4NKTA

Structure of cid1 in complex with the utp analog umpnpp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 111
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nktA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nktA02
4KLGA 1ZQOA 4P4MA 2ZH1A 4XRHA 1BPZA 2FMQA 3OUYB 1MIVA 4X4QA 4XA5A 4Z6DA 4JWMA 4UB3A 3V72A 2NRKA 4X5VA 7ICQA 3H38A 4KLSA 2BCRA 5CHGA 8ICZA 3AUOA 3OVAA 3C2MA 3RJGA 3HJ1A 4NKTA 1Q78A 7ICPA 5CB1A 5BOLA 4QZFA 3JPSA 4QZHA 4LZGA 4AT8A 4RQ4A 4E8FA 3WFOA 5HRDA 4P4PA 1PX5A 4QZ9A 7ICMA 5J2EA 9ICVA 3JPQA 3C5GA 4M9JA 8ICWA 4IG8A 8ICMA 4O9MA 2PFQA 3PNCA 4I2GA 9ICLA 1JQRA 4MFCA 4X0BA 1ZQRA 4LT6A 4UAYA 9ICWA 1ZQHA 2BCVA 9ICEA 4RQ7A 3LQCB 4RQ2A 5J0WA 5CJ7A 4IQVA 4AT7A 5J29A 3JPTA 2FMPA 7ICTA 1MQ3A 1JN3A 4PGYA 5HR9A 2ZH6A 3LK9A 4RWNA 3C2LA 4X4TA 9ICOA 3H37A 3RJEA 3JPPA 1MQ2A 4KLFA 4TUSA 4KLMA 5J2KA 2HHPA 2ZH7A 1MIWA 5IIIA 1ZQLA 4EP7A 5J0UA 4TURA 4QZEA 1R8AA 7ICSA 5J0QA 1NO5A 4R63A 1ZQAA 8ICUA 4PH5A 4PPXA 7ICKA 4RWQA 5IIMA 9ICPA 5IIKA 3OVSA 3MGIA 2ZH4A 4F5OA 3HJ4A 5J2GA 5J0SA 7ICVA 3JYYA 4O5KA 4NKUA 5HREA 4IQWA 4NM1A 9ICAA 5BPCA 4M9NA 4I2JA 3AU2A 9ICJA 1TFWA 8ICHA 4FHYA 1OU5A 4PGQA 7ICGA 2DRAA 4I2AA 1UEUA 5J2FA 2PFOA 9ICIA 1BPYA 2B4VA 3AQMA 4E80A 3RH4A 2BCSA 4LVSA 1ZQPA 7ICRA 4Z6EA 4M2YA 7ICUA 8ICXA 5DB6A 4MF8A 2ZHBA 3OUYA 9ICRA 5DKWA 4EBKA 4AT9A 4FHPA 3JPNA 1R89A 4IQUA 3TFRA 2W9MA 4YCXA 8ICLA 3H39A 2M2WA 4F5RA 4YD1A 5EOZA 1ZQIA 4WC2A 3RH6A 4Z6FA 4PHPA 5DB9A 1R8CA 2RFFA 1HUOA 5J0XA 5J2JA 4EBJA 4GXKA 4NLNA 4I2HA 5HC9A 4TUPA 3WFRE 5IIJA 4I2DA 8ICYA 1WOTA 4I2BA 4MF2A 7ICJA 4YMNA 5D49A 1ZQFA 4QZ8A 4PGXA 3L9DA 5IIOA 4DOBA 1RZTA 4NLKA 5J0PA 3PMLA 1ZQQA 4PHEA 2ZH5A 4ATBB 5CWRA 1FA0A 9ICUA 4UB1A 1HUZA 4DOCA 5TZVA 4FH3A 2DR8A 4IQTA 4PHAA 5HRKA 3UXOA 5J0YA 4UAZA 4P4OA 4X4SA 2BCUA 1ZQUA 2B56A 8ICFA 2B51A 5HRIA 3UPQA 4I29A 4RT3A 5DB7A 1YLQA 5J2CA 3B0XA 5J0OA 4E7XA 5J2DA 1ZQMA 4UB5A 9ICBA 3V7JA 2BPGA 2VANA 3UPSA 4RQ1A 4RT2A 9ICFA 4I28A 2PFPA 1RPLA 2PBEA 5HRBA 3RJKA 1F5AA 4X4RA 4UBCA 4PHDA 7ICFA 4WC5A 8ICEA 8ICIA 4X4VA 2M2VA 1TVAA 4X4NA 9ICKA 4UD4A 4F5PA 4AT8B 9ICSA 5IILA 4X4UA 3GDXA 1ZQNA 2ISOA 3RH5A 1UETA 9ICMA 2I9GA 4YMOA 4S3NA 4QZGA 1BPBA 4P2HA 8ICNA 4M9GA 1ZQSA 3AQLA 4MFFA 4WC0A 1BPXA 3WFSC 4RPYA 9ICNA 5J0TA 4I2IA 4FH5A 9ICGA 4WC7A 3HIYA 5DBCA 1XSNA 8ICCA 4KLJA 4WCWA 3RJFA 2GWSA 4NM2A 2M2TA 3ISBA 1MIYA 7ICIA 1KDHA 9ICHA 3RJJA 4M5DA 1BPEA 4X4OA 5CR0A 1ZQTA 1ZQDA 4KLUA 4FO6A 4I27A 4NLZA 7ICEA 8ICBA 9ICXA 4XQ7A 4F5QA 4XQ8A 4QZIA 3AQKA 7ICNA 8ICOA 4RQ0A 3HX0A 5DBBA 1ZQXA 4XUSA 4KLHA 9ICTA 1TV9A 1VJ7A 1ZJNA 4KLDA 1BPDA 2DVIA 3UXNA 4GXIA 4WC3A 1VFGA 4UB2A 4R65A 4FHVA 9ICCA 5HRHA 1TFYA 2BE3A 4NXZA 8ICVA 2ZH8A 1ZQEA 3OV7A 2PXIA 4F5NA 4RQ5A 1JAJA 3OGUA 2ZH2A 3C5FA 3H3AA 3JPRA 4TUQA 1XSLA 7ICLA 3WFQE 3ISCA 2O5AA 2DRBA 4NY8A 1KEJA 3C66A 4KLQA 3V7KA 4K4IA 4AT9B 3OVBA 4WC6A 1ZQVA 4R66A 5DEDA 5F2VO 4KLOA 4RWPA 1V4AA 4FHXA 7ICHA 4UBBA 5J0RA 1XSPA 3UXPA 3JZ0A 1ZQYA 5CP2A 1UEVA 2DR5A 2PFNA 3RJHA 3TFSA 4WBYA 3V7LA 5J2HA 4RPXA 4QZAA 1ZQCA 5HRFA 4UB4A 2IHMA 4M9LA 1R8BA 9ICQA 2M2UA 3JPOA 3UQ2A 1ZQJA 2P66A 3PMNA 5HHHA 4K4HA 2ID1A 4RWOA 4YMMA 4JWNA 3MDCA 1ZQBA 3ISDA 2ZH3A 8ICPA 4X0AA 3MGHA 2DR9A 2Q66A 4WBZA 3C2KA 4KLTA 4I2FA 3MDAA 3RJIA 4QZCA 4RQ6A 5J2BA 5BOMA 3MBYA 3K75D 5CA7A 4RQ8A 1KNYA 2FMSA 4R64A 4O5CA 8ICSA 3AQNA 3HWTA 4KLLA 4Z6CA 4UD5A 4FHWA 1ZJMA 4AT7B 4DOAA 4KLIA 4LZDA 4M47A 8ICRA 4RQ3A 5DECA 5DB8A 1ZQGA 4DO9A 4I2EA 8ICAA 3WFPA 5DDMA 4QZBA 2ZHAA 3AU6A 2BCQA 4WC4A 5DBAA 1ZQKA 3B0YA 4I2CA 4X4PA 3HW8A 4GXJA 5DDYA 4M04A 4RPZA 4YN4A 2BPCA 4UAWA 5D4BA 4M9HA 4O5EA 4WC1A 7ICOA 4QZDA 2BPFA 4KLEA 5J2IA 1Q79A 3NYBA 4YD2A 1ZQWA 5HRLA 8ICQA 8ICGA 5IINA 1NOMA 5D46A 2O1PA 4M0AA 3UQ0A 2ZH9A 2ISPA 8ICTA 4K4GA 3C18A 2DR7A 8ICJA 8ICKA 5HRGA 4ATBA 1ZQZA 5HHIA 1JMSA 5J2AA 4MFAA
chains in the Genus database with same CATH superfamily
4KLGA 1ZQOA 2ZH1A 4P4MA 4WQLA 2HN1A 4XRHA 4WH5A 1BPZA 2FMQA 3JCFA 3OUYB 1MIVA 4X4QA 4XA5A 5CFSA 4Z6DA 4JWMA 4UB3A 3V72A 2NRKA 4X5VA 7ICQA 3H38A 3NWIA 4KLSA 2BCRA 5CHGA 8ICZA 3AUOA 3OVAA 2BBHA 3C2MA 3RJGA 3HJ1A 4NKTA 1Q78A 7ICPA 5CB1A 5BOLA 4QZFA 3JPSA 4QZHA 4LZGA 4AT8A 4RQ4A 4E8FA 3WFOA 5HRDA 4P4PA 1PX5A 4QZ9A 7ICMA 5J2EA 9ICVA 3JPQA 3C5GA 4M9JA 8ICWA 4O67A 4IG8A 4O9MA 8ICMA 2PFQA 3PNCA 4I2GA 9ICLA 3ER9B 1JQRA 4MFCA 4X0BA 1ZQRA 4LT6A 4UAYA 9ICWA 1ZQHA 5CFTA 2BCVA 9ICEA 4RQ7A 3LQCB 4EGWA 4RQ2A 5J0WA 5CJ7A 4AT7A 4IQVA 5CFUA 5J29A 3JPTA 2FMPA 7ICTA 1MQ3A 1JN3A 4PGYA 2ZH6A 5HR9A 3LK9A 4RWNA 3C2LA 4X4TA 9ICOA 3H37A 3RJEA 4K99A 2IUBA 3JPPA 4K96A 1MQ2A 4KLFA 4TUSA 4KLMA 5J2KA 2HHPA 2ZH7A 1MIWA 5IIIA 1ZQLA 4NXWA 4EP7A 5J0UA 4TURA 4QZEA 1R8AA 7ICSA 5J0QA 1NO5A 4R63A 1ZQAA 8ICUA 5D63A 4PH5A 4PPXA 7ICKA 4RWQA 5IIMA 9ICPA 5IIKA 5JTGA 3OVSA 3MGIA 4WOYA 2BBJA 2ZH4A 4F5OA 3HJ4A 3MCRA 5J0SA 5J2GA 7ICVA 3JYYA 4O5KA 4NKUA 5HREA 4IQWA 4NM1A 9ICAA 5BPCA 5B3PA 4M9NA 4I2JA 3AU2A 3EF2A 9ICJA 1TFWA 8ICHA 4FHYA 1OU5A 4PGQA 4OAHA 2DRAA 7ICGA 4I2AA 1UEUA 5J2FA 2PFOA 3PHZA 9ICIA 1BPYA 2B4VA 4O68A 3AQMA 4E80A 3RH4A 2BCSA 4LVSA 1ZQPA 3CK6A 7ICRA 4Z6EA 4M2YA 7ICUA 8ICXA 5DB6A 2ZHBA 4MF8A 3OUYA 4I0UA 9ICRA 5DKWA 4EBKA 4AT9A 4FHPA 3JPNA 1R89A 4IQUA 3TFRA 2W9MA 4YCXA 8ICLA 3H39A 2M2WA 3ER8C 4F5RA 4YD1A 5EOZA 1ZQIA 4WC2A 3RH6A 4Z6FA 4PHPA 5DB9A 5D62A 1R8CA 2RFFA 1HUOA 5J0XA 5J2JA 4EBJA 4GXKA 4NLNA 4EV6A 4I2HA 5HC9A 4TUPA 3WFRE 5IIJA 4I2DA 8ICYA 1WOTA 4I2BA 4MF2A 7ICJA 4YMNA 5D49A 4KM5A 1ZQFA 4QZ8A 4PGXA 4N7RA 3L9DA 5IIOA 4DOBA 1RZTA 4NLKA 5J0PA 3PMLA 1ZQQA 4PHEA 2ZH5A 4ATBB 5CWRA 1FA0A 9ICUA 4UB1A 1HUZA 4DOCA 5TZVA 4FH3A 2DR8A 5HRKA 4OAIZ 4IQTA 4PHAA 3UXOA 5J0YA 4UAZA 4LEWA 4P4OA 4X4SA 2BCUA 1ZQUA 2B56A 3ERCC 8ICFA 2B51A 5HRIA 4K97A 3UPQA 4I29A 4RT3A 5DB7A 1YLQA 5J2CA 3B0XA 5J0OA 4E7XA 4HX0A 5J2DA 1ZQMA 4UB5A 9ICBA 3V7JA 2BPGA 2VANA 3UPSA 3NKUA 4RQ1A 4RT2A 9ICFA 4I28A 2PFPA 1RPLA 2PBEA 5HRBA 3RJKA 4K8VA 1F5AA 4X4RA 4UBCA 4PHDA 7ICFA 4WC5A 8ICEA 8ICIA 4X4VA 2M2VA 1TVAA 4NXTA 4X4NA 9ICKA 4UD4A 4F5PA 4NXXA 4AT8B 9ICSA 3K7DA 5IILA 4X4UA 3GDXA 1ZQNA 2ISOA 3RH5A 1UETA 9ICMA 2I9GA 4YMOA 4S3NA 4QZGA 1BPBA 4P2HA 8ICNA 4M9GA 1ZQSA 4OAGA 3AQLA 4MFFA 4WC0A 1BPXA 3WFSC 4RPYA 2EWRA 9ICNA 5J0TA 4I2IA 4FH5A 9ICGA 4WC7A 3HIYA 5DBCA 1XSNA 8ICCA 4MKPA 4KLJA 4WCWA 3RJFA 4XJEA 2GWSA 4JLZA 4NM2A 2M2TA 3ISBA 1MIYA 7ICIA 1KDHA 9ICHA 3RJJA 4M5DA 1BPEA 4X4OA 5CR0A 1ZQTA 1ZQDA 4KLUA 4FO6A 4I27A 4NLZA 7ICEA 4NXVA 8ICBA 9ICXA 4XQ7A 2HN2A 4F5QA 4XQ8A 4K98A 4QZIA 3AQKA 7ICNA 8ICOA 4RQ0A 3HX0A 2IHOA 5DBBA 4EEDA 1ZQXA 4XUSA 4KLHA 9ICTA 1TV9A 1VJ7A 1ZJNA 4KLDA 1BPDA 2DVIA 3UXNA 4GXIA 4WC3A 1VFGA 4UB2A 4R65A 4FHVA 9ICCA 5HRHA 1TFYA 2BE3A 4NXZA 8ICVA 2ZH8A 1ZQEA 3OV7A 2PXIA 4F5NA 4RQ5A 1JAJA 3OGUA 2ZH2A 3C5FA 3H3AA 3JPRA 4NXUA 4TUQA 1XSLA 7ICLA 3WFQE 3ISCA 4LEYA 2O5AA 2DRBA 4NY8A 1KEJA 3C66A 4KLQA 3V7KA 4K4IA 4AT9B 3OVBA 4WC6A 1ZQVA 4OAFA 4R66A 5DEDA 5F2VO 4KLOA 4RWPA 1V4AA 4FHXA 7ICHA 4UBBA 2FCLA 5J0RA 1XSPA 3UXPA 3JZ0A 4LEZA 1ZQYA 3NVOA 1UEVA 5CP2A 2DR5A 2PFNA 3RJHA 3TFSA 4WBYA 4EEBA 3V7LA 5J2HA 4RPXA 4QZAA 1ZQCA 5HRFA 4UB4A 2IHMA 4M9LA 1R8BA 9ICQA 2M2UA 3JPOA 3UQ2A 1ZQJA 2P66A 3PMNA 5HHHA 4K4HA 2ID1A 4O69A 4RWOA 4YMMA 4JWNA 3MDCA 1ZQBA 3OWGA 3ISDA 2ZH3A 8ICPA 4X0AA 3MGHA 2DR9A 4JLXA 2Q66A 4WBZA 3C2KA 4KLTA 4K9AA 4I2FA 3MDAA 3RJIA 4QZCA 4RQ6A 5J2BA 5BOMA 3MBYA 3K75D 5CA7A 4RQ8A 1KNYA 2FMSA 4R64A 4O5CA 8ICSA 3AQNA 3HWTA 4KLLA 4Z6CA 4UD5A 4FHWA 1ZJMA 4AT7B 4O6AA 4DOAA 4KLIA 4LZDA 2GA9D 4M47A 8ICRA 4RQ3A 5DECA 5DB8A 1ZQGA 4DO9A 4LEVA 4I2EA 1GPJA 8ICAA 3WFPA 4WQKA 5DDMA 4QZBA 2ZHAA 3AU6A 2BCQA 4WC4A 5DBAA 1ZQKA 3B0YA 4I2CA 4X4PA 3HW8A 5B3QA 4K9BA 4GXJA 5DDYA 4M04A 4RPZA 4YN4A 2BPCA 4UAWA 5D4BA 4M9HA 4O5EA 4WC1A 7ICOA 4QZDA 2BPFA 4KLEA 5D61A 1Q79A 5J2IA 3NYBA 4YD2A 1ZQWA 5HRLA 8ICQA 8ICGA 5IINA 1NOMA 5CHEA 5D46A 2O1PA 4M0AA 4FO1A 2ZH9A 3UQ0A 2ISPA 8ICTA 4K4GA 3C18A 2DR7A 8ICJA 8ICKA 4KB6A 5HRGA 4ATBA 1ZQZA 5HHIA 2GAFD 1JMSA 5J2AA 4MFAA
chains in the Genus database with same CATH topology
4KLGA 1ZQOA 2ZH1A 4P4MA 4XRHA 1BPZA 2FMQA 3OUYB 1MIVA 4X4QA 4XA5A 4Z6DA 4JWMA 4UB3A 3V72A 2NRKA 4X5VA 7ICQA 3H38A 4KLSA 2BCRA 5CHGA 8ICZA 3AUOA 3OVAA 3C2MA 3RJGA 3HJ1A 4NKTA 1Q78A 7ICPA 5CB1A 5BOLA 4QZFA 3JPSA 4QZHA 4LZGA 4AT8A 4RQ4A 4E8FA 3WFOA 5HRDA 4P4PA 1PX5A 4QZ9A 7ICMA 5J2EA 9ICVA 3JPQA 3C5GA 4M9JA 8ICWA 4O67A 4IG8A 4O9MA 8ICMA 2PFQA 3PNCA 4I2GA 9ICLA 1JQRA 4MFCA 4X0BA 1ZQRA 4LT6A 4UAYA 9ICWA 1ZQHA 2BCVA 9ICEA 4RQ7A 3LQCB 4RQ2A 5J0WA 5CJ7A 4AT7A 4IQVA 5J29A 3JPTA 2FMPA 7ICTA 1MQ3A 1JN3A 4PGYA 2ZH6A 5HR9A 3LK9A 4RWNA 3C2LA 4X4TA 9ICOA 3H37A 3RJEA 4K99A 3JPPA 4K96A 1MQ2A 4KLFA 4TUSA 4KLMA 5J2KA 2HHPA 2ZH7A 1MIWA 5IIIA 1ZQLA 5J0UA 4NXWA 4EP7A 4TURA 4QZEA 1R8AA 7ICSA 5J0QA 1NO5A 4R63A 1ZQAA 8ICUA 4PH5A 4PPXA 7ICKA 4RWQA 5IIMA 9ICPA 5IIKA 3OVSA 3MGIA 4WOYA 2ZH4A 4F5OA 3HJ4A 5J2GA 5J0SA 7ICVA 3JYYA 4O5KA 4NKUA 5HREA 4IQWA 4NM1A 9ICAA 5BPCA 4M9NA 4I2JA 3AU2A 9ICJA 1TFWA 8ICHA 4FHYA 1OU5A 4PGQA 4OAHA 2DRAA 7ICGA 4I2AA 1UEUA 5J2FA 2PFOA 9ICIA 1BPYA 2B4VA 4O68A 3AQMA 4E80A 3RH4A 2BCSA 4LVSA 1ZQPA 7ICRA 4Z6EA 4M2YA 7ICUA 8ICXA 5DB6A 2ZHBA 4MF8A 3OUYA 9ICRA 5DKWA 4EBKA 4AT9A 4FHPA 3JPNA 1R89A 4IQUA 3TFRA 2W9MA 4YCXA 8ICLA 3H39A 2M2WA 4F5RA 4YD1A 5EOZA 1ZQIA 4WC2A 3RH6A 4Z6FA 4PHPA 5DB9A 1R8CA 2RFFA 1HUOA 5J0XA 5J2JA 4EBJA 4GXKA 4NLNA 4I2HA 5HC9A 4TUPA 3WFRE 5IIJA 4I2DA 8ICYA 1WOTA 4I2BA 4MF2A 7ICJA 4YMNA 5D49A 4KM5A 1ZQFA 4QZ8A 4PGXA 3L9DA 5IIOA 4DOBA 1RZTA 4NLKA 5J0PA 3PMLA 1ZQQA 4PHEA 2ZH5A 4ATBB 5CWRA 1FA0A 9ICUA 4UB1A 1HUZA 4DOCA 5TZVA 4FH3A 2DR8A 4OAIZ 4IQTA 4PHAA 5HRKA 3UXOA 5J0YA 4UAZA 4LEWA 4P4OA 4X4SA 2BCUA 1ZQUA 2B56A 8ICFA 2B51A 5HRIA 4K97A 3UPQA 4I29A 4RT3A 5DB7A 1YLQA 5J2CA 3B0XA 5J0OA 4E7XA 5J2DA 1ZQMA 4UB5A 9ICBA 3V7JA 2BPGA 2VANA 3UPSA 4RQ1A 4RT2A 9ICFA 4I28A 2PFPA 1RPLA 2PBEA 5HRBA 3RJKA 4K8VA 1F5AA 4X4RA 4UBCA 4PHDA 7ICFA 4WC5A 8ICEA 8ICIA 4X4VA 2M2VA 1TVAA 4NXTA 4X4NA 9ICKA 4UD4A 4F5PA 4NXXA 4AT8B 9ICSA 5IILA 4X4UA 3GDXA 1ZQNA 2ISOA 3RH5A 1UETA 9ICMA 2I9GA 4YMOA 4S3NA 4QZGA 1BPBA 4P2HA 8ICNA 4M9GA 1ZQSA 4OAGA 3AQLA 4MFFA 4WC0A 1BPXA 3WFSC 4RPYA 9ICNA 5J0TA 4I2IA 4FH5A 9ICGA 4WC7A 3HIYA 5DBCA 1XSNA 8ICCA 4MKPA 4KLJA 4WCWA 3RJFA 2GWSA 4JLZA 4NM2A 2M2TA 3ISBA 1MIYA 7ICIA 1KDHA 9ICHA 3RJJA 4M5DA 1BPEA 4X4OA 5CR0A 1ZQTA 1ZQDA 4KLUA 4FO6A 4I27A 4NLZA 7ICEA 4NXVA 8ICBA 9ICXA 4XQ7A 4F5QA 4XQ8A 4K98A 4QZIA 3AQKA 7ICNA 8ICOA 4RQ0A 3HX0A 5DBBA 1ZQXA 4XUSA 4KLHA 9ICTA 1TV9A 1VJ7A 1ZJNA 4KLDA 1BPDA 2DVIA 3UXNA 4GXIA 4WC3A 1VFGA 4UB2A 4R65A 4FHVA 9ICCA 5HRHA 1TFYA 2BE3A 4NXZA 8ICVA 2ZH8A 1ZQEA 3OV7A 2PXIA 4F5NA 4RQ5A 1JAJA 3OGUA 2ZH2A 3C5FA 3H3AA 3JPRA 4NXUA 4TUQA 1XSLA 7ICLA 3WFQE 3ISCA 4LEYA 2O5AA 2DRBA 4NY8A 1KEJA 3C66A 4KLQA 3V7KA 4K4IA 4AT9B 3OVBA 4WC6A 1ZQVA 4OAFA 4R66A 5DEDA 5F2VO 4KLOA 4RWPA 1V4AA 4FHXA 7ICHA 4UBBA 5J0RA 1XSPA 3UXPA 3JZ0A 4LEZA 1ZQYA 5CP2A 1UEVA 2DR5A 2PFNA 3RJHA 3TFSA 4WBYA 3V7LA 5J2HA 4RPXA 4QZAA 1ZQCA 5HRFA 4UB4A 2IHMA 4M9LA 1R8BA 9ICQA 2M2UA 3JPOA 3UQ2A 1ZQJA 2P66A 3PMNA 5HHHA 4K4HA 2ID1A 4O69A 4RWOA 4YMMA 4JWNA 3MDCA 1ZQBA 3ISDA 2ZH3A 8ICPA 4X0AA 3MGHA 2DR9A 4JLXA 2Q66A 4WBZA 3C2KA 4KLTA 4K9AA 4I2FA 3MDAA 3RJIA 4QZCA 4RQ6A 5J2BA 5BOMA 3MBYA 3K75D 5CA7A 4RQ8A 1KNYA 2FMSA 4R64A 4O5CA 8ICSA 3AQNA 3HWTA 4KLLA 4Z6CA 4UD5A 4FHWA 1ZJMA 4AT7B 4O6AA 4DOAA 4KLIA 4LZDA 4M47A 8ICRA 4RQ3A 5DECA 5DB8A 1ZQGA 4DO9A 4LEVA 4I2EA 8ICAA 3WFPA 5DDMA 4QZBA 2ZHAA 3AU6A 2BCQA 4WC4A 5DBAA 1ZQKA 3B0YA 4I2CA 4X4PA 3HW8A 4K9BA 4GXJA 5DDYA 4M04A 4RPZA 4YN4A 2BPCA 4UAWA 5D4BA 4M9HA 4O5EA 4WC1A 7ICOA 4QZDA 2BPFA 4KLEA 5J2IA 1Q79A 3NYBA 4YD2A 1ZQWA 5HRLA 8ICQA 8ICGA 5IINA 1NOMA 5D46A 2O1PA 4M0AA 3UQ0A 2ZH9A 2ISPA 8ICTA 4K4GA 3C18A 2DR7A 8ICJA 8ICKA 4KB6A 5HRGA 4ATBA 1ZQZA 5HHIA 1JMSA 5J2AA 4MFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLG A;  1ZQO A;  4P4M A;  2ZH1 A;  4XRH A;  1BPZ A;  2FMQ A;  3OUY B;  1MIV A;  4X4Q A;  4XA5 A;  4Z6D A;  4JWM A;  4UB3 A;  3V72 A;  2NRK A;  4X5V A;  7ICQ A;  3H38 A;  4KLS A;  2BCR A;  5CHG A;  8ICZ A;  3AUO A;  3OVA A;  3C2M A;  3RJG A;  3HJ1 A;  4NKT A;  1Q78 A;  7ICP A;  5CB1 A;  5BOL A;  4QZF A;  3JPS A;  4QZH A;  4LZG A;  4AT8 A;  4RQ4 A;  4E8F A;  3WFO A;  5HRD A;  4P4P A;  1PX5 A;  4QZ9 A;  7ICM A;  5J2E A;  9ICV A;  3JPQ A;  3C5G A;  4M9J A;  8ICW A;  4IG8 A;  8ICM A;  4O9M A;  2PFQ A;  3PNC A;  4I2G A;  9ICL A;  1JQR A;  4MFC A;  4X0B A;  1ZQR A;  4LT6 A;  4UAY A;  9ICW A;  1ZQH A;  2BCV A;  9ICE A;  4RQ7 A;  3LQC B;  4RQ2 A;  5J0W A;  5CJ7 A;  4IQV A;  4AT7 A;  5J29 A;  3JPT A;  2FMP A;  7ICT A;  1MQ3 A;  1JN3 A;  4PGY A;  5HR9 A;  2ZH6 A;  3LK9 A;  4RWN A;  3C2L A;  4X4T A;  9ICO A;  3H37 A;  3RJE A;  3JPP A;  1MQ2 A;  4KLF A;  4TUS A;  4KLM A;  5J2K A;  2HHP A;  2ZH7 A;  1MIW A;  5III A;  1ZQL A;  4EP7 A;  5J0U A;  4TUR A;  4QZE A;  1R8A A;  7ICS A;  5J0Q A;  1NO5 A;  4R63 A;  1ZQA A;  8ICU A;  4PH5 A;  4PPX A;  7ICK A;  4RWQ A;  5IIM A;  9ICP A;  5IIK A;  3OVS A;  3MGI A;  2ZH4 A;  4F5O A;  3HJ4 A;  5J2G A;  5J0S A;  7ICV A;  3JYY A;  4O5K A;  4NKU A;  5HRE A;  4IQW A;  4NM1 A;  9ICA A;  5BPC A;  4M9N A;  4I2J A;  3AU2 A;  9ICJ A;  1TFW A;  8ICH A;  4FHY A;  1OU5 A;  4PGQ A;  7ICG A;  2DRA A;  4I2A A;  1UEU A;  5J2F A;  2PFO A;  9ICI A;  1BPY A;  2B4V A;  3AQM A;  4E80 A;  3RH4 A;  2BCS A;  4LVS A;  1ZQP A;  7ICR A;  4Z6E A;  4M2Y A;  7ICU A;  8ICX A;  5DB6 A;  4MF8 A;  2ZHB A;  3OUY A;  9ICR A;  5DKW A;  4EBK A;  4AT9 A;  4FHP A;  3JPN A;  1R89 A;  4IQU A;  3TFR A;  2W9M A;  4YCX A;  8ICL A;  3H39 A;  2M2W A;  4F5R A;  4YD1 A;  5EOZ A;  1ZQI A;  4WC2 A;  3RH6 A;  4Z6F A;  4PHP A;  5DB9 A;  1R8C A;  2RFF A;  1HUO A;  5J0X A;  5J2J A;  4EBJ A;  4GXK A;  4NLN A;  4I2H A;  5HC9 A;  4TUP A;  3WFR E;  5IIJ A;  4I2D A;  8ICY A;  1WOT A;  4I2B A;  4MF2 A;  7ICJ A;  4YMN A;  5D49 A;  1ZQF A;  4QZ8 A;  4PGX A;  3L9D A;  5IIO A;  4DOB A;  1RZT A;  4NLK A;  5J0P A;  3PML A;  1ZQQ A;  4PHE A;  2ZH5 A;  4ATB B;  5CWR A;  1FA0 A;  9ICU A;  4UB1 A;  1HUZ A;  4DOC A;  5TZV A;  4FH3 A;  2DR8 A;  4IQT A;  4PHA A;  5HRK A;  3UXO A;  5J0Y A;  4UAZ A;  4P4O A;  4X4S A;  2BCU A;  1ZQU A;  2B56 A;  8ICF A;  2B51 A;  5HRI A;  3UPQ A;  4I29 A;  4RT3 A;  5DB7 A;  1YLQ A;  5J2C A;  3B0X A;  5J0O A;  4E7X A;  5J2D A;  1ZQM A;  4UB5 A;  9ICB A;  3V7J A;  2BPG A;  2VAN A;  3UPS A;  4RQ1 A;  4RT2 A;  9ICF A;  4I28 A;  2PFP A;  1RPL A;  2PBE A;  5HRB A;  3RJK A;  1F5A A;  4X4R A;  4UBC A;  4PHD A;  7ICF A;  4WC5 A;  8ICE A;  8ICI A;  4X4V A;  2M2V A;  1TVA A;  4X4N A;  9ICK A;  4UD4 A;  4F5P A;  4AT8 B;  9ICS A;  5IIL A;  4X4U A;  3GDX A;  1ZQN A;  2ISO A;  3RH5 A;  1UET A;  9ICM A;  2I9G A;  4YMO A;  4S3N A;  4QZG A;  1BPB A;  4P2H A;  8ICN A;  4M9G A;  1ZQS A;  3AQL A;  4MFF A;  4WC0 A;  1BPX A;  3WFS C;  4RPY A;  9ICN A;  5J0T A;  4I2I A;  4FH5 A;  9ICG A;  4WC7 A;  3HIY A;  5DBC A;  1XSN A;  8ICC A;  4KLJ A;  4WCW A;  3RJF A;  2GWS A;  4NM2 A;  2M2T A;  3ISB A;  1MIY A;  7ICI A;  1KDH A;  9ICH A;  3RJJ A;  4M5D A;  1BPE A;  4X4O A;  5CR0 A;  1ZQT A;  1ZQD A;  4KLU A;  4FO6 A;  4I27 A;  4NLZ A;  7ICE A;  8ICB A;  9ICX A;  4XQ7 A;  4F5Q A;  4XQ8 A;  4QZI A;  3AQK A;  7ICN A;  8ICO A;  4RQ0 A;  3HX0 A;  5DBB A;  1ZQX A;  4XUS A;  4KLH A;  9ICT A;  1TV9 A;  1VJ7 A;  1ZJN A;  4KLD A;  1BPD A;  2DVI A;  3UXN A;  4GXI A;  4WC3 A;  1VFG A;  4UB2 A;  4R65 A;  4FHV A;  9ICC A;  5HRH A;  1TFY A;  2BE3 A;  4NXZ A;  8ICV A;  2ZH8 A;  1ZQE A;  3OV7 A;  2PXI A;  4F5N A;  4RQ5 A;  1JAJ A;  3OGU A;  2ZH2 A;  3C5F A;  3H3A A;  3JPR A;  4TUQ A;  1XSL A;  7ICL A;  3WFQ E;  3ISC A;  2O5A A;  2DRB A;  4NY8 A;  1KEJ A;  3C66 A;  4KLQ A;  3V7K A;  4K4I A;  4AT9 B;  3OVB A;  4WC6 A;  1ZQV A;  4R66 A;  5DED A;  5F2V O;  4KLO A;  4RWP A;  1V4A A;  4FHX A;  7ICH A;  4UBB A;  5J0R A;  1XSP A;  3UXP A;  3JZ0 A;  1ZQY A;  5CP2 A;  1UEV A;  2DR5 A;  2PFN A;  3RJH A;  3TFS A;  4WBY A;  3V7L A;  5J2H A;  4RPX A;  4QZA A;  1ZQC A;  5HRF A;  4UB4 A;  2IHM A;  4M9L A;  1R8B A;  9ICQ A;  2M2U A;  3JPO A;  3UQ2 A;  1ZQJ A;  2P66 A;  3PMN A;  5HHH A;  4K4H A;  2ID1 A;  4RWO A;  4YMM A;  4JWN A;  3MDC A;  1ZQB A;  3ISD A;  2ZH3 A;  8ICP A;  4X0A A;  3MGH A;  2DR9 A;  2Q66 A;  4WBZ A;  3C2K A;  4KLT A;  4I2F A;  3MDA A;  3RJI A;  4QZC A;  4RQ6 A;  5J2B A;  5BOM A;  3MBY A;  3K75 D;  5CA7 A;  4RQ8 A;  1KNY A;  2FMS A;  4R64 A;  4O5C A;  8ICS A;  3AQN A;  3HWT A;  4KLL A;  4Z6C A;  4UD5 A;  4FHW A;  1ZJM A;  4AT7 B;  4DOA A;  4KLI A;  4LZD A;  4M47 A;  8ICR A;  4RQ3 A;  5DEC A;  5DB8 A;  1ZQG A;  4DO9 A;  4I2E A;  8ICA A;  3WFP A;  5DDM A;  4QZB A;  2ZHA A;  3AU6 A;  2BCQ A;  4WC4 A;  5DBA A;  1ZQK A;  3B0Y A;  4I2C A;  4X4P A;  3HW8 A;  4GXJ A;  5DDY A;  4M04 A;  4RPZ A;  4YN4 A;  2BPC A;  4UAW A;  5D4B A;  4M9H A;  4O5E A;  4WC1 A;  7ICO A;  4QZD A;  2BPF A;  4KLE A;  5J2I A;  1Q79 A;  3NYB A;  4YD2 A;  1ZQW A;  5HRL A;  8ICQ A;  8ICG A;  5IIN A;  1NOM A;  5D46 A;  2O1P A;  4M0A A;  3UQ0 A;  2ZH9 A;  2ISP A;  8ICT A;  4K4G A;  3C18 A;  2DR7 A;  8ICJ A;  8ICK A;  5HRG A;  4ATB A;  1ZQZ A;  5HHI A;  1JMS A;  5J2A A;  4MFA A; 
#chains in the Genus database with same CATH topology
 4KLG A;  1ZQO A;  2ZH1 A;  4P4M A;  4WQL A;  2HN1 A;  4XRH A;  4WH5 A;  1BPZ A;  2FMQ A;  3JCF A;  3OUY B;  1MIV A;  4X4Q A;  4XA5 A;  5CFS A;  4Z6D A;  4JWM A;  4UB3 A;  3V72 A;  2NRK A;  4X5V A;  7ICQ A;  3H38 A;  3NWI A;  4KLS A;  2BCR A;  5CHG A;  8ICZ A;  3AUO A;  3OVA A;  2BBH A;  3C2M A;  3RJG A;  3HJ1 A;  4NKT A;  1Q78 A;  7ICP A;  5CB1 A;  5BOL A;  4QZF A;  3JPS A;  4QZH A;  4LZG A;  4AT8 A;  4RQ4 A;  4E8F A;  3WFO A;  5HRD A;  4P4P A;  1PX5 A;  4QZ9 A;  7ICM A;  5J2E A;  9ICV A;  3JPQ A;  3C5G A;  4M9J A;  8ICW A;  4O67 A;  4IG8 A;  4O9M A;  8ICM A;  2PFQ A;  3PNC A;  4I2G A;  9ICL A;  3ER9 B;  1JQR A;  4MFC A;  4X0B A;  1ZQR A;  4LT6 A;  4UAY A;  9ICW A;  1ZQH A;  5CFT A;  2BCV A;  9ICE A;  4RQ7 A;  3LQC B;  4EGW A;  4RQ2 A;  5J0W A;  5CJ7 A;  4AT7 A;  4IQV A;  5CFU A;  5J29 A;  3JPT A;  2FMP A;  7ICT A;  1MQ3 A;  1JN3 A;  4PGY A;  2ZH6 A;  5HR9 A;  3LK9 A;  4RWN A;  3C2L A;  4X4T A;  9ICO A;  3H37 A;  3RJE A;  4K99 A;  2IUB A;  3JPP A;  4K96 A;  1MQ2 A;  4KLF A;  4TUS A;  4KLM A;  5J2K A;  2HHP A;  2ZH7 A;  1MIW A;  5III A;  1ZQL A;  4NXW A;  4EP7 A;  5J0U A;  4TUR A;  4QZE A;  1R8A A;  7ICS A;  5J0Q A;  1NO5 A;  4R63 A;  1ZQA A;  8ICU A;  5D63 A;  4PH5 A;  4PPX A;  7ICK A;  4RWQ A;  5IIM A;  9ICP A;  5IIK A;  5JTG A;  3OVS A;  3MGI A;  4WOY A;  2BBJ A;  2ZH4 A;  4F5O A;  3HJ4 A;  3MCR A;  5J0S A;  5J2G A;  7ICV A;  3JYY A;  4O5K A;  4NKU A;  5HRE A;  4IQW A;  4NM1 A;  9ICA A;  5BPC A;  5B3P A;  4M9N A;  4I2J A;  3AU2 A;  3EF2 A;  9ICJ A;  1TFW A;  8ICH A;  4FHY A;  1OU5 A;  4PGQ A;  4OAH A;  2DRA A;  7ICG A;  4I2A A;  1UEU A;  5J2F A;  2PFO A;  3PHZ A;  9ICI A;  1BPY A;  2B4V A;  4O68 A;  3AQM A;  4E80 A;  3RH4 A;  2BCS A;  4LVS A;  1ZQP A;  3CK6 A;  7ICR A;  4Z6E A;  4M2Y A;  7ICU A;  8ICX A;  5DB6 A;  2ZHB A;  4MF8 A;  3OUY A;  4I0U A;  9ICR A;  5DKW A;  4EBK A;  4AT9 A;  4FHP A;  3JPN A;  1R89 A;  4IQU A;  3TFR A;  2W9M A;  4YCX A;  8ICL A;  3H39 A;  2M2W A;  3ER8 C;  4F5R A;  4YD1 A;  5EOZ A;  1ZQI A;  4WC2 A;  3RH6 A;  4Z6F A;  4PHP A;  5DB9 A;  5D62 A;  1R8C A;  2RFF A;  1HUO A;  5J0X A;  5J2J A;  4EBJ A;  4GXK A;  4NLN A;  4EV6 A;  4I2H A;  5HC9 A;  4TUP A;  3WFR E;  5IIJ A;  4I2D A;  8ICY A;  1WOT A;  4I2B A;  4MF2 A;  7ICJ A;  4YMN A;  5D49 A;  4KM5 A;  1ZQF A;  4QZ8 A;  4PGX A;  4N7R A;  3L9D A;  5IIO A;  4DOB A;  1RZT A;  4NLK A;  5J0P A;  3PML A;  1ZQQ A;  4PHE A;  2ZH5 A;  4ATB B;  5CWR A;  1FA0 A;  9ICU A;  4UB1 A;  1HUZ A;  4DOC A;  5TZV A;  4FH3 A;  2DR8 A;  5HRK A;  4OAI Z;  4IQT A;  4PHA A;  3UXO A;  5J0Y A;  4UAZ A;  4LEW A;  4P4O A;  4X4S A;  2BCU A;  1ZQU A;  2B56 A;  3ERC C;  8ICF A;  2B51 A;  5HRI A;  4K97 A;  3UPQ A;  4I29 A;  4RT3 A;  5DB7 A;  1YLQ A;  5J2C A;  3B0X A;  5J0O A;  4E7X A;  4HX0 A;  5J2D A;  1ZQM A;  4UB5 A;  9ICB A;  3V7J A;  2BPG A;  2VAN A;  3UPS A;  3NKU A;  4RQ1 A;  4RT2 A;  9ICF A;  4I28 A;  2PFP A;  1RPL A;  2PBE A;  5HRB A;  3RJK A;  4K8V A;  1F5A A;  4X4R A;  4UBC A;  4PHD A;  7ICF A;  4WC5 A;  8ICE A;  8ICI A;  4X4V A;  2M2V A;  1TVA A;  4NXT A;  4X4N A;  9ICK A;  4UD4 A;  4F5P A;  4NXX A;  4AT8 B;  9ICS A;  3K7D A;  5IIL A;  4X4U A;  3GDX A;  1ZQN A;  2ISO A;  3RH5 A;  1UET A;  9ICM A;  2I9G A;  4YMO A;  4S3N A;  4QZG A;  1BPB A;  4P2H A;  8ICN A;  4M9G A;  1ZQS A;  4OAG A;  3AQL A;  4MFF A;  4WC0 A;  1BPX A;  3WFS C;  4RPY A;  2EWR A;  9ICN A;  5J0T A;  4I2I A;  4FH5 A;  9ICG A;  4WC7 A;  3HIY A;  5DBC A;  1XSN A;  8ICC A;  4MKP A;  4KLJ A;  4WCW A;  3RJF A;  4XJE A;  2GWS A;  4JLZ A;  4NM2 A;  2M2T A;  3ISB A;  1MIY A;  7ICI A;  1KDH A;  9ICH A;  3RJJ A;  4M5D A;  1BPE A;  4X4O A;  5CR0 A;  1ZQT A;  1ZQD A;  4KLU A;  4FO6 A;  4I27 A;  4NLZ A;  7ICE A;  4NXV A;  8ICB A;  9ICX A;  4XQ7 A;  2HN2 A;  4F5Q A;  4XQ8 A;  4K98 A;  4QZI A;  3AQK A;  7ICN A;  8ICO A;  4RQ0 A;  3HX0 A;  2IHO A;  5DBB A;  4EED A;  1ZQX A;  4XUS A;  4KLH A;  9ICT A;  1TV9 A;  1VJ7 A;  1ZJN A;  4KLD A;  1BPD A;  2DVI A;  3UXN A;  4GXI A;  4WC3 A;  1VFG A;  4UB2 A;  4R65 A;  4FHV A;  9ICC A;  5HRH A;  1TFY A;  2BE3 A;  4NXZ A;  8ICV A;  2ZH8 A;  1ZQE A;  3OV7 A;  2PXI A;  4F5N A;  4RQ5 A;  1JAJ A;  3OGU A;  2ZH2 A;  3C5F A;  3H3A A;  3JPR A;  4NXU A;  4TUQ A;  1XSL A;  7ICL A;  3WFQ E;  3ISC A;  4LEY A;  2O5A A;  2DRB A;  4NY8 A;  1KEJ A;  3C66 A;  4KLQ A;  3V7K A;  4K4I A;  4AT9 B;  3OVB A;  4WC6 A;  1ZQV A;  4OAF A;  4R66 A;  5DED A;  5F2V O;  4KLO A;  4RWP A;  1V4A A;  4FHX A;  7ICH A;  4UBB A;  2FCL A;  5J0R A;  1XSP A;  3UXP A;  3JZ0 A;  4LEZ A;  1ZQY A;  3NVO A;  1UEV A;  5CP2 A;  2DR5 A;  2PFN A;  3RJH A;  3TFS A;  4WBY A;  4EEB A;  3V7L A;  5J2H A;  4RPX A;  4QZA A;  1ZQC A;  5HRF A;  4UB4 A;  2IHM A;  4M9L A;  1R8B A;  9ICQ A;  2M2U A;  3JPO A;  3UQ2 A;  1ZQJ A;  2P66 A;  3PMN A;  5HHH A;  4K4H A;  2ID1 A;  4O69 A;  4RWO A;  4YMM A;  4JWN A;  3MDC A;  1ZQB A;  3OWG A;  3ISD A;  2ZH3 A;  8ICP A;  4X0A A;  3MGH A;  2DR9 A;  4JLX A;  2Q66 A;  4WBZ A;  3C2K A;  4KLT A;  4K9A A;  4I2F A;  3MDA A;  3RJI A;  4QZC A;  4RQ6 A;  5J2B A;  5BOM A;  3MBY A;  3K75 D;  5CA7 A;  4RQ8 A;  1KNY A;  2FMS A;  4R64 A;  4O5C A;  8ICS A;  3AQN A;  3HWT A;  4KLL A;  4Z6C A;  4UD5 A;  4FHW A;  1ZJM A;  4AT7 B;  4O6A A;  4DOA A;  4KLI A;  4LZD A;  2GA9 D;  4M47 A;  8ICR A;  4RQ3 A;  5DEC A;  5DB8 A;  1ZQG A;  4DO9 A;  4LEV A;  4I2E A;  1GPJ A;  8ICA A;  3WFP A;  4WQK A;  5DDM A;  4QZB A;  2ZHA A;  3AU6 A;  2BCQ A;  4WC4 A;  5DBA A;  1ZQK A;  3B0Y A;  4I2C A;  4X4P A;  3HW8 A;  5B3Q A;  4K9B A;  4GXJ A;  5DDY A;  4M04 A;  4RPZ A;  4YN4 A;  2BPC A;  4UAW A;  5D4B A;  4M9H A;  4O5E A;  4WC1 A;  7ICO A;  4QZD A;  2BPF A;  4KLE A;  5D61 A;  1Q79 A;  5J2I A;  3NYB A;  4YD2 A;  1ZQW A;  5HRL A;  8ICQ A;  8ICG A;  5IIN A;  1NOM A;  5CHE A;  5D46 A;  2O1P A;  4M0A A;  4FO1 A;  2ZH9 A;  3UQ0 A;  2ISP A;  8ICT A;  4K4G A;  3C18 A;  2DR7 A;  8ICJ A;  8ICK A;  4KB6 A;  5HRG A;  4ATB A;  1ZQZ A;  5HHI A;  2GAF D;  1JMS A;  5J2A A;  4MFA A; 
#chains in the Genus database with same CATH homology
 4KLG A;  1ZQO A;  2ZH1 A;  4P4M A;  4XRH A;  1BPZ A;  2FMQ A;  3OUY B;  1MIV A;  4X4Q A;  4XA5 A;  4Z6D A;  4JWM A;  4UB3 A;  3V72 A;  2NRK A;  4X5V A;  7ICQ A;  3H38 A;  4KLS A;  2BCR A;  5CHG A;  8ICZ A;  3AUO A;  3OVA A;  3C2M A;  3RJG A;  3HJ1 A;  4NKT A;  1Q78 A;  7ICP A;  5CB1 A;  5BOL A;  4QZF A;  3JPS A;  4QZH A;  4LZG A;  4AT8 A;  4RQ4 A;  4E8F A;  3WFO A;  5HRD A;  4P4P A;  1PX5 A;  4QZ9 A;  7ICM A;  5J2E A;  9ICV A;  3JPQ A;  3C5G A;  4M9J A;  8ICW A;  4O67 A;  4IG8 A;  4O9M A;  8ICM A;  2PFQ A;  3PNC A;  4I2G A;  9ICL A;  1JQR A;  4MFC A;  4X0B A;  1ZQR A;  4LT6 A;  4UAY A;  9ICW A;  1ZQH A;  2BCV A;  9ICE A;  4RQ7 A;  3LQC B;  4RQ2 A;  5J0W A;  5CJ7 A;  4AT7 A;  4IQV A;  5J29 A;  3JPT A;  2FMP A;  7ICT A;  1MQ3 A;  1JN3 A;  4PGY A;  2ZH6 A;  5HR9 A;  3LK9 A;  4RWN A;  3C2L A;  4X4T A;  9ICO A;  3H37 A;  3RJE A;  4K99 A;  3JPP A;  4K96 A;  1MQ2 A;  4KLF A;  4TUS A;  4KLM A;  5J2K A;  2HHP A;  2ZH7 A;  1MIW A;  5III A;  1ZQL A;  5J0U A;  4NXW A;  4EP7 A;  4TUR A;  4QZE A;  1R8A A;  7ICS A;  5J0Q A;  1NO5 A;  4R63 A;  1ZQA A;  8ICU A;  4PH5 A;  4PPX A;  7ICK A;  4RWQ A;  5IIM A;  9ICP A;  5IIK A;  3OVS A;  3MGI A;  4WOY A;  2ZH4 A;  4F5O A;  3HJ4 A;  5J2G A;  5J0S A;  7ICV A;  3JYY A;  4O5K A;  4NKU A;  5HRE A;  4IQW A;  4NM1 A;  9ICA A;  5BPC A;  4M9N A;  4I2J A;  3AU2 A;  9ICJ A;  1TFW A;  8ICH A;  4FHY A;  1OU5 A;  4PGQ A;  4OAH A;  2DRA A;  7ICG A;  4I2A A;  1UEU A;  5J2F A;  2PFO A;  9ICI A;  1BPY A;  2B4V A;  4O68 A;  3AQM A;  4E80 A;  3RH4 A;  2BCS A;  4LVS A;  1ZQP A;  7ICR A;  4Z6E A;  4M2Y A;  7ICU A;  8ICX A;  5DB6 A;  2ZHB A;  4MF8 A;  3OUY A;  9ICR A;  5DKW A;  4EBK A;  4AT9 A;  4FHP A;  3JPN A;  1R89 A;  4IQU A;  3TFR A;  2W9M A;  4YCX A;  8ICL A;  3H39 A;  2M2W A;  4F5R A;  4YD1 A;  5EOZ A;  1ZQI A;  4WC2 A;  3RH6 A;  4Z6F A;  4PHP A;  5DB9 A;  1R8C A;  2RFF A;  1HUO A;  5J0X A;  5J2J A;  4EBJ A;  4GXK A;  4NLN A;  4I2H A;  5HC9 A;  4TUP A;  3WFR E;  5IIJ A;  4I2D A;  8ICY A;  1WOT A;  4I2B A;  4MF2 A;  7ICJ A;  4YMN A;  5D49 A;  4KM5 A;  1ZQF A;  4QZ8 A;  4PGX A;  3L9D A;  5IIO A;  4DOB A;  1RZT A;  4NLK A;  5J0P A;  3PML A;  1ZQQ A;  4PHE A;  2ZH5 A;  4ATB B;  5CWR A;  1FA0 A;  9ICU A;  4UB1 A;  1HUZ A;  4DOC A;  5TZV A;  4FH3 A;  2DR8 A;  4OAI Z;  4IQT A;  4PHA A;  5HRK A;  3UXO A;  5J0Y A;  4UAZ A;  4LEW A;  4P4O A;  4X4S A;  2BCU A;  1ZQU A;  2B56 A;  8ICF A;  2B51 A;  5HRI A;  4K97 A;  3UPQ A;  4I29 A;  4RT3 A;  5DB7 A;  1YLQ A;  5J2C A;  3B0X A;  5J0O A;  4E7X A;  5J2D A;  1ZQM A;  4UB5 A;  9ICB A;  3V7J A;  2BPG A;  2VAN A;  3UPS A;  4RQ1 A;  4RT2 A;  9ICF A;  4I28 A;  2PFP A;  1RPL A;  2PBE A;  5HRB A;  3RJK A;  4K8V A;  1F5A A;  4X4R A;  4UBC A;  4PHD A;  7ICF A;  4WC5 A;  8ICE A;  8ICI A;  4X4V A;  2M2V A;  1TVA A;  4NXT A;  4X4N A;  9ICK A;  4UD4 A;  4F5P A;  4NXX A;  4AT8 B;  9ICS A;  5IIL A;  4X4U A;  3GDX A;  1ZQN A;  2ISO A;  3RH5 A;  1UET A;  9ICM A;  2I9G A;  4YMO A;  4S3N A;  4QZG A;  1BPB A;  4P2H A;  8ICN A;  4M9G A;  1ZQS A;  4OAG A;  3AQL A;  4MFF A;  4WC0 A;  1BPX A;  3WFS C;  4RPY A;  9ICN A;  5J0T A;  4I2I A;  4FH5 A;  9ICG A;  4WC7 A;  3HIY A;  5DBC A;  1XSN A;  8ICC A;  4MKP A;  4KLJ A;  4WCW A;  3RJF A;  2GWS A;  4JLZ A;  4NM2 A;  2M2T A;  3ISB A;  1MIY A;  7ICI A;  1KDH A;  9ICH A;  3RJJ A;  4M5D A;  1BPE A;  4X4O A;  5CR0 A;  1ZQT A;  1ZQD A;  4KLU A;  4FO6 A;  4I27 A;  4NLZ A;  7ICE A;  4NXV A;  8ICB A;  9ICX A;  4XQ7 A;  4F5Q A;  4XQ8 A;  4K98 A;  4QZI A;  3AQK A;  7ICN A;  8ICO A;  4RQ0 A;  3HX0 A;  5DBB A;  1ZQX A;  4XUS A;  4KLH A;  9ICT A;  1TV9 A;  1VJ7 A;  1ZJN A;  4KLD A;  1BPD A;  2DVI A;  3UXN A;  4GXI A;  4WC3 A;  1VFG A;  4UB2 A;  4R65 A;  4FHV A;  9ICC A;  5HRH A;  1TFY A;  2BE3 A;  4NXZ A;  8ICV A;  2ZH8 A;  1ZQE A;  3OV7 A;  2PXI A;  4F5N A;  4RQ5 A;  1JAJ A;  3OGU A;  2ZH2 A;  3C5F A;  3H3A A;  3JPR A;  4NXU A;  4TUQ A;  1XSL A;  7ICL A;  3WFQ E;  3ISC A;  4LEY A;  2O5A A;  2DRB A;  4NY8 A;  1KEJ A;  3C66 A;  4KLQ A;  3V7K A;  4K4I A;  4AT9 B;  3OVB A;  4WC6 A;  1ZQV A;  4OAF A;  4R66 A;  5DED A;  5F2V O;  4KLO A;  4RWP A;  1V4A A;  4FHX A;  7ICH A;  4UBB A;  5J0R A;  1XSP A;  3UXP A;  3JZ0 A;  4LEZ A;  1ZQY A;  5CP2 A;  1UEV A;  2DR5 A;  2PFN A;  3RJH A;  3TFS A;  4WBY A;  3V7L A;  5J2H A;  4RPX A;  4QZA A;  1ZQC A;  5HRF A;  4UB4 A;  2IHM A;  4M9L A;  1R8B A;  9ICQ A;  2M2U A;  3JPO A;  3UQ2 A;  1ZQJ A;  2P66 A;  3PMN A;  5HHH A;  4K4H A;  2ID1 A;  4O69 A;  4RWO A;  4YMM A;  4JWN A;  3MDC A;  1ZQB A;  3ISD A;  2ZH3 A;  8ICP A;  4X0A A;  3MGH A;  2DR9 A;  4JLX A;  2Q66 A;  4WBZ A;  3C2K A;  4KLT A;  4K9A A;  4I2F A;  3MDA A;  3RJI A;  4QZC A;  4RQ6 A;  5J2B A;  5BOM A;  3MBY A;  3K75 D;  5CA7 A;  4RQ8 A;  1KNY A;  2FMS A;  4R64 A;  4O5C A;  8ICS A;  3AQN A;  3HWT A;  4KLL A;  4Z6C A;  4UD5 A;  4FHW A;  1ZJM A;  4AT7 B;  4O6A A;  4DOA A;  4KLI A;  4LZD A;  4M47 A;  8ICR A;  4RQ3 A;  5DEC A;  5DB8 A;  1ZQG A;  4DO9 A;  4LEV A;  4I2E A;  8ICA A;  3WFP A;  5DDM A;  4QZB A;  2ZHA A;  3AU6 A;  2BCQ A;  4WC4 A;  5DBA A;  1ZQK A;  3B0Y A;  4I2C A;  4X4P A;  3HW8 A;  4K9B A;  4GXJ A;  5DDY A;  4M04 A;  4RPZ A;  4YN4 A;  2BPC A;  4UAW A;  5D4B A;  4M9H A;  4O5E A;  4WC1 A;  7ICO A;  4QZD A;  2BPF A;  4KLE A;  5J2I A;  1Q79 A;  3NYB A;  4YD2 A;  1ZQW A;  5HRL A;  8ICQ A;  8ICG A;  5IIN A;  1NOM A;  5D46 A;  2O1P A;  4M0A A;  3UQ0 A;  2ZH9 A;  2ISP A;  8ICT A;  4K4G A;  3C18 A;  2DR7 A;  8ICJ A;  8ICK A;  4KB6 A;  5HRG A;  4ATB A;  1ZQZ A;  5HHI A;  1JMS A;  5J2A A;  4MFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...