2O5AA

Crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
108
Chain Sequence
SNQELLQLAVNAVDDKKAEQVVALNMKGISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEIKRLEGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVELEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords BH1328 protein
total genus 29
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02410 RsfS Ribosomal silencing factor during starvation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2o5aA01
9ICUA 3AQMA 4NXZA 4IQWA 4R65A 4X4OA 4QZBA 3H37A 3JPQA 3JPOA 5BOMA 9ICAA 3GDXA 1KEJA 3H39A 4WC6A 1BPXA 9ICSA 5DB7A 4YD2A 5HC9A 1JN3A 5J2BA 3L9DA 1HUOA 4QZDA 5J2IA 4X4QA 2PFQA 8ICQA 2BPFA 1XSLA 4M9NA 4FHXA 3ISDA 1ZQHA 5DDMA 3MGIA 5J2DA 4QZFA 4YD1A 3PNCA 1ZQZA 1F5AA 4F5NA 4I2BA 3RJIA 4Z6DA 4NLNA 4DOAA 2DRAA 4TUPA 5J0YA 3WFSC 2O5AA 4EBKA 4KLFA 4KLLA 5IIKA 5DECA 4TURA 4KLQA 4RPYA 1RPLA 8ICSA 2ID1A 4XA5A 1BPYA 1PX5A 1XSNA 4RQ8A 4DOBA 1ZQWA 1ZQPA 1MIYA 4UB3A 4AT9A 3HJ1A 3V7LA 3C2KA 3UXPA 4RWPA 3AU2A 5IINA 5DBBA 4XQ8A 5HHHA 4UAYA 4KLMA 1R89A 2FMQA 1MQ3A 9ICCA 4WBYA 3UXOA 1YLQA 3OV7A 4M5DA 4GXJA 9ICMA 4O5KA 1ZQXA 2BCQA 8ICTA 4M9HA 8ICMA 9ICIA 4AT7A 5J0UA 3WFRE 3LQCB 2DRBA 2ZH5A 2FMPA 4WC5A 4S3NA 4RWOA 4FH5A 4TUSA 3V7KA 4X5VA 4NM1A 9ICTA 2BPGA 1ZQAA 7ICKA 4KLEA 7ICIA 5J2EA 3C2LA 2ZH4A 8ICJA 1ZQCA 1BPEA 4JWNA 4NM2A 5DBCA 4F5RA 3JZ0A 9ICXA 3B0XA 5HRBA 5CA7A 2BCRA 4WC1A 4X0BA 8ICRA 9ICFA 1JAJA 8ICLA 9ICQA 5CP2A 1V4AA 5J0PA 3C66A 4DOCA 5CWRA 4YMOA 3NYBA 4M9JA 3OVSA 3AQNA 3AQKA 1XSPA 4RQ7A 8ICEA 4O9MA 9ICWA 5F2VO 4I2CA 4RQ0A 4NLKA 2VANA 1OU5A 5DEDA 5BOLA 4KLHA 3H3AA 3RJJA 5J0XA 1TFYA 4GXKA 7ICNA 5D46A 4X4PA 4PHAA 4QZCA 2PFOA 5J0WA 4EP7A 5J0TA 5J2GA 1ZQQA 4PHPA 8ICFA 4I2JA 9ICPA 4I27A 4UB1A 3PMNA 4YN4A 1R8BA 1Q78A 1ZQYA 5EOZA 3WFOA 1WOTA 1ZQVA 4QZ8A 4RT2A 1FA0A 5BPCA 4WC4A 4X4UA 4PGQA 4UD5A 3ISCA 2ZHAA 2BCSA 4I2HA 8ICXA 1ZQKA 3UPSA 1ZQGA 7ICFA 2W9MA 4NY8A 2HHPA 4LZGA 1ZQTA 5J2JA 5J2KA 4YMNA 4UAWA 4M9GA 4QZGA 5J2FA 4FHYA 4RWNA 3JPPA 4IQTA 3RJEA 4FO6A 2BCUA 2Q66A 8ICHA 5CR0A 4O5EA 5IIJA 8ICVA 4NKTA 4O5CA 4E80A 3H38A 5J29A 3HW8A 3HJ4A 1ZQRA 4I2EA 7ICPA 2O1PA 2ZH7A 5DBAA 2DR7A 5J0OA 8ICBA 4M9LA 2ISPA 8ICGA 4I2DA 4WC3A 4I2FA 4WCWA 1ZQDA 4AT8A 3HIYA 3OUYB 2DR8A 4UAZA 4X4TA 3JPTA 4LT6A 4RQ5A 2DVIA 4EBJA 7ICTA 4YCXA 3WFQE 4JWMA 4M04A 1RZTA 1UEUA 4K4HA 4AT8B 4R63A 2ZH6A 9ICJA 5HRLA 5CB1A 3MDAA 9ICLA 3PMLA 1ZQNA 4RQ1A 1Q79A 3MGHA 8ICOA 1ZQJA 4PPXA 4QZHA 1ZQIA 4FHVA 5HRKA 4X4SA 4RT3A 4ATBA 4MFAA 2RFFA 4YMMA 3V72A 4KLTA 5HRGA 4M0AA 3C18A 5IIOA 3UPQA 3B0YA 3RJGA 1R8CA 1NO5A 4KLUA 8ICAA 5J2AA 3C2MA 2I9GA 4QZ9A 8ICCA 8ICWA 4UB5A 4AT9B 1UEVA 4QZAA 4KLOA 2NRKA 1BPBA 3AQLA 4P4OA 2PXIA 3OGUA 4IQUA 4AT7B 4XRHA 4KLSA 1VFGA 5TZVA 4F5OA 7ICRA 4X0AA 4XUSA 3TFSA 2M2TA 9ICOA 4LZDA 4Z6EA 4MFFA 9ICEA 4PH5A 3RJHA 3UXNA 4X4VA 9ICNA 7ICGA 1ZQMA 5HHIA 3RH4A 4KLIA 1ZQLA 4IG8A 2P66A 4IQVA 5HRHA 2M2WA 3V7JA 4E8FA 1R8AA 4WC7A 3JPSA 4TUQA 4F5QA 4I2AA 4WBZA 3JPNA 1ZQBA 5D4BA 9ICHA 4WC0A 4P4PA 4WC2A 5IILA 5DKWA 4DO9A 3WFPA 4MFCA 4FHPA 4NLZA 4X4NA 1BPDA 4R64A 9ICRA 3MDCA 7ICUA 4ATBB 4RQ2A 4UB4A 2M2UA 8ICUA 5IIMA 4PHDA 2ZH1A 4X4RA 4MF8A 3RJKA 7ICHA 3OVBA 4UB2A 4RWQA 4FHWA 2ZHBA 4M2YA 1ZJNA 7ICVA 3UQ2A 1MIVA 4XQ7A 7ICOA 4KLGA 2BE3A 4UBCA 2ZH9A 2ISOA 3ISBA 1JQRA 1BPZA 3RJFA 4K4GA 2M2VA 4LVSA 5J0RA 3HX0A 3RH5A 8ICPA 4E7XA 5CJ7A 9ICBA 4RQ3A 5HR9A 4GXIA 7ICEA 2BCVA 4KLJA 4FH3A 1NOMA 4UBBA 1ZQEA 4RPXA 2IHMA 1KNYA 4I28A 7ICLA 2ZH2A 3OUYA 4I29A 5HRDA 1KDHA 2PFPA 4K4IA 3HWTA 4RQ6A 3AUOA 1TVAA 5DB9A 8ICKA 4NKUA 5J0QA 2PBEA 4P2HA 1UETA 7ICMA 4I2GA 5DB8A 5J2CA 1MIWA 1ZJMA 1ZQSA 2ZH8A 3K75D 3LK9A 3AU6A 4I2IA 5DDYA 5DB6A 1MQ2A 1ZQFA 2PFNA 2GWSA 4KLDA 3C5GA 4QZIA 2ZH3A 5HREA 4UD4A 5J0SA 4RQ4A 5IIIA 5CHGA 4R66A 2FMSA 3OVAA 4QZEA 8ICNA 1VJ7A 1TFWA 8ICIA 3RH6A 7ICQA 4PGXA 5J2HA 4P4MA 4MF2A 7ICSA 3JPRA 3TFRA 1JMSA 4Z6FA 4RPZA 3MBYA 1ZQOA 4PGYA 1ZQUA 9ICGA 8ICZA 2BPCA 1TV9A 3UQ0A 7ICJA 5D49A 3C5FA 4PHEA 8ICYA 4Z6CA 9ICVA 5HRFA 1HUZA 2DR5A 3JYYA 4M47A 4F5PA 9ICKA 2DR9A 5HRIA
chains in the Genus database with same CATH superfamily
9ICUA 3AQMA 4NXZA 4IQWA 4R65A 4X4OA 4QZBA 3H37A 3OWGA 4N7RA 3JPQA 4JLZA 3JPOA 5BOMA 3EF2A 9ICAA 3GDXA 1KEJA 3H39A 4WC6A 1BPXA 9ICSA 5DB7A 4YD2A 5HC9A 3ER9B 1JN3A 4OAFA 2HN2A 3L9DA 5J2BA 1HUOA 4QZDA 5J2IA 4X4QA 5D61A 2PFQA 8ICQA 2BPFA 1XSLA 4M9NA 4FHXA 3ISDA 1ZQHA 5DDMA 3MGIA 5J2DA 4QZFA 4YD1A 3PNCA 1ZQZA 1F5AA 4F5NA 4I2BA 3RJIA 4Z6DA 4NLNA 4DOAA 2DRAA 4TUPA 5J0YA 3WFSC 2O5AA 4EBKA 4KLFA 2BBJA 4KLLA 5IIKA 5DECA 4TURA 4KLQA 4RPYA 1RPLA 8ICSA 2ID1A 4XA5A 1BPYA 1PX5A 1XSNA 4RQ8A 4DOBA 1ZQWA 1ZQPA 1MIYA 4UB3A 4AT9A 5B3QA 3HJ1A 3V7LA 3C2KA 3UXPA 4RWPA 3AU2A 5IINA 5DBBA 4XQ8A 5HHHA 4UAYA 4KLMA 1R89A 2FMQA 1MQ3A 9ICCA 4WBYA 3UXOA 1YLQA 5CHEA 4I0UA 3OV7A 4M5DA 4GXJA 9ICMA 4O5KA 1ZQXA 2IHOA 2BCQA 8ICTA 4M9HA 8ICMA 9ICIA 4AT7A 5J0UA 3WFRE 3LQCB 2DRBA 2ZH5A 2FMPA 4WC5A 4S3NA 4RWOA 4FH5A 4TUSA 3V7KA 4X5VA 4NM1A 9ICTA 2BPGA 1ZQAA 7ICKA 4KLEA 7ICIA 5J2EA 3C2LA 2ZH4A 4MKPA 8ICJA 1ZQCA 1BPEA 4JWNA 4NM2A 5DBCA 4F5RA 3JZ0A 9ICXA 3B0XA 5HRBA 5CA7A 2BCRA 4WC1A 4X0BA 8ICRA 9ICFA 1JAJA 8ICLA 9ICQA 2GAFD 1V4AA 5CP2A 5J0PA 3C66A 4DOCA 5CWRA 4OAHA 4YMOA 3NYBA 4M9JA 3OVSA 3AQNA 3AQKA 1XSPA 4RQ7A 8ICEA 4O9MA 9ICWA 5F2VO 4I2CA 4RQ0A 4NLKA 2VANA 1OU5A 5DEDA 5BOLA 4KLHA 3H3AA 3RJJA 5J0XA 1TFYA 4GXKA 7ICNA 4EGWA 3ERCC 5D46A 4X4PA 4PHAA 4QZCA 4LEVA 2PFOA 5J0WA 4EP7A 5J0TA 5J2GA 1ZQQA 4PHPA 8ICFA 4I2JA 9ICPA 4I27A 4UB1A 3NVOA 3PMNA 4YN4A 4EV6A 1R8BA 1Q78A 2IUBA 1ZQYA 5EOZA 3WFOA 1WOTA 1ZQVA 4QZ8A 5BPCA 1FA0A 4RT2A 4WC4A 4O68A 4X4UA 4PGQA 4HX0A 4UD5A 3ISCA 2ZHAA 2BCSA 4I2HA 8ICXA 1ZQKA 3UPSA 1ZQGA 3ER8C 7ICFA 2W9MA 4NY8A 2HHPA 4LZGA 4WQLA 1ZQTA 5J2JA 5J2KA 4YMNA 4UAWA 4M9GA 4QZGA 5J2FA 4FHYA 4RWNA 3JPPA 4IQTA 3RJEA 4FO6A 2BCUA 2Q66A 8ICHA 4NXTA 5CR0A 4O5EA 5CFSA 5IIJA 8ICVA 4NKTA 4O5CA 4E80A 3H38A 3NWIA 5J29A 3HW8A 3HJ4A 1ZQRA 4I2EA 7ICPA 2O1PA 2ZH7A 4KB6A 5DBAA 4FO1A 2DR7A 5J0OA 8ICBA 4M9LA 2ISPA 8ICGA 4I2DA 4WC3A 2B4VA 4I2FA 4WCWA 2FCLA 1ZQDA 4AT8A 3HIYA 3OUYB 2DR8A 4UAZA 4X4TA 3JPTA 4LT6A 4RQ5A 4OAGA 2DVIA 4EBJA 7ICTA 4YCXA 3WFQE 4JWMA 4M04A 1RZTA 1UEUA 4K4HA 4AT8B 4R63A 2ZH6A 9ICJA 5HRLA 4K9AA 5CB1A 3MDAA 9ICLA 3PMLA 1ZQNA 3CK6A 4RQ1A 1Q79A 3MGHA 8ICOA 1ZQJA 4PPXA 4K9BA 4QZHA 1ZQIA 4FHVA 5HRKA 4X4SA 4RT3A 4ATBA 4MFAA 4LEYA 4O67A 2RFFA 4YMMA 3V72A 4KLTA 5HRGA 4M0AA 3C18A 5IIOA 3UPQA 3B0YA 3RJGA 1R8CA 1NO5A 4KLUA 8ICAA 4LEZA 2B51A 5J2AA 3C2MA 2I9GA 4QZ9A 4JLXA 8ICCA 8ICWA 4UB5A 4AT9B 4NXUA 1UEVA 4QZAA 4KLOA 2NRKA 4K8VA 1BPBA 3AQLA 3NKUA 4P4OA 4NXXA 2PXIA 3OGUA 4IQUA 4AT7B 4XRHA 4WQKA 4KLSA 1VFGA 5TZVA 4F5OA 7ICRA 3PHZA 4X0AA 4XUSA 3TFSA 2M2TA 9ICOA 4LZDA 4Z6EA 4MFFA 9ICEA 4PH5A 3RJHA 3UXNA 4X4VA 9ICNA 7ICGA 1ZQMA 5HHIA 3RH4A 4KLIA 1ZQLA 4IG8A 2P66A 4IQVA 5HRHA 2M2WA 3V7JA 4E8FA 1R8AA 4WC7A 3JPSA 4TUQA 4F5QA 4I2AA 5B3PA 4WBZA 3JPNA 1ZQBA 5D4BA 9ICHA 4WC0A 4P4PA 4WC2A 5IILA 5DKWA 4DO9A 4XJEA 3WFPA 4MFCA 4FHPA 4NLZA 4X4NA 1BPDA 4R64A 9ICRA 4KM5A 3MDCA 7ICUA 4ATBB 4RQ2A 4UB4A 4O69A 2M2UA 8ICUA 5IIMA 4PHDA 2ZH1A 4X4RA 4MF8A 3RJKA 5CFUA 7ICHA 3OVBA 4EEDA 4UB2A 4RWQA 4WOYA 4FHWA 2ZHBA 4M2YA 1ZJNA 7ICVA 3UQ2A 1MIVA 4XQ7A 7ICOA 4KLGA 2BE3A 4UBCA 2ZH9A 2ISOA 4NXWA 3ISBA 1JQRA 1BPZA 3RJFA 4K4GA 2M2VA 4LVSA 5J0RA 3HX0A 3RH5A 8ICPA 4E7XA 5CJ7A 9ICBA 4RQ3A 5HR9A 4GXIA 3JCFA 7ICEA 2BCVA 4KLJA 5JTGA 4FH3A 4LEWA 1NOMA 4UBBA 2EWRA 1ZQEA 4RPXA 2IHMA 1KNYA 4I28A 7ICLA 2ZH2A 3OUYA 4I29A 5HRDA 1KDHA 2PFPA 4K4IA 5D62A 3HWTA 1GPJA 4RQ6A 4K99A 3AUOA 1TVAA 4EEBA 3K7DA 5DB9A 8ICKA 2B56A 4NKUA 5J0QA 2PBEA 4P2HA 1UETA 7ICMA 4I2GA 5CFTA 5DB8A 4WH5A 5J2CA 1MIWA 1ZJMA 2GA9D 1ZQSA 2ZH8A 3K75D 3LK9A 3AU6A 4I2IA 5DDYA 5DB6A 1MQ2A 1ZQFA 2PFNA 2GWSA 4KLDA 3C5GA 4QZIA 2ZH3A 5HREA 3MCRA 5D63A 4UD4A 5J0SA 4RQ4A 5IIIA 5CHGA 4R66A 2FMSA 3OVAA 4QZEA 8ICNA 1VJ7A 1TFWA 4K98A 8ICIA 3RH6A 7ICQA 4PGXA 5J2HA 4P4MA 4MF2A 7ICSA 4NXVA 3JPRA 3TFRA 1JMSA 4Z6FA 4RPZA 2HN1A 4K96A 3MBYA 1ZQOA 4PGYA 1ZQUA 9ICGA 8ICZA 2BPCA 1TV9A 4O6AA 3UQ0A 7ICJA 5D49A 3C5FA 4PHEA 8ICYA 4Z6CA 9ICVA 5HRFA 1HUZA 4K97A 2DR5A 4OAIZ 3JYYA 4M47A 4F5PA 9ICKA 2BBHA 2DR9A 5HRIA
chains in the Genus database with same CATH topology
9ICUA 3AQMA 4NXZA 4IQWA 4R65A 4X4OA 4QZBA 3H37A 3JPQA 3JPOA 5BOMA 9ICAA 3GDXA 1KEJA 3H39A 4WC6A 1BPXA 9ICSA 5DB7A 4YD2A 5HC9A 1JN3A 5J2BA 3L9DA 1HUOA 4QZDA 5J2IA 4X4QA 2PFQA 8ICQA 2BPFA 1XSLA 4M9NA 4FHXA 3ISDA 1ZQHA 5DDMA 3MGIA 5J2DA 4QZFA 4YD1A 3PNCA 1ZQZA 1F5AA 4F5NA 4I2BA 3RJIA 4Z6DA 4NLNA 4DOAA 2DRAA 4TUPA 5J0YA 3WFSC 2O5AA 4EBKA 4KLFA 4KLLA 5IIKA 5DECA 4TURA 4KLQA 4RPYA 1RPLA 8ICSA 2ID1A 4XA5A 1BPYA 1PX5A 1XSNA 4RQ8A 4DOBA 1ZQWA 1ZQPA 1MIYA 4UB3A 4AT9A 3HJ1A 3V7LA 3C2KA 3UXPA 4RWPA 3AU2A 5IINA 5DBBA 4XQ8A 5HHHA 4UAYA 4KLMA 1R89A 2FMQA 1MQ3A 9ICCA 4WBYA 3UXOA 1YLQA 3OV7A 4M5DA 4GXJA 9ICMA 4O5KA 1ZQXA 2BCQA 8ICTA 4M9HA 8ICMA 9ICIA 4AT7A 5J0UA 3WFRE 3LQCB 2DRBA 2ZH5A 2FMPA 4WC5A 4S3NA 4RWOA 4FH5A 4TUSA 3V7KA 4X5VA 4NM1A 9ICTA 2BPGA 1ZQAA 7ICKA 4KLEA 7ICIA 5J2EA 3C2LA 2ZH4A 8ICJA 1ZQCA 1BPEA 4JWNA 4NM2A 5DBCA 4F5RA 3JZ0A 9ICXA 3B0XA 5HRBA 5CA7A 2BCRA 4WC1A 4X0BA 8ICRA 9ICFA 1JAJA 8ICLA 9ICQA 5CP2A 1V4AA 5J0PA 3C66A 4DOCA 5CWRA 4YMOA 3NYBA 4M9JA 3OVSA 3AQNA 3AQKA 1XSPA 4RQ7A 8ICEA 4O9MA 9ICWA 5F2VO 4I2CA 4RQ0A 4NLKA 2VANA 1OU5A 5DEDA 5BOLA 4KLHA 3H3AA 3RJJA 5J0XA 1TFYA 4GXKA 7ICNA 5D46A 4X4PA 4PHAA 4QZCA 2PFOA 5J0WA 4EP7A 5J0TA 5J2GA 1ZQQA 4PHPA 8ICFA 4I2JA 9ICPA 4I27A 4UB1A 3PMNA 4YN4A 1R8BA 1Q78A 1ZQYA 5EOZA 3WFOA 1WOTA 1ZQVA 4QZ8A 4RT2A 1FA0A 5BPCA 4WC4A 4X4UA 4PGQA 4UD5A 3ISCA 2ZHAA 2BCSA 4I2HA 8ICXA 1ZQKA 3UPSA 1ZQGA 7ICFA 2W9MA 4NY8A 2HHPA 4LZGA 1ZQTA 5J2JA 5J2KA 4YMNA 4UAWA 4M9GA 4QZGA 5J2FA 4FHYA 4RWNA 3JPPA 4IQTA 3RJEA 4FO6A 2BCUA 2Q66A 8ICHA 5CR0A 4O5EA 5IIJA 8ICVA 4NKTA 4O5CA 4E80A 3H38A 5J29A 3HW8A 3HJ4A 1ZQRA 4I2EA 7ICPA 2O1PA 2ZH7A 5DBAA 2DR7A 5J0OA 8ICBA 4M9LA 2ISPA 8ICGA 4I2DA 4WC3A 4I2FA 4WCWA 1ZQDA 4AT8A 3HIYA 3OUYB 2DR8A 4UAZA 4X4TA 3JPTA 4LT6A 4RQ5A 2DVIA 4EBJA 7ICTA 4YCXA 3WFQE 4JWMA 4M04A 1RZTA 1UEUA 4K4HA 4AT8B 4R63A 2ZH6A 9ICJA 5HRLA 5CB1A 3MDAA 9ICLA 3PMLA 1ZQNA 4RQ1A 1Q79A 3MGHA 8ICOA 1ZQJA 4PPXA 4QZHA 1ZQIA 4FHVA 5HRKA 4X4SA 4RT3A 4ATBA 4MFAA 2RFFA 4YMMA 3V72A 4KLTA 5HRGA 4M0AA 3C18A 5IIOA 3UPQA 3B0YA 3RJGA 1R8CA 1NO5A 4KLUA 8ICAA 5J2AA 3C2MA 2I9GA 4QZ9A 8ICCA 8ICWA 4UB5A 4AT9B 1UEVA 4QZAA 4KLOA 2NRKA 1BPBA 3AQLA 4P4OA 2PXIA 3OGUA 4IQUA 4AT7B 4XRHA 4KLSA 1VFGA 5TZVA 4F5OA 7ICRA 4X0AA 4XUSA 3TFSA 2M2TA 9ICOA 4LZDA 4Z6EA 4MFFA 9ICEA 4PH5A 3RJHA 3UXNA 4X4VA 9ICNA 7ICGA 1ZQMA 5HHIA 3RH4A 4KLIA 1ZQLA 4IG8A 2P66A 4IQVA 5HRHA 2M2WA 3V7JA 4E8FA 1R8AA 4WC7A 3JPSA 4TUQA 4F5QA 4I2AA 4WBZA 3JPNA 1ZQBA 5D4BA 9ICHA 4WC0A 4P4PA 4WC2A 5IILA 5DKWA 4DO9A 3WFPA 4MFCA 4FHPA 4NLZA 4X4NA 1BPDA 4R64A 9ICRA 3MDCA 7ICUA 4ATBB 4RQ2A 4UB4A 2M2UA 8ICUA 5IIMA 4PHDA 2ZH1A 4X4RA 4MF8A 3RJKA 7ICHA 3OVBA 4UB2A 4RWQA 4FHWA 2ZHBA 4M2YA 1ZJNA 7ICVA 3UQ2A 1MIVA 4XQ7A 7ICOA 4KLGA 2BE3A 4UBCA 2ZH9A 2ISOA 3ISBA 1JQRA 1BPZA 3RJFA 4K4GA 2M2VA 4LVSA 5J0RA 3HX0A 3RH5A 8ICPA 4E7XA 5CJ7A 9ICBA 4RQ3A 5HR9A 4GXIA 7ICEA 2BCVA 4KLJA 4FH3A 1NOMA 4UBBA 1ZQEA 4RPXA 2IHMA 1KNYA 4I28A 7ICLA 2ZH2A 3OUYA 4I29A 5HRDA 1KDHA 2PFPA 4K4IA 3HWTA 4RQ6A 3AUOA 1TVAA 5DB9A 8ICKA 4NKUA 5J0QA 2PBEA 4P2HA 1UETA 7ICMA 4I2GA 5DB8A 5J2CA 1MIWA 1ZJMA 1ZQSA 2ZH8A 3K75D 3LK9A 3AU6A 4I2IA 5DDYA 5DB6A 1MQ2A 1ZQFA 2PFNA 2GWSA 4KLDA 3C5GA 4QZIA 2ZH3A 5HREA 4UD4A 5J0SA 4RQ4A 5IIIA 5CHGA 4R66A 2FMSA 3OVAA 4QZEA 8ICNA 1VJ7A 1TFWA 8ICIA 3RH6A 7ICQA 4PGXA 5J2HA 4P4MA 4MF2A 7ICSA 3JPRA 3TFRA 1JMSA 4Z6FA 4RPZA 3MBYA 1ZQOA 4PGYA 1ZQUA 9ICGA 8ICZA 2BPCA 1TV9A 3UQ0A 7ICJA 5D49A 3C5FA 4PHEA 8ICYA 4Z6CA 9ICVA 5HRFA 1HUZA 2DR5A 3JYYA 4M47A 4F5PA 9ICKA 2DR9A 5HRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICU A;  3AQM A;  4NXZ A;  4IQW A;  4R65 A;  4X4O A;  4QZB A;  3H37 A;  3JPQ A;  3JPO A;  5BOM A;  9ICA A;  3GDX A;  1KEJ A;  3H39 A;  4WC6 A;  1BPX A;  9ICS A;  5DB7 A;  4YD2 A;  5HC9 A;  1JN3 A;  5J2B A;  3L9D A;  1HUO A;  4QZD A;  5J2I A;  4X4Q A;  2PFQ A;  8ICQ A;  2BPF A;  1XSL A;  4M9N A;  4FHX A;  3ISD A;  1ZQH A;  5DDM A;  3MGI A;  5J2D A;  4QZF A;  4YD1 A;  3PNC A;  1ZQZ A;  1F5A A;  4F5N A;  4I2B A;  3RJI A;  4Z6D A;  4NLN A;  4DOA A;  2DRA A;  4TUP A;  5J0Y A;  3WFS C;  2O5A A;  4EBK A;  4KLF A;  4KLL A;  5IIK A;  5DEC A;  4TUR A;  4KLQ A;  4RPY A;  1RPL A;  8ICS A;  2ID1 A;  4XA5 A;  1BPY A;  1PX5 A;  1XSN A;  4RQ8 A;  4DOB A;  1ZQW A;  1ZQP A;  1MIY A;  4UB3 A;  4AT9 A;  3HJ1 A;  3V7L A;  3C2K A;  3UXP A;  4RWP A;  3AU2 A;  5IIN A;  5DBB A;  4XQ8 A;  5HHH A;  4UAY A;  4KLM A;  1R89 A;  2FMQ A;  1MQ3 A;  9ICC A;  4WBY A;  3UXO A;  1YLQ A;  3OV7 A;  4M5D A;  4GXJ A;  9ICM A;  4O5K A;  1ZQX A;  2BCQ A;  8ICT A;  4M9H A;  8ICM A;  9ICI A;  4AT7 A;  5J0U A;  3WFR E;  3LQC B;  2DRB A;  2ZH5 A;  2FMP A;  4WC5 A;  4S3N A;  4RWO A;  4FH5 A;  4TUS A;  3V7K A;  4X5V A;  4NM1 A;  9ICT A;  2BPG A;  1ZQA A;  7ICK A;  4KLE A;  7ICI A;  5J2E A;  3C2L A;  2ZH4 A;  8ICJ A;  1ZQC A;  1BPE A;  4JWN A;  4NM2 A;  5DBC A;  4F5R A;  3JZ0 A;  9ICX A;  3B0X A;  5HRB A;  5CA7 A;  2BCR A;  4WC1 A;  4X0B A;  8ICR A;  9ICF A;  1JAJ A;  8ICL A;  9ICQ A;  5CP2 A;  1V4A A;  5J0P A;  3C66 A;  4DOC A;  5CWR A;  4YMO A;  3NYB A;  4M9J A;  3OVS A;  3AQN A;  3AQK A;  1XSP A;  4RQ7 A;  8ICE A;  4O9M A;  9ICW A;  5F2V O;  4I2C A;  4RQ0 A;  4NLK A;  2VAN A;  1OU5 A;  5DED A;  5BOL A;  4KLH A;  3H3A A;  3RJJ A;  5J0X A;  1TFY A;  4GXK A;  7ICN A;  5D46 A;  4X4P A;  4PHA A;  4QZC A;  2PFO A;  5J0W A;  4EP7 A;  5J0T A;  5J2G A;  1ZQQ A;  4PHP A;  8ICF A;  4I2J A;  9ICP A;  4I27 A;  4UB1 A;  3PMN A;  4YN4 A;  1R8B A;  1Q78 A;  1ZQY A;  5EOZ A;  3WFO A;  1WOT A;  1ZQV A;  4QZ8 A;  4RT2 A;  1FA0 A;  5BPC A;  4WC4 A;  4X4U A;  4PGQ A;  4UD5 A;  3ISC A;  2ZHA A;  2BCS A;  4I2H A;  8ICX A;  1ZQK A;  3UPS A;  1ZQG A;  7ICF A;  2W9M A;  4NY8 A;  2HHP A;  4LZG A;  1ZQT A;  5J2J A;  5J2K A;  4YMN A;  4UAW A;  4M9G A;  4QZG A;  5J2F A;  4FHY A;  4RWN A;  3JPP A;  4IQT A;  3RJE A;  4FO6 A;  2BCU A;  2Q66 A;  8ICH A;  5CR0 A;  4O5E A;  5IIJ A;  8ICV A;  4NKT A;  4O5C A;  4E80 A;  3H38 A;  5J29 A;  3HW8 A;  3HJ4 A;  1ZQR A;  4I2E A;  7ICP A;  2O1P A;  2ZH7 A;  5DBA A;  2DR7 A;  5J0O A;  8ICB A;  4M9L A;  2ISP A;  8ICG A;  4I2D A;  4WC3 A;  4I2F A;  4WCW A;  1ZQD A;  4AT8 A;  3HIY A;  3OUY B;  2DR8 A;  4UAZ A;  4X4T A;  3JPT A;  4LT6 A;  4RQ5 A;  2DVI A;  4EBJ A;  7ICT A;  4YCX A;  3WFQ E;  4JWM A;  4M04 A;  1RZT A;  1UEU A;  4K4H A;  4AT8 B;  4R63 A;  2ZH6 A;  9ICJ A;  5HRL A;  5CB1 A;  3MDA A;  9ICL A;  3PML A;  1ZQN A;  4RQ1 A;  1Q79 A;  3MGH A;  8ICO A;  1ZQJ A;  4PPX A;  4QZH A;  1ZQI A;  4FHV A;  5HRK A;  4X4S A;  4RT3 A;  4ATB A;  4MFA A;  2RFF A;  4YMM A;  3V72 A;  4KLT A;  5HRG A;  4M0A A;  3C18 A;  5IIO A;  3UPQ A;  3B0Y A;  3RJG A;  1R8C A;  1NO5 A;  4KLU A;  8ICA A;  5J2A A;  3C2M A;  2I9G A;  4QZ9 A;  8ICC A;  8ICW A;  4UB5 A;  4AT9 B;  1UEV A;  4QZA A;  4KLO A;  2NRK A;  1BPB A;  3AQL A;  4P4O A;  2PXI A;  3OGU A;  4IQU A;  4AT7 B;  4XRH A;  4KLS A;  1VFG A;  5TZV A;  4F5O A;  7ICR A;  4X0A A;  4XUS A;  3TFS A;  2M2T A;  9ICO A;  4LZD A;  4Z6E A;  4MFF A;  9ICE A;  4PH5 A;  3RJH A;  3UXN A;  4X4V A;  9ICN A;  7ICG A;  1ZQM A;  5HHI A;  3RH4 A;  4KLI A;  1ZQL A;  4IG8 A;  2P66 A;  4IQV A;  5HRH A;  2M2W A;  3V7J A;  4E8F A;  1R8A A;  4WC7 A;  3JPS A;  4TUQ A;  4F5Q A;  4I2A A;  4WBZ A;  3JPN A;  1ZQB A;  5D4B A;  9ICH A;  4WC0 A;  4P4P A;  4WC2 A;  5IIL A;  5DKW A;  4DO9 A;  3WFP A;  4MFC A;  4FHP A;  4NLZ A;  4X4N A;  1BPD A;  4R64 A;  9ICR A;  3MDC A;  7ICU A;  4ATB B;  4RQ2 A;  4UB4 A;  2M2U A;  8ICU A;  5IIM A;  4PHD A;  2ZH1 A;  4X4R A;  4MF8 A;  3RJK A;  7ICH A;  3OVB A;  4UB2 A;  4RWQ A;  4FHW A;  2ZHB A;  4M2Y A;  1ZJN A;  7ICV A;  3UQ2 A;  1MIV A;  4XQ7 A;  7ICO A;  4KLG A;  2BE3 A;  4UBC A;  2ZH9 A;  2ISO A;  3ISB A;  1JQR A;  1BPZ A;  3RJF A;  4K4G A;  2M2V A;  4LVS A;  5J0R A;  3HX0 A;  3RH5 A;  8ICP A;  4E7X A;  5CJ7 A;  9ICB A;  4RQ3 A;  5HR9 A;  4GXI A;  7ICE A;  2BCV A;  4KLJ A;  4FH3 A;  1NOM A;  4UBB A;  1ZQE A;  4RPX A;  2IHM A;  1KNY A;  4I28 A;  7ICL A;  2ZH2 A;  3OUY A;  4I29 A;  5HRD A;  1KDH A;  2PFP A;  4K4I A;  3HWT A;  4RQ6 A;  3AUO A;  1TVA A;  5DB9 A;  8ICK A;  4NKU A;  5J0Q A;  2PBE A;  4P2H A;  1UET A;  7ICM A;  4I2G A;  5DB8 A;  5J2C A;  1MIW A;  1ZJM A;  1ZQS A;  2ZH8 A;  3K75 D;  3LK9 A;  3AU6 A;  4I2I A;  5DDY A;  5DB6 A;  1MQ2 A;  1ZQF A;  2PFN A;  2GWS A;  4KLD A;  3C5G A;  4QZI A;  2ZH3 A;  5HRE A;  4UD4 A;  5J0S A;  4RQ4 A;  5III A;  5CHG A;  4R66 A;  2FMS A;  3OVA A;  4QZE A;  8ICN A;  1VJ7 A;  1TFW A;  8ICI A;  3RH6 A;  7ICQ A;  4PGX A;  5J2H A;  4P4M A;  4MF2 A;  7ICS A;  3JPR A;  3TFR A;  1JMS A;  4Z6F A;  4RPZ A;  3MBY A;  1ZQO A;  4PGY A;  1ZQU A;  9ICG A;  8ICZ A;  2BPC A;  1TV9 A;  3UQ0 A;  7ICJ A;  5D49 A;  3C5F A;  4PHE A;  8ICY A;  4Z6C A;  9ICV A;  5HRF A;  1HUZ A;  2DR5 A;  3JYY A;  4M47 A;  4F5P A;  9ICK A;  2DR9 A;  5HRI A; 
#chains in the Genus database with same CATH topology
 9ICU A;  3AQM A;  4NXZ A;  4IQW A;  4R65 A;  4X4O A;  4QZB A;  3H37 A;  3OWG A;  4N7R A;  3JPQ A;  4JLZ A;  3JPO A;  5BOM A;  3EF2 A;  9ICA A;  3GDX A;  1KEJ A;  3H39 A;  4WC6 A;  1BPX A;  9ICS A;  5DB7 A;  4YD2 A;  5HC9 A;  3ER9 B;  1JN3 A;  4OAF A;  2HN2 A;  3L9D A;  5J2B A;  1HUO A;  4QZD A;  5J2I A;  4X4Q A;  5D61 A;  2PFQ A;  8ICQ A;  2BPF A;  1XSL A;  4M9N A;  4FHX A;  3ISD A;  1ZQH A;  5DDM A;  3MGI A;  5J2D A;  4QZF A;  4YD1 A;  3PNC A;  1ZQZ A;  1F5A A;  4F5N A;  4I2B A;  3RJI A;  4Z6D A;  4NLN A;  4DOA A;  2DRA A;  4TUP A;  5J0Y A;  3WFS C;  2O5A A;  4EBK A;  4KLF A;  2BBJ A;  4KLL A;  5IIK A;  5DEC A;  4TUR A;  4KLQ A;  4RPY A;  1RPL A;  8ICS A;  2ID1 A;  4XA5 A;  1BPY A;  1PX5 A;  1XSN A;  4RQ8 A;  4DOB A;  1ZQW A;  1ZQP A;  1MIY A;  4UB3 A;  4AT9 A;  5B3Q A;  3HJ1 A;  3V7L A;  3C2K A;  3UXP A;  4RWP A;  3AU2 A;  5IIN A;  5DBB A;  4XQ8 A;  5HHH A;  4UAY A;  4KLM A;  1R89 A;  2FMQ A;  1MQ3 A;  9ICC A;  4WBY A;  3UXO A;  1YLQ A;  5CHE A;  4I0U A;  3OV7 A;  4M5D A;  4GXJ A;  9ICM A;  4O5K A;  1ZQX A;  2IHO A;  2BCQ A;  8ICT A;  4M9H A;  8ICM A;  9ICI A;  4AT7 A;  5J0U A;  3WFR E;  3LQC B;  2DRB A;  2ZH5 A;  2FMP A;  4WC5 A;  4S3N A;  4RWO A;  4FH5 A;  4TUS A;  3V7K A;  4X5V A;  4NM1 A;  9ICT A;  2BPG A;  1ZQA A;  7ICK A;  4KLE A;  7ICI A;  5J2E A;  3C2L A;  2ZH4 A;  4MKP A;  8ICJ A;  1ZQC A;  1BPE A;  4JWN A;  4NM2 A;  5DBC A;  4F5R A;  3JZ0 A;  9ICX A;  3B0X A;  5HRB A;  5CA7 A;  2BCR A;  4WC1 A;  4X0B A;  8ICR A;  9ICF A;  1JAJ A;  8ICL A;  9ICQ A;  2GAF D;  1V4A A;  5CP2 A;  5J0P A;  3C66 A;  4DOC A;  5CWR A;  4OAH A;  4YMO A;  3NYB A;  4M9J A;  3OVS A;  3AQN A;  3AQK A;  1XSP A;  4RQ7 A;  8ICE A;  4O9M A;  9ICW A;  5F2V O;  4I2C A;  4RQ0 A;  4NLK A;  2VAN A;  1OU5 A;  5DED A;  5BOL A;  4KLH A;  3H3A A;  3RJJ A;  5J0X A;  1TFY A;  4GXK A;  7ICN A;  4EGW A;  3ERC C;  5D46 A;  4X4P A;  4PHA A;  4QZC A;  4LEV A;  2PFO A;  5J0W A;  4EP7 A;  5J0T A;  5J2G A;  1ZQQ A;  4PHP A;  8ICF A;  4I2J A;  9ICP A;  4I27 A;  4UB1 A;  3NVO A;  3PMN A;  4YN4 A;  4EV6 A;  1R8B A;  1Q78 A;  2IUB A;  1ZQY A;  5EOZ A;  3WFO A;  1WOT A;  1ZQV A;  4QZ8 A;  5BPC A;  1FA0 A;  4RT2 A;  4WC4 A;  4O68 A;  4X4U A;  4PGQ A;  4HX0 A;  4UD5 A;  3ISC A;  2ZHA A;  2BCS A;  4I2H A;  8ICX A;  1ZQK A;  3UPS A;  1ZQG A;  3ER8 C;  7ICF A;  2W9M A;  4NY8 A;  2HHP A;  4LZG A;  4WQL A;  1ZQT A;  5J2J A;  5J2K A;  4YMN A;  4UAW A;  4M9G A;  4QZG A;  5J2F A;  4FHY A;  4RWN A;  3JPP A;  4IQT A;  3RJE A;  4FO6 A;  2BCU A;  2Q66 A;  8ICH A;  4NXT A;  5CR0 A;  4O5E A;  5CFS A;  5IIJ A;  8ICV A;  4NKT A;  4O5C A;  4E80 A;  3H38 A;  3NWI A;  5J29 A;  3HW8 A;  3HJ4 A;  1ZQR A;  4I2E A;  7ICP A;  2O1P A;  2ZH7 A;  4KB6 A;  5DBA A;  4FO1 A;  2DR7 A;  5J0O A;  8ICB A;  4M9L A;  2ISP A;  8ICG A;  4I2D A;  4WC3 A;  2B4V A;  4I2F A;  4WCW A;  2FCL A;  1ZQD A;  4AT8 A;  3HIY A;  3OUY B;  2DR8 A;  4UAZ A;  4X4T A;  3JPT A;  4LT6 A;  4RQ5 A;  4OAG A;  2DVI A;  4EBJ A;  7ICT A;  4YCX A;  3WFQ E;  4JWM A;  4M04 A;  1RZT A;  1UEU A;  4K4H A;  4AT8 B;  4R63 A;  2ZH6 A;  9ICJ A;  5HRL A;  4K9A A;  5CB1 A;  3MDA A;  9ICL A;  3PML A;  1ZQN A;  3CK6 A;  4RQ1 A;  1Q79 A;  3MGH A;  8ICO A;  1ZQJ A;  4PPX A;  4K9B A;  4QZH A;  1ZQI A;  4FHV A;  5HRK A;  4X4S A;  4RT3 A;  4ATB A;  4MFA A;  4LEY A;  4O67 A;  2RFF A;  4YMM A;  3V72 A;  4KLT A;  5HRG A;  4M0A A;  3C18 A;  5IIO A;  3UPQ A;  3B0Y A;  3RJG A;  1R8C A;  1NO5 A;  4KLU A;  8ICA A;  4LEZ A;  2B51 A;  5J2A A;  3C2M A;  2I9G A;  4QZ9 A;  4JLX A;  8ICC A;  8ICW A;  4UB5 A;  4AT9 B;  4NXU A;  1UEV A;  4QZA A;  4KLO A;  2NRK A;  4K8V A;  1BPB A;  3AQL A;  3NKU A;  4P4O A;  4NXX A;  2PXI A;  3OGU A;  4IQU A;  4AT7 B;  4XRH A;  4WQK A;  4KLS A;  1VFG A;  5TZV A;  4F5O A;  7ICR A;  3PHZ A;  4X0A A;  4XUS A;  3TFS A;  2M2T A;  9ICO A;  4LZD A;  4Z6E A;  4MFF A;  9ICE A;  4PH5 A;  3RJH A;  3UXN A;  4X4V A;  9ICN A;  7ICG A;  1ZQM A;  5HHI A;  3RH4 A;  4KLI A;  1ZQL A;  4IG8 A;  2P66 A;  4IQV A;  5HRH A;  2M2W A;  3V7J A;  4E8F A;  1R8A A;  4WC7 A;  3JPS A;  4TUQ A;  4F5Q A;  4I2A A;  5B3P A;  4WBZ A;  3JPN A;  1ZQB A;  5D4B A;  9ICH A;  4WC0 A;  4P4P A;  4WC2 A;  5IIL A;  5DKW A;  4DO9 A;  4XJE A;  3WFP A;  4MFC A;  4FHP A;  4NLZ A;  4X4N A;  1BPD A;  4R64 A;  9ICR A;  4KM5 A;  3MDC A;  7ICU A;  4ATB B;  4RQ2 A;  4UB4 A;  4O69 A;  2M2U A;  8ICU A;  5IIM A;  4PHD A;  2ZH1 A;  4X4R A;  4MF8 A;  3RJK A;  5CFU A;  7ICH A;  3OVB A;  4EED A;  4UB2 A;  4RWQ A;  4WOY A;  4FHW A;  2ZHB A;  4M2Y A;  1ZJN A;  7ICV A;  3UQ2 A;  1MIV A;  4XQ7 A;  7ICO A;  4KLG A;  2BE3 A;  4UBC A;  2ZH9 A;  2ISO A;  4NXW A;  3ISB A;  1JQR A;  1BPZ A;  3RJF A;  4K4G A;  2M2V A;  4LVS A;  5J0R A;  3HX0 A;  3RH5 A;  8ICP A;  4E7X A;  5CJ7 A;  9ICB A;  4RQ3 A;  5HR9 A;  4GXI A;  3JCF A;  7ICE A;  2BCV A;  4KLJ A;  5JTG A;  4FH3 A;  4LEW A;  1NOM A;  4UBB A;  2EWR A;  1ZQE A;  4RPX A;  2IHM A;  1KNY A;  4I28 A;  7ICL A;  2ZH2 A;  3OUY A;  4I29 A;  5HRD A;  1KDH A;  2PFP A;  4K4I A;  5D62 A;  3HWT A;  1GPJ A;  4RQ6 A;  4K99 A;  3AUO A;  1TVA A;  4EEB A;  3K7D A;  5DB9 A;  8ICK A;  2B56 A;  4NKU A;  5J0Q A;  2PBE A;  4P2H A;  1UET A;  7ICM A;  4I2G A;  5CFT A;  5DB8 A;  4WH5 A;  5J2C A;  1MIW A;  1ZJM A;  2GA9 D;  1ZQS A;  2ZH8 A;  3K75 D;  3LK9 A;  3AU6 A;  4I2I A;  5DDY A;  5DB6 A;  1MQ2 A;  1ZQF A;  2PFN A;  2GWS A;  4KLD A;  3C5G A;  4QZI A;  2ZH3 A;  5HRE A;  3MCR A;  5D63 A;  4UD4 A;  5J0S A;  4RQ4 A;  5III A;  5CHG A;  4R66 A;  2FMS A;  3OVA A;  4QZE A;  8ICN A;  1VJ7 A;  1TFW A;  4K98 A;  8ICI A;  3RH6 A;  7ICQ A;  4PGX A;  5J2H A;  4P4M A;  4MF2 A;  7ICS A;  4NXV A;  3JPR A;  3TFR A;  1JMS A;  4Z6F A;  4RPZ A;  2HN1 A;  4K96 A;  3MBY A;  1ZQO A;  4PGY A;  1ZQU A;  9ICG A;  8ICZ A;  2BPC A;  1TV9 A;  4O6A A;  3UQ0 A;  7ICJ A;  5D49 A;  3C5F A;  4PHE A;  8ICY A;  4Z6C A;  9ICV A;  5HRF A;  1HUZ A;  4K97 A;  2DR5 A;  4OAI Z;  3JYY A;  4M47 A;  4F5P A;  9ICK A;  2BBH A;  2DR9 A;  5HRI A; 
#chains in the Genus database with same CATH homology
 9ICU A;  3AQM A;  4NXZ A;  4IQW A;  4R65 A;  4X4O A;  4QZB A;  3H37 A;  3JPQ A;  3JPO A;  5BOM A;  9ICA A;  3GDX A;  1KEJ A;  3H39 A;  4WC6 A;  1BPX A;  9ICS A;  5DB7 A;  4YD2 A;  5HC9 A;  1JN3 A;  5J2B A;  3L9D A;  1HUO A;  4QZD A;  5J2I A;  4X4Q A;  2PFQ A;  8ICQ A;  2BPF A;  1XSL A;  4M9N A;  4FHX A;  3ISD A;  1ZQH A;  5DDM A;  3MGI A;  5J2D A;  4QZF A;  4YD1 A;  3PNC A;  1ZQZ A;  1F5A A;  4F5N A;  4I2B A;  3RJI A;  4Z6D A;  4NLN A;  4DOA A;  2DRA A;  4TUP A;  5J0Y A;  3WFS C;  2O5A A;  4EBK A;  4KLF A;  4KLL A;  5IIK A;  5DEC A;  4TUR A;  4KLQ A;  4RPY A;  1RPL A;  8ICS A;  2ID1 A;  4XA5 A;  1BPY A;  1PX5 A;  1XSN A;  4RQ8 A;  4DOB A;  1ZQW A;  1ZQP A;  1MIY A;  4UB3 A;  4AT9 A;  3HJ1 A;  3V7L A;  3C2K A;  3UXP A;  4RWP A;  3AU2 A;  5IIN A;  5DBB A;  4XQ8 A;  5HHH A;  4UAY A;  4KLM A;  1R89 A;  2FMQ A;  1MQ3 A;  9ICC A;  4WBY A;  3UXO A;  1YLQ A;  3OV7 A;  4M5D A;  4GXJ A;  9ICM A;  4O5K A;  1ZQX A;  2BCQ A;  8ICT A;  4M9H A;  8ICM A;  9ICI A;  4AT7 A;  5J0U A;  3WFR E;  3LQC B;  2DRB A;  2ZH5 A;  2FMP A;  4WC5 A;  4S3N A;  4RWO A;  4FH5 A;  4TUS A;  3V7K A;  4X5V A;  4NM1 A;  9ICT A;  2BPG A;  1ZQA A;  7ICK A;  4KLE A;  7ICI A;  5J2E A;  3C2L A;  2ZH4 A;  8ICJ A;  1ZQC A;  1BPE A;  4JWN A;  4NM2 A;  5DBC A;  4F5R A;  3JZ0 A;  9ICX A;  3B0X A;  5HRB A;  5CA7 A;  2BCR A;  4WC1 A;  4X0B A;  8ICR A;  9ICF A;  1JAJ A;  8ICL A;  9ICQ A;  5CP2 A;  1V4A A;  5J0P A;  3C66 A;  4DOC A;  5CWR A;  4YMO A;  3NYB A;  4M9J A;  3OVS A;  3AQN A;  3AQK A;  1XSP A;  4RQ7 A;  8ICE A;  4O9M A;  9ICW A;  5F2V O;  4I2C A;  4RQ0 A;  4NLK A;  2VAN A;  1OU5 A;  5DED A;  5BOL A;  4KLH A;  3H3A A;  3RJJ A;  5J0X A;  1TFY A;  4GXK A;  7ICN A;  5D46 A;  4X4P A;  4PHA A;  4QZC A;  2PFO A;  5J0W A;  4EP7 A;  5J0T A;  5J2G A;  1ZQQ A;  4PHP A;  8ICF A;  4I2J A;  9ICP A;  4I27 A;  4UB1 A;  3PMN A;  4YN4 A;  1R8B A;  1Q78 A;  1ZQY A;  5EOZ A;  3WFO A;  1WOT A;  1ZQV A;  4QZ8 A;  4RT2 A;  1FA0 A;  5BPC A;  4WC4 A;  4X4U A;  4PGQ A;  4UD5 A;  3ISC A;  2ZHA A;  2BCS A;  4I2H A;  8ICX A;  1ZQK A;  3UPS A;  1ZQG A;  7ICF A;  2W9M A;  4NY8 A;  2HHP A;  4LZG A;  1ZQT A;  5J2J A;  5J2K A;  4YMN A;  4UAW A;  4M9G A;  4QZG A;  5J2F A;  4FHY A;  4RWN A;  3JPP A;  4IQT A;  3RJE A;  4FO6 A;  2BCU A;  2Q66 A;  8ICH A;  5CR0 A;  4O5E A;  5IIJ A;  8ICV A;  4NKT A;  4O5C A;  4E80 A;  3H38 A;  5J29 A;  3HW8 A;  3HJ4 A;  1ZQR A;  4I2E A;  7ICP A;  2O1P A;  2ZH7 A;  5DBA A;  2DR7 A;  5J0O A;  8ICB A;  4M9L A;  2ISP A;  8ICG A;  4I2D A;  4WC3 A;  4I2F A;  4WCW A;  1ZQD A;  4AT8 A;  3HIY A;  3OUY B;  2DR8 A;  4UAZ A;  4X4T A;  3JPT A;  4LT6 A;  4RQ5 A;  2DVI A;  4EBJ A;  7ICT A;  4YCX A;  3WFQ E;  4JWM A;  4M04 A;  1RZT A;  1UEU A;  4K4H A;  4AT8 B;  4R63 A;  2ZH6 A;  9ICJ A;  5HRL A;  5CB1 A;  3MDA A;  9ICL A;  3PML A;  1ZQN A;  4RQ1 A;  1Q79 A;  3MGH A;  8ICO A;  1ZQJ A;  4PPX A;  4QZH A;  1ZQI A;  4FHV A;  5HRK A;  4X4S A;  4RT3 A;  4ATB A;  4MFA A;  2RFF A;  4YMM A;  3V72 A;  4KLT A;  5HRG A;  4M0A A;  3C18 A;  5IIO A;  3UPQ A;  3B0Y A;  3RJG A;  1R8C A;  1NO5 A;  4KLU A;  8ICA A;  5J2A A;  3C2M A;  2I9G A;  4QZ9 A;  8ICC A;  8ICW A;  4UB5 A;  4AT9 B;  1UEV A;  4QZA A;  4KLO A;  2NRK A;  1BPB A;  3AQL A;  4P4O A;  2PXI A;  3OGU A;  4IQU A;  4AT7 B;  4XRH A;  4KLS A;  1VFG A;  5TZV A;  4F5O A;  7ICR A;  4X0A A;  4XUS A;  3TFS A;  2M2T A;  9ICO A;  4LZD A;  4Z6E A;  4MFF A;  9ICE A;  4PH5 A;  3RJH A;  3UXN A;  4X4V A;  9ICN A;  7ICG A;  1ZQM A;  5HHI A;  3RH4 A;  4KLI A;  1ZQL A;  4IG8 A;  2P66 A;  4IQV A;  5HRH A;  2M2W A;  3V7J A;  4E8F A;  1R8A A;  4WC7 A;  3JPS A;  4TUQ A;  4F5Q A;  4I2A A;  4WBZ A;  3JPN A;  1ZQB A;  5D4B A;  9ICH A;  4WC0 A;  4P4P A;  4WC2 A;  5IIL A;  5DKW A;  4DO9 A;  3WFP A;  4MFC A;  4FHP A;  4NLZ A;  4X4N A;  1BPD A;  4R64 A;  9ICR A;  3MDC A;  7ICU A;  4ATB B;  4RQ2 A;  4UB4 A;  2M2U A;  8ICU A;  5IIM A;  4PHD A;  2ZH1 A;  4X4R A;  4MF8 A;  3RJK A;  7ICH A;  3OVB A;  4UB2 A;  4RWQ A;  4FHW A;  2ZHB A;  4M2Y A;  1ZJN A;  7ICV A;  3UQ2 A;  1MIV A;  4XQ7 A;  7ICO A;  4KLG A;  2BE3 A;  4UBC A;  2ZH9 A;  2ISO A;  3ISB A;  1JQR A;  1BPZ A;  3RJF A;  4K4G A;  2M2V A;  4LVS A;  5J0R A;  3HX0 A;  3RH5 A;  8ICP A;  4E7X A;  5CJ7 A;  9ICB A;  4RQ3 A;  5HR9 A;  4GXI A;  7ICE A;  2BCV A;  4KLJ A;  4FH3 A;  1NOM A;  4UBB A;  1ZQE A;  4RPX A;  2IHM A;  1KNY A;  4I28 A;  7ICL A;  2ZH2 A;  3OUY A;  4I29 A;  5HRD A;  1KDH A;  2PFP A;  4K4I A;  3HWT A;  4RQ6 A;  3AUO A;  1TVA A;  5DB9 A;  8ICK A;  4NKU A;  5J0Q A;  2PBE A;  4P2H A;  1UET A;  7ICM A;  4I2G A;  5DB8 A;  5J2C A;  1MIW A;  1ZJM A;  1ZQS A;  2ZH8 A;  3K75 D;  3LK9 A;  3AU6 A;  4I2I A;  5DDY A;  5DB6 A;  1MQ2 A;  1ZQF A;  2PFN A;  2GWS A;  4KLD A;  3C5G A;  4QZI A;  2ZH3 A;  5HRE A;  4UD4 A;  5J0S A;  4RQ4 A;  5III A;  5CHG A;  4R66 A;  2FMS A;  3OVA A;  4QZE A;  8ICN A;  1VJ7 A;  1TFW A;  8ICI A;  3RH6 A;  7ICQ A;  4PGX A;  5J2H A;  4P4M A;  4MF2 A;  7ICS A;  3JPR A;  3TFR A;  1JMS A;  4Z6F A;  4RPZ A;  3MBY A;  1ZQO A;  4PGY A;  1ZQU A;  9ICG A;  8ICZ A;  2BPC A;  1TV9 A;  3UQ0 A;  7ICJ A;  5D49 A;  3C5F A;  4PHE A;  8ICY A;  4Z6C A;  9ICV A;  5HRF A;  1HUZ A;  2DR5 A;  3JYY A;  4M47 A;  4F5P A;  9ICK A;  2DR9 A;  5HRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...