2M2TA

Asfv pol x structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
molecule keywords Repair DNA polymerase X
total genus 41
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2tA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2tA01
2M2TA 2M2UA 8ICQA 2BCRA 4I2DA 8ICBA 7ICVA 4KLLA 8ICRA 4PHAA 4WC6A 4X4TA 3ISCA 2DR5A 3UXOA 2PFQA 4RQ1A 3C18A 4M2YA 4EBKA 4X4UA 4WBZA 2PBEA 4FHYA 2W9MA 5CR0A 4I2JA 2DR7A 4EBJA 4RPZA 2ZH5A 4KLEA 9ICLA 1ZQJA 3WFRE 2NRKA 1Q79A 4RWOA 1KEJA 4RQ5A 3JPRA 7ICMA 9ICJA 4XRHA 3V7LA 4WC3A 4FO6A 2BPCA 2BCSA 3HIYA 4QZIA 5J0QA 5J0SA 3MBYA 5HRFA 8ICXA 4AT9B 2ZH9A 9ICOA 3JPNA 9ICFA 2ZHAA 1UETA 4QZEA 1R89A 3AQKA 1ZQLA 8ICOA 4MF8A 4I2HA 5J29A 2P66A 4NXZA 4AT9A 8ICSA 4M04A 2HHPA 4M9HA 5J0RA 5D4BA 5DB7A 3RH4A 8ICKA 4I2CA 2ZH7A 4UB2A 9ICUA 5J2CA 4E8FA 8ICVA 3C5FA 7ICIA 4UD5A 3UQ0A 3HWTA 4YMMA 5CA7A 2M2WA 5J2DA 1BPDA 1RPLA 3UXNA 3OUYA 8ICFA 1NOMA 2O1PA 2I9GA 3WFQE 4RPXA 4JWNA 4QZAA 5J0WA 4KLDA 2O5AA 5CJ7A 4RWQA 3LK9A 5CB1A 3MDCA 2BCQA 4KLFA 9ICVA 4UBBA 3MDAA 1ZJNA 7ICPA 5TZVA 1R8BA 3PNCA 7ICQA 1ZQDA 3OVBA 1KNYA 4Z6EA 5J0YA 4MFAA 4IQTA 9ICGA 4UD4A 4XQ8A 4FH5A 4QZCA 3K75D 9ICRA 4K4GA 4WC1A 3RJEA 4LZGA 5J2KA 1Q78A 4QZFA 3TFSA 7ICFA 9ICWA 4IQWA 5IIIA 4RQ8A 5IIKA 5DBAA 4PHDA 8ICEA 2Q66A 4RPYA 3L9DA 4GXJA 3PMLA 4ATBB 4P4OA 1MIVA 4X0BA 3JPQA 4YD2A 2ZH4A 4UB3A 1VJ7A 5IILA 1R8AA 8ICAA 4S3NA 4P4MA 1R8CA 3UXPA 1ZQHA 4MFFA 3JPSA 1MQ3A 1ZQNA 1JMSA 2BPGA 1MQ2A 3MGIA 4WC4A 1ZQWA 4DOBA 1ZQQA 3C2LA 3OVAA 4M9NA 8ICNA 4PH5A 1HUZA 4KLGA 5DEDA 2DRAA 3C2KA 9ICTA 8ICZA 3TFRA 1ZQUA 5DDYA 4O5CA 3RH5A 3C2MA 5CWRA 5J0XA 1ZQEA 3OVSA 5HHIA 3V7KA 5J2HA 4PGYA 9ICSA 5J2EA 1V4AA 3H38A 1PX5A 2ZH6A 2ZH2A 4R63A 4X4VA 1WOTA 9ICPA 2VANA 1ZQKA 4X4PA 4O5KA 4UAWA 2FMPA 4YN4A 1ZQIA 2ZH8A 9ICMA 3AQLA 9ICHA 5J2FA 3AQMA 4RWPA 7ICLA 4LVSA 4QZ8A 4M5DA 3OGUA 4UB5A 2BCVA 3UPQA 2FMQA 4X4SA 3WFPA 3AUOA 4X4NA 4WC5A 1UEUA 7ICSA 3RH6A 4KLJA 4MF2A 2DRBA 4X0AA 9ICAA 4FHPA 5BOLA 7ICJA 4RQ3A 4KLHA 3OUYB 9ICCA 3HX0A 5HRGA 4YCXA 3AQNA 1YLQA 7ICUA 2DR9A 2PXIA 1TVAA 1MIWA 4XQ7A 1BPEA 5HRIA 1JAJA 4KLTA 1TFYA 4NKUA 8ICJA 4QZDA 5J0TA 4M9JA 4LZDA 4IQUA 4M47A 3H3AA 2ISPA 3C66A 4WC2A 2BPFA 1ZQZA 9ICXA 1JQRA 9ICIA 3ISBA 4GXIA 4O9MA 4M9GA 5BOMA 3PMNA 5IINA 3H37A 1XSPA 5DKWA 4M9LA 5HRLA 3JPOA 2IHMA 3V7JA 1ZQPA 4NLKA 4Z6FA 4P2HA 5J2AA 1RZTA 2RFFA 4QZHA 5HC9A 4TUSA 4MFCA 4AT7B 3JPTA 4I28A 4M0AA 3AU2A 4RT2A 3RJGA 5BPCA 1UEVA 5IIOA 4RQ4A 4AT8A 4TUPA 8ICIA 7ICEA 5HRDA 4UAZA 3RJKA 4NLZA 4DOCA 5HRKA 7ICOA 4UAYA 4I2EA 1FA0A 4EP7A 4P4PA 1BPZA 4F5NA 4I29A 4KLOA 1MIYA 4DO9A 4JWMA 5HRBA 3V72A 4QZ9A 4RT3A 4KLMA 4F5PA 1TFWA 4ATBA 1VFGA 2PFPA 1HUOA 5J2GA 5DB8A 5J0PA 4I2AA 4F5RA 1BPYA 4YD1A 3OV7A 8ICCA 2PFNA 4WBYA 2ID1A 4R65A 1ZQRA 3RJIA 4AT8B 2ISOA 1BPBA 4LT6A 4QZBA 4RQ0A 3UPSA 5HRHA 4TUQA 1XSLA 4K4HA 1NO5A 2DR8A 4KLIA 1ZQAA 3B0YA 4KLSA 4NLNA 4UB1A 4R64A 4F5OA 5D46A 5DB9A 4KLQA 4TURA 5DB6A 2BE3A 9ICBA 2ZH3A 1ZQSA 5DDMA 4PGXA 4YMNA 4NM2A 1ZQTA 2ZHBA 4AT7A 1ZQBA 5EOZA 4NM1A 8ICGA 4RQ2A 5J2BA 4IQVA 3AU6A 4UBCA 4FHXA 3MGHA 7ICNA 4PHEA 1ZQFA 2ZH1A 3WFSC 2PFOA 3UQ2A 3GDXA 9ICQA 5D49A 3JZ0A 8ICLA 3C5GA 1ZJMA 8ICPA 3HJ4A 3HJ1A 4RQ6A 4NY8A 3RJHA 1XSNA 4GXKA 5DBCA 4E80A 4I2BA 3LQCB 7ICGA 4I2IA 4Z6DA 4R66A 1ZQGA 4QZGA 4Z6CA 4I27A 5J2IA 4WCWA 1TV9A 8ICWA 8ICMA 9ICKA 8ICTA 9ICNA 4PHPA 4K4IA 3RJJA 1ZQVA 4X4QA 4WC0A 4YMOA 7ICTA 4X4RA 1F5AA 4I2FA 3H39A 5F2VO 5HR9A 9ICEA 5IIMA 8ICHA 5DBBA 3JYYA 3JPPA 2GWSA 1ZQOA 8ICUA 4E7XA 4DOAA 7ICHA 5CP2A 4IG8A 2M2VA 3ISDA 7ICRA 1ZQMA 3WFOA 5CHGA 4XUSA 5DECA 3RJFA 4RWNA 4PPXA 4FHVA 3NYBA 1ZQXA 4FH3A 4NKTA 4X4OA 4O5EA 3HW8A 5J0UA 1BPXA 4WC7A 5IIJA 2DVIA 4FHWA 4XA5A 2FMSA 1KDHA 5HREA 4KLUA 7ICKA 4F5QA 4UB4A 4RQ7A 1JN3A 3B0XA 2BCUA 4PGQA 5HHHA 8ICYA 5J0OA 4I2GA 4X5VA 1ZQCA 1ZQYA 1OU5A 5J2JA
chains in the Genus database with same CATH superfamily
2M2TA 2M2UA 8ICQA 2BCRA 4I2DA 8ICBA 7ICVA 5JTGA 4KLLA 8ICRA 4PHAA 1GPJA 4WC6A 2B51A 4O68A 4X4TA 3ISCA 2DR5A 3UXOA 2PFQA 4RQ1A 3C18A 4M2YA 4EBKA 4X4UA 4WBZA 2PBEA 4FHYA 3ER8C 2W9MA 5CR0A 4I2JA 2DR7A 4WQKA 4EBJA 4RPZA 2ZH5A 4KLEA 9ICLA 1ZQJA 3WFRE 2NRKA 1Q79A 4RWOA 1KEJA 4RQ5A 3JPRA 4LEWA 4EGWA 7ICMA 9ICJA 4XRHA 3V7LA 4WC3A 4FO6A 5B3QA 2BPCA 2BCSA 3HIYA 4QZIA 5J0QA 5J0SA 3MBYA 5HRFA 8ICXA 4AT9B 2ZH9A 9ICOA 3JPNA 9ICFA 2ZHAA 1UETA 4QZEA 4K96A 1R89A 4JLXA 3AQKA 1ZQLA 8ICOA 4NXXA 4MF8A 4I2HA 5J29A 2P66A 4NXZA 4AT9A 8ICSA 4M04A 4KB6A 2HHPA 4M9HA 5J0RA 5D4BA 5DB7A 4WOYA 3RH4A 8ICKA 4I2CA 2ZH7A 4UB2A 9ICUA 5J2CA 4E8FA 8ICVA 3C5FA 7ICIA 4UD5A 3UQ0A 5B3PA 3HWTA 4YMMA 5CA7A 2M2WA 5J2DA 1BPDA 1RPLA 3UXNA 3OUYA 8ICFA 1NOMA 2O1PA 2I9GA 3WFQE 4RPXA 4JWNA 4QZAA 5J0WA 4KLDA 2O5AA 4JLZA 5CJ7A 4RWQA 3LK9A 5CB1A 3MDCA 2BCQA 4KLFA 3MCRA 9ICVA 4UBBA 3MDAA 1ZJNA 7ICPA 5CFTA 5TZVA 1R8BA 3PNCA 7ICQA 2HN2A 1ZQDA 3OVBA 1KNYA 4Z6EA 5J0YA 4MFAA 4IQTA 9ICGA 4UD4A 4XQ8A 4FH5A 4QZCA 3K75D 9ICRA 4K4GA 4WC1A 3RJEA 4LZGA 5J2KA 1Q78A 4QZFA 3TFSA 7ICFA 9ICWA 4IQWA 5CFUA 5IIIA 4RQ8A 5IIKA 5DBAA 4O67A 4PHDA 8ICEA 2Q66A 4RPYA 3L9DA 4GXJA 3PMLA 4ATBB 4P4OA 1MIVA 4X0BA 3JPQA 4YD2A 2ZH4A 4UB3A 1VJ7A 5IILA 1R8AA 8ICAA 4S3NA 4P4MA 1R8CA 3UXPA 1ZQHA 3JCFA 4MFFA 3JPSA 1MQ3A 1ZQNA 1JMSA 2BPGA 1MQ2A 3MGIA 4WC4A 1ZQWA 4DOBA 1ZQQA 3C2LA 3OVAA 4M9NA 8ICNA 4EEDA 3OWGA 4OAFA 4PH5A 2BBHA 1HUZA 4KLGA 5DEDA 2DRAA 3C2KA 9ICTA 8ICZA 3TFRA 1ZQUA 5DDYA 4O6AA 4O5CA 3RH5A 3C2MA 5CWRA 5J0XA 1ZQEA 3OVSA 5HHIA 3V7KA 5J2HA 4PGYA 9ICSA 5J2EA 1V4AA 3H38A 4OAGA 2BBJA 1PX5A 2ZH6A 2ZH2A 4R63A 4X4VA 2FCLA 1WOTA 9ICPA 2VANA 1ZQKA 4X4PA 4O5KA 4UAWA 2FMPA 4YN4A 1ZQIA 2ZH8A 9ICMA 2GAFD 3AQLA 9ICHA 5J2FA 3AQMA 4RWPA 7ICLA 4LVSA 4QZ8A 3K7DA 4M5DA 3OGUA 4UB5A 5CFSA 2BCVA 3UPQA 2FMQA 4X4SA 3WFPA 3AUOA 4X4NA 4WC5A 1UEUA 7ICSA 3RH6A 4KLJA 4LEYA 4MF2A 2DRBA 4X0AA 9ICAA 4FHPA 5BOLA 5D63A 2B4VA 7ICJA 4RQ3A 4KLHA 3OUYB 9ICCA 3HX0A 5HRGA 4YCXA 4NXVA 3AQNA 1YLQA 7ICUA 2DR9A 2PXIA 1TVAA 1MIWA 4XQ7A 4KM5A 1BPEA 5HRIA 1JAJA 4KLTA 2GA9D 1TFYA 4NKUA 8ICJA 4EV6A 4QZDA 5J0TA 4M9JA 4LZDA 4IQUA 4M47A 2IHOA 3H3AA 2ISPA 3C66A 4WC2A 2BPFA 1ZQZA 9ICXA 1JQRA 9ICIA 3ISBA 4GXIA 4O9MA 4M9GA 5BOMA 3PMNA 5IINA 3H37A 3NKUA 1XSPA 5DKWA 4M9LA 5HRLA 3JPOA 4HX0A 2IHMA 3V7JA 1ZQPA 4NLKA 4Z6FA 4P2HA 5J2AA 4FO1A 1RZTA 2RFFA 4QZHA 5HC9A 4TUSA 4MFCA 4AT7B 3JPTA 4I28A 4M0AA 3AU2A 5CHEA 4RT2A 3RJGA 5BPCA 1UEVA 5IIOA 3CK6A 4RQ4A 4AT8A 4TUPA 8ICIA 7ICEA 5HRDA 4UAZA 3RJKA 2IUBA 4NLZA 4DOCA 5HRKA 7ICOA 4UAYA 4I2EA 1FA0A 4EP7A 4P4PA 1BPZA 4F5NA 4I29A 4KLOA 1MIYA 4DO9A 4JWMA 5HRBA 3V72A 4QZ9A 4RT3A 4K8VA 4KLMA 4LEVA 4F5PA 1TFWA 4ATBA 1VFGA 4MKPA 3NWIA 4LEZA 2PFPA 1HUOA 5J2GA 5DB8A 5J0PA 4I2AA 4F5RA 2EWRA 1BPYA 4YD1A 3OV7A 8ICCA 2PFNA 4WBYA 2ID1A 4R65A 1ZQRA 3RJIA 4AT8B 4WH5A 2ISOA 1BPBA 4LT6A 4QZBA 4RQ0A 3UPSA 5HRHA 4TUQA 1XSLA 4K4HA 1NO5A 4WQLA 2DR8A 4KLIA 1ZQAA 3ERCC 3B0YA 4KLSA 4NLNA 4UB1A 5D61A 4R64A 4F5OA 5D46A 5DB9A 4KLQA 3ER9B 4TURA 5DB6A 2BE3A 9ICBA 2ZH3A 1ZQSA 5DDMA 4PGXA 4YMNA 4NM2A 1ZQTA 2ZHBA 4AT7A 1ZQBA 5EOZA 2B56A 4NM1A 8ICGA 4RQ2A 5J2BA 4IQVA 3AU6A 4UBCA 4FHXA 3MGHA 4NXWA 7ICNA 4PHEA 1ZQFA 2ZH1A 3WFSC 2PFOA 3UQ2A 3GDXA 4K9BA 9ICQA 5D49A 5D62A 3JZ0A 3NVOA 8ICLA 3C5GA 1ZJMA 8ICPA 3HJ4A 4K99A 3HJ1A 4RQ6A 4NY8A 3RJHA 1XSNA 4GXKA 5DBCA 4E80A 4I2BA 3LQCB 7ICGA 4I2IA 4Z6DA 4R66A 1ZQGA 4QZGA 4Z6CA 4I27A 5J2IA 4WCWA 1TV9A 8ICWA 4K98A 8ICMA 9ICKA 8ICTA 9ICNA 4PHPA 4K4IA 3RJJA 4NXUA 1ZQVA 4X4QA 4WC0A 4YMOA 4K97A 7ICTA 4X4RA 1F5AA 4I2FA 3H39A 5F2VO 4XJEA 5HR9A 9ICEA 5IIMA 4N7RA 8ICHA 5DBBA 3JYYA 3JPPA 2GWSA 1ZQOA 8ICUA 4E7XA 4DOAA 7ICHA 5CP2A 4IG8A 2M2VA 3ISDA 7ICRA 4OAHA 1ZQMA 3WFOA 3EF2A 5CHGA 4XUSA 5DECA 4K9AA 4NXTA 3RJFA 4RWNA 4EEBA 4PPXA 4FHVA 3NYBA 1ZQXA 4FH3A 4NKTA 4X4OA 4I0UA 4O5EA 3HW8A 4OAIZ 5J0UA 1BPXA 4WC7A 5IIJA 2DVIA 4FHWA 4XA5A 2FMSA 1KDHA 5HREA 4KLUA 7ICKA 4F5QA 4UB4A 2HN1A 3PHZA 4RQ7A 1JN3A 3B0XA 2BCUA 4O69A 4PGQA 5HHHA 8ICYA 5J0OA 4I2GA 4X5VA 1ZQCA 1ZQYA 1OU5A 5J2JA
chains in the Genus database with same CATH topology
2M2TA 2M2UA 8ICQA 2BCRA 4I2DA 8ICBA 7ICVA 4KLLA 8ICRA 4PHAA 4WC6A 4X4TA 3ISCA 2DR5A 3UXOA 2PFQA 4RQ1A 3C18A 4M2YA 4EBKA 4X4UA 4WBZA 2PBEA 4FHYA 2W9MA 5CR0A 4I2JA 2DR7A 4EBJA 4RPZA 2ZH5A 4KLEA 9ICLA 1ZQJA 3WFRE 2NRKA 1Q79A 4RWOA 1KEJA 4RQ5A 3JPRA 7ICMA 9ICJA 4XRHA 3V7LA 4WC3A 4FO6A 2BPCA 2BCSA 3HIYA 4QZIA 5J0QA 5J0SA 3MBYA 5HRFA 8ICXA 4AT9B 2ZH9A 9ICOA 3JPNA 9ICFA 2ZHAA 1UETA 4QZEA 1R89A 3AQKA 1ZQLA 8ICOA 4MF8A 4I2HA 5J29A 2P66A 4NXZA 4AT9A 8ICSA 4M04A 2HHPA 4M9HA 5J0RA 5D4BA 5DB7A 3RH4A 8ICKA 4I2CA 2ZH7A 4UB2A 9ICUA 5J2CA 4E8FA 8ICVA 3C5FA 7ICIA 4UD5A 3UQ0A 3HWTA 4YMMA 5CA7A 2M2WA 5J2DA 1BPDA 1RPLA 3UXNA 3OUYA 8ICFA 1NOMA 2O1PA 2I9GA 3WFQE 4RPXA 4JWNA 4QZAA 5J0WA 4KLDA 2O5AA 5CJ7A 4RWQA 3LK9A 5CB1A 3MDCA 2BCQA 4KLFA 9ICVA 4UBBA 3MDAA 1ZJNA 7ICPA 5TZVA 1R8BA 3PNCA 7ICQA 1ZQDA 3OVBA 1KNYA 4Z6EA 5J0YA 4MFAA 4IQTA 9ICGA 4UD4A 4XQ8A 4FH5A 4QZCA 3K75D 9ICRA 4K4GA 4WC1A 3RJEA 4LZGA 5J2KA 1Q78A 4QZFA 3TFSA 7ICFA 9ICWA 4IQWA 5IIIA 4RQ8A 5IIKA 5DBAA 4PHDA 8ICEA 2Q66A 4RPYA 3L9DA 4GXJA 3PMLA 4ATBB 4P4OA 1MIVA 4X0BA 3JPQA 4YD2A 2ZH4A 4UB3A 1VJ7A 5IILA 1R8AA 8ICAA 4S3NA 4P4MA 1R8CA 3UXPA 1ZQHA 4MFFA 3JPSA 1MQ3A 1ZQNA 1JMSA 2BPGA 1MQ2A 3MGIA 4WC4A 1ZQWA 4DOBA 1ZQQA 3C2LA 3OVAA 4M9NA 8ICNA 4PH5A 1HUZA 4KLGA 5DEDA 2DRAA 3C2KA 9ICTA 8ICZA 3TFRA 1ZQUA 5DDYA 4O5CA 3RH5A 3C2MA 5CWRA 5J0XA 1ZQEA 3OVSA 5HHIA 3V7KA 5J2HA 4PGYA 9ICSA 5J2EA 1V4AA 3H38A 1PX5A 2ZH6A 2ZH2A 4R63A 4X4VA 1WOTA 9ICPA 2VANA 1ZQKA 4X4PA 4O5KA 4UAWA 2FMPA 4YN4A 1ZQIA 2ZH8A 9ICMA 3AQLA 9ICHA 5J2FA 3AQMA 4RWPA 7ICLA 4LVSA 4QZ8A 4M5DA 3OGUA 4UB5A 2BCVA 3UPQA 2FMQA 4X4SA 3WFPA 3AUOA 4X4NA 4WC5A 1UEUA 7ICSA 3RH6A 4KLJA 4MF2A 2DRBA 4X0AA 9ICAA 4FHPA 5BOLA 7ICJA 4RQ3A 4KLHA 3OUYB 9ICCA 3HX0A 5HRGA 4YCXA 3AQNA 1YLQA 7ICUA 2DR9A 2PXIA 1TVAA 1MIWA 4XQ7A 1BPEA 5HRIA 1JAJA 4KLTA 1TFYA 4NKUA 8ICJA 4QZDA 5J0TA 4M9JA 4LZDA 4IQUA 4M47A 3H3AA 2ISPA 3C66A 4WC2A 2BPFA 1ZQZA 9ICXA 1JQRA 9ICIA 3ISBA 4GXIA 4O9MA 4M9GA 5BOMA 3PMNA 5IINA 3H37A 1XSPA 5DKWA 4M9LA 5HRLA 3JPOA 2IHMA 3V7JA 1ZQPA 4NLKA 4Z6FA 4P2HA 5J2AA 1RZTA 2RFFA 4QZHA 5HC9A 4TUSA 4MFCA 4AT7B 3JPTA 4I28A 4M0AA 3AU2A 4RT2A 3RJGA 5BPCA 1UEVA 5IIOA 4RQ4A 4AT8A 4TUPA 8ICIA 7ICEA 5HRDA 4UAZA 3RJKA 4NLZA 4DOCA 5HRKA 7ICOA 4UAYA 4I2EA 1FA0A 4EP7A 4P4PA 1BPZA 4F5NA 4I29A 4KLOA 1MIYA 4DO9A 4JWMA 5HRBA 3V72A 4QZ9A 4RT3A 4KLMA 4F5PA 1TFWA 4ATBA 1VFGA 2PFPA 1HUOA 5J2GA 5DB8A 5J0PA 4I2AA 4F5RA 1BPYA 4YD1A 3OV7A 8ICCA 2PFNA 4WBYA 2ID1A 4R65A 1ZQRA 3RJIA 4AT8B 2ISOA 1BPBA 4LT6A 4QZBA 4RQ0A 3UPSA 5HRHA 4TUQA 1XSLA 4K4HA 1NO5A 2DR8A 4KLIA 1ZQAA 3B0YA 4KLSA 4NLNA 4UB1A 4R64A 4F5OA 5D46A 5DB9A 4KLQA 4TURA 5DB6A 2BE3A 9ICBA 2ZH3A 1ZQSA 5DDMA 4PGXA 4YMNA 4NM2A 1ZQTA 2ZHBA 4AT7A 1ZQBA 5EOZA 4NM1A 8ICGA 4RQ2A 5J2BA 4IQVA 3AU6A 4UBCA 4FHXA 3MGHA 7ICNA 4PHEA 1ZQFA 2ZH1A 3WFSC 2PFOA 3UQ2A 3GDXA 9ICQA 5D49A 3JZ0A 8ICLA 3C5GA 1ZJMA 8ICPA 3HJ4A 3HJ1A 4RQ6A 4NY8A 3RJHA 1XSNA 4GXKA 5DBCA 4E80A 4I2BA 3LQCB 7ICGA 4I2IA 4Z6DA 4R66A 1ZQGA 4QZGA 4Z6CA 4I27A 5J2IA 4WCWA 1TV9A 8ICWA 8ICMA 9ICKA 8ICTA 9ICNA 4PHPA 4K4IA 3RJJA 1ZQVA 4X4QA 4WC0A 4YMOA 7ICTA 4X4RA 1F5AA 4I2FA 3H39A 5F2VO 5HR9A 9ICEA 5IIMA 8ICHA 5DBBA 3JYYA 3JPPA 2GWSA 1ZQOA 8ICUA 4E7XA 4DOAA 7ICHA 5CP2A 4IG8A 2M2VA 3ISDA 7ICRA 1ZQMA 3WFOA 5CHGA 4XUSA 5DECA 3RJFA 4RWNA 4PPXA 4FHVA 3NYBA 1ZQXA 4FH3A 4NKTA 4X4OA 4O5EA 3HW8A 5J0UA 1BPXA 4WC7A 5IIJA 2DVIA 4FHWA 4XA5A 2FMSA 1KDHA 5HREA 4KLUA 7ICKA 4F5QA 4UB4A 4RQ7A 1JN3A 3B0XA 2BCUA 4PGQA 5HHHA 8ICYA 5J0OA 4I2GA 4X5VA 1ZQCA 1ZQYA 1OU5A 5J2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2T A;  2M2U A;  8ICQ A;  2BCR A;  4I2D A;  8ICB A;  7ICV A;  4KLL A;  8ICR A;  4PHA A;  4WC6 A;  4X4T A;  3ISC A;  2DR5 A;  3UXO A;  2PFQ A;  4RQ1 A;  3C18 A;  4M2Y A;  4EBK A;  4X4U A;  4WBZ A;  2PBE A;  4FHY A;  2W9M A;  5CR0 A;  4I2J A;  2DR7 A;  4EBJ A;  4RPZ A;  2ZH5 A;  4KLE A;  9ICL A;  1ZQJ A;  3WFR E;  2NRK A;  1Q79 A;  4RWO A;  1KEJ A;  4RQ5 A;  3JPR A;  7ICM A;  9ICJ A;  4XRH A;  3V7L A;  4WC3 A;  4FO6 A;  2BPC A;  2BCS A;  3HIY A;  4QZI A;  5J0Q A;  5J0S A;  3MBY A;  5HRF A;  8ICX A;  4AT9 B;  2ZH9 A;  9ICO A;  3JPN A;  9ICF A;  2ZHA A;  1UET A;  4QZE A;  1R89 A;  3AQK A;  1ZQL A;  8ICO A;  4MF8 A;  4I2H A;  5J29 A;  2P66 A;  4NXZ A;  4AT9 A;  8ICS A;  4M04 A;  2HHP A;  4M9H A;  5J0R A;  5D4B A;  5DB7 A;  3RH4 A;  8ICK A;  4I2C A;  2ZH7 A;  4UB2 A;  9ICU A;  5J2C A;  4E8F A;  8ICV A;  3C5F A;  7ICI A;  4UD5 A;  3UQ0 A;  3HWT A;  4YMM A;  5CA7 A;  2M2W A;  5J2D A;  1BPD A;  1RPL A;  3UXN A;  3OUY A;  8ICF A;  1NOM A;  2O1P A;  2I9G A;  3WFQ E;  4RPX A;  4JWN A;  4QZA A;  5J0W A;  4KLD A;  2O5A A;  5CJ7 A;  4RWQ A;  3LK9 A;  5CB1 A;  3MDC A;  2BCQ A;  4KLF A;  9ICV A;  4UBB A;  3MDA A;  1ZJN A;  7ICP A;  5TZV A;  1R8B A;  3PNC A;  7ICQ A;  1ZQD A;  3OVB A;  1KNY A;  4Z6E A;  5J0Y A;  4MFA A;  4IQT A;  9ICG A;  4UD4 A;  4XQ8 A;  4FH5 A;  4QZC A;  3K75 D;  9ICR A;  4K4G A;  4WC1 A;  3RJE A;  4LZG A;  5J2K A;  1Q78 A;  4QZF A;  3TFS A;  7ICF A;  9ICW A;  4IQW A;  5III A;  4RQ8 A;  5IIK A;  5DBA A;  4PHD A;  8ICE A;  2Q66 A;  4RPY A;  3L9D A;  4GXJ A;  3PML A;  4ATB B;  4P4O A;  1MIV A;  4X0B A;  3JPQ A;  4YD2 A;  2ZH4 A;  4UB3 A;  1VJ7 A;  5IIL A;  1R8A A;  8ICA A;  4S3N A;  4P4M A;  1R8C A;  3UXP A;  1ZQH A;  4MFF A;  3JPS A;  1MQ3 A;  1ZQN A;  1JMS A;  2BPG A;  1MQ2 A;  3MGI A;  4WC4 A;  1ZQW A;  4DOB A;  1ZQQ A;  3C2L A;  3OVA A;  4M9N A;  8ICN A;  4PH5 A;  1HUZ A;  4KLG A;  5DED A;  2DRA A;  3C2K A;  9ICT A;  8ICZ A;  3TFR A;  1ZQU A;  5DDY A;  4O5C A;  3RH5 A;  3C2M A;  5CWR A;  5J0X A;  1ZQE A;  3OVS A;  5HHI A;  3V7K A;  5J2H A;  4PGY A;  9ICS A;  5J2E A;  1V4A A;  3H38 A;  1PX5 A;  2ZH6 A;  2ZH2 A;  4R63 A;  4X4V A;  1WOT A;  9ICP A;  2VAN A;  1ZQK A;  4X4P A;  4O5K A;  4UAW A;  2FMP A;  4YN4 A;  1ZQI A;  2ZH8 A;  9ICM A;  3AQL A;  9ICH A;  5J2F A;  3AQM A;  4RWP A;  7ICL A;  4LVS A;  4QZ8 A;  4M5D A;  3OGU A;  4UB5 A;  2BCV A;  3UPQ A;  2FMQ A;  4X4S A;  3WFP A;  3AUO A;  4X4N A;  4WC5 A;  1UEU A;  7ICS A;  3RH6 A;  4KLJ A;  4MF2 A;  2DRB A;  4X0A A;  9ICA A;  4FHP A;  5BOL A;  7ICJ A;  4RQ3 A;  4KLH A;  3OUY B;  9ICC A;  3HX0 A;  5HRG A;  4YCX A;  3AQN A;  1YLQ A;  7ICU A;  2DR9 A;  2PXI A;  1TVA A;  1MIW A;  4XQ7 A;  1BPE A;  5HRI A;  1JAJ A;  4KLT A;  1TFY A;  4NKU A;  8ICJ A;  4QZD A;  5J0T A;  4M9J A;  4LZD A;  4IQU A;  4M47 A;  3H3A A;  2ISP A;  3C66 A;  4WC2 A;  2BPF A;  1ZQZ A;  9ICX A;  1JQR A;  9ICI A;  3ISB A;  4GXI A;  4O9M A;  4M9G A;  5BOM A;  3PMN A;  5IIN A;  3H37 A;  1XSP A;  5DKW A;  4M9L A;  5HRL A;  3JPO A;  2IHM A;  3V7J A;  1ZQP A;  4NLK A;  4Z6F A;  4P2H A;  5J2A A;  1RZT A;  2RFF A;  4QZH A;  5HC9 A;  4TUS A;  4MFC A;  4AT7 B;  3JPT A;  4I28 A;  4M0A A;  3AU2 A;  4RT2 A;  3RJG A;  5BPC A;  1UEV A;  5IIO A;  4RQ4 A;  4AT8 A;  4TUP A;  8ICI A;  7ICE A;  5HRD A;  4UAZ A;  3RJK A;  4NLZ A;  4DOC A;  5HRK A;  7ICO A;  4UAY A;  4I2E A;  1FA0 A;  4EP7 A;  4P4P A;  1BPZ A;  4F5N A;  4I29 A;  4KLO A;  1MIY A;  4DO9 A;  4JWM A;  5HRB A;  3V72 A;  4QZ9 A;  4RT3 A;  4KLM A;  4F5P A;  1TFW A;  4ATB A;  1VFG A;  2PFP A;  1HUO A;  5J2G A;  5DB8 A;  5J0P A;  4I2A A;  4F5R A;  1BPY A;  4YD1 A;  3OV7 A;  8ICC A;  2PFN A;  4WBY A;  2ID1 A;  4R65 A;  1ZQR A;  3RJI A;  4AT8 B;  2ISO A;  1BPB A;  4LT6 A;  4QZB A;  4RQ0 A;  3UPS A;  5HRH A;  4TUQ A;  1XSL A;  4K4H A;  1NO5 A;  2DR8 A;  4KLI A;  1ZQA A;  3B0Y A;  4KLS A;  4NLN A;  4UB1 A;  4R64 A;  4F5O A;  5D46 A;  5DB9 A;  4KLQ A;  4TUR A;  5DB6 A;  2BE3 A;  9ICB A;  2ZH3 A;  1ZQS A;  5DDM A;  4PGX A;  4YMN A;  4NM2 A;  1ZQT A;  2ZHB A;  4AT7 A;  1ZQB A;  5EOZ A;  4NM1 A;  8ICG A;  4RQ2 A;  5J2B A;  4IQV A;  3AU6 A;  4UBC A;  4FHX A;  3MGH A;  7ICN A;  4PHE A;  1ZQF A;  2ZH1 A;  3WFS C;  2PFO A;  3UQ2 A;  3GDX A;  9ICQ A;  5D49 A;  3JZ0 A;  8ICL A;  3C5G A;  1ZJM A;  8ICP A;  3HJ4 A;  3HJ1 A;  4RQ6 A;  4NY8 A;  3RJH A;  1XSN A;  4GXK A;  5DBC A;  4E80 A;  4I2B A;  3LQC B;  7ICG A;  4I2I A;  4Z6D A;  4R66 A;  1ZQG A;  4QZG A;  4Z6C A;  4I27 A;  5J2I A;  4WCW A;  1TV9 A;  8ICW A;  8ICM A;  9ICK A;  8ICT A;  9ICN A;  4PHP A;  4K4I A;  3RJJ A;  1ZQV A;  4X4Q A;  4WC0 A;  4YMO A;  7ICT A;  4X4R A;  1F5A A;  4I2F A;  3H39 A;  5F2V O;  5HR9 A;  9ICE A;  5IIM A;  8ICH A;  5DBB A;  3JYY A;  3JPP A;  2GWS A;  1ZQO A;  8ICU A;  4E7X A;  4DOA A;  7ICH A;  5CP2 A;  4IG8 A;  2M2V A;  3ISD A;  7ICR A;  1ZQM A;  3WFO A;  5CHG A;  4XUS A;  5DEC A;  3RJF A;  4RWN A;  4PPX A;  4FHV A;  3NYB A;  1ZQX A;  4FH3 A;  4NKT A;  4X4O A;  4O5E A;  3HW8 A;  5J0U A;  1BPX A;  4WC7 A;  5IIJ A;  2DVI A;  4FHW A;  4XA5 A;  2FMS A;  1KDH A;  5HRE A;  4KLU A;  7ICK A;  4F5Q A;  4UB4 A;  4RQ7 A;  1JN3 A;  3B0X A;  2BCU A;  4PGQ A;  5HHH A;  8ICY A;  5J0O A;  4I2G A;  4X5V A;  1ZQC A;  1ZQY A;  1OU5 A;  5J2J A; 
#chains in the Genus database with same CATH topology
 2M2T A;  2M2U A;  8ICQ A;  2BCR A;  4I2D A;  8ICB A;  7ICV A;  5JTG A;  4KLL A;  8ICR A;  4PHA A;  1GPJ A;  4WC6 A;  2B51 A;  4O68 A;  4X4T A;  3ISC A;  2DR5 A;  3UXO A;  2PFQ A;  4RQ1 A;  3C18 A;  4M2Y A;  4EBK A;  4X4U A;  4WBZ A;  2PBE A;  4FHY A;  3ER8 C;  2W9M A;  5CR0 A;  4I2J A;  2DR7 A;  4WQK A;  4EBJ A;  4RPZ A;  2ZH5 A;  4KLE A;  9ICL A;  1ZQJ A;  3WFR E;  2NRK A;  1Q79 A;  4RWO A;  1KEJ A;  4RQ5 A;  3JPR A;  4LEW A;  4EGW A;  7ICM A;  9ICJ A;  4XRH A;  3V7L A;  4WC3 A;  4FO6 A;  5B3Q A;  2BPC A;  2BCS A;  3HIY A;  4QZI A;  5J0Q A;  5J0S A;  3MBY A;  5HRF A;  8ICX A;  4AT9 B;  2ZH9 A;  9ICO A;  3JPN A;  9ICF A;  2ZHA A;  1UET A;  4QZE A;  4K96 A;  1R89 A;  4JLX A;  3AQK A;  1ZQL A;  8ICO A;  4NXX A;  4MF8 A;  4I2H A;  5J29 A;  2P66 A;  4NXZ A;  4AT9 A;  8ICS A;  4M04 A;  4KB6 A;  2HHP A;  4M9H A;  5J0R A;  5D4B A;  5DB7 A;  4WOY A;  3RH4 A;  8ICK A;  4I2C A;  2ZH7 A;  4UB2 A;  9ICU A;  5J2C A;  4E8F A;  8ICV A;  3C5F A;  7ICI A;  4UD5 A;  3UQ0 A;  5B3P A;  3HWT A;  4YMM A;  5CA7 A;  2M2W A;  5J2D A;  1BPD A;  1RPL A;  3UXN A;  3OUY A;  8ICF A;  1NOM A;  2O1P A;  2I9G A;  3WFQ E;  4RPX A;  4JWN A;  4QZA A;  5J0W A;  4KLD A;  2O5A A;  4JLZ A;  5CJ7 A;  4RWQ A;  3LK9 A;  5CB1 A;  3MDC A;  2BCQ A;  4KLF A;  3MCR A;  9ICV A;  4UBB A;  3MDA A;  1ZJN A;  7ICP A;  5CFT A;  5TZV A;  1R8B A;  3PNC A;  7ICQ A;  2HN2 A;  1ZQD A;  3OVB A;  1KNY A;  4Z6E A;  5J0Y A;  4MFA A;  4IQT A;  9ICG A;  4UD4 A;  4XQ8 A;  4FH5 A;  4QZC A;  3K75 D;  9ICR A;  4K4G A;  4WC1 A;  3RJE A;  4LZG A;  5J2K A;  1Q78 A;  4QZF A;  3TFS A;  7ICF A;  9ICW A;  4IQW A;  5CFU A;  5III A;  4RQ8 A;  5IIK A;  5DBA A;  4O67 A;  4PHD A;  8ICE A;  2Q66 A;  4RPY A;  3L9D A;  4GXJ A;  3PML A;  4ATB B;  4P4O A;  1MIV A;  4X0B A;  3JPQ A;  4YD2 A;  2ZH4 A;  4UB3 A;  1VJ7 A;  5IIL A;  1R8A A;  8ICA A;  4S3N A;  4P4M A;  1R8C A;  3UXP A;  1ZQH A;  3JCF A;  4MFF A;  3JPS A;  1MQ3 A;  1ZQN A;  1JMS A;  2BPG A;  1MQ2 A;  3MGI A;  4WC4 A;  1ZQW A;  4DOB A;  1ZQQ A;  3C2L A;  3OVA A;  4M9N A;  8ICN A;  4EED A;  3OWG A;  4OAF A;  4PH5 A;  2BBH A;  1HUZ A;  4KLG A;  5DED A;  2DRA A;  3C2K A;  9ICT A;  8ICZ A;  3TFR A;  1ZQU A;  5DDY A;  4O6A A;  4O5C A;  3RH5 A;  3C2M A;  5CWR A;  5J0X A;  1ZQE A;  3OVS A;  5HHI A;  3V7K A;  5J2H A;  4PGY A;  9ICS A;  5J2E A;  1V4A A;  3H38 A;  4OAG A;  2BBJ A;  1PX5 A;  2ZH6 A;  2ZH2 A;  4R63 A;  4X4V A;  2FCL A;  1WOT A;  9ICP A;  2VAN A;  1ZQK A;  4X4P A;  4O5K A;  4UAW A;  2FMP A;  4YN4 A;  1ZQI A;  2ZH8 A;  9ICM A;  2GAF D;  3AQL A;  9ICH A;  5J2F A;  3AQM A;  4RWP A;  7ICL A;  4LVS A;  4QZ8 A;  3K7D A;  4M5D A;  3OGU A;  4UB5 A;  5CFS A;  2BCV A;  3UPQ A;  2FMQ A;  4X4S A;  3WFP A;  3AUO A;  4X4N A;  4WC5 A;  1UEU A;  7ICS A;  3RH6 A;  4KLJ A;  4LEY A;  4MF2 A;  2DRB A;  4X0A A;  9ICA A;  4FHP A;  5BOL A;  5D63 A;  2B4V A;  7ICJ A;  4RQ3 A;  4KLH A;  3OUY B;  9ICC A;  3HX0 A;  5HRG A;  4YCX A;  4NXV A;  3AQN A;  1YLQ A;  7ICU A;  2DR9 A;  2PXI A;  1TVA A;  1MIW A;  4XQ7 A;  4KM5 A;  1BPE A;  5HRI A;  1JAJ A;  4KLT A;  2GA9 D;  1TFY A;  4NKU A;  8ICJ A;  4EV6 A;  4QZD A;  5J0T A;  4M9J A;  4LZD A;  4IQU A;  4M47 A;  2IHO A;  3H3A A;  2ISP A;  3C66 A;  4WC2 A;  2BPF A;  1ZQZ A;  9ICX A;  1JQR A;  9ICI A;  3ISB A;  4GXI A;  4O9M A;  4M9G A;  5BOM A;  3PMN A;  5IIN A;  3H37 A;  3NKU A;  1XSP A;  5DKW A;  4M9L A;  5HRL A;  3JPO A;  4HX0 A;  2IHM A;  3V7J A;  1ZQP A;  4NLK A;  4Z6F A;  4P2H A;  5J2A A;  4FO1 A;  1RZT A;  2RFF A;  4QZH A;  5HC9 A;  4TUS A;  4MFC A;  4AT7 B;  3JPT A;  4I28 A;  4M0A A;  3AU2 A;  5CHE A;  4RT2 A;  3RJG A;  5BPC A;  1UEV A;  5IIO A;  3CK6 A;  4RQ4 A;  4AT8 A;  4TUP A;  8ICI A;  7ICE A;  5HRD A;  4UAZ A;  3RJK A;  2IUB A;  4NLZ A;  4DOC A;  5HRK A;  7ICO A;  4UAY A;  4I2E A;  1FA0 A;  4EP7 A;  4P4P A;  1BPZ A;  4F5N A;  4I29 A;  4KLO A;  1MIY A;  4DO9 A;  4JWM A;  5HRB A;  3V72 A;  4QZ9 A;  4RT3 A;  4K8V A;  4KLM A;  4LEV A;  4F5P A;  1TFW A;  4ATB A;  1VFG A;  4MKP A;  3NWI A;  4LEZ A;  2PFP A;  1HUO A;  5J2G A;  5DB8 A;  5J0P A;  4I2A A;  4F5R A;  2EWR A;  1BPY A;  4YD1 A;  3OV7 A;  8ICC A;  2PFN A;  4WBY A;  2ID1 A;  4R65 A;  1ZQR A;  3RJI A;  4AT8 B;  4WH5 A;  2ISO A;  1BPB A;  4LT6 A;  4QZB A;  4RQ0 A;  3UPS A;  5HRH A;  4TUQ A;  1XSL A;  4K4H A;  1NO5 A;  4WQL A;  2DR8 A;  4KLI A;  1ZQA A;  3ERC C;  3B0Y A;  4KLS A;  4NLN A;  4UB1 A;  5D61 A;  4R64 A;  4F5O A;  5D46 A;  5DB9 A;  4KLQ A;  3ER9 B;  4TUR A;  5DB6 A;  2BE3 A;  9ICB A;  2ZH3 A;  1ZQS A;  5DDM A;  4PGX A;  4YMN A;  4NM2 A;  1ZQT A;  2ZHB A;  4AT7 A;  1ZQB A;  5EOZ A;  2B56 A;  4NM1 A;  8ICG A;  4RQ2 A;  5J2B A;  4IQV A;  3AU6 A;  4UBC A;  4FHX A;  3MGH A;  4NXW A;  7ICN A;  4PHE A;  1ZQF A;  2ZH1 A;  3WFS C;  2PFO A;  3UQ2 A;  3GDX A;  4K9B A;  9ICQ A;  5D49 A;  5D62 A;  3JZ0 A;  3NVO A;  8ICL A;  3C5G A;  1ZJM A;  8ICP A;  3HJ4 A;  4K99 A;  3HJ1 A;  4RQ6 A;  4NY8 A;  3RJH A;  1XSN A;  4GXK A;  5DBC A;  4E80 A;  4I2B A;  3LQC B;  7ICG A;  4I2I A;  4Z6D A;  4R66 A;  1ZQG A;  4QZG A;  4Z6C A;  4I27 A;  5J2I A;  4WCW A;  1TV9 A;  8ICW A;  4K98 A;  8ICM A;  9ICK A;  8ICT A;  9ICN A;  4PHP A;  4K4I A;  3RJJ A;  4NXU A;  1ZQV A;  4X4Q A;  4WC0 A;  4YMO A;  4K97 A;  7ICT A;  4X4R A;  1F5A A;  4I2F A;  3H39 A;  5F2V O;  4XJE A;  5HR9 A;  9ICE A;  5IIM A;  4N7R A;  8ICH A;  5DBB A;  3JYY A;  3JPP A;  2GWS A;  1ZQO A;  8ICU A;  4E7X A;  4DOA A;  7ICH A;  5CP2 A;  4IG8 A;  2M2V A;  3ISD A;  7ICR A;  4OAH A;  1ZQM A;  3WFO A;  3EF2 A;  5CHG A;  4XUS A;  5DEC A;  4K9A A;  4NXT A;  3RJF A;  4RWN A;  4EEB A;  4PPX A;  4FHV A;  3NYB A;  1ZQX A;  4FH3 A;  4NKT A;  4X4O A;  4I0U A;  4O5E A;  3HW8 A;  4OAI Z;  5J0U A;  1BPX A;  4WC7 A;  5IIJ A;  2DVI A;  4FHW A;  4XA5 A;  2FMS A;  1KDH A;  5HRE A;  4KLU A;  7ICK A;  4F5Q A;  4UB4 A;  2HN1 A;  3PHZ A;  4RQ7 A;  1JN3 A;  3B0X A;  2BCU A;  4O69 A;  4PGQ A;  5HHH A;  8ICY A;  5J0O A;  4I2G A;  4X5V A;  1ZQC A;  1ZQY A;  1OU5 A;  5J2J A; 
#chains in the Genus database with same CATH homology
 2M2T A;  2M2U A;  8ICQ A;  2BCR A;  4I2D A;  8ICB A;  7ICV A;  4KLL A;  8ICR A;  4PHA A;  4WC6 A;  4X4T A;  3ISC A;  2DR5 A;  3UXO A;  2PFQ A;  4RQ1 A;  3C18 A;  4M2Y A;  4EBK A;  4X4U A;  4WBZ A;  2PBE A;  4FHY A;  2W9M A;  5CR0 A;  4I2J A;  2DR7 A;  4EBJ A;  4RPZ A;  2ZH5 A;  4KLE A;  9ICL A;  1ZQJ A;  3WFR E;  2NRK A;  1Q79 A;  4RWO A;  1KEJ A;  4RQ5 A;  3JPR A;  7ICM A;  9ICJ A;  4XRH A;  3V7L A;  4WC3 A;  4FO6 A;  2BPC A;  2BCS A;  3HIY A;  4QZI A;  5J0Q A;  5J0S A;  3MBY A;  5HRF A;  8ICX A;  4AT9 B;  2ZH9 A;  9ICO A;  3JPN A;  9ICF A;  2ZHA A;  1UET A;  4QZE A;  1R89 A;  3AQK A;  1ZQL A;  8ICO A;  4MF8 A;  4I2H A;  5J29 A;  2P66 A;  4NXZ A;  4AT9 A;  8ICS A;  4M04 A;  2HHP A;  4M9H A;  5J0R A;  5D4B A;  5DB7 A;  3RH4 A;  8ICK A;  4I2C A;  2ZH7 A;  4UB2 A;  9ICU A;  5J2C A;  4E8F A;  8ICV A;  3C5F A;  7ICI A;  4UD5 A;  3UQ0 A;  3HWT A;  4YMM A;  5CA7 A;  2M2W A;  5J2D A;  1BPD A;  1RPL A;  3UXN A;  3OUY A;  8ICF A;  1NOM A;  2O1P A;  2I9G A;  3WFQ E;  4RPX A;  4JWN A;  4QZA A;  5J0W A;  4KLD A;  2O5A A;  5CJ7 A;  4RWQ A;  3LK9 A;  5CB1 A;  3MDC A;  2BCQ A;  4KLF A;  9ICV A;  4UBB A;  3MDA A;  1ZJN A;  7ICP A;  5TZV A;  1R8B A;  3PNC A;  7ICQ A;  1ZQD A;  3OVB A;  1KNY A;  4Z6E A;  5J0Y A;  4MFA A;  4IQT A;  9ICG A;  4UD4 A;  4XQ8 A;  4FH5 A;  4QZC A;  3K75 D;  9ICR A;  4K4G A;  4WC1 A;  3RJE A;  4LZG A;  5J2K A;  1Q78 A;  4QZF A;  3TFS A;  7ICF A;  9ICW A;  4IQW A;  5III A;  4RQ8 A;  5IIK A;  5DBA A;  4PHD A;  8ICE A;  2Q66 A;  4RPY A;  3L9D A;  4GXJ A;  3PML A;  4ATB B;  4P4O A;  1MIV A;  4X0B A;  3JPQ A;  4YD2 A;  2ZH4 A;  4UB3 A;  1VJ7 A;  5IIL A;  1R8A A;  8ICA A;  4S3N A;  4P4M A;  1R8C A;  3UXP A;  1ZQH A;  4MFF A;  3JPS A;  1MQ3 A;  1ZQN A;  1JMS A;  2BPG A;  1MQ2 A;  3MGI A;  4WC4 A;  1ZQW A;  4DOB A;  1ZQQ A;  3C2L A;  3OVA A;  4M9N A;  8ICN A;  4PH5 A;  1HUZ A;  4KLG A;  5DED A;  2DRA A;  3C2K A;  9ICT A;  8ICZ A;  3TFR A;  1ZQU A;  5DDY A;  4O5C A;  3RH5 A;  3C2M A;  5CWR A;  5J0X A;  1ZQE A;  3OVS A;  5HHI A;  3V7K A;  5J2H A;  4PGY A;  9ICS A;  5J2E A;  1V4A A;  3H38 A;  1PX5 A;  2ZH6 A;  2ZH2 A;  4R63 A;  4X4V A;  1WOT A;  9ICP A;  2VAN A;  1ZQK A;  4X4P A;  4O5K A;  4UAW A;  2FMP A;  4YN4 A;  1ZQI A;  2ZH8 A;  9ICM A;  3AQL A;  9ICH A;  5J2F A;  3AQM A;  4RWP A;  7ICL A;  4LVS A;  4QZ8 A;  4M5D A;  3OGU A;  4UB5 A;  2BCV A;  3UPQ A;  2FMQ A;  4X4S A;  3WFP A;  3AUO A;  4X4N A;  4WC5 A;  1UEU A;  7ICS A;  3RH6 A;  4KLJ A;  4MF2 A;  2DRB A;  4X0A A;  9ICA A;  4FHP A;  5BOL A;  7ICJ A;  4RQ3 A;  4KLH A;  3OUY B;  9ICC A;  3HX0 A;  5HRG A;  4YCX A;  3AQN A;  1YLQ A;  7ICU A;  2DR9 A;  2PXI A;  1TVA A;  1MIW A;  4XQ7 A;  1BPE A;  5HRI A;  1JAJ A;  4KLT A;  1TFY A;  4NKU A;  8ICJ A;  4QZD A;  5J0T A;  4M9J A;  4LZD A;  4IQU A;  4M47 A;  3H3A A;  2ISP A;  3C66 A;  4WC2 A;  2BPF A;  1ZQZ A;  9ICX A;  1JQR A;  9ICI A;  3ISB A;  4GXI A;  4O9M A;  4M9G A;  5BOM A;  3PMN A;  5IIN A;  3H37 A;  1XSP A;  5DKW A;  4M9L A;  5HRL A;  3JPO A;  2IHM A;  3V7J A;  1ZQP A;  4NLK A;  4Z6F A;  4P2H A;  5J2A A;  1RZT A;  2RFF A;  4QZH A;  5HC9 A;  4TUS A;  4MFC A;  4AT7 B;  3JPT A;  4I28 A;  4M0A A;  3AU2 A;  4RT2 A;  3RJG A;  5BPC A;  1UEV A;  5IIO A;  4RQ4 A;  4AT8 A;  4TUP A;  8ICI A;  7ICE A;  5HRD A;  4UAZ A;  3RJK A;  4NLZ A;  4DOC A;  5HRK A;  7ICO A;  4UAY A;  4I2E A;  1FA0 A;  4EP7 A;  4P4P A;  1BPZ A;  4F5N A;  4I29 A;  4KLO A;  1MIY A;  4DO9 A;  4JWM A;  5HRB A;  3V72 A;  4QZ9 A;  4RT3 A;  4KLM A;  4F5P A;  1TFW A;  4ATB A;  1VFG A;  2PFP A;  1HUO A;  5J2G A;  5DB8 A;  5J0P A;  4I2A A;  4F5R A;  1BPY A;  4YD1 A;  3OV7 A;  8ICC A;  2PFN A;  4WBY A;  2ID1 A;  4R65 A;  1ZQR A;  3RJI A;  4AT8 B;  2ISO A;  1BPB A;  4LT6 A;  4QZB A;  4RQ0 A;  3UPS A;  5HRH A;  4TUQ A;  1XSL A;  4K4H A;  1NO5 A;  2DR8 A;  4KLI A;  1ZQA A;  3B0Y A;  4KLS A;  4NLN A;  4UB1 A;  4R64 A;  4F5O A;  5D46 A;  5DB9 A;  4KLQ A;  4TUR A;  5DB6 A;  2BE3 A;  9ICB A;  2ZH3 A;  1ZQS A;  5DDM A;  4PGX A;  4YMN A;  4NM2 A;  1ZQT A;  2ZHB A;  4AT7 A;  1ZQB A;  5EOZ A;  4NM1 A;  8ICG A;  4RQ2 A;  5J2B A;  4IQV A;  3AU6 A;  4UBC A;  4FHX A;  3MGH A;  7ICN A;  4PHE A;  1ZQF A;  2ZH1 A;  3WFS C;  2PFO A;  3UQ2 A;  3GDX A;  9ICQ A;  5D49 A;  3JZ0 A;  8ICL A;  3C5G A;  1ZJM A;  8ICP A;  3HJ4 A;  3HJ1 A;  4RQ6 A;  4NY8 A;  3RJH A;  1XSN A;  4GXK A;  5DBC A;  4E80 A;  4I2B A;  3LQC B;  7ICG A;  4I2I A;  4Z6D A;  4R66 A;  1ZQG A;  4QZG A;  4Z6C A;  4I27 A;  5J2I A;  4WCW A;  1TV9 A;  8ICW A;  8ICM A;  9ICK A;  8ICT A;  9ICN A;  4PHP A;  4K4I A;  3RJJ A;  1ZQV A;  4X4Q A;  4WC0 A;  4YMO A;  7ICT A;  4X4R A;  1F5A A;  4I2F A;  3H39 A;  5F2V O;  5HR9 A;  9ICE A;  5IIM A;  8ICH A;  5DBB A;  3JYY A;  3JPP A;  2GWS A;  1ZQO A;  8ICU A;  4E7X A;  4DOA A;  7ICH A;  5CP2 A;  4IG8 A;  2M2V A;  3ISD A;  7ICR A;  1ZQM A;  3WFO A;  5CHG A;  4XUS A;  5DEC A;  3RJF A;  4RWN A;  4PPX A;  4FHV A;  3NYB A;  1ZQX A;  4FH3 A;  4NKT A;  4X4O A;  4O5E A;  3HW8 A;  5J0U A;  1BPX A;  4WC7 A;  5IIJ A;  2DVI A;  4FHW A;  4XA5 A;  2FMS A;  1KDH A;  5HRE A;  4KLU A;  7ICK A;  4F5Q A;  4UB4 A;  4RQ7 A;  1JN3 A;  3B0X A;  2BCU A;  4PGQ A;  5HHH A;  8ICY A;  5J0O A;  4I2G A;  4X5V A;  1ZQC A;  1ZQY A;  1OU5 A;  5J2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...