4AT7A

Crystal structure of the nf90-nf45 dimerisation domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
334
structure length
334
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 115
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at7A02
1KNYA 2RFFA 3PNCA 1ZQFA 3UQ2A 1RPLA 1ZQIA 3UXNA 8ICZA 2FMSA 4FH3A 1OU5A 5J2HA 4O69A 3PMNA 2O5AA 5DB7A 5CA7A 8ICUA 4O9MA 5J2IA 1Q79A 5DECA 3AQMA 2BCUA 4RWPA 1ZQAA 4RWOA 4I28A 5IIKA 2DRBA 4JLXA 5IIMA 3OGUA 3JZ0A 3RJIA 2PXIA 5F2VO 7ICIA 3JPTA 4YCXA 5D4BA 4Z6EA 3HWTA 4WC0A 4UAWA 5BPCA 2HHPA 4AT9B 4WC4A 4I29A 4QZ9A 8ICJA 1MQ3A 5HR9A 2DR8A 4M9NA 3OVAA 4TUSA 8ICFA 5D49A 2BCSA 1JQRA 7ICLA 4F5RA 3OUYA 4M2YA 1TVAA 1ZQBA 2BPFA 3H38A 4X4QA 9ICFA 3WFQE 4NXXA 8ICCA 7ICHA 7ICVA 4O67A 2BCRA 4Z6FA 4QZDA 4I2FA 4NY8A 4OAGA 4K4GA 4KLLA 4FHWA 4X4OA 4MFFA 8ICVA 4NXUA 1ZQDA 4NM2A 9ICEA 1PX5A 4K9AA 8ICPA 2ISOA 2ZH5A 4YD2A 4WC1A 7ICRA 5J2EA 1ZQCA 9ICSA 4QZFA 4YMNA 4PH5A 2P66A 4P4MA 8ICRA 8ICIA 4QZCA 9ICLA 3RJHA 3JPOA 4FH5A 3AU2A 4QZAA 4X4RA 7ICFA 4F5QA 4I27A 5J2CA 2PFPA 4X4SA 4LEWA 1BPXA 4I2AA 1UETA 5J2AA 5HHHA 4K4IA 5HREA 8ICGA 3V7KA 8ICXA 4KLEA 3C2LA 1MIWA 1ZQUA 8ICEA 5HRFA 4DO9A 1ZQHA 4NXTA 4EBJA 4RQ6A 5J0QA 4LVSA 7ICQA 4LT6A 5CWRA 3AQKA 4EP7A 4K97A 3K75D 2ZHBA 1NOMA 4WCWA 2BE3A 5DBBA 4NXVA 5IIJA 3RJKA 3L9DA 3JPRA 4KLTA 5HRLA 5CB1A 2NRKA 9ICQA 3H37A 4WC2A 7ICOA 1XSLA 1KEJA 4PHPA 1JN3A 3WFPA 4AT7A 4LEVA 4IQUA 4S3NA 3RH5A 2ZH4A 1MQ2A 3ISCA 4QZHA 4JLZA 8ICAA 2DRAA 4FHXA 3GDXA 3MDAA 4TUPA 5HRBA 3JPSA 4K99A 1FA0A 9ICXA 1ZQZA 1MIVA 1ZQPA 4R65A 5J2JA 4XQ8A 4LEZA 1BPDA 4Z6CA 4UB5A 3OVBA 7ICPA 3OUYB 2ZH3A 1R89A 1ZQRA 2W9MA 4KLQA 5J2DA 2ZH9A 4QZBA 4F5OA 1ZQJA 2PFOA 8ICMA 5J0RA 4R66A 4TURA 5IILA 2ZHAA 1Q78A 1R8CA 4X4UA 4RWNA 5D46A 4IG8A 4NKUA 3RJJA 4X5VA 5IIOA 2Q66A 3B0YA 4K98A 4I2IA 2ID1A 4RPYA 4K8VA 3AQNA 4ATBA 8ICKA 3UXOA 2FMQA 9ICWA 4XQ7A 4I2EA 2DR5A 8ICQA 1TV9A 9ICOA 4KLGA 4RQ5A 1ZQGA 4JWMA 1YLQA 4EBKA 4QZIA 2BCQA 3TFRA 4NLNA 4OAFA 3NYBA 5DDYA 4UB4A 7ICEA 4M9LA 3UPSA 3HJ4A 4NKTA 4I2CA 4M9JA 4KLJA 3V72A 4UAZA 4LZGA 3AQLA 4O68A 5J0SA 5DBCA 3C2MA 9ICBA 2ZH6A 1VJ7A 4QZ8A 2DR9A 1VFGA 4RPZA 1TFWA 5DB9A 4KLMA 3UPQA 1ZQOA 3AU6A 4WC7A 8ICYA 9ICTA 9ICCA 3H39A 4UB2A 2DR7A 9ICGA 1ZQEA 8ICLA 1UEVA 1V4AA 4RT2A 5DB6A 4UAYA 4LEYA 4AT7B 3HW8A 4AT8A 4P4OA 3OV7A 4M0AA 5J2FA 4X0AA 3ISBA 4RQ8A 4DOBA 2FMPA 7ICUA 5J2GA 3PMLA 3MDCA 1TFYA 3JPPA 4P2HA 5HHIA 1ZQYA 4R64A 4PHDA 4NXZA 4MFAA 9ICPA 4M9GA 5HRIA 1ZJNA 2IHMA 4FHVA 1F5AA 4XUSA 1HUZA 2O1PA 5J29A 4O5EA 3C5FA 1ZQVA 4TUQA 4KLUA 4QZEA 4XA5A 5CHGA 4LZDA 1MIYA 4NXWA 3V7LA 5J0WA 4FO6A 4WBYA 4RQ7A 4KLSA 4R63A 3AUOA 4WC6A 4KM5A 1WOTA 4RQ3A 5J0UA 2PFNA 4X0BA 7ICSA 5J0OA 4NLKA 4M5DA 5BOMA 3HIYA 4XRHA 1ZQKA 4YMOA 2ZH1A 4ATBB 4UB3A 3RH4A 4X4VA 5HC9A 3C66A 4I2DA 4IQWA 4WBZA 1XSNA 9ICMA 3TFSA 5CJ7A 3UQ0A 7ICNA 2ZH7A 4JWNA 4M04A 4QZGA 8ICTA 3C2KA 3WFOA 4E7XA 2VANA 7ICJA 8ICNA 5IIIA 8ICBA 4MKPA 2ISPA 4KLDA 4MF8A 7ICMA 1ZQSA 4E8FA 8ICWA 1XSPA 1BPBA 4KLIA 4IQVA 1ZQMA 2BCVA 5HRDA 2GWSA 3WFSC 9ICKA 4I2HA 3B0XA 3LK9A 4M47A 9ICHA 3RH6A 1UEUA 4RWQA 1KDHA 3JPNA 1JAJA 9ICNA 2PBEA 4E80A 5J2BA 4MFCA 7ICKA 1NO5A 2M2WA 5CP2A 3ISDA 7ICGA 3OVSA 9ICAA 4NLZA 4NM1A 5HRKA 4WC3A 3MBYA 8ICHA 3V7JA 3RJFA 9ICUA 3RJGA 4O5CA 3HX0A 2PFQA 5TZVA 4X4TA 3JYYA 1ZQQA 4O5KA 1R8BA 4AT8B 4M9HA 4Z6DA 4RQ2A 4KLHA 8ICSA 1ZQNA 5J2KA 4I2BA 3LQCB 1ZQTA 5CR0A 4KB6A 4AT9A 1BPEA 8ICOA 4K96A 4KLFA 4I2GA 1ZQXA 5DB8A 2ZH2A 1ZQLA 4I2JA 4PHAA 4X4PA 4P4PA 1ZQWA 4GXKA 7ICTA 2M2VA 5J0PA 5EOZA 3JPQA 5IINA 5BOLA 4O6AA 2I9GA 4FHYA 5J0YA 4RQ0A 4F5PA 5DBAA 4GXIA 3WFRE 4UB1A 4FHPA 5DDMA 4PGQA 4PHEA 2M2TA 4YN4A 2BPCA 5HRGA 4PGYA 4YMMA 1BPZA 4K9BA 1R8AA 9ICJA 4DOCA 4IQTA 5HRHA 2BPGA 5J0XA 1JMSA 3MGIA 4RQ1A 4GXJA 4RQ4A 4WC5A 3C18A 4WOYA 4YD1A 3UXPA 4X4NA 1BPYA 4PGXA 4UD5A 3H3AA 3C5GA 4F5NA 4KLOA 5J0TA 4MF2A 1RZTA 9ICVA 1HUOA 4K4HA 3MGHA 5DKWA 4RPXA 4UBCA 4OAHA 2ZH8A 1ZJMA 9ICIA 4OAIZ 4PPXA 2M2UA 4DOAA 2DVIA 3RJEA 5DEDA 3HJ1A 4UD4A 4UBBA 4RT3A 9ICRA
chains in the Genus database with same CATH superfamily
1KNYA 2RFFA 3PNCA 5CHEA 4EEDA 1ZQFA 3UQ2A 1RPLA 1ZQIA 3UXNA 8ICZA 2FMSA 4FH3A 1OU5A 5J2HA 4O69A 3PMNA 2O5AA 3ERCC 5DB7A 5CA7A 8ICUA 4O9MA 5J2IA 1Q79A 5DECA 3AQMA 2BCUA 4RWPA 1ZQAA 4RWOA 4I28A 5IIKA 2DRBA 4JLXA 5IIMA 3OGUA 3JZ0A 3RJIA 2PXIA 5F2VO 7ICIA 3JPTA 4YCXA 2HN1A 5D4BA 4Z6EA 3HWTA 4WC0A 4UAWA 5BPCA 2HHPA 4AT9B 4WC4A 4I29A 2GAFD 4QZ9A 8ICJA 1MQ3A 5HR9A 2DR8A 4M9NA 3OVAA 4TUSA 8ICFA 3OWGA 5D49A 2BCSA 1JQRA 7ICLA 4F5RA 3OUYA 4M2YA 1TVAA 1ZQBA 2BPFA 3H38A 4X4QA 9ICFA 3WFQE 4NXXA 8ICCA 7ICHA 7ICVA 4O67A 2BCRA 4Z6FA 4XJEA 4QZDA 4I2FA 4NY8A 4OAGA 4K4GA 5D63A 4KLLA 4FHWA 4X4OA 4MFFA 8ICVA 4NXUA 1ZQDA 4NM2A 5CFTA 9ICEA 1PX5A 4K9AA 8ICPA 2ISOA 2ZH5A 4YD2A 4WC1A 7ICRA 5J2EA 1ZQCA 9ICSA 4QZFA 4YMNA 4PH5A 2P66A 4P4MA 3ER8C 8ICRA 8ICIA 4QZCA 9ICLA 4I0UA 5D62A 3RJHA 3JPOA 4FH5A 4X4RA 3AU2A 4QZAA 7ICFA 4F5QA 4I27A 5J2CA 2PFPA 4X4SA 4LEWA 1BPXA 4I2AA 1UETA 5J2AA 5HHHA 4K4IA 5HREA 8ICGA 3V7KA 8ICXA 4KLEA 3C2LA 1MIWA 1ZQUA 8ICEA 5HRFA 4DO9A 1ZQHA 4NXTA 4EBJA 4RQ6A 5J0QA 4LVSA 2B56A 7ICQA 4LT6A 5CWRA 3AQKA 3CK6A 4EP7A 4K97A 3K75D 2ZHBA 1NOMA 4WCWA 2BE3A 5DBBA 2IUBA 4NXVA 3JCFA 5IIJA 3RJKA 3L9DA 3JPRA 4KLTA 5HRLA 5CB1A 2NRKA 9ICQA 3EF2A 3H37A 4WC2A 7ICOA 1XSLA 1KEJA 4PHPA 1JN3A 3WFPA 4AT7A 4LEVA 4S3NA 4IQUA 3RH5A 2ZH4A 1MQ2A 3ISCA 4QZHA 4JLZA 8ICAA 2DRAA 4FHXA 3GDXA 3MDAA 4TUPA 5HRBA 3JPSA 4K99A 1FA0A 5CFUA 9ICXA 1ZQZA 1MIVA 1ZQPA 4R65A 5J2JA 4XQ8A 4LEZA 1BPDA 4Z6CA 4UB5A 2BBJA 3OVBA 7ICPA 3OUYB 2ZH3A 1R89A 1ZQRA 2W9MA 5D61A 4KLQA 5J2DA 2ZH9A 4QZBA 4F5OA 1ZQJA 2PFOA 8ICMA 5J0RA 4R66A 3NVOA 4TURA 5IILA 2ZHAA 1Q78A 1R8CA 4X4UA 4RWNA 5D46A 4IG8A 4NKUA 4N7RA 3RJJA 2HN2A 4X5VA 5IIOA 2Q66A 3B0YA 4K98A 4I2IA 2ID1A 4RPYA 4K8VA 3AQNA 4ATBA 8ICKA 3UXOA 2FMQA 9ICWA 4XQ7A 4I2EA 2DR5A 8ICQA 1TV9A 9ICOA 4KLGA 4RQ5A 1ZQGA 4JWMA 1YLQA 4EBKA 4QZIA 2BCQA 3TFRA 4NLNA 4OAFA 3NYBA 5DDYA 4UB4A 7ICEA 4M9LA 3UPSA 3HJ4A 4NKTA 4I2CA 4M9JA 4KLJA 3V72A 4UAZA 4LZGA 3AQLA 4O68A 5J0SA 5DBCA 3C2MA 9ICBA 2ZH6A 1VJ7A 4QZ8A 2DR9A 1VFGA 4RPZA 1TFWA 5DB9A 4KLMA 3UPQA 1ZQOA 3AU6A 4WC7A 8ICYA 9ICTA 9ICCA 3H39A 4UB2A 2DR7A 9ICGA 1ZQEA 8ICLA 1UEVA 1V4AA 4RT2A 5DB6A 4UAYA 4WH5A 4LEYA 4AT7B 4EEBA 3HW8A 4AT8A 4P4OA 3OV7A 4M0AA 5J2FA 4X0AA 3ISBA 4RQ8A 4DOBA 2FMPA 7ICUA 5J2GA 3PMLA 1TFYA 3MDCA 3JPPA 4P2HA 5B3QA 5HHIA 1ZQYA 4R64A 4PHDA 4NXZA 4MFAA 9ICPA 4M9GA 4WQKA 5HRIA 1ZJNA 2IHMA 4FHVA 1F5AA 4XUSA 1HUZA 1GPJA 2O1PA 5J29A 4O5EA 3C5FA 1ZQVA 4TUQA 4KLUA 4QZEA 4XA5A 5CHGA 4LZDA 1MIYA 4NXWA 3V7LA 5J0WA 4FO6A 4WBYA 4EV6A 2IHOA 4HX0A 4RQ7A 2B4VA 5JTGA 4KLSA 4R63A 3AUOA 4WC6A 4KM5A 1WOTA 4RQ3A 5J0UA 2PFNA 4X0BA 7ICSA 5J0OA 4NLKA 4M5DA 5BOMA 3HIYA 4XRHA 1ZQKA 2ZH1A 4YMOA 4ATBB 4UB3A 3RH4A 4X4VA 5HC9A 3C66A 4I2DA 4IQWA 4WBZA 1XSNA 9ICMA 3TFSA 5CJ7A 3UQ0A 7ICNA 2ZH7A 2EWRA 4JWNA 4M04A 4QZGA 8ICTA 3C2KA 3WFOA 4E7XA 2VANA 7ICJA 8ICNA 2B51A 5IIIA 8ICBA 4MKPA 2ISPA 4KLDA 4MF8A 7ICMA 1ZQSA 4E8FA 8ICWA 1XSPA 1BPBA 4KLIA 4IQVA 1ZQMA 2BCVA 5HRDA 2GWSA 3WFSC 9ICKA 4I2HA 3B0XA 3LK9A 4M47A 9ICHA 3NKUA 3RH6A 1UEUA 4RWQA 1KDHA 3JPNA 1JAJA 9ICNA 2PBEA 3NWIA 4E80A 5J2BA 4MFCA 7ICKA 1NO5A 2M2WA 2BBHA 5CP2A 3ISDA 7ICGA 3OVSA 9ICAA 4NLZA 4NM1A 5HRKA 4WC3A 3MBYA 8ICHA 3V7JA 5B3PA 3RJFA 9ICUA 3RJGA 4O5CA 3HX0A 2PFQA 5TZVA 4X4TA 3JYYA 1ZQQA 4O5KA 1R8BA 2GA9D 4AT8B 4M9HA 4Z6DA 4RQ2A 4KLHA 3K7DA 8ICSA 1ZQNA 5J2KA 4I2BA 3LQCB 1ZQTA 5CR0A 4KB6A 4AT9A 3ER9B 1BPEA 8ICOA 4K96A 4KLFA 4I2GA 1ZQXA 5DB8A 2ZH2A 1ZQLA 4I2JA 4PHAA 4X4PA 4P4PA 1ZQWA 4GXKA 4EGWA 7ICTA 2M2VA 5J0PA 5EOZA 3JPQA 5IINA 5BOLA 4O6AA 2I9GA 4FHYA 5J0YA 4RQ0A 4F5PA 5DBAA 4GXIA 3WFRE 4UB1A 4FHPA 5DDMA 4PGQA 4PHEA 2M2TA 4YN4A 2BPCA 5HRGA 4PGYA 4YMMA 1BPZA 1R8AA 4K9BA 9ICJA 4DOCA 4IQTA 5HRHA 2BPGA 5J0XA 1JMSA 3MGIA 4WQLA 4RQ1A 4GXJA 4RQ4A 4WC5A 3C18A 4WOYA 4YD1A 3UXPA 4X4NA 1BPYA 4PGXA 4UD5A 3H3AA 3C5GA 4F5NA 4KLOA 5J0TA 4MF2A 1RZTA 9ICVA 1HUOA 4K4HA 3MGHA 5DKWA 4RPXA 2ZH8A 4OAHA 4UBCA 1ZJMA 9ICIA 4OAIZ 4PPXA 2M2UA 4DOAA 3MCRA 2DVIA 4FO1A 5DEDA 3RJEA 3HJ1A 3PHZA 4UD4A 4UBBA 5CFSA 4RT3A 2FCLA 9ICRA
chains in the Genus database with same CATH topology
1KNYA 2RFFA 3PNCA 1ZQFA 3UQ2A 1RPLA 1ZQIA 3UXNA 8ICZA 2FMSA 4FH3A 1OU5A 5J2HA 4O69A 3PMNA 2O5AA 5DB7A 5CA7A 8ICUA 4O9MA 5J2IA 1Q79A 5DECA 3AQMA 2BCUA 4RWPA 1ZQAA 4RWOA 4I28A 5IIKA 2DRBA 4JLXA 5IIMA 3OGUA 3JZ0A 3RJIA 2PXIA 5F2VO 7ICIA 3JPTA 4YCXA 5D4BA 4Z6EA 3HWTA 4WC0A 4UAWA 5BPCA 2HHPA 4AT9B 4WC4A 4I29A 4QZ9A 8ICJA 1MQ3A 5HR9A 2DR8A 4M9NA 3OVAA 4TUSA 8ICFA 5D49A 2BCSA 1JQRA 7ICLA 4F5RA 3OUYA 4M2YA 1TVAA 1ZQBA 2BPFA 3H38A 4X4QA 9ICFA 3WFQE 4NXXA 8ICCA 7ICHA 7ICVA 4O67A 2BCRA 4Z6FA 4QZDA 4I2FA 4NY8A 4OAGA 4K4GA 4KLLA 4FHWA 4X4OA 4MFFA 8ICVA 4NXUA 1ZQDA 4NM2A 9ICEA 1PX5A 4K9AA 8ICPA 2ISOA 2ZH5A 4YD2A 4WC1A 7ICRA 5J2EA 1ZQCA 9ICSA 4QZFA 4YMNA 4PH5A 2P66A 4P4MA 8ICRA 8ICIA 4QZCA 9ICLA 3RJHA 3JPOA 4FH5A 4X4RA 3AU2A 4QZAA 7ICFA 4F5QA 4I27A 5J2CA 2PFPA 4X4SA 4LEWA 1BPXA 4I2AA 1UETA 5J2AA 5HHHA 4K4IA 5HREA 8ICGA 3V7KA 8ICXA 4KLEA 3C2LA 1MIWA 1ZQUA 8ICEA 5HRFA 4DO9A 1ZQHA 4NXTA 4EBJA 4RQ6A 5J0QA 4LVSA 2B56A 7ICQA 4LT6A 5CWRA 3AQKA 4EP7A 4K97A 3K75D 2ZHBA 1NOMA 4WCWA 2BE3A 5DBBA 4NXVA 5IIJA 3RJKA 3L9DA 3JPRA 4KLTA 5HRLA 5CB1A 2NRKA 9ICQA 3H37A 4WC2A 7ICOA 1XSLA 1KEJA 4PHPA 1JN3A 3WFPA 4AT7A 4LEVA 4IQUA 4S3NA 3RH5A 2ZH4A 1MQ2A 3ISCA 4QZHA 4JLZA 8ICAA 2DRAA 4FHXA 3GDXA 3MDAA 4TUPA 5HRBA 3JPSA 4K99A 1FA0A 9ICXA 1ZQZA 1MIVA 1ZQPA 4R65A 5J2JA 4XQ8A 4LEZA 1BPDA 4Z6CA 4UB5A 3OVBA 7ICPA 3OUYB 2ZH3A 1R89A 1ZQRA 2W9MA 4KLQA 5J2DA 2ZH9A 4QZBA 4F5OA 1ZQJA 2PFOA 8ICMA 5J0RA 4R66A 4TURA 5IILA 2ZHAA 1Q78A 1R8CA 4X4UA 4RWNA 5D46A 4IG8A 4NKUA 3RJJA 4X5VA 5IIOA 2Q66A 3B0YA 4K98A 4I2IA 2ID1A 4RPYA 4K8VA 3AQNA 4ATBA 8ICKA 3UXOA 2FMQA 9ICWA 4XQ7A 4I2EA 2DR5A 8ICQA 1TV9A 9ICOA 4KLGA 4RQ5A 1ZQGA 4JWMA 1YLQA 4EBKA 4QZIA 2BCQA 3TFRA 4NLNA 4OAFA 3NYBA 5DDYA 4UB4A 7ICEA 4M9LA 3UPSA 3HJ4A 4NKTA 4I2CA 4M9JA 4KLJA 3V72A 4UAZA 4LZGA 3AQLA 4O68A 5J0SA 5DBCA 3C2MA 9ICBA 2ZH6A 1VJ7A 4QZ8A 2DR9A 1VFGA 4RPZA 1TFWA 5DB9A 4KLMA 3UPQA 1ZQOA 3AU6A 4WC7A 8ICYA 9ICTA 9ICCA 3H39A 4UB2A 2DR7A 9ICGA 1ZQEA 8ICLA 1UEVA 1V4AA 4RT2A 5DB6A 4UAYA 4LEYA 4AT7B 3HW8A 4AT8A 4P4OA 3OV7A 4M0AA 5J2FA 4X0AA 3ISBA 4RQ8A 4DOBA 2FMPA 7ICUA 5J2GA 3PMLA 1TFYA 3MDCA 3JPPA 4P2HA 5HHIA 1ZQYA 4R64A 4PHDA 4NXZA 4MFAA 9ICPA 4M9GA 5HRIA 1ZJNA 2IHMA 4FHVA 1F5AA 4XUSA 1HUZA 2O1PA 5J29A 4O5EA 3C5FA 1ZQVA 4TUQA 4KLUA 4QZEA 4XA5A 5CHGA 4LZDA 1MIYA 4NXWA 3V7LA 5J0WA 4FO6A 4WBYA 4RQ7A 2B4VA 4KLSA 4R63A 3AUOA 4WC6A 4KM5A 1WOTA 4RQ3A 5J0UA 2PFNA 4X0BA 7ICSA 5J0OA 4NLKA 4M5DA 5BOMA 3HIYA 4XRHA 1ZQKA 2ZH1A 4YMOA 4ATBB 4UB3A 3RH4A 4X4VA 5HC9A 3C66A 4I2DA 4IQWA 4WBZA 1XSNA 9ICMA 3TFSA 5CJ7A 3UQ0A 7ICNA 2ZH7A 4JWNA 4M04A 4QZGA 8ICTA 3C2KA 3WFOA 4E7XA 2VANA 7ICJA 8ICNA 2B51A 5IIIA 8ICBA 4MKPA 2ISPA 4KLDA 4MF8A 7ICMA 1ZQSA 4E8FA 8ICWA 1XSPA 1BPBA 4KLIA 4IQVA 1ZQMA 2BCVA 5HRDA 2GWSA 3WFSC 9ICKA 4I2HA 3B0XA 3LK9A 4M47A 9ICHA 3RH6A 1UEUA 4RWQA 1KDHA 3JPNA 1JAJA 9ICNA 2PBEA 4E80A 5J2BA 4MFCA 7ICKA 1NO5A 2M2WA 5CP2A 3ISDA 7ICGA 3OVSA 9ICAA 4NLZA 4NM1A 5HRKA 4WC3A 3MBYA 8ICHA 3V7JA 3RJFA 9ICUA 3RJGA 4O5CA 3HX0A 2PFQA 5TZVA 4X4TA 3JYYA 1ZQQA 4O5KA 1R8BA 4AT8B 4M9HA 4Z6DA 4RQ2A 4KLHA 8ICSA 1ZQNA 5J2KA 4I2BA 3LQCB 1ZQTA 5CR0A 4KB6A 4AT9A 1BPEA 8ICOA 4K96A 4KLFA 4I2GA 1ZQXA 5DB8A 2ZH2A 1ZQLA 4I2JA 4PHAA 4X4PA 4P4PA 1ZQWA 4GXKA 7ICTA 2M2VA 5J0PA 5EOZA 3JPQA 5IINA 5BOLA 4O6AA 2I9GA 4FHYA 5J0YA 4RQ0A 4F5PA 5DBAA 4GXIA 3WFRE 4UB1A 4FHPA 5DDMA 4PGQA 4PHEA 2M2TA 4YN4A 2BPCA 5HRGA 4PGYA 4YMMA 1BPZA 1R8AA 4K9BA 9ICJA 4DOCA 4IQTA 5HRHA 2BPGA 5J0XA 1JMSA 3MGIA 4RQ1A 4GXJA 4RQ4A 4WC5A 3C18A 4WOYA 4YD1A 3UXPA 4X4NA 1BPYA 4PGXA 4UD5A 3H3AA 3C5GA 4F5NA 4KLOA 5J0TA 4MF2A 1RZTA 9ICVA 1HUOA 4K4HA 3MGHA 5DKWA 4RPXA 2ZH8A 4OAHA 4UBCA 1ZJMA 9ICIA 4OAIZ 4PPXA 2M2UA 4DOAA 2DVIA 3RJEA 5DEDA 3HJ1A 4UD4A 4UBBA 4RT3A 9ICRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNY A;  2RFF A;  3PNC A;  1ZQF A;  3UQ2 A;  1RPL A;  1ZQI A;  3UXN A;  8ICZ A;  2FMS A;  4FH3 A;  1OU5 A;  5J2H A;  4O69 A;  3PMN A;  2O5A A;  5DB7 A;  5CA7 A;  8ICU A;  4O9M A;  5J2I A;  1Q79 A;  5DEC A;  3AQM A;  2BCU A;  4RWP A;  1ZQA A;  4RWO A;  4I28 A;  5IIK A;  2DRB A;  4JLX A;  5IIM A;  3OGU A;  3JZ0 A;  3RJI A;  2PXI A;  5F2V O;  7ICI A;  3JPT A;  4YCX A;  5D4B A;  4Z6E A;  3HWT A;  4WC0 A;  4UAW A;  5BPC A;  2HHP A;  4AT9 B;  4WC4 A;  4I29 A;  4QZ9 A;  8ICJ A;  1MQ3 A;  5HR9 A;  2DR8 A;  4M9N A;  3OVA A;  4TUS A;  8ICF A;  5D49 A;  2BCS A;  1JQR A;  7ICL A;  4F5R A;  3OUY A;  4M2Y A;  1TVA A;  1ZQB A;  2BPF A;  3H38 A;  4X4Q A;  9ICF A;  3WFQ E;  4NXX A;  8ICC A;  7ICH A;  7ICV A;  4O67 A;  2BCR A;  4Z6F A;  4QZD A;  4I2F A;  4NY8 A;  4OAG A;  4K4G A;  4KLL A;  4FHW A;  4X4O A;  4MFF A;  8ICV A;  4NXU A;  1ZQD A;  4NM2 A;  9ICE A;  1PX5 A;  4K9A A;  8ICP A;  2ISO A;  2ZH5 A;  4YD2 A;  4WC1 A;  7ICR A;  5J2E A;  1ZQC A;  9ICS A;  4QZF A;  4YMN A;  4PH5 A;  2P66 A;  4P4M A;  8ICR A;  8ICI A;  4QZC A;  9ICL A;  3RJH A;  3JPO A;  4FH5 A;  3AU2 A;  4QZA A;  4X4R A;  7ICF A;  4F5Q A;  4I27 A;  5J2C A;  2PFP A;  4X4S A;  4LEW A;  1BPX A;  4I2A A;  1UET A;  5J2A A;  5HHH A;  4K4I A;  5HRE A;  8ICG A;  3V7K A;  8ICX A;  4KLE A;  3C2L A;  1MIW A;  1ZQU A;  8ICE A;  5HRF A;  4DO9 A;  1ZQH A;  4NXT A;  4EBJ A;  4RQ6 A;  5J0Q A;  4LVS A;  7ICQ A;  4LT6 A;  5CWR A;  3AQK A;  4EP7 A;  4K97 A;  3K75 D;  2ZHB A;  1NOM A;  4WCW A;  2BE3 A;  5DBB A;  4NXV A;  5IIJ A;  3RJK A;  3L9D A;  3JPR A;  4KLT A;  5HRL A;  5CB1 A;  2NRK A;  9ICQ A;  3H37 A;  4WC2 A;  7ICO A;  1XSL A;  1KEJ A;  4PHP A;  1JN3 A;  3WFP A;  4AT7 A;  4LEV A;  4IQU A;  4S3N A;  3RH5 A;  2ZH4 A;  1MQ2 A;  3ISC A;  4QZH A;  4JLZ A;  8ICA A;  2DRA A;  4FHX A;  3GDX A;  3MDA A;  4TUP A;  5HRB A;  3JPS A;  4K99 A;  1FA0 A;  9ICX A;  1ZQZ A;  1MIV A;  1ZQP A;  4R65 A;  5J2J A;  4XQ8 A;  4LEZ A;  1BPD A;  4Z6C A;  4UB5 A;  3OVB A;  7ICP A;  3OUY B;  2ZH3 A;  1R89 A;  1ZQR A;  2W9M A;  4KLQ A;  5J2D A;  2ZH9 A;  4QZB A;  4F5O A;  1ZQJ A;  2PFO A;  8ICM A;  5J0R A;  4R66 A;  4TUR A;  5IIL A;  2ZHA A;  1Q78 A;  1R8C A;  4X4U A;  4RWN A;  5D46 A;  4IG8 A;  4NKU A;  3RJJ A;  4X5V A;  5IIO A;  2Q66 A;  3B0Y A;  4K98 A;  4I2I A;  2ID1 A;  4RPY A;  4K8V A;  3AQN A;  4ATB A;  8ICK A;  3UXO A;  2FMQ A;  9ICW A;  4XQ7 A;  4I2E A;  2DR5 A;  8ICQ A;  1TV9 A;  9ICO A;  4KLG A;  4RQ5 A;  1ZQG A;  4JWM A;  1YLQ A;  4EBK A;  4QZI A;  2BCQ A;  3TFR A;  4NLN A;  4OAF A;  3NYB A;  5DDY A;  4UB4 A;  7ICE A;  4M9L A;  3UPS A;  3HJ4 A;  4NKT A;  4I2C A;  4M9J A;  4KLJ A;  3V72 A;  4UAZ A;  4LZG A;  3AQL A;  4O68 A;  5J0S A;  5DBC A;  3C2M A;  9ICB A;  2ZH6 A;  1VJ7 A;  4QZ8 A;  2DR9 A;  1VFG A;  4RPZ A;  1TFW A;  5DB9 A;  4KLM A;  3UPQ A;  1ZQO A;  3AU6 A;  4WC7 A;  8ICY A;  9ICT A;  9ICC A;  3H39 A;  4UB2 A;  2DR7 A;  9ICG A;  1ZQE A;  8ICL A;  1UEV A;  1V4A A;  4RT2 A;  5DB6 A;  4UAY A;  4LEY A;  4AT7 B;  3HW8 A;  4AT8 A;  4P4O A;  3OV7 A;  4M0A A;  5J2F A;  4X0A A;  3ISB A;  4RQ8 A;  4DOB A;  2FMP A;  7ICU A;  5J2G A;  3PML A;  3MDC A;  1TFY A;  3JPP A;  4P2H A;  5HHI A;  1ZQY A;  4R64 A;  4PHD A;  4NXZ A;  4MFA A;  9ICP A;  4M9G A;  5HRI A;  1ZJN A;  2IHM A;  4FHV A;  1F5A A;  4XUS A;  1HUZ A;  2O1P A;  5J29 A;  4O5E A;  3C5F A;  1ZQV A;  4TUQ A;  4KLU A;  4QZE A;  4XA5 A;  5CHG A;  4LZD A;  1MIY A;  4NXW A;  3V7L A;  5J0W A;  4FO6 A;  4WBY A;  4RQ7 A;  4KLS A;  4R63 A;  3AUO A;  4WC6 A;  4KM5 A;  1WOT A;  4RQ3 A;  5J0U A;  2PFN A;  4X0B A;  7ICS A;  5J0O A;  4NLK A;  4M5D A;  5BOM A;  3HIY A;  4XRH A;  1ZQK A;  4YMO A;  2ZH1 A;  4ATB B;  4UB3 A;  3RH4 A;  4X4V A;  5HC9 A;  3C66 A;  4I2D A;  4IQW A;  4WBZ A;  1XSN A;  9ICM A;  3TFS A;  5CJ7 A;  3UQ0 A;  7ICN A;  2ZH7 A;  4JWN A;  4M04 A;  4QZG A;  8ICT A;  3C2K A;  3WFO A;  4E7X A;  2VAN A;  7ICJ A;  8ICN A;  5III A;  8ICB A;  4MKP A;  2ISP A;  4KLD A;  4MF8 A;  7ICM A;  1ZQS A;  4E8F A;  8ICW A;  1XSP A;  1BPB A;  4KLI A;  4IQV A;  1ZQM A;  2BCV A;  5HRD A;  2GWS A;  3WFS C;  9ICK A;  4I2H A;  3B0X A;  3LK9 A;  4M47 A;  9ICH A;  3RH6 A;  1UEU A;  4RWQ A;  1KDH A;  3JPN A;  1JAJ A;  9ICN A;  2PBE A;  4E80 A;  5J2B A;  4MFC A;  7ICK A;  1NO5 A;  2M2W A;  5CP2 A;  3ISD A;  7ICG A;  3OVS A;  9ICA A;  4NLZ A;  4NM1 A;  5HRK A;  4WC3 A;  3MBY A;  8ICH A;  3V7J A;  3RJF A;  9ICU A;  3RJG A;  4O5C A;  3HX0 A;  2PFQ A;  5TZV A;  4X4T A;  3JYY A;  1ZQQ A;  4O5K A;  1R8B A;  4AT8 B;  4M9H A;  4Z6D A;  4RQ2 A;  4KLH A;  8ICS A;  1ZQN A;  5J2K A;  4I2B A;  3LQC B;  1ZQT A;  5CR0 A;  4KB6 A;  4AT9 A;  1BPE A;  8ICO A;  4K96 A;  4KLF A;  4I2G A;  1ZQX A;  5DB8 A;  2ZH2 A;  1ZQL A;  4I2J A;  4PHA A;  4X4P A;  4P4P A;  1ZQW A;  4GXK A;  7ICT A;  2M2V A;  5J0P A;  5EOZ A;  3JPQ A;  5IIN A;  5BOL A;  4O6A A;  2I9G A;  4FHY A;  5J0Y A;  4RQ0 A;  4F5P A;  5DBA A;  4GXI A;  3WFR E;  4UB1 A;  4FHP A;  5DDM A;  4PGQ A;  4PHE A;  2M2T A;  4YN4 A;  2BPC A;  5HRG A;  4PGY A;  4YMM A;  1BPZ A;  4K9B A;  1R8A A;  9ICJ A;  4DOC A;  4IQT A;  5HRH A;  2BPG A;  5J0X A;  1JMS A;  3MGI A;  4RQ1 A;  4GXJ A;  4RQ4 A;  4WC5 A;  3C18 A;  4WOY A;  4YD1 A;  3UXP A;  4X4N A;  1BPY A;  4PGX A;  4UD5 A;  3H3A A;  3C5G A;  4F5N A;  4KLO A;  5J0T A;  4MF2 A;  1RZT A;  9ICV A;  1HUO A;  4K4H A;  3MGH A;  5DKW A;  4RPX A;  4UBC A;  4OAH A;  2ZH8 A;  1ZJM A;  9ICI A;  4OAI Z;  4PPX A;  2M2U A;  4DOA A;  2DVI A;  3RJE A;  5DED A;  3HJ1 A;  4UD4 A;  4UBB A;  4RT3 A;  9ICR A; 
#chains in the Genus database with same CATH topology
 1KNY A;  2RFF A;  3PNC A;  5CHE A;  4EED A;  1ZQF A;  3UQ2 A;  1RPL A;  1ZQI A;  3UXN A;  8ICZ A;  2FMS A;  4FH3 A;  1OU5 A;  5J2H A;  4O69 A;  3PMN A;  2O5A A;  3ERC C;  5DB7 A;  5CA7 A;  8ICU A;  4O9M A;  5J2I A;  1Q79 A;  5DEC A;  3AQM A;  2BCU A;  4RWP A;  1ZQA A;  4RWO A;  4I28 A;  5IIK A;  2DRB A;  4JLX A;  5IIM A;  3OGU A;  3JZ0 A;  3RJI A;  2PXI A;  5F2V O;  7ICI A;  3JPT A;  4YCX A;  2HN1 A;  5D4B A;  4Z6E A;  3HWT A;  4WC0 A;  4UAW A;  5BPC A;  2HHP A;  4AT9 B;  4WC4 A;  4I29 A;  2GAF D;  4QZ9 A;  8ICJ A;  1MQ3 A;  5HR9 A;  2DR8 A;  4M9N A;  3OVA A;  4TUS A;  8ICF A;  3OWG A;  5D49 A;  2BCS A;  1JQR A;  7ICL A;  4F5R A;  3OUY A;  4M2Y A;  1TVA A;  1ZQB A;  2BPF A;  3H38 A;  4X4Q A;  9ICF A;  3WFQ E;  4NXX A;  8ICC A;  7ICH A;  7ICV A;  4O67 A;  2BCR A;  4Z6F A;  4XJE A;  4QZD A;  4I2F A;  4NY8 A;  4OAG A;  4K4G A;  5D63 A;  4KLL A;  4FHW A;  4X4O A;  4MFF A;  8ICV A;  4NXU A;  1ZQD A;  4NM2 A;  5CFT A;  9ICE A;  1PX5 A;  4K9A A;  8ICP A;  2ISO A;  2ZH5 A;  4YD2 A;  4WC1 A;  7ICR A;  5J2E A;  1ZQC A;  9ICS A;  4QZF A;  4YMN A;  4PH5 A;  2P66 A;  4P4M A;  3ER8 C;  8ICR A;  8ICI A;  4QZC A;  9ICL A;  4I0U A;  5D62 A;  3RJH A;  3JPO A;  4FH5 A;  4X4R A;  3AU2 A;  4QZA A;  7ICF A;  4F5Q A;  4I27 A;  5J2C A;  2PFP A;  4X4S A;  4LEW A;  1BPX A;  4I2A A;  1UET A;  5J2A A;  5HHH A;  4K4I A;  5HRE A;  8ICG A;  3V7K A;  8ICX A;  4KLE A;  3C2L A;  1MIW A;  1ZQU A;  8ICE A;  5HRF A;  4DO9 A;  1ZQH A;  4NXT A;  4EBJ A;  4RQ6 A;  5J0Q A;  4LVS A;  2B56 A;  7ICQ A;  4LT6 A;  5CWR A;  3AQK A;  3CK6 A;  4EP7 A;  4K97 A;  3K75 D;  2ZHB A;  1NOM A;  4WCW A;  2BE3 A;  5DBB A;  2IUB A;  4NXV A;  3JCF A;  5IIJ A;  3RJK A;  3L9D A;  3JPR A;  4KLT A;  5HRL A;  5CB1 A;  2NRK A;  9ICQ A;  3EF2 A;  3H37 A;  4WC2 A;  7ICO A;  1XSL A;  1KEJ A;  4PHP A;  1JN3 A;  3WFP A;  4AT7 A;  4LEV A;  4S3N A;  4IQU A;  3RH5 A;  2ZH4 A;  1MQ2 A;  3ISC A;  4QZH A;  4JLZ A;  8ICA A;  2DRA A;  4FHX A;  3GDX A;  3MDA A;  4TUP A;  5HRB A;  3JPS A;  4K99 A;  1FA0 A;  5CFU A;  9ICX A;  1ZQZ A;  1MIV A;  1ZQP A;  4R65 A;  5J2J A;  4XQ8 A;  4LEZ A;  1BPD A;  4Z6C A;  4UB5 A;  2BBJ A;  3OVB A;  7ICP A;  3OUY B;  2ZH3 A;  1R89 A;  1ZQR A;  2W9M A;  5D61 A;  4KLQ A;  5J2D A;  2ZH9 A;  4QZB A;  4F5O A;  1ZQJ A;  2PFO A;  8ICM A;  5J0R A;  4R66 A;  3NVO A;  4TUR A;  5IIL A;  2ZHA A;  1Q78 A;  1R8C A;  4X4U A;  4RWN A;  5D46 A;  4IG8 A;  4NKU A;  4N7R A;  3RJJ A;  2HN2 A;  4X5V A;  5IIO A;  2Q66 A;  3B0Y A;  4K98 A;  4I2I A;  2ID1 A;  4RPY A;  4K8V A;  3AQN A;  4ATB A;  8ICK A;  3UXO A;  2FMQ A;  9ICW A;  4XQ7 A;  4I2E A;  2DR5 A;  8ICQ A;  1TV9 A;  9ICO A;  4KLG A;  4RQ5 A;  1ZQG A;  4JWM A;  1YLQ A;  4EBK A;  4QZI A;  2BCQ A;  3TFR A;  4NLN A;  4OAF A;  3NYB A;  5DDY A;  4UB4 A;  7ICE A;  4M9L A;  3UPS A;  3HJ4 A;  4NKT A;  4I2C A;  4M9J A;  4KLJ A;  3V72 A;  4UAZ A;  4LZG A;  3AQL A;  4O68 A;  5J0S A;  5DBC A;  3C2M A;  9ICB A;  2ZH6 A;  1VJ7 A;  4QZ8 A;  2DR9 A;  1VFG A;  4RPZ A;  1TFW A;  5DB9 A;  4KLM A;  3UPQ A;  1ZQO A;  3AU6 A;  4WC7 A;  8ICY A;  9ICT A;  9ICC A;  3H39 A;  4UB2 A;  2DR7 A;  9ICG A;  1ZQE A;  8ICL A;  1UEV A;  1V4A A;  4RT2 A;  5DB6 A;  4UAY A;  4WH5 A;  4LEY A;  4AT7 B;  4EEB A;  3HW8 A;  4AT8 A;  4P4O A;  3OV7 A;  4M0A A;  5J2F A;  4X0A A;  3ISB A;  4RQ8 A;  4DOB A;  2FMP A;  7ICU A;  5J2G A;  3PML A;  1TFY A;  3MDC A;  3JPP A;  4P2H A;  5B3Q A;  5HHI A;  1ZQY A;  4R64 A;  4PHD A;  4NXZ A;  4MFA A;  9ICP A;  4M9G A;  4WQK A;  5HRI A;  1ZJN A;  2IHM A;  4FHV A;  1F5A A;  4XUS A;  1HUZ A;  1GPJ A;  2O1P A;  5J29 A;  4O5E A;  3C5F A;  1ZQV A;  4TUQ A;  4KLU A;  4QZE A;  4XA5 A;  5CHG A;  4LZD A;  1MIY A;  4NXW A;  3V7L A;  5J0W A;  4FO6 A;  4WBY A;  4EV6 A;  2IHO A;  4HX0 A;  4RQ7 A;  2B4V A;  5JTG A;  4KLS A;  4R63 A;  3AUO A;  4WC6 A;  4KM5 A;  1WOT A;  4RQ3 A;  5J0U A;  2PFN A;  4X0B A;  7ICS A;  5J0O A;  4NLK A;  4M5D A;  5BOM A;  3HIY A;  4XRH A;  1ZQK A;  2ZH1 A;  4YMO A;  4ATB B;  4UB3 A;  3RH4 A;  4X4V A;  5HC9 A;  3C66 A;  4I2D A;  4IQW A;  4WBZ A;  1XSN A;  9ICM A;  3TFS A;  5CJ7 A;  3UQ0 A;  7ICN A;  2ZH7 A;  2EWR A;  4JWN A;  4M04 A;  4QZG A;  8ICT A;  3C2K A;  3WFO A;  4E7X A;  2VAN A;  7ICJ A;  8ICN A;  2B51 A;  5III A;  8ICB A;  4MKP A;  2ISP A;  4KLD A;  4MF8 A;  7ICM A;  1ZQS A;  4E8F A;  8ICW A;  1XSP A;  1BPB A;  4KLI A;  4IQV A;  1ZQM A;  2BCV A;  5HRD A;  2GWS A;  3WFS C;  9ICK A;  4I2H A;  3B0X A;  3LK9 A;  4M47 A;  9ICH A;  3NKU A;  3RH6 A;  1UEU A;  4RWQ A;  1KDH A;  3JPN A;  1JAJ A;  9ICN A;  2PBE A;  3NWI A;  4E80 A;  5J2B A;  4MFC A;  7ICK A;  1NO5 A;  2M2W A;  2BBH A;  5CP2 A;  3ISD A;  7ICG A;  3OVS A;  9ICA A;  4NLZ A;  4NM1 A;  5HRK A;  4WC3 A;  3MBY A;  8ICH A;  3V7J A;  5B3P A;  3RJF A;  9ICU A;  3RJG A;  4O5C A;  3HX0 A;  2PFQ A;  5TZV A;  4X4T A;  3JYY A;  1ZQQ A;  4O5K A;  1R8B A;  2GA9 D;  4AT8 B;  4M9H A;  4Z6D A;  4RQ2 A;  4KLH A;  3K7D A;  8ICS A;  1ZQN A;  5J2K A;  4I2B A;  3LQC B;  1ZQT A;  5CR0 A;  4KB6 A;  4AT9 A;  3ER9 B;  1BPE A;  8ICO A;  4K96 A;  4KLF A;  4I2G A;  1ZQX A;  5DB8 A;  2ZH2 A;  1ZQL A;  4I2J A;  4PHA A;  4X4P A;  4P4P A;  1ZQW A;  4GXK A;  4EGW A;  7ICT A;  2M2V A;  5J0P A;  5EOZ A;  3JPQ A;  5IIN A;  5BOL A;  4O6A A;  2I9G A;  4FHY A;  5J0Y A;  4RQ0 A;  4F5P A;  5DBA A;  4GXI A;  3WFR E;  4UB1 A;  4FHP A;  5DDM A;  4PGQ A;  4PHE A;  2M2T A;  4YN4 A;  2BPC A;  5HRG A;  4PGY A;  4YMM A;  1BPZ A;  1R8A A;  4K9B A;  9ICJ A;  4DOC A;  4IQT A;  5HRH A;  2BPG A;  5J0X A;  1JMS A;  3MGI A;  4WQL A;  4RQ1 A;  4GXJ A;  4RQ4 A;  4WC5 A;  3C18 A;  4WOY A;  4YD1 A;  3UXP A;  4X4N A;  1BPY A;  4PGX A;  4UD5 A;  3H3A A;  3C5G A;  4F5N A;  4KLO A;  5J0T A;  4MF2 A;  1RZT A;  9ICV A;  1HUO A;  4K4H A;  3MGH A;  5DKW A;  4RPX A;  2ZH8 A;  4OAH A;  4UBC A;  1ZJM A;  9ICI A;  4OAI Z;  4PPX A;  2M2U A;  4DOA A;  3MCR A;  2DVI A;  4FO1 A;  5DED A;  3RJE A;  3HJ1 A;  3PHZ A;  4UD4 A;  4UBB A;  5CFS A;  4RT3 A;  2FCL A;  9ICR A; 
#chains in the Genus database with same CATH homology
 1KNY A;  2RFF A;  3PNC A;  1ZQF A;  3UQ2 A;  1RPL A;  1ZQI A;  3UXN A;  8ICZ A;  2FMS A;  4FH3 A;  1OU5 A;  5J2H A;  4O69 A;  3PMN A;  2O5A A;  5DB7 A;  5CA7 A;  8ICU A;  4O9M A;  5J2I A;  1Q79 A;  5DEC A;  3AQM A;  2BCU A;  4RWP A;  1ZQA A;  4RWO A;  4I28 A;  5IIK A;  2DRB A;  4JLX A;  5IIM A;  3OGU A;  3JZ0 A;  3RJI A;  2PXI A;  5F2V O;  7ICI A;  3JPT A;  4YCX A;  5D4B A;  4Z6E A;  3HWT A;  4WC0 A;  4UAW A;  5BPC A;  2HHP A;  4AT9 B;  4WC4 A;  4I29 A;  4QZ9 A;  8ICJ A;  1MQ3 A;  5HR9 A;  2DR8 A;  4M9N A;  3OVA A;  4TUS A;  8ICF A;  5D49 A;  2BCS A;  1JQR A;  7ICL A;  4F5R A;  3OUY A;  4M2Y A;  1TVA A;  1ZQB A;  2BPF A;  3H38 A;  4X4Q A;  9ICF A;  3WFQ E;  4NXX A;  8ICC A;  7ICH A;  7ICV A;  4O67 A;  2BCR A;  4Z6F A;  4QZD A;  4I2F A;  4NY8 A;  4OAG A;  4K4G A;  4KLL A;  4FHW A;  4X4O A;  4MFF A;  8ICV A;  4NXU A;  1ZQD A;  4NM2 A;  9ICE A;  1PX5 A;  4K9A A;  8ICP A;  2ISO A;  2ZH5 A;  4YD2 A;  4WC1 A;  7ICR A;  5J2E A;  1ZQC A;  9ICS A;  4QZF A;  4YMN A;  4PH5 A;  2P66 A;  4P4M A;  8ICR A;  8ICI A;  4QZC A;  9ICL A;  3RJH A;  3JPO A;  4FH5 A;  4X4R A;  3AU2 A;  4QZA A;  7ICF A;  4F5Q A;  4I27 A;  5J2C A;  2PFP A;  4X4S A;  4LEW A;  1BPX A;  4I2A A;  1UET A;  5J2A A;  5HHH A;  4K4I A;  5HRE A;  8ICG A;  3V7K A;  8ICX A;  4KLE A;  3C2L A;  1MIW A;  1ZQU A;  8ICE A;  5HRF A;  4DO9 A;  1ZQH A;  4NXT A;  4EBJ A;  4RQ6 A;  5J0Q A;  4LVS A;  2B56 A;  7ICQ A;  4LT6 A;  5CWR A;  3AQK A;  4EP7 A;  4K97 A;  3K75 D;  2ZHB A;  1NOM A;  4WCW A;  2BE3 A;  5DBB A;  4NXV A;  5IIJ A;  3RJK A;  3L9D A;  3JPR A;  4KLT A;  5HRL A;  5CB1 A;  2NRK A;  9ICQ A;  3H37 A;  4WC2 A;  7ICO A;  1XSL A;  1KEJ A;  4PHP A;  1JN3 A;  3WFP A;  4AT7 A;  4LEV A;  4IQU A;  4S3N A;  3RH5 A;  2ZH4 A;  1MQ2 A;  3ISC A;  4QZH A;  4JLZ A;  8ICA A;  2DRA A;  4FHX A;  3GDX A;  3MDA A;  4TUP A;  5HRB A;  3JPS A;  4K99 A;  1FA0 A;  9ICX A;  1ZQZ A;  1MIV A;  1ZQP A;  4R65 A;  5J2J A;  4XQ8 A;  4LEZ A;  1BPD A;  4Z6C A;  4UB5 A;  3OVB A;  7ICP A;  3OUY B;  2ZH3 A;  1R89 A;  1ZQR A;  2W9M A;  4KLQ A;  5J2D A;  2ZH9 A;  4QZB A;  4F5O A;  1ZQJ A;  2PFO A;  8ICM A;  5J0R A;  4R66 A;  4TUR A;  5IIL A;  2ZHA A;  1Q78 A;  1R8C A;  4X4U A;  4RWN A;  5D46 A;  4IG8 A;  4NKU A;  3RJJ A;  4X5V A;  5IIO A;  2Q66 A;  3B0Y A;  4K98 A;  4I2I A;  2ID1 A;  4RPY A;  4K8V A;  3AQN A;  4ATB A;  8ICK A;  3UXO A;  2FMQ A;  9ICW A;  4XQ7 A;  4I2E A;  2DR5 A;  8ICQ A;  1TV9 A;  9ICO A;  4KLG A;  4RQ5 A;  1ZQG A;  4JWM A;  1YLQ A;  4EBK A;  4QZI A;  2BCQ A;  3TFR A;  4NLN A;  4OAF A;  3NYB A;  5DDY A;  4UB4 A;  7ICE A;  4M9L A;  3UPS A;  3HJ4 A;  4NKT A;  4I2C A;  4M9J A;  4KLJ A;  3V72 A;  4UAZ A;  4LZG A;  3AQL A;  4O68 A;  5J0S A;  5DBC A;  3C2M A;  9ICB A;  2ZH6 A;  1VJ7 A;  4QZ8 A;  2DR9 A;  1VFG A;  4RPZ A;  1TFW A;  5DB9 A;  4KLM A;  3UPQ A;  1ZQO A;  3AU6 A;  4WC7 A;  8ICY A;  9ICT A;  9ICC A;  3H39 A;  4UB2 A;  2DR7 A;  9ICG A;  1ZQE A;  8ICL A;  1UEV A;  1V4A A;  4RT2 A;  5DB6 A;  4UAY A;  4LEY A;  4AT7 B;  3HW8 A;  4AT8 A;  4P4O A;  3OV7 A;  4M0A A;  5J2F A;  4X0A A;  3ISB A;  4RQ8 A;  4DOB A;  2FMP A;  7ICU A;  5J2G A;  3PML A;  1TFY A;  3MDC A;  3JPP A;  4P2H A;  5HHI A;  1ZQY A;  4R64 A;  4PHD A;  4NXZ A;  4MFA A;  9ICP A;  4M9G A;  5HRI A;  1ZJN A;  2IHM A;  4FHV A;  1F5A A;  4XUS A;  1HUZ A;  2O1P A;  5J29 A;  4O5E A;  3C5F A;  1ZQV A;  4TUQ A;  4KLU A;  4QZE A;  4XA5 A;  5CHG A;  4LZD A;  1MIY A;  4NXW A;  3V7L A;  5J0W A;  4FO6 A;  4WBY A;  4RQ7 A;  2B4V A;  4KLS A;  4R63 A;  3AUO A;  4WC6 A;  4KM5 A;  1WOT A;  4RQ3 A;  5J0U A;  2PFN A;  4X0B A;  7ICS A;  5J0O A;  4NLK A;  4M5D A;  5BOM A;  3HIY A;  4XRH A;  1ZQK A;  2ZH1 A;  4YMO A;  4ATB B;  4UB3 A;  3RH4 A;  4X4V A;  5HC9 A;  3C66 A;  4I2D A;  4IQW A;  4WBZ A;  1XSN A;  9ICM A;  3TFS A;  5CJ7 A;  3UQ0 A;  7ICN A;  2ZH7 A;  4JWN A;  4M04 A;  4QZG A;  8ICT A;  3C2K A;  3WFO A;  4E7X A;  2VAN A;  7ICJ A;  8ICN A;  2B51 A;  5III A;  8ICB A;  4MKP A;  2ISP A;  4KLD A;  4MF8 A;  7ICM A;  1ZQS A;  4E8F A;  8ICW A;  1XSP A;  1BPB A;  4KLI A;  4IQV A;  1ZQM A;  2BCV A;  5HRD A;  2GWS A;  3WFS C;  9ICK A;  4I2H A;  3B0X A;  3LK9 A;  4M47 A;  9ICH A;  3RH6 A;  1UEU A;  4RWQ A;  1KDH A;  3JPN A;  1JAJ A;  9ICN A;  2PBE A;  4E80 A;  5J2B A;  4MFC A;  7ICK A;  1NO5 A;  2M2W A;  5CP2 A;  3ISD A;  7ICG A;  3OVS A;  9ICA A;  4NLZ A;  4NM1 A;  5HRK A;  4WC3 A;  3MBY A;  8ICH A;  3V7J A;  3RJF A;  9ICU A;  3RJG A;  4O5C A;  3HX0 A;  2PFQ A;  5TZV A;  4X4T A;  3JYY A;  1ZQQ A;  4O5K A;  1R8B A;  4AT8 B;  4M9H A;  4Z6D A;  4RQ2 A;  4KLH A;  8ICS A;  1ZQN A;  5J2K A;  4I2B A;  3LQC B;  1ZQT A;  5CR0 A;  4KB6 A;  4AT9 A;  1BPE A;  8ICO A;  4K96 A;  4KLF A;  4I2G A;  1ZQX A;  5DB8 A;  2ZH2 A;  1ZQL A;  4I2J A;  4PHA A;  4X4P A;  4P4P A;  1ZQW A;  4GXK A;  7ICT A;  2M2V A;  5J0P A;  5EOZ A;  3JPQ A;  5IIN A;  5BOL A;  4O6A A;  2I9G A;  4FHY A;  5J0Y A;  4RQ0 A;  4F5P A;  5DBA A;  4GXI A;  3WFR E;  4UB1 A;  4FHP A;  5DDM A;  4PGQ A;  4PHE A;  2M2T A;  4YN4 A;  2BPC A;  5HRG A;  4PGY A;  4YMM A;  1BPZ A;  1R8A A;  4K9B A;  9ICJ A;  4DOC A;  4IQT A;  5HRH A;  2BPG A;  5J0X A;  1JMS A;  3MGI A;  4RQ1 A;  4GXJ A;  4RQ4 A;  4WC5 A;  3C18 A;  4WOY A;  4YD1 A;  3UXP A;  4X4N A;  1BPY A;  4PGX A;  4UD5 A;  3H3A A;  3C5G A;  4F5N A;  4KLO A;  5J0T A;  4MF2 A;  1RZT A;  9ICV A;  1HUO A;  4K4H A;  3MGH A;  5DKW A;  4RPX A;  2ZH8 A;  4OAH A;  4UBC A;  1ZJM A;  9ICI A;  4OAI Z;  4PPX A;  2M2U A;  4DOA A;  2DVI A;  3RJE A;  5DED A;  3HJ1 A;  4UD4 A;  4UBB A;  4RT3 A;  9ICR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...