4NKTA

Structure of cid1 in complex with the utp analog umpnpp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
319
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 111
structure length 319
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nktA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nktA02
4UBCA 4TUPA 4YN4A 4UB4A 3LQCB 7ICNA 2M2VA 3RJHA 4UB3A 1ZQIA 4MF2A 4FHVA 8ICUA 5J0XA 4MF8A 7ICTA 4UBBA 3WFPA 4M9GA 5J2EA 4WC3A 2W9MA 2BCRA 3RJJA 4X4NA 4PH5A 3H37A 5HRDA 4YD2A 3HW8A 1UETA 1JN3A 4KLDA 1KNYA 9ICJA 5CJ7A 4QZDA 2ZHAA 5J2FA 2ZH1A 4QZEA 4PHPA 5DB7A 3UXNA 4KLGA 8ICHA 4IQUA 4E8FA 5IIJA 5DDMA 4YMNA 3UXOA 4K4GA 2B51A 3WFQE 9ICBA 2PBEA 4I2IA 3RJKA 5J0QA 7ICKA 4WC4A 5IIOA 4LZGA 4X5VA 3OVAA 4IQTA 2B4VA 4I2CA 2HHPA 5DKWA 5J2DA 4RT3A 7ICVA 1JQRA 5HC9A 4X4SA 5D4BA 2BCSA 4EBJA 1TFWA 5DB9A 1KDHA 2GWSA 5CR0A 1R8BA 4M04A 1HUZA 2DR9A 3RH6A 2DVIA 4WBYA 4PPXA 1ZQEA 1ZQHA 2ISPA 1ZQTA 4ATBB 4JWNA 3AQLA 4I2BA 4I2EA 4AT7A 1MIVA 1ZQVA 5HRHA 5IINA 4FHPA 4PHEA 4UD4A 9ICSA 8ICGA 5IIIA 3V7KA 4UB1A 1ZQFA 1WOTA 3B0XA 3JPPA 1BPZA 3V7JA 3MDAA 4FH5A 2DRBA 4YCXA 5DB6A 1ZJMA 3ISDA 3JPNA 4XUSA 4M2YA 4DOAA 4I29A 4YD1A 4M0AA 4UB5A 1TVAA 8ICKA 4AT8B 5J2AA 9ICMA 3RH4A 3JPSA 3OV7A 5IIKA 5CB1A 4RQ8A 1ZQKA 7ICGA 4QZAA 9ICNA 1ZQMA 9ICOA 2BPFA 4QZ9A 4IG8A 3OVSA 9ICEA 4LT6A 8ICRA 3UXPA 4FH3A 4KLOA 4PGXA 4LZDA 5J2GA 3OUYA 2ZH2A 4X4QA 3GDXA 1TFYA 4JWMA 4FHYA 2BCVA 3RJEA 4KLQA 4WC6A 1ZQBA 4UAWA 1ZQQA 4M9HA 4M5DA 3H39A 4KLFA 1ZJNA 5HHIA 4TUSA 4UD5A 5D46A 8ICSA 2ZH6A 8ICOA 1NO5A 7ICSA 4WCWA 3MDCA 1XSNA 2ZH5A 3JPTA 4KLHA 9ICXA 4TURA 5DECA 2BPGA 4F5NA 3PNCA 4RQ6A 8ICNA 3C2LA 7ICPA 4Z6EA 3AU6A 1ZQOA 5TZVA 2B56A 2ZH7A 1ZQCA 4IQWA 2RFFA 4GXJA 1NOMA 3C18A 5J0TA 1R89A 8ICFA 9ICRA 3C5FA 5CA7A 2ZHBA 3PMNA 4KLJA 7ICMA 8ICZA 4RT2A 2I9GA 2DRAA 5J2CA 4F5RA 4O9MA 3JPQA 3OGUA 1ZQRA 4PGYA 5BOLA 1ZQLA 4I2AA 1R8CA 4RQ0A 4X4PA 3C5GA 7ICJA 4GXIA 4AT9A 7ICQA 5DDYA 4X4VA 4QZHA 4I28A 5D49A 2BE3A 4MFAA 1MIWA 2M2WA 8ICMA 2VANA 3AQNA 5CWRA 4I2FA 7ICOA 8ICAA 4FHWA 4KLLA 4I2DA 4M9JA 2PFQA 3UPSA 4I2JA 5HREA 3TFSA 5IIMA 4QZGA 2BCUA 2BPCA 3AU2A 5BOMA 5J0UA 4UAYA 4I2GA 2DR8A 1ZQXA 4WC0A 2M2UA 4M9LA 1ZQNA 3HJ1A 4K4IA 5J0YA 4O5EA 3HJ4A 4XA5A 8ICWA 4RQ2A 7ICRA 4KLUA 4X0BA 4QZFA 1HUOA 4R63A 4F5PA 3TFRA 4X0AA 2PXIA 4KLIA 1ZQWA 4RWPA 4R66A 2FMSA 4FO6A 8ICPA 2PFNA 1ZQYA 4RQ4A 1JAJA 4QZ8A 5F2VO 5DB8A 5J0SA 2IHMA 8ICVA 1BPDA 8ICLA 9ICQA 3MGHA 3HX0A 3OVBA 3AQKA 4RWOA 3V72A 2Q66A 4DOCA 4NLKA 4R65A 9ICWA 1BPYA 1ZQUA 3ISBA 5BPCA 7ICFA 1MQ3A 1JMSA 4QZIA 2P66A 4O5KA 1F5AA 8ICQA 4X4RA 1FA0A 9ICCA 3JYYA 1ZQPA 2DR7A 5HRFA 4Z6DA 8ICJA 1ZQJA 4FHXA 3UPQA 3AQMA 5DBAA 9ICHA 3C2KA 4NM2A 3UQ0A 4ATBA 4AT7B 4RQ1A 9ICIA 3L9DA 2ZH9A 1YLQA 9ICAA 2BCQA 4Z6FA 4P4MA 4WBZA 2DR5A 1RPLA 3AUOA 1VJ7A 4XRHA 8ICXA 8ICCA 2PFPA 4RWQA 4P2HA 5J0PA 4GXKA 4RQ7A 1BPEA 1Q79A 1TV9A 4UAZA 4WC2A 5HRKA 1XSPA 2ZH4A 5CHGA 3JZ0A 3NYBA 9ICTA 5DBCA 4NLZA 3WFRE 1VFGA 2O5AA 1R8AA 5IILA 1MIYA 9ICPA 2ID1A 3HWTA 3H38A 4P4OA 4EBKA 4I2HA 4X4TA 4RPZA 2FMQA 2M2TA 4TUQA 4WC5A 4PHAA 4AT8A 4NKTA 4I27A 3HIYA 3MBYA 4XQ7A 3C66A 5DEDA 5HRLA 1ZQZA 1UEVA 4DOBA 4NM1A 4KLMA 4NKUA 4M47A 5HRBA 4E7XA 3OUYB 4YMMA 1RZTA 3PMLA 4S3NA 1MQ2A 4YMOA 4QZCA 4LVSA 5DBBA 4MFCA 4RPXA 3JPOA 3UQ2A 2ISOA 5EOZA 4E80A 1XSLA 3C2MA 8ICTA 4Z6CA 4RWNA 3MGIA 7ICEA 5HR9A 4R64A 4NY8A 3RJGA 1Q78A 3B0YA 3V7LA 4O5CA 1UEUA 3RH5A 4MFFA 5HRGA 5J2JA 5CP2A 5J2HA 4DO9A 4X4UA 5HRIA 3RJIA 3RJFA 5J0OA 4RQ3A 4UB2A 2PFOA 4NXZA 4QZBA 4P4PA 4K4HA 5J2BA 7ICLA 4KLEA 2ZH3A 5HHHA 8ICEA 3K75D 3H3AA 7ICIA 1ZQSA 4PGQA 4M9NA 3WFOA 5J0RA 1BPBA 8ICIA 2ZH8A 4RPYA 2NRKA 3LK9A 5J29A 1KEJA 4NLNA 9ICLA 4WC7A 3JPRA 4F5QA 5J2KA 4AT9B 5J2IA 2FMPA 2O1PA 1ZQDA 9ICKA 8ICBA 1BPXA 4KLTA 8ICYA 1PX5A 9ICVA 1ZQAA 5J0WA 9ICGA 4XQ8A 1OU5A 9ICFA 1ZQGA 4IQVA 4X4OA 7ICUA 4EP7A 3ISCA 4KLSA 4PHDA 3WFSC 7ICHA 4F5OA 9ICUA 1V4AA 4WC1A 4RQ5A
chains in the Genus database with same CATH superfamily
4UBCA 4TUPA 2GAFD 4LEYA 4YN4A 4UB4A 3LQCB 7ICNA 2M2VA 3RJHA 4UB3A 1ZQIA 2GA9D 4MF2A 4FHVA 8ICUA 5J0XA 4MF8A 7ICTA 4UBBA 5CHEA 3WFPA 4X4NA 5J2EA 4WC3A 2W9MA 2BCRA 3RJJA 4M9GA 2IHOA 4PH5A 3H37A 5HRDA 4YD2A 3HW8A 1UETA 1JN3A 4KLDA 4K97A 1KNYA 9ICJA 5CJ7A 4QZDA 2ZHAA 5J2FA 2ZH1A 5D62A 4QZEA 4PHPA 5DB7A 3UXNA 4KLGA 8ICHA 4IQUA 4E8FA 5IIJA 5DDMA 4YMNA 3UXOA 4K4GA 2B51A 3WFQE 9ICBA 2PBEA 4I2IA 3RJKA 5B3PA 5J0QA 4XJEA 7ICKA 4WC4A 5IIOA 4LZGA 4X5VA 3OVAA 4IQTA 2B4VA 4MKPA 4I2CA 2HHPA 5DKWA 5J2DA 4RT3A 7ICVA 1JQRA 5HC9A 4X4SA 5D4BA 4I0UA 4N7RA 2BCSA 4EBJA 1TFWA 4NXUA 5DB9A 1KDHA 2GWSA 5CR0A 1R8BA 4M04A 2DR9A 1HUZA 3RH6A 2DVIA 4WBYA 4PPXA 1ZQEA 1ZQHA 2ISPA 3JCFA 1ZQTA 4ATBB 4JWNA 3AQLA 4I2BA 4I2EA 2BBJA 4AT7A 1MIVA 1ZQVA 5HRHA 5IINA 4FHPA 4NXXA 4PHEA 4UD4A 9ICSA 8ICGA 5IIIA 3V7KA 4UB1A 1ZQFA 1WOTA 3B0XA 3JPPA 1BPZA 3V7JA 3MDAA 4FH5A 2DRBA 4YCXA 5DB6A 1ZJMA 3ISDA 5B3QA 4NXVA 3JPNA 4XUSA 4M2YA 2BBHA 4DOAA 4I29A 4YD1A 4M0AA 4UB5A 2EWRA 1TVAA 4NXTA 8ICKA 4AT8B 5J2AA 9ICMA 3RH4A 5IIKA 3OV7A 3JPSA 5CB1A 4RQ8A 3PHZA 1ZQKA 7ICGA 4QZAA 9ICNA 1ZQMA 3NVOA 9ICOA 2BPFA 4QZ9A 4IG8A 3OVSA 9ICEA 4LT6A 8ICRA 3UXPA 4FH3A 4KLOA 4PGXA 4LZDA 3OUYA 5J2GA 2ZH2A 4X4QA 1TFYA 3GDXA 4JWMA 4FHYA 2BCVA 3RJEA 4KLQA 4WC6A 1ZQBA 4UAWA 1ZQQA 4M9HA 4M5DA 3H39A 4KLFA 1ZJNA 5HHIA 4TUSA 4KM5A 4UD5A 5D46A 8ICSA 2ZH6A 4K9BA 4EEBA 8ICOA 1NO5A 7ICSA 4WCWA 4EV6A 4O69A 3MDCA 4WQKA 1XSNA 2ZH5A 3JPTA 4KLHA 9ICXA 4EEDA 4TURA 5DECA 2BPGA 4FO1A 3PNCA 4F5NA 4RQ6A 8ICNA 3CK6A 5D63A 3C2LA 7ICPA 4Z6EA 3AU6A 1ZQOA 5TZVA 2B56A 2ZH7A 1ZQCA 4IQWA 2RFFA 4GXJA 1NOMA 3C18A 5J0TA 1R89A 8ICFA 9ICRA 3NWIA 3C5FA 5CA7A 2ZHBA 3PMNA 4KLJA 3NKUA 7ICMA 8ICZA 4RT2A 2I9GA 2DRAA 5J2CA 4F5RA 4O9MA 3JPQA 4LEZA 3OGUA 1ZQRA 4PGYA 5BOLA 1ZQLA 4I2AA 1R8CA 4X4PA 4RQ0A 3C5GA 7ICJA 4GXIA 5CFUA 4AT9A 7ICQA 5CFSA 5DDYA 4O6AA 4X4VA 4QZHA 4I28A 4O67A 5D49A 2BE3A 4MFAA 4LEVA 1MIWA 2M2WA 8ICMA 2VANA 3AQNA 5CWRA 4I2FA 7ICOA 8ICAA 4FHWA 4KLLA 4I2DA 4M9JA 2PFQA 3UPSA 4I2JA 5HREA 3TFSA 4O68A 5IIMA 4QZGA 2BCUA 2BPCA 3AU2A 5BOMA 5J0UA 4UAYA 4I2GA 2DR8A 1ZQXA 2HN1A 4WC0A 4K9AA 2M2UA 4M9LA 1ZQNA 3HJ1A 4K4IA 5J0YA 4O5EA 3HJ4A 4XA5A 8ICWA 4RQ2A 7ICRA 4KLUA 4X0BA 4QZFA 1HUOA 4R63A 4F5PA 3TFRA 4X0AA 2PXIA 4KLIA 4RWPA 1ZQWA 4R66A 2FMSA 4FO6A 8ICPA 2PFNA 1ZQYA 4RQ4A 1JAJA 4QZ8A 5F2VO 5CFTA 5DB8A 5J0SA 2IHMA 8ICVA 2IUBA 1BPDA 8ICLA 9ICQA 3MGHA 3HX0A 4K96A 3OVBA 4RWOA 3AQKA 3V72A 2Q66A 4DOCA 4NLKA 4R65A 9ICWA 1BPYA 1ZQUA 3ISBA 5BPCA 7ICFA 1MQ3A 1JMSA 4QZIA 2P66A 4O5KA 1F5AA 8ICQA 4X4RA 3ER8C 1FA0A 9ICCA 3JYYA 2DR7A 1ZQPA 5HRFA 4Z6DA 8ICJA 3EF2A 1ZQJA 4FHXA 4JLXA 3UPQA 3AQMA 5DBAA 4OAHA 9ICHA 3C2KA 4NM2A 5JTGA 3UQ0A 4ATBA 4K98A 4AT7B 4RQ1A 9ICIA 3L9DA 2ZH9A 1YLQA 9ICAA 2BCQA 3K7DA 4Z6FA 4P4MA 2DR5A 4K99A 4WBZA 1RPLA 3AUOA 1VJ7A 4XRHA 8ICXA 8ICCA 3ERCC 2PFPA 4RWQA 4P2HA 5J0PA 4GXKA 4RQ7A 1BPEA 1Q79A 1TV9A 4UAZA 4WC2A 5HRKA 1XSPA 2ZH4A 5CHGA 3JZ0A 3ER9B 3NYBA 3OWGA 9ICTA 5DBCA 4NLZA 3WFRE 1VFGA 2O5AA 1R8AA 5IILA 1MIYA 9ICPA 2ID1A 4OAIZ 3HWTA 4WOYA 3H38A 4P4OA 4EBKA 4WQLA 4I2HA 4X4TA 4RPZA 2FMQA 2M2TA 4OAFA 4TUQA 4WC5A 4PHAA 4AT8A 4NKTA 4I27A 5D61A 3HIYA 3MBYA 4XQ7A 3C66A 5DEDA 5HRLA 1ZQZA 1UEVA 4DOBA 4NM1A 4EGWA 4NKUA 4KLMA 4M47A 5HRBA 4E7XA 3OUYB 4YMMA 1RZTA 3PMLA 4S3NA 4WH5A 2HN2A 1MQ2A 4YMOA 4QZCA 4LVSA 5DBBA 4MFCA 4RPXA 3JPOA 3UQ2A 2ISOA 5EOZA 4E80A 4KB6A 1XSLA 3C2MA 8ICTA 4Z6CA 4RWNA 3MGIA 7ICEA 5HR9A 4R64A 4NY8A 3RJGA 1Q78A 3B0YA 3V7LA 4O5CA 1UEUA 3RH5A 4MFFA 4K8VA 5HRGA 5J2JA 5CP2A 5J2HA 4X4UA 4DO9A 5HRIA 3RJIA 3RJFA 5J0OA 4HX0A 4RQ3A 4UB2A 2PFOA 4NXZA 4QZBA 4P4PA 4K4HA 5J2BA 7ICLA 4KLEA 2ZH3A 5HHHA 8ICEA 3K75D 3H3AA 7ICIA 1ZQSA 4PGQA 4M9NA 3WFOA 5J0RA 1BPBA 8ICIA 2ZH8A 4RPYA 1GPJA 2NRKA 4NXWA 3LK9A 5J29A 4LEWA 1KEJA 4NLNA 9ICLA 4WC7A 3JPRA 4F5QA 5J2KA 4AT9B 5J2IA 2FMPA 2O1PA 1ZQDA 9ICKA 8ICBA 1BPXA 3MCRA 4KLTA 8ICYA 1PX5A 9ICVA 1ZQAA 5J0WA 9ICGA 4JLZA 4XQ8A 1OU5A 2FCLA 9ICFA 1ZQGA 4IQVA 4X4OA 4OAGA 7ICUA 4EP7A 3ISCA 4KLSA 4PHDA 3WFSC 7ICHA 4F5OA 9ICUA 1V4AA 4WC1A 4RQ5A
chains in the Genus database with same CATH topology
4UBCA 4TUPA 4LEYA 4YN4A 4UB4A 3LQCB 7ICNA 2M2VA 3RJHA 4UB3A 1ZQIA 4MF2A 4FHVA 8ICUA 5J0XA 4MF8A 7ICTA 4UBBA 3WFPA 4X4NA 5J2EA 4WC3A 2W9MA 2BCRA 3RJJA 4M9GA 4PH5A 3H37A 5HRDA 4YD2A 3HW8A 1UETA 1JN3A 4KLDA 4K97A 1KNYA 9ICJA 5CJ7A 4QZDA 2ZHAA 5J2FA 2ZH1A 4QZEA 4PHPA 5DB7A 3UXNA 4KLGA 8ICHA 4IQUA 4E8FA 5IIJA 5DDMA 4YMNA 3UXOA 4K4GA 2B51A 3WFQE 9ICBA 2PBEA 4I2IA 3RJKA 5J0QA 7ICKA 4WC4A 5IIOA 4LZGA 4X5VA 3OVAA 4IQTA 2B4VA 4MKPA 4I2CA 2HHPA 5DKWA 5J2DA 4RT3A 7ICVA 1JQRA 5HC9A 4X4SA 5D4BA 2BCSA 4EBJA 1TFWA 4NXUA 5DB9A 1KDHA 2GWSA 5CR0A 1R8BA 4M04A 2DR9A 1HUZA 3RH6A 2DVIA 4WBYA 4PPXA 1ZQEA 1ZQHA 2ISPA 1ZQTA 4ATBB 4JWNA 3AQLA 4I2BA 4I2EA 4AT7A 1MIVA 1ZQVA 5HRHA 5IINA 4FHPA 4NXXA 4PHEA 4UD4A 9ICSA 8ICGA 5IIIA 3V7KA 4UB1A 1ZQFA 1WOTA 3B0XA 3JPPA 1BPZA 3V7JA 3MDAA 4FH5A 2DRBA 4YCXA 5DB6A 1ZJMA 3ISDA 4NXVA 3JPNA 4XUSA 4M2YA 4DOAA 4I29A 4YD1A 4M0AA 4UB5A 1TVAA 4NXTA 8ICKA 4AT8B 5J2AA 9ICMA 3RH4A 5IIKA 3OV7A 3JPSA 5CB1A 4RQ8A 1ZQKA 7ICGA 4QZAA 9ICNA 1ZQMA 9ICOA 2BPFA 4QZ9A 4IG8A 3OVSA 9ICEA 4LT6A 8ICRA 3UXPA 4FH3A 4KLOA 4PGXA 4LZDA 3OUYA 5J2GA 2ZH2A 4X4QA 1TFYA 3GDXA 4JWMA 4FHYA 2BCVA 3RJEA 4KLQA 4WC6A 1ZQBA 4UAWA 1ZQQA 4M9HA 4M5DA 3H39A 4KLFA 1ZJNA 5HHIA 4TUSA 4KM5A 4UD5A 5D46A 8ICSA 2ZH6A 4K9BA 8ICOA 1NO5A 7ICSA 4WCWA 4O69A 3MDCA 1XSNA 2ZH5A 3JPTA 4KLHA 9ICXA 4TURA 5DECA 2BPGA 4F5NA 3PNCA 4RQ6A 8ICNA 3C2LA 7ICPA 4Z6EA 3AU6A 1ZQOA 5TZVA 2B56A 2ZH7A 1ZQCA 4IQWA 2RFFA 4GXJA 1NOMA 3C18A 5J0TA 1R89A 8ICFA 9ICRA 3C5FA 5CA7A 2ZHBA 3PMNA 4KLJA 7ICMA 8ICZA 4RT2A 2I9GA 2DRAA 5J2CA 4F5RA 4O9MA 3JPQA 4LEZA 3OGUA 1ZQRA 4PGYA 5BOLA 1ZQLA 4I2AA 1R8CA 4X4PA 4RQ0A 3C5GA 7ICJA 4GXIA 4AT9A 7ICQA 5DDYA 4O6AA 4X4VA 4QZHA 4I28A 4O67A 5D49A 2BE3A 4MFAA 4LEVA 1MIWA 2M2WA 8ICMA 2VANA 3AQNA 5CWRA 4I2FA 7ICOA 8ICAA 4FHWA 4KLLA 4I2DA 4M9JA 2PFQA 3UPSA 4I2JA 5HREA 3TFSA 4O68A 5IIMA 4QZGA 2BCUA 2BPCA 3AU2A 5BOMA 5J0UA 4UAYA 4I2GA 2DR8A 1ZQXA 4WC0A 4K9AA 2M2UA 4M9LA 1ZQNA 3HJ1A 4K4IA 5J0YA 4O5EA 3HJ4A 4XA5A 8ICWA 4RQ2A 7ICRA 4KLUA 4X0BA 4QZFA 1HUOA 4R63A 4F5PA 3TFRA 4X0AA 2PXIA 4KLIA 1ZQWA 4RWPA 4R66A 2FMSA 4FO6A 8ICPA 2PFNA 1ZQYA 4RQ4A 1JAJA 4QZ8A 5F2VO 5DB8A 5J0SA 2IHMA 8ICVA 1BPDA 8ICLA 9ICQA 3MGHA 3HX0A 4K96A 3OVBA 3AQKA 4RWOA 3V72A 2Q66A 4DOCA 4NLKA 4R65A 9ICWA 1BPYA 1ZQUA 3ISBA 5BPCA 7ICFA 1MQ3A 1JMSA 4QZIA 2P66A 4O5KA 1F5AA 8ICQA 4X4RA 1FA0A 9ICCA 3JYYA 2DR7A 1ZQPA 5HRFA 4Z6DA 8ICJA 1ZQJA 4FHXA 4JLXA 3UPQA 3AQMA 5DBAA 4OAHA 9ICHA 3C2KA 4NM2A 3UQ0A 4ATBA 4K98A 4AT7B 4RQ1A 9ICIA 3L9DA 2ZH9A 1YLQA 9ICAA 2BCQA 4Z6FA 4P4MA 2DR5A 4K99A 4WBZA 1RPLA 3AUOA 1VJ7A 4XRHA 8ICXA 8ICCA 2PFPA 4RWQA 4P2HA 5J0PA 4GXKA 4RQ7A 1BPEA 1Q79A 1TV9A 4UAZA 4WC2A 5HRKA 1XSPA 2ZH4A 5CHGA 3JZ0A 3NYBA 9ICTA 5DBCA 4NLZA 3WFRE 1VFGA 2O5AA 1R8AA 5IILA 1MIYA 9ICPA 2ID1A 4OAIZ 3HWTA 4WOYA 3H38A 4P4OA 4EBKA 4I2HA 4X4TA 4RPZA 2FMQA 2M2TA 4OAFA 4TUQA 4WC5A 4PHAA 4AT8A 4NKTA 4I27A 3HIYA 3MBYA 4XQ7A 3C66A 5DEDA 5HRLA 1ZQZA 1UEVA 4DOBA 4NM1A 4KLMA 4NKUA 4M47A 5HRBA 4E7XA 3OUYB 4YMMA 1RZTA 3PMLA 4S3NA 1MQ2A 4YMOA 4QZCA 4LVSA 5DBBA 4MFCA 4RPXA 3JPOA 3UQ2A 2ISOA 5EOZA 4E80A 4KB6A 1XSLA 3C2MA 8ICTA 4Z6CA 4RWNA 3MGIA 7ICEA 5HR9A 4R64A 4NY8A 3RJGA 1Q78A 3B0YA 3V7LA 4O5CA 1UEUA 3RH5A 4MFFA 4K8VA 5HRGA 5J2JA 5CP2A 5J2HA 4X4UA 4DO9A 5HRIA 3RJIA 3RJFA 5J0OA 4RQ3A 4UB2A 2PFOA 4NXZA 4QZBA 4P4PA 4K4HA 5J2BA 7ICLA 4KLEA 2ZH3A 5HHHA 8ICEA 3K75D 3H3AA 7ICIA 1ZQSA 4PGQA 4M9NA 3WFOA 5J0RA 1BPBA 8ICIA 2ZH8A 4RPYA 2NRKA 4NXWA 3LK9A 5J29A 4LEWA 1KEJA 4NLNA 9ICLA 4WC7A 3JPRA 4F5QA 5J2KA 4AT9B 5J2IA 2FMPA 2O1PA 1ZQDA 9ICKA 8ICBA 1BPXA 4KLTA 8ICYA 1PX5A 9ICVA 1ZQAA 5J0WA 9ICGA 4JLZA 4XQ8A 1OU5A 9ICFA 1ZQGA 4IQVA 4X4OA 4OAGA 7ICUA 4EP7A 3ISCA 4KLSA 4PHDA 3WFSC 7ICHA 4F5OA 9ICUA 1V4AA 4WC1A 4RQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UBC A;  4TUP A;  4YN4 A;  4UB4 A;  3LQC B;  7ICN A;  2M2V A;  3RJH A;  4UB3 A;  1ZQI A;  4MF2 A;  4FHV A;  8ICU A;  5J0X A;  4MF8 A;  7ICT A;  4UBB A;  3WFP A;  4M9G A;  5J2E A;  4WC3 A;  2W9M A;  2BCR A;  3RJJ A;  4X4N A;  4PH5 A;  3H37 A;  5HRD A;  4YD2 A;  3HW8 A;  1UET A;  1JN3 A;  4KLD A;  1KNY A;  9ICJ A;  5CJ7 A;  4QZD A;  2ZHA A;  5J2F A;  2ZH1 A;  4QZE A;  4PHP A;  5DB7 A;  3UXN A;  4KLG A;  8ICH A;  4IQU A;  4E8F A;  5IIJ A;  5DDM A;  4YMN A;  3UXO A;  4K4G A;  2B51 A;  3WFQ E;  9ICB A;  2PBE A;  4I2I A;  3RJK A;  5J0Q A;  7ICK A;  4WC4 A;  5IIO A;  4LZG A;  4X5V A;  3OVA A;  4IQT A;  2B4V A;  4I2C A;  2HHP A;  5DKW A;  5J2D A;  4RT3 A;  7ICV A;  1JQR A;  5HC9 A;  4X4S A;  5D4B A;  2BCS A;  4EBJ A;  1TFW A;  5DB9 A;  1KDH A;  2GWS A;  5CR0 A;  1R8B A;  4M04 A;  1HUZ A;  2DR9 A;  3RH6 A;  2DVI A;  4WBY A;  4PPX A;  1ZQE A;  1ZQH A;  2ISP A;  1ZQT A;  4ATB B;  4JWN A;  3AQL A;  4I2B A;  4I2E A;  4AT7 A;  1MIV A;  1ZQV A;  5HRH A;  5IIN A;  4FHP A;  4PHE A;  4UD4 A;  9ICS A;  8ICG A;  5III A;  3V7K A;  4UB1 A;  1ZQF A;  1WOT A;  3B0X A;  3JPP A;  1BPZ A;  3V7J A;  3MDA A;  4FH5 A;  2DRB A;  4YCX A;  5DB6 A;  1ZJM A;  3ISD A;  3JPN A;  4XUS A;  4M2Y A;  4DOA A;  4I29 A;  4YD1 A;  4M0A A;  4UB5 A;  1TVA A;  8ICK A;  4AT8 B;  5J2A A;  9ICM A;  3RH4 A;  3JPS A;  3OV7 A;  5IIK A;  5CB1 A;  4RQ8 A;  1ZQK A;  7ICG A;  4QZA A;  9ICN A;  1ZQM A;  9ICO A;  2BPF A;  4QZ9 A;  4IG8 A;  3OVS A;  9ICE A;  4LT6 A;  8ICR A;  3UXP A;  4FH3 A;  4KLO A;  4PGX A;  4LZD A;  5J2G A;  3OUY A;  2ZH2 A;  4X4Q A;  3GDX A;  1TFY A;  4JWM A;  4FHY A;  2BCV A;  3RJE A;  4KLQ A;  4WC6 A;  1ZQB A;  4UAW A;  1ZQQ A;  4M9H A;  4M5D A;  3H39 A;  4KLF A;  1ZJN A;  5HHI A;  4TUS A;  4UD5 A;  5D46 A;  8ICS A;  2ZH6 A;  8ICO A;  1NO5 A;  7ICS A;  4WCW A;  3MDC A;  1XSN A;  2ZH5 A;  3JPT A;  4KLH A;  9ICX A;  4TUR A;  5DEC A;  2BPG A;  4F5N A;  3PNC A;  4RQ6 A;  8ICN A;  3C2L A;  7ICP A;  4Z6E A;  3AU6 A;  1ZQO A;  5TZV A;  2B56 A;  2ZH7 A;  1ZQC A;  4IQW A;  2RFF A;  4GXJ A;  1NOM A;  3C18 A;  5J0T A;  1R89 A;  8ICF A;  9ICR A;  3C5F A;  5CA7 A;  2ZHB A;  3PMN A;  4KLJ A;  7ICM A;  8ICZ A;  4RT2 A;  2I9G A;  2DRA A;  5J2C A;  4F5R A;  4O9M A;  3JPQ A;  3OGU A;  1ZQR A;  4PGY A;  5BOL A;  1ZQL A;  4I2A A;  1R8C A;  4RQ0 A;  4X4P A;  3C5G A;  7ICJ A;  4GXI A;  4AT9 A;  7ICQ A;  5DDY A;  4X4V A;  4QZH A;  4I28 A;  5D49 A;  2BE3 A;  4MFA A;  1MIW A;  2M2W A;  8ICM A;  2VAN A;  3AQN A;  5CWR A;  4I2F A;  7ICO A;  8ICA A;  4FHW A;  4KLL A;  4I2D A;  4M9J A;  2PFQ A;  3UPS A;  4I2J A;  5HRE A;  3TFS A;  5IIM A;  4QZG A;  2BCU A;  2BPC A;  3AU2 A;  5BOM A;  5J0U A;  4UAY A;  4I2G A;  2DR8 A;  1ZQX A;  4WC0 A;  2M2U A;  4M9L A;  1ZQN A;  3HJ1 A;  4K4I A;  5J0Y A;  4O5E A;  3HJ4 A;  4XA5 A;  8ICW A;  4RQ2 A;  7ICR A;  4KLU A;  4X0B A;  4QZF A;  1HUO A;  4R63 A;  4F5P A;  3TFR A;  4X0A A;  2PXI A;  4KLI A;  1ZQW A;  4RWP A;  4R66 A;  2FMS A;  4FO6 A;  8ICP A;  2PFN A;  1ZQY A;  4RQ4 A;  1JAJ A;  4QZ8 A;  5F2V O;  5DB8 A;  5J0S A;  2IHM A;  8ICV A;  1BPD A;  8ICL A;  9ICQ A;  3MGH A;  3HX0 A;  3OVB A;  3AQK A;  4RWO A;  3V72 A;  2Q66 A;  4DOC A;  4NLK A;  4R65 A;  9ICW A;  1BPY A;  1ZQU A;  3ISB A;  5BPC A;  7ICF A;  1MQ3 A;  1JMS A;  4QZI A;  2P66 A;  4O5K A;  1F5A A;  8ICQ A;  4X4R A;  1FA0 A;  9ICC A;  3JYY A;  1ZQP A;  2DR7 A;  5HRF A;  4Z6D A;  8ICJ A;  1ZQJ A;  4FHX A;  3UPQ A;  3AQM A;  5DBA A;  9ICH A;  3C2K A;  4NM2 A;  3UQ0 A;  4ATB A;  4AT7 B;  4RQ1 A;  9ICI A;  3L9D A;  2ZH9 A;  1YLQ A;  9ICA A;  2BCQ A;  4Z6F A;  4P4M A;  4WBZ A;  2DR5 A;  1RPL A;  3AUO A;  1VJ7 A;  4XRH A;  8ICX A;  8ICC A;  2PFP A;  4RWQ A;  4P2H A;  5J0P A;  4GXK A;  4RQ7 A;  1BPE A;  1Q79 A;  1TV9 A;  4UAZ A;  4WC2 A;  5HRK A;  1XSP A;  2ZH4 A;  5CHG A;  3JZ0 A;  3NYB A;  9ICT A;  5DBC A;  4NLZ A;  3WFR E;  1VFG A;  2O5A A;  1R8A A;  5IIL A;  1MIY A;  9ICP A;  2ID1 A;  3HWT A;  3H38 A;  4P4O A;  4EBK A;  4I2H A;  4X4T A;  4RPZ A;  2FMQ A;  2M2T A;  4TUQ A;  4WC5 A;  4PHA A;  4AT8 A;  4NKT A;  4I27 A;  3HIY A;  3MBY A;  4XQ7 A;  3C66 A;  5DED A;  5HRL A;  1ZQZ A;  1UEV A;  4DOB A;  4NM1 A;  4KLM A;  4NKU A;  4M47 A;  5HRB A;  4E7X A;  3OUY B;  4YMM A;  1RZT A;  3PML A;  4S3N A;  1MQ2 A;  4YMO A;  4QZC A;  4LVS A;  5DBB A;  4MFC A;  4RPX A;  3JPO A;  3UQ2 A;  2ISO A;  5EOZ A;  4E80 A;  1XSL A;  3C2M A;  8ICT A;  4Z6C A;  4RWN A;  3MGI A;  7ICE A;  5HR9 A;  4R64 A;  4NY8 A;  3RJG A;  1Q78 A;  3B0Y A;  3V7L A;  4O5C A;  1UEU A;  3RH5 A;  4MFF A;  5HRG A;  5J2J A;  5CP2 A;  5J2H A;  4DO9 A;  4X4U A;  5HRI A;  3RJI A;  3RJF A;  5J0O A;  4RQ3 A;  4UB2 A;  2PFO A;  4NXZ A;  4QZB A;  4P4P A;  4K4H A;  5J2B A;  7ICL A;  4KLE A;  2ZH3 A;  5HHH A;  8ICE A;  3K75 D;  3H3A A;  7ICI A;  1ZQS A;  4PGQ A;  4M9N A;  3WFO A;  5J0R A;  1BPB A;  8ICI A;  2ZH8 A;  4RPY A;  2NRK A;  3LK9 A;  5J29 A;  1KEJ A;  4NLN A;  9ICL A;  4WC7 A;  3JPR A;  4F5Q A;  5J2K A;  4AT9 B;  5J2I A;  2FMP A;  2O1P A;  1ZQD A;  9ICK A;  8ICB A;  1BPX A;  4KLT A;  8ICY A;  1PX5 A;  9ICV A;  1ZQA A;  5J0W A;  9ICG A;  4XQ8 A;  1OU5 A;  9ICF A;  1ZQG A;  4IQV A;  4X4O A;  7ICU A;  4EP7 A;  3ISC A;  4KLS A;  4PHD A;  3WFS C;  7ICH A;  4F5O A;  9ICU A;  1V4A A;  4WC1 A;  4RQ5 A; 
#chains in the Genus database with same CATH topology
 4UBC A;  4TUP A;  2GAF D;  4LEY A;  4YN4 A;  4UB4 A;  3LQC B;  7ICN A;  2M2V A;  3RJH A;  4UB3 A;  1ZQI A;  2GA9 D;  4MF2 A;  4FHV A;  8ICU A;  5J0X A;  4MF8 A;  7ICT A;  4UBB A;  5CHE A;  3WFP A;  4X4N A;  5J2E A;  4WC3 A;  2W9M A;  2BCR A;  3RJJ A;  4M9G A;  2IHO A;  4PH5 A;  3H37 A;  5HRD A;  4YD2 A;  3HW8 A;  1UET A;  1JN3 A;  4KLD A;  4K97 A;  1KNY A;  9ICJ A;  5CJ7 A;  4QZD A;  2ZHA A;  5J2F A;  2ZH1 A;  5D62 A;  4QZE A;  4PHP A;  5DB7 A;  3UXN A;  4KLG A;  8ICH A;  4IQU A;  4E8F A;  5IIJ A;  5DDM A;  4YMN A;  3UXO A;  4K4G A;  2B51 A;  3WFQ E;  9ICB A;  2PBE A;  4I2I A;  3RJK A;  5B3P A;  5J0Q A;  4XJE A;  7ICK A;  4WC4 A;  5IIO A;  4LZG A;  4X5V A;  3OVA A;  4IQT A;  2B4V A;  4MKP A;  4I2C A;  2HHP A;  5DKW A;  5J2D A;  4RT3 A;  7ICV A;  1JQR A;  5HC9 A;  4X4S A;  5D4B A;  4I0U A;  4N7R A;  2BCS A;  4EBJ A;  1TFW A;  4NXU A;  5DB9 A;  1KDH A;  2GWS A;  5CR0 A;  1R8B A;  4M04 A;  2DR9 A;  1HUZ A;  3RH6 A;  2DVI A;  4WBY A;  4PPX A;  1ZQE A;  1ZQH A;  2ISP A;  3JCF A;  1ZQT A;  4ATB B;  4JWN A;  3AQL A;  4I2B A;  4I2E A;  2BBJ A;  4AT7 A;  1MIV A;  1ZQV A;  5HRH A;  5IIN A;  4FHP A;  4NXX A;  4PHE A;  4UD4 A;  9ICS A;  8ICG A;  5III A;  3V7K A;  4UB1 A;  1ZQF A;  1WOT A;  3B0X A;  3JPP A;  1BPZ A;  3V7J A;  3MDA A;  4FH5 A;  2DRB A;  4YCX A;  5DB6 A;  1ZJM A;  3ISD A;  5B3Q A;  4NXV A;  3JPN A;  4XUS A;  4M2Y A;  2BBH A;  4DOA A;  4I29 A;  4YD1 A;  4M0A A;  4UB5 A;  2EWR A;  1TVA A;  4NXT A;  8ICK A;  4AT8 B;  5J2A A;  9ICM A;  3RH4 A;  5IIK A;  3OV7 A;  3JPS A;  5CB1 A;  4RQ8 A;  3PHZ A;  1ZQK A;  7ICG A;  4QZA A;  9ICN A;  1ZQM A;  3NVO A;  9ICO A;  2BPF A;  4QZ9 A;  4IG8 A;  3OVS A;  9ICE A;  4LT6 A;  8ICR A;  3UXP A;  4FH3 A;  4KLO A;  4PGX A;  4LZD A;  3OUY A;  5J2G A;  2ZH2 A;  4X4Q A;  1TFY A;  3GDX A;  4JWM A;  4FHY A;  2BCV A;  3RJE A;  4KLQ A;  4WC6 A;  1ZQB A;  4UAW A;  1ZQQ A;  4M9H A;  4M5D A;  3H39 A;  4KLF A;  1ZJN A;  5HHI A;  4TUS A;  4KM5 A;  4UD5 A;  5D46 A;  8ICS A;  2ZH6 A;  4K9B A;  4EEB A;  8ICO A;  1NO5 A;  7ICS A;  4WCW A;  4EV6 A;  4O69 A;  3MDC A;  4WQK A;  1XSN A;  2ZH5 A;  3JPT A;  4KLH A;  9ICX A;  4EED A;  4TUR A;  5DEC A;  2BPG A;  4FO1 A;  3PNC A;  4F5N A;  4RQ6 A;  8ICN A;  3CK6 A;  5D63 A;  3C2L A;  7ICP A;  4Z6E A;  3AU6 A;  1ZQO A;  5TZV A;  2B56 A;  2ZH7 A;  1ZQC A;  4IQW A;  2RFF A;  4GXJ A;  1NOM A;  3C18 A;  5J0T A;  1R89 A;  8ICF A;  9ICR A;  3NWI A;  3C5F A;  5CA7 A;  2ZHB A;  3PMN A;  4KLJ A;  3NKU A;  7ICM A;  8ICZ A;  4RT2 A;  2I9G A;  2DRA A;  5J2C A;  4F5R A;  4O9M A;  3JPQ A;  4LEZ A;  3OGU A;  1ZQR A;  4PGY A;  5BOL A;  1ZQL A;  4I2A A;  1R8C A;  4X4P A;  4RQ0 A;  3C5G A;  7ICJ A;  4GXI A;  5CFU A;  4AT9 A;  7ICQ A;  5CFS A;  5DDY A;  4O6A A;  4X4V A;  4QZH A;  4I28 A;  4O67 A;  5D49 A;  2BE3 A;  4MFA A;  4LEV A;  1MIW A;  2M2W A;  8ICM A;  2VAN A;  3AQN A;  5CWR A;  4I2F A;  7ICO A;  8ICA A;  4FHW A;  4KLL A;  4I2D A;  4M9J A;  2PFQ A;  3UPS A;  4I2J A;  5HRE A;  3TFS A;  4O68 A;  5IIM A;  4QZG A;  2BCU A;  2BPC A;  3AU2 A;  5BOM A;  5J0U A;  4UAY A;  4I2G A;  2DR8 A;  1ZQX A;  2HN1 A;  4WC0 A;  4K9A A;  2M2U A;  4M9L A;  1ZQN A;  3HJ1 A;  4K4I A;  5J0Y A;  4O5E A;  3HJ4 A;  4XA5 A;  8ICW A;  4RQ2 A;  7ICR A;  4KLU A;  4X0B A;  4QZF A;  1HUO A;  4R63 A;  4F5P A;  3TFR A;  4X0A A;  2PXI A;  4KLI A;  4RWP A;  1ZQW A;  4R66 A;  2FMS A;  4FO6 A;  8ICP A;  2PFN A;  1ZQY A;  4RQ4 A;  1JAJ A;  4QZ8 A;  5F2V O;  5CFT A;  5DB8 A;  5J0S A;  2IHM A;  8ICV A;  2IUB A;  1BPD A;  8ICL A;  9ICQ A;  3MGH A;  3HX0 A;  4K96 A;  3OVB A;  4RWO A;  3AQK A;  3V72 A;  2Q66 A;  4DOC A;  4NLK A;  4R65 A;  9ICW A;  1BPY A;  1ZQU A;  3ISB A;  5BPC A;  7ICF A;  1MQ3 A;  1JMS A;  4QZI A;  2P66 A;  4O5K A;  1F5A A;  8ICQ A;  4X4R A;  3ER8 C;  1FA0 A;  9ICC A;  3JYY A;  2DR7 A;  1ZQP A;  5HRF A;  4Z6D A;  8ICJ A;  3EF2 A;  1ZQJ A;  4FHX A;  4JLX A;  3UPQ A;  3AQM A;  5DBA A;  4OAH A;  9ICH A;  3C2K A;  4NM2 A;  5JTG A;  3UQ0 A;  4ATB A;  4K98 A;  4AT7 B;  4RQ1 A;  9ICI A;  3L9D A;  2ZH9 A;  1YLQ A;  9ICA A;  2BCQ A;  3K7D A;  4Z6F A;  4P4M A;  2DR5 A;  4K99 A;  4WBZ A;  1RPL A;  3AUO A;  1VJ7 A;  4XRH A;  8ICX A;  8ICC A;  3ERC C;  2PFP A;  4RWQ A;  4P2H A;  5J0P A;  4GXK A;  4RQ7 A;  1BPE A;  1Q79 A;  1TV9 A;  4UAZ A;  4WC2 A;  5HRK A;  1XSP A;  2ZH4 A;  5CHG A;  3JZ0 A;  3ER9 B;  3NYB A;  3OWG A;  9ICT A;  5DBC A;  4NLZ A;  3WFR E;  1VFG A;  2O5A A;  1R8A A;  5IIL A;  1MIY A;  9ICP A;  2ID1 A;  4OAI Z;  3HWT A;  4WOY A;  3H38 A;  4P4O A;  4EBK A;  4WQL A;  4I2H A;  4X4T A;  4RPZ A;  2FMQ A;  2M2T A;  4OAF A;  4TUQ A;  4WC5 A;  4PHA A;  4AT8 A;  4NKT A;  4I27 A;  5D61 A;  3HIY A;  3MBY A;  4XQ7 A;  3C66 A;  5DED A;  5HRL A;  1ZQZ A;  1UEV A;  4DOB A;  4NM1 A;  4EGW A;  4NKU A;  4KLM A;  4M47 A;  5HRB A;  4E7X A;  3OUY B;  4YMM A;  1RZT A;  3PML A;  4S3N A;  4WH5 A;  2HN2 A;  1MQ2 A;  4YMO A;  4QZC A;  4LVS A;  5DBB A;  4MFC A;  4RPX A;  3JPO A;  3UQ2 A;  2ISO A;  5EOZ A;  4E80 A;  4KB6 A;  1XSL A;  3C2M A;  8ICT A;  4Z6C A;  4RWN A;  3MGI A;  7ICE A;  5HR9 A;  4R64 A;  4NY8 A;  3RJG A;  1Q78 A;  3B0Y A;  3V7L A;  4O5C A;  1UEU A;  3RH5 A;  4MFF A;  4K8V A;  5HRG A;  5J2J A;  5CP2 A;  5J2H A;  4X4U A;  4DO9 A;  5HRI A;  3RJI A;  3RJF A;  5J0O A;  4HX0 A;  4RQ3 A;  4UB2 A;  2PFO A;  4NXZ A;  4QZB A;  4P4P A;  4K4H A;  5J2B A;  7ICL A;  4KLE A;  2ZH3 A;  5HHH A;  8ICE A;  3K75 D;  3H3A A;  7ICI A;  1ZQS A;  4PGQ A;  4M9N A;  3WFO A;  5J0R A;  1BPB A;  8ICI A;  2ZH8 A;  4RPY A;  1GPJ A;  2NRK A;  4NXW A;  3LK9 A;  5J29 A;  4LEW A;  1KEJ A;  4NLN A;  9ICL A;  4WC7 A;  3JPR A;  4F5Q A;  5J2K A;  4AT9 B;  5J2I A;  2FMP A;  2O1P A;  1ZQD A;  9ICK A;  8ICB A;  1BPX A;  3MCR A;  4KLT A;  8ICY A;  1PX5 A;  9ICV A;  1ZQA A;  5J0W A;  9ICG A;  4JLZ A;  4XQ8 A;  1OU5 A;  2FCL A;  9ICF A;  1ZQG A;  4IQV A;  4X4O A;  4OAG A;  7ICU A;  4EP7 A;  3ISC A;  4KLS A;  4PHD A;  3WFS C;  7ICH A;  4F5O A;  9ICU A;  1V4A A;  4WC1 A;  4RQ5 A; 
#chains in the Genus database with same CATH homology
 4UBC A;  4TUP A;  4LEY A;  4YN4 A;  4UB4 A;  3LQC B;  7ICN A;  2M2V A;  3RJH A;  4UB3 A;  1ZQI A;  4MF2 A;  4FHV A;  8ICU A;  5J0X A;  4MF8 A;  7ICT A;  4UBB A;  3WFP A;  4X4N A;  5J2E A;  4WC3 A;  2W9M A;  2BCR A;  3RJJ A;  4M9G A;  4PH5 A;  3H37 A;  5HRD A;  4YD2 A;  3HW8 A;  1UET A;  1JN3 A;  4KLD A;  4K97 A;  1KNY A;  9ICJ A;  5CJ7 A;  4QZD A;  2ZHA A;  5J2F A;  2ZH1 A;  4QZE A;  4PHP A;  5DB7 A;  3UXN A;  4KLG A;  8ICH A;  4IQU A;  4E8F A;  5IIJ A;  5DDM A;  4YMN A;  3UXO A;  4K4G A;  2B51 A;  3WFQ E;  9ICB A;  2PBE A;  4I2I A;  3RJK A;  5J0Q A;  7ICK A;  4WC4 A;  5IIO A;  4LZG A;  4X5V A;  3OVA A;  4IQT A;  2B4V A;  4MKP A;  4I2C A;  2HHP A;  5DKW A;  5J2D A;  4RT3 A;  7ICV A;  1JQR A;  5HC9 A;  4X4S A;  5D4B A;  2BCS A;  4EBJ A;  1TFW A;  4NXU A;  5DB9 A;  1KDH A;  2GWS A;  5CR0 A;  1R8B A;  4M04 A;  2DR9 A;  1HUZ A;  3RH6 A;  2DVI A;  4WBY A;  4PPX A;  1ZQE A;  1ZQH A;  2ISP A;  1ZQT A;  4ATB B;  4JWN A;  3AQL A;  4I2B A;  4I2E A;  4AT7 A;  1MIV A;  1ZQV A;  5HRH A;  5IIN A;  4FHP A;  4NXX A;  4PHE A;  4UD4 A;  9ICS A;  8ICG A;  5III A;  3V7K A;  4UB1 A;  1ZQF A;  1WOT A;  3B0X A;  3JPP A;  1BPZ A;  3V7J A;  3MDA A;  4FH5 A;  2DRB A;  4YCX A;  5DB6 A;  1ZJM A;  3ISD A;  4NXV A;  3JPN A;  4XUS A;  4M2Y A;  4DOA A;  4I29 A;  4YD1 A;  4M0A A;  4UB5 A;  1TVA A;  4NXT A;  8ICK A;  4AT8 B;  5J2A A;  9ICM A;  3RH4 A;  5IIK A;  3OV7 A;  3JPS A;  5CB1 A;  4RQ8 A;  1ZQK A;  7ICG A;  4QZA A;  9ICN A;  1ZQM A;  9ICO A;  2BPF A;  4QZ9 A;  4IG8 A;  3OVS A;  9ICE A;  4LT6 A;  8ICR A;  3UXP A;  4FH3 A;  4KLO A;  4PGX A;  4LZD A;  3OUY A;  5J2G A;  2ZH2 A;  4X4Q A;  1TFY A;  3GDX A;  4JWM A;  4FHY A;  2BCV A;  3RJE A;  4KLQ A;  4WC6 A;  1ZQB A;  4UAW A;  1ZQQ A;  4M9H A;  4M5D A;  3H39 A;  4KLF A;  1ZJN A;  5HHI A;  4TUS A;  4KM5 A;  4UD5 A;  5D46 A;  8ICS A;  2ZH6 A;  4K9B A;  8ICO A;  1NO5 A;  7ICS A;  4WCW A;  4O69 A;  3MDC A;  1XSN A;  2ZH5 A;  3JPT A;  4KLH A;  9ICX A;  4TUR A;  5DEC A;  2BPG A;  4F5N A;  3PNC A;  4RQ6 A;  8ICN A;  3C2L A;  7ICP A;  4Z6E A;  3AU6 A;  1ZQO A;  5TZV A;  2B56 A;  2ZH7 A;  1ZQC A;  4IQW A;  2RFF A;  4GXJ A;  1NOM A;  3C18 A;  5J0T A;  1R89 A;  8ICF A;  9ICR A;  3C5F A;  5CA7 A;  2ZHB A;  3PMN A;  4KLJ A;  7ICM A;  8ICZ A;  4RT2 A;  2I9G A;  2DRA A;  5J2C A;  4F5R A;  4O9M A;  3JPQ A;  4LEZ A;  3OGU A;  1ZQR A;  4PGY A;  5BOL A;  1ZQL A;  4I2A A;  1R8C A;  4X4P A;  4RQ0 A;  3C5G A;  7ICJ A;  4GXI A;  4AT9 A;  7ICQ A;  5DDY A;  4O6A A;  4X4V A;  4QZH A;  4I28 A;  4O67 A;  5D49 A;  2BE3 A;  4MFA A;  4LEV A;  1MIW A;  2M2W A;  8ICM A;  2VAN A;  3AQN A;  5CWR A;  4I2F A;  7ICO A;  8ICA A;  4FHW A;  4KLL A;  4I2D A;  4M9J A;  2PFQ A;  3UPS A;  4I2J A;  5HRE A;  3TFS A;  4O68 A;  5IIM A;  4QZG A;  2BCU A;  2BPC A;  3AU2 A;  5BOM A;  5J0U A;  4UAY A;  4I2G A;  2DR8 A;  1ZQX A;  4WC0 A;  4K9A A;  2M2U A;  4M9L A;  1ZQN A;  3HJ1 A;  4K4I A;  5J0Y A;  4O5E A;  3HJ4 A;  4XA5 A;  8ICW A;  4RQ2 A;  7ICR A;  4KLU A;  4X0B A;  4QZF A;  1HUO A;  4R63 A;  4F5P A;  3TFR A;  4X0A A;  2PXI A;  4KLI A;  1ZQW A;  4RWP A;  4R66 A;  2FMS A;  4FO6 A;  8ICP A;  2PFN A;  1ZQY A;  4RQ4 A;  1JAJ A;  4QZ8 A;  5F2V O;  5DB8 A;  5J0S A;  2IHM A;  8ICV A;  1BPD A;  8ICL A;  9ICQ A;  3MGH A;  3HX0 A;  4K96 A;  3OVB A;  3AQK A;  4RWO A;  3V72 A;  2Q66 A;  4DOC A;  4NLK A;  4R65 A;  9ICW A;  1BPY A;  1ZQU A;  3ISB A;  5BPC A;  7ICF A;  1MQ3 A;  1JMS A;  4QZI A;  2P66 A;  4O5K A;  1F5A A;  8ICQ A;  4X4R A;  1FA0 A;  9ICC A;  3JYY A;  2DR7 A;  1ZQP A;  5HRF A;  4Z6D A;  8ICJ A;  1ZQJ A;  4FHX A;  4JLX A;  3UPQ A;  3AQM A;  5DBA A;  4OAH A;  9ICH A;  3C2K A;  4NM2 A;  3UQ0 A;  4ATB A;  4K98 A;  4AT7 B;  4RQ1 A;  9ICI A;  3L9D A;  2ZH9 A;  1YLQ A;  9ICA A;  2BCQ A;  4Z6F A;  4P4M A;  2DR5 A;  4K99 A;  4WBZ A;  1RPL A;  3AUO A;  1VJ7 A;  4XRH A;  8ICX A;  8ICC A;  2PFP A;  4RWQ A;  4P2H A;  5J0P A;  4GXK A;  4RQ7 A;  1BPE A;  1Q79 A;  1TV9 A;  4UAZ A;  4WC2 A;  5HRK A;  1XSP A;  2ZH4 A;  5CHG A;  3JZ0 A;  3NYB A;  9ICT A;  5DBC A;  4NLZ A;  3WFR E;  1VFG A;  2O5A A;  1R8A A;  5IIL A;  1MIY A;  9ICP A;  2ID1 A;  4OAI Z;  3HWT A;  4WOY A;  3H38 A;  4P4O A;  4EBK A;  4I2H A;  4X4T A;  4RPZ A;  2FMQ A;  2M2T A;  4OAF A;  4TUQ A;  4WC5 A;  4PHA A;  4AT8 A;  4NKT A;  4I27 A;  3HIY A;  3MBY A;  4XQ7 A;  3C66 A;  5DED A;  5HRL A;  1ZQZ A;  1UEV A;  4DOB A;  4NM1 A;  4KLM A;  4NKU A;  4M47 A;  5HRB A;  4E7X A;  3OUY B;  4YMM A;  1RZT A;  3PML A;  4S3N A;  1MQ2 A;  4YMO A;  4QZC A;  4LVS A;  5DBB A;  4MFC A;  4RPX A;  3JPO A;  3UQ2 A;  2ISO A;  5EOZ A;  4E80 A;  4KB6 A;  1XSL A;  3C2M A;  8ICT A;  4Z6C A;  4RWN A;  3MGI A;  7ICE A;  5HR9 A;  4R64 A;  4NY8 A;  3RJG A;  1Q78 A;  3B0Y A;  3V7L A;  4O5C A;  1UEU A;  3RH5 A;  4MFF A;  4K8V A;  5HRG A;  5J2J A;  5CP2 A;  5J2H A;  4X4U A;  4DO9 A;  5HRI A;  3RJI A;  3RJF A;  5J0O A;  4RQ3 A;  4UB2 A;  2PFO A;  4NXZ A;  4QZB A;  4P4P A;  4K4H A;  5J2B A;  7ICL A;  4KLE A;  2ZH3 A;  5HHH A;  8ICE A;  3K75 D;  3H3A A;  7ICI A;  1ZQS A;  4PGQ A;  4M9N A;  3WFO A;  5J0R A;  1BPB A;  8ICI A;  2ZH8 A;  4RPY A;  2NRK A;  4NXW A;  3LK9 A;  5J29 A;  4LEW A;  1KEJ A;  4NLN A;  9ICL A;  4WC7 A;  3JPR A;  4F5Q A;  5J2K A;  4AT9 B;  5J2I A;  2FMP A;  2O1P A;  1ZQD A;  9ICK A;  8ICB A;  1BPX A;  4KLT A;  8ICY A;  1PX5 A;  9ICV A;  1ZQA A;  5J0W A;  9ICG A;  4JLZ A;  4XQ8 A;  1OU5 A;  9ICF A;  1ZQG A;  4IQV A;  4X4O A;  4OAG A;  7ICU A;  4EP7 A;  3ISC A;  4KLS A;  4PHD A;  3WFS C;  7ICH A;  4F5O A;  9ICU A;  1V4A A;  4WC1 A;  4RQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...