2I9GA

Dna polymerase beta with a benzo[c]phenanthrene diol epoxide adducted guanine base
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
325
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*TP*CP*GP*G)-3'
publication title Structure of DNA polymerase beta with a benzo[c]phenanthrene diol epoxide-adducted template exhibits mutagenic features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 109
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2i9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2i9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2i9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2i9gA03
5CJ7A 4NM2A 2M9NA 4FHYA 4AT8B 4EBDA 2JEJA 4O5KA 1L3UA 3RH6A 3QZ8A 4GLXA 3HJ1A 4O3OA 5KT4A 4O9MA 9ICBA 2ZTEA 2DRAA 4RQ4A 2VA3A 4ED7A 4CCHA 1BNOA 2P6RA 2Y1IA 8ICAA 3GIJA 2W9CB 4ECUA 3HT3A 9ICGA 4EBCA 5CR0A 1CEZA 2ISOA 3AQNA 1XSPA 4RT3A 4MFCA 1XU4A 5CA7A 5J0XA 3T5HA 4KLFA 4KLIA 5J0YA 4UQGA 4GC6A 5DQGA 4Q8FA 4QZ9A 4I2IA 4X4NA 1NK4A 7ICTA 2IBKA 1UT5A 1ZQYA 1A77A 1L3SA 2PI4A 5C5JA 3OVBA 2ZUBA 4KLGA 3MR5A 7ICVA 3Q8QB 1TAUA 4UD4A 3JPTA 5KT3A 1KFTA 3OUYA 2BQRA 4IRCA 4PHEA 4TQRA 4DQIA 4F5RA 1NOMA 1ZQLA 4RUAA 1JXLA 4GC7A 4DWIA 9ICNA 2XY7A 4J9RA 3RH5A 9ICPA 2RFFA 9ICEA 2M2WA 4EBJA 2NRXA 3UQ2A 4P4PA 4PGYA 3AU6A 5J0UA 4C8LA 2MUTA 3V6KA 9ICJA 3MFHA 4Q45A 2PFQA 3EWAA 7ICRA 1V4AA 2KP7A 1FA0A 5HHIA 3M9OB 1L3VA 3OHAA 1ZJMA 5CP2A 4X4VA 2AJQA 5DB8A 8ICCA 4F91B 1EXNA 4M04A 5DB7A 4QZHA 3AQKA 4LT6A 5KT7A 4WC7A 5KFGA 1DK2A 4I2GA 8ICFA 4X4TA 4DQQA 2ZH1A 5L1KA 4F50A 1LV5A 2IMWP 4M2YA 4RU9A 4ECQA 3RB6A 4B9MA 3C5FA 3HW8A 4X4RA 1BGXT 9ICQA 3RJGA 2I1QA 4YN4A 4YR3A 4UAWA 3SYZA 4DSEA 3RRHA 4O3PA 3V7LA 3T5KA 3NGDA 4DL3A 1UA0A 4RNMA 2DR9A 4UAZA 5KFQA 4F5NA 1NK8A 3FDSA 8ICYA 1ZQMA 4Z6EA 8ICKA 4R63A 1NKEA 9ICIA 1UEVA 3MDCA 3MABA 3UPSA 8ICNA 5DBAA 3OUYB 5J2GA 4YVZA 5KFJA 5DKWA 2KZMA 2ZH6A 4ED1A 4ED6A 1D8YA 3NYBA 3MDAA 4ECRA 1RXVA 9ICKA 3C21A 1JXEA 1S10A 4PHDA 2J6TA 4B9SA 3ORYA 1RPLA 4TUPA 2HVIA 2MUTB 2DRBA 3RB0A 4JUZA 3BQTA 2ALZA 2FLPA 1UEUA 3GV7B 1U45A 5KFCA 4UB5A 1H38A 2BCSA 7ICEA 3OSPA 4DL7A 4NLGA 4KLSA 5DDYA 3JPQA 7ICPA 5KT6A 2FPLA 2FMQA 2AQ0A 2W9BB 2M2VA 2KZ3A 4MF2A 3H8JA 3MR6A 3T3FA 4O5CA 1T8EA 1ZQPA 4RNOA 3PV8A 7ICMA 3KHRA 1UETA 4XQ8A 4YP3A 4LVSA 8ICHA 4YD1A 4IQWA 5KFWA 4DSLA 1U9LA 2KTQA 5IIMA 5J2IA 3OSNA 3Q8MA 1MQ2A 2BPCA 4ZH4A 2RDIA 4KLTA 9ICVA 4ED8A 3OV7A 4PH5A 2DPIA 5DEDA 4DFPA 4UB1A 4ECYA 2R8GA 5KFPA 3PW4A 4FS2A 1U48A 5J29A 4O3NA 5BPCA 3PW7A 1S97A 2UVVA 1TK0A 3H37A 2MAXA 3HPOA 4FHWA 5KG4A 2IHMA 1SL1A 4DSFA 1JX4A 3M9NB 4O3QA 2BHNA 1KTQA 5DLFA 1XWLA 5HMMA 1LB2B 1X9MA 2ZJAA 4YXJA 1Q78A 1VJ7A 5HRGA 2JZBA 2XGPA 2XY6A 4KLDA 1A76A 5IILA 4TUSA 1L3TA 3WFSC 3PY8A 2C28A 5KFHA 5D4BA 5J0RA 4PHPA 1MQ3A 2IHNA 4E8FA 2ZHAA 5KG3A 3PW2A 8ICUA 2PFPA 4UBBA 1V9PA 4PGQA 2VA2A 2BPGA 9ICTA 8ICXA 4EP7A 2NRWA 1IM4A 4I2JA 4WC1A 4AT9A 4QZDA 2W8KA 1R8AA 5J2BA 1R8BA 4Q44A 5L9XA 1ZQGA 2O1PA 2J6SA 3RAQA 4X4PA 2Q66A 4F5OA 5KFBA 8ICZA 2ATLA 2NRKA 2V4RA 4ECZA 1SL0A 4I27A 1PX5A 4WC2A 5DB6A 4NLZA 1TK8A 4G3IA 2HHPA 5IINA 4RPYA 1WOTA 5KFUA 3ZDBA 4I2BA 3MR3A 5HRIA 4FHVA 4X4SA 3RTVA 3V72A 3PR5B 4YCXA 5DLGA 2J6UA 3PO4A 4DS5A 4O3RA 4RWOA 4QZEA 2DR8A 4WCWA 3RJEA 4K4IA 4DO9A 4K4HA 4I2CA 2C2DA 2HW3A 3Q8SB 2KN7A 1RXWA 3ZD8A 3RJIA 7ICGA 1MSWD 4EBKA 4DFJA 4WC6A 5DG7A 1ZQDA 4KLEA 4FH5A 3TAQA 4ECXA 4AT7A 3SV4A 4DS4A 1ZQSA 1DGSA 4RZRA 4YG2A 3KHGA 4X5VA 5F9NA 1S0NA 2BDPA 4XA5A 1YLQA 4NLNA 1BPZA 2NRTA 4YMOA 3C5GA 3WFRE 1PZNA 3KHLA 4QWAA 3ZDEA 5KFOA 3PO5A 3WFQE 2LYHA 5KFZA 5D49A 5KTQA 3M8SA 4IQVA 2AQ4A 1SKRA 1Q79A 4YFKA 4ECTA 1U47A 3HJ4A 1NK7A 1KDHA 5F9LA 1KLNA 1S9FA 1D8LA 2FMSA 9ICWA 1ZYQA 1ZETA 2F1IA 5DG9A 9ICFA 4F5QA 2FPMA 3SZ2A 2ID1A 5JUMA 2W9AA 8ICIA 4PHAA 3JPRA 1R89A 9ICMA 2PI5A 4QZ8A 3OHBA 7ICSA 5HP4A 1T4GA 1NJXA 1KSPA 3ISBA 1ZQBA 5DECA 3N4MB 2ASLA 4IRKA 4YMMA 5J0QA 4IRDA 8ICOA 4DSKA 3M9MB 3T5LA 4C8MA 4F4YA 4DLEA 3B0XA 4NXZA 1QSSA 1ZQEA 4I2HA 1MIYA 4AT7B 4RQ1A 4S3NA 4E80A 1S0OA 4F93B 4ATBA 2OWOA 5IIKA 3UQ0A 2PXIA 4QWDA 3PX6A 1ZQXA 1NK0A 4I28A 3EW9A 4QW9A 4YR2A 1S76D 5CB1A 4GXJA 4ECSA 1WCLA 3RR8A 4J9NA 3NTUA 4YXMA 3FYHA 4R66A 5J0OA 4M47A 3EZ5A 5KG6A 1TVAA 2IA6A 1Y88A 2PFOA 3RRGA 4J9MA 2JEFA 5KFXA 2DPJA 3BDPA 1X9WA 5HRFA 5J2HA 3BQ1A 2AU0A 1NKBA 1B22A 2KZZA 9ICUA 5DB9A 2ZH4A 2ZTDA 3PX0A 1NJZA 3WFPA 5CWRA 3V6JA 4I2AA 5J0WA 1ZQCA 7ICFA 3LWMA 1KFDA 3MFIA 1NK5A 2NRZA 1HUZA 4UAYA 2BCUA 1HJPA 1RYRA 4ED3A 3QEBZ 2BCRA 3HWTA 4MEXA 3H8WA 3N97B 1WCNA 1QSYA 4DF4A 1RZTA 2JEIA 5J2JA 8ICVA 3C2MA 4BGDA 2DR7A 3G6VA 1OU5A 3TANA 4XUSA 4KMUA 4ATBB 4KLMA 1DOQA 4QZBA 4I2FA 7ICHA 4X0AA 2DFLA 2XGQA 3SI8A 3THVA 4IR9A 4RPXA 2A1JA 5HR9A 1N48A 2NRVA 4BWJA 3LWLA 4M9JA 3UXOA 3OVAA 2ZUDA 4QZIA 4QWBA 7ICQA 4TQSA 3K75D 3H40A 1BNPA 3C18A 2DVIA 3B0YA 1UT8A 4RWQA 3PX4A 4UBCA 1BPEA 1VFGA 1ZQWA 5DQIA 5KG7A 2F1JA 3Q8RB 4P2HA 1NZPA 3RJFA 3LQCB 5HRBA 1S0VA 2W8LA 5J2CA 5L1JA 2HHSA 5KFIA 3C2LA 5KFLA 5KFTA 4DSJA 4DL4A 4R64A 1NK6A 2PBEA 4E7XA 1S0MA 4DEZA 4QZGA 4IQUA 4Q8EA 1QTMA 4ELTA 2HHWA 1ZQAA 4TUQA 4QW8A 4NM1A 2KFNA 1S77D 2V9WA 2PFNA 4DQPA 5HREA 2HHQA 2C22A 1JAJA 4I29A 2XO7A 3RR7A 2O5AA 4DQSA 1ZQQA 3RJJA 4DOCA 5HC9A 4QZCA 5EWEA 1NK9A 5KG1A 4O5EA 3JZ0A 3OVSA 2ZH3A 4WC5A 1F5AA 9ICOA 3GIMA 1XO1A 4FBUA 4E0DA 2A1JB 4J9PA 3TFSA 1NJWA 4FS1A 2HHTA 3RBDA 5J2DA 5DDMA 8ICQA 1MIWA 5J2KA 2P66A 4YQWA 1T3NA 2UVUA 4AT8A 5EOZA 2HVHA 4I2EA 4X4OA 4HYKA 4RWPA 7ICUA 9ICSA 2F1HA 5J2FA 3RB4A 1KEJA 2ZUCA 4R65A 4MF8A 2R8HA 4GXKA 3L9DA 2W9CA 3PMNA 4J9LA 4PGXA 2C2RA 1C7YA 1BPDA 4DOBA 2R8KA 5BOMA 3EPIA 4BXOA 4C8KA 1JMSA 4RQ0A 4RQ8A 2HHVA 4JV1A 3H3AA 3TQ1A 3GV5B 3HIYA 1TFRA 2ZH2A 1RYSA 3C23A 3OGUA 2JZBB 4GXIA 4PPXA 2R8IA 1BVSA 2BKEA 1BPYA 8ICPA 1NJYA 2XCPA 3H8SA 4JWMA 2B21A 2M2UA 1K1QA 4RT2A 1B43A 3TAPA 3ISCA 7ICLA 5HRDA 2HHXA 4ED0A 4KLQA 3AU2A 5KFKA 3LK9A 4WC3A 4DL6A 1TKDA 5HHHA 3PW0A 4C8OA 1KNYA 4NLKA 3GIKA 5F2VO 5HMLA 3GFKB 4EYIB 3RB3A 1ZQIA 4AT9B 2I9GA 3JPOA 9ICXA 1ZQOA 2VA8A 1D9FA 5CHGA 1SZPA 5J2AA 3GV8B 4FO6A 4KLUA 4KTQA 8ICRA 3UXNA 4K4GA 4XQ7A 4IR1A 5KT5A 2FLNA 4NY8A 5J0TA 2XCAA 3V6HA 3JYYA 3G6XA 4JV0A 4DFMA 4BXOB 4ECWA 2XY5A 4EEYA 1Z00A 5IIJA 3MGIA 4M5DA 3MR2A 7ICOA 9ICCA 4NKUA 2BCVA 1UA1A 1TK5A 1JN3A 1QSLA 5J0SA 4I2DA 4QWCA 5KFMA 4DF8A 2ISPA 4M6WA 7ICJA 3UPQA 4WC0A 4O0IA 2H5XA 3IHQB 4Z6CA 3PVXA 5DGBA 3H4BA 2XC9A 3H7IA 4ELUA 4M9HA 8ICBA 1DK3A 1ZQVA 3AUOA 3ZDAA 8ICSA 5IIIA 1SKSA 4X4QA 4BWMA 2ZH8A 5KT2A 4RPZA 1TV9A 3IM1A 1ZQKA 3PR4A 3H4DA 3C2KA 2UVRA 3PNCA 4JV2A 2BCQA 5EWFA 3PMLA 4KN7A 4ECVA 8ICJA 4MEYA 3ZD9A 5KFEA 4DL2A 1SKWA 2Y1JA 2ASDA 1XSLA 4Z6DA 4FBTA 4RWNA 4UB3A 1X9SA 3LDAA 1XC9A 2AGQA 8ICTA 4TURA 2AGOA 3ISDA 3SV3A 2W9MA 2W9BA 4F4WA 4EZ9A 1MIVA 1TFWA 1MC8A 5KFYA 5KG2A 4QZFA 4DLGA 1Z00B 7ICKA 3RJHA 2BE3A 3ZDDA 1X2IA 1QLNA 4Z6FA 4B9NA 2FLLA 3RJKA 2ZTCA 3E2EA 5KG5A 3JPNA 4RQ2A 1TAQA 3MBYA 2R8JA 4JWNA 3JPSA 5KFRA 4KLLA 1COOA 4KLOA 4M6WB 5L1IA 2AGPA 3WFOA 4IG8A 4O3SA 1KFSA 2RDJA 4BDPA 1K1SA 4B9UA 1ZJNA 1ZQZA 1D9DA 4ED2A 4DFKA 3PW5A 3Q8KA 1U4BA 3GIIA 4DL5A 4J9OA 4DOAA 4LZGA 5HRKA 5IIOA 5KFDA 4NKTA 1BPXA 4EBEA 2FPKA 5DQHA 3Q8LA 3H38A 3OJSA 4MFFA 3K4GA 5DBCA 3GILA 2FMPA 3BQ0A 1NKCA 4RUCA 4M0AA 3M8RA 2KFZA 1ZQNA 8ICLA 1AROP 3EPGA 4UB2A 4F4KA 5EWGA 2C2EA 1XS9D 4ELVA 4KLJA 1HUOA 3MGHA 3AQLA 4X0BA 1IXRA 4WBYA 4F92B 4F8RA 4P4OA 1XSNA 1ZQUA 3C1ZA 8ICEA 1R8CA 3C1YA 4M9NA 4UD5A 3QZ7A 3TFRA 7ICNA 3KHHA 3G6YA 3HX0A 4J9SA 1KRPA 5HNKA 1N56A 5KFVA 3RBEA 5DBBA 4YD2A 1CUKA 5TZVA 8ICMA 3KTQA 4F3OA 2P6UA 2JEGA 4M9GA 8ICGA 5HRHA 4YMNA 4LZDA 4DSIA 4F5PA 3RH4A 4EZ6A 1ZQJA 5DGAA 2UVWA 5HRLA 4RQ6A 3TI0A 4RQ5A 1NO5A 4RNNA 3OJUA 1ZQFA 3GQCA 8ICWA 2ZH9A 2BGWA 3C66A 4QWEA 1L5UA 9ICAA 3AQMA 5BOLA 4R8UA 3BQ2A 4B9VA 3UXPA 4FHPA 4F4XA 2GWSA 2HHUA 3HP6A 5L1LA 4FH3A 4M9LA 4DQRA 3RAXA 3GDXA 3T5JA 4JK1A 4QZAA 3H39A 3ZDCA 2ZH5A 1BPBA 4FHXA 4Q43A 4EYHB 1JQRA 3TARA 4P4MA 1ZQHA 5KG0A 2DR5A 5KFAA 4X4UA 1SL2A 3V7JA 5J2EA 4UB4A 2WTFA 4F4ZA 2BQ3A 4F2SA 2BQUA 5KFFA 3QE9Y 4B9TA 2V4QA 9ICRA 2VANA 4MFAA 4KITB 3BJYA 2Q0ZX 2ZJ5A 2ASJA 1JIHA 4IQTA 4XRHA 1ZQRA 2BPFA 2ZJ8A 9ICHA 2M2TA 5KFNA 5DG8A 5KFSA 4F2RA 4C8NA 3EYZA 3V7KA 3ETLA 2BR0A 3QEAZ 3JPPA 1TFYA 5J0PA 4KN4A 4WC4A 1Z3EB 4B9LA 1U49A 4RQ7A 2ZH7A 3Q8PB 1ZQTA 4YR0A 4J9QA 1T7PA 9ICLA 4WBZA 4KLHA 2ZHBA 4RQ3A 5D46A 4J9KA 4R8UB 7ICIA
chains in the Genus database with same CATH superfamily
3HRDD 4AT8B 4EBDA 2JEJA 2ZTEA 4RQ4A 9ICGA 4EBCA 2A19A 2BZFA 4RT3A 5J0XA 2HOQA 7ICTA 7ICVA 4KLGA 3L4PA 2DUYA 4UASA 3Q8QB 3KFUF 3OUYA 4TQRA 1NOMA 3BQ7A 4RUAA 1VDVA 4EBJA 2DF4B 3RH5A 2M2WA 1RQLA 4C8LA 2MUTA 3V6KA 3SENA 5HHIA 4NXVA 3M9OB 5DB8A 8ICCA 5KT7A 4WC7A 4X4TA 4F50A 4JMUA 4ECQA 1BGXT 2ZHBA 4YN4A 4U7CA 4DL3A 3T5KA 2DR9A 3NGDA 1NK8A 2K89A 4MHVA 1UEVA 3MABA 5DBAA 3KZIU 3OUYB 5J2GA 2KZMA 1D8YA 3T79A 1S10A 4B9SA 4TUPA 2MUTB 3BQTA 3GV7B 3UMGA 1U45A 7ICEA 3OSPA 4OAHA 3JPQA 2W9BB 3H8JA 4O5CA 1ZQPA 3PV8A 1UETA 1CI4A 1GPJA 4NL9C 2G06A 4KLTA 9ICVA 2BPCA 1WG8A 4ECYA 2E1EA 5HR7A 5AKLA 2A3VA 4O3NA 2W43A 3PW7A 1S97A 1RDFA 1TK0A 2MAXA 3N28A 3HPOA 5KG4A 4O3QA 1ED1A 2FE9A 1LB2B 2ZJAA 2XY6A 4NXUA 5T14A 1NI3A 5IILA 4TUSA 1Z1BA 3PY8A 5KFHA 5D4BA 1MQ3A 5KL1B 4E8FA 2PFPA 2VA2A 2ODGA 9ICTA 2KIVA 3QUBA 5H2FU 1IM4A 4I2JA 5ALNA 2PKEA 1R8AA 1ZQGA 2OHFA 4X4PA 2Q66A 5KFBA 4CE6A 2NRKA 3F53A 4RQMA 1PX5A 1YZ7A 4WC2A 2HHPA 1TK8A 5KFUA 5HRIA 3V72A 4UB8U 3RJEA 4DO9A 2HW3A 3Q8SB 2KN7A 4EBKA 5DG7A 2YMPA 1FFUA 3CRXA 3SV4A 3KHGA 1S0NA 3WFRE 1PZNA 4QWAA 5KFOA 3WFQE 5KFZA 5D49A 4FZLA 4LJXA 1QCKA 2OCEA 1U47A 5F9LA 2ZXHA 1S9FA 1SB3C 2PI5A 4QZ8A 1B4FA 5HP4A 1T4GA 5ALJA 2BDUA 2HI0A 3B0XA 4NXZA 3HJEA 1ZQEA 4I2HA 2KOBA 2YB1A 2OWOA 2PXIA 4QWDA 4OJ5A 3PX6A 1ZQXA 2W3RA 4US8A 3EW9A 4QW9A 4CRXA 4I28A 1S76D 5CB1A 4KX5A 4ECSA 2E5SA 4YXMA 3FYHA 2YY6A 3EZ5A 1QQ7A 2IA6A 2PFOA 2B56A 2JEFA 3S6JA 3BDPA 2H3FA 1B22A 3BQ1A 2KZZA 3D2SA 2JXJA 2GH1A 2ZTDA 1NJZA 3IG8A 4MKPA 1O08A 1HJPA 2BCRA 3HWTA 4MEXA 2AH5A 2JEIA 2KKVA 2F8KA 5J2JA 4BGDA 4J03A 3TANA 1L7MA 3SAFA 1DOQA 4I2FA 4IR9A 4RPXA 1Q3UA 1N48A 2B4VA 2ZUDA 2ZIVA 4QWBA 7ICQA 1BNPA 1UT8A 4C4TA 3PSPA 1ZQWA 4P2HA 1NZPA 5HRBA 2W11A 5L1JA 5KFIA 4WQLA 4DL4A 1S0MA 4IQUA 4ELTA 3OPXA 4TUQA 3M6KA 5JU5A 4DQPA 3ETRA 4I29A 3RR7A 1N60A 3QUTA 4DOCA 4QZCA 5EWEA 1DRGA 4WC5A 1F5AA 3GIMA 1XO1A 4FBUA 4E0DA 3NS1A 4FS1A 3RBDA 4OJOA 2P66A 4YQWA 4K99A 5A0LA 4I2EA 4X4OA 7ICUA 4UB6U 3H0LB 4R65A 2W9CA 3PMNA 4J9LA 1VFGA 1BPDA 4DOBA 4BXOA 5BOMA 4G3IA 1X42A 2DKXA 3D2NA 2F77X 4Y2VA 5B5EU 1BPYA 5ALZA 4O6AA 3H8SA 2E8MA 4F71A 5HRDA 1M6YA 5KFKA 4KLQA 3LK9A 4DL6A 5CHEA 3QU2A 4C8OA 1HIWA 1KNYA 3NWIA 3GFKB 2VIXA 2E8OA 3WK9A 4KTQA 4K4GA 2DGZA 4XQ7A 5KT5A 2FLNA 2DL0A 3V6HA 3G6XA 4JV0A 4BXOB 3DDHA 7ICOA 9ICCA 1J97A 2BE3A 3WKEA 4I2DA 2H5XA 4Z6CA 3ICXA 3PVXA 2XC9A 4ELUA 2HOFA 1ZQVA 4X4QA 4BWMA 4RPZA 3IM1A 1ZQKA 3C2KA 2UVRA 4WH5A 4ECVA 5AIAA 3GZFA 1XSLA 4Z6DA 1X9SA 1PVQA 3LDAA 3F2BA 2H3IA 5J8YC 1MIVA 5AKZA 1SV4A 3ZDDA 4B9NA 4RQ2A 1TAQA 4CGZA 5KFRA 4IG8A 2RRDA 5AI6A 2IHOA 1U4BA 3F5AA 3GIIA 4DL5A 2B51A 5IIOA 3E0FA 2OYYA 3OJSA 2FMPA 2VKQA 5AK3A 4RUCA 8ICLA 2KFZA 3EPGA 3O0FA 2KHQA 2IUBA 4FZMA 4NL9A 5ALSA 4F92B 4IL6U 2CPRA 3QZ7A 2YTUA 1KRPA 3UMCA 3RBEA 8ICMA 4M9GA 4YMNA 4LZDA 4DSIA 3RH4A 4EZ6A 1ZQJA 5DGAA 3TI0A 5ALTA 2AXTU 3C66A 4QWEA 1L5UA 3AQMA 4R8UA 4NXWA 3B9JA 2EZYA 1PK3A 4M9LA 3RAXA 3T5JA 4QZAA 3H39A 3NUQA 5G5GA 1ZQHA 5KG0A 2CXYA 4X4UA 4F4ZA 4UB4A 3QE9Y 2ZXIA 4B9TA 2V4QA 5AI8A 3SQIA 4KITB 2ASJA 4IQTA 4XRHA 9ICHA 2M2TA 5KFNA 4EEDA 2OM6A 4FZNA 3V7KA 1V38A 2BR0A 1SIJA 2EWRA 2ZIXA 1Z3EB 3LVVA 2QARA 3U26A 3Q8PB 1JROA 4RQ3A 4J9KA 5KL8B 4R8UB 7ICIA 3ER8C 3TACB 5ALWA 3QZ8A 2DRAA 3GU3A 4ED7A 3LYSA 8ICAA 3AQNA 2ISOA 5ALPA 4MFCA 2XVTA 4Q8FA 5DQGA 2K4IA 4I2IA 1ZQYA 5AKXA 3OVBA 2QARB 2ZUBA 3MR5A 1TAUA 3JPTA 2BQRA 4US9A 4IRCA 4DWIA 4P4PA 5ALLA 4PGYA 3AU6A 2W54A 2B0CA 3EWAA 1V4AA 1FA0A 1L3VA 4X4VA 3OHAA 1ZJMA 2AJQA 4M04A 2EANA 4QZHA 3AQKA 1B0XA 5KFGA 1DK2A 4I2GA 1DXSA 2H3QA 4RU9A 3KKAC 4B9MA 3C5FA 1XSPA 4UAWA 4DSEA 1XC9A 9ICKA 4O3PA 3V7LA 4QIWC 4RNMA 4F5NA 3PSFA 2XICA 4Z6EA 8ICKA 1NKEA 2I6XA 5AK4A 8ICNA 3UPSA 4NXTA 4YVZA 5DKWA 2LI6A 2ZH6A 4ECRA 1RXVA 3C21A 3WK5A 4PHDA 2HVIA 1RPLA 2HBMA 4JUZA 4OJPA 5KFCA 1N2XA 2K60A 4UB5A 2BCSA 4KLSA 5DDYA 7ICPA 2LMRA 2LPEA 5KT6A 2FPLA 5AKYA 2FMQA 4MF2A 3MR6A 2HOIA 1T8EA 2WHEA 3BS7A 7ICMA 3KHRA 4YD1A 5ALEA 5KFWA 2ZIWA 2JMGA 2WF9A 3CW2C 4UW9A 4JLZA 3A0HU 1MQ2A 5ALGA 4PH5A 2DPIA 3SAGA 5KFPA 5AI0A 3PW4A 4FS2A 5BPCA 3UMBA 2UVVA 4K97A 2IHMA 3ALRA 4DSFA 1JX4A 5DLFA 2ZH8A 2BHNA 5HMMA 5HRGA 2JZBA 4KLDA 1ZD3A 1L3TA 4WQKA 2GA9D 1J2NA 5KG3A 3PW2A 5AKIA 3H0RB 5AM1A 1V9PA 2Q4TA 8ICXA 5ALMA 1JRPA 2CN1A 1F44A 3JCFA 4AT9A 5J2BA 2ZIWB 1R8BA 1COKA 1TAMA 3RAQA 8ICZA 2H3ZA 2V4RA 5DB6A 1LVHA 4PL1A 5IINA 4RPYA 5B3PA 3FAHA 3ZDBA 4I2BA 4X4SA 4EEKA 4YCXA 2J6UA 1JI7A 4F72A 4QZEA 2DR8A 4WCWA 2C2DA 3I28A 4Y2TA 7ICGA 1MSWD 4NLBA 2K8CB 1JALA 1PK1B 1ZQDA 4WC6A 1X9XA 4YG2A 4X5VA 5F9NA 2BDPA 4BX9C 4NLNA 1KN5A 4CF3A 3ZDEA 4CNQA 2LYHA 1L7NA 4IQVA 1SKRA 4YFKA 1L6NA 1SV0C 2G08A 3HJ4A 1KDHA 5G5HA 1MA7A 2QLTA 1ZETA 4P0QA 1ZYQA 4F5QA 2QB0B 2KNJA 8ICIA 4JB3A 3FM9A 3NRWA 2MSNA 1NJXA 1KSPA 2QKQA 4IC9A 2G5IB 3ISBA 2ASLA 4IRKA 4YMMA 3M9MB 3T5LA 4O68A 2F3NA 4RQ1A 3QU9A 4E80A 1S0OA 2LYAA 4Y2PA 3VCBA 2N1RA 5J8YA 5ALRA 4UARA 4BJQA 4M47A 4Y2UA 1Y88A 4PL2A 3RRGA 2DPJA 4P0QB 1LKYA 3QXGA 5J2HA 2AU0A 3R9KA 1NKBA 2ZH4A 3PX0A 2YMLA 3WFPA 5CWRA 3N7SC 5AKKA 2H3VA 1ZQCA 3LWMA 1KFDA 1NK5A 2NRZA 1HUZA 2BCUA 3ERCC 3IN5A 1RYRA 4ED3A 3H8WA 3AQEA 1QSYA 4DF4A 2JH7A 1OU5A 4XUSA 7ICHA 2G0AA 3SI8A 3SR6A 3PZPA 1NNLA 5HR9A 3FC4A 3UXOA 2LM1A 3B0YA 4KB6A 1LKYB 2F1JA 5TISU 4GIBA 3C2LA 5KFTA 2PBEA 2K4PA 4NM1A 2KHVA 3IG5A 2ES6A 1JAJA 2EZZA 2XO7A 2O5AA 4DQSA 1ZQQA 3AEVA 5HC9A 2I5HA 5KG1A 4O5EA 3OVSA 2ZH3A 4J9PA 3N7PD 1NJWA 4FO1A 1MIWA 5J2KA 2PMZF 1T3NA 4LEZA 5EOZA 2HBKA 2HVHA 2P35A 4RWPA 1V85A 5J2FA 1KEJA 2ZUCA 4MF8A 2R8KA 1ZRNA 2JV3A 1JMSA 3TQ1A 3HIYA 2ZH2A 1RYUA 1KBUA 3OGUA 3C23A 3CP8A 5AM3A 2R8IA 2BKEA 1WUDA 1NJYA 4JWMA 2M2UA 2YB4A 1YZ6A 2NV3A 5HHHA 3PW0A 2JH1A 5CFSA 3HKZF 5F2VO 1QQ5A 1D9FA 5J2AA 4HX0A 5B3QA 4FO6A 4BUGA 2IOFA 3IP4B 3RF9A 4A8EA 5J0TA 2XCAA 1PVRA 2FCLA 4DFMA 4ECWA 2KE7A 1SZHA 4EEYA 3BZCA 1Z00A 3SEIA 4M5DA 1QSLA 4QWCA 5ALDA 7ICJA 4DF8A 4O0IA 3LVWA 1CRXA 3H4BA 8ICBA 2EQYA 1SKSA 2JHDA 2FDRA 1ECWA 2KVSA 3PR4A 3H4DA 2ZHAA 3PMLA 3ZD9A 5KFEA 3WKCA 2G07A 3KKAA 2WAQC 3WK4A 4UB3A 4TURA 3ISDA 4EZ9A 4Y2JA 4F4WA 1MC8A 5KG2A 4QZFA 2WF5A 1Z00B 3RJHA 2A1AA 2R8JA 2YMQA 4EV6A 5L1IA 3WFOA 2NO5A 4O3SA 2RDJA 4BDPA 4B9UA 1ZQZA 3PW5A 3Q8KA 5HRKA 4C80A 5KFDA 4NKTA 4EBEA 4KX3A 4MFFA 2YX8A 2QB1A 1AROP 5EWGA 2RP5A 2RHFA 3SMVA 3MGHA 4X0BA 2VJ4A 4F8RA 1XSNA 3C1ZA 3C1YA 2DWQA 7ICNA 4EENA 3G6YA 1N56A 5DBBA 3KTQA 2P6UA 8ICGA 3QX7A 2DQNB 1ZQ1C 4RNNA 2ZH9A 3A0BU 8ICWA 3AL0B 4EEBA 5ALKA 4B9VA 4FHPA 4F4XA 1N61A 3M6ZA 3HP6A 5L1LA 1S5LU 2ZIVB 4EYHB 1JQRA 2GO7A 4P4MA 4K9BA 1SL2A 4C7YA 9ICRA 4CF4A 2Q0ZX 5DG8A 2WF7A 5KFSA 4F2RA 5AM2A 3QEAZ 1TFYA 5JTIA 4B9LA 2ZH7A 9ICLA 4WBZA 4WOYA 5D46A 5ALXA 4NM2A 2M9NA 3AMZA 1L3UA 3RH6A 3HJ1A 1RQNA 5KT4A 2JRZA 3AM9A 2VA3A 2W9CB 2ESEA 1CEZA 1XU4A 3KD3A 1OW5A 5J0YA 4UQGA 3TADC 4C7ZA 4NLCA 1ZOLA 2KSOA 1KL9A 5CFUA 1KFTA 4PHEA 4DQIA 4F5RA 2E3TA 4GC7A 4J9RA 2RFFA 2KEYA 9ICPA 3DV9A 9ICJA 2D6FC 3MFHA 4Q45A 2PFQA 1KW4A 5CP2A 2KJ5A 3NVVA 2ZH1A 4DQQA 5L1KA 1LV5A 4M2YA 3RB6A 1VJ5A 4X4RA 3HW8A 3RJGA 3SYZA 1UA0A 3OTQA 3RRHA 3AQFA 4UAZA 5KFQA 3F2DA 1ZQMA 5EE9A 4R63A 9ICIA 1XO0A 5KFJA 4EX7A 4ED1A 2K4HA 3NYBA 3MDAA 2J6TA 1JXEA 3ORYA 2DRBA 5D61A 3L5KA 2ALZA 1Q46A 1UEUA 4OAGA 4DL7A 4NLGA 4G9BA 5AI4A 2K4EA 5L1MA 2WB1F 2Z7JA 2M2VA 2KZ3A 4KMOB 3T3FA 4RNOA 3J81j 2WF8A 3KOOA 4USAA 4DSLA 1KKXA 2KTQA 3ER9B 2KG5A 3QU4A 5IIMA 5J2IA 4AP9A 3OV7A 4ZH4A 3C28A 4ED8A 4DFPA 4UB1A 1UQVA 5J29A 4FHWA 4NV0A 3M9NB 1KTQA 4PZNA 4C0ZA 1Q78A 3H8MA 2XGPA 1A76A 1YT3A 5AM0A 5AK6A 1P7DA 3D6JA 2FJ6A 5JRTA 2LHTA 4UBBA 2BPGA 4K98A 2B6GA 2NRWA 4QZDA 2W8KA 4Q44A 5L9XA 2R18A 2O1PA 4NJ8A 2ATLA 4ECZA 1SL0A 4NLZA 1PVPA 3QYPA 4DS5A 4O3RA 3OWGA 4RWOA 3SAHA 4K4HA 5AHXA 3H0MB 4DFJA 2W04A 1KQQA 4KLEA 4ECXA 2E1FA 4DS4A 2XIDA 1DGSA 4XA5A 1BPZA 2NRTA 3PO5A 5KTQA 2AQ4A 2M0NA 2ZIXB 2KD1A 1KLNA 9ICWA 2FMSA 2F1IA 5DG9A 9ICFA 2FPMA 3MCRA 2ID1A 2G5HB 2W9AA 3JPRA 9ICMA 2LM4A 4ZOHC 1IV8A 5J0QA 4DSKA 2XI9A 3ONNA 4F4YA 5ALVA 1QSSA 1K5OA 4LEVA 4S3NA 3WK7A 4F93B 4ATBA 1Q3VA 4P0PA 3M7DA 2DBYA 5AKHA 1L7PA 3RR8A 3PSIA 4J9NA 3NTUA 4R66A 5KG6A 3WK6A 4J9MA 3QNMA 5CFTA 5J0WA 7ICFA 4OO1J 3D2QA 3MFIA 3N97B 1V97A 1RZTA 8ICVA 3C2MA 3G6VA 4ATBB 4KLMA 4QZBA 2DFLA 3THVA 4P0PB 1ZRMA 1L8OA 2NRVA 3LWLA 4KM5A 4HAIA 1NZBA 4QZIA 4TQSA 4RWQA 4UBCA 5DQIA 5KG7A 3RJFA 2W8LA 5J2CA 1NK6A 4E7XA 4QZGA 4Q8EA 1QTMA 3DEEA 2KFNA 2V9WA 4RQNA 5KNIA 1QH9A 1D8BA 3RJJA 2AHOB 4UAVA 1NK9A 5ALFA 3CYMA 9ICOA 4JLXA 2E8PA 4DFDA 5AM5A 5DDMA 5J2DA 1L7OA 2UVUA 4AT8A 4HYKA 3RB4A 1FIQA 1X40A 2R8HA 4GXKA 3L9DA 4PGXA 1C7YA 4C8KA 2HHVA 3H3AA 4RQ8A 2OEHA 1ZXIA 4JV1A 3WKAA 1TFRA 3I1YA 2JZBB 2LYBA 4GXIA 4PPXA 5ALHA 4RT2A 3TAPA 4ED0A 4AYBF 3AU2A 4WC3A 2ZIUA 2YN4A 5AI9A 2CRXA 3GIKA 5HMLA 5AM4A 1J2MA 1WWVA 4AT9B 1ZQIA 2I9GA 5AKGA 9ICXA 1X66A 1ZQOA 2VA8A 1FEZA 8ICRA 3UXNA 3TADA 4IR1A 4NWIA 4NY8A 2KV2A 1Z4NA 3L3FX 1OUQA 1FO4A 4FE3A 5IIJA 3MGIA 2GOLA 4NKUA 2WFAA 3CK6A 2BCVA 1TK5A 1JN3A 4QNLA 2NYVA 3UPQA 4WC0A 4PJ0U 1IIPA 1SXDA 2ZIUB 5DGBA 3AUOA 2WB1C 3NKUA 5IIIA 1DGJA 5KAFU 3PNCA 5EWFA 8ICJA 2F76X 2Y1JA 2D8CA 2ASDA 5HR6A 3NVWA 3SV3A 2W9MA 2W9BA 4DLGA 4GFJA 1ZD5A 1N5WA 1QLNA 1AQ6A 4Z6FA 3RJKA 2ZTCA 5KG5A 4KLLA 3MBYA 2AGPA 2IOHA 3SD7A 1K1SA 3PHZA 4Y2QA 3WK8A 1D9DA 4ED2A 2DKZA 2MU2A 1UPHA 4LZGA 2KJ9A 2D3DA 2W7OA 1BPXA 5DQHA 3Q8LA 3K4GA 2HBJA 3M8RA 1ZQNA 4F4KA 1N62A 4ELVA 1XS9D 2F44A 4ACOA 4OJ6A 1R8CA 2EAPA 4EX6A 3TFRA 3KHHA 3HX0A 2HSZA 5KFVA 1CUKA 5TZVA 4N7RA 2HMXA 5HRHA 3K1ZA 2W03A 5HRLA 4RQ6A 4RQ5A 3GQCA 9ICAA 5BOLA 2F2AB 4OJLA 1RG6A 4K9AA 2HHUA 1TE2A 5K4LA 4JK1A 1A0PA 3ZDCA 1N63A 2ZH5A 3TARA 2L5YA 3WKBA 3V7JA 3BS5A 2WTFA 5KFFA 1HEKA 1L8LA 5JTGA 2VANA 2UVWA 3BJYA 2BPFA 2EZXA 3AN1A 2ZJ8A 3E58A 4C8NA 3ETLA 3NVYA 5EE3A 3JPPA 5J0PA 3WU2U 4WC4A 1U49A 4C4RA 4RQ7A 2W3SA 4YR0A 4J9QA 4KLHA 1X6JA 4FFDA 2FI1A 5CJ7A 4FHYA 4O5KA 5B66U 4K96A 4GLXA 4O3OA 4O9MA 9ICBA 3EF2A 4CCHA 1BNOA 2P6RA 2Y1IA 3GIJA 4ECUA 3BS5B 3HT3A 5CR0A 1JUDA 5CA7A 2KVCA 3T5HA 4KLFA 4KLIA 4GC6A 4Y2RA 4QZ9A 5GTIU 4X4NA 1NK4A 2IBKA 1UT5A 1A77A 3MC1A 5D63A 1L3SA 2PI4A 5C5JA 2KKPA 4UD4A 5KT3A 1O03A 1ZQLA 1JXLA 9ICNA 2XY7A 9ICEA 2NRXA 3UQ2A 2G09A 5J0UA 7ICRA 2BBHA 2KP7A 5C0YA 3RFAA 4F91B 1EXNA 5DB7A 4LT6A 1F5SA 8ICFA 2IMWP 9ICQA 2I1QA 4YR3A 3VC8A 3I76A 3FDSA 8ICYA 3NASA 4Y2YA 3MDCA 4IS7A 4ED6A 5EE0A 3NVOA 5AKEA 3F5EA 3RB0A 3K1RB 2FLPA 3MGVA 3IRUA 2EAOA 1H38A 4LEYA 3ED5A 2AQ0A 2GAFD 2W55A 4XJEA 4UAUA 4XQ8A 4YP3A 5AKJA 4LVSA 8ICHA 4IQWA 1U9LA 4U6PA 3OSNA 3Q8MA 1Z19A 2RDIA 5DEDA 4AYBC 1URJA 2R8GA 5FP0A 5ALQA 4B6JA 1U48A 3H37A 1SL1A 1XWLA 1X9MA 4QIWF 4YXJA 2K8AA 1VJ7A 3WFSC 2C28A 2IHNA 5AI5A 4PHPA 5J0RA 8ICUA 3ZI4A 4PGQA 3QU5A 2HDOA 2JR5A 1A6SA 4EP7A 4WC1A 1Z4OA 2LBOA 2J6SA 4F5OA 3IDWA 4I27A 1WOTA 3MR3A 4FHVA 3RTVA 3PO4A 3PR5B 5DLGA 2HN1A 3C29A 4K4IA 4I2CA 2MA1A 1RXWA 1WYGA 3ZD8A 2Y0SF 3RJIA 5CEHA 3TAQA 4FH5A 4AT7A 1ZQSA 1SV0A 4RZRA 1SXEA 1YLQA 4YMOA 1SWVA 1T94A 3C5GA 3KHLA 2OXOA 5KAIU 5ALOA 3M8SA 5GTHU 5ALIA 1Q79A 4ECTA 1NK7A 1D8LA 4UATA 3SZ2A 5JUMA 4PHAA 1R89A 3OHBA 7ICSA 1ZQBA 5D62A 4QJFB 3N4MB 5DECA 4IRDA 8ICOA 4C8MA 4DLEA 1MIYA 4AT7B 5AICA 3KBBA 5IIKA 3UQ0A 4EELA 2OH2A 1NK0A 3QUQA 4YR2A 2HBLA 4GXJA 1WCLA 3EUB2 3K7DA 5J0OA 2KSOB 1TVAA 1T3QA 3CNHA 5KFXA 1X9WA 5HRFA 1MN8A 3N7RC 4PZOA 5DB9A 2RQ5A 9ICUA 2IOFK 2BBJA 3V6JA 4I2AA 2PMZC 4UAYA 3QEBZ 1WCNA 4DCCA 3M1YA 2DR7A 2Y9UA 4CF5A 2GLEA 4KMUA 2W7PA 4X0AA 2XGQA 2A1JA 4BWJA 4M9JA 2WF6A 3HILA 3OVAA 2KMDA 1S8OA 3C18A 3H40A 3K75D 2DVIA 2KK0A 3PX4A 1BPEA 2ZG6A 4NXXA 3Q8RB 3LQCB 1S0VA 2HHSA 3HKZC 5KFLA 1ZD2P 4DSJA 4R64A 2HHWA 4DEZA 1ZQAA 4QW8A 1S77D 4I0UA 2KIWA 4OD0A 2PFNA 2HN2A 5HREA 1UHUA 2HHQA 2C22A 4Y2XA 3JZ0A 3WKDA 2RLTA 2A1JB 3TFSA 1SWWA 2JGAA 2HHTA 1RM6C 8ICQA 3PSTA 2Y9TA 1X6IA 3QU7A 9ICSA 2F1HA 4WJ3B 2C2RA 3EPIA 4RQ0A 3GV5B 1C20A 1RYSA 1Q8KA 3NVZA 1BVSA 8ICPA 2MRLA 2XCPA 2B21A 4Y2SA 1K1QA 1B43A 3ISCA 7ICLA 4O69A 2HHXA 1TKDA 4NLKA 4EYIB 3RB3A 3JPOA 5CHGA 1SZPA 4C4SA 1GO3F 3GV8B 4KLUA 3BZKA 3QUCA 1SGGA 3JYYA 2XY5A 3MR2A 4LEWA 1UA1A 5J0SA 5KFMA 2ISPA 4M6WA 3IHQB 2EAMA 2EDUA 3H7IA 4M9HA 1DK3A 3UM9A 3ZDAA 8ICSA 5KT2A 1TV9A 3IV6A 4OAFA 4JV2A 2BCQA 4KN7A 4MEYA 4DL2A 1SKWA 2NO4A 1VLBA 4FBTA 4RWNA 1ZD4A 2EH9A 2AGQA 8ICTA 2AGOA 5ALYA 1TFWA 3NRZA 5KFYA 7ICKA 1X2IA 2K8BB 3KZXA 3E2EA 3JPNA 1N5XA 4KLOA 3F2CA 4JWNA 3JPSA 1COOA 4M6WB 2LKYA 1KFSA 1ZJNA 1Z1VA 1QQ6A 4DFKA 5AK5A 1F0MA 4J9OA 4DOAA 4K8VA 2FPKA 3H38A 5CRXA 5DBCA 4O67A 4O3MA 3GILA 5F3XB 3BQ0A 2YQEA 1NKCA 4M0AA 2YMMA 4UB2A 2C2EA 2VJ5A 4KLJA 1HUOA 3AQLA 1IXRA 4WBYA 4P4OA 1ZQUA 5E79U 8ICEA 4UD5A 4M9NA 4J9SA 5HNKA 3TKAA 4YD2A 4F3OA 2JEGA 1PUZA 4OCZA 4F5PA 2Y0SC 2WAQF 1NO5A 4OAIZ 5EE1A 1WWUA 3OJUA 1ZQFA 2BGWA 3BQ2A 3UXPA 4CDGA 2GWSA 4FH3A 4DQRA 1FFVA 2HCFA 3GDXA 2KJ8A 1BPBA 4FHXA 4Q43A 1IG6A 5AIBA 2DR5A 5KFAA 1PK1A 5J2EA 2BQ3A 4F2SA 2BQUA 1UCVA 4MFAA 2FLLA 1ZQRA 2E8NA 2ZJ5A 4EGWA 1JIHA 1OXJA 4ICAA 3EYZA 2F8LA 1XNSA 4KN4A 1ZQTA 2KICA 2O6KA 1T7PA 2QB0A 5ALUA
chains in the Genus database with same CATH topology
5CJ7A 4NM2A 2M9NA 4FHYA 4AT8B 4EBDA 2JEJA 4O5KA 1L3UA 3RH6A 3QZ8A 4GLXA 3HJ1A 4O3OA 5KT4A 4O9MA 9ICBA 2ZTEA 2DRAA 4RQ4A 2VA3A 4ED7A 4CCHA 1BNOA 2P6RA 2Y1IA 8ICAA 3GIJA 2W9CB 4ECUA 3HT3A 9ICGA 4EBCA 5CR0A 1CEZA 2ISOA 3AQNA 1XSPA 4RT3A 4MFCA 1XU4A 5CA7A 5J0XA 3T5HA 4KLFA 4KLIA 5J0YA 4UQGA 4GC6A 5DQGA 4Q8FA 4QZ9A 4I2IA 4X4NA 1NK4A 7ICTA 2IBKA 1UT5A 1ZQYA 1A77A 1L3SA 2PI4A 5C5JA 3OVBA 2ZUBA 4KLGA 3MR5A 7ICVA 3Q8QB 1TAUA 4UD4A 3JPTA 5KT3A 1KFTA 3OUYA 2BQRA 4IRCA 4PHEA 4TQRA 4DQIA 4F5RA 1NOMA 1ZQLA 4RUAA 1JXLA 4GC7A 4DWIA 9ICNA 2XY7A 4J9RA 3RH5A 9ICPA 2RFFA 9ICEA 2M2WA 4EBJA 2NRXA 3UQ2A 4P4PA 4PGYA 3AU6A 5J0UA 4C8LA 2MUTA 3V6KA 9ICJA 3MFHA 4Q45A 2PFQA 3EWAA 7ICRA 1V4AA 2KP7A 1FA0A 5HHIA 3M9OB 1L3VA 3OHAA 1ZJMA 5CP2A 4X4VA 2AJQA 5DB8A 8ICCA 4F91B 1EXNA 4M04A 5DB7A 4QZHA 3AQKA 4LT6A 5KT7A 4WC7A 5KFGA 1DK2A 4I2GA 8ICFA 4X4TA 4DQQA 2ZH1A 5L1KA 4F50A 1LV5A 2IMWP 4M2YA 4RU9A 4ECQA 3RB6A 4B9MA 3C5FA 3HW8A 4X4RA 1BGXT 9ICQA 3RJGA 2I1QA 4YN4A 4YR3A 4UAWA 3SYZA 4DSEA 3RRHA 4O3PA 3V7LA 3T5KA 3NGDA 4DL3A 1UA0A 4RNMA 2DR9A 4UAZA 5KFQA 4F5NA 1NK8A 3FDSA 8ICYA 1ZQMA 4Z6EA 8ICKA 4R63A 1NKEA 9ICIA 1UEVA 3MDCA 3MABA 3UPSA 8ICNA 5DBAA 3OUYB 5J2GA 4YVZA 5KFJA 5DKWA 2KZMA 2ZH6A 4ED1A 4ED6A 1D8YA 3NYBA 3MDAA 4ECRA 1RXVA 9ICKA 3C21A 1JXEA 1S10A 4PHDA 2J6TA 4B9SA 3ORYA 1RPLA 4TUPA 2HVIA 2MUTB 2DRBA 3RB0A 4JUZA 3BQTA 2ALZA 2FLPA 1UEUA 3GV7B 1U45A 5KFCA 4UB5A 1H38A 2BCSA 7ICEA 3OSPA 4DL7A 4NLGA 4KLSA 5DDYA 3JPQA 7ICPA 5KT6A 2FPLA 2FMQA 2AQ0A 2W9BB 2M2VA 2KZ3A 4MF2A 3H8JA 3MR6A 3T3FA 4O5CA 1T8EA 1ZQPA 4RNOA 3PV8A 7ICMA 3KHRA 1UETA 4XQ8A 4YP3A 4LVSA 8ICHA 4YD1A 4IQWA 5KFWA 4DSLA 1U9LA 2KTQA 5IIMA 5J2IA 3OSNA 3Q8MA 1MQ2A 2BPCA 4ZH4A 2RDIA 4KLTA 9ICVA 4ED8A 3OV7A 4PH5A 2DPIA 5DEDA 4DFPA 4UB1A 4ECYA 2R8GA 5KFPA 3PW4A 4FS2A 1U48A 5J29A 4O3NA 5BPCA 3PW7A 1S97A 2UVVA 1TK0A 3H37A 2MAXA 3HPOA 4FHWA 5KG4A 2IHMA 1SL1A 4DSFA 1JX4A 3M9NB 4O3QA 2BHNA 1KTQA 5DLFA 1XWLA 5HMMA 1LB2B 1X9MA 2ZJAA 4YXJA 1Q78A 1VJ7A 5HRGA 2JZBA 2XGPA 2XY6A 4KLDA 1A76A 5IILA 4TUSA 1L3TA 3WFSC 3PY8A 2C28A 5KFHA 5D4BA 5J0RA 4PHPA 1MQ3A 2IHNA 4E8FA 2ZHAA 5KG3A 3PW2A 8ICUA 2PFPA 4UBBA 1V9PA 4PGQA 2VA2A 2BPGA 9ICTA 8ICXA 4EP7A 2NRWA 1IM4A 4I2JA 4WC1A 4AT9A 4QZDA 2W8KA 1R8AA 5J2BA 1R8BA 4Q44A 5L9XA 1ZQGA 2O1PA 2J6SA 3RAQA 4X4PA 2Q66A 4F5OA 5KFBA 8ICZA 2ATLA 2NRKA 2V4RA 4ECZA 1SL0A 4I27A 1PX5A 4WC2A 5DB6A 4NLZA 1TK8A 4G3IA 2HHPA 5IINA 4RPYA 1WOTA 5KFUA 3ZDBA 4I2BA 3MR3A 5HRIA 4FHVA 4X4SA 3RTVA 3V72A 3PR5B 4YCXA 5DLGA 2J6UA 3PO4A 4DS5A 4O3RA 4RWOA 4QZEA 2DR8A 4WCWA 3RJEA 4K4IA 4DO9A 4K4HA 4I2CA 2C2DA 2HW3A 3Q8SB 2KN7A 1RXWA 3ZD8A 3RJIA 7ICGA 1MSWD 4EBKA 4DFJA 4WC6A 5DG7A 1ZQDA 4KLEA 4FH5A 3TAQA 4ECXA 4AT7A 3SV4A 4DS4A 1ZQSA 1DGSA 4RZRA 4YG2A 3KHGA 4X5VA 5F9NA 1S0NA 2BDPA 4XA5A 1YLQA 4NLNA 1BPZA 2NRTA 4YMOA 3C5GA 3WFRE 1PZNA 3KHLA 4QWAA 3ZDEA 5KFOA 3PO5A 3WFQE 2LYHA 5KFZA 5D49A 5KTQA 3M8SA 4IQVA 2AQ4A 1SKRA 1Q79A 4YFKA 4ECTA 1U47A 3HJ4A 1NK7A 1KDHA 5F9LA 1KLNA 1S9FA 1D8LA 2FMSA 9ICWA 1ZYQA 1ZETA 2F1IA 5DG9A 9ICFA 4F5QA 2FPMA 3SZ2A 2ID1A 5JUMA 2W9AA 8ICIA 4PHAA 3JPRA 1R89A 9ICMA 2PI5A 4QZ8A 3OHBA 7ICSA 5HP4A 1T4GA 1NJXA 1KSPA 3ISBA 1ZQBA 5DECA 3N4MB 2ASLA 4IRKA 4YMMA 5J0QA 4IRDA 8ICOA 4DSKA 3M9MB 3T5LA 4C8MA 4F4YA 4DLEA 3B0XA 4NXZA 1QSSA 1ZQEA 4I2HA 1MIYA 4AT7B 4RQ1A 4S3NA 4E80A 1S0OA 4F93B 4ATBA 2OWOA 5IIKA 3UQ0A 2PXIA 4QWDA 3PX6A 1ZQXA 1NK0A 4I28A 3EW9A 4QW9A 4YR2A 1S76D 5CB1A 4GXJA 4ECSA 1WCLA 3RR8A 4J9NA 3NTUA 4YXMA 3FYHA 4R66A 5J0OA 4M47A 3EZ5A 5KG6A 1TVAA 2IA6A 1Y88A 2PFOA 3RRGA 4J9MA 2JEFA 5KFXA 2DPJA 3BDPA 1X9WA 5HRFA 5J2HA 3BQ1A 2AU0A 1NKBA 1B22A 2KZZA 9ICUA 5DB9A 2ZH4A 2ZTDA 3PX0A 1NJZA 3WFPA 5CWRA 3V6JA 4I2AA 5J0WA 1ZQCA 7ICFA 3LWMA 1KFDA 3MFIA 1NK5A 2NRZA 1HUZA 4UAYA 2BCUA 1HJPA 1RYRA 4ED3A 3QEBZ 2BCRA 3HWTA 4MEXA 3H8WA 3N97B 1WCNA 1QSYA 4DF4A 1RZTA 2JEIA 5J2JA 8ICVA 3C2MA 4BGDA 2DR7A 3G6VA 1OU5A 3TANA 4XUSA 4KMUA 4ATBB 4KLMA 1DOQA 4QZBA 4I2FA 7ICHA 4X0AA 2DFLA 2XGQA 3SI8A 3THVA 4IR9A 4RPXA 2A1JA 5HR9A 1N48A 2NRVA 4BWJA 3LWLA 4M9JA 3UXOA 3OVAA 2ZUDA 4QZIA 4QWBA 7ICQA 4TQSA 3K75D 3H40A 1BNPA 3C18A 2DVIA 3B0YA 1UT8A 4RWQA 3PX4A 4UBCA 1BPEA 1VFGA 1ZQWA 5DQIA 5KG7A 2F1JA 3Q8RB 4P2HA 1NZPA 3RJFA 3LQCB 5HRBA 1S0VA 2W8LA 5J2CA 5L1JA 2HHSA 5KFIA 3C2LA 5KFLA 5KFTA 4DSJA 4DL4A 4R64A 1NK6A 2PBEA 4E7XA 1S0MA 4DEZA 4QZGA 4IQUA 4Q8EA 1QTMA 4ELTA 2HHWA 1ZQAA 4TUQA 4QW8A 4NM1A 2KFNA 1S77D 2V9WA 2PFNA 4DQPA 5HREA 2HHQA 2C22A 1JAJA 4I29A 2XO7A 3RR7A 2O5AA 4DQSA 1ZQQA 3RJJA 4DOCA 5HC9A 4QZCA 5EWEA 1NK9A 5KG1A 4O5EA 3JZ0A 3OVSA 2ZH3A 4WC5A 1F5AA 9ICOA 3GIMA 1XO1A 4FBUA 4E0DA 2A1JB 4J9PA 3TFSA 1NJWA 4FS1A 2HHTA 3RBDA 5J2DA 5DDMA 8ICQA 1MIWA 5J2KA 2P66A 4YQWA 1T3NA 2UVUA 4AT8A 5EOZA 2HVHA 4I2EA 4X4OA 4HYKA 4RWPA 7ICUA 9ICSA 2F1HA 5J2FA 3RB4A 1KEJA 2ZUCA 4R65A 4MF8A 2R8HA 4GXKA 3L9DA 2W9CA 3PMNA 4J9LA 4PGXA 2C2RA 1C7YA 1BPDA 4DOBA 2R8KA 5BOMA 3EPIA 4BXOA 4C8KA 1JMSA 4RQ0A 4RQ8A 2HHVA 4JV1A 3H3AA 3TQ1A 3GV5B 3HIYA 1TFRA 2ZH2A 1RYSA 3C23A 3OGUA 2JZBB 4GXIA 4PPXA 2R8IA 1BVSA 2BKEA 1BPYA 8ICPA 1NJYA 2XCPA 3H8SA 4JWMA 2B21A 2M2UA 1K1QA 4RT2A 1B43A 3TAPA 3ISCA 7ICLA 5HRDA 2HHXA 4ED0A 4KLQA 3AU2A 5KFKA 3LK9A 4WC3A 4DL6A 1TKDA 5HHHA 3PW0A 4C8OA 1KNYA 4NLKA 3GIKA 5F2VO 5HMLA 3GFKB 4EYIB 3RB3A 1ZQIA 4AT9B 2I9GA 3JPOA 9ICXA 1ZQOA 2VA8A 1D9FA 5CHGA 1SZPA 5J2AA 3GV8B 4FO6A 4KLUA 4KTQA 8ICRA 3UXNA 4K4GA 4XQ7A 4IR1A 5KT5A 2FLNA 4NY8A 5J0TA 2XCAA 3V6HA 3JYYA 3G6XA 4JV0A 4DFMA 4BXOB 4ECWA 2XY5A 4EEYA 1Z00A 5IIJA 3MGIA 4M5DA 3MR2A 7ICOA 9ICCA 4NKUA 2BCVA 1UA1A 1TK5A 1JN3A 1QSLA 5J0SA 4I2DA 4QWCA 5KFMA 4DF8A 2ISPA 4M6WA 7ICJA 3UPQA 4WC0A 4O0IA 2H5XA 3IHQB 4Z6CA 3PVXA 5DGBA 3H4BA 2XC9A 3H7IA 4ELUA 4M9HA 8ICBA 1DK3A 1ZQVA 3AUOA 3ZDAA 8ICSA 5IIIA 1SKSA 4X4QA 4BWMA 2ZH8A 5KT2A 4RPZA 1TV9A 3IM1A 1ZQKA 3PR4A 3H4DA 3C2KA 2UVRA 3PNCA 4JV2A 2BCQA 5EWFA 3PMLA 4KN7A 4ECVA 8ICJA 4MEYA 3ZD9A 5KFEA 4DL2A 1SKWA 2Y1JA 2ASDA 1XSLA 4Z6DA 4FBTA 4RWNA 4UB3A 1X9SA 3LDAA 1XC9A 2AGQA 8ICTA 4TURA 2AGOA 3ISDA 3SV3A 2W9MA 2W9BA 4F4WA 4EZ9A 1MIVA 1TFWA 1MC8A 5KFYA 5KG2A 4QZFA 4DLGA 1Z00B 7ICKA 3RJHA 2BE3A 3ZDDA 1X2IA 1QLNA 4Z6FA 4B9NA 2FLLA 3RJKA 2ZTCA 3E2EA 5KG5A 3JPNA 4RQ2A 1TAQA 3MBYA 2R8JA 4JWNA 3JPSA 5KFRA 4KLLA 1COOA 4KLOA 4M6WB 5L1IA 2AGPA 3WFOA 4IG8A 4O3SA 1KFSA 2RDJA 4BDPA 1K1SA 4B9UA 1ZJNA 1ZQZA 1D9DA 4ED2A 4DFKA 3PW5A 3Q8KA 1U4BA 3GIIA 4DL5A 4J9OA 4DOAA 4LZGA 5HRKA 5IIOA 5KFDA 4NKTA 1BPXA 4EBEA 2FPKA 5DQHA 3Q8LA 3H38A 3OJSA 4MFFA 3K4GA 5DBCA 3GILA 2FMPA 3BQ0A 1NKCA 4RUCA 4M0AA 3M8RA 2KFZA 1ZQNA 8ICLA 1AROP 3EPGA 4UB2A 4F4KA 5EWGA 2C2EA 1XS9D 4ELVA 4KLJA 1HUOA 3MGHA 3AQLA 4X0BA 1IXRA 4WBYA 4F92B 4F8RA 4P4OA 1XSNA 1ZQUA 3C1ZA 8ICEA 1R8CA 3C1YA 4M9NA 4UD5A 3QZ7A 3TFRA 7ICNA 3KHHA 3G6YA 3HX0A 4J9SA 1KRPA 5HNKA 1N56A 5KFVA 3RBEA 5DBBA 4YD2A 1CUKA 5TZVA 8ICMA 3KTQA 4F3OA 2P6UA 2JEGA 4M9GA 8ICGA 5HRHA 4YMNA 4LZDA 4DSIA 4F5PA 3RH4A 4EZ6A 1ZQJA 5DGAA 2UVWA 5HRLA 4RQ6A 3TI0A 4RQ5A 1NO5A 4RNNA 3OJUA 1ZQFA 3GQCA 8ICWA 2ZH9A 2BGWA 3C66A 4QWEA 1L5UA 9ICAA 3AQMA 5BOLA 4R8UA 3BQ2A 4B9VA 3UXPA 4FHPA 4F4XA 2GWSA 2HHUA 3HP6A 5L1LA 4FH3A 4M9LA 4DQRA 3RAXA 3GDXA 3T5JA 4JK1A 4QZAA 3H39A 3ZDCA 2ZH5A 1BPBA 4FHXA 4Q43A 4EYHB 1JQRA 3TARA 4P4MA 1ZQHA 5KG0A 2DR5A 5KFAA 4X4UA 1SL2A 3V7JA 5J2EA 4UB4A 2WTFA 4F4ZA 2BQ3A 4F2SA 2BQUA 5KFFA 3QE9Y 4B9TA 2V4QA 9ICRA 2VANA 4MFAA 4KITB 3BJYA 2Q0ZX 2ZJ5A 2ASJA 1JIHA 4IQTA 4XRHA 1ZQRA 2BPFA 2ZJ8A 9ICHA 2M2TA 5KFNA 5DG8A 5KFSA 4F2RA 4C8NA 3EYZA 3V7KA 3ETLA 2BR0A 3QEAZ 3JPPA 1TFYA 5J0PA 4KN4A 4WC4A 1Z3EB 4B9LA 1U49A 4RQ7A 2ZH7A 3Q8PB 1ZQTA 4YR0A 4J9QA 1T7PA 9ICLA 4WBZA 4KLHA 2ZHBA 4RQ3A 5D46A 4J9KA 4R8UB 7ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CJ7 A;  4NM2 A;  2M9N A;  4FHY A;  4AT8 B;  4EBD A;  2JEJ A;  4O5K A;  1L3U A;  3RH6 A;  3QZ8 A;  4GLX A;  3HJ1 A;  4O3O A;  5KT4 A;  4O9M A;  9ICB A;  2ZTE A;  2DRA A;  4RQ4 A;  2VA3 A;  4ED7 A;  4CCH A;  1BNO A;  2P6R A;  2Y1I A;  8ICA A;  3GIJ A;  2W9C B;  4ECU A;  3HT3 A;  9ICG A;  4EBC A;  5CR0 A;  1CEZ A;  2ISO A;  3AQN A;  1XSP A;  4RT3 A;  4MFC A;  1XU4 A;  5CA7 A;  5J0X A;  3T5H A;  4KLF A;  4KLI A;  5J0Y A;  4UQG A;  4GC6 A;  5DQG A;  4Q8F A;  4QZ9 A;  4I2I A;  4X4N A;  1NK4 A;  7ICT A;  2IBK A;  1UT5 A;  1ZQY A;  1A77 A;  1L3S A;  2PI4 A;  5C5J A;  3OVB A;  2ZUB A;  4KLG A;  3MR5 A;  7ICV A;  3Q8Q B;  1TAU A;  4UD4 A;  3JPT A;  5KT3 A;  1KFT A;  3OUY A;  2BQR A;  4IRC A;  4PHE A;  4TQR A;  4DQI A;  4F5R A;  1NOM A;  1ZQL A;  4RUA A;  1JXL A;  4GC7 A;  4DWI A;  9ICN A;  2XY7 A;  4J9R A;  3RH5 A;  9ICP A;  2RFF A;  9ICE A;  2M2W A;  4EBJ A;  2NRX A;  3UQ2 A;  4P4P A;  4PGY A;  3AU6 A;  5J0U A;  4C8L A;  2MUT A;  3V6K A;  9ICJ A;  3MFH A;  4Q45 A;  2PFQ A;  3EWA A;  7ICR A;  1V4A A;  2KP7 A;  1FA0 A;  5HHI A;  3M9O B;  1L3V A;  3OHA A;  1ZJM A;  5CP2 A;  4X4V A;  2AJQ A;  5DB8 A;  8ICC A;  4F91 B;  1EXN A;  4M04 A;  5DB7 A;  4QZH A;  3AQK A;  4LT6 A;  5KT7 A;  4WC7 A;  5KFG A;  1DK2 A;  4I2G A;  8ICF A;  4X4T A;  4DQQ A;  2ZH1 A;  5L1K A;  4F50 A;  1LV5 A;  2IMW P;  4M2Y A;  4RU9 A;  4ECQ A;  3RB6 A;  4B9M A;  3C5F A;  3HW8 A;  4X4R A;  1BGX T;  9ICQ A;  3RJG A;  2I1Q A;  4YN4 A;  4YR3 A;  4UAW A;  3SYZ A;  4DSE A;  3RRH A;  4O3P A;  3V7L A;  3T5K A;  3NGD A;  4DL3 A;  1UA0 A;  4RNM A;  2DR9 A;  4UAZ A;  5KFQ A;  4F5N A;  1NK8 A;  3FDS A;  8ICY A;  1ZQM A;  4Z6E A;  8ICK A;  4R63 A;  1NKE A;  9ICI A;  1UEV A;  3MDC A;  3MAB A;  3UPS A;  8ICN A;  5DBA A;  3OUY B;  5J2G A;  4YVZ A;  5KFJ A;  5DKW A;  2KZM A;  2ZH6 A;  4ED1 A;  4ED6 A;  1D8Y A;  3NYB A;  3MDA A;  4ECR A;  1RXV A;  9ICK A;  3C21 A;  1JXE A;  1S10 A;  4PHD A;  2J6T A;  4B9S A;  3ORY A;  1RPL A;  4TUP A;  2HVI A;  2MUT B;  2DRB A;  3RB0 A;  4JUZ A;  3BQT A;  2ALZ A;  2FLP A;  1UEU A;  3GV7 B;  1U45 A;  5KFC A;  4UB5 A;  1H38 A;  2BCS A;  7ICE A;  3OSP A;  4DL7 A;  4NLG A;  4KLS A;  5DDY A;  3JPQ A;  7ICP A;  5KT6 A;  2FPL A;  2FMQ A;  2AQ0 A;  2W9B B;  2M2V A;  2KZ3 A;  4MF2 A;  3H8J A;  3MR6 A;  3T3F A;  4O5C A;  1T8E A;  1ZQP A;  4RNO A;  3PV8 A;  7ICM A;  3KHR A;  1UET A;  4XQ8 A;  4YP3 A;  4LVS A;  8ICH A;  4YD1 A;  4IQW A;  5KFW A;  4DSL A;  1U9L A;  2KTQ A;  5IIM A;  5J2I A;  3OSN A;  3Q8M A;  1MQ2 A;  2BPC A;  4ZH4 A;  2RDI A;  4KLT A;  9ICV A;  4ED8 A;  3OV7 A;  4PH5 A;  2DPI A;  5DED A;  4DFP A;  4UB1 A;  4ECY A;  2R8G A;  5KFP A;  3PW4 A;  4FS2 A;  1U48 A;  5J29 A;  4O3N A;  5BPC A;  3PW7 A;  1S97 A;  2UVV A;  1TK0 A;  3H37 A;  2MAX A;  3HPO A;  4FHW A;  5KG4 A;  2IHM A;  1SL1 A;  4DSF A;  1JX4 A;  3M9N B;  4O3Q A;  2BHN A;  1KTQ A;  5DLF A;  1XWL A;  5HMM A;  1LB2 B;  1X9M A;  2ZJA A;  4YXJ A;  1Q78 A;  1VJ7 A;  5HRG A;  2JZB A;  2XGP A;  2XY6 A;  4KLD A;  1A76 A;  5IIL A;  4TUS A;  1L3T A;  3WFS C;  3PY8 A;  2C28 A;  5KFH A;  5D4B A;  5J0R A;  4PHP A;  1MQ3 A;  2IHN A;  4E8F A;  2ZHA A;  5KG3 A;  3PW2 A;  8ICU A;  2PFP A;  4UBB A;  1V9P A;  4PGQ A;  2VA2 A;  2BPG A;  9ICT A;  8ICX A;  4EP7 A;  2NRW A;  1IM4 A;  4I2J A;  4WC1 A;  4AT9 A;  4QZD A;  2W8K A;  1R8A A;  5J2B A;  1R8B A;  4Q44 A;  5L9X A;  1ZQG A;  2O1P A;  2J6S A;  3RAQ A;  4X4P A;  2Q66 A;  4F5O A;  5KFB A;  8ICZ A;  2ATL A;  2NRK A;  2V4R A;  4ECZ A;  1SL0 A;  4I27 A;  1PX5 A;  4WC2 A;  5DB6 A;  4NLZ A;  1TK8 A;  4G3I A;  2HHP A;  5IIN A;  4RPY A;  1WOT A;  5KFU A;  3ZDB A;  4I2B A;  3MR3 A;  5HRI A;  4FHV A;  4X4S A;  3RTV A;  3V72 A;  3PR5 B;  4YCX A;  5DLG A;  2J6U A;  3PO4 A;  4DS5 A;  4O3R A;  4RWO A;  4QZE A;  2DR8 A;  4WCW A;  3RJE A;  4K4I A;  4DO9 A;  4K4H A;  4I2C A;  2C2D A;  2HW3 A;  3Q8S B;  2KN7 A;  1RXW A;  3ZD8 A;  3RJI A;  7ICG A;  1MSW D;  4EBK A;  4DFJ A;  4WC6 A;  5DG7 A;  1ZQD A;  4KLE A;  4FH5 A;  3TAQ A;  4ECX A;  4AT7 A;  3SV4 A;  4DS4 A;  1ZQS A;  1DGS A;  4RZR A;  4YG2 A;  3KHG A;  4X5V A;  5F9N A;  1S0N A;  2BDP A;  4XA5 A;  1YLQ A;  4NLN A;  1BPZ A;  2NRT A;  4YMO A;  3C5G A;  3WFR E;  1PZN A;  3KHL A;  4QWA A;  3ZDE A;  5KFO A;  3PO5 A;  3WFQ E;  2LYH A;  5KFZ A;  5D49 A;  5KTQ A;  3M8S A;  4IQV A;  2AQ4 A;  1SKR A;  1Q79 A;  4YFK A;  4ECT A;  1U47 A;  3HJ4 A;  1NK7 A;  1KDH A;  5F9L A;  1KLN A;  1S9F A;  1D8L A;  2FMS A;  9ICW A;  1ZYQ A;  1ZET A;  2F1I A;  5DG9 A;  9ICF A;  4F5Q A;  2FPM A;  3SZ2 A;  2ID1 A;  5JUM A;  2W9A A;  8ICI A;  4PHA A;  3JPR A;  1R89 A;  9ICM A;  2PI5 A;  4QZ8 A;  3OHB A;  7ICS A;  5HP4 A;  1T4G A;  1NJX A;  1KSP A;  3ISB A;  1ZQB A;  5DEC A;  3N4M B;  2ASL A;  4IRK A;  4YMM A;  5J0Q A;  4IRD A;  8ICO A;  4DSK A;  3M9M B;  3T5L A;  4C8M A;  4F4Y A;  4DLE A;  3B0X A;  4NXZ A;  1QSS A;  1ZQE A;  4I2H A;  1MIY A;  4AT7 B;  4RQ1 A;  4S3N A;  4E80 A;  1S0O A;  4F93 B;  4ATB A;  2OWO A;  5IIK A;  3UQ0 A;  2PXI A;  4QWD A;  3PX6 A;  1ZQX A;  1NK0 A;  4I28 A;  3EW9 A;  4QW9 A;  4YR2 A;  1S76 D;  5CB1 A;  4GXJ A;  4ECS A;  1WCL A;  3RR8 A;  4J9N A;  3NTU A;  4YXM A;  3FYH A;  4R66 A;  5J0O A;  4M47 A;  3EZ5 A;  5KG6 A;  1TVA A;  2IA6 A;  1Y88 A;  2PFO A;  3RRG A;  4J9M A;  2JEF A;  5KFX A;  2DPJ A;  3BDP A;  1X9W A;  5HRF A;  5J2H A;  3BQ1 A;  2AU0 A;  1NKB A;  1B22 A;  2KZZ A;  9ICU A;  5DB9 A;  2ZH4 A;  2ZTD A;  3PX0 A;  1NJZ A;  3WFP A;  5CWR A;  3V6J A;  4I2A A;  5J0W A;  1ZQC A;  7ICF A;  3LWM A;  1KFD A;  3MFI A;  1NK5 A;  2NRZ A;  1HUZ A;  4UAY A;  2BCU A;  1HJP A;  1RYR A;  4ED3 A;  3QEB Z;  2BCR A;  3HWT A;  4MEX A;  3H8W A;  3N97 B;  1WCN A;  1QSY A;  4DF4 A;  1RZT A;  2JEI A;  5J2J A;  8ICV A;  3C2M A;  4BGD A;  2DR7 A;  3G6V A;  1OU5 A;  3TAN A;  4XUS A;  4KMU A;  4ATB B;  4KLM A;  1DOQ A;  4QZB A;  4I2F A;  7ICH A;  4X0A A;  2DFL A;  2XGQ A;  3SI8 A;  3THV A;  4IR9 A;  4RPX A;  2A1J A;  5HR9 A;  1N48 A;  2NRV A;  4BWJ A;  3LWL A;  4M9J A;  3UXO A;  3OVA A;  2ZUD A;  4QZI A;  4QWB A;  7ICQ A;  4TQS A;  3K75 D;  3H40 A;  1BNP A;  3C18 A;  2DVI A;  3B0Y A;  1UT8 A;  4RWQ A;  3PX4 A;  4UBC A;  1BPE A;  1VFG A;  1ZQW A;  5DQI A;  5KG7 A;  2F1J A;  3Q8R B;  4P2H A;  1NZP A;  3RJF A;  3LQC B;  5HRB A;  1S0V A;  2W8L A;  5J2C A;  5L1J A;  2HHS A;  5KFI A;  3C2L A;  5KFL A;  5KFT A;  4DSJ A;  4DL4 A;  4R64 A;  1NK6 A;  2PBE A;  4E7X A;  1S0M A;  4DEZ A;  4QZG A;  4IQU A;  4Q8E A;  1QTM A;  4ELT A;  2HHW A;  1ZQA A;  4TUQ A;  4QW8 A;  4NM1 A;  2KFN A;  1S77 D;  2V9W A;  2PFN A;  4DQP A;  5HRE A;  2HHQ A;  2C22 A;  1JAJ A;  4I29 A;  2XO7 A;  3RR7 A;  2O5A A;  4DQS A;  1ZQQ A;  3RJJ A;  4DOC A;  5HC9 A;  4QZC A;  5EWE A;  1NK9 A;  5KG1 A;  4O5E A;  3JZ0 A;  3OVS A;  2ZH3 A;  4WC5 A;  1F5A A;  9ICO A;  3GIM A;  1XO1 A;  4FBU A;  4E0D A;  2A1J B;  4J9P A;  3TFS A;  1NJW A;  4FS1 A;  2HHT A;  3RBD A;  5J2D A;  5DDM A;  8ICQ A;  1MIW A;  5J2K A;  2P66 A;  4YQW A;  1T3N A;  2UVU A;  4AT8 A;  5EOZ A;  2HVH A;  4I2E A;  4X4O A;  4HYK A;  4RWP A;  7ICU A;  9ICS A;  2F1H A;  5J2F A;  3RB4 A;  1KEJ A;  2ZUC A;  4R65 A;  4MF8 A;  2R8H A;  4GXK A;  3L9D A;  2W9C A;  3PMN A;  4J9L A;  4PGX A;  2C2R A;  1C7Y A;  1BPD A;  4DOB A;  2R8K A;  5BOM A;  3EPI A;  4BXO A;  4C8K A;  1JMS A;  4RQ0 A;  4RQ8 A;  2HHV A;  4JV1 A;  3H3A A;  3TQ1 A;  3GV5 B;  3HIY A;  1TFR A;  2ZH2 A;  1RYS A;  3C23 A;  3OGU A;  2JZB B;  4GXI A;  4PPX A;  2R8I A;  1BVS A;  2BKE A;  1BPY A;  8ICP A;  1NJY A;  2XCP A;  3H8S A;  4JWM A;  2B21 A;  2M2U A;  1K1Q A;  4RT2 A;  1B43 A;  3TAP A;  3ISC A;  7ICL A;  5HRD A;  2HHX A;  4ED0 A;  4KLQ A;  3AU2 A;  5KFK A;  3LK9 A;  4WC3 A;  4DL6 A;  1TKD A;  5HHH A;  3PW0 A;  4C8O A;  1KNY A;  4NLK A;  3GIK A;  5F2V O;  5HML A;  3GFK B;  4EYI B;  3RB3 A;  1ZQI A;  4AT9 B;  2I9G A;  3JPO A;  9ICX A;  1ZQO A;  2VA8 A;  1D9F A;  5CHG A;  1SZP A;  5J2A A;  3GV8 B;  4FO6 A;  4KLU A;  4KTQ A;  8ICR A;  3UXN A;  4K4G A;  4XQ7 A;  4IR1 A;  5KT5 A;  2FLN A;  4NY8 A;  5J0T A;  2XCA A;  3V6H A;  3JYY A;  3G6X A;  4JV0 A;  4DFM A;  4BXO B;  4ECW A;  2XY5 A;  4EEY A;  1Z00 A;  5IIJ A;  3MGI A;  4M5D A;  3MR2 A;  7ICO A;  9ICC A;  4NKU A;  2BCV A;  1UA1 A;  1TK5 A;  1JN3 A;  1QSL A;  5J0S A;  4I2D A;  4QWC A;  5KFM A;  4DF8 A;  2ISP A;  4M6W A;  7ICJ A;  3UPQ A;  4WC0 A;  4O0I A;  2H5X A;  3IHQ B;  4Z6C A;  3PVX A;  5DGB A;  3H4B A;  2XC9 A;  3H7I A;  4ELU A;  4M9H A;  8ICB A;  1DK3 A;  1ZQV A;  3AUO A;  3ZDA A;  8ICS A;  5III A;  1SKS A;  4X4Q A;  4BWM A;  2ZH8 A;  5KT2 A;  4RPZ A;  1TV9 A;  3IM1 A;  1ZQK A;  3PR4 A;  3H4D A;  3C2K A;  2UVR A;  3PNC A;  4JV2 A;  2BCQ A;  5EWF A;  3PML A;  4KN7 A;  4ECV A;  8ICJ A;  4MEY A;  3ZD9 A;  5KFE A;  4DL2 A;  1SKW A;  2Y1J A;  2ASD A;  1XSL A;  4Z6D A;  4FBT A;  4RWN A;  4UB3 A;  1X9S A;  3LDA A;  1XC9 A;  2AGQ A;  8ICT A;  4TUR A;  2AGO A;  3ISD A;  3SV3 A;  2W9M A;  2W9B A;  4F4W A;  4EZ9 A;  1MIV A;  1TFW A;  1MC8 A;  5KFY A;  5KG2 A;  4QZF A;  4DLG A;  1Z00 B;  7ICK A;  3RJH A;  2BE3 A;  3ZDD A;  1X2I A;  1QLN A;  4Z6F A;  4B9N A;  2FLL A;  3RJK A;  2ZTC A;  3E2E A;  5KG5 A;  3JPN A;  4RQ2 A;  1TAQ A;  3MBY A;  2R8J A;  4JWN A;  3JPS A;  5KFR A;  4KLL A;  1COO A;  4KLO A;  4M6W B;  5L1I A;  2AGP A;  3WFO A;  4IG8 A;  4O3S A;  1KFS A;  2RDJ A;  4BDP A;  1K1S A;  4B9U A;  1ZJN A;  1ZQZ A;  1D9D A;  4ED2 A;  4DFK A;  3PW5 A;  3Q8K A;  1U4B A;  3GII A;  4DL5 A;  4J9O A;  4DOA A;  4LZG A;  5HRK A;  5IIO A;  5KFD A;  4NKT A;  1BPX A;  4EBE A;  2FPK A;  5DQH A;  3Q8L A;  3H38 A;  3OJS A;  4MFF A;  3K4G A;  5DBC A;  3GIL A;  2FMP A;  3BQ0 A;  1NKC A;  4RUC A;  4M0A A;  3M8R A;  2KFZ A;  1ZQN A;  8ICL A;  1ARO P;  3EPG A;  4UB2 A;  4F4K A;  5EWG A;  2C2E A;  1XS9 D;  4ELV A;  4KLJ A;  1HUO A;  3MGH A;  3AQL A;  4X0B A;  1IXR A;  4WBY A;  4F92 B;  4F8R A;  4P4O A;  1XSN A;  1ZQU A;  3C1Z A;  8ICE A;  1R8C A;  3C1Y A;  4M9N A;  4UD5 A;  3QZ7 A;  3TFR A;  7ICN A;  3KHH A;  3G6Y A;  3HX0 A;  4J9S A;  1KRP A;  5HNK A;  1N56 A;  5KFV A;  3RBE A;  5DBB A;  4YD2 A;  1CUK A;  5TZV A;  8ICM A;  3KTQ A;  4F3O A;  2P6U A;  2JEG A;  4M9G A;  8ICG A;  5HRH A;  4YMN A;  4LZD A;  4DSI A;  4F5P A;  3RH4 A;  4EZ6 A;  1ZQJ A;  5DGA A;  2UVW A;  5HRL A;  4RQ6 A;  3TI0 A;  4RQ5 A;  1NO5 A;  4RNN A;  3OJU A;  1ZQF A;  3GQC A;  8ICW A;  2ZH9 A;  2BGW A;  3C66 A;  4QWE A;  1L5U A;  9ICA A;  3AQM A;  5BOL A;  4R8U A;  3BQ2 A;  4B9V A;  3UXP A;  4FHP A;  4F4X A;  2GWS A;  2HHU A;  3HP6 A;  5L1L A;  4FH3 A;  4M9L A;  4DQR A;  3RAX A;  3GDX A;  3T5J A;  4JK1 A;  4QZA A;  3H39 A;  3ZDC A;  2ZH5 A;  1BPB A;  4FHX A;  4Q43 A;  4EYH B;  1JQR A;  3TAR A;  4P4M A;  1ZQH A;  5KG0 A;  2DR5 A;  5KFA A;  4X4U A;  1SL2 A;  3V7J A;  5J2E A;  4UB4 A;  2WTF A;  4F4Z A;  2BQ3 A;  4F2S A;  2BQU A;  5KFF A;  3QE9 Y;  4B9T A;  2V4Q A;  9ICR A;  2VAN A;  4MFA A;  4KIT B;  3BJY A;  2Q0Z X;  2ZJ5 A;  2ASJ A;  1JIH A;  4IQT A;  4XRH A;  1ZQR A;  2BPF A;  2ZJ8 A;  9ICH A;  2M2T A;  5KFN A;  5DG8 A;  5KFS A;  4F2R A;  4C8N A;  3EYZ A;  3V7K A;  3ETL A;  2BR0 A;  3QEA Z;  3JPP A;  1TFY A;  5J0P A;  4KN4 A;  4WC4 A;  1Z3E B;  4B9L A;  1U49 A;  4RQ7 A;  2ZH7 A;  3Q8P B;  1ZQT A;  4YR0 A;  4J9Q A;  1T7P A;  9ICL A;  4WBZ A;  4KLH A;  2ZHB A;  4RQ3 A;  5D46 A;  4J9K A;  4R8U B;  7ICI A; 
#chains in the Genus database with same CATH topology
 3HRD D;  4AT8 B;  4EBD A;  2JEJ A;  2ZTE A;  4RQ4 A;  9ICG A;  4EBC A;  2A19 A;  2BZF A;  4RT3 A;  5J0X A;  2HOQ A;  7ICT A;  7ICV A;  4KLG A;  3L4P A;  2DUY A;  4UAS A;  3Q8Q B;  3KFU F;  3OUY A;  4TQR A;  1NOM A;  3BQ7 A;  4RUA A;  1VDV A;  4EBJ A;  2DF4 B;  3RH5 A;  2M2W A;  1RQL A;  4C8L A;  2MUT A;  3V6K A;  3SEN A;  5HHI A;  4NXV A;  3M9O B;  5DB8 A;  8ICC A;  5KT7 A;  4WC7 A;  4X4T A;  4F50 A;  4JMU A;  4ECQ A;  1BGX T;  2ZHB A;  4YN4 A;  4U7C A;  4DL3 A;  3T5K A;  2DR9 A;  3NGD A;  1NK8 A;  2K89 A;  4MHV A;  1UEV A;  3MAB A;  5DBA A;  3KZI U;  3OUY B;  5J2G A;  2KZM A;  1D8Y A;  3T79 A;  1S10 A;  4B9S A;  4TUP A;  2MUT B;  3BQT A;  3GV7 B;  3UMG A;  1U45 A;  7ICE A;  3OSP A;  4OAH A;  3JPQ A;  2W9B B;  3H8J A;  4O5C A;  1ZQP A;  3PV8 A;  1UET A;  1CI4 A;  1GPJ A;  4NL9 C;  2G06 A;  4KLT A;  9ICV A;  2BPC A;  1WG8 A;  4ECY A;  2E1E A;  5HR7 A;  5AKL A;  2A3V A;  4O3N A;  2W43 A;  3PW7 A;  1S97 A;  1RDF A;  1TK0 A;  2MAX A;  3N28 A;  3HPO A;  5KG4 A;  4O3Q A;  1ED1 A;  2FE9 A;  1LB2 B;  2ZJA A;  2XY6 A;  4NXU A;  5T14 A;  1NI3 A;  5IIL A;  4TUS A;  1Z1B A;  3PY8 A;  5KFH A;  5D4B A;  1MQ3 A;  5KL1 B;  4E8F A;  2PFP A;  2VA2 A;  2ODG A;  9ICT A;  2KIV A;  3QUB A;  5H2F U;  1IM4 A;  4I2J A;  5ALN A;  2PKE A;  1R8A A;  1ZQG A;  2OHF A;  4X4P A;  2Q66 A;  5KFB A;  4CE6 A;  2NRK A;  3F53 A;  4RQM A;  1PX5 A;  1YZ7 A;  4WC2 A;  2HHP A;  1TK8 A;  5KFU A;  5HRI A;  3V72 A;  4UB8 U;  3RJE A;  4DO9 A;  2HW3 A;  3Q8S B;  2KN7 A;  4EBK A;  5DG7 A;  2YMP A;  1FFU A;  3CRX A;  3SV4 A;  3KHG A;  1S0N A;  3WFR E;  1PZN A;  4QWA A;  5KFO A;  3WFQ E;  5KFZ A;  5D49 A;  4FZL A;  4LJX A;  1QCK A;  2OCE A;  1U47 A;  5F9L A;  2ZXH A;  1S9F A;  1SB3 C;  2PI5 A;  4QZ8 A;  1B4F A;  5HP4 A;  1T4G A;  5ALJ A;  2BDU A;  2HI0 A;  3B0X A;  4NXZ A;  3HJE A;  1ZQE A;  4I2H A;  2KOB A;  2YB1 A;  2OWO A;  2PXI A;  4QWD A;  4OJ5 A;  3PX6 A;  1ZQX A;  2W3R A;  4US8 A;  3EW9 A;  4QW9 A;  4CRX A;  4I28 A;  1S76 D;  5CB1 A;  4KX5 A;  4ECS A;  2E5S A;  4YXM A;  3FYH A;  2YY6 A;  3EZ5 A;  1QQ7 A;  2IA6 A;  2PFO A;  2B56 A;  2JEF A;  3S6J A;  3BDP A;  2H3F A;  1B22 A;  3BQ1 A;  2KZZ A;  3D2S A;  2JXJ A;  2GH1 A;  2ZTD A;  1NJZ A;  3IG8 A;  4MKP A;  1O08 A;  1HJP A;  2BCR A;  3HWT A;  4MEX A;  2AH5 A;  2JEI A;  2KKV A;  2F8K A;  5J2J A;  4BGD A;  4J03 A;  3TAN A;  1L7M A;  3SAF A;  1DOQ A;  4I2F A;  4IR9 A;  4RPX A;  1Q3U A;  1N48 A;  2B4V A;  2ZUD A;  2ZIV A;  4QWB A;  7ICQ A;  1BNP A;  1UT8 A;  4C4T A;  3PSP A;  1ZQW A;  4P2H A;  1NZP A;  5HRB A;  2W11 A;  5L1J A;  5KFI A;  4WQL A;  4DL4 A;  1S0M A;  4IQU A;  4ELT A;  3OPX A;  4TUQ A;  3M6K A;  5JU5 A;  4DQP A;  3ETR A;  4I29 A;  3RR7 A;  1N60 A;  3QUT A;  4DOC A;  4QZC A;  5EWE A;  1DRG A;  4WC5 A;  1F5A A;  3GIM A;  1XO1 A;  4FBU A;  4E0D A;  3NS1 A;  4FS1 A;  3RBD A;  4OJO A;  2P66 A;  4YQW A;  4K99 A;  5A0L A;  4I2E A;  4X4O A;  7ICU A;  4UB6 U;  3H0L B;  4R65 A;  2W9C A;  3PMN A;  4J9L A;  1VFG A;  1BPD A;  4DOB A;  4BXO A;  5BOM A;  4G3I A;  1X42 A;  2DKX A;  3D2N A;  2F77 X;  4Y2V A;  5B5E U;  1BPY A;  5ALZ A;  4O6A A;  3H8S A;  2E8M A;  4F71 A;  5HRD A;  1M6Y A;  5KFK A;  4KLQ A;  3LK9 A;  4DL6 A;  5CHE A;  3QU2 A;  4C8O A;  1HIW A;  1KNY A;  3NWI A;  3GFK B;  2VIX A;  2E8O A;  3WK9 A;  4KTQ A;  4K4G A;  2DGZ A;  4XQ7 A;  5KT5 A;  2FLN A;  2DL0 A;  3V6H A;  3G6X A;  4JV0 A;  4BXO B;  3DDH A;  7ICO A;  9ICC A;  1J97 A;  2BE3 A;  3WKE A;  4I2D A;  2H5X A;  4Z6C A;  3ICX A;  3PVX A;  2XC9 A;  4ELU A;  2HOF A;  1ZQV A;  4X4Q A;  4BWM A;  4RPZ A;  3IM1 A;  1ZQK A;  3C2K A;  2UVR A;  4WH5 A;  4ECV A;  5AIA A;  3GZF A;  1XSL A;  4Z6D A;  1X9S A;  1PVQ A;  3LDA A;  3F2B A;  2H3I A;  5J8Y C;  1MIV A;  5AKZ A;  1SV4 A;  3ZDD A;  4B9N A;  4RQ2 A;  1TAQ A;  4CGZ A;  5KFR A;  4IG8 A;  2RRD A;  5AI6 A;  2IHO A;  1U4B A;  3F5A A;  3GII A;  4DL5 A;  2B51 A;  5IIO A;  3E0F A;  2OYY A;  3OJS A;  2FMP A;  2VKQ A;  5AK3 A;  4RUC A;  8ICL A;  2KFZ A;  3EPG A;  3O0F A;  2KHQ A;  2IUB A;  4FZM A;  4NL9 A;  5ALS A;  4F92 B;  4IL6 U;  2CPR A;  3QZ7 A;  2YTU A;  1KRP A;  3UMC A;  3RBE A;  8ICM A;  4M9G A;  4YMN A;  4LZD A;  4DSI A;  3RH4 A;  4EZ6 A;  1ZQJ A;  5DGA A;  3TI0 A;  5ALT A;  2AXT U;  3C66 A;  4QWE A;  1L5U A;  3AQM A;  4R8U A;  4NXW A;  3B9J A;  2EZY A;  1PK3 A;  4M9L A;  3RAX A;  3T5J A;  4QZA A;  3H39 A;  3NUQ A;  5G5G A;  1ZQH A;  5KG0 A;  2CXY A;  4X4U A;  4F4Z A;  4UB4 A;  3QE9 Y;  2ZXI A;  4B9T A;  2V4Q A;  5AI8 A;  3SQI A;  4KIT B;  2ASJ A;  4IQT A;  4XRH A;  9ICH A;  2M2T A;  5KFN A;  4EED A;  2OM6 A;  4FZN A;  3V7K A;  1V38 A;  2BR0 A;  1SIJ A;  2EWR A;  2ZIX A;  1Z3E B;  3LVV A;  2QAR A;  3U26 A;  3Q8P B;  1JRO A;  4RQ3 A;  4J9K A;  5KL8 B;  4R8U B;  7ICI A;  3ER8 C;  3TAC B;  5ALW A;  3QZ8 A;  2DRA A;  3GU3 A;  4ED7 A;  3LYS A;  8ICA A;  3AQN A;  2ISO A;  5ALP A;  4MFC A;  2XVT A;  4Q8F A;  5DQG A;  2K4I A;  4I2I A;  1ZQY A;  5AKX A;  3OVB A;  2QAR B;  2ZUB A;  3MR5 A;  1TAU A;  3JPT A;  2BQR A;  4US9 A;  4IRC A;  4DWI A;  4P4P A;  5ALL A;  4PGY A;  3AU6 A;  2W54 A;  2B0C A;  3EWA A;  1V4A A;  1FA0 A;  1L3V A;  4X4V A;  3OHA A;  1ZJM A;  2AJQ A;  4M04 A;  2EAN A;  4QZH A;  3AQK A;  1B0X A;  5KFG A;  1DK2 A;  4I2G A;  1DXS A;  2H3Q A;  4RU9 A;  3KKA C;  4B9M A;  3C5F A;  1XSP A;  4UAW A;  4DSE A;  1XC9 A;  9ICK A;  4O3P A;  3V7L A;  4QIW C;  4RNM A;  4F5N A;  3PSF A;  2XIC A;  4Z6E A;  8ICK A;  1NKE A;  2I6X A;  5AK4 A;  8ICN A;  3UPS A;  4NXT A;  4YVZ A;  5DKW A;  2LI6 A;  2ZH6 A;  4ECR A;  1RXV A;  3C21 A;  3WK5 A;  4PHD A;  2HVI A;  1RPL A;  2HBM A;  4JUZ A;  4OJP A;  5KFC A;  1N2X A;  2K60 A;  4UB5 A;  2BCS A;  4KLS A;  5DDY A;  7ICP A;  2LMR A;  2LPE A;  5KT6 A;  2FPL A;  5AKY A;  2FMQ A;  4MF2 A;  3MR6 A;  2HOI A;  1T8E A;  2WHE A;  3BS7 A;  7ICM A;  3KHR A;  4YD1 A;  5ALE A;  5KFW A;  2ZIW A;  2JMG A;  2WF9 A;  3CW2 C;  4UW9 A;  4JLZ A;  3A0H U;  1MQ2 A;  5ALG A;  4PH5 A;  2DPI A;  3SAG A;  5KFP A;  5AI0 A;  3PW4 A;  4FS2 A;  5BPC A;  3UMB A;  2UVV A;  4K97 A;  2IHM A;  3ALR A;  4DSF A;  1JX4 A;  5DLF A;  2ZH8 A;  2BHN A;  5HMM A;  5HRG A;  2JZB A;  4KLD A;  1ZD3 A;  1L3T A;  4WQK A;  2GA9 D;  1J2N A;  5KG3 A;  3PW2 A;  5AKI A;  3H0R B;  5AM1 A;  1V9P A;  2Q4T A;  8ICX A;  5ALM A;  1JRP A;  2CN1 A;  1F44 A;  3JCF A;  4AT9 A;  5J2B A;  2ZIW B;  1R8B A;  1COK A;  1TAM A;  3RAQ A;  8ICZ A;  2H3Z A;  2V4R A;  5DB6 A;  1LVH A;  4PL1 A;  5IIN A;  4RPY A;  5B3P A;  3FAH A;  3ZDB A;  4I2B A;  4X4S A;  4EEK A;  4YCX A;  2J6U A;  1JI7 A;  4F72 A;  4QZE A;  2DR8 A;  4WCW A;  2C2D A;  3I28 A;  4Y2T A;  7ICG A;  1MSW D;  4NLB A;  2K8C B;  1JAL A;  1PK1 B;  1ZQD A;  4WC6 A;  1X9X A;  4YG2 A;  4X5V A;  5F9N A;  2BDP A;  4BX9 C;  4NLN A;  1KN5 A;  4CF3 A;  3ZDE A;  4CNQ A;  2LYH A;  1L7N A;  4IQV A;  1SKR A;  4YFK A;  1L6N A;  1SV0 C;  2G08 A;  3HJ4 A;  1KDH A;  5G5H A;  1MA7 A;  2QLT A;  1ZET A;  4P0Q A;  1ZYQ A;  4F5Q A;  2QB0 B;  2KNJ A;  8ICI A;  4JB3 A;  3FM9 A;  3NRW A;  2MSN A;  1NJX A;  1KSP A;  2QKQ A;  4IC9 A;  2G5I B;  3ISB A;  2ASL A;  4IRK A;  4YMM A;  3M9M B;  3T5L A;  4O68 A;  2F3N A;  4RQ1 A;  3QU9 A;  4E80 A;  1S0O A;  2LYA A;  4Y2P A;  3VCB A;  2N1R A;  5J8Y A;  5ALR A;  4UAR A;  4BJQ A;  4M47 A;  4Y2U A;  1Y88 A;  4PL2 A;  3RRG A;  2DPJ A;  4P0Q B;  1LKY A;  3QXG A;  5J2H A;  2AU0 A;  3R9K A;  1NKB A;  2ZH4 A;  3PX0 A;  2YML A;  3WFP A;  5CWR A;  3N7S C;  5AKK A;  2H3V A;  1ZQC A;  3LWM A;  1KFD A;  1NK5 A;  2NRZ A;  1HUZ A;  2BCU A;  3ERC C;  3IN5 A;  1RYR A;  4ED3 A;  3H8W A;  3AQE A;  1QSY A;  4DF4 A;  2JH7 A;  1OU5 A;  4XUS A;  7ICH A;  2G0A A;  3SI8 A;  3SR6 A;  3PZP A;  1NNL A;  5HR9 A;  3FC4 A;  3UXO A;  2LM1 A;  3B0Y A;  4KB6 A;  1LKY B;  2F1J A;  5TIS U;  4GIB A;  3C2L A;  5KFT A;  2PBE A;  2K4P A;  4NM1 A;  2KHV A;  3IG5 A;  2ES6 A;  1JAJ A;  2EZZ A;  2XO7 A;  2O5A A;  4DQS A;  1ZQQ A;  3AEV A;  5HC9 A;  2I5H A;  5KG1 A;  4O5E A;  3OVS A;  2ZH3 A;  4J9P A;  3N7P D;  1NJW A;  4FO1 A;  1MIW A;  5J2K A;  2PMZ F;  1T3N A;  4LEZ A;  5EOZ A;  2HBK A;  2HVH A;  2P35 A;  4RWP A;  1V85 A;  5J2F A;  1KEJ A;  2ZUC A;  4MF8 A;  2R8K A;  1ZRN A;  2JV3 A;  1JMS A;  3TQ1 A;  3HIY A;  2ZH2 A;  1RYU A;  1KBU A;  3OGU A;  3C23 A;  3CP8 A;  5AM3 A;  2R8I A;  2BKE A;  1WUD A;  1NJY A;  4JWM A;  2M2U A;  2YB4 A;  1YZ6 A;  2NV3 A;  5HHH A;  3PW0 A;  2JH1 A;  5CFS A;  3HKZ F;  5F2V O;  1QQ5 A;  1D9F A;  5J2A A;  4HX0 A;  5B3Q A;  4FO6 A;  4BUG A;  2IOF A;  3IP4 B;  3RF9 A;  4A8E A;  5J0T A;  2XCA A;  1PVR A;  2FCL A;  4DFM A;  4ECW A;  2KE7 A;  1SZH A;  4EEY A;  3BZC A;  1Z00 A;  3SEI A;  4M5D A;  1QSL A;  4QWC A;  5ALD A;  7ICJ A;  4DF8 A;  4O0I A;  3LVW A;  1CRX A;  3H4B A;  8ICB A;  2EQY A;  1SKS A;  2JHD A;  2FDR A;  1ECW A;  2KVS A;  3PR4 A;  3H4D A;  2ZHA A;  3PML A;  3ZD9 A;  5KFE A;  3WKC A;  2G07 A;  3KKA A;  2WAQ C;  3WK4 A;  4UB3 A;  4TUR A;  3ISD A;  4EZ9 A;  4Y2J A;  4F4W A;  1MC8 A;  5KG2 A;  4QZF A;  2WF5 A;  1Z00 B;  3RJH A;  2A1A A;  2R8J A;  2YMQ A;  4EV6 A;  5L1I A;  3WFO A;  2NO5 A;  4O3S A;  2RDJ A;  4BDP A;  4B9U A;  1ZQZ A;  3PW5 A;  3Q8K A;  5HRK A;  4C80 A;  5KFD A;  4NKT A;  4EBE A;  4KX3 A;  4MFF A;  2YX8 A;  2QB1 A;  1ARO P;  5EWG A;  2RP5 A;  2RHF A;  3SMV A;  3MGH A;  4X0B A;  2VJ4 A;  4F8R A;  1XSN A;  3C1Z A;  3C1Y A;  2DWQ A;  7ICN A;  4EEN A;  3G6Y A;  1N56 A;  5DBB A;  3KTQ A;  2P6U A;  8ICG A;  3QX7 A;  2DQN B;  1ZQ1 C;  4RNN A;  2ZH9 A;  3A0B U;  8ICW A;  3AL0 B;  4EEB A;  5ALK A;  4B9V A;  4FHP A;  4F4X A;  1N61 A;  3M6Z A;  3HP6 A;  5L1L A;  1S5L U;  2ZIV B;  4EYH B;  1JQR A;  2GO7 A;  4P4M A;  4K9B A;  1SL2 A;  4C7Y A;  9ICR A;  4CF4 A;  2Q0Z X;  5DG8 A;  2WF7 A;  5KFS A;  4F2R A;  5AM2 A;  3QEA Z;  1TFY A;  5JTI A;  4B9L A;  2ZH7 A;  9ICL A;  4WBZ A;  4WOY A;  5D46 A;  5ALX A;  4NM2 A;  2M9N A;  3AMZ A;  1L3U A;  3RH6 A;  3HJ1 A;  1RQN A;  5KT4 A;  2JRZ A;  3AM9 A;  2VA3 A;  2W9C B;  2ESE A;  1CEZ A;  1XU4 A;  3KD3 A;  1OW5 A;  5J0Y A;  4UQG A;  3TAD C;  4C7Z A;  4NLC A;  1ZOL A;  2KSO A;  1KL9 A;  5CFU A;  1KFT A;  4PHE A;  4DQI A;  4F5R A;  2E3T A;  4GC7 A;  4J9R A;  2RFF A;  2KEY A;  9ICP A;  3DV9 A;  9ICJ A;  2D6F C;  3MFH A;  4Q45 A;  2PFQ A;  1KW4 A;  5CP2 A;  2KJ5 A;  3NVV A;  2ZH1 A;  4DQQ A;  5L1K A;  1LV5 A;  4M2Y A;  3RB6 A;  1VJ5 A;  4X4R A;  3HW8 A;  3RJG A;  3SYZ A;  1UA0 A;  3OTQ A;  3RRH A;  3AQF A;  4UAZ A;  5KFQ A;  3F2D A;  1ZQM A;  5EE9 A;  4R63 A;  9ICI A;  1XO0 A;  5KFJ A;  4EX7 A;  4ED1 A;  2K4H A;  3NYB A;  3MDA A;  2J6T A;  1JXE A;  3ORY A;  2DRB A;  5D61 A;  3L5K A;  2ALZ A;  1Q46 A;  1UEU A;  4OAG A;  4DL7 A;  4NLG A;  4G9B A;  5AI4 A;  2K4E A;  5L1M A;  2WB1 F;  2Z7J A;  2M2V A;  2KZ3 A;  4KMO B;  3T3F A;  4RNO A;  3J81 j;  2WF8 A;  3KOO A;  4USA A;  4DSL A;  1KKX A;  2KTQ A;  3ER9 B;  2KG5 A;  3QU4 A;  5IIM A;  5J2I A;  4AP9 A;  3OV7 A;  4ZH4 A;  3C28 A;  4ED8 A;  4DFP A;  4UB1 A;  1UQV A;  5J29 A;  4FHW A;  4NV0 A;  3M9N B;  1KTQ A;  4PZN A;  4C0Z A;  1Q78 A;  3H8M A;  2XGP A;  1A76 A;  1YT3 A;  5AM0 A;  5AK6 A;  1P7D A;  3D6J A;  2FJ6 A;  5JRT A;  2LHT A;  4UBB A;  2BPG A;  4K98 A;  2B6G A;  2NRW A;  4QZD A;  2W8K A;  4Q44 A;  5L9X A;  2R18 A;  2O1P A;  4NJ8 A;  2ATL A;  4ECZ A;  1SL0 A;  4NLZ A;  1PVP A;  3QYP A;  4DS5 A;  4O3R A;  3OWG A;  4RWO A;  3SAH A;  4K4H A;  5AHX A;  3H0M B;  4DFJ A;  2W04 A;  1KQQ A;  4KLE A;  4ECX A;  2E1F A;  4DS4 A;  2XID A;  1DGS A;  4XA5 A;  1BPZ A;  2NRT A;  3PO5 A;  5KTQ A;  2AQ4 A;  2M0N A;  2ZIX B;  2KD1 A;  1KLN A;  9ICW A;  2FMS A;  2F1I A;  5DG9 A;  9ICF A;  2FPM A;  3MCR A;  2ID1 A;  2G5H B;  2W9A A;  3JPR A;  9ICM A;  2LM4 A;  4ZOH C;  1IV8 A;  5J0Q A;  4DSK A;  2XI9 A;  3ONN A;  4F4Y A;  5ALV A;  1QSS A;  1K5O A;  4LEV A;  4S3N A;  3WK7 A;  4F93 B;  4ATB A;  1Q3V A;  4P0P A;  3M7D A;  2DBY A;  5AKH A;  1L7P A;  3RR8 A;  3PSI A;  4J9N A;  3NTU A;  4R66 A;  5KG6 A;  3WK6 A;  4J9M A;  3QNM A;  5CFT A;  5J0W A;  7ICF A;  4OO1 J;  3D2Q A;  3MFI A;  3N97 B;  1V97 A;  1RZT A;  8ICV A;  3C2M A;  3G6V A;  4ATB B;  4KLM A;  4QZB A;  2DFL A;  3THV A;  4P0P B;  1ZRM A;  1L8O A;  2NRV A;  3LWL A;  4KM5 A;  4HAI A;  1NZB A;  4QZI A;  4TQS A;  4RWQ A;  4UBC A;  5DQI A;  5KG7 A;  3RJF A;  2W8L A;  5J2C A;  1NK6 A;  4E7X A;  4QZG A;  4Q8E A;  1QTM A;  3DEE A;  2KFN A;  2V9W A;  4RQN A;  5KNI A;  1QH9 A;  1D8B A;  3RJJ A;  2AHO B;  4UAV A;  1NK9 A;  5ALF A;  3CYM A;  9ICO A;  4JLX A;  2E8P A;  4DFD A;  5AM5 A;  5DDM A;  5J2D A;  1L7O A;  2UVU A;  4AT8 A;  4HYK A;  3RB4 A;  1FIQ A;  1X40 A;  2R8H A;  4GXK A;  3L9D A;  4PGX A;  1C7Y A;  4C8K A;  2HHV A;  3H3A A;  4RQ8 A;  2OEH A;  1ZXI A;  4JV1 A;  3WKA A;  1TFR A;  3I1Y A;  2JZB B;  2LYB A;  4GXI A;  4PPX A;  5ALH A;  4RT2 A;  3TAP A;  4ED0 A;  4AYB F;  3AU2 A;  4WC3 A;  2ZIU A;  2YN4 A;  5AI9 A;  2CRX A;  3GIK A;  5HML A;  5AM4 A;  1J2M A;  1WWV A;  4AT9 B;  1ZQI A;  2I9G A;  5AKG A;  9ICX A;  1X66 A;  1ZQO A;  2VA8 A;  1FEZ A;  8ICR A;  3UXN A;  3TAD A;  4IR1 A;  4NWI A;  4NY8 A;  2KV2 A;  1Z4N A;  3L3F X;  1OUQ A;  1FO4 A;  4FE3 A;  5IIJ A;  3MGI A;  2GOL A;  4NKU A;  2WFA A;  3CK6 A;  2BCV A;  1TK5 A;  1JN3 A;  4QNL A;  2NYV A;  3UPQ A;  4WC0 A;  4PJ0 U;  1IIP A;  1SXD A;  2ZIU B;  5DGB A;  3AUO A;  2WB1 C;  3NKU A;  5III A;  1DGJ A;  5KAF U;  3PNC A;  5EWF A;  8ICJ A;  2F76 X;  2Y1J A;  2D8C A;  2ASD A;  5HR6 A;  3NVW A;  3SV3 A;  2W9M A;  2W9B A;  4DLG A;  4GFJ A;  1ZD5 A;  1N5W A;  1QLN A;  1AQ6 A;  4Z6F A;  3RJK A;  2ZTC A;  5KG5 A;  4KLL A;  3MBY A;  2AGP A;  2IOH A;  3SD7 A;  1K1S A;  3PHZ A;  4Y2Q A;  3WK8 A;  1D9D A;  4ED2 A;  2DKZ A;  2MU2 A;  1UPH A;  4LZG A;  2KJ9 A;  2D3D A;  2W7O A;  1BPX A;  5DQH A;  3Q8L A;  3K4G A;  2HBJ A;  3M8R A;  1ZQN A;  4F4K A;  1N62 A;  4ELV A;  1XS9 D;  2F44 A;  4ACO A;  4OJ6 A;  1R8C A;  2EAP A;  4EX6 A;  3TFR A;  3KHH A;  3HX0 A;  2HSZ A;  5KFV A;  1CUK A;  5TZV A;  4N7R A;  2HMX A;  5HRH A;  3K1Z A;  2W03 A;  5HRL A;  4RQ6 A;  4RQ5 A;  3GQC A;  9ICA A;  5BOL A;  2F2A B;  4OJL A;  1RG6 A;  4K9A A;  2HHU A;  1TE2 A;  5K4L A;  4JK1 A;  1A0P A;  3ZDC A;  1N63 A;  2ZH5 A;  3TAR A;  2L5Y A;  3WKB A;  3V7J A;  3BS5 A;  2WTF A;  5KFF A;  1HEK A;  1L8L A;  5JTG A;  2VAN A;  2UVW A;  3BJY A;  2BPF A;  2EZX A;  3AN1 A;  2ZJ8 A;  3E58 A;  4C8N A;  3ETL A;  3NVY A;  5EE3 A;  3JPP A;  5J0P A;  3WU2 U;  4WC4 A;  1U49 A;  4C4R A;  4RQ7 A;  2W3S A;  4YR0 A;  4J9Q A;  4KLH A;  1X6J A;  4FFD A;  2FI1 A;  5CJ7 A;  4FHY A;  4O5K A;  5B66 U;  4K96 A;  4GLX A;  4O3O A;  4O9M A;  9ICB A;  3EF2 A;  4CCH A;  1BNO A;  2P6R A;  2Y1I A;  3GIJ A;  4ECU A;  3BS5 B;  3HT3 A;  5CR0 A;  1JUD A;  5CA7 A;  2KVC A;  3T5H A;  4KLF A;  4KLI A;  4GC6 A;  4Y2R A;  4QZ9 A;  5GTI U;  4X4N A;  1NK4 A;  2IBK A;  1UT5 A;  1A77 A;  3MC1 A;  5D63 A;  1L3S A;  2PI4 A;  5C5J A;  2KKP A;  4UD4 A;  5KT3 A;  1O03 A;  1ZQL A;  1JXL A;  9ICN A;  2XY7 A;  9ICE A;  2NRX A;  3UQ2 A;  2G09 A;  5J0U A;  7ICR A;  2BBH A;  2KP7 A;  5C0Y A;  3RFA A;  4F91 B;  1EXN A;  5DB7 A;  4LT6 A;  1F5S A;  8ICF A;  2IMW P;  9ICQ A;  2I1Q A;  4YR3 A;  3VC8 A;  3I76 A;  3FDS A;  8ICY A;  3NAS A;  4Y2Y A;  3MDC A;  4IS7 A;  4ED6 A;  5EE0 A;  3NVO A;  5AKE A;  3F5E A;  3RB0 A;  3K1R B;  2FLP A;  3MGV A;  3IRU A;  2EAO A;  1H38 A;  4LEY A;  3ED5 A;  2AQ0 A;  2GAF D;  2W55 A;  4XJE A;  4UAU A;  4XQ8 A;  4YP3 A;  5AKJ A;  4LVS A;  8ICH A;  4IQW A;  1U9L A;  4U6P A;  3OSN A;  3Q8M A;  1Z19 A;  2RDI A;  5DED A;  4AYB C;  1URJ A;  2R8G A;  5FP0 A;  5ALQ A;  4B6J A;  1U48 A;  3H37 A;  1SL1 A;  1XWL A;  1X9M A;  4QIW F;  4YXJ A;  2K8A A;  1VJ7 A;  3WFS C;  2C28 A;  2IHN A;  5AI5 A;  4PHP A;  5J0R A;  8ICU A;  3ZI4 A;  4PGQ A;  3QU5 A;  2HDO A;  2JR5 A;  1A6S A;  4EP7 A;  4WC1 A;  1Z4O A;  2LBO A;  2J6S A;  4F5O A;  3IDW A;  4I27 A;  1WOT A;  3MR3 A;  4FHV A;  3RTV A;  3PO4 A;  3PR5 B;  5DLG A;  2HN1 A;  3C29 A;  4K4I A;  4I2C A;  2MA1 A;  1RXW A;  1WYG A;  3ZD8 A;  2Y0S F;  3RJI A;  5CEH A;  3TAQ A;  4FH5 A;  4AT7 A;  1ZQS A;  1SV0 A;  4RZR A;  1SXE A;  1YLQ A;  4YMO A;  1SWV A;  1T94 A;  3C5G A;  3KHL A;  2OXO A;  5KAI U;  5ALO A;  3M8S A;  5GTH U;  5ALI A;  1Q79 A;  4ECT A;  1NK7 A;  1D8L A;  4UAT A;  3SZ2 A;  5JUM A;  4PHA A;  1R89 A;  3OHB A;  7ICS A;  1ZQB A;  5D62 A;  4QJF B;  3N4M B;  5DEC A;  4IRD A;  8ICO A;  4C8M A;  4DLE A;  1MIY A;  4AT7 B;  5AIC A;  3KBB A;  5IIK A;  3UQ0 A;  4EEL A;  2OH2 A;  1NK0 A;  3QUQ A;  4YR2 A;  2HBL A;  4GXJ A;  1WCL A;  3EUB 2;  3K7D A;  5J0O A;  2KSO B;  1TVA A;  1T3Q A;  3CNH A;  5KFX A;  1X9W A;  5HRF A;  1MN8 A;  3N7R C;  4PZO A;  5DB9 A;  2RQ5 A;  9ICU A;  2IOF K;  2BBJ A;  3V6J A;  4I2A A;  2PMZ C;  4UAY A;  3QEB Z;  1WCN A;  4DCC A;  3M1Y A;  2DR7 A;  2Y9U A;  4CF5 A;  2GLE A;  4KMU A;  2W7P A;  4X0A A;  2XGQ A;  2A1J A;  4BWJ A;  4M9J A;  2WF6 A;  3HIL A;  3OVA A;  2KMD A;  1S8O A;  3C18 A;  3H40 A;  3K75 D;  2DVI A;  2KK0 A;  3PX4 A;  1BPE A;  2ZG6 A;  4NXX A;  3Q8R B;  3LQC B;  1S0V A;  2HHS A;  3HKZ C;  5KFL A;  1ZD2 P;  4DSJ A;  4R64 A;  2HHW A;  4DEZ A;  1ZQA A;  4QW8 A;  1S77 D;  4I0U A;  2KIW A;  4OD0 A;  2PFN A;  2HN2 A;  5HRE A;  1UHU A;  2HHQ A;  2C22 A;  4Y2X A;  3JZ0 A;  3WKD A;  2RLT A;  2A1J B;  3TFS A;  1SWW A;  2JGA A;  2HHT A;  1RM6 C;  8ICQ A;  3PST A;  2Y9T A;  1X6I A;  3QU7 A;  9ICS A;  2F1H A;  4WJ3 B;  2C2R A;  3EPI A;  4RQ0 A;  3GV5 B;  1C20 A;  1RYS A;  1Q8K A;  3NVZ A;  1BVS A;  8ICP A;  2MRL A;  2XCP A;  2B21 A;  4Y2S A;  1K1Q A;  1B43 A;  3ISC A;  7ICL A;  4O69 A;  2HHX A;  1TKD A;  4NLK A;  4EYI B;  3RB3 A;  3JPO A;  5CHG A;  1SZP A;  4C4S A;  1GO3 F;  3GV8 B;  4KLU A;  3BZK A;  3QUC A;  1SGG A;  3JYY A;  2XY5 A;  3MR2 A;  4LEW A;  1UA1 A;  5J0S A;  5KFM A;  2ISP A;  4M6W A;  3IHQ B;  2EAM A;  2EDU A;  3H7I A;  4M9H A;  1DK3 A;  3UM9 A;  3ZDA A;  8ICS A;  5KT2 A;  1TV9 A;  3IV6 A;  4OAF A;  4JV2 A;  2BCQ A;  4KN7 A;  4MEY A;  4DL2 A;  1SKW A;  2NO4 A;  1VLB A;  4FBT A;  4RWN A;  1ZD4 A;  2EH9 A;  2AGQ A;  8ICT A;  2AGO A;  5ALY A;  1TFW A;  3NRZ A;  5KFY A;  7ICK A;  1X2I A;  2K8B B;  3KZX A;  3E2E A;  3JPN A;  1N5X A;  4KLO A;  3F2C A;  4JWN A;  3JPS A;  1COO A;  4M6W B;  2LKY A;  1KFS A;  1ZJN A;  1Z1V A;  1QQ6 A;  4DFK A;  5AK5 A;  1F0M A;  4J9O A;  4DOA A;  4K8V A;  2FPK A;  3H38 A;  5CRX A;  5DBC A;  4O67 A;  4O3M A;  3GIL A;  5F3X B;  3BQ0 A;  2YQE A;  1NKC A;  4M0A A;  2YMM A;  4UB2 A;  2C2E A;  2VJ5 A;  4KLJ A;  1HUO A;  3AQL A;  1IXR A;  4WBY A;  4P4O A;  1ZQU A;  5E79 U;  8ICE A;  4UD5 A;  4M9N A;  4J9S A;  5HNK A;  3TKA A;  4YD2 A;  4F3O A;  2JEG A;  1PUZ A;  4OCZ A;  4F5P A;  2Y0S C;  2WAQ F;  1NO5 A;  4OAI Z;  5EE1 A;  1WWU A;  3OJU A;  1ZQF A;  2BGW A;  3BQ2 A;  3UXP A;  4CDG A;  2GWS A;  4FH3 A;  4DQR A;  1FFV A;  2HCF A;  3GDX A;  2KJ8 A;  1BPB A;  4FHX A;  4Q43 A;  1IG6 A;  5AIB A;  2DR5 A;  5KFA A;  1PK1 A;  5J2E A;  2BQ3 A;  4F2S A;  2BQU A;  1UCV A;  4MFA A;  2FLL A;  1ZQR A;  2E8N A;  2ZJ5 A;  4EGW A;  1JIH A;  1OXJ A;  4ICA A;  3EYZ A;  2F8L A;  1XNS A;  4KN4 A;  1ZQT A;  2KIC A;  2O6K A;  1T7P A;  2QB0 A;  5ALU A; 
#chains in the Genus database with same CATH homology
 5CJ7 A;  4NM2 A;  2M9N A;  4FHY A;  4AT8 B;  4EBD A;  2JEJ A;  4O5K A;  1L3U A;  3RH6 A;  3QZ8 A;  4GLX A;  3HJ1 A;  4O3O A;  5KT4 A;  4O9M A;  9ICB A;  2ZTE A;  2DRA A;  4RQ4 A;  2VA3 A;  4ED7 A;  4CCH A;  1BNO A;  2P6R A;  2Y1I A;  8ICA A;  3GIJ A;  2W9C B;  4ECU A;  3HT3 A;  9ICG A;  4EBC A;  5CR0 A;  1CEZ A;  2ISO A;  3AQN A;  1XSP A;  4RT3 A;  4MFC A;  1XU4 A;  5CA7 A;  5J0X A;  3T5H A;  4KLF A;  4KLI A;  5J0Y A;  4UQG A;  4GC6 A;  5DQG A;  4Q8F A;  4QZ9 A;  4I2I A;  4X4N A;  1NK4 A;  7ICT A;  2IBK A;  1UT5 A;  1ZQY A;  1A77 A;  1L3S A;  2PI4 A;  5C5J A;  3OVB A;  2ZUB A;  4KLG A;  3MR5 A;  7ICV A;  3Q8Q B;  1TAU A;  4UD4 A;  3JPT A;  5KT3 A;  1KFT A;  3OUY A;  2BQR A;  4IRC A;  4PHE A;  4TQR A;  4DQI A;  4F5R A;  1NOM A;  1ZQL A;  4RUA A;  1JXL A;  4GC7 A;  4DWI A;  9ICN A;  2XY7 A;  4J9R A;  3RH5 A;  9ICP A;  2RFF A;  9ICE A;  2M2W A;  4EBJ A;  2NRX A;  3UQ2 A;  4P4P A;  4PGY A;  3AU6 A;  5J0U A;  4C8L A;  2MUT A;  3V6K A;  9ICJ A;  3MFH A;  4Q45 A;  2PFQ A;  3EWA A;  7ICR A;  1V4A A;  2KP7 A;  1FA0 A;  5HHI A;  3M9O B;  1L3V A;  3OHA A;  1ZJM A;  5CP2 A;  4X4V A;  2AJQ A;  5DB8 A;  8ICC A;  4F91 B;  1EXN A;  4M04 A;  5DB7 A;  4QZH A;  3AQK A;  4LT6 A;  5KT7 A;  4WC7 A;  5KFG A;  1DK2 A;  4I2G A;  8ICF A;  4X4T A;  4DQQ A;  2ZH1 A;  5L1K A;  4F50 A;  1LV5 A;  2IMW P;  4M2Y A;  4RU9 A;  4ECQ A;  3RB6 A;  4B9M A;  3C5F A;  3HW8 A;  4X4R A;  1BGX T;  9ICQ A;  3RJG A;  2I1Q A;  4YN4 A;  4YR3 A;  4UAW A;  3SYZ A;  4DSE A;  3RRH A;  4O3P A;  3V7L A;  3T5K A;  3NGD A;  4DL3 A;  1UA0 A;  4RNM A;  2DR9 A;  4UAZ A;  5KFQ A;  4F5N A;  1NK8 A;  3FDS A;  8ICY A;  1ZQM A;  4Z6E A;  8ICK A;  4R63 A;  1NKE A;  9ICI A;  1UEV A;  3MDC A;  3MAB A;  3UPS A;  8ICN A;  5DBA A;  3OUY B;  5J2G A;  4YVZ A;  5KFJ A;  5DKW A;  2KZM A;  2ZH6 A;  4ED1 A;  4ED6 A;  1D8Y A;  3NYB A;  3MDA A;  4ECR A;  1RXV A;  9ICK A;  3C21 A;  1JXE A;  1S10 A;  4PHD A;  2J6T A;  4B9S A;  3ORY A;  1RPL A;  4TUP A;  2HVI A;  2MUT B;  2DRB A;  3RB0 A;  4JUZ A;  3BQT A;  2ALZ A;  2FLP A;  1UEU A;  3GV7 B;  1U45 A;  5KFC A;  4UB5 A;  1H38 A;  2BCS A;  7ICE A;  3OSP A;  4DL7 A;  4NLG A;  4KLS A;  5DDY A;  3JPQ A;  7ICP A;  5KT6 A;  2FPL A;  2FMQ A;  2AQ0 A;  2W9B B;  2M2V A;  2KZ3 A;  4MF2 A;  3H8J A;  3MR6 A;  3T3F A;  4O5C A;  1T8E A;  1ZQP A;  4RNO A;  3PV8 A;  7ICM A;  3KHR A;  1UET A;  4XQ8 A;  4YP3 A;  4LVS A;  8ICH A;  4YD1 A;  4IQW A;  5KFW A;  4DSL A;  1U9L A;  2KTQ A;  5IIM A;  5J2I A;  3OSN A;  3Q8M A;  1MQ2 A;  2BPC A;  4ZH4 A;  2RDI A;  4KLT A;  9ICV A;  4ED8 A;  3OV7 A;  4PH5 A;  2DPI A;  5DED A;  4DFP A;  4UB1 A;  4ECY A;  2R8G A;  5KFP A;  3PW4 A;  4FS2 A;  1U48 A;  5J29 A;  4O3N A;  5BPC A;  3PW7 A;  1S97 A;  2UVV A;  1TK0 A;  3H37 A;  2MAX A;  3HPO A;  4FHW A;  5KG4 A;  2IHM A;  1SL1 A;  4DSF A;  1JX4 A;  3M9N B;  4O3Q A;  2BHN A;  1KTQ A;  5DLF A;  1XWL A;  5HMM A;  1LB2 B;  1X9M A;  2ZJA A;  4YXJ A;  1Q78 A;  1VJ7 A;  5HRG A;  2JZB A;  2XGP A;  2XY6 A;  4KLD A;  1A76 A;  5IIL A;  4TUS A;  1L3T A;  3WFS C;  3PY8 A;  2C28 A;  5KFH A;  5D4B A;  5J0R A;  4PHP A;  1MQ3 A;  2IHN A;  4E8F A;  2ZHA A;  5KG3 A;  3PW2 A;  8ICU A;  2PFP A;  4UBB A;  1V9P A;  4PGQ A;  2VA2 A;  2BPG A;  9ICT A;  8ICX A;  4EP7 A;  2NRW A;  1IM4 A;  4I2J A;  4WC1 A;  4AT9 A;  4QZD A;  2W8K A;  1R8A A;  5J2B A;  1R8B A;  4Q44 A;  5L9X A;  1ZQG A;  2O1P A;  2J6S A;  3RAQ A;  4X4P A;  2Q66 A;  4F5O A;  5KFB A;  8ICZ A;  2ATL A;  2NRK A;  2V4R A;  4ECZ A;  1SL0 A;  4I27 A;  1PX5 A;  4WC2 A;  5DB6 A;  4NLZ A;  1TK8 A;  4G3I A;  2HHP A;  5IIN A;  4RPY A;  1WOT A;  5KFU A;  3ZDB A;  4I2B A;  3MR3 A;  5HRI A;  4FHV A;  4X4S A;  3RTV A;  3V72 A;  3PR5 B;  4YCX A;  5DLG A;  2J6U A;  3PO4 A;  4DS5 A;  4O3R A;  4RWO A;  4QZE A;  2DR8 A;  4WCW A;  3RJE A;  4K4I A;  4DO9 A;  4K4H A;  4I2C A;  2C2D A;  2HW3 A;  3Q8S B;  2KN7 A;  1RXW A;  3ZD8 A;  3RJI A;  7ICG A;  1MSW D;  4EBK A;  4DFJ A;  4WC6 A;  5DG7 A;  1ZQD A;  4KLE A;  4FH5 A;  3TAQ A;  4ECX A;  4AT7 A;  3SV4 A;  4DS4 A;  1ZQS A;  1DGS A;  4RZR A;  4YG2 A;  3KHG A;  4X5V A;  5F9N A;  1S0N A;  2BDP A;  4XA5 A;  1YLQ A;  4NLN A;  1BPZ A;  2NRT A;  4YMO A;  3C5G A;  3WFR E;  1PZN A;  3KHL A;  4QWA A;  3ZDE A;  5KFO A;  3PO5 A;  3WFQ E;  2LYH A;  5KFZ A;  5D49 A;  5KTQ A;  3M8S A;  4IQV A;  2AQ4 A;  1SKR A;  1Q79 A;  4YFK A;  4ECT A;  1U47 A;  3HJ4 A;  1NK7 A;  1KDH A;  5F9L A;  1KLN A;  1S9F A;  1D8L A;  2FMS A;  9ICW A;  1ZYQ A;  1ZET A;  2F1I A;  5DG9 A;  9ICF A;  4F5Q A;  2FPM A;  3SZ2 A;  2ID1 A;  5JUM A;  2W9A A;  8ICI A;  4PHA A;  3JPR A;  1R89 A;  9ICM A;  2PI5 A;  4QZ8 A;  3OHB A;  7ICS A;  5HP4 A;  1T4G A;  1NJX A;  1KSP A;  3ISB A;  1ZQB A;  5DEC A;  3N4M B;  2ASL A;  4IRK A;  4YMM A;  5J0Q A;  4IRD A;  8ICO A;  4DSK A;  3M9M B;  3T5L A;  4C8M A;  4F4Y A;  4DLE A;  3B0X A;  4NXZ A;  1QSS A;  1ZQE A;  4I2H A;  1MIY A;  4AT7 B;  4RQ1 A;  4S3N A;  4E80 A;  1S0O A;  4F93 B;  4ATB A;  2OWO A;  5IIK A;  3UQ0 A;  2PXI A;  4QWD A;  3PX6 A;  1ZQX A;  1NK0 A;  4I28 A;  3EW9 A;  4QW9 A;  4YR2 A;  1S76 D;  5CB1 A;  4GXJ A;  4ECS A;  1WCL A;  3RR8 A;  4J9N A;  3NTU A;  4YXM A;  3FYH A;  4R66 A;  5J0O A;  4M47 A;  3EZ5 A;  5KG6 A;  1TVA A;  2IA6 A;  1Y88 A;  2PFO A;  3RRG A;  4J9M A;  2JEF A;  5KFX A;  2DPJ A;  3BDP A;  1X9W A;  5HRF A;  5J2H A;  3BQ1 A;  2AU0 A;  1NKB A;  1B22 A;  2KZZ A;  9ICU A;  5DB9 A;  2ZH4 A;  2ZTD A;  3PX0 A;  1NJZ A;  3WFP A;  5CWR A;  3V6J A;  4I2A A;  5J0W A;  1ZQC A;  7ICF A;  3LWM A;  1KFD A;  3MFI A;  1NK5 A;  2NRZ A;  1HUZ A;  4UAY A;  2BCU A;  1HJP A;  1RYR A;  4ED3 A;  3QEB Z;  2BCR A;  3HWT A;  4MEX A;  3H8W A;  3N97 B;  1WCN A;  1QSY A;  4DF4 A;  1RZT A;  2JEI A;  5J2J A;  8ICV A;  3C2M A;  4BGD A;  2DR7 A;  3G6V A;  1OU5 A;  3TAN A;  4XUS A;  4KMU A;  4ATB B;  4KLM A;  1DOQ A;  4QZB A;  4I2F A;  7ICH A;  4X0A A;  2DFL A;  2XGQ A;  3SI8 A;  3THV A;  4IR9 A;  4RPX A;  2A1J A;  5HR9 A;  1N48 A;  2NRV A;  4BWJ A;  3LWL A;  4M9J A;  3UXO A;  3OVA A;  2ZUD A;  4QZI A;  4QWB A;  7ICQ A;  4TQS A;  3K75 D;  3H40 A;  1BNP A;  3C18 A;  2DVI A;  3B0Y A;  1UT8 A;  4RWQ A;  3PX4 A;  4UBC A;  1BPE A;  1VFG A;  1ZQW A;  5DQI A;  5KG7 A;  2F1J A;  3Q8R B;  4P2H A;  1NZP A;  3RJF A;  3LQC B;  5HRB A;  1S0V A;  2W8L A;  5J2C A;  5L1J A;  2HHS A;  5KFI A;  3C2L A;  5KFL A;  5KFT A;  4DSJ A;  4DL4 A;  4R64 A;  1NK6 A;  2PBE A;  4E7X A;  1S0M A;  4DEZ A;  4QZG A;  4IQU A;  4Q8E A;  1QTM A;  4ELT A;  2HHW A;  1ZQA A;  4TUQ A;  4QW8 A;  4NM1 A;  2KFN A;  1S77 D;  2V9W A;  2PFN A;  4DQP A;  5HRE A;  2HHQ A;  2C22 A;  1JAJ A;  4I29 A;  2XO7 A;  3RR7 A;  2O5A A;  4DQS A;  1ZQQ A;  3RJJ A;  4DOC A;  5HC9 A;  4QZC A;  5EWE A;  1NK9 A;  5KG1 A;  4O5E A;  3JZ0 A;  3OVS A;  2ZH3 A;  4WC5 A;  1F5A A;  9ICO A;  3GIM A;  1XO1 A;  4FBU A;  4E0D A;  2A1J B;  4J9P A;  3TFS A;  1NJW A;  4FS1 A;  2HHT A;  3RBD A;  5J2D A;  5DDM A;  8ICQ A;  1MIW A;  5J2K A;  2P66 A;  4YQW A;  1T3N A;  2UVU A;  4AT8 A;  5EOZ A;  2HVH A;  4I2E A;  4X4O A;  4HYK A;  4RWP A;  7ICU A;  9ICS A;  2F1H A;  5J2F A;  3RB4 A;  1KEJ A;  2ZUC A;  4R65 A;  4MF8 A;  2R8H A;  4GXK A;  3L9D A;  2W9C A;  3PMN A;  4J9L A;  4PGX A;  2C2R A;  1C7Y A;  1BPD A;  4DOB A;  2R8K A;  5BOM A;  3EPI A;  4BXO A;  4C8K A;  1JMS A;  4RQ0 A;  4RQ8 A;  2HHV A;  4JV1 A;  3H3A A;  3TQ1 A;  3GV5 B;  3HIY A;  1TFR A;  2ZH2 A;  1RYS A;  3C23 A;  3OGU A;  2JZB B;  4GXI A;  4PPX A;  2R8I A;  1BVS A;  2BKE A;  1BPY A;  8ICP A;  1NJY A;  2XCP A;  3H8S A;  4JWM A;  2B21 A;  2M2U A;  1K1Q A;  4RT2 A;  1B43 A;  3TAP A;  3ISC A;  7ICL A;  5HRD A;  2HHX A;  4ED0 A;  4KLQ A;  3AU2 A;  5KFK A;  3LK9 A;  4WC3 A;  4DL6 A;  1TKD A;  5HHH A;  3PW0 A;  4C8O A;  1KNY A;  4NLK A;  3GIK A;  5F2V O;  5HML A;  3GFK B;  4EYI B;  3RB3 A;  1ZQI A;  4AT9 B;  2I9G A;  3JPO A;  9ICX A;  1ZQO A;  2VA8 A;  1D9F A;  5CHG A;  1SZP A;  5J2A A;  3GV8 B;  4FO6 A;  4KLU A;  4KTQ A;  8ICR A;  3UXN A;  4K4G A;  4XQ7 A;  4IR1 A;  5KT5 A;  2FLN A;  4NY8 A;  5J0T A;  2XCA A;  3V6H A;  3JYY A;  3G6X A;  4JV0 A;  4DFM A;  4BXO B;  4ECW A;  2XY5 A;  4EEY A;  1Z00 A;  5IIJ A;  3MGI A;  4M5D A;  3MR2 A;  7ICO A;  9ICC A;  4NKU A;  2BCV A;  1UA1 A;  1TK5 A;  1JN3 A;  1QSL A;  5J0S A;  4I2D A;  4QWC A;  5KFM A;  4DF8 A;  2ISP A;  4M6W A;  7ICJ A;  3UPQ A;  4WC0 A;  4O0I A;  2H5X A;  3IHQ B;  4Z6C A;  3PVX A;  5DGB A;  3H4B A;  2XC9 A;  3H7I A;  4ELU A;  4M9H A;  8ICB A;  1DK3 A;  1ZQV A;  3AUO A;  3ZDA A;  8ICS A;  5III A;  1SKS A;  4X4Q A;  4BWM A;  2ZH8 A;  5KT2 A;  4RPZ A;  1TV9 A;  3IM1 A;  1ZQK A;  3PR4 A;  3H4D A;  3C2K A;  2UVR A;  3PNC A;  4JV2 A;  2BCQ A;  5EWF A;  3PML A;  4KN7 A;  4ECV A;  8ICJ A;  4MEY A;  3ZD9 A;  5KFE A;  4DL2 A;  1SKW A;  2Y1J A;  2ASD A;  1XSL A;  4Z6D A;  4FBT A;  4RWN A;  4UB3 A;  1X9S A;  3LDA A;  1XC9 A;  2AGQ A;  8ICT A;  4TUR A;  2AGO A;  3ISD A;  3SV3 A;  2W9M A;  2W9B A;  4F4W A;  4EZ9 A;  1MIV A;  1TFW A;  1MC8 A;  5KFY A;  5KG2 A;  4QZF A;  4DLG A;  1Z00 B;  7ICK A;  3RJH A;  2BE3 A;  3ZDD A;  1X2I A;  1QLN A;  4Z6F A;  4B9N A;  2FLL A;  3RJK A;  2ZTC A;  3E2E A;  5KG5 A;  3JPN A;  4RQ2 A;  1TAQ A;  3MBY A;  2R8J A;  4JWN A;  3JPS A;  5KFR A;  4KLL A;  1COO A;  4KLO A;  4M6W B;  5L1I A;  2AGP A;  3WFO A;  4IG8 A;  4O3S A;  1KFS A;  2RDJ A;  4BDP A;  1K1S A;  4B9U A;  1ZJN A;  1ZQZ A;  1D9D A;  4ED2 A;  4DFK A;  3PW5 A;  3Q8K A;  1U4B A;  3GII A;  4DL5 A;  4J9O A;  4DOA A;  4LZG A;  5HRK A;  5IIO A;  5KFD A;  4NKT A;  1BPX A;  4EBE A;  2FPK A;  5DQH A;  3Q8L A;  3H38 A;  3OJS A;  4MFF A;  3K4G A;  5DBC A;  3GIL A;  2FMP A;  3BQ0 A;  1NKC A;  4RUC A;  4M0A A;  3M8R A;  2KFZ A;  1ZQN A;  8ICL A;  1ARO P;  3EPG A;  4UB2 A;  4F4K A;  5EWG A;  2C2E A;  1XS9 D;  4ELV A;  4KLJ A;  1HUO A;  3MGH A;  3AQL A;  4X0B A;  1IXR A;  4WBY A;  4F92 B;  4F8R A;  4P4O A;  1XSN A;  1ZQU A;  3C1Z A;  8ICE A;  1R8C A;  3C1Y A;  4M9N A;  4UD5 A;  3QZ7 A;  3TFR A;  7ICN A;  3KHH A;  3G6Y A;  3HX0 A;  4J9S A;  1KRP A;  5HNK A;  1N56 A;  5KFV A;  3RBE A;  5DBB A;  4YD2 A;  1CUK A;  5TZV A;  8ICM A;  3KTQ A;  4F3O A;  2P6U A;  2JEG A;  4M9G A;  8ICG A;  5HRH A;  4YMN A;  4LZD A;  4DSI A;  4F5P A;  3RH4 A;  4EZ6 A;  1ZQJ A;  5DGA A;  2UVW A;  5HRL A;  4RQ6 A;  3TI0 A;  4RQ5 A;  1NO5 A;  4RNN A;  3OJU A;  1ZQF A;  3GQC A;  8ICW A;  2ZH9 A;  2BGW A;  3C66 A;  4QWE A;  1L5U A;  9ICA A;  3AQM A;  5BOL A;  4R8U A;  3BQ2 A;  4B9V A;  3UXP A;  4FHP A;  4F4X A;  2GWS A;  2HHU A;  3HP6 A;  5L1L A;  4FH3 A;  4M9L A;  4DQR A;  3RAX A;  3GDX A;  3T5J A;  4JK1 A;  4QZA A;  3H39 A;  3ZDC A;  2ZH5 A;  1BPB A;  4FHX A;  4Q43 A;  4EYH B;  1JQR A;  3TAR A;  4P4M A;  1ZQH A;  5KG0 A;  2DR5 A;  5KFA A;  4X4U A;  1SL2 A;  3V7J A;  5J2E A;  4UB4 A;  2WTF A;  4F4Z A;  2BQ3 A;  4F2S A;  2BQU A;  5KFF A;  3QE9 Y;  4B9T A;  2V4Q A;  9ICR A;  2VAN A;  4MFA A;  4KIT B;  3BJY A;  2Q0Z X;  2ZJ5 A;  2ASJ A;  1JIH A;  4IQT A;  4XRH A;  1ZQR A;  2BPF A;  2ZJ8 A;  9ICH A;  2M2T A;  5KFN A;  5DG8 A;  5KFS A;  4F2R A;  4C8N A;  3EYZ A;  3V7K A;  3ETL A;  2BR0 A;  3QEA Z;  3JPP A;  1TFY A;  5J0P A;  4KN4 A;  4WC4 A;  1Z3E B;  4B9L A;  1U49 A;  4RQ7 A;  2ZH7 A;  3Q8P B;  1ZQT A;  4YR0 A;  4J9Q A;  1T7P A;  9ICL A;  4WBZ A;  4KLH A;  2ZHB A;  4RQ3 A;  5D46 A;  4J9K A;  4R8U B;  7ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...