2RFFA

Crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
GMGKGKSAIESQIRMLKLAKEIVEEVASSFPNLEEVYIFGSRARGDYLDTSDIDILFVFKGIKEMNVFDRMYMVSRFIRGNVDYIVLDEGEKDRVKDKVLFWKREKGFVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative nucleotidyltransferase
publication title Crystal structure of a putative nucleotidyltransferase (NP_343093.1) from Sulfolobus solfataricus at 1.40 A resolution
rcsb
source organism Sulfolobus solfataricus p2
total genus 35
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2rffA00
9ICWA 3UQ0A 4FO6A 4E80A 3H39A 2PXIA 3V7JA 5CWRA 1UEUA 5BPCA 4R63A 3HWTA 4KLTA 3PMNA 1ZQSA 4UB5A 5HR9A 1MIWA 4X4TA 4TURA 4PGXA 5HRLA 2FMPA 4PHPA 5DB7A 4NLZA 4NXZA 4I2DA 4QZDA 3AQMA 5HHIA 2DR8A 4X5VA 2ZH9A 1ZQVA 4F5QA 3AQKA 4KLGA 4P2HA 3LK9A 4O5CA 4UAWA 4DO9A 3C2LA 4RQ1A 2BCQA 4WC5A 7ICUA 4WC4A 2DR7A 1ZQOA 1MIVA 3B0YA 1JAJA 2ZH2A 9ICJA 4KLQA 4AT8B 4UD4A 4IQVA 3C5FA 1ZQEA 9ICSA 1ZQCA 5HRHA 7ICOA 9ICQA 5DBAA 3HJ1A 1RPLA 5J0XA 4QZBA 4X4PA 5HRGA 5DBBA 4KLSA 1VJ7A 1KDHA 8ICRA 2I9GA 5HRFA 4RWOA 4AT7B 2DRAA 8ICOA 8ICNA 4LZGA 9ICIA 3OVBA 4IQWA 4X4RA 5DDMA 7ICKA 4M9JA 1ZQMA 3UXNA 4ATBA 1R8AA 4YMNA 3HW8A 8ICIA 4M04A 5J0TA 3MGHA 3V72A 1BPBA 4QZGA 2HHPA 2PFOA 1PX5A 4XQ8A 4RWPA 4M9LA 2ID1A 3B0XA 3H37A 4E7XA 5IIMA 8ICCA 4I2CA 4I2HA 2RFFA 5J0RA 2DVIA 1ZQRA 9ICAA 1JMSA 5DECA 4O5EA 4UB2A 4MFFA 3JPOA 4IQUA 4RQ6A 5J2JA 1XSNA 4UAZA 4FH3A 3ISCA 3MBYA 4NKTA 3TFRA 2PFPA 5J2GA 4LVSA 1ZQIA 7ICRA 9ICHA 4F5NA 3OVSA 2BCVA 4FH5A 5IIKA 4PHAA 4MF8A 5IIIA 1ZQBA 5HRBA 3WFPA 9ICGA 4TUPA 1NO5A 1WOTA 2IHMA 4I28A 3RJGA 7ICLA 4QZCA 1V4AA 3ISBA 4QZAA 1R8CA 1KEJA 4Z6EA 4UAYA 4P4PA 4I2GA 4M2YA 1TV9A 1VFGA 4I27A 7ICGA 7ICTA 4WCWA 5J0QA 5DBCA 9ICMA 1HUOA 4MFAA 5DB8A 4R65A 7ICNA 2BCUA 1XSLA 4RWQA 1ZQUA 4GXIA 2O5AA 3L9DA 7ICVA 4I29A 4UB3A 1ZQPA 4NKUA 4TUSA 2GWSA 3UPSA 4I2JA 5DDYA 4E8FA 9ICCA 4P4OA 4X4NA 4K4HA 3JPQA 3V7LA 4YCXA 3MGIA 7ICHA 2ZHAA 4M9HA 4Z6FA 4RQ2A 3OUYB 4K4IA 1TVAA 2DR9A 7ICPA 4JWNA 9ICKA 5J2HA 5IINA 5CP2A 1YLQA 4P4MA 4RPYA 1FA0A 4AT8A 3RJHA 4MF2A 5D49A 4EP7A 1MQ2A 5J2FA 2ZH5A 3HIYA 4QZHA 3RJEA 3AQLA 3RH5A 4X4VA 1ZQJA 2M2TA 4KLMA 3C2KA 4R66A 4DOBA 5HRIA 3OGUA 9ICNA 1XSPA 1Q79A 4UBCA 2ZH3A 8ICXA 2PFQA 4FHVA 1ZQYA 2BPGA 4WC1A 9ICLA 4K4GA 4M9GA 2ZH8A 3RH6A 1BPEA 4PGQA 4QZEA 2FMSA 4PPXA 5J2EA 1ZQAA 4WC7A 2BPFA 3UQ2A 3RJKA 2FMQA 5J0UA 4AT9B 3NYBA 5DB6A 3JPPA 4FHXA 1NOMA 4YMOA 1BPZA 5HRDA 4XQ7A 2M2WA 7ICJA 3GDXA 1UETA 5J0WA 3JZ0A 4KLEA 5J0YA 1OU5A 2W9MA 5J0SA 3JPSA 3WFSC 9ICEA 5J2KA 8ICTA 1F5AA 4TUQA 5HHHA 2P66A 5J0PA 3PMLA 8ICQA 5J29A 4UBBA 3AUOA 4KLUA 4KLDA 2NRKA 2PFNA 1ZQFA 2DRBA 4KLIA 5CA7A 1KNYA 4QZFA 1HUZA 4EBJA 4O9MA 9ICBA 7ICSA 3C66A 1ZQDA 8ICKA 4RQ0A 3LQCB 4NM2A 5CJ7A 5J2AA 1ZQKA 3UPQA 5IILA 4YMMA 8ICBA 1R8BA 1ZJMA 8ICMA 3AU6A 3UXPA 5D46A 5HREA 5BOLA 1UEVA 4RT2A 4LT6A 4NLKA 4GXKA 4UB1A 2Q66A 3ISDA 5DB9A 5BOMA 3UXOA 5HC9A 3HJ4A 2ISPA 5J2IA 4M0AA 1ZJNA 7ICIA 8ICWA 2BPCA 8ICUA 5D4BA 4UB4A 4GXJA 1TFWA 8ICFA 4WBZA 4R64A 4RPXA 3JPRA 4EBKA 2PBEA 1ZQXA 2DR5A 4WC2A 5TZVA 5DKWA 3JPTA 3OUYA 7ICEA 8ICYA 4PHDA 8ICSA 8ICEA 1R89A 2M2UA 9ICUA 3PNCA 4QZ8A 4X4UA 1ZQLA 3WFOA 4X4SA 2BCSA 4F5PA 3RH4A 9ICFA 4F5RA 3MDCA 9ICOA 4NY8A 5IIOA 4FHYA 4O5KA 4X4OA 1ZQZA 4X0BA 2BCRA 2O1PA 5DEDA 1TFYA 4AT7A 1Q78A 5HRKA 8ICGA 4KLHA 5CR0A 8ICVA 4I2IA 8ICHA 3RJIA 2ZH6A 4QZ9A 4FHWA 4YD2A 4IG8A 9ICVA 4PGYA 4I2EA 4X0AA 2ZH7A 4RQ5A 1RZTA 3H3AA 3JPNA 8ICZA 4ATBB 2ISOA 3C18A 1BPXA 4NM1A 4NLNA 5IIJA 3RJFA 4I2AA 4DOAA 4PH5A 4RQ4A 1BPYA 5F2VO 3JYYA 2VANA 4I2FA 4UD5A 4KLOA 8ICJA 7ICFA 2BE3A 4WC6A 3AU2A 4AT9A 8ICLA 4XA5A 4RT3A 9ICRA 4FHPA 4LZDA 3TFSA 1ZQQA 4XRHA 4I2BA 4KLLA 8ICPA 3HX0A 1BPDA 1ZQTA 3WFQE 7ICMA 9ICXA 4WC0A 5J2DA 5J2CA 4RWNA 1ZQHA 2ZH1A 5CHGA 4WC3A 4RQ7A 4Z6DA 3OV7A 3H38A 4MFCA 7ICQA 1MIYA 4X4QA 1ZQNA 9ICPA 9ICTA 4IQTA 3V7KA 4YD1A 4RPZA 5CB1A 4YN4A 1JQRA 2ZH4A 4M5DA 4KLFA 3C2MA 4DOCA 4Z6CA 4QZIA 4F5OA 3K75D 4XUSA 4RQ8A 4WBYA 4PHEA 8ICAA 4RQ3A 2ZHBA 4M9NA 3OVAA 5EOZA 4M47A 3C5GA 3RJJA 2M2VA 4S3NA 1ZQGA 5J2BA 4JWMA 4KLJA 3WFRE 5J0OA 1ZQWA 3AQNA 1MQ3A 3MDAA 1JN3A
chains in the Genus database with same CATH superfamily
9ICWA 3UQ0A 4FO6A 4E80A 3H39A 2PXIA 3V7JA 5CWRA 1UEUA 5BPCA 4R63A 3HWTA 4K98A 2GA9D 4KLTA 3PMNA 1ZQSA 4UB5A 4NXXA 5HR9A 1MIWA 4X4TA 4TURA 4PGXA 5CHEA 5HRLA 2FMPA 4PHPA 4OAIZ 5DB7A 4NLZA 4NXZA 4I2DA 4QZDA 3AQMA 5HHIA 2DR8A 4X5VA 4I0UA 2ZH9A 1ZQVA 4F5QA 3AQKA 4KLGA 4P2HA 3LK9A 3K7DA 4O5CA 4UAWA 4HX0A 4DO9A 5CFUA 3C2LA 4RQ1A 2BCQA 4WC5A 7ICUA 4WC4A 2DR7A 1ZQOA 1MIVA 2HN1A 3B0YA 1JAJA 2EWRA 2ZH2A 9ICJA 4KLQA 4AT8B 4UD4A 4XJEA 4IQVA 3C5FA 1ZQEA 4K9AA 9ICSA 1ZQCA 5HRHA 2FCLA 3JCFA 5DBAA 7ICOA 3HJ1A 9ICQA 1RPLA 5J0XA 2GAFD 4QZBA 4X4PA 4WQLA 5HRGA 5DBBA 4KLSA 1VJ7A 1KDHA 4WH5A 8ICRA 2I9GA 5HRFA 3EF2A 4RWOA 4AT7B 2DRAA 8ICOA 8ICNA 3CK6A 4LZGA 9ICIA 3OVBA 4IQWA 4X4RA 5DDMA 7ICKA 4M9JA 1ZQMA 3UXNA 4ATBA 1R8AA 4YMNA 3HW8A 8ICIA 4M04A 5J0TA 3MGHA 3V72A 1BPBA 4QZGA 2HHPA 2PFOA 1PX5A 5D62A 4XQ8A 4RWPA 4M9LA 2ID1A 3B0XA 3H37A 4K8VA 4E7XA 5IIMA 8ICCA 4OAGA 4I2CA 4I2HA 2RFFA 5J0RA 2DVIA 1ZQRA 9ICAA 1JMSA 5DECA 4O5EA 4UB2A 4MFFA 4OAHA 4IQUA 3JPOA 4RQ6A 5J2JA 1XSNA 4UAZA 4FH3A 3ISCA 2B4VA 3MBYA 4NKTA 3TFRA 2PFPA 4KB6A 5J2GA 4JLZA 4LVSA 1ZQIA 7ICRA 9ICHA 3PHZA 4F5NA 3OVSA 2BCVA 4FH5A 5IIKA 4PHAA 4MF8A 5IIIA 1ZQBA 5HRBA 3WFPA 9ICGA 4TUPA 1NO5A 1WOTA 2IHMA 5B3PA 4I28A 3RJGA 7ICLA 3OWGA 4QZCA 1V4AA 3ISBA 4NXVA 4QZAA 1R8CA 1KEJA 4Z6EA 4UAYA 4P4PA 4I2GA 4M2YA 4O67A 1TV9A 1VFGA 4I27A 7ICGA 7ICTA 4WCWA 5J0QA 5DBCA 3NKUA 2HN2A 9ICMA 1HUOA 4MFAA 4EV6A 5DB8A 4R65A 7ICNA 2BCUA 1XSLA 4RWQA 3ERCC 1ZQUA 4O69A 4GXIA 2O5AA 3L9DA 4FO1A 7ICVA 4I29A 4UB3A 1ZQPA 4NKUA 4TUSA 2GWSA 3UPSA 4I2JA 5DDYA 4E8FA 9ICCA 4P4OA 4X4NA 4K4HA 3JPQA 3V7LA 4YCXA 4O68A 3MGIA 7ICHA 2ZHAA 4M9HA 4Z6FA 2B56A 4RQ2A 3OUYB 4K4IA 5CFTA 1TVAA 2DR9A 7ICPA 4JWNA 9ICKA 5J2HA 5IINA 5CP2A 1YLQA 4P4MA 4RPYA 1FA0A 4AT8A 3RJHA 4MF2A 5D49A 2BBJA 4NXTA 4EP7A 1MQ2A 5J2FA 2ZH5A 3HIYA 4QZHA 3RJEA 3AQLA 3RH5A 4X4VA 1ZQJA 2M2TA 4KLMA 3C2KA 4R66A 4DOBA 5HRIA 3OGUA 9ICNA 1XSPA 1Q79A 4UBCA 2ZH3A 8ICXA 2PFQA 4FHVA 1ZQYA 3ER9B 4WC1A 2BPGA 9ICLA 4K4GA 4M9GA 2ZH8A 3RH6A 1BPEA 4PGQA 4QZEA 2FMSA 1GPJA 4PPXA 5J2EA 1ZQAA 4WC7A 2BPFA 3UQ2A 3RJKA 2FMQA 5J0UA 4AT9B 3NYBA 4MKPA 4NXUA 5DB6A 3JPPA 4FHXA 1NOMA 4YMOA 1BPZA 5HRDA 4XQ7A 2M2WA 7ICJA 4EEBA 3GDXA 1UETA 5J0WA 3JZ0A 4KLEA 5J0YA 4LEYA 1OU5A 2W9MA 5J0SA 3JPSA 3WFSC 9ICEA 5J2KA 8ICTA 2B51A 1F5AA 4TUQA 5HHHA 4JLXA 2P66A 5J0PA 3PMLA 8ICQA 3NWIA 5J29A 2IUBA 4UBBA 3AUOA 4KLUA 4KLDA 2NRKA 2PFNA 1ZQFA 2DRBA 4KLIA 4LEVA 4KM5A 5CA7A 1KNYA 4QZFA 1HUZA 4EBJA 4O9MA 3MCRA 9ICBA 7ICSA 3C66A 4WOYA 2BBHA 4OAFA 1ZQDA 8ICKA 4RQ0A 3LQCB 4NM2A 5CJ7A 5J2AA 1ZQKA 3NVOA 3UPQA 5IILA 4YMMA 8ICBA 1R8BA 1ZJMA 8ICMA 3AU6A 3UXPA 5D46A 5HREA 5BOLA 1UEVA 4RT2A 4K99A 4LT6A 4NLKA 4GXKA 4UB1A 2Q66A 3ISDA 5DB9A 5BOMA 3UXOA 5HC9A 3HJ4A 2ISPA 5J2IA 4M0AA 1ZJNA 7ICIA 8ICWA 4NXWA 4O6AA 2BPCA 5B3QA 8ICUA 5D4BA 4UB4A 4GXJA 1TFWA 8ICFA 3ER8C 4WBZA 5CFSA 4R64A 4RPXA 4K96A 3JPRA 4EBKA 2PBEA 1ZQXA 2DR5A 4WC2A 5TZVA 5DKWA 3JPTA 3OUYA 7ICEA 8ICYA 4PHDA 8ICSA 8ICEA 1R89A 2M2UA 9ICUA 4K9BA 3PNCA 4QZ8A 4X4UA 1ZQLA 3WFOA 4X4SA 2BCSA 5JTGA 4F5PA 3RH4A 9ICFA 4F5RA 3MDCA 4LEZA 9ICOA 4NY8A 5IIOA 4FHYA 4O5KA 4X4OA 1ZQZA 4X0BA 2BCRA 2O1PA 5DEDA 4K97A 1TFYA 4AT7A 1Q78A 5HRKA 8ICGA 4KLHA 4EEDA 5CR0A 8ICVA 4I2IA 8ICHA 5D61A 3RJIA 2ZH6A 4QZ9A 4FHWA 4YD2A 4IG8A 9ICVA 4PGYA 4I2EA 4X0AA 2ZH7A 4RQ5A 1RZTA 3H3AA 3JPNA 8ICZA 4ATBB 2ISOA 3C18A 1BPXA 4NM1A 4N7RA 4NLNA 5IIJA 3RJFA 4I2AA 4DOAA 4PH5A 4RQ4A 1BPYA 5F2VO 3JYYA 2VANA 4I2FA 4UD5A 4KLOA 4LEWA 8ICJA 7ICFA 2BE3A 4WC6A 3AU2A 4AT9A 8ICLA 4XA5A 4RT3A 9ICRA 4FHPA 4LZDA 3TFSA 1ZQQA 4XRHA 4I2BA 4KLLA 8ICPA 3HX0A 1BPDA 4EGWA 1ZQTA 3WFQE 7ICMA 9ICXA 4WC0A 5J2DA 5J2CA 4RWNA 1ZQHA 2ZH1A 5CHGA 4WC3A 4RQ7A 4Z6DA 3OV7A 3H38A 4MFCA 7ICQA 1MIYA 4X4QA 1ZQNA 9ICPA 9ICTA 4IQTA 3V7KA 4YD1A 4RPZA 5CB1A 4YN4A 1JQRA 2ZH4A 4M5DA 4KLFA 2IHOA 3C2MA 4DOCA 4Z6CA 4QZIA 4F5OA 3K75D 4XUSA 4RQ8A 4WBYA 4PHEA 8ICAA 4RQ3A 2ZHBA 4WQKA 4M9NA 3OVAA 5EOZA 4M47A 3C5GA 3RJJA 2M2VA 4S3NA 1ZQGA 5J2BA 4JWMA 4KLJA 3WFRE 5J0OA 1ZQWA 3AQNA 1MQ3A 3MDAA 5D63A 1JN3A
chains in the Genus database with same CATH topology
9ICWA 3UQ0A 4FO6A 4E80A 3H39A 2PXIA 3V7JA 5CWRA 1UEUA 5BPCA 4R63A 3HWTA 4KLTA 3PMNA 1ZQSA 4UB5A 5HR9A 1MIWA 4X4TA 4TURA 4PGXA 5HRLA 2FMPA 4PHPA 5DB7A 4NLZA 4NXZA 4I2DA 4QZDA 3AQMA 5HHIA 2DR8A 4X5VA 2ZH9A 1ZQVA 4F5QA 3AQKA 4KLGA 4P2HA 3LK9A 4O5CA 4UAWA 4DO9A 3C2LA 4RQ1A 2BCQA 4WC5A 7ICUA 4WC4A 2DR7A 1ZQOA 1MIVA 3B0YA 1JAJA 2ZH2A 9ICJA 4KLQA 4AT8B 4UD4A 4IQVA 3C5FA 1ZQEA 9ICSA 1ZQCA 5HRHA 7ICOA 9ICQA 5DBAA 3HJ1A 1RPLA 5J0XA 4QZBA 4X4PA 5HRGA 5DBBA 4KLSA 1VJ7A 1KDHA 8ICRA 2I9GA 5HRFA 4RWOA 4AT7B 2DRAA 8ICOA 8ICNA 4LZGA 9ICIA 3OVBA 4IQWA 4X4RA 5DDMA 7ICKA 4M9JA 1ZQMA 3UXNA 4ATBA 1R8AA 4YMNA 3HW8A 8ICIA 4M04A 5J0TA 3MGHA 3V72A 1BPBA 4QZGA 2HHPA 2PFOA 1PX5A 4XQ8A 4RWPA 4M9LA 2ID1A 3B0XA 3H37A 4E7XA 5IIMA 8ICCA 4I2CA 4I2HA 2RFFA 5J0RA 2DVIA 1ZQRA 9ICAA 1JMSA 5DECA 4O5EA 4UB2A 4MFFA 3JPOA 4IQUA 4RQ6A 5J2JA 1XSNA 4UAZA 4FH3A 3ISCA 3MBYA 4NKTA 3TFRA 2PFPA 5J2GA 4LVSA 1ZQIA 7ICRA 9ICHA 4F5NA 3OVSA 2BCVA 4FH5A 5IIKA 4PHAA 4MF8A 5IIIA 1ZQBA 5HRBA 3WFPA 9ICGA 4TUPA 1NO5A 1WOTA 2IHMA 4I28A 3RJGA 7ICLA 4QZCA 1V4AA 3ISBA 4QZAA 1R8CA 1KEJA 4Z6EA 4UAYA 4P4PA 4I2GA 4M2YA 1TV9A 1VFGA 4I27A 7ICGA 7ICTA 4WCWA 5J0QA 5DBCA 9ICMA 1HUOA 4MFAA 5DB8A 4R65A 7ICNA 2BCUA 1XSLA 4RWQA 1ZQUA 4GXIA 2O5AA 3L9DA 7ICVA 4I29A 4UB3A 1ZQPA 4NKUA 4TUSA 2GWSA 3UPSA 4I2JA 5DDYA 4E8FA 9ICCA 4P4OA 4X4NA 4K4HA 3JPQA 3V7LA 4YCXA 3MGIA 7ICHA 2ZHAA 4M9HA 4Z6FA 4RQ2A 3OUYB 4K4IA 1TVAA 2DR9A 7ICPA 4JWNA 9ICKA 5J2HA 5IINA 5CP2A 1YLQA 4P4MA 4RPYA 1FA0A 4AT8A 3RJHA 4MF2A 5D49A 4EP7A 1MQ2A 5J2FA 2ZH5A 3HIYA 4QZHA 3RJEA 3AQLA 3RH5A 4X4VA 1ZQJA 2M2TA 4KLMA 3C2KA 4R66A 4DOBA 5HRIA 3OGUA 9ICNA 1XSPA 1Q79A 4UBCA 2ZH3A 8ICXA 2PFQA 4FHVA 1ZQYA 2BPGA 4WC1A 9ICLA 4K4GA 4M9GA 2ZH8A 3RH6A 1BPEA 4PGQA 4QZEA 2FMSA 4PPXA 5J2EA 1ZQAA 4WC7A 2BPFA 3UQ2A 3RJKA 2FMQA 5J0UA 4AT9B 3NYBA 5DB6A 3JPPA 4FHXA 1NOMA 4YMOA 1BPZA 5HRDA 4XQ7A 2M2WA 7ICJA 3GDXA 1UETA 5J0WA 3JZ0A 4KLEA 5J0YA 1OU5A 2W9MA 5J0SA 3JPSA 3WFSC 9ICEA 5J2KA 8ICTA 1F5AA 4TUQA 5HHHA 2P66A 5J0PA 3PMLA 8ICQA 5J29A 4UBBA 3AUOA 4KLUA 4KLDA 2NRKA 2PFNA 1ZQFA 2DRBA 4KLIA 5CA7A 1KNYA 4QZFA 1HUZA 4EBJA 4O9MA 9ICBA 7ICSA 3C66A 1ZQDA 8ICKA 4RQ0A 3LQCB 4NM2A 5CJ7A 5J2AA 1ZQKA 3UPQA 5IILA 4YMMA 8ICBA 1R8BA 1ZJMA 8ICMA 3AU6A 3UXPA 5D46A 5HREA 5BOLA 1UEVA 4RT2A 4LT6A 4NLKA 4GXKA 4UB1A 2Q66A 3ISDA 5DB9A 5BOMA 3UXOA 5HC9A 3HJ4A 2ISPA 5J2IA 4M0AA 1ZJNA 7ICIA 8ICWA 2BPCA 8ICUA 5D4BA 4UB4A 4GXJA 1TFWA 8ICFA 4WBZA 4R64A 4RPXA 3JPRA 4EBKA 2PBEA 1ZQXA 2DR5A 4WC2A 5TZVA 5DKWA 3JPTA 3OUYA 7ICEA 8ICYA 4PHDA 8ICSA 8ICEA 1R89A 2M2UA 9ICUA 3PNCA 4QZ8A 4X4UA 1ZQLA 3WFOA 4X4SA 2BCSA 4F5PA 3RH4A 9ICFA 4F5RA 3MDCA 9ICOA 4NY8A 5IIOA 4FHYA 4O5KA 4X4OA 1ZQZA 4X0BA 2BCRA 2O1PA 5DEDA 1TFYA 4AT7A 1Q78A 5HRKA 8ICGA 4KLHA 5CR0A 8ICVA 4I2IA 8ICHA 3RJIA 2ZH6A 4QZ9A 4FHWA 4YD2A 4IG8A 9ICVA 4PGYA 4I2EA 4X0AA 2ZH7A 4RQ5A 1RZTA 3H3AA 3JPNA 8ICZA 4ATBB 2ISOA 3C18A 1BPXA 4NM1A 4NLNA 5IIJA 3RJFA 4I2AA 4DOAA 4PH5A 4RQ4A 1BPYA 5F2VO 3JYYA 2VANA 4I2FA 4UD5A 4KLOA 8ICJA 7ICFA 2BE3A 4WC6A 3AU2A 4AT9A 8ICLA 4XA5A 4RT3A 9ICRA 4FHPA 4LZDA 3TFSA 1ZQQA 4XRHA 4I2BA 4KLLA 8ICPA 3HX0A 1BPDA 1ZQTA 3WFQE 7ICMA 9ICXA 4WC0A 5J2DA 5J2CA 4RWNA 1ZQHA 2ZH1A 5CHGA 4WC3A 4RQ7A 4Z6DA 3OV7A 3H38A 4MFCA 7ICQA 1MIYA 4X4QA 1ZQNA 9ICPA 9ICTA 4IQTA 3V7KA 4YD1A 4RPZA 5CB1A 4YN4A 1JQRA 2ZH4A 4M5DA 4KLFA 3C2MA 4DOCA 4Z6CA 4QZIA 4F5OA 3K75D 4XUSA 4RQ8A 4WBYA 4PHEA 8ICAA 4RQ3A 2ZHBA 4M9NA 3OVAA 5EOZA 4M47A 3C5GA 3RJJA 2M2VA 4S3NA 1ZQGA 5J2BA 4JWMA 4KLJA 3WFRE 5J0OA 1ZQWA 3AQNA 1MQ3A 3MDAA 1JN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICW A;  3UQ0 A;  4FO6 A;  4E80 A;  3H39 A;  2PXI A;  3V7J A;  5CWR A;  1UEU A;  5BPC A;  4R63 A;  3HWT A;  4KLT A;  3PMN A;  1ZQS A;  4UB5 A;  5HR9 A;  1MIW A;  4X4T A;  4TUR A;  4PGX A;  5HRL A;  2FMP A;  4PHP A;  5DB7 A;  4NLZ A;  4NXZ A;  4I2D A;  4QZD A;  3AQM A;  5HHI A;  2DR8 A;  4X5V A;  2ZH9 A;  1ZQV A;  4F5Q A;  3AQK A;  4KLG A;  4P2H A;  3LK9 A;  4O5C A;  4UAW A;  4DO9 A;  3C2L A;  4RQ1 A;  2BCQ A;  4WC5 A;  7ICU A;  4WC4 A;  2DR7 A;  1ZQO A;  1MIV A;  3B0Y A;  1JAJ A;  2ZH2 A;  9ICJ A;  4KLQ A;  4AT8 B;  4UD4 A;  4IQV A;  3C5F A;  1ZQE A;  9ICS A;  1ZQC A;  5HRH A;  7ICO A;  9ICQ A;  5DBA A;  3HJ1 A;  1RPL A;  5J0X A;  4QZB A;  4X4P A;  5HRG A;  5DBB A;  4KLS A;  1VJ7 A;  1KDH A;  8ICR A;  2I9G A;  5HRF A;  4RWO A;  4AT7 B;  2DRA A;  8ICO A;  8ICN A;  4LZG A;  9ICI A;  3OVB A;  4IQW A;  4X4R A;  5DDM A;  7ICK A;  4M9J A;  1ZQM A;  3UXN A;  4ATB A;  1R8A A;  4YMN A;  3HW8 A;  8ICI A;  4M04 A;  5J0T A;  3MGH A;  3V72 A;  1BPB A;  4QZG A;  2HHP A;  2PFO A;  1PX5 A;  4XQ8 A;  4RWP A;  4M9L A;  2ID1 A;  3B0X A;  3H37 A;  4E7X A;  5IIM A;  8ICC A;  4I2C A;  4I2H A;  2RFF A;  5J0R A;  2DVI A;  1ZQR A;  9ICA A;  1JMS A;  5DEC A;  4O5E A;  4UB2 A;  4MFF A;  3JPO A;  4IQU A;  4RQ6 A;  5J2J A;  1XSN A;  4UAZ A;  4FH3 A;  3ISC A;  3MBY A;  4NKT A;  3TFR A;  2PFP A;  5J2G A;  4LVS A;  1ZQI A;  7ICR A;  9ICH A;  4F5N A;  3OVS A;  2BCV A;  4FH5 A;  5IIK A;  4PHA A;  4MF8 A;  5III A;  1ZQB A;  5HRB A;  3WFP A;  9ICG A;  4TUP A;  1NO5 A;  1WOT A;  2IHM A;  4I28 A;  3RJG A;  7ICL A;  4QZC A;  1V4A A;  3ISB A;  4QZA A;  1R8C A;  1KEJ A;  4Z6E A;  4UAY A;  4P4P A;  4I2G A;  4M2Y A;  1TV9 A;  1VFG A;  4I27 A;  7ICG A;  7ICT A;  4WCW A;  5J0Q A;  5DBC A;  9ICM A;  1HUO A;  4MFA A;  5DB8 A;  4R65 A;  7ICN A;  2BCU A;  1XSL A;  4RWQ A;  1ZQU A;  4GXI A;  2O5A A;  3L9D A;  7ICV A;  4I29 A;  4UB3 A;  1ZQP A;  4NKU A;  4TUS A;  2GWS A;  3UPS A;  4I2J A;  5DDY A;  4E8F A;  9ICC A;  4P4O A;  4X4N A;  4K4H A;  3JPQ A;  3V7L A;  4YCX A;  3MGI A;  7ICH A;  2ZHA A;  4M9H A;  4Z6F A;  4RQ2 A;  3OUY B;  4K4I A;  1TVA A;  2DR9 A;  7ICP A;  4JWN A;  9ICK A;  5J2H A;  5IIN A;  5CP2 A;  1YLQ A;  4P4M A;  4RPY A;  1FA0 A;  4AT8 A;  3RJH A;  4MF2 A;  5D49 A;  4EP7 A;  1MQ2 A;  5J2F A;  2ZH5 A;  3HIY A;  4QZH A;  3RJE A;  3AQL A;  3RH5 A;  4X4V A;  1ZQJ A;  2M2T A;  4KLM A;  3C2K A;  4R66 A;  4DOB A;  5HRI A;  3OGU A;  9ICN A;  1XSP A;  1Q79 A;  4UBC A;  2ZH3 A;  8ICX A;  2PFQ A;  4FHV A;  1ZQY A;  2BPG A;  4WC1 A;  9ICL A;  4K4G A;  4M9G A;  2ZH8 A;  3RH6 A;  1BPE A;  4PGQ A;  4QZE A;  2FMS A;  4PPX A;  5J2E A;  1ZQA A;  4WC7 A;  2BPF A;  3UQ2 A;  3RJK A;  2FMQ A;  5J0U A;  4AT9 B;  3NYB A;  5DB6 A;  3JPP A;  4FHX A;  1NOM A;  4YMO A;  1BPZ A;  5HRD A;  4XQ7 A;  2M2W A;  7ICJ A;  3GDX A;  1UET A;  5J0W A;  3JZ0 A;  4KLE A;  5J0Y A;  1OU5 A;  2W9M A;  5J0S A;  3JPS A;  3WFS C;  9ICE A;  5J2K A;  8ICT A;  1F5A A;  4TUQ A;  5HHH A;  2P66 A;  5J0P A;  3PML A;  8ICQ A;  5J29 A;  4UBB A;  3AUO A;  4KLU A;  4KLD A;  2NRK A;  2PFN A;  1ZQF A;  2DRB A;  4KLI A;  5CA7 A;  1KNY A;  4QZF A;  1HUZ A;  4EBJ A;  4O9M A;  9ICB A;  7ICS A;  3C66 A;  1ZQD A;  8ICK A;  4RQ0 A;  3LQC B;  4NM2 A;  5CJ7 A;  5J2A A;  1ZQK A;  3UPQ A;  5IIL A;  4YMM A;  8ICB A;  1R8B A;  1ZJM A;  8ICM A;  3AU6 A;  3UXP A;  5D46 A;  5HRE A;  5BOL A;  1UEV A;  4RT2 A;  4LT6 A;  4NLK A;  4GXK A;  4UB1 A;  2Q66 A;  3ISD A;  5DB9 A;  5BOM A;  3UXO A;  5HC9 A;  3HJ4 A;  2ISP A;  5J2I A;  4M0A A;  1ZJN A;  7ICI A;  8ICW A;  2BPC A;  8ICU A;  5D4B A;  4UB4 A;  4GXJ A;  1TFW A;  8ICF A;  4WBZ A;  4R64 A;  4RPX A;  3JPR A;  4EBK A;  2PBE A;  1ZQX A;  2DR5 A;  4WC2 A;  5TZV A;  5DKW A;  3JPT A;  3OUY A;  7ICE A;  8ICY A;  4PHD A;  8ICS A;  8ICE A;  1R89 A;  2M2U A;  9ICU A;  3PNC A;  4QZ8 A;  4X4U A;  1ZQL A;  3WFO A;  4X4S A;  2BCS A;  4F5P A;  3RH4 A;  9ICF A;  4F5R A;  3MDC A;  9ICO A;  4NY8 A;  5IIO A;  4FHY A;  4O5K A;  4X4O A;  1ZQZ A;  4X0B A;  2BCR A;  2O1P A;  5DED A;  1TFY A;  4AT7 A;  1Q78 A;  5HRK A;  8ICG A;  4KLH A;  5CR0 A;  8ICV A;  4I2I A;  8ICH A;  3RJI A;  2ZH6 A;  4QZ9 A;  4FHW A;  4YD2 A;  4IG8 A;  9ICV A;  4PGY A;  4I2E A;  4X0A A;  2ZH7 A;  4RQ5 A;  1RZT A;  3H3A A;  3JPN A;  8ICZ A;  4ATB B;  2ISO A;  3C18 A;  1BPX A;  4NM1 A;  4NLN A;  5IIJ A;  3RJF A;  4I2A A;  4DOA A;  4PH5 A;  4RQ4 A;  1BPY A;  5F2V O;  3JYY A;  2VAN A;  4I2F A;  4UD5 A;  4KLO A;  8ICJ A;  7ICF A;  2BE3 A;  4WC6 A;  3AU2 A;  4AT9 A;  8ICL A;  4XA5 A;  4RT3 A;  9ICR A;  4FHP A;  4LZD A;  3TFS A;  1ZQQ A;  4XRH A;  4I2B A;  4KLL A;  8ICP A;  3HX0 A;  1BPD A;  1ZQT A;  3WFQ E;  7ICM A;  9ICX A;  4WC0 A;  5J2D A;  5J2C A;  4RWN A;  1ZQH A;  2ZH1 A;  5CHG A;  4WC3 A;  4RQ7 A;  4Z6D A;  3OV7 A;  3H38 A;  4MFC A;  7ICQ A;  1MIY A;  4X4Q A;  1ZQN A;  9ICP A;  9ICT A;  4IQT A;  3V7K A;  4YD1 A;  4RPZ A;  5CB1 A;  4YN4 A;  1JQR A;  2ZH4 A;  4M5D A;  4KLF A;  3C2M A;  4DOC A;  4Z6C A;  4QZI A;  4F5O A;  3K75 D;  4XUS A;  4RQ8 A;  4WBY A;  4PHE A;  8ICA A;  4RQ3 A;  2ZHB A;  4M9N A;  3OVA A;  5EOZ A;  4M47 A;  3C5G A;  3RJJ A;  2M2V A;  4S3N A;  1ZQG A;  5J2B A;  4JWM A;  4KLJ A;  3WFR E;  5J0O A;  1ZQW A;  3AQN A;  1MQ3 A;  3MDA A;  1JN3 A; 
#chains in the Genus database with same CATH topology
 9ICW A;  3UQ0 A;  4FO6 A;  4E80 A;  3H39 A;  2PXI A;  3V7J A;  5CWR A;  1UEU A;  5BPC A;  4R63 A;  3HWT A;  4K98 A;  2GA9 D;  4KLT A;  3PMN A;  1ZQS A;  4UB5 A;  4NXX A;  5HR9 A;  1MIW A;  4X4T A;  4TUR A;  4PGX A;  5CHE A;  5HRL A;  2FMP A;  4PHP A;  4OAI Z;  5DB7 A;  4NLZ A;  4NXZ A;  4I2D A;  4QZD A;  3AQM A;  5HHI A;  2DR8 A;  4X5V A;  4I0U A;  2ZH9 A;  1ZQV A;  4F5Q A;  3AQK A;  4KLG A;  4P2H A;  3LK9 A;  3K7D A;  4O5C A;  4UAW A;  4HX0 A;  4DO9 A;  5CFU A;  3C2L A;  4RQ1 A;  2BCQ A;  4WC5 A;  7ICU A;  4WC4 A;  2DR7 A;  1ZQO A;  1MIV A;  2HN1 A;  3B0Y A;  1JAJ A;  2EWR A;  2ZH2 A;  9ICJ A;  4KLQ A;  4AT8 B;  4UD4 A;  4XJE A;  4IQV A;  3C5F A;  1ZQE A;  4K9A A;  9ICS A;  1ZQC A;  5HRH A;  2FCL A;  3JCF A;  5DBA A;  7ICO A;  3HJ1 A;  9ICQ A;  1RPL A;  5J0X A;  2GAF D;  4QZB A;  4X4P A;  4WQL A;  5HRG A;  5DBB A;  4KLS A;  1VJ7 A;  1KDH A;  4WH5 A;  8ICR A;  2I9G A;  5HRF A;  3EF2 A;  4RWO A;  4AT7 B;  2DRA A;  8ICO A;  8ICN A;  3CK6 A;  4LZG A;  9ICI A;  3OVB A;  4IQW A;  4X4R A;  5DDM A;  7ICK A;  4M9J A;  1ZQM A;  3UXN A;  4ATB A;  1R8A A;  4YMN A;  3HW8 A;  8ICI A;  4M04 A;  5J0T A;  3MGH A;  3V72 A;  1BPB A;  4QZG A;  2HHP A;  2PFO A;  1PX5 A;  5D62 A;  4XQ8 A;  4RWP A;  4M9L A;  2ID1 A;  3B0X A;  3H37 A;  4K8V A;  4E7X A;  5IIM A;  8ICC A;  4OAG A;  4I2C A;  4I2H A;  2RFF A;  5J0R A;  2DVI A;  1ZQR A;  9ICA A;  1JMS A;  5DEC A;  4O5E A;  4UB2 A;  4MFF A;  4OAH A;  4IQU A;  3JPO A;  4RQ6 A;  5J2J A;  1XSN A;  4UAZ A;  4FH3 A;  3ISC A;  2B4V A;  3MBY A;  4NKT A;  3TFR A;  2PFP A;  4KB6 A;  5J2G A;  4JLZ A;  4LVS A;  1ZQI A;  7ICR A;  9ICH A;  3PHZ A;  4F5N A;  3OVS A;  2BCV A;  4FH5 A;  5IIK A;  4PHA A;  4MF8 A;  5III A;  1ZQB A;  5HRB A;  3WFP A;  9ICG A;  4TUP A;  1NO5 A;  1WOT A;  2IHM A;  5B3P A;  4I28 A;  3RJG A;  7ICL A;  3OWG A;  4QZC A;  1V4A A;  3ISB A;  4NXV A;  4QZA A;  1R8C A;  1KEJ A;  4Z6E A;  4UAY A;  4P4P A;  4I2G A;  4M2Y A;  4O67 A;  1TV9 A;  1VFG A;  4I27 A;  7ICG A;  7ICT A;  4WCW A;  5J0Q A;  5DBC A;  3NKU A;  2HN2 A;  9ICM A;  1HUO A;  4MFA A;  4EV6 A;  5DB8 A;  4R65 A;  7ICN A;  2BCU A;  1XSL A;  4RWQ A;  3ERC C;  1ZQU A;  4O69 A;  4GXI A;  2O5A A;  3L9D A;  4FO1 A;  7ICV A;  4I29 A;  4UB3 A;  1ZQP A;  4NKU A;  4TUS A;  2GWS A;  3UPS A;  4I2J A;  5DDY A;  4E8F A;  9ICC A;  4P4O A;  4X4N A;  4K4H A;  3JPQ A;  3V7L A;  4YCX A;  4O68 A;  3MGI A;  7ICH A;  2ZHA A;  4M9H A;  4Z6F A;  2B56 A;  4RQ2 A;  3OUY B;  4K4I A;  5CFT A;  1TVA A;  2DR9 A;  7ICP A;  4JWN A;  9ICK A;  5J2H A;  5IIN A;  5CP2 A;  1YLQ A;  4P4M A;  4RPY A;  1FA0 A;  4AT8 A;  3RJH A;  4MF2 A;  5D49 A;  2BBJ A;  4NXT A;  4EP7 A;  1MQ2 A;  5J2F A;  2ZH5 A;  3HIY A;  4QZH A;  3RJE A;  3AQL A;  3RH5 A;  4X4V A;  1ZQJ A;  2M2T A;  4KLM A;  3C2K A;  4R66 A;  4DOB A;  5HRI A;  3OGU A;  9ICN A;  1XSP A;  1Q79 A;  4UBC A;  2ZH3 A;  8ICX A;  2PFQ A;  4FHV A;  1ZQY A;  3ER9 B;  4WC1 A;  2BPG A;  9ICL A;  4K4G A;  4M9G A;  2ZH8 A;  3RH6 A;  1BPE A;  4PGQ A;  4QZE A;  2FMS A;  1GPJ A;  4PPX A;  5J2E A;  1ZQA A;  4WC7 A;  2BPF A;  3UQ2 A;  3RJK A;  2FMQ A;  5J0U A;  4AT9 B;  3NYB A;  4MKP A;  4NXU A;  5DB6 A;  3JPP A;  4FHX A;  1NOM A;  4YMO A;  1BPZ A;  5HRD A;  4XQ7 A;  2M2W A;  7ICJ A;  4EEB A;  3GDX A;  1UET A;  5J0W A;  3JZ0 A;  4KLE A;  5J0Y A;  4LEY A;  1OU5 A;  2W9M A;  5J0S A;  3JPS A;  3WFS C;  9ICE A;  5J2K A;  8ICT A;  2B51 A;  1F5A A;  4TUQ A;  5HHH A;  4JLX A;  2P66 A;  5J0P A;  3PML A;  8ICQ A;  3NWI A;  5J29 A;  2IUB A;  4UBB A;  3AUO A;  4KLU A;  4KLD A;  2NRK A;  2PFN A;  1ZQF A;  2DRB A;  4KLI A;  4LEV A;  4KM5 A;  5CA7 A;  1KNY A;  4QZF A;  1HUZ A;  4EBJ A;  4O9M A;  3MCR A;  9ICB A;  7ICS A;  3C66 A;  4WOY A;  2BBH A;  4OAF A;  1ZQD A;  8ICK A;  4RQ0 A;  3LQC B;  4NM2 A;  5CJ7 A;  5J2A A;  1ZQK A;  3NVO A;  3UPQ A;  5IIL A;  4YMM A;  8ICB A;  1R8B A;  1ZJM A;  8ICM A;  3AU6 A;  3UXP A;  5D46 A;  5HRE A;  5BOL A;  1UEV A;  4RT2 A;  4K99 A;  4LT6 A;  4NLK A;  4GXK A;  4UB1 A;  2Q66 A;  3ISD A;  5DB9 A;  5BOM A;  3UXO A;  5HC9 A;  3HJ4 A;  2ISP A;  5J2I A;  4M0A A;  1ZJN A;  7ICI A;  8ICW A;  4NXW A;  4O6A A;  2BPC A;  5B3Q A;  8ICU A;  5D4B A;  4UB4 A;  4GXJ A;  1TFW A;  8ICF A;  3ER8 C;  4WBZ A;  5CFS A;  4R64 A;  4RPX A;  4K96 A;  3JPR A;  4EBK A;  2PBE A;  1ZQX A;  2DR5 A;  4WC2 A;  5TZV A;  5DKW A;  3JPT A;  3OUY A;  7ICE A;  8ICY A;  4PHD A;  8ICS A;  8ICE A;  1R89 A;  2M2U A;  9ICU A;  4K9B A;  3PNC A;  4QZ8 A;  4X4U A;  1ZQL A;  3WFO A;  4X4S A;  2BCS A;  5JTG A;  4F5P A;  3RH4 A;  9ICF A;  4F5R A;  3MDC A;  4LEZ A;  9ICO A;  4NY8 A;  5IIO A;  4FHY A;  4O5K A;  4X4O A;  1ZQZ A;  4X0B A;  2BCR A;  2O1P A;  5DED A;  4K97 A;  1TFY A;  4AT7 A;  1Q78 A;  5HRK A;  8ICG A;  4KLH A;  4EED A;  5CR0 A;  8ICV A;  4I2I A;  8ICH A;  5D61 A;  3RJI A;  2ZH6 A;  4QZ9 A;  4FHW A;  4YD2 A;  4IG8 A;  9ICV A;  4PGY A;  4I2E A;  4X0A A;  2ZH7 A;  4RQ5 A;  1RZT A;  3H3A A;  3JPN A;  8ICZ A;  4ATB B;  2ISO A;  3C18 A;  1BPX A;  4NM1 A;  4N7R A;  4NLN A;  5IIJ A;  3RJF A;  4I2A A;  4DOA A;  4PH5 A;  4RQ4 A;  1BPY A;  5F2V O;  3JYY A;  2VAN A;  4I2F A;  4UD5 A;  4KLO A;  4LEW A;  8ICJ A;  7ICF A;  2BE3 A;  4WC6 A;  3AU2 A;  4AT9 A;  8ICL A;  4XA5 A;  4RT3 A;  9ICR A;  4FHP A;  4LZD A;  3TFS A;  1ZQQ A;  4XRH A;  4I2B A;  4KLL A;  8ICP A;  3HX0 A;  1BPD A;  4EGW A;  1ZQT A;  3WFQ E;  7ICM A;  9ICX A;  4WC0 A;  5J2D A;  5J2C A;  4RWN A;  1ZQH A;  2ZH1 A;  5CHG A;  4WC3 A;  4RQ7 A;  4Z6D A;  3OV7 A;  3H38 A;  4MFC A;  7ICQ A;  1MIY A;  4X4Q A;  1ZQN A;  9ICP A;  9ICT A;  4IQT A;  3V7K A;  4YD1 A;  4RPZ A;  5CB1 A;  4YN4 A;  1JQR A;  2ZH4 A;  4M5D A;  4KLF A;  2IHO A;  3C2M A;  4DOC A;  4Z6C A;  4QZI A;  4F5O A;  3K75 D;  4XUS A;  4RQ8 A;  4WBY A;  4PHE A;  8ICA A;  4RQ3 A;  2ZHB A;  4WQK A;  4M9N A;  3OVA A;  5EOZ A;  4M47 A;  3C5G A;  3RJJ A;  2M2V A;  4S3N A;  1ZQG A;  5J2B A;  4JWM A;  4KLJ A;  3WFR E;  5J0O A;  1ZQW A;  3AQN A;  1MQ3 A;  3MDA A;  5D63 A;  1JN3 A; 
#chains in the Genus database with same CATH homology
 9ICW A;  3UQ0 A;  4FO6 A;  4E80 A;  3H39 A;  2PXI A;  3V7J A;  5CWR A;  1UEU A;  5BPC A;  4R63 A;  3HWT A;  4KLT A;  3PMN A;  1ZQS A;  4UB5 A;  5HR9 A;  1MIW A;  4X4T A;  4TUR A;  4PGX A;  5HRL A;  2FMP A;  4PHP A;  5DB7 A;  4NLZ A;  4NXZ A;  4I2D A;  4QZD A;  3AQM A;  5HHI A;  2DR8 A;  4X5V A;  2ZH9 A;  1ZQV A;  4F5Q A;  3AQK A;  4KLG A;  4P2H A;  3LK9 A;  4O5C A;  4UAW A;  4DO9 A;  3C2L A;  4RQ1 A;  2BCQ A;  4WC5 A;  7ICU A;  4WC4 A;  2DR7 A;  1ZQO A;  1MIV A;  3B0Y A;  1JAJ A;  2ZH2 A;  9ICJ A;  4KLQ A;  4AT8 B;  4UD4 A;  4IQV A;  3C5F A;  1ZQE A;  9ICS A;  1ZQC A;  5HRH A;  7ICO A;  9ICQ A;  5DBA A;  3HJ1 A;  1RPL A;  5J0X A;  4QZB A;  4X4P A;  5HRG A;  5DBB A;  4KLS A;  1VJ7 A;  1KDH A;  8ICR A;  2I9G A;  5HRF A;  4RWO A;  4AT7 B;  2DRA A;  8ICO A;  8ICN A;  4LZG A;  9ICI A;  3OVB A;  4IQW A;  4X4R A;  5DDM A;  7ICK A;  4M9J A;  1ZQM A;  3UXN A;  4ATB A;  1R8A A;  4YMN A;  3HW8 A;  8ICI A;  4M04 A;  5J0T A;  3MGH A;  3V72 A;  1BPB A;  4QZG A;  2HHP A;  2PFO A;  1PX5 A;  4XQ8 A;  4RWP A;  4M9L A;  2ID1 A;  3B0X A;  3H37 A;  4E7X A;  5IIM A;  8ICC A;  4I2C A;  4I2H A;  2RFF A;  5J0R A;  2DVI A;  1ZQR A;  9ICA A;  1JMS A;  5DEC A;  4O5E A;  4UB2 A;  4MFF A;  3JPO A;  4IQU A;  4RQ6 A;  5J2J A;  1XSN A;  4UAZ A;  4FH3 A;  3ISC A;  3MBY A;  4NKT A;  3TFR A;  2PFP A;  5J2G A;  4LVS A;  1ZQI A;  7ICR A;  9ICH A;  4F5N A;  3OVS A;  2BCV A;  4FH5 A;  5IIK A;  4PHA A;  4MF8 A;  5III A;  1ZQB A;  5HRB A;  3WFP A;  9ICG A;  4TUP A;  1NO5 A;  1WOT A;  2IHM A;  4I28 A;  3RJG A;  7ICL A;  4QZC A;  1V4A A;  3ISB A;  4QZA A;  1R8C A;  1KEJ A;  4Z6E A;  4UAY A;  4P4P A;  4I2G A;  4M2Y A;  1TV9 A;  1VFG A;  4I27 A;  7ICG A;  7ICT A;  4WCW A;  5J0Q A;  5DBC A;  9ICM A;  1HUO A;  4MFA A;  5DB8 A;  4R65 A;  7ICN A;  2BCU A;  1XSL A;  4RWQ A;  1ZQU A;  4GXI A;  2O5A A;  3L9D A;  7ICV A;  4I29 A;  4UB3 A;  1ZQP A;  4NKU A;  4TUS A;  2GWS A;  3UPS A;  4I2J A;  5DDY A;  4E8F A;  9ICC A;  4P4O A;  4X4N A;  4K4H A;  3JPQ A;  3V7L A;  4YCX A;  3MGI A;  7ICH A;  2ZHA A;  4M9H A;  4Z6F A;  4RQ2 A;  3OUY B;  4K4I A;  1TVA A;  2DR9 A;  7ICP A;  4JWN A;  9ICK A;  5J2H A;  5IIN A;  5CP2 A;  1YLQ A;  4P4M A;  4RPY A;  1FA0 A;  4AT8 A;  3RJH A;  4MF2 A;  5D49 A;  4EP7 A;  1MQ2 A;  5J2F A;  2ZH5 A;  3HIY A;  4QZH A;  3RJE A;  3AQL A;  3RH5 A;  4X4V A;  1ZQJ A;  2M2T A;  4KLM A;  3C2K A;  4R66 A;  4DOB A;  5HRI A;  3OGU A;  9ICN A;  1XSP A;  1Q79 A;  4UBC A;  2ZH3 A;  8ICX A;  2PFQ A;  4FHV A;  1ZQY A;  2BPG A;  4WC1 A;  9ICL A;  4K4G A;  4M9G A;  2ZH8 A;  3RH6 A;  1BPE A;  4PGQ A;  4QZE A;  2FMS A;  4PPX A;  5J2E A;  1ZQA A;  4WC7 A;  2BPF A;  3UQ2 A;  3RJK A;  2FMQ A;  5J0U A;  4AT9 B;  3NYB A;  5DB6 A;  3JPP A;  4FHX A;  1NOM A;  4YMO A;  1BPZ A;  5HRD A;  4XQ7 A;  2M2W A;  7ICJ A;  3GDX A;  1UET A;  5J0W A;  3JZ0 A;  4KLE A;  5J0Y A;  1OU5 A;  2W9M A;  5J0S A;  3JPS A;  3WFS C;  9ICE A;  5J2K A;  8ICT A;  1F5A A;  4TUQ A;  5HHH A;  2P66 A;  5J0P A;  3PML A;  8ICQ A;  5J29 A;  4UBB A;  3AUO A;  4KLU A;  4KLD A;  2NRK A;  2PFN A;  1ZQF A;  2DRB A;  4KLI A;  5CA7 A;  1KNY A;  4QZF A;  1HUZ A;  4EBJ A;  4O9M A;  9ICB A;  7ICS A;  3C66 A;  1ZQD A;  8ICK A;  4RQ0 A;  3LQC B;  4NM2 A;  5CJ7 A;  5J2A A;  1ZQK A;  3UPQ A;  5IIL A;  4YMM A;  8ICB A;  1R8B A;  1ZJM A;  8ICM A;  3AU6 A;  3UXP A;  5D46 A;  5HRE A;  5BOL A;  1UEV A;  4RT2 A;  4LT6 A;  4NLK A;  4GXK A;  4UB1 A;  2Q66 A;  3ISD A;  5DB9 A;  5BOM A;  3UXO A;  5HC9 A;  3HJ4 A;  2ISP A;  5J2I A;  4M0A A;  1ZJN A;  7ICI A;  8ICW A;  2BPC A;  8ICU A;  5D4B A;  4UB4 A;  4GXJ A;  1TFW A;  8ICF A;  4WBZ A;  4R64 A;  4RPX A;  3JPR A;  4EBK A;  2PBE A;  1ZQX A;  2DR5 A;  4WC2 A;  5TZV A;  5DKW A;  3JPT A;  3OUY A;  7ICE A;  8ICY A;  4PHD A;  8ICS A;  8ICE A;  1R89 A;  2M2U A;  9ICU A;  3PNC A;  4QZ8 A;  4X4U A;  1ZQL A;  3WFO A;  4X4S A;  2BCS A;  4F5P A;  3RH4 A;  9ICF A;  4F5R A;  3MDC A;  9ICO A;  4NY8 A;  5IIO A;  4FHY A;  4O5K A;  4X4O A;  1ZQZ A;  4X0B A;  2BCR A;  2O1P A;  5DED A;  1TFY A;  4AT7 A;  1Q78 A;  5HRK A;  8ICG A;  4KLH A;  5CR0 A;  8ICV A;  4I2I A;  8ICH A;  3RJI A;  2ZH6 A;  4QZ9 A;  4FHW A;  4YD2 A;  4IG8 A;  9ICV A;  4PGY A;  4I2E A;  4X0A A;  2ZH7 A;  4RQ5 A;  1RZT A;  3H3A A;  3JPN A;  8ICZ A;  4ATB B;  2ISO A;  3C18 A;  1BPX A;  4NM1 A;  4NLN A;  5IIJ A;  3RJF A;  4I2A A;  4DOA A;  4PH5 A;  4RQ4 A;  1BPY A;  5F2V O;  3JYY A;  2VAN A;  4I2F A;  4UD5 A;  4KLO A;  8ICJ A;  7ICF A;  2BE3 A;  4WC6 A;  3AU2 A;  4AT9 A;  8ICL A;  4XA5 A;  4RT3 A;  9ICR A;  4FHP A;  4LZD A;  3TFS A;  1ZQQ A;  4XRH A;  4I2B A;  4KLL A;  8ICP A;  3HX0 A;  1BPD A;  1ZQT A;  3WFQ E;  7ICM A;  9ICX A;  4WC0 A;  5J2D A;  5J2C A;  4RWN A;  1ZQH A;  2ZH1 A;  5CHG A;  4WC3 A;  4RQ7 A;  4Z6D A;  3OV7 A;  3H38 A;  4MFC A;  7ICQ A;  1MIY A;  4X4Q A;  1ZQN A;  9ICP A;  9ICT A;  4IQT A;  3V7K A;  4YD1 A;  4RPZ A;  5CB1 A;  4YN4 A;  1JQR A;  2ZH4 A;  4M5D A;  4KLF A;  3C2M A;  4DOC A;  4Z6C A;  4QZI A;  4F5O A;  3K75 D;  4XUS A;  4RQ8 A;  4WBY A;  4PHE A;  8ICA A;  4RQ3 A;  2ZHB A;  4M9N A;  3OVA A;  5EOZ A;  4M47 A;  3C5G A;  3RJJ A;  2M2V A;  4S3N A;  1ZQG A;  5J2B A;  4JWM A;  4KLJ A;  3WFR E;  5J0O A;  1ZQW A;  3AQN A;  1MQ3 A;  3MDA A;  1JN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...