2O5AA

Crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
108
Chain Sequence
SNQELLQLAVNAVDDKKAEQVVALNMKGISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEIKRLEGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVELEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1328 protein
publication title Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 29
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2o5aA01
1XSNA 3HW8A 4KLUA 4YMOA 4I28A 1BPXA 4QZFA 7ICQA 3RJEA 8ICEA 5CR0A 1MIVA 4RQ2A 1TFWA 2ZH3A 4TURA 7ICVA 5J2FA 4UAWA 5J2AA 2BCSA 4TUPA 1ZQVA 8ICJA 3V7KA 4QZGA 9ICCA 4AT9A 5IINA 5DEDA 2DR9A 8ICUA 1WOTA 5IIKA 3AQMA 9ICRA 3C2MA 4RQ3A 7ICKA 9ICMA 3OVAA 7ICHA 4RWOA 9ICJA 3ISBA 2DRBA 1ZJMA 4RQ8A 4KLIA 3OUYA 4JWNA 1R8AA 3RH4A 4UD5A 5D46A 5J0TA 1FA0A 4AT8A 3V7JA 1BPDA 8ICOA 5HHIA 4XQ7A 3MDAA 1ZQWA 3UXPA 5J2CA 1ZQMA 4WC1A 2PFQA 1NOMA 5BOMA 2ZH6A 4TUSA 4X5VA 1BPEA 2ID1A 4XUSA 4I2HA 4RT3A 4MFAA 2FMPA 4EBKA 4O5KA 7ICOA 2PFOA 1ZQUA 4ATBB 5HC9A 4QZDA 3HJ4A 4WC5A 4QZBA 3HJ1A 1ZQYA 4XA5A 4UAZA 4RPYA 4AT7B 4R66A 5J0XA 5D4BA 1ZJNA 3HIYA 4QZCA 4KLEA 3HWTA 1ZQCA 9ICGA 3ISDA 4I2JA 4F5OA 7ICIA 7ICRA 3UPSA 8ICYA 4X4UA 4I2FA 2ZH4A 4E8FA 4EBJA 4MFCA 4RWQA 4EP7A 1JMSA 4LT6A 9ICNA 1ZQFA 4WC7A 4GXKA 4UAYA 4E80A 4UB4A 1ZQBA 3H3AA 3WFRE 3WFOA 4P4PA 2P66A 4PHPA 8ICWA 3WFQE 4IQVA 2M2VA 4FHYA 4MF2A 2O5AA 1Q78A 4O9MA 3UXNA 3OGUA 5DB7A 3UQ2A 4UB5A 4K4HA 8ICTA 1JQRA 5J2DA 2PFNA 4KLGA 3JPQA 5HR9A 5J0PA 5J0UA 2FMQA 2GWSA 3PMNA 4QZ8A 2ISOA 4LZDA 3GDXA 9ICVA 4NKUA 4I2BA 2I9GA 1MIWA 1MIYA 4FH5A 7ICFA 1ZQSA 4LZGA 9ICFA 4TUQA 5CWRA 2BE3A 1ZQJA 4PGYA 5HHHA 2IHMA 3AU2A 4Z6FA 1KNYA 2M2WA 4UB3A 5J2IA 1UETA 4FH3A 4M0AA 3TFRA 8ICVA 2DR5A 4X4VA 8ICNA 3NYBA 1MQ2A 4FO6A 4Z6EA 4X0BA 4M9JA 3JPSA 4NM2A 5BOLA 5HRDA 1XSLA 5IIIA 1ZQDA 4F5PA 3UQ0A 1ZQOA 8ICXA 4P2HA 4YMMA 4QZAA 1ZQTA 4RQ6A 1ZQZA 3OVBA 5J29A 4R64A 1HUOA 3H37A 2DRAA 5DBAA 5HRGA 4FHWA 2ZHBA 4QZHA 8ICKA 9ICOA 3AUOA 4P4OA 5J0OA 4LVSA 3JPPA 8ICZA 2VANA 4AT9B 4I2AA 3WFPA 5J2GA 1KDHA 1TFYA 9ICUA 5DB6A 5J0YA 4X4QA 2FMSA 4M9LA 1XSPA 1ZQLA 3MGHA 3K75D 3RJKA 2HHPA 4WC4A 5HRHA 3OUYB 1YLQA 4Z6DA 4M9HA 4X4RA 5J0SA 7ICJA 4AT8B 5CJ7A 4UBBA 4FHXA 3JPNA 5HRFA 4PGQA 1ZQAA 4RWNA 2PFPA 1R8BA 4KLJA 3H38A 4I29A 1VJ7A 4M2YA 4X4NA 4RQ0A 3RH6A 1ZQKA 9ICSA 3JPOA 4UBCA 7ICMA 5J0WA 1VFGA 1KEJA 2ZH7A 8ICLA 4NLNA 4X0AA 5IIMA 3HX0A 4Z6CA 1ZQGA 2BPGA 3AQLA 4M9GA 3PMLA 3RJGA 9ICPA 1HUZA 4DO9A 3UPQA 5BPCA 4YD2A 5DDMA 1V4AA 1NO5A 3RJJA 3C2KA 4KLQA 4XQ8A 4MF8A 2ZH9A 3RJFA 8ICMA 3PNCA 1ZQHA 5HREA 4S3NA 1BPBA 4YN4A 4F5NA 4R63A 4M9NA 8ICBA 2NRKA 4NY8A 4KLTA 7ICLA 5IIOA 8ICIA 3UXOA 4DOCA 9ICLA 7ICUA 9ICHA 4K4GA 7ICNA 5IIJA 4O5EA 4IG8A 8ICCA 4DOAA 3LK9A 2RFFA 9ICXA 4RQ7A 4PGXA 1UEUA 4YMNA 7ICSA 2O1PA 3B0YA 4WC3A 5DB9A 5DECA 5DKWA 3C2LA 4O5CA 4PHAA 2PBEA 8ICQA 3V7LA 5DBCA 5J2KA 5DDYA 2BCVA 4NXZA 3RJHA 3V72A 4WC2A 4IQWA 4RQ4A 2BCUA 8ICAA 5DB8A 1BPYA 3C18A 1OU5A 4FHPA 5HRLA 4QZIA 4IQUA 2BCRA 2ZH8A 4NKTA 9ICKA 4DOBA 4ATBA 7ICPA 4I2CA 3OVSA 3C5FA 4M47A 8ICRA 7ICGA 4UB1A 4RPXA 2BPFA 1ZQEA 3WFSC 4I2EA 4AT7A 3JPRA 1RZTA 3MDCA 5TZVA 3RJIA 5CA7A 2W9MA 4I2IA 2DVIA 9ICTA 1TVAA 3AQKA 1BPZA 2DR8A 4RQ5A 4F5QA 2BPCA 4R65A 5HRKA 8ICFA 1R8CA 1TV9A 4I2GA 3OV7A 4NM1A 9ICIA 4PPXA 3C5GA 4MFFA 4KLLA 3JYYA 4WCWA 4K4IA 5CP2A 4F5RA 4WC6A 4FHVA 2M2UA 2Q66A 4KLSA 3L9DA 4X4TA 4YD1A 5J0QA 4RT2A 5HRIA 4M04A 1ZQXA 1Q79A 4WBZA 9ICWA 1F5AA 4KLHA 2ZH2A 9ICAA 8ICSA 5IILA 4IQTA 2BCQA 4WBYA 2PXIA 4UB2A 3JZ0A 4NLZA 9ICQA 5F2VO 1PX5A 5EOZA 4KLFA 5CHGA 4GXIA 4RQ1A 4NLKA 3AQNA 4QZEA 2ZHAA 4E7XA 4QZ9A 1JAJA 4X4PA 7ICTA 5J2BA 2ZH5A 3MGIA 1ZQNA 4PHEA 1MQ3A 4M5DA 4WC0A 3TFSA 2ZH1A 4GXJA 5CB1A 5DBBA 1ZQPA 4KLMA 1JN3A 4X4SA 3AU6A 7ICEA 5J2EA 3RH5A 4KLDA 2DR7A 3JPTA 5J2JA 3B0XA 3ISCA 4RWPA 4PH5A 5D49A 1ZQRA 9ICBA 3MBYA 1ZQQA 9ICEA 3H39A 5HRBA 8ICGA 4UD4A 4I27A 3C66A 8ICPA 4X4OA 8ICHA 4YCXA 2M2TA 4PHDA 4I2DA 4KLOA 4XRHA 1RPLA 5J2HA 4P4MA 4RPZA 2ISPA 5J0RA 1ZQIA 1R89A 3LQCB 4JWMA 1UEVA
chains in the Genus database with same CATH superfamily
1XSNA 3HW8A 4KLUA 4YMOA 4JLZA 4I28A 1BPXA 4QZFA 7ICQA 3RJEA 8ICEA 5CR0A 1MIVA 4RQ2A 1TFWA 2ZH3A 4TURA 7ICVA 5J2FA 4UAWA 5J2AA 2BCSA 4TUPA 1ZQVA 8ICJA 3V7KA 4QZGA 9ICCA 4AT9A 5IINA 5DEDA 2DR9A 8ICUA 1WOTA 2B51A 3AQMA 5IIKA 9ICRA 3C2MA 4K98A 4RQ3A 7ICKA 9ICMA 3OVAA 7ICHA 4RWOA 9ICJA 3ISBA 2DRBA 1ZJMA 4RQ8A 4KLIA 4O67A 2B4VA 3OUYA 4JWNA 1GPJA 1R8AA 3RH4A 4NXXA 4UD5A 5D46A 5J0TA 1FA0A 4AT8A 3V7JA 1BPDA 8ICOA 5HHIA 4XQ7A 3MDAA 1ZQWA 5CHEA 3UXPA 5J2CA 1ZQMA 4WC1A 2PFQA 1NOMA 5BOMA 2ZH6A 4TUSA 4X5VA 1BPEA 2ID1A 4XUSA 4I2HA 4RT3A 4MFAA 2FMPA 4EBKA 4O5KA 7ICOA 2PFOA 1ZQUA 4ATBB 5HC9A 4QZDA 4KB6A 3HJ4A 4LEYA 4WC5A 4QZBA 3HJ1A 1ZQYA 4NXUA 4XA5A 4UAZA 5CFUA 4RPYA 4AT7B 2IHOA 3OWGA 4R66A 2FCLA 5J0XA 5D4BA 1ZJNA 3HIYA 4LEWA 4QZCA 4KLEA 3HWTA 1ZQCA 9ICGA 3ISDA 4O6AA 4I2JA 4F5OA 7ICIA 7ICRA 3UPSA 8ICYA 4X4UA 4I2FA 2ZH4A 4E8FA 4EBJA 4MFCA 4RWQA 4EP7A 1JMSA 4K99A 2BBJA 3CK6A 4LT6A 9ICNA 1ZQFA 4WC7A 4GXKA 4UAYA 4E80A 4UB4A 1ZQBA 4K9AA 3H3AA 3WFRE 3WFOA 4P4PA 4XJEA 2P66A 4PHPA 4OAIZ 8ICWA 3WFQE 4IQVA 2M2VA 4FHYA 4MF2A 2O5AA 5D63A 1Q78A 4O9MA 3UXNA 3OGUA 5DB7A 3UQ2A 4UB5A 4K4HA 8ICTA 3EF2A 1JQRA 5J2DA 2PFNA 2IUBA 4KLGA 3JPQA 5HR9A 5J0PA 5J0UA 2FMQA 2GWSA 3PMNA 2EWRA 4QZ8A 2ISOA 4N7RA 4LZDA 3GDXA 9ICVA 4HX0A 5B3QA 4NKUA 4I2BA 2I9GA 1MIWA 4KM5A 1MIYA 4FH5A 7ICFA 1ZQSA 4LZGA 9ICFA 4TUQA 5CWRA 2BE3A 1ZQJA 5CFSA 3ERCC 4PGYA 5HHHA 2IHMA 3AU2A 4Z6FA 1KNYA 2M2WA 4UB3A 5J2IA 4EV6A 1UETA 4NXVA 4FH3A 4M0AA 4O69A 4EEDA 3TFRA 8ICVA 2DR5A 4X4VA 4NXWA 8ICNA 3NYBA 4I0UA 1MQ2A 4FO6A 3NVOA 4Z6EA 4X0BA 4M9JA 3JPSA 4NM2A 5BOLA 5HRDA 1XSLA 5IIIA 1ZQDA 4F5PA 3UQ0A 1ZQOA 4MKPA 8ICXA 4P2HA 4YMMA 4QZAA 1ZQTA 4RQ6A 1ZQZA 3OVBA 5J29A 4R64A 1HUOA 3H37A 4NXTA 2DRAA 5DBAA 5HRGA 4FHWA 2ZHBA 4QZHA 8ICKA 9ICOA 3AUOA 4P4OA 5J0OA 4LVSA 3JPPA 8ICZA 2VANA 4AT9B 4I2AA 3WFPA 2GA9D 5J2GA 1KDHA 1TFYA 9ICUA 5DB6A 5J0YA 4X4QA 2FMSA 2HN1A 4M9LA 1XSPA 1ZQLA 4LEZA 3MGHA 3K75D 3RJKA 2HHPA 4WC4A 5HRHA 3OUYB 1YLQA 4Z6DA 3PHZA 4M9HA 4X4RA 5J0SA 7ICJA 4K8VA 4AT8B 5CJ7A 4UBBA 4FHXA 4O68A 3JPNA 4WQLA 5HRFA 4PGQA 1ZQAA 4RWNA 2GAFD 2PFPA 1R8BA 4KLJA 3H38A 4I29A 1VJ7A 4M2YA 4X4NA 4RQ0A 3RH6A 1ZQKA 9ICSA 3JPOA 4UBCA 7ICMA 5J0WA 1VFGA 1KEJA 2ZH7A 8ICLA 4NLNA 4X0AA 5IIMA 3HX0A 4Z6CA 1ZQGA 2BPGA 3AQLA 4M9GA 2B56A 3PMLA 3RJGA 9ICPA 1HUZA 4DO9A 4LEVA 5BPCA 3UPQA 4YD2A 3JCFA 5DDMA 1V4AA 1NO5A 3RJJA 4K96A 3C2KA 4KLQA 4XQ8A 4K97A 4MF8A 2ZH9A 3RJFA 8ICMA 3PNCA 1ZQHA 5D62A 4OAGA 5HREA 4S3NA 1BPBA 4YN4A 4F5NA 4R63A 4M9NA 8ICBA 2NRKA 4NY8A 4KLTA 7ICLA 5IIOA 4K9BA 4OAFA 8ICIA 3UXOA 4DOCA 9ICLA 7ICUA 9ICHA 2BBHA 4K4GA 7ICNA 5IIJA 4O5EA 4IG8A 8ICCA 4DOAA 3LK9A 2RFFA 9ICXA 4RQ7A 4PGXA 1UEUA 4YMNA 3ER8C 7ICSA 2O1PA 4JLXA 3B0YA 4WC3A 5DB9A 5DECA 5DKWA 3C2LA 4O5CA 4PHAA 2PBEA 8ICQA 3V7LA 5DBCA 5B3PA 5J2KA 5DDYA 2BCVA 4NXZA 3RJHA 3V72A 4WC2A 4IQWA 4RQ4A 2BCUA 3NKUA 8ICAA 5DB8A 1BPYA 3C18A 1OU5A 4FHPA 5HRLA 4QZIA 4IQUA 2BCRA 2ZH8A 4NKTA 9ICKA 4DOBA 4ATBA 7ICPA 4I2CA 3OVSA 4WQKA 3C5FA 4M47A 8ICRA 7ICGA 4UB1A 4RPXA 2BPFA 1ZQEA 3WFSC 4I2EA 4AT7A 3JPRA 1RZTA 3MDCA 5TZVA 3RJIA 3NWIA 5CA7A 2W9MA 4I2IA 2DVIA 9ICTA 1TVAA 3AQKA 1BPZA 2DR8A 4EGWA 4RQ5A 4F5QA 2BPCA 4R65A 4OAHA 5HRKA 8ICFA 1R8CA 1TV9A 2HN2A 4I2GA 3OV7A 3K7DA 4NM1A 9ICIA 4WH5A 4PPXA 3C5GA 4MFFA 4KLLA 3JYYA 4WCWA 4K4IA 5D61A 5CP2A 4F5RA 4WC6A 4FHVA 2M2UA 2Q66A 4KLSA 3L9DA 4X4TA 4EEBA 4YD1A 5J0QA 4RT2A 5HRIA 4M04A 1ZQXA 1Q79A 4WBZA 9ICWA 1F5AA 4KLHA 2ZH2A 9ICAA 8ICSA 5IILA 4IQTA 2BCQA 4WBYA 2PXIA 4FO1A 3ER9B 4UB2A 3JZ0A 4NLZA 9ICQA 5F2VO 1PX5A 5CFTA 5EOZA 4KLFA 4WOYA 5CHGA 4GXIA 4RQ1A 4NLKA 3AQNA 4QZEA 2ZHAA 4E7XA 4QZ9A 1JAJA 4X4PA 7ICTA 5J2BA 2ZH5A 3MGIA 1ZQNA 4PHEA 1MQ3A 4M5DA 5JTGA 4WC0A 3TFSA 2ZH1A 4GXJA 5CB1A 5DBBA 1ZQPA 4KLMA 3MCRA 1JN3A 4X4SA 3AU6A 7ICEA 5J2EA 3RH5A 4KLDA 2DR7A 3JPTA 5J2JA 3B0XA 3ISCA 4RWPA 4PH5A 5D49A 1ZQRA 9ICBA 3MBYA 1ZQQA 9ICEA 3H39A 5HRBA 8ICGA 4UD4A 4I27A 3C66A 8ICPA 4X4OA 8ICHA 4YCXA 2M2TA 4PHDA 4I2DA 4KLOA 4XRHA 1RPLA 5J2HA 4P4MA 4RPZA 2ISPA 5J0RA 1ZQIA 1R89A 3LQCB 4JWMA 1UEVA
chains in the Genus database with same CATH topology
1XSNA 3HW8A 4KLUA 4YMOA 4I28A 1BPXA 4QZFA 7ICQA 3RJEA 8ICEA 5CR0A 1MIVA 4RQ2A 1TFWA 2ZH3A 4TURA 7ICVA 5J2FA 4UAWA 5J2AA 2BCSA 4TUPA 1ZQVA 8ICJA 3V7KA 4QZGA 9ICCA 4AT9A 5IINA 5DEDA 2DR9A 8ICUA 1WOTA 5IIKA 3AQMA 9ICRA 3C2MA 4RQ3A 7ICKA 9ICMA 3OVAA 7ICHA 4RWOA 9ICJA 3ISBA 2DRBA 1ZJMA 4RQ8A 4KLIA 3OUYA 4JWNA 1R8AA 3RH4A 4UD5A 5D46A 5J0TA 1FA0A 4AT8A 3V7JA 1BPDA 8ICOA 5HHIA 4XQ7A 3MDAA 1ZQWA 3UXPA 5J2CA 1ZQMA 4WC1A 2PFQA 1NOMA 5BOMA 2ZH6A 4TUSA 4X5VA 1BPEA 2ID1A 4XUSA 4I2HA 4RT3A 4MFAA 2FMPA 4EBKA 4O5KA 7ICOA 2PFOA 1ZQUA 4ATBB 5HC9A 4QZDA 3HJ4A 4WC5A 4QZBA 3HJ1A 1ZQYA 4XA5A 4UAZA 4RPYA 4AT7B 4R66A 5J0XA 5D4BA 1ZJNA 3HIYA 4QZCA 4KLEA 3HWTA 1ZQCA 9ICGA 3ISDA 4I2JA 4F5OA 7ICIA 7ICRA 3UPSA 8ICYA 4X4UA 4I2FA 2ZH4A 4E8FA 4EBJA 4MFCA 4RWQA 4EP7A 1JMSA 4LT6A 9ICNA 1ZQFA 4WC7A 4GXKA 4UAYA 4E80A 4UB4A 1ZQBA 3H3AA 3WFRE 3WFOA 4P4PA 2P66A 4PHPA 8ICWA 3WFQE 4IQVA 2M2VA 4FHYA 4MF2A 2O5AA 1Q78A 4O9MA 3UXNA 3OGUA 5DB7A 3UQ2A 4UB5A 4K4HA 8ICTA 1JQRA 5J2DA 2PFNA 4KLGA 3JPQA 5HR9A 5J0PA 5J0UA 2FMQA 2GWSA 3PMNA 4QZ8A 2ISOA 4LZDA 3GDXA 9ICVA 4NKUA 4I2BA 2I9GA 1MIWA 1MIYA 4FH5A 7ICFA 1ZQSA 4LZGA 9ICFA 4TUQA 5CWRA 2BE3A 1ZQJA 4PGYA 5HHHA 2IHMA 3AU2A 4Z6FA 1KNYA 2M2WA 4UB3A 5J2IA 1UETA 4FH3A 4M0AA 3TFRA 8ICVA 2DR5A 4X4VA 8ICNA 3NYBA 1MQ2A 4FO6A 4Z6EA 4X0BA 4M9JA 3JPSA 4NM2A 5BOLA 5HRDA 1XSLA 5IIIA 1ZQDA 4F5PA 3UQ0A 1ZQOA 8ICXA 4P2HA 4YMMA 4QZAA 1ZQTA 4RQ6A 1ZQZA 3OVBA 5J29A 4R64A 1HUOA 3H37A 2DRAA 5DBAA 5HRGA 4FHWA 2ZHBA 4QZHA 8ICKA 9ICOA 3AUOA 4P4OA 5J0OA 4LVSA 3JPPA 8ICZA 2VANA 4AT9B 4I2AA 3WFPA 5J2GA 1KDHA 1TFYA 9ICUA 5DB6A 5J0YA 4X4QA 2FMSA 4M9LA 1XSPA 1ZQLA 3MGHA 3K75D 3RJKA 2HHPA 4WC4A 5HRHA 3OUYB 1YLQA 4Z6DA 4M9HA 4X4RA 5J0SA 7ICJA 4AT8B 5CJ7A 4UBBA 4FHXA 3JPNA 5HRFA 4PGQA 1ZQAA 4RWNA 2PFPA 1R8BA 4KLJA 3H38A 4I29A 1VJ7A 4M2YA 4X4NA 4RQ0A 3RH6A 1ZQKA 9ICSA 3JPOA 4UBCA 7ICMA 5J0WA 1VFGA 1KEJA 2ZH7A 8ICLA 4NLNA 4X0AA 5IIMA 3HX0A 4Z6CA 1ZQGA 2BPGA 3AQLA 4M9GA 3PMLA 3RJGA 9ICPA 1HUZA 4DO9A 3UPQA 5BPCA 4YD2A 5DDMA 1V4AA 1NO5A 3RJJA 3C2KA 4KLQA 4XQ8A 4MF8A 2ZH9A 3RJFA 8ICMA 3PNCA 1ZQHA 5HREA 4S3NA 1BPBA 4YN4A 4F5NA 4R63A 4M9NA 8ICBA 2NRKA 4NY8A 4KLTA 7ICLA 5IIOA 8ICIA 3UXOA 4DOCA 9ICLA 7ICUA 9ICHA 4K4GA 7ICNA 5IIJA 4O5EA 4IG8A 8ICCA 4DOAA 3LK9A 2RFFA 9ICXA 4RQ7A 4PGXA 1UEUA 4YMNA 7ICSA 2O1PA 3B0YA 4WC3A 5DB9A 5DECA 5DKWA 3C2LA 4O5CA 4PHAA 2PBEA 8ICQA 3V7LA 5DBCA 5J2KA 5DDYA 2BCVA 4NXZA 3RJHA 3V72A 4WC2A 4IQWA 4RQ4A 2BCUA 8ICAA 5DB8A 1BPYA 3C18A 1OU5A 4FHPA 5HRLA 4QZIA 4IQUA 2BCRA 2ZH8A 4NKTA 9ICKA 4DOBA 4ATBA 7ICPA 4I2CA 3OVSA 3C5FA 4M47A 8ICRA 7ICGA 4UB1A 4RPXA 2BPFA 1ZQEA 3WFSC 4I2EA 4AT7A 3JPRA 1RZTA 3MDCA 5TZVA 3RJIA 5CA7A 2W9MA 4I2IA 2DVIA 9ICTA 1TVAA 3AQKA 1BPZA 2DR8A 4RQ5A 4F5QA 2BPCA 4R65A 5HRKA 8ICFA 1R8CA 1TV9A 4I2GA 3OV7A 4NM1A 9ICIA 4PPXA 3C5GA 4MFFA 4KLLA 3JYYA 4WCWA 4K4IA 5CP2A 4F5RA 4WC6A 4FHVA 2M2UA 2Q66A 4KLSA 3L9DA 4X4TA 4YD1A 5J0QA 4RT2A 5HRIA 4M04A 1ZQXA 1Q79A 4WBZA 9ICWA 1F5AA 4KLHA 2ZH2A 9ICAA 8ICSA 5IILA 4IQTA 2BCQA 4WBYA 2PXIA 4UB2A 3JZ0A 4NLZA 9ICQA 5F2VO 1PX5A 5EOZA 4KLFA 5CHGA 4GXIA 4RQ1A 4NLKA 3AQNA 4QZEA 2ZHAA 4E7XA 4QZ9A 1JAJA 4X4PA 7ICTA 5J2BA 2ZH5A 3MGIA 1ZQNA 4PHEA 1MQ3A 4M5DA 4WC0A 3TFSA 2ZH1A 4GXJA 5CB1A 5DBBA 1ZQPA 4KLMA 1JN3A 4X4SA 3AU6A 7ICEA 5J2EA 3RH5A 4KLDA 2DR7A 3JPTA 5J2JA 3B0XA 3ISCA 4RWPA 4PH5A 5D49A 1ZQRA 9ICBA 3MBYA 1ZQQA 9ICEA 3H39A 5HRBA 8ICGA 4UD4A 4I27A 3C66A 8ICPA 4X4OA 8ICHA 4YCXA 2M2TA 4PHDA 4I2DA 4KLOA 4XRHA 1RPLA 5J2HA 4P4MA 4RPZA 2ISPA 5J0RA 1ZQIA 1R89A 3LQCB 4JWMA 1UEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSN A;  3HW8 A;  4KLU A;  4YMO A;  4I28 A;  1BPX A;  4QZF A;  7ICQ A;  3RJE A;  8ICE A;  5CR0 A;  1MIV A;  4RQ2 A;  1TFW A;  2ZH3 A;  4TUR A;  7ICV A;  5J2F A;  4UAW A;  5J2A A;  2BCS A;  4TUP A;  1ZQV A;  8ICJ A;  3V7K A;  4QZG A;  9ICC A;  4AT9 A;  5IIN A;  5DED A;  2DR9 A;  8ICU A;  1WOT A;  5IIK A;  3AQM A;  9ICR A;  3C2M A;  4RQ3 A;  7ICK A;  9ICM A;  3OVA A;  7ICH A;  4RWO A;  9ICJ A;  3ISB A;  2DRB A;  1ZJM A;  4RQ8 A;  4KLI A;  3OUY A;  4JWN A;  1R8A A;  3RH4 A;  4UD5 A;  5D46 A;  5J0T A;  1FA0 A;  4AT8 A;  3V7J A;  1BPD A;  8ICO A;  5HHI A;  4XQ7 A;  3MDA A;  1ZQW A;  3UXP A;  5J2C A;  1ZQM A;  4WC1 A;  2PFQ A;  1NOM A;  5BOM A;  2ZH6 A;  4TUS A;  4X5V A;  1BPE A;  2ID1 A;  4XUS A;  4I2H A;  4RT3 A;  4MFA A;  2FMP A;  4EBK A;  4O5K A;  7ICO A;  2PFO A;  1ZQU A;  4ATB B;  5HC9 A;  4QZD A;  3HJ4 A;  4WC5 A;  4QZB A;  3HJ1 A;  1ZQY A;  4XA5 A;  4UAZ A;  4RPY A;  4AT7 B;  4R66 A;  5J0X A;  5D4B A;  1ZJN A;  3HIY A;  4QZC A;  4KLE A;  3HWT A;  1ZQC A;  9ICG A;  3ISD A;  4I2J A;  4F5O A;  7ICI A;  7ICR A;  3UPS A;  8ICY A;  4X4U A;  4I2F A;  2ZH4 A;  4E8F A;  4EBJ A;  4MFC A;  4RWQ A;  4EP7 A;  1JMS A;  4LT6 A;  9ICN A;  1ZQF A;  4WC7 A;  4GXK A;  4UAY A;  4E80 A;  4UB4 A;  1ZQB A;  3H3A A;  3WFR E;  3WFO A;  4P4P A;  2P66 A;  4PHP A;  8ICW A;  3WFQ E;  4IQV A;  2M2V A;  4FHY A;  4MF2 A;  2O5A A;  1Q78 A;  4O9M A;  3UXN A;  3OGU A;  5DB7 A;  3UQ2 A;  4UB5 A;  4K4H A;  8ICT A;  1JQR A;  5J2D A;  2PFN A;  4KLG A;  3JPQ A;  5HR9 A;  5J0P A;  5J0U A;  2FMQ A;  2GWS A;  3PMN A;  4QZ8 A;  2ISO A;  4LZD A;  3GDX A;  9ICV A;  4NKU A;  4I2B A;  2I9G A;  1MIW A;  1MIY A;  4FH5 A;  7ICF A;  1ZQS A;  4LZG A;  9ICF A;  4TUQ A;  5CWR A;  2BE3 A;  1ZQJ A;  4PGY A;  5HHH A;  2IHM A;  3AU2 A;  4Z6F A;  1KNY A;  2M2W A;  4UB3 A;  5J2I A;  1UET A;  4FH3 A;  4M0A A;  3TFR A;  8ICV A;  2DR5 A;  4X4V A;  8ICN A;  3NYB A;  1MQ2 A;  4FO6 A;  4Z6E A;  4X0B A;  4M9J A;  3JPS A;  4NM2 A;  5BOL A;  5HRD A;  1XSL A;  5III A;  1ZQD A;  4F5P A;  3UQ0 A;  1ZQO A;  8ICX A;  4P2H A;  4YMM A;  4QZA A;  1ZQT A;  4RQ6 A;  1ZQZ A;  3OVB A;  5J29 A;  4R64 A;  1HUO A;  3H37 A;  2DRA A;  5DBA A;  5HRG A;  4FHW A;  2ZHB A;  4QZH A;  8ICK A;  9ICO A;  3AUO A;  4P4O A;  5J0O A;  4LVS A;  3JPP A;  8ICZ A;  2VAN A;  4AT9 B;  4I2A A;  3WFP A;  5J2G A;  1KDH A;  1TFY A;  9ICU A;  5DB6 A;  5J0Y A;  4X4Q A;  2FMS A;  4M9L A;  1XSP A;  1ZQL A;  3MGH A;  3K75 D;  3RJK A;  2HHP A;  4WC4 A;  5HRH A;  3OUY B;  1YLQ A;  4Z6D A;  4M9H A;  4X4R A;  5J0S A;  7ICJ A;  4AT8 B;  5CJ7 A;  4UBB A;  4FHX A;  3JPN A;  5HRF A;  4PGQ A;  1ZQA A;  4RWN A;  2PFP A;  1R8B A;  4KLJ A;  3H38 A;  4I29 A;  1VJ7 A;  4M2Y A;  4X4N A;  4RQ0 A;  3RH6 A;  1ZQK A;  9ICS A;  3JPO A;  4UBC A;  7ICM A;  5J0W A;  1VFG A;  1KEJ A;  2ZH7 A;  8ICL A;  4NLN A;  4X0A A;  5IIM A;  3HX0 A;  4Z6C A;  1ZQG A;  2BPG A;  3AQL A;  4M9G A;  3PML A;  3RJG A;  9ICP A;  1HUZ A;  4DO9 A;  3UPQ A;  5BPC A;  4YD2 A;  5DDM A;  1V4A A;  1NO5 A;  3RJJ A;  3C2K A;  4KLQ A;  4XQ8 A;  4MF8 A;  2ZH9 A;  3RJF A;  8ICM A;  3PNC A;  1ZQH A;  5HRE A;  4S3N A;  1BPB A;  4YN4 A;  4F5N A;  4R63 A;  4M9N A;  8ICB A;  2NRK A;  4NY8 A;  4KLT A;  7ICL A;  5IIO A;  8ICI A;  3UXO A;  4DOC A;  9ICL A;  7ICU A;  9ICH A;  4K4G A;  7ICN A;  5IIJ A;  4O5E A;  4IG8 A;  8ICC A;  4DOA A;  3LK9 A;  2RFF A;  9ICX A;  4RQ7 A;  4PGX A;  1UEU A;  4YMN A;  7ICS A;  2O1P A;  3B0Y A;  4WC3 A;  5DB9 A;  5DEC A;  5DKW A;  3C2L A;  4O5C A;  4PHA A;  2PBE A;  8ICQ A;  3V7L A;  5DBC A;  5J2K A;  5DDY A;  2BCV A;  4NXZ A;  3RJH A;  3V72 A;  4WC2 A;  4IQW A;  4RQ4 A;  2BCU A;  8ICA A;  5DB8 A;  1BPY A;  3C18 A;  1OU5 A;  4FHP A;  5HRL A;  4QZI A;  4IQU A;  2BCR A;  2ZH8 A;  4NKT A;  9ICK A;  4DOB A;  4ATB A;  7ICP A;  4I2C A;  3OVS A;  3C5F A;  4M47 A;  8ICR A;  7ICG A;  4UB1 A;  4RPX A;  2BPF A;  1ZQE A;  3WFS C;  4I2E A;  4AT7 A;  3JPR A;  1RZT A;  3MDC A;  5TZV A;  3RJI A;  5CA7 A;  2W9M A;  4I2I A;  2DVI A;  9ICT A;  1TVA A;  3AQK A;  1BPZ A;  2DR8 A;  4RQ5 A;  4F5Q A;  2BPC A;  4R65 A;  5HRK A;  8ICF A;  1R8C A;  1TV9 A;  4I2G A;  3OV7 A;  4NM1 A;  9ICI A;  4PPX A;  3C5G A;  4MFF A;  4KLL A;  3JYY A;  4WCW A;  4K4I A;  5CP2 A;  4F5R A;  4WC6 A;  4FHV A;  2M2U A;  2Q66 A;  4KLS A;  3L9D A;  4X4T A;  4YD1 A;  5J0Q A;  4RT2 A;  5HRI A;  4M04 A;  1ZQX A;  1Q79 A;  4WBZ A;  9ICW A;  1F5A A;  4KLH A;  2ZH2 A;  9ICA A;  8ICS A;  5IIL A;  4IQT A;  2BCQ A;  4WBY A;  2PXI A;  4UB2 A;  3JZ0 A;  4NLZ A;  9ICQ A;  5F2V O;  1PX5 A;  5EOZ A;  4KLF A;  5CHG A;  4GXI A;  4RQ1 A;  4NLK A;  3AQN A;  4QZE A;  2ZHA A;  4E7X A;  4QZ9 A;  1JAJ A;  4X4P A;  7ICT A;  5J2B A;  2ZH5 A;  3MGI A;  1ZQN A;  4PHE A;  1MQ3 A;  4M5D A;  4WC0 A;  3TFS A;  2ZH1 A;  4GXJ A;  5CB1 A;  5DBB A;  1ZQP A;  4KLM A;  1JN3 A;  4X4S A;  3AU6 A;  7ICE A;  5J2E A;  3RH5 A;  4KLD A;  2DR7 A;  3JPT A;  5J2J A;  3B0X A;  3ISC A;  4RWP A;  4PH5 A;  5D49 A;  1ZQR A;  9ICB A;  3MBY A;  1ZQQ A;  9ICE A;  3H39 A;  5HRB A;  8ICG A;  4UD4 A;  4I27 A;  3C66 A;  8ICP A;  4X4O A;  8ICH A;  4YCX A;  2M2T A;  4PHD A;  4I2D A;  4KLO A;  4XRH A;  1RPL A;  5J2H A;  4P4M A;  4RPZ A;  2ISP A;  5J0R A;  1ZQI A;  1R89 A;  3LQC B;  4JWM A;  1UEV A; 
#chains in the Genus database with same CATH topology
 1XSN A;  3HW8 A;  4KLU A;  4YMO A;  4JLZ A;  4I28 A;  1BPX A;  4QZF A;  7ICQ A;  3RJE A;  8ICE A;  5CR0 A;  1MIV A;  4RQ2 A;  1TFW A;  2ZH3 A;  4TUR A;  7ICV A;  5J2F A;  4UAW A;  5J2A A;  2BCS A;  4TUP A;  1ZQV A;  8ICJ A;  3V7K A;  4QZG A;  9ICC A;  4AT9 A;  5IIN A;  5DED A;  2DR9 A;  8ICU A;  1WOT A;  2B51 A;  3AQM A;  5IIK A;  9ICR A;  3C2M A;  4K98 A;  4RQ3 A;  7ICK A;  9ICM A;  3OVA A;  7ICH A;  4RWO A;  9ICJ A;  3ISB A;  2DRB A;  1ZJM A;  4RQ8 A;  4KLI A;  4O67 A;  2B4V A;  3OUY A;  4JWN A;  1GPJ A;  1R8A A;  3RH4 A;  4NXX A;  4UD5 A;  5D46 A;  5J0T A;  1FA0 A;  4AT8 A;  3V7J A;  1BPD A;  8ICO A;  5HHI A;  4XQ7 A;  3MDA A;  1ZQW A;  5CHE A;  3UXP A;  5J2C A;  1ZQM A;  4WC1 A;  2PFQ A;  1NOM A;  5BOM A;  2ZH6 A;  4TUS A;  4X5V A;  1BPE A;  2ID1 A;  4XUS A;  4I2H A;  4RT3 A;  4MFA A;  2FMP A;  4EBK A;  4O5K A;  7ICO A;  2PFO A;  1ZQU A;  4ATB B;  5HC9 A;  4QZD A;  4KB6 A;  3HJ4 A;  4LEY A;  4WC5 A;  4QZB A;  3HJ1 A;  1ZQY A;  4NXU A;  4XA5 A;  4UAZ A;  5CFU A;  4RPY A;  4AT7 B;  2IHO A;  3OWG A;  4R66 A;  2FCL A;  5J0X A;  5D4B A;  1ZJN A;  3HIY A;  4LEW A;  4QZC A;  4KLE A;  3HWT A;  1ZQC A;  9ICG A;  3ISD A;  4O6A A;  4I2J A;  4F5O A;  7ICI A;  7ICR A;  3UPS A;  8ICY A;  4X4U A;  4I2F A;  2ZH4 A;  4E8F A;  4EBJ A;  4MFC A;  4RWQ A;  4EP7 A;  1JMS A;  4K99 A;  2BBJ A;  3CK6 A;  4LT6 A;  9ICN A;  1ZQF A;  4WC7 A;  4GXK A;  4UAY A;  4E80 A;  4UB4 A;  1ZQB A;  4K9A A;  3H3A A;  3WFR E;  3WFO A;  4P4P A;  4XJE A;  2P66 A;  4PHP A;  4OAI Z;  8ICW A;  3WFQ E;  4IQV A;  2M2V A;  4FHY A;  4MF2 A;  2O5A A;  5D63 A;  1Q78 A;  4O9M A;  3UXN A;  3OGU A;  5DB7 A;  3UQ2 A;  4UB5 A;  4K4H A;  8ICT A;  3EF2 A;  1JQR A;  5J2D A;  2PFN A;  2IUB A;  4KLG A;  3JPQ A;  5HR9 A;  5J0P A;  5J0U A;  2FMQ A;  2GWS A;  3PMN A;  2EWR A;  4QZ8 A;  2ISO A;  4N7R A;  4LZD A;  3GDX A;  9ICV A;  4HX0 A;  5B3Q A;  4NKU A;  4I2B A;  2I9G A;  1MIW A;  4KM5 A;  1MIY A;  4FH5 A;  7ICF A;  1ZQS A;  4LZG A;  9ICF A;  4TUQ A;  5CWR A;  2BE3 A;  1ZQJ A;  5CFS A;  3ERC C;  4PGY A;  5HHH A;  2IHM A;  3AU2 A;  4Z6F A;  1KNY A;  2M2W A;  4UB3 A;  5J2I A;  4EV6 A;  1UET A;  4NXV A;  4FH3 A;  4M0A A;  4O69 A;  4EED A;  3TFR A;  8ICV A;  2DR5 A;  4X4V A;  4NXW A;  8ICN A;  3NYB A;  4I0U A;  1MQ2 A;  4FO6 A;  3NVO A;  4Z6E A;  4X0B A;  4M9J A;  3JPS A;  4NM2 A;  5BOL A;  5HRD A;  1XSL A;  5III A;  1ZQD A;  4F5P A;  3UQ0 A;  1ZQO A;  4MKP A;  8ICX A;  4P2H A;  4YMM A;  4QZA A;  1ZQT A;  4RQ6 A;  1ZQZ A;  3OVB A;  5J29 A;  4R64 A;  1HUO A;  3H37 A;  4NXT A;  2DRA A;  5DBA A;  5HRG A;  4FHW A;  2ZHB A;  4QZH A;  8ICK A;  9ICO A;  3AUO A;  4P4O A;  5J0O A;  4LVS A;  3JPP A;  8ICZ A;  2VAN A;  4AT9 B;  4I2A A;  3WFP A;  2GA9 D;  5J2G A;  1KDH A;  1TFY A;  9ICU A;  5DB6 A;  5J0Y A;  4X4Q A;  2FMS A;  2HN1 A;  4M9L A;  1XSP A;  1ZQL A;  4LEZ A;  3MGH A;  3K75 D;  3RJK A;  2HHP A;  4WC4 A;  5HRH A;  3OUY B;  1YLQ A;  4Z6D A;  3PHZ A;  4M9H A;  4X4R A;  5J0S A;  7ICJ A;  4K8V A;  4AT8 B;  5CJ7 A;  4UBB A;  4FHX A;  4O68 A;  3JPN A;  4WQL A;  5HRF A;  4PGQ A;  1ZQA A;  4RWN A;  2GAF D;  2PFP A;  1R8B A;  4KLJ A;  3H38 A;  4I29 A;  1VJ7 A;  4M2Y A;  4X4N A;  4RQ0 A;  3RH6 A;  1ZQK A;  9ICS A;  3JPO A;  4UBC A;  7ICM A;  5J0W A;  1VFG A;  1KEJ A;  2ZH7 A;  8ICL A;  4NLN A;  4X0A A;  5IIM A;  3HX0 A;  4Z6C A;  1ZQG A;  2BPG A;  3AQL A;  4M9G A;  2B56 A;  3PML A;  3RJG A;  9ICP A;  1HUZ A;  4DO9 A;  4LEV A;  5BPC A;  3UPQ A;  4YD2 A;  3JCF A;  5DDM A;  1V4A A;  1NO5 A;  3RJJ A;  4K96 A;  3C2K A;  4KLQ A;  4XQ8 A;  4K97 A;  4MF8 A;  2ZH9 A;  3RJF A;  8ICM A;  3PNC A;  1ZQH A;  5D62 A;  4OAG A;  5HRE A;  4S3N A;  1BPB A;  4YN4 A;  4F5N A;  4R63 A;  4M9N A;  8ICB A;  2NRK A;  4NY8 A;  4KLT A;  7ICL A;  5IIO A;  4K9B A;  4OAF A;  8ICI A;  3UXO A;  4DOC A;  9ICL A;  7ICU A;  9ICH A;  2BBH A;  4K4G A;  7ICN A;  5IIJ A;  4O5E A;  4IG8 A;  8ICC A;  4DOA A;  3LK9 A;  2RFF A;  9ICX A;  4RQ7 A;  4PGX A;  1UEU A;  4YMN A;  3ER8 C;  7ICS A;  2O1P A;  4JLX A;  3B0Y A;  4WC3 A;  5DB9 A;  5DEC A;  5DKW A;  3C2L A;  4O5C A;  4PHA A;  2PBE A;  8ICQ A;  3V7L A;  5DBC A;  5B3P A;  5J2K A;  5DDY A;  2BCV A;  4NXZ A;  3RJH A;  3V72 A;  4WC2 A;  4IQW A;  4RQ4 A;  2BCU A;  3NKU A;  8ICA A;  5DB8 A;  1BPY A;  3C18 A;  1OU5 A;  4FHP A;  5HRL A;  4QZI A;  4IQU A;  2BCR A;  2ZH8 A;  4NKT A;  9ICK A;  4DOB A;  4ATB A;  7ICP A;  4I2C A;  3OVS A;  4WQK A;  3C5F A;  4M47 A;  8ICR A;  7ICG A;  4UB1 A;  4RPX A;  2BPF A;  1ZQE A;  3WFS C;  4I2E A;  4AT7 A;  3JPR A;  1RZT A;  3MDC A;  5TZV A;  3RJI A;  3NWI A;  5CA7 A;  2W9M A;  4I2I A;  2DVI A;  9ICT A;  1TVA A;  3AQK A;  1BPZ A;  2DR8 A;  4EGW A;  4RQ5 A;  4F5Q A;  2BPC A;  4R65 A;  4OAH A;  5HRK A;  8ICF A;  1R8C A;  1TV9 A;  2HN2 A;  4I2G A;  3OV7 A;  3K7D A;  4NM1 A;  9ICI A;  4WH5 A;  4PPX A;  3C5G A;  4MFF A;  4KLL A;  3JYY A;  4WCW A;  4K4I A;  5D61 A;  5CP2 A;  4F5R A;  4WC6 A;  4FHV A;  2M2U A;  2Q66 A;  4KLS A;  3L9D A;  4X4T A;  4EEB A;  4YD1 A;  5J0Q A;  4RT2 A;  5HRI A;  4M04 A;  1ZQX A;  1Q79 A;  4WBZ A;  9ICW A;  1F5A A;  4KLH A;  2ZH2 A;  9ICA A;  8ICS A;  5IIL A;  4IQT A;  2BCQ A;  4WBY A;  2PXI A;  4FO1 A;  3ER9 B;  4UB2 A;  3JZ0 A;  4NLZ A;  9ICQ A;  5F2V O;  1PX5 A;  5CFT A;  5EOZ A;  4KLF A;  4WOY A;  5CHG A;  4GXI A;  4RQ1 A;  4NLK A;  3AQN A;  4QZE A;  2ZHA A;  4E7X A;  4QZ9 A;  1JAJ A;  4X4P A;  7ICT A;  5J2B A;  2ZH5 A;  3MGI A;  1ZQN A;  4PHE A;  1MQ3 A;  4M5D A;  5JTG A;  4WC0 A;  3TFS A;  2ZH1 A;  4GXJ A;  5CB1 A;  5DBB A;  1ZQP A;  4KLM A;  3MCR A;  1JN3 A;  4X4S A;  3AU6 A;  7ICE A;  5J2E A;  3RH5 A;  4KLD A;  2DR7 A;  3JPT A;  5J2J A;  3B0X A;  3ISC A;  4RWP A;  4PH5 A;  5D49 A;  1ZQR A;  9ICB A;  3MBY A;  1ZQQ A;  9ICE A;  3H39 A;  5HRB A;  8ICG A;  4UD4 A;  4I27 A;  3C66 A;  8ICP A;  4X4O A;  8ICH A;  4YCX A;  2M2T A;  4PHD A;  4I2D A;  4KLO A;  4XRH A;  1RPL A;  5J2H A;  4P4M A;  4RPZ A;  2ISP A;  5J0R A;  1ZQI A;  1R89 A;  3LQC B;  4JWM A;  1UEV A; 
#chains in the Genus database with same CATH homology
 1XSN A;  3HW8 A;  4KLU A;  4YMO A;  4I28 A;  1BPX A;  4QZF A;  7ICQ A;  3RJE A;  8ICE A;  5CR0 A;  1MIV A;  4RQ2 A;  1TFW A;  2ZH3 A;  4TUR A;  7ICV A;  5J2F A;  4UAW A;  5J2A A;  2BCS A;  4TUP A;  1ZQV A;  8ICJ A;  3V7K A;  4QZG A;  9ICC A;  4AT9 A;  5IIN A;  5DED A;  2DR9 A;  8ICU A;  1WOT A;  5IIK A;  3AQM A;  9ICR A;  3C2M A;  4RQ3 A;  7ICK A;  9ICM A;  3OVA A;  7ICH A;  4RWO A;  9ICJ A;  3ISB A;  2DRB A;  1ZJM A;  4RQ8 A;  4KLI A;  3OUY A;  4JWN A;  1R8A A;  3RH4 A;  4UD5 A;  5D46 A;  5J0T A;  1FA0 A;  4AT8 A;  3V7J A;  1BPD A;  8ICO A;  5HHI A;  4XQ7 A;  3MDA A;  1ZQW A;  3UXP A;  5J2C A;  1ZQM A;  4WC1 A;  2PFQ A;  1NOM A;  5BOM A;  2ZH6 A;  4TUS A;  4X5V A;  1BPE A;  2ID1 A;  4XUS A;  4I2H A;  4RT3 A;  4MFA A;  2FMP A;  4EBK A;  4O5K A;  7ICO A;  2PFO A;  1ZQU A;  4ATB B;  5HC9 A;  4QZD A;  3HJ4 A;  4WC5 A;  4QZB A;  3HJ1 A;  1ZQY A;  4XA5 A;  4UAZ A;  4RPY A;  4AT7 B;  4R66 A;  5J0X A;  5D4B A;  1ZJN A;  3HIY A;  4QZC A;  4KLE A;  3HWT A;  1ZQC A;  9ICG A;  3ISD A;  4I2J A;  4F5O A;  7ICI A;  7ICR A;  3UPS A;  8ICY A;  4X4U A;  4I2F A;  2ZH4 A;  4E8F A;  4EBJ A;  4MFC A;  4RWQ A;  4EP7 A;  1JMS A;  4LT6 A;  9ICN A;  1ZQF A;  4WC7 A;  4GXK A;  4UAY A;  4E80 A;  4UB4 A;  1ZQB A;  3H3A A;  3WFR E;  3WFO A;  4P4P A;  2P66 A;  4PHP A;  8ICW A;  3WFQ E;  4IQV A;  2M2V A;  4FHY A;  4MF2 A;  2O5A A;  1Q78 A;  4O9M A;  3UXN A;  3OGU A;  5DB7 A;  3UQ2 A;  4UB5 A;  4K4H A;  8ICT A;  1JQR A;  5J2D A;  2PFN A;  4KLG A;  3JPQ A;  5HR9 A;  5J0P A;  5J0U A;  2FMQ A;  2GWS A;  3PMN A;  4QZ8 A;  2ISO A;  4LZD A;  3GDX A;  9ICV A;  4NKU A;  4I2B A;  2I9G A;  1MIW A;  1MIY A;  4FH5 A;  7ICF A;  1ZQS A;  4LZG A;  9ICF A;  4TUQ A;  5CWR A;  2BE3 A;  1ZQJ A;  4PGY A;  5HHH A;  2IHM A;  3AU2 A;  4Z6F A;  1KNY A;  2M2W A;  4UB3 A;  5J2I A;  1UET A;  4FH3 A;  4M0A A;  3TFR A;  8ICV A;  2DR5 A;  4X4V A;  8ICN A;  3NYB A;  1MQ2 A;  4FO6 A;  4Z6E A;  4X0B A;  4M9J A;  3JPS A;  4NM2 A;  5BOL A;  5HRD A;  1XSL A;  5III A;  1ZQD A;  4F5P A;  3UQ0 A;  1ZQO A;  8ICX A;  4P2H A;  4YMM A;  4QZA A;  1ZQT A;  4RQ6 A;  1ZQZ A;  3OVB A;  5J29 A;  4R64 A;  1HUO A;  3H37 A;  2DRA A;  5DBA A;  5HRG A;  4FHW A;  2ZHB A;  4QZH A;  8ICK A;  9ICO A;  3AUO A;  4P4O A;  5J0O A;  4LVS A;  3JPP A;  8ICZ A;  2VAN A;  4AT9 B;  4I2A A;  3WFP A;  5J2G A;  1KDH A;  1TFY A;  9ICU A;  5DB6 A;  5J0Y A;  4X4Q A;  2FMS A;  4M9L A;  1XSP A;  1ZQL A;  3MGH A;  3K75 D;  3RJK A;  2HHP A;  4WC4 A;  5HRH A;  3OUY B;  1YLQ A;  4Z6D A;  4M9H A;  4X4R A;  5J0S A;  7ICJ A;  4AT8 B;  5CJ7 A;  4UBB A;  4FHX A;  3JPN A;  5HRF A;  4PGQ A;  1ZQA A;  4RWN A;  2PFP A;  1R8B A;  4KLJ A;  3H38 A;  4I29 A;  1VJ7 A;  4M2Y A;  4X4N A;  4RQ0 A;  3RH6 A;  1ZQK A;  9ICS A;  3JPO A;  4UBC A;  7ICM A;  5J0W A;  1VFG A;  1KEJ A;  2ZH7 A;  8ICL A;  4NLN A;  4X0A A;  5IIM A;  3HX0 A;  4Z6C A;  1ZQG A;  2BPG A;  3AQL A;  4M9G A;  3PML A;  3RJG A;  9ICP A;  1HUZ A;  4DO9 A;  3UPQ A;  5BPC A;  4YD2 A;  5DDM A;  1V4A A;  1NO5 A;  3RJJ A;  3C2K A;  4KLQ A;  4XQ8 A;  4MF8 A;  2ZH9 A;  3RJF A;  8ICM A;  3PNC A;  1ZQH A;  5HRE A;  4S3N A;  1BPB A;  4YN4 A;  4F5N A;  4R63 A;  4M9N A;  8ICB A;  2NRK A;  4NY8 A;  4KLT A;  7ICL A;  5IIO A;  8ICI A;  3UXO A;  4DOC A;  9ICL A;  7ICU A;  9ICH A;  4K4G A;  7ICN A;  5IIJ A;  4O5E A;  4IG8 A;  8ICC A;  4DOA A;  3LK9 A;  2RFF A;  9ICX A;  4RQ7 A;  4PGX A;  1UEU A;  4YMN A;  7ICS A;  2O1P A;  3B0Y A;  4WC3 A;  5DB9 A;  5DEC A;  5DKW A;  3C2L A;  4O5C A;  4PHA A;  2PBE A;  8ICQ A;  3V7L A;  5DBC A;  5J2K A;  5DDY A;  2BCV A;  4NXZ A;  3RJH A;  3V72 A;  4WC2 A;  4IQW A;  4RQ4 A;  2BCU A;  8ICA A;  5DB8 A;  1BPY A;  3C18 A;  1OU5 A;  4FHP A;  5HRL A;  4QZI A;  4IQU A;  2BCR A;  2ZH8 A;  4NKT A;  9ICK A;  4DOB A;  4ATB A;  7ICP A;  4I2C A;  3OVS A;  3C5F A;  4M47 A;  8ICR A;  7ICG A;  4UB1 A;  4RPX A;  2BPF A;  1ZQE A;  3WFS C;  4I2E A;  4AT7 A;  3JPR A;  1RZT A;  3MDC A;  5TZV A;  3RJI A;  5CA7 A;  2W9M A;  4I2I A;  2DVI A;  9ICT A;  1TVA A;  3AQK A;  1BPZ A;  2DR8 A;  4RQ5 A;  4F5Q A;  2BPC A;  4R65 A;  5HRK A;  8ICF A;  1R8C A;  1TV9 A;  4I2G A;  3OV7 A;  4NM1 A;  9ICI A;  4PPX A;  3C5G A;  4MFF A;  4KLL A;  3JYY A;  4WCW A;  4K4I A;  5CP2 A;  4F5R A;  4WC6 A;  4FHV A;  2M2U A;  2Q66 A;  4KLS A;  3L9D A;  4X4T A;  4YD1 A;  5J0Q A;  4RT2 A;  5HRI A;  4M04 A;  1ZQX A;  1Q79 A;  4WBZ A;  9ICW A;  1F5A A;  4KLH A;  2ZH2 A;  9ICA A;  8ICS A;  5IIL A;  4IQT A;  2BCQ A;  4WBY A;  2PXI A;  4UB2 A;  3JZ0 A;  4NLZ A;  9ICQ A;  5F2V O;  1PX5 A;  5EOZ A;  4KLF A;  5CHG A;  4GXI A;  4RQ1 A;  4NLK A;  3AQN A;  4QZE A;  2ZHA A;  4E7X A;  4QZ9 A;  1JAJ A;  4X4P A;  7ICT A;  5J2B A;  2ZH5 A;  3MGI A;  1ZQN A;  4PHE A;  1MQ3 A;  4M5D A;  4WC0 A;  3TFS A;  2ZH1 A;  4GXJ A;  5CB1 A;  5DBB A;  1ZQP A;  4KLM A;  1JN3 A;  4X4S A;  3AU6 A;  7ICE A;  5J2E A;  3RH5 A;  4KLD A;  2DR7 A;  3JPT A;  5J2J A;  3B0X A;  3ISC A;  4RWP A;  4PH5 A;  5D49 A;  1ZQR A;  9ICB A;  3MBY A;  1ZQQ A;  9ICE A;  3H39 A;  5HRB A;  8ICG A;  4UD4 A;  4I27 A;  3C66 A;  8ICP A;  4X4O A;  8ICH A;  4YCX A;  2M2T A;  4PHD A;  4I2D A;  4KLO A;  4XRH A;  1RPL A;  5J2H A;  4P4M A;  4RPZ A;  2ISP A;  5J0R A;  1ZQI A;  1R89 A;  3LQC B;  4JWM A;  1UEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...