2I9GA

Dna polymerase beta with a benzo[c]phenanthrene diol epoxide adducted guanine base
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
325
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of DNA polymerase beta with a benzo[c]phenanthrene diol epoxide-adducted template exhibits mutagenic features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords 5'-D(P*GP*TP*CP*GP*G)-3'
total genus 109
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2i9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2i9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2i9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2i9gA03
9ICUA 9ICIA 4R8UB 5J29A 2XCPA 4LVSA 9ICSA 2R8HA 3MGIA 3T5JA 2ZH5A 4ECRA 4DFKA 5DQHA 1QSSA 2JEJA 4DL7A 4F4KA 4F4XA 4RUCA 3UPSA 1QLNA 4UQGA 5D49A 3H4BA 3RB6A 4QZCA 3BQTA 1N56A 4B9VA 3MFHA 3T5KA 5J0YA 8ICHA 2DVIA 1KSPA 5IIMA 2H5XA 5DB9A 4PHEA 3RRGA 7ICJA 2ID1A 1XC9A 5C5JA 7ICUA 4M9NA 2NRKA 2W9AA 3PO4A 4AT9B 3Q8QB 3C21A 4ED8A 1QSLA 5IINA 8ICSA 3MR3A 3AQMA 3LK9A 3WFOA 4R65A 3QEAZ 2KN7A 4ED6A 1RYSA 5J0OA 4EBJA 4P4OA 4DQPA 4GXJA 1RPLA 1KFDA 1HJPA 4F4WA 3RH4A 5EWEA 4RT3A 1CUKA 4EBDA 3EW9A 4J9LA 2M9NA 4UAWA 4FBUA 3BDPA 8ICKA 3JYYA 3GIMA 3PX0A 5CB1A 3TFRA 9ICQA 5KT2A 4R8UA 4PHAA 5DG9A 5TZVA 5J2GA 1S0MA 2R8JA 4KLJA 3H8JA 1MIYA 1R8BA 3RTVA 5DDMA 3PVXA 5CWRA 1ZQZA 3LWLA 5D46A 5KFPA 4UB3A 4KTQA 7ICMA 1ZQPA 3H38A 4ED7A 4Q8EA 4ECXA 2NRWA 2BCVA 4FHXA 5DB8A 4FBTA 2RFFA 4ED1A 4XQ7A 4ELUA 4Q43A 4J9MA 4JWNA 1S0VA 5DGAA 3ZDCA 8ICCA 5D4BA 3N97B 3C5GA 3RAXA 5CR0A 4M9JA 8ICQA 4FH5A 3M9MB 5KFKA 3ZDDA 4JK1A 2DRBA 4O3QA 3PX4A 5KT5A 5J2EA 2XGQA 4MFFA 1Z00B 7ICLA 1NKBA 2XY5A 4DOCA 2AQ4A 1H38A 5J0QA 1MQ3A 4UB5A 1ZQOA 2PI4A 4XUSA 4QZAA 1U9LA 1JMSA 3JPTA 4DQSA 4I29A 3LWMA 5HRKA 3HT3A 8ICGA 1T8EA 3UXNA 3C5FA 4F2SA 8ICFA 2XO7A 4J9KA 2Q0ZX 4F91B 3G6XA 2BCRA 2BDPA 4Z6DA 3MFIA 1BGXT 3M9OB 1KRPA 1PX5A 2JEGA 5KFEA 1ZQAA 5DQGA 4I2BA 4NLGA 3QE9Y 2A1JA 3TI0A 2HHTA 3KHHA 2M2WA 4P4PA 4ATBB 3ISBA 1LV5A 3WFQE 4RNMA 3GFKB 2UVVA 4TURA 1T3NA 2KTQA 3H7IA 3H8SA 3OV7A 4X0BA 5F9NA 4Q45A 4XQ8A 2HHWA 5KG5A 4FO6A 3JPQA 4EYIB 4C8MA 1L5UA 1ZQYA 2FLNA 3RR8A 2ZJAA 4DL5A 1NJYA 2ZTEA 3OVAA 7ICNA 4DO9A 2P6RA 2HVHA 2AU0A 9ICBA 3GIJA 5KFVA 2FLPA 2C22A 5IIIA 5DECA 2BHNA 3EZ5A 9ICRA 1Q79A 3HP6A 4WC7A 4NLZA 4QZBA 2BCSA 3BQ1A 4YD1A 2KP7A 8ICIA 4F4ZA 8ICAA 8ICBA 2ZH1A 3V6JA 1NK8A 5KG7A 4QZFA 1HUZA 3GQCA 5J0PA 4CCHA 9ICOA 3HJ4A 2DFLA 4IQVA 3GDXA 1SKSA 1MC8A 5J0XA 3MR5A 9ICJA 3SZ2A 3RR7A 8ICOA 2RDIA 7ICFA 1MQ2A 1ZQTA 3MABA 3C2MA 4BWJA 2IHMA 2PI5A 4ECWA 4J9RA 4DSJA 4NY8A 7ICEA 3UXPA 1TK8A 3KHRA 3GV8B 5L1KA 3OVSA 2W9BA 3BQ0A 4JV0A 3RJIA 1BPZA 2ZHAA 1KFSA 2ZHBA 1S76D 4GXIA 4X0AA 1PZNA 4EZ6A 4WC4A 5DG8A 4LZDA 4AT9A 8ICMA 7ICGA 1MIVA 4JV1A 4I2DA 1IXRA 2ASDA 3JPRA 8ICNA 4JUZA 4I2JA 4UAYA 4O3SA 4DL4A 2A1JB 4RNOA 1UEUA 1B22A 2BPFA 5KFQA 5BPCA 5F9LA 4QWDA 4RQ4A 5L1LA 4DSLA 3N4MB 2J6SA 3V72A 1ZQBA 4O5EA 4YN4A 3T3FA 1ZQUA 4ECUA 1NJWA 4DLGA 4YVZA 1ZQDA 4GLXA 4DFPA 4EYHB 5DBBA 3ETLA 2W8LA 5J2KA 3HWTA 4M2YA 1JIHA 1SKRA 4DS4A 1ZQNA 4KLEA 8ICEA 5KFYA 3M9NB 1DGSA 2HHVA 4ECZA 2KFZA 4X4QA 2BQUA 1R8CA 3TAPA 4F5RA 2ZJ5A 3H40A 4UAZA 2R8IA 4M6WB 5KFUA 3TQ1A 4KLGA 8ICYA 9ICCA 1Y88A 1SL2A 3BJYA 1ZYQA 3KTQA 4PGYA 4YMMA 1NO5A 1D9DA 4QWAA 1S10A 4PPXA 4RWQA 2ZTCA 5J2CA 2JZBA 2DR9A 2R8KA 4O5KA 2DPIA 1XU4A 2NRZA 2MUTA 4BXOB 5DEDA 1TAUA 4QZGA 5KFNA 5BOMA 4F4YA 3UPQA 2C2RA 3MR6A 3TAQA 2PFQA 3H8WA 3C23A 2KZZA 3GILA 1U45A 8ICRA 1NK0A 4YMNA 3PMNA 3FYHA 5KG2A 4TQSA 4AT7B 5HHHA 4ELTA 4B9NA 1JXLA 4BGDA 5J0UA 1UA1A 1S0NA 1FA0A 2NRXA 3ORYA 2XGPA 4BWMA 9ICVA 9ICNA 1DOQA 3JPPA 4YR2A 3FDSA 1NZPA 4UD5A 1JXEA 1SKWA 4KLIA 3OUYB 1R8AA 9ICFA 4M0AA 2ZJ8A 4PH5A 2W9MA 4RQ6A 2PFOA 4F5QA 2ZH7A 4KLLA 4X4SA 2GWSA 3Q8KA 2UVUA 5KFIA 1ZQRA 1BVSA 4X4UA 3HW8A 5DBCA 4F92B 5DKWA 3PR5B 4PHDA 1ZQQA 4BXOA 4O5CA 9ICKA 3PW7A 4RU9A 3ZDBA 2ISPA 1NOMA 4F5OA 2BGWA 2PFNA 4O3PA 5J2HA 1TK5A 2KZMA 7ICQA 4FH3A 3SV4A 1S77D 3C18A 4AT8A 3RAQA 3PY8A 2RDJA 2J6TA 4YXJA 4B9UA 2HW3A 1TFWA 3C2KA 2W8KA 2NRVA 4E0DA 2XY7A 4K4HA 1WCNA 1S0OA 2FPMA 1N48A 4KN7A 3V7JA 2BCUA 4C8OA 4X5VA 4FHVA 3QEBZ 5DG7A 5DQIA 2DPJA 2IMWP 2ZH4A 4YR0A 2HHXA 4RWNA 3THVA 5DGBA 3PW4A 3AQNA 1TV9A 4P4MA 2FPLA 1ZQFA 2FMQA 8ICVA 2W9CB 1EXNA 4KLSA 3WFRE 4ECTA 1TFYA 1BPBA 4KMUA 1TK0A 4TUQA 3H4DA 1ZJNA 4KITB 4QZDA 4QZ9A 4WC5A 4YXMA 4YD2A 3OHBA 5IILA 3MGHA 3V6HA 1UETA 2V9WA 4O3NA 2MUTB 1ZETA 4E8FA 4EBCA 5KFJA 2VA8A 4I28A 2BR0A 4ED2A 4WC0A 2F1IA 4RQ1A 3MR2A 4ECSA 2KZ3A 4DF4A 4I27A 4O9MA 1ZQLA 2F1HA 1D9FA 1XO1A 3ZD9A 2FMPA 2FMSA 2VA3A 3EPIA 2PFPA 5HRLA 4B9LA 1ZQXA 3HX0A 5KFHA 3ISDA 5IIJA 1S9FA 4MFCA 2HVIA 9ICXA 5KFOA 5HRDA 1V4AA 3IM1A 2ZH8A 3GV7B 1L3UA 1U49A 4EZ9A 4IRKA 4I2FA 3LDAA 4QZHA 4HYKA 4DSEA 1D8YA 4R64A 1D8LA 1XS9D 4ED3A 3TARA 1UEVA 1ZQEA 2ZUCA 4WC1A 3HJ1A 1YLQA 4IRCA 2AJQA 4FHYA 1X9WA 3EWAA 4R63A 3JPOA 4YP3A 2WTFA 3MDAA 4J9NA 3AUOA 2C2EA 1UA0A 3PV8A 4TUPA 1ZQJA 3JPNA 1KFTA 2C2DA 2UVWA 3UQ0A 5HRBA 4RWOA 4J9QA 2DR7A 1XSNA 4C8NA 2DRAA 2IBKA 4F8RA 1Z00A 3LQCB 4K4GA 2LYHA 4R66A 1NJZA 8ICZA 5HR9A 1ZQHA 1X9MA 4PGQA 4DWIA 2JEIA 3RB0A 5HMMA 1U48A 2M2UA 4FS2A 3NTUA 4IQUA 5KFAA 1U4BA 5DB7A 4RNNA 4TUSA 1V9PA 2VANA 2M2VA 1R89A 4DFJA 4WBYA 4ATBA 2R8GA 3T5LA 4EEYA 2AGPA 4X4PA 2BPCA 1UT8A 3NGDA 8ICWA 4DSFA 5EOZA 4IRDA 4UBCA 5J0RA 4B9MA 5KFMA 2W9BB 1BNOA 9ICEA 3T5HA 1ZQWA 5KFBA 2W9CA 1JQRA 2FLLA 3KHGA 3UQ2A 5HNKA 1COOA 5KT3A 5JUMA 1T4GA 5EWFA 3SI8A 1SL1A 1ZQKA 5L9XA 5IIOA 1ZQMA 4KLOA 4J9SA 2HHUA 4DQIA 5DB6A 4QWEA 5KFDA 2ZUBA 1L3SA 4LZGA 1Z3EB 4I2HA 2HHSA 9ICGA 3UXOA 4NXZA 3KHLA 4RPXA 3EPGA 3TFSA 4KLQA 4M5DA 1CEZA 4UD4A 5DLFA 4M9GA 5J2IA 9ICLA 3AQKA 4B9TA 5CA7A 4DLEA 4IQWA 5J2BA 3PNCA 1RZTA 4KLFA 3AU2A 1K1SA 4RQ5A 3SYZA 4DOAA 3RH6A 4O3RA 5KFRA 4O0IA 2ZH6A 2ISOA 5KG0A 2P6UA 5BOLA 3OSPA 4M6WA 2O5AA 4ZH4A 4RPYA 1NK5A 3G6YA 2JEFA 4X4OA 3HPOA 4Z6CA 3PO5A 7ICHA 5KG1A 1XWLA 5J0TA 1ZQVA 4RT2A 4X4VA 3Q8SB 1SZPA 2NRTA 4RQ7A 4RQ0A 3OSNA 4KN4A 4F93B 5KFLA 4ECVA 1BPYA 1C7YA 2AGOA 4KLUA 7ICKA 7ICVA 3C1ZA 5KFXA 4ED0A 1ZQSA 7ICOA 4QWBA 3M8SA 4M9HA 5IIKA 4KLHA 5HRHA 3H37A 2FPKA 4YR3A 3PX6A 7ICTA 4FHWA 2DR5A 4QZIA 4DF8A 3RJHA 3RJFA 7ICPA 4IR9A 4Q44A 1HUOA 4TQRA 4RPZA 4WC2A 4NM2A 4J9OA 4RQ3A 1TFRA 3V7LA 4I2IA 7ICRA 1X9SA 2Y1JA 9ICMA 3WFSC 2C28A 9ICAA 1KTQA 5HHIA 5DLGA 3B0YA 4J9PA 2DR8A 3ZDEA 1ZQCA 3L9DA 2ZTDA 8ICUA 1A76A 4I2GA 2PBEA 4DOBA 4YCXA 3RJGA 3RBDA 4RQ8A 5KT4A 3GIIA 4NKUA 4PGXA 5KFTA 3WFPA 4DL6A 3PW5A 1U47A 3OGUA 4DL2A 4QW8A 3RB4A 8ICPA 4F2RA 8ICTA 4NLKA 4IG8A 1K1QA 2KFNA 1TKDA 4LT6A 3M8RA 1WOTA 5J0WA 4S3NA 3RJEA 1LB2B 5KFCA 9ICHA 4MEYA 3QZ8A 7ICIA 3PR4A 1QTMA 1KDHA 1UT5A 4DQQA 1MIWA 1VFGA 2Q66A 2BQRA 1BNPA 2AGQA 5KFZA 2XC9A 3MBYA 1A77A 4QZ8A 3GIKA 4DFMA 1SL0A 5HP4A 4FS1A 4DQRA 5J2DA 1NK9A 2J6UA 4ELVA 1XSPA 5DDYA 5KT6A 1ZQIA 4I2EA 4IQTA 3JPSA 2ZH3A 3RH5A 3C2LA 1NKCA 2V4QA 4I2AA 4C8LA 1KNYA 3H39A 4F3OA 4EP7A 5HMLA 2XCAA 4UB1A 4DS5A 3AU6A 4M47A 8ICLA 5L1JA 1TVAA 4Q8FA 4RZRA 3G6VA 5KFFA 3B0XA 3ISCA 4BDPA 5L1IA 1ZQGA 3OUYA 3PMLA 4GXKA 1ZJMA 3Q8LA 5HC9A 4UBBA 2F1JA 5KG3A 2ZUDA 3IHQB 2OWOA 4I2CA 9ICTA 5KG6A 1KEJA 4WBZA 3OVBA 1L3VA 3ZDAA 5CP2A 1WCLA 1JN3A 4GC6A 2ASJA 1L3TA 4B9SA 5J2AA 4MEXA 5HRFA 8ICJA 3RBEA 4X4NA 4MF8A 2XY6A 3TANA 5HRGA 2BCQA 5KTQA 2AQ0A 9ICPA 3Q8MA 3OJSA 2M2TA 4YQWA 5KG4A 4RWPA 1JX4A 1VJ7A 4UB2A 4X4RA 1MSWD 5KFSA 4WC3A 4G3IA 1BPXA 3MDCA 1NJXA 4RUAA 1B43A 5J2FA 2JZBB 3RB3A 8ICXA 3NYBA 2I1QA 1RYRA 2Y1IA 2VA2A 1T7PA 4ECYA 4NLNA 1DK3A 4DSIA 4MF2A 4QZEA 4RQ2A 4NM1A 3OHAA 2V4RA 4YFKA 2ATLA 1RXWA 1NK6A 1XSLA 4PHPA 3K4GA 4K4IA 4M9LA 3Q8RB 2BQ3A 5EWGA 1Q78A 2O1PA 4WC6A 1BPDA 2UVRA 5F2VO 4AT8B 1NK7A 5CJ7A 3RJKA 2BKEA 3GV5B 3RRHA 4JV2A 3V7KA 3RJJA 2BPGA 3V6KA 2BE3A 4F5PA 1S97A 4DEZA 2ALZA 1QSYA 2I9GA 5KFWA 3AQLA 4Z6EA 4WCWA 4XA5A 2B21A 3OJUA 4YMOA 3ZD8A 3PW2A 5KT7A 4QW9A 4JWMA 2HHQA 4NKTA 4X4TA 5HREA 4M04A 1DK2A 3HIYA 1BPEA 4AT7A 2P66A 1NK4A 1TAQA 3E2EA 3K75D 1F5AA 4GC7A 4E80A 2HHPA 4FHPA 5KFGA 3EYZA 4YG2A 5J2JA 1OU5A 4O3OA 4QWCA 9ICWA 3H3AA 1NKEA 3BQ2A 3C1YA 3Q8PB 1RXVA 4E7XA 1KLNA 4UB4A 3SV3A 4DSKA 4MFAA 2ASLA 3JZ0A 1JAJA 5HRIA 5J0SA 5DBAA 4DL3A 3C66A 4KLTA 4F5NA 4KLMA 3QZ7A 2MAXA 4ECQA 2IA6A 7ICSA 5CHGA 2PXIA 4EBEA 2IHNA 4EBKA 4IR1A 4Z6FA 4KLDA 1IM4A 4C8KA 1X2IA 1AROP 4P2HA 3PW0A 2ZH9A 4XRHA 2ZH2A 4F50A
chains in the Genus database with same CATH superfamily
9ICIA 2GOLA 4R8UB 5J29A 2XCPA 9ICSA 2ZH5A 5DQHA 2JEJA 4DL7A 4F4KA 2LYBA 3L4PA 5D49A 1QH9A 3RRGA 3HKZC 1XC9A 2NRKA 4ED8A 3AQEA 4WQKA 5AICA 3AQMA 3WFOA 5AI8A 2KN7A 4J03A 1RYSA 4EBJA 1RPLA 1KFDA 3RH4A 4F4WA 2HBMA 4EX7A 3AM9A 3LVVA 4RT3A 4EBDA 3JYYA 4UAWA 3BDPA 8ICKA 3CW2C 1S0MA 1MIYA 1R8BA 4QNLA 5DDMA 2EANA 4UB3A 7ICMA 3O0FA 4KMOB 1NZBA 1ECWA 4XQ7A 4Q43A 2YB1A 4JWNA 1S0VA 5D4BA 3K1ZA 2BDUA 1F0MA 4FH5A 2DRBA 5KT5A 4MFFA 7ICLA 4DOCA 1KL9A 5JTIA 3LWMA 4J9KA 1CI4A 3G6XA 4PL1A 5FP0A 4Z6DA 5DQGA 4I2BA 2A1JA 3HKZF 4B6JA 2G5IB 3UM9A 4ATBB 3WFQE 4P4PA 4KX3A 3GFKB 5AKEA 3NVOA 4TURA 1T3NA 5HR6A 5F9NA 5KG5A 2H3FA 4FO6A 3AN1A 4DL5A 1YT3A 1NJYA 4AYBC 4DO9A 5AM0A 2HVHA 2AU0A 9ICBA 3N7PD 1SB3C 2JRZA 3DV9A 9ICRA 1Q79A 4WC7A 3BQ1A 2M0NA 1X6IA 4F4ZA 8ICBA 3HJ4A 3GQCA 4OAGA 3ONNA 3QX7A 4IQVA 2RQ5A 5B66U 3GDXA 3MR5A 1ZQTA 4BWJA 4ECWA 4J9RA 4US8A 1TK8A 5L1KA 1OW5A 3OVSA 4Y2UA 4Y2SA 3BQ0A 2ZHAA 1B4FA 1KFSA 3H0LB 4WC4A 4LZDA 4Y2VA 3J81j 4NXUA 4JV1A 2ASDA 1IXRA 4JUZA 4UAYA 1COKA 4O3SA 1Z4NA 4UASA 2OXOA 5L1LA 3N4MB 1ZQBA 4YN4A 4ECUA 4EYHB 1S5LU 3HWTA 4M2YA 1JIHA 1ZQNA 4X4QA 3M9NB 4KLGA 8ICYA 2R8IA 4UAZA 3TQ1A 5KFUA 9ICCA 2XICA 2K8AA 4PGYA 3KFUF 3OWGA 4PPXA 2JZBA 2R8KA 2NRZA 2MUTA 4HX0A 2WAQF 1TAUA 2LM1A 3TAQA 3MR6A 3H8WA 3L5KA 3RFAA 3GILA 8ICRA 1NK0A 2OCEA 4ELTA 4B9NA 4BGDA 1UA1A 3ORYA 3JPPA 4YR2A 3FDSA 4UD5A 4KLIA 2E3TA 1DRGA 3WKCA 1R8AA 2YB4A 3VCBA 2ZJ8A 2EH9A 5ALKA 2JR5A 3HW8A 5DBCA 2YTUA 4PHDA 1FIQA 5KNIA 3D6JA 5AI0A 4O3PA 1TK5A 2KZMA 4P0PA 4FH3A 3RAQA 3PY8A 4B9UA 4O67A 4F72A 3C2KA 4DFDA 2NRVA 2RLTA 1S0OA 4JB3A 2ZIXB 4FHVA 5DG7A 2ZH4A 2HHXA 3M6KA 3HILA 1TE2A 3UMBA 4EX6A 3OPXA 1Q3UA 2FMQA 2LBOA 1BPBA 1TK0A 3H4DA 1O03A 4YXMA 4O3NA 1FO4A 3SENA 4EBCA 4UARA 3PSTA 4WC0A 2L5YA 3MR2A 3R9KA 1ZQLA 1XO1A 2ZXHA 2FMSA 5HRLA 5ALRA 2HVIA 5KFHA 3ISDA 4MFCA 5HRDA 9ICXA 2ZH8A 4EZ9A 4IRKA 3LDAA 4K9BA 4DSEA 1D8YA 4R64A 4C7ZA 2HBJA 3HJ1A 2VJ5A 1X9WA 4EELA 4R63A 1B0XA 2WTFA 2C2EA 7ICPA 1IG6A 1UA0A 1KFTA 4TUPA 5KL1B 3JPNA 2K8BB 3UQ0A 2B0CA 2Y0SC 4F8RA 2HI0A 3LQCB 4R66A 8ICZA 3FM9A 2JEIA 3RB0A 5HMMA 4O3MA 2M2VA 5KFAA 1U4BA 2YMLA 4RNNA 2G0AA 4X4PA 4EEYA 2BPCA 4K9AA 1UT8A 8ICWA 5EOZA 4B9MA 4CF5A 2W9BB 1BNOA 1ZQWA 5KAIU 3UQ2A 4OAIZ 4NLCA 2RP5A 5JUMA 5IIOA 1SIJA 2W43A 4J9SA 2HHUA 5C0YA 1JROA 1X42A 5KFDA 4QWEA 4LZGA 9ICGA 4EEDA 1CEZA 4ICAA 9ICLA 4Y2TA 4B9TA 1N60A 3QXGA 2LYAA 2K89A 2QB0B 3AU2A 2GH1A 1K1SA 5CEHA 4DOAA 2E1EA 1SV0C 5BOLA 4RPYA 4KM5A 4OAFA 5KG1A 1ZQVA 3Q8SB 4ECVA 3OSNA 4EGWA 4F93B 2AGOA 4FZLA 7ICKA 7ICVA 3C1ZA 4QWBA 3M8SA 1DGJA 4QIWF 3RJHA 3RJFA 4TQRA 4WC2A 4NM2A 4J9OA 4I2IA 2C28A 3FAHA 1ZQCA 3L9DA 1RG6A 2W7OA 2PBEA 2WF8A 5AIAA 5KFTA 1U47A 2WFAA 4DL2A 2G07A 8ICPA 5KL8B 1K1QA 5KFCA 1UCVA 9ICHA 3K1RB 1KDHA 2BQRA 3AQFA 4OJLA 3WKEA 2J6UA 4DQRA 1NK9A 2OHFA 5DDYA 1J2MA 1FFVA 4I2EA 2ZH3A 3JCFA 3SEIA 3BS5B 5ALDA 2QKQA 1KNYA 3M7DA 5HMLA 1V85A 3AU6A 3B0XA 4LEZA 1ZQGA 3OUYA 2JV3A 4UBBA 2EZZA 5AKJA 3ZDAA 1L3TA 4B9SA 3RBEA 5KTQA 3OTQA 2B51A 1QQ7A 3OJSA 3NUQA 2M2TA 4YQWA 3MDCA 1B43A 3RB3A 4LJXA 2I1QA 2ODGA 4EENA 4DSIA 3MCRA 4QJFB 1GO3F 4NM1A 3OHAA 3N28A 4YFKA 2V4RA 2F8LA 4PHPA 3K4GA 5AHXA 2BQ3A 2O1PA 4IC9A 3QUBA 2CN1A 3F2BA 3BS7A 3RJKA 2BKEA 3IV6A 2E1FA 3RRHA 2BPGA 1RYUA 3QU2A 4EEKA 1S97A 2ALZA 2I9GA 5KFWA 2LPEA 4XA5A 1N63A 4QW9A 2JHDA 5CFUA 4M04A 1DK2A 3HIYA 4AT7A 1TAQA 2KICA 5D63A 3N7SC 1VDVA 4AYBF 4FHPA 2P35A 5J2JA 2A3VA 1OU5A 1X6JA 2DGZA 4QWCA 3H3AA 4E7XA 1SWVA 1SXEA 3SV3A 4ACOA 2ASLA 3JZ0A 1JAJA 4DL3A 2EAMA 4KLMA 2MAXA 5CHGA 4PJ0U 4Z6FA 4KLDA 3QU5A 1X2IA 2ZH9A 2ZH2A 4PZNA 5AIBA 2FJ6A 4DFKA 1QLNA 5ALXA 4QZCA 3BQTA 4JMUA 8ICHA 2H5XA 5DB9A 4PHEA 4WOYA 5C5JA 3PO4A 3Q8QB 2XVTA 1RDFA 4C4RA 4R65A 3BS5A 4DQPA 4OO1J 1HJPA 2IOFA 5EWEA 3PHZA 4J9LA 2G06A 1N61A 5CB1A 2G5HB 1RM6C 1SV4A 2LMRA 5DG9A 3IN5A 3RTVA 4UATA 5AKHA 3PVXA 3LWLA 4KTQA 5D46A 1L8OA 4ED7A 2BCVA 5DB8A 2PMZC 1ZD4A 2RFFA 1WG8A 1ZQ1C 4J9MA 5ALQA 5DGAA 3ZDCA 8ICCA 3N97B 3RAXA 4M9JA 4JK1A 4O3QA 2PI4A 1ZQOA 4XUSA 1JMSA 1J97A 3EF2A 1HIWA 2EAPA 1T8EA 3UXNA 3C5FA 2XO7A 2ESEA 1C20A 2BDPA 3MFIA 1BGXT 4RQMA 2VIXA 5AI5A 4K97A 2DKZA 3PSFA 3KHHA 4RNMA 2EAOA 2HBLA 2UVVA 2KTQA 5AK6A 3OV7A 4Q45A 2W3RA 3JPQA 4C8MA 5G5GA 4NV0A 1L5UA 2ZJAA 3HRDD 5AM1A 1YZ7A 5DECA 4QZBA 8ICIA 8ICAA 2ZH1A 3V6JA 5KG7A 3NKUA 1Q46A 2KMDA 1MC8A 9ICJA 3WK4A 3SZ2A 3RR7A 4IL6U 2RDIA 1MQ2A 3MABA 3C2MA 3F5AA 2PI5A 4NY8A 3PSPA 3UXPA 2DQNB 4JV0A 2YX8A 1PVQA 2ZHBA 1S76D 1PZNA 4EZ6A 4AT9A 4I2JA 4Y2QA 1KBUA 1JALA 2K4PA 2A1JB 4RNOA 3IRUA 2WHEA 1UEUA 2WB1C 5KFQA 1Q3VA 5F9LA 4QWDA 4MKPA 3V72A 3ETLA 8ICEA 5J2KA 5B5EU 2QARA 2HHVA 2KFZA 2ID1A 4M6WB 1Y88A 4N7RA 1SL2A 4YMMA 2AXTU 3GU3A 1D9DA 4K8VA 5J2CA 2DPIA 1XU4A 5B3QA 5DEDA 2W3SA 3M1YA 4QZGA 2W04A 3FYHA 3SAHA 5ALMA 4AT7B 1JXLA 2NRXA 1K5OA 4BWMA 4UW9A 2GO7A 2KSOB 2QB1A 3QU7A 9ICFA 4M0AA 4PH5A 2W9MA 2PFOA 5B3PA 5ALLA 1ZXIA 1ZQRA 4GFJA 5G5HA 4FZMA 5DKWA 2I6XA 1ZQQA 4OD0A 3QYPA 2BGWA 2PFNA 5J2HA 2MRLA 3SV4A 2RDJA 5AK3A 2J6TA 2HOIA 3VC8A 2H3ZA 2XY7A 4K4HA 3I1YA 3LVWA 4KN7A 2YMQA 3V7JA 4C8OA 3QEBZ 1TAMA 2DPJA 4LEVA 4YR0A 5DGBA 2ZIUA 1FFUA 1EXNA 2WF5A 5ALIA 4KMUA 4KITB 1WYGA 3ICXA 4YD2A 5AKGA 3OHBA 2MUTB 4E8FA 5KFJA 2K4HA 2VA8A 4I28A 2F1IA 1JRPA 1ZOLA 4O9MA 2F8KA 2EWRA 3NRWA 5AM2A 4B9LA 2KNJA 4LEYA 1L3UA 1LKYB 1U49A 4Y2XA 4WC1A 4IRCA 3JPOA 3MDAA 1V38A 5CFSA 2DR7A 1XSNA 2IBKA 1Z00A 2KG5A 2A19A 3IDWA 2E8MA 3WKDA 3IP4B 3F5EA 4PGQA 4K96A 1KW4A 3NTUA 1SXDA 5DB7A 1V9PA 4ATBA 2R8GA 4DSFA 3F53A 5J0RA 4Y2PA 4UBCA 4ZOHC 1D8BA 3WK9A 5EWFA 1T4GA 5L9XA 1ZQMA 2KJ5A 3NVVA 5DB6A 2ZUBA 4NXZA 4KLQA 3TFSA 2KVCA 1S8OA 4UD4A 2YMMA 5DLFA 4M9GA 5CA7A 4IQWA 2EQYA 2F2AB 3SYZA 1JUDA 5KFRA 2ZH6A 3WK8A 5KG0A 5L1MA 4LEWA 4M6WA 2O5AA 4ZH4A 2JEFA 4CDGA 4X4OA 4Z6CA 7ICHA 4RT2A 5J0TA 1WWVA 1SZPA 2NRTA 4RQ7A 4O69A 5KAFU 5KFLA 5GTIU 1ZQSA 7ICOA 3D2SA 5HRHA 4YR3A 4DF8A 4IR9A 4C4SA 2HOQA 1TFRA 1X9SA 2Y1JA 3T79A 3B0YA 2DR8A 2KEYA 2ZTDA 4I2GA 4DOBA 3RJGA 5KT4A 3GIIA 2E5SA 3DDHA 2IHOA 4FZNA 4QW8A 3RB4A 4F2RA 8ICTA 2KFNA 1MN8A 2RRDA 4S3NA 5AI9A 3RJEA 3QZ8A 3PR4A 5ALEA 1UT5A 1MIWA 1VFGA 3TADA 1BNPA 2KHQA 1A77A 1N2XA 5HP4A 4ELVA 4HAIA 3K7DA 2FCLA 4IQTA 3QNMA 4NXWA 2NV3A 1PVRA 4NL9A 4F3OA 3H39A 4UB1A 2YMPA 8ICLA 3G6VA 5KFFA 5A0LA 3PMLA 4OJ6A 5HC9A 3PSIA 5KG3A 3EUB2 3IHQB 2F44A 2GLEA 3OVBA 1L3VA 5JRTA 4GC6A 1WCLA 4WCWA 5J2AA 4MEXA 1QQ5A 4X4NA 3M6ZA 4MF8A 2XY6A 2BCQA 2AQ0A 3Q8MA 2XIDA 4RWPA 4X4RA 4WC3A 1BPXA 2B6GA 4P0PB 5AK5A 3NYBA 4ECYA 5ALFA 1IIPA 4RQ2A 4KX5A 2KE7A 1JI7A 2AHOB 1WWUA 4WC6A 5F2VO 1ZRMA 4JV2A 3RJJA 2KHVA 1SZHA 4UB8U 4NL9C 4F5PA 2E8NA 2DL0A 2MA1A 4DEZA 1QSYA 3AQLA 4YMOA 2HHQA 4Y2RA 1NK4A 3E2EA 4GC7A 1A6SA 4E80A 1OUQA 4YG2A 4O3OA 1NKEA 3BQ2A 3Q8PB 3SD7A 4MFAA 5AKLA 5DBAA 4KLTA 1NNLA 3QZ7A 4ECQA 2IA6A 1PUZA 7ICSA 4EBEA 2IHNA 4IR1A 1IM4A 2FI1A 4PZOA 3PW0A 4XRHA 2PMZF 1AQ6A 4LVSA 2R8HA 3T5JA 1N5XA 1PK3A 2E8OA 2B4VA 1LKYA 4RUCA 2YQEA 4UQGA 3A0HU 4B9VA 3MFHA 3T5KA 1Q8KA 2DVIA 2Y9TA 5IIMA 7ICJA 7ICUA 4M9NA 2KOBA 1QSLA 3MR3A 2O6KA 3LK9A 3QEAZ 4ED6A 4P4OA 4GXJA 4WJ3B 3EW9A 5ALJA 2M9NA 3PX0A 9ICQA 5AKYA 5TZVA 2R8JA 4KLJA 3H8JA 1L7OA 5CWRA 1L7PA 4CF4A 4FHXA 3ZI4A 3KOOA 4ED1A 4ELUA 3ALRA 3E58A 3GZFA 4QIWC 1PVPA 1A0PA 5CR0A 8ICQA 5KFKA 3PX4A 5J2EA 5ALGA 2AQ4A 1H38A 3B9JA 4UB5A 2RHFA 3RF9A 3KZIU 4I29A 5HRKA 3HT3A 2A1AA 1ED1A 4F2SA 8ICFA 4IS7A 2Q0ZX 4F91B 3M9OB 1KRPA 1PX5A 2JEGA 2EDUA 3TI0A 3L3FX 2M2WA 1Z4OA 4X0BA 4NXVA 2HHWA 3RR8A 2OYYA 2ZTEA 3OVAA 7ICNA 3TKAA 2JH1A 2P6RA 1PK1A 2C22A 2HN2A 3EZ5A 2KP7A 2BCSA 5AKXA 4QZFA 5J0PA 4CCHA 4O6AA 2DFLA 2HN1A 2QARB 2IHMA 4A8EA 3CNHA 2CPRA 4NWIA 3GV8B 4XJEA 3WK5A 7ICGA 1T94A 3JPRA 4FE3A 4DL4A 4NXXA 3BZKA 4RQ4A 4DSLA 4MHVA 4O5EA 3T3FA 1ZQUA 4DLGA 4DFPA 4KLEA 4LT6A 5D61A 1T3QA 5KFYA 1DGSA 4ECZA 4PL2A 1R8CA 2ZJ5A 5AM4A 2H3QA 3BJYA 4C4TA 3S6JA 1ZYQA 3KTQA 4K98A 4QWAA 1S10A 4RWQA 2D8CA 4BX9C 4BXOB 1UQVA 3UPQA 4F4YA 5BOMA 2ES6A 4U7CA 2PFQA 3C23A 2W03A 3C29A 2KZZA 1U45A 4OCZA 3H0MB 5HHHA 3NVZA 1S0NA 2IOFK 2D6FC 9ICNA 1DOQA 2ZG6A 2OM6A 1JXEA 1SKWA 4C0ZA 2ZIUB 3DEEA 4RQ6A 2QB0A 4F5QA 1L6NA 1O08A 2ZH7A 4X4SA 2GWSA 3Q8KA 2UVUA 5KFIA 2G09A 4O5CA 9ICKA 4F92B 3PR5B 4RU9A 5E79U 1NOMA 4F5OA 2JGAA 5AM3A 7ICQA 3ER8C 4EEBA 2VKQA 5ALPA 1TFWA 1WCNA 1N48A 4X5VA 4RWNA 5DQIA 3PW4A 1TV9A 4P4MA 2FPLA 8ICVA 2W9CB 1TFYA 4KLSA 4ECTA 5EE1A 1ZJNA 2H3VA 1SGGA 4QZDA 1UETA 3MGHA 2V9WA 5F3XB 5GTHU 1SV0A 1ZRNA 1HEKA 2BR0A 3NS1A 2F76X 3TADC 4RQ1A 4ECSA 2KZ3A 4OAHA 2F1HA 3ZD9A 1RQNA 3HJEA 2PFPA 1S9FA 1V4AA 5KFOA 1GPJA 2Q4TA 3GV7B 4QZHA 1D8LA 1XS9D 4ED3A 1UEVA 2W11A 2ZUCA 4FHYA 1NZPA 4J9NA 1ZQJA 2CRXA 2VA3A 3AEVA 4O68A 3NASA 2LI6A 2UVWA 2DRAA 2H3IA 4K4GA 3WKBA 1ZQHA 1RQLA 1U48A 1UPHA 5AI4A 5JTGA 1R89A 5J8YA 4WBYA 2YY6A 2AGPA 3NGDA 4NLBA 2ZIXA 5KFMA 9ICEA 3T5HA 5CFTA 1X66A 5KFBA 2W9CA 5JU5A 2FLLA 1COOA 2VJ4A 2BBHA 2W54A 4Y2JA 1L3SA 2HHSA 3KHLA 2CXYA 3SAGA 2LM4A 3D2NA 3QUQA 2DKXA 2WAQC 1RZTA 3FC4A 4RQ5A 3RH6A 4O3RA 4O0IA 3OSPA 1NK5A 3G6YA 3HPOA 4X4VA 3KD3A 4CNQA 4KN4A 5HR7A 1C7YA 5KFXA 4ED0A 3NRZA 5IIKA 4NXTA 3H37A 2DR5A 4FHWA 3I28A 5AKIA 4Q44A 1HUOA 2NO4A 4RQ3A 9ICMA 3WFSC 1KTQA 5HHIA 5DLGA 4J9PA 3WFRE 4DCCA 8ICUA 2JH7A 4YCXA 3RBDA 4RQ8A 4PGXA 3WFPA 2K4EA 4G9BA 2B56A 4P0QB 1TKDA 3M8RA 1QTMA 4DQQA 2Q66A 2OEHA 4OJOA 2AGQA 1SL0A 4QZ8A 3GIKA 1XSPA 5KT6A 2KKPA 1ZQIA 1CRXA 3JPSA 3C2LA 1NKCA 5ALUA 4I2AA 4C8LA 2XCAA 1KN5A 4Q8FA 1QCKA 4BDPA 2G08A 4GXKA 1ZJMA 1DXSA 2ZUDA 2ZIVA 2KIVA 4RQNA 4I2CA 5KG6A 1KEJA 4O5KA 5CP2A 2ASJA 1JN3A 5KG4A 1VJ7A 1UHUA 2HSZA 4CF3A 5J2FA 5ALWA 8ICXA 1DK3A 1RYRA 2VA2A 3ER9B 5AKZA 3CRXA 1NK6A 1X40A 2ATLA 2ZIWA 3TACB 3F2DA 3Q8RB 2UVRA 1NK7A 3GV5B 3V6KA 2BE3A 2ZXIA 1XNSA 4Z6EA 2B21A 5KT7A 4NKTA 4X4TA 5HREA 3K75D 1L7NA 1F5AA 4USAA 5KFGA 3QUCA 1KLNA 2K8CB 5HRIA 4WQLA 2YN4A 4F5NA 3H8MA 2PXIA 3UMCA 2WB1F 4C8KA 4P2HA 5ALNA 1AROP 1NO5A 9ICUA 4FFDA 3MGIA 4ECRA 1ZD5A 1QSSA 4F4XA 3UPSA 3H4BA 3RB6A 3KBBA 1N56A 5J0YA 2FDRA 1KSPA 2Y0SF 2W9AA 4AT9B 3C21A 2DWQA 5IINA 8ICSA 5J0OA 4NJ8A 4I0UA 2IUBA 1CUKA 4FBUA 2WF6A 2I5HA 3GIMA 3TFRA 5KT2A 4R8UA 4PHAA 5J2GA 2QLTA 1F44A 1ZQZA 3H38A 5KFPA 1ZQPA 4P0QA 4Q8EA 4ECXA 2NRWA 2AH5A 4FBTA 2EZXA 1XO0A 4KB6A 2XI9A 3C5GA 3SR6A 3M9MB 3ZDDA 2FE9A 2XGQA 5H2FU 1Z00B 1NKBA 2XY5A 5J0QA 1MQ3A 1URJA 4QZAA 1U9LA 4DQSA 3JPTA 8ICGA 2K4IA 1F5SA 3QU4A 2BCRA 4UAVA 5KFEA 1ZQAA 4NLGA 3QE9Y 2KJ9A 2HHTA 1KQQA 3ISBA 1LV5A 2DBYA 2W55A 3ERCC 3H7IA 1QQ6A 3H8SA 2BZFA 4XQ8A 4EYIB 1ZQYA 2FLNA 3GIJA 5KFVA 2FLPA 5ALYA 5IIIA 2BHNA 3HP6A 4NLZA 4YD1A 1NK8A 5K4LA 1HUZA 9ICOA 1P7DA 1SKSA 5J0XA 8ICOA 7ICFA 3QUTA 1PK1B 4DSJA 7ICEA 3MC1A 3KHRA 4CGZA 2W9BA 1BPZA 3RJIA 4GXIA 4X0AA 5DG8A 8ICMA 3WK6A 1MIVA 3LYSA 1NI3A 4I2DA 8ICNA 2R18A 2KD1A 1B22A 4Y2YA 2BPFA 5BPCA 2J6SA 1NJWA 4YVZA 1ZQDA 4GLXA 5DBBA 2W8LA 1SKRA 4DS4A 1N62A 3SAFA 2BQUA 3TAPA 4F5RA 3H40A 4OJPA 2IOHA 2BBJA 5AI6A 1ZD2P 2DR9A 2MU2A 2ZTCA 2ZIWB 3KKAA 5KFNA 2C2RA 3NVWA 3KZXA 4YMNA 3PMNA 5KG2A 4TQSA 3UMGA 5J0UA 1N5WA 1FA0A 2XGPA 9ICVA 4CE6A 3MGVA 1LVHA 3OUYB 2MSNA 3H0RB 2NYVA 2WF7A 3CP8A 4KLLA 5AK4A 1OXJA 1BVSA 4X4UA 4BXOA 3PW7A 3ZDBA 4WH5A 2HMXA 3I76A 4JLZA 1S77D 3CYMA 1V97A 4YXJA 2HW3A 4UB6U 2W8KA 3BZCA 4E0DA 1VJ5A 2FPMA 2BCUA 5AM5A 1VLBA 2IMWP 3THVA 3AQNA 1L8LA 2KK0A 4F71A 4TUQA 2ZIVB 4QZ9A 4WC5A 4C7YA 5IILA 3V6HA 1ZETA 4ED2A 5EE3A 4DF4A 4I27A 1D9FA 2FMPA 4US9A 3EPIA 1FEZA 1ZQXA 3HX0A 4CRXA 5IIJA 3IM1A 2F77X 3IG5A 4I2FA 3NVYA 4HYKA 4U6PA 3TARA 4BJQA 1ZQEA 1YLQA 2AJQA 2K60A 3ETRA 3EWAA 4YP3A 3AUOA 1ZD3A 2ISPA 4AT8A 3E0FA 5ALVA 3PV8A 5HRBA 4RWOA 2C2DA 4J9QA 5CHEA 4C8NA 5ALOA 2LYHA 1NJZA 5HR9A 1MA7A 1X9MA 2JMGA 4DWIA 2M2UA 4FS2A 4IQUA 4TUSA 2VANA 4DFJA 3T5LA 4IRDA 3WU2U 4OJ5A 4FO1A 2KKVA 1JQRA 3KHGA 5HNKA 3NWIA 3SI8A 5KT3A 1ZQKA 1SL1A 4KLOA 2KSOA 4DQIA 2NO5A 3C18A 1Z3EB 4I2HA 2E8PA 3UXOA 3IG8A 4RPXA 3EPGA 4M5DA 5J2IA 3AQKA 3SMVA 2F3NA 2DUYA 4DLEA 5J2BA 3PNCA 2HOFA 4KLFA 4JLXA 2ISOA 2PKEA 2P6UA 3PO5A 3AL0B 3ED5A 1XWLA 3AMZA 4RQ0A 1BPYA 2D3DA 4KLUA 4BUGA 1WUDA 5D62A 4M9HA 2GAFD 2HDOA 4KLHA 2FPKA 3PX6A 7ICTA 4QZIA 5CRXA 4RPZA 3V7LA 7ICRA 5EE0A 1IV8A 9ICAA 3ZDEA 2HBKA 1A76A 2JXJA 4AP9A 4NKUA 4DL6A 3PW5A 3BQ7A 3SQIA 5ALTA 3OGUA 3WKAA 1J2NA 2KJ8A 2N1RA 4NLKA 4IG8A 2Y9UA 3N7RC 1WOTA 5J0WA 1LB2B 4MEYA 7ICIA 5TISU 5KFZA 2XC9A 3MBYA 4DFMA 4FS1A 5J2DA 2WF9A 3D2QA 5EE9A 1KKXA 1SWWA 2W7PA 3RH5A 2V4QA 2OH2A 3C28A 4EP7A 4DS5A 4M47A 2HCFA 2GA9D 5L1JA 1TVAA 4RZRA 3ISCA 5ALZA 1YZ6A 5L1IA 5T14A 3Q8LA 2F1JA 3QU9A 2OWOA 4GIBA 9ICTA 4WBZA 3U26A 1X9XA 5HRFA 8ICJA 2KV2A 2Z7JA 3F2CA 3TANA 5HRGA 9ICPA 5J8YC 1L7MA 5ALSA 1JX4A 4UB2A 1MSWD 5KFSA 1M6YA 4G3IA 1NJXA 4K99A 4RUAA 1Z1BA 2JZBB 2LHTA 2Y1IA 1T7PA 4NLNA 4MF2A 4QZEA 1RXWA 1XSLA 3PZPA 2KVSA 3A0BU 1Z19A 4K4IA 4M9LA 1Q78A 5EWGA 1BPDA 4AT8B 5CJ7A 4EV6A 3V7KA 3KKAC 1Z1VA 2EZYA 3ZD8A 3OJUA 3PW2A 4JWMA 2KIWA 3CK6A 1BPEA 2P66A 4C80A 2HHPA 3EYZA 2DF4B 4UAUA 3WK7A 9ICWA 3C1YA 1RXVA 5ALHA 4UB4A 4DSKA 2LKYA 5AKKA 5J0SA 3C66A 4EBKA 1ZQFA 4F50A
chains in the Genus database with same CATH topology
9ICUA 9ICIA 4R8UB 5J29A 2XCPA 4LVSA 9ICSA 2R8HA 3MGIA 3T5JA 2ZH5A 4ECRA 4DFKA 5DQHA 1QSSA 2JEJA 4DL7A 4F4KA 4F4XA 4RUCA 3UPSA 1QLNA 4UQGA 5D49A 3H4BA 3RB6A 4QZCA 3BQTA 1N56A 4B9VA 3MFHA 3T5KA 5J0YA 8ICHA 2DVIA 1KSPA 5IIMA 2H5XA 5DB9A 4PHEA 3RRGA 7ICJA 2ID1A 1XC9A 5C5JA 7ICUA 4M9NA 2NRKA 2W9AA 3PO4A 4AT9B 3Q8QB 3C21A 4ED8A 1QSLA 5IINA 8ICSA 3MR3A 3AQMA 3LK9A 3WFOA 4R65A 3QEAZ 2KN7A 4ED6A 1RYSA 5J0OA 4EBJA 4P4OA 4DQPA 4GXJA 1RPLA 1KFDA 1HJPA 4F4WA 3RH4A 5EWEA 4RT3A 1CUKA 4EBDA 3EW9A 4J9LA 2M9NA 4UAWA 4FBUA 3BDPA 8ICKA 3JYYA 3GIMA 3PX0A 5CB1A 3TFRA 9ICQA 5KT2A 4R8UA 4PHAA 5DG9A 5TZVA 5J2GA 1S0MA 2R8JA 4KLJA 3H8JA 1MIYA 1R8BA 3RTVA 5DDMA 3PVXA 5CWRA 1ZQZA 3LWLA 5D46A 5KFPA 4UB3A 4KTQA 7ICMA 1ZQPA 3H38A 4ED7A 4Q8EA 4ECXA 2NRWA 2BCVA 4FHXA 5DB8A 4FBTA 2RFFA 4ED1A 4XQ7A 4ELUA 4Q43A 4J9MA 4JWNA 1S0VA 5DGAA 3ZDCA 8ICCA 5D4BA 3N97B 3C5GA 3RAXA 5CR0A 4M9JA 8ICQA 4FH5A 3M9MB 5KFKA 3ZDDA 4JK1A 2DRBA 4O3QA 3PX4A 5KT5A 5J2EA 2XGQA 4MFFA 1Z00B 7ICLA 1NKBA 2XY5A 4DOCA 2AQ4A 1H38A 5J0QA 1MQ3A 4UB5A 1ZQOA 2PI4A 4XUSA 4QZAA 1U9LA 1JMSA 3JPTA 4DQSA 4I29A 3LWMA 5HRKA 3HT3A 8ICGA 1T8EA 3UXNA 3C5FA 4F2SA 8ICFA 2XO7A 4J9KA 2Q0ZX 4F91B 3G6XA 2BCRA 2BDPA 4Z6DA 3MFIA 1BGXT 3M9OB 1KRPA 1PX5A 2JEGA 5KFEA 1ZQAA 5DQGA 4I2BA 4NLGA 3QE9Y 2A1JA 3TI0A 2HHTA 3KHHA 2M2WA 4P4PA 4ATBB 3ISBA 1LV5A 3WFQE 4RNMA 3GFKB 2UVVA 4TURA 1T3NA 2KTQA 3H7IA 3H8SA 3OV7A 4X0BA 5F9NA 4Q45A 4XQ8A 2HHWA 5KG5A 4FO6A 3JPQA 4EYIB 4C8MA 1L5UA 1ZQYA 2FLNA 3RR8A 2ZJAA 4DL5A 1NJYA 2ZTEA 3OVAA 7ICNA 4DO9A 2P6RA 2HVHA 2AU0A 9ICBA 3GIJA 5KFVA 2FLPA 2C22A 5IIIA 5DECA 2BHNA 3EZ5A 9ICRA 1Q79A 3HP6A 4WC7A 4NLZA 4QZBA 2BCSA 3BQ1A 4YD1A 2KP7A 8ICIA 4F4ZA 8ICAA 8ICBA 2ZH1A 3V6JA 1NK8A 5KG7A 4QZFA 1HUZA 3GQCA 5J0PA 4CCHA 9ICOA 3HJ4A 2DFLA 4IQVA 3GDXA 1SKSA 1MC8A 5J0XA 3MR5A 9ICJA 3SZ2A 3RR7A 8ICOA 2RDIA 7ICFA 1MQ2A 1ZQTA 3MABA 3C2MA 4BWJA 2IHMA 2PI5A 4ECWA 4J9RA 4DSJA 4NY8A 7ICEA 3UXPA 1TK8A 3KHRA 3GV8B 5L1KA 3OVSA 2W9BA 3BQ0A 4JV0A 3RJIA 1BPZA 2ZHAA 1KFSA 2ZHBA 1S76D 4GXIA 4X0AA 1PZNA 4EZ6A 4WC4A 5DG8A 4LZDA 4AT9A 8ICMA 7ICGA 1MIVA 4JV1A 4I2DA 1IXRA 2ASDA 3JPRA 8ICNA 4JUZA 4I2JA 4UAYA 4O3SA 4DL4A 2A1JB 4RNOA 1UEUA 1B22A 2BPFA 5KFQA 5BPCA 5F9LA 4QWDA 4RQ4A 5L1LA 4DSLA 3N4MB 2J6SA 3V72A 1ZQBA 4O5EA 4YN4A 3T3FA 1ZQUA 4ECUA 1NJWA 4DLGA 4YVZA 1ZQDA 4GLXA 4DFPA 4EYHB 5DBBA 3ETLA 2W8LA 5J2KA 3HWTA 4M2YA 1JIHA 1SKRA 4DS4A 1ZQNA 4KLEA 8ICEA 5KFYA 3M9NB 1DGSA 2HHVA 4ECZA 2KFZA 4X4QA 2BQUA 1R8CA 3TAPA 4F5RA 2ZJ5A 3H40A 4UAZA 2R8IA 4M6WB 5KFUA 3TQ1A 4KLGA 8ICYA 9ICCA 1Y88A 1SL2A 3BJYA 1ZYQA 3KTQA 4PGYA 4YMMA 1NO5A 1D9DA 4QWAA 1S10A 4PPXA 4RWQA 2ZTCA 5J2CA 2JZBA 2DR9A 2R8KA 4O5KA 2DPIA 1XU4A 2NRZA 2MUTA 4BXOB 5DEDA 1TAUA 4QZGA 5KFNA 5BOMA 4F4YA 3UPQA 2C2RA 3MR6A 3TAQA 2PFQA 3H8WA 3C23A 2KZZA 3GILA 1U45A 8ICRA 1NK0A 4YMNA 3PMNA 3FYHA 5KG2A 4TQSA 4AT7B 5HHHA 4ELTA 4B9NA 1JXLA 4BGDA 5J0UA 1UA1A 1S0NA 1FA0A 2NRXA 3ORYA 2XGPA 4BWMA 9ICVA 9ICNA 1DOQA 3JPPA 4YR2A 3FDSA 1NZPA 4UD5A 1JXEA 1SKWA 4KLIA 3OUYB 1R8AA 9ICFA 4M0AA 2ZJ8A 4PH5A 2W9MA 4RQ6A 2PFOA 4F5QA 2ZH7A 4KLLA 4X4SA 2GWSA 3Q8KA 2UVUA 5KFIA 1ZQRA 1BVSA 4X4UA 3HW8A 5DBCA 4F92B 5DKWA 3PR5B 4PHDA 1ZQQA 4BXOA 4O5CA 9ICKA 3PW7A 4RU9A 3ZDBA 2ISPA 1NOMA 4F5OA 2BGWA 2PFNA 4O3PA 5J2HA 1TK5A 2KZMA 7ICQA 4FH3A 3SV4A 1S77D 3C18A 4AT8A 3RAQA 3PY8A 2RDJA 2J6TA 4YXJA 4B9UA 2HW3A 1TFWA 3C2KA 2W8KA 2NRVA 4E0DA 2XY7A 4K4HA 1WCNA 1S0OA 2FPMA 1N48A 4KN7A 3V7JA 2BCUA 4C8OA 4X5VA 4FHVA 3QEBZ 5DG7A 5DQIA 2DPJA 2IMWP 2ZH4A 4YR0A 2HHXA 4RWNA 3THVA 5DGBA 3PW4A 3AQNA 1TV9A 4P4MA 2FPLA 1ZQFA 2FMQA 8ICVA 2W9CB 1EXNA 4KLSA 3WFRE 4ECTA 1TFYA 1BPBA 4KMUA 1TK0A 4TUQA 3H4DA 1ZJNA 4KITB 4QZDA 4QZ9A 4WC5A 4YXMA 4YD2A 3OHBA 5IILA 3MGHA 3V6HA 1UETA 2V9WA 4O3NA 2MUTB 1ZETA 4E8FA 4EBCA 5KFJA 2VA8A 4I28A 2BR0A 4ED2A 4WC0A 2F1IA 4RQ1A 3MR2A 4ECSA 2KZ3A 4DF4A 4I27A 4O9MA 1ZQLA 2F1HA 1D9FA 1XO1A 3ZD9A 2FMPA 2FMSA 2VA3A 3EPIA 2PFPA 5HRLA 4B9LA 1ZQXA 3HX0A 5KFHA 3ISDA 5IIJA 1S9FA 4MFCA 2HVIA 9ICXA 5KFOA 5HRDA 1V4AA 3IM1A 2ZH8A 3GV7B 1L3UA 1U49A 4EZ9A 4IRKA 4I2FA 3LDAA 4QZHA 4HYKA 4DSEA 1D8YA 4R64A 1D8LA 1XS9D 4ED3A 3TARA 1UEVA 1ZQEA 2ZUCA 4WC1A 3HJ1A 1YLQA 4IRCA 2AJQA 4FHYA 1X9WA 3EWAA 4R63A 3JPOA 4YP3A 2WTFA 3MDAA 4J9NA 3AUOA 2C2EA 1UA0A 3PV8A 4TUPA 1ZQJA 3JPNA 1KFTA 2C2DA 2UVWA 3UQ0A 5HRBA 4RWOA 4J9QA 2DR7A 1XSNA 4C8NA 2DRAA 2IBKA 4F8RA 1Z00A 3LQCB 4K4GA 2LYHA 4R66A 1NJZA 8ICZA 5HR9A 1ZQHA 1X9MA 4PGQA 4DWIA 2JEIA 3RB0A 5HMMA 1U48A 2M2UA 4FS2A 3NTUA 4IQUA 5KFAA 1U4BA 5DB7A 4RNNA 4TUSA 1V9PA 2VANA 2M2VA 1R89A 4DFJA 4WBYA 4ATBA 2R8GA 3T5LA 4EEYA 2AGPA 4X4PA 2BPCA 1UT8A 3NGDA 8ICWA 4DSFA 5EOZA 4IRDA 4UBCA 5J0RA 4B9MA 5KFMA 2W9BB 1BNOA 9ICEA 3T5HA 1ZQWA 5KFBA 2W9CA 1JQRA 2FLLA 3KHGA 3UQ2A 5HNKA 1COOA 5KT3A 5JUMA 1T4GA 5EWFA 3SI8A 1SL1A 1ZQKA 5L9XA 5IIOA 1ZQMA 4KLOA 4J9SA 2HHUA 4DQIA 5DB6A 4QWEA 5KFDA 2ZUBA 1L3SA 4LZGA 1Z3EB 4I2HA 2HHSA 9ICGA 3UXOA 4NXZA 3KHLA 4RPXA 3EPGA 3TFSA 4KLQA 4M5DA 1CEZA 4UD4A 5DLFA 4M9GA 5J2IA 9ICLA 3AQKA 4B9TA 5CA7A 4DLEA 4IQWA 5J2BA 3PNCA 1RZTA 4KLFA 3AU2A 1K1SA 4RQ5A 3SYZA 4DOAA 3RH6A 4O3RA 5KFRA 4O0IA 2ZH6A 2ISOA 5KG0A 2P6UA 5BOLA 3OSPA 4M6WA 2O5AA 4ZH4A 4RPYA 1NK5A 3G6YA 2JEFA 4X4OA 3HPOA 4Z6CA 3PO5A 7ICHA 5KG1A 1XWLA 5J0TA 1ZQVA 4RT2A 4X4VA 3Q8SB 1SZPA 2NRTA 4RQ7A 4RQ0A 3OSNA 4KN4A 4F93B 5KFLA 4ECVA 1BPYA 1C7YA 2AGOA 4KLUA 7ICKA 7ICVA 3C1ZA 5KFXA 4ED0A 1ZQSA 7ICOA 4QWBA 3M8SA 4M9HA 5IIKA 4KLHA 5HRHA 3H37A 2FPKA 4YR3A 3PX6A 7ICTA 4FHWA 2DR5A 4QZIA 4DF8A 3RJHA 3RJFA 7ICPA 4IR9A 4Q44A 1HUOA 4TQRA 4RPZA 4WC2A 4NM2A 4J9OA 4RQ3A 1TFRA 3V7LA 4I2IA 7ICRA 1X9SA 2Y1JA 9ICMA 3WFSC 2C28A 9ICAA 1KTQA 5HHIA 5DLGA 3B0YA 4J9PA 2DR8A 3ZDEA 1ZQCA 3L9DA 2ZTDA 8ICUA 1A76A 4I2GA 2PBEA 4DOBA 4YCXA 3RJGA 3RBDA 4RQ8A 5KT4A 3GIIA 4NKUA 4PGXA 5KFTA 3WFPA 4DL6A 3PW5A 1U47A 3OGUA 4DL2A 4QW8A 3RB4A 8ICPA 4F2RA 8ICTA 4NLKA 4IG8A 1K1QA 2KFNA 1TKDA 4LT6A 3M8RA 1WOTA 5J0WA 4S3NA 3RJEA 1LB2B 5KFCA 9ICHA 4MEYA 3QZ8A 7ICIA 3PR4A 1QTMA 1KDHA 1UT5A 4DQQA 1MIWA 1VFGA 2Q66A 2BQRA 1BNPA 2AGQA 5KFZA 2XC9A 3MBYA 1A77A 4QZ8A 3GIKA 4DFMA 1SL0A 5HP4A 4FS1A 4DQRA 5J2DA 1NK9A 2J6UA 4ELVA 1XSPA 5DDYA 5KT6A 1ZQIA 4I2EA 4IQTA 3JPSA 2ZH3A 3RH5A 3C2LA 1NKCA 2V4QA 4I2AA 4C8LA 1KNYA 3H39A 4F3OA 4EP7A 5HMLA 2XCAA 4UB1A 4DS5A 3AU6A 4M47A 8ICLA 5L1JA 1TVAA 4Q8FA 4RZRA 3G6VA 5KFFA 3B0XA 3ISCA 4BDPA 5L1IA 1ZQGA 3OUYA 3PMLA 4GXKA 1ZJMA 3Q8LA 5HC9A 4UBBA 2F1JA 5KG3A 2ZUDA 3IHQB 2OWOA 4I2CA 9ICTA 5KG6A 1KEJA 4WBZA 3OVBA 1L3VA 3ZDAA 5CP2A 1WCLA 1JN3A 4GC6A 2ASJA 1L3TA 4B9SA 5J2AA 4MEXA 5HRFA 8ICJA 3RBEA 4X4NA 4MF8A 2XY6A 3TANA 5HRGA 2BCQA 5KTQA 2AQ0A 9ICPA 3Q8MA 3OJSA 2M2TA 4YQWA 5KG4A 4RWPA 1JX4A 1VJ7A 4UB2A 4X4RA 1MSWD 5KFSA 4WC3A 4G3IA 1BPXA 3MDCA 1NJXA 4RUAA 1B43A 5J2FA 2JZBB 3RB3A 8ICXA 3NYBA 2I1QA 1RYRA 2Y1IA 2VA2A 1T7PA 4ECYA 4NLNA 1DK3A 4DSIA 4MF2A 4QZEA 4RQ2A 4NM1A 3OHAA 2V4RA 4YFKA 2ATLA 1RXWA 1NK6A 1XSLA 4PHPA 3K4GA 4K4IA 4M9LA 3Q8RB 2BQ3A 5EWGA 1Q78A 2O1PA 4WC6A 1BPDA 2UVRA 5F2VO 4AT8B 1NK7A 5CJ7A 3RJKA 2BKEA 3GV5B 3RRHA 4JV2A 3V7KA 3RJJA 2BPGA 3V6KA 2BE3A 4F5PA 1S97A 4DEZA 2ALZA 1QSYA 2I9GA 5KFWA 3AQLA 4Z6EA 4WCWA 4XA5A 2B21A 3OJUA 4YMOA 3ZD8A 3PW2A 5KT7A 4QW9A 4JWMA 2HHQA 4NKTA 4X4TA 5HREA 4M04A 1DK2A 3HIYA 1BPEA 4AT7A 2P66A 1NK4A 1TAQA 3E2EA 3K75D 1F5AA 4GC7A 4E80A 2HHPA 4FHPA 5KFGA 3EYZA 4YG2A 5J2JA 1OU5A 4O3OA 4QWCA 9ICWA 3H3AA 1NKEA 3BQ2A 3C1YA 3Q8PB 1RXVA 4E7XA 1KLNA 4UB4A 3SV3A 4DSKA 4MFAA 2ASLA 3JZ0A 1JAJA 5HRIA 5J0SA 5DBAA 4DL3A 3C66A 4KLTA 4F5NA 4KLMA 3QZ7A 2MAXA 4ECQA 2IA6A 7ICSA 5CHGA 2PXIA 4EBEA 2IHNA 4EBKA 4IR1A 4Z6FA 4KLDA 1IM4A 4C8KA 1X2IA 1AROP 4P2HA 3PW0A 2ZH9A 4XRHA 2ZH2A 4F50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICU A;  9ICI A;  4R8U B;  5J29 A;  2XCP A;  4LVS A;  9ICS A;  2R8H A;  3MGI A;  3T5J A;  2ZH5 A;  4ECR A;  4DFK A;  5DQH A;  1QSS A;  2JEJ A;  4DL7 A;  4F4K A;  4F4X A;  4RUC A;  3UPS A;  1QLN A;  4UQG A;  5D49 A;  3H4B A;  3RB6 A;  4QZC A;  3BQT A;  1N56 A;  4B9V A;  3MFH A;  3T5K A;  5J0Y A;  8ICH A;  2DVI A;  1KSP A;  5IIM A;  2H5X A;  5DB9 A;  4PHE A;  3RRG A;  7ICJ A;  2ID1 A;  1XC9 A;  5C5J A;  7ICU A;  4M9N A;  2NRK A;  2W9A A;  3PO4 A;  4AT9 B;  3Q8Q B;  3C21 A;  4ED8 A;  1QSL A;  5IIN A;  8ICS A;  3MR3 A;  3AQM A;  3LK9 A;  3WFO A;  4R65 A;  3QEA Z;  2KN7 A;  4ED6 A;  1RYS A;  5J0O A;  4EBJ A;  4P4O A;  4DQP A;  4GXJ A;  1RPL A;  1KFD A;  1HJP A;  4F4W A;  3RH4 A;  5EWE A;  4RT3 A;  1CUK A;  4EBD A;  3EW9 A;  4J9L A;  2M9N A;  4UAW A;  4FBU A;  3BDP A;  8ICK A;  3JYY A;  3GIM A;  3PX0 A;  5CB1 A;  3TFR A;  9ICQ A;  5KT2 A;  4R8U A;  4PHA A;  5DG9 A;  5TZV A;  5J2G A;  1S0M A;  2R8J A;  4KLJ A;  3H8J A;  1MIY A;  1R8B A;  3RTV A;  5DDM A;  3PVX A;  5CWR A;  1ZQZ A;  3LWL A;  5D46 A;  5KFP A;  4UB3 A;  4KTQ A;  7ICM A;  1ZQP A;  3H38 A;  4ED7 A;  4Q8E A;  4ECX A;  2NRW A;  2BCV A;  4FHX A;  5DB8 A;  4FBT A;  2RFF A;  4ED1 A;  4XQ7 A;  4ELU A;  4Q43 A;  4J9M A;  4JWN A;  1S0V A;  5DGA A;  3ZDC A;  8ICC A;  5D4B A;  3N97 B;  3C5G A;  3RAX A;  5CR0 A;  4M9J A;  8ICQ A;  4FH5 A;  3M9M B;  5KFK A;  3ZDD A;  4JK1 A;  2DRB A;  4O3Q A;  3PX4 A;  5KT5 A;  5J2E A;  2XGQ A;  4MFF A;  1Z00 B;  7ICL A;  1NKB A;  2XY5 A;  4DOC A;  2AQ4 A;  1H38 A;  5J0Q A;  1MQ3 A;  4UB5 A;  1ZQO A;  2PI4 A;  4XUS A;  4QZA A;  1U9L A;  1JMS A;  3JPT A;  4DQS A;  4I29 A;  3LWM A;  5HRK A;  3HT3 A;  8ICG A;  1T8E A;  3UXN A;  3C5F A;  4F2S A;  8ICF A;  2XO7 A;  4J9K A;  2Q0Z X;  4F91 B;  3G6X A;  2BCR A;  2BDP A;  4Z6D A;  3MFI A;  1BGX T;  3M9O B;  1KRP A;  1PX5 A;  2JEG A;  5KFE A;  1ZQA A;  5DQG A;  4I2B A;  4NLG A;  3QE9 Y;  2A1J A;  3TI0 A;  2HHT A;  3KHH A;  2M2W A;  4P4P A;  4ATB B;  3ISB A;  1LV5 A;  3WFQ E;  4RNM A;  3GFK B;  2UVV A;  4TUR A;  1T3N A;  2KTQ A;  3H7I A;  3H8S A;  3OV7 A;  4X0B A;  5F9N A;  4Q45 A;  4XQ8 A;  2HHW A;  5KG5 A;  4FO6 A;  3JPQ A;  4EYI B;  4C8M A;  1L5U A;  1ZQY A;  2FLN A;  3RR8 A;  2ZJA A;  4DL5 A;  1NJY A;  2ZTE A;  3OVA A;  7ICN A;  4DO9 A;  2P6R A;  2HVH A;  2AU0 A;  9ICB A;  3GIJ A;  5KFV A;  2FLP A;  2C22 A;  5III A;  5DEC A;  2BHN A;  3EZ5 A;  9ICR A;  1Q79 A;  3HP6 A;  4WC7 A;  4NLZ A;  4QZB A;  2BCS A;  3BQ1 A;  4YD1 A;  2KP7 A;  8ICI A;  4F4Z A;  8ICA A;  8ICB A;  2ZH1 A;  3V6J A;  1NK8 A;  5KG7 A;  4QZF A;  1HUZ A;  3GQC A;  5J0P A;  4CCH A;  9ICO A;  3HJ4 A;  2DFL A;  4IQV A;  3GDX A;  1SKS A;  1MC8 A;  5J0X A;  3MR5 A;  9ICJ A;  3SZ2 A;  3RR7 A;  8ICO A;  2RDI A;  7ICF A;  1MQ2 A;  1ZQT A;  3MAB A;  3C2M A;  4BWJ A;  2IHM A;  2PI5 A;  4ECW A;  4J9R A;  4DSJ A;  4NY8 A;  7ICE A;  3UXP A;  1TK8 A;  3KHR A;  3GV8 B;  5L1K A;  3OVS A;  2W9B A;  3BQ0 A;  4JV0 A;  3RJI A;  1BPZ A;  2ZHA A;  1KFS A;  2ZHB A;  1S76 D;  4GXI A;  4X0A A;  1PZN A;  4EZ6 A;  4WC4 A;  5DG8 A;  4LZD A;  4AT9 A;  8ICM A;  7ICG A;  1MIV A;  4JV1 A;  4I2D A;  1IXR A;  2ASD A;  3JPR A;  8ICN A;  4JUZ A;  4I2J A;  4UAY A;  4O3S A;  4DL4 A;  2A1J B;  4RNO A;  1UEU A;  1B22 A;  2BPF A;  5KFQ A;  5BPC A;  5F9L A;  4QWD A;  4RQ4 A;  5L1L A;  4DSL A;  3N4M B;  2J6S A;  3V72 A;  1ZQB A;  4O5E A;  4YN4 A;  3T3F A;  1ZQU A;  4ECU A;  1NJW A;  4DLG A;  4YVZ A;  1ZQD A;  4GLX A;  4DFP A;  4EYH B;  5DBB A;  3ETL A;  2W8L A;  5J2K A;  3HWT A;  4M2Y A;  1JIH A;  1SKR A;  4DS4 A;  1ZQN A;  4KLE A;  8ICE A;  5KFY A;  3M9N B;  1DGS A;  2HHV A;  4ECZ A;  2KFZ A;  4X4Q A;  2BQU A;  1R8C A;  3TAP A;  4F5R A;  2ZJ5 A;  3H40 A;  4UAZ A;  2R8I A;  4M6W B;  5KFU A;  3TQ1 A;  4KLG A;  8ICY A;  9ICC A;  1Y88 A;  1SL2 A;  3BJY A;  1ZYQ A;  3KTQ A;  4PGY A;  4YMM A;  1NO5 A;  1D9D A;  4QWA A;  1S10 A;  4PPX A;  4RWQ A;  2ZTC A;  5J2C A;  2JZB A;  2DR9 A;  2R8K A;  4O5K A;  2DPI A;  1XU4 A;  2NRZ A;  2MUT A;  4BXO B;  5DED A;  1TAU A;  4QZG A;  5KFN A;  5BOM A;  4F4Y A;  3UPQ A;  2C2R A;  3MR6 A;  3TAQ A;  2PFQ A;  3H8W A;  3C23 A;  2KZZ A;  3GIL A;  1U45 A;  8ICR A;  1NK0 A;  4YMN A;  3PMN A;  3FYH A;  5KG2 A;  4TQS A;  4AT7 B;  5HHH A;  4ELT A;  4B9N A;  1JXL A;  4BGD A;  5J0U A;  1UA1 A;  1S0N A;  1FA0 A;  2NRX A;  3ORY A;  2XGP A;  4BWM A;  9ICV A;  9ICN A;  1DOQ A;  3JPP A;  4YR2 A;  3FDS A;  1NZP A;  4UD5 A;  1JXE A;  1SKW A;  4KLI A;  3OUY B;  1R8A A;  9ICF A;  4M0A A;  2ZJ8 A;  4PH5 A;  2W9M A;  4RQ6 A;  2PFO A;  4F5Q A;  2ZH7 A;  4KLL A;  4X4S A;  2GWS A;  3Q8K A;  2UVU A;  5KFI A;  1ZQR A;  1BVS A;  4X4U A;  3HW8 A;  5DBC A;  4F92 B;  5DKW A;  3PR5 B;  4PHD A;  1ZQQ A;  4BXO A;  4O5C A;  9ICK A;  3PW7 A;  4RU9 A;  3ZDB A;  2ISP A;  1NOM A;  4F5O A;  2BGW A;  2PFN A;  4O3P A;  5J2H A;  1TK5 A;  2KZM A;  7ICQ A;  4FH3 A;  3SV4 A;  1S77 D;  3C18 A;  4AT8 A;  3RAQ A;  3PY8 A;  2RDJ A;  2J6T A;  4YXJ A;  4B9U A;  2HW3 A;  1TFW A;  3C2K A;  2W8K A;  2NRV A;  4E0D A;  2XY7 A;  4K4H A;  1WCN A;  1S0O A;  2FPM A;  1N48 A;  4KN7 A;  3V7J A;  2BCU A;  4C8O A;  4X5V A;  4FHV A;  3QEB Z;  5DG7 A;  5DQI A;  2DPJ A;  2IMW P;  2ZH4 A;  4YR0 A;  2HHX A;  4RWN A;  3THV A;  5DGB A;  3PW4 A;  3AQN A;  1TV9 A;  4P4M A;  2FPL A;  1ZQF A;  2FMQ A;  8ICV A;  2W9C B;  1EXN A;  4KLS A;  3WFR E;  4ECT A;  1TFY A;  1BPB A;  4KMU A;  1TK0 A;  4TUQ A;  3H4D A;  1ZJN A;  4KIT B;  4QZD A;  4QZ9 A;  4WC5 A;  4YXM A;  4YD2 A;  3OHB A;  5IIL A;  3MGH A;  3V6H A;  1UET A;  2V9W A;  4O3N A;  2MUT B;  1ZET A;  4E8F A;  4EBC A;  5KFJ A;  2VA8 A;  4I28 A;  2BR0 A;  4ED2 A;  4WC0 A;  2F1I A;  4RQ1 A;  3MR2 A;  4ECS A;  2KZ3 A;  4DF4 A;  4I27 A;  4O9M A;  1ZQL A;  2F1H A;  1D9F A;  1XO1 A;  3ZD9 A;  2FMP A;  2FMS A;  2VA3 A;  3EPI A;  2PFP A;  5HRL A;  4B9L A;  1ZQX A;  3HX0 A;  5KFH A;  3ISD A;  5IIJ A;  1S9F A;  4MFC A;  2HVI A;  9ICX A;  5KFO A;  5HRD A;  1V4A A;  3IM1 A;  2ZH8 A;  3GV7 B;  1L3U A;  1U49 A;  4EZ9 A;  4IRK A;  4I2F A;  3LDA A;  4QZH A;  4HYK A;  4DSE A;  1D8Y A;  4R64 A;  1D8L A;  1XS9 D;  4ED3 A;  3TAR A;  1UEV A;  1ZQE A;  2ZUC A;  4WC1 A;  3HJ1 A;  1YLQ A;  4IRC A;  2AJQ A;  4FHY A;  1X9W A;  3EWA A;  4R63 A;  3JPO A;  4YP3 A;  2WTF A;  3MDA A;  4J9N A;  3AUO A;  2C2E A;  1UA0 A;  3PV8 A;  4TUP A;  1ZQJ A;  3JPN A;  1KFT A;  2C2D A;  2UVW A;  3UQ0 A;  5HRB A;  4RWO A;  4J9Q A;  2DR7 A;  1XSN A;  4C8N A;  2DRA A;  2IBK A;  4F8R A;  1Z00 A;  3LQC B;  4K4G A;  2LYH A;  4R66 A;  1NJZ A;  8ICZ A;  5HR9 A;  1ZQH A;  1X9M A;  4PGQ A;  4DWI A;  2JEI A;  3RB0 A;  5HMM A;  1U48 A;  2M2U A;  4FS2 A;  3NTU A;  4IQU A;  5KFA A;  1U4B A;  5DB7 A;  4RNN A;  4TUS A;  1V9P A;  2VAN A;  2M2V A;  1R89 A;  4DFJ A;  4WBY A;  4ATB A;  2R8G A;  3T5L A;  4EEY A;  2AGP A;  4X4P A;  2BPC A;  1UT8 A;  3NGD A;  8ICW A;  4DSF A;  5EOZ A;  4IRD A;  4UBC A;  5J0R A;  4B9M A;  5KFM A;  2W9B B;  1BNO A;  9ICE A;  3T5H A;  1ZQW A;  5KFB A;  2W9C A;  1JQR A;  2FLL A;  3KHG A;  3UQ2 A;  5HNK A;  1COO A;  5KT3 A;  5JUM A;  1T4G A;  5EWF A;  3SI8 A;  1SL1 A;  1ZQK A;  5L9X A;  5IIO A;  1ZQM A;  4KLO A;  4J9S A;  2HHU A;  4DQI A;  5DB6 A;  4QWE A;  5KFD A;  2ZUB A;  1L3S A;  4LZG A;  1Z3E B;  4I2H A;  2HHS A;  9ICG A;  3UXO A;  4NXZ A;  3KHL A;  4RPX A;  3EPG A;  3TFS A;  4KLQ A;  4M5D A;  1CEZ A;  4UD4 A;  5DLF A;  4M9G A;  5J2I A;  9ICL A;  3AQK A;  4B9T A;  5CA7 A;  4DLE A;  4IQW A;  5J2B A;  3PNC A;  1RZT A;  4KLF A;  3AU2 A;  1K1S A;  4RQ5 A;  3SYZ A;  4DOA A;  3RH6 A;  4O3R A;  5KFR A;  4O0I A;  2ZH6 A;  2ISO A;  5KG0 A;  2P6U A;  5BOL A;  3OSP A;  4M6W A;  2O5A A;  4ZH4 A;  4RPY A;  1NK5 A;  3G6Y A;  2JEF A;  4X4O A;  3HPO A;  4Z6C A;  3PO5 A;  7ICH A;  5KG1 A;  1XWL A;  5J0T A;  1ZQV A;  4RT2 A;  4X4V A;  3Q8S B;  1SZP A;  2NRT A;  4RQ7 A;  4RQ0 A;  3OSN A;  4KN4 A;  4F93 B;  5KFL A;  4ECV A;  1BPY A;  1C7Y A;  2AGO A;  4KLU A;  7ICK A;  7ICV A;  3C1Z A;  5KFX A;  4ED0 A;  1ZQS A;  7ICO A;  4QWB A;  3M8S A;  4M9H A;  5IIK A;  4KLH A;  5HRH A;  3H37 A;  2FPK A;  4YR3 A;  3PX6 A;  7ICT A;  4FHW A;  2DR5 A;  4QZI A;  4DF8 A;  3RJH A;  3RJF A;  7ICP A;  4IR9 A;  4Q44 A;  1HUO A;  4TQR A;  4RPZ A;  4WC2 A;  4NM2 A;  4J9O A;  4RQ3 A;  1TFR A;  3V7L A;  4I2I A;  7ICR A;  1X9S A;  2Y1J A;  9ICM A;  3WFS C;  2C28 A;  9ICA A;  1KTQ A;  5HHI A;  5DLG A;  3B0Y A;  4J9P A;  2DR8 A;  3ZDE A;  1ZQC A;  3L9D A;  2ZTD A;  8ICU A;  1A76 A;  4I2G A;  2PBE A;  4DOB A;  4YCX A;  3RJG A;  3RBD A;  4RQ8 A;  5KT4 A;  3GII A;  4NKU A;  4PGX A;  5KFT A;  3WFP A;  4DL6 A;  3PW5 A;  1U47 A;  3OGU A;  4DL2 A;  4QW8 A;  3RB4 A;  8ICP A;  4F2R A;  8ICT A;  4NLK A;  4IG8 A;  1K1Q A;  2KFN A;  1TKD A;  4LT6 A;  3M8R A;  1WOT A;  5J0W A;  4S3N A;  3RJE A;  1LB2 B;  5KFC A;  9ICH A;  4MEY A;  3QZ8 A;  7ICI A;  3PR4 A;  1QTM A;  1KDH A;  1UT5 A;  4DQQ A;  1MIW A;  1VFG A;  2Q66 A;  2BQR A;  1BNP A;  2AGQ A;  5KFZ A;  2XC9 A;  3MBY A;  1A77 A;  4QZ8 A;  3GIK A;  4DFM A;  1SL0 A;  5HP4 A;  4FS1 A;  4DQR A;  5J2D A;  1NK9 A;  2J6U A;  4ELV A;  1XSP A;  5DDY A;  5KT6 A;  1ZQI A;  4I2E A;  4IQT A;  3JPS A;  2ZH3 A;  3RH5 A;  3C2L A;  1NKC A;  2V4Q A;  4I2A A;  4C8L A;  1KNY A;  3H39 A;  4F3O A;  4EP7 A;  5HML A;  2XCA A;  4UB1 A;  4DS5 A;  3AU6 A;  4M47 A;  8ICL A;  5L1J A;  1TVA A;  4Q8F A;  4RZR A;  3G6V A;  5KFF A;  3B0X A;  3ISC A;  4BDP A;  5L1I A;  1ZQG A;  3OUY A;  3PML A;  4GXK A;  1ZJM A;  3Q8L A;  5HC9 A;  4UBB A;  2F1J A;  5KG3 A;  2ZUD A;  3IHQ B;  2OWO A;  4I2C A;  9ICT A;  5KG6 A;  1KEJ A;  4WBZ A;  3OVB A;  1L3V A;  3ZDA A;  5CP2 A;  1WCL A;  1JN3 A;  4GC6 A;  2ASJ A;  1L3T A;  4B9S A;  5J2A A;  4MEX A;  5HRF A;  8ICJ A;  3RBE A;  4X4N A;  4MF8 A;  2XY6 A;  3TAN A;  5HRG A;  2BCQ A;  5KTQ A;  2AQ0 A;  9ICP A;  3Q8M A;  3OJS A;  2M2T A;  4YQW A;  5KG4 A;  4RWP A;  1JX4 A;  1VJ7 A;  4UB2 A;  4X4R A;  1MSW D;  5KFS A;  4WC3 A;  4G3I A;  1BPX A;  3MDC A;  1NJX A;  4RUA A;  1B43 A;  5J2F A;  2JZB B;  3RB3 A;  8ICX A;  3NYB A;  2I1Q A;  1RYR A;  2Y1I A;  2VA2 A;  1T7P A;  4ECY A;  4NLN A;  1DK3 A;  4DSI A;  4MF2 A;  4QZE A;  4RQ2 A;  4NM1 A;  3OHA A;  2V4R A;  4YFK A;  2ATL A;  1RXW A;  1NK6 A;  1XSL A;  4PHP A;  3K4G A;  4K4I A;  4M9L A;  3Q8R B;  2BQ3 A;  5EWG A;  1Q78 A;  2O1P A;  4WC6 A;  1BPD A;  2UVR A;  5F2V O;  4AT8 B;  1NK7 A;  5CJ7 A;  3RJK A;  2BKE A;  3GV5 B;  3RRH A;  4JV2 A;  3V7K A;  3RJJ A;  2BPG A;  3V6K A;  2BE3 A;  4F5P A;  1S97 A;  4DEZ A;  2ALZ A;  1QSY A;  2I9G A;  5KFW A;  3AQL A;  4Z6E A;  4WCW A;  4XA5 A;  2B21 A;  3OJU A;  4YMO A;  3ZD8 A;  3PW2 A;  5KT7 A;  4QW9 A;  4JWM A;  2HHQ A;  4NKT A;  4X4T A;  5HRE A;  4M04 A;  1DK2 A;  3HIY A;  1BPE A;  4AT7 A;  2P66 A;  1NK4 A;  1TAQ A;  3E2E A;  3K75 D;  1F5A A;  4GC7 A;  4E80 A;  2HHP A;  4FHP A;  5KFG A;  3EYZ A;  4YG2 A;  5J2J A;  1OU5 A;  4O3O A;  4QWC A;  9ICW A;  3H3A A;  1NKE A;  3BQ2 A;  3C1Y A;  3Q8P B;  1RXV A;  4E7X A;  1KLN A;  4UB4 A;  3SV3 A;  4DSK A;  4MFA A;  2ASL A;  3JZ0 A;  1JAJ A;  5HRI A;  5J0S A;  5DBA A;  4DL3 A;  3C66 A;  4KLT A;  4F5N A;  4KLM A;  3QZ7 A;  2MAX A;  4ECQ A;  2IA6 A;  7ICS A;  5CHG A;  2PXI A;  4EBE A;  2IHN A;  4EBK A;  4IR1 A;  4Z6F A;  4KLD A;  1IM4 A;  4C8K A;  1X2I A;  1ARO P;  4P2H A;  3PW0 A;  2ZH9 A;  4XRH A;  2ZH2 A;  4F50 A; 
#chains in the Genus database with same CATH topology
 9ICI A;  2GOL A;  4R8U B;  5J29 A;  2XCP A;  9ICS A;  2ZH5 A;  5DQH A;  2JEJ A;  4DL7 A;  4F4K A;  2LYB A;  3L4P A;  5D49 A;  1QH9 A;  3RRG A;  3HKZ C;  1XC9 A;  2NRK A;  4ED8 A;  3AQE A;  4WQK A;  5AIC A;  3AQM A;  3WFO A;  5AI8 A;  2KN7 A;  4J03 A;  1RYS A;  4EBJ A;  1RPL A;  1KFD A;  3RH4 A;  4F4W A;  2HBM A;  4EX7 A;  3AM9 A;  3LVV A;  4RT3 A;  4EBD A;  3JYY A;  4UAW A;  3BDP A;  8ICK A;  3CW2 C;  1S0M A;  1MIY A;  1R8B A;  4QNL A;  5DDM A;  2EAN A;  4UB3 A;  7ICM A;  3O0F A;  4KMO B;  1NZB A;  1ECW A;  4XQ7 A;  4Q43 A;  2YB1 A;  4JWN A;  1S0V A;  5D4B A;  3K1Z A;  2BDU A;  1F0M A;  4FH5 A;  2DRB A;  5KT5 A;  4MFF A;  7ICL A;  4DOC A;  1KL9 A;  5JTI A;  3LWM A;  4J9K A;  1CI4 A;  3G6X A;  4PL1 A;  5FP0 A;  4Z6D A;  5DQG A;  4I2B A;  2A1J A;  3HKZ F;  4B6J A;  2G5I B;  3UM9 A;  4ATB B;  3WFQ E;  4P4P A;  4KX3 A;  3GFK B;  5AKE A;  3NVO A;  4TUR A;  1T3N A;  5HR6 A;  5F9N A;  5KG5 A;  2H3F A;  4FO6 A;  3AN1 A;  4DL5 A;  1YT3 A;  1NJY A;  4AYB C;  4DO9 A;  5AM0 A;  2HVH A;  2AU0 A;  9ICB A;  3N7P D;  1SB3 C;  2JRZ A;  3DV9 A;  9ICR A;  1Q79 A;  4WC7 A;  3BQ1 A;  2M0N A;  1X6I A;  4F4Z A;  8ICB A;  3HJ4 A;  3GQC A;  4OAG A;  3ONN A;  3QX7 A;  4IQV A;  2RQ5 A;  5B66 U;  3GDX A;  3MR5 A;  1ZQT A;  4BWJ A;  4ECW A;  4J9R A;  4US8 A;  1TK8 A;  5L1K A;  1OW5 A;  3OVS A;  4Y2U A;  4Y2S A;  3BQ0 A;  2ZHA A;  1B4F A;  1KFS A;  3H0L B;  4WC4 A;  4LZD A;  4Y2V A;  3J81 j;  4NXU A;  4JV1 A;  2ASD A;  1IXR A;  4JUZ A;  4UAY A;  1COK A;  4O3S A;  1Z4N A;  4UAS A;  2OXO A;  5L1L A;  3N4M B;  1ZQB A;  4YN4 A;  4ECU A;  4EYH B;  1S5L U;  3HWT A;  4M2Y A;  1JIH A;  1ZQN A;  4X4Q A;  3M9N B;  4KLG A;  8ICY A;  2R8I A;  4UAZ A;  3TQ1 A;  5KFU A;  9ICC A;  2XIC A;  2K8A A;  4PGY A;  3KFU F;  3OWG A;  4PPX A;  2JZB A;  2R8K A;  2NRZ A;  2MUT A;  4HX0 A;  2WAQ F;  1TAU A;  2LM1 A;  3TAQ A;  3MR6 A;  3H8W A;  3L5K A;  3RFA A;  3GIL A;  8ICR A;  1NK0 A;  2OCE A;  4ELT A;  4B9N A;  4BGD A;  1UA1 A;  3ORY A;  3JPP A;  4YR2 A;  3FDS A;  4UD5 A;  4KLI A;  2E3T A;  1DRG A;  3WKC A;  1R8A A;  2YB4 A;  3VCB A;  2ZJ8 A;  2EH9 A;  5ALK A;  2JR5 A;  3HW8 A;  5DBC A;  2YTU A;  4PHD A;  1FIQ A;  5KNI A;  3D6J A;  5AI0 A;  4O3P A;  1TK5 A;  2KZM A;  4P0P A;  4FH3 A;  3RAQ A;  3PY8 A;  4B9U A;  4O67 A;  4F72 A;  3C2K A;  4DFD A;  2NRV A;  2RLT A;  1S0O A;  4JB3 A;  2ZIX B;  4FHV A;  5DG7 A;  2ZH4 A;  2HHX A;  3M6K A;  3HIL A;  1TE2 A;  3UMB A;  4EX6 A;  3OPX A;  1Q3U A;  2FMQ A;  2LBO A;  1BPB A;  1TK0 A;  3H4D A;  1O03 A;  4YXM A;  4O3N A;  1FO4 A;  3SEN A;  4EBC A;  4UAR A;  3PST A;  4WC0 A;  2L5Y A;  3MR2 A;  3R9K A;  1ZQL A;  1XO1 A;  2ZXH A;  2FMS A;  5HRL A;  5ALR A;  2HVI A;  5KFH A;  3ISD A;  4MFC A;  5HRD A;  9ICX A;  2ZH8 A;  4EZ9 A;  4IRK A;  3LDA A;  4K9B A;  4DSE A;  1D8Y A;  4R64 A;  4C7Z A;  2HBJ A;  3HJ1 A;  2VJ5 A;  1X9W A;  4EEL A;  4R63 A;  1B0X A;  2WTF A;  2C2E A;  7ICP A;  1IG6 A;  1UA0 A;  1KFT A;  4TUP A;  5KL1 B;  3JPN A;  2K8B B;  3UQ0 A;  2B0C A;  2Y0S C;  4F8R A;  2HI0 A;  3LQC B;  4R66 A;  8ICZ A;  3FM9 A;  2JEI A;  3RB0 A;  5HMM A;  4O3M A;  2M2V A;  5KFA A;  1U4B A;  2YML A;  4RNN A;  2G0A A;  4X4P A;  4EEY A;  2BPC A;  4K9A A;  1UT8 A;  8ICW A;  5EOZ A;  4B9M A;  4CF5 A;  2W9B B;  1BNO A;  1ZQW A;  5KAI U;  3UQ2 A;  4OAI Z;  4NLC A;  2RP5 A;  5JUM A;  5IIO A;  1SIJ A;  2W43 A;  4J9S A;  2HHU A;  5C0Y A;  1JRO A;  1X42 A;  5KFD A;  4QWE A;  4LZG A;  9ICG A;  4EED A;  1CEZ A;  4ICA A;  9ICL A;  4Y2T A;  4B9T A;  1N60 A;  3QXG A;  2LYA A;  2K89 A;  2QB0 B;  3AU2 A;  2GH1 A;  1K1S A;  5CEH A;  4DOA A;  2E1E A;  1SV0 C;  5BOL A;  4RPY A;  4KM5 A;  4OAF A;  5KG1 A;  1ZQV A;  3Q8S B;  4ECV A;  3OSN A;  4EGW A;  4F93 B;  2AGO A;  4FZL A;  7ICK A;  7ICV A;  3C1Z A;  4QWB A;  3M8S A;  1DGJ A;  4QIW F;  3RJH A;  3RJF A;  4TQR A;  4WC2 A;  4NM2 A;  4J9O A;  4I2I A;  2C28 A;  3FAH A;  1ZQC A;  3L9D A;  1RG6 A;  2W7O A;  2PBE A;  2WF8 A;  5AIA A;  5KFT A;  1U47 A;  2WFA A;  4DL2 A;  2G07 A;  8ICP A;  5KL8 B;  1K1Q A;  5KFC A;  1UCV A;  9ICH A;  3K1R B;  1KDH A;  2BQR A;  3AQF A;  4OJL A;  3WKE A;  2J6U A;  4DQR A;  1NK9 A;  2OHF A;  5DDY A;  1J2M A;  1FFV A;  4I2E A;  2ZH3 A;  3JCF A;  3SEI A;  3BS5 B;  5ALD A;  2QKQ A;  1KNY A;  3M7D A;  5HML A;  1V85 A;  3AU6 A;  3B0X A;  4LEZ A;  1ZQG A;  3OUY A;  2JV3 A;  4UBB A;  2EZZ A;  5AKJ A;  3ZDA A;  1L3T A;  4B9S A;  3RBE A;  5KTQ A;  3OTQ A;  2B51 A;  1QQ7 A;  3OJS A;  3NUQ A;  2M2T A;  4YQW A;  3MDC A;  1B43 A;  3RB3 A;  4LJX A;  2I1Q A;  2ODG A;  4EEN A;  4DSI A;  3MCR A;  4QJF B;  1GO3 F;  4NM1 A;  3OHA A;  3N28 A;  4YFK A;  2V4R A;  2F8L A;  4PHP A;  3K4G A;  5AHX A;  2BQ3 A;  2O1P A;  4IC9 A;  3QUB A;  2CN1 A;  3F2B A;  3BS7 A;  3RJK A;  2BKE A;  3IV6 A;  2E1F A;  3RRH A;  2BPG A;  1RYU A;  3QU2 A;  4EEK A;  1S97 A;  2ALZ A;  2I9G A;  5KFW A;  2LPE A;  4XA5 A;  1N63 A;  4QW9 A;  2JHD A;  5CFU A;  4M04 A;  1DK2 A;  3HIY A;  4AT7 A;  1TAQ A;  2KIC A;  5D63 A;  3N7S C;  1VDV A;  4AYB F;  4FHP A;  2P35 A;  5J2J A;  2A3V A;  1OU5 A;  1X6J A;  2DGZ A;  4QWC A;  3H3A A;  4E7X A;  1SWV A;  1SXE A;  3SV3 A;  4ACO A;  2ASL A;  3JZ0 A;  1JAJ A;  4DL3 A;  2EAM A;  4KLM A;  2MAX A;  5CHG A;  4PJ0 U;  4Z6F A;  4KLD A;  3QU5 A;  1X2I A;  2ZH9 A;  2ZH2 A;  4PZN A;  5AIB A;  2FJ6 A;  4DFK A;  1QLN A;  5ALX A;  4QZC A;  3BQT A;  4JMU A;  8ICH A;  2H5X A;  5DB9 A;  4PHE A;  4WOY A;  5C5J A;  3PO4 A;  3Q8Q B;  2XVT A;  1RDF A;  4C4R A;  4R65 A;  3BS5 A;  4DQP A;  4OO1 J;  1HJP A;  2IOF A;  5EWE A;  3PHZ A;  4J9L A;  2G06 A;  1N61 A;  5CB1 A;  2G5H B;  1RM6 C;  1SV4 A;  2LMR A;  5DG9 A;  3IN5 A;  3RTV A;  4UAT A;  5AKH A;  3PVX A;  3LWL A;  4KTQ A;  5D46 A;  1L8O A;  4ED7 A;  2BCV A;  5DB8 A;  2PMZ C;  1ZD4 A;  2RFF A;  1WG8 A;  1ZQ1 C;  4J9M A;  5ALQ A;  5DGA A;  3ZDC A;  8ICC A;  3N97 B;  3RAX A;  4M9J A;  4JK1 A;  4O3Q A;  2PI4 A;  1ZQO A;  4XUS A;  1JMS A;  1J97 A;  3EF2 A;  1HIW A;  2EAP A;  1T8E A;  3UXN A;  3C5F A;  2XO7 A;  2ESE A;  1C20 A;  2BDP A;  3MFI A;  1BGX T;  4RQM A;  2VIX A;  5AI5 A;  4K97 A;  2DKZ A;  3PSF A;  3KHH A;  4RNM A;  2EAO A;  2HBL A;  2UVV A;  2KTQ A;  5AK6 A;  3OV7 A;  4Q45 A;  2W3R A;  3JPQ A;  4C8M A;  5G5G A;  4NV0 A;  1L5U A;  2ZJA A;  3HRD D;  5AM1 A;  1YZ7 A;  5DEC A;  4QZB A;  8ICI A;  8ICA A;  2ZH1 A;  3V6J A;  5KG7 A;  3NKU A;  1Q46 A;  2KMD A;  1MC8 A;  9ICJ A;  3WK4 A;  3SZ2 A;  3RR7 A;  4IL6 U;  2RDI A;  1MQ2 A;  3MAB A;  3C2M A;  3F5A A;  2PI5 A;  4NY8 A;  3PSP A;  3UXP A;  2DQN B;  4JV0 A;  2YX8 A;  1PVQ A;  2ZHB A;  1S76 D;  1PZN A;  4EZ6 A;  4AT9 A;  4I2J A;  4Y2Q A;  1KBU A;  1JAL A;  2K4P A;  2A1J B;  4RNO A;  3IRU A;  2WHE A;  1UEU A;  2WB1 C;  5KFQ A;  1Q3V A;  5F9L A;  4QWD A;  4MKP A;  3V72 A;  3ETL A;  8ICE A;  5J2K A;  5B5E U;  2QAR A;  2HHV A;  2KFZ A;  2ID1 A;  4M6W B;  1Y88 A;  4N7R A;  1SL2 A;  4YMM A;  2AXT U;  3GU3 A;  1D9D A;  4K8V A;  5J2C A;  2DPI A;  1XU4 A;  5B3Q A;  5DED A;  2W3S A;  3M1Y A;  4QZG A;  2W04 A;  3FYH A;  3SAH A;  5ALM A;  4AT7 B;  1JXL A;  2NRX A;  1K5O A;  4BWM A;  4UW9 A;  2GO7 A;  2KSO B;  2QB1 A;  3QU7 A;  9ICF A;  4M0A A;  4PH5 A;  2W9M A;  2PFO A;  5B3P A;  5ALL A;  1ZXI A;  1ZQR A;  4GFJ A;  5G5H A;  4FZM A;  5DKW A;  2I6X A;  1ZQQ A;  4OD0 A;  3QYP A;  2BGW A;  2PFN A;  5J2H A;  2MRL A;  3SV4 A;  2RDJ A;  5AK3 A;  2J6T A;  2HOI A;  3VC8 A;  2H3Z A;  2XY7 A;  4K4H A;  3I1Y A;  3LVW A;  4KN7 A;  2YMQ A;  3V7J A;  4C8O A;  3QEB Z;  1TAM A;  2DPJ A;  4LEV A;  4YR0 A;  5DGB A;  2ZIU A;  1FFU A;  1EXN A;  2WF5 A;  5ALI A;  4KMU A;  4KIT B;  1WYG A;  3ICX A;  4YD2 A;  5AKG A;  3OHB A;  2MUT B;  4E8F A;  5KFJ A;  2K4H A;  2VA8 A;  4I28 A;  2F1I A;  1JRP A;  1ZOL A;  4O9M A;  2F8K A;  2EWR A;  3NRW A;  5AM2 A;  4B9L A;  2KNJ A;  4LEY A;  1L3U A;  1LKY B;  1U49 A;  4Y2X A;  4WC1 A;  4IRC A;  3JPO A;  3MDA A;  1V38 A;  5CFS A;  2DR7 A;  1XSN A;  2IBK A;  1Z00 A;  2KG5 A;  2A19 A;  3IDW A;  2E8M A;  3WKD A;  3IP4 B;  3F5E A;  4PGQ A;  4K96 A;  1KW4 A;  3NTU A;  1SXD A;  5DB7 A;  1V9P A;  4ATB A;  2R8G A;  4DSF A;  3F53 A;  5J0R A;  4Y2P A;  4UBC A;  4ZOH C;  1D8B A;  3WK9 A;  5EWF A;  1T4G A;  5L9X A;  1ZQM A;  2KJ5 A;  3NVV A;  5DB6 A;  2ZUB A;  4NXZ A;  4KLQ A;  3TFS A;  2KVC A;  1S8O A;  4UD4 A;  2YMM A;  5DLF A;  4M9G A;  5CA7 A;  4IQW A;  2EQY A;  2F2A B;  3SYZ A;  1JUD A;  5KFR A;  2ZH6 A;  3WK8 A;  5KG0 A;  5L1M A;  4LEW A;  4M6W A;  2O5A A;  4ZH4 A;  2JEF A;  4CDG A;  4X4O A;  4Z6C A;  7ICH A;  4RT2 A;  5J0T A;  1WWV A;  1SZP A;  2NRT A;  4RQ7 A;  4O69 A;  5KAF U;  5KFL A;  5GTI U;  1ZQS A;  7ICO A;  3D2S A;  5HRH A;  4YR3 A;  4DF8 A;  4IR9 A;  4C4S A;  2HOQ A;  1TFR A;  1X9S A;  2Y1J A;  3T79 A;  3B0Y A;  2DR8 A;  2KEY A;  2ZTD A;  4I2G A;  4DOB A;  3RJG A;  5KT4 A;  3GII A;  2E5S A;  3DDH A;  2IHO A;  4FZN A;  4QW8 A;  3RB4 A;  4F2R A;  8ICT A;  2KFN A;  1MN8 A;  2RRD A;  4S3N A;  5AI9 A;  3RJE A;  3QZ8 A;  3PR4 A;  5ALE A;  1UT5 A;  1MIW A;  1VFG A;  3TAD A;  1BNP A;  2KHQ A;  1A77 A;  1N2X A;  5HP4 A;  4ELV A;  4HAI A;  3K7D A;  2FCL A;  4IQT A;  3QNM A;  4NXW A;  2NV3 A;  1PVR A;  4NL9 A;  4F3O A;  3H39 A;  4UB1 A;  2YMP A;  8ICL A;  3G6V A;  5KFF A;  5A0L A;  3PML A;  4OJ6 A;  5HC9 A;  3PSI A;  5KG3 A;  3EUB 2;  3IHQ B;  2F44 A;  2GLE A;  3OVB A;  1L3V A;  5JRT A;  4GC6 A;  1WCL A;  4WCW A;  5J2A A;  4MEX A;  1QQ5 A;  4X4N A;  3M6Z A;  4MF8 A;  2XY6 A;  2BCQ A;  2AQ0 A;  3Q8M A;  2XID A;  4RWP A;  4X4R A;  4WC3 A;  1BPX A;  2B6G A;  4P0P B;  5AK5 A;  3NYB A;  4ECY A;  5ALF A;  1IIP A;  4RQ2 A;  4KX5 A;  2KE7 A;  1JI7 A;  2AHO B;  1WWU A;  4WC6 A;  5F2V O;  1ZRM A;  4JV2 A;  3RJJ A;  2KHV A;  1SZH A;  4UB8 U;  4NL9 C;  4F5P A;  2E8N A;  2DL0 A;  2MA1 A;  4DEZ A;  1QSY A;  3AQL A;  4YMO A;  2HHQ A;  4Y2R A;  1NK4 A;  3E2E A;  4GC7 A;  1A6S A;  4E80 A;  1OUQ A;  4YG2 A;  4O3O A;  1NKE A;  3BQ2 A;  3Q8P B;  3SD7 A;  4MFA A;  5AKL A;  5DBA A;  4KLT A;  1NNL A;  3QZ7 A;  4ECQ A;  2IA6 A;  1PUZ A;  7ICS A;  4EBE A;  2IHN A;  4IR1 A;  1IM4 A;  2FI1 A;  4PZO A;  3PW0 A;  4XRH A;  2PMZ F;  1AQ6 A;  4LVS A;  2R8H A;  3T5J A;  1N5X A;  1PK3 A;  2E8O A;  2B4V A;  1LKY A;  4RUC A;  2YQE A;  4UQG A;  3A0H U;  4B9V A;  3MFH A;  3T5K A;  1Q8K A;  2DVI A;  2Y9T A;  5IIM A;  7ICJ A;  7ICU A;  4M9N A;  2KOB A;  1QSL A;  3MR3 A;  2O6K A;  3LK9 A;  3QEA Z;  4ED6 A;  4P4O A;  4GXJ A;  4WJ3 B;  3EW9 A;  5ALJ A;  2M9N A;  3PX0 A;  9ICQ A;  5AKY A;  5TZV A;  2R8J A;  4KLJ A;  3H8J A;  1L7O A;  5CWR A;  1L7P A;  4CF4 A;  4FHX A;  3ZI4 A;  3KOO A;  4ED1 A;  4ELU A;  3ALR A;  3E58 A;  3GZF A;  4QIW C;  1PVP A;  1A0P A;  5CR0 A;  8ICQ A;  5KFK A;  3PX4 A;  5J2E A;  5ALG A;  2AQ4 A;  1H38 A;  3B9J A;  4UB5 A;  2RHF A;  3RF9 A;  3KZI U;  4I29 A;  5HRK A;  3HT3 A;  2A1A A;  1ED1 A;  4F2S A;  8ICF A;  4IS7 A;  2Q0Z X;  4F91 B;  3M9O B;  1KRP A;  1PX5 A;  2JEG A;  2EDU A;  3TI0 A;  3L3F X;  2M2W A;  1Z4O A;  4X0B A;  4NXV A;  2HHW A;  3RR8 A;  2OYY A;  2ZTE A;  3OVA A;  7ICN A;  3TKA A;  2JH1 A;  2P6R A;  1PK1 A;  2C22 A;  2HN2 A;  3EZ5 A;  2KP7 A;  2BCS A;  5AKX A;  4QZF A;  5J0P A;  4CCH A;  4O6A A;  2DFL A;  2HN1 A;  2QAR B;  2IHM A;  4A8E A;  3CNH A;  2CPR A;  4NWI A;  3GV8 B;  4XJE A;  3WK5 A;  7ICG A;  1T94 A;  3JPR A;  4FE3 A;  4DL4 A;  4NXX A;  3BZK A;  4RQ4 A;  4DSL A;  4MHV A;  4O5E A;  3T3F A;  1ZQU A;  4DLG A;  4DFP A;  4KLE A;  4LT6 A;  5D61 A;  1T3Q A;  5KFY A;  1DGS A;  4ECZ A;  4PL2 A;  1R8C A;  2ZJ5 A;  5AM4 A;  2H3Q A;  3BJY A;  4C4T A;  3S6J A;  1ZYQ A;  3KTQ A;  4K98 A;  4QWA A;  1S10 A;  4RWQ A;  2D8C A;  4BX9 C;  4BXO B;  1UQV A;  3UPQ A;  4F4Y A;  5BOM A;  2ES6 A;  4U7C A;  2PFQ A;  3C23 A;  2W03 A;  3C29 A;  2KZZ A;  1U45 A;  4OCZ A;  3H0M B;  5HHH A;  3NVZ A;  1S0N A;  2IOF K;  2D6F C;  9ICN A;  1DOQ A;  2ZG6 A;  2OM6 A;  1JXE A;  1SKW A;  4C0Z A;  2ZIU B;  3DEE A;  4RQ6 A;  2QB0 A;  4F5Q A;  1L6N A;  1O08 A;  2ZH7 A;  4X4S A;  2GWS A;  3Q8K A;  2UVU A;  5KFI A;  2G09 A;  4O5C A;  9ICK A;  4F92 B;  3PR5 B;  4RU9 A;  5E79 U;  1NOM A;  4F5O A;  2JGA A;  5AM3 A;  7ICQ A;  3ER8 C;  4EEB A;  2VKQ A;  5ALP A;  1TFW A;  1WCN A;  1N48 A;  4X5V A;  4RWN A;  5DQI A;  3PW4 A;  1TV9 A;  4P4M A;  2FPL A;  8ICV A;  2W9C B;  1TFY A;  4KLS A;  4ECT A;  5EE1 A;  1ZJN A;  2H3V A;  1SGG A;  4QZD A;  1UET A;  3MGH A;  2V9W A;  5F3X B;  5GTH U;  1SV0 A;  1ZRN A;  1HEK A;  2BR0 A;  3NS1 A;  2F76 X;  3TAD C;  4RQ1 A;  4ECS A;  2KZ3 A;  4OAH A;  2F1H A;  3ZD9 A;  1RQN A;  3HJE A;  2PFP A;  1S9F A;  1V4A A;  5KFO A;  1GPJ A;  2Q4T A;  3GV7 B;  4QZH A;  1D8L A;  1XS9 D;  4ED3 A;  1UEV A;  2W11 A;  2ZUC A;  4FHY A;  1NZP A;  4J9N A;  1ZQJ A;  2CRX A;  2VA3 A;  3AEV A;  4O68 A;  3NAS A;  2LI6 A;  2UVW A;  2DRA A;  2H3I A;  4K4G A;  3WKB A;  1ZQH A;  1RQL A;  1U48 A;  1UPH A;  5AI4 A;  5JTG A;  1R89 A;  5J8Y A;  4WBY A;  2YY6 A;  2AGP A;  3NGD A;  4NLB A;  2ZIX A;  5KFM A;  9ICE A;  3T5H A;  5CFT A;  1X66 A;  5KFB A;  2W9C A;  5JU5 A;  2FLL A;  1COO A;  2VJ4 A;  2BBH A;  2W54 A;  4Y2J A;  1L3S A;  2HHS A;  3KHL A;  2CXY A;  3SAG A;  2LM4 A;  3D2N A;  3QUQ A;  2DKX A;  2WAQ C;  1RZT A;  3FC4 A;  4RQ5 A;  3RH6 A;  4O3R A;  4O0I A;  3OSP A;  1NK5 A;  3G6Y A;  3HPO A;  4X4V A;  3KD3 A;  4CNQ A;  4KN4 A;  5HR7 A;  1C7Y A;  5KFX A;  4ED0 A;  3NRZ A;  5IIK A;  4NXT A;  3H37 A;  2DR5 A;  4FHW A;  3I28 A;  5AKI A;  4Q44 A;  1HUO A;  2NO4 A;  4RQ3 A;  9ICM A;  3WFS C;  1KTQ A;  5HHI A;  5DLG A;  4J9P A;  3WFR E;  4DCC A;  8ICU A;  2JH7 A;  4YCX A;  3RBD A;  4RQ8 A;  4PGX A;  3WFP A;  2K4E A;  4G9B A;  2B56 A;  4P0Q B;  1TKD A;  3M8R A;  1QTM A;  4DQQ A;  2Q66 A;  2OEH A;  4OJO A;  2AGQ A;  1SL0 A;  4QZ8 A;  3GIK A;  1XSP A;  5KT6 A;  2KKP A;  1ZQI A;  1CRX A;  3JPS A;  3C2L A;  1NKC A;  5ALU A;  4I2A A;  4C8L A;  2XCA A;  1KN5 A;  4Q8F A;  1QCK A;  4BDP A;  2G08 A;  4GXK A;  1ZJM A;  1DXS A;  2ZUD A;  2ZIV A;  2KIV A;  4RQN A;  4I2C A;  5KG6 A;  1KEJ A;  4O5K A;  5CP2 A;  2ASJ A;  1JN3 A;  5KG4 A;  1VJ7 A;  1UHU A;  2HSZ A;  4CF3 A;  5J2F A;  5ALW A;  8ICX A;  1DK3 A;  1RYR A;  2VA2 A;  3ER9 B;  5AKZ A;  3CRX A;  1NK6 A;  1X40 A;  2ATL A;  2ZIW A;  3TAC B;  3F2D A;  3Q8R B;  2UVR A;  1NK7 A;  3GV5 B;  3V6K A;  2BE3 A;  2ZXI A;  1XNS A;  4Z6E A;  2B21 A;  5KT7 A;  4NKT A;  4X4T A;  5HRE A;  3K75 D;  1L7N A;  1F5A A;  4USA A;  5KFG A;  3QUC A;  1KLN A;  2K8C B;  5HRI A;  4WQL A;  2YN4 A;  4F5N A;  3H8M A;  2PXI A;  3UMC A;  2WB1 F;  4C8K A;  4P2H A;  5ALN A;  1ARO P;  1NO5 A;  9ICU A;  4FFD A;  3MGI A;  4ECR A;  1ZD5 A;  1QSS A;  4F4X A;  3UPS A;  3H4B A;  3RB6 A;  3KBB A;  1N56 A;  5J0Y A;  2FDR A;  1KSP A;  2Y0S F;  2W9A A;  4AT9 B;  3C21 A;  2DWQ A;  5IIN A;  8ICS A;  5J0O A;  4NJ8 A;  4I0U A;  2IUB A;  1CUK A;  4FBU A;  2WF6 A;  2I5H A;  3GIM A;  3TFR A;  5KT2 A;  4R8U A;  4PHA A;  5J2G A;  2QLT A;  1F44 A;  1ZQZ A;  3H38 A;  5KFP A;  1ZQP A;  4P0Q A;  4Q8E A;  4ECX A;  2NRW A;  2AH5 A;  4FBT A;  2EZX A;  1XO0 A;  4KB6 A;  2XI9 A;  3C5G A;  3SR6 A;  3M9M B;  3ZDD A;  2FE9 A;  2XGQ A;  5H2F U;  1Z00 B;  1NKB A;  2XY5 A;  5J0Q A;  1MQ3 A;  1URJ A;  4QZA A;  1U9L A;  4DQS A;  3JPT A;  8ICG A;  2K4I A;  1F5S A;  3QU4 A;  2BCR A;  4UAV A;  5KFE A;  1ZQA A;  4NLG A;  3QE9 Y;  2KJ9 A;  2HHT A;  1KQQ A;  3ISB A;  1LV5 A;  2DBY A;  2W55 A;  3ERC C;  3H7I A;  1QQ6 A;  3H8S A;  2BZF A;  4XQ8 A;  4EYI B;  1ZQY A;  2FLN A;  3GIJ A;  5KFV A;  2FLP A;  5ALY A;  5III A;  2BHN A;  3HP6 A;  4NLZ A;  4YD1 A;  1NK8 A;  5K4L A;  1HUZ A;  9ICO A;  1P7D A;  1SKS A;  5J0X A;  8ICO A;  7ICF A;  3QUT A;  1PK1 B;  4DSJ A;  7ICE A;  3MC1 A;  3KHR A;  4CGZ A;  2W9B A;  1BPZ A;  3RJI A;  4GXI A;  4X0A A;  5DG8 A;  8ICM A;  3WK6 A;  1MIV A;  3LYS A;  1NI3 A;  4I2D A;  8ICN A;  2R18 A;  2KD1 A;  1B22 A;  4Y2Y A;  2BPF A;  5BPC A;  2J6S A;  1NJW A;  4YVZ A;  1ZQD A;  4GLX A;  5DBB A;  2W8L A;  1SKR A;  4DS4 A;  1N62 A;  3SAF A;  2BQU A;  3TAP A;  4F5R A;  3H40 A;  4OJP A;  2IOH A;  2BBJ A;  5AI6 A;  1ZD2 P;  2DR9 A;  2MU2 A;  2ZTC A;  2ZIW B;  3KKA A;  5KFN A;  2C2R A;  3NVW A;  3KZX A;  4YMN A;  3PMN A;  5KG2 A;  4TQS A;  3UMG A;  5J0U A;  1N5W A;  1FA0 A;  2XGP A;  9ICV A;  4CE6 A;  3MGV A;  1LVH A;  3OUY B;  2MSN A;  3H0R B;  2NYV A;  2WF7 A;  3CP8 A;  4KLL A;  5AK4 A;  1OXJ A;  1BVS A;  4X4U A;  4BXO A;  3PW7 A;  3ZDB A;  4WH5 A;  2HMX A;  3I76 A;  4JLZ A;  1S77 D;  3CYM A;  1V97 A;  4YXJ A;  2HW3 A;  4UB6 U;  2W8K A;  3BZC A;  4E0D A;  1VJ5 A;  2FPM A;  2BCU A;  5AM5 A;  1VLB A;  2IMW P;  3THV A;  3AQN A;  1L8L A;  2KK0 A;  4F71 A;  4TUQ A;  2ZIV B;  4QZ9 A;  4WC5 A;  4C7Y A;  5IIL A;  3V6H A;  1ZET A;  4ED2 A;  5EE3 A;  4DF4 A;  4I27 A;  1D9F A;  2FMP A;  4US9 A;  3EPI A;  1FEZ A;  1ZQX A;  3HX0 A;  4CRX A;  5IIJ A;  3IM1 A;  2F77 X;  3IG5 A;  4I2F A;  3NVY A;  4HYK A;  4U6P A;  3TAR A;  4BJQ A;  1ZQE A;  1YLQ A;  2AJQ A;  2K60 A;  3ETR A;  3EWA A;  4YP3 A;  3AUO A;  1ZD3 A;  2ISP A;  4AT8 A;  3E0F A;  5ALV A;  3PV8 A;  5HRB A;  4RWO A;  2C2D A;  4J9Q A;  5CHE A;  4C8N A;  5ALO A;  2LYH A;  1NJZ A;  5HR9 A;  1MA7 A;  1X9M A;  2JMG A;  4DWI A;  2M2U A;  4FS2 A;  4IQU A;  4TUS A;  2VAN A;  4DFJ A;  3T5L A;  4IRD A;  3WU2 U;  4OJ5 A;  4FO1 A;  2KKV A;  1JQR A;  3KHG A;  5HNK A;  3NWI A;  3SI8 A;  5KT3 A;  1ZQK A;  1SL1 A;  4KLO A;  2KSO A;  4DQI A;  2NO5 A;  3C18 A;  1Z3E B;  4I2H A;  2E8P A;  3UXO A;  3IG8 A;  4RPX A;  3EPG A;  4M5D A;  5J2I A;  3AQK A;  3SMV A;  2F3N A;  2DUY A;  4DLE A;  5J2B A;  3PNC A;  2HOF A;  4KLF A;  4JLX A;  2ISO A;  2PKE A;  2P6U A;  3PO5 A;  3AL0 B;  3ED5 A;  1XWL A;  3AMZ A;  4RQ0 A;  1BPY A;  2D3D A;  4KLU A;  4BUG A;  1WUD A;  5D62 A;  4M9H A;  2GAF D;  2HDO A;  4KLH A;  2FPK A;  3PX6 A;  7ICT A;  4QZI A;  5CRX A;  4RPZ A;  3V7L A;  7ICR A;  5EE0 A;  1IV8 A;  9ICA A;  3ZDE A;  2HBK A;  1A76 A;  2JXJ A;  4AP9 A;  4NKU A;  4DL6 A;  3PW5 A;  3BQ7 A;  3SQI A;  5ALT A;  3OGU A;  3WKA A;  1J2N A;  2KJ8 A;  2N1R A;  4NLK A;  4IG8 A;  2Y9U A;  3N7R C;  1WOT A;  5J0W A;  1LB2 B;  4MEY A;  7ICI A;  5TIS U;  5KFZ A;  2XC9 A;  3MBY A;  4DFM A;  4FS1 A;  5J2D A;  2WF9 A;  3D2Q A;  5EE9 A;  1KKX A;  1SWW A;  2W7P A;  3RH5 A;  2V4Q A;  2OH2 A;  3C28 A;  4EP7 A;  4DS5 A;  4M47 A;  2HCF A;  2GA9 D;  5L1J A;  1TVA A;  4RZR A;  3ISC A;  5ALZ A;  1YZ6 A;  5L1I A;  5T14 A;  3Q8L A;  2F1J A;  3QU9 A;  2OWO A;  4GIB A;  9ICT A;  4WBZ A;  3U26 A;  1X9X A;  5HRF A;  8ICJ A;  2KV2 A;  2Z7J A;  3F2C A;  3TAN A;  5HRG A;  9ICP A;  5J8Y C;  1L7M A;  5ALS A;  1JX4 A;  4UB2 A;  1MSW D;  5KFS A;  1M6Y A;  4G3I A;  1NJX A;  4K99 A;  4RUA A;  1Z1B A;  2JZB B;  2LHT A;  2Y1I A;  1T7P A;  4NLN A;  4MF2 A;  4QZE A;  1RXW A;  1XSL A;  3PZP A;  2KVS A;  3A0B U;  1Z19 A;  4K4I A;  4M9L A;  1Q78 A;  5EWG A;  1BPD A;  4AT8 B;  5CJ7 A;  4EV6 A;  3V7K A;  3KKA C;  1Z1V A;  2EZY A;  3ZD8 A;  3OJU A;  3PW2 A;  4JWM A;  2KIW A;  3CK6 A;  1BPE A;  2P66 A;  4C80 A;  2HHP A;  3EYZ A;  2DF4 B;  4UAU A;  3WK7 A;  9ICW A;  3C1Y A;  1RXV A;  5ALH A;  4UB4 A;  4DSK A;  2LKY A;  5AKK A;  5J0S A;  3C66 A;  4EBK A;  1ZQF A;  4F50 A; 
#chains in the Genus database with same CATH homology
 9ICU A;  9ICI A;  4R8U B;  5J29 A;  2XCP A;  4LVS A;  9ICS A;  2R8H A;  3MGI A;  3T5J A;  2ZH5 A;  4ECR A;  4DFK A;  5DQH A;  1QSS A;  2JEJ A;  4DL7 A;  4F4K A;  4F4X A;  4RUC A;  3UPS A;  1QLN A;  4UQG A;  5D49 A;  3H4B A;  3RB6 A;  4QZC A;  3BQT A;  1N56 A;  4B9V A;  3MFH A;  3T5K A;  5J0Y A;  8ICH A;  2DVI A;  1KSP A;  5IIM A;  2H5X A;  5DB9 A;  4PHE A;  3RRG A;  7ICJ A;  2ID1 A;  1XC9 A;  5C5J A;  7ICU A;  4M9N A;  2NRK A;  2W9A A;  3PO4 A;  4AT9 B;  3Q8Q B;  3C21 A;  4ED8 A;  1QSL A;  5IIN A;  8ICS A;  3MR3 A;  3AQM A;  3LK9 A;  3WFO A;  4R65 A;  3QEA Z;  2KN7 A;  4ED6 A;  1RYS A;  5J0O A;  4EBJ A;  4P4O A;  4DQP A;  4GXJ A;  1RPL A;  1KFD A;  1HJP A;  4F4W A;  3RH4 A;  5EWE A;  4RT3 A;  1CUK A;  4EBD A;  3EW9 A;  4J9L A;  2M9N A;  4UAW A;  4FBU A;  3BDP A;  8ICK A;  3JYY A;  3GIM A;  3PX0 A;  5CB1 A;  3TFR A;  9ICQ A;  5KT2 A;  4R8U A;  4PHA A;  5DG9 A;  5TZV A;  5J2G A;  1S0M A;  2R8J A;  4KLJ A;  3H8J A;  1MIY A;  1R8B A;  3RTV A;  5DDM A;  3PVX A;  5CWR A;  1ZQZ A;  3LWL A;  5D46 A;  5KFP A;  4UB3 A;  4KTQ A;  7ICM A;  1ZQP A;  3H38 A;  4ED7 A;  4Q8E A;  4ECX A;  2NRW A;  2BCV A;  4FHX A;  5DB8 A;  4FBT A;  2RFF A;  4ED1 A;  4XQ7 A;  4ELU A;  4Q43 A;  4J9M A;  4JWN A;  1S0V A;  5DGA A;  3ZDC A;  8ICC A;  5D4B A;  3N97 B;  3C5G A;  3RAX A;  5CR0 A;  4M9J A;  8ICQ A;  4FH5 A;  3M9M B;  5KFK A;  3ZDD A;  4JK1 A;  2DRB A;  4O3Q A;  3PX4 A;  5KT5 A;  5J2E A;  2XGQ A;  4MFF A;  1Z00 B;  7ICL A;  1NKB A;  2XY5 A;  4DOC A;  2AQ4 A;  1H38 A;  5J0Q A;  1MQ3 A;  4UB5 A;  1ZQO A;  2PI4 A;  4XUS A;  4QZA A;  1U9L A;  1JMS A;  3JPT A;  4DQS A;  4I29 A;  3LWM A;  5HRK A;  3HT3 A;  8ICG A;  1T8E A;  3UXN A;  3C5F A;  4F2S A;  8ICF A;  2XO7 A;  4J9K A;  2Q0Z X;  4F91 B;  3G6X A;  2BCR A;  2BDP A;  4Z6D A;  3MFI A;  1BGX T;  3M9O B;  1KRP A;  1PX5 A;  2JEG A;  5KFE A;  1ZQA A;  5DQG A;  4I2B A;  4NLG A;  3QE9 Y;  2A1J A;  3TI0 A;  2HHT A;  3KHH A;  2M2W A;  4P4P A;  4ATB B;  3ISB A;  1LV5 A;  3WFQ E;  4RNM A;  3GFK B;  2UVV A;  4TUR A;  1T3N A;  2KTQ A;  3H7I A;  3H8S A;  3OV7 A;  4X0B A;  5F9N A;  4Q45 A;  4XQ8 A;  2HHW A;  5KG5 A;  4FO6 A;  3JPQ A;  4EYI B;  4C8M A;  1L5U A;  1ZQY A;  2FLN A;  3RR8 A;  2ZJA A;  4DL5 A;  1NJY A;  2ZTE A;  3OVA A;  7ICN A;  4DO9 A;  2P6R A;  2HVH A;  2AU0 A;  9ICB A;  3GIJ A;  5KFV A;  2FLP A;  2C22 A;  5III A;  5DEC A;  2BHN A;  3EZ5 A;  9ICR A;  1Q79 A;  3HP6 A;  4WC7 A;  4NLZ A;  4QZB A;  2BCS A;  3BQ1 A;  4YD1 A;  2KP7 A;  8ICI A;  4F4Z A;  8ICA A;  8ICB A;  2ZH1 A;  3V6J A;  1NK8 A;  5KG7 A;  4QZF A;  1HUZ A;  3GQC A;  5J0P A;  4CCH A;  9ICO A;  3HJ4 A;  2DFL A;  4IQV A;  3GDX A;  1SKS A;  1MC8 A;  5J0X A;  3MR5 A;  9ICJ A;  3SZ2 A;  3RR7 A;  8ICO A;  2RDI A;  7ICF A;  1MQ2 A;  1ZQT A;  3MAB A;  3C2M A;  4BWJ A;  2IHM A;  2PI5 A;  4ECW A;  4J9R A;  4DSJ A;  4NY8 A;  7ICE A;  3UXP A;  1TK8 A;  3KHR A;  3GV8 B;  5L1K A;  3OVS A;  2W9B A;  3BQ0 A;  4JV0 A;  3RJI A;  1BPZ A;  2ZHA A;  1KFS A;  2ZHB A;  1S76 D;  4GXI A;  4X0A A;  1PZN A;  4EZ6 A;  4WC4 A;  5DG8 A;  4LZD A;  4AT9 A;  8ICM A;  7ICG A;  1MIV A;  4JV1 A;  4I2D A;  1IXR A;  2ASD A;  3JPR A;  8ICN A;  4JUZ A;  4I2J A;  4UAY A;  4O3S A;  4DL4 A;  2A1J B;  4RNO A;  1UEU A;  1B22 A;  2BPF A;  5KFQ A;  5BPC A;  5F9L A;  4QWD A;  4RQ4 A;  5L1L A;  4DSL A;  3N4M B;  2J6S A;  3V72 A;  1ZQB A;  4O5E A;  4YN4 A;  3T3F A;  1ZQU A;  4ECU A;  1NJW A;  4DLG A;  4YVZ A;  1ZQD A;  4GLX A;  4DFP A;  4EYH B;  5DBB A;  3ETL A;  2W8L A;  5J2K A;  3HWT A;  4M2Y A;  1JIH A;  1SKR A;  4DS4 A;  1ZQN A;  4KLE A;  8ICE A;  5KFY A;  3M9N B;  1DGS A;  2HHV A;  4ECZ A;  2KFZ A;  4X4Q A;  2BQU A;  1R8C A;  3TAP A;  4F5R A;  2ZJ5 A;  3H40 A;  4UAZ A;  2R8I A;  4M6W B;  5KFU A;  3TQ1 A;  4KLG A;  8ICY A;  9ICC A;  1Y88 A;  1SL2 A;  3BJY A;  1ZYQ A;  3KTQ A;  4PGY A;  4YMM A;  1NO5 A;  1D9D A;  4QWA A;  1S10 A;  4PPX A;  4RWQ A;  2ZTC A;  5J2C A;  2JZB A;  2DR9 A;  2R8K A;  4O5K A;  2DPI A;  1XU4 A;  2NRZ A;  2MUT A;  4BXO B;  5DED A;  1TAU A;  4QZG A;  5KFN A;  5BOM A;  4F4Y A;  3UPQ A;  2C2R A;  3MR6 A;  3TAQ A;  2PFQ A;  3H8W A;  3C23 A;  2KZZ A;  3GIL A;  1U45 A;  8ICR A;  1NK0 A;  4YMN A;  3PMN A;  3FYH A;  5KG2 A;  4TQS A;  4AT7 B;  5HHH A;  4ELT A;  4B9N A;  1JXL A;  4BGD A;  5J0U A;  1UA1 A;  1S0N A;  1FA0 A;  2NRX A;  3ORY A;  2XGP A;  4BWM A;  9ICV A;  9ICN A;  1DOQ A;  3JPP A;  4YR2 A;  3FDS A;  1NZP A;  4UD5 A;  1JXE A;  1SKW A;  4KLI A;  3OUY B;  1R8A A;  9ICF A;  4M0A A;  2ZJ8 A;  4PH5 A;  2W9M A;  4RQ6 A;  2PFO A;  4F5Q A;  2ZH7 A;  4KLL A;  4X4S A;  2GWS A;  3Q8K A;  2UVU A;  5KFI A;  1ZQR A;  1BVS A;  4X4U A;  3HW8 A;  5DBC A;  4F92 B;  5DKW A;  3PR5 B;  4PHD A;  1ZQQ A;  4BXO A;  4O5C A;  9ICK A;  3PW7 A;  4RU9 A;  3ZDB A;  2ISP A;  1NOM A;  4F5O A;  2BGW A;  2PFN A;  4O3P A;  5J2H A;  1TK5 A;  2KZM A;  7ICQ A;  4FH3 A;  3SV4 A;  1S77 D;  3C18 A;  4AT8 A;  3RAQ A;  3PY8 A;  2RDJ A;  2J6T A;  4YXJ A;  4B9U A;  2HW3 A;  1TFW A;  3C2K A;  2W8K A;  2NRV A;  4E0D A;  2XY7 A;  4K4H A;  1WCN A;  1S0O A;  2FPM A;  1N48 A;  4KN7 A;  3V7J A;  2BCU A;  4C8O A;  4X5V A;  4FHV A;  3QEB Z;  5DG7 A;  5DQI A;  2DPJ A;  2IMW P;  2ZH4 A;  4YR0 A;  2HHX A;  4RWN A;  3THV A;  5DGB A;  3PW4 A;  3AQN A;  1TV9 A;  4P4M A;  2FPL A;  1ZQF A;  2FMQ A;  8ICV A;  2W9C B;  1EXN A;  4KLS A;  3WFR E;  4ECT A;  1TFY A;  1BPB A;  4KMU A;  1TK0 A;  4TUQ A;  3H4D A;  1ZJN A;  4KIT B;  4QZD A;  4QZ9 A;  4WC5 A;  4YXM A;  4YD2 A;  3OHB A;  5IIL A;  3MGH A;  3V6H A;  1UET A;  2V9W A;  4O3N A;  2MUT B;  1ZET A;  4E8F A;  4EBC A;  5KFJ A;  2VA8 A;  4I28 A;  2BR0 A;  4ED2 A;  4WC0 A;  2F1I A;  4RQ1 A;  3MR2 A;  4ECS A;  2KZ3 A;  4DF4 A;  4I27 A;  4O9M A;  1ZQL A;  2F1H A;  1D9F A;  1XO1 A;  3ZD9 A;  2FMP A;  2FMS A;  2VA3 A;  3EPI A;  2PFP A;  5HRL A;  4B9L A;  1ZQX A;  3HX0 A;  5KFH A;  3ISD A;  5IIJ A;  1S9F A;  4MFC A;  2HVI A;  9ICX A;  5KFO A;  5HRD A;  1V4A A;  3IM1 A;  2ZH8 A;  3GV7 B;  1L3U A;  1U49 A;  4EZ9 A;  4IRK A;  4I2F A;  3LDA A;  4QZH A;  4HYK A;  4DSE A;  1D8Y A;  4R64 A;  1D8L A;  1XS9 D;  4ED3 A;  3TAR A;  1UEV A;  1ZQE A;  2ZUC A;  4WC1 A;  3HJ1 A;  1YLQ A;  4IRC A;  2AJQ A;  4FHY A;  1X9W A;  3EWA A;  4R63 A;  3JPO A;  4YP3 A;  2WTF A;  3MDA A;  4J9N A;  3AUO A;  2C2E A;  1UA0 A;  3PV8 A;  4TUP A;  1ZQJ A;  3JPN A;  1KFT A;  2C2D A;  2UVW A;  3UQ0 A;  5HRB A;  4RWO A;  4J9Q A;  2DR7 A;  1XSN A;  4C8N A;  2DRA A;  2IBK A;  4F8R A;  1Z00 A;  3LQC B;  4K4G A;  2LYH A;  4R66 A;  1NJZ A;  8ICZ A;  5HR9 A;  1ZQH A;  1X9M A;  4PGQ A;  4DWI A;  2JEI A;  3RB0 A;  5HMM A;  1U48 A;  2M2U A;  4FS2 A;  3NTU A;  4IQU A;  5KFA A;  1U4B A;  5DB7 A;  4RNN A;  4TUS A;  1V9P A;  2VAN A;  2M2V A;  1R89 A;  4DFJ A;  4WBY A;  4ATB A;  2R8G A;  3T5L A;  4EEY A;  2AGP A;  4X4P A;  2BPC A;  1UT8 A;  3NGD A;  8ICW A;  4DSF A;  5EOZ A;  4IRD A;  4UBC A;  5J0R A;  4B9M A;  5KFM A;  2W9B B;  1BNO A;  9ICE A;  3T5H A;  1ZQW A;  5KFB A;  2W9C A;  1JQR A;  2FLL A;  3KHG A;  3UQ2 A;  5HNK A;  1COO A;  5KT3 A;  5JUM A;  1T4G A;  5EWF A;  3SI8 A;  1SL1 A;  1ZQK A;  5L9X A;  5IIO A;  1ZQM A;  4KLO A;  4J9S A;  2HHU A;  4DQI A;  5DB6 A;  4QWE A;  5KFD A;  2ZUB A;  1L3S A;  4LZG A;  1Z3E B;  4I2H A;  2HHS A;  9ICG A;  3UXO A;  4NXZ A;  3KHL A;  4RPX A;  3EPG A;  3TFS A;  4KLQ A;  4M5D A;  1CEZ A;  4UD4 A;  5DLF A;  4M9G A;  5J2I A;  9ICL A;  3AQK A;  4B9T A;  5CA7 A;  4DLE A;  4IQW A;  5J2B A;  3PNC A;  1RZT A;  4KLF A;  3AU2 A;  1K1S A;  4RQ5 A;  3SYZ A;  4DOA A;  3RH6 A;  4O3R A;  5KFR A;  4O0I A;  2ZH6 A;  2ISO A;  5KG0 A;  2P6U A;  5BOL A;  3OSP A;  4M6W A;  2O5A A;  4ZH4 A;  4RPY A;  1NK5 A;  3G6Y A;  2JEF A;  4X4O A;  3HPO A;  4Z6C A;  3PO5 A;  7ICH A;  5KG1 A;  1XWL A;  5J0T A;  1ZQV A;  4RT2 A;  4X4V A;  3Q8S B;  1SZP A;  2NRT A;  4RQ7 A;  4RQ0 A;  3OSN A;  4KN4 A;  4F93 B;  5KFL A;  4ECV A;  1BPY A;  1C7Y A;  2AGO A;  4KLU A;  7ICK A;  7ICV A;  3C1Z A;  5KFX A;  4ED0 A;  1ZQS A;  7ICO A;  4QWB A;  3M8S A;  4M9H A;  5IIK A;  4KLH A;  5HRH A;  3H37 A;  2FPK A;  4YR3 A;  3PX6 A;  7ICT A;  4FHW A;  2DR5 A;  4QZI A;  4DF8 A;  3RJH A;  3RJF A;  7ICP A;  4IR9 A;  4Q44 A;  1HUO A;  4TQR A;  4RPZ A;  4WC2 A;  4NM2 A;  4J9O A;  4RQ3 A;  1TFR A;  3V7L A;  4I2I A;  7ICR A;  1X9S A;  2Y1J A;  9ICM A;  3WFS C;  2C28 A;  9ICA A;  1KTQ A;  5HHI A;  5DLG A;  3B0Y A;  4J9P A;  2DR8 A;  3ZDE A;  1ZQC A;  3L9D A;  2ZTD A;  8ICU A;  1A76 A;  4I2G A;  2PBE A;  4DOB A;  4YCX A;  3RJG A;  3RBD A;  4RQ8 A;  5KT4 A;  3GII A;  4NKU A;  4PGX A;  5KFT A;  3WFP A;  4DL6 A;  3PW5 A;  1U47 A;  3OGU A;  4DL2 A;  4QW8 A;  3RB4 A;  8ICP A;  4F2R A;  8ICT A;  4NLK A;  4IG8 A;  1K1Q A;  2KFN A;  1TKD A;  4LT6 A;  3M8R A;  1WOT A;  5J0W A;  4S3N A;  3RJE A;  1LB2 B;  5KFC A;  9ICH A;  4MEY A;  3QZ8 A;  7ICI A;  3PR4 A;  1QTM A;  1KDH A;  1UT5 A;  4DQQ A;  1MIW A;  1VFG A;  2Q66 A;  2BQR A;  1BNP A;  2AGQ A;  5KFZ A;  2XC9 A;  3MBY A;  1A77 A;  4QZ8 A;  3GIK A;  4DFM A;  1SL0 A;  5HP4 A;  4FS1 A;  4DQR A;  5J2D A;  1NK9 A;  2J6U A;  4ELV A;  1XSP A;  5DDY A;  5KT6 A;  1ZQI A;  4I2E A;  4IQT A;  3JPS A;  2ZH3 A;  3RH5 A;  3C2L A;  1NKC A;  2V4Q A;  4I2A A;  4C8L A;  1KNY A;  3H39 A;  4F3O A;  4EP7 A;  5HML A;  2XCA A;  4UB1 A;  4DS5 A;  3AU6 A;  4M47 A;  8ICL A;  5L1J A;  1TVA A;  4Q8F A;  4RZR A;  3G6V A;  5KFF A;  3B0X A;  3ISC A;  4BDP A;  5L1I A;  1ZQG A;  3OUY A;  3PML A;  4GXK A;  1ZJM A;  3Q8L A;  5HC9 A;  4UBB A;  2F1J A;  5KG3 A;  2ZUD A;  3IHQ B;  2OWO A;  4I2C A;  9ICT A;  5KG6 A;  1KEJ A;  4WBZ A;  3OVB A;  1L3V A;  3ZDA A;  5CP2 A;  1WCL A;  1JN3 A;  4GC6 A;  2ASJ A;  1L3T A;  4B9S A;  5J2A A;  4MEX A;  5HRF A;  8ICJ A;  3RBE A;  4X4N A;  4MF8 A;  2XY6 A;  3TAN A;  5HRG A;  2BCQ A;  5KTQ A;  2AQ0 A;  9ICP A;  3Q8M A;  3OJS A;  2M2T A;  4YQW A;  5KG4 A;  4RWP A;  1JX4 A;  1VJ7 A;  4UB2 A;  4X4R A;  1MSW D;  5KFS A;  4WC3 A;  4G3I A;  1BPX A;  3MDC A;  1NJX A;  4RUA A;  1B43 A;  5J2F A;  2JZB B;  3RB3 A;  8ICX A;  3NYB A;  2I1Q A;  1RYR A;  2Y1I A;  2VA2 A;  1T7P A;  4ECY A;  4NLN A;  1DK3 A;  4DSI A;  4MF2 A;  4QZE A;  4RQ2 A;  4NM1 A;  3OHA A;  2V4R A;  4YFK A;  2ATL A;  1RXW A;  1NK6 A;  1XSL A;  4PHP A;  3K4G A;  4K4I A;  4M9L A;  3Q8R B;  2BQ3 A;  5EWG A;  1Q78 A;  2O1P A;  4WC6 A;  1BPD A;  2UVR A;  5F2V O;  4AT8 B;  1NK7 A;  5CJ7 A;  3RJK A;  2BKE A;  3GV5 B;  3RRH A;  4JV2 A;  3V7K A;  3RJJ A;  2BPG A;  3V6K A;  2BE3 A;  4F5P A;  1S97 A;  4DEZ A;  2ALZ A;  1QSY A;  2I9G A;  5KFW A;  3AQL A;  4Z6E A;  4WCW A;  4XA5 A;  2B21 A;  3OJU A;  4YMO A;  3ZD8 A;  3PW2 A;  5KT7 A;  4QW9 A;  4JWM A;  2HHQ A;  4NKT A;  4X4T A;  5HRE A;  4M04 A;  1DK2 A;  3HIY A;  1BPE A;  4AT7 A;  2P66 A;  1NK4 A;  1TAQ A;  3E2E A;  3K75 D;  1F5A A;  4GC7 A;  4E80 A;  2HHP A;  4FHP A;  5KFG A;  3EYZ A;  4YG2 A;  5J2J A;  1OU5 A;  4O3O A;  4QWC A;  9ICW A;  3H3A A;  1NKE A;  3BQ2 A;  3C1Y A;  3Q8P B;  1RXV A;  4E7X A;  1KLN A;  4UB4 A;  3SV3 A;  4DSK A;  4MFA A;  2ASL A;  3JZ0 A;  1JAJ A;  5HRI A;  5J0S A;  5DBA A;  4DL3 A;  3C66 A;  4KLT A;  4F5N A;  4KLM A;  3QZ7 A;  2MAX A;  4ECQ A;  2IA6 A;  7ICS A;  5CHG A;  2PXI A;  4EBE A;  2IHN A;  4EBK A;  4IR1 A;  4Z6F A;  4KLD A;  1IM4 A;  4C8K A;  1X2I A;  1ARO P;  4P2H A;  3PW0 A;  2ZH9 A;  4XRH A;  2ZH2 A;  4F50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...