4NKTA

Structure of cid1 in complex with the utp analog umpnpp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 111
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nktA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nktA02
4KLTA 4RWQA 3AQNA 1ZQVA 3C66A 1JN3A 9ICOA 2M2VA 3OUYA 3L9DA 2B51A 5J2KA 4PGXA 1JMSA 1UEUA 4NXZA 2M2TA 4F5OA 3B0YA 4QZAA 3LK9A 4R65A 1YLQA 9ICGA 4MF2A 4PHPA 7ICMA 4FHPA 4WC6A 4YD1A 5HRIA 8ICEA 9ICAA 1ZQNA 1KNYA 5IINA 3NYBA 1ZQAA 8ICFA 1MQ3A 1BPYA 4QZGA 9ICEA 4XUSA 1TV9A 3H3AA 3JPRA 4XQ7A 3RH6A 3RJEA 7ICKA 4M5DA 4EBJA 4FH5A 4PHAA 4NLKA 4X4PA 3ISDA 2B4VA 4KLJA 1ZQSA 7ICSA 4R63A 2DRBA 9ICCA 1ZQYA 1ZQDA 1R89A 1WOTA 4P4OA 2DVIA 4ATBB 7ICJA 3WFOA 5CB1A 4KLQA 5DB9A 9ICIA 4QZBA 1ZJNA 4MFCA 4E7XA 4M04A 5HRLA 4RWPA 3WFSC 2ZH9A 3UQ0A 4QZIA 4X4RA 4FHWA 4R64A 3V7JA 3C2MA 5HREA 4F5QA 4UB3A 4KLFA 3JPPA 4AT7B 9ICMA 4KLEA 4RQ3A 9ICSA 4XRHA 5DBAA 9ICRA 2BPFA 4M9LA 2ZH1A 4P2HA 2DRAA 4E80A 2O5AA 4QZEA 4YMNA 5DB6A 4YMMA 1Q79A 3H37A 4TUPA 7ICEA 4I2CA 5J0OA 4KLHA 8ICIA 1KDHA 4KLDA 3TFRA 7ICGA 1ZQMA 3JYYA 5J2HA 2BCQA 7ICPA 4R66A 8ICJA 2PXIA 9ICVA 4AT9B 2GWSA 2ZHAA 4QZ9A 1ZQWA 4LZDA 1XSNA 2BPCA 1BPEA 5DKWA 4X4VA 4RT3A 1ZQPA 1ZQIA 3C18A 3HWTA 4DOCA 4EBKA 8ICNA 4X4QA 2ZH4A 1R8BA 1RPLA 3OV7A 9ICQA 5J2AA 4UB4A 4YN4A 5D4BA 4MFFA 1ZQLA 4UB5A 7ICRA 1FA0A 3JPSA 3MDCA 1VFGA 1R8AA 3ISCA 5J0QA 3JPNA 9ICBA 4I2IA 3JPTA 4WC2A 2ZH2A 4K4IA 4RQ4A 4RWNA 4IG8A 4MF8A 4RT2A 4UAYA 4WC4A 4Z6DA 2FMQA 5J2BA 4M9JA 4RPYA 3RJFA 3OVSA 4MFAA 4RPZA 3OVAA 4ATBA 1ZJMA 5HRBA 2PFPA 3HX0A 3RJIA 1KEJA 3RH4A 4PH5A 4I2FA 5HRDA 1MIYA 2PFQA 3AQLA 4FH3A 5HRGA 2B56A 2ISOA 4X4NA 1JAJA 2BCSA 4KLUA 5HRFA 5J0XA 9ICWA 4YMOA 4AT7A 1MIVA 5J2JA 2ZH8A 1MIWA 4PHEA 2PFOA 1OU5A 4RQ5A 2ZH7A 3C5FA 5J0UA 4KLMA 7ICTA 1TVAA 2W9MA 1ZQRA 2M2WA 8ICAA 3HIYA 4P4PA 4XQ8A 8ICGA 1BPXA 7ICNA 4IQTA 4PPXA 4KLOA 3JPQA 9ICJA 4E8FA 7ICUA 4X0BA 3PMLA 3C2LA 4FHXA 4AT9A 3AU2A 4UD5A 2IHMA 3UXNA 5CA7A 2RFFA 4M2YA 8ICBA 4I2DA 1UETA 4QZFA 4WCWA 4I28A 4WC3A 7ICHA 8ICZA 5DECA 4K4GA 1ZQXA 4PGYA 4O5EA 3WFPA 4X0AA 4GXIA 1ZQOA 4WC0A 5F2VO 5DBCA 4FHVA 8ICMA 8ICWA 4P4MA 1ZQKA 4I2EA 8ICKA 4GXKA 5HRHA 4Z6CA 4JWMA 5CHGA 2DR7A 1UEVA 5CR0A 4RWOA 3V7KA 1XSPA 5BOLA 4F5PA 7ICQA 8ICOA 4NM2A 5IIOA 4QZ8A 4RPXA 4XA5A 2DR9A 5IIJA 4DOAA 5J0SA 1ZQBA 4I2BA 4NM1A 9ICXA 3HW8A 5J0RA 4WBYA 4F5NA 4KLGA 4O5KA 7ICOA 1NO5A 1NOMA 3AU6A 2O1PA 1Q78A 3AQKA 5J2EA 4DOBA 3MDAA 1BPDA 3AQMA 4WC5A 2M2UA 4K4HA 1VJ7A 4O9MA 8ICHA 4QZHA 4M9NA 3C2KA 5D49A 3OVBA 8ICTA 8ICUA 4UB2A 2Q66A 3JPOA 4X5VA 4WBZA 1HUOA 1ZQCA 4RQ1A 8ICXA 7ICLA 4IQVA 4AT8B 4PGQA 4M47A 1ZQJA 4DO9A 7ICVA 1ZQFA 4TUSA 1JQRA 3LQCB 4WC1A 5IIMA 8ICCA 3HJ4A 3MGHA 2VANA 9ICHA 5J2GA 1ZQTA 3HJ1A 4IQWA 3GDXA 3UXOA 1F5AA 4QZDA 4I27A 2BCRA 3RJGA 4I2HA 8ICPA 4JWNA 5J29A 3V7LA 2ISPA 9ICKA 8ICVA 4M9GA 3V72A 3H38A 3MGIA 1PX5A 4I2JA 5J2IA 4UBBA 3PMNA 3WFRE 8ICYA 1V4AA 4RQ6A 1TFYA 3RJKA 2DR8A 3WFQE 1BPZA 5IILA 7ICIA 4RQ7A 5DDMA 4PHDA 4RQ2A 4YCXA 2FMPA 5BOMA 4F5RA 3UQ2A 4FO6A 2ZH3A 1ZQEA 4KLSA 5J2DA 4KLLA 3OUYB 4X4OA 5IIIA 5J0TA 5J2FA 4RQ8A 2ZHBA 4GXJA 8ICLA 2NRKA 5HRKA 2FMSA 3MBYA 4X4TA 4FHYA 9ICPA 9ICFA 3AUOA 3PNCA 4X4SA 9ICLA 1RZTA 3RJHA 1BPBA 2BE3A 5CP2A 5DDYA 5HR9A 5EOZA 5CWRA 4Z6FA 1MQ2A 1ZQZA 2PBEA 2BCVA 4UD4A 3UPQA 1ZQHA 4M0AA 5HHIA 3RH5A 4KLIA 4UBCA 4NY8A 3B0XA 3ISBA 4NKTA 5TZVA 8ICQA 2DR5A 5DB7A 4I2AA 1ZQUA 4TUQA 4X4UA 4AT8A 5CJ7A 4RQ0A 2P66A 7ICFA 4YD2A 2ID1A 5J0WA 1TFWA 9ICUA 1ZQQA 3UXPA 5DEDA 4I29A 2ZH6A 4UAWA 1XSLA 4UB1A 2BPGA 9ICNA 4IQUA 4EP7A 4M9HA 3C5GA 3TFSA 5HC9A 2I9GA 4Z6EA 5J0YA 5D46A 5J2CA 4NLNA 4NKUA 4LZGA 3JZ0A 3OGUA 3K75D 4LVSA 5DBBA 2BCUA 4QZCA 4WC7A 5J0PA 4O5CA 5DB8A 4I2GA 3UPSA 8ICRA 4LT6A 1ZQGA 4TURA 1HUZA 4UAZA 3H39A 1R8CA 9ICTA 2PFNA 5BPCA 8ICSA 3RJJA 4S3NA 5IIKA 4NLZA 5HHHA 2ZH5A 2HHPA
chains in the Genus database with same CATH superfamily
4KLTA 4RWQA 4OAFA 3AQNA 1ZQVA 3C66A 1JN3A 9ICOA 2M2VA 3OUYA 3L9DA 2B51A 4O6AA 4XJEA 5J2KA 4PGXA 1UEUA 1JMSA 4NXZA 2M2TA 4F5OA 3B0YA 4QZAA 3LK9A 4R65A 1YLQA 9ICGA 4MF2A 4PHPA 7ICMA 4FHPA 4WC6A 4YD1A 5HRIA 8ICEA 9ICAA 1ZQNA 1KNYA 5IINA 3NYBA 1ZQAA 8ICFA 1MQ3A 1BPYA 4QZGA 9ICEA 4XUSA 1TV9A 3H3AA 3JPRA 4XQ7A 3RH6A 3RJEA 2HN2A 7ICKA 4M5DA 4EBJA 4FH5A 4PHAA 4NLKA 4MKPA 2FCLA 4X4PA 3ISDA 2B4VA 4KLJA 1ZQSA 7ICSA 4JLZA 4R63A 2DRBA 9ICCA 1ZQYA 1ZQDA 1R89A 4WQLA 1WOTA 4NXXA 4P4OA 2DVIA 4ATBB 7ICJA 3WFOA 5CB1A 4KLQA 5DB9A 9ICIA 4QZBA 1ZJNA 4MFCA 4E7XA 4M04A 5HRLA 4RWPA 3WFSC 2ZH9A 3UQ0A 4QZIA 1GPJA 4X4RA 4FHWA 4R64A 3V7JA 3C2MA 5HREA 4F5QA 4UB3A 4KLFA 3JPPA 4AT7B 9ICMA 4KLEA 4LEZA 4RQ3A 9ICSA 4XRHA 5DBAA 9ICRA 2BPFA 3CK6A 2ZH1A 4M9LA 4P2HA 2DRAA 3K7DA 4E80A 2O5AA 4QZEA 4YMNA 5DB6A 4YMMA 1Q79A 3H37A 4TUPA 7ICEA 4I2CA 5J0OA 4KLHA 8ICIA 1KDHA 5D61A 4KLDA 3TFRA 7ICGA 1ZQMA 3JYYA 5J2HA 2BCQA 7ICPA 3ER8C 4R66A 8ICJA 2PXIA 9ICVA 5CFTA 4AT9B 2GWSA 2ZHAA 4QZ9A 1ZQWA 4LZDA 1XSNA 2BPCA 1BPEA 5DKWA 4X4VA 4RT3A 1ZQPA 1ZQIA 3C18A 3HWTA 4EEBA 4DOCA 4EBKA 8ICNA 4X4QA 2ZH4A 1R8BA 1RPLA 3ERCC 3OV7A 9ICQA 5J2AA 4UB4A 4YN4A 5D4BA 4MFFA 1ZQLA 4UB5A 4HX0A 7ICRA 4FO1A 1FA0A 4K9AA 2BBHA 3JPSA 3MDCA 1VFGA 1R8AA 3ISCA 5J0QA 3JPNA 9ICBA 4I2IA 4EEDA 3JPTA 4WC2A 5CFSA 2ZH2A 2GAFD 4K4IA 5CHEA 4RQ4A 4RWNA 3JCFA 4IG8A 4MF8A 4RT2A 4UAYA 4WC4A 4Z6DA 4LEVA 2FMQA 5J2BA 5B3QA 4M9JA 4RPYA 3RJFA 3OVSA 4MFAA 3OVAA 4RPZA 4ATBA 1ZJMA 5HRBA 2PFPA 3HX0A 3RJIA 1KEJA 3RH4A 4PH5A 4I2FA 5HRDA 1MIYA 2PFQA 3AQLA 4FH3A 4NXVA 5HRGA 2B56A 2ISOA 4X4NA 1JAJA 2BCSA 4KLUA 5HRFA 5J0XA 9ICWA 4YMOA 4AT7A 1MIVA 2ZH8A 5J2JA 1MIWA 4PHEA 2PFOA 1OU5A 2ZH7A 4RQ5A 3C5FA 5J0UA 4KLMA 7ICTA 1TVAA 2W9MA 1ZQRA 2M2WA 8ICAA 3HIYA 4P4PA 4XQ8A 8ICGA 1BPXA 7ICNA 4IQTA 4PPXA 4KLOA 3JPQA 9ICJA 4E8FA 7ICUA 4X0BA 3PHZA 3PMLA 3C2LA 4FHXA 4AT9A 3AU2A 4UD5A 2GA9D 2IHMA 3UXNA 5CA7A 2RFFA 4M2YA 8ICBA 4I2DA 1UETA 4QZFA 4WCWA 4I28A 4K8VA 4WC3A 7ICHA 8ICZA 2HN1A 5DECA 4N7RA 4K4GA 1ZQXA 4PGYA 4KM5A 4O5EA 3WFPA 4X0AA 4GXIA 1ZQOA 4WC0A 5F2VO 5DBCA 4FHVA 8ICMA 8ICWA 4P4MA 1ZQKA 4I2EA 8ICKA 4GXKA 5HRHA 4Z6CA 4JWMA 5CHGA 2DR7A 1UEVA 5CR0A 4RWOA 3V7KA 1XSPA 5BOLA 4JLXA 4F5PA 7ICQA 8ICOA 4NM2A 5IIOA 4QZ8A 4RPXA 4XA5A 2DR9A 5IIJA 4DOAA 5J0SA 1ZQBA 3NVOA 4I2BA 4NM1A 9ICXA 4OAIZ 3HW8A 5J0RA 4WBYA 4F5NA 4KLGA 4O5KA 7ICOA 1NO5A 1NOMA 3AU6A 2O1PA 1Q78A 3AQKA 5J2EA 4DOBA 3MDAA 1BPDA 3AQMA 4WC5A 2M2UA 4K4HA 1VJ7A 3OWGA 4O9MA 8ICHA 4QZHA 4M9NA 3C2KA 2BBJA 5D49A 3OVBA 4LEWA 8ICTA 8ICUA 4UB2A 2Q66A 3JPOA 4X5VA 4WBZA 1HUOA 1ZQCA 4RQ1A 8ICXA 7ICLA 4IQVA 4AT8B 4K96A 4PGQA 4M47A 1ZQJA 4DO9A 7ICVA 1ZQFA 4TUSA 1JQRA 3LQCB 4WC1A 5IIMA 8ICCA 3HJ4A 3MGHA 2VANA 9ICHA 5J2GA 4K99A 4K97A 1ZQTA 3HJ1A 4IQWA 3GDXA 4NXWA 3UXOA 1F5AA 4QZDA 4I27A 2BCRA 3RJGA 4I2HA 8ICPA 4JWNA 5J29A 3V7LA 2ISPA 9ICKA 8ICVA 4I0UA 4M9GA 3V72A 3H38A 4EGWA 3MGIA 1PX5A 4I2JA 5J2IA 4O68A 4O69A 2EWRA 4UBBA 3PMNA 3WFRE 8ICYA 1V4AA 4RQ6A 1TFYA 3RJKA 2DR8A 3WFQE 1BPZA 5IILA 7ICIA 4RQ7A 5DDMA 4PHDA 4RQ2A 4YCXA 2FMPA 5BOMA 4F5RA 3UQ2A 4FO6A 2ZH3A 1ZQEA 4KLSA 5J2DA 4KLLA 4WOYA 4NXUA 3OUYB 4KB6A 5D62A 4X4OA 5IIIA 5CFUA 5J0TA 5J2FA 2ZHBA 4RQ8A 4GXJA 8ICLA 2NRKA 5HRKA 2FMSA 3MBYA 4X4TA 4FHYA 9ICPA 9ICFA 3AUOA 4K9BA 3PNCA 4X4SA 9ICLA 3EF2A 1RZTA 3RJHA 5JTGA 1BPBA 2BE3A 5CP2A 5DDYA 5HR9A 5EOZA 5CWRA 3NWIA 4Z6FA 1ZQZA 2PBEA 5B3PA 1MQ2A 4UD4A 2BCVA 3UPQA 1ZQHA 4M0AA 5HHIA 3RH5A 4KLIA 4UBCA 4NY8A 3B0XA 3ISBA 4NKTA 5TZVA 8ICQA 2DR5A 5DB7A 4X4UA 1ZQUA 4TUQA 4I2AA 4AT8A 4LEYA 5CJ7A 4RQ0A 1TFWA 2P66A 4YD2A 2ID1A 5J0WA 7ICFA 9ICUA 1ZQQA 3UXPA 5DEDA 4I29A 2ZH6A 4UAWA 1XSLA 4UB1A 2BPGA 9ICNA 4IQUA 4EP7A 4M9HA 3C5GA 3TFSA 5HC9A 2I9GA 4Z6EA 4O67A 5J0YA 5D46A 5J2CA 4NLNA 4WQKA 4NKUA 3NKUA 4LZGA 3JZ0A 3OGUA 3K75D 4LVSA 5DBBA 4OAGA 2BCUA 2IHOA 4QZCA 4WC7A 5J0PA 4O5CA 3MCRA 2IUBA 4WH5A 4OAHA 5DB8A 4I2GA 3UPSA 8ICRA 4LT6A 1ZQGA 4EV6A 4TURA 3ER9B 5D63A 1HUZA 4UAZA 3H39A 1R8CA 9ICTA 2PFNA 4NXTA 5BPCA 8ICSA 3RJJA 4S3NA 5IIKA 4NLZA 5HHHA 2ZH5A 4K98A 2HHPA
chains in the Genus database with same CATH topology
4KLTA 4RWQA 4OAFA 3AQNA 1ZQVA 3C66A 1JN3A 9ICOA 2M2VA 3OUYA 3L9DA 2B51A 4O6AA 5J2KA 4PGXA 1UEUA 1JMSA 4NXZA 2M2TA 4F5OA 3B0YA 4QZAA 3LK9A 4R65A 1YLQA 9ICGA 4MF2A 4PHPA 7ICMA 4FHPA 4WC6A 4YD1A 5HRIA 8ICEA 9ICAA 1ZQNA 1KNYA 5IINA 3NYBA 1ZQAA 8ICFA 1MQ3A 1BPYA 4QZGA 9ICEA 4XUSA 1TV9A 3H3AA 3JPRA 4XQ7A 3RH6A 3RJEA 7ICKA 4M5DA 4EBJA 4FH5A 4PHAA 4NLKA 4MKPA 4X4PA 3ISDA 2B4VA 4KLJA 1ZQSA 7ICSA 4JLZA 4R63A 2DRBA 9ICCA 1ZQYA 1ZQDA 1R89A 1WOTA 4NXXA 4P4OA 2DVIA 4ATBB 7ICJA 3WFOA 5CB1A 4KLQA 5DB9A 9ICIA 4QZBA 1ZJNA 4MFCA 4E7XA 4M04A 5HRLA 4RWPA 3WFSC 2ZH9A 3UQ0A 4QZIA 4X4RA 4FHWA 4R64A 3V7JA 3C2MA 5HREA 4F5QA 4UB3A 4KLFA 3JPPA 4AT7B 9ICMA 4KLEA 4LEZA 4RQ3A 9ICSA 4XRHA 5DBAA 9ICRA 2BPFA 4M9LA 2ZH1A 4P2HA 2DRAA 4E80A 2O5AA 4QZEA 4YMNA 5DB6A 4YMMA 1Q79A 3H37A 4TUPA 7ICEA 4I2CA 5J0OA 4KLHA 8ICIA 1KDHA 4KLDA 3TFRA 7ICGA 1ZQMA 3JYYA 5J2HA 2BCQA 7ICPA 4R66A 8ICJA 2PXIA 9ICVA 4AT9B 2GWSA 2ZHAA 4QZ9A 1ZQWA 4LZDA 1XSNA 2BPCA 1BPEA 5DKWA 4X4VA 4RT3A 1ZQPA 1ZQIA 3C18A 3HWTA 4DOCA 4EBKA 8ICNA 4X4QA 2ZH4A 1R8BA 1RPLA 3OV7A 9ICQA 5J2AA 4UB4A 4YN4A 5D4BA 4MFFA 1ZQLA 4UB5A 7ICRA 1FA0A 4K9AA 3JPSA 3MDCA 1VFGA 1R8AA 3ISCA 5J0QA 3JPNA 9ICBA 4I2IA 3JPTA 4WC2A 2ZH2A 4K4IA 4RQ4A 4RWNA 4IG8A 4MF8A 4RT2A 4UAYA 4WC4A 4Z6DA 4LEVA 2FMQA 5J2BA 4M9JA 4RPYA 3RJFA 3OVSA 4MFAA 3OVAA 4RPZA 4ATBA 1ZJMA 5HRBA 2PFPA 3HX0A 3RJIA 1KEJA 3RH4A 4PH5A 4I2FA 5HRDA 1MIYA 2PFQA 3AQLA 4FH3A 4NXVA 5HRGA 2B56A 2ISOA 4X4NA 1JAJA 2BCSA 4KLUA 5HRFA 5J0XA 9ICWA 4YMOA 4AT7A 1MIVA 2ZH8A 5J2JA 1MIWA 4PHEA 2PFOA 1OU5A 2ZH7A 4RQ5A 3C5FA 5J0UA 4KLMA 7ICTA 1TVAA 2W9MA 1ZQRA 2M2WA 8ICAA 3HIYA 4P4PA 4XQ8A 8ICGA 1BPXA 7ICNA 4IQTA 4PPXA 4KLOA 3JPQA 9ICJA 4E8FA 7ICUA 4X0BA 3PMLA 3C2LA 4FHXA 4AT9A 3AU2A 4UD5A 2IHMA 3UXNA 5CA7A 2RFFA 4M2YA 8ICBA 4I2DA 1UETA 4QZFA 4WCWA 4I28A 4K8VA 4WC3A 7ICHA 8ICZA 5DECA 4K4GA 1ZQXA 4PGYA 4KM5A 4O5EA 3WFPA 4X0AA 4GXIA 1ZQOA 4WC0A 5F2VO 5DBCA 4FHVA 8ICMA 8ICWA 4P4MA 1ZQKA 4I2EA 8ICKA 4GXKA 5HRHA 4Z6CA 4JWMA 5CHGA 2DR7A 1UEVA 5CR0A 4RWOA 3V7KA 1XSPA 5BOLA 4JLXA 4F5PA 7ICQA 8ICOA 4NM2A 5IIOA 4QZ8A 4RPXA 4XA5A 2DR9A 5IIJA 4DOAA 5J0SA 1ZQBA 4I2BA 4NM1A 9ICXA 4OAIZ 3HW8A 5J0RA 4WBYA 4F5NA 4KLGA 4O5KA 7ICOA 1NO5A 1NOMA 3AU6A 2O1PA 1Q78A 5J2EA 3AQKA 4DOBA 3MDAA 1BPDA 3AQMA 4WC5A 2M2UA 4K4HA 1VJ7A 4O9MA 8ICHA 4QZHA 4M9NA 3C2KA 5D49A 3OVBA 4LEWA 8ICTA 8ICUA 4UB2A 2Q66A 3JPOA 4X5VA 4WBZA 1HUOA 1ZQCA 4RQ1A 8ICXA 7ICLA 4IQVA 4AT8B 4K96A 4PGQA 4M47A 1ZQJA 4DO9A 7ICVA 1ZQFA 4TUSA 1JQRA 3LQCB 4WC1A 5IIMA 8ICCA 3HJ4A 3MGHA 2VANA 9ICHA 5J2GA 4K99A 4K97A 1ZQTA 3HJ1A 4IQWA 3GDXA 4NXWA 3UXOA 1F5AA 4QZDA 4I27A 2BCRA 3RJGA 4I2HA 8ICPA 4JWNA 5J29A 3V7LA 2ISPA 9ICKA 8ICVA 4M9GA 3V72A 3H38A 3MGIA 1PX5A 4I2JA 5J2IA 4O68A 4O69A 4UBBA 3PMNA 3WFRE 8ICYA 1V4AA 4RQ6A 1TFYA 3RJKA 2DR8A 3WFQE 1BPZA 5IILA 7ICIA 4RQ7A 5DDMA 4PHDA 4RQ2A 4YCXA 2FMPA 5BOMA 4F5RA 3UQ2A 4FO6A 2ZH3A 1ZQEA 4KLSA 5J2DA 4KLLA 4WOYA 4NXUA 3OUYB 4KB6A 4X4OA 5IIIA 5J0TA 5J2FA 2ZHBA 4RQ8A 4GXJA 8ICLA 2NRKA 5HRKA 2FMSA 3MBYA 4X4TA 4FHYA 9ICPA 9ICFA 3AUOA 4K9BA 3PNCA 4X4SA 9ICLA 1RZTA 3RJHA 1BPBA 2BE3A 5CP2A 5DDYA 5HR9A 5EOZA 5CWRA 4Z6FA 1MQ2A 1ZQZA 2PBEA 2BCVA 4UD4A 3UPQA 1ZQHA 4M0AA 5HHIA 3RH5A 4KLIA 4UBCA 4NY8A 3B0XA 3ISBA 4NKTA 5TZVA 8ICQA 2DR5A 5DB7A 4X4UA 1ZQUA 4TUQA 4I2AA 4AT8A 4LEYA 5CJ7A 4RQ0A 1TFWA 2P66A 4YD2A 2ID1A 5J0WA 7ICFA 9ICUA 1ZQQA 3UXPA 5DEDA 4I29A 2ZH6A 4UAWA 1XSLA 4UB1A 2BPGA 9ICNA 4IQUA 4EP7A 4M9HA 3C5GA 3TFSA 5HC9A 2I9GA 4Z6EA 4O67A 5J0YA 5D46A 5J2CA 4NLNA 4NKUA 4LZGA 3JZ0A 3OGUA 3K75D 4LVSA 5DBBA 4OAGA 2BCUA 4QZCA 4WC7A 5J0PA 4O5CA 4OAHA 5DB8A 4I2GA 3UPSA 8ICRA 4LT6A 1ZQGA 4TURA 1HUZA 4UAZA 3H39A 1R8CA 9ICTA 2PFNA 4NXTA 5BPCA 8ICSA 3RJJA 4S3NA 5IIKA 4NLZA 5HHHA 2ZH5A 4K98A 2HHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLT A;  4RWQ A;  3AQN A;  1ZQV A;  3C66 A;  1JN3 A;  9ICO A;  2M2V A;  3OUY A;  3L9D A;  2B51 A;  5J2K A;  4PGX A;  1JMS A;  1UEU A;  4NXZ A;  2M2T A;  4F5O A;  3B0Y A;  4QZA A;  3LK9 A;  4R65 A;  1YLQ A;  9ICG A;  4MF2 A;  4PHP A;  7ICM A;  4FHP A;  4WC6 A;  4YD1 A;  5HRI A;  8ICE A;  9ICA A;  1ZQN A;  1KNY A;  5IIN A;  3NYB A;  1ZQA A;  8ICF A;  1MQ3 A;  1BPY A;  4QZG A;  9ICE A;  4XUS A;  1TV9 A;  3H3A A;  3JPR A;  4XQ7 A;  3RH6 A;  3RJE A;  7ICK A;  4M5D A;  4EBJ A;  4FH5 A;  4PHA A;  4NLK A;  4X4P A;  3ISD A;  2B4V A;  4KLJ A;  1ZQS A;  7ICS A;  4R63 A;  2DRB A;  9ICC A;  1ZQY A;  1ZQD A;  1R89 A;  1WOT A;  4P4O A;  2DVI A;  4ATB B;  7ICJ A;  3WFO A;  5CB1 A;  4KLQ A;  5DB9 A;  9ICI A;  4QZB A;  1ZJN A;  4MFC A;  4E7X A;  4M04 A;  5HRL A;  4RWP A;  3WFS C;  2ZH9 A;  3UQ0 A;  4QZI A;  4X4R A;  4FHW A;  4R64 A;  3V7J A;  3C2M A;  5HRE A;  4F5Q A;  4UB3 A;  4KLF A;  3JPP A;  4AT7 B;  9ICM A;  4KLE A;  4RQ3 A;  9ICS A;  4XRH A;  5DBA A;  9ICR A;  2BPF A;  4M9L A;  2ZH1 A;  4P2H A;  2DRA A;  4E80 A;  2O5A A;  4QZE A;  4YMN A;  5DB6 A;  4YMM A;  1Q79 A;  3H37 A;  4TUP A;  7ICE A;  4I2C A;  5J0O A;  4KLH A;  8ICI A;  1KDH A;  4KLD A;  3TFR A;  7ICG A;  1ZQM A;  3JYY A;  5J2H A;  2BCQ A;  7ICP A;  4R66 A;  8ICJ A;  2PXI A;  9ICV A;  4AT9 B;  2GWS A;  2ZHA A;  4QZ9 A;  1ZQW A;  4LZD A;  1XSN A;  2BPC A;  1BPE A;  5DKW A;  4X4V A;  4RT3 A;  1ZQP A;  1ZQI A;  3C18 A;  3HWT A;  4DOC A;  4EBK A;  8ICN A;  4X4Q A;  2ZH4 A;  1R8B A;  1RPL A;  3OV7 A;  9ICQ A;  5J2A A;  4UB4 A;  4YN4 A;  5D4B A;  4MFF A;  1ZQL A;  4UB5 A;  7ICR A;  1FA0 A;  3JPS A;  3MDC A;  1VFG A;  1R8A A;  3ISC A;  5J0Q A;  3JPN A;  9ICB A;  4I2I A;  3JPT A;  4WC2 A;  2ZH2 A;  4K4I A;  4RQ4 A;  4RWN A;  4IG8 A;  4MF8 A;  4RT2 A;  4UAY A;  4WC4 A;  4Z6D A;  2FMQ A;  5J2B A;  4M9J A;  4RPY A;  3RJF A;  3OVS A;  4MFA A;  4RPZ A;  3OVA A;  4ATB A;  1ZJM A;  5HRB A;  2PFP A;  3HX0 A;  3RJI A;  1KEJ A;  3RH4 A;  4PH5 A;  4I2F A;  5HRD A;  1MIY A;  2PFQ A;  3AQL A;  4FH3 A;  5HRG A;  2B56 A;  2ISO A;  4X4N A;  1JAJ A;  2BCS A;  4KLU A;  5HRF A;  5J0X A;  9ICW A;  4YMO A;  4AT7 A;  1MIV A;  5J2J A;  2ZH8 A;  1MIW A;  4PHE A;  2PFO A;  1OU5 A;  4RQ5 A;  2ZH7 A;  3C5F A;  5J0U A;  4KLM A;  7ICT A;  1TVA A;  2W9M A;  1ZQR A;  2M2W A;  8ICA A;  3HIY A;  4P4P A;  4XQ8 A;  8ICG A;  1BPX A;  7ICN A;  4IQT A;  4PPX A;  4KLO A;  3JPQ A;  9ICJ A;  4E8F A;  7ICU A;  4X0B A;  3PML A;  3C2L A;  4FHX A;  4AT9 A;  3AU2 A;  4UD5 A;  2IHM A;  3UXN A;  5CA7 A;  2RFF A;  4M2Y A;  8ICB A;  4I2D A;  1UET A;  4QZF A;  4WCW A;  4I28 A;  4WC3 A;  7ICH A;  8ICZ A;  5DEC A;  4K4G A;  1ZQX A;  4PGY A;  4O5E A;  3WFP A;  4X0A A;  4GXI A;  1ZQO A;  4WC0 A;  5F2V O;  5DBC A;  4FHV A;  8ICM A;  8ICW A;  4P4M A;  1ZQK A;  4I2E A;  8ICK A;  4GXK A;  5HRH A;  4Z6C A;  4JWM A;  5CHG A;  2DR7 A;  1UEV A;  5CR0 A;  4RWO A;  3V7K A;  1XSP A;  5BOL A;  4F5P A;  7ICQ A;  8ICO A;  4NM2 A;  5IIO A;  4QZ8 A;  4RPX A;  4XA5 A;  2DR9 A;  5IIJ A;  4DOA A;  5J0S A;  1ZQB A;  4I2B A;  4NM1 A;  9ICX A;  3HW8 A;  5J0R A;  4WBY A;  4F5N A;  4KLG A;  4O5K A;  7ICO A;  1NO5 A;  1NOM A;  3AU6 A;  2O1P A;  1Q78 A;  3AQK A;  5J2E A;  4DOB A;  3MDA A;  1BPD A;  3AQM A;  4WC5 A;  2M2U A;  4K4H A;  1VJ7 A;  4O9M A;  8ICH A;  4QZH A;  4M9N A;  3C2K A;  5D49 A;  3OVB A;  8ICT A;  8ICU A;  4UB2 A;  2Q66 A;  3JPO A;  4X5V A;  4WBZ A;  1HUO A;  1ZQC A;  4RQ1 A;  8ICX A;  7ICL A;  4IQV A;  4AT8 B;  4PGQ A;  4M47 A;  1ZQJ A;  4DO9 A;  7ICV A;  1ZQF A;  4TUS A;  1JQR A;  3LQC B;  4WC1 A;  5IIM A;  8ICC A;  3HJ4 A;  3MGH A;  2VAN A;  9ICH A;  5J2G A;  1ZQT A;  3HJ1 A;  4IQW A;  3GDX A;  3UXO A;  1F5A A;  4QZD A;  4I27 A;  2BCR A;  3RJG A;  4I2H A;  8ICP A;  4JWN A;  5J29 A;  3V7L A;  2ISP A;  9ICK A;  8ICV A;  4M9G A;  3V72 A;  3H38 A;  3MGI A;  1PX5 A;  4I2J A;  5J2I A;  4UBB A;  3PMN A;  3WFR E;  8ICY A;  1V4A A;  4RQ6 A;  1TFY A;  3RJK A;  2DR8 A;  3WFQ E;  1BPZ A;  5IIL A;  7ICI A;  4RQ7 A;  5DDM A;  4PHD A;  4RQ2 A;  4YCX A;  2FMP A;  5BOM A;  4F5R A;  3UQ2 A;  4FO6 A;  2ZH3 A;  1ZQE A;  4KLS A;  5J2D A;  4KLL A;  3OUY B;  4X4O A;  5III A;  5J0T A;  5J2F A;  4RQ8 A;  2ZHB A;  4GXJ A;  8ICL A;  2NRK A;  5HRK A;  2FMS A;  3MBY A;  4X4T A;  4FHY A;  9ICP A;  9ICF A;  3AUO A;  3PNC A;  4X4S A;  9ICL A;  1RZT A;  3RJH A;  1BPB A;  2BE3 A;  5CP2 A;  5DDY A;  5HR9 A;  5EOZ A;  5CWR A;  4Z6F A;  1MQ2 A;  1ZQZ A;  2PBE A;  2BCV A;  4UD4 A;  3UPQ A;  1ZQH A;  4M0A A;  5HHI A;  3RH5 A;  4KLI A;  4UBC A;  4NY8 A;  3B0X A;  3ISB A;  4NKT A;  5TZV A;  8ICQ A;  2DR5 A;  5DB7 A;  4I2A A;  1ZQU A;  4TUQ A;  4X4U A;  4AT8 A;  5CJ7 A;  4RQ0 A;  2P66 A;  7ICF A;  4YD2 A;  2ID1 A;  5J0W A;  1TFW A;  9ICU A;  1ZQQ A;  3UXP A;  5DED A;  4I29 A;  2ZH6 A;  4UAW A;  1XSL A;  4UB1 A;  2BPG A;  9ICN A;  4IQU A;  4EP7 A;  4M9H A;  3C5G A;  3TFS A;  5HC9 A;  2I9G A;  4Z6E A;  5J0Y A;  5D46 A;  5J2C A;  4NLN A;  4NKU A;  4LZG A;  3JZ0 A;  3OGU A;  3K75 D;  4LVS A;  5DBB A;  2BCU A;  4QZC A;  4WC7 A;  5J0P A;  4O5C A;  5DB8 A;  4I2G A;  3UPS A;  8ICR A;  4LT6 A;  1ZQG A;  4TUR A;  1HUZ A;  4UAZ A;  3H39 A;  1R8C A;  9ICT A;  2PFN A;  5BPC A;  8ICS A;  3RJJ A;  4S3N A;  5IIK A;  4NLZ A;  5HHH A;  2ZH5 A;  2HHP A; 
#chains in the Genus database with same CATH topology
 4KLT A;  4RWQ A;  4OAF A;  3AQN A;  1ZQV A;  3C66 A;  1JN3 A;  9ICO A;  2M2V A;  3OUY A;  3L9D A;  2B51 A;  4O6A A;  4XJE A;  5J2K A;  4PGX A;  1UEU A;  1JMS A;  4NXZ A;  2M2T A;  4F5O A;  3B0Y A;  4QZA A;  3LK9 A;  4R65 A;  1YLQ A;  9ICG A;  4MF2 A;  4PHP A;  7ICM A;  4FHP A;  4WC6 A;  4YD1 A;  5HRI A;  8ICE A;  9ICA A;  1ZQN A;  1KNY A;  5IIN A;  3NYB A;  1ZQA A;  8ICF A;  1MQ3 A;  1BPY A;  4QZG A;  9ICE A;  4XUS A;  1TV9 A;  3H3A A;  3JPR A;  4XQ7 A;  3RH6 A;  3RJE A;  2HN2 A;  7ICK A;  4M5D A;  4EBJ A;  4FH5 A;  4PHA A;  4NLK A;  4MKP A;  2FCL A;  4X4P A;  3ISD A;  2B4V A;  4KLJ A;  1ZQS A;  7ICS A;  4JLZ A;  4R63 A;  2DRB A;  9ICC A;  1ZQY A;  1ZQD A;  1R89 A;  4WQL A;  1WOT A;  4NXX A;  4P4O A;  2DVI A;  4ATB B;  7ICJ A;  3WFO A;  5CB1 A;  4KLQ A;  5DB9 A;  9ICI A;  4QZB A;  1ZJN A;  4MFC A;  4E7X A;  4M04 A;  5HRL A;  4RWP A;  3WFS C;  2ZH9 A;  3UQ0 A;  4QZI A;  1GPJ A;  4X4R A;  4FHW A;  4R64 A;  3V7J A;  3C2M A;  5HRE A;  4F5Q A;  4UB3 A;  4KLF A;  3JPP A;  4AT7 B;  9ICM A;  4KLE A;  4LEZ A;  4RQ3 A;  9ICS A;  4XRH A;  5DBA A;  9ICR A;  2BPF A;  3CK6 A;  2ZH1 A;  4M9L A;  4P2H A;  2DRA A;  3K7D A;  4E80 A;  2O5A A;  4QZE A;  4YMN A;  5DB6 A;  4YMM A;  1Q79 A;  3H37 A;  4TUP A;  7ICE A;  4I2C A;  5J0O A;  4KLH A;  8ICI A;  1KDH A;  5D61 A;  4KLD A;  3TFR A;  7ICG A;  1ZQM A;  3JYY A;  5J2H A;  2BCQ A;  7ICP A;  3ER8 C;  4R66 A;  8ICJ A;  2PXI A;  9ICV A;  5CFT A;  4AT9 B;  2GWS A;  2ZHA A;  4QZ9 A;  1ZQW A;  4LZD A;  1XSN A;  2BPC A;  1BPE A;  5DKW A;  4X4V A;  4RT3 A;  1ZQP A;  1ZQI A;  3C18 A;  3HWT A;  4EEB A;  4DOC A;  4EBK A;  8ICN A;  4X4Q A;  2ZH4 A;  1R8B A;  1RPL A;  3ERC C;  3OV7 A;  9ICQ A;  5J2A A;  4UB4 A;  4YN4 A;  5D4B A;  4MFF A;  1ZQL A;  4UB5 A;  4HX0 A;  7ICR A;  4FO1 A;  1FA0 A;  4K9A A;  2BBH A;  3JPS A;  3MDC A;  1VFG A;  1R8A A;  3ISC A;  5J0Q A;  3JPN A;  9ICB A;  4I2I A;  4EED A;  3JPT A;  4WC2 A;  5CFS A;  2ZH2 A;  2GAF D;  4K4I A;  5CHE A;  4RQ4 A;  4RWN A;  3JCF A;  4IG8 A;  4MF8 A;  4RT2 A;  4UAY A;  4WC4 A;  4Z6D A;  4LEV A;  2FMQ A;  5J2B A;  5B3Q A;  4M9J A;  4RPY A;  3RJF A;  3OVS A;  4MFA A;  3OVA A;  4RPZ A;  4ATB A;  1ZJM A;  5HRB A;  2PFP A;  3HX0 A;  3RJI A;  1KEJ A;  3RH4 A;  4PH5 A;  4I2F A;  5HRD A;  1MIY A;  2PFQ A;  3AQL A;  4FH3 A;  4NXV A;  5HRG A;  2B56 A;  2ISO A;  4X4N A;  1JAJ A;  2BCS A;  4KLU A;  5HRF A;  5J0X A;  9ICW A;  4YMO A;  4AT7 A;  1MIV A;  2ZH8 A;  5J2J A;  1MIW A;  4PHE A;  2PFO A;  1OU5 A;  2ZH7 A;  4RQ5 A;  3C5F A;  5J0U A;  4KLM A;  7ICT A;  1TVA A;  2W9M A;  1ZQR A;  2M2W A;  8ICA A;  3HIY A;  4P4P A;  4XQ8 A;  8ICG A;  1BPX A;  7ICN A;  4IQT A;  4PPX A;  4KLO A;  3JPQ A;  9ICJ A;  4E8F A;  7ICU A;  4X0B A;  3PHZ A;  3PML A;  3C2L A;  4FHX A;  4AT9 A;  3AU2 A;  4UD5 A;  2GA9 D;  2IHM A;  3UXN A;  5CA7 A;  2RFF A;  4M2Y A;  8ICB A;  4I2D A;  1UET A;  4QZF A;  4WCW A;  4I28 A;  4K8V A;  4WC3 A;  7ICH A;  8ICZ A;  2HN1 A;  5DEC A;  4N7R A;  4K4G A;  1ZQX A;  4PGY A;  4KM5 A;  4O5E A;  3WFP A;  4X0A A;  4GXI A;  1ZQO A;  4WC0 A;  5F2V O;  5DBC A;  4FHV A;  8ICM A;  8ICW A;  4P4M A;  1ZQK A;  4I2E A;  8ICK A;  4GXK A;  5HRH A;  4Z6C A;  4JWM A;  5CHG A;  2DR7 A;  1UEV A;  5CR0 A;  4RWO A;  3V7K A;  1XSP A;  5BOL A;  4JLX A;  4F5P A;  7ICQ A;  8ICO A;  4NM2 A;  5IIO A;  4QZ8 A;  4RPX A;  4XA5 A;  2DR9 A;  5IIJ A;  4DOA A;  5J0S A;  1ZQB A;  3NVO A;  4I2B A;  4NM1 A;  9ICX A;  4OAI Z;  3HW8 A;  5J0R A;  4WBY A;  4F5N A;  4KLG A;  4O5K A;  7ICO A;  1NO5 A;  1NOM A;  3AU6 A;  2O1P A;  1Q78 A;  3AQK A;  5J2E A;  4DOB A;  3MDA A;  1BPD A;  3AQM A;  4WC5 A;  2M2U A;  4K4H A;  1VJ7 A;  3OWG A;  4O9M A;  8ICH A;  4QZH A;  4M9N A;  3C2K A;  2BBJ A;  5D49 A;  3OVB A;  4LEW A;  8ICT A;  8ICU A;  4UB2 A;  2Q66 A;  3JPO A;  4X5V A;  4WBZ A;  1HUO A;  1ZQC A;  4RQ1 A;  8ICX A;  7ICL A;  4IQV A;  4AT8 B;  4K96 A;  4PGQ A;  4M47 A;  1ZQJ A;  4DO9 A;  7ICV A;  1ZQF A;  4TUS A;  1JQR A;  3LQC B;  4WC1 A;  5IIM A;  8ICC A;  3HJ4 A;  3MGH A;  2VAN A;  9ICH A;  5J2G A;  4K99 A;  4K97 A;  1ZQT A;  3HJ1 A;  4IQW A;  3GDX A;  4NXW A;  3UXO A;  1F5A A;  4QZD A;  4I27 A;  2BCR A;  3RJG A;  4I2H A;  8ICP A;  4JWN A;  5J29 A;  3V7L A;  2ISP A;  9ICK A;  8ICV A;  4I0U A;  4M9G A;  3V72 A;  3H38 A;  4EGW A;  3MGI A;  1PX5 A;  4I2J A;  5J2I A;  4O68 A;  4O69 A;  2EWR A;  4UBB A;  3PMN A;  3WFR E;  8ICY A;  1V4A A;  4RQ6 A;  1TFY A;  3RJK A;  2DR8 A;  3WFQ E;  1BPZ A;  5IIL A;  7ICI A;  4RQ7 A;  5DDM A;  4PHD A;  4RQ2 A;  4YCX A;  2FMP A;  5BOM A;  4F5R A;  3UQ2 A;  4FO6 A;  2ZH3 A;  1ZQE A;  4KLS A;  5J2D A;  4KLL A;  4WOY A;  4NXU A;  3OUY B;  4KB6 A;  5D62 A;  4X4O A;  5III A;  5CFU A;  5J0T A;  5J2F A;  2ZHB A;  4RQ8 A;  4GXJ A;  8ICL A;  2NRK A;  5HRK A;  2FMS A;  3MBY A;  4X4T A;  4FHY A;  9ICP A;  9ICF A;  3AUO A;  4K9B A;  3PNC A;  4X4S A;  9ICL A;  3EF2 A;  1RZT A;  3RJH A;  5JTG A;  1BPB A;  2BE3 A;  5CP2 A;  5DDY A;  5HR9 A;  5EOZ A;  5CWR A;  3NWI A;  4Z6F A;  1ZQZ A;  2PBE A;  5B3P A;  1MQ2 A;  4UD4 A;  2BCV A;  3UPQ A;  1ZQH A;  4M0A A;  5HHI A;  3RH5 A;  4KLI A;  4UBC A;  4NY8 A;  3B0X A;  3ISB A;  4NKT A;  5TZV A;  8ICQ A;  2DR5 A;  5DB7 A;  4X4U A;  1ZQU A;  4TUQ A;  4I2A A;  4AT8 A;  4LEY A;  5CJ7 A;  4RQ0 A;  1TFW A;  2P66 A;  4YD2 A;  2ID1 A;  5J0W A;  7ICF A;  9ICU A;  1ZQQ A;  3UXP A;  5DED A;  4I29 A;  2ZH6 A;  4UAW A;  1XSL A;  4UB1 A;  2BPG A;  9ICN A;  4IQU A;  4EP7 A;  4M9H A;  3C5G A;  3TFS A;  5HC9 A;  2I9G A;  4Z6E A;  4O67 A;  5J0Y A;  5D46 A;  5J2C A;  4NLN A;  4WQK A;  4NKU A;  3NKU A;  4LZG A;  3JZ0 A;  3OGU A;  3K75 D;  4LVS A;  5DBB A;  4OAG A;  2BCU A;  2IHO A;  4QZC A;  4WC7 A;  5J0P A;  4O5C A;  3MCR A;  2IUB A;  4WH5 A;  4OAH A;  5DB8 A;  4I2G A;  3UPS A;  8ICR A;  4LT6 A;  1ZQG A;  4EV6 A;  4TUR A;  3ER9 B;  5D63 A;  1HUZ A;  4UAZ A;  3H39 A;  1R8C A;  9ICT A;  2PFN A;  4NXT A;  5BPC A;  8ICS A;  3RJJ A;  4S3N A;  5IIK A;  4NLZ A;  5HHH A;  2ZH5 A;  4K98 A;  2HHP A; 
#chains in the Genus database with same CATH homology
 4KLT A;  4RWQ A;  4OAF A;  3AQN A;  1ZQV A;  3C66 A;  1JN3 A;  9ICO A;  2M2V A;  3OUY A;  3L9D A;  2B51 A;  4O6A A;  5J2K A;  4PGX A;  1UEU A;  1JMS A;  4NXZ A;  2M2T A;  4F5O A;  3B0Y A;  4QZA A;  3LK9 A;  4R65 A;  1YLQ A;  9ICG A;  4MF2 A;  4PHP A;  7ICM A;  4FHP A;  4WC6 A;  4YD1 A;  5HRI A;  8ICE A;  9ICA A;  1ZQN A;  1KNY A;  5IIN A;  3NYB A;  1ZQA A;  8ICF A;  1MQ3 A;  1BPY A;  4QZG A;  9ICE A;  4XUS A;  1TV9 A;  3H3A A;  3JPR A;  4XQ7 A;  3RH6 A;  3RJE A;  7ICK A;  4M5D A;  4EBJ A;  4FH5 A;  4PHA A;  4NLK A;  4MKP A;  4X4P A;  3ISD A;  2B4V A;  4KLJ A;  1ZQS A;  7ICS A;  4JLZ A;  4R63 A;  2DRB A;  9ICC A;  1ZQY A;  1ZQD A;  1R89 A;  1WOT A;  4NXX A;  4P4O A;  2DVI A;  4ATB B;  7ICJ A;  3WFO A;  5CB1 A;  4KLQ A;  5DB9 A;  9ICI A;  4QZB A;  1ZJN A;  4MFC A;  4E7X A;  4M04 A;  5HRL A;  4RWP A;  3WFS C;  2ZH9 A;  3UQ0 A;  4QZI A;  4X4R A;  4FHW A;  4R64 A;  3V7J A;  3C2M A;  5HRE A;  4F5Q A;  4UB3 A;  4KLF A;  3JPP A;  4AT7 B;  9ICM A;  4KLE A;  4LEZ A;  4RQ3 A;  9ICS A;  4XRH A;  5DBA A;  9ICR A;  2BPF A;  4M9L A;  2ZH1 A;  4P2H A;  2DRA A;  4E80 A;  2O5A A;  4QZE A;  4YMN A;  5DB6 A;  4YMM A;  1Q79 A;  3H37 A;  4TUP A;  7ICE A;  4I2C A;  5J0O A;  4KLH A;  8ICI A;  1KDH A;  4KLD A;  3TFR A;  7ICG A;  1ZQM A;  3JYY A;  5J2H A;  2BCQ A;  7ICP A;  4R66 A;  8ICJ A;  2PXI A;  9ICV A;  4AT9 B;  2GWS A;  2ZHA A;  4QZ9 A;  1ZQW A;  4LZD A;  1XSN A;  2BPC A;  1BPE A;  5DKW A;  4X4V A;  4RT3 A;  1ZQP A;  1ZQI A;  3C18 A;  3HWT A;  4DOC A;  4EBK A;  8ICN A;  4X4Q A;  2ZH4 A;  1R8B A;  1RPL A;  3OV7 A;  9ICQ A;  5J2A A;  4UB4 A;  4YN4 A;  5D4B A;  4MFF A;  1ZQL A;  4UB5 A;  7ICR A;  1FA0 A;  4K9A A;  3JPS A;  3MDC A;  1VFG A;  1R8A A;  3ISC A;  5J0Q A;  3JPN A;  9ICB A;  4I2I A;  3JPT A;  4WC2 A;  2ZH2 A;  4K4I A;  4RQ4 A;  4RWN A;  4IG8 A;  4MF8 A;  4RT2 A;  4UAY A;  4WC4 A;  4Z6D A;  4LEV A;  2FMQ A;  5J2B A;  4M9J A;  4RPY A;  3RJF A;  3OVS A;  4MFA A;  3OVA A;  4RPZ A;  4ATB A;  1ZJM A;  5HRB A;  2PFP A;  3HX0 A;  3RJI A;  1KEJ A;  3RH4 A;  4PH5 A;  4I2F A;  5HRD A;  1MIY A;  2PFQ A;  3AQL A;  4FH3 A;  4NXV A;  5HRG A;  2B56 A;  2ISO A;  4X4N A;  1JAJ A;  2BCS A;  4KLU A;  5HRF A;  5J0X A;  9ICW A;  4YMO A;  4AT7 A;  1MIV A;  2ZH8 A;  5J2J A;  1MIW A;  4PHE A;  2PFO A;  1OU5 A;  2ZH7 A;  4RQ5 A;  3C5F A;  5J0U A;  4KLM A;  7ICT A;  1TVA A;  2W9M A;  1ZQR A;  2M2W A;  8ICA A;  3HIY A;  4P4P A;  4XQ8 A;  8ICG A;  1BPX A;  7ICN A;  4IQT A;  4PPX A;  4KLO A;  3JPQ A;  9ICJ A;  4E8F A;  7ICU A;  4X0B A;  3PML A;  3C2L A;  4FHX A;  4AT9 A;  3AU2 A;  4UD5 A;  2IHM A;  3UXN A;  5CA7 A;  2RFF A;  4M2Y A;  8ICB A;  4I2D A;  1UET A;  4QZF A;  4WCW A;  4I28 A;  4K8V A;  4WC3 A;  7ICH A;  8ICZ A;  5DEC A;  4K4G A;  1ZQX A;  4PGY A;  4KM5 A;  4O5E A;  3WFP A;  4X0A A;  4GXI A;  1ZQO A;  4WC0 A;  5F2V O;  5DBC A;  4FHV A;  8ICM A;  8ICW A;  4P4M A;  1ZQK A;  4I2E A;  8ICK A;  4GXK A;  5HRH A;  4Z6C A;  4JWM A;  5CHG A;  2DR7 A;  1UEV A;  5CR0 A;  4RWO A;  3V7K A;  1XSP A;  5BOL A;  4JLX A;  4F5P A;  7ICQ A;  8ICO A;  4NM2 A;  5IIO A;  4QZ8 A;  4RPX A;  4XA5 A;  2DR9 A;  5IIJ A;  4DOA A;  5J0S A;  1ZQB A;  4I2B A;  4NM1 A;  9ICX A;  4OAI Z;  3HW8 A;  5J0R A;  4WBY A;  4F5N A;  4KLG A;  4O5K A;  7ICO A;  1NO5 A;  1NOM A;  3AU6 A;  2O1P A;  1Q78 A;  5J2E A;  3AQK A;  4DOB A;  3MDA A;  1BPD A;  3AQM A;  4WC5 A;  2M2U A;  4K4H A;  1VJ7 A;  4O9M A;  8ICH A;  4QZH A;  4M9N A;  3C2K A;  5D49 A;  3OVB A;  4LEW A;  8ICT A;  8ICU A;  4UB2 A;  2Q66 A;  3JPO A;  4X5V A;  4WBZ A;  1HUO A;  1ZQC A;  4RQ1 A;  8ICX A;  7ICL A;  4IQV A;  4AT8 B;  4K96 A;  4PGQ A;  4M47 A;  1ZQJ A;  4DO9 A;  7ICV A;  1ZQF A;  4TUS A;  1JQR A;  3LQC B;  4WC1 A;  5IIM A;  8ICC A;  3HJ4 A;  3MGH A;  2VAN A;  9ICH A;  5J2G A;  4K99 A;  4K97 A;  1ZQT A;  3HJ1 A;  4IQW A;  3GDX A;  4NXW A;  3UXO A;  1F5A A;  4QZD A;  4I27 A;  2BCR A;  3RJG A;  4I2H A;  8ICP A;  4JWN A;  5J29 A;  3V7L A;  2ISP A;  9ICK A;  8ICV A;  4M9G A;  3V72 A;  3H38 A;  3MGI A;  1PX5 A;  4I2J A;  5J2I A;  4O68 A;  4O69 A;  4UBB A;  3PMN A;  3WFR E;  8ICY A;  1V4A A;  4RQ6 A;  1TFY A;  3RJK A;  2DR8 A;  3WFQ E;  1BPZ A;  5IIL A;  7ICI A;  4RQ7 A;  5DDM A;  4PHD A;  4RQ2 A;  4YCX A;  2FMP A;  5BOM A;  4F5R A;  3UQ2 A;  4FO6 A;  2ZH3 A;  1ZQE A;  4KLS A;  5J2D A;  4KLL A;  4WOY A;  4NXU A;  3OUY B;  4KB6 A;  4X4O A;  5III A;  5J0T A;  5J2F A;  2ZHB A;  4RQ8 A;  4GXJ A;  8ICL A;  2NRK A;  5HRK A;  2FMS A;  3MBY A;  4X4T A;  4FHY A;  9ICP A;  9ICF A;  3AUO A;  4K9B A;  3PNC A;  4X4S A;  9ICL A;  1RZT A;  3RJH A;  1BPB A;  2BE3 A;  5CP2 A;  5DDY A;  5HR9 A;  5EOZ A;  5CWR A;  4Z6F A;  1MQ2 A;  1ZQZ A;  2PBE A;  2BCV A;  4UD4 A;  3UPQ A;  1ZQH A;  4M0A A;  5HHI A;  3RH5 A;  4KLI A;  4UBC A;  4NY8 A;  3B0X A;  3ISB A;  4NKT A;  5TZV A;  8ICQ A;  2DR5 A;  5DB7 A;  4X4U A;  1ZQU A;  4TUQ A;  4I2A A;  4AT8 A;  4LEY A;  5CJ7 A;  4RQ0 A;  1TFW A;  2P66 A;  4YD2 A;  2ID1 A;  5J0W A;  7ICF A;  9ICU A;  1ZQQ A;  3UXP A;  5DED A;  4I29 A;  2ZH6 A;  4UAW A;  1XSL A;  4UB1 A;  2BPG A;  9ICN A;  4IQU A;  4EP7 A;  4M9H A;  3C5G A;  3TFS A;  5HC9 A;  2I9G A;  4Z6E A;  4O67 A;  5J0Y A;  5D46 A;  5J2C A;  4NLN A;  4NKU A;  4LZG A;  3JZ0 A;  3OGU A;  3K75 D;  4LVS A;  5DBB A;  4OAG A;  2BCU A;  4QZC A;  4WC7 A;  5J0P A;  4O5C A;  4OAH A;  5DB8 A;  4I2G A;  3UPS A;  8ICR A;  4LT6 A;  1ZQG A;  4TUR A;  1HUZ A;  4UAZ A;  3H39 A;  1R8C A;  9ICT A;  2PFN A;  4NXT A;  5BPC A;  8ICS A;  3RJJ A;  4S3N A;  5IIK A;  4NLZ A;  5HHH A;  2ZH5 A;  4K98 A;  2HHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...