2I9GA

Dna polymerase beta with a benzo[c]phenanthrene diol epoxide adducted guanine base
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
325
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(P*GP*TP*CP*GP*G)-3'
publication title Structure of DNA polymerase beta with a benzo[c]phenanthrene diol epoxide-adducted template exhibits mutagenic features.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2i9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2i9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2i9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2i9gA03
5HRBA 1D9FA 2UVVA 4ED8A 1TFWA 5KT3A 4FH5A 2DR9A 1U9LA 4QW8A 4FBUA 1L3UA 4ECZA 3PV8A 1NK0A 1BNOA 5HR9A 5CP2A 3OVBA 2P6UA 1U45A 3UXOA 2BCUA 2BCSA 2KFZA 4J9QA 1ZJNA 4CCHA 4YN4A 2HHTA 4YG2A 1NO5A 3HJ1A 4DEZA 4B9NA 1D9DA 4DOAA 1ZQYA 5KFKA 9ICAA 1ZQIA 3UXNA 5J2GA 1DK2A 5DG9A 5EWEA 3EYZA 4UQGA 7ICHA 3ZD9A 1ZJMA 1KFTA 4YD2A 5J29A 4DL4A 1RYSA 5KFDA 2XGQA 4BDPA 3Q8RB 1ZYQA 1L5UA 4MFAA 2AGOA 2V4RA 2ZTCA 4UB3A 2MUTB 2MUTA 4GC7A 4Z6DA 3V6HA 2R8JA 4QZBA 4PHDA 4KLTA 3C1YA 3M8SA 1K1QA 3MDCA 2Y1IA 1UETA 4NKUA 1PZNA 4I2AA 5DGAA 1QLNA 9ICKA 5HRHA 2HHXA 3HT3A 5J2CA 4IQWA 4FHVA 2C2RA 4F5NA 3RR7A 3RR8A 2JZBA 1TV9A 1X9SA 1ZQVA 5J0SA 5KFGA 3H8JA 4F5QA 1ZQOA 2BPFA 5KFYA 3TI0A 3TANA 5J0OA 4X4TA 4X4UA 4QZHA 5F9LA 9ICGA 4KLDA 3QZ7A 7ICGA 5DDYA 4Z6EA 3V72A 2C22A 8ICVA 1R8CA 4J9PA 1RYRA 3AQNA 1NK9A 2ATLA 2J6TA 2NRKA 1VJ7A 5DDMA 1TK8A 9ICHA 2BE3A 1WCLA 1NJYA 2O5AA 8ICMA 5J0RA 4AT8B 2DFLA 2M9NA 4AT8A 4KLEA 2R8HA 4F5PA 4F4ZA 1A77A 4ED6A 2FPMA 4UBBA 5KFNA 1R8AA 3ZDEA 1KFSA 2AGQA 5L1JA 2WTFA 1U4BA 4P4OA 4DL5A 4E80A 3T5JA 1ZQDA 3H4DA 2KZMA 8ICZA 4LZGA 3KTQA 4RU9A 4ECRA 4NM1A 2C28A 3PO4A 3RJFA 2PFQA 4P4PA 4WBZA 4ED2A 5DB7A 2ALZA 3EZ5A 2IA6A 5KFMA 1SZPA 1ZQTA 4EBKA 4MFFA 5BOMA 3GV7B 2W9BB 1QSLA 2W9BA 4DS5A 2ZJ5A 4K4GA 3HP6A 4M9NA 1HUZA 4KLSA 3ORYA 3QE9Y 4M2YA 2PI4A 4TUPA 3MR3A 3T5KA 4I2CA 9ICIA 4ECSA 2BPGA 2I1QA 8ICSA 3GV8B 4Q43A 2W9CA 1HUOA 4C8MA 4RNMA 9ICJA 4IR9A 3OV7A 1IM4A 4J9KA 4RUCA 4I2HA 3C1ZA 3H7IA 4Z6FA 2ZJ8A 5KFLA 4J9SA 1BPYA 1ZETA 4KTQA 4FHPA 3ZDAA 5DBBA 4J9LA 4PGYA 3RB0A 4J9OA 4ED1A 4R63A 1KTQA 1ZQFA 1DK3A 3HIYA 3UQ0A 4JUZA 3QEAZ 2IHNA 3MR5A 5HRDA 3T5LA 2ZHAA 3JPQA 4F4XA 1JN3A 3MFHA 3TAQA 4MEYA 4UB4A 5J2FA 4KMUA 3LK9A 2P66A 2ZJAA 4KN7A 3WFOA 4IG8A 2HHQA 5HRIA 2BPCA 3V7JA 5J2HA 4DL3A 1S0VA 3MDAA 4RUAA 2VA3A 3C2KA 4M6WB 2FLNA 4M6WA 3FYHA 5J2DA 1D8LA 1F5AA 2OWOA 5HNKA 8ICNA 4F91B 5EWFA 2IHMA 4P4MA 1Z00A 5KT4A 3G6XA 1ZQGA 4YR2A 9ICSA 4XQ7A 4J9NA 4B9VA 3RJIA 5KT7A 5KFOA 3JPTA 4QWDA 1MIYA 5CB1A 1MQ2A 4EEYA 3NGDA 7ICNA 1T3NA 4WC1A 2I9GA 3N4MB 1Q79A 2DRAA 4EYIB 3TFRA 4C8OA 5DQGA 4F8RA 4ZH4A 4JV1A 4M9LA 4WC5A 9ICOA 4XUSA 3RJJA 3ZDBA 4JWMA 4EP7A 4DQSA 3HWTA 2M2WA 4XQ8A 1UEUA 4Z6CA 2BHNA 3OJUA 2ASDA 4WC7A 4Q44A 4QZFA 3OGUA 4PGXA 1JXEA 1QSSA 4IRCA 3GIJA 5TZVA 4FS2A 3PY8A 4DFKA 3NYBA 1ZQRA 2ASJA 3H8SA 3Q8KA 3H8WA 4DLGA 1ZQQA 1ZQXA 2C2EA 3B0XA 4EBDA 8ICYA 4R8UB 4R8UA 5DB9A 5J0XA 3SI8A 5HRKA 5HP4A 4WC0A 1QSYA 4C8KA 2ZUDA 3OJSA 3RBEA 4YMNA 4TQRA 5DBAA 2R8KA 4Q8FA 1BNPA 4I29A 5J2IA 4O3RA 1S0OA 4EYHB 5HREA 4X4NA 5HC9A 4KITB 3EPIA 3EWAA 4QZIA 2PFOA 2O1PA 3TARA 4QZAA 9ICTA 2PBEA 2RFFA 3MR6A 4GXIA 3RJEA 1BPZA 4YR3A 4AT7B 4AT7A 4R66A 2JEFA 1XWLA 5DB8A 1S76D 5J0TA 3V7LA 5J2AA 4HYKA 5KFVA 3RH5A 1BPDA 1TKDA 2KP7A 3PX6A 2W8KA 3JYYA 4X4VA 2ZUCA 3EPGA 3ETLA 3THVA 1U48A 3OSPA 4RWQA 4KN4A 1NK4A 3RTVA 4RNOA 3GFKB 3M8RA 1NK7A 4RQ3A 2W9MA 2JZBB 4UAYA 4AT9A 1UT5A 5HRGA 4WC2A 9ICMA 5KFUA 2PFNA 2AU0A 3K4GA 3JZ0A 2Q66A 2ID1A 1B43A 2PXIA 3G6YA 4YFKA 3PVXA 3OUYB 3OUYA 3H40A 2DR5A 5KFSA 3ZDCA 1AROP 4X4RA 1TK5A 1ZQBA 1JQRA 3H3AA 2BCVA 2UVRA 2MAXA 2HHWA 4WC6A 3GILA 4NLGA 2ASLA 7ICOA 2H5XA 4RQ4A 4YP3A 1N48A 3H38A 4X0BA 2XY7A 4JV0A 5L9XA 2AQ4A 2VANA 1NKEA 5CA7A 3E2EA 4DQQA 5KG1A 3PW2A 1ZQEA 9ICRA 7ICEA 5JUMA 4ED7A 5BPCA 1NKBA 2PI5A 1SKWA 1IXRA 4YD1A 3M9NB 3C5GA 4ED0A 1UA1A 5C5JA 1JXLA 2FMPA 4DSJA 3KHRA 8ICBA 8ICIA 2F1JA 1XU4A 4YXMA 4RWOA 4UB2A 5KT5A 8ICQA 5L1KA 8ICFA 5BOLA 4ELTA 5KT6A 9ICQA 3Q8LA 4BXOB 9ICEA 2KN7A 2XCAA 3RJKA 4BXOA 2J6UA 5DQIA 5L1LA 4EBEA 1ZQAA 4R64A 2DPIA 2FPKA 2NRXA 5KTQA 3BQ2A 5HRLA 4M5DA 5HMLA 2B21A 5J0PA 3AQMA 2KZZA 4O3OA 3PX0A 3RAXA 2Q0ZX 4F4KA 1YLQA 5J0WA 3BJYA 4IRKA 4YMOA 2W9CB 7ICJA 1SL1A 4RQ7A 9ICPA 4I2EA 5KT2A 3OSNA 4TUSA 3BQ0A 5KFHA 4X4QA 4NXZA 1MSWD 1R89A 4RQ1A 4MFCA 1BGXT 2RDJA 1S9FA 5KG3A 1TFRA 3PMLA 7ICUA 5HHHA 2XY5A 2IBKA 7ICIA 4DS4A 3GQCA 2UVUA 4NLKA 4DSKA 4IQVA 4DFJA 7ICVA 5D49A 2ZH4A 3RB4A 1ZQMA 4M9JA 4X5VA 4R65A 4RWNA 4RZRA 4F2RA 4I2IA 4Q8EA 1FA0A 4FHXA 4G3IA 4X4PA 8ICRA 4FH3A 4M9HA 4O5KA 2UVWA 3KHGA 1JMSA 5KG5A 3TQ1A 4IQUA 4DQPA 2FMSA 4DFMA 2HVHA 3B0YA 4DF8A 2JEJA 7ICSA 4RWPA 1OU5A 1L3SA 4ELUA 1BPEA 4EZ9A 2M2VA 2HW3A 5KFQA 2ZUBA 4IRDA 3LWMA 1JX4A 2JEIA 4FHWA 1ZQCA 2AJQA 2P6RA 4Q45A 3Q8SB 2R8GA 1Z00B 4GXJA 4YMMA 4IQTA 3OHBA 4WC3A 4O9MA 8ICCA 3C2LA 3AUOA 8ICLA 2HHVA 4F50A 2FPLA 1B22A 1TAQA 3MFIA 3MGHA 2M2TA 4RPXA 5DB6A 2F1HA 2A1JB 9ICCA 2A1JA 4F2SA 5D4BA 4DQRA 4RQ5A 9ICUA 1T8EA 4EZ6A 5CHGA 5KFRA 5CWRA 4DLEA 3PW5A 5F2VO 2NRTA 4PGQA 1RXVA 4O5EA 4KLHA 9ICLA 8ICUA 2KFNA 8ICGA 3AQLA 3GV5B 5KFIA 4KLOA 1ZQZA 4F92B 3GDXA 3T3FA 5HMMA 2F1IA 4M9GA 3GIIA 4DSFA 3V6JA 4YQWA 1HJPA 4B9UA 2BCQA 4UD5A 1PX5A 1LB2B 4QZEA 1T7PA 4UD4A 4O3PA 5KFCA 4ECWA 2VA8A 5CJ7A 3NTUA 1Q78A 1SL2A 5KG4A 2KTQA 4ATBB 4ATBA 4XRHA 3WFPA 1N56A 3ISCA 3C21A 1KSPA 1TAUA 4O0IA 1X2IA 3RAQA 2ISPA 3C23A 4RQ8A 3LQCB 5IIIA 3SZ2A 3C5FA 1NJXA 4NLZA 4QW9A 2J6SA 4YR0A 1XC9A 4QZCA 3G6VA 5KG2A 2XO7A 4EBJA 2RDIA 2ZH2A 4E8FA 1XS9D 5DBCA 5IIOA 4DOCA 1H38A 4NKTA 4YVZA 1MQ3A 4LT6A 4KLUA 3H37A 4BGDA 3HX0A 3PW0A 4KLFA 3RB6A 3K75D 1KFDA 3GIMA 2ZH7A 1BPBA 4O3NA 4J9RA 3UQ2A 2GWSA 4DSLA 4YCXA 5DQHA 5IIJA 1KDHA 5KG6A 1U47A 5HHIA 4UB5A 5DECA 4I2FA 4RNNA 1EXNA 4DO9A 4ED3A 4TURA 7ICKA 4ECTA 3RJHA 2ZH9A 4GC6A 1ZQKA 4WBYA 5DEDA 1NOMA 5KFTA 4KLGA 4E0DA 5DG8A 4MF8A 1NK8A 1RZTA 2AQ0A 3RH4A 8ICOA 9ICVA 5IILA 4BWMA 2W8LA 4O3SA 4I2DA 5J0UA 3QZ8A 5DLFA 4X4SA 9ICNA 7ICFA 4AT9B 4ECUA 3RH6A 3N97B 5CR0A 5DG7A 5HRFA 3LDAA 1WCNA 5KFZA 1NZPA 4DL6A 3AQKA 5DLGA 3UPQA 3AU2A 4M0AA 4K4HA 1S0NA 4F3OA 1X9MA 3WFRE 4YXJA 1DGSA 8ICJA 1U49A 1S0MA 3ISBA 1BVSA 3RRHA 4DQIA 4LVSA 4PHEA 1CUKA 8ICPA 3C18A 1K1SA 4UAWA 4P2HA 4WCWA 4EBCA 1UEVA 3C2MA 2NRZA 4MEXA 4RQ6A 4RT3A 5KFWA 4B9TA 1JAJA 4S3NA 1MIVA 3WFQE 9ICXA 4ECYA 5J2KA 4GLXA 5KFEA 3IHQB 1RXWA 8ICEA 4J9MA 1JIHA 1XO1A 2ISOA 4B9MA 4O5CA 3L9DA 5KG7A 4XA5A 4X0AA 4KLMA 1QTMA 3PW7A 2DRBA 4DSIA 2XCPA 4PHPA 1MC8A 3RB3A 1TFYA 2DR8A 4I2BA 3QEBZ 5J0YA 4RPYA 3BDPA 2XGPA 4F5OA 3FDSA 2BR0A 4DFPA 7ICTA 5KFAA 1COOA 2Y1JA 1NKCA 2HHPA 4KLJA 5L1IA 4KLQA 4F4YA 4FS1A 3BQ1A 3ZDDA 7ICPA 4C8LA 2FLLA 4M04A 1NK5A 2ZHBA 9ICWA 2DR7A 7ICMA 4QWEA 2HHUA 1ZQHA 4ELVA 4I2GA 9ICBA 2ZTDA 3PR5B 4NM2A 3TAPA 5IIKA 1UA0A 5F9NA 1XSLA 4BWJA 2ZH3A 4MF2A 5IINA 4RQ0A 3MR2A 4UB1A 4JV2A 4M47A 4DWIA 1R8BA 3UPSA 1A76A 2XC9A 4UAZA 4FO6A 1KNYA 3OVSA 2ZH6A 2R8IA 4LZDA 5EWGA 4RT2A 4DL7A 1S97A 3PMNA 4I27A 1MIWA 3KHHA 2ZH1A 4QZGA 2DPJA 4O3QA 3PX4A 2NRWA 5KFPA 4TQSA 4TUQA 3PO5A 5KFBA 3LWLA 8ICWA 3WFSC 1Y88A 3SV3A 4X4OA 2C2DA 4F5RA 4FBTA 2NRVA 1XSNA 4ECXA 4QZ8A 4UBCA 8ICTA 1T4GA 2ZTEA 1X9WA 3IM1A 3GIKA 5J2BA 3HPOA 4QWAA 3H4BA 1TK0A 3M9OB 4B9LA 3Q8PB 4DOBA 3M9MB 4PPXA 1L3TA 3EW9A 4QZDA 3MGIA 3PNCA 1SKSA 4B9SA 1ZQUA 3TFSA 2BDPA 8ICKA 3JPSA 1Z3EB 1LV5A 5DKWA 1ZQPA 4C8NA 2IMWP 1RPLA 4NY8A 2M2UA 3C66A 2BQRA 2VA2A 2BQ3A 3KHLA 2KZ3A 4PHAA 3AU6A 5KFJA 3PR4A 5EOZA 4DF4A 1BPXA 3Q8MA 3JPRA 1S10A 7ICLA 7ICRA 3PW4A 2FLPA 1NJWA 2JEGA 4I28A 3OHAA 3V6KA 4QZ9A 5IIMA 4QWCA 4ECVA 2AGPA 4RQ2A 3T5HA 3MBYA 4F4WA 1L3VA 4DL2A 3JPPA 3RBDA 1ZQJA 1ZQNA 3SV4A 8ICAA 4KLLA 5KFXA 4IR1A 4K4IA 2ZH5A 4QWBA 2HVIA 1CEZA 3RRGA 8ICXA 3HW8A 2PFPA 3V7KA 2BQUA 4JWNA 8ICHA 4PH5A 1D8YA 1SL0A 7ICQA 1ZQLA 2V9WA 3ZD8A 4I2JA 4KLIA 1TVAA 1V4AA 1C7YA 2W9AA 3ISDA 1XSPA 4DSEA 3OVAA 1S77D 5KG0A 4RPZA 2BGWA 4NLNA 3RJGA 5D46A 3MABA 1DOQA 1KLNA 4E7XA 2BKEA 4FHYA 1ZQSA 5KFFA 2XY6A 1NJZA 3SYZA 3JPOA 1WOTA 4WC4A 2V4QA 3H39A 2HHSA 4JK1A 4ECQA 2ZH8A 1VFGA 2BCRA 1UT8A 5DGBA 1KEJA 3BQTA 4F93B 3JPNA 1NK6A 2DVIA 5J0QA 5J2EA 2FMQA 9ICFA 4GXKA 3HJ4A 3UXPA 2LYHA 1SKRA 3Q8QB 1V9PA 1KRPA 1ZQWA 5J2JA
chains in the Genus database with same CATH superfamily
2UVVA 1U9LA 3I1YA 2BCUA 5KAFU 2BCSA 4J9QA 4CCHA 4YN4A 4YG2A 1MN8A 4DOAA 2DF4B 4EELA 3EYZA 1KFTA 4DL4A 1RYSA 4BDPA 2QARA 2Y9UA 2V4RA 2ZTCA 2AGOA 2R8JA 1RDFA 3C1YA 2IOFA 3FC4A 2Y1IA 1UETA 4NKUA 3AL0B 1QLNA 9ICKA 5HRHA 2HHXA 3WK8A 4UAUA 3HT3A 4PJ0U 4IQWA 2C2RA 3RR7A 4O68A 2JZBA 4Y2JA 3H8JA 1V85A 1RM6C 5J0OA 4X4UA 4QZHA 5F9LA 9ICGA 4NL9A 3QZ7A 7ICGA 2C22A 2W11A 4CGZA 8ICVA 1RYRA 3AQNA 2DL0A 3IP4B 1TK8A 9ICHA 1WCLA 2GA9D 5B3QA 2DFLA 4AT8A 2FCLA 4F5PA 4F4ZA 1A77A 5KFNA 1LVHA 3IRUA 5L1JA 1U4BA 4E80A 4GIBA 4LZGA 3M6ZA 3KTQA 2C28A 3RJFA 4P4PA 4WBZA 5DB7A 4EEBA 5CFTA 1ZQTA 5KNIA 2W9BB 5B66U 1F0MA 4C0ZA 3QE9Y 4M2YA 2PI4A 4TUPA 4I2CA 8ICSA 5ALVA 3GV8B 3HKZC 4IR9A 3OV7A 2NO5A 4RUCA 3D2QA 3C1ZA 3H7IA 4Z6FA 5KFLA 4NXTA 1ZETA 3ZDAA 5DBBA 4PGYA 4ED1A 1KTQA 5D61A 2HOFA 3MR5A 2A19A 2P66A 4O69A 2ZJAA 3WFOA 3L5KA 5J2HA 2VA3A 3C2KA 1SV0C 4M6WB 2OWOA 1Z19A 4FZNA 2IHMA 1ZQGA 4B9VA 5CHEA 3RJIA 3F5AA 1MIYA 3NGDA 2YN4A 5AIAA 3H0RB 5ALEA 1ECWA 3BQ7A 4F8RA 3QU9A 5AI5A 4C8OA 4JV1A 5HR6A 2M2WA 3SD7A 2BHNA 4Q44A 4IRCA 4PGXA 5G5GA 1JALA 1NNLA 3NYBA 2LKYA 3B0XA 5J0XA 5HRKA 1Q3VA 4WC0A 3T79A 2PMZF 2ZUDA 3RBEA 5JTGA 4O6AA 3NVYA 5HREA 5A0LA 5AKKA 2QARB 1NZBA 2E1FA 3MR6A 4PZOA 3L3FX 4QJFB 4AT7A 1XWLA 3CRXA 4HYKA 5J2AA 3RH5A 2FI1A 2W8KA 1JROA 4KN4A 1NK4A 3RTVA 3M8RA 2W9MA 2JZBB 4UAYA 5HRGA 2KJ9A 3BS7A 2PFNA 4CF4A 5TISU 2ID1A 2G5HB 4FO1A 1B43A 2PXIA 3OUYB 3I28A 3H40A 3RF9A 5KFSA 1ZQBA 2MAXA 4C4TA 4WC6A 4NLGA 2ASLA 1N48A 4RQ4A 4YP3A 1NKEA 5CA7A 9ICRA 3WK5A 2LI6A 5BPCA 1SKWA 2FMPA 1UA1A 8ICIA 4DSJA 2F1JA 4UB2A 1SWWA 1FA0A 2KN7A 2GOLA 2NRXA 5HRLA 1SWVA 3KOOA 2PMZC 3NVVA 2KZZA 3PX0A 5D63A 3OSNA 5EE1A 1MSWD 2RDJA 7ICUA 5HHHA 2XY5A 2IBKA 4DSKA 4DFJA 4C7ZA 2CPRA 4M9JA 4LJXA 3AEVA 4R65A 5AICA 8ICRA 3KFUF 1JMSA 2KKPA 1UHUA 1SXEA 1PVPA 3M7DA 2FMSA 4P0PB 2ODGA 4RWPA 5AM2A 2W43A 2W3RA 1L3SA 4ELUA 3BZKA 1N5XA 2M2VA 4F72A 2ZIUA 4Q45A 4YMMA 4JMUA 4O9MA 8ICCA 3AUOA 2HHVA 4F50A 2ZIVA 2FPLA 2YY6A 3B9JA 3MGHA 3WKBA 2EAOA 2DWQA 3VCBA 5D4BA 4DQRA 2IOFK 4C80A 4HAIA 3E0FA 5CHGA 5CWRA 4PGQA 3GV5B 4F92B 1M6YA 4OJ5A 3LVWA 1LB2B 1N63A 1Q78A 2RQ5A 4ECWA 1SL2A 4ATBA 2H3QA 2ISPA 1T3QA 3C5FA 3SZ2A 3K7DA 4QW9A 4Y2XA 5KG2A 4EBJA 2RDIA 4PL1A 4E8FA 1WWUA 1IIPA 4RQNA 4YVZA 1FIQA 3HX0A 3K75D 5ALZA 3UQ2A 5ALUA 5IIJA 2HI0A 5KG6A 4UB5A 5DECA 4KX3A 3RJHA 4GC6A 4EEDA 1NOMA 2KOBA 5KFTA 4K97A 4NV0A 2AQ0A 5AK3A 3QUTA 4O3SA 4X4SA 5DLFA 5CR0A 3UPQA 1S0NA 1S8OA 1PK3A 2VJ5A 2D8CA 4LVSA 1WWVA 3NRWA 4UAWA 1JAJA 4S3NA 2WF6A 5J2KA 1RXWA 4B9MA 4DFDA 4JLZA 4KLMA 1QTMA 4DSIA 2DR8A 4OAFA 1XO0A 2Y1JA 1NKCA 4KLQA 4F4YA 3BQ1A 2FJ6A 2FLLA 2DR7A 1NK5A 7ICMA 2ZTDA 4NM2A 3SMVA 4BWJA 1LKYB 4DWIA 1R8BA 1A76A 1IV8A 2XC9A 4WOYA 3OVSA 2ZH6A 2ZH1A 3PMNA 3KHHA 2RHFA 5AKEA 1Y88A 2EAMA 2KIWA 1T4GA 5AKHA 1TK0A 4CNQA 4B9LA 1KKXA 1DGJA 3NASA 3TACB 3PNCA 1SKSA 2KD1A 2BDPA 2Q4TA 2G5IB 2HSZA 1SGGA 3OPXA 2HCFA 2VA2A 2KZ3A 4PHAA 2P35A 3KZXA 5IIMA 4QZ9A 2AGPA 4RQ2A 1Z4NA 1NI3A 5ALQA 3RBDA 4KLLA 4IR1A 2ZH5A 5JTIA 2HMXA 2HVIA 1O03A 4PH5A 1SL0A 1DXSA 2KVCA 4GFJA 4I2JA 1TVAA 2HN1A 2W9AA 3OVAA 4AP9A 1S77D 1MA7A 1NJZA 3SYZA 3JPOA 4WC4A 2V4QA 3H39A 2HHSA 2I5HA 2BCRA 5DGBA 3H8MA 2W3SA 3UXPA 1ZQ1C 5KT3A 4FBUA 1SV4A 5AK6A 4ECZA 1L6NA 5HR9A 2AXTU 2F3NA 3N7RC 5AI0A 1U45A 4K98A 1ZJNA 2HHTA 2R18A 1ZQYA 5KFKA 5J2GA 1DK2A 5EWEA 1ZJMA 1N2XA 3M1YA 2KK0A 5KFDA 1ZYQA 2QKQA 4UB3A 2FDRA 1FEZA 4GC7A 2KICA 2E8NA 4QZBA 3IG8A 2VJ4A 4NXXA 4KLTA 3MDCA 5ALLA 1PZNA 4I2AA 5ALSA 5J8YA 4K99A 2KVSA 5J0SA 5KFGA 3TI0A 4X4TA 4NLBA 4LEYA 3V72A 2JMGA 1Z1VA 1NJYA 2O5AA 2M9NA 1SZHA 3QU5A 1R8AA 4DCCA 2JHDA 1FO4A 2K60A 4P4OA 4DL5A 3H4DA 2KZMA 4NM1A 5ALNA 3J81j 5AM5A 3EZ5A 5KFMA 1SZPA 5BOMA 1QSLA 2W9BA 4K4GA 3HP6A 4M9NA 1HUZA 2GO7A 3QUQA 9ICIA 3T5KA 2HBLA 4RNMA 4J9KA 5GTHU 2ZJ8A 5ALWA 2E8MA 4J9SA 4J9LA 3RB0A 1ZQFA 2W54A 1JN3A 4MEYA 4UB4A 3LK9A 2QLTA 4KN7A 1B0XA 3FAHA 1S0VA 2FLNA 4M6WA 5J2DA 1D8LA 8ICNA 4JB3A 4CF3A 4P4MA 3G6XA 3UMBA 9ICSA 5KT7A 5KFOA 4EEYA 1T3NA 2I9GA 2DRAA 4M9LA 1J97A 2KJ5A 9ICOA 5AK5A 2ZXHA 1J2NA 4JWMA 4DQSA 2YMMA 4PZNA 1UEUA 4WC7A 2ASDA 1JXEA 2JXJA 4FS2A 4OJOA 4DFKA 3PY8A 3H8SA 4DLGA 1ZQQA 3SAFA 1F5SA 4Q8FA 2KHVA 2H3VA 3HKZF 2CXYA 4KITB 4QZIA 2O1PA 2RFFA 3K1ZA 2JEFA 5DB8A 2KP7A 5KFVA 5KAIU 1BPDA 5KL8B 4BUGA 3JYYA 4X4VA 1U48A 2WFAA 5ALRA 4RNOA 2QB1A 3UM9A 4AT9A 9ICMA 3TKAA 4P0QA 5JU5A 2Q66A 3G6YA 4YFKA 3OUYA 2QB0A 2DR5A 1WYGA 3ZDCA 4B6JA 1N60A 3PSIA 1TK5A 1JQRA 2BCVA 4OJLA 1PK1B 1ZD2P 1N5WA 1Z4OA 5L9XA 2AQ4A 4LEZA 3PW2A 2XIDA 5JUMA 1IXRA 3ZI4A 1JXLA 8ICBA 4UASA 3QU4A 3NRZA 5F3XB 8ICQA 5BOLA 3Q8LA 2XCAA 5DQIA 1IG6A 4R64A 5KTQA 2WHEA 4M5DA 5ALTA 3AQMA 3F5EA 2Q0ZX 1YLQA 4IRKA 7ICJA 4RQ7A 5KT2A 3ER9B 3D2NA 4X4QA 4RQ1A 4MFCA 1BGXT 1S9FA 3F53A 3HJEA 1TFRA 5KG3A 3PMLA 7ICIA 1C20A 3IG5A 2ZG6A 4ZOHC 2RRDA 2HBJA 3MCRA 2XVTA 4FZMA 3CW2C 4Q8EA 4I2IA 1ZD3A 2UVWA 2G09A 5KG5A 1COKA 4IQUA 4DFMA 1ZOLA 1QCKA 3WU2U 1Q46A 4P0PA 4EZ9A 1JX4A 1ZQCA 5L1MA 2R8GA 3Q8SB 4N7RA 2N1RA 3CP8A 4GXJA 3A0HU 5AKYA 5GTIU 1B22A 4RQ5A 5AM3A 1SIJA 5KFRA 5F2VO 2NRTA 1RXVA 4O5EA 3AQLA 1X42A 2JH1A 3GDXA 2F1IA 3GIIA 3CK6A 1L7PA 4WQKA 1PX5A 4QZEA 2BDUA 3NTUA 2EZYA 4J03A 3F2BA 2YMLA 3WFPA 3ISCA 3C21A 3RFAA 3RAQA 1JRPA 1SV0A 4NLZA 3D6JA 5AKIA 2JRZA 4QZCA 2XO7A 2VIXA 1QH9A 5DBCA 5IIOA 2F77X 4DOCA 1MQ3A 4BGDA 3PW0A 4KLFA 1X6IA 5DQHA 1KDHA 4RNNA 7ICKA 4ECTA 3TADC 4WBYA 4CRXA 4FZLA 5CRXA 5DG8A 9ICVA 3RH4A 3WKCA 3EF2A 4I2DA 5J0UA 2YX8A 4AT9B 4K9BA 5DG7A 3LDAA 1NZPA 4DL6A 4P0QB 4M0AA 2QB0B 4F3OA 5AM4A 4YXJA 1DGSA 1U49A 3ISBA 1SB3C 1BVSA 3RRHA 1PVQA 3C18A 1K1SA 2A3VA 2WB1F 1P7DA 5KFWA 2DBYA 9ICXA 4ECYA 5KFEA 2G08A 2B0CA 2ISOA 1JIHA 4O5CA 3L9DA 4UARA 4X0AA 2EAPA 2NV3A 3RB3A 4I2BA 5J0YA 3BDPA 2BR0A 3FDSA 4DFPA 4US9A 5KFAA 4BX9C 5L1IA 4FS1A 4M04A 2E1EA 1ZQHA 2EWRA 4ELVA 4OAIZ 4NWIA 2W03A 4JV2A 1LKYA 2PKEA 4LZDA 5EWGA 4RT2A 1S97A 1WUDA 3PO5A 4TQSA 5KFBA 3LWLA 2D6FC 4X4OA 4UB6U 4FBTA 2XICA 4PL2A 4QZ8A 4ECXA 8ICTA 1X9WA 3HPOA 3H4BA 4QWAA 2MU2A 3Q8PB 3M9MB 2LBOA 4PPXA 1L3TA 4O3MA 5ALDA 1Z3EB 1LV5A 2IMWP 1RPLA 3SAGA 3C66A 2BQRA 1FFUA 1L8LA 1B4FA 3AU6A 1S10A 3V6KA 4CF5A 2WB1C 4F4WA 5AKGA 1L3VA 2MRLA 4ACOA 3JPPA 1ZQJA 1RG6A 3SV4A 3WK7A 2IUBA 3KZIU 1CEZA 2KNJA 3HW8A 4UAVA 4JWNA 7ICQA 2DKXA 3ALRA 5KG0A 4NLNA 3SQIA 2BKEA 5KFFA 2WAQC 3JPNA 2DVIA 1NK6A 3KD3A 5J2EA 3JCFA 1V9PA 1ZQWA 1TFWA 1CI4A 4QW8A 3PV8A 1NK0A 4OD0A 3UXOA 1L8OA 2KFZA 4EP7A 1NO5A 1UCVA 3HJ1A 4DEZA 4B9NA 4C4RA 3KKAC 9ICAA 1ZQIA 5DG9A 4UQGA 3ZD9A 4YD2A 5J29A 3M6KA 2XGQA 4JLXA 3Q8RB 1L5UA 4MFAA 2MUTB 4Z6DA 3V6HA 4PHDA 1ZRMA 4EEKA 1K1QA 1RYUA 5DGAA 1PUZA 2K4IA 5J2CA 4FHVA 3QUBA 2H3FA 1X9SA 3WK9A 4F5QA 1ZQOA 2BPFA 1GPJA 5DDYA 4Z6EA 4UB8U 1VDVA 2F2AB 2ATLA 2LM4A 2J6TA 1VJ7A 2NRKA 1YZ7A 5DDMA 2BE3A 4KLEA 2R8HA 4ED6A 2FPMA 2OXOA 3QU7A 3LVVA 3T5JA 2Y9TA 3N7SC 4RU9A 4ECRA 3PO4A 2YB4A 2KHQA 1L7MA 2O6KA 2ALZA 2IA6A 3GV7B 4KLSA 3EUB2 3MR3A 3AQEA 4ECSA 2BPGA 2I1QA 2W9CA 1HUOA 9ICJA 4MKPA 1X9XA 2HDOA 1UQVA 2DKZA 4I2HA 4FHPA 1ZXIA 2E3TA 4QIWC 4J9OA 4R63A 2HBKA 5ALIA 3HIYA 4KX5A 3QEAZ 2IHNA 3T5LA 4WH5A 5AI8A 3MFHA 3TAQA 5J2FA 1X40A 4KMUA 1T94A 2HHQA 5HRIA 2BPCA 5KL1B 4RUAA 1F5AA 1N62A 5EWFA 1JUDA 1Z00A 4YR2A 4XQ7A 4J9NA 4QWDA 1MQ2A 4WC1A 7ICNA 3AMZA 1Q79A 2K8AA 4EYIB 5B3PA 5K4LA 3DDHA 4XUSA 1KQQA 3RJJA 2K4PA 4XQ8A 2KSOB 4Z6CA 3OJUA 3O0FA 4QZFA 5TZVA 2ASJA 3Q8KA 3H8WA 5ALMA 1ZQXA 2C2EA 8ICYA 4R8UB 5DB9A 4K9AA 3SI8A 5HP4A 3E58A 3NVWA 1L7NA 5H2FU 3OJSA 5EE3A 4I29A 5J2IA 1S0OA 4X4NA 3EPIA 5AIBA 2PFOA 3TARA 4QZAA 9ICTA 4Y2TA 4GXIA 1BPZA 4YR3A 4R66A 2HN2A 5J0TA 3NUQA 3ETLA 3OSPA 3BZCA 5AM1A 3GU3A 4RQ3A 1UT5A 1QQ6A 2EQYA 4OAHA 4Y2YA 1KBUA 3PVXA 1AROP 3C29A 3H3AA 4UATA 2HHWA 4EGWA 1PK1A 1ZRNA 7ICOA 2H5XA 3H38A 2XY7A 4JV0A 3BS5B 3E2EA 5KG1A 1ZQEA 7ICEA 3SR6A 3M9NB 3C5GA 2F8LA 5KT5A 3LYSA 4ELTA 8ICFA 4BXOB 9ICEA 2J6UA 1ZQAA 3IN5A 2DPIA 2EDUA 3BQ2A 4FE3A 5HMLA 3PSFA 4O3OA 2W9CB 1KW4A 9ICPA 4TUSA 3BQ0A 4NXZA 5ALGA 1R89A 2BBHA 4DS4A 3GQCA 2UVUA 4WQLA 4IQVA 1PVRA 3RB4A 1Q8KA 4RWNA 4FHXA 4X4PA 3KHGA 3TQ1A 2HBMA 2H3IA 2JEIA 3LWMA 2LYBA 1Z00B 4MHVA 4IQTA 4WC3A 1TAQA 3MFIA 2M2TA 2F1HA 2A1JB 4F2SA 9ICUA 4EZ6A 3PW5A 4DLEA 9ICLA 4KLHA 3K1RB 1ZQZA 1YT3A 4M9GA 4YQWA 4I0UA 1HJPA 4B9UA 2BCQA 2VA8A 4US8A 3IDWA 5KG4A 4Y2SA 2E8OA 4XRHA 1N56A 1TAUA 4O0IA 1V97A 1X2IA 3LQCB 5IIIA 2WF8A 1Q3UA 3IV6A 5CFUA 1VJ5A 1XS9D 5HR7A 2G06A 1H38A 1FFVA 4KLUA 3H37A 2ZH7A 1KFDA 1BPBA 4O3NA 5AKZA 3KBBA 4TURA 4NL9C 1ZQKA 5DEDA 4KLGA 5C0YA 4E0DA 4MF8A 1NK8A 4BWMA 3QZ8A 2EZXA 4AYBF 3N28A 2M0NA 2B56A 4ECUA 3RH6A 3PSTA 5HRFA 1WCNA 5KFZA 3AQKA 2K89A 4KB6A 3AU2A 3WFRE 4K4HA 2LM1A 8ICJA 4DQIA 3PHZA 4PHEA 8ICPA 4P2HA 4EV6A 1D8BA 1UEVA 4MEXA 4RQ6A 4RT3A 4B9TA 3D2SA 5E79U 3QUCA 4GLXA 2ZH9A 8ICEA 3IHQB 4J9MA 1XO1A 2I6XA 2IHOA 5KG7A 1K5OA 2DRBA 3PW7A 3QNMA 3QEBZ 4F5OA 7ICTA 3AM9A 2GH1A 3SENA 2ZIXB 4KLJA 2RP5A 7ICPA 5FP0A 4Y2UA 9ICWA 4I2GA 1UA0A 4FFDA 2ZH3A 5T14A 4MF2A 5IINA 4RQ0A 3N7PD 4UB1A 3UPSA 3A0BU 3CYMA 4UAZA 1KNYA 3WK4A 1Z1BA 2R8IA 4CDGA 4I27A 1CRXA 2KIVA 4O3QA 2NRWA 4TUQA 8ICWA 3WFSC 3SV3A 2C2DA 5ALXA 2NRVA 1XSNA 1X66A 2ZTEA 5J2BA 2ZIWB 4C7YA 1QQ7A 4AYBC 1XNSA 3EW9A 4QZDA 4B9SA 1ZQUA 3ETRA 2LPEA 3TFSA 8ICKA 3JPSA 5DKWA 2M2UA 7ICLA 5EOZA 3Q8MA 2HOIA 3PW4A 2JEGA 4CE6A 2RLTA 3T5HA 1RQLA 2AH5A 4DL2A 1ZQNA 5AI9A 4QWBA 4IL6U 8ICXA 5G5HA 1JI7A 3ICXA 8ICHA 2YMQA 1ZQLA 3ZD8A 3MC1A 2V9WA 3ISDA 4RPZA 2BGWA 1L7OA 2KG5A 3RJGA 4A8EA 1KLNA 4E7XA 4FHYA 1ZQSA 4K8VA 2KKVA 4NJ8A 1WOTA 3WKDA 4JK1A 4ECQA 1KEJA 1VLBA 2FMQA 9ICFA 4GXKA 3HJ4A 4FHWA 2LYHA 3Q8QB 5J2JA 1N61A 5HRBA 1D9FA 4ED8A 4XJEA 1L3UA 1BNOA 4WJ3B 2GLEA 2A1AA 5CP2A 3OVBA 1WG8A 2P6UA 2OEHA 1D9DA 4UW9A 3UXNA 7ICHA 5EE0A 2MUTA 3S6JA 3UMGA 3M8SA 2OM6A 2W7PA 3NVZA 1ED1A 4F5NA 4Y2PA 3RR8A 1TV9A 2K8BB 1ZQVA 5KFYA 3TANA 2VKQA 3TADA 4KLDA 1R8CA 1RQNA 4J9PA 2FE9A 1NK9A 4Y2RA 2GAFD 8ICMA 4F71A 5J0RA 4AT8B 4UBBA 2WAQF 3ZDEA 1KFSA 2AGQA 2WTFA 1ZQDA 8ICZA 3GZFA 2JV3A 2PFQA 4ED2A 2KJ8A 1ZD5A 4OJ6A 4EBKA 4EENA 4MFFA 2PBEA 2JH7A 4DS5A 2ZJ5A 3ORYA 3OTQA 4Q43A 5ALJA 4C8MA 1IM4A 2F76X 4HX0A 2DGZA 1BPYA 4KTQA 2YB1A 1DK3A 5ALKA 5B5EU 3UQ0A 2G0AA 4JUZA 5HRDA 2ZHAA 3JPQA 4F4XA 2E5SA 1S5LU 4IG8A 3V7JA 4DL3A 3MDAA 3FYHA 5HNKA 4F91B 5KT4A 3FM9A 4USAA 1HEKA 2W55A 3JPTA 2LYAA 5CB1A 4KM5A 1GO3F 3N4MB 3QYPA 3TFRA 4WC5A 5DQGA 4ZH4A 2EH9A 3NKUA 3ZDBA 3HWTA 5D62A 2KSOA 2HOQA 3OGUA 1A0PA 1QSSA 4NXWA 3GIJA 1ZQRA 5AK4A 4EBDA 4R8UA 3WKAA 4OJPA 1QSYA 4C8KA 4C4SA 2ESEA 4YMNA 4TQRA 5DBAA 2R8KA 1BNPA 2EZZA 4O3RA 2B51A 4EYHB 4LEVA 5HC9A 2B6GA 2OH2A 3EWAA 4BJQA 3R9KA 3RJEA 4QIWF 4AT7B 3AQFA 5ALPA 2D3DA 3WKEA 1S76D 3V7LA 4Y2QA 3H0MB 2IOHA 4RQMA 1TKDA 3PX6A 2ZUCA 3EPGA 3THVA 2WF9A 3QU2A 4RWQA 4NXUA 3GFKB 1NK7A 2K4HA 2B4VA 4WC2A 5KFUA 5EE9A 2AU0A 3K4GA 3JZ0A 2DUYA 5AHXA 4X4RA 4IS7A 2UVRA 3KKAA 3GILA 2YTUA 5ALHA 4X0BA 2LMRA 3BS5A 2VANA 3HILA 3MGVA 4DQQA 2W7OA 4ED7A 2PI5A 1NKBA 1V4AA 4YD1A 4ED0A 4KLIA 5C5JA 4OO1J 3KHRA 1XU4A 4YXMA 4RWOA 2NYVA 5L1KA 5KT6A 9ICQA 4BXOA 3RJKA 5L1LA 4EBEA 2DQNB 2FPKA 2B21A 3ERCC 5J0PA 2WF5A 5AKXA 4U7CA 3RAXA 4F4KA 2DR9A 5J0WA 3BJYA 4YMOA 1SL1A 4I2EA 2OCEA 2F8KA 5KFHA 3F2DA 1O08A 2F44A 5AKJA 2CN1A 4OAGA 2CRXA 4NLKA 7ICVA 5D49A 2ZH4A 1ZQMA 1KL9A 2L5YA 3UMCA 4X5VA 4RZRA 4F2RA 1ZD4A 4G3IA 4FH3A 4M9HA 1DRGA 4O5KA 4EX6A 2YMPA 2K4EA 4O67A 2HVHA 4DQPA 3B0YA 4DF8A 2JEJA 7ICSA 1OU5A 1BPEA 1OXJA 2HW3A 1QQ5A 2ZIUB 5KFQA 3PZPA 2KMDA 2ZUBA 4IRDA 2AJQA 2P6RA 3QX7A 2H3ZA 2G07A 3OHBA 3C2LA 8ICLA 2ZIVB 2LHTA 1AQ6A 2YQEA 3QXGA 2ES6A 5DB6A 4RPXA 9ICCA 2A1JA 2BZFA 3NS1A 2Y0SF 2ZXIA 1T8EA 4Y2VA 3NVOA 8ICUA 8ICGA 4NLCA 5KFIA 4KLOA 1V38A 3T3FA 4NXVA 5HMMA 4ICAA 4DSFA 3V6JA 1TAMA 4UD5A 5ALYA 5AI4A 4G9BA 3PSPA 1T7PA 4UD4A 4O3PA 5KFCA 1OUQA 5AM0A 5CJ7A 2E8PA 2KTQA 4ATBB 2NO4A 4U6PA 1KSPA 3C23A 5ALOA 4RQ8A 1NJXA 2J6SA 4YR0A 1XC9A 3G6VA 2ZH2A 4NKTA 3DEEA 5J8YC 4LT6A 3WFQE 3RB6A 3GIMA 4OCZA 4J9RA 3AN1A 2GWSA 4DSLA 4YCXA 1U47A 5HHIA 1X6JA 4DO9A 1EXNA 4ED3A 4I2FA 3ER8C 1RZTA 8ICOA 5IILA 2K8CB 2W8LA 5AKLA 9ICNA 5AI6A 7ICFA 3N97B 2KE7A 5DLGA 4LEWA 1X9MA 5CEHA 1S0MA 1CUKA 1UPHA 3ONNA 4WCWA 4EBCA 2Y0SC 3C2MA 2NRZA 2JR5A 1MIVA 3L4PA 3SEIA 4XA5A 2XCPA 4PHPA 1MC8A 1TFYA 2Z7JA 4RPYA 2XGPA 1COOA 2HHPA 3U26A 2ZIXA 4QNLA 3ZDDA 4EX7A 4C8LA 2ZHBA 2HHUA 4QWEA 3SAHA 9ICBA 3PR5B 3TAPA 5IIKA 1KN5A 5F9NA 1XSLA 3MR2A 4M47A 3VC8A 2WF7A 4FO6A 4DL7A 1MIWA 4QZGA 2DPJA 3C28A 3PX4A 5KFPA 3CNHA 1TE2A 3OWGA 4F5RA 4IC9A 4UBCA 2W04A 3IM1A 3GIKA 2ZIWA 3M9OB 4DOBA 3H0LB 2BBJA 3MGIA 3DV9A 2OHFA 2EANA 3NWIA 1HIWA 1ZQPA 4C8NA 4NY8A 2OYYA 2KEYA 1J2MA 3KHLA 3WK6A 2BQ3A 4FH5A 5KFJA 3PR4A 4DF4A 1BPXA 7ICRA 3JPRA 2XI9A 4KMOB 4I28A 2FLPA 1NJWA 3OHAA 4QWCA 4ECVA 1F44A 3MBYA 4K96A 1YZ6A 8ICAA 3HRDD 5KFXA 2KV2A 4K4IA 3RRGA 2MSNA 3V7KA 2PFPA 2BQUA 1D8YA 1C7YA 1URJA 5JRTA 1XSPA 2MA1A 4DSEA 1A6SA 3ED5A 5CFSA 5D46A 3MABA 1DOQA 2XY6A 2AHOB 1OW5A 1SXDA 3F2CA 2ZH8A 1VFGA 3I76A 1UT8A 3BQTA 4F93B 5J0QA 2JGAA 5ALFA 1SKRA 2KFNA 1KRPA
chains in the Genus database with same CATH topology
5HRBA 1D9FA 2UVVA 4ED8A 1TFWA 5KT3A 4FH5A 2DR9A 1U9LA 4QW8A 4FBUA 1L3UA 4ECZA 3PV8A 1NK0A 1BNOA 5HR9A 5CP2A 3OVBA 2P6UA 1U45A 3UXOA 2BCUA 2BCSA 2KFZA 4J9QA 1ZJNA 4CCHA 4YN4A 2HHTA 4YG2A 1NO5A 3HJ1A 4DEZA 4B9NA 1D9DA 4DOAA 1ZQYA 5KFKA 9ICAA 1ZQIA 3UXNA 5J2GA 1DK2A 5DG9A 5EWEA 3EYZA 4UQGA 7ICHA 3ZD9A 1ZJMA 1KFTA 4YD2A 5J29A 4DL4A 1RYSA 5KFDA 2XGQA 4BDPA 3Q8RB 1ZYQA 1L5UA 4MFAA 2AGOA 2V4RA 2ZTCA 4UB3A 2MUTB 2MUTA 4GC7A 4Z6DA 3V6HA 2R8JA 4QZBA 4PHDA 4KLTA 3C1YA 3M8SA 1K1QA 3MDCA 2Y1IA 1UETA 4NKUA 1PZNA 4I2AA 5DGAA 1QLNA 9ICKA 5HRHA 2HHXA 3HT3A 5J2CA 4IQWA 4FHVA 2C2RA 4F5NA 3RR7A 3RR8A 2JZBA 1TV9A 1X9SA 1ZQVA 5J0SA 5KFGA 3H8JA 4F5QA 1ZQOA 2BPFA 5KFYA 3TI0A 3TANA 5J0OA 4X4TA 4X4UA 4QZHA 5F9LA 9ICGA 4KLDA 3QZ7A 7ICGA 5DDYA 4Z6EA 3V72A 2C22A 8ICVA 1R8CA 4J9PA 1RYRA 3AQNA 1NK9A 2ATLA 2J6TA 2NRKA 1VJ7A 5DDMA 1TK8A 9ICHA 2BE3A 1WCLA 1NJYA 2O5AA 8ICMA 5J0RA 4AT8B 2DFLA 2M9NA 4AT8A 4KLEA 2R8HA 4F5PA 4F4ZA 1A77A 4ED6A 2FPMA 4UBBA 5KFNA 1R8AA 3ZDEA 1KFSA 2AGQA 5L1JA 2WTFA 1U4BA 4P4OA 4DL5A 4E80A 3T5JA 1ZQDA 3H4DA 2KZMA 8ICZA 4LZGA 3KTQA 4RU9A 4ECRA 4NM1A 2C28A 3PO4A 3RJFA 2PFQA 4P4PA 4WBZA 4ED2A 5DB7A 2ALZA 3EZ5A 2IA6A 5KFMA 1SZPA 1ZQTA 4EBKA 4MFFA 5BOMA 3GV7B 2W9BB 1QSLA 2W9BA 4DS5A 2ZJ5A 4K4GA 3HP6A 4M9NA 1HUZA 4KLSA 3ORYA 3QE9Y 4M2YA 2PI4A 4TUPA 3MR3A 3T5KA 4I2CA 9ICIA 4ECSA 2BPGA 2I1QA 8ICSA 3GV8B 4Q43A 2W9CA 1HUOA 4C8MA 4RNMA 9ICJA 4IR9A 3OV7A 1IM4A 4J9KA 4RUCA 4I2HA 3C1ZA 3H7IA 4Z6FA 2ZJ8A 5KFLA 4J9SA 1BPYA 1ZETA 4KTQA 4FHPA 3ZDAA 5DBBA 4J9LA 4PGYA 3RB0A 4J9OA 4ED1A 4R63A 1KTQA 1ZQFA 1DK3A 3HIYA 3UQ0A 4JUZA 3QEAZ 2IHNA 3MR5A 5HRDA 3T5LA 2ZHAA 3JPQA 4F4XA 1JN3A 3MFHA 3TAQA 4MEYA 4UB4A 5J2FA 4KMUA 3LK9A 2P66A 2ZJAA 4KN7A 3WFOA 4IG8A 2HHQA 5HRIA 2BPCA 3V7JA 5J2HA 4DL3A 1S0VA 3MDAA 4RUAA 2VA3A 3C2KA 4M6WB 2FLNA 4M6WA 3FYHA 5J2DA 1D8LA 1F5AA 2OWOA 5HNKA 8ICNA 4F91B 5EWFA 2IHMA 4P4MA 1Z00A 5KT4A 3G6XA 1ZQGA 4YR2A 9ICSA 4XQ7A 4J9NA 4B9VA 3RJIA 5KT7A 5KFOA 3JPTA 4QWDA 1MIYA 5CB1A 1MQ2A 4EEYA 3NGDA 7ICNA 1T3NA 4WC1A 2I9GA 3N4MB 1Q79A 2DRAA 4EYIB 3TFRA 4C8OA 5DQGA 4F8RA 4ZH4A 4JV1A 4M9LA 4WC5A 9ICOA 4XUSA 3RJJA 3ZDBA 4JWMA 4EP7A 4DQSA 3HWTA 2M2WA 4XQ8A 1UEUA 4Z6CA 2BHNA 3OJUA 2ASDA 4WC7A 4Q44A 4QZFA 3OGUA 4PGXA 1JXEA 1QSSA 4IRCA 3GIJA 5TZVA 4FS2A 3PY8A 4DFKA 3NYBA 1ZQRA 2ASJA 3H8SA 3Q8KA 3H8WA 4DLGA 1ZQQA 1ZQXA 2C2EA 3B0XA 4EBDA 8ICYA 4R8UB 4R8UA 5DB9A 5J0XA 3SI8A 5HRKA 5HP4A 4WC0A 1QSYA 4C8KA 2ZUDA 3OJSA 3RBEA 4YMNA 4TQRA 5DBAA 2R8KA 4Q8FA 1BNPA 4I29A 5J2IA 4O3RA 1S0OA 4EYHB 5HREA 4X4NA 5HC9A 4KITB 3EPIA 3EWAA 4QZIA 2PFOA 2O1PA 3TARA 4QZAA 9ICTA 2PBEA 2RFFA 3MR6A 4GXIA 3RJEA 1BPZA 4YR3A 4AT7B 4AT7A 4R66A 2JEFA 1XWLA 5DB8A 1S76D 5J0TA 3V7LA 5J2AA 4HYKA 5KFVA 3RH5A 1BPDA 1TKDA 2KP7A 3PX6A 2W8KA 3JYYA 4X4VA 2ZUCA 3EPGA 3ETLA 3THVA 1U48A 3OSPA 4RWQA 4KN4A 1NK4A 3RTVA 4RNOA 3GFKB 3M8RA 1NK7A 4RQ3A 2W9MA 2JZBB 4UAYA 4AT9A 1UT5A 5HRGA 4WC2A 9ICMA 5KFUA 2PFNA 2AU0A 3K4GA 3JZ0A 2Q66A 2ID1A 1B43A 2PXIA 3G6YA 4YFKA 3PVXA 3OUYB 3OUYA 3H40A 2DR5A 5KFSA 3ZDCA 1AROP 4X4RA 1TK5A 1ZQBA 1JQRA 3H3AA 2BCVA 2UVRA 2MAXA 2HHWA 4WC6A 3GILA 4NLGA 2ASLA 7ICOA 2H5XA 4RQ4A 4YP3A 1N48A 3H38A 4X0BA 2XY7A 4JV0A 5L9XA 2AQ4A 2VANA 1NKEA 5CA7A 3E2EA 4DQQA 5KG1A 3PW2A 1ZQEA 9ICRA 7ICEA 5JUMA 4ED7A 5BPCA 1NKBA 2PI5A 1SKWA 1IXRA 4YD1A 3M9NB 3C5GA 4ED0A 1UA1A 5C5JA 1JXLA 2FMPA 4DSJA 3KHRA 8ICBA 8ICIA 2F1JA 1XU4A 4YXMA 4RWOA 4UB2A 5KT5A 8ICQA 5L1KA 8ICFA 5BOLA 4ELTA 5KT6A 9ICQA 3Q8LA 4BXOB 9ICEA 2KN7A 2XCAA 3RJKA 4BXOA 2J6UA 5DQIA 5L1LA 4EBEA 1ZQAA 4R64A 2DPIA 2FPKA 2NRXA 5KTQA 3BQ2A 5HRLA 4M5DA 5HMLA 2B21A 5J0PA 3AQMA 2KZZA 4O3OA 3PX0A 3RAXA 2Q0ZX 4F4KA 1YLQA 5J0WA 3BJYA 4IRKA 4YMOA 2W9CB 7ICJA 1SL1A 4RQ7A 9ICPA 4I2EA 5KT2A 3OSNA 4TUSA 3BQ0A 5KFHA 4X4QA 4NXZA 1MSWD 1R89A 4RQ1A 4MFCA 1BGXT 2RDJA 1S9FA 5KG3A 1TFRA 3PMLA 7ICUA 5HHHA 2XY5A 2IBKA 7ICIA 4DS4A 3GQCA 2UVUA 4NLKA 4DSKA 4IQVA 4DFJA 7ICVA 5D49A 2ZH4A 3RB4A 1ZQMA 4M9JA 4X5VA 4R65A 4RWNA 4RZRA 4F2RA 4I2IA 4Q8EA 1FA0A 4FHXA 4G3IA 4X4PA 8ICRA 4FH3A 4M9HA 4O5KA 2UVWA 3KHGA 1JMSA 5KG5A 3TQ1A 4IQUA 4DQPA 2FMSA 4DFMA 2HVHA 3B0YA 4DF8A 2JEJA 7ICSA 4RWPA 1OU5A 1L3SA 4ELUA 1BPEA 4EZ9A 2M2VA 2HW3A 5KFQA 2ZUBA 4IRDA 3LWMA 1JX4A 2JEIA 4FHWA 1ZQCA 2AJQA 2P6RA 4Q45A 3Q8SB 2R8GA 1Z00B 4GXJA 4YMMA 4IQTA 3OHBA 4WC3A 4O9MA 8ICCA 3C2LA 3AUOA 8ICLA 2HHVA 4F50A 2FPLA 1B22A 1TAQA 3MFIA 3MGHA 2M2TA 4RPXA 5DB6A 2F1HA 2A1JB 9ICCA 2A1JA 4F2SA 5D4BA 4DQRA 4RQ5A 9ICUA 1T8EA 4EZ6A 5CHGA 5KFRA 5CWRA 4DLEA 3PW5A 5F2VO 2NRTA 4PGQA 1RXVA 4O5EA 4KLHA 9ICLA 8ICUA 2KFNA 8ICGA 3AQLA 3GV5B 5KFIA 4KLOA 1ZQZA 4F92B 3GDXA 3T3FA 5HMMA 2F1IA 4M9GA 3GIIA 4DSFA 3V6JA 4YQWA 1HJPA 4B9UA 2BCQA 4UD5A 1PX5A 1LB2B 4QZEA 1T7PA 4UD4A 4O3PA 5KFCA 4ECWA 2VA8A 5CJ7A 3NTUA 1Q78A 1SL2A 5KG4A 2KTQA 4ATBB 4ATBA 4XRHA 3WFPA 1N56A 3ISCA 3C21A 1KSPA 1TAUA 4O0IA 1X2IA 3RAQA 2ISPA 3C23A 4RQ8A 3LQCB 5IIIA 3SZ2A 3C5FA 1NJXA 4NLZA 4QW9A 2J6SA 4YR0A 1XC9A 4QZCA 3G6VA 5KG2A 2XO7A 4EBJA 2RDIA 2ZH2A 4E8FA 1XS9D 5DBCA 5IIOA 4DOCA 1H38A 4NKTA 4YVZA 1MQ3A 4LT6A 4KLUA 3H37A 4BGDA 3HX0A 3PW0A 4KLFA 3RB6A 3K75D 1KFDA 3GIMA 2ZH7A 1BPBA 4O3NA 4J9RA 3UQ2A 2GWSA 4DSLA 4YCXA 5DQHA 5IIJA 1KDHA 5KG6A 1U47A 5HHIA 4UB5A 5DECA 4I2FA 4RNNA 1EXNA 4DO9A 4ED3A 4TURA 7ICKA 4ECTA 3RJHA 2ZH9A 4GC6A 1ZQKA 4WBYA 5DEDA 1NOMA 5KFTA 4KLGA 4E0DA 5DG8A 4MF8A 1NK8A 1RZTA 2AQ0A 3RH4A 8ICOA 9ICVA 5IILA 4BWMA 2W8LA 4O3SA 4I2DA 5J0UA 3QZ8A 5DLFA 4X4SA 9ICNA 7ICFA 4AT9B 4ECUA 3RH6A 3N97B 5CR0A 5DG7A 5HRFA 3LDAA 1WCNA 5KFZA 1NZPA 4DL6A 3AQKA 5DLGA 3UPQA 3AU2A 4M0AA 4K4HA 1S0NA 4F3OA 1X9MA 3WFRE 4YXJA 1DGSA 8ICJA 1U49A 1S0MA 3ISBA 1BVSA 3RRHA 4DQIA 4LVSA 4PHEA 1CUKA 8ICPA 3C18A 1K1SA 4UAWA 4P2HA 4WCWA 4EBCA 1UEVA 3C2MA 2NRZA 4MEXA 4RQ6A 4RT3A 5KFWA 4B9TA 1JAJA 4S3NA 1MIVA 3WFQE 9ICXA 4ECYA 5J2KA 4GLXA 5KFEA 3IHQB 1RXWA 8ICEA 4J9MA 1JIHA 1XO1A 2ISOA 4B9MA 4O5CA 3L9DA 5KG7A 4XA5A 4X0AA 4KLMA 1QTMA 3PW7A 2DRBA 4DSIA 2XCPA 4PHPA 1MC8A 3RB3A 1TFYA 2DR8A 4I2BA 3QEBZ 5J0YA 4RPYA 3BDPA 2XGPA 4F5OA 3FDSA 2BR0A 4DFPA 7ICTA 5KFAA 1COOA 2Y1JA 1NKCA 2HHPA 4KLJA 5L1IA 4KLQA 4F4YA 4FS1A 3BQ1A 3ZDDA 7ICPA 4C8LA 2FLLA 4M04A 1NK5A 2ZHBA 9ICWA 2DR7A 7ICMA 4QWEA 2HHUA 1ZQHA 4ELVA 4I2GA 9ICBA 2ZTDA 3PR5B 4NM2A 3TAPA 5IIKA 1UA0A 5F9NA 1XSLA 4BWJA 2ZH3A 4MF2A 5IINA 4RQ0A 3MR2A 4UB1A 4JV2A 4M47A 4DWIA 1R8BA 3UPSA 1A76A 2XC9A 4UAZA 4FO6A 1KNYA 3OVSA 2ZH6A 2R8IA 4LZDA 5EWGA 4RT2A 4DL7A 1S97A 3PMNA 4I27A 1MIWA 3KHHA 2ZH1A 4QZGA 2DPJA 4O3QA 3PX4A 2NRWA 5KFPA 4TQSA 4TUQA 3PO5A 5KFBA 3LWLA 8ICWA 3WFSC 1Y88A 3SV3A 4X4OA 2C2DA 4F5RA 4FBTA 2NRVA 1XSNA 4ECXA 4QZ8A 4UBCA 8ICTA 1T4GA 2ZTEA 1X9WA 3IM1A 3GIKA 5J2BA 3HPOA 4QWAA 3H4BA 1TK0A 3M9OB 4B9LA 3Q8PB 4DOBA 3M9MB 4PPXA 1L3TA 3EW9A 4QZDA 3MGIA 3PNCA 1SKSA 4B9SA 1ZQUA 3TFSA 2BDPA 8ICKA 3JPSA 1Z3EB 1LV5A 5DKWA 1ZQPA 4C8NA 2IMWP 1RPLA 4NY8A 2M2UA 3C66A 2BQRA 2VA2A 2BQ3A 3KHLA 2KZ3A 4PHAA 3AU6A 5KFJA 3PR4A 5EOZA 4DF4A 1BPXA 3Q8MA 3JPRA 1S10A 7ICLA 7ICRA 3PW4A 2FLPA 1NJWA 2JEGA 4I28A 3OHAA 3V6KA 4QZ9A 5IIMA 4QWCA 4ECVA 2AGPA 4RQ2A 3T5HA 3MBYA 4F4WA 1L3VA 4DL2A 3JPPA 3RBDA 1ZQJA 1ZQNA 3SV4A 8ICAA 4KLLA 5KFXA 4IR1A 4K4IA 2ZH5A 4QWBA 2HVIA 1CEZA 3RRGA 8ICXA 3HW8A 2PFPA 3V7KA 2BQUA 4JWNA 8ICHA 4PH5A 1D8YA 1SL0A 7ICQA 1ZQLA 2V9WA 3ZD8A 4I2JA 4KLIA 1TVAA 1V4AA 1C7YA 2W9AA 3ISDA 1XSPA 4DSEA 3OVAA 1S77D 5KG0A 4RPZA 2BGWA 4NLNA 3RJGA 5D46A 3MABA 1DOQA 1KLNA 4E7XA 2BKEA 4FHYA 1ZQSA 5KFFA 2XY6A 1NJZA 3SYZA 3JPOA 1WOTA 4WC4A 2V4QA 3H39A 2HHSA 4JK1A 4ECQA 2ZH8A 1VFGA 2BCRA 1UT8A 5DGBA 1KEJA 3BQTA 4F93B 3JPNA 1NK6A 2DVIA 5J0QA 5J2EA 2FMQA 9ICFA 4GXKA 3HJ4A 3UXPA 2LYHA 1SKRA 3Q8QB 1V9PA 1KRPA 1ZQWA 5J2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRB A;  1D9F A;  2UVV A;  4ED8 A;  1TFW A;  5KT3 A;  4FH5 A;  2DR9 A;  1U9L A;  4QW8 A;  4FBU A;  1L3U A;  4ECZ A;  3PV8 A;  1NK0 A;  1BNO A;  5HR9 A;  5CP2 A;  3OVB A;  2P6U A;  1U45 A;  3UXO A;  2BCU A;  2BCS A;  2KFZ A;  4J9Q A;  1ZJN A;  4CCH A;  4YN4 A;  2HHT A;  4YG2 A;  1NO5 A;  3HJ1 A;  4DEZ A;  4B9N A;  1D9D A;  4DOA A;  1ZQY A;  5KFK A;  9ICA A;  1ZQI A;  3UXN A;  5J2G A;  1DK2 A;  5DG9 A;  5EWE A;  3EYZ A;  4UQG A;  7ICH A;  3ZD9 A;  1ZJM A;  1KFT A;  4YD2 A;  5J29 A;  4DL4 A;  1RYS A;  5KFD A;  2XGQ A;  4BDP A;  3Q8R B;  1ZYQ A;  1L5U A;  4MFA A;  2AGO A;  2V4R A;  2ZTC A;  4UB3 A;  2MUT B;  2MUT A;  4GC7 A;  4Z6D A;  3V6H A;  2R8J A;  4QZB A;  4PHD A;  4KLT A;  3C1Y A;  3M8S A;  1K1Q A;  3MDC A;  2Y1I A;  1UET A;  4NKU A;  1PZN A;  4I2A A;  5DGA A;  1QLN A;  9ICK A;  5HRH A;  2HHX A;  3HT3 A;  5J2C A;  4IQW A;  4FHV A;  2C2R A;  4F5N A;  3RR7 A;  3RR8 A;  2JZB A;  1TV9 A;  1X9S A;  1ZQV A;  5J0S A;  5KFG A;  3H8J A;  4F5Q A;  1ZQO A;  2BPF A;  5KFY A;  3TI0 A;  3TAN A;  5J0O A;  4X4T A;  4X4U A;  4QZH A;  5F9L A;  9ICG A;  4KLD A;  3QZ7 A;  7ICG A;  5DDY A;  4Z6E A;  3V72 A;  2C22 A;  8ICV A;  1R8C A;  4J9P A;  1RYR A;  3AQN A;  1NK9 A;  2ATL A;  2J6T A;  2NRK A;  1VJ7 A;  5DDM A;  1TK8 A;  9ICH A;  2BE3 A;  1WCL A;  1NJY A;  2O5A A;  8ICM A;  5J0R A;  4AT8 B;  2DFL A;  2M9N A;  4AT8 A;  4KLE A;  2R8H A;  4F5P A;  4F4Z A;  1A77 A;  4ED6 A;  2FPM A;  4UBB A;  5KFN A;  1R8A A;  3ZDE A;  1KFS A;  2AGQ A;  5L1J A;  2WTF A;  1U4B A;  4P4O A;  4DL5 A;  4E80 A;  3T5J A;  1ZQD A;  3H4D A;  2KZM A;  8ICZ A;  4LZG A;  3KTQ A;  4RU9 A;  4ECR A;  4NM1 A;  2C28 A;  3PO4 A;  3RJF A;  2PFQ A;  4P4P A;  4WBZ A;  4ED2 A;  5DB7 A;  2ALZ A;  3EZ5 A;  2IA6 A;  5KFM A;  1SZP A;  1ZQT A;  4EBK A;  4MFF A;  5BOM A;  3GV7 B;  2W9B B;  1QSL A;  2W9B A;  4DS5 A;  2ZJ5 A;  4K4G A;  3HP6 A;  4M9N A;  1HUZ A;  4KLS A;  3ORY A;  3QE9 Y;  4M2Y A;  2PI4 A;  4TUP A;  3MR3 A;  3T5K A;  4I2C A;  9ICI A;  4ECS A;  2BPG A;  2I1Q A;  8ICS A;  3GV8 B;  4Q43 A;  2W9C A;  1HUO A;  4C8M A;  4RNM A;  9ICJ A;  4IR9 A;  3OV7 A;  1IM4 A;  4J9K A;  4RUC A;  4I2H A;  3C1Z A;  3H7I A;  4Z6F A;  2ZJ8 A;  5KFL A;  4J9S A;  1BPY A;  1ZET A;  4KTQ A;  4FHP A;  3ZDA A;  5DBB A;  4J9L A;  4PGY A;  3RB0 A;  4J9O A;  4ED1 A;  4R63 A;  1KTQ A;  1ZQF A;  1DK3 A;  3HIY A;  3UQ0 A;  4JUZ A;  3QEA Z;  2IHN A;  3MR5 A;  5HRD A;  3T5L A;  2ZHA A;  3JPQ A;  4F4X A;  1JN3 A;  3MFH A;  3TAQ A;  4MEY A;  4UB4 A;  5J2F A;  4KMU A;  3LK9 A;  2P66 A;  2ZJA A;  4KN7 A;  3WFO A;  4IG8 A;  2HHQ A;  5HRI A;  2BPC A;  3V7J A;  5J2H A;  4DL3 A;  1S0V A;  3MDA A;  4RUA A;  2VA3 A;  3C2K A;  4M6W B;  2FLN A;  4M6W A;  3FYH A;  5J2D A;  1D8L A;  1F5A A;  2OWO A;  5HNK A;  8ICN A;  4F91 B;  5EWF A;  2IHM A;  4P4M A;  1Z00 A;  5KT4 A;  3G6X A;  1ZQG A;  4YR2 A;  9ICS A;  4XQ7 A;  4J9N A;  4B9V A;  3RJI A;  5KT7 A;  5KFO A;  3JPT A;  4QWD A;  1MIY A;  5CB1 A;  1MQ2 A;  4EEY A;  3NGD A;  7ICN A;  1T3N A;  4WC1 A;  2I9G A;  3N4M B;  1Q79 A;  2DRA A;  4EYI B;  3TFR A;  4C8O A;  5DQG A;  4F8R A;  4ZH4 A;  4JV1 A;  4M9L A;  4WC5 A;  9ICO A;  4XUS A;  3RJJ A;  3ZDB A;  4JWM A;  4EP7 A;  4DQS A;  3HWT A;  2M2W A;  4XQ8 A;  1UEU A;  4Z6C A;  2BHN A;  3OJU A;  2ASD A;  4WC7 A;  4Q44 A;  4QZF A;  3OGU A;  4PGX A;  1JXE A;  1QSS A;  4IRC A;  3GIJ A;  5TZV A;  4FS2 A;  3PY8 A;  4DFK A;  3NYB A;  1ZQR A;  2ASJ A;  3H8S A;  3Q8K A;  3H8W A;  4DLG A;  1ZQQ A;  1ZQX A;  2C2E A;  3B0X A;  4EBD A;  8ICY A;  4R8U B;  4R8U A;  5DB9 A;  5J0X A;  3SI8 A;  5HRK A;  5HP4 A;  4WC0 A;  1QSY A;  4C8K A;  2ZUD A;  3OJS A;  3RBE A;  4YMN A;  4TQR A;  5DBA A;  2R8K A;  4Q8F A;  1BNP A;  4I29 A;  5J2I A;  4O3R A;  1S0O A;  4EYH B;  5HRE A;  4X4N A;  5HC9 A;  4KIT B;  3EPI A;  3EWA A;  4QZI A;  2PFO A;  2O1P A;  3TAR A;  4QZA A;  9ICT A;  2PBE A;  2RFF A;  3MR6 A;  4GXI A;  3RJE A;  1BPZ A;  4YR3 A;  4AT7 B;  4AT7 A;  4R66 A;  2JEF A;  1XWL A;  5DB8 A;  1S76 D;  5J0T A;  3V7L A;  5J2A A;  4HYK A;  5KFV A;  3RH5 A;  1BPD A;  1TKD A;  2KP7 A;  3PX6 A;  2W8K A;  3JYY A;  4X4V A;  2ZUC A;  3EPG A;  3ETL A;  3THV A;  1U48 A;  3OSP A;  4RWQ A;  4KN4 A;  1NK4 A;  3RTV A;  4RNO A;  3GFK B;  3M8R A;  1NK7 A;  4RQ3 A;  2W9M A;  2JZB B;  4UAY A;  4AT9 A;  1UT5 A;  5HRG A;  4WC2 A;  9ICM A;  5KFU A;  2PFN A;  2AU0 A;  3K4G A;  3JZ0 A;  2Q66 A;  2ID1 A;  1B43 A;  2PXI A;  3G6Y A;  4YFK A;  3PVX A;  3OUY B;  3OUY A;  3H40 A;  2DR5 A;  5KFS A;  3ZDC A;  1ARO P;  4X4R A;  1TK5 A;  1ZQB A;  1JQR A;  3H3A A;  2BCV A;  2UVR A;  2MAX A;  2HHW A;  4WC6 A;  3GIL A;  4NLG A;  2ASL A;  7ICO A;  2H5X A;  4RQ4 A;  4YP3 A;  1N48 A;  3H38 A;  4X0B A;  2XY7 A;  4JV0 A;  5L9X A;  2AQ4 A;  2VAN A;  1NKE A;  5CA7 A;  3E2E A;  4DQQ A;  5KG1 A;  3PW2 A;  1ZQE A;  9ICR A;  7ICE A;  5JUM A;  4ED7 A;  5BPC A;  1NKB A;  2PI5 A;  1SKW A;  1IXR A;  4YD1 A;  3M9N B;  3C5G A;  4ED0 A;  1UA1 A;  5C5J A;  1JXL A;  2FMP A;  4DSJ A;  3KHR A;  8ICB A;  8ICI A;  2F1J A;  1XU4 A;  4YXM A;  4RWO A;  4UB2 A;  5KT5 A;  8ICQ A;  5L1K A;  8ICF A;  5BOL A;  4ELT A;  5KT6 A;  9ICQ A;  3Q8L A;  4BXO B;  9ICE A;  2KN7 A;  2XCA A;  3RJK A;  4BXO A;  2J6U A;  5DQI A;  5L1L A;  4EBE A;  1ZQA A;  4R64 A;  2DPI A;  2FPK A;  2NRX A;  5KTQ A;  3BQ2 A;  5HRL A;  4M5D A;  5HML A;  2B21 A;  5J0P A;  3AQM A;  2KZZ A;  4O3O A;  3PX0 A;  3RAX A;  2Q0Z X;  4F4K A;  1YLQ A;  5J0W A;  3BJY A;  4IRK A;  4YMO A;  2W9C B;  7ICJ A;  1SL1 A;  4RQ7 A;  9ICP A;  4I2E A;  5KT2 A;  3OSN A;  4TUS A;  3BQ0 A;  5KFH A;  4X4Q A;  4NXZ A;  1MSW D;  1R89 A;  4RQ1 A;  4MFC A;  1BGX T;  2RDJ A;  1S9F A;  5KG3 A;  1TFR A;  3PML A;  7ICU A;  5HHH A;  2XY5 A;  2IBK A;  7ICI A;  4DS4 A;  3GQC A;  2UVU A;  4NLK A;  4DSK A;  4IQV A;  4DFJ A;  7ICV A;  5D49 A;  2ZH4 A;  3RB4 A;  1ZQM A;  4M9J A;  4X5V A;  4R65 A;  4RWN A;  4RZR A;  4F2R A;  4I2I A;  4Q8E A;  1FA0 A;  4FHX A;  4G3I A;  4X4P A;  8ICR A;  4FH3 A;  4M9H A;  4O5K A;  2UVW A;  3KHG A;  1JMS A;  5KG5 A;  3TQ1 A;  4IQU A;  4DQP A;  2FMS A;  4DFM A;  2HVH A;  3B0Y A;  4DF8 A;  2JEJ A;  7ICS A;  4RWP A;  1OU5 A;  1L3S A;  4ELU A;  1BPE A;  4EZ9 A;  2M2V A;  2HW3 A;  5KFQ A;  2ZUB A;  4IRD A;  3LWM A;  1JX4 A;  2JEI A;  4FHW A;  1ZQC A;  2AJQ A;  2P6R A;  4Q45 A;  3Q8S B;  2R8G A;  1Z00 B;  4GXJ A;  4YMM A;  4IQT A;  3OHB A;  4WC3 A;  4O9M A;  8ICC A;  3C2L A;  3AUO A;  8ICL A;  2HHV A;  4F50 A;  2FPL A;  1B22 A;  1TAQ A;  3MFI A;  3MGH A;  2M2T A;  4RPX A;  5DB6 A;  2F1H A;  2A1J B;  9ICC A;  2A1J A;  4F2S A;  5D4B A;  4DQR A;  4RQ5 A;  9ICU A;  1T8E A;  4EZ6 A;  5CHG A;  5KFR A;  5CWR A;  4DLE A;  3PW5 A;  5F2V O;  2NRT A;  4PGQ A;  1RXV A;  4O5E A;  4KLH A;  9ICL A;  8ICU A;  2KFN A;  8ICG A;  3AQL A;  3GV5 B;  5KFI A;  4KLO A;  1ZQZ A;  4F92 B;  3GDX A;  3T3F A;  5HMM A;  2F1I A;  4M9G A;  3GII A;  4DSF A;  3V6J A;  4YQW A;  1HJP A;  4B9U A;  2BCQ A;  4UD5 A;  1PX5 A;  1LB2 B;  4QZE A;  1T7P A;  4UD4 A;  4O3P A;  5KFC A;  4ECW A;  2VA8 A;  5CJ7 A;  3NTU A;  1Q78 A;  1SL2 A;  5KG4 A;  2KTQ A;  4ATB B;  4ATB A;  4XRH A;  3WFP A;  1N56 A;  3ISC A;  3C21 A;  1KSP A;  1TAU A;  4O0I A;  1X2I A;  3RAQ A;  2ISP A;  3C23 A;  4RQ8 A;  3LQC B;  5III A;  3SZ2 A;  3C5F A;  1NJX A;  4NLZ A;  4QW9 A;  2J6S A;  4YR0 A;  1XC9 A;  4QZC A;  3G6V A;  5KG2 A;  2XO7 A;  4EBJ A;  2RDI A;  2ZH2 A;  4E8F A;  1XS9 D;  5DBC A;  5IIO A;  4DOC A;  1H38 A;  4NKT A;  4YVZ A;  1MQ3 A;  4LT6 A;  4KLU A;  3H37 A;  4BGD A;  3HX0 A;  3PW0 A;  4KLF A;  3RB6 A;  3K75 D;  1KFD A;  3GIM A;  2ZH7 A;  1BPB A;  4O3N A;  4J9R A;  3UQ2 A;  2GWS A;  4DSL A;  4YCX A;  5DQH A;  5IIJ A;  1KDH A;  5KG6 A;  1U47 A;  5HHI A;  4UB5 A;  5DEC A;  4I2F A;  4RNN A;  1EXN A;  4DO9 A;  4ED3 A;  4TUR A;  7ICK A;  4ECT A;  3RJH A;  2ZH9 A;  4GC6 A;  1ZQK A;  4WBY A;  5DED A;  1NOM A;  5KFT A;  4KLG A;  4E0D A;  5DG8 A;  4MF8 A;  1NK8 A;  1RZT A;  2AQ0 A;  3RH4 A;  8ICO A;  9ICV A;  5IIL A;  4BWM A;  2W8L A;  4O3S A;  4I2D A;  5J0U A;  3QZ8 A;  5DLF A;  4X4S A;  9ICN A;  7ICF A;  4AT9 B;  4ECU A;  3RH6 A;  3N97 B;  5CR0 A;  5DG7 A;  5HRF A;  3LDA A;  1WCN A;  5KFZ A;  1NZP A;  4DL6 A;  3AQK A;  5DLG A;  3UPQ A;  3AU2 A;  4M0A A;  4K4H A;  1S0N A;  4F3O A;  1X9M A;  3WFR E;  4YXJ A;  1DGS A;  8ICJ A;  1U49 A;  1S0M A;  3ISB A;  1BVS A;  3RRH A;  4DQI A;  4LVS A;  4PHE A;  1CUK A;  8ICP A;  3C18 A;  1K1S A;  4UAW A;  4P2H A;  4WCW A;  4EBC A;  1UEV A;  3C2M A;  2NRZ A;  4MEX A;  4RQ6 A;  4RT3 A;  5KFW A;  4B9T A;  1JAJ A;  4S3N A;  1MIV A;  3WFQ E;  9ICX A;  4ECY A;  5J2K A;  4GLX A;  5KFE A;  3IHQ B;  1RXW A;  8ICE A;  4J9M A;  1JIH A;  1XO1 A;  2ISO A;  4B9M A;  4O5C A;  3L9D A;  5KG7 A;  4XA5 A;  4X0A A;  4KLM A;  1QTM A;  3PW7 A;  2DRB A;  4DSI A;  2XCP A;  4PHP A;  1MC8 A;  3RB3 A;  1TFY A;  2DR8 A;  4I2B A;  3QEB Z;  5J0Y A;  4RPY A;  3BDP A;  2XGP A;  4F5O A;  3FDS A;  2BR0 A;  4DFP A;  7ICT A;  5KFA A;  1COO A;  2Y1J A;  1NKC A;  2HHP A;  4KLJ A;  5L1I A;  4KLQ A;  4F4Y A;  4FS1 A;  3BQ1 A;  3ZDD A;  7ICP A;  4C8L A;  2FLL A;  4M04 A;  1NK5 A;  2ZHB A;  9ICW A;  2DR7 A;  7ICM A;  4QWE A;  2HHU A;  1ZQH A;  4ELV A;  4I2G A;  9ICB A;  2ZTD A;  3PR5 B;  4NM2 A;  3TAP A;  5IIK A;  1UA0 A;  5F9N A;  1XSL A;  4BWJ A;  2ZH3 A;  4MF2 A;  5IIN A;  4RQ0 A;  3MR2 A;  4UB1 A;  4JV2 A;  4M47 A;  4DWI A;  1R8B A;  3UPS A;  1A76 A;  2XC9 A;  4UAZ A;  4FO6 A;  1KNY A;  3OVS A;  2ZH6 A;  2R8I A;  4LZD A;  5EWG A;  4RT2 A;  4DL7 A;  1S97 A;  3PMN A;  4I27 A;  1MIW A;  3KHH A;  2ZH1 A;  4QZG A;  2DPJ A;  4O3Q A;  3PX4 A;  2NRW A;  5KFP A;  4TQS A;  4TUQ A;  3PO5 A;  5KFB A;  3LWL A;  8ICW A;  3WFS C;  1Y88 A;  3SV3 A;  4X4O A;  2C2D A;  4F5R A;  4FBT A;  2NRV A;  1XSN A;  4ECX A;  4QZ8 A;  4UBC A;  8ICT A;  1T4G A;  2ZTE A;  1X9W A;  3IM1 A;  3GIK A;  5J2B A;  3HPO A;  4QWA A;  3H4B A;  1TK0 A;  3M9O B;  4B9L A;  3Q8P B;  4DOB A;  3M9M B;  4PPX A;  1L3T A;  3EW9 A;  4QZD A;  3MGI A;  3PNC A;  1SKS A;  4B9S A;  1ZQU A;  3TFS A;  2BDP A;  8ICK A;  3JPS A;  1Z3E B;  1LV5 A;  5DKW A;  1ZQP A;  4C8N A;  2IMW P;  1RPL A;  4NY8 A;  2M2U A;  3C66 A;  2BQR A;  2VA2 A;  2BQ3 A;  3KHL A;  2KZ3 A;  4PHA A;  3AU6 A;  5KFJ A;  3PR4 A;  5EOZ A;  4DF4 A;  1BPX A;  3Q8M A;  3JPR A;  1S10 A;  7ICL A;  7ICR A;  3PW4 A;  2FLP A;  1NJW A;  2JEG A;  4I28 A;  3OHA A;  3V6K A;  4QZ9 A;  5IIM A;  4QWC A;  4ECV A;  2AGP A;  4RQ2 A;  3T5H A;  3MBY A;  4F4W A;  1L3V A;  4DL2 A;  3JPP A;  3RBD A;  1ZQJ A;  1ZQN A;  3SV4 A;  8ICA A;  4KLL A;  5KFX A;  4IR1 A;  4K4I A;  2ZH5 A;  4QWB A;  2HVI A;  1CEZ A;  3RRG A;  8ICX A;  3HW8 A;  2PFP A;  3V7K A;  2BQU A;  4JWN A;  8ICH A;  4PH5 A;  1D8Y A;  1SL0 A;  7ICQ A;  1ZQL A;  2V9W A;  3ZD8 A;  4I2J A;  4KLI A;  1TVA A;  1V4A A;  1C7Y A;  2W9A A;  3ISD A;  1XSP A;  4DSE A;  3OVA A;  1S77 D;  5KG0 A;  4RPZ A;  2BGW A;  4NLN A;  3RJG A;  5D46 A;  3MAB A;  1DOQ A;  1KLN A;  4E7X A;  2BKE A;  4FHY A;  1ZQS A;  5KFF A;  2XY6 A;  1NJZ A;  3SYZ A;  3JPO A;  1WOT A;  4WC4 A;  2V4Q A;  3H39 A;  2HHS A;  4JK1 A;  4ECQ A;  2ZH8 A;  1VFG A;  2BCR A;  1UT8 A;  5DGB A;  1KEJ A;  3BQT A;  4F93 B;  3JPN A;  1NK6 A;  2DVI A;  5J0Q A;  5J2E A;  2FMQ A;  9ICF A;  4GXK A;  3HJ4 A;  3UXP A;  2LYH A;  1SKR A;  3Q8Q B;  1V9P A;  1KRP A;  1ZQW A;  5J2J A; 
#chains in the Genus database with same CATH topology
 2UVV A;  1U9L A;  3I1Y A;  2BCU A;  5KAF U;  2BCS A;  4J9Q A;  4CCH A;  4YN4 A;  4YG2 A;  1MN8 A;  4DOA A;  2DF4 B;  4EEL A;  3EYZ A;  1KFT A;  4DL4 A;  1RYS A;  4BDP A;  2QAR A;  2Y9U A;  2V4R A;  2ZTC A;  2AGO A;  2R8J A;  1RDF A;  3C1Y A;  2IOF A;  3FC4 A;  2Y1I A;  1UET A;  4NKU A;  3AL0 B;  1QLN A;  9ICK A;  5HRH A;  2HHX A;  3WK8 A;  4UAU A;  3HT3 A;  4PJ0 U;  4IQW A;  2C2R A;  3RR7 A;  4O68 A;  2JZB A;  4Y2J A;  3H8J A;  1V85 A;  1RM6 C;  5J0O A;  4X4U A;  4QZH A;  5F9L A;  9ICG A;  4NL9 A;  3QZ7 A;  7ICG A;  2C22 A;  2W11 A;  4CGZ A;  8ICV A;  1RYR A;  3AQN A;  2DL0 A;  3IP4 B;  1TK8 A;  9ICH A;  1WCL A;  2GA9 D;  5B3Q A;  2DFL A;  4AT8 A;  2FCL A;  4F5P A;  4F4Z A;  1A77 A;  5KFN A;  1LVH A;  3IRU A;  5L1J A;  1U4B A;  4E80 A;  4GIB A;  4LZG A;  3M6Z A;  3KTQ A;  2C28 A;  3RJF A;  4P4P A;  4WBZ A;  5DB7 A;  4EEB A;  5CFT A;  1ZQT A;  5KNI A;  2W9B B;  5B66 U;  1F0M A;  4C0Z A;  3QE9 Y;  4M2Y A;  2PI4 A;  4TUP A;  4I2C A;  8ICS A;  5ALV A;  3GV8 B;  3HKZ C;  4IR9 A;  3OV7 A;  2NO5 A;  4RUC A;  3D2Q A;  3C1Z A;  3H7I A;  4Z6F A;  5KFL A;  4NXT A;  1ZET A;  3ZDA A;  5DBB A;  4PGY A;  4ED1 A;  1KTQ A;  5D61 A;  2HOF A;  3MR5 A;  2A19 A;  2P66 A;  4O69 A;  2ZJA A;  3WFO A;  3L5K A;  5J2H A;  2VA3 A;  3C2K A;  1SV0 C;  4M6W B;  2OWO A;  1Z19 A;  4FZN A;  2IHM A;  1ZQG A;  4B9V A;  5CHE A;  3RJI A;  3F5A A;  1MIY A;  3NGD A;  2YN4 A;  5AIA A;  3H0R B;  5ALE A;  1ECW A;  3BQ7 A;  4F8R A;  3QU9 A;  5AI5 A;  4C8O A;  4JV1 A;  5HR6 A;  2M2W A;  3SD7 A;  2BHN A;  4Q44 A;  4IRC A;  4PGX A;  5G5G A;  1JAL A;  1NNL A;  3NYB A;  2LKY A;  3B0X A;  5J0X A;  5HRK A;  1Q3V A;  4WC0 A;  3T79 A;  2PMZ F;  2ZUD A;  3RBE A;  5JTG A;  4O6A A;  3NVY A;  5HRE A;  5A0L A;  5AKK A;  2QAR B;  1NZB A;  2E1F A;  3MR6 A;  4PZO A;  3L3F X;  4QJF B;  4AT7 A;  1XWL A;  3CRX A;  4HYK A;  5J2A A;  3RH5 A;  2FI1 A;  2W8K A;  1JRO A;  4KN4 A;  1NK4 A;  3RTV A;  3M8R A;  2W9M A;  2JZB B;  4UAY A;  5HRG A;  2KJ9 A;  3BS7 A;  2PFN A;  4CF4 A;  5TIS U;  2ID1 A;  2G5H B;  4FO1 A;  1B43 A;  2PXI A;  3OUY B;  3I28 A;  3H40 A;  3RF9 A;  5KFS A;  1ZQB A;  2MAX A;  4C4T A;  4WC6 A;  4NLG A;  2ASL A;  1N48 A;  4RQ4 A;  4YP3 A;  1NKE A;  5CA7 A;  9ICR A;  3WK5 A;  2LI6 A;  5BPC A;  1SKW A;  2FMP A;  1UA1 A;  8ICI A;  4DSJ A;  2F1J A;  4UB2 A;  1SWW A;  1FA0 A;  2KN7 A;  2GOL A;  2NRX A;  5HRL A;  1SWV A;  3KOO A;  2PMZ C;  3NVV A;  2KZZ A;  3PX0 A;  5D63 A;  3OSN A;  5EE1 A;  1MSW D;  2RDJ A;  7ICU A;  5HHH A;  2XY5 A;  2IBK A;  4DSK A;  4DFJ A;  4C7Z A;  2CPR A;  4M9J A;  4LJX A;  3AEV A;  4R65 A;  5AIC A;  8ICR A;  3KFU F;  1JMS A;  2KKP A;  1UHU A;  1SXE A;  1PVP A;  3M7D A;  2FMS A;  4P0P B;  2ODG A;  4RWP A;  5AM2 A;  2W43 A;  2W3R A;  1L3S A;  4ELU A;  3BZK A;  1N5X A;  2M2V A;  4F72 A;  2ZIU A;  4Q45 A;  4YMM A;  4JMU A;  4O9M A;  8ICC A;  3AUO A;  2HHV A;  4F50 A;  2ZIV A;  2FPL A;  2YY6 A;  3B9J A;  3MGH A;  3WKB A;  2EAO A;  2DWQ A;  3VCB A;  5D4B A;  4DQR A;  2IOF K;  4C80 A;  4HAI A;  3E0F A;  5CHG A;  5CWR A;  4PGQ A;  3GV5 B;  4F92 B;  1M6Y A;  4OJ5 A;  3LVW A;  1LB2 B;  1N63 A;  1Q78 A;  2RQ5 A;  4ECW A;  1SL2 A;  4ATB A;  2H3Q A;  2ISP A;  1T3Q A;  3C5F A;  3SZ2 A;  3K7D A;  4QW9 A;  4Y2X A;  5KG2 A;  4EBJ A;  2RDI A;  4PL1 A;  4E8F A;  1WWU A;  1IIP A;  4RQN A;  4YVZ A;  1FIQ A;  3HX0 A;  3K75 D;  5ALZ A;  3UQ2 A;  5ALU A;  5IIJ A;  2HI0 A;  5KG6 A;  4UB5 A;  5DEC A;  4KX3 A;  3RJH A;  4GC6 A;  4EED A;  1NOM A;  2KOB A;  5KFT A;  4K97 A;  4NV0 A;  2AQ0 A;  5AK3 A;  3QUT A;  4O3S A;  4X4S A;  5DLF A;  5CR0 A;  3UPQ A;  1S0N A;  1S8O A;  1PK3 A;  2VJ5 A;  2D8C A;  4LVS A;  1WWV A;  3NRW A;  4UAW A;  1JAJ A;  4S3N A;  2WF6 A;  5J2K A;  1RXW A;  4B9M A;  4DFD A;  4JLZ A;  4KLM A;  1QTM A;  4DSI A;  2DR8 A;  4OAF A;  1XO0 A;  2Y1J A;  1NKC A;  4KLQ A;  4F4Y A;  3BQ1 A;  2FJ6 A;  2FLL A;  2DR7 A;  1NK5 A;  7ICM A;  2ZTD A;  4NM2 A;  3SMV A;  4BWJ A;  1LKY B;  4DWI A;  1R8B A;  1A76 A;  1IV8 A;  2XC9 A;  4WOY A;  3OVS A;  2ZH6 A;  2ZH1 A;  3PMN A;  3KHH A;  2RHF A;  5AKE A;  1Y88 A;  2EAM A;  2KIW A;  1T4G A;  5AKH A;  1TK0 A;  4CNQ A;  4B9L A;  1KKX A;  1DGJ A;  3NAS A;  3TAC B;  3PNC A;  1SKS A;  2KD1 A;  2BDP A;  2Q4T A;  2G5I B;  2HSZ A;  1SGG A;  3OPX A;  2HCF A;  2VA2 A;  2KZ3 A;  4PHA A;  2P35 A;  3KZX A;  5IIM A;  4QZ9 A;  2AGP A;  4RQ2 A;  1Z4N A;  1NI3 A;  5ALQ A;  3RBD A;  4KLL A;  4IR1 A;  2ZH5 A;  5JTI A;  2HMX A;  2HVI A;  1O03 A;  4PH5 A;  1SL0 A;  1DXS A;  2KVC A;  4GFJ A;  4I2J A;  1TVA A;  2HN1 A;  2W9A A;  3OVA A;  4AP9 A;  1S77 D;  1MA7 A;  1NJZ A;  3SYZ A;  3JPO A;  4WC4 A;  2V4Q A;  3H39 A;  2HHS A;  2I5H A;  2BCR A;  5DGB A;  3H8M A;  2W3S A;  3UXP A;  1ZQ1 C;  5KT3 A;  4FBU A;  1SV4 A;  5AK6 A;  4ECZ A;  1L6N A;  5HR9 A;  2AXT U;  2F3N A;  3N7R C;  5AI0 A;  1U45 A;  4K98 A;  1ZJN A;  2HHT A;  2R18 A;  1ZQY A;  5KFK A;  5J2G A;  1DK2 A;  5EWE A;  1ZJM A;  1N2X A;  3M1Y A;  2KK0 A;  5KFD A;  1ZYQ A;  2QKQ A;  4UB3 A;  2FDR A;  1FEZ A;  4GC7 A;  2KIC A;  2E8N A;  4QZB A;  3IG8 A;  2VJ4 A;  4NXX A;  4KLT A;  3MDC A;  5ALL A;  1PZN A;  4I2A A;  5ALS A;  5J8Y A;  4K99 A;  2KVS A;  5J0S A;  5KFG A;  3TI0 A;  4X4T A;  4NLB A;  4LEY A;  3V72 A;  2JMG A;  1Z1V A;  1NJY A;  2O5A A;  2M9N A;  1SZH A;  3QU5 A;  1R8A A;  4DCC A;  2JHD A;  1FO4 A;  2K60 A;  4P4O A;  4DL5 A;  3H4D A;  2KZM A;  4NM1 A;  5ALN A;  3J81 j;  5AM5 A;  3EZ5 A;  5KFM A;  1SZP A;  5BOM A;  1QSL A;  2W9B A;  4K4G A;  3HP6 A;  4M9N A;  1HUZ A;  2GO7 A;  3QUQ A;  9ICI A;  3T5K A;  2HBL A;  4RNM A;  4J9K A;  5GTH U;  2ZJ8 A;  5ALW A;  2E8M A;  4J9S A;  4J9L A;  3RB0 A;  1ZQF A;  2W54 A;  1JN3 A;  4MEY A;  4UB4 A;  3LK9 A;  2QLT A;  4KN7 A;  1B0X A;  3FAH A;  1S0V A;  2FLN A;  4M6W A;  5J2D A;  1D8L A;  8ICN A;  4JB3 A;  4CF3 A;  4P4M A;  3G6X A;  3UMB A;  9ICS A;  5KT7 A;  5KFO A;  4EEY A;  1T3N A;  2I9G A;  2DRA A;  4M9L A;  1J97 A;  2KJ5 A;  9ICO A;  5AK5 A;  2ZXH A;  1J2N A;  4JWM A;  4DQS A;  2YMM A;  4PZN A;  1UEU A;  4WC7 A;  2ASD A;  1JXE A;  2JXJ A;  4FS2 A;  4OJO A;  4DFK A;  3PY8 A;  3H8S A;  4DLG A;  1ZQQ A;  3SAF A;  1F5S A;  4Q8F A;  2KHV A;  2H3V A;  3HKZ F;  2CXY A;  4KIT B;  4QZI A;  2O1P A;  2RFF A;  3K1Z A;  2JEF A;  5DB8 A;  2KP7 A;  5KFV A;  5KAI U;  1BPD A;  5KL8 B;  4BUG A;  3JYY A;  4X4V A;  1U48 A;  2WFA A;  5ALR A;  4RNO A;  2QB1 A;  3UM9 A;  4AT9 A;  9ICM A;  3TKA A;  4P0Q A;  5JU5 A;  2Q66 A;  3G6Y A;  4YFK A;  3OUY A;  2QB0 A;  2DR5 A;  1WYG A;  3ZDC A;  4B6J A;  1N60 A;  3PSI A;  1TK5 A;  1JQR A;  2BCV A;  4OJL A;  1PK1 B;  1ZD2 P;  1N5W A;  1Z4O A;  5L9X A;  2AQ4 A;  4LEZ A;  3PW2 A;  2XID A;  5JUM A;  1IXR A;  3ZI4 A;  1JXL A;  8ICB A;  4UAS A;  3QU4 A;  3NRZ A;  5F3X B;  8ICQ A;  5BOL A;  3Q8L A;  2XCA A;  5DQI A;  1IG6 A;  4R64 A;  5KTQ A;  2WHE A;  4M5D A;  5ALT A;  3AQM A;  3F5E A;  2Q0Z X;  1YLQ A;  4IRK A;  7ICJ A;  4RQ7 A;  5KT2 A;  3ER9 B;  3D2N A;  4X4Q A;  4RQ1 A;  4MFC A;  1BGX T;  1S9F A;  3F53 A;  3HJE A;  1TFR A;  5KG3 A;  3PML A;  7ICI A;  1C20 A;  3IG5 A;  2ZG6 A;  4ZOH C;  2RRD A;  2HBJ A;  3MCR A;  2XVT A;  4FZM A;  3CW2 C;  4Q8E A;  4I2I A;  1ZD3 A;  2UVW A;  2G09 A;  5KG5 A;  1COK A;  4IQU A;  4DFM A;  1ZOL A;  1QCK A;  3WU2 U;  1Q46 A;  4P0P A;  4EZ9 A;  1JX4 A;  1ZQC A;  5L1M A;  2R8G A;  3Q8S B;  4N7R A;  2N1R A;  3CP8 A;  4GXJ A;  3A0H U;  5AKY A;  5GTI U;  1B22 A;  4RQ5 A;  5AM3 A;  1SIJ A;  5KFR A;  5F2V O;  2NRT A;  1RXV A;  4O5E A;  3AQL A;  1X42 A;  2JH1 A;  3GDX A;  2F1I A;  3GII A;  3CK6 A;  1L7P A;  4WQK A;  1PX5 A;  4QZE A;  2BDU A;  3NTU A;  2EZY A;  4J03 A;  3F2B A;  2YML A;  3WFP A;  3ISC A;  3C21 A;  3RFA A;  3RAQ A;  1JRP A;  1SV0 A;  4NLZ A;  3D6J A;  5AKI A;  2JRZ A;  4QZC A;  2XO7 A;  2VIX A;  1QH9 A;  5DBC A;  5IIO A;  2F77 X;  4DOC A;  1MQ3 A;  4BGD A;  3PW0 A;  4KLF A;  1X6I A;  5DQH A;  1KDH A;  4RNN A;  7ICK A;  4ECT A;  3TAD C;  4WBY A;  4CRX A;  4FZL A;  5CRX A;  5DG8 A;  9ICV A;  3RH4 A;  3WKC A;  3EF2 A;  4I2D A;  5J0U A;  2YX8 A;  4AT9 B;  4K9B A;  5DG7 A;  3LDA A;  1NZP A;  4DL6 A;  4P0Q B;  4M0A A;  2QB0 B;  4F3O A;  5AM4 A;  4YXJ A;  1DGS A;  1U49 A;  3ISB A;  1SB3 C;  1BVS A;  3RRH A;  1PVQ A;  3C18 A;  1K1S A;  2A3V A;  2WB1 F;  1P7D A;  5KFW A;  2DBY A;  9ICX A;  4ECY A;  5KFE A;  2G08 A;  2B0C A;  2ISO A;  1JIH A;  4O5C A;  3L9D A;  4UAR A;  4X0A A;  2EAP A;  2NV3 A;  3RB3 A;  4I2B A;  5J0Y A;  3BDP A;  2BR0 A;  3FDS A;  4DFP A;  4US9 A;  5KFA A;  4BX9 C;  5L1I A;  4FS1 A;  4M04 A;  2E1E A;  1ZQH A;  2EWR A;  4ELV A;  4OAI Z;  4NWI A;  2W03 A;  4JV2 A;  1LKY A;  2PKE A;  4LZD A;  5EWG A;  4RT2 A;  1S97 A;  1WUD A;  3PO5 A;  4TQS A;  5KFB A;  3LWL A;  2D6F C;  4X4O A;  4UB6 U;  4FBT A;  2XIC A;  4PL2 A;  4QZ8 A;  4ECX A;  8ICT A;  1X9W A;  3HPO A;  3H4B A;  4QWA A;  2MU2 A;  3Q8P B;  3M9M B;  2LBO A;  4PPX A;  1L3T A;  4O3M A;  5ALD A;  1Z3E B;  1LV5 A;  2IMW P;  1RPL A;  3SAG A;  3C66 A;  2BQR A;  1FFU A;  1L8L A;  1B4F A;  3AU6 A;  1S10 A;  3V6K A;  4CF5 A;  2WB1 C;  4F4W A;  5AKG A;  1L3V A;  2MRL A;  4ACO A;  3JPP A;  1ZQJ A;  1RG6 A;  3SV4 A;  3WK7 A;  2IUB A;  3KZI U;  1CEZ A;  2KNJ A;  3HW8 A;  4UAV A;  4JWN A;  7ICQ A;  2DKX A;  3ALR A;  5KG0 A;  4NLN A;  3SQI A;  2BKE A;  5KFF A;  2WAQ C;  3JPN A;  2DVI A;  1NK6 A;  3KD3 A;  5J2E A;  3JCF A;  1V9P A;  1ZQW A;  1TFW A;  1CI4 A;  4QW8 A;  3PV8 A;  1NK0 A;  4OD0 A;  3UXO A;  1L8O A;  2KFZ A;  4EP7 A;  1NO5 A;  1UCV A;  3HJ1 A;  4DEZ A;  4B9N A;  4C4R A;  3KKA C;  9ICA A;  1ZQI A;  5DG9 A;  4UQG A;  3ZD9 A;  4YD2 A;  5J29 A;  3M6K A;  2XGQ A;  4JLX A;  3Q8R B;  1L5U A;  4MFA A;  2MUT B;  4Z6D A;  3V6H A;  4PHD A;  1ZRM A;  4EEK A;  1K1Q A;  1RYU A;  5DGA A;  1PUZ A;  2K4I A;  5J2C A;  4FHV A;  3QUB A;  2H3F A;  1X9S A;  3WK9 A;  4F5Q A;  1ZQO A;  2BPF A;  1GPJ A;  5DDY A;  4Z6E A;  4UB8 U;  1VDV A;  2F2A B;  2ATL A;  2LM4 A;  2J6T A;  1VJ7 A;  2NRK A;  1YZ7 A;  5DDM A;  2BE3 A;  4KLE A;  2R8H A;  4ED6 A;  2FPM A;  2OXO A;  3QU7 A;  3LVV A;  3T5J A;  2Y9T A;  3N7S C;  4RU9 A;  4ECR A;  3PO4 A;  2YB4 A;  2KHQ A;  1L7M A;  2O6K A;  2ALZ A;  2IA6 A;  3GV7 B;  4KLS A;  3EUB 2;  3MR3 A;  3AQE A;  4ECS A;  2BPG A;  2I1Q A;  2W9C A;  1HUO A;  9ICJ A;  4MKP A;  1X9X A;  2HDO A;  1UQV A;  2DKZ A;  4I2H A;  4FHP A;  1ZXI A;  2E3T A;  4QIW C;  4J9O A;  4R63 A;  2HBK A;  5ALI A;  3HIY A;  4KX5 A;  3QEA Z;  2IHN A;  3T5L A;  4WH5 A;  5AI8 A;  3MFH A;  3TAQ A;  5J2F A;  1X40 A;  4KMU A;  1T94 A;  2HHQ A;  5HRI A;  2BPC A;  5KL1 B;  4RUA A;  1F5A A;  1N62 A;  5EWF A;  1JUD A;  1Z00 A;  4YR2 A;  4XQ7 A;  4J9N A;  4QWD A;  1MQ2 A;  4WC1 A;  7ICN A;  3AMZ A;  1Q79 A;  2K8A A;  4EYI B;  5B3P A;  5K4L A;  3DDH A;  4XUS A;  1KQQ A;  3RJJ A;  2K4P A;  4XQ8 A;  2KSO B;  4Z6C A;  3OJU A;  3O0F A;  4QZF A;  5TZV A;  2ASJ A;  3Q8K A;  3H8W A;  5ALM A;  1ZQX A;  2C2E A;  8ICY A;  4R8U B;  5DB9 A;  4K9A A;  3SI8 A;  5HP4 A;  3E58 A;  3NVW A;  1L7N A;  5H2F U;  3OJS A;  5EE3 A;  4I29 A;  5J2I A;  1S0O A;  4X4N A;  3EPI A;  5AIB A;  2PFO A;  3TAR A;  4QZA A;  9ICT A;  4Y2T A;  4GXI A;  1BPZ A;  4YR3 A;  4R66 A;  2HN2 A;  5J0T A;  3NUQ A;  3ETL A;  3OSP A;  3BZC A;  5AM1 A;  3GU3 A;  4RQ3 A;  1UT5 A;  1QQ6 A;  2EQY A;  4OAH A;  4Y2Y A;  1KBU A;  3PVX A;  1ARO P;  3C29 A;  3H3A A;  4UAT A;  2HHW A;  4EGW A;  1PK1 A;  1ZRN A;  7ICO A;  2H5X A;  3H38 A;  2XY7 A;  4JV0 A;  3BS5 B;  3E2E A;  5KG1 A;  1ZQE A;  7ICE A;  3SR6 A;  3M9N B;  3C5G A;  2F8L A;  5KT5 A;  3LYS A;  4ELT A;  8ICF A;  4BXO B;  9ICE A;  2J6U A;  1ZQA A;  3IN5 A;  2DPI A;  2EDU A;  3BQ2 A;  4FE3 A;  5HML A;  3PSF A;  4O3O A;  2W9C B;  1KW4 A;  9ICP A;  4TUS A;  3BQ0 A;  4NXZ A;  5ALG A;  1R89 A;  2BBH A;  4DS4 A;  3GQC A;  2UVU A;  4WQL A;  4IQV A;  1PVR A;  3RB4 A;  1Q8K A;  4RWN A;  4FHX A;  4X4P A;  3KHG A;  3TQ1 A;  2HBM A;  2H3I A;  2JEI A;  3LWM A;  2LYB A;  1Z00 B;  4MHV A;  4IQT A;  4WC3 A;  1TAQ A;  3MFI A;  2M2T A;  2F1H A;  2A1J B;  4F2S A;  9ICU A;  4EZ6 A;  3PW5 A;  4DLE A;  9ICL A;  4KLH A;  3K1R B;  1ZQZ A;  1YT3 A;  4M9G A;  4YQW A;  4I0U A;  1HJP A;  4B9U A;  2BCQ A;  2VA8 A;  4US8 A;  3IDW A;  5KG4 A;  4Y2S A;  2E8O A;  4XRH A;  1N56 A;  1TAU A;  4O0I A;  1V97 A;  1X2I A;  3LQC B;  5III A;  2WF8 A;  1Q3U A;  3IV6 A;  5CFU A;  1VJ5 A;  1XS9 D;  5HR7 A;  2G06 A;  1H38 A;  1FFV A;  4KLU A;  3H37 A;  2ZH7 A;  1KFD A;  1BPB A;  4O3N A;  5AKZ A;  3KBB A;  4TUR A;  4NL9 C;  1ZQK A;  5DED A;  4KLG A;  5C0Y A;  4E0D A;  4MF8 A;  1NK8 A;  4BWM A;  3QZ8 A;  2EZX A;  4AYB F;  3N28 A;  2M0N A;  2B56 A;  4ECU A;  3RH6 A;  3PST A;  5HRF A;  1WCN A;  5KFZ A;  3AQK A;  2K89 A;  4KB6 A;  3AU2 A;  3WFR E;  4K4H A;  2LM1 A;  8ICJ A;  4DQI A;  3PHZ A;  4PHE A;  8ICP A;  4P2H A;  4EV6 A;  1D8B A;  1UEV A;  4MEX A;  4RQ6 A;  4RT3 A;  4B9T A;  3D2S A;  5E79 U;  3QUC A;  4GLX A;  2ZH9 A;  8ICE A;  3IHQ B;  4J9M A;  1XO1 A;  2I6X A;  2IHO A;  5KG7 A;  1K5O A;  2DRB A;  3PW7 A;  3QNM A;  3QEB Z;  4F5O A;  7ICT A;  3AM9 A;  2GH1 A;  3SEN A;  2ZIX B;  4KLJ A;  2RP5 A;  7ICP A;  5FP0 A;  4Y2U A;  9ICW A;  4I2G A;  1UA0 A;  4FFD A;  2ZH3 A;  5T14 A;  4MF2 A;  5IIN A;  4RQ0 A;  3N7P D;  4UB1 A;  3UPS A;  3A0B U;  3CYM A;  4UAZ A;  1KNY A;  3WK4 A;  1Z1B A;  2R8I A;  4CDG A;  4I27 A;  1CRX A;  2KIV A;  4O3Q A;  2NRW A;  4TUQ A;  8ICW A;  3WFS C;  3SV3 A;  2C2D A;  5ALX A;  2NRV A;  1XSN A;  1X66 A;  2ZTE A;  5J2B A;  2ZIW B;  4C7Y A;  1QQ7 A;  4AYB C;  1XNS A;  3EW9 A;  4QZD A;  4B9S A;  1ZQU A;  3ETR A;  2LPE A;  3TFS A;  8ICK A;  3JPS A;  5DKW A;  2M2U A;  7ICL A;  5EOZ A;  3Q8M A;  2HOI A;  3PW4 A;  2JEG A;  4CE6 A;  2RLT A;  3T5H A;  1RQL A;  2AH5 A;  4DL2 A;  1ZQN A;  5AI9 A;  4QWB A;  4IL6 U;  8ICX A;  5G5H A;  1JI7 A;  3ICX A;  8ICH A;  2YMQ A;  1ZQL A;  3ZD8 A;  3MC1 A;  2V9W A;  3ISD A;  4RPZ A;  2BGW A;  1L7O A;  2KG5 A;  3RJG A;  4A8E A;  1KLN A;  4E7X A;  4FHY A;  1ZQS A;  4K8V A;  2KKV A;  4NJ8 A;  1WOT A;  3WKD A;  4JK1 A;  4ECQ A;  1KEJ A;  1VLB A;  2FMQ A;  9ICF A;  4GXK A;  3HJ4 A;  4FHW A;  2LYH A;  3Q8Q B;  5J2J A;  1N61 A;  5HRB A;  1D9F A;  4ED8 A;  4XJE A;  1L3U A;  1BNO A;  4WJ3 B;  2GLE A;  2A1A A;  5CP2 A;  3OVB A;  1WG8 A;  2P6U A;  2OEH A;  1D9D A;  4UW9 A;  3UXN A;  7ICH A;  5EE0 A;  2MUT A;  3S6J A;  3UMG A;  3M8S A;  2OM6 A;  2W7P A;  3NVZ A;  1ED1 A;  4F5N A;  4Y2P A;  3RR8 A;  1TV9 A;  2K8B B;  1ZQV A;  5KFY A;  3TAN A;  2VKQ A;  3TAD A;  4KLD A;  1R8C A;  1RQN A;  4J9P A;  2FE9 A;  1NK9 A;  4Y2R A;  2GAF D;  8ICM A;  4F71 A;  5J0R A;  4AT8 B;  4UBB A;  2WAQ F;  3ZDE A;  1KFS A;  2AGQ A;  2WTF A;  1ZQD A;  8ICZ A;  3GZF A;  2JV3 A;  2PFQ A;  4ED2 A;  2KJ8 A;  1ZD5 A;  4OJ6 A;  4EBK A;  4EEN A;  4MFF A;  2PBE A;  2JH7 A;  4DS5 A;  2ZJ5 A;  3ORY A;  3OTQ A;  4Q43 A;  5ALJ A;  4C8M A;  1IM4 A;  2F76 X;  4HX0 A;  2DGZ A;  1BPY A;  4KTQ A;  2YB1 A;  1DK3 A;  5ALK A;  5B5E U;  3UQ0 A;  2G0A A;  4JUZ A;  5HRD A;  2ZHA A;  3JPQ A;  4F4X A;  2E5S A;  1S5L U;  4IG8 A;  3V7J A;  4DL3 A;  3MDA A;  3FYH A;  5HNK A;  4F91 B;  5KT4 A;  3FM9 A;  4USA A;  1HEK A;  2W55 A;  3JPT A;  2LYA A;  5CB1 A;  4KM5 A;  1GO3 F;  3N4M B;  3QYP A;  3TFR A;  4WC5 A;  5DQG A;  4ZH4 A;  2EH9 A;  3NKU A;  3ZDB A;  3HWT A;  5D62 A;  2KSO A;  2HOQ A;  3OGU A;  1A0P A;  1QSS A;  4NXW A;  3GIJ A;  1ZQR A;  5AK4 A;  4EBD A;  4R8U A;  3WKA A;  4OJP A;  1QSY A;  4C8K A;  4C4S A;  2ESE A;  4YMN A;  4TQR A;  5DBA A;  2R8K A;  1BNP A;  2EZZ A;  4O3R A;  2B51 A;  4EYH B;  4LEV A;  5HC9 A;  2B6G A;  2OH2 A;  3EWA A;  4BJQ A;  3R9K A;  3RJE A;  4QIW F;  4AT7 B;  3AQF A;  5ALP A;  2D3D A;  3WKE A;  1S76 D;  3V7L A;  4Y2Q A;  3H0M B;  2IOH A;  4RQM A;  1TKD A;  3PX6 A;  2ZUC A;  3EPG A;  3THV A;  2WF9 A;  3QU2 A;  4RWQ A;  4NXU A;  3GFK B;  1NK7 A;  2K4H A;  2B4V A;  4WC2 A;  5KFU A;  5EE9 A;  2AU0 A;  3K4G A;  3JZ0 A;  2DUY A;  5AHX A;  4X4R A;  4IS7 A;  2UVR A;  3KKA A;  3GIL A;  2YTU A;  5ALH A;  4X0B A;  2LMR A;  3BS5 A;  2VAN A;  3HIL A;  3MGV A;  4DQQ A;  2W7O A;  4ED7 A;  2PI5 A;  1NKB A;  1V4A A;  4YD1 A;  4ED0 A;  4KLI A;  5C5J A;  4OO1 J;  3KHR A;  1XU4 A;  4YXM A;  4RWO A;  2NYV A;  5L1K A;  5KT6 A;  9ICQ A;  4BXO A;  3RJK A;  5L1L A;  4EBE A;  2DQN B;  2FPK A;  2B21 A;  3ERC C;  5J0P A;  2WF5 A;  5AKX A;  4U7C A;  3RAX A;  4F4K A;  2DR9 A;  5J0W A;  3BJY A;  4YMO A;  1SL1 A;  4I2E A;  2OCE A;  2F8K A;  5KFH A;  3F2D A;  1O08 A;  2F44 A;  5AKJ A;  2CN1 A;  4OAG A;  2CRX A;  4NLK A;  7ICV A;  5D49 A;  2ZH4 A;  1ZQM A;  1KL9 A;  2L5Y A;  3UMC A;  4X5V A;  4RZR A;  4F2R A;  1ZD4 A;  4G3I A;  4FH3 A;  4M9H A;  1DRG A;  4O5K A;  4EX6 A;  2YMP A;  2K4E A;  4O67 A;  2HVH A;  4DQP A;  3B0Y A;  4DF8 A;  2JEJ A;  7ICS A;  1OU5 A;  1BPE A;  1OXJ A;  2HW3 A;  1QQ5 A;  2ZIU B;  5KFQ A;  3PZP A;  2KMD A;  2ZUB A;  4IRD A;  2AJQ A;  2P6R A;  3QX7 A;  2H3Z A;  2G07 A;  3OHB A;  3C2L A;  8ICL A;  2ZIV B;  2LHT A;  1AQ6 A;  2YQE A;  3QXG A;  2ES6 A;  5DB6 A;  4RPX A;  9ICC A;  2A1J A;  2BZF A;  3NS1 A;  2Y0S F;  2ZXI A;  1T8E A;  4Y2V A;  3NVO A;  8ICU A;  8ICG A;  4NLC A;  5KFI A;  4KLO A;  1V38 A;  3T3F A;  4NXV A;  5HMM A;  4ICA A;  4DSF A;  3V6J A;  1TAM A;  4UD5 A;  5ALY A;  5AI4 A;  4G9B A;  3PSP A;  1T7P A;  4UD4 A;  4O3P A;  5KFC A;  1OUQ A;  5AM0 A;  5CJ7 A;  2E8P A;  2KTQ A;  4ATB B;  2NO4 A;  4U6P A;  1KSP A;  3C23 A;  5ALO A;  4RQ8 A;  1NJX A;  2J6S A;  4YR0 A;  1XC9 A;  3G6V A;  2ZH2 A;  4NKT A;  3DEE A;  5J8Y C;  4LT6 A;  3WFQ E;  3RB6 A;  3GIM A;  4OCZ A;  4J9R A;  3AN1 A;  2GWS A;  4DSL A;  4YCX A;  1U47 A;  5HHI A;  1X6J A;  4DO9 A;  1EXN A;  4ED3 A;  4I2F A;  3ER8 C;  1RZT A;  8ICO A;  5IIL A;  2K8C B;  2W8L A;  5AKL A;  9ICN A;  5AI6 A;  7ICF A;  3N97 B;  2KE7 A;  5DLG A;  4LEW A;  1X9M A;  5CEH A;  1S0M A;  1CUK A;  1UPH A;  3ONN A;  4WCW A;  4EBC A;  2Y0S C;  3C2M A;  2NRZ A;  2JR5 A;  1MIV A;  3L4P A;  3SEI A;  4XA5 A;  2XCP A;  4PHP A;  1MC8 A;  1TFY A;  2Z7J A;  4RPY A;  2XGP A;  1COO A;  2HHP A;  3U26 A;  2ZIX A;  4QNL A;  3ZDD A;  4EX7 A;  4C8L A;  2ZHB A;  2HHU A;  4QWE A;  3SAH A;  9ICB A;  3PR5 B;  3TAP A;  5IIK A;  1KN5 A;  5F9N A;  1XSL A;  3MR2 A;  4M47 A;  3VC8 A;  2WF7 A;  4FO6 A;  4DL7 A;  1MIW A;  4QZG A;  2DPJ A;  3C28 A;  3PX4 A;  5KFP A;  3CNH A;  1TE2 A;  3OWG A;  4F5R A;  4IC9 A;  4UBC A;  2W04 A;  3IM1 A;  3GIK A;  2ZIW A;  3M9O B;  4DOB A;  3H0L B;  2BBJ A;  3MGI A;  3DV9 A;  2OHF A;  2EAN A;  3NWI A;  1HIW A;  1ZQP A;  4C8N A;  4NY8 A;  2OYY A;  2KEY A;  1J2M A;  3KHL A;  3WK6 A;  2BQ3 A;  4FH5 A;  5KFJ A;  3PR4 A;  4DF4 A;  1BPX A;  7ICR A;  3JPR A;  2XI9 A;  4KMO B;  4I28 A;  2FLP A;  1NJW A;  3OHA A;  4QWC A;  4ECV A;  1F44 A;  3MBY A;  4K96 A;  1YZ6 A;  8ICA A;  3HRD D;  5KFX A;  2KV2 A;  4K4I A;  3RRG A;  2MSN A;  3V7K A;  2PFP A;  2BQU A;  1D8Y A;  1C7Y A;  1URJ A;  5JRT A;  1XSP A;  2MA1 A;  4DSE A;  1A6S A;  3ED5 A;  5CFS A;  5D46 A;  3MAB A;  1DOQ A;  2XY6 A;  2AHO B;  1OW5 A;  1SXD A;  3F2C A;  2ZH8 A;  1VFG A;  3I76 A;  1UT8 A;  3BQT A;  4F93 B;  5J0Q A;  2JGA A;  5ALF A;  1SKR A;  2KFN A;  1KRP A; 
#chains in the Genus database with same CATH homology
 5HRB A;  1D9F A;  2UVV A;  4ED8 A;  1TFW A;  5KT3 A;  4FH5 A;  2DR9 A;  1U9L A;  4QW8 A;  4FBU A;  1L3U A;  4ECZ A;  3PV8 A;  1NK0 A;  1BNO A;  5HR9 A;  5CP2 A;  3OVB A;  2P6U A;  1U45 A;  3UXO A;  2BCU A;  2BCS A;  2KFZ A;  4J9Q A;  1ZJN A;  4CCH A;  4YN4 A;  2HHT A;  4YG2 A;  1NO5 A;  3HJ1 A;  4DEZ A;  4B9N A;  1D9D A;  4DOA A;  1ZQY A;  5KFK A;  9ICA A;  1ZQI A;  3UXN A;  5J2G A;  1DK2 A;  5DG9 A;  5EWE A;  3EYZ A;  4UQG A;  7ICH A;  3ZD9 A;  1ZJM A;  1KFT A;  4YD2 A;  5J29 A;  4DL4 A;  1RYS A;  5KFD A;  2XGQ A;  4BDP A;  3Q8R B;  1ZYQ A;  1L5U A;  4MFA A;  2AGO A;  2V4R A;  2ZTC A;  4UB3 A;  2MUT B;  2MUT A;  4GC7 A;  4Z6D A;  3V6H A;  2R8J A;  4QZB A;  4PHD A;  4KLT A;  3C1Y A;  3M8S A;  1K1Q A;  3MDC A;  2Y1I A;  1UET A;  4NKU A;  1PZN A;  4I2A A;  5DGA A;  1QLN A;  9ICK A;  5HRH A;  2HHX A;  3HT3 A;  5J2C A;  4IQW A;  4FHV A;  2C2R A;  4F5N A;  3RR7 A;  3RR8 A;  2JZB A;  1TV9 A;  1X9S A;  1ZQV A;  5J0S A;  5KFG A;  3H8J A;  4F5Q A;  1ZQO A;  2BPF A;  5KFY A;  3TI0 A;  3TAN A;  5J0O A;  4X4T A;  4X4U A;  4QZH A;  5F9L A;  9ICG A;  4KLD A;  3QZ7 A;  7ICG A;  5DDY A;  4Z6E A;  3V72 A;  2C22 A;  8ICV A;  1R8C A;  4J9P A;  1RYR A;  3AQN A;  1NK9 A;  2ATL A;  2J6T A;  2NRK A;  1VJ7 A;  5DDM A;  1TK8 A;  9ICH A;  2BE3 A;  1WCL A;  1NJY A;  2O5A A;  8ICM A;  5J0R A;  4AT8 B;  2DFL A;  2M9N A;  4AT8 A;  4KLE A;  2R8H A;  4F5P A;  4F4Z A;  1A77 A;  4ED6 A;  2FPM A;  4UBB A;  5KFN A;  1R8A A;  3ZDE A;  1KFS A;  2AGQ A;  5L1J A;  2WTF A;  1U4B A;  4P4O A;  4DL5 A;  4E80 A;  3T5J A;  1ZQD A;  3H4D A;  2KZM A;  8ICZ A;  4LZG A;  3KTQ A;  4RU9 A;  4ECR A;  4NM1 A;  2C28 A;  3PO4 A;  3RJF A;  2PFQ A;  4P4P A;  4WBZ A;  4ED2 A;  5DB7 A;  2ALZ A;  3EZ5 A;  2IA6 A;  5KFM A;  1SZP A;  1ZQT A;  4EBK A;  4MFF A;  5BOM A;  3GV7 B;  2W9B B;  1QSL A;  2W9B A;  4DS5 A;  2ZJ5 A;  4K4G A;  3HP6 A;  4M9N A;  1HUZ A;  4KLS A;  3ORY A;  3QE9 Y;  4M2Y A;  2PI4 A;  4TUP A;  3MR3 A;  3T5K A;  4I2C A;  9ICI A;  4ECS A;  2BPG A;  2I1Q A;  8ICS A;  3GV8 B;  4Q43 A;  2W9C A;  1HUO A;  4C8M A;  4RNM A;  9ICJ A;  4IR9 A;  3OV7 A;  1IM4 A;  4J9K A;  4RUC A;  4I2H A;  3C1Z A;  3H7I A;  4Z6F A;  2ZJ8 A;  5KFL A;  4J9S A;  1BPY A;  1ZET A;  4KTQ A;  4FHP A;  3ZDA A;  5DBB A;  4J9L A;  4PGY A;  3RB0 A;  4J9O A;  4ED1 A;  4R63 A;  1KTQ A;  1ZQF A;  1DK3 A;  3HIY A;  3UQ0 A;  4JUZ A;  3QEA Z;  2IHN A;  3MR5 A;  5HRD A;  3T5L A;  2ZHA A;  3JPQ A;  4F4X A;  1JN3 A;  3MFH A;  3TAQ A;  4MEY A;  4UB4 A;  5J2F A;  4KMU A;  3LK9 A;  2P66 A;  2ZJA A;  4KN7 A;  3WFO A;  4IG8 A;  2HHQ A;  5HRI A;  2BPC A;  3V7J A;  5J2H A;  4DL3 A;  1S0V A;  3MDA A;  4RUA A;  2VA3 A;  3C2K A;  4M6W B;  2FLN A;  4M6W A;  3FYH A;  5J2D A;  1D8L A;  1F5A A;  2OWO A;  5HNK A;  8ICN A;  4F91 B;  5EWF A;  2IHM A;  4P4M A;  1Z00 A;  5KT4 A;  3G6X A;  1ZQG A;  4YR2 A;  9ICS A;  4XQ7 A;  4J9N A;  4B9V A;  3RJI A;  5KT7 A;  5KFO A;  3JPT A;  4QWD A;  1MIY A;  5CB1 A;  1MQ2 A;  4EEY A;  3NGD A;  7ICN A;  1T3N A;  4WC1 A;  2I9G A;  3N4M B;  1Q79 A;  2DRA A;  4EYI B;  3TFR A;  4C8O A;  5DQG A;  4F8R A;  4ZH4 A;  4JV1 A;  4M9L A;  4WC5 A;  9ICO A;  4XUS A;  3RJJ A;  3ZDB A;  4JWM A;  4EP7 A;  4DQS A;  3HWT A;  2M2W A;  4XQ8 A;  1UEU A;  4Z6C A;  2BHN A;  3OJU A;  2ASD A;  4WC7 A;  4Q44 A;  4QZF A;  3OGU A;  4PGX A;  1JXE A;  1QSS A;  4IRC A;  3GIJ A;  5TZV A;  4FS2 A;  3PY8 A;  4DFK A;  3NYB A;  1ZQR A;  2ASJ A;  3H8S A;  3Q8K A;  3H8W A;  4DLG A;  1ZQQ A;  1ZQX A;  2C2E A;  3B0X A;  4EBD A;  8ICY A;  4R8U B;  4R8U A;  5DB9 A;  5J0X A;  3SI8 A;  5HRK A;  5HP4 A;  4WC0 A;  1QSY A;  4C8K A;  2ZUD A;  3OJS A;  3RBE A;  4YMN A;  4TQR A;  5DBA A;  2R8K A;  4Q8F A;  1BNP A;  4I29 A;  5J2I A;  4O3R A;  1S0O A;  4EYH B;  5HRE A;  4X4N A;  5HC9 A;  4KIT B;  3EPI A;  3EWA A;  4QZI A;  2PFO A;  2O1P A;  3TAR A;  4QZA A;  9ICT A;  2PBE A;  2RFF A;  3MR6 A;  4GXI A;  3RJE A;  1BPZ A;  4YR3 A;  4AT7 B;  4AT7 A;  4R66 A;  2JEF A;  1XWL A;  5DB8 A;  1S76 D;  5J0T A;  3V7L A;  5J2A A;  4HYK A;  5KFV A;  3RH5 A;  1BPD A;  1TKD A;  2KP7 A;  3PX6 A;  2W8K A;  3JYY A;  4X4V A;  2ZUC A;  3EPG A;  3ETL A;  3THV A;  1U48 A;  3OSP A;  4RWQ A;  4KN4 A;  1NK4 A;  3RTV A;  4RNO A;  3GFK B;  3M8R A;  1NK7 A;  4RQ3 A;  2W9M A;  2JZB B;  4UAY A;  4AT9 A;  1UT5 A;  5HRG A;  4WC2 A;  9ICM A;  5KFU A;  2PFN A;  2AU0 A;  3K4G A;  3JZ0 A;  2Q66 A;  2ID1 A;  1B43 A;  2PXI A;  3G6Y A;  4YFK A;  3PVX A;  3OUY B;  3OUY A;  3H40 A;  2DR5 A;  5KFS A;  3ZDC A;  1ARO P;  4X4R A;  1TK5 A;  1ZQB A;  1JQR A;  3H3A A;  2BCV A;  2UVR A;  2MAX A;  2HHW A;  4WC6 A;  3GIL A;  4NLG A;  2ASL A;  7ICO A;  2H5X A;  4RQ4 A;  4YP3 A;  1N48 A;  3H38 A;  4X0B A;  2XY7 A;  4JV0 A;  5L9X A;  2AQ4 A;  2VAN A;  1NKE A;  5CA7 A;  3E2E A;  4DQQ A;  5KG1 A;  3PW2 A;  1ZQE A;  9ICR A;  7ICE A;  5JUM A;  4ED7 A;  5BPC A;  1NKB A;  2PI5 A;  1SKW A;  1IXR A;  4YD1 A;  3M9N B;  3C5G A;  4ED0 A;  1UA1 A;  5C5J A;  1JXL A;  2FMP A;  4DSJ A;  3KHR A;  8ICB A;  8ICI A;  2F1J A;  1XU4 A;  4YXM A;  4RWO A;  4UB2 A;  5KT5 A;  8ICQ A;  5L1K A;  8ICF A;  5BOL A;  4ELT A;  5KT6 A;  9ICQ A;  3Q8L A;  4BXO B;  9ICE A;  2KN7 A;  2XCA A;  3RJK A;  4BXO A;  2J6U A;  5DQI A;  5L1L A;  4EBE A;  1ZQA A;  4R64 A;  2DPI A;  2FPK A;  2NRX A;  5KTQ A;  3BQ2 A;  5HRL A;  4M5D A;  5HML A;  2B21 A;  5J0P A;  3AQM A;  2KZZ A;  4O3O A;  3PX0 A;  3RAX A;  2Q0Z X;  4F4K A;  1YLQ A;  5J0W A;  3BJY A;  4IRK A;  4YMO A;  2W9C B;  7ICJ A;  1SL1 A;  4RQ7 A;  9ICP A;  4I2E A;  5KT2 A;  3OSN A;  4TUS A;  3BQ0 A;  5KFH A;  4X4Q A;  4NXZ A;  1MSW D;  1R89 A;  4RQ1 A;  4MFC A;  1BGX T;  2RDJ A;  1S9F A;  5KG3 A;  1TFR A;  3PML A;  7ICU A;  5HHH A;  2XY5 A;  2IBK A;  7ICI A;  4DS4 A;  3GQC A;  2UVU A;  4NLK A;  4DSK A;  4IQV A;  4DFJ A;  7ICV A;  5D49 A;  2ZH4 A;  3RB4 A;  1ZQM A;  4M9J A;  4X5V A;  4R65 A;  4RWN A;  4RZR A;  4F2R A;  4I2I A;  4Q8E A;  1FA0 A;  4FHX A;  4G3I A;  4X4P A;  8ICR A;  4FH3 A;  4M9H A;  4O5K A;  2UVW A;  3KHG A;  1JMS A;  5KG5 A;  3TQ1 A;  4IQU A;  4DQP A;  2FMS A;  4DFM A;  2HVH A;  3B0Y A;  4DF8 A;  2JEJ A;  7ICS A;  4RWP A;  1OU5 A;  1L3S A;  4ELU A;  1BPE A;  4EZ9 A;  2M2V A;  2HW3 A;  5KFQ A;  2ZUB A;  4IRD A;  3LWM A;  1JX4 A;  2JEI A;  4FHW A;  1ZQC A;  2AJQ A;  2P6R A;  4Q45 A;  3Q8S B;  2R8G A;  1Z00 B;  4GXJ A;  4YMM A;  4IQT A;  3OHB A;  4WC3 A;  4O9M A;  8ICC A;  3C2L A;  3AUO A;  8ICL A;  2HHV A;  4F50 A;  2FPL A;  1B22 A;  1TAQ A;  3MFI A;  3MGH A;  2M2T A;  4RPX A;  5DB6 A;  2F1H A;  2A1J B;  9ICC A;  2A1J A;  4F2S A;  5D4B A;  4DQR A;  4RQ5 A;  9ICU A;  1T8E A;  4EZ6 A;  5CHG A;  5KFR A;  5CWR A;  4DLE A;  3PW5 A;  5F2V O;  2NRT A;  4PGQ A;  1RXV A;  4O5E A;  4KLH A;  9ICL A;  8ICU A;  2KFN A;  8ICG A;  3AQL A;  3GV5 B;  5KFI A;  4KLO A;  1ZQZ A;  4F92 B;  3GDX A;  3T3F A;  5HMM A;  2F1I A;  4M9G A;  3GII A;  4DSF A;  3V6J A;  4YQW A;  1HJP A;  4B9U A;  2BCQ A;  4UD5 A;  1PX5 A;  1LB2 B;  4QZE A;  1T7P A;  4UD4 A;  4O3P A;  5KFC A;  4ECW A;  2VA8 A;  5CJ7 A;  3NTU A;  1Q78 A;  1SL2 A;  5KG4 A;  2KTQ A;  4ATB B;  4ATB A;  4XRH A;  3WFP A;  1N56 A;  3ISC A;  3C21 A;  1KSP A;  1TAU A;  4O0I A;  1X2I A;  3RAQ A;  2ISP A;  3C23 A;  4RQ8 A;  3LQC B;  5III A;  3SZ2 A;  3C5F A;  1NJX A;  4NLZ A;  4QW9 A;  2J6S A;  4YR0 A;  1XC9 A;  4QZC A;  3G6V A;  5KG2 A;  2XO7 A;  4EBJ A;  2RDI A;  2ZH2 A;  4E8F A;  1XS9 D;  5DBC A;  5IIO A;  4DOC A;  1H38 A;  4NKT A;  4YVZ A;  1MQ3 A;  4LT6 A;  4KLU A;  3H37 A;  4BGD A;  3HX0 A;  3PW0 A;  4KLF A;  3RB6 A;  3K75 D;  1KFD A;  3GIM A;  2ZH7 A;  1BPB A;  4O3N A;  4J9R A;  3UQ2 A;  2GWS A;  4DSL A;  4YCX A;  5DQH A;  5IIJ A;  1KDH A;  5KG6 A;  1U47 A;  5HHI A;  4UB5 A;  5DEC A;  4I2F A;  4RNN A;  1EXN A;  4DO9 A;  4ED3 A;  4TUR A;  7ICK A;  4ECT A;  3RJH A;  2ZH9 A;  4GC6 A;  1ZQK A;  4WBY A;  5DED A;  1NOM A;  5KFT A;  4KLG A;  4E0D A;  5DG8 A;  4MF8 A;  1NK8 A;  1RZT A;  2AQ0 A;  3RH4 A;  8ICO A;  9ICV A;  5IIL A;  4BWM A;  2W8L A;  4O3S A;  4I2D A;  5J0U A;  3QZ8 A;  5DLF A;  4X4S A;  9ICN A;  7ICF A;  4AT9 B;  4ECU A;  3RH6 A;  3N97 B;  5CR0 A;  5DG7 A;  5HRF A;  3LDA A;  1WCN A;  5KFZ A;  1NZP A;  4DL6 A;  3AQK A;  5DLG A;  3UPQ A;  3AU2 A;  4M0A A;  4K4H A;  1S0N A;  4F3O A;  1X9M A;  3WFR E;  4YXJ A;  1DGS A;  8ICJ A;  1U49 A;  1S0M A;  3ISB A;  1BVS A;  3RRH A;  4DQI A;  4LVS A;  4PHE A;  1CUK A;  8ICP A;  3C18 A;  1K1S A;  4UAW A;  4P2H A;  4WCW A;  4EBC A;  1UEV A;  3C2M A;  2NRZ A;  4MEX A;  4RQ6 A;  4RT3 A;  5KFW A;  4B9T A;  1JAJ A;  4S3N A;  1MIV A;  3WFQ E;  9ICX A;  4ECY A;  5J2K A;  4GLX A;  5KFE A;  3IHQ B;  1RXW A;  8ICE A;  4J9M A;  1JIH A;  1XO1 A;  2ISO A;  4B9M A;  4O5C A;  3L9D A;  5KG7 A;  4XA5 A;  4X0A A;  4KLM A;  1QTM A;  3PW7 A;  2DRB A;  4DSI A;  2XCP A;  4PHP A;  1MC8 A;  3RB3 A;  1TFY A;  2DR8 A;  4I2B A;  3QEB Z;  5J0Y A;  4RPY A;  3BDP A;  2XGP A;  4F5O A;  3FDS A;  2BR0 A;  4DFP A;  7ICT A;  5KFA A;  1COO A;  2Y1J A;  1NKC A;  2HHP A;  4KLJ A;  5L1I A;  4KLQ A;  4F4Y A;  4FS1 A;  3BQ1 A;  3ZDD A;  7ICP A;  4C8L A;  2FLL A;  4M04 A;  1NK5 A;  2ZHB A;  9ICW A;  2DR7 A;  7ICM A;  4QWE A;  2HHU A;  1ZQH A;  4ELV A;  4I2G A;  9ICB A;  2ZTD A;  3PR5 B;  4NM2 A;  3TAP A;  5IIK A;  1UA0 A;  5F9N A;  1XSL A;  4BWJ A;  2ZH3 A;  4MF2 A;  5IIN A;  4RQ0 A;  3MR2 A;  4UB1 A;  4JV2 A;  4M47 A;  4DWI A;  1R8B A;  3UPS A;  1A76 A;  2XC9 A;  4UAZ A;  4FO6 A;  1KNY A;  3OVS A;  2ZH6 A;  2R8I A;  4LZD A;  5EWG A;  4RT2 A;  4DL7 A;  1S97 A;  3PMN A;  4I27 A;  1MIW A;  3KHH A;  2ZH1 A;  4QZG A;  2DPJ A;  4O3Q A;  3PX4 A;  2NRW A;  5KFP A;  4TQS A;  4TUQ A;  3PO5 A;  5KFB A;  3LWL A;  8ICW A;  3WFS C;  1Y88 A;  3SV3 A;  4X4O A;  2C2D A;  4F5R A;  4FBT A;  2NRV A;  1XSN A;  4ECX A;  4QZ8 A;  4UBC A;  8ICT A;  1T4G A;  2ZTE A;  1X9W A;  3IM1 A;  3GIK A;  5J2B A;  3HPO A;  4QWA A;  3H4B A;  1TK0 A;  3M9O B;  4B9L A;  3Q8P B;  4DOB A;  3M9M B;  4PPX A;  1L3T A;  3EW9 A;  4QZD A;  3MGI A;  3PNC A;  1SKS A;  4B9S A;  1ZQU A;  3TFS A;  2BDP A;  8ICK A;  3JPS A;  1Z3E B;  1LV5 A;  5DKW A;  1ZQP A;  4C8N A;  2IMW P;  1RPL A;  4NY8 A;  2M2U A;  3C66 A;  2BQR A;  2VA2 A;  2BQ3 A;  3KHL A;  2KZ3 A;  4PHA A;  3AU6 A;  5KFJ A;  3PR4 A;  5EOZ A;  4DF4 A;  1BPX A;  3Q8M A;  3JPR A;  1S10 A;  7ICL A;  7ICR A;  3PW4 A;  2FLP A;  1NJW A;  2JEG A;  4I28 A;  3OHA A;  3V6K A;  4QZ9 A;  5IIM A;  4QWC A;  4ECV A;  2AGP A;  4RQ2 A;  3T5H A;  3MBY A;  4F4W A;  1L3V A;  4DL2 A;  3JPP A;  3RBD A;  1ZQJ A;  1ZQN A;  3SV4 A;  8ICA A;  4KLL A;  5KFX A;  4IR1 A;  4K4I A;  2ZH5 A;  4QWB A;  2HVI A;  1CEZ A;  3RRG A;  8ICX A;  3HW8 A;  2PFP A;  3V7K A;  2BQU A;  4JWN A;  8ICH A;  4PH5 A;  1D8Y A;  1SL0 A;  7ICQ A;  1ZQL A;  2V9W A;  3ZD8 A;  4I2J A;  4KLI A;  1TVA A;  1V4A A;  1C7Y A;  2W9A A;  3ISD A;  1XSP A;  4DSE A;  3OVA A;  1S77 D;  5KG0 A;  4RPZ A;  2BGW A;  4NLN A;  3RJG A;  5D46 A;  3MAB A;  1DOQ A;  1KLN A;  4E7X A;  2BKE A;  4FHY A;  1ZQS A;  5KFF A;  2XY6 A;  1NJZ A;  3SYZ A;  3JPO A;  1WOT A;  4WC4 A;  2V4Q A;  3H39 A;  2HHS A;  4JK1 A;  4ECQ A;  2ZH8 A;  1VFG A;  2BCR A;  1UT8 A;  5DGB A;  1KEJ A;  3BQT A;  4F93 B;  3JPN A;  1NK6 A;  2DVI A;  5J0Q A;  5J2E A;  2FMQ A;  9ICF A;  4GXK A;  3HJ4 A;  3UXP A;  2LYH A;  1SKR A;  3Q8Q B;  1V9P A;  1KRP A;  1ZQW A;  5J2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...