4NM2A

Structure of human dna polymerase beta complexed with a nicked dna containing a 8brg-g at n-1 position and g-c at n position
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
321
Chain Sequence
b'NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 103
structure length 321
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nm2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nm2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nm2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nm2A03
2BCUA 4EEYA 1RYRA 5KFUA 4F5QA 4KTQA 8ICSA 9ICQA 3GV7B 1ZYQA 3PY8A 4F4KA 4QZGA 4UD5A 5J2BA 3UQ0A 3PV8A 4IR1A 8ICPA 1MIWA 4EBCA 4KLDA 4PH5A 5J0PA 5F2VO 1UT8A 1R8AA 3H39A 5KT5A 4RQ3A 2FMSA 3OVSA 2VA2A 3OSNA 3SV3A 5J2HA 4I2GA 5HRHA 4I2AA 3MR6A 3PR4A 1ZQQA 4DFKA 3RAXA 2XCPA 1S0NA 2DPJA 2NRZA 1QSYA 4M2YA 1TK5A 4RWPA 5J0UA 4RT2A 1NO5A 2ZHBA 1A76A 3AU2A 4M9GA 4UB5A 2DRAA 8ICHA 5BPCA 3Q8MA 1KLNA 1L3SA 1ZQUA 4GXIA 8ICGA 3QEAZ 4DQPA 3RR7A 1SKSA 1KTQA 1TVAA 4KLLA 1S0VA 4AT7A 4M9JA 1V9PA 2FLLA 4RZRA 2KZ3A 1ZJMA 8ICQA 9ICRA 5EOZA 8ICIA 4E80A 2JZBB 2ASJA 3JZ0A 4YR3A 4F4YA 4DLEA 4IQWA 3RR8A 1JAJA 1KEJA 3ETLA 4ED8A 1ZQNA 2F1HA 1UETA 4RUCA 3C66A 4RWNA 1SL0A 5KT6A 4QWEA 1T3NA 1TK8A 4YQWA 2IHNA 2R8JA 2ZHAA 4X4UA 4F5PA 5BOMA 5L9XA 4KLTA 4PPXA 2HHQA 4PGXA 3C23A 4M9LA 2MUTA 4YFKA 4KN7A 2PFOA 4X4NA 4LT6A 4DS5A 3G6XA 1NK4A 9ICOA 1ZQXA 3C21A 3HPOA 9ICJA 4F50A 4DO9A 9ICNA 4Q8EA 3HIYA 2DR8A 3RRHA 5HR9A 4DF8A 1ZQLA 1IM4A 4BDPA 4J9SA 1CUKA 5KG7A 3OHBA 4B9MA 3UQ2A 4Z6FA 4PGYA 1BPYA 3HT3A 1AROP 3OHAA 3H4DA 5BOLA 4EBEA 4DS4A 2R8IA 4RUAA 5KFRA 3RJGA 4B9LA 4LZGA 4DSEA 3T5HA 5DG7A 3TARA 1S77D 5C5JA 4ELVA 1NK6A 4BXOA 1NK5A 3ZD9A 4J9KA 1S0OA 4I2EA 4M5DA 4UQGA 3H40A 2ISPA 4NLZA 4KITB 5KT3A 2W8LA 4DQRA 4K4HA 4RQ6A 1ZQDA 5DQGA 2HHUA 5F9NA 2PFPA 5F9LA 5DB6A 5KFPA 1OU5A 3L9DA 4WC3A 5J0OA 4FS2A 4DL5A 2XC9A 3OJSA 4ECUA 4PGQA 4C8OA 1DOQA 3EWAA 3M9MB 2KFNA 9ICHA 3V7LA 2ZH4A 3C1ZA 3EZ5A 4ECTA 9ICEA 3HJ4A 4WBZA 3UXOA 2ZUBA 1ZQGA 3H8WA 5KT7A 4UD4A 3UPSA 3OUYB 4ED0A 5HC9A 4IR9A 1XWLA 3ZDAA 3Q8SB 1XC9A 4Q8FA 3TAPA 2W9CB 1BNPA 4YR0A 8ICXA 4P4PA 5DBAA 1ZQKA 1DGSA 1EXNA 4TQRA 1HUOA 1NK7A 4DFMA 5JUMA 4X0AA 2V4QA 1ZQJA 1ZQTA 2AQ0A 3MR3A 4I27A 3H7IA 3V6JA 1SL1A 4HYKA 1SL2A 4DL6A 5TZVA 3PX6A 4KLIA 2R8KA 2FLPA 2AGOA 4KLUA 8ICCA 3JYYA 2NRKA 4ECZA 3TAQA 5CHGA 2V9WA 4WCWA 2HHSA 4ELUA 3PW5A 4O3SA 7ICEA 7ICHA 5HRBA 3QEBZ 5DBCA 3PX4A 1MSWD 4KLGA 4WC4A 1Z00B 5HNKA 1NZPA 5HRIA 2A1JA 4ELTA 4NM1A 2M2WA 2V4RA 4X4TA 9ICMA 4WC0A 4AT9B 4TURA 5HRGA 5DGBA 4F5OA 2BPFA 1VFGA 4I2IA 4UBBA 3RJFA 3JPPA 4RNOA 2JEJA 5KG2A 3MR2A 3KHHA 3LDAA 1QTMA 8ICJA 2ZUDA 4KLHA 5KFIA 3GV8B 3H8JA 3MFIA 2AGPA 1TV9A 3ISBA 2J6TA 1S97A 1Z3EB 3TANA 3WFQE 3ORYA 9ICWA 5IIOA 5KFTA 3PNCA 5J2FA 4J9OA 3PX0A 3ZDCA 3V72A 1H38A 3AQLA 7ICVA 3NGDA 3NYBA 5HREA 5J2CA 3IM1A 4KN4A 3AUOA 4J9QA 4I2FA 8ICTA 5KG0A 5IIIA 5HHIA 3OVBA 2HHPA 4R64A 5KFDA 4RU9A 3V6HA 1U48A 1T7PA 4EYIB 8ICKA 5HRFA 3LWLA 4NKTA 4RWOA 1U9LA 5J2DA 3UXPA 4DEZA 4O9MA 4DL3A 4F91B 5J0SA 4MEYA 4MFAA 2VA3A 4B9TA 1MIVA 2DR5A 4QWDA 2BHNA 4J9LA 9ICKA 7ICSA 3JPTA 3RJHA 4E0DA 4WC6A 2P6UA 3MGHA 4PHPA 3GIMA 5HMLA 4FO6A 2ASLA 4I28A 4JV1A 9ICBA 4YMOA 1N48A 2IA6A 5J0YA 4F5NA 2ZH1A 5KG5A 3SI8A 3JPQA 4JV2A 2RDJA 4JK1A 3B0XA 2Y1JA 4MF2A 4MFCA 3LQCB 3MDCA 1ZQEA 2PBEA 3AQNA 1S10A 3WFRE 5L1LA 2BCSA 1L3TA 4IQVA 4DSJA 9ICVA 2J6UA 4QZ8A 4MF8A 4XQ8A 4ECXA 3MFHA 2PFQA 1XS9D 4B9SA 3TQ1A 5L1JA 4AT7B 1NJXA 1N56A 4RQ8A 5KFGA 1ZETA 4F8RA 2M2VA 7ICNA 3RH4A 4Q44A 2BKEA 3ISDA 4RQ5A 1KFDA 5J0WA 2XCAA 2C2EA 2XGQA 7ICRA 4RQ0A 2M2TA 3HW8A 5KFSA 1XSPA 4EBJA 1WCLA 4X0BA 1TFYA 4X4VA 1DK2A 2BGWA 2O1PA 4UB3A 3PMNA 4J9PA 3EPGA 2ZTEA 5KTQA 4DSFA 4UB4A 2KN7A 4YR2A 2MUTB 4TUQA 4FHYA 5KFNA 3PMLA 1ZQPA 2NRXA 3M9OB 2ZH3A 3KHGA 2KZZA 4UAYA 4EBDA 4PHAA 4YN4A 8ICWA 1RXWA 4DSIA 4BWMA 4FHPA 3AQMA 1KFTA 3BJYA 5IIKA 5IILA 3AU6A 4X4OA 2BDPA 2ZTDA 4YD1A 2ZH6A 3UXNA 2C28A 2FMQA 2ASDA 4RPXA 1ZQAA 4J9MA 5D49A 9ICTA 3IHQB 2UVWA 2IHMA 1RXVA 9ICLA 4BXOB 3H37A 5KFLA 4C8NA 5KFVA 4M47A 1R8BA 3ISCA 4NKUA 5KT4A 2OWOA 2VANA 2ATLA 4X4RA 8ICNA 2ZH5A 2F1JA 4X5VA 3C2MA 5CJ7A 4XUSA 2KFZA 2JEIA 1HJPA 5KFBA 2BCQA 7ICFA 5HMMA 3FDSA 3NTUA 4MFFA 4DLGA 4NLKA 8ICOA 3RJEA 3MBYA 4XQ7A 2HHWA 4BGDA 1F5AA 2W9MA 4YVZA 3LWMA 4DL7A 4DL4A 2BE3A 3WFSC 4DL2A 3AQKA 4P2HA 1U45A 5KG3A 3MDAA 4EZ6A 4FH5A 4JV0A 1S0MA 1R8CA 2ZJ8A 3RH6A 3C5FA 1X9SA 3QZ8A 1XSLA 4DFPA 2ZH8A 2O5AA 4RNNA 5J2AA 3T5LA 4ZH4A 4KLEA 5KFHA 5DQHA 5HRKA 1UEVA 1NKCA 3RJKA 3QE9Y 5DG9A 2AQ4A 8ICRA 4EBKA 3G6YA 4RWQA 4FHWA 5KFAA 4WC7A 4FHXA 3K75D 5HRDA 4ED7A 4KLMA 4GXJA 1SZPA 4X4PA 1JQRA 4ECYA 1YLQA 2HHTA 5IINA 3SZ2A 1TK0A 3C18A 1U4BA 4RNMA 4FH3A 3SV4A 2A1JB 1BPZA 3Q8QB 5KFXA 4C8MA 5HRLA 3T5JA 5D4BA 5EWEA 3JPNA 3HJ1A 2GWSA 1XU4A 4QZ9A 1KRPA 5CWRA 1ZQBA 1C7YA 4WC2A 1K1SA 4UB2A 4F5RA 2UVRA 3Q8KA 1ZQRA 1D8YA 3HP6A 2JEFA 4UAZA 3RBDA 1ZQSA 3M8SA 4ATBA 5L1KA 9ICGA 4YCXA 5IIJA 3TI0A 4QZCA 4C8LA 1PZNA 3H38A 2F1IA 3LK9A 2BQ3A 3N97B 5EWGA 1IXRA 4QWCA 2NRVA 4YMNA 4O3OA 4QWAA 4UBCA 2C2RA 1BPDA 4F3OA 4KLFA 3RJJA 1JXEA 2KZMA 3MR5A 1NOMA 2PXIA 3TFRA 1T8EA 5J2JA 4I2BA 3THVA 7ICTA 5KT2A 4YG2A 5KFCA 4ECRA 4R65A 4DQQA 3Q8LA 5KFOA 1TAQA 1L3VA 1ZQYA 2RDIA 3ZDDA 4M04A 1HUZA 5KG1A 4R66A 4DOCA 4FBTA 2DRBA 4M6WA 1XSNA 2VA8A 3FYHA 2XY7A 2FPKA 4P4OA 4QW9A 8ICYA 4AT8A 1XO1A 4PHEA 3RJIA 4B9UA 1MQ3A 1RPLA 7ICIA 2DR9A 2I9GA 2ZJ5A 4XA5A 5HP4A 5J0QA 4KMUA 4QZEA 5DLGA 4QWBA 1QSLA 7ICPA 1BGXT 1JX4A 9ICSA 3HX0A 1QSSA 1QLNA 1ZQOA 7ICJA 4R8UB 4J9NA 4FS1A 2XY6A 7ICLA 1KNYA 5HHHA 3RB6A 5DQIA 5J2KA 4KLJA 4TQSA 4ED3A 2KP7A 2MAXA 4QZDA 1MIYA 4R8UA 4JWMA 3GIJA 8ICLA 5L1IA 3RB0A 4EZ9A 4F93B 4YP3A 4DOBA 4IRKA 2C22A 1R89A 4BWJA 4EYHB 4LZDA 2PFNA 2PI4A 1LV5A 5IIMA 4NM2A 3GFKB 4J9RA 1RZTA 4DWIA 5DECA 5D46A 4DQSA 4O3QA 5EWFA 5J0XA 1ZQWA 4DFJA 3PVXA 1KDHA 1ZQCA 4K4IA 3K4GA 3QZ7A 4GC6A 3RRGA 2HHXA 4RQ1A 2BCVA 4IRCA 2ZUCA 4QZBA 5DGAA 4ECSA 3T5KA 2XY5A 1SKRA 2P6RA 4JUZA 3C2LA 1T4GA 3V7KA 3PW0A 2BCRA 1TFWA 3H8SA 4FBUA 4QZFA 3G6VA 8ICZA 2DVIA 4R63A 5DLFA 4G3IA 5KFFA 5DB7A 4O3NA 4PHDA 4F4ZA 3ZDBA 7ICKA 4WC1A 5CA7A 2HVIA 4KLOA 7ICOA 5DB9A 1D9DA 1L3UA 4Q45A 1ZJNA 1NK8A 4JWNA 4TUSA 3RB3A 5DDMA 3BQTA 5DDYA 2ALZA 2NRWA 8ICBA 1LB2B 5J2IA 3RBEA 4Z6DA 2C2DA 9ICAA 5CP2A 7ICGA 2H5XA 1ZQFA 1CEZA 1L5UA 1K1QA 9ICUA 1Q78A 1B43A 3V6KA 5KFQA 1ZQHA 1KFSA 4E7XA 4IG8A 3GDXA 1X2IA 3GILA 3PO4A 5DG8A 1UA0A 4M9NA 4ECQA 4DSLA 8ICUA 4IQTA 2W8KA 1PX5A 3T3FA 3C1YA 1FA0A 3BDPA 1NJWA 3MGIA 2JZBA 3OSPA 4Z6CA 2BPCA 1NK0A 3PW4A 1BVSA 4IQUA 4I2CA 2R8HA 3V7JA 4KLQA 1NKBA 2RFFA 9ICFA 2BQRA 4YD2A 2DPIA 2UVVA 3PO5A 4O5KA 1MC8A 2DR7A 4I29A 1Y88A 4GLXA 2Q66A 1UT5A 1S76D 3MABA 4DOAA 2HHVA 3UPQA 4B9NA 3JPOA 3OGUA 1JMSA 5KG6A 5DBBA 1ZQVA 2BR0A 4C8KA 4KLSA 4YMMA 3RH5A 8ICAA 1TKDA 3RAQA 4M0AA 1NJZA 2FPMA 1BPEA 2P66A 4CCHA 4F2SA 2M2UA 5KFKA 1D8LA 4ED2A 4GC7A 4O5CA 1JN3A 4ED1A 2BQUA 3KHLA 2ISOA 2ZTCA 1COOA 4RT3A 3Q8PB 1NK9A 4QW8A 3H4BA 4NXZA 3RTVA 7ICMA 4X4QA 2Q0ZX 4I2DA 3OJUA 3PR5B 2WTFA 3C5GA 4UB1A 3PW2A 4RQ4A 5J2GA 3Q8RB 2XO7A 1WCNA 3GIKA 3BQ0A 2UVUA 4RPYA 1BPXA 1KSPA 4M9HA 2HVHA 1UA1A 1Q79A 4DQIA 4Q43A 1ZQMA 2FPLA 4QZHA 4O3RA 2IMWP 1NKEA 2AJQA 1U47A 4RPZA 1ZQIA 4FHVA 4ECWA 4IRDA 4ATBB 7ICUA 5KFJA 1TFRA 3M8RA 3PW7A 3ZDEA 4YXJA 4NY8A 4O3PA 5CB1A 5J0TA 3RB4A 9ICPA 2IBKA 5DEDA 1WOTA 2DFLA 2AGQA 8ICVA 3OUYA 2W9AA 3ZD8A 4UAWA 3HWTA 3B0YA 4TUPA 2NRTA 4ED6A 2R8GA 2W9CA 3OVAA 4EP7A 3JPSA 1MQ2A 4I2HA 4DSKA 3BQ1A 9ICIA 3WFOA 1TAUA 3SYZA 1DK3A 3H3AA 2J6SA 1BNOA 5J0RA 5KFEA 4F4XA 1U49A 4ECVA 1VJ7A 4X4SA 1X9MA 2FMPA 4LVSA 4QZAA 4YXMA 8ICEA 1JXLA 1NJYA 2I1QA 4M6WB 2XGPA 4DF4A 3C2KA 2M9NA 4S3NA 5CR0A 4AT8B 3OV7A 3EYZA 4MEXA 4K4GA 5KFYA 3N4MB 5DKWA 1X9WA 3M9NB 3KHRA 1B22A 1Z00A 3KTQA 4RQ2A 5J29A 4I2JA 4NLGA 4WBYA 3E2EA 3TFSA 1SKWA 2ID1A 4F2RA 5KG4A 5KFWA 2AU0A 3GIIA 4AT9A 2ZH9A 4O5EA 3WFPA 1BPBA 1A77A 2ZH7A 2LYHA 4GXKA 3BQ2A 8ICMA 5J2EA 2W9BB 3GQCA 4F4WA 2KTQA 2ZJAA 7ICQA 1V4AA 4WC5A 8ICFA 2ZH2A 2HW3A 5KFZA 4QZIA 4XRHA 5DB8A 2PI5A 3EW9A 1UEUA 4E8FA 2JEGA 2B21A 1JIHA 1ZQZA 4O0IA 4RQ7A 3JPRA 4F92B 2W9BA 3EPIA 2BPGA 4B9VA 4Z6EA 3GV5B 2FLNA 2Y1IA 9ICCA 1RYSA 9ICXA 4P4MA 1S9FA 4NLNA 5KFMA 1D9FA
chains in the Genus database with same CATH superfamily
1KL9A 5KFUA 3GV7B 5ALUA 4UD5A 5J2BA 4EBCA 4KLDA 5KT5A 1LVHA 3OSNA 5ALXA 3MR6A 3PR4A 1ZQQA 2XCPA 4OJLA 4Y2YA 4RWPA 1NO5A 5JTIA 3ONNA 4MHVA 1OW5A 1ZQUA 3K7DA 1T94A 4OJPA 4KLLA 1S0VA 1ZJMA 9ICRA 2FCLA 1WWVA 1X6IA 4DLEA 5AIAA 3ETLA 4ED8A 5KT6A 1TE2A 1Z4OA 1T3NA 5J8YA 1TK8A 1DRGA 3D2NA 5BOMA 4PPXA 4PGXA 4X4NA 5EE9A 4DS5A 1NK4A 9ICOA 1ZQXA 4F50A 9ICNA 3HIYA 3I76A 4AP9A 5HR9A 1ZQLA 4J9SA 4B9MA 3OHBA 1V97A 4UD4A 2KJ8A 3OHAA 3H4DA 4DS4A 5KFRA 2KMDA 3T5HA 2CPRA 5DG7A 5C0YA 1NK5A 4J9KA 4LEZA 4I2EA 4M5DA 2ISPA 3H40A 4KITB 2W8LA 4K4HA 2HHUA 1ZQDA 5DQGA 4PZOA 3I1YA 4WC3A 4F72A 4ECUA 3EWAA 2KFNA 3M9MB 3V7LA 1IIPA 5ALFA 2ZUBA 5KT7A 3OUYB 2GO7A 4IR9A 3ZDAA 1BNPA 2O6KA 2FE9A 4WQKA 1HUOA 3UMGA 5JUMA 4X0AA 1ZQJA 3MR3A 3V6JA 4KLIA 4KLUA 4ECZA 3TAQA 3KKAC 4O3SA 3QEBZ 5DBCA 1PK1A 4KLGA 1DGJA 1NZPA 2V4RA 2FJ6A 4US9A 4WC0A 5DGBA 2BPFA 4I2IA 3RJFA 4UAVA 4RNOA 2JEJA 2ZUDA 4KLHA 1Z4NA 1TV9A 3TANA 5KFTA 3PNCA 2OXOA 2P35A 4QJFB 3V72A 2NO4A 5HREA 1NZBA 5ALLA 4O69A 2OCEA 4I2FA 8ICTA 5KG0A 2DQNB 3OVBA 4RWOA 4DL3A 5J0SA 4MEYA 4QWDA 9ICKA 4E0DA 3RJHA 3MGHA 2ASLA 4PHPA 4O6AA 4K98A 4YMOA 5J0YA 1Z19A 1RQNA 2RQ5A 4MF2A 3LQCB 2PBEA 4EENA 4HAIA 5D63A 1CI4A 2LM4A 1GPJA 9ICVA 2J6UA 4ECXA 3MFHA 4B9SA 5AM5A 4F8RA 3RH4A 1YZ7A 2C2EA 3LVVA 4EBJA 2H3ZA 4X0BA 1TFYA 1WCLA 5ALZA 4CE6A 4J9PA 4Y2PA 1N5WA 4UB4A 2MUTB 3RF9A 4TUQA 4FHYA 3PMLA 1ZQPA 3M9OB 3IN5A 2F3NA 2KZZA 4PHAA 4YN4A 1RXWA 4QIWC 1Q3VA 4FHPA 1KFTA 5IILA 2BDPA 2ZTDA 2ZH6A 1Q3UA 5ALDA 3LVWA 2ASDA 4RPXA 2FMQA 5D49A 4Y2TA 1RXVA 5KFVA 4M47A 1R8BA 4NKUA 5KT4A 2ATLA 8ICNA 3C2MA 5CJ7A 3TADC 5KFBA 2HOQA 7ICFA 4MFFA 3FDSA 3NTUA 3WK9A 2VJ5A 2JRZA 2HHWA 1F5AA 4DL7A 4DL4A 4IL6U 3AM9A 2ZIUB 4JV0A 2W04A 4USAA 3QZ8A 4RNNA 5J2AA 4CDGA 5DQHA 1UEVA 3ALRA 3RJKA 3K1RB 2KV2A 4X4PA 5IINA 3SZ2A 4FH3A 5AKEA 1BPZA 3F5EA 3Q8QB 4P0PA 2QARA 2EWRA 2GWSA 1XU4A 2KD1A 4QZ9A 1KRPA 1ZQBA 4WC2A 4F5RA 4UB2A 1D8YA 1O03A 1RM6C 3M8SA 3RBDA 2VJ4A 3R9KA 1ZQSA 3N28A 4C8LA 2F1IA 3WU2U 2BQ3A 1LKYB 1KW4A 5EWGA 4QWCA 3BS7A 4O3OA 2B0CA 2KOBA 2KZMA 2HBJA 3TFRA 3QU4A 5T14A 7ICTA 5CEHA 5KFCA 2HCFA 3C29A 5KFOA 1TAQA 3PZPA 2YB1A 5ALWA 1OUQA 4M6WA 1XSNA 2VA8A 2IOHA 2EZXA 4QW9A 4NXUA 3RJIA 2I9GA 2ZJ5A 2D8CA 2KKPA 4KB6A 4KMUA 1QSLA 1CRXA 3BZKA 1QSSA 3B9JA 1ZQOA 4R8UB 7ICJA 4KX5A 1N60A 4TQSA 8ICLA 3RB0A 4YP3A 2ODGA 2PFNA 2PI4A 5IIMA 4NM2A 3GFKB 3D6JA 5D46A 5KAFU 4NJ8A 5EWFA 1ZQWA 5ALYA 2PKEA 3PVXA 3SAHA 2WAQC 2BBJA 2KHQA 2HHXA 4IRCA 2P6RA 2XY5A 4UB6U 4JUZA 2OYYA 5B3QA 8ICZA 2DVIA 5KFFA 4O3NA 4P0QB 4WC1A 1RDFA 5DB9A 1L3UA 2DWQA 4KX3A 3NVWA 2LBOA 3RB3A 2ALZA 5DDYA 3RBEA 2DF4B 2A19A 1L5UA 9ICUA 1B43A 5KFQA 4E7XA 2G06A 1X42A 4M9NA 8ICUA 2ZXHA 2F8KA 5AM2A 4Z6CA 3PW4A 1BVSA 4I2CA 4K9AA 3V7JA 9ICFA 4WQLA 2RHFA 4DOAA 2KICA 4O67A 2KG5A 3F5AA 1L7NA 1JMSA 1SB3C 2BR0A 1JI7A 3F53A 1NJZA 2ZH3A 3KZIU 5KFKA 4EEBA 2BQUA 3KHLA 1Z1VA 5AK5A 1S0MA 2E3TA 3C5GA 4UB1A 2MRLA 5ALGA 3PW2A 4Y2UA 1MIWA 4RPYA 2FPLA 4O3RA 2W7OA 4RPZA 1ZQIA 2HDOA 1TFRA 3PW7A 1WWUA 3H8MA 4O3PA 5DEDA 2JR5A 2AGQA 8ICVA 2W9AA 3ZD8A 3AMZA 4ED6A 2NRTA 2BZFA 1TAMA 4ECVA 1VJ7A 1X9MA 4YXMA 2I1QA 5CR0A 3EYZA 3N4MB 3KTQA 4FZLA 2NV3A 3H0LB 2ZH9A 1BPBA 1A77A 2ZH7A 5AM1A 2DKZA 3BQ2A 4F4WA 2KTQA 2D6FC 1V4AA 7ICQA 3QUBA 5TISU 5DB8A 5ALNA 1UEUA 2JEGA 2B21A 3JPRA 3EPIA 4RQ7A 4B9VA 2FLNA 3SMVA 2F8LA 4P4MA 4NLNA 1L7OA 5KFMA 5B5EU 5B3PA 2BCUA 4EEYA 8ICSA 4F5QA 9ICQA 2G5HB 2AHOB 8ICPA 2YMPA 3H39A 3OVSA 2VA2A 1K5OA 1GO3F 4I2GA 1Z1BA 5AICA 3RAXA 1UHUA 1J2NA 1S0NA 5J0UA 1F44A 4UB5A 1L3SA 4GXIA 8ICGA 4K97A 1KTQA 1TVAA 4AT7A 4M9JA 1V9PA 2FLLA 8ICQA 2JH1A 5EOZA 4E80A 1ZOLA 5KAIU 4YR3A 4F4YA 3RR8A 3IG8A 1WG8A 4RWNA 2RRDA 4QWEA 2R8JA 5AI9A 2HHQA 4OJOA 4KN7A 2PFOA 4LT6A 3CNHA 3C21A 4Q8EA 2RLTA 2E8NA 4DF8A 1CUKA 3UQ2A 4PGYA 1AROP 2NYVA 4B9LA 4RUAA 3TARA 5C5JA 4ELVA 1Q8KA 2Y0SF 3AN1A 2KSOB 5ALQA 3ZD9A 3PSTA 4UQGA 3N7RC 5KT3A 4DQRA 4NLCA 4C80A 4RQ6A 2CRXA 5ALEA 2HI0A 2H3QA 1OU5A 5AI6A 4FS2A 4DL5A 2XC9A 9ICHA 3WK8A 4ECTA 4WBZA 4LEWA 3H8WA 3UPSA 4EV6A 3Q8SB 2B4VA 1XC9A 2W9CB 2IOFA 1ZQKA 4TQRA 1EXNA 1XO0A 5JTGA 1PUZA 4DFMA 4I27A 3H7IA 4BJQA 2EAMA 5TZVA 1KBUA 8ICCA 3JYYA 2AGOA 2NRKA 5CHGA 2V9WA 3E0FA 2HHSA 4ELUA 4CGZA 3PX4A 1MSWD 4WC4A 3QU7A 2HN2A 2A1JA 5ALRA 4NM1A 3EF2A 2E1FA 4F5OA 3ETRA 2LKYA 3KHHA 2Y9TA 1HIWA 2LMRA 3GV8B 3ISBA 1S97A 5IIOA 4J9OA 3ZDCA 2OM6A 5GTHU 5ALHA 2H3IA 2HBMA 4Y2RA 7ICVA 3AUOA 4R64A 3V6HA 8ICKA 1U48A 4NKTA 1A0PA 1ECWA 1ZD3A 4O9MA 5J2DA 4F91B 4MFAA 4J03A 4J9LA 3D2QA 4JV1A 4I28A 2EANA 5HR6A 3DV9A 5KG5A 3SI8A 2B56A 3NKUA 1S10A 3WFRE 3NRZA 5L1LA 1F0MA 2BCSA 1L3TA 2IUBA 4MF8A 3TQ1A 5EE1A 1NJXA 1N56A 1QQ5A 4RQ8A 4Q44A 3ISDA 4RQ5A 1KFDA 5J0WA 1L6NA 3HW8A 1XSPA 2AH5A 3VC8A 3CW2C 4UB3A 2Y0SC 2ZTEA 4EX6A 2NRXA 2AXTU 2OHFA 4UAYA 4EBDA 4DSIA 4YD1A 4UARA 3UXNA 9ICTA 4A8EA 3NVYA 2K60A 4BXOB 1M6YA 2HMXA 4C8NA 1SWWA 1MA7A 2OWOA 2VANA 4X5VA 4OJ5A 4XUSA 2JEIA 4BGDA 2BE3A 4QIWF 1U45A 3RFAA 2EH9A 2ZJ8A 3RH6A 1XSLA 3BS5A 4EEDA 4NL9C 4CRXA 5DG9A 3G6YA 4RWQA 4FHWA 5KFAA 3H0RB 3QUCA 4FHXA 5K4LA 3WKCA 5HRDA 1ZD2P 4P0PB 1JQRA 1YZ6A 5AI8A 4ECYA 3C18A 3AEVA 3SV4A 4OO1J 5KFXA 3J81j 3HJ1A 1C7YA 4XJEA 1JALA 5IIJA 3TI0A 4QZCA 3LK9A 1IXRA 4UBCA 1BPDA 2HOIA 3RJJA 3MR5A 2PXIA 1NOMA 2GOLA 3THVA 1J2MA 3JCFA 2ZXIA 3MGVA 4ECRA 1J97A 4R65A 1ZQYA 3ZDDA 1A6SA 1DXSA 4FBTA 3FAHA 3FM9A 4B9UA 2DR9A 1MQ3A 1RPLA 3KD3A 5HP4A 9ICSA 7ICPA 1BGXT 2OH2A 7ICLA 2KJ9A 1ZD4A 2EAOA 3RB6A 2KP7A 1MIYA 4QZDA 4OD0A 4C4TA 5L1IA 2C22A 1R89A 4LZDA 2W3RA 1LV5A 4J9RA 3NVVA 5J0XA 1ZQCA 3QZ7A 2NO5A 5AK4A 2BCVA 2BDUA 3T5KA 1SKRA 4NXTA 3DDHA 3V7KA 2W3SA 2BCRA 1TFWA 4R63A 2WF8A 4G3IA 4OCZA 4PHDA 3ZDBA 2HVIA 4BX9C 3OWGA 4TUSA 3BQTA 4JB3A 2H5XA 3SAGA 1K1QA 1SV0A 1Q78A 1KFSA 4IG8A 1VJ5A 2WAQF 2K4IA 2G0AA 1UA0A 4DSLA 2W8KA 3C1YA 3MGIA 3OSPA 2BPCA 4EELA 5AKKA 2VIXA 4IQUA 2R8HA 1NKBA 3QXGA 5AK6A 4YD2A 1MC8A 1B0XA 2Q4TA 1Y88A 4GLXA 2YX8A 2HHVA 4B9NA 3QUTA 5AKXA 3OGUA 2ZIWB 4OAFA 4CNQA 4C8KA 3L4PA 3RH5A 8ICAA 3RAQA 4M0AA 1D8LA 4Y2SA 2ZTCA 4RT3A 1NK9A 1UCVA 4QW8A 4NXZA 3H4BA 2Q0ZX 3OJUA 3PR5B 2DPJA 3KOOA 1V38A 5J2GA 1WCNA 3GIKA 4WOYA 2CN1A 1BPXA 1L7MA 4M9HA 3FC4A 3CP8A 1UA1A 1ZQMA 1NKEA 2YMQA 4FHVA 4IRDA 4ATBB 5KFJA 3M8RA 4NWIA 1WOTA 5D62A 2EDUA 2DFLA 3PHZA 3OUYA 3OVAA 4EP7A 4I2HA 3BQ1A 9ICIA 1TAUA 3ZI4A 3E58A 2FMPA 1QCKA 4LVSA 4N7RA 8ICEA 1JXLA 1V85A 3C2KA 4AT8B 5KFYA 2G08A 4I2JA 3TFSA 4DFDA 5KG4A 2AU0A 4O5EA 3D2SA 2I5HA 2LYHA 8ICMA 2H3FA 2QLTA 2ZJAA 2MU2A 2ZH2A 3WK6A 4CF4A 4QZIA 2PI5A 1ZD5A 1PVQA 4O0IA 5JU5A 4UAUA 2KHVA 1RYRA 1IG6A 5ALMA 3PSPA 4OAIZ 1ZYQA 3PY8A 4F4KA 4IR1A 5J8YC 1UT8A 4RQMA 4RQ3A 2ZIXA 1S8OA 3SV3A 5HRHA 4I2AA 3H0MB 1P7DA 1QSYA 1F5SA 4RT2A 2E5SA 2ZHBA 1VLBA 2ZIVB 4M9GA 2LYAA 2DRAA 8ICHA 5BPCA 1SKSA 5FP0A 2F77X 3A0BU 2KZ3A 3AL0B 4UW9A 2JZBB 1B4FA 1ZQ1C 2F1HA 1SL0A 4QNLA 2IHNA 2ZHAA 4F5PA 3F2CA 5L9XA 4KLTA 3C23A 3ER8C 2MUTA 4NV0A 2F44A 5AI4A 3G6XA 3HPOA 3RRHA 1IM4A 4BDPA 5KG7A 2XVTA 5AKZA 1BPYA 3IP4B 4DSEA 1ZRMA 1NK6A 4K96A 1S0OA 5D61A 4NLZA 2XICA 1SWVA 2WF9A 5DB6A 3EZ5A 9ICEA 1RYUA 2WF6A 2ZIUA 2R18A 1XWLA 4Q8FA 1L7PA 4P4PA 5DBAA 1DGSA 2V4QA 2AQ0A 1SL1A 4FZMA 1SL2A 4DL6A 3PX6A 1WUDA 2A3VA 4WCWA 4C0ZA 2QB0B 3PW5A 1XNSA 1Z00B 4ELTA 2M2WA 4X4TA 3SD7A 4AT9B 4EGWA 1VDVA 3ED5A 4UBBA 3TACB 3JPPA 2HN1A 1OXJA 5KG2A 1QTMA 3LDAA 3WFQE 1Z3EB 2KVSA 5J2FA 1LKYA 5G5HA 4I0UA 1H38A 1ZRNA 3AQLA 1RG6A 5J2CA 3IM1A 4KMOB 4KN4A 2ES6A 3DEEA 4J9QA 3M6ZA 5IIIA 2HHPA 4RU9A 1T7PA 4EYIB 5CFSA 1L8OA 1U9LA 1AQ6A 3KKAA 1MIVA 2VA3A 2DR5A 4WC6A 1SXDA 1NI3A 2KIWA 2P6UA 5HMLA 9ICBA 1N48A 2K4PA 4F5NA 3JPQA 2RDJA 2Y1JA 3B0XA 3AQNA 1X6JA 2VKQA 4IQVA 5KL1B 3L3FX 4QZ8A 4B6JA 2PFQA 4IS7A 5ALKA 4EX7A 1ZETA 2B51A 7ICNA 1C20A 4U7CA 4EEKA 3K1ZA 4RQ0A 2M2TA 4O3MA 3PMNA 5KTQA 2KN7A 2IHOA 3BQ7A 4P0QA 8ICWA 1FFVA 2G07A 4LJXA 4BWMA 3WKEA 1N2XA 3IV6A 4X4OA 1X40A 2K8CB 4J9MA 1N63A 3H37A 2IHMA 9ICLA 1JRPA 3ISCA 2F1JA 4BUGA 4NLKA 4DLGA 8ICOA 1PK3A 4XQ7A 2YY6A 2W9MA 4YVZA 4K9BA 1L8LA 3BS5B 5KG3A 4EZ6A 2F76X 4FH5A 3BZCA 1R8CA 1X9SA 2ZH8A 4DFPA 2O5AA 3GZFA 4KLEA 5KFHA 3QX7A 5AI5A 1NKCA 1HEKA 3QE9Y 4EBKA 8ICRA 3HILA 4JMUA 4ED7A 1ED1A 2XIDA 5AK3A 2HHTA 2GA9D 1PK1B 1U4BA 5ALJA 1SV4A 4C8MA 2DGZA 4C4SA 3TADA 3T5JA 5D4BA 2B6GA 2FI1A 3Q8KA 2JEFA 3AQEA 4YCXA 2JV3A 2MA1A 1PZNA 4F71A 2NRVA 4QWAA 2C2RA 4OAGA 1UPHA 1JXEA 2KJ5A 5J2JA 1KN5A 5EE0A 2LPEA 5KT2A 4YG2A 3Q8LA 4DQQA 2RDIA 3WK5A 3SEIA 3CYMA 2BBHA 2DRBA 3FYHA 2W03A 2FPKA 5AM4A 4P4OA 5CRXA 3M1YA 1XO1A 4PHEA 7ICIA 4UATA 2E8OA 4QWBA 1QLNA 2XY6A 4J9NA 4FS1A 1FEZA 1SXEA 4KLJA 5DQIA 3F2BA 2IOFK 4FO1A 4JLZA 2WF5A 4F93B 5L1MA 1QQ6A 1X9XA 4BWJA 1RZTA 4DWIA 5DECA 1YT3A 4O3QA 4DFJA 3AQFA 3K4GA 3OTQA 3ER9B 1KKXA 4GC6A 3U26A 3RRGA 2ZUCA 4QZBA 5DGAA 4X4QA 1VFGA 2OEHA 2KKVA 1T4GA 3PW0A 4QZFA 3G6VA 5DLFA 7ICKA 5ALIA 1MN8A 7ICOA 3M7DA 1ZJNA 3NASA 8ICBA 1LB2B 5J2IA 2K89A 5AKYA 5CP2A 2JH7A 3HJEA 1ZQHA 3GDXA 5DG8A 4ECQA 4IQTA 2EZYA 1PX5A 1FA0A 5AKHA 3S6JA 2E8MA 4I29A 2Q66A 5AKJA 1UT5A 5AM3A 1S76D 4C7YA 3JPOA 3UMBA 3N7PD 4GFJA 4YMMA 1TKDA 4JLXA 4F2SA 2FPMA 1BPEA 2P66A 4CCHA 4GC7A 1JN3A 4ED1A 3RTVA 2WTFA 4RQ4A 3Q8RB 2UVUA 3BQ0A 2KSOA 3LYSA 2LM1A 1N61A 5H2FU 2QARB 1Q79A 3ERCC 2EZZA 4Q43A 2IMWP 2AJQA 1U47A 2WHEA 3ZDEA 2DL0A 4YXJA 3L5KA 3RB4A 2IBKA 2L5YA 2YMMA 2UVWA 3B0YA 2R8GA 2W9CA 2KVCA 4DSKA 5CHEA 3SYZA 1DK3A 1BNOA 5GTIU 5KFEA 4LEVA 1U49A 4X4SA 3NVZA 5AM0A 3MCRA 1NJYA 4M6WB 4DF4A 4OJ6A 4C4RA 2M9NA 4K4GA 5DKWA 3KHRA 4OAHA 5J29A 4NLGA 1SKWA 2G5IB 4PL1A 3WFPA 4NLBA 1WYGA 4GXKA 1T3QA 3GQCA 4WC5A 2WB1F 2HW3A 1QQ7A 4XRHA 4Y2VA 3QU2A 1D8BA 3EW9A 2W9BA 4PZNA 4Z6EA 3N7SC 2Y1IA 9ICCA 4CF5A 1RYSA 9ICXA 1S9FA 2HSZA 3WKAA 4KTQA 1PVPA 3QU5A 2ZIXB 4QZGA 1FIQA 3UQ0A 3PV8A 4PH5A 5J0PA 2DKXA 1R8AA 2FMSA 3HRDD 5J2HA 1KQQA 3PSFA 4DFKA 4M2YA 2NRZA 1TK5A 1FO4A 2K8AA 4GIBA 1A76A 3AU2A 3Q8MA 1KLNA 1N5XA 2GAFD 3QEAZ 3HKZF 3RR7A 4DQPA 2QB1A 3C28A 2XI9A 4Y2XA 4RZRA 1URJA 3NRWA 8ICIA 2ASJA 3JZ0A 4IQWA 1JAJA 1KEJA 1ZQNA 1UETA 3C66A 4RUCA 4NXXA 4DCCA 3CRXA 4YQWA 2H3VA 4X4UA 2JHDA 5ALSA 1Q46A 5AI0A 4M9LA 4YFKA 5KNIA 2A1AA 9ICJA 4DO9A 4MKPA 2DR8A 3ICXA 5CFUA 4NXVA 3OPXA 4Z6FA 2FDRA 3HT3A 4EBEA 3QNMA 5BOLA 2R8IA 4LZGA 3RJGA 5ALVA 2HBKA 2RP5A 4BXOA 2W7PA 3F2DA 3CK6A 2KE7A 2DBYA 5F9NA 2PFPA 5F9LA 5KFPA 3L9DA 5J0OA 1UQVA 4C8OA 3OJSA 4PGQA 1DOQA 2ZH4A 3C1ZA 3HJ4A 5ALOA 3UXOA 1ZQGA 2G09A 5HC9A 4ED0A 4AYBF 5B66U 3TAPA 4YR0A 8ICXA 1NK7A 1ZQTA 2WB1C 4HYKA 2R8KA 2FLPA 1JUDA 7ICEA 7ICHA 5HRBA 2E1EA 4K99A 2ESEA 5HNKA 5HRIA 9ICMA 4TURA 5HRGA 3WK7A 3MR2A 8ICJA 5KFIA 3H8JA 3MFIA 2AGPA 2J6TA 3ORYA 1O08A 9ICWA 3PX0A 3EUB2 4FZNA 3NGDA 3NYBA 2KIVA 3M6KA 5HHIA 2HOFA 5KFDA 5HRFA 3LWLA 3UXPA 3HKZC 4DEZA 5AKGA 4B9TA 2YQEA 2MSNA 1RQLA 5AKIA 7ICSA 2BHNA 3JPTA 3SAFA 3GIMA 3VCBA 4FO6A 2KNJA 2IA6A 5E79U 2ZH1A 4JV2A 4JK1A 4MFCA 3MDCA 1ZQEA 5JRTA 1N62A 2I6XA 4DSJA 2JGAA 4XQ8A 3QYPA 1XS9D 5L1JA 4AT7B 5G5GA 5KFGA 2M2VA 1SZHA 2BKEA 2XCAA 7ICRA 2XGQA 2EQYA 4Y2JA 5KFSA 1PVRA 4X4VA 1DK2A 2BGWA 2O1PA 4PJ0U 3EPGA 4DSFA 3KZXA 3SQIA 4YR2A 2N1RA 5KFNA 3KHGA 5AHXA 3AQMA 3BJYA 5IIKA 3AU6A 2GLEA 4WH5A 2C28A 1ZQAA 3IHQB 4AYBC 5KFLA 4FFDA 2PMZF 4X4RA 1SGGA 2ZH5A 2KFZA 3MC1A 1HJPA 4RQNA 2BCQA 5HMMA 3RJEA 3MBYA 3LWMA 3WFSC 4DL2A 3AQKA 4P2HA 2WF7A 5AIBA 3NVOA 3MDAA 3WK4A 3C5FA 1X66A 1QH9A 3T5LA 4ZH4A 5HRKA 2ZIWA 3SR6A 2AQ4A 4WC7A 2YN4A 4LEYA 3K75D 5AKLA 4KLMA 4GXJA 1SZPA 3NS1A 1YLQA 1TK0A 4RNMA 3IRUA 2LHTA 2A1JB 4WJ3B 5HRLA 3WKDA 5CFTA 5EWEA 3JPNA 5CWRA 4KM5A 1K1SA 2UVRA 1ZQRA 3HP6A 2YMLA 4UAZA 4ATBA 5L1KA 9ICGA 5EE3A 3IG5A 3H38A 2WFAA 3N97B 4F3OA 4YMNA 4KLFA 4K8VA 4U6PA 1T8EA 2F2AB 5HR7A 4NL9A 4IC9A 4I2BA 4ZOHC 4CF3A 1L3VA 2M0NA 4M04A 1HUZA 5KG1A 4R66A 4DOCA 2W54A 2K4EA 2W55A 2XY7A 8ICYA 4AT8A 3KFUF 2Y9UA 4XA5A 5J0QA 4QZEA 5DLGA 4UB8U 1JX4A 3HX0A 1KNYA 5HHHA 5J2KA 4ED3A 4O68A 2MAXA 3TKAA 4US8A 4R8UA 2YB4A 3GIJA 4JWMA 2KEYA 4UASA 4EZ9A 4DOBA 1SV0C 4IRKA 4EYHB 3A0HU 4DQSA 3UM9A 2LYBA 3QUQA 1KDHA 4K4IA 4RQ1A 4C7ZA 2JMGA 4ECSA 3IDWA 3C2LA 3H8SA 2PMZC 4FBUA 4PL2A 1ZXIA 5DB7A 4F4ZA 3GU3A 5CA7A 4KLOA 3I28A 5KL8B 1D9DA 4Q45A 1NK8A 4JWNA 5DDMA 2ZIVA 2NRWA 2W11A 4Z6DA 2C2DA 9ICAA 7ICGA 1ZQFA 1CEZA 1SIJA 3V6KA 3SENA 1X2IA 3GILA 3PO4A 2W43A 3UMCA 2LI6A 3T3FA 3BDPA 3O0FA 1NJWA 2JZBA 1NK0A 4KLQA 2DUYA 2RFFA 4HX0A 2BQRA 2DPIA 2UVVA 2JXJA 3PO5A 4O5KA 2DR7A 1IV8A 2YTUA 5ALPA 2KK0A 3MABA 3UPQA 2Z7JA 5KG6A 2EAPA 5DBBA 5A0LA 1ZQVA 4KLSA 4ACOA 4G9BA 5F2VO 2M2UA 4O5CA 4ED2A 2ISOA 7ICMA 1COOA 3Q8PB 3WKBA 4I2DA 2ZG6A 2XO7A 4FE3A 3KBBA 1KSPA 2HVHA 4DQIA 4QZHA 2CXYA 2E8PA 3NUQA 2K4HA 4ECWA 1S5LU 5ALTA 7ICUA 4NY8A 5CB1A 5J0TA 9ICPA 1COKA 2GH1A 5F3XB 4UAWA 3HWTA 4TUPA 3JPSA 1MQ2A 3T79A 3WFOA 3H3AA 2D3DA 2J6SA 5J0RA 4F4XA 2QKQA 4QZAA 2XGPA 3QU9A 4S3NA 4Y2QA 2QB0A 3OV7A 4MEXA 3NWIA 1X9WA 1B22A 3M9NB 2HBLA 1Z00A 4RQ2A 4WBYA 3E2EA 2ID1A 4F2RA 5KFWA 4AT9A 3GIIA 4ICAA 5J2EA 2W9BB 8ICFA 5KFZA 3PSIA 4E8FA 1S77D 1JIHA 1ZQZA 2BPGA 4F92B 1FFUA 2K8BB 3GV5B 1NNLA 4NXWA 1JROA 1D9FA
chains in the Genus database with same CATH topology
2BCUA 4EEYA 1RYRA 5KFUA 4F5QA 4KTQA 8ICSA 9ICQA 3GV7B 1ZYQA 3PY8A 4F4KA 4QZGA 4UD5A 5J2BA 3UQ0A 3PV8A 4IR1A 8ICPA 1MIWA 4EBCA 4KLDA 4PH5A 5J0PA 5F2VO 1UT8A 1R8AA 3H39A 5KT5A 4RQ3A 2FMSA 3OVSA 2VA2A 3OSNA 3SV3A 5J2HA 4I2GA 5HRHA 4I2AA 3MR6A 3PR4A 1ZQQA 4DFKA 3RAXA 2XCPA 1S0NA 2DPJA 2NRZA 1QSYA 4M2YA 1TK5A 4RWPA 5J0UA 4RT2A 1NO5A 2ZHBA 1A76A 3AU2A 4M9GA 4UB5A 2DRAA 8ICHA 5BPCA 3Q8MA 1KLNA 1L3SA 1ZQUA 4GXIA 8ICGA 3QEAZ 4DQPA 3RR7A 1SKSA 1KTQA 1TVAA 4KLLA 1S0VA 4AT7A 4M9JA 1V9PA 2FLLA 4RZRA 2KZ3A 1ZJMA 8ICQA 9ICRA 5EOZA 8ICIA 4E80A 2JZBB 2ASJA 3JZ0A 4YR3A 4F4YA 4DLEA 4IQWA 3RR8A 1JAJA 1KEJA 3ETLA 4ED8A 1ZQNA 2F1HA 1UETA 4RUCA 3C66A 4RWNA 1SL0A 5KT6A 4QWEA 1T3NA 1TK8A 4YQWA 2IHNA 2R8JA 2ZHAA 4X4UA 4F5PA 5BOMA 5L9XA 4KLTA 4PPXA 2HHQA 4PGXA 3C23A 4M9LA 2MUTA 4YFKA 4KN7A 2PFOA 4X4NA 4LT6A 4DS5A 3G6XA 1NK4A 9ICOA 1ZQXA 3C21A 3HPOA 9ICJA 4F50A 4DO9A 9ICNA 4Q8EA 3HIYA 2DR8A 3RRHA 5HR9A 4DF8A 1ZQLA 1IM4A 4BDPA 4J9SA 1CUKA 5KG7A 3OHBA 4B9MA 3UQ2A 4Z6FA 4PGYA 1BPYA 3HT3A 1AROP 3OHAA 3H4DA 5BOLA 4EBEA 4DS4A 2R8IA 4RUAA 5KFRA 3RJGA 4B9LA 4LZGA 4DSEA 3T5HA 5DG7A 3TARA 1S77D 5C5JA 4ELVA 1NK6A 4BXOA 1NK5A 3ZD9A 4J9KA 1S0OA 4I2EA 4M5DA 4UQGA 3H40A 2ISPA 4NLZA 4KITB 5KT3A 2W8LA 4DQRA 4K4HA 4RQ6A 1ZQDA 5DQGA 2HHUA 5F9NA 2PFPA 5F9LA 5DB6A 5KFPA 1OU5A 3L9DA 4WC3A 5J0OA 4FS2A 4DL5A 2XC9A 3OJSA 4ECUA 4PGQA 4C8OA 1DOQA 3EWAA 3M9MB 2KFNA 9ICHA 3V7LA 2ZH4A 3C1ZA 3EZ5A 4ECTA 9ICEA 3HJ4A 4WBZA 3UXOA 2ZUBA 1ZQGA 3H8WA 5KT7A 4UD4A 3UPSA 3OUYB 4ED0A 5HC9A 4IR9A 1XWLA 3ZDAA 3Q8SB 1XC9A 4Q8FA 3TAPA 2W9CB 1BNPA 4YR0A 8ICXA 4P4PA 5DBAA 1ZQKA 1DGSA 1EXNA 4TQRA 1HUOA 1NK7A 4DFMA 5JUMA 4X0AA 2V4QA 1ZQJA 1ZQTA 2AQ0A 3MR3A 4I27A 3H7IA 3V6JA 1SL1A 4HYKA 1SL2A 4DL6A 5TZVA 3PX6A 4KLIA 2R8KA 2FLPA 2AGOA 4KLUA 8ICCA 3JYYA 2NRKA 4ECZA 3TAQA 5CHGA 2V9WA 4WCWA 2HHSA 4ELUA 3PW5A 4O3SA 7ICEA 7ICHA 5HRBA 3QEBZ 5DBCA 3PX4A 1MSWD 4KLGA 4WC4A 1Z00B 5HNKA 1NZPA 5HRIA 2A1JA 4ELTA 4NM1A 2M2WA 2V4RA 4X4TA 9ICMA 4WC0A 4AT9B 4TURA 5HRGA 5DGBA 4F5OA 2BPFA 1VFGA 4I2IA 4UBBA 3RJFA 3JPPA 4RNOA 2JEJA 5KG2A 3MR2A 3KHHA 3LDAA 1QTMA 8ICJA 2ZUDA 4KLHA 5KFIA 3GV8B 3H8JA 3MFIA 2AGPA 1TV9A 3ISBA 2J6TA 1S97A 1Z3EB 3TANA 3WFQE 3ORYA 9ICWA 5IIOA 5KFTA 3PNCA 5J2FA 4J9OA 3PX0A 3ZDCA 3V72A 1H38A 3AQLA 7ICVA 3NGDA 3NYBA 5HREA 5J2CA 3IM1A 4KN4A 3AUOA 4J9QA 4I2FA 8ICTA 5KG0A 5IIIA 5HHIA 3OVBA 2HHPA 4R64A 5KFDA 4RU9A 3V6HA 1U48A 1T7PA 4EYIB 8ICKA 5HRFA 3LWLA 4NKTA 4RWOA 1U9LA 5J2DA 3UXPA 4DEZA 4O9MA 4DL3A 4F91B 5J0SA 4MEYA 4MFAA 2VA3A 4B9TA 1MIVA 2DR5A 4QWDA 2BHNA 4J9LA 9ICKA 7ICSA 3JPTA 3RJHA 4E0DA 4WC6A 2P6UA 3MGHA 4PHPA 3GIMA 5HMLA 4FO6A 2ASLA 4I28A 4JV1A 9ICBA 4YMOA 1N48A 2IA6A 5J0YA 4F5NA 2ZH1A 5KG5A 3SI8A 3JPQA 4JV2A 2RDJA 4JK1A 3B0XA 2Y1JA 4MF2A 4MFCA 3LQCB 3MDCA 1ZQEA 2PBEA 3AQNA 1S10A 3WFRE 5L1LA 2BCSA 1L3TA 4IQVA 4DSJA 9ICVA 2J6UA 4QZ8A 4MF8A 4XQ8A 4ECXA 3MFHA 2PFQA 1XS9D 4B9SA 3TQ1A 5L1JA 4AT7B 1NJXA 1N56A 4RQ8A 5KFGA 1ZETA 4F8RA 2M2VA 7ICNA 3RH4A 4Q44A 2BKEA 3ISDA 4RQ5A 1KFDA 5J0WA 2XCAA 2C2EA 2XGQA 7ICRA 4RQ0A 2M2TA 3HW8A 5KFSA 1XSPA 4EBJA 1WCLA 4X0BA 1TFYA 4X4VA 1DK2A 2BGWA 2O1PA 4UB3A 3PMNA 4J9PA 3EPGA 2ZTEA 5KTQA 4DSFA 4UB4A 2KN7A 4YR2A 2MUTB 4TUQA 4FHYA 5KFNA 3PMLA 1ZQPA 2NRXA 3M9OB 2ZH3A 3KHGA 2KZZA 4UAYA 4EBDA 4PHAA 4YN4A 8ICWA 1RXWA 4DSIA 4BWMA 4FHPA 3AQMA 1KFTA 3BJYA 5IIKA 5IILA 3AU6A 4X4OA 2BDPA 2ZTDA 4YD1A 2ZH6A 3UXNA 2C28A 2FMQA 2ASDA 4RPXA 1ZQAA 4J9MA 5D49A 9ICTA 3IHQB 2UVWA 2IHMA 1RXVA 9ICLA 4BXOB 3H37A 5KFLA 4C8NA 5KFVA 4M47A 1R8BA 3ISCA 4NKUA 5KT4A 2OWOA 2VANA 2ATLA 4X4RA 8ICNA 2ZH5A 2F1JA 4X5VA 3C2MA 5CJ7A 4XUSA 2KFZA 2JEIA 1HJPA 5KFBA 2BCQA 7ICFA 5HMMA 3FDSA 3NTUA 4MFFA 4DLGA 4NLKA 8ICOA 3RJEA 3MBYA 4XQ7A 2HHWA 4BGDA 1F5AA 2W9MA 4YVZA 3LWMA 4DL7A 4DL4A 2BE3A 3WFSC 4DL2A 3AQKA 4P2HA 1U45A 5KG3A 3MDAA 4EZ6A 4FH5A 4JV0A 1S0MA 1R8CA 2ZJ8A 3RH6A 3C5FA 1X9SA 3QZ8A 1XSLA 4DFPA 2ZH8A 2O5AA 4RNNA 5J2AA 3T5LA 4ZH4A 4KLEA 5KFHA 5DQHA 5HRKA 1UEVA 1NKCA 3RJKA 3QE9Y 5DG9A 2AQ4A 8ICRA 4EBKA 3G6YA 4RWQA 4FHWA 5KFAA 4WC7A 4FHXA 3K75D 5HRDA 4ED7A 4KLMA 4GXJA 1SZPA 4X4PA 1JQRA 4ECYA 1YLQA 2HHTA 5IINA 3SZ2A 1TK0A 3C18A 1U4BA 4RNMA 4FH3A 3SV4A 2A1JB 1BPZA 3Q8QB 5KFXA 4C8MA 5HRLA 3T5JA 5D4BA 5EWEA 3JPNA 3HJ1A 2GWSA 1XU4A 4QZ9A 1KRPA 5CWRA 1ZQBA 1C7YA 4WC2A 1K1SA 4UB2A 4F5RA 2UVRA 3Q8KA 1ZQRA 1D8YA 3HP6A 2JEFA 4UAZA 3RBDA 1ZQSA 3M8SA 4ATBA 5L1KA 9ICGA 4YCXA 5IIJA 3TI0A 4QZCA 4C8LA 1PZNA 3H38A 2F1IA 3LK9A 2BQ3A 3N97B 5EWGA 1IXRA 4QWCA 2NRVA 4YMNA 4O3OA 4QWAA 4UBCA 2C2RA 1BPDA 4F3OA 4KLFA 3RJJA 1JXEA 2KZMA 3MR5A 1NOMA 2PXIA 3TFRA 1T8EA 5J2JA 4I2BA 3THVA 7ICTA 5KT2A 4YG2A 5KFCA 4ECRA 4R65A 4DQQA 3Q8LA 5KFOA 1TAQA 1L3VA 1ZQYA 2RDIA 3ZDDA 4M04A 1HUZA 5KG1A 4R66A 4DOCA 4FBTA 2DRBA 4M6WA 1XSNA 2VA8A 3FYHA 2XY7A 2FPKA 4P4OA 4QW9A 8ICYA 4AT8A 1XO1A 4PHEA 3RJIA 4B9UA 1MQ3A 1RPLA 7ICIA 2DR9A 2I9GA 2ZJ5A 4XA5A 5HP4A 5J0QA 4KMUA 4QZEA 5DLGA 4QWBA 1QSLA 7ICPA 1BGXT 1JX4A 9ICSA 3HX0A 1QSSA 1QLNA 1ZQOA 7ICJA 4R8UB 4J9NA 4FS1A 2XY6A 7ICLA 1KNYA 5HHHA 3RB6A 5DQIA 5J2KA 4KLJA 4TQSA 4ED3A 2KP7A 2MAXA 4QZDA 1MIYA 4R8UA 4JWMA 3GIJA 8ICLA 5L1IA 3RB0A 4EZ9A 4F93B 4YP3A 4DOBA 4IRKA 2C22A 1R89A 4BWJA 4EYHB 4LZDA 2PFNA 2PI4A 1LV5A 5IIMA 4NM2A 3GFKB 4J9RA 1RZTA 4DWIA 5DECA 5D46A 4DQSA 4O3QA 5EWFA 5J0XA 1ZQWA 4DFJA 3PVXA 1KDHA 1ZQCA 4K4IA 3K4GA 3QZ7A 4GC6A 3RRGA 2HHXA 4RQ1A 2BCVA 4IRCA 2ZUCA 4QZBA 5DGAA 4ECSA 3T5KA 2XY5A 1SKRA 2P6RA 4JUZA 3C2LA 1T4GA 3V7KA 3PW0A 2BCRA 1TFWA 3H8SA 4FBUA 4QZFA 3G6VA 8ICZA 2DVIA 4R63A 5DLFA 4G3IA 5KFFA 5DB7A 4O3NA 4PHDA 4F4ZA 3ZDBA 7ICKA 4WC1A 5CA7A 2HVIA 4KLOA 7ICOA 5DB9A 1D9DA 1L3UA 4Q45A 1ZJNA 1NK8A 4JWNA 4TUSA 3RB3A 5DDMA 3BQTA 5DDYA 2ALZA 2NRWA 8ICBA 1LB2B 5J2IA 3RBEA 4Z6DA 2C2DA 9ICAA 5CP2A 7ICGA 2H5XA 1ZQFA 1CEZA 1L5UA 1K1QA 9ICUA 1Q78A 1B43A 3V6KA 5KFQA 1ZQHA 1KFSA 4E7XA 4IG8A 3GDXA 1X2IA 3GILA 3PO4A 5DG8A 1UA0A 4M9NA 4ECQA 4DSLA 8ICUA 4IQTA 2W8KA 1PX5A 3T3FA 3C1YA 1FA0A 3BDPA 1NJWA 3MGIA 2JZBA 3OSPA 4Z6CA 2BPCA 1NK0A 3PW4A 1BVSA 4IQUA 4I2CA 2R8HA 3V7JA 4KLQA 1NKBA 2RFFA 9ICFA 2BQRA 4YD2A 2DPIA 2UVVA 3PO5A 4O5KA 1MC8A 2DR7A 4I29A 1Y88A 4GLXA 2Q66A 1UT5A 1S76D 3MABA 4DOAA 2HHVA 3UPQA 4B9NA 3JPOA 3OGUA 1JMSA 5KG6A 5DBBA 1ZQVA 2BR0A 4C8KA 4KLSA 4YMMA 3RH5A 8ICAA 1TKDA 3RAQA 4M0AA 1NJZA 2FPMA 1BPEA 2P66A 4CCHA 4F2SA 2M2UA 5KFKA 1D8LA 4ED2A 4GC7A 4O5CA 1JN3A 4ED1A 2BQUA 3KHLA 2ISOA 2ZTCA 1COOA 4RT3A 3Q8PB 1NK9A 4QW8A 3H4BA 4NXZA 3RTVA 7ICMA 4X4QA 2Q0ZX 4I2DA 3OJUA 3PR5B 2WTFA 3C5GA 4UB1A 3PW2A 4RQ4A 5J2GA 3Q8RB 2XO7A 1WCNA 3GIKA 3BQ0A 2UVUA 4RPYA 1BPXA 1KSPA 4M9HA 2HVHA 1UA1A 1Q79A 4DQIA 4Q43A 1ZQMA 2FPLA 4QZHA 4O3RA 2IMWP 1NKEA 2AJQA 1U47A 4RPZA 1ZQIA 4FHVA 4ECWA 4IRDA 4ATBB 7ICUA 5KFJA 1TFRA 3M8RA 3PW7A 3ZDEA 4YXJA 4NY8A 4O3PA 5CB1A 5J0TA 3RB4A 9ICPA 2IBKA 5DEDA 1WOTA 2DFLA 2AGQA 8ICVA 3OUYA 2W9AA 3ZD8A 4UAWA 3HWTA 3B0YA 4TUPA 2NRTA 4ED6A 2R8GA 2W9CA 3OVAA 4EP7A 3JPSA 1MQ2A 4I2HA 4DSKA 3BQ1A 9ICIA 3WFOA 1TAUA 3SYZA 1DK3A 3H3AA 2J6SA 1BNOA 5J0RA 5KFEA 4F4XA 1U49A 4ECVA 1VJ7A 4X4SA 1X9MA 2FMPA 4LVSA 4QZAA 4YXMA 8ICEA 1JXLA 1NJYA 2I1QA 4M6WB 2XGPA 4DF4A 3C2KA 2M9NA 4S3NA 5CR0A 4AT8B 3OV7A 3EYZA 4MEXA 4K4GA 5KFYA 3N4MB 5DKWA 1X9WA 3M9NB 3KHRA 1B22A 1Z00A 3KTQA 4RQ2A 5J29A 4I2JA 4NLGA 4WBYA 3E2EA 3TFSA 1SKWA 2ID1A 4F2RA 5KG4A 5KFWA 2AU0A 3GIIA 4AT9A 2ZH9A 4O5EA 3WFPA 1BPBA 1A77A 2ZH7A 2LYHA 4GXKA 3BQ2A 8ICMA 5J2EA 2W9BB 3GQCA 4F4WA 2KTQA 2ZJAA 7ICQA 1V4AA 4WC5A 8ICFA 2ZH2A 2HW3A 5KFZA 4QZIA 4XRHA 5DB8A 2PI5A 3EW9A 1UEUA 4E8FA 2JEGA 2B21A 1JIHA 1ZQZA 4O0IA 4RQ7A 3JPRA 4F92B 2W9BA 3EPIA 2BPGA 4B9VA 4Z6EA 3GV5B 2FLNA 2Y1IA 9ICCA 1RYSA 9ICXA 4P4MA 1S9FA 4NLNA 5KFMA 1D9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCU A;  4EEY A;  1RYR A;  5KFU A;  4F5Q A;  4KTQ A;  8ICS A;  9ICQ A;  3GV7 B;  1ZYQ A;  3PY8 A;  4F4K A;  4QZG A;  4UD5 A;  5J2B A;  3UQ0 A;  3PV8 A;  4IR1 A;  8ICP A;  1MIW A;  4EBC A;  4KLD A;  4PH5 A;  5J0P A;  5F2V O;  1UT8 A;  1R8A A;  3H39 A;  5KT5 A;  4RQ3 A;  2FMS A;  3OVS A;  2VA2 A;  3OSN A;  3SV3 A;  5J2H A;  4I2G A;  5HRH A;  4I2A A;  3MR6 A;  3PR4 A;  1ZQQ A;  4DFK A;  3RAX A;  2XCP A;  1S0N A;  2DPJ A;  2NRZ A;  1QSY A;  4M2Y A;  1TK5 A;  4RWP A;  5J0U A;  4RT2 A;  1NO5 A;  2ZHB A;  1A76 A;  3AU2 A;  4M9G A;  4UB5 A;  2DRA A;  8ICH A;  5BPC A;  3Q8M A;  1KLN A;  1L3S A;  1ZQU A;  4GXI A;  8ICG A;  3QEA Z;  4DQP A;  3RR7 A;  1SKS A;  1KTQ A;  1TVA A;  4KLL A;  1S0V A;  4AT7 A;  4M9J A;  1V9P A;  2FLL A;  4RZR A;  2KZ3 A;  1ZJM A;  8ICQ A;  9ICR A;  5EOZ A;  8ICI A;  4E80 A;  2JZB B;  2ASJ A;  3JZ0 A;  4YR3 A;  4F4Y A;  4DLE A;  4IQW A;  3RR8 A;  1JAJ A;  1KEJ A;  3ETL A;  4ED8 A;  1ZQN A;  2F1H A;  1UET A;  4RUC A;  3C66 A;  4RWN A;  1SL0 A;  5KT6 A;  4QWE A;  1T3N A;  1TK8 A;  4YQW A;  2IHN A;  2R8J A;  2ZHA A;  4X4U A;  4F5P A;  5BOM A;  5L9X A;  4KLT A;  4PPX A;  2HHQ A;  4PGX A;  3C23 A;  4M9L A;  2MUT A;  4YFK A;  4KN7 A;  2PFO A;  4X4N A;  4LT6 A;  4DS5 A;  3G6X A;  1NK4 A;  9ICO A;  1ZQX A;  3C21 A;  3HPO A;  9ICJ A;  4F50 A;  4DO9 A;  9ICN A;  4Q8E A;  3HIY A;  2DR8 A;  3RRH A;  5HR9 A;  4DF8 A;  1ZQL A;  1IM4 A;  4BDP A;  4J9S A;  1CUK A;  5KG7 A;  3OHB A;  4B9M A;  3UQ2 A;  4Z6F A;  4PGY A;  1BPY A;  3HT3 A;  1ARO P;  3OHA A;  3H4D A;  5BOL A;  4EBE A;  4DS4 A;  2R8I A;  4RUA A;  5KFR A;  3RJG A;  4B9L A;  4LZG A;  4DSE A;  3T5H A;  5DG7 A;  3TAR A;  1S77 D;  5C5J A;  4ELV A;  1NK6 A;  4BXO A;  1NK5 A;  3ZD9 A;  4J9K A;  1S0O A;  4I2E A;  4M5D A;  4UQG A;  3H40 A;  2ISP A;  4NLZ A;  4KIT B;  5KT3 A;  2W8L A;  4DQR A;  4K4H A;  4RQ6 A;  1ZQD A;  5DQG A;  2HHU A;  5F9N A;  2PFP A;  5F9L A;  5DB6 A;  5KFP A;  1OU5 A;  3L9D A;  4WC3 A;  5J0O A;  4FS2 A;  4DL5 A;  2XC9 A;  3OJS A;  4ECU A;  4PGQ A;  4C8O A;  1DOQ A;  3EWA A;  3M9M B;  2KFN A;  9ICH A;  3V7L A;  2ZH4 A;  3C1Z A;  3EZ5 A;  4ECT A;  9ICE A;  3HJ4 A;  4WBZ A;  3UXO A;  2ZUB A;  1ZQG A;  3H8W A;  5KT7 A;  4UD4 A;  3UPS A;  3OUY B;  4ED0 A;  5HC9 A;  4IR9 A;  1XWL A;  3ZDA A;  3Q8S B;  1XC9 A;  4Q8F A;  3TAP A;  2W9C B;  1BNP A;  4YR0 A;  8ICX A;  4P4P A;  5DBA A;  1ZQK A;  1DGS A;  1EXN A;  4TQR A;  1HUO A;  1NK7 A;  4DFM A;  5JUM A;  4X0A A;  2V4Q A;  1ZQJ A;  1ZQT A;  2AQ0 A;  3MR3 A;  4I27 A;  3H7I A;  3V6J A;  1SL1 A;  4HYK A;  1SL2 A;  4DL6 A;  5TZV A;  3PX6 A;  4KLI A;  2R8K A;  2FLP A;  2AGO A;  4KLU A;  8ICC A;  3JYY A;  2NRK A;  4ECZ A;  3TAQ A;  5CHG A;  2V9W A;  4WCW A;  2HHS A;  4ELU A;  3PW5 A;  4O3S A;  7ICE A;  7ICH A;  5HRB A;  3QEB Z;  5DBC A;  3PX4 A;  1MSW D;  4KLG A;  4WC4 A;  1Z00 B;  5HNK A;  1NZP A;  5HRI A;  2A1J A;  4ELT A;  4NM1 A;  2M2W A;  2V4R A;  4X4T A;  9ICM A;  4WC0 A;  4AT9 B;  4TUR A;  5HRG A;  5DGB A;  4F5O A;  2BPF A;  1VFG A;  4I2I A;  4UBB A;  3RJF A;  3JPP A;  4RNO A;  2JEJ A;  5KG2 A;  3MR2 A;  3KHH A;  3LDA A;  1QTM A;  8ICJ A;  2ZUD A;  4KLH A;  5KFI A;  3GV8 B;  3H8J A;  3MFI A;  2AGP A;  1TV9 A;  3ISB A;  2J6T A;  1S97 A;  1Z3E B;  3TAN A;  3WFQ E;  3ORY A;  9ICW A;  5IIO A;  5KFT A;  3PNC A;  5J2F A;  4J9O A;  3PX0 A;  3ZDC A;  3V72 A;  1H38 A;  3AQL A;  7ICV A;  3NGD A;  3NYB A;  5HRE A;  5J2C A;  3IM1 A;  4KN4 A;  3AUO A;  4J9Q A;  4I2F A;  8ICT A;  5KG0 A;  5III A;  5HHI A;  3OVB A;  2HHP A;  4R64 A;  5KFD A;  4RU9 A;  3V6H A;  1U48 A;  1T7P A;  4EYI B;  8ICK A;  5HRF A;  3LWL A;  4NKT A;  4RWO A;  1U9L A;  5J2D A;  3UXP A;  4DEZ A;  4O9M A;  4DL3 A;  4F91 B;  5J0S A;  4MEY A;  4MFA A;  2VA3 A;  4B9T A;  1MIV A;  2DR5 A;  4QWD A;  2BHN A;  4J9L A;  9ICK A;  7ICS A;  3JPT A;  3RJH A;  4E0D A;  4WC6 A;  2P6U A;  3MGH A;  4PHP A;  3GIM A;  5HML A;  4FO6 A;  2ASL A;  4I28 A;  4JV1 A;  9ICB A;  4YMO A;  1N48 A;  2IA6 A;  5J0Y A;  4F5N A;  2ZH1 A;  5KG5 A;  3SI8 A;  3JPQ A;  4JV2 A;  2RDJ A;  4JK1 A;  3B0X A;  2Y1J A;  4MF2 A;  4MFC A;  3LQC B;  3MDC A;  1ZQE A;  2PBE A;  3AQN A;  1S10 A;  3WFR E;  5L1L A;  2BCS A;  1L3T A;  4IQV A;  4DSJ A;  9ICV A;  2J6U A;  4QZ8 A;  4MF8 A;  4XQ8 A;  4ECX A;  3MFH A;  2PFQ A;  1XS9 D;  4B9S A;  3TQ1 A;  5L1J A;  4AT7 B;  1NJX A;  1N56 A;  4RQ8 A;  5KFG A;  1ZET A;  4F8R A;  2M2V A;  7ICN A;  3RH4 A;  4Q44 A;  2BKE A;  3ISD A;  4RQ5 A;  1KFD A;  5J0W A;  2XCA A;  2C2E A;  2XGQ A;  7ICR A;  4RQ0 A;  2M2T A;  3HW8 A;  5KFS A;  1XSP A;  4EBJ A;  1WCL A;  4X0B A;  1TFY A;  4X4V A;  1DK2 A;  2BGW A;  2O1P A;  4UB3 A;  3PMN A;  4J9P A;  3EPG A;  2ZTE A;  5KTQ A;  4DSF A;  4UB4 A;  2KN7 A;  4YR2 A;  2MUT B;  4TUQ A;  4FHY A;  5KFN A;  3PML A;  1ZQP A;  2NRX A;  3M9O B;  2ZH3 A;  3KHG A;  2KZZ A;  4UAY A;  4EBD A;  4PHA A;  4YN4 A;  8ICW A;  1RXW A;  4DSI A;  4BWM A;  4FHP A;  3AQM A;  1KFT A;  3BJY A;  5IIK A;  5IIL A;  3AU6 A;  4X4O A;  2BDP A;  2ZTD A;  4YD1 A;  2ZH6 A;  3UXN A;  2C28 A;  2FMQ A;  2ASD A;  4RPX A;  1ZQA A;  4J9M A;  5D49 A;  9ICT A;  3IHQ B;  2UVW A;  2IHM A;  1RXV A;  9ICL A;  4BXO B;  3H37 A;  5KFL A;  4C8N A;  5KFV A;  4M47 A;  1R8B A;  3ISC A;  4NKU A;  5KT4 A;  2OWO A;  2VAN A;  2ATL A;  4X4R A;  8ICN A;  2ZH5 A;  2F1J A;  4X5V A;  3C2M A;  5CJ7 A;  4XUS A;  2KFZ A;  2JEI A;  1HJP A;  5KFB A;  2BCQ A;  7ICF A;  5HMM A;  3FDS A;  3NTU A;  4MFF A;  4DLG A;  4NLK A;  8ICO A;  3RJE A;  3MBY A;  4XQ7 A;  2HHW A;  4BGD A;  1F5A A;  2W9M A;  4YVZ A;  3LWM A;  4DL7 A;  4DL4 A;  2BE3 A;  3WFS C;  4DL2 A;  3AQK A;  4P2H A;  1U45 A;  5KG3 A;  3MDA A;  4EZ6 A;  4FH5 A;  4JV0 A;  1S0M A;  1R8C A;  2ZJ8 A;  3RH6 A;  3C5F A;  1X9S A;  3QZ8 A;  1XSL A;  4DFP A;  2ZH8 A;  2O5A A;  4RNN A;  5J2A A;  3T5L A;  4ZH4 A;  4KLE A;  5KFH A;  5DQH A;  5HRK A;  1UEV A;  1NKC A;  3RJK A;  3QE9 Y;  5DG9 A;  2AQ4 A;  8ICR A;  4EBK A;  3G6Y A;  4RWQ A;  4FHW A;  5KFA A;  4WC7 A;  4FHX A;  3K75 D;  5HRD A;  4ED7 A;  4KLM A;  4GXJ A;  1SZP A;  4X4P A;  1JQR A;  4ECY A;  1YLQ A;  2HHT A;  5IIN A;  3SZ2 A;  1TK0 A;  3C18 A;  1U4B A;  4RNM A;  4FH3 A;  3SV4 A;  2A1J B;  1BPZ A;  3Q8Q B;  5KFX A;  4C8M A;  5HRL A;  3T5J A;  5D4B A;  5EWE A;  3JPN A;  3HJ1 A;  2GWS A;  1XU4 A;  4QZ9 A;  1KRP A;  5CWR A;  1ZQB A;  1C7Y A;  4WC2 A;  1K1S A;  4UB2 A;  4F5R A;  2UVR A;  3Q8K A;  1ZQR A;  1D8Y A;  3HP6 A;  2JEF A;  4UAZ A;  3RBD A;  1ZQS A;  3M8S A;  4ATB A;  5L1K A;  9ICG A;  4YCX A;  5IIJ A;  3TI0 A;  4QZC A;  4C8L A;  1PZN A;  3H38 A;  2F1I A;  3LK9 A;  2BQ3 A;  3N97 B;  5EWG A;  1IXR A;  4QWC A;  2NRV A;  4YMN A;  4O3O A;  4QWA A;  4UBC A;  2C2R A;  1BPD A;  4F3O A;  4KLF A;  3RJJ A;  1JXE A;  2KZM A;  3MR5 A;  1NOM A;  2PXI A;  3TFR A;  1T8E A;  5J2J A;  4I2B A;  3THV A;  7ICT A;  5KT2 A;  4YG2 A;  5KFC A;  4ECR A;  4R65 A;  4DQQ A;  3Q8L A;  5KFO A;  1TAQ A;  1L3V A;  1ZQY A;  2RDI A;  3ZDD A;  4M04 A;  1HUZ A;  5KG1 A;  4R66 A;  4DOC A;  4FBT A;  2DRB A;  4M6W A;  1XSN A;  2VA8 A;  3FYH A;  2XY7 A;  2FPK A;  4P4O A;  4QW9 A;  8ICY A;  4AT8 A;  1XO1 A;  4PHE A;  3RJI A;  4B9U A;  1MQ3 A;  1RPL A;  7ICI A;  2DR9 A;  2I9G A;  2ZJ5 A;  4XA5 A;  5HP4 A;  5J0Q A;  4KMU A;  4QZE A;  5DLG A;  4QWB A;  1QSL A;  7ICP A;  1BGX T;  1JX4 A;  9ICS A;  3HX0 A;  1QSS A;  1QLN A;  1ZQO A;  7ICJ A;  4R8U B;  4J9N A;  4FS1 A;  2XY6 A;  7ICL A;  1KNY A;  5HHH A;  3RB6 A;  5DQI A;  5J2K A;  4KLJ A;  4TQS A;  4ED3 A;  2KP7 A;  2MAX A;  4QZD A;  1MIY A;  4R8U A;  4JWM A;  3GIJ A;  8ICL A;  5L1I A;  3RB0 A;  4EZ9 A;  4F93 B;  4YP3 A;  4DOB A;  4IRK A;  2C22 A;  1R89 A;  4BWJ A;  4EYH B;  4LZD A;  2PFN A;  2PI4 A;  1LV5 A;  5IIM A;  4NM2 A;  3GFK B;  4J9R A;  1RZT A;  4DWI A;  5DEC A;  5D46 A;  4DQS A;  4O3Q A;  5EWF A;  5J0X A;  1ZQW A;  4DFJ A;  3PVX A;  1KDH A;  1ZQC A;  4K4I A;  3K4G A;  3QZ7 A;  4GC6 A;  3RRG A;  2HHX A;  4RQ1 A;  2BCV A;  4IRC A;  2ZUC A;  4QZB A;  5DGA A;  4ECS A;  3T5K A;  2XY5 A;  1SKR A;  2P6R A;  4JUZ A;  3C2L A;  1T4G A;  3V7K A;  3PW0 A;  2BCR A;  1TFW A;  3H8S A;  4FBU A;  4QZF A;  3G6V A;  8ICZ A;  2DVI A;  4R63 A;  5DLF A;  4G3I A;  5KFF A;  5DB7 A;  4O3N A;  4PHD A;  4F4Z A;  3ZDB A;  7ICK A;  4WC1 A;  5CA7 A;  2HVI A;  4KLO A;  7ICO A;  5DB9 A;  1D9D A;  1L3U A;  4Q45 A;  1ZJN A;  1NK8 A;  4JWN A;  4TUS A;  3RB3 A;  5DDM A;  3BQT A;  5DDY A;  2ALZ A;  2NRW A;  8ICB A;  1LB2 B;  5J2I A;  3RBE A;  4Z6D A;  2C2D A;  9ICA A;  5CP2 A;  7ICG A;  2H5X A;  1ZQF A;  1CEZ A;  1L5U A;  1K1Q A;  9ICU A;  1Q78 A;  1B43 A;  3V6K A;  5KFQ A;  1ZQH A;  1KFS A;  4E7X A;  4IG8 A;  3GDX A;  1X2I A;  3GIL A;  3PO4 A;  5DG8 A;  1UA0 A;  4M9N A;  4ECQ A;  4DSL A;  8ICU A;  4IQT A;  2W8K A;  1PX5 A;  3T3F A;  3C1Y A;  1FA0 A;  3BDP A;  1NJW A;  3MGI A;  2JZB A;  3OSP A;  4Z6C A;  2BPC A;  1NK0 A;  3PW4 A;  1BVS A;  4IQU A;  4I2C A;  2R8H A;  3V7J A;  4KLQ A;  1NKB A;  2RFF A;  9ICF A;  2BQR A;  4YD2 A;  2DPI A;  2UVV A;  3PO5 A;  4O5K A;  1MC8 A;  2DR7 A;  4I29 A;  1Y88 A;  4GLX A;  2Q66 A;  1UT5 A;  1S76 D;  3MAB A;  4DOA A;  2HHV A;  3UPQ A;  4B9N A;  3JPO A;  3OGU A;  1JMS A;  5KG6 A;  5DBB A;  1ZQV A;  2BR0 A;  4C8K A;  4KLS A;  4YMM A;  3RH5 A;  8ICA A;  1TKD A;  3RAQ A;  4M0A A;  1NJZ A;  2FPM A;  1BPE A;  2P66 A;  4CCH A;  4F2S A;  2M2U A;  5KFK A;  1D8L A;  4ED2 A;  4GC7 A;  4O5C A;  1JN3 A;  4ED1 A;  2BQU A;  3KHL A;  2ISO A;  2ZTC A;  1COO A;  4RT3 A;  3Q8P B;  1NK9 A;  4QW8 A;  3H4B A;  4NXZ A;  3RTV A;  7ICM A;  4X4Q A;  2Q0Z X;  4I2D A;  3OJU A;  3PR5 B;  2WTF A;  3C5G A;  4UB1 A;  3PW2 A;  4RQ4 A;  5J2G A;  3Q8R B;  2XO7 A;  1WCN A;  3GIK A;  3BQ0 A;  2UVU A;  4RPY A;  1BPX A;  1KSP A;  4M9H A;  2HVH A;  1UA1 A;  1Q79 A;  4DQI A;  4Q43 A;  1ZQM A;  2FPL A;  4QZH A;  4O3R A;  2IMW P;  1NKE A;  2AJQ A;  1U47 A;  4RPZ A;  1ZQI A;  4FHV A;  4ECW A;  4IRD A;  4ATB B;  7ICU A;  5KFJ A;  1TFR A;  3M8R A;  3PW7 A;  3ZDE A;  4YXJ A;  4NY8 A;  4O3P A;  5CB1 A;  5J0T A;  3RB4 A;  9ICP A;  2IBK A;  5DED A;  1WOT A;  2DFL A;  2AGQ A;  8ICV A;  3OUY A;  2W9A A;  3ZD8 A;  4UAW A;  3HWT A;  3B0Y A;  4TUP A;  2NRT A;  4ED6 A;  2R8G A;  2W9C A;  3OVA A;  4EP7 A;  3JPS A;  1MQ2 A;  4I2H A;  4DSK A;  3BQ1 A;  9ICI A;  3WFO A;  1TAU A;  3SYZ A;  1DK3 A;  3H3A A;  2J6S A;  1BNO A;  5J0R A;  5KFE A;  4F4X A;  1U49 A;  4ECV A;  1VJ7 A;  4X4S A;  1X9M A;  2FMP A;  4LVS A;  4QZA A;  4YXM A;  8ICE A;  1JXL A;  1NJY A;  2I1Q A;  4M6W B;  2XGP A;  4DF4 A;  3C2K A;  2M9N A;  4S3N A;  5CR0 A;  4AT8 B;  3OV7 A;  3EYZ A;  4MEX A;  4K4G A;  5KFY A;  3N4M B;  5DKW A;  1X9W A;  3M9N B;  3KHR A;  1B22 A;  1Z00 A;  3KTQ A;  4RQ2 A;  5J29 A;  4I2J A;  4NLG A;  4WBY A;  3E2E A;  3TFS A;  1SKW A;  2ID1 A;  4F2R A;  5KG4 A;  5KFW A;  2AU0 A;  3GII A;  4AT9 A;  2ZH9 A;  4O5E A;  3WFP A;  1BPB A;  1A77 A;  2ZH7 A;  2LYH A;  4GXK A;  3BQ2 A;  8ICM A;  5J2E A;  2W9B B;  3GQC A;  4F4W A;  2KTQ A;  2ZJA A;  7ICQ A;  1V4A A;  4WC5 A;  8ICF A;  2ZH2 A;  2HW3 A;  5KFZ A;  4QZI A;  4XRH A;  5DB8 A;  2PI5 A;  3EW9 A;  1UEU A;  4E8F A;  2JEG A;  2B21 A;  1JIH A;  1ZQZ A;  4O0I A;  4RQ7 A;  3JPR A;  4F92 B;  2W9B A;  3EPI A;  2BPG A;  4B9V A;  4Z6E A;  3GV5 B;  2FLN A;  2Y1I A;  9ICC A;  1RYS A;  9ICX A;  4P4M A;  1S9F A;  4NLN A;  5KFM A;  1D9F A; 
#chains in the Genus database with same CATH topology
 1KL9 A;  5KFU A;  3GV7 B;  5ALU A;  4UD5 A;  5J2B A;  4EBC A;  4KLD A;  5KT5 A;  1LVH A;  3OSN A;  5ALX A;  3MR6 A;  3PR4 A;  1ZQQ A;  2XCP A;  4OJL A;  4Y2Y A;  4RWP A;  1NO5 A;  5JTI A;  3ONN A;  4MHV A;  1OW5 A;  1ZQU A;  3K7D A;  1T94 A;  4OJP A;  4KLL A;  1S0V A;  1ZJM A;  9ICR A;  2FCL A;  1WWV A;  1X6I A;  4DLE A;  5AIA A;  3ETL A;  4ED8 A;  5KT6 A;  1TE2 A;  1Z4O A;  1T3N A;  5J8Y A;  1TK8 A;  1DRG A;  3D2N A;  5BOM A;  4PPX A;  4PGX A;  4X4N A;  5EE9 A;  4DS5 A;  1NK4 A;  9ICO A;  1ZQX A;  4F50 A;  9ICN A;  3HIY A;  3I76 A;  4AP9 A;  5HR9 A;  1ZQL A;  4J9S A;  4B9M A;  3OHB A;  1V97 A;  4UD4 A;  2KJ8 A;  3OHA A;  3H4D A;  4DS4 A;  5KFR A;  2KMD A;  3T5H A;  2CPR A;  5DG7 A;  5C0Y A;  1NK5 A;  4J9K A;  4LEZ A;  4I2E A;  4M5D A;  2ISP A;  3H40 A;  4KIT B;  2W8L A;  4K4H A;  2HHU A;  1ZQD A;  5DQG A;  4PZO A;  3I1Y A;  4WC3 A;  4F72 A;  4ECU A;  3EWA A;  2KFN A;  3M9M B;  3V7L A;  1IIP A;  5ALF A;  2ZUB A;  5KT7 A;  3OUY B;  2GO7 A;  4IR9 A;  3ZDA A;  1BNP A;  2O6K A;  2FE9 A;  4WQK A;  1HUO A;  3UMG A;  5JUM A;  4X0A A;  1ZQJ A;  3MR3 A;  3V6J A;  4KLI A;  4KLU A;  4ECZ A;  3TAQ A;  3KKA C;  4O3S A;  3QEB Z;  5DBC A;  1PK1 A;  4KLG A;  1DGJ A;  1NZP A;  2V4R A;  2FJ6 A;  4US9 A;  4WC0 A;  5DGB A;  2BPF A;  4I2I A;  3RJF A;  4UAV A;  4RNO A;  2JEJ A;  2ZUD A;  4KLH A;  1Z4N A;  1TV9 A;  3TAN A;  5KFT A;  3PNC A;  2OXO A;  2P35 A;  4QJF B;  3V72 A;  2NO4 A;  5HRE A;  1NZB A;  5ALL A;  4O69 A;  2OCE A;  4I2F A;  8ICT A;  5KG0 A;  2DQN B;  3OVB A;  4RWO A;  4DL3 A;  5J0S A;  4MEY A;  4QWD A;  9ICK A;  4E0D A;  3RJH A;  3MGH A;  2ASL A;  4PHP A;  4O6A A;  4K98 A;  4YMO A;  5J0Y A;  1Z19 A;  1RQN A;  2RQ5 A;  4MF2 A;  3LQC B;  2PBE A;  4EEN A;  4HAI A;  5D63 A;  1CI4 A;  2LM4 A;  1GPJ A;  9ICV A;  2J6U A;  4ECX A;  3MFH A;  4B9S A;  5AM5 A;  4F8R A;  3RH4 A;  1YZ7 A;  2C2E A;  3LVV A;  4EBJ A;  2H3Z A;  4X0B A;  1TFY A;  1WCL A;  5ALZ A;  4CE6 A;  4J9P A;  4Y2P A;  1N5W A;  4UB4 A;  2MUT B;  3RF9 A;  4TUQ A;  4FHY A;  3PML A;  1ZQP A;  3M9O B;  3IN5 A;  2F3N A;  2KZZ A;  4PHA A;  4YN4 A;  1RXW A;  4QIW C;  1Q3V A;  4FHP A;  1KFT A;  5IIL A;  2BDP A;  2ZTD A;  2ZH6 A;  1Q3U A;  5ALD A;  3LVW A;  2ASD A;  4RPX A;  2FMQ A;  5D49 A;  4Y2T A;  1RXV A;  5KFV A;  4M47 A;  1R8B A;  4NKU A;  5KT4 A;  2ATL A;  8ICN A;  3C2M A;  5CJ7 A;  3TAD C;  5KFB A;  2HOQ A;  7ICF A;  4MFF A;  3FDS A;  3NTU A;  3WK9 A;  2VJ5 A;  2JRZ A;  2HHW A;  1F5A A;  4DL7 A;  4DL4 A;  4IL6 U;  3AM9 A;  2ZIU B;  4JV0 A;  2W04 A;  4USA A;  3QZ8 A;  4RNN A;  5J2A A;  4CDG A;  5DQH A;  1UEV A;  3ALR A;  3RJK A;  3K1R B;  2KV2 A;  4X4P A;  5IIN A;  3SZ2 A;  4FH3 A;  5AKE A;  1BPZ A;  3F5E A;  3Q8Q B;  4P0P A;  2QAR A;  2EWR A;  2GWS A;  1XU4 A;  2KD1 A;  4QZ9 A;  1KRP A;  1ZQB A;  4WC2 A;  4F5R A;  4UB2 A;  1D8Y A;  1O03 A;  1RM6 C;  3M8S A;  3RBD A;  2VJ4 A;  3R9K A;  1ZQS A;  3N28 A;  4C8L A;  2F1I A;  3WU2 U;  2BQ3 A;  1LKY B;  1KW4 A;  5EWG A;  4QWC A;  3BS7 A;  4O3O A;  2B0C A;  2KOB A;  2KZM A;  2HBJ A;  3TFR A;  3QU4 A;  5T14 A;  7ICT A;  5CEH A;  5KFC A;  2HCF A;  3C29 A;  5KFO A;  1TAQ A;  3PZP A;  2YB1 A;  5ALW A;  1OUQ A;  4M6W A;  1XSN A;  2VA8 A;  2IOH A;  2EZX A;  4QW9 A;  4NXU A;  3RJI A;  2I9G A;  2ZJ5 A;  2D8C A;  2KKP A;  4KB6 A;  4KMU A;  1QSL A;  1CRX A;  3BZK A;  1QSS A;  3B9J A;  1ZQO A;  4R8U B;  7ICJ A;  4KX5 A;  1N60 A;  4TQS A;  8ICL A;  3RB0 A;  4YP3 A;  2ODG A;  2PFN A;  2PI4 A;  5IIM A;  4NM2 A;  3GFK B;  3D6J A;  5D46 A;  5KAF U;  4NJ8 A;  5EWF A;  1ZQW A;  5ALY A;  2PKE A;  3PVX A;  3SAH A;  2WAQ C;  2BBJ A;  2KHQ A;  2HHX A;  4IRC A;  2P6R A;  2XY5 A;  4UB6 U;  4JUZ A;  2OYY A;  5B3Q A;  8ICZ A;  2DVI A;  5KFF A;  4O3N A;  4P0Q B;  4WC1 A;  1RDF A;  5DB9 A;  1L3U A;  2DWQ A;  4KX3 A;  3NVW A;  2LBO A;  3RB3 A;  2ALZ A;  5DDY A;  3RBE A;  2DF4 B;  2A19 A;  1L5U A;  9ICU A;  1B43 A;  5KFQ A;  4E7X A;  2G06 A;  1X42 A;  4M9N A;  8ICU A;  2ZXH A;  2F8K A;  5AM2 A;  4Z6C A;  3PW4 A;  1BVS A;  4I2C A;  4K9A A;  3V7J A;  9ICF A;  4WQL A;  2RHF A;  4DOA A;  2KIC A;  4O67 A;  2KG5 A;  3F5A A;  1L7N A;  1JMS A;  1SB3 C;  2BR0 A;  1JI7 A;  3F53 A;  1NJZ A;  2ZH3 A;  3KZI U;  5KFK A;  4EEB A;  2BQU A;  3KHL A;  1Z1V A;  5AK5 A;  1S0M A;  2E3T A;  3C5G A;  4UB1 A;  2MRL A;  5ALG A;  3PW2 A;  4Y2U A;  1MIW A;  4RPY A;  2FPL A;  4O3R A;  2W7O A;  4RPZ A;  1ZQI A;  2HDO A;  1TFR A;  3PW7 A;  1WWU A;  3H8M A;  4O3P A;  5DED A;  2JR5 A;  2AGQ A;  8ICV A;  2W9A A;  3ZD8 A;  3AMZ A;  4ED6 A;  2NRT A;  2BZF A;  1TAM A;  4ECV A;  1VJ7 A;  1X9M A;  4YXM A;  2I1Q A;  5CR0 A;  3EYZ A;  3N4M B;  3KTQ A;  4FZL A;  2NV3 A;  3H0L B;  2ZH9 A;  1BPB A;  1A77 A;  2ZH7 A;  5AM1 A;  2DKZ A;  3BQ2 A;  4F4W A;  2KTQ A;  2D6F C;  1V4A A;  7ICQ A;  3QUB A;  5TIS U;  5DB8 A;  5ALN A;  1UEU A;  2JEG A;  2B21 A;  3JPR A;  3EPI A;  4RQ7 A;  4B9V A;  2FLN A;  3SMV A;  2F8L A;  4P4M A;  4NLN A;  1L7O A;  5KFM A;  5B5E U;  5B3P A;  2BCU A;  4EEY A;  8ICS A;  4F5Q A;  9ICQ A;  2G5H B;  2AHO B;  8ICP A;  2YMP A;  3H39 A;  3OVS A;  2VA2 A;  1K5O A;  1GO3 F;  4I2G A;  1Z1B A;  5AIC A;  3RAX A;  1UHU A;  1J2N A;  1S0N A;  5J0U A;  1F44 A;  4UB5 A;  1L3S A;  4GXI A;  8ICG A;  4K97 A;  1KTQ A;  1TVA A;  4AT7 A;  4M9J A;  1V9P A;  2FLL A;  8ICQ A;  2JH1 A;  5EOZ A;  4E80 A;  1ZOL A;  5KAI U;  4YR3 A;  4F4Y A;  3RR8 A;  3IG8 A;  1WG8 A;  4RWN A;  2RRD A;  4QWE A;  2R8J A;  5AI9 A;  2HHQ A;  4OJO A;  4KN7 A;  2PFO A;  4LT6 A;  3CNH A;  3C21 A;  4Q8E A;  2RLT A;  2E8N A;  4DF8 A;  1CUK A;  3UQ2 A;  4PGY A;  1ARO P;  2NYV A;  4B9L A;  4RUA A;  3TAR A;  5C5J A;  4ELV A;  1Q8K A;  2Y0S F;  3AN1 A;  2KSO B;  5ALQ A;  3ZD9 A;  3PST A;  4UQG A;  3N7R C;  5KT3 A;  4DQR A;  4NLC A;  4C80 A;  4RQ6 A;  2CRX A;  5ALE A;  2HI0 A;  2H3Q A;  1OU5 A;  5AI6 A;  4FS2 A;  4DL5 A;  2XC9 A;  9ICH A;  3WK8 A;  4ECT A;  4WBZ A;  4LEW A;  3H8W A;  3UPS A;  4EV6 A;  3Q8S B;  2B4V A;  1XC9 A;  2W9C B;  2IOF A;  1ZQK A;  4TQR A;  1EXN A;  1XO0 A;  5JTG A;  1PUZ A;  4DFM A;  4I27 A;  3H7I A;  4BJQ A;  2EAM A;  5TZV A;  1KBU A;  8ICC A;  3JYY A;  2AGO A;  2NRK A;  5CHG A;  2V9W A;  3E0F A;  2HHS A;  4ELU A;  4CGZ A;  3PX4 A;  1MSW D;  4WC4 A;  3QU7 A;  2HN2 A;  2A1J A;  5ALR A;  4NM1 A;  3EF2 A;  2E1F A;  4F5O A;  3ETR A;  2LKY A;  3KHH A;  2Y9T A;  1HIW A;  2LMR A;  3GV8 B;  3ISB A;  1S97 A;  5IIO A;  4J9O A;  3ZDC A;  2OM6 A;  5GTH U;  5ALH A;  2H3I A;  2HBM A;  4Y2R A;  7ICV A;  3AUO A;  4R64 A;  3V6H A;  8ICK A;  1U48 A;  4NKT A;  1A0P A;  1ECW A;  1ZD3 A;  4O9M A;  5J2D A;  4F91 B;  4MFA A;  4J03 A;  4J9L A;  3D2Q A;  4JV1 A;  4I28 A;  2EAN A;  5HR6 A;  3DV9 A;  5KG5 A;  3SI8 A;  2B56 A;  3NKU A;  1S10 A;  3WFR E;  3NRZ A;  5L1L A;  1F0M A;  2BCS A;  1L3T A;  2IUB A;  4MF8 A;  3TQ1 A;  5EE1 A;  1NJX A;  1N56 A;  1QQ5 A;  4RQ8 A;  4Q44 A;  3ISD A;  4RQ5 A;  1KFD A;  5J0W A;  1L6N A;  3HW8 A;  1XSP A;  2AH5 A;  3VC8 A;  3CW2 C;  4UB3 A;  2Y0S C;  2ZTE A;  4EX6 A;  2NRX A;  2AXT U;  2OHF A;  4UAY A;  4EBD A;  4DSI A;  4YD1 A;  4UAR A;  3UXN A;  9ICT A;  4A8E A;  3NVY A;  2K60 A;  4BXO B;  1M6Y A;  2HMX A;  4C8N A;  1SWW A;  1MA7 A;  2OWO A;  2VAN A;  4X5V A;  4OJ5 A;  4XUS A;  2JEI A;  4BGD A;  2BE3 A;  4QIW F;  1U45 A;  3RFA A;  2EH9 A;  2ZJ8 A;  3RH6 A;  1XSL A;  3BS5 A;  4EED A;  4NL9 C;  4CRX A;  5DG9 A;  3G6Y A;  4RWQ A;  4FHW A;  5KFA A;  3H0R B;  3QUC A;  4FHX A;  5K4L A;  3WKC A;  5HRD A;  1ZD2 P;  4P0P B;  1JQR A;  1YZ6 A;  5AI8 A;  4ECY A;  3C18 A;  3AEV A;  3SV4 A;  4OO1 J;  5KFX A;  3J81 j;  3HJ1 A;  1C7Y A;  4XJE A;  1JAL A;  5IIJ A;  3TI0 A;  4QZC A;  3LK9 A;  1IXR A;  4UBC A;  1BPD A;  2HOI A;  3RJJ A;  3MR5 A;  2PXI A;  1NOM A;  2GOL A;  3THV A;  1J2M A;  3JCF A;  2ZXI A;  3MGV A;  4ECR A;  1J97 A;  4R65 A;  1ZQY A;  3ZDD A;  1A6S A;  1DXS A;  4FBT A;  3FAH A;  3FM9 A;  4B9U A;  2DR9 A;  1MQ3 A;  1RPL A;  3KD3 A;  5HP4 A;  9ICS A;  7ICP A;  1BGX T;  2OH2 A;  7ICL A;  2KJ9 A;  1ZD4 A;  2EAO A;  3RB6 A;  2KP7 A;  1MIY A;  4QZD A;  4OD0 A;  4C4T A;  5L1I A;  2C22 A;  1R89 A;  4LZD A;  2W3R A;  1LV5 A;  4J9R A;  3NVV A;  5J0X A;  1ZQC A;  3QZ7 A;  2NO5 A;  5AK4 A;  2BCV A;  2BDU A;  3T5K A;  1SKR A;  4NXT A;  3DDH A;  3V7K A;  2W3S A;  2BCR A;  1TFW A;  4R63 A;  2WF8 A;  4G3I A;  4OCZ A;  4PHD A;  3ZDB A;  2HVI A;  4BX9 C;  3OWG A;  4TUS A;  3BQT A;  4JB3 A;  2H5X A;  3SAG A;  1K1Q A;  1SV0 A;  1Q78 A;  1KFS A;  4IG8 A;  1VJ5 A;  2WAQ F;  2K4I A;  2G0A A;  1UA0 A;  4DSL A;  2W8K A;  3C1Y A;  3MGI A;  3OSP A;  2BPC A;  4EEL A;  5AKK A;  2VIX A;  4IQU A;  2R8H A;  1NKB A;  3QXG A;  5AK6 A;  4YD2 A;  1MC8 A;  1B0X A;  2Q4T A;  1Y88 A;  4GLX A;  2YX8 A;  2HHV A;  4B9N A;  3QUT A;  5AKX A;  3OGU A;  2ZIW B;  4OAF A;  4CNQ A;  4C8K A;  3L4P A;  3RH5 A;  8ICA A;  3RAQ A;  4M0A A;  1D8L A;  4Y2S A;  2ZTC A;  4RT3 A;  1NK9 A;  1UCV A;  4QW8 A;  4NXZ A;  3H4B A;  2Q0Z X;  3OJU A;  3PR5 B;  2DPJ A;  3KOO A;  1V38 A;  5J2G A;  1WCN A;  3GIK A;  4WOY A;  2CN1 A;  1BPX A;  1L7M A;  4M9H A;  3FC4 A;  3CP8 A;  1UA1 A;  1ZQM A;  1NKE A;  2YMQ A;  4FHV A;  4IRD A;  4ATB B;  5KFJ A;  3M8R A;  4NWI A;  1WOT A;  5D62 A;  2EDU A;  2DFL A;  3PHZ A;  3OUY A;  3OVA A;  4EP7 A;  4I2H A;  3BQ1 A;  9ICI A;  1TAU A;  3ZI4 A;  3E58 A;  2FMP A;  1QCK A;  4LVS A;  4N7R A;  8ICE A;  1JXL A;  1V85 A;  3C2K A;  4AT8 B;  5KFY A;  2G08 A;  4I2J A;  3TFS A;  4DFD A;  5KG4 A;  2AU0 A;  4O5E A;  3D2S A;  2I5H A;  2LYH A;  8ICM A;  2H3F A;  2QLT A;  2ZJA A;  2MU2 A;  2ZH2 A;  3WK6 A;  4CF4 A;  4QZI A;  2PI5 A;  1ZD5 A;  1PVQ A;  4O0I A;  5JU5 A;  4UAU A;  2KHV A;  1RYR A;  1IG6 A;  5ALM A;  3PSP A;  4OAI Z;  1ZYQ A;  3PY8 A;  4F4K A;  4IR1 A;  5J8Y C;  1UT8 A;  4RQM A;  4RQ3 A;  2ZIX A;  1S8O A;  3SV3 A;  5HRH A;  4I2A A;  3H0M B;  1P7D A;  1QSY A;  1F5S A;  4RT2 A;  2E5S A;  2ZHB A;  1VLB A;  2ZIV B;  4M9G A;  2LYA A;  2DRA A;  8ICH A;  5BPC A;  1SKS A;  5FP0 A;  2F77 X;  3A0B U;  2KZ3 A;  3AL0 B;  4UW9 A;  2JZB B;  1B4F A;  1ZQ1 C;  2F1H A;  1SL0 A;  4QNL A;  2IHN A;  2ZHA A;  4F5P A;  3F2C A;  5L9X A;  4KLT A;  3C23 A;  3ER8 C;  2MUT A;  4NV0 A;  2F44 A;  5AI4 A;  3G6X A;  3HPO A;  3RRH A;  1IM4 A;  4BDP A;  5KG7 A;  2XVT A;  5AKZ A;  1BPY A;  3IP4 B;  4DSE A;  1ZRM A;  1NK6 A;  4K96 A;  1S0O A;  5D61 A;  4NLZ A;  2XIC A;  1SWV A;  2WF9 A;  5DB6 A;  3EZ5 A;  9ICE A;  1RYU A;  2WF6 A;  2ZIU A;  2R18 A;  1XWL A;  4Q8F A;  1L7P A;  4P4P A;  5DBA A;  1DGS A;  2V4Q A;  2AQ0 A;  1SL1 A;  4FZM A;  1SL2 A;  4DL6 A;  3PX6 A;  1WUD A;  2A3V A;  4WCW A;  4C0Z A;  2QB0 B;  3PW5 A;  1XNS A;  1Z00 B;  4ELT A;  2M2W A;  4X4T A;  3SD7 A;  4AT9 B;  4EGW A;  1VDV A;  3ED5 A;  4UBB A;  3TAC B;  3JPP A;  2HN1 A;  1OXJ A;  5KG2 A;  1QTM A;  3LDA A;  3WFQ E;  1Z3E B;  2KVS A;  5J2F A;  1LKY A;  5G5H A;  4I0U A;  1H38 A;  1ZRN A;  3AQL A;  1RG6 A;  5J2C A;  3IM1 A;  4KMO B;  4KN4 A;  2ES6 A;  3DEE A;  4J9Q A;  3M6Z A;  5III A;  2HHP A;  4RU9 A;  1T7P A;  4EYI B;  5CFS A;  1L8O A;  1U9L A;  1AQ6 A;  3KKA A;  1MIV A;  2VA3 A;  2DR5 A;  4WC6 A;  1SXD A;  1NI3 A;  2KIW A;  2P6U A;  5HML A;  9ICB A;  1N48 A;  2K4P A;  4F5N A;  3JPQ A;  2RDJ A;  2Y1J A;  3B0X A;  3AQN A;  1X6J A;  2VKQ A;  4IQV A;  5KL1 B;  3L3F X;  4QZ8 A;  4B6J A;  2PFQ A;  4IS7 A;  5ALK A;  4EX7 A;  1ZET A;  2B51 A;  7ICN A;  1C20 A;  4U7C A;  4EEK A;  3K1Z A;  4RQ0 A;  2M2T A;  4O3M A;  3PMN A;  5KTQ A;  2KN7 A;  2IHO A;  3BQ7 A;  4P0Q A;  8ICW A;  1FFV A;  2G07 A;  4LJX A;  4BWM A;  3WKE A;  1N2X A;  3IV6 A;  4X4O A;  1X40 A;  2K8C B;  4J9M A;  1N63 A;  3H37 A;  2IHM A;  9ICL A;  1JRP A;  3ISC A;  2F1J A;  4BUG A;  4NLK A;  4DLG A;  8ICO A;  1PK3 A;  4XQ7 A;  2YY6 A;  2W9M A;  4YVZ A;  4K9B A;  1L8L A;  3BS5 B;  5KG3 A;  4EZ6 A;  2F76 X;  4FH5 A;  3BZC A;  1R8C A;  1X9S A;  2ZH8 A;  4DFP A;  2O5A A;  3GZF A;  4KLE A;  5KFH A;  3QX7 A;  5AI5 A;  1NKC A;  1HEK A;  3QE9 Y;  4EBK A;  8ICR A;  3HIL A;  4JMU A;  4ED7 A;  1ED1 A;  2XID A;  5AK3 A;  2HHT A;  2GA9 D;  1PK1 B;  1U4B A;  5ALJ A;  1SV4 A;  4C8M A;  2DGZ A;  4C4S A;  3TAD A;  3T5J A;  5D4B A;  2B6G A;  2FI1 A;  3Q8K A;  2JEF A;  3AQE A;  4YCX A;  2JV3 A;  2MA1 A;  1PZN A;  4F71 A;  2NRV A;  4QWA A;  2C2R A;  4OAG A;  1UPH A;  1JXE A;  2KJ5 A;  5J2J A;  1KN5 A;  5EE0 A;  2LPE A;  5KT2 A;  4YG2 A;  3Q8L A;  4DQQ A;  2RDI A;  3WK5 A;  3SEI A;  3CYM A;  2BBH A;  2DRB A;  3FYH A;  2W03 A;  2FPK A;  5AM4 A;  4P4O A;  5CRX A;  3M1Y A;  1XO1 A;  4PHE A;  7ICI A;  4UAT A;  2E8O A;  4QWB A;  1QLN A;  2XY6 A;  4J9N A;  4FS1 A;  1FEZ A;  1SXE A;  4KLJ A;  5DQI A;  3F2B A;  2IOF K;  4FO1 A;  4JLZ A;  2WF5 A;  4F93 B;  5L1M A;  1QQ6 A;  1X9X A;  4BWJ A;  1RZT A;  4DWI A;  5DEC A;  1YT3 A;  4O3Q A;  4DFJ A;  3AQF A;  3K4G A;  3OTQ A;  3ER9 B;  1KKX A;  4GC6 A;  3U26 A;  3RRG A;  2ZUC A;  4QZB A;  5DGA A;  4X4Q A;  1VFG A;  2OEH A;  2KKV A;  1T4G A;  3PW0 A;  4QZF A;  3G6V A;  5DLF A;  7ICK A;  5ALI A;  1MN8 A;  7ICO A;  3M7D A;  1ZJN A;  3NAS A;  8ICB A;  1LB2 B;  5J2I A;  2K89 A;  5AKY A;  5CP2 A;  2JH7 A;  3HJE A;  1ZQH A;  3GDX A;  5DG8 A;  4ECQ A;  4IQT A;  2EZY A;  1PX5 A;  1FA0 A;  5AKH A;  3S6J A;  2E8M A;  4I29 A;  2Q66 A;  5AKJ A;  1UT5 A;  5AM3 A;  1S76 D;  4C7Y A;  3JPO A;  3UMB A;  3N7P D;  4GFJ A;  4YMM A;  1TKD A;  4JLX A;  4F2S A;  2FPM A;  1BPE A;  2P66 A;  4CCH A;  4GC7 A;  1JN3 A;  4ED1 A;  3RTV A;  2WTF A;  4RQ4 A;  3Q8R B;  2UVU A;  3BQ0 A;  2KSO A;  3LYS A;  2LM1 A;  1N61 A;  5H2F U;  2QAR B;  1Q79 A;  3ERC C;  2EZZ A;  4Q43 A;  2IMW P;  2AJQ A;  1U47 A;  2WHE A;  3ZDE A;  2DL0 A;  4YXJ A;  3L5K A;  3RB4 A;  2IBK A;  2L5Y A;  2YMM A;  2UVW A;  3B0Y A;  2R8G A;  2W9C A;  2KVC A;  4DSK A;  5CHE A;  3SYZ A;  1DK3 A;  1BNO A;  5GTI U;  5KFE A;  4LEV A;  1U49 A;  4X4S A;  3NVZ A;  5AM0 A;  3MCR A;  1NJY A;  4M6W B;  4DF4 A;  4OJ6 A;  4C4R A;  2M9N A;  4K4G A;  5DKW A;  3KHR A;  4OAH A;  5J29 A;  4NLG A;  1SKW A;  2G5I B;  4PL1 A;  3WFP A;  4NLB A;  1WYG A;  4GXK A;  1T3Q A;  3GQC A;  4WC5 A;  2WB1 F;  2HW3 A;  1QQ7 A;  4XRH A;  4Y2V A;  3QU2 A;  1D8B A;  3EW9 A;  2W9B A;  4PZN A;  4Z6E A;  3N7S C;  2Y1I A;  9ICC A;  4CF5 A;  1RYS A;  9ICX A;  1S9F A;  2HSZ A;  3WKA A;  4KTQ A;  1PVP A;  3QU5 A;  2ZIX B;  4QZG A;  1FIQ A;  3UQ0 A;  3PV8 A;  4PH5 A;  5J0P A;  2DKX A;  1R8A A;  2FMS A;  3HRD D;  5J2H A;  1KQQ A;  3PSF A;  4DFK A;  4M2Y A;  2NRZ A;  1TK5 A;  1FO4 A;  2K8A A;  4GIB A;  1A76 A;  3AU2 A;  3Q8M A;  1KLN A;  1N5X A;  2GAF D;  3QEA Z;  3HKZ F;  3RR7 A;  4DQP A;  2QB1 A;  3C28 A;  2XI9 A;  4Y2X A;  4RZR A;  1URJ A;  3NRW A;  8ICI A;  2ASJ A;  3JZ0 A;  4IQW A;  1JAJ A;  1KEJ A;  1ZQN A;  1UET A;  3C66 A;  4RUC A;  4NXX A;  4DCC A;  3CRX A;  4YQW A;  2H3V A;  4X4U A;  2JHD A;  5ALS A;  1Q46 A;  5AI0 A;  4M9L A;  4YFK A;  5KNI A;  2A1A A;  9ICJ A;  4DO9 A;  4MKP A;  2DR8 A;  3ICX A;  5CFU A;  4NXV A;  3OPX A;  4Z6F A;  2FDR A;  3HT3 A;  4EBE A;  3QNM A;  5BOL A;  2R8I A;  4LZG A;  3RJG A;  5ALV A;  2HBK A;  2RP5 A;  4BXO A;  2W7P A;  3F2D A;  3CK6 A;  2KE7 A;  2DBY A;  5F9N A;  2PFP A;  5F9L A;  5KFP A;  3L9D A;  5J0O A;  1UQV A;  4C8O A;  3OJS A;  4PGQ A;  1DOQ A;  2ZH4 A;  3C1Z A;  3HJ4 A;  5ALO A;  3UXO A;  1ZQG A;  2G09 A;  5HC9 A;  4ED0 A;  4AYB F;  5B66 U;  3TAP A;  4YR0 A;  8ICX A;  1NK7 A;  1ZQT A;  2WB1 C;  4HYK A;  2R8K A;  2FLP A;  1JUD A;  7ICE A;  7ICH A;  5HRB A;  2E1E A;  4K99 A;  2ESE A;  5HNK A;  5HRI A;  9ICM A;  4TUR A;  5HRG A;  3WK7 A;  3MR2 A;  8ICJ A;  5KFI A;  3H8J A;  3MFI A;  2AGP A;  2J6T A;  3ORY A;  1O08 A;  9ICW A;  3PX0 A;  3EUB 2;  4FZN A;  3NGD A;  3NYB A;  2KIV A;  3M6K A;  5HHI A;  2HOF A;  5KFD A;  5HRF A;  3LWL A;  3UXP A;  3HKZ C;  4DEZ A;  5AKG A;  4B9T A;  2YQE A;  2MSN A;  1RQL A;  5AKI A;  7ICS A;  2BHN A;  3JPT A;  3SAF A;  3GIM A;  3VCB A;  4FO6 A;  2KNJ A;  2IA6 A;  5E79 U;  2ZH1 A;  4JV2 A;  4JK1 A;  4MFC A;  3MDC A;  1ZQE A;  5JRT A;  1N62 A;  2I6X A;  4DSJ A;  2JGA A;  4XQ8 A;  3QYP A;  1XS9 D;  5L1J A;  4AT7 B;  5G5G A;  5KFG A;  2M2V A;  1SZH A;  2BKE A;  2XCA A;  7ICR A;  2XGQ A;  2EQY A;  4Y2J A;  5KFS A;  1PVR A;  4X4V A;  1DK2 A;  2BGW A;  2O1P A;  4PJ0 U;  3EPG A;  4DSF A;  3KZX A;  3SQI A;  4YR2 A;  2N1R A;  5KFN A;  3KHG A;  5AHX A;  3AQM A;  3BJY A;  5IIK A;  3AU6 A;  2GLE A;  4WH5 A;  2C28 A;  1ZQA A;  3IHQ B;  4AYB C;  5KFL A;  4FFD A;  2PMZ F;  4X4R A;  1SGG A;  2ZH5 A;  2KFZ A;  3MC1 A;  1HJP A;  4RQN A;  2BCQ A;  5HMM A;  3RJE A;  3MBY A;  3LWM A;  3WFS C;  4DL2 A;  3AQK A;  4P2H A;  2WF7 A;  5AIB A;  3NVO A;  3MDA A;  3WK4 A;  3C5F A;  1X66 A;  1QH9 A;  3T5L A;  4ZH4 A;  5HRK A;  2ZIW A;  3SR6 A;  2AQ4 A;  4WC7 A;  2YN4 A;  4LEY A;  3K75 D;  5AKL A;  4KLM A;  4GXJ A;  1SZP A;  3NS1 A;  1YLQ A;  1TK0 A;  4RNM A;  3IRU A;  2LHT A;  2A1J B;  4WJ3 B;  5HRL A;  3WKD A;  5CFT A;  5EWE A;  3JPN A;  5CWR A;  4KM5 A;  1K1S A;  2UVR A;  1ZQR A;  3HP6 A;  2YML A;  4UAZ A;  4ATB A;  5L1K A;  9ICG A;  5EE3 A;  3IG5 A;  3H38 A;  2WFA A;  3N97 B;  4F3O A;  4YMN A;  4KLF A;  4K8V A;  4U6P A;  1T8E A;  2F2A B;  5HR7 A;  4NL9 A;  4IC9 A;  4I2B A;  4ZOH C;  4CF3 A;  1L3V A;  2M0N A;  4M04 A;  1HUZ A;  5KG1 A;  4R66 A;  4DOC A;  2W54 A;  2K4E A;  2W55 A;  2XY7 A;  8ICY A;  4AT8 A;  3KFU F;  2Y9U A;  4XA5 A;  5J0Q A;  4QZE A;  5DLG A;  4UB8 U;  1JX4 A;  3HX0 A;  1KNY A;  5HHH A;  5J2K A;  4ED3 A;  4O68 A;  2MAX A;  3TKA A;  4US8 A;  4R8U A;  2YB4 A;  3GIJ A;  4JWM A;  2KEY A;  4UAS A;  4EZ9 A;  4DOB A;  1SV0 C;  4IRK A;  4EYH B;  3A0H U;  4DQS A;  3UM9 A;  2LYB A;  3QUQ A;  1KDH A;  4K4I A;  4RQ1 A;  4C7Z A;  2JMG A;  4ECS A;  3IDW A;  3C2L A;  3H8S A;  2PMZ C;  4FBU A;  4PL2 A;  1ZXI A;  5DB7 A;  4F4Z A;  3GU3 A;  5CA7 A;  4KLO A;  3I28 A;  5KL8 B;  1D9D A;  4Q45 A;  1NK8 A;  4JWN A;  5DDM A;  2ZIV A;  2NRW A;  2W11 A;  4Z6D A;  2C2D A;  9ICA A;  7ICG A;  1ZQF A;  1CEZ A;  1SIJ A;  3V6K A;  3SEN A;  1X2I A;  3GIL A;  3PO4 A;  2W43 A;  3UMC A;  2LI6 A;  3T3F A;  3BDP A;  3O0F A;  1NJW A;  2JZB A;  1NK0 A;  4KLQ A;  2DUY A;  2RFF A;  4HX0 A;  2BQR A;  2DPI A;  2UVV A;  2JXJ A;  3PO5 A;  4O5K A;  2DR7 A;  1IV8 A;  2YTU A;  5ALP A;  2KK0 A;  3MAB A;  3UPQ A;  2Z7J A;  5KG6 A;  2EAP A;  5DBB A;  5A0L A;  1ZQV A;  4KLS A;  4ACO A;  4G9B A;  5F2V O;  2M2U A;  4O5C A;  4ED2 A;  2ISO A;  7ICM A;  1COO A;  3Q8P B;  3WKB A;  4I2D A;  2ZG6 A;  2XO7 A;  4FE3 A;  3KBB A;  1KSP A;  2HVH A;  4DQI A;  4QZH A;  2CXY A;  2E8P A;  3NUQ A;  2K4H A;  4ECW A;  1S5L U;  5ALT A;  7ICU A;  4NY8 A;  5CB1 A;  5J0T A;  9ICP A;  1COK A;  2GH1 A;  5F3X B;  4UAW A;  3HWT A;  4TUP A;  3JPS A;  1MQ2 A;  3T79 A;  3WFO A;  3H3A A;  2D3D A;  2J6S A;  5J0R A;  4F4X A;  2QKQ A;  4QZA A;  2XGP A;  3QU9 A;  4S3N A;  4Y2Q A;  2QB0 A;  3OV7 A;  4MEX A;  3NWI A;  1X9W A;  1B22 A;  3M9N B;  2HBL A;  1Z00 A;  4RQ2 A;  4WBY A;  3E2E A;  2ID1 A;  4F2R A;  5KFW A;  4AT9 A;  3GII A;  4ICA A;  5J2E A;  2W9B B;  8ICF A;  5KFZ A;  3PSI A;  4E8F A;  1S77 D;  1JIH A;  1ZQZ A;  2BPG A;  4F92 B;  1FFU A;  2K8B B;  3GV5 B;  1NNL A;  4NXW A;  1JRO A;  1D9F A; 
#chains in the Genus database with same CATH homology
 2BCU A;  4EEY A;  1RYR A;  5KFU A;  4F5Q A;  4KTQ A;  8ICS A;  9ICQ A;  3GV7 B;  1ZYQ A;  3PY8 A;  4F4K A;  4QZG A;  4UD5 A;  5J2B A;  3UQ0 A;  3PV8 A;  4IR1 A;  8ICP A;  1MIW A;  4EBC A;  4KLD A;  4PH5 A;  5J0P A;  5F2V O;  1UT8 A;  1R8A A;  3H39 A;  5KT5 A;  4RQ3 A;  2FMS A;  3OVS A;  2VA2 A;  3OSN A;  3SV3 A;  5J2H A;  4I2G A;  5HRH A;  4I2A A;  3MR6 A;  3PR4 A;  1ZQQ A;  4DFK A;  3RAX A;  2XCP A;  1S0N A;  2DPJ A;  2NRZ A;  1QSY A;  4M2Y A;  1TK5 A;  4RWP A;  5J0U A;  4RT2 A;  1NO5 A;  2ZHB A;  1A76 A;  3AU2 A;  4M9G A;  4UB5 A;  2DRA A;  8ICH A;  5BPC A;  3Q8M A;  1KLN A;  1L3S A;  1ZQU A;  4GXI A;  8ICG A;  3QEA Z;  4DQP A;  3RR7 A;  1SKS A;  1KTQ A;  1TVA A;  4KLL A;  1S0V A;  4AT7 A;  4M9J A;  1V9P A;  2FLL A;  4RZR A;  2KZ3 A;  1ZJM A;  8ICQ A;  9ICR A;  5EOZ A;  8ICI A;  4E80 A;  2JZB B;  2ASJ A;  3JZ0 A;  4YR3 A;  4F4Y A;  4DLE A;  4IQW A;  3RR8 A;  1JAJ A;  1KEJ A;  3ETL A;  4ED8 A;  1ZQN A;  2F1H A;  1UET A;  4RUC A;  3C66 A;  4RWN A;  1SL0 A;  5KT6 A;  4QWE A;  1T3N A;  1TK8 A;  4YQW A;  2IHN A;  2R8J A;  2ZHA A;  4X4U A;  4F5P A;  5BOM A;  5L9X A;  4KLT A;  4PPX A;  2HHQ A;  4PGX A;  3C23 A;  4M9L A;  2MUT A;  4YFK A;  4KN7 A;  2PFO A;  4X4N A;  4LT6 A;  4DS5 A;  3G6X A;  1NK4 A;  9ICO A;  1ZQX A;  3C21 A;  3HPO A;  9ICJ A;  4F50 A;  4DO9 A;  9ICN A;  4Q8E A;  3HIY A;  2DR8 A;  3RRH A;  5HR9 A;  4DF8 A;  1ZQL A;  1IM4 A;  4BDP A;  4J9S A;  1CUK A;  5KG7 A;  3OHB A;  4B9M A;  3UQ2 A;  4Z6F A;  4PGY A;  1BPY A;  3HT3 A;  1ARO P;  3OHA A;  3H4D A;  5BOL A;  4EBE A;  4DS4 A;  2R8I A;  4RUA A;  5KFR A;  3RJG A;  4B9L A;  4LZG A;  4DSE A;  3T5H A;  5DG7 A;  3TAR A;  1S77 D;  5C5J A;  4ELV A;  1NK6 A;  4BXO A;  1NK5 A;  3ZD9 A;  4J9K A;  1S0O A;  4I2E A;  4M5D A;  4UQG A;  3H40 A;  2ISP A;  4NLZ A;  4KIT B;  5KT3 A;  2W8L A;  4DQR A;  4K4H A;  4RQ6 A;  1ZQD A;  5DQG A;  2HHU A;  5F9N A;  2PFP A;  5F9L A;  5DB6 A;  5KFP A;  1OU5 A;  3L9D A;  4WC3 A;  5J0O A;  4FS2 A;  4DL5 A;  2XC9 A;  3OJS A;  4ECU A;  4PGQ A;  4C8O A;  1DOQ A;  3EWA A;  3M9M B;  2KFN A;  9ICH A;  3V7L A;  2ZH4 A;  3C1Z A;  3EZ5 A;  4ECT A;  9ICE A;  3HJ4 A;  4WBZ A;  3UXO A;  2ZUB A;  1ZQG A;  3H8W A;  5KT7 A;  4UD4 A;  3UPS A;  3OUY B;  4ED0 A;  5HC9 A;  4IR9 A;  1XWL A;  3ZDA A;  3Q8S B;  1XC9 A;  4Q8F A;  3TAP A;  2W9C B;  1BNP A;  4YR0 A;  8ICX A;  4P4P A;  5DBA A;  1ZQK A;  1DGS A;  1EXN A;  4TQR A;  1HUO A;  1NK7 A;  4DFM A;  5JUM A;  4X0A A;  2V4Q A;  1ZQJ A;  1ZQT A;  2AQ0 A;  3MR3 A;  4I27 A;  3H7I A;  3V6J A;  1SL1 A;  4HYK A;  1SL2 A;  4DL6 A;  5TZV A;  3PX6 A;  4KLI A;  2R8K A;  2FLP A;  2AGO A;  4KLU A;  8ICC A;  3JYY A;  2NRK A;  4ECZ A;  3TAQ A;  5CHG A;  2V9W A;  4WCW A;  2HHS A;  4ELU A;  3PW5 A;  4O3S A;  7ICE A;  7ICH A;  5HRB A;  3QEB Z;  5DBC A;  3PX4 A;  1MSW D;  4KLG A;  4WC4 A;  1Z00 B;  5HNK A;  1NZP A;  5HRI A;  2A1J A;  4ELT A;  4NM1 A;  2M2W A;  2V4R A;  4X4T A;  9ICM A;  4WC0 A;  4AT9 B;  4TUR A;  5HRG A;  5DGB A;  4F5O A;  2BPF A;  1VFG A;  4I2I A;  4UBB A;  3RJF A;  3JPP A;  4RNO A;  2JEJ A;  5KG2 A;  3MR2 A;  3KHH A;  3LDA A;  1QTM A;  8ICJ A;  2ZUD A;  4KLH A;  5KFI A;  3GV8 B;  3H8J A;  3MFI A;  2AGP A;  1TV9 A;  3ISB A;  2J6T A;  1S97 A;  1Z3E B;  3TAN A;  3WFQ E;  3ORY A;  9ICW A;  5IIO A;  5KFT A;  3PNC A;  5J2F A;  4J9O A;  3PX0 A;  3ZDC A;  3V72 A;  1H38 A;  3AQL A;  7ICV A;  3NGD A;  3NYB A;  5HRE A;  5J2C A;  3IM1 A;  4KN4 A;  3AUO A;  4J9Q A;  4I2F A;  8ICT A;  5KG0 A;  5III A;  5HHI A;  3OVB A;  2HHP A;  4R64 A;  5KFD A;  4RU9 A;  3V6H A;  1U48 A;  1T7P A;  4EYI B;  8ICK A;  5HRF A;  3LWL A;  4NKT A;  4RWO A;  1U9L A;  5J2D A;  3UXP A;  4DEZ A;  4O9M A;  4DL3 A;  4F91 B;  5J0S A;  4MEY A;  4MFA A;  2VA3 A;  4B9T A;  1MIV A;  2DR5 A;  4QWD A;  2BHN A;  4J9L A;  9ICK A;  7ICS A;  3JPT A;  3RJH A;  4E0D A;  4WC6 A;  2P6U A;  3MGH A;  4PHP A;  3GIM A;  5HML A;  4FO6 A;  2ASL A;  4I28 A;  4JV1 A;  9ICB A;  4YMO A;  1N48 A;  2IA6 A;  5J0Y A;  4F5N A;  2ZH1 A;  5KG5 A;  3SI8 A;  3JPQ A;  4JV2 A;  2RDJ A;  4JK1 A;  3B0X A;  2Y1J A;  4MF2 A;  4MFC A;  3LQC B;  3MDC A;  1ZQE A;  2PBE A;  3AQN A;  1S10 A;  3WFR E;  5L1L A;  2BCS A;  1L3T A;  4IQV A;  4DSJ A;  9ICV A;  2J6U A;  4QZ8 A;  4MF8 A;  4XQ8 A;  4ECX A;  3MFH A;  2PFQ A;  1XS9 D;  4B9S A;  3TQ1 A;  5L1J A;  4AT7 B;  1NJX A;  1N56 A;  4RQ8 A;  5KFG A;  1ZET A;  4F8R A;  2M2V A;  7ICN A;  3RH4 A;  4Q44 A;  2BKE A;  3ISD A;  4RQ5 A;  1KFD A;  5J0W A;  2XCA A;  2C2E A;  2XGQ A;  7ICR A;  4RQ0 A;  2M2T A;  3HW8 A;  5KFS A;  1XSP A;  4EBJ A;  1WCL A;  4X0B A;  1TFY A;  4X4V A;  1DK2 A;  2BGW A;  2O1P A;  4UB3 A;  3PMN A;  4J9P A;  3EPG A;  2ZTE A;  5KTQ A;  4DSF A;  4UB4 A;  2KN7 A;  4YR2 A;  2MUT B;  4TUQ A;  4FHY A;  5KFN A;  3PML A;  1ZQP A;  2NRX A;  3M9O B;  2ZH3 A;  3KHG A;  2KZZ A;  4UAY A;  4EBD A;  4PHA A;  4YN4 A;  8ICW A;  1RXW A;  4DSI A;  4BWM A;  4FHP A;  3AQM A;  1KFT A;  3BJY A;  5IIK A;  5IIL A;  3AU6 A;  4X4O A;  2BDP A;  2ZTD A;  4YD1 A;  2ZH6 A;  3UXN A;  2C28 A;  2FMQ A;  2ASD A;  4RPX A;  1ZQA A;  4J9M A;  5D49 A;  9ICT A;  3IHQ B;  2UVW A;  2IHM A;  1RXV A;  9ICL A;  4BXO B;  3H37 A;  5KFL A;  4C8N A;  5KFV A;  4M47 A;  1R8B A;  3ISC A;  4NKU A;  5KT4 A;  2OWO A;  2VAN A;  2ATL A;  4X4R A;  8ICN A;  2ZH5 A;  2F1J A;  4X5V A;  3C2M A;  5CJ7 A;  4XUS A;  2KFZ A;  2JEI A;  1HJP A;  5KFB A;  2BCQ A;  7ICF A;  5HMM A;  3FDS A;  3NTU A;  4MFF A;  4DLG A;  4NLK A;  8ICO A;  3RJE A;  3MBY A;  4XQ7 A;  2HHW A;  4BGD A;  1F5A A;  2W9M A;  4YVZ A;  3LWM A;  4DL7 A;  4DL4 A;  2BE3 A;  3WFS C;  4DL2 A;  3AQK A;  4P2H A;  1U45 A;  5KG3 A;  3MDA A;  4EZ6 A;  4FH5 A;  4JV0 A;  1S0M A;  1R8C A;  2ZJ8 A;  3RH6 A;  3C5F A;  1X9S A;  3QZ8 A;  1XSL A;  4DFP A;  2ZH8 A;  2O5A A;  4RNN A;  5J2A A;  3T5L A;  4ZH4 A;  4KLE A;  5KFH A;  5DQH A;  5HRK A;  1UEV A;  1NKC A;  3RJK A;  3QE9 Y;  5DG9 A;  2AQ4 A;  8ICR A;  4EBK A;  3G6Y A;  4RWQ A;  4FHW A;  5KFA A;  4WC7 A;  4FHX A;  3K75 D;  5HRD A;  4ED7 A;  4KLM A;  4GXJ A;  1SZP A;  4X4P A;  1JQR A;  4ECY A;  1YLQ A;  2HHT A;  5IIN A;  3SZ2 A;  1TK0 A;  3C18 A;  1U4B A;  4RNM A;  4FH3 A;  3SV4 A;  2A1J B;  1BPZ A;  3Q8Q B;  5KFX A;  4C8M A;  5HRL A;  3T5J A;  5D4B A;  5EWE A;  3JPN A;  3HJ1 A;  2GWS A;  1XU4 A;  4QZ9 A;  1KRP A;  5CWR A;  1ZQB A;  1C7Y A;  4WC2 A;  1K1S A;  4UB2 A;  4F5R A;  2UVR A;  3Q8K A;  1ZQR A;  1D8Y A;  3HP6 A;  2JEF A;  4UAZ A;  3RBD A;  1ZQS A;  3M8S A;  4ATB A;  5L1K A;  9ICG A;  4YCX A;  5IIJ A;  3TI0 A;  4QZC A;  4C8L A;  1PZN A;  3H38 A;  2F1I A;  3LK9 A;  2BQ3 A;  3N97 B;  5EWG A;  1IXR A;  4QWC A;  2NRV A;  4YMN A;  4O3O A;  4QWA A;  4UBC A;  2C2R A;  1BPD A;  4F3O A;  4KLF A;  3RJJ A;  1JXE A;  2KZM A;  3MR5 A;  1NOM A;  2PXI A;  3TFR A;  1T8E A;  5J2J A;  4I2B A;  3THV A;  7ICT A;  5KT2 A;  4YG2 A;  5KFC A;  4ECR A;  4R65 A;  4DQQ A;  3Q8L A;  5KFO A;  1TAQ A;  1L3V A;  1ZQY A;  2RDI A;  3ZDD A;  4M04 A;  1HUZ A;  5KG1 A;  4R66 A;  4DOC A;  4FBT A;  2DRB A;  4M6W A;  1XSN A;  2VA8 A;  3FYH A;  2XY7 A;  2FPK A;  4P4O A;  4QW9 A;  8ICY A;  4AT8 A;  1XO1 A;  4PHE A;  3RJI A;  4B9U A;  1MQ3 A;  1RPL A;  7ICI A;  2DR9 A;  2I9G A;  2ZJ5 A;  4XA5 A;  5HP4 A;  5J0Q A;  4KMU A;  4QZE A;  5DLG A;  4QWB A;  1QSL A;  7ICP A;  1BGX T;  1JX4 A;  9ICS A;  3HX0 A;  1QSS A;  1QLN A;  1ZQO A;  7ICJ A;  4R8U B;  4J9N A;  4FS1 A;  2XY6 A;  7ICL A;  1KNY A;  5HHH A;  3RB6 A;  5DQI A;  5J2K A;  4KLJ A;  4TQS A;  4ED3 A;  2KP7 A;  2MAX A;  4QZD A;  1MIY A;  4R8U A;  4JWM A;  3GIJ A;  8ICL A;  5L1I A;  3RB0 A;  4EZ9 A;  4F93 B;  4YP3 A;  4DOB A;  4IRK A;  2C22 A;  1R89 A;  4BWJ A;  4EYH B;  4LZD A;  2PFN A;  2PI4 A;  1LV5 A;  5IIM A;  4NM2 A;  3GFK B;  4J9R A;  1RZT A;  4DWI A;  5DEC A;  5D46 A;  4DQS A;  4O3Q A;  5EWF A;  5J0X A;  1ZQW A;  4DFJ A;  3PVX A;  1KDH A;  1ZQC A;  4K4I A;  3K4G A;  3QZ7 A;  4GC6 A;  3RRG A;  2HHX A;  4RQ1 A;  2BCV A;  4IRC A;  2ZUC A;  4QZB A;  5DGA A;  4ECS A;  3T5K A;  2XY5 A;  1SKR A;  2P6R A;  4JUZ A;  3C2L A;  1T4G A;  3V7K A;  3PW0 A;  2BCR A;  1TFW A;  3H8S A;  4FBU A;  4QZF A;  3G6V A;  8ICZ A;  2DVI A;  4R63 A;  5DLF A;  4G3I A;  5KFF A;  5DB7 A;  4O3N A;  4PHD A;  4F4Z A;  3ZDB A;  7ICK A;  4WC1 A;  5CA7 A;  2HVI A;  4KLO A;  7ICO A;  5DB9 A;  1D9D A;  1L3U A;  4Q45 A;  1ZJN A;  1NK8 A;  4JWN A;  4TUS A;  3RB3 A;  5DDM A;  3BQT A;  5DDY A;  2ALZ A;  2NRW A;  8ICB A;  1LB2 B;  5J2I A;  3RBE A;  4Z6D A;  2C2D A;  9ICA A;  5CP2 A;  7ICG A;  2H5X A;  1ZQF A;  1CEZ A;  1L5U A;  1K1Q A;  9ICU A;  1Q78 A;  1B43 A;  3V6K A;  5KFQ A;  1ZQH A;  1KFS A;  4E7X A;  4IG8 A;  3GDX A;  1X2I A;  3GIL A;  3PO4 A;  5DG8 A;  1UA0 A;  4M9N A;  4ECQ A;  4DSL A;  8ICU A;  4IQT A;  2W8K A;  1PX5 A;  3T3F A;  3C1Y A;  1FA0 A;  3BDP A;  1NJW A;  3MGI A;  2JZB A;  3OSP A;  4Z6C A;  2BPC A;  1NK0 A;  3PW4 A;  1BVS A;  4IQU A;  4I2C A;  2R8H A;  3V7J A;  4KLQ A;  1NKB A;  2RFF A;  9ICF A;  2BQR A;  4YD2 A;  2DPI A;  2UVV A;  3PO5 A;  4O5K A;  1MC8 A;  2DR7 A;  4I29 A;  1Y88 A;  4GLX A;  2Q66 A;  1UT5 A;  1S76 D;  3MAB A;  4DOA A;  2HHV A;  3UPQ A;  4B9N A;  3JPO A;  3OGU A;  1JMS A;  5KG6 A;  5DBB A;  1ZQV A;  2BR0 A;  4C8K A;  4KLS A;  4YMM A;  3RH5 A;  8ICA A;  1TKD A;  3RAQ A;  4M0A A;  1NJZ A;  2FPM A;  1BPE A;  2P66 A;  4CCH A;  4F2S A;  2M2U A;  5KFK A;  1D8L A;  4ED2 A;  4GC7 A;  4O5C A;  1JN3 A;  4ED1 A;  2BQU A;  3KHL A;  2ISO A;  2ZTC A;  1COO A;  4RT3 A;  3Q8P B;  1NK9 A;  4QW8 A;  3H4B A;  4NXZ A;  3RTV A;  7ICM A;  4X4Q A;  2Q0Z X;  4I2D A;  3OJU A;  3PR5 B;  2WTF A;  3C5G A;  4UB1 A;  3PW2 A;  4RQ4 A;  5J2G A;  3Q8R B;  2XO7 A;  1WCN A;  3GIK A;  3BQ0 A;  2UVU A;  4RPY A;  1BPX A;  1KSP A;  4M9H A;  2HVH A;  1UA1 A;  1Q79 A;  4DQI A;  4Q43 A;  1ZQM A;  2FPL A;  4QZH A;  4O3R A;  2IMW P;  1NKE A;  2AJQ A;  1U47 A;  4RPZ A;  1ZQI A;  4FHV A;  4ECW A;  4IRD A;  4ATB B;  7ICU A;  5KFJ A;  1TFR A;  3M8R A;  3PW7 A;  3ZDE A;  4YXJ A;  4NY8 A;  4O3P A;  5CB1 A;  5J0T A;  3RB4 A;  9ICP A;  2IBK A;  5DED A;  1WOT A;  2DFL A;  2AGQ A;  8ICV A;  3OUY A;  2W9A A;  3ZD8 A;  4UAW A;  3HWT A;  3B0Y A;  4TUP A;  2NRT A;  4ED6 A;  2R8G A;  2W9C A;  3OVA A;  4EP7 A;  3JPS A;  1MQ2 A;  4I2H A;  4DSK A;  3BQ1 A;  9ICI A;  3WFO A;  1TAU A;  3SYZ A;  1DK3 A;  3H3A A;  2J6S A;  1BNO A;  5J0R A;  5KFE A;  4F4X A;  1U49 A;  4ECV A;  1VJ7 A;  4X4S A;  1X9M A;  2FMP A;  4LVS A;  4QZA A;  4YXM A;  8ICE A;  1JXL A;  1NJY A;  2I1Q A;  4M6W B;  2XGP A;  4DF4 A;  3C2K A;  2M9N A;  4S3N A;  5CR0 A;  4AT8 B;  3OV7 A;  3EYZ A;  4MEX A;  4K4G A;  5KFY A;  3N4M B;  5DKW A;  1X9W A;  3M9N B;  3KHR A;  1B22 A;  1Z00 A;  3KTQ A;  4RQ2 A;  5J29 A;  4I2J A;  4NLG A;  4WBY A;  3E2E A;  3TFS A;  1SKW A;  2ID1 A;  4F2R A;  5KG4 A;  5KFW A;  2AU0 A;  3GII A;  4AT9 A;  2ZH9 A;  4O5E A;  3WFP A;  1BPB A;  1A77 A;  2ZH7 A;  2LYH A;  4GXK A;  3BQ2 A;  8ICM A;  5J2E A;  2W9B B;  3GQC A;  4F4W A;  2KTQ A;  2ZJA A;  7ICQ A;  1V4A A;  4WC5 A;  8ICF A;  2ZH2 A;  2HW3 A;  5KFZ A;  4QZI A;  4XRH A;  5DB8 A;  2PI5 A;  3EW9 A;  1UEU A;  4E8F A;  2JEG A;  2B21 A;  1JIH A;  1ZQZ A;  4O0I A;  4RQ7 A;  3JPR A;  4F92 B;  2W9B A;  3EPI A;  2BPG A;  4B9V A;  4Z6E A;  3GV5 B;  2FLN A;  2Y1I A;  9ICC A;  1RYS A;  9ICX A;  4P4M A;  1S9F A;  4NLN A;  5KFM A;  1D9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...