2M2TA

Asfv pol x structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase
total genus 41
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2tA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2tA01
5DB8A 3H39A 2W9MA 4PH5A 9ICFA 5DBBA 3HJ4A 3C2KA 2PXIA 4XQ7A 3WFRE 1TVAA 4IQWA 3PNCA 4UAZA 5J29A 4PGYA 4XA5A 4EP7A 1BPXA 1ZQXA 3K75D 3C2MA 4UB4A 5J2HA 4F5RA 1R89A 1RZTA 3RH6A 1BPBA 1ZQSA 2M2WA 9ICWA 4I2AA 4PGXA 9ICHA 3HX0A 4UB1A 4NLNA 2BCUA 4WC6A 5F2VO 4I2EA 3H38A 2PFQA 3RJFA 4TUQA 4NKUA 4X4UA 4RQ1A 1ZQRA 4NLKA 7ICVA 1HUZA 4KLSA 1OU5A 4X4NA 8ICCA 4NY8A 4QZDA 8ICEA 3RJJA 4LVSA 5J0QA 4S3NA 4NKTA 4P4MA 5IIKA 4YN4A 5EOZA 2ZH2A 4PPXA 3B0YA 4YCXA 9ICIA 4I28A 1XSLA 1JN3A 3HIYA 3L9DA 2BPGA 5HR9A 4RQ8A 3ISBA 1BPDA 2RFFA 4UD5A 5J2IA 8ICZA 5CB1A 3JPTA 5BOMA 3C2LA 4M9LA 4PHPA 5J0YA 4K4IA 4KLEA 2ZHAA 4NXZA 4AT9A 5HREA 4YD1A 3AQNA 3RJEA 8ICPA 4M04A 3ISCA 1R8CA 1ZQIA 4M2YA 5J2AA 3UQ0A 1ZQYA 4MF2A 1XSNA 2BE3A 7ICHA 4DOCA 3UXOA 5HHIA 5DDYA 4RPXA 1UETA 3WFQE 2ZH9A 4QZAA 5J2CA 3V7LA 8ICAA 4UD4A 4O5EA 3LQCB 4RT3A 1ZQKA 3H37A 2ZH7A 4IG8A 3RJHA 1ZQDA 4FHXA 1XSPA 4YMOA 4M0AA 1ZQGA 3RJGA 4FHWA 1BPZA 3NYBA 2DRBA 4ATBA 4RQ6A 3MGHA 4QZ9A 1ZQJA 7ICIA 1V4AA 3HW8A 4KLIA 4KLLA 3LK9A 5J0TA 3JPQA 5D4BA 4Z6DA 1R8BA 8ICLA 4UB3A 4M47A 3OUYA 3HJ1A 5J2KA 7ICRA 1KDHA 4WC0A 4O5CA 5CJ7A 4O9MA 1PX5A 4KLQA 3UXNA 5IIJA 3OVBA 8ICSA 4AT7B 4MFCA 9ICPA 4KLOA 8ICVA 5J2EA 3AU2A 1ZQPA 2PFPA 3WFOA 5J0XA 4P2HA 5DECA 4RQ3A 4RQ7A 5BPCA 1HUOA 5HHHA 5HRDA 5CP2A 4I2CA 4UBCA 1NO5A 4QZBA 3OV7A 3B0XA 4X4PA 1ZQWA 4WCWA 5DBCA 3JPSA 4X0AA 2I9GA 9ICLA 4XRHA 4MFFA 4KLUA 4X4TA 4R63A 1TV9A 5BOLA 5J0SA 4YMMA 8ICFA 2BPCA 2ZHBA 3C5GA 8ICYA 2M2UA 4MFAA 4GXIA 5CA7A 5IIMA 3JPRA 4RWOA 2ISPA 5J0PA 4WBYA 5DB6A 4X4SA 4EBKA 4RWQA 4KLMA 4LZGA 8ICNA 2IHMA 2PBEA 3UPQA 4RQ4A 4R66A 4E7XA 3V7JA 2NRKA 1ZQLA 4QZEA 2ZH4A 4F5OA 4WBZA 1ZQUA 4UAWA 2DRAA 2M2TA 4O5KA 4F5NA 9ICBA 3HWTA 2DVIA 3UXPA 2ZH3A 4M9NA 1ZQBA 8ICGA 5J0WA 2DR7A 1MQ3A 3WFPA 5J2BA 4I2IA 1ZJMA 4RWNA 1JAJA 2VANA 9ICSA 8ICBA 9ICVA 4UAYA 4AT8B 7ICKA 1F5AA 3RH5A 4E8FA 5HRGA 2BCVA 3RJKA 4UBBA 4X4RA 4LZDA 3MDCA 5IIIA 2BPFA 5CHGA 2BCQA 9ICCA 2ZH8A 2O1PA 4FH3A 3AQKA 3PMLA 1MIWA 4JWNA 4K4GA 2O5AA 4WC5A 3V7KA 4PGQA 8ICIA 4Z6CA 5IINA 8ICXA 5HRHA 2BCRA 4QZGA 4TURA 4M9JA 4I2FA 8ICWA 1TFWA 5CWRA 2FMQA 4KLDA 3MDAA 4YMNA 1VJ7A 5DEDA 5J0RA 1KNYA 4RPYA 1YLQA 4M9HA 5HRLA 3ISDA 1BPYA 4P4OA 2BCSA 8ICMA 4NM2A 3C5FA 5DKWA 4FHYA 4WC4A 5IILA 2ZH6A 2GWSA 9ICKA 5DDMA 4X4OA 4RPZA 9ICXA 1RPLA 4XQ8A 5DB9A 4M9GA 1UEVA 4X4QA 4IQVA 1Q78A 4AT7A 5J2FA 7ICOA 4I2HA 4F5QA 4WC7A 4RQ0A 1Q79A 1ZQCA 9ICGA 2M2VA 9ICEA 4TUSA 4QZHA 4NLZA 4I27A 4WC3A 4QZ8A 3AQLA 3RH4A 4RQ2A 4TUPA 9ICOA 4RQ5A 3PMNA 4X0BA 7ICTA 8ICQA 3UPSA 4X4VA 8ICJA 8ICRA 4FHVA 7ICFA 4DOAA 9ICMA 7ICUA 3JPNA 1ZQEA 5CR0A 4MF8A 5HRKA 3AU6A 4FHPA 4E80A 4WC1A 1TFYA 5IIOA 3WFSC 3OVAA 4F5PA 8ICHA 4M5DA 3AUOA 1JMSA 4JWMA 1ZQHA 9ICAA 1MIYA 2DR5A 9ICUA 4QZIA 2P66A 1VFGA 3JPOA 5D46A 3AQMA 9ICRA 3MBYA 2FMSA 4P4PA 4FO6A 2ID1A 4DOBA 4I29A 1UEUA 3GDXA 4R65A 4I2GA 1ZQOA 9ICJA 1R8AA 4KLTA 8ICTA 3JPPA 4LT6A 3C18A 4AT9B 1JQRA 2PFOA 1ZQZA 4RT2A 4Z6EA 4I2DA 9ICNA 5J2DA 1BPEA 2ZH1A 3TFSA 2HHPA 4PHDA 4DO9A 7ICPA 1ZQVA 2ISOA 4QZFA 5J0UA 4PHEA 5D49A 4GXKA 1ZQTA 2DR8A 1KEJA 4UB2A 8ICOA 1MIVA 1WOTA 3V72A 4IQUA 3MGIA 1ZQQA 5TZVA 4WC2A 4AT8A 5J2GA 2PFNA 4RWPA 4UB5A 2FMPA 3UQ2A 2Q66A 7ICGA 8ICUA 3OVSA 3C66A 7ICQA 5HRIA 4KLGA 4KLJA 4ATBB 4EBJA 1ZQFA 7ICEA 4K4HA 7ICSA 3TFRA 7ICLA 4GXJA 4Z6FA 7ICMA 9ICQA 1FA0A 5DBAA 4I2BA 4XUSA 5HRFA 3OUYB 5HRBA 3RJIA 5DB7A 4KLFA 3JZ0A 4IQTA 7ICJA 4R64A 4I2JA 1NOMA 1MQ2A 2ZH5A 7ICNA 5HC9A 2DR9A 5J2JA 8ICKA 4PHAA 4YD2A 3H3AA 4QZCA 3OGUA 1ZQNA 4FH5A 1ZQMA 9ICTA 4NM1A 5J0OA 3JYYA 1ZQAA 4X5VA 1ZJNA 4KLHA
chains in the Genus database with same CATH superfamily
5DB8A 3H39A 2W9MA 4PH5A 9ICFA 5DBBA 5D63A 3HJ4A 5B3QA 3C2KA 2PXIA 4XQ7A 3WFRE 1TVAA 4IQWA 3PNCA 4UAZA 5J29A 4PGYA 4XA5A 2BBJA 4EP7A 1BPXA 1ZQXA 3K75D 3C2MA 4UB4A 5J2HA 4F5RA 1R89A 1RZTA 3RH6A 4JLXA 1BPBA 3K7DA 1ZQSA 2M2WA 5CFSA 9ICWA 2GA9D 4I2AA 4PGXA 3NVOA 9ICHA 3HX0A 4UB1A 4NLNA 4K97A 2BCUA 4WC6A 5F2VO 4I2EA 3H38A 4K8VA 2PFQA 3RJFA 4TUQA 4NKUA 4X4UA 4RQ1A 1ZQRA 4NLKA 7ICVA 1HUZA 4KLSA 1OU5A 4X4NA 8ICCA 4NY8A 4QZDA 8ICEA 4JLZA 3RJJA 4LVSA 5J0QA 4LEVA 4S3NA 3NKUA 4NKTA 4P4MA 5IIKA 4YN4A 5EOZA 2ZH2A 4PPXA 3B0YA 4YCXA 9ICIA 4I28A 1XSLA 1JN3A 3HIYA 3L9DA 2BPGA 5HR9A 4RQ8A 3ISBA 1BPDA 2RFFA 4UD5A 5J2IA 8ICZA 5CB1A 3JPTA 2FCLA 5BOMA 3C2LA 4M9LA 4N7RA 4K96A 4PHPA 5J0YA 4K4IA 4KLEA 2ZHAA 4NXZA 4AT9A 5HREA 4YD1A 3AQNA 3RJEA 8ICPA 4M04A 5JTGA 3ISCA 1R8CA 1ZQIA 4M2YA 5J2AA 3UQ0A 1ZQYA 4MF2A 1XSNA 2BE3A 7ICHA 4DOCA 3UXOA 5HHIA 3EF2A 5DDYA 4RPXA 1UETA 3WFQE 2ZH9A 4QZAA 5J2CA 3V7LA 8ICAA 4UD4A 4O5EA 3LQCB 4RT3A 4EEBA 1ZQKA 3H37A 2ZH7A 4KB6A 4IG8A 3RJHA 2IHOA 1ZQDA 4FHXA 1XSPA 4YMOA 4M0AA 1ZQGA 3RJGA 4FHWA 1BPZA 3NYBA 2DRBA 4ATBA 4RQ6A 3MGHA 4QZ9A 1ZQJA 7ICIA 1V4AA 3HW8A 3ER9B 4KLIA 2GAFD 4OAGA 4KLLA 3LK9A 5J0TA 3JPQA 5D4BA 4Z6DA 1R8BA 8ICLA 4UB3A 4M47A 3OUYA 3HJ1A 5J2KA 7ICRA 1KDHA 4WC0A 4O5CA 5CJ7A 4O9MA 1PX5A 4KLQA 3UXNA 5IIJA 3PHZA 3OVBA 8ICSA 4AT7B 4MFCA 9ICPA 4KLOA 8ICVA 5J2EA 3AU2A 1ZQPA 2PFPA 3WFOA 5J0XA 4P2HA 2IUBA 4RQ3A 4NXTA 5CHEA 4RQ7A 5DECA 5BPCA 1HUOA 5HHHA 5HRDA 4EEDA 5CP2A 4I2CA 2B51A 4UBCA 1NO5A 4QZBA 3OV7A 3B0XA 4X4PA 4OAHA 1ZQWA 4WCWA 5DBCA 3JPSA 4X0AA 3ER8C 2I9GA 5CFTA 9ICLA 4XRHA 4MFFA 4NXVA 4KLUA 4X4TA 4R63A 1TV9A 5BOLA 5J0SA 4YMMA 8ICFA 2BPCA 2ZHBA 3C5GA 8ICYA 2M2UA 4MFAA 4GXIA 5CA7A 5IIMA 3JPRA 4RWOA 2ISPA 5J0PA 1GPJA 4WBYA 5DB6A 4NXXA 4X4SA 4EBKA 4RWQA 4KLMA 4LZGA 8ICNA 2IHMA 2PBEA 3UPQA 5B3PA 4RQ4A 4R66A 4E7XA 3V7JA 2NRKA 1ZQLA 4QZEA 4WH5A 4F5OA 4WBZA 2ZH4A 1ZQUA 4UAWA 5CFUA 2DRAA 2M2TA 4O5KA 4I0UA 4F5NA 9ICBA 3HWTA 2DVIA 3UXPA 2ZH3A 4M9NA 1ZQBA 8ICGA 3NWIA 5J0WA 2DR7A 1MQ3A 3WFPA 5J2BA 4I2IA 1ZJMA 4RWNA 1JAJA 4LEYA 2VANA 9ICSA 8ICBA 9ICVA 4UAYA 4AT8B 4O69A 7ICKA 1F5AA 3RH5A 4E8FA 5HRGA 2BCVA 4XJEA 3RJKA 4UBBA 4X4RA 4LZDA 3MDCA 5IIIA 2BPFA 5CHGA 2BCQA 9ICCA 2ZH8A 2O1PA 4FH3A 3AQKA 3PMLA 1MIWA 4JWNA 4K4GA 2O5AA 4EGWA 4WC5A 3V7KA 4PGQA 8ICIA 5D62A 4Z6CA 5IINA 8ICXA 5HRHA 2BCRA 4QZGA 4TURA 4M9JA 4I2FA 8ICWA 1TFWA 5CWRA 2FMQA 4KLDA 3MDAA 2EWRA 4YMNA 1VJ7A 5DEDA 5J0RA 1KNYA 3CK6A 4RPYA 1YLQA 4M9HA 5HRLA 3ISDA 1BPYA 4P4OA 2BCSA 8ICMA 4NM2A 3C5FA 5DKWA 4FHYA 2B4VA 4WC4A 5IILA 2ZH6A 3JCFA 2GWSA 3MCRA 9ICKA 5DDMA 4NXWA 4X4OA 4RPZA 9ICXA 1RPLA 4XQ8A 4KM5A 5DB9A 4M9GA 1UEVA 4X4QA 4IQVA 1Q78A 4AT7A 4WOYA 5J2FA 7ICOA 4I2HA 4F5QA 4WC7A 4FO1A 4RQ0A 3ERCC 1Q79A 1ZQCA 9ICGA 2M2VA 9ICEA 4TUSA 4QZHA 4NLZA 4I27A 4WC3A 4QZ8A 3AQLA 3RH4A 4RQ2A 4TUPA 9ICOA 4RQ5A 3PMNA 4X0BA 7ICTA 8ICQA 3UPSA 4K99A 4X4VA 8ICJA 8ICRA 4FHVA 7ICFA 4DOAA 9ICMA 7ICUA 3JPNA 1ZQEA 5CR0A 4MF8A 5HRKA 3AU6A 4FHPA 4E80A 4WC1A 1TFYA 5IIOA 3WFSC 3OVAA 4F5PA 4O68A 8ICHA 2HN2A 4M5DA 4EV6A 3AUOA 1JMSA 3OWGA 4JWMA 1ZQHA 9ICAA 1MIYA 2DR5A 9ICUA 4QZIA 2P66A 1VFGA 3JPOA 5D46A 3AQMA 4OAIZ 9ICRA 3MBYA 2FMSA 4P4PA 4FO6A 2ID1A 4DOBA 4I29A 1UEUA 3GDXA 4R65A 4I2GA 4O6AA 1ZQOA 9ICJA 1R8AA 4KLTA 8ICTA 4K9AA 3JPPA 4LT6A 3C18A 5D61A 4AT9B 1JQRA 2PFOA 1ZQZA 4RT2A 4Z6EA 4WQKA 4I2DA 9ICNA 5J2DA 1BPEA 2ZH1A 3TFSA 2HHPA 4PHDA 2B56A 4DO9A 7ICPA 1ZQVA 2ISOA 4OAFA 4QZFA 5J0UA 4PHEA 5D49A 4GXKA 1ZQTA 2DR8A 2HN1A 1KEJA 4K98A 4UB2A 8ICOA 1MIVA 1WOTA 3V72A 4K9BA 4IQUA 3MGIA 1ZQQA 5TZVA 4O67A 4WC2A 4NXUA 5J2GA 4AT8A 2PFNA 4RWPA 4UB5A 2FMPA 3UQ2A 2Q66A 7ICGA 8ICUA 3OVSA 3C66A 7ICQA 5HRIA 4KLGA 4KLJA 4ATBB 4EBJA 1ZQFA 2BBHA 7ICEA 4K4HA 7ICSA 3TFRA 7ICLA 4GXJA 4Z6FA 7ICMA 4HX0A 9ICQA 1FA0A 5DBAA 4I2BA 4WQLA 4XUSA 5HRFA 3OUYB 5HRBA 3RJIA 5DB7A 4KLFA 3JZ0A 4IQTA 7ICJA 4R64A 4I2JA 1NOMA 1MQ2A 2ZH5A 7ICNA 4LEZA 5HC9A 2DR9A 5J2JA 8ICKA 4PHAA 4YD2A 3H3AA 4QZCA 3OGUA 1ZQNA 4FH5A 4LEWA 1ZQMA 9ICTA 4NM1A 5J0OA 3JYYA 4MKPA 1ZQAA 4X5VA 1ZJNA 4KLHA
chains in the Genus database with same CATH topology
5DB8A 3H39A 2W9MA 4PH5A 9ICFA 5DBBA 3HJ4A 3C2KA 2PXIA 4XQ7A 3WFRE 1TVAA 4IQWA 3PNCA 4UAZA 5J29A 4PGYA 4XA5A 4EP7A 1BPXA 1ZQXA 3K75D 3C2MA 4UB4A 5J2HA 4F5RA 1R89A 1RZTA 3RH6A 1BPBA 1ZQSA 2M2WA 9ICWA 4I2AA 4PGXA 9ICHA 3HX0A 4UB1A 4NLNA 2BCUA 4WC6A 5F2VO 4I2EA 3H38A 2PFQA 3RJFA 4TUQA 4NKUA 4X4UA 4RQ1A 1ZQRA 4NLKA 7ICVA 1HUZA 4KLSA 1OU5A 4X4NA 8ICCA 4NY8A 4QZDA 8ICEA 3RJJA 4LVSA 5J0QA 4S3NA 4NKTA 4P4MA 5IIKA 4YN4A 5EOZA 2ZH2A 4PPXA 3B0YA 4YCXA 9ICIA 4I28A 1XSLA 1JN3A 3HIYA 3L9DA 2BPGA 5HR9A 4RQ8A 3ISBA 1BPDA 2RFFA 4UD5A 5J2IA 8ICZA 5CB1A 3JPTA 5BOMA 3C2LA 4M9LA 4PHPA 5J0YA 4K4IA 4KLEA 2ZHAA 4NXZA 4AT9A 5HREA 4YD1A 3AQNA 3RJEA 8ICPA 4M04A 3ISCA 1R8CA 1ZQIA 4M2YA 5J2AA 3UQ0A 1ZQYA 4MF2A 1XSNA 2BE3A 7ICHA 4DOCA 3UXOA 5HHIA 5DDYA 4RPXA 1UETA 3WFQE 2ZH9A 4QZAA 5J2CA 3V7LA 8ICAA 4UD4A 4O5EA 3LQCB 4RT3A 1ZQKA 3H37A 2ZH7A 4IG8A 3RJHA 1ZQDA 4FHXA 1XSPA 4YMOA 4M0AA 1ZQGA 3RJGA 4FHWA 1BPZA 3NYBA 2DRBA 4ATBA 4RQ6A 3MGHA 4QZ9A 1ZQJA 7ICIA 1V4AA 3HW8A 4KLIA 4KLLA 3LK9A 5J0TA 3JPQA 5D4BA 4Z6DA 1R8BA 8ICLA 4UB3A 4M47A 3OUYA 3HJ1A 5J2KA 7ICRA 1KDHA 4WC0A 4O5CA 5CJ7A 4O9MA 1PX5A 4KLQA 3UXNA 5IIJA 3OVBA 8ICSA 4AT7B 4MFCA 9ICPA 4KLOA 8ICVA 5J2EA 3AU2A 1ZQPA 2PFPA 3WFOA 5J0XA 4P2HA 5DECA 4RQ3A 4RQ7A 5BPCA 1HUOA 5HHHA 5HRDA 5CP2A 4I2CA 4UBCA 1NO5A 4QZBA 3OV7A 3B0XA 4X4PA 1ZQWA 4WCWA 5DBCA 3JPSA 4X0AA 2I9GA 9ICLA 4XRHA 4MFFA 4KLUA 4X4TA 4R63A 1TV9A 5BOLA 5J0SA 4YMMA 8ICFA 2BPCA 2ZHBA 3C5GA 8ICYA 2M2UA 4MFAA 4GXIA 5CA7A 5IIMA 3JPRA 4RWOA 2ISPA 5J0PA 4WBYA 5DB6A 4X4SA 4EBKA 4RWQA 4KLMA 4LZGA 8ICNA 2IHMA 2PBEA 3UPQA 4RQ4A 4R66A 4E7XA 3V7JA 2NRKA 1ZQLA 4QZEA 2ZH4A 4F5OA 4WBZA 1ZQUA 4UAWA 2DRAA 2M2TA 4O5KA 4F5NA 9ICBA 3HWTA 2DVIA 3UXPA 2ZH3A 4M9NA 1ZQBA 8ICGA 5J0WA 2DR7A 1MQ3A 3WFPA 5J2BA 4I2IA 1ZJMA 4RWNA 1JAJA 2VANA 9ICSA 8ICBA 9ICVA 4UAYA 4AT8B 7ICKA 1F5AA 3RH5A 4E8FA 5HRGA 2BCVA 3RJKA 4UBBA 4X4RA 4LZDA 3MDCA 5IIIA 2BPFA 5CHGA 2BCQA 9ICCA 2ZH8A 2O1PA 4FH3A 3AQKA 3PMLA 1MIWA 4JWNA 4K4GA 2O5AA 4WC5A 3V7KA 4PGQA 8ICIA 4Z6CA 5IINA 8ICXA 5HRHA 2BCRA 4QZGA 4TURA 4M9JA 4I2FA 8ICWA 1TFWA 5CWRA 2FMQA 4KLDA 3MDAA 4YMNA 1VJ7A 5DEDA 5J0RA 1KNYA 4RPYA 1YLQA 4M9HA 5HRLA 3ISDA 1BPYA 4P4OA 2BCSA 8ICMA 4NM2A 3C5FA 5DKWA 4FHYA 4WC4A 5IILA 2ZH6A 2GWSA 9ICKA 5DDMA 4X4OA 4RPZA 9ICXA 1RPLA 4XQ8A 5DB9A 4M9GA 1UEVA 4X4QA 4IQVA 1Q78A 4AT7A 5J2FA 7ICOA 4I2HA 4F5QA 4WC7A 4RQ0A 1Q79A 1ZQCA 9ICGA 2M2VA 9ICEA 4TUSA 4QZHA 4NLZA 4I27A 4WC3A 4QZ8A 3AQLA 3RH4A 4RQ2A 4TUPA 9ICOA 4RQ5A 3PMNA 4X0BA 7ICTA 8ICQA 3UPSA 4X4VA 8ICJA 8ICRA 4FHVA 7ICFA 4DOAA 9ICMA 7ICUA 3JPNA 1ZQEA 5CR0A 4MF8A 5HRKA 3AU6A 4FHPA 4E80A 4WC1A 1TFYA 5IIOA 3WFSC 3OVAA 4F5PA 8ICHA 4M5DA 3AUOA 1JMSA 4JWMA 1ZQHA 9ICAA 1MIYA 2DR5A 9ICUA 4QZIA 2P66A 1VFGA 3JPOA 5D46A 3AQMA 9ICRA 3MBYA 2FMSA 4P4PA 4FO6A 2ID1A 4DOBA 4I29A 1UEUA 3GDXA 4R65A 4I2GA 1ZQOA 9ICJA 1R8AA 4KLTA 8ICTA 3JPPA 4LT6A 3C18A 4AT9B 1JQRA 2PFOA 1ZQZA 4RT2A 4Z6EA 4I2DA 9ICNA 5J2DA 1BPEA 2ZH1A 3TFSA 2HHPA 4PHDA 4DO9A 7ICPA 1ZQVA 2ISOA 4QZFA 5J0UA 4PHEA 5D49A 4GXKA 1ZQTA 2DR8A 1KEJA 4UB2A 8ICOA 1MIVA 1WOTA 3V72A 4IQUA 3MGIA 1ZQQA 5TZVA 4WC2A 4AT8A 5J2GA 2PFNA 4RWPA 4UB5A 2FMPA 3UQ2A 2Q66A 7ICGA 8ICUA 3OVSA 3C66A 7ICQA 5HRIA 4KLGA 4KLJA 4ATBB 4EBJA 1ZQFA 7ICEA 4K4HA 7ICSA 3TFRA 7ICLA 4GXJA 4Z6FA 7ICMA 9ICQA 1FA0A 5DBAA 4I2BA 4XUSA 5HRFA 3OUYB 5HRBA 3RJIA 5DB7A 4KLFA 3JZ0A 4IQTA 7ICJA 4R64A 4I2JA 1NOMA 1MQ2A 2ZH5A 7ICNA 5HC9A 2DR9A 5J2JA 8ICKA 4PHAA 4YD2A 3H3AA 4QZCA 3OGUA 1ZQNA 4FH5A 1ZQMA 9ICTA 4NM1A 5J0OA 3JYYA 1ZQAA 4X5VA 1ZJNA 4KLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DB8 A;  3H39 A;  2W9M A;  4PH5 A;  9ICF A;  5DBB A;  3HJ4 A;  3C2K A;  2PXI A;  4XQ7 A;  3WFR E;  1TVA A;  4IQW A;  3PNC A;  4UAZ A;  5J29 A;  4PGY A;  4XA5 A;  4EP7 A;  1BPX A;  1ZQX A;  3K75 D;  3C2M A;  4UB4 A;  5J2H A;  4F5R A;  1R89 A;  1RZT A;  3RH6 A;  1BPB A;  1ZQS A;  2M2W A;  9ICW A;  4I2A A;  4PGX A;  9ICH A;  3HX0 A;  4UB1 A;  4NLN A;  2BCU A;  4WC6 A;  5F2V O;  4I2E A;  3H38 A;  2PFQ A;  3RJF A;  4TUQ A;  4NKU A;  4X4U A;  4RQ1 A;  1ZQR A;  4NLK A;  7ICV A;  1HUZ A;  4KLS A;  1OU5 A;  4X4N A;  8ICC A;  4NY8 A;  4QZD A;  8ICE A;  3RJJ A;  4LVS A;  5J0Q A;  4S3N A;  4NKT A;  4P4M A;  5IIK A;  4YN4 A;  5EOZ A;  2ZH2 A;  4PPX A;  3B0Y A;  4YCX A;  9ICI A;  4I28 A;  1XSL A;  1JN3 A;  3HIY A;  3L9D A;  2BPG A;  5HR9 A;  4RQ8 A;  3ISB A;  1BPD A;  2RFF A;  4UD5 A;  5J2I A;  8ICZ A;  5CB1 A;  3JPT A;  5BOM A;  3C2L A;  4M9L A;  4PHP A;  5J0Y A;  4K4I A;  4KLE A;  2ZHA A;  4NXZ A;  4AT9 A;  5HRE A;  4YD1 A;  3AQN A;  3RJE A;  8ICP A;  4M04 A;  3ISC A;  1R8C A;  1ZQI A;  4M2Y A;  5J2A A;  3UQ0 A;  1ZQY A;  4MF2 A;  1XSN A;  2BE3 A;  7ICH A;  4DOC A;  3UXO A;  5HHI A;  5DDY A;  4RPX A;  1UET A;  3WFQ E;  2ZH9 A;  4QZA A;  5J2C A;  3V7L A;  8ICA A;  4UD4 A;  4O5E A;  3LQC B;  4RT3 A;  1ZQK A;  3H37 A;  2ZH7 A;  4IG8 A;  3RJH A;  1ZQD A;  4FHX A;  1XSP A;  4YMO A;  4M0A A;  1ZQG A;  3RJG A;  4FHW A;  1BPZ A;  3NYB A;  2DRB A;  4ATB A;  4RQ6 A;  3MGH A;  4QZ9 A;  1ZQJ A;  7ICI A;  1V4A A;  3HW8 A;  4KLI A;  4KLL A;  3LK9 A;  5J0T A;  3JPQ A;  5D4B A;  4Z6D A;  1R8B A;  8ICL A;  4UB3 A;  4M47 A;  3OUY A;  3HJ1 A;  5J2K A;  7ICR A;  1KDH A;  4WC0 A;  4O5C A;  5CJ7 A;  4O9M A;  1PX5 A;  4KLQ A;  3UXN A;  5IIJ A;  3OVB A;  8ICS A;  4AT7 B;  4MFC A;  9ICP A;  4KLO A;  8ICV A;  5J2E A;  3AU2 A;  1ZQP A;  2PFP A;  3WFO A;  5J0X A;  4P2H A;  5DEC A;  4RQ3 A;  4RQ7 A;  5BPC A;  1HUO A;  5HHH A;  5HRD A;  5CP2 A;  4I2C A;  4UBC A;  1NO5 A;  4QZB A;  3OV7 A;  3B0X A;  4X4P A;  1ZQW A;  4WCW A;  5DBC A;  3JPS A;  4X0A A;  2I9G A;  9ICL A;  4XRH A;  4MFF A;  4KLU A;  4X4T A;  4R63 A;  1TV9 A;  5BOL A;  5J0S A;  4YMM A;  8ICF A;  2BPC A;  2ZHB A;  3C5G A;  8ICY A;  2M2U A;  4MFA A;  4GXI A;  5CA7 A;  5IIM A;  3JPR A;  4RWO A;  2ISP A;  5J0P A;  4WBY A;  5DB6 A;  4X4S A;  4EBK A;  4RWQ A;  4KLM A;  4LZG A;  8ICN A;  2IHM A;  2PBE A;  3UPQ A;  4RQ4 A;  4R66 A;  4E7X A;  3V7J A;  2NRK A;  1ZQL A;  4QZE A;  2ZH4 A;  4F5O A;  4WBZ A;  1ZQU A;  4UAW A;  2DRA A;  2M2T A;  4O5K A;  4F5N A;  9ICB A;  3HWT A;  2DVI A;  3UXP A;  2ZH3 A;  4M9N A;  1ZQB A;  8ICG A;  5J0W A;  2DR7 A;  1MQ3 A;  3WFP A;  5J2B A;  4I2I A;  1ZJM A;  4RWN A;  1JAJ A;  2VAN A;  9ICS A;  8ICB A;  9ICV A;  4UAY A;  4AT8 B;  7ICK A;  1F5A A;  3RH5 A;  4E8F A;  5HRG A;  2BCV A;  3RJK A;  4UBB A;  4X4R A;  4LZD A;  3MDC A;  5III A;  2BPF A;  5CHG A;  2BCQ A;  9ICC A;  2ZH8 A;  2O1P A;  4FH3 A;  3AQK A;  3PML A;  1MIW A;  4JWN A;  4K4G A;  2O5A A;  4WC5 A;  3V7K A;  4PGQ A;  8ICI A;  4Z6C A;  5IIN A;  8ICX A;  5HRH A;  2BCR A;  4QZG A;  4TUR A;  4M9J A;  4I2F A;  8ICW A;  1TFW A;  5CWR A;  2FMQ A;  4KLD A;  3MDA A;  4YMN A;  1VJ7 A;  5DED A;  5J0R A;  1KNY A;  4RPY A;  1YLQ A;  4M9H A;  5HRL A;  3ISD A;  1BPY A;  4P4O A;  2BCS A;  8ICM A;  4NM2 A;  3C5F A;  5DKW A;  4FHY A;  4WC4 A;  5IIL A;  2ZH6 A;  2GWS A;  9ICK A;  5DDM A;  4X4O A;  4RPZ A;  9ICX A;  1RPL A;  4XQ8 A;  5DB9 A;  4M9G A;  1UEV A;  4X4Q A;  4IQV A;  1Q78 A;  4AT7 A;  5J2F A;  7ICO A;  4I2H A;  4F5Q A;  4WC7 A;  4RQ0 A;  1Q79 A;  1ZQC A;  9ICG A;  2M2V A;  9ICE A;  4TUS A;  4QZH A;  4NLZ A;  4I27 A;  4WC3 A;  4QZ8 A;  3AQL A;  3RH4 A;  4RQ2 A;  4TUP A;  9ICO A;  4RQ5 A;  3PMN A;  4X0B A;  7ICT A;  8ICQ A;  3UPS A;  4X4V A;  8ICJ A;  8ICR A;  4FHV A;  7ICF A;  4DOA A;  9ICM A;  7ICU A;  3JPN A;  1ZQE A;  5CR0 A;  4MF8 A;  5HRK A;  3AU6 A;  4FHP A;  4E80 A;  4WC1 A;  1TFY A;  5IIO A;  3WFS C;  3OVA A;  4F5P A;  8ICH A;  4M5D A;  3AUO A;  1JMS A;  4JWM A;  1ZQH A;  9ICA A;  1MIY A;  2DR5 A;  9ICU A;  4QZI A;  2P66 A;  1VFG A;  3JPO A;  5D46 A;  3AQM A;  9ICR A;  3MBY A;  2FMS A;  4P4P A;  4FO6 A;  2ID1 A;  4DOB A;  4I29 A;  1UEU A;  3GDX A;  4R65 A;  4I2G A;  1ZQO A;  9ICJ A;  1R8A A;  4KLT A;  8ICT A;  3JPP A;  4LT6 A;  3C18 A;  4AT9 B;  1JQR A;  2PFO A;  1ZQZ A;  4RT2 A;  4Z6E A;  4I2D A;  9ICN A;  5J2D A;  1BPE A;  2ZH1 A;  3TFS A;  2HHP A;  4PHD A;  4DO9 A;  7ICP A;  1ZQV A;  2ISO A;  4QZF A;  5J0U A;  4PHE A;  5D49 A;  4GXK A;  1ZQT A;  2DR8 A;  1KEJ A;  4UB2 A;  8ICO A;  1MIV A;  1WOT A;  3V72 A;  4IQU A;  3MGI A;  1ZQQ A;  5TZV A;  4WC2 A;  4AT8 A;  5J2G A;  2PFN A;  4RWP A;  4UB5 A;  2FMP A;  3UQ2 A;  2Q66 A;  7ICG A;  8ICU A;  3OVS A;  3C66 A;  7ICQ A;  5HRI A;  4KLG A;  4KLJ A;  4ATB B;  4EBJ A;  1ZQF A;  7ICE A;  4K4H A;  7ICS A;  3TFR A;  7ICL A;  4GXJ A;  4Z6F A;  7ICM A;  9ICQ A;  1FA0 A;  5DBA A;  4I2B A;  4XUS A;  5HRF A;  3OUY B;  5HRB A;  3RJI A;  5DB7 A;  4KLF A;  3JZ0 A;  4IQT A;  7ICJ A;  4R64 A;  4I2J A;  1NOM A;  1MQ2 A;  2ZH5 A;  7ICN A;  5HC9 A;  2DR9 A;  5J2J A;  8ICK A;  4PHA A;  4YD2 A;  3H3A A;  4QZC A;  3OGU A;  1ZQN A;  4FH5 A;  1ZQM A;  9ICT A;  4NM1 A;  5J0O A;  3JYY A;  1ZQA A;  4X5V A;  1ZJN A;  4KLH A; 
#chains in the Genus database with same CATH topology
 5DB8 A;  3H39 A;  2W9M A;  4PH5 A;  9ICF A;  5DBB A;  5D63 A;  3HJ4 A;  5B3Q A;  3C2K A;  2PXI A;  4XQ7 A;  3WFR E;  1TVA A;  4IQW A;  3PNC A;  4UAZ A;  5J29 A;  4PGY A;  4XA5 A;  2BBJ A;  4EP7 A;  1BPX A;  1ZQX A;  3K75 D;  3C2M A;  4UB4 A;  5J2H A;  4F5R A;  1R89 A;  1RZT A;  3RH6 A;  4JLX A;  1BPB A;  3K7D A;  1ZQS A;  2M2W A;  5CFS A;  9ICW A;  2GA9 D;  4I2A A;  4PGX A;  3NVO A;  9ICH A;  3HX0 A;  4UB1 A;  4NLN A;  4K97 A;  2BCU A;  4WC6 A;  5F2V O;  4I2E A;  3H38 A;  4K8V A;  2PFQ A;  3RJF A;  4TUQ A;  4NKU A;  4X4U A;  4RQ1 A;  1ZQR A;  4NLK A;  7ICV A;  1HUZ A;  4KLS A;  1OU5 A;  4X4N A;  8ICC A;  4NY8 A;  4QZD A;  8ICE A;  4JLZ A;  3RJJ A;  4LVS A;  5J0Q A;  4LEV A;  4S3N A;  3NKU A;  4NKT A;  4P4M A;  5IIK A;  4YN4 A;  5EOZ A;  2ZH2 A;  4PPX A;  3B0Y A;  4YCX A;  9ICI A;  4I28 A;  1XSL A;  1JN3 A;  3HIY A;  3L9D A;  2BPG A;  5HR9 A;  4RQ8 A;  3ISB A;  1BPD A;  2RFF A;  4UD5 A;  5J2I A;  8ICZ A;  5CB1 A;  3JPT A;  2FCL A;  5BOM A;  3C2L A;  4M9L A;  4N7R A;  4K96 A;  4PHP A;  5J0Y A;  4K4I A;  4KLE A;  2ZHA A;  4NXZ A;  4AT9 A;  5HRE A;  4YD1 A;  3AQN A;  3RJE A;  8ICP A;  4M04 A;  5JTG A;  3ISC A;  1R8C A;  1ZQI A;  4M2Y A;  5J2A A;  3UQ0 A;  1ZQY A;  4MF2 A;  1XSN A;  2BE3 A;  7ICH A;  4DOC A;  3UXO A;  5HHI A;  3EF2 A;  5DDY A;  4RPX A;  1UET A;  3WFQ E;  2ZH9 A;  4QZA A;  5J2C A;  3V7L A;  8ICA A;  4UD4 A;  4O5E A;  3LQC B;  4RT3 A;  4EEB A;  1ZQK A;  3H37 A;  2ZH7 A;  4KB6 A;  4IG8 A;  3RJH A;  2IHO A;  1ZQD A;  4FHX A;  1XSP A;  4YMO A;  4M0A A;  1ZQG A;  3RJG A;  4FHW A;  1BPZ A;  3NYB A;  2DRB A;  4ATB A;  4RQ6 A;  3MGH A;  4QZ9 A;  1ZQJ A;  7ICI A;  1V4A A;  3HW8 A;  3ER9 B;  4KLI A;  2GAF D;  4OAG A;  4KLL A;  3LK9 A;  5J0T A;  3JPQ A;  5D4B A;  4Z6D A;  1R8B A;  8ICL A;  4UB3 A;  4M47 A;  3OUY A;  3HJ1 A;  5J2K A;  7ICR A;  1KDH A;  4WC0 A;  4O5C A;  5CJ7 A;  4O9M A;  1PX5 A;  4KLQ A;  3UXN A;  5IIJ A;  3PHZ A;  3OVB A;  8ICS A;  4AT7 B;  4MFC A;  9ICP A;  4KLO A;  8ICV A;  5J2E A;  3AU2 A;  1ZQP A;  2PFP A;  3WFO A;  5J0X A;  4P2H A;  2IUB A;  4RQ3 A;  4NXT A;  5CHE A;  4RQ7 A;  5DEC A;  5BPC A;  1HUO A;  5HHH A;  5HRD A;  4EED A;  5CP2 A;  4I2C A;  2B51 A;  4UBC A;  1NO5 A;  4QZB A;  3OV7 A;  3B0X A;  4X4P A;  4OAH A;  1ZQW A;  4WCW A;  5DBC A;  3JPS A;  4X0A A;  3ER8 C;  2I9G A;  5CFT A;  9ICL A;  4XRH A;  4MFF A;  4NXV A;  4KLU A;  4X4T A;  4R63 A;  1TV9 A;  5BOL A;  5J0S A;  4YMM A;  8ICF A;  2BPC A;  2ZHB A;  3C5G A;  8ICY A;  2M2U A;  4MFA A;  4GXI A;  5CA7 A;  5IIM A;  3JPR A;  4RWO A;  2ISP A;  5J0P A;  1GPJ A;  4WBY A;  5DB6 A;  4NXX A;  4X4S A;  4EBK A;  4RWQ A;  4KLM A;  4LZG A;  8ICN A;  2IHM A;  2PBE A;  3UPQ A;  5B3P A;  4RQ4 A;  4R66 A;  4E7X A;  3V7J A;  2NRK A;  1ZQL A;  4QZE A;  4WH5 A;  4F5O A;  4WBZ A;  2ZH4 A;  1ZQU A;  4UAW A;  5CFU A;  2DRA A;  2M2T A;  4O5K A;  4I0U A;  4F5N A;  9ICB A;  3HWT A;  2DVI A;  3UXP A;  2ZH3 A;  4M9N A;  1ZQB A;  8ICG A;  3NWI A;  5J0W A;  2DR7 A;  1MQ3 A;  3WFP A;  5J2B A;  4I2I A;  1ZJM A;  4RWN A;  1JAJ A;  4LEY A;  2VAN A;  9ICS A;  8ICB A;  9ICV A;  4UAY A;  4AT8 B;  4O69 A;  7ICK A;  1F5A A;  3RH5 A;  4E8F A;  5HRG A;  2BCV A;  4XJE A;  3RJK A;  4UBB A;  4X4R A;  4LZD A;  3MDC A;  5III A;  2BPF A;  5CHG A;  2BCQ A;  9ICC A;  2ZH8 A;  2O1P A;  4FH3 A;  3AQK A;  3PML A;  1MIW A;  4JWN A;  4K4G A;  2O5A A;  4EGW A;  4WC5 A;  3V7K A;  4PGQ A;  8ICI A;  5D62 A;  4Z6C A;  5IIN A;  8ICX A;  5HRH A;  2BCR A;  4QZG A;  4TUR A;  4M9J A;  4I2F A;  8ICW A;  1TFW A;  5CWR A;  2FMQ A;  4KLD A;  3MDA A;  2EWR A;  4YMN A;  1VJ7 A;  5DED A;  5J0R A;  1KNY A;  3CK6 A;  4RPY A;  1YLQ A;  4M9H A;  5HRL A;  3ISD A;  1BPY A;  4P4O A;  2BCS A;  8ICM A;  4NM2 A;  3C5F A;  5DKW A;  4FHY A;  2B4V A;  4WC4 A;  5IIL A;  2ZH6 A;  3JCF A;  2GWS A;  3MCR A;  9ICK A;  5DDM A;  4NXW A;  4X4O A;  4RPZ A;  9ICX A;  1RPL A;  4XQ8 A;  4KM5 A;  5DB9 A;  4M9G A;  1UEV A;  4X4Q A;  4IQV A;  1Q78 A;  4AT7 A;  4WOY A;  5J2F A;  7ICO A;  4I2H A;  4F5Q A;  4WC7 A;  4FO1 A;  4RQ0 A;  3ERC C;  1Q79 A;  1ZQC A;  9ICG A;  2M2V A;  9ICE A;  4TUS A;  4QZH A;  4NLZ A;  4I27 A;  4WC3 A;  4QZ8 A;  3AQL A;  3RH4 A;  4RQ2 A;  4TUP A;  9ICO A;  4RQ5 A;  3PMN A;  4X0B A;  7ICT A;  8ICQ A;  3UPS A;  4K99 A;  4X4V A;  8ICJ A;  8ICR A;  4FHV A;  7ICF A;  4DOA A;  9ICM A;  7ICU A;  3JPN A;  1ZQE A;  5CR0 A;  4MF8 A;  5HRK A;  3AU6 A;  4FHP A;  4E80 A;  4WC1 A;  1TFY A;  5IIO A;  3WFS C;  3OVA A;  4F5P A;  4O68 A;  8ICH A;  2HN2 A;  4M5D A;  4EV6 A;  3AUO A;  1JMS A;  3OWG A;  4JWM A;  1ZQH A;  9ICA A;  1MIY A;  2DR5 A;  9ICU A;  4QZI A;  2P66 A;  1VFG A;  3JPO A;  5D46 A;  3AQM A;  4OAI Z;  9ICR A;  3MBY A;  2FMS A;  4P4P A;  4FO6 A;  2ID1 A;  4DOB A;  4I29 A;  1UEU A;  3GDX A;  4R65 A;  4I2G A;  4O6A A;  1ZQO A;  9ICJ A;  1R8A A;  4KLT A;  8ICT A;  4K9A A;  3JPP A;  4LT6 A;  3C18 A;  5D61 A;  4AT9 B;  1JQR A;  2PFO A;  1ZQZ A;  4RT2 A;  4Z6E A;  4WQK A;  4I2D A;  9ICN A;  5J2D A;  1BPE A;  2ZH1 A;  3TFS A;  2HHP A;  4PHD A;  2B56 A;  4DO9 A;  7ICP A;  1ZQV A;  2ISO A;  4OAF A;  4QZF A;  5J0U A;  4PHE A;  5D49 A;  4GXK A;  1ZQT A;  2DR8 A;  2HN1 A;  1KEJ A;  4K98 A;  4UB2 A;  8ICO A;  1MIV A;  1WOT A;  3V72 A;  4K9B A;  4IQU A;  3MGI A;  1ZQQ A;  5TZV A;  4O67 A;  4WC2 A;  4NXU A;  5J2G A;  4AT8 A;  2PFN A;  4RWP A;  4UB5 A;  2FMP A;  3UQ2 A;  2Q66 A;  7ICG A;  8ICU A;  3OVS A;  3C66 A;  7ICQ A;  5HRI A;  4KLG A;  4KLJ A;  4ATB B;  4EBJ A;  1ZQF A;  2BBH A;  7ICE A;  4K4H A;  7ICS A;  3TFR A;  7ICL A;  4GXJ A;  4Z6F A;  7ICM A;  4HX0 A;  9ICQ A;  1FA0 A;  5DBA A;  4I2B A;  4WQL A;  4XUS A;  5HRF A;  3OUY B;  5HRB A;  3RJI A;  5DB7 A;  4KLF A;  3JZ0 A;  4IQT A;  7ICJ A;  4R64 A;  4I2J A;  1NOM A;  1MQ2 A;  2ZH5 A;  7ICN A;  4LEZ A;  5HC9 A;  2DR9 A;  5J2J A;  8ICK A;  4PHA A;  4YD2 A;  3H3A A;  4QZC A;  3OGU A;  1ZQN A;  4FH5 A;  4LEW A;  1ZQM A;  9ICT A;  4NM1 A;  5J0O A;  3JYY A;  4MKP A;  1ZQA A;  4X5V A;  1ZJN A;  4KLH A; 
#chains in the Genus database with same CATH homology
 5DB8 A;  3H39 A;  2W9M A;  4PH5 A;  9ICF A;  5DBB A;  3HJ4 A;  3C2K A;  2PXI A;  4XQ7 A;  3WFR E;  1TVA A;  4IQW A;  3PNC A;  4UAZ A;  5J29 A;  4PGY A;  4XA5 A;  4EP7 A;  1BPX A;  1ZQX A;  3K75 D;  3C2M A;  4UB4 A;  5J2H A;  4F5R A;  1R89 A;  1RZT A;  3RH6 A;  1BPB A;  1ZQS A;  2M2W A;  9ICW A;  4I2A A;  4PGX A;  9ICH A;  3HX0 A;  4UB1 A;  4NLN A;  2BCU A;  4WC6 A;  5F2V O;  4I2E A;  3H38 A;  2PFQ A;  3RJF A;  4TUQ A;  4NKU A;  4X4U A;  4RQ1 A;  1ZQR A;  4NLK A;  7ICV A;  1HUZ A;  4KLS A;  1OU5 A;  4X4N A;  8ICC A;  4NY8 A;  4QZD A;  8ICE A;  3RJJ A;  4LVS A;  5J0Q A;  4S3N A;  4NKT A;  4P4M A;  5IIK A;  4YN4 A;  5EOZ A;  2ZH2 A;  4PPX A;  3B0Y A;  4YCX A;  9ICI A;  4I28 A;  1XSL A;  1JN3 A;  3HIY A;  3L9D A;  2BPG A;  5HR9 A;  4RQ8 A;  3ISB A;  1BPD A;  2RFF A;  4UD5 A;  5J2I A;  8ICZ A;  5CB1 A;  3JPT A;  5BOM A;  3C2L A;  4M9L A;  4PHP A;  5J0Y A;  4K4I A;  4KLE A;  2ZHA A;  4NXZ A;  4AT9 A;  5HRE A;  4YD1 A;  3AQN A;  3RJE A;  8ICP A;  4M04 A;  3ISC A;  1R8C A;  1ZQI A;  4M2Y A;  5J2A A;  3UQ0 A;  1ZQY A;  4MF2 A;  1XSN A;  2BE3 A;  7ICH A;  4DOC A;  3UXO A;  5HHI A;  5DDY A;  4RPX A;  1UET A;  3WFQ E;  2ZH9 A;  4QZA A;  5J2C A;  3V7L A;  8ICA A;  4UD4 A;  4O5E A;  3LQC B;  4RT3 A;  1ZQK A;  3H37 A;  2ZH7 A;  4IG8 A;  3RJH A;  1ZQD A;  4FHX A;  1XSP A;  4YMO A;  4M0A A;  1ZQG A;  3RJG A;  4FHW A;  1BPZ A;  3NYB A;  2DRB A;  4ATB A;  4RQ6 A;  3MGH A;  4QZ9 A;  1ZQJ A;  7ICI A;  1V4A A;  3HW8 A;  4KLI A;  4KLL A;  3LK9 A;  5J0T A;  3JPQ A;  5D4B A;  4Z6D A;  1R8B A;  8ICL A;  4UB3 A;  4M47 A;  3OUY A;  3HJ1 A;  5J2K A;  7ICR A;  1KDH A;  4WC0 A;  4O5C A;  5CJ7 A;  4O9M A;  1PX5 A;  4KLQ A;  3UXN A;  5IIJ A;  3OVB A;  8ICS A;  4AT7 B;  4MFC A;  9ICP A;  4KLO A;  8ICV A;  5J2E A;  3AU2 A;  1ZQP A;  2PFP A;  3WFO A;  5J0X A;  4P2H A;  5DEC A;  4RQ3 A;  4RQ7 A;  5BPC A;  1HUO A;  5HHH A;  5HRD A;  5CP2 A;  4I2C A;  4UBC A;  1NO5 A;  4QZB A;  3OV7 A;  3B0X A;  4X4P A;  1ZQW A;  4WCW A;  5DBC A;  3JPS A;  4X0A A;  2I9G A;  9ICL A;  4XRH A;  4MFF A;  4KLU A;  4X4T A;  4R63 A;  1TV9 A;  5BOL A;  5J0S A;  4YMM A;  8ICF A;  2BPC A;  2ZHB A;  3C5G A;  8ICY A;  2M2U A;  4MFA A;  4GXI A;  5CA7 A;  5IIM A;  3JPR A;  4RWO A;  2ISP A;  5J0P A;  4WBY A;  5DB6 A;  4X4S A;  4EBK A;  4RWQ A;  4KLM A;  4LZG A;  8ICN A;  2IHM A;  2PBE A;  3UPQ A;  4RQ4 A;  4R66 A;  4E7X A;  3V7J A;  2NRK A;  1ZQL A;  4QZE A;  2ZH4 A;  4F5O A;  4WBZ A;  1ZQU A;  4UAW A;  2DRA A;  2M2T A;  4O5K A;  4F5N A;  9ICB A;  3HWT A;  2DVI A;  3UXP A;  2ZH3 A;  4M9N A;  1ZQB A;  8ICG A;  5J0W A;  2DR7 A;  1MQ3 A;  3WFP A;  5J2B A;  4I2I A;  1ZJM A;  4RWN A;  1JAJ A;  2VAN A;  9ICS A;  8ICB A;  9ICV A;  4UAY A;  4AT8 B;  7ICK A;  1F5A A;  3RH5 A;  4E8F A;  5HRG A;  2BCV A;  3RJK A;  4UBB A;  4X4R A;  4LZD A;  3MDC A;  5III A;  2BPF A;  5CHG A;  2BCQ A;  9ICC A;  2ZH8 A;  2O1P A;  4FH3 A;  3AQK A;  3PML A;  1MIW A;  4JWN A;  4K4G A;  2O5A A;  4WC5 A;  3V7K A;  4PGQ A;  8ICI A;  4Z6C A;  5IIN A;  8ICX A;  5HRH A;  2BCR A;  4QZG A;  4TUR A;  4M9J A;  4I2F A;  8ICW A;  1TFW A;  5CWR A;  2FMQ A;  4KLD A;  3MDA A;  4YMN A;  1VJ7 A;  5DED A;  5J0R A;  1KNY A;  4RPY A;  1YLQ A;  4M9H A;  5HRL A;  3ISD A;  1BPY A;  4P4O A;  2BCS A;  8ICM A;  4NM2 A;  3C5F A;  5DKW A;  4FHY A;  4WC4 A;  5IIL A;  2ZH6 A;  2GWS A;  9ICK A;  5DDM A;  4X4O A;  4RPZ A;  9ICX A;  1RPL A;  4XQ8 A;  5DB9 A;  4M9G A;  1UEV A;  4X4Q A;  4IQV A;  1Q78 A;  4AT7 A;  5J2F A;  7ICO A;  4I2H A;  4F5Q A;  4WC7 A;  4RQ0 A;  1Q79 A;  1ZQC A;  9ICG A;  2M2V A;  9ICE A;  4TUS A;  4QZH A;  4NLZ A;  4I27 A;  4WC3 A;  4QZ8 A;  3AQL A;  3RH4 A;  4RQ2 A;  4TUP A;  9ICO A;  4RQ5 A;  3PMN A;  4X0B A;  7ICT A;  8ICQ A;  3UPS A;  4X4V A;  8ICJ A;  8ICR A;  4FHV A;  7ICF A;  4DOA A;  9ICM A;  7ICU A;  3JPN A;  1ZQE A;  5CR0 A;  4MF8 A;  5HRK A;  3AU6 A;  4FHP A;  4E80 A;  4WC1 A;  1TFY A;  5IIO A;  3WFS C;  3OVA A;  4F5P A;  8ICH A;  4M5D A;  3AUO A;  1JMS A;  4JWM A;  1ZQH A;  9ICA A;  1MIY A;  2DR5 A;  9ICU A;  4QZI A;  2P66 A;  1VFG A;  3JPO A;  5D46 A;  3AQM A;  9ICR A;  3MBY A;  2FMS A;  4P4P A;  4FO6 A;  2ID1 A;  4DOB A;  4I29 A;  1UEU A;  3GDX A;  4R65 A;  4I2G A;  1ZQO A;  9ICJ A;  1R8A A;  4KLT A;  8ICT A;  3JPP A;  4LT6 A;  3C18 A;  4AT9 B;  1JQR A;  2PFO A;  1ZQZ A;  4RT2 A;  4Z6E A;  4I2D A;  9ICN A;  5J2D A;  1BPE A;  2ZH1 A;  3TFS A;  2HHP A;  4PHD A;  4DO9 A;  7ICP A;  1ZQV A;  2ISO A;  4QZF A;  5J0U A;  4PHE A;  5D49 A;  4GXK A;  1ZQT A;  2DR8 A;  1KEJ A;  4UB2 A;  8ICO A;  1MIV A;  1WOT A;  3V72 A;  4IQU A;  3MGI A;  1ZQQ A;  5TZV A;  4WC2 A;  4AT8 A;  5J2G A;  2PFN A;  4RWP A;  4UB5 A;  2FMP A;  3UQ2 A;  2Q66 A;  7ICG A;  8ICU A;  3OVS A;  3C66 A;  7ICQ A;  5HRI A;  4KLG A;  4KLJ A;  4ATB B;  4EBJ A;  1ZQF A;  7ICE A;  4K4H A;  7ICS A;  3TFR A;  7ICL A;  4GXJ A;  4Z6F A;  7ICM A;  9ICQ A;  1FA0 A;  5DBA A;  4I2B A;  4XUS A;  5HRF A;  3OUY B;  5HRB A;  3RJI A;  5DB7 A;  4KLF A;  3JZ0 A;  4IQT A;  7ICJ A;  4R64 A;  4I2J A;  1NOM A;  1MQ2 A;  2ZH5 A;  7ICN A;  5HC9 A;  2DR9 A;  5J2J A;  8ICK A;  4PHA A;  4YD2 A;  3H3A A;  4QZC A;  3OGU A;  1ZQN A;  4FH5 A;  1ZQM A;  9ICT A;  4NM1 A;  5J0O A;  3JYY A;  1ZQA A;  4X5V A;  1ZJN A;  4KLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...