4AT7A

Crystal structure of the nf90-nf45 dimerisation domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
334
structure length
334
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
total genus 115
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at7A02
4IQWA 8ICIA 4QZIA 4Z6DA 4K99A 3AQNA 5DBBA 1ZQXA 1MQ2A 4KLQA 4QZ8A 5J0QA 4UB2A 4KLUA 3AQKA 4DO9A 1ZQVA 4KLTA 3NYBA 4OAFA 7ICKA 1ZQNA 4LEZA 5DKWA 4M2YA 3H39A 5D49A 9ICSA 2ZH8A 4KM5A 4AT9A 3AUOA 1BPXA 1ZQSA 4YMOA 4KLIA 3RJKA 4O5EA 4O69A 2O5AA 4PHPA 5J2FA 4KLHA 3K75D 4KLFA 1XSNA 4I2FA 9ICWA 1ZQFA 3AQMA 5IIMA 4K8VA 5IIIA 4M0AA 4NXUA 4RQ5A 2BCRA 2BCVA 4DOCA 4Z6FA 3OVBA 3GDXA 4WC6A 3MGIA 4I2DA 4NM1A 4K4HA 2ZH3A 9ICEA 5HR9A 4RT2A 4QZAA 4QZEA 4I2JA 5DDYA 4LEYA 1VFGA 9ICGA 5J0SA 3WFQE 4M04A 1ZQIA 4Z6CA 3PMNA 1OU5A 4RPZA 9ICNA 4TURA 8ICEA 8ICBA 3UXOA 9ICAA 3JPPA 5HREA 4FHWA 4UBCA 3C5FA 3WFOA 1R89A 1ZQHA 4MF8A 8ICCA 4AT9B 4WBZA 1TVAA 3UPSA 1MIWA 5IIOA 4NXTA 4RQ2A 4M9JA 4RQ6A 3HJ1A 5J0WA 9ICUA 4I27A 4KLMA 1UEUA 4YD1A 4R64A 4YMNA 4XQ7A 1Q79A 4KLOA 4PHAA 4UAZA 4KB6A 3RH5A 4WC0A 2BPGA 4K4IA 2ISPA 3MDAA 1RPLA 4PPXA 5J2BA 1XSLA 4YMMA 2M2VA 4E80A 4UAWA 5BOLA 9ICPA 4FHVA 3MGHA 1ZQAA 8ICZA 7ICQA 9ICBA 4WC1A 4YCXA 3HX0A 2VANA 1ZQLA 4LZDA 4UD4A 4JLXA 8ICNA 4TUQA 4M9HA 4RQ3A 3WFPA 5HRKA 1ZQDA 4X4SA 5IIJA 4O5CA 3RJEA 3L9DA 1R8BA 4RQ8A 4DOAA 3JPTA 8ICJA 4K9BA 1MIYA 1HUOA 1BPBA 5CJ7A 3AU2A 1R8AA 3MDCA 4RWOA 4M9GA 4O5KA 3WFSC 4QZ9A 4P4OA 3V72A 3ISCA 3RH4A 5J2CA 5J29A 3C2MA 9ICIA 2ZHAA 5DECA 9ICVA 4R66A 1JQRA 4XRHA 2BE3A 4OAIZ 5BOMA 8ICMA 1YLQA 1BPEA 5J2EA 3HIYA 4RWQA 5HRHA 2FMQA 7ICUA 9ICQA 3JPNA 4GXIA 3AU6A 4PGYA 4QZBA 5DEDA 4WC3A 3C2KA 1ZJNA 3UXNA 8ICKA 1ZQBA 4RQ4A 3HWTA 9ICHA 4O68A 5CWRA 1HUZA 5J2IA 3RJFA 4RWPA 2PFQA 4P4PA 4X4RA 4RQ0A 3OVSA 4UB1A 5DBCA 4KLSA 7ICVA 3JPRA 2IHMA 4NXWA 4I2AA 5HRIA 5J0TA 1BPDA 1BPZA 2PBEA 4ATBA 4QZFA 8ICRA 4MFFA 5F2VO 4QZDA 1ZQMA 2ZH2A 4E8FA 2DR9A 1ZQZA 3JPSA 4X4UA 4YN4A 8ICFA 4KLJA 4F5OA 4K97A 9ICFA 4X4OA 2DRBA 7ICNA 5DB9A 4PHEA 4WOYA 2BPCA 5TZVA 2DR8A 8ICLA 4UB3A 5D46A 4X4TA 4PGQA 5HRGA 4LZGA 5HRLA 7ICEA 5J0XA 1UEVA 4UBBA 4WC7A 3OVAA 4M5DA 5HRFA 1PX5A 1TFYA 4LVSA 7ICRA 4NY8A 4XUSA 5HHHA 1ZQYA 4FHYA 4WBYA 4E7XA 4UB4A 4M47A 8ICVA 3RJGA 1JAJA 3UXPA 2FMSA 4XA5A 7ICOA 1NO5A 2BCSA 5IINA 4JLZA 2ZH5A 7ICMA 4ATBB 2BCUA 2GWSA 9ICCA 4AT8A 4FHPA 5J0RA 3OUYA 1R8CA 4MKPA 5CR0A 5EOZA 4PHDA 4I2HA 2DRAA 1XSPA 3LQCB 3PMLA 4M9LA 4X4VA 4WC5A 9ICTA 4NM2A 3OV7A 3V7JA 3HJ4A 8ICPA 5DB6A 9ICRA 5J2DA 5DDMA 1ZQEA 1KEJA 5HHIA 4NXZA 1ZQRA 4RQ7A 3B0XA 8ICSA 5HC9A 3C18A 3H37A 4NKUA 2DR5A 5J0YA 9ICOA 4EBKA 3HW8A 4IQVA 4X4NA 4EBJA 2ZH6A 2ZHBA 4X0BA 8ICUA 4AT8B 5J2AA 4FO6A 4KLDA 4OAGA 1ZQJA 3OUYB 2NRKA 4WC4A 4F5RA 4I2EA 3ISDA 5J2KA 4LEWA 4MF2A 4IQUA 2FMPA 4GXKA 2PFNA 1ZQCA 4I2CA 5DB7A 4UD5A 4R65A 3TFRA 2PXIA 4LEVA 3MBYA 4NXXA 8ICAA 4PH5A 1ZQOA 2O1PA 4X5VA 1TV9A 2ZH1A 3RJIA 4F5NA 4RT3A 1KDHA 7ICHA 1ZQQA 5BPCA 2ZH7A 5DB8A 4QZHA 4F5PA 3UPQA 5IIKA 2Q66A 4MFAA 4K9AA 4RWNA 1V4AA 3B0YA 3JYYA 1ZQGA 8ICXA 2ZH4A 3JZ0A 3RJHA 4O9MA 4RQ1A 5CB1A 2I9GA 3RH6A 7ICTA 4UB5A 2BPFA 1Q78A 5D4BA 4I29A 9ICJA 5IILA 7ICFA 9ICMA 4FH3A 2M2UA 3UQ2A 4RPXA 4M9NA 5J0UA 5J2HA 4P4MA 5CA7A 4WCWA 2BCQA 1RZTA 4IG8A 1ZQUA 1MIVA 2W9MA 8ICQA 3C2LA 5DBAA 4OAHA 3H38A 2M2WA 4I2BA 3V7LA 4NLKA 4JWNA 1KNYA 3AQLA 3ISBA 7ICGA 2ZH9A 1TFWA 4IQTA 1WOTA 4FHXA 9ICXA 7ICIA 4AT7A 4TUPA 1BPYA 4S3NA 2M2TA 4I2GA 4NKTA 7ICJA 7ICPA 9ICKA 8ICOA 1VJ7A 4X4PA 1FA0A 1JN3A 4DOBA 2DVIA 2PFPA 4QZCA 3JPQA 3WFRE 3C66A 8ICWA 5J2JA 5J2GA 1MQ3A 4K4GA 9ICLA 7ICLA 1ZQTA 8ICTA 4NLNA 4EP7A 3V7KA 4NXVA 3PNCA 4I2IA 4XQ8A 4NLZA 1ZJMA 4LT6A 4FH5A 5CP2A 2RFFA 2ID1A 3UQ0A 5HRDA 4KLEA 1ZQWA 3C5GA 4KLLA 4WC2A 4KLGA 4R63A 4X4QA 4O67A 1NOMA 4UAYA 4YD2A 3OGUA 4F5QA 4PGXA 7ICSA 1ZQKA 3TFSA 8ICYA 4MFCA 4RPYA 4K96A 2HHPA 4I28A 5HRBA 4QZGA 3LK9A 1UETA 4K98A 5J0OA 4AT7B 2PFOA 1F5AA 5J0PA 4O6AA 5CHGA 8ICGA 3JPOA 8ICHA 3H3AA 4X0AA 2DR7A 4Z6EA 3RJJA 1ZQPA 4TUSA 2P66A 1JMSA 4P2HA 4JWMA 2ISOA 4GXJA
chains in the Genus database with same CATH superfamily
4IQWA 8ICIA 4QZIA 1GPJA 4Z6DA 4K99A 3AQNA 5DBBA 1ZQXA 1MQ2A 4KLQA 4QZ8A 4WQKA 5J0QA 4UB2A 4KLUA 3AQKA 4DO9A 1ZQVA 4KLTA 3NYBA 4OAFA 7ICKA 1ZQNA 4LEZA 2B4VA 5DKWA 3CK6A 4M2YA 3H39A 5D49A 9ICSA 2ZH8A 4KM5A 4AT9A 3AUOA 5B3QA 1BPXA 1ZQSA 4YMOA 4KLIA 3RJKA 4O5EA 4O69A 2O5AA 4PHPA 5J2FA 4KLHA 3K75D 4KLFA 2B51A 1XSNA 4I2FA 9ICWA 3PHZA 1ZQFA 3AQMA 5D63A 4K8VA 5IIMA 5IIIA 4M0AA 4NXUA 4RQ5A 2BCRA 2BCVA 3OVBA 4Z6FA 4DOCA 3GDXA 4WC6A 3MGIA 4I2DA 4EV6A 4WH5A 4NM1A 4K4HA 2ZH3A 9ICEA 5HR9A 4RT2A 4QZAA 4QZEA 4I2JA 5DDYA 4LEYA 1VFGA 9ICGA 5J0SA 3WFQE 4M04A 1ZQIA 4Z6CA 3PMNA 1OU5A 4RPZA 9ICNA 4TURA 4N7RA 8ICEA 8ICBA 3UXOA 9ICAA 3JPPA 5HREA 4FHWA 4UBCA 3C5FA 3WFOA 1R89A 1ZQHA 4MF8A 8ICCA 4AT9B 4WBZA 4I0UA 1TVAA 3UPSA 1MIWA 5IIOA 4NXTA 4RQ2A 4M9JA 4RQ6A 3HJ1A 5J0WA 4FO1A 9ICUA 4I27A 4KLMA 1UEUA 4YD1A 4R64A 4YMNA 4XQ7A 1Q79A 4KLOA 4PHAA 4UAZA 4KB6A 3RH5A 4WC0A 2BPGA 4K4IA 2ISPA 3MDAA 1RPLA 4PPXA 5J2BA 1XSLA 4YMMA 2M2VA 3K7DA 4E80A 5BOLA 4UAWA 9ICPA 4FHVA 3MGHA 1ZQAA 8ICZA 7ICQA 3NKUA 9ICBA 4WC1A 4YCXA 3HX0A 2VANA 1ZQLA 4LZDA 4UD4A 4JLXA 8ICNA 4TUQA 4M9HA 4RQ3A 3WFPA 5HRKA 1ZQDA 4X4SA 5IIJA 4O5CA 3RJEA 3L9DA 1R8BA 4RQ8A 4DOAA 5B3PA 3JPTA 8ICJA 4K9BA 1MIYA 1HUOA 1BPBA 5CJ7A 3NVOA 3AU2A 1R8AA 3MDCA 3JCFA 4RWOA 4M9GA 4O5KA 3WFSC 4QZ9A 4P4OA 3V72A 3ISCA 3RH4A 5J2CA 5J29A 3C2MA 9ICIA 2ZHAA 5DECA 9ICVA 4R66A 1JQRA 4XRHA 4XJEA 2BE3A 4OAIZ 5BOMA 8ICMA 2BBJA 1YLQA 1BPEA 5J2EA 3HIYA 4RWQA 5HRHA 2FMQA 7ICUA 9ICQA 3JPNA 4GXIA 3AU6A 4PGYA 4QZBA 5DEDA 4WC3A 3C2KA 1ZJNA 3UXNA 8ICKA 1ZQBA 4RQ4A 3HWTA 9ICHA 4O68A 5CWRA 1HUZA 5J2IA 3RJFA 4RWPA 2PFQA 4P4PA 4EEBA 4X4RA 4RQ0A 5CFUA 3OVSA 4UB1A 5DBCA 4KLSA 7ICVA 3JPRA 2IHMA 4NXWA 4I2AA 5HRIA 5J0TA 1BPDA 1BPZA 2PBEA 4ATBA 4QZFA 8ICRA 4MFFA 5F2VO 4QZDA 1ZQMA 2ZH2A 4E8FA 2DR9A 1ZQZA 3JPSA 4X4UA 4YN4A 5CFSA 8ICFA 4KLJA 4F5OA 4K97A 9ICFA 4X4OA 2DRBA 7ICNA 5DB9A 4PHEA 4WOYA 2BPCA 5TZVA 2DR8A 8ICLA 5D46A 4X4TA 4UB3A 4PGQA 5HRGA 4LZGA 5HRLA 7ICEA 5J0XA 1UEVA 4UBBA 4WC7A 3OVAA 4M5DA 5HRFA 1PX5A 1TFYA 4LVSA 7ICRA 4NY8A 4XUSA 5HHHA 1ZQYA 4FHYA 4WBYA 4E7XA 4UB4A 4M47A 8ICVA 3RJGA 1JAJA 3UXPA 2FMSA 4XA5A 7ICOA 1NO5A 2BCSA 5IINA 4JLZA 2ZH5A 7ICMA 4ATBB 2BCUA 2GWSA 9ICCA 4AT8A 4FHPA 5J0RA 3OUYA 1R8CA 4MKPA 5CR0A 5EOZA 4PHDA 2GA9D 2DRAA 4I2HA 1XSPA 2IUBA 3LQCB 5D61A 3PMLA 4M9LA 4X4VA 4WC5A 9ICTA 4NM2A 3OV7A 3V7JA 3HJ4A 8ICPA 5DB6A 9ICRA 5J2DA 5DDMA 1ZQEA 1KEJA 5HHIA 4NXZA 4WQLA 1ZQRA 4RQ7A 3B0XA 2FCLA 4EGWA 8ICSA 5HC9A 3C18A 3H37A 3MCRA 4NKUA 2DR5A 5J0YA 9ICOA 4EBKA 3HW8A 4IQVA 4X4NA 2HN2A 4EBJA 2ZH6A 2ZHBA 2IHOA 4X0BA 8ICUA 2BBHA 4AT8B 5J2AA 4FO6A 4KLDA 4OAGA 1ZQJA 3OUYB 4WC4A 2NRKA 4F5RA 4I2EA 3ISDA 4HX0A 5J2KA 4LEWA 5CHEA 4MF2A 4IQUA 2FMPA 4GXKA 2PFNA 1ZQCA 4I2CA 5DB7A 4UD5A 4R65A 3TFRA 2PXIA 4LEVA 3MBYA 4NXXA 8ICAA 4PH5A 1ZQOA 3ERCC 2O1PA 4X5VA 1TV9A 2ZH1A 3RJIA 4EEDA 4F5NA 4RT3A 3EF2A 1KDHA 7ICHA 1ZQQA 5BPCA 2ZH7A 5DB8A 4QZHA 4F5PA 3UPQA 5IIKA 2Q66A 4MFAA 4K9AA 4RWNA 1V4AA 3B0YA 3JYYA 1ZQGA 8ICXA 2ZH4A 3JZ0A 3RJHA 4O9MA 4RQ1A 5CB1A 2I9GA 3RH6A 7ICTA 4UB5A 2BPFA 5D62A 1Q78A 5D4BA 4I29A 9ICJA 5IILA 7ICFA 9ICMA 4FH3A 2M2UA 3UQ2A 4RPXA 4M9NA 5J0UA 5J2HA 4P4MA 5CA7A 4WCWA 2BCQA 1RZTA 4IG8A 1ZQUA 1MIVA 2W9MA 2HN1A 8ICQA 3C2LA 5DBAA 4OAHA 2GAFD 3H38A 2M2WA 4I2BA 3V7LA 4NLKA 4JWNA 1KNYA 3AQLA 3ISBA 7ICGA 2ZH9A 1TFWA 4IQTA 1WOTA 4FHXA 2EWRA 3OWGA 9ICXA 7ICIA 4AT7A 3NWIA 4TUPA 1BPYA 4S3NA 2M2TA 4I2GA 4NKTA 7ICJA 7ICPA 9ICKA 8ICOA 4X4PA 1VJ7A 1FA0A 1JN3A 4DOBA 2DVIA 5JTGA 2PFPA 3ER8C 4QZCA 3JPQA 3WFRE 3C66A 8ICWA 5J2JA 5J2GA 1MQ3A 4K4GA 9ICLA 7ICLA 1ZQTA 8ICTA 4NLNA 4EP7A 3V7KA 4NXVA 3PNCA 4I2IA 4XQ8A 4NLZA 1ZJMA 4LT6A 4FH5A 5CP2A 2RFFA 2ID1A 3UQ0A 5HRDA 4KLEA 1ZQWA 3C5GA 4KLLA 4WC2A 4KLGA 4R63A 2B56A 4X4QA 4O67A 1NOMA 4UAYA 4YD2A 3OGUA 4F5QA 4PGXA 7ICSA 1ZQKA 3TFSA 8ICYA 4MFCA 4RPYA 4K96A 2HHPA 4I28A 5HRBA 4QZGA 3LK9A 1UETA 5CFTA 4K98A 5J0OA 4AT7B 2PFOA 1F5AA 5J0PA 4O6AA 5CHGA 8ICGA 3ER9B 3JPOA 8ICHA 3H3AA 2DR7A 4X0AA 4Z6EA 3RJJA 1ZQPA 4TUSA 2P66A 1JMSA 4P2HA 4JWMA 2ISOA 4GXJA
chains in the Genus database with same CATH topology
4IQWA 8ICIA 4QZIA 4Z6DA 4K99A 3AQNA 5DBBA 1ZQXA 1MQ2A 4KLQA 4QZ8A 5J0QA 4UB2A 4KLUA 3AQKA 4DO9A 1ZQVA 4KLTA 3NYBA 4OAFA 7ICKA 1ZQNA 4LEZA 2B4VA 5DKWA 4M2YA 3H39A 5D49A 9ICSA 2ZH8A 4KM5A 4AT9A 3AUOA 1BPXA 1ZQSA 4YMOA 4KLIA 3RJKA 4O5EA 4O69A 2O5AA 4PHPA 5J2FA 4KLHA 3K75D 4KLFA 2B51A 1XSNA 4I2FA 9ICWA 1ZQFA 3AQMA 5IIMA 4K8VA 5IIIA 4M0AA 4NXUA 4RQ5A 2BCRA 2BCVA 3OVBA 4Z6FA 4DOCA 3GDXA 4WC6A 3MGIA 4I2DA 4NM1A 4K4HA 2ZH3A 9ICEA 5HR9A 4RT2A 4QZAA 4QZEA 4I2JA 5DDYA 4LEYA 1VFGA 9ICGA 5J0SA 3WFQE 4M04A 1ZQIA 4Z6CA 3PMNA 1OU5A 4RPZA 9ICNA 4TURA 8ICEA 8ICBA 3UXOA 9ICAA 3JPPA 5HREA 4FHWA 4UBCA 3C5FA 3WFOA 1R89A 1ZQHA 4MF8A 8ICCA 4AT9B 4WBZA 1TVAA 3UPSA 1MIWA 5IIOA 4NXTA 4RQ2A 4M9JA 4RQ6A 3HJ1A 5J0WA 9ICUA 4I27A 4KLMA 1UEUA 4YD1A 4R64A 4YMNA 4XQ7A 1Q79A 4KLOA 4PHAA 4UAZA 4KB6A 3RH5A 4WC0A 2BPGA 4K4IA 2ISPA 3MDAA 1RPLA 4PPXA 5J2BA 1XSLA 4YMMA 2M2VA 4E80A 5BOLA 4UAWA 9ICPA 4FHVA 3MGHA 1ZQAA 8ICZA 7ICQA 9ICBA 4WC1A 4YCXA 3HX0A 2VANA 1ZQLA 4LZDA 4UD4A 4JLXA 8ICNA 4TUQA 4M9HA 4RQ3A 3WFPA 5HRKA 1ZQDA 4X4SA 5IIJA 4O5CA 3RJEA 3L9DA 1R8BA 4RQ8A 4DOAA 3JPTA 8ICJA 4K9BA 1MIYA 1HUOA 1BPBA 5CJ7A 3AU2A 1R8AA 3MDCA 4RWOA 4M9GA 4O5KA 3WFSC 4QZ9A 4P4OA 3V72A 3ISCA 3RH4A 5J2CA 5J29A 3C2MA 9ICIA 2ZHAA 5DECA 9ICVA 4R66A 1JQRA 4XRHA 2BE3A 4OAIZ 5BOMA 8ICMA 1YLQA 1BPEA 5J2EA 3HIYA 4RWQA 5HRHA 2FMQA 7ICUA 9ICQA 3JPNA 4GXIA 3AU6A 4PGYA 4QZBA 5DEDA 4WC3A 3C2KA 1ZJNA 3UXNA 8ICKA 1ZQBA 4RQ4A 3HWTA 9ICHA 4O68A 5CWRA 1HUZA 5J2IA 3RJFA 4RWPA 2PFQA 4P4PA 4X4RA 4RQ0A 3OVSA 4UB1A 5DBCA 4KLSA 7ICVA 3JPRA 2IHMA 4NXWA 4I2AA 5HRIA 5J0TA 1BPDA 1BPZA 2PBEA 4ATBA 4QZFA 8ICRA 4MFFA 5F2VO 4QZDA 1ZQMA 2ZH2A 4E8FA 2DR9A 1ZQZA 3JPSA 4X4UA 4YN4A 8ICFA 4KLJA 4F5OA 4K97A 9ICFA 4X4OA 2DRBA 7ICNA 5DB9A 4PHEA 4WOYA 2BPCA 5TZVA 2DR8A 8ICLA 5D46A 4X4TA 4UB3A 4PGQA 5HRGA 4LZGA 5HRLA 7ICEA 5J0XA 1UEVA 4UBBA 4WC7A 3OVAA 4M5DA 5HRFA 1PX5A 1TFYA 4LVSA 7ICRA 4NY8A 4XUSA 5HHHA 1ZQYA 4FHYA 4WBYA 4E7XA 4UB4A 4M47A 8ICVA 3RJGA 1JAJA 3UXPA 2FMSA 4XA5A 7ICOA 1NO5A 2BCSA 5IINA 4JLZA 2ZH5A 7ICMA 4ATBB 2BCUA 2GWSA 9ICCA 4AT8A 4FHPA 5J0RA 3OUYA 1R8CA 4MKPA 5CR0A 5EOZA 4PHDA 2DRAA 4I2HA 1XSPA 3LQCB 3PMLA 4M9LA 4X4VA 4WC5A 9ICTA 4NM2A 3OV7A 3V7JA 3HJ4A 8ICPA 5DB6A 9ICRA 5J2DA 5DDMA 1ZQEA 1KEJA 5HHIA 4NXZA 1ZQRA 4RQ7A 3B0XA 8ICSA 5HC9A 3C18A 3H37A 4NKUA 2DR5A 5J0YA 9ICOA 4EBKA 3HW8A 4IQVA 4X4NA 4EBJA 2ZH6A 2ZHBA 4X0BA 8ICUA 4AT8B 5J2AA 4FO6A 4KLDA 4OAGA 1ZQJA 3OUYB 2NRKA 4WC4A 4F5RA 4I2EA 3ISDA 5J2KA 4LEWA 4MF2A 4IQUA 2FMPA 4GXKA 2PFNA 1ZQCA 4I2CA 5DB7A 4UD5A 4R65A 3TFRA 2PXIA 4LEVA 3MBYA 4NXXA 8ICAA 4PH5A 1ZQOA 2O1PA 4X5VA 1TV9A 2ZH1A 3RJIA 4F5NA 4RT3A 1KDHA 7ICHA 1ZQQA 5BPCA 2ZH7A 5DB8A 4QZHA 4F5PA 3UPQA 5IIKA 2Q66A 4MFAA 4K9AA 4RWNA 1V4AA 3B0YA 3JYYA 1ZQGA 8ICXA 2ZH4A 3JZ0A 3RJHA 4O9MA 4RQ1A 5CB1A 2I9GA 3RH6A 7ICTA 4UB5A 2BPFA 1Q78A 5D4BA 4I29A 9ICJA 5IILA 7ICFA 9ICMA 4FH3A 2M2UA 3UQ2A 4RPXA 4M9NA 5J0UA 5J2HA 4P4MA 5CA7A 4WCWA 2BCQA 1RZTA 4IG8A 1ZQUA 1MIVA 2W9MA 8ICQA 3C2LA 5DBAA 4OAHA 3H38A 2M2WA 4I2BA 3V7LA 4NLKA 4JWNA 1KNYA 3AQLA 3ISBA 7ICGA 2ZH9A 1TFWA 4IQTA 1WOTA 4FHXA 9ICXA 7ICIA 4AT7A 4TUPA 1BPYA 4S3NA 2M2TA 4I2GA 4NKTA 7ICJA 7ICPA 9ICKA 8ICOA 4X4PA 1VJ7A 1FA0A 1JN3A 4DOBA 2DVIA 2PFPA 4QZCA 3JPQA 3WFRE 3C66A 8ICWA 5J2JA 5J2GA 1MQ3A 4K4GA 9ICLA 7ICLA 1ZQTA 8ICTA 4NLNA 4EP7A 3V7KA 4NXVA 3PNCA 4I2IA 4XQ8A 4NLZA 1ZJMA 4LT6A 4FH5A 5CP2A 2RFFA 2ID1A 3UQ0A 5HRDA 4KLEA 1ZQWA 3C5GA 4KLLA 4WC2A 4KLGA 4R63A 2B56A 4X4QA 4O67A 1NOMA 4UAYA 4YD2A 3OGUA 4F5QA 4PGXA 7ICSA 1ZQKA 3TFSA 8ICYA 4MFCA 4RPYA 4K96A 2HHPA 4I28A 5HRBA 4QZGA 3LK9A 1UETA 4K98A 5J0OA 4AT7B 2PFOA 1F5AA 5J0PA 4O6AA 5CHGA 8ICGA 3JPOA 8ICHA 3H3AA 2DR7A 4X0AA 4Z6EA 3RJJA 1ZQPA 4TUSA 2P66A 1JMSA 4P2HA 4JWMA 2ISOA 4GXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQW A;  8ICI A;  4QZI A;  4Z6D A;  4K99 A;  3AQN A;  5DBB A;  1ZQX A;  1MQ2 A;  4KLQ A;  4QZ8 A;  5J0Q A;  4UB2 A;  4KLU A;  3AQK A;  4DO9 A;  1ZQV A;  4KLT A;  3NYB A;  4OAF A;  7ICK A;  1ZQN A;  4LEZ A;  5DKW A;  4M2Y A;  3H39 A;  5D49 A;  9ICS A;  2ZH8 A;  4KM5 A;  4AT9 A;  3AUO A;  1BPX A;  1ZQS A;  4YMO A;  4KLI A;  3RJK A;  4O5E A;  4O69 A;  2O5A A;  4PHP A;  5J2F A;  4KLH A;  3K75 D;  4KLF A;  1XSN A;  4I2F A;  9ICW A;  1ZQF A;  3AQM A;  5IIM A;  4K8V A;  5III A;  4M0A A;  4NXU A;  4RQ5 A;  2BCR A;  2BCV A;  4DOC A;  4Z6F A;  3OVB A;  3GDX A;  4WC6 A;  3MGI A;  4I2D A;  4NM1 A;  4K4H A;  2ZH3 A;  9ICE A;  5HR9 A;  4RT2 A;  4QZA A;  4QZE A;  4I2J A;  5DDY A;  4LEY A;  1VFG A;  9ICG A;  5J0S A;  3WFQ E;  4M04 A;  1ZQI A;  4Z6C A;  3PMN A;  1OU5 A;  4RPZ A;  9ICN A;  4TUR A;  8ICE A;  8ICB A;  3UXO A;  9ICA A;  3JPP A;  5HRE A;  4FHW A;  4UBC A;  3C5F A;  3WFO A;  1R89 A;  1ZQH A;  4MF8 A;  8ICC A;  4AT9 B;  4WBZ A;  1TVA A;  3UPS A;  1MIW A;  5IIO A;  4NXT A;  4RQ2 A;  4M9J A;  4RQ6 A;  3HJ1 A;  5J0W A;  9ICU A;  4I27 A;  4KLM A;  1UEU A;  4YD1 A;  4R64 A;  4YMN A;  4XQ7 A;  1Q79 A;  4KLO A;  4PHA A;  4UAZ A;  4KB6 A;  3RH5 A;  4WC0 A;  2BPG A;  4K4I A;  2ISP A;  3MDA A;  1RPL A;  4PPX A;  5J2B A;  1XSL A;  4YMM A;  2M2V A;  4E80 A;  4UAW A;  5BOL A;  9ICP A;  4FHV A;  3MGH A;  1ZQA A;  8ICZ A;  7ICQ A;  9ICB A;  4WC1 A;  4YCX A;  3HX0 A;  2VAN A;  1ZQL A;  4LZD A;  4UD4 A;  4JLX A;  8ICN A;  4TUQ A;  4M9H A;  4RQ3 A;  3WFP A;  5HRK A;  1ZQD A;  4X4S A;  5IIJ A;  4O5C A;  3RJE A;  3L9D A;  1R8B A;  4RQ8 A;  4DOA A;  3JPT A;  8ICJ A;  4K9B A;  1MIY A;  1HUO A;  1BPB A;  5CJ7 A;  3AU2 A;  1R8A A;  3MDC A;  4RWO A;  4M9G A;  4O5K A;  3WFS C;  4QZ9 A;  4P4O A;  3V72 A;  3ISC A;  3RH4 A;  5J2C A;  5J29 A;  3C2M A;  9ICI A;  2ZHA A;  5DEC A;  9ICV A;  4R66 A;  1JQR A;  4XRH A;  2BE3 A;  4OAI Z;  5BOM A;  8ICM A;  1YLQ A;  1BPE A;  5J2E A;  3HIY A;  4RWQ A;  5HRH A;  2FMQ A;  7ICU A;  9ICQ A;  3JPN A;  4GXI A;  3AU6 A;  4PGY A;  4QZB A;  5DED A;  4WC3 A;  3C2K A;  1ZJN A;  3UXN A;  8ICK A;  1ZQB A;  4RQ4 A;  3HWT A;  9ICH A;  4O68 A;  5CWR A;  1HUZ A;  5J2I A;  3RJF A;  4RWP A;  2PFQ A;  4P4P A;  4X4R A;  4RQ0 A;  3OVS A;  4UB1 A;  5DBC A;  4KLS A;  7ICV A;  3JPR A;  2IHM A;  4NXW A;  4I2A A;  5HRI A;  5J0T A;  1BPD A;  1BPZ A;  2PBE A;  4ATB A;  4QZF A;  8ICR A;  4MFF A;  5F2V O;  4QZD A;  1ZQM A;  2ZH2 A;  4E8F A;  2DR9 A;  1ZQZ A;  3JPS A;  4X4U A;  4YN4 A;  8ICF A;  4KLJ A;  4F5O A;  4K97 A;  9ICF A;  4X4O A;  2DRB A;  7ICN A;  5DB9 A;  4PHE A;  4WOY A;  2BPC A;  5TZV A;  2DR8 A;  8ICL A;  4UB3 A;  5D46 A;  4X4T A;  4PGQ A;  5HRG A;  4LZG A;  5HRL A;  7ICE A;  5J0X A;  1UEV A;  4UBB A;  4WC7 A;  3OVA A;  4M5D A;  5HRF A;  1PX5 A;  1TFY A;  4LVS A;  7ICR A;  4NY8 A;  4XUS A;  5HHH A;  1ZQY A;  4FHY A;  4WBY A;  4E7X A;  4UB4 A;  4M47 A;  8ICV A;  3RJG A;  1JAJ A;  3UXP A;  2FMS A;  4XA5 A;  7ICO A;  1NO5 A;  2BCS A;  5IIN A;  4JLZ A;  2ZH5 A;  7ICM A;  4ATB B;  2BCU A;  2GWS A;  9ICC A;  4AT8 A;  4FHP A;  5J0R A;  3OUY A;  1R8C A;  4MKP A;  5CR0 A;  5EOZ A;  4PHD A;  4I2H A;  2DRA A;  1XSP A;  3LQC B;  3PML A;  4M9L A;  4X4V A;  4WC5 A;  9ICT A;  4NM2 A;  3OV7 A;  3V7J A;  3HJ4 A;  8ICP A;  5DB6 A;  9ICR A;  5J2D A;  5DDM A;  1ZQE A;  1KEJ A;  5HHI A;  4NXZ A;  1ZQR A;  4RQ7 A;  3B0X A;  8ICS A;  5HC9 A;  3C18 A;  3H37 A;  4NKU A;  2DR5 A;  5J0Y A;  9ICO A;  4EBK A;  3HW8 A;  4IQV A;  4X4N A;  4EBJ A;  2ZH6 A;  2ZHB A;  4X0B A;  8ICU A;  4AT8 B;  5J2A A;  4FO6 A;  4KLD A;  4OAG A;  1ZQJ A;  3OUY B;  2NRK A;  4WC4 A;  4F5R A;  4I2E A;  3ISD A;  5J2K A;  4LEW A;  4MF2 A;  4IQU A;  2FMP A;  4GXK A;  2PFN A;  1ZQC A;  4I2C A;  5DB7 A;  4UD5 A;  4R65 A;  3TFR A;  2PXI A;  4LEV A;  3MBY A;  4NXX A;  8ICA A;  4PH5 A;  1ZQO A;  2O1P A;  4X5V A;  1TV9 A;  2ZH1 A;  3RJI A;  4F5N A;  4RT3 A;  1KDH A;  7ICH A;  1ZQQ A;  5BPC A;  2ZH7 A;  5DB8 A;  4QZH A;  4F5P A;  3UPQ A;  5IIK A;  2Q66 A;  4MFA A;  4K9A A;  4RWN A;  1V4A A;  3B0Y A;  3JYY A;  1ZQG A;  8ICX A;  2ZH4 A;  3JZ0 A;  3RJH A;  4O9M A;  4RQ1 A;  5CB1 A;  2I9G A;  3RH6 A;  7ICT A;  4UB5 A;  2BPF A;  1Q78 A;  5D4B A;  4I29 A;  9ICJ A;  5IIL A;  7ICF A;  9ICM A;  4FH3 A;  2M2U A;  3UQ2 A;  4RPX A;  4M9N A;  5J0U A;  5J2H A;  4P4M A;  5CA7 A;  4WCW A;  2BCQ A;  1RZT A;  4IG8 A;  1ZQU A;  1MIV A;  2W9M A;  8ICQ A;  3C2L A;  5DBA A;  4OAH A;  3H38 A;  2M2W A;  4I2B A;  3V7L A;  4NLK A;  4JWN A;  1KNY A;  3AQL A;  3ISB A;  7ICG A;  2ZH9 A;  1TFW A;  4IQT A;  1WOT A;  4FHX A;  9ICX A;  7ICI A;  4AT7 A;  4TUP A;  1BPY A;  4S3N A;  2M2T A;  4I2G A;  4NKT A;  7ICJ A;  7ICP A;  9ICK A;  8ICO A;  1VJ7 A;  4X4P A;  1FA0 A;  1JN3 A;  4DOB A;  2DVI A;  2PFP A;  4QZC A;  3JPQ A;  3WFR E;  3C66 A;  8ICW A;  5J2J A;  5J2G A;  1MQ3 A;  4K4G A;  9ICL A;  7ICL A;  1ZQT A;  8ICT A;  4NLN A;  4EP7 A;  3V7K A;  4NXV A;  3PNC A;  4I2I A;  4XQ8 A;  4NLZ A;  1ZJM A;  4LT6 A;  4FH5 A;  5CP2 A;  2RFF A;  2ID1 A;  3UQ0 A;  5HRD A;  4KLE A;  1ZQW A;  3C5G A;  4KLL A;  4WC2 A;  4KLG A;  4R63 A;  4X4Q A;  4O67 A;  1NOM A;  4UAY A;  4YD2 A;  3OGU A;  4F5Q A;  4PGX A;  7ICS A;  1ZQK A;  3TFS A;  8ICY A;  4MFC A;  4RPY A;  4K96 A;  2HHP A;  4I28 A;  5HRB A;  4QZG A;  3LK9 A;  1UET A;  4K98 A;  5J0O A;  4AT7 B;  2PFO A;  1F5A A;  5J0P A;  4O6A A;  5CHG A;  8ICG A;  3JPO A;  8ICH A;  3H3A A;  4X0A A;  2DR7 A;  4Z6E A;  3RJJ A;  1ZQP A;  4TUS A;  2P66 A;  1JMS A;  4P2H A;  4JWM A;  2ISO A;  4GXJ A; 
#chains in the Genus database with same CATH topology
 4IQW A;  8ICI A;  4QZI A;  1GPJ A;  4Z6D A;  4K99 A;  3AQN A;  5DBB A;  1ZQX A;  1MQ2 A;  4KLQ A;  4QZ8 A;  4WQK A;  5J0Q A;  4UB2 A;  4KLU A;  3AQK A;  4DO9 A;  1ZQV A;  4KLT A;  3NYB A;  4OAF A;  7ICK A;  1ZQN A;  4LEZ A;  2B4V A;  5DKW A;  3CK6 A;  4M2Y A;  3H39 A;  5D49 A;  9ICS A;  2ZH8 A;  4KM5 A;  4AT9 A;  3AUO A;  5B3Q A;  1BPX A;  1ZQS A;  4YMO A;  4KLI A;  3RJK A;  4O5E A;  4O69 A;  2O5A A;  4PHP A;  5J2F A;  4KLH A;  3K75 D;  4KLF A;  2B51 A;  1XSN A;  4I2F A;  9ICW A;  3PHZ A;  1ZQF A;  3AQM A;  5D63 A;  4K8V A;  5IIM A;  5III A;  4M0A A;  4NXU A;  4RQ5 A;  2BCR A;  2BCV A;  3OVB A;  4Z6F A;  4DOC A;  3GDX A;  4WC6 A;  3MGI A;  4I2D A;  4EV6 A;  4WH5 A;  4NM1 A;  4K4H A;  2ZH3 A;  9ICE A;  5HR9 A;  4RT2 A;  4QZA A;  4QZE A;  4I2J A;  5DDY A;  4LEY A;  1VFG A;  9ICG A;  5J0S A;  3WFQ E;  4M04 A;  1ZQI A;  4Z6C A;  3PMN A;  1OU5 A;  4RPZ A;  9ICN A;  4TUR A;  4N7R A;  8ICE A;  8ICB A;  3UXO A;  9ICA A;  3JPP A;  5HRE A;  4FHW A;  4UBC A;  3C5F A;  3WFO A;  1R89 A;  1ZQH A;  4MF8 A;  8ICC A;  4AT9 B;  4WBZ A;  4I0U A;  1TVA A;  3UPS A;  1MIW A;  5IIO A;  4NXT A;  4RQ2 A;  4M9J A;  4RQ6 A;  3HJ1 A;  5J0W A;  4FO1 A;  9ICU A;  4I27 A;  4KLM A;  1UEU A;  4YD1 A;  4R64 A;  4YMN A;  4XQ7 A;  1Q79 A;  4KLO A;  4PHA A;  4UAZ A;  4KB6 A;  3RH5 A;  4WC0 A;  2BPG A;  4K4I A;  2ISP A;  3MDA A;  1RPL A;  4PPX A;  5J2B A;  1XSL A;  4YMM A;  2M2V A;  3K7D A;  4E80 A;  5BOL A;  4UAW A;  9ICP A;  4FHV A;  3MGH A;  1ZQA A;  8ICZ A;  7ICQ A;  3NKU A;  9ICB A;  4WC1 A;  4YCX A;  3HX0 A;  2VAN A;  1ZQL A;  4LZD A;  4UD4 A;  4JLX A;  8ICN A;  4TUQ A;  4M9H A;  4RQ3 A;  3WFP A;  5HRK A;  1ZQD A;  4X4S A;  5IIJ A;  4O5C A;  3RJE A;  3L9D A;  1R8B A;  4RQ8 A;  4DOA A;  5B3P A;  3JPT A;  8ICJ A;  4K9B A;  1MIY A;  1HUO A;  1BPB A;  5CJ7 A;  3NVO A;  3AU2 A;  1R8A A;  3MDC A;  3JCF A;  4RWO A;  4M9G A;  4O5K A;  3WFS C;  4QZ9 A;  4P4O A;  3V72 A;  3ISC A;  3RH4 A;  5J2C A;  5J29 A;  3C2M A;  9ICI A;  2ZHA A;  5DEC A;  9ICV A;  4R66 A;  1JQR A;  4XRH A;  4XJE A;  2BE3 A;  4OAI Z;  5BOM A;  8ICM A;  2BBJ A;  1YLQ A;  1BPE A;  5J2E A;  3HIY A;  4RWQ A;  5HRH A;  2FMQ A;  7ICU A;  9ICQ A;  3JPN A;  4GXI A;  3AU6 A;  4PGY A;  4QZB A;  5DED A;  4WC3 A;  3C2K A;  1ZJN A;  3UXN A;  8ICK A;  1ZQB A;  4RQ4 A;  3HWT A;  9ICH A;  4O68 A;  5CWR A;  1HUZ A;  5J2I A;  3RJF A;  4RWP A;  2PFQ A;  4P4P A;  4EEB A;  4X4R A;  4RQ0 A;  5CFU A;  3OVS A;  4UB1 A;  5DBC A;  4KLS A;  7ICV A;  3JPR A;  2IHM A;  4NXW A;  4I2A A;  5HRI A;  5J0T A;  1BPD A;  1BPZ A;  2PBE A;  4ATB A;  4QZF A;  8ICR A;  4MFF A;  5F2V O;  4QZD A;  1ZQM A;  2ZH2 A;  4E8F A;  2DR9 A;  1ZQZ A;  3JPS A;  4X4U A;  4YN4 A;  5CFS A;  8ICF A;  4KLJ A;  4F5O A;  4K97 A;  9ICF A;  4X4O A;  2DRB A;  7ICN A;  5DB9 A;  4PHE A;  4WOY A;  2BPC A;  5TZV A;  2DR8 A;  8ICL A;  5D46 A;  4X4T A;  4UB3 A;  4PGQ A;  5HRG A;  4LZG A;  5HRL A;  7ICE A;  5J0X A;  1UEV A;  4UBB A;  4WC7 A;  3OVA A;  4M5D A;  5HRF A;  1PX5 A;  1TFY A;  4LVS A;  7ICR A;  4NY8 A;  4XUS A;  5HHH A;  1ZQY A;  4FHY A;  4WBY A;  4E7X A;  4UB4 A;  4M47 A;  8ICV A;  3RJG A;  1JAJ A;  3UXP A;  2FMS A;  4XA5 A;  7ICO A;  1NO5 A;  2BCS A;  5IIN A;  4JLZ A;  2ZH5 A;  7ICM A;  4ATB B;  2BCU A;  2GWS A;  9ICC A;  4AT8 A;  4FHP A;  5J0R A;  3OUY A;  1R8C A;  4MKP A;  5CR0 A;  5EOZ A;  4PHD A;  2GA9 D;  2DRA A;  4I2H A;  1XSP A;  2IUB A;  3LQC B;  5D61 A;  3PML A;  4M9L A;  4X4V A;  4WC5 A;  9ICT A;  4NM2 A;  3OV7 A;  3V7J A;  3HJ4 A;  8ICP A;  5DB6 A;  9ICR A;  5J2D A;  5DDM A;  1ZQE A;  1KEJ A;  5HHI A;  4NXZ A;  4WQL A;  1ZQR A;  4RQ7 A;  3B0X A;  2FCL A;  4EGW A;  8ICS A;  5HC9 A;  3C18 A;  3H37 A;  3MCR A;  4NKU A;  2DR5 A;  5J0Y A;  9ICO A;  4EBK A;  3HW8 A;  4IQV A;  4X4N A;  2HN2 A;  4EBJ A;  2ZH6 A;  2ZHB A;  2IHO A;  4X0B A;  8ICU A;  2BBH A;  4AT8 B;  5J2A A;  4FO6 A;  4KLD A;  4OAG A;  1ZQJ A;  3OUY B;  4WC4 A;  2NRK A;  4F5R A;  4I2E A;  3ISD A;  4HX0 A;  5J2K A;  4LEW A;  5CHE A;  4MF2 A;  4IQU A;  2FMP A;  4GXK A;  2PFN A;  1ZQC A;  4I2C A;  5DB7 A;  4UD5 A;  4R65 A;  3TFR A;  2PXI A;  4LEV A;  3MBY A;  4NXX A;  8ICA A;  4PH5 A;  1ZQO A;  3ERC C;  2O1P A;  4X5V A;  1TV9 A;  2ZH1 A;  3RJI A;  4EED A;  4F5N A;  4RT3 A;  3EF2 A;  1KDH A;  7ICH A;  1ZQQ A;  5BPC A;  2ZH7 A;  5DB8 A;  4QZH A;  4F5P A;  3UPQ A;  5IIK A;  2Q66 A;  4MFA A;  4K9A A;  4RWN A;  1V4A A;  3B0Y A;  3JYY A;  1ZQG A;  8ICX A;  2ZH4 A;  3JZ0 A;  3RJH A;  4O9M A;  4RQ1 A;  5CB1 A;  2I9G A;  3RH6 A;  7ICT A;  4UB5 A;  2BPF A;  5D62 A;  1Q78 A;  5D4B A;  4I29 A;  9ICJ A;  5IIL A;  7ICF A;  9ICM A;  4FH3 A;  2M2U A;  3UQ2 A;  4RPX A;  4M9N A;  5J0U A;  5J2H A;  4P4M A;  5CA7 A;  4WCW A;  2BCQ A;  1RZT A;  4IG8 A;  1ZQU A;  1MIV A;  2W9M A;  2HN1 A;  8ICQ A;  3C2L A;  5DBA A;  4OAH A;  2GAF D;  3H38 A;  2M2W A;  4I2B A;  3V7L A;  4NLK A;  4JWN A;  1KNY A;  3AQL A;  3ISB A;  7ICG A;  2ZH9 A;  1TFW A;  4IQT A;  1WOT A;  4FHX A;  2EWR A;  3OWG A;  9ICX A;  7ICI A;  4AT7 A;  3NWI A;  4TUP A;  1BPY A;  4S3N A;  2M2T A;  4I2G A;  4NKT A;  7ICJ A;  7ICP A;  9ICK A;  8ICO A;  4X4P A;  1VJ7 A;  1FA0 A;  1JN3 A;  4DOB A;  2DVI A;  5JTG A;  2PFP A;  3ER8 C;  4QZC A;  3JPQ A;  3WFR E;  3C66 A;  8ICW A;  5J2J A;  5J2G A;  1MQ3 A;  4K4G A;  9ICL A;  7ICL A;  1ZQT A;  8ICT A;  4NLN A;  4EP7 A;  3V7K A;  4NXV A;  3PNC A;  4I2I A;  4XQ8 A;  4NLZ A;  1ZJM A;  4LT6 A;  4FH5 A;  5CP2 A;  2RFF A;  2ID1 A;  3UQ0 A;  5HRD A;  4KLE A;  1ZQW A;  3C5G A;  4KLL A;  4WC2 A;  4KLG A;  4R63 A;  2B56 A;  4X4Q A;  4O67 A;  1NOM A;  4UAY A;  4YD2 A;  3OGU A;  4F5Q A;  4PGX A;  7ICS A;  1ZQK A;  3TFS A;  8ICY A;  4MFC A;  4RPY A;  4K96 A;  2HHP A;  4I28 A;  5HRB A;  4QZG A;  3LK9 A;  1UET A;  5CFT A;  4K98 A;  5J0O A;  4AT7 B;  2PFO A;  1F5A A;  5J0P A;  4O6A A;  5CHG A;  8ICG A;  3ER9 B;  3JPO A;  8ICH A;  3H3A A;  2DR7 A;  4X0A A;  4Z6E A;  3RJJ A;  1ZQP A;  4TUS A;  2P66 A;  1JMS A;  4P2H A;  4JWM A;  2ISO A;  4GXJ A; 
#chains in the Genus database with same CATH homology
 4IQW A;  8ICI A;  4QZI A;  4Z6D A;  4K99 A;  3AQN A;  5DBB A;  1ZQX A;  1MQ2 A;  4KLQ A;  4QZ8 A;  5J0Q A;  4UB2 A;  4KLU A;  3AQK A;  4DO9 A;  1ZQV A;  4KLT A;  3NYB A;  4OAF A;  7ICK A;  1ZQN A;  4LEZ A;  2B4V A;  5DKW A;  4M2Y A;  3H39 A;  5D49 A;  9ICS A;  2ZH8 A;  4KM5 A;  4AT9 A;  3AUO A;  1BPX A;  1ZQS A;  4YMO A;  4KLI A;  3RJK A;  4O5E A;  4O69 A;  2O5A A;  4PHP A;  5J2F A;  4KLH A;  3K75 D;  4KLF A;  2B51 A;  1XSN A;  4I2F A;  9ICW A;  1ZQF A;  3AQM A;  5IIM A;  4K8V A;  5III A;  4M0A A;  4NXU A;  4RQ5 A;  2BCR A;  2BCV A;  3OVB A;  4Z6F A;  4DOC A;  3GDX A;  4WC6 A;  3MGI A;  4I2D A;  4NM1 A;  4K4H A;  2ZH3 A;  9ICE A;  5HR9 A;  4RT2 A;  4QZA A;  4QZE A;  4I2J A;  5DDY A;  4LEY A;  1VFG A;  9ICG A;  5J0S A;  3WFQ E;  4M04 A;  1ZQI A;  4Z6C A;  3PMN A;  1OU5 A;  4RPZ A;  9ICN A;  4TUR A;  8ICE A;  8ICB A;  3UXO A;  9ICA A;  3JPP A;  5HRE A;  4FHW A;  4UBC A;  3C5F A;  3WFO A;  1R89 A;  1ZQH A;  4MF8 A;  8ICC A;  4AT9 B;  4WBZ A;  1TVA A;  3UPS A;  1MIW A;  5IIO A;  4NXT A;  4RQ2 A;  4M9J A;  4RQ6 A;  3HJ1 A;  5J0W A;  9ICU A;  4I27 A;  4KLM A;  1UEU A;  4YD1 A;  4R64 A;  4YMN A;  4XQ7 A;  1Q79 A;  4KLO A;  4PHA A;  4UAZ A;  4KB6 A;  3RH5 A;  4WC0 A;  2BPG A;  4K4I A;  2ISP A;  3MDA A;  1RPL A;  4PPX A;  5J2B A;  1XSL A;  4YMM A;  2M2V A;  4E80 A;  5BOL A;  4UAW A;  9ICP A;  4FHV A;  3MGH A;  1ZQA A;  8ICZ A;  7ICQ A;  9ICB A;  4WC1 A;  4YCX A;  3HX0 A;  2VAN A;  1ZQL A;  4LZD A;  4UD4 A;  4JLX A;  8ICN A;  4TUQ A;  4M9H A;  4RQ3 A;  3WFP A;  5HRK A;  1ZQD A;  4X4S A;  5IIJ A;  4O5C A;  3RJE A;  3L9D A;  1R8B A;  4RQ8 A;  4DOA A;  3JPT A;  8ICJ A;  4K9B A;  1MIY A;  1HUO A;  1BPB A;  5CJ7 A;  3AU2 A;  1R8A A;  3MDC A;  4RWO A;  4M9G A;  4O5K A;  3WFS C;  4QZ9 A;  4P4O A;  3V72 A;  3ISC A;  3RH4 A;  5J2C A;  5J29 A;  3C2M A;  9ICI A;  2ZHA A;  5DEC A;  9ICV A;  4R66 A;  1JQR A;  4XRH A;  2BE3 A;  4OAI Z;  5BOM A;  8ICM A;  1YLQ A;  1BPE A;  5J2E A;  3HIY A;  4RWQ A;  5HRH A;  2FMQ A;  7ICU A;  9ICQ A;  3JPN A;  4GXI A;  3AU6 A;  4PGY A;  4QZB A;  5DED A;  4WC3 A;  3C2K A;  1ZJN A;  3UXN A;  8ICK A;  1ZQB A;  4RQ4 A;  3HWT A;  9ICH A;  4O68 A;  5CWR A;  1HUZ A;  5J2I A;  3RJF A;  4RWP A;  2PFQ A;  4P4P A;  4X4R A;  4RQ0 A;  3OVS A;  4UB1 A;  5DBC A;  4KLS A;  7ICV A;  3JPR A;  2IHM A;  4NXW A;  4I2A A;  5HRI A;  5J0T A;  1BPD A;  1BPZ A;  2PBE A;  4ATB A;  4QZF A;  8ICR A;  4MFF A;  5F2V O;  4QZD A;  1ZQM A;  2ZH2 A;  4E8F A;  2DR9 A;  1ZQZ A;  3JPS A;  4X4U A;  4YN4 A;  8ICF A;  4KLJ A;  4F5O A;  4K97 A;  9ICF A;  4X4O A;  2DRB A;  7ICN A;  5DB9 A;  4PHE A;  4WOY A;  2BPC A;  5TZV A;  2DR8 A;  8ICL A;  5D46 A;  4X4T A;  4UB3 A;  4PGQ A;  5HRG A;  4LZG A;  5HRL A;  7ICE A;  5J0X A;  1UEV A;  4UBB A;  4WC7 A;  3OVA A;  4M5D A;  5HRF A;  1PX5 A;  1TFY A;  4LVS A;  7ICR A;  4NY8 A;  4XUS A;  5HHH A;  1ZQY A;  4FHY A;  4WBY A;  4E7X A;  4UB4 A;  4M47 A;  8ICV A;  3RJG A;  1JAJ A;  3UXP A;  2FMS A;  4XA5 A;  7ICO A;  1NO5 A;  2BCS A;  5IIN A;  4JLZ A;  2ZH5 A;  7ICM A;  4ATB B;  2BCU A;  2GWS A;  9ICC A;  4AT8 A;  4FHP A;  5J0R A;  3OUY A;  1R8C A;  4MKP A;  5CR0 A;  5EOZ A;  4PHD A;  2DRA A;  4I2H A;  1XSP A;  3LQC B;  3PML A;  4M9L A;  4X4V A;  4WC5 A;  9ICT A;  4NM2 A;  3OV7 A;  3V7J A;  3HJ4 A;  8ICP A;  5DB6 A;  9ICR A;  5J2D A;  5DDM A;  1ZQE A;  1KEJ A;  5HHI A;  4NXZ A;  1ZQR A;  4RQ7 A;  3B0X A;  8ICS A;  5HC9 A;  3C18 A;  3H37 A;  4NKU A;  2DR5 A;  5J0Y A;  9ICO A;  4EBK A;  3HW8 A;  4IQV A;  4X4N A;  4EBJ A;  2ZH6 A;  2ZHB A;  4X0B A;  8ICU A;  4AT8 B;  5J2A A;  4FO6 A;  4KLD A;  4OAG A;  1ZQJ A;  3OUY B;  2NRK A;  4WC4 A;  4F5R A;  4I2E A;  3ISD A;  5J2K A;  4LEW A;  4MF2 A;  4IQU A;  2FMP A;  4GXK A;  2PFN A;  1ZQC A;  4I2C A;  5DB7 A;  4UD5 A;  4R65 A;  3TFR A;  2PXI A;  4LEV A;  3MBY A;  4NXX A;  8ICA A;  4PH5 A;  1ZQO A;  2O1P A;  4X5V A;  1TV9 A;  2ZH1 A;  3RJI A;  4F5N A;  4RT3 A;  1KDH A;  7ICH A;  1ZQQ A;  5BPC A;  2ZH7 A;  5DB8 A;  4QZH A;  4F5P A;  3UPQ A;  5IIK A;  2Q66 A;  4MFA A;  4K9A A;  4RWN A;  1V4A A;  3B0Y A;  3JYY A;  1ZQG A;  8ICX A;  2ZH4 A;  3JZ0 A;  3RJH A;  4O9M A;  4RQ1 A;  5CB1 A;  2I9G A;  3RH6 A;  7ICT A;  4UB5 A;  2BPF A;  1Q78 A;  5D4B A;  4I29 A;  9ICJ A;  5IIL A;  7ICF A;  9ICM A;  4FH3 A;  2M2U A;  3UQ2 A;  4RPX A;  4M9N A;  5J0U A;  5J2H A;  4P4M A;  5CA7 A;  4WCW A;  2BCQ A;  1RZT A;  4IG8 A;  1ZQU A;  1MIV A;  2W9M A;  8ICQ A;  3C2L A;  5DBA A;  4OAH A;  3H38 A;  2M2W A;  4I2B A;  3V7L A;  4NLK A;  4JWN A;  1KNY A;  3AQL A;  3ISB A;  7ICG A;  2ZH9 A;  1TFW A;  4IQT A;  1WOT A;  4FHX A;  9ICX A;  7ICI A;  4AT7 A;  4TUP A;  1BPY A;  4S3N A;  2M2T A;  4I2G A;  4NKT A;  7ICJ A;  7ICP A;  9ICK A;  8ICO A;  4X4P A;  1VJ7 A;  1FA0 A;  1JN3 A;  4DOB A;  2DVI A;  2PFP A;  4QZC A;  3JPQ A;  3WFR E;  3C66 A;  8ICW A;  5J2J A;  5J2G A;  1MQ3 A;  4K4G A;  9ICL A;  7ICL A;  1ZQT A;  8ICT A;  4NLN A;  4EP7 A;  3V7K A;  4NXV A;  3PNC A;  4I2I A;  4XQ8 A;  4NLZ A;  1ZJM A;  4LT6 A;  4FH5 A;  5CP2 A;  2RFF A;  2ID1 A;  3UQ0 A;  5HRD A;  4KLE A;  1ZQW A;  3C5G A;  4KLL A;  4WC2 A;  4KLG A;  4R63 A;  2B56 A;  4X4Q A;  4O67 A;  1NOM A;  4UAY A;  4YD2 A;  3OGU A;  4F5Q A;  4PGX A;  7ICS A;  1ZQK A;  3TFS A;  8ICY A;  4MFC A;  4RPY A;  4K96 A;  2HHP A;  4I28 A;  5HRB A;  4QZG A;  3LK9 A;  1UET A;  4K98 A;  5J0O A;  4AT7 B;  2PFO A;  1F5A A;  5J0P A;  4O6A A;  5CHG A;  8ICG A;  3JPO A;  8ICH A;  3H3A A;  2DR7 A;  4X0A A;  4Z6E A;  3RJJ A;  1ZQP A;  4TUS A;  2P66 A;  1JMS A;  4P2H A;  4JWM A;  2ISO A;  4GXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...