4NM2A

Structure of human dna polymerase beta complexed with a nicked dna containing a 8brg-g at n-1 position and g-c at n position
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
321
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 103
structure length 321
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nm2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nm2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nm2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nm2A03
1T8EA 2JEJA 4X4RA 4BXOA 1Z00A 3EPGA 4DQRA 1ZQTA 4MEXA 9ICXA 1U48A 4HYKA 4QZFA 3RB4A 3JPTA 3OSPA 5D49A 3Q8MA 3HJ1A 5DB8A 4NM2A 2BPFA 3N97B 4JV1A 5J2CA 1XC9A 2BCRA 2ZH4A 3RBDA 4QZDA 3LDAA 8ICQA 5DQIA 2AGQA 1NJXA 4F92B 4F3OA 4EBKA 2NRWA 2XC9A 4E0DA 9ICIA 3V72A 4DS5A 5HRKA 1QSYA 2BE3A 2R8JA 4UAYA 8ICPA 4FH3A 1X2IA 7ICVA 2AGOA 3M8RA 4EBEA 1RYRA 1D9FA 3M8SA 9ICWA 5IIJA 2KFZA 4KLMA 5KFLA 2C2EA 1NJYA 4J9QA 2ALZA 5BOLA 2NRVA 4RUAA 4X4TA 5IIIA 4CCHA 9ICUA 1NZPA 4F5NA 4RUCA 5TZVA 2W9CB 3B0XA 1NK6A 2W8KA 1WOTA 4MFAA 3GV5B 3RJHA 1BVSA 8ICAA 4F5OA 3PV8A 4M0AA 3SZ2A 3QZ8A 3RJFA 1SL2A 2MUTA 3TFRA 2KZMA 5CB1A 3UXOA 5KFNA 4RNNA 4ECRA 3RJJA 9ICGA 4RWQA 2ISPA 4AT9B 3JZ0A 4Z6CA 1LB2B 4ZH4A 1LV5A 4Q8EA 3M9MB 4GLXA 5KG4A 3SV3A 5DQHA 1CUKA 4DL7A 1ZQQA 5KFUA 1SKWA 4RQ2A 1RXWA 4X5VA 3QEBZ 4F2SA 1TFRA 3C2LA 4UAWA 4TURA 5KFAA 3C21A 4ELVA 5KFQA 4P4OA 5J2AA 4UB1A 1NO5A 2ZH7A 3L9DA 3M9NB 3RRHA 1X9WA 2JEGA 2C22A 8ICYA 3MDCA 3AQKA 4EYHB 3RTVA 1XSNA 1S97A 2PFPA 4IR1A 1S0NA 7ICIA 4X4VA 2JEIA 1IM4A 5KFSA 5HNKA 3HPOA 3H37A 3GIKA 3UPSA 3Q8PB 1ZQHA 4DSJA 4QZCA 5KT7A 3Q8RB 4F91B 2UVRA 4RNOA 4FBUA 1U9LA 2AQ0A 1IXRA 4RT2A 3JPPA 4ED8A 7ICHA 4O3PA 4UBBA 1XS9D 3BQ2A 4QZ8A 2IHMA 1YLQA 4ECVA 1BNPA 4ED1A 4YMOA 2VA8A 5CJ7A 4TQRA 3LWLA 1SKRA 4WC2A 1XO1A 4DOAA 5HR9A 4MFCA 5KT3A 3WFQE 1ZQOA 4O9MA 4UD5A 7ICTA 1PZNA 3V7KA 4I2AA 3SYZA 1BPBA 3EWAA 1L3TA 4C8LA 3AQNA 2HHXA 2XO7A 4ED3A 2ZJ5A 2BQRA 4S3NA 3PX4A 4B9SA 5EWGA 1NKCA 5F2VO 1TAQA 3JPOA 3TANA 3OUYB 2DRBA 5L9XA 3H8SA 4UB2A 2I1QA 4LT6A 3RH5A 4PHAA 4J9RA 8ICEA 4F4YA 8ICIA 2ZH8A 1HJPA 3KTQA 4Z6EA 9ICQA 1UEUA 4FH5A 4LZGA 2DR5A 4PHPA 5KFVA 2ISOA 4J9OA 5J0PA 2W8LA 5KFWA 4RZRA 1NKEA 4E7XA 1V9PA 2DPIA 1ZQKA 1JAJA 2M9NA 4QZGA 3AU2A 5DLFA 4RWNA 3HP6A 2I9GA 1Y88A 3PW5A 4RWPA 1TVAA 2FPKA 5KG1A 5KFPA 1NK7A 3KHRA 3PW7A 4DQIA 4KLOA 9ICPA 3KHGA 1NK9A 3HW8A 9ICEA 2ZTEA 8ICUA 1A77A 1ZJMA 4JK1A 3C1ZA 4ECQA 1K1QA 2RFFA 2GWSA 4R64A 2ZH6A 3WFPA 3GFKB 4DS4A 5KG6A 5DBBA 5L1KA 1DGSA 2ID1A 2UVVA 3T3FA 2R8KA 4TUPA 2HHTA 3E2EA 5J0WA 1DOQA 4RU9A 1RYSA 2M2WA 5HRLA 4LVSA 4UB5A 2ZH2A 2ZUBA 1EXNA 4RQ3A 3PO4A 3M9OB 5KFIA 2R8HA 3MFHA 5HMMA 2OWOA 2W9CA 3RAQA 4I27A 9ICNA 4X4PA 5DLGA 1COOA 2BPGA 4I2CA 7ICEA 1K1SA 5DBCA 4RNMA 4F4WA 5KG2A 3AQLA 4LZDA 3EPIA 1BPYA 4XQ8A 3PX0A 4C8OA 4F5RA 4ECTA 4RQ6A 4FS1A 4DL6A 3PW4A 1JN3A 4M6WA 4YXMA 4I29A 4KLQA 1HUZA 2HHPA 4NKTA 4R65A 5KFFA 7ICKA 1BPEA 4WC3A 3KHLA 4KMUA 4QWDA 4P4PA 3MGIA 4E80A 4ED2A 2FLLA 1SKSA 4GXJA 4FO6A 3ZDBA 1S76D 8ICOA 2BCUA 2AGPA 4DL5A 1ZQBA 4B9MA 3JPSA 1TV9A 2ZJ8A 5EWEA 1SL1A 4WC7A 4DLGA 3NTUA 5KG7A 3K75D 4YP3A 2BHNA 1KFDA 4NXZA 1XSLA 2PXIA 1KTQA 4RPXA 5F9LA 3JPNA 2DVIA 5IINA 1NJZA 1ZQUA 1TKDA 3HT3A 4F4XA 4DQPA 5BOMA 1L3UA 3RB3A 4ECYA 4O3RA 1BPDA 4B9UA 3G6VA 2AU0A 1TK0A 5HRGA 3G6YA 4NLZA 3H7IA 3HJ4A 2C2DA 1ZQDA 4YN4A 3C5FA 1ZQXA 7ICMA 5J0OA 1SZPA 2A1JA 1TK8A 4I2JA 1T7PA 3Q8KA 1JXEA 1MIVA 1TFWA 4R63A 4O5KA 4ATBB 4GC7A 4I2BA 1CEZA 4AT8A 4EBDA 3MABA 5L1LA 5HRDA 8ICRA 3FYHA 2ASLA 4R66A 4DSFA 3IM1A 2VA3A 3ORYA 5HREA 2AJQA 4PHDA 4RQ8A 4J9PA 3ZDAA 5KT4A 4UB4A 3Q8QB 5CR0A 2JEFA 5J0QA 3RB6A 4G3IA 2ZH3A 1ZQVA 4QZHA 5KFOA 4ELUA 4QZ9A 1ZJNA 1NK5A 4O3QA 4P4MA 3PNCA 3RR7A 3BQ1A 1ZETA 1R8CA 1KRPA 3PR5B 2H5XA 3PR4A 4YFKA 4ECUA 1N48A 3UXPA 4ED0A 1XSPA 3ISDA 1N56A 5HRIA 1Q78A 4RQ4A 2KP7A 4NLNA 2R8IA 1S9FA 1XWLA 4NLGA 3H8WA 4WC6A 5HHHA 1BPXA 1ZQPA 4DLEA 2FMQA 4QWEA 4PGYA 5EWFA 4DFKA 2F1JA 4DSIA 9ICCA 4NKUA 8ICLA 5DB7A 4X4OA 5HC9A 2ZH9A 2W9AA 4IRKA 1ZQRA 2PI4A 4BWJA 3JPQA 2DPJA 3MR6A 2J6UA 2ASDA 3RBEA 1NKBA 3RRGA 1JXLA 2IA6A 4PGXA 3TARA 5DBAA 3RJEA 8ICSA 2ZH1A 4MFFA 3JYYA 4C8NA 4M2YA 1Z00B 4QZBA 9ICSA 2HVHA 2RDJA 5HRFA 2ZHBA 4ELTA 3OJSA 3PX6A 4YG2A 3H8JA 5J0XA 2ZTCA 8ICBA 1H38A 3LWMA 4FHPA 3OSNA 1ZQMA 2NRZA 1Z3EB 3KHHA 4DL4A 1VJ7A 4O3OA 5DB9A 4QW8A 2FPMA 3B0YA 4ED6A 4K4IA 2HHQA 3C18A 5DEDA 4X0BA 2FPLA 2ZHAA 3OV7A 2ATLA 5DGBA 4O3SA 3RR8A 5CP2A 1S0VA 7ICOA 4J9NA 1ZQSA 4GXIA 3RH6A 4YD2A 1WCLA 2FMPA 4EZ6A 1R8BA 2ZUDA 4WC5A 4DOBA 5CA7A 4B9VA 4I2GA 1ZQEA 4F8RA 4KLFA 4TQSA 8ICJA 4EBJA 3GIMA 4M9JA 3SI8A 1DK2A 3WFRE 2P6UA 5DG9A 4ECXA 4XA5A 4IQWA 2O5AA 2R8GA 4X4NA 4KN7A 3ZD8A 9ICBA 3OVBA 1ZQIA 2IMWP 5DG8A 7ICGA 4UD4A 9ICFA 5HRHA 3OVSA 8ICGA 1ZQFA 4GC6A 2BCSA 2VA2A 5KFCA 7ICFA 1KFTA 2O1PA 1ZQAA 3QZ7A 1RZTA 9ICKA 3T5JA 5KFYA 2FMSA 2XY5A 1RPLA 4XRHA 1JIHA 4JV0A 1ZQLA 2BCVA 4YVZA 1F5AA 3G6XA 4WC1A 1UA1A 4F5QA 3RAXA 2XCAA 1D8LA 3N4MB 4M9LA 3ZDDA 3BQ0A 1JQRA 2BPCA 4MF8A 4IRDA 3NYBA 5KT5A 3MGHA 4DFPA 2B21A 9ICTA 2ZJAA 1MSWD 2BKEA 3H40A 4AT7B 4R8UB 4ECWA 4J9MA 4M47A 3H39A 3WFOA 5J2JA 4EEYA 4DL2A 4DF4A 5HP4A 1B43A 3Q8LA 4EZ9A 2IBKA 3ZD9A 1KLNA 2NRTA 3GIJA 8ICHA 4QW9A 1QSSA 3ZDEA 5CWRA 3AU6A 4DQSA 2FLNA 5DB6A 4KLGA 2HVIA 5KFTA 5J0YA 5KFZA 5C5JA 4C8MA 4XUSA 3MDAA 7ICPA 2BDPA 3QE9Y 4TUQA 4B9TA 2M2TA 1TAUA 1X9SA 4AT9A 1L3SA 4K4GA 3RB0A 3OVAA 5IILA 4BWMA 4NY8A 2V4RA 3PVXA 5DG7A 1Q79A 1BGXT 2BQ3A 3GV8B 7ICNA 9ICHA 2XY7A 1ZQGA 4O5CA 4KLUA 7ICUA 1QTMA 1JMSA 3C2MA 5D4BA 4EP7A 1BNOA 5KG3A 3PW2A 2BR0A 4X4SA 5DQGA 4RQ0A 4YMNA 2UVUA 4DSKA 3EW9A 4UBCA 3ISBA 3RJIA 1D9DA 4WC4A 3GIIA 4PPXA 1PX5A 1B22A 1U45A 4O3NA 4QZAA 2M2VA 5KFHA 4E8FA 3LK9A 3HX0A 2W9BB 3V6JA 3MR5A 3H4BA 3OGUA 8ICCA 4NLKA 3C1YA 4Z6FA 2MAXA 3UQ2A 4B9LA 5F9NA 4K4HA 5KT6A 1NK0A 4J9LA 2DRAA 3ISCA 3PMNA 3ZDCA 4WBZA 2RDIA 4YR3A 1KNYA 4XQ7A 1L3VA 1L5UA 3TQ1A 1A76A 3GQCA 4B9NA 3V6KA 2BGWA 2PI5A 3WFSC 3TAQA 2JZBB 4YR0A 2P66A 4RQ5A 4DO9A 2HHUA 1MIWA 2W9MA 4KTQA 8ICXA 4FHWA 3RJGA 2Y1JA 1MIYA 3T5HA 4IG8A 9ICVA 4Z6DA 4PH5A 8ICNA 3NGDA 3OUYA 5J2FA 3UXNA 4FBTA 4JWMA 4ECZA 1BPZA 2KFNA 5KFBA 4WC0A 3K4GA 1D8YA 1VFGA 4GXKA 2BCQA 4PHEA 4Q45A 2WTFA 5J0UA 4M04A 1UETA 4BDPA 3IHQB 4DEZA 2V4QA 2Q66A 1C7YA 7ICRA 2DR9A 4DL3A 4F4KA 4WCWA 3H4DA 3OHBA 5KFXA 1U49A 5J0RA 2NRKA 5J2BA 3OHAA 3MBYA 8ICWA 4RT3A 5KFGA 4C8KA 4UB3A 1U4BA 4BGDA 4DFJA 1X9MA 1MQ2A 4I2FA 1MQ3A 3JPRA 4WBYA 4M9NA 1WCNA 4PGQA 8ICZA 1AROP 5CHGA 1SL0A 4I2EA 5J2EA 4UAZA 1QLNA 7ICLA 4M6WB 5J29A 4X4UA 3EZ5A 4ED7A 1T3NA 4IQTA 4BXOB 2XY6A 4P2HA 4I2DA 4KN4A 5L1IA 3H3AA 2DR7A 1ZQJA 4I2HA 3C2KA 4YMMA 1ZQZA 4YD1A 5J2GA 3UQ0A 3PO5A 3V7LA 4TUSA 4KLLA 4DSLA 5IIKA 1RXVA 1QSLA 4X4QA 2KN7A 3QEAZ 1UA0A 3TAPA 4M9HA 2AQ4A 1UT8A 4Q8FA 4QWAA 7ICSA 4AT7A 4R8UA 1XU4A 2LYHA 4ECSA 4YQWA 7ICQA 3HIYA 3FDSA 2P6RA 1R8AA 2PBEA 2F1IA 3THVA 1NK8A 1UT5A 5J2KA 4J9KA 2Y1IA 4RQ7A 2UVWA 3T5LA 5KT2A 3C23A 1DK3A 1OU5A 2ASJA 5KFMA 3V6HA 4F4ZA 1NK4A 4QWCA 3PY8A 1TFYA 5IIMA 2J6TA 1R89A 4M9GA 2PFNA 4J9SA 1V4AA 4JWNA 3BQTA 2A1JB 3BJYA 2Q0ZX 2PFQA 2HW3A 1ZQCA 3RH4A 3GDXA 9ICJA 4EBCA 3PMLA 1NOMA 4KITB 2HHSA 4JV2A 2KZZA 2BQUA 9ICOA 1TK5A 4AT8B 9ICAA 5J2DA 4KLSA 3UPQA 2PFOA 2XGQA 4KLIA 3AUOA 4IQUA 3GV7B 4KLTA 5EOZA 5D46A 8ICVA 4KLJA 5IIOA 5BPCA 5JUMA 1FA0A 4YCXA 2MUTB 3T5KA 4DFMA 1ZYQA 4YR2A 4NM1A 9ICMA 5L1JA 4RPYA 4QZIA 2VANA 2C28A 5KFRA 5KFKA 2W9BA 4DF8A 4F2RA 9ICRA 5J2IA 3SV4A 4DSEA 5DDYA 8ICMA 4RPZA 1S0OA 5KG5A 4I2IA 5HRBA 2KZ3A 4UQGA 4FHYA 3BDPA 8ICFA 4ATBA 4KLEA 9ICLA 1UEVA 1S77D 5KTQA 4DQQA 1JX4A 2JZBA 4O5EA 4X0AA 3LQCB 1U47A 5DECA 2ZH5A 8ICKA 4MEYA 2V9WA 4KLDA 4RWOA 2J6SA 4EYIB 2DR8A 4YXJA 5DKWA 3HWTA 4FS2A 3H38A 4DOCA 1ZQWA 4F93B 3OJUA 3MFIA 5KFDA 7ICJA 5J0TA 2C2RA 4I28A 1MC8A 3MR2A 2DFLA 1T4GA 3MR3A 5J2HA 4Q43A 2ZUCA 1KFSA 1KEJA 3Q8SB 4MF2A 5HHIA 1S0MA 5DDMA 2XGPA 4F50A 3TFSA 5KFEA 3V7JA 3PW0A 2F1HA 8ICTA 1NJWA 4JUZA 4RQ1A 4IRCA 1S10A 3RJKA 4QZEA 3C5GA 1HUOA 5J0SA 4F5PA 2HHWA 4M5DA 2HHVA 4Q44A 4KLHA 3GILA 5KG0A 2XCPA 1ZQYA 2IHNA 4DWIA 2KTQA 2NRXA 3ETLA 4O0IA 5KFJA 4IR9A 3C66A 4FHXA 2M2UA 5DGAA 3EYZA 3TI0A 4IQVA 1KSPA 2FLPA 3AQMA 2ZTDA 4FHVA 4QWBA 1KDHA 5HMLA 1ZQNA
chains in the Genus database with same CATH superfamily
4G9BA 4BXOA 1Z00A 4DQRA 1ZQTA 5AHXA 4HYKA 4QZFA 4RQNA 3KFUF 3JPTA 5EE3A 5D49A 2ZH4A 2QARB 8ICQA 1ZD5A 3AM9A 5DQIA 2AGQA 4P0QB 4F3OA 1KQQA 2G07A 4DS5A 2R8JA 1ED1A 7ICVA 2K4PA 2KJ5A 2AGOA 3M8RA 3ZI4A 4NL9C 4Y2SA 1ZXIA 9ICWA 2HMXA 5AKXA 2NRVA 4X4TA 1NZPA 4CCHA 4F5NA 4RUCA 5TZVA 2W9CB 1NK6A 3L3FX 2W8KA 3AL0B 1BVSA 8ICAA 1X6IA 3QZ8A 5CB1A 4K9AA 5KFNA 4AT9B 3JZ0A 1LB2B 2EAOA 4ZH4A 3M9MB 1ZD2P 5KG4A 1ZQQA 1SKWA 2FDRA 2VJ5A 4UAWA 5KFAA 4K98A 3I1YA 3L5KA 4O67A 5KFQA 4P4OA 4UB1A 3L9DA 3M9NB 2C22A 1SZHA 3MDCA 4EYHB 2KKVA 1XSNA 1S97A 2Y0SC 2WF6A 2JEIA 5HNKA 1TAMA 4FBUA 3Q8RB 4RNOA 1U9LA 4RT2A 3JPPA 4O3PA 1SXEA 4EV6A 4ED1A 2VA8A 5CFSA 2YB4A 4OJPA 5KT3A 3WFQE 4NXXA 3H3AA 3SYZA 1BPBA 3AQNA 2HHXA 3PX4A 2F77X 4JMUA 3JPOA 3TANA 2DRBA 3H8SA 2GA9D 4UB2A 2OYYA 3RH5A 2KSOA 4LZGA 5KFVA 4J9OA 1PK1B 2HOFA 4CRXA 5JTGA 4QZGA 2NV3A 5JU5A 3UM9A 1TVAA 2EDUA 5KG1A 3KHRA 1V85A 2NO4A 3KHGA 3HW8A 9ICEA 1ZJMA 3M7DA 2GWSA 2K8CB 3S6JA 1SWVA 4EGWA 2UVVA 2KE7A 2MA1A 2R8KA 2HHTA 3NVYA 5HRLA 2ZH2A 4RQ3A 2OWOA 2IUBA 3RAQA 4I27A 2QLTA 4X4PA 4I2CA 1COOA 1SV4A 2Y9UA 3AQLA 4Y2QA 3PX0A 4C8OA 1PVQA 2WF8A 4DL6A 4FS1A 2HHPA 4NKTA 4WC3A 4P4PA 1SKSA 8ICOA 2BCUA 4LEZA 4DL5A 5EWEA 4DLGA 1KFDA 3AQFA 1XSLA 4USAA 2PXIA 4NXWA 4RPXA 2DVIA 3JPNA 5IINA 1ZQUA 3HT3A 5BOMA 2BBHA 1OUQA 2JH7A 1BPDA 4B9UA 4NLZA 3HJ4A 3H7IA 3NVZA 2C2DA 5J0OA 1SZPA 2F76X 1T7PA 3Q8KA 3HRDD 5L1LA 4R66A 2VA3A 3ORYA 5TISU 2AJQA 3F5EA 2ZH3A 1QH9A 5CR0A 3RB6A 5AK4A 5KFOA 1NK5A 4P4MA 2YY6A 1TE2A 3PR5B 3PR4A 4ED0A 5HRIA 1N56A 1Q78A 2KP7A 4C0ZA 1XWLA 1S9FA 4NLGA 4WC6A 5HHHA 1BPXA 1ZQPA 4DLEA 4QWEA 4DSIA 1KW4A 5AK5A 1QCKA 2PI4A 3WK8A 1JXLA 2IA6A 2YTUA 5KNIA 2EWRA 4O6AA 5DBAA 5ALQA 2ZH1A 4MFFA 3JYYA 4QZBA 2RDJA 5HRFA 5ALKA 1Z4OA 4YG2A 3JCFA 3OSNA 2NRZA 1Z3EB 1VJ7A 2FPMA 1HIWA 2ZHAA 4K4IA 3OV7A 4YD2A 1R8BA 2ZUDA 2YN4A 4WC5A 2JH1A 4KLFA 4TQSA 2W54A 3QU4A 2WAQF 3SI8A 3CK6A 3N7RC 3MC1A 5DG9A 4IQWA 2JRZA 3F2CA 4X4NA 9ICBA 5DG8A 7ICGA 1L6NA 1KFTA 2BCSA 4QNLA 5KFYA 2RP5A 1Z1BA 1F5AA 3EUB2 4MHVA 4YVZA 2KK0A 3RAXA 2KIVA 3N4MB 1JQRA 2BPCA 3NYBA 2OCEA 9ICTA 4J9MA 1FFUA 5J2JA 1S8OA 2HBMA 5HP4A 1B43A 2IBKA 1KLNA 2NRTA 3AU6A 4DQSA 4KLGA 5ALUA 2LMRA 5J0YA 2G0AA 7ICPA 4TUQA 2WF5A 2M2TA 2A1AA 4K4GA 2YMMA 4BWMA 5DG7A 3GV8B 3N7PD 3RFAA 3C2MA 3UMBA 2BR0A 2G5IB 5DQGA 4RQ0A 2UVUA 4UBCA 3ISBA 3N7SC 1P7DA 4ICAA 2KNJA 4E8FA 5G5HA 2W9BB 4WQKA 3C1YA 5EE0A 2IOFA 2DF4B 3ERCC 3SEIA 3PMNA 3FC4A 4B9NA 5D62A 3WFSC 3PSIA 4YR0A 2HHUA 1MIWA 4KTQA 4IG8A 3RJGA 2Y1JA 5JTIA 2KG5A 5ALPA 9ICVA 4Z6DA 3NGDA 4FBTA 1J97A 4ECZA 1D8YA 4GXKA 2E3TA 2EH9A 3IHQB 2V4QA 4WCWA 5J0RA 2HBLA 3OHAA 4DFJA 4WBYA 4M9NA 4PGQA 8ICZA 5J2EA 3QU5A 2KOBA 3SD7A 2ZXHA 5CRXA 2XY6A 1V38A 4I2HA 4YD1A 3PHZA 3V7LA 4NLCA 1UA0A 4Q8FA 4QWAA 1ECWA 4ECSA 3QYPA 4YQWA 1NK8A 5J2KA 4J9KA 4RQ7A 2UVWA 5KT2A 3RF9A 3V6HA 1NK4A 5IIMA 2E8MA 1V4AA 2A1JB 3BJYA 2Q0ZX 5ALGA 3UMGA 5CEHA 3PMLA 3ICXA 9ICOA 4JB3A 4UATA 2XGQA 1J2NA 4IQUA 4UB8U 5IIOA 5JUMA 1ZYQA 9ICMA 2WAQC 5L1JA 4RPYA 5KFRA 3TACB 4FFDA 4DF8A 3SV4A 4DSEA 8ICMA 4RPZA 2W55A 5KG5A 1UHUA 3TADA 3I28A 1J2MA 5GTIU 4KLEA 4DQQA 4X0AA 3LQCB 5DECA 2ZXIA 4MEYA 5B3QA 2DR8A 3KBBA 5KL8B 2F8KA 1X42A 5HHIA 1S0MA 3PW0A 4UASA 4RQ1A 1V97A 3BS5B 3C5GA 4M5DA 2ZIVB 4KLHA 3GILA 1ZQYA 3IP4B 3ETLA 4O0IA 4IR9A 3MGVA 1N5XA 2FLPA 3AMZA 3AQMA 4FHVA 4QWBA 5T14A 4WJ3B 4C7ZA 1XC9A 4QZDA 4CDGA 1JRPA 4EBKA 2YQEA 2XC9A 4E0DA 2KHQA 3SAFA 4EBEA 1D9FA 2AHOB 2EZYA 5IIJA 2KFZA 4KLMA 5KFLA 2C2EA 4KB6A 1NJYA 4J9QA 5BOLA 4RUAA 2G09A 1SWWA 2Q4TA 3B0XA 1K5OA 3GV5B 3LVVA 4F5OA 2KZMA 3RJJA 3UXOA 4ECRA 2ISPA 2LYAA 3FAHA 4I0UA 1LV5A 1NZBA 5DQHA 4X5VA 3QEBZ 4F2SA 4TURA 4EENA 3E0FA 5J2AA 1NO5A 2ZH7A 2CN1A 1X9WA 2ZIUA 1ZD3A 8ICYA 7ICIA 2PFPA 4IR1A 4X4VA 1IM4A 5KFSA 3ED5A 4NWIA 3KKAC 3Q8PB 4DSJA 3LYSA 4XQ7A 4F91B 3CP8A 2AQ0A 4ED8A 7ICHA 4UBBA 1YLQA 1BNPA 4YMOA 1SKRA 4WC2A 2YMLA 1XO1A 5HR9A 4MFCA 1ZQOA 4OAFA 4UD5A 4Y2PA 2XO7A 4ED3A 2BQRA 4PZNA 1NKCA 1TAQA 2E8PA 3OUYB 1ZQ1C 2RRDA 5L9XA 1F44A 4PHAA 8ICIA 2ZH8A 4F4YA 1HJPA 2KKPA 4E7XA 1URJA 5KFWA 1NKEA 1VDVA 1YZ6A 1V9PA 2DPIA 1DRGA 4RWNA 2I9GA 5ALDA 4RWPA 1DGJA 3ALRA 2FPKA 5KFPA 4KLOA 4Y2YA 2QARA 8ICUA 3QXGA 1A77A 3C1ZA 4ECQA 1K1QA 2KVSA 3WKAA 4OAHA 2DL0A 1DGSA 4P0PB 2ID1A 3E2EA 5J0WA 1DOQA 4KX3A 4UB5A 1NI3A 3K1RB 2OEHA 1Q8KA 1T3QA 2GH1A 5HMMA 2W9CA 5CHEA 5ALXA 9ICNA 5DLGA 2CPRA 5DBCA 3EPIA 4XQ8A 4F5RA 3PW4A 4KLQA 4M6WA 4I29A 1HUZA 2DQNB 3KHLA 2PMZF 2NO5A 3ZDBA 3IV6A 1ZQBA 4C4SA 4WC7A 2ZJ8A 2A19A 1SL1A 3NTUA 2BHNA 4NXZA 2IHOA 2YMQA 1NJZA 2G08A 4DQPA 4F4XA 2KJ8A 4OJLA 3WK5A 2FCLA 1L3UA 4O3RA 2LYBA 3G6VA 4YN4A 1SXDA 5KAFU 4I2JA 1YZ7A 1JXEA 4UAVA 4U7CA 4I2BA 2RQ5A 5HRDA 8ICRA 4Y2XA 2ZIWB 3ETRA 1FO4A 4UB4A 5J0QA 3BZKA 4O3QA 5B66U 3BQ1A 1ZETA 1KRPA 3F2DA 4NLNA 3D6JA 1PK1A 2I5HA 3NASA 2XVTA 5EWFA 4NKUA 2F1JA 3SENA 9ICCA 5DB7A 2ZH9A 5ALVA 3TKAA 3JPQA 3MR6A 5ALEA 1NKBA 4C8NA 5ALNA 1Z00B 9ICSA 4C7YA 4HX0A 4CF4A 3WKBA 3H8JA 5J0XA 2ZTCA 1H38A 3LWMA 4DL4A 5AIAA 4O3OA 2HHQA 4ED6A 4X0BA 5DEDA 1O08A 1S0VA 7ICOA 3RR8A 4J9NA 3U26A 1ZQSA 4GXIA 3RH6A 2FMPA 2G06A 2KIWA 4EBJA 3GIMA 4ECXA 2GAFD 2HBJA 1PK3A 3A0BU 5AM2A 2DKZA 5AIBA 4UD4A 5HRHA 4LJXA 2O1PA 1ZQAA 9ICKA 4EELA 2LBOA 2FMSA 1JIHA 1ZQLA 3N28A 3KD3A 4CE6A 2AH5A 1L7PA 3ZDDA 3BQ0A 4MF8A 5KT5A 2B21A 2ZJAA 3H40A 4AT7B 4R8UB 5AI8A 4M47A 1IIPA 3H39A 2D6FC 2B51A 4UAUA 2FI1A 1A6SA 4QW9A 1QSSA 2E8NA 5CWRA 5DB6A 2GOLA 2ESEA 2KEYA 2PKEA 5KFTA 1F5SA 1QQ6A 4KMOB 2BDPA 3QE9Y 2H3FA 3D2QA 1L3SA 4F72A 3RB0A 4NY8A 2V4RA 2FE9A 2JHDA 5JRTA 4O5CA 1QTMA 1JMSA 4KM5A 4EP7A 2LPEA 1BNOA 5KG3A 3E58A 2ZG6A 3RJIA 2M0NA 1D9DA 4WC4A 3AEVA 3GIIA 1B22A 5KFHA 2KVCA 2PMZC 3LK9A 1L7OA 3V6JA 3GZFA 3MR5A 1LVHA 3H4BA 2H3VA 2QB0A 4YR3A 2Y9TA 1L3VA 3GQCA 3V6KA 3IDWA 3TAQA 2JZBB 5ALMA 4RQ5A 2W9MA 1MIYA 3T5HA 3OPXA 3VCBA 4WC0A 3QNMA 2BCQA 4PHEA 4Q45A 1C7YA 4DL3A 4F4KA 2IOFK 1ZRNA 4K96A 3UMCA 1WCNA 1AROP 3WK9A 4UAZA 4CNQA 3CRXA 3KZXA 4C80A 3EZ5A 1KL9A 1OXJA 4I2DA 4KN4A 3F2BA 5L1IA 3PO5A 4YMMA 4X4QA 1QSLA 3SR6A 2AQ4A 4EEKA 1L8OA 1XU4A 7ICQA 2PBEA 3GU3A 3PSTA 1DK3A 2ASJA 3VC8A 1B0XA 5ALHA 4JWNA 5ALZA 4U6PA 2HW3A 5AM0A 1ZQCA 9ICJA 2IOHA 2H3ZA 1NOMA 4JV2A 3UPQA 2F44A 2PFOA 3AUOA 3M6KA 4K8VA 3B9JA 5EOZA 4KLJA 1FA0A 2K8BB 4YCXA 2MUTB 3T5KA 4DFMA 2VIXA 2OM6A 4QZIA 2VANA 4AP9A 2W9BA 4F2RA 5AKYA 5HRBA 2YX8A 3BDPA 8ICFA 4ATBA 9ICLA 1UEVA 4US8A 5ALIA 8ICKA 5DKWA 3HWTA 4DOCA 3NVOA 3MFIA 7ICJA 4I28A 3MR2A 1XNSA 1T4GA 4Q43A 1KFSA 5GTHU 2WHEA 8ICTA 3NVWA 4JUZA 3RJKA 4QZEA 4F5PA 1SV0A 5KG0A 2IHNA 2KTQA 4RQMA 4NXUA 2W3RA 5HMLA 1T8EA 2JEJA 3EPGA 4MEXA 4NV0A 2KJ9A 3RB4A 2MRLA 3OSPA 3HJ1A 5DB8A 4NM2A 4JV1A 1LKYB 3IRUA 5J2CA 2BCRA 2B56A 3LDAA 2W11A 1NJXA 2KICA 2NRWA 2BDUA 3V72A 5HRKA 1QSYA 4C4RA 8ICPA 4NLBA 4OO1J 1RQLA 3M8SA 2WB1F 2K89A 3QUQA 5G5GA 4PZOA 2ALZA 5IIIA 9ICUA 5H2FU 3RJHA 2JXJA 2DUYA 3HKZF 3PV8A 4M0AA 1SL2A 9ICGA 4Z6CA 2QB1A 2A3VA 2XI9A 4GLXA 4DL7A 1JI7A 4RQ2A 2JEGA 3NUQA 3AQKA 3RTVA 4ZOHC 4BUGA 4Y2VA 3H37A 2R18A 3T79A 3IG5A 5AKZA 1FEZA 5KT7A 2UVRA 4FHPA 1SB3C 1XS9D 3BQ2A 4QZ8A 4ECVA 5CJ7A 3LWLA 1KBUA 3OWGA 7ICTA 3BS5A 3V7KA 4HAIA 1ZD4A 4S3NA 3QUBA 5F2VO 5EWGA 4QIWF 1A0PA 2O6KA 8ICEA 2DR5A 3KTQA 4Z6EA 4NL9A 1UEUA 1UQVA 1X9XA 3WKCA 1Q46A 5J0PA 2W8LA 4RZRA 1ZQKA 2M9NA 5DLFA 3PW5A 4GIBA 3PW7A 9ICPA 5AKKA 1NK9A 2ZTEA 3SQIA 4JK1A 1B4FA 1Z4NA 1ZOLA 2ZH6A 4R64A 3WFPA 4DS4A 5DBBA 1PVRA 5L1KA 5AKEA 4TUPA 1RYSA 3NS1A 2WF7A 3PO4A 5KFIA 2R8HA 4LEYA 2OHFA 2I6XA 7ICEA 1K1SA 4RNMA 4F4WA 3PZPA 2G5HB 4ECTA 5KL1B 4YXMA 4R65A 2KMDA 1BPEA 3QUCA 4KMUA 4QWDA 5EE9A 2BBJA 4E80A 4ED2A 2FLLA 4GXJA 4FO6A 2L5YA 1S76D 2AGPA 4IC9A 2K4EA 2LKYA 3AQEA 1X6JA 5F9LA 1TKDA 4ACOA 3RB3A 4ECYA 5HRGA 2E5SA 3I76A 1ZQDA 3D2NA 3WKEA 5KAIU 2LM1A 3DDHA 1D8BA 1TFWA 4R63A 4O5KA 1S5LU 4GC7A 4AT8A 4EBDA 3MABA 3FM9A 3IM1A 1RYUA 1OW5A 4Y2JA 4PHDA 4J9PA 5KT4A 5AM4A 1KKXA 1ZQVA 4QZHA 2WB1C 4QZ9A 2DBYA 3PNCA 4FZLA 4YFKA 5AI5A 4NXVA 1XSPA 4RQ4A 2R8IA 3H8WA 2FMQA 5HR6A 5HC9A 2W9AA 4IRKA 1ZQRA 2VKQA 3KOOA 4BWJA 3RRGA 3RBEA 4WOYA 5FP0A 3TARA 3RJEA 2Y0SF 1WYGA 4P0PA 4ELTA 5ALWA 5AI4A 3PX6A 8ICBA 5ALFA 3KHHA 3C18A 2FPLA 2ATLA 5DGBA 4O3SA 5CP2A 2ZIXB 5CA7A 1ZQEA 4F8RA 8ICJA 4WH5A 4M9JA 1F0MA 1DK2A 3WFRE 4Y2UA 2NYVA 2P6UA 2O5AA 4XA5A 1FFVA 2R8GA 3ZD8A 2K4IA 1ZQIA 1RM6C 5AICA 4QIWC 2F8LA 3QZ7A 3T5JA 3WU2U 4B6JA 4P0QA 5AI9A 3NVVA 4JV0A 2BCVA 3K1ZA 3G6XA 4WC1A 1KN5A 1D8LA 3MGHA 4LEVA 3NRWA 2HDOA 1MSWD 4ECWA 2JGAA 4DF4A 4EZ9A 3Q8LA 2ZIUB 3GIJA 1CRXA 4N7RA 2ZIWA 2HVIA 1PUZA 5ALRA 4UB6U 3MCRA 5ALSA 3BZCA 5C5JA 4C8MA 4XUSA 3H0LB 2D3DA 4B9TA 1TAUA 4AT9A 5L1MA 5ALYA 3PVXA 1BGXT 4Y2RA 7ICNA 9ICHA 2XY7A 1ZQGA 4KLUA 7ICUA 5D4BA 4OJ6A 4IL6U 4X4SA 2EZXA 3EW9A 4PPXA 5AKHA 1PX5A 3CW2C 1N61A 5AK3A 8ICCA 3WK7A 4B9LA 4NLKA 4K99A 4EEBA 1JALA 2HCFA 4K4HA 4J9LA 3ISCA 4LEWA 3C29A 2BGWA 1MA7A 1Z1VA 4DO9A 4PH5A 5J2FA 3M1YA 1Q3UA 5KFBA 3K4GA 1VFGA 2WTFA 4M04A 4BDPA 5AKGA 3TADC 2WF9A 3OHBA 2YB1A 5KFXA 1XO0A 1U49A 8ICWA 1T94A 2E8OA 5KFGA 4UB3A 1U4BA 1MQ2A 1X9MA 1MQ3A 4CF5A 4FE3A 5CHGA 1SL0A 4I2EA 3CNHA 4A8EA 4M6WB 5J29A 1RQNA 1T3NA 4BXOB 4P2HA 2DR7A 1ZQJA 5J2GA 4PJ0U 2BZFA 2EAPA 4TUSA 4DSLA 5IIKA 1RXVA 4M9HA 1UT8A 7ICSA 2GO7A 4AT7A 4R8UA 3HIYA 3FDSA 3THVA 1UT5A 2OH2A 3T5LA 2VJ4A 3C23A 1OU5A 4BX9C 5KFMA 4F4ZA 4OD0A 3PY8A 1TFYA 5J8YC 1R89A 4M9GA 2PFNA 2D8CA 1FIQA 3BQTA 5AM3A 2PFQA 2W3SA 3RH4A 3GDXA 2HHSA 2KZZA 9ICAA 4KLSA 2KV2A 5D46A 8ICVA 5BPCA 5HR7A 2JMGA 4YR2A 3HJEA 2GLEA 4EX6A 4QJFB 9ICRA 3M6ZA 5DDYA 5AM1A 4PL2A 4I2IA 4Y2TA 4NJ8A 1S77D 5KTQA 3CYMA 2JZBA 2V9WA 2HOQA 2AXTU 4RWOA 4EYIB 4FS2A 1ZQWA 4F93B 5KFDA 5J0TA 2DFLA 5J2HA 1RDFA 2W03A 2ZUCA 4MF2A 9ICXA 5DDMA 2XGPA 3TFSA 5KFEA 3V7JA 1NJWA 1S10A 1DXSA 5J0SA 2HHWA 1Z19A 2HHVA 5ALJA 2NRXA 5DGAA 2ZTDA 2KSOB 1KDHA 4LT6A 4NXTA 4X4RA 3LVWA 1U48A 3H0MB 1O03A 3Q8MA 2H3IA 2BPFA 4JLZA 3N97B 2MSNA 3RBDA 2P35A 3O0FA 4F92B 2ES6A 1SIJA 9ICIA 2BE3A 4UAYA 2W7OA 4FH3A 1X2IA 5B3PA 3OTQA 1RYRA 1IG6A 4EEDA 2K4HA 1WOTA 4MFAA 4K9BA 2W7PA 3SZ2A 3RJFA 2MUTA 3TFRA 4RNNA 4RWQA 2HBKA 2MU2A 2HN2A 4OJOA 5A0LA 4Q8EA 3SV3A 1CUKA 5KFUA 2DWQA 1RXWA 1TFRA 3C2LA 3C21A 4ELVA 3RRHA 1HEKA 1S0NA 2LHTA 1N5WA 3HPOA 3UPSA 3F5AA 4UW9A 3GIKA 1ZQHA 4QZCA 1JROA 2YMPA 1IXRA 2QB0B 2E1FA 2DGZA 5AI6A 2IHMA 4TQRA 4DOAA 4O9MA 4O68A 1PZNA 4I2AA 1L3TA 3EWAA 4C8LA 2ZJ5A 4B9SA 5EE1A 4KX5A 3BS7A 3HILA 2I1QA 3SMVA 5AKLA 4J9RA 1ZRMA 9ICQA 4FH5A 4PHPA 3IG8A 2ISOA 1JAJA 3NWIA 3AU2A 4DFDA 3WKDA 3HP6A 1Y88A 1RG6A 1LKYA 1NK7A 4DQIA 4CF3A 4JLXA 2CXYA 2RFFA 1YT3A 3GFKB 5KG6A 3QUTA 3T3FA 4RU9A 2M2WA 4LVSA 2ZUBA 1EXNA 3M9OB 3MFHA 2LM4A 2FJ6A 3A0HU 2BPGA 5KG2A 1UPHA 4LZDA 2DKXA 1BPYA 2HOIA 4OAIZ 2LI6A 4RQ6A 3KKAA 1JN3A 5KFFA 7ICKA 5F3XB 3MGIA 5CFUA 2JV3A 4K97A 4B9MA 4GFJA 5ALOA 3JPSA 1TV9A 3BQ7A 1VLBA 5KG7A 1WWUA 3K75D 4YP3A 1N62A 1KTQA 4AYBF 1UCVA 5AI0A 3H8MA 2AU0A 1TK0A 3G6YA 3J81j 1AQ6A 3C5FA 1ZQXA 7ICMA 2A1JA 2ODGA 1TK8A 3NRZA 4ATBB 1CEZA 3ONNA 3FYHA 2ASLA 4DSFA 3PSFA 5K4LA 5HREA 2QKQA 4RQ8A 2KD1A 3Q8QB 3ZDAA 4G3IA 2JEFA 2CRXA 5C0YA 5AKJA 5D63A 4ELUA 1ZJNA 4CGZA 3RR7A 1R8CA 2H5XA 4ECUA 1N48A 3UXPA 3ISDA 3IN5A 2N1RA 4PGYA 1CI4A 4DFKA 2W04A 8ICLA 2WFAA 4J03A 4F71A 2DPJA 2J6UA 2ASDA 1COKA 4PGXA 8ICSA 4M2YA 2OXOA 3R9KA 2HVHA 2ZHBA 3OJSA 1N63A 3DEEA 1ZQMA 4QW8A 5DB9A 3B0YA 2EAMA 2B6GA 1C20A 2ZIVA 4OCZA 1QQ7A 1WCLA 4EZ6A 2K60A 4BJQA 2B4VA 4DOBA 4B9VA 4I2GA 5CFTA 2RLTA 4KN7A 3OVBA 2IMWP 4EX7A 3SAGA 9ICFA 3OVSA 8ICGA 1ZQFA 4GC6A 2VA2A 7ICFA 5ALTA 5KFCA 3D2SA 1RZTA 3QU2A 2XY5A 3SAHA 1RPLA 4XRHA 2EQYA 5D61A 1UA1A 4F5QA 4M9LA 2XCAA 2H3QA 4IRDA 4DFPA 4MKPA 4PL1A 2BKEA 2RHFA 5AM5A 3WFOA 4EEYA 4DL2A 1MIVA 1L7MA 1MN8A 3ZD9A 8ICHA 2Z7JA 3PSPA 3ZDEA 2FLNA 5KFZA 4WQLA 3MDAA 1X9SA 4OAGA 3OVAA 5IILA 1Q79A 3WK6A 2BQ3A 3EF2A 4O3MA 3PW2A 1GPJA 4YMNA 4DSKA 5J8YA 2M2VA 1U45A 4O3NA 4QZAA 3HX0A 1GO3F 3AN1A 3OGUA 1WWVA 4Z6FA 2MAXA 5AK6A 3UQ2A 4FO1A 2XICA 5F9NA 3QU7A 5KT6A 1N60A 1NK0A 2DRAA 4US9A 3ZDCA 4WBZA 2RDIA 1KNYA 4AYBC 3QU9A 1L5UA 3TQ1A 1A76A 3H0RB 2F2AB 1VJ5A 2F3NA 2PI5A 2P66A 4FHWA 4X4OA 8ICXA 1X66A 2ZIXA 2E1EA 8ICNA 3OUYA 3UXNA 4JWMA 1BPZA 2KFNA 1M6YA 4OJ5A 5J0UA 1UETA 4DCCA 2JR5A 4DEZA 2Q66A 1NNLA 2DR9A 7ICRA 2EANA 2HI0A 3H4DA 4FZNA 2NRKA 5J2BA 3MBYA 4RT3A 4C8KA 1JUDA 2KHVA 3HKZC 4BGDA 4I2FA 3JPRA 3DV9A 1QLNA 7ICLA 4X4UA 3C28A 4ED7A 1WUDA 4IQTA 3KZIU 4UARA 3NKUA 3C2KA 4KLLA 1ZQZA 3UQ0A 3ER9B 2KN7A 3QEAZ 3TAPA 2HN1A 1L7NA 2LYHA 2B0CA 2P6RA 1R8AA 2F1IA 1SV0C 2Y1IA 3ER8C 2EZZA 4QWCA 4O69A 2J6TA 4J9SA 1N2XA 2HSZA 4FZMA 4EBCA 4KITB 5AKIA 2BQUA 1TK5A 4AT8B 1L8LA 1X40A 5J2DA 1Q3VA 4KLIA 1SGGA 3GV7B 4KLTA 4NM1A 2C28A 1PVPA 5KFKA 5J2IA 5ALLA 3L4PA 1S0OA 1QQ5A 2KZ3A 4UQGA 4FHYA 4IS7A 1JX4A 4O5EA 2ZH5A 1U47A 4KLDA 2J6SA 2XIDA 4YXJA 3H38A 1WG8A 2W43A 3K7DA 3OJUA 2C2RA 1MC8A 5E79U 3MR3A 1KEJA 3Q8SB 4F50A 2F1HA 3QX7A 3WK4A 4IRCA 1IV8A 2K8AA 1HUOA 4Q44A 2XCPA 4XJEA 4DWIA 5KFJA 3C66A 4FHXA 2M2UA 3F53A 3EYZA 3TI0A 4IQVA 1KSPA 4C4TA 5B5EU 1ZQNA
chains in the Genus database with same CATH topology
1T8EA 2JEJA 4X4RA 4BXOA 1Z00A 3EPGA 4DQRA 1ZQTA 4MEXA 9ICXA 1U48A 4HYKA 4QZFA 3RB4A 3JPTA 3OSPA 5D49A 3Q8MA 3HJ1A 5DB8A 4NM2A 2BPFA 3N97B 4JV1A 5J2CA 1XC9A 2BCRA 2ZH4A 3RBDA 4QZDA 3LDAA 8ICQA 5DQIA 2AGQA 1NJXA 4F92B 4F3OA 4EBKA 2NRWA 2XC9A 4E0DA 9ICIA 3V72A 4DS5A 5HRKA 1QSYA 2BE3A 2R8JA 4UAYA 8ICPA 4FH3A 1X2IA 7ICVA 2AGOA 3M8RA 4EBEA 1RYRA 1D9FA 3M8SA 9ICWA 5IIJA 2KFZA 4KLMA 5KFLA 2C2EA 1NJYA 4J9QA 2ALZA 5BOLA 2NRVA 4RUAA 4X4TA 5IIIA 4CCHA 9ICUA 1NZPA 4F5NA 4RUCA 5TZVA 2W9CB 3B0XA 1NK6A 2W8KA 1WOTA 4MFAA 3GV5B 3RJHA 1BVSA 8ICAA 4F5OA 3PV8A 4M0AA 3SZ2A 3QZ8A 3RJFA 1SL2A 2MUTA 3TFRA 2KZMA 5CB1A 3UXOA 5KFNA 4RNNA 4ECRA 3RJJA 9ICGA 4RWQA 2ISPA 4AT9B 3JZ0A 4Z6CA 1LB2B 4ZH4A 1LV5A 4Q8EA 3M9MB 4GLXA 5KG4A 3SV3A 5DQHA 1CUKA 4DL7A 1ZQQA 5KFUA 1SKWA 4RQ2A 1RXWA 4X5VA 3QEBZ 4F2SA 1TFRA 3C2LA 4UAWA 4TURA 5KFAA 3C21A 4ELVA 5KFQA 4P4OA 5J2AA 4UB1A 1NO5A 2ZH7A 3L9DA 3M9NB 3RRHA 1X9WA 2JEGA 2C22A 8ICYA 3MDCA 3AQKA 4EYHB 3RTVA 1XSNA 1S97A 2PFPA 4IR1A 1S0NA 7ICIA 4X4VA 2JEIA 1IM4A 5KFSA 5HNKA 3HPOA 3H37A 3GIKA 3UPSA 3Q8PB 1ZQHA 4DSJA 4QZCA 5KT7A 3Q8RB 4F91B 2UVRA 4RNOA 4FBUA 1U9LA 2AQ0A 1IXRA 4RT2A 3JPPA 4ED8A 7ICHA 4O3PA 4UBBA 1XS9D 3BQ2A 4QZ8A 2IHMA 1YLQA 4ECVA 1BNPA 4ED1A 4YMOA 2VA8A 5CJ7A 4TQRA 3LWLA 1SKRA 4WC2A 1XO1A 4DOAA 5HR9A 4MFCA 5KT3A 3WFQE 1ZQOA 4O9MA 4UD5A 7ICTA 1PZNA 3V7KA 4I2AA 3SYZA 1BPBA 3EWAA 1L3TA 4C8LA 3AQNA 2HHXA 2XO7A 4ED3A 2ZJ5A 2BQRA 4S3NA 3PX4A 4B9SA 5EWGA 1NKCA 5F2VO 1TAQA 3JPOA 3TANA 3OUYB 2DRBA 5L9XA 3H8SA 4UB2A 2I1QA 4LT6A 3RH5A 4PHAA 4J9RA 8ICEA 4F4YA 8ICIA 2ZH8A 1HJPA 3KTQA 4Z6EA 9ICQA 1UEUA 4FH5A 4LZGA 2DR5A 4PHPA 5KFVA 2ISOA 4J9OA 5J0PA 2W8LA 5KFWA 4RZRA 1NKEA 4E7XA 1V9PA 2DPIA 1ZQKA 1JAJA 2M9NA 4QZGA 3AU2A 5DLFA 4RWNA 3HP6A 2I9GA 1Y88A 3PW5A 4RWPA 1TVAA 2FPKA 5KG1A 5KFPA 1NK7A 3KHRA 3PW7A 4DQIA 4KLOA 9ICPA 3KHGA 1NK9A 3HW8A 9ICEA 2ZTEA 8ICUA 1A77A 1ZJMA 4JK1A 3C1ZA 4ECQA 1K1QA 2RFFA 2GWSA 4R64A 2ZH6A 3WFPA 3GFKB 4DS4A 5KG6A 5DBBA 5L1KA 1DGSA 2ID1A 2UVVA 3T3FA 2R8KA 4TUPA 2HHTA 3E2EA 5J0WA 1DOQA 4RU9A 1RYSA 2M2WA 5HRLA 4LVSA 4UB5A 2ZH2A 2ZUBA 1EXNA 4RQ3A 3PO4A 3M9OB 5KFIA 2R8HA 3MFHA 5HMMA 2OWOA 2W9CA 3RAQA 4I27A 9ICNA 4X4PA 5DLGA 1COOA 2BPGA 4I2CA 7ICEA 1K1SA 5DBCA 4RNMA 4F4WA 5KG2A 3AQLA 4LZDA 3EPIA 1BPYA 4XQ8A 3PX0A 4C8OA 4F5RA 4ECTA 4RQ6A 4FS1A 4DL6A 3PW4A 1JN3A 4M6WA 4YXMA 4I29A 4KLQA 1HUZA 2HHPA 4NKTA 4R65A 5KFFA 7ICKA 1BPEA 4WC3A 3KHLA 4KMUA 4QWDA 4P4PA 3MGIA 4E80A 4ED2A 2FLLA 1SKSA 4GXJA 4FO6A 3ZDBA 1S76D 8ICOA 2BCUA 2AGPA 4DL5A 1ZQBA 4B9MA 3JPSA 1TV9A 2ZJ8A 5EWEA 1SL1A 4WC7A 4DLGA 3NTUA 5KG7A 3K75D 4YP3A 2BHNA 1KFDA 4NXZA 1XSLA 2PXIA 1KTQA 4RPXA 5F9LA 3JPNA 2DVIA 5IINA 1NJZA 1ZQUA 1TKDA 3HT3A 4F4XA 4DQPA 5BOMA 1L3UA 3RB3A 4ECYA 4O3RA 1BPDA 4B9UA 3G6VA 2AU0A 1TK0A 5HRGA 3G6YA 4NLZA 3H7IA 3HJ4A 2C2DA 1ZQDA 4YN4A 3C5FA 1ZQXA 7ICMA 5J0OA 1SZPA 2A1JA 1TK8A 4I2JA 1T7PA 3Q8KA 1JXEA 1MIVA 1TFWA 4R63A 4O5KA 4ATBB 4GC7A 4I2BA 1CEZA 4AT8A 4EBDA 3MABA 5L1LA 5HRDA 8ICRA 3FYHA 2ASLA 4R66A 4DSFA 3IM1A 2VA3A 3ORYA 5HREA 2AJQA 4PHDA 4RQ8A 4J9PA 3ZDAA 5KT4A 4UB4A 3Q8QB 5CR0A 2JEFA 5J0QA 3RB6A 4G3IA 2ZH3A 1ZQVA 4QZHA 5KFOA 4ELUA 4QZ9A 1ZJNA 1NK5A 4O3QA 4P4MA 3PNCA 3RR7A 3BQ1A 1ZETA 1R8CA 1KRPA 3PR5B 2H5XA 3PR4A 4YFKA 4ECUA 1N48A 3UXPA 4ED0A 1XSPA 3ISDA 1N56A 5HRIA 1Q78A 4RQ4A 2KP7A 4NLNA 2R8IA 1S9FA 1XWLA 4NLGA 3H8WA 4WC6A 5HHHA 1BPXA 1ZQPA 4DLEA 2FMQA 4QWEA 4PGYA 5EWFA 4DFKA 2F1JA 4DSIA 9ICCA 4NKUA 8ICLA 5DB7A 4X4OA 5HC9A 2ZH9A 2W9AA 4IRKA 1ZQRA 2PI4A 4BWJA 3JPQA 2DPJA 3MR6A 2J6UA 2ASDA 3RBEA 1NKBA 3RRGA 1JXLA 2IA6A 4PGXA 3TARA 5DBAA 3RJEA 8ICSA 2ZH1A 4MFFA 3JYYA 4C8NA 4M2YA 1Z00B 4QZBA 9ICSA 2HVHA 2RDJA 5HRFA 2ZHBA 4ELTA 3OJSA 3PX6A 4YG2A 3H8JA 5J0XA 2ZTCA 8ICBA 1H38A 3LWMA 4FHPA 3OSNA 1ZQMA 2NRZA 1Z3EB 3KHHA 4DL4A 1VJ7A 4O3OA 5DB9A 4QW8A 2FPMA 3B0YA 4ED6A 4K4IA 2HHQA 3C18A 5DEDA 4X0BA 2FPLA 2ZHAA 3OV7A 2ATLA 5DGBA 4O3SA 3RR8A 5CP2A 1S0VA 7ICOA 4J9NA 1ZQSA 4GXIA 3RH6A 4YD2A 1WCLA 2FMPA 4EZ6A 1R8BA 2ZUDA 4WC5A 4DOBA 5CA7A 4B9VA 4I2GA 1ZQEA 4F8RA 4KLFA 4TQSA 8ICJA 4EBJA 3GIMA 4M9JA 3SI8A 1DK2A 3WFRE 2P6UA 5DG9A 4ECXA 4XA5A 4IQWA 2O5AA 2R8GA 4X4NA 4KN7A 3ZD8A 9ICBA 3OVBA 1ZQIA 2IMWP 5DG8A 7ICGA 4UD4A 9ICFA 5HRHA 3OVSA 8ICGA 1ZQFA 4GC6A 2BCSA 2VA2A 5KFCA 7ICFA 1KFTA 2O1PA 1ZQAA 3QZ7A 1RZTA 9ICKA 3T5JA 5KFYA 2FMSA 2XY5A 1RPLA 4XRHA 1JIHA 4JV0A 1ZQLA 2BCVA 4YVZA 1F5AA 3G6XA 4WC1A 1UA1A 4F5QA 3RAXA 2XCAA 1D8LA 3N4MB 4M9LA 3ZDDA 3BQ0A 1JQRA 2BPCA 4MF8A 4IRDA 3NYBA 5KT5A 3MGHA 4DFPA 2B21A 9ICTA 2ZJAA 1MSWD 2BKEA 3H40A 4AT7B 4R8UB 4ECWA 4J9MA 4M47A 3H39A 3WFOA 5J2JA 4EEYA 4DL2A 4DF4A 5HP4A 1B43A 3Q8LA 4EZ9A 2IBKA 3ZD9A 1KLNA 2NRTA 3GIJA 8ICHA 4QW9A 1QSSA 3ZDEA 5CWRA 3AU6A 4DQSA 2FLNA 5DB6A 4KLGA 2HVIA 5KFTA 5J0YA 5KFZA 5C5JA 4C8MA 4XUSA 3MDAA 7ICPA 2BDPA 3QE9Y 4TUQA 4B9TA 2M2TA 1TAUA 1X9SA 4AT9A 1L3SA 4K4GA 3RB0A 3OVAA 5IILA 4BWMA 4NY8A 2V4RA 3PVXA 5DG7A 1Q79A 1BGXT 2BQ3A 3GV8B 7ICNA 9ICHA 2XY7A 1ZQGA 4O5CA 4KLUA 7ICUA 1QTMA 1JMSA 3C2MA 5D4BA 4EP7A 1BNOA 5KG3A 3PW2A 2BR0A 4X4SA 5DQGA 4RQ0A 4YMNA 2UVUA 4DSKA 3EW9A 4UBCA 3ISBA 3RJIA 1D9DA 4WC4A 3GIIA 4PPXA 1PX5A 1B22A 1U45A 4O3NA 4QZAA 2M2VA 5KFHA 4E8FA 3LK9A 3HX0A 2W9BB 3V6JA 3MR5A 3H4BA 3OGUA 8ICCA 4NLKA 3C1YA 4Z6FA 2MAXA 3UQ2A 4B9LA 5F9NA 4K4HA 5KT6A 1NK0A 4J9LA 2DRAA 3ISCA 3PMNA 3ZDCA 4WBZA 2RDIA 4YR3A 1KNYA 4XQ7A 1L3VA 1L5UA 3TQ1A 1A76A 3GQCA 4B9NA 3V6KA 2BGWA 2PI5A 3WFSC 3TAQA 2JZBB 4YR0A 2P66A 4RQ5A 4DO9A 2HHUA 1MIWA 2W9MA 4KTQA 8ICXA 4FHWA 3RJGA 2Y1JA 1MIYA 3T5HA 4IG8A 9ICVA 4Z6DA 4PH5A 8ICNA 3NGDA 3OUYA 5J2FA 3UXNA 4FBTA 4JWMA 4ECZA 1BPZA 2KFNA 5KFBA 4WC0A 3K4GA 1D8YA 1VFGA 4GXKA 2BCQA 4PHEA 4Q45A 2WTFA 5J0UA 4M04A 1UETA 4BDPA 3IHQB 4DEZA 2V4QA 2Q66A 1C7YA 7ICRA 2DR9A 4DL3A 4F4KA 4WCWA 3H4DA 3OHBA 5KFXA 1U49A 5J0RA 2NRKA 5J2BA 3OHAA 3MBYA 8ICWA 4RT3A 5KFGA 4C8KA 4UB3A 1U4BA 4BGDA 4DFJA 1X9MA 1MQ2A 4I2FA 1MQ3A 3JPRA 4WBYA 4M9NA 1WCNA 4PGQA 8ICZA 1AROP 5CHGA 1SL0A 4I2EA 5J2EA 4UAZA 1QLNA 7ICLA 4M6WB 5J29A 4X4UA 3EZ5A 4ED7A 1T3NA 4IQTA 4BXOB 2XY6A 4P2HA 4I2DA 4KN4A 5L1IA 3H3AA 2DR7A 1ZQJA 4I2HA 3C2KA 4YMMA 1ZQZA 4YD1A 5J2GA 3UQ0A 3PO5A 3V7LA 4TUSA 4KLLA 4DSLA 5IIKA 1RXVA 1QSLA 4X4QA 2KN7A 3QEAZ 1UA0A 3TAPA 4M9HA 2AQ4A 1UT8A 4Q8FA 4QWAA 7ICSA 4AT7A 4R8UA 1XU4A 2LYHA 4ECSA 4YQWA 7ICQA 3HIYA 3FDSA 2P6RA 1R8AA 2PBEA 2F1IA 3THVA 1NK8A 1UT5A 5J2KA 4J9KA 2Y1IA 4RQ7A 2UVWA 3T5LA 5KT2A 3C23A 1DK3A 1OU5A 2ASJA 5KFMA 3V6HA 4F4ZA 1NK4A 4QWCA 3PY8A 1TFYA 5IIMA 2J6TA 1R89A 4M9GA 2PFNA 4J9SA 1V4AA 4JWNA 3BQTA 2A1JB 3BJYA 2Q0ZX 2PFQA 2HW3A 1ZQCA 3RH4A 3GDXA 9ICJA 4EBCA 3PMLA 1NOMA 4KITB 2HHSA 4JV2A 2KZZA 2BQUA 9ICOA 1TK5A 4AT8B 9ICAA 5J2DA 4KLSA 3UPQA 2PFOA 2XGQA 4KLIA 3AUOA 4IQUA 3GV7B 4KLTA 5EOZA 5D46A 8ICVA 4KLJA 5IIOA 5BPCA 5JUMA 1FA0A 4YCXA 2MUTB 3T5KA 4DFMA 1ZYQA 4YR2A 4NM1A 9ICMA 5L1JA 4RPYA 4QZIA 2VANA 2C28A 5KFRA 5KFKA 2W9BA 4DF8A 4F2RA 9ICRA 5J2IA 3SV4A 4DSEA 5DDYA 8ICMA 4RPZA 1S0OA 5KG5A 4I2IA 5HRBA 2KZ3A 4UQGA 4FHYA 3BDPA 8ICFA 4ATBA 4KLEA 9ICLA 1UEVA 1S77D 5KTQA 4DQQA 1JX4A 2JZBA 4O5EA 4X0AA 3LQCB 1U47A 5DECA 2ZH5A 8ICKA 4MEYA 2V9WA 4KLDA 4RWOA 2J6SA 4EYIB 2DR8A 4YXJA 5DKWA 3HWTA 4FS2A 3H38A 4DOCA 1ZQWA 4F93B 3OJUA 3MFIA 5KFDA 7ICJA 5J0TA 2C2RA 4I28A 1MC8A 3MR2A 2DFLA 1T4GA 3MR3A 5J2HA 4Q43A 2ZUCA 1KFSA 1KEJA 3Q8SB 4MF2A 5HHIA 1S0MA 5DDMA 2XGPA 4F50A 3TFSA 5KFEA 3V7JA 3PW0A 2F1HA 8ICTA 1NJWA 4JUZA 4RQ1A 4IRCA 1S10A 3RJKA 4QZEA 3C5GA 1HUOA 5J0SA 4F5PA 2HHWA 4M5DA 2HHVA 4Q44A 4KLHA 3GILA 5KG0A 2XCPA 1ZQYA 2IHNA 4DWIA 2KTQA 2NRXA 3ETLA 4O0IA 5KFJA 4IR9A 3C66A 4FHXA 2M2UA 5DGAA 3EYZA 3TI0A 4IQVA 1KSPA 2FLPA 3AQMA 2ZTDA 4FHVA 4QWBA 1KDHA 5HMLA 1ZQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8E A;  2JEJ A;  4X4R A;  4BXO A;  1Z00 A;  3EPG A;  4DQR A;  1ZQT A;  4MEX A;  9ICX A;  1U48 A;  4HYK A;  4QZF A;  3RB4 A;  3JPT A;  3OSP A;  5D49 A;  3Q8M A;  3HJ1 A;  5DB8 A;  4NM2 A;  2BPF A;  3N97 B;  4JV1 A;  5J2C A;  1XC9 A;  2BCR A;  2ZH4 A;  3RBD A;  4QZD A;  3LDA A;  8ICQ A;  5DQI A;  2AGQ A;  1NJX A;  4F92 B;  4F3O A;  4EBK A;  2NRW A;  2XC9 A;  4E0D A;  9ICI A;  3V72 A;  4DS5 A;  5HRK A;  1QSY A;  2BE3 A;  2R8J A;  4UAY A;  8ICP A;  4FH3 A;  1X2I A;  7ICV A;  2AGO A;  3M8R A;  4EBE A;  1RYR A;  1D9F A;  3M8S A;  9ICW A;  5IIJ A;  2KFZ A;  4KLM A;  5KFL A;  2C2E A;  1NJY A;  4J9Q A;  2ALZ A;  5BOL A;  2NRV A;  4RUA A;  4X4T A;  5III A;  4CCH A;  9ICU A;  1NZP A;  4F5N A;  4RUC A;  5TZV A;  2W9C B;  3B0X A;  1NK6 A;  2W8K A;  1WOT A;  4MFA A;  3GV5 B;  3RJH A;  1BVS A;  8ICA A;  4F5O A;  3PV8 A;  4M0A A;  3SZ2 A;  3QZ8 A;  3RJF A;  1SL2 A;  2MUT A;  3TFR A;  2KZM A;  5CB1 A;  3UXO A;  5KFN A;  4RNN A;  4ECR A;  3RJJ A;  9ICG A;  4RWQ A;  2ISP A;  4AT9 B;  3JZ0 A;  4Z6C A;  1LB2 B;  4ZH4 A;  1LV5 A;  4Q8E A;  3M9M B;  4GLX A;  5KG4 A;  3SV3 A;  5DQH A;  1CUK A;  4DL7 A;  1ZQQ A;  5KFU A;  1SKW A;  4RQ2 A;  1RXW A;  4X5V A;  3QEB Z;  4F2S A;  1TFR A;  3C2L A;  4UAW A;  4TUR A;  5KFA A;  3C21 A;  4ELV A;  5KFQ A;  4P4O A;  5J2A A;  4UB1 A;  1NO5 A;  2ZH7 A;  3L9D A;  3M9N B;  3RRH A;  1X9W A;  2JEG A;  2C22 A;  8ICY A;  3MDC A;  3AQK A;  4EYH B;  3RTV A;  1XSN A;  1S97 A;  2PFP A;  4IR1 A;  1S0N A;  7ICI A;  4X4V A;  2JEI A;  1IM4 A;  5KFS A;  5HNK A;  3HPO A;  3H37 A;  3GIK A;  3UPS A;  3Q8P B;  1ZQH A;  4DSJ A;  4QZC A;  5KT7 A;  3Q8R B;  4F91 B;  2UVR A;  4RNO A;  4FBU A;  1U9L A;  2AQ0 A;  1IXR A;  4RT2 A;  3JPP A;  4ED8 A;  7ICH A;  4O3P A;  4UBB A;  1XS9 D;  3BQ2 A;  4QZ8 A;  2IHM A;  1YLQ A;  4ECV A;  1BNP A;  4ED1 A;  4YMO A;  2VA8 A;  5CJ7 A;  4TQR A;  3LWL A;  1SKR A;  4WC2 A;  1XO1 A;  4DOA A;  5HR9 A;  4MFC A;  5KT3 A;  3WFQ E;  1ZQO A;  4O9M A;  4UD5 A;  7ICT A;  1PZN A;  3V7K A;  4I2A A;  3SYZ A;  1BPB A;  3EWA A;  1L3T A;  4C8L A;  3AQN A;  2HHX A;  2XO7 A;  4ED3 A;  2ZJ5 A;  2BQR A;  4S3N A;  3PX4 A;  4B9S A;  5EWG A;  1NKC A;  5F2V O;  1TAQ A;  3JPO A;  3TAN A;  3OUY B;  2DRB A;  5L9X A;  3H8S A;  4UB2 A;  2I1Q A;  4LT6 A;  3RH5 A;  4PHA A;  4J9R A;  8ICE A;  4F4Y A;  8ICI A;  2ZH8 A;  1HJP A;  3KTQ A;  4Z6E A;  9ICQ A;  1UEU A;  4FH5 A;  4LZG A;  2DR5 A;  4PHP A;  5KFV A;  2ISO A;  4J9O A;  5J0P A;  2W8L A;  5KFW A;  4RZR A;  1NKE A;  4E7X A;  1V9P A;  2DPI A;  1ZQK A;  1JAJ A;  2M9N A;  4QZG A;  3AU2 A;  5DLF A;  4RWN A;  3HP6 A;  2I9G A;  1Y88 A;  3PW5 A;  4RWP A;  1TVA A;  2FPK A;  5KG1 A;  5KFP A;  1NK7 A;  3KHR A;  3PW7 A;  4DQI A;  4KLO A;  9ICP A;  3KHG A;  1NK9 A;  3HW8 A;  9ICE A;  2ZTE A;  8ICU A;  1A77 A;  1ZJM A;  4JK1 A;  3C1Z A;  4ECQ A;  1K1Q A;  2RFF A;  2GWS A;  4R64 A;  2ZH6 A;  3WFP A;  3GFK B;  4DS4 A;  5KG6 A;  5DBB A;  5L1K A;  1DGS A;  2ID1 A;  2UVV A;  3T3F A;  2R8K A;  4TUP A;  2HHT A;  3E2E A;  5J0W A;  1DOQ A;  4RU9 A;  1RYS A;  2M2W A;  5HRL A;  4LVS A;  4UB5 A;  2ZH2 A;  2ZUB A;  1EXN A;  4RQ3 A;  3PO4 A;  3M9O B;  5KFI A;  2R8H A;  3MFH A;  5HMM A;  2OWO A;  2W9C A;  3RAQ A;  4I27 A;  9ICN A;  4X4P A;  5DLG A;  1COO A;  2BPG A;  4I2C A;  7ICE A;  1K1S A;  5DBC A;  4RNM A;  4F4W A;  5KG2 A;  3AQL A;  4LZD A;  3EPI A;  1BPY A;  4XQ8 A;  3PX0 A;  4C8O A;  4F5R A;  4ECT A;  4RQ6 A;  4FS1 A;  4DL6 A;  3PW4 A;  1JN3 A;  4M6W A;  4YXM A;  4I29 A;  4KLQ A;  1HUZ A;  2HHP A;  4NKT A;  4R65 A;  5KFF A;  7ICK A;  1BPE A;  4WC3 A;  3KHL A;  4KMU A;  4QWD A;  4P4P A;  3MGI A;  4E80 A;  4ED2 A;  2FLL A;  1SKS A;  4GXJ A;  4FO6 A;  3ZDB A;  1S76 D;  8ICO A;  2BCU A;  2AGP A;  4DL5 A;  1ZQB A;  4B9M A;  3JPS A;  1TV9 A;  2ZJ8 A;  5EWE A;  1SL1 A;  4WC7 A;  4DLG A;  3NTU A;  5KG7 A;  3K75 D;  4YP3 A;  2BHN A;  1KFD A;  4NXZ A;  1XSL A;  2PXI A;  1KTQ A;  4RPX A;  5F9L A;  3JPN A;  2DVI A;  5IIN A;  1NJZ A;  1ZQU A;  1TKD A;  3HT3 A;  4F4X A;  4DQP A;  5BOM A;  1L3U A;  3RB3 A;  4ECY A;  4O3R A;  1BPD A;  4B9U A;  3G6V A;  2AU0 A;  1TK0 A;  5HRG A;  3G6Y A;  4NLZ A;  3H7I A;  3HJ4 A;  2C2D A;  1ZQD A;  4YN4 A;  3C5F A;  1ZQX A;  7ICM A;  5J0O A;  1SZP A;  2A1J A;  1TK8 A;  4I2J A;  1T7P A;  3Q8K A;  1JXE A;  1MIV A;  1TFW A;  4R63 A;  4O5K A;  4ATB B;  4GC7 A;  4I2B A;  1CEZ A;  4AT8 A;  4EBD A;  3MAB A;  5L1L A;  5HRD A;  8ICR A;  3FYH A;  2ASL A;  4R66 A;  4DSF A;  3IM1 A;  2VA3 A;  3ORY A;  5HRE A;  2AJQ A;  4PHD A;  4RQ8 A;  4J9P A;  3ZDA A;  5KT4 A;  4UB4 A;  3Q8Q B;  5CR0 A;  2JEF A;  5J0Q A;  3RB6 A;  4G3I A;  2ZH3 A;  1ZQV A;  4QZH A;  5KFO A;  4ELU A;  4QZ9 A;  1ZJN A;  1NK5 A;  4O3Q A;  4P4M A;  3PNC A;  3RR7 A;  3BQ1 A;  1ZET A;  1R8C A;  1KRP A;  3PR5 B;  2H5X A;  3PR4 A;  4YFK A;  4ECU A;  1N48 A;  3UXP A;  4ED0 A;  1XSP A;  3ISD A;  1N56 A;  5HRI A;  1Q78 A;  4RQ4 A;  2KP7 A;  4NLN A;  2R8I A;  1S9F A;  1XWL A;  4NLG A;  3H8W A;  4WC6 A;  5HHH A;  1BPX A;  1ZQP A;  4DLE A;  2FMQ A;  4QWE A;  4PGY A;  5EWF A;  4DFK A;  2F1J A;  4DSI A;  9ICC A;  4NKU A;  8ICL A;  5DB7 A;  4X4O A;  5HC9 A;  2ZH9 A;  2W9A A;  4IRK A;  1ZQR A;  2PI4 A;  4BWJ A;  3JPQ A;  2DPJ A;  3MR6 A;  2J6U A;  2ASD A;  3RBE A;  1NKB A;  3RRG A;  1JXL A;  2IA6 A;  4PGX A;  3TAR A;  5DBA A;  3RJE A;  8ICS A;  2ZH1 A;  4MFF A;  3JYY A;  4C8N A;  4M2Y A;  1Z00 B;  4QZB A;  9ICS A;  2HVH A;  2RDJ A;  5HRF A;  2ZHB A;  4ELT A;  3OJS A;  3PX6 A;  4YG2 A;  3H8J A;  5J0X A;  2ZTC A;  8ICB A;  1H38 A;  3LWM A;  4FHP A;  3OSN A;  1ZQM A;  2NRZ A;  1Z3E B;  3KHH A;  4DL4 A;  1VJ7 A;  4O3O A;  5DB9 A;  4QW8 A;  2FPM A;  3B0Y A;  4ED6 A;  4K4I A;  2HHQ A;  3C18 A;  5DED A;  4X0B A;  2FPL A;  2ZHA A;  3OV7 A;  2ATL A;  5DGB A;  4O3S A;  3RR8 A;  5CP2 A;  1S0V A;  7ICO A;  4J9N A;  1ZQS A;  4GXI A;  3RH6 A;  4YD2 A;  1WCL A;  2FMP A;  4EZ6 A;  1R8B A;  2ZUD A;  4WC5 A;  4DOB A;  5CA7 A;  4B9V A;  4I2G A;  1ZQE A;  4F8R A;  4KLF A;  4TQS A;  8ICJ A;  4EBJ A;  3GIM A;  4M9J A;  3SI8 A;  1DK2 A;  3WFR E;  2P6U A;  5DG9 A;  4ECX A;  4XA5 A;  4IQW A;  2O5A A;  2R8G A;  4X4N A;  4KN7 A;  3ZD8 A;  9ICB A;  3OVB A;  1ZQI A;  2IMW P;  5DG8 A;  7ICG A;  4UD4 A;  9ICF A;  5HRH A;  3OVS A;  8ICG A;  1ZQF A;  4GC6 A;  2BCS A;  2VA2 A;  5KFC A;  7ICF A;  1KFT A;  2O1P A;  1ZQA A;  3QZ7 A;  1RZT A;  9ICK A;  3T5J A;  5KFY A;  2FMS A;  2XY5 A;  1RPL A;  4XRH A;  1JIH A;  4JV0 A;  1ZQL A;  2BCV A;  4YVZ A;  1F5A A;  3G6X A;  4WC1 A;  1UA1 A;  4F5Q A;  3RAX A;  2XCA A;  1D8L A;  3N4M B;  4M9L A;  3ZDD A;  3BQ0 A;  1JQR A;  2BPC A;  4MF8 A;  4IRD A;  3NYB A;  5KT5 A;  3MGH A;  4DFP A;  2B21 A;  9ICT A;  2ZJA A;  1MSW D;  2BKE A;  3H40 A;  4AT7 B;  4R8U B;  4ECW A;  4J9M A;  4M47 A;  3H39 A;  3WFO A;  5J2J A;  4EEY A;  4DL2 A;  4DF4 A;  5HP4 A;  1B43 A;  3Q8L A;  4EZ9 A;  2IBK A;  3ZD9 A;  1KLN A;  2NRT A;  3GIJ A;  8ICH A;  4QW9 A;  1QSS A;  3ZDE A;  5CWR A;  3AU6 A;  4DQS A;  2FLN A;  5DB6 A;  4KLG A;  2HVI A;  5KFT A;  5J0Y A;  5KFZ A;  5C5J A;  4C8M A;  4XUS A;  3MDA A;  7ICP A;  2BDP A;  3QE9 Y;  4TUQ A;  4B9T A;  2M2T A;  1TAU A;  1X9S A;  4AT9 A;  1L3S A;  4K4G A;  3RB0 A;  3OVA A;  5IIL A;  4BWM A;  4NY8 A;  2V4R A;  3PVX A;  5DG7 A;  1Q79 A;  1BGX T;  2BQ3 A;  3GV8 B;  7ICN A;  9ICH A;  2XY7 A;  1ZQG A;  4O5C A;  4KLU A;  7ICU A;  1QTM A;  1JMS A;  3C2M A;  5D4B A;  4EP7 A;  1BNO A;  5KG3 A;  3PW2 A;  2BR0 A;  4X4S A;  5DQG A;  4RQ0 A;  4YMN A;  2UVU A;  4DSK A;  3EW9 A;  4UBC A;  3ISB A;  3RJI A;  1D9D A;  4WC4 A;  3GII A;  4PPX A;  1PX5 A;  1B22 A;  1U45 A;  4O3N A;  4QZA A;  2M2V A;  5KFH A;  4E8F A;  3LK9 A;  3HX0 A;  2W9B B;  3V6J A;  3MR5 A;  3H4B A;  3OGU A;  8ICC A;  4NLK A;  3C1Y A;  4Z6F A;  2MAX A;  3UQ2 A;  4B9L A;  5F9N A;  4K4H A;  5KT6 A;  1NK0 A;  4J9L A;  2DRA A;  3ISC A;  3PMN A;  3ZDC A;  4WBZ A;  2RDI A;  4YR3 A;  1KNY A;  4XQ7 A;  1L3V A;  1L5U A;  3TQ1 A;  1A76 A;  3GQC A;  4B9N A;  3V6K A;  2BGW A;  2PI5 A;  3WFS C;  3TAQ A;  2JZB B;  4YR0 A;  2P66 A;  4RQ5 A;  4DO9 A;  2HHU A;  1MIW A;  2W9M A;  4KTQ A;  8ICX A;  4FHW A;  3RJG A;  2Y1J A;  1MIY A;  3T5H A;  4IG8 A;  9ICV A;  4Z6D A;  4PH5 A;  8ICN A;  3NGD A;  3OUY A;  5J2F A;  3UXN A;  4FBT A;  4JWM A;  4ECZ A;  1BPZ A;  2KFN A;  5KFB A;  4WC0 A;  3K4G A;  1D8Y A;  1VFG A;  4GXK A;  2BCQ A;  4PHE A;  4Q45 A;  2WTF A;  5J0U A;  4M04 A;  1UET A;  4BDP A;  3IHQ B;  4DEZ A;  2V4Q A;  2Q66 A;  1C7Y A;  7ICR A;  2DR9 A;  4DL3 A;  4F4K A;  4WCW A;  3H4D A;  3OHB A;  5KFX A;  1U49 A;  5J0R A;  2NRK A;  5J2B A;  3OHA A;  3MBY A;  8ICW A;  4RT3 A;  5KFG A;  4C8K A;  4UB3 A;  1U4B A;  4BGD A;  4DFJ A;  1X9M A;  1MQ2 A;  4I2F A;  1MQ3 A;  3JPR A;  4WBY A;  4M9N A;  1WCN A;  4PGQ A;  8ICZ A;  1ARO P;  5CHG A;  1SL0 A;  4I2E A;  5J2E A;  4UAZ A;  1QLN A;  7ICL A;  4M6W B;  5J29 A;  4X4U A;  3EZ5 A;  4ED7 A;  1T3N A;  4IQT A;  4BXO B;  2XY6 A;  4P2H A;  4I2D A;  4KN4 A;  5L1I A;  3H3A A;  2DR7 A;  1ZQJ A;  4I2H A;  3C2K A;  4YMM A;  1ZQZ A;  4YD1 A;  5J2G A;  3UQ0 A;  3PO5 A;  3V7L A;  4TUS A;  4KLL A;  4DSL A;  5IIK A;  1RXV A;  1QSL A;  4X4Q A;  2KN7 A;  3QEA Z;  1UA0 A;  3TAP A;  4M9H A;  2AQ4 A;  1UT8 A;  4Q8F A;  4QWA A;  7ICS A;  4AT7 A;  4R8U A;  1XU4 A;  2LYH A;  4ECS A;  4YQW A;  7ICQ A;  3HIY A;  3FDS A;  2P6R A;  1R8A A;  2PBE A;  2F1I A;  3THV A;  1NK8 A;  1UT5 A;  5J2K A;  4J9K A;  2Y1I A;  4RQ7 A;  2UVW A;  3T5L A;  5KT2 A;  3C23 A;  1DK3 A;  1OU5 A;  2ASJ A;  5KFM A;  3V6H A;  4F4Z A;  1NK4 A;  4QWC A;  3PY8 A;  1TFY A;  5IIM A;  2J6T A;  1R89 A;  4M9G A;  2PFN A;  4J9S A;  1V4A A;  4JWN A;  3BQT A;  2A1J B;  3BJY A;  2Q0Z X;  2PFQ A;  2HW3 A;  1ZQC A;  3RH4 A;  3GDX A;  9ICJ A;  4EBC A;  3PML A;  1NOM A;  4KIT B;  2HHS A;  4JV2 A;  2KZZ A;  2BQU A;  9ICO A;  1TK5 A;  4AT8 B;  9ICA A;  5J2D A;  4KLS A;  3UPQ A;  2PFO A;  2XGQ A;  4KLI A;  3AUO A;  4IQU A;  3GV7 B;  4KLT A;  5EOZ A;  5D46 A;  8ICV A;  4KLJ A;  5IIO A;  5BPC A;  5JUM A;  1FA0 A;  4YCX A;  2MUT B;  3T5K A;  4DFM A;  1ZYQ A;  4YR2 A;  4NM1 A;  9ICM A;  5L1J A;  4RPY A;  4QZI A;  2VAN A;  2C28 A;  5KFR A;  5KFK A;  2W9B A;  4DF8 A;  4F2R A;  9ICR A;  5J2I A;  3SV4 A;  4DSE A;  5DDY A;  8ICM A;  4RPZ A;  1S0O A;  5KG5 A;  4I2I A;  5HRB A;  2KZ3 A;  4UQG A;  4FHY A;  3BDP A;  8ICF A;  4ATB A;  4KLE A;  9ICL A;  1UEV A;  1S77 D;  5KTQ A;  4DQQ A;  1JX4 A;  2JZB A;  4O5E A;  4X0A A;  3LQC B;  1U47 A;  5DEC A;  2ZH5 A;  8ICK A;  4MEY A;  2V9W A;  4KLD A;  4RWO A;  2J6S A;  4EYI B;  2DR8 A;  4YXJ A;  5DKW A;  3HWT A;  4FS2 A;  3H38 A;  4DOC A;  1ZQW A;  4F93 B;  3OJU A;  3MFI A;  5KFD A;  7ICJ A;  5J0T A;  2C2R A;  4I28 A;  1MC8 A;  3MR2 A;  2DFL A;  1T4G A;  3MR3 A;  5J2H A;  4Q43 A;  2ZUC A;  1KFS A;  1KEJ A;  3Q8S B;  4MF2 A;  5HHI A;  1S0M A;  5DDM A;  2XGP A;  4F50 A;  3TFS A;  5KFE A;  3V7J A;  3PW0 A;  2F1H A;  8ICT A;  1NJW A;  4JUZ A;  4RQ1 A;  4IRC A;  1S10 A;  3RJK A;  4QZE A;  3C5G A;  1HUO A;  5J0S A;  4F5P A;  2HHW A;  4M5D A;  2HHV A;  4Q44 A;  4KLH A;  3GIL A;  5KG0 A;  2XCP A;  1ZQY A;  2IHN A;  4DWI A;  2KTQ A;  2NRX A;  3ETL A;  4O0I A;  5KFJ A;  4IR9 A;  3C66 A;  4FHX A;  2M2U A;  5DGA A;  3EYZ A;  3TI0 A;  4IQV A;  1KSP A;  2FLP A;  3AQM A;  2ZTD A;  4FHV A;  4QWB A;  1KDH A;  5HML A;  1ZQN A; 
#chains in the Genus database with same CATH topology
 4G9B A;  4BXO A;  1Z00 A;  4DQR A;  1ZQT A;  5AHX A;  4HYK A;  4QZF A;  4RQN A;  3KFU F;  3JPT A;  5EE3 A;  5D49 A;  2ZH4 A;  2QAR B;  8ICQ A;  1ZD5 A;  3AM9 A;  5DQI A;  2AGQ A;  4P0Q B;  4F3O A;  1KQQ A;  2G07 A;  4DS5 A;  2R8J A;  1ED1 A;  7ICV A;  2K4P A;  2KJ5 A;  2AGO A;  3M8R A;  3ZI4 A;  4NL9 C;  4Y2S A;  1ZXI A;  9ICW A;  2HMX A;  5AKX A;  2NRV A;  4X4T A;  1NZP A;  4CCH A;  4F5N A;  4RUC A;  5TZV A;  2W9C B;  1NK6 A;  3L3F X;  2W8K A;  3AL0 B;  1BVS A;  8ICA A;  1X6I A;  3QZ8 A;  5CB1 A;  4K9A A;  5KFN A;  4AT9 B;  3JZ0 A;  1LB2 B;  2EAO A;  4ZH4 A;  3M9M B;  1ZD2 P;  5KG4 A;  1ZQQ A;  1SKW A;  2FDR A;  2VJ5 A;  4UAW A;  5KFA A;  4K98 A;  3I1Y A;  3L5K A;  4O67 A;  5KFQ A;  4P4O A;  4UB1 A;  3L9D A;  3M9N B;  2C22 A;  1SZH A;  3MDC A;  4EYH B;  2KKV A;  1XSN A;  1S97 A;  2Y0S C;  2WF6 A;  2JEI A;  5HNK A;  1TAM A;  4FBU A;  3Q8R B;  4RNO A;  1U9L A;  4RT2 A;  3JPP A;  4O3P A;  1SXE A;  4EV6 A;  4ED1 A;  2VA8 A;  5CFS A;  2YB4 A;  4OJP A;  5KT3 A;  3WFQ E;  4NXX A;  3H3A A;  3SYZ A;  1BPB A;  3AQN A;  2HHX A;  3PX4 A;  2F77 X;  4JMU A;  3JPO A;  3TAN A;  2DRB A;  3H8S A;  2GA9 D;  4UB2 A;  2OYY A;  3RH5 A;  2KSO A;  4LZG A;  5KFV A;  4J9O A;  1PK1 B;  2HOF A;  4CRX A;  5JTG A;  4QZG A;  2NV3 A;  5JU5 A;  3UM9 A;  1TVA A;  2EDU A;  5KG1 A;  3KHR A;  1V85 A;  2NO4 A;  3KHG A;  3HW8 A;  9ICE A;  1ZJM A;  3M7D A;  2GWS A;  2K8C B;  3S6J A;  1SWV A;  4EGW A;  2UVV A;  2KE7 A;  2MA1 A;  2R8K A;  2HHT A;  3NVY A;  5HRL A;  2ZH2 A;  4RQ3 A;  2OWO A;  2IUB A;  3RAQ A;  4I27 A;  2QLT A;  4X4P A;  4I2C A;  1COO A;  1SV4 A;  2Y9U A;  3AQL A;  4Y2Q A;  3PX0 A;  4C8O A;  1PVQ A;  2WF8 A;  4DL6 A;  4FS1 A;  2HHP A;  4NKT A;  4WC3 A;  4P4P A;  1SKS A;  8ICO A;  2BCU A;  4LEZ A;  4DL5 A;  5EWE A;  4DLG A;  1KFD A;  3AQF A;  1XSL A;  4USA A;  2PXI A;  4NXW A;  4RPX A;  2DVI A;  3JPN A;  5IIN A;  1ZQU A;  3HT3 A;  5BOM A;  2BBH A;  1OUQ A;  2JH7 A;  1BPD A;  4B9U A;  4NLZ A;  3HJ4 A;  3H7I A;  3NVZ A;  2C2D A;  5J0O A;  1SZP A;  2F76 X;  1T7P A;  3Q8K A;  3HRD D;  5L1L A;  4R66 A;  2VA3 A;  3ORY A;  5TIS U;  2AJQ A;  3F5E A;  2ZH3 A;  1QH9 A;  5CR0 A;  3RB6 A;  5AK4 A;  5KFO A;  1NK5 A;  4P4M A;  2YY6 A;  1TE2 A;  3PR5 B;  3PR4 A;  4ED0 A;  5HRI A;  1N56 A;  1Q78 A;  2KP7 A;  4C0Z A;  1XWL A;  1S9F A;  4NLG A;  4WC6 A;  5HHH A;  1BPX A;  1ZQP A;  4DLE A;  4QWE A;  4DSI A;  1KW4 A;  5AK5 A;  1QCK A;  2PI4 A;  3WK8 A;  1JXL A;  2IA6 A;  2YTU A;  5KNI A;  2EWR A;  4O6A A;  5DBA A;  5ALQ A;  2ZH1 A;  4MFF A;  3JYY A;  4QZB A;  2RDJ A;  5HRF A;  5ALK A;  1Z4O A;  4YG2 A;  3JCF A;  3OSN A;  2NRZ A;  1Z3E B;  1VJ7 A;  2FPM A;  1HIW A;  2ZHA A;  4K4I A;  3OV7 A;  4YD2 A;  1R8B A;  2ZUD A;  2YN4 A;  4WC5 A;  2JH1 A;  4KLF A;  4TQS A;  2W54 A;  3QU4 A;  2WAQ F;  3SI8 A;  3CK6 A;  3N7R C;  3MC1 A;  5DG9 A;  4IQW A;  2JRZ A;  3F2C A;  4X4N A;  9ICB A;  5DG8 A;  7ICG A;  1L6N A;  1KFT A;  2BCS A;  4QNL A;  5KFY A;  2RP5 A;  1Z1B A;  1F5A A;  3EUB 2;  4MHV A;  4YVZ A;  2KK0 A;  3RAX A;  2KIV A;  3N4M B;  1JQR A;  2BPC A;  3NYB A;  2OCE A;  9ICT A;  4J9M A;  1FFU A;  5J2J A;  1S8O A;  2HBM A;  5HP4 A;  1B43 A;  2IBK A;  1KLN A;  2NRT A;  3AU6 A;  4DQS A;  4KLG A;  5ALU A;  2LMR A;  5J0Y A;  2G0A A;  7ICP A;  4TUQ A;  2WF5 A;  2M2T A;  2A1A A;  4K4G A;  2YMM A;  4BWM A;  5DG7 A;  3GV8 B;  3N7P D;  3RFA A;  3C2M A;  3UMB A;  2BR0 A;  2G5I B;  5DQG A;  4RQ0 A;  2UVU A;  4UBC A;  3ISB A;  3N7S C;  1P7D A;  4ICA A;  2KNJ A;  4E8F A;  5G5H A;  2W9B B;  4WQK A;  3C1Y A;  5EE0 A;  2IOF A;  2DF4 B;  3ERC C;  3SEI A;  3PMN A;  3FC4 A;  4B9N A;  5D62 A;  3WFS C;  3PSI A;  4YR0 A;  2HHU A;  1MIW A;  4KTQ A;  4IG8 A;  3RJG A;  2Y1J A;  5JTI A;  2KG5 A;  5ALP A;  9ICV A;  4Z6D A;  3NGD A;  4FBT A;  1J97 A;  4ECZ A;  1D8Y A;  4GXK A;  2E3T A;  2EH9 A;  3IHQ B;  2V4Q A;  4WCW A;  5J0R A;  2HBL A;  3OHA A;  4DFJ A;  4WBY A;  4M9N A;  4PGQ A;  8ICZ A;  5J2E A;  3QU5 A;  2KOB A;  3SD7 A;  2ZXH A;  5CRX A;  2XY6 A;  1V38 A;  4I2H A;  4YD1 A;  3PHZ A;  3V7L A;  4NLC A;  1UA0 A;  4Q8F A;  4QWA A;  1ECW A;  4ECS A;  3QYP A;  4YQW A;  1NK8 A;  5J2K A;  4J9K A;  4RQ7 A;  2UVW A;  5KT2 A;  3RF9 A;  3V6H A;  1NK4 A;  5IIM A;  2E8M A;  1V4A A;  2A1J B;  3BJY A;  2Q0Z X;  5ALG A;  3UMG A;  5CEH A;  3PML A;  3ICX A;  9ICO A;  4JB3 A;  4UAT A;  2XGQ A;  1J2N A;  4IQU A;  4UB8 U;  5IIO A;  5JUM A;  1ZYQ A;  9ICM A;  2WAQ C;  5L1J A;  4RPY A;  5KFR A;  3TAC B;  4FFD A;  4DF8 A;  3SV4 A;  4DSE A;  8ICM A;  4RPZ A;  2W55 A;  5KG5 A;  1UHU A;  3TAD A;  3I28 A;  1J2M A;  5GTI U;  4KLE A;  4DQQ A;  4X0A A;  3LQC B;  5DEC A;  2ZXI A;  4MEY A;  5B3Q A;  2DR8 A;  3KBB A;  5KL8 B;  2F8K A;  1X42 A;  5HHI A;  1S0M A;  3PW0 A;  4UAS A;  4RQ1 A;  1V97 A;  3BS5 B;  3C5G A;  4M5D A;  2ZIV B;  4KLH A;  3GIL A;  1ZQY A;  3IP4 B;  3ETL A;  4O0I A;  4IR9 A;  3MGV A;  1N5X A;  2FLP A;  3AMZ A;  3AQM A;  4FHV A;  4QWB A;  5T14 A;  4WJ3 B;  4C7Z A;  1XC9 A;  4QZD A;  4CDG A;  1JRP A;  4EBK A;  2YQE A;  2XC9 A;  4E0D A;  2KHQ A;  3SAF A;  4EBE A;  1D9F A;  2AHO B;  2EZY A;  5IIJ A;  2KFZ A;  4KLM A;  5KFL A;  2C2E A;  4KB6 A;  1NJY A;  4J9Q A;  5BOL A;  4RUA A;  2G09 A;  1SWW A;  2Q4T A;  3B0X A;  1K5O A;  3GV5 B;  3LVV A;  4F5O A;  2KZM A;  3RJJ A;  3UXO A;  4ECR A;  2ISP A;  2LYA A;  3FAH A;  4I0U A;  1LV5 A;  1NZB A;  5DQH A;  4X5V A;  3QEB Z;  4F2S A;  4TUR A;  4EEN A;  3E0F A;  5J2A A;  1NO5 A;  2ZH7 A;  2CN1 A;  1X9W A;  2ZIU A;  1ZD3 A;  8ICY A;  7ICI A;  2PFP A;  4IR1 A;  4X4V A;  1IM4 A;  5KFS A;  3ED5 A;  4NWI A;  3KKA C;  3Q8P B;  4DSJ A;  3LYS A;  4XQ7 A;  4F91 B;  3CP8 A;  2AQ0 A;  4ED8 A;  7ICH A;  4UBB A;  1YLQ A;  1BNP A;  4YMO A;  1SKR A;  4WC2 A;  2YML A;  1XO1 A;  5HR9 A;  4MFC A;  1ZQO A;  4OAF A;  4UD5 A;  4Y2P A;  2XO7 A;  4ED3 A;  2BQR A;  4PZN A;  1NKC A;  1TAQ A;  2E8P A;  3OUY B;  1ZQ1 C;  2RRD A;  5L9X A;  1F44 A;  4PHA A;  8ICI A;  2ZH8 A;  4F4Y A;  1HJP A;  2KKP A;  4E7X A;  1URJ A;  5KFW A;  1NKE A;  1VDV A;  1YZ6 A;  1V9P A;  2DPI A;  1DRG A;  4RWN A;  2I9G A;  5ALD A;  4RWP A;  1DGJ A;  3ALR A;  2FPK A;  5KFP A;  4KLO A;  4Y2Y A;  2QAR A;  8ICU A;  3QXG A;  1A77 A;  3C1Z A;  4ECQ A;  1K1Q A;  2KVS A;  3WKA A;  4OAH A;  2DL0 A;  1DGS A;  4P0P B;  2ID1 A;  3E2E A;  5J0W A;  1DOQ A;  4KX3 A;  4UB5 A;  1NI3 A;  3K1R B;  2OEH A;  1Q8K A;  1T3Q A;  2GH1 A;  5HMM A;  2W9C A;  5CHE A;  5ALX A;  9ICN A;  5DLG A;  2CPR A;  5DBC A;  3EPI A;  4XQ8 A;  4F5R A;  3PW4 A;  4KLQ A;  4M6W A;  4I29 A;  1HUZ A;  2DQN B;  3KHL A;  2PMZ F;  2NO5 A;  3ZDB A;  3IV6 A;  1ZQB A;  4C4S A;  4WC7 A;  2ZJ8 A;  2A19 A;  1SL1 A;  3NTU A;  2BHN A;  4NXZ A;  2IHO A;  2YMQ A;  1NJZ A;  2G08 A;  4DQP A;  4F4X A;  2KJ8 A;  4OJL A;  3WK5 A;  2FCL A;  1L3U A;  4O3R A;  2LYB A;  3G6V A;  4YN4 A;  1SXD A;  5KAF U;  4I2J A;  1YZ7 A;  1JXE A;  4UAV A;  4U7C A;  4I2B A;  2RQ5 A;  5HRD A;  8ICR A;  4Y2X A;  2ZIW B;  3ETR A;  1FO4 A;  4UB4 A;  5J0Q A;  3BZK A;  4O3Q A;  5B66 U;  3BQ1 A;  1ZET A;  1KRP A;  3F2D A;  4NLN A;  3D6J A;  1PK1 A;  2I5H A;  3NAS A;  2XVT A;  5EWF A;  4NKU A;  2F1J A;  3SEN A;  9ICC A;  5DB7 A;  2ZH9 A;  5ALV A;  3TKA A;  3JPQ A;  3MR6 A;  5ALE A;  1NKB A;  4C8N A;  5ALN A;  1Z00 B;  9ICS A;  4C7Y A;  4HX0 A;  4CF4 A;  3WKB A;  3H8J A;  5J0X A;  2ZTC A;  1H38 A;  3LWM A;  4DL4 A;  5AIA A;  4O3O A;  2HHQ A;  4ED6 A;  4X0B A;  5DED A;  1O08 A;  1S0V A;  7ICO A;  3RR8 A;  4J9N A;  3U26 A;  1ZQS A;  4GXI A;  3RH6 A;  2FMP A;  2G06 A;  2KIW A;  4EBJ A;  3GIM A;  4ECX A;  2GAF D;  2HBJ A;  1PK3 A;  3A0B U;  5AM2 A;  2DKZ A;  5AIB A;  4UD4 A;  5HRH A;  4LJX A;  2O1P A;  1ZQA A;  9ICK A;  4EEL A;  2LBO A;  2FMS A;  1JIH A;  1ZQL A;  3N28 A;  3KD3 A;  4CE6 A;  2AH5 A;  1L7P A;  3ZDD A;  3BQ0 A;  4MF8 A;  5KT5 A;  2B21 A;  2ZJA A;  3H40 A;  4AT7 B;  4R8U B;  5AI8 A;  4M47 A;  1IIP A;  3H39 A;  2D6F C;  2B51 A;  4UAU A;  2FI1 A;  1A6S A;  4QW9 A;  1QSS A;  2E8N A;  5CWR A;  5DB6 A;  2GOL A;  2ESE A;  2KEY A;  2PKE A;  5KFT A;  1F5S A;  1QQ6 A;  4KMO B;  2BDP A;  3QE9 Y;  2H3F A;  3D2Q A;  1L3S A;  4F72 A;  3RB0 A;  4NY8 A;  2V4R A;  2FE9 A;  2JHD A;  5JRT A;  4O5C A;  1QTM A;  1JMS A;  4KM5 A;  4EP7 A;  2LPE A;  1BNO A;  5KG3 A;  3E58 A;  2ZG6 A;  3RJI A;  2M0N A;  1D9D A;  4WC4 A;  3AEV A;  3GII A;  1B22 A;  5KFH A;  2KVC A;  2PMZ C;  3LK9 A;  1L7O A;  3V6J A;  3GZF A;  3MR5 A;  1LVH A;  3H4B A;  2H3V A;  2QB0 A;  4YR3 A;  2Y9T A;  1L3V A;  3GQC A;  3V6K A;  3IDW A;  3TAQ A;  2JZB B;  5ALM A;  4RQ5 A;  2W9M A;  1MIY A;  3T5H A;  3OPX A;  3VCB A;  4WC0 A;  3QNM A;  2BCQ A;  4PHE A;  4Q45 A;  1C7Y A;  4DL3 A;  4F4K A;  2IOF K;  1ZRN A;  4K96 A;  3UMC A;  1WCN A;  1ARO P;  3WK9 A;  4UAZ A;  4CNQ A;  3CRX A;  3KZX A;  4C80 A;  3EZ5 A;  1KL9 A;  1OXJ A;  4I2D A;  4KN4 A;  3F2B A;  5L1I A;  3PO5 A;  4YMM A;  4X4Q A;  1QSL A;  3SR6 A;  2AQ4 A;  4EEK A;  1L8O A;  1XU4 A;  7ICQ A;  2PBE A;  3GU3 A;  3PST A;  1DK3 A;  2ASJ A;  3VC8 A;  1B0X A;  5ALH A;  4JWN A;  5ALZ A;  4U6P A;  2HW3 A;  5AM0 A;  1ZQC A;  9ICJ A;  2IOH A;  2H3Z A;  1NOM A;  4JV2 A;  3UPQ A;  2F44 A;  2PFO A;  3AUO A;  3M6K A;  4K8V A;  3B9J A;  5EOZ A;  4KLJ A;  1FA0 A;  2K8B B;  4YCX A;  2MUT B;  3T5K A;  4DFM A;  2VIX A;  2OM6 A;  4QZI A;  2VAN A;  4AP9 A;  2W9B A;  4F2R A;  5AKY A;  5HRB A;  2YX8 A;  3BDP A;  8ICF A;  4ATB A;  9ICL A;  1UEV A;  4US8 A;  5ALI A;  8ICK A;  5DKW A;  3HWT A;  4DOC A;  3NVO A;  3MFI A;  7ICJ A;  4I28 A;  3MR2 A;  1XNS A;  1T4G A;  4Q43 A;  1KFS A;  5GTH U;  2WHE A;  8ICT A;  3NVW A;  4JUZ A;  3RJK A;  4QZE A;  4F5P A;  1SV0 A;  5KG0 A;  2IHN A;  2KTQ A;  4RQM A;  4NXU A;  2W3R A;  5HML A;  1T8E A;  2JEJ A;  3EPG A;  4MEX A;  4NV0 A;  2KJ9 A;  3RB4 A;  2MRL A;  3OSP A;  3HJ1 A;  5DB8 A;  4NM2 A;  4JV1 A;  1LKY B;  3IRU A;  5J2C A;  2BCR A;  2B56 A;  3LDA A;  2W11 A;  1NJX A;  2KIC A;  2NRW A;  2BDU A;  3V72 A;  5HRK A;  1QSY A;  4C4R A;  8ICP A;  4NLB A;  4OO1 J;  1RQL A;  3M8S A;  2WB1 F;  2K89 A;  3QUQ A;  5G5G A;  4PZO A;  2ALZ A;  5III A;  9ICU A;  5H2F U;  3RJH A;  2JXJ A;  2DUY A;  3HKZ F;  3PV8 A;  4M0A A;  1SL2 A;  9ICG A;  4Z6C A;  2QB1 A;  2A3V A;  2XI9 A;  4GLX A;  4DL7 A;  1JI7 A;  4RQ2 A;  2JEG A;  3NUQ A;  3AQK A;  3RTV A;  4ZOH C;  4BUG A;  4Y2V A;  3H37 A;  2R18 A;  3T79 A;  3IG5 A;  5AKZ A;  1FEZ A;  5KT7 A;  2UVR A;  4FHP A;  1SB3 C;  1XS9 D;  3BQ2 A;  4QZ8 A;  4ECV A;  5CJ7 A;  3LWL A;  1KBU A;  3OWG A;  7ICT A;  3BS5 A;  3V7K A;  4HAI A;  1ZD4 A;  4S3N A;  3QUB A;  5F2V O;  5EWG A;  4QIW F;  1A0P A;  2O6K A;  8ICE A;  2DR5 A;  3KTQ A;  4Z6E A;  4NL9 A;  1UEU A;  1UQV A;  1X9X A;  3WKC A;  1Q46 A;  5J0P A;  2W8L A;  4RZR A;  1ZQK A;  2M9N A;  5DLF A;  3PW5 A;  4GIB A;  3PW7 A;  9ICP A;  5AKK A;  1NK9 A;  2ZTE A;  3SQI A;  4JK1 A;  1B4F A;  1Z4N A;  1ZOL A;  2ZH6 A;  4R64 A;  3WFP A;  4DS4 A;  5DBB A;  1PVR A;  5L1K A;  5AKE A;  4TUP A;  1RYS A;  3NS1 A;  2WF7 A;  3PO4 A;  5KFI A;  2R8H A;  4LEY A;  2OHF A;  2I6X A;  7ICE A;  1K1S A;  4RNM A;  4F4W A;  3PZP A;  2G5H B;  4ECT A;  5KL1 B;  4YXM A;  4R65 A;  2KMD A;  1BPE A;  3QUC A;  4KMU A;  4QWD A;  5EE9 A;  2BBJ A;  4E80 A;  4ED2 A;  2FLL A;  4GXJ A;  4FO6 A;  2L5Y A;  1S76 D;  2AGP A;  4IC9 A;  2K4E A;  2LKY A;  3AQE A;  1X6J A;  5F9L A;  1TKD A;  4ACO A;  3RB3 A;  4ECY A;  5HRG A;  2E5S A;  3I76 A;  1ZQD A;  3D2N A;  3WKE A;  5KAI U;  2LM1 A;  3DDH A;  1D8B A;  1TFW A;  4R63 A;  4O5K A;  1S5L U;  4GC7 A;  4AT8 A;  4EBD A;  3MAB A;  3FM9 A;  3IM1 A;  1RYU A;  1OW5 A;  4Y2J A;  4PHD A;  4J9P A;  5KT4 A;  5AM4 A;  1KKX A;  1ZQV A;  4QZH A;  2WB1 C;  4QZ9 A;  2DBY A;  3PNC A;  4FZL A;  4YFK A;  5AI5 A;  4NXV A;  1XSP A;  4RQ4 A;  2R8I A;  3H8W A;  2FMQ A;  5HR6 A;  5HC9 A;  2W9A A;  4IRK A;  1ZQR A;  2VKQ A;  3KOO A;  4BWJ A;  3RRG A;  3RBE A;  4WOY A;  5FP0 A;  3TAR A;  3RJE A;  2Y0S F;  1WYG A;  4P0P A;  4ELT A;  5ALW A;  5AI4 A;  3PX6 A;  8ICB A;  5ALF A;  3KHH A;  3C18 A;  2FPL A;  2ATL A;  5DGB A;  4O3S A;  5CP2 A;  2ZIX B;  5CA7 A;  1ZQE A;  4F8R A;  8ICJ A;  4WH5 A;  4M9J A;  1F0M A;  1DK2 A;  3WFR E;  4Y2U A;  2NYV A;  2P6U A;  2O5A A;  4XA5 A;  1FFV A;  2R8G A;  3ZD8 A;  2K4I A;  1ZQI A;  1RM6 C;  5AIC A;  4QIW C;  2F8L A;  3QZ7 A;  3T5J A;  3WU2 U;  4B6J A;  4P0Q A;  5AI9 A;  3NVV A;  4JV0 A;  2BCV A;  3K1Z A;  3G6X A;  4WC1 A;  1KN5 A;  1D8L A;  3MGH A;  4LEV A;  3NRW A;  2HDO A;  1MSW D;  4ECW A;  2JGA A;  4DF4 A;  4EZ9 A;  3Q8L A;  2ZIU B;  3GIJ A;  1CRX A;  4N7R A;  2ZIW A;  2HVI A;  1PUZ A;  5ALR A;  4UB6 U;  3MCR A;  5ALS A;  3BZC A;  5C5J A;  4C8M A;  4XUS A;  3H0L B;  2D3D A;  4B9T A;  1TAU A;  4AT9 A;  5L1M A;  5ALY A;  3PVX A;  1BGX T;  4Y2R A;  7ICN A;  9ICH A;  2XY7 A;  1ZQG A;  4KLU A;  7ICU A;  5D4B A;  4OJ6 A;  4IL6 U;  4X4S A;  2EZX A;  3EW9 A;  4PPX A;  5AKH A;  1PX5 A;  3CW2 C;  1N61 A;  5AK3 A;  8ICC A;  3WK7 A;  4B9L A;  4NLK A;  4K99 A;  4EEB A;  1JAL A;  2HCF A;  4K4H A;  4J9L A;  3ISC A;  4LEW A;  3C29 A;  2BGW A;  1MA7 A;  1Z1V A;  4DO9 A;  4PH5 A;  5J2F A;  3M1Y A;  1Q3U A;  5KFB A;  3K4G A;  1VFG A;  2WTF A;  4M04 A;  4BDP A;  5AKG A;  3TAD C;  2WF9 A;  3OHB A;  2YB1 A;  5KFX A;  1XO0 A;  1U49 A;  8ICW A;  1T94 A;  2E8O A;  5KFG A;  4UB3 A;  1U4B A;  1MQ2 A;  1X9M A;  1MQ3 A;  4CF5 A;  4FE3 A;  5CHG A;  1SL0 A;  4I2E A;  3CNH A;  4A8E A;  4M6W B;  5J29 A;  1RQN A;  1T3N A;  4BXO B;  4P2H A;  2DR7 A;  1ZQJ A;  5J2G A;  4PJ0 U;  2BZF A;  2EAP A;  4TUS A;  4DSL A;  5IIK A;  1RXV A;  4M9H A;  1UT8 A;  7ICS A;  2GO7 A;  4AT7 A;  4R8U A;  3HIY A;  3FDS A;  3THV A;  1UT5 A;  2OH2 A;  3T5L A;  2VJ4 A;  3C23 A;  1OU5 A;  4BX9 C;  5KFM A;  4F4Z A;  4OD0 A;  3PY8 A;  1TFY A;  5J8Y C;  1R89 A;  4M9G A;  2PFN A;  2D8C A;  1FIQ A;  3BQT A;  5AM3 A;  2PFQ A;  2W3S A;  3RH4 A;  3GDX A;  2HHS A;  2KZZ A;  9ICA A;  4KLS A;  2KV2 A;  5D46 A;  8ICV A;  5BPC A;  5HR7 A;  2JMG A;  4YR2 A;  3HJE A;  2GLE A;  4EX6 A;  4QJF B;  9ICR A;  3M6Z A;  5DDY A;  5AM1 A;  4PL2 A;  4I2I A;  4Y2T A;  4NJ8 A;  1S77 D;  5KTQ A;  3CYM A;  2JZB A;  2V9W A;  2HOQ A;  2AXT U;  4RWO A;  4EYI B;  4FS2 A;  1ZQW A;  4F93 B;  5KFD A;  5J0T A;  2DFL A;  5J2H A;  1RDF A;  2W03 A;  2ZUC A;  4MF2 A;  9ICX A;  5DDM A;  2XGP A;  3TFS A;  5KFE A;  3V7J A;  1NJW A;  1S10 A;  1DXS A;  5J0S A;  2HHW A;  1Z19 A;  2HHV A;  5ALJ A;  2NRX A;  5DGA A;  2ZTD A;  2KSO B;  1KDH A;  4LT6 A;  4NXT A;  4X4R A;  3LVW A;  1U48 A;  3H0M B;  1O03 A;  3Q8M A;  2H3I A;  2BPF A;  4JLZ A;  3N97 B;  2MSN A;  3RBD A;  2P35 A;  3O0F A;  4F92 B;  2ES6 A;  1SIJ A;  9ICI A;  2BE3 A;  4UAY A;  2W7O A;  4FH3 A;  1X2I A;  5B3P A;  3OTQ A;  1RYR A;  1IG6 A;  4EED A;  2K4H A;  1WOT A;  4MFA A;  4K9B A;  2W7P A;  3SZ2 A;  3RJF A;  2MUT A;  3TFR A;  4RNN A;  4RWQ A;  2HBK A;  2MU2 A;  2HN2 A;  4OJO A;  5A0L A;  4Q8E A;  3SV3 A;  1CUK A;  5KFU A;  2DWQ A;  1RXW A;  1TFR A;  3C2L A;  3C21 A;  4ELV A;  3RRH A;  1HEK A;  1S0N A;  2LHT A;  1N5W A;  3HPO A;  3UPS A;  3F5A A;  4UW9 A;  3GIK A;  1ZQH A;  4QZC A;  1JRO A;  2YMP A;  1IXR A;  2QB0 B;  2E1F A;  2DGZ A;  5AI6 A;  2IHM A;  4TQR A;  4DOA A;  4O9M A;  4O68 A;  1PZN A;  4I2A A;  1L3T A;  3EWA A;  4C8L A;  2ZJ5 A;  4B9S A;  5EE1 A;  4KX5 A;  3BS7 A;  3HIL A;  2I1Q A;  3SMV A;  5AKL A;  4J9R A;  1ZRM A;  9ICQ A;  4FH5 A;  4PHP A;  3IG8 A;  2ISO A;  1JAJ A;  3NWI A;  3AU2 A;  4DFD A;  3WKD A;  3HP6 A;  1Y88 A;  1RG6 A;  1LKY A;  1NK7 A;  4DQI A;  4CF3 A;  4JLX A;  2CXY A;  2RFF A;  1YT3 A;  3GFK B;  5KG6 A;  3QUT A;  3T3F A;  4RU9 A;  2M2W A;  4LVS A;  2ZUB A;  1EXN A;  3M9O B;  3MFH A;  2LM4 A;  2FJ6 A;  3A0H U;  2BPG A;  5KG2 A;  1UPH A;  4LZD A;  2DKX A;  1BPY A;  2HOI A;  4OAI Z;  2LI6 A;  4RQ6 A;  3KKA A;  1JN3 A;  5KFF A;  7ICK A;  5F3X B;  3MGI A;  5CFU A;  2JV3 A;  4K97 A;  4B9M A;  4GFJ A;  5ALO A;  3JPS A;  1TV9 A;  3BQ7 A;  1VLB A;  5KG7 A;  1WWU A;  3K75 D;  4YP3 A;  1N62 A;  1KTQ A;  4AYB F;  1UCV A;  5AI0 A;  3H8M A;  2AU0 A;  1TK0 A;  3G6Y A;  3J81 j;  1AQ6 A;  3C5F A;  1ZQX A;  7ICM A;  2A1J A;  2ODG A;  1TK8 A;  3NRZ A;  4ATB B;  1CEZ A;  3ONN A;  3FYH A;  2ASL A;  4DSF A;  3PSF A;  5K4L A;  5HRE A;  2QKQ A;  4RQ8 A;  2KD1 A;  3Q8Q B;  3ZDA A;  4G3I A;  2JEF A;  2CRX A;  5C0Y A;  5AKJ A;  5D63 A;  4ELU A;  1ZJN A;  4CGZ A;  3RR7 A;  1R8C A;  2H5X A;  4ECU A;  1N48 A;  3UXP A;  3ISD A;  3IN5 A;  2N1R A;  4PGY A;  1CI4 A;  4DFK A;  2W04 A;  8ICL A;  2WFA A;  4J03 A;  4F71 A;  2DPJ A;  2J6U A;  2ASD A;  1COK A;  4PGX A;  8ICS A;  4M2Y A;  2OXO A;  3R9K A;  2HVH A;  2ZHB A;  3OJS A;  1N63 A;  3DEE A;  1ZQM A;  4QW8 A;  5DB9 A;  3B0Y A;  2EAM A;  2B6G A;  1C20 A;  2ZIV A;  4OCZ A;  1QQ7 A;  1WCL A;  4EZ6 A;  2K60 A;  4BJQ A;  2B4V A;  4DOB A;  4B9V A;  4I2G A;  5CFT A;  2RLT A;  4KN7 A;  3OVB A;  2IMW P;  4EX7 A;  3SAG A;  9ICF A;  3OVS A;  8ICG A;  1ZQF A;  4GC6 A;  2VA2 A;  7ICF A;  5ALT A;  5KFC A;  3D2S A;  1RZT A;  3QU2 A;  2XY5 A;  3SAH A;  1RPL A;  4XRH A;  2EQY A;  5D61 A;  1UA1 A;  4F5Q A;  4M9L A;  2XCA A;  2H3Q A;  4IRD A;  4DFP A;  4MKP A;  4PL1 A;  2BKE A;  2RHF A;  5AM5 A;  3WFO A;  4EEY A;  4DL2 A;  1MIV A;  1L7M A;  1MN8 A;  3ZD9 A;  8ICH A;  2Z7J A;  3PSP A;  3ZDE A;  2FLN A;  5KFZ A;  4WQL A;  3MDA A;  1X9S A;  4OAG A;  3OVA A;  5IIL A;  1Q79 A;  3WK6 A;  2BQ3 A;  3EF2 A;  4O3M A;  3PW2 A;  1GPJ A;  4YMN A;  4DSK A;  5J8Y A;  2M2V A;  1U45 A;  4O3N A;  4QZA A;  3HX0 A;  1GO3 F;  3AN1 A;  3OGU A;  1WWV A;  4Z6F A;  2MAX A;  5AK6 A;  3UQ2 A;  4FO1 A;  2XIC A;  5F9N A;  3QU7 A;  5KT6 A;  1N60 A;  1NK0 A;  2DRA A;  4US9 A;  3ZDC A;  4WBZ A;  2RDI A;  1KNY A;  4AYB C;  3QU9 A;  1L5U A;  3TQ1 A;  1A76 A;  3H0R B;  2F2A B;  1VJ5 A;  2F3N A;  2PI5 A;  2P66 A;  4FHW A;  4X4O A;  8ICX A;  1X66 A;  2ZIX A;  2E1E A;  8ICN A;  3OUY A;  3UXN A;  4JWM A;  1BPZ A;  2KFN A;  1M6Y A;  4OJ5 A;  5J0U A;  1UET A;  4DCC A;  2JR5 A;  4DEZ A;  2Q66 A;  1NNL A;  2DR9 A;  7ICR A;  2EAN A;  2HI0 A;  3H4D A;  4FZN A;  2NRK A;  5J2B A;  3MBY A;  4RT3 A;  4C8K A;  1JUD A;  2KHV A;  3HKZ C;  4BGD A;  4I2F A;  3JPR A;  3DV9 A;  1QLN A;  7ICL A;  4X4U A;  3C28 A;  4ED7 A;  1WUD A;  4IQT A;  3KZI U;  4UAR A;  3NKU A;  3C2K A;  4KLL A;  1ZQZ A;  3UQ0 A;  3ER9 B;  2KN7 A;  3QEA Z;  3TAP A;  2HN1 A;  1L7N A;  2LYH A;  2B0C A;  2P6R A;  1R8A A;  2F1I A;  1SV0 C;  2Y1I A;  3ER8 C;  2EZZ A;  4QWC A;  4O69 A;  2J6T A;  4J9S A;  1N2X A;  2HSZ A;  4FZM A;  4EBC A;  4KIT B;  5AKI A;  2BQU A;  1TK5 A;  4AT8 B;  1L8L A;  1X40 A;  5J2D A;  1Q3V A;  4KLI A;  1SGG A;  3GV7 B;  4KLT A;  4NM1 A;  2C28 A;  1PVP A;  5KFK A;  5J2I A;  5ALL A;  3L4P A;  1S0O A;  1QQ5 A;  2KZ3 A;  4UQG A;  4FHY A;  4IS7 A;  1JX4 A;  4O5E A;  2ZH5 A;  1U47 A;  4KLD A;  2J6S A;  2XID A;  4YXJ A;  3H38 A;  1WG8 A;  2W43 A;  3K7D A;  3OJU A;  2C2R A;  1MC8 A;  5E79 U;  3MR3 A;  1KEJ A;  3Q8S B;  4F50 A;  2F1H A;  3QX7 A;  3WK4 A;  4IRC A;  1IV8 A;  2K8A A;  1HUO A;  4Q44 A;  2XCP A;  4XJE A;  4DWI A;  5KFJ A;  3C66 A;  4FHX A;  2M2U A;  3F53 A;  3EYZ A;  3TI0 A;  4IQV A;  1KSP A;  4C4T A;  5B5E U;  1ZQN A; 
#chains in the Genus database with same CATH homology
 1T8E A;  2JEJ A;  4X4R A;  4BXO A;  1Z00 A;  3EPG A;  4DQR A;  1ZQT A;  4MEX A;  9ICX A;  1U48 A;  4HYK A;  4QZF A;  3RB4 A;  3JPT A;  3OSP A;  5D49 A;  3Q8M A;  3HJ1 A;  5DB8 A;  4NM2 A;  2BPF A;  3N97 B;  4JV1 A;  5J2C A;  1XC9 A;  2BCR A;  2ZH4 A;  3RBD A;  4QZD A;  3LDA A;  8ICQ A;  5DQI A;  2AGQ A;  1NJX A;  4F92 B;  4F3O A;  4EBK A;  2NRW A;  2XC9 A;  4E0D A;  9ICI A;  3V72 A;  4DS5 A;  5HRK A;  1QSY A;  2BE3 A;  2R8J A;  4UAY A;  8ICP A;  4FH3 A;  1X2I A;  7ICV A;  2AGO A;  3M8R A;  4EBE A;  1RYR A;  1D9F A;  3M8S A;  9ICW A;  5IIJ A;  2KFZ A;  4KLM A;  5KFL A;  2C2E A;  1NJY A;  4J9Q A;  2ALZ A;  5BOL A;  2NRV A;  4RUA A;  4X4T A;  5III A;  4CCH A;  9ICU A;  1NZP A;  4F5N A;  4RUC A;  5TZV A;  2W9C B;  3B0X A;  1NK6 A;  2W8K A;  1WOT A;  4MFA A;  3GV5 B;  3RJH A;  1BVS A;  8ICA A;  4F5O A;  3PV8 A;  4M0A A;  3SZ2 A;  3QZ8 A;  3RJF A;  1SL2 A;  2MUT A;  3TFR A;  2KZM A;  5CB1 A;  3UXO A;  5KFN A;  4RNN A;  4ECR A;  3RJJ A;  9ICG A;  4RWQ A;  2ISP A;  4AT9 B;  3JZ0 A;  4Z6C A;  1LB2 B;  4ZH4 A;  1LV5 A;  4Q8E A;  3M9M B;  4GLX A;  5KG4 A;  3SV3 A;  5DQH A;  1CUK A;  4DL7 A;  1ZQQ A;  5KFU A;  1SKW A;  4RQ2 A;  1RXW A;  4X5V A;  3QEB Z;  4F2S A;  1TFR A;  3C2L A;  4UAW A;  4TUR A;  5KFA A;  3C21 A;  4ELV A;  5KFQ A;  4P4O A;  5J2A A;  4UB1 A;  1NO5 A;  2ZH7 A;  3L9D A;  3M9N B;  3RRH A;  1X9W A;  2JEG A;  2C22 A;  8ICY A;  3MDC A;  3AQK A;  4EYH B;  3RTV A;  1XSN A;  1S97 A;  2PFP A;  4IR1 A;  1S0N A;  7ICI A;  4X4V A;  2JEI A;  1IM4 A;  5KFS A;  5HNK A;  3HPO A;  3H37 A;  3GIK A;  3UPS A;  3Q8P B;  1ZQH A;  4DSJ A;  4QZC A;  5KT7 A;  3Q8R B;  4F91 B;  2UVR A;  4RNO A;  4FBU A;  1U9L A;  2AQ0 A;  1IXR A;  4RT2 A;  3JPP A;  4ED8 A;  7ICH A;  4O3P A;  4UBB A;  1XS9 D;  3BQ2 A;  4QZ8 A;  2IHM A;  1YLQ A;  4ECV A;  1BNP A;  4ED1 A;  4YMO A;  2VA8 A;  5CJ7 A;  4TQR A;  3LWL A;  1SKR A;  4WC2 A;  1XO1 A;  4DOA A;  5HR9 A;  4MFC A;  5KT3 A;  3WFQ E;  1ZQO A;  4O9M A;  4UD5 A;  7ICT A;  1PZN A;  3V7K A;  4I2A A;  3SYZ A;  1BPB A;  3EWA A;  1L3T A;  4C8L A;  3AQN A;  2HHX A;  2XO7 A;  4ED3 A;  2ZJ5 A;  2BQR A;  4S3N A;  3PX4 A;  4B9S A;  5EWG A;  1NKC A;  5F2V O;  1TAQ A;  3JPO A;  3TAN A;  3OUY B;  2DRB A;  5L9X A;  3H8S A;  4UB2 A;  2I1Q A;  4LT6 A;  3RH5 A;  4PHA A;  4J9R A;  8ICE A;  4F4Y A;  8ICI A;  2ZH8 A;  1HJP A;  3KTQ A;  4Z6E A;  9ICQ A;  1UEU A;  4FH5 A;  4LZG A;  2DR5 A;  4PHP A;  5KFV A;  2ISO A;  4J9O A;  5J0P A;  2W8L A;  5KFW A;  4RZR A;  1NKE A;  4E7X A;  1V9P A;  2DPI A;  1ZQK A;  1JAJ A;  2M9N A;  4QZG A;  3AU2 A;  5DLF A;  4RWN A;  3HP6 A;  2I9G A;  1Y88 A;  3PW5 A;  4RWP A;  1TVA A;  2FPK A;  5KG1 A;  5KFP A;  1NK7 A;  3KHR A;  3PW7 A;  4DQI A;  4KLO A;  9ICP A;  3KHG A;  1NK9 A;  3HW8 A;  9ICE A;  2ZTE A;  8ICU A;  1A77 A;  1ZJM A;  4JK1 A;  3C1Z A;  4ECQ A;  1K1Q A;  2RFF A;  2GWS A;  4R64 A;  2ZH6 A;  3WFP A;  3GFK B;  4DS4 A;  5KG6 A;  5DBB A;  5L1K A;  1DGS A;  2ID1 A;  2UVV A;  3T3F A;  2R8K A;  4TUP A;  2HHT A;  3E2E A;  5J0W A;  1DOQ A;  4RU9 A;  1RYS A;  2M2W A;  5HRL A;  4LVS A;  4UB5 A;  2ZH2 A;  2ZUB A;  1EXN A;  4RQ3 A;  3PO4 A;  3M9O B;  5KFI A;  2R8H A;  3MFH A;  5HMM A;  2OWO A;  2W9C A;  3RAQ A;  4I27 A;  9ICN A;  4X4P A;  5DLG A;  1COO A;  2BPG A;  4I2C A;  7ICE A;  1K1S A;  5DBC A;  4RNM A;  4F4W A;  5KG2 A;  3AQL A;  4LZD A;  3EPI A;  1BPY A;  4XQ8 A;  3PX0 A;  4C8O A;  4F5R A;  4ECT A;  4RQ6 A;  4FS1 A;  4DL6 A;  3PW4 A;  1JN3 A;  4M6W A;  4YXM A;  4I29 A;  4KLQ A;  1HUZ A;  2HHP A;  4NKT A;  4R65 A;  5KFF A;  7ICK A;  1BPE A;  4WC3 A;  3KHL A;  4KMU A;  4QWD A;  4P4P A;  3MGI A;  4E80 A;  4ED2 A;  2FLL A;  1SKS A;  4GXJ A;  4FO6 A;  3ZDB A;  1S76 D;  8ICO A;  2BCU A;  2AGP A;  4DL5 A;  1ZQB A;  4B9M A;  3JPS A;  1TV9 A;  2ZJ8 A;  5EWE A;  1SL1 A;  4WC7 A;  4DLG A;  3NTU A;  5KG7 A;  3K75 D;  4YP3 A;  2BHN A;  1KFD A;  4NXZ A;  1XSL A;  2PXI A;  1KTQ A;  4RPX A;  5F9L A;  3JPN A;  2DVI A;  5IIN A;  1NJZ A;  1ZQU A;  1TKD A;  3HT3 A;  4F4X A;  4DQP A;  5BOM A;  1L3U A;  3RB3 A;  4ECY A;  4O3R A;  1BPD A;  4B9U A;  3G6V A;  2AU0 A;  1TK0 A;  5HRG A;  3G6Y A;  4NLZ A;  3H7I A;  3HJ4 A;  2C2D A;  1ZQD A;  4YN4 A;  3C5F A;  1ZQX A;  7ICM A;  5J0O A;  1SZP A;  2A1J A;  1TK8 A;  4I2J A;  1T7P A;  3Q8K A;  1JXE A;  1MIV A;  1TFW A;  4R63 A;  4O5K A;  4ATB B;  4GC7 A;  4I2B A;  1CEZ A;  4AT8 A;  4EBD A;  3MAB A;  5L1L A;  5HRD A;  8ICR A;  3FYH A;  2ASL A;  4R66 A;  4DSF A;  3IM1 A;  2VA3 A;  3ORY A;  5HRE A;  2AJQ A;  4PHD A;  4RQ8 A;  4J9P A;  3ZDA A;  5KT4 A;  4UB4 A;  3Q8Q B;  5CR0 A;  2JEF A;  5J0Q A;  3RB6 A;  4G3I A;  2ZH3 A;  1ZQV A;  4QZH A;  5KFO A;  4ELU A;  4QZ9 A;  1ZJN A;  1NK5 A;  4O3Q A;  4P4M A;  3PNC A;  3RR7 A;  3BQ1 A;  1ZET A;  1R8C A;  1KRP A;  3PR5 B;  2H5X A;  3PR4 A;  4YFK A;  4ECU A;  1N48 A;  3UXP A;  4ED0 A;  1XSP A;  3ISD A;  1N56 A;  5HRI A;  1Q78 A;  4RQ4 A;  2KP7 A;  4NLN A;  2R8I A;  1S9F A;  1XWL A;  4NLG A;  3H8W A;  4WC6 A;  5HHH A;  1BPX A;  1ZQP A;  4DLE A;  2FMQ A;  4QWE A;  4PGY A;  5EWF A;  4DFK A;  2F1J A;  4DSI A;  9ICC A;  4NKU A;  8ICL A;  5DB7 A;  4X4O A;  5HC9 A;  2ZH9 A;  2W9A A;  4IRK A;  1ZQR A;  2PI4 A;  4BWJ A;  3JPQ A;  2DPJ A;  3MR6 A;  2J6U A;  2ASD A;  3RBE A;  1NKB A;  3RRG A;  1JXL A;  2IA6 A;  4PGX A;  3TAR A;  5DBA A;  3RJE A;  8ICS A;  2ZH1 A;  4MFF A;  3JYY A;  4C8N A;  4M2Y A;  1Z00 B;  4QZB A;  9ICS A;  2HVH A;  2RDJ A;  5HRF A;  2ZHB A;  4ELT A;  3OJS A;  3PX6 A;  4YG2 A;  3H8J A;  5J0X A;  2ZTC A;  8ICB A;  1H38 A;  3LWM A;  4FHP A;  3OSN A;  1ZQM A;  2NRZ A;  1Z3E B;  3KHH A;  4DL4 A;  1VJ7 A;  4O3O A;  5DB9 A;  4QW8 A;  2FPM A;  3B0Y A;  4ED6 A;  4K4I A;  2HHQ A;  3C18 A;  5DED A;  4X0B A;  2FPL A;  2ZHA A;  3OV7 A;  2ATL A;  5DGB A;  4O3S A;  3RR8 A;  5CP2 A;  1S0V A;  7ICO A;  4J9N A;  1ZQS A;  4GXI A;  3RH6 A;  4YD2 A;  1WCL A;  2FMP A;  4EZ6 A;  1R8B A;  2ZUD A;  4WC5 A;  4DOB A;  5CA7 A;  4B9V A;  4I2G A;  1ZQE A;  4F8R A;  4KLF A;  4TQS A;  8ICJ A;  4EBJ A;  3GIM A;  4M9J A;  3SI8 A;  1DK2 A;  3WFR E;  2P6U A;  5DG9 A;  4ECX A;  4XA5 A;  4IQW A;  2O5A A;  2R8G A;  4X4N A;  4KN7 A;  3ZD8 A;  9ICB A;  3OVB A;  1ZQI A;  2IMW P;  5DG8 A;  7ICG A;  4UD4 A;  9ICF A;  5HRH A;  3OVS A;  8ICG A;  1ZQF A;  4GC6 A;  2BCS A;  2VA2 A;  5KFC A;  7ICF A;  1KFT A;  2O1P A;  1ZQA A;  3QZ7 A;  1RZT A;  9ICK A;  3T5J A;  5KFY A;  2FMS A;  2XY5 A;  1RPL A;  4XRH A;  1JIH A;  4JV0 A;  1ZQL A;  2BCV A;  4YVZ A;  1F5A A;  3G6X A;  4WC1 A;  1UA1 A;  4F5Q A;  3RAX A;  2XCA A;  1D8L A;  3N4M B;  4M9L A;  3ZDD A;  3BQ0 A;  1JQR A;  2BPC A;  4MF8 A;  4IRD A;  3NYB A;  5KT5 A;  3MGH A;  4DFP A;  2B21 A;  9ICT A;  2ZJA A;  1MSW D;  2BKE A;  3H40 A;  4AT7 B;  4R8U B;  4ECW A;  4J9M A;  4M47 A;  3H39 A;  3WFO A;  5J2J A;  4EEY A;  4DL2 A;  4DF4 A;  5HP4 A;  1B43 A;  3Q8L A;  4EZ9 A;  2IBK A;  3ZD9 A;  1KLN A;  2NRT A;  3GIJ A;  8ICH A;  4QW9 A;  1QSS A;  3ZDE A;  5CWR A;  3AU6 A;  4DQS A;  2FLN A;  5DB6 A;  4KLG A;  2HVI A;  5KFT A;  5J0Y A;  5KFZ A;  5C5J A;  4C8M A;  4XUS A;  3MDA A;  7ICP A;  2BDP A;  3QE9 Y;  4TUQ A;  4B9T A;  2M2T A;  1TAU A;  1X9S A;  4AT9 A;  1L3S A;  4K4G A;  3RB0 A;  3OVA A;  5IIL A;  4BWM A;  4NY8 A;  2V4R A;  3PVX A;  5DG7 A;  1Q79 A;  1BGX T;  2BQ3 A;  3GV8 B;  7ICN A;  9ICH A;  2XY7 A;  1ZQG A;  4O5C A;  4KLU A;  7ICU A;  1QTM A;  1JMS A;  3C2M A;  5D4B A;  4EP7 A;  1BNO A;  5KG3 A;  3PW2 A;  2BR0 A;  4X4S A;  5DQG A;  4RQ0 A;  4YMN A;  2UVU A;  4DSK A;  3EW9 A;  4UBC A;  3ISB A;  3RJI A;  1D9D A;  4WC4 A;  3GII A;  4PPX A;  1PX5 A;  1B22 A;  1U45 A;  4O3N A;  4QZA A;  2M2V A;  5KFH A;  4E8F A;  3LK9 A;  3HX0 A;  2W9B B;  3V6J A;  3MR5 A;  3H4B A;  3OGU A;  8ICC A;  4NLK A;  3C1Y A;  4Z6F A;  2MAX A;  3UQ2 A;  4B9L A;  5F9N A;  4K4H A;  5KT6 A;  1NK0 A;  4J9L A;  2DRA A;  3ISC A;  3PMN A;  3ZDC A;  4WBZ A;  2RDI A;  4YR3 A;  1KNY A;  4XQ7 A;  1L3V A;  1L5U A;  3TQ1 A;  1A76 A;  3GQC A;  4B9N A;  3V6K A;  2BGW A;  2PI5 A;  3WFS C;  3TAQ A;  2JZB B;  4YR0 A;  2P66 A;  4RQ5 A;  4DO9 A;  2HHU A;  1MIW A;  2W9M A;  4KTQ A;  8ICX A;  4FHW A;  3RJG A;  2Y1J A;  1MIY A;  3T5H A;  4IG8 A;  9ICV A;  4Z6D A;  4PH5 A;  8ICN A;  3NGD A;  3OUY A;  5J2F A;  3UXN A;  4FBT A;  4JWM A;  4ECZ A;  1BPZ A;  2KFN A;  5KFB A;  4WC0 A;  3K4G A;  1D8Y A;  1VFG A;  4GXK A;  2BCQ A;  4PHE A;  4Q45 A;  2WTF A;  5J0U A;  4M04 A;  1UET A;  4BDP A;  3IHQ B;  4DEZ A;  2V4Q A;  2Q66 A;  1C7Y A;  7ICR A;  2DR9 A;  4DL3 A;  4F4K A;  4WCW A;  3H4D A;  3OHB A;  5KFX A;  1U49 A;  5J0R A;  2NRK A;  5J2B A;  3OHA A;  3MBY A;  8ICW A;  4RT3 A;  5KFG A;  4C8K A;  4UB3 A;  1U4B A;  4BGD A;  4DFJ A;  1X9M A;  1MQ2 A;  4I2F A;  1MQ3 A;  3JPR A;  4WBY A;  4M9N A;  1WCN A;  4PGQ A;  8ICZ A;  1ARO P;  5CHG A;  1SL0 A;  4I2E A;  5J2E A;  4UAZ A;  1QLN A;  7ICL A;  4M6W B;  5J29 A;  4X4U A;  3EZ5 A;  4ED7 A;  1T3N A;  4IQT A;  4BXO B;  2XY6 A;  4P2H A;  4I2D A;  4KN4 A;  5L1I A;  3H3A A;  2DR7 A;  1ZQJ A;  4I2H A;  3C2K A;  4YMM A;  1ZQZ A;  4YD1 A;  5J2G A;  3UQ0 A;  3PO5 A;  3V7L A;  4TUS A;  4KLL A;  4DSL A;  5IIK A;  1RXV A;  1QSL A;  4X4Q A;  2KN7 A;  3QEA Z;  1UA0 A;  3TAP A;  4M9H A;  2AQ4 A;  1UT8 A;  4Q8F A;  4QWA A;  7ICS A;  4AT7 A;  4R8U A;  1XU4 A;  2LYH A;  4ECS A;  4YQW A;  7ICQ A;  3HIY A;  3FDS A;  2P6R A;  1R8A A;  2PBE A;  2F1I A;  3THV A;  1NK8 A;  1UT5 A;  5J2K A;  4J9K A;  2Y1I A;  4RQ7 A;  2UVW A;  3T5L A;  5KT2 A;  3C23 A;  1DK3 A;  1OU5 A;  2ASJ A;  5KFM A;  3V6H A;  4F4Z A;  1NK4 A;  4QWC A;  3PY8 A;  1TFY A;  5IIM A;  2J6T A;  1R89 A;  4M9G A;  2PFN A;  4J9S A;  1V4A A;  4JWN A;  3BQT A;  2A1J B;  3BJY A;  2Q0Z X;  2PFQ A;  2HW3 A;  1ZQC A;  3RH4 A;  3GDX A;  9ICJ A;  4EBC A;  3PML A;  1NOM A;  4KIT B;  2HHS A;  4JV2 A;  2KZZ A;  2BQU A;  9ICO A;  1TK5 A;  4AT8 B;  9ICA A;  5J2D A;  4KLS A;  3UPQ A;  2PFO A;  2XGQ A;  4KLI A;  3AUO A;  4IQU A;  3GV7 B;  4KLT A;  5EOZ A;  5D46 A;  8ICV A;  4KLJ A;  5IIO A;  5BPC A;  5JUM A;  1FA0 A;  4YCX A;  2MUT B;  3T5K A;  4DFM A;  1ZYQ A;  4YR2 A;  4NM1 A;  9ICM A;  5L1J A;  4RPY A;  4QZI A;  2VAN A;  2C28 A;  5KFR A;  5KFK A;  2W9B A;  4DF8 A;  4F2R A;  9ICR A;  5J2I A;  3SV4 A;  4DSE A;  5DDY A;  8ICM A;  4RPZ A;  1S0O A;  5KG5 A;  4I2I A;  5HRB A;  2KZ3 A;  4UQG A;  4FHY A;  3BDP A;  8ICF A;  4ATB A;  4KLE A;  9ICL A;  1UEV A;  1S77 D;  5KTQ A;  4DQQ A;  1JX4 A;  2JZB A;  4O5E A;  4X0A A;  3LQC B;  1U47 A;  5DEC A;  2ZH5 A;  8ICK A;  4MEY A;  2V9W A;  4KLD A;  4RWO A;  2J6S A;  4EYI B;  2DR8 A;  4YXJ A;  5DKW A;  3HWT A;  4FS2 A;  3H38 A;  4DOC A;  1ZQW A;  4F93 B;  3OJU A;  3MFI A;  5KFD A;  7ICJ A;  5J0T A;  2C2R A;  4I28 A;  1MC8 A;  3MR2 A;  2DFL A;  1T4G A;  3MR3 A;  5J2H A;  4Q43 A;  2ZUC A;  1KFS A;  1KEJ A;  3Q8S B;  4MF2 A;  5HHI A;  1S0M A;  5DDM A;  2XGP A;  4F50 A;  3TFS A;  5KFE A;  3V7J A;  3PW0 A;  2F1H A;  8ICT A;  1NJW A;  4JUZ A;  4RQ1 A;  4IRC A;  1S10 A;  3RJK A;  4QZE A;  3C5G A;  1HUO A;  5J0S A;  4F5P A;  2HHW A;  4M5D A;  2HHV A;  4Q44 A;  4KLH A;  3GIL A;  5KG0 A;  2XCP A;  1ZQY A;  2IHN A;  4DWI A;  2KTQ A;  2NRX A;  3ETL A;  4O0I A;  5KFJ A;  4IR9 A;  3C66 A;  4FHX A;  2M2U A;  5DGA A;  3EYZ A;  3TI0 A;  4IQV A;  1KSP A;  2FLP A;  3AQM A;  2ZTD A;  4FHV A;  4QWB A;  1KDH A;  5HML A;  1ZQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...