2M2TA

Asfv pol x structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
total genus 41
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2tA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2tA01
1BPXA 5CJ7A 1KNYA 3PMNA 4KLOA 4X4VA 2DR8A 9ICCA 1ZQYA 4X4SA 5IIJA 4UBCA 2ZHAA 4PHDA 4KLEA 7ICVA 4F5PA 9ICQA 5J0QA 3C18A 4UB5A 4GXIA 4YD2A 1TFYA 4GXJA 2GWSA 2ISOA 1ZQBA 2O1PA 3AQNA 4KLLA 4WC3A 4NLNA 3MDCA 3JPTA 4RT3A 1ZQDA 1ZQFA 4X4OA 4I2GA 5BPCA 4QZIA 3WFOA 4TUSA 3JYYA 2VANA 3OV7A 1MIVA 3OVAA 4XQ8A 8ICUA 4KLSA 4UAYA 4QZ8A 4TURA 4K4IA 2FMPA 4KLIA 4F5NA 5DB7A 4NLKA 9ICWA 1FA0A 2Q66A 5HRIA 4AT7A 4M9JA 3C2KA 2BCVA 8ICSA 1ZQAA 3JPQA 1R8BA 2ID1A 4M9NA 8ICFA 3HX0A 2PFNA 4O5KA 9ICVA 5IIMA 5CP2A 4FHYA 4X5VA 7ICFA 4MFCA 8ICKA 4RT2A 4YMNA 4WC5A 8ICPA 3OUYA 5HHIA 4RQ7A 9ICTA 5HRFA 3H3AA 5D49A 4M9LA 5HRLA 1ZQPA 1ZQJA 4RQ5A 4X4NA 3PNCA 2ZH4A 9ICPA 1Q78A 3UPQA 3UXNA 4RPZA 2P66A 4TUQA 4F5QA 5HREA 5DB8A 3V72A 3OVSA 4FO6A 4KLDA 4EP7A 5J0SA 3V7LA 1ZQHA 5J2JA 2DRBA 1MQ3A 3JZ0A 1RPLA 4WC2A 5HHHA 5J2BA 4RWQA 3RJHA 4DOAA 7ICJA 4I29A 3HW8A 4KLQA 2PFQA 4F5OA 5BOLA 3WFSC 1UETA 2ZH6A 8ICLA 2ZH5A 8ICZA 3HJ1A 3GDXA 1JQRA 1JMSA 1ZQWA 4JWMA 4Z6EA 1XSLA 4UBBA 3JPOA 4AT9A 7ICLA 3H38A 4UB1A 4XUSA 5J2IA 1WOTA 4YCXA 4P4MA 4WBZA 7ICRA 4MF2A 9ICUA 5F2VO 1VFGA 3UQ2A 7ICMA 3OVBA 4NY8A 1UEVA 9ICEA 1ZQVA 5DB9A 3LK9A 3RJEA 4M2YA 3B0XA 4LT6A 3H39A 1ZQSA 1ZQUA 4Z6FA 4I27A 2DVIA 4QZEA 3HWTA 5IINA 5D46A 2W9MA 2PBEA 7ICGA 4LZGA 8ICXA 4RQ4A 4XQ7A 4O5CA 4NLZA 2ZH9A 2BCRA 7ICUA 1ZQGA 1ZQIA 2ZH1A 3HIYA 4PGXA 5J0TA 1UEUA 4R65A 5DDMA 3AUOA 1KDHA 4RQ3A 1ZQCA 5J2FA 1YLQA 3V7JA 4K4HA 4FH5A 2ZH8A 3LQCB 8ICWA 4WC4A 9ICOA 1KEJA 3WFQE 1V4AA 4QZ9A 3TFSA 5HRKA 3JPPA 3C2LA 4RPYA 4O9MA 4IQTA 5J0RA 4E8FA 4X4TA 9ICSA 3RH5A 9ICRA 3B0YA 5IIKA 4R66A 8ICBA 7ICPA 3HJ4A 7ICQA 4X0BA 3UQ0A 1MQ2A 1F5AA 1ZQQA 4EBKA 2BCQA 4I2CA 9ICLA 1NOMA 3WFPA 5CR0A 4YN4A 1BPZA 4R64A 4NKUA 3ISDA 4E80A 1ZQTA 3C2MA 4WC7A 1ZJNA 4UAWA 1ZQMA 5DECA 4X4UA 4R63A 1OU5A 2PFPA 5J2CA 4WC0A 4WC6A 4QZGA 1MIYA 5J0UA 3UPSA 3JPRA 2M2UA 4RQ0A 4QZDA 4ATBB 5DBAA 3MGHA 2IHMA 1TVAA 5EOZA 2BPCA 1VJ7A 3AQKA 4UD5A 4QZBA 4WCWA 9ICIA 4AT8B 5HR9A 4IQUA 3RJIA 4UB2A 4X0AA 3ISCA 4UAZA 4IQVA 1BPDA 5IILA 5HRHA 1ZQLA 5J2GA 4PHPA 9ICFA 4UB3A 1ZQEA 3JPNA 4FHPA 4M9GA 5DBBA 4YMOA 1XSPA 8ICYA 4O5EA 3H37A 7ICNA 4NXZA 4P2HA 5D4BA 1ZQZA 4UD4A 4FH3A 5J29A 5HC9A 9ICNA 4I2DA 5DDYA 4M0AA 1BPBA 3WFRE 2HHPA 2DRAA 4NM1A 8ICGA 5CB1A 1ZJMA 1BPYA 5J0XA 5HRGA 3UXOA 4DO9A 2BE3A 3AU2A 5IIIA 2PFOA 7ICIA 5TZVA 1ZQOA 5DB6A 4Z6DA 4P4PA 4F5RA 1JAJA 2I9GA 4FHWA 8ICOA 4QZCA 7ICEA 3OGUA 9ICXA 3TFRA 1ZQRA 5J2HA 1TV9A 3MBYA 2DR7A 4RWNA 3L9DA 4P4OA 5J0PA 4Z6CA 4MFFA 9ICAA 1PX5A 4FHVA 4LZDA 3NYBA 5J2AA 3RH4A 4YMMA 4FHXA 8ICVA 8ICQA 1R8CA 5DKWA 3C5FA 4I2JA 1R89A 8ICCA 4WC1A 2NRKA 4RQ8A 5J2EA 4IQWA 4PH5A 2RFFA 5HRDA 1TFWA 9ICJA 4NM2A 4M04A 9ICGA 1NO5A 4PHEA 2ZHBA 2DR9A 8ICNA 2ZH3A 4S3NA 4I2EA 1R8AA 4X4RA 4E7XA 4RPXA 3AQMA 4LVSA 2M2VA 4AT7B 4I2AA 4UB4A 3C66A 4PGYA 4KLFA 4GXKA 4XRHA 2PXIA 4QZHA 1ZQXA 4ATBA 5DBCA 4X4PA 1BPEA 5BOMA 7ICKA 4RQ2A 4IG8A 4TUPA 3RJFA 7ICSA 7ICOA 2M2WA 4AT8A 3OUYB 8ICTA 9ICHA 3AU6A 8ICRA 5IIOA 5CWRA 9ICKA 2M2TA 8ICJA 1JN3A 4PHAA 5DEDA 4DOCA 3RJKA 8ICHA 4M5DA 4I2BA 3V7KA 1HUZA 4KLUA 5J2DA 1RZTA 1MIWA 4MF8A 2BCUA 4YD1A 3UXPA 4K4GA 4XA5A 9ICMA 8ICAA 3AQLA 5HRBA 3C5GA 2O5AA 1Q79A 3JPSA 4I2FA 4WBYA 4KLHA 2ISPA 5J0OA 5J0WA 4MFAA 3PMLA 1HUOA 2ZH2A 4RQ6A 3MGIA 4EBJA 1ZQNA 4KLTA 5J2KA 4JWNA 7ICHA 2FMQA 1XSNA 5CA7A 3RJGA 2BPGA 3MDAA 4I28A 9ICBA 4M47A 4X4QA 4I2IA 4I2HA 4RWPA 1ZQKA 8ICIA 4PGQA 4NKTA 5J0YA 7ICTA 5CHGA 4PPXA 4QZFA 2FMSA 4QZAA 4KLMA 4KLGA 4RWOA 2BPFA 3RJJA 2BCSA 8ICMA 4DOBA 4M9HA 4KLJA 8ICEA 4AT9B 3ISBA 4RQ1A 2DR5A 3RH6A 3K75D 2ZH7A
chains in the Genus database with same CATH superfamily
1BPXA 5CJ7A 1KNYA 3PMNA 4KLOA 4X4VA 2DR8A 9ICCA 1ZQYA 4X4SA 5IIJA 4UBCA 2ZHAA 4PHDA 4KLEA 7ICVA 4F5PA 9ICQA 5J0QA 3C18A 4UB5A 4GXIA 4YD2A 1TFYA 4K9BA 4GXJA 2GWSA 2ISOA 1GPJA 5D61A 1ZQBA 2O1PA 3AQNA 4KLLA 4WC3A 4NLNA 3MDCA 3JPTA 4RT3A 1ZQDA 1ZQFA 4X4OA 4I2GA 5BPCA 4QZIA 3WFOA 4TUSA 3JYYA 2VANA 3OV7A 1MIVA 3OVAA 4XQ8A 8ICUA 4KLSA 4UAYA 4QZ8A 4TURA 4K4IA 2FMPA 4KLIA 4F5NA 5DB7A 4NLKA 9ICWA 1FA0A 2Q66A 5HRIA 4AT7A 4M9JA 3C2KA 2BCVA 8ICSA 1ZQAA 3JPQA 1R8BA 2ID1A 4M9NA 8ICFA 2GAFD 3HX0A 2PFNA 4O5KA 9ICVA 2B4VA 5IIMA 5CP2A 4FHYA 4X5VA 7ICFA 4MFCA 8ICKA 4RT2A 4YMNA 4WC5A 8ICPA 3OUYA 5HHIA 4RQ7A 9ICTA 5HRFA 3H3AA 5D49A 4M9LA 5HRLA 1ZQPA 1ZQJA 5CFTA 4RQ5A 4X4NA 3PNCA 2ZH4A 9ICPA 1Q78A 3UPQA 3UXNA 4RPZA 2P66A 4TUQA 2BBJA 4F5QA 3JCFA 5HREA 5DB8A 3V72A 3OVSA 4EEDA 5CFUA 4FO6A 4KLDA 4EP7A 5J0SA 3V7LA 1ZQHA 5J2JA 3PHZA 4K8VA 2DRBA 1MQ3A 3JZ0A 1RPLA 4WC2A 5HHHA 5J2BA 4NXTA 4RWQA 3RJHA 4DOAA 5B3PA 7ICJA 4K9AA 4I29A 3HW8A 4KLQA 2IUBA 2PFQA 4F5OA 5BOLA 3WFSC 1UETA 3ER8C 2ZH6A 4KM5A 8ICLA 5B3QA 2ZH5A 8ICZA 3HJ1A 3GDXA 1JQRA 1JMSA 1ZQWA 4JWMA 4Z6EA 1XSLA 4UBBA 3JPOA 4AT9A 7ICLA 3H38A 4UB1A 4XUSA 5J2IA 1WOTA 4YCXA 4P4MA 4WBZA 7ICRA 4MF2A 9ICUA 5F2VO 1VFGA 3UQ2A 7ICMA 3OVBA 3NVOA 4NY8A 1UEVA 9ICEA 1ZQVA 5DB9A 3LK9A 3RJEA 4M2YA 3B0XA 4LT6A 3H39A 1ZQSA 1ZQUA 4Z6FA 4I27A 2DVIA 4EGWA 4QZEA 3ER9B 3HWTA 5IINA 5D46A 2W9MA 2PBEA 7ICGA 4LZGA 2GA9D 8ICXA 4RQ4A 4XQ7A 4O5CA 4NLZA 2HN1A 2ZH9A 2BCRA 7ICUA 1ZQGA 3EF2A 1ZQIA 2ZH1A 3HIYA 4PGXA 5J0TA 1UEUA 4R65A 4OAHA 5DDMA 3AUOA 1KDHA 4RQ3A 1ZQCA 5J2FA 1YLQA 3V7JA 4K4HA 4FH5A 2ZH8A 3LQCB 8ICWA 3NWIA 4WC4A 9ICOA 1KEJA 3WFQE 1V4AA 2FCLA 4QZ9A 3TFSA 5HRKA 3JPPA 3C2LA 4RPYA 4O9MA 2IHOA 5D62A 4IQTA 4OAFA 5J0RA 4E8FA 4X4TA 3CK6A 9ICSA 4KB6A 3RH5A 9ICRA 3B0YA 5IIKA 4R66A 8ICBA 4LEWA 7ICPA 3HJ4A 7ICQA 4OAIZ 4X0BA 3UQ0A 1MQ2A 1F5AA 4NXVA 1ZQQA 4O69A 4EBKA 2BCQA 4I2CA 9ICLA 1NOMA 3WFPA 5CR0A 4YN4A 1BPZA 4WQKA 4R64A 4NKUA 3ISDA 4E80A 1ZQTA 3C2MA 4WC7A 1ZJNA 4UAWA 1ZQMA 5DECA 4X4UA 4R63A 1OU5A 2PFPA 5J2CA 4WC0A 4WC6A 4QZGA 1MIYA 5J0UA 3UPSA 3JPRA 2M2UA 4RQ0A 4QZDA 4ATBB 5DBAA 3MGHA 2IHMA 1TVAA 5EOZA 2BPCA 1VJ7A 3AQKA 4UD5A 4NXWA 4QZBA 4WCWA 9ICIA 4AT8B 5HR9A 4IQUA 3RJIA 4WOYA 4UB2A 4X0AA 5JTGA 3ISCA 4UAZA 2HN2A 4IQVA 1BPDA 5IILA 5HRHA 1ZQLA 5J2GA 4PHPA 9ICFA 4UB3A 1ZQEA 3JPNA 4FHPA 4M9GA 4OAGA 5DBBA 4YMOA 1XSPA 8ICYA 3MCRA 4O5EA 4O67A 3H37A 7ICNA 4NXZA 4P2HA 5D4BA 1ZQZA 4UD4A 4FH3A 5J29A 4WQLA 5HC9A 9ICNA 4I2DA 5DDYA 4M0AA 1BPBA 3WFRE 4LEVA 4EV6A 5D63A 4HX0A 2HHPA 4XJEA 5CHEA 2DRAA 4NM1A 8ICGA 5CB1A 1ZJMA 1BPYA 5J0XA 5HRGA 3UXOA 4DO9A 2BE3A 3AU2A 5IIIA 2PFOA 7ICIA 4N7RA 5TZVA 1ZQOA 4JLZA 5DB6A 4K98A 4Z6DA 4P4PA 4F5RA 1JAJA 2I9GA 4FHWA 8ICOA 4QZCA 7ICEA 3K7DA 3OGUA 9ICXA 4LEZA 3TFRA 1ZQRA 5J2HA 1TV9A 4JLXA 3MBYA 2DR7A 4RWNA 3L9DA 4P4OA 5J0PA 4Z6CA 4MFFA 4K97A 9ICAA 3NKUA 1PX5A 4FHVA 4LZDA 3NYBA 5J2AA 3RH4A 4YMMA 4FHXA 8ICVA 8ICQA 1R8CA 4I0UA 5DKWA 3C5FA 4I2JA 1R89A 8ICCA 4WC1A 2NRKA 4RQ8A 5J2EA 4IQWA 4PH5A 2RFFA 4FO1A 5HRDA 1TFWA 9ICJA 4NM2A 4M04A 9ICGA 1NO5A 4PHEA 2ZHBA 2B51A 2DR9A 8ICNA 2ZH3A 4S3NA 4I2EA 1R8AA 4EEBA 4E7XA 4X4RA 4RPXA 3AQMA 4LVSA 2M2VA 4AT7B 4I2AA 4UB4A 3C66A 4PGYA 4KLFA 4GXKA 4XRHA 4WH5A 2PXIA 4QZHA 1ZQXA 4ATBA 5DBCA 4X4PA 1BPEA 5BOMA 7ICKA 4RQ2A 4IG8A 4TUPA 3RJFA 7ICSA 4K96A 7ICOA 2M2WA 4AT8A 3OUYB 8ICTA 9ICHA 4O6AA 3AU6A 8ICRA 5IIOA 5CWRA 9ICKA 2M2TA 3OWGA 8ICJA 1JN3A 4PHAA 4MKPA 5DEDA 4DOCA 3RJKA 8ICHA 4M5DA 4I2BA 3V7KA 1HUZA 4KLUA 5J2DA 4LEYA 1RZTA 4K99A 1MIWA 4MF8A 4NXUA 2BCUA 4YD1A 3UXPA 4K4GA 2B56A 4XA5A 9ICMA 8ICAA 3AQLA 4NXXA 4O68A 5HRBA 3C5GA 2O5AA 1Q79A 3JPSA 4I2FA 4WBYA 4KLHA 3ERCC 2ISPA 5J0OA 2EWRA 5J0WA 4MFAA 3PMLA 1HUOA 2ZH2A 4RQ6A 3MGIA 4EBJA 5CFSA 1ZQNA 4KLTA 5J2KA 4JWNA 7ICHA 2FMQA 1XSNA 5CA7A 3RJGA 2BPGA 3MDAA 4I28A 9ICBA 4M47A 4X4QA 4I2IA 2BBHA 4I2HA 4RWPA 1ZQKA 8ICIA 4PGQA 4NKTA 5J0YA 7ICTA 5CHGA 4PPXA 4QZFA 2FMSA 4QZAA 4KLMA 4KLGA 4RWOA 2BPFA 3RJJA 2BCSA 8ICMA 4DOBA 4M9HA 4KLJA 8ICEA 4AT9B 3ISBA 4RQ1A 2DR5A 3RH6A 3K75D 2ZH7A
chains in the Genus database with same CATH topology
1BPXA 5CJ7A 1KNYA 3PMNA 4KLOA 4X4VA 2DR8A 9ICCA 1ZQYA 4X4SA 5IIJA 4UBCA 2ZHAA 4PHDA 4KLEA 7ICVA 4F5PA 9ICQA 5J0QA 3C18A 4UB5A 4GXIA 4YD2A 1TFYA 4GXJA 2GWSA 2ISOA 1ZQBA 2O1PA 3AQNA 4KLLA 4WC3A 4NLNA 3MDCA 3JPTA 4RT3A 1ZQDA 1ZQFA 4X4OA 4I2GA 5BPCA 4QZIA 3WFOA 4TUSA 3JYYA 2VANA 3OV7A 1MIVA 3OVAA 4XQ8A 8ICUA 4KLSA 4UAYA 4QZ8A 4TURA 4K4IA 2FMPA 4KLIA 4F5NA 5DB7A 4NLKA 9ICWA 1FA0A 2Q66A 5HRIA 4AT7A 4M9JA 3C2KA 2BCVA 8ICSA 1ZQAA 3JPQA 1R8BA 2ID1A 4M9NA 8ICFA 3HX0A 2PFNA 4O5KA 9ICVA 5IIMA 5CP2A 4FHYA 4X5VA 7ICFA 4MFCA 8ICKA 4RT2A 4YMNA 4WC5A 8ICPA 3OUYA 5HHIA 4RQ7A 9ICTA 5HRFA 3H3AA 5D49A 4M9LA 5HRLA 1ZQPA 1ZQJA 4RQ5A 4X4NA 3PNCA 2ZH4A 9ICPA 1Q78A 3UPQA 3UXNA 4RPZA 2P66A 4TUQA 4F5QA 5HREA 5DB8A 3V72A 3OVSA 4FO6A 4KLDA 4EP7A 5J0SA 3V7LA 1ZQHA 5J2JA 2DRBA 1MQ3A 3JZ0A 1RPLA 4WC2A 5HHHA 5J2BA 4RWQA 3RJHA 4DOAA 7ICJA 4I29A 3HW8A 4KLQA 2PFQA 4F5OA 5BOLA 3WFSC 1UETA 2ZH6A 8ICLA 2ZH5A 8ICZA 3HJ1A 3GDXA 1JQRA 1JMSA 1ZQWA 4JWMA 4Z6EA 1XSLA 4UBBA 3JPOA 4AT9A 7ICLA 3H38A 4UB1A 4XUSA 5J2IA 1WOTA 4YCXA 4P4MA 4WBZA 7ICRA 4MF2A 9ICUA 5F2VO 1VFGA 3UQ2A 7ICMA 3OVBA 4NY8A 1UEVA 9ICEA 1ZQVA 5DB9A 3LK9A 3RJEA 4M2YA 3B0XA 4LT6A 3H39A 1ZQSA 1ZQUA 4Z6FA 4I27A 2DVIA 4QZEA 3HWTA 5IINA 5D46A 2W9MA 2PBEA 7ICGA 4LZGA 8ICXA 4RQ4A 4XQ7A 4O5CA 4NLZA 2ZH9A 2BCRA 7ICUA 1ZQGA 1ZQIA 2ZH1A 3HIYA 4PGXA 5J0TA 1UEUA 4R65A 5DDMA 3AUOA 1KDHA 4RQ3A 1ZQCA 5J2FA 1YLQA 3V7JA 4K4HA 4FH5A 2ZH8A 3LQCB 8ICWA 4WC4A 9ICOA 1KEJA 3WFQE 1V4AA 4QZ9A 3TFSA 5HRKA 3JPPA 3C2LA 4RPYA 4O9MA 4IQTA 5J0RA 4E8FA 4X4TA 9ICSA 3RH5A 9ICRA 3B0YA 5IIKA 4R66A 8ICBA 7ICPA 3HJ4A 7ICQA 4X0BA 3UQ0A 1MQ2A 1F5AA 1ZQQA 4EBKA 2BCQA 4I2CA 9ICLA 1NOMA 3WFPA 5CR0A 4YN4A 1BPZA 4R64A 4NKUA 3ISDA 4E80A 1ZQTA 3C2MA 4WC7A 1ZJNA 4UAWA 1ZQMA 5DECA 4X4UA 4R63A 1OU5A 2PFPA 5J2CA 4WC0A 4WC6A 4QZGA 1MIYA 5J0UA 3UPSA 3JPRA 2M2UA 4RQ0A 4QZDA 4ATBB 5DBAA 3MGHA 2IHMA 1TVAA 5EOZA 2BPCA 1VJ7A 3AQKA 4UD5A 4QZBA 4WCWA 9ICIA 4AT8B 5HR9A 4IQUA 3RJIA 4UB2A 4X0AA 3ISCA 4UAZA 4IQVA 1BPDA 5IILA 5HRHA 1ZQLA 5J2GA 4PHPA 9ICFA 4UB3A 1ZQEA 3JPNA 4FHPA 4M9GA 5DBBA 4YMOA 1XSPA 8ICYA 4O5EA 3H37A 7ICNA 4NXZA 4P2HA 5D4BA 1ZQZA 4UD4A 4FH3A 5J29A 5HC9A 9ICNA 4I2DA 5DDYA 4M0AA 1BPBA 3WFRE 2HHPA 2DRAA 4NM1A 8ICGA 5CB1A 1ZJMA 1BPYA 5J0XA 5HRGA 3UXOA 4DO9A 2BE3A 3AU2A 5IIIA 2PFOA 7ICIA 5TZVA 1ZQOA 5DB6A 4Z6DA 4P4PA 4F5RA 1JAJA 2I9GA 4FHWA 8ICOA 4QZCA 7ICEA 3OGUA 9ICXA 3TFRA 1ZQRA 5J2HA 1TV9A 3MBYA 2DR7A 4RWNA 3L9DA 4P4OA 5J0PA 4Z6CA 4MFFA 9ICAA 1PX5A 4FHVA 4LZDA 3NYBA 5J2AA 3RH4A 4YMMA 4FHXA 8ICVA 8ICQA 1R8CA 5DKWA 3C5FA 4I2JA 1R89A 8ICCA 4WC1A 2NRKA 4RQ8A 5J2EA 4IQWA 4PH5A 2RFFA 5HRDA 1TFWA 9ICJA 4NM2A 4M04A 9ICGA 1NO5A 4PHEA 2ZHBA 2DR9A 8ICNA 2ZH3A 4S3NA 4I2EA 1R8AA 4X4RA 4E7XA 4RPXA 3AQMA 4LVSA 2M2VA 4AT7B 4I2AA 4UB4A 3C66A 4PGYA 4KLFA 4GXKA 4XRHA 2PXIA 4QZHA 1ZQXA 4ATBA 5DBCA 4X4PA 1BPEA 5BOMA 7ICKA 4RQ2A 4IG8A 4TUPA 3RJFA 7ICSA 7ICOA 2M2WA 4AT8A 3OUYB 8ICTA 9ICHA 3AU6A 8ICRA 5IIOA 5CWRA 9ICKA 2M2TA 8ICJA 1JN3A 4PHAA 5DEDA 4DOCA 3RJKA 8ICHA 4M5DA 4I2BA 3V7KA 1HUZA 4KLUA 5J2DA 1RZTA 1MIWA 4MF8A 2BCUA 4YD1A 3UXPA 4K4GA 4XA5A 9ICMA 8ICAA 3AQLA 5HRBA 3C5GA 2O5AA 1Q79A 3JPSA 4I2FA 4WBYA 4KLHA 2ISPA 5J0OA 5J0WA 4MFAA 3PMLA 1HUOA 2ZH2A 4RQ6A 3MGIA 4EBJA 1ZQNA 4KLTA 5J2KA 4JWNA 7ICHA 2FMQA 1XSNA 5CA7A 3RJGA 2BPGA 3MDAA 4I28A 9ICBA 4M47A 4X4QA 4I2IA 4I2HA 4RWPA 1ZQKA 8ICIA 4PGQA 4NKTA 5J0YA 7ICTA 5CHGA 4PPXA 4QZFA 2FMSA 4QZAA 4KLMA 4KLGA 4RWOA 2BPFA 3RJJA 2BCSA 8ICMA 4DOBA 4M9HA 4KLJA 8ICEA 4AT9B 3ISBA 4RQ1A 2DR5A 3RH6A 3K75D 2ZH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPX A;  5CJ7 A;  1KNY A;  3PMN A;  4KLO A;  4X4V A;  2DR8 A;  9ICC A;  1ZQY A;  4X4S A;  5IIJ A;  4UBC A;  2ZHA A;  4PHD A;  4KLE A;  7ICV A;  4F5P A;  9ICQ A;  5J0Q A;  3C18 A;  4UB5 A;  4GXI A;  4YD2 A;  1TFY A;  4GXJ A;  2GWS A;  2ISO A;  1ZQB A;  2O1P A;  3AQN A;  4KLL A;  4WC3 A;  4NLN A;  3MDC A;  3JPT A;  4RT3 A;  1ZQD A;  1ZQF A;  4X4O A;  4I2G A;  5BPC A;  4QZI A;  3WFO A;  4TUS A;  3JYY A;  2VAN A;  3OV7 A;  1MIV A;  3OVA A;  4XQ8 A;  8ICU A;  4KLS A;  4UAY A;  4QZ8 A;  4TUR A;  4K4I A;  2FMP A;  4KLI A;  4F5N A;  5DB7 A;  4NLK A;  9ICW A;  1FA0 A;  2Q66 A;  5HRI A;  4AT7 A;  4M9J A;  3C2K A;  2BCV A;  8ICS A;  1ZQA A;  3JPQ A;  1R8B A;  2ID1 A;  4M9N A;  8ICF A;  3HX0 A;  2PFN A;  4O5K A;  9ICV A;  5IIM A;  5CP2 A;  4FHY A;  4X5V A;  7ICF A;  4MFC A;  8ICK A;  4RT2 A;  4YMN A;  4WC5 A;  8ICP A;  3OUY A;  5HHI A;  4RQ7 A;  9ICT A;  5HRF A;  3H3A A;  5D49 A;  4M9L A;  5HRL A;  1ZQP A;  1ZQJ A;  4RQ5 A;  4X4N A;  3PNC A;  2ZH4 A;  9ICP A;  1Q78 A;  3UPQ A;  3UXN A;  4RPZ A;  2P66 A;  4TUQ A;  4F5Q A;  5HRE A;  5DB8 A;  3V72 A;  3OVS A;  4FO6 A;  4KLD A;  4EP7 A;  5J0S A;  3V7L A;  1ZQH A;  5J2J A;  2DRB A;  1MQ3 A;  3JZ0 A;  1RPL A;  4WC2 A;  5HHH A;  5J2B A;  4RWQ A;  3RJH A;  4DOA A;  7ICJ A;  4I29 A;  3HW8 A;  4KLQ A;  2PFQ A;  4F5O A;  5BOL A;  3WFS C;  1UET A;  2ZH6 A;  8ICL A;  2ZH5 A;  8ICZ A;  3HJ1 A;  3GDX A;  1JQR A;  1JMS A;  1ZQW A;  4JWM A;  4Z6E A;  1XSL A;  4UBB A;  3JPO A;  4AT9 A;  7ICL A;  3H38 A;  4UB1 A;  4XUS A;  5J2I A;  1WOT A;  4YCX A;  4P4M A;  4WBZ A;  7ICR A;  4MF2 A;  9ICU A;  5F2V O;  1VFG A;  3UQ2 A;  7ICM A;  3OVB A;  4NY8 A;  1UEV A;  9ICE A;  1ZQV A;  5DB9 A;  3LK9 A;  3RJE A;  4M2Y A;  3B0X A;  4LT6 A;  3H39 A;  1ZQS A;  1ZQU A;  4Z6F A;  4I27 A;  2DVI A;  4QZE A;  3HWT A;  5IIN A;  5D46 A;  2W9M A;  2PBE A;  7ICG A;  4LZG A;  8ICX A;  4RQ4 A;  4XQ7 A;  4O5C A;  4NLZ A;  2ZH9 A;  2BCR A;  7ICU A;  1ZQG A;  1ZQI A;  2ZH1 A;  3HIY A;  4PGX A;  5J0T A;  1UEU A;  4R65 A;  5DDM A;  3AUO A;  1KDH A;  4RQ3 A;  1ZQC A;  5J2F A;  1YLQ A;  3V7J A;  4K4H A;  4FH5 A;  2ZH8 A;  3LQC B;  8ICW A;  4WC4 A;  9ICO A;  1KEJ A;  3WFQ E;  1V4A A;  4QZ9 A;  3TFS A;  5HRK A;  3JPP A;  3C2L A;  4RPY A;  4O9M A;  4IQT A;  5J0R A;  4E8F A;  4X4T A;  9ICS A;  3RH5 A;  9ICR A;  3B0Y A;  5IIK A;  4R66 A;  8ICB A;  7ICP A;  3HJ4 A;  7ICQ A;  4X0B A;  3UQ0 A;  1MQ2 A;  1F5A A;  1ZQQ A;  4EBK A;  2BCQ A;  4I2C A;  9ICL A;  1NOM A;  3WFP A;  5CR0 A;  4YN4 A;  1BPZ A;  4R64 A;  4NKU A;  3ISD A;  4E80 A;  1ZQT A;  3C2M A;  4WC7 A;  1ZJN A;  4UAW A;  1ZQM A;  5DEC A;  4X4U A;  4R63 A;  1OU5 A;  2PFP A;  5J2C A;  4WC0 A;  4WC6 A;  4QZG A;  1MIY A;  5J0U A;  3UPS A;  3JPR A;  2M2U A;  4RQ0 A;  4QZD A;  4ATB B;  5DBA A;  3MGH A;  2IHM A;  1TVA A;  5EOZ A;  2BPC A;  1VJ7 A;  3AQK A;  4UD5 A;  4QZB A;  4WCW A;  9ICI A;  4AT8 B;  5HR9 A;  4IQU A;  3RJI A;  4UB2 A;  4X0A A;  3ISC A;  4UAZ A;  4IQV A;  1BPD A;  5IIL A;  5HRH A;  1ZQL A;  5J2G A;  4PHP A;  9ICF A;  4UB3 A;  1ZQE A;  3JPN A;  4FHP A;  4M9G A;  5DBB A;  4YMO A;  1XSP A;  8ICY A;  4O5E A;  3H37 A;  7ICN A;  4NXZ A;  4P2H A;  5D4B A;  1ZQZ A;  4UD4 A;  4FH3 A;  5J29 A;  5HC9 A;  9ICN A;  4I2D A;  5DDY A;  4M0A A;  1BPB A;  3WFR E;  2HHP A;  2DRA A;  4NM1 A;  8ICG A;  5CB1 A;  1ZJM A;  1BPY A;  5J0X A;  5HRG A;  3UXO A;  4DO9 A;  2BE3 A;  3AU2 A;  5III A;  2PFO A;  7ICI A;  5TZV A;  1ZQO A;  5DB6 A;  4Z6D A;  4P4P A;  4F5R A;  1JAJ A;  2I9G A;  4FHW A;  8ICO A;  4QZC A;  7ICE A;  3OGU A;  9ICX A;  3TFR A;  1ZQR A;  5J2H A;  1TV9 A;  3MBY A;  2DR7 A;  4RWN A;  3L9D A;  4P4O A;  5J0P A;  4Z6C A;  4MFF A;  9ICA A;  1PX5 A;  4FHV A;  4LZD A;  3NYB A;  5J2A A;  3RH4 A;  4YMM A;  4FHX A;  8ICV A;  8ICQ A;  1R8C A;  5DKW A;  3C5F A;  4I2J A;  1R89 A;  8ICC A;  4WC1 A;  2NRK A;  4RQ8 A;  5J2E A;  4IQW A;  4PH5 A;  2RFF A;  5HRD A;  1TFW A;  9ICJ A;  4NM2 A;  4M04 A;  9ICG A;  1NO5 A;  4PHE A;  2ZHB A;  2DR9 A;  8ICN A;  2ZH3 A;  4S3N A;  4I2E A;  1R8A A;  4X4R A;  4E7X A;  4RPX A;  3AQM A;  4LVS A;  2M2V A;  4AT7 B;  4I2A A;  4UB4 A;  3C66 A;  4PGY A;  4KLF A;  4GXK A;  4XRH A;  2PXI A;  4QZH A;  1ZQX A;  4ATB A;  5DBC A;  4X4P A;  1BPE A;  5BOM A;  7ICK A;  4RQ2 A;  4IG8 A;  4TUP A;  3RJF A;  7ICS A;  7ICO A;  2M2W A;  4AT8 A;  3OUY B;  8ICT A;  9ICH A;  3AU6 A;  8ICR A;  5IIO A;  5CWR A;  9ICK A;  2M2T A;  8ICJ A;  1JN3 A;  4PHA A;  5DED A;  4DOC A;  3RJK A;  8ICH A;  4M5D A;  4I2B A;  3V7K A;  1HUZ A;  4KLU A;  5J2D A;  1RZT A;  1MIW A;  4MF8 A;  2BCU A;  4YD1 A;  3UXP A;  4K4G A;  4XA5 A;  9ICM A;  8ICA A;  3AQL A;  5HRB A;  3C5G A;  2O5A A;  1Q79 A;  3JPS A;  4I2F A;  4WBY A;  4KLH A;  2ISP A;  5J0O A;  5J0W A;  4MFA A;  3PML A;  1HUO A;  2ZH2 A;  4RQ6 A;  3MGI A;  4EBJ A;  1ZQN A;  4KLT A;  5J2K A;  4JWN A;  7ICH A;  2FMQ A;  1XSN A;  5CA7 A;  3RJG A;  2BPG A;  3MDA A;  4I28 A;  9ICB A;  4M47 A;  4X4Q A;  4I2I A;  4I2H A;  4RWP A;  1ZQK A;  8ICI A;  4PGQ A;  4NKT A;  5J0Y A;  7ICT A;  5CHG A;  4PPX A;  4QZF A;  2FMS A;  4QZA A;  4KLM A;  4KLG A;  4RWO A;  2BPF A;  3RJJ A;  2BCS A;  8ICM A;  4DOB A;  4M9H A;  4KLJ A;  8ICE A;  4AT9 B;  3ISB A;  4RQ1 A;  2DR5 A;  3RH6 A;  3K75 D;  2ZH7 A; 
#chains in the Genus database with same CATH topology
 1BPX A;  5CJ7 A;  1KNY A;  3PMN A;  4KLO A;  4X4V A;  2DR8 A;  9ICC A;  1ZQY A;  4X4S A;  5IIJ A;  4UBC A;  2ZHA A;  4PHD A;  4KLE A;  7ICV A;  4F5P A;  9ICQ A;  5J0Q A;  3C18 A;  4UB5 A;  4GXI A;  4YD2 A;  1TFY A;  4K9B A;  4GXJ A;  2GWS A;  2ISO A;  1GPJ A;  5D61 A;  1ZQB A;  2O1P A;  3AQN A;  4KLL A;  4WC3 A;  4NLN A;  3MDC A;  3JPT A;  4RT3 A;  1ZQD A;  1ZQF A;  4X4O A;  4I2G A;  5BPC A;  4QZI A;  3WFO A;  4TUS A;  3JYY A;  2VAN A;  3OV7 A;  1MIV A;  3OVA A;  4XQ8 A;  8ICU A;  4KLS A;  4UAY A;  4QZ8 A;  4TUR A;  4K4I A;  2FMP A;  4KLI A;  4F5N A;  5DB7 A;  4NLK A;  9ICW A;  1FA0 A;  2Q66 A;  5HRI A;  4AT7 A;  4M9J A;  3C2K A;  2BCV A;  8ICS A;  1ZQA A;  3JPQ A;  1R8B A;  2ID1 A;  4M9N A;  8ICF A;  2GAF D;  3HX0 A;  2PFN A;  4O5K A;  9ICV A;  2B4V A;  5IIM A;  5CP2 A;  4FHY A;  4X5V A;  7ICF A;  4MFC A;  8ICK A;  4RT2 A;  4YMN A;  4WC5 A;  8ICP A;  3OUY A;  5HHI A;  4RQ7 A;  9ICT A;  5HRF A;  3H3A A;  5D49 A;  4M9L A;  5HRL A;  1ZQP A;  1ZQJ A;  5CFT A;  4RQ5 A;  4X4N A;  3PNC A;  2ZH4 A;  9ICP A;  1Q78 A;  3UPQ A;  3UXN A;  4RPZ A;  2P66 A;  4TUQ A;  2BBJ A;  4F5Q A;  3JCF A;  5HRE A;  5DB8 A;  3V72 A;  3OVS A;  4EED A;  5CFU A;  4FO6 A;  4KLD A;  4EP7 A;  5J0S A;  3V7L A;  1ZQH A;  5J2J A;  3PHZ A;  4K8V A;  2DRB A;  1MQ3 A;  3JZ0 A;  1RPL A;  4WC2 A;  5HHH A;  5J2B A;  4NXT A;  4RWQ A;  3RJH A;  4DOA A;  5B3P A;  7ICJ A;  4K9A A;  4I29 A;  3HW8 A;  4KLQ A;  2IUB A;  2PFQ A;  4F5O A;  5BOL A;  3WFS C;  1UET A;  3ER8 C;  2ZH6 A;  4KM5 A;  8ICL A;  5B3Q A;  2ZH5 A;  8ICZ A;  3HJ1 A;  3GDX A;  1JQR A;  1JMS A;  1ZQW A;  4JWM A;  4Z6E A;  1XSL A;  4UBB A;  3JPO A;  4AT9 A;  7ICL A;  3H38 A;  4UB1 A;  4XUS A;  5J2I A;  1WOT A;  4YCX A;  4P4M A;  4WBZ A;  7ICR A;  4MF2 A;  9ICU A;  5F2V O;  1VFG A;  3UQ2 A;  7ICM A;  3OVB A;  3NVO A;  4NY8 A;  1UEV A;  9ICE A;  1ZQV A;  5DB9 A;  3LK9 A;  3RJE A;  4M2Y A;  3B0X A;  4LT6 A;  3H39 A;  1ZQS A;  1ZQU A;  4Z6F A;  4I27 A;  2DVI A;  4EGW A;  4QZE A;  3ER9 B;  3HWT A;  5IIN A;  5D46 A;  2W9M A;  2PBE A;  7ICG A;  4LZG A;  2GA9 D;  8ICX A;  4RQ4 A;  4XQ7 A;  4O5C A;  4NLZ A;  2HN1 A;  2ZH9 A;  2BCR A;  7ICU A;  1ZQG A;  3EF2 A;  1ZQI A;  2ZH1 A;  3HIY A;  4PGX A;  5J0T A;  1UEU A;  4R65 A;  4OAH A;  5DDM A;  3AUO A;  1KDH A;  4RQ3 A;  1ZQC A;  5J2F A;  1YLQ A;  3V7J A;  4K4H A;  4FH5 A;  2ZH8 A;  3LQC B;  8ICW A;  3NWI A;  4WC4 A;  9ICO A;  1KEJ A;  3WFQ E;  1V4A A;  2FCL A;  4QZ9 A;  3TFS A;  5HRK A;  3JPP A;  3C2L A;  4RPY A;  4O9M A;  2IHO A;  5D62 A;  4IQT A;  4OAF A;  5J0R A;  4E8F A;  4X4T A;  3CK6 A;  9ICS A;  4KB6 A;  3RH5 A;  9ICR A;  3B0Y A;  5IIK A;  4R66 A;  8ICB A;  4LEW A;  7ICP A;  3HJ4 A;  7ICQ A;  4OAI Z;  4X0B A;  3UQ0 A;  1MQ2 A;  1F5A A;  4NXV A;  1ZQQ A;  4O69 A;  4EBK A;  2BCQ A;  4I2C A;  9ICL A;  1NOM A;  3WFP A;  5CR0 A;  4YN4 A;  1BPZ A;  4WQK A;  4R64 A;  4NKU A;  3ISD A;  4E80 A;  1ZQT A;  3C2M A;  4WC7 A;  1ZJN A;  4UAW A;  1ZQM A;  5DEC A;  4X4U A;  4R63 A;  1OU5 A;  2PFP A;  5J2C A;  4WC0 A;  4WC6 A;  4QZG A;  1MIY A;  5J0U A;  3UPS A;  3JPR A;  2M2U A;  4RQ0 A;  4QZD A;  4ATB B;  5DBA A;  3MGH A;  2IHM A;  1TVA A;  5EOZ A;  2BPC A;  1VJ7 A;  3AQK A;  4UD5 A;  4NXW A;  4QZB A;  4WCW A;  9ICI A;  4AT8 B;  5HR9 A;  4IQU A;  3RJI A;  4WOY A;  4UB2 A;  4X0A A;  5JTG A;  3ISC A;  4UAZ A;  2HN2 A;  4IQV A;  1BPD A;  5IIL A;  5HRH A;  1ZQL A;  5J2G A;  4PHP A;  9ICF A;  4UB3 A;  1ZQE A;  3JPN A;  4FHP A;  4M9G A;  4OAG A;  5DBB A;  4YMO A;  1XSP A;  8ICY A;  3MCR A;  4O5E A;  4O67 A;  3H37 A;  7ICN A;  4NXZ A;  4P2H A;  5D4B A;  1ZQZ A;  4UD4 A;  4FH3 A;  5J29 A;  4WQL A;  5HC9 A;  9ICN A;  4I2D A;  5DDY A;  4M0A A;  1BPB A;  3WFR E;  4LEV A;  4EV6 A;  5D63 A;  4HX0 A;  2HHP A;  4XJE A;  5CHE A;  2DRA A;  4NM1 A;  8ICG A;  5CB1 A;  1ZJM A;  1BPY A;  5J0X A;  5HRG A;  3UXO A;  4DO9 A;  2BE3 A;  3AU2 A;  5III A;  2PFO A;  7ICI A;  4N7R A;  5TZV A;  1ZQO A;  4JLZ A;  5DB6 A;  4K98 A;  4Z6D A;  4P4P A;  4F5R A;  1JAJ A;  2I9G A;  4FHW A;  8ICO A;  4QZC A;  7ICE A;  3K7D A;  3OGU A;  9ICX A;  4LEZ A;  3TFR A;  1ZQR A;  5J2H A;  1TV9 A;  4JLX A;  3MBY A;  2DR7 A;  4RWN A;  3L9D A;  4P4O A;  5J0P A;  4Z6C A;  4MFF A;  4K97 A;  9ICA A;  3NKU A;  1PX5 A;  4FHV A;  4LZD A;  3NYB A;  5J2A A;  3RH4 A;  4YMM A;  4FHX A;  8ICV A;  8ICQ A;  1R8C A;  4I0U A;  5DKW A;  3C5F A;  4I2J A;  1R89 A;  8ICC A;  4WC1 A;  2NRK A;  4RQ8 A;  5J2E A;  4IQW A;  4PH5 A;  2RFF A;  4FO1 A;  5HRD A;  1TFW A;  9ICJ A;  4NM2 A;  4M04 A;  9ICG A;  1NO5 A;  4PHE A;  2ZHB A;  2B51 A;  2DR9 A;  8ICN A;  2ZH3 A;  4S3N A;  4I2E A;  1R8A A;  4EEB A;  4E7X A;  4X4R A;  4RPX A;  3AQM A;  4LVS A;  2M2V A;  4AT7 B;  4I2A A;  4UB4 A;  3C66 A;  4PGY A;  4KLF A;  4GXK A;  4XRH A;  4WH5 A;  2PXI A;  4QZH A;  1ZQX A;  4ATB A;  5DBC A;  4X4P A;  1BPE A;  5BOM A;  7ICK A;  4RQ2 A;  4IG8 A;  4TUP A;  3RJF A;  7ICS A;  4K96 A;  7ICO A;  2M2W A;  4AT8 A;  3OUY B;  8ICT A;  9ICH A;  4O6A A;  3AU6 A;  8ICR A;  5IIO A;  5CWR A;  9ICK A;  2M2T A;  3OWG A;  8ICJ A;  1JN3 A;  4PHA A;  4MKP A;  5DED A;  4DOC A;  3RJK A;  8ICH A;  4M5D A;  4I2B A;  3V7K A;  1HUZ A;  4KLU A;  5J2D A;  4LEY A;  1RZT A;  4K99 A;  1MIW A;  4MF8 A;  4NXU A;  2BCU A;  4YD1 A;  3UXP A;  4K4G A;  2B56 A;  4XA5 A;  9ICM A;  8ICA A;  3AQL A;  4NXX A;  4O68 A;  5HRB A;  3C5G A;  2O5A A;  1Q79 A;  3JPS A;  4I2F A;  4WBY A;  4KLH A;  3ERC C;  2ISP A;  5J0O A;  2EWR A;  5J0W A;  4MFA A;  3PML A;  1HUO A;  2ZH2 A;  4RQ6 A;  3MGI A;  4EBJ A;  5CFS A;  1ZQN A;  4KLT A;  5J2K A;  4JWN A;  7ICH A;  2FMQ A;  1XSN A;  5CA7 A;  3RJG A;  2BPG A;  3MDA A;  4I28 A;  9ICB A;  4M47 A;  4X4Q A;  4I2I A;  2BBH A;  4I2H A;  4RWP A;  1ZQK A;  8ICI A;  4PGQ A;  4NKT A;  5J0Y A;  7ICT A;  5CHG A;  4PPX A;  4QZF A;  2FMS A;  4QZA A;  4KLM A;  4KLG A;  4RWO A;  2BPF A;  3RJJ A;  2BCS A;  8ICM A;  4DOB A;  4M9H A;  4KLJ A;  8ICE A;  4AT9 B;  3ISB A;  4RQ1 A;  2DR5 A;  3RH6 A;  3K75 D;  2ZH7 A; 
#chains in the Genus database with same CATH homology
 1BPX A;  5CJ7 A;  1KNY A;  3PMN A;  4KLO A;  4X4V A;  2DR8 A;  9ICC A;  1ZQY A;  4X4S A;  5IIJ A;  4UBC A;  2ZHA A;  4PHD A;  4KLE A;  7ICV A;  4F5P A;  9ICQ A;  5J0Q A;  3C18 A;  4UB5 A;  4GXI A;  4YD2 A;  1TFY A;  4GXJ A;  2GWS A;  2ISO A;  1ZQB A;  2O1P A;  3AQN A;  4KLL A;  4WC3 A;  4NLN A;  3MDC A;  3JPT A;  4RT3 A;  1ZQD A;  1ZQF A;  4X4O A;  4I2G A;  5BPC A;  4QZI A;  3WFO A;  4TUS A;  3JYY A;  2VAN A;  3OV7 A;  1MIV A;  3OVA A;  4XQ8 A;  8ICU A;  4KLS A;  4UAY A;  4QZ8 A;  4TUR A;  4K4I A;  2FMP A;  4KLI A;  4F5N A;  5DB7 A;  4NLK A;  9ICW A;  1FA0 A;  2Q66 A;  5HRI A;  4AT7 A;  4M9J A;  3C2K A;  2BCV A;  8ICS A;  1ZQA A;  3JPQ A;  1R8B A;  2ID1 A;  4M9N A;  8ICF A;  3HX0 A;  2PFN A;  4O5K A;  9ICV A;  5IIM A;  5CP2 A;  4FHY A;  4X5V A;  7ICF A;  4MFC A;  8ICK A;  4RT2 A;  4YMN A;  4WC5 A;  8ICP A;  3OUY A;  5HHI A;  4RQ7 A;  9ICT A;  5HRF A;  3H3A A;  5D49 A;  4M9L A;  5HRL A;  1ZQP A;  1ZQJ A;  4RQ5 A;  4X4N A;  3PNC A;  2ZH4 A;  9ICP A;  1Q78 A;  3UPQ A;  3UXN A;  4RPZ A;  2P66 A;  4TUQ A;  4F5Q A;  5HRE A;  5DB8 A;  3V72 A;  3OVS A;  4FO6 A;  4KLD A;  4EP7 A;  5J0S A;  3V7L A;  1ZQH A;  5J2J A;  2DRB A;  1MQ3 A;  3JZ0 A;  1RPL A;  4WC2 A;  5HHH A;  5J2B A;  4RWQ A;  3RJH A;  4DOA A;  7ICJ A;  4I29 A;  3HW8 A;  4KLQ A;  2PFQ A;  4F5O A;  5BOL A;  3WFS C;  1UET A;  2ZH6 A;  8ICL A;  2ZH5 A;  8ICZ A;  3HJ1 A;  3GDX A;  1JQR A;  1JMS A;  1ZQW A;  4JWM A;  4Z6E A;  1XSL A;  4UBB A;  3JPO A;  4AT9 A;  7ICL A;  3H38 A;  4UB1 A;  4XUS A;  5J2I A;  1WOT A;  4YCX A;  4P4M A;  4WBZ A;  7ICR A;  4MF2 A;  9ICU A;  5F2V O;  1VFG A;  3UQ2 A;  7ICM A;  3OVB A;  4NY8 A;  1UEV A;  9ICE A;  1ZQV A;  5DB9 A;  3LK9 A;  3RJE A;  4M2Y A;  3B0X A;  4LT6 A;  3H39 A;  1ZQS A;  1ZQU A;  4Z6F A;  4I27 A;  2DVI A;  4QZE A;  3HWT A;  5IIN A;  5D46 A;  2W9M A;  2PBE A;  7ICG A;  4LZG A;  8ICX A;  4RQ4 A;  4XQ7 A;  4O5C A;  4NLZ A;  2ZH9 A;  2BCR A;  7ICU A;  1ZQG A;  1ZQI A;  2ZH1 A;  3HIY A;  4PGX A;  5J0T A;  1UEU A;  4R65 A;  5DDM A;  3AUO A;  1KDH A;  4RQ3 A;  1ZQC A;  5J2F A;  1YLQ A;  3V7J A;  4K4H A;  4FH5 A;  2ZH8 A;  3LQC B;  8ICW A;  4WC4 A;  9ICO A;  1KEJ A;  3WFQ E;  1V4A A;  4QZ9 A;  3TFS A;  5HRK A;  3JPP A;  3C2L A;  4RPY A;  4O9M A;  4IQT A;  5J0R A;  4E8F A;  4X4T A;  9ICS A;  3RH5 A;  9ICR A;  3B0Y A;  5IIK A;  4R66 A;  8ICB A;  7ICP A;  3HJ4 A;  7ICQ A;  4X0B A;  3UQ0 A;  1MQ2 A;  1F5A A;  1ZQQ A;  4EBK A;  2BCQ A;  4I2C A;  9ICL A;  1NOM A;  3WFP A;  5CR0 A;  4YN4 A;  1BPZ A;  4R64 A;  4NKU A;  3ISD A;  4E80 A;  1ZQT A;  3C2M A;  4WC7 A;  1ZJN A;  4UAW A;  1ZQM A;  5DEC A;  4X4U A;  4R63 A;  1OU5 A;  2PFP A;  5J2C A;  4WC0 A;  4WC6 A;  4QZG A;  1MIY A;  5J0U A;  3UPS A;  3JPR A;  2M2U A;  4RQ0 A;  4QZD A;  4ATB B;  5DBA A;  3MGH A;  2IHM A;  1TVA A;  5EOZ A;  2BPC A;  1VJ7 A;  3AQK A;  4UD5 A;  4QZB A;  4WCW A;  9ICI A;  4AT8 B;  5HR9 A;  4IQU A;  3RJI A;  4UB2 A;  4X0A A;  3ISC A;  4UAZ A;  4IQV A;  1BPD A;  5IIL A;  5HRH A;  1ZQL A;  5J2G A;  4PHP A;  9ICF A;  4UB3 A;  1ZQE A;  3JPN A;  4FHP A;  4M9G A;  5DBB A;  4YMO A;  1XSP A;  8ICY A;  4O5E A;  3H37 A;  7ICN A;  4NXZ A;  4P2H A;  5D4B A;  1ZQZ A;  4UD4 A;  4FH3 A;  5J29 A;  5HC9 A;  9ICN A;  4I2D A;  5DDY A;  4M0A A;  1BPB A;  3WFR E;  2HHP A;  2DRA A;  4NM1 A;  8ICG A;  5CB1 A;  1ZJM A;  1BPY A;  5J0X A;  5HRG A;  3UXO A;  4DO9 A;  2BE3 A;  3AU2 A;  5III A;  2PFO A;  7ICI A;  5TZV A;  1ZQO A;  5DB6 A;  4Z6D A;  4P4P A;  4F5R A;  1JAJ A;  2I9G A;  4FHW A;  8ICO A;  4QZC A;  7ICE A;  3OGU A;  9ICX A;  3TFR A;  1ZQR A;  5J2H A;  1TV9 A;  3MBY A;  2DR7 A;  4RWN A;  3L9D A;  4P4O A;  5J0P A;  4Z6C A;  4MFF A;  9ICA A;  1PX5 A;  4FHV A;  4LZD A;  3NYB A;  5J2A A;  3RH4 A;  4YMM A;  4FHX A;  8ICV A;  8ICQ A;  1R8C A;  5DKW A;  3C5F A;  4I2J A;  1R89 A;  8ICC A;  4WC1 A;  2NRK A;  4RQ8 A;  5J2E A;  4IQW A;  4PH5 A;  2RFF A;  5HRD A;  1TFW A;  9ICJ A;  4NM2 A;  4M04 A;  9ICG A;  1NO5 A;  4PHE A;  2ZHB A;  2DR9 A;  8ICN A;  2ZH3 A;  4S3N A;  4I2E A;  1R8A A;  4X4R A;  4E7X A;  4RPX A;  3AQM A;  4LVS A;  2M2V A;  4AT7 B;  4I2A A;  4UB4 A;  3C66 A;  4PGY A;  4KLF A;  4GXK A;  4XRH A;  2PXI A;  4QZH A;  1ZQX A;  4ATB A;  5DBC A;  4X4P A;  1BPE A;  5BOM A;  7ICK A;  4RQ2 A;  4IG8 A;  4TUP A;  3RJF A;  7ICS A;  7ICO A;  2M2W A;  4AT8 A;  3OUY B;  8ICT A;  9ICH A;  3AU6 A;  8ICR A;  5IIO A;  5CWR A;  9ICK A;  2M2T A;  8ICJ A;  1JN3 A;  4PHA A;  5DED A;  4DOC A;  3RJK A;  8ICH A;  4M5D A;  4I2B A;  3V7K A;  1HUZ A;  4KLU A;  5J2D A;  1RZT A;  1MIW A;  4MF8 A;  2BCU A;  4YD1 A;  3UXP A;  4K4G A;  4XA5 A;  9ICM A;  8ICA A;  3AQL A;  5HRB A;  3C5G A;  2O5A A;  1Q79 A;  3JPS A;  4I2F A;  4WBY A;  4KLH A;  2ISP A;  5J0O A;  5J0W A;  4MFA A;  3PML A;  1HUO A;  2ZH2 A;  4RQ6 A;  3MGI A;  4EBJ A;  1ZQN A;  4KLT A;  5J2K A;  4JWN A;  7ICH A;  2FMQ A;  1XSN A;  5CA7 A;  3RJG A;  2BPG A;  3MDA A;  4I28 A;  9ICB A;  4M47 A;  4X4Q A;  4I2I A;  4I2H A;  4RWP A;  1ZQK A;  8ICI A;  4PGQ A;  4NKT A;  5J0Y A;  7ICT A;  5CHG A;  4PPX A;  4QZF A;  2FMS A;  4QZA A;  4KLM A;  4KLG A;  4RWO A;  2BPF A;  3RJJ A;  2BCS A;  8ICM A;  4DOB A;  4M9H A;  4KLJ A;  8ICE A;  4AT9 B;  3ISB A;  4RQ1 A;  2DR5 A;  3RH6 A;  3K75 D;  2ZH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...