2M2TA

Asfv pol x structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
molecule keywords Repair DNA polymerase X
total genus 41
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2tA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2tA01
7ICRA 4KLGA 1UEVA 5BPCA 4MFFA 2ZH9A 4X4SA 3MDCA 7ICVA 4DOAA 3OUYA 9ICKA 3V72A 8ICHA 3HX0A 3C18A 1MIYA 3RJGA 3ISCA 9ICMA 3RJKA 4YD1A 7ICGA 2PFOA 3AQMA 1FA0A 4RQ6A 3TFRA 1BPBA 4UAWA 1V4AA 1ZQLA 1JMSA 4UBBA 4O9MA 4X4TA 4NLKA 4O5CA 3V7LA 4KLQA 4WC6A 8ICZA 5DB7A 4AT7B 4RWOA 2ZH6A 3OVAA 1ZQFA 5DDMA 5TZVA 4UD5A 3HWTA 4YCXA 9ICCA 4AT8B 5DBBA 3NYBA 4PHPA 3JZ0A 1Q79A 3UQ2A 4RT2A 1ZQPA 4EBKA 4YMNA 5J2JA 9ICPA 4KLEA 1KEJA 4X4OA 4IQVA 4Z6DA 4RPYA 3MGIA 2BCVA 9ICRA 4Z6EA 5IIKA 8ICLA 4I27A 9ICJA 4WBYA 1TFWA 5J0WA 4JWMA 3JPNA 4F5QA 3MDAA 5D4BA 1HUZA 8ICYA 3H39A 4I2AA 8ICRA 3V7KA 4EP7A 3AUOA 2ZHAA 4NXZA 5J29A 1MIWA 4NLZA 2DRBA 4WC7A 3GDXA 3RJJA 2IHMA 8ICJA 4IQUA 3HJ1A 1VFGA 4RQ8A 4RWNA 4UB4A 4P2HA 3JPQA 3AQKA 2FMQA 8ICIA 5DB6A 4R65A 4X0BA 4M0AA 4QZHA 3PMLA 5J2EA 3L9DA 3WFSC 4QZFA 1ZQQA 4FHVA 4E80A 4I2CA 1Q78A 1ZQXA 7ICMA 4I2BA 8ICXA 5HREA 5D49A 1BPDA 4QZDA 4ATBA 4K4HA 4NKUA 1PX5A 3WFRE 1ZQRA 3RH5A 3JYYA 3JPOA 9ICFA 5J0XA 4TUQA 4F5RA 4O5KA 4X4PA 8ICVA 2VANA 2M2VA 4I2EA 3UQ0A 4I2IA 5J2FA 5CWRA 2I9GA 2NRKA 8ICCA 2GWSA 9ICXA 3K75D 1MIVA 5BOLA 4XA5A 8ICQA 5HHIA 4UAYA 3MGHA 4X4RA 4F5OA 2DRAA 4YN4A 2BCUA 2BCRA 4FH5A 8ICMA 5DDYA 3AQNA 3C5FA 5BOMA 1ZQCA 2ZHBA 5HRHA 4DO9A 1R8AA 1XSLA 8ICPA 5CHGA 4KLDA 4FHXA 5D46A 4XRHA 1ZQOA 4FHPA 2BPCA 1R8CA 4MFAA 4RQ5A 5HRBA 5DB8A 4M2YA 5J2BA 4PHDA 9ICEA 5IILA 4I2DA 2M2TA 1ZQTA 8ICTA 9ICUA 1ZQHA 4M47A 1MQ3A 4KLMA 9ICHA 4RQ3A 9ICBA 7ICFA 3WFPA 4M9NA 4I2JA 5HRLA 4RPZA 2BE3A 4KLIA 2PBEA 2DR7A 5HRKA 4FO6A 4FHYA 4IG8A 4S3NA 7ICQA 5IIOA 3TFSA 2FMPA 4X4VA 4I29A 2PXIA 4PH5A 4PGYA 8ICNA 5J0UA 5J0PA 4KLUA 1JQRA 5HRFA 7ICNA 4YMMA 4P4MA 4LZGA 7ICJA 5CJ7A 3JPTA 4KLOA 2ZH1A 5F2VO 4QZAA 5J2AA 4R66A 2M2UA 4M9HA 2Q66A 1XSNA 1ZQBA 4NLNA 4FH3A 1ZQZA 1ZQIA 4DOCA 7ICLA 4RQ4A 5J0SA 4R63A 3JPRA 4UB2A 1BPYA 2PFQA 4GXJA 5HRIA 3C2KA 4LZDA 4RQ1A 4RQ7A 4QZCA 3PNCA 5J2IA 5CR0A 1UEUA 4PHEA 4X0AA 5J0TA 1HUOA 3B0YA 4YD2A 1TVAA 5J0OA 4MFCA 4KLJA 1TFYA 5HHHA 1ZQKA 8ICOA 5J2CA 4UAZA 2M2WA 5J2HA 2ISOA 4KLFA 3C2LA 4WC1A 7ICSA 4XQ7A 4QZ8A 4F5PA 9ICLA 4IQWA 3UPSA 7ICUA 4EBJA 8ICBA 3RJFA 4NM2A 4AT9B 4I2GA 4Z6FA 5DBCA 5HRDA 1OU5A 3RH6A 9ICNA 4TURA 9ICOA 4QZ9A 3JPPA 4IQTA 7ICKA 1F5AA 4PGQA 8ICKA 2FMSA 2HHPA 4NKTA 4NY8A 3HIYA 1XSPA 3HW8A 4X5VA 4QZGA 1ZQDA 2BCQA 4AT9A 3UXNA 1ZQWA 1KDHA 3LK9A 7ICEA 4FHWA 5HC9A 3MBYA 2DR9A 4LT6A 9ICVA 3V7JA 4RQ2A 8ICFA 2BPGA 2O1PA 7ICTA 1ZQAA 5J0RA 4WC0A 1UETA 4TUPA 2W9MA 4QZEA 5DB9A 5IINA 3C66A 4KLTA 4UBCA 2ZH7A 3LQCB 5J2KA 1VJ7A 4WC3A 4KLHA 2ISPA 1BPZA 5CB1A 4AT7A 5IIMA 3B0XA 5IIJA 5CA7A 4GXKA 3UPQA 4KLLA 4WBZA 1ZQEA 3OVSA 5J2DA 4E7XA 5DKWA 3OUYB 7ICIA 1ZQUA 4XUSA 2P66A 4M9JA 1ZQSA 2ZH8A 5HR9A 1BPEA 7ICPA 4QZIA 4WC4A 4WC5A 1ZQMA 3PMNA 1NO5A 1ZQYA 5DEDA 9ICSA 5CP2A 1ZJMA 3H38A 4RWQA 4KLSA 4M5DA 3OVBA 2BCSA 2PFPA 4PPXA 4WCWA 2DR5A 2BPFA 3RJHA 4UD4A 5DBAA 4P4OA 4NM1A 3RH4A 1YLQA 2PFNA 3OV7A 1R8BA 1ZQGA 3ISDA 1ZJNA 2O5AA 2RFFA 4I28A 3C5GA 4DOBA 1ZQNA 4X4QA 4WC2A 4AT8A 3C2MA 1R89A 2ZH3A 9ICQA 3JPSA 4R64A 3AQLA 5DECA 3WFQE 3H37A 1TV9A 3H3AA 3WFOA 8ICAA 2ZH5A 4JWNA 4M04A 2ZH2A 4X4NA 8ICWA 3HJ4A 2DR8A 4K4GA 1ZQJA 4K4IA 4O5EA 4GXIA 3AU6A 4TUSA 3AU2A 4RWPA 4M9GA 4UB3A 4PGXA 8ICEA 1MQ2A 5IIIA 5EOZA 4RQ0A 1RZTA 1ZQVA 9ICWA 2DVIA 7ICHA 1KNYA 3RJEA 4ATBB 1JN3A 4P4PA 4PHAA 4E8FA 4I2FA 3RJIA 4QZBA 4Z6CA 9ICTA 2ZH4A 4RT3A 5J0QA 3OGUA 4LVSA 4I2HA 9ICGA 4UB5A 2ID1A 4F5NA 1NOMA 3UXPA 5J0YA 4XQ8A 4UB1A 9ICAA 1RPLA 1BPXA 9ICIA 4MF8A 4X4UA 3ISBA 8ICUA 8ICGA 5HRGA 1WOTA 4RPXA 4MF2A 8ICSA 4M9LA 5J2GA 1JAJA 3UXOA 4YMOA 7ICOA
chains in the Genus database with same CATH superfamily
7ICRA 4KLGA 1UEVA 5BPCA 4MFFA 2IUBA 2ZH9A 4X4SA 3MDCA 7ICVA 4DOAA 5B3QA 3OUYA 9ICKA 3V72A 8ICHA 3HX0A 3C18A 1MIYA 4NXVA 3RJGA 3ISCA 9ICMA 3RJKA 4YD1A 7ICGA 2PFOA 3AQMA 1FA0A 4RQ6A 3TFRA 1BPBA 4UAWA 4OAIZ 1V4AA 1ZQLA 1JMSA 4UBBA 4O9MA 4X4TA 4NLKA 4O5CA 4LEZA 3V7LA 4KLQA 4WC6A 8ICZA 5DB7A 3OWGA 4AT7B 4RWOA 4K99A 4OAHA 2ZH6A 3OVAA 1ZQFA 5DDMA 5TZVA 4UD5A 3HWTA 4YCXA 9ICCA 4AT8B 5DBBA 3NYBA 4PHPA 3JZ0A 1Q79A 3UQ2A 4RT2A 1ZQPA 4EBKA 4YMNA 5J2JA 9ICPA 4KLEA 1KEJA 2B56A 4WQKA 4X4OA 4IQVA 4Z6DA 4RPYA 3MGIA 2BCVA 9ICRA 4Z6EA 5IIKA 8ICLA 4I27A 9ICJA 4WBYA 1TFWA 3ER9B 4WH5A 5J0WA 4I0UA 4JWMA 4NXTA 4JLZA 4OAFA 3JPNA 4F5QA 3MDAA 3ER8C 5D4BA 1HUZA 8ICYA 3H39A 4I2AA 8ICRA 3V7KA 4EP7A 3AUOA 2ZHAA 4NXZA 5D61A 5J29A 1MIWA 4NLZA 2DRBA 4WC7A 3GDXA 3RJJA 2BBHA 2IHMA 8ICJA 4IQUA 3HJ1A 1VFGA 4RQ8A 4RWNA 4UB4A 4P2HA 3JPQA 3AQKA 2FMQA 8ICIA 5DB6A 4R65A 4X0BA 4M0AA 4QZHA 3PMLA 5J2EA 3L9DA 3WFSC 4QZFA 1ZQQA 4FHVA 4E80A 4I2CA 1Q78A 1ZQXA 7ICMA 4I2BA 8ICXA 5HREA 5D49A 1BPDA 4QZDA 4ATBA 4K4HA 4NKUA 1PX5A 3WFRE 1ZQRA 3RH5A 3JYYA 3JPOA 9ICFA 5J0XA 4TUQA 4LEWA 4K96A 4F5RA 4O5KA 4X4PA 8ICVA 2VANA 2M2VA 4I2EA 3UQ0A 4I2IA 5J2FA 5CWRA 4MKPA 2I9GA 2NRKA 3JCFA 5CFTA 8ICCA 2GWSA 9ICXA 3K75D 1MIVA 5BOLA 4XA5A 8ICQA 5HHIA 4UAYA 3MGHA 2HN1A 4X4RA 4F5OA 2DRAA 4YN4A 2BCUA 2BCRA 4FH5A 8ICMA 5DDYA 3AQNA 3C5FA 5BOMA 1ZQCA 2ZHBA 5HRHA 4DO9A 1R8AA 1XSLA 8ICPA 5CHGA 4KLDA 4FHXA 5D46A 4XRHA 3NWIA 1ZQOA 4FHPA 2BPCA 1R8CA 4MFAA 4RQ5A 5HRBA 5DB8A 4EEBA 4M2YA 4K9AA 5J2BA 4PHDA 9ICEA 5IILA 4I2DA 2M2TA 1ZQTA 8ICTA 9ICUA 1ZQHA 4M47A 1MQ3A 4KLMA 9ICHA 4RQ3A 9ICBA 7ICFA 4LEVA 3WFPA 4M9NA 4I2JA 5HRLA 4RPZA 2BE3A 4KLIA 2PBEA 2DR7A 5HRKA 4FO6A 4FHYA 4IG8A 4S3NA 7ICQA 5IIOA 3TFSA 2FMPA 4X4VA 4I29A 2PXIA 4PH5A 4PGYA 8ICNA 5J0UA 5J0PA 4KLUA 5D62A 1JQRA 5HRFA 3EF2A 7ICNA 4YMMA 4P4MA 4LZGA 4XJEA 7ICJA 5CJ7A 3JPTA 4KLOA 2B4VA 2ZH1A 5F2VO 4QZAA 5J2AA 4R66A 2M2UA 4M9HA 2Q66A 1XSNA 1ZQBA 4NLNA 4FH3A 1ZQZA 1ZQIA 4DOCA 7ICLA 4RQ4A 5J0SA 4R63A 3JPRA 5D63A 4UB2A 1BPYA 2PFQA 4GXJA 5HRIA 3C2KA 4LZDA 4RQ1A 4HX0A 4RQ7A 3CK6A 4QZCA 3PNCA 5J2IA 4O67A 5CR0A 2IHOA 1UEUA 4PHEA 4X0AA 5J0TA 1HUOA 3B0YA 4YD2A 1TVAA 5J0OA 4MFCA 4KLJA 1TFYA 5HHHA 1ZQKA 8ICOA 5J2CA 4UAZA 2M2WA 5J2HA 2ISOA 4KLFA 3ERCC 3C2LA 4KB6A 4WC1A 3NKUA 7ICSA 4XQ7A 4QZ8A 4F5PA 9ICLA 4IQWA 3UPSA 7ICUA 4EBJA 8ICBA 3RJFA 4NM2A 4AT9B 4I2GA 4Z6FA 2GA9D 4K97A 5DBCA 5HRDA 1OU5A 4NXWA 3RH6A 9ICNA 4TURA 9ICOA 4QZ9A 3JPPA 4IQTA 7ICKA 1F5AA 4PGQA 8ICKA 2FMSA 2HHPA 4NKTA 4NY8A 3HIYA 1XSPA 2GAFD 3HW8A 4X5VA 4QZGA 1ZQDA 2BCQA 4AT9A 3UXNA 1ZQWA 1KDHA 3LK9A 7ICEA 4FHWA 5HC9A 3MBYA 2DR9A 2B51A 4LT6A 4OAGA 9ICVA 3V7JA 4RQ2A 8ICFA 4WQLA 4NXXA 2BPGA 2O1PA 7ICTA 1ZQAA 5J0RA 4WC0A 1UETA 4FO1A 5B3PA 4TUPA 2W9MA 4QZEA 5DB9A 5IINA 3C66A 4KLTA 4UBCA 4K8VA 2ZH7A 3LQCB 5J2KA 1VJ7A 4WC3A 4KLHA 2ISPA 1BPZA 5CB1A 4AT7A 5IIMA 3B0XA 4LEYA 5IIJA 2EWRA 5CA7A 2FCLA 4O69A 4GXKA 3UPQA 4KLLA 5CFUA 4WBZA 1ZQEA 3OVSA 5J2DA 4E7XA 5DKWA 3OUYB 7ICIA 1ZQUA 5CHEA 4XUSA 2P66A 4M9JA 1ZQSA 4N7RA 2ZH8A 5HR9A 1BPEA 7ICPA 4QZIA 4WC4A 4WC5A 1ZQMA 3PMNA 1NO5A 1ZQYA 4NXUA 5DEDA 9ICSA 5CP2A 1ZJMA 5CFSA 3H38A 4RWQA 4K98A 4KLSA 4M5DA 3OVBA 2BCSA 2PFPA 4EEDA 4PPXA 4WCWA 2DR5A 2BPFA 3RJHA 4UD4A 5DBAA 4P4OA 4NM1A 3RH4A 1YLQA 2PFNA 3OV7A 1R8BA 1ZQGA 3ISDA 1ZJNA 2O5AA 2RFFA 3K7DA 4I28A 3C5GA 4DOBA 1ZQNA 4X4QA 4WC2A 4AT8A 3C2MA 1R89A 2ZH3A 9ICQA 3JPSA 4R64A 3AQLA 4WOYA 5DECA 3WFQE 3H37A 1TV9A 3H3AA 3WFOA 8ICAA 2ZH5A 4JWNA 4M04A 2ZH2A 4X4NA 8ICWA 4EGWA 3HJ4A 2DR8A 4KM5A 4K4GA 2BBJA 1ZQJA 4K4IA 4O5EA 4K9BA 4GXIA 3AU6A 4TUSA 3AU2A 4RWPA 4M9GA 3PHZA 4UB3A 4PGXA 8ICEA 1MQ2A 5IIIA 5EOZA 4RQ0A 1RZTA 4O6AA 1ZQVA 9ICWA 2DVIA 7ICHA 1KNYA 3RJEA 4O68A 1JN3A 4ATBB 4P4PA 4PHAA 4E8FA 4I2FA 3RJIA 4QZBA 4Z6CA 9ICTA 2ZH4A 4RT3A 4EV6A 5J0QA 3OGUA 4LVSA 4I2HA 9ICGA 4UB5A 2ID1A 4F5NA 1NOMA 3UXPA 5J0YA 1GPJA 4XQ8A 4UB1A 9ICAA 1RPLA 1BPXA 9ICIA 4MF8A 4X4UA 3ISBA 8ICUA 8ICGA 5HRGA 2HN2A 3MCRA 1WOTA 3NVOA 4RPXA 4MF2A 8ICSA 4JLXA 4M9LA 5J2GA 1JAJA 3UXOA 4YMOA 5JTGA 7ICOA
chains in the Genus database with same CATH topology
7ICRA 4KLGA 1UEVA 5BPCA 4MFFA 2ZH9A 4X4SA 3MDCA 7ICVA 4DOAA 3OUYA 9ICKA 3V72A 8ICHA 3HX0A 3C18A 1MIYA 3RJGA 3ISCA 9ICMA 3RJKA 4YD1A 7ICGA 2PFOA 3AQMA 1FA0A 4RQ6A 3TFRA 1BPBA 4UAWA 1V4AA 1ZQLA 1JMSA 4UBBA 4O9MA 4X4TA 4NLKA 4O5CA 3V7LA 4KLQA 4WC6A 8ICZA 5DB7A 4AT7B 4RWOA 2ZH6A 3OVAA 1ZQFA 5DDMA 5TZVA 4UD5A 3HWTA 4YCXA 9ICCA 4AT8B 5DBBA 3NYBA 4PHPA 3JZ0A 1Q79A 3UQ2A 4RT2A 1ZQPA 4EBKA 4YMNA 5J2JA 9ICPA 4KLEA 1KEJA 4X4OA 4IQVA 4Z6DA 4RPYA 3MGIA 2BCVA 9ICRA 4Z6EA 5IIKA 8ICLA 4I27A 9ICJA 4WBYA 1TFWA 5J0WA 4JWMA 3JPNA 4F5QA 3MDAA 5D4BA 1HUZA 8ICYA 3H39A 4I2AA 8ICRA 3V7KA 4EP7A 3AUOA 2ZHAA 4NXZA 5J29A 1MIWA 4NLZA 2DRBA 4WC7A 3GDXA 3RJJA 2IHMA 8ICJA 4IQUA 3HJ1A 1VFGA 4RQ8A 4RWNA 4UB4A 4P2HA 3JPQA 3AQKA 2FMQA 8ICIA 5DB6A 4R65A 4X0BA 4M0AA 4QZHA 3PMLA 5J2EA 3L9DA 3WFSC 4QZFA 1ZQQA 4FHVA 4E80A 4I2CA 1Q78A 1ZQXA 7ICMA 4I2BA 8ICXA 5HREA 5D49A 1BPDA 4QZDA 4ATBA 4K4HA 4NKUA 1PX5A 3WFRE 1ZQRA 3RH5A 3JYYA 3JPOA 9ICFA 5J0XA 4TUQA 4F5RA 4O5KA 4X4PA 8ICVA 2VANA 2M2VA 4I2EA 3UQ0A 4I2IA 5J2FA 5CWRA 2I9GA 2NRKA 8ICCA 2GWSA 9ICXA 3K75D 1MIVA 5BOLA 4XA5A 8ICQA 5HHIA 4UAYA 3MGHA 4X4RA 4F5OA 2DRAA 4YN4A 2BCUA 2BCRA 4FH5A 8ICMA 5DDYA 3AQNA 3C5FA 5BOMA 1ZQCA 2ZHBA 5HRHA 4DO9A 1R8AA 1XSLA 8ICPA 5CHGA 4KLDA 4FHXA 5D46A 4XRHA 1ZQOA 4FHPA 2BPCA 1R8CA 4MFAA 4RQ5A 5HRBA 5DB8A 4M2YA 5J2BA 4PHDA 9ICEA 5IILA 4I2DA 2M2TA 1ZQTA 8ICTA 9ICUA 1ZQHA 4M47A 1MQ3A 4KLMA 9ICHA 4RQ3A 9ICBA 7ICFA 3WFPA 4M9NA 4I2JA 5HRLA 4RPZA 2BE3A 4KLIA 2PBEA 2DR7A 5HRKA 4FO6A 4FHYA 4IG8A 4S3NA 7ICQA 5IIOA 3TFSA 2FMPA 4X4VA 4I29A 2PXIA 4PH5A 4PGYA 8ICNA 5J0UA 5J0PA 4KLUA 1JQRA 5HRFA 7ICNA 4YMMA 4P4MA 4LZGA 7ICJA 5CJ7A 3JPTA 4KLOA 2ZH1A 5F2VO 4QZAA 5J2AA 4R66A 2M2UA 4M9HA 2Q66A 1XSNA 1ZQBA 4NLNA 4FH3A 1ZQZA 1ZQIA 4DOCA 7ICLA 4RQ4A 5J0SA 4R63A 3JPRA 4UB2A 1BPYA 2PFQA 4GXJA 5HRIA 3C2KA 4LZDA 4RQ1A 4RQ7A 4QZCA 3PNCA 5J2IA 5CR0A 1UEUA 4PHEA 4X0AA 5J0TA 1HUOA 3B0YA 4YD2A 1TVAA 5J0OA 4MFCA 4KLJA 1TFYA 5HHHA 1ZQKA 8ICOA 5J2CA 4UAZA 2M2WA 5J2HA 2ISOA 4KLFA 3C2LA 4WC1A 7ICSA 4XQ7A 4QZ8A 4F5PA 9ICLA 4IQWA 3UPSA 7ICUA 4EBJA 8ICBA 3RJFA 4NM2A 4AT9B 4I2GA 4Z6FA 5DBCA 5HRDA 1OU5A 3RH6A 9ICNA 4TURA 9ICOA 4QZ9A 3JPPA 4IQTA 7ICKA 1F5AA 4PGQA 8ICKA 2FMSA 2HHPA 4NKTA 4NY8A 3HIYA 1XSPA 3HW8A 4X5VA 4QZGA 1ZQDA 2BCQA 4AT9A 3UXNA 1ZQWA 1KDHA 3LK9A 7ICEA 4FHWA 5HC9A 3MBYA 2DR9A 4LT6A 9ICVA 3V7JA 4RQ2A 8ICFA 2BPGA 2O1PA 7ICTA 1ZQAA 5J0RA 4WC0A 1UETA 4TUPA 2W9MA 4QZEA 5DB9A 5IINA 3C66A 4KLTA 4UBCA 2ZH7A 3LQCB 5J2KA 1VJ7A 4WC3A 4KLHA 2ISPA 1BPZA 5CB1A 4AT7A 5IIMA 3B0XA 5IIJA 5CA7A 4GXKA 3UPQA 4KLLA 4WBZA 1ZQEA 3OVSA 5J2DA 4E7XA 5DKWA 3OUYB 7ICIA 1ZQUA 4XUSA 2P66A 4M9JA 1ZQSA 2ZH8A 5HR9A 1BPEA 7ICPA 4QZIA 4WC4A 4WC5A 1ZQMA 3PMNA 1NO5A 1ZQYA 5DEDA 9ICSA 5CP2A 1ZJMA 3H38A 4RWQA 4KLSA 4M5DA 3OVBA 2BCSA 2PFPA 4PPXA 4WCWA 2DR5A 2BPFA 3RJHA 4UD4A 5DBAA 4P4OA 4NM1A 3RH4A 1YLQA 2PFNA 3OV7A 1R8BA 1ZQGA 3ISDA 1ZJNA 2O5AA 2RFFA 4I28A 3C5GA 4DOBA 1ZQNA 4X4QA 4WC2A 4AT8A 3C2MA 1R89A 2ZH3A 9ICQA 3JPSA 4R64A 3AQLA 5DECA 3WFQE 3H37A 1TV9A 3H3AA 3WFOA 8ICAA 2ZH5A 4JWNA 4M04A 2ZH2A 4X4NA 8ICWA 3HJ4A 2DR8A 4K4GA 1ZQJA 4K4IA 4O5EA 4GXIA 3AU6A 4TUSA 3AU2A 4RWPA 4M9GA 4UB3A 4PGXA 8ICEA 1MQ2A 5IIIA 5EOZA 4RQ0A 1RZTA 1ZQVA 9ICWA 2DVIA 7ICHA 1KNYA 3RJEA 4ATBB 1JN3A 4P4PA 4PHAA 4E8FA 4I2FA 3RJIA 4QZBA 4Z6CA 9ICTA 2ZH4A 4RT3A 5J0QA 3OGUA 4LVSA 4I2HA 9ICGA 4UB5A 2ID1A 4F5NA 1NOMA 3UXPA 5J0YA 4XQ8A 4UB1A 9ICAA 1RPLA 1BPXA 9ICIA 4MF8A 4X4UA 3ISBA 8ICUA 8ICGA 5HRGA 1WOTA 4RPXA 4MF2A 8ICSA 4M9LA 5J2GA 1JAJA 3UXOA 4YMOA 7ICOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICR A;  4KLG A;  1UEV A;  5BPC A;  4MFF A;  2ZH9 A;  4X4S A;  3MDC A;  7ICV A;  4DOA A;  3OUY A;  9ICK A;  3V72 A;  8ICH A;  3HX0 A;  3C18 A;  1MIY A;  3RJG A;  3ISC A;  9ICM A;  3RJK A;  4YD1 A;  7ICG A;  2PFO A;  3AQM A;  1FA0 A;  4RQ6 A;  3TFR A;  1BPB A;  4UAW A;  1V4A A;  1ZQL A;  1JMS A;  4UBB A;  4O9M A;  4X4T A;  4NLK A;  4O5C A;  3V7L A;  4KLQ A;  4WC6 A;  8ICZ A;  5DB7 A;  4AT7 B;  4RWO A;  2ZH6 A;  3OVA A;  1ZQF A;  5DDM A;  5TZV A;  4UD5 A;  3HWT A;  4YCX A;  9ICC A;  4AT8 B;  5DBB A;  3NYB A;  4PHP A;  3JZ0 A;  1Q79 A;  3UQ2 A;  4RT2 A;  1ZQP A;  4EBK A;  4YMN A;  5J2J A;  9ICP A;  4KLE A;  1KEJ A;  4X4O A;  4IQV A;  4Z6D A;  4RPY A;  3MGI A;  2BCV A;  9ICR A;  4Z6E A;  5IIK A;  8ICL A;  4I27 A;  9ICJ A;  4WBY A;  1TFW A;  5J0W A;  4JWM A;  3JPN A;  4F5Q A;  3MDA A;  5D4B A;  1HUZ A;  8ICY A;  3H39 A;  4I2A A;  8ICR A;  3V7K A;  4EP7 A;  3AUO A;  2ZHA A;  4NXZ A;  5J29 A;  1MIW A;  4NLZ A;  2DRB A;  4WC7 A;  3GDX A;  3RJJ A;  2IHM A;  8ICJ A;  4IQU A;  3HJ1 A;  1VFG A;  4RQ8 A;  4RWN A;  4UB4 A;  4P2H A;  3JPQ A;  3AQK A;  2FMQ A;  8ICI A;  5DB6 A;  4R65 A;  4X0B A;  4M0A A;  4QZH A;  3PML A;  5J2E A;  3L9D A;  3WFS C;  4QZF A;  1ZQQ A;  4FHV A;  4E80 A;  4I2C A;  1Q78 A;  1ZQX A;  7ICM A;  4I2B A;  8ICX A;  5HRE A;  5D49 A;  1BPD A;  4QZD A;  4ATB A;  4K4H A;  4NKU A;  1PX5 A;  3WFR E;  1ZQR A;  3RH5 A;  3JYY A;  3JPO A;  9ICF A;  5J0X A;  4TUQ A;  4F5R A;  4O5K A;  4X4P A;  8ICV A;  2VAN A;  2M2V A;  4I2E A;  3UQ0 A;  4I2I A;  5J2F A;  5CWR A;  2I9G A;  2NRK A;  8ICC A;  2GWS A;  9ICX A;  3K75 D;  1MIV A;  5BOL A;  4XA5 A;  8ICQ A;  5HHI A;  4UAY A;  3MGH A;  4X4R A;  4F5O A;  2DRA A;  4YN4 A;  2BCU A;  2BCR A;  4FH5 A;  8ICM A;  5DDY A;  3AQN A;  3C5F A;  5BOM A;  1ZQC A;  2ZHB A;  5HRH A;  4DO9 A;  1R8A A;  1XSL A;  8ICP A;  5CHG A;  4KLD A;  4FHX A;  5D46 A;  4XRH A;  1ZQO A;  4FHP A;  2BPC A;  1R8C A;  4MFA A;  4RQ5 A;  5HRB A;  5DB8 A;  4M2Y A;  5J2B A;  4PHD A;  9ICE A;  5IIL A;  4I2D A;  2M2T A;  1ZQT A;  8ICT A;  9ICU A;  1ZQH A;  4M47 A;  1MQ3 A;  4KLM A;  9ICH A;  4RQ3 A;  9ICB A;  7ICF A;  3WFP A;  4M9N A;  4I2J A;  5HRL A;  4RPZ A;  2BE3 A;  4KLI A;  2PBE A;  2DR7 A;  5HRK A;  4FO6 A;  4FHY A;  4IG8 A;  4S3N A;  7ICQ A;  5IIO A;  3TFS A;  2FMP A;  4X4V A;  4I29 A;  2PXI A;  4PH5 A;  4PGY A;  8ICN A;  5J0U A;  5J0P A;  4KLU A;  1JQR A;  5HRF A;  7ICN A;  4YMM A;  4P4M A;  4LZG A;  7ICJ A;  5CJ7 A;  3JPT A;  4KLO A;  2ZH1 A;  5F2V O;  4QZA A;  5J2A A;  4R66 A;  2M2U A;  4M9H A;  2Q66 A;  1XSN A;  1ZQB A;  4NLN A;  4FH3 A;  1ZQZ A;  1ZQI A;  4DOC A;  7ICL A;  4RQ4 A;  5J0S A;  4R63 A;  3JPR A;  4UB2 A;  1BPY A;  2PFQ A;  4GXJ A;  5HRI A;  3C2K A;  4LZD A;  4RQ1 A;  4RQ7 A;  4QZC A;  3PNC A;  5J2I A;  5CR0 A;  1UEU A;  4PHE A;  4X0A A;  5J0T A;  1HUO A;  3B0Y A;  4YD2 A;  1TVA A;  5J0O A;  4MFC A;  4KLJ A;  1TFY A;  5HHH A;  1ZQK A;  8ICO A;  5J2C A;  4UAZ A;  2M2W A;  5J2H A;  2ISO A;  4KLF A;  3C2L A;  4WC1 A;  7ICS A;  4XQ7 A;  4QZ8 A;  4F5P A;  9ICL A;  4IQW A;  3UPS A;  7ICU A;  4EBJ A;  8ICB A;  3RJF A;  4NM2 A;  4AT9 B;  4I2G A;  4Z6F A;  5DBC A;  5HRD A;  1OU5 A;  3RH6 A;  9ICN A;  4TUR A;  9ICO A;  4QZ9 A;  3JPP A;  4IQT A;  7ICK A;  1F5A A;  4PGQ A;  8ICK A;  2FMS A;  2HHP A;  4NKT A;  4NY8 A;  3HIY A;  1XSP A;  3HW8 A;  4X5V A;  4QZG A;  1ZQD A;  2BCQ A;  4AT9 A;  3UXN A;  1ZQW A;  1KDH A;  3LK9 A;  7ICE A;  4FHW A;  5HC9 A;  3MBY A;  2DR9 A;  4LT6 A;  9ICV A;  3V7J A;  4RQ2 A;  8ICF A;  2BPG A;  2O1P A;  7ICT A;  1ZQA A;  5J0R A;  4WC0 A;  1UET A;  4TUP A;  2W9M A;  4QZE A;  5DB9 A;  5IIN A;  3C66 A;  4KLT A;  4UBC A;  2ZH7 A;  3LQC B;  5J2K A;  1VJ7 A;  4WC3 A;  4KLH A;  2ISP A;  1BPZ A;  5CB1 A;  4AT7 A;  5IIM A;  3B0X A;  5IIJ A;  5CA7 A;  4GXK A;  3UPQ A;  4KLL A;  4WBZ A;  1ZQE A;  3OVS A;  5J2D A;  4E7X A;  5DKW A;  3OUY B;  7ICI A;  1ZQU A;  4XUS A;  2P66 A;  4M9J A;  1ZQS A;  2ZH8 A;  5HR9 A;  1BPE A;  7ICP A;  4QZI A;  4WC4 A;  4WC5 A;  1ZQM A;  3PMN A;  1NO5 A;  1ZQY A;  5DED A;  9ICS A;  5CP2 A;  1ZJM A;  3H38 A;  4RWQ A;  4KLS A;  4M5D A;  3OVB A;  2BCS A;  2PFP A;  4PPX A;  4WCW A;  2DR5 A;  2BPF A;  3RJH A;  4UD4 A;  5DBA A;  4P4O A;  4NM1 A;  3RH4 A;  1YLQ A;  2PFN A;  3OV7 A;  1R8B A;  1ZQG A;  3ISD A;  1ZJN A;  2O5A A;  2RFF A;  4I28 A;  3C5G A;  4DOB A;  1ZQN A;  4X4Q A;  4WC2 A;  4AT8 A;  3C2M A;  1R89 A;  2ZH3 A;  9ICQ A;  3JPS A;  4R64 A;  3AQL A;  5DEC A;  3WFQ E;  3H37 A;  1TV9 A;  3H3A A;  3WFO A;  8ICA A;  2ZH5 A;  4JWN A;  4M04 A;  2ZH2 A;  4X4N A;  8ICW A;  3HJ4 A;  2DR8 A;  4K4G A;  1ZQJ A;  4K4I A;  4O5E A;  4GXI A;  3AU6 A;  4TUS A;  3AU2 A;  4RWP A;  4M9G A;  4UB3 A;  4PGX A;  8ICE A;  1MQ2 A;  5III A;  5EOZ A;  4RQ0 A;  1RZT A;  1ZQV A;  9ICW A;  2DVI A;  7ICH A;  1KNY A;  3RJE A;  4ATB B;  1JN3 A;  4P4P A;  4PHA A;  4E8F A;  4I2F A;  3RJI A;  4QZB A;  4Z6C A;  9ICT A;  2ZH4 A;  4RT3 A;  5J0Q A;  3OGU A;  4LVS A;  4I2H A;  9ICG A;  4UB5 A;  2ID1 A;  4F5N A;  1NOM A;  3UXP A;  5J0Y A;  4XQ8 A;  4UB1 A;  9ICA A;  1RPL A;  1BPX A;  9ICI A;  4MF8 A;  4X4U A;  3ISB A;  8ICU A;  8ICG A;  5HRG A;  1WOT A;  4RPX A;  4MF2 A;  8ICS A;  4M9L A;  5J2G A;  1JAJ A;  3UXO A;  4YMO A;  7ICO A; 
#chains in the Genus database with same CATH topology
 7ICR A;  4KLG A;  1UEV A;  5BPC A;  4MFF A;  2IUB A;  2ZH9 A;  4X4S A;  3MDC A;  7ICV A;  4DOA A;  5B3Q A;  3OUY A;  9ICK A;  3V72 A;  8ICH A;  3HX0 A;  3C18 A;  1MIY A;  4NXV A;  3RJG A;  3ISC A;  9ICM A;  3RJK A;  4YD1 A;  7ICG A;  2PFO A;  3AQM A;  1FA0 A;  4RQ6 A;  3TFR A;  1BPB A;  4UAW A;  4OAI Z;  1V4A A;  1ZQL A;  1JMS A;  4UBB A;  4O9M A;  4X4T A;  4NLK A;  4O5C A;  4LEZ A;  3V7L A;  4KLQ A;  4WC6 A;  8ICZ A;  5DB7 A;  3OWG A;  4AT7 B;  4RWO A;  4K99 A;  4OAH A;  2ZH6 A;  3OVA A;  1ZQF A;  5DDM A;  5TZV A;  4UD5 A;  3HWT A;  4YCX A;  9ICC A;  4AT8 B;  5DBB A;  3NYB A;  4PHP A;  3JZ0 A;  1Q79 A;  3UQ2 A;  4RT2 A;  1ZQP A;  4EBK A;  4YMN A;  5J2J A;  9ICP A;  4KLE A;  1KEJ A;  2B56 A;  4WQK A;  4X4O A;  4IQV A;  4Z6D A;  4RPY A;  3MGI A;  2BCV A;  9ICR A;  4Z6E A;  5IIK A;  8ICL A;  4I27 A;  9ICJ A;  4WBY A;  1TFW A;  3ER9 B;  4WH5 A;  5J0W A;  4I0U A;  4JWM A;  4NXT A;  4JLZ A;  4OAF A;  3JPN A;  4F5Q A;  3MDA A;  3ER8 C;  5D4B A;  1HUZ A;  8ICY A;  3H39 A;  4I2A A;  8ICR A;  3V7K A;  4EP7 A;  3AUO A;  2ZHA A;  4NXZ A;  5D61 A;  5J29 A;  1MIW A;  4NLZ A;  2DRB A;  4WC7 A;  3GDX A;  3RJJ A;  2BBH A;  2IHM A;  8ICJ A;  4IQU A;  3HJ1 A;  1VFG A;  4RQ8 A;  4RWN A;  4UB4 A;  4P2H A;  3JPQ A;  3AQK A;  2FMQ A;  8ICI A;  5DB6 A;  4R65 A;  4X0B A;  4M0A A;  4QZH A;  3PML A;  5J2E A;  3L9D A;  3WFS C;  4QZF A;  1ZQQ A;  4FHV A;  4E80 A;  4I2C A;  1Q78 A;  1ZQX A;  7ICM A;  4I2B A;  8ICX A;  5HRE A;  5D49 A;  1BPD A;  4QZD A;  4ATB A;  4K4H A;  4NKU A;  1PX5 A;  3WFR E;  1ZQR A;  3RH5 A;  3JYY A;  3JPO A;  9ICF A;  5J0X A;  4TUQ A;  4LEW A;  4K96 A;  4F5R A;  4O5K A;  4X4P A;  8ICV A;  2VAN A;  2M2V A;  4I2E A;  3UQ0 A;  4I2I A;  5J2F A;  5CWR A;  4MKP A;  2I9G A;  2NRK A;  3JCF A;  5CFT A;  8ICC A;  2GWS A;  9ICX A;  3K75 D;  1MIV A;  5BOL A;  4XA5 A;  8ICQ A;  5HHI A;  4UAY A;  3MGH A;  2HN1 A;  4X4R A;  4F5O A;  2DRA A;  4YN4 A;  2BCU A;  2BCR A;  4FH5 A;  8ICM A;  5DDY A;  3AQN A;  3C5F A;  5BOM A;  1ZQC A;  2ZHB A;  5HRH A;  4DO9 A;  1R8A A;  1XSL A;  8ICP A;  5CHG A;  4KLD A;  4FHX A;  5D46 A;  4XRH A;  3NWI A;  1ZQO A;  4FHP A;  2BPC A;  1R8C A;  4MFA A;  4RQ5 A;  5HRB A;  5DB8 A;  4EEB A;  4M2Y A;  4K9A A;  5J2B A;  4PHD A;  9ICE A;  5IIL A;  4I2D A;  2M2T A;  1ZQT A;  8ICT A;  9ICU A;  1ZQH A;  4M47 A;  1MQ3 A;  4KLM A;  9ICH A;  4RQ3 A;  9ICB A;  7ICF A;  4LEV A;  3WFP A;  4M9N A;  4I2J A;  5HRL A;  4RPZ A;  2BE3 A;  4KLI A;  2PBE A;  2DR7 A;  5HRK A;  4FO6 A;  4FHY A;  4IG8 A;  4S3N A;  7ICQ A;  5IIO A;  3TFS A;  2FMP A;  4X4V A;  4I29 A;  2PXI A;  4PH5 A;  4PGY A;  8ICN A;  5J0U A;  5J0P A;  4KLU A;  5D62 A;  1JQR A;  5HRF A;  3EF2 A;  7ICN A;  4YMM A;  4P4M A;  4LZG A;  4XJE A;  7ICJ A;  5CJ7 A;  3JPT A;  4KLO A;  2B4V A;  2ZH1 A;  5F2V O;  4QZA A;  5J2A A;  4R66 A;  2M2U A;  4M9H A;  2Q66 A;  1XSN A;  1ZQB A;  4NLN A;  4FH3 A;  1ZQZ A;  1ZQI A;  4DOC A;  7ICL A;  4RQ4 A;  5J0S A;  4R63 A;  3JPR A;  5D63 A;  4UB2 A;  1BPY A;  2PFQ A;  4GXJ A;  5HRI A;  3C2K A;  4LZD A;  4RQ1 A;  4HX0 A;  4RQ7 A;  3CK6 A;  4QZC A;  3PNC A;  5J2I A;  4O67 A;  5CR0 A;  2IHO A;  1UEU A;  4PHE A;  4X0A A;  5J0T A;  1HUO A;  3B0Y A;  4YD2 A;  1TVA A;  5J0O A;  4MFC A;  4KLJ A;  1TFY A;  5HHH A;  1ZQK A;  8ICO A;  5J2C A;  4UAZ A;  2M2W A;  5J2H A;  2ISO A;  4KLF A;  3ERC C;  3C2L A;  4KB6 A;  4WC1 A;  3NKU A;  7ICS A;  4XQ7 A;  4QZ8 A;  4F5P A;  9ICL A;  4IQW A;  3UPS A;  7ICU A;  4EBJ A;  8ICB A;  3RJF A;  4NM2 A;  4AT9 B;  4I2G A;  4Z6F A;  2GA9 D;  4K97 A;  5DBC A;  5HRD A;  1OU5 A;  4NXW A;  3RH6 A;  9ICN A;  4TUR A;  9ICO A;  4QZ9 A;  3JPP A;  4IQT A;  7ICK A;  1F5A A;  4PGQ A;  8ICK A;  2FMS A;  2HHP A;  4NKT A;  4NY8 A;  3HIY A;  1XSP A;  2GAF D;  3HW8 A;  4X5V A;  4QZG A;  1ZQD A;  2BCQ A;  4AT9 A;  3UXN A;  1ZQW A;  1KDH A;  3LK9 A;  7ICE A;  4FHW A;  5HC9 A;  3MBY A;  2DR9 A;  2B51 A;  4LT6 A;  4OAG A;  9ICV A;  3V7J A;  4RQ2 A;  8ICF A;  4WQL A;  4NXX A;  2BPG A;  2O1P A;  7ICT A;  1ZQA A;  5J0R A;  4WC0 A;  1UET A;  4FO1 A;  5B3P A;  4TUP A;  2W9M A;  4QZE A;  5DB9 A;  5IIN A;  3C66 A;  4KLT A;  4UBC A;  4K8V A;  2ZH7 A;  3LQC B;  5J2K A;  1VJ7 A;  4WC3 A;  4KLH A;  2ISP A;  1BPZ A;  5CB1 A;  4AT7 A;  5IIM A;  3B0X A;  4LEY A;  5IIJ A;  2EWR A;  5CA7 A;  2FCL A;  4O69 A;  4GXK A;  3UPQ A;  4KLL A;  5CFU A;  4WBZ A;  1ZQE A;  3OVS A;  5J2D A;  4E7X A;  5DKW A;  3OUY B;  7ICI A;  1ZQU A;  5CHE A;  4XUS A;  2P66 A;  4M9J A;  1ZQS A;  4N7R A;  2ZH8 A;  5HR9 A;  1BPE A;  7ICP A;  4QZI A;  4WC4 A;  4WC5 A;  1ZQM A;  3PMN A;  1NO5 A;  1ZQY A;  4NXU A;  5DED A;  9ICS A;  5CP2 A;  1ZJM A;  5CFS A;  3H38 A;  4RWQ A;  4K98 A;  4KLS A;  4M5D A;  3OVB A;  2BCS A;  2PFP A;  4EED A;  4PPX A;  4WCW A;  2DR5 A;  2BPF A;  3RJH A;  4UD4 A;  5DBA A;  4P4O A;  4NM1 A;  3RH4 A;  1YLQ A;  2PFN A;  3OV7 A;  1R8B A;  1ZQG A;  3ISD A;  1ZJN A;  2O5A A;  2RFF A;  3K7D A;  4I28 A;  3C5G A;  4DOB A;  1ZQN A;  4X4Q A;  4WC2 A;  4AT8 A;  3C2M A;  1R89 A;  2ZH3 A;  9ICQ A;  3JPS A;  4R64 A;  3AQL A;  4WOY A;  5DEC A;  3WFQ E;  3H37 A;  1TV9 A;  3H3A A;  3WFO A;  8ICA A;  2ZH5 A;  4JWN A;  4M04 A;  2ZH2 A;  4X4N A;  8ICW A;  4EGW A;  3HJ4 A;  2DR8 A;  4KM5 A;  4K4G A;  2BBJ A;  1ZQJ A;  4K4I A;  4O5E A;  4K9B A;  4GXI A;  3AU6 A;  4TUS A;  3AU2 A;  4RWP A;  4M9G A;  3PHZ A;  4UB3 A;  4PGX A;  8ICE A;  1MQ2 A;  5III A;  5EOZ A;  4RQ0 A;  1RZT A;  4O6A A;  1ZQV A;  9ICW A;  2DVI A;  7ICH A;  1KNY A;  3RJE A;  4O68 A;  1JN3 A;  4ATB B;  4P4P A;  4PHA A;  4E8F A;  4I2F A;  3RJI A;  4QZB A;  4Z6C A;  9ICT A;  2ZH4 A;  4RT3 A;  4EV6 A;  5J0Q A;  3OGU A;  4LVS A;  4I2H A;  9ICG A;  4UB5 A;  2ID1 A;  4F5N A;  1NOM A;  3UXP A;  5J0Y A;  1GPJ A;  4XQ8 A;  4UB1 A;  9ICA A;  1RPL A;  1BPX A;  9ICI A;  4MF8 A;  4X4U A;  3ISB A;  8ICU A;  8ICG A;  5HRG A;  2HN2 A;  3MCR A;  1WOT A;  3NVO A;  4RPX A;  4MF2 A;  8ICS A;  4JLX A;  4M9L A;  5J2G A;  1JAJ A;  3UXO A;  4YMO A;  5JTG A;  7ICO A; 
#chains in the Genus database with same CATH homology
 7ICR A;  4KLG A;  1UEV A;  5BPC A;  4MFF A;  2ZH9 A;  4X4S A;  3MDC A;  7ICV A;  4DOA A;  3OUY A;  9ICK A;  3V72 A;  8ICH A;  3HX0 A;  3C18 A;  1MIY A;  3RJG A;  3ISC A;  9ICM A;  3RJK A;  4YD1 A;  7ICG A;  2PFO A;  3AQM A;  1FA0 A;  4RQ6 A;  3TFR A;  1BPB A;  4UAW A;  1V4A A;  1ZQL A;  1JMS A;  4UBB A;  4O9M A;  4X4T A;  4NLK A;  4O5C A;  3V7L A;  4KLQ A;  4WC6 A;  8ICZ A;  5DB7 A;  4AT7 B;  4RWO A;  2ZH6 A;  3OVA A;  1ZQF A;  5DDM A;  5TZV A;  4UD5 A;  3HWT A;  4YCX A;  9ICC A;  4AT8 B;  5DBB A;  3NYB A;  4PHP A;  3JZ0 A;  1Q79 A;  3UQ2 A;  4RT2 A;  1ZQP A;  4EBK A;  4YMN A;  5J2J A;  9ICP A;  4KLE A;  1KEJ A;  4X4O A;  4IQV A;  4Z6D A;  4RPY A;  3MGI A;  2BCV A;  9ICR A;  4Z6E A;  5IIK A;  8ICL A;  4I27 A;  9ICJ A;  4WBY A;  1TFW A;  5J0W A;  4JWM A;  3JPN A;  4F5Q A;  3MDA A;  5D4B A;  1HUZ A;  8ICY A;  3H39 A;  4I2A A;  8ICR A;  3V7K A;  4EP7 A;  3AUO A;  2ZHA A;  4NXZ A;  5J29 A;  1MIW A;  4NLZ A;  2DRB A;  4WC7 A;  3GDX A;  3RJJ A;  2IHM A;  8ICJ A;  4IQU A;  3HJ1 A;  1VFG A;  4RQ8 A;  4RWN A;  4UB4 A;  4P2H A;  3JPQ A;  3AQK A;  2FMQ A;  8ICI A;  5DB6 A;  4R65 A;  4X0B A;  4M0A A;  4QZH A;  3PML A;  5J2E A;  3L9D A;  3WFS C;  4QZF A;  1ZQQ A;  4FHV A;  4E80 A;  4I2C A;  1Q78 A;  1ZQX A;  7ICM A;  4I2B A;  8ICX A;  5HRE A;  5D49 A;  1BPD A;  4QZD A;  4ATB A;  4K4H A;  4NKU A;  1PX5 A;  3WFR E;  1ZQR A;  3RH5 A;  3JYY A;  3JPO A;  9ICF A;  5J0X A;  4TUQ A;  4F5R A;  4O5K A;  4X4P A;  8ICV A;  2VAN A;  2M2V A;  4I2E A;  3UQ0 A;  4I2I A;  5J2F A;  5CWR A;  2I9G A;  2NRK A;  8ICC A;  2GWS A;  9ICX A;  3K75 D;  1MIV A;  5BOL A;  4XA5 A;  8ICQ A;  5HHI A;  4UAY A;  3MGH A;  4X4R A;  4F5O A;  2DRA A;  4YN4 A;  2BCU A;  2BCR A;  4FH5 A;  8ICM A;  5DDY A;  3AQN A;  3C5F A;  5BOM A;  1ZQC A;  2ZHB A;  5HRH A;  4DO9 A;  1R8A A;  1XSL A;  8ICP A;  5CHG A;  4KLD A;  4FHX A;  5D46 A;  4XRH A;  1ZQO A;  4FHP A;  2BPC A;  1R8C A;  4MFA A;  4RQ5 A;  5HRB A;  5DB8 A;  4M2Y A;  5J2B A;  4PHD A;  9ICE A;  5IIL A;  4I2D A;  2M2T A;  1ZQT A;  8ICT A;  9ICU A;  1ZQH A;  4M47 A;  1MQ3 A;  4KLM A;  9ICH A;  4RQ3 A;  9ICB A;  7ICF A;  3WFP A;  4M9N A;  4I2J A;  5HRL A;  4RPZ A;  2BE3 A;  4KLI A;  2PBE A;  2DR7 A;  5HRK A;  4FO6 A;  4FHY A;  4IG8 A;  4S3N A;  7ICQ A;  5IIO A;  3TFS A;  2FMP A;  4X4V A;  4I29 A;  2PXI A;  4PH5 A;  4PGY A;  8ICN A;  5J0U A;  5J0P A;  4KLU A;  1JQR A;  5HRF A;  7ICN A;  4YMM A;  4P4M A;  4LZG A;  7ICJ A;  5CJ7 A;  3JPT A;  4KLO A;  2ZH1 A;  5F2V O;  4QZA A;  5J2A A;  4R66 A;  2M2U A;  4M9H A;  2Q66 A;  1XSN A;  1ZQB A;  4NLN A;  4FH3 A;  1ZQZ A;  1ZQI A;  4DOC A;  7ICL A;  4RQ4 A;  5J0S A;  4R63 A;  3JPR A;  4UB2 A;  1BPY A;  2PFQ A;  4GXJ A;  5HRI A;  3C2K A;  4LZD A;  4RQ1 A;  4RQ7 A;  4QZC A;  3PNC A;  5J2I A;  5CR0 A;  1UEU A;  4PHE A;  4X0A A;  5J0T A;  1HUO A;  3B0Y A;  4YD2 A;  1TVA A;  5J0O A;  4MFC A;  4KLJ A;  1TFY A;  5HHH A;  1ZQK A;  8ICO A;  5J2C A;  4UAZ A;  2M2W A;  5J2H A;  2ISO A;  4KLF A;  3C2L A;  4WC1 A;  7ICS A;  4XQ7 A;  4QZ8 A;  4F5P A;  9ICL A;  4IQW A;  3UPS A;  7ICU A;  4EBJ A;  8ICB A;  3RJF A;  4NM2 A;  4AT9 B;  4I2G A;  4Z6F A;  5DBC A;  5HRD A;  1OU5 A;  3RH6 A;  9ICN A;  4TUR A;  9ICO A;  4QZ9 A;  3JPP A;  4IQT A;  7ICK A;  1F5A A;  4PGQ A;  8ICK A;  2FMS A;  2HHP A;  4NKT A;  4NY8 A;  3HIY A;  1XSP A;  3HW8 A;  4X5V A;  4QZG A;  1ZQD A;  2BCQ A;  4AT9 A;  3UXN A;  1ZQW A;  1KDH A;  3LK9 A;  7ICE A;  4FHW A;  5HC9 A;  3MBY A;  2DR9 A;  4LT6 A;  9ICV A;  3V7J A;  4RQ2 A;  8ICF A;  2BPG A;  2O1P A;  7ICT A;  1ZQA A;  5J0R A;  4WC0 A;  1UET A;  4TUP A;  2W9M A;  4QZE A;  5DB9 A;  5IIN A;  3C66 A;  4KLT A;  4UBC A;  2ZH7 A;  3LQC B;  5J2K A;  1VJ7 A;  4WC3 A;  4KLH A;  2ISP A;  1BPZ A;  5CB1 A;  4AT7 A;  5IIM A;  3B0X A;  5IIJ A;  5CA7 A;  4GXK A;  3UPQ A;  4KLL A;  4WBZ A;  1ZQE A;  3OVS A;  5J2D A;  4E7X A;  5DKW A;  3OUY B;  7ICI A;  1ZQU A;  4XUS A;  2P66 A;  4M9J A;  1ZQS A;  2ZH8 A;  5HR9 A;  1BPE A;  7ICP A;  4QZI A;  4WC4 A;  4WC5 A;  1ZQM A;  3PMN A;  1NO5 A;  1ZQY A;  5DED A;  9ICS A;  5CP2 A;  1ZJM A;  3H38 A;  4RWQ A;  4KLS A;  4M5D A;  3OVB A;  2BCS A;  2PFP A;  4PPX A;  4WCW A;  2DR5 A;  2BPF A;  3RJH A;  4UD4 A;  5DBA A;  4P4O A;  4NM1 A;  3RH4 A;  1YLQ A;  2PFN A;  3OV7 A;  1R8B A;  1ZQG A;  3ISD A;  1ZJN A;  2O5A A;  2RFF A;  4I28 A;  3C5G A;  4DOB A;  1ZQN A;  4X4Q A;  4WC2 A;  4AT8 A;  3C2M A;  1R89 A;  2ZH3 A;  9ICQ A;  3JPS A;  4R64 A;  3AQL A;  5DEC A;  3WFQ E;  3H37 A;  1TV9 A;  3H3A A;  3WFO A;  8ICA A;  2ZH5 A;  4JWN A;  4M04 A;  2ZH2 A;  4X4N A;  8ICW A;  3HJ4 A;  2DR8 A;  4K4G A;  1ZQJ A;  4K4I A;  4O5E A;  4GXI A;  3AU6 A;  4TUS A;  3AU2 A;  4RWP A;  4M9G A;  4UB3 A;  4PGX A;  8ICE A;  1MQ2 A;  5III A;  5EOZ A;  4RQ0 A;  1RZT A;  1ZQV A;  9ICW A;  2DVI A;  7ICH A;  1KNY A;  3RJE A;  4ATB B;  1JN3 A;  4P4P A;  4PHA A;  4E8F A;  4I2F A;  3RJI A;  4QZB A;  4Z6C A;  9ICT A;  2ZH4 A;  4RT3 A;  5J0Q A;  3OGU A;  4LVS A;  4I2H A;  9ICG A;  4UB5 A;  2ID1 A;  4F5N A;  1NOM A;  3UXP A;  5J0Y A;  4XQ8 A;  4UB1 A;  9ICA A;  1RPL A;  1BPX A;  9ICI A;  4MF8 A;  4X4U A;  3ISB A;  8ICU A;  8ICG A;  5HRG A;  1WOT A;  4RPX A;  4MF2 A;  8ICS A;  4M9L A;  5J2G A;  1JAJ A;  3UXO A;  4YMO A;  7ICO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...