2O5AA

Crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
108
Chain Sequence
b'SNQELLQLAVNAVDDKKAEQVVALNMKGISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEIKRLEGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVELEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1328 protein
publication title Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 29
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2o5aA01
4YD2A 5HREA 4NLNA 3V7KA 1ZQEA 4I2FA 5CR0A 4X4VA 2BPGA 4NM1A 5DDMA 1ZQSA 2ID1A 3RJFA 9ICIA 1ZQOA 4UBBA 8ICYA 4I27A 4RT2A 4PHAA 1ZQZA 3UQ2A 4KLQA 8ICKA 2PBEA 4RWPA 4QZAA 3C2LA 4GXIA 4E7XA 4KLHA 8ICCA 4AT8A 4P4MA 5HRHA 3WFPA 2DRBA 3V7JA 7ICJA 4QZBA 1Q79A 3JYYA 4IQWA 7ICNA 7ICMA 3AQMA 3H37A 3RJHA 4KLJA 3AU2A 4RQ0A 3MDCA 1ZQXA 4FH3A 4PH5A 4PGXA 4FH5A 4FHXA 5CP2A 4FHWA 4RQ5A 5DDYA 8ICVA 7ICQA 3MBYA 1ZQGA 4NXZA 1ZQDA 4AT9A 3H39A 5D46A 5J0WA 5J2HA 4GXKA 1R89A 4YD1A 3C5GA 4YMNA 4M9NA 2BPCA 1ZQUA 5IINA 4RQ2A 1MQ3A 5J2JA 7ICEA 4X4OA 4UBCA 3JPSA 7ICOA 8ICXA 8ICNA 7ICPA 4WC7A 1TV9A 4AT9B 5TZVA 3WFRE 1ZQNA 5CWRA 4F5OA 4I2BA 4RQ7A 3H38A 9ICNA 2DR9A 4M9LA 3HWTA 4KLIA 3MDAA 5DBCA 4XQ8A 1BPYA 2NRKA 1ZQBA 2IHMA 7ICIA 8ICQA 5DBAA 4IQUA 5DKWA 3PMNA 9ICXA 5CA7A 3OUYA 4KLSA 1MIYA 4F5RA 9ICQA 4RQ8A 3UXPA 5J2AA 4RQ1A 8ICBA 5HRFA 4TUPA 3OUYB 3NYBA 3ISDA 2FMQA 4I2IA 4WC4A 8ICPA 4PHEA 2PFPA 8ICIA 5D49A 4R63A 8ICHA 5F2VO 4PHPA 4Z6CA 2M2WA 4RQ3A 8ICZA 5DB7A 1ZJMA 4O5CA 4RT3A 4QZGA 4YMMA 4X5VA 4XUSA 4KLFA 5J2CA 1TVAA 2O5AA 5J2GA 4E80A 2ZHAA 4DOCA 5HRKA 4RWOA 1VFGA 2DR7A 4K4GA 7ICTA 1FA0A 3RH6A 4UD5A 4UB2A 4PGQA 8ICMA 4E8FA 4R65A 1HUOA 9ICAA 4UAZA 2DVIA 5HR9A 4AT7A 9ICLA 5DB8A 4MFFA 3AUOA 2BPFA 4JWMA 3JPPA 4QZ9A 7ICLA 5BOLA 4X4PA 4X4NA 4NKTA 4TUSA 1XSLA 2M2VA 8ICOA 5IIIA 4XRHA 3RJKA 1TFWA 4AT7B 2ZH7A 1UEVA 4F5PA 2BCQA 9ICPA 8ICEA 4M0AA 5IIKA 3HX0A 3JPRA 3PMLA 5IILA 7ICGA 9ICRA 4EP7A 4TUQA 1BPEA 4FO6A 3GDXA 2ZH2A 2O1PA 2PXIA 9ICOA 1PX5A 4Z6FA 4RWNA 1F5AA 4FHVA 4UB4A 8ICRA 4KLTA 3B0XA 4X4SA 3C66A 2W9MA 2BE3A 5IIJA 1TFYA 8ICFA 4X4QA 4MFCA 4NY8A 4WCWA 1V4AA 7ICSA 4QZCA 4F5NA 4RQ4A 7ICUA 2BCVA 4WC2A 4P2HA 4NM2A 1RPLA 4KLEA 1ZQAA 9ICSA 4Z6EA 2FMSA 4WBYA 4NLKA 5HC9A 2ZH3A 4IQVA 1Q78A 4I2EA 2DRAA 4DO9A 3C2KA 4YMOA 4LVSA 4I2HA 2I9GA 2M2UA 3C2MA 5J0YA 3TFRA 2ISOA 3LQCB 3OGUA 1ZQFA 2GWSA 3LK9A 2ZH8A 4RPYA 3RJGA 3HW8A 4PHDA 3HJ4A 3UXOA 1MIVA 1MIWA 4WBZA 7ICHA 4WC5A 3JPTA 1ZQYA 1ZQJA 4EBJA 5J0TA 4I28A 4X4UA 2BCUA 1KEJA 3WFQE 4X0AA 1ZQIA 5BPCA 5J2DA 3HJ1A 4PGYA 3OVBA 4Z6DA 4O9MA 4KLUA 1YLQA 4M04A 1KDHA 4QZDA 4TURA 3UXNA 4LZDA 4YCXA 4KLMA 1JN3A 4LZGA 2BCSA 1VJ7A 5HRDA 4LT6A 4I29A 5DB9A 3JPOA 8ICGA 4YN4A 3UQ0A 2ZHBA 4O5EA 1BPXA 1NOMA 4S3NA 4RPXA 3UPSA 9ICJA 4R66A 3L9DA 1UETA 2ZH4A 3B0YA 5IIMA 1BPZA 5DB6A 9ICCA 3K75D 1MQ2A 9ICEA 9ICGA 3C18A 1JMSA 2PFNA 1WOTA 4I2DA 2ISPA 5J29A 2DR5A 4NLZA 5HHIA 4NKUA 1ZQCA 1OU5A 2Q66A 1ZQHA 4K4IA 9ICHA 1JQRA 3WFOA 3AQKA 1JAJA 2FMPA 5J0XA 1ZQWA 1ZQMA 1ZQLA 9ICUA 4F5QA 4P4PA 4XA5A 4DOAA 2P66A 4DOBA 4UB5A 1R8CA 4KLDA 4RWQA 3JZ0A 4GXJA 5J0PA 4UB1A 3PNCA 1UEUA 2BCRA 5HRGA 1R8AA 1ZQQA 5J2FA 5CHGA 8ICUA 4QZ8A 3JPNA 4WC0A 4WC3A 4M47A 3C5FA 1HUZA 8ICLA 3RJJA 4K4HA 5EOZA 4JWNA 4I2JA 5DBBA 4M2YA 4QZEA 9ICKA 4P4OA 9ICFA 4I2CA 3V7LA 3AU6A 5DEDA 3TFSA 3MGIA 5IIOA 2VANA 2M2TA 2HHPA 1ZQPA 3RJEA 4M5DA 4AT8B 5BOMA 1ZQVA 2PFOA 4IG8A 4RPZA 4RQ6A 1ZJNA 3ISCA 3RJIA 4I2AA 7ICRA 5DECA 4FHYA 5J0OA 8ICWA 3RH4A 1BPBA 3HIYA 4FHPA 7ICFA 3RH5A 2ZH1A 5D4BA 4UB3A 2RFFA 9ICVA 5J0QA 4X4TA 4X4RA 5J2EA 5J2BA 5CJ7A 3V72A 3AQNA 4ATBA 4WC1A 5HRLA 4UAYA 1NO5A 1RZTA 7ICVA 2ZH5A 9ICMA 4KLLA 4KLOA 4M9JA 5HRBA 4R64A 1ZQKA 8ICTA 4ATBB 4PPXA 1ZQRA 1XSPA 1BPDA 4KLGA 4MF2A 4I2GA 9ICBA 4UAWA 5HHHA 3OV7A 3UPQA 7ICKA 3JPQA 9ICWA 5J2KA 5J2IA 4X0BA 4MF8A 4MFAA 3OVAA 5J0RA 4QZIA 9ICTA 1XSNA 3MGHA 8ICSA 3H3AA 5J0SA 2DR8A 5CB1A 4XQ7A 5J0UA 4WC6A 4M9HA 3WFSC 8ICAA 4EBKA 4UD4A 1R8BA 4O5KA 1KNYA 3ISBA 2ZH6A 5HRIA 3OVSA 1ZQTA 2ZH9A 8ICJA 2PFQA 3AQLA 4QZFA 4QZHA 4M9GA 4IQTA
chains in the Genus database with same CATH superfamily
2FCLA 4YD2A 5HREA 4NLNA 3V7KA 1ZQEA 4I2FA 5CR0A 4JLZA 4X4VA 2BPGA 4NM1A 5DDMA 1ZQSA 2ID1A 4O67A 3RJFA 9ICIA 1ZQOA 4UBBA 8ICYA 4I27A 4RT2A 4PHAA 1ZQZA 2BBJA 3UQ2A 4KLQA 8ICKA 2PBEA 4RWPA 4QZAA 3C2LA 4GXIA 4E7XA 4KLHA 8ICCA 4AT8A 5D61A 4P4MA 5HRHA 3WFPA 2DRBA 3EF2A 3V7JA 7ICJA 4QZBA 1Q79A 3JYYA 4IQWA 7ICNA 7ICMA 3AQMA 3H37A 3RJHA 4KLJA 3AU2A 5D62A 4RQ0A 3MDCA 1ZQXA 2B56A 4FH3A 4PH5A 4PGXA 4FH5A 4FHXA 5CP2A 4FHWA 3ERCC 4RQ5A 4WQKA 5DDYA 8ICVA 7ICQA 2GAFD 5CHEA 3MBYA 1ZQGA 4O69A 4LEYA 4NXZA 1ZQDA 4AT9A 3H39A 5D46A 5J0WA 5J2HA 4GXKA 1R89A 4YD1A 3C5GA 4YMNA 4M9NA 2BPCA 1ZQUA 5JTGA 5IINA 4RQ2A 1MQ3A 5J2JA 4K9BA 7ICEA 4X4OA 4UBCA 3JPSA 7ICOA 8ICXA 8ICNA 7ICPA 4WC7A 1TV9A 4AT9B 5TZVA 3WFRE 1ZQNA 5CWRA 4F5OA 4I2BA 3K7DA 4RQ7A 3H38A 9ICNA 2DR9A 4M9LA 4K8VA 3HWTA 4KLIA 4EEDA 3MDAA 5DBCA 4XQ8A 1BPYA 2NRKA 1ZQBA 4LEWA 2IHMA 7ICIA 8ICQA 4WOYA 1GPJA 5DBAA 4IQUA 5DKWA 3PMNA 9ICXA 5CA7A 3OUYA 4KLSA 1MIYA 4F5RA 9ICQA 4RQ8A 5B3QA 3UXPA 5J2AA 4RQ1A 8ICBA 5HRFA 4TUPA 3OUYB 3NYBA 3ER8C 3ISDA 2FMQA 4I2IA 4WC4A 8ICPA 4PHEA 2PFPA 8ICIA 5D49A 4R63A 8ICHA 5F2VO 4PHPA 4Z6CA 2M2WA 4RQ3A 8ICZA 5DB7A 3NKUA 1ZJMA 4OAHA 4O5CA 4O6AA 4RT3A 4QZGA 4YMMA 4X5VA 4XUSA 4KLFA 5J2CA 1TVAA 2O5AA 5J2GA 4E80A 2ZHAA 4DOCA 5HRKA 4RWOA 1VFGA 2DR7A 4K4GA 7ICTA 1FA0A 4HX0A 3RH6A 4UD5A 4UB2A 3OWGA 4PGQA 4JLXA 4E8FA 8ICMA 4R65A 1HUOA 9ICAA 4UAZA 2DVIA 5HR9A 4AT7A 9ICLA 3MCRA 5DB8A 4MFFA 3AUOA 2BPFA 4K99A 4JWMA 3JPPA 4QZ9A 7ICLA 5BOLA 4X4PA 4X4NA 4NKTA 4TUSA 1XSLA 2M2VA 8ICOA 5IIIA 4XRHA 3RJKA 1TFWA 4AT7B 2ZH7A 1UEVA 4F5PA 2BCQA 9ICPA 8ICEA 4M0AA 5IIKA 3JCFA 3HX0A 3JPRA 3PMLA 5IILA 7ICGA 9ICRA 2GA9D 4EP7A 4TUQA 1BPEA 4FO6A 4NXTA 3GDXA 2ZH2A 2O1PA 5CFTA 2PXIA 9ICOA 1PX5A 4Z6FA 4RWNA 1F5AA 4FHVA 4UB4A 8ICRA 4KLTA 3B0XA 4X4SA 3C66A 4K97A 2W9MA 2BE3A 5IIJA 1TFYA 8ICFA 4X4QA 4MFCA 4NY8A 4WCWA 1V4AA 4MKPA 4QZCA 3NWIA 4KB6A 4F5NA 7ICSA 4RQ4A 7ICUA 2BCVA 4WC2A 4P2HA 4NM2A 1RPLA 4K9AA 4KLEA 1ZQAA 9ICSA 4Z6EA 2FMSA 4WBYA 4NLKA 5HC9A 4OAIZ 2ZH3A 5D63A 1Q78A 4IQVA 4I2EA 2DRAA 4DO9A 3C2KA 4YMOA 4LVSA 4I2HA 2I9GA 2M2UA 3C2MA 5J0YA 3TFRA 2ISOA 3LQCB 3OGUA 1ZQFA 2GWSA 3LK9A 5CFSA 4RPYA 2ZH8A 3RJGA 2IUBA 4PHDA 3HJ4A 3HW8A 3UXOA 1MIVA 1MIWA 4WBZA 7ICHA 4FO1A 4WC5A 3JPTA 1ZQYA 1ZQJA 4EBJA 5J0TA 4I28A 4X4UA 2BCUA 1KEJA 3WFQE 4X0AA 1ZQIA 5BPCA 5J2DA 3HJ1A 4PGYA 3OVBA 4EV6A 4Z6DA 4O9MA 4KLUA 1YLQA 4M04A 1KDHA 4QZDA 4TURA 3UXNA 4LZDA 4YCXA 4KM5A 4KLMA 1JN3A 4LZGA 2BCSA 1VJ7A 4I0UA 5HRDA 4LT6A 4I29A 5DB9A 3JPOA 8ICGA 4YN4A 3UQ0A 2ZHBA 4O5EA 1BPXA 1NOMA 4S3NA 4RPXA 3UPSA 9ICJA 4R66A 2B4VA 3L9DA 1UETA 2ZH4A 3B0YA 4K96A 2IHOA 5IIMA 1BPZA 5DB6A 9ICCA 4EGWA 3K75D 1MQ2A 9ICEA 9ICGA 5B3PA 3C18A 1JMSA 2BBHA 2PFNA 1WOTA 4I2DA 2ISPA 5J29A 2DR5A 4NLZA 5HHIA 4NKUA 4K98A 1ZQCA 1OU5A 2Q66A 1ZQHA 4K4IA 9ICHA 1JQRA 3WFOA 3AQKA 1JAJA 2FMPA 5J0XA 1ZQWA 1ZQMA 1ZQLA 9ICUA 4F5QA 2B51A 4P4PA 2EWRA 4XA5A 4DOAA 2P66A 3NVOA 4DOBA 4EEBA 4UB5A 1R8CA 4KLDA 4RWQA 3JZ0A 4GXJA 4WQLA 5J0PA 4UB1A 3PNCA 1UEUA 2BCRA 5HRGA 1R8AA 1ZQQA 5J2FA 3CK6A 5CHGA 8ICUA 4QZ8A 3JPNA 4WC0A 4WC3A 4M47A 3C5FA 1HUZA 8ICLA 3RJJA 2HN2A 4K4HA 4WH5A 5EOZA 4JWNA 4I2JA 5DBBA 4M2YA 4QZEA 9ICKA 2HN1A 4P4OA 9ICFA 4I2CA 3V7LA 3AU6A 5DEDA 3TFSA 3MGIA 5IIOA 2VANA 2M2TA 2HHPA 1ZQPA 3RJEA 4M5DA 4AT8B 5BOMA 4LEZA 1ZQVA 2PFOA 4IG8A 4RPZA 4RQ6A 1ZJNA 3ISCA 3RJIA 4OAGA 4I2AA 7ICRA 5DECA 4FHYA 5J0OA 8ICWA 3RH4A 1BPBA 3HIYA 4FHPA 7ICFA 3RH5A 2ZH1A 5D4BA 4UB3A 2RFFA 9ICVA 5J0QA 4X4TA 4X4RA 5J2EA 5J2BA 5CJ7A 3V72A 3AQNA 4ATBA 4WC1A 5HRLA 4UAYA 1NO5A 1RZTA 7ICVA 5CFUA 2ZH5A 9ICMA 4KLLA 4KLOA 4M9JA 5HRBA 4R64A 1ZQKA 8ICTA 4ATBB 4PPXA 1ZQRA 1XSPA 1BPDA 4NXVA 4NXWA 4KLGA 4LEVA 4MF2A 4I2GA 9ICBA 4UAWA 5HHHA 3OV7A 3UPQA 7ICKA 3JPQA 9ICWA 5J2KA 5J2IA 4NXUA 4XJEA 4X0BA 4MF8A 4MFAA 3OVAA 5J0RA 4QZIA 9ICTA 1XSNA 4OAFA 3MGHA 8ICSA 3H3AA 3PHZA 5J0SA 2DR8A 5CB1A 4N7RA 4XQ7A 5J0UA 4WC6A 4M9HA 3WFSC 4O68A 8ICAA 4EBKA 4UD4A 1R8BA 4O5KA 1KNYA 3ISBA 2ZH6A 5HRIA 3OVSA 1ZQTA 2ZH9A 8ICJA 2PFQA 3AQLA 4QZFA 4QZHA 4M9GA 4NXXA 3ER9B 4IQTA
chains in the Genus database with same CATH topology
4YD2A 5HREA 4NLNA 3V7KA 1ZQEA 4I2FA 5CR0A 4X4VA 2BPGA 4NM1A 5DDMA 1ZQSA 2ID1A 3RJFA 9ICIA 1ZQOA 4UBBA 8ICYA 4I27A 4RT2A 4PHAA 1ZQZA 3UQ2A 4KLQA 8ICKA 2PBEA 4RWPA 4QZAA 3C2LA 4GXIA 4E7XA 4KLHA 8ICCA 4AT8A 4P4MA 5HRHA 3WFPA 2DRBA 3V7JA 7ICJA 4QZBA 1Q79A 3JYYA 4IQWA 7ICNA 7ICMA 3AQMA 3H37A 3RJHA 4KLJA 3AU2A 4RQ0A 3MDCA 1ZQXA 4FH3A 4PH5A 4PGXA 4FH5A 4FHXA 5CP2A 4FHWA 4RQ5A 5DDYA 8ICVA 7ICQA 3MBYA 1ZQGA 4NXZA 1ZQDA 4AT9A 3H39A 5D46A 5J0WA 5J2HA 4GXKA 1R89A 4YD1A 3C5GA 4YMNA 4M9NA 2BPCA 1ZQUA 5IINA 4RQ2A 1MQ3A 5J2JA 7ICEA 4X4OA 4UBCA 3JPSA 7ICOA 8ICXA 8ICNA 7ICPA 4WC7A 1TV9A 4AT9B 5TZVA 3WFRE 1ZQNA 5CWRA 4F5OA 4I2BA 4RQ7A 3H38A 9ICNA 2DR9A 4M9LA 3HWTA 4KLIA 3MDAA 5DBCA 4XQ8A 1BPYA 2NRKA 1ZQBA 2IHMA 7ICIA 8ICQA 5DBAA 4IQUA 5DKWA 3PMNA 9ICXA 5CA7A 3OUYA 4KLSA 1MIYA 4F5RA 9ICQA 4RQ8A 3UXPA 5J2AA 4RQ1A 8ICBA 5HRFA 4TUPA 3OUYB 3NYBA 3ISDA 2FMQA 4I2IA 4WC4A 8ICPA 4PHEA 2PFPA 8ICIA 5D49A 4R63A 8ICHA 5F2VO 4PHPA 4Z6CA 2M2WA 4RQ3A 8ICZA 5DB7A 1ZJMA 4O5CA 4RT3A 4QZGA 4YMMA 4X5VA 4XUSA 4KLFA 5J2CA 1TVAA 2O5AA 5J2GA 4E80A 2ZHAA 4DOCA 5HRKA 4RWOA 1VFGA 2DR7A 4K4GA 7ICTA 1FA0A 3RH6A 4UD5A 4UB2A 4PGQA 8ICMA 4E8FA 4R65A 1HUOA 9ICAA 4UAZA 2DVIA 5HR9A 4AT7A 9ICLA 5DB8A 4MFFA 3AUOA 2BPFA 4JWMA 3JPPA 4QZ9A 7ICLA 5BOLA 4X4PA 4X4NA 4NKTA 4TUSA 1XSLA 2M2VA 8ICOA 5IIIA 4XRHA 3RJKA 1TFWA 4AT7B 2ZH7A 1UEVA 4F5PA 2BCQA 9ICPA 8ICEA 4M0AA 5IIKA 3HX0A 3JPRA 3PMLA 5IILA 7ICGA 9ICRA 4EP7A 4TUQA 1BPEA 4FO6A 3GDXA 2ZH2A 2O1PA 2PXIA 9ICOA 1PX5A 4Z6FA 4RWNA 1F5AA 4FHVA 4UB4A 8ICRA 4KLTA 3B0XA 4X4SA 3C66A 2W9MA 2BE3A 5IIJA 1TFYA 8ICFA 4X4QA 4MFCA 4NY8A 4WCWA 1V4AA 7ICSA 4QZCA 4F5NA 4RQ4A 7ICUA 2BCVA 4WC2A 4P2HA 4NM2A 1RPLA 4KLEA 1ZQAA 9ICSA 4Z6EA 2FMSA 4WBYA 4NLKA 5HC9A 2ZH3A 4IQVA 1Q78A 4I2EA 2DRAA 4DO9A 3C2KA 4YMOA 4LVSA 4I2HA 2I9GA 2M2UA 3C2MA 5J0YA 3TFRA 2ISOA 3LQCB 3OGUA 1ZQFA 2GWSA 3LK9A 2ZH8A 4RPYA 3RJGA 3HW8A 4PHDA 3HJ4A 3UXOA 1MIVA 1MIWA 4WBZA 7ICHA 4WC5A 3JPTA 1ZQYA 1ZQJA 4EBJA 5J0TA 4I28A 4X4UA 2BCUA 1KEJA 3WFQE 4X0AA 1ZQIA 5BPCA 5J2DA 3HJ1A 4PGYA 3OVBA 4Z6DA 4O9MA 4KLUA 1YLQA 4M04A 1KDHA 4QZDA 4TURA 3UXNA 4LZDA 4YCXA 4KLMA 1JN3A 4LZGA 2BCSA 1VJ7A 5HRDA 4LT6A 4I29A 5DB9A 3JPOA 8ICGA 4YN4A 3UQ0A 2ZHBA 4O5EA 1BPXA 1NOMA 4S3NA 4RPXA 3UPSA 9ICJA 4R66A 3L9DA 1UETA 2ZH4A 3B0YA 5IIMA 1BPZA 5DB6A 9ICCA 3K75D 1MQ2A 9ICEA 9ICGA 3C18A 1JMSA 2PFNA 1WOTA 4I2DA 2ISPA 5J29A 2DR5A 4NLZA 5HHIA 4NKUA 1ZQCA 1OU5A 2Q66A 1ZQHA 4K4IA 9ICHA 1JQRA 3WFOA 3AQKA 1JAJA 2FMPA 5J0XA 1ZQWA 1ZQMA 1ZQLA 9ICUA 4F5QA 4P4PA 4XA5A 4DOAA 2P66A 4DOBA 4UB5A 1R8CA 4KLDA 4RWQA 3JZ0A 4GXJA 5J0PA 4UB1A 3PNCA 1UEUA 2BCRA 5HRGA 1R8AA 1ZQQA 5J2FA 5CHGA 8ICUA 4QZ8A 3JPNA 4WC0A 4WC3A 4M47A 3C5FA 1HUZA 8ICLA 3RJJA 4K4HA 5EOZA 4JWNA 4I2JA 5DBBA 4M2YA 4QZEA 9ICKA 4P4OA 9ICFA 4I2CA 3V7LA 3AU6A 5DEDA 3TFSA 3MGIA 5IIOA 2VANA 2M2TA 2HHPA 1ZQPA 3RJEA 4M5DA 4AT8B 5BOMA 1ZQVA 2PFOA 4IG8A 4RPZA 4RQ6A 1ZJNA 3ISCA 3RJIA 4I2AA 7ICRA 5DECA 4FHYA 5J0OA 8ICWA 3RH4A 1BPBA 3HIYA 4FHPA 7ICFA 3RH5A 2ZH1A 5D4BA 4UB3A 2RFFA 9ICVA 5J0QA 4X4TA 4X4RA 5J2EA 5J2BA 5CJ7A 3V72A 3AQNA 4ATBA 4WC1A 5HRLA 4UAYA 1NO5A 1RZTA 7ICVA 2ZH5A 9ICMA 4KLLA 4KLOA 4M9JA 5HRBA 4R64A 1ZQKA 8ICTA 4ATBB 4PPXA 1ZQRA 1XSPA 1BPDA 4KLGA 4MF2A 4I2GA 9ICBA 4UAWA 5HHHA 3OV7A 3UPQA 7ICKA 3JPQA 9ICWA 5J2KA 5J2IA 4X0BA 4MF8A 4MFAA 3OVAA 5J0RA 4QZIA 9ICTA 1XSNA 3MGHA 8ICSA 3H3AA 5J0SA 2DR8A 5CB1A 4XQ7A 5J0UA 4WC6A 4M9HA 3WFSC 8ICAA 4EBKA 4UD4A 1R8BA 4O5KA 1KNYA 3ISBA 2ZH6A 5HRIA 3OVSA 1ZQTA 2ZH9A 8ICJA 2PFQA 3AQLA 4QZFA 4QZHA 4M9GA 4IQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YD2 A;  5HRE A;  4NLN A;  3V7K A;  1ZQE A;  4I2F A;  5CR0 A;  4X4V A;  2BPG A;  4NM1 A;  5DDM A;  1ZQS A;  2ID1 A;  3RJF A;  9ICI A;  1ZQO A;  4UBB A;  8ICY A;  4I27 A;  4RT2 A;  4PHA A;  1ZQZ A;  3UQ2 A;  4KLQ A;  8ICK A;  2PBE A;  4RWP A;  4QZA A;  3C2L A;  4GXI A;  4E7X A;  4KLH A;  8ICC A;  4AT8 A;  4P4M A;  5HRH A;  3WFP A;  2DRB A;  3V7J A;  7ICJ A;  4QZB A;  1Q79 A;  3JYY A;  4IQW A;  7ICN A;  7ICM A;  3AQM A;  3H37 A;  3RJH A;  4KLJ A;  3AU2 A;  4RQ0 A;  3MDC A;  1ZQX A;  4FH3 A;  4PH5 A;  4PGX A;  4FH5 A;  4FHX A;  5CP2 A;  4FHW A;  4RQ5 A;  5DDY A;  8ICV A;  7ICQ A;  3MBY A;  1ZQG A;  4NXZ A;  1ZQD A;  4AT9 A;  3H39 A;  5D46 A;  5J0W A;  5J2H A;  4GXK A;  1R89 A;  4YD1 A;  3C5G A;  4YMN A;  4M9N A;  2BPC A;  1ZQU A;  5IIN A;  4RQ2 A;  1MQ3 A;  5J2J A;  7ICE A;  4X4O A;  4UBC A;  3JPS A;  7ICO A;  8ICX A;  8ICN A;  7ICP A;  4WC7 A;  1TV9 A;  4AT9 B;  5TZV A;  3WFR E;  1ZQN A;  5CWR A;  4F5O A;  4I2B A;  4RQ7 A;  3H38 A;  9ICN A;  2DR9 A;  4M9L A;  3HWT A;  4KLI A;  3MDA A;  5DBC A;  4XQ8 A;  1BPY A;  2NRK A;  1ZQB A;  2IHM A;  7ICI A;  8ICQ A;  5DBA A;  4IQU A;  5DKW A;  3PMN A;  9ICX A;  5CA7 A;  3OUY A;  4KLS A;  1MIY A;  4F5R A;  9ICQ A;  4RQ8 A;  3UXP A;  5J2A A;  4RQ1 A;  8ICB A;  5HRF A;  4TUP A;  3OUY B;  3NYB A;  3ISD A;  2FMQ A;  4I2I A;  4WC4 A;  8ICP A;  4PHE A;  2PFP A;  8ICI A;  5D49 A;  4R63 A;  8ICH A;  5F2V O;  4PHP A;  4Z6C A;  2M2W A;  4RQ3 A;  8ICZ A;  5DB7 A;  1ZJM A;  4O5C A;  4RT3 A;  4QZG A;  4YMM A;  4X5V A;  4XUS A;  4KLF A;  5J2C A;  1TVA A;  2O5A A;  5J2G A;  4E80 A;  2ZHA A;  4DOC A;  5HRK A;  4RWO A;  1VFG A;  2DR7 A;  4K4G A;  7ICT A;  1FA0 A;  3RH6 A;  4UD5 A;  4UB2 A;  4PGQ A;  8ICM A;  4E8F A;  4R65 A;  1HUO A;  9ICA A;  4UAZ A;  2DVI A;  5HR9 A;  4AT7 A;  9ICL A;  5DB8 A;  4MFF A;  3AUO A;  2BPF A;  4JWM A;  3JPP A;  4QZ9 A;  7ICL A;  5BOL A;  4X4P A;  4X4N A;  4NKT A;  4TUS A;  1XSL A;  2M2V A;  8ICO A;  5III A;  4XRH A;  3RJK A;  1TFW A;  4AT7 B;  2ZH7 A;  1UEV A;  4F5P A;  2BCQ A;  9ICP A;  8ICE A;  4M0A A;  5IIK A;  3HX0 A;  3JPR A;  3PML A;  5IIL A;  7ICG A;  9ICR A;  4EP7 A;  4TUQ A;  1BPE A;  4FO6 A;  3GDX A;  2ZH2 A;  2O1P A;  2PXI A;  9ICO A;  1PX5 A;  4Z6F A;  4RWN A;  1F5A A;  4FHV A;  4UB4 A;  8ICR A;  4KLT A;  3B0X A;  4X4S A;  3C66 A;  2W9M A;  2BE3 A;  5IIJ A;  1TFY A;  8ICF A;  4X4Q A;  4MFC A;  4NY8 A;  4WCW A;  1V4A A;  7ICS A;  4QZC A;  4F5N A;  4RQ4 A;  7ICU A;  2BCV A;  4WC2 A;  4P2H A;  4NM2 A;  1RPL A;  4KLE A;  1ZQA A;  9ICS A;  4Z6E A;  2FMS A;  4WBY A;  4NLK A;  5HC9 A;  2ZH3 A;  4IQV A;  1Q78 A;  4I2E A;  2DRA A;  4DO9 A;  3C2K A;  4YMO A;  4LVS A;  4I2H A;  2I9G A;  2M2U A;  3C2M A;  5J0Y A;  3TFR A;  2ISO A;  3LQC B;  3OGU A;  1ZQF A;  2GWS A;  3LK9 A;  2ZH8 A;  4RPY A;  3RJG A;  3HW8 A;  4PHD A;  3HJ4 A;  3UXO A;  1MIV A;  1MIW A;  4WBZ A;  7ICH A;  4WC5 A;  3JPT A;  1ZQY A;  1ZQJ A;  4EBJ A;  5J0T A;  4I28 A;  4X4U A;  2BCU A;  1KEJ A;  3WFQ E;  4X0A A;  1ZQI A;  5BPC A;  5J2D A;  3HJ1 A;  4PGY A;  3OVB A;  4Z6D A;  4O9M A;  4KLU A;  1YLQ A;  4M04 A;  1KDH A;  4QZD A;  4TUR A;  3UXN A;  4LZD A;  4YCX A;  4KLM A;  1JN3 A;  4LZG A;  2BCS A;  1VJ7 A;  5HRD A;  4LT6 A;  4I29 A;  5DB9 A;  3JPO A;  8ICG A;  4YN4 A;  3UQ0 A;  2ZHB A;  4O5E A;  1BPX A;  1NOM A;  4S3N A;  4RPX A;  3UPS A;  9ICJ A;  4R66 A;  3L9D A;  1UET A;  2ZH4 A;  3B0Y A;  5IIM A;  1BPZ A;  5DB6 A;  9ICC A;  3K75 D;  1MQ2 A;  9ICE A;  9ICG A;  3C18 A;  1JMS A;  2PFN A;  1WOT A;  4I2D A;  2ISP A;  5J29 A;  2DR5 A;  4NLZ A;  5HHI A;  4NKU A;  1ZQC A;  1OU5 A;  2Q66 A;  1ZQH A;  4K4I A;  9ICH A;  1JQR A;  3WFO A;  3AQK A;  1JAJ A;  2FMP A;  5J0X A;  1ZQW A;  1ZQM A;  1ZQL A;  9ICU A;  4F5Q A;  4P4P A;  4XA5 A;  4DOA A;  2P66 A;  4DOB A;  4UB5 A;  1R8C A;  4KLD A;  4RWQ A;  3JZ0 A;  4GXJ A;  5J0P A;  4UB1 A;  3PNC A;  1UEU A;  2BCR A;  5HRG A;  1R8A A;  1ZQQ A;  5J2F A;  5CHG A;  8ICU A;  4QZ8 A;  3JPN A;  4WC0 A;  4WC3 A;  4M47 A;  3C5F A;  1HUZ A;  8ICL A;  3RJJ A;  4K4H A;  5EOZ A;  4JWN A;  4I2J A;  5DBB A;  4M2Y A;  4QZE A;  9ICK A;  4P4O A;  9ICF A;  4I2C A;  3V7L A;  3AU6 A;  5DED A;  3TFS A;  3MGI A;  5IIO A;  2VAN A;  2M2T A;  2HHP A;  1ZQP A;  3RJE A;  4M5D A;  4AT8 B;  5BOM A;  1ZQV A;  2PFO A;  4IG8 A;  4RPZ A;  4RQ6 A;  1ZJN A;  3ISC A;  3RJI A;  4I2A A;  7ICR A;  5DEC A;  4FHY A;  5J0O A;  8ICW A;  3RH4 A;  1BPB A;  3HIY A;  4FHP A;  7ICF A;  3RH5 A;  2ZH1 A;  5D4B A;  4UB3 A;  2RFF A;  9ICV A;  5J0Q A;  4X4T A;  4X4R A;  5J2E A;  5J2B A;  5CJ7 A;  3V72 A;  3AQN A;  4ATB A;  4WC1 A;  5HRL A;  4UAY A;  1NO5 A;  1RZT A;  7ICV A;  2ZH5 A;  9ICM A;  4KLL A;  4KLO A;  4M9J A;  5HRB A;  4R64 A;  1ZQK A;  8ICT A;  4ATB B;  4PPX A;  1ZQR A;  1XSP A;  1BPD A;  4KLG A;  4MF2 A;  4I2G A;  9ICB A;  4UAW A;  5HHH A;  3OV7 A;  3UPQ A;  7ICK A;  3JPQ A;  9ICW A;  5J2K A;  5J2I A;  4X0B A;  4MF8 A;  4MFA A;  3OVA A;  5J0R A;  4QZI A;  9ICT A;  1XSN A;  3MGH A;  8ICS A;  3H3A A;  5J0S A;  2DR8 A;  5CB1 A;  4XQ7 A;  5J0U A;  4WC6 A;  4M9H A;  3WFS C;  8ICA A;  4EBK A;  4UD4 A;  1R8B A;  4O5K A;  1KNY A;  3ISB A;  2ZH6 A;  5HRI A;  3OVS A;  1ZQT A;  2ZH9 A;  8ICJ A;  2PFQ A;  3AQL A;  4QZF A;  4QZH A;  4M9G A;  4IQT A; 
#chains in the Genus database with same CATH topology
 2FCL A;  4YD2 A;  5HRE A;  4NLN A;  3V7K A;  1ZQE A;  4I2F A;  5CR0 A;  4JLZ A;  4X4V A;  2BPG A;  4NM1 A;  5DDM A;  1ZQS A;  2ID1 A;  4O67 A;  3RJF A;  9ICI A;  1ZQO A;  4UBB A;  8ICY A;  4I27 A;  4RT2 A;  4PHA A;  1ZQZ A;  2BBJ A;  3UQ2 A;  4KLQ A;  8ICK A;  2PBE A;  4RWP A;  4QZA A;  3C2L A;  4GXI A;  4E7X A;  4KLH A;  8ICC A;  4AT8 A;  5D61 A;  4P4M A;  5HRH A;  3WFP A;  2DRB A;  3EF2 A;  3V7J A;  7ICJ A;  4QZB A;  1Q79 A;  3JYY A;  4IQW A;  7ICN A;  7ICM A;  3AQM A;  3H37 A;  3RJH A;  4KLJ A;  3AU2 A;  5D62 A;  4RQ0 A;  3MDC A;  1ZQX A;  2B56 A;  4FH3 A;  4PH5 A;  4PGX A;  4FH5 A;  4FHX A;  5CP2 A;  4FHW A;  3ERC C;  4RQ5 A;  4WQK A;  5DDY A;  8ICV A;  7ICQ A;  2GAF D;  5CHE A;  3MBY A;  1ZQG A;  4O69 A;  4LEY A;  4NXZ A;  1ZQD A;  4AT9 A;  3H39 A;  5D46 A;  5J0W A;  5J2H A;  4GXK A;  1R89 A;  4YD1 A;  3C5G A;  4YMN A;  4M9N A;  2BPC A;  1ZQU A;  5JTG A;  5IIN A;  4RQ2 A;  1MQ3 A;  5J2J A;  4K9B A;  7ICE A;  4X4O A;  4UBC A;  3JPS A;  7ICO A;  8ICX A;  8ICN A;  7ICP A;  4WC7 A;  1TV9 A;  4AT9 B;  5TZV A;  3WFR E;  1ZQN A;  5CWR A;  4F5O A;  4I2B A;  3K7D A;  4RQ7 A;  3H38 A;  9ICN A;  2DR9 A;  4M9L A;  4K8V A;  3HWT A;  4KLI A;  4EED A;  3MDA A;  5DBC A;  4XQ8 A;  1BPY A;  2NRK A;  1ZQB A;  4LEW A;  2IHM A;  7ICI A;  8ICQ A;  4WOY A;  1GPJ A;  5DBA A;  4IQU A;  5DKW A;  3PMN A;  9ICX A;  5CA7 A;  3OUY A;  4KLS A;  1MIY A;  4F5R A;  9ICQ A;  4RQ8 A;  5B3Q A;  3UXP A;  5J2A A;  4RQ1 A;  8ICB A;  5HRF A;  4TUP A;  3OUY B;  3NYB A;  3ER8 C;  3ISD A;  2FMQ A;  4I2I A;  4WC4 A;  8ICP A;  4PHE A;  2PFP A;  8ICI A;  5D49 A;  4R63 A;  8ICH A;  5F2V O;  4PHP A;  4Z6C A;  2M2W A;  4RQ3 A;  8ICZ A;  5DB7 A;  3NKU A;  1ZJM A;  4OAH A;  4O5C A;  4O6A A;  4RT3 A;  4QZG A;  4YMM A;  4X5V A;  4XUS A;  4KLF A;  5J2C A;  1TVA A;  2O5A A;  5J2G A;  4E80 A;  2ZHA A;  4DOC A;  5HRK A;  4RWO A;  1VFG A;  2DR7 A;  4K4G A;  7ICT A;  1FA0 A;  4HX0 A;  3RH6 A;  4UD5 A;  4UB2 A;  3OWG A;  4PGQ A;  4JLX A;  4E8F A;  8ICM A;  4R65 A;  1HUO A;  9ICA A;  4UAZ A;  2DVI A;  5HR9 A;  4AT7 A;  9ICL A;  3MCR A;  5DB8 A;  4MFF A;  3AUO A;  2BPF A;  4K99 A;  4JWM A;  3JPP A;  4QZ9 A;  7ICL A;  5BOL A;  4X4P A;  4X4N A;  4NKT A;  4TUS A;  1XSL A;  2M2V A;  8ICO A;  5III A;  4XRH A;  3RJK A;  1TFW A;  4AT7 B;  2ZH7 A;  1UEV A;  4F5P A;  2BCQ A;  9ICP A;  8ICE A;  4M0A A;  5IIK A;  3JCF A;  3HX0 A;  3JPR A;  3PML A;  5IIL A;  7ICG A;  9ICR A;  2GA9 D;  4EP7 A;  4TUQ A;  1BPE A;  4FO6 A;  4NXT A;  3GDX A;  2ZH2 A;  2O1P A;  5CFT A;  2PXI A;  9ICO A;  1PX5 A;  4Z6F A;  4RWN A;  1F5A A;  4FHV A;  4UB4 A;  8ICR A;  4KLT A;  3B0X A;  4X4S A;  3C66 A;  4K97 A;  2W9M A;  2BE3 A;  5IIJ A;  1TFY A;  8ICF A;  4X4Q A;  4MFC A;  4NY8 A;  4WCW A;  1V4A A;  4MKP A;  4QZC A;  3NWI A;  4KB6 A;  4F5N A;  7ICS A;  4RQ4 A;  7ICU A;  2BCV A;  4WC2 A;  4P2H A;  4NM2 A;  1RPL A;  4K9A A;  4KLE A;  1ZQA A;  9ICS A;  4Z6E A;  2FMS A;  4WBY A;  4NLK A;  5HC9 A;  4OAI Z;  2ZH3 A;  5D63 A;  1Q78 A;  4IQV A;  4I2E A;  2DRA A;  4DO9 A;  3C2K A;  4YMO A;  4LVS A;  4I2H A;  2I9G A;  2M2U A;  3C2M A;  5J0Y A;  3TFR A;  2ISO A;  3LQC B;  3OGU A;  1ZQF A;  2GWS A;  3LK9 A;  5CFS A;  4RPY A;  2ZH8 A;  3RJG A;  2IUB A;  4PHD A;  3HJ4 A;  3HW8 A;  3UXO A;  1MIV A;  1MIW A;  4WBZ A;  7ICH A;  4FO1 A;  4WC5 A;  3JPT A;  1ZQY A;  1ZQJ A;  4EBJ A;  5J0T A;  4I28 A;  4X4U A;  2BCU A;  1KEJ A;  3WFQ E;  4X0A A;  1ZQI A;  5BPC A;  5J2D A;  3HJ1 A;  4PGY A;  3OVB A;  4EV6 A;  4Z6D A;  4O9M A;  4KLU A;  1YLQ A;  4M04 A;  1KDH A;  4QZD A;  4TUR A;  3UXN A;  4LZD A;  4YCX A;  4KM5 A;  4KLM A;  1JN3 A;  4LZG A;  2BCS A;  1VJ7 A;  4I0U A;  5HRD A;  4LT6 A;  4I29 A;  5DB9 A;  3JPO A;  8ICG A;  4YN4 A;  3UQ0 A;  2ZHB A;  4O5E A;  1BPX A;  1NOM A;  4S3N A;  4RPX A;  3UPS A;  9ICJ A;  4R66 A;  2B4V A;  3L9D A;  1UET A;  2ZH4 A;  3B0Y A;  4K96 A;  2IHO A;  5IIM A;  1BPZ A;  5DB6 A;  9ICC A;  4EGW A;  3K75 D;  1MQ2 A;  9ICE A;  9ICG A;  5B3P A;  3C18 A;  1JMS A;  2BBH A;  2PFN A;  1WOT A;  4I2D A;  2ISP A;  5J29 A;  2DR5 A;  4NLZ A;  5HHI A;  4NKU A;  4K98 A;  1ZQC A;  1OU5 A;  2Q66 A;  1ZQH A;  4K4I A;  9ICH A;  1JQR A;  3WFO A;  3AQK A;  1JAJ A;  2FMP A;  5J0X A;  1ZQW A;  1ZQM A;  1ZQL A;  9ICU A;  4F5Q A;  2B51 A;  4P4P A;  2EWR A;  4XA5 A;  4DOA A;  2P66 A;  3NVO A;  4DOB A;  4EEB A;  4UB5 A;  1R8C A;  4KLD A;  4RWQ A;  3JZ0 A;  4GXJ A;  4WQL A;  5J0P A;  4UB1 A;  3PNC A;  1UEU A;  2BCR A;  5HRG A;  1R8A A;  1ZQQ A;  5J2F A;  3CK6 A;  5CHG A;  8ICU A;  4QZ8 A;  3JPN A;  4WC0 A;  4WC3 A;  4M47 A;  3C5F A;  1HUZ A;  8ICL A;  3RJJ A;  2HN2 A;  4K4H A;  4WH5 A;  5EOZ A;  4JWN A;  4I2J A;  5DBB A;  4M2Y A;  4QZE A;  9ICK A;  2HN1 A;  4P4O A;  9ICF A;  4I2C A;  3V7L A;  3AU6 A;  5DED A;  3TFS A;  3MGI A;  5IIO A;  2VAN A;  2M2T A;  2HHP A;  1ZQP A;  3RJE A;  4M5D A;  4AT8 B;  5BOM A;  4LEZ A;  1ZQV A;  2PFO A;  4IG8 A;  4RPZ A;  4RQ6 A;  1ZJN A;  3ISC A;  3RJI A;  4OAG A;  4I2A A;  7ICR A;  5DEC A;  4FHY A;  5J0O A;  8ICW A;  3RH4 A;  1BPB A;  3HIY A;  4FHP A;  7ICF A;  3RH5 A;  2ZH1 A;  5D4B A;  4UB3 A;  2RFF A;  9ICV A;  5J0Q A;  4X4T A;  4X4R A;  5J2E A;  5J2B A;  5CJ7 A;  3V72 A;  3AQN A;  4ATB A;  4WC1 A;  5HRL A;  4UAY A;  1NO5 A;  1RZT A;  7ICV A;  5CFU A;  2ZH5 A;  9ICM A;  4KLL A;  4KLO A;  4M9J A;  5HRB A;  4R64 A;  1ZQK A;  8ICT A;  4ATB B;  4PPX A;  1ZQR A;  1XSP A;  1BPD A;  4NXV A;  4NXW A;  4KLG A;  4LEV A;  4MF2 A;  4I2G A;  9ICB A;  4UAW A;  5HHH A;  3OV7 A;  3UPQ A;  7ICK A;  3JPQ A;  9ICW A;  5J2K A;  5J2I A;  4NXU A;  4XJE A;  4X0B A;  4MF8 A;  4MFA A;  3OVA A;  5J0R A;  4QZI A;  9ICT A;  1XSN A;  4OAF A;  3MGH A;  8ICS A;  3H3A A;  3PHZ A;  5J0S A;  2DR8 A;  5CB1 A;  4N7R A;  4XQ7 A;  5J0U A;  4WC6 A;  4M9H A;  3WFS C;  4O68 A;  8ICA A;  4EBK A;  4UD4 A;  1R8B A;  4O5K A;  1KNY A;  3ISB A;  2ZH6 A;  5HRI A;  3OVS A;  1ZQT A;  2ZH9 A;  8ICJ A;  2PFQ A;  3AQL A;  4QZF A;  4QZH A;  4M9G A;  4NXX A;  3ER9 B;  4IQT A; 
#chains in the Genus database with same CATH homology
 4YD2 A;  5HRE A;  4NLN A;  3V7K A;  1ZQE A;  4I2F A;  5CR0 A;  4X4V A;  2BPG A;  4NM1 A;  5DDM A;  1ZQS A;  2ID1 A;  3RJF A;  9ICI A;  1ZQO A;  4UBB A;  8ICY A;  4I27 A;  4RT2 A;  4PHA A;  1ZQZ A;  3UQ2 A;  4KLQ A;  8ICK A;  2PBE A;  4RWP A;  4QZA A;  3C2L A;  4GXI A;  4E7X A;  4KLH A;  8ICC A;  4AT8 A;  4P4M A;  5HRH A;  3WFP A;  2DRB A;  3V7J A;  7ICJ A;  4QZB A;  1Q79 A;  3JYY A;  4IQW A;  7ICN A;  7ICM A;  3AQM A;  3H37 A;  3RJH A;  4KLJ A;  3AU2 A;  4RQ0 A;  3MDC A;  1ZQX A;  4FH3 A;  4PH5 A;  4PGX A;  4FH5 A;  4FHX A;  5CP2 A;  4FHW A;  4RQ5 A;  5DDY A;  8ICV A;  7ICQ A;  3MBY A;  1ZQG A;  4NXZ A;  1ZQD A;  4AT9 A;  3H39 A;  5D46 A;  5J0W A;  5J2H A;  4GXK A;  1R89 A;  4YD1 A;  3C5G A;  4YMN A;  4M9N A;  2BPC A;  1ZQU A;  5IIN A;  4RQ2 A;  1MQ3 A;  5J2J A;  7ICE A;  4X4O A;  4UBC A;  3JPS A;  7ICO A;  8ICX A;  8ICN A;  7ICP A;  4WC7 A;  1TV9 A;  4AT9 B;  5TZV A;  3WFR E;  1ZQN A;  5CWR A;  4F5O A;  4I2B A;  4RQ7 A;  3H38 A;  9ICN A;  2DR9 A;  4M9L A;  3HWT A;  4KLI A;  3MDA A;  5DBC A;  4XQ8 A;  1BPY A;  2NRK A;  1ZQB A;  2IHM A;  7ICI A;  8ICQ A;  5DBA A;  4IQU A;  5DKW A;  3PMN A;  9ICX A;  5CA7 A;  3OUY A;  4KLS A;  1MIY A;  4F5R A;  9ICQ A;  4RQ8 A;  3UXP A;  5J2A A;  4RQ1 A;  8ICB A;  5HRF A;  4TUP A;  3OUY B;  3NYB A;  3ISD A;  2FMQ A;  4I2I A;  4WC4 A;  8ICP A;  4PHE A;  2PFP A;  8ICI A;  5D49 A;  4R63 A;  8ICH A;  5F2V O;  4PHP A;  4Z6C A;  2M2W A;  4RQ3 A;  8ICZ A;  5DB7 A;  1ZJM A;  4O5C A;  4RT3 A;  4QZG A;  4YMM A;  4X5V A;  4XUS A;  4KLF A;  5J2C A;  1TVA A;  2O5A A;  5J2G A;  4E80 A;  2ZHA A;  4DOC A;  5HRK A;  4RWO A;  1VFG A;  2DR7 A;  4K4G A;  7ICT A;  1FA0 A;  3RH6 A;  4UD5 A;  4UB2 A;  4PGQ A;  8ICM A;  4E8F A;  4R65 A;  1HUO A;  9ICA A;  4UAZ A;  2DVI A;  5HR9 A;  4AT7 A;  9ICL A;  5DB8 A;  4MFF A;  3AUO A;  2BPF A;  4JWM A;  3JPP A;  4QZ9 A;  7ICL A;  5BOL A;  4X4P A;  4X4N A;  4NKT A;  4TUS A;  1XSL A;  2M2V A;  8ICO A;  5III A;  4XRH A;  3RJK A;  1TFW A;  4AT7 B;  2ZH7 A;  1UEV A;  4F5P A;  2BCQ A;  9ICP A;  8ICE A;  4M0A A;  5IIK A;  3HX0 A;  3JPR A;  3PML A;  5IIL A;  7ICG A;  9ICR A;  4EP7 A;  4TUQ A;  1BPE A;  4FO6 A;  3GDX A;  2ZH2 A;  2O1P A;  2PXI A;  9ICO A;  1PX5 A;  4Z6F A;  4RWN A;  1F5A A;  4FHV A;  4UB4 A;  8ICR A;  4KLT A;  3B0X A;  4X4S A;  3C66 A;  2W9M A;  2BE3 A;  5IIJ A;  1TFY A;  8ICF A;  4X4Q A;  4MFC A;  4NY8 A;  4WCW A;  1V4A A;  7ICS A;  4QZC A;  4F5N A;  4RQ4 A;  7ICU A;  2BCV A;  4WC2 A;  4P2H A;  4NM2 A;  1RPL A;  4KLE A;  1ZQA A;  9ICS A;  4Z6E A;  2FMS A;  4WBY A;  4NLK A;  5HC9 A;  2ZH3 A;  4IQV A;  1Q78 A;  4I2E A;  2DRA A;  4DO9 A;  3C2K A;  4YMO A;  4LVS A;  4I2H A;  2I9G A;  2M2U A;  3C2M A;  5J0Y A;  3TFR A;  2ISO A;  3LQC B;  3OGU A;  1ZQF A;  2GWS A;  3LK9 A;  2ZH8 A;  4RPY A;  3RJG A;  3HW8 A;  4PHD A;  3HJ4 A;  3UXO A;  1MIV A;  1MIW A;  4WBZ A;  7ICH A;  4WC5 A;  3JPT A;  1ZQY A;  1ZQJ A;  4EBJ A;  5J0T A;  4I28 A;  4X4U A;  2BCU A;  1KEJ A;  3WFQ E;  4X0A A;  1ZQI A;  5BPC A;  5J2D A;  3HJ1 A;  4PGY A;  3OVB A;  4Z6D A;  4O9M A;  4KLU A;  1YLQ A;  4M04 A;  1KDH A;  4QZD A;  4TUR A;  3UXN A;  4LZD A;  4YCX A;  4KLM A;  1JN3 A;  4LZG A;  2BCS A;  1VJ7 A;  5HRD A;  4LT6 A;  4I29 A;  5DB9 A;  3JPO A;  8ICG A;  4YN4 A;  3UQ0 A;  2ZHB A;  4O5E A;  1BPX A;  1NOM A;  4S3N A;  4RPX A;  3UPS A;  9ICJ A;  4R66 A;  3L9D A;  1UET A;  2ZH4 A;  3B0Y A;  5IIM A;  1BPZ A;  5DB6 A;  9ICC A;  3K75 D;  1MQ2 A;  9ICE A;  9ICG A;  3C18 A;  1JMS A;  2PFN A;  1WOT A;  4I2D A;  2ISP A;  5J29 A;  2DR5 A;  4NLZ A;  5HHI A;  4NKU A;  1ZQC A;  1OU5 A;  2Q66 A;  1ZQH A;  4K4I A;  9ICH A;  1JQR A;  3WFO A;  3AQK A;  1JAJ A;  2FMP A;  5J0X A;  1ZQW A;  1ZQM A;  1ZQL A;  9ICU A;  4F5Q A;  4P4P A;  4XA5 A;  4DOA A;  2P66 A;  4DOB A;  4UB5 A;  1R8C A;  4KLD A;  4RWQ A;  3JZ0 A;  4GXJ A;  5J0P A;  4UB1 A;  3PNC A;  1UEU A;  2BCR A;  5HRG A;  1R8A A;  1ZQQ A;  5J2F A;  5CHG A;  8ICU A;  4QZ8 A;  3JPN A;  4WC0 A;  4WC3 A;  4M47 A;  3C5F A;  1HUZ A;  8ICL A;  3RJJ A;  4K4H A;  5EOZ A;  4JWN A;  4I2J A;  5DBB A;  4M2Y A;  4QZE A;  9ICK A;  4P4O A;  9ICF A;  4I2C A;  3V7L A;  3AU6 A;  5DED A;  3TFS A;  3MGI A;  5IIO A;  2VAN A;  2M2T A;  2HHP A;  1ZQP A;  3RJE A;  4M5D A;  4AT8 B;  5BOM A;  1ZQV A;  2PFO A;  4IG8 A;  4RPZ A;  4RQ6 A;  1ZJN A;  3ISC A;  3RJI A;  4I2A A;  7ICR A;  5DEC A;  4FHY A;  5J0O A;  8ICW A;  3RH4 A;  1BPB A;  3HIY A;  4FHP A;  7ICF A;  3RH5 A;  2ZH1 A;  5D4B A;  4UB3 A;  2RFF A;  9ICV A;  5J0Q A;  4X4T A;  4X4R A;  5J2E A;  5J2B A;  5CJ7 A;  3V72 A;  3AQN A;  4ATB A;  4WC1 A;  5HRL A;  4UAY A;  1NO5 A;  1RZT A;  7ICV A;  2ZH5 A;  9ICM A;  4KLL A;  4KLO A;  4M9J A;  5HRB A;  4R64 A;  1ZQK A;  8ICT A;  4ATB B;  4PPX A;  1ZQR A;  1XSP A;  1BPD A;  4KLG A;  4MF2 A;  4I2G A;  9ICB A;  4UAW A;  5HHH A;  3OV7 A;  3UPQ A;  7ICK A;  3JPQ A;  9ICW A;  5J2K A;  5J2I A;  4X0B A;  4MF8 A;  4MFA A;  3OVA A;  5J0R A;  4QZI A;  9ICT A;  1XSN A;  3MGH A;  8ICS A;  3H3A A;  5J0S A;  2DR8 A;  5CB1 A;  4XQ7 A;  5J0U A;  4WC6 A;  4M9H A;  3WFS C;  8ICA A;  4EBK A;  4UD4 A;  1R8B A;  4O5K A;  1KNY A;  3ISB A;  2ZH6 A;  5HRI A;  3OVS A;  1ZQT A;  2ZH9 A;  8ICJ A;  2PFQ A;  3AQL A;  4QZF A;  4QZH A;  4M9G A;  4IQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...