4NM2A

Structure of human dna polymerase beta complexed with a nicked dna containing a 8brg-g at n-1 position and g-c at n position
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
321
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 321
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4nm2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4nm2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4nm2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nm2A03
1N56A 3H8SA 4F4WA 3H38A 5L1JA 4KLSA 4DF8A 2A1JB 2UVVA 3TI0A 3ETLA 4QWEA 1XSLA 4KLTA 4FHWA 2XO7A 5KFHA 4YMOA 1UT5A 4I2AA 2ZH8A 1SL2A 4AT8A 4RWNA 3MBYA 2BPFA 5KFZA 4J9LA 3HX0A 2RDIA 1NKCA 2BGWA 4PH5A 2XGPA 3GIJA 3GV5B 2AU0A 1NK7A 3C2KA 3BQ2A 3C1ZA 3GFKB 4FH3A 5EWFA 1NK8A 4BXOA 4WC5A 7ICMA 3GQCA 4RNMA 4UB5A 4UAZA 5IILA 4QZIA 3M9NB 3RJJA 2IA6A 3NTUA 4K4HA 5KFUA 3PX4A 4RQ7A 3QEBZ 4GXKA 5DB7A 8ICMA 2Y1JA 3MGHA 1ZQNA 5DB9A 5KFDA 7ICEA 3GILA 2FMQA 5KFFA 1ZJNA 1XWLA 4ECSA 3T5KA 2JZBA 3C21A 5EWGA 4KMUA 1Z00B 4ELUA 1XU4A 8ICEA 1DK2A 3KHHA 2FPLA 1ZJMA 1U45A 4RUAA 2BCQA 3QZ8A 3OJUA 3RTVA 3ZDDA 2KTQA 4F2SA 2ZUBA 4E80A 1JIHA 3JPOA 1LB2B 1ZQZA 3KHLA 4Z6CA 3ISBA 2NRZA 4RZRA 4JUZA 4X5VA 1BPZA 3Q8PB 1ZQGA 4C8NA 3JYYA 4NLKA 3ISDA 3AQKA 2DR8A 4FHXA 5KG3A 9ICQA 2NRWA 2Q0ZX 4I27A 4UBCA 1V9PA 8ICBA 4WC4A 1ZETA 1MIWA 4X4OA 2ZHBA 3PW7A 1RXWA 1KRPA 2DRBA 1UT8A 3FDSA 4I2BA 5KFGA 2A1JA 1ZQEA 1QSLA 9ICSA 3PMLA 4B9UA 1ZQFA 2ZH2A 8ICRA 4QW8A 1S10A 9ICXA 2AQ0A 3TFSA 5J0YA 4DL4A 5EWEA 4B9VA 2V4RA 4QW9A 2V4QA 2ASDA 4I2JA 1B22A 1F5AA 1BPXA 1UEVA 8ICTA 3EZ5A 5DG9A 3RH4A 5HREA 3WFPA 4F8RA 1T8EA 4J9RA 3B0XA 2BQUA 9ICAA 2ZH1A 1L5UA 1XSNA 1NK0A 4C8KA 3M9MB 4F50A 5KG4A 5L1IA 4ECYA 5HP4A 1KFSA 2XY5A 2C2DA 1ZQXA 1C7YA 1QSSA 2JEFA 4DSJA 2H5XA 4EBCA 8ICGA 3RJFA 1KNYA 3RR8A 2ZHAA 2ISPA 4O3QA 3GV8B 5HNKA 2IHNA 5KFYA 3TARA 2BCUA 1XC9A 9ICEA 2ZH3A 1TKDA 4NXZA 3T5HA 1TK0A 5KFBA 1Y88A 3PO4A 2J6TA 8ICZA 5HRHA 4F92B 1SKRA 2RFFA 3EYZA 4QZFA 8ICNA 4KLMA 3UQ2A 1JXLA 1RYSA 3HIYA 5JUMA 4QZDA 3GV7B 1S9FA 4BGDA 4F4KA 4UD4A 1ZQIA 4R65A 4QZHA 2UVWA 4FHVA 4RPXA 2BE3A 4O5KA 3SZ2A 3RJIA 2BR0A 1NK5A 5F9NA 5J0UA 4PHPA 4Q45A 2NRTA 4RQ6A 2R8IA 4J9SA 4DFMA 3PVXA 2ZH5A 5KT6A 5KFAA 2MAXA 4O0IA 2W9AA 4ECZA 1Z3EB 1TVAA 1X9SA 4RWPA 4DSEA 3AU6A 2IHMA 5BOLA 5C5JA 3PW2A 2AGPA 9ICMA 2PBEA 4ECTA 4DL5A 1R8BA 5F9LA 4AT7B 4P2HA 5J2GA 4BXOB 1ZQQA 4F5PA 2HHQA 7ICIA 4LZDA 8ICAA 2VANA 2ZUDA 2FMPA 2O5AA 2HHSA 4RQ0A 4C8LA 4FBTA 4RQ3A 4RT2A 3ZDEA 1UETA 4MF8A 2R8KA 4YQWA 2ZTCA 2Q66A 4X0BA 5IIJA 4RNOA 4IRKA 3H4DA 1L3TA 8ICIA 5HRIA 4QZCA 4FH5A 4X0AA 1MSWD 3H40A 1KDHA 5J0XA 2BDPA 9ICNA 5HRFA 1T7PA 3E2EA 4WC6A 1ZQAA 3HWTA 1ZQHA 3LWLA 4LZGA 3ZD8A 3RB4A 2AQ4A 4KLQA 3FYHA 4X4UA 4O3SA 1Q78A 8ICCA 1HJPA 4IQUA 5DQIA 1S0MA 4J9KA 1YLQA 3HJ4A 2ZJ8A 1DK3A 4RNNA 4S3NA 3MABA 5KG1A 1LV5A 2R8JA 5CHGA 1S0OA 4Q8EA 4AT9B 1DOQA 4RPYA 5DKWA 4F5NA 2J6UA 4CCHA 4I2CA 1B43A 3PR4A 1ZQOA 2IBKA 3WFRE 3OVAA 2AGQA 2PFQA 4O3PA 5J29A 4DOAA 3ZD9A 4Q44A 1RXVA 4DF4A 4FBUA 4PHDA 3GIKA 4ATBB 5IIIA 4PGXA 4WC2A 4KLGA 4M9JA 3EW9A 4JV1A 8ICLA 3AUOA 1V4AA 4F91B 4UAYA 2DR7A 4BWMA 4NM1A 3H8JA 3C5FA 5HC9A 3NGDA 2VA3A 4XQ7A 4GXIA 8ICHA 4F5RA 5F2VO 1NKEA 3GIMA 3JPQA 5J0OA 4WC1A 3M9OB 3QEAZ 1R89A 1ZQPA 2I9GA 1N48A 1K1SA 2BQRA 2XC9A 2DVIA 4EZ6A 4DSFA 4YMNA 2PFOA 3OJSA 1K1QA 4EBEA 3TAPA 4LVSA 5J2EA 5KFJA 5DEDA 1JXEA 2VA2A 4ECQA 1ZYQA 1JAJA 1X9WA 4MF2A 4O5CA 5KTQA 5DB8A 2B21A 5DBBA 2M2TA 3MR3A 2DR5A 1BPYA 4M04A 5HRDA 2ZJAA 1WCLA 3MFIA 3GIIA 4ECXA 5DGAA 3OSPA 5J2KA 5CWRA 1TFRA 3JPRA 2ASLA 4QZGA 2HHPA 4EYIB 5L9XA 4RQ1A 3WFOA 5J0PA 4YN4A 4XRHA 3M8SA 3T3FA 3UPSA 4AT8B 4F5QA 2V9WA 4RQ4A 4FHPA 3UQ0A 1R8CA 4DSLA 2BPCA 4KLEA 4WC7A 3OV7A 5KFOA 5DGBA 3UXNA 9ICIA 4IQTA 2ZH9A 2F1IA 3EWAA 2FLNA 4RUCA 5DQHA 3RRGA 2HHUA 2DRAA 3C2MA 2UVRA 2C2RA 1HUZA 2DFLA 9ICKA 7ICRA 3V6KA 2ZH6A 5BOMA 4TQRA 3HJ1A 3RAQA 1S0VA 2I1QA 1D8LA 1JX4A 5KFLA 5DG7A 3SV3A 4K4IA 7ICOA 5DBAA 8ICJA 3C66A 3WFSC 5HMMA 1IXRA 2ISOA 2DR9A 3MR2A 3RAXA 4PHEA 4P4PA 4XA5A 4YD1A 4X4VA 3C1YA 5KFKA 4J9NA 3N4MB 4IQWA 3RJGA 8ICYA 4TUPA 2ZJ5A 1MQ3A 4M0AA 4R66A 3OSNA 5D49A 4FS2A 1U48A 3SYZA 3B0YA 5IIKA 2W9MA 3V7KA 1ZQLA 4ED3A 5KFRA 4NLNA 5DBCA 1EXNA 4MEYA 3Q8SB 2ALZA 1XS9D 5KFNA 1L3UA 1KLNA 4PPXA 9ICJA 2MUTA 4YR0A 3RJEA 4DOBA 4ECUA 2P6RA 1NK9A 4E7XA 1A76A 2KZ3A 4I2DA 1S0NA 3ORYA 4O3OA 2W9CA 4QWAA 3AU2A 1RZTA 4M2YA 2KZZA 3V6JA 5KFCA 3C23A 2JEIA 4P4MA 4Q43A 1TK8A 3MGIA 5HRLA 4JV0A 8ICFA 1KTQA 4J9OA 3TQ1A 2BKEA 4P4OA 4NLGA 4X4SA 1ZQVA 4J9MA 2PFPA 4GC6A 4YR2A 4DSKA 9ICGA 5L1KA 1SZPA 3PR5B 3RB6A 3Q8MA 1U4BA 3IHQB 5KG7A 1NJWA 2J6SA 5KFWA 3KHGA 3UPQA 2BQ3A 3PY8A 4KLHA 4DQSA 2PXIA 4MFAA 5J0SA 3EPIA 2HHXA 2XCAA 4NLZA 3BDPA 4GLXA 7ICPA 8ICXA 8ICKA 4M9GA 5KG0A 1S97A 3H7IA 4R8UA 1SKWA 1KSPA 4YXJA 3BQ1A 4IR9A 2NRKA 5CA7A 5CB1A 4F93B 4MFFA 4AT9A 4KN7A 4IRDA 1Z00A 4FHYA 4UAWA 3PV8A 1NJYA 3GDXA 2BCVA 4EBKA 4ELTA 3ISCA 7ICHA 9ICBA 4ECRA 4RPZA 4DS5A 2BPGA 3H39A 4DLEA 4DQRA 2VA8A 4JWMA 4YMMA 5IINA 4M47A 2R8HA 5KT3A 4JWNA 4R64A 3T5LA 3H8WA 1ZQUA 3RH6A 5J2HA 1ZQJA 4M9LA 4R63A 1U9LA 3OHAA 2FPMA 3V6HA 2FLPA 1S76D 1X9MA 2M2UA 2JEGA 3OUYB 2XY7A 1TFWA 1NKBA 4IQVA 4YD2A 3RRHA 4ECWA 3G6VA 4O3NA 2FMSA 1S77D 1PX5A 4DLGA 4LT6A 1BPBA 3RJKA 4KTQA 4DFKA 1ZQYA 8ICOA 3L9DA 1BVSA 4C8MA 3OVSA 4DS4A 3THVA 1MQ2A 3LQCB 5D46A 2M9NA 1ZQMA 4E0DA 1NZPA 3PW5A 2ZTDA 4BWJA 3QZ7A 2W9CB 3SV4A 3OVBA 3MDAA 4EYHB 2HHVA 4E8FA 4UBBA 5KFMA 2PI5A 5KT4A 3JPSA 2XY6A 4YG2A 1ZQDA 1H38A 4QZEA 8ICVA 1TAQA 9ICLA 5DLGA 3MR6A 4DSIA 8ICSA 4F4XA 4M9NA 3RJHA 1JQRA 3WFQE 1UA0A 4DOCA 2Y1IA 1QSYA 9ICUA 2C2EA 3K4GA 4I2HA 5J0WA 3BJYA 4AT7A 1CEZA 9ICPA 2M2VA 1WCNA 1WOTA 4I2FA 5J2BA 4ED7A 4Z6FA 4DL6A 4I2GA 1SKSA 4RQ2A 4M6WA 4R8UB 1ZQBA 3KTQA 4M5DA 1VJ7A 3RR7A 3T5JA 4TUQA 1TV9A 3LDAA 1TK5A 5KFPA 5KFSA 5IIMA 1COOA 5IIOA 3OGUA 4MFCA 5DLFA 9ICWA 4NKTA 5DECA 4F4YA 4WC0A 4KLDA 4ED8A 3OHBA 2W9BB 3G6YA 4YXMA 1D9FA 4UD5A 2ATLA 5KFXA 2KFZA 5DB6A 4I2IA 3M8RA 4B9SA 4JK1A 2KN7A 1VFGA 3RB0A 4ECVA 5BPCA 3V72A 3TFRA 1NJXA 2ZUCA 3IM1A 1T3NA 4KLFA 2BHNA 4EP7A 5HR9A 1TAUA 4Z6DA 5CP2A 3HP6A 3LWMA 2W8LA 4KLOA 2O1PA 3JZ0A 4DL7A 4RQ5A 4DWIA 7ICKA 3RBEA 4B9NA 4DO9A 2DPIA 4ELVA 3PNCA 3H37A 5J2CA 1MIYA 1KEJA 4RT3A 3MFHA 4RU9A 1ZQWA 4QZ9A 2ASJA 1D9DA 4KLLA 3JPPA 4IR1A 1FA0A 1QTMA 2W9BA 4DQQA 5J2DA 2WTFA 3G6XA 4X4TA 3PX0A 4QZAA 4DQPA 5KFEA 3K75D 5CR0A 4TURA 5HHHA 4MEXA 2HVHA 2OWOA 5HRGA 2XGQA 8ICQA 1NK6A 3H4BA 1JN3A 3PMNA 3LK9A 4RWQA 1BNOA 4O9MA 4QWCA 5DQGA 5HRBA 4O3RA 4B9TA 1SL0A 4XQ8A 5J0TA 4FO6A 5CJ7A 5D4BA 5J2JA 2HVIA 3ZDAA 1T4GA 7ICNA 5J2AA 2NRVA 5TZVA 7ICVA 4ZH4A 3ZDBA 4F4ZA 4M6WB 1ZQKA 4Q8FA 4NM2A 7ICUA 1ZQTA 4WC3A 3PX6A 5HMLA 3KHRA 4IG8A 1NK4A 4KLUA 1JMSA 4QWDA 1ZQCA 3NYBA 3JPTA 3SI8A 3PO5A 3Q8RB 1A77A 3Q8QB 4DFPA 3PW4A 2C22A 5HRKA 1KFTA 4NKUA 4TQSA 1OU5A 3AQLA 1Q79A 5KG2A 3TANA 7ICSA 4KN4A 2ZTEA 4WBZA 3HW8A 1D8YA 4EBJA 5KG6A 5EOZA 2RDJA 4KLIA 4PHAA 3RH5A 2BCRA 2F1JA 4O5EA 1IM4A 1DGSA 2P66A 9ICFA 1NJZA 3RB3A 7ICFA 4IRCA 4UB4A 5KG5A 4ED2A 1NOMA 3H3AA 4DEZA 4YP3A 4QZ8A 3RBDA 4RQ8A 4ED0A 3MR5A 9ICVA 9ICHA 1U49A 1L3SA 5J0QA 4XUSA 2PFNA 5KT5A 2KFNA 8ICUA 3MDCA 4WCWA 3OUYA 1RPLA 5DG8A 4TUSA 4UB3A 4ED6A 1XSPA 1ZQSA 1AROP 1BPEA 4GXJA 2KZMA 1RYRA 1UEUA 4GC7A 2DPJA 4F5OA 1CUKA 4J9QA 4DL3A 2HW3A 5KFIA 3BQ0A 4FS1A 5L1LA 4UB2A 4QWBA 5J2FA 4I29A 3V7JA 1XO1A 2F1HA 3UXPA 5KFVA 4EBDA 1U47A 2IMWP 4B9LA 8ICPA 4ATBA 3N97B 4DFJA 4RWOA 5J2IA 3Q8KA 4DQIA 4F2RA 5KT7A 7ICQA 3AQNA 4B9MA 1ZQRA 2AGOA 2GWSA 3TAQA 1QLNA 2XCPA 7ICTA 2P6UA 1PZNA 4YVZA 3Q8LA 3C5GA 1BGXT 1X2IA 2AJQA 3BQTA 2HHTA 7ICJA 3HPOA 5DDYA 3C2LA 4EEYA 3PW0A 1UA1A 1KFDA 2W8KA 4UB1A 4C8OA 1NO5A 4QZBA 2JEJA 2MUTB 2FPKA 4DL2A 5J0RA 4K4GA 4PGYA 2KP7A 4YFKA 1L3VA 2FLLA 4JV2A 4YCXA 8ICWA 1MIVA 3AQMA 4X4PA 3V7LA 2PI4A 3EPGA 1SL1A 4J9PA 4ED1A 5KFTA 4KITB 9ICRA 4PGQA 3HT3A 4G3IA 1R8AA 4M9HA 5KFQA 5KT2A 5DDMA 4X4QA 4NY8A 1MC8A 4BDPA 3QE9Y 4F3OA 2JZBB 4WBYA 3C18A 2ZH4A 1BPDA 3JPNA 4KLJA 2C28A 2ZH7A 2LYHA 1TFYA 2ID1A 7ICLA 2UVUA 9ICCA 4X4RA 1HUOA 7ICGA 4EZ9A 4X4NA 2HHWA 1BNPA 4I28A 9ICOA 4YR3A 4Z6EA 2BCSA 2R8GA 5HHIA 2M2WA 3UXOA 4UQGA 9ICTA 4HYKA 4I2EA 2NRXA 3ZDCA
chains in the Genus database with same CATH superfamily
3H8SA 5L1MA 3LYSA 4FHWA 5KFHA 4YMOA 1UT5A 1V97A 1Z4NA 4Y2VA 5KFZA 4J9LA 1NKCA 3GIJA 2AU0A 1PVQA 1SV0C 3C1ZA 3GFKB 4FH3A 1NK8A 4BXOA 7ICMA 2NO4A 3M9NB 5JTGA 3RJJA 4FZLA 2IA6A 3NTUA 5DB7A 2FMQA 4NXUA 3C21A 4N7RA 1XU4A 1AQ6A 5G5GA 3QZ8A 1ZD4A 2HOQA 3OJUA 3PSTA 2N1RA 1Q3VA 3JPOA 1LB2B 1ZQGA 4C8NA 2ZIUA 1RDFA 2DR8A 5KG3A 4I27A 1V9PA 2EAMA 1GO3F 8ICBA 1KKXA 1Z19A 4I2BA 3I28A 9ICSA 2IOFK 2W03A 2AQ0A 1PVRA 2E1FA 2DL0A 5J0YA 2KKPA 8ICTA 3EZ5A 5HREA 2BQUA 2JH7A 1L5UA 4F50A 1N2XA 3F53A 2JEFA 4DSJA 8ICGA 4OAFA 5AK4A 3UMBA 2BCUA 2IUBA 4PZNA 1QQ7A 4NXZA 1TKDA 3PO4A 2J6TA 2RFFA 4QZFA 8ICNA 5AK6A 4KLMA 1RYSA 5JUMA 3GV7B 1S9FA 4NLBA 2YMQA 2UVWA 4FHVA 4RQMA 4OJ5A 1NK5A 4Q45A 5H2FU 2W9AA 1X9SA 1TVAA 4Y2JA 3AU6A 5BOLA 4AT7B 4US8A 4BXOB 3AQEA 5ALRA 4LZDA 2KIWA 8ICAA 2ZUDA 2FMPA 1ZD3A 2O5AA 2HDOA 2EAPA 2R8KA 5HRIA 1L3TA 3H40A 2KEYA 4C0ZA 4KB6A 1B4FA 3ZD8A 5ALOA 3FYHA 2OCEA 2OYYA 4J9KA 4NL9A 2R8JA 3PSPA 2PKEA 4QIWF 3VC8A 4RPYA 4CCHA 4KMOB 5B3PA 1B43A 2W7PA 1WWUA 1ZQOA 2IBKA 3OVAA 2E1EA 1TAMA 2CXYA 2BZFA 3QNMA 1FO4A 5ALVA 2DR7A 4C7ZA 5AM3A 4NM1A 5HC9A 4XQ7A 8ICHA 2HN2A 2LPEA 3GIMA 3PHZA 1L8OA 2OEHA 3U26A 2EZXA 3T79A 5AIBA 1IV8A 4EZ6A 4LVSA 4EBEA 5KFJA 1JXEA 2VA2A 1JAJA 5AKXA 5KTQA 1SXDA 2B21A 5DBBA 4J03A 2W43A 2ZJAA 5J2KA 2G06A 1TFRA 3JPRA 2HHPA 4RQ1A 5J0PA 3M8SA 4XRHA 4AT8B 5ALUA 1P7DA 4FHPA 3OV7A 4Y2YA 1L7OA 5KFOA 2KVCA 9ICIA 2K8AA 3EWAA 4RUCA 2HHUA 3PSFA 7ICRA 3V6KA 2ZH6A 4TQRA 2I1QA 5KFLA 4WJ3B 5DBAA 3WFSC 5HMMA 2GO7A 4XA5A 4X4VA 2KSOB 2AXTU 2CRXA 4NXVA 4QNLA 1MQ3A 5D49A 2W9MA 4ED3A 1D8BA 4MEYA 3Q8SB 4A8EA 4DOBA 2BBJA 2KZ3A 1RZTA 4C4TA 2ZIUB 3C23A 3MGIA 8ICFA 4J9OA 2BKEA 2ZIWA 3HRDD 1WG8A 1ZQVA 2DBYA 4J9MA 9ICGA 1SZPA 2JEGA 3KOOA 2J6SA 3UPQA 4DQSA 2ZXIA 4NLZA 1N63A 3SAFA 5HR6A 4PZOA 8ICKA 3H7IA 4R8UA 1KSPA 3BQ1A 4AT9A 3HKZF 5ALEA 1NJYA 3PV8A 3GDXA 2FJ6A 2BCVA 3ISCA 4DS5A 4RPZA 2BPGA 2VA8A 5KT3A 4R64A 3T5LA 1ZQUA 5J2HA 2M2UA 4K97A 2K4HA 1TFWA 1L7NA 3RRHA 4IQVA 1YZ7A 5AKJA 3G6VA 1S77D 4DLGA 1BPBA 3L9DA 1BVSA 4C8MA 3THVA 3LQCB 1OXJA 3PW5A 4OAIZ 3OVBA 5KFMA 4YG2A 1ZQDA 4UW9A 9ICLA 4DSIA 3AEVA 4M9NA 1L6NA 3WFQE 1J2MA 2Y1IA 1QSYA 4I2HA 1WCNA 1WOTA 5J2BA 4Z6FA 2WF9A 3RR7A 3T5JA 4TUQA 1TK5A 3AM9A 5KFPA 5IIMA 1COOA 5IIOA 1SV0A 5DLFA 4Y2XA 2NO5A 1D9FA 2ATLA 5KFXA 4I2IA 4K99A 4JK1A 3RB0A 2D3DA 3V72A 1T3NA 5ALLA 3SR6A 5CP2A 3JZ0A 3WK5A 7ICKA 2KG5A 2DPIA 4C4RA 5J2CA 1MIYA 1KEJA 2ASJA 4KLLA 3JPPA 5ALIA 1FA0A 2WTFA 2QB1A 3L3FX 3PX0A 4DQPA 4LEWA 3KD3A 1N61A 5CR0A 2HVHA 2G5IB 8ICQA 3QUBA 4Y2SA 1JN3A 4RWQA 5DQGA 2E8PA 5ALJA 4XQ8A 1ZRMA 1FEZA 2MRLA 4EEBA 2YMPA 4M6WB 3CK6A 4EV6A 1ZQTA 4LEYA 4WC3A 5AI5A 1MA7A 1UQVA 1ZQCA 4UARA 3SI8A 3PO5A 3Q8RB 2F77X 2WAQF 5ALTA 2F8KA 4TQSA 2HOIA 1OU5A 1WUDA 5EOZA 2A19A 3RH5A 4KLIA 1DGSA 2P66A 5KG5A 2WAQC 4RQ8A 4ED0A 9ICHA 1U49A 4G9BA 2PFNA 5KT5A 3OUYA 1T94A 5DG8A 1XSPA 1RYRA 1UEUA 1XO0A 2W04A 1SB3C 4F5OA 4DL3A 3NYBA 1KFTA 5AM0A 3V7JA 1XO1A 2F1HA 5KFVA 2IMWP 4B9LA 3UMCA 2E8NA 4OD0A 3Q8KA 1JUDA 5CFSA 2PMZC 5EE1A 3NWIA 2HBJA 5E79U 4OCZA 2GH1A 2HHTA 1UA1A 1UHUA 1NO5A 2GOLA 5ALDA 4QZBA 5KL8B 4DL2A 5J0RA 2E3TA 2KP7A 4YFKA 4JV2A 3IG8A 2KJ8A 4BUGA 5A0LA 4J9PA 4GFJA 1TE2A 5KT2A 5DDMA 4X4QA 4NY8A 4F3OA 2VJ5A 3QUQA 2YQEA 2ZH7A 4PL1A 4X4NA 4C80A 5KAIU 2YMLA 4YR3A 2KE7A 3BS7A 4UQGA 4I2EA 1X66A 4DF8A 2A1JB 3TI0A 3ETLA 1XSLA 2QB0B 1SL2A 4RWNA 5JRTA 5AI8A 3F2DA 3HX0A 2RDIA 3C2KA 5EWFA 5AM4A 4UB5A 4UAZA 4EGWA 1KBUA 4RQ7A 1NNLA 3WK8A 1ZQNA 1N5WA 1ZJNA 2FI1A 2JZBA 1Z00B 4OJLA 1RYUA 1ZJMA 1U45A 2BCQA 4RUAA 2W3RA 3ZDDA 3CRXA 3Q8PB 2LI6A 3JYYA 4FHXA 3PW7A 4QW8A 1S10A 4B9VA 5EWEA 2V4RA 1PK1A 1F5AA 1UEVA 1B22A 1KL9A 1BPXA 5ALWA 5ALXA 3NVWA 5DG9A 3RH4A 3WFPA 4F8RA 3R9KA 4NL9C 2ZH1A 1XSNA 1NK0A 2YMMA 4LEZA 5HP4A 2C2DA 2FE9A 4EBCA 3RR8A 2ZHAA 1PUZA 2I6XA 4O3QA 3GV8B 5HNKA 2IHNA 1FFUA 3NVOA 9ICEA 5AK3A 4O68A 8ICZA 4F92B 1IIPA 1SKRA 2DGZA 5ALMA 3EYZA 1F5SA 4BGDA 2QB0A 4R65A 4RPXA 3SZ2A 1ZQPA 4P2HA 2NRTA 1FFVA 4J9SA 2MAXA 4ECZA 5C5JA 2PBEA 4ECTA 4F5PA 4UAVA 7ICIA 3M7DA 3ALRA 4RQ0A 4RQ3A 4RT2A 5IIJA 4X0AA 4C4SA 4K9AA 2BDPA 3WK6A 4K9BA 3KZXA 4EENA 3KKAC 1ZQAA 1ZQHA 1FIQA 3RB4A 2AQ4A 4X4UA 1S0MA 5DQIA 2ZJ8A 2IOFA 1DK3A 4S3NA 3MABA 1S0OA 4Q8EA 5DKWA 4EEDA 2AGQA 4O3PA 3S6JA 4ATBB 3ZD9A 1JALA 4KLGA 2KOBA 8ICLA 1V4AA 4F91B 3H8JA 3C5FA 3OWGA 3NGDA 2VA3A 5F2VO 4GXIA 1J97A 2WHEA 4ICAA 2XC9A 4YMNA 3QXGA 4P0PA 2H3VA 3TAPA 4ECQA 4MF2A 2CPRA 3RF9A 2HBKA 3LVWA 3M6KA 4KX3A 1BPYA 2F8LA 3F2CA 3SAHA 2Y9UA 5CWRA 5AKGA 2ASLA 4QZGA 3WFOA 2H3ZA 3QU4A 2V9WA 3UQ0A 4DSLA 5DGBA 4LEVA 3F2BA 2F1IA 2FLNA 4JLXA 5DQHA 3RRGA 3C2MA 2UVRA 3IDWA 2DFLA 4AYBF 2OHFA 5BOMA 3HJ1A 3RAQA 1D8LA 4K4IA 7ICOA 8ICJA 3C66A 3NS1A 1IXRA 3RAXA 1XNSA 4PHEA 4YD1A 4TUPA 1SV4A 4M0AA 4R66A 3V7KA 5DBCA 3HJEA 2ALZA 5KFNA 4ECUA 1NK9A 2YN4A 2W9CA 1B0XA 1X6JA 2RRDA 5KFCA 4KX5A 1TK8A 1KTQA 3IN5A 2PFPA 5L1KA 1U4BA 1NJWA 1T3QA 3PY8A 3KFUF 2BQ3A 4KLHA 4U7CA 3EPIA 2QARB 2HHXA 3K7DA 3QU2A 3BDPA 4GLXA 2JR5A 2NRKA 5CA7A 4MFFA 2KD1A 4KN7A 2EANA 1F0MA 4JB3A 2DUYA 4DQRA 1X42A 3BQ7A 2R8HA 1ZQJA 3CP8A 4M9LA 5ALKA 3V6HA 2YTUA 3H8MA 2FMSA 4ECWA 1PX5A 4O3NA 4KTQA 4DFKA 1ZQYA 8ICOA 3OVSA 5D46A 4E0DA 1NZPA 3QYPA 3UMGA 4EYHB 2HHVA 4UBBA 2XY6A 1H38A 4AP9A 4QZEA 1TAQA 5DLGA 5AKKA 8ICSA 1JQRA 2C2EA 5J0WA 3QU9A 2HN1A 4I2FA 5KNIA 4I2GA 3MGVA 4NWIA 2P35A 1ZQBA 1VJ7A 3N7RC 4ELVA 1TV9A 3LDAA 3J81j 3HILA 5KFSA 4MFCA 4NKTA 9ICWA 3A0HU 4WC0A 5CHEA 2K8CB 4YXMA 5DB6A 1PK1B 1Q46A 1NJXA 3IM1A 1DGJA 2GAFD 5HR9A 3HP6A 2O1PA 1F44A 4RQ5A 4OJ6A 4DWIA 3RBEA 2JV3A 4BX9C 4DO9A 4B9NA 3MFHA 4Y2PA 4QZ9A 2G08A 2W54A 1D9DA 4I0UA 4X4TA 4JMUA 4QZAA 3D2QA 5KFEA 3K75D 4TURA 4MEXA 5HHHA 1NI3A 2XGQA 5HRGA 3H4BA 3LK9A 2MU2A 1BNOA 5HRBA 2W11A 4NJ8A 1A0PA 5ALSA 7ICNA 3ZDAA 1T4GA 4CF5A 4ZH4A 3ZDBA 3O0FA 4F4ZA 5EE3A 7ICUA 1CI4A 3PX6A 4IG8A 5G5HA 4UB6U 3JPTA 1A77A 5AKHA 4DFPA 5HRKA 2C22A 2GLEA 4NKUA 5KG2A 3TANA 4KN4A 2ZTEA 4EBJA 1D8YA 5ALQA 2BCRA 4O5EA 1IM4A 4P0QA 4IRCA 3H3AA 4DEZA 4QZ8A 3MR5A 1L3SA 5ALGA 5AKYA 1RPLA 5TISU 4OAGA 2VIXA 2JGAA 2D8CA 5CFUA 4J9QA 2Y0SC 3BQ0A 4E80A 5L1LA 4UB2A 4QWBA 3NRZA 5J2FA 3UXPA 4EBDA 4ATBA 4DFJA 5F3XB 5AICA 4DQIA 4F2RA 3IRUA 7ICQA 3AQNA 1WYGA 4B9MA 1QLNA 7ICTA 3C5GA 1X2IA 2M0NA 2EH9A 7ICJA 3PW0A 4UB1A 2GA9D 2ZG6A 4PGYA 8ICWA 3H0LB 4YCXA 4P0PB 3V7LA 4PGQA 5KFQA 1MC8A 3AQFA 4EEKA 4K98A 3C18A 2ZH4A 2LYHA 1TFYA 2ID1A 3WK7A 7ICGA 2FCLA 3CW2C 2KSOA 2WF5A 2EAOA 2R8GA 2M2WA 1Z4OA 1V38A 9ICTA 2DKXA 3ZDCA 5L1JA 3B9JA 2UVVA 4QWEA 2G07A 3PSIA 2I5HA 3KKAA 3MBYA 1WWVA 5CEHA 1L8LA 2L5YA 2BGWA 2XGPA 3BQ2A 3GQCA 3C29A 4JLZA 3QEBZ 3UM9A 4GXKA 8ICMA 2Y1JA 3MGHA 5DB9A 1XWLA 4ECSA 3T5KA 4ELUA 5EWGA 1DK2A 4KMUA 1L7MA 2FPLA 1JI7A 1CRXA 3KHLA 4Z6CA 3EF2A 1BPZA 4JUZA 2LM1A 4NLKA 1OW5A 3ISDA 2Q0ZX 4X4OA 1RXWA 1KRPA 2DRBA 3FDSA 3BZCA 4B9UA 3OTQA 1ZQFA 5CRXA 8ICRA 9ICXA 4WOYA 2F76X 3TFSA 4QW9A 5JTIA 4I2JA 4U6PA 1O03A 1L7PA 1T8EA 3B0XA 1S8OA 9ICAA 5AM1A 3M9MB 5L1IA 2XY5A 1C7YA 2Z7JA 1QSSA 1QH9A 2H5XA 4BJQA 2ISPA 1NZBA 5EE9A 5ALFA 3NVVA 3TARA 3PZPA 3T5HA 1MN8A 1TK0A 1Y88A 5HRHA 2LYAA 2VKQA 4NXWA 2LM4A 3ER8C 4MHVA 5B3QA 4UD4A 4F4KA 4CGZA 4O5KA 3RJIA 5J0UA 4PHPA 5J8YA 2DQNB 2ZH5A 4AYBC 5KFAA 4X4PA 1Z3EB 2IHMA 3PW2A 9ICMA 1DRGA 3ONNA 1R8BA 5J2GA 1ZQQA 1VJ5A 3FM9A 5AI6A 2HHSA 3GU3A 1UETA 3ZDEA 3N7PD 2ZTCA 4P0QB 4IRKA 1N62A 5J0XA 2W3SA 1KQQA 9ICNA 2ZIWB 1T7PA 3E2EA 4WC6A 3HWTA 5KL1B 5AKEA 4O3SA 4FO1A 3FC4A 8ICCA 1HJPA 4IQUA 1HIWA 4MKPA 3HJ4A 2K60A 1ZOLA 4AT9B 1DOQA 2J6UA 4I2CA 3K1RB 3WFRE 3H0RB 2EQYA 2EDUA 4DOAA 1RXVA 4Q44A 4DF4A 3GIKA 5IIIA 4PGXA 3AMZA 4WC2A 4M9JA 3EW9A 4JV1A 2F3NA 3WKAA 4UAYA 3M9OB 3QEAZ 1R89A 2I9GA 2XICA 1K5OA 2KHQA 2BQRA 2LMRA 1M6YA 4DSFA 3OJSA 2ZIVA 5J2EA 1ZYQA 3KZIU 1X9WA 4K8VA 4FZMA 1VDVA 2MA1A 2M2TA 4M04A 1ZD2P 3NUQA 1WCLA 3MFIA 3OSPA 1S5LU 3N7SC 1ZQ1C 5L9XA 4YN4A 3T3FA 3LVVA 2OXOA 4F5QA 4RQ4A 2PMZF 4KLEA 2QKQA 3L5KA 1SGGA 2DRAA 1KW4A 1HUZA 1S0VA 4QIWC 1JX4A 1Q3UA 5DG7A 3SV3A 2HCFA 2IOHA 5HR7A 1SIJA 2ISOA 2DR9A 3IV6A 1UPHA 3C1YA 5KFKA 4J9NA 3RJGA 2H3FA 2ZJ5A 3OSNA 4GIBA 5IIKA 4NLNA 1EXNA 1COKA 9ICJA 4IC9A 4PPXA 2MUTA 4E7XA 3D6JA 1A76A 4M2YA 3ORYA 3AU2A 5B66U 4P4MA 4Q43A 4JV0A 1RG6A 2H3IA 3WU2U 4X4SA 1JRPA 4GC6A 4YR2A 4AT8A 5ALYA 3RB6A 3IHQB 3SEIA 5J0SA 1DXSA 2XVTA 7ICPA 1URJA 4M9GA 5KG0A 1S97A 1SKWA 4FZNA 1QQ6A 5CB1A 4F93B 4FHYA 4UAWA 4ECRA 3H39A 4DLEA 4JWMA 4YMMA 5IINA 4M47A 3RH6A 1S76D 1U9LA 3OHAA 1JROA 1X9MA 2B56A 3OUYB 3WK4A 2RP5A 1NKBA 4YD2A 4LT6A 3RJKA 2ZXHA 3TKAA 2M9NA 1ZQMA 4BWJA 2EZZA 3QZ7A 3SV4A 4ACOA 2IHOA 2PI5A 4C7YA 5KT4A 3JPSA 2KVSA 8ICVA 4F4XA 2D6FC 3RJHA 1UA0A 4DOCA 2F2AB 2NYVA 3BJYA 2XI9A 2M2VA 4O6AA 2YB1A 4ED7A 4DL6A 1SKSA 4RQ2A 4M6WA 4R8UB 4RQNA 4M5DA 4KM5A 1J2NA 5DECA 4F4YA 4WH5A 4ED8A 2H3QA 3G6YA 4UD5A 1VFGA 2WF6A 1X9XA 1YT3A 2ZUCA 4KLFA 2HI0A 2BHNA 4WQKA 4Z6DA 3E58A 4KLOA 1ECWA 3PNCA 3H37A 2BDUA 3HKZC 4RT3A 4RU9A 4IR1A 1QTMA 4DQQA 2KKVA 4Y2TA 5C0YA 4FE3A 3PMNA 2R18A 4QWCA 4O9MA 2MSNA 2YX8A 4B9TA 3QU7A 1SL0A 5CJ7A 3MCRA 2NRVA 4OO1J 7ICVA 3WKDA 1X6IA 3IG5A 4Q8FA 4NM2A 5HMLA 1RM6C 3QX7A 4QWDA 3Q8QB 3PW4A 2B0CA 2Y9TA 7ICSA 3HW8A 2RDJA 4PHAA 2QLTA 2F1JA 2NV3A 5AI0A 3RB3A 4ED2A 1NOMA 1ED1A 3RFAA 4XUSA 5J0QA 2KFNA 8ICUA 3MDCA 4WCWA 4TUSA 5CFTA 1ZQSA 4GXJA 2DPJA 1CUKA 2JHDA 5KFIA 8ICPA 1U47A 3N97B 4OAHA 5J2IA 4RWOA 1A6SA 5KT7A 4USAA 2XCPA 3Q8LA 5AKIA 1KFDA 2JEJA 2MUTB 3NASA 1MIVA 1OUQA 2PI4A 3SMVA 9ICRA 4ED1A 5KFTA 4G3IA 1R8AA 1C20A 4BDPA 3QE9Y 2JZBB 2W55A 1BPDA 2C28A 2K89A 1N60A 4F71A 2UVUA 9ICCA 4X4RA 1HUOA 3CYMA 4EZ9A 1BNPA 3WKCA 9ICOA 4Z6EA 3NKUA 2BCSA 5HHIA 3UXOA 2NRXA 1N56A 4F4WA 3H38A 4KLSA 5T14A 4NXTA 4KLTA 2XO7A 2K4EA 5AKZA 4PJ0U 3SENA 4I2AA 2ZH8A 3M6ZA 3SQIA 2BPFA 3FAHA 4PH5A 3GV5B 1NK7A 3ER9B 3AN1A 4WC5A 3NVYA 4RNMA 5IILA 4QZIA 2ESEA 4K4HA 5KFUA 3PX4A 2KICA 7ICEA 5KFDA 3GILA 1Q8KA 5KFFA 2OM6A 5AHXA 3SAGA 8ICEA 1Z1VA 4EX7A 2AHOB 3KHHA 4NV0A 3ETRA 4EX6A 3RTVA 2HBMA 2KTQA 4F2SA 2ZUBA 1JIHA 1ZQZA 3ISBA 2NRZA 4RZRA 4X5VA 5D63A 2WFAA 3F5AA 2BBHA 3AQKA 9ICQA 2NRWA 4WC4A 4UBCA 2ZHBA 1ZETA 1MIWA 4O69A 1RQLA 3DDHA 1UT8A 4XJEA 3WK9A 5KFGA 2A1JA 1ZQEA 1QSLA 3PMLA 2ZH2A 4HAIA 4DL4A 2V4QA 2ASDA 1SZHA 4J9RA 3DV9A 4C8KA 4Y2UA 4ECYA 5KG4A 1KFSA 1ZQXA 1YZ6A 3RJFA 1KNYA 2Q4TA 5KFYA 2B4VA 1XC9A 2ZH3A 5KFBA 2YY6A 4CRXA 3I1YA 2K8BB 2G0AA 3UQ2A 1JXLA 1N5XA 2FDRA 3HIYA 4QZDA 2CN1A 1ZQIA 4QZHA 2BE3A 4OJOA 2BR0A 5F9NA 3PVXA 2R8IA 4RQ6A 4DFMA 5KT6A 2KJ5A 4O0IA 4RWPA 1QQ5A 2K4PA 4DSEA 2AGPA 4DL5A 5F9LA 3TACB 2HHQA 2VANA 4C8LA 4FBTA 1LVHA 4MF8A 4YQWA 4DCCA 2Q66A 4X0BA 4RNOA 3H4DA 4FH5A 8ICIA 4QZCA 1MSWD 1KDHA 4CF4A 2ZIXA 5HRFA 2HOFA 3LWLA 4LZGA 4KLQA 2Y0SF 3A0BU 3BZKA 1YLQA 2W7OA 2B6GA 2B51A 4RNNA 3NVZA 5KG1A 2RQ5A 5AM5A 1LV5A 3QU5A 4OJPA 5CHGA 4UB8U 4F5NA 3PR4A 2PFQA 5J29A 4FBUA 4PHDA 2KV2A 5ALPA 1SWVA 4CF3A 3AUOA 3IP4B 4BWMA 5AI9A 3ERCC 3TADA 4F5RA 4US9A 1NKEA 4WC1A 3JPQA 5J0OA 3ICXA 4IL6U 4QJFB 1N48A 1K1SA 3KBBA 5GTIU 3GZFA 2DVIA 2K4IA 2PFOA 2EZYA 1K1QA 1IG6A 5DEDA 4O5CA 2JH1A 5DB8A 4UAUA 2DR5A 3MR3A 3JCFA 1V85A 5HRDA 4ECXA 3GIIA 5DGAA 2A3VA 2YB4A 2DKZA 4EYIB 3CNHA 3UPSA 1O08A 1R8CA 2BPCA 4WC7A 3UXNA 2G09A 4IQTA 5KAFU 2QARA 2ZH9A 4F72A 5FP0A 2C2RA 9ICKA 1LKYB 3MR2A 2E5SA 4P4PA 2AH5A 2LHTA 4B6JA 3N4MB 4IQWA 2O6KA 8ICYA 2RHFA 3E0FA 1U48A 4FS2A 2XIDA 3SYZA 3B0YA 1ZQLA 3SD7A 2ZIVB 5KFRA 3H0MB 1XS9D 1KLNA 1LKYA 1L3UA 5ALHA 3C28A 4YR0A 3RJEA 4HX0A 2P6RA 2ES6A 4I2DA 4CE6A 5D61A 1S0NA 4O3OA 5EE0A 4QWAA 2KZZA 3V6JA 2JEIA 5HRLA 2KK0A 2DF4B 3TQ1A 4P4OA 4NLGA 2G5HB 1SXEA 4DSKA 3Q8MA 3PR5B 5D62A 5KG7A 5KFWA 3KHGA 2PXIA 4MFAA 2XCAA 1GPJA 8ICXA 2ODGA 3EUB2 4YXJA 4IR9A 4EBKA 1VLBA 1Z00A 4IRDA 4ELTA 7ICHA 9ICBA 2KHVA 1HEKA 1KN5A 4JWNA 1ZRNA 2WF7A 3H8WA 4R63A 2FPMA 2FLPA 3MC1A 4PL2A 2XY7A 2WB1F 4O3MA 4IS7A 5ALNA 4ZOHC 4DS4A 1MQ2A 2HBLA 2ZTDA 2W9CB 3MDAA 4E8FA 2WF8A 4O67A 4NLCA 3VCBA 4CNQA 3ZI4A 3MR6A 3QUCA 1RQNA 9ICUA 1UCVA 3K4GA 4AT7A 1CEZA 9ICPA 2KMDA 3N28A 3WKEA 5AKLA 4NXXA 3KTQA 3I76A 4FFDA 2F44A 3OGUA 2ZIXB 4WQLA 4KLDA 3OHBA 2W9BB 4CDGA 2KFZA 3M8RA 4B9SA 4Y2RA 1PK3A 2KN7A 4ECVA 5BPCA 3TFRA 2RLTA 3M1YA 4EP7A 1TAUA 2W8LA 3LWMA 4DL7A 3NRWA 2JMGA 1ZQWA 3WKBA 1ZD5A 2JRZA 2W9BA 3BS5A 5J2DA 3G6XA 3ED5A 3D2NA 5K4LA 1QCKA 2OWOA 1NK6A 4O3RA 1X40A 5J0TA 4FO6A 5D4BA 2HVIA 5J2JA 4K96A 5J2AA 2WB1C 5TZVA 3BS5B 1ZQKA 2E8OA 5AM2A 3KHRA 1NK4A 4KLUA 1JMSA 2EWRA 3AQLA 1Q79A 1ZXIA 4WBZA 3DEEA 5KG6A 2KJ9A 9ICFA 1NJZA 7ICFA 4UB4A 2LYBA 4YP3A 3RBDA 9ICVA 3QUTA 4ED6A 2KZMA 4UB3A 1AROP 1BPEA 2HSZA 1PVPA 2KNJA 2LBOA 4GC7A 2HW3A 3K1ZA 4FS1A 4I29A 1Q78A 5B5EU 3OPXA 4UASA 2HMXA 3L4PA 1SWWA 2KIVA 2VJ4A 2A1AA 1ZQRA 2AGOA 4UATA 2GWSA 3TAQA 2P6UA 1PZNA 4YVZA 1BGXT 2AJQA 3BQTA 3AL0B 3HPOA 5DDYA 3C2LA 4EEYA 2W8KA 4EELA 4C8OA 2FPKA 5GTHU 1Z1BA 4K4GA 5AK5A 4DFDA 1L3VA 2FLLA 2JXJA 3D2SA 3AQMA 3F5EA 5JU5A 3EPGA 1SL1A 2DWQA 4KITB 3HT3A 4M9HA 2E8MA 4WBYA 4LJXA 2OH2A 3JPNA 4KLJA 5AIAA 5J8YC 7ICLA 5ALZA 2HHWA 5AI4A 4I28A 4Y2QA 4HYKA 3TADC 2LKYA
chains in the Genus database with same CATH topology
1N56A 3H8SA 4F4WA 3H38A 5L1JA 4KLSA 4DF8A 2A1JB 2UVVA 3TI0A 3ETLA 4QWEA 1XSLA 4KLTA 4FHWA 2XO7A 5KFHA 4YMOA 1UT5A 4I2AA 2ZH8A 1SL2A 4AT8A 4RWNA 3MBYA 2BPFA 5KFZA 4J9LA 3HX0A 2RDIA 1NKCA 2BGWA 4PH5A 2XGPA 3GIJA 3GV5B 2AU0A 1NK7A 3C2KA 3BQ2A 3C1ZA 3GFKB 4FH3A 5EWFA 1NK8A 4BXOA 4WC5A 7ICMA 3GQCA 4RNMA 4UB5A 4UAZA 5IILA 4QZIA 3M9NB 3RJJA 2IA6A 3NTUA 4K4HA 5KFUA 3PX4A 4RQ7A 3QEBZ 4GXKA 5DB7A 8ICMA 2Y1JA 3MGHA 1ZQNA 5DB9A 5KFDA 7ICEA 3GILA 2FMQA 5KFFA 1ZJNA 1XWLA 4ECSA 3T5KA 2JZBA 3C21A 5EWGA 4KMUA 1Z00B 4ELUA 1XU4A 8ICEA 1DK2A 3KHHA 2FPLA 1ZJMA 1U45A 4RUAA 2BCQA 3QZ8A 3OJUA 3RTVA 3ZDDA 2KTQA 4F2SA 2ZUBA 4E80A 1JIHA 3JPOA 1LB2B 1ZQZA 3KHLA 4Z6CA 3ISBA 2NRZA 4RZRA 4JUZA 4X5VA 1BPZA 3Q8PB 1ZQGA 4C8NA 3JYYA 4NLKA 3ISDA 3AQKA 2DR8A 4FHXA 5KG3A 9ICQA 2NRWA 2Q0ZX 4I27A 4UBCA 1V9PA 8ICBA 4WC4A 1ZETA 1MIWA 4X4OA 2ZHBA 3PW7A 1RXWA 1KRPA 2DRBA 1UT8A 3FDSA 4I2BA 5KFGA 2A1JA 1ZQEA 1QSLA 9ICSA 3PMLA 4B9UA 1ZQFA 2ZH2A 8ICRA 4QW8A 1S10A 9ICXA 2AQ0A 3TFSA 5J0YA 4DL4A 5EWEA 4B9VA 2V4RA 4QW9A 2V4QA 2ASDA 4I2JA 1B22A 1F5AA 1BPXA 1UEVA 8ICTA 3EZ5A 5DG9A 3RH4A 5HREA 3WFPA 4F8RA 1T8EA 4J9RA 3B0XA 2BQUA 9ICAA 2ZH1A 1L5UA 1XSNA 1NK0A 4C8KA 3M9MB 4F50A 5KG4A 5L1IA 4ECYA 5HP4A 1KFSA 2XY5A 2C2DA 1ZQXA 1C7YA 1QSSA 2JEFA 4DSJA 2H5XA 4EBCA 8ICGA 3RJFA 1KNYA 3RR8A 2ZHAA 2ISPA 4O3QA 3GV8B 5HNKA 2IHNA 5KFYA 3TARA 2BCUA 1XC9A 9ICEA 2ZH3A 1TKDA 4NXZA 3T5HA 1TK0A 5KFBA 1Y88A 3PO4A 2J6TA 8ICZA 5HRHA 4F92B 1SKRA 2RFFA 3EYZA 4QZFA 8ICNA 4KLMA 3UQ2A 1JXLA 1RYSA 3HIYA 5JUMA 4QZDA 3GV7B 1S9FA 4BGDA 4F4KA 4UD4A 1ZQIA 4R65A 4QZHA 2UVWA 4FHVA 4RPXA 2BE3A 4O5KA 3SZ2A 3RJIA 2BR0A 1NK5A 5F9NA 5J0UA 4PHPA 4Q45A 2NRTA 4RQ6A 2R8IA 4J9SA 4DFMA 3PVXA 2ZH5A 5KT6A 5KFAA 2MAXA 4O0IA 2W9AA 4ECZA 1Z3EB 1TVAA 1X9SA 4RWPA 4DSEA 3AU6A 2IHMA 5BOLA 5C5JA 3PW2A 2AGPA 9ICMA 2PBEA 4ECTA 4DL5A 1R8BA 5F9LA 4AT7B 4P2HA 5J2GA 4BXOB 1ZQQA 4F5PA 2HHQA 7ICIA 4LZDA 8ICAA 2VANA 2ZUDA 2FMPA 2O5AA 2HHSA 4RQ0A 4C8LA 4FBTA 4RQ3A 4RT2A 3ZDEA 1UETA 4MF8A 2R8KA 4YQWA 2ZTCA 2Q66A 4X0BA 5IIJA 4RNOA 4IRKA 3H4DA 1L3TA 8ICIA 5HRIA 4QZCA 4FH5A 4X0AA 1MSWD 3H40A 1KDHA 5J0XA 2BDPA 9ICNA 5HRFA 1T7PA 3E2EA 4WC6A 1ZQAA 3HWTA 1ZQHA 3LWLA 4LZGA 3ZD8A 3RB4A 2AQ4A 4KLQA 3FYHA 4X4UA 4O3SA 1Q78A 8ICCA 1HJPA 4IQUA 5DQIA 1S0MA 4J9KA 1YLQA 3HJ4A 2ZJ8A 1DK3A 4RNNA 4S3NA 3MABA 5KG1A 1LV5A 2R8JA 5CHGA 1S0OA 4Q8EA 4AT9B 1DOQA 4RPYA 5DKWA 4F5NA 2J6UA 4CCHA 4I2CA 1B43A 3PR4A 1ZQOA 2IBKA 3WFRE 3OVAA 2AGQA 2PFQA 4O3PA 5J29A 4DOAA 3ZD9A 4Q44A 1RXVA 4DF4A 4FBUA 4PHDA 3GIKA 4ATBB 5IIIA 4PGXA 4WC2A 4KLGA 4M9JA 3EW9A 4JV1A 8ICLA 3AUOA 1V4AA 4F91B 4UAYA 2DR7A 4BWMA 4NM1A 3H8JA 3C5FA 5HC9A 3NGDA 2VA3A 4XQ7A 4GXIA 8ICHA 4F5RA 5F2VO 1NKEA 3GIMA 3JPQA 5J0OA 4WC1A 3M9OB 3QEAZ 1R89A 1ZQPA 2I9GA 1N48A 1K1SA 2BQRA 2XC9A 2DVIA 4EZ6A 4DSFA 4YMNA 2PFOA 3OJSA 1K1QA 4EBEA 3TAPA 4LVSA 5J2EA 5KFJA 5DEDA 1JXEA 2VA2A 4ECQA 1ZYQA 1JAJA 1X9WA 4MF2A 4O5CA 5KTQA 5DB8A 2B21A 5DBBA 2M2TA 3MR3A 2DR5A 1BPYA 4M04A 5HRDA 2ZJAA 1WCLA 3MFIA 3GIIA 4ECXA 5DGAA 3OSPA 5J2KA 5CWRA 1TFRA 3JPRA 2ASLA 4QZGA 2HHPA 4EYIB 5L9XA 4RQ1A 3WFOA 5J0PA 4YN4A 4XRHA 3M8SA 3T3FA 3UPSA 4AT8B 4F5QA 2V9WA 4RQ4A 4FHPA 3UQ0A 1R8CA 4DSLA 2BPCA 4KLEA 4WC7A 3OV7A 5KFOA 5DGBA 3UXNA 9ICIA 4IQTA 2ZH9A 2F1IA 3EWAA 2FLNA 4RUCA 5DQHA 3RRGA 2HHUA 2DRAA 3C2MA 2UVRA 2C2RA 1HUZA 2DFLA 9ICKA 7ICRA 3V6KA 2ZH6A 5BOMA 4TQRA 3HJ1A 3RAQA 1S0VA 2I1QA 1D8LA 1JX4A 5KFLA 5DG7A 3SV3A 4K4IA 7ICOA 5DBAA 8ICJA 3C66A 3WFSC 5HMMA 1IXRA 2ISOA 2DR9A 3MR2A 3RAXA 4PHEA 4P4PA 4XA5A 4YD1A 4X4VA 3C1YA 5KFKA 4J9NA 3N4MB 4IQWA 3RJGA 8ICYA 4TUPA 2ZJ5A 1MQ3A 4M0AA 4R66A 3OSNA 5D49A 4FS2A 1U48A 3SYZA 3B0YA 5IIKA 2W9MA 3V7KA 1ZQLA 4ED3A 5KFRA 4NLNA 5DBCA 1EXNA 4MEYA 3Q8SB 2ALZA 1XS9D 5KFNA 1L3UA 1KLNA 4PPXA 9ICJA 2MUTA 4YR0A 3RJEA 4DOBA 4ECUA 2P6RA 1NK9A 4E7XA 1A76A 2KZ3A 4I2DA 1S0NA 3ORYA 4O3OA 2W9CA 4QWAA 3AU2A 1RZTA 4M2YA 2KZZA 3V6JA 5KFCA 3C23A 2JEIA 4P4MA 4Q43A 1TK8A 3MGIA 5HRLA 4JV0A 8ICFA 1KTQA 4J9OA 3TQ1A 2BKEA 4P4OA 4NLGA 4X4SA 1ZQVA 4J9MA 2PFPA 4GC6A 4YR2A 4DSKA 9ICGA 5L1KA 1SZPA 3PR5B 3RB6A 3Q8MA 1U4BA 3IHQB 5KG7A 1NJWA 2J6SA 5KFWA 3KHGA 3UPQA 2BQ3A 3PY8A 4KLHA 4DQSA 2PXIA 4MFAA 5J0SA 3EPIA 2HHXA 2XCAA 4NLZA 3BDPA 4GLXA 7ICPA 8ICXA 8ICKA 4M9GA 5KG0A 1S97A 3H7IA 4R8UA 1SKWA 1KSPA 4YXJA 3BQ1A 4IR9A 2NRKA 5CA7A 5CB1A 4F93B 4MFFA 4AT9A 4KN7A 4IRDA 1Z00A 4FHYA 4UAWA 3PV8A 1NJYA 3GDXA 2BCVA 4EBKA 4ELTA 3ISCA 7ICHA 9ICBA 4ECRA 4RPZA 4DS5A 2BPGA 3H39A 4DLEA 4DQRA 2VA8A 4JWMA 4YMMA 5IINA 4M47A 2R8HA 5KT3A 4JWNA 4R64A 3T5LA 3H8WA 1ZQUA 3RH6A 5J2HA 1ZQJA 4M9LA 4R63A 1U9LA 3OHAA 2FPMA 3V6HA 2FLPA 1S76D 1X9MA 2M2UA 2JEGA 3OUYB 2XY7A 1TFWA 1NKBA 4IQVA 4YD2A 3RRHA 4ECWA 3G6VA 4O3NA 2FMSA 1S77D 1PX5A 4DLGA 4LT6A 1BPBA 3RJKA 4KTQA 4DFKA 1ZQYA 8ICOA 3L9DA 1BVSA 4C8MA 3OVSA 4DS4A 3THVA 1MQ2A 3LQCB 5D46A 2M9NA 1ZQMA 4E0DA 1NZPA 3PW5A 2ZTDA 4BWJA 3QZ7A 2W9CB 3SV4A 3OVBA 3MDAA 4EYHB 2HHVA 4E8FA 4UBBA 5KFMA 2PI5A 5KT4A 3JPSA 2XY6A 4YG2A 1ZQDA 1H38A 4QZEA 8ICVA 1TAQA 9ICLA 5DLGA 3MR6A 4DSIA 8ICSA 4F4XA 4M9NA 3RJHA 1JQRA 3WFQE 1UA0A 4DOCA 2Y1IA 1QSYA 9ICUA 2C2EA 3K4GA 4I2HA 5J0WA 3BJYA 4AT7A 1CEZA 9ICPA 2M2VA 1WCNA 1WOTA 4I2FA 5J2BA 4ED7A 4Z6FA 4DL6A 4I2GA 1SKSA 4RQ2A 4M6WA 4R8UB 1ZQBA 3KTQA 4M5DA 1VJ7A 3RR7A 3T5JA 4TUQA 1TV9A 3LDAA 1TK5A 5KFPA 5KFSA 5IIMA 1COOA 5IIOA 3OGUA 4MFCA 5DLFA 9ICWA 4NKTA 5DECA 4F4YA 4WC0A 4KLDA 4ED8A 3OHBA 2W9BB 3G6YA 4YXMA 1D9FA 4UD5A 2ATLA 5KFXA 2KFZA 5DB6A 4I2IA 3M8RA 4B9SA 4JK1A 2KN7A 1VFGA 3RB0A 4ECVA 5BPCA 3V72A 3TFRA 1NJXA 2ZUCA 3IM1A 1T3NA 4KLFA 2BHNA 4EP7A 5HR9A 1TAUA 4Z6DA 5CP2A 3HP6A 3LWMA 2W8LA 4KLOA 2O1PA 3JZ0A 4DL7A 4RQ5A 4DWIA 7ICKA 3RBEA 4B9NA 4DO9A 2DPIA 4ELVA 3PNCA 3H37A 5J2CA 1MIYA 1KEJA 4RT3A 3MFHA 4RU9A 1ZQWA 4QZ9A 2ASJA 1D9DA 4KLLA 3JPPA 4IR1A 1FA0A 1QTMA 2W9BA 4DQQA 5J2DA 2WTFA 3G6XA 4X4TA 3PX0A 4QZAA 4DQPA 5KFEA 3K75D 5CR0A 4TURA 5HHHA 4MEXA 2HVHA 2OWOA 5HRGA 2XGQA 8ICQA 1NK6A 3H4BA 1JN3A 3PMNA 3LK9A 4RWQA 1BNOA 4O9MA 4QWCA 5DQGA 5HRBA 4O3RA 4B9TA 1SL0A 4XQ8A 5J0TA 4FO6A 5CJ7A 5D4BA 5J2JA 2HVIA 3ZDAA 1T4GA 7ICNA 5J2AA 2NRVA 5TZVA 7ICVA 4ZH4A 3ZDBA 4F4ZA 4M6WB 1ZQKA 4Q8FA 4NM2A 7ICUA 1ZQTA 4WC3A 3PX6A 5HMLA 3KHRA 4IG8A 1NK4A 4KLUA 1JMSA 4QWDA 1ZQCA 3NYBA 3JPTA 3SI8A 3PO5A 3Q8RB 1A77A 3Q8QB 4DFPA 3PW4A 2C22A 5HRKA 1KFTA 4NKUA 4TQSA 1OU5A 3AQLA 1Q79A 5KG2A 3TANA 7ICSA 4KN4A 2ZTEA 4WBZA 3HW8A 1D8YA 4EBJA 5KG6A 5EOZA 2RDJA 4KLIA 4PHAA 3RH5A 2BCRA 2F1JA 4O5EA 1IM4A 1DGSA 2P66A 9ICFA 1NJZA 3RB3A 7ICFA 4IRCA 4UB4A 5KG5A 4ED2A 1NOMA 3H3AA 4DEZA 4YP3A 4QZ8A 3RBDA 4RQ8A 4ED0A 3MR5A 9ICVA 9ICHA 1U49A 1L3SA 5J0QA 4XUSA 2PFNA 5KT5A 2KFNA 8ICUA 3MDCA 4WCWA 3OUYA 1RPLA 5DG8A 4TUSA 4UB3A 4ED6A 1XSPA 1ZQSA 1AROP 1BPEA 4GXJA 2KZMA 1RYRA 1UEUA 4GC7A 2DPJA 4F5OA 1CUKA 4J9QA 4DL3A 2HW3A 5KFIA 3BQ0A 4FS1A 5L1LA 4UB2A 4QWBA 5J2FA 4I29A 3V7JA 1XO1A 2F1HA 3UXPA 5KFVA 4EBDA 1U47A 2IMWP 4B9LA 8ICPA 4ATBA 3N97B 4DFJA 4RWOA 5J2IA 3Q8KA 4DQIA 4F2RA 5KT7A 7ICQA 3AQNA 4B9MA 1ZQRA 2AGOA 2GWSA 3TAQA 1QLNA 2XCPA 7ICTA 2P6UA 1PZNA 4YVZA 3Q8LA 3C5GA 1BGXT 1X2IA 2AJQA 3BQTA 2HHTA 7ICJA 3HPOA 5DDYA 3C2LA 4EEYA 3PW0A 1UA1A 1KFDA 2W8KA 4UB1A 4C8OA 1NO5A 4QZBA 2JEJA 2MUTB 2FPKA 4DL2A 5J0RA 4K4GA 4PGYA 2KP7A 4YFKA 1L3VA 2FLLA 4JV2A 4YCXA 8ICWA 1MIVA 3AQMA 4X4PA 3V7LA 2PI4A 3EPGA 1SL1A 4J9PA 4ED1A 5KFTA 4KITB 9ICRA 4PGQA 3HT3A 4G3IA 1R8AA 4M9HA 5KFQA 5KT2A 5DDMA 4X4QA 4NY8A 1MC8A 4BDPA 3QE9Y 4F3OA 2JZBB 4WBYA 3C18A 2ZH4A 1BPDA 3JPNA 4KLJA 2C28A 2ZH7A 2LYHA 1TFYA 2ID1A 7ICLA 2UVUA 9ICCA 4X4RA 1HUOA 7ICGA 4EZ9A 4X4NA 2HHWA 1BNPA 4I28A 9ICOA 4YR3A 4Z6EA 2BCSA 2R8GA 5HHIA 2M2WA 3UXOA 4UQGA 9ICTA 4HYKA 4I2EA 2NRXA 3ZDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N56 A;  3H8S A;  4F4W A;  3H38 A;  5L1J A;  4KLS A;  4DF8 A;  2A1J B;  2UVV A;  3TI0 A;  3ETL A;  4QWE A;  1XSL A;  4KLT A;  4FHW A;  2XO7 A;  5KFH A;  4YMO A;  1UT5 A;  4I2A A;  2ZH8 A;  1SL2 A;  4AT8 A;  4RWN A;  3MBY A;  2BPF A;  5KFZ A;  4J9L A;  3HX0 A;  2RDI A;  1NKC A;  2BGW A;  4PH5 A;  2XGP A;  3GIJ A;  3GV5 B;  2AU0 A;  1NK7 A;  3C2K A;  3BQ2 A;  3C1Z A;  3GFK B;  4FH3 A;  5EWF A;  1NK8 A;  4BXO A;  4WC5 A;  7ICM A;  3GQC A;  4RNM A;  4UB5 A;  4UAZ A;  5IIL A;  4QZI A;  3M9N B;  3RJJ A;  2IA6 A;  3NTU A;  4K4H A;  5KFU A;  3PX4 A;  4RQ7 A;  3QEB Z;  4GXK A;  5DB7 A;  8ICM A;  2Y1J A;  3MGH A;  1ZQN A;  5DB9 A;  5KFD A;  7ICE A;  3GIL A;  2FMQ A;  5KFF A;  1ZJN A;  1XWL A;  4ECS A;  3T5K A;  2JZB A;  3C21 A;  5EWG A;  4KMU A;  1Z00 B;  4ELU A;  1XU4 A;  8ICE A;  1DK2 A;  3KHH A;  2FPL A;  1ZJM A;  1U45 A;  4RUA A;  2BCQ A;  3QZ8 A;  3OJU A;  3RTV A;  3ZDD A;  2KTQ A;  4F2S A;  2ZUB A;  4E80 A;  1JIH A;  3JPO A;  1LB2 B;  1ZQZ A;  3KHL A;  4Z6C A;  3ISB A;  2NRZ A;  4RZR A;  4JUZ A;  4X5V A;  1BPZ A;  3Q8P B;  1ZQG A;  4C8N A;  3JYY A;  4NLK A;  3ISD A;  3AQK A;  2DR8 A;  4FHX A;  5KG3 A;  9ICQ A;  2NRW A;  2Q0Z X;  4I27 A;  4UBC A;  1V9P A;  8ICB A;  4WC4 A;  1ZET A;  1MIW A;  4X4O A;  2ZHB A;  3PW7 A;  1RXW A;  1KRP A;  2DRB A;  1UT8 A;  3FDS A;  4I2B A;  5KFG A;  2A1J A;  1ZQE A;  1QSL A;  9ICS A;  3PML A;  4B9U A;  1ZQF A;  2ZH2 A;  8ICR A;  4QW8 A;  1S10 A;  9ICX A;  2AQ0 A;  3TFS A;  5J0Y A;  4DL4 A;  5EWE A;  4B9V A;  2V4R A;  4QW9 A;  2V4Q A;  2ASD A;  4I2J A;  1B22 A;  1F5A A;  1BPX A;  1UEV A;  8ICT A;  3EZ5 A;  5DG9 A;  3RH4 A;  5HRE A;  3WFP A;  4F8R A;  1T8E A;  4J9R A;  3B0X A;  2BQU A;  9ICA A;  2ZH1 A;  1L5U A;  1XSN A;  1NK0 A;  4C8K A;  3M9M B;  4F50 A;  5KG4 A;  5L1I A;  4ECY A;  5HP4 A;  1KFS A;  2XY5 A;  2C2D A;  1ZQX A;  1C7Y A;  1QSS A;  2JEF A;  4DSJ A;  2H5X A;  4EBC A;  8ICG A;  3RJF A;  1KNY A;  3RR8 A;  2ZHA A;  2ISP A;  4O3Q A;  3GV8 B;  5HNK A;  2IHN A;  5KFY A;  3TAR A;  2BCU A;  1XC9 A;  9ICE A;  2ZH3 A;  1TKD A;  4NXZ A;  3T5H A;  1TK0 A;  5KFB A;  1Y88 A;  3PO4 A;  2J6T A;  8ICZ A;  5HRH A;  4F92 B;  1SKR A;  2RFF A;  3EYZ A;  4QZF A;  8ICN A;  4KLM A;  3UQ2 A;  1JXL A;  1RYS A;  3HIY A;  5JUM A;  4QZD A;  3GV7 B;  1S9F A;  4BGD A;  4F4K A;  4UD4 A;  1ZQI A;  4R65 A;  4QZH A;  2UVW A;  4FHV A;  4RPX A;  2BE3 A;  4O5K A;  3SZ2 A;  3RJI A;  2BR0 A;  1NK5 A;  5F9N A;  5J0U A;  4PHP A;  4Q45 A;  2NRT A;  4RQ6 A;  2R8I A;  4J9S A;  4DFM A;  3PVX A;  2ZH5 A;  5KT6 A;  5KFA A;  2MAX A;  4O0I A;  2W9A A;  4ECZ A;  1Z3E B;  1TVA A;  1X9S A;  4RWP A;  4DSE A;  3AU6 A;  2IHM A;  5BOL A;  5C5J A;  3PW2 A;  2AGP A;  9ICM A;  2PBE A;  4ECT A;  4DL5 A;  1R8B A;  5F9L A;  4AT7 B;  4P2H A;  5J2G A;  4BXO B;  1ZQQ A;  4F5P A;  2HHQ A;  7ICI A;  4LZD A;  8ICA A;  2VAN A;  2ZUD A;  2FMP A;  2O5A A;  2HHS A;  4RQ0 A;  4C8L A;  4FBT A;  4RQ3 A;  4RT2 A;  3ZDE A;  1UET A;  4MF8 A;  2R8K A;  4YQW A;  2ZTC A;  2Q66 A;  4X0B A;  5IIJ A;  4RNO A;  4IRK A;  3H4D A;  1L3T A;  8ICI A;  5HRI A;  4QZC A;  4FH5 A;  4X0A A;  1MSW D;  3H40 A;  1KDH A;  5J0X A;  2BDP A;  9ICN A;  5HRF A;  1T7P A;  3E2E A;  4WC6 A;  1ZQA A;  3HWT A;  1ZQH A;  3LWL A;  4LZG A;  3ZD8 A;  3RB4 A;  2AQ4 A;  4KLQ A;  3FYH A;  4X4U A;  4O3S A;  1Q78 A;  8ICC A;  1HJP A;  4IQU A;  5DQI A;  1S0M A;  4J9K A;  1YLQ A;  3HJ4 A;  2ZJ8 A;  1DK3 A;  4RNN A;  4S3N A;  3MAB A;  5KG1 A;  1LV5 A;  2R8J A;  5CHG A;  1S0O A;  4Q8E A;  4AT9 B;  1DOQ A;  4RPY A;  5DKW A;  4F5N A;  2J6U A;  4CCH A;  4I2C A;  1B43 A;  3PR4 A;  1ZQO A;  2IBK A;  3WFR E;  3OVA A;  2AGQ A;  2PFQ A;  4O3P A;  5J29 A;  4DOA A;  3ZD9 A;  4Q44 A;  1RXV A;  4DF4 A;  4FBU A;  4PHD A;  3GIK A;  4ATB B;  5III A;  4PGX A;  4WC2 A;  4KLG A;  4M9J A;  3EW9 A;  4JV1 A;  8ICL A;  3AUO A;  1V4A A;  4F91 B;  4UAY A;  2DR7 A;  4BWM A;  4NM1 A;  3H8J A;  3C5F A;  5HC9 A;  3NGD A;  2VA3 A;  4XQ7 A;  4GXI A;  8ICH A;  4F5R A;  5F2V O;  1NKE A;  3GIM A;  3JPQ A;  5J0O A;  4WC1 A;  3M9O B;  3QEA Z;  1R89 A;  1ZQP A;  2I9G A;  1N48 A;  1K1S A;  2BQR A;  2XC9 A;  2DVI A;  4EZ6 A;  4DSF A;  4YMN A;  2PFO A;  3OJS A;  1K1Q A;  4EBE A;  3TAP A;  4LVS A;  5J2E A;  5KFJ A;  5DED A;  1JXE A;  2VA2 A;  4ECQ A;  1ZYQ A;  1JAJ A;  1X9W A;  4MF2 A;  4O5C A;  5KTQ A;  5DB8 A;  2B21 A;  5DBB A;  2M2T A;  3MR3 A;  2DR5 A;  1BPY A;  4M04 A;  5HRD A;  2ZJA A;  1WCL A;  3MFI A;  3GII A;  4ECX A;  5DGA A;  3OSP A;  5J2K A;  5CWR A;  1TFR A;  3JPR A;  2ASL A;  4QZG A;  2HHP A;  4EYI B;  5L9X A;  4RQ1 A;  3WFO A;  5J0P A;  4YN4 A;  4XRH A;  3M8S A;  3T3F A;  3UPS A;  4AT8 B;  4F5Q A;  2V9W A;  4RQ4 A;  4FHP A;  3UQ0 A;  1R8C A;  4DSL A;  2BPC A;  4KLE A;  4WC7 A;  3OV7 A;  5KFO A;  5DGB A;  3UXN A;  9ICI A;  4IQT A;  2ZH9 A;  2F1I A;  3EWA A;  2FLN A;  4RUC A;  5DQH A;  3RRG A;  2HHU A;  2DRA A;  3C2M A;  2UVR A;  2C2R A;  1HUZ A;  2DFL A;  9ICK A;  7ICR A;  3V6K A;  2ZH6 A;  5BOM A;  4TQR A;  3HJ1 A;  3RAQ A;  1S0V A;  2I1Q A;  1D8L A;  1JX4 A;  5KFL A;  5DG7 A;  3SV3 A;  4K4I A;  7ICO A;  5DBA A;  8ICJ A;  3C66 A;  3WFS C;  5HMM A;  1IXR A;  2ISO A;  2DR9 A;  3MR2 A;  3RAX A;  4PHE A;  4P4P A;  4XA5 A;  4YD1 A;  4X4V A;  3C1Y A;  5KFK A;  4J9N A;  3N4M B;  4IQW A;  3RJG A;  8ICY A;  4TUP A;  2ZJ5 A;  1MQ3 A;  4M0A A;  4R66 A;  3OSN A;  5D49 A;  4FS2 A;  1U48 A;  3SYZ A;  3B0Y A;  5IIK A;  2W9M A;  3V7K A;  1ZQL A;  4ED3 A;  5KFR A;  4NLN A;  5DBC A;  1EXN A;  4MEY A;  3Q8S B;  2ALZ A;  1XS9 D;  5KFN A;  1L3U A;  1KLN A;  4PPX A;  9ICJ A;  2MUT A;  4YR0 A;  3RJE A;  4DOB A;  4ECU A;  2P6R A;  1NK9 A;  4E7X A;  1A76 A;  2KZ3 A;  4I2D A;  1S0N A;  3ORY A;  4O3O A;  2W9C A;  4QWA A;  3AU2 A;  1RZT A;  4M2Y A;  2KZZ A;  3V6J A;  5KFC A;  3C23 A;  2JEI A;  4P4M A;  4Q43 A;  1TK8 A;  3MGI A;  5HRL A;  4JV0 A;  8ICF A;  1KTQ A;  4J9O A;  3TQ1 A;  2BKE A;  4P4O A;  4NLG A;  4X4S A;  1ZQV A;  4J9M A;  2PFP A;  4GC6 A;  4YR2 A;  4DSK A;  9ICG A;  5L1K A;  1SZP A;  3PR5 B;  3RB6 A;  3Q8M A;  1U4B A;  3IHQ B;  5KG7 A;  1NJW A;  2J6S A;  5KFW A;  3KHG A;  3UPQ A;  2BQ3 A;  3PY8 A;  4KLH A;  4DQS A;  2PXI A;  4MFA A;  5J0S A;  3EPI A;  2HHX A;  2XCA A;  4NLZ A;  3BDP A;  4GLX A;  7ICP A;  8ICX A;  8ICK A;  4M9G A;  5KG0 A;  1S97 A;  3H7I A;  4R8U A;  1SKW A;  1KSP A;  4YXJ A;  3BQ1 A;  4IR9 A;  2NRK A;  5CA7 A;  5CB1 A;  4F93 B;  4MFF A;  4AT9 A;  4KN7 A;  4IRD A;  1Z00 A;  4FHY A;  4UAW A;  3PV8 A;  1NJY A;  3GDX A;  2BCV A;  4EBK A;  4ELT A;  3ISC A;  7ICH A;  9ICB A;  4ECR A;  4RPZ A;  4DS5 A;  2BPG A;  3H39 A;  4DLE A;  4DQR A;  2VA8 A;  4JWM A;  4YMM A;  5IIN A;  4M47 A;  2R8H A;  5KT3 A;  4JWN A;  4R64 A;  3T5L A;  3H8W A;  1ZQU A;  3RH6 A;  5J2H A;  1ZQJ A;  4M9L A;  4R63 A;  1U9L A;  3OHA A;  2FPM A;  3V6H A;  2FLP A;  1S76 D;  1X9M A;  2M2U A;  2JEG A;  3OUY B;  2XY7 A;  1TFW A;  1NKB A;  4IQV A;  4YD2 A;  3RRH A;  4ECW A;  3G6V A;  4O3N A;  2FMS A;  1S77 D;  1PX5 A;  4DLG A;  4LT6 A;  1BPB A;  3RJK A;  4KTQ A;  4DFK A;  1ZQY A;  8ICO A;  3L9D A;  1BVS A;  4C8M A;  3OVS A;  4DS4 A;  3THV A;  1MQ2 A;  3LQC B;  5D46 A;  2M9N A;  1ZQM A;  4E0D A;  1NZP A;  3PW5 A;  2ZTD A;  4BWJ A;  3QZ7 A;  2W9C B;  3SV4 A;  3OVB A;  3MDA A;  4EYH B;  2HHV A;  4E8F A;  4UBB A;  5KFM A;  2PI5 A;  5KT4 A;  3JPS A;  2XY6 A;  4YG2 A;  1ZQD A;  1H38 A;  4QZE A;  8ICV A;  1TAQ A;  9ICL A;  5DLG A;  3MR6 A;  4DSI A;  8ICS A;  4F4X A;  4M9N A;  3RJH A;  1JQR A;  3WFQ E;  1UA0 A;  4DOC A;  2Y1I A;  1QSY A;  9ICU A;  2C2E A;  3K4G A;  4I2H A;  5J0W A;  3BJY A;  4AT7 A;  1CEZ A;  9ICP A;  2M2V A;  1WCN A;  1WOT A;  4I2F A;  5J2B A;  4ED7 A;  4Z6F A;  4DL6 A;  4I2G A;  1SKS A;  4RQ2 A;  4M6W A;  4R8U B;  1ZQB A;  3KTQ A;  4M5D A;  1VJ7 A;  3RR7 A;  3T5J A;  4TUQ A;  1TV9 A;  3LDA A;  1TK5 A;  5KFP A;  5KFS A;  5IIM A;  1COO A;  5IIO A;  3OGU A;  4MFC A;  5DLF A;  9ICW A;  4NKT A;  5DEC A;  4F4Y A;  4WC0 A;  4KLD A;  4ED8 A;  3OHB A;  2W9B B;  3G6Y A;  4YXM A;  1D9F A;  4UD5 A;  2ATL A;  5KFX A;  2KFZ A;  5DB6 A;  4I2I A;  3M8R A;  4B9S A;  4JK1 A;  2KN7 A;  1VFG A;  3RB0 A;  4ECV A;  5BPC A;  3V72 A;  3TFR A;  1NJX A;  2ZUC A;  3IM1 A;  1T3N A;  4KLF A;  2BHN A;  4EP7 A;  5HR9 A;  1TAU A;  4Z6D A;  5CP2 A;  3HP6 A;  3LWM A;  2W8L A;  4KLO A;  2O1P A;  3JZ0 A;  4DL7 A;  4RQ5 A;  4DWI A;  7ICK A;  3RBE A;  4B9N A;  4DO9 A;  2DPI A;  4ELV A;  3PNC A;  3H37 A;  5J2C A;  1MIY A;  1KEJ A;  4RT3 A;  3MFH A;  4RU9 A;  1ZQW A;  4QZ9 A;  2ASJ A;  1D9D A;  4KLL A;  3JPP A;  4IR1 A;  1FA0 A;  1QTM A;  2W9B A;  4DQQ A;  5J2D A;  2WTF A;  3G6X A;  4X4T A;  3PX0 A;  4QZA A;  4DQP A;  5KFE A;  3K75 D;  5CR0 A;  4TUR A;  5HHH A;  4MEX A;  2HVH A;  2OWO A;  5HRG A;  2XGQ A;  8ICQ A;  1NK6 A;  3H4B A;  1JN3 A;  3PMN A;  3LK9 A;  4RWQ A;  1BNO A;  4O9M A;  4QWC A;  5DQG A;  5HRB A;  4O3R A;  4B9T A;  1SL0 A;  4XQ8 A;  5J0T A;  4FO6 A;  5CJ7 A;  5D4B A;  5J2J A;  2HVI A;  3ZDA A;  1T4G A;  7ICN A;  5J2A A;  2NRV A;  5TZV A;  7ICV A;  4ZH4 A;  3ZDB A;  4F4Z A;  4M6W B;  1ZQK A;  4Q8F A;  4NM2 A;  7ICU A;  1ZQT A;  4WC3 A;  3PX6 A;  5HML A;  3KHR A;  4IG8 A;  1NK4 A;  4KLU A;  1JMS A;  4QWD A;  1ZQC A;  3NYB A;  3JPT A;  3SI8 A;  3PO5 A;  3Q8R B;  1A77 A;  3Q8Q B;  4DFP A;  3PW4 A;  2C22 A;  5HRK A;  1KFT A;  4NKU A;  4TQS A;  1OU5 A;  3AQL A;  1Q79 A;  5KG2 A;  3TAN A;  7ICS A;  4KN4 A;  2ZTE A;  4WBZ A;  3HW8 A;  1D8Y A;  4EBJ A;  5KG6 A;  5EOZ A;  2RDJ A;  4KLI A;  4PHA A;  3RH5 A;  2BCR A;  2F1J A;  4O5E A;  1IM4 A;  1DGS A;  2P66 A;  9ICF A;  1NJZ A;  3RB3 A;  7ICF A;  4IRC A;  4UB4 A;  5KG5 A;  4ED2 A;  1NOM A;  3H3A A;  4DEZ A;  4YP3 A;  4QZ8 A;  3RBD A;  4RQ8 A;  4ED0 A;  3MR5 A;  9ICV A;  9ICH A;  1U49 A;  1L3S A;  5J0Q A;  4XUS A;  2PFN A;  5KT5 A;  2KFN A;  8ICU A;  3MDC A;  4WCW A;  3OUY A;  1RPL A;  5DG8 A;  4TUS A;  4UB3 A;  4ED6 A;  1XSP A;  1ZQS A;  1ARO P;  1BPE A;  4GXJ A;  2KZM A;  1RYR A;  1UEU A;  4GC7 A;  2DPJ A;  4F5O A;  1CUK A;  4J9Q A;  4DL3 A;  2HW3 A;  5KFI A;  3BQ0 A;  4FS1 A;  5L1L A;  4UB2 A;  4QWB A;  5J2F A;  4I29 A;  3V7J A;  1XO1 A;  2F1H A;  3UXP A;  5KFV A;  4EBD A;  1U47 A;  2IMW P;  4B9L A;  8ICP A;  4ATB A;  3N97 B;  4DFJ A;  4RWO A;  5J2I A;  3Q8K A;  4DQI A;  4F2R A;  5KT7 A;  7ICQ A;  3AQN A;  4B9M A;  1ZQR A;  2AGO A;  2GWS A;  3TAQ A;  1QLN A;  2XCP A;  7ICT A;  2P6U A;  1PZN A;  4YVZ A;  3Q8L A;  3C5G A;  1BGX T;  1X2I A;  2AJQ A;  3BQT A;  2HHT A;  7ICJ A;  3HPO A;  5DDY A;  3C2L A;  4EEY A;  3PW0 A;  1UA1 A;  1KFD A;  2W8K A;  4UB1 A;  4C8O A;  1NO5 A;  4QZB A;  2JEJ A;  2MUT B;  2FPK A;  4DL2 A;  5J0R A;  4K4G A;  4PGY A;  2KP7 A;  4YFK A;  1L3V A;  2FLL A;  4JV2 A;  4YCX A;  8ICW A;  1MIV A;  3AQM A;  4X4P A;  3V7L A;  2PI4 A;  3EPG A;  1SL1 A;  4J9P A;  4ED1 A;  5KFT A;  4KIT B;  9ICR A;  4PGQ A;  3HT3 A;  4G3I A;  1R8A A;  4M9H A;  5KFQ A;  5KT2 A;  5DDM A;  4X4Q A;  4NY8 A;  1MC8 A;  4BDP A;  3QE9 Y;  4F3O A;  2JZB B;  4WBY A;  3C18 A;  2ZH4 A;  1BPD A;  3JPN A;  4KLJ A;  2C28 A;  2ZH7 A;  2LYH A;  1TFY A;  2ID1 A;  7ICL A;  2UVU A;  9ICC A;  4X4R A;  1HUO A;  7ICG A;  4EZ9 A;  4X4N A;  2HHW A;  1BNP A;  4I28 A;  9ICO A;  4YR3 A;  4Z6E A;  2BCS A;  2R8G A;  5HHI A;  2M2W A;  3UXO A;  4UQG A;  9ICT A;  4HYK A;  4I2E A;  2NRX A;  3ZDC A; 
#chains in the Genus database with same CATH topology
 3H8S A;  5L1M A;  3LYS A;  4FHW A;  5KFH A;  4YMO A;  1UT5 A;  1V97 A;  1Z4N A;  4Y2V A;  5KFZ A;  4J9L A;  1NKC A;  3GIJ A;  2AU0 A;  1PVQ A;  1SV0 C;  3C1Z A;  3GFK B;  4FH3 A;  1NK8 A;  4BXO A;  7ICM A;  2NO4 A;  3M9N B;  5JTG A;  3RJJ A;  4FZL A;  2IA6 A;  3NTU A;  5DB7 A;  2FMQ A;  4NXU A;  3C21 A;  4N7R A;  1XU4 A;  1AQ6 A;  5G5G A;  3QZ8 A;  1ZD4 A;  2HOQ A;  3OJU A;  3PST A;  2N1R A;  1Q3V A;  3JPO A;  1LB2 B;  1ZQG A;  4C8N A;  2ZIU A;  1RDF A;  2DR8 A;  5KG3 A;  4I27 A;  1V9P A;  2EAM A;  1GO3 F;  8ICB A;  1KKX A;  1Z19 A;  4I2B A;  3I28 A;  9ICS A;  2IOF K;  2W03 A;  2AQ0 A;  1PVR A;  2E1F A;  2DL0 A;  5J0Y A;  2KKP A;  8ICT A;  3EZ5 A;  5HRE A;  2BQU A;  2JH7 A;  1L5U A;  4F50 A;  1N2X A;  3F53 A;  2JEF A;  4DSJ A;  8ICG A;  4OAF A;  5AK4 A;  3UMB A;  2BCU A;  2IUB A;  4PZN A;  1QQ7 A;  4NXZ A;  1TKD A;  3PO4 A;  2J6T A;  2RFF A;  4QZF A;  8ICN A;  5AK6 A;  4KLM A;  1RYS A;  5JUM A;  3GV7 B;  1S9F A;  4NLB A;  2YMQ A;  2UVW A;  4FHV A;  4RQM A;  4OJ5 A;  1NK5 A;  4Q45 A;  5H2F U;  2W9A A;  1X9S A;  1TVA A;  4Y2J A;  3AU6 A;  5BOL A;  4AT7 B;  4US8 A;  4BXO B;  3AQE A;  5ALR A;  4LZD A;  2KIW A;  8ICA A;  2ZUD A;  2FMP A;  1ZD3 A;  2O5A A;  2HDO A;  2EAP A;  2R8K A;  5HRI A;  1L3T A;  3H40 A;  2KEY A;  4C0Z A;  4KB6 A;  1B4F A;  3ZD8 A;  5ALO A;  3FYH A;  2OCE A;  2OYY A;  4J9K A;  4NL9 A;  2R8J A;  3PSP A;  2PKE A;  4QIW F;  3VC8 A;  4RPY A;  4CCH A;  4KMO B;  5B3P A;  1B43 A;  2W7P A;  1WWU A;  1ZQO A;  2IBK A;  3OVA A;  2E1E A;  1TAM A;  2CXY A;  2BZF A;  3QNM A;  1FO4 A;  5ALV A;  2DR7 A;  4C7Z A;  5AM3 A;  4NM1 A;  5HC9 A;  4XQ7 A;  8ICH A;  2HN2 A;  2LPE A;  3GIM A;  3PHZ A;  1L8O A;  2OEH A;  3U26 A;  2EZX A;  3T79 A;  5AIB A;  1IV8 A;  4EZ6 A;  4LVS A;  4EBE A;  5KFJ A;  1JXE A;  2VA2 A;  1JAJ A;  5AKX A;  5KTQ A;  1SXD A;  2B21 A;  5DBB A;  4J03 A;  2W43 A;  2ZJA A;  5J2K A;  2G06 A;  1TFR A;  3JPR A;  2HHP A;  4RQ1 A;  5J0P A;  3M8S A;  4XRH A;  4AT8 B;  5ALU A;  1P7D A;  4FHP A;  3OV7 A;  4Y2Y A;  1L7O A;  5KFO A;  2KVC A;  9ICI A;  2K8A A;  3EWA A;  4RUC A;  2HHU A;  3PSF A;  7ICR A;  3V6K A;  2ZH6 A;  4TQR A;  2I1Q A;  5KFL A;  4WJ3 B;  5DBA A;  3WFS C;  5HMM A;  2GO7 A;  4XA5 A;  4X4V A;  2KSO B;  2AXT U;  2CRX A;  4NXV A;  4QNL A;  1MQ3 A;  5D49 A;  2W9M A;  4ED3 A;  1D8B A;  4MEY A;  3Q8S B;  4A8E A;  4DOB A;  2BBJ A;  2KZ3 A;  1RZT A;  4C4T A;  2ZIU B;  3C23 A;  3MGI A;  8ICF A;  4J9O A;  2BKE A;  2ZIW A;  3HRD D;  1WG8 A;  1ZQV A;  2DBY A;  4J9M A;  9ICG A;  1SZP A;  2JEG A;  3KOO A;  2J6S A;  3UPQ A;  4DQS A;  2ZXI A;  4NLZ A;  1N63 A;  3SAF A;  5HR6 A;  4PZO A;  8ICK A;  3H7I A;  4R8U A;  1KSP A;  3BQ1 A;  4AT9 A;  3HKZ F;  5ALE A;  1NJY A;  3PV8 A;  3GDX A;  2FJ6 A;  2BCV A;  3ISC A;  4DS5 A;  4RPZ A;  2BPG A;  2VA8 A;  5KT3 A;  4R64 A;  3T5L A;  1ZQU A;  5J2H A;  2M2U A;  4K97 A;  2K4H A;  1TFW A;  1L7N A;  3RRH A;  4IQV A;  1YZ7 A;  5AKJ A;  3G6V A;  1S77 D;  4DLG A;  1BPB A;  3L9D A;  1BVS A;  4C8M A;  3THV A;  3LQC B;  1OXJ A;  3PW5 A;  4OAI Z;  3OVB A;  5KFM A;  4YG2 A;  1ZQD A;  4UW9 A;  9ICL A;  4DSI A;  3AEV A;  4M9N A;  1L6N A;  3WFQ E;  1J2M A;  2Y1I A;  1QSY A;  4I2H A;  1WCN A;  1WOT A;  5J2B A;  4Z6F A;  2WF9 A;  3RR7 A;  3T5J A;  4TUQ A;  1TK5 A;  3AM9 A;  5KFP A;  5IIM A;  1COO A;  5IIO A;  1SV0 A;  5DLF A;  4Y2X A;  2NO5 A;  1D9F A;  2ATL A;  5KFX A;  4I2I A;  4K99 A;  4JK1 A;  3RB0 A;  2D3D A;  3V72 A;  1T3N A;  5ALL A;  3SR6 A;  5CP2 A;  3JZ0 A;  3WK5 A;  7ICK A;  2KG5 A;  2DPI A;  4C4R A;  5J2C A;  1MIY A;  1KEJ A;  2ASJ A;  4KLL A;  3JPP A;  5ALI A;  1FA0 A;  2WTF A;  2QB1 A;  3L3F X;  3PX0 A;  4DQP A;  4LEW A;  3KD3 A;  1N61 A;  5CR0 A;  2HVH A;  2G5I B;  8ICQ A;  3QUB A;  4Y2S A;  1JN3 A;  4RWQ A;  5DQG A;  2E8P A;  5ALJ A;  4XQ8 A;  1ZRM A;  1FEZ A;  2MRL A;  4EEB A;  2YMP A;  4M6W B;  3CK6 A;  4EV6 A;  1ZQT A;  4LEY A;  4WC3 A;  5AI5 A;  1MA7 A;  1UQV A;  1ZQC A;  4UAR A;  3SI8 A;  3PO5 A;  3Q8R B;  2F77 X;  2WAQ F;  5ALT A;  2F8K A;  4TQS A;  2HOI A;  1OU5 A;  1WUD A;  5EOZ A;  2A19 A;  3RH5 A;  4KLI A;  1DGS A;  2P66 A;  5KG5 A;  2WAQ C;  4RQ8 A;  4ED0 A;  9ICH A;  1U49 A;  4G9B A;  2PFN A;  5KT5 A;  3OUY A;  1T94 A;  5DG8 A;  1XSP A;  1RYR A;  1UEU A;  1XO0 A;  2W04 A;  1SB3 C;  4F5O A;  4DL3 A;  3NYB A;  1KFT A;  5AM0 A;  3V7J A;  1XO1 A;  2F1H A;  5KFV A;  2IMW P;  4B9L A;  3UMC A;  2E8N A;  4OD0 A;  3Q8K A;  1JUD A;  5CFS A;  2PMZ C;  5EE1 A;  3NWI A;  2HBJ A;  5E79 U;  4OCZ A;  2GH1 A;  2HHT A;  1UA1 A;  1UHU A;  1NO5 A;  2GOL A;  5ALD A;  4QZB A;  5KL8 B;  4DL2 A;  5J0R A;  2E3T A;  2KP7 A;  4YFK A;  4JV2 A;  3IG8 A;  2KJ8 A;  4BUG A;  5A0L A;  4J9P A;  4GFJ A;  1TE2 A;  5KT2 A;  5DDM A;  4X4Q A;  4NY8 A;  4F3O A;  2VJ5 A;  3QUQ A;  2YQE A;  2ZH7 A;  4PL1 A;  4X4N A;  4C80 A;  5KAI U;  2YML A;  4YR3 A;  2KE7 A;  3BS7 A;  4UQG A;  4I2E A;  1X66 A;  4DF8 A;  2A1J B;  3TI0 A;  3ETL A;  1XSL A;  2QB0 B;  1SL2 A;  4RWN A;  5JRT A;  5AI8 A;  3F2D A;  3HX0 A;  2RDI A;  3C2K A;  5EWF A;  5AM4 A;  4UB5 A;  4UAZ A;  4EGW A;  1KBU A;  4RQ7 A;  1NNL A;  3WK8 A;  1ZQN A;  1N5W A;  1ZJN A;  2FI1 A;  2JZB A;  1Z00 B;  4OJL A;  1RYU A;  1ZJM A;  1U45 A;  2BCQ A;  4RUA A;  2W3R A;  3ZDD A;  3CRX A;  3Q8P B;  2LI6 A;  3JYY A;  4FHX A;  3PW7 A;  4QW8 A;  1S10 A;  4B9V A;  5EWE A;  2V4R A;  1PK1 A;  1F5A A;  1UEV A;  1B22 A;  1KL9 A;  1BPX A;  5ALW A;  5ALX A;  3NVW A;  5DG9 A;  3RH4 A;  3WFP A;  4F8R A;  3R9K A;  4NL9 C;  2ZH1 A;  1XSN A;  1NK0 A;  2YMM A;  4LEZ A;  5HP4 A;  2C2D A;  2FE9 A;  4EBC A;  3RR8 A;  2ZHA A;  1PUZ A;  2I6X A;  4O3Q A;  3GV8 B;  5HNK A;  2IHN A;  1FFU A;  3NVO A;  9ICE A;  5AK3 A;  4O68 A;  8ICZ A;  4F92 B;  1IIP A;  1SKR A;  2DGZ A;  5ALM A;  3EYZ A;  1F5S A;  4BGD A;  2QB0 A;  4R65 A;  4RPX A;  3SZ2 A;  1ZQP A;  4P2H A;  2NRT A;  1FFV A;  4J9S A;  2MAX A;  4ECZ A;  5C5J A;  2PBE A;  4ECT A;  4F5P A;  4UAV A;  7ICI A;  3M7D A;  3ALR A;  4RQ0 A;  4RQ3 A;  4RT2 A;  5IIJ A;  4X0A A;  4C4S A;  4K9A A;  2BDP A;  3WK6 A;  4K9B A;  3KZX A;  4EEN A;  3KKA C;  1ZQA A;  1ZQH A;  1FIQ A;  3RB4 A;  2AQ4 A;  4X4U A;  1S0M A;  5DQI A;  2ZJ8 A;  2IOF A;  1DK3 A;  4S3N A;  3MAB A;  1S0O A;  4Q8E A;  5DKW A;  4EED A;  2AGQ A;  4O3P A;  3S6J A;  4ATB B;  3ZD9 A;  1JAL A;  4KLG A;  2KOB A;  8ICL A;  1V4A A;  4F91 B;  3H8J A;  3C5F A;  3OWG A;  3NGD A;  2VA3 A;  5F2V O;  4GXI A;  1J97 A;  2WHE A;  4ICA A;  2XC9 A;  4YMN A;  3QXG A;  4P0P A;  2H3V A;  3TAP A;  4ECQ A;  4MF2 A;  2CPR A;  3RF9 A;  2HBK A;  3LVW A;  3M6K A;  4KX3 A;  1BPY A;  2F8L A;  3F2C A;  3SAH A;  2Y9U A;  5CWR A;  5AKG A;  2ASL A;  4QZG A;  3WFO A;  2H3Z A;  3QU4 A;  2V9W A;  3UQ0 A;  4DSL A;  5DGB A;  4LEV A;  3F2B A;  2F1I A;  2FLN A;  4JLX A;  5DQH A;  3RRG A;  3C2M A;  2UVR A;  3IDW A;  2DFL A;  4AYB F;  2OHF A;  5BOM A;  3HJ1 A;  3RAQ A;  1D8L A;  4K4I A;  7ICO A;  8ICJ A;  3C66 A;  3NS1 A;  1IXR A;  3RAX A;  1XNS A;  4PHE A;  4YD1 A;  4TUP A;  1SV4 A;  4M0A A;  4R66 A;  3V7K A;  5DBC A;  3HJE A;  2ALZ A;  5KFN A;  4ECU A;  1NK9 A;  2YN4 A;  2W9C A;  1B0X A;  1X6J A;  2RRD A;  5KFC A;  4KX5 A;  1TK8 A;  1KTQ A;  3IN5 A;  2PFP A;  5L1K A;  1U4B A;  1NJW A;  1T3Q A;  3PY8 A;  3KFU F;  2BQ3 A;  4KLH A;  4U7C A;  3EPI A;  2QAR B;  2HHX A;  3K7D A;  3QU2 A;  3BDP A;  4GLX A;  2JR5 A;  2NRK A;  5CA7 A;  4MFF A;  2KD1 A;  4KN7 A;  2EAN A;  1F0M A;  4JB3 A;  2DUY A;  4DQR A;  1X42 A;  3BQ7 A;  2R8H A;  1ZQJ A;  3CP8 A;  4M9L A;  5ALK A;  3V6H A;  2YTU A;  3H8M A;  2FMS A;  4ECW A;  1PX5 A;  4O3N A;  4KTQ A;  4DFK A;  1ZQY A;  8ICO A;  3OVS A;  5D46 A;  4E0D A;  1NZP A;  3QYP A;  3UMG A;  4EYH B;  2HHV A;  4UBB A;  2XY6 A;  1H38 A;  4AP9 A;  4QZE A;  1TAQ A;  5DLG A;  5AKK A;  8ICS A;  1JQR A;  2C2E A;  5J0W A;  3QU9 A;  2HN1 A;  4I2F A;  5KNI A;  4I2G A;  3MGV A;  4NWI A;  2P35 A;  1ZQB A;  1VJ7 A;  3N7R C;  4ELV A;  1TV9 A;  3LDA A;  3J81 j;  3HIL A;  5KFS A;  4MFC A;  4NKT A;  9ICW A;  3A0H U;  4WC0 A;  5CHE A;  2K8C B;  4YXM A;  5DB6 A;  1PK1 B;  1Q46 A;  1NJX A;  3IM1 A;  1DGJ A;  2GAF D;  5HR9 A;  3HP6 A;  2O1P A;  1F44 A;  4RQ5 A;  4OJ6 A;  4DWI A;  3RBE A;  2JV3 A;  4BX9 C;  4DO9 A;  4B9N A;  3MFH A;  4Y2P A;  4QZ9 A;  2G08 A;  2W54 A;  1D9D A;  4I0U A;  4X4T A;  4JMU A;  4QZA A;  3D2Q A;  5KFE A;  3K75 D;  4TUR A;  4MEX A;  5HHH A;  1NI3 A;  2XGQ A;  5HRG A;  3H4B A;  3LK9 A;  2MU2 A;  1BNO A;  5HRB A;  2W11 A;  4NJ8 A;  1A0P A;  5ALS A;  7ICN A;  3ZDA A;  1T4G A;  4CF5 A;  4ZH4 A;  3ZDB A;  3O0F A;  4F4Z A;  5EE3 A;  7ICU A;  1CI4 A;  3PX6 A;  4IG8 A;  5G5H A;  4UB6 U;  3JPT A;  1A77 A;  5AKH A;  4DFP A;  5HRK A;  2C22 A;  2GLE A;  4NKU A;  5KG2 A;  3TAN A;  4KN4 A;  2ZTE A;  4EBJ A;  1D8Y A;  5ALQ A;  2BCR A;  4O5E A;  1IM4 A;  4P0Q A;  4IRC A;  3H3A A;  4DEZ A;  4QZ8 A;  3MR5 A;  1L3S A;  5ALG A;  5AKY A;  1RPL A;  5TIS U;  4OAG A;  2VIX A;  2JGA A;  2D8C A;  5CFU A;  4J9Q A;  2Y0S C;  3BQ0 A;  4E80 A;  5L1L A;  4UB2 A;  4QWB A;  3NRZ A;  5J2F A;  3UXP A;  4EBD A;  4ATB A;  4DFJ A;  5F3X B;  5AIC A;  4DQI A;  4F2R A;  3IRU A;  7ICQ A;  3AQN A;  1WYG A;  4B9M A;  1QLN A;  7ICT A;  3C5G A;  1X2I A;  2M0N A;  2EH9 A;  7ICJ A;  3PW0 A;  4UB1 A;  2GA9 D;  2ZG6 A;  4PGY A;  8ICW A;  3H0L B;  4YCX A;  4P0P B;  3V7L A;  4PGQ A;  5KFQ A;  1MC8 A;  3AQF A;  4EEK A;  4K98 A;  3C18 A;  2ZH4 A;  2LYH A;  1TFY A;  2ID1 A;  3WK7 A;  7ICG A;  2FCL A;  3CW2 C;  2KSO A;  2WF5 A;  2EAO A;  2R8G A;  2M2W A;  1Z4O A;  1V38 A;  9ICT A;  2DKX A;  3ZDC A;  5L1J A;  3B9J A;  2UVV A;  4QWE A;  2G07 A;  3PSI A;  2I5H A;  3KKA A;  3MBY A;  1WWV A;  5CEH A;  1L8L A;  2L5Y A;  2BGW A;  2XGP A;  3BQ2 A;  3GQC A;  3C29 A;  4JLZ A;  3QEB Z;  3UM9 A;  4GXK A;  8ICM A;  2Y1J A;  3MGH A;  5DB9 A;  1XWL A;  4ECS A;  3T5K A;  4ELU A;  5EWG A;  1DK2 A;  4KMU A;  1L7M A;  2FPL A;  1JI7 A;  1CRX A;  3KHL A;  4Z6C A;  3EF2 A;  1BPZ A;  4JUZ A;  2LM1 A;  4NLK A;  1OW5 A;  3ISD A;  2Q0Z X;  4X4O A;  1RXW A;  1KRP A;  2DRB A;  3FDS A;  3BZC A;  4B9U A;  3OTQ A;  1ZQF A;  5CRX A;  8ICR A;  9ICX A;  4WOY A;  2F76 X;  3TFS A;  4QW9 A;  5JTI A;  4I2J A;  4U6P A;  1O03 A;  1L7P A;  1T8E A;  3B0X A;  1S8O A;  9ICA A;  5AM1 A;  3M9M B;  5L1I A;  2XY5 A;  1C7Y A;  2Z7J A;  1QSS A;  1QH9 A;  2H5X A;  4BJQ A;  2ISP A;  1NZB A;  5EE9 A;  5ALF A;  3NVV A;  3TAR A;  3PZP A;  3T5H A;  1MN8 A;  1TK0 A;  1Y88 A;  5HRH A;  2LYA A;  2VKQ A;  4NXW A;  2LM4 A;  3ER8 C;  4MHV A;  5B3Q A;  4UD4 A;  4F4K A;  4CGZ A;  4O5K A;  3RJI A;  5J0U A;  4PHP A;  5J8Y A;  2DQN B;  2ZH5 A;  4AYB C;  5KFA A;  4X4P A;  1Z3E B;  2IHM A;  3PW2 A;  9ICM A;  1DRG A;  3ONN A;  1R8B A;  5J2G A;  1ZQQ A;  1VJ5 A;  3FM9 A;  5AI6 A;  2HHS A;  3GU3 A;  1UET A;  3ZDE A;  3N7P D;  2ZTC A;  4P0Q B;  4IRK A;  1N62 A;  5J0X A;  2W3S A;  1KQQ A;  9ICN A;  2ZIW B;  1T7P A;  3E2E A;  4WC6 A;  3HWT A;  5KL1 B;  5AKE A;  4O3S A;  4FO1 A;  3FC4 A;  8ICC A;  1HJP A;  4IQU A;  1HIW A;  4MKP A;  3HJ4 A;  2K60 A;  1ZOL A;  4AT9 B;  1DOQ A;  2J6U A;  4I2C A;  3K1R B;  3WFR E;  3H0R B;  2EQY A;  2EDU A;  4DOA A;  1RXV A;  4Q44 A;  4DF4 A;  3GIK A;  5III A;  4PGX A;  3AMZ A;  4WC2 A;  4M9J A;  3EW9 A;  4JV1 A;  2F3N A;  3WKA A;  4UAY A;  3M9O B;  3QEA Z;  1R89 A;  2I9G A;  2XIC A;  1K5O A;  2KHQ A;  2BQR A;  2LMR A;  1M6Y A;  4DSF A;  3OJS A;  2ZIV A;  5J2E A;  1ZYQ A;  3KZI U;  1X9W A;  4K8V A;  4FZM A;  1VDV A;  2MA1 A;  2M2T A;  4M04 A;  1ZD2 P;  3NUQ A;  1WCL A;  3MFI A;  3OSP A;  1S5L U;  3N7S C;  1ZQ1 C;  5L9X A;  4YN4 A;  3T3F A;  3LVV A;  2OXO A;  4F5Q A;  4RQ4 A;  2PMZ F;  4KLE A;  2QKQ A;  3L5K A;  1SGG A;  2DRA A;  1KW4 A;  1HUZ A;  1S0V A;  4QIW C;  1JX4 A;  1Q3U A;  5DG7 A;  3SV3 A;  2HCF A;  2IOH A;  5HR7 A;  1SIJ A;  2ISO A;  2DR9 A;  3IV6 A;  1UPH A;  3C1Y A;  5KFK A;  4J9N A;  3RJG A;  2H3F A;  2ZJ5 A;  3OSN A;  4GIB A;  5IIK A;  4NLN A;  1EXN A;  1COK A;  9ICJ A;  4IC9 A;  4PPX A;  2MUT A;  4E7X A;  3D6J A;  1A76 A;  4M2Y A;  3ORY A;  3AU2 A;  5B66 U;  4P4M A;  4Q43 A;  4JV0 A;  1RG6 A;  2H3I A;  3WU2 U;  4X4S A;  1JRP A;  4GC6 A;  4YR2 A;  4AT8 A;  5ALY A;  3RB6 A;  3IHQ B;  3SEI A;  5J0S A;  1DXS A;  2XVT A;  7ICP A;  1URJ A;  4M9G A;  5KG0 A;  1S97 A;  1SKW A;  4FZN A;  1QQ6 A;  5CB1 A;  4F93 B;  4FHY A;  4UAW A;  4ECR A;  3H39 A;  4DLE A;  4JWM A;  4YMM A;  5IIN A;  4M47 A;  3RH6 A;  1S76 D;  1U9L A;  3OHA A;  1JRO A;  1X9M A;  2B56 A;  3OUY B;  3WK4 A;  2RP5 A;  1NKB A;  4YD2 A;  4LT6 A;  3RJK A;  2ZXH A;  3TKA A;  2M9N A;  1ZQM A;  4BWJ A;  2EZZ A;  3QZ7 A;  3SV4 A;  4ACO A;  2IHO A;  2PI5 A;  4C7Y A;  5KT4 A;  3JPS A;  2KVS A;  8ICV A;  4F4X A;  2D6F C;  3RJH A;  1UA0 A;  4DOC A;  2F2A B;  2NYV A;  3BJY A;  2XI9 A;  2M2V A;  4O6A A;  2YB1 A;  4ED7 A;  4DL6 A;  1SKS A;  4RQ2 A;  4M6W A;  4R8U B;  4RQN A;  4M5D A;  4KM5 A;  1J2N A;  5DEC A;  4F4Y A;  4WH5 A;  4ED8 A;  2H3Q A;  3G6Y A;  4UD5 A;  1VFG A;  2WF6 A;  1X9X A;  1YT3 A;  2ZUC A;  4KLF A;  2HI0 A;  2BHN A;  4WQK A;  4Z6D A;  3E58 A;  4KLO A;  1ECW A;  3PNC A;  3H37 A;  2BDU A;  3HKZ C;  4RT3 A;  4RU9 A;  4IR1 A;  1QTM A;  4DQQ A;  2KKV A;  4Y2T A;  5C0Y A;  4FE3 A;  3PMN A;  2R18 A;  4QWC A;  4O9M A;  2MSN A;  2YX8 A;  4B9T A;  3QU7 A;  1SL0 A;  5CJ7 A;  3MCR A;  2NRV A;  4OO1 J;  7ICV A;  3WKD A;  1X6I A;  3IG5 A;  4Q8F A;  4NM2 A;  5HML A;  1RM6 C;  3QX7 A;  4QWD A;  3Q8Q B;  3PW4 A;  2B0C A;  2Y9T A;  7ICS A;  3HW8 A;  2RDJ A;  4PHA A;  2QLT A;  2F1J A;  2NV3 A;  5AI0 A;  3RB3 A;  4ED2 A;  1NOM A;  1ED1 A;  3RFA A;  4XUS A;  5J0Q A;  2KFN A;  8ICU A;  3MDC A;  4WCW A;  4TUS A;  5CFT A;  1ZQS A;  4GXJ A;  2DPJ A;  1CUK A;  2JHD A;  5KFI A;  8ICP A;  1U47 A;  3N97 B;  4OAH A;  5J2I A;  4RWO A;  1A6S A;  5KT7 A;  4USA A;  2XCP A;  3Q8L A;  5AKI A;  1KFD A;  2JEJ A;  2MUT B;  3NAS A;  1MIV A;  1OUQ A;  2PI4 A;  3SMV A;  9ICR A;  4ED1 A;  5KFT A;  4G3I A;  1R8A A;  1C20 A;  4BDP A;  3QE9 Y;  2JZB B;  2W55 A;  1BPD A;  2C28 A;  2K89 A;  1N60 A;  4F71 A;  2UVU A;  9ICC A;  4X4R A;  1HUO A;  3CYM A;  4EZ9 A;  1BNP A;  3WKC A;  9ICO A;  4Z6E A;  3NKU A;  2BCS A;  5HHI A;  3UXO A;  2NRX A;  1N56 A;  4F4W A;  3H38 A;  4KLS A;  5T14 A;  4NXT A;  4KLT A;  2XO7 A;  2K4E A;  5AKZ A;  4PJ0 U;  3SEN A;  4I2A A;  2ZH8 A;  3M6Z A;  3SQI A;  2BPF A;  3FAH A;  4PH5 A;  3GV5 B;  1NK7 A;  3ER9 B;  3AN1 A;  4WC5 A;  3NVY A;  4RNM A;  5IIL A;  4QZI A;  2ESE A;  4K4H A;  5KFU A;  3PX4 A;  2KIC A;  7ICE A;  5KFD A;  3GIL A;  1Q8K A;  5KFF A;  2OM6 A;  5AHX A;  3SAG A;  8ICE A;  1Z1V A;  4EX7 A;  2AHO B;  3KHH A;  4NV0 A;  3ETR A;  4EX6 A;  3RTV A;  2HBM A;  2KTQ A;  4F2S A;  2ZUB A;  1JIH A;  1ZQZ A;  3ISB A;  2NRZ A;  4RZR A;  4X5V A;  5D63 A;  2WFA A;  3F5A A;  2BBH A;  3AQK A;  9ICQ A;  2NRW A;  4WC4 A;  4UBC A;  2ZHB A;  1ZET A;  1MIW A;  4O69 A;  1RQL A;  3DDH A;  1UT8 A;  4XJE A;  3WK9 A;  5KFG A;  2A1J A;  1ZQE A;  1QSL A;  3PML A;  2ZH2 A;  4HAI A;  4DL4 A;  2V4Q A;  2ASD A;  1SZH A;  4J9R A;  3DV9 A;  4C8K A;  4Y2U A;  4ECY A;  5KG4 A;  1KFS A;  1ZQX A;  1YZ6 A;  3RJF A;  1KNY A;  2Q4T A;  5KFY A;  2B4V A;  1XC9 A;  2ZH3 A;  5KFB A;  2YY6 A;  4CRX A;  3I1Y A;  2K8B B;  2G0A A;  3UQ2 A;  1JXL A;  1N5X A;  2FDR A;  3HIY A;  4QZD A;  2CN1 A;  1ZQI A;  4QZH A;  2BE3 A;  4OJO A;  2BR0 A;  5F9N A;  3PVX A;  2R8I A;  4RQ6 A;  4DFM A;  5KT6 A;  2KJ5 A;  4O0I A;  4RWP A;  1QQ5 A;  2K4P A;  4DSE A;  2AGP A;  4DL5 A;  5F9L A;  3TAC B;  2HHQ A;  2VAN A;  4C8L A;  4FBT A;  1LVH A;  4MF8 A;  4YQW A;  4DCC A;  2Q66 A;  4X0B A;  4RNO A;  3H4D A;  4FH5 A;  8ICI A;  4QZC A;  1MSW D;  1KDH A;  4CF4 A;  2ZIX A;  5HRF A;  2HOF A;  3LWL A;  4LZG A;  4KLQ A;  2Y0S F;  3A0B U;  3BZK A;  1YLQ A;  2W7O A;  2B6G A;  2B51 A;  4RNN A;  3NVZ A;  5KG1 A;  2RQ5 A;  5AM5 A;  1LV5 A;  3QU5 A;  4OJP A;  5CHG A;  4UB8 U;  4F5N A;  3PR4 A;  2PFQ A;  5J29 A;  4FBU A;  4PHD A;  2KV2 A;  5ALP A;  1SWV A;  4CF3 A;  3AUO A;  3IP4 B;  4BWM A;  5AI9 A;  3ERC C;  3TAD A;  4F5R A;  4US9 A;  1NKE A;  4WC1 A;  3JPQ A;  5J0O A;  3ICX A;  4IL6 U;  4QJF B;  1N48 A;  1K1S A;  3KBB A;  5GTI U;  3GZF A;  2DVI A;  2K4I A;  2PFO A;  2EZY A;  1K1Q A;  1IG6 A;  5DED A;  4O5C A;  2JH1 A;  5DB8 A;  4UAU A;  2DR5 A;  3MR3 A;  3JCF A;  1V85 A;  5HRD A;  4ECX A;  3GII A;  5DGA A;  2A3V A;  2YB4 A;  2DKZ A;  4EYI B;  3CNH A;  3UPS A;  1O08 A;  1R8C A;  2BPC A;  4WC7 A;  3UXN A;  2G09 A;  4IQT A;  5KAF U;  2QAR A;  2ZH9 A;  4F72 A;  5FP0 A;  2C2R A;  9ICK A;  1LKY B;  3MR2 A;  2E5S A;  4P4P A;  2AH5 A;  2LHT A;  4B6J A;  3N4M B;  4IQW A;  2O6K A;  8ICY A;  2RHF A;  3E0F A;  1U48 A;  4FS2 A;  2XID A;  3SYZ A;  3B0Y A;  1ZQL A;  3SD7 A;  2ZIV B;  5KFR A;  3H0M B;  1XS9 D;  1KLN A;  1LKY A;  1L3U A;  5ALH A;  3C28 A;  4YR0 A;  3RJE A;  4HX0 A;  2P6R A;  2ES6 A;  4I2D A;  4CE6 A;  5D61 A;  1S0N A;  4O3O A;  5EE0 A;  4QWA A;  2KZZ A;  3V6J A;  2JEI A;  5HRL A;  2KK0 A;  2DF4 B;  3TQ1 A;  4P4O A;  4NLG A;  2G5H B;  1SXE A;  4DSK A;  3Q8M A;  3PR5 B;  5D62 A;  5KG7 A;  5KFW A;  3KHG A;  2PXI A;  4MFA A;  2XCA A;  1GPJ A;  8ICX A;  2ODG A;  3EUB 2;  4YXJ A;  4IR9 A;  4EBK A;  1VLB A;  1Z00 A;  4IRD A;  4ELT A;  7ICH A;  9ICB A;  2KHV A;  1HEK A;  1KN5 A;  4JWN A;  1ZRN A;  2WF7 A;  3H8W A;  4R63 A;  2FPM A;  2FLP A;  3MC1 A;  4PL2 A;  2XY7 A;  2WB1 F;  4O3M A;  4IS7 A;  5ALN A;  4ZOH C;  4DS4 A;  1MQ2 A;  2HBL A;  2ZTD A;  2W9C B;  3MDA A;  4E8F A;  2WF8 A;  4O67 A;  4NLC A;  3VCB A;  4CNQ A;  3ZI4 A;  3MR6 A;  3QUC A;  1RQN A;  9ICU A;  1UCV A;  3K4G A;  4AT7 A;  1CEZ A;  9ICP A;  2KMD A;  3N28 A;  3WKE A;  5AKL A;  4NXX A;  3KTQ A;  3I76 A;  4FFD A;  2F44 A;  3OGU A;  2ZIX B;  4WQL A;  4KLD A;  3OHB A;  2W9B B;  4CDG A;  2KFZ A;  3M8R A;  4B9S A;  4Y2R A;  1PK3 A;  2KN7 A;  4ECV A;  5BPC A;  3TFR A;  2RLT A;  3M1Y A;  4EP7 A;  1TAU A;  2W8L A;  3LWM A;  4DL7 A;  3NRW A;  2JMG A;  1ZQW A;  3WKB A;  1ZD5 A;  2JRZ A;  2W9B A;  3BS5 A;  5J2D A;  3G6X A;  3ED5 A;  3D2N A;  5K4L A;  1QCK A;  2OWO A;  1NK6 A;  4O3R A;  1X40 A;  5J0T A;  4FO6 A;  5D4B A;  2HVI A;  5J2J A;  4K96 A;  5J2A A;  2WB1 C;  5TZV A;  3BS5 B;  1ZQK A;  2E8O A;  5AM2 A;  3KHR A;  1NK4 A;  4KLU A;  1JMS A;  2EWR A;  3AQL A;  1Q79 A;  1ZXI A;  4WBZ A;  3DEE A;  5KG6 A;  2KJ9 A;  9ICF A;  1NJZ A;  7ICF A;  4UB4 A;  2LYB A;  4YP3 A;  3RBD A;  9ICV A;  3QUT A;  4ED6 A;  2KZM A;  4UB3 A;  1ARO P;  1BPE A;  2HSZ A;  1PVP A;  2KNJ A;  2LBO A;  4GC7 A;  2HW3 A;  3K1Z A;  4FS1 A;  4I29 A;  1Q78 A;  5B5E U;  3OPX A;  4UAS A;  2HMX A;  3L4P A;  1SWW A;  2KIV A;  2VJ4 A;  2A1A A;  1ZQR A;  2AGO A;  4UAT A;  2GWS A;  3TAQ A;  2P6U A;  1PZN A;  4YVZ A;  1BGX T;  2AJQ A;  3BQT A;  3AL0 B;  3HPO A;  5DDY A;  3C2L A;  4EEY A;  2W8K A;  4EEL A;  4C8O A;  2FPK A;  5GTH U;  1Z1B A;  4K4G A;  5AK5 A;  4DFD A;  1L3V A;  2FLL A;  2JXJ A;  3D2S A;  3AQM A;  3F5E A;  5JU5 A;  3EPG A;  1SL1 A;  2DWQ A;  4KIT B;  3HT3 A;  4M9H A;  2E8M A;  4WBY A;  4LJX A;  2OH2 A;  3JPN A;  4KLJ A;  5AIA A;  5J8Y C;  7ICL A;  5ALZ A;  2HHW A;  5AI4 A;  4I28 A;  4Y2Q A;  4HYK A;  3TAD C;  2LKY A; 
#chains in the Genus database with same CATH homology
 1N56 A;  3H8S A;  4F4W A;  3H38 A;  5L1J A;  4KLS A;  4DF8 A;  2A1J B;  2UVV A;  3TI0 A;  3ETL A;  4QWE A;  1XSL A;  4KLT A;  4FHW A;  2XO7 A;  5KFH A;  4YMO A;  1UT5 A;  4I2A A;  2ZH8 A;  1SL2 A;  4AT8 A;  4RWN A;  3MBY A;  2BPF A;  5KFZ A;  4J9L A;  3HX0 A;  2RDI A;  1NKC A;  2BGW A;  4PH5 A;  2XGP A;  3GIJ A;  3GV5 B;  2AU0 A;  1NK7 A;  3C2K A;  3BQ2 A;  3C1Z A;  3GFK B;  4FH3 A;  5EWF A;  1NK8 A;  4BXO A;  4WC5 A;  7ICM A;  3GQC A;  4RNM A;  4UB5 A;  4UAZ A;  5IIL A;  4QZI A;  3M9N B;  3RJJ A;  2IA6 A;  3NTU A;  4K4H A;  5KFU A;  3PX4 A;  4RQ7 A;  3QEB Z;  4GXK A;  5DB7 A;  8ICM A;  2Y1J A;  3MGH A;  1ZQN A;  5DB9 A;  5KFD A;  7ICE A;  3GIL A;  2FMQ A;  5KFF A;  1ZJN A;  1XWL A;  4ECS A;  3T5K A;  2JZB A;  3C21 A;  5EWG A;  4KMU A;  1Z00 B;  4ELU A;  1XU4 A;  8ICE A;  1DK2 A;  3KHH A;  2FPL A;  1ZJM A;  1U45 A;  4RUA A;  2BCQ A;  3QZ8 A;  3OJU A;  3RTV A;  3ZDD A;  2KTQ A;  4F2S A;  2ZUB A;  4E80 A;  1JIH A;  3JPO A;  1LB2 B;  1ZQZ A;  3KHL A;  4Z6C A;  3ISB A;  2NRZ A;  4RZR A;  4JUZ A;  4X5V A;  1BPZ A;  3Q8P B;  1ZQG A;  4C8N A;  3JYY A;  4NLK A;  3ISD A;  3AQK A;  2DR8 A;  4FHX A;  5KG3 A;  9ICQ A;  2NRW A;  2Q0Z X;  4I27 A;  4UBC A;  1V9P A;  8ICB A;  4WC4 A;  1ZET A;  1MIW A;  4X4O A;  2ZHB A;  3PW7 A;  1RXW A;  1KRP A;  2DRB A;  1UT8 A;  3FDS A;  4I2B A;  5KFG A;  2A1J A;  1ZQE A;  1QSL A;  9ICS A;  3PML A;  4B9U A;  1ZQF A;  2ZH2 A;  8ICR A;  4QW8 A;  1S10 A;  9ICX A;  2AQ0 A;  3TFS A;  5J0Y A;  4DL4 A;  5EWE A;  4B9V A;  2V4R A;  4QW9 A;  2V4Q A;  2ASD A;  4I2J A;  1B22 A;  1F5A A;  1BPX A;  1UEV A;  8ICT A;  3EZ5 A;  5DG9 A;  3RH4 A;  5HRE A;  3WFP A;  4F8R A;  1T8E A;  4J9R A;  3B0X A;  2BQU A;  9ICA A;  2ZH1 A;  1L5U A;  1XSN A;  1NK0 A;  4C8K A;  3M9M B;  4F50 A;  5KG4 A;  5L1I A;  4ECY A;  5HP4 A;  1KFS A;  2XY5 A;  2C2D A;  1ZQX A;  1C7Y A;  1QSS A;  2JEF A;  4DSJ A;  2H5X A;  4EBC A;  8ICG A;  3RJF A;  1KNY A;  3RR8 A;  2ZHA A;  2ISP A;  4O3Q A;  3GV8 B;  5HNK A;  2IHN A;  5KFY A;  3TAR A;  2BCU A;  1XC9 A;  9ICE A;  2ZH3 A;  1TKD A;  4NXZ A;  3T5H A;  1TK0 A;  5KFB A;  1Y88 A;  3PO4 A;  2J6T A;  8ICZ A;  5HRH A;  4F92 B;  1SKR A;  2RFF A;  3EYZ A;  4QZF A;  8ICN A;  4KLM A;  3UQ2 A;  1JXL A;  1RYS A;  3HIY A;  5JUM A;  4QZD A;  3GV7 B;  1S9F A;  4BGD A;  4F4K A;  4UD4 A;  1ZQI A;  4R65 A;  4QZH A;  2UVW A;  4FHV A;  4RPX A;  2BE3 A;  4O5K A;  3SZ2 A;  3RJI A;  2BR0 A;  1NK5 A;  5F9N A;  5J0U A;  4PHP A;  4Q45 A;  2NRT A;  4RQ6 A;  2R8I A;  4J9S A;  4DFM A;  3PVX A;  2ZH5 A;  5KT6 A;  5KFA A;  2MAX A;  4O0I A;  2W9A A;  4ECZ A;  1Z3E B;  1TVA A;  1X9S A;  4RWP A;  4DSE A;  3AU6 A;  2IHM A;  5BOL A;  5C5J A;  3PW2 A;  2AGP A;  9ICM A;  2PBE A;  4ECT A;  4DL5 A;  1R8B A;  5F9L A;  4AT7 B;  4P2H A;  5J2G A;  4BXO B;  1ZQQ A;  4F5P A;  2HHQ A;  7ICI A;  4LZD A;  8ICA A;  2VAN A;  2ZUD A;  2FMP A;  2O5A A;  2HHS A;  4RQ0 A;  4C8L A;  4FBT A;  4RQ3 A;  4RT2 A;  3ZDE A;  1UET A;  4MF8 A;  2R8K A;  4YQW A;  2ZTC A;  2Q66 A;  4X0B A;  5IIJ A;  4RNO A;  4IRK A;  3H4D A;  1L3T A;  8ICI A;  5HRI A;  4QZC A;  4FH5 A;  4X0A A;  1MSW D;  3H40 A;  1KDH A;  5J0X A;  2BDP A;  9ICN A;  5HRF A;  1T7P A;  3E2E A;  4WC6 A;  1ZQA A;  3HWT A;  1ZQH A;  3LWL A;  4LZG A;  3ZD8 A;  3RB4 A;  2AQ4 A;  4KLQ A;  3FYH A;  4X4U A;  4O3S A;  1Q78 A;  8ICC A;  1HJP A;  4IQU A;  5DQI A;  1S0M A;  4J9K A;  1YLQ A;  3HJ4 A;  2ZJ8 A;  1DK3 A;  4RNN A;  4S3N A;  3MAB A;  5KG1 A;  1LV5 A;  2R8J A;  5CHG A;  1S0O A;  4Q8E A;  4AT9 B;  1DOQ A;  4RPY A;  5DKW A;  4F5N A;  2J6U A;  4CCH A;  4I2C A;  1B43 A;  3PR4 A;  1ZQO A;  2IBK A;  3WFR E;  3OVA A;  2AGQ A;  2PFQ A;  4O3P A;  5J29 A;  4DOA A;  3ZD9 A;  4Q44 A;  1RXV A;  4DF4 A;  4FBU A;  4PHD A;  3GIK A;  4ATB B;  5III A;  4PGX A;  4WC2 A;  4KLG A;  4M9J A;  3EW9 A;  4JV1 A;  8ICL A;  3AUO A;  1V4A A;  4F91 B;  4UAY A;  2DR7 A;  4BWM A;  4NM1 A;  3H8J A;  3C5F A;  5HC9 A;  3NGD A;  2VA3 A;  4XQ7 A;  4GXI A;  8ICH A;  4F5R A;  5F2V O;  1NKE A;  3GIM A;  3JPQ A;  5J0O A;  4WC1 A;  3M9O B;  3QEA Z;  1R89 A;  1ZQP A;  2I9G A;  1N48 A;  1K1S A;  2BQR A;  2XC9 A;  2DVI A;  4EZ6 A;  4DSF A;  4YMN A;  2PFO A;  3OJS A;  1K1Q A;  4EBE A;  3TAP A;  4LVS A;  5J2E A;  5KFJ A;  5DED A;  1JXE A;  2VA2 A;  4ECQ A;  1ZYQ A;  1JAJ A;  1X9W A;  4MF2 A;  4O5C A;  5KTQ A;  5DB8 A;  2B21 A;  5DBB A;  2M2T A;  3MR3 A;  2DR5 A;  1BPY A;  4M04 A;  5HRD A;  2ZJA A;  1WCL A;  3MFI A;  3GII A;  4ECX A;  5DGA A;  3OSP A;  5J2K A;  5CWR A;  1TFR A;  3JPR A;  2ASL A;  4QZG A;  2HHP A;  4EYI B;  5L9X A;  4RQ1 A;  3WFO A;  5J0P A;  4YN4 A;  4XRH A;  3M8S A;  3T3F A;  3UPS A;  4AT8 B;  4F5Q A;  2V9W A;  4RQ4 A;  4FHP A;  3UQ0 A;  1R8C A;  4DSL A;  2BPC A;  4KLE A;  4WC7 A;  3OV7 A;  5KFO A;  5DGB A;  3UXN A;  9ICI A;  4IQT A;  2ZH9 A;  2F1I A;  3EWA A;  2FLN A;  4RUC A;  5DQH A;  3RRG A;  2HHU A;  2DRA A;  3C2M A;  2UVR A;  2C2R A;  1HUZ A;  2DFL A;  9ICK A;  7ICR A;  3V6K A;  2ZH6 A;  5BOM A;  4TQR A;  3HJ1 A;  3RAQ A;  1S0V A;  2I1Q A;  1D8L A;  1JX4 A;  5KFL A;  5DG7 A;  3SV3 A;  4K4I A;  7ICO A;  5DBA A;  8ICJ A;  3C66 A;  3WFS C;  5HMM A;  1IXR A;  2ISO A;  2DR9 A;  3MR2 A;  3RAX A;  4PHE A;  4P4P A;  4XA5 A;  4YD1 A;  4X4V A;  3C1Y A;  5KFK A;  4J9N A;  3N4M B;  4IQW A;  3RJG A;  8ICY A;  4TUP A;  2ZJ5 A;  1MQ3 A;  4M0A A;  4R66 A;  3OSN A;  5D49 A;  4FS2 A;  1U48 A;  3SYZ A;  3B0Y A;  5IIK A;  2W9M A;  3V7K A;  1ZQL A;  4ED3 A;  5KFR A;  4NLN A;  5DBC A;  1EXN A;  4MEY A;  3Q8S B;  2ALZ A;  1XS9 D;  5KFN A;  1L3U A;  1KLN A;  4PPX A;  9ICJ A;  2MUT A;  4YR0 A;  3RJE A;  4DOB A;  4ECU A;  2P6R A;  1NK9 A;  4E7X A;  1A76 A;  2KZ3 A;  4I2D A;  1S0N A;  3ORY A;  4O3O A;  2W9C A;  4QWA A;  3AU2 A;  1RZT A;  4M2Y A;  2KZZ A;  3V6J A;  5KFC A;  3C23 A;  2JEI A;  4P4M A;  4Q43 A;  1TK8 A;  3MGI A;  5HRL A;  4JV0 A;  8ICF A;  1KTQ A;  4J9O A;  3TQ1 A;  2BKE A;  4P4O A;  4NLG A;  4X4S A;  1ZQV A;  4J9M A;  2PFP A;  4GC6 A;  4YR2 A;  4DSK A;  9ICG A;  5L1K A;  1SZP A;  3PR5 B;  3RB6 A;  3Q8M A;  1U4B A;  3IHQ B;  5KG7 A;  1NJW A;  2J6S A;  5KFW A;  3KHG A;  3UPQ A;  2BQ3 A;  3PY8 A;  4KLH A;  4DQS A;  2PXI A;  4MFA A;  5J0S A;  3EPI A;  2HHX A;  2XCA A;  4NLZ A;  3BDP A;  4GLX A;  7ICP A;  8ICX A;  8ICK A;  4M9G A;  5KG0 A;  1S97 A;  3H7I A;  4R8U A;  1SKW A;  1KSP A;  4YXJ A;  3BQ1 A;  4IR9 A;  2NRK A;  5CA7 A;  5CB1 A;  4F93 B;  4MFF A;  4AT9 A;  4KN7 A;  4IRD A;  1Z00 A;  4FHY A;  4UAW A;  3PV8 A;  1NJY A;  3GDX A;  2BCV A;  4EBK A;  4ELT A;  3ISC A;  7ICH A;  9ICB A;  4ECR A;  4RPZ A;  4DS5 A;  2BPG A;  3H39 A;  4DLE A;  4DQR A;  2VA8 A;  4JWM A;  4YMM A;  5IIN A;  4M47 A;  2R8H A;  5KT3 A;  4JWN A;  4R64 A;  3T5L A;  3H8W A;  1ZQU A;  3RH6 A;  5J2H A;  1ZQJ A;  4M9L A;  4R63 A;  1U9L A;  3OHA A;  2FPM A;  3V6H A;  2FLP A;  1S76 D;  1X9M A;  2M2U A;  2JEG A;  3OUY B;  2XY7 A;  1TFW A;  1NKB A;  4IQV A;  4YD2 A;  3RRH A;  4ECW A;  3G6V A;  4O3N A;  2FMS A;  1S77 D;  1PX5 A;  4DLG A;  4LT6 A;  1BPB A;  3RJK A;  4KTQ A;  4DFK A;  1ZQY A;  8ICO A;  3L9D A;  1BVS A;  4C8M A;  3OVS A;  4DS4 A;  3THV A;  1MQ2 A;  3LQC B;  5D46 A;  2M9N A;  1ZQM A;  4E0D A;  1NZP A;  3PW5 A;  2ZTD A;  4BWJ A;  3QZ7 A;  2W9C B;  3SV4 A;  3OVB A;  3MDA A;  4EYH B;  2HHV A;  4E8F A;  4UBB A;  5KFM A;  2PI5 A;  5KT4 A;  3JPS A;  2XY6 A;  4YG2 A;  1ZQD A;  1H38 A;  4QZE A;  8ICV A;  1TAQ A;  9ICL A;  5DLG A;  3MR6 A;  4DSI A;  8ICS A;  4F4X A;  4M9N A;  3RJH A;  1JQR A;  3WFQ E;  1UA0 A;  4DOC A;  2Y1I A;  1QSY A;  9ICU A;  2C2E A;  3K4G A;  4I2H A;  5J0W A;  3BJY A;  4AT7 A;  1CEZ A;  9ICP A;  2M2V A;  1WCN A;  1WOT A;  4I2F A;  5J2B A;  4ED7 A;  4Z6F A;  4DL6 A;  4I2G A;  1SKS A;  4RQ2 A;  4M6W A;  4R8U B;  1ZQB A;  3KTQ A;  4M5D A;  1VJ7 A;  3RR7 A;  3T5J A;  4TUQ A;  1TV9 A;  3LDA A;  1TK5 A;  5KFP A;  5KFS A;  5IIM A;  1COO A;  5IIO A;  3OGU A;  4MFC A;  5DLF A;  9ICW A;  4NKT A;  5DEC A;  4F4Y A;  4WC0 A;  4KLD A;  4ED8 A;  3OHB A;  2W9B B;  3G6Y A;  4YXM A;  1D9F A;  4UD5 A;  2ATL A;  5KFX A;  2KFZ A;  5DB6 A;  4I2I A;  3M8R A;  4B9S A;  4JK1 A;  2KN7 A;  1VFG A;  3RB0 A;  4ECV A;  5BPC A;  3V72 A;  3TFR A;  1NJX A;  2ZUC A;  3IM1 A;  1T3N A;  4KLF A;  2BHN A;  4EP7 A;  5HR9 A;  1TAU A;  4Z6D A;  5CP2 A;  3HP6 A;  3LWM A;  2W8L A;  4KLO A;  2O1P A;  3JZ0 A;  4DL7 A;  4RQ5 A;  4DWI A;  7ICK A;  3RBE A;  4B9N A;  4DO9 A;  2DPI A;  4ELV A;  3PNC A;  3H37 A;  5J2C A;  1MIY A;  1KEJ A;  4RT3 A;  3MFH A;  4RU9 A;  1ZQW A;  4QZ9 A;  2ASJ A;  1D9D A;  4KLL A;  3JPP A;  4IR1 A;  1FA0 A;  1QTM A;  2W9B A;  4DQQ A;  5J2D A;  2WTF A;  3G6X A;  4X4T A;  3PX0 A;  4QZA A;  4DQP A;  5KFE A;  3K75 D;  5CR0 A;  4TUR A;  5HHH A;  4MEX A;  2HVH A;  2OWO A;  5HRG A;  2XGQ A;  8ICQ A;  1NK6 A;  3H4B A;  1JN3 A;  3PMN A;  3LK9 A;  4RWQ A;  1BNO A;  4O9M A;  4QWC A;  5DQG A;  5HRB A;  4O3R A;  4B9T A;  1SL0 A;  4XQ8 A;  5J0T A;  4FO6 A;  5CJ7 A;  5D4B A;  5J2J A;  2HVI A;  3ZDA A;  1T4G A;  7ICN A;  5J2A A;  2NRV A;  5TZV A;  7ICV A;  4ZH4 A;  3ZDB A;  4F4Z A;  4M6W B;  1ZQK A;  4Q8F A;  4NM2 A;  7ICU A;  1ZQT A;  4WC3 A;  3PX6 A;  5HML A;  3KHR A;  4IG8 A;  1NK4 A;  4KLU A;  1JMS A;  4QWD A;  1ZQC A;  3NYB A;  3JPT A;  3SI8 A;  3PO5 A;  3Q8R B;  1A77 A;  3Q8Q B;  4DFP A;  3PW4 A;  2C22 A;  5HRK A;  1KFT A;  4NKU A;  4TQS A;  1OU5 A;  3AQL A;  1Q79 A;  5KG2 A;  3TAN A;  7ICS A;  4KN4 A;  2ZTE A;  4WBZ A;  3HW8 A;  1D8Y A;  4EBJ A;  5KG6 A;  5EOZ A;  2RDJ A;  4KLI A;  4PHA A;  3RH5 A;  2BCR A;  2F1J A;  4O5E A;  1IM4 A;  1DGS A;  2P66 A;  9ICF A;  1NJZ A;  3RB3 A;  7ICF A;  4IRC A;  4UB4 A;  5KG5 A;  4ED2 A;  1NOM A;  3H3A A;  4DEZ A;  4YP3 A;  4QZ8 A;  3RBD A;  4RQ8 A;  4ED0 A;  3MR5 A;  9ICV A;  9ICH A;  1U49 A;  1L3S A;  5J0Q A;  4XUS A;  2PFN A;  5KT5 A;  2KFN A;  8ICU A;  3MDC A;  4WCW A;  3OUY A;  1RPL A;  5DG8 A;  4TUS A;  4UB3 A;  4ED6 A;  1XSP A;  1ZQS A;  1ARO P;  1BPE A;  4GXJ A;  2KZM A;  1RYR A;  1UEU A;  4GC7 A;  2DPJ A;  4F5O A;  1CUK A;  4J9Q A;  4DL3 A;  2HW3 A;  5KFI A;  3BQ0 A;  4FS1 A;  5L1L A;  4UB2 A;  4QWB A;  5J2F A;  4I29 A;  3V7J A;  1XO1 A;  2F1H A;  3UXP A;  5KFV A;  4EBD A;  1U47 A;  2IMW P;  4B9L A;  8ICP A;  4ATB A;  3N97 B;  4DFJ A;  4RWO A;  5J2I A;  3Q8K A;  4DQI A;  4F2R A;  5KT7 A;  7ICQ A;  3AQN A;  4B9M A;  1ZQR A;  2AGO A;  2GWS A;  3TAQ A;  1QLN A;  2XCP A;  7ICT A;  2P6U A;  1PZN A;  4YVZ A;  3Q8L A;  3C5G A;  1BGX T;  1X2I A;  2AJQ A;  3BQT A;  2HHT A;  7ICJ A;  3HPO A;  5DDY A;  3C2L A;  4EEY A;  3PW0 A;  1UA1 A;  1KFD A;  2W8K A;  4UB1 A;  4C8O A;  1NO5 A;  4QZB A;  2JEJ A;  2MUT B;  2FPK A;  4DL2 A;  5J0R A;  4K4G A;  4PGY A;  2KP7 A;  4YFK A;  1L3V A;  2FLL A;  4JV2 A;  4YCX A;  8ICW A;  1MIV A;  3AQM A;  4X4P A;  3V7L A;  2PI4 A;  3EPG A;  1SL1 A;  4J9P A;  4ED1 A;  5KFT A;  4KIT B;  9ICR A;  4PGQ A;  3HT3 A;  4G3I A;  1R8A A;  4M9H A;  5KFQ A;  5KT2 A;  5DDM A;  4X4Q A;  4NY8 A;  1MC8 A;  4BDP A;  3QE9 Y;  4F3O A;  2JZB B;  4WBY A;  3C18 A;  2ZH4 A;  1BPD A;  3JPN A;  4KLJ A;  2C28 A;  2ZH7 A;  2LYH A;  1TFY A;  2ID1 A;  7ICL A;  2UVU A;  9ICC A;  4X4R A;  1HUO A;  7ICG A;  4EZ9 A;  4X4N A;  2HHW A;  1BNP A;  4I28 A;  9ICO A;  4YR3 A;  4Z6E A;  2BCS A;  2R8G A;  5HHI A;  2M2W A;  3UXO A;  4UQG A;  9ICT A;  4HYK A;  4I2E A;  2NRX A;  3ZDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...