OA 4KLEA 5IIMA 4I2AA 9ICVA 8ICJA 5HRKA 4I28A 3UQ2A 4UB2A 8ICCA 2I9GA 4UAZA 1ZQJA 3MCRA 5D46A 8ICGA 4M9NA 4IG8A 4P4PA 4AT8B 5CP2A 3C66A 4LZDA 4KLDA 3RJKA 4KLIA 4X4PA 7ICHA 3HX0A 4NKTA 1HUOA 2GAFD 5HRIA 2O5AA 3ER8C 4RQ4A 4X4RA 4QZAA 4JLXA 9ICBA 1ZQVA 5HREA 5J2GA 3MDAA 3RH4A 3ER9B 5J2AA 4WC7A 4WQLA 8ICKA 7ICPA 5DB7A 1XSPA 3GDXA 2B56A 2M2UA 4KLQA 4Z6DA 4E7XA 1ZQAA 1NO5A 4LZGA 1Q78A 5J0PA 3OV7A 2ZH9A 3OUYA 8ICPA 3PMNA 3HWTA 4EGWA 4O67A 5J2DA 4FHWA 5IIJA 2BPCA 4RPZA 4TURA 4GXKA 3H38A 5B3PA 2PFPA 5IILA 4AT7B 5CB1A 1KNYA 9ICIA 4YN4A 1TV9A 4YD1A 4YCXA 2DR5A 3WFQE 4UD5A 4P4MA 1ZQMA 3C2MA 3JYYA 4YMOA 2ISOA 7ICNA 2M2VA 4AT7A 5J29A 3ISBA 1BPZA 1MQ3A 3RJEA 4WH5A 4RQ3A 3ISDA 5J2EA 4QZDA 8ICQA 1ZQFA 4QZEA 3H37A 4NXWA 1JN3A 1BPEA 5J2HA 3RH6A 4MFCA 8ICHA 2ZH5A 4PHAA 1XSNA 1TVAA 5J2KA 1MIWA 5TZVA 5D63A 4AT9B 2ZH8A 1ZJMA 4PGYA 5HRHA 5F2VO 5J2BA 1ZQLA 4OAGA 4R63A 1ZQNA 4NKUA 1F5AA 3H3AA 4WC1A 1V4AA 4UAWA 4UBCA 4FHXA 5HRDA 2B4VA 4AT9A 3ERCC 8ICLA 1R8CA 4RWPA 5DKWA 5J2IA 7ICEA 3PHZA 2M2TA 4EBKA 4DOCA 4EEBA 3AQLA 3RJHA 4NM1A 4X4TA 4M2YA 7ICMA 7ICIA 4TUQA 1ZQYA 2BCSA 4I29A 4WBZA 3C5FA 5HC9A 2PFQA 7ICSA 3ISCA 1BPDA 3WFOA 7ICGA 3TFSA 4R64A 3MGHA 4NY8A 3JCFA 3B0YA 4XQ7A 4OAFA 4KLHA 4DOAA 4P4OA 2VANA 4I2FA 4LEWA 4XJEA 4QZ9A 1ZQBA 1ZQOA 9ICOA 2ZHAA 1JAJA 3L9DA 3V7KA 3V72A 4GXIA 2HN1A 1ZQWA 1ZQZA 4XUSA 1R8BA
chains in the Genus database with same CATH topology
7ICJA 4X4UA 4Z6CA 5EOZA 1VJ7A 4WBYA 1BPYA 1UEVA 1OU5A 4RPXA 4WC4A 4I2GA 2BCRA 5D4BA 9ICAA 5J0WA 3WFSC 3H39A 2BCUA 2ZH4A 1MIVA 1ZQGA 5HR9A 5J0RA 2DRAA 3AU6A 3C18A 1RPLA 1MIYA 3C2KA 3NYBA 4M04A 5DB9A 5CR0A 5DBCA 2ZH1A 2BCQA 4GXJA 9ICTA 3OUYB 8ICIA 4NLZA 4X0AA 4F5PA 4IQUA 9ICNA 4UD4A 2BE3A 8ICOA 4K4GA 4LVSA 9ICJA 5DB6A 1XSLA 4RWNA 3V7LA 4F5NA 4XA5A 4X4VA 9ICPA 2HHPA 4KLFA 4M47A 5IINA 4NM2A 4M9GA 3JPQA 7ICKA 1ZJNA 3UXNA 4E80A 4PHPA 3LK9A 4EBJA 3UQ0A 2IHMA 4PH5A 4X0BA 2RFFA 7ICOA 4I2IA 8ICYA 3RJIA 4P2HA 4O5CA 9ICWA 4WC0A 4WC2A 4I2EA 1ZQHA 7ICRA 2ISPA 3AU2A 2BCVA 4M5DA 3UXOA 4PHDA 2PFOA 9ICMA 4M9LA 5HHIA 4M0AA 3JPSA 4YMMA 4UB5A 4MFAA 8ICVA 3PNCA 2DVIA 4M9JA 4X4SA 4MF8A 3OVSA 8ICZA 4IQTA 1RZTA 3UXPA 4TUSA 4KLGA 8ICFA 4XQ8A 4KLOA 3B0XA 3PMLA 2ZH3A 4FO6A 5CA7A 5HRGA 5J2CA 3C2LA 1KDHA 2ZHBA 4MFFA 4FH5A 4R65A 2ZH6A 4X4QA 1FA0A 2W9MA 1ZQCA 4YD2A 2M2WA 4NXZA 5DBAA 4DO9A 4X5VA 5DECA 7ICVA 4KLMA 4KLUA 5DDYA 3AQNA 4JWNA 9ICHA 2Q66A 5DB8A 9ICEA 4I2CA 3RJGA 4O9MA 4KLTA 9ICLA 4LT6A 4Z6EA 5BOMA 3HW8A 1MQ2A 3OVAA 3MDCA 2PXIA 4O5KA 4NLNA 3WFRE 7ICUA 5IIKA 4K4IA 4NLKA 7ICTA 4RT3A 8ICTA 2DR7A 4I27A 7ICQA 1ZQIA 4UB4A 5D49A 3HIYA 3MGIA 1TFWA 4YMNA 8ICRA 3AUOA 4RWQA 4FHYA 4Z6FA 4RQ1A 4FH3A 2P66A 4PPXA 9ICFA 1ZQRA 5DBBA 3K75D 3RH5A 4MF2A 2O1PA 5J0QA 4RQ6A 1ZQTA 2ID1A 4F5QA 5DEDA 5J0TA 7ICFA 4QZCA 4UAYA 2PFNA 4K4HA 1KEJA 8ICNA 8ICAA 4FHVA 3OGUA 7ICLA 4WCWA 4ATBB 4PHEA 4KLLA 2ZH2A 2FMPA 8ICEA 9ICCA 4I2JA 5CHGA 4TUPA 3JPRA 4FHPA 1BPBA 5HRBA 4S3NA 3AQMA 4RWOA 4I2BA 2FMSA 8ICSA 4AT8A 4KLJA 4ATBA 4E8FA 4XRHA 2BPGA 4O5EA 3JPNA 9ICKA 1R8AA 5HRFA 4F5OA 4M9HA 4RQ8A 1NOMA 3RJJA 4JWMA 5IIIA 3JZ0A 3UPSA 3JPTA 3TFRA 5HRLA 8ICWA 4UB1A 5J2JA 4RPYA 1BPXA 1JQRA 8ICMA 4QZFA 1PX5A 1ZQEA 4X4NA 3V7JA 5CWRA 8ICBA 4IQWA 3LQCB 9ICUA 2NRKA 4RQ5A 1UETA 1R89A 5J0SA 1ZQSA 5DDMA 8ICXA 4IQVA 4I2HA 2PBEA 4RQ2A 1ZQQA 2FMQA 3RJFA 1ZQKA 9ICRA 1ZQPA 4F5RA 4RQ7A 3HJ4A 5J0UA 4KLSA 9ICSA 2DRBA 9ICQA 1YLQA 4DOBA 4QZBA 3C5GA 5HHHA 2GWSA 1ZQDA 1Q79A 4PGQA 3JPOA 3OVBA 4QZGA 1VFGA 4I2DA 9ICXA 4QZ8A 5J0XA 3UPQA 4RT2A 1JMSA 4QZHA 3HJ1A 1TFYA 4UBBA 1UEUA 4WC5A 1ZQXA 2DR9A 4R66A 3WFPA 5J0YA 3JPPA 1HUZA 1WOTA 8ICUA 1ZQUA 4QZIA 4X4OA 4EP7A 5CJ7A 2ZH7A 4RQ0A 4UB3A 2BPFA 5BPCA 4WC6A 2DR8A 5BOLA 4WC3A 3MBYA 3AQKA 9ICGA 5J2FA 5IIOA 4PGXA 5J0OA 4KLEA 5IIMA 4I2AA 9ICVA 8ICJA 5HRKA 4I28A 3UQ2A 4UB2A 8ICCA 2I9GA 4UAZA 1ZQJA 5D46A 8ICGA 4M9NA 4IG8A 4P4PA 4AT8B 5CP2A 3C66A 4LZDA 4KLDA 3RJKA 4KLIA 4X4PA 7ICHA 3HX0A 4NKTA 1HUOA 5HRIA 2O5AA 4RQ4A 4X4RA 4QZAA 9ICBA 1ZQVA 5HREA 5J2GA 3MDAA 3RH4A 5J2AA 4WC7A 8ICKA 7ICPA 5DB7A 1XSPA 3GDXA 2M2UA 4KLQA 4Z6DA 4E7XA 1ZQAA 1NO5A 4LZGA 1Q78A 5J0PA 3OV7A 2ZH9A 3OUYA 8ICPA 3PMNA 3HWTA 5J2DA 4FHWA 5IIJA 2BPCA 4RPZA 4TURA 4GXKA 3H38A 2PFPA 5IILA 4AT7B 5CB1A 1KNYA 9ICIA 4YN4A 1TV9A 4YD1A 4YCXA 2DR5A 3WFQE 4UD5A 4P4MA 1ZQMA 3C2MA 3JYYA 4YMOA 2ISOA 7ICNA 2M2VA 4AT7A 5J29A 3ISBA 1BPZA 1MQ3A 3RJEA 4RQ3A 3ISDA 5J2EA 4QZDA 8ICQA 1ZQFA 4QZEA 3H37A 1JN3A 1BPEA 5J2HA 3RH6A 4MFCA 8ICHA 2ZH5A 4PHAA 1XSNA 1TVAA 5J2KA 1MIWA 5TZVA 4AT9B 2ZH8A 1ZJMA 4PGYA 5HRHA 5F2VO 5J2BA 1ZQLA 4R63A 1ZQNA 4NKUA 1F5AA 3H3AA 4WC1A 1V4AA 4UAWA 4UBCA 4FHXA 5HRDA 4AT9A 8ICLA 1R8CA 4RWPA 5DKWA 5J2IA 7ICEA 2M2TA 4EBKA 4DOCA 3RJHA 3AQLA 4NM1A 4X4TA 4M2YA 7ICMA 7ICIA 4TUQA 1ZQYA 2BCSA 4I29A 4WBZA 3C5FA 5HC9A 2PFQA 7ICSA 3ISCA 1BPDA 3WFOA 7ICGA 3TFSA 4R64A 3MGHA 4NY8A 3B0YA 4XQ7A 4KLHA 4DOAA 4P4OA 2VANA 4I2FA 1ZQBA 4QZ9A 1ZQOA 9ICOA 2ZHAA 1JAJA 3L9DA 3V7KA 3V72A 4GXIA 1ZQWA 1ZQZA 4XUSA 1R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICJ A;  4X4U A;  4Z6C A;  5EOZ A;  1VJ7 A;  4WBY A;  1BPY A;  1UEV A;  1OU5 A;  4RPX A;  4WC4 A;  4I2G A;  2BCR A;  5D4B A;  9ICA A;  5J0W A;  3WFS C;  3H39 A;  2BCU A;  2ZH4 A;  1MIV A;  1ZQG A;  5HR9 A;  5J0R A;  2DRA A;  3AU6 A;  3C18 A;  1RPL A;  1MIY A;  3C2K A;  3NYB A;  4M04 A;  5DB9 A;  5CR0 A;  5DBC A;  2ZH1 A;  2BCQ A;  4GXJ A;  9ICT A;  3OUY B;  8ICI A;  4NLZ A;  4X0A A;  4F5P A;  4IQU A;  9ICN A;  4UD4 A;  2BE3 A;  8ICO A;  4K4G A;  4LVS A;  9ICJ A;  5DB6 A;  1XSL A;  4RWN A;  3V7L A;  4F5N A;  4XA5 A;  4X4V A;  9ICP A;  2HHP A;  4KLF A;  4M47 A;  5IIN A;  4NM2 A;  4M9G A;  3JPQ A;  7ICK A;  1ZJN A;  3UXN A;  4E80 A;  4PHP A;  3LK9 A;  4EBJ A;  3UQ0 A;  2IHM A;  4PH5 A;  4X0B A;  2RFF A;  7ICO A;  4I2I A;  8ICY A;  3RJI A;  4P2H A;  4O5C A;  9ICW A;  4WC0 A;  4WC2 A;  4I2E A;  1ZQH A;  7ICR A;  2ISP A;  3AU2 A;  2BCV A;  4M5D A;  3UXO A;  4PHD A;  2PFO A;  9ICM A;  4M9L A;  5HHI A;  4M0A A;  3JPS A;  4YMM A;  4UB5 A;  4MFA A;  8ICV A;  3PNC A;  2DVI A;  4M9J A;  4X4S A;  4MF8 A;  3OVS A;  8ICZ A;  4IQT A;  1RZT A;  3UXP A;  4TUS A;  4KLG A;  8ICF A;  4XQ8 A;  4KLO A;  3B0X A;  3PML A;  2ZH3 A;  4FO6 A;  5CA7 A;  5HRG A;  5J2C A;  3C2L A;  1KDH A;  2ZHB A;  4MFF A;  4FH5 A;  4R65 A;  2ZH6 A;  4X4Q A;  1FA0 A;  2W9M A;  1ZQC A;  4YD2 A;  2M2W A;  4NXZ A;  5DBA A;  4DO9 A;  4X5V A;  5DEC A;  7ICV A;  4KLM A;  4KLU A;  5DDY A;  3AQN A;  4JWN A;  9ICH A;  2Q66 A;  5DB8 A;  9ICE A;  4I2C A;  3RJG A;  4O9M A;  4KLT A;  9ICL A;  4LT6 A;  4Z6E A;  5BOM A;  3HW8 A;  1MQ2 A;  3OVA A;  3MDC A;  2PXI A;  4O5K A;  4NLN A;  3WFR E;  7ICU A;  5IIK A;  4K4I A;  4NLK A;  7ICT A;  4RT3 A;  8ICT A;  2DR7 A;  4I27 A;  7ICQ A;  1ZQI A;  4UB4 A;  5D49 A;  3HIY A;  3MGI A;  1TFW A;  4YMN A;  8ICR A;  3AUO A;  4RWQ A;  4FHY A;  4Z6F A;  4RQ1 A;  4FH3 A;  2P66 A;  4PPX A;  9ICF A;  1ZQR A;  5DBB A;  3K75 D;  3RH5 A;  4MF2 A;  2O1P A;  5J0Q A;  4RQ6 A;  1ZQT A;  2ID1 A;  4F5Q A;  5DED A;  5J0T A;  7ICF A;  4QZC A;  4UAY A;  2PFN A;  4K4H A;  1KEJ A;  8ICN A;  8ICA A;  4FHV A;  3OGU A;  7ICL A;  4WCW A;  4ATB B;  4PHE A;  4KLL A;  2ZH2 A;  2FMP A;  8ICE A;  9ICC A;  4I2J A;  5CHG A;  4TUP A;  3JPR A;  4FHP A;  1BPB A;  5HRB A;  4S3N A;  3AQM A;  4RWO A;  4I2B A;  2FMS A;  8ICS A;  4AT8 A;  4KLJ A;  4ATB A;  4E8F A;  4XRH A;  2BPG A;  4O5E A;  3JPN A;  9ICK A;  1R8A A;  5HRF A;  4F5O A;  4M9H A;  4RQ8 A;  1NOM A;  3RJJ A;  4JWM A;  5III A;  3JZ0 A;  3UPS A;  3JPT A;  3TFR A;  5HRL A;  8ICW A;  4UB1 A;  5J2J A;  4RPY A;  1BPX A;  1JQR A;  8ICM A;  4QZF A;  1PX5 A;  1ZQE A;  4X4N A;  3V7J A;  5CWR A;  8ICB A;  4IQW A;  3LQC B;  9ICU A;  2NRK A;  4RQ5 A;  1UET A;  1R89 A;  5J0S A;  1ZQS A;  5DDM A;  8ICX A;  4IQV A;  4I2H A;  2PBE A;  4RQ2 A;  1ZQQ A;  2FMQ A;  3RJF A;  1ZQK A;  9ICR A;  1ZQP A;  4F5R A;  4RQ7 A;  3HJ4 A;  5J0U A;  4KLS A;  9ICS A;  2DRB A;  9ICQ A;  1YLQ A;  4DOB A;  4QZB A;  3C5G A;  5HHH A;  2GWS A;  1ZQD A;  1Q79 A;  4PGQ A;  3JPO A;  3OVB A;  4QZG A;  1VFG A;  4I2D A;  9ICX A;  4QZ8 A;  5J0X A;  3UPQ A;  4RT2 A;  1JMS A;  4QZH A;  3HJ1 A;  1TFY A;  4UBB A;  1UEU A;  4WC5 A;  1ZQX A;  2DR9 A;  4R66 A;  3WFP A;  5J0Y A;  3JPP A;  1HUZ A;  1WOT A;  8ICU A;  1ZQU A;  4QZI A;  4X4O A;  4EP7 A;  5CJ7 A;  2ZH7 A;  4RQ0 A;  4UB3 A;  2BPF A;  5BPC A;  4WC6 A;  2DR8 A;  5BOL A;  4WC3 A;  3MBY A;  3AQK A;  9ICG A;  5J2F A;  5IIO A;  4PGX A;  5J0O A;  4KLE A;  5IIM A;  4I2A A;  9ICV A;  8ICJ A;  5HRK A;  4I28 A;  3UQ2 A;  4UB2 A;  8ICC A;  2I9G A;  4UAZ A;  1ZQJ A;  5D46 A;  8ICG A;  4M9N A;  4IG8 A;  4P4P A;  4AT8 B;  5CP2 A;  3C66 A;  4LZD A;  4KLD A;  3RJK A;  4KLI A;  4X4P A;  7ICH A;  3HX0 A;  4NKT A;  1HUO A;  5HRI A;  2O5A A;  4RQ4 A;  4X4R A;  4QZA A;  9ICB A;  1ZQV A;  5HRE A;  5J2G A;  3MDA A;  3RH4 A;  5J2A A;  4WC7 A;  8ICK A;  7ICP A;  5DB7 A;  1XSP A;  3GDX A;  2M2U A;  4KLQ A;  4Z6D A;  4E7X A;  1ZQA A;  1NO5 A;  4LZG A;  1Q78 A;  5J0P A;  3OV7 A;  2ZH9 A;  3OUY A;  8ICP A;  3PMN A;  3HWT A;  5J2D A;  4FHW A;  5IIJ A;  2BPC A;  4RPZ A;  4TUR A;  4GXK A;  3H38 A;  2PFP A;  5IIL A;  4AT7 B;  5CB1 A;  1KNY A;  9ICI A;  4YN4 A;  1TV9 A;  4YD1 A;  4YCX A;  2DR5 A;  3WFQ E;  4UD5 A;  4P4M A;  1ZQM A;  3C2M A;  3JYY A;  4YMO A;  2ISO A;  7ICN A;  2M2V A;  4AT7 A;  5J29 A;  3ISB A;  1BPZ A;  1MQ3 A;  3RJE A;  4RQ3 A;  3ISD A;  5J2E A;  4QZD A;  8ICQ A;  1ZQF A;  4QZE A;  3H37 A;  1JN3 A;  1BPE A;  5J2H A;  3RH6 A;  4MFC A;  8ICH A;  2ZH5 A;  4PHA A;  1XSN A;  1TVA A;  5J2K A;  1MIW A;  5TZV A;  4AT9 B;  2ZH8 A;  1ZJM A;  4PGY A;  5HRH A;  5F2V O;  5J2B A;  1ZQL A;  4R63 A;  1ZQN A;  4NKU A;  1F5A A;  3H3A A;  4WC1 A;  1V4A A;  4UAW A;  4UBC A;  4FHX A;  5HRD A;  4AT9 A;  8ICL A;  1R8C A;  4RWP A;  5DKW A;  5J2I A;  7ICE A;  2M2T A;  4EBK A;  4DOC A;  3RJH A;  3AQL A;  4NM1 A;  4X4T A;  4M2Y A;  7ICM A;  7ICI A;  4TUQ A;  1ZQY A;  2BCS A;  4I29 A;  4WBZ A;  3C5F A;  5HC9 A;  2PFQ A;  7ICS A;  3ISC A;  1BPD A;  3WFO A;  7ICG A;  3TFS A;  4R64 A;  3MGH A;  4NY8 A;  3B0Y A;  4XQ7 A;  4KLH A;  4DOA A;  4P4O A;  2VAN A;  4I2F A;  1ZQB A;  4QZ9 A;  1ZQO A;  9ICO A;  2ZHA A;  1JAJ A;  3L9D A;  3V7K A;  3V72 A;  4GXI A;  1ZQW A;  1ZQZ A;  4XUS A;  1R8B A; 
#chains in the Genus database with same CATH topology
 7ICJ A;  5B3Q A;  4X4U A;  4Z6C A;  5EOZ A;  1VJ7 A;  4OAH A;  4WBY A;  1BPY A;  1UEV A;  1OU5 A;  4RPX A;  4WC4 A;  5CFS A;  4I2G A;  2BCR A;  5D4B A;  9ICA A;  5J0W A;  3WFS C;  3H39 A;  4K8V A;  2ZH4 A;  2BCU A;  1MIV A;  4HX0 A;  1ZQG A;  4OAI Z;  5HR9 A;  5J0R A;  2DRA A;  3AU6 A;  3C18 A;  1RPL A;  1MIY A;  3C2K A;  4K99 A;  3NYB A;  4M04 A;  5DB9 A;  5CR0 A;  5DBC A;  4K9B A;  2ZH1 A;  2BCQ A;  4GXJ A;  9ICT A;  3OUY B;  8ICI A;  4NLZ A;  4X0A A;  4F5P A;  4IQU A;  4LEZ A;  4K98 A;  9ICN A;  3K7D A;  4UD4 A;  4LEY A;  2BE3 A;  8ICO A;  4K4G A;  4LVS A;  9ICJ A;  5DB6 A;  2EWR A;  1XSL A;  4RWN A;  3V7L A;  4F5N A;  4XA5 A;  4X4V A;  4O6A A;  9ICP A;  2HHP A;  4KLF A;  4EED A;  4M47 A;  5IIN A;  4NM2 A;  4M9G A;  3JPQ A;  7ICK A;  1ZJN A;  3UXN A;  4PHP A;  4E80 A;  3LK9 A;  4EBJ A;  4N7R A;  3UQ0 A;  2IHM A;  4PH5 A;  4X0B A;  3CK6 A;  2RFF A;  3NWI A;  4NXU A;  7ICO A;  4I2I A;  8ICY A;  3RJI A;  4P2H A;  4NXT A;  4O5C A;  9ICW A;  4WC0 A;  4WC2 A;  4I2E A;  1ZQH A;  7ICR A;  2ISP A;  3AU2 A;  3EF2 A;  2BCV A;  4M5D A;  3UXO A;  4PHD A;  2PFO A;  9ICM A;  4M9L A;  5D62 A;  5HHI A;  4M0A A;  3JPS A;  4YMM A;  4UB5 A;  4MFA A;  8ICV A;  5JTG A;  3PNC A;  2DVI A;  4M9J A;  4X4S A;  4MF8 A;  3OVS A;  8ICZ A;  4IQT A;  1RZT A;  3UXP A;  4TUS A;  4KLG A;  8ICF A;  4XQ8 A;  4KLO A;  3B0X A;  3PML A;  2ZH3 A;  4WQK A;  4FO6 A;  5CA7 A;  5HRG A;  5J2C A;  3C2L A;  1KDH A;  2ZHB A;  4MFF A;  4FH5 A;  4R65 A;  2ZH6 A;  4X4Q A;  2BBJ A;  1FA0 A;  2W9M A;  1ZQC A;  4YD2 A;  2M2W A;  4NXZ A;  5DBA A;  4DO9 A;  4X5V A;  5DEC A;  7ICV A;  4KLM A;  4KLU A;  5DDY A;  2GA9 D;  4K9A A;  2FCL A;  3AQN A;  4I0U A;  4JWN A;  9ICH A;  2Q66 A;  2B51 A;  5DB8 A;  9ICE A;  4I2C A;  3RJG A;  4O9M A;  4KLT A;  9ICL A;  4LT6 A;  4KM5 A;  4Z6E A;  5BOM A;  3HW8 A;  1MQ2 A;  3OVA A;  3MDC A;  2PXI A;  4O5K A;  4NLN A;  3WFR E;  7ICU A;  5IIK A;  4K4I A;  4NLK A;  7ICT A;  4RT3 A;  8ICT A;  2DR7 A;  4I27 A;  7ICQ A;  1ZQI A;  4UB4 A;  5D49 A;  3HIY A;  3MGI A;  1TFW A;  4YMN A;  8ICR A;  3AUO A;  4RWQ A;  4FHY A;  4Z6F A;  4KB6 A;  4RQ1 A;  4FH3 A;  2P66 A;  4K97 A;  4PPX A;  9ICF A;  5CFU A;  1ZQR A;  5DBB A;  3K75 D;  3RH5 A;  4MF2 A;  2O1P A;  5J0Q A;  4RQ6 A;  1ZQT A;  2ID1 A;  4F5Q A;  5DED A;  5J0T A;  7ICF A;  4QZC A;  4UAY A;  2PFN A;  4K4H A;  1KEJ A;  8ICN A;  8ICA A;  4O68 A;  4FHV A;  3OGU A;  7ICL A;  4WCW A;  4ATB B;  4PHE A;  4KLL A;  2ZH2 A;  2FMP A;  8ICE A;  9ICC A;  4I2J A;  5CHG A;  4TUP A;  3JPR A;  3NVO A;  4FHP A;  1BPB A;  5HRB A;  4S3N A;  3AQM A;  4RWO A;  4I2B A;  2FMS A;  5CFT A;  8ICS A;  4AT8 A;  4KLJ A;  4ATB A;  4E8F A;  4XRH A;  2BPG A;  4O5E A;  3JPN A;  9ICK A;  1R8A A;  5HRF A;  4O69 A;  4F5O A;  4MKP A;  4M9H A;  4RQ8 A;  4NXX A;  1NOM A;  3RJJ A;  4JWM A;  5III A;  3JZ0 A;  3UPS A;  3JPT A;  4K96 A;  3TFR A;  5HRL A;  8ICW A;  4UB1 A;  5J2J A;  4RPY A;  1BPX A;  1JQR A;  8ICM A;  2HN2 A;  4QZF A;  1PX5 A;  1ZQE A;  4X4N A;  3V7J A;  5CWR A;  8ICB A;  4IQW A;  3LQC B;  9ICU A;  2NRK A;  4RQ5 A;  1UET A;  1R89 A;  5J0S A;  1ZQS A;  5DDM A;  8ICX A;  4IQV A;  4I2H A;  2PBE A;  4RQ2 A;  1ZQQ A;  4JLZ A;  2FMQ A;  3RJF A;  1ZQK A;  9ICR A;  1ZQP A;  4F5R A;  4RQ7 A;  3HJ4 A;  5J0U A;  4KLS A;  9ICS A;  2BBH A;  2DRB A;  9ICQ A;  1YLQ A;  4DOB A;  4QZB A;  3C5G A;  5HHH A;  2GWS A;  1ZQD A;  1Q79 A;  4PGQ A;  3JPO A;  3OVB A;  4QZG A;  1VFG A;  4I2D A;  9ICX A;  4QZ8 A;  5J0X A;  3UPQ A;  4RT2 A;  1JMS A;  4QZH A;  3HJ1 A;  1TFY A;  4UBB A;  1GPJ A;  1UEU A;  4WC5 A;  1ZQX A;  2DR9 A;  2IHO A;  4R66 A;  3WFP A;  5J0Y A;  3JPP A;  4LEV A;  1HUZ A;  3NKU A;  4WOY A;  1WOT A;  8ICU A;  1ZQU A;  3OWG A;  4QZI A;  4FO1 A;  4EV6 A;  4X4O A;  5D61 A;  4EP7 A;  5CJ7 A;  2ZH7 A;  4RQ0 A;  4UB3 A;  2BPF A;  5CHE A;  5BPC A;  2IUB A;  4NXV A;  4WC6 A;  2DR8 A;  5BOL A;  4WC3 A;  3MBY A;  3AQK A;  9ICG A;  5J2F A;  5IIO A;  4PGX A;  5J0O A;  4KLE A;  5IIM A;  4I2A A;  9ICV A;  8ICJ A;  5HRK A;  4I28 A;  3UQ2 A;  4UB2 A;  8ICC A;  2I9G A;  4UAZ A;  1ZQJ A;  3MCR A;  5D46 A;  8ICG A;  4M9N A;  4IG8 A;  4P4P A;  4AT8 B;  5CP2 A;  3C66 A;  4LZD A;  4KLD A;  3RJK A;  4KLI A;  4X4P A;  7ICH A;  3HX0 A;  4NKT A;  1HUO A;  2GAF D;  5HRI A;  2O5A A;  3ER8 C;  4RQ4 A;  4X4R A;  4QZA A;  4JLX A;  9ICB A;  1ZQV A;  5HRE A;  5J2G A;  3MDA A;  3RH4 A;  3ER9 B;  5J2A A;  4WC7 A;  4WQL A;  8ICK A;  7ICP A;  5DB7 A;  1XSP A;  3GDX A;  2B56 A;  2M2U A;  4KLQ A;  4Z6D A;  4E7X A;  1ZQA A;  1NO5 A;  4LZG A;  1Q78 A;  5J0P A;  3OV7 A;  2ZH9 A;  3OUY A;  8ICP A;  3PMN A;  3HWT A;  4EGW A;  4O67 A;  5J2D A;  4FHW A;  5IIJ A;  2BPC A;  4RPZ A;  4TUR A;  4GXK A;  3H38 A;  5B3P A;  2PFP A;  5IIL A;  4AT7 B;  5CB1 A;  1KNY A;  9ICI A;  4YN4 A;  1TV9 A;  4YD1 A;  4YCX A;  2DR5 A;  3WFQ E;  4UD5 A;  4P4M A;  1ZQM A;  3C2M A;  3JYY A;  4YMO A;  2ISO A;  7ICN A;  2M2V A;  4AT7 A;  5J29 A;  3ISB A;  1BPZ A;  1MQ3 A;  3RJE A;  4WH5 A;  4RQ3 A;  3ISD A;  5J2E A;  4QZD A;  8ICQ A;  1ZQF A;  4QZE A;  3H37 A;  4NXW A;  1JN3 A;  1BPE A;  5J2H A;  3RH6 A;  4MFC A;  8ICH A;  2ZH5 A;  4PHA A;  1XSN A;  1TVA A;  5J2K A;  1MIW A;  5TZV A;  5D63 A;  4AT9 B;  2ZH8 A;  1ZJM A;  4PGY A;  5HRH A;  5F2V O;  5J2B A;  1ZQL A;  4OAG A;  4R63 A;  1ZQN A;  4NKU A;  1F5A A;  3H3A A;  4WC1 A;  1V4A A;  4UAW A;  4UBC A;  4FHX A;  5HRD A;  2B4V A;  4AT9 A;  3ERC C;  8ICL A;  1R8C A;  4RWP A;  5DKW A;  5J2I A;  7ICE A;  3PHZ A;  2M2T A;  4EBK A;  4DOC A;  4EEB A;  3AQL A;  3RJH A;  4NM1 A;  4X4T A;  4M2Y A;  7ICM A;  7ICI A;  4TUQ A;  1ZQY A;  2BCS A;  4I29 A;  4WBZ A;  3C5F A;  5HC9 A;  2PFQ A;  7ICS A;  3ISC A;  1BPD A;  3WFO A;  7ICG A;  3TFS A;  4R64 A;  3MGH A;  4NY8 A;  3JCF A;  3B0Y A;  4XQ7 A;  4OAF A;  4KLH A;  4DOA A;  4P4O A;  2VAN A;  4I2F A;  4LEW A;  4XJE A;  4QZ9 A;  1ZQB A;  1ZQO A;  9ICO A;  2ZHA A;  1JAJ A;  3L9D A;  3V7K A;  3V72 A;  4GXI A;  2HN1 A;  1ZQW A;  1ZQZ A;  4XUS A;  1R8B A; 
#chains in the Genus database with same CATH homology
 7ICJ A;  4X4U A;  4Z6C A;  5EOZ A;  1VJ7 A;  4WBY A;  1BPY A;  1UEV A;  1OU5 A;  4RPX A;  4WC4 A;  4I2G A;  2BCR A;  5D4B A;  9ICA A;  5J0W A;  3WFS C;  3H39 A;  2BCU A;  2ZH4 A;  1MIV A;  1ZQG A;  5HR9 A;  5J0R A;  2DRA A;  3AU6 A;  3C18 A;  1RPL A;  1MIY A;  3C2K A;  3NYB A;  4M04 A;  5DB9 A;  5CR0 A;  5DBC A;  2ZH1 A;  2BCQ A;  4GXJ A;  9ICT A;  3OUY B;  8ICI A;  4NLZ A;  4X0A A;  4F5P A;  4IQU A;  9ICN A;  4UD4 A;  2BE3 A;  8ICO A;  4K4G A;  4LVS A;  9ICJ A;  5DB6 A;  1XSL A;  4RWN A;  3V7L A;  4F5N A;  4XA5 A;  4X4V A;  9ICP A;  2HHP A;  4KLF A;  4M47 A;  5IIN A;  4NM2 A;  4M9G A;  3JPQ A;  7ICK A;  1ZJN A;  3UXN A;  4E80 A;  4PHP A;  3LK9 A;  4EBJ A;  3UQ0 A;  2IHM A;  4PH5 A;  4X0B A;  2RFF A;  7ICO A;  4I2I A;  8ICY A;  3RJI A;  4P2H A;  4O5C A;  9ICW A;  4WC0 A;  4WC2 A;  4I2E A;  1ZQH A;  7ICR A;  2ISP A;  3AU2 A;  2BCV A;  4M5D A;  3UXO A;  4PHD A;  2PFO A;  9ICM A;  4M9L A;  5HHI A;  4M0A A;  3JPS A;  4YMM A;  4UB5 A;  4MFA A;  8ICV A;  3PNC A;  2DVI A;  4M9J A;  4X4S A;  4MF8 A;  3OVS A;  8ICZ A;  4IQT A;  1RZT A;  3UXP A;  4TUS A;  4KLG A;  8ICF A;  4XQ8 A;  4KLO A;  3B0X A;  3PML A;  2ZH3 A;  4FO6 A;  5CA7 A;  5HRG A;  5J2C A;  3C2L A;  1KDH A;  2ZHB A;  4MFF A;  4FH5 A;  4R65 A;  2ZH6 A;  4X4Q A;  1FA0 A;  2W9M A;  1ZQC A;  4YD2 A;  2M2W A;  4NXZ A;  5DBA A;  4DO9 A;  4X5V A;  5DEC A;  7ICV A;  4KLM A;  4KLU A;  5DDY A;  3AQN A;  4JWN A;  9ICH A;  2Q66 A;  5DB8 A;  9ICE A;  4I2C A;  3RJG A;  4O9M A;  4KLT A;  9ICL A;  4LT6 A;  4Z6E A;  5BOM A;  3HW8 A;  1MQ2 A;  3OVA A;  3MDC A;  2PXI A;  4O5K A;  4NLN A;  3WFR E;  7ICU A;  5IIK A;  4K4I A;  4NLK A;  7ICT A;  4RT3 A;  8ICT A;  2DR7 A;  4I27 A;  7ICQ A;  1ZQI A;  4UB4 A;  5D49 A;  3HIY A;  3MGI A;  1TFW A;  4YMN A;  8ICR A;  3AUO A;  4RWQ A;  4FHY A;  4Z6F A;  4RQ1 A;  4FH3 A;  2P66 A;  4PPX A;  9ICF A;  1ZQR A;  5DBB A;  3K75 D;  3RH5 A;  4MF2 A;  2O1P A;  5J0Q A;  4RQ6 A;  1ZQT A;  2ID1 A;  4F5Q A;  5DED A;  5J0T A;  7ICF A;  4QZC A;  4UAY A;  2PFN A;  4K4H A;  1KEJ A;  8ICN A;  8ICA A;  4FHV A;  3OGU A;  7ICL A;  4WCW A;  4ATB B;  4PHE A;  4KLL A;  2ZH2 A;  2FMP A;  8ICE A;  9ICC A;  4I2J A;  5CHG A;  4TUP A;  3JPR A;  4FHP A;  1BPB A;  5HRB A;  4S3N A;  3AQM A;  4RWO A;  4I2B A;  2FMS A;  8ICS A;  4AT8 A;  4KLJ A;  4ATB A;  4E8F A;  4XRH A;  2BPG A;  4O5E A;  3JPN A;  9ICK A;  1R8A A;  5HRF A;  4F5O A;  4M9H A;  4RQ8 A;  1NOM A;  3RJJ A;  4JWM A;  5III A;  3JZ0 A;  3UPS A;  3JPT A;  3TFR A;  5HRL A;  8ICW A;  4UB1 A;  5J2J A;  4RPY A;  1BPX A;  1JQR A;  8ICM A;  4QZF A;  1PX5 A;  1ZQE A;  4X4N A;  3V7J A;  5CWR A;  8ICB A;  4IQW A;  3LQC B;  9ICU A;  2NRK A;  4RQ5 A;  1UET A;  1R89 A;  5J0S A;  1ZQS A;  5DDM A;  8ICX A;  4IQV A;  4I2H A;  2PBE A;  4RQ2 A;  1ZQQ A;  2FMQ A;  3RJF A;  1ZQK A;  9ICR A;  1ZQP A;  4F5R A;  4RQ7 A;  3HJ4 A;  5J0U A;  4KLS A;  9ICS A;  2DRB A;  9ICQ A;  1YLQ A;  4DOB A;  4QZB A;  3C5G A;  5HHH A;  2GWS A;  1ZQD A;  1Q79 A;  4PGQ A;  3JPO A;  3OVB A;  4QZG A;  1VFG A;  4I2D A;  9ICX A;  4QZ8 A;  5J0X A;  3UPQ A;  4RT2 A;  1JMS A;  4QZH A;  3HJ1 A;  1TFY A;  4UBB A;  1UEU A;  4WC5 A;  1ZQX A;  2DR9 A;  4R66 A;  3WFP A;  5J0Y A;  3JPP A;  1HUZ A;  1WOT A;  8ICU A;  1ZQU A;  4QZI A;  4X4O A;  4EP7 A;  5CJ7 A;  2ZH7 A;  4RQ0 A;  4UB3 A;  2BPF A;  5BPC A;  4WC6 A;  2DR8 A;  5BOL A;  4WC3 A;  3MBY A;  3AQK A;  9ICG A;  5J2F A;  5IIO A;  4PGX A;  5J0O A;  4KLE A;  5IIM A;  4I2A A;  9ICV A;  8ICJ A;  5HRK A;  4I28 A;  3UQ2 A;  4UB2 A;  8ICC A;  2I9G A;  4UAZ A;  1ZQJ A;  5D46 A;  8ICG A;  4M9N A;  4IG8 A;  4P4P A;  4AT8 B;  5CP2 A;  3C66 A;  4LZD A;  4KLD A;  3RJK A;  4KLI A;  4X4P A;  7ICH A;  3HX0 A;  4NKT A;  1HUO A;  5HRI A;  2O5A A;  4RQ4 A;  4X4R A;  4QZA A;  9ICB A;  1ZQV A;  5HRE A;  5J2G A;  3MDA A;  3RH4 A;  5J2A A;  4WC7 A;  8ICK A;  7ICP A;  5DB7 A;  1XSP A;  3GDX A;  2M2U A;  4KLQ A;  4Z6D A;  4E7X A;  1ZQA A;  1NO5 A;  4LZG A;  1Q78 A;  5J0P A;  3OV7 A;  2ZH9 A;  3OUY A;  8ICP A;  3PMN A;  3HWT A;  5J2D A;  4FHW A;  5IIJ A;  2BPC A;  4RPZ A;  4TUR A;  4GXK A;  3H38 A;  2PFP A;  5IIL A;  4AT7 B;  5CB1 A;  1KNY A;  9ICI A;  4YN4 A;  1TV9 A;  4YD1 A;  4YCX A;  2DR5 A;  3WFQ E;  4UD5 A;  4P4M A;  1ZQM A;  3C2M A;  3JYY A;  4YMO A;  2ISO A;  7ICN A;  2M2V A;  4AT7 A;  5J29 A;  3ISB A;  1BPZ A;  1MQ3 A;  3RJE A;  4RQ3 A;  3ISD A;  5J2E A;  4QZD A;  8ICQ A;  1ZQF A;  4QZE A;  3H37 A;  1JN3 A;  1BPE A;  5J2H A;  3RH6 A;  4MFC A;  8ICH A;  2ZH5 A;  4PHA A;  1XSN A;  1TVA A;  5J2K A;  1MIW A;  5TZV A;  4AT9 B;  2ZH8 A;  1ZJM A;  4PGY A;  5HRH A;  5F2V O;  5J2B A;  1ZQL A;  4R63 A;  1ZQN A;  4NKU A;  1F5A A;  3H3A A;  4WC1 A;  1V4A A;  4UAW A;  4UBC A;  4FHX A;  5HRD A;  4AT9 A;  8ICL A;  1R8C A;  4RWP A;  5DKW A;  5J2I A;  7ICE A;  2M2T A;  4EBK A;  4DOC A;  3RJH A;  3AQL A;  4NM1 A;  4X4T A;  4M2Y A;  7ICM A;  7ICI A;  4TUQ A;  1ZQY A;  2BCS A;  4I29 A;  4WBZ A;  3C5F A;  5HC9 A;  2PFQ A;  7ICS A;  3ISC A;  1BPD A;  3WFO A;  7ICG A;  3TFS A;  4R64 A;  3MGH A;  4NY8 A;  3B0Y A;  4XQ7 A;  4KLH A;  4DOA A;  4P4O A;  2VAN A;  4I2F A;  1ZQB A;  4QZ9 A;  1ZQO A;  9ICO A;  2ZHA A;  1JAJ A;  3L9D A;  3V7K A;  3V72 A;  4GXI A;  1ZQW A;  1ZQZ A;  4XUS A;  1R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...