5HHHA

Structure of human dna polymerase beta host-guest complexed with the control g for n7-cbz-platination
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
327
structure length
325
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Synthesis, structure, and biological evaluation of a platinum-carbazole conjugate.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5hhhA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5hhhA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hhhA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hhhA03
4QWCA 2RDIA 4M6WB 2FMPA 4JV2A 4AT9B 4TUQA 4WBYA 2ZH9A 4P4MA 1TV9A 1NK9A 4UAZA 2ZHAA 5KFVA 1S77D 5HRDA 3KTQA 2DR7A 3HT3A 3ISDA 4DO9A 1CEZA 4ECXA 1BPZA 4M9HA 4RUCA 2BQRA 2AGOA 3H8JA 4ECVA 8ICEA 1KNYA 3RRHA 4NLKA 3AQKA 1BPEA 3K75D 3TARA 3H39A 4GC6A 2WTFA 3JZ0A 5KFXA 1TAUA 5J2FA 5DGAA 5CJ7A 1ZETA 2PFOA 3QZ8A 4KLHA 4MF8A 3M9NB 4PHAA 4ED3A 4NLNA 4QZBA 1A76A 4DSEA 1CUKA 2JEGA 7ICMA 3C1YA 2C2DA 2XO7A 1L3SA 4M9GA 4IR1A 1KTQA 4PH5A 5KT3A 4UAWA 4IG8A 4GXIA 9ICHA 1MQ3A 4DQPA 2XC9A 3UQ0A 4NM2A 3RTVA 3RB0A 1L3TA 3ORYA 4QZ8A 3OHBA 3JPRA 4F4XA 4ECTA 4UB1A 1DK2A 3ISBA 2P6UA 2BCSA 5KFFA 3LQCB 3PX6A 3GIKA 4BWMA 4X0AA 4BXOB 3ZDDA 3AUOA 2BCVA 4PPXA 3OJSA 4C8MA 4Z6EA 2XY7A 1SL0A 2IHNA 4FHWA 4BDPA 4RQ6A 1BNPA 1WCNA 3Q8KA 4EZ6A 3NYBA 5J2CA 4FH3A 4YR0A 4M47A 4DL2A 4WCWA 4DSJA 1TK8A 3QE9Y 3V72A 2AQ0A 1NJXA 4NKUA 2C28A 3JPNA 1RXVA 2PFQA 4QZAA 4QZCA 4P4PA 4M9JA 5F9NA 2ISPA 1T8EA 1JQRA 2W9CA 5BOMA 4RQ5A 2VA2A 3ZDCA 2P6RA 4ECQA 3C23A 5HRIA 1RZTA 3RJKA 4B9TA 5DQGA 1HJPA 4Q45A 4I2IA 3HPOA 4MEYA 5KFPA 5J2IA 1HUOA 4I2GA 4FBTA 1Z00B 4O0IA 4NLGA 1V4AA 1WOTA 4RWOA 4RWPA 2ZHBA 5J0RA 3M8SA 2JEJA 1QLNA 5DKWA 1MIWA 2HHQA 4DSFA 5DEDA 3PNCA 3T3FA 5KT7A 2FLPA 2ZTDA 4C8LA 2A1JA 5DG8A 4WC0A 4QZ9A 3AQMA 4NKTA 2UVVA 1X2IA 3EW9A 1KLNA 5J29A 1COOA 3RJJA 3B0XA 3RRGA 2ZH6A 1FA0A 4RWNA 8ICIA 5J0UA 3L9DA 1Z3EB 9ICNA 1WCLA 3T5KA 2KP7A 1Q78A 2H5XA 4QWAA 4UB5A 3H7IA 3MR2A 4O5CA 3NTUA 5KG6A 3OGUA 4C8OA 3WFQE 4YMMA 4DF4A 2IHMA 4KLUA 1R8BA 4EBKA 1ZQWA 1ZQAA 4I2EA 1JAJA 2O5AA 2DR5A 3TANA 5EOZA 7ICSA 1Y88A 4J9RA 1JX4A 4YQWA 8ICCA 2O1PA 4AT8A 4NM1A 3RJIA 1IM4A 4DSIA 4KLMA 4J9PA 3PY8A 2BCRA 1NKBA 4FHVA 4X4QA 2B21A 3HP6A 1U45A 2BHNA 5HNKA 4RZRA 4Z6FA 4R66A 4QWEA 2M2WA 3JPQA 4ECZA 2MAXA 1R89A 9ICPA 1TKDA 4ECRA 3MFHA 5J0QA 3TFRA 1T3NA 2R8GA 4DOBA 5IIJA 2V9WA 4ECYA 2I1QA 4DEZA 3RH4A 5DGBA 4ELTA 1NJZA 3AQLA 1B22A 2ZUDA 4F91B 4I2FA 2JZBB 2ZJ8A 1S0MA 3RJFA 4M9NA 1JIHA 4ELVA 9ICMA 8ICNA 5KFHA 3LWMA 4KITB 3Q8QB 4TUPA 2PXIA 4DFJA 1MQ2A 3GV7B 1ZQOA 2BDPA 4X4NA 5KFBA 4EBCA 8ICJA 5KFMA 1ZJMA 2BCUA 4CCHA 4ATBB 3TI0A 3H3AA 1D8LA 4Z6CA 4R64A 4FO6A 4MF2A 5CR0A 2FPKA 1ZQVA 4ATBA 5KFTA 3H37A 5IIKA 2HHPA 5IIOA 4DLEA 8ICTA 3C21A 1NJWA 4KLEA 5HHHA 5KG7A 4RNMA 4B9MA 8ICQA 4FH5A 1IXRA 3PVXA 1ZQJA 3Q8RB 5KG0A 3RAXA 4P2HA 9ICIA 3MGHA 4EYHB 4J9NA 3RB6A 2XGPA 2PI5A 1NK4A 4KTQA 2KFNA 1MIVA 2FMQA 2AJQA 5L1IA 3OVSA 1ZQQA 4Q8EA 1BGXT 2IMWP 3OHAA 5KG2A 1OU5A 4X4VA 2ZTCA 4MFCA 4FS2A 3WFRE 4YR2A 4AT9A 4M6WA 3JPPA 3H4BA 1ZQZA 2MUTB 4FHYA 3OUYB 1ZQFA 1JXLA 4O3RA 1KSPA 3B0YA 4ED1A 1ZQIA 4QZEA 3EPGA 4MFFA 1KEJA 5CB1A 3BJYA 4B9SA 5D4BA 3MR3A 5J2BA 4K4GA 4YMOA 4IRDA 4E80A 3N4MB 3SYZA 3SZ2A 4MFAA 5KFQA 4X5VA 1PX5A 4YN4A 4FHXA 2ZH2A 4B9VA 4QZIA 1NK5A 1KRPA 2ZUBA 1ZQYA 3OJUA 4GC7A 2V4RA 3T5HA 2I9GA 3WFSC 3TQ1A 5KFEA 5J2AA 3UXOA 4RQ8A 3QEAZ 4GXJA 1ZQSA 4IQUA 8ICSA 4ED8A 1RPLA 4KN4A 4DFKA 3GFKB 1XS9D 4RT2A 2XCPA 2P66A 2KTQA 2HHWA 5HREA 2AQ4A 1SZPA 2DVIA 5DB7A 4PHEA 3GIMA 9ICJA 1KFDA 5KFNA 2ZH3A 4ECSA 2AGQA 1LV5A 4WBZA 3OV7A 4YD2A 4ELUA 4RQ7A 9ICUA 3G6YA 5KFZA 3C2LA 2LYHA 3M8RA 4XUSA 3Q8MA 1ZQRA 4DL4A 4BXOA 1S97A 1JN3A 2R8HA 4F4WA 5DQIA 4KLFA 3SV3A 7ICFA 7ICNA 4KLOA 5DBAA 4YXMA 3RAQA 3HX0A 3RB4A 4RWQA 2FLNA 2W9MA 1TAQA 3G6XA 3LDAA 4EBEA 2DRAA 3HIYA 3LK9A 2BQ3A 2ISOA 1S10A 3EZ5A 3OSNA 3HW8A 2OWOA 3OVBA 5KT6A 4YVZA 5KFOA 2XY5A 5KFSA 5F9LA 9ICXA 5KFJA 5CA7A 4F5QA 5DBCA 4XQ8A 4I28A 3C66A 2NRTA 7ICJA 9ICFA 3LWLA 3PW2A 4TUSA 8ICWA 5HRGA 2NRVA 4FHPA 1Z00A 2ASLA 1XO1A 3K4GA 4F2SA 1K1SA 2C22A 2W9BB 2UVUA 3WFOA 5EWGA 5IIIA 4J9QA 1R8CA 5DLFA 4F4YA 4YP3A 4DOCA 1TFYA 4IRCA 4J9KA 4Q8FA 2W9BA 1PZNA 5KFWA 4YXJA 3JPSA 4GXKA 3UPQA 1XSNA 4RT3A 3TAQA 1ZYQA 4RQ3A 4O3QA 3PR4A 2UVWA 5HRFA 3ZD9A 1SL1A 3MDAA 4F93B 4LZDA 1S0VA 4UD4A 1B43A 4YD1A 3V6HA 4RPYA 7ICIA 1XC9A 5HHIA 4PGYA 3EWAA 2HHUA 2KZ3A 4Z6DA 5KG5A 4PGXA 1L3UA 4RPZA 3PMLA 1XU4A 1QTMA 2FMSA 4J9LA 5KFRA 4EZ9A 1ZQMA 2J6UA 9ICWA 4WC2A 4IQVA 3H8SA 7ICRA 4ECUA 3GQCA 1XWLA 4QZGA 1X9MA 9ICBA 2ZUCA 8ICPA 1F5AA 7ICHA 3JPTA 4UD5A 3V7JA 3GIJA 3MABA 5KG1A 3THVA 2DFLA 1C7YA 5DLGA 3V6KA 4S3NA 2DPJA 4UB4A 4E0DA 1NZPA 4RNOA 3NGDA 4F50A 2ZH8A 4X4UA 2ZH7A 4QZFA 3PX0A 4DOAA 4J9SA 5HRHA 2PI4A 2DR8A 3HWTA 7ICPA 3Q8LA 5DQHA 3PMNA 5F2VO 3N97B 1N48A 4DSKA 2KZMA 4WC5A 5JUMA 4QW8A 2KZZA 3KHHA 1NO5A 9ICLA 1SKWA 1X9WA 4XA5A 4XRHA 4F92B 3ZDBA 1BNOA 1QSSA 4QWBA 2BPCA 4UAYA 1LB2B 3PO4A 4B9NA 1A77A 2JZBA 2JEIA 9ICGA 4C8KA 4M2YA 4E7XA 5KT4A 2W9AA 2BGWA 5J0SA 2VA3A 4M0AA 5CHGA 1MIYA 9ICSA 1MSWD 4R8UB 3AU6A 5L1KA 2FPMA 4BWJA 2BPFA 3RR8A 3RBDA 1BVSA 3HJ1A 1S9FA 4KLDA 4YG2A 1BPDA 4IRKA 2HHVA 2F1JA 4K4IA 2J6SA 4F5OA 8ICHA 5HMLA 3MGIA 1ZQTA 4DQSA 5DDMA 1NOMA 5J0YA 4RPXA 3Q8PB 2BKEA 5DG9A 4UBBA 3BDPA 4WC6A 5KG3A 4RQ0A 1UA0A 3OVAA 5HR9A 4J9OA 1ZQBA 4DL5A 4PGQA 3PW7A 2PBEA 3FYHA 5KTQA 4RUAA 5BPCA 5KG4A 2Y1IA 1K1QA 5DDYA 1NKCA 5D49A 2RFFA 5D46A 1S0NA 2ZTEA 2MUTA 4PHPA 4DS4A 4DF8A 5J0TA 5HP4A 5DB9A 4I29A 1R8AA 1V9PA 3UPSA 5HMMA 4I2JA 4UB3A 2PFNA 4X4RA 3E2EA 3H38A 2ZH1A 1UEUA 2HHTA 2XY6A 4F3OA 1NK6A 7ICLA 4KN7A 2DRBA 4QW9A 3MDCA 3ZD8A 1NK8A 2ZH5A 2Q66A 1ZQXA 1D8YA 5J2DA 4RNNA 3PV8A 4IQWA 4F5RA 4LVSA 1TVAA 4O5KA 4WC3A 4X4OA 1L3VA 4I2DA 1MC8A 3SV4A 1SL2A 1XSLA 5KFLA 3RH6A 5J0OA 4XQ7A 9ICOA 2M2UA 2NRZA 4M04A 2FPLA 1BPBA 1T4GA 3C5GA 3PW0A 3RB3A 1S0OA 3RR7A 7ICQA 3Q8SB 3C1ZA 2NRKA 2BCQA 4ECWA 2HHSA 8ICMA 4WC7A 1H38A 3T5JA 4PHDA 4O5EA 3KHGA 4WC4A 5J0WA 5J2KA 4BGDA 1Q79A 2R8KA 4RQ2A 4NLZA 7ICUA 1TK5A 1KDHA 5HRKA 3KHRA 8ICFA 4JUZA 2JEFA 4I2BA 1NK7A 2DPIA 1ZQDA 2F1IA 1U4BA 1X9SA 4F5PA 1ZQKA 4JV1A 4F4ZA 1SKRA 4I2CA 2M2TA 4QWDA 4NY8A 4F4KA 4YCXA 4O3PA 1AROP 9ICCA 1YLQA 4UQGA 3QZ7A 2DR9A 3GIIA 4P4OA 5KFYA 1ZQHA 1KFSA 3V7KA 3C5FA 2PFPA 8ICGA 4EBDA 9ICRA 4J9MA 8ICLA 4R63A 1RYSA 7ICOA 1DOQA 2W8KA 1D9FA 4DWIA 4X4TA 2IBKA 4KLGA 4M5DA 5TZVA 1ZJNA 2C2EA 5EWEA 4DL7A 4LT6A 4DQIA 1RYRA 2W9CB 5HC9A 8ICUA 4AT7B 4DL6A 3TFSA 3G6VA 2Q0ZX 5CWRA 2FLLA 2XCAA 4M9LA 3MR5A 2W8LA 3HJ4A 5DB6A 3EPIA 5J2JA 3PW5A 3PR5B 4KLLA 1JXEA 4AT7A 1UT5A 5KFDA 1TK0A 3AU2A 4KLSA 3BQ0A 3ISCA 7ICGA 5CP2A 3PX4A 1ZQGA 2UVRA 2C2RA 2BQUA 2ZJ5A 1SKSA 4DLGA 4B9LA 4I2AA 9ICQA 4KMUA 3M9MB 3RJEA 9ICAA 4Q44A 8ICAA 4GLXA 3JYYA 4O3OA 3FDSA 3ZDAA 2A1JB 4KLJA 3C2MA 4JWMA 5BOLA 2ATLA 5KT2A 3BQ1A 4JK1A 4YR3A 4DL3A 2V4QA 1QSLA 7ICEA 4G3IA 3MR6A 5KFGA 5KFIA 4O9MA 4C8NA 3PW4A 2KFZA 3C18A 5KFUA 3EYZA 3AQNA 4ED0A 1KFTA 2J6TA 3IHQB 2RDJA 3QEBZ 4RQ4A 1U48A 4DSLA 4JWNA 3PO5A 4EEYA 1U47A 1D9DA 8ICXA 3RBEA 4O3SA 1S76D 3M9OB 4E8FA 3MFIA 2NRWA 3GV8B 4KLTA 2ZJAA 2AGPA 4DQQA 8ICZA 3OUYA 4YMNA 4RQ1A 4ED7A 4FS1A 4KLQA 3V6JA 4DFPA 3MBYA 4F8RA 9ICVA 2VANA 8ICYA 5J2GA 1HUZA 3ETLA 5J2HA 3RJHA 4I27A 5IIMA 3SI8A 2M2VA 5KFCA 7ICKA 3V7LA 4EBJA 4AT8B 5DECA 4YFKA 4TQRA 4Q43A 1TFWA 2ASJA 4F2RA 3TAPA 3RJGA 2VA8A 1T7PA 1ZQUA 4JV0A 2BR0A 2M9NA 4UB2A 1NJYA 1N56A 7ICVA 4QZDA 5KT5A 2IA6A 5L1LA 2R8IA 3UXPA 2R8JA 2HVHA 5KFAA 3JPOA 3GILA 2ALZA 1UA1A 1BPXA 4UBCA 1ZQLA 4MEXA 1ZQEA 1TFRA 2BE3A 1U9LA 1UT8A 3H40A 2XGQA 5L1JA 4IR9A 4X4SA 9ICKA 9ICTA 4X4PA 5J2EA 5IINA 4KLIA 5L9XA 1ZQPA 4EYIB 1DGSA 1UETA 2ZH4A 4R8UA 3WFPA 5C5JA 4ZH4A 4DFMA 8ICOA 4TQSA 4RU9A 4I2HA 3BQTA 4TURA 3UXNA 5HRLA 2BPGA 4F5NA 5DG7A 5EWFA 4R65A 3GDXA 4HYKA 4B9UA 2NRXA 2F1HA 2HHXA 9ICEA 4WC1A 3C2KA 4X0BA 3H8WA 5J0PA 3GV5B 3UQ2A 2AU0A 1NK0A 1ZQCA 4FBUA 4ED6A 5J0XA 4DQRA 1VJ7A 2ID1A 5DB8A 4ED2A 8ICVA 1BPYA 4LZGA 7ICTA 1U49A 1JMSA 3IM1A 4DS5A 3RH5A 1XSPA 3ZDEA 5DBBA 1NKEA 2GWSA 4IQTA 2HVIA 1DK3A 5KFKA 5HRBA 1UEVA 1EXNA 3BQ2A 4O3NA 5IILA 2ASDA 8ICBA 8ICRA 4NXZA 3KHLA 3H4DA 4K4HA 1VFGA 1RXWA 4QZHA 8ICKA 1ZQNA 2HW3A 2Y1JA 3OSPA 1QSYA 4EP7A 1L5UA 3T5LA 2KN7A
chains in the Genus database with same CATH superfamily
2ZH9A 2RDIA 2FMPA 4TUQA 4P4MA 2DR7A 2NV3A 4DO9A 3ISDA 1CEZA 4CF4A 3C29A 1KNYA 3TARA 2PFOA 4PHAA 4NLNA 7ICMA 2C2DA 5AKLA 4PH5A 4EX6A 5KT3A 4GXIA 1RM6C 1MQ3A 1L6NA 2XC9A 4F4XA 2YN4A 2BCSA 3GZFA 1QCKA 3ZDDA 4UARA 2KVSA 3WKCA 5J2CA 4YR0A 4M47A 3BS7A 4GIBA 3V72A 1NJXA 2C28A 2PFQA 1JQRA 1DXSA 4RQ5A 3ZDCA 5J2IA 4FBTA 4RWOA 4O0IA 2B0CA 5EE1A 4C0ZA 5DKWA 4DSFA 5KT7A 3CK6A 2WAQF 5DG8A 2VJ5A 2UVVA 3EW9A 2EZYA 5J29A 1FA0A 4WH5A 2IOFA 4RWNA 1C20A 5J0UA 3IN5A 3L9DA 2PMZC 4IL6U 2H5XA 2XICA 3H7IA 1R8BA 4I2EA 1UPHA 1F44A 5EOZA 8ICCA 4YQWA 4NM1A 3L3FX 2IOHA 2BCRA 1NKBA 3HP6A 2M2WA 3JPQA 1R89A 3TFRA 4DOBA 2V9WA 4ECYA 1SIJA 3SR6A 5ALIA 4I2FA 4M9NA 5AM1A 1JIHA 2BDPA 4X4NA 3PSTA 4UAVA 8ICJA 3HKZF 5KFMA 5AKGA 4Z6CA 4R64A 2FI1A 3N7PD 2FPKA 8ICTA 3C21A 5HHHA 2WAQC 5AK3A 4IG8A 3RAXA 4P2HA 9ICIA 3MGHA 3RB6A 2XGPA 1NK4A 1MIVA 5L1IA 2B4VA 3OHAA 4MFCA 3WFRE 1VLBA 4O68A 4AT9A 4M6WA 5ALGA 4FHYA 3OUYB 1ZQFA 3B0YA 1ZQIA 3SAGA 5KL1B 4MFFA 4K4GA 5J2BA 2QARB 1PX5A 1GPJA 2D8CA 1ZQYA 1S8OA 2V4RA 3QEAZ 4GXJA 5E79U 1ZQSA 4DFKA 3GFKB 2P66A 2XCPA 2KTQA 3GIMA 9ICJA 3R9KA 5KFNA 4ECSA 2AGQA 4WBZA 2F3NA 4RQ7A 2LYHA 2MU2A 3M8RA 4XUSA 4BXOA 1S97A 2R8HA 5DQIA 5DBAA 4YXMA 3RB4A 2W9MA 5AKYA 3LK9A 2ISOA 3IG8A 2KIVA 3OSNA 3OVBA 2F44A 5KFOA 5KFSA 4USAA 1F5SA 5ALUA 4F5QA 3C66A 2NRTA 4Y2QA 8ICWA 1J97A 1XO1A 2JRZA 3K4GA 4F2SA 2C22A 5EWGA 4U7CA 4DOCA 1TFYA 2OXOA 4Q8FA 4J9KA 4EGWA 1PZNA 3M7DA 4RT3A 3NWIA 5KL8B 1PVQA 4O3QA 5HRFA 4NLCA 3ZD9A 3QUBA 4F93B 4KMOB 2K4IA 3V6HA 2KK0A 7ICIA 5CHEA 1XC9A 2N1RA 1XU4A 4J9LA 2J6UA 3H8SA 2EWRA 9ICBA 4UD5A 3GIJA 3THVA 2ZIXB 3V6KA 4F50A 5G5GA 2A19A 4QZFA 3PX0A 2YY6A 2ZIXA 2K4PA 7ICPA 1Q3VA 3PMNA 3D2SA 4DSKA 5JUMA 2W03A 5ALXA 4F92B 3ZDBA 4UAYA 2JEIA 2KG5A 4E7XA 3KZXA 2VA3A 4M0AA 1SXDA 2FPMA 3MCRA 3WK8A 3HJ1A 1ZD3A 2KIWA 4Y2PA 4YG2A 4K9BA 2FJ6A 3F2DA 4K4IA 2Y9TA 5HMLA 1ZQTA 1ZQ1C 3KBBA 3BDPA 1NOMA 5HR6A 1UQVA 2KJ8A 5KG3A 4RQ0A 2HCFA 4UW9A 2BBJA 1ZQBA 4LEYA 4PGQA 3F53A 2KV2A 2Y9UA 4CDGA 5D49A 2LBOA 2MUTA 5HP4A 1R8AA 1V9PA 1MA7A 3F5EA 4F3OA 2Q66A 2MA1A 1D8YA 4WC3A 2YMQA 1L3VA 4PL1A 1SL2A 3RH6A 4XQ7A 4EEBA 1T4GA 3C5GA 7ICQA 3C1ZA 5ALNA 4ECWA 2RHFA 3WKDA 4WC4A 4BGDA 2R8KA 2G08A 1OXJA 1KDHA 3N28A 1NK7A 5HR7A 3RF9A 1N5XA 4UQGA 3QZ7A 4P4OA 3V7KA 2DWQA 1O08A 2OYYA 4JLZA 4J9MA 5ALFA 4X4TA 4C80A 2IBKA 5EE0A 4DL7A 3B9JA 5HC9A 4AT7B 2Q0ZX 4M9LA 3NUQA 2XCAA 5B5EU 4AT7A 4KLSA 3ISCA 2UVRA 3PX4A 2BQUA 1RQLA 4AYBF 4DLGA 4B9LA 4KMUA 3RJEA 8ICAA 4EENA 4GLXA 4O3OA 2ATLA 4YR3A 3OTQA 3WK5A 2G0AA 4K8VA 5KFUA 3EYZA 3AQNA 3QEBZ 3LYSA 2WF7A 1U48A 3I1YA 4O67A 4O3SA 1XNSA 2NRWA 4FS1A 4DFPA 1Z4OA 9ICVA 5J2GA 3ETLA 2E1EA 3IDWA 2H3IA 3CP8A 3V7LA 4AT8B 4CE6A 4YFKA 4Q43A 4F2RA 3TAPA 5AK6A 4UB2A 3GILA 1TFRA 1U9LA 2QB0B 1SV4A 2W3SA 2ZIUA 5J2EA 5IINA 2H3QA 5L9XA 1ZQPA 4EYIB 2FE9A 2XI9A 3WFPA 2FDRA 4PL2A 8ICOA 1B0XA 2H3ZA 2Y0SF 3IP4B 4RU9A 3UXNA 5HRLA 3SAFA 5DG7A 1SWWA 2F1HA 1TAMA 4EV6A 1NI3A 4AYBC 1ZQCA 2HMXA 4ED6A 4LJXA 5J0XA 4EEKA 5DB8A 4RQMA 5T14A 3RH5A 2HVIA 5IILA 3K1ZA 2LMRA 1ZQNA 4NXXA 3H0MB 4EP7A 4JV2A 2F76X 4WBYA 4P0PB 1NK9A 5HRDA 4ECXA 4M9HA 4RUCA 4QIWF 2BQRA 1T94A 4I0UA 3TADC 2KEYA 2AGOA 2MSNA 3H8JA 4C7ZA 4NLKA 1SGGA 2ZIVB 3JZ0A 2R18A 1TE2A 1TAUA 3QZ8A 2CN1A 4KLHA 4MF8A 1CUKA 1VDVA 3D2NA 9ICHA 4DQPA 1O03A 2ZXHA 4NM2A 4ECTA 3ISBA 4P0QA 4UB6U 4F71A 4G9BA 4X0AA 4BWMA 2KKVA 4OJ5A 1QQ5A 2KVCA 4C8MA 2KSOA 3C28A 2IHNA 4FHWA 1BNPA 1WCNA 3NYBA 4LEZA 4JLXA 4DSJA 2EDUA 4FZMA 4HX0A 3N7RC 2VA2A 5HRIA 1RZTA 3RJKA 4A8EA 2W04A 4Q45A 3HPOA 5KFPA 3UM9A 1WOTA 2OHFA 5J0RA 1PK1B 3M8SA 5ALDA 2JEJA 1QLNA 1MIWA 2HHQA 2A1JA 2WF5A 4NKTA 3EF2A 1KLNA 1N63A 3RJJA 2HN1A 3SD7A 3B0XA 4QIWC 2ZH6A 5AI8A 3TKAA 1Z3EB 2KP7A 1Q78A 4O5CA 4C8OA 3WFQE 2K89A 3D6JA 3U26A 2ZXIA 1Y88A 3NS1A 2O1PA 1IM4A 2WFAA 2KHQA 4J9PA 2K4EA 2B21A 4R66A 4Z6FA 2NO4A 1T3NA 2R8GA 2DL0A 5IIJA 5CFSA 2I1QA 3WKAA 2B51A 1B22A 2EZXA 2ZUDA 2JZBB 2ZJ8A 1K5OA 4ELVA 4DFJA 2BCUA 1ZJMA 5GTIU 5CR0A 3ED5A 4B6JA 1ZQVA 3H37A 5IIOA 4DLEA 1NJWA 4KLEA 2EANA 3E0FA 5KG7A 4RNMA 8ICQA 4FH5A 1IXRA 1ZQJA 3Q8RB 1MIYA 1DRGA 4KTQA 2RQ5A 2AJQA 4Q8EA 1BGXT 2IMWP 4EEDA 4YR2A 2KJ5A 3TACB 1RQNA 1JXLA 1KSPA 2HI0A 2YTUA 1KEJA 5CB1A 3BJYA 5AKEA 5AM0A 4YMOA 4E80A 3SYZA 4MFAA 5KFQA 1HEKA 4YN4A 4B9VA 1IV8A 4QZIA 2I9GA 2YX8A 5KFEA 5J2AA 4RQ8A 1NZBA 2DVIA 5DB7A 4N7RA 1LV5A 4YD2A 4ELUA 9ICUA 3G6YA 5KFZA 2IHOA 3Q8MA 4ICAA 4DL4A 7ICNA 7ICFA 4KLOA 3BZKA 2HSZA 1KBUA 3HX0A 2FLNA 1V85A 3G6XA 4RQNA 1M6YA 3HIYA 2BQ3A 1S10A 2OWOA 4YVZA 2W7PA 5F9LA 9ICXA 5CA7A 3NVYA 3E58A 3LWLA 3PW2A 4TUSA 2ASLA 1K1SA 2W55A 2XVTA 3ONNA 5IIIA 4F4YA 5KFWA 1X66A 3UPQA 1XSNA 1ZYQA 4O69A 4RQ3A 3PR4A 2UVWA 3UMGA 1SL1A 4UD4A 1JUDA 3QXGA 4YD1A 4RPYA 5HHIA 2I5HA 1V38A 4PGYA 4K98A 2KZ3A 4Z6DA 4K99A 9ICWA 2LHTA 4Y2YA 2ZUCA 3MC1A 8ICPA 1C7YA 4S3NA 4UB4A 4E0DA 4RNOA 4X4UA 3KKAC 2ODGA 2GH1A 2DR8A 3HWTA 3Q8LA 3SMVA 3HJEA 1N48A 4US9A 4FFDA 4OJOA 2KZZA 1X9WA 4XA5A 4XRHA 2K60A 2YB4A 3PHZA 3PO4A 1FO4A 4C8KA 5KT4A 2BGWA 2W11A 5AKXA 3VCBA 9ICSA 4R8UB 1UHUA 5L1KA 4BWJA 2BPFA 3QUQA 4MKPA 4KLDA 4U6PA 3RFAA 4IRKA 1ED1A 1PUZA 4RPXA 5J0YA 3Q8PB 2JGAA 5DG9A 4UBBA 4WC6A 1KW4A 1UA0A 5AM4A 3PW7A 2PBEA 4NXTA 1YZ6A 1SWVA 5KTQA 5BPCA 2RFFA 1K1QA 2DGZA 2DQNB 1S0NA 2ZTEA 2DUYA 5AKZA 3OUYA 5J0TA 4I29A 3UPSA 4UB3A 3KKAA 4X4RA 3CNHA 1UEUA 2XY6A 7ICLA 2DRBA 3MDCA 2QARA 1NK8A 4IQWA 4X4OA 1TVAA 2DBYA 3N7SC 1L7PA 9ICOA 2NRZA 4M04A 1BPBA 3RR7A 3Q8SB 2NRKA 5C0YA 2HHSA 4PHDA 3KHGA 5J0WA 5J2KA 4RQ2A 2GLEA 4IC9A 5HRKA 3HKZC 4JUZA 2YMMA 2JEFA 4NJ8A 1ZQKA 4KX5A 1X9SA 4I2CA 2W43A 4F4ZA 1SKRA 2M2TA 4QWDA 1L8OA 4F4KA 5KAFU 3GIIA 2ESEA 1KFSA 4Y2VA 3C5FA 4EBDA 8ICLA 7ICOA 1B4FA 1RYUA 4M5DA 5TZVA 5EWEA 2AHOB 4DQIA 2W9CB 3TFSA 3HJ4A 5J2JA 3PR5B 2HBLA 1JXEA 1UT5A 3WFOA 3BQ0A 4O5EA 4I2AA 1SKSA 9ICQA 2LKYA 1IG6A 4KLJA 4JWMA 5BOLA 1YT3A 4JK1A 4DL3A 2V4QA 1FFUA 1Z4NA 5KFIA 4ED0A 2B6GA 3IHQB 2BZFA 4DSLA 1KN5A 3PO5A 8ICXA 1U47A 1QQ7A 1S76D 3GU3A 4DQQA 4Y2RA 4RQ1A 5KNIA 4KLQA 5AI4A 4F8RA 8ICYA 4I27A 3RJHA 5H2FU 5ALKA 2YMPA 5DECA 3T79A 1TFWA 1JI7A 2WHEA 2ASJA 3NVOA 2VA8A 1ZQUA 4JV0A 2M9NA 1NJYA 4O3MA 2E1FA 3DDHA 4NXVA 2R8IA 3HILA 1X6IA 4CNQA 4UBCA 1ZQLA 4MEXA 1VJ5A 1UT8A 3H40A 4X4SA 3WU2U 4X4PA 4NL9C 2FCLA 4KLIA 2GO7A 1UETA 5G5HA 5C5JA 3BZCA 5ALVA 4TQSA 3BQTA 2H3VA 1A0PA 5EWFA 4R65A 2EQYA 4PZOA 4HYKA 4B9UA 4WC1A 1NK0A 2F2AB 2ID1A 3NVVA 4LZGA 7ICTA 1U49A 1JMSA 2GAFD 4DS5A 1XSPA 2W7OA 1DK3A 5DBBA 1UEVA 4O3NA 8ICBA 2JH7A 2E5SA 1SB3C 4K4HA 1JROA 4QZHA 3QU5A 2HW3A 2Y1JA 5B3PA 4LEVA 2EAPA 1TV9A 2ZHAA 5KFVA 3KTQA 2KJ9A 1XO0A 2K8CB 3RRHA 1BPEA 3K75D 1X40A 1N61A 2WTFA 5KFXA 5J2FA 5CJ7A 3M9NB 5JRTA 5ALMA 4QZBA 2JEGA 4NL9A 3AM9A 1KTQA 4F72A 3UQ0A 1L3TA 3RB0A 1LKYB 3ORYA 4QZ8A 1ECWA 1DK2A 4UB1A 3VC8A 2P6UA 2OM6A 5KFFA 3PX6A 2XY7A 1SL0A 4Z6EA 4FH3A 5ALJA 3FAHA 1TK8A 4NKUA 3JPNA 5AICA 4QZAA 4QZCA 2ISPA 1T8EA 5BOMA 3C23A 3WK9A 2QKQA 1HJPA 4I2IA 4MEYA 3ZI4A 1CI4A 1Z00B 4NLGA 5AM5A 1COKA 5DEDA 3T3FA 2ZTDA 4QZ9A 3AQMA 2G07A 9ICNA 4QWAA 2HN2A 2YB1A 3MR2A 5JTGA 3NTUA 5KG6A 3OGUA 4DF4A 4KLUA 1ZQWA 2NO5A 5AIBA 7ICSA 1Z19A 2BDUA 4J9RA 3ICXA 4AT8A 4EX7A 2RLTA 5ALYA 3PY8A 2EH9A 2BHNA 4RZRA 4QWEA 4ECZA 2MAXA 4DCCA 9ICPA 4ECRA 3MFHA 5J0QA 2QB0A 3RH4A 5DGBA 1NJZA 5ALPA 4OAHA 4F91B 1S0MA 5AI9A 1ZD2P 5KFHA 3LWMA 3Q8QB 4TUPA 1ZQOA 3GV7B 4EBCA 4CCHA 3H3AA 5EE9A 4FO6A 5CFTA 5IIKA 2NYVA 2HHPA 2K8BB 3LVWA 4K9AA 3PVXA 3QUCA 2CPRA 4FE3A 4EYHB 4J9NA 2FMQA 1OU5A 2ZTCA 2VKQA 2WF9A 3H4BA 4P0PA 2YQEA 1KKXA 4QZEA 4B9SA 4FZLA 5AM3A 3MR3A 2ZIVA 3SZ2A 4X5VA 3UMBA 1Q46A 1NK5A 4GC7A 3T5HA 1Z1VA 3UXOA 4IQUA 4KN4A 1XS9D 5HREA 4RT2A 1SZPA 4PHEA 2ZH3A 3SENA 1P7DA 3OV7A 3AQFA 4OD0A 2VJ4A 3IV6A 4NV0A 1FFVA 2E8MA 2Y0SC 1ZQRA 4F4WA 3ER9B 2ZIWB 4OAIZ 4OAGA 3D2QA 1IIPA 4JMUA 1TAQA 3LDAA 2DRAA 1SZHA 5AIAA 5JU5A 3HW8A 5KT6A 2XY5A 1Q8KA 2G06A 5DBCA 4I28A 3TADA 3SEIA 2HOQA 1NNLA 2NRVA 2K8AA 2OCEA 2UVUA 1PK1A 2KOBA 5DLFA 4YP3A 2ZG6A 2WF6A 3JPSA 4GXKA 1S0VA 1B43A 4UATA 1X6JA 1JRPA 3EWAA 1AQ6A 5D63A 5KG5A 4PGXA 1QTMA 4MF2A 4RPZA 3PMLA 2O6KA 5JTIA 3AEVA 5KFRA 4IQVA 4WOYA 4QJFB 4J03A 3GQCA 1XWLA 4QZGA 1X9MA 4C4TA 1F5AA 3JPTA 3MABA 5KG1A 2DFLA 3BS5B 5DLGA 1NZPA 3NGDA 2KHVA 4DOAA 4J9SA 1RDFA 2PI4A 5AHXA 1ZD4A 3N97B 2KZMA 4KB6A 9ICLA 2CXYA 2KICA 4QWBA 2BPCA 1LB2B 4B9NA 9ICGA 2JZBA 4NXWA 2W9AA 5J0SA 2DKZA 2F77X 2G5IB 3H0RB 4KX3A 5CHGA 1MSWD 3BQ7A 3RR8A 2MRLA 1S9FA 1BPDA 1WYGA 5CFUA 8ICHA 5ALZA 1LVHA 2BKEA 5B3QA 1L7NA 5HR9A 4BX9C 4J9OA 4DL5A 2M0NA 1NKCA 4DSIA 5KG4A 5HMMA 4I2JA 2PFNA 1A6SA 2ZH1A 2HHTA 5ALLA 1NK6A 3M6ZA 2EAOA 4LEWA 3S6JA 1ZQXA 2A1AA 5J2DA 4RNNA 2HOIA 4F5RA 4LVSA 4O5KA 4I2DA 5J0OA 2M2UA 4CGZA 2L5YA 2PMZF 3RB3A 1S0OA 4BJQA 2P35A 2BCQA 2YMLA 1H38A 3T5JA 4NLBA 4C4SA 5J8YC 7ICUA 1TK5A 3KHRA 8ICFA 3QU7A 4UB8U 4I2BA 1N5WA 3ALRA 2F1IA 4JV1A 1RG6A 1KQQA 2E3TA 4NY8A 4MHVA 9ICCA 4YCXA 4O3PA 1DGJA 1YLQA 3K7DA 2DR9A 2PFPA 8ICGA 9ICRA 3QUTA 2A3VA 3H8MA 1WG8A 1DOQA 1D9FA 4DWIA 4KLGA 3QYPA 3NVWA 1ZJNA 2LYAA 2C2EA 4GFJA 4DL6A 5CWRA 2G5HB 2W8LA 3EPIA 3PW5A 4JB3A 1OW5A 1TK0A 3AU2A 2IUBA 2VIXA 9ICAA 4Q44A 3JYYA 3FDSA 3FM9A 3C2MA 3BQ1A 1QSLA 4G3IA 2LM4A 4C8NA 3PW4A 3C18A 2HOFA 2EZZA 1KFTA 5AK4A 2J6TA 2RDJA 4RQ4A 4JWNA 4EEYA 1D9DA 3RBEA 3M9OB 3NASA 2DKXA 1N60A 4E8FA 3GV8B 5J8YA 1ZRMA 3F2CA 2JHDA 2ZJAA 2AGPA 4KM5A 3CYMA 2D6FC 3PSFA 4NXUA 5KFCA 1KL9A 4TQRA 3KFUF 3WK4A 3JCFA 3NKUA 1T7PA 2ZH4A 5GTHU 2DF4B 1QH9A 2E8OA 5L1LA 3UXPA 2HVHA 1UA1A 4OO1J 5L1JA 4IR9A 9ICKA 5AM2A 5AK5A 5AI5A 4IS7A 5ALEA 1DGSA 2HBJA 4R8UA 4ZH4A 4DFMA 4TURA 2BPGA 4F5NA 1QQ6A 2GOLA 2HHXA 3WKEA 9ICEA 2ZHBA 3UQ2A 3WK7A 5J0PA 3H39A 1VJ7A 3NRWA 8ICVA 4CRXA 1BPYA 1Z1BA 3IM1A 3OWGA 1NKEA 3IG5A 3QU4A 3F5AA 1J2NA 2ASDA 3KHLA 3H4DA 1VFGA 1FEZA 3OSPA 1QSYA 3AMZA 3DEEA 2KN7A 4QWCA 2QB1A 4M6WB 4C4RA 5CEHA 3T5LA 4PPXA 4AT9B 4UAZA 1S77D 5ALHA 3HT3A 2KKPA 1BPZA 3L5KA 4ECVA 8ICEA 5A0LA 4US8A 5D61A 3AQKA 4GC6A 5DGAA 1ZETA 4ED3A 1A76A 4FZNA 4DSEA 3C1YA 3MGVA 2XO7A 2K4HA 1L3SA 4IR1A 4M9GA 4UAWA 3RTVA 3JPRA 3OHBA 4CF3A 3QNMA 3LQCB 3GIKA 4BXOB 2OH2A 2AXTU 3AUOA 2BCVA 4EELA 1ZOLA 3OJSA 4BDPA 4RQ6A 3Q8KA 4EZ6A 1MN8A 4DL2A 4WCWA 3QE9Y 2AQ0A 1RXVA 4P4PA 4M9JA 5F9NA 2W9CA 2P6RA 4ECQA 1GO3F 4UASA 4OAFA 2AH5A 4B9TA 5DQGA 1HUOA 4I2GA 1V4AA 4RWPA 3PNCA 2FLPA 4C8LA 4WC0A 3KD3A 1X2IA 1COOA 1WUDA 3UMCA 3RRGA 2W54A 8ICIA 1WCLA 3T5KA 4UB5A 2KE7A 3ERCC 4YMMA 2IHMA 4EBKA 1CRXA 1ZQAA 2O5AA 1JAJA 1F0MA 2OEHA 5TISU 2DR5A 2H3FA 5EE3A 3TANA 4FO1A 1JX4A 3RJIA 2Q4TA 4AP9A 4KLMA 3A0HU 1OUQA 1V97A 4X4QA 4FHVA 4OJPA 1U45A 5F3XB 5HNKA 1ZD5A 4K96A 1TKDA 3OPXA 5ALTA 2WF8A 4DEZA 2KNJA 4ELTA 3DV9A 4XJEA 3AQLA 3RJFA 9ICMA 8ICNA 1WWUA 1MQ2A 4KITB 2PXIA 4WQLA 5KFBA 4ATBB 5CRXA 3TI0A 1D8LA 4HAIA 2JMGA 2WB1F 4ATBA 5KFTA 3AL0B 1L8LA 4B9MA 3A0BU 2W3RA 1FIQA 3NRZA 5KG0A 1URJA 5L1MA 2PI5A 2KFNA 3QU9A 3OVSA 1ZQQA 1SV0C 5KG2A 4FS2A 3JPPA 1ZXIA 1ZQZA 2MUTB 2ES6A 4Y2XA 4O3RA 4ED1A 3EPGA 1JALA 5D4BA 4OCZA 5B66U 4IRDA 3N4MB 2ZH2A 4FHXA 3QX7A 1PVRA 1KRPA 2JV3A 2ZUBA 3OJUA 2JXJA 3WFSC 3TQ1A 2B56A 8ICSA 4ED8A 1RPLA 3O0FA 3PSIA 2HHWA 2D3DA 2AQ4A 1LKYA 1KFDA 1N62A 3ER8C 1PVPA 1L7OA 1UCVA 3C2LA 1JN3A 2KMDA 3SV3A 3HRDD 3RAQA 5FP0A 2JH1A 2HDOA 4RWQA 4BUGA 4EBEA 2WB1C 3EZ5A 1SV0A 4NWIA 2G09A 5KFJA 4CF5A 4XQ8A 2LPEA 3KOOA 7ICJA 9ICFA 4C7YA 5HRGA 4FHPA 1Z00A 2CRXA 2W9BB 4J9QA 1R8CA 1YZ7A 1WWVA 2LI6A 4IRCA 2W9BA 3QU2A 4YXJA 5K4LA 2RRDA 3H0LB 3TAQA 1PK3A 2PKEA 3MDAA 4DFDA 4LZDA 4ACOA 2HHUA 1L3UA 5D62A 2FMSA 4EZ9A 2EAMA 1ZQMA 4WC2A 3I28A 7ICRA 4ECUA 7ICHA 3V7JA 5ALQA 2ZH8A 4Y2UA 2DPJA 3SAHA 3AQEA 4Y2TA 4QNLA 5HRHA 3KZIU 5DQHA 5F2VO 5KAIU 1X9XA 4WC5A 4QW8A 3KHHA 1NO5A 3ETRA 5ALSA 1SKWA 1BNOA 4PJ0U 5AKIA 1QSSA 2JR5A 1A77A 4M2YA 2ZIUB 1J2MA 4OJ6A 3AU6A 2RP5A 3RBDA 1BVSA 2HHVA 2F1JA 4K97A 2J6SA 4F5OA 3MGIA 4DQSA 5DDMA 3OVAA 5AKHA 4WQKA 4Y2SA 3CRXA 3FYHA 4RUAA 5ALOA 2Y1IA 5DDYA 5D46A 4PHPA 4DS4A 4DF8A 5DB9A 3M6KA 3E2EA 3H38A 4PZNA 4KN7A 2E8PA 4QW9A 3ZD8A 2ZH5A 3J81j 3PV8A 3LVVA 4ZOHC 3FC4A 1MC8A 3SV4A 1L7MA 1XSLA 5KFLA 2FPLA 3PW0A 2LYBA 3WK6A 4X4VA 3AN1A 8ICMA 4WC7A 3F2BA 2BBHA 1Q79A 4NLZA 4O6AA 4P0QB 2DPIA 1ZQDA 1U4BA 2ZIWA 4F5PA 1AROP 3CW2C 5KFYA 2KSOB 1ZQHA 2LM1A 3K1RB 4R63A 2HBMA 1RYSA 2W8KA 4LT6A 1RYRA 8ICUA 5AI0A 5AKKA 3G6VA 2FLLA 3MR5A 5DB6A 4KLLA 5KFDA 1HIWA 7ICGA 4UAUA 5CP2A 1ZQGA 4KLFA 2C2RA 2ZJ5A 3M9MB 3ZDAA 2A1JB 5KT2A 7ICEA 3MR6A 5KFGA 4Y2JA 3M1YA 4O9MA 2KFZA 3IRUA 1D8BA 1S5LU 5ALWA 3MFIA 4KLTA 8ICZA 4YMNA 3PZPA 4ED7A 1X42A 3BS5A 2I6XA 3V6JA 2XIDA 3MBYA 2VANA 1HUZA 5J2HA 2M2VA 5IIMA 3SI8A 7ICKA 4EBJA 3EUB2 3RJGA 1N56A 2QLTA 2BR0A 7ICVA 5AKJA 4QZDA 2HBKA 5KT5A 2IA6A 2R8JA 1ZRNA 2Z7JA 5KFAA 3JPOA 2E8NA 2ALZA 2F8LA 4WJ3B 1BPXA 3WKBA 1ZQEA 2BE3A 3PSPA 1SXEA 2XGQA 1T3QA 1Q3UA 4OJLA 9ICTA 3I76A 2GA9D 1N2XA 4I2HA 5AI6A 3GDXA 2NRXA 3L4PA 4X0BA 2KD1A 2ZH7A 3C2KA 2IOFK 3H8WA 3GV5B 2AU0A 4FBUA 4DQRA 3SQIA 4ED2A 2GWSA 3ZDEA 4IQTA 5KFKA 3NVZA 5HRBA 1EXNA 3BQ2A 2F8KA 5ALRA 8ICRA 4NXZA 1RXWA 8ICKA 1L5UA
chains in the Genus database with same CATH topology
4QWCA 2RDIA 4M6WB 2FMPA 4JV2A 4AT9B 4TUQA 4WBYA 2ZH9A 4P4MA 1TV9A 1NK9A 4UAZA 2ZHAA 5KFVA 1S77D 5HRDA 3KTQA 2DR7A 3HT3A 3ISDA 4DO9A 1CEZA 4ECXA 1BPZA 4M9HA 4RUCA 2BQRA 2AGOA 3H8JA 4ECVA 8ICEA 1KNYA 3RRHA 4NLKA 3AQKA 1BPEA 3K75D 3TARA 3H39A 4GC6A 2WTFA 3JZ0A 5KFXA 1TAUA 5J2FA 5DGAA 5CJ7A 1ZETA 2PFOA 3QZ8A 4KLHA 4MF8A 3M9NB 4PHAA 4ED3A 4NLNA 4QZBA 1A76A 4DSEA 1CUKA 2JEGA 7ICMA 3C1YA 2C2DA 2XO7A 1L3SA 4M9GA 4IR1A 1KTQA 4PH5A 5KT3A 4UAWA 4IG8A 4GXIA 9ICHA 1MQ3A 4DQPA 2XC9A 3UQ0A 4NM2A 3RTVA 3RB0A 1L3TA 3ORYA 4QZ8A 3OHBA 3JPRA 4F4XA 4ECTA 4UB1A 1DK2A 3ISBA 2P6UA 2BCSA 5KFFA 3LQCB 3PX6A 3GIKA 4BWMA 4X0AA 4BXOB 3ZDDA 3AUOA 2BCVA 4PPXA 3OJSA 4C8MA 4Z6EA 2XY7A 1SL0A 2IHNA 4FHWA 4BDPA 4RQ6A 1BNPA 1WCNA 3Q8KA 4EZ6A 3NYBA 5J2CA 4FH3A 4YR0A 4M47A 4DL2A 4WCWA 4DSJA 1TK8A 3QE9Y 3V72A 2AQ0A 1NJXA 4NKUA 2C28A 3JPNA 1RXVA 2PFQA 4QZAA 4QZCA 4P4PA 4M9JA 5F9NA 2ISPA 1T8EA 1JQRA 2W9CA 5BOMA 4RQ5A 2VA2A 3ZDCA 2P6RA 4ECQA 3C23A 5HRIA 1RZTA 3RJKA 4B9TA 5DQGA 1HJPA 4Q45A 4I2IA 3HPOA 4MEYA 5KFPA 5J2IA 1HUOA 4I2GA 4FBTA 1Z00B 4O0IA 4NLGA 1V4AA 1WOTA 4RWOA 4RWPA 2ZHBA 5J0RA 3M8SA 2JEJA 1QLNA 5DKWA 1MIWA 2HHQA 4DSFA 5DEDA 3PNCA 3T3FA 5KT7A 2FLPA 2ZTDA 4C8LA 2A1JA 5DG8A 4WC0A 4QZ9A 3AQMA 4NKTA 2UVVA 1X2IA 3EW9A 1KLNA 5J29A 1COOA 3RJJA 3B0XA 3RRGA 2ZH6A 1FA0A 4RWNA 8ICIA 5J0UA 3L9DA 1Z3EB 9ICNA 1WCLA 3T5KA 2KP7A 1Q78A 2H5XA 4QWAA 4UB5A 3H7IA 3MR2A 4O5CA 3NTUA 5KG6A 3OGUA 4C8OA 3WFQE 4YMMA 4DF4A 2IHMA 4KLUA 1R8BA 4EBKA 1ZQWA 1ZQAA 4I2EA 1JAJA 2O5AA 2DR5A 3TANA 5EOZA 7ICSA 1Y88A 4J9RA 1JX4A 4YQWA 8ICCA 2O1PA 4AT8A 4NM1A 3RJIA 1IM4A 4DSIA 4KLMA 4J9PA 3PY8A 2BCRA 1NKBA 4FHVA 4X4QA 2B21A 3HP6A 1U45A 2BHNA 5HNKA 4RZRA 4Z6FA 4R66A 4QWEA 2M2WA 3JPQA 4ECZA 2MAXA 1R89A 9ICPA 1TKDA 4ECRA 3MFHA 5J0QA 3TFRA 1T3NA 2R8GA 4DOBA 5IIJA 2V9WA 4ECYA 2I1QA 4DEZA 3RH4A 5DGBA 4ELTA 1NJZA 3AQLA 1B22A 2ZUDA 4F91B 4I2FA 2JZBB 2ZJ8A 1S0MA 3RJFA 4M9NA 1JIHA 4ELVA 9ICMA 8ICNA 5KFHA 3LWMA 4KITB 3Q8QB 4TUPA 2PXIA 4DFJA 1MQ2A 3GV7B 1ZQOA 2BDPA 4X4NA 5KFBA 4EBCA 8ICJA 5KFMA 1ZJMA 2BCUA 4CCHA 4ATBB 3TI0A 3H3AA 1D8LA 4Z6CA 4R64A 4FO6A 4MF2A 5CR0A 2FPKA 1ZQVA 4ATBA 5KFTA 3H37A 5IIKA 2HHPA 5IIOA 4DLEA 8ICTA 3C21A 1NJWA 4KLEA 5HHHA 5KG7A 4RNMA 4B9MA 8ICQA 4FH5A 1IXRA 3PVXA 1ZQJA 3Q8RB 5KG0A 3RAXA 4P2HA 9ICIA 3MGHA 4EYHB 4J9NA 3RB6A 2XGPA 2PI5A 1NK4A 4KTQA 2KFNA 1MIVA 2FMQA 2AJQA 5L1IA 3OVSA 1ZQQA 4Q8EA 1BGXT 2IMWP 3OHAA 5KG2A 1OU5A 4X4VA 2ZTCA 4MFCA 4FS2A 3WFRE 4YR2A 4AT9A 4M6WA 3JPPA 3H4BA 1ZQZA 2MUTB 4FHYA 3OUYB 1ZQFA 1JXLA 4O3RA 1KSPA 3B0YA 4ED1A 1ZQIA 4QZEA 3EPGA 4MFFA 1KEJA 5CB1A 3BJYA 4B9SA 5D4BA 3MR3A 5J2BA 4K4GA 4YMOA 4IRDA 4E80A 3N4MB 3SYZA 3SZ2A 4MFAA 5KFQA 4X5VA 1PX5A 4YN4A 4FHXA 2ZH2A 4B9VA 4QZIA 1NK5A 1KRPA 2ZUBA 1ZQYA 3OJUA 4GC7A 2V4RA 3T5HA 2I9GA 3WFSC 3TQ1A 5KFEA 5J2AA 3UXOA 4RQ8A 3QEAZ 4GXJA 1ZQSA 4IQUA 8ICSA 4ED8A 1RPLA 4KN4A 4DFKA 3GFKB 1XS9D 4RT2A 2XCPA 2P66A 2KTQA 2HHWA 5HREA 2AQ4A 1SZPA 2DVIA 5DB7A 4PHEA 3GIMA 9ICJA 1KFDA 5KFNA 2ZH3A 4ECSA 2AGQA 1LV5A 4WBZA 3OV7A 4YD2A 4ELUA 4RQ7A 9ICUA 3G6YA 5KFZA 3C2LA 2LYHA 3M8RA 4XUSA 3Q8MA 1ZQRA 4DL4A 4BXOA 1S97A 1JN3A 2R8HA 4F4WA 5DQIA 4KLFA 3SV3A 7ICFA 7ICNA 4KLOA 5DBAA 4YXMA 3RAQA 3HX0A 3RB4A 4RWQA 2FLNA 2W9MA 1TAQA 3G6XA 3LDAA 4EBEA 2DRAA 3HIYA 3LK9A 2BQ3A 2ISOA 1S10A 3EZ5A 3OSNA 3HW8A 2OWOA 3OVBA 5KT6A 4YVZA 5KFOA 2XY5A 5KFSA 5F9LA 9ICXA 5KFJA 5CA7A 4F5QA 5DBCA 4XQ8A 4I28A 3C66A 2NRTA 7ICJA 9ICFA 3LWLA 3PW2A 4TUSA 8ICWA 5HRGA 2NRVA 4FHPA 1Z00A 2ASLA 1XO1A 3K4GA 4F2SA 1K1SA 2C22A 2W9BB 2UVUA 3WFOA 5EWGA 5IIIA 4J9QA 1R8CA 5DLFA 4F4YA 4YP3A 4DOCA 1TFYA 4IRCA 4J9KA 4Q8FA 2W9BA 1PZNA 5KFWA 4YXJA 3JPSA 4GXKA 3UPQA 1XSNA 4RT3A 3TAQA 1ZYQA 4RQ3A 4O3QA 3PR4A 2UVWA 5HRFA 3ZD9A 1SL1A 3MDAA 4F93B 4LZDA 1S0VA 4UD4A 1B43A 4YD1A 3V6HA 4RPYA 7ICIA 1XC9A 5HHIA 4PGYA 3EWAA 2HHUA 2KZ3A 4Z6DA 5KG5A 4PGXA 1L3UA 4RPZA 3PMLA 1XU4A 1QTMA 2FMSA 4J9LA 5KFRA 4EZ9A 1ZQMA 2J6UA 9ICWA 4WC2A 4IQVA 3H8SA 7ICRA 4ECUA 3GQCA 1XWLA 4QZGA 1X9MA 9ICBA 2ZUCA 8ICPA 1F5AA 7ICHA 3JPTA 4UD5A 3V7JA 3GIJA 3MABA 5KG1A 3THVA 2DFLA 1C7YA 5DLGA 3V6KA 4S3NA 2DPJA 4UB4A 4E0DA 1NZPA 4RNOA 3NGDA 4F50A 2ZH8A 4X4UA 2ZH7A 4QZFA 3PX0A 4DOAA 4J9SA 5HRHA 2PI4A 2DR8A 3HWTA 7ICPA 3Q8LA 5DQHA 3PMNA 5F2VO 3N97B 1N48A 4DSKA 2KZMA 4WC5A 5JUMA 4QW8A 2KZZA 3KHHA 1NO5A 9ICLA 1SKWA 1X9WA 4XA5A 4XRHA 4F92B 3ZDBA 1BNOA 1QSSA 4QWBA 2BPCA 4UAYA 1LB2B 3PO4A 4B9NA 1A77A 2JZBA 2JEIA 9ICGA 4C8KA 4M2YA 4E7XA 5KT4A 2W9AA 2BGWA 5J0SA 2VA3A 4M0AA 5CHGA 1MIYA 9ICSA 1MSWD 4R8UB 3AU6A 5L1KA 2FPMA 4BWJA 2BPFA 3RR8A 3RBDA 1BVSA 3HJ1A 1S9FA 4KLDA 4YG2A 1BPDA 4IRKA 2HHVA 2F1JA 4K4IA 2J6SA 4F5OA 8ICHA 5HMLA 3MGIA 1ZQTA 4DQSA 5DDMA 1NOMA 5J0YA 4RPXA 3Q8PB 2BKEA 5DG9A 4UBBA 3BDPA 4WC6A 5KG3A 4RQ0A 1UA0A 3OVAA 5HR9A 4J9OA 1ZQBA 4DL5A 4PGQA 3PW7A 2PBEA 3FYHA 5KTQA 4RUAA 5BPCA 5KG4A 2Y1IA 1K1QA 5DDYA 1NKCA 5D49A 2RFFA 5D46A 1S0NA 2ZTEA 2MUTA 4PHPA 4DS4A 4DF8A 5J0TA 5HP4A 5DB9A 4I29A 1R8AA 1V9PA 3UPSA 5HMMA 4I2JA 4UB3A 2PFNA 4X4RA 3E2EA 3H38A 2ZH1A 1UEUA 2HHTA 2XY6A 4F3OA 1NK6A 7ICLA 4KN7A 2DRBA 4QW9A 3MDCA 3ZD8A 1NK8A 2ZH5A 2Q66A 1ZQXA 1D8YA 5J2DA 4RNNA 3PV8A 4IQWA 4F5RA 4LVSA 1TVAA 4O5KA 4WC3A 4X4OA 1L3VA 4I2DA 1MC8A 3SV4A 1SL2A 1XSLA 5KFLA 3RH6A 5J0OA 4XQ7A 9ICOA 2M2UA 2NRZA 4M04A 2FPLA 1BPBA 1T4GA 3C5GA 3PW0A 3RB3A 1S0OA 3RR7A 7ICQA 3Q8SB 3C1ZA 2NRKA 2BCQA 4ECWA 2HHSA 8ICMA 4WC7A 1H38A 3T5JA 4PHDA 4O5EA 3KHGA 4WC4A 5J0WA 5J2KA 4BGDA 1Q79A 2R8KA 4RQ2A 4NLZA 7ICUA 1TK5A 1KDHA 5HRKA 3KHRA 8ICFA 4JUZA 2JEFA 4I2BA 1NK7A 2DPIA 1ZQDA 2F1IA 1U4BA 1X9SA 4F5PA 1ZQKA 4JV1A 4F4ZA 1SKRA 4I2CA 2M2TA 4QWDA 4NY8A 4F4KA 4YCXA 4O3PA 1AROP 9ICCA 1YLQA 4UQGA 3QZ7A 2DR9A 3GIIA 4P4OA 5KFYA 1ZQHA 1KFSA 3V7KA 3C5FA 2PFPA 8ICGA 4EBDA 9ICRA 4J9MA 8ICLA 4R63A 1RYSA 7ICOA 1DOQA 2W8KA 1D9FA 4DWIA 4X4TA 2IBKA 4KLGA 4M5DA 5TZVA 1ZJNA 2C2EA 5EWEA 4DL7A 4LT6A 4DQIA 1RYRA 2W9CB 5HC9A 8ICUA 4AT7B 4DL6A 3TFSA 3G6VA 2Q0ZX 5CWRA 2FLLA 2XCAA 4M9LA 3MR5A 2W8LA 3HJ4A 5DB6A 3EPIA 5J2JA 3PW5A 3PR5B 4KLLA 1JXEA 4AT7A 1UT5A 5KFDA 1TK0A 3AU2A 4KLSA 3BQ0A 3ISCA 7ICGA 5CP2A 3PX4A 1ZQGA 2UVRA 2C2RA 2BQUA 2ZJ5A 1SKSA 4DLGA 4B9LA 4I2AA 9ICQA 4KMUA 3M9MB 3RJEA 9ICAA 4Q44A 8ICAA 4GLXA 3JYYA 4O3OA 3FDSA 3ZDAA 2A1JB 4KLJA 3C2MA 4JWMA 5BOLA 2ATLA 5KT2A 3BQ1A 4JK1A 4YR3A 4DL3A 2V4QA 1QSLA 7ICEA 4G3IA 3MR6A 5KFGA 5KFIA 4O9MA 4C8NA 3PW4A 2KFZA 3C18A 5KFUA 3EYZA 3AQNA 4ED0A 1KFTA 2J6TA 3IHQB 2RDJA 3QEBZ 4RQ4A 1U48A 4DSLA 4JWNA 3PO5A 4EEYA 1U47A 1D9DA 8ICXA 3RBEA 4O3SA 1S76D 3M9OB 4E8FA 3MFIA 2NRWA 3GV8B 4KLTA 2ZJAA 2AGPA 4DQQA 8ICZA 3OUYA 4YMNA 4RQ1A 4ED7A 4FS1A 4KLQA 3V6JA 4DFPA 3MBYA 4F8RA 9ICVA 2VANA 8ICYA 5J2GA 1HUZA 3ETLA 5J2HA 3RJHA 4I27A 5IIMA 3SI8A 2M2VA 5KFCA 7ICKA 3V7LA 4EBJA 4AT8B 5DECA 4YFKA 4TQRA 4Q43A 1TFWA 2ASJA 4F2RA 3TAPA 3RJGA 2VA8A 1T7PA 1ZQUA 4JV0A 2BR0A 2M9NA 4UB2A 1NJYA 1N56A 7ICVA 4QZDA 5KT5A 2IA6A 5L1LA 2R8IA 3UXPA 2R8JA 2HVHA 5KFAA 3JPOA 3GILA 2ALZA 1UA1A 1BPXA 4UBCA 1ZQLA 4MEXA 1ZQEA 1TFRA 2BE3A 1U9LA 1UT8A 3H40A 2XGQA 5L1JA 4IR9A 4X4SA 9ICKA 9ICTA 4X4PA 5J2EA 5IINA 4KLIA 5L9XA 1ZQPA 4EYIB 1DGSA 1UETA 2ZH4A 4R8UA 3WFPA 5C5JA 4ZH4A 4DFMA 8ICOA 4TQSA 4RU9A 4I2HA 3BQTA 4TURA 3UXNA 5HRLA 2BPGA 4F5NA 5DG7A 5EWFA 4R65A 3GDXA 4HYKA 4B9UA 2NRXA 2F1HA 2HHXA 9ICEA 4WC1A 3C2KA 4X0BA 3H8WA 5J0PA 3GV5B 3UQ2A 2AU0A 1NK0A 1ZQCA 4FBUA 4ED6A 5J0XA 4DQRA 1VJ7A 2ID1A 5DB8A 4ED2A 8ICVA 1BPYA 4LZGA 7ICTA 1U49A 1JMSA 3IM1A 4DS5A 3RH5A 1XSPA 3ZDEA 5DBBA 1NKEA 2GWSA 4IQTA 2HVIA 1DK3A 5KFKA 5HRBA 1UEVA 1EXNA 3BQ2A 4O3NA 5IILA 2ASDA 8ICBA 8ICRA 4NXZA 3KHLA 3H4DA 4K4HA 1VFGA 1RXWA 4QZHA 8ICKA 1ZQNA 2HW3A 2Y1JA 3OSPA 1QSYA 4EP7A 1L5UA 3T5LA 2KN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWC A;  2RDI A;  4M6W B;  2FMP A;  4JV2 A;  4AT9 B;  4TUQ A;  4WBY A;  2ZH9 A;  4P4M A;  1TV9 A;  1NK9 A;  4UAZ A;  2ZHA A;  5KFV A;  1S77 D;  5HRD A;  3KTQ A;  2DR7 A;  3HT3 A;  3ISD A;  4DO9 A;  1CEZ A;  4ECX A;  1BPZ A;  4M9H A;  4RUC A;  2BQR A;  2AGO A;  3H8J A;  4ECV A;  8ICE A;  1KNY A;  3RRH A;  4NLK A;  3AQK A;  1BPE A;  3K75 D;  3TAR A;  3H39 A;  4GC6 A;  2WTF A;  3JZ0 A;  5KFX A;  1TAU A;  5J2F A;  5DGA A;  5CJ7 A;  1ZET A;  2PFO A;  3QZ8 A;  4KLH A;  4MF8 A;  3M9N B;  4PHA A;  4ED3 A;  4NLN A;  4QZB A;  1A76 A;  4DSE A;  1CUK A;  2JEG A;  7ICM A;  3C1Y A;  2C2D A;  2XO7 A;  1L3S A;  4M9G A;  4IR1 A;  1KTQ A;  4PH5 A;  5KT3 A;  4UAW A;  4IG8 A;  4GXI A;  9ICH A;  1MQ3 A;  4DQP A;  2XC9 A;  3UQ0 A;  4NM2 A;  3RTV A;  3RB0 A;  1L3T A;  3ORY A;  4QZ8 A;  3OHB A;  3JPR A;  4F4X A;  4ECT A;  4UB1 A;  1DK2 A;  3ISB A;  2P6U A;  2BCS A;  5KFF A;  3LQC B;  3PX6 A;  3GIK A;  4BWM A;  4X0A A;  4BXO B;  3ZDD A;  3AUO A;  2BCV A;  4PPX A;  3OJS A;  4C8M A;  4Z6E A;  2XY7 A;  1SL0 A;  2IHN A;  4FHW A;  4BDP A;  4RQ6 A;  1BNP A;  1WCN A;  3Q8K A;  4EZ6 A;  3NYB A;  5J2C A;  4FH3 A;  4YR0 A;  4M47 A;  4DL2 A;  4WCW A;  4DSJ A;  1TK8 A;  3QE9 Y;  3V72 A;  2AQ0 A;  1NJX A;  4NKU A;  2C28 A;  3JPN A;  1RXV A;  2PFQ A;  4QZA A;  4QZC A;  4P4P A;  4M9J A;  5F9N A;  2ISP A;  1T8E A;  1JQR A;  2W9C A;  5BOM A;  4RQ5 A;  2VA2 A;  3ZDC A;  2P6R A;  4ECQ A;  3C23 A;  5HRI A;  1RZT A;  3RJK A;  4B9T A;  5DQG A;  1HJP A;  4Q45 A;  4I2I A;  3HPO A;  4MEY A;  5KFP A;  5J2I A;  1HUO A;  4I2G A;  4FBT A;  1Z00 B;  4O0I A;  4NLG A;  1V4A A;  1WOT A;  4RWO A;  4RWP A;  2ZHB A;  5J0R A;  3M8S A;  2JEJ A;  1QLN A;  5DKW A;  1MIW A;  2HHQ A;  4DSF A;  5DED A;  3PNC A;  3T3F A;  5KT7 A;  2FLP A;  2ZTD A;  4C8L A;  2A1J A;  5DG8 A;  4WC0 A;  4QZ9 A;  3AQM A;  4NKT A;  2UVV A;  1X2I A;  3EW9 A;  1KLN A;  5J29 A;  1COO A;  3RJJ A;  3B0X A;  3RRG A;  2ZH6 A;  1FA0 A;  4RWN A;  8ICI A;  5J0U A;  3L9D A;  1Z3E B;  9ICN A;  1WCL A;  3T5K A;  2KP7 A;  1Q78 A;  2H5X A;  4QWA A;  4UB5 A;  3H7I A;  3MR2 A;  4O5C A;  3NTU A;  5KG6 A;  3OGU A;  4C8O A;  3WFQ E;  4YMM A;  4DF4 A;  2IHM A;  4KLU A;  1R8B A;  4EBK A;  1ZQW A;  1ZQA A;  4I2E A;  1JAJ A;  2O5A A;  2DR5 A;  3TAN A;  5EOZ A;  7ICS A;  1Y88 A;  4J9R A;  1JX4 A;  4YQW A;  8ICC A;  2O1P A;  4AT8 A;  4NM1 A;  3RJI A;  1IM4 A;  4DSI A;  4KLM A;  4J9P A;  3PY8 A;  2BCR A;  1NKB A;  4FHV A;  4X4Q A;  2B21 A;  3HP6 A;  1U45 A;  2BHN A;  5HNK A;  4RZR A;  4Z6F A;  4R66 A;  4QWE A;  2M2W A;  3JPQ A;  4ECZ A;  2MAX A;  1R89 A;  9ICP A;  1TKD A;  4ECR A;  3MFH A;  5J0Q A;  3TFR A;  1T3N A;  2R8G A;  4DOB A;  5IIJ A;  2V9W A;  4ECY A;  2I1Q A;  4DEZ A;  3RH4 A;  5DGB A;  4ELT A;  1NJZ A;  3AQL A;  1B22 A;  2ZUD A;  4F91 B;  4I2F A;  2JZB B;  2ZJ8 A;  1S0M A;  3RJF A;  4M9N A;  1JIH A;  4ELV A;  9ICM A;  8ICN A;  5KFH A;  3LWM A;  4KIT B;  3Q8Q B;  4TUP A;  2PXI A;  4DFJ A;  1MQ2 A;  3GV7 B;  1ZQO A;  2BDP A;  4X4N A;  5KFB A;  4EBC A;  8ICJ A;  5KFM A;  1ZJM A;  2BCU A;  4CCH A;  4ATB B;  3TI0 A;  3H3A A;  1D8L A;  4Z6C A;  4R64 A;  4FO6 A;  4MF2 A;  5CR0 A;  2FPK A;  1ZQV A;  4ATB A;  5KFT A;  3H37 A;  5IIK A;  2HHP A;  5IIO A;  4DLE A;  8ICT A;  3C21 A;  1NJW A;  4KLE A;  5HHH A;  5KG7 A;  4RNM A;  4B9M A;  8ICQ A;  4FH5 A;  1IXR A;  3PVX A;  1ZQJ A;  3Q8R B;  5KG0 A;  3RAX A;  4P2H A;  9ICI A;  3MGH A;  4EYH B;  4J9N A;  3RB6 A;  2XGP A;  2PI5 A;  1NK4 A;  4KTQ A;  2KFN A;  1MIV A;  2FMQ A;  2AJQ A;  5L1I A;  3OVS A;  1ZQQ A;  4Q8E A;  1BGX T;  2IMW P;  3OHA A;  5KG2 A;  1OU5 A;  4X4V A;  2ZTC A;  4MFC A;  4FS2 A;  3WFR E;  4YR2 A;  4AT9 A;  4M6W A;  3JPP A;  3H4B A;  1ZQZ A;  2MUT B;  4FHY A;  3OUY B;  1ZQF A;  1JXL A;  4O3R A;  1KSP A;  3B0Y A;  4ED1 A;  1ZQI A;  4QZE A;  3EPG A;  4MFF A;  1KEJ A;  5CB1 A;  3BJY A;  4B9S A;  5D4B A;  3MR3 A;  5J2B A;  4K4G A;  4YMO A;  4IRD A;  4E80 A;  3N4M B;  3SYZ A;  3SZ2 A;  4MFA A;  5KFQ A;  4X5V A;  1PX5 A;  4YN4 A;  4FHX A;  2ZH2 A;  4B9V A;  4QZI A;  1NK5 A;  1KRP A;  2ZUB A;  1ZQY A;  3OJU A;  4GC7 A;  2V4R A;  3T5H A;  2I9G A;  3WFS C;  3TQ1 A;  5KFE A;  5J2A A;  3UXO A;  4RQ8 A;  3QEA Z;  4GXJ A;  1ZQS A;  4IQU A;  8ICS A;  4ED8 A;  1RPL A;  4KN4 A;  4DFK A;  3GFK B;  1XS9 D;  4RT2 A;  2XCP A;  2P66 A;  2KTQ A;  2HHW A;  5HRE A;  2AQ4 A;  1SZP A;  2DVI A;  5DB7 A;  4PHE A;  3GIM A;  9ICJ A;  1KFD A;  5KFN A;  2ZH3 A;  4ECS A;  2AGQ A;  1LV5 A;  4WBZ A;  3OV7 A;  4YD2 A;  4ELU A;  4RQ7 A;  9ICU A;  3G6Y A;  5KFZ A;  3C2L A;  2LYH A;  3M8R A;  4XUS A;  3Q8M A;  1ZQR A;  4DL4 A;  4BXO A;  1S97 A;  1JN3 A;  2R8H A;  4F4W A;  5DQI A;  4KLF A;  3SV3 A;  7ICF A;  7ICN A;  4KLO A;  5DBA A;  4YXM A;  3RAQ A;  3HX0 A;  3RB4 A;  4RWQ A;  2FLN A;  2W9M A;  1TAQ A;  3G6X A;  3LDA A;  4EBE A;  2DRA A;  3HIY A;  3LK9 A;  2BQ3 A;  2ISO A;  1S10 A;  3EZ5 A;  3OSN A;  3HW8 A;  2OWO A;  3OVB A;  5KT6 A;  4YVZ A;  5KFO A;  2XY5 A;  5KFS A;  5F9L A;  9ICX A;  5KFJ A;  5CA7 A;  4F5Q A;  5DBC A;  4XQ8 A;  4I28 A;  3C66 A;  2NRT A;  7ICJ A;  9ICF A;  3LWL A;  3PW2 A;  4TUS A;  8ICW A;  5HRG A;  2NRV A;  4FHP A;  1Z00 A;  2ASL A;  1XO1 A;  3K4G A;  4F2S A;  1K1S A;  2C22 A;  2W9B B;  2UVU A;  3WFO A;  5EWG A;  5III A;  4J9Q A;  1R8C A;  5DLF A;  4F4Y A;  4YP3 A;  4DOC A;  1TFY A;  4IRC A;  4J9K A;  4Q8F A;  2W9B A;  1PZN A;  5KFW A;  4YXJ A;  3JPS A;  4GXK A;  3UPQ A;  1XSN A;  4RT3 A;  3TAQ A;  1ZYQ A;  4RQ3 A;  4O3Q A;  3PR4 A;  2UVW A;  5HRF A;  3ZD9 A;  1SL1 A;  3MDA A;  4F93 B;  4LZD A;  1S0V A;  4UD4 A;  1B43 A;  4YD1 A;  3V6H A;  4RPY A;  7ICI A;  1XC9 A;  5HHI A;  4PGY A;  3EWA A;  2HHU A;  2KZ3 A;  4Z6D A;  5KG5 A;  4PGX A;  1L3U A;  4RPZ A;  3PML A;  1XU4 A;  1QTM A;  2FMS A;  4J9L A;  5KFR A;  4EZ9 A;  1ZQM A;  2J6U A;  9ICW A;  4WC2 A;  4IQV A;  3H8S A;  7ICR A;  4ECU A;  3GQC A;  1XWL A;  4QZG A;  1X9M A;  9ICB A;  2ZUC A;  8ICP A;  1F5A A;  7ICH A;  3JPT A;  4UD5 A;  3V7J A;  3GIJ A;  3MAB A;  5KG1 A;  3THV A;  2DFL A;  1C7Y A;  5DLG A;  3V6K A;  4S3N A;  2DPJ A;  4UB4 A;  4E0D A;  1NZP A;  4RNO A;  3NGD A;  4F50 A;  2ZH8 A;  4X4U A;  2ZH7 A;  4QZF A;  3PX0 A;  4DOA A;  4J9S A;  5HRH A;  2PI4 A;  2DR8 A;  3HWT A;  7ICP A;  3Q8L A;  5DQH A;  3PMN A;  5F2V O;  3N97 B;  1N48 A;  4DSK A;  2KZM A;  4WC5 A;  5JUM A;  4QW8 A;  2KZZ A;  3KHH A;  1NO5 A;  9ICL A;  1SKW A;  1X9W A;  4XA5 A;  4XRH A;  4F92 B;  3ZDB A;  1BNO A;  1QSS A;  4QWB A;  2BPC A;  4UAY A;  1LB2 B;  3PO4 A;  4B9N A;  1A77 A;  2JZB A;  2JEI A;  9ICG A;  4C8K A;  4M2Y A;  4E7X A;  5KT4 A;  2W9A A;  2BGW A;  5J0S A;  2VA3 A;  4M0A A;  5CHG A;  1MIY A;  9ICS A;  1MSW D;  4R8U B;  3AU6 A;  5L1K A;  2FPM A;  4BWJ A;  2BPF A;  3RR8 A;  3RBD A;  1BVS A;  3HJ1 A;  1S9F A;  4KLD A;  4YG2 A;  1BPD A;  4IRK A;  2HHV A;  2F1J A;  4K4I A;  2J6S A;  4F5O A;  8ICH A;  5HML A;  3MGI A;  1ZQT A;  4DQS A;  5DDM A;  1NOM A;  5J0Y A;  4RPX A;  3Q8P B;  2BKE A;  5DG9 A;  4UBB A;  3BDP A;  4WC6 A;  5KG3 A;  4RQ0 A;  1UA0 A;  3OVA A;  5HR9 A;  4J9O A;  1ZQB A;  4DL5 A;  4PGQ A;  3PW7 A;  2PBE A;  3FYH A;  5KTQ A;  4RUA A;  5BPC A;  5KG4 A;  2Y1I A;  1K1Q A;  5DDY A;  1NKC A;  5D49 A;  2RFF A;  5D46 A;  1S0N A;  2ZTE A;  2MUT A;  4PHP A;  4DS4 A;  4DF8 A;  5J0T A;  5HP4 A;  5DB9 A;  4I29 A;  1R8A A;  1V9P A;  3UPS A;  5HMM A;  4I2J A;  4UB3 A;  2PFN A;  4X4R A;  3E2E A;  3H38 A;  2ZH1 A;  1UEU A;  2HHT A;  2XY6 A;  4F3O A;  1NK6 A;  7ICL A;  4KN7 A;  2DRB A;  4QW9 A;  3MDC A;  3ZD8 A;  1NK8 A;  2ZH5 A;  2Q66 A;  1ZQX A;  1D8Y A;  5J2D A;  4RNN A;  3PV8 A;  4IQW A;  4F5R A;  4LVS A;  1TVA A;  4O5K A;  4WC3 A;  4X4O A;  1L3V A;  4I2D A;  1MC8 A;  3SV4 A;  1SL2 A;  1XSL A;  5KFL A;  3RH6 A;  5J0O A;  4XQ7 A;  9ICO A;  2M2U A;  2NRZ A;  4M04 A;  2FPL A;  1BPB A;  1T4G A;  3C5G A;  3PW0 A;  3RB3 A;  1S0O A;  3RR7 A;  7ICQ A;  3Q8S B;  3C1Z A;  2NRK A;  2BCQ A;  4ECW A;  2HHS A;  8ICM A;  4WC7 A;  1H38 A;  3T5J A;  4PHD A;  4O5E A;  3KHG A;  4WC4 A;  5J0W A;  5J2K A;  4BGD A;  1Q79 A;  2R8K A;  4RQ2 A;  4NLZ A;  7ICU A;  1TK5 A;  1KDH A;  5HRK A;  3KHR A;  8ICF A;  4JUZ A;  2JEF A;  4I2B A;  1NK7 A;  2DPI A;  1ZQD A;  2F1I A;  1U4B A;  1X9S A;  4F5P A;  1ZQK A;  4JV1 A;  4F4Z A;  1SKR A;  4I2C A;  2M2T A;  4QWD A;  4NY8 A;  4F4K A;  4YCX A;  4O3P A;  1ARO P;  9ICC A;  1YLQ A;  4UQG A;  3QZ7 A;  2DR9 A;  3GII A;  4P4O A;  5KFY A;  1ZQH A;  1KFS A;  3V7K A;  3C5F A;  2PFP A;  8ICG A;  4EBD A;  9ICR A;  4J9M A;  8ICL A;  4R63 A;  1RYS A;  7ICO A;  1DOQ A;  2W8K A;  1D9F A;  4DWI A;  4X4T A;  2IBK A;  4KLG A;  4M5D A;  5TZV A;  1ZJN A;  2C2E A;  5EWE A;  4DL7 A;  4LT6 A;  4DQI A;  1RYR A;  2W9C B;  5HC9 A;  8ICU A;  4AT7 B;  4DL6 A;  3TFS A;  3G6V A;  2Q0Z X;  5CWR A;  2FLL A;  2XCA A;  4M9L A;  3MR5 A;  2W8L A;  3HJ4 A;  5DB6 A;  3EPI A;  5J2J A;  3PW5 A;  3PR5 B;  4KLL A;  1JXE A;  4AT7 A;  1UT5 A;  5KFD A;  1TK0 A;  3AU2 A;  4KLS A;  3BQ0 A;  3ISC A;  7ICG A;  5CP2 A;  3PX4 A;  1ZQG A;  2UVR A;  2C2R A;  2BQU A;  2ZJ5 A;  1SKS A;  4DLG A;  4B9L A;  4I2A A;  9ICQ A;  4KMU A;  3M9M B;  3RJE A;  9ICA A;  4Q44 A;  8ICA A;  4GLX A;  3JYY A;  4O3O A;  3FDS A;  3ZDA A;  2A1J B;  4KLJ A;  3C2M A;  4JWM A;  5BOL A;  2ATL A;  5KT2 A;  3BQ1 A;  4JK1 A;  4YR3 A;  4DL3 A;  2V4Q A;  1QSL A;  7ICE A;  4G3I A;  3MR6 A;  5KFG A;  5KFI A;  4O9M A;  4C8N A;  3PW4 A;  2KFZ A;  3C18 A;  5KFU A;  3EYZ A;  3AQN A;  4ED0 A;  1KFT A;  2J6T A;  3IHQ B;  2RDJ A;  3QEB Z;  4RQ4 A;  1U48 A;  4DSL A;  4JWN A;  3PO5 A;  4EEY A;  1U47 A;  1D9D A;  8ICX A;  3RBE A;  4O3S A;  1S76 D;  3M9O B;  4E8F A;  3MFI A;  2NRW A;  3GV8 B;  4KLT A;  2ZJA A;  2AGP A;  4DQQ A;  8ICZ A;  3OUY A;  4YMN A;  4RQ1 A;  4ED7 A;  4FS1 A;  4KLQ A;  3V6J A;  4DFP A;  3MBY A;  4F8R A;  9ICV A;  2VAN A;  8ICY A;  5J2G A;  1HUZ A;  3ETL A;  5J2H A;  3RJH A;  4I27 A;  5IIM A;  3SI8 A;  2M2V A;  5KFC A;  7ICK A;  3V7L A;  4EBJ A;  4AT8 B;  5DEC A;  4YFK A;  4TQR A;  4Q43 A;  1TFW A;  2ASJ A;  4F2R A;  3TAP A;  3RJG A;  2VA8 A;  1T7P A;  1ZQU A;  4JV0 A;  2BR0 A;  2M9N A;  4UB2 A;  1NJY A;  1N56 A;  7ICV A;  4QZD A;  5KT5 A;  2IA6 A;  5L1L A;  2R8I A;  3UXP A;  2R8J A;  2HVH A;  5KFA A;  3JPO A;  3GIL A;  2ALZ A;  1UA1 A;  1BPX A;  4UBC A;  1ZQL A;  4MEX A;  1ZQE A;  1TFR A;  2BE3 A;  1U9L A;  1UT8 A;  3H40 A;  2XGQ A;  5L1J A;  4IR9 A;  4X4S A;  9ICK A;  9ICT A;  4X4P A;  5J2E A;  5IIN A;  4KLI A;  5L9X A;  1ZQP A;  4EYI B;  1DGS A;  1UET A;  2ZH4 A;  4R8U A;  3WFP A;  5C5J A;  4ZH4 A;  4DFM A;  8ICO A;  4TQS A;  4RU9 A;  4I2H A;  3BQT A;  4TUR A;  3UXN A;  5HRL A;  2BPG A;  4F5N A;  5DG7 A;  5EWF A;  4R65 A;  3GDX A;  4HYK A;  4B9U A;  2NRX A;  2F1H A;  2HHX A;  9ICE A;  4WC1 A;  3C2K A;  4X0B A;  3H8W A;  5J0P A;  3GV5 B;  3UQ2 A;  2AU0 A;  1NK0 A;  1ZQC A;  4FBU A;  4ED6 A;  5J0X A;  4DQR A;  1VJ7 A;  2ID1 A;  5DB8 A;  4ED2 A;  8ICV A;  1BPY A;  4LZG A;  7ICT A;  1U49 A;  1JMS A;  3IM1 A;  4DS5 A;  3RH5 A;  1XSP A;  3ZDE A;  5DBB A;  1NKE A;  2GWS A;  4IQT A;  2HVI A;  1DK3 A;  5KFK A;  5HRB A;  1UEV A;  1EXN A;  3BQ2 A;  4O3N A;  5IIL A;  2ASD A;  8ICB A;  8ICR A;  4NXZ A;  3KHL A;  3H4D A;  4K4H A;  1VFG A;  1RXW A;  4QZH A;  8ICK A;  1ZQN A;  2HW3 A;  2Y1J A;  3OSP A;  1QSY A;  4EP7 A;  1L5U A;  3T5L A;  2KN7 A; 
#chains in the Genus database with same CATH topology
 2ZH9 A;  2RDI A;  2FMP A;  4TUQ A;  4P4M A;  2DR7 A;  2NV3 A;  4DO9 A;  3ISD A;  1CEZ A;  4CF4 A;  3C29 A;  1KNY A;  3TAR A;  2PFO A;  4PHA A;  4NLN A;  7ICM A;  2C2D A;  5AKL A;  4PH5 A;  4EX6 A;  5KT3 A;  4GXI A;  1RM6 C;  1MQ3 A;  1L6N A;  2XC9 A;  4F4X A;  2YN4 A;  2BCS A;  3GZF A;  1QCK A;  3ZDD A;  4UAR A;  2KVS A;  3WKC A;  5J2C A;  4YR0 A;  4M47 A;  3BS7 A;  4GIB A;  3V72 A;  1NJX A;  2C28 A;  2PFQ A;  1JQR A;  1DXS A;  4RQ5 A;  3ZDC A;  5J2I A;  4FBT A;  4RWO A;  4O0I A;  2B0C A;  5EE1 A;  4C0Z A;  5DKW A;  4DSF A;  5KT7 A;  3CK6 A;  2WAQ F;  5DG8 A;  2VJ5 A;  2UVV A;  3EW9 A;  2EZY A;  5J29 A;  1FA0 A;  4WH5 A;  2IOF A;  4RWN A;  1C20 A;  5J0U A;  3IN5 A;  3L9D A;  2PMZ C;  4IL6 U;  2H5X A;  2XIC A;  3H7I A;  1R8B A;  4I2E A;  1UPH A;  1F44 A;  5EOZ A;  8ICC A;  4YQW A;  4NM1 A;  3L3F X;  2IOH A;  2BCR A;  1NKB A;  3HP6 A;  2M2W A;  3JPQ A;  1R89 A;  3TFR A;  4DOB A;  2V9W A;  4ECY A;  1SIJ A;  3SR6 A;  5ALI A;  4I2F A;  4M9N A;  5AM1 A;  1JIH A;  2BDP A;  4X4N A;  3PST A;  4UAV A;  8ICJ A;  3HKZ F;  5KFM A;  5AKG A;  4Z6C A;  4R64 A;  2FI1 A;  3N7P D;  2FPK A;  8ICT A;  3C21 A;  5HHH A;  2WAQ C;  5AK3 A;  4IG8 A;  3RAX A;  4P2H A;  9ICI A;  3MGH A;  3RB6 A;  2XGP A;  1NK4 A;  1MIV A;  5L1I A;  2B4V A;  3OHA A;  4MFC A;  3WFR E;  1VLB A;  4O68 A;  4AT9 A;  4M6W A;  5ALG A;  4FHY A;  3OUY B;  1ZQF A;  3B0Y A;  1ZQI A;  3SAG A;  5KL1 B;  4MFF A;  4K4G A;  5J2B A;  2QAR B;  1PX5 A;  1GPJ A;  2D8C A;  1ZQY A;  1S8O A;  2V4R A;  3QEA Z;  4GXJ A;  5E79 U;  1ZQS A;  4DFK A;  3GFK B;  2P66 A;  2XCP A;  2KTQ A;  3GIM A;  9ICJ A;  3R9K A;  5KFN A;  4ECS A;  2AGQ A;  4WBZ A;  2F3N A;  4RQ7 A;  2LYH A;  2MU2 A;  3M8R A;  4XUS A;  4BXO A;  1S97 A;  2R8H A;  5DQI A;  5DBA A;  4YXM A;  3RB4 A;  2W9M A;  5AKY A;  3LK9 A;  2ISO A;  3IG8 A;  2KIV A;  3OSN A;  3OVB A;  2F44 A;  5KFO A;  5KFS A;  4USA A;  1F5S A;  5ALU A;  4F5Q A;  3C66 A;  2NRT A;  4Y2Q A;  8ICW A;  1J97 A;  1XO1 A;  2JRZ A;  3K4G A;  4F2S A;  2C22 A;  5EWG A;  4U7C A;  4DOC A;  1TFY A;  2OXO A;  4Q8F A;  4J9K A;  4EGW A;  1PZN A;  3M7D A;  4RT3 A;  3NWI A;  5KL8 B;  1PVQ A;  4O3Q A;  5HRF A;  4NLC A;  3ZD9 A;  3QUB A;  4F93 B;  4KMO B;  2K4I A;  3V6H A;  2KK0 A;  7ICI A;  5CHE A;  1XC9 A;  2N1R A;  1XU4 A;  4J9L A;  2J6U A;  3H8S A;  2EWR A;  9ICB A;  4UD5 A;  3GIJ A;  3THV A;  2ZIX B;  3V6K A;  4F50 A;  5G5G A;  2A19 A;  4QZF A;  3PX0 A;  2YY6 A;  2ZIX A;  2K4P A;  7ICP A;  1Q3V A;  3PMN A;  3D2S A;  4DSK A;  5JUM A;  2W03 A;  5ALX A;  4F92 B;  3ZDB A;  4UAY A;  2JEI A;  2KG5 A;  4E7X A;  3KZX A;  2VA3 A;  4M0A A;  1SXD A;  2FPM A;  3MCR A;  3WK8 A;  3HJ1 A;  1ZD3 A;  2KIW A;  4Y2P A;  4YG2 A;  4K9B A;  2FJ6 A;  3F2D A;  4K4I A;  2Y9T A;  5HML A;  1ZQT A;  1ZQ1 C;  3KBB A;  3BDP A;  1NOM A;  5HR6 A;  1UQV A;  2KJ8 A;  5KG3 A;  4RQ0 A;  2HCF A;  4UW9 A;  2BBJ A;  1ZQB A;  4LEY A;  4PGQ A;  3F53 A;  2KV2 A;  2Y9U A;  4CDG A;  5D49 A;  2LBO A;  2MUT A;  5HP4 A;  1R8A A;  1V9P A;  1MA7 A;  3F5E A;  4F3O A;  2Q66 A;  2MA1 A;  1D8Y A;  4WC3 A;  2YMQ A;  1L3V A;  4PL1 A;  1SL2 A;  3RH6 A;  4XQ7 A;  4EEB A;  1T4G A;  3C5G A;  7ICQ A;  3C1Z A;  5ALN A;  4ECW A;  2RHF A;  3WKD A;  4WC4 A;  4BGD A;  2R8K A;  2G08 A;  1OXJ A;  1KDH A;  3N28 A;  1NK7 A;  5HR7 A;  3RF9 A;  1N5X A;  4UQG A;  3QZ7 A;  4P4O A;  3V7K A;  2DWQ A;  1O08 A;  2OYY A;  4JLZ A;  4J9M A;  5ALF A;  4X4T A;  4C80 A;  2IBK A;  5EE0 A;  4DL7 A;  3B9J A;  5HC9 A;  4AT7 B;  2Q0Z X;  4M9L A;  3NUQ A;  2XCA A;  5B5E U;  4AT7 A;  4KLS A;  3ISC A;  2UVR A;  3PX4 A;  2BQU A;  1RQL A;  4AYB F;  4DLG A;  4B9L A;  4KMU A;  3RJE A;  8ICA A;  4EEN A;  4GLX A;  4O3O A;  2ATL A;  4YR3 A;  3OTQ A;  3WK5 A;  2G0A A;  4K8V A;  5KFU A;  3EYZ A;  3AQN A;  3QEB Z;  3LYS A;  2WF7 A;  1U48 A;  3I1Y A;  4O67 A;  4O3S A;  1XNS A;  2NRW A;  4FS1 A;  4DFP A;  1Z4O A;  9ICV A;  5J2G A;  3ETL A;  2E1E A;  3IDW A;  2H3I A;  3CP8 A;  3V7L A;  4AT8 B;  4CE6 A;  4YFK A;  4Q43 A;  4F2R A;  3TAP A;  5AK6 A;  4UB2 A;  3GIL A;  1TFR A;  1U9L A;  2QB0 B;  1SV4 A;  2W3S A;  2ZIU A;  5J2E A;  5IIN A;  2H3Q A;  5L9X A;  1ZQP A;  4EYI B;  2FE9 A;  2XI9 A;  3WFP A;  2FDR A;  4PL2 A;  8ICO A;  1B0X A;  2H3Z A;  2Y0S F;  3IP4 B;  4RU9 A;  3UXN A;  5HRL A;  3SAF A;  5DG7 A;  1SWW A;  2F1H A;  1TAM A;  4EV6 A;  1NI3 A;  4AYB C;  1ZQC A;  2HMX A;  4ED6 A;  4LJX A;  5J0X A;  4EEK A;  5DB8 A;  4RQM A;  5T14 A;  3RH5 A;  2HVI A;  5IIL A;  3K1Z A;  2LMR A;  1ZQN A;  4NXX A;  3H0M B;  4EP7 A;  4JV2 A;  2F76 X;  4WBY A;  4P0P B;  1NK9 A;  5HRD A;  4ECX A;  4M9H A;  4RUC A;  4QIW F;  2BQR A;  1T94 A;  4I0U A;  3TAD C;  2KEY A;  2AGO A;  2MSN A;  3H8J A;  4C7Z A;  4NLK A;  1SGG A;  2ZIV B;  3JZ0 A;  2R18 A;  1TE2 A;  1TAU A;  3QZ8 A;  2CN1 A;  4KLH A;  4MF8 A;  1CUK A;  1VDV A;  3D2N A;  9ICH A;  4DQP A;  1O03 A;  2ZXH A;  4NM2 A;  4ECT A;  3ISB A;  4P0Q A;  4UB6 U;  4F71 A;  4G9B A;  4X0A A;  4BWM A;  2KKV A;  4OJ5 A;  1QQ5 A;  2KVC A;  4C8M A;  2KSO A;  3C28 A;  2IHN A;  4FHW A;  1BNP A;  1WCN A;  3NYB A;  4LEZ A;  4JLX A;  4DSJ A;  2EDU A;  4FZM A;  4HX0 A;  3N7R C;  2VA2 A;  5HRI A;  1RZT A;  3RJK A;  4A8E A;  2W04 A;  4Q45 A;  3HPO A;  5KFP A;  3UM9 A;  1WOT A;  2OHF A;  5J0R A;  1PK1 B;  3M8S A;  5ALD A;  2JEJ A;  1QLN A;  1MIW A;  2HHQ A;  2A1J A;  2WF5 A;  4NKT A;  3EF2 A;  1KLN A;  1N63 A;  3RJJ A;  2HN1 A;  3SD7 A;  3B0X A;  4QIW C;  2ZH6 A;  5AI8 A;  3TKA A;  1Z3E B;  2KP7 A;  1Q78 A;  4O5C A;  4C8O A;  3WFQ E;  2K89 A;  3D6J A;  3U26 A;  2ZXI A;  1Y88 A;  3NS1 A;  2O1P A;  1IM4 A;  2WFA A;  2KHQ A;  4J9P A;  2K4E A;  2B21 A;  4R66 A;  4Z6F A;  2NO4 A;  1T3N A;  2R8G A;  2DL0 A;  5IIJ A;  5CFS A;  2I1Q A;  3WKA A;  2B51 A;  1B22 A;  2EZX A;  2ZUD A;  2JZB B;  2ZJ8 A;  1K5O A;  4ELV A;  4DFJ A;  2BCU A;  1ZJM A;  5GTI U;  5CR0 A;  3ED5 A;  4B6J A;  1ZQV A;  3H37 A;  5IIO A;  4DLE A;  1NJW A;  4KLE A;  2EAN A;  3E0F A;  5KG7 A;  4RNM A;  8ICQ A;  4FH5 A;  1IXR A;  1ZQJ A;  3Q8R B;  1MIY A;  1DRG A;  4KTQ A;  2RQ5 A;  2AJQ A;  4Q8E A;  1BGX T;  2IMW P;  4EED A;  4YR2 A;  2KJ5 A;  3TAC B;  1RQN A;  1JXL A;  1KSP A;  2HI0 A;  2YTU A;  1KEJ A;  5CB1 A;  3BJY A;  5AKE A;  5AM0 A;  4YMO A;  4E80 A;  3SYZ A;  4MFA A;  5KFQ A;  1HEK A;  4YN4 A;  4B9V A;  1IV8 A;  4QZI A;  2I9G A;  2YX8 A;  5KFE A;  5J2A A;  4RQ8 A;  1NZB A;  2DVI A;  5DB7 A;  4N7R A;  1LV5 A;  4YD2 A;  4ELU A;  9ICU A;  3G6Y A;  5KFZ A;  2IHO A;  3Q8M A;  4ICA A;  4DL4 A;  7ICN A;  7ICF A;  4KLO A;  3BZK A;  2HSZ A;  1KBU A;  3HX0 A;  2FLN A;  1V85 A;  3G6X A;  4RQN A;  1M6Y A;  3HIY A;  2BQ3 A;  1S10 A;  2OWO A;  4YVZ A;  2W7P A;  5F9L A;  9ICX A;  5CA7 A;  3NVY A;  3E58 A;  3LWL A;  3PW2 A;  4TUS A;  2ASL A;  1K1S A;  2W55 A;  2XVT A;  3ONN A;  5III A;  4F4Y A;  5KFW A;  1X66 A;  3UPQ A;  1XSN A;  1ZYQ A;  4O69 A;  4RQ3 A;  3PR4 A;  2UVW A;  3UMG A;  1SL1 A;  4UD4 A;  1JUD A;  3QXG A;  4YD1 A;  4RPY A;  5HHI A;  2I5H A;  1V38 A;  4PGY A;  4K98 A;  2KZ3 A;  4Z6D A;  4K99 A;  9ICW A;  2LHT A;  4Y2Y A;  2ZUC A;  3MC1 A;  8ICP A;  1C7Y A;  4S3N A;  4UB4 A;  4E0D A;  4RNO A;  4X4U A;  3KKA C;  2ODG A;  2GH1 A;  2DR8 A;  3HWT A;  3Q8L A;  3SMV A;  3HJE A;  1N48 A;  4US9 A;  4FFD A;  4OJO A;  2KZZ A;  1X9W A;  4XA5 A;  4XRH A;  2K60 A;  2YB4 A;  3PHZ A;  3PO4 A;  1FO4 A;  4C8K A;  5KT4 A;  2BGW A;  2W11 A;  5AKX A;  3VCB A;  9ICS A;  4R8U B;  1UHU A;  5L1K A;  4BWJ A;  2BPF A;  3QUQ A;  4MKP A;  4KLD A;  4U6P A;  3RFA A;  4IRK A;  1ED1 A;  1PUZ A;  4RPX A;  5J0Y A;  3Q8P B;  2JGA A;  5DG9 A;  4UBB A;  4WC6 A;  1KW4 A;  1UA0 A;  5AM4 A;  3PW7 A;  2PBE A;  4NXT A;  1YZ6 A;  1SWV A;  5KTQ A;  5BPC A;  2RFF A;  1K1Q A;  2DGZ A;  2DQN B;  1S0N A;  2ZTE A;  2DUY A;  5AKZ A;  3OUY A;  5J0T A;  4I29 A;  3UPS A;  4UB3 A;  3KKA A;  4X4R A;  3CNH A;  1UEU A;  2XY6 A;  7ICL A;  2DRB A;  3MDC A;  2QAR A;  1NK8 A;  4IQW A;  4X4O A;  1TVA A;  2DBY A;  3N7S C;  1L7P A;  9ICO A;  2NRZ A;  4M04 A;  1BPB A;  3RR7 A;  3Q8S B;  2NRK A;  5C0Y A;  2HHS A;  4PHD A;  3KHG A;  5J0W A;  5J2K A;  4RQ2 A;  2GLE A;  4IC9 A;  5HRK A;  3HKZ C;  4JUZ A;  2YMM A;  2JEF A;  4NJ8 A;  1ZQK A;  4KX5 A;  1X9S A;  4I2C A;  2W43 A;  4F4Z A;  1SKR A;  2M2T A;  4QWD A;  1L8O A;  4F4K A;  5KAF U;  3GII A;  2ESE A;  1KFS A;  4Y2V A;  3C5F A;  4EBD A;  8ICL A;  7ICO A;  1B4F A;  1RYU A;  4M5D A;  5TZV A;  5EWE A;  2AHO B;  4DQI A;  2W9C B;  3TFS A;  3HJ4 A;  5J2J A;  3PR5 B;  2HBL A;  1JXE A;  1UT5 A;  3WFO A;  3BQ0 A;  4O5E A;  4I2A A;  1SKS A;  9ICQ A;  2LKY A;  1IG6 A;  4KLJ A;  4JWM A;  5BOL A;  1YT3 A;  4JK1 A;  4DL3 A;  2V4Q A;  1FFU A;  1Z4N A;  5KFI A;  4ED0 A;  2B6G A;  3IHQ B;  2BZF A;  4DSL A;  1KN5 A;  3PO5 A;  8ICX A;  1U47 A;  1QQ7 A;  1S76 D;  3GU3 A;  4DQQ A;  4Y2R A;  4RQ1 A;  5KNI A;  4KLQ A;  5AI4 A;  4F8R A;  8ICY A;  4I27 A;  3RJH A;  5H2F U;  5ALK A;  2YMP A;  5DEC A;  3T79 A;  1TFW A;  1JI7 A;  2WHE A;  2ASJ A;  3NVO A;  2VA8 A;  1ZQU A;  4JV0 A;  2M9N A;  1NJY A;  4O3M A;  2E1F A;  3DDH A;  4NXV A;  2R8I A;  3HIL A;  1X6I A;  4CNQ A;  4UBC A;  1ZQL A;  4MEX A;  1VJ5 A;  1UT8 A;  3H40 A;  4X4S A;  3WU2 U;  4X4P A;  4NL9 C;  2FCL A;  4KLI A;  2GO7 A;  1UET A;  5G5H A;  5C5J A;  3BZC A;  5ALV A;  4TQS A;  3BQT A;  2H3V A;  1A0P A;  5EWF A;  4R65 A;  2EQY A;  4PZO A;  4HYK A;  4B9U A;  4WC1 A;  1NK0 A;  2F2A B;  2ID1 A;  3NVV A;  4LZG A;  7ICT A;  1U49 A;  1JMS A;  2GAF D;  4DS5 A;  1XSP A;  2W7O A;  1DK3 A;  5DBB A;  1UEV A;  4O3N A;  8ICB A;  2JH7 A;  2E5S A;  1SB3 C;  4K4H A;  1JRO A;  4QZH A;  3QU5 A;  2HW3 A;  2Y1J A;  5B3P A;  4LEV A;  2EAP A;  1TV9 A;  2ZHA A;  5KFV A;  3KTQ A;  2KJ9 A;  1XO0 A;  2K8C B;  3RRH A;  1BPE A;  3K75 D;  1X40 A;  1N61 A;  2WTF A;  5KFX A;  5J2F A;  5CJ7 A;  3M9N B;  5JRT A;  5ALM A;  4QZB A;  2JEG A;  4NL9 A;  3AM9 A;  1KTQ A;  4F72 A;  3UQ0 A;  1L3T A;  3RB0 A;  1LKY B;  3ORY A;  4QZ8 A;  1ECW A;  1DK2 A;  4UB1 A;  3VC8 A;  2P6U A;  2OM6 A;  5KFF A;  3PX6 A;  2XY7 A;  1SL0 A;  4Z6E A;  4FH3 A;  5ALJ A;  3FAH A;  1TK8 A;  4NKU A;  3JPN A;  5AIC A;  4QZA A;  4QZC A;  2ISP A;  1T8E A;  5BOM A;  3C23 A;  3WK9 A;  2QKQ A;  1HJP A;  4I2I A;  4MEY A;  3ZI4 A;  1CI4 A;  1Z00 B;  4NLG A;  5AM5 A;  1COK A;  5DED A;  3T3F A;  2ZTD A;  4QZ9 A;  3AQM A;  2G07 A;  9ICN A;  4QWA A;  2HN2 A;  2YB1 A;  3MR2 A;  5JTG A;  3NTU A;  5KG6 A;  3OGU A;  4DF4 A;  4KLU A;  1ZQW A;  2NO5 A;  5AIB A;  7ICS A;  1Z19 A;  2BDU A;  4J9R A;  3ICX A;  4AT8 A;  4EX7 A;  2RLT A;  5ALY A;  3PY8 A;  2EH9 A;  2BHN A;  4RZR A;  4QWE A;  4ECZ A;  2MAX A;  4DCC A;  9ICP A;  4ECR A;  3MFH A;  5J0Q A;  2QB0 A;  3RH4 A;  5DGB A;  1NJZ A;  5ALP A;  4OAH A;  4F91 B;  1S0M A;  5AI9 A;  1ZD2 P;  5KFH A;  3LWM A;  3Q8Q B;  4TUP A;  1ZQO A;  3GV7 B;  4EBC A;  4CCH A;  3H3A A;  5EE9 A;  4FO6 A;  5CFT A;  5IIK A;  2NYV A;  2HHP A;  2K8B B;  3LVW A;  4K9A A;  3PVX A;  3QUC A;  2CPR A;  4FE3 A;  4EYH B;  4J9N A;  2FMQ A;  1OU5 A;  2ZTC A;  2VKQ A;  2WF9 A;  3H4B A;  4P0P A;  2YQE A;  1KKX A;  4QZE A;  4B9S A;  4FZL A;  5AM3 A;  3MR3 A;  2ZIV A;  3SZ2 A;  4X5V A;  3UMB A;  1Q46 A;  1NK5 A;  4GC7 A;  3T5H A;  1Z1V A;  3UXO A;  4IQU A;  4KN4 A;  1XS9 D;  5HRE A;  4RT2 A;  1SZP A;  4PHE A;  2ZH3 A;  3SEN A;  1P7D A;  3OV7 A;  3AQF A;  4OD0 A;  2VJ4 A;  3IV6 A;  4NV0 A;  1FFV A;  2E8M A;  2Y0S C;  1ZQR A;  4F4W A;  3ER9 B;  2ZIW B;  4OAI Z;  4OAG A;  3D2Q A;  1IIP A;  4JMU A;  1TAQ A;  3LDA A;  2DRA A;  1SZH A;  5AIA A;  5JU5 A;  3HW8 A;  5KT6 A;  2XY5 A;  1Q8K A;  2G06 A;  5DBC A;  4I28 A;  3TAD A;  3SEI A;  2HOQ A;  1NNL A;  2NRV A;  2K8A A;  2OCE A;  2UVU A;  1PK1 A;  2KOB A;  5DLF A;  4YP3 A;  2ZG6 A;  2WF6 A;  3JPS A;  4GXK A;  1S0V A;  1B43 A;  4UAT A;  1X6J A;  1JRP A;  3EWA A;  1AQ6 A;  5D63 A;  5KG5 A;  4PGX A;  1QTM A;  4MF2 A;  4RPZ A;  3PML A;  2O6K A;  5JTI A;  3AEV A;  5KFR A;  4IQV A;  4WOY A;  4QJF B;  4J03 A;  3GQC A;  1XWL A;  4QZG A;  1X9M A;  4C4T A;  1F5A A;  3JPT A;  3MAB A;  5KG1 A;  2DFL A;  3BS5 B;  5DLG A;  1NZP A;  3NGD A;  2KHV A;  4DOA A;  4J9S A;  1RDF A;  2PI4 A;  5AHX A;  1ZD4 A;  3N97 B;  2KZM A;  4KB6 A;  9ICL A;  2CXY A;  2KIC A;  4QWB A;  2BPC A;  1LB2 B;  4B9N A;  9ICG A;  2JZB A;  4NXW A;  2W9A A;  5J0S A;  2DKZ A;  2F77 X;  2G5I B;  3H0R B;  4KX3 A;  5CHG A;  1MSW D;  3BQ7 A;  3RR8 A;  2MRL A;  1S9F A;  1BPD A;  1WYG A;  5CFU A;  8ICH A;  5ALZ A;  1LVH A;  2BKE A;  5B3Q A;  1L7N A;  5HR9 A;  4BX9 C;  4J9O A;  4DL5 A;  2M0N A;  1NKC A;  4DSI A;  5KG4 A;  5HMM A;  4I2J A;  2PFN A;  1A6S A;  2ZH1 A;  2HHT A;  5ALL A;  1NK6 A;  3M6Z A;  2EAO A;  4LEW A;  3S6J A;  1ZQX A;  2A1A A;  5J2D A;  4RNN A;  2HOI A;  4F5R A;  4LVS A;  4O5K A;  4I2D A;  5J0O A;  2M2U A;  4CGZ A;  2L5Y A;  2PMZ F;  3RB3 A;  1S0O A;  4BJQ A;  2P35 A;  2BCQ A;  2YML A;  1H38 A;  3T5J A;  4NLB A;  4C4S A;  5J8Y C;  7ICU A;  1TK5 A;  3KHR A;  8ICF A;  3QU7 A;  4UB8 U;  4I2B A;  1N5W A;  3ALR A;  2F1I A;  4JV1 A;  1RG6 A;  1KQQ A;  2E3T A;  4NY8 A;  4MHV A;  9ICC A;  4YCX A;  4O3P A;  1DGJ A;  1YLQ A;  3K7D A;  2DR9 A;  2PFP A;  8ICG A;  9ICR A;  3QUT A;  2A3V A;  3H8M A;  1WG8 A;  1DOQ A;  1D9F A;  4DWI A;  4KLG A;  3QYP A;  3NVW A;  1ZJN A;  2LYA A;  2C2E A;  4GFJ A;  4DL6 A;  5CWR A;  2G5H B;  2W8L A;  3EPI A;  3PW5 A;  4JB3 A;  1OW5 A;  1TK0 A;  3AU2 A;  2IUB A;  2VIX A;  9ICA A;  4Q44 A;  3JYY A;  3FDS A;  3FM9 A;  3C2M A;  3BQ1 A;  1QSL A;  4G3I A;  2LM4 A;  4C8N A;  3PW4 A;  3C18 A;  2HOF A;  2EZZ A;  1KFT A;  5AK4 A;  2J6T A;  2RDJ A;  4RQ4 A;  4JWN A;  4EEY A;  1D9D A;  3RBE A;  3M9O B;  3NAS A;  2DKX A;  1N60 A;  4E8F A;  3GV8 B;  5J8Y A;  1ZRM A;  3F2C A;  2JHD A;  2ZJA A;  2AGP A;  4KM5 A;  3CYM A;  2D6F C;  3PSF A;  4NXU A;  5KFC A;  1KL9 A;  4TQR A;  3KFU F;  3WK4 A;  3JCF A;  3NKU A;  1T7P A;  2ZH4 A;  5GTH U;  2DF4 B;  1QH9 A;  2E8O A;  5L1L A;  3UXP A;  2HVH A;  1UA1 A;  4OO1 J;  5L1J A;  4IR9 A;  9ICK A;  5AM2 A;  5AK5 A;  5AI5 A;  4IS7 A;  5ALE A;  1DGS A;  2HBJ A;  4R8U A;  4ZH4 A;  4DFM A;  4TUR A;  2BPG A;  4F5N A;  1QQ6 A;  2GOL A;  2HHX A;  3WKE A;  9ICE A;  2ZHB A;  3UQ2 A;  3WK7 A;  5J0P A;  3H39 A;  1VJ7 A;  3NRW A;  8ICV A;  4CRX A;  1BPY A;  1Z1B A;  3IM1 A;  3OWG A;  1NKE A;  3IG5 A;  3QU4 A;  3F5A A;  1J2N A;  2ASD A;  3KHL A;  3H4D A;  1VFG A;  1FEZ A;  3OSP A;  1QSY A;  3AMZ A;  3DEE A;  2KN7 A;  4QWC A;  2QB1 A;  4M6W B;  4C4R A;  5CEH A;  3T5L A;  4PPX A;  4AT9 B;  4UAZ A;  1S77 D;  5ALH A;  3HT3 A;  2KKP A;  1BPZ A;  3L5K A;  4ECV A;  8ICE A;  5A0L A;  4US8 A;  5D61 A;  3AQK A;  4GC6 A;  5DGA A;  1ZET A;  4ED3 A;  1A76 A;  4FZN A;  4DSE A;  3C1Y A;  3MGV A;  2XO7 A;  2K4H A;  1L3S A;  4IR1 A;  4M9G A;  4UAW A;  3RTV A;  3JPR A;  3OHB A;  4CF3 A;  3QNM A;  3LQC B;  3GIK A;  4BXO B;  2OH2 A;  2AXT U;  3AUO A;  2BCV A;  4EEL A;  1ZOL A;  3OJS A;  4BDP A;  4RQ6 A;  3Q8K A;  4EZ6 A;  1MN8 A;  4DL2 A;  4WCW A;  3QE9 Y;  2AQ0 A;  1RXV A;  4P4P A;  4M9J A;  5F9N A;  2W9C A;  2P6R A;  4ECQ A;  1GO3 F;  4UAS A;  4OAF A;  2AH5 A;  4B9T A;  5DQG A;  1HUO A;  4I2G A;  1V4A A;  4RWP A;  3PNC A;  2FLP A;  4C8L A;  4WC0 A;  3KD3 A;  1X2I A;  1COO A;  1WUD A;  3UMC A;  3RRG A;  2W54 A;  8ICI A;  1WCL A;  3T5K A;  4UB5 A;  2KE7 A;  3ERC C;  4YMM A;  2IHM A;  4EBK A;  1CRX A;  1ZQA A;  2O5A A;  1JAJ A;  1F0M A;  2OEH A;  5TIS U;  2DR5 A;  2H3F A;  5EE3 A;  3TAN A;  4FO1 A;  1JX4 A;  3RJI A;  2Q4T A;  4AP9 A;  4KLM A;  3A0H U;  1OUQ A;  1V97 A;  4X4Q A;  4FHV A;  4OJP A;  1U45 A;  5F3X B;  5HNK A;  1ZD5 A;  4K96 A;  1TKD A;  3OPX A;  5ALT A;  2WF8 A;  4DEZ A;  2KNJ A;  4ELT A;  3DV9 A;  4XJE A;  3AQL A;  3RJF A;  9ICM A;  8ICN A;  1WWU A;  1MQ2 A;  4KIT B;  2PXI A;  4WQL A;  5KFB A;  4ATB B;  5CRX A;  3TI0 A;  1D8L A;  4HAI A;  2JMG A;  2WB1 F;  4ATB A;  5KFT A;  3AL0 B;  1L8L A;  4B9M A;  3A0B U;  2W3R A;  1FIQ A;  3NRZ A;  5KG0 A;  1URJ A;  5L1M A;  2PI5 A;  2KFN A;  3QU9 A;  3OVS A;  1ZQQ A;  1SV0 C;  5KG2 A;  4FS2 A;  3JPP A;  1ZXI A;  1ZQZ A;  2MUT B;  2ES6 A;  4Y2X A;  4O3R A;  4ED1 A;  3EPG A;  1JAL A;  5D4B A;  4OCZ A;  5B66 U;  4IRD A;  3N4M B;  2ZH2 A;  4FHX A;  3QX7 A;  1PVR A;  1KRP A;  2JV3 A;  2ZUB A;  3OJU A;  2JXJ A;  3WFS C;  3TQ1 A;  2B56 A;  8ICS A;  4ED8 A;  1RPL A;  3O0F A;  3PSI A;  2HHW A;  2D3D A;  2AQ4 A;  1LKY A;  1KFD A;  1N62 A;  3ER8 C;  1PVP A;  1L7O A;  1UCV A;  3C2L A;  1JN3 A;  2KMD A;  3SV3 A;  3HRD D;  3RAQ A;  5FP0 A;  2JH1 A;  2HDO A;  4RWQ A;  4BUG A;  4EBE A;  2WB1 C;  3EZ5 A;  1SV0 A;  4NWI A;  2G09 A;  5KFJ A;  4CF5 A;  4XQ8 A;  2LPE A;  3KOO A;  7ICJ A;  9ICF A;  4C7Y A;  5HRG A;  4FHP A;  1Z00 A;  2CRX A;  2W9B B;  4J9Q A;  1R8C A;  1YZ7 A;  1WWV A;  2LI6 A;  4IRC A;  2W9B A;  3QU2 A;  4YXJ A;  5K4L A;  2RRD A;  3H0L B;  3TAQ A;  1PK3 A;  2PKE A;  3MDA A;  4DFD A;  4LZD A;  4ACO A;  2HHU A;  1L3U A;  5D62 A;  2FMS A;  4EZ9 A;  2EAM A;  1ZQM A;  4WC2 A;  3I28 A;  7ICR A;  4ECU A;  7ICH A;  3V7J A;  5ALQ A;  2ZH8 A;  4Y2U A;  2DPJ A;  3SAH A;  3AQE A;  4Y2T A;  4QNL A;  5HRH A;  3KZI U;  5DQH A;  5F2V O;  5KAI U;  1X9X A;  4WC5 A;  4QW8 A;  3KHH A;  1NO5 A;  3ETR A;  5ALS A;  1SKW A;  1BNO A;  4PJ0 U;  5AKI A;  1QSS A;  2JR5 A;  1A77 A;  4M2Y A;  2ZIU B;  1J2M A;  4OJ6 A;  3AU6 A;  2RP5 A;  3RBD A;  1BVS A;  2HHV A;  2F1J A;  4K97 A;  2J6S A;  4F5O A;  3MGI A;  4DQS A;  5DDM A;  3OVA A;  5AKH A;  4WQK A;  4Y2S A;  3CRX A;  3FYH A;  4RUA A;  5ALO A;  2Y1I A;  5DDY A;  5D46 A;  4PHP A;  4DS4 A;  4DF8 A;  5DB9 A;  3M6K A;  3E2E A;  3H38 A;  4PZN A;  4KN7 A;  2E8P A;  4QW9 A;  3ZD8 A;  2ZH5 A;  3J81 j;  3PV8 A;  3LVV A;  4ZOH C;  3FC4 A;  1MC8 A;  3SV4 A;  1L7M A;  1XSL A;  5KFL A;  2FPL A;  3PW0 A;  2LYB A;  3WK6 A;  4X4V A;  3AN1 A;  8ICM A;  4WC7 A;  3F2B A;  2BBH A;  1Q79 A;  4NLZ A;  4O6A A;  4P0Q B;  2DPI A;  1ZQD A;  1U4B A;  2ZIW A;  4F5P A;  1ARO P;  3CW2 C;  5KFY A;  2KSO B;  1ZQH A;  2LM1 A;  3K1R B;  4R63 A;  2HBM A;  1RYS A;  2W8K A;  4LT6 A;  1RYR A;  8ICU A;  5AI0 A;  5AKK A;  3G6V A;  2FLL A;  3MR5 A;  5DB6 A;  4KLL A;  5KFD A;  1HIW A;  7ICG A;  4UAU A;  5CP2 A;  1ZQG A;  4KLF A;  2C2R A;  2ZJ5 A;  3M9M B;  3ZDA A;  2A1J B;  5KT2 A;  7ICE A;  3MR6 A;  5KFG A;  4Y2J A;  3M1Y A;  4O9M A;  2KFZ A;  3IRU A;  1D8B A;  1S5L U;  5ALW A;  3MFI A;  4KLT A;  8ICZ A;  4YMN A;  3PZP A;  4ED7 A;  1X42 A;  3BS5 A;  2I6X A;  3V6J A;  2XID A;  3MBY A;  2VAN A;  1HUZ A;  5J2H A;  2M2V A;  5IIM A;  3SI8 A;  7ICK A;  4EBJ A;  3EUB 2;  3RJG A;  1N56 A;  2QLT A;  2BR0 A;  7ICV A;  5AKJ A;  4QZD A;  2HBK A;  5KT5 A;  2IA6 A;  2R8J A;  1ZRN A;  2Z7J A;  5KFA A;  3JPO A;  2E8N A;  2ALZ A;  2F8L A;  4WJ3 B;  1BPX A;  3WKB A;  1ZQE A;  2BE3 A;  3PSP A;  1SXE A;  2XGQ A;  1T3Q A;  1Q3U A;  4OJL A;  9ICT A;  3I76 A;  2GA9 D;  1N2X A;  4I2H A;  5AI6 A;  3GDX A;  2NRX A;  3L4P A;  4X0B A;  2KD1 A;  2ZH7 A;  3C2K A;  2IOF K;  3H8W A;  3GV5 B;  2AU0 A;  4FBU A;  4DQR A;  3SQI A;  4ED2 A;  2GWS A;  3ZDE A;  4IQT A;  5KFK A;  3NVZ A;  5HRB A;  1EXN A;  3BQ2 A;  2F8K A;  5ALR A;  8ICR A;  4NXZ A;  1RXW A;  8ICK A;  1L5U A; 
#chains in the Genus database with same CATH homology
 4QWC A;  2RDI A;  4M6W B;  2FMP A;  4JV2 A;  4AT9 B;  4TUQ A;  4WBY A;  2ZH9 A;  4P4M A;  1TV9 A;  1NK9 A;  4UAZ A;  2ZHA A;  5KFV A;  1S77 D;  5HRD A;  3KTQ A;  2DR7 A;  3HT3 A;  3ISD A;  4DO9 A;  1CEZ A;  4ECX A;  1BPZ A;  4M9H A;  4RUC A;  2BQR A;  2AGO A;  3H8J A;  4ECV A;  8ICE A;  1KNY A;  3RRH A;  4NLK A;  3AQK A;  1BPE A;  3K75 D;  3TAR A;  3H39 A;  4GC6 A;  2WTF A;  3JZ0 A;  5KFX A;  1TAU A;  5J2F A;  5DGA A;  5CJ7 A;  1ZET A;  2PFO A;  3QZ8 A;  4KLH A;  4MF8 A;  3M9N B;  4PHA A;  4ED3 A;  4NLN A;  4QZB A;  1A76 A;  4DSE A;  1CUK A;  2JEG A;  7ICM A;  3C1Y A;  2C2D A;  2XO7 A;  1L3S A;  4M9G A;  4IR1 A;  1KTQ A;  4PH5 A;  5KT3 A;  4UAW A;  4IG8 A;  4GXI A;  9ICH A;  1MQ3 A;  4DQP A;  2XC9 A;  3UQ0 A;  4NM2 A;  3RTV A;  3RB0 A;  1L3T A;  3ORY A;  4QZ8 A;  3OHB A;  3JPR A;  4F4X A;  4ECT A;  4UB1 A;  1DK2 A;  3ISB A;  2P6U A;  2BCS A;  5KFF A;  3LQC B;  3PX6 A;  3GIK A;  4BWM A;  4X0A A;  4BXO B;  3ZDD A;  3AUO A;  2BCV A;  4PPX A;  3OJS A;  4C8M A;  4Z6E A;  2XY7 A;  1SL0 A;  2IHN A;  4FHW A;  4BDP A;  4RQ6 A;  1BNP A;  1WCN A;  3Q8K A;  4EZ6 A;  3NYB A;  5J2C A;  4FH3 A;  4YR0 A;  4M47 A;  4DL2 A;  4WCW A;  4DSJ A;  1TK8 A;  3QE9 Y;  3V72 A;  2AQ0 A;  1NJX A;  4NKU A;  2C28 A;  3JPN A;  1RXV A;  2PFQ A;  4QZA A;  4QZC A;  4P4P A;  4M9J A;  5F9N A;  2ISP A;  1T8E A;  1JQR A;  2W9C A;  5BOM A;  4RQ5 A;  2VA2 A;  3ZDC A;  2P6R A;  4ECQ A;  3C23 A;  5HRI A;  1RZT A;  3RJK A;  4B9T A;  5DQG A;  1HJP A;  4Q45 A;  4I2I A;  3HPO A;  4MEY A;  5KFP A;  5J2I A;  1HUO A;  4I2G A;  4FBT A;  1Z00 B;  4O0I A;  4NLG A;  1V4A A;  1WOT A;  4RWO A;  4RWP A;  2ZHB A;  5J0R A;  3M8S A;  2JEJ A;  1QLN A;  5DKW A;  1MIW A;  2HHQ A;  4DSF A;  5DED A;  3PNC A;  3T3F A;  5KT7 A;  2FLP A;  2ZTD A;  4C8L A;  2A1J A;  5DG8 A;  4WC0 A;  4QZ9 A;  3AQM A;  4NKT A;  2UVV A;  1X2I A;  3EW9 A;  1KLN A;  5J29 A;  1COO A;  3RJJ A;  3B0X A;  3RRG A;  2ZH6 A;  1FA0 A;  4RWN A;  8ICI A;  5J0U A;  3L9D A;  1Z3E B;  9ICN A;  1WCL A;  3T5K A;  2KP7 A;  1Q78 A;  2H5X A;  4QWA A;  4UB5 A;  3H7I A;  3MR2 A;  4O5C A;  3NTU A;  5KG6 A;  3OGU A;  4C8O A;  3WFQ E;  4YMM A;  4DF4 A;  2IHM A;  4KLU A;  1R8B A;  4EBK A;  1ZQW A;  1ZQA A;  4I2E A;  1JAJ A;  2O5A A;  2DR5 A;  3TAN A;  5EOZ A;  7ICS A;  1Y88 A;  4J9R A;  1JX4 A;  4YQW A;  8ICC A;  2O1P A;  4AT8 A;  4NM1 A;  3RJI A;  1IM4 A;  4DSI A;  4KLM A;  4J9P A;  3PY8 A;  2BCR A;  1NKB A;  4FHV A;  4X4Q A;  2B21 A;  3HP6 A;  1U45 A;  2BHN A;  5HNK A;  4RZR A;  4Z6F A;  4R66 A;  4QWE A;  2M2W A;  3JPQ A;  4ECZ A;  2MAX A;  1R89 A;  9ICP A;  1TKD A;  4ECR A;  3MFH A;  5J0Q A;  3TFR A;  1T3N A;  2R8G A;  4DOB A;  5IIJ A;  2V9W A;  4ECY A;  2I1Q A;  4DEZ A;  3RH4 A;  5DGB A;  4ELT A;  1NJZ A;  3AQL A;  1B22 A;  2ZUD A;  4F91 B;  4I2F A;  2JZB B;  2ZJ8 A;  1S0M A;  3RJF A;  4M9N A;  1JIH A;  4ELV A;  9ICM A;  8ICN A;  5KFH A;  3LWM A;  4KIT B;  3Q8Q B;  4TUP A;  2PXI A;  4DFJ A;  1MQ2 A;  3GV7 B;  1ZQO A;  2BDP A;  4X4N A;  5KFB A;  4EBC A;  8ICJ A;  5KFM A;  1ZJM A;  2BCU A;  4CCH A;  4ATB B;  3TI0 A;  3H3A A;  1D8L A;  4Z6C A;  4R64 A;  4FO6 A;  4MF2 A;  5CR0 A;  2FPK A;  1ZQV A;  4ATB A;  5KFT A;  3H37 A;  5IIK A;  2HHP A;  5IIO A;  4DLE A;  8ICT A;  3C21 A;  1NJW A;  4KLE A;  5HHH A;  5KG7 A;  4RNM A;  4B9M A;  8ICQ A;  4FH5 A;  1IXR A;  3PVX A;  1ZQJ A;  3Q8R B;  5KG0 A;  3RAX A;  4P2H A;  9ICI A;  3MGH A;  4EYH B;  4J9N A;  3RB6 A;  2XGP A;  2PI5 A;  1NK4 A;  4KTQ A;  2KFN A;  1MIV A;  2FMQ A;  2AJQ A;  5L1I A;  3OVS A;  1ZQQ A;  4Q8E A;  1BGX T;  2IMW P;  3OHA A;  5KG2 A;  1OU5 A;  4X4V A;  2ZTC A;  4MFC A;  4FS2 A;  3WFR E;  4YR2 A;  4AT9 A;  4M6W A;  3JPP A;  3H4B A;  1ZQZ A;  2MUT B;  4FHY A;  3OUY B;  1ZQF A;  1JXL A;  4O3R A;  1KSP A;  3B0Y A;  4ED1 A;  1ZQI A;  4QZE A;  3EPG A;  4MFF A;  1KEJ A;  5CB1 A;  3BJY A;  4B9S A;  5D4B A;  3MR3 A;  5J2B A;  4K4G A;  4YMO A;  4IRD A;  4E80 A;  3N4M B;  3SYZ A;  3SZ2 A;  4MFA A;  5KFQ A;  4X5V A;  1PX5 A;  4YN4 A;  4FHX A;  2ZH2 A;  4B9V A;  4QZI A;  1NK5 A;  1KRP A;  2ZUB A;  1ZQY A;  3OJU A;  4GC7 A;  2V4R A;  3T5H A;  2I9G A;  3WFS C;  3TQ1 A;  5KFE A;  5J2A A;  3UXO A;  4RQ8 A;  3QEA Z;  4GXJ A;  1ZQS A;  4IQU A;  8ICS A;  4ED8 A;  1RPL A;  4KN4 A;  4DFK A;  3GFK B;  1XS9 D;  4RT2 A;  2XCP A;  2P66 A;  2KTQ A;  2HHW A;  5HRE A;  2AQ4 A;  1SZP A;  2DVI A;  5DB7 A;  4PHE A;  3GIM A;  9ICJ A;  1KFD A;  5KFN A;  2ZH3 A;  4ECS A;  2AGQ A;  1LV5 A;  4WBZ A;  3OV7 A;  4YD2 A;  4ELU A;  4RQ7 A;  9ICU A;  3G6Y A;  5KFZ A;  3C2L A;  2LYH A;  3M8R A;  4XUS A;  3Q8M A;  1ZQR A;  4DL4 A;  4BXO A;  1S97 A;  1JN3 A;  2R8H A;  4F4W A;  5DQI A;  4KLF A;  3SV3 A;  7ICF A;  7ICN A;  4KLO A;  5DBA A;  4YXM A;  3RAQ A;  3HX0 A;  3RB4 A;  4RWQ A;  2FLN A;  2W9M A;  1TAQ A;  3G6X A;  3LDA A;  4EBE A;  2DRA A;  3HIY A;  3LK9 A;  2BQ3 A;  2ISO A;  1S10 A;  3EZ5 A;  3OSN A;  3HW8 A;  2OWO A;  3OVB A;  5KT6 A;  4YVZ A;  5KFO A;  2XY5 A;  5KFS A;  5F9L A;  9ICX A;  5KFJ A;  5CA7 A;  4F5Q A;  5DBC A;  4XQ8 A;  4I28 A;  3C66 A;  2NRT A;  7ICJ A;  9ICF A;  3LWL A;  3PW2 A;  4TUS A;  8ICW A;  5HRG A;  2NRV A;  4FHP A;  1Z00 A;  2ASL A;  1XO1 A;  3K4G A;  4F2S A;  1K1S A;  2C22 A;  2W9B B;  2UVU A;  3WFO A;  5EWG A;  5III A;  4J9Q A;  1R8C A;  5DLF A;  4F4Y A;  4YP3 A;  4DOC A;  1TFY A;  4IRC A;  4J9K A;  4Q8F A;  2W9B A;  1PZN A;  5KFW A;  4YXJ A;  3JPS A;  4GXK A;  3UPQ A;  1XSN A;  4RT3 A;  3TAQ A;  1ZYQ A;  4RQ3 A;  4O3Q A;  3PR4 A;  2UVW A;  5HRF A;  3ZD9 A;  1SL1 A;  3MDA A;  4F93 B;  4LZD A;  1S0V A;  4UD4 A;  1B43 A;  4YD1 A;  3V6H A;  4RPY A;  7ICI A;  1XC9 A;  5HHI A;  4PGY A;  3EWA A;  2HHU A;  2KZ3 A;  4Z6D A;  5KG5 A;  4PGX A;  1L3U A;  4RPZ A;  3PML A;  1XU4 A;  1QTM A;  2FMS A;  4J9L A;  5KFR A;  4EZ9 A;  1ZQM A;  2J6U A;  9ICW A;  4WC2 A;  4IQV A;  3H8S A;  7ICR A;  4ECU A;  3GQC A;  1XWL A;  4QZG A;  1X9M A;  9ICB A;  2ZUC A;  8ICP A;  1F5A A;  7ICH A;  3JPT A;  4UD5 A;  3V7J A;  3GIJ A;  3MAB A;  5KG1 A;  3THV A;  2DFL A;  1C7Y A;  5DLG A;  3V6K A;  4S3N A;  2DPJ A;  4UB4 A;  4E0D A;  1NZP A;  4RNO A;  3NGD A;  4F50 A;  2ZH8 A;  4X4U A;  2ZH7 A;  4QZF A;  3PX0 A;  4DOA A;  4J9S A;  5HRH A;  2PI4 A;  2DR8 A;  3HWT A;  7ICP A;  3Q8L A;  5DQH A;  3PMN A;  5F2V O;  3N97 B;  1N48 A;  4DSK A;  2KZM A;  4WC5 A;  5JUM A;  4QW8 A;  2KZZ A;  3KHH A;  1NO5 A;  9ICL A;  1SKW A;  1X9W A;  4XA5 A;  4XRH A;  4F92 B;  3ZDB A;  1BNO A;  1QSS A;  4QWB A;  2BPC A;  4UAY A;  1LB2 B;  3PO4 A;  4B9N A;  1A77 A;  2JZB A;  2JEI A;  9ICG A;  4C8K A;  4M2Y A;  4E7X A;  5KT4 A;  2W9A A;  2BGW A;  5J0S A;  2VA3 A;  4M0A A;  5CHG A;  1MIY A;  9ICS A;  1MSW D;  4R8U B;  3AU6 A;  5L1K A;  2FPM A;  4BWJ A;  2BPF A;  3RR8 A;  3RBD A;  1BVS A;  3HJ1 A;  1S9F A;  4KLD A;  4YG2 A;  1BPD A;  4IRK A;  2HHV A;  2F1J A;  4K4I A;  2J6S A;  4F5O A;  8ICH A;  5HML A;  3MGI A;  1ZQT A;  4DQS A;  5DDM A;  1NOM A;  5J0Y A;  4RPX A;  3Q8P B;  2BKE A;  5DG9 A;  4UBB A;  3BDP A;  4WC6 A;  5KG3 A;  4RQ0 A;  1UA0 A;  3OVA A;  5HR9 A;  4J9O A;  1ZQB A;  4DL5 A;  4PGQ A;  3PW7 A;  2PBE A;  3FYH A;  5KTQ A;  4RUA A;  5BPC A;  5KG4 A;  2Y1I A;  1K1Q A;  5DDY A;  1NKC A;  5D49 A;  2RFF A;  5D46 A;  1S0N A;  2ZTE A;  2MUT A;  4PHP A;  4DS4 A;  4DF8 A;  5J0T A;  5HP4 A;  5DB9 A;  4I29 A;  1R8A A;  1V9P A;  3UPS A;  5HMM A;  4I2J A;  4UB3 A;  2PFN A;  4X4R A;  3E2E A;  3H38 A;  2ZH1 A;  1UEU A;  2HHT A;  2XY6 A;  4F3O A;  1NK6 A;  7ICL A;  4KN7 A;  2DRB A;  4QW9 A;  3MDC A;  3ZD8 A;  1NK8 A;  2ZH5 A;  2Q66 A;  1ZQX A;  1D8Y A;  5J2D A;  4RNN A;  3PV8 A;  4IQW A;  4F5R A;  4LVS A;  1TVA A;  4O5K A;  4WC3 A;  4X4O A;  1L3V A;  4I2D A;  1MC8 A;  3SV4 A;  1SL2 A;  1XSL A;  5KFL A;  3RH6 A;  5J0O A;  4XQ7 A;  9ICO A;  2M2U A;  2NRZ A;  4M04 A;  2FPL A;  1BPB A;  1T4G A;  3C5G A;  3PW0 A;  3RB3 A;  1S0O A;  3RR7 A;  7ICQ A;  3Q8S B;  3C1Z A;  2NRK A;  2BCQ A;  4ECW A;  2HHS A;  8ICM A;  4WC7 A;  1H38 A;  3T5J A;  4PHD A;  4O5E A;  3KHG A;  4WC4 A;  5J0W A;  5J2K A;  4BGD A;  1Q79 A;  2R8K A;  4RQ2 A;  4NLZ A;  7ICU A;  1TK5 A;  1KDH A;  5HRK A;  3KHR A;  8ICF A;  4JUZ A;  2JEF A;  4I2B A;  1NK7 A;  2DPI A;  1ZQD A;  2F1I A;  1U4B A;  1X9S A;  4F5P A;  1ZQK A;  4JV1 A;  4F4Z A;  1SKR A;  4I2C A;  2M2T A;  4QWD A;  4NY8 A;  4F4K A;  4YCX A;  4O3P A;  1ARO P;  9ICC A;  1YLQ A;  4UQG A;  3QZ7 A;  2DR9 A;  3GII A;  4P4O A;  5KFY A;  1ZQH A;  1KFS A;  3V7K A;  3C5F A;  2PFP A;  8ICG A;  4EBD A;  9ICR A;  4J9M A;  8ICL A;  4R63 A;  1RYS A;  7ICO A;  1DOQ A;  2W8K A;  1D9F A;  4DWI A;  4X4T A;  2IBK A;  4KLG A;  4M5D A;  5TZV A;  1ZJN A;  2C2E A;  5EWE A;  4DL7 A;  4LT6 A;  4DQI A;  1RYR A;  2W9C B;  5HC9 A;  8ICU A;  4AT7 B;  4DL6 A;  3TFS A;  3G6V A;  2Q0Z X;  5CWR A;  2FLL A;  2XCA A;  4M9L A;  3MR5 A;  2W8L A;  3HJ4 A;  5DB6 A;  3EPI A;  5J2J A;  3PW5 A;  3PR5 B;  4KLL A;  1JXE A;  4AT7 A;  1UT5 A;  5KFD A;  1TK0 A;  3AU2 A;  4KLS A;  3BQ0 A;  3ISC A;  7ICG A;  5CP2 A;  3PX4 A;  1ZQG A;  2UVR A;  2C2R A;  2BQU A;  2ZJ5 A;  1SKS A;  4DLG A;  4B9L A;  4I2A A;  9ICQ A;  4KMU A;  3M9M B;  3RJE A;  9ICA A;  4Q44 A;  8ICA A;  4GLX A;  3JYY A;  4O3O A;  3FDS A;  3ZDA A;  2A1J B;  4KLJ A;  3C2M A;  4JWM A;  5BOL A;  2ATL A;  5KT2 A;  3BQ1 A;  4JK1 A;  4YR3 A;  4DL3 A;  2V4Q A;  1QSL A;  7ICE A;  4G3I A;  3MR6 A;  5KFG A;  5KFI A;  4O9M A;  4C8N A;  3PW4 A;  2KFZ A;  3C18 A;  5KFU A;  3EYZ A;  3AQN A;  4ED0 A;  1KFT A;  2J6T A;  3IHQ B;  2RDJ A;  3QEB Z;  4RQ4 A;  1U48 A;  4DSL A;  4JWN A;  3PO5 A;  4EEY A;  1U47 A;  1D9D A;  8ICX A;  3RBE A;  4O3S A;  1S76 D;  3M9O B;  4E8F A;  3MFI A;  2NRW A;  3GV8 B;  4KLT A;  2ZJA A;  2AGP A;  4DQQ A;  8ICZ A;  3OUY A;  4YMN A;  4RQ1 A;  4ED7 A;  4FS1 A;  4KLQ A;  3V6J A;  4DFP A;  3MBY A;  4F8R A;  9ICV A;  2VAN A;  8ICY A;  5J2G A;  1HUZ A;  3ETL A;  5J2H A;  3RJH A;  4I27 A;  5IIM A;  3SI8 A;  2M2V A;  5KFC A;  7ICK A;  3V7L A;  4EBJ A;  4AT8 B;  5DEC A;  4YFK A;  4TQR A;  4Q43 A;  1TFW A;  2ASJ A;  4F2R A;  3TAP A;  3RJG A;  2VA8 A;  1T7P A;  1ZQU A;  4JV0 A;  2BR0 A;  2M9N A;  4UB2 A;  1NJY A;  1N56 A;  7ICV A;  4QZD A;  5KT5 A;  2IA6 A;  5L1L A;  2R8I A;  3UXP A;  2R8J A;  2HVH A;  5KFA A;  3JPO A;  3GIL A;  2ALZ A;  1UA1 A;  1BPX A;  4UBC A;  1ZQL A;  4MEX A;  1ZQE A;  1TFR A;  2BE3 A;  1U9L A;  1UT8 A;  3H40 A;  2XGQ A;  5L1J A;  4IR9 A;  4X4S A;  9ICK A;  9ICT A;  4X4P A;  5J2E A;  5IIN A;  4KLI A;  5L9X A;  1ZQP A;  4EYI B;  1DGS A;  1UET A;  2ZH4 A;  4R8U A;  3WFP A;  5C5J A;  4ZH4 A;  4DFM A;  8ICO A;  4TQS A;  4RU9 A;  4I2H A;  3BQT A;  4TUR A;  3UXN A;  5HRL A;  2BPG A;  4F5N A;  5DG7 A;  5EWF A;  4R65 A;  3GDX A;  4HYK A;  4B9U A;  2NRX A;  2F1H A;  2HHX A;  9ICE A;  4WC1 A;  3C2K A;  4X0B A;  3H8W A;  5J0P A;  3GV5 B;  3UQ2 A;  2AU0 A;  1NK0 A;  1ZQC A;  4FBU A;  4ED6 A;  5J0X A;  4DQR A;  1VJ7 A;  2ID1 A;  5DB8 A;  4ED2 A;  8ICV A;  1BPY A;  4LZG A;  7ICT A;  1U49 A;  1JMS A;  3IM1 A;  4DS5 A;  3RH5 A;  1XSP A;  3ZDE A;  5DBB A;  1NKE A;  2GWS A;  4IQT A;  2HVI A;  1DK3 A;  5KFK A;  5HRB A;  1UEV A;  1EXN A;  3BQ2 A;  4O3N A;  5IIL A;  2ASD A;  8ICB A;  8ICR A;  4NXZ A;  3KHL A;  3H4D A;  4K4H A;  1VFG A;  1RXW A;  4QZH A;  8ICK A;  1ZQN A;  2HW3 A;  2Y1J A;  3OSP A;  1QSY A;  4EP7 A;  1L5U A;  3T5L A;  2KN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...