2O5AA

Crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
108
Chain Sequence
SNQELLQLAVNAVDDKKAEQVVALNMKGISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEIKRLEGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVELEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords BH1328 protein
publication title Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21
rcsb
source organism Bacillus halodurans
total genus 29
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2o5aA01
5DBBA 3RJEA 4WC7A 1XSPA 4IQWA 4M9LA 5IIOA 8ICUA 7ICRA 4X4NA 3UXNA 2ZHAA 3WFOA 3AQKA 1KEJA 3UQ2A 4WC6A 4UB3A 2BCSA 4M9GA 3RJJA 4X4TA 4TUQA 2GWSA 2BCVA 8ICJA 5IIKA 3JPOA 5HRGA 2ZH3A 3OVAA 1ZQFA 1Q78A 9ICJA 5J0YA 5J29A 4LZDA 4KLGA 4XA5A 3MGHA 2PFPA 7ICOA 4Z6EA 4P4PA 4R64A 9ICKA 5D49A 4F5OA 4RQ1A 2PBEA 4XRHA 4I2BA 4R63A 4P4OA 9ICWA 4X0BA 2ZH9A 3RH5A 4AT9B 5J0XA 4PGYA 3RJKA 5TZVA 1HUZA 3AQMA 5J0SA 1V4AA 4RPXA 4UAZA 2ZH7A 4P2HA 1NOMA 4IQUA 4FH3A 4F5NA 2DRBA 3AU2A 7ICUA 1XSLA 4EBKA 4X4VA 2ZH2A 3L9DA 4IG8A 7ICEA 4YN4A 5IINA 5IIMA 5DKWA 4WC4A 4KLJA 4LT6A 4O9MA 8ICPA 4TUPA 3C5GA 9ICIA 5DDYA 4RT2A 5J2CA 4X5VA 4K4GA 1ZQHA 4I2GA 8ICFA 1KNYA 4GXIA 4KLMA 2M2VA 4RQ6A 4PHEA 2W9MA 2PFOA 4XQ8A 2ZH6A 4X0AA 3AQLA 9ICHA 4DO9A 8ICCA 2PFQA 3LQCB 4JWMA 9ICTA 3OGUA 2DR9A 8ICKA 5CP2A 2DR7A 4KLFA 5CWRA 1BPYA 3UPQA 2M2UA 2FMPA 4O5CA 4PHPA 2P66A 5J0OA 3C66A 9ICOA 4YMMA 4LVSA 2O1PA 4FHWA 2ISOA 4QZ9A 4Z6DA 3JYYA 3HWTA 4EBJA 8ICYA 4JWNA 2ZHBA 4DOAA 4E8FA 3WFRE 1Q79A 4GXJA 4YMOA 4KLSA 4NM1A 9ICMA 3C2LA 4QZ8A 1R8BA 5HRFA 4M9JA 3PMNA 4F5PA 2ZH5A 4E80A 2ZH4A 1ZQDA 1ZQUA 5EOZA 8ICAA 2ID1A 4WC1A 4TURA 4DOCA 5BOMA 3LK9A 4NLNA 4UB2A 4FO6A 5J2DA 1ZQBA 4KLDA 3C5FA 4P4MA 4I2JA 5CHGA 3JPPA 9ICSA 1MQ2A 1KDHA 4PPXA 2HHPA 5HRBA 7ICTA 4X4OA 1ZQVA 4X4PA 4I2DA 1UEUA 3UPSA 9ICPA 4K4IA 1TFYA 4PHAA 1OU5A 5J2BA 4IQTA 4M47A 1BPEA 4GXKA 7ICHA 4KLLA 4KLHA 4PGQA 2BPCA 4AT7A 9ICQA 2FMSA 1YLQA 4I2IA 4MFFA 2PXIA 1HUOA 8ICSA 1ZQLA 2FMQA 4QZDA 4RWNA 4UB5A 3MDAA 3RJGA 1RPLA 5J2JA 2BPFA 4EP7A 3C2KA 5CA7A 5HHIA 4RT3A 3RJIA 4YD1A 1ZQJA 1TFWA 7ICNA 4UD5A 5F2VO 8ICMA 9ICCA 4QZHA 7ICKA 1ZQRA 8ICGA 1ZQMA 8ICBA 4QZIA 2IHMA 1JQRA 4QZAA 1JN3A 1ZQGA 1BPDA 3NYBA 4M04A 9ICAA 4UB1A 4RWQA 2ISPA 4UBBA 1MIVA 4QZEA 5J0WA 4FHXA 4MF8A 4F5RA 4QZBA 3JPSA 4M5DA 5J0TA 3OUYB 3RJHA 1WOTA 7ICSA 1VJ7A 2ZH1A 4NKTA 1PX5A 3C18A 1F5AA 4RQ8A 1ZQOA 8ICVA 4LZGA 5HC9A 3WFQE 4KLQA 3ISCA 4WBZA 4YCXA 7ICGA 5HHHA 4RQ3A 9ICBA 3JPTA 3TFRA 4UAYA 4RQ4A 4I29A 3V7JA 9ICNA 4AT8B 4UD4A 4PGXA 3V7LA 3HW8A 4AT9A 3UXPA 3RH4A 4NM2A 3HX0A 5D4BA 4I2AA 5J2HA 3ISBA 4NKUA 5DB7A 2DRAA 5BOLA 4WC3A 4Z6FA 4RPZA 4I2CA 4ATBA 3H37A 2I9GA 1ZQEA 4RQ0A 1ZQAA 4WBYA 8ICWA 4FH5A 4RWPA 4RPYA 3V72A 4R65A 2DVIA 8ICHA 1BPXA 1R8CA 5DB8A 1ZQZA 3RJFA 1MIWA 8ICOA 1MQ3A 5J2AA 3WFPA 3JPRA 4I28A 3JZ0A 2BCRA 7ICFA 1FA0A 7ICLA 3TFSA 5IIJA 1TV9A 5J2FA 4O5EA 5J0UA 4S3NA 5BPCA 4M2YA 9ICEA 3UQ0A 8ICNA 2BCQA 4M0AA 2ZH8A 5J0RA 1ZQWA 1ZQXA 4I2FA 4QZFA 3AUOA 5DECA 3OV7A 4KLUA 3B0YA 2BE3A 4DOBA 1XSNA 9ICVA 7ICVA 5J0PA 1ZQQA 4FHVA 5J2EA 8ICIA 3HIYA 3MDCA 4MF2A 4KLOA 3C2MA 5CJ7A 2RFFA 4M9HA 1VFGA 4Z6CA 3UXOA 4X4UA 3H38A 3K75D 3ISDA 5J2KA 5DB9A 3WFSC 1ZQTA 1UEVA 5CB1A 3OVSA 3JPNA 9ICFA 2DR8A 4RQ5A 4PH5A 4NLZA 5HRIA 4F5QA 9ICLA 1ZQIA 3MBYA 4IQVA 4X4QA 1MIYA 1R89A 5HRLA 1ZJNA 4QZGA 1ZQSA 1TVAA 4XUSA 1JMSA 4R66A 4KLEA 4M9NA 4FHYA 2VANA 4UBCA 5IIIA 5CR0A 4RQ2A 4UAWA 3JPQA 9ICXA 3H3AA 4XQ7A 4WC2A 1ZQKA 4K4HA 3OVBA 4I2HA 8ICZA 2O5AA 9ICRA 1ZQNA 4E7XA 7ICQA 5D46A 4FHPA 1NO5A 7ICJA 4I27A 4ATBB 1R8AA 2Q66A 5HRDA 4NXZA 9ICGA 7ICPA 5DBAA 3H39A 5DBCA 4X4RA 8ICLA 5HRHA 8ICRA 5HRKA 2NRKA 5HR9A 4RWOA 4X4SA 4RQ7A 4O5KA 5DB6A 7ICMA 1ZQCA 9ICUA 4KLIA 8ICQA 2PFNA 4TUSA 5HREA 3V7KA 8ICXA 4YD2A 4MFAA 4I2EA 3MGIA 3PMLA 8ICTA 4YMNA 2BCUA 5DEDA 2BPGA 4NLKA 2DR5A 4PHDA 4NY8A 1ZQYA 3OUYA 5IILA 3AQNA 1BPBA 5J2IA 5J2GA 4MFCA 4QZCA 3B0XA 3PNCA 5J0QA 2M2TA 2M2WA 3HJ1A 4WC5A 7ICIA 3GDXA 1UETA 3RH6A 4AT8A 4AT7B 1ZJMA 1RZTA 3HJ4A 4KLTA 4UB4A 1ZQPA 4WC0A 1JAJA 5DDMA 8ICEA 1BPZA 4WCWA 3AU6A
chains in the Genus database with same CATH superfamily
5DBBA 5CFUA 3RJEA 4WC7A 1XSPA 4IQWA 4M9LA 5IIOA 8ICUA 7ICRA 4X4NA 3UXNA 2ZHAA 3WFOA 3AQKA 5CHEA 1KEJA 3UQ2A 4O67A 4WC6A 4UB3A 2BCSA 4M9GA 3RJJA 4X4TA 4TUQA 2GWSA 2BCVA 8ICJA 5IIKA 3JPOA 5HRGA 3K7DA 4XJEA 2ZH3A 3OVAA 4EV6A 4WQKA 1ZQFA 1Q78A 9ICJA 5J0YA 5J29A 4LZDA 4KLGA 4XA5A 5CFSA 3MGHA 2PFPA 7ICOA 4Z6EA 4FO1A 4P4PA 4R64A 9ICKA 5D49A 4F5OA 4RQ1A 2PBEA 2IHOA 4XRHA 4I2BA 4R63A 4P4OA 9ICWA 4X0BA 2ZH9A 3RH5A 4AT9B 5J0XA 4PGYA 4WQLA 3RJKA 5TZVA 1HUZA 3AQMA 5J0SA 1V4AA 4RPXA 5B3QA 4UAZA 2ZH7A 4P2HA 1NOMA 4IQUA 4FH3A 4F5NA 2DRBA 3AU2A 7ICUA 1XSLA 4EBKA 4MKPA 4X4VA 4WH5A 3L9DA 2ZH2A 4IG8A 7ICEA 4YN4A 5IINA 5IIMA 5DKWA 4WC4A 4KLJA 4LT6A 4O9MA 8ICPA 4TUPA 3C5GA 9ICIA 5DDYA 4RT2A 5J2CA 3ERCC 4K96A 4X5VA 4K4GA 1ZQHA 4I2GA 8ICFA 1KNYA 4GXIA 4KLMA 2M2VA 4RQ6A 4PHEA 2W9MA 2PFOA 4XQ8A 2ZH6A 4X0AA 3AQLA 9ICHA 4JLZA 4DO9A 8ICCA 2PFQA 3LQCB 4JWMA 9ICTA 3OGUA 2DR9A 8ICKA 3MCRA 5CP2A 2DR7A 4O68A 4KLFA 5CWRA 1BPYA 5D63A 3UPQA 2M2UA 2FMPA 4O5CA 4PHPA 2P66A 5J0OA 3C66A 9ICOA 4YMMA 4LVSA 2O1PA 4FHWA 2ISOA 4QZ9A 4Z6DA 4I0UA 3JYYA 4O6AA 3HWTA 4EBJA 8ICYA 4JWNA 2ZHBA 4DOAA 4E8FA 3WFRE 1Q79A 4LEVA 4GXJA 4YMOA 4KLSA 4NM1A 9ICMA 3C2LA 4QZ8A 1R8BA 4O69A 5HRFA 4EGWA 4M9JA 3PMNA 4F5PA 2ZH5A 4E80A 2ZH4A 1ZQDA 4K9BA 1ZQUA 5EOZA 8ICAA 2ID1A 4WC1A 4TURA 4DOCA 5BOMA 3LK9A 4NLNA 4UB2A 4FO6A 4OAIZ 5J2DA 1ZQBA 4KLDA 3C5FA 4P4MA 4I2JA 5CHGA 3JPPA 9ICSA 1MQ2A 1KDHA 4PPXA 2HHPA 5HRBA 7ICTA 4X4OA 1ZQVA 4X4PA 4I2DA 1UEUA 3UPSA 9ICPA 4K4IA 1TFYA 4PHAA 1OU5A 5J2BA 4IQTA 4M47A 1BPEA 4GXKA 7ICHA 4KLLA 4KLHA 4PGQA 2BPCA 4AT7A 9ICQA 4KM5A 2FMSA 3EF2A 1YLQA 4I2IA 4MFFA 2PXIA 1HUOA 8ICSA 1ZQLA 2FMQA 4QZDA 4K8VA 4RWNA 4UB5A 3MDAA 3RJGA 1RPLA 5J2JA 2BPFA 4EP7A 3C2KA 5CA7A 5HHIA 4RT3A 4K98A 3RJIA 4YD1A 2HN2A 1ZQJA 1TFWA 7ICNA 4UD5A 5F2VO 8ICMA 9ICCA 4QZHA 7ICKA 1ZQRA 8ICGA 1ZQMA 8ICBA 4QZIA 2IHMA 1JQRA 4QZAA 1JN3A 1ZQGA 1BPDA 3NYBA 3OWGA 4M04A 9ICAA 4UB1A 4RWQA 2ISPA 4UBBA 1MIVA 4QZEA 5J0WA 4FHXA 4MF8A 4F5RA 4QZBA 3JPSA 2EWRA 4M5DA 5J0TA 3OUYB 3RJHA 1WOTA 7ICSA 1VJ7A 2ZH1A 4NKTA 1PX5A 3C18A 1F5AA 4RQ8A 1ZQOA 8ICVA 4LZGA 5HC9A 3WFQE 4KLQA 3ISCA 4WBZA 4YCXA 7ICGA 1GPJA 5HHHA 4RQ3A 9ICBA 3JPTA 3TFRA 4NXUA 4UAYA 4RQ4A 4I29A 3V7JA 9ICNA 4AT8B 4UD4A 4LEYA 4PGXA 3V7LA 3HW8A 4AT9A 3UXPA 4N7RA 3RH4A 4NM2A 3HX0A 5D4BA 4I2AA 5J2HA 3ISBA 4NKUA 5DB7A 2DRAA 5BOLA 2FCLA 4K9AA 4WC3A 4Z6FA 4RPZA 4I2CA 4ATBA 3H37A 2I9GA 1ZQEA 4RQ0A 1ZQAA 4WBYA 8ICWA 4FH5A 4RWPA 4RPYA 3V72A 4R65A 2DVIA 3ER8C 8ICHA 1BPXA 1R8CA 4EEDA 5DB8A 1ZQZA 3JCFA 3RJFA 1MIWA 8ICOA 2GAFD 1MQ3A 3PHZA 3WFPA 5J2AA 3JPRA 5D61A 4LEZA 4I28A 3JZ0A 2BCRA 2IUBA 7ICFA 1FA0A 7ICLA 3TFSA 5IIJA 1TV9A 5J2FA 4O5EA 5J0UA 4S3NA 5BPCA 4M2YA 9ICEA 3UQ0A 8ICNA 2BCQA 4M0AA 2BBHA 2ZH8A 5J0RA 1ZQWA 1ZQXA 4I2FA 4QZFA 3AUOA 5DECA 3OV7A 4KLUA 3B0YA 2BE3A 4DOBA 1XSNA 9ICVA 7ICVA 4NXTA 5J0PA 1ZQQA 2GA9D 4FHVA 4OAFA 5J2EA 8ICIA 3HIYA 3MDCA 3NVOA 4MF2A 4KLOA 3C2MA 5CJ7A 2RFFA 2HN1A 4M9HA 1VFGA 4Z6CA 3UXOA 4X4UA 3H38A 3K75D 3ISDA 5J2KA 5DB9A 3WFSC 1ZQTA 1UEVA 4NXXA 3NWIA 5CB1A 3OVSA 3JPNA 9ICFA 2B51A 2DR8A 4RQ5A 4PH5A 4NLZA 4HX0A 5HRIA 4F5QA 9ICLA 1ZQIA 3MBYA 4IQVA 4X4QA 1MIYA 1R89A 5HRLA 1ZJNA 4WOYA 4QZGA 4LEWA 1ZQSA 1TVAA 4XUSA 1JMSA 4R66A 5JTGA 4KLEA 4M9NA 4FHYA 2VANA 4UBCA 5IIIA 5CR0A 4RQ2A 4UAWA 3JPQA 9ICXA 2BBJA 3H3AA 4XQ7A 4WC2A 1ZQKA 4K4HA 3OVBA 4I2HA 4EEBA 2O5AA 8ICZA 9ICRA 1ZQNA 4OAGA 4JLXA 4E7XA 7ICQA 4K97A 5B3PA 5D46A 4FHPA 1NO5A 7ICJA 4I27A 4ATBB 1R8AA 2B4VA 5HRDA 2Q66A 5D62A 4NXZA 9ICGA 3CK6A 7ICPA 5DBAA 3H39A 5DBCA 4X4RA 8ICLA 5HRHA 8ICRA 5HRKA 2NRKA 3ER9B 5HR9A 4RWOA 4X4SA 4RQ7A 4O5KA 5DB6A 4OAHA 7ICMA 1ZQCA 5CFTA 9ICUA 4KLIA 8ICQA 2PFNA 4TUSA 5HREA 3V7KA 8ICXA 4YD2A 4MFAA 4I2EA 4K99A 3MGIA 3PMLA 8ICTA 4YMNA 2BCUA 5DEDA 2BPGA 4NLKA 2DR5A 4PHDA 4NY8A 1ZQYA 3OUYA 5IILA 3AQNA 1BPBA 5J2IA 4NXWA 5J2GA 4MFCA 4QZCA 2B56A 3B0XA 3PNCA 5J0QA 2M2TA 2M2WA 3HJ1A 4WC5A 7ICIA 3GDXA 1UETA 4KB6A 3RH6A 4NXVA 4AT8A 4AT7B 1ZJMA 1RZTA 3HJ4A 4KLTA 4UB4A 1ZQPA 4WC0A 1JAJA 5DDMA 3NKUA 8ICEA 1BPZA 4WCWA 3AU6A
chains in the Genus database with same CATH topology
5DBBA 3RJEA 4WC7A 1XSPA 4IQWA 4M9LA 5IIOA 8ICUA 7ICRA 4X4NA 3UXNA 2ZHAA 3WFOA 3AQKA 1KEJA 3UQ2A 4WC6A 4UB3A 2BCSA 4M9GA 3RJJA 4X4TA 4TUQA 2GWSA 2BCVA 8ICJA 5IIKA 3JPOA 5HRGA 2ZH3A 3OVAA 1ZQFA 1Q78A 9ICJA 5J0YA 5J29A 4LZDA 4KLGA 4XA5A 3MGHA 2PFPA 7ICOA 4Z6EA 4P4PA 4R64A 9ICKA 5D49A 4F5OA 4RQ1A 2PBEA 4XRHA 4I2BA 4R63A 4P4OA 9ICWA 4X0BA 2ZH9A 3RH5A 4AT9B 5J0XA 4PGYA 3RJKA 5TZVA 1HUZA 3AQMA 5J0SA 1V4AA 4RPXA 4UAZA 2ZH7A 4P2HA 1NOMA 4IQUA 4FH3A 4F5NA 2DRBA 3AU2A 7ICUA 1XSLA 4EBKA 4X4VA 2ZH2A 3L9DA 4IG8A 7ICEA 4YN4A 5IINA 5IIMA 5DKWA 4WC4A 4KLJA 4LT6A 4O9MA 8ICPA 4TUPA 3C5GA 9ICIA 5DDYA 4RT2A 5J2CA 4X5VA 4K4GA 1ZQHA 4I2GA 8ICFA 1KNYA 4GXIA 4KLMA 2M2VA 4RQ6A 4PHEA 2W9MA 2PFOA 4XQ8A 2ZH6A 4X0AA 3AQLA 9ICHA 4DO9A 8ICCA 2PFQA 3LQCB 4JWMA 9ICTA 3OGUA 2DR9A 8ICKA 5CP2A 2DR7A 4KLFA 5CWRA 1BPYA 3UPQA 2M2UA 2FMPA 4O5CA 4PHPA 2P66A 5J0OA 3C66A 9ICOA 4YMMA 4LVSA 2O1PA 4FHWA 2ISOA 4QZ9A 4Z6DA 3JYYA 3HWTA 4EBJA 8ICYA 4JWNA 2ZHBA 4DOAA 4E8FA 3WFRE 1Q79A 4GXJA 4YMOA 4KLSA 4NM1A 9ICMA 3C2LA 4QZ8A 1R8BA 5HRFA 4M9JA 3PMNA 4F5PA 2ZH5A 4E80A 2ZH4A 1ZQDA 1ZQUA 5EOZA 8ICAA 2ID1A 4WC1A 4TURA 4DOCA 5BOMA 3LK9A 4NLNA 4UB2A 4FO6A 5J2DA 1ZQBA 4KLDA 3C5FA 4P4MA 4I2JA 5CHGA 3JPPA 9ICSA 1MQ2A 1KDHA 4PPXA 2HHPA 5HRBA 7ICTA 4X4OA 1ZQVA 4X4PA 4I2DA 1UEUA 3UPSA 9ICPA 4K4IA 1TFYA 4PHAA 1OU5A 5J2BA 4IQTA 4M47A 1BPEA 4GXKA 7ICHA 4KLLA 4KLHA 4PGQA 2BPCA 4AT7A 9ICQA 2FMSA 1YLQA 4I2IA 4MFFA 2PXIA 1HUOA 8ICSA 1ZQLA 2FMQA 4QZDA 4RWNA 4UB5A 3MDAA 3RJGA 1RPLA 5J2JA 2BPFA 4EP7A 3C2KA 5CA7A 5HHIA 4RT3A 3RJIA 4YD1A 1ZQJA 1TFWA 7ICNA 4UD5A 5F2VO 8ICMA 9ICCA 4QZHA 7ICKA 1ZQRA 8ICGA 1ZQMA 8ICBA 4QZIA 2IHMA 1JQRA 4QZAA 1JN3A 1ZQGA 1BPDA 3NYBA 4M04A 9ICAA 4UB1A 4RWQA 2ISPA 4UBBA 1MIVA 4QZEA 5J0WA 4FHXA 4MF8A 4F5RA 4QZBA 3JPSA 4M5DA 5J0TA 3OUYB 3RJHA 1WOTA 7ICSA 1VJ7A 2ZH1A 4NKTA 1PX5A 3C18A 1F5AA 4RQ8A 1ZQOA 8ICVA 4LZGA 5HC9A 3WFQE 4KLQA 3ISCA 4WBZA 4YCXA 7ICGA 5HHHA 4RQ3A 9ICBA 3JPTA 3TFRA 4UAYA 4RQ4A 4I29A 3V7JA 9ICNA 4AT8B 4UD4A 4PGXA 3V7LA 3HW8A 4AT9A 3UXPA 3RH4A 4NM2A 3HX0A 5D4BA 4I2AA 5J2HA 3ISBA 4NKUA 5DB7A 2DRAA 5BOLA 4WC3A 4Z6FA 4RPZA 4I2CA 4ATBA 3H37A 2I9GA 1ZQEA 4RQ0A 1ZQAA 4WBYA 8ICWA 4FH5A 4RWPA 4RPYA 3V72A 4R65A 2DVIA 8ICHA 1BPXA 1R8CA 5DB8A 1ZQZA 3RJFA 1MIWA 8ICOA 1MQ3A 5J2AA 3WFPA 3JPRA 4I28A 3JZ0A 2BCRA 7ICFA 1FA0A 7ICLA 3TFSA 5IIJA 1TV9A 5J2FA 4O5EA 5J0UA 4S3NA 5BPCA 4M2YA 9ICEA 3UQ0A 8ICNA 2BCQA 4M0AA 2ZH8A 5J0RA 1ZQWA 1ZQXA 4I2FA 4QZFA 3AUOA 5DECA 3OV7A 4KLUA 3B0YA 2BE3A 4DOBA 1XSNA 9ICVA 7ICVA 5J0PA 1ZQQA 4FHVA 5J2EA 8ICIA 3HIYA 3MDCA 4MF2A 4KLOA 3C2MA 5CJ7A 2RFFA 4M9HA 1VFGA 4Z6CA 3UXOA 4X4UA 3H38A 3K75D 3ISDA 5J2KA 5DB9A 3WFSC 1ZQTA 1UEVA 5CB1A 3OVSA 3JPNA 9ICFA 2DR8A 4RQ5A 4PH5A 4NLZA 5HRIA 4F5QA 9ICLA 1ZQIA 3MBYA 4IQVA 4X4QA 1MIYA 1R89A 5HRLA 1ZJNA 4QZGA 1ZQSA 1TVAA 4XUSA 1JMSA 4R66A 4KLEA 4M9NA 4FHYA 2VANA 4UBCA 5IIIA 5CR0A 4RQ2A 4UAWA 3JPQA 9ICXA 3H3AA 4XQ7A 4WC2A 1ZQKA 4K4HA 3OVBA 4I2HA 8ICZA 2O5AA 9ICRA 1ZQNA 4E7XA 7ICQA 5D46A 4FHPA 1NO5A 7ICJA 4I27A 4ATBB 1R8AA 2Q66A 5HRDA 4NXZA 9ICGA 7ICPA 5DBAA 3H39A 5DBCA 4X4RA 8ICLA 5HRHA 8ICRA 5HRKA 2NRKA 5HR9A 4RWOA 4X4SA 4RQ7A 4O5KA 5DB6A 7ICMA 1ZQCA 9ICUA 4KLIA 8ICQA 2PFNA 4TUSA 5HREA 3V7KA 8ICXA 4YD2A 4MFAA 4I2EA 3MGIA 3PMLA 8ICTA 4YMNA 2BCUA 5DEDA 2BPGA 4NLKA 2DR5A 4PHDA 4NY8A 1ZQYA 3OUYA 5IILA 3AQNA 1BPBA 5J2IA 5J2GA 4MFCA 4QZCA 3B0XA 3PNCA 5J0QA 2M2TA 2M2WA 3HJ1A 4WC5A 7ICIA 3GDXA 1UETA 3RH6A 4AT8A 4AT7B 1ZJMA 1RZTA 3HJ4A 4KLTA 4UB4A 1ZQPA 4WC0A 1JAJA 5DDMA 8ICEA 1BPZA 4WCWA 3AU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBB A;  3RJE A;  4WC7 A;  1XSP A;  4IQW A;  4M9L A;  5IIO A;  8ICU A;  7ICR A;  4X4N A;  3UXN A;  2ZHA A;  3WFO A;  3AQK A;  1KEJ A;  3UQ2 A;  4WC6 A;  4UB3 A;  2BCS A;  4M9G A;  3RJJ A;  4X4T A;  4TUQ A;  2GWS A;  2BCV A;  8ICJ A;  5IIK A;  3JPO A;  5HRG A;  2ZH3 A;  3OVA A;  1ZQF A;  1Q78 A;  9ICJ A;  5J0Y A;  5J29 A;  4LZD A;  4KLG A;  4XA5 A;  3MGH A;  2PFP A;  7ICO A;  4Z6E A;  4P4P A;  4R64 A;  9ICK A;  5D49 A;  4F5O A;  4RQ1 A;  2PBE A;  4XRH A;  4I2B A;  4R63 A;  4P4O A;  9ICW A;  4X0B A;  2ZH9 A;  3RH5 A;  4AT9 B;  5J0X A;  4PGY A;  3RJK A;  5TZV A;  1HUZ A;  3AQM A;  5J0S A;  1V4A A;  4RPX A;  4UAZ A;  2ZH7 A;  4P2H A;  1NOM A;  4IQU A;  4FH3 A;  4F5N A;  2DRB A;  3AU2 A;  7ICU A;  1XSL A;  4EBK A;  4X4V A;  2ZH2 A;  3L9D A;  4IG8 A;  7ICE A;  4YN4 A;  5IIN A;  5IIM A;  5DKW A;  4WC4 A;  4KLJ A;  4LT6 A;  4O9M A;  8ICP A;  4TUP A;  3C5G A;  9ICI A;  5DDY A;  4RT2 A;  5J2C A;  4X5V A;  4K4G A;  1ZQH A;  4I2G A;  8ICF A;  1KNY A;  4GXI A;  4KLM A;  2M2V A;  4RQ6 A;  4PHE A;  2W9M A;  2PFO A;  4XQ8 A;  2ZH6 A;  4X0A A;  3AQL A;  9ICH A;  4DO9 A;  8ICC A;  2PFQ A;  3LQC B;  4JWM A;  9ICT A;  3OGU A;  2DR9 A;  8ICK A;  5CP2 A;  2DR7 A;  4KLF A;  5CWR A;  1BPY A;  3UPQ A;  2M2U A;  2FMP A;  4O5C A;  4PHP A;  2P66 A;  5J0O A;  3C66 A;  9ICO A;  4YMM A;  4LVS A;  2O1P A;  4FHW A;  2ISO A;  4QZ9 A;  4Z6D A;  3JYY A;  3HWT A;  4EBJ A;  8ICY A;  4JWN A;  2ZHB A;  4DOA A;  4E8F A;  3WFR E;  1Q79 A;  4GXJ A;  4YMO A;  4KLS A;  4NM1 A;  9ICM A;  3C2L A;  4QZ8 A;  1R8B A;  5HRF A;  4M9J A;  3PMN A;  4F5P A;  2ZH5 A;  4E80 A;  2ZH4 A;  1ZQD A;  1ZQU A;  5EOZ A;  8ICA A;  2ID1 A;  4WC1 A;  4TUR A;  4DOC A;  5BOM A;  3LK9 A;  4NLN A;  4UB2 A;  4FO6 A;  5J2D A;  1ZQB A;  4KLD A;  3C5F A;  4P4M A;  4I2J A;  5CHG A;  3JPP A;  9ICS A;  1MQ2 A;  1KDH A;  4PPX A;  2HHP A;  5HRB A;  7ICT A;  4X4O A;  1ZQV A;  4X4P A;  4I2D A;  1UEU A;  3UPS A;  9ICP A;  4K4I A;  1TFY A;  4PHA A;  1OU5 A;  5J2B A;  4IQT A;  4M47 A;  1BPE A;  4GXK A;  7ICH A;  4KLL A;  4KLH A;  4PGQ A;  2BPC A;  4AT7 A;  9ICQ A;  2FMS A;  1YLQ A;  4I2I A;  4MFF A;  2PXI A;  1HUO A;  8ICS A;  1ZQL A;  2FMQ A;  4QZD A;  4RWN A;  4UB5 A;  3MDA A;  3RJG A;  1RPL A;  5J2J A;  2BPF A;  4EP7 A;  3C2K A;  5CA7 A;  5HHI A;  4RT3 A;  3RJI A;  4YD1 A;  1ZQJ A;  1TFW A;  7ICN A;  4UD5 A;  5F2V O;  8ICM A;  9ICC A;  4QZH A;  7ICK A;  1ZQR A;  8ICG A;  1ZQM A;  8ICB A;  4QZI A;  2IHM A;  1JQR A;  4QZA A;  1JN3 A;  1ZQG A;  1BPD A;  3NYB A;  4M04 A;  9ICA A;  4UB1 A;  4RWQ A;  2ISP A;  4UBB A;  1MIV A;  4QZE A;  5J0W A;  4FHX A;  4MF8 A;  4F5R A;  4QZB A;  3JPS A;  4M5D A;  5J0T A;  3OUY B;  3RJH A;  1WOT A;  7ICS A;  1VJ7 A;  2ZH1 A;  4NKT A;  1PX5 A;  3C18 A;  1F5A A;  4RQ8 A;  1ZQO A;  8ICV A;  4LZG A;  5HC9 A;  3WFQ E;  4KLQ A;  3ISC A;  4WBZ A;  4YCX A;  7ICG A;  5HHH A;  4RQ3 A;  9ICB A;  3JPT A;  3TFR A;  4UAY A;  4RQ4 A;  4I29 A;  3V7J A;  9ICN A;  4AT8 B;  4UD4 A;  4PGX A;  3V7L A;  3HW8 A;  4AT9 A;  3UXP A;  3RH4 A;  4NM2 A;  3HX0 A;  5D4B A;  4I2A A;  5J2H A;  3ISB A;  4NKU A;  5DB7 A;  2DRA A;  5BOL A;  4WC3 A;  4Z6F A;  4RPZ A;  4I2C A;  4ATB A;  3H37 A;  2I9G A;  1ZQE A;  4RQ0 A;  1ZQA A;  4WBY A;  8ICW A;  4FH5 A;  4RWP A;  4RPY A;  3V72 A;  4R65 A;  2DVI A;  8ICH A;  1BPX A;  1R8C A;  5DB8 A;  1ZQZ A;  3RJF A;  1MIW A;  8ICO A;  1MQ3 A;  5J2A A;  3WFP A;  3JPR A;  4I28 A;  3JZ0 A;  2BCR A;  7ICF A;  1FA0 A;  7ICL A;  3TFS A;  5IIJ A;  1TV9 A;  5J2F A;  4O5E A;  5J0U A;  4S3N A;  5BPC A;  4M2Y A;  9ICE A;  3UQ0 A;  8ICN A;  2BCQ A;  4M0A A;  2ZH8 A;  5J0R A;  1ZQW A;  1ZQX A;  4I2F A;  4QZF A;  3AUO A;  5DEC A;  3OV7 A;  4KLU A;  3B0Y A;  2BE3 A;  4DOB A;  1XSN A;  9ICV A;  7ICV A;  5J0P A;  1ZQQ A;  4FHV A;  5J2E A;  8ICI A;  3HIY A;  3MDC A;  4MF2 A;  4KLO A;  3C2M A;  5CJ7 A;  2RFF A;  4M9H A;  1VFG A;  4Z6C A;  3UXO A;  4X4U A;  3H38 A;  3K75 D;  3ISD A;  5J2K A;  5DB9 A;  3WFS C;  1ZQT A;  1UEV A;  5CB1 A;  3OVS A;  3JPN A;  9ICF A;  2DR8 A;  4RQ5 A;  4PH5 A;  4NLZ A;  5HRI A;  4F5Q A;  9ICL A;  1ZQI A;  3MBY A;  4IQV A;  4X4Q A;  1MIY A;  1R89 A;  5HRL A;  1ZJN A;  4QZG A;  1ZQS A;  1TVA A;  4XUS A;  1JMS A;  4R66 A;  4KLE A;  4M9N A;  4FHY A;  2VAN A;  4UBC A;  5III A;  5CR0 A;  4RQ2 A;  4UAW A;  3JPQ A;  9ICX A;  3H3A A;  4XQ7 A;  4WC2 A;  1ZQK A;  4K4H A;  3OVB A;  4I2H A;  8ICZ A;  2O5A A;  9ICR A;  1ZQN A;  4E7X A;  7ICQ A;  5D46 A;  4FHP A;  1NO5 A;  7ICJ A;  4I27 A;  4ATB B;  1R8A A;  2Q66 A;  5HRD A;  4NXZ A;  9ICG A;  7ICP A;  5DBA A;  3H39 A;  5DBC A;  4X4R A;  8ICL A;  5HRH A;  8ICR A;  5HRK A;  2NRK A;  5HR9 A;  4RWO A;  4X4S A;  4RQ7 A;  4O5K A;  5DB6 A;  7ICM A;  1ZQC A;  9ICU A;  4KLI A;  8ICQ A;  2PFN A;  4TUS A;  5HRE A;  3V7K A;  8ICX A;  4YD2 A;  4MFA A;  4I2E A;  3MGI A;  3PML A;  8ICT A;  4YMN A;  2BCU A;  5DED A;  2BPG A;  4NLK A;  2DR5 A;  4PHD A;  4NY8 A;  1ZQY A;  3OUY A;  5IIL A;  3AQN A;  1BPB A;  5J2I A;  5J2G A;  4MFC A;  4QZC A;  3B0X A;  3PNC A;  5J0Q A;  2M2T A;  2M2W A;  3HJ1 A;  4WC5 A;  7ICI A;  3GDX A;  1UET A;  3RH6 A;  4AT8 A;  4AT7 B;  1ZJM A;  1RZT A;  3HJ4 A;  4KLT A;  4UB4 A;  1ZQP A;  4WC0 A;  1JAJ A;  5DDM A;  8ICE A;  1BPZ A;  4WCW A;  3AU6 A; 
#chains in the Genus database with same CATH topology
 5DBB A;  5CFU A;  3RJE A;  4WC7 A;  1XSP A;  4IQW A;  4M9L A;  5IIO A;  8ICU A;  7ICR A;  4X4N A;  3UXN A;  2ZHA A;  3WFO A;  3AQK A;  5CHE A;  1KEJ A;  3UQ2 A;  4O67 A;  4WC6 A;  4UB3 A;  2BCS A;  4M9G A;  3RJJ A;  4X4T A;  4TUQ A;  2GWS A;  2BCV A;  8ICJ A;  5IIK A;  3JPO A;  5HRG A;  3K7D A;  4XJE A;  2ZH3 A;  3OVA A;  4EV6 A;  4WQK A;  1ZQF A;  1Q78 A;  9ICJ A;  5J0Y A;  5J29 A;  4LZD A;  4KLG A;  4XA5 A;  5CFS A;  3MGH A;  2PFP A;  7ICO A;  4Z6E A;  4FO1 A;  4P4P A;  4R64 A;  9ICK A;  5D49 A;  4F5O A;  4RQ1 A;  2PBE A;  2IHO A;  4XRH A;  4I2B A;  4R63 A;  4P4O A;  9ICW A;  4X0B A;  2ZH9 A;  3RH5 A;  4AT9 B;  5J0X A;  4PGY A;  4WQL A;  3RJK A;  5TZV A;  1HUZ A;  3AQM A;  5J0S A;  1V4A A;  4RPX A;  5B3Q A;  4UAZ A;  2ZH7 A;  4P2H A;  1NOM A;  4IQU A;  4FH3 A;  4F5N A;  2DRB A;  3AU2 A;  7ICU A;  1XSL A;  4EBK A;  4MKP A;  4X4V A;  4WH5 A;  3L9D A;  2ZH2 A;  4IG8 A;  7ICE A;  4YN4 A;  5IIN A;  5IIM A;  5DKW A;  4WC4 A;  4KLJ A;  4LT6 A;  4O9M A;  8ICP A;  4TUP A;  3C5G A;  9ICI A;  5DDY A;  4RT2 A;  5J2C A;  3ERC C;  4K96 A;  4X5V A;  4K4G A;  1ZQH A;  4I2G A;  8ICF A;  1KNY A;  4GXI A;  4KLM A;  2M2V A;  4RQ6 A;  4PHE A;  2W9M A;  2PFO A;  4XQ8 A;  2ZH6 A;  4X0A A;  3AQL A;  9ICH A;  4JLZ A;  4DO9 A;  8ICC A;  2PFQ A;  3LQC B;  4JWM A;  9ICT A;  3OGU A;  2DR9 A;  8ICK A;  3MCR A;  5CP2 A;  2DR7 A;  4O68 A;  4KLF A;  5CWR A;  1BPY A;  5D63 A;  3UPQ A;  2M2U A;  2FMP A;  4O5C A;  4PHP A;  2P66 A;  5J0O A;  3C66 A;  9ICO A;  4YMM A;  4LVS A;  2O1P A;  4FHW A;  2ISO A;  4QZ9 A;  4Z6D A;  4I0U A;  3JYY A;  4O6A A;  3HWT A;  4EBJ A;  8ICY A;  4JWN A;  2ZHB A;  4DOA A;  4E8F A;  3WFR E;  1Q79 A;  4LEV A;  4GXJ A;  4YMO A;  4KLS A;  4NM1 A;  9ICM A;  3C2L A;  4QZ8 A;  1R8B A;  4O69 A;  5HRF A;  4EGW A;  4M9J A;  3PMN A;  4F5P A;  2ZH5 A;  4E80 A;  2ZH4 A;  1ZQD A;  4K9B A;  1ZQU A;  5EOZ A;  8ICA A;  2ID1 A;  4WC1 A;  4TUR A;  4DOC A;  5BOM A;  3LK9 A;  4NLN A;  4UB2 A;  4FO6 A;  4OAI Z;  5J2D A;  1ZQB A;  4KLD A;  3C5F A;  4P4M A;  4I2J A;  5CHG A;  3JPP A;  9ICS A;  1MQ2 A;  1KDH A;  4PPX A;  2HHP A;  5HRB A;  7ICT A;  4X4O A;  1ZQV A;  4X4P A;  4I2D A;  1UEU A;  3UPS A;  9ICP A;  4K4I A;  1TFY A;  4PHA A;  1OU5 A;  5J2B A;  4IQT A;  4M47 A;  1BPE A;  4GXK A;  7ICH A;  4KLL A;  4KLH A;  4PGQ A;  2BPC A;  4AT7 A;  9ICQ A;  4KM5 A;  2FMS A;  3EF2 A;  1YLQ A;  4I2I A;  4MFF A;  2PXI A;  1HUO A;  8ICS A;  1ZQL A;  2FMQ A;  4QZD A;  4K8V A;  4RWN A;  4UB5 A;  3MDA A;  3RJG A;  1RPL A;  5J2J A;  2BPF A;  4EP7 A;  3C2K A;  5CA7 A;  5HHI A;  4RT3 A;  4K98 A;  3RJI A;  4YD1 A;  2HN2 A;  1ZQJ A;  1TFW A;  7ICN A;  4UD5 A;  5F2V O;  8ICM A;  9ICC A;  4QZH A;  7ICK A;  1ZQR A;  8ICG A;  1ZQM A;  8ICB A;  4QZI A;  2IHM A;  1JQR A;  4QZA A;  1JN3 A;  1ZQG A;  1BPD A;  3NYB A;  3OWG A;  4M04 A;  9ICA A;  4UB1 A;  4RWQ A;  2ISP A;  4UBB A;  1MIV A;  4QZE A;  5J0W A;  4FHX A;  4MF8 A;  4F5R A;  4QZB A;  3JPS A;  2EWR A;  4M5D A;  5J0T A;  3OUY B;  3RJH A;  1WOT A;  7ICS A;  1VJ7 A;  2ZH1 A;  4NKT A;  1PX5 A;  3C18 A;  1F5A A;  4RQ8 A;  1ZQO A;  8ICV A;  4LZG A;  5HC9 A;  3WFQ E;  4KLQ A;  3ISC A;  4WBZ A;  4YCX A;  7ICG A;  1GPJ A;  5HHH A;  4RQ3 A;  9ICB A;  3JPT A;  3TFR A;  4NXU A;  4UAY A;  4RQ4 A;  4I29 A;  3V7J A;  9ICN A;  4AT8 B;  4UD4 A;  4LEY A;  4PGX A;  3V7L A;  3HW8 A;  4AT9 A;  3UXP A;  4N7R A;  3RH4 A;  4NM2 A;  3HX0 A;  5D4B A;  4I2A A;  5J2H A;  3ISB A;  4NKU A;  5DB7 A;  2DRA A;  5BOL A;  2FCL A;  4K9A A;  4WC3 A;  4Z6F A;  4RPZ A;  4I2C A;  4ATB A;  3H37 A;  2I9G A;  1ZQE A;  4RQ0 A;  1ZQA A;  4WBY A;  8ICW A;  4FH5 A;  4RWP A;  4RPY A;  3V72 A;  4R65 A;  2DVI A;  3ER8 C;  8ICH A;  1BPX A;  1R8C A;  4EED A;  5DB8 A;  1ZQZ A;  3JCF A;  3RJF A;  1MIW A;  8ICO A;  2GAF D;  1MQ3 A;  3PHZ A;  3WFP A;  5J2A A;  3JPR A;  5D61 A;  4LEZ A;  4I28 A;  3JZ0 A;  2BCR A;  2IUB A;  7ICF A;  1FA0 A;  7ICL A;  3TFS A;  5IIJ A;  1TV9 A;  5J2F A;  4O5E A;  5J0U A;  4S3N A;  5BPC A;  4M2Y A;  9ICE A;  3UQ0 A;  8ICN A;  2BCQ A;  4M0A A;  2BBH A;  2ZH8 A;  5J0R A;  1ZQW A;  1ZQX A;  4I2F A;  4QZF A;  3AUO A;  5DEC A;  3OV7 A;  4KLU A;  3B0Y A;  2BE3 A;  4DOB A;  1XSN A;  9ICV A;  7ICV A;  4NXT A;  5J0P A;  1ZQQ A;  2GA9 D;  4FHV A;  4OAF A;  5J2E A;  8ICI A;  3HIY A;  3MDC A;  3NVO A;  4MF2 A;  4KLO A;  3C2M A;  5CJ7 A;  2RFF A;  2HN1 A;  4M9H A;  1VFG A;  4Z6C A;  3UXO A;  4X4U A;  3H38 A;  3K75 D;  3ISD A;  5J2K A;  5DB9 A;  3WFS C;  1ZQT A;  1UEV A;  4NXX A;  3NWI A;  5CB1 A;  3OVS A;  3JPN A;  9ICF A;  2B51 A;  2DR8 A;  4RQ5 A;  4PH5 A;  4NLZ A;  4HX0 A;  5HRI A;  4F5Q A;  9ICL A;  1ZQI A;  3MBY A;  4IQV A;  4X4Q A;  1MIY A;  1R89 A;  5HRL A;  1ZJN A;  4WOY A;  4QZG A;  4LEW A;  1ZQS A;  1TVA A;  4XUS A;  1JMS A;  4R66 A;  5JTG A;  4KLE A;  4M9N A;  4FHY A;  2VAN A;  4UBC A;  5III A;  5CR0 A;  4RQ2 A;  4UAW A;  3JPQ A;  9ICX A;  2BBJ A;  3H3A A;  4XQ7 A;  4WC2 A;  1ZQK A;  4K4H A;  3OVB A;  4I2H A;  4EEB A;  2O5A A;  8ICZ A;  9ICR A;  1ZQN A;  4OAG A;  4JLX A;  4E7X A;  7ICQ A;  4K97 A;  5B3P A;  5D46 A;  4FHP A;  1NO5 A;  7ICJ A;  4I27 A;  4ATB B;  1R8A A;  2B4V A;  5HRD A;  2Q66 A;  5D62 A;  4NXZ A;  9ICG A;  3CK6 A;  7ICP A;  5DBA A;  3H39 A;  5DBC A;  4X4R A;  8ICL A;  5HRH A;  8ICR A;  5HRK A;  2NRK A;  3ER9 B;  5HR9 A;  4RWO A;  4X4S A;  4RQ7 A;  4O5K A;  5DB6 A;  4OAH A;  7ICM A;  1ZQC A;  5CFT A;  9ICU A;  4KLI A;  8ICQ A;  2PFN A;  4TUS A;  5HRE A;  3V7K A;  8ICX A;  4YD2 A;  4MFA A;  4I2E A;  4K99 A;  3MGI A;  3PML A;  8ICT A;  4YMN A;  2BCU A;  5DED A;  2BPG A;  4NLK A;  2DR5 A;  4PHD A;  4NY8 A;  1ZQY A;  3OUY A;  5IIL A;  3AQN A;  1BPB A;  5J2I A;  4NXW A;  5J2G A;  4MFC A;  4QZC A;  2B56 A;  3B0X A;  3PNC A;  5J0Q A;  2M2T A;  2M2W A;  3HJ1 A;  4WC5 A;  7ICI A;  3GDX A;  1UET A;  4KB6 A;  3RH6 A;  4NXV A;  4AT8 A;  4AT7 B;  1ZJM A;  1RZT A;  3HJ4 A;  4KLT A;  4UB4 A;  1ZQP A;  4WC0 A;  1JAJ A;  5DDM A;  3NKU A;  8ICE A;  1BPZ A;  4WCW A;  3AU6 A; 
#chains in the Genus database with same CATH homology
 5DBB A;  3RJE A;  4WC7 A;  1XSP A;  4IQW A;  4M9L A;  5IIO A;  8ICU A;  7ICR A;  4X4N A;  3UXN A;  2ZHA A;  3WFO A;  3AQK A;  1KEJ A;  3UQ2 A;  4WC6 A;  4UB3 A;  2BCS A;  4M9G A;  3RJJ A;  4X4T A;  4TUQ A;  2GWS A;  2BCV A;  8ICJ A;  5IIK A;  3JPO A;  5HRG A;  2ZH3 A;  3OVA A;  1ZQF A;  1Q78 A;  9ICJ A;  5J0Y A;  5J29 A;  4LZD A;  4KLG A;  4XA5 A;  3MGH A;  2PFP A;  7ICO A;  4Z6E A;  4P4P A;  4R64 A;  9ICK A;  5D49 A;  4F5O A;  4RQ1 A;  2PBE A;  4XRH A;  4I2B A;  4R63 A;  4P4O A;  9ICW A;  4X0B A;  2ZH9 A;  3RH5 A;  4AT9 B;  5J0X A;  4PGY A;  3RJK A;  5TZV A;  1HUZ A;  3AQM A;  5J0S A;  1V4A A;  4RPX A;  4UAZ A;  2ZH7 A;  4P2H A;  1NOM A;  4IQU A;  4FH3 A;  4F5N A;  2DRB A;  3AU2 A;  7ICU A;  1XSL A;  4EBK A;  4X4V A;  2ZH2 A;  3L9D A;  4IG8 A;  7ICE A;  4YN4 A;  5IIN A;  5IIM A;  5DKW A;  4WC4 A;  4KLJ A;  4LT6 A;  4O9M A;  8ICP A;  4TUP A;  3C5G A;  9ICI A;  5DDY A;  4RT2 A;  5J2C A;  4X5V A;  4K4G A;  1ZQH A;  4I2G A;  8ICF A;  1KNY A;  4GXI A;  4KLM A;  2M2V A;  4RQ6 A;  4PHE A;  2W9M A;  2PFO A;  4XQ8 A;  2ZH6 A;  4X0A A;  3AQL A;  9ICH A;  4DO9 A;  8ICC A;  2PFQ A;  3LQC B;  4JWM A;  9ICT A;  3OGU A;  2DR9 A;  8ICK A;  5CP2 A;  2DR7 A;  4KLF A;  5CWR A;  1BPY A;  3UPQ A;  2M2U A;  2FMP A;  4O5C A;  4PHP A;  2P66 A;  5J0O A;  3C66 A;  9ICO A;  4YMM A;  4LVS A;  2O1P A;  4FHW A;  2ISO A;  4QZ9 A;  4Z6D A;  3JYY A;  3HWT A;  4EBJ A;  8ICY A;  4JWN A;  2ZHB A;  4DOA A;  4E8F A;  3WFR E;  1Q79 A;  4GXJ A;  4YMO A;  4KLS A;  4NM1 A;  9ICM A;  3C2L A;  4QZ8 A;  1R8B A;  5HRF A;  4M9J A;  3PMN A;  4F5P A;  2ZH5 A;  4E80 A;  2ZH4 A;  1ZQD A;  1ZQU A;  5EOZ A;  8ICA A;  2ID1 A;  4WC1 A;  4TUR A;  4DOC A;  5BOM A;  3LK9 A;  4NLN A;  4UB2 A;  4FO6 A;  5J2D A;  1ZQB A;  4KLD A;  3C5F A;  4P4M A;  4I2J A;  5CHG A;  3JPP A;  9ICS A;  1MQ2 A;  1KDH A;  4PPX A;  2HHP A;  5HRB A;  7ICT A;  4X4O A;  1ZQV A;  4X4P A;  4I2D A;  1UEU A;  3UPS A;  9ICP A;  4K4I A;  1TFY A;  4PHA A;  1OU5 A;  5J2B A;  4IQT A;  4M47 A;  1BPE A;  4GXK A;  7ICH A;  4KLL A;  4KLH A;  4PGQ A;  2BPC A;  4AT7 A;  9ICQ A;  2FMS A;  1YLQ A;  4I2I A;  4MFF A;  2PXI A;  1HUO A;  8ICS A;  1ZQL A;  2FMQ A;  4QZD A;  4RWN A;  4UB5 A;  3MDA A;  3RJG A;  1RPL A;  5J2J A;  2BPF A;  4EP7 A;  3C2K A;  5CA7 A;  5HHI A;  4RT3 A;  3RJI A;  4YD1 A;  1ZQJ A;  1TFW A;  7ICN A;  4UD5 A;  5F2V O;  8ICM A;  9ICC A;  4QZH A;  7ICK A;  1ZQR A;  8ICG A;  1ZQM A;  8ICB A;  4QZI A;  2IHM A;  1JQR A;  4QZA A;  1JN3 A;  1ZQG A;  1BPD A;  3NYB A;  4M04 A;  9ICA A;  4UB1 A;  4RWQ A;  2ISP A;  4UBB A;  1MIV A;  4QZE A;  5J0W A;  4FHX A;  4MF8 A;  4F5R A;  4QZB A;  3JPS A;  4M5D A;  5J0T A;  3OUY B;  3RJH A;  1WOT A;  7ICS A;  1VJ7 A;  2ZH1 A;  4NKT A;  1PX5 A;  3C18 A;  1F5A A;  4RQ8 A;  1ZQO A;  8ICV A;  4LZG A;  5HC9 A;  3WFQ E;  4KLQ A;  3ISC A;  4WBZ A;  4YCX A;  7ICG A;  5HHH A;  4RQ3 A;  9ICB A;  3JPT A;  3TFR A;  4UAY A;  4RQ4 A;  4I29 A;  3V7J A;  9ICN A;  4AT8 B;  4UD4 A;  4PGX A;  3V7L A;  3HW8 A;  4AT9 A;  3UXP A;  3RH4 A;  4NM2 A;  3HX0 A;  5D4B A;  4I2A A;  5J2H A;  3ISB A;  4NKU A;  5DB7 A;  2DRA A;  5BOL A;  4WC3 A;  4Z6F A;  4RPZ A;  4I2C A;  4ATB A;  3H37 A;  2I9G A;  1ZQE A;  4RQ0 A;  1ZQA A;  4WBY A;  8ICW A;  4FH5 A;  4RWP A;  4RPY A;  3V72 A;  4R65 A;  2DVI A;  8ICH A;  1BPX A;  1R8C A;  5DB8 A;  1ZQZ A;  3RJF A;  1MIW A;  8ICO A;  1MQ3 A;  5J2A A;  3WFP A;  3JPR A;  4I28 A;  3JZ0 A;  2BCR A;  7ICF A;  1FA0 A;  7ICL A;  3TFS A;  5IIJ A;  1TV9 A;  5J2F A;  4O5E A;  5J0U A;  4S3N A;  5BPC A;  4M2Y A;  9ICE A;  3UQ0 A;  8ICN A;  2BCQ A;  4M0A A;  2ZH8 A;  5J0R A;  1ZQW A;  1ZQX A;  4I2F A;  4QZF A;  3AUO A;  5DEC A;  3OV7 A;  4KLU A;  3B0Y A;  2BE3 A;  4DOB A;  1XSN A;  9ICV A;  7ICV A;  5J0P A;  1ZQQ A;  4FHV A;  5J2E A;  8ICI A;  3HIY A;  3MDC A;  4MF2 A;  4KLO A;  3C2M A;  5CJ7 A;  2RFF A;  4M9H A;  1VFG A;  4Z6C A;  3UXO A;  4X4U A;  3H38 A;  3K75 D;  3ISD A;  5J2K A;  5DB9 A;  3WFS C;  1ZQT A;  1UEV A;  5CB1 A;  3OVS A;  3JPN A;  9ICF A;  2DR8 A;  4RQ5 A;  4PH5 A;  4NLZ A;  5HRI A;  4F5Q A;  9ICL A;  1ZQI A;  3MBY A;  4IQV A;  4X4Q A;  1MIY A;  1R89 A;  5HRL A;  1ZJN A;  4QZG A;  1ZQS A;  1TVA A;  4XUS A;  1JMS A;  4R66 A;  4KLE A;  4M9N A;  4FHY A;  2VAN A;  4UBC A;  5III A;  5CR0 A;  4RQ2 A;  4UAW A;  3JPQ A;  9ICX A;  3H3A A;  4XQ7 A;  4WC2 A;  1ZQK A;  4K4H A;  3OVB A;  4I2H A;  8ICZ A;  2O5A A;  9ICR A;  1ZQN A;  4E7X A;  7ICQ A;  5D46 A;  4FHP A;  1NO5 A;  7ICJ A;  4I27 A;  4ATB B;  1R8A A;  2Q66 A;  5HRD A;  4NXZ A;  9ICG A;  7ICP A;  5DBA A;  3H39 A;  5DBC A;  4X4R A;  8ICL A;  5HRH A;  8ICR A;  5HRK A;  2NRK A;  5HR9 A;  4RWO A;  4X4S A;  4RQ7 A;  4O5K A;  5DB6 A;  7ICM A;  1ZQC A;  9ICU A;  4KLI A;  8ICQ A;  2PFN A;  4TUS A;  5HRE A;  3V7K A;  8ICX A;  4YD2 A;  4MFA A;  4I2E A;  3MGI A;  3PML A;  8ICT A;  4YMN A;  2BCU A;  5DED A;  2BPG A;  4NLK A;  2DR5 A;  4PHD A;  4NY8 A;  1ZQY A;  3OUY A;  5IIL A;  3AQN A;  1BPB A;  5J2I A;  5J2G A;  4MFC A;  4QZC A;  3B0X A;  3PNC A;  5J0Q A;  2M2T A;  2M2W A;  3HJ1 A;  4WC5 A;  7ICI A;  3GDX A;  1UET A;  3RH6 A;  4AT8 A;  4AT7 B;  1ZJM A;  1RZT A;  3HJ4 A;  4KLT A;  4UB4 A;  1ZQP A;  4WC0 A;  1JAJ A;  5DDM A;  8ICE A;  1BPZ A;  4WCW A;  3AU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...