2RFFA

Crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
GMGKGKSAIESQIRMLKLAKEIVEEVASSFPNLEEVYIFGSRARGDYLDTSDIDILFVFKGIKEMNVFDRMYMVSRFIRGNVDYIVLDEGEKDRVKDKVLFWKREKGFVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotidyltransferase
publication title Crystal structure of a putative nucleotidyltransferase (NP_343093.1) from Sulfolobus solfataricus at 1.40 A resolution
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase
total genus 35
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2rffA00
4QZHA 4FHYA 7ICUA 4YN4A 4FO6A 4MFCA 4QZBA 1ZQWA 8ICKA 5IIOA 3NYBA 4AT8B 1ZQOA 9ICBA 2Q66A 1TFYA 3RJFA 5J0PA 3OV7A 8ICNA 2GWSA 9ICIA 4PGYA 1ZQDA 4FHPA 2DVIA 2BCVA 4AT7B 9ICLA 4I2AA 1BPYA 5BPCA 3OVAA 7ICMA 5DB6A 4IQUA 3TFSA 4KLEA 5DDYA 4QZ9A 8ICIA 2ID1A 7ICRA 1UETA 4PHPA 4KLQA 1ZQQA 9ICVA 1V4AA 1MQ2A 3LQCB 5D49A 3C2LA 4TUSA 3WFRE 7ICHA 1OU5A 9ICTA 5DB8A 2DR5A 4FHWA 3AU6A 9ICOA 1ZQCA 3L9DA 4K4GA 3UXPA 4M04A 1ZQGA 4LZGA 2BCUA 4YMMA 9ICFA 7ICSA 2BCRA 5CJ7A 4PHEA 5J2JA 3MDCA 8ICQA 4XQ8A 7ICPA 3H39A 3C66A 8ICCA 4FH5A 4X0AA 4KLDA 5J2AA 1HUOA 1TFWA 4AT9B 3C5GA 3OUYB 2VANA 2PBEA 4UD4A 4RWNA 4I2JA 4F5OA 8ICVA 1ZQTA 2RFFA 5HHHA 4F5NA 3C2MA 9ICHA 4IG8A 4QZFA 7ICIA 2ISPA 1BPDA 1KNYA 5HR9A 5CHGA 3TFRA 4Z6CA 4UAWA 5HRBA 4LVSA 1HUZA 5DECA 5J2EA 3JPPA 9ICGA 4YMOA 4EBJA 4I27A 4M2YA 4WC3A 1FA0A 4NLNA 2DR7A 3ISCA 3PMNA 1UEUA 1VJ7A 8ICOA 3JYYA 4FHVA 4UBBA 1ZQJA 4X4SA 4XQ7A 4UAYA 4MFFA 9ICKA 4I2DA 4X4NA 2M2UA 3RH5A 4X4OA 3JPOA 8ICYA 2ZH7A 4X5VA 4QZIA 3JZ0A 4JWMA 5DEDA 5IIMA 3C2KA 4IQTA 4NLKA 8ICSA 3HIYA 9ICJA 2ZH5A 3OVBA 1R8BA 3RJGA 4RQ0A 7ICLA 2O5AA 5F2VO 5J0OA 2BPCA 1R89A 5J2KA 3OGUA 8ICEA 5J2CA 4M9NA 4KLJA 1ZQZA 4PGQA 2DR9A 5IIJA 4X4PA 4PHAA 5HRLA 4FH3A 3WFQE 2ZH3A 3HJ1A 4TURA 1JAJA 2W9MA 4E80A 3HWTA 1ZQKA 3OVSA 4NKUA 4NM1A 1Q78A 4S3NA 3ISDA 1BPXA 4WC6A 2NRKA 2PFPA 4DO9A 9ICSA 4E8FA 8ICXA 4YD2A 4WC2A 4P4MA 4PGXA 4UB3A 1KDHA 1JQRA 5HHIA 4Z6FA 3MGHA 5CA7A 4ATBA 1ZQSA 5DDMA 4GXKA 9ICNA 4XUSA 7ICGA 4JWNA 4KLFA 3MDAA 5DBBA 1ZQFA 3WFSC 1ZQMA 1TV9A 4F5RA 4EP7A 1MQ3A 8ICLA 4RQ3A 5BOMA 5EOZA 5HRDA 3UQ2A 1XSPA 4LZDA 8ICAA 3B0YA 4E7XA 4RPYA 4XRHA 4QZAA 1ZJMA 3AQMA 1R8AA 2ZHBA 2DRBA 1Q79A 5HRKA 1XSLA 9ICXA 3H37A 5HRFA 3HX0A 1UEVA 4I2IA 4WBZA 9ICAA 4GXIA 4WC4A 5J2BA 5TZVA 4KLLA 8ICPA 4M0AA 8ICJA 8ICTA 4O5KA 5J2IA 2FMSA 8ICWA 5CP2A 4QZCA 4M9GA 5DB9A 2M2VA 4X4RA 8ICHA 5J2FA 1PX5A 2M2WA 1KEJA 3V7LA 3C18A 2ZHAA 9ICWA 1ZQNA 8ICBA 1XSNA 7ICQA 4Z6EA 3C5FA 5J0UA 7ICOA 4RQ1A 2BPGA 2O1PA 5HRGA 4GXJA 5J0YA 1ZQUA 4RWOA 2FMPA 4K4HA 2DR8A 4EBKA 7ICFA 1MIVA 4RQ4A 2IHMA 1ZJNA 7ICEA 4TUPA 4MF8A 5HRIA 3AU2A 4RWQA 4I2BA 3RJEA 4WC7A 4WC5A 8ICUA 1VFGA 4NKTA 4M9LA 5J0TA 4X0BA 4X4VA 3V7KA 4YCXA 3RJIA 1RPLA 5HREA 4R63A 1ZQIA 5DKWA 2BCQA 4X4UA 4R66A 7ICKA 5J2HA 1ZQYA 4AT8A 4P4PA 3V7JA 8ICFA 4MFAA 5CWRA 3H3AA 4K4IA 4KLSA 5J0WA 1MIYA 4AT7A 2HHPA 4RQ2A 3HJ4A 1TVAA 3K75D 4RT2A 4P2HA 1WOTA 4UB5A 2BCSA 4O5CA 5BOLA 4M47A 4M9JA 1ZQPA 4YD1A 2M2TA 3PNCA 5D4BA 1BPZA 1BPBA 4MF2A 2ZH1A 3UPQA 4I2GA 2ZH2A 4DOCA 4F5QA 8ICMA 3PMLA 4NM2A 4UBCA 4PPXA 1ZQVA 4I2EA 9ICEA 3AUOA 2DRAA 5CR0A 1R8CA 3MBYA 4F5PA 9ICPA 3RJKA 3RH4A 4UD5A 4LT6A 1ZQHA 3B0XA 7ICJA 5IIKA 4ATBB 5J2DA 4R64A 4AT9A 4RQ7A 4UB4A 5CB1A 8ICGA 4FHXA 3WFOA 3OUYA 1ZQXA 4R65A 4YMNA 4NXZA 4KLUA 5J0QA 5J2GA 1RZTA 4UB2A 1JMSA 5HRHA 1BPEA 4RQ5A 1ZQLA 4O9MA 4WBYA 4DOBA 4PHDA 5HC9A 3GDXA 3WFPA 4IQVA 3RJHA 3ISBA 3V72A 4M9HA 9ICCA 4KLTA 2PFNA 4QZ8A 4M5DA 4RPXA 3RH6A 1ZQAA 3H38A 3JPTA 3JPNA 4I2HA 1MIWA 3RJJA 5J29A 3UQ0A 4X4TA 5DBAA 1ZQBA 4UB1A 4TUQA 7ICNA 3MGIA 5DB7A 2ZH6A 4QZEA 9ICMA 2P66A 7ICTA 5DBCA 3UPSA 4RPZA 4PH5A 3UXNA 2PFQA 9ICUA 4WC0A 2FMQA 2PFOA 3JPRA 4I2FA 3AQKA 4RQ6A 2BPFA 5IINA 5J0XA 2ZH4A 1ZQEA 5IILA 4XA5A 4RWPA 1NO5A 3AQNA 3JPSA 2ZH9A 9ICRA 3AQLA 4IQWA 4QZGA 4I28A 3HW8A 1NOMA 1YLQA 2ISOA 5IIIA 4UAZA 7ICVA 5J0SA 5D46A 4DOAA 3LK9A 4I29A 4P4OA 4NY8A 2ZH8A 4WC1A 4QZDA 1ZQRA 9ICQA 4RQ8A 4KLHA 4NLZA 4X4QA 8ICRA 2I9GA 3JPQA 8ICZA 4I2CA 1JN3A 4O5EA 4RT3A 4KLOA 2BE3A 2PXIA 4KLIA 4Z6DA 3UXOA 4KLGA 1F5AA 4KLMA 4WCWA 5J0RA
chains in the Genus database with same CATH superfamily
4QZHA 4FHYA 7ICUA 4YN4A 4FO6A 4MFCA 4QZBA 1ZQWA 8ICKA 5IIOA 3NYBA 4AT8B 1ZQOA 9ICBA 2Q66A 1TFYA 3RJFA 5J0PA 3OV7A 8ICNA 2GWSA 9ICIA 4PGYA 1ZQDA 4FHPA 2DVIA 2BCVA 4AT7B 9ICLA 4I2AA 4K9BA 1BPYA 5BPCA 3OVAA 7ICMA 5DB6A 4IQUA 3TFSA 3JCFA 4KLEA 5DDYA 4QZ9A 8ICIA 2ID1A 7ICRA 1UETA 4PHPA 4KLQA 1ZQQA 9ICVA 1V4AA 1MQ2A 3LQCB 5D49A 3C2LA 3NVOA 4TUSA 3WFRE 1OU5A 7ICHA 9ICTA 5DB8A 2DR5A 4FHWA 3AU6A 9ICOA 3ER9B 1ZQCA 3L9DA 4K4GA 3UXPA 4M04A 4K9AA 1ZQGA 4LZGA 2BCUA 4YMMA 9ICFA 7ICSA 2BCRA 5CJ7A 4PHEA 5J2JA 3MDCA 8ICQA 4XQ8A 7ICPA 3H39A 3C66A 8ICCA 3CK6A 4FH5A 3NKUA 4X0AA 4WQLA 5J2AA 4KLDA 1HUOA 1TFWA 2BBJA 4AT9B 3C5GA 3OUYB 2VANA 2PBEA 2GAFD 4UD4A 4K96A 4RWNA 4I2JA 4F5OA 8ICVA 1ZQTA 2RFFA 5HHHA 4F5NA 3C2MA 9ICHA 4IG8A 4QZFA 7ICIA 2ISPA 1BPDA 1KNYA 5HR9A 5CHGA 3TFRA 4Z6CA 4UAWA 5HRBA 5B3PA 2B4VA 4LVSA 5JTGA 1HUZA 5DECA 5J2EA 3JPPA 9ICGA 4YMOA 4EBJA 4I27A 4M2YA 4WC3A 1FA0A 4NLNA 2DR7A 3ISCA 3PMNA 1UEUA 1VJ7A 8ICOA 3JYYA 4FHVA 4UBBA 1ZQJA 4X4SA 4XQ7A 4UAYA 4MFFA 9ICKA 4I2DA 4X4NA 2M2UA 3RH5A 4X4OA 3JPOA 8ICYA 2ZH7A 4X5VA 4QZIA 3JZ0A 4JWMA 5DEDA 5IIMA 3C2KA 4IQTA 4NLKA 8ICSA 3HIYA 9ICJA 2ZH5A 3OVBA 1R8BA 3RJGA 4RQ0A 7ICLA 2O5AA 5F2VO 4WOYA 5J0OA 2BPCA 2BBHA 1R89A 5J2KA 3OGUA 8ICEA 5J2CA 4M9NA 4KLJA 1ZQZA 4PGQA 2DR9A 5CHEA 5IIJA 4X4PA 4PHAA 5HRLA 4FH3A 3WFQE 2ZH3A 4EEDA 3HJ1A 4NXXA 4LEWA 4TURA 1JAJA 5D61A 2W9MA 4EV6A 4E80A 3HWTA 1ZQKA 3OVSA 4NKUA 2HN1A 4NM1A 1Q78A 3OWGA 4OAGA 4S3NA 3ISDA 1BPXA 4WC6A 2NRKA 2PFPA 4DO9A 9ICSA 4E8FA 8ICXA 4YD2A 4WC2A 4P4MA 4PGXA 4UB3A 1KDHA 4XJEA 1JQRA 5HHIA 4Z6FA 4KM5A 3MGHA 5CA7A 4ATBA 1ZQSA 5DDMA 4GXKA 9ICNA 4FO1A 4EEBA 4XUSA 4JWNA 4KLFA 7ICGA 3MDAA 5DBBA 5CFUA 1ZQFA 3WFSC 1ZQMA 4N7RA 1TV9A 4KB6A 4F5RA 4JLZA 4HX0A 4EP7A 1MQ3A 8ICLA 4RQ3A 5BOMA 5EOZA 5HRDA 3UQ2A 1XSPA 4LZDA 8ICAA 3B0YA 2EWRA 4E7XA 4RPYA 4XRHA 4QZAA 1ZJMA 3AQMA 1R8AA 2ZHBA 2DRBA 1Q79A 5HRKA 1XSLA 4LEZA 9ICXA 3H37A 5HRFA 3PHZA 3HX0A 1UEVA 4I2IA 4WBZA 9ICAA 4GXIA 4WC4A 5J2BA 5TZVA 4KLLA 3MCRA 4O68A 8ICPA 4M0AA 8ICJA 8ICTA 4O5KA 3NWIA 5J2IA 2FMSA 4K99A 4MKPA 4NXVA 8ICWA 5CP2A 4QZCA 4EGWA 4K97A 4M9GA 5DB9A 2M2VA 5CFTA 4X4RA 8ICHA 5J2FA 1PX5A 2M2WA 1KEJA 3V7LA 3C18A 2ZHAA 9ICWA 1ZQNA 8ICBA 4NXUA 1XSNA 4O69A 7ICQA 4Z6EA 3C5FA 5J0UA 7ICOA 4NXTA 4RQ1A 2BPGA 2O1PA 5HRGA 4GXJA 5J0YA 1ZQUA 4RWOA 2FMPA 4K4HA 2DR8A 4EBKA 7ICFA 1MIVA 4RQ4A 3K7DA 2IHMA 1ZJNA 7ICEA 4TUPA 4MF8A 2GA9D 2HN2A 5HRIA 3AU2A 4RWQA 4I2BA 3RJEA 4WC7A 4I0UA 4WC5A 8ICUA 5CFSA 2FCLA 1VFGA 4NKTA 4M9LA 5J0TA 4X0BA 4X4VA 2B56A 3V7KA 4YCXA 3RJIA 1RPLA 5HREA 4R63A 1ZQIA 5DKWA 4O6AA 2BCQA 4X4UA 4R66A 5D62A 7ICKA 5J2HA 1ZQYA 4AT8A 4P4PA 3V7JA 4LEVA 4MFAA 5CWRA 3H3AA 8ICFA 4K4IA 4KLSA 5J0WA 4WQKA 1MIYA 4AT7A 2HHPA 4RQ2A 3HJ4A 1TVAA 3K75D 4RT2A 4P2HA 1WOTA 4UB5A 2BCSA 4O5CA 5BOLA 4OAFA 4M47A 4M9JA 1ZQPA 4O67A 4YD1A 2M2TA 3PNCA 5D4BA 1BPZA 1BPBA 4MF2A 2ZH1A 3UPQA 4I2GA 2ZH2A 4DOCA 4F5QA 8ICMA 3PMLA 4NM2A 4UBCA 4PPXA 1ZQVA 4I2EA 9ICEA 3AUOA 2DRAA 5CR0A 1R8CA 3MBYA 4OAHA 4F5PA 9ICPA 3RJKA 3RH4A 4UD5A 4LT6A 1ZQHA 3B0XA 7ICJA 5IIKA 4ATBB 5J2DA 4R64A 4AT9A 4RQ7A 4UB4A 5CB1A 8ICGA 4FHXA 3WFOA 3OUYA 1ZQXA 4R65A 4YMNA 4NXZA 4KLUA 5J0QA 5J2GA 1RZTA 4UB2A 1JMSA 5B3QA 5HRHA 1BPEA 4RQ5A 1ZQLA 4O9MA 4WBYA 5D63A 4DOBA 4PHDA 5HC9A 3GDXA 3WFPA 4JLXA 4WH5A 4IQVA 4OAIZ 3RJHA 3ISBA 3V72A 4M9HA 9ICCA 4KLTA 3ERCC 2PFNA 4QZ8A 4M5DA 4RPXA 3RH6A 1ZQAA 4K8VA 3H38A 3JPTA 3JPNA 4I2HA 1MIWA 3RJJA 5J29A 3UQ0A 4X4TA 5DBAA 1ZQBA 4UB1A 3EF2A 4TUQA 7ICNA 3MGIA 5DB7A 2ZH6A 4QZEA 1GPJA 9ICMA 2P66A 7ICTA 5DBCA 2IUBA 3UPSA 4RPZA 2IHOA 4PH5A 3UXNA 2PFQA 9ICUA 4WC0A 2FMQA 2PFOA 3JPRA 4I2FA 3AQKA 4RQ6A 2BPFA 5IINA 5J0XA 4NXWA 2ZH4A 1ZQEA 5IILA 4XA5A 4RWPA 1NO5A 3AQNA 3JPSA 4K98A 2ZH9A 9ICRA 3AQLA 4IQWA 4QZGA 4I28A 3HW8A 1NOMA 1YLQA 2ISOA 5IIIA 4UAZA 7ICVA 5J0SA 5D46A 4DOAA 3LK9A 4I29A 4P4OA 4NY8A 2ZH8A 4WC1A 4QZDA 2B51A 1ZQRA 4LEYA 4RQ8A 9ICQA 4KLHA 4NLZA 4X4QA 8ICRA 2I9GA 3JPQA 8ICZA 4I2CA 1JN3A 4O5EA 4RT3A 4KLOA 2BE3A 2PXIA 4KLIA 4Z6DA 3UXOA 3ER8C 4KLGA 1F5AA 4KLMA 4WCWA 5J0RA
chains in the Genus database with same CATH topology
4QZHA 4FHYA 7ICUA 4YN4A 4FO6A 4MFCA 4QZBA 1ZQWA 8ICKA 5IIOA 3NYBA 4AT8B 1ZQOA 9ICBA 2Q66A 1TFYA 3RJFA 5J0PA 3OV7A 8ICNA 2GWSA 9ICIA 4PGYA 1ZQDA 4FHPA 2DVIA 2BCVA 4AT7B 9ICLA 4I2AA 1BPYA 5BPCA 3OVAA 7ICMA 5DB6A 4IQUA 3TFSA 4KLEA 5DDYA 4QZ9A 8ICIA 2ID1A 7ICRA 1UETA 4PHPA 4KLQA 1ZQQA 9ICVA 1V4AA 1MQ2A 3LQCB 5D49A 3C2LA 4TUSA 3WFRE 7ICHA 1OU5A 9ICTA 5DB8A 2DR5A 4FHWA 3AU6A 9ICOA 1ZQCA 3L9DA 4K4GA 3UXPA 4M04A 1ZQGA 4LZGA 2BCUA 4YMMA 9ICFA 7ICSA 2BCRA 5CJ7A 4PHEA 5J2JA 3MDCA 8ICQA 4XQ8A 7ICPA 3H39A 3C66A 8ICCA 4FH5A 4X0AA 4KLDA 5J2AA 1HUOA 1TFWA 4AT9B 3C5GA 3OUYB 2VANA 2PBEA 4UD4A 4RWNA 4I2JA 4F5OA 8ICVA 1ZQTA 2RFFA 5HHHA 4F5NA 3C2MA 9ICHA 4IG8A 4QZFA 7ICIA 2ISPA 1BPDA 1KNYA 5HR9A 5CHGA 3TFRA 4Z6CA 4UAWA 5HRBA 4LVSA 1HUZA 5DECA 5J2EA 3JPPA 9ICGA 4YMOA 4EBJA 4I27A 4M2YA 4WC3A 1FA0A 4NLNA 2DR7A 3ISCA 3PMNA 1UEUA 1VJ7A 8ICOA 3JYYA 4FHVA 4UBBA 1ZQJA 4X4SA 4XQ7A 4UAYA 4MFFA 9ICKA 4I2DA 4X4NA 2M2UA 3RH5A 4X4OA 3JPOA 8ICYA 2ZH7A 4X5VA 4QZIA 3JZ0A 4JWMA 5DEDA 5IIMA 3C2KA 4IQTA 4NLKA 8ICSA 3HIYA 9ICJA 2ZH5A 3OVBA 1R8BA 3RJGA 4RQ0A 7ICLA 2O5AA 5F2VO 5J0OA 2BPCA 1R89A 5J2KA 3OGUA 8ICEA 5J2CA 4M9NA 4KLJA 1ZQZA 4PGQA 2DR9A 5IIJA 4X4PA 4PHAA 5HRLA 4FH3A 3WFQE 2ZH3A 3HJ1A 4TURA 1JAJA 2W9MA 4E80A 3HWTA 1ZQKA 3OVSA 4NKUA 4NM1A 1Q78A 4S3NA 3ISDA 1BPXA 4WC6A 2NRKA 2PFPA 4DO9A 9ICSA 4E8FA 8ICXA 4YD2A 4WC2A 4P4MA 4PGXA 4UB3A 1KDHA 1JQRA 5HHIA 4Z6FA 3MGHA 5CA7A 4ATBA 1ZQSA 5DDMA 4GXKA 9ICNA 4XUSA 7ICGA 4JWNA 4KLFA 3MDAA 5DBBA 1ZQFA 3WFSC 1ZQMA 1TV9A 4F5RA 4EP7A 1MQ3A 8ICLA 4RQ3A 5BOMA 5EOZA 5HRDA 3UQ2A 1XSPA 4LZDA 8ICAA 3B0YA 4E7XA 4RPYA 4XRHA 4QZAA 1ZJMA 3AQMA 1R8AA 2ZHBA 2DRBA 1Q79A 5HRKA 1XSLA 9ICXA 3H37A 5HRFA 3HX0A 1UEVA 4I2IA 4WBZA 9ICAA 4GXIA 4WC4A 5J2BA 5TZVA 4KLLA 8ICPA 4M0AA 8ICJA 8ICTA 4O5KA 5J2IA 2FMSA 8ICWA 5CP2A 4QZCA 4M9GA 5DB9A 2M2VA 4X4RA 8ICHA 5J2FA 1PX5A 2M2WA 1KEJA 3V7LA 3C18A 2ZHAA 9ICWA 1ZQNA 8ICBA 1XSNA 7ICQA 4Z6EA 3C5FA 5J0UA 7ICOA 4RQ1A 2BPGA 2O1PA 5HRGA 4GXJA 5J0YA 1ZQUA 4RWOA 2FMPA 4K4HA 2DR8A 4EBKA 7ICFA 1MIVA 4RQ4A 2IHMA 1ZJNA 7ICEA 4TUPA 4MF8A 5HRIA 3AU2A 4RWQA 4I2BA 3RJEA 4WC7A 4WC5A 8ICUA 1VFGA 4NKTA 4M9LA 5J0TA 4X0BA 4X4VA 3V7KA 4YCXA 3RJIA 1RPLA 5HREA 4R63A 1ZQIA 5DKWA 2BCQA 4X4UA 4R66A 7ICKA 5J2HA 1ZQYA 4AT8A 4P4PA 3V7JA 8ICFA 4MFAA 5CWRA 3H3AA 4K4IA 4KLSA 5J0WA 1MIYA 4AT7A 2HHPA 4RQ2A 3HJ4A 1TVAA 3K75D 4RT2A 4P2HA 1WOTA 4UB5A 2BCSA 4O5CA 5BOLA 4M47A 4M9JA 1ZQPA 4YD1A 2M2TA 3PNCA 5D4BA 1BPZA 1BPBA 4MF2A 2ZH1A 3UPQA 4I2GA 2ZH2A 4DOCA 4F5QA 8ICMA 3PMLA 4NM2A 4UBCA 4PPXA 1ZQVA 4I2EA 9ICEA 3AUOA 2DRAA 5CR0A 1R8CA 3MBYA 4F5PA 9ICPA 3RJKA 3RH4A 4UD5A 4LT6A 1ZQHA 3B0XA 7ICJA 5IIKA 4ATBB 5J2DA 4R64A 4AT9A 4RQ7A 4UB4A 5CB1A 8ICGA 4FHXA 3WFOA 3OUYA 1ZQXA 4R65A 4YMNA 4NXZA 4KLUA 5J0QA 5J2GA 1RZTA 4UB2A 1JMSA 5HRHA 1BPEA 4RQ5A 1ZQLA 4O9MA 4WBYA 4DOBA 4PHDA 5HC9A 3GDXA 3WFPA 4IQVA 3RJHA 3ISBA 3V72A 4M9HA 9ICCA 4KLTA 2PFNA 4QZ8A 4M5DA 4RPXA 3RH6A 1ZQAA 3H38A 3JPTA 3JPNA 4I2HA 1MIWA 3RJJA 5J29A 3UQ0A 4X4TA 5DBAA 1ZQBA 4UB1A 4TUQA 7ICNA 3MGIA 5DB7A 2ZH6A 4QZEA 9ICMA 2P66A 7ICTA 5DBCA 3UPSA 4RPZA 4PH5A 3UXNA 2PFQA 9ICUA 4WC0A 2FMQA 2PFOA 3JPRA 4I2FA 3AQKA 4RQ6A 2BPFA 5IINA 5J0XA 2ZH4A 1ZQEA 5IILA 4XA5A 4RWPA 1NO5A 3AQNA 3JPSA 2ZH9A 9ICRA 3AQLA 4IQWA 4QZGA 4I28A 3HW8A 1NOMA 1YLQA 2ISOA 5IIIA 4UAZA 7ICVA 5J0SA 5D46A 4DOAA 3LK9A 4I29A 4P4OA 4NY8A 2ZH8A 4WC1A 4QZDA 1ZQRA 9ICQA 4RQ8A 4KLHA 4NLZA 4X4QA 8ICRA 2I9GA 3JPQA 8ICZA 4I2CA 1JN3A 4O5EA 4RT3A 4KLOA 2BE3A 2PXIA 4KLIA 4Z6DA 3UXOA 4KLGA 1F5AA 4KLMA 4WCWA 5J0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZH A;  4FHY A;  7ICU A;  4YN4 A;  4FO6 A;  4MFC A;  4QZB A;  1ZQW A;  8ICK A;  5IIO A;  3NYB A;  4AT8 B;  1ZQO A;  9ICB A;  2Q66 A;  1TFY A;  3RJF A;  5J0P A;  3OV7 A;  8ICN A;  2GWS A;  9ICI A;  4PGY A;  1ZQD A;  4FHP A;  2DVI A;  2BCV A;  4AT7 B;  9ICL A;  4I2A A;  1BPY A;  5BPC A;  3OVA A;  7ICM A;  5DB6 A;  4IQU A;  3TFS A;  4KLE A;  5DDY A;  4QZ9 A;  8ICI A;  2ID1 A;  7ICR A;  1UET A;  4PHP A;  4KLQ A;  1ZQQ A;  9ICV A;  1V4A A;  1MQ2 A;  3LQC B;  5D49 A;  3C2L A;  4TUS A;  3WFR E;  7ICH A;  1OU5 A;  9ICT A;  5DB8 A;  2DR5 A;  4FHW A;  3AU6 A;  9ICO A;  1ZQC A;  3L9D A;  4K4G A;  3UXP A;  4M04 A;  1ZQG A;  4LZG A;  2BCU A;  4YMM A;  9ICF A;  7ICS A;  2BCR A;  5CJ7 A;  4PHE A;  5J2J A;  3MDC A;  8ICQ A;  4XQ8 A;  7ICP A;  3H39 A;  3C66 A;  8ICC A;  4FH5 A;  4X0A A;  4KLD A;  5J2A A;  1HUO A;  1TFW A;  4AT9 B;  3C5G A;  3OUY B;  2VAN A;  2PBE A;  4UD4 A;  4RWN A;  4I2J A;  4F5O A;  8ICV A;  1ZQT A;  2RFF A;  5HHH A;  4F5N A;  3C2M A;  9ICH A;  4IG8 A;  4QZF A;  7ICI A;  2ISP A;  1BPD A;  1KNY A;  5HR9 A;  5CHG A;  3TFR A;  4Z6C A;  4UAW A;  5HRB A;  4LVS A;  1HUZ A;  5DEC A;  5J2E A;  3JPP A;  9ICG A;  4YMO A;  4EBJ A;  4I27 A;  4M2Y A;  4WC3 A;  1FA0 A;  4NLN A;  2DR7 A;  3ISC A;  3PMN A;  1UEU A;  1VJ7 A;  8ICO A;  3JYY A;  4FHV A;  4UBB A;  1ZQJ A;  4X4S A;  4XQ7 A;  4UAY A;  4MFF A;  9ICK A;  4I2D A;  4X4N A;  2M2U A;  3RH5 A;  4X4O A;  3JPO A;  8ICY A;  2ZH7 A;  4X5V A;  4QZI A;  3JZ0 A;  4JWM A;  5DED A;  5IIM A;  3C2K A;  4IQT A;  4NLK A;  8ICS A;  3HIY A;  9ICJ A;  2ZH5 A;  3OVB A;  1R8B A;  3RJG A;  4RQ0 A;  7ICL A;  2O5A A;  5F2V O;  5J0O A;  2BPC A;  1R89 A;  5J2K A;  3OGU A;  8ICE A;  5J2C A;  4M9N A;  4KLJ A;  1ZQZ A;  4PGQ A;  2DR9 A;  5IIJ A;  4X4P A;  4PHA A;  5HRL A;  4FH3 A;  3WFQ E;  2ZH3 A;  3HJ1 A;  4TUR A;  1JAJ A;  2W9M A;  4E80 A;  3HWT A;  1ZQK A;  3OVS A;  4NKU A;  4NM1 A;  1Q78 A;  4S3N A;  3ISD A;  1BPX A;  4WC6 A;  2NRK A;  2PFP A;  4DO9 A;  9ICS A;  4E8F A;  8ICX A;  4YD2 A;  4WC2 A;  4P4M A;  4PGX A;  4UB3 A;  1KDH A;  1JQR A;  5HHI A;  4Z6F A;  3MGH A;  5CA7 A;  4ATB A;  1ZQS A;  5DDM A;  4GXK A;  9ICN A;  4XUS A;  7ICG A;  4JWN A;  4KLF A;  3MDA A;  5DBB A;  1ZQF A;  3WFS C;  1ZQM A;  1TV9 A;  4F5R A;  4EP7 A;  1MQ3 A;  8ICL A;  4RQ3 A;  5BOM A;  5EOZ A;  5HRD A;  3UQ2 A;  1XSP A;  4LZD A;  8ICA A;  3B0Y A;  4E7X A;  4RPY A;  4XRH A;  4QZA A;  1ZJM A;  3AQM A;  1R8A A;  2ZHB A;  2DRB A;  1Q79 A;  5HRK A;  1XSL A;  9ICX A;  3H37 A;  5HRF A;  3HX0 A;  1UEV A;  4I2I A;  4WBZ A;  9ICA A;  4GXI A;  4WC4 A;  5J2B A;  5TZV A;  4KLL A;  8ICP A;  4M0A A;  8ICJ A;  8ICT A;  4O5K A;  5J2I A;  2FMS A;  8ICW A;  5CP2 A;  4QZC A;  4M9G A;  5DB9 A;  2M2V A;  4X4R A;  8ICH A;  5J2F A;  1PX5 A;  2M2W A;  1KEJ A;  3V7L A;  3C18 A;  2ZHA A;  9ICW A;  1ZQN A;  8ICB A;  1XSN A;  7ICQ A;  4Z6E A;  3C5F A;  5J0U A;  7ICO A;  4RQ1 A;  2BPG A;  2O1P A;  5HRG A;  4GXJ A;  5J0Y A;  1ZQU A;  4RWO A;  2FMP A;  4K4H A;  2DR8 A;  4EBK A;  7ICF A;  1MIV A;  4RQ4 A;  2IHM A;  1ZJN A;  7ICE A;  4TUP A;  4MF8 A;  5HRI A;  3AU2 A;  4RWQ A;  4I2B A;  3RJE A;  4WC7 A;  4WC5 A;  8ICU A;  1VFG A;  4NKT A;  4M9L A;  5J0T A;  4X0B A;  4X4V A;  3V7K A;  4YCX A;  3RJI A;  1RPL A;  5HRE A;  4R63 A;  1ZQI A;  5DKW A;  2BCQ A;  4X4U A;  4R66 A;  7ICK A;  5J2H A;  1ZQY A;  4AT8 A;  4P4P A;  3V7J A;  8ICF A;  4MFA A;  5CWR A;  3H3A A;  4K4I A;  4KLS A;  5J0W A;  1MIY A;  4AT7 A;  2HHP A;  4RQ2 A;  3HJ4 A;  1TVA A;  3K75 D;  4RT2 A;  4P2H A;  1WOT A;  4UB5 A;  2BCS A;  4O5C A;  5BOL A;  4M47 A;  4M9J A;  1ZQP A;  4YD1 A;  2M2T A;  3PNC A;  5D4B A;  1BPZ A;  1BPB A;  4MF2 A;  2ZH1 A;  3UPQ A;  4I2G A;  2ZH2 A;  4DOC A;  4F5Q A;  8ICM A;  3PML A;  4NM2 A;  4UBC A;  4PPX A;  1ZQV A;  4I2E A;  9ICE A;  3AUO A;  2DRA A;  5CR0 A;  1R8C A;  3MBY A;  4F5P A;  9ICP A;  3RJK A;  3RH4 A;  4UD5 A;  4LT6 A;  1ZQH A;  3B0X A;  7ICJ A;  5IIK A;  4ATB B;  5J2D A;  4R64 A;  4AT9 A;  4RQ7 A;  4UB4 A;  5CB1 A;  8ICG A;  4FHX A;  3WFO A;  3OUY A;  1ZQX A;  4R65 A;  4YMN A;  4NXZ A;  4KLU A;  5J0Q A;  5J2G A;  1RZT A;  4UB2 A;  1JMS A;  5HRH A;  1BPE A;  4RQ5 A;  1ZQL A;  4O9M A;  4WBY A;  4DOB A;  4PHD A;  5HC9 A;  3GDX A;  3WFP A;  4IQV A;  3RJH A;  3ISB A;  3V72 A;  4M9H A;  9ICC A;  4KLT A;  2PFN A;  4QZ8 A;  4M5D A;  4RPX A;  3RH6 A;  1ZQA A;  3H38 A;  3JPT A;  3JPN A;  4I2H A;  1MIW A;  3RJJ A;  5J29 A;  3UQ0 A;  4X4T A;  5DBA A;  1ZQB A;  4UB1 A;  4TUQ A;  7ICN A;  3MGI A;  5DB7 A;  2ZH6 A;  4QZE A;  9ICM A;  2P66 A;  7ICT A;  5DBC A;  3UPS A;  4RPZ A;  4PH5 A;  3UXN A;  2PFQ A;  9ICU A;  4WC0 A;  2FMQ A;  2PFO A;  3JPR A;  4I2F A;  3AQK A;  4RQ6 A;  2BPF A;  5IIN A;  5J0X A;  2ZH4 A;  1ZQE A;  5IIL A;  4XA5 A;  4RWP A;  1NO5 A;  3AQN A;  3JPS A;  2ZH9 A;  9ICR A;  3AQL A;  4IQW A;  4QZG A;  4I28 A;  3HW8 A;  1NOM A;  1YLQ A;  2ISO A;  5III A;  4UAZ A;  7ICV A;  5J0S A;  5D46 A;  4DOA A;  3LK9 A;  4I29 A;  4P4O A;  4NY8 A;  2ZH8 A;  4WC1 A;  4QZD A;  1ZQR A;  9ICQ A;  4RQ8 A;  4KLH A;  4NLZ A;  4X4Q A;  8ICR A;  2I9G A;  3JPQ A;  8ICZ A;  4I2C A;  1JN3 A;  4O5E A;  4RT3 A;  4KLO A;  2BE3 A;  2PXI A;  4KLI A;  4Z6D A;  3UXO A;  4KLG A;  1F5A A;  4KLM A;  4WCW A;  5J0R A; 
#chains in the Genus database with same CATH topology
 4QZH A;  4FHY A;  7ICU A;  4YN4 A;  4FO6 A;  4MFC A;  4QZB A;  1ZQW A;  8ICK A;  5IIO A;  3NYB A;  4AT8 B;  1ZQO A;  9ICB A;  2Q66 A;  1TFY A;  3RJF A;  5J0P A;  3OV7 A;  8ICN A;  2GWS A;  9ICI A;  4PGY A;  1ZQD A;  4FHP A;  2DVI A;  2BCV A;  4AT7 B;  9ICL A;  4I2A A;  4K9B A;  1BPY A;  5BPC A;  3OVA A;  7ICM A;  5DB6 A;  4IQU A;  3TFS A;  3JCF A;  4KLE A;  5DDY A;  4QZ9 A;  8ICI A;  2ID1 A;  7ICR A;  1UET A;  4PHP A;  4KLQ A;  1ZQQ A;  9ICV A;  1V4A A;  1MQ2 A;  3LQC B;  5D49 A;  3C2L A;  3NVO A;  4TUS A;  3WFR E;  1OU5 A;  7ICH A;  9ICT A;  5DB8 A;  2DR5 A;  4FHW A;  3AU6 A;  9ICO A;  3ER9 B;  1ZQC A;  3L9D A;  4K4G A;  3UXP A;  4M04 A;  4K9A A;  1ZQG A;  4LZG A;  2BCU A;  4YMM A;  9ICF A;  7ICS A;  2BCR A;  5CJ7 A;  4PHE A;  5J2J A;  3MDC A;  8ICQ A;  4XQ8 A;  7ICP A;  3H39 A;  3C66 A;  8ICC A;  3CK6 A;  4FH5 A;  3NKU A;  4X0A A;  4WQL A;  5J2A A;  4KLD A;  1HUO A;  1TFW A;  2BBJ A;  4AT9 B;  3C5G A;  3OUY B;  2VAN A;  2PBE A;  2GAF D;  4UD4 A;  4K96 A;  4RWN A;  4I2J A;  4F5O A;  8ICV A;  1ZQT A;  2RFF A;  5HHH A;  4F5N A;  3C2M A;  9ICH A;  4IG8 A;  4QZF A;  7ICI A;  2ISP A;  1BPD A;  1KNY A;  5HR9 A;  5CHG A;  3TFR A;  4Z6C A;  4UAW A;  5HRB A;  5B3P A;  2B4V A;  4LVS A;  5JTG A;  1HUZ A;  5DEC A;  5J2E A;  3JPP A;  9ICG A;  4YMO A;  4EBJ A;  4I27 A;  4M2Y A;  4WC3 A;  1FA0 A;  4NLN A;  2DR7 A;  3ISC A;  3PMN A;  1UEU A;  1VJ7 A;  8ICO A;  3JYY A;  4FHV A;  4UBB A;  1ZQJ A;  4X4S A;  4XQ7 A;  4UAY A;  4MFF A;  9ICK A;  4I2D A;  4X4N A;  2M2U A;  3RH5 A;  4X4O A;  3JPO A;  8ICY A;  2ZH7 A;  4X5V A;  4QZI A;  3JZ0 A;  4JWM A;  5DED A;  5IIM A;  3C2K A;  4IQT A;  4NLK A;  8ICS A;  3HIY A;  9ICJ A;  2ZH5 A;  3OVB A;  1R8B A;  3RJG A;  4RQ0 A;  7ICL A;  2O5A A;  5F2V O;  4WOY A;  5J0O A;  2BPC A;  2BBH A;  1R89 A;  5J2K A;  3OGU A;  8ICE A;  5J2C A;  4M9N A;  4KLJ A;  1ZQZ A;  4PGQ A;  2DR9 A;  5CHE A;  5IIJ A;  4X4P A;  4PHA A;  5HRL A;  4FH3 A;  3WFQ E;  2ZH3 A;  4EED A;  3HJ1 A;  4NXX A;  4LEW A;  4TUR A;  1JAJ A;  5D61 A;  2W9M A;  4EV6 A;  4E80 A;  3HWT A;  1ZQK A;  3OVS A;  4NKU A;  2HN1 A;  4NM1 A;  1Q78 A;  3OWG A;  4OAG A;  4S3N A;  3ISD A;  1BPX A;  4WC6 A;  2NRK A;  2PFP A;  4DO9 A;  9ICS A;  4E8F A;  8ICX A;  4YD2 A;  4WC2 A;  4P4M A;  4PGX A;  4UB3 A;  1KDH A;  4XJE A;  1JQR A;  5HHI A;  4Z6F A;  4KM5 A;  3MGH A;  5CA7 A;  4ATB A;  1ZQS A;  5DDM A;  4GXK A;  9ICN A;  4FO1 A;  4EEB A;  4XUS A;  4JWN A;  4KLF A;  7ICG A;  3MDA A;  5DBB A;  5CFU A;  1ZQF A;  3WFS C;  1ZQM A;  4N7R A;  1TV9 A;  4KB6 A;  4F5R A;  4JLZ A;  4HX0 A;  4EP7 A;  1MQ3 A;  8ICL A;  4RQ3 A;  5BOM A;  5EOZ A;  5HRD A;  3UQ2 A;  1XSP A;  4LZD A;  8ICA A;  3B0Y A;  2EWR A;  4E7X A;  4RPY A;  4XRH A;  4QZA A;  1ZJM A;  3AQM A;  1R8A A;  2ZHB A;  2DRB A;  1Q79 A;  5HRK A;  1XSL A;  4LEZ A;  9ICX A;  3H37 A;  5HRF A;  3PHZ A;  3HX0 A;  1UEV A;  4I2I A;  4WBZ A;  9ICA A;  4GXI A;  4WC4 A;  5J2B A;  5TZV A;  4KLL A;  3MCR A;  4O68 A;  8ICP A;  4M0A A;  8ICJ A;  8ICT A;  4O5K A;  3NWI A;  5J2I A;  2FMS A;  4K99 A;  4MKP A;  4NXV A;  8ICW A;  5CP2 A;  4QZC A;  4EGW A;  4K97 A;  4M9G A;  5DB9 A;  2M2V A;  5CFT A;  4X4R A;  8ICH A;  5J2F A;  1PX5 A;  2M2W A;  1KEJ A;  3V7L A;  3C18 A;  2ZHA A;  9ICW A;  1ZQN A;  8ICB A;  4NXU A;  1XSN A;  4O69 A;  7ICQ A;  4Z6E A;  3C5F A;  5J0U A;  7ICO A;  4NXT A;  4RQ1 A;  2BPG A;  2O1P A;  5HRG A;  4GXJ A;  5J0Y A;  1ZQU A;  4RWO A;  2FMP A;  4K4H A;  2DR8 A;  4EBK A;  7ICF A;  1MIV A;  4RQ4 A;  3K7D A;  2IHM A;  1ZJN A;  7ICE A;  4TUP A;  4MF8 A;  2GA9 D;  2HN2 A;  5HRI A;  3AU2 A;  4RWQ A;  4I2B A;  3RJE A;  4WC7 A;  4I0U A;  4WC5 A;  8ICU A;  5CFS A;  2FCL A;  1VFG A;  4NKT A;  4M9L A;  5J0T A;  4X0B A;  4X4V A;  2B56 A;  3V7K A;  4YCX A;  3RJI A;  1RPL A;  5HRE A;  4R63 A;  1ZQI A;  5DKW A;  4O6A A;  2BCQ A;  4X4U A;  4R66 A;  5D62 A;  7ICK A;  5J2H A;  1ZQY A;  4AT8 A;  4P4P A;  3V7J A;  4LEV A;  4MFA A;  5CWR A;  3H3A A;  8ICF A;  4K4I A;  4KLS A;  5J0W A;  4WQK A;  1MIY A;  4AT7 A;  2HHP A;  4RQ2 A;  3HJ4 A;  1TVA A;  3K75 D;  4RT2 A;  4P2H A;  1WOT A;  4UB5 A;  2BCS A;  4O5C A;  5BOL A;  4OAF A;  4M47 A;  4M9J A;  1ZQP A;  4O67 A;  4YD1 A;  2M2T A;  3PNC A;  5D4B A;  1BPZ A;  1BPB A;  4MF2 A;  2ZH1 A;  3UPQ A;  4I2G A;  2ZH2 A;  4DOC A;  4F5Q A;  8ICM A;  3PML A;  4NM2 A;  4UBC A;  4PPX A;  1ZQV A;  4I2E A;  9ICE A;  3AUO A;  2DRA A;  5CR0 A;  1R8C A;  3MBY A;  4OAH A;  4F5P A;  9ICP A;  3RJK A;  3RH4 A;  4UD5 A;  4LT6 A;  1ZQH A;  3B0X A;  7ICJ A;  5IIK A;  4ATB B;  5J2D A;  4R64 A;  4AT9 A;  4RQ7 A;  4UB4 A;  5CB1 A;  8ICG A;  4FHX A;  3WFO A;  3OUY A;  1ZQX A;  4R65 A;  4YMN A;  4NXZ A;  4KLU A;  5J0Q A;  5J2G A;  1RZT A;  4UB2 A;  1JMS A;  5B3Q A;  5HRH A;  1BPE A;  4RQ5 A;  1ZQL A;  4O9M A;  4WBY A;  5D63 A;  4DOB A;  4PHD A;  5HC9 A;  3GDX A;  3WFP A;  4JLX A;  4WH5 A;  4IQV A;  4OAI Z;  3RJH A;  3ISB A;  3V72 A;  4M9H A;  9ICC A;  4KLT A;  3ERC C;  2PFN A;  4QZ8 A;  4M5D A;  4RPX A;  3RH6 A;  1ZQA A;  4K8V A;  3H38 A;  3JPT A;  3JPN A;  4I2H A;  1MIW A;  3RJJ A;  5J29 A;  3UQ0 A;  4X4T A;  5DBA A;  1ZQB A;  4UB1 A;  3EF2 A;  4TUQ A;  7ICN A;  3MGI A;  5DB7 A;  2ZH6 A;  4QZE A;  1GPJ A;  9ICM A;  2P66 A;  7ICT A;  5DBC A;  2IUB A;  3UPS A;  4RPZ A;  2IHO A;  4PH5 A;  3UXN A;  2PFQ A;  9ICU A;  4WC0 A;  2FMQ A;  2PFO A;  3JPR A;  4I2F A;  3AQK A;  4RQ6 A;  2BPF A;  5IIN A;  5J0X A;  4NXW A;  2ZH4 A;  1ZQE A;  5IIL A;  4XA5 A;  4RWP A;  1NO5 A;  3AQN A;  3JPS A;  4K98 A;  2ZH9 A;  9ICR A;  3AQL A;  4IQW A;  4QZG A;  4I28 A;  3HW8 A;  1NOM A;  1YLQ A;  2ISO A;  5III A;  4UAZ A;  7ICV A;  5J0S A;  5D46 A;  4DOA A;  3LK9 A;  4I29 A;  4P4O A;  4NY8 A;  2ZH8 A;  4WC1 A;  4QZD A;  2B51 A;  1ZQR A;  4LEY A;  4RQ8 A;  9ICQ A;  4KLH A;  4NLZ A;  4X4Q A;  8ICR A;  2I9G A;  3JPQ A;  8ICZ A;  4I2C A;  1JN3 A;  4O5E A;  4RT3 A;  4KLO A;  2BE3 A;  2PXI A;  4KLI A;  4Z6D A;  3UXO A;  3ER8 C;  4KLG A;  1F5A A;  4KLM A;  4WCW A;  5J0R A; 
#chains in the Genus database with same CATH homology
 4QZH A;  4FHY A;  7ICU A;  4YN4 A;  4FO6 A;  4MFC A;  4QZB A;  1ZQW A;  8ICK A;  5IIO A;  3NYB A;  4AT8 B;  1ZQO A;  9ICB A;  2Q66 A;  1TFY A;  3RJF A;  5J0P A;  3OV7 A;  8ICN A;  2GWS A;  9ICI A;  4PGY A;  1ZQD A;  4FHP A;  2DVI A;  2BCV A;  4AT7 B;  9ICL A;  4I2A A;  1BPY A;  5BPC A;  3OVA A;  7ICM A;  5DB6 A;  4IQU A;  3TFS A;  4KLE A;  5DDY A;  4QZ9 A;  8ICI A;  2ID1 A;  7ICR A;  1UET A;  4PHP A;  4KLQ A;  1ZQQ A;  9ICV A;  1V4A A;  1MQ2 A;  3LQC B;  5D49 A;  3C2L A;  4TUS A;  3WFR E;  7ICH A;  1OU5 A;  9ICT A;  5DB8 A;  2DR5 A;  4FHW A;  3AU6 A;  9ICO A;  1ZQC A;  3L9D A;  4K4G A;  3UXP A;  4M04 A;  1ZQG A;  4LZG A;  2BCU A;  4YMM A;  9ICF A;  7ICS A;  2BCR A;  5CJ7 A;  4PHE A;  5J2J A;  3MDC A;  8ICQ A;  4XQ8 A;  7ICP A;  3H39 A;  3C66 A;  8ICC A;  4FH5 A;  4X0A A;  4KLD A;  5J2A A;  1HUO A;  1TFW A;  4AT9 B;  3C5G A;  3OUY B;  2VAN A;  2PBE A;  4UD4 A;  4RWN A;  4I2J A;  4F5O A;  8ICV A;  1ZQT A;  2RFF A;  5HHH A;  4F5N A;  3C2M A;  9ICH A;  4IG8 A;  4QZF A;  7ICI A;  2ISP A;  1BPD A;  1KNY A;  5HR9 A;  5CHG A;  3TFR A;  4Z6C A;  4UAW A;  5HRB A;  4LVS A;  1HUZ A;  5DEC A;  5J2E A;  3JPP A;  9ICG A;  4YMO A;  4EBJ A;  4I27 A;  4M2Y A;  4WC3 A;  1FA0 A;  4NLN A;  2DR7 A;  3ISC A;  3PMN A;  1UEU A;  1VJ7 A;  8ICO A;  3JYY A;  4FHV A;  4UBB A;  1ZQJ A;  4X4S A;  4XQ7 A;  4UAY A;  4MFF A;  9ICK A;  4I2D A;  4X4N A;  2M2U A;  3RH5 A;  4X4O A;  3JPO A;  8ICY A;  2ZH7 A;  4X5V A;  4QZI A;  3JZ0 A;  4JWM A;  5DED A;  5IIM A;  3C2K A;  4IQT A;  4NLK A;  8ICS A;  3HIY A;  9ICJ A;  2ZH5 A;  3OVB A;  1R8B A;  3RJG A;  4RQ0 A;  7ICL A;  2O5A A;  5F2V O;  5J0O A;  2BPC A;  1R89 A;  5J2K A;  3OGU A;  8ICE A;  5J2C A;  4M9N A;  4KLJ A;  1ZQZ A;  4PGQ A;  2DR9 A;  5IIJ A;  4X4P A;  4PHA A;  5HRL A;  4FH3 A;  3WFQ E;  2ZH3 A;  3HJ1 A;  4TUR A;  1JAJ A;  2W9M A;  4E80 A;  3HWT A;  1ZQK A;  3OVS A;  4NKU A;  4NM1 A;  1Q78 A;  4S3N A;  3ISD A;  1BPX A;  4WC6 A;  2NRK A;  2PFP A;  4DO9 A;  9ICS A;  4E8F A;  8ICX A;  4YD2 A;  4WC2 A;  4P4M A;  4PGX A;  4UB3 A;  1KDH A;  1JQR A;  5HHI A;  4Z6F A;  3MGH A;  5CA7 A;  4ATB A;  1ZQS A;  5DDM A;  4GXK A;  9ICN A;  4XUS A;  7ICG A;  4JWN A;  4KLF A;  3MDA A;  5DBB A;  1ZQF A;  3WFS C;  1ZQM A;  1TV9 A;  4F5R A;  4EP7 A;  1MQ3 A;  8ICL A;  4RQ3 A;  5BOM A;  5EOZ A;  5HRD A;  3UQ2 A;  1XSP A;  4LZD A;  8ICA A;  3B0Y A;  4E7X A;  4RPY A;  4XRH A;  4QZA A;  1ZJM A;  3AQM A;  1R8A A;  2ZHB A;  2DRB A;  1Q79 A;  5HRK A;  1XSL A;  9ICX A;  3H37 A;  5HRF A;  3HX0 A;  1UEV A;  4I2I A;  4WBZ A;  9ICA A;  4GXI A;  4WC4 A;  5J2B A;  5TZV A;  4KLL A;  8ICP A;  4M0A A;  8ICJ A;  8ICT A;  4O5K A;  5J2I A;  2FMS A;  8ICW A;  5CP2 A;  4QZC A;  4M9G A;  5DB9 A;  2M2V A;  4X4R A;  8ICH A;  5J2F A;  1PX5 A;  2M2W A;  1KEJ A;  3V7L A;  3C18 A;  2ZHA A;  9ICW A;  1ZQN A;  8ICB A;  1XSN A;  7ICQ A;  4Z6E A;  3C5F A;  5J0U A;  7ICO A;  4RQ1 A;  2BPG A;  2O1P A;  5HRG A;  4GXJ A;  5J0Y A;  1ZQU A;  4RWO A;  2FMP A;  4K4H A;  2DR8 A;  4EBK A;  7ICF A;  1MIV A;  4RQ4 A;  2IHM A;  1ZJN A;  7ICE A;  4TUP A;  4MF8 A;  5HRI A;  3AU2 A;  4RWQ A;  4I2B A;  3RJE A;  4WC7 A;  4WC5 A;  8ICU A;  1VFG A;  4NKT A;  4M9L A;  5J0T A;  4X0B A;  4X4V A;  3V7K A;  4YCX A;  3RJI A;  1RPL A;  5HRE A;  4R63 A;  1ZQI A;  5DKW A;  2BCQ A;  4X4U A;  4R66 A;  7ICK A;  5J2H A;  1ZQY A;  4AT8 A;  4P4P A;  3V7J A;  8ICF A;  4MFA A;  5CWR A;  3H3A A;  4K4I A;  4KLS A;  5J0W A;  1MIY A;  4AT7 A;  2HHP A;  4RQ2 A;  3HJ4 A;  1TVA A;  3K75 D;  4RT2 A;  4P2H A;  1WOT A;  4UB5 A;  2BCS A;  4O5C A;  5BOL A;  4M47 A;  4M9J A;  1ZQP A;  4YD1 A;  2M2T A;  3PNC A;  5D4B A;  1BPZ A;  1BPB A;  4MF2 A;  2ZH1 A;  3UPQ A;  4I2G A;  2ZH2 A;  4DOC A;  4F5Q A;  8ICM A;  3PML A;  4NM2 A;  4UBC A;  4PPX A;  1ZQV A;  4I2E A;  9ICE A;  3AUO A;  2DRA A;  5CR0 A;  1R8C A;  3MBY A;  4F5P A;  9ICP A;  3RJK A;  3RH4 A;  4UD5 A;  4LT6 A;  1ZQH A;  3B0X A;  7ICJ A;  5IIK A;  4ATB B;  5J2D A;  4R64 A;  4AT9 A;  4RQ7 A;  4UB4 A;  5CB1 A;  8ICG A;  4FHX A;  3WFO A;  3OUY A;  1ZQX A;  4R65 A;  4YMN A;  4NXZ A;  4KLU A;  5J0Q A;  5J2G A;  1RZT A;  4UB2 A;  1JMS A;  5HRH A;  1BPE A;  4RQ5 A;  1ZQL A;  4O9M A;  4WBY A;  4DOB A;  4PHD A;  5HC9 A;  3GDX A;  3WFP A;  4IQV A;  3RJH A;  3ISB A;  3V72 A;  4M9H A;  9ICC A;  4KLT A;  2PFN A;  4QZ8 A;  4M5D A;  4RPX A;  3RH6 A;  1ZQA A;  3H38 A;  3JPT A;  3JPN A;  4I2H A;  1MIW A;  3RJJ A;  5J29 A;  3UQ0 A;  4X4T A;  5DBA A;  1ZQB A;  4UB1 A;  4TUQ A;  7ICN A;  3MGI A;  5DB7 A;  2ZH6 A;  4QZE A;  9ICM A;  2P66 A;  7ICT A;  5DBC A;  3UPS A;  4RPZ A;  4PH5 A;  3UXN A;  2PFQ A;  9ICU A;  4WC0 A;  2FMQ A;  2PFO A;  3JPR A;  4I2F A;  3AQK A;  4RQ6 A;  2BPF A;  5IIN A;  5J0X A;  2ZH4 A;  1ZQE A;  5IIL A;  4XA5 A;  4RWP A;  1NO5 A;  3AQN A;  3JPS A;  2ZH9 A;  9ICR A;  3AQL A;  4IQW A;  4QZG A;  4I28 A;  3HW8 A;  1NOM A;  1YLQ A;  2ISO A;  5III A;  4UAZ A;  7ICV A;  5J0S A;  5D46 A;  4DOA A;  3LK9 A;  4I29 A;  4P4O A;  4NY8 A;  2ZH8 A;  4WC1 A;  4QZD A;  1ZQR A;  9ICQ A;  4RQ8 A;  4KLH A;  4NLZ A;  4X4Q A;  8ICR A;  2I9G A;  3JPQ A;  8ICZ A;  4I2C A;  1JN3 A;  4O5E A;  4RT3 A;  4KLO A;  2BE3 A;  2PXI A;  4KLI A;  4Z6D A;  3UXO A;  4KLG A;  1F5A A;  4KLM A;  4WCW A;  5J0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...