5HHHA

Structure of human dna polymerase beta host-guest complexed with the control g for n7-cbz-platination
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
327
structure length
325
Chain Sequence
b'ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Synthesis, structure, and biological evaluation of a platinum-carbazole conjugate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 111
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5hhhA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5hhhA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hhhA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hhhA03
4B9MA 4FHWA 4RPXA 3RRGA 4YR2A 4Q8FA 1ZQLA 5L1IA 3RB3A 1ZQXA 3PMNA 2Y1IA 1XSNA 4UB1A 3Q8LA 4NLNA 4ECYA 4KLEA 2HHWA 1BPXA 4X0AA 5J0RA 3MABA 1R8AA 4I27A 5L1JA 5L1KA 3PX0A 3ZDEA 4ED1A 1ZQUA 7ICMA 1NK4A 2VA3A 1DK3A 1L3SA 2ZJ8A 1JXLA 4DL3A 3RR8A 2R8HA 2KFZA 9ICTA 2JEIA 4PGYA 1F5AA 1QSYA 4I2CA 4RPYA 1V4AA 8ICWA 4WC5A 4IQTA 3PO5A 1ZQQA 3PW7A 5J0QA 4ED7A 5L9XA 4O3PA 5HR9A 3BQTA 4K4IA 3MFIA 3RH4A 1NJXA 4KN7A 1HUOA 1BPZA 1U47A 1L3UA 5DQGA 1MSWD 2ZJAA 3PVXA 9ICNA 7ICSA 1HUZA 2PFPA 4M5DA 1XU4A 5DB6A 2ASJA 5CHGA 4Z6EA 2ZH2A 4WC1A 2C22A 3C21A 5KG7A 2XGPA 5KFSA 3KHHA 2BR0A 1RXWA 4P4PA 5HRFA 3PW2A 4KN4A 4TUQA 3C2KA 5DGAA 4JV1A 8ICKA 4C8KA 4WC6A 2AJQA 5KG1A 3TANA 4QZHA 4RT2A 3LK9A 3MBYA 5J2CA 3ISDA 1R8CA 4MFFA 4FHVA 5DKWA 2PBEA 4LT6A 4JV0A 3FDSA 5J2DA 4QWDA 3Q8SB 3ZD8A 4RQ8A 4IQWA 4IG8A 4E80A 4KLLA 2ZJ5A 4DQQA 5IINA 3OUYB 2C2DA 4FS2A 5BOMA 7ICIA 3HW8A 1TVAA 2HHVA 7ICOA 9ICUA 1JMSA 2B21A 4KLIA 3UXOA 1TK8A 4FBUA 3EW9A 5HMMA 4UBCA 4BGDA 5DLGA 3GV8B 2XY7A 4FHYA 1BPDA 4YXMA 3G6VA 9ICEA 8ICSA 2XC9A 3TAQA 3HJ1A 4Z6CA 4E0DA 5KFFA 2O5AA 1BPBA 1BVSA 1ZQNA 1B22A 3M9NB 3EYZA 1KFTA 1CUKA 5IIKA 4ELVA 4BXOA 4P4OA 4YR3A 3TQ1A 2ASDA 1NJZA 4KTQA 9ICRA 1DK2A 7ICEA 4RQ0A 1LV5A 4LZGA 4J9KA 2KZZA 4P4MA 5KFNA 4RNOA 2KN7A 1UA0A 4F4XA 3MGIA 3Q8MA 1U9LA 3H7IA 8ICRA 1U45A 5DB9A 1R89A 2MUTB 4ECQA 3C2LA 3QZ7A 1ZQPA 3JPOA 3TI0A 3BQ2A 4QWEA 1KFSA 2JEGA 1KDHA 3RJEA 4XUSA 3MR3A 3AQKA 4PHPA 5IIMA 4QZGA 2R8IA 3SV3A 1NK5A 3T5JA 1S0MA 4K4GA 1ZQYA 1T4GA 4I2FA 1ZQDA 4O3NA 4F4YA 5KFQA 9ICQA 3RB4A 4C8LA 3EWAA 2FPKA 2V4QA 3SYZA 4YFKA 1RZTA 5KT7A 4F5NA 3B0XA 4FS1A 3RTVA 2M2VA 1X9SA 2HVHA 7ICNA 7ICLA 4NXZA 1LB2B 4FH5A 1K1QA 8ICZA 3L9DA 4PH5A 1SL2A 5HREA 4R66A 2DVIA 5J0YA 3H4BA 5HRGA 1RYRA 2HW3A 2KFNA 3QE9Y 4GLXA 5J0TA 3C66A 4DSIA 4YN4A 2ASLA 8ICFA 4RZRA 3K4GA 5DEDA 2IHMA 2FPLA 4I2DA 4DSEA 1KLNA 4J9SA 3H8JA 8ICEA 2DRAA 1NK9A 8ICNA 9ICMA 1EXNA 3MGHA 5KT2A 1NK8A 3HT3A 1D9FA 4J9MA 4F4KA 4NKTA 2ZUDA 3EPIA 2KZ3A 3ETLA 3E2EA 7ICRA 4X4SA 4GC6A 2RDIA 1JN3A 4E8FA 4NY8A 4KLJA 9ICIA 3HJ4A 2ZH5A 9ICJA 4RNNA 2DR7A 4DS4A 1XSLA 5J29A 4DSLA 2F1JA 4BWMA 5DG8A 4DFKA 4JUZA 4DFPA 3B0YA 3ZDDA 2UVUA 5KFVA 3Q8KA 4K4HA 8ICBA 4IQUA 3C5FA 4J9RA 9ICGA 1KFDA 4X4PA 2HHTA 4KLSA 2XO7A 1S0OA 3HWTA 2M2TA 1UT5A 2ZUCA 1TFRA 5KT5A 5IILA 4TQSA 4FO6A 4ECWA 3SI8A 7ICUA 4R64A 1SL0A 4DSFA 2RDJA 3HIYA 3C18A 4DL2A 3RJKA 3OSPA 2M9NA 9ICAA 2V4RA 4YMNA 2BCRA 4IR1A 3RR7A 3UPSA 5CB1A 1U49A 5CA7A 4DQSA 2BGWA 4GXKA 4DS5A 3T3FA 1DOQA 5HRKA 4F4ZA 2FLPA 1U4BA 4ZH4A 4AT7B 5J2BA 3BQ1A 4F4WA 2F1HA 2JZBA 1WCLA 5EOZA 1ZQFA 2F1IA 4AT8A 2FLNA 1SKWA 4QZAA 1UA1A 4F2RA 5KG5A 2HHXA 2HHSA 2NRVA 5KFDA 2RFFA 2ZHBA 1PZNA 4DLEA 1D8YA 3OSNA 1TV9A 2OWOA 5D49A 5KT3A 4I29A 3H40A 5BPCA 1JX4A 4O3QA 3C2MA 2VANA 2ATLA 4B9NA 3GV7B 4YG2A 4RUCA 3OHBA 2W9BA 5DG7A 4TQRA 4DQRA 2A1JA 3PV8A 1MQ3A 3V7KA 8ICPA 1MIYA 2C2EA 2FMQA 4NKUA 8ICTA 2Y1JA 4GC7A 2ZTEA 1S9FA 3H4DA 5BOLA 1WCNA 5KFOA 5HMLA 4F5OA 3V72A 2PFNA 3RBDA 3M9OB 1XSPA 2VA8A 1BNPA 4WC7A 1V9PA 4J9QA 4GXIA 8ICQA 4YP3A 3FYHA 1H38A 4IRKA 1ZQMA 8ICLA 3OVAA 1ZJMA 4KLUA 3GILA 3GQCA 4FH3A 3BDPA 4FBTA 3G6XA 5J2JA 3MR5A 8ICCA 4B9TA 4BXOB 5C5JA 4NM1A 1NJWA 2UVWA 4ED8A 4P2HA 4Z6FA 1K1SA 3BJYA 4QW9A 2UVRA 3AU6A 4O3RA 2AGQA 4J9PA 3OHAA 2IBKA 4UB5A 2Q66A 4PPXA 5KFEA 4M9NA 4YMMA 3RJGA 4UB3A 4PHAA 3GIKA 5HRIA 1AROP 2MAXA 2NRXA 1S97A 3KTQA 5CR0A 1KSPA 4R63A 2FMPA 4UAZA 4F3OA 8ICVA 2AQ0A 4Q45A 3M8RA 1OU5A 3NTUA 2ZH9A 2NRKA 5KFUA 3WFQE 4YQWA 1BPYA 3ORYA 5JUMA 1VFGA 3PX6A 5HNKA 3RAQA 4RU9A 1QTMA 2M2WA 3AQMA 2BCUA 1B43A 3LWMA 4EEYA 3MR6A 3TARA 3JZ0A 1NZPA 3H38A 1XC9A 2DPIA 2ZHAA 4UBBA 2W8LA 4AT9A 5KFGA 2XCAA 3GIIA 2ZH8A 4I2IA 3TFRA 7ICQA 4O5EA 5DLFA 5J2EA 4JWMA 4KITB 4BDPA 1XWLA 4TUPA 4IRCA 1Z00A 4DL6A 4O5CA 7ICFA 3WFOA 4RQ5A 4RWNA 4I2JA 4QZBA 4ED0A 1ZETA 1TK5A 2XGQA 3PW0A 3RB0A 1ZQTA 2I9GA 2R8JA 4JWNA 9ICBA 5J2GA 3RJIA 5KT4A 4I2AA 3JPQA 4EP7A 5DQHA 3M9MB 4M9LA 4MFAA 4NLZA 2BPCA 5KFZA 3SZ2A 4B9SA 4YMOA 1KRPA 3PNCA 4QZ9A 4ATBB 4O3SA 9ICFA 4WC4A 3PW4A 4I28A 4RQ3A 4X5VA 4X4QA 4UD5A 5KFBA 9ICSA 1NK0A 1A76A 2KZMA 5DB8A 3OVSA 4JK1A 2IMWP 4MF2A 4KLMA 4LVSA 1ZQOA 5J0UA 2V9WA 1QSLA 5F2VO 4PGXA 2DR9A 4F5PA 4KLQA 4QZIA 1ZQBA 2NRTA 1NK6A 5EWGA 5DB7A 4M6WB 4X4NA 4RQ7A 3K75D 4RNMA 2R8KA 4ECZA 5KTQA 3PMLA 5KG6A 5J2FA 4I2HA 4QW8A 2HHQA 4GXJA 4QWAA 1JIHA 4C8MA 4RQ1A 3OGUA 4YXJA 3SV4A 7ICPA 3C1YA 5DQIA 1T8EA 5J2KA 3RAXA 4QZFA 1NOMA 4F5RA 4B9VA 3Q8QB 3OJSA 4YCXA 3T5KA 1TKDA 2P6RA 3KHRA 4MEXA 4B9LA 8ICHA 4UD4A 3UQ2A 1ZQRA 3QZ8A 4RUAA 1ZQKA 2JZBB 3THVA 4ECXA 3ISBA 2BKEA 2Q0ZX 4PHEA 4EYHB 1T7PA 3AU2A 3C5GA 4AT8B 3UQ0A 4DOCA 9ICXA 1UETA 1KNYA 4WC3A 2C28A 2BHNA 2LYHA 3RB6A 2IHNA 2P66A 2ID1A 4M9JA 4KLGA 3JYYA 2HVIA 4RQ4A 1BGXT 3MDAA 3RJFA 1XS9D 5HRLA 5KT6A 4IQVA 2FLLA 4PGQA 4FHXA 4DFJA 4CCHA 1S0VA 3QEAZ 1Q79A 1L5UA 3GFKB 2W9BB 2XCPA 5F9NA 1BNOA 1RYSA 1FA0A 5J0XA 5D4BA 5J2IA 2AU0A 9ICPA 1ZQIA 2ZH6A 3H37A 2NRZA 1NJYA 5KFMA 3GIMA 1Y88A 3LQCB 4XRHA 4O9MA 3JPRA 4NLGA 1IXRA 3M8SA 3BQ0A 4DL7A 9ICHA 3EZ5A 2P6UA 4EBKA 5KFAA 1COOA 1N48A 9ICOA 3RJHA 3EPGA 4DQIA 4NLKA 1MIWA 1UEVA 4FHPA 2M2UA 1JXEA 2PI4A 4YR0A 4XQ8A 4M9HA 4QZCA 4RQ2A 2ISPA 5KFTA 4B9UA 1S77D 4M9GA 3Q8PB 2VA2A 8ICJA 3OJUA 3KHLA 1YLQA 2HHPA 5DGBA 3ISCA 3T5HA 4R8UA 3T5LA 2BPGA 4DQPA 2UVVA 4I2GA 1KTQA 1XO1A 2PXIA 4WBZA 2AGPA 4UB2A 5HC9A 1KEJA 4F93B 4EYIB 1ZQSA 8ICXA 2ISOA 1WOTA 1MIVA 3AUOA 3TAPA 5CJ7A 2BCSA 3GV5B 2DFLA 5CP2A 4HYKA 4F50A 3V6HA 1TK0A 1U48A 4LZDA 4ECSA 4ELUA 4I2BA 4WC0A 5DECA 3MFHA 4ED6A 9ICWA 1Q78A 1S0NA 3V6KA 4NM2A 3H8SA 3V7JA 4UAYA 5D46A 8ICGA 5HRDA 3IHQB 2ZH4A 2KP7A 4C8NA 7ICVA 4MFCA 1RPLA 3IM1A 3ZD9A 4DOAA 2JEJA 4Z6DA 1QSSA 4F92B 2W9CA 4KLDA 4TURA 3JPSA 3OUYA 5DDYA 3WFRE 4QWBA 3JPNA 4QZ8A 3GIJA 5HRBA 5IIOA 4DEZA 4DF8A 4Q8EA 4JV2A 4X0BA 4ECTA 5KFJA 1D9DA 3G6YA 4KLHA 8ICMA 4AT7A 4AT9B 1SKRA 2ZH3A 2BE3A 3ZDCA 1SZPA 1Z00B 2ZTDA 2W8KA 4S3NA 4M04A 4Q44A 3LDAA 4F91B 1BPEA 5J0SA 1ZQJA 4X4TA 5DBBA 4EBJA 1Z3EB 2BQRA 1QLNA 1JAJA 4EBEA 4F2SA 4ECVA 4M47A 3Q8RB 3C1ZA 4RPZA 5KG0A 4DL5A 4DL4A 4QZEA 3RH5A 3AQNA 4DWIA 7ICGA 8ICAA 8ICUA 5KFWA 4RWQA 4EZ9A 2PI5A 5IIJA 4F5QA 3PR5B 4KLTA 4WBYA 3PX4A 9ICKA 1N56A 3ZDBA 1S76D 2PFQA 1CEZA 1TFWA 3GDXA 2GWSA 3NYBA 4RWPA 1TFYA 1HJPA 5KFHA 2WTFA 4J9LA 7ICJA 4RT3A 5J0PA 1ZQWA 3TFSA 2BDPA 4BWJA 4EBCA 1NKEA 5EWFA 3KHGA 1ZQGA 5KFXA 2AQ4A 4DSJA 3QEBZ 2BPFA 4I2EA 4ATBA 4F8RA 3OV7A 5DDMA 4ED3A 1ZYQA 5F9LA 4R65A 1NKBA 2DPJA 2XY5A 3HPOA 5KFYA 1VJ7A 4X4UA 3H8WA 4DOBA 4J9NA 4WCWA 3N97B 4RQ6A 4EBDA 4X4RA 1DGSA 4ECUA 4IRDA 4PHDA 4ECRA 5HRHA 5KG2A 1MC8A 3PR4A 4DO9A 5J2HA 4IR9A 4UQGA 3RBEA 4QZDA 3N4MB 5J0OA 5KFRA 4TUSA 1NKCA 2ALZA 1L3VA 4YD1A 4X4OA 2FPMA 5KFLA 5J2AA 1NK7A 4EZ6A 1R8BA 4YVZA 2BCQA 1IM4A 9ICCA 5KG3A 4G3IA 2W9MA 3V7LA 9ICVA 1NO5A 5HHIA 3H39A 4WC2A 1UT8A 5HP4A 4YD2A 3MDCA 2J6SA 4O0IA 1ZJNA 2BQ3A 5KFIA 3UPQA 3RH6A 2ZUBA 3PW5A 5DBCA 3RRHA 2HHUA 2FMSA 4DF4A 2JEFA 3UXNA 1SKSA 4KLOA 3UXPA 5CWRA 2J6TA 4ED2A 4KLFA 7ICTA 3ZDAA 2I1QA 5HHHA 3HX0A 2DRBA 2MUTA 3LWLA 2ZH1A 4X4VA 1TAUA 3MR2A 1RXVA 1ZQVA 2W9AA 1TAQA 2BCVA 4UB4A 1S10A 2AGOA 2NRWA 1C7YA 3JPTA 5KFCA 2J6UA 1ZQEA 1UEUA 2O1PA 8ICIA 2IA6A 1ZQAA 7ICHA 1PX5A 4Q43A 3PO4A 1D8LA 2BQUA 5DG9A 7ICKA 5KFKA 1X9MA 3H3AA 4DSKA 4MEYA 9ICLA 4J9OA 2XY6A 4E7XA 2KTQA 3WFPA 4QWCA 4M0AA 2DR5A 2H5XA 1ZQZA 3NGDA 4O3OA 1ZQHA 4R8UB 2PFOA 2A1JB 5IIIA 4XA5A 1X2IA 1T3NA 4RWOA 5KG4A 5L1LA 4M2YA 3JPPA 1SL1A 1X9WA 1MQ2A 4MF8A 2DR8A 4KMUA 3RJJA 4ELTA 8ICYA 1JQRA 4M6WA 4C8OA 3OVBA 4XQ7A 4UAWA 3C23A 1A77A 4DLGA 3PY8A 3WFSC 5KFPA 2C2RA 4O5KA 5EWEA 2ZTCA 5DBAA 4DFMA 2R8GA 2ZH7A 5TZVA 2W9CB 8ICOA 3AQLA 3V6JA 3HP6A 1L3TA 1ZQCA 5J0WA
chains in the Genus database with same CATH superfamily
5CFTA 1ZQXA 3PMNA 1XSNA 2VJ5A 2HHWA 5A0LA 1BPXA 2ZIWB 5J0RA 3MABA 2CN1A 5L1JA 5L1KA 1F0MA 3ZDEA 1JI7A 4O69A 3CRXA 2LMRA 2NO5A 4DL3A 3WKBA 2R8HA 9ICTA 2JEIA 2DUYA 1V4AA 2KNJA 3A0BU 1XNSA 5DQGA 4M5DA 4K8VA 3NKUA 4WQLA 2ZH2A 5KG7A 2XGPA 3NUQA 4O3MA 2BR0A 3K7DA 4P4PA 3AL0B 1A0PA 3ALRA 4JV1A 4EENA 4JMUA 3TANA 3ISDA 5ALMA 3KBBA 4QWDA 4RQ8A 4E80A 4KLLA 2WF8A 2P35A 4DQQA 5BOMA 2FE9A 1TVAA 7ICIA 2HHVA 1TK8A 3F2CA 1BPDA 8ICSA 2XC9A 1JALA 4E0DA 2K8BB 1BPBA 1BVSA 2HBLA 5ALIA 2WB1C 1CUKA 4BXOA 2ZXHA 1DK2A 1SV0A 2KZZA 5KFNA 3H7IA 3NWIA 4NLCA 3QZ7A 2PKEA 1KDHA 2VKQA 3SV3A 1S0MA 4KM5A 3F53A 5KFQA 2MU2A 9ICQA 2W03A 4A8EA 4FS1A 3RTVA 2I5HA 2YTUA 7ICLA 4NXZA 2CRXA 5AM3A 2IOFA 2DVIA 2HSZA 2HW3A 2KFNA 2LBOA 4K99A 2ASLA 8ICFA 2KE7A 5DEDA 2IHMA 5AKZA 1NK9A 9ICMA 5L1MA 1EXNA 3MGHA 5KT2A 7ICRA 3HRDD 1JN3A 3HJ4A 2FDRA 2YY6A 2RHFA 4DS4A 3H0LB 5J29A 2F1JA 2EZZA 4DFKA 1WG8A 3C5FA 3L4PA 3SAHA 1UT5A 2MRLA 9ICAA 4DQSA 1COKA 2VJ4A 3T3FA 5AK5A 1U4BA 5F3XB 1SB3C 4EEDA 3AQFA 2IHOA 2G06A 5KNIA 2QLTA 4AT8A 3FM9A 2FLNA 5KG5A 2ZXIA 2NRVA 2ZHBA 5D49A 4I29A 5BPCA 2KVSA 2W9BA 4RUCA 1MQ3A 2A1JA 5ALGA 1MIYA 2C2EA 4NKUA 2HCFA 5ALDA 2HBKA 1WCNA 4F5OA 5CHEA 3ED5A 2F77X 1XSPA 1HIWA 4GXIA 8ICQA 3FYHA 5AKJA 4FH3A 3GQCA 2QARA 2KIWA 4BXOB 5AHXA 1NJWA 4P2HA 3F2DA 4IL6U 2IBKA 3ONNA 2Q66A 4PPXA 4M9NA 4OAFA 4UB3A 2N1RA 5HRIA 3DV9A 3WKDA 1PVQA 1S97A 2GLEA 2FMPA 4UAZA 4F3OA 2F3NA 3WK7A 2NRKA 3WFQE 5E79U 3ORYA 5ALOA 3PX6A 2JGAA 2BCUA 2DPIA 2ZH8A 2ZIUA 5ALUA 4I2IA 4LEYA 3M1YA 5DLFA 3KKAA 4TUPA 3JCFA 4QZBA 1ZETA 3NVWA 5GTIU 4I2AA 3JPQA 5DQHA 3M9MB 4NLZA 3SZ2A 2JH1A 4C7YA 1KRPA 4JLXA 9ICFA 2H3QA 4I28A 4MF2A 2IMWP 4KLMA 2WF9A 2V9WA 4FZNA 4F5PA 5DB7A 4RQ7A 3K75D 4ECZA 1KBUA 2F76X 3SMVA 4C8MA 4YXJA 7ICPA 3NVVA 1T8EA 4QZFA 1QH9A 3OJSA 4YCXA 4MEXA 1PUZA 4RUAA 1ZQKA 4ECXA 3ISBA 4PHEA 4AT8B 3UMBA 2LYHA 2MA1A 2DKXA 2YQEA 3RJFA 4FHXA 3QEAZ 1L5UA 1UCVA 2W9BB 1MA7A 1FA0A 5J0XA 3HJEA 5AM0A 3NRZA 2AU0A 1ZQIA 5J8YC 2JRZA 5KFMA 4QNLA 4O9MA 5EE1A 4NLGA 4PL1A 1ZXIA 3L5KA 3RJHA 4DQIA 4NLKA 3IV6A 1S5LU 5JRTA 2QARB 1T3QA 2ISPA 5KFTA 5DGBA 3ISCA 3T5HA 4R8UA 4DQPA 4I2GA 2PXIA 3QUBA 4UB2A 5HC9A 1KEJA 8ICXA 4FZMA 2HI0A 1S77D 4HYKA 1TK0A 4WC0A 3MFHA 4ED6A 2AXTU 8ICGA 5ALLA 4UAYA 5D46A 3IHQB 3ZD9A 3WK5A 1QSSA 3JPSA 3T79A 3PHZA 5HRBA 4QZ8A 4Q8EA 1SZHA 3G6YA 8ICMA 3RF9A 3SD7A 2BE3A 3ZDCA 5AKGA 5J0SA 5DBBA 2LPEA 2G0AA 4DWIA 7ICGA 8ICUA 5AM2A 3WK4A 4F5QA 4WBYA 3PX4A 2PFQA 3AM9A 1TFYA 4J9LA 4RT3A 2BDPA 2HOIA 4QJFB 3NVZA 4EBCA 2JXJA 1ZQGA 5KFXA 5J8YA 2H3FA 2BPFA 5DDMA 4CDGA 4UAUA 2DPJA 2R18A 2XY5A 4X4UA 5ALNA 4DOBA 2KKVA 3O0FA 4ECRA 1MC8A 4DO9A 5J2HA 5B5EU 4LEVA 4FE3A 4UASA 2FPMA 1Z4OA 5KFLA 5J2AA 4OJPA 4YVZA 2BCQA 5AI8A 2W9MA 3V7LA 2E1FA 1NO5A 1QQ5A 3TACB 1NZBA 4O0IA 3UPQA 2ZUBA 3QUCA 5DBCA 3RRHA 2HHUA 2FMSA 3UXNA 4WOYA 4KLOA 3E0FA 3HX0A 1AQ6A 1X6IA 1OXJA 3IP4B 3MR2A 4NXXA 2W04A 4UB4A 5KFCA 4Y2UA 1UEUA 2A1AA 1ZQAA 7ICHA 1ZD2P 4DSKA 2HOFA 4J9OA 2XY6A 4C80A 2DR5A 2WFAA 2H5XA 1ZQZA 4O3OA 4R8UB 4XA5A 4Y2TA 4RWOA 2VIXA 1MQ2A 3RJJA 4ELTA 4C8OA 2RP5A 4UAWA 3PY8A 4O5KA 1PK1A 2KEYA 5DBAA 2G5IB 2F2AB 4AYBC 5AI0A 5AI9A 1L3TA 5TISU 1ZQCA 4FHWA 4YR2A 4EX7A 3PSPA 2KVCA 3SR6A 1R8AA 4I27A 2D3DA 1RG6A 1ZQUA 4EELA 3QU7A 4PGYA 1F5AA 2NV3A 4I2CA 2WF7A 4RPYA 4P0QB 5JTIA 8ICWA 4WC5A 3PO5A 5L9XA 4O3PA 5HR9A 3RH4A 1HUOA 1L3UA 2ZJAA 3PVXA 2EH9A 1XU4A 5DB6A 2ASJA 4AYBF 4WC1A 1Z4NA 3KHHA 5HRFA 3PW2A 4KN4A 5DGAA 2NYVA 8ICKA 4C0ZA 3N28A 2PBEA 4LT6A 4IG8A 4IQWA 3Q8SB 4JB3A 2ZIXA 2B51A 2C2DA 2W7OA 7ICOA 1JMSA 1YT3A 3UXOA 3EW9A 4UBCA 5DLGA 1KKXA 4CF5A 4YXMA 3TAQA 2O5AA 1F5SA 1RYUA 5IIKA 3I76A 3R9KA 4YR3A 9ICRA 1NJZA 4KTQA 5AIBA 4BX9C 7ICEA 2D6FC 4P4MA 1UA0A 3MGIA 4I0UA 4DCCA 4ZOHC 1ZQPA 2GAFD 4QWEA 2JEGA 3RJEA 3AQKA 3MR3A 2H3VA 2R8IA 5JU5A 5KL1B 1Z1VA 4I2FA 2K8CB 4F4YA 1PVRA 2YMMA 3M6KA 2DL0A 2V4QA 3SYZA 1RZTA 3KOOA 2HN2A 3B0XA 1QQ7A 1X9SA 7ICNA 1ED1A 8ICZA 3L9DA 4PH5A 5KAFU 3J81j 4R66A 3H4BA 1F44A 2LI6A 4GLXA 1DGJA 1QQ6A 4RZRA 1PK1B 8ICNA 2KJ5A 3HT3A 4NJ8A 2EWRA 3EPIA 3ETLA 5AI4A 2G5HB 4NY8A 4KLJA 1J2MA 9ICIA 2DR7A 4DSLA 4DFPA 5DG8A 4JUZA 3ZDDA 2UVUA 1KFDA 2M2TA 2EZYA 1SL0A 4DSFA 3C28A 2CXYA 4IR1A 1VJ5A 3UPSA 5HRKA 2FLPA 1ZD3A 2FJ6A 3PSIA 4AT7B 1OW5A 4IS7A 2QB0B 4LEZA 2F8KA 4BUGA 1WCLA 3N7RC 4KMOB 5AKKA 3BS7A 1SKWA 1UA1A 2HHSA 3I28A 5KFDA 3PZPA 3I1YA 4DLEA 3OSNA 5KT3A 2ZIXB 4O3QA 2ATLA 4B9NA 3EF2A 3GV7B 4YG2A 3OHBA 4TQRA 3V7KA 3VC8A 3WU2U 8ICTA 2Y1JA 3D2QA 2KG5A 3K1RB 4Y2YA 4Y2QA 5KFOA 3H4DA 2Y0SC 3WK8A 2VA8A 2BBJA 4WC7A 2LM1A 4IRKA 3OVAA 4FBTA 5J2JA 3MR5A 8ICCA 3MCRA 2UVWA 4ED8A 1K1SA 4AP9A 2UVRA 3AU6A 4O3RA 4C4TA 4J9PA 3OHAA 3CNHA 4UB5A 4K97A 4PHAA 1S8OA 1KSPA 2KHQA 8ICVA 2YMQA 5ALJA 2ZH9A 2LYAA 2Y0SF 4YQWA 4CF3A 1VFGA 5HNKA 3RAQA 2M2WA 3AQMA 3TARA 2YMLA 2ZG6A 1V38A 1NZPA 3H38A 4UBBA 5KFGA 1VDVA 2XCAA 2Q4TA 3QU4A 4KITB 1XWLA 4IRCA 7ICFA 3QU2A 1Z1BA 4J03A 4RWNA 4JWNA 5EE0A 2XGQA 3PW0A 9ICBA 2WF6A 4M9LA 2BPCA 2A3VA 1MN8A 4UB8U 4Y2PA 4UD5A 5KFBA 1A76A 5DB8A 1QSLA 5F2VO 2DR9A 3AN1A 4UW9A 4QIWC 3F5AA 4NLBA 4RNMA 2RQ5A 4GXJA 3UMCA 1JIHA 1PK3A 4WJ3B 4K98A 3RAXA 1NOMA 3Q8QB 3T5KA 1TKDA 3SAGA 2P6RA 1J2NA 3KHRA 8ICHA 3UQ2A 1ZQRA 2PMZF 2BKEA 5EE9A 2FCLA 5CFUA 5AM1A 1UETA 1KNYA 2DF4B 3D2NA 2IHNA 2GA9D 4KLGA 1NI3A 3QU5A 4QIWF 1BGXT 1XS9D 5KT6A 4IQVA 3KKAC 2FLLA 4PGQA 1S0VA 5J2IA 3GIMA 3LQCB 4XRHA 3JPRA 1IXRA 2OCEA 1UEVA 4FHPA 4NXWA 2PI4A 4M9HA 4QZCA 4RQ2A 2DWQA 4B9UA 2E8PA 4M9GA 3PSFA 2VA2A 3OJUA 8ICJA 2KV2A 2Z7JA 5GTHU 2UVVA 1KTQA 4EYIB 1L7PA 3TAPA 2BCSA 2DFLA 4F50A 4ELUA 1U48A 4LZDA 4ECSA 9ICWA 1S0NA 3V6KA 5AKLA 3V7JA 1Q46A 2KP7A 3IG8A 3MC1A 3SEIA 5CRXA 3WK9A 4DOAA 2JEJA 1O08A 4KLDA 3GU3A 4TURA 3KD3A 3GIJA 5IIOA 4JV2A 3F5EA 5B3PA 4X0BA 5KFJA 2OHFA 2ZH3A 1SZPA 2W8KA 4S3NA 4F91B 1CRXA 4WQKA 4Y2RA 2K4EA 2W11A 4F2SA 3C1ZA 4RPZA 5AICA 5KG0A 3RH5A 4WH5A 2M0NA 5KFWA 4EZ9A 5IIJA 5B66U 2JMGA 4KLTA 3F2BA 9ICKA 3ZDBA 1TFWA 3GDXA 2GWSA 1QCKA 2IOHA 5CFSA 4FO1A 2DGZA 2WTFA 2YB1A 3DDHA 3OTQA 3TFSA 4BWJA 1NKEA 3L3FX 5AM5A 3HILA 4DSJA 3QEBZ 3OV7A 1N62A 4ED3A 1NKBA 4OAHA 4J9NA 1DGSA 4IRDA 5HRHA 2ES6A 5KG2A 3RBEA 1YZ7A 4OD0A 2ALZA 4USAA 3SQIA 1L3VA 1NK7A 1IM4A 2EANA 1N63A 3H39A 3SAFA 3MDCA 2BQ3A 4DF4A 1SKSA 3UXPA 3A0HU 2K4IA 2J6TA 7ICTA 2I1QA 2DRBA 2MUTA 5AK4A 5FP0A 4C4RA 2ZH1A 4X4VA 1TAQA 5AI5A 1SWWA 2AGOA 2J6UA 1ZOLA 1ZQEA 2O1PA 2F8LA 8ICIA 1X9MA 1SXEA 1LVHA 2EQYA 2KTQA 4QWCA 2PFOA 1ZQHA 2A1JB 1Z19A 4M2YA 1SL1A 1X9WA 4M6WA 3WKAA 3OVBA 3C23A 1A77A 5EWEA 5ALWA 2BZFA 3AQLA 4ED7A 4DL2A 2KOBA 1ZQLA 5L1IA 3RB3A 2K8AA 4UB1A 4ECYA 3PX0A 4ED1A 1L3SA 2KFZA 3RR8A 3WKCA 1QSYA 1RQNA 2XVTA 3LYSA 4IQTA 5J0QA 4C4SA 1IG6A 1UQVA 3BQTA 4K4IA 1NJXA 1BPZA 1MSWD 1HUZA 2ZIUB 3C21A 4TUQA 4C8KA 2AJQA 1R8CA 2RRDA 4QZHA 4RT2A 5J2CA 4MFFA 5DKWA 5J2DA 3FDSA 4Y2JA 3PSTA 4FS2A 3HW8A 9ICUA 2B21A 5T14A 4FBUA 5HMMA 3QUTA 4BGDA 3GZFA 2XY7A 4FHYA 3HJ1A 3AMZA 5KFFA 2KKPA 1ZQNA 4O68A 3M9NB 3EYZA 4UAVA 3NS1A 3AQEA 3TQ1A 1LV5A 4OJLA 4J9KA 2W7PA 3D6JA 2KN7A 8ICRA 4F4XA 1U9LA 1R89A 1U45A 5DB9A 2MUTB 1X66A 5AKEA 4ECQA 2W43A 3C2LA 1O03A 3JPOA 3TI0A 3BQ2A 3KZXA 4XUSA 2H3IA 4PHPA 3CK6A 4QZGA 4K4GA 1NK5A 1T4GA 1UPHA 1ZQDA 4O3NA 2B6GA 3KFUF 3RB4A 2FPKA 4YFKA 5KT7A 4OO1J 5AKIA 2M2VA 3QYPA 1SL2A 5G5HA 3TADC 5HRGA 1RYRA 1NNLA 5J0TA 2EAOA 1IV8A 4DSIA 4XJEA 1V97A 4YN4A 5AI6A 2FPLA 4I2DA 4DSEA 1KLNA 4J9SA 3H8JA 2DRAA 5KL8B 1Q3UA 1D9FA 4NKTA 2ZUDA 2AH5A 2RDIA 2ZH5A 9ICJA 2WAQC 4RNNA 3ER9B 1XO0A 3N7SC 1XSLA 4E7XA 3B0YA 5KFVA 4K4HA 9ICGA 4X4PA 2HHTA 3D2SA 1WUDA 3HWTA 2B56A 1TFRA 5KT5A 7ICUA 5AKXA 4R64A 3RJKA 3N7PD 4YMNA 2BCRA 1U49A 5CA7A 2BGWA 4GXKA 4DS5A 1DOQA 5ALRA 2EZXA 2JZBA 2KHVA 5EOZA 2WAQF 1PVPA 3FC4A 4F2RA 1PZNA 1D8YA 1JX4A 2VANA 5AK6A 4DQRA 3PV8A 3K1ZA 3QX7A 4GC7A 2ZTEA 4JWMA 2PFNA 5BOLA 3V72A 1L8LA 3IN5A 1V9PA 3TADA 4J9QA 5HR6A 2OEHA 4EEBA 2KD1A 4C7ZA 4KLUA 2F44A 2YX8A 3BDPA 3G6XA 4B6JA 4B9TA 2EDUA 4Z6FA 4QW9A 2AGQA 5KFEA 4YMMA 3RJGA 3GIKA 2MAXA 3KTQA 4R63A 1OU5A 1D8BA 5KFUA 1RQLA 5JUMA 1QTMA 1WWVA 3LWMA 4EEYA 1K5OA 1SV4A 3JZ0A 4KX3A 4F72A 1XC9A 4AT9A 3GIIA 4BDPA 2G07A 5ALPA 4DL6A 4EV6A 4I2JA 3RB0A 1DRGA 2I9GA 1WWUA 5KT4A 4EP7A 2HBMA 1FO4A 4Y2SA 3ZI4A 3PNCA 4HX0A 4O3SA 3PW4A 4NL9A 1SXDA 9ICSA 2XICA 4GIBA 2KZMA 5C0YA 3OVSA 2OXOA 4JK1A 4LVSA 1ZQOA 5J0UA 4PGXA 4KLQA 1X6JA 4QZIA 1ZQBA 2NRTA 1NK6A 4X4NA 5KTQA 3B9JA 5AKYA 5KG6A 3PMLA 4OAIZ 4QWAA 3M7DA 3OGUA 5J2KA 4F5RA 4B9VA 4B9LA 1B22A 1KFTA 4UD4A 5ALYA 3QZ8A 2JZBB 3THVA 1JUDA 2Q0ZX 1T7PA 3C5GA 3DEEA 3UQ0A 4DOCA 2K4HA 3WKEA 3JYYA 5HR7A 2LKYA 1KW4A 4RQ4A 2E8MA 1FEZA 3LVVA 3NASA 4CCHA 1Q79A 3GFKB 1RYSA 5D4BA 9ICPA 2ZH6A 5AIAA 3H37A 1NJYA 1Y88A 2OYYA 4DL7A 9ICHA 4EBKA 1COOA 9ICOA 3EPGA 1MIWA 3IRUA 2M2UA 1JXEA 4YR0A 2DBYA 3S6JA 3Q8PB 2HHPA 2BPGA 3T5LA 1XO1A 1WOTA 2ISOA 1MIVA 1Q3VA 3AUOA 3GV5B 4I2BA 3QU9A 4NM2A 3H8SA 4GFJA 1P7DA 1TAMA 2ZH4A 3IM1A 1LKYA 4Z6DA 4F92B 2W9CA 3E58A 3JPNA 4DEZA 4ECTA 4N7RA 4AT9B 4KLHA 5KAIU 3NVYA 5ALKA 2ZTDA 5CEHA 4Q44A 4EBJA 1Z3EB 4OJOA 2BQRA 1N60A 1JAJA 3CYMA 4EBEA 4M47A 3Q8RB 2KMDA 3AQNA 4QZEA 8ICAA 4EX6A 5ALEA 5ALHA 1N56A 2G09A 2WF5A 3NYBA 4RWPA 1HJPA 3OPXA 5KFHA 7ICJA 5D63A 1JRPA 5J0PA 1ZQWA 3U26A 2O6KA 5AK3A 4O67A 2AQ4A 4ATBA 4F8RA 2JHDA 4R65A 1VJ7A 2ODGA 1B0XA 3H8WA 4WCWA 4RQ6A 4EBDA 4PHDA 3PR4A 2PMZC 4QZDA 3N4MB 5KFRA 4UATA 4TUSA 1NKCA 4ICAA 1R8BA 1L7NA 4EZ6A 4O6AA 9ICCA 4EEKA 9ICVA 1N2XA 5HHIA 4NXVA 2ESEA 5HP4A 4YD2A 1ZJNA 5KFIA 3RH6A 5ALFA 1RM6C 5ALTA 5CWRA 2WB1F 4KLFA 3ZDAA 2KJ8A 3BS5A 2W9AA 2BCVA 1S10A 1C7YA 1T94A 1PX5A 4Q43A 3PO4A 1D8LA 5DG9A 5KFKA 2OM6A 9ICLA 1ZD4A 3WFPA 4M0AA 1TE2A 5ALZA 4US8A 5IIIA 5AM4A 2AHOB 5KG4A 3JPPA 2G08A 4KMUA 2E8OA 4DLGA 5KFPA 2C2RA 3UMGA 2ZTCA 4DFMA 2R8GA 1LKYB 5TZVA 2W9CB 8ICOA 3V6JA 3HP6A 2EAMA 4B9MA 4RPXA 3RRGA 4Q8FA 2Y1IA 3Q8LA 4NLNA 4KLEA 4X0AA 2BDUA 4OJ5A 3EUB2 7ICMA 1NK4A 1DK3A 2VA3A 2ZJ8A 1JXLA 1KQQA 2HBJA 3CW2C 1ZQQA 3PW7A 5H2FU 2EAPA 3MFIA 4KN7A 9ICNA 1U47A 7ICSA 2PFPA 5CHGA 4Z6EA 2C22A 2A19A 5KFSA 1RXWA 1CI4A 3C2KA 4WC6A 5KG1A 4FHVA 3LK9A 4ATBB 3MBYA 1N5WA 1FFVA 2KIVA 4JV0A 3M6ZA 3ZD8A 2ZJ5A 5IINA 4KLIA 4FFDA 3GV8B 9ICEA 3G6VA 2LM4A 2XI9A 4CF4A 4Z6CA 4PL2A 4ELVA 3UM9A 4P4OA 1WYGA 3IG5A 2ASDA 4RQ0A 4LZGA 4K9AA 4RNOA 3Q8MA 3C29A 4CRXA 2KSOA 2W3RA 2QB1A 3BS5B 1KFSA 4UARA 2YB4A 5IIMA 3T5JA 4JLZA 1ZQYA 4G9BA 3BZKA 4C8LA 4DFDA 3EWAA 4CE6A 4CGZA 4F5NA 1V85A 2HVHA 1LB2B 4FH5A 1K1QA 5HREA 5J0YA 3ERCC 3QE9Y 1ECWA 2L5YA 3C66A 2W55A 4MHVA 1ZRNA 3K4GA 1X40A 2HDOA 8ICEA 5D62A 2KK0A 4MKPA 2GH1A 2IOFK 1NK8A 4J9MA 4F4KA 1SIJA 3E2EA 2KZ3A 4CNQA 4X4SA 4GC6A 4E8FA 4Y2XA 3H0RB 4BWMA 1L8OA 4IC9A 1UHUA 4NWIA 3Q8KA 8ICBA 4IQUA 4J9RA 3HKZC 3FAHA 4KLSA 2XO7A 1S0OA 3AEVA 2ZUCA 5IILA 4TQSA 4FO6A 4ECWA 3SI8A 3VCBA 2RDJA 3HIYA 3C18A 3OSPA 2M9NA 4UB6U 2V4RA 3RR7A 4PJ0U 5CB1A 4F4ZA 5ALSA 4ZH4A 3MGVA 5J2BA 1N5XA 3BQ1A 4F4WA 4NXUA 2F1HA 1L7OA 5EE3A 1ZQFA 2F1IA 4KB6A 1YZ6A 3H8MA 4QZAA 2HHXA 4US9A 3HKZF 2RFFA 2OWOA 2W3SA 1TV9A 3H40A 1KN5A 3C2MA 4OJ6A 1KL9A 2QKQA 5DG7A 8ICPA 4XQ7A 2FMQA 1S9FA 5ALVA 5HMLA 3RBDA 3M9OB 1BNPA 4YP3A 1H38A 1ZQMA 8ICLA 2JR5A 3CP8A 1ZJMA 3GILA 2DQNB 5C5JA 4NM1A 1VLBA 3BJYA 2NO4A 2KSOB 2GOLA 1AROP 2YN4A 1ZRMA 2NRXA 5B3QA 5CR0A 2AQ0A 4Q45A 3M8RA 3NTUA 4KX5A 4P0QA 1BPYA 4RU9A 2CPRA 4EGWA 1HEKA 1B43A 3MR6A 2ZHAA 4RQNA 2W8LA 3TFRA 1FFUA 7ICQA 4O5EA 5J2EA 1Z00A 3WFOA 4O5CA 4RQ5A 4ED0A 1TK5A 2R8JA 3QUQA 1ZQTA 5J2GA 3RJIA 4U6PA 4MFAA 3LVWA 5KFZA 1B4FA 4B9SA 4YMOA 4QZ9A 2KICA 4WC4A 2I6XA 4RQ3A 4X5VA 4X4QA 1JROA 1NK0A 1GO3F 2JH7A 3WK6A 1GPJA 1FIQA 2WHEA 3SENA 5EWGA 4M6WB 1SWVA 2R8KA 3IDWA 4I2HA 5J2FA 4Y2VA 4QW8A 3TKAA 2HHQA 2HMXA 1ZD5A 4RQ1A 5D61A 3SV4A 3C1YA 5DQIA 4P0PA 5JTGA 3BQ7A 3ETRA 4EYHB 3AU2A 9ICXA 4WC3A 2C28A 2BHNA 3RB6A 2P66A 1RDFA 2ID1A 2E8NA 2H3ZA 4M9JA 2HVIA 4NXTA 3MDAA 5HRLA 4DFJA 2XCPA 5F9NA 4LEWA 1BNOA 2YMPA 2DKZA 2NRZA 2FI1A 3ICXA 1X42A 3M8SA 3BQ0A 2K60A 3EZ5A 2P6UA 5KFAA 1N48A 4NL9C 2K4PA 2ZIVA 2E3TA 2K89A 4XQ8A 3BZCA 1SGGA 5K4LA 1YLQA 3KHLA 2IUBA 4WBZA 4HAIA 2AGPA 4F93B 1ZQSA 5CJ7A 3NRWA 5CP2A 3V6HA 5DECA 2OH2A 1Q78A 4PZOA 5HRDA 4C8NA 7ICVA 4MFCA 1RPLA 4ACOA 3OUYA 5DDYA 3WFRE 4QWBA 4DF8A 1OUQA 5ALQA 1D9DA 4AT7A 2B4VA 1SKRA 2QB0A 2ZIWA 4BJQA 1Z00B 3NVOA 4M04A 3LDAA 1ZQJA 1BPEA 4X4TA 1QLNA 4ECVA 1A6SA 4RQMA 2KJ9A 2LYBA 4DL5A 4DL4A 4RWQA 3KZIU 2PI5A 2LHTA 3PR5B 1S76D 1CEZA 4U7CA 3RFAA 1X9XA 2Y9TA 2HOQA 4PZNA 5EWFA 3KHGA 4FZLA 4I2EA 3QXGA 5G5GA 1ZYQA 5F9LA 2RLTA 3HPOA 5KFYA 2D8CA 4NV0A 3N97B 4X4RA 4ECUA 3OWGA 4IR9A 4UQGA 5AKHA 5J0OA 4P0PB 1ZQ1C 4YD1A 4X4OA 2JV3A 2E1EA 2HN1A 5KG3A 4G3IA 4WC2A 1Q8KA 1UT8A 4K9BA 2J6SA 2W54A 3PW5A 4OCZA 4F71A 2JEFA 1IIPA 4ED2A 5ALXA 5HHHA 3LWLA 3H0MB 1TAUA 2BBHA 1RXVA 1ZQVA 2GO7A 2NRWA 1N61A 3JPTA 1URJA 2IA6A 2BQUA 7ICKA 2ZIVB 3H3AA 4K96A 4MEYA 2B0CA 1DXSA 3QNMA 3NGDA 1X2IA 1T3NA 2XIDA 5L1LA 4OAGA 4MF8A 2DR8A 1JQRA 8ICYA 1L7MA 2Y9UA 3ER8C 1SV0C 3WFSC 1C20A 1M6YA 1L6NA 2MSNA 1J97A 2ZH7A 2E5SA 4LJXA 3OUYB 5J0WA
chains in the Genus database with same CATH topology
4B9MA 4FHWA 4RPXA 3RRGA 4YR2A 4Q8FA 1ZQLA 5L1IA 3RB3A 1ZQXA 3PMNA 2Y1IA 1XSNA 4UB1A 3Q8LA 4NLNA 4ECYA 4KLEA 2HHWA 1BPXA 4X0AA 5J0RA 3MABA 1R8AA 4I27A 5L1JA 5L1KA 3PX0A 3ZDEA 4ED1A 1ZQUA 7ICMA 1NK4A 2VA3A 1DK3A 1L3SA 2ZJ8A 1JXLA 4DL3A 3RR8A 2R8HA 2KFZA 9ICTA 2JEIA 4PGYA 1F5AA 1QSYA 4I2CA 4RPYA 1V4AA 8ICWA 4WC5A 4IQTA 3PO5A 1ZQQA 3PW7A 5J0QA 4ED7A 5L9XA 4O3PA 5HR9A 3BQTA 4K4IA 3MFIA 3RH4A 1NJXA 4KN7A 1HUOA 1BPZA 1U47A 1L3UA 5DQGA 1MSWD 2ZJAA 3PVXA 9ICNA 7ICSA 1HUZA 2PFPA 4M5DA 1XU4A 5DB6A 2ASJA 5CHGA 4Z6EA 2ZH2A 4WC1A 2C22A 3C21A 5KG7A 2XGPA 5KFSA 3KHHA 2BR0A 1RXWA 4P4PA 5HRFA 3PW2A 4KN4A 4TUQA 3C2KA 5DGAA 4JV1A 8ICKA 4C8KA 4WC6A 2AJQA 5KG1A 3TANA 4QZHA 4RT2A 3LK9A 3MBYA 5J2CA 3ISDA 1R8CA 4MFFA 4FHVA 5DKWA 2PBEA 4LT6A 4JV0A 3FDSA 5J2DA 4QWDA 3Q8SB 3ZD8A 4RQ8A 4IQWA 4IG8A 4E80A 4KLLA 2ZJ5A 4DQQA 5IINA 3OUYB 2C2DA 4FS2A 5BOMA 7ICIA 3HW8A 1TVAA 2HHVA 7ICOA 9ICUA 1JMSA 2B21A 4KLIA 3UXOA 1TK8A 4FBUA 3EW9A 5HMMA 4UBCA 4BGDA 5DLGA 3GV8B 2XY7A 4FHYA 1BPDA 4YXMA 3G6VA 9ICEA 8ICSA 2XC9A 3TAQA 3HJ1A 4Z6CA 4E0DA 5KFFA 2O5AA 1BPBA 1BVSA 1ZQNA 1B22A 3M9NB 3EYZA 1KFTA 1CUKA 5IIKA 4ELVA 4BXOA 4P4OA 4YR3A 3TQ1A 2ASDA 1NJZA 4KTQA 9ICRA 1DK2A 7ICEA 4RQ0A 1LV5A 4LZGA 4J9KA 2KZZA 4P4MA 5KFNA 4RNOA 2KN7A 1UA0A 4F4XA 3MGIA 3Q8MA 1U9LA 3H7IA 8ICRA 1U45A 5DB9A 1R89A 2MUTB 4ECQA 3C2LA 3QZ7A 1ZQPA 3JPOA 3TI0A 3BQ2A 4QWEA 1KFSA 2JEGA 1KDHA 3RJEA 4XUSA 3MR3A 3AQKA 4PHPA 5IIMA 4QZGA 2R8IA 3SV3A 1NK5A 3T5JA 1S0MA 4K4GA 1ZQYA 1T4GA 4I2FA 1ZQDA 4O3NA 4F4YA 5KFQA 9ICQA 3RB4A 4C8LA 3EWAA 2FPKA 2V4QA 3SYZA 4YFKA 1RZTA 5KT7A 4F5NA 3B0XA 4FS1A 3RTVA 2M2VA 1X9SA 2HVHA 7ICNA 7ICLA 4NXZA 1LB2B 4FH5A 1K1QA 8ICZA 3L9DA 4PH5A 1SL2A 5HREA 4R66A 2DVIA 5J0YA 3H4BA 5HRGA 1RYRA 2HW3A 2KFNA 3QE9Y 4GLXA 5J0TA 3C66A 4DSIA 4YN4A 2ASLA 8ICFA 4RZRA 3K4GA 5DEDA 2IHMA 2FPLA 4I2DA 4DSEA 1KLNA 4J9SA 3H8JA 8ICEA 2DRAA 1NK9A 8ICNA 9ICMA 1EXNA 3MGHA 5KT2A 1NK8A 3HT3A 1D9FA 4J9MA 4F4KA 4NKTA 2ZUDA 3EPIA 2KZ3A 3ETLA 3E2EA 7ICRA 4X4SA 4GC6A 2RDIA 1JN3A 4E8FA 4NY8A 4KLJA 9ICIA 3HJ4A 2ZH5A 9ICJA 4RNNA 2DR7A 4DS4A 1XSLA 5J29A 4DSLA 2F1JA 4BWMA 5DG8A 4DFKA 4JUZA 4DFPA 3B0YA 3ZDDA 2UVUA 5KFVA 3Q8KA 4K4HA 8ICBA 4IQUA 3C5FA 4J9RA 9ICGA 1KFDA 4X4PA 2HHTA 4KLSA 2XO7A 1S0OA 3HWTA 2M2TA 1UT5A 2ZUCA 1TFRA 5KT5A 5IILA 4TQSA 4FO6A 4ECWA 3SI8A 7ICUA 4R64A 1SL0A 4DSFA 2RDJA 3HIYA 3C18A 4DL2A 3RJKA 3OSPA 2M9NA 9ICAA 2V4RA 4YMNA 2BCRA 4IR1A 3RR7A 3UPSA 5CB1A 1U49A 5CA7A 4DQSA 2BGWA 4GXKA 4DS5A 3T3FA 1DOQA 5HRKA 4F4ZA 2FLPA 1U4BA 4ZH4A 4AT7B 5J2BA 3BQ1A 4F4WA 2F1HA 2JZBA 1WCLA 5EOZA 1ZQFA 2F1IA 4AT8A 2FLNA 1SKWA 4QZAA 1UA1A 4F2RA 5KG5A 2HHXA 2HHSA 2NRVA 5KFDA 2RFFA 2ZHBA 1PZNA 4DLEA 1D8YA 3OSNA 1TV9A 2OWOA 5D49A 5KT3A 4I29A 3H40A 5BPCA 1JX4A 4O3QA 3C2MA 2VANA 2ATLA 4B9NA 3GV7B 4YG2A 4RUCA 3OHBA 2W9BA 5DG7A 4TQRA 4DQRA 2A1JA 3PV8A 1MQ3A 3V7KA 8ICPA 1MIYA 2C2EA 2FMQA 4NKUA 8ICTA 2Y1JA 4GC7A 2ZTEA 1S9FA 3H4DA 5BOLA 1WCNA 5KFOA 5HMLA 4F5OA 3V72A 2PFNA 3RBDA 3M9OB 1XSPA 2VA8A 1BNPA 4WC7A 1V9PA 4J9QA 4GXIA 8ICQA 4YP3A 3FYHA 1H38A 4IRKA 1ZQMA 8ICLA 3OVAA 1ZJMA 4KLUA 3GILA 3GQCA 4FH3A 3BDPA 4FBTA 3G6XA 5J2JA 3MR5A 8ICCA 4B9TA 4BXOB 5C5JA 4NM1A 1NJWA 2UVWA 4ED8A 4P2HA 4Z6FA 1K1SA 3BJYA 4QW9A 2UVRA 3AU6A 4O3RA 2AGQA 4J9PA 3OHAA 2IBKA 4UB5A 2Q66A 4PPXA 5KFEA 4M9NA 4YMMA 3RJGA 4UB3A 4PHAA 3GIKA 5HRIA 1AROP 2MAXA 2NRXA 1S97A 3KTQA 5CR0A 1KSPA 4R63A 2FMPA 4UAZA 4F3OA 8ICVA 2AQ0A 4Q45A 3M8RA 1OU5A 3NTUA 2ZH9A 2NRKA 5KFUA 3WFQE 4YQWA 1BPYA 3ORYA 5JUMA 1VFGA 3PX6A 5HNKA 3RAQA 4RU9A 1QTMA 2M2WA 3AQMA 2BCUA 1B43A 3LWMA 4EEYA 3MR6A 3TARA 3JZ0A 1NZPA 3H38A 1XC9A 2DPIA 2ZHAA 4UBBA 2W8LA 4AT9A 5KFGA 2XCAA 3GIIA 2ZH8A 4I2IA 3TFRA 7ICQA 4O5EA 5DLFA 5J2EA 4JWMA 4KITB 4BDPA 1XWLA 4TUPA 4IRCA 1Z00A 4DL6A 4O5CA 7ICFA 3WFOA 4RQ5A 4RWNA 4I2JA 4QZBA 4ED0A 1ZETA 1TK5A 2XGQA 3PW0A 3RB0A 1ZQTA 2I9GA 2R8JA 4JWNA 9ICBA 5J2GA 3RJIA 5KT4A 4I2AA 3JPQA 4EP7A 5DQHA 3M9MB 4M9LA 4MFAA 4NLZA 2BPCA 5KFZA 3SZ2A 4B9SA 4YMOA 1KRPA 3PNCA 4QZ9A 4ATBB 4O3SA 9ICFA 4WC4A 3PW4A 4I28A 4RQ3A 4X5VA 4X4QA 4UD5A 5KFBA 9ICSA 1NK0A 1A76A 2KZMA 5DB8A 3OVSA 4JK1A 2IMWP 4MF2A 4KLMA 4LVSA 1ZQOA 5J0UA 2V9WA 1QSLA 5F2VO 4PGXA 2DR9A 4F5PA 4KLQA 4QZIA 1ZQBA 2NRTA 1NK6A 5EWGA 5DB7A 4M6WB 4X4NA 4RQ7A 3K75D 4RNMA 2R8KA 4ECZA 5KTQA 3PMLA 5KG6A 5J2FA 4I2HA 4QW8A 2HHQA 4GXJA 4QWAA 1JIHA 4C8MA 4RQ1A 3OGUA 4YXJA 3SV4A 7ICPA 3C1YA 5DQIA 1T8EA 5J2KA 3RAXA 4QZFA 1NOMA 4F5RA 4B9VA 3Q8QB 3OJSA 4YCXA 3T5KA 1TKDA 2P6RA 3KHRA 4MEXA 4B9LA 8ICHA 4UD4A 3UQ2A 1ZQRA 3QZ8A 4RUAA 1ZQKA 2JZBB 3THVA 4ECXA 3ISBA 2BKEA 2Q0ZX 4PHEA 4EYHB 1T7PA 3AU2A 3C5GA 4AT8B 3UQ0A 4DOCA 9ICXA 1UETA 1KNYA 4WC3A 2C28A 2BHNA 2LYHA 3RB6A 2IHNA 2P66A 2ID1A 4M9JA 4KLGA 3JYYA 2HVIA 4RQ4A 1BGXT 3MDAA 3RJFA 1XS9D 5HRLA 5KT6A 4IQVA 2FLLA 4PGQA 4FHXA 4DFJA 4CCHA 1S0VA 3QEAZ 1Q79A 1L5UA 3GFKB 2W9BB 2XCPA 5F9NA 1BNOA 1RYSA 1FA0A 5J0XA 5D4BA 5J2IA 2AU0A 9ICPA 1ZQIA 2ZH6A 3H37A 2NRZA 1NJYA 5KFMA 3GIMA 1Y88A 3LQCB 4XRHA 4O9MA 3JPRA 4NLGA 1IXRA 3M8SA 3BQ0A 4DL7A 9ICHA 3EZ5A 2P6UA 4EBKA 5KFAA 1COOA 1N48A 9ICOA 3RJHA 3EPGA 4DQIA 4NLKA 1MIWA 1UEVA 4FHPA 2M2UA 1JXEA 2PI4A 4YR0A 4XQ8A 4M9HA 4QZCA 4RQ2A 2ISPA 5KFTA 4B9UA 1S77D 4M9GA 3Q8PB 2VA2A 8ICJA 3OJUA 3KHLA 1YLQA 2HHPA 5DGBA 3ISCA 3T5HA 4R8UA 3T5LA 2BPGA 4DQPA 2UVVA 4I2GA 1KTQA 1XO1A 2PXIA 4WBZA 2AGPA 4UB2A 5HC9A 1KEJA 4F93B 4EYIB 1ZQSA 8ICXA 2ISOA 1WOTA 1MIVA 3AUOA 3TAPA 5CJ7A 2BCSA 3GV5B 2DFLA 5CP2A 4HYKA 4F50A 3V6HA 1TK0A 1U48A 4LZDA 4ECSA 4ELUA 4I2BA 4WC0A 5DECA 3MFHA 4ED6A 9ICWA 1Q78A 1S0NA 3V6KA 4NM2A 3H8SA 3V7JA 4UAYA 5D46A 8ICGA 5HRDA 3IHQB 2ZH4A 2KP7A 4C8NA 7ICVA 4MFCA 1RPLA 3IM1A 3ZD9A 4DOAA 2JEJA 4Z6DA 1QSSA 4F92B 2W9CA 4KLDA 4TURA 3JPSA 3OUYA 5DDYA 3WFRE 4QWBA 3JPNA 4QZ8A 3GIJA 5HRBA 5IIOA 4DEZA 4DF8A 4Q8EA 4JV2A 4X0BA 4ECTA 5KFJA 1D9DA 3G6YA 4KLHA 8ICMA 4AT7A 4AT9B 1SKRA 2ZH3A 2BE3A 3ZDCA 1SZPA 1Z00B 2ZTDA 2W8KA 4S3NA 4M04A 4Q44A 3LDAA 4F91B 1BPEA 5J0SA 1ZQJA 4X4TA 5DBBA 4EBJA 1Z3EB 2BQRA 1QLNA 1JAJA 4EBEA 4F2SA 4ECVA 4M47A 3Q8RB 3C1ZA 4RPZA 5KG0A 4DL5A 4DL4A 4QZEA 3RH5A 3AQNA 4DWIA 7ICGA 8ICAA 8ICUA 5KFWA 4RWQA 4EZ9A 2PI5A 5IIJA 4F5QA 3PR5B 4KLTA 4WBYA 3PX4A 9ICKA 1N56A 3ZDBA 1S76D 2PFQA 1CEZA 1TFWA 3GDXA 2GWSA 3NYBA 4RWPA 1TFYA 1HJPA 5KFHA 2WTFA 4J9LA 7ICJA 4RT3A 5J0PA 1ZQWA 3TFSA 2BDPA 4BWJA 4EBCA 1NKEA 5EWFA 3KHGA 1ZQGA 5KFXA 2AQ4A 4DSJA 3QEBZ 2BPFA 4I2EA 4ATBA 4F8RA 3OV7A 5DDMA 4ED3A 1ZYQA 5F9LA 4R65A 1NKBA 2DPJA 2XY5A 3HPOA 5KFYA 1VJ7A 4X4UA 3H8WA 4DOBA 4J9NA 4WCWA 3N97B 4RQ6A 4EBDA 4X4RA 1DGSA 4ECUA 4IRDA 4PHDA 4ECRA 5HRHA 5KG2A 1MC8A 3PR4A 4DO9A 5J2HA 4IR9A 4UQGA 3RBEA 4QZDA 3N4MB 5J0OA 5KFRA 4TUSA 1NKCA 2ALZA 1L3VA 4YD1A 4X4OA 2FPMA 5KFLA 5J2AA 1NK7A 4EZ6A 1R8BA 4YVZA 2BCQA 1IM4A 9ICCA 5KG3A 4G3IA 2W9MA 3V7LA 9ICVA 1NO5A 5HHIA 3H39A 4WC2A 1UT8A 5HP4A 4YD2A 3MDCA 2J6SA 4O0IA 1ZJNA 2BQ3A 5KFIA 3UPQA 3RH6A 2ZUBA 3PW5A 5DBCA 3RRHA 2HHUA 2FMSA 4DF4A 2JEFA 3UXNA 1SKSA 4KLOA 3UXPA 5CWRA 2J6TA 4ED2A 4KLFA 7ICTA 3ZDAA 2I1QA 5HHHA 3HX0A 2DRBA 2MUTA 3LWLA 2ZH1A 4X4VA 1TAUA 3MR2A 1RXVA 1ZQVA 2W9AA 1TAQA 2BCVA 4UB4A 1S10A 2AGOA 2NRWA 1C7YA 3JPTA 5KFCA 2J6UA 1ZQEA 1UEUA 2O1PA 8ICIA 2IA6A 1ZQAA 7ICHA 1PX5A 4Q43A 3PO4A 1D8LA 2BQUA 5DG9A 7ICKA 5KFKA 1X9MA 3H3AA 4DSKA 4MEYA 9ICLA 4J9OA 2XY6A 4E7XA 2KTQA 3WFPA 4QWCA 4M0AA 2DR5A 2H5XA 1ZQZA 3NGDA 4O3OA 1ZQHA 4R8UB 2PFOA 2A1JB 5IIIA 4XA5A 1X2IA 1T3NA 4RWOA 5KG4A 5L1LA 4M2YA 3JPPA 1SL1A 1X9WA 1MQ2A 4MF8A 2DR8A 4KMUA 3RJJA 4ELTA 8ICYA 1JQRA 4M6WA 4C8OA 3OVBA 4XQ7A 4UAWA 3C23A 1A77A 4DLGA 3PY8A 3WFSC 5KFPA 2C2RA 4O5KA 5EWEA 2ZTCA 5DBAA 4DFMA 2R8GA 2ZH7A 5TZVA 2W9CB 8ICOA 3AQLA 3V6JA 3HP6A 1L3TA 1ZQCA 5J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9M A;  4FHW A;  4RPX A;  3RRG A;  4YR2 A;  4Q8F A;  1ZQL A;  5L1I A;  3RB3 A;  1ZQX A;  3PMN A;  2Y1I A;  1XSN A;  4UB1 A;  3Q8L A;  4NLN A;  4ECY A;  4KLE A;  2HHW A;  1BPX A;  4X0A A;  5J0R A;  3MAB A;  1R8A A;  4I27 A;  5L1J A;  5L1K A;  3PX0 A;  3ZDE A;  4ED1 A;  1ZQU A;  7ICM A;  1NK4 A;  2VA3 A;  1DK3 A;  1L3S A;  2ZJ8 A;  1JXL A;  4DL3 A;  3RR8 A;  2R8H A;  2KFZ A;  9ICT A;  2JEI A;  4PGY A;  1F5A A;  1QSY A;  4I2C A;  4RPY A;  1V4A A;  8ICW A;  4WC5 A;  4IQT A;  3PO5 A;  1ZQQ A;  3PW7 A;  5J0Q A;  4ED7 A;  5L9X A;  4O3P A;  5HR9 A;  3BQT A;  4K4I A;  3MFI A;  3RH4 A;  1NJX A;  4KN7 A;  1HUO A;  1BPZ A;  1U47 A;  1L3U A;  5DQG A;  1MSW D;  2ZJA A;  3PVX A;  9ICN A;  7ICS A;  1HUZ A;  2PFP A;  4M5D A;  1XU4 A;  5DB6 A;  2ASJ A;  5CHG A;  4Z6E A;  2ZH2 A;  4WC1 A;  2C22 A;  3C21 A;  5KG7 A;  2XGP A;  5KFS A;  3KHH A;  2BR0 A;  1RXW A;  4P4P A;  5HRF A;  3PW2 A;  4KN4 A;  4TUQ A;  3C2K A;  5DGA A;  4JV1 A;  8ICK A;  4C8K A;  4WC6 A;  2AJQ A;  5KG1 A;  3TAN A;  4QZH A;  4RT2 A;  3LK9 A;  3MBY A;  5J2C A;  3ISD A;  1R8C A;  4MFF A;  4FHV A;  5DKW A;  2PBE A;  4LT6 A;  4JV0 A;  3FDS A;  5J2D A;  4QWD A;  3Q8S B;  3ZD8 A;  4RQ8 A;  4IQW A;  4IG8 A;  4E80 A;  4KLL A;  2ZJ5 A;  4DQQ A;  5IIN A;  3OUY B;  2C2D A;  4FS2 A;  5BOM A;  7ICI A;  3HW8 A;  1TVA A;  2HHV A;  7ICO A;  9ICU A;  1JMS A;  2B21 A;  4KLI A;  3UXO A;  1TK8 A;  4FBU A;  3EW9 A;  5HMM A;  4UBC A;  4BGD A;  5DLG A;  3GV8 B;  2XY7 A;  4FHY A;  1BPD A;  4YXM A;  3G6V A;  9ICE A;  8ICS A;  2XC9 A;  3TAQ A;  3HJ1 A;  4Z6C A;  4E0D A;  5KFF A;  2O5A A;  1BPB A;  1BVS A;  1ZQN A;  1B22 A;  3M9N B;  3EYZ A;  1KFT A;  1CUK A;  5IIK A;  4ELV A;  4BXO A;  4P4O A;  4YR3 A;  3TQ1 A;  2ASD A;  1NJZ A;  4KTQ A;  9ICR A;  1DK2 A;  7ICE A;  4RQ0 A;  1LV5 A;  4LZG A;  4J9K A;  2KZZ A;  4P4M A;  5KFN A;  4RNO A;  2KN7 A;  1UA0 A;  4F4X A;  3MGI A;  3Q8M A;  1U9L A;  3H7I A;  8ICR A;  1U45 A;  5DB9 A;  1R89 A;  2MUT B;  4ECQ A;  3C2L A;  3QZ7 A;  1ZQP A;  3JPO A;  3TI0 A;  3BQ2 A;  4QWE A;  1KFS A;  2JEG A;  1KDH A;  3RJE A;  4XUS A;  3MR3 A;  3AQK A;  4PHP A;  5IIM A;  4QZG A;  2R8I A;  3SV3 A;  1NK5 A;  3T5J A;  1S0M A;  4K4G A;  1ZQY A;  1T4G A;  4I2F A;  1ZQD A;  4O3N A;  4F4Y A;  5KFQ A;  9ICQ A;  3RB4 A;  4C8L A;  3EWA A;  2FPK A;  2V4Q A;  3SYZ A;  4YFK A;  1RZT A;  5KT7 A;  4F5N A;  3B0X A;  4FS1 A;  3RTV A;  2M2V A;  1X9S A;  2HVH A;  7ICN A;  7ICL A;  4NXZ A;  1LB2 B;  4FH5 A;  1K1Q A;  8ICZ A;  3L9D A;  4PH5 A;  1SL2 A;  5HRE A;  4R66 A;  2DVI A;  5J0Y A;  3H4B A;  5HRG A;  1RYR A;  2HW3 A;  2KFN A;  3QE9 Y;  4GLX A;  5J0T A;  3C66 A;  4DSI A;  4YN4 A;  2ASL A;  8ICF A;  4RZR A;  3K4G A;  5DED A;  2IHM A;  2FPL A;  4I2D A;  4DSE A;  1KLN A;  4J9S A;  3H8J A;  8ICE A;  2DRA A;  1NK9 A;  8ICN A;  9ICM A;  1EXN A;  3MGH A;  5KT2 A;  1NK8 A;  3HT3 A;  1D9F A;  4J9M A;  4F4K A;  4NKT A;  2ZUD A;  3EPI A;  2KZ3 A;  3ETL A;  3E2E A;  7ICR A;  4X4S A;  4GC6 A;  2RDI A;  1JN3 A;  4E8F A;  4NY8 A;  4KLJ A;  9ICI A;  3HJ4 A;  2ZH5 A;  9ICJ A;  4RNN A;  2DR7 A;  4DS4 A;  1XSL A;  5J29 A;  4DSL A;  2F1J A;  4BWM A;  5DG8 A;  4DFK A;  4JUZ A;  4DFP A;  3B0Y A;  3ZDD A;  2UVU A;  5KFV A;  3Q8K A;  4K4H A;  8ICB A;  4IQU A;  3C5F A;  4J9R A;  9ICG A;  1KFD A;  4X4P A;  2HHT A;  4KLS A;  2XO7 A;  1S0O A;  3HWT A;  2M2T A;  1UT5 A;  2ZUC A;  1TFR A;  5KT5 A;  5IIL A;  4TQS A;  4FO6 A;  4ECW A;  3SI8 A;  7ICU A;  4R64 A;  1SL0 A;  4DSF A;  2RDJ A;  3HIY A;  3C18 A;  4DL2 A;  3RJK A;  3OSP A;  2M9N A;  9ICA A;  2V4R A;  4YMN A;  2BCR A;  4IR1 A;  3RR7 A;  3UPS A;  5CB1 A;  1U49 A;  5CA7 A;  4DQS A;  2BGW A;  4GXK A;  4DS5 A;  3T3F A;  1DOQ A;  5HRK A;  4F4Z A;  2FLP A;  1U4B A;  4ZH4 A;  4AT7 B;  5J2B A;  3BQ1 A;  4F4W A;  2F1H A;  2JZB A;  1WCL A;  5EOZ A;  1ZQF A;  2F1I A;  4AT8 A;  2FLN A;  1SKW A;  4QZA A;  1UA1 A;  4F2R A;  5KG5 A;  2HHX A;  2HHS A;  2NRV A;  5KFD A;  2RFF A;  2ZHB A;  1PZN A;  4DLE A;  1D8Y A;  3OSN A;  1TV9 A;  2OWO A;  5D49 A;  5KT3 A;  4I29 A;  3H40 A;  5BPC A;  1JX4 A;  4O3Q A;  3C2M A;  2VAN A;  2ATL A;  4B9N A;  3GV7 B;  4YG2 A;  4RUC A;  3OHB A;  2W9B A;  5DG7 A;  4TQR A;  4DQR A;  2A1J A;  3PV8 A;  1MQ3 A;  3V7K A;  8ICP A;  1MIY A;  2C2E A;  2FMQ A;  4NKU A;  8ICT A;  2Y1J A;  4GC7 A;  2ZTE A;  1S9F A;  3H4D A;  5BOL A;  1WCN A;  5KFO A;  5HML A;  4F5O A;  3V72 A;  2PFN A;  3RBD A;  3M9O B;  1XSP A;  2VA8 A;  1BNP A;  4WC7 A;  1V9P A;  4J9Q A;  4GXI A;  8ICQ A;  4YP3 A;  3FYH A;  1H38 A;  4IRK A;  1ZQM A;  8ICL A;  3OVA A;  1ZJM A;  4KLU A;  3GIL A;  3GQC A;  4FH3 A;  3BDP A;  4FBT A;  3G6X A;  5J2J A;  3MR5 A;  8ICC A;  4B9T A;  4BXO B;  5C5J A;  4NM1 A;  1NJW A;  2UVW A;  4ED8 A;  4P2H A;  4Z6F A;  1K1S A;  3BJY A;  4QW9 A;  2UVR A;  3AU6 A;  4O3R A;  2AGQ A;  4J9P A;  3OHA A;  2IBK A;  4UB5 A;  2Q66 A;  4PPX A;  5KFE A;  4M9N A;  4YMM A;  3RJG A;  4UB3 A;  4PHA A;  3GIK A;  5HRI A;  1ARO P;  2MAX A;  2NRX A;  1S97 A;  3KTQ A;  5CR0 A;  1KSP A;  4R63 A;  2FMP A;  4UAZ A;  4F3O A;  8ICV A;  2AQ0 A;  4Q45 A;  3M8R A;  1OU5 A;  3NTU A;  2ZH9 A;  2NRK A;  5KFU A;  3WFQ E;  4YQW A;  1BPY A;  3ORY A;  5JUM A;  1VFG A;  3PX6 A;  5HNK A;  3RAQ A;  4RU9 A;  1QTM A;  2M2W A;  3AQM A;  2BCU A;  1B43 A;  3LWM A;  4EEY A;  3MR6 A;  3TAR A;  3JZ0 A;  1NZP A;  3H38 A;  1XC9 A;  2DPI A;  2ZHA A;  4UBB A;  2W8L A;  4AT9 A;  5KFG A;  2XCA A;  3GII A;  2ZH8 A;  4I2I A;  3TFR A;  7ICQ A;  4O5E A;  5DLF A;  5J2E A;  4JWM A;  4KIT B;  4BDP A;  1XWL A;  4TUP A;  4IRC A;  1Z00 A;  4DL6 A;  4O5C A;  7ICF A;  3WFO A;  4RQ5 A;  4RWN A;  4I2J A;  4QZB A;  4ED0 A;  1ZET A;  1TK5 A;  2XGQ A;  3PW0 A;  3RB0 A;  1ZQT A;  2I9G A;  2R8J A;  4JWN A;  9ICB A;  5J2G A;  3RJI A;  5KT4 A;  4I2A A;  3JPQ A;  4EP7 A;  5DQH A;  3M9M B;  4M9L A;  4MFA A;  4NLZ A;  2BPC A;  5KFZ A;  3SZ2 A;  4B9S A;  4YMO A;  1KRP A;  3PNC A;  4QZ9 A;  4ATB B;  4O3S A;  9ICF A;  4WC4 A;  3PW4 A;  4I28 A;  4RQ3 A;  4X5V A;  4X4Q A;  4UD5 A;  5KFB A;  9ICS A;  1NK0 A;  1A76 A;  2KZM A;  5DB8 A;  3OVS A;  4JK1 A;  2IMW P;  4MF2 A;  4KLM A;  4LVS A;  1ZQO A;  5J0U A;  2V9W A;  1QSL A;  5F2V O;  4PGX A;  2DR9 A;  4F5P A;  4KLQ A;  4QZI A;  1ZQB A;  2NRT A;  1NK6 A;  5EWG A;  5DB7 A;  4M6W B;  4X4N A;  4RQ7 A;  3K75 D;  4RNM A;  2R8K A;  4ECZ A;  5KTQ A;  3PML A;  5KG6 A;  5J2F A;  4I2H A;  4QW8 A;  2HHQ A;  4GXJ A;  4QWA A;  1JIH A;  4C8M A;  4RQ1 A;  3OGU A;  4YXJ A;  3SV4 A;  7ICP A;  3C1Y A;  5DQI A;  1T8E A;  5J2K A;  3RAX A;  4QZF A;  1NOM A;  4F5R A;  4B9V A;  3Q8Q B;  3OJS A;  4YCX A;  3T5K A;  1TKD A;  2P6R A;  3KHR A;  4MEX A;  4B9L A;  8ICH A;  4UD4 A;  3UQ2 A;  1ZQR A;  3QZ8 A;  4RUA A;  1ZQK A;  2JZB B;  3THV A;  4ECX A;  3ISB A;  2BKE A;  2Q0Z X;  4PHE A;  4EYH B;  1T7P A;  3AU2 A;  3C5G A;  4AT8 B;  3UQ0 A;  4DOC A;  9ICX A;  1UET A;  1KNY A;  4WC3 A;  2C28 A;  2BHN A;  2LYH A;  3RB6 A;  2IHN A;  2P66 A;  2ID1 A;  4M9J A;  4KLG A;  3JYY A;  2HVI A;  4RQ4 A;  1BGX T;  3MDA A;  3RJF A;  1XS9 D;  5HRL A;  5KT6 A;  4IQV A;  2FLL A;  4PGQ A;  4FHX A;  4DFJ A;  4CCH A;  1S0V A;  3QEA Z;  1Q79 A;  1L5U A;  3GFK B;  2W9B B;  2XCP A;  5F9N A;  1BNO A;  1RYS A;  1FA0 A;  5J0X A;  5D4B A;  5J2I A;  2AU0 A;  9ICP A;  1ZQI A;  2ZH6 A;  3H37 A;  2NRZ A;  1NJY A;  5KFM A;  3GIM A;  1Y88 A;  3LQC B;  4XRH A;  4O9M A;  3JPR A;  4NLG A;  1IXR A;  3M8S A;  3BQ0 A;  4DL7 A;  9ICH A;  3EZ5 A;  2P6U A;  4EBK A;  5KFA A;  1COO A;  1N48 A;  9ICO A;  3RJH A;  3EPG A;  4DQI A;  4NLK A;  1MIW A;  1UEV A;  4FHP A;  2M2U A;  1JXE A;  2PI4 A;  4YR0 A;  4XQ8 A;  4M9H A;  4QZC A;  4RQ2 A;  2ISP A;  5KFT A;  4B9U A;  1S77 D;  4M9G A;  3Q8P B;  2VA2 A;  8ICJ A;  3OJU A;  3KHL A;  1YLQ A;  2HHP A;  5DGB A;  3ISC A;  3T5H A;  4R8U A;  3T5L A;  2BPG A;  4DQP A;  2UVV A;  4I2G A;  1KTQ A;  1XO1 A;  2PXI A;  4WBZ A;  2AGP A;  4UB2 A;  5HC9 A;  1KEJ A;  4F93 B;  4EYI B;  1ZQS A;  8ICX A;  2ISO A;  1WOT A;  1MIV A;  3AUO A;  3TAP A;  5CJ7 A;  2BCS A;  3GV5 B;  2DFL A;  5CP2 A;  4HYK A;  4F50 A;  3V6H A;  1TK0 A;  1U48 A;  4LZD A;  4ECS A;  4ELU A;  4I2B A;  4WC0 A;  5DEC A;  3MFH A;  4ED6 A;  9ICW A;  1Q78 A;  1S0N A;  3V6K A;  4NM2 A;  3H8S A;  3V7J A;  4UAY A;  5D46 A;  8ICG A;  5HRD A;  3IHQ B;  2ZH4 A;  2KP7 A;  4C8N A;  7ICV A;  4MFC A;  1RPL A;  3IM1 A;  3ZD9 A;  4DOA A;  2JEJ A;  4Z6D A;  1QSS A;  4F92 B;  2W9C A;  4KLD A;  4TUR A;  3JPS A;  3OUY A;  5DDY A;  3WFR E;  4QWB A;  3JPN A;  4QZ8 A;  3GIJ A;  5HRB A;  5IIO A;  4DEZ A;  4DF8 A;  4Q8E A;  4JV2 A;  4X0B A;  4ECT A;  5KFJ A;  1D9D A;  3G6Y A;  4KLH A;  8ICM A;  4AT7 A;  4AT9 B;  1SKR A;  2ZH3 A;  2BE3 A;  3ZDC A;  1SZP A;  1Z00 B;  2ZTD A;  2W8K A;  4S3N A;  4M04 A;  4Q44 A;  3LDA A;  4F91 B;  1BPE A;  5J0S A;  1ZQJ A;  4X4T A;  5DBB A;  4EBJ A;  1Z3E B;  2BQR A;  1QLN A;  1JAJ A;  4EBE A;  4F2S A;  4ECV A;  4M47 A;  3Q8R B;  3C1Z A;  4RPZ A;  5KG0 A;  4DL5 A;  4DL4 A;  4QZE A;  3RH5 A;  3AQN A;  4DWI A;  7ICG A;  8ICA A;  8ICU A;  5KFW A;  4RWQ A;  4EZ9 A;  2PI5 A;  5IIJ A;  4F5Q A;  3PR5 B;  4KLT A;  4WBY A;  3PX4 A;  9ICK A;  1N56 A;  3ZDB A;  1S76 D;  2PFQ A;  1CEZ A;  1TFW A;  3GDX A;  2GWS A;  3NYB A;  4RWP A;  1TFY A;  1HJP A;  5KFH A;  2WTF A;  4J9L A;  7ICJ A;  4RT3 A;  5J0P A;  1ZQW A;  3TFS A;  2BDP A;  4BWJ A;  4EBC A;  1NKE A;  5EWF A;  3KHG A;  1ZQG A;  5KFX A;  2AQ4 A;  4DSJ A;  3QEB Z;  2BPF A;  4I2E A;  4ATB A;  4F8R A;  3OV7 A;  5DDM A;  4ED3 A;  1ZYQ A;  5F9L A;  4R65 A;  1NKB A;  2DPJ A;  2XY5 A;  3HPO A;  5KFY A;  1VJ7 A;  4X4U A;  3H8W A;  4DOB A;  4J9N A;  4WCW A;  3N97 B;  4RQ6 A;  4EBD A;  4X4R A;  1DGS A;  4ECU A;  4IRD A;  4PHD A;  4ECR A;  5HRH A;  5KG2 A;  1MC8 A;  3PR4 A;  4DO9 A;  5J2H A;  4IR9 A;  4UQG A;  3RBE A;  4QZD A;  3N4M B;  5J0O A;  5KFR A;  4TUS A;  1NKC A;  2ALZ A;  1L3V A;  4YD1 A;  4X4O A;  2FPM A;  5KFL A;  5J2A A;  1NK7 A;  4EZ6 A;  1R8B A;  4YVZ A;  2BCQ A;  1IM4 A;  9ICC A;  5KG3 A;  4G3I A;  2W9M A;  3V7L A;  9ICV A;  1NO5 A;  5HHI A;  3H39 A;  4WC2 A;  1UT8 A;  5HP4 A;  4YD2 A;  3MDC A;  2J6S A;  4O0I A;  1ZJN A;  2BQ3 A;  5KFI A;  3UPQ A;  3RH6 A;  2ZUB A;  3PW5 A;  5DBC A;  3RRH A;  2HHU A;  2FMS A;  4DF4 A;  2JEF A;  3UXN A;  1SKS A;  4KLO A;  3UXP A;  5CWR A;  2J6T A;  4ED2 A;  4KLF A;  7ICT A;  3ZDA A;  2I1Q A;  5HHH A;  3HX0 A;  2DRB A;  2MUT A;  3LWL A;  2ZH1 A;  4X4V A;  1TAU A;  3MR2 A;  1RXV A;  1ZQV A;  2W9A A;  1TAQ A;  2BCV A;  4UB4 A;  1S10 A;  2AGO A;  2NRW A;  1C7Y A;  3JPT A;  5KFC A;  2J6U A;  1ZQE A;  1UEU A;  2O1P A;  8ICI A;  2IA6 A;  1ZQA A;  7ICH A;  1PX5 A;  4Q43 A;  3PO4 A;  1D8L A;  2BQU A;  5DG9 A;  7ICK A;  5KFK A;  1X9M A;  3H3A A;  4DSK A;  4MEY A;  9ICL A;  4J9O A;  2XY6 A;  4E7X A;  2KTQ A;  3WFP A;  4QWC A;  4M0A A;  2DR5 A;  2H5X A;  1ZQZ A;  3NGD A;  4O3O A;  1ZQH A;  4R8U B;  2PFO A;  2A1J B;  5III A;  4XA5 A;  1X2I A;  1T3N A;  4RWO A;  5KG4 A;  5L1L A;  4M2Y A;  3JPP A;  1SL1 A;  1X9W A;  1MQ2 A;  4MF8 A;  2DR8 A;  4KMU A;  3RJJ A;  4ELT A;  8ICY A;  1JQR A;  4M6W A;  4C8O A;  3OVB A;  4XQ7 A;  4UAW A;  3C23 A;  1A77 A;  4DLG A;  3PY8 A;  3WFS C;  5KFP A;  2C2R A;  4O5K A;  5EWE A;  2ZTC A;  5DBA A;  4DFM A;  2R8G A;  2ZH7 A;  5TZV A;  2W9C B;  8ICO A;  3AQL A;  3V6J A;  3HP6 A;  1L3T A;  1ZQC A;  5J0W A; 
#chains in the Genus database with same CATH topology
 5CFT A;  1ZQX A;  3PMN A;  1XSN A;  2VJ5 A;  2HHW A;  5A0L A;  1BPX A;  2ZIW B;  5J0R A;  3MAB A;  2CN1 A;  5L1J A;  5L1K A;  1F0M A;  3ZDE A;  1JI7 A;  4O69 A;  3CRX A;  2LMR A;  2NO5 A;  4DL3 A;  3WKB A;  2R8H A;  9ICT A;  2JEI A;  2DUY A;  1V4A A;  2KNJ A;  3A0B U;  1XNS A;  5DQG A;  4M5D A;  4K8V A;  3NKU A;  4WQL A;  2ZH2 A;  5KG7 A;  2XGP A;  3NUQ A;  4O3M A;  2BR0 A;  3K7D A;  4P4P A;  3AL0 B;  1A0P A;  3ALR A;  4JV1 A;  4EEN A;  4JMU A;  3TAN A;  3ISD A;  5ALM A;  3KBB A;  4QWD A;  4RQ8 A;  4E80 A;  4KLL A;  2WF8 A;  2P35 A;  4DQQ A;  5BOM A;  2FE9 A;  1TVA A;  7ICI A;  2HHV A;  1TK8 A;  3F2C A;  1BPD A;  8ICS A;  2XC9 A;  1JAL A;  4E0D A;  2K8B B;  1BPB A;  1BVS A;  2HBL A;  5ALI A;  2WB1 C;  1CUK A;  4BXO A;  2ZXH A;  1DK2 A;  1SV0 A;  2KZZ A;  5KFN A;  3H7I A;  3NWI A;  4NLC A;  3QZ7 A;  2PKE A;  1KDH A;  2VKQ A;  3SV3 A;  1S0M A;  4KM5 A;  3F53 A;  5KFQ A;  2MU2 A;  9ICQ A;  2W03 A;  4A8E A;  4FS1 A;  3RTV A;  2I5H A;  2YTU A;  7ICL A;  4NXZ A;  2CRX A;  5AM3 A;  2IOF A;  2DVI A;  2HSZ A;  2HW3 A;  2KFN A;  2LBO A;  4K99 A;  2ASL A;  8ICF A;  2KE7 A;  5DED A;  2IHM A;  5AKZ A;  1NK9 A;  9ICM A;  5L1M A;  1EXN A;  3MGH A;  5KT2 A;  7ICR A;  3HRD D;  1JN3 A;  3HJ4 A;  2FDR A;  2YY6 A;  2RHF A;  4DS4 A;  3H0L B;  5J29 A;  2F1J A;  2EZZ A;  4DFK A;  1WG8 A;  3C5F A;  3L4P A;  3SAH A;  1UT5 A;  2MRL A;  9ICA A;  4DQS A;  1COK A;  2VJ4 A;  3T3F A;  5AK5 A;  1U4B A;  5F3X B;  1SB3 C;  4EED A;  3AQF A;  2IHO A;  2G06 A;  5KNI A;  2QLT A;  4AT8 A;  3FM9 A;  2FLN A;  5KG5 A;  2ZXI A;  2NRV A;  2ZHB A;  5D49 A;  4I29 A;  5BPC A;  2KVS A;  2W9B A;  4RUC A;  1MQ3 A;  2A1J A;  5ALG A;  1MIY A;  2C2E A;  4NKU A;  2HCF A;  5ALD A;  2HBK A;  1WCN A;  4F5O A;  5CHE A;  3ED5 A;  2F77 X;  1XSP A;  1HIW A;  4GXI A;  8ICQ A;  3FYH A;  5AKJ A;  4FH3 A;  3GQC A;  2QAR A;  2KIW A;  4BXO B;  5AHX A;  1NJW A;  4P2H A;  3F2D A;  4IL6 U;  2IBK A;  3ONN A;  2Q66 A;  4PPX A;  4M9N A;  4OAF A;  4UB3 A;  2N1R A;  5HRI A;  3DV9 A;  3WKD A;  1PVQ A;  1S97 A;  2GLE A;  2FMP A;  4UAZ A;  4F3O A;  2F3N A;  3WK7 A;  2NRK A;  3WFQ E;  5E79 U;  3ORY A;  5ALO A;  3PX6 A;  2JGA A;  2BCU A;  2DPI A;  2ZH8 A;  2ZIU A;  5ALU A;  4I2I A;  4LEY A;  3M1Y A;  5DLF A;  3KKA A;  4TUP A;  3JCF A;  4QZB A;  1ZET A;  3NVW A;  5GTI U;  4I2A A;  3JPQ A;  5DQH A;  3M9M B;  4NLZ A;  3SZ2 A;  2JH1 A;  4C7Y A;  1KRP A;  4JLX A;  9ICF A;  2H3Q A;  4I28 A;  4MF2 A;  2IMW P;  4KLM A;  2WF9 A;  2V9W A;  4FZN A;  4F5P A;  5DB7 A;  4RQ7 A;  3K75 D;  4ECZ A;  1KBU A;  2F76 X;  3SMV A;  4C8M A;  4YXJ A;  7ICP A;  3NVV A;  1T8E A;  4QZF A;  1QH9 A;  3OJS A;  4YCX A;  4MEX A;  1PUZ A;  4RUA A;  1ZQK A;  4ECX A;  3ISB A;  4PHE A;  4AT8 B;  3UMB A;  2LYH A;  2MA1 A;  2DKX A;  2YQE A;  3RJF A;  4FHX A;  3QEA Z;  1L5U A;  1UCV A;  2W9B B;  1MA7 A;  1FA0 A;  5J0X A;  3HJE A;  5AM0 A;  3NRZ A;  2AU0 A;  1ZQI A;  5J8Y C;  2JRZ A;  5KFM A;  4QNL A;  4O9M A;  5EE1 A;  4NLG A;  4PL1 A;  1ZXI A;  3L5K A;  3RJH A;  4DQI A;  4NLK A;  3IV6 A;  1S5L U;  5JRT A;  2QAR B;  1T3Q A;  2ISP A;  5KFT A;  5DGB A;  3ISC A;  3T5H A;  4R8U A;  4DQP A;  4I2G A;  2PXI A;  3QUB A;  4UB2 A;  5HC9 A;  1KEJ A;  8ICX A;  4FZM A;  2HI0 A;  1S77 D;  4HYK A;  1TK0 A;  4WC0 A;  3MFH A;  4ED6 A;  2AXT U;  8ICG A;  5ALL A;  4UAY A;  5D46 A;  3IHQ B;  3ZD9 A;  3WK5 A;  1QSS A;  3JPS A;  3T79 A;  3PHZ A;  5HRB A;  4QZ8 A;  4Q8E A;  1SZH A;  3G6Y A;  8ICM A;  3RF9 A;  3SD7 A;  2BE3 A;  3ZDC A;  5AKG A;  5J0S A;  5DBB A;  2LPE A;  2G0A A;  4DWI A;  7ICG A;  8ICU A;  5AM2 A;  3WK4 A;  4F5Q A;  4WBY A;  3PX4 A;  2PFQ A;  3AM9 A;  1TFY A;  4J9L A;  4RT3 A;  2BDP A;  2HOI A;  4QJF B;  3NVZ A;  4EBC A;  2JXJ A;  1ZQG A;  5KFX A;  5J8Y A;  2H3F A;  2BPF A;  5DDM A;  4CDG A;  4UAU A;  2DPJ A;  2R18 A;  2XY5 A;  4X4U A;  5ALN A;  4DOB A;  2KKV A;  3O0F A;  4ECR A;  1MC8 A;  4DO9 A;  5J2H A;  5B5E U;  4LEV A;  4FE3 A;  4UAS A;  2FPM A;  1Z4O A;  5KFL A;  5J2A A;  4OJP A;  4YVZ A;  2BCQ A;  5AI8 A;  2W9M A;  3V7L A;  2E1F A;  1NO5 A;  1QQ5 A;  3TAC B;  1NZB A;  4O0I A;  3UPQ A;  2ZUB A;  3QUC A;  5DBC A;  3RRH A;  2HHU A;  2FMS A;  3UXN A;  4WOY A;  4KLO A;  3E0F A;  3HX0 A;  1AQ6 A;  1X6I A;  1OXJ A;  3IP4 B;  3MR2 A;  4NXX A;  2W04 A;  4UB4 A;  5KFC A;  4Y2U A;  1UEU A;  2A1A A;  1ZQA A;  7ICH A;  1ZD2 P;  4DSK A;  2HOF A;  4J9O A;  2XY6 A;  4C80 A;  2DR5 A;  2WFA A;  2H5X A;  1ZQZ A;  4O3O A;  4R8U B;  4XA5 A;  4Y2T A;  4RWO A;  2VIX A;  1MQ2 A;  3RJJ A;  4ELT A;  4C8O A;  2RP5 A;  4UAW A;  3PY8 A;  4O5K A;  1PK1 A;  2KEY A;  5DBA A;  2G5I B;  2F2A B;  4AYB C;  5AI0 A;  5AI9 A;  1L3T A;  5TIS U;  1ZQC A;  4FHW A;  4YR2 A;  4EX7 A;  3PSP A;  2KVC A;  3SR6 A;  1R8A A;  4I27 A;  2D3D A;  1RG6 A;  1ZQU A;  4EEL A;  3QU7 A;  4PGY A;  1F5A A;  2NV3 A;  4I2C A;  2WF7 A;  4RPY A;  4P0Q B;  5JTI A;  8ICW A;  4WC5 A;  3PO5 A;  5L9X A;  4O3P A;  5HR9 A;  3RH4 A;  1HUO A;  1L3U A;  2ZJA A;  3PVX A;  2EH9 A;  1XU4 A;  5DB6 A;  2ASJ A;  4AYB F;  4WC1 A;  1Z4N A;  3KHH A;  5HRF A;  3PW2 A;  4KN4 A;  5DGA A;  2NYV A;  8ICK A;  4C0Z A;  3N28 A;  2PBE A;  4LT6 A;  4IG8 A;  4IQW A;  3Q8S B;  4JB3 A;  2ZIX A;  2B51 A;  2C2D A;  2W7O A;  7ICO A;  1JMS A;  1YT3 A;  3UXO A;  3EW9 A;  4UBC A;  5DLG A;  1KKX A;  4CF5 A;  4YXM A;  3TAQ A;  2O5A A;  1F5S A;  1RYU A;  5IIK A;  3I76 A;  3R9K A;  4YR3 A;  9ICR A;  1NJZ A;  4KTQ A;  5AIB A;  4BX9 C;  7ICE A;  2D6F C;  4P4M A;  1UA0 A;  3MGI A;  4I0U A;  4DCC A;  4ZOH C;  1ZQP A;  2GAF D;  4QWE A;  2JEG A;  3RJE A;  3AQK A;  3MR3 A;  2H3V A;  2R8I A;  5JU5 A;  5KL1 B;  1Z1V A;  4I2F A;  2K8C B;  4F4Y A;  1PVR A;  2YMM A;  3M6K A;  2DL0 A;  2V4Q A;  3SYZ A;  1RZT A;  3KOO A;  2HN2 A;  3B0X A;  1QQ7 A;  1X9S A;  7ICN A;  1ED1 A;  8ICZ A;  3L9D A;  4PH5 A;  5KAF U;  3J81 j;  4R66 A;  3H4B A;  1F44 A;  2LI6 A;  4GLX A;  1DGJ A;  1QQ6 A;  4RZR A;  1PK1 B;  8ICN A;  2KJ5 A;  3HT3 A;  4NJ8 A;  2EWR A;  3EPI A;  3ETL A;  5AI4 A;  2G5H B;  4NY8 A;  4KLJ A;  1J2M A;  9ICI A;  2DR7 A;  4DSL A;  4DFP A;  5DG8 A;  4JUZ A;  3ZDD A;  2UVU A;  1KFD A;  2M2T A;  2EZY A;  1SL0 A;  4DSF A;  3C28 A;  2CXY A;  4IR1 A;  1VJ5 A;  3UPS A;  5HRK A;  2FLP A;  1ZD3 A;  2FJ6 A;  3PSI A;  4AT7 B;  1OW5 A;  4IS7 A;  2QB0 B;  4LEZ A;  2F8K A;  4BUG A;  1WCL A;  3N7R C;  4KMO B;  5AKK A;  3BS7 A;  1SKW A;  1UA1 A;  2HHS A;  3I28 A;  5KFD A;  3PZP A;  3I1Y A;  4DLE A;  3OSN A;  5KT3 A;  2ZIX B;  4O3Q A;  2ATL A;  4B9N A;  3EF2 A;  3GV7 B;  4YG2 A;  3OHB A;  4TQR A;  3V7K A;  3VC8 A;  3WU2 U;  8ICT A;  2Y1J A;  3D2Q A;  2KG5 A;  3K1R B;  4Y2Y A;  4Y2Q A;  5KFO A;  3H4D A;  2Y0S C;  3WK8 A;  2VA8 A;  2BBJ A;  4WC7 A;  2LM1 A;  4IRK A;  3OVA A;  4FBT A;  5J2J A;  3MR5 A;  8ICC A;  3MCR A;  2UVW A;  4ED8 A;  1K1S A;  4AP9 A;  2UVR A;  3AU6 A;  4O3R A;  4C4T A;  4J9P A;  3OHA A;  3CNH A;  4UB5 A;  4K97 A;  4PHA A;  1S8O A;  1KSP A;  2KHQ A;  8ICV A;  2YMQ A;  5ALJ A;  2ZH9 A;  2LYA A;  2Y0S F;  4YQW A;  4CF3 A;  1VFG A;  5HNK A;  3RAQ A;  2M2W A;  3AQM A;  3TAR A;  2YML A;  2ZG6 A;  1V38 A;  1NZP A;  3H38 A;  4UBB A;  5KFG A;  1VDV A;  2XCA A;  2Q4T A;  3QU4 A;  4KIT B;  1XWL A;  4IRC A;  7ICF A;  3QU2 A;  1Z1B A;  4J03 A;  4RWN A;  4JWN A;  5EE0 A;  2XGQ A;  3PW0 A;  9ICB A;  2WF6 A;  4M9L A;  2BPC A;  2A3V A;  1MN8 A;  4UB8 U;  4Y2P A;  4UD5 A;  5KFB A;  1A76 A;  5DB8 A;  1QSL A;  5F2V O;  2DR9 A;  3AN1 A;  4UW9 A;  4QIW C;  3F5A A;  4NLB A;  4RNM A;  2RQ5 A;  4GXJ A;  3UMC A;  1JIH A;  1PK3 A;  4WJ3 B;  4K98 A;  3RAX A;  1NOM A;  3Q8Q B;  3T5K A;  1TKD A;  3SAG A;  2P6R A;  1J2N A;  3KHR A;  8ICH A;  3UQ2 A;  1ZQR A;  2PMZ F;  2BKE A;  5EE9 A;  2FCL A;  5CFU A;  5AM1 A;  1UET A;  1KNY A;  2DF4 B;  3D2N A;  2IHN A;  2GA9 D;  4KLG A;  1NI3 A;  3QU5 A;  4QIW F;  1BGX T;  1XS9 D;  5KT6 A;  4IQV A;  3KKA C;  2FLL A;  4PGQ A;  1S0V A;  5J2I A;  3GIM A;  3LQC B;  4XRH A;  3JPR A;  1IXR A;  2OCE A;  1UEV A;  4FHP A;  4NXW A;  2PI4 A;  4M9H A;  4QZC A;  4RQ2 A;  2DWQ A;  4B9U A;  2E8P A;  4M9G A;  3PSF A;  2VA2 A;  3OJU A;  8ICJ A;  2KV2 A;  2Z7J A;  5GTH U;  2UVV A;  1KTQ A;  4EYI B;  1L7P A;  3TAP A;  2BCS A;  2DFL A;  4F50 A;  4ELU A;  1U48 A;  4LZD A;  4ECS A;  9ICW A;  1S0N A;  3V6K A;  5AKL A;  3V7J A;  1Q46 A;  2KP7 A;  3IG8 A;  3MC1 A;  3SEI A;  5CRX A;  3WK9 A;  4DOA A;  2JEJ A;  1O08 A;  4KLD A;  3GU3 A;  4TUR A;  3KD3 A;  3GIJ A;  5IIO A;  4JV2 A;  3F5E A;  5B3P A;  4X0B A;  5KFJ A;  2OHF A;  2ZH3 A;  1SZP A;  2W8K A;  4S3N A;  4F91 B;  1CRX A;  4WQK A;  4Y2R A;  2K4E A;  2W11 A;  4F2S A;  3C1Z A;  4RPZ A;  5AIC A;  5KG0 A;  3RH5 A;  4WH5 A;  2M0N A;  5KFW A;  4EZ9 A;  5IIJ A;  5B66 U;  2JMG A;  4KLT A;  3F2B A;  9ICK A;  3ZDB A;  1TFW A;  3GDX A;  2GWS A;  1QCK A;  2IOH A;  5CFS A;  4FO1 A;  2DGZ A;  2WTF A;  2YB1 A;  3DDH A;  3OTQ A;  3TFS A;  4BWJ A;  1NKE A;  3L3F X;  5AM5 A;  3HIL A;  4DSJ A;  3QEB Z;  3OV7 A;  1N62 A;  4ED3 A;  1NKB A;  4OAH A;  4J9N A;  1DGS A;  4IRD A;  5HRH A;  2ES6 A;  5KG2 A;  3RBE A;  1YZ7 A;  4OD0 A;  2ALZ A;  4USA A;  3SQI A;  1L3V A;  1NK7 A;  1IM4 A;  2EAN A;  1N63 A;  3H39 A;  3SAF A;  3MDC A;  2BQ3 A;  4DF4 A;  1SKS A;  3UXP A;  3A0H U;  2K4I A;  2J6T A;  7ICT A;  2I1Q A;  2DRB A;  2MUT A;  5AK4 A;  5FP0 A;  4C4R A;  2ZH1 A;  4X4V A;  1TAQ A;  5AI5 A;  1SWW A;  2AGO A;  2J6U A;  1ZOL A;  1ZQE A;  2O1P A;  2F8L A;  8ICI A;  1X9M A;  1SXE A;  1LVH A;  2EQY A;  2KTQ A;  4QWC A;  2PFO A;  1ZQH A;  2A1J B;  1Z19 A;  4M2Y A;  1SL1 A;  1X9W A;  4M6W A;  3WKA A;  3OVB A;  3C23 A;  1A77 A;  5EWE A;  5ALW A;  2BZF A;  3AQL A;  4ED7 A;  4DL2 A;  2KOB A;  1ZQL A;  5L1I A;  3RB3 A;  2K8A A;  4UB1 A;  4ECY A;  3PX0 A;  4ED1 A;  1L3S A;  2KFZ A;  3RR8 A;  3WKC A;  1QSY A;  1RQN A;  2XVT A;  3LYS A;  4IQT A;  5J0Q A;  4C4S A;  1IG6 A;  1UQV A;  3BQT A;  4K4I A;  1NJX A;  1BPZ A;  1MSW D;  1HUZ A;  2ZIU B;  3C21 A;  4TUQ A;  4C8K A;  2AJQ A;  1R8C A;  2RRD A;  4QZH A;  4RT2 A;  5J2C A;  4MFF A;  5DKW A;  5J2D A;  3FDS A;  4Y2J A;  3PST A;  4FS2 A;  3HW8 A;  9ICU A;  2B21 A;  5T14 A;  4FBU A;  5HMM A;  3QUT A;  4BGD A;  3GZF A;  2XY7 A;  4FHY A;  3HJ1 A;  3AMZ A;  5KFF A;  2KKP A;  1ZQN A;  4O68 A;  3M9N B;  3EYZ A;  4UAV A;  3NS1 A;  3AQE A;  3TQ1 A;  1LV5 A;  4OJL A;  4J9K A;  2W7P A;  3D6J A;  2KN7 A;  8ICR A;  4F4X A;  1U9L A;  1R89 A;  1U45 A;  5DB9 A;  2MUT B;  1X66 A;  5AKE A;  4ECQ A;  2W43 A;  3C2L A;  1O03 A;  3JPO A;  3TI0 A;  3BQ2 A;  3KZX A;  4XUS A;  2H3I A;  4PHP A;  3CK6 A;  4QZG A;  4K4G A;  1NK5 A;  1T4G A;  1UPH A;  1ZQD A;  4O3N A;  2B6G A;  3KFU F;  3RB4 A;  2FPK A;  4YFK A;  5KT7 A;  4OO1 J;  5AKI A;  2M2V A;  3QYP A;  1SL2 A;  5G5H A;  3TAD C;  5HRG A;  1RYR A;  1NNL A;  5J0T A;  2EAO A;  1IV8 A;  4DSI A;  4XJE A;  1V97 A;  4YN4 A;  5AI6 A;  2FPL A;  4I2D A;  4DSE A;  1KLN A;  4J9S A;  3H8J A;  2DRA A;  5KL8 B;  1Q3U A;  1D9F A;  4NKT A;  2ZUD A;  2AH5 A;  2RDI A;  2ZH5 A;  9ICJ A;  2WAQ C;  4RNN A;  3ER9 B;  1XO0 A;  3N7S C;  1XSL A;  4E7X A;  3B0Y A;  5KFV A;  4K4H A;  9ICG A;  4X4P A;  2HHT A;  3D2S A;  1WUD A;  3HWT A;  2B56 A;  1TFR A;  5KT5 A;  7ICU A;  5AKX A;  4R64 A;  3RJK A;  3N7P D;  4YMN A;  2BCR A;  1U49 A;  5CA7 A;  2BGW A;  4GXK A;  4DS5 A;  1DOQ A;  5ALR A;  2EZX A;  2JZB A;  2KHV A;  5EOZ A;  2WAQ F;  1PVP A;  3FC4 A;  4F2R A;  1PZN A;  1D8Y A;  1JX4 A;  2VAN A;  5AK6 A;  4DQR A;  3PV8 A;  3K1Z A;  3QX7 A;  4GC7 A;  2ZTE A;  4JWM A;  2PFN A;  5BOL A;  3V72 A;  1L8L A;  3IN5 A;  1V9P A;  3TAD A;  4J9Q A;  5HR6 A;  2OEH A;  4EEB A;  2KD1 A;  4C7Z A;  4KLU A;  2F44 A;  2YX8 A;  3BDP A;  3G6X A;  4B6J A;  4B9T A;  2EDU A;  4Z6F A;  4QW9 A;  2AGQ A;  5KFE A;  4YMM A;  3RJG A;  3GIK A;  2MAX A;  3KTQ A;  4R63 A;  1OU5 A;  1D8B A;  5KFU A;  1RQL A;  5JUM A;  1QTM A;  1WWV A;  3LWM A;  4EEY A;  1K5O A;  1SV4 A;  3JZ0 A;  4KX3 A;  4F72 A;  1XC9 A;  4AT9 A;  3GII A;  4BDP A;  2G07 A;  5ALP A;  4DL6 A;  4EV6 A;  4I2J A;  3RB0 A;  1DRG A;  2I9G A;  1WWU A;  5KT4 A;  4EP7 A;  2HBM A;  1FO4 A;  4Y2S A;  3ZI4 A;  3PNC A;  4HX0 A;  4O3S A;  3PW4 A;  4NL9 A;  1SXD A;  9ICS A;  2XIC A;  4GIB A;  2KZM A;  5C0Y A;  3OVS A;  2OXO A;  4JK1 A;  4LVS A;  1ZQO A;  5J0U A;  4PGX A;  4KLQ A;  1X6J A;  4QZI A;  1ZQB A;  2NRT A;  1NK6 A;  4X4N A;  5KTQ A;  3B9J A;  5AKY A;  5KG6 A;  3PML A;  4OAI Z;  4QWA A;  3M7D A;  3OGU A;  5J2K A;  4F5R A;  4B9V A;  4B9L A;  1B22 A;  1KFT A;  4UD4 A;  5ALY A;  3QZ8 A;  2JZB B;  3THV A;  1JUD A;  2Q0Z X;  1T7P A;  3C5G A;  3DEE A;  3UQ0 A;  4DOC A;  2K4H A;  3WKE A;  3JYY A;  5HR7 A;  2LKY A;  1KW4 A;  4RQ4 A;  2E8M A;  1FEZ A;  3LVV A;  3NAS A;  4CCH A;  1Q79 A;  3GFK B;  1RYS A;  5D4B A;  9ICP A;  2ZH6 A;  5AIA A;  3H37 A;  1NJY A;  1Y88 A;  2OYY A;  4DL7 A;  9ICH A;  4EBK A;  1COO A;  9ICO A;  3EPG A;  1MIW A;  3IRU A;  2M2U A;  1JXE A;  4YR0 A;  2DBY A;  3S6J A;  3Q8P B;  2HHP A;  2BPG A;  3T5L A;  1XO1 A;  1WOT A;  2ISO A;  1MIV A;  1Q3V A;  3AUO A;  3GV5 B;  4I2B A;  3QU9 A;  4NM2 A;  3H8S A;  4GFJ A;  1P7D A;  1TAM A;  2ZH4 A;  3IM1 A;  1LKY A;  4Z6D A;  4F92 B;  2W9C A;  3E58 A;  3JPN A;  4DEZ A;  4ECT A;  4N7R A;  4AT9 B;  4KLH A;  5KAI U;  3NVY A;  5ALK A;  2ZTD A;  5CEH A;  4Q44 A;  4EBJ A;  1Z3E B;  4OJO A;  2BQR A;  1N60 A;  1JAJ A;  3CYM A;  4EBE A;  4M47 A;  3Q8R B;  2KMD A;  3AQN A;  4QZE A;  8ICA A;  4EX6 A;  5ALE A;  5ALH A;  1N56 A;  2G09 A;  2WF5 A;  3NYB A;  4RWP A;  1HJP A;  3OPX A;  5KFH A;  7ICJ A;  5D63 A;  1JRP A;  5J0P A;  1ZQW A;  3U26 A;  2O6K A;  5AK3 A;  4O67 A;  2AQ4 A;  4ATB A;  4F8R A;  2JHD A;  4R65 A;  1VJ7 A;  2ODG A;  1B0X A;  3H8W A;  4WCW A;  4RQ6 A;  4EBD A;  4PHD A;  3PR4 A;  2PMZ C;  4QZD A;  3N4M B;  5KFR A;  4UAT A;  4TUS A;  1NKC A;  4ICA A;  1R8B A;  1L7N A;  4EZ6 A;  4O6A A;  9ICC A;  4EEK A;  9ICV A;  1N2X A;  5HHI A;  4NXV A;  2ESE A;  5HP4 A;  4YD2 A;  1ZJN A;  5KFI A;  3RH6 A;  5ALF A;  1RM6 C;  5ALT A;  5CWR A;  2WB1 F;  4KLF A;  3ZDA A;  2KJ8 A;  3BS5 A;  2W9A A;  2BCV A;  1S10 A;  1C7Y A;  1T94 A;  1PX5 A;  4Q43 A;  3PO4 A;  1D8L A;  5DG9 A;  5KFK A;  2OM6 A;  9ICL A;  1ZD4 A;  3WFP A;  4M0A A;  1TE2 A;  5ALZ A;  4US8 A;  5III A;  5AM4 A;  2AHO B;  5KG4 A;  3JPP A;  2G08 A;  4KMU A;  2E8O A;  4DLG A;  5KFP A;  2C2R A;  3UMG A;  2ZTC A;  4DFM A;  2R8G A;  1LKY B;  5TZV A;  2W9C B;  8ICO A;  3V6J A;  3HP6 A;  2EAM A;  4B9M A;  4RPX A;  3RRG A;  4Q8F A;  2Y1I A;  3Q8L A;  4NLN A;  4KLE A;  4X0A A;  2BDU A;  4OJ5 A;  3EUB 2;  7ICM A;  1NK4 A;  1DK3 A;  2VA3 A;  2ZJ8 A;  1JXL A;  1KQQ A;  2HBJ A;  3CW2 C;  1ZQQ A;  3PW7 A;  5H2F U;  2EAP A;  3MFI A;  4KN7 A;  9ICN A;  1U47 A;  7ICS A;  2PFP A;  5CHG A;  4Z6E A;  2C22 A;  2A19 A;  5KFS A;  1RXW A;  1CI4 A;  3C2K A;  4WC6 A;  5KG1 A;  4FHV A;  3LK9 A;  4ATB B;  3MBY A;  1N5W A;  1FFV A;  2KIV A;  4JV0 A;  3M6Z A;  3ZD8 A;  2ZJ5 A;  5IIN A;  4KLI A;  4FFD A;  3GV8 B;  9ICE A;  3G6V A;  2LM4 A;  2XI9 A;  4CF4 A;  4Z6C A;  4PL2 A;  4ELV A;  3UM9 A;  4P4O A;  1WYG A;  3IG5 A;  2ASD A;  4RQ0 A;  4LZG A;  4K9A A;  4RNO A;  3Q8M A;  3C29 A;  4CRX A;  2KSO A;  2W3R A;  2QB1 A;  3BS5 B;  1KFS A;  4UAR A;  2YB4 A;  5IIM A;  3T5J A;  4JLZ A;  1ZQY A;  4G9B A;  3BZK A;  4C8L A;  4DFD A;  3EWA A;  4CE6 A;  4CGZ A;  4F5N A;  1V85 A;  2HVH A;  1LB2 B;  4FH5 A;  1K1Q A;  5HRE A;  5J0Y A;  3ERC C;  3QE9 Y;  1ECW A;  2L5Y A;  3C66 A;  2W55 A;  4MHV A;  1ZRN A;  3K4G A;  1X40 A;  2HDO A;  8ICE A;  5D62 A;  2KK0 A;  4MKP A;  2GH1 A;  2IOF K;  1NK8 A;  4J9M A;  4F4K A;  1SIJ A;  3E2E A;  2KZ3 A;  4CNQ A;  4X4S A;  4GC6 A;  4E8F A;  4Y2X A;  3H0R B;  4BWM A;  1L8O A;  4IC9 A;  1UHU A;  4NWI A;  3Q8K A;  8ICB A;  4IQU A;  4J9R A;  3HKZ C;  3FAH A;  4KLS A;  2XO7 A;  1S0O A;  3AEV A;  2ZUC A;  5IIL A;  4TQS A;  4FO6 A;  4ECW A;  3SI8 A;  3VCB A;  2RDJ A;  3HIY A;  3C18 A;  3OSP A;  2M9N A;  4UB6 U;  2V4R A;  3RR7 A;  4PJ0 U;  5CB1 A;  4F4Z A;  5ALS A;  4ZH4 A;  3MGV A;  5J2B A;  1N5X A;  3BQ1 A;  4F4W A;  4NXU A;  2F1H A;  1L7O A;  5EE3 A;  1ZQF A;  2F1I A;  4KB6 A;  1YZ6 A;  3H8M A;  4QZA A;  2HHX A;  4US9 A;  3HKZ F;  2RFF A;  2OWO A;  2W3S A;  1TV9 A;  3H40 A;  1KN5 A;  3C2M A;  4OJ6 A;  1KL9 A;  2QKQ A;  5DG7 A;  8ICP A;  4XQ7 A;  2FMQ A;  1S9F A;  5ALV A;  5HML A;  3RBD A;  3M9O B;  1BNP A;  4YP3 A;  1H38 A;  1ZQM A;  8ICL A;  2JR5 A;  3CP8 A;  1ZJM A;  3GIL A;  2DQN B;  5C5J A;  4NM1 A;  1VLB A;  3BJY A;  2NO4 A;  2KSO B;  2GOL A;  1ARO P;  2YN4 A;  1ZRM A;  2NRX A;  5B3Q A;  5CR0 A;  2AQ0 A;  4Q45 A;  3M8R A;  3NTU A;  4KX5 A;  4P0Q A;  1BPY A;  4RU9 A;  2CPR A;  4EGW A;  1HEK A;  1B43 A;  3MR6 A;  2ZHA A;  4RQN A;  2W8L A;  3TFR A;  1FFU A;  7ICQ A;  4O5E A;  5J2E A;  1Z00 A;  3WFO A;  4O5C A;  4RQ5 A;  4ED0 A;  1TK5 A;  2R8J A;  3QUQ A;  1ZQT A;  5J2G A;  3RJI A;  4U6P A;  4MFA A;  3LVW A;  5KFZ A;  1B4F A;  4B9S A;  4YMO A;  4QZ9 A;  2KIC A;  4WC4 A;  2I6X A;  4RQ3 A;  4X5V A;  4X4Q A;  1JRO A;  1NK0 A;  1GO3 F;  2JH7 A;  3WK6 A;  1GPJ A;  1FIQ A;  2WHE A;  3SEN A;  5EWG A;  4M6W B;  1SWV A;  2R8K A;  3IDW A;  4I2H A;  5J2F A;  4Y2V A;  4QW8 A;  3TKA A;  2HHQ A;  2HMX A;  1ZD5 A;  4RQ1 A;  5D61 A;  3SV4 A;  3C1Y A;  5DQI A;  4P0P A;  5JTG A;  3BQ7 A;  3ETR A;  4EYH B;  3AU2 A;  9ICX A;  4WC3 A;  2C28 A;  2BHN A;  3RB6 A;  2P66 A;  1RDF A;  2ID1 A;  2E8N A;  2H3Z A;  4M9J A;  2HVI A;  4NXT A;  3MDA A;  5HRL A;  4DFJ A;  2XCP A;  5F9N A;  4LEW A;  1BNO A;  2YMP A;  2DKZ A;  2NRZ A;  2FI1 A;  3ICX A;  1X42 A;  3M8S A;  3BQ0 A;  2K60 A;  3EZ5 A;  2P6U A;  5KFA A;  1N48 A;  4NL9 C;  2K4P A;  2ZIV A;  2E3T A;  2K89 A;  4XQ8 A;  3BZC A;  1SGG A;  5K4L A;  1YLQ A;  3KHL A;  2IUB A;  4WBZ A;  4HAI A;  2AGP A;  4F93 B;  1ZQS A;  5CJ7 A;  3NRW A;  5CP2 A;  3V6H A;  5DEC A;  2OH2 A;  1Q78 A;  4PZO A;  5HRD A;  4C8N A;  7ICV A;  4MFC A;  1RPL A;  4ACO A;  3OUY A;  5DDY A;  3WFR E;  4QWB A;  4DF8 A;  1OUQ A;  5ALQ A;  1D9D A;  4AT7 A;  2B4V A;  1SKR A;  2QB0 A;  2ZIW A;  4BJQ A;  1Z00 B;  3NVO A;  4M04 A;  3LDA A;  1ZQJ A;  1BPE A;  4X4T A;  1QLN A;  4ECV A;  1A6S A;  4RQM A;  2KJ9 A;  2LYB A;  4DL5 A;  4DL4 A;  4RWQ A;  3KZI U;  2PI5 A;  2LHT A;  3PR5 B;  1S76 D;  1CEZ A;  4U7C A;  3RFA A;  1X9X A;  2Y9T A;  2HOQ A;  4PZN A;  5EWF A;  3KHG A;  4FZL A;  4I2E A;  3QXG A;  5G5G A;  1ZYQ A;  5F9L A;  2RLT A;  3HPO A;  5KFY A;  2D8C A;  4NV0 A;  3N97 B;  4X4R A;  4ECU A;  3OWG A;  4IR9 A;  4UQG A;  5AKH A;  5J0O A;  4P0P B;  1ZQ1 C;  4YD1 A;  4X4O A;  2JV3 A;  2E1E A;  2HN1 A;  5KG3 A;  4G3I A;  4WC2 A;  1Q8K A;  1UT8 A;  4K9B A;  2J6S A;  2W54 A;  3PW5 A;  4OCZ A;  4F71 A;  2JEF A;  1IIP A;  4ED2 A;  5ALX A;  5HHH A;  3LWL A;  3H0M B;  1TAU A;  2BBH A;  1RXV A;  1ZQV A;  2GO7 A;  2NRW A;  1N61 A;  3JPT A;  1URJ A;  2IA6 A;  2BQU A;  7ICK A;  2ZIV B;  3H3A A;  4K96 A;  4MEY A;  2B0C A;  1DXS A;  3QNM A;  3NGD A;  1X2I A;  1T3N A;  2XID A;  5L1L A;  4OAG A;  4MF8 A;  2DR8 A;  1JQR A;  8ICY A;  1L7M A;  2Y9U A;  3ER8 C;  1SV0 C;  3WFS C;  1C20 A;  1M6Y A;  1L6N A;  2MSN A;  1J97 A;  2ZH7 A;  2E5S A;  4LJX A;  3OUY B;  5J0W A; 
#chains in the Genus database with same CATH homology
 4B9M A;  4FHW A;  4RPX A;  3RRG A;  4YR2 A;  4Q8F A;  1ZQL A;  5L1I A;  3RB3 A;  1ZQX A;  3PMN A;  2Y1I A;  1XSN A;  4UB1 A;  3Q8L A;  4NLN A;  4ECY A;  4KLE A;  2HHW A;  1BPX A;  4X0A A;  5J0R A;  3MAB A;  1R8A A;  4I27 A;  5L1J A;  5L1K A;  3PX0 A;  3ZDE A;  4ED1 A;  1ZQU A;  7ICM A;  1NK4 A;  2VA3 A;  1DK3 A;  1L3S A;  2ZJ8 A;  1JXL A;  4DL3 A;  3RR8 A;  2R8H A;  2KFZ A;  9ICT A;  2JEI A;  4PGY A;  1F5A A;  1QSY A;  4I2C A;  4RPY A;  1V4A A;  8ICW A;  4WC5 A;  4IQT A;  3PO5 A;  1ZQQ A;  3PW7 A;  5J0Q A;  4ED7 A;  5L9X A;  4O3P A;  5HR9 A;  3BQT A;  4K4I A;  3MFI A;  3RH4 A;  1NJX A;  4KN7 A;  1HUO A;  1BPZ A;  1U47 A;  1L3U A;  5DQG A;  1MSW D;  2ZJA A;  3PVX A;  9ICN A;  7ICS A;  1HUZ A;  2PFP A;  4M5D A;  1XU4 A;  5DB6 A;  2ASJ A;  5CHG A;  4Z6E A;  2ZH2 A;  4WC1 A;  2C22 A;  3C21 A;  5KG7 A;  2XGP A;  5KFS A;  3KHH A;  2BR0 A;  1RXW A;  4P4P A;  5HRF A;  3PW2 A;  4KN4 A;  4TUQ A;  3C2K A;  5DGA A;  4JV1 A;  8ICK A;  4C8K A;  4WC6 A;  2AJQ A;  5KG1 A;  3TAN A;  4QZH A;  4RT2 A;  3LK9 A;  3MBY A;  5J2C A;  3ISD A;  1R8C A;  4MFF A;  4FHV A;  5DKW A;  2PBE A;  4LT6 A;  4JV0 A;  3FDS A;  5J2D A;  4QWD A;  3Q8S B;  3ZD8 A;  4RQ8 A;  4IQW A;  4IG8 A;  4E80 A;  4KLL A;  2ZJ5 A;  4DQQ A;  5IIN A;  3OUY B;  2C2D A;  4FS2 A;  5BOM A;  7ICI A;  3HW8 A;  1TVA A;  2HHV A;  7ICO A;  9ICU A;  1JMS A;  2B21 A;  4KLI A;  3UXO A;  1TK8 A;  4FBU A;  3EW9 A;  5HMM A;  4UBC A;  4BGD A;  5DLG A;  3GV8 B;  2XY7 A;  4FHY A;  1BPD A;  4YXM A;  3G6V A;  9ICE A;  8ICS A;  2XC9 A;  3TAQ A;  3HJ1 A;  4Z6C A;  4E0D A;  5KFF A;  2O5A A;  1BPB A;  1BVS A;  1ZQN A;  1B22 A;  3M9N B;  3EYZ A;  1KFT A;  1CUK A;  5IIK A;  4ELV A;  4BXO A;  4P4O A;  4YR3 A;  3TQ1 A;  2ASD A;  1NJZ A;  4KTQ A;  9ICR A;  1DK2 A;  7ICE A;  4RQ0 A;  1LV5 A;  4LZG A;  4J9K A;  2KZZ A;  4P4M A;  5KFN A;  4RNO A;  2KN7 A;  1UA0 A;  4F4X A;  3MGI A;  3Q8M A;  1U9L A;  3H7I A;  8ICR A;  1U45 A;  5DB9 A;  1R89 A;  2MUT B;  4ECQ A;  3C2L A;  3QZ7 A;  1ZQP A;  3JPO A;  3TI0 A;  3BQ2 A;  4QWE A;  1KFS A;  2JEG A;  1KDH A;  3RJE A;  4XUS A;  3MR3 A;  3AQK A;  4PHP A;  5IIM A;  4QZG A;  2R8I A;  3SV3 A;  1NK5 A;  3T5J A;  1S0M A;  4K4G A;  1ZQY A;  1T4G A;  4I2F A;  1ZQD A;  4O3N A;  4F4Y A;  5KFQ A;  9ICQ A;  3RB4 A;  4C8L A;  3EWA A;  2FPK A;  2V4Q A;  3SYZ A;  4YFK A;  1RZT A;  5KT7 A;  4F5N A;  3B0X A;  4FS1 A;  3RTV A;  2M2V A;  1X9S A;  2HVH A;  7ICN A;  7ICL A;  4NXZ A;  1LB2 B;  4FH5 A;  1K1Q A;  8ICZ A;  3L9D A;  4PH5 A;  1SL2 A;  5HRE A;  4R66 A;  2DVI A;  5J0Y A;  3H4B A;  5HRG A;  1RYR A;  2HW3 A;  2KFN A;  3QE9 Y;  4GLX A;  5J0T A;  3C66 A;  4DSI A;  4YN4 A;  2ASL A;  8ICF A;  4RZR A;  3K4G A;  5DED A;  2IHM A;  2FPL A;  4I2D A;  4DSE A;  1KLN A;  4J9S A;  3H8J A;  8ICE A;  2DRA A;  1NK9 A;  8ICN A;  9ICM A;  1EXN A;  3MGH A;  5KT2 A;  1NK8 A;  3HT3 A;  1D9F A;  4J9M A;  4F4K A;  4NKT A;  2ZUD A;  3EPI A;  2KZ3 A;  3ETL A;  3E2E A;  7ICR A;  4X4S A;  4GC6 A;  2RDI A;  1JN3 A;  4E8F A;  4NY8 A;  4KLJ A;  9ICI A;  3HJ4 A;  2ZH5 A;  9ICJ A;  4RNN A;  2DR7 A;  4DS4 A;  1XSL A;  5J29 A;  4DSL A;  2F1J A;  4BWM A;  5DG8 A;  4DFK A;  4JUZ A;  4DFP A;  3B0Y A;  3ZDD A;  2UVU A;  5KFV A;  3Q8K A;  4K4H A;  8ICB A;  4IQU A;  3C5F A;  4J9R A;  9ICG A;  1KFD A;  4X4P A;  2HHT A;  4KLS A;  2XO7 A;  1S0O A;  3HWT A;  2M2T A;  1UT5 A;  2ZUC A;  1TFR A;  5KT5 A;  5IIL A;  4TQS A;  4FO6 A;  4ECW A;  3SI8 A;  7ICU A;  4R64 A;  1SL0 A;  4DSF A;  2RDJ A;  3HIY A;  3C18 A;  4DL2 A;  3RJK A;  3OSP A;  2M9N A;  9ICA A;  2V4R A;  4YMN A;  2BCR A;  4IR1 A;  3RR7 A;  3UPS A;  5CB1 A;  1U49 A;  5CA7 A;  4DQS A;  2BGW A;  4GXK A;  4DS5 A;  3T3F A;  1DOQ A;  5HRK A;  4F4Z A;  2FLP A;  1U4B A;  4ZH4 A;  4AT7 B;  5J2B A;  3BQ1 A;  4F4W A;  2F1H A;  2JZB A;  1WCL A;  5EOZ A;  1ZQF A;  2F1I A;  4AT8 A;  2FLN A;  1SKW A;  4QZA A;  1UA1 A;  4F2R A;  5KG5 A;  2HHX A;  2HHS A;  2NRV A;  5KFD A;  2RFF A;  2ZHB A;  1PZN A;  4DLE A;  1D8Y A;  3OSN A;  1TV9 A;  2OWO A;  5D49 A;  5KT3 A;  4I29 A;  3H40 A;  5BPC A;  1JX4 A;  4O3Q A;  3C2M A;  2VAN A;  2ATL A;  4B9N A;  3GV7 B;  4YG2 A;  4RUC A;  3OHB A;  2W9B A;  5DG7 A;  4TQR A;  4DQR A;  2A1J A;  3PV8 A;  1MQ3 A;  3V7K A;  8ICP A;  1MIY A;  2C2E A;  2FMQ A;  4NKU A;  8ICT A;  2Y1J A;  4GC7 A;  2ZTE A;  1S9F A;  3H4D A;  5BOL A;  1WCN A;  5KFO A;  5HML A;  4F5O A;  3V72 A;  2PFN A;  3RBD A;  3M9O B;  1XSP A;  2VA8 A;  1BNP A;  4WC7 A;  1V9P A;  4J9Q A;  4GXI A;  8ICQ A;  4YP3 A;  3FYH A;  1H38 A;  4IRK A;  1ZQM A;  8ICL A;  3OVA A;  1ZJM A;  4KLU A;  3GIL A;  3GQC A;  4FH3 A;  3BDP A;  4FBT A;  3G6X A;  5J2J A;  3MR5 A;  8ICC A;  4B9T A;  4BXO B;  5C5J A;  4NM1 A;  1NJW A;  2UVW A;  4ED8 A;  4P2H A;  4Z6F A;  1K1S A;  3BJY A;  4QW9 A;  2UVR A;  3AU6 A;  4O3R A;  2AGQ A;  4J9P A;  3OHA A;  2IBK A;  4UB5 A;  2Q66 A;  4PPX A;  5KFE A;  4M9N A;  4YMM A;  3RJG A;  4UB3 A;  4PHA A;  3GIK A;  5HRI A;  1ARO P;  2MAX A;  2NRX A;  1S97 A;  3KTQ A;  5CR0 A;  1KSP A;  4R63 A;  2FMP A;  4UAZ A;  4F3O A;  8ICV A;  2AQ0 A;  4Q45 A;  3M8R A;  1OU5 A;  3NTU A;  2ZH9 A;  2NRK A;  5KFU A;  3WFQ E;  4YQW A;  1BPY A;  3ORY A;  5JUM A;  1VFG A;  3PX6 A;  5HNK A;  3RAQ A;  4RU9 A;  1QTM A;  2M2W A;  3AQM A;  2BCU A;  1B43 A;  3LWM A;  4EEY A;  3MR6 A;  3TAR A;  3JZ0 A;  1NZP A;  3H38 A;  1XC9 A;  2DPI A;  2ZHA A;  4UBB A;  2W8L A;  4AT9 A;  5KFG A;  2XCA A;  3GII A;  2ZH8 A;  4I2I A;  3TFR A;  7ICQ A;  4O5E A;  5DLF A;  5J2E A;  4JWM A;  4KIT B;  4BDP A;  1XWL A;  4TUP A;  4IRC A;  1Z00 A;  4DL6 A;  4O5C A;  7ICF A;  3WFO A;  4RQ5 A;  4RWN A;  4I2J A;  4QZB A;  4ED0 A;  1ZET A;  1TK5 A;  2XGQ A;  3PW0 A;  3RB0 A;  1ZQT A;  2I9G A;  2R8J A;  4JWN A;  9ICB A;  5J2G A;  3RJI A;  5KT4 A;  4I2A A;  3JPQ A;  4EP7 A;  5DQH A;  3M9M B;  4M9L A;  4MFA A;  4NLZ A;  2BPC A;  5KFZ A;  3SZ2 A;  4B9S A;  4YMO A;  1KRP A;  3PNC A;  4QZ9 A;  4ATB B;  4O3S A;  9ICF A;  4WC4 A;  3PW4 A;  4I28 A;  4RQ3 A;  4X5V A;  4X4Q A;  4UD5 A;  5KFB A;  9ICS A;  1NK0 A;  1A76 A;  2KZM A;  5DB8 A;  3OVS A;  4JK1 A;  2IMW P;  4MF2 A;  4KLM A;  4LVS A;  1ZQO A;  5J0U A;  2V9W A;  1QSL A;  5F2V O;  4PGX A;  2DR9 A;  4F5P A;  4KLQ A;  4QZI A;  1ZQB A;  2NRT A;  1NK6 A;  5EWG A;  5DB7 A;  4M6W B;  4X4N A;  4RQ7 A;  3K75 D;  4RNM A;  2R8K A;  4ECZ A;  5KTQ A;  3PML A;  5KG6 A;  5J2F A;  4I2H A;  4QW8 A;  2HHQ A;  4GXJ A;  4QWA A;  1JIH A;  4C8M A;  4RQ1 A;  3OGU A;  4YXJ A;  3SV4 A;  7ICP A;  3C1Y A;  5DQI A;  1T8E A;  5J2K A;  3RAX A;  4QZF A;  1NOM A;  4F5R A;  4B9V A;  3Q8Q B;  3OJS A;  4YCX A;  3T5K A;  1TKD A;  2P6R A;  3KHR A;  4MEX A;  4B9L A;  8ICH A;  4UD4 A;  3UQ2 A;  1ZQR A;  3QZ8 A;  4RUA A;  1ZQK A;  2JZB B;  3THV A;  4ECX A;  3ISB A;  2BKE A;  2Q0Z X;  4PHE A;  4EYH B;  1T7P A;  3AU2 A;  3C5G A;  4AT8 B;  3UQ0 A;  4DOC A;  9ICX A;  1UET A;  1KNY A;  4WC3 A;  2C28 A;  2BHN A;  2LYH A;  3RB6 A;  2IHN A;  2P66 A;  2ID1 A;  4M9J A;  4KLG A;  3JYY A;  2HVI A;  4RQ4 A;  1BGX T;  3MDA A;  3RJF A;  1XS9 D;  5HRL A;  5KT6 A;  4IQV A;  2FLL A;  4PGQ A;  4FHX A;  4DFJ A;  4CCH A;  1S0V A;  3QEA Z;  1Q79 A;  1L5U A;  3GFK B;  2W9B B;  2XCP A;  5F9N A;  1BNO A;  1RYS A;  1FA0 A;  5J0X A;  5D4B A;  5J2I A;  2AU0 A;  9ICP A;  1ZQI A;  2ZH6 A;  3H37 A;  2NRZ A;  1NJY A;  5KFM A;  3GIM A;  1Y88 A;  3LQC B;  4XRH A;  4O9M A;  3JPR A;  4NLG A;  1IXR A;  3M8S A;  3BQ0 A;  4DL7 A;  9ICH A;  3EZ5 A;  2P6U A;  4EBK A;  5KFA A;  1COO A;  1N48 A;  9ICO A;  3RJH A;  3EPG A;  4DQI A;  4NLK A;  1MIW A;  1UEV A;  4FHP A;  2M2U A;  1JXE A;  2PI4 A;  4YR0 A;  4XQ8 A;  4M9H A;  4QZC A;  4RQ2 A;  2ISP A;  5KFT A;  4B9U A;  1S77 D;  4M9G A;  3Q8P B;  2VA2 A;  8ICJ A;  3OJU A;  3KHL A;  1YLQ A;  2HHP A;  5DGB A;  3ISC A;  3T5H A;  4R8U A;  3T5L A;  2BPG A;  4DQP A;  2UVV A;  4I2G A;  1KTQ A;  1XO1 A;  2PXI A;  4WBZ A;  2AGP A;  4UB2 A;  5HC9 A;  1KEJ A;  4F93 B;  4EYI B;  1ZQS A;  8ICX A;  2ISO A;  1WOT A;  1MIV A;  3AUO A;  3TAP A;  5CJ7 A;  2BCS A;  3GV5 B;  2DFL A;  5CP2 A;  4HYK A;  4F50 A;  3V6H A;  1TK0 A;  1U48 A;  4LZD A;  4ECS A;  4ELU A;  4I2B A;  4WC0 A;  5DEC A;  3MFH A;  4ED6 A;  9ICW A;  1Q78 A;  1S0N A;  3V6K A;  4NM2 A;  3H8S A;  3V7J A;  4UAY A;  5D46 A;  8ICG A;  5HRD A;  3IHQ B;  2ZH4 A;  2KP7 A;  4C8N A;  7ICV A;  4MFC A;  1RPL A;  3IM1 A;  3ZD9 A;  4DOA A;  2JEJ A;  4Z6D A;  1QSS A;  4F92 B;  2W9C A;  4KLD A;  4TUR A;  3JPS A;  3OUY A;  5DDY A;  3WFR E;  4QWB A;  3JPN A;  4QZ8 A;  3GIJ A;  5HRB A;  5IIO A;  4DEZ A;  4DF8 A;  4Q8E A;  4JV2 A;  4X0B A;  4ECT A;  5KFJ A;  1D9D A;  3G6Y A;  4KLH A;  8ICM A;  4AT7 A;  4AT9 B;  1SKR A;  2ZH3 A;  2BE3 A;  3ZDC A;  1SZP A;  1Z00 B;  2ZTD A;  2W8K A;  4S3N A;  4M04 A;  4Q44 A;  3LDA A;  4F91 B;  1BPE A;  5J0S A;  1ZQJ A;  4X4T A;  5DBB A;  4EBJ A;  1Z3E B;  2BQR A;  1QLN A;  1JAJ A;  4EBE A;  4F2S A;  4ECV A;  4M47 A;  3Q8R B;  3C1Z A;  4RPZ A;  5KG0 A;  4DL5 A;  4DL4 A;  4QZE A;  3RH5 A;  3AQN A;  4DWI A;  7ICG A;  8ICA A;  8ICU A;  5KFW A;  4RWQ A;  4EZ9 A;  2PI5 A;  5IIJ A;  4F5Q A;  3PR5 B;  4KLT A;  4WBY A;  3PX4 A;  9ICK A;  1N56 A;  3ZDB A;  1S76 D;  2PFQ A;  1CEZ A;  1TFW A;  3GDX A;  2GWS A;  3NYB A;  4RWP A;  1TFY A;  1HJP A;  5KFH A;  2WTF A;  4J9L A;  7ICJ A;  4RT3 A;  5J0P A;  1ZQW A;  3TFS A;  2BDP A;  4BWJ A;  4EBC A;  1NKE A;  5EWF A;  3KHG A;  1ZQG A;  5KFX A;  2AQ4 A;  4DSJ A;  3QEB Z;  2BPF A;  4I2E A;  4ATB A;  4F8R A;  3OV7 A;  5DDM A;  4ED3 A;  1ZYQ A;  5F9L A;  4R65 A;  1NKB A;  2DPJ A;  2XY5 A;  3HPO A;  5KFY A;  1VJ7 A;  4X4U A;  3H8W A;  4DOB A;  4J9N A;  4WCW A;  3N97 B;  4RQ6 A;  4EBD A;  4X4R A;  1DGS A;  4ECU A;  4IRD A;  4PHD A;  4ECR A;  5HRH A;  5KG2 A;  1MC8 A;  3PR4 A;  4DO9 A;  5J2H A;  4IR9 A;  4UQG A;  3RBE A;  4QZD A;  3N4M B;  5J0O A;  5KFR A;  4TUS A;  1NKC A;  2ALZ A;  1L3V A;  4YD1 A;  4X4O A;  2FPM A;  5KFL A;  5J2A A;  1NK7 A;  4EZ6 A;  1R8B A;  4YVZ A;  2BCQ A;  1IM4 A;  9ICC A;  5KG3 A;  4G3I A;  2W9M A;  3V7L A;  9ICV A;  1NO5 A;  5HHI A;  3H39 A;  4WC2 A;  1UT8 A;  5HP4 A;  4YD2 A;  3MDC A;  2J6S A;  4O0I A;  1ZJN A;  2BQ3 A;  5KFI A;  3UPQ A;  3RH6 A;  2ZUB A;  3PW5 A;  5DBC A;  3RRH A;  2HHU A;  2FMS A;  4DF4 A;  2JEF A;  3UXN A;  1SKS A;  4KLO A;  3UXP A;  5CWR A;  2J6T A;  4ED2 A;  4KLF A;  7ICT A;  3ZDA A;  2I1Q A;  5HHH A;  3HX0 A;  2DRB A;  2MUT A;  3LWL A;  2ZH1 A;  4X4V A;  1TAU A;  3MR2 A;  1RXV A;  1ZQV A;  2W9A A;  1TAQ A;  2BCV A;  4UB4 A;  1S10 A;  2AGO A;  2NRW A;  1C7Y A;  3JPT A;  5KFC A;  2J6U A;  1ZQE A;  1UEU A;  2O1P A;  8ICI A;  2IA6 A;  1ZQA A;  7ICH A;  1PX5 A;  4Q43 A;  3PO4 A;  1D8L A;  2BQU A;  5DG9 A;  7ICK A;  5KFK A;  1X9M A;  3H3A A;  4DSK A;  4MEY A;  9ICL A;  4J9O A;  2XY6 A;  4E7X A;  2KTQ A;  3WFP A;  4QWC A;  4M0A A;  2DR5 A;  2H5X A;  1ZQZ A;  3NGD A;  4O3O A;  1ZQH A;  4R8U B;  2PFO A;  2A1J B;  5III A;  4XA5 A;  1X2I A;  1T3N A;  4RWO A;  5KG4 A;  5L1L A;  4M2Y A;  3JPP A;  1SL1 A;  1X9W A;  1MQ2 A;  4MF8 A;  2DR8 A;  4KMU A;  3RJJ A;  4ELT A;  8ICY A;  1JQR A;  4M6W A;  4C8O A;  3OVB A;  4XQ7 A;  4UAW A;  3C23 A;  1A77 A;  4DLG A;  3PY8 A;  3WFS C;  5KFP A;  2C2R A;  4O5K A;  5EWE A;  2ZTC A;  5DBA A;  4DFM A;  2R8G A;  2ZH7 A;  5TZV A;  2W9C B;  8ICO A;  3AQL A;  3V6J A;  3HP6 A;  1L3T A;  1ZQC A;  5J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...