2I9GA

Dna polymerase beta with a benzo[c]phenanthrene diol epoxide adducted guanine base
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
325
Chain Sequence
b'ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*GP*TP*CP*GP*G)-3'
molecule tags Transferase/dna
source organism Homo sapiens
publication title Structure of DNA polymerase beta with a benzo[c]phenanthrene diol epoxide-adducted template exhibits mutagenic features.
pubmed doi rcsb
total genus 109
structure length 325
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2i9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2i9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2i9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2i9gA03
1ZQXA 2R8IA 4CCHA 4I2AA 2KFNA 4O5KA 2W8KA 4WC0A 4BWJA 2RFFA 4YR2A 1MQ3A 1ZQVA 8ICKA 9ICTA 4X4VA 7ICRA 1ZQOA 3LDAA 4F5OA 4RWNA 3G6VA 4ECTA 8ICIA 2HHVA 4F5PA 3RRHA 5F9LA 1ZQLA 3MR6A 4KMUA 3Q8QB 4ED2A 1TK0A 4B9VA 4PPXA 9ICKA 2XY5A 3H8JA 2XO7A 2FMSA 3BQTA 4FS1A 4P4MA 3UQ0A 4ECWA 3TARA 3H4BA 4J9NA 1U47A 2KZMA 4MEYA 3PW0A 3V6JA 1TKDA 2W9AA 1QSYA 2V4QA 2IHNA 1TK8A 4DL2A 2R8HA 3RRGA 1OU5A 1TVAA 4I2CA 4DS5A 4FHVA 5KG0A 3OHBA 4EYHB 3HT3A 4BDPA 4M0AA 4RU9A 2R8JA 5KFWA 4QZDA 2UVUA 7ICOA 2HHSA 1UA0A 4ATBB 5J0XA 4RQ7A 3AQNA 4AT8B 5DGAA 4QZHA 3H40A 1TFRA 4ELVA 5HP4A 1L3TA 5BPCA 4I2BA 4WC7A 2NRVA 4PHPA 4UB1A 3GDXA 9ICGA 5KTQA 5TZVA 2KP7A 4YMMA 4IQUA 4DQRA 3NTUA 2J6SA 2V9WA 1N56A 4B9LA 3Q8LA 4DOCA 4BGDA 2HW3A 4ECUA 1ZQRA 1N48A 5BOMA 3RB4A 2JEJA 4JV0A 4M2YA 4EBKA 3Q8RB 5D46A 3LWLA 4C8MA 1XS9D 1BVSA 1Z00B 2BCQA 4HYKA 2JEIA 3RJJA 4ELUA 1QLNA 2ZH4A 1A77A 4EEYA 4WC6A 4P4PA 2KN7A 1S0OA 3RBDA 3MR2A 2XGPA 3PMLA 1NK5A 3GV5B 2DFLA 1NK4A 3ZDBA 2LYHA 1BGXT 5KFHA 2XC9A 3V7JA 4GXIA 1L3UA 3OVBA 4JWMA 3WFSC 1HJPA 4QZFA 4LZGA 3BQ2A 1BPYA 1Z3EB 4F91B 1NZPA 4E80A 4DFPA 3PX4A 1ZQHA 5L1JA 2XGQA 4I29A 1ZQWA 9ICAA 1MIVA 4I2HA 5CA7A 4ATBA 3C5FA 3PX0A 4ED7A 4Z6DA 2J6UA 2R8KA 2NRWA 3K4GA 1UT5A 3MABA 3BQ0A 1ZQPA 4BWMA 3RB0A 2R8GA 1AROP 9ICOA 1IXRA 5J29A 3M9NB 2KFZA 5KG2A 5CHGA 2HHWA 4NKTA 3RJEA 7ICEA 3T5JA 8ICHA 2W9CA 5CR0A 3UXPA 2AQ0A 1X9MA 3OSPA 4K4HA 3WFPA 4O0IA 4KLFA 4X4TA 3IHQB 1UETA 4K4GA 2RDJA 3ZDAA 3NGDA 4FS2A 4JK1A 5KFOA 3T5HA 1U4BA 1TK5A 1S0NA 1ZQNA 4NLZA 4KLQA 4X5VA 1SKWA 1KFTA 3RAXA 2VA3A 5DB6A 3JZ0A 3OJUA 3JPNA 1XWLA 3M9OB 5HMLA 4DSEA 2AQ4A 1VJ7A 4RNNA 3ISDA 4XQ7A 4M04A 3EZ5A 5DDYA 5EWFA 5KFLA 1XSNA 4EBJA 4MFAA 4FO6A 1U49A 1ZQAA 4QW8A 3GIJA 4F4KA 2PFNA 9ICUA 1IM4A 1PX5A 4J9OA 4X4SA 1NKEA 3OVSA 3SV3A 1KRPA 4GXKA 2BGWA 3OV7A 1KTQA 3QZ8A 3M8SA 4J9PA 4ECVA 8ICFA 2DR8A 4QWDA 3PO4A 3K75D 5DQIA 4UBBA 8ICLA 5DKWA 4MFFA 1ZQTA 2IBKA 4Z6CA 4YXMA 5KFJA 4EYIB 9ICJA 3LQCB 4YR0A 3RB6A 4NLNA 3FYHA 1TAUA 1KNYA 2JZBB 5DDMA 2FPKA 3OGUA 3MR3A 3BQ1A 4XUSA 5KFSA 1U45A 4PHAA 8ICVA 8ICEA 2O5AA 2ZH6A 5F9NA 3JPOA 1JN3A 5KT2A 4IQTA 3TI0A 5HRIA 2ZH2A 2H5XA 4FBUA 5CJ7A 3KTQA 4KLDA 5KFRA 2OWOA 4QWCA 3OUYA 4YP3A 1ZQBA 1NKBA 1KFDA 5HRBA 4RQ0A 2AGQA 4RUCA 4O3SA 4F5QA 2Y1JA 4F2RA 4IRCA 1JAJA 4TQRA 4LZDA 4DFJA 3L9DA 4C8LA 1XO1A 7ICLA 3KHRA 4RQ2A 1MIWA 5F2VO 5IIOA 3RJKA 3RJFA 4I2IA 4ED1A 1BPXA 2AU0A 3RJIA 5KFXA 4TUSA 4QWEA 8ICGA 4QWBA 3WFQE 2F1JA 1S97A 4FHPA 4UB4A 4ECSA 9ICBA 4AT7B 3T5LA 5EWEA 3V6KA 3RH4A 2J6TA 2ZTDA 1KDHA 4R63A 1LB2B 1JXEA 2DR5A 5KFZA 5KFNA 4F4YA 3RH6A 2BCSA 5KG1A 4O3PA 5CP2A 4S3NA 9ICXA 4MF8A 3AU2A 3C2MA 3PV8A 2ZTEA 4KITB 1ZJMA 4F2SA 5HRHA 5KFYA 4EP7A 2HHUA 8ICJA 4IQWA 3UPSA 1S77D 5KFTA 3KHGA 1B43A 5DBAA 1RXWA 9ICNA 1U9LA 2W8LA 7ICPA 3WFOA 1ZQDA 3T3FA 4DQPA 4QZ9A 4I2FA 1B22A 4Q45A 2ASLA 4WC1A 5KFKA 3HPOA 3ZD9A 4GLXA 4KLGA 8ICYA 2FPMA 2FLPA 2HHQA 3UXOA 8ICCA 2M2TA 3OUYB 1WCNA 3C2LA 1SL1A 1QSLA 4O5CA 7ICVA 3RR8A 4NM1A 4PHEA 5D49A 3RBEA 4G3IA 4DO9A 4YXJA 4DL4A 1ZQMA 3ZDEA 4IR1A 4WC4A 4B9UA 2AJQA 2KTQA 1ZQIA 4F3OA 4Z6EA 3GIKA 4RQ1A 4F5NA 5IINA 3G6XA 2BE3A 4QZEA 4RPZA 2HHXA 5DG9A 1FA0A 4YMOA 4RWQA 4M9GA 4KLUA 4WBZA 2W9MA 1Q78A 9ICFA 3QE9Y 4RWOA 9ICEA 4PGXA 4QWAA 2XY7A 4YMNA 2BR0A 1ZQJA 4DSKA 3LK9A 3RR7A 1MIYA 3M8RA 1QTMA 4O3RA 3EWAA 4QZAA 3MGHA 4DFMA 1TAQA 1D8YA 1KLNA 4C8KA 2A1JA 2ZUDA 4RUAA 3C1YA 4J9QA 3V6HA 9ICMA 3H38A 1S76D 5J0TA 1Y88A 4PGYA 2M9NA 4RNOA 5HRGA 3TFRA 3BDPA 2ZH7A 5JUMA 1BPBA 3HJ4A 4YVZA 1Q79A 3JPRA 2I1QA 5CB1A 3AUOA 3THVA 2F1IA 4B9SA 1H38A 2BPFA 7ICSA 3GV8B 1QSSA 3SZ2A 2GWSA 4DQIA 4RT3A 5KFFA 4ED6A 1S9FA 5KFDA 2BCRA 5CWRA 1CUKA 3AU6A 3TANA 1ZQKA 2C22A 4M9HA 1L5UA 1HUOA 2ISPA 5L1KA 8ICAA 1R8CA 4RPXA 4O9MA 2JZBA 1A76A 8ICNA 1RPLA 5KT7A 4NM2A 3SV4A 1TV9A 4ED0A 9ICVA 3HIYA 4R8UA 3AQLA 5HR9A 4ECYA 4I2JA 5KFBA 4F93B 5DG7A 1ZQQA 4TUQA 1S0VA 2HVIA 2ZH9A 1KEJA 1UA1A 2HHTA 3UQ2A 3MGIA 3PO5A 1JQRA 3KHLA 4AT9B 3C21A 4NXZA 3EPGA 2RDIA 7ICJA 3HWTA 4O3NA 4ED3A 3E2EA 3HW8A 4Q8FA 9ICCA 3KHHA 5HRKA 4M5DA 1PZNA 2C2EA 2UVRA 2IHMA 4M9NA 5HRFA 1MSWD 4LT6A 2P6UA 3GV7B 2BPGA 1KSPA 5DB8A 4UAWA 3N97B 1ZQEA 3EPIA 4TQSA 1UEVA 5HHHA 7ICNA 3V7LA 4GC6A 1HUZA 2PI5A 4UB2A 2M2WA 5HREA 5HRDA 3OJSA 1RYSA 1C7YA 5DLFA 3C2KA 1NJYA 2PFQA 8ICRA 4PHDA 3HX0A 4B9TA 4FHXA 2DVIA 4J9KA 4F4ZA 4KLJA 3ISCA 5KG4A 2Q0ZX 5DBBA 3IM1A 4QZIA 2C2DA 2BQRA 2VA8A 3PR5B 1MQ2A 4NLKA 2BHNA 3GQCA 7ICFA 4AT7A 4X0AA 3JPPA 5KT5A 5J2FA 5D4BA 3RTVA 8ICOA 4I2GA 5DEDA 3AQMA 4UD5A 2VANA 1ZQUA 4I28A 4EBEA 4KLMA 4F50A 7ICQA 5DLGA 4QZBA 3B0YA 5J0WA 7ICTA 4KLOA 4R64A 4UQGA 2M2VA 4IG8A 5KT3A 9ICHA 4F8RA 8ICZA 5DQGA 5KFQA 4DOBA 4KLTA 4YD1A 2NRKA 2FMPA 1WOTA 3H7IA 2P6RA 2PBEA 5DBCA 2XY6A 2ZJAA 3GIIA 3ZDCA 2WTFA 1KFSA 1NJWA 3MR5A 8ICXA 5DECA 4X4RA 1VFGA 1RZTA 1UT8A 5J0RA 4WCWA 4F4WA 1F5AA 4RWPA 8ICUA 5J2DA 1T7PA 4IR9A 5KFMA 3H37A 2ID1A 5IIIA 1NK9A 2DPIA 1X9SA 2XCPA 4IRKA 1BPZA 4E0DA 3TAQA 5J0SA 4F5RA 1TFYA 3V72A 4ZH4A 9ICRA 5KFEA 1L3VA 1V9PA 2UVVA 4YFKA 1T8EA 4X4UA 3H4DA 5DB9A 5HC9A 2FPLA 1D9DA 4AT8A 9ICLA 5HMMA 3LWMA 4X0BA 3UXNA 2PFOA 5J2AA 7ICIA 1BNOA 4J9RA 2PI4A 4JV2A 2DR9A 3GIMA 4IQVA 4DF8A 4DL5A 4DL3A 5EWGA 3FDSA 5J2IA 1XSPA 2DPJA 3ZD8A 4X4NA 2MUTB 4QZGA 5IIMA 1ZETA 3SYZA 4F4XA 9ICPA 1T4GA 2ZUBA 4ECQA 5HNKA 3JPSA 3TAPA 1NJZA 2FLLA 9ICIA 4DLGA 1R8BA 5L1IA 3PVXA 2BKEA 4C8OA 3H8WA 4RQ6A 3PW5A 1X9WA 1DOQA 2BQ3A 1NK8A 4X4PA 4DSFA 1DK2A 4RT2A 4YD2A 1BNPA 4J9MA 2ZH8A 2PXIA 1L3SA 4KLIA 2HVHA 3H8SA 4UB3A 4QW9A 3N4MB 4QZCA 2I9GA 4GXJA 5J2JA 5J2CA 2ATLA 1XSLA 4PGQA 1NKCA 3EW9A 2MUTA 5IILA 4B9NA 3EYZA 1NK6A 2ZH1A 8ICBA 5J2BA 4YCXA 2DR7A 4RPYA 1S0MA 4M6WB 3HP6A 4KN7A 4R8UB 8ICWA 1SL0A 4O5EA 8ICMA 2FMQA 2BDPA 4R65A 3MDAA 4XA5A 4JV1A 1K1QA 1JMSA 4M6WA 5J2KA 1UEUA 2KZ3A 4NY8A 1D8LA 4EBCA 2AGPA 5KFUA 2ISOA 4MF2A 2KZZA 4O3OA 1JXLA 3QEBZ 2BCUA 4Q44A 2P66A 2BPCA 2PFPA 5KFAA 1NO5A 8ICQA 1MC8A 4YG2A 4KLLA 2NRTA 2V4RA 3TQ1A 3B0XA 2ALZA 1CEZA 1TFWA 4I27A 5KFIA 3T5KA 4MEXA 1XU4A 5J2GA 5J2HA 3Q8KA 4IRDA 4X4OA 2ZH5A 4FHYA 3C1ZA 3ETLA 4YQWA 4NLGA 5KG5A 2ZTCA 4ED8A 1DK3A 4KTQA 3NYBA 5IIJA 7ICHA 3OHAA 3ISBA 5KFGA 1XC9A 3MFHA 4TURA 4NKUA 1ZQGA 4E8FA 8ICSA 5KFVA 5DQHA 3BJYA 7ICKA 3H3AA 4E7XA 3M9MB 2W9CB 4EZ9A 3AQKA 1NOMA 1ZQYA 5KG3A 5DG8A 3Q8SB 3JPQA 5L1LA 3PW2A 4ECXA 2ASJA 1JIHA 5EOZA 4TUPA 2JEFA 4FBTA 2AGOA 3QEAZ 2IMWP 1DGSA 1U48A 8ICPA 1ZYQA 4WC2A 1COOA 2Q66A 4M9LA 4UBCA 2XCAA 4JUZA 4BXOA 4LVSA 9ICWA 4DS4A 3ORYA 3MFIA 5J0YA 3ZDDA 4RQ5A 4O3QA 3MBYA 3PR4A 5DGBA 4M47A 4Q43A 4FH3A 1BPDA 4ECRA 4DL7A 1Z00A 2IA6A 4P2HA 3PW7A 5KT6A 4I2EA 4J9SA 3JYYA 4WBYA 4FH5A 4WC3A 4Q8EA 4EBDA 3UPQA 4DOAA 2M2UA 4DSJA 4PH5A 7ICUA 1SZPA 3PW4A 2BCVA 4XQ8A 1NK0A 3C5GA 5KG7A 2C28A 5KFCA 4UB5A 3PX6A 1ZQZA 4XRHA 4YR3A 3SI8A 2VA2A 5J0OA 7ICMA 5J2EA 4JWNA 4AT9A 1SKRA 4RQ8A 1WCLA 4DSLA 2ZJ8A 1X2IA 2UVWA 1K1SA 4Z6FA 3OVAA 4KN4A 3Q8PB 3C66A 3PNCA 3GILA 1YLQA 2ZJ5A 5HRLA 4BXOB 1T3NA 4P4OA 4UAZA 4DQSA 1SL2A 3TFSA 4DWIA 4DL6A 3PY8A 1SKSA 2F1HA 4ECZA 1ZQSA 3RJHA 1R8AA 4RQ3A 3RJGA 4F92B 2NRZA 3OSNA 2W9BB 3JPTA 1S10A 1RYRA 4DF4A 2JEGA 3H39A 3HJ1A 3G6YA 1LV5A 2BQUA 1ZJNA 3Q8MA 4KLSA 4MFCA 1NJXA 2O1PA 9ICSA 5IIKA 5KFPA 4C8NA 4YN4A 1ZQCA 2B21A 3WFRE 1JX4A 5DB7A 3QZ7A 4DLEA 2HHPA 3RH5A 3C23A 5HHIA 5C5JA 4RZRA 4QZ8A 2ZUCA 4DQQA 1BPEA 2C2RA 4DEZA 5J0QA 3MDCA 4B9MA 4KLHA 4ELTA 5L9XA 2DRAA 4FHWA 1EXNA 2DRBA 4RQ4A 2ZHAA 2A1JB 5BOLA 2MAXA 5J0PA 3GFKB 3RB3A 1RXVA 1D9FA 2ZHBA 4KLEA 1R89A 4DSIA 4M9JA 4UAYA 5KT4A 4R66A 4J9LA 4GC7A 8ICTA 5KG6A 2W9BA 9ICQA 4WC5A 4X4QA 5J0UA 4I2DA 4RNMA 3PMNA 4EZ6A 2ZH3A 3C18A 1NK7A 2Y1IA 3RAQA 2ASDA 3V7KA 4K4IA 1V4AA 4UD4A 7ICGA 1ZQFA 2NRXA 4DFKA 2FLNA
chains in the Genus database with same CATH superfamily
2FCLA 7ICRA 3G6VA 3MR6A 1TK0A 2K8CB 2XY5A 3KKAA 1YT3A 3UQ0A 5ALGA 1OW5A 3H4BA 2KZMA 4MEYA 4OJOA 2YMMA 5AI9A 1OU5A 2ZIVA 4DS5A 4FHVA 4EYHB 4Y2YA 5D61A 4FZNA 4O69A 2QLTA 2R18A 7ICOA 2JH1A 2HHSA 4RQ7A 1D8BA 4I2BA 5BPCA 4WC7A 5AIAA 5EE1A 3CRXA 3NTUA 2J6SA 4Y2SA 3Q8LA 3AMZA 2HOQA 2JEJA 3RB4A 3Q8RB 1BVSA 2BCQA 2JEIA 3I28A 4EEYA 2DL0A 4O68A 2JHDA 2KN7A 1S0OA 3MR2A 1L7NA 3GV5B 2DFLA 3OVBA 3ZDBA 4JWMA 3WFSC 1HJPA 3ETRA 1Z3EB 3SENA 3PX4A 5L1JA 1O08A 4I2HA 5CA7A 5ALOA 4ED7A 2J6UA 2R8KA 1UT5A 3UMGA 1AROP 9ICOA 3GZFA 5T14A 5KG2A 2HHWA 2GA9D 5CR0A 1PVRA 3WFPA 1DXSA 3SAHA 4KLFA 4X4TA 4K4GA 3BS7A 3NGDA 4JK1A 1U4BA 1TK5A 1TAUA 1KFTA 4X5VA 2NO5A 3JZ0A 3JPNA 4RNNA 4LEWA 9ICUA 2PFNA 2LYAA 4J9OA 3SV3A 4Y2XA 1A0PA 4AP9A 1KTQA 2BGWA 3M8SA 4J9PA 2VJ5A 8ICFA 4QWDA 4KMOB 4EV6A 4WCWA 4UBBA 4X4SA 1ZQTA 4Z6CA 4YXMA 3LQCB 4EYIB 4YR0A 3FYHA 2JZBB 5DDMA 2FPKA 3OGUA 1JN3A 3L5KA 2MSNA 2ZH2A 1JUDA 2H5XA 5CJ7A 4KLDA 2OWOA 4QWCA 2KJ9A 1ZQBA 2AGQA 1DGJA 3KOOA 4LZDA 1XO1A 4RQ2A 5IIOA 3RJKA 3QYPA 4QWBA 5EWEA 3V6KA 5KFNA 4F4YA 2BCSA 9ICXA 3C2MA 4KITB 8ICJA 3UPSA 5DBAA 3WFOA 1ZQDA 4WC1A 3M1YA 4GLXA 4OJLA 4RQNA 3C2LA 4O5CA 7ICVA 1QSLA 5ALUA 5ALWA 4PHEA 2KKVA 1ZRMA 3GIKA 2ZXIA 1KBUA 3G6XA 4QZEA 3HJEA 3WK8A 2W9MA 4RWOA 3QE9Y 4QWAA 3LK9A 3RR7A 3AM9A 1RG6A 3CP8A 2ZIVB 3BDPA 5JUMA 1BPBA 4YVZA 2F76X 5CB1A 3JPRA 3HKZF 3HKZC 2BPFA 7ICSA 1QSSA 2GO7A 3ER9B 2HOFA 4ZOHC 4RT3A 2BCRA 5CWRA 1V97A 2ISPA 4RPXA 1RPLA 4ICAA 5CEHA 1TV9A 5HR9A 4ECYA 1Q3VA 1Z1BA 4F93B 1S0VA 2ZH9A 1JQRA 3MGIA 2QB0B 7ICJA 3HWTA 2C2EA 4M9NA 2P6UA 3GV7B 1KSPA 7ICNA 2M2WA 2VIXA 1RYSA 1C7YA 4FFDA 5DLFA 1NJYA 8ICRA 4PHDA 4B9TA 3D2QA 4F4ZA 3PO5A 2C2DA 3IM1A 2VA8A 4X0AA 5KT5A 3RTVA 2BBJA 2WHEA 5DEDA 4I28A 2IOHA 1PUZA 4F50A 5J0WA 4R64A 4UQGA 9ICHA 3FM9A 4KLTA 4DOBA 2FMPA 1WOTA 5ALMA 2P6RA 2ZJAA 3PSPA 5B3PA 5DECA 2W7OA 1X6JA 5KFMA 2DPIA 2XCPA 1RDFA 1RM6C 4N7RA 5CFUA 2NYVA 4ZH4A 1JROA 3V72A 5CRXA 9ICLA 3NWIA 4X0BA 2YN4A 2PI4A 5AI0A 5AKZA 3FDSA 4HAIA 4RQMA 1T4GA 3VC8A 2ZUBA 5HNKA 2D8CA 3JPSA 3HRDD 1NJZA 3KD3A 4DLGA 2W04A 1DOQA 2BQ3A 4JLZA 2H3ZA 3IV6A 4DSFA 4RT2A 1Z4NA 1B4FA 5ALZA 1SV0A 2HVHA 4UB3A 2PKEA 4GXJA 5GTIU 2EDUA 4BUGA 3TKAA 2DR7A 1S0MA 4KN7A 1SL0A 4KX5A 3RF9A 3SAFA 3MDAA 4XA5A 4UATA 5J2KA 2AGPA 2DF4B 2E3TA 3QEBZ 1JXLA 2BPCA 5KFAA 2ZG6A 8ICQA 2NRTA 2PMZC 2V4RA 1TFWA 5KFIA 3N7SC 1XU4A 5J2GA 2ZIXB 4JLXA 4NLGA 5KG5A 5ALTA 4ED8A 3NYBA 5JTIA 7ICHA 3OPXA 3ED5A 4CF5A 1OXJA 8ICSA 4E7XA 5DQHA 3M9MB 2XI9A 1Q3UA 3Q8SB 5KG3A 3O0FA 5ALYA 5EOZA 2AGOA 1DGSA 4PZNA 5AKLA 2Q66A 1UHUA 1VLBA 4M9LA 4BXOA 5J0YA 2IHOA 4RQ5A 4Y2UA 3PSTA 4M47A 2YB1A 1BPDA 4P0QA 5JU5A 1Z00A 1SV0C 4P2HA 2HSZA 1N5XA 2CN1A 1UCVA 2M2UA 4DSJA 1SZPA 3E58A 2BCVA 4XQ8A 1NK0A 5KG7A 3PX6A 5KFCA 7ICQA 4XRHA 5J2EA 4JWNA 5HR7A 4AT9A 1GPJA 4Z6FA 3OVAA 2E5SA 3PNCA 5HRLA 4P4OA 2LM1A 1SL2A 4DWIA 1SKSA 2F1HA 1JRPA 5AM3A 1ZQSA 1M6YA 5AM1A 1R8AA 3OSNA 3JPTA 2WB1F 3H39A 2KVCA 1ZJNA 2DGZA 4KLSA 4MFCA 1NJXA 3F53A 5KFPA 1ZQCA 3QUQA 2D3DA 2AHOB 4KB6A 3RH5A 3C23A 1HEKA 4DQQA 1BPEA 4KLHA 4B9MA 4ELTA 5H2FU 4FHWA 3RB3A 5AKHA 1SXEA 3N7RC 5AM5A 4R66A 4GC7A 4OAFA 2W43A 3BS5B 2EAMA 3C18A 2ASDA 2KE7A 3BQ7A 3V7KA 1AQ6A 2W11A 1ZQFA 3Q8KA 1X42A 1ZQXA 1V38A 4WC0A 2RFFA 8ICKA 1ZQVA 4X4VA 4ECTA 8ICIA 2HHVA 3QUTA 4G9BA 4ED2A 3SMVA 2W7PA 4US9A 4FS1A 3EUB2 4P4MA 5D63A 1WYGA 3PW0A 3GU3A 1TKDA 1QSYA 4DL2A 4I2CA 2R8JA 2UVUA 1IG6A 1UA0A 3AQNA 4AT8B 4NWIA 1TFRA 1L3TA 2NRVA 1LVHA 9ICGA 5ALDA 5KTQA 2KP7A 1ZRNA 4IQUA 4DQRA 2V9WA 1LKYB 2W55A 2HW3A 4ECUA 1ZQRA 2GLEA 3IG8A 4NL9A 4JV0A 3IDWA 2P35A 1XS9D 1Z00B 1COKA 1QLNA 3NS1A 1A77A 1UQVA 2WAQF 1NK5A 1NK4A 2XIDA 1BGXT 5KFHA 3V7JA 2GOLA 4LZGA 1BPYA 2QARA 4F91B 4EGWA 1ZQHA 2LPEA 4OJPA 4ATBA 4OJ5A 2HBKA 5E79U 2NRWA 4BWMA 5B3QA 3BZCA 4NJ8A 5CHGA 4WOYA 3S6JA 3RJEA 4NV0A 3T5JA 8ICHA 2W9CA 3UXPA 1X9MA 4K4HA 2W3RA 3IHQB 5B5EU 5KFOA 4NLZA 4LEZA 1X40A 3RAXA 2VA3A 1XWLA 3M9OB 5HMLA 2IUBA 4XQ7A 2OXOA 4M04A 1SWWA 5AK5A 1PX5A 5HR6A 2CXYA 1KRPA 3OV7A 2LI6A 5KAIU 3K75D 8ICLA 1RYUA 5KFJA 3T79A 2FI1A 8ICVA 4XUSA 5KFSA 8ICEA 2JH7A 5F9NA 3TI0A 3JPOA 4FBUA 5CFSA 5KFRA 1NKBA 4DFDA 2HCFA 2Y1JA 1JAJA 2GH1A 4I2IA 3BZKA 5KFXA 3ALRA 8ICGA 5AIBA 2F8LA 1LB2B 1JXEA 5KFZA 3H0MB 3PV8A 2ZTEA 4F2SA 2KJ5A 1S77D 3ER8C 5KFTA 2W8LA 1ZOLA 3NRZA 2AH5A 3T3FA 4DQPA 2ASLA 4EEBA 4KLGA 8ICYA 1FFVA 2FPMA 3WK5A 3UXOA 8ICCA 4XJEA 3RR8A 5KAFU 4G3IA 4DO9A 3H0LB 4B9UA 2K4IA 1ZQIA 4F3OA 1LKYA 4Z6EA 4RQ1A 5IINA 5JTGA 4M9GA 4U6PA 5KNIA 4O3MA 4KX3A 3M8RA 4O3RA 3EWAA 4WC6A 1TAQA 2EAPA 1D8YA 4C8KA 2ZUDA 2M9NA 3TFRA 1Q79A 3AUOA 3THVA 1H38A 1B0XA 3GV8B 3F2DA 4QJFB 4ED6A 1S9FA 3J81j 2MRLA 3AU6A 1IIPA 3QU5A 4U7CA 2C22A 4M9HA 5AKXA 5ALHA 2HN2A 2OCEA 1Q46A 4NM2A 3SV4A 2LM4A 3HIYA 2O6KA 5KFBA 4TUQA 2HHTA 2G0AA 3UQ2A 4AT9B 3EPGA 3KKAC 5ALKA 3KHHA 1XO0A 3NVVA 4LEVA 1ZQEA 2MA1A 3N97B 1UEVA 3V7LA 4USAA 2ZIWB 4Y2VA 3OJSA 2JV3A 5KL1B 2CRXA 2I5HA 4J9KA 2KKPA 5DBBA 4QZIA 2BQRA 7ICFA 3SD7A 2KEYA 4I2GA 1SGGA 2VANA 1ZQUA 3RFAA 4FE3A 2HMXA 2HN1A 4KLOA 4IG8A 4F8RA 2B4VA 5DQGA 5KFQA 4YD1A 3F2BA 3H7IA 3GIIA 2WTFA 1NJWA 4C80A 5J2DA 1T7PA 4IR9A 3QXGA 3H37A 5IIIA 1NK9A 4IRKA 4E0DA 1TFYA 4F5RA 4IL6U 5AI6A 5KFEA 1V9PA 5EE0A 1CRXA 4X4UA 1T8EA 4WH5A 3H4DA 3PHZA 5HMMA 3UXNA 4J9RA 4JV2A 2DR9A 2KSOB 5J2IA 5AKIA 4BX9C 2MUTB 5IIMA 4ECQA 3TAPA 9ICIA 4CF3A 4C8OA 4RQ6A 1X9WA 1DRGA 1X66A 1ZD4A 1L3SA 4KLIA 4QZCA 2I9GA 2ATLA 5J2CA 1XSLA 4OAIZ 2KG5A 3NVOA 2LHTA 3F5EA 3KBBA 3HP6A 3QU7A 4K9BA 2KSOA 2KZ3A 1D8LA 4EBCA 2ISOA 4O3OA 2BCUA 3M6ZA 1F5SA 4YG2A 3TQ1A 1CEZA 4IRDA 5J2HA 2ZH5A 4FHYA 3AQEA 3ETLA 1DK3A 4KTQA 5IIJA 4E8FA 5KFVA 7ICKA 3H3AA 4NL9C 2M0NA 4EX7A 1NOMA 3AQKA 3PW2A 4ECXA 1U48A 1ZYQA 9ICWA 4JUZA 2K4EA 4LVSA 3ORYA 3MFIA 3PZPA 3MBYA 3F5AA 5DGBA 4Q43A 2K89A 4DL7A 2WF8A 2JXJA 5D62A 4FH5A 4Q8EA 3UPQA 4DOAA 3DEEA 4GIBA 3K1RB 4UB5A 1WWUA 7ICMA 5GTHU 4OCZA 9ICQA 1SKRA 1K1SA 3Q8PB 3BS5A 1YLQA 4UAZA 4ECZA 2W9BB 2JEGA 3QX7A 4WQKA 2EZYA 3Q8MA 4UASA 9ICSA 5IIKA 4C8NA 2B21A 1JX4A 3AN1A 5DB7A 4DLEA 1HIWA 4RZRA 4MKPA 2ZUCA 1X9XA 2C2RA 2DRAA 2WF5A 2ZHAA 1KKXA 2A1JB 4UB8U 5J0PA 1D9FA 1RXVA 4KLEA 1MA7A 4DSIA 4J9LA 2W3SA 5JRTA 3UMBA 3PMNA 3KZXA 2NRXA 2DKZA 3WK9A 4DFKA 2A19A 2WF6A 3IG5A 4I2AA 2KFNA 2W8KA 1C20A 4YR2A 1ZQOA 3LDAA 4RWNA 1QH9A 2DBYA 2OH2A 2GAFD 3RRHA 5F9LA 3B9JA 2XO7A 1U47A 4J9NA 3U26A 2B56A 2Z7JA 1TK8A 2R8HA 3RRGA 5KG0A 3OHBA 3HT3A 2KOBA 5KFWA 1N60A 1FEZA 4QZHA 3H40A 4PHPA 2DKXA 1QQ7A 5C0YA 3SQIA 4YMMA 4B9LA 4BGDA 5K4LA 1N48A 5BOMA 3QNMA 3RJJA 4P4PA 4EEDA 3RBDA 3I1YA 4GXIA 4QZFA 1N62A 4E80A 3IRUA 2XGQA 1ZQWA 9ICAA 1MIVA 5FP0A 3PX0A 1L7PA 4Y2QA 3K4GA 2R8GA 3RB0A 4BJQA 3D2NA 1JI7A 5J29A 5AK4A 2KFZA 3K7DA 3PSFA 1FO4A 4O0IA 1KQQA 5A0LA 1UETA 4FS2A 1NZBA 5AI4A 3T5HA 4KLQA 1SKWA 4DSEA 2JMGA 4Y2RA 2AQ4A 3EZ5A 5DDYA 5EWFA 2NO4A 4EX6A 5KFLA 4FO6A 2H3QA 1ZQAA 4QW8A 2OM6A 2E8PA 1FFUA 1NI3A 3PO4A 2G09A 5DQIA 2JGAA 4NLNA 4OAGA 4C4TA 2ZH6A 3FAHA 3SR6A 5HRIA 3KTQA 3OUYA 2KMDA 4YP3A 3QUBA 3LVVA 5HRBA 3LVWA 4O3SA 4IRCA 4TQRA 3L9DA 1MIWA 2KHQA 2KNJA 4ED1A 3KFUF 3RJIA 4TUSA 5J8YA 4OAHA 3MC1A 4QWEA 1S97A 4JB3A 4UB4A 3NRWA 4ECSA 9ICBA 1ZXIA 4AT7B 1KDHA 4R63A 2DR5A 1SB3C 5KG1A 1KW4A 2Y9UA 2H3FA 4O3PA 4S3NA 2E1EA 2DR8A 4O6AA 5KFYA 4EP7A 2HHUA 3CYMA 1PK3A 1B43A 3KHGA 2FE9A 1RXWA 9ICNA 5L1MA 3N7PD 7ICPA 4QZ9A 1B22A 5KFKA 2HHQA 2OEHA 3OUYB 1WCNA 1SL1A 2YY6A 3TACB 3AQFA 1A6SA 4NXTA 2W03A 3ZDEA 4WC4A 2AJQA 2KTQA 2AXTU 4F5NA 2F2AB 5AKEA 4OJ6A 4RPZA 5AKGA 2HHXA 1FA0A 5AK3A 4KLUA 9ICFA 9ICEA 1Z1VA 5ALXA 5EE9A 4PGXA 4F72A 1MIYA 3DV9A 1QTMA 1FIQA 3MGHA 4RUAA 3V6HA 2ESEA 9ICMA 1N61A 3NASA 1Y88A 5ALRA 4QIWF 2HBMA 2OHFA 2GWSA 3HILA 4DQIA 4PL2A 1CUKA 1ZQKA 1RQLA 1L5UA 1HUOA 5L1KA 1R8CA 2YMPA 4A8EA 2JZBA 2WF9A 5KT7A 5J8YC 2EH9A 4ED0A 9ICVA 5DG7A 3TADC 3L4PA 1PK1A 2HVIA 1UA1A 3C21A 4ACOA 3ONNA 4O3NA 4Q8FA 9ICCA 4M5DA 1PZNA 2UVRA 2IHMA 5HRFA 3WKBA 4LT6A 2HDOA 2BPGA 5DB8A 4UAWA 2KIWA 4TQSA 3EPIA 5HHHA 4GC6A 1HUZA 5HREA 3JCFA 5HRDA 1O03A 2KD1A 2PFQA 1YZ6A 3HX0A 4K98A 2DVIA 1SXDA 2WFAA 4KLJA 3ISCA 2Q0ZX 4AT7A 3PR5B 3GQCA 2NV3A 1P7DA 5J2FA 5D4BA 8ICOA 4EBEA 5DLGA 4QZBA 7ICTA 2M2VA 3N28A 2NRKA 5AKYA 3NVYA 2PBEA 3ZDCA 4Y2JA 3MR5A 4IS7A 4X4RA 2FJ6A 2YMQA 4F4WA 1PVQA 1F5AA 3TAQA 9ICRA 2UVVA 4YFKA 3A0HU 1KN5A 3LWMA 2K8AA 5J2AA 1L8OA 4IQVA 3ZD8A 2ZXHA 3MGVA 4QZGA 1ZETA 1K5OA 3SYZA 1NNLA 5L1IA 2BKEA 2FDRA 2IOFA 1NK8A 4X4PA 1DK2A 2WAQC 4YD2A 1BNPA 4J9MA 2ZH8A 5AI5A 5ALSA 4CDGA 3H8SA 3ERCC 2ZIWA 2EANA 4PGQA 2E8MA 4NLBA 5IILA 4B9NA 8ICBA 2MU2A 4YCXA 4RPYA 3NKUA 2DWQA 4M6WB 8ICWA 8ICMA 2FMQA 2YTUA 3D2SA 3K1ZA 4JV1A 4M6WA 4NY8A 4MF2A 2KZZA 5AK6A 4Q44A 2PFPA 4P0PB 1NO5A 4B6JA 3NVWA 2QB1A 4KLLA 3WK4A 4I27A 3T5KA 4MEXA 4EEKA 2KICA 3C1ZA 3AL0B 2ZTCA 2RRDA 4Y2TA 3OHAA 3ISBA 1XC9A 3MFHA 4TURA 1ZQGA 3BJYA 4UB6U 2EZZA 4LJXA 4EZ9A 1L7MA 2JEFA 5L1LA 4FBTA 4TUPA 2YMLA 4EENA 2IMWP 3QEAZ 2RHFA 4FO1A 2K4HA 1COOA 4WC2A 1CI4A 5ALJA 4DS4A 3ZDDA 4O3QA 4WJ3B 5KT6A 1L7OA 4J9SA 3JYYA 3QU2A 4K97A 7ICUA 3C29A 2G5HB 3C5GA 3CW2C 2C28A 4C7ZA 5KL8B 5J0OA 4RQ8A 2ZJ8A 1X2IA 3SEIA 2UVWA 3GILA 1N2XA 3WK6A 4BXOB 2E8OA 3H0RB 1T3NA 4DQSA 3TFSA 3ICXA 4DCCA 1PK1B 4FZMA 4OO1J 3EF2A 3RJHA 3RJGA 2NRZA 3WKEA 4DF4A 3HJ1A 2O1PA 4YN4A 4OD0A 2ZIUA 5HHIA 1JALA 4QZ8A 4DEZA 5J0QA 3MDCA 5L9XA 2LMRA 1EXNA 2DRBA 5BOLA 2ZHBA 2N1RA 3NUQA 3PSIA 4UAYA 5KT4A 8ICTA 4X4QA 2Y0SF 4RNMA 4EZ6A 2ZH3A 2DQNB 5ALLA 2KJ8A 1NK7A 3RAQA 2A3VA 1QCKA 2KK0A 4K4IA 7ICGA 5HP4A 2FLNA 2R8IA 4CCHA 4O5KA 4BWJA 4J03A 2HOIA 1MQ3A 1UPHA 9ICTA 3VCBA 4F5OA 4F5PA 4PPXA 1ZQLA 4B9VA 4KMUA 3Q8QB 9ICKA 3H8JA 5TISU 2WF7A 3BQTA 2FMSA 4ECWA 3TARA 3V6JA 5G5HA 2W9AA 4K99A 2B51A 2V4QA 2IHNA 4F71A 4IC9A 2JRZA 1TVAA 3I76A 4QNLA 4JMUA 4BDPA 4M0AA 4RU9A 2DUYA 4QZDA 2YQEA 4ATBB 4UAUA 5J0XA 1OUQA 5DGAA 4AYBF 4ELVA 2KIVA 4CE6A 4UB1A 3GDXA 3QU9A 2G07A 5TZVA 4WQLA 1N56A 5AI8A 4DOCA 1SIJA 1MN8A 4M2YA 1WWVA 4EBKA 3LWLA 5D46A 4C8MA 3C28A 4HYKA 4ELUA 2ZH4A 2BZFA 2XGPA 3PMLA 2IOFK 4C4RA 2LYHA 2XC9A 1L3UA 2G08A 4C4SA 3BQ2A 5AKJA 3M6KA 1NZPA 1T94A 4DFPA 2BBHA 4I29A 3C5FA 1TAMA 4Z6DA 3MABA 3BQ0A 5ALNA 1ZQPA 2ZIUB 1IXRA 3M9NB 4NKTA 3E0FA 7ICEA 2I6XA 4UW9A 2AQ0A 3OSPA 5AM2A 3M7DA 2RDJA 1Z4OA 3TADA 3ZDAA 4C0ZA 1ZQNA 1S0NA 5AHXA 5DB6A 2WB1C 3WU2U 3UM9A 3OJUA 1VJ7A 3ISDA 1XSNA 4EBJA 4MFAA 2HBLA 4KM5A 1U49A 3GIJA 4F4KA 5B66U 1IM4A 3OVSA 2K4PA 1NKEA 5AKKA 4GXKA 4I0UA 3QZ8A 4ECVA 5DKWA 4MFFA 2IBKA 9ICJA 1F0MA 3RB6A 2EZXA 2HBJA 3MR3A 3BQ1A 1U45A 2O5AA 4PHAA 1URJA 1IV8A 5KT2A 4IQTA 2F8KA 1KFDA 2QKQA 4RQ0A 4RUCA 4F5QA 4F2RA 1N5WA 1S5LU 4DFJA 5F2VO 4C8LA 7ICLA 3KHRA 3RJFA 1BPXA 1SZHA 2AU0A 3WFQE 2PMZF 2F1JA 4FHPA 1X6IA 3T5LA 4O67A 3RH4A 2J6TA 2ZTDA 1ZD3A 2EWRA 3RH6A 2A1AA 5CP2A 3R9KA 5CFTA 4MF8A 3AU2A 1ZJMA 4HX0A 5HRHA 4IQWA 1VDVA 1U9LA 4NXXA 2VKQA 5ALQA 3WK7A 4FZLA 3D6JA 4I2FA 4Q45A 3HPOA 3IP4B 3ZD9A 4NLCA 2FLPA 2M2TA 3ZI4A 4NM1A 5D49A 3RBEA 2YB4A 4YXJA 4DL4A 5ALFA 1ZQMA 1RQNA 4IR1A 2W54A 3MCRA 4P0PA 2BE3A 2CPRA 5ALPA 1PVPA 5DG9A 4RWQA 4YMOA 4P0QB 4WBZA 1N63A 4UAVA 5ALEA 1Q78A 1J2MA 3OTQA 3SAGA 2KHVA 2XY7A 4YMNA 2BR0A 1ZQJA 3OWGA 4QZAA 4DFMA 1KLNA 2A1JA 4J9QA 3C1YA 3H38A 3WKAA 1S76D 5J0TA 4PGYA 4RNOA 5HRGA 5ALIA 2ZH7A 3HJ4A 2RP5A 3WKCA 2I1QA 2F1IA 4K8VA 5AICA 4B9SA 3SZ2A 5KFFA 4DSKA 5KFDA 3TANA 2JR5A 1VJ5A 2RQ5A 8ICAA 2H3VA 3F2CA 4Y2PA 4O9MA 1A76A 8ICNA 1ZD5A 3DDHA 4R8UA 3AQLA 1ZQQA 4I2JA 1KEJA 3CK6A 3KHLA 4K96A 4NXZA 3CNHA 2RDIA 4ED3A 3E2EA 3HW8A 5HRKA 1MSWD 4NXUA 1WG8A 2Y9TA 2PI5A 4UB2A 4NXWA 3AEVA 3C2KA 3KZIU 2HI0A 4FHXA 2VJ4A 5KG4A 4NLKA 2Q4TA 1MQ2A 1ED1A 4PJ0U 2BHNA 3JPPA 2ODGA 1KL9A 3AQMA 2EAOA 4UD5A 4K9AA 4KLMA 3B0YA 5KT3A 2LBOA 8ICZA 1ECWA 5DBCA 2XY6A 2EQYA 1KFSA 2ZIXA 2LYBA 1YZ7A 8ICXA 1VFGA 1RZTA 1UT8A 5J0RA 1L8LA 4CF4A 4RWPA 8ICUA 2KV2A 5G5GA 4US8A 2ID1A 1X9SA 4EELA 1BPZA 5J0SA 2E8NA 4CRXA 1L3VA 5DB9A 5HC9A 2FPLA 1D9DA 4AT8A 1SV4A 2BDUA 2PFOA 7ICIA 1BNOA 3GIMA 4DF8A 4DL3A 4DL5A 5EWGA 1ZQ1C 1XSPA 2DPJA 4X4NA 4GFJA 4F4XA 9ICPA 3LYSA 2L5YA 2FLLA 1R8BA 5F3XB 3PVXA 1Z19A 3H8WA 1XNSA 3PW5A 4CGZA 2PXIA 4QW9A 3N4MB 2ES6A 5J2JA 3QUCA 1NKCA 3EW9A 2MUTA 2OYYA 3EYZA 2QARB 4PL1A 1NK6A 5J2BA 2ZH1A 2K8BB 3FC4A 4R8UB 1V85A 4O5EA 2BDPA 4R65A 1J2NA 1GO3F 1K1QA 1JMSA 1UEUA 3A0BU 5KFUA 3UMCA 2B0CA 2KVSA 1J97A 1Q8KA 2P66A 1MC8A 3L3FX 1WUDA 3B0XA 2ALZA 4AYBC 4X4OA 4YQWA 2E1FA 5KFGA 4NKUA 2F77X 2W9CB 2ASJA 1ZQYA 5DG8A 3JPQA 1KNYA 1JIHA 8ICPA 1ZD2P 1QQ5A 4UBCA 2XCAA 4MHVA 5ALVA 3PR4A 3QU4A 4FH3A 4ECRA 2IA6A 3PW7A 4I2EA 4WBYA 4WC3A 2XICA 4EBDA 2G06A 4PH5A 3PW4A 5EE3A 2VA2A 2LKYA 1ZQZA 4YR3A 3SI8A 1TE2A 2YX8A 3IN5A 3WKDA 1WCLA 4DSLA 4KN4A 1T3QA 3C66A 3H8MA 2ZJ5A 4DL6A 3PY8A 1QQ6A 4RQ3A 4F92B 1S10A 3NVZA 1RYRA 3G6YA 1LV5A 2BQUA 4C7YA 4UARA 4LEYA 1S8OA 2H3IA 4NXVA 5AM4A 2F3NA 2D6FC 2XVTA 2B6GA 3WFRE 2RLTA 3QZ7A 2HHPA 2F44A 2G5IB 5C5JA 2K60A 4PZOA 4RQ4A 1F44A 2MAXA 3GFKB 1R89A 4M9JA 4WC5A 5KG6A 2W9BA 2QB0A 5J0UA 4I2DA 1SWVA 2Y0SC 4QIWC 2Y1IA 4CNQA 1V4AA 5AM0A 4UD4A 5CHEA 1L6NA
chains in the Genus database with same CATH topology
1ZQXA 2R8IA 4CCHA 4I2AA 2KFNA 4O5KA 2W8KA 4WC0A 4BWJA 2RFFA 4YR2A 1MQ3A 1ZQVA 8ICKA 9ICTA 4X4VA 7ICRA 1ZQOA 3LDAA 4F5OA 4RWNA 3G6VA 4ECTA 8ICIA 2HHVA 4F5PA 3RRHA 5F9LA 1ZQLA 3MR6A 4KMUA 3Q8QB 4ED2A 1TK0A 4B9VA 4PPXA 9ICKA 2XY5A 3H8JA 2XO7A 2FMSA 3BQTA 4FS1A 4P4MA 3UQ0A 4ECWA 3TARA 3H4BA 4J9NA 1U47A 2KZMA 4MEYA 3PW0A 3V6JA 1TKDA 2W9AA 1QSYA 2V4QA 2IHNA 1TK8A 4DL2A 2R8HA 3RRGA 1OU5A 1TVAA 4I2CA 4DS5A 4FHVA 5KG0A 3OHBA 4EYHB 3HT3A 4BDPA 4M0AA 4RU9A 2R8JA 5KFWA 4QZDA 2UVUA 7ICOA 2HHSA 1UA0A 4ATBB 5J0XA 4RQ7A 3AQNA 4AT8B 5DGAA 4QZHA 3H40A 1TFRA 4ELVA 5HP4A 1L3TA 5BPCA 4I2BA 4WC7A 2NRVA 4PHPA 4UB1A 3GDXA 9ICGA 5KTQA 5TZVA 2KP7A 4YMMA 4IQUA 4DQRA 3NTUA 2J6SA 2V9WA 1N56A 4B9LA 3Q8LA 4DOCA 4BGDA 2HW3A 4ECUA 1ZQRA 1N48A 5BOMA 3RB4A 2JEJA 4JV0A 4M2YA 4EBKA 3Q8RB 5D46A 3LWLA 4C8MA 1XS9D 1BVSA 1Z00B 2BCQA 4HYKA 2JEIA 3RJJA 4ELUA 1QLNA 2ZH4A 1A77A 4EEYA 4WC6A 4P4PA 2KN7A 1S0OA 3RBDA 3MR2A 2XGPA 3PMLA 1NK5A 3GV5B 2DFLA 1NK4A 3ZDBA 2LYHA 1BGXT 5KFHA 2XC9A 3V7JA 4GXIA 1L3UA 3OVBA 4JWMA 3WFSC 1HJPA 4QZFA 4LZGA 3BQ2A 1BPYA 1Z3EB 4F91B 1NZPA 4E80A 4DFPA 3PX4A 1ZQHA 5L1JA 2XGQA 4I29A 1ZQWA 9ICAA 1MIVA 4I2HA 5CA7A 4ATBA 3C5FA 3PX0A 4ED7A 4Z6DA 2J6UA 2R8KA 2NRWA 3K4GA 1UT5A 3MABA 3BQ0A 1ZQPA 4BWMA 3RB0A 2R8GA 1AROP 9ICOA 1IXRA 5J29A 3M9NB 2KFZA 5KG2A 5CHGA 2HHWA 4NKTA 3RJEA 7ICEA 3T5JA 8ICHA 2W9CA 5CR0A 3UXPA 2AQ0A 1X9MA 3OSPA 4K4HA 3WFPA 4O0IA 4KLFA 4X4TA 3IHQB 1UETA 4K4GA 2RDJA 3ZDAA 3NGDA 4FS2A 4JK1A 5KFOA 3T5HA 1U4BA 1TK5A 1S0NA 1ZQNA 4NLZA 4KLQA 4X5VA 1SKWA 1KFTA 3RAXA 2VA3A 5DB6A 3JZ0A 3OJUA 3JPNA 1XWLA 3M9OB 5HMLA 4DSEA 2AQ4A 1VJ7A 4RNNA 3ISDA 4XQ7A 4M04A 3EZ5A 5DDYA 5EWFA 5KFLA 1XSNA 4EBJA 4MFAA 4FO6A 1U49A 1ZQAA 4QW8A 3GIJA 4F4KA 2PFNA 9ICUA 1IM4A 1PX5A 4J9OA 4X4SA 1NKEA 3OVSA 3SV3A 1KRPA 4GXKA 2BGWA 3OV7A 1KTQA 3QZ8A 3M8SA 4J9PA 4ECVA 8ICFA 2DR8A 4QWDA 3PO4A 3K75D 5DQIA 4UBBA 8ICLA 5DKWA 4MFFA 1ZQTA 2IBKA 4Z6CA 4YXMA 5KFJA 4EYIB 9ICJA 3LQCB 4YR0A 3RB6A 4NLNA 3FYHA 1TAUA 1KNYA 2JZBB 5DDMA 2FPKA 3OGUA 3MR3A 3BQ1A 4XUSA 5KFSA 1U45A 4PHAA 8ICVA 8ICEA 2O5AA 2ZH6A 5F9NA 3JPOA 1JN3A 5KT2A 4IQTA 3TI0A 5HRIA 2ZH2A 2H5XA 4FBUA 5CJ7A 3KTQA 4KLDA 5KFRA 2OWOA 4QWCA 3OUYA 4YP3A 1ZQBA 1NKBA 1KFDA 5HRBA 4RQ0A 2AGQA 4RUCA 4O3SA 4F5QA 2Y1JA 4F2RA 4IRCA 1JAJA 4TQRA 4LZDA 4DFJA 3L9DA 4C8LA 1XO1A 7ICLA 3KHRA 4RQ2A 1MIWA 5F2VO 5IIOA 3RJKA 3RJFA 4I2IA 4ED1A 1BPXA 2AU0A 3RJIA 5KFXA 4TUSA 4QWEA 8ICGA 4QWBA 3WFQE 2F1JA 1S97A 4FHPA 4UB4A 4ECSA 9ICBA 4AT7B 3T5LA 5EWEA 3V6KA 3RH4A 2J6TA 2ZTDA 1KDHA 4R63A 1LB2B 1JXEA 2DR5A 5KFZA 5KFNA 4F4YA 3RH6A 2BCSA 5KG1A 4O3PA 5CP2A 4S3NA 9ICXA 4MF8A 3AU2A 3C2MA 3PV8A 2ZTEA 4KITB 1ZJMA 4F2SA 5HRHA 5KFYA 4EP7A 2HHUA 8ICJA 4IQWA 3UPSA 1S77D 5KFTA 3KHGA 1B43A 5DBAA 1RXWA 9ICNA 1U9LA 2W8LA 7ICPA 3WFOA 1ZQDA 3T3FA 4DQPA 4QZ9A 4I2FA 1B22A 4Q45A 2ASLA 4WC1A 5KFKA 3HPOA 3ZD9A 4GLXA 4KLGA 8ICYA 2FPMA 2FLPA 2HHQA 3UXOA 8ICCA 2M2TA 3OUYB 1WCNA 3C2LA 1SL1A 1QSLA 4O5CA 7ICVA 3RR8A 4NM1A 4PHEA 5D49A 3RBEA 4G3IA 4DO9A 4YXJA 4DL4A 1ZQMA 3ZDEA 4IR1A 4WC4A 4B9UA 2AJQA 2KTQA 1ZQIA 4F3OA 4Z6EA 3GIKA 4RQ1A 4F5NA 5IINA 3G6XA 2BE3A 4QZEA 4RPZA 2HHXA 5DG9A 1FA0A 4YMOA 4RWQA 4M9GA 4KLUA 4WBZA 2W9MA 1Q78A 9ICFA 3QE9Y 4RWOA 9ICEA 4PGXA 4QWAA 2XY7A 4YMNA 2BR0A 1ZQJA 4DSKA 3LK9A 3RR7A 1MIYA 3M8RA 1QTMA 4O3RA 3EWAA 4QZAA 3MGHA 4DFMA 1TAQA 1D8YA 1KLNA 4C8KA 2A1JA 2ZUDA 4RUAA 3C1YA 4J9QA 3V6HA 9ICMA 3H38A 1S76D 5J0TA 1Y88A 4PGYA 2M9NA 4RNOA 5HRGA 3TFRA 3BDPA 2ZH7A 5JUMA 1BPBA 3HJ4A 4YVZA 1Q79A 3JPRA 2I1QA 5CB1A 3AUOA 3THVA 2F1IA 4B9SA 1H38A 2BPFA 7ICSA 3GV8B 1QSSA 3SZ2A 2GWSA 4DQIA 4RT3A 5KFFA 4ED6A 1S9FA 5KFDA 2BCRA 5CWRA 1CUKA 3AU6A 3TANA 1ZQKA 2C22A 4M9HA 1L5UA 1HUOA 2ISPA 5L1KA 8ICAA 1R8CA 4RPXA 4O9MA 2JZBA 1A76A 8ICNA 1RPLA 5KT7A 4NM2A 3SV4A 1TV9A 4ED0A 9ICVA 3HIYA 4R8UA 3AQLA 5HR9A 4ECYA 4I2JA 5KFBA 4F93B 5DG7A 1ZQQA 4TUQA 1S0VA 2HVIA 2ZH9A 1KEJA 1UA1A 2HHTA 3UQ2A 3MGIA 3PO5A 1JQRA 3KHLA 4AT9B 3C21A 4NXZA 3EPGA 2RDIA 7ICJA 3HWTA 4O3NA 4ED3A 3E2EA 3HW8A 4Q8FA 9ICCA 3KHHA 5HRKA 4M5DA 1PZNA 2C2EA 2UVRA 2IHMA 4M9NA 5HRFA 1MSWD 4LT6A 2P6UA 3GV7B 2BPGA 1KSPA 5DB8A 4UAWA 3N97B 1ZQEA 3EPIA 4TQSA 1UEVA 5HHHA 7ICNA 3V7LA 4GC6A 1HUZA 2PI5A 4UB2A 2M2WA 5HREA 5HRDA 3OJSA 1RYSA 1C7YA 5DLFA 3C2KA 1NJYA 2PFQA 8ICRA 4PHDA 3HX0A 4B9TA 4FHXA 2DVIA 4J9KA 4F4ZA 4KLJA 3ISCA 5KG4A 2Q0ZX 5DBBA 3IM1A 4QZIA 2C2DA 2BQRA 2VA8A 3PR5B 1MQ2A 4NLKA 2BHNA 3GQCA 7ICFA 4AT7A 4X0AA 3JPPA 5KT5A 5J2FA 5D4BA 3RTVA 8ICOA 4I2GA 5DEDA 3AQMA 4UD5A 2VANA 1ZQUA 4I28A 4EBEA 4KLMA 4F50A 7ICQA 5DLGA 4QZBA 3B0YA 5J0WA 7ICTA 4KLOA 4R64A 4UQGA 2M2VA 4IG8A 5KT3A 9ICHA 4F8RA 8ICZA 5DQGA 5KFQA 4DOBA 4KLTA 4YD1A 2NRKA 2FMPA 1WOTA 3H7IA 2P6RA 2PBEA 5DBCA 2XY6A 2ZJAA 3GIIA 3ZDCA 2WTFA 1KFSA 1NJWA 3MR5A 8ICXA 5DECA 4X4RA 1VFGA 1RZTA 1UT8A 5J0RA 4WCWA 4F4WA 1F5AA 4RWPA 8ICUA 5J2DA 1T7PA 4IR9A 5KFMA 3H37A 2ID1A 5IIIA 1NK9A 2DPIA 1X9SA 2XCPA 4IRKA 1BPZA 4E0DA 3TAQA 5J0SA 4F5RA 1TFYA 3V72A 4ZH4A 9ICRA 5KFEA 1L3VA 1V9PA 2UVVA 4YFKA 1T8EA 4X4UA 3H4DA 5DB9A 5HC9A 2FPLA 1D9DA 4AT8A 9ICLA 5HMMA 3LWMA 4X0BA 3UXNA 2PFOA 5J2AA 7ICIA 1BNOA 4J9RA 2PI4A 4JV2A 2DR9A 3GIMA 4IQVA 4DF8A 4DL5A 4DL3A 5EWGA 3FDSA 5J2IA 1XSPA 2DPJA 3ZD8A 4X4NA 2MUTB 4QZGA 5IIMA 1ZETA 3SYZA 4F4XA 9ICPA 1T4GA 2ZUBA 4ECQA 5HNKA 3JPSA 3TAPA 1NJZA 2FLLA 9ICIA 4DLGA 1R8BA 5L1IA 3PVXA 2BKEA 4C8OA 3H8WA 4RQ6A 3PW5A 1X9WA 1DOQA 2BQ3A 1NK8A 4X4PA 4DSFA 1DK2A 4RT2A 4YD2A 1BNPA 4J9MA 2ZH8A 2PXIA 1L3SA 4KLIA 2HVHA 3H8SA 4UB3A 4QW9A 3N4MB 4QZCA 2I9GA 4GXJA 5J2JA 5J2CA 2ATLA 1XSLA 4PGQA 1NKCA 3EW9A 2MUTA 5IILA 4B9NA 3EYZA 1NK6A 2ZH1A 8ICBA 5J2BA 4YCXA 2DR7A 4RPYA 1S0MA 4M6WB 3HP6A 4KN7A 4R8UB 8ICWA 1SL0A 4O5EA 8ICMA 2FMQA 2BDPA 4R65A 3MDAA 4XA5A 4JV1A 1K1QA 1JMSA 4M6WA 5J2KA 1UEUA 2KZ3A 4NY8A 1D8LA 4EBCA 2AGPA 5KFUA 2ISOA 4MF2A 2KZZA 4O3OA 1JXLA 3QEBZ 2BCUA 4Q44A 2P66A 2BPCA 2PFPA 5KFAA 1NO5A 8ICQA 1MC8A 4YG2A 4KLLA 2NRTA 2V4RA 3TQ1A 3B0XA 2ALZA 1CEZA 1TFWA 4I27A 5KFIA 3T5KA 4MEXA 1XU4A 5J2GA 5J2HA 3Q8KA 4IRDA 4X4OA 2ZH5A 4FHYA 3C1ZA 3ETLA 4YQWA 4NLGA 5KG5A 2ZTCA 4ED8A 1DK3A 4KTQA 3NYBA 5IIJA 7ICHA 3OHAA 3ISBA 5KFGA 1XC9A 3MFHA 4TURA 4NKUA 1ZQGA 4E8FA 8ICSA 5KFVA 5DQHA 3BJYA 7ICKA 3H3AA 4E7XA 3M9MB 2W9CB 4EZ9A 3AQKA 1NOMA 1ZQYA 5KG3A 5DG8A 3Q8SB 3JPQA 5L1LA 3PW2A 4ECXA 2ASJA 1JIHA 5EOZA 4TUPA 2JEFA 4FBTA 2AGOA 3QEAZ 2IMWP 1DGSA 1U48A 8ICPA 1ZYQA 4WC2A 1COOA 2Q66A 4M9LA 4UBCA 2XCAA 4JUZA 4BXOA 4LVSA 9ICWA 4DS4A 3ORYA 3MFIA 5J0YA 3ZDDA 4RQ5A 4O3QA 3MBYA 3PR4A 5DGBA 4M47A 4Q43A 4FH3A 1BPDA 4ECRA 4DL7A 1Z00A 2IA6A 4P2HA 3PW7A 5KT6A 4I2EA 4J9SA 3JYYA 4WBYA 4FH5A 4WC3A 4Q8EA 4EBDA 3UPQA 4DOAA 2M2UA 4DSJA 4PH5A 7ICUA 1SZPA 3PW4A 2BCVA 4XQ8A 1NK0A 3C5GA 5KG7A 2C28A 5KFCA 4UB5A 3PX6A 1ZQZA 4XRHA 4YR3A 3SI8A 2VA2A 5J0OA 7ICMA 5J2EA 4JWNA 4AT9A 1SKRA 4RQ8A 1WCLA 4DSLA 2ZJ8A 1X2IA 2UVWA 1K1SA 4Z6FA 3OVAA 4KN4A 3Q8PB 3C66A 3PNCA 3GILA 1YLQA 2ZJ5A 5HRLA 4BXOB 1T3NA 4P4OA 4UAZA 4DQSA 1SL2A 3TFSA 4DWIA 4DL6A 3PY8A 1SKSA 2F1HA 4ECZA 1ZQSA 3RJHA 1R8AA 4RQ3A 3RJGA 4F92B 2NRZA 3OSNA 2W9BB 3JPTA 1S10A 1RYRA 4DF4A 2JEGA 3H39A 3HJ1A 3G6YA 1LV5A 2BQUA 1ZJNA 3Q8MA 4KLSA 4MFCA 1NJXA 2O1PA 9ICSA 5IIKA 5KFPA 4C8NA 4YN4A 1ZQCA 2B21A 3WFRE 1JX4A 5DB7A 3QZ7A 4DLEA 2HHPA 3RH5A 3C23A 5HHIA 5C5JA 4RZRA 4QZ8A 2ZUCA 4DQQA 1BPEA 2C2RA 4DEZA 5J0QA 3MDCA 4B9MA 4KLHA 4ELTA 5L9XA 2DRAA 4FHWA 1EXNA 2DRBA 4RQ4A 2ZHAA 2A1JB 5BOLA 2MAXA 5J0PA 3GFKB 3RB3A 1RXVA 1D9FA 2ZHBA 4KLEA 1R89A 4DSIA 4M9JA 4UAYA 5KT4A 4R66A 4J9LA 4GC7A 8ICTA 5KG6A 2W9BA 9ICQA 4WC5A 4X4QA 5J0UA 4I2DA 4RNMA 3PMNA 4EZ6A 2ZH3A 3C18A 1NK7A 2Y1IA 3RAQA 2ASDA 3V7KA 4K4IA 1V4AA 4UD4A 7ICGA 1ZQFA 2NRXA 4DFKA 2FLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQX A;  2R8I A;  4CCH A;  4I2A A;  2KFN A;  4O5K A;  2W8K A;  4WC0 A;  4BWJ A;  2RFF A;  4YR2 A;  1MQ3 A;  1ZQV A;  8ICK A;  9ICT A;  4X4V A;  7ICR A;  1ZQO A;  3LDA A;  4F5O A;  4RWN A;  3G6V A;  4ECT A;  8ICI A;  2HHV A;  4F5P A;  3RRH A;  5F9L A;  1ZQL A;  3MR6 A;  4KMU A;  3Q8Q B;  4ED2 A;  1TK0 A;  4B9V A;  4PPX A;  9ICK A;  2XY5 A;  3H8J A;  2XO7 A;  2FMS A;  3BQT A;  4FS1 A;  4P4M A;  3UQ0 A;  4ECW A;  3TAR A;  3H4B A;  4J9N A;  1U47 A;  2KZM A;  4MEY A;  3PW0 A;  3V6J A;  1TKD A;  2W9A A;  1QSY A;  2V4Q A;  2IHN A;  1TK8 A;  4DL2 A;  2R8H A;  3RRG A;  1OU5 A;  1TVA A;  4I2C A;  4DS5 A;  4FHV A;  5KG0 A;  3OHB A;  4EYH B;  3HT3 A;  4BDP A;  4M0A A;  4RU9 A;  2R8J A;  5KFW A;  4QZD A;  2UVU A;  7ICO A;  2HHS A;  1UA0 A;  4ATB B;  5J0X A;  4RQ7 A;  3AQN A;  4AT8 B;  5DGA A;  4QZH A;  3H40 A;  1TFR A;  4ELV A;  5HP4 A;  1L3T A;  5BPC A;  4I2B A;  4WC7 A;  2NRV A;  4PHP A;  4UB1 A;  3GDX A;  9ICG A;  5KTQ A;  5TZV A;  2KP7 A;  4YMM A;  4IQU A;  4DQR A;  3NTU A;  2J6S A;  2V9W A;  1N56 A;  4B9L A;  3Q8L A;  4DOC A;  4BGD A;  2HW3 A;  4ECU A;  1ZQR A;  1N48 A;  5BOM A;  3RB4 A;  2JEJ A;  4JV0 A;  4M2Y A;  4EBK A;  3Q8R B;  5D46 A;  3LWL A;  4C8M A;  1XS9 D;  1BVS A;  1Z00 B;  2BCQ A;  4HYK A;  2JEI A;  3RJJ A;  4ELU A;  1QLN A;  2ZH4 A;  1A77 A;  4EEY A;  4WC6 A;  4P4P A;  2KN7 A;  1S0O A;  3RBD A;  3MR2 A;  2XGP A;  3PML A;  1NK5 A;  3GV5 B;  2DFL A;  1NK4 A;  3ZDB A;  2LYH A;  1BGX T;  5KFH A;  2XC9 A;  3V7J A;  4GXI A;  1L3U A;  3OVB A;  4JWM A;  3WFS C;  1HJP A;  4QZF A;  4LZG A;  3BQ2 A;  1BPY A;  1Z3E B;  4F91 B;  1NZP A;  4E80 A;  4DFP A;  3PX4 A;  1ZQH A;  5L1J A;  2XGQ A;  4I29 A;  1ZQW A;  9ICA A;  1MIV A;  4I2H A;  5CA7 A;  4ATB A;  3C5F A;  3PX0 A;  4ED7 A;  4Z6D A;  2J6U A;  2R8K A;  2NRW A;  3K4G A;  1UT5 A;  3MAB A;  3BQ0 A;  1ZQP A;  4BWM A;  3RB0 A;  2R8G A;  1ARO P;  9ICO A;  1IXR A;  5J29 A;  3M9N B;  2KFZ A;  5KG2 A;  5CHG A;  2HHW A;  4NKT A;  3RJE A;  7ICE A;  3T5J A;  8ICH A;  2W9C A;  5CR0 A;  3UXP A;  2AQ0 A;  1X9M A;  3OSP A;  4K4H A;  3WFP A;  4O0I A;  4KLF A;  4X4T A;  3IHQ B;  1UET A;  4K4G A;  2RDJ A;  3ZDA A;  3NGD A;  4FS2 A;  4JK1 A;  5KFO A;  3T5H A;  1U4B A;  1TK5 A;  1S0N A;  1ZQN A;  4NLZ A;  4KLQ A;  4X5V A;  1SKW A;  1KFT A;  3RAX A;  2VA3 A;  5DB6 A;  3JZ0 A;  3OJU A;  3JPN A;  1XWL A;  3M9O B;  5HML A;  4DSE A;  2AQ4 A;  1VJ7 A;  4RNN A;  3ISD A;  4XQ7 A;  4M04 A;  3EZ5 A;  5DDY A;  5EWF A;  5KFL A;  1XSN A;  4EBJ A;  4MFA A;  4FO6 A;  1U49 A;  1ZQA A;  4QW8 A;  3GIJ A;  4F4K A;  2PFN A;  9ICU A;  1IM4 A;  1PX5 A;  4J9O A;  4X4S A;  1NKE A;  3OVS A;  3SV3 A;  1KRP A;  4GXK A;  2BGW A;  3OV7 A;  1KTQ A;  3QZ8 A;  3M8S A;  4J9P A;  4ECV A;  8ICF A;  2DR8 A;  4QWD A;  3PO4 A;  3K75 D;  5DQI A;  4UBB A;  8ICL A;  5DKW A;  4MFF A;  1ZQT A;  2IBK A;  4Z6C A;  4YXM A;  5KFJ A;  4EYI B;  9ICJ A;  3LQC B;  4YR0 A;  3RB6 A;  4NLN A;  3FYH A;  1TAU A;  1KNY A;  2JZB B;  5DDM A;  2FPK A;  3OGU A;  3MR3 A;  3BQ1 A;  4XUS A;  5KFS A;  1U45 A;  4PHA A;  8ICV A;  8ICE A;  2O5A A;  2ZH6 A;  5F9N A;  3JPO A;  1JN3 A;  5KT2 A;  4IQT A;  3TI0 A;  5HRI A;  2ZH2 A;  2H5X A;  4FBU A;  5CJ7 A;  3KTQ A;  4KLD A;  5KFR A;  2OWO A;  4QWC A;  3OUY A;  4YP3 A;  1ZQB A;  1NKB A;  1KFD A;  5HRB A;  4RQ0 A;  2AGQ A;  4RUC A;  4O3S A;  4F5Q A;  2Y1J A;  4F2R A;  4IRC A;  1JAJ A;  4TQR A;  4LZD A;  4DFJ A;  3L9D A;  4C8L A;  1XO1 A;  7ICL A;  3KHR A;  4RQ2 A;  1MIW A;  5F2V O;  5IIO A;  3RJK A;  3RJF A;  4I2I A;  4ED1 A;  1BPX A;  2AU0 A;  3RJI A;  5KFX A;  4TUS A;  4QWE A;  8ICG A;  4QWB A;  3WFQ E;  2F1J A;  1S97 A;  4FHP A;  4UB4 A;  4ECS A;  9ICB A;  4AT7 B;  3T5L A;  5EWE A;  3V6K A;  3RH4 A;  2J6T A;  2ZTD A;  1KDH A;  4R63 A;  1LB2 B;  1JXE A;  2DR5 A;  5KFZ A;  5KFN A;  4F4Y A;  3RH6 A;  2BCS A;  5KG1 A;  4O3P A;  5CP2 A;  4S3N A;  9ICX A;  4MF8 A;  3AU2 A;  3C2M A;  3PV8 A;  2ZTE A;  4KIT B;  1ZJM A;  4F2S A;  5HRH A;  5KFY A;  4EP7 A;  2HHU A;  8ICJ A;  4IQW A;  3UPS A;  1S77 D;  5KFT A;  3KHG A;  1B43 A;  5DBA A;  1RXW A;  9ICN A;  1U9L A;  2W8L A;  7ICP A;  3WFO A;  1ZQD A;  3T3F A;  4DQP A;  4QZ9 A;  4I2F A;  1B22 A;  4Q45 A;  2ASL A;  4WC1 A;  5KFK A;  3HPO A;  3ZD9 A;  4GLX A;  4KLG A;  8ICY A;  2FPM A;  2FLP A;  2HHQ A;  3UXO A;  8ICC A;  2M2T A;  3OUY B;  1WCN A;  3C2L A;  1SL1 A;  1QSL A;  4O5C A;  7ICV A;  3RR8 A;  4NM1 A;  4PHE A;  5D49 A;  3RBE A;  4G3I A;  4DO9 A;  4YXJ A;  4DL4 A;  1ZQM A;  3ZDE A;  4IR1 A;  4WC4 A;  4B9U A;  2AJQ A;  2KTQ A;  1ZQI A;  4F3O A;  4Z6E A;  3GIK A;  4RQ1 A;  4F5N A;  5IIN A;  3G6X A;  2BE3 A;  4QZE A;  4RPZ A;  2HHX A;  5DG9 A;  1FA0 A;  4YMO A;  4RWQ A;  4M9G A;  4KLU A;  4WBZ A;  2W9M A;  1Q78 A;  9ICF A;  3QE9 Y;  4RWO A;  9ICE A;  4PGX A;  4QWA A;  2XY7 A;  4YMN A;  2BR0 A;  1ZQJ A;  4DSK A;  3LK9 A;  3RR7 A;  1MIY A;  3M8R A;  1QTM A;  4O3R A;  3EWA A;  4QZA A;  3MGH A;  4DFM A;  1TAQ A;  1D8Y A;  1KLN A;  4C8K A;  2A1J A;  2ZUD A;  4RUA A;  3C1Y A;  4J9Q A;  3V6H A;  9ICM A;  3H38 A;  1S76 D;  5J0T A;  1Y88 A;  4PGY A;  2M9N A;  4RNO A;  5HRG A;  3TFR A;  3BDP A;  2ZH7 A;  5JUM A;  1BPB A;  3HJ4 A;  4YVZ A;  1Q79 A;  3JPR A;  2I1Q A;  5CB1 A;  3AUO A;  3THV A;  2F1I A;  4B9S A;  1H38 A;  2BPF A;  7ICS A;  3GV8 B;  1QSS A;  3SZ2 A;  2GWS A;  4DQI A;  4RT3 A;  5KFF A;  4ED6 A;  1S9F A;  5KFD A;  2BCR A;  5CWR A;  1CUK A;  3AU6 A;  3TAN A;  1ZQK A;  2C22 A;  4M9H A;  1L5U A;  1HUO A;  2ISP A;  5L1K A;  8ICA A;  1R8C A;  4RPX A;  4O9M A;  2JZB A;  1A76 A;  8ICN A;  1RPL A;  5KT7 A;  4NM2 A;  3SV4 A;  1TV9 A;  4ED0 A;  9ICV A;  3HIY A;  4R8U A;  3AQL A;  5HR9 A;  4ECY A;  4I2J A;  5KFB A;  4F93 B;  5DG7 A;  1ZQQ A;  4TUQ A;  1S0V A;  2HVI A;  2ZH9 A;  1KEJ A;  1UA1 A;  2HHT A;  3UQ2 A;  3MGI A;  3PO5 A;  1JQR A;  3KHL A;  4AT9 B;  3C21 A;  4NXZ A;  3EPG A;  2RDI A;  7ICJ A;  3HWT A;  4O3N A;  4ED3 A;  3E2E A;  3HW8 A;  4Q8F A;  9ICC A;  3KHH A;  5HRK A;  4M5D A;  1PZN A;  2C2E A;  2UVR A;  2IHM A;  4M9N A;  5HRF A;  1MSW D;  4LT6 A;  2P6U A;  3GV7 B;  2BPG A;  1KSP A;  5DB8 A;  4UAW A;  3N97 B;  1ZQE A;  3EPI A;  4TQS A;  1UEV A;  5HHH A;  7ICN A;  3V7L A;  4GC6 A;  1HUZ A;  2PI5 A;  4UB2 A;  2M2W A;  5HRE A;  5HRD A;  3OJS A;  1RYS A;  1C7Y A;  5DLF A;  3C2K A;  1NJY A;  2PFQ A;  8ICR A;  4PHD A;  3HX0 A;  4B9T A;  4FHX A;  2DVI A;  4J9K A;  4F4Z A;  4KLJ A;  3ISC A;  5KG4 A;  2Q0Z X;  5DBB A;  3IM1 A;  4QZI A;  2C2D A;  2BQR A;  2VA8 A;  3PR5 B;  1MQ2 A;  4NLK A;  2BHN A;  3GQC A;  7ICF A;  4AT7 A;  4X0A A;  3JPP A;  5KT5 A;  5J2F A;  5D4B A;  3RTV A;  8ICO A;  4I2G A;  5DED A;  3AQM A;  4UD5 A;  2VAN A;  1ZQU A;  4I28 A;  4EBE A;  4KLM A;  4F50 A;  7ICQ A;  5DLG A;  4QZB A;  3B0Y A;  5J0W A;  7ICT A;  4KLO A;  4R64 A;  4UQG A;  2M2V A;  4IG8 A;  5KT3 A;  9ICH A;  4F8R A;  8ICZ A;  5DQG A;  5KFQ A;  4DOB A;  4KLT A;  4YD1 A;  2NRK A;  2FMP A;  1WOT A;  3H7I A;  2P6R A;  2PBE A;  5DBC A;  2XY6 A;  2ZJA A;  3GII A;  3ZDC A;  2WTF A;  1KFS A;  1NJW A;  3MR5 A;  8ICX A;  5DEC A;  4X4R A;  1VFG A;  1RZT A;  1UT8 A;  5J0R A;  4WCW A;  4F4W A;  1F5A A;  4RWP A;  8ICU A;  5J2D A;  1T7P A;  4IR9 A;  5KFM A;  3H37 A;  2ID1 A;  5III A;  1NK9 A;  2DPI A;  1X9S A;  2XCP A;  4IRK A;  1BPZ A;  4E0D A;  3TAQ A;  5J0S A;  4F5R A;  1TFY A;  3V72 A;  4ZH4 A;  9ICR A;  5KFE A;  1L3V A;  1V9P A;  2UVV A;  4YFK A;  1T8E A;  4X4U A;  3H4D A;  5DB9 A;  5HC9 A;  2FPL A;  1D9D A;  4AT8 A;  9ICL A;  5HMM A;  3LWM A;  4X0B A;  3UXN A;  2PFO A;  5J2A A;  7ICI A;  1BNO A;  4J9R A;  2PI4 A;  4JV2 A;  2DR9 A;  3GIM A;  4IQV A;  4DF8 A;  4DL5 A;  4DL3 A;  5EWG A;  3FDS A;  5J2I A;  1XSP A;  2DPJ A;  3ZD8 A;  4X4N A;  2MUT B;  4QZG A;  5IIM A;  1ZET A;  3SYZ A;  4F4X A;  9ICP A;  1T4G A;  2ZUB A;  4ECQ A;  5HNK A;  3JPS A;  3TAP A;  1NJZ A;  2FLL A;  9ICI A;  4DLG A;  1R8B A;  5L1I A;  3PVX A;  2BKE A;  4C8O A;  3H8W A;  4RQ6 A;  3PW5 A;  1X9W A;  1DOQ A;  2BQ3 A;  1NK8 A;  4X4P A;  4DSF A;  1DK2 A;  4RT2 A;  4YD2 A;  1BNP A;  4J9M A;  2ZH8 A;  2PXI A;  1L3S A;  4KLI A;  2HVH A;  3H8S A;  4UB3 A;  4QW9 A;  3N4M B;  4QZC A;  2I9G A;  4GXJ A;  5J2J A;  5J2C A;  2ATL A;  1XSL A;  4PGQ A;  1NKC A;  3EW9 A;  2MUT A;  5IIL A;  4B9N A;  3EYZ A;  1NK6 A;  2ZH1 A;  8ICB A;  5J2B A;  4YCX A;  2DR7 A;  4RPY A;  1S0M A;  4M6W B;  3HP6 A;  4KN7 A;  4R8U B;  8ICW A;  1SL0 A;  4O5E A;  8ICM A;  2FMQ A;  2BDP A;  4R65 A;  3MDA A;  4XA5 A;  4JV1 A;  1K1Q A;  1JMS A;  4M6W A;  5J2K A;  1UEU A;  2KZ3 A;  4NY8 A;  1D8L A;  4EBC A;  2AGP A;  5KFU A;  2ISO A;  4MF2 A;  2KZZ A;  4O3O A;  1JXL A;  3QEB Z;  2BCU A;  4Q44 A;  2P66 A;  2BPC A;  2PFP A;  5KFA A;  1NO5 A;  8ICQ A;  1MC8 A;  4YG2 A;  4KLL A;  2NRT A;  2V4R A;  3TQ1 A;  3B0X A;  2ALZ A;  1CEZ A;  1TFW A;  4I27 A;  5KFI A;  3T5K A;  4MEX A;  1XU4 A;  5J2G A;  5J2H A;  3Q8K A;  4IRD A;  4X4O A;  2ZH5 A;  4FHY A;  3C1Z A;  3ETL A;  4YQW A;  4NLG A;  5KG5 A;  2ZTC A;  4ED8 A;  1DK3 A;  4KTQ A;  3NYB A;  5IIJ A;  7ICH A;  3OHA A;  3ISB A;  5KFG A;  1XC9 A;  3MFH A;  4TUR A;  4NKU A;  1ZQG A;  4E8F A;  8ICS A;  5KFV A;  5DQH A;  3BJY A;  7ICK A;  3H3A A;  4E7X A;  3M9M B;  2W9C B;  4EZ9 A;  3AQK A;  1NOM A;  1ZQY A;  5KG3 A;  5DG8 A;  3Q8S B;  3JPQ A;  5L1L A;  3PW2 A;  4ECX A;  2ASJ A;  1JIH A;  5EOZ A;  4TUP A;  2JEF A;  4FBT A;  2AGO A;  3QEA Z;  2IMW P;  1DGS A;  1U48 A;  8ICP A;  1ZYQ A;  4WC2 A;  1COO A;  2Q66 A;  4M9L A;  4UBC A;  2XCA A;  4JUZ A;  4BXO A;  4LVS A;  9ICW A;  4DS4 A;  3ORY A;  3MFI A;  5J0Y A;  3ZDD A;  4RQ5 A;  4O3Q A;  3MBY A;  3PR4 A;  5DGB A;  4M47 A;  4Q43 A;  4FH3 A;  1BPD A;  4ECR A;  4DL7 A;  1Z00 A;  2IA6 A;  4P2H A;  3PW7 A;  5KT6 A;  4I2E A;  4J9S A;  3JYY A;  4WBY A;  4FH5 A;  4WC3 A;  4Q8E A;  4EBD A;  3UPQ A;  4DOA A;  2M2U A;  4DSJ A;  4PH5 A;  7ICU A;  1SZP A;  3PW4 A;  2BCV A;  4XQ8 A;  1NK0 A;  3C5G A;  5KG7 A;  2C28 A;  5KFC A;  4UB5 A;  3PX6 A;  1ZQZ A;  4XRH A;  4YR3 A;  3SI8 A;  2VA2 A;  5J0O A;  7ICM A;  5J2E A;  4JWN A;  4AT9 A;  1SKR A;  4RQ8 A;  1WCL A;  4DSL A;  2ZJ8 A;  1X2I A;  2UVW A;  1K1S A;  4Z6F A;  3OVA A;  4KN4 A;  3Q8P B;  3C66 A;  3PNC A;  3GIL A;  1YLQ A;  2ZJ5 A;  5HRL A;  4BXO B;  1T3N A;  4P4O A;  4UAZ A;  4DQS A;  1SL2 A;  3TFS A;  4DWI A;  4DL6 A;  3PY8 A;  1SKS A;  2F1H A;  4ECZ A;  1ZQS A;  3RJH A;  1R8A A;  4RQ3 A;  3RJG A;  4F92 B;  2NRZ A;  3OSN A;  2W9B B;  3JPT A;  1S10 A;  1RYR A;  4DF4 A;  2JEG A;  3H39 A;  3HJ1 A;  3G6Y A;  1LV5 A;  2BQU A;  1ZJN A;  3Q8M A;  4KLS A;  4MFC A;  1NJX A;  2O1P A;  9ICS A;  5IIK A;  5KFP A;  4C8N A;  4YN4 A;  1ZQC A;  2B21 A;  3WFR E;  1JX4 A;  5DB7 A;  3QZ7 A;  4DLE A;  2HHP A;  3RH5 A;  3C23 A;  5HHI A;  5C5J A;  4RZR A;  4QZ8 A;  2ZUC A;  4DQQ A;  1BPE A;  2C2R A;  4DEZ A;  5J0Q A;  3MDC A;  4B9M A;  4KLH A;  4ELT A;  5L9X A;  2DRA A;  4FHW A;  1EXN A;  2DRB A;  4RQ4 A;  2ZHA A;  2A1J B;  5BOL A;  2MAX A;  5J0P A;  3GFK B;  3RB3 A;  1RXV A;  1D9F A;  2ZHB A;  4KLE A;  1R89 A;  4DSI A;  4M9J A;  4UAY A;  5KT4 A;  4R66 A;  4J9L A;  4GC7 A;  8ICT A;  5KG6 A;  2W9B A;  9ICQ A;  4WC5 A;  4X4Q A;  5J0U A;  4I2D A;  4RNM A;  3PMN A;  4EZ6 A;  2ZH3 A;  3C18 A;  1NK7 A;  2Y1I A;  3RAQ A;  2ASD A;  3V7K A;  4K4I A;  1V4A A;  4UD4 A;  7ICG A;  1ZQF A;  2NRX A;  4DFK A;  2FLN A; 
#chains in the Genus database with same CATH topology
 2FCL A;  7ICR A;  3G6V A;  3MR6 A;  1TK0 A;  2K8C B;  2XY5 A;  3KKA A;  1YT3 A;  3UQ0 A;  5ALG A;  1OW5 A;  3H4B A;  2KZM A;  4MEY A;  4OJO A;  2YMM A;  5AI9 A;  1OU5 A;  2ZIV A;  4DS5 A;  4FHV A;  4EYH B;  4Y2Y A;  5D61 A;  4FZN A;  4O69 A;  2QLT A;  2R18 A;  7ICO A;  2JH1 A;  2HHS A;  4RQ7 A;  1D8B A;  4I2B A;  5BPC A;  4WC7 A;  5AIA A;  5EE1 A;  3CRX A;  3NTU A;  2J6S A;  4Y2S A;  3Q8L A;  3AMZ A;  2HOQ A;  2JEJ A;  3RB4 A;  3Q8R B;  1BVS A;  2BCQ A;  2JEI A;  3I28 A;  4EEY A;  2DL0 A;  4O68 A;  2JHD A;  2KN7 A;  1S0O A;  3MR2 A;  1L7N A;  3GV5 B;  2DFL A;  3OVB A;  3ZDB A;  4JWM A;  3WFS C;  1HJP A;  3ETR A;  1Z3E B;  3SEN A;  3PX4 A;  5L1J A;  1O08 A;  4I2H A;  5CA7 A;  5ALO A;  4ED7 A;  2J6U A;  2R8K A;  1UT5 A;  3UMG A;  1ARO P;  9ICO A;  3GZF A;  5T14 A;  5KG2 A;  2HHW A;  2GA9 D;  5CR0 A;  1PVR A;  3WFP A;  1DXS A;  3SAH A;  4KLF A;  4X4T A;  4K4G A;  3BS7 A;  3NGD A;  4JK1 A;  1U4B A;  1TK5 A;  1TAU A;  1KFT A;  4X5V A;  2NO5 A;  3JZ0 A;  3JPN A;  4RNN A;  4LEW A;  9ICU A;  2PFN A;  2LYA A;  4J9O A;  3SV3 A;  4Y2X A;  1A0P A;  4AP9 A;  1KTQ A;  2BGW A;  3M8S A;  4J9P A;  2VJ5 A;  8ICF A;  4QWD A;  4KMO B;  4EV6 A;  4WCW A;  4UBB A;  4X4S A;  1ZQT A;  4Z6C A;  4YXM A;  3LQC B;  4EYI B;  4YR0 A;  3FYH A;  2JZB B;  5DDM A;  2FPK A;  3OGU A;  1JN3 A;  3L5K A;  2MSN A;  2ZH2 A;  1JUD A;  2H5X A;  5CJ7 A;  4KLD A;  2OWO A;  4QWC A;  2KJ9 A;  1ZQB A;  2AGQ A;  1DGJ A;  3KOO A;  4LZD A;  1XO1 A;  4RQ2 A;  5IIO A;  3RJK A;  3QYP A;  4QWB A;  5EWE A;  3V6K A;  5KFN A;  4F4Y A;  2BCS A;  9ICX A;  3C2M A;  4KIT B;  8ICJ A;  3UPS A;  5DBA A;  3WFO A;  1ZQD A;  4WC1 A;  3M1Y A;  4GLX A;  4OJL A;  4RQN A;  3C2L A;  4O5C A;  7ICV A;  1QSL A;  5ALU A;  5ALW A;  4PHE A;  2KKV A;  1ZRM A;  3GIK A;  2ZXI A;  1KBU A;  3G6X A;  4QZE A;  3HJE A;  3WK8 A;  2W9M A;  4RWO A;  3QE9 Y;  4QWA A;  3LK9 A;  3RR7 A;  3AM9 A;  1RG6 A;  3CP8 A;  2ZIV B;  3BDP A;  5JUM A;  1BPB A;  4YVZ A;  2F76 X;  5CB1 A;  3JPR A;  3HKZ F;  3HKZ C;  2BPF A;  7ICS A;  1QSS A;  2GO7 A;  3ER9 B;  2HOF A;  4ZOH C;  4RT3 A;  2BCR A;  5CWR A;  1V97 A;  2ISP A;  4RPX A;  1RPL A;  4ICA A;  5CEH A;  1TV9 A;  5HR9 A;  4ECY A;  1Q3V A;  1Z1B A;  4F93 B;  1S0V A;  2ZH9 A;  1JQR A;  3MGI A;  2QB0 B;  7ICJ A;  3HWT A;  2C2E A;  4M9N A;  2P6U A;  3GV7 B;  1KSP A;  7ICN A;  2M2W A;  2VIX A;  1RYS A;  1C7Y A;  4FFD A;  5DLF A;  1NJY A;  8ICR A;  4PHD A;  4B9T A;  3D2Q A;  4F4Z A;  3PO5 A;  2C2D A;  3IM1 A;  2VA8 A;  4X0A A;  5KT5 A;  3RTV A;  2BBJ A;  2WHE A;  5DED A;  4I28 A;  2IOH A;  1PUZ A;  4F50 A;  5J0W A;  4R64 A;  4UQG A;  9ICH A;  3FM9 A;  4KLT A;  4DOB A;  2FMP A;  1WOT A;  5ALM A;  2P6R A;  2ZJA A;  3PSP A;  5B3P A;  5DEC A;  2W7O A;  1X6J A;  5KFM A;  2DPI A;  2XCP A;  1RDF A;  1RM6 C;  4N7R A;  5CFU A;  2NYV A;  4ZH4 A;  1JRO A;  3V72 A;  5CRX A;  9ICL A;  3NWI A;  4X0B A;  2YN4 A;  2PI4 A;  5AI0 A;  5AKZ A;  3FDS A;  4HAI A;  4RQM A;  1T4G A;  3VC8 A;  2ZUB A;  5HNK A;  2D8C A;  3JPS A;  3HRD D;  1NJZ A;  3KD3 A;  4DLG A;  2W04 A;  1DOQ A;  2BQ3 A;  4JLZ A;  2H3Z A;  3IV6 A;  4DSF A;  4RT2 A;  1Z4N A;  1B4F A;  5ALZ A;  1SV0 A;  2HVH A;  4UB3 A;  2PKE A;  4GXJ A;  5GTI U;  2EDU A;  4BUG A;  3TKA A;  2DR7 A;  1S0M A;  4KN7 A;  1SL0 A;  4KX5 A;  3RF9 A;  3SAF A;  3MDA A;  4XA5 A;  4UAT A;  5J2K A;  2AGP A;  2DF4 B;  2E3T A;  3QEB Z;  1JXL A;  2BPC A;  5KFA A;  2ZG6 A;  8ICQ A;  2NRT A;  2PMZ C;  2V4R A;  1TFW A;  5KFI A;  3N7S C;  1XU4 A;  5J2G A;  2ZIX B;  4JLX A;  4NLG A;  5KG5 A;  5ALT A;  4ED8 A;  3NYB A;  5JTI A;  7ICH A;  3OPX A;  3ED5 A;  4CF5 A;  1OXJ A;  8ICS A;  4E7X A;  5DQH A;  3M9M B;  2XI9 A;  1Q3U A;  3Q8S B;  5KG3 A;  3O0F A;  5ALY A;  5EOZ A;  2AGO A;  1DGS A;  4PZN A;  5AKL A;  2Q66 A;  1UHU A;  1VLB A;  4M9L A;  4BXO A;  5J0Y A;  2IHO A;  4RQ5 A;  4Y2U A;  3PST A;  4M47 A;  2YB1 A;  1BPD A;  4P0Q A;  5JU5 A;  1Z00 A;  1SV0 C;  4P2H A;  2HSZ A;  1N5X A;  2CN1 A;  1UCV A;  2M2U A;  4DSJ A;  1SZP A;  3E58 A;  2BCV A;  4XQ8 A;  1NK0 A;  5KG7 A;  3PX6 A;  5KFC A;  7ICQ A;  4XRH A;  5J2E A;  4JWN A;  5HR7 A;  4AT9 A;  1GPJ A;  4Z6F A;  3OVA A;  2E5S A;  3PNC A;  5HRL A;  4P4O A;  2LM1 A;  1SL2 A;  4DWI A;  1SKS A;  2F1H A;  1JRP A;  5AM3 A;  1ZQS A;  1M6Y A;  5AM1 A;  1R8A A;  3OSN A;  3JPT A;  2WB1 F;  3H39 A;  2KVC A;  1ZJN A;  2DGZ A;  4KLS A;  4MFC A;  1NJX A;  3F53 A;  5KFP A;  1ZQC A;  3QUQ A;  2D3D A;  2AHO B;  4KB6 A;  3RH5 A;  3C23 A;  1HEK A;  4DQQ A;  1BPE A;  4KLH A;  4B9M A;  4ELT A;  5H2F U;  4FHW A;  3RB3 A;  5AKH A;  1SXE A;  3N7R C;  5AM5 A;  4R66 A;  4GC7 A;  4OAF A;  2W43 A;  3BS5 B;  2EAM A;  3C18 A;  2ASD A;  2KE7 A;  3BQ7 A;  3V7K A;  1AQ6 A;  2W11 A;  1ZQF A;  3Q8K A;  1X42 A;  1ZQX A;  1V38 A;  4WC0 A;  2RFF A;  8ICK A;  1ZQV A;  4X4V A;  4ECT A;  8ICI A;  2HHV A;  3QUT A;  4G9B A;  4ED2 A;  3SMV A;  2W7P A;  4US9 A;  4FS1 A;  3EUB 2;  4P4M A;  5D63 A;  1WYG A;  3PW0 A;  3GU3 A;  1TKD A;  1QSY A;  4DL2 A;  4I2C A;  2R8J A;  2UVU A;  1IG6 A;  1UA0 A;  3AQN A;  4AT8 B;  4NWI A;  1TFR A;  1L3T A;  2NRV A;  1LVH A;  9ICG A;  5ALD A;  5KTQ A;  2KP7 A;  1ZRN A;  4IQU A;  4DQR A;  2V9W A;  1LKY B;  2W55 A;  2HW3 A;  4ECU A;  1ZQR A;  2GLE A;  3IG8 A;  4NL9 A;  4JV0 A;  3IDW A;  2P35 A;  1XS9 D;  1Z00 B;  1COK A;  1QLN A;  3NS1 A;  1A77 A;  1UQV A;  2WAQ F;  1NK5 A;  1NK4 A;  2XID A;  1BGX T;  5KFH A;  3V7J A;  2GOL A;  4LZG A;  1BPY A;  2QAR A;  4F91 B;  4EGW A;  1ZQH A;  2LPE A;  4OJP A;  4ATB A;  4OJ5 A;  2HBK A;  5E79 U;  2NRW A;  4BWM A;  5B3Q A;  3BZC A;  4NJ8 A;  5CHG A;  4WOY A;  3S6J A;  3RJE A;  4NV0 A;  3T5J A;  8ICH A;  2W9C A;  3UXP A;  1X9M A;  4K4H A;  2W3R A;  3IHQ B;  5B5E U;  5KFO A;  4NLZ A;  4LEZ A;  1X40 A;  3RAX A;  2VA3 A;  1XWL A;  3M9O B;  5HML A;  2IUB A;  4XQ7 A;  2OXO A;  4M04 A;  1SWW A;  5AK5 A;  1PX5 A;  5HR6 A;  2CXY A;  1KRP A;  3OV7 A;  2LI6 A;  5KAI U;  3K75 D;  8ICL A;  1RYU A;  5KFJ A;  3T79 A;  2FI1 A;  8ICV A;  4XUS A;  5KFS A;  8ICE A;  2JH7 A;  5F9N A;  3TI0 A;  3JPO A;  4FBU A;  5CFS A;  5KFR A;  1NKB A;  4DFD A;  2HCF A;  2Y1J A;  1JAJ A;  2GH1 A;  4I2I A;  3BZK A;  5KFX A;  3ALR A;  8ICG A;  5AIB A;  2F8L A;  1LB2 B;  1JXE A;  5KFZ A;  3H0M B;  3PV8 A;  2ZTE A;  4F2S A;  2KJ5 A;  1S77 D;  3ER8 C;  5KFT A;  2W8L A;  1ZOL A;  3NRZ A;  2AH5 A;  3T3F A;  4DQP A;  2ASL A;  4EEB A;  4KLG A;  8ICY A;  1FFV A;  2FPM A;  3WK5 A;  3UXO A;  8ICC A;  4XJE A;  3RR8 A;  5KAF U;  4G3I A;  4DO9 A;  3H0L B;  4B9U A;  2K4I A;  1ZQI A;  4F3O A;  1LKY A;  4Z6E A;  4RQ1 A;  5IIN A;  5JTG A;  4M9G A;  4U6P A;  5KNI A;  4O3M A;  4KX3 A;  3M8R A;  4O3R A;  3EWA A;  4WC6 A;  1TAQ A;  2EAP A;  1D8Y A;  4C8K A;  2ZUD A;  2M9N A;  3TFR A;  1Q79 A;  3AUO A;  3THV A;  1H38 A;  1B0X A;  3GV8 B;  3F2D A;  4QJF B;  4ED6 A;  1S9F A;  3J81 j;  2MRL A;  3AU6 A;  1IIP A;  3QU5 A;  4U7C A;  2C22 A;  4M9H A;  5AKX A;  5ALH A;  2HN2 A;  2OCE A;  1Q46 A;  4NM2 A;  3SV4 A;  2LM4 A;  3HIY A;  2O6K A;  5KFB A;  4TUQ A;  2HHT A;  2G0A A;  3UQ2 A;  4AT9 B;  3EPG A;  3KKA C;  5ALK A;  3KHH A;  1XO0 A;  3NVV A;  4LEV A;  1ZQE A;  2MA1 A;  3N97 B;  1UEV A;  3V7L A;  4USA A;  2ZIW B;  4Y2V A;  3OJS A;  2JV3 A;  5KL1 B;  2CRX A;  2I5H A;  4J9K A;  2KKP A;  5DBB A;  4QZI A;  2BQR A;  7ICF A;  3SD7 A;  2KEY A;  4I2G A;  1SGG A;  2VAN A;  1ZQU A;  3RFA A;  4FE3 A;  2HMX A;  2HN1 A;  4KLO A;  4IG8 A;  4F8R A;  2B4V A;  5DQG A;  5KFQ A;  4YD1 A;  3F2B A;  3H7I A;  3GII A;  2WTF A;  1NJW A;  4C80 A;  5J2D A;  1T7P A;  4IR9 A;  3QXG A;  3H37 A;  5III A;  1NK9 A;  4IRK A;  4E0D A;  1TFY A;  4F5R A;  4IL6 U;  5AI6 A;  5KFE A;  1V9P A;  5EE0 A;  1CRX A;  4X4U A;  1T8E A;  4WH5 A;  3H4D A;  3PHZ A;  5HMM A;  3UXN A;  4J9R A;  4JV2 A;  2DR9 A;  2KSO B;  5J2I A;  5AKI A;  4BX9 C;  2MUT B;  5IIM A;  4ECQ A;  3TAP A;  9ICI A;  4CF3 A;  4C8O A;  4RQ6 A;  1X9W A;  1DRG A;  1X66 A;  1ZD4 A;  1L3S A;  4KLI A;  4QZC A;  2I9G A;  2ATL A;  5J2C A;  1XSL A;  4OAI Z;  2KG5 A;  3NVO A;  2LHT A;  3F5E A;  3KBB A;  3HP6 A;  3QU7 A;  4K9B A;  2KSO A;  2KZ3 A;  1D8L A;  4EBC A;  2ISO A;  4O3O A;  2BCU A;  3M6Z A;  1F5S A;  4YG2 A;  3TQ1 A;  1CEZ A;  4IRD A;  5J2H A;  2ZH5 A;  4FHY A;  3AQE A;  3ETL A;  1DK3 A;  4KTQ A;  5IIJ A;  4E8F A;  5KFV A;  7ICK A;  3H3A A;  4NL9 C;  2M0N A;  4EX7 A;  1NOM A;  3AQK A;  3PW2 A;  4ECX A;  1U48 A;  1ZYQ A;  9ICW A;  4JUZ A;  2K4E A;  4LVS A;  3ORY A;  3MFI A;  3PZP A;  3MBY A;  3F5A A;  5DGB A;  4Q43 A;  2K89 A;  4DL7 A;  2WF8 A;  2JXJ A;  5D62 A;  4FH5 A;  4Q8E A;  3UPQ A;  4DOA A;  3DEE A;  4GIB A;  3K1R B;  4UB5 A;  1WWU A;  7ICM A;  5GTH U;  4OCZ A;  9ICQ A;  1SKR A;  1K1S A;  3Q8P B;  3BS5 A;  1YLQ A;  4UAZ A;  4ECZ A;  2W9B B;  2JEG A;  3QX7 A;  4WQK A;  2EZY A;  3Q8M A;  4UAS A;  9ICS A;  5IIK A;  4C8N A;  2B21 A;  1JX4 A;  3AN1 A;  5DB7 A;  4DLE A;  1HIW A;  4RZR A;  4MKP A;  2ZUC A;  1X9X A;  2C2R A;  2DRA A;  2WF5 A;  2ZHA A;  1KKX A;  2A1J B;  4UB8 U;  5J0P A;  1D9F A;  1RXV A;  4KLE A;  1MA7 A;  4DSI A;  4J9L A;  2W3S A;  5JRT A;  3UMB A;  3PMN A;  3KZX A;  2NRX A;  2DKZ A;  3WK9 A;  4DFK A;  2A19 A;  2WF6 A;  3IG5 A;  4I2A A;  2KFN A;  2W8K A;  1C20 A;  4YR2 A;  1ZQO A;  3LDA A;  4RWN A;  1QH9 A;  2DBY A;  2OH2 A;  2GAF D;  3RRH A;  5F9L A;  3B9J A;  2XO7 A;  1U47 A;  4J9N A;  3U26 A;  2B56 A;  2Z7J A;  1TK8 A;  2R8H A;  3RRG A;  5KG0 A;  3OHB A;  3HT3 A;  2KOB A;  5KFW A;  1N60 A;  1FEZ A;  4QZH A;  3H40 A;  4PHP A;  2DKX A;  1QQ7 A;  5C0Y A;  3SQI A;  4YMM A;  4B9L A;  4BGD A;  5K4L A;  1N48 A;  5BOM A;  3QNM A;  3RJJ A;  4P4P A;  4EED A;  3RBD A;  3I1Y A;  4GXI A;  4QZF A;  1N62 A;  4E80 A;  3IRU A;  2XGQ A;  1ZQW A;  9ICA A;  1MIV A;  5FP0 A;  3PX0 A;  1L7P A;  4Y2Q A;  3K4G A;  2R8G A;  3RB0 A;  4BJQ A;  3D2N A;  1JI7 A;  5J29 A;  5AK4 A;  2KFZ A;  3K7D A;  3PSF A;  1FO4 A;  4O0I A;  1KQQ A;  5A0L A;  1UET A;  4FS2 A;  1NZB A;  5AI4 A;  3T5H A;  4KLQ A;  1SKW A;  4DSE A;  2JMG A;  4Y2R A;  2AQ4 A;  3EZ5 A;  5DDY A;  5EWF A;  2NO4 A;  4EX6 A;  5KFL A;  4FO6 A;  2H3Q A;  1ZQA A;  4QW8 A;  2OM6 A;  2E8P A;  1FFU A;  1NI3 A;  3PO4 A;  2G09 A;  5DQI A;  2JGA A;  4NLN A;  4OAG A;  4C4T A;  2ZH6 A;  3FAH A;  3SR6 A;  5HRI A;  3KTQ A;  3OUY A;  2KMD A;  4YP3 A;  3QUB A;  3LVV A;  5HRB A;  3LVW A;  4O3S A;  4IRC A;  4TQR A;  3L9D A;  1MIW A;  2KHQ A;  2KNJ A;  4ED1 A;  3KFU F;  3RJI A;  4TUS A;  5J8Y A;  4OAH A;  3MC1 A;  4QWE A;  1S97 A;  4JB3 A;  4UB4 A;  3NRW A;  4ECS A;  9ICB A;  1ZXI A;  4AT7 B;  1KDH A;  4R63 A;  2DR5 A;  1SB3 C;  5KG1 A;  1KW4 A;  2Y9U A;  2H3F A;  4O3P A;  4S3N A;  2E1E A;  2DR8 A;  4O6A A;  5KFY A;  4EP7 A;  2HHU A;  3CYM A;  1PK3 A;  1B43 A;  3KHG A;  2FE9 A;  1RXW A;  9ICN A;  5L1M A;  3N7P D;  7ICP A;  4QZ9 A;  1B22 A;  5KFK A;  2HHQ A;  2OEH A;  3OUY B;  1WCN A;  1SL1 A;  2YY6 A;  3TAC B;  3AQF A;  1A6S A;  4NXT A;  2W03 A;  3ZDE A;  4WC4 A;  2AJQ A;  2KTQ A;  2AXT U;  4F5N A;  2F2A B;  5AKE A;  4OJ6 A;  4RPZ A;  5AKG A;  2HHX A;  1FA0 A;  5AK3 A;  4KLU A;  9ICF A;  9ICE A;  1Z1V A;  5ALX A;  5EE9 A;  4PGX A;  4F72 A;  1MIY A;  3DV9 A;  1QTM A;  1FIQ A;  3MGH A;  4RUA A;  3V6H A;  2ESE A;  9ICM A;  1N61 A;  3NAS A;  1Y88 A;  5ALR A;  4QIW F;  2HBM A;  2OHF A;  2GWS A;  3HIL A;  4DQI A;  4PL2 A;  1CUK A;  1ZQK A;  1RQL A;  1L5U A;  1HUO A;  5L1K A;  1R8C A;  2YMP A;  4A8E A;  2JZB A;  2WF9 A;  5KT7 A;  5J8Y C;  2EH9 A;  4ED0 A;  9ICV A;  5DG7 A;  3TAD C;  3L4P A;  1PK1 A;  2HVI A;  1UA1 A;  3C21 A;  4ACO A;  3ONN A;  4O3N A;  4Q8F A;  9ICC A;  4M5D A;  1PZN A;  2UVR A;  2IHM A;  5HRF A;  3WKB A;  4LT6 A;  2HDO A;  2BPG A;  5DB8 A;  4UAW A;  2KIW A;  4TQS A;  3EPI A;  5HHH A;  4GC6 A;  1HUZ A;  5HRE A;  3JCF A;  5HRD A;  1O03 A;  2KD1 A;  2PFQ A;  1YZ6 A;  3HX0 A;  4K98 A;  2DVI A;  1SXD A;  2WFA A;  4KLJ A;  3ISC A;  2Q0Z X;  4AT7 A;  3PR5 B;  3GQC A;  2NV3 A;  1P7D A;  5J2F A;  5D4B A;  8ICO A;  4EBE A;  5DLG A;  4QZB A;  7ICT A;  2M2V A;  3N28 A;  2NRK A;  5AKY A;  3NVY A;  2PBE A;  3ZDC A;  4Y2J A;  3MR5 A;  4IS7 A;  4X4R A;  2FJ6 A;  2YMQ A;  4F4W A;  1PVQ A;  1F5A A;  3TAQ A;  9ICR A;  2UVV A;  4YFK A;  3A0H U;  1KN5 A;  3LWM A;  2K8A A;  5J2A A;  1L8O A;  4IQV A;  3ZD8 A;  2ZXH A;  3MGV A;  4QZG A;  1ZET A;  1K5O A;  3SYZ A;  1NNL A;  5L1I A;  2BKE A;  2FDR A;  2IOF A;  1NK8 A;  4X4P A;  1DK2 A;  2WAQ C;  4YD2 A;  1BNP A;  4J9M A;  2ZH8 A;  5AI5 A;  5ALS A;  4CDG A;  3H8S A;  3ERC C;  2ZIW A;  2EAN A;  4PGQ A;  2E8M A;  4NLB A;  5IIL A;  4B9N A;  8ICB A;  2MU2 A;  4YCX A;  4RPY A;  3NKU A;  2DWQ A;  4M6W B;  8ICW A;  8ICM A;  2FMQ A;  2YTU A;  3D2S A;  3K1Z A;  4JV1 A;  4M6W A;  4NY8 A;  4MF2 A;  2KZZ A;  5AK6 A;  4Q44 A;  2PFP A;  4P0P B;  1NO5 A;  4B6J A;  3NVW A;  2QB1 A;  4KLL A;  3WK4 A;  4I27 A;  3T5K A;  4MEX A;  4EEK A;  2KIC A;  3C1Z A;  3AL0 B;  2ZTC A;  2RRD A;  4Y2T A;  3OHA A;  3ISB A;  1XC9 A;  3MFH A;  4TUR A;  1ZQG A;  3BJY A;  4UB6 U;  2EZZ A;  4LJX A;  4EZ9 A;  1L7M A;  2JEF A;  5L1L A;  4FBT A;  4TUP A;  2YML A;  4EEN A;  2IMW P;  3QEA Z;  2RHF A;  4FO1 A;  2K4H A;  1COO A;  4WC2 A;  1CI4 A;  5ALJ A;  4DS4 A;  3ZDD A;  4O3Q A;  4WJ3 B;  5KT6 A;  1L7O A;  4J9S A;  3JYY A;  3QU2 A;  4K97 A;  7ICU A;  3C29 A;  2G5H B;  3C5G A;  3CW2 C;  2C28 A;  4C7Z A;  5KL8 B;  5J0O A;  4RQ8 A;  2ZJ8 A;  1X2I A;  3SEI A;  2UVW A;  3GIL A;  1N2X A;  3WK6 A;  4BXO B;  2E8O A;  3H0R B;  1T3N A;  4DQS A;  3TFS A;  3ICX A;  4DCC A;  1PK1 B;  4FZM A;  4OO1 J;  3EF2 A;  3RJH A;  3RJG A;  2NRZ A;  3WKE A;  4DF4 A;  3HJ1 A;  2O1P A;  4YN4 A;  4OD0 A;  2ZIU A;  5HHI A;  1JAL A;  4QZ8 A;  4DEZ A;  5J0Q A;  3MDC A;  5L9X A;  2LMR A;  1EXN A;  2DRB A;  5BOL A;  2ZHB A;  2N1R A;  3NUQ A;  3PSI A;  4UAY A;  5KT4 A;  8ICT A;  4X4Q A;  2Y0S F;  4RNM A;  4EZ6 A;  2ZH3 A;  2DQN B;  5ALL A;  2KJ8 A;  1NK7 A;  3RAQ A;  2A3V A;  1QCK A;  2KK0 A;  4K4I A;  7ICG A;  5HP4 A;  2FLN A;  2R8I A;  4CCH A;  4O5K A;  4BWJ A;  4J03 A;  2HOI A;  1MQ3 A;  1UPH A;  9ICT A;  3VCB A;  4F5O A;  4F5P A;  4PPX A;  1ZQL A;  4B9V A;  4KMU A;  3Q8Q B;  9ICK A;  3H8J A;  5TIS U;  2WF7 A;  3BQT A;  2FMS A;  4ECW A;  3TAR A;  3V6J A;  5G5H A;  2W9A A;  4K99 A;  2B51 A;  2V4Q A;  2IHN A;  4F71 A;  4IC9 A;  2JRZ A;  1TVA A;  3I76 A;  4QNL A;  4JMU A;  4BDP A;  4M0A A;  4RU9 A;  2DUY A;  4QZD A;  2YQE A;  4ATB B;  4UAU A;  5J0X A;  1OUQ A;  5DGA A;  4AYB F;  4ELV A;  2KIV A;  4CE6 A;  4UB1 A;  3GDX A;  3QU9 A;  2G07 A;  5TZV A;  4WQL A;  1N56 A;  5AI8 A;  4DOC A;  1SIJ A;  1MN8 A;  4M2Y A;  1WWV A;  4EBK A;  3LWL A;  5D46 A;  4C8M A;  3C28 A;  4HYK A;  4ELU A;  2ZH4 A;  2BZF A;  2XGP A;  3PML A;  2IOF K;  4C4R A;  2LYH A;  2XC9 A;  1L3U A;  2G08 A;  4C4S A;  3BQ2 A;  5AKJ A;  3M6K A;  1NZP A;  1T94 A;  4DFP A;  2BBH A;  4I29 A;  3C5F A;  1TAM A;  4Z6D A;  3MAB A;  3BQ0 A;  5ALN A;  1ZQP A;  2ZIU B;  1IXR A;  3M9N B;  4NKT A;  3E0F A;  7ICE A;  2I6X A;  4UW9 A;  2AQ0 A;  3OSP A;  5AM2 A;  3M7D A;  2RDJ A;  1Z4O A;  3TAD A;  3ZDA A;  4C0Z A;  1ZQN A;  1S0N A;  5AHX A;  5DB6 A;  2WB1 C;  3WU2 U;  3UM9 A;  3OJU A;  1VJ7 A;  3ISD A;  1XSN A;  4EBJ A;  4MFA A;  2HBL A;  4KM5 A;  1U49 A;  3GIJ A;  4F4K A;  5B66 U;  1IM4 A;  3OVS A;  2K4P A;  1NKE A;  5AKK A;  4GXK A;  4I0U A;  3QZ8 A;  4ECV A;  5DKW A;  4MFF A;  2IBK A;  9ICJ A;  1F0M A;  3RB6 A;  2EZX A;  2HBJ A;  3MR3 A;  3BQ1 A;  1U45 A;  2O5A A;  4PHA A;  1URJ A;  1IV8 A;  5KT2 A;  4IQT A;  2F8K A;  1KFD A;  2QKQ A;  4RQ0 A;  4RUC A;  4F5Q A;  4F2R A;  1N5W A;  1S5L U;  4DFJ A;  5F2V O;  4C8L A;  7ICL A;  3KHR A;  3RJF A;  1BPX A;  1SZH A;  2AU0 A;  3WFQ E;  2PMZ F;  2F1J A;  4FHP A;  1X6I A;  3T5L A;  4O67 A;  3RH4 A;  2J6T A;  2ZTD A;  1ZD3 A;  2EWR A;  3RH6 A;  2A1A A;  5CP2 A;  3R9K A;  5CFT A;  4MF8 A;  3AU2 A;  1ZJM A;  4HX0 A;  5HRH A;  4IQW A;  1VDV A;  1U9L A;  4NXX A;  2VKQ A;  5ALQ A;  3WK7 A;  4FZL A;  3D6J A;  4I2F A;  4Q45 A;  3HPO A;  3IP4 B;  3ZD9 A;  4NLC A;  2FLP A;  2M2T A;  3ZI4 A;  4NM1 A;  5D49 A;  3RBE A;  2YB4 A;  4YXJ A;  4DL4 A;  5ALF A;  1ZQM A;  1RQN A;  4IR1 A;  2W54 A;  3MCR A;  4P0P A;  2BE3 A;  2CPR A;  5ALP A;  1PVP A;  5DG9 A;  4RWQ A;  4YMO A;  4P0Q B;  4WBZ A;  1N63 A;  4UAV A;  5ALE A;  1Q78 A;  1J2M A;  3OTQ A;  3SAG A;  2KHV A;  2XY7 A;  4YMN A;  2BR0 A;  1ZQJ A;  3OWG A;  4QZA A;  4DFM A;  1KLN A;  2A1J A;  4J9Q A;  3C1Y A;  3H38 A;  3WKA A;  1S76 D;  5J0T A;  4PGY A;  4RNO A;  5HRG A;  5ALI A;  2ZH7 A;  3HJ4 A;  2RP5 A;  3WKC A;  2I1Q A;  2F1I A;  4K8V A;  5AIC A;  4B9S A;  3SZ2 A;  5KFF A;  4DSK A;  5KFD A;  3TAN A;  2JR5 A;  1VJ5 A;  2RQ5 A;  8ICA A;  2H3V A;  3F2C A;  4Y2P A;  4O9M A;  1A76 A;  8ICN A;  1ZD5 A;  3DDH A;  4R8U A;  3AQL A;  1ZQQ A;  4I2J A;  1KEJ A;  3CK6 A;  3KHL A;  4K96 A;  4NXZ A;  3CNH A;  2RDI A;  4ED3 A;  3E2E A;  3HW8 A;  5HRK A;  1MSW D;  4NXU A;  1WG8 A;  2Y9T A;  2PI5 A;  4UB2 A;  4NXW A;  3AEV A;  3C2K A;  3KZI U;  2HI0 A;  4FHX A;  2VJ4 A;  5KG4 A;  4NLK A;  2Q4T A;  1MQ2 A;  1ED1 A;  4PJ0 U;  2BHN A;  3JPP A;  2ODG A;  1KL9 A;  3AQM A;  2EAO A;  4UD5 A;  4K9A A;  4KLM A;  3B0Y A;  5KT3 A;  2LBO A;  8ICZ A;  1ECW A;  5DBC A;  2XY6 A;  2EQY A;  1KFS A;  2ZIX A;  2LYB A;  1YZ7 A;  8ICX A;  1VFG A;  1RZT A;  1UT8 A;  5J0R A;  1L8L A;  4CF4 A;  4RWP A;  8ICU A;  2KV2 A;  5G5G A;  4US8 A;  2ID1 A;  1X9S A;  4EEL A;  1BPZ A;  5J0S A;  2E8N A;  4CRX A;  1L3V A;  5DB9 A;  5HC9 A;  2FPL A;  1D9D A;  4AT8 A;  1SV4 A;  2BDU A;  2PFO A;  7ICI A;  1BNO A;  3GIM A;  4DF8 A;  4DL3 A;  4DL5 A;  5EWG A;  1ZQ1 C;  1XSP A;  2DPJ A;  4X4N A;  4GFJ A;  4F4X A;  9ICP A;  3LYS A;  2L5Y A;  2FLL A;  1R8B A;  5F3X B;  3PVX A;  1Z19 A;  3H8W A;  1XNS A;  3PW5 A;  4CGZ A;  2PXI A;  4QW9 A;  3N4M B;  2ES6 A;  5J2J A;  3QUC A;  1NKC A;  3EW9 A;  2MUT A;  2OYY A;  3EYZ A;  2QAR B;  4PL1 A;  1NK6 A;  5J2B A;  2ZH1 A;  2K8B B;  3FC4 A;  4R8U B;  1V85 A;  4O5E A;  2BDP A;  4R65 A;  1J2N A;  1GO3 F;  1K1Q A;  1JMS A;  1UEU A;  3A0B U;  5KFU A;  3UMC A;  2B0C A;  2KVS A;  1J97 A;  1Q8K A;  2P66 A;  1MC8 A;  3L3F X;  1WUD A;  3B0X A;  2ALZ A;  4AYB C;  4X4O A;  4YQW A;  2E1F A;  5KFG A;  4NKU A;  2F77 X;  2W9C B;  2ASJ A;  1ZQY A;  5DG8 A;  3JPQ A;  1KNY A;  1JIH A;  8ICP A;  1ZD2 P;  1QQ5 A;  4UBC A;  2XCA A;  4MHV A;  5ALV A;  3PR4 A;  3QU4 A;  4FH3 A;  4ECR A;  2IA6 A;  3PW7 A;  4I2E A;  4WBY A;  4WC3 A;  2XIC A;  4EBD A;  2G06 A;  4PH5 A;  3PW4 A;  5EE3 A;  2VA2 A;  2LKY A;  1ZQZ A;  4YR3 A;  3SI8 A;  1TE2 A;  2YX8 A;  3IN5 A;  3WKD A;  1WCL A;  4DSL A;  4KN4 A;  1T3Q A;  3C66 A;  3H8M A;  2ZJ5 A;  4DL6 A;  3PY8 A;  1QQ6 A;  4RQ3 A;  4F92 B;  1S10 A;  3NVZ A;  1RYR A;  3G6Y A;  1LV5 A;  2BQU A;  4C7Y A;  4UAR A;  4LEY A;  1S8O A;  2H3I A;  4NXV A;  5AM4 A;  2F3N A;  2D6F C;  2XVT A;  2B6G A;  3WFR E;  2RLT A;  3QZ7 A;  2HHP A;  2F44 A;  2G5I B;  5C5J A;  2K60 A;  4PZO A;  4RQ4 A;  1F44 A;  2MAX A;  3GFK B;  1R89 A;  4M9J A;  4WC5 A;  5KG6 A;  2W9B A;  2QB0 A;  5J0U A;  4I2D A;  1SWV A;  2Y0S C;  4QIW C;  2Y1I A;  4CNQ A;  1V4A A;  5AM0 A;  4UD4 A;  5CHE A;  1L6N A; 
#chains in the Genus database with same CATH homology
 1ZQX A;  2R8I A;  4CCH A;  4I2A A;  2KFN A;  4O5K A;  2W8K A;  4WC0 A;  4BWJ A;  2RFF A;  4YR2 A;  1MQ3 A;  1ZQV A;  8ICK A;  9ICT A;  4X4V A;  7ICR A;  1ZQO A;  3LDA A;  4F5O A;  4RWN A;  3G6V A;  4ECT A;  8ICI A;  2HHV A;  4F5P A;  3RRH A;  5F9L A;  1ZQL A;  3MR6 A;  4KMU A;  3Q8Q B;  4ED2 A;  1TK0 A;  4B9V A;  4PPX A;  9ICK A;  2XY5 A;  3H8J A;  2XO7 A;  2FMS A;  3BQT A;  4FS1 A;  4P4M A;  3UQ0 A;  4ECW A;  3TAR A;  3H4B A;  4J9N A;  1U47 A;  2KZM A;  4MEY A;  3PW0 A;  3V6J A;  1TKD A;  2W9A A;  1QSY A;  2V4Q A;  2IHN A;  1TK8 A;  4DL2 A;  2R8H A;  3RRG A;  1OU5 A;  1TVA A;  4I2C A;  4DS5 A;  4FHV A;  5KG0 A;  3OHB A;  4EYH B;  3HT3 A;  4BDP A;  4M0A A;  4RU9 A;  2R8J A;  5KFW A;  4QZD A;  2UVU A;  7ICO A;  2HHS A;  1UA0 A;  4ATB B;  5J0X A;  4RQ7 A;  3AQN A;  4AT8 B;  5DGA A;  4QZH A;  3H40 A;  1TFR A;  4ELV A;  5HP4 A;  1L3T A;  5BPC A;  4I2B A;  4WC7 A;  2NRV A;  4PHP A;  4UB1 A;  3GDX A;  9ICG A;  5KTQ A;  5TZV A;  2KP7 A;  4YMM A;  4IQU A;  4DQR A;  3NTU A;  2J6S A;  2V9W A;  1N56 A;  4B9L A;  3Q8L A;  4DOC A;  4BGD A;  2HW3 A;  4ECU A;  1ZQR A;  1N48 A;  5BOM A;  3RB4 A;  2JEJ A;  4JV0 A;  4M2Y A;  4EBK A;  3Q8R B;  5D46 A;  3LWL A;  4C8M A;  1XS9 D;  1BVS A;  1Z00 B;  2BCQ A;  4HYK A;  2JEI A;  3RJJ A;  4ELU A;  1QLN A;  2ZH4 A;  1A77 A;  4EEY A;  4WC6 A;  4P4P A;  2KN7 A;  1S0O A;  3RBD A;  3MR2 A;  2XGP A;  3PML A;  1NK5 A;  3GV5 B;  2DFL A;  1NK4 A;  3ZDB A;  2LYH A;  1BGX T;  5KFH A;  2XC9 A;  3V7J A;  4GXI A;  1L3U A;  3OVB A;  4JWM A;  3WFS C;  1HJP A;  4QZF A;  4LZG A;  3BQ2 A;  1BPY A;  1Z3E B;  4F91 B;  1NZP A;  4E80 A;  4DFP A;  3PX4 A;  1ZQH A;  5L1J A;  2XGQ A;  4I29 A;  1ZQW A;  9ICA A;  1MIV A;  4I2H A;  5CA7 A;  4ATB A;  3C5F A;  3PX0 A;  4ED7 A;  4Z6D A;  2J6U A;  2R8K A;  2NRW A;  3K4G A;  1UT5 A;  3MAB A;  3BQ0 A;  1ZQP A;  4BWM A;  3RB0 A;  2R8G A;  1ARO P;  9ICO A;  1IXR A;  5J29 A;  3M9N B;  2KFZ A;  5KG2 A;  5CHG A;  2HHW A;  4NKT A;  3RJE A;  7ICE A;  3T5J A;  8ICH A;  2W9C A;  5CR0 A;  3UXP A;  2AQ0 A;  1X9M A;  3OSP A;  4K4H A;  3WFP A;  4O0I A;  4KLF A;  4X4T A;  3IHQ B;  1UET A;  4K4G A;  2RDJ A;  3ZDA A;  3NGD A;  4FS2 A;  4JK1 A;  5KFO A;  3T5H A;  1U4B A;  1TK5 A;  1S0N A;  1ZQN A;  4NLZ A;  4KLQ A;  4X5V A;  1SKW A;  1KFT A;  3RAX A;  2VA3 A;  5DB6 A;  3JZ0 A;  3OJU A;  3JPN A;  1XWL A;  3M9O B;  5HML A;  4DSE A;  2AQ4 A;  1VJ7 A;  4RNN A;  3ISD A;  4XQ7 A;  4M04 A;  3EZ5 A;  5DDY A;  5EWF A;  5KFL A;  1XSN A;  4EBJ A;  4MFA A;  4FO6 A;  1U49 A;  1ZQA A;  4QW8 A;  3GIJ A;  4F4K A;  2PFN A;  9ICU A;  1IM4 A;  1PX5 A;  4J9O A;  4X4S A;  1NKE A;  3OVS A;  3SV3 A;  1KRP A;  4GXK A;  2BGW A;  3OV7 A;  1KTQ A;  3QZ8 A;  3M8S A;  4J9P A;  4ECV A;  8ICF A;  2DR8 A;  4QWD A;  3PO4 A;  3K75 D;  5DQI A;  4UBB A;  8ICL A;  5DKW A;  4MFF A;  1ZQT A;  2IBK A;  4Z6C A;  4YXM A;  5KFJ A;  4EYI B;  9ICJ A;  3LQC B;  4YR0 A;  3RB6 A;  4NLN A;  3FYH A;  1TAU A;  1KNY A;  2JZB B;  5DDM A;  2FPK A;  3OGU A;  3MR3 A;  3BQ1 A;  4XUS A;  5KFS A;  1U45 A;  4PHA A;  8ICV A;  8ICE A;  2O5A A;  2ZH6 A;  5F9N A;  3JPO A;  1JN3 A;  5KT2 A;  4IQT A;  3TI0 A;  5HRI A;  2ZH2 A;  2H5X A;  4FBU A;  5CJ7 A;  3KTQ A;  4KLD A;  5KFR A;  2OWO A;  4QWC A;  3OUY A;  4YP3 A;  1ZQB A;  1NKB A;  1KFD A;  5HRB A;  4RQ0 A;  2AGQ A;  4RUC A;  4O3S A;  4F5Q A;  2Y1J A;  4F2R A;  4IRC A;  1JAJ A;  4TQR A;  4LZD A;  4DFJ A;  3L9D A;  4C8L A;  1XO1 A;  7ICL A;  3KHR A;  4RQ2 A;  1MIW A;  5F2V O;  5IIO A;  3RJK A;  3RJF A;  4I2I A;  4ED1 A;  1BPX A;  2AU0 A;  3RJI A;  5KFX A;  4TUS A;  4QWE A;  8ICG A;  4QWB A;  3WFQ E;  2F1J A;  1S97 A;  4FHP A;  4UB4 A;  4ECS A;  9ICB A;  4AT7 B;  3T5L A;  5EWE A;  3V6K A;  3RH4 A;  2J6T A;  2ZTD A;  1KDH A;  4R63 A;  1LB2 B;  1JXE A;  2DR5 A;  5KFZ A;  5KFN A;  4F4Y A;  3RH6 A;  2BCS A;  5KG1 A;  4O3P A;  5CP2 A;  4S3N A;  9ICX A;  4MF8 A;  3AU2 A;  3C2M A;  3PV8 A;  2ZTE A;  4KIT B;  1ZJM A;  4F2S A;  5HRH A;  5KFY A;  4EP7 A;  2HHU A;  8ICJ A;  4IQW A;  3UPS A;  1S77 D;  5KFT A;  3KHG A;  1B43 A;  5DBA A;  1RXW A;  9ICN A;  1U9L A;  2W8L A;  7ICP A;  3WFO A;  1ZQD A;  3T3F A;  4DQP A;  4QZ9 A;  4I2F A;  1B22 A;  4Q45 A;  2ASL A;  4WC1 A;  5KFK A;  3HPO A;  3ZD9 A;  4GLX A;  4KLG A;  8ICY A;  2FPM A;  2FLP A;  2HHQ A;  3UXO A;  8ICC A;  2M2T A;  3OUY B;  1WCN A;  3C2L A;  1SL1 A;  1QSL A;  4O5C A;  7ICV A;  3RR8 A;  4NM1 A;  4PHE A;  5D49 A;  3RBE A;  4G3I A;  4DO9 A;  4YXJ A;  4DL4 A;  1ZQM A;  3ZDE A;  4IR1 A;  4WC4 A;  4B9U A;  2AJQ A;  2KTQ A;  1ZQI A;  4F3O A;  4Z6E A;  3GIK A;  4RQ1 A;  4F5N A;  5IIN A;  3G6X A;  2BE3 A;  4QZE A;  4RPZ A;  2HHX A;  5DG9 A;  1FA0 A;  4YMO A;  4RWQ A;  4M9G A;  4KLU A;  4WBZ A;  2W9M A;  1Q78 A;  9ICF A;  3QE9 Y;  4RWO A;  9ICE A;  4PGX A;  4QWA A;  2XY7 A;  4YMN A;  2BR0 A;  1ZQJ A;  4DSK A;  3LK9 A;  3RR7 A;  1MIY A;  3M8R A;  1QTM A;  4O3R A;  3EWA A;  4QZA A;  3MGH A;  4DFM A;  1TAQ A;  1D8Y A;  1KLN A;  4C8K A;  2A1J A;  2ZUD A;  4RUA A;  3C1Y A;  4J9Q A;  3V6H A;  9ICM A;  3H38 A;  1S76 D;  5J0T A;  1Y88 A;  4PGY A;  2M9N A;  4RNO A;  5HRG A;  3TFR A;  3BDP A;  2ZH7 A;  5JUM A;  1BPB A;  3HJ4 A;  4YVZ A;  1Q79 A;  3JPR A;  2I1Q A;  5CB1 A;  3AUO A;  3THV A;  2F1I A;  4B9S A;  1H38 A;  2BPF A;  7ICS A;  3GV8 B;  1QSS A;  3SZ2 A;  2GWS A;  4DQI A;  4RT3 A;  5KFF A;  4ED6 A;  1S9F A;  5KFD A;  2BCR A;  5CWR A;  1CUK A;  3AU6 A;  3TAN A;  1ZQK A;  2C22 A;  4M9H A;  1L5U A;  1HUO A;  2ISP A;  5L1K A;  8ICA A;  1R8C A;  4RPX A;  4O9M A;  2JZB A;  1A76 A;  8ICN A;  1RPL A;  5KT7 A;  4NM2 A;  3SV4 A;  1TV9 A;  4ED0 A;  9ICV A;  3HIY A;  4R8U A;  3AQL A;  5HR9 A;  4ECY A;  4I2J A;  5KFB A;  4F93 B;  5DG7 A;  1ZQQ A;  4TUQ A;  1S0V A;  2HVI A;  2ZH9 A;  1KEJ A;  1UA1 A;  2HHT A;  3UQ2 A;  3MGI A;  3PO5 A;  1JQR A;  3KHL A;  4AT9 B;  3C21 A;  4NXZ A;  3EPG A;  2RDI A;  7ICJ A;  3HWT A;  4O3N A;  4ED3 A;  3E2E A;  3HW8 A;  4Q8F A;  9ICC A;  3KHH A;  5HRK A;  4M5D A;  1PZN A;  2C2E A;  2UVR A;  2IHM A;  4M9N A;  5HRF A;  1MSW D;  4LT6 A;  2P6U A;  3GV7 B;  2BPG A;  1KSP A;  5DB8 A;  4UAW A;  3N97 B;  1ZQE A;  3EPI A;  4TQS A;  1UEV A;  5HHH A;  7ICN A;  3V7L A;  4GC6 A;  1HUZ A;  2PI5 A;  4UB2 A;  2M2W A;  5HRE A;  5HRD A;  3OJS A;  1RYS A;  1C7Y A;  5DLF A;  3C2K A;  1NJY A;  2PFQ A;  8ICR A;  4PHD A;  3HX0 A;  4B9T A;  4FHX A;  2DVI A;  4J9K A;  4F4Z A;  4KLJ A;  3ISC A;  5KG4 A;  2Q0Z X;  5DBB A;  3IM1 A;  4QZI A;  2C2D A;  2BQR A;  2VA8 A;  3PR5 B;  1MQ2 A;  4NLK A;  2BHN A;  3GQC A;  7ICF A;  4AT7 A;  4X0A A;  3JPP A;  5KT5 A;  5J2F A;  5D4B A;  3RTV A;  8ICO A;  4I2G A;  5DED A;  3AQM A;  4UD5 A;  2VAN A;  1ZQU A;  4I28 A;  4EBE A;  4KLM A;  4F50 A;  7ICQ A;  5DLG A;  4QZB A;  3B0Y A;  5J0W A;  7ICT A;  4KLO A;  4R64 A;  4UQG A;  2M2V A;  4IG8 A;  5KT3 A;  9ICH A;  4F8R A;  8ICZ A;  5DQG A;  5KFQ A;  4DOB A;  4KLT A;  4YD1 A;  2NRK A;  2FMP A;  1WOT A;  3H7I A;  2P6R A;  2PBE A;  5DBC A;  2XY6 A;  2ZJA A;  3GII A;  3ZDC A;  2WTF A;  1KFS A;  1NJW A;  3MR5 A;  8ICX A;  5DEC A;  4X4R A;  1VFG A;  1RZT A;  1UT8 A;  5J0R A;  4WCW A;  4F4W A;  1F5A A;  4RWP A;  8ICU A;  5J2D A;  1T7P A;  4IR9 A;  5KFM A;  3H37 A;  2ID1 A;  5III A;  1NK9 A;  2DPI A;  1X9S A;  2XCP A;  4IRK A;  1BPZ A;  4E0D A;  3TAQ A;  5J0S A;  4F5R A;  1TFY A;  3V72 A;  4ZH4 A;  9ICR A;  5KFE A;  1L3V A;  1V9P A;  2UVV A;  4YFK A;  1T8E A;  4X4U A;  3H4D A;  5DB9 A;  5HC9 A;  2FPL A;  1D9D A;  4AT8 A;  9ICL A;  5HMM A;  3LWM A;  4X0B A;  3UXN A;  2PFO A;  5J2A A;  7ICI A;  1BNO A;  4J9R A;  2PI4 A;  4JV2 A;  2DR9 A;  3GIM A;  4IQV A;  4DF8 A;  4DL5 A;  4DL3 A;  5EWG A;  3FDS A;  5J2I A;  1XSP A;  2DPJ A;  3ZD8 A;  4X4N A;  2MUT B;  4QZG A;  5IIM A;  1ZET A;  3SYZ A;  4F4X A;  9ICP A;  1T4G A;  2ZUB A;  4ECQ A;  5HNK A;  3JPS A;  3TAP A;  1NJZ A;  2FLL A;  9ICI A;  4DLG A;  1R8B A;  5L1I A;  3PVX A;  2BKE A;  4C8O A;  3H8W A;  4RQ6 A;  3PW5 A;  1X9W A;  1DOQ A;  2BQ3 A;  1NK8 A;  4X4P A;  4DSF A;  1DK2 A;  4RT2 A;  4YD2 A;  1BNP A;  4J9M A;  2ZH8 A;  2PXI A;  1L3S A;  4KLI A;  2HVH A;  3H8S A;  4UB3 A;  4QW9 A;  3N4M B;  4QZC A;  2I9G A;  4GXJ A;  5J2J A;  5J2C A;  2ATL A;  1XSL A;  4PGQ A;  1NKC A;  3EW9 A;  2MUT A;  5IIL A;  4B9N A;  3EYZ A;  1NK6 A;  2ZH1 A;  8ICB A;  5J2B A;  4YCX A;  2DR7 A;  4RPY A;  1S0M A;  4M6W B;  3HP6 A;  4KN7 A;  4R8U B;  8ICW A;  1SL0 A;  4O5E A;  8ICM A;  2FMQ A;  2BDP A;  4R65 A;  3MDA A;  4XA5 A;  4JV1 A;  1K1Q A;  1JMS A;  4M6W A;  5J2K A;  1UEU A;  2KZ3 A;  4NY8 A;  1D8L A;  4EBC A;  2AGP A;  5KFU A;  2ISO A;  4MF2 A;  2KZZ A;  4O3O A;  1JXL A;  3QEB Z;  2BCU A;  4Q44 A;  2P66 A;  2BPC A;  2PFP A;  5KFA A;  1NO5 A;  8ICQ A;  1MC8 A;  4YG2 A;  4KLL A;  2NRT A;  2V4R A;  3TQ1 A;  3B0X A;  2ALZ A;  1CEZ A;  1TFW A;  4I27 A;  5KFI A;  3T5K A;  4MEX A;  1XU4 A;  5J2G A;  5J2H A;  3Q8K A;  4IRD A;  4X4O A;  2ZH5 A;  4FHY A;  3C1Z A;  3ETL A;  4YQW A;  4NLG A;  5KG5 A;  2ZTC A;  4ED8 A;  1DK3 A;  4KTQ A;  3NYB A;  5IIJ A;  7ICH A;  3OHA A;  3ISB A;  5KFG A;  1XC9 A;  3MFH A;  4TUR A;  4NKU A;  1ZQG A;  4E8F A;  8ICS A;  5KFV A;  5DQH A;  3BJY A;  7ICK A;  3H3A A;  4E7X A;  3M9M B;  2W9C B;  4EZ9 A;  3AQK A;  1NOM A;  1ZQY A;  5KG3 A;  5DG8 A;  3Q8S B;  3JPQ A;  5L1L A;  3PW2 A;  4ECX A;  2ASJ A;  1JIH A;  5EOZ A;  4TUP A;  2JEF A;  4FBT A;  2AGO A;  3QEA Z;  2IMW P;  1DGS A;  1U48 A;  8ICP A;  1ZYQ A;  4WC2 A;  1COO A;  2Q66 A;  4M9L A;  4UBC A;  2XCA A;  4JUZ A;  4BXO A;  4LVS A;  9ICW A;  4DS4 A;  3ORY A;  3MFI A;  5J0Y A;  3ZDD A;  4RQ5 A;  4O3Q A;  3MBY A;  3PR4 A;  5DGB A;  4M47 A;  4Q43 A;  4FH3 A;  1BPD A;  4ECR A;  4DL7 A;  1Z00 A;  2IA6 A;  4P2H A;  3PW7 A;  5KT6 A;  4I2E A;  4J9S A;  3JYY A;  4WBY A;  4FH5 A;  4WC3 A;  4Q8E A;  4EBD A;  3UPQ A;  4DOA A;  2M2U A;  4DSJ A;  4PH5 A;  7ICU A;  1SZP A;  3PW4 A;  2BCV A;  4XQ8 A;  1NK0 A;  3C5G A;  5KG7 A;  2C28 A;  5KFC A;  4UB5 A;  3PX6 A;  1ZQZ A;  4XRH A;  4YR3 A;  3SI8 A;  2VA2 A;  5J0O A;  7ICM A;  5J2E A;  4JWN A;  4AT9 A;  1SKR A;  4RQ8 A;  1WCL A;  4DSL A;  2ZJ8 A;  1X2I A;  2UVW A;  1K1S A;  4Z6F A;  3OVA A;  4KN4 A;  3Q8P B;  3C66 A;  3PNC A;  3GIL A;  1YLQ A;  2ZJ5 A;  5HRL A;  4BXO B;  1T3N A;  4P4O A;  4UAZ A;  4DQS A;  1SL2 A;  3TFS A;  4DWI A;  4DL6 A;  3PY8 A;  1SKS A;  2F1H A;  4ECZ A;  1ZQS A;  3RJH A;  1R8A A;  4RQ3 A;  3RJG A;  4F92 B;  2NRZ A;  3OSN A;  2W9B B;  3JPT A;  1S10 A;  1RYR A;  4DF4 A;  2JEG A;  3H39 A;  3HJ1 A;  3G6Y A;  1LV5 A;  2BQU A;  1ZJN A;  3Q8M A;  4KLS A;  4MFC A;  1NJX A;  2O1P A;  9ICS A;  5IIK A;  5KFP A;  4C8N A;  4YN4 A;  1ZQC A;  2B21 A;  3WFR E;  1JX4 A;  5DB7 A;  3QZ7 A;  4DLE A;  2HHP A;  3RH5 A;  3C23 A;  5HHI A;  5C5J A;  4RZR A;  4QZ8 A;  2ZUC A;  4DQQ A;  1BPE A;  2C2R A;  4DEZ A;  5J0Q A;  3MDC A;  4B9M A;  4KLH A;  4ELT A;  5L9X A;  2DRA A;  4FHW A;  1EXN A;  2DRB A;  4RQ4 A;  2ZHA A;  2A1J B;  5BOL A;  2MAX A;  5J0P A;  3GFK B;  3RB3 A;  1RXV A;  1D9F A;  2ZHB A;  4KLE A;  1R89 A;  4DSI A;  4M9J A;  4UAY A;  5KT4 A;  4R66 A;  4J9L A;  4GC7 A;  8ICT A;  5KG6 A;  2W9B A;  9ICQ A;  4WC5 A;  4X4Q A;  5J0U A;  4I2D A;  4RNM A;  3PMN A;  4EZ6 A;  2ZH3 A;  3C18 A;  1NK7 A;  2Y1I A;  3RAQ A;  2ASD A;  3V7K A;  4K4I A;  1V4A A;  4UD4 A;  7ICG A;  1ZQF A;  2NRX A;  4DFK A;  2FLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...