5HHHA

Structure of human dna polymerase beta host-guest complexed with the control g for n7-cbz-platination
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
327
structure length
325
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Synthesis, structure, and biological evaluation of a platinum-carbazole conjugate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 111
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5hhhA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5hhhA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hhhA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hhhA03
1ZQAA 3PW4A 1T3NA 3N97B 4KLIA 4WC4A 2Y1JA 4GXKA 4F5OA 4I2CA 4M9NA 2HVHA 2HW3A 2HVIA 4GLXA 3LWMA 4UB5A 4DO9A 2XGPA 5DG7A 1U48A 5HHIA 4M9GA 3MDCA 3GIJA 4DFKA 3C18A 1ZYQA 4M47A 1TV9A 2PXIA 8ICAA 4RQ1A 2BQ3A 1KLNA 3MABA 1V9PA 3JPSA 1S77D 3Q8KA 1JAJA 3KHGA 4AT8B 3GV7B 5KT3A 2ZH2A 9ICJA 8ICIA 3MR5A 5J2IA 4UQGA 4F4XA 2C28A 4R66A 2AGQA 3ISDA 2IMWP 3G6VA 4DFJA 4ECVA 3PMLA 3TANA 1A76A 2VANA 4UBCA 3QEBZ 1DGSA 3EPGA 3C2MA 7ICRA 4WCWA 4XQ8A 1NK8A 2FLLA 1ZETA 5KFAA 4ECSA 4PH5A 5DQIA 5IINA 2AU0A 4EBKA 3RH5A 2V9WA 1TKDA 1Q79A 4G3IA 3C23A 3K4GA 4E8FA 4KN4A 1BPEA 4J9RA 5J0XA 3PW7A 5HRFA 4UB1A 3GIKA 4J9NA 4YN4A 1XU4A 2ZUDA 5DB7A 3MR2A 3THVA 2AGPA 1ZQVA 3Q8LA 1S9FA 3OSPA 3RJEA 2HHTA 8ICNA 5HHHA 9ICSA 1NZPA 5HNKA 4NKUA 3E2EA 4EBDA 1ZQTA 4MF2A 7ICLA 4AT9A 4LT6A 1MC8A 1WOTA 4ECYA 2AQ0A 2FPMA 5KFGA 4TQSA 3OGUA 3QEAZ 2C22A 1UEUA 2Q66A 4I2HA 4M2YA 4YCXA 2ZH9A 1ZQBA 3H8JA 2W9CB 1ZQHA 3PV8A 4I2EA 3OVSA 3OUYB 2HHQA 1L5UA 1UA0A 2BCUA 2HHVA 1MQ2A 4O5CA 3KHRA 4RT3A 4X4QA 1RZTA 4KLQA 3LDAA 4O3RA 4ED3A 1MSWD 5DLGA 2BPFA 4DSEA 1TFRA 2W8KA 2ISOA 1NOMA 4RNNA 4F5NA 3RAXA 3H7IA 3RBEA 4Q43A 2XGQA 3G6YA 4QZ9A 3TQ1A 4RQ3A 4EBEA 4BDPA 1ZQPA 4GC6A 3RB3A 1R8CA 2J6SA 1HJPA 3RB6A 5KFPA 3UQ0A 2BGWA 2ZH8A 5KFEA 1HUZA 7ICMA 9ICEA 5KFLA 2BCVA 2DRAA 5L1LA 3QE9Y 1ZQQA 5L1IA 2KN7A 4Z6FA 3FYHA 4E7XA 9ICTA 2A1JA 3GFKB 4YD2A 4M04A 4ED1A 4JV1A 2MUTB 4F4KA 3L9DA 5J2HA 1PX5A 5DBBA 3QZ8A 3WFSC 4RQ8A 2UVUA 4PHPA 4NM1A 8ICOA 2FPLA 3BQ1A 4WBZA 5KG0A 2BCSA 3ZDDA 8ICEA 4NLNA 1BVSA 3RH4A 1ZQDA 2F1JA 8ICLA 3PR4A 2DRBA 5DDYA 4FBTA 4R8UB 1ZQCA 3PVXA 2ZH5A 3RRHA 5HRGA 1L3UA 3OV7A 1ZQLA 3PX0A 4QWCA 2KFZA 1D8LA 4EBCA 5F9NA 5J2AA 5DB9A 4PHDA 4ECQA 4UD4A 5KFYA 3NTUA 2DR9A 3N4MB 1Z00A 3OVAA 1DOQA 5KT7A 3EYZA 4DS5A 2DFLA 1TK0A 3PW0A 4DSFA 4KLTA 4DL7A 4X4TA 5EOZA 3GIMA 4C8MA 4PGQA 4J9KA 3TAPA 2J6UA 2KTQA 4GXJA 3M9OB 1KRPA 9ICHA 8ICKA 1T4GA 3C21A 2W9MA 3V72A 4I2GA 2BCRA 4DOCA 5J2JA 4TURA 4M9LA 3GV5B 2FMSA 5HRLA 4Q8EA 3ETLA 3G6XA 1SL0A 1JMSA 1ZQKA 3LWLA 1ZQGA 4IQUA 4QZEA 4ECWA 4I2FA 3AQKA 2ZH6A 4GC7A 3EWAA 7ICVA 5KG3A 5KT6A 4EZ9A 9ICAA 2PBEA 4O0IA 2ZUCA 4ED7A 4MFFA 4UB2A 4FH5A 1NK6A 4ECXA 1U4BA 1ZQZA 1NKEA 1S0VA 3V7LA 3RTVA 8ICVA 1TK8A 5IIOA 4DQRA 1CEZA 4DOAA 3H38A 3V7JA 3C5FA 7ICOA 2UVRA 1JQRA 5KG4A 2ZUBA 4RZRA 2R8IA 9ICBA 5DQHA 7ICPA 4J9MA 2GWSA 2LYHA 1VFGA 3NYBA 4YXMA 4X4UA 7ICKA 3BJYA 1XS9D 7ICJA 3ZD8A 4DQQA 3NGDA 2HHUA 4X4PA 4UAYA 4Z6CA 4I2DA 4JK1A 5DQGA 1L3TA 1ZJNA 1XC9A 1ZQOA 1RYRA 2HHSA 8ICYA 3WFOA 2PFNA 1IXRA 3GV8B 2W9AA 4J9PA 1D9DA 4QWAA 4EZ6A 4XQ7A 3H3AA 2VA8A 4DSIA 2FLPA 2KZMA 9ICRA 1B22A 2VA3A 3IM1A 3ISBA 3V6KA 1S10A 2BCQA 4PHAA 3SI8A 4QW9A 3LQCB 4P4PA 5J29A 5KG2A 4Q45A 1SKSA 4IQWA 3GILA 4ECTA 1ZJMA 3C5GA 1UA1A 1NK9A 1PZNA 3B0YA 5CR0A 2B21A 3PR5B 4ED0A 3Q8PB 4DSJA 1AROP 1KTQA 4I2BA 2ZH4A 4B9UA 4QWBA 4RNOA 1JXEA 5KFCA 3RB0A 2PFPA 9ICIA 3OJUA 1TAQA 5J0QA 4X0AA 1JIHA 3GIIA 4C8KA 5HMLA 2NRXA 4NLGA 3UXPA 2M2UA 5EWEA 5KG7A 1DK3A 2W9CA 4KTQA 5KFIA 4O3QA 5HMMA 7ICUA 1R8BA 5CB1A 5HREA 3OUYA 4MEYA 4DWIA 9ICQA 9ICCA 3LK9A 2NRVA 8ICJA 4WC5A 4I29A 4MEXA 3EZ5A 2HHPA 1U49A 4RQ5A 4B9LA 4S3NA 2ZH7A 1K1SA 3OSNA 2KP7A 2RDJA 5DKWA 2HHWA 4DL6A 2AJQA 3HJ1A 5BOMA 1D8YA 1KFSA 5HRHA 4RWOA 3MFHA 2ZHAA 5KFQA 4QZAA 3HIYA 5KFBA 3KHLA 4IRKA 1EXNA 2PFOA 4P2HA 4FHYA 2F1IA 4UAZA 1QSYA 4WC2A 4XUSA 9ICOA 3AQLA 4FS1A 3BQTA 9ICNA 1SKWA 2RDIA 4WC0A 2Q0ZX 2MUTA 2V4QA 1TK5A 4X4VA 2R8KA 3KHHA 4M0AA 4KLFA 7ICIA 2ASDA 3MGHA 1NKBA 1FA0A 1ZQJA 2OWOA 2DPIA 8ICBA 3UPSA 2XCPA 2RFFA 4X4SA 4C8NA 2ZJAA 4NXZA 4QZIA 4O3OA 4QZHA 4RQ6A 3UQ2A 3V6HA 2XY7A 4KLUA 2ASJA 4F2SA 1RPLA 4RQ4A 4R8UA 3AQNA 3OJSA 1BGXT 4O5EA 4TUQA 1R89A 2PI4A 4I2AA 1SZPA 3H8WA 2WTFA 3RJGA 1XSLA 5DEDA 2ZH1A 3ORYA 4PHEA 5J2BA 9ICWA 4DS4A 5KFSA 5DB8A 1TFWA 4DQPA 2IBKA 4K4IA 3SV4A 5DGAA 2DVIA 5IIJA 4NLKA 3JPQA 1R8AA 3H39A 2JEFA 4M5DA 2AQ4A 5HRBA 9ICLA 4I2IA 2FLNA 4ELVA 2NRWA 3H8SA 1CUKA 4X4OA 1ZQMA 1KSPA 4O3PA 1N56A 4RUCA 4B9NA 1ZQIA 3KTQA 2M2TA 2H5XA 2M9NA 3EPIA 3T5HA 3H37A 4M9HA 3EW9A 4WBYA 4EYHB 5F9LA 1L3VA 4YMNA 3Q8RB 4J9LA 1RYSA 5L9XA 4YVZA 4F50A 1LB2B 3RR8A 9ICMA 2M2VA 4DL3A 1BPZA 9ICGA 5EWFA 2ALZA 1D9FA 7ICNA 5J2KA 3V7KA 4XRHA 8ICWA 4F4WA 3OHAA 2FPKA 5D4BA 5CWRA 2ZH3A 3RH6A 2V4RA 4Z6DA 4TUSA 3PO5A 1A77A 4O5KA 2XCAA 3RJFA 1QTMA 1JN3A 4RWQA 5CJ7A 4WC7A 4RPXA 4F5PA 2P6RA 1X2IA 4FHVA 8ICFA 2PFQA 5KFWA 4F3OA 2C2DA 4MFAA 4KLSA 1NO5A 4P4OA 4JV2A 3TAQA 3T5KA 5KG5A 1B43A 3MFIA 5KFXA 5J0UA 1L3SA 1UT5A 3HP6A 2M2WA 4QWDA 1SL1A 3H4DA 4F5QA 2ZTDA 4O3NA 8ICTA 2NRKA 3WFPA 2AGOA 3UPQA 1Z3EB 4O3SA 4MF8A 4M9JA 7ICFA 4FHPA 4QZCA 3T3FA 4ATBB 1BPXA 3H4BA 2ZJ5A 4JUZA 4DSLA 1Q78A 4R64A 4KLEA 4IR1A 1YLQA 3H40A 3BQ2A 2XY6A 5KFMA 5DBAA 3TI0A 3RR7A 3RJJA 4B9VA 8ICHA 5CP2A 4WC1A 5DG8A 3HT3A 2KZ3A 3C1ZA 2BDPA 4KLGA 3JPNA 4F4ZA 4FHXA 4RT2A 1NK7A 4ED8A 3QZ7A 3V6JA 4BWMA 4X4RA 4B9MA 1ZQXA 4DEZA 2W8LA 5DBCA 1NK0A 1F5AA 4UAWA 3TFRA 4RPZA 4DL5A 1N48A 7ICTA 3ZD9A 2JEIA 4RUAA 4RWPA 5KG6A 4PGYA 1JXLA 4RQ2A 4UB3A 4IR9A 7ICHA 1KDHA 2DR7A 4QZGA 3PW5A 1TVAA 1MQ3A 1Y88A 3PNCA 1ZQRA 5IIMA 5HR9A 1QSLA 5HRKA 4C8OA 3TFSA 1MIYA 1TFYA 5KFRA 4EP7A 5CHGA 8ICGA 4FO6A 4FBUA 2F1HA 2XC9A 3RB4A 4BXOB 8ICPA 4IG8A 3SYZA 3HPOA 4B9TA 4GXIA 4UBBA 2BQRA 3MBYA 2O5AA 1UT8A 3WFRE 2Y1IA 1WCLA 4IQVA 1NJWA 1DK2A 4ECUA 1S0MA 3MR6A 4PPXA 5KTQA 3RAQA 3C2LA 7ICSA 2ZTCA 1OU5A 3ISCA 1V4AA 4YR2A 2P66A 3HX0A 3RJIA 4QZFA 4YR3A 3MGIA 4TQRA 5KFNA 1BPBA 5KFVA 4F91B 3HWTA 2NRTA 4JV0A 3GQCA 4F4YA 3AU6A 5KFJA 3Q8MA 1NK4A 3HJ4A 4FS2A 2FMPA 2C2EA 9ICXA 3M8SA 4QWEA 3RJHA 3UXOA 3ZDCA 2IHMA 2P6UA 4XA5A 3SV3A 4RQ7A 5IIIA 1ZQNA 1KNYA 4YXJA 3BDPA 5HRDA 5CA7A 4DQSA 3T5JA 5KFFA 4RU9A 1U45A 1XSNA 4FHWA 1UETA 3M9NB 4M6WA 5C5JA 5J0YA 3PX4A 3OVBA 4PGXA 1NJYA 5IIKA 4YP3A 1NJZA 1U9LA 2XO7A 4F2RA 1X9MA 4ELUA 2HHXA 2ISPA 4K4GA 2BPGA 1S76D 5J0TA 2ATLA 1BPDA 3MR3A 4DLGA 4LVSA 3UXNA 5KFHA 5L1KA 3PX6A 2C2RA 2VA2A 3ZDBA 5J0RA 1T8EA 4NLZA 3ZDAA 2KFNA 4QZDA 4E80A 3SZ2A 1ZQYA 4J9SA 4C8LA 1SKRA 2KZZA 4F93B 1T7PA 8ICRA 4DOBA 1ZQWA 1LV5A 4MFCA 5J0SA 1RXVA 8ICQA 4FH3A 3RRGA 2BKEA 3C1YA 1KFDA 3AU2A 1NKCA 9ICUA 1MIWA 4RWNA 1S0NA 2NRZA 4M6WB 2JEJA 2O1PA 4Q44A 4KMUA 4KLOA 7ICGA 4DSKA 4DF4A 4WC6A 4TUPA 5J2EA 2JZBA 4K4HA 4KLDA 4KLLA 1TAUA 2ZJ8A 1VJ7A 3PO4A 4R65A 2ID1A 1XSPA 4ED6A 2DPJA 3K75D 4JWMA 5KFTA 5J2FA 4J9QA 1ZQSA 4EBJA 5DB6A 1U47A 5J2DA 1SL2A 4IQTA 4DL4A 3IHQB 4NM2A 5J2GA 1X9WA 4R63A 1ZQFA 4F8RA 1IM4A 2MAXA 4X4NA 2R8JA 1ZQUA 1S0OA 1XO1A 7ICEA 8ICXA 5KG1A 9ICPA 2DR8A 4YR0A 5D49A 3M8RA 2BQUA 2XY5A 4QZBA 4NY8A 4NKTA 3ZDEA 1RXWA 1ZQEA 4AT9B 4DQIA 4I27A 5J0OA 1S97A 1C7YA 4LZGA 2IA6A 3PMNA 1KEJA 2UVVA 4ATBA 4ED2A 2JZBB 4UB4A 4Z6EA 3PW2A 4X5VA 1NK5A 1X9SA 1BNOA 5DLFA 3BQ0A 4AT7A 4ECRA 3HW8A 8ICCA 4RPYA 3Q8SB 3WFQE 3GDXA 5JUMA 2W9BA 4J9OA 3PY8A 2BPCA 4UD5A 4DL2A 2BHNA 4BGDA 5J2CA 8ICZA 3TARA 5BOLA 4EEYA 2BR0A 4DF8A 5F2VO 4WC3A 5L1JA 5J0PA 5KFKA 4KLMA 1NJXA 5KFZA 8ICMA 7ICQA 2BE3A 3JPPA 5HC9A 3MDAA 2R8HA 1K1QA 2PI5A 2I9GA 3AQMA 4B9SA 4F5RA 5KT5A 4Q8FA 9ICFA 5J0WA 5DDMA 4DLEA 4DFPA 5DG9A 3FDSA 3B0XA 4AT7B 2A1JB 4ECZA 5KT2A 3JPRA 9ICVA 2UVWA 1HUOA 5KFUA 1QSSA 4RQ0A 3Q8QB 4KLJA 2I1QA 4IRCA 2J6TA 2IHNA 2W9BB 8ICUA 4O9MA 4LZDA 3C66A 4ZH4A 5HP4A 3T5LA 4QW8A 4X0BA 5KFOA 4YMMA 4BXOA 2ASLA 5DECA 3RJKA 1H38A 4I2JA 4EYIB 2ZTEA 3JPTA 1COOA 1XWLA 4RNMA 3M9MB 5EWGA 4CCHA 4QZ8A 5D46A 1BNPA 4DFMA 4IRDA 2FMQA 3JYYA 2JEGA 4YG2A 4BWJA 1Z00B 3RBDA 2DR5A 3JPOA 4P4MA 4E0DA 1BPYA 1KFTA 5IILA 4HYKA 1JX4A 4KLHA 3JZ0A 8ICSA 3AUOA 4KITB 5TZVA 3OHBA 4AT8A 2ZHBA 1WCNA 2R8GA 1QLNA 5KFDA 5DGBA 4YD1A 3C2KA 4ELTA 4YMOA 4F92B 4I28A 5HRIA 5KT4A 4KN7A 5BPCA 1MIVA 1UEVA 4YFKA 4YQWA 9ICKA 4JWNA
chains in the Genus database with same CATH superfamily
5J8YA 4M9NA 1ED1A 1F0MA 5DG7A 1WG8A 3MDCA 2PXIA 4RQ1A 1KLNA 1V9PA 1JAJA 4UB6U 3GV7B 1SXEA 2C28A 4R66A 3ISDA 4DFJA 1DGSA 1SIJA 4WCWA 5KFAA 5ALRA 4PH5A 5DQIA 2V9WA 3C23A 3QUQA 4FZLA 3D2QA 5J0XA 3F2DA 3NASA 3PW7A 5HRFA 2ZUDA 2LYAA 3HJEA 1S9FA 3OSPA 3RJEA 2HHTA 7ICLA 1MC8A 2KSOB 1WOTA 4ECYA 4WQKA 3PSFA 1RDFA 3OGUA 4I2HA 1XNSA 1L5UA 2BCUA 3KHRA 1IIPA 5E79U 1NOMA 4F5NA 3F2BA 4Q43A 4O69A 3G6YA 2G0AA 4BDPA 3RB3A 1HJPA 3L4PA 5KFEA 2DRAA 2KVSA 3QE9Y 2HN1A 1GPJA 3CRXA 2A1JA 4M04A 4ED1A 3L9DA 3ETRA 5ALQA 4US9A 2KOBA 2UVUA 2H3FA 5T14A 1JUDA 1ZRMA 3PVXA 1OW5A 3RRHA 1V38A 5HR6A 1ZQLA 3PX0A 4QWCA 2W03A 5F9NA 4UD4A 4PHDA 3N4MB 2ZIVA 2DFLA 2LYBA 4DL7A 4X4TA 5EOZA 2J6UA 2BDUA 4J9KA 8ICKA 1Q3UA 2FMSA 3G6XA 1SL0A 3LWLA 3AQEA 2YMPA 4QZEA 4ECWA 3AQKA 2ZH6A 5ALPA 4O0IA 1LKYB 1NK6A 2KICA 1FO4A 3RTVA 8ICVA 5IIOA 3IN5A 3C5FA 4OAHA 2H3VA 3NYBA 4X4UA 4UARA 2PKEA 4U6PA 4X4PA 1JRPA 3QU7A 4Z6CA 1L3TA 5DQGA 3ICXA 1ZQOA 3SAGA 3K1ZA 2KNJA 1IXRA 3OTQA 2ES6A 3H3AA 2VA8A 1B22A 4Y2QA 1QH9A 2VA3A 2DGZA 3ISBA 2BCQA 5J29A 1N60A 4Q45A 1SKSA 2MSNA 3QUTA 2OH2A 4I2BA 1DXSA 3B0YA 3QX7A 4B9UA 2Y0SC 5EE0A 5KFCA 5AI4A 9ICIA 2EANA 1P7DA 2E8MA 3WKAA 4C8KA 2NRXA 5EWEA 5KG7A 5AK3A 1DK3A 7ICUA 5HMMA 1R8BA 5AM0A 5AM1A 1YZ6A 5B66U 3N28A 4I29A 4MEXA 2ZH7A 1U49A 4RQ5A 2KP7A 1RQLA 2DQNB 2RDJA 5BOMA 1HIWA 3LVVA 3KHLA 2PFOA 4FHYA 1QSYA 4O6AA 3AQLA 9ICOA 5ALJA 5AK6A 3KKAC 2V4QA 3ONNA 1J97A 1TK5A 4KLFA 2DPIA 3UPSA 4X4SA 4NXZA 3V6HA 4KLUA 4NXXA 1RPLA 4RQ4A 3QU9A 3QXGA 4O5EA 3SD7A 1R89A 4I2AA 1SZPA 2QLTA 3AM9A 5DEDA 2ZH1A 5ALWA 5ALHA 4DS4A 2EH9A 5DB8A 3CK6A 4K4IA 3SV4A 2DVIA 2JEFA 2KMDA 4X4OA 2E5SA 4O3PA 2LMRA 2GAFD 3QUBA 2F8LA 3EW9A 3N7PD 5F9LA 3RR8A 4J9LA 4F50A 3SR6A 9ICGA 1D9FA 4OJ6A 2OEHA 2FPKA 5D4BA 1VDVA 2O6KA 5CWRA 3RH6A 1RYUA 3RJFA 4RWQA 4ZOHC 1S5LU 4F3OA 3WK5A 4P4OA 1PK1A 1PVRA 2M0NA 1B43A 3TADA 4CF4A 3MFIA 5KG5A 3HP6A 1PUZA 2ZTDA 4WOYA 2AGOA 4MF8A 4FHPA 3T3FA 2ZJ5A 4JUZA 4DSLA 5CFUA 4R64A 3CYMA 3BQ2A 5AKZA 3N7RC 5KFMA 5DBAA 3RJJA 3RF9A 1D8BA 4KLGA 2BDPA 5AKLA 3V6JA 4BWMA 5JTIA 4UASA 1NK0A 3TFRA 1N48A 7ICTA 2XICA 5KG6A 7ICHA 4QZGA 1MQ3A 1Y88A 3PSTA 1ZQRA 2D3DA 1MIYA 4FO6A 3UM9A 2A1AA 4PZOA 4K8VA 4B9TA 2Y1IA 4PPXA 4EEDA 7ICSA 1OU5A 3HWTA 4YR3A 3MGIA 5KFVA 4F91B 3AL0B 1JI7A 4QWEA 1Q8KA 2EWRA 4RQ7A 3NVZA 3BDPA 5HRDA 5CA7A 4RU9A 5D61A 1UETA 4Y2RA 5J0YA 3OVBA 4PGXA 1NJYA 1NJZA 1U9LA 1X9MA 2ISPA 2GO7A 2BPGA 4K4GA 3MR3A 2JR5A 3CP8A 4LVSA 3PZPA 2VA2A 5EE1A 5ALTA 5J0RA 2WFAA 2DF4B 4NLZA 8ICRA 4F93B 4FH3A 5AM4A 3C1YA 5AKGA 3AU2A 5JTGA 3ED5A 4M6WB 2JEJA 4KMUA 5AM3A 4BUGA 4DSKA 2H3ZA 4WC6A 2JZBA 5G5HA 5KFTA 5J2FA 1ZQSA 2W04A 2BBHA 5J2GA 4R63A 2JHDA 2ZIWA 5ALEA 2MAXA 2QB1A 5KG1A 2RHFA 3H0MB 3M8RA 4OAIZ 4QZBA 1LVHA 1RXWA 4I27A 1C7YA 2WF6A 4ED2A 3HW8A 3Q8SB 2HBJA 2W9BA 4IS7A 5C0YA 1FIQA 5F2VO 1L7NA 5L1JA 5KFKA 3JPPA 2R8HA 1K1QA 4F5RA 4Q8FA 5DDMA 2JH1A 3FDSA 3C29A 3OWGA 1QQ7A 2KHQA 3JPRA 9ICVA 4KLJA 2I1QA 4C4RA 2B51A 8ICUA 1L8LA 3VCBA 5HP4A 3T5LA 4QW8A 4WQLA 5DECA 5AKIA 2G5IB 1VLBA 4OJPA 3JPTA 5EWGA 2ZIXB 4IRDA 2QARB 3BZKA 4YG2A 1Z00B 2DR5A 1KFTA 5IILA 4KLHA 4KITB 1FFVA 1WCNA 4K98A 4QNLA 1Z1VA 4KN7A 5BPCA 3M7DA 3LWMA 4YFKA 1T3NA 2Y1JA 4GXKA 4F5OA 2HVHA 3IG5A 2XGPA 4KB6A 1U48A 3C18A 1KKXA 4PJ0U 1CI4A 2GA9D 2ZH2A 2AXTU 3MR5A 4F4XA 2AGQA 3G6VA 3TANA 2K4EA 1A76A 7ICRA 5CHEA 5IINA 2AU0A 2VIXA 3RH5A 4LEWA 4G3IA 3H0LB 3VC8A 3BS5B 4J9RA 3CNHA 4J9NA 4YN4A 1XU4A 2AGPA 1ZQVA 3Q8LA 9ICSA 1NZPA 5HNKA 4K96A 3E2EA 3NVYA 4AT9A 1UEUA 5KFGA 2C22A 4YCXA 1F44A 1ZQBA 2FJ6A 3H8JA 4RQNA 1SGGA 1UA0A 2HHVA 1RZTA 3LDAA 2YMQA 4MHVA 2W8KA 2ISOA 4RNNA 3H7IA 4RQ3A 1O03A 1MN8A 2HMXA 2JXJA 2PMZF 2J6SA 3UQ0A 2ZH8A 1M6YA 4OJ5A 1HUZA 4EX7A 2DUYA 2HOIA 4P0QA 9ICEA 1XO0A 4E7XA 2MUTB 5J2HA 1PX5A 5DBBA 3KBBA 4RQ8A 4WBZA 2BCSA 3QNMA 8ICEA 4NLNA 4Y2XA 8ICLA 3FC4A 4AP9A 4FBTA 2ZH5A 5HRGA 2MRLA 4OJOA 4ECQA 2B0CA 3CW2C 1DOQA 3EYZA 1TK0A 4KLTA 4C8MA 2KTQA 4GXJA 3M9OB 1T4GA 3C21A 2BCRA 2K89A 2W7OA 4Q8EA 3SMVA 3NUQA 1ZQKA 4Y2UA 4I2FA 2ZUCA 4NXUA 4UB2A 3D6JA 3I1YA 1L7PA 1ZQZA 4JLZA 1CEZA 4DCCA 4DQRA 2ZUBA 2R8IA 4J9MA 4FO1A 5ALKA 2W43A 1VFGA 3BJYA 1XS9D 2W3SA 3NGDA 2LM4A 2HHUA 3F5EA 4JK1A 4FZNA 1ZJNA 1RYRA 3LVWA 3WFOA 4EZ6A 5KL8B 2LKYA 4DSIA 5D63A 4IL6U 4PHAA 2MA1A 3LQCB 3C5GA 1NK9A 3PR5B 1AROP 1JXEA 3RB0A 3OJUA 3KFUF 4B6JA 3O0FA 2W9CA 4NWIA 3OUYA 4DWIA 5ALNA 2P35A 2NRVA 3LK9A 8ICJA 5ALIA 5ALLA 4B9LA 3A0BU 5DKWA 3HJ1A 1D8YA 2ZHAA 3PSIA 1EXNA 3WK7A 5ALSA 5AHXA 4WC2A 2K8BB 4FS1A 9ICNA 5B3PA 2Q0ZX 5KL1B 3WK8A 7ICIA 5AK4A 8ICBA 2RP5A 2WB1F 2OXOA 2JH7A 2ZJAA 3KKAA 4RQ6A 2W54A 2CRXA 4F2SA 4R8UA 3OJSA 3L3FX 2PI4A 3DEEA 3HKZF 2WTFA 2W55A 1XSLA 9ICWA 5KFSA 1N61A 4NLKA 3JPQA 1R8AA 2OHFA 4M5DA 2AQ4A 5ALUA 2K4IA 3MC1A 4OCZA 1ZQMA 1N56A 4RUCA 2M2TA 3EPIA 5ALGA 2F2AB 4YMNA 1RYSA 5L9XA 5J2KA 3V7KA 4F4WA 2ZH3A 4TUSA 3PO5A 5F3XB 1A77A 4O5KA 2XCAA 2NO4A 1QTMA 1K5OA 2QB0B 4RPXA 2P6RA 5ALZA 4LEVA 3AQFA 5G5GA 2C2DA 4KLSA 3T5KA 1L7OA 1URJA 1UT5A 2M2WA 4QWDA 3WKBA 4O3NA 2KG5A 4O3SA 2EQYA 4M9JA 1BPXA 2LM1A 4KLEA 1YLQA 3TACB 3WFPA 2GOLA 5CP2A 1ZD3A 2HDOA 2JRZA 3BS7A 4HX0A 1KW4A 3QZ7A 2HBMA 1ZQXA 2G08A 5DBCA 4UAWA 3E0FA 4RPZA 3B9JA 3ZD9A 1KBUA 4RUAA 2DR7A 2HSZA 1ZD4A 3PW5A 3PNCA 3MGVA 3HRDD 1QSLA 5KFRA 5AK5A 1Q3VA 8ICPA 1N62A 2F44A 4GXIA 3MBYA 1WCLA 1X6JA 3C2LA 2ZTCA 5KAFU 3ISCA 4YR2A 3RJIA 1JALA 4BX9C 3NKUA 4FS2A 3M8SA 3UXOA 3SV3A 3BQ7A 4YXJA 2E1FA 1XSNA 4M6WA 2L5YA 5IIKA 4YP3A 2YTUA 3H8MA 4XJEA 1L7MA 2RLTA 5J0TA 2JMGA 4DLGA 2K4PA 2C2RA 3ZDBA 5B3QA 2NO5A 5J0SA 4Y2JA 1RXVA 1O08A 1NKCA 1MIWA 2NRZA 2WAQF 4CF3A 4Q44A 4TUPA 3IG8A 2IOFK 4NV0A 1VJ7A 4R65A 4GFJA 2DPJA 3K75D 4EBJA 5DB6A 1U47A 1B0XA 4IQTA 1X9WA 4F8RA 2KJ9A 1IM4A 7ICEA 1ZQUA 5ALVA 1XO1A 5K4LA 9ICPA 2EZYA 2XY5A 2OM6A 4UB8U 1ZQEA 5AM5A 3K7DA 3PMNA 3L5KA 4ATBA 1BNOA 5DLFA 4ECRA 2ZIUB 4RPYA 4J9OA 4O3MA 3PY8A 4DL2A 4MKPA 1VJ5A 4DF8A 2BZFA 5KFZA 3MDAA 4OJLA 2PI5A 2I9GA 9ICFA 4IC9A 3F2CA 4DFPA 3B0XA 4AT7B 2A1JB 4ECZA 5KT2A 2B4VA 2UVWA 4Y2SA 2E1EA 3C66A 4C4SA 4I2JA 4EYIB 2ZTEA 1COOA 4RNMA 1Z1BA 2KKVA 5EE3A 4CCHA 2F8KA 4QZ8A 4DFMA 5H2FU 2FMQA 3JYYA 1T94A 4C4TA 1N5WA 3NRZA 2ZIVB 4P4MA 4E0DA 1DGJA 4HYKA 1JX4A 3JZ0A 2D8CA 4C7ZA 2R8GA 1QLNA 4JMUA 1SZHA 3IV6A 2KK0A 3M6KA 4NJ8A 2YN4A 4CDGA 2OYYA 2XIDA 4BXOB 9ICKA 4JWNA 3BZCA 1ZQAA 3PW4A 4KLIA 4I2CA 2HW3A 2HVIA 1B4FA 1ZXIA 4M9GA 4DFKA 3GIJA 4M47A 4EEKA 2HOQA 3BS5A 8ICAA 1C20A 5FP0A 3MABA 3JPSA 3KHGA 9ICJA 8ICIA 5J2IA 4UQGA 1QQ5A 3PMLA 1IV8A 2VANA 3QEBZ 3EPGA 3C2MA 3DDHA 1NK8A 2FLLA 2ZXHA 4EBKA 5JRTA 5AKEA 5L1MA 2QKQA 1Q79A 1N2XA 4KN4A 4PZNA 4UB1A 2YX8A 5DB7A 3T79A 1T3QA 8ICNA 4NKUA 3NVVA 1SV4A 5HHHA 2G06A 4EBDA 4MF2A 3KOOA 4Y2YA 2WF8A 5AI6A 2Q66A 4M2YA 3PV8A 4I2EA 2KKPA 2NV3A 2W7PA 4O5CA 3H0RB 4X4QA 4KLQA 4N7RA 4O3RA 4ED3A 1PVQA 1V85A 5DLGA 2MU2A 1S8OA 1SB3C 3TQ1A 4AYBF 2VJ4A 5ALDA 1R8CA 4P0PA 3RB6A 5KFPA 2EAMA 3TKAA 7ICMA 5KFLA 5L1IA 4Z6FA 1SV0C 2XI9A 3AMZA 3WFSC 4F72A 2EDUA 2FPLA 3DV9A 3BQ1A 5KG0A 4EELA 4K97A 3PR4A 2DRBA 1ZQCA 3QU2A 1L3UA 3OV7A 1MA7A 4EBCA 2ESEA 5J2AA 5KFYA 3RFAA 4DS5A 3GIMA 4BJQA 9ICHA 4I2GA 2W9MA 3I76A 3V72A 5J2JA 4M9LA 3GV5B 5HRLA 1JMSA 3PHZA 4IQUA 4US8A 4GC7A 5KG3A 5KT6A 4ED7A 1NKEA 4U7CA 3V7LA 2VKQA 1TK8A 3H38A 4DOAA 3V7JA 2UVRA 5KG4A 4RZRA 5DQHA 2GWSA 4YXMA 5CRXA 4EV6A 7ICJA 2KJ8A 2WF5A 2HBKA 1NZBA 4UAYA 3F5AA 4JB3A 8ICYA 1PK1B 2PFNA 2W9AA 1D9DA 4QWAA 4KMOB 2KZMA 2FDRA 3V6KA 3SI8A 4QW9A 3S6JA 2CPRA 5KG2A 4IQWA 3GILA 4ECTA 1ZJMA 2DBYA 1TFYA 1PZNA 5CR0A 4DSJA 1COKA 4RNOA 3KD3A 2KSOA 4X0AA 3A0HU 1JIHA 4NLGA 4KX3A 2KV2A 4KTQA 4O3QA 4MEYA 9ICQA 2HHPA 1WUDA 3EZ5A 4DL6A 5ALOA 3HIYA 5KFBA 4IRKA 4P2HA 4NL9C 2DKZA 4XUSA 2HI0A 3BQTA 1ZD2P 2RDIA 3HILA 4X4VA 3H37A 3KHHA 4M0AA 5KNIA 2ASDA 1KQQA 1ZQJA 2OWOA 2IOFA 1Z4OA 2XCPA 2RFFA 4O3OA 4QZHA 3UQ2A 2XY7A 3AQNA 2HCFA 4RQMA 4TUQA 4OAGA 1OXJA 3RJGA 3ORYA 4PHEA 5J2BA 4EGWA 1TFWA 1A0PA 2IBKA 1X9XA 3GU3A 5DGAA 5CFSA 5AKHA 1F5SA 1DRGA 5HRBA 2QB0A 9ICLA 2NRWA 1FFUA 3ER8C 3I28A 1KSPA 5ALXA 2FCLA 4B9NA 1ZQIA 3KTQA 2H5XA 4M9HA 3QUCA 5AI5A 3NVWA 1L3VA 3Q8RB 1LB2B 1LKYA 2M2VA 9ICMA 2HOFA 4DL3A 5EWFA 2ALZA 7ICNA 3OHAA 2V4RA 4Z6DA 4WH5A 1RG6A 3AN1A 1ZRNA 4WC7A 4F5PA 1X2IA 8ICFA 2PFQA 2ZIWB 4JV2A 3TAQA 1NNLA 5GTIU 8ICTA 3OPXA 3UPQA 2JGAA 1QCKA 3EF2A 2WF7A 3H40A 2XY6A 1KL9A 4B9VA 4WC1A 2HBLA 5DG8A 3HT3A 2KZ3A 4KX5A 3JPNA 3GZFA 4FHXA 4RT2A 1YT3A 1NK7A 4C0ZA 3ERCC 4DEZA 2F77X 1F5AA 2K8AA 3IRUA 4DL5A 2JEIA 3IDWA 5AKXA 1SXDA 4RWPA 4PGYA 4RQ2A 4UB3A 2IHOA 4O68A 3N7SC 5IIMA 5HRKA 4C8OA 3WKEA 4EP7A 2I5HA 2OCEA 4FBUA 4IG8A 5AKJA 3SYZA 3HPOA 4UBBA 2O5AA 3WFRE 4IQVA 1NJWA 4ECUA 3D2SA 5KTQA 3RAQA 3KZIU 4F71A 3HX0A 4FFDA 4QZFA 4CRXA 1BPBA 3GQCA 1S10A 1NK4A 2NRTA 3Q8MA 4K9BA 9ICXA 2C2EA 3SQIA 2VJ5A 3RJHA 3ZDCA 5D62A 1ZQNA 1KNYA 5KFFA 4FHWA 3SAFA 3M9NB 5A0LA 4O67A 5C5JA 3PX4A 2XO7A 1WYGA 2K60A 2KD1A 1S76D 1BPDA 4I0UA 3UXNA 5KFHA 5L1KA 3LYSA 3PX6A 1T8EA 3ZDAA 4QZDA 3SZ2A 2KZZA 4C8LA 1SKRA 4AYBC 1ZQWA 1LV5A 3RRGA 1KFDA 4RWNA 1S0NA 4UATA 1Z4NA 4FE3A 1PVPA 4KLOA 5ALYA 5J2EA 3PO4A 2ID1A 1XSPA 4ED6A 2ZIUA 4J03A 2EZZA 3IHQB 1ZQFA 2JV3A 1S0OA 2WHEA 2DR8A 2BQUA 4NKTA 4EX6A 3IP4B 3ZDEA 4AT9B 1S97A 4LZGA 1KEJA 4UB4A 2LPEA 4Z6EA 4X5VA 1X9SA 4AT7A 4CE6A 2B6GA 3WU2U 3WFQE 3GDXA 5JUMA 2AHOB 1J2NA 2BHNA 2EAPA 4PL1A 8ICZA 3SEIA 3TARA 2BR0A 4Y2PA 3UMBA 2H3IA 5J0PA 8ICMA 3AQMA 5KT5A 4P0QB 5AM2A 5ALFA 3K1RB 3Q8QB 4IRCA 3EUB2 3ZI4A 2ZG6A 2IHNA 2IUBA 4O9MA 4LZDA 5KFOA 4BXOA 3RJKA 1H38A 2CN1A 2JEGA 4OAFA 4BWJA 5TISU 3RBDA 3J81j 3JPOA 2NYVA 2YMLA 3AUOA 1Z19A 3OHBA 2ZHBA 5KFDA 5DGBA 5J8YC 4YD1A 5KAIU 4ELTA 3NWIA 1UEVA 4YQWA 3N97B 4WC4A 3UMCA 4GLXA 4UB5A 4DO9A 5HHIA 4ACOA 1ZYQA 1TV9A 4EEBA 2BQ3A 5JU5A 3M1YA 1S77D 3Q8KA 4FZMA 2A3VA 4AT8B 5KT3A 4JLXA 2H3QA 2IMWP 4ECVA 4UBCA 4GIBA 4XQ8A 3MCRA 1ZETA 4ECSA 2XVTA 1TKDA 2KE7A 3K4GA 4E8FA 1BPEA 3GIKA 3THVA 1X6IA 3PSPA 3MR2A 2PMZC 4NXTA 1ZQTA 2AQ0A 2FPMA 4TQSA 2K8CB 3QEAZ 1RQNA 2ZH9A 2W9CB 1ZQHA 3OVSA 3OUYB 2HHQA 3E58A 2E3TA 1MQ2A 4RT3A 4OD0A 1MSWD 2BPFA 4DSEA 1TFRA 3RAXA 3RBEA 2XGQA 4QZ9A 1UHUA 4EBEA 1ZQPA 4GC6A 1PK3A 1N5XA 4QIWF 2BGWA 1SWVA 2BCVA 5L1LA 1ZQQA 2KN7A 3FYHA 9ICTA 3GFKB 4YD2A 4JV1A 4F4KA 3QZ8A 1L8OA 5AKYA 5GTHU 4Y2VA 4PHPA 4NM1A 8ICOA 1SV0A 5B5EU 3ZDDA 1BVSA 3RH4A 2KIWA 2F1JA 1ZQDA 4HAIA 5DDYA 4R8UB 3NS1A 2KFZA 1D8LA 2ZIXA 5ALMA 2QARA 5DB9A 3NTUA 2DR9A 1Z00A 5KT7A 1FEZA 3PW0A 4DSFA 5AIAA 4PGQA 3TAPA 1KRPA 3F53A 2W11A 4DOCA 4TURA 3ETLA 1ZQGA 7ICVA 3EWAA 4EZ9A 9ICAA 3U26A 2PBEA 4MFFA 4FH5A 4ECXA 1U4BA 1S0VA 1JQRA 7ICOA 3KZXA 9ICBA 3NRWA 5AICA 7ICPA 2LYHA 7ICKA 3ZD8A 4DQQA 4LEZA 1X42A 2G09A 2CXYA 4I2DA 1XC9A 1HEKA 2HHSA 3GV8B 4J9PA 3C28A 4XQ7A 9ICRA 4ICAA 2FLPA 3IM1A 4K99A 4P4PA 1UQVA 1UA1A 2B21A 4ED0A 2ZH4A 2WF9A 3Q8PB 1KTQA 4QWBA 2FI1A 2GLEA 2PFPA 1TAQA 5J0QA 1J2MA 2Y9TA 3GIIA 5HMLA 2M2UA 3UXPA 1RM6C 1TE2A 1UPHA 5KFIA 5CB1A 5HREA 2I6XA 4QJFB 9ICCA 2WB1C 4WC5A 4S3NA 2AH5A 1K1SA 3OSNA 2YY6A 2HHWA 2AJQA 4RWOA 5HRHA 1KFSA 3MFHA 1NI3A 5KFQA 4QZAA 1TAMA 3D2NA 1GO3F 2HN2A 3HKZC 2EAOA 2F1IA 4UAZA 5EE9A 2IOHA 4C80A 1SKWA 1QQ6A 5AIBA 4NL9A 4WC0A 2MUTA 2R8KA 2YMMA 3MGHA 1NKBA 1FA0A 4C8NA 4QZIA 5HR7A 2ASJA 2E8NA 4UAVA 1BGXT 1ZD5A 2KJ5A 2N1RA 3H8WA 2RQ5A 4DQPA 5IIJA 4NXWA 3H39A 1JROA 4I2IA 2FLNA 4ELVA 3H8SA 1CUKA 1X40A 5CEHA 4WBYA 2M9NA 2Y9UA 3T5HA 3NVOA 3M6ZA 4EYHB 4K9AA 3OVAA 1A6SA 2BBJA 4YVZA 3QU5A 1BPZA 4Y2TA 8ICWA 4XRHA 1IG6A 4UAUA 1JN3A 2DL0A 5AKKA 4C7YA 5CJ7A 4DFDA 3TADC 4FHVA 3QYPA 5KFWA 4CF5A 4MFAA 1NO5A 2EZXA 4CNQA 3AEVA 1L6NA 5KFXA 5J0UA 1L3SA 1SL1A 3H4DA 4F5QA 3R9KA 2E8PA 2NRKA 1Z3EB 2F76X 2G07A 4A8EA 7ICFA 4QZCA 4ATBB 1ZOLA 4USAA 3H4BA 1Q78A 4IR1A 3RR7A 3TI0A 8ICHA 3C1ZA 4F4ZA 4WJ3B 4ED8A 1ZQ1C 4X4RA 4B9MA 2W8LA 1KN5A 2KEYA 2KVCA 3WKCA 1UCVA 1JXLA 4IR9A 1KDHA 1TVAA 2KHVA 5HR9A 4NXVA 3TFSA 2GH1A 5CHGA 8ICGA 2DWQA 2F1HA 2XC9A 3RB4A 1V97A 2Q4TA 2BQRA 1UT8A 2D6FC 4PL2A 3ER9B 1DK2A 3ALRA 1S0MA 3MR6A 2F3NA 1V4AA 1X66A 2P66A 4LT6A 4TQRA 5KFNA 4F4YA 4JV0A 3AU6A 5KFJA 3HJ4A 2FMPA 5AI9A 2IHMA 2P6UA 4XA5A 5IIIA 4DQSA 5AI8A 3T5JA 1AQ6A 1U45A 2WAQC 2YB4A 1YZ7A 2Y0SF 4F2RA 4ELUA 2HHXA 1SWWA 2ATLA 2ZXIA 3QU4A 2KFNA 4E80A 1ZQYA 4J9SA 1T7PA 4DOBA 1Q46A 2LI6A 3WK4A 4MFCA 4QIWC 8ICQA 4EENA 2BKEA 2ODGA 9ICUA 2YB1A 4G9BA 2RRDA 2O1PA 2A19A 2KIVA 7ICGA 4DF4A 4K4HA 4KLDA 4KLLA 1TAUA 2ZJ8A 5CFTA 4JWMA 4J9QA 3FM9A 4KM5A 5J2DA 1SL2A 4DL4A 2R18A 4NM2A 1CRXA 2LBOA 4X4NA 2R8JA 8ICXA 4YR0A 3SENA 1WWUA 5D49A 3UMGA 4UW9A 4NY8A 2YQEA 4DQIA 5J0OA 2IA6A 2UVVA 2JZBB 4LJXA 3PW2A 1NK5A 1OUQA 3BQ0A 2DKXA 8ICCA 4OO1J 1ECWA 2BPCA 4UD5A 1N63A 4BGDA 5J2CA 5BOLA 4EEYA 3FAHA 4WC3A 4KLMA 7ICQA 2Z7JA 1NJXA 2BE3A 5HC9A 4P0PB 4LEYA 4B9SA 3WK6A 3WKDA 5J0WA 4DLEA 5DG9A 1HUOA 5KFUA 1QSSA 4RQ0A 2J6TA 2W9BB 3JCFA 4ZH4A 4X0BA 1WWVA 4YMMA 2ASLA 2LHTA 1XWLA 3M9MB 2G5HB 4NLBA 4NLCA 5D46A 1BNPA 2K4HA 2E8OA 4CGZA 2FE9A 1BPYA 3WK9A 8ICSA 3SAHA 5TZVA 2B56A 4AT8A 2W3RA 3C2KA 5AI0A 4YMOA 4F92B 4I28A 5HRIA 5KT4A 1MIVA
chains in the Genus database with same CATH topology
1ZQAA 3PW4A 1T3NA 3N97B 4KLIA 4WC4A 2Y1JA 4GXKA 4F5OA 4I2CA 4M9NA 2HVHA 2HW3A 2HVIA 4GLXA 3LWMA 4UB5A 4DO9A 2XGPA 5DG7A 1U48A 5HHIA 4M9GA 3MDCA 3GIJA 4DFKA 3C18A 1ZYQA 4M47A 1TV9A 2PXIA 8ICAA 4RQ1A 2BQ3A 1KLNA 3MABA 1V9PA 3JPSA 1S77D 3Q8KA 1JAJA 3KHGA 4AT8B 3GV7B 5KT3A 2ZH2A 9ICJA 8ICIA 3MR5A 5J2IA 4UQGA 4F4XA 2C28A 4R66A 2AGQA 3ISDA 2IMWP 3G6VA 4DFJA 4ECVA 3PMLA 3TANA 1A76A 2VANA 4UBCA 3QEBZ 1DGSA 3EPGA 3C2MA 7ICRA 4WCWA 4XQ8A 1NK8A 2FLLA 1ZETA 5KFAA 4ECSA 4PH5A 5DQIA 5IINA 2AU0A 4EBKA 3RH5A 2V9WA 1TKDA 1Q79A 4G3IA 3C23A 3K4GA 4E8FA 4KN4A 1BPEA 4J9RA 5J0XA 3PW7A 5HRFA 4UB1A 3GIKA 4J9NA 4YN4A 1XU4A 2ZUDA 5DB7A 3MR2A 3THVA 2AGPA 1ZQVA 3Q8LA 1S9FA 3OSPA 3RJEA 2HHTA 8ICNA 5HHHA 9ICSA 1NZPA 5HNKA 4NKUA 3E2EA 4EBDA 1ZQTA 4MF2A 7ICLA 4AT9A 4LT6A 1MC8A 1WOTA 4ECYA 2AQ0A 2FPMA 5KFGA 4TQSA 3OGUA 3QEAZ 2C22A 1UEUA 2Q66A 4I2HA 4M2YA 4YCXA 2ZH9A 1ZQBA 3H8JA 2W9CB 1ZQHA 3PV8A 4I2EA 3OVSA 3OUYB 2HHQA 1L5UA 1UA0A 2BCUA 2HHVA 1MQ2A 4O5CA 3KHRA 4RT3A 4X4QA 1RZTA 4KLQA 3LDAA 4O3RA 4ED3A 1MSWD 5DLGA 2BPFA 4DSEA 1TFRA 2W8KA 2ISOA 1NOMA 4RNNA 4F5NA 3RAXA 3H7IA 3RBEA 4Q43A 2XGQA 3G6YA 4QZ9A 3TQ1A 4RQ3A 4EBEA 4BDPA 1ZQPA 4GC6A 3RB3A 1R8CA 2J6SA 1HJPA 3RB6A 5KFPA 3UQ0A 2BGWA 2ZH8A 5KFEA 1HUZA 7ICMA 9ICEA 5KFLA 2BCVA 2DRAA 5L1LA 3QE9Y 1ZQQA 5L1IA 2KN7A 4Z6FA 3FYHA 4E7XA 9ICTA 2A1JA 3GFKB 4YD2A 4M04A 4ED1A 4JV1A 2MUTB 4F4KA 3L9DA 5J2HA 1PX5A 5DBBA 3QZ8A 3WFSC 4RQ8A 2UVUA 4PHPA 4NM1A 8ICOA 2FPLA 3BQ1A 4WBZA 5KG0A 2BCSA 3ZDDA 8ICEA 4NLNA 1BVSA 3RH4A 1ZQDA 2F1JA 8ICLA 3PR4A 2DRBA 5DDYA 4FBTA 4R8UB 1ZQCA 3PVXA 2ZH5A 3RRHA 5HRGA 1L3UA 3OV7A 1ZQLA 3PX0A 4QWCA 2KFZA 1D8LA 4EBCA 5F9NA 5J2AA 5DB9A 4PHDA 4ECQA 4UD4A 5KFYA 3NTUA 2DR9A 3N4MB 1Z00A 3OVAA 1DOQA 5KT7A 3EYZA 4DS5A 2DFLA 1TK0A 3PW0A 4DSFA 4KLTA 4DL7A 4X4TA 5EOZA 3GIMA 4C8MA 4PGQA 4J9KA 3TAPA 2J6UA 2KTQA 4GXJA 3M9OB 1KRPA 9ICHA 8ICKA 1T4GA 3C21A 2W9MA 3V72A 4I2GA 2BCRA 4DOCA 5J2JA 4TURA 4M9LA 3GV5B 2FMSA 5HRLA 4Q8EA 3ETLA 3G6XA 1SL0A 1JMSA 1ZQKA 3LWLA 1ZQGA 4IQUA 4QZEA 4ECWA 4I2FA 3AQKA 2ZH6A 4GC7A 3EWAA 7ICVA 5KG3A 5KT6A 4EZ9A 9ICAA 2PBEA 4O0IA 2ZUCA 4ED7A 4MFFA 4UB2A 4FH5A 1NK6A 4ECXA 1U4BA 1ZQZA 1NKEA 1S0VA 3V7LA 3RTVA 8ICVA 1TK8A 5IIOA 4DQRA 1CEZA 4DOAA 3H38A 3V7JA 3C5FA 7ICOA 2UVRA 1JQRA 5KG4A 2ZUBA 4RZRA 2R8IA 9ICBA 5DQHA 7ICPA 4J9MA 2GWSA 2LYHA 1VFGA 3NYBA 4YXMA 4X4UA 7ICKA 3BJYA 1XS9D 7ICJA 3ZD8A 4DQQA 3NGDA 2HHUA 4X4PA 4UAYA 4Z6CA 4I2DA 4JK1A 5DQGA 1L3TA 1ZJNA 1XC9A 1ZQOA 1RYRA 2HHSA 8ICYA 3WFOA 2PFNA 1IXRA 3GV8B 2W9AA 4J9PA 1D9DA 4QWAA 4EZ6A 4XQ7A 3H3AA 2VA8A 4DSIA 2FLPA 2KZMA 9ICRA 1B22A 2VA3A 3IM1A 3ISBA 3V6KA 1S10A 2BCQA 4PHAA 3SI8A 4QW9A 3LQCB 4P4PA 5J29A 5KG2A 4Q45A 1SKSA 4IQWA 3GILA 4ECTA 1ZJMA 3C5GA 1UA1A 1NK9A 1PZNA 3B0YA 5CR0A 2B21A 3PR5B 4ED0A 3Q8PB 4DSJA 1AROP 1KTQA 4I2BA 2ZH4A 4B9UA 4QWBA 4RNOA 1JXEA 5KFCA 3RB0A 2PFPA 9ICIA 3OJUA 1TAQA 5J0QA 4X0AA 1JIHA 3GIIA 4C8KA 5HMLA 2NRXA 4NLGA 3UXPA 2M2UA 5EWEA 5KG7A 1DK3A 2W9CA 4KTQA 5KFIA 4O3QA 5HMMA 7ICUA 1R8BA 5CB1A 5HREA 3OUYA 4MEYA 4DWIA 9ICQA 9ICCA 3LK9A 2NRVA 8ICJA 4WC5A 4I29A 4MEXA 3EZ5A 2HHPA 1U49A 4RQ5A 4B9LA 4S3NA 2ZH7A 1K1SA 3OSNA 2KP7A 2RDJA 5DKWA 2HHWA 4DL6A 2AJQA 3HJ1A 5BOMA 1D8YA 1KFSA 5HRHA 4RWOA 3MFHA 2ZHAA 5KFQA 4QZAA 3HIYA 5KFBA 3KHLA 4IRKA 1EXNA 2PFOA 4P2HA 4FHYA 2F1IA 4UAZA 1QSYA 4WC2A 4XUSA 9ICOA 3AQLA 4FS1A 3BQTA 9ICNA 1SKWA 2RDIA 4WC0A 2Q0ZX 2MUTA 2V4QA 1TK5A 4X4VA 2R8KA 3KHHA 4M0AA 4KLFA 7ICIA 2ASDA 3MGHA 1NKBA 1FA0A 1ZQJA 2OWOA 2DPIA 8ICBA 3UPSA 2XCPA 2RFFA 4X4SA 4C8NA 2ZJAA 4NXZA 4QZIA 4O3OA 4QZHA 4RQ6A 3UQ2A 3V6HA 2XY7A 4KLUA 2ASJA 4F2SA 1RPLA 4RQ4A 4R8UA 3AQNA 3OJSA 1BGXT 4O5EA 4TUQA 1R89A 2PI4A 4I2AA 1SZPA 3H8WA 2WTFA 3RJGA 1XSLA 5DEDA 2ZH1A 3ORYA 4PHEA 5J2BA 9ICWA 4DS4A 5KFSA 5DB8A 1TFWA 4DQPA 2IBKA 4K4IA 3SV4A 5DGAA 2DVIA 5IIJA 4NLKA 3JPQA 1R8AA 3H39A 2JEFA 4M5DA 2AQ4A 5HRBA 9ICLA 4I2IA 2FLNA 4ELVA 2NRWA 3H8SA 1CUKA 4X4OA 1ZQMA 1KSPA 4O3PA 1N56A 4RUCA 4B9NA 1ZQIA 3KTQA 2M2TA 2H5XA 2M9NA 3EPIA 3T5HA 3H37A 4M9HA 3EW9A 4WBYA 4EYHB 5F9LA 1L3VA 4YMNA 3Q8RB 4J9LA 1RYSA 5L9XA 4YVZA 4F50A 1LB2B 3RR8A 9ICMA 2M2VA 4DL3A 1BPZA 9ICGA 5EWFA 2ALZA 1D9FA 7ICNA 5J2KA 3V7KA 4XRHA 8ICWA 4F4WA 3OHAA 2FPKA 5D4BA 5CWRA 2ZH3A 3RH6A 2V4RA 4Z6DA 4TUSA 3PO5A 1A77A 4O5KA 2XCAA 3RJFA 1QTMA 1JN3A 4RWQA 5CJ7A 4WC7A 4RPXA 4F5PA 2P6RA 1X2IA 4FHVA 8ICFA 2PFQA 5KFWA 4F3OA 2C2DA 4MFAA 4KLSA 1NO5A 4P4OA 4JV2A 3TAQA 3T5KA 5KG5A 1B43A 3MFIA 5KFXA 5J0UA 1L3SA 1UT5A 3HP6A 2M2WA 4QWDA 1SL1A 3H4DA 4F5QA 2ZTDA 4O3NA 8ICTA 2NRKA 3WFPA 2AGOA 3UPQA 1Z3EB 4O3SA 4MF8A 4M9JA 7ICFA 4FHPA 4QZCA 3T3FA 4ATBB 1BPXA 3H4BA 2ZJ5A 4JUZA 4DSLA 1Q78A 4R64A 4KLEA 4IR1A 1YLQA 3H40A 3BQ2A 2XY6A 5KFMA 5DBAA 3TI0A 3RR7A 3RJJA 4B9VA 8ICHA 5CP2A 4WC1A 5DG8A 3HT3A 2KZ3A 3C1ZA 2BDPA 4KLGA 3JPNA 4F4ZA 4FHXA 4RT2A 1NK7A 4ED8A 3QZ7A 3V6JA 4BWMA 4X4RA 4B9MA 1ZQXA 4DEZA 2W8LA 5DBCA 1NK0A 1F5AA 4UAWA 3TFRA 4RPZA 4DL5A 1N48A 7ICTA 3ZD9A 2JEIA 4RUAA 4RWPA 5KG6A 4PGYA 1JXLA 4RQ2A 4UB3A 4IR9A 7ICHA 1KDHA 2DR7A 4QZGA 3PW5A 1TVAA 1MQ3A 1Y88A 3PNCA 1ZQRA 5IIMA 5HR9A 1QSLA 5HRKA 4C8OA 3TFSA 1MIYA 1TFYA 5KFRA 4EP7A 5CHGA 8ICGA 4FO6A 4FBUA 2F1HA 2XC9A 3RB4A 4BXOB 8ICPA 4IG8A 3SYZA 3HPOA 4B9TA 4GXIA 4UBBA 2BQRA 3MBYA 2O5AA 1UT8A 3WFRE 2Y1IA 1WCLA 4IQVA 1NJWA 1DK2A 4ECUA 1S0MA 3MR6A 4PPXA 5KTQA 3RAQA 3C2LA 7ICSA 2ZTCA 1OU5A 3ISCA 1V4AA 4YR2A 2P66A 3HX0A 3RJIA 4QZFA 4YR3A 3MGIA 4TQRA 5KFNA 1BPBA 5KFVA 4F91B 3HWTA 2NRTA 4JV0A 3GQCA 4F4YA 3AU6A 5KFJA 3Q8MA 1NK4A 3HJ4A 4FS2A 2FMPA 2C2EA 9ICXA 3M8SA 4QWEA 3RJHA 3UXOA 3ZDCA 2IHMA 2P6UA 4XA5A 3SV3A 4RQ7A 5IIIA 1ZQNA 1KNYA 4YXJA 3BDPA 5HRDA 5CA7A 4DQSA 3T5JA 5KFFA 4RU9A 1U45A 1XSNA 4FHWA 1UETA 3M9NB 4M6WA 5C5JA 5J0YA 3PX4A 3OVBA 4PGXA 1NJYA 5IIKA 4YP3A 1NJZA 1U9LA 2XO7A 4F2RA 1X9MA 4ELUA 2HHXA 2ISPA 4K4GA 2BPGA 1S76D 5J0TA 2ATLA 1BPDA 3MR3A 4DLGA 4LVSA 3UXNA 5KFHA 5L1KA 3PX6A 2C2RA 2VA2A 3ZDBA 5J0RA 1T8EA 4NLZA 3ZDAA 2KFNA 4QZDA 4E80A 3SZ2A 1ZQYA 4J9SA 4C8LA 1SKRA 2KZZA 4F93B 1T7PA 8ICRA 4DOBA 1ZQWA 1LV5A 4MFCA 5J0SA 1RXVA 8ICQA 4FH3A 3RRGA 2BKEA 3C1YA 1KFDA 3AU2A 1NKCA 9ICUA 1MIWA 4RWNA 1S0NA 2NRZA 4M6WB 2JEJA 2O1PA 4Q44A 4KMUA 4KLOA 7ICGA 4DSKA 4DF4A 4WC6A 4TUPA 5J2EA 2JZBA 4K4HA 4KLDA 4KLLA 1TAUA 2ZJ8A 1VJ7A 3PO4A 4R65A 2ID1A 1XSPA 4ED6A 2DPJA 3K75D 4JWMA 5KFTA 5J2FA 4J9QA 1ZQSA 4EBJA 5DB6A 1U47A 5J2DA 1SL2A 4IQTA 4DL4A 3IHQB 4NM2A 5J2GA 1X9WA 4R63A 1ZQFA 4F8RA 1IM4A 2MAXA 4X4NA 2R8JA 1ZQUA 1S0OA 1XO1A 7ICEA 8ICXA 5KG1A 9ICPA 2DR8A 4YR0A 5D49A 3M8RA 2BQUA 2XY5A 4QZBA 4NY8A 4NKTA 3ZDEA 1RXWA 1ZQEA 4AT9B 4DQIA 4I27A 5J0OA 1S97A 1C7YA 4LZGA 2IA6A 3PMNA 1KEJA 2UVVA 4ATBA 4ED2A 2JZBB 4UB4A 4Z6EA 3PW2A 4X5VA 1NK5A 1X9SA 1BNOA 5DLFA 3BQ0A 4AT7A 4ECRA 3HW8A 8ICCA 4RPYA 3Q8SB 3WFQE 3GDXA 5JUMA 2W9BA 4J9OA 3PY8A 2BPCA 4UD5A 4DL2A 2BHNA 4BGDA 5J2CA 8ICZA 3TARA 5BOLA 4EEYA 2BR0A 4DF8A 5F2VO 4WC3A 5L1JA 5J0PA 5KFKA 4KLMA 1NJXA 5KFZA 8ICMA 7ICQA 2BE3A 3JPPA 5HC9A 3MDAA 2R8HA 1K1QA 2PI5A 2I9GA 3AQMA 4B9SA 4F5RA 5KT5A 4Q8FA 9ICFA 5J0WA 5DDMA 4DLEA 4DFPA 5DG9A 3FDSA 3B0XA 4AT7B 2A1JB 4ECZA 5KT2A 3JPRA 9ICVA 2UVWA 1HUOA 5KFUA 1QSSA 4RQ0A 3Q8QB 4KLJA 2I1QA 4IRCA 2J6TA 2IHNA 2W9BB 8ICUA 4O9MA 4LZDA 3C66A 4ZH4A 5HP4A 3T5LA 4QW8A 4X0BA 5KFOA 4YMMA 4BXOA 2ASLA 5DECA 3RJKA 1H38A 4I2JA 4EYIB 2ZTEA 3JPTA 1COOA 1XWLA 4RNMA 3M9MB 5EWGA 4CCHA 4QZ8A 5D46A 1BNPA 4DFMA 4IRDA 2FMQA 3JYYA 2JEGA 4YG2A 4BWJA 1Z00B 3RBDA 2DR5A 3JPOA 4P4MA 4E0DA 1BPYA 1KFTA 5IILA 4HYKA 1JX4A 4KLHA 3JZ0A 8ICSA 3AUOA 4KITB 5TZVA 3OHBA 4AT8A 2ZHBA 1WCNA 2R8GA 1QLNA 5KFDA 5DGBA 4YD1A 3C2KA 4ELTA 4YMOA 4F92B 4I28A 5HRIA 5KT4A 4KN7A 5BPCA 1MIVA 1UEVA 4YFKA 4YQWA 9ICKA 4JWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQA A;  3PW4 A;  1T3N A;  3N97 B;  4KLI A;  4WC4 A;  2Y1J A;  4GXK A;  4F5O A;  4I2C A;  4M9N A;  2HVH A;  2HW3 A;  2HVI A;  4GLX A;  3LWM A;  4UB5 A;  4DO9 A;  2XGP A;  5DG7 A;  1U48 A;  5HHI A;  4M9G A;  3MDC A;  3GIJ A;  4DFK A;  3C18 A;  1ZYQ A;  4M47 A;  1TV9 A;  2PXI A;  8ICA A;  4RQ1 A;  2BQ3 A;  1KLN A;  3MAB A;  1V9P A;  3JPS A;  1S77 D;  3Q8K A;  1JAJ A;  3KHG A;  4AT8 B;  3GV7 B;  5KT3 A;  2ZH2 A;  9ICJ A;  8ICI A;  3MR5 A;  5J2I A;  4UQG A;  4F4X A;  2C28 A;  4R66 A;  2AGQ A;  3ISD A;  2IMW P;  3G6V A;  4DFJ A;  4ECV A;  3PML A;  3TAN A;  1A76 A;  2VAN A;  4UBC A;  3QEB Z;  1DGS A;  3EPG A;  3C2M A;  7ICR A;  4WCW A;  4XQ8 A;  1NK8 A;  2FLL A;  1ZET A;  5KFA A;  4ECS A;  4PH5 A;  5DQI A;  5IIN A;  2AU0 A;  4EBK A;  3RH5 A;  2V9W A;  1TKD A;  1Q79 A;  4G3I A;  3C23 A;  3K4G A;  4E8F A;  4KN4 A;  1BPE A;  4J9R A;  5J0X A;  3PW7 A;  5HRF A;  4UB1 A;  3GIK A;  4J9N A;  4YN4 A;  1XU4 A;  2ZUD A;  5DB7 A;  3MR2 A;  3THV A;  2AGP A;  1ZQV A;  3Q8L A;  1S9F A;  3OSP A;  3RJE A;  2HHT A;  8ICN A;  5HHH A;  9ICS A;  1NZP A;  5HNK A;  4NKU A;  3E2E A;  4EBD A;  1ZQT A;  4MF2 A;  7ICL A;  4AT9 A;  4LT6 A;  1MC8 A;  1WOT A;  4ECY A;  2AQ0 A;  2FPM A;  5KFG A;  4TQS A;  3OGU A;  3QEA Z;  2C22 A;  1UEU A;  2Q66 A;  4I2H A;  4M2Y A;  4YCX A;  2ZH9 A;  1ZQB A;  3H8J A;  2W9C B;  1ZQH A;  3PV8 A;  4I2E A;  3OVS A;  3OUY B;  2HHQ A;  1L5U A;  1UA0 A;  2BCU A;  2HHV A;  1MQ2 A;  4O5C A;  3KHR A;  4RT3 A;  4X4Q A;  1RZT A;  4KLQ A;  3LDA A;  4O3R A;  4ED3 A;  1MSW D;  5DLG A;  2BPF A;  4DSE A;  1TFR A;  2W8K A;  2ISO A;  1NOM A;  4RNN A;  4F5N A;  3RAX A;  3H7I A;  3RBE A;  4Q43 A;  2XGQ A;  3G6Y A;  4QZ9 A;  3TQ1 A;  4RQ3 A;  4EBE A;  4BDP A;  1ZQP A;  4GC6 A;  3RB3 A;  1R8C A;  2J6S A;  1HJP A;  3RB6 A;  5KFP A;  3UQ0 A;  2BGW A;  2ZH8 A;  5KFE A;  1HUZ A;  7ICM A;  9ICE A;  5KFL A;  2BCV A;  2DRA A;  5L1L A;  3QE9 Y;  1ZQQ A;  5L1I A;  2KN7 A;  4Z6F A;  3FYH A;  4E7X A;  9ICT A;  2A1J A;  3GFK B;  4YD2 A;  4M04 A;  4ED1 A;  4JV1 A;  2MUT B;  4F4K A;  3L9D A;  5J2H A;  1PX5 A;  5DBB A;  3QZ8 A;  3WFS C;  4RQ8 A;  2UVU A;  4PHP A;  4NM1 A;  8ICO A;  2FPL A;  3BQ1 A;  4WBZ A;  5KG0 A;  2BCS A;  3ZDD A;  8ICE A;  4NLN A;  1BVS A;  3RH4 A;  1ZQD A;  2F1J A;  8ICL A;  3PR4 A;  2DRB A;  5DDY A;  4FBT A;  4R8U B;  1ZQC A;  3PVX A;  2ZH5 A;  3RRH A;  5HRG A;  1L3U A;  3OV7 A;  1ZQL A;  3PX0 A;  4QWC A;  2KFZ A;  1D8L A;  4EBC A;  5F9N A;  5J2A A;  5DB9 A;  4PHD A;  4ECQ A;  4UD4 A;  5KFY A;  3NTU A;  2DR9 A;  3N4M B;  1Z00 A;  3OVA A;  1DOQ A;  5KT7 A;  3EYZ A;  4DS5 A;  2DFL A;  1TK0 A;  3PW0 A;  4DSF A;  4KLT A;  4DL7 A;  4X4T A;  5EOZ A;  3GIM A;  4C8M A;  4PGQ A;  4J9K A;  3TAP A;  2J6U A;  2KTQ A;  4GXJ A;  3M9O B;  1KRP A;  9ICH A;  8ICK A;  1T4G A;  3C21 A;  2W9M A;  3V72 A;  4I2G A;  2BCR A;  4DOC A;  5J2J A;  4TUR A;  4M9L A;  3GV5 B;  2FMS A;  5HRL A;  4Q8E A;  3ETL A;  3G6X A;  1SL0 A;  1JMS A;  1ZQK A;  3LWL A;  1ZQG A;  4IQU A;  4QZE A;  4ECW A;  4I2F A;  3AQK A;  2ZH6 A;  4GC7 A;  3EWA A;  7ICV A;  5KG3 A;  5KT6 A;  4EZ9 A;  9ICA A;  2PBE A;  4O0I A;  2ZUC A;  4ED7 A;  4MFF A;  4UB2 A;  4FH5 A;  1NK6 A;  4ECX A;  1U4B A;  1ZQZ A;  1NKE A;  1S0V A;  3V7L A;  3RTV A;  8ICV A;  1TK8 A;  5IIO A;  4DQR A;  1CEZ A;  4DOA A;  3H38 A;  3V7J A;  3C5F A;  7ICO A;  2UVR A;  1JQR A;  5KG4 A;  2ZUB A;  4RZR A;  2R8I A;  9ICB A;  5DQH A;  7ICP A;  4J9M A;  2GWS A;  2LYH A;  1VFG A;  3NYB A;  4YXM A;  4X4U A;  7ICK A;  3BJY A;  1XS9 D;  7ICJ A;  3ZD8 A;  4DQQ A;  3NGD A;  2HHU A;  4X4P A;  4UAY A;  4Z6C A;  4I2D A;  4JK1 A;  5DQG A;  1L3T A;  1ZJN A;  1XC9 A;  1ZQO A;  1RYR A;  2HHS A;  8ICY A;  3WFO A;  2PFN A;  1IXR A;  3GV8 B;  2W9A A;  4J9P A;  1D9D A;  4QWA A;  4EZ6 A;  4XQ7 A;  3H3A A;  2VA8 A;  4DSI A;  2FLP A;  2KZM A;  9ICR A;  1B22 A;  2VA3 A;  3IM1 A;  3ISB A;  3V6K A;  1S10 A;  2BCQ A;  4PHA A;  3SI8 A;  4QW9 A;  3LQC B;  4P4P A;  5J29 A;  5KG2 A;  4Q45 A;  1SKS A;  4IQW A;  3GIL A;  4ECT A;  1ZJM A;  3C5G A;  1UA1 A;  1NK9 A;  1PZN A;  3B0Y A;  5CR0 A;  2B21 A;  3PR5 B;  4ED0 A;  3Q8P B;  4DSJ A;  1ARO P;  1KTQ A;  4I2B A;  2ZH4 A;  4B9U A;  4QWB A;  4RNO A;  1JXE A;  5KFC A;  3RB0 A;  2PFP A;  9ICI A;  3OJU A;  1TAQ A;  5J0Q A;  4X0A A;  1JIH A;  3GII A;  4C8K A;  5HML A;  2NRX A;  4NLG A;  3UXP A;  2M2U A;  5EWE A;  5KG7 A;  1DK3 A;  2W9C A;  4KTQ A;  5KFI A;  4O3Q A;  5HMM A;  7ICU A;  1R8B A;  5CB1 A;  5HRE A;  3OUY A;  4MEY A;  4DWI A;  9ICQ A;  9ICC A;  3LK9 A;  2NRV A;  8ICJ A;  4WC5 A;  4I29 A;  4MEX A;  3EZ5 A;  2HHP A;  1U49 A;  4RQ5 A;  4B9L A;  4S3N A;  2ZH7 A;  1K1S A;  3OSN A;  2KP7 A;  2RDJ A;  5DKW A;  2HHW A;  4DL6 A;  2AJQ A;  3HJ1 A;  5BOM A;  1D8Y A;  1KFS A;  5HRH A;  4RWO A;  3MFH A;  2ZHA A;  5KFQ A;  4QZA A;  3HIY A;  5KFB A;  3KHL A;  4IRK A;  1EXN A;  2PFO A;  4P2H A;  4FHY A;  2F1I A;  4UAZ A;  1QSY A;  4WC2 A;  4XUS A;  9ICO A;  3AQL A;  4FS1 A;  3BQT A;  9ICN A;  1SKW A;  2RDI A;  4WC0 A;  2Q0Z X;  2MUT A;  2V4Q A;  1TK5 A;  4X4V A;  2R8K A;  3KHH A;  4M0A A;  4KLF A;  7ICI A;  2ASD A;  3MGH A;  1NKB A;  1FA0 A;  1ZQJ A;  2OWO A;  2DPI A;  8ICB A;  3UPS A;  2XCP A;  2RFF A;  4X4S A;  4C8N A;  2ZJA A;  4NXZ A;  4QZI A;  4O3O A;  4QZH A;  4RQ6 A;  3UQ2 A;  3V6H A;  2XY7 A;  4KLU A;  2ASJ A;  4F2S A;  1RPL A;  4RQ4 A;  4R8U A;  3AQN A;  3OJS A;  1BGX T;  4O5E A;  4TUQ A;  1R89 A;  2PI4 A;  4I2A A;  1SZP A;  3H8W A;  2WTF A;  3RJG A;  1XSL A;  5DED A;  2ZH1 A;  3ORY A;  4PHE A;  5J2B A;  9ICW A;  4DS4 A;  5KFS A;  5DB8 A;  1TFW A;  4DQP A;  2IBK A;  4K4I A;  3SV4 A;  5DGA A;  2DVI A;  5IIJ A;  4NLK A;  3JPQ A;  1R8A A;  3H39 A;  2JEF A;  4M5D A;  2AQ4 A;  5HRB A;  9ICL A;  4I2I A;  2FLN A;  4ELV A;  2NRW A;  3H8S A;  1CUK A;  4X4O A;  1ZQM A;  1KSP A;  4O3P A;  1N56 A;  4RUC A;  4B9N A;  1ZQI A;  3KTQ A;  2M2T A;  2H5X A;  2M9N A;  3EPI A;  3T5H A;  3H37 A;  4M9H A;  3EW9 A;  4WBY A;  4EYH B;  5F9L A;  1L3V A;  4YMN A;  3Q8R B;  4J9L A;  1RYS A;  5L9X A;  4YVZ A;  4F50 A;  1LB2 B;  3RR8 A;  9ICM A;  2M2V A;  4DL3 A;  1BPZ A;  9ICG A;  5EWF A;  2ALZ A;  1D9F A;  7ICN A;  5J2K A;  3V7K A;  4XRH A;  8ICW A;  4F4W A;  3OHA A;  2FPK A;  5D4B A;  5CWR A;  2ZH3 A;  3RH6 A;  2V4R A;  4Z6D A;  4TUS A;  3PO5 A;  1A77 A;  4O5K A;  2XCA A;  3RJF A;  1QTM A;  1JN3 A;  4RWQ A;  5CJ7 A;  4WC7 A;  4RPX A;  4F5P A;  2P6R A;  1X2I A;  4FHV A;  8ICF A;  2PFQ A;  5KFW A;  4F3O A;  2C2D A;  4MFA A;  4KLS A;  1NO5 A;  4P4O A;  4JV2 A;  3TAQ A;  3T5K A;  5KG5 A;  1B43 A;  3MFI A;  5KFX A;  5J0U A;  1L3S A;  1UT5 A;  3HP6 A;  2M2W A;  4QWD A;  1SL1 A;  3H4D A;  4F5Q A;  2ZTD A;  4O3N A;  8ICT A;  2NRK A;  3WFP A;  2AGO A;  3UPQ A;  1Z3E B;  4O3S A;  4MF8 A;  4M9J A;  7ICF A;  4FHP A;  4QZC A;  3T3F A;  4ATB B;  1BPX A;  3H4B A;  2ZJ5 A;  4JUZ A;  4DSL A;  1Q78 A;  4R64 A;  4KLE A;  4IR1 A;  1YLQ A;  3H40 A;  3BQ2 A;  2XY6 A;  5KFM A;  5DBA A;  3TI0 A;  3RR7 A;  3RJJ A;  4B9V A;  8ICH A;  5CP2 A;  4WC1 A;  5DG8 A;  3HT3 A;  2KZ3 A;  3C1Z A;  2BDP A;  4KLG A;  3JPN A;  4F4Z A;  4FHX A;  4RT2 A;  1NK7 A;  4ED8 A;  3QZ7 A;  3V6J A;  4BWM A;  4X4R A;  4B9M A;  1ZQX A;  4DEZ A;  2W8L A;  5DBC A;  1NK0 A;  1F5A A;  4UAW A;  3TFR A;  4RPZ A;  4DL5 A;  1N48 A;  7ICT A;  3ZD9 A;  2JEI A;  4RUA A;  4RWP A;  5KG6 A;  4PGY A;  1JXL A;  4RQ2 A;  4UB3 A;  4IR9 A;  7ICH A;  1KDH A;  2DR7 A;  4QZG A;  3PW5 A;  1TVA A;  1MQ3 A;  1Y88 A;  3PNC A;  1ZQR A;  5IIM A;  5HR9 A;  1QSL A;  5HRK A;  4C8O A;  3TFS A;  1MIY A;  1TFY A;  5KFR A;  4EP7 A;  5CHG A;  8ICG A;  4FO6 A;  4FBU A;  2F1H A;  2XC9 A;  3RB4 A;  4BXO B;  8ICP A;  4IG8 A;  3SYZ A;  3HPO A;  4B9T A;  4GXI A;  4UBB A;  2BQR A;  3MBY A;  2O5A A;  1UT8 A;  3WFR E;  2Y1I A;  1WCL A;  4IQV A;  1NJW A;  1DK2 A;  4ECU A;  1S0M A;  3MR6 A;  4PPX A;  5KTQ A;  3RAQ A;  3C2L A;  7ICS A;  2ZTC A;  1OU5 A;  3ISC A;  1V4A A;  4YR2 A;  2P66 A;  3HX0 A;  3RJI A;  4QZF A;  4YR3 A;  3MGI A;  4TQR A;  5KFN A;  1BPB A;  5KFV A;  4F91 B;  3HWT A;  2NRT A;  4JV0 A;  3GQC A;  4F4Y A;  3AU6 A;  5KFJ A;  3Q8M A;  1NK4 A;  3HJ4 A;  4FS2 A;  2FMP A;  2C2E A;  9ICX A;  3M8S A;  4QWE A;  3RJH A;  3UXO A;  3ZDC A;  2IHM A;  2P6U A;  4XA5 A;  3SV3 A;  4RQ7 A;  5III A;  1ZQN A;  1KNY A;  4YXJ A;  3BDP A;  5HRD A;  5CA7 A;  4DQS A;  3T5J A;  5KFF A;  4RU9 A;  1U45 A;  1XSN A;  4FHW A;  1UET A;  3M9N B;  4M6W A;  5C5J A;  5J0Y A;  3PX4 A;  3OVB A;  4PGX A;  1NJY A;  5IIK A;  4YP3 A;  1NJZ A;  1U9L A;  2XO7 A;  4F2R A;  1X9M A;  4ELU A;  2HHX A;  2ISP A;  4K4G A;  2BPG A;  1S76 D;  5J0T A;  2ATL A;  1BPD A;  3MR3 A;  4DLG A;  4LVS A;  3UXN A;  5KFH A;  5L1K A;  3PX6 A;  2C2R A;  2VA2 A;  3ZDB A;  5J0R A;  1T8E A;  4NLZ A;  3ZDA A;  2KFN A;  4QZD A;  4E80 A;  3SZ2 A;  1ZQY A;  4J9S A;  4C8L A;  1SKR A;  2KZZ A;  4F93 B;  1T7P A;  8ICR A;  4DOB A;  1ZQW A;  1LV5 A;  4MFC A;  5J0S A;  1RXV A;  8ICQ A;  4FH3 A;  3RRG A;  2BKE A;  3C1Y A;  1KFD A;  3AU2 A;  1NKC A;  9ICU A;  1MIW A;  4RWN A;  1S0N A;  2NRZ A;  4M6W B;  2JEJ A;  2O1P A;  4Q44 A;  4KMU A;  4KLO A;  7ICG A;  4DSK A;  4DF4 A;  4WC6 A;  4TUP A;  5J2E A;  2JZB A;  4K4H A;  4KLD A;  4KLL A;  1TAU A;  2ZJ8 A;  1VJ7 A;  3PO4 A;  4R65 A;  2ID1 A;  1XSP A;  4ED6 A;  2DPJ A;  3K75 D;  4JWM A;  5KFT A;  5J2F A;  4J9Q A;  1ZQS A;  4EBJ A;  5DB6 A;  1U47 A;  5J2D A;  1SL2 A;  4IQT A;  4DL4 A;  3IHQ B;  4NM2 A;  5J2G A;  1X9W A;  4R63 A;  1ZQF A;  4F8R A;  1IM4 A;  2MAX A;  4X4N A;  2R8J A;  1ZQU A;  1S0O A;  1XO1 A;  7ICE A;  8ICX A;  5KG1 A;  9ICP A;  2DR8 A;  4YR0 A;  5D49 A;  3M8R A;  2BQU A;  2XY5 A;  4QZB A;  4NY8 A;  4NKT A;  3ZDE A;  1RXW A;  1ZQE A;  4AT9 B;  4DQI A;  4I27 A;  5J0O A;  1S97 A;  1C7Y A;  4LZG A;  2IA6 A;  3PMN A;  1KEJ A;  2UVV A;  4ATB A;  4ED2 A;  2JZB B;  4UB4 A;  4Z6E A;  3PW2 A;  4X5V A;  1NK5 A;  1X9S A;  1BNO A;  5DLF A;  3BQ0 A;  4AT7 A;  4ECR A;  3HW8 A;  8ICC A;  4RPY A;  3Q8S B;  3WFQ E;  3GDX A;  5JUM A;  2W9B A;  4J9O A;  3PY8 A;  2BPC A;  4UD5 A;  4DL2 A;  2BHN A;  4BGD A;  5J2C A;  8ICZ A;  3TAR A;  5BOL A;  4EEY A;  2BR0 A;  4DF8 A;  5F2V O;  4WC3 A;  5L1J A;  5J0P A;  5KFK A;  4KLM A;  1NJX A;  5KFZ A;  8ICM A;  7ICQ A;  2BE3 A;  3JPP A;  5HC9 A;  3MDA A;  2R8H A;  1K1Q A;  2PI5 A;  2I9G A;  3AQM A;  4B9S A;  4F5R A;  5KT5 A;  4Q8F A;  9ICF A;  5J0W A;  5DDM A;  4DLE A;  4DFP A;  5DG9 A;  3FDS A;  3B0X A;  4AT7 B;  2A1J B;  4ECZ A;  5KT2 A;  3JPR A;  9ICV A;  2UVW A;  1HUO A;  5KFU A;  1QSS A;  4RQ0 A;  3Q8Q B;  4KLJ A;  2I1Q A;  4IRC A;  2J6T A;  2IHN A;  2W9B B;  8ICU A;  4O9M A;  4LZD A;  3C66 A;  4ZH4 A;  5HP4 A;  3T5L A;  4QW8 A;  4X0B A;  5KFO A;  4YMM A;  4BXO A;  2ASL A;  5DEC A;  3RJK A;  1H38 A;  4I2J A;  4EYI B;  2ZTE A;  3JPT A;  1COO A;  1XWL A;  4RNM A;  3M9M B;  5EWG A;  4CCH A;  4QZ8 A;  5D46 A;  1BNP A;  4DFM A;  4IRD A;  2FMQ A;  3JYY A;  2JEG A;  4YG2 A;  4BWJ A;  1Z00 B;  3RBD A;  2DR5 A;  3JPO A;  4P4M A;  4E0D A;  1BPY A;  1KFT A;  5IIL A;  4HYK A;  1JX4 A;  4KLH A;  3JZ0 A;  8ICS A;  3AUO A;  4KIT B;  5TZV A;  3OHB A;  4AT8 A;  2ZHB A;  1WCN A;  2R8G A;  1QLN A;  5KFD A;  5DGB A;  4YD1 A;  3C2K A;  4ELT A;  4YMO A;  4F92 B;  4I28 A;  5HRI A;  5KT4 A;  4KN7 A;  5BPC A;  1MIV A;  1UEV A;  4YFK A;  4YQW A;  9ICK A;  4JWN A; 
#chains in the Genus database with same CATH topology
 5J8Y A;  4M9N A;  1ED1 A;  1F0M A;  5DG7 A;  1WG8 A;  3MDC A;  2PXI A;  4RQ1 A;  1KLN A;  1V9P A;  1JAJ A;  4UB6 U;  3GV7 B;  1SXE A;  2C28 A;  4R66 A;  3ISD A;  4DFJ A;  1DGS A;  1SIJ A;  4WCW A;  5KFA A;  5ALR A;  4PH5 A;  5DQI A;  2V9W A;  3C23 A;  3QUQ A;  4FZL A;  3D2Q A;  5J0X A;  3F2D A;  3NAS A;  3PW7 A;  5HRF A;  2ZUD A;  2LYA A;  3HJE A;  1S9F A;  3OSP A;  3RJE A;  2HHT A;  7ICL A;  1MC8 A;  2KSO B;  1WOT A;  4ECY A;  4WQK A;  3PSF A;  1RDF A;  3OGU A;  4I2H A;  1XNS A;  1L5U A;  2BCU A;  3KHR A;  1IIP A;  5E79 U;  1NOM A;  4F5N A;  3F2B A;  4Q43 A;  4O69 A;  3G6Y A;  2G0A A;  4BDP A;  3RB3 A;  1HJP A;  3L4P A;  5KFE A;  2DRA A;  2KVS A;  3QE9 Y;  2HN1 A;  1GPJ A;  3CRX A;  2A1J A;  4M04 A;  4ED1 A;  3L9D A;  3ETR A;  5ALQ A;  4US9 A;  2KOB A;  2UVU A;  2H3F A;  5T14 A;  1JUD A;  1ZRM A;  3PVX A;  1OW5 A;  3RRH A;  1V38 A;  5HR6 A;  1ZQL A;  3PX0 A;  4QWC A;  2W03 A;  5F9N A;  4UD4 A;  4PHD A;  3N4M B;  2ZIV A;  2DFL A;  2LYB A;  4DL7 A;  4X4T A;  5EOZ A;  2J6U A;  2BDU A;  4J9K A;  8ICK A;  1Q3U A;  2FMS A;  3G6X A;  1SL0 A;  3LWL A;  3AQE A;  2YMP A;  4QZE A;  4ECW A;  3AQK A;  2ZH6 A;  5ALP A;  4O0I A;  1LKY B;  1NK6 A;  2KIC A;  1FO4 A;  3RTV A;  8ICV A;  5IIO A;  3IN5 A;  3C5F A;  4OAH A;  2H3V A;  3NYB A;  4X4U A;  4UAR A;  2PKE A;  4U6P A;  4X4P A;  1JRP A;  3QU7 A;  4Z6C A;  1L3T A;  5DQG A;  3ICX A;  1ZQO A;  3SAG A;  3K1Z A;  2KNJ A;  1IXR A;  3OTQ A;  2ES6 A;  3H3A A;  2VA8 A;  1B22 A;  4Y2Q A;  1QH9 A;  2VA3 A;  2DGZ A;  3ISB A;  2BCQ A;  5J29 A;  1N60 A;  4Q45 A;  1SKS A;  2MSN A;  3QUT A;  2OH2 A;  4I2B A;  1DXS A;  3B0Y A;  3QX7 A;  4B9U A;  2Y0S C;  5EE0 A;  5KFC A;  5AI4 A;  9ICI A;  2EAN A;  1P7D A;  2E8M A;  3WKA A;  4C8K A;  2NRX A;  5EWE A;  5KG7 A;  5AK3 A;  1DK3 A;  7ICU A;  5HMM A;  1R8B A;  5AM0 A;  5AM1 A;  1YZ6 A;  5B66 U;  3N28 A;  4I29 A;  4MEX A;  2ZH7 A;  1U49 A;  4RQ5 A;  2KP7 A;  1RQL A;  2DQN B;  2RDJ A;  5BOM A;  1HIW A;  3LVV A;  3KHL A;  2PFO A;  4FHY A;  1QSY A;  4O6A A;  3AQL A;  9ICO A;  5ALJ A;  5AK6 A;  3KKA C;  2V4Q A;  3ONN A;  1J97 A;  1TK5 A;  4KLF A;  2DPI A;  3UPS A;  4X4S A;  4NXZ A;  3V6H A;  4KLU A;  4NXX A;  1RPL A;  4RQ4 A;  3QU9 A;  3QXG A;  4O5E A;  3SD7 A;  1R89 A;  4I2A A;  1SZP A;  2QLT A;  3AM9 A;  5DED A;  2ZH1 A;  5ALW A;  5ALH A;  4DS4 A;  2EH9 A;  5DB8 A;  3CK6 A;  4K4I A;  3SV4 A;  2DVI A;  2JEF A;  2KMD A;  4X4O A;  2E5S A;  4O3P A;  2LMR A;  2GAF D;  3QUB A;  2F8L A;  3EW9 A;  3N7P D;  5F9L A;  3RR8 A;  4J9L A;  4F50 A;  3SR6 A;  9ICG A;  1D9F A;  4OJ6 A;  2OEH A;  2FPK A;  5D4B A;  1VDV A;  2O6K A;  5CWR A;  3RH6 A;  1RYU A;  3RJF A;  4RWQ A;  4ZOH C;  1S5L U;  4F3O A;  3WK5 A;  4P4O A;  1PK1 A;  1PVR A;  2M0N A;  1B43 A;  3TAD A;  4CF4 A;  3MFI A;  5KG5 A;  3HP6 A;  1PUZ A;  2ZTD A;  4WOY A;  2AGO A;  4MF8 A;  4FHP A;  3T3F A;  2ZJ5 A;  4JUZ A;  4DSL A;  5CFU A;  4R64 A;  3CYM A;  3BQ2 A;  5AKZ A;  3N7R C;  5KFM A;  5DBA A;  3RJJ A;  3RF9 A;  1D8B A;  4KLG A;  2BDP A;  5AKL A;  3V6J A;  4BWM A;  5JTI A;  4UAS A;  1NK0 A;  3TFR A;  1N48 A;  7ICT A;  2XIC A;  5KG6 A;  7ICH A;  4QZG A;  1MQ3 A;  1Y88 A;  3PST A;  1ZQR A;  2D3D A;  1MIY A;  4FO6 A;  3UM9 A;  2A1A A;  4PZO A;  4K8V A;  4B9T A;  2Y1I A;  4PPX A;  4EED A;  7ICS A;  1OU5 A;  3HWT A;  4YR3 A;  3MGI A;  5KFV A;  4F91 B;  3AL0 B;  1JI7 A;  4QWE A;  1Q8K A;  2EWR A;  4RQ7 A;  3NVZ A;  3BDP A;  5HRD A;  5CA7 A;  4RU9 A;  5D61 A;  1UET A;  4Y2R A;  5J0Y A;  3OVB A;  4PGX A;  1NJY A;  1NJZ A;  1U9L A;  1X9M A;  2ISP A;  2GO7 A;  2BPG A;  4K4G A;  3MR3 A;  2JR5 A;  3CP8 A;  4LVS A;  3PZP A;  2VA2 A;  5EE1 A;  5ALT A;  5J0R A;  2WFA A;  2DF4 B;  4NLZ A;  8ICR A;  4F93 B;  4FH3 A;  5AM4 A;  3C1Y A;  5AKG A;  3AU2 A;  5JTG A;  3ED5 A;  4M6W B;  2JEJ A;  4KMU A;  5AM3 A;  4BUG A;  4DSK A;  2H3Z A;  4WC6 A;  2JZB A;  5G5H A;  5KFT A;  5J2F A;  1ZQS A;  2W04 A;  2BBH A;  5J2G A;  4R63 A;  2JHD A;  2ZIW A;  5ALE A;  2MAX A;  2QB1 A;  5KG1 A;  2RHF A;  3H0M B;  3M8R A;  4OAI Z;  4QZB A;  1LVH A;  1RXW A;  4I27 A;  1C7Y A;  2WF6 A;  4ED2 A;  3HW8 A;  3Q8S B;  2HBJ A;  2W9B A;  4IS7 A;  5C0Y A;  1FIQ A;  5F2V O;  1L7N A;  5L1J A;  5KFK A;  3JPP A;  2R8H A;  1K1Q A;  4F5R A;  4Q8F A;  5DDM A;  2JH1 A;  3FDS A;  3C29 A;  3OWG A;  1QQ7 A;  2KHQ A;  3JPR A;  9ICV A;  4KLJ A;  2I1Q A;  4C4R A;  2B51 A;  8ICU A;  1L8L A;  3VCB A;  5HP4 A;  3T5L A;  4QW8 A;  4WQL A;  5DEC A;  5AKI A;  2G5I B;  1VLB A;  4OJP A;  3JPT A;  5EWG A;  2ZIX B;  4IRD A;  2QAR B;  3BZK A;  4YG2 A;  1Z00 B;  2DR5 A;  1KFT A;  5IIL A;  4KLH A;  4KIT B;  1FFV A;  1WCN A;  4K98 A;  4QNL A;  1Z1V A;  4KN7 A;  5BPC A;  3M7D A;  3LWM A;  4YFK A;  1T3N A;  2Y1J A;  4GXK A;  4F5O A;  2HVH A;  3IG5 A;  2XGP A;  4KB6 A;  1U48 A;  3C18 A;  1KKX A;  4PJ0 U;  1CI4 A;  2GA9 D;  2ZH2 A;  2AXT U;  3MR5 A;  4F4X A;  2AGQ A;  3G6V A;  3TAN A;  2K4E A;  1A76 A;  7ICR A;  5CHE A;  5IIN A;  2AU0 A;  2VIX A;  3RH5 A;  4LEW A;  4G3I A;  3H0L B;  3VC8 A;  3BS5 B;  4J9R A;  3CNH A;  4J9N A;  4YN4 A;  1XU4 A;  2AGP A;  1ZQV A;  3Q8L A;  9ICS A;  1NZP A;  5HNK A;  4K96 A;  3E2E A;  3NVY A;  4AT9 A;  1UEU A;  5KFG A;  2C22 A;  4YCX A;  1F44 A;  1ZQB A;  2FJ6 A;  3H8J A;  4RQN A;  1SGG A;  1UA0 A;  2HHV A;  1RZT A;  3LDA A;  2YMQ A;  4MHV A;  2W8K A;  2ISO A;  4RNN A;  3H7I A;  4RQ3 A;  1O03 A;  1MN8 A;  2HMX A;  2JXJ A;  2PMZ F;  2J6S A;  3UQ0 A;  2ZH8 A;  1M6Y A;  4OJ5 A;  1HUZ A;  4EX7 A;  2DUY A;  2HOI A;  4P0Q A;  9ICE A;  1XO0 A;  4E7X A;  2MUT B;  5J2H A;  1PX5 A;  5DBB A;  3KBB A;  4RQ8 A;  4WBZ A;  2BCS A;  3QNM A;  8ICE A;  4NLN A;  4Y2X A;  8ICL A;  3FC4 A;  4AP9 A;  4FBT A;  2ZH5 A;  5HRG A;  2MRL A;  4OJO A;  4ECQ A;  2B0C A;  3CW2 C;  1DOQ A;  3EYZ A;  1TK0 A;  4KLT A;  4C8M A;  2KTQ A;  4GXJ A;  3M9O B;  1T4G A;  3C21 A;  2BCR A;  2K89 A;  2W7O A;  4Q8E A;  3SMV A;  3NUQ A;  1ZQK A;  4Y2U A;  4I2F A;  2ZUC A;  4NXU A;  4UB2 A;  3D6J A;  3I1Y A;  1L7P A;  1ZQZ A;  4JLZ A;  1CEZ A;  4DCC A;  4DQR A;  2ZUB A;  2R8I A;  4J9M A;  4FO1 A;  5ALK A;  2W43 A;  1VFG A;  3BJY A;  1XS9 D;  2W3S A;  3NGD A;  2LM4 A;  2HHU A;  3F5E A;  4JK1 A;  4FZN A;  1ZJN A;  1RYR A;  3LVW A;  3WFO A;  4EZ6 A;  5KL8 B;  2LKY A;  4DSI A;  5D63 A;  4IL6 U;  4PHA A;  2MA1 A;  3LQC B;  3C5G A;  1NK9 A;  3PR5 B;  1ARO P;  1JXE A;  3RB0 A;  3OJU A;  3KFU F;  4B6J A;  3O0F A;  2W9C A;  4NWI A;  3OUY A;  4DWI A;  5ALN A;  2P35 A;  2NRV A;  3LK9 A;  8ICJ A;  5ALI A;  5ALL A;  4B9L A;  3A0B U;  5DKW A;  3HJ1 A;  1D8Y A;  2ZHA A;  3PSI A;  1EXN A;  3WK7 A;  5ALS A;  5AHX A;  4WC2 A;  2K8B B;  4FS1 A;  9ICN A;  5B3P A;  2Q0Z X;  5KL1 B;  3WK8 A;  7ICI A;  5AK4 A;  8ICB A;  2RP5 A;  2WB1 F;  2OXO A;  2JH7 A;  2ZJA A;  3KKA A;  4RQ6 A;  2W54 A;  2CRX A;  4F2S A;  4R8U A;  3OJS A;  3L3F X;  2PI4 A;  3DEE A;  3HKZ F;  2WTF A;  2W55 A;  1XSL A;  9ICW A;  5KFS A;  1N61 A;  4NLK A;  3JPQ A;  1R8A A;  2OHF A;  4M5D A;  2AQ4 A;  5ALU A;  2K4I A;  3MC1 A;  4OCZ A;  1ZQM A;  1N56 A;  4RUC A;  2M2T A;  3EPI A;  5ALG A;  2F2A B;  4YMN A;  1RYS A;  5L9X A;  5J2K A;  3V7K A;  4F4W A;  2ZH3 A;  4TUS A;  3PO5 A;  5F3X B;  1A77 A;  4O5K A;  2XCA A;  2NO4 A;  1QTM A;  1K5O A;  2QB0 B;  4RPX A;  2P6R A;  5ALZ A;  4LEV A;  3AQF A;  5G5G A;  2C2D A;  4KLS A;  3T5K A;  1L7O A;  1URJ A;  1UT5 A;  2M2W A;  4QWD A;  3WKB A;  4O3N A;  2KG5 A;  4O3S A;  2EQY A;  4M9J A;  1BPX A;  2LM1 A;  4KLE A;  1YLQ A;  3TAC B;  3WFP A;  2GOL A;  5CP2 A;  1ZD3 A;  2HDO A;  2JRZ A;  3BS7 A;  4HX0 A;  1KW4 A;  3QZ7 A;  2HBM A;  1ZQX A;  2G08 A;  5DBC A;  4UAW A;  3E0F A;  4RPZ A;  3B9J A;  3ZD9 A;  1KBU A;  4RUA A;  2DR7 A;  2HSZ A;  1ZD4 A;  3PW5 A;  3PNC A;  3MGV A;  3HRD D;  1QSL A;  5KFR A;  5AK5 A;  1Q3V A;  8ICP A;  1N62 A;  2F44 A;  4GXI A;  3MBY A;  1WCL A;  1X6J A;  3C2L A;  2ZTC A;  5KAF U;  3ISC A;  4YR2 A;  3RJI A;  1JAL A;  4BX9 C;  3NKU A;  4FS2 A;  3M8S A;  3UXO A;  3SV3 A;  3BQ7 A;  4YXJ A;  2E1F A;  1XSN A;  4M6W A;  2L5Y A;  5IIK A;  4YP3 A;  2YTU A;  3H8M A;  4XJE A;  1L7M A;  2RLT A;  5J0T A;  2JMG A;  4DLG A;  2K4P A;  2C2R A;  3ZDB A;  5B3Q A;  2NO5 A;  5J0S A;  4Y2J A;  1RXV A;  1O08 A;  1NKC A;  1MIW A;  2NRZ A;  2WAQ F;  4CF3 A;  4Q44 A;  4TUP A;  3IG8 A;  2IOF K;  4NV0 A;  1VJ7 A;  4R65 A;  4GFJ A;  2DPJ A;  3K75 D;  4EBJ A;  5DB6 A;  1U47 A;  1B0X A;  4IQT A;  1X9W A;  4F8R A;  2KJ9 A;  1IM4 A;  7ICE A;  1ZQU A;  5ALV A;  1XO1 A;  5K4L A;  9ICP A;  2EZY A;  2XY5 A;  2OM6 A;  4UB8 U;  1ZQE A;  5AM5 A;  3K7D A;  3PMN A;  3L5K A;  4ATB A;  1BNO A;  5DLF A;  4ECR A;  2ZIU B;  4RPY A;  4J9O A;  4O3M A;  3PY8 A;  4DL2 A;  4MKP A;  1VJ5 A;  4DF8 A;  2BZF A;  5KFZ A;  3MDA A;  4OJL A;  2PI5 A;  2I9G A;  9ICF A;  4IC9 A;  3F2C A;  4DFP A;  3B0X A;  4AT7 B;  2A1J B;  4ECZ A;  5KT2 A;  2B4V A;  2UVW A;  4Y2S A;  2E1E A;  3C66 A;  4C4S A;  4I2J A;  4EYI B;  2ZTE A;  1COO A;  4RNM A;  1Z1B A;  2KKV A;  5EE3 A;  4CCH A;  2F8K A;  4QZ8 A;  4DFM A;  5H2F U;  2FMQ A;  3JYY A;  1T94 A;  4C4T A;  1N5W A;  3NRZ A;  2ZIV B;  4P4M A;  4E0D A;  1DGJ A;  4HYK A;  1JX4 A;  3JZ0 A;  2D8C A;  4C7Z A;  2R8G A;  1QLN A;  4JMU A;  1SZH A;  3IV6 A;  2KK0 A;  3M6K A;  4NJ8 A;  2YN4 A;  4CDG A;  2OYY A;  2XID A;  4BXO B;  9ICK A;  4JWN A;  3BZC A;  1ZQA A;  3PW4 A;  4KLI A;  4I2C A;  2HW3 A;  2HVI A;  1B4F A;  1ZXI A;  4M9G A;  4DFK A;  3GIJ A;  4M47 A;  4EEK A;  2HOQ A;  3BS5 A;  8ICA A;  1C20 A;  5FP0 A;  3MAB A;  3JPS A;  3KHG A;  9ICJ A;  8ICI A;  5J2I A;  4UQG A;  1QQ5 A;  3PML A;  1IV8 A;  2VAN A;  3QEB Z;  3EPG A;  3C2M A;  3DDH A;  1NK8 A;  2FLL A;  2ZXH A;  4EBK A;  5JRT A;  5AKE A;  5L1M A;  2QKQ A;  1Q79 A;  1N2X A;  4KN4 A;  4PZN A;  4UB1 A;  2YX8 A;  5DB7 A;  3T79 A;  1T3Q A;  8ICN A;  4NKU A;  3NVV A;  1SV4 A;  5HHH A;  2G06 A;  4EBD A;  4MF2 A;  3KOO A;  4Y2Y A;  2WF8 A;  5AI6 A;  2Q66 A;  4M2Y A;  3PV8 A;  4I2E A;  2KKP A;  2NV3 A;  2W7P A;  4O5C A;  3H0R B;  4X4Q A;  4KLQ A;  4N7R A;  4O3R A;  4ED3 A;  1PVQ A;  1V85 A;  5DLG A;  2MU2 A;  1S8O A;  1SB3 C;  3TQ1 A;  4AYB F;  2VJ4 A;  5ALD A;  1R8C A;  4P0P A;  3RB6 A;  5KFP A;  2EAM A;  3TKA A;  7ICM A;  5KFL A;  5L1I A;  4Z6F A;  1SV0 C;  2XI9 A;  3AMZ A;  3WFS C;  4F72 A;  2EDU A;  2FPL A;  3DV9 A;  3BQ1 A;  5KG0 A;  4EEL A;  4K97 A;  3PR4 A;  2DRB A;  1ZQC A;  3QU2 A;  1L3U A;  3OV7 A;  1MA7 A;  4EBC A;  2ESE A;  5J2A A;  5KFY A;  3RFA A;  4DS5 A;  3GIM A;  4BJQ A;  9ICH A;  4I2G A;  2W9M A;  3I76 A;  3V72 A;  5J2J A;  4M9L A;  3GV5 B;  5HRL A;  1JMS A;  3PHZ A;  4IQU A;  4US8 A;  4GC7 A;  5KG3 A;  5KT6 A;  4ED7 A;  1NKE A;  4U7C A;  3V7L A;  2VKQ A;  1TK8 A;  3H38 A;  4DOA A;  3V7J A;  2UVR A;  5KG4 A;  4RZR A;  5DQH A;  2GWS A;  4YXM A;  5CRX A;  4EV6 A;  7ICJ A;  2KJ8 A;  2WF5 A;  2HBK A;  1NZB A;  4UAY A;  3F5A A;  4JB3 A;  8ICY A;  1PK1 B;  2PFN A;  2W9A A;  1D9D A;  4QWA A;  4KMO B;  2KZM A;  2FDR A;  3V6K A;  3SI8 A;  4QW9 A;  3S6J A;  2CPR A;  5KG2 A;  4IQW A;  3GIL A;  4ECT A;  1ZJM A;  2DBY A;  1TFY A;  1PZN A;  5CR0 A;  4DSJ A;  1COK A;  4RNO A;  3KD3 A;  2KSO A;  4X0A A;  3A0H U;  1JIH A;  4NLG A;  4KX3 A;  2KV2 A;  4KTQ A;  4O3Q A;  4MEY A;  9ICQ A;  2HHP A;  1WUD A;  3EZ5 A;  4DL6 A;  5ALO A;  3HIY A;  5KFB A;  4IRK A;  4P2H A;  4NL9 C;  2DKZ A;  4XUS A;  2HI0 A;  3BQT A;  1ZD2 P;  2RDI A;  3HIL A;  4X4V A;  3H37 A;  3KHH A;  4M0A A;  5KNI A;  2ASD A;  1KQQ A;  1ZQJ A;  2OWO A;  2IOF A;  1Z4O A;  2XCP A;  2RFF A;  4O3O A;  4QZH A;  3UQ2 A;  2XY7 A;  3AQN A;  2HCF A;  4RQM A;  4TUQ A;  4OAG A;  1OXJ A;  3RJG A;  3ORY A;  4PHE A;  5J2B A;  4EGW A;  1TFW A;  1A0P A;  2IBK A;  1X9X A;  3GU3 A;  5DGA A;  5CFS A;  5AKH A;  1F5S A;  1DRG A;  5HRB A;  2QB0 A;  9ICL A;  2NRW A;  1FFU A;  3ER8 C;  3I28 A;  1KSP A;  5ALX A;  2FCL A;  4B9N A;  1ZQI A;  3KTQ A;  2H5X A;  4M9H A;  3QUC A;  5AI5 A;  3NVW A;  1L3V A;  3Q8R B;  1LB2 B;  1LKY A;  2M2V A;  9ICM A;  2HOF A;  4DL3 A;  5EWF A;  2ALZ A;  7ICN A;  3OHA A;  2V4R A;  4Z6D A;  4WH5 A;  1RG6 A;  3AN1 A;  1ZRN A;  4WC7 A;  4F5P A;  1X2I A;  8ICF A;  2PFQ A;  2ZIW B;  4JV2 A;  3TAQ A;  1NNL A;  5GTI U;  8ICT A;  3OPX A;  3UPQ A;  2JGA A;  1QCK A;  3EF2 A;  2WF7 A;  3H40 A;  2XY6 A;  1KL9 A;  4B9V A;  4WC1 A;  2HBL A;  5DG8 A;  3HT3 A;  2KZ3 A;  4KX5 A;  3JPN A;  3GZF A;  4FHX A;  4RT2 A;  1YT3 A;  1NK7 A;  4C0Z A;  3ERC C;  4DEZ A;  2F77 X;  1F5A A;  2K8A A;  3IRU A;  4DL5 A;  2JEI A;  3IDW A;  5AKX A;  1SXD A;  4RWP A;  4PGY A;  4RQ2 A;  4UB3 A;  2IHO A;  4O68 A;  3N7S C;  5IIM A;  5HRK A;  4C8O A;  3WKE A;  4EP7 A;  2I5H A;  2OCE A;  4FBU A;  4IG8 A;  5AKJ A;  3SYZ A;  3HPO A;  4UBB A;  2O5A A;  3WFR E;  4IQV A;  1NJW A;  4ECU A;  3D2S A;  5KTQ A;  3RAQ A;  3KZI U;  4F71 A;  3HX0 A;  4FFD A;  4QZF A;  4CRX A;  1BPB A;  3GQC A;  1S10 A;  1NK4 A;  2NRT A;  3Q8M A;  4K9B A;  9ICX A;  2C2E A;  3SQI A;  2VJ5 A;  3RJH A;  3ZDC A;  5D62 A;  1ZQN A;  1KNY A;  5KFF A;  4FHW A;  3SAF A;  3M9N B;  5A0L A;  4O67 A;  5C5J A;  3PX4 A;  2XO7 A;  1WYG A;  2K60 A;  2KD1 A;  1S76 D;  1BPD A;  4I0U A;  3UXN A;  5KFH A;  5L1K A;  3LYS A;  3PX6 A;  1T8E A;  3ZDA A;  4QZD A;  3SZ2 A;  2KZZ A;  4C8L A;  1SKR A;  4AYB C;  1ZQW A;  1LV5 A;  3RRG A;  1KFD A;  4RWN A;  1S0N A;  4UAT A;  1Z4N A;  4FE3 A;  1PVP A;  4KLO A;  5ALY A;  5J2E A;  3PO4 A;  2ID1 A;  1XSP A;  4ED6 A;  2ZIU A;  4J03 A;  2EZZ A;  3IHQ B;  1ZQF A;  2JV3 A;  1S0O A;  2WHE A;  2DR8 A;  2BQU A;  4NKT A;  4EX6 A;  3IP4 B;  3ZDE A;  4AT9 B;  1S97 A;  4LZG A;  1KEJ A;  4UB4 A;  2LPE A;  4Z6E A;  4X5V A;  1X9S A;  4AT7 A;  4CE6 A;  2B6G A;  3WU2 U;  3WFQ E;  3GDX A;  5JUM A;  2AHO B;  1J2N A;  2BHN A;  2EAP A;  4PL1 A;  8ICZ A;  3SEI A;  3TAR A;  2BR0 A;  4Y2P A;  3UMB A;  2H3I A;  5J0P A;  8ICM A;  3AQM A;  5KT5 A;  4P0Q B;  5AM2 A;  5ALF A;  3K1R B;  3Q8Q B;  4IRC A;  3EUB 2;  3ZI4 A;  2ZG6 A;  2IHN A;  2IUB A;  4O9M A;  4LZD A;  5KFO A;  4BXO A;  3RJK A;  1H38 A;  2CN1 A;  2JEG A;  4OAF A;  4BWJ A;  5TIS U;  3RBD A;  3J81 j;  3JPO A;  2NYV A;  2YML A;  3AUO A;  1Z19 A;  3OHB A;  2ZHB A;  5KFD A;  5DGB A;  5J8Y C;  4YD1 A;  5KAI U;  4ELT A;  3NWI A;  1UEV A;  4YQW A;  3N97 B;  4WC4 A;  3UMC A;  4GLX A;  4UB5 A;  4DO9 A;  5HHI A;  4ACO A;  1ZYQ A;  1TV9 A;  4EEB A;  2BQ3 A;  5JU5 A;  3M1Y A;  1S77 D;  3Q8K A;  4FZM A;  2A3V A;  4AT8 B;  5KT3 A;  4JLX A;  2H3Q A;  2IMW P;  4ECV A;  4UBC A;  4GIB A;  4XQ8 A;  3MCR A;  1ZET A;  4ECS A;  2XVT A;  1TKD A;  2KE7 A;  3K4G A;  4E8F A;  1BPE A;  3GIK A;  3THV A;  1X6I A;  3PSP A;  3MR2 A;  2PMZ C;  4NXT A;  1ZQT A;  2AQ0 A;  2FPM A;  4TQS A;  2K8C B;  3QEA Z;  1RQN A;  2ZH9 A;  2W9C B;  1ZQH A;  3OVS A;  3OUY B;  2HHQ A;  3E58 A;  2E3T A;  1MQ2 A;  4RT3 A;  4OD0 A;  1MSW D;  2BPF A;  4DSE A;  1TFR A;  3RAX A;  3RBE A;  2XGQ A;  4QZ9 A;  1UHU A;  4EBE A;  1ZQP A;  4GC6 A;  1PK3 A;  1N5X A;  4QIW F;  2BGW A;  1SWV A;  2BCV A;  5L1L A;  1ZQQ A;  2KN7 A;  3FYH A;  9ICT A;  3GFK B;  4YD2 A;  4JV1 A;  4F4K A;  3QZ8 A;  1L8O A;  5AKY A;  5GTH U;  4Y2V A;  4PHP A;  4NM1 A;  8ICO A;  1SV0 A;  5B5E U;  3ZDD A;  1BVS A;  3RH4 A;  2KIW A;  2F1J A;  1ZQD A;  4HAI A;  5DDY A;  4R8U B;  3NS1 A;  2KFZ A;  1D8L A;  2ZIX A;  5ALM A;  2QAR A;  5DB9 A;  3NTU A;  2DR9 A;  1Z00 A;  5KT7 A;  1FEZ A;  3PW0 A;  4DSF A;  5AIA A;  4PGQ A;  3TAP A;  1KRP A;  3F53 A;  2W11 A;  4DOC A;  4TUR A;  3ETL A;  1ZQG A;  7ICV A;  3EWA A;  4EZ9 A;  9ICA A;  3U26 A;  2PBE A;  4MFF A;  4FH5 A;  4ECX A;  1U4B A;  1S0V A;  1JQR A;  7ICO A;  3KZX A;  9ICB A;  3NRW A;  5AIC A;  7ICP A;  2LYH A;  7ICK A;  3ZD8 A;  4DQQ A;  4LEZ A;  1X42 A;  2G09 A;  2CXY A;  4I2D A;  1XC9 A;  1HEK A;  2HHS A;  3GV8 B;  4J9P A;  3C28 A;  4XQ7 A;  9ICR A;  4ICA A;  2FLP A;  3IM1 A;  4K99 A;  4P4P A;  1UQV A;  1UA1 A;  2B21 A;  4ED0 A;  2ZH4 A;  2WF9 A;  3Q8P B;  1KTQ A;  4QWB A;  2FI1 A;  2GLE A;  2PFP A;  1TAQ A;  5J0Q A;  1J2M A;  2Y9T A;  3GII A;  5HML A;  2M2U A;  3UXP A;  1RM6 C;  1TE2 A;  1UPH A;  5KFI A;  5CB1 A;  5HRE A;  2I6X A;  4QJF B;  9ICC A;  2WB1 C;  4WC5 A;  4S3N A;  2AH5 A;  1K1S A;  3OSN A;  2YY6 A;  2HHW A;  2AJQ A;  4RWO A;  5HRH A;  1KFS A;  3MFH A;  1NI3 A;  5KFQ A;  4QZA A;  1TAM A;  3D2N A;  1GO3 F;  2HN2 A;  3HKZ C;  2EAO A;  2F1I A;  4UAZ A;  5EE9 A;  2IOH A;  4C80 A;  1SKW A;  1QQ6 A;  5AIB A;  4NL9 A;  4WC0 A;  2MUT A;  2R8K A;  2YMM A;  3MGH A;  1NKB A;  1FA0 A;  4C8N A;  4QZI A;  5HR7 A;  2ASJ A;  2E8N A;  4UAV A;  1BGX T;  1ZD5 A;  2KJ5 A;  2N1R A;  3H8W A;  2RQ5 A;  4DQP A;  5IIJ A;  4NXW A;  3H39 A;  1JRO A;  4I2I A;  2FLN A;  4ELV A;  3H8S A;  1CUK A;  1X40 A;  5CEH A;  4WBY A;  2M9N A;  2Y9U A;  3T5H A;  3NVO A;  3M6Z A;  4EYH B;  4K9A A;  3OVA A;  1A6S A;  2BBJ A;  4YVZ A;  3QU5 A;  1BPZ A;  4Y2T A;  8ICW A;  4XRH A;  1IG6 A;  4UAU A;  1JN3 A;  2DL0 A;  5AKK A;  4C7Y A;  5CJ7 A;  4DFD A;  3TAD C;  4FHV A;  3QYP A;  5KFW A;  4CF5 A;  4MFA A;  1NO5 A;  2EZX A;  4CNQ A;  3AEV A;  1L6N A;  5KFX A;  5J0U A;  1L3S A;  1SL1 A;  3H4D A;  4F5Q A;  3R9K A;  2E8P A;  2NRK A;  1Z3E B;  2F76 X;  2G07 A;  4A8E A;  7ICF A;  4QZC A;  4ATB B;  1ZOL A;  4USA A;  3H4B A;  1Q78 A;  4IR1 A;  3RR7 A;  3TI0 A;  8ICH A;  3C1Z A;  4F4Z A;  4WJ3 B;  4ED8 A;  1ZQ1 C;  4X4R A;  4B9M A;  2W8L A;  1KN5 A;  2KEY A;  2KVC A;  3WKC A;  1UCV A;  1JXL A;  4IR9 A;  1KDH A;  1TVA A;  2KHV A;  5HR9 A;  4NXV A;  3TFS A;  2GH1 A;  5CHG A;  8ICG A;  2DWQ A;  2F1H A;  2XC9 A;  3RB4 A;  1V97 A;  2Q4T A;  2BQR A;  1UT8 A;  2D6F C;  4PL2 A;  3ER9 B;  1DK2 A;  3ALR A;  1S0M A;  3MR6 A;  2F3N A;  1V4A A;  1X66 A;  2P66 A;  4LT6 A;  4TQR A;  5KFN A;  4F4Y A;  4JV0 A;  3AU6 A;  5KFJ A;  3HJ4 A;  2FMP A;  5AI9 A;  2IHM A;  2P6U A;  4XA5 A;  5III A;  4DQS A;  5AI8 A;  3T5J A;  1AQ6 A;  1U45 A;  2WAQ C;  2YB4 A;  1YZ7 A;  2Y0S F;  4F2R A;  4ELU A;  2HHX A;  1SWW A;  2ATL A;  2ZXI A;  3QU4 A;  2KFN A;  4E80 A;  1ZQY A;  4J9S A;  1T7P A;  4DOB A;  1Q46 A;  2LI6 A;  3WK4 A;  4MFC A;  4QIW C;  8ICQ A;  4EEN A;  2BKE A;  2ODG A;  9ICU A;  2YB1 A;  4G9B A;  2RRD A;  2O1P A;  2A19 A;  2KIV A;  7ICG A;  4DF4 A;  4K4H A;  4KLD A;  4KLL A;  1TAU A;  2ZJ8 A;  5CFT A;  4JWM A;  4J9Q A;  3FM9 A;  4KM5 A;  5J2D A;  1SL2 A;  4DL4 A;  2R18 A;  4NM2 A;  1CRX A;  2LBO A;  4X4N A;  2R8J A;  8ICX A;  4YR0 A;  3SEN A;  1WWU A;  5D49 A;  3UMG A;  4UW9 A;  4NY8 A;  2YQE A;  4DQI A;  5J0O A;  2IA6 A;  2UVV A;  2JZB B;  4LJX A;  3PW2 A;  1NK5 A;  1OUQ A;  3BQ0 A;  2DKX A;  8ICC A;  4OO1 J;  1ECW A;  2BPC A;  4UD5 A;  1N63 A;  4BGD A;  5J2C A;  5BOL A;  4EEY A;  3FAH A;  4WC3 A;  4KLM A;  7ICQ A;  2Z7J A;  1NJX A;  2BE3 A;  5HC9 A;  4P0P B;  4LEY A;  4B9S A;  3WK6 A;  3WKD A;  5J0W A;  4DLE A;  5DG9 A;  1HUO A;  5KFU A;  1QSS A;  4RQ0 A;  2J6T A;  2W9B B;  3JCF A;  4ZH4 A;  4X0B A;  1WWV A;  4YMM A;  2ASL A;  2LHT A;  1XWL A;  3M9M B;  2G5H B;  4NLB A;  4NLC A;  5D46 A;  1BNP A;  2K4H A;  2E8O A;  4CGZ A;  2FE9 A;  1BPY A;  3WK9 A;  8ICS A;  3SAH A;  5TZV A;  2B56 A;  4AT8 A;  2W3R A;  3C2K A;  5AI0 A;  4YMO A;  4F92 B;  4I28 A;  5HRI A;  5KT4 A;  1MIV A; 
#chains in the Genus database with same CATH homology
 1ZQA A;  3PW4 A;  1T3N A;  3N97 B;  4KLI A;  4WC4 A;  2Y1J A;  4GXK A;  4F5O A;  4I2C A;  4M9N A;  2HVH A;  2HW3 A;  2HVI A;  4GLX A;  3LWM A;  4UB5 A;  4DO9 A;  2XGP A;  5DG7 A;  1U48 A;  5HHI A;  4M9G A;  3MDC A;  3GIJ A;  4DFK A;  3C18 A;  1ZYQ A;  4M47 A;  1TV9 A;  2PXI A;  8ICA A;  4RQ1 A;  2BQ3 A;  1KLN A;  3MAB A;  1V9P A;  3JPS A;  1S77 D;  3Q8K A;  1JAJ A;  3KHG A;  4AT8 B;  3GV7 B;  5KT3 A;  2ZH2 A;  9ICJ A;  8ICI A;  3MR5 A;  5J2I A;  4UQG A;  4F4X A;  2C28 A;  4R66 A;  2AGQ A;  3ISD A;  2IMW P;  3G6V A;  4DFJ A;  4ECV A;  3PML A;  3TAN A;  1A76 A;  2VAN A;  4UBC A;  3QEB Z;  1DGS A;  3EPG A;  3C2M A;  7ICR A;  4WCW A;  4XQ8 A;  1NK8 A;  2FLL A;  1ZET A;  5KFA A;  4ECS A;  4PH5 A;  5DQI A;  5IIN A;  2AU0 A;  4EBK A;  3RH5 A;  2V9W A;  1TKD A;  1Q79 A;  4G3I A;  3C23 A;  3K4G A;  4E8F A;  4KN4 A;  1BPE A;  4J9R A;  5J0X A;  3PW7 A;  5HRF A;  4UB1 A;  3GIK A;  4J9N A;  4YN4 A;  1XU4 A;  2ZUD A;  5DB7 A;  3MR2 A;  3THV A;  2AGP A;  1ZQV A;  3Q8L A;  1S9F A;  3OSP A;  3RJE A;  2HHT A;  8ICN A;  5HHH A;  9ICS A;  1NZP A;  5HNK A;  4NKU A;  3E2E A;  4EBD A;  1ZQT A;  4MF2 A;  7ICL A;  4AT9 A;  4LT6 A;  1MC8 A;  1WOT A;  4ECY A;  2AQ0 A;  2FPM A;  5KFG A;  4TQS A;  3OGU A;  3QEA Z;  2C22 A;  1UEU A;  2Q66 A;  4I2H A;  4M2Y A;  4YCX A;  2ZH9 A;  1ZQB A;  3H8J A;  2W9C B;  1ZQH A;  3PV8 A;  4I2E A;  3OVS A;  3OUY B;  2HHQ A;  1L5U A;  1UA0 A;  2BCU A;  2HHV A;  1MQ2 A;  4O5C A;  3KHR A;  4RT3 A;  4X4Q A;  1RZT A;  4KLQ A;  3LDA A;  4O3R A;  4ED3 A;  1MSW D;  5DLG A;  2BPF A;  4DSE A;  1TFR A;  2W8K A;  2ISO A;  1NOM A;  4RNN A;  4F5N A;  3RAX A;  3H7I A;  3RBE A;  4Q43 A;  2XGQ A;  3G6Y A;  4QZ9 A;  3TQ1 A;  4RQ3 A;  4EBE A;  4BDP A;  1ZQP A;  4GC6 A;  3RB3 A;  1R8C A;  2J6S A;  1HJP A;  3RB6 A;  5KFP A;  3UQ0 A;  2BGW A;  2ZH8 A;  5KFE A;  1HUZ A;  7ICM A;  9ICE A;  5KFL A;  2BCV A;  2DRA A;  5L1L A;  3QE9 Y;  1ZQQ A;  5L1I A;  2KN7 A;  4Z6F A;  3FYH A;  4E7X A;  9ICT A;  2A1J A;  3GFK B;  4YD2 A;  4M04 A;  4ED1 A;  4JV1 A;  2MUT B;  4F4K A;  3L9D A;  5J2H A;  1PX5 A;  5DBB A;  3QZ8 A;  3WFS C;  4RQ8 A;  2UVU A;  4PHP A;  4NM1 A;  8ICO A;  2FPL A;  3BQ1 A;  4WBZ A;  5KG0 A;  2BCS A;  3ZDD A;  8ICE A;  4NLN A;  1BVS A;  3RH4 A;  1ZQD A;  2F1J A;  8ICL A;  3PR4 A;  2DRB A;  5DDY A;  4FBT A;  4R8U B;  1ZQC A;  3PVX A;  2ZH5 A;  3RRH A;  5HRG A;  1L3U A;  3OV7 A;  1ZQL A;  3PX0 A;  4QWC A;  2KFZ A;  1D8L A;  4EBC A;  5F9N A;  5J2A A;  5DB9 A;  4PHD A;  4ECQ A;  4UD4 A;  5KFY A;  3NTU A;  2DR9 A;  3N4M B;  1Z00 A;  3OVA A;  1DOQ A;  5KT7 A;  3EYZ A;  4DS5 A;  2DFL A;  1TK0 A;  3PW0 A;  4DSF A;  4KLT A;  4DL7 A;  4X4T A;  5EOZ A;  3GIM A;  4C8M A;  4PGQ A;  4J9K A;  3TAP A;  2J6U A;  2KTQ A;  4GXJ A;  3M9O B;  1KRP A;  9ICH A;  8ICK A;  1T4G A;  3C21 A;  2W9M A;  3V72 A;  4I2G A;  2BCR A;  4DOC A;  5J2J A;  4TUR A;  4M9L A;  3GV5 B;  2FMS A;  5HRL A;  4Q8E A;  3ETL A;  3G6X A;  1SL0 A;  1JMS A;  1ZQK A;  3LWL A;  1ZQG A;  4IQU A;  4QZE A;  4ECW A;  4I2F A;  3AQK A;  2ZH6 A;  4GC7 A;  3EWA A;  7ICV A;  5KG3 A;  5KT6 A;  4EZ9 A;  9ICA A;  2PBE A;  4O0I A;  2ZUC A;  4ED7 A;  4MFF A;  4UB2 A;  4FH5 A;  1NK6 A;  4ECX A;  1U4B A;  1ZQZ A;  1NKE A;  1S0V A;  3V7L A;  3RTV A;  8ICV A;  1TK8 A;  5IIO A;  4DQR A;  1CEZ A;  4DOA A;  3H38 A;  3V7J A;  3C5F A;  7ICO A;  2UVR A;  1JQR A;  5KG4 A;  2ZUB A;  4RZR A;  2R8I A;  9ICB A;  5DQH A;  7ICP A;  4J9M A;  2GWS A;  2LYH A;  1VFG A;  3NYB A;  4YXM A;  4X4U A;  7ICK A;  3BJY A;  1XS9 D;  7ICJ A;  3ZD8 A;  4DQQ A;  3NGD A;  2HHU A;  4X4P A;  4UAY A;  4Z6C A;  4I2D A;  4JK1 A;  5DQG A;  1L3T A;  1ZJN A;  1XC9 A;  1ZQO A;  1RYR A;  2HHS A;  8ICY A;  3WFO A;  2PFN A;  1IXR A;  3GV8 B;  2W9A A;  4J9P A;  1D9D A;  4QWA A;  4EZ6 A;  4XQ7 A;  3H3A A;  2VA8 A;  4DSI A;  2FLP A;  2KZM A;  9ICR A;  1B22 A;  2VA3 A;  3IM1 A;  3ISB A;  3V6K A;  1S10 A;  2BCQ A;  4PHA A;  3SI8 A;  4QW9 A;  3LQC B;  4P4P A;  5J29 A;  5KG2 A;  4Q45 A;  1SKS A;  4IQW A;  3GIL A;  4ECT A;  1ZJM A;  3C5G A;  1UA1 A;  1NK9 A;  1PZN A;  3B0Y A;  5CR0 A;  2B21 A;  3PR5 B;  4ED0 A;  3Q8P B;  4DSJ A;  1ARO P;  1KTQ A;  4I2B A;  2ZH4 A;  4B9U A;  4QWB A;  4RNO A;  1JXE A;  5KFC A;  3RB0 A;  2PFP A;  9ICI A;  3OJU A;  1TAQ A;  5J0Q A;  4X0A A;  1JIH A;  3GII A;  4C8K A;  5HML A;  2NRX A;  4NLG A;  3UXP A;  2M2U A;  5EWE A;  5KG7 A;  1DK3 A;  2W9C A;  4KTQ A;  5KFI A;  4O3Q A;  5HMM A;  7ICU A;  1R8B A;  5CB1 A;  5HRE A;  3OUY A;  4MEY A;  4DWI A;  9ICQ A;  9ICC A;  3LK9 A;  2NRV A;  8ICJ A;  4WC5 A;  4I29 A;  4MEX A;  3EZ5 A;  2HHP A;  1U49 A;  4RQ5 A;  4B9L A;  4S3N A;  2ZH7 A;  1K1S A;  3OSN A;  2KP7 A;  2RDJ A;  5DKW A;  2HHW A;  4DL6 A;  2AJQ A;  3HJ1 A;  5BOM A;  1D8Y A;  1KFS A;  5HRH A;  4RWO A;  3MFH A;  2ZHA A;  5KFQ A;  4QZA A;  3HIY A;  5KFB A;  3KHL A;  4IRK A;  1EXN A;  2PFO A;  4P2H A;  4FHY A;  2F1I A;  4UAZ A;  1QSY A;  4WC2 A;  4XUS A;  9ICO A;  3AQL A;  4FS1 A;  3BQT A;  9ICN A;  1SKW A;  2RDI A;  4WC0 A;  2Q0Z X;  2MUT A;  2V4Q A;  1TK5 A;  4X4V A;  2R8K A;  3KHH A;  4M0A A;  4KLF A;  7ICI A;  2ASD A;  3MGH A;  1NKB A;  1FA0 A;  1ZQJ A;  2OWO A;  2DPI A;  8ICB A;  3UPS A;  2XCP A;  2RFF A;  4X4S A;  4C8N A;  2ZJA A;  4NXZ A;  4QZI A;  4O3O A;  4QZH A;  4RQ6 A;  3UQ2 A;  3V6H A;  2XY7 A;  4KLU A;  2ASJ A;  4F2S A;  1RPL A;  4RQ4 A;  4R8U A;  3AQN A;  3OJS A;  1BGX T;  4O5E A;  4TUQ A;  1R89 A;  2PI4 A;  4I2A A;  1SZP A;  3H8W A;  2WTF A;  3RJG A;  1XSL A;  5DED A;  2ZH1 A;  3ORY A;  4PHE A;  5J2B A;  9ICW A;  4DS4 A;  5KFS A;  5DB8 A;  1TFW A;  4DQP A;  2IBK A;  4K4I A;  3SV4 A;  5DGA A;  2DVI A;  5IIJ A;  4NLK A;  3JPQ A;  1R8A A;  3H39 A;  2JEF A;  4M5D A;  2AQ4 A;  5HRB A;  9ICL A;  4I2I A;  2FLN A;  4ELV A;  2NRW A;  3H8S A;  1CUK A;  4X4O A;  1ZQM A;  1KSP A;  4O3P A;  1N56 A;  4RUC A;  4B9N A;  1ZQI A;  3KTQ A;  2M2T A;  2H5X A;  2M9N A;  3EPI A;  3T5H A;  3H37 A;  4M9H A;  3EW9 A;  4WBY A;  4EYH B;  5F9L A;  1L3V A;  4YMN A;  3Q8R B;  4J9L A;  1RYS A;  5L9X A;  4YVZ A;  4F50 A;  1LB2 B;  3RR8 A;  9ICM A;  2M2V A;  4DL3 A;  1BPZ A;  9ICG A;  5EWF A;  2ALZ A;  1D9F A;  7ICN A;  5J2K A;  3V7K A;  4XRH A;  8ICW A;  4F4W A;  3OHA A;  2FPK A;  5D4B A;  5CWR A;  2ZH3 A;  3RH6 A;  2V4R A;  4Z6D A;  4TUS A;  3PO5 A;  1A77 A;  4O5K A;  2XCA A;  3RJF A;  1QTM A;  1JN3 A;  4RWQ A;  5CJ7 A;  4WC7 A;  4RPX A;  4F5P A;  2P6R A;  1X2I A;  4FHV A;  8ICF A;  2PFQ A;  5KFW A;  4F3O A;  2C2D A;  4MFA A;  4KLS A;  1NO5 A;  4P4O A;  4JV2 A;  3TAQ A;  3T5K A;  5KG5 A;  1B43 A;  3MFI A;  5KFX A;  5J0U A;  1L3S A;  1UT5 A;  3HP6 A;  2M2W A;  4QWD A;  1SL1 A;  3H4D A;  4F5Q A;  2ZTD A;  4O3N A;  8ICT A;  2NRK A;  3WFP A;  2AGO A;  3UPQ A;  1Z3E B;  4O3S A;  4MF8 A;  4M9J A;  7ICF A;  4FHP A;  4QZC A;  3T3F A;  4ATB B;  1BPX A;  3H4B A;  2ZJ5 A;  4JUZ A;  4DSL A;  1Q78 A;  4R64 A;  4KLE A;  4IR1 A;  1YLQ A;  3H40 A;  3BQ2 A;  2XY6 A;  5KFM A;  5DBA A;  3TI0 A;  3RR7 A;  3RJJ A;  4B9V A;  8ICH A;  5CP2 A;  4WC1 A;  5DG8 A;  3HT3 A;  2KZ3 A;  3C1Z A;  2BDP A;  4KLG A;  3JPN A;  4F4Z A;  4FHX A;  4RT2 A;  1NK7 A;  4ED8 A;  3QZ7 A;  3V6J A;  4BWM A;  4X4R A;  4B9M A;  1ZQX A;  4DEZ A;  2W8L A;  5DBC A;  1NK0 A;  1F5A A;  4UAW A;  3TFR A;  4RPZ A;  4DL5 A;  1N48 A;  7ICT A;  3ZD9 A;  2JEI A;  4RUA A;  4RWP A;  5KG6 A;  4PGY A;  1JXL A;  4RQ2 A;  4UB3 A;  4IR9 A;  7ICH A;  1KDH A;  2DR7 A;  4QZG A;  3PW5 A;  1TVA A;  1MQ3 A;  1Y88 A;  3PNC A;  1ZQR A;  5IIM A;  5HR9 A;  1QSL A;  5HRK A;  4C8O A;  3TFS A;  1MIY A;  1TFY A;  5KFR A;  4EP7 A;  5CHG A;  8ICG A;  4FO6 A;  4FBU A;  2F1H A;  2XC9 A;  3RB4 A;  4BXO B;  8ICP A;  4IG8 A;  3SYZ A;  3HPO A;  4B9T A;  4GXI A;  4UBB A;  2BQR A;  3MBY A;  2O5A A;  1UT8 A;  3WFR E;  2Y1I A;  1WCL A;  4IQV A;  1NJW A;  1DK2 A;  4ECU A;  1S0M A;  3MR6 A;  4PPX A;  5KTQ A;  3RAQ A;  3C2L A;  7ICS A;  2ZTC A;  1OU5 A;  3ISC A;  1V4A A;  4YR2 A;  2P66 A;  3HX0 A;  3RJI A;  4QZF A;  4YR3 A;  3MGI A;  4TQR A;  5KFN A;  1BPB A;  5KFV A;  4F91 B;  3HWT A;  2NRT A;  4JV0 A;  3GQC A;  4F4Y A;  3AU6 A;  5KFJ A;  3Q8M A;  1NK4 A;  3HJ4 A;  4FS2 A;  2FMP A;  2C2E A;  9ICX A;  3M8S A;  4QWE A;  3RJH A;  3UXO A;  3ZDC A;  2IHM A;  2P6U A;  4XA5 A;  3SV3 A;  4RQ7 A;  5III A;  1ZQN A;  1KNY A;  4YXJ A;  3BDP A;  5HRD A;  5CA7 A;  4DQS A;  3T5J A;  5KFF A;  4RU9 A;  1U45 A;  1XSN A;  4FHW A;  1UET A;  3M9N B;  4M6W A;  5C5J A;  5J0Y A;  3PX4 A;  3OVB A;  4PGX A;  1NJY A;  5IIK A;  4YP3 A;  1NJZ A;  1U9L A;  2XO7 A;  4F2R A;  1X9M A;  4ELU A;  2HHX A;  2ISP A;  4K4G A;  2BPG A;  1S76 D;  5J0T A;  2ATL A;  1BPD A;  3MR3 A;  4DLG A;  4LVS A;  3UXN A;  5KFH A;  5L1K A;  3PX6 A;  2C2R A;  2VA2 A;  3ZDB A;  5J0R A;  1T8E A;  4NLZ A;  3ZDA A;  2KFN A;  4QZD A;  4E80 A;  3SZ2 A;  1ZQY A;  4J9S A;  4C8L A;  1SKR A;  2KZZ A;  4F93 B;  1T7P A;  8ICR A;  4DOB A;  1ZQW A;  1LV5 A;  4MFC A;  5J0S A;  1RXV A;  8ICQ A;  4FH3 A;  3RRG A;  2BKE A;  3C1Y A;  1KFD A;  3AU2 A;  1NKC A;  9ICU A;  1MIW A;  4RWN A;  1S0N A;  2NRZ A;  4M6W B;  2JEJ A;  2O1P A;  4Q44 A;  4KMU A;  4KLO A;  7ICG A;  4DSK A;  4DF4 A;  4WC6 A;  4TUP A;  5J2E A;  2JZB A;  4K4H A;  4KLD A;  4KLL A;  1TAU A;  2ZJ8 A;  1VJ7 A;  3PO4 A;  4R65 A;  2ID1 A;  1XSP A;  4ED6 A;  2DPJ A;  3K75 D;  4JWM A;  5KFT A;  5J2F A;  4J9Q A;  1ZQS A;  4EBJ A;  5DB6 A;  1U47 A;  5J2D A;  1SL2 A;  4IQT A;  4DL4 A;  3IHQ B;  4NM2 A;  5J2G A;  1X9W A;  4R63 A;  1ZQF A;  4F8R A;  1IM4 A;  2MAX A;  4X4N A;  2R8J A;  1ZQU A;  1S0O A;  1XO1 A;  7ICE A;  8ICX A;  5KG1 A;  9ICP A;  2DR8 A;  4YR0 A;  5D49 A;  3M8R A;  2BQU A;  2XY5 A;  4QZB A;  4NY8 A;  4NKT A;  3ZDE A;  1RXW A;  1ZQE A;  4AT9 B;  4DQI A;  4I27 A;  5J0O A;  1S97 A;  1C7Y A;  4LZG A;  2IA6 A;  3PMN A;  1KEJ A;  2UVV A;  4ATB A;  4ED2 A;  2JZB B;  4UB4 A;  4Z6E A;  3PW2 A;  4X5V A;  1NK5 A;  1X9S A;  1BNO A;  5DLF A;  3BQ0 A;  4AT7 A;  4ECR A;  3HW8 A;  8ICC A;  4RPY A;  3Q8S B;  3WFQ E;  3GDX A;  5JUM A;  2W9B A;  4J9O A;  3PY8 A;  2BPC A;  4UD5 A;  4DL2 A;  2BHN A;  4BGD A;  5J2C A;  8ICZ A;  3TAR A;  5BOL A;  4EEY A;  2BR0 A;  4DF8 A;  5F2V O;  4WC3 A;  5L1J A;  5J0P A;  5KFK A;  4KLM A;  1NJX A;  5KFZ A;  8ICM A;  7ICQ A;  2BE3 A;  3JPP A;  5HC9 A;  3MDA A;  2R8H A;  1K1Q A;  2PI5 A;  2I9G A;  3AQM A;  4B9S A;  4F5R A;  5KT5 A;  4Q8F A;  9ICF A;  5J0W A;  5DDM A;  4DLE A;  4DFP A;  5DG9 A;  3FDS A;  3B0X A;  4AT7 B;  2A1J B;  4ECZ A;  5KT2 A;  3JPR A;  9ICV A;  2UVW A;  1HUO A;  5KFU A;  1QSS A;  4RQ0 A;  3Q8Q B;  4KLJ A;  2I1Q A;  4IRC A;  2J6T A;  2IHN A;  2W9B B;  8ICU A;  4O9M A;  4LZD A;  3C66 A;  4ZH4 A;  5HP4 A;  3T5L A;  4QW8 A;  4X0B A;  5KFO A;  4YMM A;  4BXO A;  2ASL A;  5DEC A;  3RJK A;  1H38 A;  4I2J A;  4EYI B;  2ZTE A;  3JPT A;  1COO A;  1XWL A;  4RNM A;  3M9M B;  5EWG A;  4CCH A;  4QZ8 A;  5D46 A;  1BNP A;  4DFM A;  4IRD A;  2FMQ A;  3JYY A;  2JEG A;  4YG2 A;  4BWJ A;  1Z00 B;  3RBD A;  2DR5 A;  3JPO A;  4P4M A;  4E0D A;  1BPY A;  1KFT A;  5IIL A;  4HYK A;  1JX4 A;  4KLH A;  3JZ0 A;  8ICS A;  3AUO A;  4KIT B;  5TZV A;  3OHB A;  4AT8 A;  2ZHB A;  1WCN A;  2R8G A;  1QLN A;  5KFD A;  5DGB A;  4YD1 A;  3C2K A;  4ELT A;  4YMO A;  4F92 B;  4I28 A;  5HRI A;  5KT4 A;  4KN7 A;  5BPC A;  1MIV A;  1UEV A;  4YFK A;  4YQW A;  9ICK A;  4JWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...