4NKTA

Structure of cid1 in complex with the utp analog umpnpp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 111
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nktA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nktA02
4TUPA 3HX0A 1HUOA 2ZH2A 4M9LA 3JPOA 1ZQNA 4I2FA 2M2TA 8ICOA 3OVSA 5J2IA 4RWQA 4RQ3A 2BPGA 9ICFA 4UB2A 8ICZA 5J0RA 3ISDA 5D49A 2B4VA 3UQ0A 9ICVA 3PMLA 8ICTA 4AT9A 8ICGA 3WFSC 4KLTA 4XUSA 4FHXA 3C5GA 4LZGA 4KLHA 8ICSA 4AT8B 8ICQA 4M9HA 4M9JA 4GXKA 4YD2A 4O5KA 4WC1A 4DOCA 5CP2A 4F5RA 1ZQUA 4UB4A 7ICIA 4GXIA 8ICUA 5F2VO 4X4TA 5HRFA 1ZQGA 4PHAA 8ICWA 5DB7A 4PHEA 9ICGA 4FH5A 4MFCA 4I2HA 3TFSA 4QZFA 5J0UA 3MDCA 4P4MA 4E80A 3K75D 5DB8A 4WBYA 4RQ6A 5HRDA 4F5NA 4AT7B 3JPPA 2PXIA 4ATBB 2DR7A 9ICBA 1R8CA 4QZ9A 4IQWA 2ZH6A 9ICMA 1XSPA 1ZQVA 2FMQA 2ISOA 2Q66A 1FA0A 4RPXA 1RZTA 4KLFA 1NOMA 4MFAA 1TVAA 7ICEA 1KEJA 8ICBA 3C66A 4X4SA 2DR5A 4UAYA 1BPZA 3UPQA 5HRIA 4RT2A 1ZQFA 4IG8A 4Z6CA 4NY8A 4LVSA 4X0BA 4NM2A 3RH4A 2DRBA 1R89A 3UXPA 3C2MA 3C5FA 4YMNA 1MQ3A 1PX5A 4RQ5A 2I9GA 5CHGA 5IIJA 1ZQZA 4PGYA 5J0PA 4RQ7A 5J2HA 2DR8A 1TFYA 3PMNA 4M04A 1JAJA 8ICVA 7ICSA 1ZQSA 4FO6A 1UEVA 5DB9A 3HWTA 3OVBA 1OU5A 9ICNA 1ZQPA 5J2GA 1RPLA 2ZHBA 1UETA 5DDMA 4UBBA 5CA7A 4M9GA 1JN3A 4R63A 5CR0A 2DR9A 4QZ8A 5BPCA 4I27A 2O5AA 4IQVA 9ICTA 4UAZA 9ICJA 5DECA 4AT8A 4MF8A 1VFGA 7ICVA 7ICNA 3C2LA 2BCSA 3ISCA 9ICAA 3WFQE 5DBBA 3H39A 1BPEA 4X4RA 4RWOA 3RH5A 2BPCA 3B0YA 2BE3A 4WC7A 4YCXA 4P4PA 1WOTA 4I29A 4K4HA 8ICXA 2BCQA 2FMSA 9ICXA 4R65A 3WFPA 1MIVA 5TZVA 4I2AA 2BCUA 1ZQCA 1ZQIA 4DOAA 4P2HA 4DO9A 3GDXA 2PFPA 8ICRA 2HHPA 4I2IA 1ZQRA 2M2VA 4EBKA 2ZHAA 5IIOA 4KLUA 4PHPA 5HHIA 4KLSA 1V4AA 1ZJMA 3JPRA 5J0YA 3V7KA 3OGUA 7ICRA 3AQNA 4M0AA 4WC4A 9ICSA 4I2BA 4KLLA 1R8AA 4YN4A 4F5OA 1KNYA 4UD5A 5D4BA 4O5CA 5DBCA 5J2BA 4WC3A 7ICHA 3V7JA 3MDAA 3H38A 4R64A 4LZDA 2FMPA 5CWRA 2M2WA 5HRGA 4X4NA 4PH5A 7ICTA 5DEDA 3RH6A 4EP7A 5J2CA 5CB1A 4E8FA 4UD4A 1ZQQA 4O5EA 4I2EA 4MFFA 1ZQEA 1XSLA 3HIYA 4I28A 1UEUA 1ZQTA 3RJGA 4XA5A 2RFFA 3LK9A 1ZQWA 3ISBA 2ZH7A 4X5VA 3RJKA 7ICMA 4FHYA 5J0QA 4KLGA 3JPSA 5EOZA 2ID1A 3UPSA 4RPYA 2B56A 4WC2A 5IIKA 5J2EA 3JPTA 4AT7A 3AU2A 1R8BA 3NYBA 2DRAA 4QZBA 8ICFA 1ZQHA 1VJ7A 2ZH5A 2ZH9A 1ZQOA 5CJ7A 3RJJA 1TFWA 9ICPA 5DKWA 4DOBA 4X4PA 4FHWA 2W9MA 4QZEA 1BPXA 4RWNA 4NXZA 2O1PA 2PFQA 4TUSA 5J2JA 4JWNA 4NLZA 4RQ8A 4X4UA 4WBZA 4I2GA 9ICIA 4NKUA 1KDHA 4M47A 4PPXA 1MIYA 4KLOA 4Z6DA 2DVIA 1ZQBA 3MGIA 4X4OA 5HHHA 4QZGA 5J0OA 7ICFA 3LQCB 2ISPA 7ICPA 9ICUA 4X4VA 4WC5A 4Z6EA 5J29A 4NKTA 4EBJA 4I2DA 4MF2A 2P66A 1ZQDA 5J2FA 4QZCA 3UXNA 4RQ4A 4KLMA 3B0XA 4KLEA 3HJ1A 4S3NA 1ZQXA 1BPDA 3L9DA 3RJFA 4UB5A 4FHPA 5HC9A 2NRKA 2ZH4A 4P4OA 4JWMA 4UAWA 1HUZA 1YLQA 5IIMA 4F5PA 8ICNA 3JPQA 2BCRA 8ICMA 4RQ1A 8ICEA 7ICUA 5HRHA 9ICEA 8ICYA 8ICJA 4TUQA 3OUYA 9ICCA 9ICWA 4I2JA 3RJIA 4RQ0A 4R66A 3V72A 5BOMA 7ICKA 7ICLA 5HRBA 1ZQAA 3JYYA 4WC0A 4IQUA 3MBYA 1BPBA 1MIWA 2GWSA 4FHVA 3UXOA 4AT9B 4XQ8A 2BCVA 5D46A 3UQ2A 3RJHA 4YMOA 4O9MA 9ICQA 4UBCA 2B51A 8ICKA 4GXJA 3WFRE 2VANA 3H3AA 2PFOA 7ICQA 1ZQMA 4QZIA 4YD1A 3HJ4A 4RT3A 3PNCA 4E7XA 4M9NA 4QZAA 8ICCA 4KLJA 4IQTA 4WC6A 4UB1A 4PGQA 2PFNA 1F5AA 8ICAA 5IIIA 4X4QA 2IHMA 9ICKA 1XSNA 5J2DA 5J0TA 2ZH8A 1ZJNA 4LT6A 3AUOA 4PHDA 1ZQKA 5HRKA 5DDYA 8ICHA 1JMSA 4Z6FA 2ZH3A 4X0AA 4K4GA 4ATBA 3HW8A 4WCWA 3C18A 1ZQYA 2PBEA 5J0SA 3C2KA 4XQ7A 8ICPA 4RPZA 8ICLA 4FH3A 5IILA 3AQKA 3OV7A 3AQLA 5DB6A 4QZHA 3JPNA 1Q79A 5BOLA 5J0WA 5J0XA 3OVAA 8ICIA 3WFOA 1BPYA 4NLNA 3AQMA 4YMMA 5DBAA 2BPFA 3RJEA 4KLDA 7ICGA 4NLKA 4KLIA 9ICRA 5J2KA 9ICOA 1MQ2A 4F5QA 1TV9A 4PGXA 4RQ2A 1JQRA 5HREA 7ICOA 4NM1A 1Q78A 3V7LA 1NO5A 4M5DA 3AU6A 4I2CA 4RWPA 9ICHA 1ZQJA 5HR9A 5J2AA 4K4IA 4UB3A 4M2YA 7ICJA 4TURA 2ZH1A 2M2UA 4QZDA 4XRHA 4KLQA 3H37A 3JZ0A 5IINA 3TFRA 9ICLA 3MGHA 5HRLA 1ZQLA 3OUYB
chains in the Genus database with same CATH superfamily
4TUPA 3HX0A 1HUOA 2ZH2A 4M9LA 3JPOA 1ZQNA 4I2FA 2M2TA 8ICOA 4JLZA 4HX0A 3OVSA 5J2IA 4RWQA 4RQ3A 2BPGA 9ICFA 4UB2A 8ICZA 5J0RA 2BBHA 3ISDA 5D49A 2B4VA 3UQ0A 9ICVA 3PMLA 8ICTA 4AT9A 2IHOA 4XJEA 8ICGA 3WFSC 4KLTA 4XUSA 4FHXA 3C5GA 4LZGA 4KLHA 8ICSA 4AT8B 8ICQA 4M9HA 4M9JA 4GXKA 4YD2A 4O5KA 4WC1A 4DOCA 5CP2A 4F5RA 1ZQUA 4UB4A 7ICIA 4GXIA 8ICUA 3MCRA 5F2VO 4X4TA 5HRFA 1ZQGA 4PHAA 8ICWA 5DB7A 4PHEA 4I0UA 9ICGA 4FH5A 2IUBA 3K7DA 4MFCA 4K9AA 4I2HA 3NWIA 3TFSA 4QZFA 5J0UA 3MDCA 5DB8A 4E80A 3K75D 4RQ6A 4WBYA 4P4MA 5HRDA 4F5NA 4AT7B 3JPPA 2PXIA 4ATBB 9ICBA 1R8CA 4QZ9A 4IQWA 2ZH6A 9ICMA 1XSPA 1ZQVA 2FMQA 2ISOA 2Q66A 1FA0A 4RPXA 1RZTA 4KLFA 1NOMA 4MFAA 1TVAA 7ICEA 1KEJA 8ICBA 3C66A 4X4SA 2DR5A 4UAYA 1BPZA 3UPQA 5HRIA 4RT2A 1ZQFA 4IG8A 4Z6CA 4NY8A 4LVSA 4X0BA 4NM2A 3RH4A 2DRBA 1R89A 3UXPA 3C2MA 3C5FA 4YMNA 1MQ3A 1PX5A 4RQ5A 2I9GA 5CHGA 5IIJA 1ZQZA 4PGYA 5J0PA 4RQ7A 5J2HA 2DR8A 1TFYA 3PMNA 4M04A 1JAJA 8ICVA 7ICSA 4K96A 1ZQSA 4FO6A 1UEVA 5DB9A 3OVBA 3HWTA 1OU5A 9ICNA 4K97A 1ZQPA 5J2GA 1UETA 2ZHBA 1RPLA 5DDMA 4UBBA 5CA7A 5CFSA 4M9GA 1JN3A 4R63A 5CR0A 2DR9A 4QZ8A 5BPCA 4I27A 2O5AA 4IQVA 4EV6A 9ICTA 4UAZA 9ICJA 5DECA 4AT8A 4MF8A 1VFGA 7ICVA 7ICNA 3C2LA 2BCSA 3ISCA 9ICAA 4LEWA 3WFQE 5DBBA 3H39A 4JLXA 1BPEA 4X4RA 4RWOA 3RH5A 4KM5A 2BPCA 3B0YA 2BE3A 5JTGA 4WC7A 4YCXA 4P4PA 1WOTA 4I29A 4K4HA 8ICXA 2BCQA 2FMSA 9ICXA 4R65A 4FO1A 3WFPA 1MIVA 5TZVA 4I2AA 2BCUA 2BBJA 1ZQCA 1ZQIA 4KB6A 4DOAA 4P2HA 4DO9A 3GDXA 2PFPA 8ICRA 2HHPA 4I2IA 1ZQRA 2M2VA 4EBKA 2ZHAA 5IIOA 4KLUA 4PHPA 5D63A 5HHIA 4KLSA 3ER9B 1V4AA 1ZJMA 3JPRA 5J0YA 4NXTA 3V7KA 3OGUA 7ICRA 3AQNA 4K8VA 4M0AA 4WC4A 2HN1A 9ICSA 4I2BA 4KLLA 2GA9D 1R8AA 4YN4A 1KNYA 4UD5A 4F5OA 5D4BA 4O5CA 5DBCA 5J2BA 4WC3A 7ICHA 3V7JA 3MDAA 3H38A 4R64A 4LZDA 4N7RA 2FMPA 4WH5A 5CWRA 2M2WA 5HRGA 4X4NA 4PH5A 7ICTA 5DEDA 3RH6A 4WOYA 4EP7A 4LEVA 5J2CA 5CB1A 4E8FA 4UD4A 1ZQQA 4O5EA 4I2EA 4MFFA 1ZQEA 1XSLA 3HIYA 4I28A 1UEUA 2FCLA 4K98A 1ZQTA 3RJGA 4XA5A 2RFFA 3LK9A 1ZQWA 3ISBA 2ZH7A 4X5VA 3RJKA 7ICMA 4FHYA 5J0QA 4KLGA 3JPSA 5EOZA 2ID1A 5D61A 3UPSA 4RPYA 2B56A 4WC2A 5IIKA 5J2EA 3JPTA 4AT7A 3AU2A 1R8BA 4O69A 3NYBA 2DRAA 4QZBA 8ICFA 1ZQHA 3OUYB 1VJ7A 2ZH5A 2ZH9A 1ZQOA 5CJ7A 4WQLA 3RJJA 1TFWA 9ICPA 5DKWA 4DOBA 4X4PA 4FHWA 2W9MA 4QZEA 1BPXA 4RWNA 4NXZA 2O1PA 2PFQA 5D62A 4TUSA 5J2JA 4JWNA 4NLZA 4RQ8A 4X4UA 4WBZA 4I2GA 9ICIA 4NKUA 1KDHA 4M47A 4PPXA 1MIYA 2EWRA 4KLOA 4Z6DA 2DVIA 3ERCC 1ZQBA 3MGIA 4X4OA 5HHHA 4QZGA 3CK6A 5J0OA 7ICFA 3LQCB 2ISPA 7ICPA 9ICUA 4X4VA 4WC5A 5CHEA 3NKUA 4NXVA 4Z6EA 5J29A 1GPJA 4NKTA 4EBJA 4I2DA 4MF2A 2P66A 1ZQDA 5J2FA 4QZCA 3UXNA 4WQKA 4RQ4A 4KLMA 3B0XA 4KLEA 3HJ1A 4S3NA 1ZQXA 1BPDA 3L9DA 3RJFA 4UB5A 4FHPA 5HC9A 2NRKA 5CFTA 2ZH4A 4P4OA 4JWMA 4UAWA 1HUZA 1YLQA 5IIMA 4F5PA 8ICNA 3JPQA 2BCRA 8ICMA 4RQ1A 8ICEA 7ICUA 5HRHA 9ICEA 3NVOA 8ICYA 8ICJA 4TUQA 3OUYA 4K99A 9ICCA 9ICWA 4I2JA 3RJIA 4RQ0A 3JCFA 4R66A 3V72A 5BOMA 4O6AA 7ICKA 7ICLA 4OAHA 5HRBA 1ZQAA 3JYYA 4WC0A 4IQUA 3MBYA 1BPBA 1MIWA 2GWSA 4FHVA 3UXOA 4AT9B 4XQ8A 2BCVA 5D46A 4OAGA 4LEZA 3UQ2A 3RJHA 4YMOA 4OAFA 4O9MA 9ICQA 4UBCA 2B51A 4LEYA 8ICKA 4GXJA 3WFRE 2VANA 3H3AA 2PFOA 7ICQA 1ZQMA 4QZIA 4YD1A 3HJ4A 4RT3A 3PNCA 4E7XA 4M9NA 4QZAA 8ICCA 4KLJA 3ER8C 4IQTA 4WC6A 4UB1A 4PGQA 2PFNA 1F5AA 8ICAA 4K9BA 4X4QA 5IIIA 2IHMA 9ICKA 1XSNA 5J2DA 5J0TA 2ZH8A 1ZJNA 4LT6A 3AUOA 4PHDA 5B3QA 1ZQKA 5HRKA 5DDYA 4EEBA 8ICHA 1JMSA 4Z6FA 2ZH3A 4X0AA 4K4GA 4ATBA 3HW8A 4WCWA 3C18A 1ZQYA 2PBEA 5J0SA 3C2KA 4XQ7A 8ICPA 4RPZA 4EGWA 8ICLA 3OWGA 4FH3A 5IILA 5CFUA 3AQKA 3OV7A 3AQLA 5DB6A 4QZHA 3JPNA 1Q79A 5BOLA 5J0WA 5J0XA 4O67A 3OVAA 8ICIA 3WFOA 4O68A 1BPYA 4NLNA 4EEDA 3AQMA 4YMMA 5DBAA 2BPFA 3RJEA 4KLDA 7ICGA 4NXXA 4NLKA 4MKPA 4KLIA 9ICRA 5J2KA 9ICOA 4NXUA 3EF2A 4F5QA 1TV9A 1MQ2A 4PGXA 4RQ2A 1JQRA 5HREA 2GAFD 7ICOA 4NM1A 3PHZA 1Q78A 4OAIZ 3V7LA 1NO5A 4M5DA 3AU6A 4NXWA 4I2CA 5B3PA 4RWPA 9ICHA 1ZQJA 5HR9A 5J2AA 4K4IA 4UB3A 4M2YA 7ICJA 4TURA 2ZH1A 2M2UA 4QZDA 4XRHA 4KLQA 3H37A 2HN2A 3JZ0A 5IINA 3TFRA 9ICLA 3MGHA 5HRLA 1ZQLA 2DR7A
chains in the Genus database with same CATH topology
4TUPA 3HX0A 1HUOA 2ZH2A 4M9LA 3JPOA 1ZQNA 4I2FA 2M2TA 8ICOA 4JLZA 3OVSA 5J2IA 4RWQA 4RQ3A 2BPGA 9ICFA 4UB2A 8ICZA 5J0RA 3ISDA 5D49A 2B4VA 3UQ0A 9ICVA 3PMLA 8ICTA 4AT9A 8ICGA 3WFSC 4KLTA 4XUSA 4FHXA 3C5GA 4LZGA 4KLHA 8ICSA 4AT8B 8ICQA 4M9HA 4M9JA 4GXKA 4YD2A 4O5KA 4WC1A 4DOCA 5CP2A 4F5RA 1ZQUA 4UB4A 7ICIA 4GXIA 8ICUA 5F2VO 4X4TA 5HRFA 1ZQGA 4PHAA 8ICWA 5DB7A 4PHEA 9ICGA 4FH5A 4MFCA 4K9AA 4I2HA 3TFSA 4QZFA 5J0UA 3MDCA 4P4MA 4E80A 3K75D 5DB8A 4WBYA 4RQ6A 5HRDA 4F5NA 4AT7B 3JPPA 2PXIA 4ATBB 9ICBA 1R8CA 4QZ9A 4IQWA 2ZH6A 9ICMA 1XSPA 1ZQVA 2FMQA 2ISOA 2Q66A 1FA0A 4RPXA 1RZTA 4KLFA 1NOMA 4MFAA 1TVAA 7ICEA 1KEJA 8ICBA 3C66A 4X4SA 2DR5A 4UAYA 1BPZA 3UPQA 5HRIA 4RT2A 1ZQFA 4IG8A 4Z6CA 4NY8A 4LVSA 4X0BA 4NM2A 3RH4A 2DRBA 1R89A 3UXPA 3C2MA 3C5FA 4YMNA 1MQ3A 1PX5A 4RQ5A 2I9GA 5CHGA 5IIJA 1ZQZA 4PGYA 5J0PA 4RQ7A 5J2HA 2DR8A 1TFYA 3PMNA 4M04A 1JAJA 8ICVA 7ICSA 4K96A 1ZQSA 4FO6A 1UEVA 5DB9A 3OVBA 3HWTA 1OU5A 9ICNA 4K97A 1ZQPA 5J2GA 1UETA 2ZHBA 1RPLA 5DDMA 4UBBA 5CA7A 4M9GA 1JN3A 4R63A 5CR0A 2DR9A 4QZ8A 5BPCA 4I27A 2O5AA 4IQVA 9ICTA 4UAZA 9ICJA 5DECA 4AT8A 4MF8A 1VFGA 7ICVA 7ICNA 3C2LA 2BCSA 3ISCA 9ICAA 4LEWA 3WFQE 5DBBA 3H39A 4JLXA 1BPEA 4X4RA 4RWOA 3RH5A 4KM5A 2BPCA 3B0YA 2BE3A 4WC7A 4YCXA 4P4PA 1WOTA 4I29A 4K4HA 8ICXA 2BCQA 2FMSA 9ICXA 4R65A 3WFPA 1MIVA 5TZVA 4I2AA 2BCUA 1ZQCA 1ZQIA 4KB6A 4DOAA 4P2HA 4DO9A 3GDXA 2PFPA 8ICRA 2HHPA 4I2IA 1ZQRA 2M2VA 4EBKA 2ZHAA 5IIOA 4KLUA 4PHPA 5HHIA 4KLSA 1V4AA 1ZJMA 3JPRA 5J0YA 4NXTA 3V7KA 3OGUA 7ICRA 3AQNA 4K8VA 4M0AA 4WC4A 9ICSA 4I2BA 4KLLA 1R8AA 4YN4A 1KNYA 4UD5A 4F5OA 5D4BA 4O5CA 5DBCA 5J2BA 4WC3A 7ICHA 3V7JA 3MDAA 3H38A 4R64A 4LZDA 2FMPA 5CWRA 2M2WA 5HRGA 4X4NA 4PH5A 7ICTA 5DEDA 3RH6A 4WOYA 4EP7A 4LEVA 5J2CA 5CB1A 4E8FA 4UD4A 1ZQQA 4O5EA 4I2EA 4MFFA 1ZQEA 1XSLA 3HIYA 4I28A 1UEUA 4K98A 1ZQTA 3RJGA 4XA5A 2RFFA 3LK9A 1ZQWA 3ISBA 2ZH7A 4X5VA 3RJKA 7ICMA 4FHYA 5J0QA 4KLGA 3JPSA 5EOZA 2ID1A 3UPSA 4RPYA 2B56A 4WC2A 5IIKA 5J2EA 3JPTA 4AT7A 3AU2A 1R8BA 4O69A 3NYBA 2DRAA 4QZBA 8ICFA 1ZQHA 3OUYB 1VJ7A 2ZH5A 2ZH9A 1ZQOA 5CJ7A 3RJJA 1TFWA 9ICPA 5DKWA 4DOBA 4X4PA 4FHWA 2W9MA 4QZEA 1BPXA 4RWNA 4NXZA 2O1PA 2PFQA 4TUSA 5J2JA 4JWNA 4NLZA 4RQ8A 4X4UA 4WBZA 4I2GA 9ICIA 4NKUA 1KDHA 4M47A 4PPXA 1MIYA 4KLOA 4Z6DA 2DVIA 1ZQBA 3MGIA 4X4OA 5HHHA 4QZGA 5J0OA 7ICFA 3LQCB 2ISPA 7ICPA 9ICUA 4X4VA 4WC5A 4NXVA 4Z6EA 5J29A 4NKTA 4EBJA 4I2DA 4MF2A 2P66A 1ZQDA 5J2FA 4QZCA 3UXNA 4RQ4A 4KLMA 3B0XA 4KLEA 3HJ1A 4S3NA 1ZQXA 1BPDA 3L9DA 3RJFA 4UB5A 4FHPA 5HC9A 2NRKA 2ZH4A 4P4OA 4JWMA 4UAWA 1HUZA 1YLQA 5IIMA 4F5PA 8ICNA 3JPQA 2BCRA 8ICMA 4RQ1A 8ICEA 7ICUA 5HRHA 9ICEA 8ICYA 8ICJA 4TUQA 3OUYA 4K99A 9ICCA 9ICWA 4I2JA 3RJIA 4RQ0A 4R66A 3V72A 5BOMA 4O6AA 7ICKA 7ICLA 4OAHA 5HRBA 1ZQAA 3JYYA 4WC0A 4IQUA 3MBYA 1BPBA 1MIWA 2GWSA 4FHVA 3UXOA 4AT9B 4XQ8A 2BCVA 5D46A 4OAGA 4LEZA 3UQ2A 3RJHA 4YMOA 4OAFA 4O9MA 9ICQA 4UBCA 2B51A 4LEYA 8ICKA 4GXJA 3WFRE 2VANA 3H3AA 2PFOA 7ICQA 1ZQMA 4QZIA 4YD1A 3HJ4A 4RT3A 3PNCA 4E7XA 4M9NA 4QZAA 8ICCA 4KLJA 4IQTA 4WC6A 4UB1A 4PGQA 2PFNA 1F5AA 8ICAA 4K9BA 4X4QA 5IIIA 2IHMA 9ICKA 1XSNA 5J2DA 5J0TA 2ZH8A 1ZJNA 4LT6A 3AUOA 4PHDA 1ZQKA 5HRKA 5DDYA 8ICHA 1JMSA 4Z6FA 2ZH3A 4X0AA 4K4GA 4ATBA 3HW8A 4WCWA 3C18A 1ZQYA 2PBEA 5J0SA 3C2KA 4XQ7A 8ICPA 4RPZA 8ICLA 4FH3A 5IILA 3AQKA 3OV7A 3AQLA 5DB6A 4QZHA 3JPNA 1Q79A 5BOLA 5J0WA 5J0XA 4O67A 3OVAA 8ICIA 3WFOA 4O68A 1BPYA 4NLNA 3AQMA 4YMMA 5DBAA 2BPFA 3RJEA 4KLDA 7ICGA 4NXXA 4NLKA 4MKPA 4KLIA 9ICRA 5J2KA 9ICOA 4NXUA 4F5QA 1MQ2A 1TV9A 4PGXA 4RQ2A 1JQRA 5HREA 7ICOA 4NM1A 1Q78A 4OAIZ 3V7LA 1NO5A 4M5DA 3AU6A 4NXWA 4I2CA 4RWPA 9ICHA 1ZQJA 5HR9A 5J2AA 4K4IA 4UB3A 4M2YA 7ICJA 4TURA 2ZH1A 2M2UA 4QZDA 4XRHA 4KLQA 3H37A 3JZ0A 5IINA 3TFRA 9ICLA 3MGHA 5HRLA 1ZQLA 2DR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUP A;  3HX0 A;  1HUO A;  2ZH2 A;  4M9L A;  3JPO A;  1ZQN A;  4I2F A;  2M2T A;  8ICO A;  3OVS A;  5J2I A;  4RWQ A;  4RQ3 A;  2BPG A;  9ICF A;  4UB2 A;  8ICZ A;  5J0R A;  3ISD A;  5D49 A;  2B4V A;  3UQ0 A;  9ICV A;  3PML A;  8ICT A;  4AT9 A;  8ICG A;  3WFS C;  4KLT A;  4XUS A;  4FHX A;  3C5G A;  4LZG A;  4KLH A;  8ICS A;  4AT8 B;  8ICQ A;  4M9H A;  4M9J A;  4GXK A;  4YD2 A;  4O5K A;  4WC1 A;  4DOC A;  5CP2 A;  4F5R A;  1ZQU A;  4UB4 A;  7ICI A;  4GXI A;  8ICU A;  5F2V O;  4X4T A;  5HRF A;  1ZQG A;  4PHA A;  8ICW A;  5DB7 A;  4PHE A;  9ICG A;  4FH5 A;  4MFC A;  4I2H A;  3TFS A;  4QZF A;  5J0U A;  3MDC A;  4P4M A;  4E80 A;  3K75 D;  5DB8 A;  4WBY A;  4RQ6 A;  5HRD A;  4F5N A;  4AT7 B;  3JPP A;  2PXI A;  4ATB B;  2DR7 A;  9ICB A;  1R8C A;  4QZ9 A;  4IQW A;  2ZH6 A;  9ICM A;  1XSP A;  1ZQV A;  2FMQ A;  2ISO A;  2Q66 A;  1FA0 A;  4RPX A;  1RZT A;  4KLF A;  1NOM A;  4MFA A;  1TVA A;  7ICE A;  1KEJ A;  8ICB A;  3C66 A;  4X4S A;  2DR5 A;  4UAY A;  1BPZ A;  3UPQ A;  5HRI A;  4RT2 A;  1ZQF A;  4IG8 A;  4Z6C A;  4NY8 A;  4LVS A;  4X0B A;  4NM2 A;  3RH4 A;  2DRB A;  1R89 A;  3UXP A;  3C2M A;  3C5F A;  4YMN A;  1MQ3 A;  1PX5 A;  4RQ5 A;  2I9G A;  5CHG A;  5IIJ A;  1ZQZ A;  4PGY A;  5J0P A;  4RQ7 A;  5J2H A;  2DR8 A;  1TFY A;  3PMN A;  4M04 A;  1JAJ A;  8ICV A;  7ICS A;  1ZQS A;  4FO6 A;  1UEV A;  5DB9 A;  3HWT A;  3OVB A;  1OU5 A;  9ICN A;  1ZQP A;  5J2G A;  1RPL A;  2ZHB A;  1UET A;  5DDM A;  4UBB A;  5CA7 A;  4M9G A;  1JN3 A;  4R63 A;  5CR0 A;  2DR9 A;  4QZ8 A;  5BPC A;  4I27 A;  2O5A A;  4IQV A;  9ICT A;  4UAZ A;  9ICJ A;  5DEC A;  4AT8 A;  4MF8 A;  1VFG A;  7ICV A;  7ICN A;  3C2L A;  2BCS A;  3ISC A;  9ICA A;  3WFQ E;  5DBB A;  3H39 A;  1BPE A;  4X4R A;  4RWO A;  3RH5 A;  2BPC A;  3B0Y A;  2BE3 A;  4WC7 A;  4YCX A;  4P4P A;  1WOT A;  4I29 A;  4K4H A;  8ICX A;  2BCQ A;  2FMS A;  9ICX A;  4R65 A;  3WFP A;  1MIV A;  5TZV A;  4I2A A;  2BCU A;  1ZQC A;  1ZQI A;  4DOA A;  4P2H A;  4DO9 A;  3GDX A;  2PFP A;  8ICR A;  2HHP A;  4I2I A;  1ZQR A;  2M2V A;  4EBK A;  2ZHA A;  5IIO A;  4KLU A;  4PHP A;  5HHI A;  4KLS A;  1V4A A;  1ZJM A;  3JPR A;  5J0Y A;  3V7K A;  3OGU A;  7ICR A;  3AQN A;  4M0A A;  4WC4 A;  9ICS A;  4I2B A;  4KLL A;  1R8A A;  4YN4 A;  4F5O A;  1KNY A;  4UD5 A;  5D4B A;  4O5C A;  5DBC A;  5J2B A;  4WC3 A;  7ICH A;  3V7J A;  3MDA A;  3H38 A;  4R64 A;  4LZD A;  2FMP A;  5CWR A;  2M2W A;  5HRG A;  4X4N A;  4PH5 A;  7ICT A;  5DED A;  3RH6 A;  4EP7 A;  5J2C A;  5CB1 A;  4E8F A;  4UD4 A;  1ZQQ A;  4O5E A;  4I2E A;  4MFF A;  1ZQE A;  1XSL A;  3HIY A;  4I28 A;  1UEU A;  1ZQT A;  3RJG A;  4XA5 A;  2RFF A;  3LK9 A;  1ZQW A;  3ISB A;  2ZH7 A;  4X5V A;  3RJK A;  7ICM A;  4FHY A;  5J0Q A;  4KLG A;  3JPS A;  5EOZ A;  2ID1 A;  3UPS A;  4RPY A;  2B56 A;  4WC2 A;  5IIK A;  5J2E A;  3JPT A;  4AT7 A;  3AU2 A;  1R8B A;  3NYB A;  2DRA A;  4QZB A;  8ICF A;  1ZQH A;  1VJ7 A;  2ZH5 A;  2ZH9 A;  1ZQO A;  5CJ7 A;  3RJJ A;  1TFW A;  9ICP A;  5DKW A;  4DOB A;  4X4P A;  4FHW A;  2W9M A;  4QZE A;  1BPX A;  4RWN A;  4NXZ A;  2O1P A;  2PFQ A;  4TUS A;  5J2J A;  4JWN A;  4NLZ A;  4RQ8 A;  4X4U A;  4WBZ A;  4I2G A;  9ICI A;  4NKU A;  1KDH A;  4M47 A;  4PPX A;  1MIY A;  4KLO A;  4Z6D A;  2DVI A;  1ZQB A;  3MGI A;  4X4O A;  5HHH A;  4QZG A;  5J0O A;  7ICF A;  3LQC B;  2ISP A;  7ICP A;  9ICU A;  4X4V A;  4WC5 A;  4Z6E A;  5J29 A;  4NKT A;  4EBJ A;  4I2D A;  4MF2 A;  2P66 A;  1ZQD A;  5J2F A;  4QZC A;  3UXN A;  4RQ4 A;  4KLM A;  3B0X A;  4KLE A;  3HJ1 A;  4S3N A;  1ZQX A;  1BPD A;  3L9D A;  3RJF A;  4UB5 A;  4FHP A;  5HC9 A;  2NRK A;  2ZH4 A;  4P4O A;  4JWM A;  4UAW A;  1HUZ A;  1YLQ A;  5IIM A;  4F5P A;  8ICN A;  3JPQ A;  2BCR A;  8ICM A;  4RQ1 A;  8ICE A;  7ICU A;  5HRH A;  9ICE A;  8ICY A;  8ICJ A;  4TUQ A;  3OUY A;  9ICC A;  9ICW A;  4I2J A;  3RJI A;  4RQ0 A;  4R66 A;  3V72 A;  5BOM A;  7ICK A;  7ICL A;  5HRB A;  1ZQA A;  3JYY A;  4WC0 A;  4IQU A;  3MBY A;  1BPB A;  1MIW A;  2GWS A;  4FHV A;  3UXO A;  4AT9 B;  4XQ8 A;  2BCV A;  5D46 A;  3UQ2 A;  3RJH A;  4YMO A;  4O9M A;  9ICQ A;  4UBC A;  2B51 A;  8ICK A;  4GXJ A;  3WFR E;  2VAN A;  3H3A A;  2PFO A;  7ICQ A;  1ZQM A;  4QZI A;  4YD1 A;  3HJ4 A;  4RT3 A;  3PNC A;  4E7X A;  4M9N A;  4QZA A;  8ICC A;  4KLJ A;  4IQT A;  4WC6 A;  4UB1 A;  4PGQ A;  2PFN A;  1F5A A;  8ICA A;  5III A;  4X4Q A;  2IHM A;  9ICK A;  1XSN A;  5J2D A;  5J0T A;  2ZH8 A;  1ZJN A;  4LT6 A;  3AUO A;  4PHD A;  1ZQK A;  5HRK A;  5DDY A;  8ICH A;  1JMS A;  4Z6F A;  2ZH3 A;  4X0A A;  4K4G A;  4ATB A;  3HW8 A;  4WCW A;  3C18 A;  1ZQY A;  2PBE A;  5J0S A;  3C2K A;  4XQ7 A;  8ICP A;  4RPZ A;  8ICL A;  4FH3 A;  5IIL A;  3AQK A;  3OV7 A;  3AQL A;  5DB6 A;  4QZH A;  3JPN A;  1Q79 A;  5BOL A;  5J0W A;  5J0X A;  3OVA A;  8ICI A;  3WFO A;  1BPY A;  4NLN A;  3AQM A;  4YMM A;  5DBA A;  2BPF A;  3RJE A;  4KLD A;  7ICG A;  4NLK A;  4KLI A;  9ICR A;  5J2K A;  9ICO A;  1MQ2 A;  4F5Q A;  1TV9 A;  4PGX A;  4RQ2 A;  1JQR A;  5HRE A;  7ICO A;  4NM1 A;  1Q78 A;  3V7L A;  1NO5 A;  4M5D A;  3AU6 A;  4I2C A;  4RWP A;  9ICH A;  1ZQJ A;  5HR9 A;  5J2A A;  4K4I A;  4UB3 A;  4M2Y A;  7ICJ A;  4TUR A;  2ZH1 A;  2M2U A;  4QZD A;  4XRH A;  4KLQ A;  3H37 A;  3JZ0 A;  5IIN A;  3TFR A;  9ICL A;  3MGH A;  5HRL A;  1ZQL A;  3OUY B; 
#chains in the Genus database with same CATH topology
 4TUP A;  3HX0 A;  1HUO A;  2ZH2 A;  4M9L A;  3JPO A;  1ZQN A;  4I2F A;  2M2T A;  8ICO A;  4JLZ A;  4HX0 A;  3OVS A;  5J2I A;  4RWQ A;  4RQ3 A;  2BPG A;  9ICF A;  4UB2 A;  8ICZ A;  5J0R A;  2BBH A;  3ISD A;  5D49 A;  2B4V A;  3UQ0 A;  9ICV A;  3PML A;  8ICT A;  4AT9 A;  2IHO A;  4XJE A;  8ICG A;  3WFS C;  4KLT A;  4XUS A;  4FHX A;  3C5G A;  4LZG A;  4KLH A;  8ICS A;  4AT8 B;  8ICQ A;  4M9H A;  4M9J A;  4GXK A;  4YD2 A;  4O5K A;  4WC1 A;  4DOC A;  5CP2 A;  4F5R A;  1ZQU A;  4UB4 A;  7ICI A;  4GXI A;  8ICU A;  3MCR A;  5F2V O;  4X4T A;  5HRF A;  1ZQG A;  4PHA A;  8ICW A;  5DB7 A;  4PHE A;  4I0U A;  9ICG A;  4FH5 A;  2IUB A;  3K7D A;  4MFC A;  4K9A A;  4I2H A;  3NWI A;  3TFS A;  4QZF A;  5J0U A;  3MDC A;  5DB8 A;  4E80 A;  3K75 D;  4RQ6 A;  4WBY A;  4P4M A;  5HRD A;  4F5N A;  4AT7 B;  3JPP A;  2PXI A;  4ATB B;  9ICB A;  1R8C A;  4QZ9 A;  4IQW A;  2ZH6 A;  9ICM A;  1XSP A;  1ZQV A;  2FMQ A;  2ISO A;  2Q66 A;  1FA0 A;  4RPX A;  1RZT A;  4KLF A;  1NOM A;  4MFA A;  1TVA A;  7ICE A;  1KEJ A;  8ICB A;  3C66 A;  4X4S A;  2DR5 A;  4UAY A;  1BPZ A;  3UPQ A;  5HRI A;  4RT2 A;  1ZQF A;  4IG8 A;  4Z6C A;  4NY8 A;  4LVS A;  4X0B A;  4NM2 A;  3RH4 A;  2DRB A;  1R89 A;  3UXP A;  3C2M A;  3C5F A;  4YMN A;  1MQ3 A;  1PX5 A;  4RQ5 A;  2I9G A;  5CHG A;  5IIJ A;  1ZQZ A;  4PGY A;  5J0P A;  4RQ7 A;  5J2H A;  2DR8 A;  1TFY A;  3PMN A;  4M04 A;  1JAJ A;  8ICV A;  7ICS A;  4K96 A;  1ZQS A;  4FO6 A;  1UEV A;  5DB9 A;  3OVB A;  3HWT A;  1OU5 A;  9ICN A;  4K97 A;  1ZQP A;  5J2G A;  1UET A;  2ZHB A;  1RPL A;  5DDM A;  4UBB A;  5CA7 A;  5CFS A;  4M9G A;  1JN3 A;  4R63 A;  5CR0 A;  2DR9 A;  4QZ8 A;  5BPC A;  4I27 A;  2O5A A;  4IQV A;  4EV6 A;  9ICT A;  4UAZ A;  9ICJ A;  5DEC A;  4AT8 A;  4MF8 A;  1VFG A;  7ICV A;  7ICN A;  3C2L A;  2BCS A;  3ISC A;  9ICA A;  4LEW A;  3WFQ E;  5DBB A;  3H39 A;  4JLX A;  1BPE A;  4X4R A;  4RWO A;  3RH5 A;  4KM5 A;  2BPC A;  3B0Y A;  2BE3 A;  5JTG A;  4WC7 A;  4YCX A;  4P4P A;  1WOT A;  4I29 A;  4K4H A;  8ICX A;  2BCQ A;  2FMS A;  9ICX A;  4R65 A;  4FO1 A;  3WFP A;  1MIV A;  5TZV A;  4I2A A;  2BCU A;  2BBJ A;  1ZQC A;  1ZQI A;  4KB6 A;  4DOA A;  4P2H A;  4DO9 A;  3GDX A;  2PFP A;  8ICR A;  2HHP A;  4I2I A;  1ZQR A;  2M2V A;  4EBK A;  2ZHA A;  5IIO A;  4KLU A;  4PHP A;  5D63 A;  5HHI A;  4KLS A;  3ER9 B;  1V4A A;  1ZJM A;  3JPR A;  5J0Y A;  4NXT A;  3V7K A;  3OGU A;  7ICR A;  3AQN A;  4K8V A;  4M0A A;  4WC4 A;  2HN1 A;  9ICS A;  4I2B A;  4KLL A;  2GA9 D;  1R8A A;  4YN4 A;  1KNY A;  4UD5 A;  4F5O A;  5D4B A;  4O5C A;  5DBC A;  5J2B A;  4WC3 A;  7ICH A;  3V7J A;  3MDA A;  3H38 A;  4R64 A;  4LZD A;  4N7R A;  2FMP A;  4WH5 A;  5CWR A;  2M2W A;  5HRG A;  4X4N A;  4PH5 A;  7ICT A;  5DED A;  3RH6 A;  4WOY A;  4EP7 A;  4LEV A;  5J2C A;  5CB1 A;  4E8F A;  4UD4 A;  1ZQQ A;  4O5E A;  4I2E A;  4MFF A;  1ZQE A;  1XSL A;  3HIY A;  4I28 A;  1UEU A;  2FCL A;  4K98 A;  1ZQT A;  3RJG A;  4XA5 A;  2RFF A;  3LK9 A;  1ZQW A;  3ISB A;  2ZH7 A;  4X5V A;  3RJK A;  7ICM A;  4FHY A;  5J0Q A;  4KLG A;  3JPS A;  5EOZ A;  2ID1 A;  5D61 A;  3UPS A;  4RPY A;  2B56 A;  4WC2 A;  5IIK A;  5J2E A;  3JPT A;  4AT7 A;  3AU2 A;  1R8B A;  4O69 A;  3NYB A;  2DRA A;  4QZB A;  8ICF A;  1ZQH A;  3OUY B;  1VJ7 A;  2ZH5 A;  2ZH9 A;  1ZQO A;  5CJ7 A;  4WQL A;  3RJJ A;  1TFW A;  9ICP A;  5DKW A;  4DOB A;  4X4P A;  4FHW A;  2W9M A;  4QZE A;  1BPX A;  4RWN A;  4NXZ A;  2O1P A;  2PFQ A;  5D62 A;  4TUS A;  5J2J A;  4JWN A;  4NLZ A;  4RQ8 A;  4X4U A;  4WBZ A;  4I2G A;  9ICI A;  4NKU A;  1KDH A;  4M47 A;  4PPX A;  1MIY A;  2EWR A;  4KLO A;  4Z6D A;  2DVI A;  3ERC C;  1ZQB A;  3MGI A;  4X4O A;  5HHH A;  4QZG A;  3CK6 A;  5J0O A;  7ICF A;  3LQC B;  2ISP A;  7ICP A;  9ICU A;  4X4V A;  4WC5 A;  5CHE A;  3NKU A;  4NXV A;  4Z6E A;  5J29 A;  1GPJ A;  4NKT A;  4EBJ A;  4I2D A;  4MF2 A;  2P66 A;  1ZQD A;  5J2F A;  4QZC A;  3UXN A;  4WQK A;  4RQ4 A;  4KLM A;  3B0X A;  4KLE A;  3HJ1 A;  4S3N A;  1ZQX A;  1BPD A;  3L9D A;  3RJF A;  4UB5 A;  4FHP A;  5HC9 A;  2NRK A;  5CFT A;  2ZH4 A;  4P4O A;  4JWM A;  4UAW A;  1HUZ A;  1YLQ A;  5IIM A;  4F5P A;  8ICN A;  3JPQ A;  2BCR A;  8ICM A;  4RQ1 A;  8ICE A;  7ICU A;  5HRH A;  9ICE A;  3NVO A;  8ICY A;  8ICJ A;  4TUQ A;  3OUY A;  4K99 A;  9ICC A;  9ICW A;  4I2J A;  3RJI A;  4RQ0 A;  3JCF A;  4R66 A;  3V72 A;  5BOM A;  4O6A A;  7ICK A;  7ICL A;  4OAH A;  5HRB A;  1ZQA A;  3JYY A;  4WC0 A;  4IQU A;  3MBY A;  1BPB A;  1MIW A;  2GWS A;  4FHV A;  3UXO A;  4AT9 B;  4XQ8 A;  2BCV A;  5D46 A;  4OAG A;  4LEZ A;  3UQ2 A;  3RJH A;  4YMO A;  4OAF A;  4O9M A;  9ICQ A;  4UBC A;  2B51 A;  4LEY A;  8ICK A;  4GXJ A;  3WFR E;  2VAN A;  3H3A A;  2PFO A;  7ICQ A;  1ZQM A;  4QZI A;  4YD1 A;  3HJ4 A;  4RT3 A;  3PNC A;  4E7X A;  4M9N A;  4QZA A;  8ICC A;  4KLJ A;  3ER8 C;  4IQT A;  4WC6 A;  4UB1 A;  4PGQ A;  2PFN A;  1F5A A;  8ICA A;  4K9B A;  4X4Q A;  5III A;  2IHM A;  9ICK A;  1XSN A;  5J2D A;  5J0T A;  2ZH8 A;  1ZJN A;  4LT6 A;  3AUO A;  4PHD A;  5B3Q A;  1ZQK A;  5HRK A;  5DDY A;  4EEB A;  8ICH A;  1JMS A;  4Z6F A;  2ZH3 A;  4X0A A;  4K4G A;  4ATB A;  3HW8 A;  4WCW A;  3C18 A;  1ZQY A;  2PBE A;  5J0S A;  3C2K A;  4XQ7 A;  8ICP A;  4RPZ A;  4EGW A;  8ICL A;  3OWG A;  4FH3 A;  5IIL A;  5CFU A;  3AQK A;  3OV7 A;  3AQL A;  5DB6 A;  4QZH A;  3JPN A;  1Q79 A;  5BOL A;  5J0W A;  5J0X A;  4O67 A;  3OVA A;  8ICI A;  3WFO A;  4O68 A;  1BPY A;  4NLN A;  4EED A;  3AQM A;  4YMM A;  5DBA A;  2BPF A;  3RJE A;  4KLD A;  7ICG A;  4NXX A;  4NLK A;  4MKP A;  4KLI A;  9ICR A;  5J2K A;  9ICO A;  4NXU A;  3EF2 A;  4F5Q A;  1TV9 A;  1MQ2 A;  4PGX A;  4RQ2 A;  1JQR A;  5HRE A;  2GAF D;  7ICO A;  4NM1 A;  3PHZ A;  1Q78 A;  4OAI Z;  3V7L A;  1NO5 A;  4M5D A;  3AU6 A;  4NXW A;  4I2C A;  5B3P A;  4RWP A;  9ICH A;  1ZQJ A;  5HR9 A;  5J2A A;  4K4I A;  4UB3 A;  4M2Y A;  7ICJ A;  4TUR A;  2ZH1 A;  2M2U A;  4QZD A;  4XRH A;  4KLQ A;  3H37 A;  2HN2 A;  3JZ0 A;  5IIN A;  3TFR A;  9ICL A;  3MGH A;  5HRL A;  1ZQL A;  2DR7 A; 
#chains in the Genus database with same CATH homology
 4TUP A;  3HX0 A;  1HUO A;  2ZH2 A;  4M9L A;  3JPO A;  1ZQN A;  4I2F A;  2M2T A;  8ICO A;  4JLZ A;  3OVS A;  5J2I A;  4RWQ A;  4RQ3 A;  2BPG A;  9ICF A;  4UB2 A;  8ICZ A;  5J0R A;  3ISD A;  5D49 A;  2B4V A;  3UQ0 A;  9ICV A;  3PML A;  8ICT A;  4AT9 A;  8ICG A;  3WFS C;  4KLT A;  4XUS A;  4FHX A;  3C5G A;  4LZG A;  4KLH A;  8ICS A;  4AT8 B;  8ICQ A;  4M9H A;  4M9J A;  4GXK A;  4YD2 A;  4O5K A;  4WC1 A;  4DOC A;  5CP2 A;  4F5R A;  1ZQU A;  4UB4 A;  7ICI A;  4GXI A;  8ICU A;  5F2V O;  4X4T A;  5HRF A;  1ZQG A;  4PHA A;  8ICW A;  5DB7 A;  4PHE A;  9ICG A;  4FH5 A;  4MFC A;  4K9A A;  4I2H A;  3TFS A;  4QZF A;  5J0U A;  3MDC A;  4P4M A;  4E80 A;  3K75 D;  5DB8 A;  4WBY A;  4RQ6 A;  5HRD A;  4F5N A;  4AT7 B;  3JPP A;  2PXI A;  4ATB B;  9ICB A;  1R8C A;  4QZ9 A;  4IQW A;  2ZH6 A;  9ICM A;  1XSP A;  1ZQV A;  2FMQ A;  2ISO A;  2Q66 A;  1FA0 A;  4RPX A;  1RZT A;  4KLF A;  1NOM A;  4MFA A;  1TVA A;  7ICE A;  1KEJ A;  8ICB A;  3C66 A;  4X4S A;  2DR5 A;  4UAY A;  1BPZ A;  3UPQ A;  5HRI A;  4RT2 A;  1ZQF A;  4IG8 A;  4Z6C A;  4NY8 A;  4LVS A;  4X0B A;  4NM2 A;  3RH4 A;  2DRB A;  1R89 A;  3UXP A;  3C2M A;  3C5F A;  4YMN A;  1MQ3 A;  1PX5 A;  4RQ5 A;  2I9G A;  5CHG A;  5IIJ A;  1ZQZ A;  4PGY A;  5J0P A;  4RQ7 A;  5J2H A;  2DR8 A;  1TFY A;  3PMN A;  4M04 A;  1JAJ A;  8ICV A;  7ICS A;  4K96 A;  1ZQS A;  4FO6 A;  1UEV A;  5DB9 A;  3OVB A;  3HWT A;  1OU5 A;  9ICN A;  4K97 A;  1ZQP A;  5J2G A;  1UET A;  2ZHB A;  1RPL A;  5DDM A;  4UBB A;  5CA7 A;  4M9G A;  1JN3 A;  4R63 A;  5CR0 A;  2DR9 A;  4QZ8 A;  5BPC A;  4I27 A;  2O5A A;  4IQV A;  9ICT A;  4UAZ A;  9ICJ A;  5DEC A;  4AT8 A;  4MF8 A;  1VFG A;  7ICV A;  7ICN A;  3C2L A;  2BCS A;  3ISC A;  9ICA A;  4LEW A;  3WFQ E;  5DBB A;  3H39 A;  4JLX A;  1BPE A;  4X4R A;  4RWO A;  3RH5 A;  4KM5 A;  2BPC A;  3B0Y A;  2BE3 A;  4WC7 A;  4YCX A;  4P4P A;  1WOT A;  4I29 A;  4K4H A;  8ICX A;  2BCQ A;  2FMS A;  9ICX A;  4R65 A;  3WFP A;  1MIV A;  5TZV A;  4I2A A;  2BCU A;  1ZQC A;  1ZQI A;  4KB6 A;  4DOA A;  4P2H A;  4DO9 A;  3GDX A;  2PFP A;  8ICR A;  2HHP A;  4I2I A;  1ZQR A;  2M2V A;  4EBK A;  2ZHA A;  5IIO A;  4KLU A;  4PHP A;  5HHI A;  4KLS A;  1V4A A;  1ZJM A;  3JPR A;  5J0Y A;  4NXT A;  3V7K A;  3OGU A;  7ICR A;  3AQN A;  4K8V A;  4M0A A;  4WC4 A;  9ICS A;  4I2B A;  4KLL A;  1R8A A;  4YN4 A;  1KNY A;  4UD5 A;  4F5O A;  5D4B A;  4O5C A;  5DBC A;  5J2B A;  4WC3 A;  7ICH A;  3V7J A;  3MDA A;  3H38 A;  4R64 A;  4LZD A;  2FMP A;  5CWR A;  2M2W A;  5HRG A;  4X4N A;  4PH5 A;  7ICT A;  5DED A;  3RH6 A;  4WOY A;  4EP7 A;  4LEV A;  5J2C A;  5CB1 A;  4E8F A;  4UD4 A;  1ZQQ A;  4O5E A;  4I2E A;  4MFF A;  1ZQE A;  1XSL A;  3HIY A;  4I28 A;  1UEU A;  4K98 A;  1ZQT A;  3RJG A;  4XA5 A;  2RFF A;  3LK9 A;  1ZQW A;  3ISB A;  2ZH7 A;  4X5V A;  3RJK A;  7ICM A;  4FHY A;  5J0Q A;  4KLG A;  3JPS A;  5EOZ A;  2ID1 A;  3UPS A;  4RPY A;  2B56 A;  4WC2 A;  5IIK A;  5J2E A;  3JPT A;  4AT7 A;  3AU2 A;  1R8B A;  4O69 A;  3NYB A;  2DRA A;  4QZB A;  8ICF A;  1ZQH A;  3OUY B;  1VJ7 A;  2ZH5 A;  2ZH9 A;  1ZQO A;  5CJ7 A;  3RJJ A;  1TFW A;  9ICP A;  5DKW A;  4DOB A;  4X4P A;  4FHW A;  2W9M A;  4QZE A;  1BPX A;  4RWN A;  4NXZ A;  2O1P A;  2PFQ A;  4TUS A;  5J2J A;  4JWN A;  4NLZ A;  4RQ8 A;  4X4U A;  4WBZ A;  4I2G A;  9ICI A;  4NKU A;  1KDH A;  4M47 A;  4PPX A;  1MIY A;  4KLO A;  4Z6D A;  2DVI A;  1ZQB A;  3MGI A;  4X4O A;  5HHH A;  4QZG A;  5J0O A;  7ICF A;  3LQC B;  2ISP A;  7ICP A;  9ICU A;  4X4V A;  4WC5 A;  4NXV A;  4Z6E A;  5J29 A;  4NKT A;  4EBJ A;  4I2D A;  4MF2 A;  2P66 A;  1ZQD A;  5J2F A;  4QZC A;  3UXN A;  4RQ4 A;  4KLM A;  3B0X A;  4KLE A;  3HJ1 A;  4S3N A;  1ZQX A;  1BPD A;  3L9D A;  3RJF A;  4UB5 A;  4FHP A;  5HC9 A;  2NRK A;  2ZH4 A;  4P4O A;  4JWM A;  4UAW A;  1HUZ A;  1YLQ A;  5IIM A;  4F5P A;  8ICN A;  3JPQ A;  2BCR A;  8ICM A;  4RQ1 A;  8ICE A;  7ICU A;  5HRH A;  9ICE A;  8ICY A;  8ICJ A;  4TUQ A;  3OUY A;  4K99 A;  9ICC A;  9ICW A;  4I2J A;  3RJI A;  4RQ0 A;  4R66 A;  3V72 A;  5BOM A;  4O6A A;  7ICK A;  7ICL A;  4OAH A;  5HRB A;  1ZQA A;  3JYY A;  4WC0 A;  4IQU A;  3MBY A;  1BPB A;  1MIW A;  2GWS A;  4FHV A;  3UXO A;  4AT9 B;  4XQ8 A;  2BCV A;  5D46 A;  4OAG A;  4LEZ A;  3UQ2 A;  3RJH A;  4YMO A;  4OAF A;  4O9M A;  9ICQ A;  4UBC A;  2B51 A;  4LEY A;  8ICK A;  4GXJ A;  3WFR E;  2VAN A;  3H3A A;  2PFO A;  7ICQ A;  1ZQM A;  4QZI A;  4YD1 A;  3HJ4 A;  4RT3 A;  3PNC A;  4E7X A;  4M9N A;  4QZA A;  8ICC A;  4KLJ A;  4IQT A;  4WC6 A;  4UB1 A;  4PGQ A;  2PFN A;  1F5A A;  8ICA A;  4K9B A;  4X4Q A;  5III A;  2IHM A;  9ICK A;  1XSN A;  5J2D A;  5J0T A;  2ZH8 A;  1ZJN A;  4LT6 A;  3AUO A;  4PHD A;  1ZQK A;  5HRK A;  5DDY A;  8ICH A;  1JMS A;  4Z6F A;  2ZH3 A;  4X0A A;  4K4G A;  4ATB A;  3HW8 A;  4WCW A;  3C18 A;  1ZQY A;  2PBE A;  5J0S A;  3C2K A;  4XQ7 A;  8ICP A;  4RPZ A;  8ICL A;  4FH3 A;  5IIL A;  3AQK A;  3OV7 A;  3AQL A;  5DB6 A;  4QZH A;  3JPN A;  1Q79 A;  5BOL A;  5J0W A;  5J0X A;  4O67 A;  3OVA A;  8ICI A;  3WFO A;  4O68 A;  1BPY A;  4NLN A;  3AQM A;  4YMM A;  5DBA A;  2BPF A;  3RJE A;  4KLD A;  7ICG A;  4NXX A;  4NLK A;  4MKP A;  4KLI A;  9ICR A;  5J2K A;  9ICO A;  4NXU A;  4F5Q A;  1MQ2 A;  1TV9 A;  4PGX A;  4RQ2 A;  1JQR A;  5HRE A;  7ICO A;  4NM1 A;  1Q78 A;  4OAI Z;  3V7L A;  1NO5 A;  4M5D A;  3AU6 A;  4NXW A;  4I2C A;  4RWP A;  9ICH A;  1ZQJ A;  5HR9 A;  5J2A A;  4K4I A;  4UB3 A;  4M2Y A;  7ICJ A;  4TUR A;  2ZH1 A;  2M2U A;  4QZD A;  4XRH A;  4KLQ A;  3H37 A;  3JZ0 A;  5IIN A;  3TFR A;  9ICL A;  3MGH A;  5HRL A;  1ZQL A;  2DR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...