4NKTA

Structure of cid1 in complex with the utp analog umpnpp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 111
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nktA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nktA02
9ICCA 5CWRA 4IQWA 5J2KA 4NY8A 7ICFA 4QZ8A 8ICFA 2ZH3A 3AU2A 4RT2A 4X0BA 3JPSA 4NXZA 1ZQFA 5HREA 1R8CA 4KLFA 1ZQJA 4YD1A 5F2VO 3C18A 4FHPA 3B0YA 4QZDA 7ICEA 4RQ6A 3AQLA 3MBYA 4YMOA 4PGXA 3JPQA 4DOCA 9ICXA 8ICRA 5BOMA 3WFOA 4X4OA 4E7XA 1ZQOA 4KLHA 5HRGA 3OV7A 3HIYA 3V7LA 9ICFA 2ZH7A 4UBBA 1ZQLA 4O5EA 4AT8B 4P2HA 1ZQWA 4UB2A 8ICPA 4KLIA 1XSLA 2FMQA 4KLDA 7ICOA 1XSNA 4RQ4A 1MIVA 3JPNA 3HJ4A 7ICMA 1UETA 5DB6A 4R66A 1TV9A 4I2IA 3WFPA 4UD4A 8ICJA 4PH5A 2O5AA 4XRHA 1VFGA 3RJKA 2ISPA 2M2WA 8ICUA 1ZQNA 4X5VA 9ICSA 4FH5A 3HX0A 1JAJA 5CB1A 4NKTA 3JYYA 4X4QA 4UB5A 4KLSA 8ICEA 1ZQRA 1BPXA 2PXIA 4M9NA 4WC0A 1TFYA 3UXPA 4AT7A 4EBJA 4UAZA 4NLKA 4F5NA 1JN3A 1ZQXA 5DB7A 2BPCA 3UQ0A 4E80A 4WC5A 5BOLA 3PMLA 5J0UA 3ISCA 2Q66A 4X4UA 5HRBA 3OUYA 9ICOA 1ZQTA 5IIJA 2BPFA 4F5PA 3TFSA 5J0PA 4E8FA 2BE3A 4AT9B 1ZQQA 9ICGA 4KLQA 7ICKA 3OGUA 4LZDA 1R89A 4KLMA 2GWSA 4RQ3A 4ATBA 5HRKA 1XSPA 2I9GA 4I2DA 4X4TA 4UBCA 4MF2A 4WBZA 4P4OA 5J2HA 2M2UA 4AT8A 4M9JA 3LK9A 5BPCA 4RPYA 2DRAA 4I2FA 1ZQKA 1R8BA 4X4RA 4WC1A 1ZQAA 1ZJMA 1RZTA 5J0XA 9ICPA 3MDCA 1ZQZA 1ZQPA 4AT9A 7ICHA 9ICLA 4WBYA 2ZHBA 4M0AA 4I2CA 4X0AA 7ICIA 5CJ7A 7ICJA 5DDYA 4LVSA 3LQCB 9ICWA 2NRKA 4FHVA 4MFAA 4RQ0A 3H3AA 5J0QA 4M04A 4S3NA 2DVIA 4R64A 3AUOA 4RPXA 4UB4A 1JMSA 3AQMA 3HWTA 4YMMA 4M9HA 5IIIA 5D4BA 5HRDA 3HW8A 1Q79A 2BCVA 5HR9A 3L9DA 4KLTA 5DEDA 5IIKA 4WC3A 2B51A 4RQ7A 4WC4A 4GXJA 1HUZA 5HC9A 5CA7A 4RQ1A 3V7KA 3OVBA 3V72A 1PX5A 1OU5A 4F5OA 5J0YA 4JWMA 3C2LA 8ICYA 4RQ8A 4LZGA 5HRHA 3C2KA 8ICOA 4AT7B 3HJ1A 8ICSA 4XQ8A 4DOBA 2BCUA 2ZH8A 4KLGA 4DO9A 4I2GA 4EP7A 2ZH4A 5CP2A 4LT6A 5IIOA 1JQRA 3AQKA 4X4VA 4QZ9A 4KLEA 8ICWA 3K75D 5CR0A 2ZH1A 7ICQA 4XUSA 4XA5A 4MFFA 4RWQA 4FH3A 1HUOA 5D49A 4NM2A 4KLLA 5DBAA 5DBCA 4F5QA 7ICRA 3RJFA 2VANA 2DR5A 4PHEA 8ICBA 4IG8A 2FMSA 4K4HA 3WFSC 4X4SA 2HHPA 1ZQUA 2O1PA 2ZH5A 1ZJNA 4FHYA 4WC7A 1RPLA 2IHMA 8ICIA 4F5RA 2BCSA 1F5AA 3MGIA 5J2FA 4K4GA 3AQNA 4TURA 9ICTA 5HHIA 4EBKA 4PHPA 4I2AA 1ZQIA 1V4AA 1ZQVA 3UXNA 9ICHA 2DR9A 4I2BA 4RPZA 2RFFA 3RJGA 3TFRA 7ICUA 4I2HA 3V7JA 1ZQGA 4QZIA 2BCQA 2B56A 4KLJA 4M9LA 5J2JA 5HRIA 4QZBA 4NLNA 3H39A 4IQVA 4KLOA 8ICXA 2P66A 1NOMA 2ID1A 4I27A 8ICGA 9ICIA 8ICNA 5DBBA 4I28A 3PNCA 1MIYA 3OVSA 4M47A 3ISDA 4PHDA 8ICMA 2ZH6A 2PFNA 9ICAA 1NO5A 4UB3A 3RJJA 9ICJA 8ICLA 4MF8A 1BPEA 5DB8A 3NYBA 9ICMA 1KDHA 2PBEA 4QZAA 8ICVA 4P4PA 4RQ2A 3UPQA 5J2IA 3JPPA 7ICSA 1BPBA 5J2EA 4UAWA 4WCWA 3H37A 1UEVA 9ICRA 1TFWA 5TZVA 4TUQA 3MDAA 4PGYA 1ZQEA 4YCXA 8ICTA 4RWNA 5J0SA 4QZGA 3H38A 7ICTA 5J2DA 5HRLA 1WOTA 8ICQA 4NM1A 4RQ5A 9ICNA 2W9MA 1BPZA 5J0WA 1KNYA 1ZQHA 5IIMA 2DRBA 4Z6FA 4I2JA 5HHHA 1ZQMA 7ICNA 9ICQA 1KEJA 3JPTA 3AU6A 3RH6A 4MFCA 3WFRE 8ICZA 4PPXA 5DB9A 4I29A 3C66A 4X4NA 4R63A 2BPGA 5J0OA 5D46A 4P4MA 1BPYA 5J2GA 3UQ2A 4UAYA 4IQUA 1MQ3A 4PHAA 3C5FA 3RH4A 4WC6A 4XQ7A 3ISBA 4GXIA 2PFQA 8ICKA 2ZH9A 4YMNA 5IILA 1ZQCA 9ICVA 4DOAA 4YN4A 4KLUA 3RJEA 5DECA 7ICVA 4PGQA 3WFQE 4M5DA 3UPSA 4YD2A 1MQ2A 4FHWA 2PFPA 5IINA 1VJ7A 5J2CA 1YLQA 3JZ0A 4FHXA 4WC2A 3B0XA 7ICPA 2ZHAA 1TVAA 3C5GA 2BCRA 4M2YA 4QZEA 4O9MA 4O5KA 4R65A 1ZQBA 5HRFA 3MGHA 2ISOA 2PFOA 5EOZA 3RH5A 8ICCA 5J0TA 9ICKA 2DR8A 2B4VA 4UD5A 3JPRA 1ZQSA 1MIWA 4QZFA 4RWOA 4Z6EA 8ICHA 3GDXA 3RJIA 5CHGA 4UB1A 1ZQYA 3UXOA 4X4PA 5J0RA 4TUPA 4NKUA 1UEUA 3RJHA 4RWPA 4RT3A 3OUYB 3OVAA 1ZQDA 7ICLA 4K4IA 4Z6CA 4GXKA 4FO6A 1FA0A 3PMNA 3C2MA 9ICUA 1R8AA 3JPOA 1BPDA 5DKWA 7ICGA 4O5CA 9ICEA 4TUSA 2ZH2A 1Q78A 4ATBB 2M2TA 4Z6DA 5J2AA 4IQTA 4M9GA 8ICAA 5DDMA 2DR7A 2M2VA 4I2EA 4QZHA 5J29A 4NLZA 2FMPA 9ICBA 4QZCA 5J2BA 4JWNA
chains in the Genus database with same CATH superfamily
9ICCA 5CWRA 4WQKA 4IQWA 5J2KA 4NY8A 7ICFA 4QZ8A 8ICFA 2ZH3A 3AU2A 4RT2A 4X0BA 3JPSA 4FO1A 4NXZA 1ZQFA 5HREA 1R8CA 4KLFA 1ZQJA 4YD1A 5F2VO 3C18A 4FHPA 3B0YA 4QZDA 7ICEA 4RQ6A 3AQLA 3MBYA 4YMOA 4PGXA 3JPQA 4DOCA 9ICXA 8ICRA 5BOMA 3WFOA 4X4OA 4E7XA 1ZQOA 4KLHA 5HRGA 3OV7A 3HIYA 4EV6A 3V7LA 9ICFA 2ZH7A 3ER9B 4UBBA 1ZQLA 4O5EA 4AT8B 4P2HA 2BBHA 1ZQWA 4UB2A 8ICPA 4KLIA 4K8VA 2HN2A 1XSLA 2FMQA 4KLDA 7ICOA 1XSNA 4RQ4A 4NXWA 1MIVA 3JPNA 3HJ4A 7ICMA 1UETA 5DB6A 4R66A 1TV9A 4I2IA 3WFPA 4UD4A 8ICJA 4PH5A 2O5AA 4XRHA 1VFGA 3RJKA 2ISPA 2M2WA 8ICUA 1ZQNA 4X5VA 9ICSA 4FH5A 3HX0A 1JAJA 5CB1A 3PHZA 4NKTA 4X4QA 3JYYA 4UB5A 4KLSA 2BBJA 8ICEA 1ZQRA 1BPXA 2PXIA 4M9NA 1TFYA 4WC0A 3UXPA 4AT7A 4EBJA 4UAZA 4NLKA 3MCRA 3K7DA 4F5NA 4O67A 1JN3A 1ZQXA 5DB7A 2BPCA 3UQ0A 4E80A 4WC5A 5BOLA 4WOYA 3PMLA 5J0UA 3ISCA 2Q66A 4X4UA 3OUYA 5HRBA 9ICOA 1ZQTA 5IIJA 2BPFA 4F5PA 5CFTA 3TFSA 4LEZA 5J0PA 4E8FA 4NXUA 2BE3A 4AT9B 1ZQQA 9ICGA 4KLQA 7ICKA 3OGUA 4LZDA 1R89A 4XJEA 4KLMA 2GWSA 4RQ3A 4ATBA 5HRKA 1XSPA 2I9GA 4I2DA 4X4TA 4K97A 5D63A 4UBCA 4MF2A 4WBZA 4P4OA 5J2HA 2M2UA 4LEWA 4AT8A 4M9JA 3LK9A 4O68A 5BPCA 4RPYA 2DRAA 4I2FA 1ZQKA 1R8BA 4X4RA 4WC1A 1ZQAA 1ZJMA 1RZTA 4LEYA 5J0XA 9ICPA 3MDCA 1ZQZA 4EEDA 4AT9A 1ZQPA 7ICHA 9ICLA 4WBYA 2ZHBA 4M0AA 4I2CA 4X0AA 4N7RA 7ICIA 5CJ7A 7ICJA 4OAFA 5DDYA 4LVSA 3LQCB 5CFUA 9ICWA 2NRKA 4FHVA 4MFAA 4RQ0A 3H3AA 3ERCC 5J0QA 4M04A 4S3NA 4KM5A 2DVIA 3EF2A 4R64A 3AUOA 4RPXA 5D61A 4UB4A 1JMSA 3AQMA 3HWTA 4YMMA 4M9HA 5IIIA 5D4BA 5HRDA 3HW8A 1Q79A 2HN1A 2BCVA 5HR9A 3L9DA 4KLTA 4JLXA 5DEDA 5IIKA 4WC3A 2B51A 4RQ7A 4WC4A 4GXJA 1HUZA 4OAIZ 5HC9A 5CA7A 4RQ1A 3V7KA 3OVBA 3V72A 1PX5A 4WQLA 4I0UA 1OU5A 4F5OA 5J0YA 4JWMA 3C2LA 8ICYA 4RQ8A 4LZGA 5HRHA 3C2KA 8ICOA 4AT7B 3HJ1A 8ICSA 4XQ8A 4DOBA 2BCUA 2ZH8A 4KLGA 4DO9A 4I2GA 4EP7A 4O6AA 2ZH4A 5CP2A 4LT6A 5IIOA 1JQRA 4X4VA 3AQKA 5CHEA 4QZ9A 4LEVA 4KLEA 8ICWA 3K75D 5CR0A 2ZH1A 7ICQA 4XUSA 4XA5A 4MFFA 4RWQA 4FH3A 4EGWA 1HUOA 3NVOA 4NM2A 5D49A 5DBAA 4KLLA 4NXVA 5DBCA 4F5QA 7ICRA 3RJFA 2VANA 2DR5A 4PHEA 8ICBA 4IG8A 2FMSA 4K4HA 3WFSC 4X4SA 2HHPA 1ZQUA 3ER8C 2O1PA 2ZH5A 1ZJNA 4FHYA 4WC7A 1RPLA 2IHMA 8ICIA 4F5RA 4WH5A 2BCSA 1F5AA 3MGIA 5J2FA 4K4GA 4NXXA 3AQNA 4TURA 9ICTA 5HHIA 4EBKA 2GA9D 4PHPA 4I2AA 2IHOA 1ZQIA 1V4AA 1ZQVA 3UXNA 9ICHA 2DR9A 4I2BA 4RPZA 4K96A 2RFFA 3RJGA 3TFRA 7ICUA 4I2HA 3V7JA 1ZQGA 4QZIA 2BCQA 2B56A 4KLJA 4M9LA 5J2JA 4K9BA 5HRIA 4QZBA 4NLNA 3H39A 4IQVA 4KLOA 8ICXA 2P66A 1NOMA 2ID1A 4I27A 8ICGA 9ICIA 8ICNA 4OAHA 5CFSA 5DBBA 4I28A 3PNCA 1MIYA 3OVSA 4M47A 3ISDA 4PHDA 8ICMA 2ZH6A 4HX0A 2PFNA 9ICAA 3NWIA 1NO5A 5B3PA 4UB3A 3RJJA 9ICJA 8ICLA 4MF8A 1BPEA 5DB8A 3NYBA 9ICMA 1KDHA 2PBEA 4QZAA 8ICVA 4P4PA 4RQ2A 3UPQA 5J2IA 3JPPA 7ICSA 1BPBA 5J2EA 4UAWA 4WCWA 3H37A 1UEVA 9ICRA 1TFWA 5TZVA 4TUQA 4MKPA 3MDAA 4PGYA 1ZQEA 4YCXA 8ICTA 4RWNA 5J0SA 4QZGA 3H38A 7ICTA 4JLZA 5J2DA 2GAFD 5HRLA 1WOTA 8ICQA 4NM1A 4RQ5A 9ICNA 2W9MA 1BPZA 2IUBA 5J0WA 1KNYA 1ZQHA 5IIMA 2DRBA 4Z6FA 4I2JA 5HHHA 1ZQMA 7ICNA 9ICQA 1KEJA 3JPTA 3AU6A 3RH6A 4MFCA 4EEBA 3WFRE 8ICZA 4PPXA 5DB9A 4I29A 3C66A 4NXTA 4X4NA 4R63A 2BPGA 5J0OA 5D46A 4P4MA 1BPYA 5J2GA 3UQ2A 4UAYA 4IQUA 2FCLA 2EWRA 1MQ3A 4KB6A 4PHAA 3C5FA 3RH4A 4WC6A 4XQ7A 4K99A 3ISBA 4GXIA 2PFQA 3CK6A 8ICKA 2ZH9A 4YMNA 5IILA 1ZQCA 9ICVA 4DOAA 4YN4A 4KLUA 3RJEA 5DECA 7ICVA 4PGQA 3WFQE 4M5DA 3UPSA 4YD2A 1MQ2A 4FHWA 2PFPA 5IINA 1VJ7A 5J2CA 1YLQA 3JZ0A 5JTGA 4FHXA 4WC2A 3B0XA 7ICPA 2ZHAA 1TVAA 3C5GA 2BCRA 4M2YA 4QZEA 4OAGA 4O9MA 4O5KA 4R65A 1ZQBA 5B3QA 5HRFA 3OWGA 3MGHA 3NKUA 5D62A 2ISOA 5EOZA 3RH5A 2PFOA 4O69A 5J0TA 8ICCA 9ICKA 2DR8A 2B4VA 4UD5A 3JPRA 1ZQSA 1MIWA 4QZFA 4RWOA 4Z6EA 8ICHA 3GDXA 3RJIA 5CHGA 4UB1A 1ZQYA 4X4PA 3UXOA 5J0RA 4TUPA 1UEUA 4NKUA 3RJHA 4RWPA 4RT3A 3OUYB 3OVAA 1GPJA 1ZQDA 7ICLA 4K4IA 4Z6CA 4GXKA 4FO6A 1FA0A 3PMNA 3C2MA 9ICUA 1R8AA 4K9AA 3JPOA 1BPDA 5DKWA 7ICGA 4O5CA 9ICEA 4TUSA 2ZH2A 1Q78A 4ATBB 2M2TA 4Z6DA 5J2AA 4IQTA 4M9GA 8ICAA 2DR7A 5DDMA 2M2VA 4I2EA 4QZHA 5J29A 4K98A 4NLZA 3JCFA 2FMPA 9ICBA 4QZCA 5J2BA 4JWNA
chains in the Genus database with same CATH topology
9ICCA 5CWRA 4IQWA 5J2KA 4NY8A 7ICFA 4QZ8A 8ICFA 2ZH3A 3AU2A 4RT2A 4X0BA 3JPSA 4NXZA 1ZQFA 5HREA 1R8CA 4KLFA 1ZQJA 4YD1A 5F2VO 3C18A 4FHPA 3B0YA 4QZDA 7ICEA 4RQ6A 3AQLA 3MBYA 4YMOA 4PGXA 3JPQA 4DOCA 9ICXA 8ICRA 5BOMA 3WFOA 4X4OA 4E7XA 1ZQOA 4KLHA 5HRGA 3OV7A 3HIYA 3V7LA 9ICFA 2ZH7A 4UBBA 1ZQLA 4O5EA 4AT8B 4P2HA 1ZQWA 4UB2A 8ICPA 4KLIA 4K8VA 1XSLA 2FMQA 4KLDA 7ICOA 1XSNA 4RQ4A 4NXWA 1MIVA 3JPNA 3HJ4A 7ICMA 1UETA 5DB6A 4R66A 1TV9A 4I2IA 3WFPA 4UD4A 8ICJA 4PH5A 2O5AA 4XRHA 1VFGA 3RJKA 2ISPA 2M2WA 8ICUA 1ZQNA 4X5VA 9ICSA 4FH5A 3HX0A 1JAJA 5CB1A 4NKTA 4X4QA 3JYYA 4UB5A 4KLSA 8ICEA 1ZQRA 1BPXA 2PXIA 4M9NA 1TFYA 4WC0A 3UXPA 4AT7A 4EBJA 4UAZA 4NLKA 4F5NA 4O67A 1JN3A 1ZQXA 5DB7A 2BPCA 3UQ0A 4E80A 4WC5A 5BOLA 4WOYA 3PMLA 5J0UA 3ISCA 2Q66A 4X4UA 3OUYA 5HRBA 9ICOA 1ZQTA 5IIJA 2BPFA 4F5PA 3TFSA 4LEZA 5J0PA 4E8FA 4NXUA 2BE3A 4AT9B 1ZQQA 9ICGA 4KLQA 7ICKA 3OGUA 4LZDA 1R89A 4KLMA 2GWSA 4RQ3A 4ATBA 5HRKA 1XSPA 2I9GA 4I2DA 4X4TA 4K97A 4UBCA 4MF2A 4WBZA 4P4OA 5J2HA 2M2UA 4LEWA 4AT8A 4M9JA 3LK9A 4O68A 5BPCA 4RPYA 2DRAA 4I2FA 1ZQKA 1R8BA 4X4RA 4WC1A 1ZQAA 1ZJMA 1RZTA 4LEYA 5J0XA 9ICPA 3MDCA 1ZQZA 1ZQPA 4AT9A 7ICHA 9ICLA 4WBYA 2ZHBA 4M0AA 4I2CA 4X0AA 7ICIA 5CJ7A 7ICJA 4OAFA 5DDYA 4LVSA 3LQCB 9ICWA 2NRKA 4FHVA 4MFAA 4RQ0A 3H3AA 5J0QA 4M04A 4S3NA 4KM5A 2DVIA 4R64A 3AUOA 4RPXA 4UB4A 1JMSA 3AQMA 3HWTA 4YMMA 4M9HA 5IIIA 5D4BA 5HRDA 3HW8A 1Q79A 2BCVA 5HR9A 3L9DA 4KLTA 4JLXA 5DEDA 5IIKA 4WC3A 2B51A 4RQ7A 4WC4A 4GXJA 1HUZA 4OAIZ 5HC9A 5CA7A 4RQ1A 3V7KA 3OVBA 3V72A 1PX5A 1OU5A 4F5OA 5J0YA 4JWMA 3C2LA 8ICYA 4RQ8A 4LZGA 5HRHA 3C2KA 8ICOA 4AT7B 3HJ1A 8ICSA 4XQ8A 4DOBA 2BCUA 2ZH8A 4KLGA 4DO9A 4I2GA 4EP7A 4O6AA 2ZH4A 5CP2A 4LT6A 5IIOA 1JQRA 4X4VA 3AQKA 4QZ9A 4LEVA 4KLEA 8ICWA 3K75D 5CR0A 2ZH1A 7ICQA 4XUSA 4XA5A 4MFFA 4RWQA 4FH3A 1HUOA 5D49A 4NM2A 4KLLA 5DBAA 4NXVA 5DBCA 4F5QA 7ICRA 3RJFA 2VANA 2DR5A 4PHEA 8ICBA 4IG8A 2FMSA 4K4HA 3WFSC 4X4SA 2HHPA 1ZQUA 2O1PA 2ZH5A 1ZJNA 4FHYA 4WC7A 1RPLA 2IHMA 8ICIA 4F5RA 2BCSA 1F5AA 3MGIA 5J2FA 4K4GA 4NXXA 3AQNA 4TURA 9ICTA 5HHIA 4EBKA 4PHPA 4I2AA 1ZQIA 1V4AA 1ZQVA 3UXNA 9ICHA 2DR9A 4I2BA 4RPZA 4K96A 2RFFA 3RJGA 3TFRA 7ICUA 4I2HA 3V7JA 1ZQGA 4QZIA 2BCQA 2B56A 4KLJA 4M9LA 5J2JA 4K9BA 5HRIA 4QZBA 4NLNA 3H39A 4IQVA 4KLOA 8ICXA 2P66A 1NOMA 2ID1A 4I27A 8ICGA 9ICIA 8ICNA 4OAHA 5DBBA 4I28A 3PNCA 1MIYA 3OVSA 4M47A 3ISDA 4PHDA 8ICMA 2ZH6A 2PFNA 9ICAA 1NO5A 4UB3A 3RJJA 9ICJA 8ICLA 4MF8A 1BPEA 5DB8A 3NYBA 9ICMA 1KDHA 2PBEA 4QZAA 8ICVA 4P4PA 4RQ2A 3UPQA 5J2IA 3JPPA 7ICSA 1BPBA 5J2EA 4UAWA 4WCWA 3H37A 1UEVA 9ICRA 1TFWA 5TZVA 4TUQA 4MKPA 3MDAA 4PGYA 1ZQEA 4YCXA 8ICTA 4RWNA 5J0SA 4QZGA 3H38A 7ICTA 4JLZA 5J2DA 5HRLA 1WOTA 8ICQA 4NM1A 4RQ5A 9ICNA 2W9MA 1BPZA 5J0WA 1KNYA 1ZQHA 5IIMA 2DRBA 4Z6FA 4I2JA 5HHHA 1ZQMA 7ICNA 9ICQA 1KEJA 3JPTA 3AU6A 3RH6A 4MFCA 3WFRE 8ICZA 4PPXA 5DB9A 4I29A 3C66A 4NXTA 4X4NA 4R63A 2BPGA 5J0OA 5D46A 4P4MA 1BPYA 5J2GA 3UQ2A 4UAYA 4IQUA 1MQ3A 4KB6A 4PHAA 3C5FA 3RH4A 4WC6A 4XQ7A 4K99A 3ISBA 4GXIA 2PFQA 8ICKA 2ZH9A 4YMNA 5IILA 1ZQCA 9ICVA 4DOAA 4YN4A 4KLUA 3RJEA 5DECA 7ICVA 4PGQA 3WFQE 4M5DA 3UPSA 4YD2A 1MQ2A 4FHWA 2PFPA 5IINA 1VJ7A 5J2CA 1YLQA 3JZ0A 4FHXA 4WC2A 3B0XA 7ICPA 2ZHAA 1TVAA 3C5GA 2BCRA 4M2YA 4QZEA 4OAGA 4O9MA 4O5KA 4R65A 1ZQBA 5HRFA 3MGHA 2ISOA 2PFOA 5EOZA 3RH5A 4O69A 5J0TA 8ICCA 9ICKA 2DR8A 2B4VA 4UD5A 3JPRA 1ZQSA 1MIWA 4QZFA 4RWOA 4Z6EA 8ICHA 3GDXA 3RJIA 5CHGA 4UB1A 1ZQYA 4X4PA 3UXOA 5J0RA 4TUPA 1UEUA 4NKUA 3RJHA 4RWPA 4RT3A 3OUYB 3OVAA 1ZQDA 7ICLA 4K4IA 4Z6CA 4GXKA 4FO6A 1FA0A 3PMNA 3C2MA 9ICUA 1R8AA 4K9AA 3JPOA 1BPDA 5DKWA 7ICGA 4O5CA 9ICEA 4TUSA 2ZH2A 1Q78A 4ATBB 2M2TA 4Z6DA 5J2AA 4IQTA 4M9GA 8ICAA 2DR7A 5DDMA 2M2VA 4I2EA 4QZHA 4K98A 5J29A 4NLZA 2FMPA 9ICBA 4QZCA 5J2BA 4JWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICC A;  5CWR A;  4IQW A;  5J2K A;  4NY8 A;  7ICF A;  4QZ8 A;  8ICF A;  2ZH3 A;  3AU2 A;  4RT2 A;  4X0B A;  3JPS A;  4NXZ A;  1ZQF A;  5HRE A;  1R8C A;  4KLF A;  1ZQJ A;  4YD1 A;  5F2V O;  3C18 A;  4FHP A;  3B0Y A;  4QZD A;  7ICE A;  4RQ6 A;  3AQL A;  3MBY A;  4YMO A;  4PGX A;  3JPQ A;  4DOC A;  9ICX A;  8ICR A;  5BOM A;  3WFO A;  4X4O A;  4E7X A;  1ZQO A;  4KLH A;  5HRG A;  3OV7 A;  3HIY A;  3V7L A;  9ICF A;  2ZH7 A;  4UBB A;  1ZQL A;  4O5E A;  4AT8 B;  4P2H A;  1ZQW A;  4UB2 A;  8ICP A;  4KLI A;  1XSL A;  2FMQ A;  4KLD A;  7ICO A;  1XSN A;  4RQ4 A;  1MIV A;  3JPN A;  3HJ4 A;  7ICM A;  1UET A;  5DB6 A;  4R66 A;  1TV9 A;  4I2I A;  3WFP A;  4UD4 A;  8ICJ A;  4PH5 A;  2O5A A;  4XRH A;  1VFG A;  3RJK A;  2ISP A;  2M2W A;  8ICU A;  1ZQN A;  4X5V A;  9ICS A;  4FH5 A;  3HX0 A;  1JAJ A;  5CB1 A;  4NKT A;  3JYY A;  4X4Q A;  4UB5 A;  4KLS A;  8ICE A;  1ZQR A;  1BPX A;  2PXI A;  4M9N A;  4WC0 A;  1TFY A;  3UXP A;  4AT7 A;  4EBJ A;  4UAZ A;  4NLK A;  4F5N A;  1JN3 A;  1ZQX A;  5DB7 A;  2BPC A;  3UQ0 A;  4E80 A;  4WC5 A;  5BOL A;  3PML A;  5J0U A;  3ISC A;  2Q66 A;  4X4U A;  5HRB A;  3OUY A;  9ICO A;  1ZQT A;  5IIJ A;  2BPF A;  4F5P A;  3TFS A;  5J0P A;  4E8F A;  2BE3 A;  4AT9 B;  1ZQQ A;  9ICG A;  4KLQ A;  7ICK A;  3OGU A;  4LZD A;  1R89 A;  4KLM A;  2GWS A;  4RQ3 A;  4ATB A;  5HRK A;  1XSP A;  2I9G A;  4I2D A;  4X4T A;  4UBC A;  4MF2 A;  4WBZ A;  4P4O A;  5J2H A;  2M2U A;  4AT8 A;  4M9J A;  3LK9 A;  5BPC A;  4RPY A;  2DRA A;  4I2F A;  1ZQK A;  1R8B A;  4X4R A;  4WC1 A;  1ZQA A;  1ZJM A;  1RZT A;  5J0X A;  9ICP A;  3MDC A;  1ZQZ A;  1ZQP A;  4AT9 A;  7ICH A;  9ICL A;  4WBY A;  2ZHB A;  4M0A A;  4I2C A;  4X0A A;  7ICI A;  5CJ7 A;  7ICJ A;  5DDY A;  4LVS A;  3LQC B;  9ICW A;  2NRK A;  4FHV A;  4MFA A;  4RQ0 A;  3H3A A;  5J0Q A;  4M04 A;  4S3N A;  2DVI A;  4R64 A;  3AUO A;  4RPX A;  4UB4 A;  1JMS A;  3AQM A;  3HWT A;  4YMM A;  4M9H A;  5III A;  5D4B A;  5HRD A;  3HW8 A;  1Q79 A;  2BCV A;  5HR9 A;  3L9D A;  4KLT A;  5DED A;  5IIK A;  4WC3 A;  2B51 A;  4RQ7 A;  4WC4 A;  4GXJ A;  1HUZ A;  5HC9 A;  5CA7 A;  4RQ1 A;  3V7K A;  3OVB A;  3V72 A;  1PX5 A;  1OU5 A;  4F5O A;  5J0Y A;  4JWM A;  3C2L A;  8ICY A;  4RQ8 A;  4LZG A;  5HRH A;  3C2K A;  8ICO A;  4AT7 B;  3HJ1 A;  8ICS A;  4XQ8 A;  4DOB A;  2BCU A;  2ZH8 A;  4KLG A;  4DO9 A;  4I2G A;  4EP7 A;  2ZH4 A;  5CP2 A;  4LT6 A;  5IIO A;  1JQR A;  3AQK A;  4X4V A;  4QZ9 A;  4KLE A;  8ICW A;  3K75 D;  5CR0 A;  2ZH1 A;  7ICQ A;  4XUS A;  4XA5 A;  4MFF A;  4RWQ A;  4FH3 A;  1HUO A;  5D49 A;  4NM2 A;  4KLL A;  5DBA A;  5DBC A;  4F5Q A;  7ICR A;  3RJF A;  2VAN A;  2DR5 A;  4PHE A;  8ICB A;  4IG8 A;  2FMS A;  4K4H A;  3WFS C;  4X4S A;  2HHP A;  1ZQU A;  2O1P A;  2ZH5 A;  1ZJN A;  4FHY A;  4WC7 A;  1RPL A;  2IHM A;  8ICI A;  4F5R A;  2BCS A;  1F5A A;  3MGI A;  5J2F A;  4K4G A;  3AQN A;  4TUR A;  9ICT A;  5HHI A;  4EBK A;  4PHP A;  4I2A A;  1ZQI A;  1V4A A;  1ZQV A;  3UXN A;  9ICH A;  2DR9 A;  4I2B A;  4RPZ A;  2RFF A;  3RJG A;  3TFR A;  7ICU A;  4I2H A;  3V7J A;  1ZQG A;  4QZI A;  2BCQ A;  2B56 A;  4KLJ A;  4M9L A;  5J2J A;  5HRI A;  4QZB A;  4NLN A;  3H39 A;  4IQV A;  4KLO A;  8ICX A;  2P66 A;  1NOM A;  2ID1 A;  4I27 A;  8ICG A;  9ICI A;  8ICN A;  5DBB A;  4I28 A;  3PNC A;  1MIY A;  3OVS A;  4M47 A;  3ISD A;  4PHD A;  8ICM A;  2ZH6 A;  2PFN A;  9ICA A;  1NO5 A;  4UB3 A;  3RJJ A;  9ICJ A;  8ICL A;  4MF8 A;  1BPE A;  5DB8 A;  3NYB A;  9ICM A;  1KDH A;  2PBE A;  4QZA A;  8ICV A;  4P4P A;  4RQ2 A;  3UPQ A;  5J2I A;  3JPP A;  7ICS A;  1BPB A;  5J2E A;  4UAW A;  4WCW A;  3H37 A;  1UEV A;  9ICR A;  1TFW A;  5TZV A;  4TUQ A;  3MDA A;  4PGY A;  1ZQE A;  4YCX A;  8ICT A;  4RWN A;  5J0S A;  4QZG A;  3H38 A;  7ICT A;  5J2D A;  5HRL A;  1WOT A;  8ICQ A;  4NM1 A;  4RQ5 A;  9ICN A;  2W9M A;  1BPZ A;  5J0W A;  1KNY A;  1ZQH A;  5IIM A;  2DRB A;  4Z6F A;  4I2J A;  5HHH A;  1ZQM A;  7ICN A;  9ICQ A;  1KEJ A;  3JPT A;  3AU6 A;  3RH6 A;  4MFC A;  3WFR E;  8ICZ A;  4PPX A;  5DB9 A;  4I29 A;  3C66 A;  4X4N A;  4R63 A;  2BPG A;  5J0O A;  5D46 A;  4P4M A;  1BPY A;  5J2G A;  3UQ2 A;  4UAY A;  4IQU A;  1MQ3 A;  4PHA A;  3C5F A;  3RH4 A;  4WC6 A;  4XQ7 A;  3ISB A;  4GXI A;  2PFQ A;  8ICK A;  2ZH9 A;  4YMN A;  5IIL A;  1ZQC A;  9ICV A;  4DOA A;  4YN4 A;  4KLU A;  3RJE A;  5DEC A;  7ICV A;  4PGQ A;  3WFQ E;  4M5D A;  3UPS A;  4YD2 A;  1MQ2 A;  4FHW A;  2PFP A;  5IIN A;  1VJ7 A;  5J2C A;  1YLQ A;  3JZ0 A;  4FHX A;  4WC2 A;  3B0X A;  7ICP A;  2ZHA A;  1TVA A;  3C5G A;  2BCR A;  4M2Y A;  4QZE A;  4O9M A;  4O5K A;  4R65 A;  1ZQB A;  5HRF A;  3MGH A;  2ISO A;  2PFO A;  5EOZ A;  3RH5 A;  8ICC A;  5J0T A;  9ICK A;  2DR8 A;  2B4V A;  4UD5 A;  3JPR A;  1ZQS A;  1MIW A;  4QZF A;  4RWO A;  4Z6E A;  8ICH A;  3GDX A;  3RJI A;  5CHG A;  4UB1 A;  1ZQY A;  3UXO A;  4X4P A;  5J0R A;  4TUP A;  4NKU A;  1UEU A;  3RJH A;  4RWP A;  4RT3 A;  3OUY B;  3OVA A;  1ZQD A;  7ICL A;  4K4I A;  4Z6C A;  4GXK A;  4FO6 A;  1FA0 A;  3PMN A;  3C2M A;  9ICU A;  1R8A A;  3JPO A;  1BPD A;  5DKW A;  7ICG A;  4O5C A;  9ICE A;  4TUS A;  2ZH2 A;  1Q78 A;  4ATB B;  2M2T A;  4Z6D A;  5J2A A;  4IQT A;  4M9G A;  8ICA A;  5DDM A;  2DR7 A;  2M2V A;  4I2E A;  4QZH A;  5J29 A;  4NLZ A;  2FMP A;  9ICB A;  4QZC A;  5J2B A;  4JWN A; 
#chains in the Genus database with same CATH topology
 9ICC A;  5CWR A;  4WQK A;  4IQW A;  5J2K A;  4NY8 A;  7ICF A;  4QZ8 A;  8ICF A;  2ZH3 A;  3AU2 A;  4RT2 A;  4X0B A;  3JPS A;  4FO1 A;  4NXZ A;  1ZQF A;  5HRE A;  1R8C A;  4KLF A;  1ZQJ A;  4YD1 A;  5F2V O;  3C18 A;  4FHP A;  3B0Y A;  4QZD A;  7ICE A;  4RQ6 A;  3AQL A;  3MBY A;  4YMO A;  4PGX A;  3JPQ A;  4DOC A;  9ICX A;  8ICR A;  5BOM A;  3WFO A;  4X4O A;  4E7X A;  1ZQO A;  4KLH A;  5HRG A;  3OV7 A;  3HIY A;  4EV6 A;  3V7L A;  9ICF A;  2ZH7 A;  3ER9 B;  4UBB A;  1ZQL A;  4O5E A;  4AT8 B;  4P2H A;  2BBH A;  1ZQW A;  4UB2 A;  8ICP A;  4KLI A;  4K8V A;  2HN2 A;  1XSL A;  2FMQ A;  4KLD A;  7ICO A;  1XSN A;  4RQ4 A;  4NXW A;  1MIV A;  3JPN A;  3HJ4 A;  7ICM A;  1UET A;  5DB6 A;  4R66 A;  1TV9 A;  4I2I A;  3WFP A;  4UD4 A;  8ICJ A;  4PH5 A;  2O5A A;  4XRH A;  1VFG A;  3RJK A;  2ISP A;  2M2W A;  8ICU A;  1ZQN A;  4X5V A;  9ICS A;  4FH5 A;  3HX0 A;  1JAJ A;  5CB1 A;  3PHZ A;  4NKT A;  4X4Q A;  3JYY A;  4UB5 A;  4KLS A;  2BBJ A;  8ICE A;  1ZQR A;  1BPX A;  2PXI A;  4M9N A;  1TFY A;  4WC0 A;  3UXP A;  4AT7 A;  4EBJ A;  4UAZ A;  4NLK A;  3MCR A;  3K7D A;  4F5N A;  4O67 A;  1JN3 A;  1ZQX A;  5DB7 A;  2BPC A;  3UQ0 A;  4E80 A;  4WC5 A;  5BOL A;  4WOY A;  3PML A;  5J0U A;  3ISC A;  2Q66 A;  4X4U A;  3OUY A;  5HRB A;  9ICO A;  1ZQT A;  5IIJ A;  2BPF A;  4F5P A;  5CFT A;  3TFS A;  4LEZ A;  5J0P A;  4E8F A;  4NXU A;  2BE3 A;  4AT9 B;  1ZQQ A;  9ICG A;  4KLQ A;  7ICK A;  3OGU A;  4LZD A;  1R89 A;  4XJE A;  4KLM A;  2GWS A;  4RQ3 A;  4ATB A;  5HRK A;  1XSP A;  2I9G A;  4I2D A;  4X4T A;  4K97 A;  5D63 A;  4UBC A;  4MF2 A;  4WBZ A;  4P4O A;  5J2H A;  2M2U A;  4LEW A;  4AT8 A;  4M9J A;  3LK9 A;  4O68 A;  5BPC A;  4RPY A;  2DRA A;  4I2F A;  1ZQK A;  1R8B A;  4X4R A;  4WC1 A;  1ZQA A;  1ZJM A;  1RZT A;  4LEY A;  5J0X A;  9ICP A;  3MDC A;  1ZQZ A;  4EED A;  4AT9 A;  1ZQP A;  7ICH A;  9ICL A;  4WBY A;  2ZHB A;  4M0A A;  4I2C A;  4X0A A;  4N7R A;  7ICI A;  5CJ7 A;  7ICJ A;  4OAF A;  5DDY A;  4LVS A;  3LQC B;  5CFU A;  9ICW A;  2NRK A;  4FHV A;  4MFA A;  4RQ0 A;  3H3A A;  3ERC C;  5J0Q A;  4M04 A;  4S3N A;  4KM5 A;  2DVI A;  3EF2 A;  4R64 A;  3AUO A;  4RPX A;  5D61 A;  4UB4 A;  1JMS A;  3AQM A;  3HWT A;  4YMM A;  4M9H A;  5III A;  5D4B A;  5HRD A;  3HW8 A;  1Q79 A;  2HN1 A;  2BCV A;  5HR9 A;  3L9D A;  4KLT A;  4JLX A;  5DED A;  5IIK A;  4WC3 A;  2B51 A;  4RQ7 A;  4WC4 A;  4GXJ A;  1HUZ A;  4OAI Z;  5HC9 A;  5CA7 A;  4RQ1 A;  3V7K A;  3OVB A;  3V72 A;  1PX5 A;  4WQL A;  4I0U A;  1OU5 A;  4F5O A;  5J0Y A;  4JWM A;  3C2L A;  8ICY A;  4RQ8 A;  4LZG A;  5HRH A;  3C2K A;  8ICO A;  4AT7 B;  3HJ1 A;  8ICS A;  4XQ8 A;  4DOB A;  2BCU A;  2ZH8 A;  4KLG A;  4DO9 A;  4I2G A;  4EP7 A;  4O6A A;  2ZH4 A;  5CP2 A;  4LT6 A;  5IIO A;  1JQR A;  4X4V A;  3AQK A;  5CHE A;  4QZ9 A;  4LEV A;  4KLE A;  8ICW A;  3K75 D;  5CR0 A;  2ZH1 A;  7ICQ A;  4XUS A;  4XA5 A;  4MFF A;  4RWQ A;  4FH3 A;  4EGW A;  1HUO A;  3NVO A;  4NM2 A;  5D49 A;  5DBA A;  4KLL A;  4NXV A;  5DBC A;  4F5Q A;  7ICR A;  3RJF A;  2VAN A;  2DR5 A;  4PHE A;  8ICB A;  4IG8 A;  2FMS A;  4K4H A;  3WFS C;  4X4S A;  2HHP A;  1ZQU A;  3ER8 C;  2O1P A;  2ZH5 A;  1ZJN A;  4FHY A;  4WC7 A;  1RPL A;  2IHM A;  8ICI A;  4F5R A;  4WH5 A;  2BCS A;  1F5A A;  3MGI A;  5J2F A;  4K4G A;  4NXX A;  3AQN A;  4TUR A;  9ICT A;  5HHI A;  4EBK A;  2GA9 D;  4PHP A;  4I2A A;  2IHO A;  1ZQI A;  1V4A A;  1ZQV A;  3UXN A;  9ICH A;  2DR9 A;  4I2B A;  4RPZ A;  4K96 A;  2RFF A;  3RJG A;  3TFR A;  7ICU A;  4I2H A;  3V7J A;  1ZQG A;  4QZI A;  2BCQ A;  2B56 A;  4KLJ A;  4M9L A;  5J2J A;  4K9B A;  5HRI A;  4QZB A;  4NLN A;  3H39 A;  4IQV A;  4KLO A;  8ICX A;  2P66 A;  1NOM A;  2ID1 A;  4I27 A;  8ICG A;  9ICI A;  8ICN A;  4OAH A;  5CFS A;  5DBB A;  4I28 A;  3PNC A;  1MIY A;  3OVS A;  4M47 A;  3ISD A;  4PHD A;  8ICM A;  2ZH6 A;  4HX0 A;  2PFN A;  9ICA A;  3NWI A;  1NO5 A;  5B3P A;  4UB3 A;  3RJJ A;  9ICJ A;  8ICL A;  4MF8 A;  1BPE A;  5DB8 A;  3NYB A;  9ICM A;  1KDH A;  2PBE A;  4QZA A;  8ICV A;  4P4P A;  4RQ2 A;  3UPQ A;  5J2I A;  3JPP A;  7ICS A;  1BPB A;  5J2E A;  4UAW A;  4WCW A;  3H37 A;  1UEV A;  9ICR A;  1TFW A;  5TZV A;  4TUQ A;  4MKP A;  3MDA A;  4PGY A;  1ZQE A;  4YCX A;  8ICT A;  4RWN A;  5J0S A;  4QZG A;  3H38 A;  7ICT A;  4JLZ A;  5J2D A;  2GAF D;  5HRL A;  1WOT A;  8ICQ A;  4NM1 A;  4RQ5 A;  9ICN A;  2W9M A;  1BPZ A;  2IUB A;  5J0W A;  1KNY A;  1ZQH A;  5IIM A;  2DRB A;  4Z6F A;  4I2J A;  5HHH A;  1ZQM A;  7ICN A;  9ICQ A;  1KEJ A;  3JPT A;  3AU6 A;  3RH6 A;  4MFC A;  4EEB A;  3WFR E;  8ICZ A;  4PPX A;  5DB9 A;  4I29 A;  3C66 A;  4NXT A;  4X4N A;  4R63 A;  2BPG A;  5J0O A;  5D46 A;  4P4M A;  1BPY A;  5J2G A;  3UQ2 A;  4UAY A;  4IQU A;  2FCL A;  2EWR A;  1MQ3 A;  4KB6 A;  4PHA A;  3C5F A;  3RH4 A;  4WC6 A;  4XQ7 A;  4K99 A;  3ISB A;  4GXI A;  2PFQ A;  3CK6 A;  8ICK A;  2ZH9 A;  4YMN A;  5IIL A;  1ZQC A;  9ICV A;  4DOA A;  4YN4 A;  4KLU A;  3RJE A;  5DEC A;  7ICV A;  4PGQ A;  3WFQ E;  4M5D A;  3UPS A;  4YD2 A;  1MQ2 A;  4FHW A;  2PFP A;  5IIN A;  1VJ7 A;  5J2C A;  1YLQ A;  3JZ0 A;  5JTG A;  4FHX A;  4WC2 A;  3B0X A;  7ICP A;  2ZHA A;  1TVA A;  3C5G A;  2BCR A;  4M2Y A;  4QZE A;  4OAG A;  4O9M A;  4O5K A;  4R65 A;  1ZQB A;  5B3Q A;  5HRF A;  3OWG A;  3MGH A;  3NKU A;  5D62 A;  2ISO A;  5EOZ A;  3RH5 A;  2PFO A;  4O69 A;  5J0T A;  8ICC A;  9ICK A;  2DR8 A;  2B4V A;  4UD5 A;  3JPR A;  1ZQS A;  1MIW A;  4QZF A;  4RWO A;  4Z6E A;  8ICH A;  3GDX A;  3RJI A;  5CHG A;  4UB1 A;  1ZQY A;  4X4P A;  3UXO A;  5J0R A;  4TUP A;  1UEU A;  4NKU A;  3RJH A;  4RWP A;  4RT3 A;  3OUY B;  3OVA A;  1GPJ A;  1ZQD A;  7ICL A;  4K4I A;  4Z6C A;  4GXK A;  4FO6 A;  1FA0 A;  3PMN A;  3C2M A;  9ICU A;  1R8A A;  4K9A A;  3JPO A;  1BPD A;  5DKW A;  7ICG A;  4O5C A;  9ICE A;  4TUS A;  2ZH2 A;  1Q78 A;  4ATB B;  2M2T A;  4Z6D A;  5J2A A;  4IQT A;  4M9G A;  8ICA A;  2DR7 A;  5DDM A;  2M2V A;  4I2E A;  4QZH A;  5J29 A;  4K98 A;  4NLZ A;  3JCF A;  2FMP A;  9ICB A;  4QZC A;  5J2B A;  4JWN A; 
#chains in the Genus database with same CATH homology
 9ICC A;  5CWR A;  4IQW A;  5J2K A;  4NY8 A;  7ICF A;  4QZ8 A;  8ICF A;  2ZH3 A;  3AU2 A;  4RT2 A;  4X0B A;  3JPS A;  4NXZ A;  1ZQF A;  5HRE A;  1R8C A;  4KLF A;  1ZQJ A;  4YD1 A;  5F2V O;  3C18 A;  4FHP A;  3B0Y A;  4QZD A;  7ICE A;  4RQ6 A;  3AQL A;  3MBY A;  4YMO A;  4PGX A;  3JPQ A;  4DOC A;  9ICX A;  8ICR A;  5BOM A;  3WFO A;  4X4O A;  4E7X A;  1ZQO A;  4KLH A;  5HRG A;  3OV7 A;  3HIY A;  3V7L A;  9ICF A;  2ZH7 A;  4UBB A;  1ZQL A;  4O5E A;  4AT8 B;  4P2H A;  1ZQW A;  4UB2 A;  8ICP A;  4KLI A;  4K8V A;  1XSL A;  2FMQ A;  4KLD A;  7ICO A;  1XSN A;  4RQ4 A;  4NXW A;  1MIV A;  3JPN A;  3HJ4 A;  7ICM A;  1UET A;  5DB6 A;  4R66 A;  1TV9 A;  4I2I A;  3WFP A;  4UD4 A;  8ICJ A;  4PH5 A;  2O5A A;  4XRH A;  1VFG A;  3RJK A;  2ISP A;  2M2W A;  8ICU A;  1ZQN A;  4X5V A;  9ICS A;  4FH5 A;  3HX0 A;  1JAJ A;  5CB1 A;  4NKT A;  4X4Q A;  3JYY A;  4UB5 A;  4KLS A;  8ICE A;  1ZQR A;  1BPX A;  2PXI A;  4M9N A;  1TFY A;  4WC0 A;  3UXP A;  4AT7 A;  4EBJ A;  4UAZ A;  4NLK A;  4F5N A;  4O67 A;  1JN3 A;  1ZQX A;  5DB7 A;  2BPC A;  3UQ0 A;  4E80 A;  4WC5 A;  5BOL A;  4WOY A;  3PML A;  5J0U A;  3ISC A;  2Q66 A;  4X4U A;  3OUY A;  5HRB A;  9ICO A;  1ZQT A;  5IIJ A;  2BPF A;  4F5P A;  3TFS A;  4LEZ A;  5J0P A;  4E8F A;  4NXU A;  2BE3 A;  4AT9 B;  1ZQQ A;  9ICG A;  4KLQ A;  7ICK A;  3OGU A;  4LZD A;  1R89 A;  4KLM A;  2GWS A;  4RQ3 A;  4ATB A;  5HRK A;  1XSP A;  2I9G A;  4I2D A;  4X4T A;  4K97 A;  4UBC A;  4MF2 A;  4WBZ A;  4P4O A;  5J2H A;  2M2U A;  4LEW A;  4AT8 A;  4M9J A;  3LK9 A;  4O68 A;  5BPC A;  4RPY A;  2DRA A;  4I2F A;  1ZQK A;  1R8B A;  4X4R A;  4WC1 A;  1ZQA A;  1ZJM A;  1RZT A;  4LEY A;  5J0X A;  9ICP A;  3MDC A;  1ZQZ A;  1ZQP A;  4AT9 A;  7ICH A;  9ICL A;  4WBY A;  2ZHB A;  4M0A A;  4I2C A;  4X0A A;  7ICI A;  5CJ7 A;  7ICJ A;  4OAF A;  5DDY A;  4LVS A;  3LQC B;  9ICW A;  2NRK A;  4FHV A;  4MFA A;  4RQ0 A;  3H3A A;  5J0Q A;  4M04 A;  4S3N A;  4KM5 A;  2DVI A;  4R64 A;  3AUO A;  4RPX A;  4UB4 A;  1JMS A;  3AQM A;  3HWT A;  4YMM A;  4M9H A;  5III A;  5D4B A;  5HRD A;  3HW8 A;  1Q79 A;  2BCV A;  5HR9 A;  3L9D A;  4KLT A;  4JLX A;  5DED A;  5IIK A;  4WC3 A;  2B51 A;  4RQ7 A;  4WC4 A;  4GXJ A;  1HUZ A;  4OAI Z;  5HC9 A;  5CA7 A;  4RQ1 A;  3V7K A;  3OVB A;  3V72 A;  1PX5 A;  1OU5 A;  4F5O A;  5J0Y A;  4JWM A;  3C2L A;  8ICY A;  4RQ8 A;  4LZG A;  5HRH A;  3C2K A;  8ICO A;  4AT7 B;  3HJ1 A;  8ICS A;  4XQ8 A;  4DOB A;  2BCU A;  2ZH8 A;  4KLG A;  4DO9 A;  4I2G A;  4EP7 A;  4O6A A;  2ZH4 A;  5CP2 A;  4LT6 A;  5IIO A;  1JQR A;  4X4V A;  3AQK A;  4QZ9 A;  4LEV A;  4KLE A;  8ICW A;  3K75 D;  5CR0 A;  2ZH1 A;  7ICQ A;  4XUS A;  4XA5 A;  4MFF A;  4RWQ A;  4FH3 A;  1HUO A;  5D49 A;  4NM2 A;  4KLL A;  5DBA A;  4NXV A;  5DBC A;  4F5Q A;  7ICR A;  3RJF A;  2VAN A;  2DR5 A;  4PHE A;  8ICB A;  4IG8 A;  2FMS A;  4K4H A;  3WFS C;  4X4S A;  2HHP A;  1ZQU A;  2O1P A;  2ZH5 A;  1ZJN A;  4FHY A;  4WC7 A;  1RPL A;  2IHM A;  8ICI A;  4F5R A;  2BCS A;  1F5A A;  3MGI A;  5J2F A;  4K4G A;  4NXX A;  3AQN A;  4TUR A;  9ICT A;  5HHI A;  4EBK A;  4PHP A;  4I2A A;  1ZQI A;  1V4A A;  1ZQV A;  3UXN A;  9ICH A;  2DR9 A;  4I2B A;  4RPZ A;  4K96 A;  2RFF A;  3RJG A;  3TFR A;  7ICU A;  4I2H A;  3V7J A;  1ZQG A;  4QZI A;  2BCQ A;  2B56 A;  4KLJ A;  4M9L A;  5J2J A;  4K9B A;  5HRI A;  4QZB A;  4NLN A;  3H39 A;  4IQV A;  4KLO A;  8ICX A;  2P66 A;  1NOM A;  2ID1 A;  4I27 A;  8ICG A;  9ICI A;  8ICN A;  4OAH A;  5DBB A;  4I28 A;  3PNC A;  1MIY A;  3OVS A;  4M47 A;  3ISD A;  4PHD A;  8ICM A;  2ZH6 A;  2PFN A;  9ICA A;  1NO5 A;  4UB3 A;  3RJJ A;  9ICJ A;  8ICL A;  4MF8 A;  1BPE A;  5DB8 A;  3NYB A;  9ICM A;  1KDH A;  2PBE A;  4QZA A;  8ICV A;  4P4P A;  4RQ2 A;  3UPQ A;  5J2I A;  3JPP A;  7ICS A;  1BPB A;  5J2E A;  4UAW A;  4WCW A;  3H37 A;  1UEV A;  9ICR A;  1TFW A;  5TZV A;  4TUQ A;  4MKP A;  3MDA A;  4PGY A;  1ZQE A;  4YCX A;  8ICT A;  4RWN A;  5J0S A;  4QZG A;  3H38 A;  7ICT A;  4JLZ A;  5J2D A;  5HRL A;  1WOT A;  8ICQ A;  4NM1 A;  4RQ5 A;  9ICN A;  2W9M A;  1BPZ A;  5J0W A;  1KNY A;  1ZQH A;  5IIM A;  2DRB A;  4Z6F A;  4I2J A;  5HHH A;  1ZQM A;  7ICN A;  9ICQ A;  1KEJ A;  3JPT A;  3AU6 A;  3RH6 A;  4MFC A;  3WFR E;  8ICZ A;  4PPX A;  5DB9 A;  4I29 A;  3C66 A;  4NXT A;  4X4N A;  4R63 A;  2BPG A;  5J0O A;  5D46 A;  4P4M A;  1BPY A;  5J2G A;  3UQ2 A;  4UAY A;  4IQU A;  1MQ3 A;  4KB6 A;  4PHA A;  3C5F A;  3RH4 A;  4WC6 A;  4XQ7 A;  4K99 A;  3ISB A;  4GXI A;  2PFQ A;  8ICK A;  2ZH9 A;  4YMN A;  5IIL A;  1ZQC A;  9ICV A;  4DOA A;  4YN4 A;  4KLU A;  3RJE A;  5DEC A;  7ICV A;  4PGQ A;  3WFQ E;  4M5D A;  3UPS A;  4YD2 A;  1MQ2 A;  4FHW A;  2PFP A;  5IIN A;  1VJ7 A;  5J2C A;  1YLQ A;  3JZ0 A;  4FHX A;  4WC2 A;  3B0X A;  7ICP A;  2ZHA A;  1TVA A;  3C5G A;  2BCR A;  4M2Y A;  4QZE A;  4OAG A;  4O9M A;  4O5K A;  4R65 A;  1ZQB A;  5HRF A;  3MGH A;  2ISO A;  2PFO A;  5EOZ A;  3RH5 A;  4O69 A;  5J0T A;  8ICC A;  9ICK A;  2DR8 A;  2B4V A;  4UD5 A;  3JPR A;  1ZQS A;  1MIW A;  4QZF A;  4RWO A;  4Z6E A;  8ICH A;  3GDX A;  3RJI A;  5CHG A;  4UB1 A;  1ZQY A;  4X4P A;  3UXO A;  5J0R A;  4TUP A;  1UEU A;  4NKU A;  3RJH A;  4RWP A;  4RT3 A;  3OUY B;  3OVA A;  1ZQD A;  7ICL A;  4K4I A;  4Z6C A;  4GXK A;  4FO6 A;  1FA0 A;  3PMN A;  3C2M A;  9ICU A;  1R8A A;  4K9A A;  3JPO A;  1BPD A;  5DKW A;  7ICG A;  4O5C A;  9ICE A;  4TUS A;  2ZH2 A;  1Q78 A;  4ATB B;  2M2T A;  4Z6D A;  5J2A A;  4IQT A;  4M9G A;  8ICA A;  2DR7 A;  5DDM A;  2M2V A;  4I2E A;  4QZH A;  4K98 A;  5J29 A;  4NLZ A;  2FMP A;  9ICB A;  4QZC A;  5J2B A;  4JWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...