2ID1A

X-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
MEIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVLVDAGDVVVHVMLPAVRDYYDIEALWGGQKPSFAVGAAKPWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
source organism Chromobacterium violaceum
total genus 28
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2id1A01
4NLZA 1YLQA 2ZH9A 1ZJMA 3RJFA 4RQ6A 4LZDA 4QZIA 3C5GA 7ICJA 4KLJA 1KDHA 4I2FA 9ICOA 4PPXA 4RQ4A 1R89A 1ZQIA 4WBZA 3C2LA 4UAZA 9ICIA 4R64A 1XSPA 1ZQNA 2PFPA 2ZH5A 7ICRA 3JPNA 3OV7A 4M2YA 4X0AA 4AT9B 4YCXA 3TFSA 3RH5A 7ICHA 2IHMA 9ICRA 5J0PA 4RWPA 8ICBA 1F5AA 2M2TA 4X4TA 1ZQVA 4K4GA 3HJ4A 4RQ3A 3HX0A 4WC4A 9ICLA 4FH5A 4JWMA 1ZQRA 1TVAA 4P4MA 4I2AA 3PNCA 1MIVA 4UD5A 4F5OA 4X5VA 2PFQA 5IIKA 1JQRA 3PMLA 1ZQWA 1ZQLA 3UPQA 2BCRA 2PBEA 4NKTA 3HW8A 4I29A 4UAWA 9ICSA 4M04A 3ISDA 4R63A 2ZH6A 9ICWA 4KLLA 8ICLA 8ICTA 1RPLA 2GWSA 3AU2A 4QZGA 4AT9A 3C5FA 7ICSA 4UB4A 1WOTA 4P4PA 8ICJA 4Z6FA 4PHAA 9ICMA 4KLMA 5HREA 2NRKA 3OVBA 8ICGA 4NM2A 3PMNA 2BCVA 8ICXA 9ICBA 9ICGA 4X4UA 4IQVA 4GXJA 5DEDA 5DKWA 4F5PA 2Q66A 4I2DA 1UEUA 4FHYA 3V7JA 4YMMA 4YD2A 5DB6A 3HWTA 5TZVA 4QZBA 1ZJNA 9ICXA 4XA5A 2BPGA 4R66A 2DR8A 4P4OA 4I2CA 4F5RA 3H37A 4K4IA 4KLSA 5HRLA 5D4BA 4PGQA 2DVIA 7ICKA 4WC7A 1MIYA 1TFWA 4QZAA 4KLFA 3ISCA 1ZQYA 5CWRA 2DRBA 4DO9A 4PGXA 3UQ0A 1BPDA 7ICTA 3WFOA 3OVSA 1BPBA 5J0XA 4KLQA 4PHDA 5J2JA 8ICFA 4E80A 3GDXA 4M47A 2W9MA 4QZEA 4DOAA 2FMSA 4M5DA 2HHPA 3RJJA 4UBCA 4X4VA 8ICVA 4YMNA 4I2GA 4AT7A 4GXKA 3MGHA 9ICQA 5J0YA 4IQWA 3AU6A 4Z6DA 4PHPA 5CR0A 4IG8A 5HRFA 3V7LA 5DB8A 4WCWA 2O1PA 5CHGA 3UQ2A 4S3NA 2M2WA 4UBBA 2RFFA 4WC3A 4I2IA 7ICOA 7ICFA 1R8BA 3RJEA 3MDAA 4KLIA 4WBYA 2FMQA 4QZHA 1UETA 4UD4A 3C18A 4NXZA 3JZ0A 3MGIA 1ZQJA 7ICNA 4I27A 2PFOA 1HUZA 3MBYA 9ICAA 8ICZA 3WFRE 5IIJA 3WFSC 3B0XA 3NYBA 4O5KA 3AQKA 4I2JA 2ZH1A 5HHHA 5HR9A 5F2VO 4P2HA 5BOMA 2ISPA 1VJ7A 4XQ7A 4M9LA 4FHVA 1KNYA 4GXIA 4FHPA 2ZH3A 1PX5A 4UB2A 1ZQCA 7ICVA 4RPZA 2BCQA 4KLTA 4RPYA 1JMSA 4KLOA 4I2EA 5DBCA 8ICIA 4NM1A 4IQTA 9ICVA 3UPSA 3UXNA 5IILA 3H3AA 2BCUA 3RH6A 8ICQA 8ICRA 5DDMA 1BPYA 3HJ1A 4O9MA 2BE3A 9ICPA 2ZH4A 1NOMA 5HRGA 4QZDA 4TUPA 2M2VA 2BCSA 5DB7A 1ZQMA 5J0UA 3K75D 8ICEA 4E8FA 4RQ8A 2BPCA 8ICNA 4I2BA 9ICKA 1BPEA 1R8CA 5CB1A 2P66A 4AT7B 4YD1A 4Z6CA 3OVAA 4O5CA 4RWOA 4XRHA 3TFRA 4AT8A 4IQUA 4FHXA 1OU5A 5HHIA 5DBBA 1ZQFA 4I2HA 7ICQA 7ICUA 4MF2A 3RJIA 1XSNA 1Q78A 3B0YA 3UXPA 2ZHBA 5HC9A 5IINA 4X4OA 4RT3A 2ZH7A 3RH4A 4X4PA 4TUQA 1MIWA 3JPTA 1KEJA 2DRAA 1UEVA 4RQ0A 4WC6A 3AUOA 4XUSA 7ICEA 5J2KA 7ICGA 4UB3A 3RJKA 1ZQSA 3OUYA 4KLHA 4NY8A 1FA0A 4WC0A 4DOCA 1MQ2A 9ICJA 9ICUA 5J2AA 4K4HA 4UAYA 5HRBA 4FO6A 8ICSA 4TURA 4RT2A 3HIYA 1ZQAA 5J2BA 9ICNA 2DR9A 8ICCA 4KLEA 2ZH2A 5J0SA 4EP7A 4LVSA 4NKUA 1V4AA 7ICIA 5IIMA 4UB5A 4RQ2A 2I9GA 1JN3A 1BPXA 4RQ7A 4MF8A 1ZQGA 1RZTA 3JPQA 1ZQBA 1ZQKA 9ICFA 1ZQDA 2DR7A 3JYYA 2ZHAA 5IIOA 4NLNA 4MFFA 1XSLA 5J0OA 2PFNA 1ZQHA 8ICOA 5J0WA 5J2FA 3RJGA 3ISBA 4QZ8A 4X4QA 4PH5A 3L9DA 8ICWA 5DBAA 5J2DA 5J2GA 5CJ7A 4M9JA 2M2UA 1R8AA 3C66A 2BPFA 4I28A 8ICHA 1NO5A 4LZGA 5J2CA 4M9HA 3WFPA 9ICTA 4KLUA 4AT8B 5J2HA 5BOLA 4M9GA 4YMOA 3UXOA 4QZFA 8ICUA 4RPXA 5CA7A 4LT6A 1ZQQA 8ICYA 1ZQTA 4RWNA 4E7XA 3JPSA 1TFYA 8ICKA 7ICPA 5CP2A 5HRKA 4O5EA 4FH3A 5HRHA 4KLDA 4PGYA 4Z6EA 3WFQE 4RQ5A 4M0AA 4WC1A 1Q79A 5DB9A 3MDCA 3OUYB 5BPCA 8ICPA 5J2IA 7ICLA 2ISOA 9ICCA 2ZH8A 1JAJA 1MQ3A 2O5AA 1BPZA 3AQNA 5J0QA 1ZQOA 2PXIA 4EBJA 4F5QA 4X4NA 1ZQXA 4F5NA 5HRDA 4UB1A 3OGUA 5EOZA 8ICAA 4ATBB 5J0RA 4X4SA 4KLGA 1VFGA 4DOBA 4R65A 9ICEA 4RWQA 3V7KA 4TUSA 3RJHA 1ZQEA 5HRIA 2DR5A 8ICMA 4FHWA 5J2EA 4WC5A 5DDYA 3AQMA 4MFCA 7ICMA 3LK9A 2FMPA 4QZ9A 5DECA 4M9NA 2ID1A 2VANA 4WC2A 4NLKA 3H39A 5D49A 3JPRA 3LQCB 1TV9A 4XQ8A 4EBKA 5IIIA 3C2KA 4RQ1A 3JPPA 3H38A 3C2MA 3JPOA 5J0TA 4YN4A 4X4RA 5J29A 4QZCA 1HUOA 4ATBA 5D46A 9ICHA 4JWNA 4PHEA 1ZQPA 4X0BA 1ZQUA 3V72A 1ZQZA 4MFAA 3AQLA
chains in the Genus database with same CATH superfamily
4NLZA 1YLQA 2ZH9A 4K96A 1ZJMA 4O69A 3RJFA 4RQ6A 4LZDA 4QZIA 3C5GA 7ICJA 4KLJA 1KDHA 4I2FA 9ICOA 3CK6A 4PPXA 4RQ4A 1R89A 1ZQIA 4WBZA 3C2LA 4UAZA 2HN1A 9ICIA 4R64A 1XSPA 1ZQNA 2PFPA 2ZH5A 7ICRA 3JPNA 4FO1A 3OV7A 4M2YA 4X0AA 4AT9B 4YCXA 3TFSA 3RH5A 7ICHA 2IHMA 9ICRA 5J0PA 4RWPA 8ICBA 1F5AA 4NXVA 5D61A 2M2TA 4X4TA 1ZQVA 4K4GA 3HJ4A 4RQ3A 3HX0A 4WC4A 9ICLA 4FH5A 4JWMA 1ZQRA 3MCRA 1TVAA 4P4MA 4I2AA 5CHEA 3PNCA 1MIVA 4UD5A 4F5OA 4X5VA 2PFQA 5IIKA 1JQRA 4O6AA 3PMLA 1ZQWA 1ZQLA 4WQKA 3UPQA 2BCRA 3ERCC 4EEBA 2PBEA 4NKTA 3HW8A 4I29A 4UAWA 3K7DA 4LEYA 4JLXA 9ICSA 5D63A 4EGWA 4M04A 3ISDA 4R63A 2ZH6A 9ICWA 4KLLA 4LEZA 8ICLA 8ICTA 1RPLA 2GWSA 3AU2A 4QZGA 4AT9A 3C5FA 7ICSA 4UB4A 1WOTA 4P4PA 8ICJA 3ER9B 4Z6FA 4PHAA 9ICMA 4LEWA 3NVOA 4KLMA 5HREA 2NRKA 4OAHA 3OVBA 4XJEA 8ICGA 4NM2A 3PMNA 2BCVA 8ICXA 9ICBA 9ICGA 4X4UA 4IQVA 4GXJA 5DEDA 5DKWA 4F5PA 2Q66A 4I2DA 1UEUA 4FHYA 3V7JA 4YMMA 4YD2A 5DB6A 3HWTA 2B4VA 4QZBA 5TZVA 1ZJNA 9ICXA 4XA5A 2BPGA 5CFSA 4R66A 2DR8A 4K9AA 4P4OA 4I2CA 4F5RA 3H37A 4K4IA 4KLSA 5HRLA 5D4BA 4PGQA 2DVIA 7ICKA 4WC7A 1MIYA 1TFWA 4QZAA 4KLFA 3ISCA 1ZQYA 2GA9D 5CWRA 2DRBA 4DO9A 4PGXA 3UQ0A 1BPDA 4OAGA 3WFOA 7ICTA 3OVSA 1BPBA 5J0XA 4KLQA 4PHDA 5J2JA 8ICFA 4E80A 3GDXA 4M47A 2W9MA 4O68A 4QZEA 4DOAA 4M5DA 2HHPA 2HN2A 2FMSA 3RJJA 4UBCA 4X4VA 8ICVA 4YMNA 4K98A 4I2GA 4AT7A 4GXKA 3MGHA 9ICQA 5J0YA 4IQWA 3AU6A 4Z6DA 4PHPA 5CR0A 4IG8A 5HRFA 3V7LA 5DB8A 4WCWA 2O1PA 5CHGA 3UQ2A 4S3NA 5B3QA 2M2WA 3PHZA 2RFFA 4WC3A 4UBBA 3JCFA 4I2IA 7ICOA 7ICFA 1R8BA 3RJEA 3MDAA 4KLIA 4WBYA 2FMQA 4QZHA 1UETA 4UD4A 3C18A 4NXZA 3JZ0A 3MGIA 1ZQJA 4HX0A 4I27A 7ICNA 2PFOA 1HUZA 3MBYA 9ICAA 8ICZA 4NXUA 3WFRE 5IIJA 2IUBA 3WFSC 3B0XA 3NYBA 4O5KA 3AQKA 4I2JA 2ZH1A 5HHHA 5HR9A 4KB6A 4K9BA 5F2VO 4P2HA 5BOMA 2ISPA 1VJ7A 4XQ7A 4NXTA 4M9LA 3OWGA 4FHVA 1KNYA 4GXIA 4FHPA 2ZH3A 1PX5A 4UB2A 1ZQCA 7ICVA 4RPZA 2BCQA 4KLTA 2B51A 4RPYA 4LEVA 1JMSA 4KLOA 4I2EA 5DBCA 8ICIA 4NM1A 4IQTA 9ICVA 5D62A 3UPSA 3UXNA 5JTGA 3H3AA 5IILA 2BCUA 3RH6A 8ICQA 8ICRA 5DDMA 1BPYA 3HJ1A 4I0UA 2BE3A 4O9MA 2ZH4A 9ICPA 1NOMA 5HRGA 4QZDA 4TUPA 2M2VA 2BCSA 5CFTA 5DB7A 1ZQMA 5J0UA 4JLZA 3K75D 8ICEA 4E8FA 4RQ8A 2BPCA 8ICNA 2EWRA 4I2BA 9ICKA 1BPEA 1R8CA 5CB1A 2P66A 4AT7B 4YD1A 4O67A 4Z6CA 3OVAA 4O5CA 4K8VA 4RWOA 4XRHA 3TFRA 4AT8A 4IQUA 4FHXA 1OU5A 5HHIA 5DBBA 1ZQFA 4I2HA 7ICQA 7ICUA 4MKPA 4MF2A 3RJIA 4K97A 1XSNA 1Q78A 3B0YA 3UXPA 2ZHBA 5HC9A 5IINA 4OAIZ 4X4OA 5CFUA 4RT3A 2ZH7A 3RH4A 4X4PA 4TUQA 1MIWA 3JPTA 1KEJA 4OAFA 2DRAA 1UEVA 4RQ0A 4WC6A 3AUOA 4XUSA 7ICEA 5J2KA 7ICGA 4UB3A 3RJKA 1ZQSA 3OUYA 4KLHA 4NY8A 1FA0A 4WC0A 4DOCA 1MQ2A 9ICJA 9ICUA 5J2AA 4K4HA 4UAYA 5HRBA 4FO6A 8ICSA 4TURA 4RT2A 3HIYA 1ZQAA 5J2BA 2GAFD 9ICNA 2DR9A 3EF2A 8ICCA 4KLEA 2ZH2A 5J0SA 4EP7A 4LVSA 4NKUA 1V4AA 7ICIA 5IIMA 4UB5A 4RQ2A 2I9GA 1JN3A 1BPXA 4RQ7A 4MF8A 1ZQGA 1RZTA 3JPQA 1ZQBA 1ZQKA 9ICFA 1ZQDA 2DR7A 3JYYA 2ZHAA 5IIOA 4NLNA 4MFFA 1XSLA 5J0OA 2PFNA 1ZQHA 8ICOA 5J0WA 5J2FA 3RJGA 3ISBA 4QZ8A 4X4QA 4PH5A 3L9DA 8ICWA 5DBAA 5J2DA 5J2GA 5CJ7A 4M9JA 2M2UA 1R8AA 3C66A 2BPFA 4I28A 8ICHA 4WQLA 1NO5A 4LZGA 5J2CA 4M9HA 3WFPA 9ICTA 4KLUA 4AT8B 5J2HA 5BOLA 4M9GA 4YMOA 3UXOA 4QZFA 8ICUA 4RPXA 5CA7A 4LT6A 4NXWA 4WH5A 1ZQQA 4N7RA 8ICYA 1ZQTA 4RWNA 4E7XA 3JPSA 1TFYA 4WOYA 2FCLA 8ICKA 7ICPA 5CP2A 5HRKA 4O5EA 4FH3A 5HRHA 4KLDA 3NKUA 2BBHA 4PGYA 4Z6EA 3WFQE 4RQ5A 4M0AA 4WC1A 1Q79A 4K99A 5DB9A 3MDCA 3OUYB 2B56A 5BPCA 8ICPA 5J2IA 7ICLA 2ISOA 4KM5A 9ICCA 2ZH8A 1JAJA 1MQ3A 2O5AA 1BPZA 3AQNA 5J0QA 1GPJA 1ZQOA 2PXIA 4EBJA 4F5QA 4X4NA 1ZQXA 4F5NA 5HRDA 4UB1A 3OGUA 5EOZA 8ICAA 4ATBB 5J0RA 4X4SA 4KLGA 1VFGA 4DOBA 4R65A 9ICEA 4RWQA 3V7KA 4TUSA 3RJHA 1ZQEA 5HRIA 2DR5A 8ICMA 4FHWA 5J2EA 5B3PA 4WC5A 5DDYA 3AQMA 4MFCA 7ICMA 3LK9A 2FMPA 4QZ9A 5DECA 4M9NA 4NXXA 3ER8C 2ID1A 2VANA 4WC2A 4NLKA 3H39A 5D49A 3JPRA 3LQCB 1TV9A 4XQ8A 4EBKA 5IIIA 3C2KA 4RQ1A 3JPPA 3H38A 3C2MA 3JPOA 5J0TA 4YN4A 4EV6A 4X4RA 2BBJA 4EEDA 5J29A 4QZCA 1HUOA 2IHOA 4ATBA 5D46A 9ICHA 4JWNA 4PHEA 1ZQPA 3NWIA 4X0BA 1ZQUA 3V72A 1ZQZA 4MFAA 3AQLA
chains in the Genus database with same CATH topology
4NLZA 1YLQA 2ZH9A 1ZJMA 3RJFA 4RQ6A 4LZDA 4QZIA 3C5GA 7ICJA 4KLJA 1KDHA 4I2FA 9ICOA 4PPXA 4RQ4A 1R89A 1ZQIA 4WBZA 3C2LA 4UAZA 9ICIA 4R64A 1XSPA 1ZQNA 2PFPA 2ZH5A 7ICRA 3JPNA 3OV7A 4M2YA 4X0AA 4AT9B 4YCXA 3TFSA 3RH5A 7ICHA 2IHMA 9ICRA 5J0PA 4RWPA 8ICBA 1F5AA 2M2TA 4X4TA 1ZQVA 4K4GA 3HJ4A 4RQ3A 3HX0A 4WC4A 9ICLA 4FH5A 4JWMA 1ZQRA 1TVAA 4P4MA 4I2AA 3PNCA 1MIVA 4UD5A 4F5OA 4X5VA 2PFQA 5IIKA 1JQRA 3PMLA 1ZQWA 1ZQLA 3UPQA 2BCRA 2PBEA 4NKTA 3HW8A 4I29A 4UAWA 9ICSA 4M04A 3ISDA 4R63A 2ZH6A 9ICWA 4KLLA 8ICLA 8ICTA 1RPLA 2GWSA 3AU2A 4QZGA 4AT9A 3C5FA 7ICSA 4UB4A 1WOTA 4P4PA 8ICJA 4Z6FA 4PHAA 9ICMA 4KLMA 5HREA 2NRKA 3OVBA 8ICGA 4NM2A 3PMNA 2BCVA 8ICXA 9ICBA 9ICGA 4X4UA 4IQVA 4GXJA 5DEDA 5DKWA 4F5PA 2Q66A 4I2DA 1UEUA 4FHYA 3V7JA 4YMMA 4YD2A 5DB6A 3HWTA 5TZVA 4QZBA 1ZJNA 9ICXA 4XA5A 2BPGA 4R66A 2DR8A 4P4OA 4I2CA 4F5RA 3H37A 4K4IA 4KLSA 5HRLA 5D4BA 4PGQA 2DVIA 7ICKA 4WC7A 1MIYA 1TFWA 4QZAA 4KLFA 3ISCA 1ZQYA 5CWRA 2DRBA 4DO9A 4PGXA 3UQ0A 1BPDA 7ICTA 3WFOA 3OVSA 1BPBA 5J0XA 4KLQA 4PHDA 5J2JA 8ICFA 4E80A 3GDXA 4M47A 2W9MA 4QZEA 4DOAA 2FMSA 4M5DA 2HHPA 3RJJA 4UBCA 4X4VA 8ICVA 4YMNA 4I2GA 4AT7A 4GXKA 3MGHA 9ICQA 5J0YA 4IQWA 3AU6A 4Z6DA 4PHPA 5CR0A 4IG8A 5HRFA 3V7LA 5DB8A 4WCWA 2O1PA 5CHGA 3UQ2A 4S3NA 2M2WA 4UBBA 2RFFA 4WC3A 4I2IA 7ICOA 7ICFA 1R8BA 3RJEA 3MDAA 4KLIA 4WBYA 2FMQA 4QZHA 1UETA 4UD4A 3C18A 4NXZA 3JZ0A 3MGIA 1ZQJA 7ICNA 4I27A 2PFOA 1HUZA 3MBYA 9ICAA 8ICZA 3WFRE 5IIJA 3WFSC 3B0XA 3NYBA 4O5KA 3AQKA 4I2JA 2ZH1A 5HHHA 5HR9A 5F2VO 4P2HA 5BOMA 2ISPA 1VJ7A 4XQ7A 4M9LA 4FHVA 1KNYA 4GXIA 4FHPA 2ZH3A 1PX5A 4UB2A 1ZQCA 7ICVA 4RPZA 2BCQA 4KLTA 4RPYA 1JMSA 4KLOA 4I2EA 5DBCA 8ICIA 4NM1A 4IQTA 9ICVA 3UPSA 3UXNA 5IILA 3H3AA 2BCUA 3RH6A 8ICQA 8ICRA 5DDMA 1BPYA 3HJ1A 4O9MA 2BE3A 9ICPA 2ZH4A 1NOMA 5HRGA 4QZDA 4TUPA 2M2VA 2BCSA 5DB7A 1ZQMA 5J0UA 3K75D 8ICEA 4E8FA 4RQ8A 2BPCA 8ICNA 4I2BA 9ICKA 1BPEA 1R8CA 5CB1A 2P66A 4AT7B 4YD1A 4Z6CA 3OVAA 4O5CA 4RWOA 4XRHA 3TFRA 4AT8A 4IQUA 4FHXA 1OU5A 5HHIA 5DBBA 1ZQFA 4I2HA 7ICQA 7ICUA 4MF2A 3RJIA 1XSNA 1Q78A 3B0YA 3UXPA 2ZHBA 5HC9A 5IINA 4X4OA 4RT3A 2ZH7A 3RH4A 4X4PA 4TUQA 1MIWA 3JPTA 1KEJA 2DRAA 1UEVA 4RQ0A 4WC6A 3AUOA 4XUSA 7ICEA 5J2KA 7ICGA 4UB3A 3RJKA 1ZQSA 3OUYA 4KLHA 4NY8A 1FA0A 4WC0A 4DOCA 1MQ2A 9ICJA 9ICUA 5J2AA 4K4HA 4UAYA 5HRBA 4FO6A 8ICSA 4TURA 4RT2A 3HIYA 1ZQAA 5J2BA 9ICNA 2DR9A 8ICCA 4KLEA 2ZH2A 5J0SA 4EP7A 4LVSA 4NKUA 1V4AA 7ICIA 5IIMA 4UB5A 4RQ2A 2I9GA 1JN3A 1BPXA 4RQ7A 4MF8A 1ZQGA 1RZTA 3JPQA 1ZQBA 1ZQKA 9ICFA 1ZQDA 2DR7A 3JYYA 2ZHAA 5IIOA 4NLNA 4MFFA 1XSLA 5J0OA 2PFNA 1ZQHA 8ICOA 5J0WA 5J2FA 3RJGA 3ISBA 4QZ8A 4X4QA 4PH5A 3L9DA 8ICWA 5DBAA 5J2DA 5J2GA 5CJ7A 4M9JA 2M2UA 1R8AA 3C66A 2BPFA 4I28A 8ICHA 1NO5A 4LZGA 5J2CA 4M9HA 3WFPA 9ICTA 4KLUA 4AT8B 5J2HA 5BOLA 4M9GA 4YMOA 3UXOA 4QZFA 8ICUA 4RPXA 5CA7A 4LT6A 1ZQQA 8ICYA 1ZQTA 4RWNA 4E7XA 3JPSA 1TFYA 8ICKA 7ICPA 5CP2A 5HRKA 4O5EA 4FH3A 5HRHA 4KLDA 4PGYA 4Z6EA 3WFQE 4RQ5A 4M0AA 4WC1A 1Q79A 5DB9A 3MDCA 3OUYB 5BPCA 8ICPA 5J2IA 7ICLA 2ISOA 9ICCA 2ZH8A 1JAJA 1MQ3A 2O5AA 1BPZA 3AQNA 5J0QA 1ZQOA 2PXIA 4EBJA 4F5QA 4X4NA 1ZQXA 4F5NA 5HRDA 4UB1A 3OGUA 5EOZA 8ICAA 4ATBB 5J0RA 4X4SA 4KLGA 1VFGA 4DOBA 4R65A 9ICEA 4RWQA 3V7KA 4TUSA 3RJHA 1ZQEA 5HRIA 2DR5A 8ICMA 4FHWA 5J2EA 4WC5A 5DDYA 3AQMA 4MFCA 7ICMA 3LK9A 2FMPA 4QZ9A 5DECA 4M9NA 2ID1A 2VANA 4WC2A 4NLKA 3H39A 5D49A 3JPRA 3LQCB 1TV9A 4XQ8A 4EBKA 5IIIA 3C2KA 4RQ1A 3JPPA 3H38A 3C2MA 3JPOA 5J0TA 4YN4A 4X4RA 5J29A 4QZCA 1HUOA 4ATBA 5D46A 9ICHA 4JWNA 4PHEA 1ZQPA 4X0BA 1ZQUA 3V72A 1ZQZA 4MFAA 3AQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLZ A;  1YLQ A;  2ZH9 A;  1ZJM A;  3RJF A;  4RQ6 A;  4LZD A;  4QZI A;  3C5G A;  7ICJ A;  4KLJ A;  1KDH A;  4I2F A;  9ICO A;  4PPX A;  4RQ4 A;  1R89 A;  1ZQI A;  4WBZ A;  3C2L A;  4UAZ A;  9ICI A;  4R64 A;  1XSP A;  1ZQN A;  2PFP A;  2ZH5 A;  7ICR A;  3JPN A;  3OV7 A;  4M2Y A;  4X0A A;  4AT9 B;  4YCX A;  3TFS A;  3RH5 A;  7ICH A;  2IHM A;  9ICR A;  5J0P A;  4RWP A;  8ICB A;  1F5A A;  2M2T A;  4X4T A;  1ZQV A;  4K4G A;  3HJ4 A;  4RQ3 A;  3HX0 A;  4WC4 A;  9ICL A;  4FH5 A;  4JWM A;  1ZQR A;  1TVA A;  4P4M A;  4I2A A;  3PNC A;  1MIV A;  4UD5 A;  4F5O A;  4X5V A;  2PFQ A;  5IIK A;  1JQR A;  3PML A;  1ZQW A;  1ZQL A;  3UPQ A;  2BCR A;  2PBE A;  4NKT A;  3HW8 A;  4I29 A;  4UAW A;  9ICS A;  4M04 A;  3ISD A;  4R63 A;  2ZH6 A;  9ICW A;  4KLL A;  8ICL A;  8ICT A;  1RPL A;  2GWS A;  3AU2 A;  4QZG A;  4AT9 A;  3C5F A;  7ICS A;  4UB4 A;  1WOT A;  4P4P A;  8ICJ A;  4Z6F A;  4PHA A;  9ICM A;  4KLM A;  5HRE A;  2NRK A;  3OVB A;  8ICG A;  4NM2 A;  3PMN A;  2BCV A;  8ICX A;  9ICB A;  9ICG A;  4X4U A;  4IQV A;  4GXJ A;  5DED A;  5DKW A;  4F5P A;  2Q66 A;  4I2D A;  1UEU A;  4FHY A;  3V7J A;  4YMM A;  4YD2 A;  5DB6 A;  3HWT A;  5TZV A;  4QZB A;  1ZJN A;  9ICX A;  4XA5 A;  2BPG A;  4R66 A;  2DR8 A;  4P4O A;  4I2C A;  4F5R A;  3H37 A;  4K4I A;  4KLS A;  5HRL A;  5D4B A;  4PGQ A;  2DVI A;  7ICK A;  4WC7 A;  1MIY A;  1TFW A;  4QZA A;  4KLF A;  3ISC A;  1ZQY A;  5CWR A;  2DRB A;  4DO9 A;  4PGX A;  3UQ0 A;  1BPD A;  7ICT A;  3WFO A;  3OVS A;  1BPB A;  5J0X A;  4KLQ A;  4PHD A;  5J2J A;  8ICF A;  4E80 A;  3GDX A;  4M47 A;  2W9M A;  4QZE A;  4DOA A;  2FMS A;  4M5D A;  2HHP A;  3RJJ A;  4UBC A;  4X4V A;  8ICV A;  4YMN A;  4I2G A;  4AT7 A;  4GXK A;  3MGH A;  9ICQ A;  5J0Y A;  4IQW A;  3AU6 A;  4Z6D A;  4PHP A;  5CR0 A;  4IG8 A;  5HRF A;  3V7L A;  5DB8 A;  4WCW A;  2O1P A;  5CHG A;  3UQ2 A;  4S3N A;  2M2W A;  4UBB A;  2RFF A;  4WC3 A;  4I2I A;  7ICO A;  7ICF A;  1R8B A;  3RJE A;  3MDA A;  4KLI A;  4WBY A;  2FMQ A;  4QZH A;  1UET A;  4UD4 A;  3C18 A;  4NXZ A;  3JZ0 A;  3MGI A;  1ZQJ A;  7ICN A;  4I27 A;  2PFO A;  1HUZ A;  3MBY A;  9ICA A;  8ICZ A;  3WFR E;  5IIJ A;  3WFS C;  3B0X A;  3NYB A;  4O5K A;  3AQK A;  4I2J A;  2ZH1 A;  5HHH A;  5HR9 A;  5F2V O;  4P2H A;  5BOM A;  2ISP A;  1VJ7 A;  4XQ7 A;  4M9L A;  4FHV A;  1KNY A;  4GXI A;  4FHP A;  2ZH3 A;  1PX5 A;  4UB2 A;  1ZQC A;  7ICV A;  4RPZ A;  2BCQ A;  4KLT A;  4RPY A;  1JMS A;  4KLO A;  4I2E A;  5DBC A;  8ICI A;  4NM1 A;  4IQT A;  9ICV A;  3UPS A;  3UXN A;  5IIL A;  3H3A A;  2BCU A;  3RH6 A;  8ICQ A;  8ICR A;  5DDM A;  1BPY A;  3HJ1 A;  4O9M A;  2BE3 A;  9ICP A;  2ZH4 A;  1NOM A;  5HRG A;  4QZD A;  4TUP A;  2M2V A;  2BCS A;  5DB7 A;  1ZQM A;  5J0U A;  3K75 D;  8ICE A;  4E8F A;  4RQ8 A;  2BPC A;  8ICN A;  4I2B A;  9ICK A;  1BPE A;  1R8C A;  5CB1 A;  2P66 A;  4AT7 B;  4YD1 A;  4Z6C A;  3OVA A;  4O5C A;  4RWO A;  4XRH A;  3TFR A;  4AT8 A;  4IQU A;  4FHX A;  1OU5 A;  5HHI A;  5DBB A;  1ZQF A;  4I2H A;  7ICQ A;  7ICU A;  4MF2 A;  3RJI A;  1XSN A;  1Q78 A;  3B0Y A;  3UXP A;  2ZHB A;  5HC9 A;  5IIN A;  4X4O A;  4RT3 A;  2ZH7 A;  3RH4 A;  4X4P A;  4TUQ A;  1MIW A;  3JPT A;  1KEJ A;  2DRA A;  1UEV A;  4RQ0 A;  4WC6 A;  3AUO A;  4XUS A;  7ICE A;  5J2K A;  7ICG A;  4UB3 A;  3RJK A;  1ZQS A;  3OUY A;  4KLH A;  4NY8 A;  1FA0 A;  4WC0 A;  4DOC A;  1MQ2 A;  9ICJ A;  9ICU A;  5J2A A;  4K4H A;  4UAY A;  5HRB A;  4FO6 A;  8ICS A;  4TUR A;  4RT2 A;  3HIY A;  1ZQA A;  5J2B A;  9ICN A;  2DR9 A;  8ICC A;  4KLE A;  2ZH2 A;  5J0S A;  4EP7 A;  4LVS A;  4NKU A;  1V4A A;  7ICI A;  5IIM A;  4UB5 A;  4RQ2 A;  2I9G A;  1JN3 A;  1BPX A;  4RQ7 A;  4MF8 A;  1ZQG A;  1RZT A;  3JPQ A;  1ZQB A;  1ZQK A;  9ICF A;  1ZQD A;  2DR7 A;  3JYY A;  2ZHA A;  5IIO A;  4NLN A;  4MFF A;  1XSL A;  5J0O A;  2PFN A;  1ZQH A;  8ICO A;  5J0W A;  5J2F A;  3RJG A;  3ISB A;  4QZ8 A;  4X4Q A;  4PH5 A;  3L9D A;  8ICW A;  5DBA A;  5J2D A;  5J2G A;  5CJ7 A;  4M9J A;  2M2U A;  1R8A A;  3C66 A;  2BPF A;  4I28 A;  8ICH A;  1NO5 A;  4LZG A;  5J2C A;  4M9H A;  3WFP A;  9ICT A;  4KLU A;  4AT8 B;  5J2H A;  5BOL A;  4M9G A;  4YMO A;  3UXO A;  4QZF A;  8ICU A;  4RPX A;  5CA7 A;  4LT6 A;  1ZQQ A;  8ICY A;  1ZQT A;  4RWN A;  4E7X A;  3JPS A;  1TFY A;  8ICK A;  7ICP A;  5CP2 A;  5HRK A;  4O5E A;  4FH3 A;  5HRH A;  4KLD A;  4PGY A;  4Z6E A;  3WFQ E;  4RQ5 A;  4M0A A;  4WC1 A;  1Q79 A;  5DB9 A;  3MDC A;  3OUY B;  5BPC A;  8ICP A;  5J2I A;  7ICL A;  2ISO A;  9ICC A;  2ZH8 A;  1JAJ A;  1MQ3 A;  2O5A A;  1BPZ A;  3AQN A;  5J0Q A;  1ZQO A;  2PXI A;  4EBJ A;  4F5Q A;  4X4N A;  1ZQX A;  4F5N A;  5HRD A;  4UB1 A;  3OGU A;  5EOZ A;  8ICA A;  4ATB B;  5J0R A;  4X4S A;  4KLG A;  1VFG A;  4DOB A;  4R65 A;  9ICE A;  4RWQ A;  3V7K A;  4TUS A;  3RJH A;  1ZQE A;  5HRI A;  2DR5 A;  8ICM A;  4FHW A;  5J2E A;  4WC5 A;  5DDY A;  3AQM A;  4MFC A;  7ICM A;  3LK9 A;  2FMP A;  4QZ9 A;  5DEC A;  4M9N A;  2ID1 A;  2VAN A;  4WC2 A;  4NLK A;  3H39 A;  5D49 A;  3JPR A;  3LQC B;  1TV9 A;  4XQ8 A;  4EBK A;  5III A;  3C2K A;  4RQ1 A;  3JPP A;  3H38 A;  3C2M A;  3JPO A;  5J0T A;  4YN4 A;  4X4R A;  5J29 A;  4QZC A;  1HUO A;  4ATB A;  5D46 A;  9ICH A;  4JWN A;  4PHE A;  1ZQP A;  4X0B A;  1ZQU A;  3V72 A;  1ZQZ A;  4MFA A;  3AQL A; 
#chains in the Genus database with same CATH topology
 4NLZ A;  1YLQ A;  2ZH9 A;  4K96 A;  1ZJM A;  4O69 A;  3RJF A;  4RQ6 A;  4LZD A;  4QZI A;  3C5G A;  7ICJ A;  4KLJ A;  1KDH A;  4I2F A;  9ICO A;  3CK6 A;  4PPX A;  4RQ4 A;  1R89 A;  1ZQI A;  4WBZ A;  3C2L A;  4UAZ A;  2HN1 A;  9ICI A;  4R64 A;  1XSP A;  1ZQN A;  2PFP A;  2ZH5 A;  7ICR A;  3JPN A;  4FO1 A;  3OV7 A;  4M2Y A;  4X0A A;  4AT9 B;  4YCX A;  3TFS A;  3RH5 A;  7ICH A;  2IHM A;  9ICR A;  5J0P A;  4RWP A;  8ICB A;  1F5A A;  4NXV A;  5D61 A;  2M2T A;  4X4T A;  1ZQV A;  4K4G A;  3HJ4 A;  4RQ3 A;  3HX0 A;  4WC4 A;  9ICL A;  4FH5 A;  4JWM A;  1ZQR A;  3MCR A;  1TVA A;  4P4M A;  4I2A A;  5CHE A;  3PNC A;  1MIV A;  4UD5 A;  4F5O A;  4X5V A;  2PFQ A;  5IIK A;  1JQR A;  4O6A A;  3PML A;  1ZQW A;  1ZQL A;  4WQK A;  3UPQ A;  2BCR A;  3ERC C;  4EEB A;  2PBE A;  4NKT A;  3HW8 A;  4I29 A;  4UAW A;  3K7D A;  4LEY A;  4JLX A;  9ICS A;  5D63 A;  4EGW A;  4M04 A;  3ISD A;  4R63 A;  2ZH6 A;  9ICW A;  4KLL A;  4LEZ A;  8ICL A;  8ICT A;  1RPL A;  2GWS A;  3AU2 A;  4QZG A;  4AT9 A;  3C5F A;  7ICS A;  4UB4 A;  1WOT A;  4P4P A;  8ICJ A;  3ER9 B;  4Z6F A;  4PHA A;  9ICM A;  4LEW A;  3NVO A;  4KLM A;  5HRE A;  2NRK A;  4OAH A;  3OVB A;  4XJE A;  8ICG A;  4NM2 A;  3PMN A;  2BCV A;  8ICX A;  9ICB A;  9ICG A;  4X4U A;  4IQV A;  4GXJ A;  5DED A;  5DKW A;  4F5P A;  2Q66 A;  4I2D A;  1UEU A;  4FHY A;  3V7J A;  4YMM A;  4YD2 A;  5DB6 A;  3HWT A;  2B4V A;  4QZB A;  5TZV A;  1ZJN A;  9ICX A;  4XA5 A;  2BPG A;  5CFS A;  4R66 A;  2DR8 A;  4K9A A;  4P4O A;  4I2C A;  4F5R A;  3H37 A;  4K4I A;  4KLS A;  5HRL A;  5D4B A;  4PGQ A;  2DVI A;  7ICK A;  4WC7 A;  1MIY A;  1TFW A;  4QZA A;  4KLF A;  3ISC A;  1ZQY A;  2GA9 D;  5CWR A;  2DRB A;  4DO9 A;  4PGX A;  3UQ0 A;  1BPD A;  4OAG A;  3WFO A;  7ICT A;  3OVS A;  1BPB A;  5J0X A;  4KLQ A;  4PHD A;  5J2J A;  8ICF A;  4E80 A;  3GDX A;  4M47 A;  2W9M A;  4O68 A;  4QZE A;  4DOA A;  4M5D A;  2HHP A;  2HN2 A;  2FMS A;  3RJJ A;  4UBC A;  4X4V A;  8ICV A;  4YMN A;  4K98 A;  4I2G A;  4AT7 A;  4GXK A;  3MGH A;  9ICQ A;  5J0Y A;  4IQW A;  3AU6 A;  4Z6D A;  4PHP A;  5CR0 A;  4IG8 A;  5HRF A;  3V7L A;  5DB8 A;  4WCW A;  2O1P A;  5CHG A;  3UQ2 A;  4S3N A;  5B3Q A;  2M2W A;  3PHZ A;  2RFF A;  4WC3 A;  4UBB A;  3JCF A;  4I2I A;  7ICO A;  7ICF A;  1R8B A;  3RJE A;  3MDA A;  4KLI A;  4WBY A;  2FMQ A;  4QZH A;  1UET A;  4UD4 A;  3C18 A;  4NXZ A;  3JZ0 A;  3MGI A;  1ZQJ A;  4HX0 A;  4I27 A;  7ICN A;  2PFO A;  1HUZ A;  3MBY A;  9ICA A;  8ICZ A;  4NXU A;  3WFR E;  5IIJ A;  2IUB A;  3WFS C;  3B0X A;  3NYB A;  4O5K A;  3AQK A;  4I2J A;  2ZH1 A;  5HHH A;  5HR9 A;  4KB6 A;  4K9B A;  5F2V O;  4P2H A;  5BOM A;  2ISP A;  1VJ7 A;  4XQ7 A;  4NXT A;  4M9L A;  3OWG A;  4FHV A;  1KNY A;  4GXI A;  4FHP A;  2ZH3 A;  1PX5 A;  4UB2 A;  1ZQC A;  7ICV A;  4RPZ A;  2BCQ A;  4KLT A;  2B51 A;  4RPY A;  4LEV A;  1JMS A;  4KLO A;  4I2E A;  5DBC A;  8ICI A;  4NM1 A;  4IQT A;  9ICV A;  5D62 A;  3UPS A;  3UXN A;  5JTG A;  3H3A A;  5IIL A;  2BCU A;  3RH6 A;  8ICQ A;  8ICR A;  5DDM A;  1BPY A;  3HJ1 A;  4I0U A;  2BE3 A;  4O9M A;  2ZH4 A;  9ICP A;  1NOM A;  5HRG A;  4QZD A;  4TUP A;  2M2V A;  2BCS A;  5CFT A;  5DB7 A;  1ZQM A;  5J0U A;  4JLZ A;  3K75 D;  8ICE A;  4E8F A;  4RQ8 A;  2BPC A;  8ICN A;  2EWR A;  4I2B A;  9ICK A;  1BPE A;  1R8C A;  5CB1 A;  2P66 A;  4AT7 B;  4YD1 A;  4O67 A;  4Z6C A;  3OVA A;  4O5C A;  4K8V A;  4RWO A;  4XRH A;  3TFR A;  4AT8 A;  4IQU A;  4FHX A;  1OU5 A;  5HHI A;  5DBB A;  1ZQF A;  4I2H A;  7ICQ A;  7ICU A;  4MKP A;  4MF2 A;  3RJI A;  4K97 A;  1XSN A;  1Q78 A;  3B0Y A;  3UXP A;  2ZHB A;  5HC9 A;  5IIN A;  4OAI Z;  4X4O A;  5CFU A;  4RT3 A;  2ZH7 A;  3RH4 A;  4X4P A;  4TUQ A;  1MIW A;  3JPT A;  1KEJ A;  4OAF A;  2DRA A;  1UEV A;  4RQ0 A;  4WC6 A;  3AUO A;  4XUS A;  7ICE A;  5J2K A;  7ICG A;  4UB3 A;  3RJK A;  1ZQS A;  3OUY A;  4KLH A;  4NY8 A;  1FA0 A;  4WC0 A;  4DOC A;  1MQ2 A;  9ICJ A;  9ICU A;  5J2A A;  4K4H A;  4UAY A;  5HRB A;  4FO6 A;  8ICS A;  4TUR A;  4RT2 A;  3HIY A;  1ZQA A;  5J2B A;  2GAF D;  9ICN A;  2DR9 A;  3EF2 A;  8ICC A;  4KLE A;  2ZH2 A;  5J0S A;  4EP7 A;  4LVS A;  4NKU A;  1V4A A;  7ICI A;  5IIM A;  4UB5 A;  4RQ2 A;  2I9G A;  1JN3 A;  1BPX A;  4RQ7 A;  4MF8 A;  1ZQG A;  1RZT A;  3JPQ A;  1ZQB A;  1ZQK A;  9ICF A;  1ZQD A;  2DR7 A;  3JYY A;  2ZHA A;  5IIO A;  4NLN A;  4MFF A;  1XSL A;  5J0O A;  2PFN A;  1ZQH A;  8ICO A;  5J0W A;  5J2F A;  3RJG A;  3ISB A;  4QZ8 A;  4X4Q A;  4PH5 A;  3L9D A;  8ICW A;  5DBA A;  5J2D A;  5J2G A;  5CJ7 A;  4M9J A;  2M2U A;  1R8A A;  3C66 A;  2BPF A;  4I28 A;  8ICH A;  4WQL A;  1NO5 A;  4LZG A;  5J2C A;  4M9H A;  3WFP A;  9ICT A;  4KLU A;  4AT8 B;  5J2H A;  5BOL A;  4M9G A;  4YMO A;  3UXO A;  4QZF A;  8ICU A;  4RPX A;  5CA7 A;  4LT6 A;  4NXW A;  4WH5 A;  1ZQQ A;  4N7R A;  8ICY A;  1ZQT A;  4RWN A;  4E7X A;  3JPS A;  1TFY A;  4WOY A;  2FCL A;  8ICK A;  7ICP A;  5CP2 A;  5HRK A;  4O5E A;  4FH3 A;  5HRH A;  4KLD A;  3NKU A;  2BBH A;  4PGY A;  4Z6E A;  3WFQ E;  4RQ5 A;  4M0A A;  4WC1 A;  1Q79 A;  4K99 A;  5DB9 A;  3MDC A;  3OUY B;  2B56 A;  5BPC A;  8ICP A;  5J2I A;  7ICL A;  2ISO A;  4KM5 A;  9ICC A;  2ZH8 A;  1JAJ A;  1MQ3 A;  2O5A A;  1BPZ A;  3AQN A;  5J0Q A;  1GPJ A;  1ZQO A;  2PXI A;  4EBJ A;  4F5Q A;  4X4N A;  1ZQX A;  4F5N A;  5HRD A;  4UB1 A;  3OGU A;  5EOZ A;  8ICA A;  4ATB B;  5J0R A;  4X4S A;  4KLG A;  1VFG A;  4DOB A;  4R65 A;  9ICE A;  4RWQ A;  3V7K A;  4TUS A;  3RJH A;  1ZQE A;  5HRI A;  2DR5 A;  8ICM A;  4FHW A;  5J2E A;  5B3P A;  4WC5 A;  5DDY A;  3AQM A;  4MFC A;  7ICM A;  3LK9 A;  2FMP A;  4QZ9 A;  5DEC A;  4M9N A;  4NXX A;  3ER8 C;  2ID1 A;  2VAN A;  4WC2 A;  4NLK A;  3H39 A;  5D49 A;  3JPR A;  3LQC B;  1TV9 A;  4XQ8 A;  4EBK A;  5III A;  3C2K A;  4RQ1 A;  3JPP A;  3H38 A;  3C2M A;  3JPO A;  5J0T A;  4YN4 A;  4EV6 A;  4X4R A;  2BBJ A;  4EED A;  5J29 A;  4QZC A;  1HUO A;  2IHO A;  4ATB A;  5D46 A;  9ICH A;  4JWN A;  4PHE A;  1ZQP A;  3NWI A;  4X0B A;  1ZQU A;  3V72 A;  1ZQZ A;  4MFA A;  3AQL A; 
#chains in the Genus database with same CATH homology
 4NLZ A;  1YLQ A;  2ZH9 A;  1ZJM A;  3RJF A;  4RQ6 A;  4LZD A;  4QZI A;  3C5G A;  7ICJ A;  4KLJ A;  1KDH A;  4I2F A;  9ICO A;  4PPX A;  4RQ4 A;  1R89 A;  1ZQI A;  4WBZ A;  3C2L A;  4UAZ A;  9ICI A;  4R64 A;  1XSP A;  1ZQN A;  2PFP A;  2ZH5 A;  7ICR A;  3JPN A;  3OV7 A;  4M2Y A;  4X0A A;  4AT9 B;  4YCX A;  3TFS A;  3RH5 A;  7ICH A;  2IHM A;  9ICR A;  5J0P A;  4RWP A;  8ICB A;  1F5A A;  2M2T A;  4X4T A;  1ZQV A;  4K4G A;  3HJ4 A;  4RQ3 A;  3HX0 A;  4WC4 A;  9ICL A;  4FH5 A;  4JWM A;  1ZQR A;  1TVA A;  4P4M A;  4I2A A;  3PNC A;  1MIV A;  4UD5 A;  4F5O A;  4X5V A;  2PFQ A;  5IIK A;  1JQR A;  3PML A;  1ZQW A;  1ZQL A;  3UPQ A;  2BCR A;  2PBE A;  4NKT A;  3HW8 A;  4I29 A;  4UAW A;  9ICS A;  4M04 A;  3ISD A;  4R63 A;  2ZH6 A;  9ICW A;  4KLL A;  8ICL A;  8ICT A;  1RPL A;  2GWS A;  3AU2 A;  4QZG A;  4AT9 A;  3C5F A;  7ICS A;  4UB4 A;  1WOT A;  4P4P A;  8ICJ A;  4Z6F A;  4PHA A;  9ICM A;  4KLM A;  5HRE A;  2NRK A;  3OVB A;  8ICG A;  4NM2 A;  3PMN A;  2BCV A;  8ICX A;  9ICB A;  9ICG A;  4X4U A;  4IQV A;  4GXJ A;  5DED A;  5DKW A;  4F5P A;  2Q66 A;  4I2D A;  1UEU A;  4FHY A;  3V7J A;  4YMM A;  4YD2 A;  5DB6 A;  3HWT A;  5TZV A;  4QZB A;  1ZJN A;  9ICX A;  4XA5 A;  2BPG A;  4R66 A;  2DR8 A;  4P4O A;  4I2C A;  4F5R A;  3H37 A;  4K4I A;  4KLS A;  5HRL A;  5D4B A;  4PGQ A;  2DVI A;  7ICK A;  4WC7 A;  1MIY A;  1TFW A;  4QZA A;  4KLF A;  3ISC A;  1ZQY A;  5CWR A;  2DRB A;  4DO9 A;  4PGX A;  3UQ0 A;  1BPD A;  7ICT A;  3WFO A;  3OVS A;  1BPB A;  5J0X A;  4KLQ A;  4PHD A;  5J2J A;  8ICF A;  4E80 A;  3GDX A;  4M47 A;  2W9M A;  4QZE A;  4DOA A;  2FMS A;  4M5D A;  2HHP A;  3RJJ A;  4UBC A;  4X4V A;  8ICV A;  4YMN A;  4I2G A;  4AT7 A;  4GXK A;  3MGH A;  9ICQ A;  5J0Y A;  4IQW A;  3AU6 A;  4Z6D A;  4PHP A;  5CR0 A;  4IG8 A;  5HRF A;  3V7L A;  5DB8 A;  4WCW A;  2O1P A;  5CHG A;  3UQ2 A;  4S3N A;  2M2W A;  4UBB A;  2RFF A;  4WC3 A;  4I2I A;  7ICO A;  7ICF A;  1R8B A;  3RJE A;  3MDA A;  4KLI A;  4WBY A;  2FMQ A;  4QZH A;  1UET A;  4UD4 A;  3C18 A;  4NXZ A;  3JZ0 A;  3MGI A;  1ZQJ A;  7ICN A;  4I27 A;  2PFO A;  1HUZ A;  3MBY A;  9ICA A;  8ICZ A;  3WFR E;  5IIJ A;  3WFS C;  3B0X A;  3NYB A;  4O5K A;  3AQK A;  4I2J A;  2ZH1 A;  5HHH A;  5HR9 A;  5F2V O;  4P2H A;  5BOM A;  2ISP A;  1VJ7 A;  4XQ7 A;  4M9L A;  4FHV A;  1KNY A;  4GXI A;  4FHP A;  2ZH3 A;  1PX5 A;  4UB2 A;  1ZQC A;  7ICV A;  4RPZ A;  2BCQ A;  4KLT A;  4RPY A;  1JMS A;  4KLO A;  4I2E A;  5DBC A;  8ICI A;  4NM1 A;  4IQT A;  9ICV A;  3UPS A;  3UXN A;  5IIL A;  3H3A A;  2BCU A;  3RH6 A;  8ICQ A;  8ICR A;  5DDM A;  1BPY A;  3HJ1 A;  4O9M A;  2BE3 A;  9ICP A;  2ZH4 A;  1NOM A;  5HRG A;  4QZD A;  4TUP A;  2M2V A;  2BCS A;  5DB7 A;  1ZQM A;  5J0U A;  3K75 D;  8ICE A;  4E8F A;  4RQ8 A;  2BPC A;  8ICN A;  4I2B A;  9ICK A;  1BPE A;  1R8C A;  5CB1 A;  2P66 A;  4AT7 B;  4YD1 A;  4Z6C A;  3OVA A;  4O5C A;  4RWO A;  4XRH A;  3TFR A;  4AT8 A;  4IQU A;  4FHX A;  1OU5 A;  5HHI A;  5DBB A;  1ZQF A;  4I2H A;  7ICQ A;  7ICU A;  4MF2 A;  3RJI A;  1XSN A;  1Q78 A;  3B0Y A;  3UXP A;  2ZHB A;  5HC9 A;  5IIN A;  4X4O A;  4RT3 A;  2ZH7 A;  3RH4 A;  4X4P A;  4TUQ A;  1MIW A;  3JPT A;  1KEJ A;  2DRA A;  1UEV A;  4RQ0 A;  4WC6 A;  3AUO A;  4XUS A;  7ICE A;  5J2K A;  7ICG A;  4UB3 A;  3RJK A;  1ZQS A;  3OUY A;  4KLH A;  4NY8 A;  1FA0 A;  4WC0 A;  4DOC A;  1MQ2 A;  9ICJ A;  9ICU A;  5J2A A;  4K4H A;  4UAY A;  5HRB A;  4FO6 A;  8ICS A;  4TUR A;  4RT2 A;  3HIY A;  1ZQA A;  5J2B A;  9ICN A;  2DR9 A;  8ICC A;  4KLE A;  2ZH2 A;  5J0S A;  4EP7 A;  4LVS A;  4NKU A;  1V4A A;  7ICI A;  5IIM A;  4UB5 A;  4RQ2 A;  2I9G A;  1JN3 A;  1BPX A;  4RQ7 A;  4MF8 A;  1ZQG A;  1RZT A;  3JPQ A;  1ZQB A;  1ZQK A;  9ICF A;  1ZQD A;  2DR7 A;  3JYY A;  2ZHA A;  5IIO A;  4NLN A;  4MFF A;  1XSL A;  5J0O A;  2PFN A;  1ZQH A;  8ICO A;  5J0W A;  5J2F A;  3RJG A;  3ISB A;  4QZ8 A;  4X4Q A;  4PH5 A;  3L9D A;  8ICW A;  5DBA A;  5J2D A;  5J2G A;  5CJ7 A;  4M9J A;  2M2U A;  1R8A A;  3C66 A;  2BPF A;  4I28 A;  8ICH A;  1NO5 A;  4LZG A;  5J2C A;  4M9H A;  3WFP A;  9ICT A;  4KLU A;  4AT8 B;  5J2H A;  5BOL A;  4M9G A;  4YMO A;  3UXO A;  4QZF A;  8ICU A;  4RPX A;  5CA7 A;  4LT6 A;  1ZQQ A;  8ICY A;  1ZQT A;  4RWN A;  4E7X A;  3JPS A;  1TFY A;  8ICK A;  7ICP A;  5CP2 A;  5HRK A;  4O5E A;  4FH3 A;  5HRH A;  4KLD A;  4PGY A;  4Z6E A;  3WFQ E;  4RQ5 A;  4M0A A;  4WC1 A;  1Q79 A;  5DB9 A;  3MDC A;  3OUY B;  5BPC A;  8ICP A;  5J2I A;  7ICL A;  2ISO A;  9ICC A;  2ZH8 A;  1JAJ A;  1MQ3 A;  2O5A A;  1BPZ A;  3AQN A;  5J0Q A;  1ZQO A;  2PXI A;  4EBJ A;  4F5Q A;  4X4N A;  1ZQX A;  4F5N A;  5HRD A;  4UB1 A;  3OGU A;  5EOZ A;  8ICA A;  4ATB B;  5J0R A;  4X4S A;  4KLG A;  1VFG A;  4DOB A;  4R65 A;  9ICE A;  4RWQ A;  3V7K A;  4TUS A;  3RJH A;  1ZQE A;  5HRI A;  2DR5 A;  8ICM A;  4FHW A;  5J2E A;  4WC5 A;  5DDY A;  3AQM A;  4MFC A;  7ICM A;  3LK9 A;  2FMP A;  4QZ9 A;  5DEC A;  4M9N A;  2ID1 A;  2VAN A;  4WC2 A;  4NLK A;  3H39 A;  5D49 A;  3JPR A;  3LQC B;  1TV9 A;  4XQ8 A;  4EBK A;  5III A;  3C2K A;  4RQ1 A;  3JPP A;  3H38 A;  3C2M A;  3JPO A;  5J0T A;  4YN4 A;  4X4R A;  5J29 A;  4QZC A;  1HUO A;  4ATB A;  5D46 A;  9ICH A;  4JWN A;  4PHE A;  1ZQP A;  4X0B A;  1ZQU A;  3V72 A;  1ZQZ A;  4MFA A;  3AQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...