2RFFA

Crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
b'GMGKGKSAIESQIRMLKLAKEIVEEVASSFPNLEEVYIFGSRARGDYLDTSDIDILFVFKGIKEMNVFDRMYMVSRFIRGNVDYIVLDEGEKDRVKDKVLFWKREKGFVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotidyltransferase
publication title Crystal structure of a putative nucleotidyltransferase (NP_343093.1) from Sulfolobus solfataricus at 1.40 A resolution
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase
total genus 35
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2rffA00
4UB1A 8ICZA 4PGQA 4DOBA 4RQ7A 9ICPA 5J0RA 4E80A 8ICPA 8ICIA 4RQ6A 4KLFA 1R8CA 3WFPA 8ICQA 4QZCA 5EOZA 1ZQBA 4PH5A 2ZH4A 3OVBA 4KLIA 3ISBA 9ICAA 8ICCA 2ZH5A 4M2YA 5DB8A 3WFSC 4UB4A 1KNYA 1BPBA 5HRLA 1V4AA 7ICEA 3RJEA 4UBCA 3OGUA 4JWMA 8ICBA 5HRGA 3NYBA 4TUSA 4DO9A 1ZQCA 1ZQFA 5CWRA 3V7KA 1JQRA 4KLTA 1ZQGA 5J2CA 4WC5A 4PHDA 8ICJA 4TUQA 4X4RA 5DB6A 4RQ4A 2BE3A 1UEVA 1HUZA 7ICSA 3JPRA 3RH6A 4F5PA 3HW8A 4FH3A 1TV9A 1ZQYA 4WCWA 9ICJA 4IG8A 7ICPA 4X4OA 4QZ8A 2BCSA 4Z6CA 4RQ3A 3C66A 4P4MA 8ICRA 4I2IA 1OU5A 3C18A 1XSLA 3WFQE 4XQ7A 4LVSA 5IIKA 2ZHAA 1R8AA 4YD2A 4RQ2A 4KLLA 2DR7A 5DKWA 8ICLA 2PXIA 1ZQXA 2NRKA 3OVSA 3H39A 1ZQAA 1F5AA 7ICTA 5J2JA 1MQ3A 1ZQQA 2VANA 3AQNA 8ICYA 3TFSA 1PX5A 5D49A 4KLUA 3PMNA 9ICUA 2ZH1A 2O1PA 3ISCA 7ICJA 4KLDA 1TFWA 3JPOA 5CP2A 3RH4A 4AT9B 9ICRA 4I2AA 3JPSA 4DOCA 4IQWA 8ICOA 4DOAA 5DB7A 5HRBA 1ZQDA 4X4PA 4YD1A 5F2VO 4XRHA 4M9HA 4I2FA 4MFAA 2BPGA 9ICTA 4NLNA 7ICHA 4WC0A 3HJ4A 4FHYA 5J2HA 9ICIA 2PFOA 2ISOA 5HRHA 4FHXA 5J0OA 3MGIA 3MDAA 4K4HA 9ICEA 4QZEA 2FMSA 1KEJA 5HHHA 3H37A 4RWOA 4X4QA 3JYYA 5J2FA 3H38A 4X4TA 4F5OA 4ATBA 5J0SA 4RWPA 4AT8A 4QZAA 8ICSA 4EBJA 2ZH7A 5D46A 4RQ8A 4KLMA 5CHGA 4M5DA 4E8FA 3AUOA 1R8BA 5HRKA 3MGHA 4I2JA 4UAYA 1ZQKA 2DRAA 4LZGA 4F5QA 3UXNA 5IIMA 4WC4A 3ISDA 3AU2A 4UAWA 2GWSA 4TUPA 3HWTA 1BPZA 3B0XA 1JMSA 1RPLA 4LT6A 4PGYA 1BPEA 9ICVA 4AT9A 3L9DA 1ZQUA 4WC2A 4F5NA 9ICNA 2FMPA 3OUYB 2M2WA 1MIYA 4RWNA 5IIIA 5J0QA 4QZIA 3GDXA 3JPTA 2DR8A 4YMOA 4M9LA 9ICLA 4NY8A 4O5CA 4M0AA 9ICFA 5J0TA 3C2KA 1JN3A 2DR9A 3JZ0A 1ZQRA 8ICWA 4QZHA 5CA7A 1ZQWA 4YMMA 4RT3A 1VFGA 8ICEA 5DECA 5IIOA 2ZH6A 3AQLA 5DBAA 1ZJNA 3UXOA 4GXIA 5J2AA 4M9NA 4UB3A 1VJ7A 5CJ7A 2ID1A 5IINA 1ZQNA 8ICXA 1RZTA 4PHEA 4WBYA 5J2KA 2ZH9A 1ZQJA 3RJKA 4AT7B 4PHAA 5HR9A 4RPZA 4UB5A 5J0UA 1MIWA 3UQ2A 4XUSA 4WC1A 1NO5A 4RQ5A 3RJIA 2DR5A 4KLOA 2RFFA 4GXKA 2BCRA 4E7XA 5DB9A 2BCUA 7ICLA 9ICBA 8ICFA 1ZQPA 3WFRE 3MBYA 4FHVA 7ICVA 2Q66A 1Q79A 5J0PA 4QZGA 1ZQIA 2FMQA 4M04A 9ICCA 9ICMA 5DBCA 7ICMA 1MIVA 4I2CA 4WC7A 1BPYA 8ICAA 7ICIA 2DRBA 4NM2A 1BPXA 4I2HA 4YCXA 1Q78A 3UPSA 5HREA 4R65A 3C5FA 4QZBA 2M2VA 4JWNA 5BOMA 4X0AA 2ISPA 1ZQZA 4FH5A 8ICVA 4UD4A 2PFNA 5J2EA 5DDMA 7ICNA 4FHPA 4UAZA 3AU6A 4M47A 1BPDA 4NKTA 3C2LA 2IHMA 2W9MA 4S3NA 3AQMA 4X5VA 3C2MA 8ICTA 3UPQA 2O5AA 4GXJA 3WFOA 4I2BA 3AQKA 3HIYA 4QZ9A 4RT2A 4RQ1A 4QZFA 2ZHBA 3RJHA 7ICKA 1TFYA 4XA5A 4NXZA 9ICHA 2BCVA 7ICRA 4UD5A 3K75D 2PBEA 1ZQOA 4M9GA 1ZQTA 8ICKA 4I2DA 1ZQMA 4PPXA 5HRDA 4MFCA 1ZQHA 4KLGA 4XQ8A 3RJGA 5HHIA 2HHPA 5DDYA 4KLJA 5J2BA 4Z6EA 4WC3A 1ZQVA 4P4PA 4FHWA 8ICUA 4Z6FA 3PNCA 1KDHA 8ICNA 3TFRA 1XSNA 5D4BA 4PGXA 4PHPA 4UBBA 3OVAA 9ICQA 4O5KA 4UB2A 5J0YA 1HUOA 5IIJA 4IQUA 2DVIA 7ICOA 8ICHA 7ICUA 9ICGA 4X4VA 7ICFA 7ICGA 5DBBA 5DEDA 2BCQA 4I29A 2M2UA 4WC6A 1YLQA 4R64A 1R89A 4M9JA 3V7JA 1ZQEA 4RWQA 4O9MA 2ZH2A 3H3AA 1MQ2A 5J2IA 4KLSA 5HC9A 4EBKA 5BPCA 4IQTA 1XSPA 3V72A 4I2EA 4KLQA 4P4OA 4YN4A 4I27A 1JAJA 3HJ1A 5CR0A 3MDCA 4RPXA 2ZH8A 5J2GA 5J0XA 5J29A 4F5RA 3JPQA 1WOTA 4IQVA 4TURA 9ICKA 3RJFA 3RJJA 4O5EA 3V7LA 2M2TA 4ATBB 4Z6DA 4QZDA 4AT8B 5J0WA 4X4SA 3OUYA 4NLZA 2PFQA 3JPNA 3UXPA 8ICGA 4RQ0A 4KLHA 9ICXA 4X0BA 4I28A 2ZH3A 4X4UA 5CB1A 5HRIA 3RH5A 4MFFA 1ZJMA 3LK9A 3OV7A 3C5GA 8ICMA 4K4IA 4EP7A 4YMNA 3B0YA 5HRFA 4FO6A 2P66A 4WBZA 5TZVA 1ZQSA 4R66A 5J2DA 2BPFA 1TVAA 1UETA 3PMLA 4I2GA 9ICWA 1ZQLA 4X4NA 4NLKA 4LZDA 5BOLA 1FA0A 3HX0A 4RPYA 4P2HA 2I9GA 3UQ0A 3JPPA 2BPCA 3LQCB 4KLEA 2PFPA 4MF8A 1NOMA 4NM1A 4NKUA 4AT7A 4K4GA 9ICOA 7ICQA 4R63A 9ICSA 1UEUA 5IILA 4MF2A
chains in the Genus database with same CATH superfamily
4K97A 4WOYA 4UB1A 8ICZA 4PGQA 4DOBA 4RQ7A 9ICPA 5J0RA 4E80A 3CK6A 8ICPA 8ICIA 3NWIA 4RQ6A 4KLFA 1R8CA 3WFPA 8ICQA 4QZCA 5EOZA 1ZQBA 4PH5A 2ZH4A 3OVBA 4KLIA 3ISBA 4LEWA 9ICAA 4K8VA 8ICCA 4NXWA 4MKPA 2ZH5A 5D61A 5DB8A 4M2YA 3WFSC 4UB4A 1KNYA 1BPBA 5HRLA 1V4AA 7ICEA 3RJEA 4UBCA 4WH5A 3OGUA 4EEDA 4JWMA 8ICBA 5HRGA 2HN1A 3NYBA 4NXTA 4TUSA 4DO9A 1ZQCA 1ZQFA 5CWRA 3V7KA 1JQRA 4KLTA 1ZQGA 5J2CA 4WC5A 4PHDA 8ICJA 4TUQA 5D62A 4X4RA 5DB6A 3ER9B 4RQ4A 2BE3A 1UEVA 1HUZA 7ICSA 3JPRA 3RH6A 4F5PA 3HW8A 4FH3A 1TV9A 1ZQYA 4WCWA 9ICJA 4IG8A 7ICPA 4X4OA 3K7DA 4QZ8A 2BCSA 4Z6CA 4RQ3A 3C66A 4P4MA 8ICRA 4I2IA 1OU5A 3C18A 4NXUA 1XSLA 3WFQE 4XQ7A 3OWGA 4LVSA 5IIKA 2ZHAA 1R8AA 4YD2A 4RQ2A 4KLLA 2DR7A 5DKWA 8ICLA 2PXIA 1ZQXA 2NRKA 3OVSA 3ER8C 3H39A 5CFSA 1ZQAA 1F5AA 7ICTA 5J2JA 1MQ3A 1ZQQA 5JTGA 2FCLA 2VANA 3AQNA 4OAIZ 8ICYA 3TFSA 1PX5A 5D49A 4KLUA 3PMNA 9ICUA 2ZH1A 2O1PA 3ISCA 7ICJA 4KLDA 1TFWA 4OAFA 5CP2A 3JPOA 3RH4A 4AT9B 4EGWA 9ICRA 4I2AA 3JPSA 4DOCA 4IQWA 8ICOA 4LEVA 4DOAA 5DB7A 5HRBA 1ZQDA 4X4PA 4YD1A 5F2VO 4XRHA 4M9HA 4I2FA 4MFAA 2BPGA 9ICTA 4NLNA 7ICHA 4WC0A 4O67A 3HJ4A 4FHYA 5J2HA 9ICIA 2PFOA 2ISOA 5HRHA 4FHXA 5J0OA 3MGIA 3MDAA 4K9AA 4K4HA 9ICEA 3JCFA 4QZEA 4JLZA 2FMSA 1KEJA 5HHHA 4KM5A 3H37A 4RWOA 4X4QA 3JYYA 5J2FA 3H38A 4X4TA 4LEYA 4F5OA 4ATBA 5J0SA 4RWPA 4AT8A 4QZAA 4NXVA 4O6AA 8ICSA 4EBJA 2ZH7A 5D46A 4RQ8A 4KLMA 5CHGA 4M5DA 4E8FA 3AUOA 1R8BA 5HRKA 3MGHA 4I2JA 4UAYA 1ZQKA 2B4VA 2DRAA 4LZGA 2IHOA 4F5QA 2B56A 3UXNA 4HX0A 5IIMA 4WC4A 3AU2A 4UAWA 3ISDA 2GWSA 4TUPA 3HWTA 1BPZA 3B0XA 1JMSA 1RPLA 4LT6A 4OAHA 4PGYA 1BPEA 9ICVA 4AT9A 3L9DA 1ZQUA 4WC2A 4F5NA 9ICNA 2FMPA 3OUYB 2M2WA 1MIYA 4RWNA 5IIIA 5J0QA 4QZIA 3GDXA 3JPTA 4KB6A 2DR8A 4YMOA 4NXXA 4M9LA 9ICLA 4NY8A 4O5CA 4M0AA 9ICFA 5J0TA 3C2KA 1JN3A 2DR9A 3JZ0A 1ZQRA 8ICWA 4QZHA 5CA7A 1ZQWA 4YMMA 4RT3A 1VFGA 8ICEA 5DECA 5IIOA 4O69A 2ZH6A 3AQLA 4WQLA 5DBAA 1ZJNA 3UXOA 4GXIA 5J2AA 4M9NA 4UB3A 1VJ7A 5CJ7A 2ID1A 5IINA 1ZQNA 8ICXA 4N7RA 5B3QA 4PHEA 1RZTA 2GA9D 4WBYA 5J2KA 2ZH9A 1ZQJA 3RJKA 4AT7B 4PHAA 5HR9A 4RPZA 4UB5A 5J0UA 1MIWA 3UQ2A 4K99A 4XUSA 2EWRA 4WC1A 1NO5A 4RQ5A 3RJIA 2DR5A 4KLOA 2RFFA 4GXKA 2BCRA 4E7XA 5CHEA 5DB9A 2BCUA 7ICLA 9ICBA 8ICFA 1ZQPA 4O68A 3WFRE 3MBYA 4FHVA 7ICVA 2Q66A 1Q79A 4EV6A 5J0PA 4QZGA 1ZQIA 2FMQA 4M04A 9ICCA 9ICMA 5DBCA 7ICMA 1MIVA 4I2CA 4WC7A 1BPYA 8ICAA 7ICIA 2DRBA 4NM2A 1BPXA 4I2HA 4YCXA 3ERCC 1Q78A 3UPSA 5HREA 4R65A 3C5FA 4QZBA 2M2VA 4JWNA 5BOMA 4X0AA 2ISPA 1ZQZA 2BBHA 4FH5A 8ICVA 4UD4A 5CFTA 2PFNA 5J2EA 5DDMA 7ICNA 4FHPA 4UAZA 3AU6A 4M47A 1BPDA 4NKTA 3C2LA 2IHMA 2W9MA 4S3NA 3AQMA 4X5VA 3C2MA 8ICTA 3UPQA 2O5AA 4GXJA 3WFOA 4I2BA 3AQKA 3HIYA 4QZ9A 4RT2A 4RQ1A 4QZFA 2ZHBA 3RJHA 7ICKA 1TFYA 4XA5A 4NXZA 9ICHA 2BCVA 7ICRA 4UD5A 3K75D 2PBEA 1ZQOA 4M9GA 1ZQTA 8ICKA 4I2DA 1ZQMA 4PPXA 5HRDA 4MFCA 1ZQHA 4KLGA 4XQ8A 3RJGA 5HHIA 2HHPA 5DDYA 4KLJA 5J2BA 4Z6EA 4WC3A 1ZQVA 4P4PA 4FHWA 8ICUA 4Z6FA 3PNCA 1KDHA 8ICNA 3TFRA 1XSNA 5D4BA 4PGXA 3EF2A 4PHPA 4UBBA 3OVAA 9ICQA 4O5KA 4UB2A 5J0YA 1HUOA 5IIJA 4IQUA 2DVIA 7ICOA 8ICHA 7ICUA 9ICGA 4X4VA 7ICFA 7ICGA 4EEBA 5DBBA 5DEDA 2BCQA 4I29A 2M2UA 4WC6A 1YLQA 4R64A 1R89A 4M9JA 3V7JA 4K96A 4XJEA 1ZQEA 4RWQA 4O9MA 2ZH2A 3H3AA 4K98A 1MQ2A 5J2IA 2HN2A 1GPJA 4KLSA 5CFUA 5HC9A 4EBKA 5BPCA 3MCRA 3NKUA 4IQTA 1XSPA 3V72A 4I2EA 4KLQA 4P4OA 4YN4A 4I27A 1JAJA 3HJ1A 5CR0A 3MDCA 2IUBA 4RPXA 2ZH8A 5J2GA 5J0XA 5J29A 4F5RA 3JPQA 1WOTA 4IQVA 4TURA 9ICKA 3NVOA 3RJFA 3RJJA 4O5EA 5D63A 3V7LA 2M2TA 4FO1A 4ATBB 4Z6DA 4QZDA 4AT8B 5J0WA 4X4SA 4JLXA 3OUYA 4NLZA 2PFQA 3JPNA 3UXPA 8ICGA 4RQ0A 4KLHA 4LEZA 9ICXA 4X0BA 4I28A 2ZH3A 4X4UA 5CB1A 5HRIA 3RH5A 4MFFA 1ZJMA 3LK9A 3OV7A 3C5GA 4I0UA 8ICMA 4K4IA 4EP7A 4YMNA 3B0YA 5HRFA 4K9BA 4FO6A 2P66A 4WBZA 5TZVA 1ZQSA 2B51A 4R66A 5J2DA 2BPFA 1TVAA 1UETA 3PMLA 4I2GA 9ICWA 1ZQLA 4X4NA 4NLKA 4LZDA 2GAFD 5BOLA 1FA0A 3PHZA 3HX0A 4RPYA 5B3PA 4P2HA 2I9GA 3UQ0A 3JPPA 2BPCA 4WQKA 3LQCB 4KLEA 2PFPA 2BBJA 4MF8A 1NOMA 4NM1A 4NKUA 4AT7A 4K4GA 9ICOA 4OAGA 4R63A 9ICSA 7ICQA 1UEUA 5IILA 4MF2A
chains in the Genus database with same CATH topology
4UB1A 8ICZA 4PGQA 4DOBA 4RQ7A 9ICPA 5J0RA 4E80A 8ICPA 8ICIA 4RQ6A 4KLFA 1R8CA 3WFPA 8ICQA 4QZCA 5EOZA 1ZQBA 4PH5A 2ZH4A 3OVBA 4KLIA 3ISBA 9ICAA 8ICCA 2ZH5A 4M2YA 5DB8A 3WFSC 4UB4A 1KNYA 1BPBA 5HRLA 1V4AA 7ICEA 3RJEA 4UBCA 3OGUA 4JWMA 8ICBA 5HRGA 3NYBA 4TUSA 4DO9A 1ZQCA 1ZQFA 5CWRA 3V7KA 1JQRA 4KLTA 1ZQGA 5J2CA 4WC5A 4PHDA 8ICJA 4TUQA 4X4RA 5DB6A 4RQ4A 2BE3A 1UEVA 1HUZA 7ICSA 3JPRA 3RH6A 4F5PA 3HW8A 4FH3A 1TV9A 1ZQYA 4WCWA 9ICJA 4IG8A 7ICPA 4X4OA 4QZ8A 2BCSA 4Z6CA 4RQ3A 3C66A 4P4MA 8ICRA 4I2IA 1OU5A 3C18A 1XSLA 3WFQE 4XQ7A 4LVSA 5IIKA 2ZHAA 1R8AA 4YD2A 4RQ2A 4KLLA 2DR7A 5DKWA 8ICLA 2PXIA 1ZQXA 2NRKA 3OVSA 3H39A 1ZQAA 1F5AA 7ICTA 5J2JA 1MQ3A 1ZQQA 2VANA 3AQNA 8ICYA 3TFSA 1PX5A 5D49A 4KLUA 3PMNA 9ICUA 2ZH1A 2O1PA 3ISCA 7ICJA 4KLDA 1TFWA 3JPOA 5CP2A 3RH4A 4AT9B 9ICRA 4I2AA 3JPSA 4DOCA 4IQWA 8ICOA 4DOAA 5DB7A 5HRBA 1ZQDA 4X4PA 4YD1A 5F2VO 4XRHA 4M9HA 4I2FA 4MFAA 2BPGA 9ICTA 4NLNA 7ICHA 4WC0A 3HJ4A 4FHYA 5J2HA 9ICIA 2PFOA 2ISOA 5HRHA 4FHXA 5J0OA 3MGIA 3MDAA 4K4HA 9ICEA 4QZEA 2FMSA 1KEJA 5HHHA 3H37A 4RWOA 4X4QA 3JYYA 5J2FA 3H38A 4X4TA 4F5OA 4ATBA 5J0SA 4RWPA 4AT8A 4QZAA 8ICSA 4EBJA 2ZH7A 5D46A 4RQ8A 4KLMA 5CHGA 4M5DA 4E8FA 3AUOA 1R8BA 5HRKA 3MGHA 4I2JA 4UAYA 1ZQKA 2DRAA 4LZGA 4F5QA 3UXNA 5IIMA 4WC4A 3ISDA 3AU2A 4UAWA 2GWSA 4TUPA 3HWTA 1BPZA 3B0XA 1JMSA 1RPLA 4LT6A 4PGYA 1BPEA 9ICVA 4AT9A 3L9DA 1ZQUA 4WC2A 4F5NA 9ICNA 2FMPA 3OUYB 2M2WA 1MIYA 4RWNA 5IIIA 5J0QA 4QZIA 3GDXA 3JPTA 2DR8A 4YMOA 4M9LA 9ICLA 4NY8A 4O5CA 4M0AA 9ICFA 5J0TA 3C2KA 1JN3A 2DR9A 3JZ0A 1ZQRA 8ICWA 4QZHA 5CA7A 1ZQWA 4YMMA 4RT3A 1VFGA 8ICEA 5DECA 5IIOA 2ZH6A 3AQLA 5DBAA 1ZJNA 3UXOA 4GXIA 5J2AA 4M9NA 4UB3A 1VJ7A 5CJ7A 2ID1A 5IINA 1ZQNA 8ICXA 1RZTA 4PHEA 4WBYA 5J2KA 2ZH9A 1ZQJA 3RJKA 4AT7B 4PHAA 5HR9A 4RPZA 4UB5A 5J0UA 1MIWA 3UQ2A 4XUSA 4WC1A 1NO5A 4RQ5A 3RJIA 2DR5A 4KLOA 2RFFA 4GXKA 2BCRA 4E7XA 5DB9A 2BCUA 7ICLA 9ICBA 8ICFA 1ZQPA 3WFRE 3MBYA 4FHVA 7ICVA 2Q66A 1Q79A 5J0PA 4QZGA 1ZQIA 2FMQA 4M04A 9ICCA 9ICMA 5DBCA 7ICMA 1MIVA 4I2CA 4WC7A 1BPYA 8ICAA 7ICIA 2DRBA 4NM2A 1BPXA 4I2HA 4YCXA 1Q78A 3UPSA 5HREA 4R65A 3C5FA 4QZBA 2M2VA 4JWNA 5BOMA 4X0AA 2ISPA 1ZQZA 4FH5A 8ICVA 4UD4A 2PFNA 5J2EA 5DDMA 7ICNA 4FHPA 4UAZA 3AU6A 4M47A 1BPDA 4NKTA 3C2LA 2IHMA 2W9MA 4S3NA 3AQMA 4X5VA 3C2MA 8ICTA 3UPQA 2O5AA 4GXJA 3WFOA 4I2BA 3AQKA 3HIYA 4QZ9A 4RT2A 4RQ1A 4QZFA 2ZHBA 3RJHA 7ICKA 1TFYA 4XA5A 4NXZA 9ICHA 2BCVA 7ICRA 4UD5A 3K75D 2PBEA 1ZQOA 4M9GA 1ZQTA 8ICKA 4I2DA 1ZQMA 4PPXA 5HRDA 4MFCA 1ZQHA 4KLGA 4XQ8A 3RJGA 5HHIA 2HHPA 5DDYA 4KLJA 5J2BA 4Z6EA 4WC3A 1ZQVA 4P4PA 4FHWA 8ICUA 4Z6FA 3PNCA 1KDHA 8ICNA 3TFRA 1XSNA 5D4BA 4PGXA 4PHPA 4UBBA 3OVAA 9ICQA 4O5KA 4UB2A 5J0YA 1HUOA 5IIJA 4IQUA 2DVIA 7ICOA 8ICHA 7ICUA 9ICGA 4X4VA 7ICFA 7ICGA 5DBBA 5DEDA 2BCQA 4I29A 2M2UA 4WC6A 1YLQA 4R64A 1R89A 4M9JA 3V7JA 1ZQEA 4RWQA 4O9MA 2ZH2A 3H3AA 1MQ2A 5J2IA 4KLSA 5HC9A 4EBKA 5BPCA 4IQTA 1XSPA 3V72A 4I2EA 4KLQA 4P4OA 4YN4A 4I27A 1JAJA 3HJ1A 5CR0A 3MDCA 4RPXA 2ZH8A 5J2GA 5J0XA 5J29A 4F5RA 3JPQA 1WOTA 4IQVA 4TURA 9ICKA 3RJFA 3RJJA 4O5EA 3V7LA 2M2TA 4ATBB 4Z6DA 4QZDA 4AT8B 5J0WA 4X4SA 3OUYA 4NLZA 2PFQA 3JPNA 3UXPA 8ICGA 4RQ0A 4KLHA 9ICXA 4X0BA 4I28A 2ZH3A 4X4UA 5CB1A 5HRIA 3RH5A 4MFFA 1ZJMA 3LK9A 3OV7A 3C5GA 8ICMA 4K4IA 4EP7A 4YMNA 3B0YA 5HRFA 4FO6A 2P66A 4WBZA 5TZVA 1ZQSA 4R66A 5J2DA 2BPFA 1TVAA 1UETA 3PMLA 4I2GA 9ICWA 1ZQLA 4X4NA 4NLKA 4LZDA 5BOLA 1FA0A 3HX0A 4RPYA 4P2HA 2I9GA 3UQ0A 3JPPA 2BPCA 3LQCB 4KLEA 2PFPA 4MF8A 1NOMA 4NM1A 4NKUA 4AT7A 4K4GA 9ICOA 7ICQA 4R63A 9ICSA 1UEUA 5IILA 4MF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB1 A;  8ICZ A;  4PGQ A;  4DOB A;  4RQ7 A;  9ICP A;  5J0R A;  4E80 A;  8ICP A;  8ICI A;  4RQ6 A;  4KLF A;  1R8C A;  3WFP A;  8ICQ A;  4QZC A;  5EOZ A;  1ZQB A;  4PH5 A;  2ZH4 A;  3OVB A;  4KLI A;  3ISB A;  9ICA A;  8ICC A;  2ZH5 A;  4M2Y A;  5DB8 A;  3WFS C;  4UB4 A;  1KNY A;  1BPB A;  5HRL A;  1V4A A;  7ICE A;  3RJE A;  4UBC A;  3OGU A;  4JWM A;  8ICB A;  5HRG A;  3NYB A;  4TUS A;  4DO9 A;  1ZQC A;  1ZQF A;  5CWR A;  3V7K A;  1JQR A;  4KLT A;  1ZQG A;  5J2C A;  4WC5 A;  4PHD A;  8ICJ A;  4TUQ A;  4X4R A;  5DB6 A;  4RQ4 A;  2BE3 A;  1UEV A;  1HUZ A;  7ICS A;  3JPR A;  3RH6 A;  4F5P A;  3HW8 A;  4FH3 A;  1TV9 A;  1ZQY A;  4WCW A;  9ICJ A;  4IG8 A;  7ICP A;  4X4O A;  4QZ8 A;  2BCS A;  4Z6C A;  4RQ3 A;  3C66 A;  4P4M A;  8ICR A;  4I2I A;  1OU5 A;  3C18 A;  1XSL A;  3WFQ E;  4XQ7 A;  4LVS A;  5IIK A;  2ZHA A;  1R8A A;  4YD2 A;  4RQ2 A;  4KLL A;  2DR7 A;  5DKW A;  8ICL A;  2PXI A;  1ZQX A;  2NRK A;  3OVS A;  3H39 A;  1ZQA A;  1F5A A;  7ICT A;  5J2J A;  1MQ3 A;  1ZQQ A;  2VAN A;  3AQN A;  8ICY A;  3TFS A;  1PX5 A;  5D49 A;  4KLU A;  3PMN A;  9ICU A;  2ZH1 A;  2O1P A;  3ISC A;  7ICJ A;  4KLD A;  1TFW A;  3JPO A;  5CP2 A;  3RH4 A;  4AT9 B;  9ICR A;  4I2A A;  3JPS A;  4DOC A;  4IQW A;  8ICO A;  4DOA A;  5DB7 A;  5HRB A;  1ZQD A;  4X4P A;  4YD1 A;  5F2V O;  4XRH A;  4M9H A;  4I2F A;  4MFA A;  2BPG A;  9ICT A;  4NLN A;  7ICH A;  4WC0 A;  3HJ4 A;  4FHY A;  5J2H A;  9ICI A;  2PFO A;  2ISO A;  5HRH A;  4FHX A;  5J0O A;  3MGI A;  3MDA A;  4K4H A;  9ICE A;  4QZE A;  2FMS A;  1KEJ A;  5HHH A;  3H37 A;  4RWO A;  4X4Q A;  3JYY A;  5J2F A;  3H38 A;  4X4T A;  4F5O A;  4ATB A;  5J0S A;  4RWP A;  4AT8 A;  4QZA A;  8ICS A;  4EBJ A;  2ZH7 A;  5D46 A;  4RQ8 A;  4KLM A;  5CHG A;  4M5D A;  4E8F A;  3AUO A;  1R8B A;  5HRK A;  3MGH A;  4I2J A;  4UAY A;  1ZQK A;  2DRA A;  4LZG A;  4F5Q A;  3UXN A;  5IIM A;  4WC4 A;  3ISD A;  3AU2 A;  4UAW A;  2GWS A;  4TUP A;  3HWT A;  1BPZ A;  3B0X A;  1JMS A;  1RPL A;  4LT6 A;  4PGY A;  1BPE A;  9ICV A;  4AT9 A;  3L9D A;  1ZQU A;  4WC2 A;  4F5N A;  9ICN A;  2FMP A;  3OUY B;  2M2W A;  1MIY A;  4RWN A;  5III A;  5J0Q A;  4QZI A;  3GDX A;  3JPT A;  2DR8 A;  4YMO A;  4M9L A;  9ICL A;  4NY8 A;  4O5C A;  4M0A A;  9ICF A;  5J0T A;  3C2K A;  1JN3 A;  2DR9 A;  3JZ0 A;  1ZQR A;  8ICW A;  4QZH A;  5CA7 A;  1ZQW A;  4YMM A;  4RT3 A;  1VFG A;  8ICE A;  5DEC A;  5IIO A;  2ZH6 A;  3AQL A;  5DBA A;  1ZJN A;  3UXO A;  4GXI A;  5J2A A;  4M9N A;  4UB3 A;  1VJ7 A;  5CJ7 A;  2ID1 A;  5IIN A;  1ZQN A;  8ICX A;  1RZT A;  4PHE A;  4WBY A;  5J2K A;  2ZH9 A;  1ZQJ A;  3RJK A;  4AT7 B;  4PHA A;  5HR9 A;  4RPZ A;  4UB5 A;  5J0U A;  1MIW A;  3UQ2 A;  4XUS A;  4WC1 A;  1NO5 A;  4RQ5 A;  3RJI A;  2DR5 A;  4KLO A;  2RFF A;  4GXK A;  2BCR A;  4E7X A;  5DB9 A;  2BCU A;  7ICL A;  9ICB A;  8ICF A;  1ZQP A;  3WFR E;  3MBY A;  4FHV A;  7ICV A;  2Q66 A;  1Q79 A;  5J0P A;  4QZG A;  1ZQI A;  2FMQ A;  4M04 A;  9ICC A;  9ICM A;  5DBC A;  7ICM A;  1MIV A;  4I2C A;  4WC7 A;  1BPY A;  8ICA A;  7ICI A;  2DRB A;  4NM2 A;  1BPX A;  4I2H A;  4YCX A;  1Q78 A;  3UPS A;  5HRE A;  4R65 A;  3C5F A;  4QZB A;  2M2V A;  4JWN A;  5BOM A;  4X0A A;  2ISP A;  1ZQZ A;  4FH5 A;  8ICV A;  4UD4 A;  2PFN A;  5J2E A;  5DDM A;  7ICN A;  4FHP A;  4UAZ A;  3AU6 A;  4M47 A;  1BPD A;  4NKT A;  3C2L A;  2IHM A;  2W9M A;  4S3N A;  3AQM A;  4X5V A;  3C2M A;  8ICT A;  3UPQ A;  2O5A A;  4GXJ A;  3WFO A;  4I2B A;  3AQK A;  3HIY A;  4QZ9 A;  4RT2 A;  4RQ1 A;  4QZF A;  2ZHB A;  3RJH A;  7ICK A;  1TFY A;  4XA5 A;  4NXZ A;  9ICH A;  2BCV A;  7ICR A;  4UD5 A;  3K75 D;  2PBE A;  1ZQO A;  4M9G A;  1ZQT A;  8ICK A;  4I2D A;  1ZQM A;  4PPX A;  5HRD A;  4MFC A;  1ZQH A;  4KLG A;  4XQ8 A;  3RJG A;  5HHI A;  2HHP A;  5DDY A;  4KLJ A;  5J2B A;  4Z6E A;  4WC3 A;  1ZQV A;  4P4P A;  4FHW A;  8ICU A;  4Z6F A;  3PNC A;  1KDH A;  8ICN A;  3TFR A;  1XSN A;  5D4B A;  4PGX A;  4PHP A;  4UBB A;  3OVA A;  9ICQ A;  4O5K A;  4UB2 A;  5J0Y A;  1HUO A;  5IIJ A;  4IQU A;  2DVI A;  7ICO A;  8ICH A;  7ICU A;  9ICG A;  4X4V A;  7ICF A;  7ICG A;  5DBB A;  5DED A;  2BCQ A;  4I29 A;  2M2U A;  4WC6 A;  1YLQ A;  4R64 A;  1R89 A;  4M9J A;  3V7J A;  1ZQE A;  4RWQ A;  4O9M A;  2ZH2 A;  3H3A A;  1MQ2 A;  5J2I A;  4KLS A;  5HC9 A;  4EBK A;  5BPC A;  4IQT A;  1XSP A;  3V72 A;  4I2E A;  4KLQ A;  4P4O A;  4YN4 A;  4I27 A;  1JAJ A;  3HJ1 A;  5CR0 A;  3MDC A;  4RPX A;  2ZH8 A;  5J2G A;  5J0X A;  5J29 A;  4F5R A;  3JPQ A;  1WOT A;  4IQV A;  4TUR A;  9ICK A;  3RJF A;  3RJJ A;  4O5E A;  3V7L A;  2M2T A;  4ATB B;  4Z6D A;  4QZD A;  4AT8 B;  5J0W A;  4X4S A;  3OUY A;  4NLZ A;  2PFQ A;  3JPN A;  3UXP A;  8ICG A;  4RQ0 A;  4KLH A;  9ICX A;  4X0B A;  4I28 A;  2ZH3 A;  4X4U A;  5CB1 A;  5HRI A;  3RH5 A;  4MFF A;  1ZJM A;  3LK9 A;  3OV7 A;  3C5G A;  8ICM A;  4K4I A;  4EP7 A;  4YMN A;  3B0Y A;  5HRF A;  4FO6 A;  2P66 A;  4WBZ A;  5TZV A;  1ZQS A;  4R66 A;  5J2D A;  2BPF A;  1TVA A;  1UET A;  3PML A;  4I2G A;  9ICW A;  1ZQL A;  4X4N A;  4NLK A;  4LZD A;  5BOL A;  1FA0 A;  3HX0 A;  4RPY A;  4P2H A;  2I9G A;  3UQ0 A;  3JPP A;  2BPC A;  3LQC B;  4KLE A;  2PFP A;  4MF8 A;  1NOM A;  4NM1 A;  4NKU A;  4AT7 A;  4K4G A;  9ICO A;  7ICQ A;  4R63 A;  9ICS A;  1UEU A;  5IIL A;  4MF2 A; 
#chains in the Genus database with same CATH topology
 4K97 A;  4WOY A;  4UB1 A;  8ICZ A;  4PGQ A;  4DOB A;  4RQ7 A;  9ICP A;  5J0R A;  4E80 A;  3CK6 A;  8ICP A;  8ICI A;  3NWI A;  4RQ6 A;  4KLF A;  1R8C A;  3WFP A;  8ICQ A;  4QZC A;  5EOZ A;  1ZQB A;  4PH5 A;  2ZH4 A;  3OVB A;  4KLI A;  3ISB A;  4LEW A;  9ICA A;  4K8V A;  8ICC A;  4NXW A;  4MKP A;  2ZH5 A;  5D61 A;  5DB8 A;  4M2Y A;  3WFS C;  4UB4 A;  1KNY A;  1BPB A;  5HRL A;  1V4A A;  7ICE A;  3RJE A;  4UBC A;  4WH5 A;  3OGU A;  4EED A;  4JWM A;  8ICB A;  5HRG A;  2HN1 A;  3NYB A;  4NXT A;  4TUS A;  4DO9 A;  1ZQC A;  1ZQF A;  5CWR A;  3V7K A;  1JQR A;  4KLT A;  1ZQG A;  5J2C A;  4WC5 A;  4PHD A;  8ICJ A;  4TUQ A;  5D62 A;  4X4R A;  5DB6 A;  3ER9 B;  4RQ4 A;  2BE3 A;  1UEV A;  1HUZ A;  7ICS A;  3JPR A;  3RH6 A;  4F5P A;  3HW8 A;  4FH3 A;  1TV9 A;  1ZQY A;  4WCW A;  9ICJ A;  4IG8 A;  7ICP A;  4X4O A;  3K7D A;  4QZ8 A;  2BCS A;  4Z6C A;  4RQ3 A;  3C66 A;  4P4M A;  8ICR A;  4I2I A;  1OU5 A;  3C18 A;  4NXU A;  1XSL A;  3WFQ E;  4XQ7 A;  3OWG A;  4LVS A;  5IIK A;  2ZHA A;  1R8A A;  4YD2 A;  4RQ2 A;  4KLL A;  2DR7 A;  5DKW A;  8ICL A;  2PXI A;  1ZQX A;  2NRK A;  3OVS A;  3ER8 C;  3H39 A;  5CFS A;  1ZQA A;  1F5A A;  7ICT A;  5J2J A;  1MQ3 A;  1ZQQ A;  5JTG A;  2FCL A;  2VAN A;  3AQN A;  4OAI Z;  8ICY A;  3TFS A;  1PX5 A;  5D49 A;  4KLU A;  3PMN A;  9ICU A;  2ZH1 A;  2O1P A;  3ISC A;  7ICJ A;  4KLD A;  1TFW A;  4OAF A;  5CP2 A;  3JPO A;  3RH4 A;  4AT9 B;  4EGW A;  9ICR A;  4I2A A;  3JPS A;  4DOC A;  4IQW A;  8ICO A;  4LEV A;  4DOA A;  5DB7 A;  5HRB A;  1ZQD A;  4X4P A;  4YD1 A;  5F2V O;  4XRH A;  4M9H A;  4I2F A;  4MFA A;  2BPG A;  9ICT A;  4NLN A;  7ICH A;  4WC0 A;  4O67 A;  3HJ4 A;  4FHY A;  5J2H A;  9ICI A;  2PFO A;  2ISO A;  5HRH A;  4FHX A;  5J0O A;  3MGI A;  3MDA A;  4K9A A;  4K4H A;  9ICE A;  3JCF A;  4QZE A;  4JLZ A;  2FMS A;  1KEJ A;  5HHH A;  4KM5 A;  3H37 A;  4RWO A;  4X4Q A;  3JYY A;  5J2F A;  3H38 A;  4X4T A;  4LEY A;  4F5O A;  4ATB A;  5J0S A;  4RWP A;  4AT8 A;  4QZA A;  4NXV A;  4O6A A;  8ICS A;  4EBJ A;  2ZH7 A;  5D46 A;  4RQ8 A;  4KLM A;  5CHG A;  4M5D A;  4E8F A;  3AUO A;  1R8B A;  5HRK A;  3MGH A;  4I2J A;  4UAY A;  1ZQK A;  2B4V A;  2DRA A;  4LZG A;  2IHO A;  4F5Q A;  2B56 A;  3UXN A;  4HX0 A;  5IIM A;  4WC4 A;  3AU2 A;  4UAW A;  3ISD A;  2GWS A;  4TUP A;  3HWT A;  1BPZ A;  3B0X A;  1JMS A;  1RPL A;  4LT6 A;  4OAH A;  4PGY A;  1BPE A;  9ICV A;  4AT9 A;  3L9D A;  1ZQU A;  4WC2 A;  4F5N A;  9ICN A;  2FMP A;  3OUY B;  2M2W A;  1MIY A;  4RWN A;  5III A;  5J0Q A;  4QZI A;  3GDX A;  3JPT A;  4KB6 A;  2DR8 A;  4YMO A;  4NXX A;  4M9L A;  9ICL A;  4NY8 A;  4O5C A;  4M0A A;  9ICF A;  5J0T A;  3C2K A;  1JN3 A;  2DR9 A;  3JZ0 A;  1ZQR A;  8ICW A;  4QZH A;  5CA7 A;  1ZQW A;  4YMM A;  4RT3 A;  1VFG A;  8ICE A;  5DEC A;  5IIO A;  4O69 A;  2ZH6 A;  3AQL A;  4WQL A;  5DBA A;  1ZJN A;  3UXO A;  4GXI A;  5J2A A;  4M9N A;  4UB3 A;  1VJ7 A;  5CJ7 A;  2ID1 A;  5IIN A;  1ZQN A;  8ICX A;  4N7R A;  5B3Q A;  4PHE A;  1RZT A;  2GA9 D;  4WBY A;  5J2K A;  2ZH9 A;  1ZQJ A;  3RJK A;  4AT7 B;  4PHA A;  5HR9 A;  4RPZ A;  4UB5 A;  5J0U A;  1MIW A;  3UQ2 A;  4K99 A;  4XUS A;  2EWR A;  4WC1 A;  1NO5 A;  4RQ5 A;  3RJI A;  2DR5 A;  4KLO A;  2RFF A;  4GXK A;  2BCR A;  4E7X A;  5CHE A;  5DB9 A;  2BCU A;  7ICL A;  9ICB A;  8ICF A;  1ZQP A;  4O68 A;  3WFR E;  3MBY A;  4FHV A;  7ICV A;  2Q66 A;  1Q79 A;  4EV6 A;  5J0P A;  4QZG A;  1ZQI A;  2FMQ A;  4M04 A;  9ICC A;  9ICM A;  5DBC A;  7ICM A;  1MIV A;  4I2C A;  4WC7 A;  1BPY A;  8ICA A;  7ICI A;  2DRB A;  4NM2 A;  1BPX A;  4I2H A;  4YCX A;  3ERC C;  1Q78 A;  3UPS A;  5HRE A;  4R65 A;  3C5F A;  4QZB A;  2M2V A;  4JWN A;  5BOM A;  4X0A A;  2ISP A;  1ZQZ A;  2BBH A;  4FH5 A;  8ICV A;  4UD4 A;  5CFT A;  2PFN A;  5J2E A;  5DDM A;  7ICN A;  4FHP A;  4UAZ A;  3AU6 A;  4M47 A;  1BPD A;  4NKT A;  3C2L A;  2IHM A;  2W9M A;  4S3N A;  3AQM A;  4X5V A;  3C2M A;  8ICT A;  3UPQ A;  2O5A A;  4GXJ A;  3WFO A;  4I2B A;  3AQK A;  3HIY A;  4QZ9 A;  4RT2 A;  4RQ1 A;  4QZF A;  2ZHB A;  3RJH A;  7ICK A;  1TFY A;  4XA5 A;  4NXZ A;  9ICH A;  2BCV A;  7ICR A;  4UD5 A;  3K75 D;  2PBE A;  1ZQO A;  4M9G A;  1ZQT A;  8ICK A;  4I2D A;  1ZQM A;  4PPX A;  5HRD A;  4MFC A;  1ZQH A;  4KLG A;  4XQ8 A;  3RJG A;  5HHI A;  2HHP A;  5DDY A;  4KLJ A;  5J2B A;  4Z6E A;  4WC3 A;  1ZQV A;  4P4P A;  4FHW A;  8ICU A;  4Z6F A;  3PNC A;  1KDH A;  8ICN A;  3TFR A;  1XSN A;  5D4B A;  4PGX A;  3EF2 A;  4PHP A;  4UBB A;  3OVA A;  9ICQ A;  4O5K A;  4UB2 A;  5J0Y A;  1HUO A;  5IIJ A;  4IQU A;  2DVI A;  7ICO A;  8ICH A;  7ICU A;  9ICG A;  4X4V A;  7ICF A;  7ICG A;  4EEB A;  5DBB A;  5DED A;  2BCQ A;  4I29 A;  2M2U A;  4WC6 A;  1YLQ A;  4R64 A;  1R89 A;  4M9J A;  3V7J A;  4K96 A;  4XJE A;  1ZQE A;  4RWQ A;  4O9M A;  2ZH2 A;  3H3A A;  4K98 A;  1MQ2 A;  5J2I A;  2HN2 A;  1GPJ A;  4KLS A;  5CFU A;  5HC9 A;  4EBK A;  5BPC A;  3MCR A;  3NKU A;  4IQT A;  1XSP A;  3V72 A;  4I2E A;  4KLQ A;  4P4O A;  4YN4 A;  4I27 A;  1JAJ A;  3HJ1 A;  5CR0 A;  3MDC A;  2IUB A;  4RPX A;  2ZH8 A;  5J2G A;  5J0X A;  5J29 A;  4F5R A;  3JPQ A;  1WOT A;  4IQV A;  4TUR A;  9ICK A;  3NVO A;  3RJF A;  3RJJ A;  4O5E A;  5D63 A;  3V7L A;  2M2T A;  4FO1 A;  4ATB B;  4Z6D A;  4QZD A;  4AT8 B;  5J0W A;  4X4S A;  4JLX A;  3OUY A;  4NLZ A;  2PFQ A;  3JPN A;  3UXP A;  8ICG A;  4RQ0 A;  4KLH A;  4LEZ A;  9ICX A;  4X0B A;  4I28 A;  2ZH3 A;  4X4U A;  5CB1 A;  5HRI A;  3RH5 A;  4MFF A;  1ZJM A;  3LK9 A;  3OV7 A;  3C5G A;  4I0U A;  8ICM A;  4K4I A;  4EP7 A;  4YMN A;  3B0Y A;  5HRF A;  4K9B A;  4FO6 A;  2P66 A;  4WBZ A;  5TZV A;  1ZQS A;  2B51 A;  4R66 A;  5J2D A;  2BPF A;  1TVA A;  1UET A;  3PML A;  4I2G A;  9ICW A;  1ZQL A;  4X4N A;  4NLK A;  4LZD A;  2GAF D;  5BOL A;  1FA0 A;  3PHZ A;  3HX0 A;  4RPY A;  5B3P A;  4P2H A;  2I9G A;  3UQ0 A;  3JPP A;  2BPC A;  4WQK A;  3LQC B;  4KLE A;  2PFP A;  2BBJ A;  4MF8 A;  1NOM A;  4NM1 A;  4NKU A;  4AT7 A;  4K4G A;  9ICO A;  4OAG A;  4R63 A;  9ICS A;  7ICQ A;  1UEU A;  5IIL A;  4MF2 A; 
#chains in the Genus database with same CATH homology
 4UB1 A;  8ICZ A;  4PGQ A;  4DOB A;  4RQ7 A;  9ICP A;  5J0R A;  4E80 A;  8ICP A;  8ICI A;  4RQ6 A;  4KLF A;  1R8C A;  3WFP A;  8ICQ A;  4QZC A;  5EOZ A;  1ZQB A;  4PH5 A;  2ZH4 A;  3OVB A;  4KLI A;  3ISB A;  9ICA A;  8ICC A;  2ZH5 A;  4M2Y A;  5DB8 A;  3WFS C;  4UB4 A;  1KNY A;  1BPB A;  5HRL A;  1V4A A;  7ICE A;  3RJE A;  4UBC A;  3OGU A;  4JWM A;  8ICB A;  5HRG A;  3NYB A;  4TUS A;  4DO9 A;  1ZQC A;  1ZQF A;  5CWR A;  3V7K A;  1JQR A;  4KLT A;  1ZQG A;  5J2C A;  4WC5 A;  4PHD A;  8ICJ A;  4TUQ A;  4X4R A;  5DB6 A;  4RQ4 A;  2BE3 A;  1UEV A;  1HUZ A;  7ICS A;  3JPR A;  3RH6 A;  4F5P A;  3HW8 A;  4FH3 A;  1TV9 A;  1ZQY A;  4WCW A;  9ICJ A;  4IG8 A;  7ICP A;  4X4O A;  4QZ8 A;  2BCS A;  4Z6C A;  4RQ3 A;  3C66 A;  4P4M A;  8ICR A;  4I2I A;  1OU5 A;  3C18 A;  1XSL A;  3WFQ E;  4XQ7 A;  4LVS A;  5IIK A;  2ZHA A;  1R8A A;  4YD2 A;  4RQ2 A;  4KLL A;  2DR7 A;  5DKW A;  8ICL A;  2PXI A;  1ZQX A;  2NRK A;  3OVS A;  3H39 A;  1ZQA A;  1F5A A;  7ICT A;  5J2J A;  1MQ3 A;  1ZQQ A;  2VAN A;  3AQN A;  8ICY A;  3TFS A;  1PX5 A;  5D49 A;  4KLU A;  3PMN A;  9ICU A;  2ZH1 A;  2O1P A;  3ISC A;  7ICJ A;  4KLD A;  1TFW A;  3JPO A;  5CP2 A;  3RH4 A;  4AT9 B;  9ICR A;  4I2A A;  3JPS A;  4DOC A;  4IQW A;  8ICO A;  4DOA A;  5DB7 A;  5HRB A;  1ZQD A;  4X4P A;  4YD1 A;  5F2V O;  4XRH A;  4M9H A;  4I2F A;  4MFA A;  2BPG A;  9ICT A;  4NLN A;  7ICH A;  4WC0 A;  3HJ4 A;  4FHY A;  5J2H A;  9ICI A;  2PFO A;  2ISO A;  5HRH A;  4FHX A;  5J0O A;  3MGI A;  3MDA A;  4K4H A;  9ICE A;  4QZE A;  2FMS A;  1KEJ A;  5HHH A;  3H37 A;  4RWO A;  4X4Q A;  3JYY A;  5J2F A;  3H38 A;  4X4T A;  4F5O A;  4ATB A;  5J0S A;  4RWP A;  4AT8 A;  4QZA A;  8ICS A;  4EBJ A;  2ZH7 A;  5D46 A;  4RQ8 A;  4KLM A;  5CHG A;  4M5D A;  4E8F A;  3AUO A;  1R8B A;  5HRK A;  3MGH A;  4I2J A;  4UAY A;  1ZQK A;  2DRA A;  4LZG A;  4F5Q A;  3UXN A;  5IIM A;  4WC4 A;  3ISD A;  3AU2 A;  4UAW A;  2GWS A;  4TUP A;  3HWT A;  1BPZ A;  3B0X A;  1JMS A;  1RPL A;  4LT6 A;  4PGY A;  1BPE A;  9ICV A;  4AT9 A;  3L9D A;  1ZQU A;  4WC2 A;  4F5N A;  9ICN A;  2FMP A;  3OUY B;  2M2W A;  1MIY A;  4RWN A;  5III A;  5J0Q A;  4QZI A;  3GDX A;  3JPT A;  2DR8 A;  4YMO A;  4M9L A;  9ICL A;  4NY8 A;  4O5C A;  4M0A A;  9ICF A;  5J0T A;  3C2K A;  1JN3 A;  2DR9 A;  3JZ0 A;  1ZQR A;  8ICW A;  4QZH A;  5CA7 A;  1ZQW A;  4YMM A;  4RT3 A;  1VFG A;  8ICE A;  5DEC A;  5IIO A;  2ZH6 A;  3AQL A;  5DBA A;  1ZJN A;  3UXO A;  4GXI A;  5J2A A;  4M9N A;  4UB3 A;  1VJ7 A;  5CJ7 A;  2ID1 A;  5IIN A;  1ZQN A;  8ICX A;  1RZT A;  4PHE A;  4WBY A;  5J2K A;  2ZH9 A;  1ZQJ A;  3RJK A;  4AT7 B;  4PHA A;  5HR9 A;  4RPZ A;  4UB5 A;  5J0U A;  1MIW A;  3UQ2 A;  4XUS A;  4WC1 A;  1NO5 A;  4RQ5 A;  3RJI A;  2DR5 A;  4KLO A;  2RFF A;  4GXK A;  2BCR A;  4E7X A;  5DB9 A;  2BCU A;  7ICL A;  9ICB A;  8ICF A;  1ZQP A;  3WFR E;  3MBY A;  4FHV A;  7ICV A;  2Q66 A;  1Q79 A;  5J0P A;  4QZG A;  1ZQI A;  2FMQ A;  4M04 A;  9ICC A;  9ICM A;  5DBC A;  7ICM A;  1MIV A;  4I2C A;  4WC7 A;  1BPY A;  8ICA A;  7ICI A;  2DRB A;  4NM2 A;  1BPX A;  4I2H A;  4YCX A;  1Q78 A;  3UPS A;  5HRE A;  4R65 A;  3C5F A;  4QZB A;  2M2V A;  4JWN A;  5BOM A;  4X0A A;  2ISP A;  1ZQZ A;  4FH5 A;  8ICV A;  4UD4 A;  2PFN A;  5J2E A;  5DDM A;  7ICN A;  4FHP A;  4UAZ A;  3AU6 A;  4M47 A;  1BPD A;  4NKT A;  3C2L A;  2IHM A;  2W9M A;  4S3N A;  3AQM A;  4X5V A;  3C2M A;  8ICT A;  3UPQ A;  2O5A A;  4GXJ A;  3WFO A;  4I2B A;  3AQK A;  3HIY A;  4QZ9 A;  4RT2 A;  4RQ1 A;  4QZF A;  2ZHB A;  3RJH A;  7ICK A;  1TFY A;  4XA5 A;  4NXZ A;  9ICH A;  2BCV A;  7ICR A;  4UD5 A;  3K75 D;  2PBE A;  1ZQO A;  4M9G A;  1ZQT A;  8ICK A;  4I2D A;  1ZQM A;  4PPX A;  5HRD A;  4MFC A;  1ZQH A;  4KLG A;  4XQ8 A;  3RJG A;  5HHI A;  2HHP A;  5DDY A;  4KLJ A;  5J2B A;  4Z6E A;  4WC3 A;  1ZQV A;  4P4P A;  4FHW A;  8ICU A;  4Z6F A;  3PNC A;  1KDH A;  8ICN A;  3TFR A;  1XSN A;  5D4B A;  4PGX A;  4PHP A;  4UBB A;  3OVA A;  9ICQ A;  4O5K A;  4UB2 A;  5J0Y A;  1HUO A;  5IIJ A;  4IQU A;  2DVI A;  7ICO A;  8ICH A;  7ICU A;  9ICG A;  4X4V A;  7ICF A;  7ICG A;  5DBB A;  5DED A;  2BCQ A;  4I29 A;  2M2U A;  4WC6 A;  1YLQ A;  4R64 A;  1R89 A;  4M9J A;  3V7J A;  1ZQE A;  4RWQ A;  4O9M A;  2ZH2 A;  3H3A A;  1MQ2 A;  5J2I A;  4KLS A;  5HC9 A;  4EBK A;  5BPC A;  4IQT A;  1XSP A;  3V72 A;  4I2E A;  4KLQ A;  4P4O A;  4YN4 A;  4I27 A;  1JAJ A;  3HJ1 A;  5CR0 A;  3MDC A;  4RPX A;  2ZH8 A;  5J2G A;  5J0X A;  5J29 A;  4F5R A;  3JPQ A;  1WOT A;  4IQV A;  4TUR A;  9ICK A;  3RJF A;  3RJJ A;  4O5E A;  3V7L A;  2M2T A;  4ATB B;  4Z6D A;  4QZD A;  4AT8 B;  5J0W A;  4X4S A;  3OUY A;  4NLZ A;  2PFQ A;  3JPN A;  3UXP A;  8ICG A;  4RQ0 A;  4KLH A;  9ICX A;  4X0B A;  4I28 A;  2ZH3 A;  4X4U A;  5CB1 A;  5HRI A;  3RH5 A;  4MFF A;  1ZJM A;  3LK9 A;  3OV7 A;  3C5G A;  8ICM A;  4K4I A;  4EP7 A;  4YMN A;  3B0Y A;  5HRF A;  4FO6 A;  2P66 A;  4WBZ A;  5TZV A;  1ZQS A;  4R66 A;  5J2D A;  2BPF A;  1TVA A;  1UET A;  3PML A;  4I2G A;  9ICW A;  1ZQL A;  4X4N A;  4NLK A;  4LZD A;  5BOL A;  1FA0 A;  3HX0 A;  4RPY A;  4P2H A;  2I9G A;  3UQ0 A;  3JPP A;  2BPC A;  3LQC B;  4KLE A;  2PFP A;  4MF8 A;  1NOM A;  4NM1 A;  4NKU A;  4AT7 A;  4K4G A;  9ICO A;  7ICQ A;  4R63 A;  9ICS A;  1UEU A;  5IIL A;  4MF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...