2I9GA

Dna polymerase beta with a benzo[c]phenanthrene diol epoxide adducted guanine base
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
325
Chain Sequence
b'ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*TP*CP*GP*G)-3'
publication title Structure of DNA polymerase beta with a benzo[c]phenanthrene diol epoxide-adducted template exhibits mutagenic features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 109
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2i9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2i9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2i9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2i9gA03
1ZQPA 4FHXA 1NK8A 4O9MA 4ECVA 3RH6A 4F4YA 4RPXA 4UD4A 4K4HA 3LWLA 3PX0A 4JWMA 1DK2A 2IHMA 5IIMA 1FA0A 5KT2A 4C8KA 2NRWA 2M9NA 3Q8SB 1OU5A 2XY7A 1R89A 2ZH8A 4DFPA 1K1QA 3NGDA 4IQUA 3OV7A 4MEYA 4PHPA 4J9KA 1NKBA 1L5UA 5J2DA 2XY6A 4YD2A 1BPZA 5EWFA 3BQ2A 4O5KA 4DL4A 3MDAA 4I2DA 1RXWA 1S0MA 1ZQHA 1D9FA 2F1HA 2JEJA 1ZQEA 7ICGA 1BGXT 3H39A 4F5PA 8ICZA 5J0RA 3MGHA 3RAXA 3C66A 3GILA 4FH3A 1X9MA 4ED6A 1BVSA 1NK7A 3M8RA 5KG0A 4J9QA 1L3UA 1N48A 1U49A 2C28A 4F2SA 2UVVA 5KG5A 4RQ6A 4RQ1A 3RB0A 5IILA 1TKDA 4M5DA 4X4SA 1S97A 4RUCA 4HYKA 5DBBA 3UQ0A 1U47A 5J0QA 5HNKA 5L1IA 1TAQA 2AGOA 4M9HA 4IG8A 1XC9A 4YFKA 1MQ2A 3UXPA 1QSLA 4YR3A 1N56A 2JEGA 5HRIA 3AU6A 3H3AA 3PW4A 2R8JA 5CHGA 2RDJA 2F1IA 2HHSA 1BPDA 1U9LA 4QWBA 4J9SA 4Q8EA 3PW2A 1Y88A 2ZTDA 3RBEA 5KFTA 1ZQOA 4IR1A 3QZ7A 4UQGA 4X4RA 4QZ8A 1B43A 2DR8A 2UVWA 3C5GA 4RPZA 2V4QA 4YXMA 2LYHA 3C1ZA 2VA3A 4RWNA 1SL2A 4F5OA 4LT6A 3ETLA 2ZHBA 2KZ3A 4R63A 3SV4A 1ZQKA 3OHAA 4Q8FA 3UPQA 4PGXA 5HRHA 1NK0A 4M9LA 2ASJA 1BPYA 4F5RA 4DSJA 3IM1A 4DF4A 4ED2A 4RT2A 3GIKA 5DG7A 3RJGA 4DO9A 5KFFA 4XRHA 8ICRA 5DBAA 1KFSA 4EBEA 4O5EA 3MR5A 5J2IA 5DB7A 3RJJA 4RNNA 4PHAA 4KLGA 3M9OB 1KEJA 2XO7A 3RBDA 2W9MA 3C21A 4F4ZA 3MR3A 1ZQLA 1XWLA 2H5XA 1S10A 2FLNA 5HRFA 3UPSA 2KN7A 2P6RA 3PX6A 1ZQSA 1RPLA 1V9PA 2BPGA 3PY8A 1HJPA 8ICTA 3KHLA 3EYZA 5D4BA 1T7PA 8ICVA 3G6XA 1BNOA 1UA0A 5J2EA 2DPJA 4B9LA 4MF2A 2ID1A 5KFSA 3PO4A 7ICFA 4R8UA 2I9GA 4ATBA 2DRBA 4X4NA 3OUYA 4M9GA 4ATBB 3MGIA 4M47A 3ZDBA 4ED1A 2BQ3A 4B9UA 4IRKA 2O1PA 4RUAA 4GXIA 5HR9A 4WBYA 4DLEA 4G3IA 4J9RA 1L3TA 4FHWA 4EBKA 5BOMA 4CCHA 5J2FA 1AROP 1S9FA 4X0BA 3RB3A 4YP3A 3H8WA 4UB4A 3ISDA 4EYIB 2AU0A 4ED0A 1XSNA 1DK3A 5J0OA 1S77D 4AT9A 3WFSC 1ZQVA 2BQRA 4I29A 4AT9B 4YXJA 4M9NA 2BCRA 4BWMA 2VA8A 4KLFA 2F1JA 5DDMA 3AQKA 2ZUBA 1ZQBA 1XO1A 3H4DA 2ZHAA 5KG3A 4LVSA 4ECZA 4RNOA 3LWMA 5F9NA 2JEIA 4KLUA 1JMSA 3BQ1A 8ICHA 1Z3EB 3ISBA 5KFBA 4YR2A 3BJYA 2Y1IA 4YMNA 3PVXA 4I2AA 5HRGA 4DS5A 9ICVA 5L1JA 2C22A 1B22A 4DF8A 4EBCA 1JQRA 1R8CA 3UQ2A 4ELUA 5KFRA 3TAQA 1ZJMA 1R8AA 4DL6A 5J29A 5KFZA 3ZDCA 2UVUA 1F5AA 1IXRA 2I1QA 2RFFA 4RQ8A 1BPXA 1ZQCA 1ZQTA 2BR0A 8ICYA 3OVSA 3V6HA 5DKWA 3JPRA 3HPOA 3NTUA 4RQ3A 3RH5A 3TARA 2NRXA 4MFCA 4YQWA 7ICEA 9ICLA 2AQ0A 4S3NA 4RT3A 2ZTEA 3G6YA 2ZH3A 2JEFA 2XCPA 1C7YA 2GWSA 4FHPA 2ZH2A 2AJQA 1ZQUA 2XGPA 4I2BA 4X4VA 4Z6FA 5KG1A 5DLGA 3MBYA 2DRAA 4YD1A 4UB3A 4DQQA 4R66A 4DSKA 8ICWA 1XSPA 4XA5A 1KDHA 3H38A 7ICHA 4MFAA 2AQ4A 3V72A 2ASLA 4QW8A 5KFXA 3RR8A 4WC1A 2HHUA 1U45A 4I2GA 3HIYA 5KFYA 3JPPA 2Q0ZX 2DFLA 3N4MB 5KFGA 5DGAA 1LB2B 4J9NA 3TFSA 1U4BA 4NLKA 2HHVA 1NO5A 2ISPA 2ISOA 1R8BA 1TFRA 3RB6A 3HJ1A 2Q66A 2IHNA 8ICLA 3KHRA 3JPNA 1Q78A 4O3NA 4M9JA 1A76A 4DOCA 5KFCA 4JK1A 4FO6A 4DSLA 2BHNA 1DOQA 2HHQA 3NYBA 4UAYA 4AT8A 5DEDA 4AT8B 3WFOA 9ICCA 3PW0A 1NZPA 5BPCA 9ICJA 1XS9D 4DL2A 5D46A 5J0XA 4UB5A 4GXKA 5HRKA 4UAZA 3RJIA 2NRZA 4TUPA 2P66A 4IR9A 2KP7A 4IQWA 3TANA 1RYSA 4BXOA 2ZH1A 3AUOA 4YG2A 4BXOB 3GIIA 5J2AA 4P4OA 2J6TA 3LQCB 3KHHA 1NOMA 2KZZA 7ICPA 9ICNA 2O5AA 1BPBA 1S0VA 5BOLA 8ICNA 9ICIA 2JZBA 4J9LA 4P2HA 5KFAA 4IQTA 4ED3A 3H37A 4QZIA 2JZBB 2AGQA 4NLZA 3RRGA 4K4GA 2PFQA 4EZ6A 2HVIA 4R65A 4DLGA 4B9SA 5JUMA 3PO5A 3OGUA 4GLXA 4QZHA 3M9NB 4C8MA 4BWJA 4F5QA 4DL3A 4MFFA 1ZQNA 2ZJ8A 3SI8A 3B0YA 4X4PA 4QZ9A 4EZ9A 7ICLA 2NRVA 3C2KA 7ICTA 4IRDA 3BQTA 1QTMA 4PH5A 4J9OA 1X9WA 2C2EA 2BDPA 5KFDA 5IINA 4DSEA 4F50A 3RH4A 5HC9A 2NRTA 3ZD8A 4XQ7A 1ZQFA 4DEZA 5DDYA 8ICUA 1H38A 2A1JA 5KG4A 3TQ1A 2HHWA 4DSFA 2ASDA 1KLNA 2A1JB 4KLIA 2PBEA 3OSNA 3Q8QB 4QWCA 3Q8RB 3GDXA 2FMSA 3E2EA 1RYRA 4F2RA 1COOA 3H8JA 3T5LA 4QZCA 4PHDA 3C2MA 4O3SA 7ICSA 4XQ8A 2BCQA 4E7XA 1TFYA 5DG9A 4F92B 4QZBA 7ICRA 4XUSA 4KLHA 4NLGA 3N97B 1RXVA 5KFKA 1UEUA 1D9DA 3EW9A 4ED7A 2FLPA 7ICNA 1JN3A 2ZUCA 4DL7A 4NXZA 2AGPA 8ICBA 9ICWA 3T5JA 3JPTA 4KN7A 1KFTA 3V7LA 3GIJA 1L3SA 4B9TA 8ICEA 2M2TA 5DQGA 1NK4A 2R8IA 3OSPA 4KLEA 7ICOA 3OVBA 2DR7A 5KFWA 1KNYA 4B9NA 3OVAA 5DQIA 4ECUA 3RJFA 3AQLA 5CJ7A 2B21A 2BGWA 3RJHA 4QZAA 2HVHA 1V4AA 1PZNA 4QZGA 3M8SA 3GIMA 3GQCA 4RNMA 4KLTA 4E8FA 4EBJA 4C8NA 1JIHA 4R8UB 4UAWA 4EEYA 3H7IA 1TVAA 4DQIA 3AQMA 1TFWA 9ICFA 1TK0A 4I2JA 8ICFA 9ICKA 5J0YA 4RWQA 4TURA 3HW8A 1ZETA 4WC7A 1MC8A 3G6VA 1T8EA 2IBKA 4O3OA 2ZTCA 3Q8LA 3RAQA 1JXEA 3MFHA 2IA6A 4JWNA 2BKEA 4KLSA 1SKRA 1ZQDA 8ICMA 4KTQA 4NKTA 5KG2A 2ZH4A 4QZEA 3RRHA 8ICSA 5HHHA 4FBTA 2P6UA 1KFDA 3EPGA 5KT3A 5KT4A 9ICRA 4I2CA 2RDIA 3ORYA 2XCAA 1UT5A 1ZQYA 4J9PA 4DOAA 2PFPA 1KRPA 2DR5A 3JPSA 4X5VA 5HRBA 3PV8A 4FHYA 3THVA 3C1YA 2DPIA 1KSPA 2J6UA 9ICAA 3T5HA 2KFNA 1UT8A 4DOBA 3Q8PB 2C2DA 3RJEA 4C8OA 1Q79A 1ZQIA 4QZFA 3JPOA 2BCSA 2KTQA 2VA2A 2Y1JA 4ECYA 8ICXA 4P4PA 5J0TA 5CR0A 2R8HA 3B0XA 4F93B 3MDCA 5EOZA 3Q8MA 8ICOA 2DR9A 3MABA 1NKCA 1MSWD 4I2FA 4RQ0A 3SV3A 2NRKA 2ZH5A 4F5NA 4DQPA 1IM4A 4KLMA 4UD5A 3WFRE 4RPYA 9ICBA 4UB1A 1TK8A 1RZTA 5KT6A 2VANA 3FDSA 1NK5A 1ZQQA 4ELTA 7ICUA 4KLJA 3UXNA 3V6KA 3PW5A 2R8KA 4ECTA 4DQRA 1L3VA 4KLQA 3H8SA 3OUYB 1SKSA 2ZH7A 5DGBA 1NJZA 4GXJA 9ICTA 5KG7A 4O3QA 1SZPA 3RR7A 4YMMA 3BDPA 2HHXA 2FPKA 3IHQB 5KFIA 2FMPA 4F4KA 3HP6A 2FLLA 3ZDAA 2PFOA 3ZDDA 4BGDA 3JPQA 4DFKA 4ZH4A 4O5CA 4O3RA 7ICIA 1YLQA 5C5JA 2W9BA 4DQSA 3ZD9A 4RQ4A 1NJYA 3QE9Y 1S0OA 3RJKA 4F8RA 2W9BB 2ZJ5A 4M0AA 3JZ0A 3Q8KA 2ZH6A 4F4WA 4DWIA 1MIVA 1VJ7A 3EZ5A 1EXNA 7ICKA 4RQ7A 3C18A 1U48A 5EWGA 1WOTA 4DFJA 4B9MA 9ICSA 1TK5A 4MEXA 4B9VA 3SYZA 2V9WA 5L1LA 2OWOA 4K4IA 4TQSA 3K4GA 4Z6EA 3UXOA 3TAPA 1MQ3A 3QEBZ 1S76D 2HW3A 4GC7A 7ICVA 3PMLA 3GV7B 3RB4A 1WCNA 3M9MB 1NK6A 2ZJAA 9ICXA 4I2IA 5KFVA 1XU4A 4LZDA 5DB8A 4Q44A 2W8LA 1S0NA 4E0DA 4X4TA 1ZQMA 4X0AA 2J6SA 4F91B 4PPXA 1ZQWA 1SL1A 3FYHA 5HRLA 3HJ4A 4FS2A 5KFNA 1QSSA 1CEZA 7ICJA 4WC4A 4NKUA 3PR5B 4ECSA 5IIKA 1X2IA 3AQNA 4WC6A 1K1SA 1UETA 3L9DA 5DECA 4X4QA 5J2CA 4KLLA 5KFJA 5J0UA 5EWEA 3KHGA 1XSLA 4RZRA 4J9MA 5J2GA 5IIIA 3V7JA 2FPLA 3PW7A 4JV2A 9ICUA 4ECWA 1BNPA 3EPIA 1QLNA 5J2KA 4KMUA 2UVRA 3HT3A 1ZJNA 1MIWA 5KT5A 2ZH9A 4JV0A 4YMOA 5J2BA 4WC0A 2M2UA 4ELVA 3ISCA 5DQHA 9ICEA 3JYYA 4QWDA 5KFMA 4DL5A 5DG8A 1UA1A 4Z6CA 4FHVA 4RQ2A 3OJUA 9ICMA 2W8KA 2MAXA 2W9CA 3V7KA 2PXIA 1ZQGA 1BPEA 4JUZA 4ECXA 1JXLA 5CP2A 4I2HA 2W9CB 4M2YA 5F2VO 1JX4A 1DGSA 5KTQA 4I2EA 4M04A 4IQVA 3PNCA 1QSYA 4ECRA 3LK9A 5KFUA 4GC6A 4RU9A 2R8GA 2BE3A 4NM2A 5J0WA 5KFLA 2XGQA 1X9SA 1ZQZA 3EWAA 1A77A 4O3PA 4YCXA 4PHEA 4WC5A 1Z00A 4KN4A 1NJXA 2FMQA 3QZ8A 1ZYQA 8ICAA 1Z00B 2BCUA 8ICGA 3C23A 1D8YA 3PX4A 5HREA 5KT7A 4TUSA 4EYHB 5DLFA 2BQUA 4PGYA 4QZDA 2XY5A 1NK9A 5KFPA 9ICOA 4X4UA 3SZ2A 2KFZA 5DB6A 1T4GA 9ICQA 1NKEA 2KZMA 2V4RA 4UBCA 1CUKA 5J2HA 2PI4A 3PMNA 5CB1A 4P4MA 1TAUA 2DVIA 4EP7A 3ZDEA 5J0SA 4Q45A 3GV8B 9ICGA 2ALZA 4BDPA 3LDAA 2WTFA 1HUZA 3HX0A 8ICPA 5IIJA 9ICHA 2M2WA 5HHIA 5L9XA 5KG6A 2PFNA 4UBBA 3T3FA 4I27A 4NM1A 3MR2A 4F4XA 5J2JA 5IIOA 3MFIA 5HP4A 3MR6A 4F3OA 2HHPA 2FPMA 5CA7A 2HHTA 1WCLA 3K75D 1KTQA 5DBCA 4R64A 3KTQA 2IMWP 4DSIA 4ED8A 5KFQA 3C2LA 1ZQXA 1ZQJA 4FH5A 4DFMA 5HMMA 5F9LA 3BQ0A 3AU2A 1SKWA 4RWPA 1PX5A 4YVZA 3PR4A 4ECQA 2BPFA 3OJSA 7ICMA 5KFEA 4O0IA 4PGQA 3WFQE 4DS4A 4FS1A 1ZQRA 2ZUDA 4YN4A 1LV5A 8ICIA 5HRDA 2BCVA 4E80A 4Z6DA 5CWRA 3GFKB 3T5KA 1NJWA 1UEVA 5KFHA 4Q43A 1ZQAA 3TFRA 4X4OA 4I28A 2PI5A 4NY8A 3OHBA 5D49A 4NLNA 1HUOA 3TI0A 8ICJA 8ICQA 1MIYA 4UB2A 5J0PA 3HWTA 4MF8A 4KLOA 2M2VA 4EBDA 2C2RA 4WBZA 3QEAZ 9ICPA 4WC2A 2XC9A 4IRCA 3C5FA 8ICCA 2BPCA 4WC3A 1VFGA 7ICQA 4AT7A 4TUQA 3H40A 1SL0A 4WCWA 4QW9A 1T3NA 4AT7B 4QWEA 4YR0A 5L1KA 1D8LA 4M6WA 5KFOA 4RQ5A 4JV1A 3RTVA 5HMLA 3V6JA 4M6WB 3WFPA 4QWAA 5TZVA 4LZGA 4KITB 4TQRA 3H4BA 1TV9A 2ATLA 2W9AA 5DB9A 4FBUA 1JAJA 2MUTA 4RWOA 4C8LA 8ICKA 2MUTB 4KLDA 3GV5B
chains in the Genus database with same CATH superfamily
2A3VA 4O9MA 2FCLA 1SXDA 2KMDA 1FA0A 1JALA 5IIMA 1R89A 3NGDA 4IQUA 1L5UA 5J2DA 1N62A 3BQ2A 4DL4A 3MDAA 2PKEA 1D9FA 1ZQEA 4F5PA 8ICZA 3MGHA 1X9MA 3AL0B 3M8RA 5KG0A 1C20A 1N48A 2UVVA 4RQ6A 4RQ1A 3RB0A 1Q8KA 3N7PD 4HYKA 1HEKA 1XC9A 1MQ2A 2JEGA 1QSLA 2HBMA 1A0PA 2F1IA 1U9LA 4QWBA 3QZ7A 4BX9C 4QZ8A 3RFAA 3QUTA 3IG8A 2AXTU 4WJ3B 1TAMA 4OJPA 3UPQA 4PGXA 1BPYA 4NLCA 2HOFA 4DCCA 4DO9A 2CPRA 5DBAA 1KFSA 4EBEA 3M9OB 2ISPA 2LBOA 1S10A 5HRFA 1T3QA 2KN7A 2BPGA 1T7PA 1BNOA 8ICVA 2DRBA 3CYMA 2ID1A 3PO4A 2I9GA 4ATBA 3MGIA 5AI0A 4ED1A 3OUYB 2HOQA 3N7SC 4RUAA 1N5XA 5HR6A 2OHFA 3KZXA 5BOMA 3H0RB 4X0BA 4YP3A 2AU0A 3ISDA 1WWVA 4I29A 1SB3C 4YXJA 4M9NA 3GU3A 4BWMA 2F1JA 3F2CA 2MRLA 4RQMA 2ZHAA 5F9NA 5AI9A 3PVXA 4I2AA 4EBCA 3UQ2A 5KFRA 3WK9A 1R8AA 2KIVA 1DGJA 3ZDCA 8ICYA 4EELA 4CF3A 3V6HA 4RQ3A 7ICEA 3TARA 2AQ0A 2ZTEA 2JEFA 2GWSA 2XGPA 4I2BA 5KG1A 4NL9C 4AYBF 1KDHA 3BZKA 2E8MA 5AK3A 4MFAA 4QW8A 2DKZA 4PL2A 2WAQF 4I2GA 2WF9A 3QUBA 1LB2B 4NLKA 3T79A 1R8BA 2ISOA 3C28A 1QQ6A 1Q78A 2KVSA 4O3NA 1A76A 2ZIXB 4CNQA 2VJ4A 1LKYB 4FO6A 4AT8A 2F77X 2HHQA 3NYBA 5BPCA 1GPJA 4DL2A 2NRZA 4TUPA 1UHUA 3AUOA 3GIIA 2J6TA 3LQCB 1XNSA 3KHHA 1NOMA 1HIWA 2ZIWB 4Y2UA 1Q46A 5BOLA 3IP4B 4IQTA 4K99A 2JZBB 4NLZA 3RF9A 2JHDA 4EZ6A 4B9SA 1ECWA 3PO5A 3D2NA 5AKYA 3OGUA 1J97A 4EENA 2WB1F 3SI8A 3M7DA 4X4PA 4QZ9A 3KKAC 4IRDA 1IG6A 5AKGA 4PH5A 2FI1A 5IINA 3RH4A 3EUB2 3ZD8A 5DDYA 8ICUA 3TQ1A 5KG4A 2HHWA 2ASDA 2A1JB 4KLIA 2PBEA 2RHFA 3ER9B 4QWCA 3GDXA 2FMSA 5ALWA 2K4PA 5AIAA 3QUCA 4O3SA 7ICSA 2NYVA 2W03A 5AICA 4KLHA 3N97B 4LJXA 5KFKA 3EW9A 2FLPA 5ALXA 4NXZA 2AGPA 8ICBA 1KFTA 2W3RA 3JPTA 4C80A 3GIJA 8ICEA 2M2TA 3PHZA 4KLEA 3UMCA 5CJ7A 4QZGA 5EE1A 3M8SA 4RNMA 3L3FX 4DQIA 3EF2A 3WK8A 1SIJA 1MC8A 2IBKA 1VJ5A 1JRPA 2ZIVB 2ES6A 4KTQA 2N1RA 2ZH4A 4GFJA 3I76A 1KN5A 4Y2PA 9ICRA 2RP5A 3ORYA 2JV3A 1UT5A 5B3QA 2PFPA 3JPSA 5HRBA 3THVA 2J6UA 4DOBA 3Q8PB 3RJEA 4C8OA 1Q79A 2YQEA 4ECYA 5J0TA 2R8HA 4F93B 3WKCA 4EGWA 1MSWD 4F5NA 9ICBA 2FDRA 4KLJA 3ERCC 3QYPA 3PW5A 1L3VA 4KLQA 3H8SA 5CFSA 4UARA 2E5SA 4GIBA 4F4KA 2FLLA 2PFOA 4BGDA 4O3RA 1PVQA 2W9BA 3NVOA 1V38A 7ICKA 4RQ7A 5EE3A 5EWGA 1WOTA 2LPEA 1WUDA 2OM6A 3K4GA 1MQ3A 2QB1A 3PMLA 5AM1A 2KEYA 2YX8A 2ZJAA 2YMLA 5KFVA 4LZDA 3D2SA 3F2DA 1NZBA 1S0NA 4E0DA 1ZQMA 2K8CB 4F91B 1ZQWA 3HJ4A 1QSSA 2JMGA 1CEZA 7ICJA 3TACB 3PR5B 1K1SA 5HR7A 4QNLA 2QB0B 4JV2A 4ECWA 3SAFA 4KMUA 2KJ8A 5KT5A 4YMOA 5J2BA 5ALOA 1O03A 4FHVA 1Z4OA 3V7KA 4C4SA 2W9CA 4ECXA 3NASA 2R18A 4I0UA 1QSYA 1F44A 2EH9A 2CN1A 4NM2A 5J0WA 1Z1BA 2EZXA 1Q3VA 3UMBA 1X9SA 3EWAA 3IRUA 5ALTA 1Z00A 3WKBA 4KN4A 3QZ8A 2BCUA 5ALIA 5AM4A 1MA7A 1D8YA 5HREA 4TUSA 2DKXA 4X4UA 3PSFA 1NKEA 2KZMA 1ZQ1C 4UBCA 1X42A 4Y2JA 5AI8A 1TE2A 2DVIA 4JMUA 3ED5A 4Q45A 4BDPA 3LDAA 4UBBA 3T3FA 4NM1A 4C7YA 5J2JA 5HP4A 1PVRA 3MR6A 2HHPA 5G5GA 1WCLA 3K75D 4DSIA 4LEWA 4UAUA 1MN8A 2ZG6A 3NRZA 3MGVA 5F9LA 3HRDD 3AU2A 2PMZF 2G09A 4ECQA 2BPFA 7ICMA 2KSOB 5KFEA 5AK4A 2ZUDA 1LV5A 4E80A 4DFDA 2D8CA 2HBLA 1NJWA 1X66A 3TI0A 8ICQA 4UB2A 3KZIU 1N63A 3ALRA 5J0PA 3HWTA 9ICPA 1J2MA 4NJ8A 4WC3A 4F72A 4AT7A 4FFDA 1D8LA 3V6JA 4M6WB 2DL0A 4QWAA 3F5AA 4LZGA 4KITB 2ATLA 5AI5A 4RWOA 3PZPA 4KLDA 3GV5B 4ECVA 4UD4A 4JWMA 2IHMA 3BS5A 2M9NA 1OU5A 1WWUA 1K1QA 2E8OA 2IUBA 4MEYA 3OV7A 1NKBA 1RDFA 4YD2A 1BPZA 4PZNA 5ALNA 2JEJA 4KX5A 2G06A 3H39A 2HDOA 4FH3A 3GILA 1NK7A 1BVSA 5ALMA 4F2SA 4X4SA 4RUCA 5CRXA 5DBBA 2D3DA 3UQ0A 1U47A 5J0QA 5HNKA 3NVWA 4IG8A 3H3AA 3AU6A 3PW4A 3WKEA 2E3TA 4WH5A 4UB8U 2ZIUA 5JRTA 2RDJA 1WYGA 2KG5A 4J9SA 5KAIU 1Y88A 2ZTDA 4US9A 3RBEA 1ZQOA 2DR8A 3NVZA 2W43A 2NO5A 3QXGA 2E8PA 5ALKA 5D61A 4YXMA 3C1ZA 4RWNA 1SL2A 3PSPA 2EAMA 4AYBC 2WAQC 5AHXA 2ASJA 4F5RA 4DSJA 2WF8A 4ED2A 3RJGA 3GIKA 5DG7A 1YZ7A 8ICRA 4F71A 3NRWA 1NI3A 2HBKA 3RJJA 4KLGA 4PHAA 1KEJA 5AI4A 2W9MA 3C21A 1XWLA 2H5XA 3UPSA 5TISU 2OCEA 3PY8A 5AM3A 3G6XA 3QU9A 3IG5A 4MF2A 4B9LA 4OJLA 2YN4A 2HCFA 4R8UA 4M9GA 4ATBB 4M47A 4PL1A 2O1PA 4UAVA 4DLEA 4G3IA 2YB4A 2MSNA 4CCHA 1AROP 1KL9A 3RB3A 3H8WA 1XSNA 2WB1C 4ED0A 3WFSC 1S77D 4U7CA 2K8BB 1S5LU 5DDMA 1RQNA 2JEIA 1F5SA 2Y1IA 4YMNA 5AM0A 5L1JA 1R8CA 1ZJMA 4EV6A 5J29A 5KFZA 2RFFA 1F5AA 1IXRA 3OVSA 4RQ8A 1DRGA 1BPXA 5DKWA 3RH5A 4S3NA 3D6JA 4YQWA 3N28A 1C7YA 3LYSA 2EZYA 3K7DA 5AKEA 4DSKA 4R66A 8ICWA 3H38A 4NXWA 2Q66A 2G5IB 5KFYA 3N4MB 1N61A 1NO5A 3HJ1A 1TFRA 8ICLA 5KL8B 2YB1A 5KFCA 3I28A 3L4PA 5DEDA 4AT8B 1NZPA 3OWGA 5D46A 4UB5A 5HRKA 1ZD2P 4BXOA 5J2AA 1Q3UA 2KZZA 7ICPA 2O5AA 1S0VA 9ICIA 4ED3A 2EWRA 4QZIA 2HVIA 4R65A 4QJFB 4GLXA 3E0FA 3M9NB 2Y9TA 4BWJA 4DL3A 4MFFA 2ZJ8A 2E1EA 3SEIA 1ZXIA 7ICLA 2NRVA 3C2KA 7ICTA 2H3QA 1QTMA 1X9WA 3IV6A 2NRTA 4P0PA 5F3XB 4DSFA 1SZHA 1X40A 1PVPA 1RYRA 4F2RA 4E7XA 4XQ8A 2BCQA 4F92B 4XUSA 4O67A 4NLGA 1COKA 1RXVA 1D9DA 2YMPA 2G07A 1JN3A 2ZUCA 9ICWA 4ZOHC 2B6GA 2B51A 3OVBA 4OCZA 5KFWA 4B9NA 5DQIA 3RJFA 2BGWA 1Z1VA 1L7MA 4KLTA 4X4TA 4UAWA 1TFWA 3H7IA 3QU5A 9ICFA 9ICKA 3Q8LA 3RAQA 2IA6A 2BKEA 1ZQDA 4NKTA 4WOYA 5KG2A 4ICAA 4QZEA 1JROA 3EPGA 5KT4A 1SV0A 2RDIA 2W11A 2XCAA 4J9PA 3SQIA 2DWQA 5EE0A 3C1YA 2DPIA 1UT8A 2Y0SF 2C2DA 3JPOA 1S8OA 4P4PA 3HJEA 3B0XA 2WF6A 4IC9A 2QKQA 1VDVA 3SMVA 3MABA 4WQLA 4EX7A 3SV3A 4UD5A 4RPYA 1FEZA 4ELTA 7ICUA 3V6KA 4ECTA 4DQRA 1SKSA 5DGBA 1NJZA 1X6JA 3BDPA 5KFIA 2A1AA 2FMPA 7ICIA 5L1MA 1YLQA 3QE9Y 4F8RA 5J8YA 2ZJ5A 2W9BB 2ZH6A 3Q8KA 5FP0A 4EEBA 4B9MA 3SYZA 5ALZA 4TQSA 3UXOA 4Z6EA 1S76D 2HW3A 1CRXA 9ICXA 4I2IA 1F0MA 4RQNA 2WF5A 5DB8A 2W8LA 2HSZA 2NO4A 4OO1J 2PMZC 1SL1A 5HRLA 2HI0A 3AQNA 1X2IA 4WC6A 3L9DA 2EAOA 5DECA 5KFJA 5J0UA 5EWEA 2F8LA 4J9MA 2FPLA 3QU7A 3EPIA 1QLNA 1N2XA 1ZJNA 2UVRA 5T14A 5JTGA 4PZOA 1A6SA 1KBUA 5B3PA 4DL5A 1UA1A 4Z6CA 2E1FA 3OJUA 4JUZA 1JXLA 5CP2A 2W9CB 2F76X 4M2YA 1JX4A 3WK4A 4IQVA 2EQYA 4ECRA 2KIWA 3LK9A 2YTUA 5EE9A 4GC6A 2H3VA 3OPXA 3SR6A 4LEYA 2XGQA 4PHEA 1DXSA 4WC5A 1RYUA 4OJ5A 8ICAA 1Z00B 3PX4A 4EYHB 5DLFA 9ICOA 2XY5A 1NK9A 1PUZA 2HN2A 3SD7A 5AI6A 5J2HA 3PMNA 5CB1A 3F53A 3ZDEA 2GAFD 2ALZA 5IIJA 5HHIA 5KG6A 1QCKA 4I27A 1QQ7A 2IOHA 2B4VA 5IIOA 4K98A 3MFIA 4K96A 4F3OA 2QLTA 3CNHA 2HHTA 2CRXA 5DBCA 5AKKA 1ZQXA 3C2LA 4FH5A 4DFMA 2XICA 3A0HU 4UATA 4NWIA 4RWPA 1QH9A 1PX5A 2JH7A 3NVYA 4PGQA 2LMRA 1RQLA 1ZQRA 5HRDA 3GFKB 3T5KA 5KFHA 4Q43A 3TFRA 4X4OA 4I28A 2PI5A 1MIYA 4XJEA 4NLNA 8ICJA 4A8EA 4OAFA 2W54A 2M2VA 4KLOA 3TADA 4EBDA 3QEAZ 4IRCA 8ICCA 3H40A 4AT7B 5CHEA 3FC4A 4JV1A 5L1KA 2VJ5A 5KFOA 4RQ5A 5HMLA 3WFPA 2KE7A 3H4BA 2Q4TA 3HILA 5DB9A 4FBUA 4OJOA 8ICKA 3AN1A 4FHXA 1NK8A 5ALVA 1IV8A 2KHVA 1N60A 3PX0A 1DK2A 5KT2A 4C8KA 3Q8SB 2XY7A 2ZH8A 3BS5B 1PK3A 1P7DA 5KAFU 3JCFA 4PHPA 4J9KA 1FO4A 2XY6A 5EWFA 4O5KA 1RXWA 4I2DA 1ZQHA 4XQ7A 1BGXT 5J0RA 2VKQA 3C66A 2QARA 4J9QA 1L3UA 1QQ5A 1U49A 3AMZA 5IILA 4KM5A 5AK5A 5L1IA 5HRIA 4YFKA 3UXPA 5GTHU 1N56A 4FO1A 2MA1A 2JH1A 2ZIUB 2HHSA 4Q8EA 3PW2A 1K5OA 5ALDA 4IS7A 4X4RA 4UQGA 1B43A 2UVWA 3F2BA 3C5GA 4RPZA 1PK1A 2F44A 2ZHBA 2KZ3A 3SV4A 1NK0A 4M9LA 5AKXA 4XRHA 2BZFA 3MR5A 4RNNA 1BNPA 3RBDA 4F4ZA 4IL6U 3MR3A 3U26A 1ZQLA 2FLNA 2O6KA 1ZQSA 1RPLA 8ICTA 3KHLA 3QU2A 1UA0A 1L6NA 7ICFA 2GOLA 3KFUF 4B9UA 4IRKA 4GXIA 5HR9A 2OXOA 3AM9A 4J9RA 1L3TA 4FHWA 5CFUA 5J2FA 1S9FA 4J03A 4UB4A 4AT9A 2BQRA 2BCRA 5KL1B 3AQKA 1ZD3A 5KG3A 4LVSA 3LWMA 8ICHA 1JMSA 3ISBA 3BJYA 1X6IA 3ZI4A 4DS5A 2C22A 1B22A 1JQRA 3TAQA 3NWIA 4DL6A 3H8MA 1SV0C 2UVUA 1ZRMA 1ZQTA 2NRXA 9ICLA 4NV0A 4RT3A 2ZH3A 2XCPA 1JUDA 3QU4A 2AJQA 4Y2TA 4X4VA 2FJ6A 3MBYA 2DRAA 4YD1A 4DQQA 4XA5A 2AQ4A 3V72A 2ASLA 5KFXA 4WC1A 2HHUA 1U45A 2KICA 2OYYA 3JPPA 5KFGA 5DGAA 4JB3A 4J9NA 3TFSA 1U4BA 1OXJA 1SWWA 3KHRA 3JPNA 4M9JA 4JK1A 2BHNA 1DOQA 3M6ZA 4UAYA 2RRDA 4UB6U 2WHEA 3WFOA 4PJ0U 1XS9D 2EDUA 4UAZA 3RJIA 2P66A 4Y2YA 3QX7A 4IQWA 4YG2A 4BXOB 4P4OA 5J8YC 2JGAA 9ICNA 3H37A 2EANA 4EX6A 2AGQA 4K4GA 2K8AA 3SENA 4DLGA 3FAHA 2IHOA 4C8MA 1ZQNA 1ED1A 2Y0SC 5ALRA 2NV3A 4OAIZ 4EZ9A 1UCVA 2C2EA 1L7NA 4DSEA 4F50A 4CDGA 5JU5A 3C29A 4P0PB 1KLNA 3OSNA 2M0NA 3Q8QB 3E2EA 2H3FA 3T5LA 3H8JA 1KKXA 3C2MA 2BBJA 5DG9A 3WKDA 4QZBA 7ICRA 4C4TA 3FM9A 1J2NA 7ICNA 2YMMA 3QUQA 1N5WA 1L3SA 1SWVA 4MHVA 5DQGA 2H3ZA 3B9JA 7ICOA 2DR7A 3AQLA 4NLBA 5ALGA 3RJHA 2HVHA 2OEHA 2W7PA 1PZNA 3GIMA 4E8FA 1JIHA 2KVCA 1TK0A 3CW2C 3DDHA 4I2JA 4RWQA 4TURA 3HW8A 3G6VA 1JXEA 4JWNA 2DUYA 1SKRA 5AIBA 1L8LA 4JLXA 2IOFK 2HMXA 2YMQA 3A0BU 3RRHA 2KNJA 4FBTA 4KX3A 5C0YA 5KT3A 4I2CA 5AM2A 1KRPA 4X5VA 2K4HA 3PV8A 4O3MA 9ICAA 3VCBA 2BCSA 2VA2A 3HKZF 2Y1JA 4LEVA 1YT3A 5CR0A 8ICOA 3KBBA 2XI9A 4RQ0A 3WFRE 4KLMA 1IM4A 1Z4NA 3CP8A 4UB1A 1TK8A 1RZTA 2LM1A 5KT6A 3FDSA 1ZQQA 3UXNA 4FZMA 4GXJA 9ICTA 5KG7A 3RR7A 1SZPA 5B5EU 2HHXA 5K4LA 2B0CA 2FPKA 3GZFA 2XIDA 5ALPA 3ZDAA 3ZDDA 2KK0A 4DFKA 1FFUA 5C5JA 4DQSA 4I2HA 3ZD9A 4RQ4A 5F2VO 3RJKA 4M0AA 5H2FU 4F4WA 1MIVA 1VJ7A 3EZ5A 3WK7A 4K97A 3C18A 1TK5A 4MEXA 4B9VA 1T94A 2V9WA 3TAPA 3F5EA 7ICVA 3QEBZ 2F3NA 3RB4A 3M9MB 1XU4A 4Q44A 3NUQA 4X0AA 1OW5A 4PPXA 4G9BA 3FYHA 2KD1A 4NKUA 4N7RA 5IIKA 1UETA 2LKYA 4X4QA 4KLLA 3KHGA 1XSLA 4O6AA 2K89A 2RQ5A 3HT3A 1MIWA 2ZH9A 4JV0A 4WC0A 2HOIA 3ISCA 3JYYA 1B0XA 4QWDA 5KFMA 1RG6A 9ICMA 2W8KA 2MAXA 2PXIA 1FIQA 5KTQA 4I2EA 4M04A 3PNCA 1ZRNA 2GO7A 5KFUA 4RU9A 1WG8A 2R8GA 2BE3A 4OAHA 1ZQZA 4O3PA 1A77A 4YCXA 3R9KA 1M6YA 8ICGA 5ALFA 3C23A 5KT7A 4QZDA 3SZ2A 4QIWF 3BQ7A 1CUKA 2KJ9A 4P4MA 4EP7A 1URJA 9ICGA 4CGZA 1VLBA 1HUZA 3HX0A 2LI6A 4CE6A 4Y2SA 5L9XA 2PFNA 3MR2A 4F4XA 2KV2A 2KKVA 2FPMA 1KTQA 3L5KA 1ZQJA 5HMMA 4FE3A 3BQ0A 5ALHA 3M1YA 1SKWA 3SAGA 4YVZA 1NNLA 3PR4A 3OJSA 4O0IA 4DS4A 4BUGA 4YN4A 8ICIA 4Z6DA 4NY8A 3OHBA 5D49A 1HUOA 2H3IA 1FFVA 4P0QA 4MF8A 2EAPA 2XC9A 2ZXIA 4US8A 4TUQA 1SL0A 2Z7JA 4OD0A 5D62A 4KMOB 4KB6A 3NVVA 5TZVA 4U6PA 1JAJA 4WQKA 2MUTA 5AK6A 5ALEA 1ZQPA 2E8NA 3RH6A 4F4YA 4RPXA 4K4HA 5ALJA 3LWLA 4WC7A 2NRWA 2RLTA 2P35A 4DFPA 3H0LB 1S0MA 1X9XA 2F1HA 7ICGA 4HX0A 3RAXA 4ED6A 2EZZA 1RM6C 2C28A 2QARB 5KG5A 4M5DA 1TKDA 1S97A 4BJQA 2JXJA 1TAQA 2AGOA 2LYBA 4M9HA 2YY6A 4YR3A 1JI7A 2R8JA 5CHGA 5B66U 1BPDA 4K9AA 5KFTA 4IR1A 3AQFA 2VIXA 5E79U 2V4QA 2VA3A 2LYHA 4CF4A 3ONNA 2KKPA 4F5OA 4LT6A 1PK1B 3ETLA 4CF5A 4R63A 2G08A 5KNIA 3WKAA 3CRXA 1ZQKA 3OHAA 4Q8FA 1L8OA 2L5YA 3E58A 2XVTA 5HRHA 4Y2VA 3IM1A 4DF4A 5AKHA 4RT2A 5KFFA 4O5EA 5J2IA 2AHOB 5DB7A 2D6FC 2XO7A 2BDPA 2ZH2A 2KJ5A 3AQEA 2P6RA 1L7OA 4FZLA 3PX6A 1V9PA 4C4RA 1HJPA 3TKAA 5ALLA 3EYZA 5D4BA 4K8VA 2DPJA 5J2EA 3K1RB 5KFSA 5ALUA 4X4NA 3OUYA 3ZDBA 2BQ3A 4WBYA 3H0MB 4OJ6A 4EBKA 3NKUA 4EYIB 2K60A 1DK3A 5J0OA 1ZQVA 2Y9UA 4AT9B 4KLFA 2VA8A 2ZUBA 1ZQBA 1XO1A 3H4DA 4ECZA 4RNOA 4KLUA 2WFAA 3BQ1A 1Z3EB 5KFBA 4YR2A 1SGGA 5AKJA 1CI4A 5HRGA 1UPHA 9ICVA 4DF8A 3DV9A 4ELUA 3ETRA 2I1QA 2G0AA 1ZQCA 2BR0A 3JPRA 3HPOA 3NTUA 4MFCA 2JRZA 3G6YA 4FHPA 1ZQUA 4Z6FA 4EEDA 5DLGA 4UB3A 2HN1A 1XSPA 7ICHA 3RR8A 3HIYA 2Q0ZX 2DFLA 3LVVA 2HHVA 2ODGA 3RB6A 3BS7A 2LM4A 2LHTA 2IHNA 3PSTA 2ZIXA 1V97A 1LKYA 4DOCA 5ALSA 4DSLA 4O69A 2DQNB 1L7PA 9ICCA 3PW0A 1GO3F 9ICJA 5J0XA 4GXKA 2GLEA 4IR9A 2KP7A 3TANA 1RYSA 2ZH1A 3O0FA 2ZIWA 3SAHA 3WK5A 1BPBA 8ICNA 2JZBA 4J9LA 4P2HA 5KFAA 3UM9A 2KOBA 3DEEA 1KQQA 3RRGA 2PFQA 5JUMA 4QZHA 4F5QA 2I6XA 3B0YA 2HBJA 4MKPA 5G5HA 4NXXA 3HKZC 3BQTA 4J9OA 5KFDA 4USAA 3S6JA 4OAGA 5HC9A 5AM5A 2F2AB 1ZQFA 4AP9A 4DEZA 1H38A 2A1JA 3MCRA 3Q8RB 3KOOA 1COOA 4QZCA 4PHDA 1XO0A 2B56A 1TFYA 1SV4A 1ZD5A 3VC8A 1UEUA 4CRXA 4ED7A 1KW4A 1UQVA 4DL7A 3T5JA 4KN7A 3V7LA 4B9TA 2W7OA 1NK4A 2R8IA 3OSPA 1O08A 1KNYA 3OVAA 4ECUA 2B21A 4QZAA 1V4AA 3GQCA 4K9BA 4EBJA 4C8NA 4R8UB 1TVAA 1ZOLA 4EEYA 3D2QA 3AQMA 2IOFA 8ICFA 5J0YA 1ZETA 2K4EA 1T8EA 4O3OA 2ZTCA 4ACOA 2ZIVA 3MFHA 4KLSA 1AQ6A 8ICMA 1OUQA 4HAIA 2W04A 5CEHA 8ICSA 5HHHA 2WF7A 2P6UA 1KFDA 4DOAA 1ZQYA 4NXVA 2DR5A 4FHYA 3J81j 1KSPA 3T5HA 2KFNA 5AKIA 3ER8C 1ZQIA 4QZFA 8ICXA 2KTQA 4B6JA 5AKLA 2AH5A 4NL9A 3MDCA 5EOZA 3Q8MA 2DR9A 1NKCA 2NRKA 4I2FA 2ZH5A 4DQPA 1NK5A 2VANA 2ZXHA 3IDWA 2R8KA 3WU2U 4C0ZA 2ZH7A 4Y2XA 4O3QA 4C7ZA 4YMMA 3IHQB 1Z19A 3HP6A 4QIWC 3M6KA 3JPQA 4ZH4A 4O5CA 3OTQA 2DF4B 2CXYA 1ZD4A 1NJYA 2I5HA 1S0OA 3JZ0A 2KHQA 4DWIA 1EXNA 1B4FA 3MC1A 1U48A 4DFJA 9ICSA 3NS1A 2OWOA 5L1LA 2W3SA 4K4IA 2F8KA 4GC7A 1IIPA 3GV7B 1WCNA 3KKAA 1NK6A 3IN5A 3BZCA 5ALQA 5A0LA 2J6SA 2ESEA 5CFTA 1V85A 4WC4A 4FS2A 5KFNA 2GA9D 4JLZA 4ECSA 2W55A 5J2CA 4NXUA 4RZRA 5J2GA 2QB0A 5IIIA 3V7JA 3PW7A 9ICUA 5J2KA 3QNMA 2M2UA 4ELVA 9ICEA 5DQHA 2MU2A 3K1ZA 5DG8A 3KD3A 4RQ2A 1ZQGA 1BPEA 2DGZA 3AEVA 2LYAA 4Y2RA 1DGSA 4Y2QA 5KFLA 1NJXA 2FMQA 1ZYQA 5AKZA 2JR5A 3WK6A 4UW9A 2BQUA 4PGYA 5KFPA 2KFZA 5DB6A 1T4GA 1YZ6A 9ICQA 2V4RA 3N7RC 2PI4A 1TAUA 3ICXA 2OH2A 3CK6A 3LVWA 4EEKA 5J0SA 2BDUA 3GV8B 4UASA 8ICPA 9ICHA 2WTFA 2M2WA 2BBHA 2FE9A 4FZNA 4LEZA 5CA7A 4R64A 2GH1A 2IMWP 3KTQA 4ED8A 5KFQA 3PSIA 4O68A 4NXTA 2KSOA 3WFQE 4FS1A 2BCVA 5CWRA 1UEVA 1ZQAA 2DBYA 2G5HB 1LVHA 2C2RA 4P0QB 4WBZA 5D63A 2A19A 1SXEA 4WC2A 3C5FA 2BPCA 5GTIU 1VFGA 7ICQA 5ALYA 4WCWA 4QW9A 1T3NA 4QWEA 4YR0A 3I1YA 3TADC 4M6WA 3RTVA 5JTIA 3UMGA 1D8BA 4TQRA 1TV9A 2W9AA 4C8LA 2MUTB 2K4IA
chains in the Genus database with same CATH topology
1ZQPA 4FHXA 1NK8A 4O9MA 4ECVA 3RH6A 4F4YA 4RPXA 4UD4A 4K4HA 3LWLA 3PX0A 4JWMA 1DK2A 2IHMA 5IIMA 1FA0A 5KT2A 4C8KA 2NRWA 2M9NA 3Q8SB 1OU5A 2XY7A 1R89A 2ZH8A 4DFPA 1K1QA 3NGDA 4IQUA 3OV7A 4MEYA 4PHPA 4J9KA 1NKBA 1L5UA 5J2DA 2XY6A 4YD2A 1BPZA 5EWFA 3BQ2A 4O5KA 4DL4A 3MDAA 4I2DA 1RXWA 1S0MA 1ZQHA 1D9FA 2F1HA 2JEJA 1ZQEA 7ICGA 1BGXT 3H39A 4F5PA 8ICZA 5J0RA 3MGHA 3RAXA 3C66A 3GILA 4FH3A 1X9MA 4ED6A 1BVSA 1NK7A 3M8RA 5KG0A 4J9QA 1L3UA 1N48A 1U49A 2C28A 4F2SA 2UVVA 5KG5A 4RQ6A 4RQ1A 3RB0A 5IILA 1TKDA 4M5DA 4X4SA 1S97A 4RUCA 4HYKA 5DBBA 3UQ0A 1U47A 5J0QA 5HNKA 5L1IA 1TAQA 2AGOA 4M9HA 4IG8A 1XC9A 4YFKA 1MQ2A 3UXPA 1QSLA 4YR3A 1N56A 2JEGA 5HRIA 3AU6A 3H3AA 3PW4A 2R8JA 5CHGA 2RDJA 2F1IA 2HHSA 1BPDA 1U9LA 4QWBA 4J9SA 4Q8EA 3PW2A 1Y88A 2ZTDA 3RBEA 5KFTA 1ZQOA 4IR1A 3QZ7A 4UQGA 4X4RA 4QZ8A 1B43A 2DR8A 2UVWA 3C5GA 4RPZA 2V4QA 4YXMA 2LYHA 3C1ZA 2VA3A 4RWNA 1SL2A 4F5OA 4LT6A 3ETLA 2ZHBA 2KZ3A 4R63A 3SV4A 1ZQKA 3OHAA 4Q8FA 3UPQA 4PGXA 5HRHA 1NK0A 4M9LA 2ASJA 1BPYA 4F5RA 4DSJA 3IM1A 4DF4A 4ED2A 4RT2A 3GIKA 5DG7A 3RJGA 4DO9A 5KFFA 4XRHA 8ICRA 5DBAA 1KFSA 4EBEA 4O5EA 3MR5A 5J2IA 5DB7A 3RJJA 4RNNA 4PHAA 4KLGA 3M9OB 1KEJA 2XO7A 3RBDA 2W9MA 3C21A 4F4ZA 3MR3A 1ZQLA 1XWLA 2H5XA 1S10A 2FLNA 5HRFA 3UPSA 2KN7A 2P6RA 3PX6A 1ZQSA 1RPLA 1V9PA 2BPGA 3PY8A 1HJPA 8ICTA 3KHLA 3EYZA 5D4BA 1T7PA 8ICVA 3G6XA 1BNOA 1UA0A 5J2EA 2DPJA 4B9LA 4MF2A 2ID1A 5KFSA 3PO4A 7ICFA 4R8UA 2I9GA 4ATBA 2DRBA 4X4NA 3OUYA 4M9GA 4ATBB 3MGIA 4M47A 3ZDBA 4ED1A 2BQ3A 4B9UA 4IRKA 2O1PA 4RUAA 4GXIA 5HR9A 4WBYA 4DLEA 4G3IA 4J9RA 1L3TA 4FHWA 4EBKA 5BOMA 4CCHA 5J2FA 1AROP 1S9FA 4X0BA 3RB3A 4YP3A 3H8WA 4UB4A 3ISDA 4EYIB 2AU0A 4ED0A 1XSNA 1DK3A 5J0OA 1S77D 4AT9A 3WFSC 1ZQVA 2BQRA 4I29A 4AT9B 4YXJA 4M9NA 2BCRA 4BWMA 2VA8A 4KLFA 2F1JA 5DDMA 3AQKA 2ZUBA 1ZQBA 1XO1A 3H4DA 2ZHAA 5KG3A 4LVSA 4ECZA 4RNOA 3LWMA 5F9NA 2JEIA 4KLUA 1JMSA 3BQ1A 8ICHA 1Z3EB 3ISBA 5KFBA 4YR2A 3BJYA 2Y1IA 4YMNA 3PVXA 4I2AA 5HRGA 4DS5A 9ICVA 5L1JA 2C22A 1B22A 4DF8A 4EBCA 1JQRA 1R8CA 3UQ2A 4ELUA 5KFRA 3TAQA 1ZJMA 1R8AA 4DL6A 5J29A 5KFZA 3ZDCA 2UVUA 1F5AA 1IXRA 2I1QA 2RFFA 4RQ8A 1BPXA 1ZQCA 1ZQTA 2BR0A 8ICYA 3OVSA 3V6HA 5DKWA 3JPRA 3HPOA 3NTUA 4RQ3A 3RH5A 3TARA 2NRXA 4MFCA 4YQWA 7ICEA 9ICLA 2AQ0A 4S3NA 4RT3A 2ZTEA 3G6YA 2ZH3A 2JEFA 2XCPA 1C7YA 2GWSA 4FHPA 2ZH2A 2AJQA 1ZQUA 2XGPA 4I2BA 4X4VA 4Z6FA 5KG1A 5DLGA 3MBYA 2DRAA 4YD1A 4UB3A 4DQQA 4R66A 4DSKA 8ICWA 1XSPA 4XA5A 1KDHA 3H38A 7ICHA 4MFAA 2AQ4A 3V72A 2ASLA 4QW8A 5KFXA 3RR8A 4WC1A 2HHUA 1U45A 4I2GA 3HIYA 5KFYA 3JPPA 2Q0ZX 2DFLA 3N4MB 5KFGA 5DGAA 1LB2B 4J9NA 3TFSA 1U4BA 4NLKA 2HHVA 1NO5A 2ISPA 2ISOA 1R8BA 1TFRA 3RB6A 3HJ1A 2Q66A 2IHNA 8ICLA 3KHRA 3JPNA 1Q78A 4O3NA 4M9JA 1A76A 4DOCA 5KFCA 4JK1A 4FO6A 4DSLA 2BHNA 1DOQA 2HHQA 3NYBA 4UAYA 4AT8A 5DEDA 4AT8B 3WFOA 9ICCA 3PW0A 1NZPA 5BPCA 9ICJA 1XS9D 4DL2A 5D46A 5J0XA 4UB5A 4GXKA 5HRKA 4UAZA 3RJIA 2NRZA 4TUPA 2P66A 4IR9A 2KP7A 4IQWA 3TANA 1RYSA 4BXOA 2ZH1A 3AUOA 4YG2A 4BXOB 3GIIA 5J2AA 4P4OA 2J6TA 3LQCB 3KHHA 1NOMA 2KZZA 7ICPA 9ICNA 2O5AA 1BPBA 1S0VA 5BOLA 8ICNA 9ICIA 2JZBA 4J9LA 4P2HA 5KFAA 4IQTA 4ED3A 3H37A 4QZIA 2JZBB 2AGQA 4NLZA 3RRGA 4K4GA 2PFQA 4EZ6A 2HVIA 4R65A 4DLGA 4B9SA 5JUMA 3PO5A 3OGUA 4GLXA 4QZHA 3M9NB 4C8MA 4BWJA 4F5QA 4DL3A 4MFFA 1ZQNA 2ZJ8A 3SI8A 3B0YA 4X4PA 4QZ9A 4EZ9A 7ICLA 2NRVA 3C2KA 7ICTA 4IRDA 3BQTA 1QTMA 4PH5A 4J9OA 1X9WA 2C2EA 2BDPA 5KFDA 5IINA 4DSEA 4F50A 3RH4A 5HC9A 2NRTA 3ZD8A 4XQ7A 1ZQFA 4DEZA 5DDYA 8ICUA 1H38A 2A1JA 5KG4A 3TQ1A 2HHWA 4DSFA 2ASDA 1KLNA 2A1JB 4KLIA 2PBEA 3OSNA 3Q8QB 4QWCA 3Q8RB 3GDXA 2FMSA 3E2EA 1RYRA 4F2RA 1COOA 3H8JA 3T5LA 4QZCA 4PHDA 3C2MA 4O3SA 7ICSA 4XQ8A 2BCQA 4E7XA 1TFYA 5DG9A 4F92B 4QZBA 7ICRA 4XUSA 4KLHA 4NLGA 3N97B 1RXVA 5KFKA 1UEUA 1D9DA 3EW9A 4ED7A 2FLPA 7ICNA 1JN3A 2ZUCA 4DL7A 4NXZA 2AGPA 8ICBA 9ICWA 3T5JA 3JPTA 4KN7A 1KFTA 3V7LA 3GIJA 1L3SA 4B9TA 8ICEA 2M2TA 5DQGA 1NK4A 2R8IA 3OSPA 4KLEA 7ICOA 3OVBA 2DR7A 5KFWA 1KNYA 4B9NA 3OVAA 5DQIA 4ECUA 3RJFA 3AQLA 5CJ7A 2B21A 2BGWA 3RJHA 4QZAA 2HVHA 1V4AA 1PZNA 4QZGA 3M8SA 3GIMA 3GQCA 4RNMA 4KLTA 4E8FA 4EBJA 4C8NA 1JIHA 4R8UB 4UAWA 4EEYA 3H7IA 1TVAA 4DQIA 3AQMA 1TFWA 9ICFA 1TK0A 4I2JA 8ICFA 9ICKA 5J0YA 4RWQA 4TURA 3HW8A 1ZETA 4WC7A 1MC8A 3G6VA 1T8EA 2IBKA 4O3OA 2ZTCA 3Q8LA 3RAQA 1JXEA 3MFHA 2IA6A 4JWNA 2BKEA 4KLSA 1SKRA 1ZQDA 8ICMA 4KTQA 4NKTA 5KG2A 2ZH4A 4QZEA 3RRHA 8ICSA 5HHHA 4FBTA 2P6UA 1KFDA 3EPGA 5KT3A 5KT4A 9ICRA 4I2CA 2RDIA 3ORYA 2XCAA 1UT5A 1ZQYA 4J9PA 4DOAA 2PFPA 1KRPA 2DR5A 3JPSA 4X5VA 5HRBA 3PV8A 4FHYA 3THVA 3C1YA 2DPIA 1KSPA 2J6UA 9ICAA 3T5HA 2KFNA 1UT8A 4DOBA 3Q8PB 2C2DA 3RJEA 4C8OA 1Q79A 1ZQIA 4QZFA 3JPOA 2BCSA 2KTQA 2VA2A 2Y1JA 4ECYA 8ICXA 4P4PA 5J0TA 5CR0A 2R8HA 3B0XA 4F93B 3MDCA 5EOZA 3Q8MA 8ICOA 2DR9A 3MABA 1NKCA 1MSWD 4I2FA 4RQ0A 3SV3A 2NRKA 2ZH5A 4F5NA 4DQPA 1IM4A 4KLMA 4UD5A 3WFRE 4RPYA 9ICBA 4UB1A 1TK8A 1RZTA 5KT6A 2VANA 3FDSA 1NK5A 1ZQQA 4ELTA 7ICUA 4KLJA 3UXNA 3V6KA 3PW5A 2R8KA 4ECTA 4DQRA 1L3VA 4KLQA 3H8SA 3OUYB 1SKSA 2ZH7A 5DGBA 1NJZA 4GXJA 9ICTA 5KG7A 4O3QA 1SZPA 3RR7A 4YMMA 3BDPA 2HHXA 2FPKA 3IHQB 5KFIA 2FMPA 4F4KA 3HP6A 2FLLA 3ZDAA 2PFOA 3ZDDA 4BGDA 3JPQA 4DFKA 4ZH4A 4O5CA 4O3RA 7ICIA 1YLQA 5C5JA 2W9BA 4DQSA 3ZD9A 4RQ4A 1NJYA 3QE9Y 1S0OA 3RJKA 4F8RA 2W9BB 2ZJ5A 4M0AA 3JZ0A 3Q8KA 2ZH6A 4F4WA 4DWIA 1MIVA 1VJ7A 3EZ5A 1EXNA 7ICKA 4RQ7A 3C18A 1U48A 5EWGA 1WOTA 4DFJA 4B9MA 9ICSA 1TK5A 4MEXA 4B9VA 3SYZA 2V9WA 5L1LA 2OWOA 4K4IA 4TQSA 3K4GA 4Z6EA 3UXOA 3TAPA 1MQ3A 3QEBZ 1S76D 2HW3A 4GC7A 7ICVA 3PMLA 3GV7B 3RB4A 1WCNA 3M9MB 1NK6A 2ZJAA 9ICXA 4I2IA 5KFVA 1XU4A 4LZDA 5DB8A 4Q44A 2W8LA 1S0NA 4E0DA 4X4TA 1ZQMA 4X0AA 2J6SA 4F91B 4PPXA 1ZQWA 1SL1A 3FYHA 5HRLA 3HJ4A 4FS2A 5KFNA 1QSSA 1CEZA 7ICJA 4WC4A 4NKUA 3PR5B 4ECSA 5IIKA 1X2IA 3AQNA 4WC6A 1K1SA 1UETA 3L9DA 5DECA 4X4QA 5J2CA 4KLLA 5KFJA 5J0UA 5EWEA 3KHGA 1XSLA 4RZRA 4J9MA 5J2GA 5IIIA 3V7JA 2FPLA 3PW7A 4JV2A 9ICUA 4ECWA 1BNPA 3EPIA 1QLNA 5J2KA 4KMUA 2UVRA 3HT3A 1ZJNA 1MIWA 5KT5A 2ZH9A 4JV0A 4YMOA 5J2BA 4WC0A 2M2UA 4ELVA 3ISCA 5DQHA 9ICEA 3JYYA 4QWDA 5KFMA 4DL5A 5DG8A 1UA1A 4Z6CA 4FHVA 4RQ2A 3OJUA 9ICMA 2W8KA 2MAXA 2W9CA 3V7KA 2PXIA 1ZQGA 1BPEA 4JUZA 4ECXA 1JXLA 5CP2A 4I2HA 2W9CB 4M2YA 5F2VO 1JX4A 1DGSA 5KTQA 4I2EA 4M04A 4IQVA 3PNCA 1QSYA 4ECRA 3LK9A 5KFUA 4GC6A 4RU9A 2R8GA 2BE3A 4NM2A 5J0WA 5KFLA 2XGQA 1X9SA 1ZQZA 3EWAA 1A77A 4O3PA 4YCXA 4PHEA 4WC5A 1Z00A 4KN4A 1NJXA 2FMQA 3QZ8A 1ZYQA 8ICAA 1Z00B 2BCUA 8ICGA 3C23A 1D8YA 3PX4A 5HREA 5KT7A 4TUSA 4EYHB 5DLFA 2BQUA 4PGYA 4QZDA 2XY5A 1NK9A 5KFPA 9ICOA 4X4UA 3SZ2A 2KFZA 5DB6A 1T4GA 9ICQA 1NKEA 2KZMA 2V4RA 4UBCA 1CUKA 5J2HA 2PI4A 3PMNA 5CB1A 4P4MA 1TAUA 2DVIA 4EP7A 3ZDEA 5J0SA 4Q45A 3GV8B 9ICGA 2ALZA 4BDPA 3LDAA 2WTFA 1HUZA 3HX0A 8ICPA 5IIJA 9ICHA 2M2WA 5HHIA 5L9XA 5KG6A 2PFNA 4UBBA 3T3FA 4I27A 4NM1A 3MR2A 4F4XA 5J2JA 5IIOA 3MFIA 5HP4A 3MR6A 4F3OA 2HHPA 2FPMA 5CA7A 2HHTA 1WCLA 3K75D 1KTQA 5DBCA 4R64A 3KTQA 2IMWP 4DSIA 4ED8A 5KFQA 3C2LA 1ZQXA 1ZQJA 4FH5A 4DFMA 5HMMA 5F9LA 3BQ0A 3AU2A 1SKWA 4RWPA 1PX5A 4YVZA 3PR4A 4ECQA 2BPFA 3OJSA 7ICMA 5KFEA 4O0IA 4PGQA 3WFQE 4DS4A 4FS1A 1ZQRA 2ZUDA 4YN4A 1LV5A 8ICIA 5HRDA 2BCVA 4E80A 4Z6DA 5CWRA 3GFKB 3T5KA 1NJWA 1UEVA 5KFHA 4Q43A 1ZQAA 3TFRA 4X4OA 4I28A 2PI5A 4NY8A 3OHBA 5D49A 4NLNA 1HUOA 3TI0A 8ICJA 8ICQA 1MIYA 4UB2A 5J0PA 3HWTA 4MF8A 4KLOA 2M2VA 4EBDA 2C2RA 4WBZA 3QEAZ 9ICPA 4WC2A 2XC9A 4IRCA 3C5FA 8ICCA 2BPCA 4WC3A 1VFGA 7ICQA 4AT7A 4TUQA 3H40A 1SL0A 4WCWA 4QW9A 1T3NA 4AT7B 4QWEA 4YR0A 5L1KA 1D8LA 4M6WA 5KFOA 4RQ5A 4JV1A 3RTVA 5HMLA 3V6JA 4M6WB 3WFPA 4QWAA 5TZVA 4LZGA 4KITB 4TQRA 3H4BA 1TV9A 2ATLA 2W9AA 5DB9A 4FBUA 1JAJA 2MUTA 4RWOA 4C8LA 8ICKA 2MUTB 4KLDA 3GV5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQP A;  4FHX A;  1NK8 A;  4O9M A;  4ECV A;  3RH6 A;  4F4Y A;  4RPX A;  4UD4 A;  4K4H A;  3LWL A;  3PX0 A;  4JWM A;  1DK2 A;  2IHM A;  5IIM A;  1FA0 A;  5KT2 A;  4C8K A;  2NRW A;  2M9N A;  3Q8S B;  1OU5 A;  2XY7 A;  1R89 A;  2ZH8 A;  4DFP A;  1K1Q A;  3NGD A;  4IQU A;  3OV7 A;  4MEY A;  4PHP A;  4J9K A;  1NKB A;  1L5U A;  5J2D A;  2XY6 A;  4YD2 A;  1BPZ A;  5EWF A;  3BQ2 A;  4O5K A;  4DL4 A;  3MDA A;  4I2D A;  1RXW A;  1S0M A;  1ZQH A;  1D9F A;  2F1H A;  2JEJ A;  1ZQE A;  7ICG A;  1BGX T;  3H39 A;  4F5P A;  8ICZ A;  5J0R A;  3MGH A;  3RAX A;  3C66 A;  3GIL A;  4FH3 A;  1X9M A;  4ED6 A;  1BVS A;  1NK7 A;  3M8R A;  5KG0 A;  4J9Q A;  1L3U A;  1N48 A;  1U49 A;  2C28 A;  4F2S A;  2UVV A;  5KG5 A;  4RQ6 A;  4RQ1 A;  3RB0 A;  5IIL A;  1TKD A;  4M5D A;  4X4S A;  1S97 A;  4RUC A;  4HYK A;  5DBB A;  3UQ0 A;  1U47 A;  5J0Q A;  5HNK A;  5L1I A;  1TAQ A;  2AGO A;  4M9H A;  4IG8 A;  1XC9 A;  4YFK A;  1MQ2 A;  3UXP A;  1QSL A;  4YR3 A;  1N56 A;  2JEG A;  5HRI A;  3AU6 A;  3H3A A;  3PW4 A;  2R8J A;  5CHG A;  2RDJ A;  2F1I A;  2HHS A;  1BPD A;  1U9L A;  4QWB A;  4J9S A;  4Q8E A;  3PW2 A;  1Y88 A;  2ZTD A;  3RBE A;  5KFT A;  1ZQO A;  4IR1 A;  3QZ7 A;  4UQG A;  4X4R A;  4QZ8 A;  1B43 A;  2DR8 A;  2UVW A;  3C5G A;  4RPZ A;  2V4Q A;  4YXM A;  2LYH A;  3C1Z A;  2VA3 A;  4RWN A;  1SL2 A;  4F5O A;  4LT6 A;  3ETL A;  2ZHB A;  2KZ3 A;  4R63 A;  3SV4 A;  1ZQK A;  3OHA A;  4Q8F A;  3UPQ A;  4PGX A;  5HRH A;  1NK0 A;  4M9L A;  2ASJ A;  1BPY A;  4F5R A;  4DSJ A;  3IM1 A;  4DF4 A;  4ED2 A;  4RT2 A;  3GIK A;  5DG7 A;  3RJG A;  4DO9 A;  5KFF A;  4XRH A;  8ICR A;  5DBA A;  1KFS A;  4EBE A;  4O5E A;  3MR5 A;  5J2I A;  5DB7 A;  3RJJ A;  4RNN A;  4PHA A;  4KLG A;  3M9O B;  1KEJ A;  2XO7 A;  3RBD A;  2W9M A;  3C21 A;  4F4Z A;  3MR3 A;  1ZQL A;  1XWL A;  2H5X A;  1S10 A;  2FLN A;  5HRF A;  3UPS A;  2KN7 A;  2P6R A;  3PX6 A;  1ZQS A;  1RPL A;  1V9P A;  2BPG A;  3PY8 A;  1HJP A;  8ICT A;  3KHL A;  3EYZ A;  5D4B A;  1T7P A;  8ICV A;  3G6X A;  1BNO A;  1UA0 A;  5J2E A;  2DPJ A;  4B9L A;  4MF2 A;  2ID1 A;  5KFS A;  3PO4 A;  7ICF A;  4R8U A;  2I9G A;  4ATB A;  2DRB A;  4X4N A;  3OUY A;  4M9G A;  4ATB B;  3MGI A;  4M47 A;  3ZDB A;  4ED1 A;  2BQ3 A;  4B9U A;  4IRK A;  2O1P A;  4RUA A;  4GXI A;  5HR9 A;  4WBY A;  4DLE A;  4G3I A;  4J9R A;  1L3T A;  4FHW A;  4EBK A;  5BOM A;  4CCH A;  5J2F A;  1ARO P;  1S9F A;  4X0B A;  3RB3 A;  4YP3 A;  3H8W A;  4UB4 A;  3ISD A;  4EYI B;  2AU0 A;  4ED0 A;  1XSN A;  1DK3 A;  5J0O A;  1S77 D;  4AT9 A;  3WFS C;  1ZQV A;  2BQR A;  4I29 A;  4AT9 B;  4YXJ A;  4M9N A;  2BCR A;  4BWM A;  2VA8 A;  4KLF A;  2F1J A;  5DDM A;  3AQK A;  2ZUB A;  1ZQB A;  1XO1 A;  3H4D A;  2ZHA A;  5KG3 A;  4LVS A;  4ECZ A;  4RNO A;  3LWM A;  5F9N A;  2JEI A;  4KLU A;  1JMS A;  3BQ1 A;  8ICH A;  1Z3E B;  3ISB A;  5KFB A;  4YR2 A;  3BJY A;  2Y1I A;  4YMN A;  3PVX A;  4I2A A;  5HRG A;  4DS5 A;  9ICV A;  5L1J A;  2C22 A;  1B22 A;  4DF8 A;  4EBC A;  1JQR A;  1R8C A;  3UQ2 A;  4ELU A;  5KFR A;  3TAQ A;  1ZJM A;  1R8A A;  4DL6 A;  5J29 A;  5KFZ A;  3ZDC A;  2UVU A;  1F5A A;  1IXR A;  2I1Q A;  2RFF A;  4RQ8 A;  1BPX A;  1ZQC A;  1ZQT A;  2BR0 A;  8ICY A;  3OVS A;  3V6H A;  5DKW A;  3JPR A;  3HPO A;  3NTU A;  4RQ3 A;  3RH5 A;  3TAR A;  2NRX A;  4MFC A;  4YQW A;  7ICE A;  9ICL A;  2AQ0 A;  4S3N A;  4RT3 A;  2ZTE A;  3G6Y A;  2ZH3 A;  2JEF A;  2XCP A;  1C7Y A;  2GWS A;  4FHP A;  2ZH2 A;  2AJQ A;  1ZQU A;  2XGP A;  4I2B A;  4X4V A;  4Z6F A;  5KG1 A;  5DLG A;  3MBY A;  2DRA A;  4YD1 A;  4UB3 A;  4DQQ A;  4R66 A;  4DSK A;  8ICW A;  1XSP A;  4XA5 A;  1KDH A;  3H38 A;  7ICH A;  4MFA A;  2AQ4 A;  3V72 A;  2ASL A;  4QW8 A;  5KFX A;  3RR8 A;  4WC1 A;  2HHU A;  1U45 A;  4I2G A;  3HIY A;  5KFY A;  3JPP A;  2Q0Z X;  2DFL A;  3N4M B;  5KFG A;  5DGA A;  1LB2 B;  4J9N A;  3TFS A;  1U4B A;  4NLK A;  2HHV A;  1NO5 A;  2ISP A;  2ISO A;  1R8B A;  1TFR A;  3RB6 A;  3HJ1 A;  2Q66 A;  2IHN A;  8ICL A;  3KHR A;  3JPN A;  1Q78 A;  4O3N A;  4M9J A;  1A76 A;  4DOC A;  5KFC A;  4JK1 A;  4FO6 A;  4DSL A;  2BHN A;  1DOQ A;  2HHQ A;  3NYB A;  4UAY A;  4AT8 A;  5DED A;  4AT8 B;  3WFO A;  9ICC A;  3PW0 A;  1NZP A;  5BPC A;  9ICJ A;  1XS9 D;  4DL2 A;  5D46 A;  5J0X A;  4UB5 A;  4GXK A;  5HRK A;  4UAZ A;  3RJI A;  2NRZ A;  4TUP A;  2P66 A;  4IR9 A;  2KP7 A;  4IQW A;  3TAN A;  1RYS A;  4BXO A;  2ZH1 A;  3AUO A;  4YG2 A;  4BXO B;  3GII A;  5J2A A;  4P4O A;  2J6T A;  3LQC B;  3KHH A;  1NOM A;  2KZZ A;  7ICP A;  9ICN A;  2O5A A;  1BPB A;  1S0V A;  5BOL A;  8ICN A;  9ICI A;  2JZB A;  4J9L A;  4P2H A;  5KFA A;  4IQT A;  4ED3 A;  3H37 A;  4QZI A;  2JZB B;  2AGQ A;  4NLZ A;  3RRG A;  4K4G A;  2PFQ A;  4EZ6 A;  2HVI A;  4R65 A;  4DLG A;  4B9S A;  5JUM A;  3PO5 A;  3OGU A;  4GLX A;  4QZH A;  3M9N B;  4C8M A;  4BWJ A;  4F5Q A;  4DL3 A;  4MFF A;  1ZQN A;  2ZJ8 A;  3SI8 A;  3B0Y A;  4X4P A;  4QZ9 A;  4EZ9 A;  7ICL A;  2NRV A;  3C2K A;  7ICT A;  4IRD A;  3BQT A;  1QTM A;  4PH5 A;  4J9O A;  1X9W A;  2C2E A;  2BDP A;  5KFD A;  5IIN A;  4DSE A;  4F50 A;  3RH4 A;  5HC9 A;  2NRT A;  3ZD8 A;  4XQ7 A;  1ZQF A;  4DEZ A;  5DDY A;  8ICU A;  1H38 A;  2A1J A;  5KG4 A;  3TQ1 A;  2HHW A;  4DSF A;  2ASD A;  1KLN A;  2A1J B;  4KLI A;  2PBE A;  3OSN A;  3Q8Q B;  4QWC A;  3Q8R B;  3GDX A;  2FMS A;  3E2E A;  1RYR A;  4F2R A;  1COO A;  3H8J A;  3T5L A;  4QZC A;  4PHD A;  3C2M A;  4O3S A;  7ICS A;  4XQ8 A;  2BCQ A;  4E7X A;  1TFY A;  5DG9 A;  4F92 B;  4QZB A;  7ICR A;  4XUS A;  4KLH A;  4NLG A;  3N97 B;  1RXV A;  5KFK A;  1UEU A;  1D9D A;  3EW9 A;  4ED7 A;  2FLP A;  7ICN A;  1JN3 A;  2ZUC A;  4DL7 A;  4NXZ A;  2AGP A;  8ICB A;  9ICW A;  3T5J A;  3JPT A;  4KN7 A;  1KFT A;  3V7L A;  3GIJ A;  1L3S A;  4B9T A;  8ICE A;  2M2T A;  5DQG A;  1NK4 A;  2R8I A;  3OSP A;  4KLE A;  7ICO A;  3OVB A;  2DR7 A;  5KFW A;  1KNY A;  4B9N A;  3OVA A;  5DQI A;  4ECU A;  3RJF A;  3AQL A;  5CJ7 A;  2B21 A;  2BGW A;  3RJH A;  4QZA A;  2HVH A;  1V4A A;  1PZN A;  4QZG A;  3M8S A;  3GIM A;  3GQC A;  4RNM A;  4KLT A;  4E8F A;  4EBJ A;  4C8N A;  1JIH A;  4R8U B;  4UAW A;  4EEY A;  3H7I A;  1TVA A;  4DQI A;  3AQM A;  1TFW A;  9ICF A;  1TK0 A;  4I2J A;  8ICF A;  9ICK A;  5J0Y A;  4RWQ A;  4TUR A;  3HW8 A;  1ZET A;  4WC7 A;  1MC8 A;  3G6V A;  1T8E A;  2IBK A;  4O3O A;  2ZTC A;  3Q8L A;  3RAQ A;  1JXE A;  3MFH A;  2IA6 A;  4JWN A;  2BKE A;  4KLS A;  1SKR A;  1ZQD A;  8ICM A;  4KTQ A;  4NKT A;  5KG2 A;  2ZH4 A;  4QZE A;  3RRH A;  8ICS A;  5HHH A;  4FBT A;  2P6U A;  1KFD A;  3EPG A;  5KT3 A;  5KT4 A;  9ICR A;  4I2C A;  2RDI A;  3ORY A;  2XCA A;  1UT5 A;  1ZQY A;  4J9P A;  4DOA A;  2PFP A;  1KRP A;  2DR5 A;  3JPS A;  4X5V A;  5HRB A;  3PV8 A;  4FHY A;  3THV A;  3C1Y A;  2DPI A;  1KSP A;  2J6U A;  9ICA A;  3T5H A;  2KFN A;  1UT8 A;  4DOB A;  3Q8P B;  2C2D A;  3RJE A;  4C8O A;  1Q79 A;  1ZQI A;  4QZF A;  3JPO A;  2BCS A;  2KTQ A;  2VA2 A;  2Y1J A;  4ECY A;  8ICX A;  4P4P A;  5J0T A;  5CR0 A;  2R8H A;  3B0X A;  4F93 B;  3MDC A;  5EOZ A;  3Q8M A;  8ICO A;  2DR9 A;  3MAB A;  1NKC A;  1MSW D;  4I2F A;  4RQ0 A;  3SV3 A;  2NRK A;  2ZH5 A;  4F5N A;  4DQP A;  1IM4 A;  4KLM A;  4UD5 A;  3WFR E;  4RPY A;  9ICB A;  4UB1 A;  1TK8 A;  1RZT A;  5KT6 A;  2VAN A;  3FDS A;  1NK5 A;  1ZQQ A;  4ELT A;  7ICU A;  4KLJ A;  3UXN A;  3V6K A;  3PW5 A;  2R8K A;  4ECT A;  4DQR A;  1L3V A;  4KLQ A;  3H8S A;  3OUY B;  1SKS A;  2ZH7 A;  5DGB A;  1NJZ A;  4GXJ A;  9ICT A;  5KG7 A;  4O3Q A;  1SZP A;  3RR7 A;  4YMM A;  3BDP A;  2HHX A;  2FPK A;  3IHQ B;  5KFI A;  2FMP A;  4F4K A;  3HP6 A;  2FLL A;  3ZDA A;  2PFO A;  3ZDD A;  4BGD A;  3JPQ A;  4DFK A;  4ZH4 A;  4O5C A;  4O3R A;  7ICI A;  1YLQ A;  5C5J A;  2W9B A;  4DQS A;  3ZD9 A;  4RQ4 A;  1NJY A;  3QE9 Y;  1S0O A;  3RJK A;  4F8R A;  2W9B B;  2ZJ5 A;  4M0A A;  3JZ0 A;  3Q8K A;  2ZH6 A;  4F4W A;  4DWI A;  1MIV A;  1VJ7 A;  3EZ5 A;  1EXN A;  7ICK A;  4RQ7 A;  3C18 A;  1U48 A;  5EWG A;  1WOT A;  4DFJ A;  4B9M A;  9ICS A;  1TK5 A;  4MEX A;  4B9V A;  3SYZ A;  2V9W A;  5L1L A;  2OWO A;  4K4I A;  4TQS A;  3K4G A;  4Z6E A;  3UXO A;  3TAP A;  1MQ3 A;  3QEB Z;  1S76 D;  2HW3 A;  4GC7 A;  7ICV A;  3PML A;  3GV7 B;  3RB4 A;  1WCN A;  3M9M B;  1NK6 A;  2ZJA A;  9ICX A;  4I2I A;  5KFV A;  1XU4 A;  4LZD A;  5DB8 A;  4Q44 A;  2W8L A;  1S0N A;  4E0D A;  4X4T A;  1ZQM A;  4X0A A;  2J6S A;  4F91 B;  4PPX A;  1ZQW A;  1SL1 A;  3FYH A;  5HRL A;  3HJ4 A;  4FS2 A;  5KFN A;  1QSS A;  1CEZ A;  7ICJ A;  4WC4 A;  4NKU A;  3PR5 B;  4ECS A;  5IIK A;  1X2I A;  3AQN A;  4WC6 A;  1K1S A;  1UET A;  3L9D A;  5DEC A;  4X4Q A;  5J2C A;  4KLL A;  5KFJ A;  5J0U A;  5EWE A;  3KHG A;  1XSL A;  4RZR A;  4J9M A;  5J2G A;  5III A;  3V7J A;  2FPL A;  3PW7 A;  4JV2 A;  9ICU A;  4ECW A;  1BNP A;  3EPI A;  1QLN A;  5J2K A;  4KMU A;  2UVR A;  3HT3 A;  1ZJN A;  1MIW A;  5KT5 A;  2ZH9 A;  4JV0 A;  4YMO A;  5J2B A;  4WC0 A;  2M2U A;  4ELV A;  3ISC A;  5DQH A;  9ICE A;  3JYY A;  4QWD A;  5KFM A;  4DL5 A;  5DG8 A;  1UA1 A;  4Z6C A;  4FHV A;  4RQ2 A;  3OJU A;  9ICM A;  2W8K A;  2MAX A;  2W9C A;  3V7K A;  2PXI A;  1ZQG A;  1BPE A;  4JUZ A;  4ECX A;  1JXL A;  5CP2 A;  4I2H A;  2W9C B;  4M2Y A;  5F2V O;  1JX4 A;  1DGS A;  5KTQ A;  4I2E A;  4M04 A;  4IQV A;  3PNC A;  1QSY A;  4ECR A;  3LK9 A;  5KFU A;  4GC6 A;  4RU9 A;  2R8G A;  2BE3 A;  4NM2 A;  5J0W A;  5KFL A;  2XGQ A;  1X9S A;  1ZQZ A;  3EWA A;  1A77 A;  4O3P A;  4YCX A;  4PHE A;  4WC5 A;  1Z00 A;  4KN4 A;  1NJX A;  2FMQ A;  3QZ8 A;  1ZYQ A;  8ICA A;  1Z00 B;  2BCU A;  8ICG A;  3C23 A;  1D8Y A;  3PX4 A;  5HRE A;  5KT7 A;  4TUS A;  4EYH B;  5DLF A;  2BQU A;  4PGY A;  4QZD A;  2XY5 A;  1NK9 A;  5KFP A;  9ICO A;  4X4U A;  3SZ2 A;  2KFZ A;  5DB6 A;  1T4G A;  9ICQ A;  1NKE A;  2KZM A;  2V4R A;  4UBC A;  1CUK A;  5J2H A;  2PI4 A;  3PMN A;  5CB1 A;  4P4M A;  1TAU A;  2DVI A;  4EP7 A;  3ZDE A;  5J0S A;  4Q45 A;  3GV8 B;  9ICG A;  2ALZ A;  4BDP A;  3LDA A;  2WTF A;  1HUZ A;  3HX0 A;  8ICP A;  5IIJ A;  9ICH A;  2M2W A;  5HHI A;  5L9X A;  5KG6 A;  2PFN A;  4UBB A;  3T3F A;  4I27 A;  4NM1 A;  3MR2 A;  4F4X A;  5J2J A;  5IIO A;  3MFI A;  5HP4 A;  3MR6 A;  4F3O A;  2HHP A;  2FPM A;  5CA7 A;  2HHT A;  1WCL A;  3K75 D;  1KTQ A;  5DBC A;  4R64 A;  3KTQ A;  2IMW P;  4DSI A;  4ED8 A;  5KFQ A;  3C2L A;  1ZQX A;  1ZQJ A;  4FH5 A;  4DFM A;  5HMM A;  5F9L A;  3BQ0 A;  3AU2 A;  1SKW A;  4RWP A;  1PX5 A;  4YVZ A;  3PR4 A;  4ECQ A;  2BPF A;  3OJS A;  7ICM A;  5KFE A;  4O0I A;  4PGQ A;  3WFQ E;  4DS4 A;  4FS1 A;  1ZQR A;  2ZUD A;  4YN4 A;  1LV5 A;  8ICI A;  5HRD A;  2BCV A;  4E80 A;  4Z6D A;  5CWR A;  3GFK B;  3T5K A;  1NJW A;  1UEV A;  5KFH A;  4Q43 A;  1ZQA A;  3TFR A;  4X4O A;  4I28 A;  2PI5 A;  4NY8 A;  3OHB A;  5D49 A;  4NLN A;  1HUO A;  3TI0 A;  8ICJ A;  8ICQ A;  1MIY A;  4UB2 A;  5J0P A;  3HWT A;  4MF8 A;  4KLO A;  2M2V A;  4EBD A;  2C2R A;  4WBZ A;  3QEA Z;  9ICP A;  4WC2 A;  2XC9 A;  4IRC A;  3C5F A;  8ICC A;  2BPC A;  4WC3 A;  1VFG A;  7ICQ A;  4AT7 A;  4TUQ A;  3H40 A;  1SL0 A;  4WCW A;  4QW9 A;  1T3N A;  4AT7 B;  4QWE A;  4YR0 A;  5L1K A;  1D8L A;  4M6W A;  5KFO A;  4RQ5 A;  4JV1 A;  3RTV A;  5HML A;  3V6J A;  4M6W B;  3WFP A;  4QWA A;  5TZV A;  4LZG A;  4KIT B;  4TQR A;  3H4B A;  1TV9 A;  2ATL A;  2W9A A;  5DB9 A;  4FBU A;  1JAJ A;  2MUT A;  4RWO A;  4C8L A;  8ICK A;  2MUT B;  4KLD A;  3GV5 B; 
#chains in the Genus database with same CATH topology
 2A3V A;  4O9M A;  2FCL A;  1SXD A;  2KMD A;  1FA0 A;  1JAL A;  5IIM A;  1R89 A;  3NGD A;  4IQU A;  1L5U A;  5J2D A;  1N62 A;  3BQ2 A;  4DL4 A;  3MDA A;  2PKE A;  1D9F A;  1ZQE A;  4F5P A;  8ICZ A;  3MGH A;  1X9M A;  3AL0 B;  3M8R A;  5KG0 A;  1C20 A;  1N48 A;  2UVV A;  4RQ6 A;  4RQ1 A;  3RB0 A;  1Q8K A;  3N7P D;  4HYK A;  1HEK A;  1XC9 A;  1MQ2 A;  2JEG A;  1QSL A;  2HBM A;  1A0P A;  2F1I A;  1U9L A;  4QWB A;  3QZ7 A;  4BX9 C;  4QZ8 A;  3RFA A;  3QUT A;  3IG8 A;  2AXT U;  4WJ3 B;  1TAM A;  4OJP A;  3UPQ A;  4PGX A;  1BPY A;  4NLC A;  2HOF A;  4DCC A;  4DO9 A;  2CPR A;  5DBA A;  1KFS A;  4EBE A;  3M9O B;  2ISP A;  2LBO A;  1S10 A;  5HRF A;  1T3Q A;  2KN7 A;  2BPG A;  1T7P A;  1BNO A;  8ICV A;  2DRB A;  3CYM A;  2ID1 A;  3PO4 A;  2I9G A;  4ATB A;  3MGI A;  5AI0 A;  4ED1 A;  3OUY B;  2HOQ A;  3N7S C;  4RUA A;  1N5X A;  5HR6 A;  2OHF A;  3KZX A;  5BOM A;  3H0R B;  4X0B A;  4YP3 A;  2AU0 A;  3ISD A;  1WWV A;  4I29 A;  1SB3 C;  4YXJ A;  4M9N A;  3GU3 A;  4BWM A;  2F1J A;  3F2C A;  2MRL A;  4RQM A;  2ZHA A;  5F9N A;  5AI9 A;  3PVX A;  4I2A A;  4EBC A;  3UQ2 A;  5KFR A;  3WK9 A;  1R8A A;  2KIV A;  1DGJ A;  3ZDC A;  8ICY A;  4EEL A;  4CF3 A;  3V6H A;  4RQ3 A;  7ICE A;  3TAR A;  2AQ0 A;  2ZTE A;  2JEF A;  2GWS A;  2XGP A;  4I2B A;  5KG1 A;  4NL9 C;  4AYB F;  1KDH A;  3BZK A;  2E8M A;  5AK3 A;  4MFA A;  4QW8 A;  2DKZ A;  4PL2 A;  2WAQ F;  4I2G A;  2WF9 A;  3QUB A;  1LB2 B;  4NLK A;  3T79 A;  1R8B A;  2ISO A;  3C28 A;  1QQ6 A;  1Q78 A;  2KVS A;  4O3N A;  1A76 A;  2ZIX B;  4CNQ A;  2VJ4 A;  1LKY B;  4FO6 A;  4AT8 A;  2F77 X;  2HHQ A;  3NYB A;  5BPC A;  1GPJ A;  4DL2 A;  2NRZ A;  4TUP A;  1UHU A;  3AUO A;  3GII A;  2J6T A;  3LQC B;  1XNS A;  3KHH A;  1NOM A;  1HIW A;  2ZIW B;  4Y2U A;  1Q46 A;  5BOL A;  3IP4 B;  4IQT A;  4K99 A;  2JZB B;  4NLZ A;  3RF9 A;  2JHD A;  4EZ6 A;  4B9S A;  1ECW A;  3PO5 A;  3D2N A;  5AKY A;  3OGU A;  1J97 A;  4EEN A;  2WB1 F;  3SI8 A;  3M7D A;  4X4P A;  4QZ9 A;  3KKA C;  4IRD A;  1IG6 A;  5AKG A;  4PH5 A;  2FI1 A;  5IIN A;  3RH4 A;  3EUB 2;  3ZD8 A;  5DDY A;  8ICU A;  3TQ1 A;  5KG4 A;  2HHW A;  2ASD A;  2A1J B;  4KLI A;  2PBE A;  2RHF A;  3ER9 B;  4QWC A;  3GDX A;  2FMS A;  5ALW A;  2K4P A;  5AIA A;  3QUC A;  4O3S A;  7ICS A;  2NYV A;  2W03 A;  5AIC A;  4KLH A;  3N97 B;  4LJX A;  5KFK A;  3EW9 A;  2FLP A;  5ALX A;  4NXZ A;  2AGP A;  8ICB A;  1KFT A;  2W3R A;  3JPT A;  4C80 A;  3GIJ A;  8ICE A;  2M2T A;  3PHZ A;  4KLE A;  3UMC A;  5CJ7 A;  4QZG A;  5EE1 A;  3M8S A;  4RNM A;  3L3F X;  4DQI A;  3EF2 A;  3WK8 A;  1SIJ A;  1MC8 A;  2IBK A;  1VJ5 A;  1JRP A;  2ZIV B;  2ES6 A;  4KTQ A;  2N1R A;  2ZH4 A;  4GFJ A;  3I76 A;  1KN5 A;  4Y2P A;  9ICR A;  2RP5 A;  3ORY A;  2JV3 A;  1UT5 A;  5B3Q A;  2PFP A;  3JPS A;  5HRB A;  3THV A;  2J6U A;  4DOB A;  3Q8P B;  3RJE A;  4C8O A;  1Q79 A;  2YQE A;  4ECY A;  5J0T A;  2R8H A;  4F93 B;  3WKC A;  4EGW A;  1MSW D;  4F5N A;  9ICB A;  2FDR A;  4KLJ A;  3ERC C;  3QYP A;  3PW5 A;  1L3V A;  4KLQ A;  3H8S A;  5CFS A;  4UAR A;  2E5S A;  4GIB A;  4F4K A;  2FLL A;  2PFO A;  4BGD A;  4O3R A;  1PVQ A;  2W9B A;  3NVO A;  1V38 A;  7ICK A;  4RQ7 A;  5EE3 A;  5EWG A;  1WOT A;  2LPE A;  1WUD A;  2OM6 A;  3K4G A;  1MQ3 A;  2QB1 A;  3PML A;  5AM1 A;  2KEY A;  2YX8 A;  2ZJA A;  2YML A;  5KFV A;  4LZD A;  3D2S A;  3F2D A;  1NZB A;  1S0N A;  4E0D A;  1ZQM A;  2K8C B;  4F91 B;  1ZQW A;  3HJ4 A;  1QSS A;  2JMG A;  1CEZ A;  7ICJ A;  3TAC B;  3PR5 B;  1K1S A;  5HR7 A;  4QNL A;  2QB0 B;  4JV2 A;  4ECW A;  3SAF A;  4KMU A;  2KJ8 A;  5KT5 A;  4YMO A;  5J2B A;  5ALO A;  1O03 A;  4FHV A;  1Z4O A;  3V7K A;  4C4S A;  2W9C A;  4ECX A;  3NAS A;  2R18 A;  4I0U A;  1QSY A;  1F44 A;  2EH9 A;  2CN1 A;  4NM2 A;  5J0W A;  1Z1B A;  2EZX A;  1Q3V A;  3UMB A;  1X9S A;  3EWA A;  3IRU A;  5ALT A;  1Z00 A;  3WKB A;  4KN4 A;  3QZ8 A;  2BCU A;  5ALI A;  5AM4 A;  1MA7 A;  1D8Y A;  5HRE A;  4TUS A;  2DKX A;  4X4U A;  3PSF A;  1NKE A;  2KZM A;  1ZQ1 C;  4UBC A;  1X42 A;  4Y2J A;  5AI8 A;  1TE2 A;  2DVI A;  4JMU A;  3ED5 A;  4Q45 A;  4BDP A;  3LDA A;  4UBB A;  3T3F A;  4NM1 A;  4C7Y A;  5J2J A;  5HP4 A;  1PVR A;  3MR6 A;  2HHP A;  5G5G A;  1WCL A;  3K75 D;  4DSI A;  4LEW A;  4UAU A;  1MN8 A;  2ZG6 A;  3NRZ A;  3MGV A;  5F9L A;  3HRD D;  3AU2 A;  2PMZ F;  2G09 A;  4ECQ A;  2BPF A;  7ICM A;  2KSO B;  5KFE A;  5AK4 A;  2ZUD A;  1LV5 A;  4E80 A;  4DFD A;  2D8C A;  2HBL A;  1NJW A;  1X66 A;  3TI0 A;  8ICQ A;  4UB2 A;  3KZI U;  1N63 A;  3ALR A;  5J0P A;  3HWT A;  9ICP A;  1J2M A;  4NJ8 A;  4WC3 A;  4F72 A;  4AT7 A;  4FFD A;  1D8L A;  3V6J A;  4M6W B;  2DL0 A;  4QWA A;  3F5A A;  4LZG A;  4KIT B;  2ATL A;  5AI5 A;  4RWO A;  3PZP A;  4KLD A;  3GV5 B;  4ECV A;  4UD4 A;  4JWM A;  2IHM A;  3BS5 A;  2M9N A;  1OU5 A;  1WWU A;  1K1Q A;  2E8O A;  2IUB A;  4MEY A;  3OV7 A;  1NKB A;  1RDF A;  4YD2 A;  1BPZ A;  4PZN A;  5ALN A;  2JEJ A;  4KX5 A;  2G06 A;  3H39 A;  2HDO A;  4FH3 A;  3GIL A;  1NK7 A;  1BVS A;  5ALM A;  4F2S A;  4X4S A;  4RUC A;  5CRX A;  5DBB A;  2D3D A;  3UQ0 A;  1U47 A;  5J0Q A;  5HNK A;  3NVW A;  4IG8 A;  3H3A A;  3AU6 A;  3PW4 A;  3WKE A;  2E3T A;  4WH5 A;  4UB8 U;  2ZIU A;  5JRT A;  2RDJ A;  1WYG A;  2KG5 A;  4J9S A;  5KAI U;  1Y88 A;  2ZTD A;  4US9 A;  3RBE A;  1ZQO A;  2DR8 A;  3NVZ A;  2W43 A;  2NO5 A;  3QXG A;  2E8P A;  5ALK A;  5D61 A;  4YXM A;  3C1Z A;  4RWN A;  1SL2 A;  3PSP A;  2EAM A;  4AYB C;  2WAQ C;  5AHX A;  2ASJ A;  4F5R A;  4DSJ A;  2WF8 A;  4ED2 A;  3RJG A;  3GIK A;  5DG7 A;  1YZ7 A;  8ICR A;  4F71 A;  3NRW A;  1NI3 A;  2HBK A;  3RJJ A;  4KLG A;  4PHA A;  1KEJ A;  5AI4 A;  2W9M A;  3C21 A;  1XWL A;  2H5X A;  3UPS A;  5TIS U;  2OCE A;  3PY8 A;  5AM3 A;  3G6X A;  3QU9 A;  3IG5 A;  4MF2 A;  4B9L A;  4OJL A;  2YN4 A;  2HCF A;  4R8U A;  4M9G A;  4ATB B;  4M47 A;  4PL1 A;  2O1P A;  4UAV A;  4DLE A;  4G3I A;  2YB4 A;  2MSN A;  4CCH A;  1ARO P;  1KL9 A;  3RB3 A;  3H8W A;  1XSN A;  2WB1 C;  4ED0 A;  3WFS C;  1S77 D;  4U7C A;  2K8B B;  1S5L U;  5DDM A;  1RQN A;  2JEI A;  1F5S A;  2Y1I A;  4YMN A;  5AM0 A;  5L1J A;  1R8C A;  1ZJM A;  4EV6 A;  5J29 A;  5KFZ A;  2RFF A;  1F5A A;  1IXR A;  3OVS A;  4RQ8 A;  1DRG A;  1BPX A;  5DKW A;  3RH5 A;  4S3N A;  3D6J A;  4YQW A;  3N28 A;  1C7Y A;  3LYS A;  2EZY A;  3K7D A;  5AKE A;  4DSK A;  4R66 A;  8ICW A;  3H38 A;  4NXW A;  2Q66 A;  2G5I B;  5KFY A;  3N4M B;  1N61 A;  1NO5 A;  3HJ1 A;  1TFR A;  8ICL A;  5KL8 B;  2YB1 A;  5KFC A;  3I28 A;  3L4P A;  5DED A;  4AT8 B;  1NZP A;  3OWG A;  5D46 A;  4UB5 A;  5HRK A;  1ZD2 P;  4BXO A;  5J2A A;  1Q3U A;  2KZZ A;  7ICP A;  2O5A A;  1S0V A;  9ICI A;  4ED3 A;  2EWR A;  4QZI A;  2HVI A;  4R65 A;  4QJF B;  4GLX A;  3E0F A;  3M9N B;  2Y9T A;  4BWJ A;  4DL3 A;  4MFF A;  2ZJ8 A;  2E1E A;  3SEI A;  1ZXI A;  7ICL A;  2NRV A;  3C2K A;  7ICT A;  2H3Q A;  1QTM A;  1X9W A;  3IV6 A;  2NRT A;  4P0P A;  5F3X B;  4DSF A;  1SZH A;  1X40 A;  1PVP A;  1RYR A;  4F2R A;  4E7X A;  4XQ8 A;  2BCQ A;  4F92 B;  4XUS A;  4O67 A;  4NLG A;  1COK A;  1RXV A;  1D9D A;  2YMP A;  2G07 A;  1JN3 A;  2ZUC A;  9ICW A;  4ZOH C;  2B6G A;  2B51 A;  3OVB A;  4OCZ A;  5KFW A;  4B9N A;  5DQI A;  3RJF A;  2BGW A;  1Z1V A;  1L7M A;  4KLT A;  4X4T A;  4UAW A;  1TFW A;  3H7I A;  3QU5 A;  9ICF A;  9ICK A;  3Q8L A;  3RAQ A;  2IA6 A;  2BKE A;  1ZQD A;  4NKT A;  4WOY A;  5KG2 A;  4ICA A;  4QZE A;  1JRO A;  3EPG A;  5KT4 A;  1SV0 A;  2RDI A;  2W11 A;  2XCA A;  4J9P A;  3SQI A;  2DWQ A;  5EE0 A;  3C1Y A;  2DPI A;  1UT8 A;  2Y0S F;  2C2D A;  3JPO A;  1S8O A;  4P4P A;  3HJE A;  3B0X A;  2WF6 A;  4IC9 A;  2QKQ A;  1VDV A;  3SMV A;  3MAB A;  4WQL A;  4EX7 A;  3SV3 A;  4UD5 A;  4RPY A;  1FEZ A;  4ELT A;  7ICU A;  3V6K A;  4ECT A;  4DQR A;  1SKS A;  5DGB A;  1NJZ A;  1X6J A;  3BDP A;  5KFI A;  2A1A A;  2FMP A;  7ICI A;  5L1M A;  1YLQ A;  3QE9 Y;  4F8R A;  5J8Y A;  2ZJ5 A;  2W9B B;  2ZH6 A;  3Q8K A;  5FP0 A;  4EEB A;  4B9M A;  3SYZ A;  5ALZ A;  4TQS A;  3UXO A;  4Z6E A;  1S76 D;  2HW3 A;  1CRX A;  9ICX A;  4I2I A;  1F0M A;  4RQN A;  2WF5 A;  5DB8 A;  2W8L A;  2HSZ A;  2NO4 A;  4OO1 J;  2PMZ C;  1SL1 A;  5HRL A;  2HI0 A;  3AQN A;  1X2I A;  4WC6 A;  3L9D A;  2EAO A;  5DEC A;  5KFJ A;  5J0U A;  5EWE A;  2F8L A;  4J9M A;  2FPL A;  3QU7 A;  3EPI A;  1QLN A;  1N2X A;  1ZJN A;  2UVR A;  5T14 A;  5JTG A;  4PZO A;  1A6S A;  1KBU A;  5B3P A;  4DL5 A;  1UA1 A;  4Z6C A;  2E1F A;  3OJU A;  4JUZ A;  1JXL A;  5CP2 A;  2W9C B;  2F76 X;  4M2Y A;  1JX4 A;  3WK4 A;  4IQV A;  2EQY A;  4ECR A;  2KIW A;  3LK9 A;  2YTU A;  5EE9 A;  4GC6 A;  2H3V A;  3OPX A;  3SR6 A;  4LEY A;  2XGQ A;  4PHE A;  1DXS A;  4WC5 A;  1RYU A;  4OJ5 A;  8ICA A;  1Z00 B;  3PX4 A;  4EYH B;  5DLF A;  9ICO A;  2XY5 A;  1NK9 A;  1PUZ A;  2HN2 A;  3SD7 A;  5AI6 A;  5J2H A;  3PMN A;  5CB1 A;  3F53 A;  3ZDE A;  2GAF D;  2ALZ A;  5IIJ A;  5HHI A;  5KG6 A;  1QCK A;  4I27 A;  1QQ7 A;  2IOH A;  2B4V A;  5IIO A;  4K98 A;  3MFI A;  4K96 A;  4F3O A;  2QLT A;  3CNH A;  2HHT A;  2CRX A;  5DBC A;  5AKK A;  1ZQX A;  3C2L A;  4FH5 A;  4DFM A;  2XIC A;  3A0H U;  4UAT A;  4NWI A;  4RWP A;  1QH9 A;  1PX5 A;  2JH7 A;  3NVY A;  4PGQ A;  2LMR A;  1RQL A;  1ZQR A;  5HRD A;  3GFK B;  3T5K A;  5KFH A;  4Q43 A;  3TFR A;  4X4O A;  4I28 A;  2PI5 A;  1MIY A;  4XJE A;  4NLN A;  8ICJ A;  4A8E A;  4OAF A;  2W54 A;  2M2V A;  4KLO A;  3TAD A;  4EBD A;  3QEA Z;  4IRC A;  8ICC A;  3H40 A;  4AT7 B;  5CHE A;  3FC4 A;  4JV1 A;  5L1K A;  2VJ5 A;  5KFO A;  4RQ5 A;  5HML A;  3WFP A;  2KE7 A;  3H4B A;  2Q4T A;  3HIL A;  5DB9 A;  4FBU A;  4OJO A;  8ICK A;  3AN1 A;  4FHX A;  1NK8 A;  5ALV A;  1IV8 A;  2KHV A;  1N60 A;  3PX0 A;  1DK2 A;  5KT2 A;  4C8K A;  3Q8S B;  2XY7 A;  2ZH8 A;  3BS5 B;  1PK3 A;  1P7D A;  5KAF U;  3JCF A;  4PHP A;  4J9K A;  1FO4 A;  2XY6 A;  5EWF A;  4O5K A;  1RXW A;  4I2D A;  1ZQH A;  4XQ7 A;  1BGX T;  5J0R A;  2VKQ A;  3C66 A;  2QAR A;  4J9Q A;  1L3U A;  1QQ5 A;  1U49 A;  3AMZ A;  5IIL A;  4KM5 A;  5AK5 A;  5L1I A;  5HRI A;  4YFK A;  3UXP A;  5GTH U;  1N56 A;  4FO1 A;  2MA1 A;  2JH1 A;  2ZIU B;  2HHS A;  4Q8E A;  3PW2 A;  1K5O A;  5ALD A;  4IS7 A;  4X4R A;  4UQG A;  1B43 A;  2UVW A;  3F2B A;  3C5G A;  4RPZ A;  1PK1 A;  2F44 A;  2ZHB A;  2KZ3 A;  3SV4 A;  1NK0 A;  4M9L A;  5AKX A;  4XRH A;  2BZF A;  3MR5 A;  4RNN A;  1BNP A;  3RBD A;  4F4Z A;  4IL6 U;  3MR3 A;  3U26 A;  1ZQL A;  2FLN A;  2O6K A;  1ZQS A;  1RPL A;  8ICT A;  3KHL A;  3QU2 A;  1UA0 A;  1L6N A;  7ICF A;  2GOL A;  3KFU F;  4B9U A;  4IRK A;  4GXI A;  5HR9 A;  2OXO A;  3AM9 A;  4J9R A;  1L3T A;  4FHW A;  5CFU A;  5J2F A;  1S9F A;  4J03 A;  4UB4 A;  4AT9 A;  2BQR A;  2BCR A;  5KL1 B;  3AQK A;  1ZD3 A;  5KG3 A;  4LVS A;  3LWM A;  8ICH A;  1JMS A;  3ISB A;  3BJY A;  1X6I A;  3ZI4 A;  4DS5 A;  2C22 A;  1B22 A;  1JQR A;  3TAQ A;  3NWI A;  4DL6 A;  3H8M A;  1SV0 C;  2UVU A;  1ZRM A;  1ZQT A;  2NRX A;  9ICL A;  4NV0 A;  4RT3 A;  2ZH3 A;  2XCP A;  1JUD A;  3QU4 A;  2AJQ A;  4Y2T A;  4X4V A;  2FJ6 A;  3MBY A;  2DRA A;  4YD1 A;  4DQQ A;  4XA5 A;  2AQ4 A;  3V72 A;  2ASL A;  5KFX A;  4WC1 A;  2HHU A;  1U45 A;  2KIC A;  2OYY A;  3JPP A;  5KFG A;  5DGA A;  4JB3 A;  4J9N A;  3TFS A;  1U4B A;  1OXJ A;  1SWW A;  3KHR A;  3JPN A;  4M9J A;  4JK1 A;  2BHN A;  1DOQ A;  3M6Z A;  4UAY A;  2RRD A;  4UB6 U;  2WHE A;  3WFO A;  4PJ0 U;  1XS9 D;  2EDU A;  4UAZ A;  3RJI A;  2P66 A;  4Y2Y A;  3QX7 A;  4IQW A;  4YG2 A;  4BXO B;  4P4O A;  5J8Y C;  2JGA A;  9ICN A;  3H37 A;  2EAN A;  4EX6 A;  2AGQ A;  4K4G A;  2K8A A;  3SEN A;  4DLG A;  3FAH A;  2IHO A;  4C8M A;  1ZQN A;  1ED1 A;  2Y0S C;  5ALR A;  2NV3 A;  4OAI Z;  4EZ9 A;  1UCV A;  2C2E A;  1L7N A;  4DSE A;  4F50 A;  4CDG A;  5JU5 A;  3C29 A;  4P0P B;  1KLN A;  3OSN A;  2M0N A;  3Q8Q B;  3E2E A;  2H3F A;  3T5L A;  3H8J A;  1KKX A;  3C2M A;  2BBJ A;  5DG9 A;  3WKD A;  4QZB A;  7ICR A;  4C4T A;  3FM9 A;  1J2N A;  7ICN A;  2YMM A;  3QUQ A;  1N5W A;  1L3S A;  1SWV A;  4MHV A;  5DQG A;  2H3Z A;  3B9J A;  7ICO A;  2DR7 A;  3AQL A;  4NLB A;  5ALG A;  3RJH A;  2HVH A;  2OEH A;  2W7P A;  1PZN A;  3GIM A;  4E8F A;  1JIH A;  2KVC A;  1TK0 A;  3CW2 C;  3DDH A;  4I2J A;  4RWQ A;  4TUR A;  3HW8 A;  3G6V A;  1JXE A;  4JWN A;  2DUY A;  1SKR A;  5AIB A;  1L8L A;  4JLX A;  2IOF K;  2HMX A;  2YMQ A;  3A0B U;  3RRH A;  2KNJ A;  4FBT A;  4KX3 A;  5C0Y A;  5KT3 A;  4I2C A;  5AM2 A;  1KRP A;  4X5V A;  2K4H A;  3PV8 A;  4O3M A;  9ICA A;  3VCB A;  2BCS A;  2VA2 A;  3HKZ F;  2Y1J A;  4LEV A;  1YT3 A;  5CR0 A;  8ICO A;  3KBB A;  2XI9 A;  4RQ0 A;  3WFR E;  4KLM A;  1IM4 A;  1Z4N A;  3CP8 A;  4UB1 A;  1TK8 A;  1RZT A;  2LM1 A;  5KT6 A;  3FDS A;  1ZQQ A;  3UXN A;  4FZM A;  4GXJ A;  9ICT A;  5KG7 A;  3RR7 A;  1SZP A;  5B5E U;  2HHX A;  5K4L A;  2B0C A;  2FPK A;  3GZF A;  2XID A;  5ALP A;  3ZDA A;  3ZDD A;  2KK0 A;  4DFK A;  1FFU A;  5C5J A;  4DQS A;  4I2H A;  3ZD9 A;  4RQ4 A;  5F2V O;  3RJK A;  4M0A A;  5H2F U;  4F4W A;  1MIV A;  1VJ7 A;  3EZ5 A;  3WK7 A;  4K97 A;  3C18 A;  1TK5 A;  4MEX A;  4B9V A;  1T94 A;  2V9W A;  3TAP A;  3F5E A;  7ICV A;  3QEB Z;  2F3N A;  3RB4 A;  3M9M B;  1XU4 A;  4Q44 A;  3NUQ A;  4X0A A;  1OW5 A;  4PPX A;  4G9B A;  3FYH A;  2KD1 A;  4NKU A;  4N7R A;  5IIK A;  1UET A;  2LKY A;  4X4Q A;  4KLL A;  3KHG A;  1XSL A;  4O6A A;  2K89 A;  2RQ5 A;  3HT3 A;  1MIW A;  2ZH9 A;  4JV0 A;  4WC0 A;  2HOI A;  3ISC A;  3JYY A;  1B0X A;  4QWD A;  5KFM A;  1RG6 A;  9ICM A;  2W8K A;  2MAX A;  2PXI A;  1FIQ A;  5KTQ A;  4I2E A;  4M04 A;  3PNC A;  1ZRN A;  2GO7 A;  5KFU A;  4RU9 A;  1WG8 A;  2R8G A;  2BE3 A;  4OAH A;  1ZQZ A;  4O3P A;  1A77 A;  4YCX A;  3R9K A;  1M6Y A;  8ICG A;  5ALF A;  3C23 A;  5KT7 A;  4QZD A;  3SZ2 A;  4QIW F;  3BQ7 A;  1CUK A;  2KJ9 A;  4P4M A;  4EP7 A;  1URJ A;  9ICG A;  4CGZ A;  1VLB A;  1HUZ A;  3HX0 A;  2LI6 A;  4CE6 A;  4Y2S A;  5L9X A;  2PFN A;  3MR2 A;  4F4X A;  2KV2 A;  2KKV A;  2FPM A;  1KTQ A;  3L5K A;  1ZQJ A;  5HMM A;  4FE3 A;  3BQ0 A;  5ALH A;  3M1Y A;  1SKW A;  3SAG A;  4YVZ A;  1NNL A;  3PR4 A;  3OJS A;  4O0I A;  4DS4 A;  4BUG A;  4YN4 A;  8ICI A;  4Z6D A;  4NY8 A;  3OHB A;  5D49 A;  1HUO A;  2H3I A;  1FFV A;  4P0Q A;  4MF8 A;  2EAP A;  2XC9 A;  2ZXI A;  4US8 A;  4TUQ A;  1SL0 A;  2Z7J A;  4OD0 A;  5D62 A;  4KMO B;  4KB6 A;  3NVV A;  5TZV A;  4U6P A;  1JAJ A;  4WQK A;  2MUT A;  5AK6 A;  5ALE A;  1ZQP A;  2E8N A;  3RH6 A;  4F4Y A;  4RPX A;  4K4H A;  5ALJ A;  3LWL A;  4WC7 A;  2NRW A;  2RLT A;  2P35 A;  4DFP A;  3H0L B;  1S0M A;  1X9X A;  2F1H A;  7ICG A;  4HX0 A;  3RAX A;  4ED6 A;  2EZZ A;  1RM6 C;  2C28 A;  2QAR B;  5KG5 A;  4M5D A;  1TKD A;  1S97 A;  4BJQ A;  2JXJ A;  1TAQ A;  2AGO A;  2LYB A;  4M9H A;  2YY6 A;  4YR3 A;  1JI7 A;  2R8J A;  5CHG A;  5B66 U;  1BPD A;  4K9A A;  5KFT A;  4IR1 A;  3AQF A;  2VIX A;  5E79 U;  2V4Q A;  2VA3 A;  2LYH A;  4CF4 A;  3ONN A;  2KKP A;  4F5O A;  4LT6 A;  1PK1 B;  3ETL A;  4CF5 A;  4R63 A;  2G08 A;  5KNI A;  3WKA A;  3CRX A;  1ZQK A;  3OHA A;  4Q8F A;  1L8O A;  2L5Y A;  3E58 A;  2XVT A;  5HRH A;  4Y2V A;  3IM1 A;  4DF4 A;  5AKH A;  4RT2 A;  5KFF A;  4O5E A;  5J2I A;  2AHO B;  5DB7 A;  2D6F C;  2XO7 A;  2BDP A;  2ZH2 A;  2KJ5 A;  3AQE A;  2P6R A;  1L7O A;  4FZL A;  3PX6 A;  1V9P A;  4C4R A;  1HJP A;  3TKA A;  5ALL A;  3EYZ A;  5D4B A;  4K8V A;  2DPJ A;  5J2E A;  3K1R B;  5KFS A;  5ALU A;  4X4N A;  3OUY A;  3ZDB A;  2BQ3 A;  4WBY A;  3H0M B;  4OJ6 A;  4EBK A;  3NKU A;  4EYI B;  2K60 A;  1DK3 A;  5J0O A;  1ZQV A;  2Y9U A;  4AT9 B;  4KLF A;  2VA8 A;  2ZUB A;  1ZQB A;  1XO1 A;  3H4D A;  4ECZ A;  4RNO A;  4KLU A;  2WFA A;  3BQ1 A;  1Z3E B;  5KFB A;  4YR2 A;  1SGG A;  5AKJ A;  1CI4 A;  5HRG A;  1UPH A;  9ICV A;  4DF8 A;  3DV9 A;  4ELU A;  3ETR A;  2I1Q A;  2G0A A;  1ZQC A;  2BR0 A;  3JPR A;  3HPO A;  3NTU A;  4MFC A;  2JRZ A;  3G6Y A;  4FHP A;  1ZQU A;  4Z6F A;  4EED A;  5DLG A;  4UB3 A;  2HN1 A;  1XSP A;  7ICH A;  3RR8 A;  3HIY A;  2Q0Z X;  2DFL A;  3LVV A;  2HHV A;  2ODG A;  3RB6 A;  3BS7 A;  2LM4 A;  2LHT A;  2IHN A;  3PST A;  2ZIX A;  1V97 A;  1LKY A;  4DOC A;  5ALS A;  4DSL A;  4O69 A;  2DQN B;  1L7P A;  9ICC A;  3PW0 A;  1GO3 F;  9ICJ A;  5J0X A;  4GXK A;  2GLE A;  4IR9 A;  2KP7 A;  3TAN A;  1RYS A;  2ZH1 A;  3O0F A;  2ZIW A;  3SAH A;  3WK5 A;  1BPB A;  8ICN A;  2JZB A;  4J9L A;  4P2H A;  5KFA A;  3UM9 A;  2KOB A;  3DEE A;  1KQQ A;  3RRG A;  2PFQ A;  5JUM A;  4QZH A;  4F5Q A;  2I6X A;  3B0Y A;  2HBJ A;  4MKP A;  5G5H A;  4NXX A;  3HKZ C;  3BQT A;  4J9O A;  5KFD A;  4USA A;  3S6J A;  4OAG A;  5HC9 A;  5AM5 A;  2F2A B;  1ZQF A;  4AP9 A;  4DEZ A;  1H38 A;  2A1J A;  3MCR A;  3Q8R B;  3KOO A;  1COO A;  4QZC A;  4PHD A;  1XO0 A;  2B56 A;  1TFY A;  1SV4 A;  1ZD5 A;  3VC8 A;  1UEU A;  4CRX A;  4ED7 A;  1KW4 A;  1UQV A;  4DL7 A;  3T5J A;  4KN7 A;  3V7L A;  4B9T A;  2W7O A;  1NK4 A;  2R8I A;  3OSP A;  1O08 A;  1KNY A;  3OVA A;  4ECU A;  2B21 A;  4QZA A;  1V4A A;  3GQC A;  4K9B A;  4EBJ A;  4C8N A;  4R8U B;  1TVA A;  1ZOL A;  4EEY A;  3D2Q A;  3AQM A;  2IOF A;  8ICF A;  5J0Y A;  1ZET A;  2K4E A;  1T8E A;  4O3O A;  2ZTC A;  4ACO A;  2ZIV A;  3MFH A;  4KLS A;  1AQ6 A;  8ICM A;  1OUQ A;  4HAI A;  2W04 A;  5CEH A;  8ICS A;  5HHH A;  2WF7 A;  2P6U A;  1KFD A;  4DOA A;  1ZQY A;  4NXV A;  2DR5 A;  4FHY A;  3J81 j;  1KSP A;  3T5H A;  2KFN A;  5AKI A;  3ER8 C;  1ZQI A;  4QZF A;  8ICX A;  2KTQ A;  4B6J A;  5AKL A;  2AH5 A;  4NL9 A;  3MDC A;  5EOZ A;  3Q8M A;  2DR9 A;  1NKC A;  2NRK A;  4I2F A;  2ZH5 A;  4DQP A;  1NK5 A;  2VAN A;  2ZXH A;  3IDW A;  2R8K A;  3WU2 U;  4C0Z A;  2ZH7 A;  4Y2X A;  4O3Q A;  4C7Z A;  4YMM A;  3IHQ B;  1Z19 A;  3HP6 A;  4QIW C;  3M6K A;  3JPQ A;  4ZH4 A;  4O5C A;  3OTQ A;  2DF4 B;  2CXY A;  1ZD4 A;  1NJY A;  2I5H A;  1S0O A;  3JZ0 A;  2KHQ A;  4DWI A;  1EXN A;  1B4F A;  3MC1 A;  1U48 A;  4DFJ A;  9ICS A;  3NS1 A;  2OWO A;  5L1L A;  2W3S A;  4K4I A;  2F8K A;  4GC7 A;  1IIP A;  3GV7 B;  1WCN A;  3KKA A;  1NK6 A;  3IN5 A;  3BZC A;  5ALQ A;  5A0L A;  2J6S A;  2ESE A;  5CFT A;  1V85 A;  4WC4 A;  4FS2 A;  5KFN A;  2GA9 D;  4JLZ A;  4ECS A;  2W55 A;  5J2C A;  4NXU A;  4RZR A;  5J2G A;  2QB0 A;  5III A;  3V7J A;  3PW7 A;  9ICU A;  5J2K A;  3QNM A;  2M2U A;  4ELV A;  9ICE A;  5DQH A;  2MU2 A;  3K1Z A;  5DG8 A;  3KD3 A;  4RQ2 A;  1ZQG A;  1BPE A;  2DGZ A;  3AEV A;  2LYA A;  4Y2R A;  1DGS A;  4Y2Q A;  5KFL A;  1NJX A;  2FMQ A;  1ZYQ A;  5AKZ A;  2JR5 A;  3WK6 A;  4UW9 A;  2BQU A;  4PGY A;  5KFP A;  2KFZ A;  5DB6 A;  1T4G A;  1YZ6 A;  9ICQ A;  2V4R A;  3N7R C;  2PI4 A;  1TAU A;  3ICX A;  2OH2 A;  3CK6 A;  3LVW A;  4EEK A;  5J0S A;  2BDU A;  3GV8 B;  4UAS A;  8ICP A;  9ICH A;  2WTF A;  2M2W A;  2BBH A;  2FE9 A;  4FZN A;  4LEZ A;  5CA7 A;  4R64 A;  2GH1 A;  2IMW P;  3KTQ A;  4ED8 A;  5KFQ A;  3PSI A;  4O68 A;  4NXT A;  2KSO A;  3WFQ E;  4FS1 A;  2BCV A;  5CWR A;  1UEV A;  1ZQA A;  2DBY A;  2G5H B;  1LVH A;  2C2R A;  4P0Q B;  4WBZ A;  5D63 A;  2A19 A;  1SXE A;  4WC2 A;  3C5F A;  2BPC A;  5GTI U;  1VFG A;  7ICQ A;  5ALY A;  4WCW A;  4QW9 A;  1T3N A;  4QWE A;  4YR0 A;  3I1Y A;  3TAD C;  4M6W A;  3RTV A;  5JTI A;  3UMG A;  1D8B A;  4TQR A;  1TV9 A;  2W9A A;  4C8L A;  2MUT B;  2K4I A; 
#chains in the Genus database with same CATH homology
 1ZQP A;  4FHX A;  1NK8 A;  4O9M A;  4ECV A;  3RH6 A;  4F4Y A;  4RPX A;  4UD4 A;  4K4H A;  3LWL A;  3PX0 A;  4JWM A;  1DK2 A;  2IHM A;  5IIM A;  1FA0 A;  5KT2 A;  4C8K A;  2NRW A;  2M9N A;  3Q8S B;  1OU5 A;  2XY7 A;  1R89 A;  2ZH8 A;  4DFP A;  1K1Q A;  3NGD A;  4IQU A;  3OV7 A;  4MEY A;  4PHP A;  4J9K A;  1NKB A;  1L5U A;  5J2D A;  2XY6 A;  4YD2 A;  1BPZ A;  5EWF A;  3BQ2 A;  4O5K A;  4DL4 A;  3MDA A;  4I2D A;  1RXW A;  1S0M A;  1ZQH A;  1D9F A;  2F1H A;  2JEJ A;  1ZQE A;  7ICG A;  1BGX T;  3H39 A;  4F5P A;  8ICZ A;  5J0R A;  3MGH A;  3RAX A;  3C66 A;  3GIL A;  4FH3 A;  1X9M A;  4ED6 A;  1BVS A;  1NK7 A;  3M8R A;  5KG0 A;  4J9Q A;  1L3U A;  1N48 A;  1U49 A;  2C28 A;  4F2S A;  2UVV A;  5KG5 A;  4RQ6 A;  4RQ1 A;  3RB0 A;  5IIL A;  1TKD A;  4M5D A;  4X4S A;  1S97 A;  4RUC A;  4HYK A;  5DBB A;  3UQ0 A;  1U47 A;  5J0Q A;  5HNK A;  5L1I A;  1TAQ A;  2AGO A;  4M9H A;  4IG8 A;  1XC9 A;  4YFK A;  1MQ2 A;  3UXP A;  1QSL A;  4YR3 A;  1N56 A;  2JEG A;  5HRI A;  3AU6 A;  3H3A A;  3PW4 A;  2R8J A;  5CHG A;  2RDJ A;  2F1I A;  2HHS A;  1BPD A;  1U9L A;  4QWB A;  4J9S A;  4Q8E A;  3PW2 A;  1Y88 A;  2ZTD A;  3RBE A;  5KFT A;  1ZQO A;  4IR1 A;  3QZ7 A;  4UQG A;  4X4R A;  4QZ8 A;  1B43 A;  2DR8 A;  2UVW A;  3C5G A;  4RPZ A;  2V4Q A;  4YXM A;  2LYH A;  3C1Z A;  2VA3 A;  4RWN A;  1SL2 A;  4F5O A;  4LT6 A;  3ETL A;  2ZHB A;  2KZ3 A;  4R63 A;  3SV4 A;  1ZQK A;  3OHA A;  4Q8F A;  3UPQ A;  4PGX A;  5HRH A;  1NK0 A;  4M9L A;  2ASJ A;  1BPY A;  4F5R A;  4DSJ A;  3IM1 A;  4DF4 A;  4ED2 A;  4RT2 A;  3GIK A;  5DG7 A;  3RJG A;  4DO9 A;  5KFF A;  4XRH A;  8ICR A;  5DBA A;  1KFS A;  4EBE A;  4O5E A;  3MR5 A;  5J2I A;  5DB7 A;  3RJJ A;  4RNN A;  4PHA A;  4KLG A;  3M9O B;  1KEJ A;  2XO7 A;  3RBD A;  2W9M A;  3C21 A;  4F4Z A;  3MR3 A;  1ZQL A;  1XWL A;  2H5X A;  1S10 A;  2FLN A;  5HRF A;  3UPS A;  2KN7 A;  2P6R A;  3PX6 A;  1ZQS A;  1RPL A;  1V9P A;  2BPG A;  3PY8 A;  1HJP A;  8ICT A;  3KHL A;  3EYZ A;  5D4B A;  1T7P A;  8ICV A;  3G6X A;  1BNO A;  1UA0 A;  5J2E A;  2DPJ A;  4B9L A;  4MF2 A;  2ID1 A;  5KFS A;  3PO4 A;  7ICF A;  4R8U A;  2I9G A;  4ATB A;  2DRB A;  4X4N A;  3OUY A;  4M9G A;  4ATB B;  3MGI A;  4M47 A;  3ZDB A;  4ED1 A;  2BQ3 A;  4B9U A;  4IRK A;  2O1P A;  4RUA A;  4GXI A;  5HR9 A;  4WBY A;  4DLE A;  4G3I A;  4J9R A;  1L3T A;  4FHW A;  4EBK A;  5BOM A;  4CCH A;  5J2F A;  1ARO P;  1S9F A;  4X0B A;  3RB3 A;  4YP3 A;  3H8W A;  4UB4 A;  3ISD A;  4EYI B;  2AU0 A;  4ED0 A;  1XSN A;  1DK3 A;  5J0O A;  1S77 D;  4AT9 A;  3WFS C;  1ZQV A;  2BQR A;  4I29 A;  4AT9 B;  4YXJ A;  4M9N A;  2BCR A;  4BWM A;  2VA8 A;  4KLF A;  2F1J A;  5DDM A;  3AQK A;  2ZUB A;  1ZQB A;  1XO1 A;  3H4D A;  2ZHA A;  5KG3 A;  4LVS A;  4ECZ A;  4RNO A;  3LWM A;  5F9N A;  2JEI A;  4KLU A;  1JMS A;  3BQ1 A;  8ICH A;  1Z3E B;  3ISB A;  5KFB A;  4YR2 A;  3BJY A;  2Y1I A;  4YMN A;  3PVX A;  4I2A A;  5HRG A;  4DS5 A;  9ICV A;  5L1J A;  2C22 A;  1B22 A;  4DF8 A;  4EBC A;  1JQR A;  1R8C A;  3UQ2 A;  4ELU A;  5KFR A;  3TAQ A;  1ZJM A;  1R8A A;  4DL6 A;  5J29 A;  5KFZ A;  3ZDC A;  2UVU A;  1F5A A;  1IXR A;  2I1Q A;  2RFF A;  4RQ8 A;  1BPX A;  1ZQC A;  1ZQT A;  2BR0 A;  8ICY A;  3OVS A;  3V6H A;  5DKW A;  3JPR A;  3HPO A;  3NTU A;  4RQ3 A;  3RH5 A;  3TAR A;  2NRX A;  4MFC A;  4YQW A;  7ICE A;  9ICL A;  2AQ0 A;  4S3N A;  4RT3 A;  2ZTE A;  3G6Y A;  2ZH3 A;  2JEF A;  2XCP A;  1C7Y A;  2GWS A;  4FHP A;  2ZH2 A;  2AJQ A;  1ZQU A;  2XGP A;  4I2B A;  4X4V A;  4Z6F A;  5KG1 A;  5DLG A;  3MBY A;  2DRA A;  4YD1 A;  4UB3 A;  4DQQ A;  4R66 A;  4DSK A;  8ICW A;  1XSP A;  4XA5 A;  1KDH A;  3H38 A;  7ICH A;  4MFA A;  2AQ4 A;  3V72 A;  2ASL A;  4QW8 A;  5KFX A;  3RR8 A;  4WC1 A;  2HHU A;  1U45 A;  4I2G A;  3HIY A;  5KFY A;  3JPP A;  2Q0Z X;  2DFL A;  3N4M B;  5KFG A;  5DGA A;  1LB2 B;  4J9N A;  3TFS A;  1U4B A;  4NLK A;  2HHV A;  1NO5 A;  2ISP A;  2ISO A;  1R8B A;  1TFR A;  3RB6 A;  3HJ1 A;  2Q66 A;  2IHN A;  8ICL A;  3KHR A;  3JPN A;  1Q78 A;  4O3N A;  4M9J A;  1A76 A;  4DOC A;  5KFC A;  4JK1 A;  4FO6 A;  4DSL A;  2BHN A;  1DOQ A;  2HHQ A;  3NYB A;  4UAY A;  4AT8 A;  5DED A;  4AT8 B;  3WFO A;  9ICC A;  3PW0 A;  1NZP A;  5BPC A;  9ICJ A;  1XS9 D;  4DL2 A;  5D46 A;  5J0X A;  4UB5 A;  4GXK A;  5HRK A;  4UAZ A;  3RJI A;  2NRZ A;  4TUP A;  2P66 A;  4IR9 A;  2KP7 A;  4IQW A;  3TAN A;  1RYS A;  4BXO A;  2ZH1 A;  3AUO A;  4YG2 A;  4BXO B;  3GII A;  5J2A A;  4P4O A;  2J6T A;  3LQC B;  3KHH A;  1NOM A;  2KZZ A;  7ICP A;  9ICN A;  2O5A A;  1BPB A;  1S0V A;  5BOL A;  8ICN A;  9ICI A;  2JZB A;  4J9L A;  4P2H A;  5KFA A;  4IQT A;  4ED3 A;  3H37 A;  4QZI A;  2JZB B;  2AGQ A;  4NLZ A;  3RRG A;  4K4G A;  2PFQ A;  4EZ6 A;  2HVI A;  4R65 A;  4DLG A;  4B9S A;  5JUM A;  3PO5 A;  3OGU A;  4GLX A;  4QZH A;  3M9N B;  4C8M A;  4BWJ A;  4F5Q A;  4DL3 A;  4MFF A;  1ZQN A;  2ZJ8 A;  3SI8 A;  3B0Y A;  4X4P A;  4QZ9 A;  4EZ9 A;  7ICL A;  2NRV A;  3C2K A;  7ICT A;  4IRD A;  3BQT A;  1QTM A;  4PH5 A;  4J9O A;  1X9W A;  2C2E A;  2BDP A;  5KFD A;  5IIN A;  4DSE A;  4F50 A;  3RH4 A;  5HC9 A;  2NRT A;  3ZD8 A;  4XQ7 A;  1ZQF A;  4DEZ A;  5DDY A;  8ICU A;  1H38 A;  2A1J A;  5KG4 A;  3TQ1 A;  2HHW A;  4DSF A;  2ASD A;  1KLN A;  2A1J B;  4KLI A;  2PBE A;  3OSN A;  3Q8Q B;  4QWC A;  3Q8R B;  3GDX A;  2FMS A;  3E2E A;  1RYR A;  4F2R A;  1COO A;  3H8J A;  3T5L A;  4QZC A;  4PHD A;  3C2M A;  4O3S A;  7ICS A;  4XQ8 A;  2BCQ A;  4E7X A;  1TFY A;  5DG9 A;  4F92 B;  4QZB A;  7ICR A;  4XUS A;  4KLH A;  4NLG A;  3N97 B;  1RXV A;  5KFK A;  1UEU A;  1D9D A;  3EW9 A;  4ED7 A;  2FLP A;  7ICN A;  1JN3 A;  2ZUC A;  4DL7 A;  4NXZ A;  2AGP A;  8ICB A;  9ICW A;  3T5J A;  3JPT A;  4KN7 A;  1KFT A;  3V7L A;  3GIJ A;  1L3S A;  4B9T A;  8ICE A;  2M2T A;  5DQG A;  1NK4 A;  2R8I A;  3OSP A;  4KLE A;  7ICO A;  3OVB A;  2DR7 A;  5KFW A;  1KNY A;  4B9N A;  3OVA A;  5DQI A;  4ECU A;  3RJF A;  3AQL A;  5CJ7 A;  2B21 A;  2BGW A;  3RJH A;  4QZA A;  2HVH A;  1V4A A;  1PZN A;  4QZG A;  3M8S A;  3GIM A;  3GQC A;  4RNM A;  4KLT A;  4E8F A;  4EBJ A;  4C8N A;  1JIH A;  4R8U B;  4UAW A;  4EEY A;  3H7I A;  1TVA A;  4DQI A;  3AQM A;  1TFW A;  9ICF A;  1TK0 A;  4I2J A;  8ICF A;  9ICK A;  5J0Y A;  4RWQ A;  4TUR A;  3HW8 A;  1ZET A;  4WC7 A;  1MC8 A;  3G6V A;  1T8E A;  2IBK A;  4O3O A;  2ZTC A;  3Q8L A;  3RAQ A;  1JXE A;  3MFH A;  2IA6 A;  4JWN A;  2BKE A;  4KLS A;  1SKR A;  1ZQD A;  8ICM A;  4KTQ A;  4NKT A;  5KG2 A;  2ZH4 A;  4QZE A;  3RRH A;  8ICS A;  5HHH A;  4FBT A;  2P6U A;  1KFD A;  3EPG A;  5KT3 A;  5KT4 A;  9ICR A;  4I2C A;  2RDI A;  3ORY A;  2XCA A;  1UT5 A;  1ZQY A;  4J9P A;  4DOA A;  2PFP A;  1KRP A;  2DR5 A;  3JPS A;  4X5V A;  5HRB A;  3PV8 A;  4FHY A;  3THV A;  3C1Y A;  2DPI A;  1KSP A;  2J6U A;  9ICA A;  3T5H A;  2KFN A;  1UT8 A;  4DOB A;  3Q8P B;  2C2D A;  3RJE A;  4C8O A;  1Q79 A;  1ZQI A;  4QZF A;  3JPO A;  2BCS A;  2KTQ A;  2VA2 A;  2Y1J A;  4ECY A;  8ICX A;  4P4P A;  5J0T A;  5CR0 A;  2R8H A;  3B0X A;  4F93 B;  3MDC A;  5EOZ A;  3Q8M A;  8ICO A;  2DR9 A;  3MAB A;  1NKC A;  1MSW D;  4I2F A;  4RQ0 A;  3SV3 A;  2NRK A;  2ZH5 A;  4F5N A;  4DQP A;  1IM4 A;  4KLM A;  4UD5 A;  3WFR E;  4RPY A;  9ICB A;  4UB1 A;  1TK8 A;  1RZT A;  5KT6 A;  2VAN A;  3FDS A;  1NK5 A;  1ZQQ A;  4ELT A;  7ICU A;  4KLJ A;  3UXN A;  3V6K A;  3PW5 A;  2R8K A;  4ECT A;  4DQR A;  1L3V A;  4KLQ A;  3H8S A;  3OUY B;  1SKS A;  2ZH7 A;  5DGB A;  1NJZ A;  4GXJ A;  9ICT A;  5KG7 A;  4O3Q A;  1SZP A;  3RR7 A;  4YMM A;  3BDP A;  2HHX A;  2FPK A;  3IHQ B;  5KFI A;  2FMP A;  4F4K A;  3HP6 A;  2FLL A;  3ZDA A;  2PFO A;  3ZDD A;  4BGD A;  3JPQ A;  4DFK A;  4ZH4 A;  4O5C A;  4O3R A;  7ICI A;  1YLQ A;  5C5J A;  2W9B A;  4DQS A;  3ZD9 A;  4RQ4 A;  1NJY A;  3QE9 Y;  1S0O A;  3RJK A;  4F8R A;  2W9B B;  2ZJ5 A;  4M0A A;  3JZ0 A;  3Q8K A;  2ZH6 A;  4F4W A;  4DWI A;  1MIV A;  1VJ7 A;  3EZ5 A;  1EXN A;  7ICK A;  4RQ7 A;  3C18 A;  1U48 A;  5EWG A;  1WOT A;  4DFJ A;  4B9M A;  9ICS A;  1TK5 A;  4MEX A;  4B9V A;  3SYZ A;  2V9W A;  5L1L A;  2OWO A;  4K4I A;  4TQS A;  3K4G A;  4Z6E A;  3UXO A;  3TAP A;  1MQ3 A;  3QEB Z;  1S76 D;  2HW3 A;  4GC7 A;  7ICV A;  3PML A;  3GV7 B;  3RB4 A;  1WCN A;  3M9M B;  1NK6 A;  2ZJA A;  9ICX A;  4I2I A;  5KFV A;  1XU4 A;  4LZD A;  5DB8 A;  4Q44 A;  2W8L A;  1S0N A;  4E0D A;  4X4T A;  1ZQM A;  4X0A A;  2J6S A;  4F91 B;  4PPX A;  1ZQW A;  1SL1 A;  3FYH A;  5HRL A;  3HJ4 A;  4FS2 A;  5KFN A;  1QSS A;  1CEZ A;  7ICJ A;  4WC4 A;  4NKU A;  3PR5 B;  4ECS A;  5IIK A;  1X2I A;  3AQN A;  4WC6 A;  1K1S A;  1UET A;  3L9D A;  5DEC A;  4X4Q A;  5J2C A;  4KLL A;  5KFJ A;  5J0U A;  5EWE A;  3KHG A;  1XSL A;  4RZR A;  4J9M A;  5J2G A;  5III A;  3V7J A;  2FPL A;  3PW7 A;  4JV2 A;  9ICU A;  4ECW A;  1BNP A;  3EPI A;  1QLN A;  5J2K A;  4KMU A;  2UVR A;  3HT3 A;  1ZJN A;  1MIW A;  5KT5 A;  2ZH9 A;  4JV0 A;  4YMO A;  5J2B A;  4WC0 A;  2M2U A;  4ELV A;  3ISC A;  5DQH A;  9ICE A;  3JYY A;  4QWD A;  5KFM A;  4DL5 A;  5DG8 A;  1UA1 A;  4Z6C A;  4FHV A;  4RQ2 A;  3OJU A;  9ICM A;  2W8K A;  2MAX A;  2W9C A;  3V7K A;  2PXI A;  1ZQG A;  1BPE A;  4JUZ A;  4ECX A;  1JXL A;  5CP2 A;  4I2H A;  2W9C B;  4M2Y A;  5F2V O;  1JX4 A;  1DGS A;  5KTQ A;  4I2E A;  4M04 A;  4IQV A;  3PNC A;  1QSY A;  4ECR A;  3LK9 A;  5KFU A;  4GC6 A;  4RU9 A;  2R8G A;  2BE3 A;  4NM2 A;  5J0W A;  5KFL A;  2XGQ A;  1X9S A;  1ZQZ A;  3EWA A;  1A77 A;  4O3P A;  4YCX A;  4PHE A;  4WC5 A;  1Z00 A;  4KN4 A;  1NJX A;  2FMQ A;  3QZ8 A;  1ZYQ A;  8ICA A;  1Z00 B;  2BCU A;  8ICG A;  3C23 A;  1D8Y A;  3PX4 A;  5HRE A;  5KT7 A;  4TUS A;  4EYH B;  5DLF A;  2BQU A;  4PGY A;  4QZD A;  2XY5 A;  1NK9 A;  5KFP A;  9ICO A;  4X4U A;  3SZ2 A;  2KFZ A;  5DB6 A;  1T4G A;  9ICQ A;  1NKE A;  2KZM A;  2V4R A;  4UBC A;  1CUK A;  5J2H A;  2PI4 A;  3PMN A;  5CB1 A;  4P4M A;  1TAU A;  2DVI A;  4EP7 A;  3ZDE A;  5J0S A;  4Q45 A;  3GV8 B;  9ICG A;  2ALZ A;  4BDP A;  3LDA A;  2WTF A;  1HUZ A;  3HX0 A;  8ICP A;  5IIJ A;  9ICH A;  2M2W A;  5HHI A;  5L9X A;  5KG6 A;  2PFN A;  4UBB A;  3T3F A;  4I27 A;  4NM1 A;  3MR2 A;  4F4X A;  5J2J A;  5IIO A;  3MFI A;  5HP4 A;  3MR6 A;  4F3O A;  2HHP A;  2FPM A;  5CA7 A;  2HHT A;  1WCL A;  3K75 D;  1KTQ A;  5DBC A;  4R64 A;  3KTQ A;  2IMW P;  4DSI A;  4ED8 A;  5KFQ A;  3C2L A;  1ZQX A;  1ZQJ A;  4FH5 A;  4DFM A;  5HMM A;  5F9L A;  3BQ0 A;  3AU2 A;  1SKW A;  4RWP A;  1PX5 A;  4YVZ A;  3PR4 A;  4ECQ A;  2BPF A;  3OJS A;  7ICM A;  5KFE A;  4O0I A;  4PGQ A;  3WFQ E;  4DS4 A;  4FS1 A;  1ZQR A;  2ZUD A;  4YN4 A;  1LV5 A;  8ICI A;  5HRD A;  2BCV A;  4E80 A;  4Z6D A;  5CWR A;  3GFK B;  3T5K A;  1NJW A;  1UEV A;  5KFH A;  4Q43 A;  1ZQA A;  3TFR A;  4X4O A;  4I28 A;  2PI5 A;  4NY8 A;  3OHB A;  5D49 A;  4NLN A;  1HUO A;  3TI0 A;  8ICJ A;  8ICQ A;  1MIY A;  4UB2 A;  5J0P A;  3HWT A;  4MF8 A;  4KLO A;  2M2V A;  4EBD A;  2C2R A;  4WBZ A;  3QEA Z;  9ICP A;  4WC2 A;  2XC9 A;  4IRC A;  3C5F A;  8ICC A;  2BPC A;  4WC3 A;  1VFG A;  7ICQ A;  4AT7 A;  4TUQ A;  3H40 A;  1SL0 A;  4WCW A;  4QW9 A;  1T3N A;  4AT7 B;  4QWE A;  4YR0 A;  5L1K A;  1D8L A;  4M6W A;  5KFO A;  4RQ5 A;  4JV1 A;  3RTV A;  5HML A;  3V6J A;  4M6W B;  3WFP A;  4QWA A;  5TZV A;  4LZG A;  4KIT B;  4TQR A;  3H4B A;  1TV9 A;  2ATL A;  2W9A A;  5DB9 A;  4FBU A;  1JAJ A;  2MUT A;  4RWO A;  4C8L A;  8ICK A;  2MUT B;  4KLD A;  3GV5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...