4NM2A

Structure of human dna polymerase beta complexed with a nicked dna containing a 8brg-g at n-1 position and g-c at n position
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
321
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 321
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nm2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nm2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nm2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nm2A03
3TANA 4QZIA 4C8NA 2ZH6A 5KFUA 4EBDA 4J9QA 1MQ3A 4MFFA 1JX4A 4YMOA 4IQWA 2NRXA 3OJSA 3ZDAA 4KLJA 2HVIA 4ATBB 2AQ0A 1SL1A 3OVAA 2ZH9A 1U49A 9ICVA 1XU4A 4AT7A 2DRAA 1U47A 4X4QA 3ISDA 4M6WB 2R8IA 2HHVA 4CCHA 4X4SA 4FHPA 4IG8A 5KT4A 1TFRA 1DK2A 1BNOA 8ICUA 2JZBB 4UD4A 3HT3A 5F9LA 3OHBA 3RH6A 7ICFA 7ICKA 1UEVA 5J0SA 4F2RA 5EWFA 4GLXA 2HHSA 3KHGA 2VA8A 2W8LA 5KFNA 2Y1JA 3UQ0A 2VA3A 4KLMA 2HHWA 9ICMA 3AQNA 4RQ2A 5KG0A 2ZJ5A 4JWMA 4IRCA 1MIYA 4XRHA 1NK6A 2HHUA 8ICXA 8ICKA 2ZTCA 4KITB 7ICHA 5J2KA 5DQHA 5KFSA 1ZQFA 1JQRA 5F9NA 1MIVA 4O5KA 2XGPA 5DB9A 2C22A 2HHXA 5DB7A 2W9MA 8ICNA 4X4TA 3PVXA 3T5HA 1KLNA 4EBCA 1QSSA 1K1SA 3ISCA 2V9WA 4WC1A 4KLDA 1ZQRA 1X9SA 5KG1A 2IBKA 4F5QA 5J2EA 4J9SA 3HW8A 4UB4A 2C28A 4M9HA 4EEYA 3RJKA 1XC9A 1WOTA 1NJXA 3JZ0A 2UVRA 4QZFA 3M8RA 4KN7A 1BPXA 4ED6A 4DSFA 4KN4A 1L3SA 1BNPA 3MR6A 2ISOA 4KLOA 4Q8FA 4F4KA 3AQLA 4WC0A 5KT7A 5CHGA 1ZQYA 2DR8A 4DL4A 2KN7A 8ICIA 1R89A 3H39A 9ICGA 9ICRA 4DL5A 4ED7A 4F93B 4IQTA 3JPRA 4AT7B 2W9AA 4M47A 3C2KA 4EBJA 4YR0A 4FHVA 1TFYA 2DR5A 4DLEA 1ZQAA 4ECVA 3GV7B 4M9LA 4PHPA 5DBBA 3LWMA 3QEBZ 4ELTA 4ECUA 5KT3A 3K4GA 1UT8A 4P4OA 4MEYA 5DKWA 3PMNA 5IINA 4DF8A 2PFNA 1S76D 3C1YA 2DPIA 3GIMA 3GQCA 3T5JA 1HUOA 3THVA 5HNKA 5KFVA 4HYKA 1PZNA 8ICVA 4FBUA 3G6XA 3V7JA 5EWEA 1XSNA 1Q78A 4P4MA 5CJ7A 3V6KA 2M2UA 3AU6A 5KFYA 5DQIA 1XSPA 4WC5A 3OJUA 4X5VA 1N56A 1AROP 1TV9A 3MR5A 5J0PA 4KLIA 2DRBA 4DQQA 2OWOA 3HPOA 4F50A 4GC7A 4YVZA 2P6RA 3RAQA 4JV2A 4J9MA 4YMNA 3PMLA 2Y1IA 1XS9D 1D8LA 4JV0A 4QWEA 2A1JA 1CUKA 3PW4A 4EBEA 1S0OA 3ZDCA 4YG2A 4DEZA 2B21A 1H38A 1ZQCA 3ORYA 4QZDA 3C2MA 4UB1A 4QZAA 3GV5B 4DS5A 3EPGA 1WCLA 2PXIA 2BPGA 4M9GA 3RH5A 5CA7A 1SKWA 4M9NA 4FH3A 3UXPA 3LDAA 2WTFA 4PGQA 4RQ6A 4DOCA 5F2VO 4I2JA 3FYHA 1EXNA 2ZHAA 2ZUBA 1A77A 1L3UA 4I2EA 1C7YA 3V6HA 1RXWA 4MF8A 4J9RA 3Q8SB 3PX6A 3H8SA 1HUZA 3HP6A 8ICOA 3NTUA 9ICXA 4M9JA 4BXOA 2DPJA 3EW9A 3G6YA 3PY8A 4UB3A 3MBYA 1ZQWA 5DB6A 5IIJA 3MFHA 3TFRA 1L5UA 3GILA 4X4OA 1RZTA 5DECA 5KFIA 1Q79A 4B9MA 5J2HA 1KFDA 4NKTA 4I2BA 4DFPA 1SL0A 2DVIA 1UEUA 2FPMA 5KFEA 1ZQLA 4I2IA 1ZQSA 5HRIA 4R66A 1U45A 3ZDBA 4DOAA 1ZQUA 4F5NA 4NM2A 5HMLA 1R8AA 2RDIA 1NJYA 7ICIA 9ICNA 1A76A 3PW2A 2I1QA 3M9OB 4DFJA 2IHMA 4WC4A 1UA1A 1X9WA 2A1JB 3B0XA 1ZQPA 2JEJA 2HHTA 9ICBA 1NKBA 2ZJ8A 4JK1A 3RJFA 5KFRA 4RT3A 3MFIA 5DLGA 4QWAA 2VA2A 3PR4A 4F4ZA 4S3NA 1D8YA 3RBEA 1VFGA 4M04A 2PBEA 1ZETA 3QZ8A 2BGWA 4TQRA 4RNNA 2HW3A 8ICYA 5J29A 8ICTA 3ETLA 8ICPA 8ICRA 3LQCB 1BPBA 8ICHA 4RQ0A 4TUSA 2BCQA 3LK9A 4DWIA 5KFQA 3PNCA 3UPSA 2W8KA 4B9SA 7ICGA 3V7LA 1XO1A 1MSWD 5HR9A 2ISPA 4XA5A 2KZMA 4BXOB 2DFLA 4NXZA 5DBCA 1U48A 4YXMA 3AU2A 4JV1A 3WFQE 1TK0A 4NKUA 4ED2A 1NK9A 2O1PA 3GV8B 5HRBA 3PX0A 5KG4A 4O9MA 4GXIA 8ICFA 4F4YA 4R64A 2XY5A 1ZQTA 4NM1A 3G6VA 4MFCA 9ICLA 4RQ1A 1DOQA 3TARA 5KFOA 4QZHA 4QW8A 2Q0ZX 2XGQA 3TAPA 1NK0A 1L3VA 2KZZA 4X4PA 2ZH8A 5J0QA 4TUPA 4KLUA 3RJGA 1T4GA 1ZYQA 3PV8A 1NKCA 2UVVA 3RJJA 4C8KA 4DO9A 9ICAA 3RBDA 4QZCA 5L1KA 9ICTA 4BWMA 3RH4A 1CEZA 3M8SA 5DG7A 5J0TA 1BPEA 1TKDA 3JPQA 4O3RA 4K4GA 1MIWA 4FHXA 4J9KA 3WFRE 4DFKA 2HHQA 4GXKA 3H4DA 3ZD9A 3MR2A 4DSLA 8ICSA 5DG9A 1ZQQA 4B9VA 1F5AA 5DEDA 9ICKA 5BOMA 1RYRA 2NRVA 4MEXA 4LZDA 1U9LA 4C8MA 4RNMA 2KFNA 1ZQKA 3BQ2A 5CP2A 3RB4A 3OHAA 1T3NA 1KDHA 1FA0A 1ZJMA 4WC3A 3TFSA 4NY8A 5DDYA 5C5JA 2M9NA 3C5GA 1MQ2A 4K4HA 5HRLA 1SKSA 3MGHA 2FMPA 5KTQA 5HHHA 1KRPA 2FMQA 4UAWA 5HRHA 2FPLA 3AQKA 4X0AA 2XO7A 4ECTA 4KTQA 5KT2A 4Z6EA 2ZTDA 4DLGA 4RZRA 4RQ8A 8ICGA 2F1IA 4QWBA 4O0IA 5KFCA 4PGXA 4KLEA 3KTQA 1R8BA 1QSLA 3ZD8A 5L1LA 4I2HA 3SYZA 2BE3A 4WC6A 4O5EA 1ZQOA 3RB6A 5BOLA 3OVSA 4DFMA 3C23A 3RB0A 1S10A 4I28A 5KFPA 4KLFA 2JEGA 2AJQA 4RWPA 4IQVA 3BQ0A 7ICOA 4AT8A 5HHIA 4EYHB 2M2TA 4UD5A 2ZH4A 4J9PA 1N48A 4YD1A 8ICJA 4UB5A 3PR5B 4PHEA 4RNOA 4F5OA 1X9MA 5KG5A 4ELVA 3MDAA 1Z00A 3H8WA 4I29A 3BQTA 1S77D 1NZPA 5KFWA 4ED0A 4F91B 3HWTA 1RPLA 4PH5A 2I9GA 1BPDA 4I2CA 8ICQA 1TFWA 4XUSA 3FDSA 4J9NA 4O5CA 4DQRA 5EOZA 4PHDA 3Q8PB 3IHQB 4RPZA 5D4BA 3OSPA 1UA0A 4I2DA 1ZQJA 2J6TA 7ICEA 2RFFA 4DL2A 2JEFA 5J2BA 1U4BA 3RJHA 5HRDA 4PGYA 3JYYA 1KSPA 3N4MB 2UVWA 2C2EA 4M2YA 4R63A 2XC9A 5IIMA 2ASJA 4X4RA 3H8JA 4BGDA 3V6JA 5L9XA 3C66A 4DL3A 5KT5A 4FS2A 4ECWA 4UBCA 9ICIA 5J2IA 4YR2A 4YFKA 2NRKA 5DBAA 5KFDA 5KFLA 5IIOA 3GIJA 4QW9A 1V4AA 3Q8KA 2NRZA 3BJYA 2FPKA 4XQ8A 4QZEA 3RRGA 5IILA 2ZH1A 9ICUA 7ICSA 5HRKA 4IQUA 5KFXA 1HJPA 4FS1A 4DS4A 8ICLA 3H40A 3H4BA 3UXOA 1ZQVA 4GXJA 3UPQA 4C8OA 1NKEA 4IRKA 5DQGA 2J6UA 4YD2A 3JPPA 2DR9A 1JAJA 4IR9A 1JN3A 2BCVA 2PFQA 1Z00B 4RPYA 4ECXA 4LZGA 2AU0A 1TVAA 3C2LA 4GC6A 9ICWA 3TI0A 8ICMA 2UVUA 3OUYA 3H37A 2W9CA 4RUAA 2V4RA 4O3SA 2KZ3A 4EYIB 4QZGA 1KFTA 4JUZA 1ZQHA 3OV7A 1B22A 2ASLA 2BDPA 4KLSA 4MFAA 4YR3A 3EWAA 3QEAZ 2R8GA 3MGIA 4DSIA 4RWQA 5KG7A 3Q8LA 1T7PA 3JPSA 4NLZA 3NYBA 3WFPA 2F1JA 4F5RA 4XQ7A 2BPCA 3Q8QB 4ED1A 5HC9A 4DL6A 3PW0A 1NK7A 1TK5A 3V72A 3LWLA 2KTQA 4RPXA 2BQUA 2IHNA 1IM4A 8ICAA 3AQMA 4Q44A 1JXLA 4B9NA 9ICPA 3MABA 4ECRA 4J9LA 2R8KA 7ICVA 3HJ1A 8ICEA 4FH5A 3BQ1A 2PI4A 2AQ4A 4UB2A 1WCNA 1NO5A 2DR7A 4NLNA 5CR0A 4YCXA 3WFSC 2W9BA 2AGPA 4RQ4A 1XSLA 4UAYA 8ICCA 4Z6FA 3N97B 2ATLA 4E0DA 3E2EA 2BPFA 5J0XA 3ISBA 1XWLA 4ZH4A 5CB1A 3RTVA 5KFZA 4C8LA 5BPCA 3PO5A 4PPXA 5KFJA 1UETA 4WBZA 5J0RA 4YN4A 2KP7A 4J9OA 4YMMA 4F2SA 3L9DA 4LVSA 4EP7A 5KFHA 5J0UA 1BGXT 1V9PA 4UBBA 5J2DA 2GWSA 4DSJA 1QLNA 2M2VA 2ZTEA 5J2CA 3TAQA 2BQ3A 1PX5A 3OUYB 5L1IA 2W9CB 4B9TA 4G3IA 4RWOA 3OVBA 4X4NA 5KFKA 3OGUA 3OSNA 3Q8MA 2MUTB 1B43A 1SZPA 1K1QA 4QZ8A 4TQSA 4DQSA 4TURA 9ICSA 4O3OA 4O3PA 1MC8A 2MAXA 3C18A 3IM1A 2HVHA 3BDPA 4FHYA 4BDPA 1OU5A 2ZHBA 1RYSA 1QTMA 3JPTA 7ICLA 1NK5A 4B9LA 1VJ7A 1TAUA 3EPIA 5CWRA 3JPOA 1KFSA 3T3FA 2P6UA 2IMWP 5KG6A 4R65A 8ICBA 9ICEA 3PO4A 4AT8B 5KFFA 4DSEA 4ECYA 2AGQA 1SKRA 4F5PA 4KLTA 4ED8A 8ICZA 4E80A 2W9BB 2ALZA 2BHNA 4F4XA 5KG2A 4AT9A 4YQWA 9ICQA 4DQPA 4BWJA 4ELUA 4I2FA 4DSKA 4IRDA 7ICRA 2ZUCA 4Z6CA 3EYZA 4DF4A 5J2AA 2BKEA 2PFOA 2FLNA 2BCUA 4QZBA 4FBTA 4WC7A 3H3AA 3KHRA 1T8EA 2R8JA 3M9NB 5DLFA 1ZQDA 1ZQXA 4DQIA 1L3TA 2C2DA 5J2JA 4R8UB 5DGAA 1ZJNA 5L1JA 4EZ6A 3HIYA 4X4UA 4KLLA 2V4QA 3PW7A 2PFPA 4UQGA 4QWCA 2HHPA 5D46A 3QE9Y 1KEJA 1ZQIA 4KLQA 4ED3A 2XCAA 5J0OA 3GIKA 4DL7A 3MDCA 2FLPA 7ICJA 3B0YA 3ZDDA 5DDMA 1D9DA 3EZ5A 1S97A 1TK8A 3KHLA 9ICOA 3T5KA 4Q43A 9ICHA 4O3QA 3JPNA 3RR8A 4X4VA 2XCPA 2BQRA 2C2RA 7ICUA 2ZH2A 4YXJA 4WCWA 2FMSA 2O5AA 1NJZA 1R8CA 4YP3A 4TUQA 1UT5A 1BPYA 2P66A 4ECQA 1NK4A 4NLGA 1TAQA 3SI8A 5KFGA 4Q45A 5HRGA 2KFZA 4KLGA 4AT9B 1KTQA 1ZQMA 4I2GA 2H5XA 3HX0A 3Q8RB 2ZH7A 5KFMA 4RUCA 2ZH3A 1S0NA 1S0VA 1S0MA 4RU9A 5J2FA 4ECZA 4MF2A 3QZ7A 5J2GA 4EBKA 4KLHA 5JUMA 4B9UA 1Z3EB 4Z6DA 2NRWA 5HP4A 4P2HA 2ID1A 4F92B 4X0BA 7ICQA 4RQ7A 4RQ3A 2PI5A 1NOMA 2VANA 5KFAA 4RQ5A 1COOA 7ICNA 3PW5A 3C5FA 1Y88A 3C21A 5IIIA 4DOBA 5KFBA 1YLQA 5HREA 4E8FA 3T5LA 1BVSA 3MR3A 1ZQBA 2AGOA 1LB2B 3UXNA 1RXVA 4E7XA 1D9FA 2J6SA 4K4IA 3WFOA 1SL2A 5J0WA 4LT6A 3NGDA 3SV3A 9ICJA 5IIKA 4F8RA 5TZVA 1X2IA 3RAXA 2LYHA 2XY7A 1QSYA 5DB8A 4ECSA 4QZ9A 4FO6A 2FLLA 2MUTA 7ICMA 7ICPA 5J0YA 1KNYA 3H38A 2R8HA 1JIHA 1BPZA 3V7KA 7ICTA 4JWNA 3KHHA 2M2WA 4ATBA 1NJWA 4IR1A 2RDJA 4P4PA 2ZUDA 9ICCA 3GIIA 4I2AA 4RWNA 4M6WA 3C1ZA 4WBYA 5DG8A 5EWGA 3RRHA 1ZQGA 3H7IA 4NLKA 1DK3A 5KT6A 2JZBA 3RR7A 2NRTA 4M0AA 3RB3A 4QWDA 5KFTA 1NK8A 1JXEA 3HJ4A 2Q66A 4KMUA 3ZDEA 1S9FA 3GDXA 4O3NA 2F1HA 2XY6A 3SZ2A 4PHAA 2ZJAA 2JEIA 4WC2A 2BCSA 1ZQEA 2BR0A 4Q8EA 4UAZA 4RT2A 1ZQNA 5D49A 3TQ1A 2ASDA 5HRFA 1JMSA 1LV5A 4I27A 3K75D 4F4WA 3RJEA 8ICWA 5DGBA 1IXRA 4M5DA 9ICFA 4F3OA 2IA6A 3UQ2A 1ZQZA 3RJIA 3AUOA 5HMMA 5KG3A 4EZ9A 3GFKB 1DGSA 2BCRA 4FHWA 3M9MB 4R8UA 2ZH5A 3PX4A 3SV4A
chains in the Genus database with same CATH superfamily
4A8EA 2E3TA 3ER8C 4NJ8A 4LEZA 2WHEA 1SXDA 3EF2A 1JX4A 2NRXA 1Q46A 2AQ0A 4IL6U 5JRTA 1JROA 4AT7A 1U47A 4M6WB 4FZLA 4CCHA 2CN1A 5KT4A 2JZBB 7ICFA 7ICKA 5KFNA 3UQ0A 4KLMA 9ICMA 5KG0A 2ZJ5A 2QB0A 1UQVA 1NK6A 8ICKA 4EEKA 5J2KA 4MKPA 1V38A 1ZQFA 4EX7A 2OHFA 5F9NA 5CFUA 2XGPA 2NO5A 2OH2A 2W9MA 3PVXA 1KLNA 3ISCA 1OXJA 4WC1A 3WK8A 5J2EA 4F5QA 4M9HA 4EEYA 3RJKA 3JZ0A 2KV2A 2UVRA 4KN7A 5ALJA 1BNPA 3A0BU 3MR6A 2ISOA 4Q8FA 4F4KA 5KT7A 2DR8A 4DL4A 8ICIA 2ZIXB 9ICGA 1JI7A 4IQTA 4CRXA 5AI4A 2E8NA 4DLEA 3HRDD 4ECVA 5H2FU 4M9LA 4FE3A 4ECUA 1L8LA 4P4OA 2ZIUB 2YQEA 3GIMA 2KJ9A 4CF3A 5KFVA 1PZNA 4FBUA 3G6XA 5KNIA 2CPRA 5CJ7A 2EH9A 5DQIA 4NV0A 4AP9A 4X5VA 1LKYA 3HPOA 1RYUA 3RAQA 4J9MA 4YMNA 1TE2A 1D8LA 4QWEA 2B21A 3L4PA 4DS5A 3GV5B 3EPGA 4FH3A 4DOCA 4PGQA 4RQ6A 2LM1A 2WAQF 1L3UA 1C7YA 5KL1B 3PX6A 2O6KA 3NRZA 4UB3A 3MBYA 5AKXA 1L6NA 4X4OA 3GILA 1RZTA 4B9MA 5J2HA 2BZFA 4I2BA 3AMZA 2FPMA 3ZDBA 4P0QB 4OO1J 4F5NA 1R8AA 2GO7A 4RQNA 1A76A 3SMVA 3PW2A 3DV9A 2H3QA 3PSTA 1UA1A 3B0XA 1X9WA 1ZQPA 2JEJA 1NKBA 5KFRA 5ALHA 3PR4A 4S3NA 3LVWA 2WFAA 4M04A 4TQRA 2HW3A 1J97A 8ICPA 8ICRA 2W7OA 4TUSA 4DWIA 5KFQA 3PNCA 2W8KA 1N61A 4B9SA 1XO1A 5HR9A 2DFLA 2KSOB 4ED2A 2WF5A 3GV8B 3PX0A 4GXIA 2YMQA 3WU2U 3QNMA 4G9BA 3G6VA 4MFCA 4EEBA 4DFDA 5D61A 2Q0ZX 5AK4A 4X4PA 4HAIA 4KLUA 1ZYQA 3PV8A 1NKCA 2VJ4A 9ICAA 2QB1A 3RBDA 4QZCA 5L1KA 1CEZA 5J0TA 5AM0A 2R18A 4GXKA 2MU2A 2BDUA 8ICSA 2HBMA 5BOMA 2LMRA 4C8MA 5JTGA 3BQ2A 2K4HA 1KDHA 1FA0A 3WK4A 5HRLA 2M9NA 2D8CA 5HHHA 1KRPA 2FMQA 5A0LA 1GPJA 2XO7A 4ECTA 5ALWA 2KIWA 4RQ8A 2HDOA 1N62A 1UHUA 3KTQA 1QSLA 5ALOA 2QLTA 2BE3A 1ZQOA 3RB0A 1S10A 2B6GA 7ICOA 4N7RA 1JALA 2LI6A 8ICJA 4F5OA 4C7YA 1Z00A 3H8WA 4I29A 4ED0A 3I76A 2FI1A 1BPDA 8ICQA 5D4BA 4EBJA 4RPZA 3IDWA 3F2DA 2W43A 5ALNA 1HEKA 2I6XA 5J2BA 3BS7A 5G5HA 2KJ8A 4O3MA 3H8MA 4NXXA 4NWIA 4M2YA 4R63A 1PUZA 5IIMA 2FJ6A 5L9XA 3C66A 2DKZA 5EE3A 9ICIA 5J2IA 4YFKA 4KM5A 1V4AA 4QW9A 4QZEA 2YB4A 2ZH1A 1C20A 4IQUA 4OJOA 5KFXA 1N2XA 4IRKA 2DR9A 2Y9TA 2J6UA 4YD2A 1JN3A 5AKGA 2BCVA 3QU2A 2EAMA 1J2MA 4RUAA 2V4RA 4EYIB 1ZQHA 2BDPA 4KLSA 4MFAA 4DSIA 3WKEA 3Q8LA 2FDRA 4NLZA 3WFPA 3TACB 4F5RA 4ED1A 4XQ7A 3CK6A 4NXUA 3V72A 1IM4A 3AQMA 9ICPA 1JXLA 4KX3A 2HI0A 4J9LA 2R8KA 8ICEA 3OPXA 4UB2A 1WCNA 4ICAA 2K8CB 5AM2A 1P7DA 2AGPA 1XSLA 3M6ZA 4UAYA 8ICCA 3N97B 2BPFA 4PPXA 5BPCA 3N28A 5KFJA 4YN4A 5HR6A 4LVSA 4EP7A 4K9BA 1BGXT 2GWSA 5CEHA 2ZTEA 4RWOA 2Q4TA 3D6JA 2XIDA 1K1QA 4NXVA 1MC8A 2MAXA 2HVHA 1RYSA 2F8KA 4FZMA 7ICLA 5ALVA 1TAUA 1KFSA 9ICEA 2AGQA 1N60A 4ECYA 4ED8A 2W9BB 2HBLA 5KG2A 4O69A 3QUQA 2G08A 7ICRA 1Z1VA 5J2AA 4NLBA 3M9NB 5DLFA 1ZQXA 1ECWA 5L1JA 4KLLA 2PFPA 5D46A 1ZQIA 3UMGA 4KLQA 3GIKA 4DL7A 3ZDDA 1D9DA 3EZ5A 3BS5B 1ZOLA 9ICOA 5AI8A 3T5KA 2BQRA 1HIWA 1IV8A 2XVTA 2C2RA 1ZXIA 2O5AA 4GFJA 2P66A 2EWRA 3I28A 1KQQA 3SAHA 4AT9B 1KTQA 2JGAA 3HX0A 2ZH7A 1S0MA 4RU9A 4ECZA 2G09A 1Z3EB 5HP4A 4CF4A 4P2HA 2ID1A 4F92B 7ICQA 4RQ7A 5KFAA 3PW5A 4DOBA 2NYVA 2XICA 4P0PA 3HILA 2AGOA 3UXNA 1LB2B 4E7XA 2K8BB 4K4IA 1FEZA 1DGJA 1SL2A 3WFOA 3NGDA 3SV3A 4Y2PA 2LYHA 1QSYA 4ECSA 4QZ9A 2MUTA 1BPZA 1ZRMA 4OAIZ 4OCZA 4P4PA 2ZUDA 4I2AA 4M6WA 5ALPA 3RRHA 1KW4A 1F5SA 2D6FC 4NLKA 1DK3A 2JZBA 5J8YA 4QWDA 3HJ4A 2Q66A 4KMUA 3ZDEA 4O3NA 5AI0A 2JEIA 2ZJAA 2BCSA 1ZQEA 1GO3F 1N5WA 1JMSA 1LV5A 1XNSA 2IA6A 1L8OA 4CNQA 1SWVA 2ZIVB 4FHWA 2G06A 4LEWA 4R8UA 3SEIA 4QZIA 4JLZA 2H3ZA 4J9QA 4AYBF 2HVIA 3ZDAA 3S6JA 2W55A 1SL1A 2ZIXA 3TKAA 9ICVA 1XU4A 2CRXA 4FHPA 4IG8A 1TFRA 4UD4A 1IIPA 3HT3A 3OHBA 1UEVA 3K1ZA 4GLXA 4F2RA 2Y1JA 2VA3A 2HSZA 2HHWA 4Y2VA 4RQ2A 4IRCA 2ZIUA 2HHUA 1UCVA 3KBBA 2ZTCA 5DQHA 4O5KA 2C22A 2LM4A 1X6JA 2GLEA 5AM1A 4X4TA 1SV0C 2MA1A 2LYBA 1A0PA 1FFVA 2WF6A 1X9SA 2IBKA 4O3SA 2C28A 2ZHAA 3HW8A 4UB4A 1NJXA 1ZD4A 2Y0SF 4KN4A 4EX6A 2A3VA 1YT3A 1KBUA 1ZQYA 3AN1A 2KN7A 3H39A 9ICRA 2W9AA 3SQIA 3C2KA 2DKXA 1TFYA 2DR5A 2EAOA 5J8YC 4PHPA 1M6YA 2A19A 3LWMA 2YMLA 3SENA 4ELTA 4O68A 3K4GA 5IINA 3AM9A 4C4RA 1SV4A 1NI3A 2DPIA 1O03A 3THVA 1T94A 8ICVA 5EWEA 1XSNA 1Q78A 1FFUA 2M2UA 4P0QA 3OJUA 1TV9A 3MR5A 1JUDA 5J0PA 4DQQA 2OWOA 4F50A 4YVZA 2Y1IA 3PMLA 2FE9A 3PW4A 1CUKA 3ONNA 4EBEA 1S0OA 4YG2A 5AKZA 4UB1A 4QZAA 1WCLA 2BPGA 1SKWA 2HOFA 5F2VO 3FYHA 2MRLA 4QJFB 2ZUBA 1A77A 3IG5A 4I2EA 3V6HA 4MF8A 4J9RA 3Q8SB 8ICOA 4U7CA 4UB8U 1L7PA 2YX8A 2KSOA 4F72A 3MFHA 5DECA 1ZQ1C 1Q79A 1KN5A 4NKTA 2F44A 4DFPA 3JCFA 1LVHA 2DVIA 4Y2TA 5KFEA 1ZQSA 5CFTA 1K5OA 1X66A 5HMLA 2RDIA 1NJYA 3WKAA 3M9OB 3KZXA 2A1JB 4EEDA 5AKYA 3RJFA 2HOIA 2VA2A 2BGWA 2EZYA 2W11A 4FZNA 8ICYA 5J29A 3ER9B 2BBJA 3CW2C 3UPSA 4UAUA 2ISPA 4BXOB 1V85A 4NXZA 5DBCA 3AU2A 4JV1A 4CGZA 1TK0A 4NKUA 2KICA 5G5GA 2O1PA 5EE0A 1ZQTA 3UM9A 2A1AA 3D2NA 3TARA 2XGQA 2ZH8A 2KZZA 3R9KA 5J0QA 4TUPA 4FFDA 1T4GA 4CE6A 2E1FA 3M1YA 1TKDA 1MIWA 4J9KA 2KVCA 3H4DA 3MR2A 1F5AA 5DEDA 1ZQQA 4B9VA 1RYRA 1U9LA 4WC3A 2D3DA 5DDYA 3C5GA 2JMGA 3MGHA 1SKSA 5KTQA 2FMPA 5HRHA 4BJQA 2NV3A 3EUB2 3ZD8A 5L1LA 4HX0A 3OVSA 4RWPA 3C23A 4KLFA 2JEGA 5HHIA 2M2TA 4UD5A 1X40A 5ALEA 3PR5B 4PHEA 4RNOA 3MDAA 3SR6A 3BQTA 1NZPA 4F91B 3HWTA 4PH5A 2GOLA 1TFWA 3FDSA 2WAQC 3HKZC 4O5CA 1UA0A 3IRUA 4I2DA 4K96A 2JEFA 1U4BA 2B0CA 3RJHA 1KSPA 2XC9A 4X4RA 3V6JA 2HMXA 4ECWA 5KFDA 3HKZF 1JRPA 2NRZA 3RRGA 4JMUA 9ICUA 3H4BA 1ZQVA 3UPQA 2ZIWB 3JPPA 1OUQA 2OXOA 2PFQA 4LZGA 2AU0A 1TVAA 3FM9A 1Z19A 3AQEA 2KKVA 2UVUA 3IN5A 3H37A 1VLBA 2KZ3A 1Q3UA 1KFTA 3N7PD 4U6PA 3C28A 1B22A 2ODGA 3EWAA 4YR3A 4RWQA 5KG7A 3LYSA 1T7PA 3NYBA 1J2NA 5HC9A 1VDVA 3PW0A 1NK7A 3BQ7A 2KTQA 2BQUA 2E8PA 2WB1F 4KX5A 2ZXIA 4ECRA 3HJ1A 3OTQA 2DR7A 2EZZA 2W9BA 2YB1A 4E0DA 3E2EA 3ERCC 2AHOB 4UB6U 5J0XA 4WBZA 5J0RA 3CYMA 2KP7A 5J2DA 1PX5A 2G5IB 5J2CA 3TAQA 5L1IA 4Y2JA 3OVBA 4X4NA 3OGUA 1S5LU 4F71A 1Z4OA 3WK5A 1ZD5A 4QIWC 2HCFA 1B43A 5AHXA 4TURA 4O3OA 4O3PA 4Y2XA 2N1RA 1AQ6A 3BS5A 1OU5A 3JPTA 3F53A 1VJ7A 5CWRA 2KHVA 3T3FA 3PO4A 4DSEA 1SKRA 4C4SA 2W7PA 3WKBA 4QIWF 2BHNA 4F4XA 2LHTA 4EGWA 4AT9A 4BWJA 4ELUA 4DSKA 3NVVA 4FBTA 3H3AA 3L5KA 1ZQDA 5AI9A 5J2JA 1ZJNA 4EZ6A 2RP5A 3ICXA 2V4QA 2HHPA 1ZRNA 1KEJA 4ED3A 2EDUA 3B0YA 5CHEA 5DDMA 4NLCA 2DQNB 4O3QA 3JPNA 2JRZA 3RR8A 3M7DA 2XCPA 4WCWA 4DCCA 1NJZA 4YP3A 2KHQA 2KFZA 4O67A 5KFMA 4RUCA 5AK6A 4K97A 3A0HU 2OEHA 1NOMA 3SAGA 4RQ5A 3C5FA 1YLQA 5HREA 3T5LA 3QXGA 3WK9A 5J0WA 2ZIVA 9ICJA 2EZXA 4F8RA 1X2IA 5ALRA 7ICPA 2ZXHA 7ICMA 1RM6C 2VJ5A 1N5XA 3KHHA 2WF9A 1F0MA 2KKPA 4IR1A 4USAA 2XI9A 4WBYA 3H7IA 3RR7A 2NRTA 4M0AA 5KFTA 1WWUA 2XY6A 1LKYB 4IC9A 1ZQNA 3WKCA 2KVSA 4I27A 3SD7A 4F4WA 8ICWA 4M5DA 9ICFA 4WH5A 3F5AA 2B4VA 3RJIA 5HMMA 1S8OA 5AM4A 5KL8B 1IG6A 4IS7A 1MQ3A 5CRXA 3OJSA 1X6IA 4KLJA 4ATBB 3OVAA 2ZH9A 1U49A 4X4QA 5AKEA 3ISDA 4LEVA 4X4SA 1PK3A 4EELA 1DK2A 8ICUA 3BZKA 2K4EA 2DRAA 5EWFA 3KHGA 2VA8A 2W8LA 2W04A 4JWMA 1MIYA 4XRHA 1Q3VA 4KITB 3AL0B 1MIVA 3T5HA 3UMBA 1K1SA 3NRWA 2V9WA 4KLDA 1TAMA 5ALQA 1WWVA 1XC9A 2AH5A 2JXJA 4QZFA 3PZPA 1QCKA 3DDHA 2YTUA 4DSFA 1L3SA 4WC0A 2PMZC 4DL5A 5ALKA 4F93B 3JPRA 5HR7A 4M47A 2Y9UA 4YR0A 4FHVA 1ZQAA 3GV7B 5DBBA 3QEBZ 4OJ5A 5KT3A 1UT8A 2KK0A 4MEYA 5AICA 5DKWA 3PMNA 4DF8A 5ALUA 3T5JA 2PMZF 1SGGA 5HNKA 4HYKA 1UPHA 3V7JA 1A6SA 3V6KA 3AU6A 1XSPA 3QU5A 3DEEA 4PZNA 1PK1B 2P6RA 4JV2A 3TADC 1XS9D 4JV0A 2A1JA 3LVVA 3ZDCA 4DEZA 1H38A 1SV0A 3ORYA 4QZDA 1ZQCA 2PXIA 3UXPA 3LDAA 2WTFA 1EXNA 5ALYA 3IG8A 1L7NA 1RXWA 3GU3A 3H8SA 9ICXA 3HP6A 3NTUA 4M9JA 4BXOA 3G6YA 4RQMA 5DB6A 1L5UA 1SL0A 4GIBA 1UEUA 4C80A 1U45A 4DOAA 1ZQUA 2EAPA 7ICIA 9ICNA 4AYBC 5AKIA 4DFJA 5ALTA 2HHTA 2ZG6A 4JK1A 2DWQA 4QWAA 1DRGA 4F4ZA 3RBEA 1VFGA 2F76X 3QZ8A 4RNNA 8ICTA 2DBYA 2IHOA 4Y2UA 3LQCB 4RQ0A 2IOFA 3LK9A 3V7LA 1MSWD 4XA5A 3PHZA 2LPEA 4YXMA 2E1EA 4Y2SA 1NK9A 4CF5A 5HRBA 4O9MA 8ICFA 2XY5A 5AKLA 4RQ1A 1DOQA 1XO0A 5KFOA 1NK0A 1L3VA 9ICTA 3TAPA 2Y0SC 3RJGA 4DO9A 4BWMA 3RH4A 4J03A 3M8SA 1BPEA 4O3RA 3JPQA 3WFRE 4K4GA 4DFKA 2HHQA 3ZD9A 3AQFA 5DG9A 2E8MA 4MEXA 4BX9C 3N7RC 4RNMA 3HJEA 2KE7A 1T3NA 1ZJMA 1MQ2A 5AKKA 4K4HA 3AQKA 2FPLA 4KTQA 3RFAA 3KZIU 2ZTDA 4Z6EA 2F1IA 4O0IA 5KFCA 4PGXA 4KLEA 1R8BA 4OAFA 4I2HA 5AM3A 4WC6A 4O5EA 3RB6A 5BOLA 2AJQA 2JV3A 4I28A 3MC1A 4IQVA 3BQ0A 5AIAA 4J9PA 2K4IA 2ZIWA 3QUTA 4UB5A 1X9MA 3L3FX 5E79U 2I9GA 1RPLA 4XUSA 3MGVA 4PHDA 5ALZA 2W03A 2RFFA 2EANA 7ICEA 4OJ6A 3VCBA 1N63A 5HRDA 1CI4A 3BZCA 4NXWA 2UVWA 1SXEA 2ASJA 3H8JA 5D63A 4DL3A 3AEVA 5KT5A 4NL9C 4FS2A 4UBCA 4YR2A 2CXYA 2KOBA 5KFLA 5IIOA 3Q8KA 3BJYA 4XQ8A 5ALDA 5HRKA 4AT8B 3H40A 4GXJA 1NKEA 5DQGA 5CFSA 4PL2A 2DUYA 4ACOA 2RHFA 1QQ6A 4C4TA 4KMOB 3C2LA 9ICWA 3TI0A 8ICMA 4CDGA 4MHVA 2B51A 4QZGA 3OV7A 3MGIA 2F8LA 2Z7JA 1F44A 3JPSA 2F1JA 3Q8QB 4UASA 4DL6A 2LYAA 4RPXA 3H0MB 4Q44A 5AK3A 7ICVA 4FH5A 5B5EU 2YMMA 2PI4A 3F5EA 3ETRA 4NLNA 2P35A 2M0NA 4PJ0U 4RQ4A 4Z6FA 2B56A 2H3VA 2ATLA 3ISBA 4ZH4A 5CB1A 5KFZA 4C8LA 3WK6A 4YMMA 4F2SA 3L9DA 5J0UA 1WYGA 1V9PA 3PSIA 2K60A 1QLNA 2BQ3A 3OUYB 2W9CB 4B9TA 4G3IA 4EV6A 5KFKA 4BUGA 1SIJA 1WG8A 2MUTB 3PSPA 1RQNA 1SZPA 9ICSA 3IM1A 3BDPA 2DGZA 1QTMA 4ZOHC 5D62A 3EPIA 5FP0A 8ICBA 3N7SC 2P6UA 5KG6A 4R65A 4KLTA 8ICZA 5GTHU 4F5PA 2K89A 9ICQA 4I2FA 3H0RB 2ZUCA 4Z6CA 3EYZA 3ZI4A 2BKEA 2FLNA 2BCUA 4WC7A 3OWGA 2YN4A 3KHRA 1T8EA 4B6JA 4DQIA 1L3TA 4R8UB 2W3SA 4UQGA 4UAVA 5J0OA 3MDCA 1FO4A 2RLTA 4WQLA 1S97A 1TK8A 3T79A 3C29A 3KD3A 5EE1A 7ICUA 2ZH2A 4YXJA 3B9JA 1R8CA 2F3NA 4TUQA 1UT5A 4NLGA 1TAQA 3SI8A 5KFGA 5AIBA 2JH1A 4KLGA 2QARB 4I2GA 2GA9D 2ZH3A 1S0NA 4O6AA 5J2FA 5J2GA 5JUMA 4B9UA 2PKEA 4Z6DA 1O08A 1SB3C 4X0BA 2VANA 1COOA 7ICNA 2ESEA 3C21A 3E58A 5IIIA 1L7MA 3H0LB 4E8FA 1BVSA 2WF8A 2RRDA 1D9FA 2J6SA 5ALSA 2WB1C 4WJ3B 4LT6A 3F2CA 5IIKA 2OM6A 3RAXA 1PVQA 5ALGA 1Z1BA 1SWWA 5DB8A 2HN2A 4FO6A 5AI6A 3WKDA 1X9XA 1RG6A 5J0YA 2R8HA 4K9AA 3V7KA 7ICTA 4ATBA 2JR5A 9ICCA 1ZD2P 3QU4A 1VJ5A 4RWNA 3C1ZA 4LEYA 5EWGA 1ZQGA 2K8AA 5KT6A 2VIXA 2YY6A 3RB3A 1NK8A 1JXEA 1MN8A 3CNHA 3GDXA 2F1HA 4PHAA 4WC2A 2BR0A 4Q8EA 2ASDA 4Y2YA 3TQ1A 5HRFA 3K75D 5DGBA 1IXRA 4FO1A 2G07A 3AUOA 4EZ9A 5B3QA 2BCRA 1DGSA 3M9MB 4XJEA 2ZH5A 3PX4A 3C18A 3TANA 4C8NA 1X42A 2ZH6A 5KFUA 4EBDA 4MFFA 4YMOA 4IQWA 3ED5A 2R8IA 2HHVA 3F2BA 1BNOA 5F9LA 5B66U 3RH6A 5J0SA 7ICHA 2HHSA 3AQNA 2LKYA 1ZD3A 8ICXA 2KNJA 5KFSA 1JQRA 5DB9A 2HHXA 5DB7A 8ICNA 4OAHA 4EBCA 1QSSA 1RDFA 1ZQRA 5KG1A 4J9SA 4OJLA 1PK1A 3M8RA 1BPXA 4ED6A 2AXTU 4KLOA 3AQLA 5CHGA 1R89A 4ED7A 4PZOA 4AT7B 4US9A 3O0FA 3VC8A 5AM5A 2KG5A 1S76D 3QUBA 2PFNA 3D2SA 3C1YA 2QB0B 1HUOA 3GQCA 3FAHA 2JH7A 2HN1A 5AI5A 4P4MA 2GAFD 5KFYA 1PVRA 4WC5A 1N56A 1AROP 2ES6A 4KLIA 2DRBA 4GC7A 4LJXA 3KFUF 1Q8KA 3M6KA 1QQ7A 3GZFA 3C2MA 4M9GA 3RH5A 5CA7A 4M9NA 4I2JA 5AK5A 4OJPA 3NVYA 5ALFA 1HUZA 2DPJA 3EW9A 3PY8A 3PSFA 1ZQWA 2LBOA 5IIJA 3TFRA 5KFIA 4NXTA 1KFDA 5JTIA 5HRIA 1ZQLA 4I2IA 4R66A 4NM2A 1NNLA 4JB3A 2I1QA 2IHMA 4WC4A 9ICBA 3U26A 2ZJ8A 3MFIA 4RT3A 5DLGA 3IP4B 1D8YA 2KIVA 3K1RB 1COKA 2PBEA 1ZETA 3ETLA 3K7DA 1BPBA 8ICHA 2BCQA 3TADA 4Y2RA 7ICGA 2OCEA 5K4LA 2KZMA 1U48A 5ALXA 3WFQE 5KG4A 3I1YA 4F4YA 4R64A 4KB6A 4NM1A 2E8OA 9ICLA 3NUQA 4QZHA 4QW8A 4C8KA 3RJJA 2UVVA 3RF9A 4US8A 4K99A 5DG7A 4FHXA 2EQYA 1DXSA 4DSLA 5TISU 5KAFU 2RQ5A 9ICKA 2F77X 2NRVA 4LZDA 2KFNA 1ZQKA 5CP2A 5GTIU 3OHAA 3RB4A 2VKQA 2I5HA 3J81j 3TFSA 4NY8A 5C5JA 2G5HB 4X0AA 4UAWA 5T14A 2DL0A 5KT2A 4DLGA 8ICGA 4RZRA 4QWBA 3NKUA 4OAGA 3SYZA 3NVZA 4DFMA 5KFPA 4AT8A 4EYHB 2ZH4A 1N48A 4YD1A 5KG5A 4ELVA 1S77D 5KFWA 4I2CA 3QUCA 4J9NA 4DQRA 3Q8PB 5EOZA 5AKJA 3IHQB 4C7ZA 3OSPA 1ZQJA 2J6TA 1D8BA 1QQ5A 1WOTA 2WF7A 4DL2A 5C0YA 2HOQA 3ALRA 4PGYA 3JYYA 3N4MB 4PL1A 2C2EA 1CRXA 4BGDA 1OW5A 2NO4A 2BBHA 2NRKA 5DBAA 2KMDA 3GIJA 2FPKA 2G0AA 5IILA 7ICSA 4K8VA 4FS1A 4DS4A 1HJPA 8ICLA 2DF4B 4K98A 3UXOA 4C8OA 1JAJA 4IR9A 2W3RA 2IOHA 1Z00B 4RPYA 4ECXA 5KAIU 4GC6A 3OUYA 2YMPA 2W9CA 2KJ5A 5F3XB 1PVPA 1KKXA 1SZHA 4JUZA 2ASLA 2R8GA 3QEAZ 1Z4NA 1NZBA 3IV6A 2BPCA 1B4FA 3UMCA 3CRXA 1TK5A 3LWLA 1URJA 2IHNA 8ICAA 4B9NA 3MABA 3BQ1A 1WUDA 2AQ4A 2HBJA 1NO5A 3NVOA 2FCLA 5CR0A 4EENA 4YCXA 4JLXA 3WFSC 1V97A 1XWLA 3RTVA 2GH1A 3PO5A 1UETA 4NL9A 4J9OA 5KFHA 4UBBA 2M2VA 4DSJA 2H3FA 3KKAA 3OSNA 3Q8MA 5EE9A 2HBKA 4QZ8A 4TQSA 4DQSA 2KEYA 3MCRA 4FHYA 4BDPA 2ZHBA 1NK5A 4B9LA 3JPOA 3NWIA 2IMWP 5KFFA 4E80A 2ALZA 1RQLA 4YQWA 1YZ7A 4DQPA 2E5SA 5AKHA 3WK7A 2QARA 4IRDA 4DF4A 4UATA 2PFOA 4QZBA 2KD1A 2R8JA 1FIQA 2C2DA 5DGAA 3QX7A 3HIYA 4X4UA 3PW7A 4QWCA 3QE9Y 2XCAA 3E0FA 2FLPA 7ICJA 2H3IA 2OYYA 3KHLA 3FC4A 4Q43A 9ICHA 2K4PA 2IUBA 4X4VA 4C0ZA 2FMSA 1BPYA 4ECQA 1NK4A 3SAFA 5HRGA 4Q45A 5L1MA 1KL9A 1ZQMA 2H5XA 3Q8RB 2L5YA 3QU7A 1S0VA 5JU5A 4MF2A 3QZ7A 4EBKA 4KLHA 2NRWA 4UARA 3KOOA 4RQ3A 2PI5A 4Y2QA 1QH9A 3KKAC 1Y88A 5ALMA 1T3QA 5KFBA 4WOYA 3MR3A 1ZQBA 1RXVA 3QU9A 4I0UA 3NASA 5TZVA 2XY7A 3NVWA 2FLLA 1KNYA 3H38A 1JIHA 4JWNA 2M2WA 3D2QA 2QKQA 1NJWA 2RDJA 3GIIA 2W54A 5DG8A 3QYPA 2F2AB 4QNLA 5B3PA 1YZ6A 1S9FA 3SZ2A 2MSNA 1L7OA 5ALIA 3CP8A 4UAZA 4RT2A 5D49A 4WQKA 4UW9A 3RJEA 4P0PB 4F3OA 3NS1A 5ALLA 3UQ2A 1ZQZA 1MA7A 2JHDA 5KG3A 3GFKB 2IOFK 1ED1A 4OD0A 1B0XA 3SV4A
chains in the Genus database with same CATH topology
3TANA 4QZIA 4C8NA 2ZH6A 5KFUA 4EBDA 4J9QA 1MQ3A 4MFFA 1JX4A 4YMOA 4IQWA 2NRXA 3OJSA 3ZDAA 4KLJA 2HVIA 4ATBB 2AQ0A 1SL1A 3OVAA 2ZH9A 1U49A 9ICVA 1XU4A 4AT7A 2DRAA 1U47A 4X4QA 3ISDA 4M6WB 2R8IA 2HHVA 4CCHA 4X4SA 4FHPA 4IG8A 5KT4A 1TFRA 1DK2A 1BNOA 8ICUA 2JZBB 4UD4A 3HT3A 5F9LA 3OHBA 3RH6A 7ICFA 7ICKA 1UEVA 5J0SA 4F2RA 5EWFA 4GLXA 2HHSA 3KHGA 2VA8A 2W8LA 5KFNA 2Y1JA 3UQ0A 2VA3A 4KLMA 2HHWA 9ICMA 3AQNA 4RQ2A 5KG0A 2ZJ5A 4JWMA 4IRCA 1MIYA 4XRHA 1NK6A 2HHUA 8ICXA 8ICKA 2ZTCA 4KITB 7ICHA 5J2KA 5DQHA 5KFSA 1ZQFA 1JQRA 5F9NA 1MIVA 4O5KA 2XGPA 5DB9A 2C22A 2HHXA 5DB7A 2W9MA 8ICNA 4X4TA 3PVXA 3T5HA 1KLNA 4EBCA 1QSSA 1K1SA 3ISCA 2V9WA 4WC1A 4KLDA 1ZQRA 1X9SA 5KG1A 2IBKA 4F5QA 5J2EA 4J9SA 3HW8A 4UB4A 2C28A 4M9HA 4EEYA 3RJKA 1XC9A 1WOTA 1NJXA 3JZ0A 2UVRA 4QZFA 3M8RA 4KN7A 1BPXA 4ED6A 4DSFA 4KN4A 1L3SA 1BNPA 3MR6A 2ISOA 4KLOA 4Q8FA 4F4KA 3AQLA 4WC0A 5KT7A 5CHGA 1ZQYA 2DR8A 4DL4A 2KN7A 8ICIA 1R89A 3H39A 9ICGA 9ICRA 4DL5A 4ED7A 4F93B 4IQTA 3JPRA 4AT7B 2W9AA 4M47A 3C2KA 4EBJA 4YR0A 4FHVA 1TFYA 2DR5A 4DLEA 1ZQAA 4ECVA 3GV7B 4M9LA 4PHPA 5DBBA 3LWMA 3QEBZ 4ELTA 4ECUA 5KT3A 3K4GA 1UT8A 4P4OA 4MEYA 5DKWA 3PMNA 5IINA 4DF8A 2PFNA 1S76D 3C1YA 2DPIA 3GIMA 3GQCA 3T5JA 1HUOA 3THVA 5HNKA 5KFVA 4HYKA 1PZNA 8ICVA 4FBUA 3G6XA 3V7JA 5EWEA 1XSNA 1Q78A 4P4MA 5CJ7A 3V6KA 2M2UA 3AU6A 5KFYA 5DQIA 1XSPA 4WC5A 3OJUA 4X5VA 1N56A 1AROP 1TV9A 3MR5A 5J0PA 4KLIA 2DRBA 4DQQA 2OWOA 3HPOA 4F50A 4GC7A 4YVZA 2P6RA 3RAQA 4JV2A 4J9MA 4YMNA 3PMLA 2Y1IA 1XS9D 1D8LA 4JV0A 4QWEA 2A1JA 1CUKA 3PW4A 4EBEA 1S0OA 3ZDCA 4YG2A 4DEZA 2B21A 1H38A 1ZQCA 3ORYA 4QZDA 3C2MA 4UB1A 4QZAA 3GV5B 4DS5A 3EPGA 1WCLA 2PXIA 2BPGA 4M9GA 3RH5A 5CA7A 1SKWA 4M9NA 4FH3A 3UXPA 3LDAA 2WTFA 4PGQA 4RQ6A 4DOCA 5F2VO 4I2JA 3FYHA 1EXNA 2ZHAA 2ZUBA 1A77A 1L3UA 4I2EA 1C7YA 3V6HA 1RXWA 4MF8A 4J9RA 3Q8SB 3PX6A 3H8SA 1HUZA 3HP6A 8ICOA 3NTUA 9ICXA 4M9JA 4BXOA 2DPJA 3EW9A 3G6YA 3PY8A 4UB3A 3MBYA 1ZQWA 5DB6A 5IIJA 3MFHA 3TFRA 1L5UA 3GILA 4X4OA 1RZTA 5DECA 5KFIA 1Q79A 4B9MA 5J2HA 1KFDA 4NKTA 4I2BA 4DFPA 1SL0A 2DVIA 1UEUA 2FPMA 5KFEA 1ZQLA 4I2IA 1ZQSA 5HRIA 4R66A 1U45A 3ZDBA 4DOAA 1ZQUA 4F5NA 4NM2A 5HMLA 1R8AA 2RDIA 1NJYA 7ICIA 9ICNA 1A76A 3PW2A 2I1QA 3M9OB 4DFJA 2IHMA 4WC4A 1UA1A 1X9WA 2A1JB 3B0XA 1ZQPA 2JEJA 2HHTA 9ICBA 1NKBA 2ZJ8A 4JK1A 3RJFA 5KFRA 4RT3A 3MFIA 5DLGA 4QWAA 2VA2A 3PR4A 4F4ZA 4S3NA 1D8YA 3RBEA 1VFGA 4M04A 2PBEA 1ZETA 3QZ8A 2BGWA 4TQRA 4RNNA 2HW3A 8ICYA 5J29A 8ICTA 3ETLA 8ICPA 8ICRA 3LQCB 1BPBA 8ICHA 4RQ0A 4TUSA 2BCQA 3LK9A 4DWIA 5KFQA 3PNCA 3UPSA 2W8KA 4B9SA 7ICGA 3V7LA 1XO1A 1MSWD 5HR9A 2ISPA 4XA5A 2KZMA 4BXOB 2DFLA 4NXZA 5DBCA 1U48A 4YXMA 3AU2A 4JV1A 3WFQE 1TK0A 4NKUA 4ED2A 1NK9A 2O1PA 3GV8B 5HRBA 3PX0A 5KG4A 4O9MA 4GXIA 8ICFA 4F4YA 4R64A 2XY5A 1ZQTA 4NM1A 3G6VA 4MFCA 9ICLA 4RQ1A 1DOQA 3TARA 5KFOA 4QZHA 4QW8A 2Q0ZX 2XGQA 3TAPA 1NK0A 1L3VA 2KZZA 4X4PA 2ZH8A 5J0QA 4TUPA 4KLUA 3RJGA 1T4GA 1ZYQA 3PV8A 1NKCA 2UVVA 3RJJA 4C8KA 4DO9A 9ICAA 3RBDA 4QZCA 5L1KA 9ICTA 4BWMA 3RH4A 1CEZA 3M8SA 5DG7A 5J0TA 1BPEA 1TKDA 3JPQA 4O3RA 4K4GA 1MIWA 4FHXA 4J9KA 3WFRE 4DFKA 2HHQA 4GXKA 3H4DA 3ZD9A 3MR2A 4DSLA 8ICSA 5DG9A 1ZQQA 4B9VA 1F5AA 5DEDA 9ICKA 5BOMA 1RYRA 2NRVA 4MEXA 4LZDA 1U9LA 4C8MA 4RNMA 2KFNA 1ZQKA 3BQ2A 5CP2A 3RB4A 3OHAA 1T3NA 1KDHA 1FA0A 1ZJMA 4WC3A 3TFSA 4NY8A 5DDYA 5C5JA 2M9NA 3C5GA 1MQ2A 4K4HA 5HRLA 1SKSA 3MGHA 2FMPA 5KTQA 5HHHA 1KRPA 2FMQA 4UAWA 5HRHA 2FPLA 3AQKA 4X0AA 2XO7A 4ECTA 4KTQA 5KT2A 4Z6EA 2ZTDA 4DLGA 4RZRA 4RQ8A 8ICGA 2F1IA 4QWBA 4O0IA 5KFCA 4PGXA 4KLEA 3KTQA 1R8BA 1QSLA 3ZD8A 5L1LA 4I2HA 3SYZA 2BE3A 4WC6A 4O5EA 1ZQOA 3RB6A 5BOLA 3OVSA 4DFMA 3C23A 3RB0A 1S10A 4I28A 5KFPA 4KLFA 2JEGA 2AJQA 4RWPA 4IQVA 3BQ0A 7ICOA 4AT8A 5HHIA 4EYHB 2M2TA 4UD5A 2ZH4A 4J9PA 1N48A 4YD1A 8ICJA 4UB5A 3PR5B 4PHEA 4RNOA 4F5OA 1X9MA 5KG5A 4ELVA 3MDAA 1Z00A 3H8WA 4I29A 3BQTA 1S77D 1NZPA 5KFWA 4ED0A 4F91B 3HWTA 1RPLA 4PH5A 2I9GA 1BPDA 4I2CA 8ICQA 1TFWA 4XUSA 3FDSA 4J9NA 4O5CA 4DQRA 5EOZA 4PHDA 3Q8PB 3IHQB 4RPZA 5D4BA 3OSPA 1UA0A 4I2DA 1ZQJA 2J6TA 7ICEA 2RFFA 4DL2A 2JEFA 5J2BA 1U4BA 3RJHA 5HRDA 4PGYA 3JYYA 1KSPA 3N4MB 2UVWA 2C2EA 4M2YA 4R63A 2XC9A 5IIMA 2ASJA 4X4RA 3H8JA 4BGDA 3V6JA 5L9XA 3C66A 4DL3A 5KT5A 4FS2A 4ECWA 4UBCA 9ICIA 5J2IA 4YR2A 4YFKA 2NRKA 5DBAA 5KFDA 5KFLA 5IIOA 3GIJA 4QW9A 1V4AA 3Q8KA 2NRZA 3BJYA 2FPKA 4XQ8A 4QZEA 3RRGA 5IILA 2ZH1A 9ICUA 7ICSA 5HRKA 4IQUA 5KFXA 1HJPA 4FS1A 4DS4A 8ICLA 3H40A 3H4BA 3UXOA 1ZQVA 4GXJA 3UPQA 4C8OA 1NKEA 4IRKA 5DQGA 2J6UA 4YD2A 3JPPA 2DR9A 1JAJA 4IR9A 1JN3A 2BCVA 2PFQA 1Z00B 4RPYA 4ECXA 4LZGA 2AU0A 1TVAA 3C2LA 4GC6A 9ICWA 3TI0A 8ICMA 2UVUA 3OUYA 3H37A 2W9CA 4RUAA 2V4RA 4O3SA 2KZ3A 4EYIB 4QZGA 1KFTA 4JUZA 1ZQHA 3OV7A 1B22A 2ASLA 2BDPA 4KLSA 4MFAA 4YR3A 3EWAA 3QEAZ 2R8GA 3MGIA 4DSIA 4RWQA 5KG7A 3Q8LA 1T7PA 3JPSA 4NLZA 3NYBA 3WFPA 2F1JA 4F5RA 4XQ7A 2BPCA 3Q8QB 4ED1A 5HC9A 4DL6A 3PW0A 1NK7A 1TK5A 3V72A 3LWLA 2KTQA 4RPXA 2BQUA 2IHNA 1IM4A 8ICAA 3AQMA 4Q44A 1JXLA 4B9NA 9ICPA 3MABA 4ECRA 4J9LA 2R8KA 7ICVA 3HJ1A 8ICEA 4FH5A 3BQ1A 2PI4A 2AQ4A 4UB2A 1WCNA 1NO5A 2DR7A 4NLNA 5CR0A 4YCXA 3WFSC 2W9BA 2AGPA 4RQ4A 1XSLA 4UAYA 8ICCA 4Z6FA 3N97B 2ATLA 4E0DA 3E2EA 2BPFA 5J0XA 3ISBA 1XWLA 4ZH4A 5CB1A 3RTVA 5KFZA 4C8LA 5BPCA 3PO5A 4PPXA 5KFJA 1UETA 4WBZA 5J0RA 4YN4A 2KP7A 4J9OA 4YMMA 4F2SA 3L9DA 4LVSA 4EP7A 5KFHA 5J0UA 1BGXT 1V9PA 4UBBA 5J2DA 2GWSA 4DSJA 1QLNA 2M2VA 2ZTEA 5J2CA 3TAQA 2BQ3A 1PX5A 3OUYB 5L1IA 2W9CB 4B9TA 4G3IA 4RWOA 3OVBA 4X4NA 5KFKA 3OGUA 3OSNA 3Q8MA 2MUTB 1B43A 1SZPA 1K1QA 4QZ8A 4TQSA 4DQSA 4TURA 9ICSA 4O3OA 4O3PA 1MC8A 2MAXA 3C18A 3IM1A 2HVHA 3BDPA 4FHYA 4BDPA 1OU5A 2ZHBA 1RYSA 1QTMA 3JPTA 7ICLA 1NK5A 4B9LA 1VJ7A 1TAUA 3EPIA 5CWRA 3JPOA 1KFSA 3T3FA 2P6UA 2IMWP 5KG6A 4R65A 8ICBA 9ICEA 3PO4A 4AT8B 5KFFA 4DSEA 4ECYA 2AGQA 1SKRA 4F5PA 4KLTA 4ED8A 8ICZA 4E80A 2W9BB 2ALZA 2BHNA 4F4XA 5KG2A 4AT9A 4YQWA 9ICQA 4DQPA 4BWJA 4ELUA 4I2FA 4DSKA 4IRDA 7ICRA 2ZUCA 4Z6CA 3EYZA 4DF4A 5J2AA 2BKEA 2PFOA 2FLNA 2BCUA 4QZBA 4FBTA 4WC7A 3H3AA 3KHRA 1T8EA 2R8JA 3M9NB 5DLFA 1ZQDA 1ZQXA 4DQIA 1L3TA 2C2DA 5J2JA 4R8UB 5DGAA 1ZJNA 5L1JA 4EZ6A 3HIYA 4X4UA 4KLLA 2V4QA 3PW7A 2PFPA 4UQGA 4QWCA 2HHPA 5D46A 3QE9Y 1KEJA 1ZQIA 4KLQA 4ED3A 2XCAA 5J0OA 3GIKA 4DL7A 3MDCA 2FLPA 7ICJA 3B0YA 3ZDDA 5DDMA 1D9DA 3EZ5A 1S97A 1TK8A 3KHLA 9ICOA 3T5KA 4Q43A 9ICHA 4O3QA 3JPNA 3RR8A 4X4VA 2XCPA 2BQRA 2C2RA 7ICUA 2ZH2A 4YXJA 4WCWA 2FMSA 2O5AA 1NJZA 1R8CA 4YP3A 4TUQA 1UT5A 1BPYA 2P66A 4ECQA 1NK4A 4NLGA 1TAQA 3SI8A 5KFGA 4Q45A 5HRGA 2KFZA 4KLGA 4AT9B 1KTQA 1ZQMA 4I2GA 2H5XA 3HX0A 3Q8RB 2ZH7A 5KFMA 4RUCA 2ZH3A 1S0NA 1S0VA 1S0MA 4RU9A 5J2FA 4ECZA 4MF2A 3QZ7A 5J2GA 4EBKA 4KLHA 5JUMA 4B9UA 1Z3EB 4Z6DA 2NRWA 5HP4A 4P2HA 2ID1A 4F92B 4X0BA 7ICQA 4RQ7A 4RQ3A 2PI5A 1NOMA 2VANA 5KFAA 4RQ5A 1COOA 7ICNA 3PW5A 3C5FA 1Y88A 3C21A 5IIIA 4DOBA 5KFBA 1YLQA 5HREA 4E8FA 3T5LA 1BVSA 3MR3A 1ZQBA 2AGOA 1LB2B 3UXNA 1RXVA 4E7XA 1D9FA 2J6SA 4K4IA 3WFOA 1SL2A 5J0WA 4LT6A 3NGDA 3SV3A 9ICJA 5IIKA 4F8RA 5TZVA 1X2IA 3RAXA 2LYHA 2XY7A 1QSYA 5DB8A 4ECSA 4QZ9A 4FO6A 2FLLA 2MUTA 7ICMA 7ICPA 5J0YA 1KNYA 3H38A 2R8HA 1JIHA 1BPZA 3V7KA 7ICTA 4JWNA 3KHHA 2M2WA 4ATBA 1NJWA 4IR1A 2RDJA 4P4PA 2ZUDA 9ICCA 3GIIA 4I2AA 4RWNA 4M6WA 3C1ZA 4WBYA 5DG8A 5EWGA 3RRHA 1ZQGA 3H7IA 4NLKA 1DK3A 5KT6A 2JZBA 3RR7A 2NRTA 4M0AA 3RB3A 4QWDA 5KFTA 1NK8A 1JXEA 3HJ4A 2Q66A 4KMUA 3ZDEA 1S9FA 3GDXA 4O3NA 2F1HA 2XY6A 3SZ2A 4PHAA 2ZJAA 2JEIA 4WC2A 2BCSA 1ZQEA 2BR0A 4Q8EA 4UAZA 4RT2A 1ZQNA 5D49A 3TQ1A 2ASDA 5HRFA 1JMSA 1LV5A 4I27A 3K75D 4F4WA 3RJEA 8ICWA 5DGBA 1IXRA 4M5DA 9ICFA 4F3OA 2IA6A 3UQ2A 1ZQZA 3RJIA 3AUOA 5HMMA 5KG3A 4EZ9A 3GFKB 1DGSA 2BCRA 4FHWA 3M9MB 4R8UA 2ZH5A 3PX4A 3SV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAN A;  4QZI A;  4C8N A;  2ZH6 A;  5KFU A;  4EBD A;  4J9Q A;  1MQ3 A;  4MFF A;  1JX4 A;  4YMO A;  4IQW A;  2NRX A;  3OJS A;  3ZDA A;  4KLJ A;  2HVI A;  4ATB B;  2AQ0 A;  1SL1 A;  3OVA A;  2ZH9 A;  1U49 A;  9ICV A;  1XU4 A;  4AT7 A;  2DRA A;  1U47 A;  4X4Q A;  3ISD A;  4M6W B;  2R8I A;  2HHV A;  4CCH A;  4X4S A;  4FHP A;  4IG8 A;  5KT4 A;  1TFR A;  1DK2 A;  1BNO A;  8ICU A;  2JZB B;  4UD4 A;  3HT3 A;  5F9L A;  3OHB A;  3RH6 A;  7ICF A;  7ICK A;  1UEV A;  5J0S A;  4F2R A;  5EWF A;  4GLX A;  2HHS A;  3KHG A;  2VA8 A;  2W8L A;  5KFN A;  2Y1J A;  3UQ0 A;  2VA3 A;  4KLM A;  2HHW A;  9ICM A;  3AQN A;  4RQ2 A;  5KG0 A;  2ZJ5 A;  4JWM A;  4IRC A;  1MIY A;  4XRH A;  1NK6 A;  2HHU A;  8ICX A;  8ICK A;  2ZTC A;  4KIT B;  7ICH A;  5J2K A;  5DQH A;  5KFS A;  1ZQF A;  1JQR A;  5F9N A;  1MIV A;  4O5K A;  2XGP A;  5DB9 A;  2C22 A;  2HHX A;  5DB7 A;  2W9M A;  8ICN A;  4X4T A;  3PVX A;  3T5H A;  1KLN A;  4EBC A;  1QSS A;  1K1S A;  3ISC A;  2V9W A;  4WC1 A;  4KLD A;  1ZQR A;  1X9S A;  5KG1 A;  2IBK A;  4F5Q A;  5J2E A;  4J9S A;  3HW8 A;  4UB4 A;  2C28 A;  4M9H A;  4EEY A;  3RJK A;  1XC9 A;  1WOT A;  1NJX A;  3JZ0 A;  2UVR A;  4QZF A;  3M8R A;  4KN7 A;  1BPX A;  4ED6 A;  4DSF A;  4KN4 A;  1L3S A;  1BNP A;  3MR6 A;  2ISO A;  4KLO A;  4Q8F A;  4F4K A;  3AQL A;  4WC0 A;  5KT7 A;  5CHG A;  1ZQY A;  2DR8 A;  4DL4 A;  2KN7 A;  8ICI A;  1R89 A;  3H39 A;  9ICG A;  9ICR A;  4DL5 A;  4ED7 A;  4F93 B;  4IQT A;  3JPR A;  4AT7 B;  2W9A A;  4M47 A;  3C2K A;  4EBJ A;  4YR0 A;  4FHV A;  1TFY A;  2DR5 A;  4DLE A;  1ZQA A;  4ECV A;  3GV7 B;  4M9L A;  4PHP A;  5DBB A;  3LWM A;  3QEB Z;  4ELT A;  4ECU A;  5KT3 A;  3K4G A;  1UT8 A;  4P4O A;  4MEY A;  5DKW A;  3PMN A;  5IIN A;  4DF8 A;  2PFN A;  1S76 D;  3C1Y A;  2DPI A;  3GIM A;  3GQC A;  3T5J A;  1HUO A;  3THV A;  5HNK A;  5KFV A;  4HYK A;  1PZN A;  8ICV A;  4FBU A;  3G6X A;  3V7J A;  5EWE A;  1XSN A;  1Q78 A;  4P4M A;  5CJ7 A;  3V6K A;  2M2U A;  3AU6 A;  5KFY A;  5DQI A;  1XSP A;  4WC5 A;  3OJU A;  4X5V A;  1N56 A;  1ARO P;  1TV9 A;  3MR5 A;  5J0P A;  4KLI A;  2DRB A;  4DQQ A;  2OWO A;  3HPO A;  4F50 A;  4GC7 A;  4YVZ A;  2P6R A;  3RAQ A;  4JV2 A;  4J9M A;  4YMN A;  3PML A;  2Y1I A;  1XS9 D;  1D8L A;  4JV0 A;  4QWE A;  2A1J A;  1CUK A;  3PW4 A;  4EBE A;  1S0O A;  3ZDC A;  4YG2 A;  4DEZ A;  2B21 A;  1H38 A;  1ZQC A;  3ORY A;  4QZD A;  3C2M A;  4UB1 A;  4QZA A;  3GV5 B;  4DS5 A;  3EPG A;  1WCL A;  2PXI A;  2BPG A;  4M9G A;  3RH5 A;  5CA7 A;  1SKW A;  4M9N A;  4FH3 A;  3UXP A;  3LDA A;  2WTF A;  4PGQ A;  4RQ6 A;  4DOC A;  5F2V O;  4I2J A;  3FYH A;  1EXN A;  2ZHA A;  2ZUB A;  1A77 A;  1L3U A;  4I2E A;  1C7Y A;  3V6H A;  1RXW A;  4MF8 A;  4J9R A;  3Q8S B;  3PX6 A;  3H8S A;  1HUZ A;  3HP6 A;  8ICO A;  3NTU A;  9ICX A;  4M9J A;  4BXO A;  2DPJ A;  3EW9 A;  3G6Y A;  3PY8 A;  4UB3 A;  3MBY A;  1ZQW A;  5DB6 A;  5IIJ A;  3MFH A;  3TFR A;  1L5U A;  3GIL A;  4X4O A;  1RZT A;  5DEC A;  5KFI A;  1Q79 A;  4B9M A;  5J2H A;  1KFD A;  4NKT A;  4I2B A;  4DFP A;  1SL0 A;  2DVI A;  1UEU A;  2FPM A;  5KFE A;  1ZQL A;  4I2I A;  1ZQS A;  5HRI A;  4R66 A;  1U45 A;  3ZDB A;  4DOA A;  1ZQU A;  4F5N A;  4NM2 A;  5HML A;  1R8A A;  2RDI A;  1NJY A;  7ICI A;  9ICN A;  1A76 A;  3PW2 A;  2I1Q A;  3M9O B;  4DFJ A;  2IHM A;  4WC4 A;  1UA1 A;  1X9W A;  2A1J B;  3B0X A;  1ZQP A;  2JEJ A;  2HHT A;  9ICB A;  1NKB A;  2ZJ8 A;  4JK1 A;  3RJF A;  5KFR A;  4RT3 A;  3MFI A;  5DLG A;  4QWA A;  2VA2 A;  3PR4 A;  4F4Z A;  4S3N A;  1D8Y A;  3RBE A;  1VFG A;  4M04 A;  2PBE A;  1ZET A;  3QZ8 A;  2BGW A;  4TQR A;  4RNN A;  2HW3 A;  8ICY A;  5J29 A;  8ICT A;  3ETL A;  8ICP A;  8ICR A;  3LQC B;  1BPB A;  8ICH A;  4RQ0 A;  4TUS A;  2BCQ A;  3LK9 A;  4DWI A;  5KFQ A;  3PNC A;  3UPS A;  2W8K A;  4B9S A;  7ICG A;  3V7L A;  1XO1 A;  1MSW D;  5HR9 A;  2ISP A;  4XA5 A;  2KZM A;  4BXO B;  2DFL A;  4NXZ A;  5DBC A;  1U48 A;  4YXM A;  3AU2 A;  4JV1 A;  3WFQ E;  1TK0 A;  4NKU A;  4ED2 A;  1NK9 A;  2O1P A;  3GV8 B;  5HRB A;  3PX0 A;  5KG4 A;  4O9M A;  4GXI A;  8ICF A;  4F4Y A;  4R64 A;  2XY5 A;  1ZQT A;  4NM1 A;  3G6V A;  4MFC A;  9ICL A;  4RQ1 A;  1DOQ A;  3TAR A;  5KFO A;  4QZH A;  4QW8 A;  2Q0Z X;  2XGQ A;  3TAP A;  1NK0 A;  1L3V A;  2KZZ A;  4X4P A;  2ZH8 A;  5J0Q A;  4TUP A;  4KLU A;  3RJG A;  1T4G A;  1ZYQ A;  3PV8 A;  1NKC A;  2UVV A;  3RJJ A;  4C8K A;  4DO9 A;  9ICA A;  3RBD A;  4QZC A;  5L1K A;  9ICT A;  4BWM A;  3RH4 A;  1CEZ A;  3M8S A;  5DG7 A;  5J0T A;  1BPE A;  1TKD A;  3JPQ A;  4O3R A;  4K4G A;  1MIW A;  4FHX A;  4J9K A;  3WFR E;  4DFK A;  2HHQ A;  4GXK A;  3H4D A;  3ZD9 A;  3MR2 A;  4DSL A;  8ICS A;  5DG9 A;  1ZQQ A;  4B9V A;  1F5A A;  5DED A;  9ICK A;  5BOM A;  1RYR A;  2NRV A;  4MEX A;  4LZD A;  1U9L A;  4C8M A;  4RNM A;  2KFN A;  1ZQK A;  3BQ2 A;  5CP2 A;  3RB4 A;  3OHA A;  1T3N A;  1KDH A;  1FA0 A;  1ZJM A;  4WC3 A;  3TFS A;  4NY8 A;  5DDY A;  5C5J A;  2M9N A;  3C5G A;  1MQ2 A;  4K4H A;  5HRL A;  1SKS A;  3MGH A;  2FMP A;  5KTQ A;  5HHH A;  1KRP A;  2FMQ A;  4UAW A;  5HRH A;  2FPL A;  3AQK A;  4X0A A;  2XO7 A;  4ECT A;  4KTQ A;  5KT2 A;  4Z6E A;  2ZTD A;  4DLG A;  4RZR A;  4RQ8 A;  8ICG A;  2F1I A;  4QWB A;  4O0I A;  5KFC A;  4PGX A;  4KLE A;  3KTQ A;  1R8B A;  1QSL A;  3ZD8 A;  5L1L A;  4I2H A;  3SYZ A;  2BE3 A;  4WC6 A;  4O5E A;  1ZQO A;  3RB6 A;  5BOL A;  3OVS A;  4DFM A;  3C23 A;  3RB0 A;  1S10 A;  4I28 A;  5KFP A;  4KLF A;  2JEG A;  2AJQ A;  4RWP A;  4IQV A;  3BQ0 A;  7ICO A;  4AT8 A;  5HHI A;  4EYH B;  2M2T A;  4UD5 A;  2ZH4 A;  4J9P A;  1N48 A;  4YD1 A;  8ICJ A;  4UB5 A;  3PR5 B;  4PHE A;  4RNO A;  4F5O A;  1X9M A;  5KG5 A;  4ELV A;  3MDA A;  1Z00 A;  3H8W A;  4I29 A;  3BQT A;  1S77 D;  1NZP A;  5KFW A;  4ED0 A;  4F91 B;  3HWT A;  1RPL A;  4PH5 A;  2I9G A;  1BPD A;  4I2C A;  8ICQ A;  1TFW A;  4XUS A;  3FDS A;  4J9N A;  4O5C A;  4DQR A;  5EOZ A;  4PHD A;  3Q8P B;  3IHQ B;  4RPZ A;  5D4B A;  3OSP A;  1UA0 A;  4I2D A;  1ZQJ A;  2J6T A;  7ICE A;  2RFF A;  4DL2 A;  2JEF A;  5J2B A;  1U4B A;  3RJH A;  5HRD A;  4PGY A;  3JYY A;  1KSP A;  3N4M B;  2UVW A;  2C2E A;  4M2Y A;  4R63 A;  2XC9 A;  5IIM A;  2ASJ A;  4X4R A;  3H8J A;  4BGD A;  3V6J A;  5L9X A;  3C66 A;  4DL3 A;  5KT5 A;  4FS2 A;  4ECW A;  4UBC A;  9ICI A;  5J2I A;  4YR2 A;  4YFK A;  2NRK A;  5DBA A;  5KFD A;  5KFL A;  5IIO A;  3GIJ A;  4QW9 A;  1V4A A;  3Q8K A;  2NRZ A;  3BJY A;  2FPK A;  4XQ8 A;  4QZE A;  3RRG A;  5IIL A;  2ZH1 A;  9ICU A;  7ICS A;  5HRK A;  4IQU A;  5KFX A;  1HJP A;  4FS1 A;  4DS4 A;  8ICL A;  3H40 A;  3H4B A;  3UXO A;  1ZQV A;  4GXJ A;  3UPQ A;  4C8O A;  1NKE A;  4IRK A;  5DQG A;  2J6U A;  4YD2 A;  3JPP A;  2DR9 A;  1JAJ A;  4IR9 A;  1JN3 A;  2BCV A;  2PFQ A;  1Z00 B;  4RPY A;  4ECX A;  4LZG A;  2AU0 A;  1TVA A;  3C2L A;  4GC6 A;  9ICW A;  3TI0 A;  8ICM A;  2UVU A;  3OUY A;  3H37 A;  2W9C A;  4RUA A;  2V4R A;  4O3S A;  2KZ3 A;  4EYI B;  4QZG A;  1KFT A;  4JUZ A;  1ZQH A;  3OV7 A;  1B22 A;  2ASL A;  2BDP A;  4KLS A;  4MFA A;  4YR3 A;  3EWA A;  3QEA Z;  2R8G A;  3MGI A;  4DSI A;  4RWQ A;  5KG7 A;  3Q8L A;  1T7P A;  3JPS A;  4NLZ A;  3NYB A;  3WFP A;  2F1J A;  4F5R A;  4XQ7 A;  2BPC A;  3Q8Q B;  4ED1 A;  5HC9 A;  4DL6 A;  3PW0 A;  1NK7 A;  1TK5 A;  3V72 A;  3LWL A;  2KTQ A;  4RPX A;  2BQU A;  2IHN A;  1IM4 A;  8ICA A;  3AQM A;  4Q44 A;  1JXL A;  4B9N A;  9ICP A;  3MAB A;  4ECR A;  4J9L A;  2R8K A;  7ICV A;  3HJ1 A;  8ICE A;  4FH5 A;  3BQ1 A;  2PI4 A;  2AQ4 A;  4UB2 A;  1WCN A;  1NO5 A;  2DR7 A;  4NLN A;  5CR0 A;  4YCX A;  3WFS C;  2W9B A;  2AGP A;  4RQ4 A;  1XSL A;  4UAY A;  8ICC A;  4Z6F A;  3N97 B;  2ATL A;  4E0D A;  3E2E A;  2BPF A;  5J0X A;  3ISB A;  1XWL A;  4ZH4 A;  5CB1 A;  3RTV A;  5KFZ A;  4C8L A;  5BPC A;  3PO5 A;  4PPX A;  5KFJ A;  1UET A;  4WBZ A;  5J0R A;  4YN4 A;  2KP7 A;  4J9O A;  4YMM A;  4F2S A;  3L9D A;  4LVS A;  4EP7 A;  5KFH A;  5J0U A;  1BGX T;  1V9P A;  4UBB A;  5J2D A;  2GWS A;  4DSJ A;  1QLN A;  2M2V A;  2ZTE A;  5J2C A;  3TAQ A;  2BQ3 A;  1PX5 A;  3OUY B;  5L1I A;  2W9C B;  4B9T A;  4G3I A;  4RWO A;  3OVB A;  4X4N A;  5KFK A;  3OGU A;  3OSN A;  3Q8M A;  2MUT B;  1B43 A;  1SZP A;  1K1Q A;  4QZ8 A;  4TQS A;  4DQS A;  4TUR A;  9ICS A;  4O3O A;  4O3P A;  1MC8 A;  2MAX A;  3C18 A;  3IM1 A;  2HVH A;  3BDP A;  4FHY A;  4BDP A;  1OU5 A;  2ZHB A;  1RYS A;  1QTM A;  3JPT A;  7ICL A;  1NK5 A;  4B9L A;  1VJ7 A;  1TAU A;  3EPI A;  5CWR A;  3JPO A;  1KFS A;  3T3F A;  2P6U A;  2IMW P;  5KG6 A;  4R65 A;  8ICB A;  9ICE A;  3PO4 A;  4AT8 B;  5KFF A;  4DSE A;  4ECY A;  2AGQ A;  1SKR A;  4F5P A;  4KLT A;  4ED8 A;  8ICZ A;  4E80 A;  2W9B B;  2ALZ A;  2BHN A;  4F4X A;  5KG2 A;  4AT9 A;  4YQW A;  9ICQ A;  4DQP A;  4BWJ A;  4ELU A;  4I2F A;  4DSK A;  4IRD A;  7ICR A;  2ZUC A;  4Z6C A;  3EYZ A;  4DF4 A;  5J2A A;  2BKE A;  2PFO A;  2FLN A;  2BCU A;  4QZB A;  4FBT A;  4WC7 A;  3H3A A;  3KHR A;  1T8E A;  2R8J A;  3M9N B;  5DLF A;  1ZQD A;  1ZQX A;  4DQI A;  1L3T A;  2C2D A;  5J2J A;  4R8U B;  5DGA A;  1ZJN A;  5L1J A;  4EZ6 A;  3HIY A;  4X4U A;  4KLL A;  2V4Q A;  3PW7 A;  2PFP A;  4UQG A;  4QWC A;  2HHP A;  5D46 A;  3QE9 Y;  1KEJ A;  1ZQI A;  4KLQ A;  4ED3 A;  2XCA A;  5J0O A;  3GIK A;  4DL7 A;  3MDC A;  2FLP A;  7ICJ A;  3B0Y A;  3ZDD A;  5DDM A;  1D9D A;  3EZ5 A;  1S97 A;  1TK8 A;  3KHL A;  9ICO A;  3T5K A;  4Q43 A;  9ICH A;  4O3Q A;  3JPN A;  3RR8 A;  4X4V A;  2XCP A;  2BQR A;  2C2R A;  7ICU A;  2ZH2 A;  4YXJ A;  4WCW A;  2FMS A;  2O5A A;  1NJZ A;  1R8C A;  4YP3 A;  4TUQ A;  1UT5 A;  1BPY A;  2P66 A;  4ECQ A;  1NK4 A;  4NLG A;  1TAQ A;  3SI8 A;  5KFG A;  4Q45 A;  5HRG A;  2KFZ A;  4KLG A;  4AT9 B;  1KTQ A;  1ZQM A;  4I2G A;  2H5X A;  3HX0 A;  3Q8R B;  2ZH7 A;  5KFM A;  4RUC A;  2ZH3 A;  1S0N A;  1S0V A;  1S0M A;  4RU9 A;  5J2F A;  4ECZ A;  4MF2 A;  3QZ7 A;  5J2G A;  4EBK A;  4KLH A;  5JUM A;  4B9U A;  1Z3E B;  4Z6D A;  2NRW A;  5HP4 A;  4P2H A;  2ID1 A;  4F92 B;  4X0B A;  7ICQ A;  4RQ7 A;  4RQ3 A;  2PI5 A;  1NOM A;  2VAN A;  5KFA A;  4RQ5 A;  1COO A;  7ICN A;  3PW5 A;  3C5F A;  1Y88 A;  3C21 A;  5III A;  4DOB A;  5KFB A;  1YLQ A;  5HRE A;  4E8F A;  3T5L A;  1BVS A;  3MR3 A;  1ZQB A;  2AGO A;  1LB2 B;  3UXN A;  1RXV A;  4E7X A;  1D9F A;  2J6S A;  4K4I A;  3WFO A;  1SL2 A;  5J0W A;  4LT6 A;  3NGD A;  3SV3 A;  9ICJ A;  5IIK A;  4F8R A;  5TZV A;  1X2I A;  3RAX A;  2LYH A;  2XY7 A;  1QSY A;  5DB8 A;  4ECS A;  4QZ9 A;  4FO6 A;  2FLL A;  2MUT A;  7ICM A;  7ICP A;  5J0Y A;  1KNY A;  3H38 A;  2R8H A;  1JIH A;  1BPZ A;  3V7K A;  7ICT A;  4JWN A;  3KHH A;  2M2W A;  4ATB A;  1NJW A;  4IR1 A;  2RDJ A;  4P4P A;  2ZUD A;  9ICC A;  3GII A;  4I2A A;  4RWN A;  4M6W A;  3C1Z A;  4WBY A;  5DG8 A;  5EWG A;  3RRH A;  1ZQG A;  3H7I A;  4NLK A;  1DK3 A;  5KT6 A;  2JZB A;  3RR7 A;  2NRT A;  4M0A A;  3RB3 A;  4QWD A;  5KFT A;  1NK8 A;  1JXE A;  3HJ4 A;  2Q66 A;  4KMU A;  3ZDE A;  1S9F A;  3GDX A;  4O3N A;  2F1H A;  2XY6 A;  3SZ2 A;  4PHA A;  2ZJA A;  2JEI A;  4WC2 A;  2BCS A;  1ZQE A;  2BR0 A;  4Q8E A;  4UAZ A;  4RT2 A;  1ZQN A;  5D49 A;  3TQ1 A;  2ASD A;  5HRF A;  1JMS A;  1LV5 A;  4I27 A;  3K75 D;  4F4W A;  3RJE A;  8ICW A;  5DGB A;  1IXR A;  4M5D A;  9ICF A;  4F3O A;  2IA6 A;  3UQ2 A;  1ZQZ A;  3RJI A;  3AUO A;  5HMM A;  5KG3 A;  4EZ9 A;  3GFK B;  1DGS A;  2BCR A;  4FHW A;  3M9M B;  4R8U A;  2ZH5 A;  3PX4 A;  3SV4 A; 
#chains in the Genus database with same CATH topology
 4A8E A;  2E3T A;  3ER8 C;  4NJ8 A;  4LEZ A;  2WHE A;  1SXD A;  3EF2 A;  1JX4 A;  2NRX A;  1Q46 A;  2AQ0 A;  4IL6 U;  5JRT A;  1JRO A;  4AT7 A;  1U47 A;  4M6W B;  4FZL A;  4CCH A;  2CN1 A;  5KT4 A;  2JZB B;  7ICF A;  7ICK A;  5KFN A;  3UQ0 A;  4KLM A;  9ICM A;  5KG0 A;  2ZJ5 A;  2QB0 A;  1UQV A;  1NK6 A;  8ICK A;  4EEK A;  5J2K A;  4MKP A;  1V38 A;  1ZQF A;  4EX7 A;  2OHF A;  5F9N A;  5CFU A;  2XGP A;  2NO5 A;  2OH2 A;  2W9M A;  3PVX A;  1KLN A;  3ISC A;  1OXJ A;  4WC1 A;  3WK8 A;  5J2E A;  4F5Q A;  4M9H A;  4EEY A;  3RJK A;  3JZ0 A;  2KV2 A;  2UVR A;  4KN7 A;  5ALJ A;  1BNP A;  3A0B U;  3MR6 A;  2ISO A;  4Q8F A;  4F4K A;  5KT7 A;  2DR8 A;  4DL4 A;  8ICI A;  2ZIX B;  9ICG A;  1JI7 A;  4IQT A;  4CRX A;  5AI4 A;  2E8N A;  4DLE A;  3HRD D;  4ECV A;  5H2F U;  4M9L A;  4FE3 A;  4ECU A;  1L8L A;  4P4O A;  2ZIU B;  2YQE A;  3GIM A;  2KJ9 A;  4CF3 A;  5KFV A;  1PZN A;  4FBU A;  3G6X A;  5KNI A;  2CPR A;  5CJ7 A;  2EH9 A;  5DQI A;  4NV0 A;  4AP9 A;  4X5V A;  1LKY A;  3HPO A;  1RYU A;  3RAQ A;  4J9M A;  4YMN A;  1TE2 A;  1D8L A;  4QWE A;  2B21 A;  3L4P A;  4DS5 A;  3GV5 B;  3EPG A;  4FH3 A;  4DOC A;  4PGQ A;  4RQ6 A;  2LM1 A;  2WAQ F;  1L3U A;  1C7Y A;  5KL1 B;  3PX6 A;  2O6K A;  3NRZ A;  4UB3 A;  3MBY A;  5AKX A;  1L6N A;  4X4O A;  3GIL A;  1RZT A;  4B9M A;  5J2H A;  2BZF A;  4I2B A;  3AMZ A;  2FPM A;  3ZDB A;  4P0Q B;  4OO1 J;  4F5N A;  1R8A A;  2GO7 A;  4RQN A;  1A76 A;  3SMV A;  3PW2 A;  3DV9 A;  2H3Q A;  3PST A;  1UA1 A;  3B0X A;  1X9W A;  1ZQP A;  2JEJ A;  1NKB A;  5KFR A;  5ALH A;  3PR4 A;  4S3N A;  3LVW A;  2WFA A;  4M04 A;  4TQR A;  2HW3 A;  1J97 A;  8ICP A;  8ICR A;  2W7O A;  4TUS A;  4DWI A;  5KFQ A;  3PNC A;  2W8K A;  1N61 A;  4B9S A;  1XO1 A;  5HR9 A;  2DFL A;  2KSO B;  4ED2 A;  2WF5 A;  3GV8 B;  3PX0 A;  4GXI A;  2YMQ A;  3WU2 U;  3QNM A;  4G9B A;  3G6V A;  4MFC A;  4EEB A;  4DFD A;  5D61 A;  2Q0Z X;  5AK4 A;  4X4P A;  4HAI A;  4KLU A;  1ZYQ A;  3PV8 A;  1NKC A;  2VJ4 A;  9ICA A;  2QB1 A;  3RBD A;  4QZC A;  5L1K A;  1CEZ A;  5J0T A;  5AM0 A;  2R18 A;  4GXK A;  2MU2 A;  2BDU A;  8ICS A;  2HBM A;  5BOM A;  2LMR A;  4C8M A;  5JTG A;  3BQ2 A;  2K4H A;  1KDH A;  1FA0 A;  3WK4 A;  5HRL A;  2M9N A;  2D8C A;  5HHH A;  1KRP A;  2FMQ A;  5A0L A;  1GPJ A;  2XO7 A;  4ECT A;  5ALW A;  2KIW A;  4RQ8 A;  2HDO A;  1N62 A;  1UHU A;  3KTQ A;  1QSL A;  5ALO A;  2QLT A;  2BE3 A;  1ZQO A;  3RB0 A;  1S10 A;  2B6G A;  7ICO A;  4N7R A;  1JAL A;  2LI6 A;  8ICJ A;  4F5O A;  4C7Y A;  1Z00 A;  3H8W A;  4I29 A;  4ED0 A;  3I76 A;  2FI1 A;  1BPD A;  8ICQ A;  5D4B A;  4EBJ A;  4RPZ A;  3IDW A;  3F2D A;  2W43 A;  5ALN A;  1HEK A;  2I6X A;  5J2B A;  3BS7 A;  5G5H A;  2KJ8 A;  4O3M A;  3H8M A;  4NXX A;  4NWI A;  4M2Y A;  4R63 A;  1PUZ A;  5IIM A;  2FJ6 A;  5L9X A;  3C66 A;  2DKZ A;  5EE3 A;  9ICI A;  5J2I A;  4YFK A;  4KM5 A;  1V4A A;  4QW9 A;  4QZE A;  2YB4 A;  2ZH1 A;  1C20 A;  4IQU A;  4OJO A;  5KFX A;  1N2X A;  4IRK A;  2DR9 A;  2Y9T A;  2J6U A;  4YD2 A;  1JN3 A;  5AKG A;  2BCV A;  3QU2 A;  2EAM A;  1J2M A;  4RUA A;  2V4R A;  4EYI B;  1ZQH A;  2BDP A;  4KLS A;  4MFA A;  4DSI A;  3WKE A;  3Q8L A;  2FDR A;  4NLZ A;  3WFP A;  3TAC B;  4F5R A;  4ED1 A;  4XQ7 A;  3CK6 A;  4NXU A;  3V72 A;  1IM4 A;  3AQM A;  9ICP A;  1JXL A;  4KX3 A;  2HI0 A;  4J9L A;  2R8K A;  8ICE A;  3OPX A;  4UB2 A;  1WCN A;  4ICA A;  2K8C B;  5AM2 A;  1P7D A;  2AGP A;  1XSL A;  3M6Z A;  4UAY A;  8ICC A;  3N97 B;  2BPF A;  4PPX A;  5BPC A;  3N28 A;  5KFJ A;  4YN4 A;  5HR6 A;  4LVS A;  4EP7 A;  4K9B A;  1BGX T;  2GWS A;  5CEH A;  2ZTE A;  4RWO A;  2Q4T A;  3D6J A;  2XID A;  1K1Q A;  4NXV A;  1MC8 A;  2MAX A;  2HVH A;  1RYS A;  2F8K A;  4FZM A;  7ICL A;  5ALV A;  1TAU A;  1KFS A;  9ICE A;  2AGQ A;  1N60 A;  4ECY A;  4ED8 A;  2W9B B;  2HBL A;  5KG2 A;  4O69 A;  3QUQ A;  2G08 A;  7ICR A;  1Z1V A;  5J2A A;  4NLB A;  3M9N B;  5DLF A;  1ZQX A;  1ECW A;  5L1J A;  4KLL A;  2PFP A;  5D46 A;  1ZQI A;  3UMG A;  4KLQ A;  3GIK A;  4DL7 A;  3ZDD A;  1D9D A;  3EZ5 A;  3BS5 B;  1ZOL A;  9ICO A;  5AI8 A;  3T5K A;  2BQR A;  1HIW A;  1IV8 A;  2XVT A;  2C2R A;  1ZXI A;  2O5A A;  4GFJ A;  2P66 A;  2EWR A;  3I28 A;  1KQQ A;  3SAH A;  4AT9 B;  1KTQ A;  2JGA A;  3HX0 A;  2ZH7 A;  1S0M A;  4RU9 A;  4ECZ A;  2G09 A;  1Z3E B;  5HP4 A;  4CF4 A;  4P2H A;  2ID1 A;  4F92 B;  7ICQ A;  4RQ7 A;  5KFA A;  3PW5 A;  4DOB A;  2NYV A;  2XIC A;  4P0P A;  3HIL A;  2AGO A;  3UXN A;  1LB2 B;  4E7X A;  2K8B B;  4K4I A;  1FEZ A;  1DGJ A;  1SL2 A;  3WFO A;  3NGD A;  3SV3 A;  4Y2P A;  2LYH A;  1QSY A;  4ECS A;  4QZ9 A;  2MUT A;  1BPZ A;  1ZRM A;  4OAI Z;  4OCZ A;  4P4P A;  2ZUD A;  4I2A A;  4M6W A;  5ALP A;  3RRH A;  1KW4 A;  1F5S A;  2D6F C;  4NLK A;  1DK3 A;  2JZB A;  5J8Y A;  4QWD A;  3HJ4 A;  2Q66 A;  4KMU A;  3ZDE A;  4O3N A;  5AI0 A;  2JEI A;  2ZJA A;  2BCS A;  1ZQE A;  1GO3 F;  1N5W A;  1JMS A;  1LV5 A;  1XNS A;  2IA6 A;  1L8O A;  4CNQ A;  1SWV A;  2ZIV B;  4FHW A;  2G06 A;  4LEW A;  4R8U A;  3SEI A;  4QZI A;  4JLZ A;  2H3Z A;  4J9Q A;  4AYB F;  2HVI A;  3ZDA A;  3S6J A;  2W55 A;  1SL1 A;  2ZIX A;  3TKA A;  9ICV A;  1XU4 A;  2CRX A;  4FHP A;  4IG8 A;  1TFR A;  4UD4 A;  1IIP A;  3HT3 A;  3OHB A;  1UEV A;  3K1Z A;  4GLX A;  4F2R A;  2Y1J A;  2VA3 A;  2HSZ A;  2HHW A;  4Y2V A;  4RQ2 A;  4IRC A;  2ZIU A;  2HHU A;  1UCV A;  3KBB A;  2ZTC A;  5DQH A;  4O5K A;  2C22 A;  2LM4 A;  1X6J A;  2GLE A;  5AM1 A;  4X4T A;  1SV0 C;  2MA1 A;  2LYB A;  1A0P A;  1FFV A;  2WF6 A;  1X9S A;  2IBK A;  4O3S A;  2C28 A;  2ZHA A;  3HW8 A;  4UB4 A;  1NJX A;  1ZD4 A;  2Y0S F;  4KN4 A;  4EX6 A;  2A3V A;  1YT3 A;  1KBU A;  1ZQY A;  3AN1 A;  2KN7 A;  3H39 A;  9ICR A;  2W9A A;  3SQI A;  3C2K A;  2DKX A;  1TFY A;  2DR5 A;  2EAO A;  5J8Y C;  4PHP A;  1M6Y A;  2A19 A;  3LWM A;  2YML A;  3SEN A;  4ELT A;  4O68 A;  3K4G A;  5IIN A;  3AM9 A;  4C4R A;  1SV4 A;  1NI3 A;  2DPI A;  1O03 A;  3THV A;  1T94 A;  8ICV A;  5EWE A;  1XSN A;  1Q78 A;  1FFU A;  2M2U A;  4P0Q A;  3OJU A;  1TV9 A;  3MR5 A;  1JUD A;  5J0P A;  4DQQ A;  2OWO A;  4F50 A;  4YVZ A;  2Y1I A;  3PML A;  2FE9 A;  3PW4 A;  1CUK A;  3ONN A;  4EBE A;  1S0O A;  4YG2 A;  5AKZ A;  4UB1 A;  4QZA A;  1WCL A;  2BPG A;  1SKW A;  2HOF A;  5F2V O;  3FYH A;  2MRL A;  4QJF B;  2ZUB A;  1A77 A;  3IG5 A;  4I2E A;  3V6H A;  4MF8 A;  4J9R A;  3Q8S B;  8ICO A;  4U7C A;  4UB8 U;  1L7P A;  2YX8 A;  2KSO A;  4F72 A;  3MFH A;  5DEC A;  1ZQ1 C;  1Q79 A;  1KN5 A;  4NKT A;  2F44 A;  4DFP A;  3JCF A;  1LVH A;  2DVI A;  4Y2T A;  5KFE A;  1ZQS A;  5CFT A;  1K5O A;  1X66 A;  5HML A;  2RDI A;  1NJY A;  3WKA A;  3M9O B;  3KZX A;  2A1J B;  4EED A;  5AKY A;  3RJF A;  2HOI A;  2VA2 A;  2BGW A;  2EZY A;  2W11 A;  4FZN A;  8ICY A;  5J29 A;  3ER9 B;  2BBJ A;  3CW2 C;  3UPS A;  4UAU A;  2ISP A;  4BXO B;  1V85 A;  4NXZ A;  5DBC A;  3AU2 A;  4JV1 A;  4CGZ A;  1TK0 A;  4NKU A;  2KIC A;  5G5G A;  2O1P A;  5EE0 A;  1ZQT A;  3UM9 A;  2A1A A;  3D2N A;  3TAR A;  2XGQ A;  2ZH8 A;  2KZZ A;  3R9K A;  5J0Q A;  4TUP A;  4FFD A;  1T4G A;  4CE6 A;  2E1F A;  3M1Y A;  1TKD A;  1MIW A;  4J9K A;  2KVC A;  3H4D A;  3MR2 A;  1F5A A;  5DED A;  1ZQQ A;  4B9V A;  1RYR A;  1U9L A;  4WC3 A;  2D3D A;  5DDY A;  3C5G A;  2JMG A;  3MGH A;  1SKS A;  5KTQ A;  2FMP A;  5HRH A;  4BJQ A;  2NV3 A;  3EUB 2;  3ZD8 A;  5L1L A;  4HX0 A;  3OVS A;  4RWP A;  3C23 A;  4KLF A;  2JEG A;  5HHI A;  2M2T A;  4UD5 A;  1X40 A;  5ALE A;  3PR5 B;  4PHE A;  4RNO A;  3MDA A;  3SR6 A;  3BQT A;  1NZP A;  4F91 B;  3HWT A;  4PH5 A;  2GOL A;  1TFW A;  3FDS A;  2WAQ C;  3HKZ C;  4O5C A;  1UA0 A;  3IRU A;  4I2D A;  4K96 A;  2JEF A;  1U4B A;  2B0C A;  3RJH A;  1KSP A;  2XC9 A;  4X4R A;  3V6J A;  2HMX A;  4ECW A;  5KFD A;  3HKZ F;  1JRP A;  2NRZ A;  3RRG A;  4JMU A;  9ICU A;  3H4B A;  1ZQV A;  3UPQ A;  2ZIW B;  3JPP A;  1OUQ A;  2OXO A;  2PFQ A;  4LZG A;  2AU0 A;  1TVA A;  3FM9 A;  1Z19 A;  3AQE A;  2KKV A;  2UVU A;  3IN5 A;  3H37 A;  1VLB A;  2KZ3 A;  1Q3U A;  1KFT A;  3N7P D;  4U6P A;  3C28 A;  1B22 A;  2ODG A;  3EWA A;  4YR3 A;  4RWQ A;  5KG7 A;  3LYS A;  1T7P A;  3NYB A;  1J2N A;  5HC9 A;  1VDV A;  3PW0 A;  1NK7 A;  3BQ7 A;  2KTQ A;  2BQU A;  2E8P A;  2WB1 F;  4KX5 A;  2ZXI A;  4ECR A;  3HJ1 A;  3OTQ A;  2DR7 A;  2EZZ A;  2W9B A;  2YB1 A;  4E0D A;  3E2E A;  3ERC C;  2AHO B;  4UB6 U;  5J0X A;  4WBZ A;  5J0R A;  3CYM A;  2KP7 A;  5J2D A;  1PX5 A;  2G5I B;  5J2C A;  3TAQ A;  5L1I A;  4Y2J A;  3OVB A;  4X4N A;  3OGU A;  1S5L U;  4F71 A;  1Z4O A;  3WK5 A;  1ZD5 A;  4QIW C;  2HCF A;  1B43 A;  5AHX A;  4TUR A;  4O3O A;  4O3P A;  4Y2X A;  2N1R A;  1AQ6 A;  3BS5 A;  1OU5 A;  3JPT A;  3F53 A;  1VJ7 A;  5CWR A;  2KHV A;  3T3F A;  3PO4 A;  4DSE A;  1SKR A;  4C4S A;  2W7P A;  3WKB A;  4QIW F;  2BHN A;  4F4X A;  2LHT A;  4EGW A;  4AT9 A;  4BWJ A;  4ELU A;  4DSK A;  3NVV A;  4FBT A;  3H3A A;  3L5K A;  1ZQD A;  5AI9 A;  5J2J A;  1ZJN A;  4EZ6 A;  2RP5 A;  3ICX A;  2V4Q A;  2HHP A;  1ZRN A;  1KEJ A;  4ED3 A;  2EDU A;  3B0Y A;  5CHE A;  5DDM A;  4NLC A;  2DQN B;  4O3Q A;  3JPN A;  2JRZ A;  3RR8 A;  3M7D A;  2XCP A;  4WCW A;  4DCC A;  1NJZ A;  4YP3 A;  2KHQ A;  2KFZ A;  4O67 A;  5KFM A;  4RUC A;  5AK6 A;  4K97 A;  3A0H U;  2OEH A;  1NOM A;  3SAG A;  4RQ5 A;  3C5F A;  1YLQ A;  5HRE A;  3T5L A;  3QXG A;  3WK9 A;  5J0W A;  2ZIV A;  9ICJ A;  2EZX A;  4F8R A;  1X2I A;  5ALR A;  7ICP A;  2ZXH A;  7ICM A;  1RM6 C;  2VJ5 A;  1N5X A;  3KHH A;  2WF9 A;  1F0M A;  2KKP A;  4IR1 A;  4USA A;  2XI9 A;  4WBY A;  3H7I A;  3RR7 A;  2NRT A;  4M0A A;  5KFT A;  1WWU A;  2XY6 A;  1LKY B;  4IC9 A;  1ZQN A;  3WKC A;  2KVS A;  4I27 A;  3SD7 A;  4F4W A;  8ICW A;  4M5D A;  9ICF A;  4WH5 A;  3F5A A;  2B4V A;  3RJI A;  5HMM A;  1S8O A;  5AM4 A;  5KL8 B;  1IG6 A;  4IS7 A;  1MQ3 A;  5CRX A;  3OJS A;  1X6I A;  4KLJ A;  4ATB B;  3OVA A;  2ZH9 A;  1U49 A;  4X4Q A;  5AKE A;  3ISD A;  4LEV A;  4X4S A;  1PK3 A;  4EEL A;  1DK2 A;  8ICU A;  3BZK A;  2K4E A;  2DRA A;  5EWF A;  3KHG A;  2VA8 A;  2W8L A;  2W04 A;  4JWM A;  1MIY A;  4XRH A;  1Q3V A;  4KIT B;  3AL0 B;  1MIV A;  3T5H A;  3UMB A;  1K1S A;  3NRW A;  2V9W A;  4KLD A;  1TAM A;  5ALQ A;  1WWV A;  1XC9 A;  2AH5 A;  2JXJ A;  4QZF A;  3PZP A;  1QCK A;  3DDH A;  2YTU A;  4DSF A;  1L3S A;  4WC0 A;  2PMZ C;  4DL5 A;  5ALK A;  4F93 B;  3JPR A;  5HR7 A;  4M47 A;  2Y9U A;  4YR0 A;  4FHV A;  1ZQA A;  3GV7 B;  5DBB A;  3QEB Z;  4OJ5 A;  5KT3 A;  1UT8 A;  2KK0 A;  4MEY A;  5AIC A;  5DKW A;  3PMN A;  4DF8 A;  5ALU A;  3T5J A;  2PMZ F;  1SGG A;  5HNK A;  4HYK A;  1UPH A;  3V7J A;  1A6S A;  3V6K A;  3AU6 A;  1XSP A;  3QU5 A;  3DEE A;  4PZN A;  1PK1 B;  2P6R A;  4JV2 A;  3TAD C;  1XS9 D;  4JV0 A;  2A1J A;  3LVV A;  3ZDC A;  4DEZ A;  1H38 A;  1SV0 A;  3ORY A;  4QZD A;  1ZQC A;  2PXI A;  3UXP A;  3LDA A;  2WTF A;  1EXN A;  5ALY A;  3IG8 A;  1L7N A;  1RXW A;  3GU3 A;  3H8S A;  9ICX A;  3HP6 A;  3NTU A;  4M9J A;  4BXO A;  3G6Y A;  4RQM A;  5DB6 A;  1L5U A;  1SL0 A;  4GIB A;  1UEU A;  4C80 A;  1U45 A;  4DOA A;  1ZQU A;  2EAP A;  7ICI A;  9ICN A;  4AYB C;  5AKI A;  4DFJ A;  5ALT A;  2HHT A;  2ZG6 A;  4JK1 A;  2DWQ A;  4QWA A;  1DRG A;  4F4Z A;  3RBE A;  1VFG A;  2F76 X;  3QZ8 A;  4RNN A;  8ICT A;  2DBY A;  2IHO A;  4Y2U A;  3LQC B;  4RQ0 A;  2IOF A;  3LK9 A;  3V7L A;  1MSW D;  4XA5 A;  3PHZ A;  2LPE A;  4YXM A;  2E1E A;  4Y2S A;  1NK9 A;  4CF5 A;  5HRB A;  4O9M A;  8ICF A;  2XY5 A;  5AKL A;  4RQ1 A;  1DOQ A;  1XO0 A;  5KFO A;  1NK0 A;  1L3V A;  9ICT A;  3TAP A;  2Y0S C;  3RJG A;  4DO9 A;  4BWM A;  3RH4 A;  4J03 A;  3M8S A;  1BPE A;  4O3R A;  3JPQ A;  3WFR E;  4K4G A;  4DFK A;  2HHQ A;  3ZD9 A;  3AQF A;  5DG9 A;  2E8M A;  4MEX A;  4BX9 C;  3N7R C;  4RNM A;  3HJE A;  2KE7 A;  1T3N A;  1ZJM A;  1MQ2 A;  5AKK A;  4K4H A;  3AQK A;  2FPL A;  4KTQ A;  3RFA A;  3KZI U;  2ZTD A;  4Z6E A;  2F1I A;  4O0I A;  5KFC A;  4PGX A;  4KLE A;  1R8B A;  4OAF A;  4I2H A;  5AM3 A;  4WC6 A;  4O5E A;  3RB6 A;  5BOL A;  2AJQ A;  2JV3 A;  4I28 A;  3MC1 A;  4IQV A;  3BQ0 A;  5AIA A;  4J9P A;  2K4I A;  2ZIW A;  3QUT A;  4UB5 A;  1X9M A;  3L3F X;  5E79 U;  2I9G A;  1RPL A;  4XUS A;  3MGV A;  4PHD A;  5ALZ A;  2W03 A;  2RFF A;  2EAN A;  7ICE A;  4OJ6 A;  3VCB A;  1N63 A;  5HRD A;  1CI4 A;  3BZC A;  4NXW A;  2UVW A;  1SXE A;  2ASJ A;  3H8J A;  5D63 A;  4DL3 A;  3AEV A;  5KT5 A;  4NL9 C;  4FS2 A;  4UBC A;  4YR2 A;  2CXY A;  2KOB A;  5KFL A;  5IIO A;  3Q8K A;  3BJY A;  4XQ8 A;  5ALD A;  5HRK A;  4AT8 B;  3H40 A;  4GXJ A;  1NKE A;  5DQG A;  5CFS A;  4PL2 A;  2DUY A;  4ACO A;  2RHF A;  1QQ6 A;  4C4T A;  4KMO B;  3C2L A;  9ICW A;  3TI0 A;  8ICM A;  4CDG A;  4MHV A;  2B51 A;  4QZG A;  3OV7 A;  3MGI A;  2F8L A;  2Z7J A;  1F44 A;  3JPS A;  2F1J A;  3Q8Q B;  4UAS A;  4DL6 A;  2LYA A;  4RPX A;  3H0M B;  4Q44 A;  5AK3 A;  7ICV A;  4FH5 A;  5B5E U;  2YMM A;  2PI4 A;  3F5E A;  3ETR A;  4NLN A;  2P35 A;  2M0N A;  4PJ0 U;  4RQ4 A;  4Z6F A;  2B56 A;  2H3V A;  2ATL A;  3ISB A;  4ZH4 A;  5CB1 A;  5KFZ A;  4C8L A;  3WK6 A;  4YMM A;  4F2S A;  3L9D A;  5J0U A;  1WYG A;  1V9P A;  3PSI A;  2K60 A;  1QLN A;  2BQ3 A;  3OUY B;  2W9C B;  4B9T A;  4G3I A;  4EV6 A;  5KFK A;  4BUG A;  1SIJ A;  1WG8 A;  2MUT B;  3PSP A;  1RQN A;  1SZP A;  9ICS A;  3IM1 A;  3BDP A;  2DGZ A;  1QTM A;  4ZOH C;  5D62 A;  3EPI A;  5FP0 A;  8ICB A;  3N7S C;  2P6U A;  5KG6 A;  4R65 A;  4KLT A;  8ICZ A;  5GTH U;  4F5P A;  2K89 A;  9ICQ A;  4I2F A;  3H0R B;  2ZUC A;  4Z6C A;  3EYZ A;  3ZI4 A;  2BKE A;  2FLN A;  2BCU A;  4WC7 A;  3OWG A;  2YN4 A;  3KHR A;  1T8E A;  4B6J A;  4DQI A;  1L3T A;  4R8U B;  2W3S A;  4UQG A;  4UAV A;  5J0O A;  3MDC A;  1FO4 A;  2RLT A;  4WQL A;  1S97 A;  1TK8 A;  3T79 A;  3C29 A;  3KD3 A;  5EE1 A;  7ICU A;  2ZH2 A;  4YXJ A;  3B9J A;  1R8C A;  2F3N A;  4TUQ A;  1UT5 A;  4NLG A;  1TAQ A;  3SI8 A;  5KFG A;  5AIB A;  2JH1 A;  4KLG A;  2QAR B;  4I2G A;  2GA9 D;  2ZH3 A;  1S0N A;  4O6A A;  5J2F A;  5J2G A;  5JUM A;  4B9U A;  2PKE A;  4Z6D A;  1O08 A;  1SB3 C;  4X0B A;  2VAN A;  1COO A;  7ICN A;  2ESE A;  3C21 A;  3E58 A;  5III A;  1L7M A;  3H0L B;  4E8F A;  1BVS A;  2WF8 A;  2RRD A;  1D9F A;  2J6S A;  5ALS A;  2WB1 C;  4WJ3 B;  4LT6 A;  3F2C A;  5IIK A;  2OM6 A;  3RAX A;  1PVQ A;  5ALG A;  1Z1B A;  1SWW A;  5DB8 A;  2HN2 A;  4FO6 A;  5AI6 A;  3WKD A;  1X9X A;  1RG6 A;  5J0Y A;  2R8H A;  4K9A A;  3V7K A;  7ICT A;  4ATB A;  2JR5 A;  9ICC A;  1ZD2 P;  3QU4 A;  1VJ5 A;  4RWN A;  3C1Z A;  4LEY A;  5EWG A;  1ZQG A;  2K8A A;  5KT6 A;  2VIX A;  2YY6 A;  3RB3 A;  1NK8 A;  1JXE A;  1MN8 A;  3CNH A;  3GDX A;  2F1H A;  4PHA A;  4WC2 A;  2BR0 A;  4Q8E A;  2ASD A;  4Y2Y A;  3TQ1 A;  5HRF A;  3K75 D;  5DGB A;  1IXR A;  4FO1 A;  2G07 A;  3AUO A;  4EZ9 A;  5B3Q A;  2BCR A;  1DGS A;  3M9M B;  4XJE A;  2ZH5 A;  3PX4 A;  3C18 A;  3TAN A;  4C8N A;  1X42 A;  2ZH6 A;  5KFU A;  4EBD A;  4MFF A;  4YMO A;  4IQW A;  3ED5 A;  2R8I A;  2HHV A;  3F2B A;  1BNO A;  5F9L A;  5B66 U;  3RH6 A;  5J0S A;  7ICH A;  2HHS A;  3AQN A;  2LKY A;  1ZD3 A;  8ICX A;  2KNJ A;  5KFS A;  1JQR A;  5DB9 A;  2HHX A;  5DB7 A;  8ICN A;  4OAH A;  4EBC A;  1QSS A;  1RDF A;  1ZQR A;  5KG1 A;  4J9S A;  4OJL A;  1PK1 A;  3M8R A;  1BPX A;  4ED6 A;  2AXT U;  4KLO A;  3AQL A;  5CHG A;  1R89 A;  4ED7 A;  4PZO A;  4AT7 B;  4US9 A;  3O0F A;  3VC8 A;  5AM5 A;  2KG5 A;  1S76 D;  3QUB A;  2PFN A;  3D2S A;  3C1Y A;  2QB0 B;  1HUO A;  3GQC A;  3FAH A;  2JH7 A;  2HN1 A;  5AI5 A;  4P4M A;  2GAF D;  5KFY A;  1PVR A;  4WC5 A;  1N56 A;  1ARO P;  2ES6 A;  4KLI A;  2DRB A;  4GC7 A;  4LJX A;  3KFU F;  1Q8K A;  3M6K A;  1QQ7 A;  3GZF A;  3C2M A;  4M9G A;  3RH5 A;  5CA7 A;  4M9N A;  4I2J A;  5AK5 A;  4OJP A;  3NVY A;  5ALF A;  1HUZ A;  2DPJ A;  3EW9 A;  3PY8 A;  3PSF A;  1ZQW A;  2LBO A;  5IIJ A;  3TFR A;  5KFI A;  4NXT A;  1KFD A;  5JTI A;  5HRI A;  1ZQL A;  4I2I A;  4R66 A;  4NM2 A;  1NNL A;  4JB3 A;  2I1Q A;  2IHM A;  4WC4 A;  9ICB A;  3U26 A;  2ZJ8 A;  3MFI A;  4RT3 A;  5DLG A;  3IP4 B;  1D8Y A;  2KIV A;  3K1R B;  1COK A;  2PBE A;  1ZET A;  3ETL A;  3K7D A;  1BPB A;  8ICH A;  2BCQ A;  3TAD A;  4Y2R A;  7ICG A;  2OCE A;  5K4L A;  2KZM A;  1U48 A;  5ALX A;  3WFQ E;  5KG4 A;  3I1Y A;  4F4Y A;  4R64 A;  4KB6 A;  4NM1 A;  2E8O A;  9ICL A;  3NUQ A;  4QZH A;  4QW8 A;  4C8K A;  3RJJ A;  2UVV A;  3RF9 A;  4US8 A;  4K99 A;  5DG7 A;  4FHX A;  2EQY A;  1DXS A;  4DSL A;  5TIS U;  5KAF U;  2RQ5 A;  9ICK A;  2F77 X;  2NRV A;  4LZD A;  2KFN A;  1ZQK A;  5CP2 A;  5GTI U;  3OHA A;  3RB4 A;  2VKQ A;  2I5H A;  3J81 j;  3TFS A;  4NY8 A;  5C5J A;  2G5H B;  4X0A A;  4UAW A;  5T14 A;  2DL0 A;  5KT2 A;  4DLG A;  8ICG A;  4RZR A;  4QWB A;  3NKU A;  4OAG A;  3SYZ A;  3NVZ A;  4DFM A;  5KFP A;  4AT8 A;  4EYH B;  2ZH4 A;  1N48 A;  4YD1 A;  5KG5 A;  4ELV A;  1S77 D;  5KFW A;  4I2C A;  3QUC A;  4J9N A;  4DQR A;  3Q8P B;  5EOZ A;  5AKJ A;  3IHQ B;  4C7Z A;  3OSP A;  1ZQJ A;  2J6T A;  1D8B A;  1QQ5 A;  1WOT A;  2WF7 A;  4DL2 A;  5C0Y A;  2HOQ A;  3ALR A;  4PGY A;  3JYY A;  3N4M B;  4PL1 A;  2C2E A;  1CRX A;  4BGD A;  1OW5 A;  2NO4 A;  2BBH A;  2NRK A;  5DBA A;  2KMD A;  3GIJ A;  2FPK A;  2G0A A;  5IIL A;  7ICS A;  4K8V A;  4FS1 A;  4DS4 A;  1HJP A;  8ICL A;  2DF4 B;  4K98 A;  3UXO A;  4C8O A;  1JAJ A;  4IR9 A;  2W3R A;  2IOH A;  1Z00 B;  4RPY A;  4ECX A;  5KAI U;  4GC6 A;  3OUY A;  2YMP A;  2W9C A;  2KJ5 A;  5F3X B;  1PVP A;  1KKX A;  1SZH A;  4JUZ A;  2ASL A;  2R8G A;  3QEA Z;  1Z4N A;  1NZB A;  3IV6 A;  2BPC A;  1B4F A;  3UMC A;  3CRX A;  1TK5 A;  3LWL A;  1URJ A;  2IHN A;  8ICA A;  4B9N A;  3MAB A;  3BQ1 A;  1WUD A;  2AQ4 A;  2HBJ A;  1NO5 A;  3NVO A;  2FCL A;  5CR0 A;  4EEN A;  4YCX A;  4JLX A;  3WFS C;  1V97 A;  1XWL A;  3RTV A;  2GH1 A;  3PO5 A;  1UET A;  4NL9 A;  4J9O A;  5KFH A;  4UBB A;  2M2V A;  4DSJ A;  2H3F A;  3KKA A;  3OSN A;  3Q8M A;  5EE9 A;  2HBK A;  4QZ8 A;  4TQS A;  4DQS A;  2KEY A;  3MCR A;  4FHY A;  4BDP A;  2ZHB A;  1NK5 A;  4B9L A;  3JPO A;  3NWI A;  2IMW P;  5KFF A;  4E80 A;  2ALZ A;  1RQL A;  4YQW A;  1YZ7 A;  4DQP A;  2E5S A;  5AKH A;  3WK7 A;  2QAR A;  4IRD A;  4DF4 A;  4UAT A;  2PFO A;  4QZB A;  2KD1 A;  2R8J A;  1FIQ A;  2C2D A;  5DGA A;  3QX7 A;  3HIY A;  4X4U A;  3PW7 A;  4QWC A;  3QE9 Y;  2XCA A;  3E0F A;  2FLP A;  7ICJ A;  2H3I A;  2OYY A;  3KHL A;  3FC4 A;  4Q43 A;  9ICH A;  2K4P A;  2IUB A;  4X4V A;  4C0Z A;  2FMS A;  1BPY A;  4ECQ A;  1NK4 A;  3SAF A;  5HRG A;  4Q45 A;  5L1M A;  1KL9 A;  1ZQM A;  2H5X A;  3Q8R B;  2L5Y A;  3QU7 A;  1S0V A;  5JU5 A;  4MF2 A;  3QZ7 A;  4EBK A;  4KLH A;  2NRW A;  4UAR A;  3KOO A;  4RQ3 A;  2PI5 A;  4Y2Q A;  1QH9 A;  3KKA C;  1Y88 A;  5ALM A;  1T3Q A;  5KFB A;  4WOY A;  3MR3 A;  1ZQB A;  1RXV A;  3QU9 A;  4I0U A;  3NAS A;  5TZV A;  2XY7 A;  3NVW A;  2FLL A;  1KNY A;  3H38 A;  1JIH A;  4JWN A;  2M2W A;  3D2Q A;  2QKQ A;  1NJW A;  2RDJ A;  3GII A;  2W54 A;  5DG8 A;  3QYP A;  2F2A B;  4QNL A;  5B3P A;  1YZ6 A;  1S9F A;  3SZ2 A;  2MSN A;  1L7O A;  5ALI A;  3CP8 A;  4UAZ A;  4RT2 A;  5D49 A;  4WQK A;  4UW9 A;  3RJE A;  4P0P B;  4F3O A;  3NS1 A;  5ALL A;  3UQ2 A;  1ZQZ A;  1MA7 A;  2JHD A;  5KG3 A;  3GFK B;  2IOF K;  1ED1 A;  4OD0 A;  1B0X A;  3SV4 A; 
#chains in the Genus database with same CATH homology
 3TAN A;  4QZI A;  4C8N A;  2ZH6 A;  5KFU A;  4EBD A;  4J9Q A;  1MQ3 A;  4MFF A;  1JX4 A;  4YMO A;  4IQW A;  2NRX A;  3OJS A;  3ZDA A;  4KLJ A;  2HVI A;  4ATB B;  2AQ0 A;  1SL1 A;  3OVA A;  2ZH9 A;  1U49 A;  9ICV A;  1XU4 A;  4AT7 A;  2DRA A;  1U47 A;  4X4Q A;  3ISD A;  4M6W B;  2R8I A;  2HHV A;  4CCH A;  4X4S A;  4FHP A;  4IG8 A;  5KT4 A;  1TFR A;  1DK2 A;  1BNO A;  8ICU A;  2JZB B;  4UD4 A;  3HT3 A;  5F9L A;  3OHB A;  3RH6 A;  7ICF A;  7ICK A;  1UEV A;  5J0S A;  4F2R A;  5EWF A;  4GLX A;  2HHS A;  3KHG A;  2VA8 A;  2W8L A;  5KFN A;  2Y1J A;  3UQ0 A;  2VA3 A;  4KLM A;  2HHW A;  9ICM A;  3AQN A;  4RQ2 A;  5KG0 A;  2ZJ5 A;  4JWM A;  4IRC A;  1MIY A;  4XRH A;  1NK6 A;  2HHU A;  8ICX A;  8ICK A;  2ZTC A;  4KIT B;  7ICH A;  5J2K A;  5DQH A;  5KFS A;  1ZQF A;  1JQR A;  5F9N A;  1MIV A;  4O5K A;  2XGP A;  5DB9 A;  2C22 A;  2HHX A;  5DB7 A;  2W9M A;  8ICN A;  4X4T A;  3PVX A;  3T5H A;  1KLN A;  4EBC A;  1QSS A;  1K1S A;  3ISC A;  2V9W A;  4WC1 A;  4KLD A;  1ZQR A;  1X9S A;  5KG1 A;  2IBK A;  4F5Q A;  5J2E A;  4J9S A;  3HW8 A;  4UB4 A;  2C28 A;  4M9H A;  4EEY A;  3RJK A;  1XC9 A;  1WOT A;  1NJX A;  3JZ0 A;  2UVR A;  4QZF A;  3M8R A;  4KN7 A;  1BPX A;  4ED6 A;  4DSF A;  4KN4 A;  1L3S A;  1BNP A;  3MR6 A;  2ISO A;  4KLO A;  4Q8F A;  4F4K A;  3AQL A;  4WC0 A;  5KT7 A;  5CHG A;  1ZQY A;  2DR8 A;  4DL4 A;  2KN7 A;  8ICI A;  1R89 A;  3H39 A;  9ICG A;  9ICR A;  4DL5 A;  4ED7 A;  4F93 B;  4IQT A;  3JPR A;  4AT7 B;  2W9A A;  4M47 A;  3C2K A;  4EBJ A;  4YR0 A;  4FHV A;  1TFY A;  2DR5 A;  4DLE A;  1ZQA A;  4ECV A;  3GV7 B;  4M9L A;  4PHP A;  5DBB A;  3LWM A;  3QEB Z;  4ELT A;  4ECU A;  5KT3 A;  3K4G A;  1UT8 A;  4P4O A;  4MEY A;  5DKW A;  3PMN A;  5IIN A;  4DF8 A;  2PFN A;  1S76 D;  3C1Y A;  2DPI A;  3GIM A;  3GQC A;  3T5J A;  1HUO A;  3THV A;  5HNK A;  5KFV A;  4HYK A;  1PZN A;  8ICV A;  4FBU A;  3G6X A;  3V7J A;  5EWE A;  1XSN A;  1Q78 A;  4P4M A;  5CJ7 A;  3V6K A;  2M2U A;  3AU6 A;  5KFY A;  5DQI A;  1XSP A;  4WC5 A;  3OJU A;  4X5V A;  1N56 A;  1ARO P;  1TV9 A;  3MR5 A;  5J0P A;  4KLI A;  2DRB A;  4DQQ A;  2OWO A;  3HPO A;  4F50 A;  4GC7 A;  4YVZ A;  2P6R A;  3RAQ A;  4JV2 A;  4J9M A;  4YMN A;  3PML A;  2Y1I A;  1XS9 D;  1D8L A;  4JV0 A;  4QWE A;  2A1J A;  1CUK A;  3PW4 A;  4EBE A;  1S0O A;  3ZDC A;  4YG2 A;  4DEZ A;  2B21 A;  1H38 A;  1ZQC A;  3ORY A;  4QZD A;  3C2M A;  4UB1 A;  4QZA A;  3GV5 B;  4DS5 A;  3EPG A;  1WCL A;  2PXI A;  2BPG A;  4M9G A;  3RH5 A;  5CA7 A;  1SKW A;  4M9N A;  4FH3 A;  3UXP A;  3LDA A;  2WTF A;  4PGQ A;  4RQ6 A;  4DOC A;  5F2V O;  4I2J A;  3FYH A;  1EXN A;  2ZHA A;  2ZUB A;  1A77 A;  1L3U A;  4I2E A;  1C7Y A;  3V6H A;  1RXW A;  4MF8 A;  4J9R A;  3Q8S B;  3PX6 A;  3H8S A;  1HUZ A;  3HP6 A;  8ICO A;  3NTU A;  9ICX A;  4M9J A;  4BXO A;  2DPJ A;  3EW9 A;  3G6Y A;  3PY8 A;  4UB3 A;  3MBY A;  1ZQW A;  5DB6 A;  5IIJ A;  3MFH A;  3TFR A;  1L5U A;  3GIL A;  4X4O A;  1RZT A;  5DEC A;  5KFI A;  1Q79 A;  4B9M A;  5J2H A;  1KFD A;  4NKT A;  4I2B A;  4DFP A;  1SL0 A;  2DVI A;  1UEU A;  2FPM A;  5KFE A;  1ZQL A;  4I2I A;  1ZQS A;  5HRI A;  4R66 A;  1U45 A;  3ZDB A;  4DOA A;  1ZQU A;  4F5N A;  4NM2 A;  5HML A;  1R8A A;  2RDI A;  1NJY A;  7ICI A;  9ICN A;  1A76 A;  3PW2 A;  2I1Q A;  3M9O B;  4DFJ A;  2IHM A;  4WC4 A;  1UA1 A;  1X9W A;  2A1J B;  3B0X A;  1ZQP A;  2JEJ A;  2HHT A;  9ICB A;  1NKB A;  2ZJ8 A;  4JK1 A;  3RJF A;  5KFR A;  4RT3 A;  3MFI A;  5DLG A;  4QWA A;  2VA2 A;  3PR4 A;  4F4Z A;  4S3N A;  1D8Y A;  3RBE A;  1VFG A;  4M04 A;  2PBE A;  1ZET A;  3QZ8 A;  2BGW A;  4TQR A;  4RNN A;  2HW3 A;  8ICY A;  5J29 A;  8ICT A;  3ETL A;  8ICP A;  8ICR A;  3LQC B;  1BPB A;  8ICH A;  4RQ0 A;  4TUS A;  2BCQ A;  3LK9 A;  4DWI A;  5KFQ A;  3PNC A;  3UPS A;  2W8K A;  4B9S A;  7ICG A;  3V7L A;  1XO1 A;  1MSW D;  5HR9 A;  2ISP A;  4XA5 A;  2KZM A;  4BXO B;  2DFL A;  4NXZ A;  5DBC A;  1U48 A;  4YXM A;  3AU2 A;  4JV1 A;  3WFQ E;  1TK0 A;  4NKU A;  4ED2 A;  1NK9 A;  2O1P A;  3GV8 B;  5HRB A;  3PX0 A;  5KG4 A;  4O9M A;  4GXI A;  8ICF A;  4F4Y A;  4R64 A;  2XY5 A;  1ZQT A;  4NM1 A;  3G6V A;  4MFC A;  9ICL A;  4RQ1 A;  1DOQ A;  3TAR A;  5KFO A;  4QZH A;  4QW8 A;  2Q0Z X;  2XGQ A;  3TAP A;  1NK0 A;  1L3V A;  2KZZ A;  4X4P A;  2ZH8 A;  5J0Q A;  4TUP A;  4KLU A;  3RJG A;  1T4G A;  1ZYQ A;  3PV8 A;  1NKC A;  2UVV A;  3RJJ A;  4C8K A;  4DO9 A;  9ICA A;  3RBD A;  4QZC A;  5L1K A;  9ICT A;  4BWM A;  3RH4 A;  1CEZ A;  3M8S A;  5DG7 A;  5J0T A;  1BPE A;  1TKD A;  3JPQ A;  4O3R A;  4K4G A;  1MIW A;  4FHX A;  4J9K A;  3WFR E;  4DFK A;  2HHQ A;  4GXK A;  3H4D A;  3ZD9 A;  3MR2 A;  4DSL A;  8ICS A;  5DG9 A;  1ZQQ A;  4B9V A;  1F5A A;  5DED A;  9ICK A;  5BOM A;  1RYR A;  2NRV A;  4MEX A;  4LZD A;  1U9L A;  4C8M A;  4RNM A;  2KFN A;  1ZQK A;  3BQ2 A;  5CP2 A;  3RB4 A;  3OHA A;  1T3N A;  1KDH A;  1FA0 A;  1ZJM A;  4WC3 A;  3TFS A;  4NY8 A;  5DDY A;  5C5J A;  2M9N A;  3C5G A;  1MQ2 A;  4K4H A;  5HRL A;  1SKS A;  3MGH A;  2FMP A;  5KTQ A;  5HHH A;  1KRP A;  2FMQ A;  4UAW A;  5HRH A;  2FPL A;  3AQK A;  4X0A A;  2XO7 A;  4ECT A;  4KTQ A;  5KT2 A;  4Z6E A;  2ZTD A;  4DLG A;  4RZR A;  4RQ8 A;  8ICG A;  2F1I A;  4QWB A;  4O0I A;  5KFC A;  4PGX A;  4KLE A;  3KTQ A;  1R8B A;  1QSL A;  3ZD8 A;  5L1L A;  4I2H A;  3SYZ A;  2BE3 A;  4WC6 A;  4O5E A;  1ZQO A;  3RB6 A;  5BOL A;  3OVS A;  4DFM A;  3C23 A;  3RB0 A;  1S10 A;  4I28 A;  5KFP A;  4KLF A;  2JEG A;  2AJQ A;  4RWP A;  4IQV A;  3BQ0 A;  7ICO A;  4AT8 A;  5HHI A;  4EYH B;  2M2T A;  4UD5 A;  2ZH4 A;  4J9P A;  1N48 A;  4YD1 A;  8ICJ A;  4UB5 A;  3PR5 B;  4PHE A;  4RNO A;  4F5O A;  1X9M A;  5KG5 A;  4ELV A;  3MDA A;  1Z00 A;  3H8W A;  4I29 A;  3BQT A;  1S77 D;  1NZP A;  5KFW A;  4ED0 A;  4F91 B;  3HWT A;  1RPL A;  4PH5 A;  2I9G A;  1BPD A;  4I2C A;  8ICQ A;  1TFW A;  4XUS A;  3FDS A;  4J9N A;  4O5C A;  4DQR A;  5EOZ A;  4PHD A;  3Q8P B;  3IHQ B;  4RPZ A;  5D4B A;  3OSP A;  1UA0 A;  4I2D A;  1ZQJ A;  2J6T A;  7ICE A;  2RFF A;  4DL2 A;  2JEF A;  5J2B A;  1U4B A;  3RJH A;  5HRD A;  4PGY A;  3JYY A;  1KSP A;  3N4M B;  2UVW A;  2C2E A;  4M2Y A;  4R63 A;  2XC9 A;  5IIM A;  2ASJ A;  4X4R A;  3H8J A;  4BGD A;  3V6J A;  5L9X A;  3C66 A;  4DL3 A;  5KT5 A;  4FS2 A;  4ECW A;  4UBC A;  9ICI A;  5J2I A;  4YR2 A;  4YFK A;  2NRK A;  5DBA A;  5KFD A;  5KFL A;  5IIO A;  3GIJ A;  4QW9 A;  1V4A A;  3Q8K A;  2NRZ A;  3BJY A;  2FPK A;  4XQ8 A;  4QZE A;  3RRG A;  5IIL A;  2ZH1 A;  9ICU A;  7ICS A;  5HRK A;  4IQU A;  5KFX A;  1HJP A;  4FS1 A;  4DS4 A;  8ICL A;  3H40 A;  3H4B A;  3UXO A;  1ZQV A;  4GXJ A;  3UPQ A;  4C8O A;  1NKE A;  4IRK A;  5DQG A;  2J6U A;  4YD2 A;  3JPP A;  2DR9 A;  1JAJ A;  4IR9 A;  1JN3 A;  2BCV A;  2PFQ A;  1Z00 B;  4RPY A;  4ECX A;  4LZG A;  2AU0 A;  1TVA A;  3C2L A;  4GC6 A;  9ICW A;  3TI0 A;  8ICM A;  2UVU A;  3OUY A;  3H37 A;  2W9C A;  4RUA A;  2V4R A;  4O3S A;  2KZ3 A;  4EYI B;  4QZG A;  1KFT A;  4JUZ A;  1ZQH A;  3OV7 A;  1B22 A;  2ASL A;  2BDP A;  4KLS A;  4MFA A;  4YR3 A;  3EWA A;  3QEA Z;  2R8G A;  3MGI A;  4DSI A;  4RWQ A;  5KG7 A;  3Q8L A;  1T7P A;  3JPS A;  4NLZ A;  3NYB A;  3WFP A;  2F1J A;  4F5R A;  4XQ7 A;  2BPC A;  3Q8Q B;  4ED1 A;  5HC9 A;  4DL6 A;  3PW0 A;  1NK7 A;  1TK5 A;  3V72 A;  3LWL A;  2KTQ A;  4RPX A;  2BQU A;  2IHN A;  1IM4 A;  8ICA A;  3AQM A;  4Q44 A;  1JXL A;  4B9N A;  9ICP A;  3MAB A;  4ECR A;  4J9L A;  2R8K A;  7ICV A;  3HJ1 A;  8ICE A;  4FH5 A;  3BQ1 A;  2PI4 A;  2AQ4 A;  4UB2 A;  1WCN A;  1NO5 A;  2DR7 A;  4NLN A;  5CR0 A;  4YCX A;  3WFS C;  2W9B A;  2AGP A;  4RQ4 A;  1XSL A;  4UAY A;  8ICC A;  4Z6F A;  3N97 B;  2ATL A;  4E0D A;  3E2E A;  2BPF A;  5J0X A;  3ISB A;  1XWL A;  4ZH4 A;  5CB1 A;  3RTV A;  5KFZ A;  4C8L A;  5BPC A;  3PO5 A;  4PPX A;  5KFJ A;  1UET A;  4WBZ A;  5J0R A;  4YN4 A;  2KP7 A;  4J9O A;  4YMM A;  4F2S A;  3L9D A;  4LVS A;  4EP7 A;  5KFH A;  5J0U A;  1BGX T;  1V9P A;  4UBB A;  5J2D A;  2GWS A;  4DSJ A;  1QLN A;  2M2V A;  2ZTE A;  5J2C A;  3TAQ A;  2BQ3 A;  1PX5 A;  3OUY B;  5L1I A;  2W9C B;  4B9T A;  4G3I A;  4RWO A;  3OVB A;  4X4N A;  5KFK A;  3OGU A;  3OSN A;  3Q8M A;  2MUT B;  1B43 A;  1SZP A;  1K1Q A;  4QZ8 A;  4TQS A;  4DQS A;  4TUR A;  9ICS A;  4O3O A;  4O3P A;  1MC8 A;  2MAX A;  3C18 A;  3IM1 A;  2HVH A;  3BDP A;  4FHY A;  4BDP A;  1OU5 A;  2ZHB A;  1RYS A;  1QTM A;  3JPT A;  7ICL A;  1NK5 A;  4B9L A;  1VJ7 A;  1TAU A;  3EPI A;  5CWR A;  3JPO A;  1KFS A;  3T3F A;  2P6U A;  2IMW P;  5KG6 A;  4R65 A;  8ICB A;  9ICE A;  3PO4 A;  4AT8 B;  5KFF A;  4DSE A;  4ECY A;  2AGQ A;  1SKR A;  4F5P A;  4KLT A;  4ED8 A;  8ICZ A;  4E80 A;  2W9B B;  2ALZ A;  2BHN A;  4F4X A;  5KG2 A;  4AT9 A;  4YQW A;  9ICQ A;  4DQP A;  4BWJ A;  4ELU A;  4I2F A;  4DSK A;  4IRD A;  7ICR A;  2ZUC A;  4Z6C A;  3EYZ A;  4DF4 A;  5J2A A;  2BKE A;  2PFO A;  2FLN A;  2BCU A;  4QZB A;  4FBT A;  4WC7 A;  3H3A A;  3KHR A;  1T8E A;  2R8J A;  3M9N B;  5DLF A;  1ZQD A;  1ZQX A;  4DQI A;  1L3T A;  2C2D A;  5J2J A;  4R8U B;  5DGA A;  1ZJN A;  5L1J A;  4EZ6 A;  3HIY A;  4X4U A;  4KLL A;  2V4Q A;  3PW7 A;  2PFP A;  4UQG A;  4QWC A;  2HHP A;  5D46 A;  3QE9 Y;  1KEJ A;  1ZQI A;  4KLQ A;  4ED3 A;  2XCA A;  5J0O A;  3GIK A;  4DL7 A;  3MDC A;  2FLP A;  7ICJ A;  3B0Y A;  3ZDD A;  5DDM A;  1D9D A;  3EZ5 A;  1S97 A;  1TK8 A;  3KHL A;  9ICO A;  3T5K A;  4Q43 A;  9ICH A;  4O3Q A;  3JPN A;  3RR8 A;  4X4V A;  2XCP A;  2BQR A;  2C2R A;  7ICU A;  2ZH2 A;  4YXJ A;  4WCW A;  2FMS A;  2O5A A;  1NJZ A;  1R8C A;  4YP3 A;  4TUQ A;  1UT5 A;  1BPY A;  2P66 A;  4ECQ A;  1NK4 A;  4NLG A;  1TAQ A;  3SI8 A;  5KFG A;  4Q45 A;  5HRG A;  2KFZ A;  4KLG A;  4AT9 B;  1KTQ A;  1ZQM A;  4I2G A;  2H5X A;  3HX0 A;  3Q8R B;  2ZH7 A;  5KFM A;  4RUC A;  2ZH3 A;  1S0N A;  1S0V A;  1S0M A;  4RU9 A;  5J2F A;  4ECZ A;  4MF2 A;  3QZ7 A;  5J2G A;  4EBK A;  4KLH A;  5JUM A;  4B9U A;  1Z3E B;  4Z6D A;  2NRW A;  5HP4 A;  4P2H A;  2ID1 A;  4F92 B;  4X0B A;  7ICQ A;  4RQ7 A;  4RQ3 A;  2PI5 A;  1NOM A;  2VAN A;  5KFA A;  4RQ5 A;  1COO A;  7ICN A;  3PW5 A;  3C5F A;  1Y88 A;  3C21 A;  5III A;  4DOB A;  5KFB A;  1YLQ A;  5HRE A;  4E8F A;  3T5L A;  1BVS A;  3MR3 A;  1ZQB A;  2AGO A;  1LB2 B;  3UXN A;  1RXV A;  4E7X A;  1D9F A;  2J6S A;  4K4I A;  3WFO A;  1SL2 A;  5J0W A;  4LT6 A;  3NGD A;  3SV3 A;  9ICJ A;  5IIK A;  4F8R A;  5TZV A;  1X2I A;  3RAX A;  2LYH A;  2XY7 A;  1QSY A;  5DB8 A;  4ECS A;  4QZ9 A;  4FO6 A;  2FLL A;  2MUT A;  7ICM A;  7ICP A;  5J0Y A;  1KNY A;  3H38 A;  2R8H A;  1JIH A;  1BPZ A;  3V7K A;  7ICT A;  4JWN A;  3KHH A;  2M2W A;  4ATB A;  1NJW A;  4IR1 A;  2RDJ A;  4P4P A;  2ZUD A;  9ICC A;  3GII A;  4I2A A;  4RWN A;  4M6W A;  3C1Z A;  4WBY A;  5DG8 A;  5EWG A;  3RRH A;  1ZQG A;  3H7I A;  4NLK A;  1DK3 A;  5KT6 A;  2JZB A;  3RR7 A;  2NRT A;  4M0A A;  3RB3 A;  4QWD A;  5KFT A;  1NK8 A;  1JXE A;  3HJ4 A;  2Q66 A;  4KMU A;  3ZDE A;  1S9F A;  3GDX A;  4O3N A;  2F1H A;  2XY6 A;  3SZ2 A;  4PHA A;  2ZJA A;  2JEI A;  4WC2 A;  2BCS A;  1ZQE A;  2BR0 A;  4Q8E A;  4UAZ A;  4RT2 A;  1ZQN A;  5D49 A;  3TQ1 A;  2ASD A;  5HRF A;  1JMS A;  1LV5 A;  4I27 A;  3K75 D;  4F4W A;  3RJE A;  8ICW A;  5DGB A;  1IXR A;  4M5D A;  9ICF A;  4F3O A;  2IA6 A;  3UQ2 A;  1ZQZ A;  3RJI A;  3AUO A;  5HMM A;  5KG3 A;  4EZ9 A;  3GFK B;  1DGS A;  2BCR A;  4FHW A;  3M9M B;  4R8U A;  2ZH5 A;  3PX4 A;  3SV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...