4AT7A

Crystal structure of the nf90-nf45 dimerisation domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
334
structure length
334
Chain Sequence
b'SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 115
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at7A02
4KM5A 4F5NA 4I2FA 2ZH8A 3C5FA 9ICHA 8ICBA 3V7JA 5D4BA 4R64A 3L9DA 7ICKA 4YD1A 4LEVA 1UETA 2O5AA 5J0QA 4LT6A 4LEYA 4I2AA 5HC9A 8ICIA 4I2DA 5D49A 5DB6A 2PFNA 2I9GA 4LEWA 4M47A 5HRLA 4XUSA 4PHAA 1ZQIA 4DOBA 4WC1A 4K98A 1MIVA 5J2GA 4TUSA 8ICMA 5J0YA 1OU5A 3PMLA 4M04A 8ICSA 4F5RA 2BE3A 4FHPA 4X4RA 4PH5A 5IIIA 5J2FA 1ZQFA 4I2JA 5DEDA 4PHDA 1UEUA 9ICNA 7ICLA 2O1PA 1ZQVA 4X4UA 5CJ7A 5J0XA 3RJFA 4XRHA 2BPFA 4O5CA 4YMNA 4FH3A 4E80A 1ZQXA 4QZGA 2Q66A 4X4NA 4KLUA 4F5PA 4TUPA 5DDYA 8ICZA 4RQ6A 2BCUA 3JYYA 4KLIA 1R8CA 4NLKA 5J2IA 5J2HA 9ICWA 3MDAA 1ZQPA 4K8VA 4X4QA 1ZQEA 1R8BA 4IQTA 2DVIA 2ZH2A 3JPTA 2BCVA 4NXVA 4RQ7A 2PFOA 1V4AA 4JWMA 5HRFA 5BOMA 5HRHA 3JPNA 5J2EA 9ICJA 5DB9A 1BPBA 8ICQA 4PHPA 4PGYA 4WCWA 4QZHA 9ICKA 1ZQWA 8ICEA 3HJ4A 4PGQA 4NXTA 4KLSA 3OUYB 4RPZA 2DRBA 2HHPA 4KLFA 3OVBA 3V72A 4K97A 1YLQA 1PX5A 4EBKA 4O5EA 5DECA 4F5OA 1TV9A 1ZQHA 7ICUA 1ZQUA 3HW8A 4TURA 1ZQYA 5IILA 3JPOA 4R63A 4YCXA 5J0OA 4WC5A 4IQUA 1ZQLA 2ISPA 4KLMA 1NO5A 4WBYA 4O69A 9ICEA 4MKPA 9ICMA 4I2GA 4M9HA 9ICSA 8ICGA 7ICEA 1ZQRA 4KLLA 4M9JA 4RQ5A 1R8AA 2W9MA 4NKTA 1ZQAA 5J0PA 1MIWA 2ISOA 7ICQA 4OAFA 3GDXA 9ICBA 1MIYA 4O67A 3C2MA 1ZQDA 1ZJMA 1R89A 4X0BA 3B0YA 4YMOA 5J2CA 9ICFA 1ZQBA 4RWPA 4NM2A 8ICYA 4ATBA 4UAYA 3RH4A 3UXOA 1BPZA 4M0AA 5CA7A 4E8FA 8ICLA 3OUYA 4QZ9A 5DB7A 8ICXA 2BCSA 4XQ7A 3AU6A 5CWRA 4YD2A 9ICOA 5J2AA 4JLXA 4RQ0A 4MF8A 3H39A 8ICWA 4RPXA 3K75D 5HHIA 4UD4A 4NXUA 1NOMA 4R65A 5J0WA 1ZQMA 5D46A 9ICTA 3JPSA 2ZHAA 5F2VO 4WC2A 4GXIA 1BPXA 3RJJA 1ZQGA 4K9BA 2ZH5A 4WC6A 3PNCA 4O6AA 5DB8A 4RQ4A 4JWNA 4M5DA 4UBBA 4FHXA 2ZH7A 5HRBA 2M2UA 4MFFA 3OGUA 1RZTA 1F5AA 2DR8A 8ICKA 4EBJA 9ICXA 5CP2A 1JN3A 4OAGA 4GXJA 3OVAA 4FO6A 4P2HA 9ICLA 4DOAA 3MBYA 1XSNA 4M9LA 4M9NA 1JQRA 4IG8A 4QZIA 2ZH3A 3V7LA 3B0XA 4I29A 4PHEA 3RJIA 5HHHA 2PFQA 8ICHA 8ICOA 4YMMA 2DRAA 4QZBA 9ICUA 4Z6CA 4KLEA 4NXXA 5TZVA 9ICAA 4WOYA 5HRGA 4KLQA 5HRIA 5DDMA 8ICAA 3AQMA 4M2YA 4PGXA 1XSLA 3NYBA 1RPLA 7ICVA 4AT8B 4X0AA 7ICSA 3RJGA 2M2VA 4I27A 9ICGA 3MGHA 4IQVA 5J0SA 4UB5A 3JPPA 7ICPA 2M2WA 2PXIA 3UXPA 3WFSC 3C5GA 2BPCA 4UD5A 4RWOA 4UB3A 5J2KA 1HUZA 4I2IA 3LQCB 1VFGA 1JAJA 3RH5A 4IQWA 3WFRE 1HUOA 8ICRA 4LZGA 4UB2A 3HWTA 4EP7A 7ICOA 4K4IA 3C18A 1KEJA 1Q78A 1FA0A 4KLHA 4WC0A 5J0UA 4K4HA 3AU2A 4QZEA 5IIOA 4R66A 2PBEA 1ZQOA 4X5VA 3OV7A 2P66A 2NRKA 3HJ1A 1KDHA 4Z6DA 5J2BA 4TUQA 3PMNA 3WFOA 1ZJNA 8ICNA 5HRKA 1BPEA 4KLTA 4O68A 4QZDA 1ZQZA 2M2TA 3RH6A 1KNYA 4NXWA 9ICVA 4RQ1A 3OVSA 3C66A 4DO9A 4OAIZ 9ICPA 4E7XA 7ICMA 7ICJA 2DR7A 3HIYA 4X4SA 5DKWA 7ICFA 1TVAA 4UAWA 4K96A 4WC3A 4QZ8A 2BCQA 4LVSA 5DBCA 4P4OA 2VANA 3H37A 3LK9A 3C2LA 5CHGA 5J2JA 4NLZA 4RWNA 4X4PA 4JLZA 3ISCA 3UPQA 7ICHA 2BCRA 5DBAA 4P4PA 4RQ3A 1TFYA 4FH5A 3JPQA 3RJEA 4X4TA 4UBCA 1ZQQA 4DOCA 2DR5A 3H38A 5IIJA 4UB1A 4XA5A 3RJHA 4X4VA 3C2KA 5J0TA 3HX0A 4RQ2A 4NLNA 5HR9A 8ICUA 5HRDA 4QZFA 4S3NA 4UB4A 3WFPA 3MGIA 8ICCA 4AT9B 4RWQA 4WC7A 4KLOA 4I2HA 2PFPA 9ICQA 4MFCA 4NY8A 2ZH9A 3AQLA 7ICGA 4WC4A 3AUOA 1XSPA 4FHWA 8ICJA 3ISDA 4Z6FA 2BPGA 5J29A 4KLGA 4Z6EA 2DR9A 3H3AA 1BPYA 4XQ8A 5CR0A 4UAZA 2ZH6A 5CB1A 3JZ0A 5IINA 5J0RA 2ZHBA 4NM1A 4I2CA 4P4MA 1VJ7A 4AT7B 2IHMA 4KLDA 1TFWA 2RFFA 4RT3A 4RPYA 2FMQA 9ICIA 4KB6A 1Q79A 4RT2A 5HREA 3WFQE 4WBZA 8ICTA 4MFAA 8ICPA 7ICTA 4MF2A 3TFRA 1ZQJA 1ZQCA 3ISBA 5IIKA 1ZQTA 7ICNA 1WOTA 2ID1A 3RJKA 4ATBB 4F5QA 1MQ3A 4KLJA 8ICFA 1ZQSA 4I28A 3TFSA 4YN4A 4QZCA 4OAHA 4LEZA 2FMPA 4FHVA 3V7KA 4M9GA 4LZDA 4K99A 3AQNA 4QZAA 4K9AA 1BPDA 4NXZA 5BPCA 4FHYA 2ZH1A 3MDCA 4O9MA 4AT9A 7ICRA 2ZH4A 9ICRA 1MQ2A 1ZQKA 4I2EA 7ICIA 5IIMA 2FMSA 3AQKA 3UQ0A 4K4GA 2GWSA 4X4OA 4GXKA 3UXNA 9ICCA 8ICVA 5DBBA 4PPXA 5EOZA 4RQ8A 3UPSA 4AT7A 4NKUA 5J2DA 4AT8A 4O5KA 3UQ2A 3JPRA 1JMSA 1ZQNA 5BOLA 4I2BA 1UEVA
chains in the Genus database with same CATH superfamily
4KM5A 4F5NA 4I2FA 2ZH8A 3EF2A 3C5FA 9ICHA 8ICBA 3V7JA 5D63A 4R64A 5D4BA 3L9DA 7ICKA 4YD1A 4LEVA 1UETA 2O5AA 5J0QA 4LT6A 4LEYA 4I2AA 5HC9A 8ICIA 4I2DA 5D49A 5DB6A 2PFNA 2I9GA 4LEWA 4M47A 5HRLA 4XUSA 4PHAA 1ZQIA 4DOBA 4WC1A 2B56A 4K98A 1MIVA 5J2GA 4TUSA 8ICMA 5J0YA 1OU5A 3PMLA 4M04A 8ICSA 4F5RA 4FHPA 4X4RA 2BE3A 4PH5A 5IIIA 5J2FA 1ZQFA 4I2JA 5DEDA 4PHDA 1UEUA 9ICNA 2GA9D 7ICLA 2O1PA 4WQLA 1ZQVA 4X4UA 5CJ7A 5J0XA 3K7DA 3RJFA 5D61A 4XRHA 2BPFA 4O5CA 4YMNA 4FH3A 4E80A 2Q66A 1ZQXA 4X4NA 4QZGA 4KLUA 4EEBA 4F5PA 4TUPA 5DDYA 8ICZA 4RQ6A 5CFTA 2BCUA 3JYYA 4KLIA 1R8CA 4NLKA 5J2IA 5J2HA 9ICWA 4WQKA 3MDAA 1ZQPA 4K8VA 4X4QA 1ZQEA 1R8BA 4IQTA 2DVIA 2ZH2A 3JPTA 2BCVA 3ER8C 4NXVA 2BBHA 4RQ7A 2PFOA 4JWMA 5HRFA 5BOMA 5HRHA 3JPNA 5J2EA 9ICJA 5DB9A 1BPBA 2EWRA 4WH5A 8ICQA 4PHPA 4PGYA 4WCWA 4QZHA 9ICKA 1ZQWA 8ICEA 3HJ4A 4PGQA 4NXTA 4KLSA 3OUYB 4RPZA 2DRBA 2HHPA 3OVBA 4KLFA 3CK6A 3V72A 4K97A 1YLQA 1PX5A 4EBKA 4O5EA 5DECA 4F5OA 1TV9A 1ZQHA 7ICUA 1ZQUA 3HW8A 1ZQYA 4TURA 5IILA 3JPOA 4R63A 4YCXA 5J0OA 4WC5A 4IQUA 1ZQLA 2ISPA 4KLMA 1NO5A 4WBYA 4O69A 9ICEA 4MKPA 9ICMA 4I2GA 4M9HA 9ICSA 8ICGA 7ICEA 1ZQRA 4KLLA 4M9JA 4RQ5A 1R8AA 4NKTA 2W9MA 1ZQAA 5J0PA 1MIWA 2ISOA 7ICQA 4OAFA 2BBJA 3GDXA 9ICBA 1MIYA 4O67A 3C2MA 2IUBA 1ZQDA 1ZJMA 1R89A 4X0BA 3B0YA 4YMOA 5J2CA 9ICFA 1ZQBA 4RWPA 4NM2A 8ICYA 4ATBA 3ERCC 4UAYA 3RH4A 3UXOA 1BPZA 4M0AA 4EEDA 5CA7A 4E8FA 8ICLA 3OUYA 4QZ9A 5DB7A 8ICXA 2BCSA 4XQ7A 5BOLA 3AU6A 5CWRA 4YD2A 9ICOA 5J2AA 4JLXA 1GPJA 4RQ0A 4MF8A 3H39A 8ICWA 4RPXA 3K75D 5HHIA 4UD4A 4NXUA 4EGWA 1NOMA 4R65A 5J0WA 1ZQMA 5D46A 9ICTA 2ZHAA 3JPSA 5F2VO 4WC2A 4GXIA 1BPXA 3RJJA 1ZQGA 4K9BA 2ZH5A 4WC6A 3PNCA 4O6AA 5DB8A 4RQ4A 4JWNA 4M5DA 4UBBA 4FHXA 2ZH7A 5HRBA 4N7RA 2M2UA 4MFFA 2B4VA 3OGUA 1RZTA 1F5AA 2DR8A 8ICKA 4EBJA 9ICXA 5CP2A 1JN3A 4OAGA 4GXJA 3OVAA 4FO6A 4P2HA 9ICLA 4DOAA 3MBYA 1XSNA 4M9LA 4M9NA 1JQRA 4IG8A 2GAFD 2ZH3A 4QZIA 3V7LA 3B0XA 4I29A 4PHEA 3RJIA 5HHHA 2PFQA 8ICHA 8ICOA 4YMMA 5B3QA 2DRAA 4QZBA 3ER9B 9ICUA 4Z6CA 4KLEA 4NXXA 5TZVA 9ICAA 4WOYA 5HRGA 4KLQA 5CFUA 5HRIA 5DDMA 8ICAA 3AQMA 4M2YA 4PGXA 1XSLA 3NYBA 1RPLA 5B3PA 7ICVA 4AT8B 2IHOA 4X0AA 7ICSA 3RJGA 2HN2A 2M2VA 4I27A 9ICGA 3MGHA 4IQVA 5J0SA 4UB5A 3JPPA 7ICPA 2M2WA 2PXIA 3UXPA 3WFSC 3C5GA 2BPCA 4UD5A 4RWOA 5D62A 3JCFA 4UB3A 5J2KA 1HUZA 4I2IA 3LQCB 4HX0A 1VFGA 1JAJA 3RH5A 4IQWA 3WFRE 1HUOA 8ICRA 4LZGA 4UB2A 3HWTA 4EP7A 7ICOA 4K4IA 3C18A 1KEJA 1Q78A 1FA0A 4KLHA 4WC0A 5J0UA 4K4HA 3AU2A 4QZEA 5IIOA 4R66A 2PBEA 1ZQOA 4X5VA 3OV7A 2P66A 3HJ1A 2NRKA 3PHZA 1KDHA 4Z6DA 5J2BA 4TUQA 3PMNA 3WFOA 5JTGA 1ZJNA 8ICNA 5HRKA 1BPEA 4KLTA 4O68A 2FCLA 4QZDA 1ZQZA 2M2TA 3RH6A 1KNYA 3NWIA 4NXWA 9ICVA 4RQ1A 3OVSA 3C66A 4DO9A 4OAIZ 9ICPA 4E7XA 7ICMA 7ICJA 2DR7A 3HIYA 4X4SA 5DKWA 7ICFA 1TVAA 4XJEA 4UAWA 4K96A 4WC3A 4FO1A 4QZ8A 2BCQA 4LVSA 5DBCA 4P4OA 2VANA 3H37A 3LK9A 3C2LA 5CHGA 5J2JA 4NLZA 4RWNA 4X4PA 4JLZA 2B51A 3ISCA 3UPQA 7ICHA 2BCRA 5DBAA 4P4PA 4RQ3A 1TFYA 4FH5A 3JPQA 3RJEA 4X4TA 4UBCA 1ZQQA 4DOCA 2DR5A 3H38A 5IIJA 4UB1A 4XA5A 3RJHA 4X4VA 3C2KA 5J0TA 3HX0A 4RQ2A 4NLNA 5HR9A 8ICUA 5HRDA 4QZFA 4S3NA 4UB4A 3WFPA 3MGIA 8ICCA 4AT9B 4RWQA 4WC7A 4KLOA 4I2HA 4I0UA 2PFPA 9ICQA 4MFCA 4NY8A 2ZH9A 3AQLA 7ICGA 4WC4A 3AUOA 1XSPA 4FHWA 8ICJA 3ISDA 5CHEA 4Z6FA 2BPGA 5J29A 4KLGA 4Z6EA 2DR9A 3H3AA 1BPYA 4XQ8A 5CR0A 4UAZA 2ZH6A 5CB1A 3JZ0A 5IINA 5J0RA 2ZHBA 4NM1A 4I2CA 4P4MA 1VJ7A 4AT7B 2IHMA 5CFSA 4KLDA 1TFWA 2RFFA 4RT3A 4RPYA 2FMQA 9ICIA 4KB6A 1Q79A 4EV6A 4RT2A 5HREA 3WFQE 4WBZA 3NKUA 8ICTA 4MFAA 8ICPA 7ICTA 2HN1A 4MF2A 3TFRA 1ZQJA 1ZQCA 3ISBA 5IIKA 1ZQTA 7ICNA 1WOTA 2ID1A 3RJKA 4ATBB 4F5QA 1MQ3A 4KLJA 8ICFA 1ZQSA 4I28A 3TFSA 4YN4A 3OWGA 4QZCA 4OAHA 4LEZA 2FMPA 4FHVA 3V7KA 3MCRA 4M9GA 4LZDA 4K99A 3AQNA 4QZAA 4K9AA 1BPDA 4NXZA 5BPCA 4FHYA 2ZH1A 3MDCA 4O9MA 3NVOA 4AT9A 7ICRA 2ZH4A 9ICRA 1MQ2A 1ZQKA 4I2EA 7ICIA 5IIMA 2FMSA 3AQKA 3UQ0A 4K4GA 2GWSA 4X4OA 4GXKA 3UXNA 9ICCA 8ICVA 5DBBA 4PPXA 5EOZA 4RQ8A 3UPSA 4AT7A 4NKUA 5J2DA 4AT8A 4O5KA 3UQ2A 3JPRA 1JMSA 1ZQNA 1V4AA 4I2BA 1UEVA
chains in the Genus database with same CATH topology
4KM5A 4F5NA 4I2FA 2ZH8A 3C5FA 9ICHA 8ICBA 3V7JA 5D4BA 4R64A 3L9DA 7ICKA 4YD1A 4LEVA 1UETA 2O5AA 5J0QA 4LT6A 4LEYA 4I2AA 5HC9A 8ICIA 4I2DA 5D49A 5DB6A 2PFNA 2I9GA 4LEWA 4M47A 5HRLA 4XUSA 4PHAA 1ZQIA 4DOBA 4WC1A 2B56A 4K98A 1MIVA 5J2GA 4TUSA 8ICMA 5J0YA 1OU5A 3PMLA 4M04A 8ICSA 4F5RA 4FHPA 4X4RA 2BE3A 4PH5A 5IIIA 5J2FA 1ZQFA 4I2JA 5DEDA 4PHDA 1UEUA 9ICNA 7ICLA 2O1PA 1ZQVA 4X4UA 5CJ7A 5J0XA 3RJFA 4XRHA 2BPFA 4O5CA 4YMNA 4FH3A 4E80A 2Q66A 1ZQXA 4X4NA 4QZGA 4KLUA 4F5PA 4TUPA 5DDYA 8ICZA 4RQ6A 2BCUA 3JYYA 4KLIA 1R8CA 4NLKA 5J2IA 5J2HA 9ICWA 3MDAA 1ZQPA 4K8VA 4X4QA 1ZQEA 1R8BA 4IQTA 2DVIA 2ZH2A 3JPTA 2BCVA 4NXVA 4RQ7A 2PFOA 1V4AA 4JWMA 5HRFA 5BOMA 5HRHA 3JPNA 5J2EA 9ICJA 5DB9A 1BPBA 8ICQA 4PHPA 4PGYA 4WCWA 4QZHA 9ICKA 1ZQWA 8ICEA 3HJ4A 4PGQA 4NXTA 4KLSA 3OUYB 4RPZA 2DRBA 2HHPA 3OVBA 4KLFA 3V72A 4K97A 1YLQA 1PX5A 4EBKA 4O5EA 5DECA 4F5OA 1TV9A 1ZQHA 7ICUA 1ZQUA 3HW8A 1ZQYA 4TURA 5IILA 3JPOA 4R63A 4YCXA 5J0OA 4WC5A 4IQUA 1ZQLA 2ISPA 4KLMA 1NO5A 4WBYA 4O69A 9ICEA 4MKPA 9ICMA 4I2GA 4M9HA 9ICSA 8ICGA 7ICEA 1ZQRA 4KLLA 4M9JA 4RQ5A 1R8AA 4NKTA 2W9MA 1ZQAA 5J0PA 1MIWA 2ISOA 7ICQA 4OAFA 3GDXA 9ICBA 1MIYA 4O67A 3C2MA 1ZQDA 1ZJMA 1R89A 4X0BA 3B0YA 4YMOA 5J2CA 9ICFA 1ZQBA 4RWPA 4NM2A 8ICYA 4ATBA 4UAYA 3RH4A 3UXOA 1BPZA 4M0AA 5CA7A 4E8FA 8ICLA 3OUYA 4QZ9A 5DB7A 8ICXA 2BCSA 4XQ7A 3AU6A 5CWRA 4YD2A 9ICOA 5J2AA 4JLXA 4RQ0A 4MF8A 3H39A 8ICWA 4RPXA 3K75D 5HHIA 4UD4A 4NXUA 1NOMA 4R65A 5J0WA 1ZQMA 5D46A 9ICTA 2ZHAA 3JPSA 5F2VO 4WC2A 4GXIA 1BPXA 3RJJA 1ZQGA 4K9BA 2ZH5A 4WC6A 3PNCA 4O6AA 5DB8A 4RQ4A 4JWNA 4M5DA 4UBBA 4FHXA 2ZH7A 5HRBA 2M2UA 4MFFA 2B4VA 3OGUA 1RZTA 1F5AA 2DR8A 8ICKA 4EBJA 9ICXA 5CP2A 1JN3A 4OAGA 4GXJA 3OVAA 4FO6A 4P2HA 9ICLA 4DOAA 3MBYA 1XSNA 4M9LA 4M9NA 1JQRA 4IG8A 2ZH3A 4QZIA 3V7LA 3B0XA 4I29A 4PHEA 3RJIA 5HHHA 2PFQA 8ICHA 8ICOA 4YMMA 2DRAA 4QZBA 9ICUA 4Z6CA 4KLEA 4NXXA 5TZVA 9ICAA 4WOYA 5HRGA 4KLQA 5HRIA 5DDMA 8ICAA 3AQMA 4M2YA 4PGXA 1XSLA 3NYBA 1RPLA 7ICVA 4AT8B 4X0AA 7ICSA 3RJGA 2M2VA 4I27A 9ICGA 3MGHA 4IQVA 5J0SA 4UB5A 3JPPA 7ICPA 2M2WA 2PXIA 3UXPA 3WFSC 3C5GA 2BPCA 4UD5A 4RWOA 4UB3A 5J2KA 1HUZA 4I2IA 3LQCB 1VFGA 1JAJA 3RH5A 4IQWA 3WFRE 1HUOA 8ICRA 4LZGA 4UB2A 3HWTA 4EP7A 7ICOA 4K4IA 3C18A 1KEJA 1Q78A 1FA0A 4KLHA 4WC0A 5J0UA 4K4HA 3AU2A 4QZEA 5IIOA 4R66A 2PBEA 1ZQOA 4X5VA 3OV7A 2P66A 3HJ1A 2NRKA 1KDHA 4Z6DA 5J2BA 4TUQA 3PMNA 3WFOA 1ZJNA 8ICNA 5HRKA 1BPEA 4KLTA 4O68A 4QZDA 1ZQZA 2M2TA 3RH6A 1KNYA 4NXWA 9ICVA 4RQ1A 3OVSA 3C66A 4DO9A 4OAIZ 9ICPA 4E7XA 7ICMA 7ICJA 2DR7A 3HIYA 4X4SA 5DKWA 7ICFA 1TVAA 4UAWA 4K96A 4WC3A 4QZ8A 2BCQA 4LVSA 5DBCA 4P4OA 2VANA 3H37A 3LK9A 3C2LA 5CHGA 5J2JA 4NLZA 4RWNA 4X4PA 4JLZA 2B51A 3ISCA 3UPQA 7ICHA 2BCRA 5DBAA 4P4PA 4RQ3A 1TFYA 4FH5A 3JPQA 3RJEA 4X4TA 4UBCA 1ZQQA 4DOCA 2DR5A 3H38A 5IIJA 4UB1A 4XA5A 3RJHA 4X4VA 3C2KA 5J0TA 3HX0A 4RQ2A 4NLNA 5HR9A 8ICUA 5HRDA 4QZFA 4S3NA 4UB4A 3WFPA 3MGIA 8ICCA 4AT9B 4RWQA 4WC7A 4KLOA 4I2HA 2PFPA 9ICQA 4MFCA 4NY8A 2ZH9A 3AQLA 7ICGA 4WC4A 3AUOA 1XSPA 4FHWA 8ICJA 3ISDA 4Z6FA 2BPGA 5J29A 4KLGA 4Z6EA 2DR9A 3H3AA 1BPYA 4XQ8A 5CR0A 4UAZA 2ZH6A 5CB1A 3JZ0A 5IINA 5J0RA 2ZHBA 4NM1A 4I2CA 4P4MA 1VJ7A 4AT7B 2IHMA 4KLDA 1TFWA 2RFFA 4RT3A 4RPYA 2FMQA 9ICIA 4KB6A 1Q79A 4RT2A 5HREA 3WFQE 4WBZA 8ICTA 4MFAA 8ICPA 7ICTA 4MF2A 3TFRA 1ZQJA 1ZQCA 3ISBA 5IIKA 1ZQTA 7ICNA 1WOTA 2ID1A 3RJKA 4ATBB 4F5QA 1MQ3A 4KLJA 8ICFA 1ZQSA 4I28A 3TFSA 4YN4A 4QZCA 4OAHA 4LEZA 2FMPA 4FHVA 3V7KA 4M9GA 4LZDA 4K99A 3AQNA 4QZAA 4K9AA 1BPDA 4NXZA 5BPCA 4FHYA 2ZH1A 3MDCA 4O9MA 4AT9A 7ICRA 2ZH4A 9ICRA 1MQ2A 1ZQKA 4I2EA 7ICIA 5IIMA 2FMSA 3AQKA 3UQ0A 4K4GA 2GWSA 4X4OA 4GXKA 3UXNA 9ICCA 8ICVA 5DBBA 4PPXA 5EOZA 4RQ8A 3UPSA 4AT7A 4NKUA 5J2DA 4AT8A 4O5KA 3UQ2A 3JPRA 1JMSA 1ZQNA 5BOLA 4I2BA 1UEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM5 A;  4F5N A;  4I2F A;  2ZH8 A;  3C5F A;  9ICH A;  8ICB A;  3V7J A;  5D4B A;  4R64 A;  3L9D A;  7ICK A;  4YD1 A;  4LEV A;  1UET A;  2O5A A;  5J0Q A;  4LT6 A;  4LEY A;  4I2A A;  5HC9 A;  8ICI A;  4I2D A;  5D49 A;  5DB6 A;  2PFN A;  2I9G A;  4LEW A;  4M47 A;  5HRL A;  4XUS A;  4PHA A;  1ZQI A;  4DOB A;  4WC1 A;  4K98 A;  1MIV A;  5J2G A;  4TUS A;  8ICM A;  5J0Y A;  1OU5 A;  3PML A;  4M04 A;  8ICS A;  4F5R A;  2BE3 A;  4FHP A;  4X4R A;  4PH5 A;  5III A;  5J2F A;  1ZQF A;  4I2J A;  5DED A;  4PHD A;  1UEU A;  9ICN A;  7ICL A;  2O1P A;  1ZQV A;  4X4U A;  5CJ7 A;  5J0X A;  3RJF A;  4XRH A;  2BPF A;  4O5C A;  4YMN A;  4FH3 A;  4E80 A;  1ZQX A;  4QZG A;  2Q66 A;  4X4N A;  4KLU A;  4F5P A;  4TUP A;  5DDY A;  8ICZ A;  4RQ6 A;  2BCU A;  3JYY A;  4KLI A;  1R8C A;  4NLK A;  5J2I A;  5J2H A;  9ICW A;  3MDA A;  1ZQP A;  4K8V A;  4X4Q A;  1ZQE A;  1R8B A;  4IQT A;  2DVI A;  2ZH2 A;  3JPT A;  2BCV A;  4NXV A;  4RQ7 A;  2PFO A;  1V4A A;  4JWM A;  5HRF A;  5BOM A;  5HRH A;  3JPN A;  5J2E A;  9ICJ A;  5DB9 A;  1BPB A;  8ICQ A;  4PHP A;  4PGY A;  4WCW A;  4QZH A;  9ICK A;  1ZQW A;  8ICE A;  3HJ4 A;  4PGQ A;  4NXT A;  4KLS A;  3OUY B;  4RPZ A;  2DRB A;  2HHP A;  4KLF A;  3OVB A;  3V72 A;  4K97 A;  1YLQ A;  1PX5 A;  4EBK A;  4O5E A;  5DEC A;  4F5O A;  1TV9 A;  1ZQH A;  7ICU A;  1ZQU A;  3HW8 A;  4TUR A;  1ZQY A;  5IIL A;  3JPO A;  4R63 A;  4YCX A;  5J0O A;  4WC5 A;  4IQU A;  1ZQL A;  2ISP A;  4KLM A;  1NO5 A;  4WBY A;  4O69 A;  9ICE A;  4MKP A;  9ICM A;  4I2G A;  4M9H A;  9ICS A;  8ICG A;  7ICE A;  1ZQR A;  4KLL A;  4M9J A;  4RQ5 A;  1R8A A;  2W9M A;  4NKT A;  1ZQA A;  5J0P A;  1MIW A;  2ISO A;  7ICQ A;  4OAF A;  3GDX A;  9ICB A;  1MIY A;  4O67 A;  3C2M A;  1ZQD A;  1ZJM A;  1R89 A;  4X0B A;  3B0Y A;  4YMO A;  5J2C A;  9ICF A;  1ZQB A;  4RWP A;  4NM2 A;  8ICY A;  4ATB A;  4UAY A;  3RH4 A;  3UXO A;  1BPZ A;  4M0A A;  5CA7 A;  4E8F A;  8ICL A;  3OUY A;  4QZ9 A;  5DB7 A;  8ICX A;  2BCS A;  4XQ7 A;  3AU6 A;  5CWR A;  4YD2 A;  9ICO A;  5J2A A;  4JLX A;  4RQ0 A;  4MF8 A;  3H39 A;  8ICW A;  4RPX A;  3K75 D;  5HHI A;  4UD4 A;  4NXU A;  1NOM A;  4R65 A;  5J0W A;  1ZQM A;  5D46 A;  9ICT A;  3JPS A;  2ZHA A;  5F2V O;  4WC2 A;  4GXI A;  1BPX A;  3RJJ A;  1ZQG A;  4K9B A;  2ZH5 A;  4WC6 A;  3PNC A;  4O6A A;  5DB8 A;  4RQ4 A;  4JWN A;  4M5D A;  4UBB A;  4FHX A;  2ZH7 A;  5HRB A;  2M2U A;  4MFF A;  3OGU A;  1RZT A;  1F5A A;  2DR8 A;  8ICK A;  4EBJ A;  9ICX A;  5CP2 A;  1JN3 A;  4OAG A;  4GXJ A;  3OVA A;  4FO6 A;  4P2H A;  9ICL A;  4DOA A;  3MBY A;  1XSN A;  4M9L A;  4M9N A;  1JQR A;  4IG8 A;  4QZI A;  2ZH3 A;  3V7L A;  3B0X A;  4I29 A;  4PHE A;  3RJI A;  5HHH A;  2PFQ A;  8ICH A;  8ICO A;  4YMM A;  2DRA A;  4QZB A;  9ICU A;  4Z6C A;  4KLE A;  4NXX A;  5TZV A;  9ICA A;  4WOY A;  5HRG A;  4KLQ A;  5HRI A;  5DDM A;  8ICA A;  3AQM A;  4M2Y A;  4PGX A;  1XSL A;  3NYB A;  1RPL A;  7ICV A;  4AT8 B;  4X0A A;  7ICS A;  3RJG A;  2M2V A;  4I27 A;  9ICG A;  3MGH A;  4IQV A;  5J0S A;  4UB5 A;  3JPP A;  7ICP A;  2M2W A;  2PXI A;  3UXP A;  3WFS C;  3C5G A;  2BPC A;  4UD5 A;  4RWO A;  4UB3 A;  5J2K A;  1HUZ A;  4I2I A;  3LQC B;  1VFG A;  1JAJ A;  3RH5 A;  4IQW A;  3WFR E;  1HUO A;  8ICR A;  4LZG A;  4UB2 A;  3HWT A;  4EP7 A;  7ICO A;  4K4I A;  3C18 A;  1KEJ A;  1Q78 A;  1FA0 A;  4KLH A;  4WC0 A;  5J0U A;  4K4H A;  3AU2 A;  4QZE A;  5IIO A;  4R66 A;  2PBE A;  1ZQO A;  4X5V A;  3OV7 A;  2P66 A;  2NRK A;  3HJ1 A;  1KDH A;  4Z6D A;  5J2B A;  4TUQ A;  3PMN A;  3WFO A;  1ZJN A;  8ICN A;  5HRK A;  1BPE A;  4KLT A;  4O68 A;  4QZD A;  1ZQZ A;  2M2T A;  3RH6 A;  1KNY A;  4NXW A;  9ICV A;  4RQ1 A;  3OVS A;  3C66 A;  4DO9 A;  4OAI Z;  9ICP A;  4E7X A;  7ICM A;  7ICJ A;  2DR7 A;  3HIY A;  4X4S A;  5DKW A;  7ICF A;  1TVA A;  4UAW A;  4K96 A;  4WC3 A;  4QZ8 A;  2BCQ A;  4LVS A;  5DBC A;  4P4O A;  2VAN A;  3H37 A;  3LK9 A;  3C2L A;  5CHG A;  5J2J A;  4NLZ A;  4RWN A;  4X4P A;  4JLZ A;  3ISC A;  3UPQ A;  7ICH A;  2BCR A;  5DBA A;  4P4P A;  4RQ3 A;  1TFY A;  4FH5 A;  3JPQ A;  3RJE A;  4X4T A;  4UBC A;  1ZQQ A;  4DOC A;  2DR5 A;  3H38 A;  5IIJ A;  4UB1 A;  4XA5 A;  3RJH A;  4X4V A;  3C2K A;  5J0T A;  3HX0 A;  4RQ2 A;  4NLN A;  5HR9 A;  8ICU A;  5HRD A;  4QZF A;  4S3N A;  4UB4 A;  3WFP A;  3MGI A;  8ICC A;  4AT9 B;  4RWQ A;  4WC7 A;  4KLO A;  4I2H A;  2PFP A;  9ICQ A;  4MFC A;  4NY8 A;  2ZH9 A;  3AQL A;  7ICG A;  4WC4 A;  3AUO A;  1XSP A;  4FHW A;  8ICJ A;  3ISD A;  4Z6F A;  2BPG A;  5J29 A;  4KLG A;  4Z6E A;  2DR9 A;  3H3A A;  1BPY A;  4XQ8 A;  5CR0 A;  4UAZ A;  2ZH6 A;  5CB1 A;  3JZ0 A;  5IIN A;  5J0R A;  2ZHB A;  4NM1 A;  4I2C A;  4P4M A;  1VJ7 A;  4AT7 B;  2IHM A;  4KLD A;  1TFW A;  2RFF A;  4RT3 A;  4RPY A;  2FMQ A;  9ICI A;  4KB6 A;  1Q79 A;  4RT2 A;  5HRE A;  3WFQ E;  4WBZ A;  8ICT A;  4MFA A;  8ICP A;  7ICT A;  4MF2 A;  3TFR A;  1ZQJ A;  1ZQC A;  3ISB A;  5IIK A;  1ZQT A;  7ICN A;  1WOT A;  2ID1 A;  3RJK A;  4ATB B;  4F5Q A;  1MQ3 A;  4KLJ A;  8ICF A;  1ZQS A;  4I28 A;  3TFS A;  4YN4 A;  4QZC A;  4OAH A;  4LEZ A;  2FMP A;  4FHV A;  3V7K A;  4M9G A;  4LZD A;  4K99 A;  3AQN A;  4QZA A;  4K9A A;  1BPD A;  4NXZ A;  5BPC A;  4FHY A;  2ZH1 A;  3MDC A;  4O9M A;  4AT9 A;  7ICR A;  2ZH4 A;  9ICR A;  1MQ2 A;  1ZQK A;  4I2E A;  7ICI A;  5IIM A;  2FMS A;  3AQK A;  3UQ0 A;  4K4G A;  2GWS A;  4X4O A;  4GXK A;  3UXN A;  9ICC A;  8ICV A;  5DBB A;  4PPX A;  5EOZ A;  4RQ8 A;  3UPS A;  4AT7 A;  4NKU A;  5J2D A;  4AT8 A;  4O5K A;  3UQ2 A;  3JPR A;  1JMS A;  1ZQN A;  5BOL A;  4I2B A;  1UEV A; 
#chains in the Genus database with same CATH topology
 4KM5 A;  4F5N A;  4I2F A;  2ZH8 A;  3EF2 A;  3C5F A;  9ICH A;  8ICB A;  3V7J A;  5D63 A;  4R64 A;  5D4B A;  3L9D A;  7ICK A;  4YD1 A;  4LEV A;  1UET A;  2O5A A;  5J0Q A;  4LT6 A;  4LEY A;  4I2A A;  5HC9 A;  8ICI A;  4I2D A;  5D49 A;  5DB6 A;  2PFN A;  2I9G A;  4LEW A;  4M47 A;  5HRL A;  4XUS A;  4PHA A;  1ZQI A;  4DOB A;  4WC1 A;  2B56 A;  4K98 A;  1MIV A;  5J2G A;  4TUS A;  8ICM A;  5J0Y A;  1OU5 A;  3PML A;  4M04 A;  8ICS A;  4F5R A;  4FHP A;  4X4R A;  2BE3 A;  4PH5 A;  5III A;  5J2F A;  1ZQF A;  4I2J A;  5DED A;  4PHD A;  1UEU A;  9ICN A;  2GA9 D;  7ICL A;  2O1P A;  4WQL A;  1ZQV A;  4X4U A;  5CJ7 A;  5J0X A;  3K7D A;  3RJF A;  5D61 A;  4XRH A;  2BPF A;  4O5C A;  4YMN A;  4FH3 A;  4E80 A;  2Q66 A;  1ZQX A;  4X4N A;  4QZG A;  4KLU A;  4EEB A;  4F5P A;  4TUP A;  5DDY A;  8ICZ A;  4RQ6 A;  5CFT A;  2BCU A;  3JYY A;  4KLI A;  1R8C A;  4NLK A;  5J2I A;  5J2H A;  9ICW A;  4WQK A;  3MDA A;  1ZQP A;  4K8V A;  4X4Q A;  1ZQE A;  1R8B A;  4IQT A;  2DVI A;  2ZH2 A;  3JPT A;  2BCV A;  3ER8 C;  4NXV A;  2BBH A;  4RQ7 A;  2PFO A;  4JWM A;  5HRF A;  5BOM A;  5HRH A;  3JPN A;  5J2E A;  9ICJ A;  5DB9 A;  1BPB A;  2EWR A;  4WH5 A;  8ICQ A;  4PHP A;  4PGY A;  4WCW A;  4QZH A;  9ICK A;  1ZQW A;  8ICE A;  3HJ4 A;  4PGQ A;  4NXT A;  4KLS A;  3OUY B;  4RPZ A;  2DRB A;  2HHP A;  3OVB A;  4KLF A;  3CK6 A;  3V72 A;  4K97 A;  1YLQ A;  1PX5 A;  4EBK A;  4O5E A;  5DEC A;  4F5O A;  1TV9 A;  1ZQH A;  7ICU A;  1ZQU A;  3HW8 A;  1ZQY A;  4TUR A;  5IIL A;  3JPO A;  4R63 A;  4YCX A;  5J0O A;  4WC5 A;  4IQU A;  1ZQL A;  2ISP A;  4KLM A;  1NO5 A;  4WBY A;  4O69 A;  9ICE A;  4MKP A;  9ICM A;  4I2G A;  4M9H A;  9ICS A;  8ICG A;  7ICE A;  1ZQR A;  4KLL A;  4M9J A;  4RQ5 A;  1R8A A;  4NKT A;  2W9M A;  1ZQA A;  5J0P A;  1MIW A;  2ISO A;  7ICQ A;  4OAF A;  2BBJ A;  3GDX A;  9ICB A;  1MIY A;  4O67 A;  3C2M A;  2IUB A;  1ZQD A;  1ZJM A;  1R89 A;  4X0B A;  3B0Y A;  4YMO A;  5J2C A;  9ICF A;  1ZQB A;  4RWP A;  4NM2 A;  8ICY A;  4ATB A;  3ERC C;  4UAY A;  3RH4 A;  3UXO A;  1BPZ A;  4M0A A;  4EED A;  5CA7 A;  4E8F A;  8ICL A;  3OUY A;  4QZ9 A;  5DB7 A;  8ICX A;  2BCS A;  4XQ7 A;  5BOL A;  3AU6 A;  5CWR A;  4YD2 A;  9ICO A;  5J2A A;  4JLX A;  1GPJ A;  4RQ0 A;  4MF8 A;  3H39 A;  8ICW A;  4RPX A;  3K75 D;  5HHI A;  4UD4 A;  4NXU A;  4EGW A;  1NOM A;  4R65 A;  5J0W A;  1ZQM A;  5D46 A;  9ICT A;  2ZHA A;  3JPS A;  5F2V O;  4WC2 A;  4GXI A;  1BPX A;  3RJJ A;  1ZQG A;  4K9B A;  2ZH5 A;  4WC6 A;  3PNC A;  4O6A A;  5DB8 A;  4RQ4 A;  4JWN A;  4M5D A;  4UBB A;  4FHX A;  2ZH7 A;  5HRB A;  4N7R A;  2M2U A;  4MFF A;  2B4V A;  3OGU A;  1RZT A;  1F5A A;  2DR8 A;  8ICK A;  4EBJ A;  9ICX A;  5CP2 A;  1JN3 A;  4OAG A;  4GXJ A;  3OVA A;  4FO6 A;  4P2H A;  9ICL A;  4DOA A;  3MBY A;  1XSN A;  4M9L A;  4M9N A;  1JQR A;  4IG8 A;  2GAF D;  2ZH3 A;  4QZI A;  3V7L A;  3B0X A;  4I29 A;  4PHE A;  3RJI A;  5HHH A;  2PFQ A;  8ICH A;  8ICO A;  4YMM A;  5B3Q A;  2DRA A;  4QZB A;  3ER9 B;  9ICU A;  4Z6C A;  4KLE A;  4NXX A;  5TZV A;  9ICA A;  4WOY A;  5HRG A;  4KLQ A;  5CFU A;  5HRI A;  5DDM A;  8ICA A;  3AQM A;  4M2Y A;  4PGX A;  1XSL A;  3NYB A;  1RPL A;  5B3P A;  7ICV A;  4AT8 B;  2IHO A;  4X0A A;  7ICS A;  3RJG A;  2HN2 A;  2M2V A;  4I27 A;  9ICG A;  3MGH A;  4IQV A;  5J0S A;  4UB5 A;  3JPP A;  7ICP A;  2M2W A;  2PXI A;  3UXP A;  3WFS C;  3C5G A;  2BPC A;  4UD5 A;  4RWO A;  5D62 A;  3JCF A;  4UB3 A;  5J2K A;  1HUZ A;  4I2I A;  3LQC B;  4HX0 A;  1VFG A;  1JAJ A;  3RH5 A;  4IQW A;  3WFR E;  1HUO A;  8ICR A;  4LZG A;  4UB2 A;  3HWT A;  4EP7 A;  7ICO A;  4K4I A;  3C18 A;  1KEJ A;  1Q78 A;  1FA0 A;  4KLH A;  4WC0 A;  5J0U A;  4K4H A;  3AU2 A;  4QZE A;  5IIO A;  4R66 A;  2PBE A;  1ZQO A;  4X5V A;  3OV7 A;  2P66 A;  3HJ1 A;  2NRK A;  3PHZ A;  1KDH A;  4Z6D A;  5J2B A;  4TUQ A;  3PMN A;  3WFO A;  5JTG A;  1ZJN A;  8ICN A;  5HRK A;  1BPE A;  4KLT A;  4O68 A;  2FCL A;  4QZD A;  1ZQZ A;  2M2T A;  3RH6 A;  1KNY A;  3NWI A;  4NXW A;  9ICV A;  4RQ1 A;  3OVS A;  3C66 A;  4DO9 A;  4OAI Z;  9ICP A;  4E7X A;  7ICM A;  7ICJ A;  2DR7 A;  3HIY A;  4X4S A;  5DKW A;  7ICF A;  1TVA A;  4XJE A;  4UAW A;  4K96 A;  4WC3 A;  4FO1 A;  4QZ8 A;  2BCQ A;  4LVS A;  5DBC A;  4P4O A;  2VAN A;  3H37 A;  3LK9 A;  3C2L A;  5CHG A;  5J2J A;  4NLZ A;  4RWN A;  4X4P A;  4JLZ A;  2B51 A;  3ISC A;  3UPQ A;  7ICH A;  2BCR A;  5DBA A;  4P4P A;  4RQ3 A;  1TFY A;  4FH5 A;  3JPQ A;  3RJE A;  4X4T A;  4UBC A;  1ZQQ A;  4DOC A;  2DR5 A;  3H38 A;  5IIJ A;  4UB1 A;  4XA5 A;  3RJH A;  4X4V A;  3C2K A;  5J0T A;  3HX0 A;  4RQ2 A;  4NLN A;  5HR9 A;  8ICU A;  5HRD A;  4QZF A;  4S3N A;  4UB4 A;  3WFP A;  3MGI A;  8ICC A;  4AT9 B;  4RWQ A;  4WC7 A;  4KLO A;  4I2H A;  4I0U A;  2PFP A;  9ICQ A;  4MFC A;  4NY8 A;  2ZH9 A;  3AQL A;  7ICG A;  4WC4 A;  3AUO A;  1XSP A;  4FHW A;  8ICJ A;  3ISD A;  5CHE A;  4Z6F A;  2BPG A;  5J29 A;  4KLG A;  4Z6E A;  2DR9 A;  3H3A A;  1BPY A;  4XQ8 A;  5CR0 A;  4UAZ A;  2ZH6 A;  5CB1 A;  3JZ0 A;  5IIN A;  5J0R A;  2ZHB A;  4NM1 A;  4I2C A;  4P4M A;  1VJ7 A;  4AT7 B;  2IHM A;  5CFS A;  4KLD A;  1TFW A;  2RFF A;  4RT3 A;  4RPY A;  2FMQ A;  9ICI A;  4KB6 A;  1Q79 A;  4EV6 A;  4RT2 A;  5HRE A;  3WFQ E;  4WBZ A;  3NKU A;  8ICT A;  4MFA A;  8ICP A;  7ICT A;  2HN1 A;  4MF2 A;  3TFR A;  1ZQJ A;  1ZQC A;  3ISB A;  5IIK A;  1ZQT A;  7ICN A;  1WOT A;  2ID1 A;  3RJK A;  4ATB B;  4F5Q A;  1MQ3 A;  4KLJ A;  8ICF A;  1ZQS A;  4I28 A;  3TFS A;  4YN4 A;  3OWG A;  4QZC A;  4OAH A;  4LEZ A;  2FMP A;  4FHV A;  3V7K A;  3MCR A;  4M9G A;  4LZD A;  4K99 A;  3AQN A;  4QZA A;  4K9A A;  1BPD A;  4NXZ A;  5BPC A;  4FHY A;  2ZH1 A;  3MDC A;  4O9M A;  3NVO A;  4AT9 A;  7ICR A;  2ZH4 A;  9ICR A;  1MQ2 A;  1ZQK A;  4I2E A;  7ICI A;  5IIM A;  2FMS A;  3AQK A;  3UQ0 A;  4K4G A;  2GWS A;  4X4O A;  4GXK A;  3UXN A;  9ICC A;  8ICV A;  5DBB A;  4PPX A;  5EOZ A;  4RQ8 A;  3UPS A;  4AT7 A;  4NKU A;  5J2D A;  4AT8 A;  4O5K A;  3UQ2 A;  3JPR A;  1JMS A;  1ZQN A;  1V4A A;  4I2B A;  1UEV A; 
#chains in the Genus database with same CATH homology
 4KM5 A;  4F5N A;  4I2F A;  2ZH8 A;  3C5F A;  9ICH A;  8ICB A;  3V7J A;  5D4B A;  4R64 A;  3L9D A;  7ICK A;  4YD1 A;  4LEV A;  1UET A;  2O5A A;  5J0Q A;  4LT6 A;  4LEY A;  4I2A A;  5HC9 A;  8ICI A;  4I2D A;  5D49 A;  5DB6 A;  2PFN A;  2I9G A;  4LEW A;  4M47 A;  5HRL A;  4XUS A;  4PHA A;  1ZQI A;  4DOB A;  4WC1 A;  2B56 A;  4K98 A;  1MIV A;  5J2G A;  4TUS A;  8ICM A;  5J0Y A;  1OU5 A;  3PML A;  4M04 A;  8ICS A;  4F5R A;  4FHP A;  4X4R A;  2BE3 A;  4PH5 A;  5III A;  5J2F A;  1ZQF A;  4I2J A;  5DED A;  4PHD A;  1UEU A;  9ICN A;  7ICL A;  2O1P A;  1ZQV A;  4X4U A;  5CJ7 A;  5J0X A;  3RJF A;  4XRH A;  2BPF A;  4O5C A;  4YMN A;  4FH3 A;  4E80 A;  2Q66 A;  1ZQX A;  4X4N A;  4QZG A;  4KLU A;  4F5P A;  4TUP A;  5DDY A;  8ICZ A;  4RQ6 A;  2BCU A;  3JYY A;  4KLI A;  1R8C A;  4NLK A;  5J2I A;  5J2H A;  9ICW A;  3MDA A;  1ZQP A;  4K8V A;  4X4Q A;  1ZQE A;  1R8B A;  4IQT A;  2DVI A;  2ZH2 A;  3JPT A;  2BCV A;  4NXV A;  4RQ7 A;  2PFO A;  1V4A A;  4JWM A;  5HRF A;  5BOM A;  5HRH A;  3JPN A;  5J2E A;  9ICJ A;  5DB9 A;  1BPB A;  8ICQ A;  4PHP A;  4PGY A;  4WCW A;  4QZH A;  9ICK A;  1ZQW A;  8ICE A;  3HJ4 A;  4PGQ A;  4NXT A;  4KLS A;  3OUY B;  4RPZ A;  2DRB A;  2HHP A;  3OVB A;  4KLF A;  3V72 A;  4K97 A;  1YLQ A;  1PX5 A;  4EBK A;  4O5E A;  5DEC A;  4F5O A;  1TV9 A;  1ZQH A;  7ICU A;  1ZQU A;  3HW8 A;  1ZQY A;  4TUR A;  5IIL A;  3JPO A;  4R63 A;  4YCX A;  5J0O A;  4WC5 A;  4IQU A;  1ZQL A;  2ISP A;  4KLM A;  1NO5 A;  4WBY A;  4O69 A;  9ICE A;  4MKP A;  9ICM A;  4I2G A;  4M9H A;  9ICS A;  8ICG A;  7ICE A;  1ZQR A;  4KLL A;  4M9J A;  4RQ5 A;  1R8A A;  4NKT A;  2W9M A;  1ZQA A;  5J0P A;  1MIW A;  2ISO A;  7ICQ A;  4OAF A;  3GDX A;  9ICB A;  1MIY A;  4O67 A;  3C2M A;  1ZQD A;  1ZJM A;  1R89 A;  4X0B A;  3B0Y A;  4YMO A;  5J2C A;  9ICF A;  1ZQB A;  4RWP A;  4NM2 A;  8ICY A;  4ATB A;  4UAY A;  3RH4 A;  3UXO A;  1BPZ A;  4M0A A;  5CA7 A;  4E8F A;  8ICL A;  3OUY A;  4QZ9 A;  5DB7 A;  8ICX A;  2BCS A;  4XQ7 A;  3AU6 A;  5CWR A;  4YD2 A;  9ICO A;  5J2A A;  4JLX A;  4RQ0 A;  4MF8 A;  3H39 A;  8ICW A;  4RPX A;  3K75 D;  5HHI A;  4UD4 A;  4NXU A;  1NOM A;  4R65 A;  5J0W A;  1ZQM A;  5D46 A;  9ICT A;  2ZHA A;  3JPS A;  5F2V O;  4WC2 A;  4GXI A;  1BPX A;  3RJJ A;  1ZQG A;  4K9B A;  2ZH5 A;  4WC6 A;  3PNC A;  4O6A A;  5DB8 A;  4RQ4 A;  4JWN A;  4M5D A;  4UBB A;  4FHX A;  2ZH7 A;  5HRB A;  2M2U A;  4MFF A;  2B4V A;  3OGU A;  1RZT A;  1F5A A;  2DR8 A;  8ICK A;  4EBJ A;  9ICX A;  5CP2 A;  1JN3 A;  4OAG A;  4GXJ A;  3OVA A;  4FO6 A;  4P2H A;  9ICL A;  4DOA A;  3MBY A;  1XSN A;  4M9L A;  4M9N A;  1JQR A;  4IG8 A;  2ZH3 A;  4QZI A;  3V7L A;  3B0X A;  4I29 A;  4PHE A;  3RJI A;  5HHH A;  2PFQ A;  8ICH A;  8ICO A;  4YMM A;  2DRA A;  4QZB A;  9ICU A;  4Z6C A;  4KLE A;  4NXX A;  5TZV A;  9ICA A;  4WOY A;  5HRG A;  4KLQ A;  5HRI A;  5DDM A;  8ICA A;  3AQM A;  4M2Y A;  4PGX A;  1XSL A;  3NYB A;  1RPL A;  7ICV A;  4AT8 B;  4X0A A;  7ICS A;  3RJG A;  2M2V A;  4I27 A;  9ICG A;  3MGH A;  4IQV A;  5J0S A;  4UB5 A;  3JPP A;  7ICP A;  2M2W A;  2PXI A;  3UXP A;  3WFS C;  3C5G A;  2BPC A;  4UD5 A;  4RWO A;  4UB3 A;  5J2K A;  1HUZ A;  4I2I A;  3LQC B;  1VFG A;  1JAJ A;  3RH5 A;  4IQW A;  3WFR E;  1HUO A;  8ICR A;  4LZG A;  4UB2 A;  3HWT A;  4EP7 A;  7ICO A;  4K4I A;  3C18 A;  1KEJ A;  1Q78 A;  1FA0 A;  4KLH A;  4WC0 A;  5J0U A;  4K4H A;  3AU2 A;  4QZE A;  5IIO A;  4R66 A;  2PBE A;  1ZQO A;  4X5V A;  3OV7 A;  2P66 A;  3HJ1 A;  2NRK A;  1KDH A;  4Z6D A;  5J2B A;  4TUQ A;  3PMN A;  3WFO A;  1ZJN A;  8ICN A;  5HRK A;  1BPE A;  4KLT A;  4O68 A;  4QZD A;  1ZQZ A;  2M2T A;  3RH6 A;  1KNY A;  4NXW A;  9ICV A;  4RQ1 A;  3OVS A;  3C66 A;  4DO9 A;  4OAI Z;  9ICP A;  4E7X A;  7ICM A;  7ICJ A;  2DR7 A;  3HIY A;  4X4S A;  5DKW A;  7ICF A;  1TVA A;  4UAW A;  4K96 A;  4WC3 A;  4QZ8 A;  2BCQ A;  4LVS A;  5DBC A;  4P4O A;  2VAN A;  3H37 A;  3LK9 A;  3C2L A;  5CHG A;  5J2J A;  4NLZ A;  4RWN A;  4X4P A;  4JLZ A;  2B51 A;  3ISC A;  3UPQ A;  7ICH A;  2BCR A;  5DBA A;  4P4P A;  4RQ3 A;  1TFY A;  4FH5 A;  3JPQ A;  3RJE A;  4X4T A;  4UBC A;  1ZQQ A;  4DOC A;  2DR5 A;  3H38 A;  5IIJ A;  4UB1 A;  4XA5 A;  3RJH A;  4X4V A;  3C2K A;  5J0T A;  3HX0 A;  4RQ2 A;  4NLN A;  5HR9 A;  8ICU A;  5HRD A;  4QZF A;  4S3N A;  4UB4 A;  3WFP A;  3MGI A;  8ICC A;  4AT9 B;  4RWQ A;  4WC7 A;  4KLO A;  4I2H A;  2PFP A;  9ICQ A;  4MFC A;  4NY8 A;  2ZH9 A;  3AQL A;  7ICG A;  4WC4 A;  3AUO A;  1XSP A;  4FHW A;  8ICJ A;  3ISD A;  4Z6F A;  2BPG A;  5J29 A;  4KLG A;  4Z6E A;  2DR9 A;  3H3A A;  1BPY A;  4XQ8 A;  5CR0 A;  4UAZ A;  2ZH6 A;  5CB1 A;  3JZ0 A;  5IIN A;  5J0R A;  2ZHB A;  4NM1 A;  4I2C A;  4P4M A;  1VJ7 A;  4AT7 B;  2IHM A;  4KLD A;  1TFW A;  2RFF A;  4RT3 A;  4RPY A;  2FMQ A;  9ICI A;  4KB6 A;  1Q79 A;  4RT2 A;  5HRE A;  3WFQ E;  4WBZ A;  8ICT A;  4MFA A;  8ICP A;  7ICT A;  4MF2 A;  3TFR A;  1ZQJ A;  1ZQC A;  3ISB A;  5IIK A;  1ZQT A;  7ICN A;  1WOT A;  2ID1 A;  3RJK A;  4ATB B;  4F5Q A;  1MQ3 A;  4KLJ A;  8ICF A;  1ZQS A;  4I28 A;  3TFS A;  4YN4 A;  4QZC A;  4OAH A;  4LEZ A;  2FMP A;  4FHV A;  3V7K A;  4M9G A;  4LZD A;  4K99 A;  3AQN A;  4QZA A;  4K9A A;  1BPD A;  4NXZ A;  5BPC A;  4FHY A;  2ZH1 A;  3MDC A;  4O9M A;  4AT9 A;  7ICR A;  2ZH4 A;  9ICR A;  1MQ2 A;  1ZQK A;  4I2E A;  7ICI A;  5IIM A;  2FMS A;  3AQK A;  3UQ0 A;  4K4G A;  2GWS A;  4X4O A;  4GXK A;  3UXN A;  9ICC A;  8ICV A;  5DBB A;  4PPX A;  5EOZ A;  4RQ8 A;  3UPS A;  4AT7 A;  4NKU A;  5J2D A;  4AT8 A;  4O5K A;  3UQ2 A;  3JPR A;  1JMS A;  1ZQN A;  5BOL A;  4I2B A;  1UEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...