2M2TA

Asfv pol x structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
b'MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
total genus 41
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2tA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2tA01
3OVAA 4RQ3A 1JQRA 3AQKA 4X4NA 2M2WA 3AQNA 4GXKA 5D4BA 3K75D 4RWNA 3RH4A 4P2HA 4KLQA 4FHXA 3MBYA 4MF2A 4RWOA 4FHWA 3JPNA 3HJ1A 2BE3A 4RT3A 4AT9B 3H3AA 3JPPA 5CWRA 4IQWA 4WCWA 7ICIA 3WFRE 2PFNA 4FHVA 4AT7A 2DR5A 2W9MA 7ICVA 3MDCA 2BCRA 1KNYA 4ATBA 7ICOA 1Q79A 5J0QA 1ZQHA 5CR0A 1ZQTA 8ICOA 1ZQMA 5IILA 1UEUA 4NXZA 1PX5A 4PGQA 3PNCA 1MIYA 7ICRA 2PXIA 9ICPA 5J2AA 1VJ7A 4YCXA 5J2KA 3WFSC 4X4UA 4QZ9A 4UD5A 4WC2A 2RFFA 3V7JA 4UAZA 5DB8A 4QZ8A 4IG8A 4X4TA 2PFQA 3JPOA 4RPYA 4X4SA 3HJ4A 2ZH6A 4M5DA 1ZJMA 1TV9A 2ZH2A 3OVBA 8ICCA 2M2UA 4UB3A 4F5NA 8ICIA 2M2VA 4Z6CA 4KLUA 3B0XA 3LK9A 4DOAA 8ICKA 9ICUA 5J0WA 3MGIA 1XSNA 4UD4A 1TFWA 4F5RA 5J2BA 8ICGA 3TFSA 4RPZA 5J2HA 3L9DA 4QZIA 3V72A 8ICFA 2DR8A 2GWSA 1ZQYA 4I2CA 7ICPA 5BOLA 4S3NA 1Q78A 4E7XA 5J0TA 5DB6A 4NY8A 2PFPA 4WC1A 8ICTA 5HRIA 4I2JA 3UXPA 4RPXA 9ICBA 4I2AA 5J2IA 4RQ4A 7ICKA 3NYBA 5DB9A 5EOZA 5HHHA 3ISDA 9ICEA 5J0OA 5J2DA 4KLIA 5CJ7A 1MIWA 3RH5A 1R8BA 3RH6A 1ZQSA 3JYYA 1WOTA 4RQ1A 4O5CA 1ZQKA 1ZQIA 1TFYA 4RQ0A 4YD1A 3WFPA 3RJJA 2DR7A 2DRAA 2ZH8A 1YLQA 4K4HA 1BPYA 4LZGA 4M04A 9ICLA 1NO5A 4M9JA 4LVSA 3B0YA 2IHMA 9ICOA 9ICXA 4I2IA 4IQVA 5J0SA 1BPEA 4NKUA 1ZQZA 4YMOA 2BPCA 5CP2A 4NM2A 3H38A 4Z6EA 4NKTA 4PHEA 5J29A 3WFQE 4RQ6A 1R89A 1ZQJA 3AU2A 9ICKA 4KLSA 2Q66A 4FHPA 4AT8B 1MIVA 4AT9A 4RQ8A 2PBEA 4PPXA 2BCSA 3RJGA 5TZVA 1FA0A 2ZH7A 5J2CA 3RJFA 4E80A 3C5GA 4M0AA 4RQ2A 1BPDA 9ICQA 4F5OA 1R8AA 4WC7A 3ISCA 4NM1A 4F5QA 4X4PA 4M9HA 4PHAA 8ICNA 4X4OA 4Z6DA 2ZH4A 2ZH9A 2DR9A 4IQTA 4R64A 4I2HA 4WC6A 4NLKA 4UB1A 5HC9A 3GDXA 4K4GA 4QZDA 8ICEA 9ICWA 4KLGA 7ICHA 5IIIA 4UBBA 4RQ5A 5IIMA 4X5VA 5F2VO 4JWNA 2ZHAA 5DBCA 7ICSA 4XQ7A 8ICBA 5IIKA 1ZQVA 2BCUA 5J0UA 5DECA 4YD2A 4PH5A 3OUYA 4I29A 1ZQOA 1ZQBA 4I2BA 8ICQA 4WBZA 5BPCA 3OV7A 3UPSA 3ISBA 3PMLA 5J2GA 2ISPA 2ZH5A 2ISOA 1NOMA 4UBCA 4TUQA 4EBJA 4QZHA 7ICGA 4M9LA 4P4OA 3C5FA 5D49A 5J0RA 1BPBA 4I28A 4QZGA 1ZQFA 5HRFA 4I2GA 8ICWA 5HRDA 3UXOA 5BOMA 3MDAA 4P4PA 3LQCB 4M47A 3OGUA 4I2EA 3TFRA 2FMPA 4O9MA 5J0PA 4XQ8A 4DOCA 8ICSA 7ICNA 4DO9A 4KLMA 8ICUA 4MFCA 4E8FA 2I9GA 5HREA 4KLTA 4IQUA 8ICHA 4TURA 5D46A 2PFOA 4M9GA 1F5AA 1VFGA 4K4IA 8ICRA 5DDYA 2DVIA 4XA5A 7ICMA 4YMNA 1ZQWA 2O1PA 3JPTA 5J2EA 1ZQEA 9ICNA 4R66A 7ICEA 3UPQA 4PHPA 2BPFA 3AQLA 2FMSA 5HRHA 3AU6A 3V7LA 3HX0A 1JMSA 1HUZA 3H37A 4MFAA 4WBYA 1OU5A 4TUSA 8ICLA 4O5KA 4KLJA 9ICRA 1ZQUA 1MQ2A 4I27A 5DB7A 3JPSA 4X0AA 8ICAA 1ZQAA 8ICMA 4UB4A 1XSLA 3HW8A 1ZQRA 5HRGA 1JAJA 4DOBA 1HUOA 4WC5A 5HRBA 7ICTA 4WC3A 3UQ2A 4UAYA 9ICHA 1ZQXA 4X4RA 4JWMA 3PMNA 1JN3A 1ZQDA 5IIOA 1UEVA 2NRKA 4M9NA 4X0BA 2P66A 4FHYA 4KLFA 2ZH1A 5J2JA 5CB1A 8ICZA 9ICVA 4I2DA 3WFOA 3H39A 1ZJNA 1UETA 4EBKA 1ZQPA 4NLNA 8ICVA 2M2TA 4LZDA 4TUPA 4KLDA 1V4AA 4AT7B 4KLOA 1KDHA 1ZQGA 9ICAA 4QZAA 8ICPA 4ATBB 7ICUA 4FO6A 5J0YA 5HR9A 5CA7A 5CHGA 5DBAA 4UB2A 1MQ3A 1RZTA 2BPGA 9ICMA 7ICLA 2BCQA 4F5PA 3UXNA 4UB5A 3HIYA 5HRLA 3OVSA 3MGHA 3C18A 2ZH3A 4QZFA 7ICJA 3RJKA 3AQMA 4WC4A 2BCVA 5DKWA 5HRKA 5J2FA 4KLLA 4R65A 4RQ7A 2ZHBA 3JPRA 4MFFA 9ICIA 4LT6A 3C2KA 4O5EA 4RT2A 3OUYB 1BPZA 3RJHA 4I2FA 4UAWA 3C2LA 8ICYA 2VANA 4NLZA 2HHPA 9ICFA 3UQ0A 1BPXA 4X4QA 3JZ0A 1RPLA 4QZBA 5IIJA 5J0XA 4PHDA 9ICCA 4PGYA 4R63A 3JPQA 4KLHA 1ZQQA 2FMQA 4QZEA 4KLEA 4QZCA 4EP7A 4YMMA 1ZQCA 1R8CA 1ZQLA 9ICJA 8ICJA 4GXIA 7ICFA 5IINA 5DEDA 1XSPA 1TVAA 9ICTA 3HWTA 5DDMA 4PGXA 4FH3A 1ZQNA 4FH5A 4WC0A 4P4MA 5DBBA 4Z6FA 9ICGA 4RWPA 4MF8A 1KEJA 3C2MA 8ICXA 9ICSA 4YN4A 7ICQA 2ID1A 2O5AA 2DRBA 4AT8A 4XUSA 4X4VA 4RWQA 3RJEA 4GXJA 3AUOA 3RJIA 3C66A 4XRHA 4M2YA 3V7KA 5HHIA
chains in the Genus database with same CATH superfamily
3OVAA 4RQ3A 1JQRA 2FCLA 3AQKA 4X4NA 2M2WA 2B51A 3AQNA 4GXKA 5D4BA 3K75D 2IHOA 3RH4A 4RWNA 4K99A 4P2HA 4KLQA 4FHXA 3MBYA 2B56A 5JTGA 4MF2A 4RWOA 4FHWA 3JPNA 3HJ1A 2BE3A 4RT3A 4AT9B 3H3AA 3JPPA 2BBHA 5CWRA 4IQWA 4WCWA 4NXTA 7ICIA 3WFRE 2PFNA 4FHVA 4AT7A 2DR5A 2W9MA 7ICVA 3MDCA 2BCRA 1KNYA 4ATBA 7ICOA 1Q79A 5J0QA 1ZQHA 4LEVA 5CR0A 1ZQTA 8ICOA 1ZQMA 5IILA 1UEUA 4NXZA 1PX5A 4PGQA 3PNCA 1MIYA 7ICRA 3EF2A 4WH5A 2PXIA 9ICPA 5J2AA 1VJ7A 4YCXA 5J2KA 3WFSC 4X4UA 4QZ9A 4UD5A 4WC2A 2RFFA 3V7JA 4UAZA 5DB8A 4QZ8A 4IG8A 4X4TA 2PFQA 3JPOA 4RPYA 4X4SA 3HJ4A 4WQLA 2ZH6A 4M5DA 1ZJMA 1TV9A 2ZH2A 3OVBA 8ICCA 3ERCC 2M2UA 4UB3A 4F5NA 8ICIA 2M2VA 4Z6CA 4KLUA 3B0XA 3LK9A 4DOAA 8ICKA 9ICUA 5J0WA 3MGIA 1XSNA 4UD4A 1TFWA 4F5RA 4O68A 5J2BA 8ICGA 5B3QA 3TFSA 4RPZA 5J2HA 3L9DA 4QZIA 3V72A 8ICFA 2DR8A 2GWSA 1ZQYA 4I2CA 7ICPA 2GA9D 4JLXA 3ER8C 5BOLA 5CFTA 4S3NA 1Q78A 4E7XA 5J0TA 5DB6A 4NY8A 2PFPA 4K97A 4WC1A 8ICTA 5HRIA 4I2JA 3UXPA 4LEWA 4RPXA 9ICBA 4I2AA 5J2IA 4RQ4A 7ICKA 3NYBA 5DB9A 5EOZA 5HHHA 3ISDA 4OAHA 9ICEA 5J0OA 4NXUA 5J2DA 4KLIA 5CJ7A 1MIWA 1GPJA 3RH5A 1R8BA 3RH6A 4OAGA 1ZQSA 5CFUA 3JYYA 1WOTA 4RQ1A 4O5CA 1ZQKA 1ZQIA 1TFYA 4RQ0A 4YD1A 3WFPA 3RJJA 2DR7A 2DRAA 5CFSA 1YLQA 2ZH8A 4K4HA 2HN1A 1BPYA 4LZGA 4M04A 9ICLA 1NO5A 4M9JA 4LVSA 3B0YA 2IHMA 9ICOA 9ICXA 4I2IA 4KB6A 4IQVA 5J0SA 1BPEA 4NKUA 1ZQZA 4YMOA 2BPCA 4LEZA 5CP2A 4NM2A 3H38A 4Z6EA 4NKTA 5D61A 4PHEA 5J29A 5CHEA 3WFQE 4RQ6A 1R89A 1ZQJA 2HN2A 3AU2A 9ICKA 3PHZA 4OAFA 4KLSA 2Q66A 4O69A 3ER9B 4FHPA 4AT8B 1MIVA 4KM5A 4AT9A 4RQ8A 2PBEA 4PPXA 2BCSA 3RJGA 5TZVA 1FA0A 4EGWA 5J2CA 3RJFA 2ZH7A 4I0UA 4E80A 3C5GA 4N7RA 4M0AA 4RQ2A 1BPDA 9ICQA 4F5OA 1R8AA 4WC7A 3ISCA 4NM1A 4F5QA 4WQKA 4X4PA 4MKPA 4M9HA 4PHAA 8ICNA 4X4OA 4Z6DA 2ZH4A 2ZH9A 2DR9A 4IQTA 4R64A 4I2HA 5D62A 4NLKA 4UB1A 4WC6A 3GDXA 5HC9A 4EEDA 4K4GA 4QZDA 8ICEA 9ICWA 4KLGA 7ICHA 5IIIA 4UBBA 4RQ5A 5IIMA 4X5VA 5F2VO 4JWNA 2ZHAA 5DBCA 7ICSA 4XQ7A 8ICBA 5IIKA 1ZQVA 2BCUA 5J0UA 5B3PA 5DECA 4YD2A 4K8VA 4PH5A 3OUYA 4I29A 1ZQOA 1ZQBA 4I2BA 8ICQA 4WBZA 5BPCA 3OV7A 3UPSA 3ISBA 3PMLA 5J2GA 2ISPA 2ZH5A 2ISOA 1NOMA 4UBCA 4TUQA 4OAIZ 4EBJA 4QZHA 7ICGA 4M9LA 4P4OA 3C5FA 5D49A 5J0RA 1BPBA 4I28A 4QZGA 1ZQFA 5HRFA 4I2GA 8ICWA 5HRDA 3UXOA 5BOMA 3MDAA 4P4PA 3LQCB 4M47A 3OGUA 4EV6A 4I2EA 3TFRA 2FMPA 4O9MA 2GAFD 5J0PA 4XQ8A 4DOCA 8ICSA 3CK6A 7ICNA 4DO9A 4KLMA 8ICUA 4MFCA 4E8FA 2I9GA 5HREA 3JCFA 4KLTA 4IQUA 8ICHA 4TURA 5D46A 2PFOA 4M9GA 1F5AA 4JLZA 4K4IA 1VFGA 2B4VA 8ICRA 5DDYA 2DVIA 3OWGA 4XA5A 7ICMA 4YMNA 1ZQWA 2O1PA 3JPTA 5J2EA 4FO1A 1ZQEA 9ICNA 4R66A 7ICEA 3UPQA 4PHPA 2BPFA 3AQLA 2FMSA 2EWRA 5HRHA 3AU6A 3V7LA 3HX0A 4K9BA 1JMSA 1HUZA 3NVOA 3H37A 4MFAA 4WBYA 4LEYA 1OU5A 4TUSA 4O67A 8ICLA 4O5KA 4KLJA 9ICRA 1ZQUA 1MQ2A 4I27A 5DB7A 3JPSA 4X0AA 8ICAA 1ZQAA 8ICMA 4UB4A 1XSLA 3HW8A 1ZQRA 5HRGA 4NXVA 1JAJA 4DOBA 1HUOA 4WC5A 5HRBA 7ICTA 4WC3A 3UQ2A 4UAYA 3NKUA 9ICHA 1ZQXA 4XJEA 4X4RA 4JWMA 3PMNA 1JN3A 1ZQDA 4HX0A 5IIOA 1UEVA 2NRKA 4M9NA 4X0BA 2P66A 4FHYA 4KLFA 2ZH1A 5J2JA 5CB1A 8ICZA 9ICVA 5D63A 4I2DA 3WFOA 3H39A 1ZJNA 1UETA 4EBKA 1ZQPA 4K9AA 4NLNA 8ICVA 2M2TA 4LZDA 2IUBA 4TUPA 4KLDA 1V4AA 4AT7B 4KLOA 1KDHA 1ZQGA 9ICAA 4QZAA 8ICPA 4ATBB 7ICUA 4FO6A 5J0YA 5HR9A 5CA7A 5CHGA 5DBAA 4UB2A 1MQ3A 1RZTA 2BPGA 9ICMA 7ICLA 2BCQA 4F5PA 3UXNA 4UB5A 4NXWA 3HIYA 5HRLA 4NXXA 3OVSA 4O6AA 3MGHA 3C18A 2ZH3A 4QZFA 7ICJA 3RJKA 3AQMA 4WC4A 2BCVA 5DKWA 5HRKA 5J2FA 4KLLA 4R65A 4WOYA 4RQ7A 2ZHBA 3JPRA 4MFFA 9ICIA 4LT6A 4K96A 3C2KA 4O5EA 4RT2A 3OUYB 1BPZA 3RJHA 4I2FA 2BBJA 4UAWA 3C2LA 8ICYA 2VANA 4NLZA 2HHPA 9ICFA 3UQ0A 1BPXA 4X4QA 3JZ0A 1RPLA 4QZBA 4EEBA 5IIJA 5J0XA 4PHDA 9ICCA 4PGYA 4R63A 3JPQA 4KLHA 1ZQQA 2FMQA 4QZEA 4KLEA 4K98A 4QZCA 4EP7A 4YMMA 1ZQCA 1R8CA 1ZQLA 9ICJA 3MCRA 8ICJA 4GXIA 3K7DA 7ICFA 5IINA 5DEDA 1XSPA 1TVAA 9ICTA 3HWTA 5DDMA 4PGXA 4FH3A 1ZQNA 3NWIA 4FH5A 4WC0A 4P4MA 5DBBA 4Z6FA 9ICGA 4RWPA 4MF8A 1KEJA 3C2MA 8ICXA 9ICSA 4YN4A 7ICQA 2ID1A 2O5AA 2DRBA 4AT8A 4XUSA 4X4VA 4RWQA 3RJEA 4GXJA 3AUOA 3RJIA 3C66A 4XRHA 4M2YA 3V7KA 5HHIA
chains in the Genus database with same CATH topology
3OVAA 4RQ3A 1JQRA 3AQKA 4X4NA 2M2WA 3AQNA 4GXKA 5D4BA 3K75D 4RWNA 3RH4A 4P2HA 4KLQA 4FHXA 3MBYA 4MF2A 4RWOA 4FHWA 3JPNA 3HJ1A 2BE3A 4RT3A 4AT9B 3H3AA 3JPPA 5CWRA 4IQWA 4WCWA 7ICIA 3WFRE 2PFNA 4FHVA 4AT7A 2DR5A 2W9MA 7ICVA 3MDCA 2BCRA 1KNYA 4ATBA 7ICOA 1Q79A 5J0QA 1ZQHA 5CR0A 1ZQTA 8ICOA 1ZQMA 5IILA 1UEUA 4NXZA 1PX5A 4PGQA 3PNCA 1MIYA 7ICRA 2PXIA 9ICPA 5J2AA 1VJ7A 4YCXA 5J2KA 3WFSC 4X4UA 4QZ9A 4UD5A 4WC2A 2RFFA 3V7JA 4UAZA 5DB8A 4QZ8A 4IG8A 4X4TA 2PFQA 3JPOA 4RPYA 4X4SA 3HJ4A 2ZH6A 4M5DA 1ZJMA 1TV9A 2ZH2A 3OVBA 8ICCA 2M2UA 4UB3A 4F5NA 8ICIA 2M2VA 4Z6CA 4KLUA 3B0XA 3LK9A 4DOAA 8ICKA 9ICUA 5J0WA 3MGIA 1XSNA 4UD4A 1TFWA 4F5RA 5J2BA 8ICGA 3TFSA 4RPZA 5J2HA 3L9DA 4QZIA 3V72A 8ICFA 2DR8A 2GWSA 1ZQYA 4I2CA 7ICPA 5BOLA 4S3NA 1Q78A 4E7XA 5J0TA 5DB6A 4NY8A 2PFPA 4WC1A 8ICTA 5HRIA 4I2JA 3UXPA 4RPXA 9ICBA 4I2AA 5J2IA 4RQ4A 7ICKA 3NYBA 5DB9A 5EOZA 5HHHA 3ISDA 9ICEA 5J0OA 5J2DA 4KLIA 5CJ7A 1MIWA 3RH5A 1R8BA 3RH6A 1ZQSA 3JYYA 1WOTA 4RQ1A 4O5CA 1ZQKA 1ZQIA 1TFYA 4RQ0A 4YD1A 3WFPA 3RJJA 2DR7A 2DRAA 2ZH8A 1YLQA 4K4HA 1BPYA 4LZGA 4M04A 9ICLA 1NO5A 4M9JA 4LVSA 3B0YA 2IHMA 9ICOA 9ICXA 4I2IA 4IQVA 5J0SA 1BPEA 4NKUA 1ZQZA 4YMOA 2BPCA 5CP2A 4NM2A 3H38A 4Z6EA 4NKTA 4PHEA 5J29A 3WFQE 4RQ6A 1R89A 1ZQJA 3AU2A 9ICKA 4KLSA 2Q66A 4FHPA 4AT8B 1MIVA 4AT9A 4RQ8A 2PBEA 4PPXA 2BCSA 3RJGA 5TZVA 1FA0A 2ZH7A 5J2CA 3RJFA 4E80A 3C5GA 4M0AA 4RQ2A 1BPDA 9ICQA 4F5OA 1R8AA 4WC7A 3ISCA 4NM1A 4F5QA 4X4PA 4M9HA 4PHAA 8ICNA 4X4OA 4Z6DA 2ZH4A 2ZH9A 2DR9A 4IQTA 4R64A 4I2HA 4WC6A 4NLKA 4UB1A 5HC9A 3GDXA 4K4GA 4QZDA 8ICEA 9ICWA 4KLGA 7ICHA 5IIIA 4UBBA 4RQ5A 5IIMA 4X5VA 5F2VO 4JWNA 2ZHAA 5DBCA 7ICSA 4XQ7A 8ICBA 5IIKA 1ZQVA 2BCUA 5J0UA 5DECA 4YD2A 4PH5A 3OUYA 4I29A 1ZQOA 1ZQBA 4I2BA 8ICQA 4WBZA 5BPCA 3OV7A 3UPSA 3ISBA 3PMLA 5J2GA 2ISPA 2ZH5A 2ISOA 1NOMA 4UBCA 4TUQA 4EBJA 4QZHA 7ICGA 4M9LA 4P4OA 3C5FA 5D49A 5J0RA 1BPBA 4I28A 4QZGA 1ZQFA 5HRFA 4I2GA 8ICWA 5HRDA 3UXOA 5BOMA 3MDAA 4P4PA 3LQCB 4M47A 3OGUA 4I2EA 3TFRA 2FMPA 4O9MA 5J0PA 4XQ8A 4DOCA 8ICSA 7ICNA 4DO9A 4KLMA 8ICUA 4MFCA 4E8FA 2I9GA 5HREA 4KLTA 4IQUA 8ICHA 4TURA 5D46A 2PFOA 4M9GA 1F5AA 1VFGA 4K4IA 8ICRA 5DDYA 2DVIA 4XA5A 7ICMA 4YMNA 1ZQWA 2O1PA 3JPTA 5J2EA 1ZQEA 9ICNA 4R66A 7ICEA 3UPQA 4PHPA 2BPFA 3AQLA 2FMSA 5HRHA 3AU6A 3V7LA 3HX0A 1JMSA 1HUZA 3H37A 4MFAA 4WBYA 1OU5A 4TUSA 8ICLA 4O5KA 4KLJA 9ICRA 1ZQUA 1MQ2A 4I27A 5DB7A 3JPSA 4X0AA 8ICAA 1ZQAA 8ICMA 4UB4A 1XSLA 3HW8A 1ZQRA 5HRGA 1JAJA 4DOBA 1HUOA 4WC5A 5HRBA 7ICTA 4WC3A 3UQ2A 4UAYA 9ICHA 1ZQXA 4X4RA 4JWMA 3PMNA 1JN3A 1ZQDA 5IIOA 1UEVA 2NRKA 4M9NA 4X0BA 2P66A 4FHYA 4KLFA 2ZH1A 5J2JA 5CB1A 8ICZA 9ICVA 4I2DA 3WFOA 3H39A 1ZJNA 1UETA 4EBKA 1ZQPA 4NLNA 8ICVA 2M2TA 4LZDA 4TUPA 4KLDA 1V4AA 4AT7B 4KLOA 1KDHA 1ZQGA 9ICAA 4QZAA 8ICPA 4ATBB 7ICUA 4FO6A 5J0YA 5HR9A 5CA7A 5CHGA 5DBAA 4UB2A 1MQ3A 1RZTA 2BPGA 9ICMA 7ICLA 2BCQA 4F5PA 3UXNA 4UB5A 3HIYA 5HRLA 3OVSA 3MGHA 3C18A 2ZH3A 4QZFA 7ICJA 3RJKA 3AQMA 4WC4A 2BCVA 5DKWA 5HRKA 5J2FA 4KLLA 4R65A 4RQ7A 2ZHBA 3JPRA 4MFFA 9ICIA 4LT6A 3C2KA 4O5EA 4RT2A 3OUYB 1BPZA 3RJHA 4I2FA 4UAWA 3C2LA 8ICYA 2VANA 4NLZA 2HHPA 9ICFA 3UQ0A 1BPXA 4X4QA 3JZ0A 1RPLA 4QZBA 5IIJA 5J0XA 4PHDA 9ICCA 4PGYA 4R63A 3JPQA 4KLHA 1ZQQA 2FMQA 4QZEA 4KLEA 4QZCA 4EP7A 4YMMA 1ZQCA 1R8CA 1ZQLA 9ICJA 8ICJA 4GXIA 7ICFA 5IINA 5DEDA 1XSPA 1TVAA 9ICTA 3HWTA 5DDMA 4PGXA 4FH3A 1ZQNA 4FH5A 4WC0A 4P4MA 5DBBA 4Z6FA 9ICGA 4RWPA 4MF8A 1KEJA 3C2MA 8ICXA 9ICSA 4YN4A 7ICQA 2ID1A 2O5AA 2DRBA 4AT8A 4XUSA 4X4VA 4RWQA 3RJEA 4GXJA 3AUOA 3RJIA 3C66A 4XRHA 4M2YA 3V7KA 5HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVA A;  4RQ3 A;  1JQR A;  3AQK A;  4X4N A;  2M2W A;  3AQN A;  4GXK A;  5D4B A;  3K75 D;  4RWN A;  3RH4 A;  4P2H A;  4KLQ A;  4FHX A;  3MBY A;  4MF2 A;  4RWO A;  4FHW A;  3JPN A;  3HJ1 A;  2BE3 A;  4RT3 A;  4AT9 B;  3H3A A;  3JPP A;  5CWR A;  4IQW A;  4WCW A;  7ICI A;  3WFR E;  2PFN A;  4FHV A;  4AT7 A;  2DR5 A;  2W9M A;  7ICV A;  3MDC A;  2BCR A;  1KNY A;  4ATB A;  7ICO A;  1Q79 A;  5J0Q A;  1ZQH A;  5CR0 A;  1ZQT A;  8ICO A;  1ZQM A;  5IIL A;  1UEU A;  4NXZ A;  1PX5 A;  4PGQ A;  3PNC A;  1MIY A;  7ICR A;  2PXI A;  9ICP A;  5J2A A;  1VJ7 A;  4YCX A;  5J2K A;  3WFS C;  4X4U A;  4QZ9 A;  4UD5 A;  4WC2 A;  2RFF A;  3V7J A;  4UAZ A;  5DB8 A;  4QZ8 A;  4IG8 A;  4X4T A;  2PFQ A;  3JPO A;  4RPY A;  4X4S A;  3HJ4 A;  2ZH6 A;  4M5D A;  1ZJM A;  1TV9 A;  2ZH2 A;  3OVB A;  8ICC A;  2M2U A;  4UB3 A;  4F5N A;  8ICI A;  2M2V A;  4Z6C A;  4KLU A;  3B0X A;  3LK9 A;  4DOA A;  8ICK A;  9ICU A;  5J0W A;  3MGI A;  1XSN A;  4UD4 A;  1TFW A;  4F5R A;  5J2B A;  8ICG A;  3TFS A;  4RPZ A;  5J2H A;  3L9D A;  4QZI A;  3V72 A;  8ICF A;  2DR8 A;  2GWS A;  1ZQY A;  4I2C A;  7ICP A;  5BOL A;  4S3N A;  1Q78 A;  4E7X A;  5J0T A;  5DB6 A;  4NY8 A;  2PFP A;  4WC1 A;  8ICT A;  5HRI A;  4I2J A;  3UXP A;  4RPX A;  9ICB A;  4I2A A;  5J2I A;  4RQ4 A;  7ICK A;  3NYB A;  5DB9 A;  5EOZ A;  5HHH A;  3ISD A;  9ICE A;  5J0O A;  5J2D A;  4KLI A;  5CJ7 A;  1MIW A;  3RH5 A;  1R8B A;  3RH6 A;  1ZQS A;  3JYY A;  1WOT A;  4RQ1 A;  4O5C A;  1ZQK A;  1ZQI A;  1TFY A;  4RQ0 A;  4YD1 A;  3WFP A;  3RJJ A;  2DR7 A;  2DRA A;  2ZH8 A;  1YLQ A;  4K4H A;  1BPY A;  4LZG A;  4M04 A;  9ICL A;  1NO5 A;  4M9J A;  4LVS A;  3B0Y A;  2IHM A;  9ICO A;  9ICX A;  4I2I A;  4IQV A;  5J0S A;  1BPE A;  4NKU A;  1ZQZ A;  4YMO A;  2BPC A;  5CP2 A;  4NM2 A;  3H38 A;  4Z6E A;  4NKT A;  4PHE A;  5J29 A;  3WFQ E;  4RQ6 A;  1R89 A;  1ZQJ A;  3AU2 A;  9ICK A;  4KLS A;  2Q66 A;  4FHP A;  4AT8 B;  1MIV A;  4AT9 A;  4RQ8 A;  2PBE A;  4PPX A;  2BCS A;  3RJG A;  5TZV A;  1FA0 A;  2ZH7 A;  5J2C A;  3RJF A;  4E80 A;  3C5G A;  4M0A A;  4RQ2 A;  1BPD A;  9ICQ A;  4F5O A;  1R8A A;  4WC7 A;  3ISC A;  4NM1 A;  4F5Q A;  4X4P A;  4M9H A;  4PHA A;  8ICN A;  4X4O A;  4Z6D A;  2ZH4 A;  2ZH9 A;  2DR9 A;  4IQT A;  4R64 A;  4I2H A;  4WC6 A;  4NLK A;  4UB1 A;  5HC9 A;  3GDX A;  4K4G A;  4QZD A;  8ICE A;  9ICW A;  4KLG A;  7ICH A;  5III A;  4UBB A;  4RQ5 A;  5IIM A;  4X5V A;  5F2V O;  4JWN A;  2ZHA A;  5DBC A;  7ICS A;  4XQ7 A;  8ICB A;  5IIK A;  1ZQV A;  2BCU A;  5J0U A;  5DEC A;  4YD2 A;  4PH5 A;  3OUY A;  4I29 A;  1ZQO A;  1ZQB A;  4I2B A;  8ICQ A;  4WBZ A;  5BPC A;  3OV7 A;  3UPS A;  3ISB A;  3PML A;  5J2G A;  2ISP A;  2ZH5 A;  2ISO A;  1NOM A;  4UBC A;  4TUQ A;  4EBJ A;  4QZH A;  7ICG A;  4M9L A;  4P4O A;  3C5F A;  5D49 A;  5J0R A;  1BPB A;  4I28 A;  4QZG A;  1ZQF A;  5HRF A;  4I2G A;  8ICW A;  5HRD A;  3UXO A;  5BOM A;  3MDA A;  4P4P A;  3LQC B;  4M47 A;  3OGU A;  4I2E A;  3TFR A;  2FMP A;  4O9M A;  5J0P A;  4XQ8 A;  4DOC A;  8ICS A;  7ICN A;  4DO9 A;  4KLM A;  8ICU A;  4MFC A;  4E8F A;  2I9G A;  5HRE A;  4KLT A;  4IQU A;  8ICH A;  4TUR A;  5D46 A;  2PFO A;  4M9G A;  1F5A A;  1VFG A;  4K4I A;  8ICR A;  5DDY A;  2DVI A;  4XA5 A;  7ICM A;  4YMN A;  1ZQW A;  2O1P A;  3JPT A;  5J2E A;  1ZQE A;  9ICN A;  4R66 A;  7ICE A;  3UPQ A;  4PHP A;  2BPF A;  3AQL A;  2FMS A;  5HRH A;  3AU6 A;  3V7L A;  3HX0 A;  1JMS A;  1HUZ A;  3H37 A;  4MFA A;  4WBY A;  1OU5 A;  4TUS A;  8ICL A;  4O5K A;  4KLJ A;  9ICR A;  1ZQU A;  1MQ2 A;  4I27 A;  5DB7 A;  3JPS A;  4X0A A;  8ICA A;  1ZQA A;  8ICM A;  4UB4 A;  1XSL A;  3HW8 A;  1ZQR A;  5HRG A;  1JAJ A;  4DOB A;  1HUO A;  4WC5 A;  5HRB A;  7ICT A;  4WC3 A;  3UQ2 A;  4UAY A;  9ICH A;  1ZQX A;  4X4R A;  4JWM A;  3PMN A;  1JN3 A;  1ZQD A;  5IIO A;  1UEV A;  2NRK A;  4M9N A;  4X0B A;  2P66 A;  4FHY A;  4KLF A;  2ZH1 A;  5J2J A;  5CB1 A;  8ICZ A;  9ICV A;  4I2D A;  3WFO A;  3H39 A;  1ZJN A;  1UET A;  4EBK A;  1ZQP A;  4NLN A;  8ICV A;  2M2T A;  4LZD A;  4TUP A;  4KLD A;  1V4A A;  4AT7 B;  4KLO A;  1KDH A;  1ZQG A;  9ICA A;  4QZA A;  8ICP A;  4ATB B;  7ICU A;  4FO6 A;  5J0Y A;  5HR9 A;  5CA7 A;  5CHG A;  5DBA A;  4UB2 A;  1MQ3 A;  1RZT A;  2BPG A;  9ICM A;  7ICL A;  2BCQ A;  4F5P A;  3UXN A;  4UB5 A;  3HIY A;  5HRL A;  3OVS A;  3MGH A;  3C18 A;  2ZH3 A;  4QZF A;  7ICJ A;  3RJK A;  3AQM A;  4WC4 A;  2BCV A;  5DKW A;  5HRK A;  5J2F A;  4KLL A;  4R65 A;  4RQ7 A;  2ZHB A;  3JPR A;  4MFF A;  9ICI A;  4LT6 A;  3C2K A;  4O5E A;  4RT2 A;  3OUY B;  1BPZ A;  3RJH A;  4I2F A;  4UAW A;  3C2L A;  8ICY A;  2VAN A;  4NLZ A;  2HHP A;  9ICF A;  3UQ0 A;  1BPX A;  4X4Q A;  3JZ0 A;  1RPL A;  4QZB A;  5IIJ A;  5J0X A;  4PHD A;  9ICC A;  4PGY A;  4R63 A;  3JPQ A;  4KLH A;  1ZQQ A;  2FMQ A;  4QZE A;  4KLE A;  4QZC A;  4EP7 A;  4YMM A;  1ZQC A;  1R8C A;  1ZQL A;  9ICJ A;  8ICJ A;  4GXI A;  7ICF A;  5IIN A;  5DED A;  1XSP A;  1TVA A;  9ICT A;  3HWT A;  5DDM A;  4PGX A;  4FH3 A;  1ZQN A;  4FH5 A;  4WC0 A;  4P4M A;  5DBB A;  4Z6F A;  9ICG A;  4RWP A;  4MF8 A;  1KEJ A;  3C2M A;  8ICX A;  9ICS A;  4YN4 A;  7ICQ A;  2ID1 A;  2O5A A;  2DRB A;  4AT8 A;  4XUS A;  4X4V A;  4RWQ A;  3RJE A;  4GXJ A;  3AUO A;  3RJI A;  3C66 A;  4XRH A;  4M2Y A;  3V7K A;  5HHI A; 
#chains in the Genus database with same CATH topology
 3OVA A;  4RQ3 A;  1JQR A;  2FCL A;  3AQK A;  4X4N A;  2M2W A;  2B51 A;  3AQN A;  4GXK A;  5D4B A;  3K75 D;  2IHO A;  3RH4 A;  4RWN A;  4K99 A;  4P2H A;  4KLQ A;  4FHX A;  3MBY A;  2B56 A;  5JTG A;  4MF2 A;  4RWO A;  4FHW A;  3JPN A;  3HJ1 A;  2BE3 A;  4RT3 A;  4AT9 B;  3H3A A;  3JPP A;  2BBH A;  5CWR A;  4IQW A;  4WCW A;  4NXT A;  7ICI A;  3WFR E;  2PFN A;  4FHV A;  4AT7 A;  2DR5 A;  2W9M A;  7ICV A;  3MDC A;  2BCR A;  1KNY A;  4ATB A;  7ICO A;  1Q79 A;  5J0Q A;  1ZQH A;  4LEV A;  5CR0 A;  1ZQT A;  8ICO A;  1ZQM A;  5IIL A;  1UEU A;  4NXZ A;  1PX5 A;  4PGQ A;  3PNC A;  1MIY A;  7ICR A;  3EF2 A;  4WH5 A;  2PXI A;  9ICP A;  5J2A A;  1VJ7 A;  4YCX A;  5J2K A;  3WFS C;  4X4U A;  4QZ9 A;  4UD5 A;  4WC2 A;  2RFF A;  3V7J A;  4UAZ A;  5DB8 A;  4QZ8 A;  4IG8 A;  4X4T A;  2PFQ A;  3JPO A;  4RPY A;  4X4S A;  3HJ4 A;  4WQL A;  2ZH6 A;  4M5D A;  1ZJM A;  1TV9 A;  2ZH2 A;  3OVB A;  8ICC A;  3ERC C;  2M2U A;  4UB3 A;  4F5N A;  8ICI A;  2M2V A;  4Z6C A;  4KLU A;  3B0X A;  3LK9 A;  4DOA A;  8ICK A;  9ICU A;  5J0W A;  3MGI A;  1XSN A;  4UD4 A;  1TFW A;  4F5R A;  4O68 A;  5J2B A;  8ICG A;  5B3Q A;  3TFS A;  4RPZ A;  5J2H A;  3L9D A;  4QZI A;  3V72 A;  8ICF A;  2DR8 A;  2GWS A;  1ZQY A;  4I2C A;  7ICP A;  2GA9 D;  4JLX A;  3ER8 C;  5BOL A;  5CFT A;  4S3N A;  1Q78 A;  4E7X A;  5J0T A;  5DB6 A;  4NY8 A;  2PFP A;  4K97 A;  4WC1 A;  8ICT A;  5HRI A;  4I2J A;  3UXP A;  4LEW A;  4RPX A;  9ICB A;  4I2A A;  5J2I A;  4RQ4 A;  7ICK A;  3NYB A;  5DB9 A;  5EOZ A;  5HHH A;  3ISD A;  4OAH A;  9ICE A;  5J0O A;  4NXU A;  5J2D A;  4KLI A;  5CJ7 A;  1MIW A;  1GPJ A;  3RH5 A;  1R8B A;  3RH6 A;  4OAG A;  1ZQS A;  5CFU A;  3JYY A;  1WOT A;  4RQ1 A;  4O5C A;  1ZQK A;  1ZQI A;  1TFY A;  4RQ0 A;  4YD1 A;  3WFP A;  3RJJ A;  2DR7 A;  2DRA A;  5CFS A;  1YLQ A;  2ZH8 A;  4K4H A;  2HN1 A;  1BPY A;  4LZG A;  4M04 A;  9ICL A;  1NO5 A;  4M9J A;  4LVS A;  3B0Y A;  2IHM A;  9ICO A;  9ICX A;  4I2I A;  4KB6 A;  4IQV A;  5J0S A;  1BPE A;  4NKU A;  1ZQZ A;  4YMO A;  2BPC A;  4LEZ A;  5CP2 A;  4NM2 A;  3H38 A;  4Z6E A;  4NKT A;  5D61 A;  4PHE A;  5J29 A;  5CHE A;  3WFQ E;  4RQ6 A;  1R89 A;  1ZQJ A;  2HN2 A;  3AU2 A;  9ICK A;  3PHZ A;  4OAF A;  4KLS A;  2Q66 A;  4O69 A;  3ER9 B;  4FHP A;  4AT8 B;  1MIV A;  4KM5 A;  4AT9 A;  4RQ8 A;  2PBE A;  4PPX A;  2BCS A;  3RJG A;  5TZV A;  1FA0 A;  4EGW A;  5J2C A;  3RJF A;  2ZH7 A;  4I0U A;  4E80 A;  3C5G A;  4N7R A;  4M0A A;  4RQ2 A;  1BPD A;  9ICQ A;  4F5O A;  1R8A A;  4WC7 A;  3ISC A;  4NM1 A;  4F5Q A;  4WQK A;  4X4P A;  4MKP A;  4M9H A;  4PHA A;  8ICN A;  4X4O A;  4Z6D A;  2ZH4 A;  2ZH9 A;  2DR9 A;  4IQT A;  4R64 A;  4I2H A;  5D62 A;  4NLK A;  4UB1 A;  4WC6 A;  3GDX A;  5HC9 A;  4EED A;  4K4G A;  4QZD A;  8ICE A;  9ICW A;  4KLG A;  7ICH A;  5III A;  4UBB A;  4RQ5 A;  5IIM A;  4X5V A;  5F2V O;  4JWN A;  2ZHA A;  5DBC A;  7ICS A;  4XQ7 A;  8ICB A;  5IIK A;  1ZQV A;  2BCU A;  5J0U A;  5B3P A;  5DEC A;  4YD2 A;  4K8V A;  4PH5 A;  3OUY A;  4I29 A;  1ZQO A;  1ZQB A;  4I2B A;  8ICQ A;  4WBZ A;  5BPC A;  3OV7 A;  3UPS A;  3ISB A;  3PML A;  5J2G A;  2ISP A;  2ZH5 A;  2ISO A;  1NOM A;  4UBC A;  4TUQ A;  4OAI Z;  4EBJ A;  4QZH A;  7ICG A;  4M9L A;  4P4O A;  3C5F A;  5D49 A;  5J0R A;  1BPB A;  4I28 A;  4QZG A;  1ZQF A;  5HRF A;  4I2G A;  8ICW A;  5HRD A;  3UXO A;  5BOM A;  3MDA A;  4P4P A;  3LQC B;  4M47 A;  3OGU A;  4EV6 A;  4I2E A;  3TFR A;  2FMP A;  4O9M A;  2GAF D;  5J0P A;  4XQ8 A;  4DOC A;  8ICS A;  3CK6 A;  7ICN A;  4DO9 A;  4KLM A;  8ICU A;  4MFC A;  4E8F A;  2I9G A;  5HRE A;  3JCF A;  4KLT A;  4IQU A;  8ICH A;  4TUR A;  5D46 A;  2PFO A;  4M9G A;  1F5A A;  4JLZ A;  4K4I A;  1VFG A;  2B4V A;  8ICR A;  5DDY A;  2DVI A;  3OWG A;  4XA5 A;  7ICM A;  4YMN A;  1ZQW A;  2O1P A;  3JPT A;  5J2E A;  4FO1 A;  1ZQE A;  9ICN A;  4R66 A;  7ICE A;  3UPQ A;  4PHP A;  2BPF A;  3AQL A;  2FMS A;  2EWR A;  5HRH A;  3AU6 A;  3V7L A;  3HX0 A;  4K9B A;  1JMS A;  1HUZ A;  3NVO A;  3H37 A;  4MFA A;  4WBY A;  4LEY A;  1OU5 A;  4TUS A;  4O67 A;  8ICL A;  4O5K A;  4KLJ A;  9ICR A;  1ZQU A;  1MQ2 A;  4I27 A;  5DB7 A;  3JPS A;  4X0A A;  8ICA A;  1ZQA A;  8ICM A;  4UB4 A;  1XSL A;  3HW8 A;  1ZQR A;  5HRG A;  4NXV A;  1JAJ A;  4DOB A;  1HUO A;  4WC5 A;  5HRB A;  7ICT A;  4WC3 A;  3UQ2 A;  4UAY A;  3NKU A;  9ICH A;  1ZQX A;  4XJE A;  4X4R A;  4JWM A;  3PMN A;  1JN3 A;  1ZQD A;  4HX0 A;  5IIO A;  1UEV A;  2NRK A;  4M9N A;  4X0B A;  2P66 A;  4FHY A;  4KLF A;  2ZH1 A;  5J2J A;  5CB1 A;  8ICZ A;  9ICV A;  5D63 A;  4I2D A;  3WFO A;  3H39 A;  1ZJN A;  1UET A;  4EBK A;  1ZQP A;  4K9A A;  4NLN A;  8ICV A;  2M2T A;  4LZD A;  2IUB A;  4TUP A;  4KLD A;  1V4A A;  4AT7 B;  4KLO A;  1KDH A;  1ZQG A;  9ICA A;  4QZA A;  8ICP A;  4ATB B;  7ICU A;  4FO6 A;  5J0Y A;  5HR9 A;  5CA7 A;  5CHG A;  5DBA A;  4UB2 A;  1MQ3 A;  1RZT A;  2BPG A;  9ICM A;  7ICL A;  2BCQ A;  4F5P A;  3UXN A;  4UB5 A;  4NXW A;  3HIY A;  5HRL A;  4NXX A;  3OVS A;  4O6A A;  3MGH A;  3C18 A;  2ZH3 A;  4QZF A;  7ICJ A;  3RJK A;  3AQM A;  4WC4 A;  2BCV A;  5DKW A;  5HRK A;  5J2F A;  4KLL A;  4R65 A;  4WOY A;  4RQ7 A;  2ZHB A;  3JPR A;  4MFF A;  9ICI A;  4LT6 A;  4K96 A;  3C2K A;  4O5E A;  4RT2 A;  3OUY B;  1BPZ A;  3RJH A;  4I2F A;  2BBJ A;  4UAW A;  3C2L A;  8ICY A;  2VAN A;  4NLZ A;  2HHP A;  9ICF A;  3UQ0 A;  1BPX A;  4X4Q A;  3JZ0 A;  1RPL A;  4QZB A;  4EEB A;  5IIJ A;  5J0X A;  4PHD A;  9ICC A;  4PGY A;  4R63 A;  3JPQ A;  4KLH A;  1ZQQ A;  2FMQ A;  4QZE A;  4KLE A;  4K98 A;  4QZC A;  4EP7 A;  4YMM A;  1ZQC A;  1R8C A;  1ZQL A;  9ICJ A;  3MCR A;  8ICJ A;  4GXI A;  3K7D A;  7ICF A;  5IIN A;  5DED A;  1XSP A;  1TVA A;  9ICT A;  3HWT A;  5DDM A;  4PGX A;  4FH3 A;  1ZQN A;  3NWI A;  4FH5 A;  4WC0 A;  4P4M A;  5DBB A;  4Z6F A;  9ICG A;  4RWP A;  4MF8 A;  1KEJ A;  3C2M A;  8ICX A;  9ICS A;  4YN4 A;  7ICQ A;  2ID1 A;  2O5A A;  2DRB A;  4AT8 A;  4XUS A;  4X4V A;  4RWQ A;  3RJE A;  4GXJ A;  3AUO A;  3RJI A;  3C66 A;  4XRH A;  4M2Y A;  3V7K A;  5HHI A; 
#chains in the Genus database with same CATH homology
 3OVA A;  4RQ3 A;  1JQR A;  3AQK A;  4X4N A;  2M2W A;  3AQN A;  4GXK A;  5D4B A;  3K75 D;  4RWN A;  3RH4 A;  4P2H A;  4KLQ A;  4FHX A;  3MBY A;  4MF2 A;  4RWO A;  4FHW A;  3JPN A;  3HJ1 A;  2BE3 A;  4RT3 A;  4AT9 B;  3H3A A;  3JPP A;  5CWR A;  4IQW A;  4WCW A;  7ICI A;  3WFR E;  2PFN A;  4FHV A;  4AT7 A;  2DR5 A;  2W9M A;  7ICV A;  3MDC A;  2BCR A;  1KNY A;  4ATB A;  7ICO A;  1Q79 A;  5J0Q A;  1ZQH A;  5CR0 A;  1ZQT A;  8ICO A;  1ZQM A;  5IIL A;  1UEU A;  4NXZ A;  1PX5 A;  4PGQ A;  3PNC A;  1MIY A;  7ICR A;  2PXI A;  9ICP A;  5J2A A;  1VJ7 A;  4YCX A;  5J2K A;  3WFS C;  4X4U A;  4QZ9 A;  4UD5 A;  4WC2 A;  2RFF A;  3V7J A;  4UAZ A;  5DB8 A;  4QZ8 A;  4IG8 A;  4X4T A;  2PFQ A;  3JPO A;  4RPY A;  4X4S A;  3HJ4 A;  2ZH6 A;  4M5D A;  1ZJM A;  1TV9 A;  2ZH2 A;  3OVB A;  8ICC A;  2M2U A;  4UB3 A;  4F5N A;  8ICI A;  2M2V A;  4Z6C A;  4KLU A;  3B0X A;  3LK9 A;  4DOA A;  8ICK A;  9ICU A;  5J0W A;  3MGI A;  1XSN A;  4UD4 A;  1TFW A;  4F5R A;  5J2B A;  8ICG A;  3TFS A;  4RPZ A;  5J2H A;  3L9D A;  4QZI A;  3V72 A;  8ICF A;  2DR8 A;  2GWS A;  1ZQY A;  4I2C A;  7ICP A;  5BOL A;  4S3N A;  1Q78 A;  4E7X A;  5J0T A;  5DB6 A;  4NY8 A;  2PFP A;  4WC1 A;  8ICT A;  5HRI A;  4I2J A;  3UXP A;  4RPX A;  9ICB A;  4I2A A;  5J2I A;  4RQ4 A;  7ICK A;  3NYB A;  5DB9 A;  5EOZ A;  5HHH A;  3ISD A;  9ICE A;  5J0O A;  5J2D A;  4KLI A;  5CJ7 A;  1MIW A;  3RH5 A;  1R8B A;  3RH6 A;  1ZQS A;  3JYY A;  1WOT A;  4RQ1 A;  4O5C A;  1ZQK A;  1ZQI A;  1TFY A;  4RQ0 A;  4YD1 A;  3WFP A;  3RJJ A;  2DR7 A;  2DRA A;  2ZH8 A;  1YLQ A;  4K4H A;  1BPY A;  4LZG A;  4M04 A;  9ICL A;  1NO5 A;  4M9J A;  4LVS A;  3B0Y A;  2IHM A;  9ICO A;  9ICX A;  4I2I A;  4IQV A;  5J0S A;  1BPE A;  4NKU A;  1ZQZ A;  4YMO A;  2BPC A;  5CP2 A;  4NM2 A;  3H38 A;  4Z6E A;  4NKT A;  4PHE A;  5J29 A;  3WFQ E;  4RQ6 A;  1R89 A;  1ZQJ A;  3AU2 A;  9ICK A;  4KLS A;  2Q66 A;  4FHP A;  4AT8 B;  1MIV A;  4AT9 A;  4RQ8 A;  2PBE A;  4PPX A;  2BCS A;  3RJG A;  5TZV A;  1FA0 A;  2ZH7 A;  5J2C A;  3RJF A;  4E80 A;  3C5G A;  4M0A A;  4RQ2 A;  1BPD A;  9ICQ A;  4F5O A;  1R8A A;  4WC7 A;  3ISC A;  4NM1 A;  4F5Q A;  4X4P A;  4M9H A;  4PHA A;  8ICN A;  4X4O A;  4Z6D A;  2ZH4 A;  2ZH9 A;  2DR9 A;  4IQT A;  4R64 A;  4I2H A;  4WC6 A;  4NLK A;  4UB1 A;  5HC9 A;  3GDX A;  4K4G A;  4QZD A;  8ICE A;  9ICW A;  4KLG A;  7ICH A;  5III A;  4UBB A;  4RQ5 A;  5IIM A;  4X5V A;  5F2V O;  4JWN A;  2ZHA A;  5DBC A;  7ICS A;  4XQ7 A;  8ICB A;  5IIK A;  1ZQV A;  2BCU A;  5J0U A;  5DEC A;  4YD2 A;  4PH5 A;  3OUY A;  4I29 A;  1ZQO A;  1ZQB A;  4I2B A;  8ICQ A;  4WBZ A;  5BPC A;  3OV7 A;  3UPS A;  3ISB A;  3PML A;  5J2G A;  2ISP A;  2ZH5 A;  2ISO A;  1NOM A;  4UBC A;  4TUQ A;  4EBJ A;  4QZH A;  7ICG A;  4M9L A;  4P4O A;  3C5F A;  5D49 A;  5J0R A;  1BPB A;  4I28 A;  4QZG A;  1ZQF A;  5HRF A;  4I2G A;  8ICW A;  5HRD A;  3UXO A;  5BOM A;  3MDA A;  4P4P A;  3LQC B;  4M47 A;  3OGU A;  4I2E A;  3TFR A;  2FMP A;  4O9M A;  5J0P A;  4XQ8 A;  4DOC A;  8ICS A;  7ICN A;  4DO9 A;  4KLM A;  8ICU A;  4MFC A;  4E8F A;  2I9G A;  5HRE A;  4KLT A;  4IQU A;  8ICH A;  4TUR A;  5D46 A;  2PFO A;  4M9G A;  1F5A A;  1VFG A;  4K4I A;  8ICR A;  5DDY A;  2DVI A;  4XA5 A;  7ICM A;  4YMN A;  1ZQW A;  2O1P A;  3JPT A;  5J2E A;  1ZQE A;  9ICN A;  4R66 A;  7ICE A;  3UPQ A;  4PHP A;  2BPF A;  3AQL A;  2FMS A;  5HRH A;  3AU6 A;  3V7L A;  3HX0 A;  1JMS A;  1HUZ A;  3H37 A;  4MFA A;  4WBY A;  1OU5 A;  4TUS A;  8ICL A;  4O5K A;  4KLJ A;  9ICR A;  1ZQU A;  1MQ2 A;  4I27 A;  5DB7 A;  3JPS A;  4X0A A;  8ICA A;  1ZQA A;  8ICM A;  4UB4 A;  1XSL A;  3HW8 A;  1ZQR A;  5HRG A;  1JAJ A;  4DOB A;  1HUO A;  4WC5 A;  5HRB A;  7ICT A;  4WC3 A;  3UQ2 A;  4UAY A;  9ICH A;  1ZQX A;  4X4R A;  4JWM A;  3PMN A;  1JN3 A;  1ZQD A;  5IIO A;  1UEV A;  2NRK A;  4M9N A;  4X0B A;  2P66 A;  4FHY A;  4KLF A;  2ZH1 A;  5J2J A;  5CB1 A;  8ICZ A;  9ICV A;  4I2D A;  3WFO A;  3H39 A;  1ZJN A;  1UET A;  4EBK A;  1ZQP A;  4NLN A;  8ICV A;  2M2T A;  4LZD A;  4TUP A;  4KLD A;  1V4A A;  4AT7 B;  4KLO A;  1KDH A;  1ZQG A;  9ICA A;  4QZA A;  8ICP A;  4ATB B;  7ICU A;  4FO6 A;  5J0Y A;  5HR9 A;  5CA7 A;  5CHG A;  5DBA A;  4UB2 A;  1MQ3 A;  1RZT A;  2BPG A;  9ICM A;  7ICL A;  2BCQ A;  4F5P A;  3UXN A;  4UB5 A;  3HIY A;  5HRL A;  3OVS A;  3MGH A;  3C18 A;  2ZH3 A;  4QZF A;  7ICJ A;  3RJK A;  3AQM A;  4WC4 A;  2BCV A;  5DKW A;  5HRK A;  5J2F A;  4KLL A;  4R65 A;  4RQ7 A;  2ZHB A;  3JPR A;  4MFF A;  9ICI A;  4LT6 A;  3C2K A;  4O5E A;  4RT2 A;  3OUY B;  1BPZ A;  3RJH A;  4I2F A;  4UAW A;  3C2L A;  8ICY A;  2VAN A;  4NLZ A;  2HHP A;  9ICF A;  3UQ0 A;  1BPX A;  4X4Q A;  3JZ0 A;  1RPL A;  4QZB A;  5IIJ A;  5J0X A;  4PHD A;  9ICC A;  4PGY A;  4R63 A;  3JPQ A;  4KLH A;  1ZQQ A;  2FMQ A;  4QZE A;  4KLE A;  4QZC A;  4EP7 A;  4YMM A;  1ZQC A;  1R8C A;  1ZQL A;  9ICJ A;  8ICJ A;  4GXI A;  7ICF A;  5IIN A;  5DED A;  1XSP A;  1TVA A;  9ICT A;  3HWT A;  5DDM A;  4PGX A;  4FH3 A;  1ZQN A;  4FH5 A;  4WC0 A;  4P4M A;  5DBB A;  4Z6F A;  9ICG A;  4RWP A;  4MF8 A;  1KEJ A;  3C2M A;  8ICX A;  9ICS A;  4YN4 A;  7ICQ A;  2ID1 A;  2O5A A;  2DRB A;  4AT8 A;  4XUS A;  4X4V A;  4RWQ A;  3RJE A;  4GXJ A;  3AUO A;  3RJI A;  3C66 A;  4XRH A;  4M2Y A;  3V7K A;  5HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...