2P66A

Human dna polymerase beta complexed with tetrahydrofuran (abasic site) containing dna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the DNA Polymerase beta deoxyribose phosphate lyase mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
total genus 101
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2p66A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2p66A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2p66A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2p66A03
1VJ7A 4RPYA 1EXNA 3H7IA 3HT3A 4B9TA 3OVAA 4KMUA 4J9NA 1WCNA 1S0NA 5F9NA 1NK6A 4KLUA 9ICXA 3G6XA 4C8MA 4IQUA 4DL6A 1NOMA 7ICMA 4WC1A 2ZH9A 3EWAA 8ICEA 4WBYA 2XCPA 2Y1JA 2HHUA 2XGQA 3C2LA 4YD2A 1SZPA 3Q8LA 3PW5A 4QWDA 4I2FA 4ZH4A 2XGPA 3ISCA 4DFPA 3ZDBA 2AJQA 5L1LA 3TQ1A 3AQKA 3C1ZA 5J0OA 2KN7A 2ZUDA 4GXJA 1TFRA 4ECWA 3GFKB 4WC2A 4X4TA 2LYHA 4ED0A 1JIHA 3IHQB 1TFYA 1ZQKA 1YLQA 1XO1A 5KFFA 5J2HA 3WFRE 3TANA 3V6HA 3N97B 2ASJA 4C8OA 5KG4A 1QLNA 3JPRA 2MUTA 5IIIA 4UAWA 4YR2A 5KFTA 4GXIA 4GXKA 2UVRA 4KTQA 4WC6A 4NLKA 4YR3A 1JN3A 4AT8B 5BOLA 1L5UA 7ICPA 4UQGA 4PHDA 4NLZA 4F5PA 2JZBB 1A76A 4Z6DA 1SL1A 4DFMA 5KFOA 4IRKA 3PVXA 4F92B 9ICHA 5HHHA 2A1JB 7ICLA 4M6WB 4O3PA 4R64A 4IQWA 3PW0A 4RQ8A 5D46A 4RPZA 5J0TA 3L9DA 3KHGA 2XY6A 4PH5A 4FBTA 4X4QA 2ISPA 5CWRA 2BPCA 4KITB 5J2AA 7ICGA 2ZHBA 5J0YA 4DL3A 3RJKA 5KT2A 4JK1A 5EWGA 5HRIA 3OJSA 2ZH4A 5IIKA 1QTMA 4RQ6A 1ZQFA 4F50A 1T4GA 2W9BB 4YD1A 1DGSA 3MABA 3EYZA 2RDIA 4RUCA 2ASLA 8ICQA 3MR6A 1TV9A 3QE9Y 8ICXA 5BPCA 3H8JA 5HMMA 3RBEA 4DWIA 4RZRA 2HVHA 5F2VO 3GIJA 4RUAA 5KT6A 2PI5A 4DQIA 5J0PA 3AQNA 3B0XA 2ZTDA 4NM1A 3PMLA 1V9PA 5KFSA 2XO7A 1ZQTA 4YQWA 3TAPA 3RJIA 1RZTA 1WCLA 4KN7A 4NY8A 5HRLA 1MSWD 8ICCA 1B43A 2P6UA 2C2DA 3T3FA 2IA6A 1XSPA 1ZQWA 3PMNA 3OGUA 2AGOA 3M9NB 1D8YA 3PR4A 5J0UA 2R8KA 4DQRA 4O9MA 1N56A 4MFCA 4ELVA 2BE3A 1FA0A 2AU0A 7ICKA 3H8WA 4LVSA 2VANA 3OV7A 1UT8A 1ZQXA 4ECZA 1L3SA 4F2RA 3MR5A 1BPDA 5D49A 2HHPA 3OHBA 2BCQA 3PR5B 3BQ0A 5KFAA 3C2KA 4R63A 5D4BA 4FHWA 3OVSA 4DSFA 5KFYA 4WC7A 4YMMA 3M8RA 4FBUA 4RQ1A 9ICNA 2W8LA 1T8EA 4UB5A 1NK0A 4NKUA 4YCXA 3RJEA 4M9NA 3V7KA 1AROP 4IRCA 4P2HA 1ZQSA 4F3OA 3ZDEA 1BNPA 1ZQUA 3HP6A 3FYHA 1NZPA 1ZQMA 5J2BA 1KFDA 3ZD8A 4KN4A 1QSLA 5J2JA 3C18A 1D8LA 4F4WA 8ICMA 1PZNA 9ICBA 2BGWA 3Q8MA 5KG0A 7ICQA 3LDAA 3N4MB 4DSLA 2KZ3A 3IM1A 1B22A 4TQRA 3C5FA 4J9KA 3H4BA 5HREA 4DEZA 3V6KA 5DKWA 2BCSA 4KLOA 4QW8A 4RWOA 1R8CA 2KZZA 4AT8A 1D9DA 3K75D 4LZDA 4X5VA 2UVVA 4JV1A 4KLSA 5HR9A 5F9LA 5J29A 2VA8A 2W8KA 3SYZA 2XY5A 1ZQPA 2ISOA 3NGDA 4X4NA 5KFRA 5KFJA 4PPXA 2FMSA 4F91B 5DDMA 5DQGA 5KG2A 3PNCA 2W9CB 4DL2A 1U47A 2ATLA 4UB2A 4M9GA 4I2HA 4ECXA 3H37A 4E8FA 4DL4A 4DO9A 1NK4A 1TKDA 3H39A 3OUYA 5J0XA 9ICKA 4LZGA 3TAQA 5DB9A 2AGPA 5CR0A 4RT2A 4RNMA 2IBKA 3ORYA 8ICNA 4M47A 3PW2A 2AGQA 4X4PA 5HRGA 1ZQRA 5HHIA 3H40A 1LV5A 1LB2B 1QSYA 4I2DA 3ZDCA 1MIYA 2I1QA 2IHMA 4E7XA 4X0BA 1RXVA 4F5NA 1HJPA 4GC6A 1U45A 4F4KA 4M9HA 3RH5A 5CB1A 4I29A 1TAUA 1BPBA 4P4MA 2HHTA 4QW9A 2KZMA 5DG8A 4F4YA 2JEJA 2C28A 7ICJA 4DFKA 8ICTA 2BDPA 4RQ2A 4J9OA 4M0AA 1ZQZA 2BKEA 3JPNA 3V72A 5HNKA 2HHVA 8ICPA 2ZH8A 5J2CA 3RB4A 2FMQA 4QZFA 3M9OB 2M2WA 2A1JA 3HX0A 4KLJA 2NRXA 1UEVA 1X9WA 4ATBA 2FPLA 4ECRA 1NK7A 3BQ2A 4QWEA 4Q45A 7ICHA 3JPSA 3MR2A 9ICUA 4EYIB 4X4RA 1WOTA 4EBCA 2ZJAA 2HHSA 1MQ2A 4FO6A 5J0QA 4ED1A 1SL0A 1KFTA 5KFVA 5DG9A 2VA2A 1KEJA 2BQUA 1UT5A 4QZBA 3EPIA 3V6JA 2W9BA 4WC3A 2HHWA 1KRPA 2R8HA 3PX6A 2GWSA 4K4IA 4LT6A 3ZDDA 4QZ9A 3JPPA 2HHXA 4BXOA 5CJ7A 1ZQAA 3RJJA 4X4VA 3UXOA 1BPXA 4JWMA 4GLXA 3RH4A 2ZH1A 5KT5A 4MF2A 1Q78A 1TVAA 3PO5A 4I27A 1NJXA 3LWMA 4TURA 5L1JA 3PY8A 3RRGA 4ATBB 3MGIA 1Y88A 4PGXA 2XCAA 2M2TA 8ICKA 3MDAA 1XC9A 8ICGA 1S9FA 8ICBA 9ICOA 1X2IA 4YG2A 4JV0A 4TQSA 5CHGA 5KFUA 3M8SA 4IR1A 4KLLA 7ICVA 4C8KA 4X4SA 2J6UA 4WBZA 2ZH3A 5C5JA 1X9SA 4B9NA 5KT4A 3MFIA 4ED6A 4PHEA 1ZQBA 1ZQGA 2P6RA 3UPSA 2C2EA 5HRDA 5EWFA 1CUKA 3ZD9A 1ZQVA 5DGBA 4PHPA 5KFPA 1TAQA 1BGXT 4B9UA 4AT7B 3AQMA 1NK8A 5J2DA 2W9AA 4J9QA 1SL2A 2NRWA 4C8LA 2ZHAA 4DOCA 4AT9B 5J0WA 1ZETA 5IIJA 4DQPA 4I2EA 2F1IA 1XU4A 3AQLA 4QZCA 2C22A 1ZQIA 1NKEA 1KLNA 3WFOA 3RTVA 1RYSA 4WC4A 2ALZA 2NRZA 3FDSA 3T5HA 7ICNA 3C5GA 4EYHB 5KFZA 4DLEA 2NRKA 4YXJA 2UVWA 4RWNA 9ICIA 4Z6EA 1JAJA 1ZQEA 5HRKA 1JXEA 4QWBA 4EBJA 5DDYA 4M5DA 3C21A 2W9MA 4YXMA 1XS9D 7ICEA 2XY7A 8ICUA 3RBDA 1MIWA 3LK9A 2ZTCA 4M2YA 3HIYA 3RAXA 1D9FA 4NLNA 5JUMA 1COOA 4MFFA 3MFHA 5KFEA 3GV7B 3KHLA 4BWJA 4BXOB 4RWPA 5KFLA 5KT3A 5KT7A 5KFIA 4FS1A 2I9GA 5DB8A 4MEYA 9ICVA 3HJ4A 2DR8A 1IM4A 1ZQNA 4KLMA 7ICTA 4RQ7A 4O3RA 1S0MA 4YR0A 2M9NA 4UBBA 2JEGA 4ECUA 5HMLA 1ZQHA 3OVBA 2ZH5A 3TI0A 1Z00A 2PI4A 3RH6A 1BPEA 4XA5A 3GV8B 3RB6A 1CEZA 3H8SA 2HVIA 2ZH2A 2DVIA 1ZQOA 3ZDAA 1KTQA 3UXNA 4HYKA 4QZ8A 1NJZA 4ECYA 2DFLA 4QZIA 3GIMA 9ICQA 2FLNA 1UEUA 1RYRA 1JX4A 3JPTA 3ETLA 4UB1A 5KFWA 1DK2A 4KLGA 4RNNA 3MGHA 4FH3A 4Z6CA 5HC9A 1ZQYA 4TUSA 4ECVA 4K4GA 4KLQA 1RXWA 2ZJ5A 3GQCA 2BQRA 1NJWA 2PFPA 5J0SA 2O5AA 1S0OA 3UXPA 2FPKA 3MDCA 4I2BA 3C2MA 4DF4A 5KFQA 3TARA 2ASDA 8ICHA 3RJHA 5HRBA 2OWOA 3LWLA 5KG7A 2ZH6A 4ECSA 8ICAA 2DRAA 3TFRA 4DS5A 3SI8A 2JZBA 3BQTA 4TUQA 3GIKA 3H4DA 1TK8A 1C7YA 3EW9A 8ICJA 4B9LA 4B9VA 3LQCB 3C23A 4UAYA 2BCRA 2R8JA 3BJYA 4F5RA 4B9SA 4I28A 9ICMA 4DSJA 4PHAA 4KLIA 3SZ2A 5IINA 4UB3A 1S0VA 3HWTA 2PFNA 5KFXA 5DEDA 5KG3A 4AT9A 4NLGA 2Q0ZX 3PX0A 5DECA 3GV5B 4ELTA 8ICOA 5KFCA 1ZJNA 1JQRA 4RQ0A 4K4HA 1DOQA 5DLFA 1SKRA 2BPGA 4S3NA 8ICRA 3BDPA 2V4RA 3HPOA 4DFJA 2KFZA 4UB4A 2IHNA 2H5XA 1NKBA 3OJUA 4KLFA 4J9LA 2V9WA 3ISBA 3JZ0A 4XRHA 5KTQA 5KFHA 2PXIA 4O3SA 4G3IA 8ICSA 1BPYA 4M9JA 2BCUA 3K4GA 4UBCA 5EOZA 4DOBA 4P4PA 4F5QA 2P66A 9ICPA 9ICRA 1S76D 2BR0A 3T5JA 1Z3EB 3B0YA 5KG1A 3G6VA 5DQHA 3RRHA 5CP2A 4EEYA 3THVA 2AQ4A 2DPJA 2R8GA 4DSKA 5L9XA 4MFAA 3KHRA 2C2RA 1TFWA 3RR7A 1UETA 4EZ9A 4JUZA 4UAZA 3UPQA 2FLPA 3PW4A 1T3NA 1JMSA 2PBEA 2DRBA 5KFBA 1T7PA 2BQ3A 1NJYA 7ICUA 4MEXA 1U4BA 5HRHA 2HW3A 4XQ8A 1R8BA 4XQ7A 2ZH7A 3H38A 1NKCA 1BNOA 5DLGA 4QZDA 1U9LA 4DQQA 2KP7A 4F5OA 4X0AA 4Z6FA 4R65A 1A77A 4RNOA 5KFMA 1U49A 4JV2A 9ICJA 4O3OA 4WC5A 4YMOA 4GC7A 1Q79A 3NYBA 2KTQA 9ICCA 9ICWA 4DL5A 3WFQE 1ZQCA 4P4OA 4QZGA 2BHNA 4R8UB 4Q44A 4RT3A 4ECTA 4YMNA 2F1JA 5DBBA 1ZQQA 1S77D 1HUOA 3HW8A 4FHXA 4BDPA 3Q8QB 1ZJMA 4DSEA 3SV4A 1ZQLA 4I2AA 3GILA 3Q8SB 5BOMA 3M9MB 4ED8A 1KDHA 3AU2A 4J9RA 2W9CA 7ICRA 2UVUA 4Q8FA 4DL7A 2J6SA 4FHPA 4I2IA 4I2JA 1IXRA 5KFGA 5KG6A 4BGDA 1X9MA 1BPZA 3OHAA 4O0IA 2IMWP 2VA3A 2KFNA 2ZUCA 2V4QA 2BPFA 4DLGA 5HRFA 3RB3A 1DK3A 3PV8A 1U48A 2MUTB 1NK5A 4EBDA 2JEIA 3EPGA 2F1HA 4NXZA 3RJGA 5J2FA 4I2CA 2M2VA 4F4XA 3RJFA 4PGYA 2HHQA 2M2UA 3UQ2A 1MC8A 3UQ0A 2PFQA 4EP7A 4MF8A 2RFFA 3PO4A 1L3UA 4F2SA 5IIMA 4Q8EA 5J0RA 1MIVA 5DB7A 5EWEA 3C1YA 1RPLA 1NO5A 3GDXA 3QZ7A 2RDJA 3V7JA 3JPQA 5IIOA 9ICAA 1S10A 3NTUA 4R66A 4NM2A 4QWAA 4B9MA 9ICLA 4BWMA 3OSPA 4XUSA 1S97A 4ELUA 4AT7A 2Q66A 1UA1A 4O5KA 8ICYA 4TUPA 4FHVA 4RQ3A 5J2GA 3Q8PB 4YVZA 5DG7A 5DQIA 5DB6A 9ICFA 4KLEA 4UD4A 4RU9A 8ICLA 2B21A 3KTQA 1Z00B 1BVSA 2WTFA 1KSPA 1QSSA 1V4AA 2FPMA 4J9SA 3JPOA 1ZYQA 7ICSA 2R8IA 3QEBZ 5TZVA 1ZQDA 4RWQA 4X4OA 1TK0A 5CA7A 4ED2A 1UA0A 5HP4A 8ICWA 2NRTA 3ISDA 4WCWA 2O1PA 2PFOA 3WFPA 4F4ZA 4R8UA 1F5AA 1XWLA 4Q43A 1R89A 3HJ1A 3PW7A 1H38A 4IQTA 2DR5A 4EBEA 1ZQJA 3SV3A 3RR8A 5KFDA 8ICVA 4YN4A 3BQ1A 1XSNA 3QZ8A 4RQ5A 4FS2A 3QEAZ 1KFSA 4IRDA 8ICFA 1OU5A 4KLDA 4PGQA 4EZ6A 4FHYA 7ICFA 4QZEA 1XSLA 2J6TA 3RB0A 4UD5A 4IQVA 3AU6A 4IG8A 4F8RA 1K1SA 3G6YA 4FH5A 3Q8KA 2NRVA 3E2EA 1JXLA 4WC0A 3T5LA 5J2KA 2Y1IA 2AQ0A 3PX4A 1NK9A 1PX5A 2FMPA 4E80A 5L1IA 2XC9A 5J2EA 3RAQA 5KG5A 4YP3A 5J2IA 4CCHA 9ICEA 8ICZA 3C66A 1VFGA 4O5CA 1KNYA 3T5KA 5DGAA 3KHHA 5IILA 4O3QA 1TK5A 2JEFA 4I2GA 3AUOA 4E0DA 2ID1A 4RQ4A 4ED3A 4QZHA 1N48A 9ICTA 4KLTA 2DR7A 3EZ5A 4ED7A 2MAXA 4DSIA 3H3AA 4RPXA 4DOAA 4EBKA 1HUZA 4YFKA 4QZAA 3TFSA 5DBAA 4O3NA 4DF8A 1MQ3A 5DBCA 8ICIA 4M04A 3GIIA 1SKSA 4ECQA 3JYYA 3V7LA 4JWNA 4J9MA 3Q8RB 3OSNA 4DQSA 1L3VA 4NKTA 2ZTEA 9ICSA 5KFNA 5L1KA 4M6WA 1L3TA 4DS4A 2DPIA 7ICIA 3OUYB 3MR3A 4KLHA 7ICOA 4X4UA 2ZJ8A 4C8NA 4QWCA 3MBYA 4M9LA 3WFSC 2DR9A 1SKWA 4O5EA 1R8AA 2BCVA 5KFKA 4J9PA 2ZUBA 2FLLA 4F93B 9ICGA 4IR9A 1K1QA
chains in the Genus database with same CATH superfamily
3H7IA 3HT3A 4J9NA 2KHVA 3I76A 1WCNA 5F9NA 4C8MA 1FFVA 1PK1B 3PSIA 4DL6A 3EWAA 2D8CA 2XCPA 1KW4A 2HHUA 4FZMA 3QU4A 3Q8LA 3PW5A 2XGPA 2EZXA 4U6PA 1TFRA 4ECWA 1FO4A 3WFRE 2K4HA 4C8OA 5KG4A 1QLNA 2UVRA 5IIIA 4WC6A 4NLKA 4YR3A 4AT8B 5BOLA 2BZFA 1L5UA 7ICPA 2W3SA 4UQGA 1L8LA 5L1MA 2JZBB 4F5PA 5KFOA 3PVXA 4OJ6A 1HIWA 3KZIU 4F92B 5HHHA 4R64A 4FZLA 3KHGA 4PH5A 5J2AA 4NL9C 3RJKA 4JK1A 1WG8A 1ZRMA 2LPEA 3NUQA 4RQ6A 1T4GA 2W9BB 1NZBA 3EYZA 2IOFA 1K5OA 3QE9Y 3RBEA 2FDRA 4RUAA 3AQNA 3B0XA 4NM1A 2HBLA 2OHFA 2W3RA 1WCLA 3A0HU 4KN7A 3CK6A 5AKHA 3NASA 4K97A 2H3IA 1ZQWA 3OGUA 2DBYA 3PR4A 5J0UA 4O9MA 2F76X 3D2SA 3H8WA 2VANA 4R63A 4WC7A 9ICNA 4NKUA 2W8LA 3QU5A 3RJEA 4AP9A 1BNPA 3AMZA 2VKQA 3ZD8A 3C18A 1D8LA 1PZNA 2A1AA 4CF3A 2KZ3A 4TQRA 4DEZA 5DKWA 2EQYA 2YQEA 2BCSA 4KLOA 4LEYA 1R8CA 1D9DA 3K75D 2UVVA 5HR9A 3KBBA 2ISOA 2XY5A 2E8MA 1ZD5A 5KFRA 4PPXA 4F91B 2K8BB 5DDMA 3PNCA 4M9GA 2ZG6A 4WBZA 5CFSA 1TFYA 3SAFA 1KKXA 4DL4A 5J0XA 5DB9A 5CR0A 4RT2A 3ORYA 3PW2A 2AGQA 1ZQRA 5HHIA 2ZIXA 4C4RA 1LB2B 1QSYA 2IHMA 4X0BA 2K60A 5ALIA 4OAHA 4KM5A 4M9HA 5CB1A 1L7NA 3NVWA 2HHTA 4OAIZ 4QW9A 5ALZA 4F4YA 2JEJA 4DFKA 4WOYA 5B3PA 4M0AA 8ICPA 5T14A 4X4NA 4AT9B 3WU2U 3HX0A 4KLJA 1S5LU 4Q45A 7ICHA 9ICUA 4X4RA 1VDVA 2ZJAA 1MQ2A 3AQEA 1KFTA 5DG9A 4J03A 2GOLA 4QZBA 3EPIA 2LM1A 1D8BA 3GZFA 2Y0SC 3CRXA 2K89A 2VJ5A 5CEHA 2HHWA 4K4IA 3RJJA 1ZQAA 1BPXA 4OCZA 4MF2A 1ED1A 3MDAA 4IR1A 1J2MA 4NXUA 7ICVA 2E8NA 1PVRA 4X4SA 3AN1A 1MA7A 3WKDA 3MFIA 4JMUA 4PHEA 2P6RA 2G5IB 5HRDA 1CUKA 5DGBA 2LMRA 1CRXA 2NYVA 1SL2A 2NRWA 4DOCA 3SEIA 4DQPA 5AI8A 4I2EA 3QUCA 1OW5A 1KLNA 3RTVA 2QARA 5KFZA 2HSZA 4YXJA 4RWNA 9ICIA 4QWBA 3ZI4A 4EBJA 1Q8KA 5DDYA 7ICEA 3ERCC 2ZTCA 3RAXA 4NXXA 1COOA 3MFHA 4RWPA 2HI0A 9ICVA 5KT7A 3H8MA 3H0LB 1RQNA 4GFJA 2JEGA 5HMLA 1M6YA 3SAGA 3RH6A 1CEZA 3H8SA 1ZQOA 3UXNA 4NXWA 2W03A 4QZ8A 2KV2A 2DFLA 3GIMA 3HKZF 1X6IA 4Y2TA 2OM6A 4LJXA 4FH3A 4Z6CA 4ECVA 4K4GA 4KLQA 2H3VA 2YMMA 2BQRA 1ZOLA 1NJWA 1S0OA 3C2MA 4DF4A 2ASDA 3TARA 2GAFD 8ICHA 2AHOB 3LWLA 3VC8A 4KX3A 2RHFA 8ICIA 2JZBA 3BQTA 1RM6C 3GIKA 4Y2VA 2BCRA 2O6KA 4I28A 4DSJA 5ALLA 2KG5A 4BUGA 4RQNA 2LBOA 2DKXA 5KFXA 4AT9A 4NLGA 5DECA 8ICOA 5KFCA 2KNJA 4K4HA 4DCCA 1X40A 8ICRA 3BDPA 3DDHA 1NKBA 3OJUA 2B6GA 1J2NA 2PXIA 4G3IA 1F5SA 9ICRA 4F5QA 1L3VA 5AKXA 2DPJA 1PK1A 1TFWA 1UETA 3PW4A 2BQ3A 1NJYA 5HRHA 1V97A 1COKA 3S6JA 5DLGA 1ECWA 4F5OA 4R65A 5AIAA 3O0FA 1N2XA 4YMOA 3NYBA 9ICCA 4P4OA 4EEBA 4RT3A 2F1JA 1S77D 4FHXA 3Q8QB 2Y9UA 3C29A 1MN8A 4I2IA 1O03A 2AXTU 2VA3A 4CRXA 4A8EA 3RB3A 2MUTB 4G9BA 3RJGA 4F4XA 2G0AA 4PGYA 2PFQA 3PO4A 2HN2A 5DB7A 5EWEA 2W43A 5AKEA 2QKQA 5ALGA 5AKJA 1S97A 2KSOA 4FHVA 4RQ3A 5J2GA 5DQIA 4UD4A 1SIJA 1V4AA 1QSSA 4OJLA 1ZQDA 4RWQA 4ED2A 3M6KA 2OEHA 2O1PA 2H3ZA 2K4IA 4Q43A 3HJ1A 3PHZA 4IQTA 2DR5A 8ICVA 5ALRA 4IRDA 4P0PB 5H2FU 1OU5A 4PGQA 3N28A 7ICFA 2VIXA 3RB0A 1L7PA 2WF5A 3FC4A 4FH5A 5D62A 5ALHA 3KKAC 1JXLA 3T5LA 1L6NA 2Y1IA 2WB1C 1NK9A 3M6ZA 4E80A 1JROA 3AL0B 2BBJA 2XC9A 5J2EA 3RAQA 5F3XB 4YP3A 4Y2UA 1VFGA 4O5CA 1KNYA 5ALEA 1A0PA 3FAHA 4C80A 4I2GA 2ID1A 3EF2A 1JUDA 4QZHA 4KLTA 3EZ5A 4KB6A 2DGZA 1N63A 2EH9A 4F72A 3OUYB 3GU3A 4C8NA 1SKWA 4AT8A 1VJ7A 4RPYA 1EXNA 3G6XA 7ICMA 5B66U 2HMXA 3QUBA 3C2LA 4K8VA 3D2QA 4Y2QA 2IOFK 3ISCA 4DFPA 4FO1A 3ZDBA 2FJ6A 2HOFA 3AQKA 4NXTA 4WC2A 2LYHA 2NV3A 3WK9A 4N7RA 2MUTA 4UAWA 2MA1A 4YR2A 4KTQA 3SQIA 1P7DA 3QU9A 1URJA 4NLZA 4OAGA 1J97A 1FFUA 5GTIU 4M6WB 2K4EA 4O3PA 2ZXHA 2PMZF 3PW0A 4RQ8A 5D46A 4RPZA 5J0TA 1FEZA 4FBTA 2JRZA 4KITB 3FM9A 2ZH4A 1QTMA 5ALVA 1ZQFA 3MABA 8ICQA 2ZIXB 3EUB2 5AK3A 5HMMA 4DWIA 3GIJA 2PI5A 4DQIA 2OYYA 3PMLA 4YQWA 5AI6A 1RZTA 4NY8A 2C2DA 5D63A 4WQLA 3I1YA 1N61A 5K4LA 2R8KA 5AKIA 4EEDA 3WKAA 4MFCA 2BE3A 2YMQA 2AU0A 7ICKA 1ZQ1C 4EX7A 4WJ3B 5D49A 2HHPA 2KJ8A 2BCQA 5FP0A 5KFAA 3C2KA 5D4BA 2ES6A 4FBUA 1B0XA 1NK0A 1PVPA 4YCXA 4M9NA 4IRCA 1ZQSA 3SR6A 4F3OA 3ZDEA 3A0BU 1ZQUA 2N1RA 5J2BA 1KFDA 1QSLA 4GIBA 2KHQA 3HRDD 4NJ8A 3N4MB 4DSLA 1B22A 4J9KA 2LKYA 5HREA 1L7MA 2YN4A 1CI4A 4LZDA 4C7ZA 4Y2YA 5KNIA 4KLSA 4FFDA 2W9CB 1YZ6A 1U47A 2ATLA 4UB2A 4ZOHC 4I2HA 3H37A 2G5HB 2WFAA 4DO9A 1TKDA 2KVCA 3OUYA 4LZGA 5KL1B 4C0ZA 2AGPA 2IBKA 5HRGA 4EELA 1TE2A 3IV6A 2EWRA 3H40A 2WB1F 2I1QA 4E7XA 4C7YA 1RXVA 1HJPA 2JH7A 3SENA 3RF9A 4I29A 4Y2RA 4WH5A 2KZMA 2C28A 8ICTA 2BDPA 3PSFA 4UW9A 3JPNA 1UHUA 4BX9C 2NRXA 1SWVA 3QNMA 3M1YA 1NK7A 3JPSA 5EE1A 2HHSA 1SWWA 3BS5A 1KEJA 1UT5A 3N7PD 3V6JA 2W9BA 1KRPA 2R8HA 2GWSA 1KQQA 4B6JA 2HHXA 3BS5B 3UXOA 5ALPA 4GLXA 1V38A 5JTIA 3LWMA 4TURA 3PY8A 3RRGA 4ATBB 5HR7A 2M2TA 1XC9A 8ICGA 1S9FA 4JV0A 3M8SA 5CHGA 4C8KA 3E0FA 4EENA 1QQ6A 1PUZA 5KT4A 4NXVA 4NLBA 5EWFA 1FIQA 2W55A 4PHPA 5KFPA 1TAQA 4B9UA 2W9AA 4J9QA 2ZHAA 2B56A 1ZETA 1XU4A 2G06A 3DEEA 3AQLA 2LHTA 1ZQIA 1Z19A 3WFOA 4WC4A 2ALZA 4Z6EA 5HRKA 2KVSA 5AKZA 4CE6A 2W9MA 4M5DA 2IHOA 3K7DA 3RBDA 1MIWA 3LK9A 5JUMA 5AM4A 3KHLA 4BXOB 2CRXA 2ZIUB 5KT3A 2YX8A 2I9GA 2DR8A 3PZPA 1ZQNA 4RQ7A 5ALDA 4O3RA 1ZQHA 3TI0A 1JALA 1BPEA 2DVIA 3ZDAA 4UB6U 2KE7A 4QZIA 2F2AB 1UEUA 1RYRA 3J81j 4KLGA 4PZNA 4RNNA 2ZJ5A 2EZZA 5ALMA 2OWOA 4ECSA 2DRAA 5KL8B 4DS5A 1ZRNA 4B9VA 2DQNB 1RDFA 3C23A 4UAYA 9ICMA 2MSNA 4F5RA 4PHAA 3SZ2A 5IINA 3CW2C 4K96A 3HWTA 2PFNA 3PX0A 1JQRA 2F44A 3ER9B 2I6XA 3KFUF 4UB4A 4J9LA 4XRHA 5KTQA 4O3SA 1BPYA 5E79U 2P66A 1Z3EB 2EAMA 3G6VA 5L9XA 3KHRA 4JUZA 1JMSA 2PBEA 2ZH7A 1R8BA 3NVYA 2F8KA 4Y2SA 4K9BA 1PK3A 4X0AA 4P0PA 4O3OA 1ZQCA 3SAHA 4R8UB 4ECTA 2QARB 4RQMA 4YMNA 1ZQQA 3HW8A 2DUYA 3ALRA 4I2JA 1IXRA 4BGDA 1BPZA 2KFNA 4O0IA 4DLGA 1DK3A 3PV8A 1U48A 1RQLA 2HHQA 2E5SA 4F2SA 5J0RA 1DRGA 3F5EA 3C1YA 1RPLA 2H3QA 4PL1A 1NO5A 2RDJA 3V7JA 3D6JA 1GO3F 4NM2A 2K4PA 2P35A 4QWAA 9ICLA 5AI4A 3CYMA 4O5KA 4O67A 5AM1A 3KKAA 4TUPA 3Q8PB 9ICFA 5DB6A 3KTQA 2L5YA 3ER8C 2BDUA 2ZXIA 4J9SA 2DKZA 2Y0SF 7ICSA 4JLXA 4O69A 1UA0A 4DFDA 3ISDA 4WCWA 2OH2A 4FZNA 4F4ZA 2BBHA 1H38A 1ZQJA 1X66A 5KFDA 4YN4A 3BQ1A 4P0QA 4U7CA 5CRXA 2ZIUA 1HEKA 4KLDA 1ZD3A 4ACOA 4QZEA 1XSLA 2J6TA 4UD5A 4OJ5A 4F8RA 3G6YA 3WK5A 2W11A 5J2KA 5AHXA 3NVZA 1PX5A 5L1IA 2WAQF 3DV9A 3C66A 5J2IA 4C4TA 4Y2XA 1TK5A 4O3QA 1IIPA 3AUOA 4US9A 5AI9A 4ED3A 3NWIA 4DSIA 2MAXA 4EBKA 4RPXA 1HUZA 2K8AA 3TFSA 5DBAA 4O3NA 4CDGA 4QJFB 3Q8RB 4DQSA 4K99A 1L7OA 1DXSA 3KOOA 2YTUA 4DS4A 2DPIA 3MR3A 4KLHA 3MBYA 3L3FX 1QQ5A 5KAIU 4O5EA 1R8AA 4J9PA 2ZUBA 1VLBA 5GTHU 3F5AA 2JH1A 4B9TA 4KMUA 9ICXA 4QIWF 4IQUA 2ZH9A 8ICEA 2XGQA 5C0YA 1SZPA 4CGZA 1Q3VA 4I2FA 1O08A 2AJQA 5L1LA 1RYUA 3TQ1A 2QB1A 3C1ZA 5J0OA 2KN7A 4GXJA 3QXGA 3GFKB 4X4TA 4ED0A 1JIHA 2HDOA 1YLQA 2JV3A 4BJQA 5KFFA 5J2HA 3N97B 3F2DA 5KFTA 4GXKA 2KICA 2HCFA 2KSOB 4UB8U 1WWVA 2IUBA 1ZD4A 3WK4A 1A76A 4IRKA 2A1JB 2B4VA 4IQWA 1RG6A 2XY6A 4X4QA 7ICGA 2BPCA 2ZHBA 1N62A 5J0YA 1JI7A 5EWGA 5IIKA 2EAOA 4F50A 4YD1A 1DGSA 2RDIA 2ASLA 3MR6A 4RZRA 5J0PA 2ZTDA 1V9PA 1ZQTA 1IG6A 2RQ5A 5G5GA 1QQ7A 1MSWD 4WQKA 3LVWA 4O6AA 2PKEA 2IA6A 4EX6A 2KJ9A 3C28A 3M9NB 1D8YA 2FI1A 4DQRA 2JHDA 4I0UA 3F2CA 4K9AA 4ELVA 3WKCA 1UQVA 4LVSA 1UT8A 1ZQXA 1L3SA 4F2RA 5ALWA 1NNLA 2ZIWA 3B9JA 3PR5B 3BQ0A 4FHWA 4DSFA 5KFYA 3M8RA 4RQ1A 1T8EA 4P2HA 4UAUA 4KN4A 4F71A 5J2JA 2KKVA 4F4WA 3Q8MA 5KG0A 3LDAA 3H4BA 2YY6A 2XIDA 2KZZA 2KIWA 3PSPA 4JV1A 5F9LA 2W8KA 2VA8A 1ZQPA 1WYGA 2FMSA 1F5AA 5DQGA 5KG2A 3BZKA 4DL2A 4ECXA 3IRUA 4UASA 3H39A 3TAQA 4X4PA 2DF4B 4I2DA 3HILA 1MIYA 5AI0A 4GC6A 2DWQA 1U45A 4F4KA 3RH5A 2GLEA 3M7DA 1TAUA 2FCLA 2D3DA 1F44A 2ESEA 2E8OA 5HNKA 2HHVA 2ZH8A 1B4FA 4IL6U 3RB4A 3IN5A 2FMQA 4QZFA 4PJ0U 4ECRA 4QWEA 3MR2A 1WOTA 2RLTA 5J0QA 4ED1A 4FO6A 5KFVA 2VA2A 4C4SA 3SMVA 2W04A 3MGVA 3IP4B 5ALTA 4WC3A 5JU5A 4LT6A 3PX6A 4QZ9A 3JPPA 5CJ7A 1Z4NA 1X9XA 2WHEA 3ICXA 5G5HA 3RH4A 3AM9A 4LEVA 4FE3A 5KT5A 4I27A 5AK5A 4XJEA 5L1JA 5KAFU 4PGXA 3QYPA 8ICKA 2H3FA 9ICOA 1X2IA 4YG2A 5ALXA 4TQSA 4KLLA 2W7OA 2J6UA 1PVQA 4AYBC 5C5JA 4ED6A 1ZQBA 1ZQGA 3UPSA 2C2EA 2XICA 3ZD9A 3F53A 1BGXT 2JXJA 1NK8A 4C8LA 4NWIA 5IIJA 2F1IA 4QZCA 1NKEA 2NRZA 3T5HA 3C5GA 4EYHB 1JRPA 2NRKA 1JAJA 1JXEA 2HBKA 2LYAA 8ICUA 4EGWA 4USAA 2GA9D 4MFFA 5KFEA 3GV7B 1N5XA 4BWJA 5KFLA 5KFIA 5DB8A 2KJ5A 1IM4A 7ICTA 5ALJA 2OCEA 1ZXIA 1Z00A 4XA5A 3IG5A 2KIVA 1KTQA 4ECYA 3LVVA 9ICQA 2FLNA 3NRZA 1JX4A 3ETLA 5KFWA 3MGHA 1ZQYA 2OXOA 4TUSA 1RXWA 3GQCA 5AKGA 2O5AA 4CF5A 3UXPA 3MDCA 4UATA 3RJHA 2ZH6A 5KG7A 5AM5A 3TFRA 3SI8A 3H4DA 3LQCB 4QNLA 2GH1A 4B9SA 1VJ5A 3BJYA 2R8JA 4KLIA 4UB3A 2EZYA 1OXJA 5DEDA 5KG3A 4IS7A 4ELTA 1Z1BA 4RQ0A 4S3NA 5ALYA 3TADC 2V4RA 3HPOA 4DFJA 4AYBF 2D6FC 1SV0A 2V9WA 3ISBA 3JZ0A 8ICSA 5AKYA 4M9JA 3K4GA 4DOBA 4P4PA 9ICPA 1S76D 5AIBA 4MKPA 3T5JA 3RRHA 4NV0A 5KG1A 2AQ4A 5CP2A 3THVA 4EEYA 2R8GA 2ZH2A 3BZCA 4MFAA 5AM0A 4MHVA 3TACB 3UPQA 2HBJA 2Y9TA 7ICUA 5JRTA 1U9LA 4HAIA 1U49A 4JV2A 9ICJA 2LM4A 4DL5A 4OJPA 4QZGA 2BHNA 1HUOA 5ALQA 5CHEA 4BDPA 4IC9A 1ZJMA 2W7PA 1ZQLA 4I2AA 3GILA 5BOMA 3M9MB 3AU2A 4J9RA 2UVUA 4Q8FA 4DL7A 4FHPA 1SXEA 5KFGA 1X9MA 2IMWP 3OHAA 2WF9A 2BPFA 5HRFA 2JEIA 3EPGA 4I2CA 5J2FA 4K98A 3RJFA 2M2UA 2RFFA 1LVHA 5IIMA 5EE9A 3KD3A 4OD0A 2JMGA 5IIOA 9ICAA 3NTUA 3OSPA 4ELUA 2Q66A 2B0CA 1UA1A 2EANA 1YZ7A 4YVZA 1IV8A 8ICLA 2B21A 1WUDA 2WTFA 2HBMA 5EE0A 3JPOA 3QEBZ 1L8OA 2XVTA 3IG8A 1TK0A 5CA7A 5HR6A 5HP4A 2PFOA 3WFPA 4R8UA 1XWLA 1R89A 3PW7A 4EBEA 1WWUA 2PMZC 3SV3A 3RR8A 4KMOB 1XSNA 4EZ6A 2A19A 3AU6A 3HJEA 4IG8A 1K1SA 3Q8KA 2NRVA 2A3VA 3E2EA 3PX4A 2FMPA 2R18A 9ICEA 8ICZA 3D2NA 5KG5A 1C20A 3OPXA 1N48A 9ICTA 3MCRA 2DR7A 4DOAA 4YFKA 3QX7A 4DF8A 1MQ3A 4M04A 3GIIA 1SKSA 4ECQA 4JWNA 4J9MA 1KL9A 2ZTEA 2AH5A 5KFNA 5L1KA 1X42A 7ICIA 2ZJ8A 4QWCA 3WFSC 2LYBA 1OUQA 2DR9A 1X6JA 2BCVA 2FLLA 9ICGA 4IR9A 1QCKA 1K1QA 1LKYA 3ED5A 3OVAA 3IDWA 4JLZA 1S0NA 1NK6A 4KLUA 4WC1A 1NOMA 4WBYA 2Y1JA 1LKYB 1SB3C 1AQ6A 4YD2A 4HX0A 4NLCA 5TISU 4JB3A 4QWDA 4ZH4A 1XNSA 4UARA 2ZUDA 5B3QA 2ZIVB 3IHQB 1ZQKA 1XO1A 3TANA 3V6HA 3AEVA 2ASJA 3JPRA 4GXIA 1QH9A 1JN3A 2YB1A 3UMBA 3TADA 4PHDA 4Z6DA 3K1RB 1SL1A 4DFMA 4UAVA 4LEZA 9ICHA 3WK7A 4CF4A 7ICLA 2CXYA 3L9DA 2ISPA 5CWRA 4DL3A 5KT2A 2XI9A 5HRIA 3OJSA 5EE3A 3R9KA 2NO4A 4RUCA 4O68A 1TV9A 8ICXA 5BPCA 3H8JA 2HVHA 2HOIA 5KT6A 2JGAA 5KFSA 2XO7A 3TAPA 3RJIA 5ALKA 5HRLA 2MU2A 8ICCA 1B43A 2P6UA 3T3FA 3OWGA 1XSPA 1SZHA 3PMNA 2AGOA 2E8PA 1ZD2P 1N56A 4ICAA 4LEWA 1FA0A 3BQ7A 3OV7A 3WKBA 4ECZA 3N7RC 3MR5A 1BPDA 2G07A 3OHBA 2E3TA 3BS7A 3OVSA 4YMMA 5AM2A 4UB5A 5ALFA 3V7KA 1AROP 3HP6A 3FYHA 1NZPA 3LYSA 1T94A 1ZQMA 5AM3A 2M0NA 8ICMA 9ICBA 5A0LA 1Z1VA 1V85A 2BGWA 3VCBA 5AICA 7ICQA 3IM1A 2EDUA 2HOQA 3C5FA 2Q4TA 3V6KA 4RWOA 4QW8A 2KOBA 4X5VA 5J29A 3SYZA 3QU2A 3NGDA 5KFJA 1Z4OA 1NK4A 3H0RB 2G09A 9ICKA 2RRDA 3SD7A 4RNMA 8ICNA 4M47A 1LV5A 3ZDCA 4PZOA 4F5NA 3F2BA 1BPBA 4P4MA 2NO5A 3WKEA 5DG8A 7ICJA 4RQ2A 4J9OA 1ZQZA 2BKEA 2JR5A 3V72A 5J2CA 5D61A 3M9OB 2M2WA 2A1JA 1UEVA 1X9WA 4ATBA 2FPLA 3BQ2A 2RP5A 2DL0A 4EYIB 4EBCA 3H0MB 1SL0A 2BQUA 3N7SC 3ZDDA 2F77X 4BXOA 5AKKA 4X4VA 2WAQC 4JWMA 2WF6A 2ZH1A 3KZXA 3CNHA 1Q78A 1TVAA 3UM9A 3PO5A 1NJXA 3HKZC 3MGIA 1Y88A 2XCAA 3NRWA 1A6SA 8ICBA 2YB4A 5KFUA 2F8LA 2ZH3A 1X9SA 4NL9A 4B9NA 3QU7A 1YT3A 1SV4A 1KN5A 3U26A 1UCVA 1ZQVA 1SV0C 4AT7B 3AQMA 5J2DA 2CPRA 4QIWC 5J0WA 5AKLA 2C22A 1RYSA 3FDSA 7ICNA 4DLEA 2KKPA 2UVWA 1ZQEA 4CNQA 4E8FA 3C21A 4YXMA 1XS9D 2XY7A 4M2YA 3HIYA 4KX5A 1D9FA 4NLNA 4FS1A 5F2VO 4MEYA 3HJ4A 4KLMA 1S0MA 3L4PA 2M9NA 4YR0A 4UBBA 4ECUA 3OVBA 2ZH5A 1UPHA 2PI4A 3GV8B 2FE9A 3RB6A 2HVIA 3ETRA 4HYKA 1NJZA 3JPTA 2CN1A 4UB1A 1DK2A 2IOHA 4O3MA 2VJ4A 5HC9A 3AQFA 3K1ZA 3NKUA 1F0MA 3UMGA 2PFPA 5J0SA 3NVOA 2FPKA 5HRBA 4I2BA 5KFQA 3JCFA 8ICAA 1C7YA 2ODGA 1TK8A 4TUQA 3EW9A 8ICJA 4B9LA 5ALUA 5AK6A 3QUQA 5AI5A 3PSTA 3CP8A 1S0VA 3T79A 1KBUA 2YMPA 3I28A 2Q0ZX 4US8A 3GV5B 4EV6A 1ZJNA 2MRLA 1DOQA 5DLFA 1SKRA 5ALOA 2BPGA 3UMCA 2KEYA 2KFZA 2K8CB 2H5XA 2KK0A 2IHNA 3RFAA 4KLFA 5KFHA 1GPJA 2BCUA 2QB0A 4UBCA 5EOZA 2LI6A 2BR0A 1T3QA 3B0YA 5DQHA 4OO1J 1N60A 1SXDA 4DSKA 3OTQA 2I5HA 2C2RA 3RR7A 4EZ9A 5B5EU 4UAZA 3NVVA 2FLPA 1T3NA 2DRBA 5KFBA 1T7PA 4MEXA 1U4BA 2HW3A 4XQ8A 3H38A 1NKCA 1BNOA 4QZDA 5ALSA 4DQQA 2KP7A 4Z6FA 1A77A 4RNOA 1N5WA 5AK4A 5KFMA 2Z7JA 1Q3UA 1XO0A 4WC5A 4GC7A 1Q79A 2KTQA 9ICWA 3WFQE 2ZIWB 5ALNA 4Q44A 2WF7A 2KMDA 5DBBA 2E1FA 1DGJA 3SV4A 4DSEA 3Q8SB 4ED8A 1KDHA 5J8YA 7ICRA 2W9CA 2J6SA 4OAFA 2QB0B 5KG6A 1NI3A 2ZUCA 3E58A 2V4QA 1NK5A 2F3NA 4EBDA 2M2VA 2F1HA 4NXZA 1Q46A 3NS1A 3UQ2A 1MC8A 3UQ0A 4EP7A 4MF8A 1L3UA 3TKAA 2GO7A 4Q8EA 5J8YC 1MIVA 4Y2PA 3GDXA 3QZ7A 3JPQA 1S10A 4R66A 4B9MA 4BWMA 4XUSA 4AT7A 3WK6A 8ICYA 2KD1A 5DG7A 5CFUA 2YMLA 4KLEA 4RU9A 2HN1A 1Z00B 1BVSA 1KSPA 3L5KA 2FPMA 3QUTA 1ZYQA 2R8IA 4X4OA 5TZVA 8ICWA 2NRTA 1S8OA 2G08A 4EEKA 5JTGA 3QZ8A 4RQ5A 4FS2A 3QEAZ 1KFSA 8ICFA 2QLTA 4FHYA 4IQVA 2EAPA 4WC0A 2B51A 2AQ0A 4PL2A 2ZIVA 4CCHA 1SGGA 2E1EA 3MC1A 3ONNA 3T5KA 5DGAA 3KHHA 5IILA 2JEFA 4XQ7A 4E0DA 4RQ4A 4ED7A 3H3AA 4QZAA 5CFTA 4Y2JA 5DBCA 1TAMA 3JYYA 3V7LA 3OSNA 4OJOA 4NKTA 9ICSA 4M6WA 1L3TA 2W54A 4X4UA 4P0QB 7ICOA 4M9LA 3WK8A 5KFKA 4F93B 2WF8A
chains in the Genus database with same CATH topology
1VJ7A 4RPYA 1EXNA 3H7IA 3HT3A 4B9TA 3OVAA 4KMUA 4J9NA 1WCNA 1S0NA 5F9NA 1NK6A 4KLUA 9ICXA 3G6XA 4C8MA 4IQUA 4DL6A 1NOMA 7ICMA 4WC1A 2ZH9A 3EWAA 8ICEA 4WBYA 2XCPA 2Y1JA 2HHUA 2XGQA 3C2LA 4YD2A 1SZPA 3Q8LA 3PW5A 4QWDA 4I2FA 4ZH4A 2XGPA 3ISCA 4DFPA 3ZDBA 2AJQA 5L1LA 3TQ1A 3AQKA 3C1ZA 5J0OA 2KN7A 2ZUDA 4GXJA 1TFRA 4ECWA 3GFKB 4WC2A 4X4TA 2LYHA 4ED0A 1JIHA 3IHQB 1TFYA 1ZQKA 1YLQA 1XO1A 5KFFA 5J2HA 3WFRE 3TANA 3V6HA 3N97B 2ASJA 4C8OA 5KG4A 1QLNA 3JPRA 2MUTA 5IIIA 4UAWA 4YR2A 5KFTA 4GXIA 4GXKA 2UVRA 4KTQA 4WC6A 4NLKA 4YR3A 1JN3A 4AT8B 5BOLA 1L5UA 7ICPA 4UQGA 4PHDA 4NLZA 4F5PA 2JZBB 1A76A 4Z6DA 1SL1A 4DFMA 5KFOA 4IRKA 3PVXA 4F92B 9ICHA 5HHHA 2A1JB 7ICLA 4M6WB 4O3PA 4R64A 4IQWA 3PW0A 4RQ8A 5D46A 4RPZA 5J0TA 3L9DA 3KHGA 2XY6A 4PH5A 4FBTA 4X4QA 2ISPA 5CWRA 2BPCA 4KITB 5J2AA 7ICGA 2ZHBA 5J0YA 4DL3A 3RJKA 5KT2A 4JK1A 5EWGA 5HRIA 3OJSA 2ZH4A 5IIKA 1QTMA 4RQ6A 1ZQFA 4F50A 1T4GA 2W9BB 4YD1A 1DGSA 3MABA 3EYZA 2RDIA 4RUCA 2ASLA 8ICQA 3MR6A 1TV9A 3QE9Y 8ICXA 5BPCA 3H8JA 5HMMA 3RBEA 4DWIA 4RZRA 2HVHA 5F2VO 3GIJA 4RUAA 5KT6A 2PI5A 4DQIA 5J0PA 3AQNA 3B0XA 2ZTDA 4NM1A 3PMLA 1V9PA 5KFSA 2XO7A 1ZQTA 4YQWA 3TAPA 3RJIA 1RZTA 1WCLA 4KN7A 4NY8A 5HRLA 1MSWD 8ICCA 1B43A 2P6UA 2C2DA 3T3FA 2IA6A 1XSPA 1ZQWA 3PMNA 3OGUA 2AGOA 3M9NB 1D8YA 3PR4A 5J0UA 2R8KA 4DQRA 4O9MA 1N56A 4MFCA 4ELVA 2BE3A 1FA0A 2AU0A 7ICKA 3H8WA 4LVSA 2VANA 3OV7A 1UT8A 1ZQXA 4ECZA 1L3SA 4F2RA 3MR5A 1BPDA 5D49A 2HHPA 3OHBA 2BCQA 3PR5B 3BQ0A 5KFAA 3C2KA 4R63A 5D4BA 4FHWA 3OVSA 4DSFA 5KFYA 4WC7A 4YMMA 3M8RA 4FBUA 4RQ1A 9ICNA 2W8LA 1T8EA 4UB5A 1NK0A 4NKUA 4YCXA 3RJEA 4M9NA 3V7KA 1AROP 4IRCA 4P2HA 1ZQSA 4F3OA 3ZDEA 1BNPA 1ZQUA 3HP6A 3FYHA 1NZPA 1ZQMA 5J2BA 1KFDA 3ZD8A 4KN4A 1QSLA 5J2JA 3C18A 1D8LA 4F4WA 8ICMA 1PZNA 9ICBA 2BGWA 3Q8MA 5KG0A 7ICQA 3LDAA 3N4MB 4DSLA 2KZ3A 3IM1A 1B22A 4TQRA 3C5FA 4J9KA 3H4BA 5HREA 4DEZA 3V6KA 5DKWA 2BCSA 4KLOA 4QW8A 4RWOA 1R8CA 2KZZA 4AT8A 1D9DA 3K75D 4LZDA 4X5VA 2UVVA 4JV1A 4KLSA 5HR9A 5F9LA 5J29A 2VA8A 2W8KA 3SYZA 2XY5A 1ZQPA 2ISOA 3NGDA 4X4NA 5KFRA 5KFJA 4PPXA 2FMSA 4F91B 5DDMA 5DQGA 5KG2A 3PNCA 2W9CB 4DL2A 1U47A 2ATLA 4UB2A 4M9GA 4I2HA 4ECXA 3H37A 4E8FA 4DL4A 4DO9A 1NK4A 1TKDA 3H39A 3OUYA 5J0XA 9ICKA 4LZGA 3TAQA 5DB9A 2AGPA 5CR0A 4RT2A 4RNMA 2IBKA 3ORYA 8ICNA 4M47A 3PW2A 2AGQA 4X4PA 5HRGA 1ZQRA 5HHIA 3H40A 1LV5A 1LB2B 1QSYA 4I2DA 3ZDCA 1MIYA 2I1QA 2IHMA 4E7XA 4X0BA 1RXVA 4F5NA 1HJPA 4GC6A 1U45A 4F4KA 4M9HA 3RH5A 5CB1A 4I29A 1TAUA 1BPBA 4P4MA 2HHTA 4QW9A 2KZMA 5DG8A 4F4YA 2JEJA 2C28A 7ICJA 4DFKA 8ICTA 2BDPA 4RQ2A 4J9OA 4M0AA 1ZQZA 2BKEA 3JPNA 3V72A 5HNKA 2HHVA 8ICPA 2ZH8A 5J2CA 3RB4A 2FMQA 4QZFA 3M9OB 2M2WA 2A1JA 3HX0A 4KLJA 2NRXA 1UEVA 1X9WA 4ATBA 2FPLA 4ECRA 1NK7A 3BQ2A 4QWEA 4Q45A 7ICHA 3JPSA 3MR2A 9ICUA 4EYIB 4X4RA 1WOTA 4EBCA 2ZJAA 2HHSA 1MQ2A 4FO6A 5J0QA 4ED1A 1SL0A 1KFTA 5KFVA 5DG9A 2VA2A 1KEJA 2BQUA 1UT5A 4QZBA 3EPIA 3V6JA 2W9BA 4WC3A 2HHWA 1KRPA 2R8HA 3PX6A 2GWSA 4K4IA 4LT6A 3ZDDA 4QZ9A 3JPPA 2HHXA 4BXOA 5CJ7A 1ZQAA 3RJJA 4X4VA 3UXOA 1BPXA 4JWMA 4GLXA 3RH4A 2ZH1A 5KT5A 4MF2A 1Q78A 1TVAA 3PO5A 4I27A 1NJXA 3LWMA 4TURA 5L1JA 3PY8A 3RRGA 4ATBB 3MGIA 1Y88A 4PGXA 2XCAA 2M2TA 8ICKA 3MDAA 1XC9A 8ICGA 1S9FA 8ICBA 9ICOA 1X2IA 4YG2A 4JV0A 4TQSA 5CHGA 5KFUA 3M8SA 4IR1A 4KLLA 7ICVA 4C8KA 4X4SA 2J6UA 4WBZA 2ZH3A 5C5JA 1X9SA 4B9NA 5KT4A 3MFIA 4ED6A 4PHEA 1ZQBA 1ZQGA 2P6RA 3UPSA 2C2EA 5HRDA 5EWFA 1CUKA 3ZD9A 1ZQVA 5DGBA 4PHPA 5KFPA 1TAQA 1BGXT 4B9UA 4AT7B 3AQMA 1NK8A 5J2DA 2W9AA 4J9QA 1SL2A 2NRWA 4C8LA 2ZHAA 4DOCA 4AT9B 5J0WA 1ZETA 5IIJA 4DQPA 4I2EA 2F1IA 1XU4A 3AQLA 4QZCA 2C22A 1ZQIA 1NKEA 1KLNA 3WFOA 3RTVA 1RYSA 4WC4A 2ALZA 2NRZA 3FDSA 3T5HA 7ICNA 3C5GA 4EYHB 5KFZA 4DLEA 2NRKA 4YXJA 2UVWA 4RWNA 9ICIA 4Z6EA 1JAJA 1ZQEA 5HRKA 1JXEA 4QWBA 4EBJA 5DDYA 4M5DA 3C21A 2W9MA 4YXMA 1XS9D 7ICEA 2XY7A 8ICUA 3RBDA 1MIWA 3LK9A 2ZTCA 4M2YA 3HIYA 3RAXA 1D9FA 4NLNA 5JUMA 1COOA 4MFFA 3MFHA 5KFEA 3GV7B 3KHLA 4BWJA 4BXOB 4RWPA 5KFLA 5KT3A 5KT7A 5KFIA 4FS1A 2I9GA 5DB8A 4MEYA 9ICVA 3HJ4A 2DR8A 1IM4A 1ZQNA 4KLMA 7ICTA 4RQ7A 4O3RA 1S0MA 4YR0A 2M9NA 4UBBA 2JEGA 4ECUA 5HMLA 1ZQHA 3OVBA 2ZH5A 3TI0A 1Z00A 2PI4A 3RH6A 1BPEA 4XA5A 3GV8B 3RB6A 1CEZA 3H8SA 2HVIA 2ZH2A 2DVIA 1ZQOA 3ZDAA 1KTQA 3UXNA 4HYKA 4QZ8A 1NJZA 4ECYA 2DFLA 4QZIA 3GIMA 9ICQA 2FLNA 1UEUA 1RYRA 1JX4A 3JPTA 3ETLA 4UB1A 5KFWA 1DK2A 4KLGA 4RNNA 3MGHA 4FH3A 4Z6CA 5HC9A 1ZQYA 4TUSA 4ECVA 4K4GA 4KLQA 1RXWA 2ZJ5A 3GQCA 2BQRA 1NJWA 2PFPA 5J0SA 2O5AA 1S0OA 3UXPA 2FPKA 3MDCA 4I2BA 3C2MA 4DF4A 5KFQA 3TARA 2ASDA 8ICHA 3RJHA 5HRBA 2OWOA 3LWLA 5KG7A 2ZH6A 4ECSA 8ICAA 2DRAA 3TFRA 4DS5A 3SI8A 2JZBA 3BQTA 4TUQA 3GIKA 3H4DA 1TK8A 1C7YA 3EW9A 8ICJA 4B9LA 4B9VA 3LQCB 3C23A 4UAYA 2BCRA 2R8JA 3BJYA 4F5RA 4B9SA 4I28A 9ICMA 4DSJA 4PHAA 4KLIA 3SZ2A 5IINA 4UB3A 1S0VA 3HWTA 2PFNA 5KFXA 5DEDA 5KG3A 4AT9A 4NLGA 2Q0ZX 3PX0A 5DECA 3GV5B 4ELTA 8ICOA 5KFCA 1ZJNA 1JQRA 4RQ0A 4K4HA 1DOQA 5DLFA 1SKRA 2BPGA 4S3NA 8ICRA 3BDPA 2V4RA 3HPOA 4DFJA 2KFZA 4UB4A 2IHNA 2H5XA 1NKBA 3OJUA 4KLFA 4J9LA 2V9WA 3ISBA 3JZ0A 4XRHA 5KTQA 5KFHA 2PXIA 4O3SA 4G3IA 8ICSA 1BPYA 4M9JA 2BCUA 3K4GA 4UBCA 5EOZA 4DOBA 4P4PA 4F5QA 2P66A 9ICPA 9ICRA 1S76D 2BR0A 3T5JA 1Z3EB 3B0YA 5KG1A 3G6VA 5DQHA 3RRHA 5CP2A 4EEYA 3THVA 2AQ4A 2DPJA 2R8GA 4DSKA 5L9XA 4MFAA 3KHRA 2C2RA 1TFWA 3RR7A 1UETA 4EZ9A 4JUZA 4UAZA 3UPQA 2FLPA 3PW4A 1T3NA 1JMSA 2PBEA 2DRBA 5KFBA 1T7PA 2BQ3A 1NJYA 7ICUA 4MEXA 1U4BA 5HRHA 2HW3A 4XQ8A 1R8BA 4XQ7A 2ZH7A 3H38A 1NKCA 1BNOA 5DLGA 4QZDA 1U9LA 4DQQA 2KP7A 4F5OA 4X0AA 4Z6FA 4R65A 1A77A 4RNOA 5KFMA 1U49A 4JV2A 9ICJA 4O3OA 4WC5A 4YMOA 4GC7A 1Q79A 3NYBA 2KTQA 9ICCA 9ICWA 4DL5A 3WFQE 1ZQCA 4P4OA 4QZGA 2BHNA 4R8UB 4Q44A 4RT3A 4ECTA 4YMNA 2F1JA 5DBBA 1ZQQA 1S77D 1HUOA 3HW8A 4FHXA 4BDPA 3Q8QB 1ZJMA 4DSEA 3SV4A 1ZQLA 4I2AA 3GILA 3Q8SB 5BOMA 3M9MB 4ED8A 1KDHA 3AU2A 4J9RA 2W9CA 7ICRA 2UVUA 4Q8FA 4DL7A 2J6SA 4FHPA 4I2IA 4I2JA 1IXRA 5KFGA 5KG6A 4BGDA 1X9MA 1BPZA 3OHAA 4O0IA 2IMWP 2VA3A 2KFNA 2ZUCA 2V4QA 2BPFA 4DLGA 5HRFA 3RB3A 1DK3A 3PV8A 1U48A 2MUTB 1NK5A 4EBDA 2JEIA 3EPGA 2F1HA 4NXZA 3RJGA 5J2FA 4I2CA 2M2VA 4F4XA 3RJFA 4PGYA 2HHQA 2M2UA 3UQ2A 1MC8A 3UQ0A 2PFQA 4EP7A 4MF8A 2RFFA 3PO4A 1L3UA 4F2SA 5IIMA 4Q8EA 5J0RA 1MIVA 5DB7A 5EWEA 3C1YA 1RPLA 1NO5A 3GDXA 3QZ7A 2RDJA 3V7JA 3JPQA 5IIOA 9ICAA 1S10A 3NTUA 4R66A 4NM2A 4QWAA 4B9MA 9ICLA 4BWMA 3OSPA 4XUSA 1S97A 4ELUA 4AT7A 2Q66A 1UA1A 4O5KA 8ICYA 4TUPA 4FHVA 4RQ3A 5J2GA 3Q8PB 4YVZA 5DG7A 5DQIA 5DB6A 9ICFA 4KLEA 4UD4A 4RU9A 8ICLA 2B21A 3KTQA 1Z00B 1BVSA 2WTFA 1KSPA 1QSSA 1V4AA 2FPMA 4J9SA 3JPOA 1ZYQA 7ICSA 2R8IA 3QEBZ 5TZVA 1ZQDA 4RWQA 4X4OA 1TK0A 5CA7A 4ED2A 1UA0A 5HP4A 8ICWA 2NRTA 3ISDA 4WCWA 2O1PA 2PFOA 3WFPA 4F4ZA 4R8UA 1F5AA 1XWLA 4Q43A 1R89A 3HJ1A 3PW7A 1H38A 4IQTA 2DR5A 4EBEA 1ZQJA 3SV3A 3RR8A 5KFDA 8ICVA 4YN4A 3BQ1A 1XSNA 3QZ8A 4RQ5A 4FS2A 3QEAZ 1KFSA 4IRDA 8ICFA 1OU5A 4KLDA 4PGQA 4EZ6A 4FHYA 7ICFA 4QZEA 1XSLA 2J6TA 3RB0A 4UD5A 4IQVA 3AU6A 4IG8A 4F8RA 1K1SA 3G6YA 4FH5A 3Q8KA 2NRVA 3E2EA 1JXLA 4WC0A 3T5LA 5J2KA 2Y1IA 2AQ0A 3PX4A 1NK9A 1PX5A 2FMPA 4E80A 5L1IA 2XC9A 5J2EA 3RAQA 5KG5A 4YP3A 5J2IA 4CCHA 9ICEA 8ICZA 3C66A 1VFGA 4O5CA 1KNYA 3T5KA 5DGAA 3KHHA 5IILA 4O3QA 1TK5A 2JEFA 4I2GA 3AUOA 4E0DA 2ID1A 4RQ4A 4ED3A 4QZHA 1N48A 9ICTA 4KLTA 2DR7A 3EZ5A 4ED7A 2MAXA 4DSIA 3H3AA 4RPXA 4DOAA 4EBKA 1HUZA 4YFKA 4QZAA 3TFSA 5DBAA 4O3NA 4DF8A 1MQ3A 5DBCA 8ICIA 4M04A 3GIIA 1SKSA 4ECQA 3JYYA 3V7LA 4JWNA 4J9MA 3Q8RB 3OSNA 4DQSA 1L3VA 4NKTA 2ZTEA 9ICSA 5KFNA 5L1KA 4M6WA 1L3TA 4DS4A 2DPIA 7ICIA 3OUYB 3MR3A 4KLHA 7ICOA 4X4UA 2ZJ8A 4C8NA 4QWCA 3MBYA 4M9LA 3WFSC 2DR9A 1SKWA 4O5EA 1R8AA 2BCVA 5KFKA 4J9PA 2ZUBA 2FLLA 4F93B 9ICGA 4IR9A 1K1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJ7 A;  4RPY A;  1EXN A;  3H7I A;  3HT3 A;  4B9T A;  3OVA A;  4KMU A;  4J9N A;  1WCN A;  1S0N A;  5F9N A;  1NK6 A;  4KLU A;  9ICX A;  3G6X A;  4C8M A;  4IQU A;  4DL6 A;  1NOM A;  7ICM A;  4WC1 A;  2ZH9 A;  3EWA A;  8ICE A;  4WBY A;  2XCP A;  2Y1J A;  2HHU A;  2XGQ A;  3C2L A;  4YD2 A;  1SZP A;  3Q8L A;  3PW5 A;  4QWD A;  4I2F A;  4ZH4 A;  2XGP A;  3ISC A;  4DFP A;  3ZDB A;  2AJQ A;  5L1L A;  3TQ1 A;  3AQK A;  3C1Z A;  5J0O A;  2KN7 A;  2ZUD A;  4GXJ A;  1TFR A;  4ECW A;  3GFK B;  4WC2 A;  4X4T A;  2LYH A;  4ED0 A;  1JIH A;  3IHQ B;  1TFY A;  1ZQK A;  1YLQ A;  1XO1 A;  5KFF A;  5J2H A;  3WFR E;  3TAN A;  3V6H A;  3N97 B;  2ASJ A;  4C8O A;  5KG4 A;  1QLN A;  3JPR A;  2MUT A;  5III A;  4UAW A;  4YR2 A;  5KFT A;  4GXI A;  4GXK A;  2UVR A;  4KTQ A;  4WC6 A;  4NLK A;  4YR3 A;  1JN3 A;  4AT8 B;  5BOL A;  1L5U A;  7ICP A;  4UQG A;  4PHD A;  4NLZ A;  4F5P A;  2JZB B;  1A76 A;  4Z6D A;  1SL1 A;  4DFM A;  5KFO A;  4IRK A;  3PVX A;  4F92 B;  9ICH A;  5HHH A;  2A1J B;  7ICL A;  4M6W B;  4O3P A;  4R64 A;  4IQW A;  3PW0 A;  4RQ8 A;  5D46 A;  4RPZ A;  5J0T A;  3L9D A;  3KHG A;  2XY6 A;  4PH5 A;  4FBT A;  4X4Q A;  2ISP A;  5CWR A;  2BPC A;  4KIT B;  5J2A A;  7ICG A;  2ZHB A;  5J0Y A;  4DL3 A;  3RJK A;  5KT2 A;  4JK1 A;  5EWG A;  5HRI A;  3OJS A;  2ZH4 A;  5IIK A;  1QTM A;  4RQ6 A;  1ZQF A;  4F50 A;  1T4G A;  2W9B B;  4YD1 A;  1DGS A;  3MAB A;  3EYZ A;  2RDI A;  4RUC A;  2ASL A;  8ICQ A;  3MR6 A;  1TV9 A;  3QE9 Y;  8ICX A;  5BPC A;  3H8J A;  5HMM A;  3RBE A;  4DWI A;  4RZR A;  2HVH A;  5F2V O;  3GIJ A;  4RUA A;  5KT6 A;  2PI5 A;  4DQI A;  5J0P A;  3AQN A;  3B0X A;  2ZTD A;  4NM1 A;  3PML A;  1V9P A;  5KFS A;  2XO7 A;  1ZQT A;  4YQW A;  3TAP A;  3RJI A;  1RZT A;  1WCL A;  4KN7 A;  4NY8 A;  5HRL A;  1MSW D;  8ICC A;  1B43 A;  2P6U A;  2C2D A;  3T3F A;  2IA6 A;  1XSP A;  1ZQW A;  3PMN A;  3OGU A;  2AGO A;  3M9N B;  1D8Y A;  3PR4 A;  5J0U A;  2R8K A;  4DQR A;  4O9M A;  1N56 A;  4MFC A;  4ELV A;  2BE3 A;  1FA0 A;  2AU0 A;  7ICK A;  3H8W A;  4LVS A;  2VAN A;  3OV7 A;  1UT8 A;  1ZQX A;  4ECZ A;  1L3S A;  4F2R A;  3MR5 A;  1BPD A;  5D49 A;  2HHP A;  3OHB A;  2BCQ A;  3PR5 B;  3BQ0 A;  5KFA A;  3C2K A;  4R63 A;  5D4B A;  4FHW A;  3OVS A;  4DSF A;  5KFY A;  4WC7 A;  4YMM A;  3M8R A;  4FBU A;  4RQ1 A;  9ICN A;  2W8L A;  1T8E A;  4UB5 A;  1NK0 A;  4NKU A;  4YCX A;  3RJE A;  4M9N A;  3V7K A;  1ARO P;  4IRC A;  4P2H A;  1ZQS A;  4F3O A;  3ZDE A;  1BNP A;  1ZQU A;  3HP6 A;  3FYH A;  1NZP A;  1ZQM A;  5J2B A;  1KFD A;  3ZD8 A;  4KN4 A;  1QSL A;  5J2J A;  3C18 A;  1D8L A;  4F4W A;  8ICM A;  1PZN A;  9ICB A;  2BGW A;  3Q8M A;  5KG0 A;  7ICQ A;  3LDA A;  3N4M B;  4DSL A;  2KZ3 A;  3IM1 A;  1B22 A;  4TQR A;  3C5F A;  4J9K A;  3H4B A;  5HRE A;  4DEZ A;  3V6K A;  5DKW A;  2BCS A;  4KLO A;  4QW8 A;  4RWO A;  1R8C A;  2KZZ A;  4AT8 A;  1D9D A;  3K75 D;  4LZD A;  4X5V A;  2UVV A;  4JV1 A;  4KLS A;  5HR9 A;  5F9L A;  5J29 A;  2VA8 A;  2W8K A;  3SYZ A;  2XY5 A;  1ZQP A;  2ISO A;  3NGD A;  4X4N A;  5KFR A;  5KFJ A;  4PPX A;  2FMS A;  4F91 B;  5DDM A;  5DQG A;  5KG2 A;  3PNC A;  2W9C B;  4DL2 A;  1U47 A;  2ATL A;  4UB2 A;  4M9G A;  4I2H A;  4ECX A;  3H37 A;  4E8F A;  4DL4 A;  4DO9 A;  1NK4 A;  1TKD A;  3H39 A;  3OUY A;  5J0X A;  9ICK A;  4LZG A;  3TAQ A;  5DB9 A;  2AGP A;  5CR0 A;  4RT2 A;  4RNM A;  2IBK A;  3ORY A;  8ICN A;  4M47 A;  3PW2 A;  2AGQ A;  4X4P A;  5HRG A;  1ZQR A;  5HHI A;  3H40 A;  1LV5 A;  1LB2 B;  1QSY A;  4I2D A;  3ZDC A;  1MIY A;  2I1Q A;  2IHM A;  4E7X A;  4X0B A;  1RXV A;  4F5N A;  1HJP A;  4GC6 A;  1U45 A;  4F4K A;  4M9H A;  3RH5 A;  5CB1 A;  4I29 A;  1TAU A;  1BPB A;  4P4M A;  2HHT A;  4QW9 A;  2KZM A;  5DG8 A;  4F4Y A;  2JEJ A;  2C28 A;  7ICJ A;  4DFK A;  8ICT A;  2BDP A;  4RQ2 A;  4J9O A;  4M0A A;  1ZQZ A;  2BKE A;  3JPN A;  3V72 A;  5HNK A;  2HHV A;  8ICP A;  2ZH8 A;  5J2C A;  3RB4 A;  2FMQ A;  4QZF A;  3M9O B;  2M2W A;  2A1J A;  3HX0 A;  4KLJ A;  2NRX A;  1UEV A;  1X9W A;  4ATB A;  2FPL A;  4ECR A;  1NK7 A;  3BQ2 A;  4QWE A;  4Q45 A;  7ICH A;  3JPS A;  3MR2 A;  9ICU A;  4EYI B;  4X4R A;  1WOT A;  4EBC A;  2ZJA A;  2HHS A;  1MQ2 A;  4FO6 A;  5J0Q A;  4ED1 A;  1SL0 A;  1KFT A;  5KFV A;  5DG9 A;  2VA2 A;  1KEJ A;  2BQU A;  1UT5 A;  4QZB A;  3EPI A;  3V6J A;  2W9B A;  4WC3 A;  2HHW A;  1KRP A;  2R8H A;  3PX6 A;  2GWS A;  4K4I A;  4LT6 A;  3ZDD A;  4QZ9 A;  3JPP A;  2HHX A;  4BXO A;  5CJ7 A;  1ZQA A;  3RJJ A;  4X4V A;  3UXO A;  1BPX A;  4JWM A;  4GLX A;  3RH4 A;  2ZH1 A;  5KT5 A;  4MF2 A;  1Q78 A;  1TVA A;  3PO5 A;  4I27 A;  1NJX A;  3LWM A;  4TUR A;  5L1J A;  3PY8 A;  3RRG A;  4ATB B;  3MGI A;  1Y88 A;  4PGX A;  2XCA A;  2M2T A;  8ICK A;  3MDA A;  1XC9 A;  8ICG A;  1S9F A;  8ICB A;  9ICO A;  1X2I A;  4YG2 A;  4JV0 A;  4TQS A;  5CHG A;  5KFU A;  3M8S A;  4IR1 A;  4KLL A;  7ICV A;  4C8K A;  4X4S A;  2J6U A;  4WBZ A;  2ZH3 A;  5C5J A;  1X9S A;  4B9N A;  5KT4 A;  3MFI A;  4ED6 A;  4PHE A;  1ZQB A;  1ZQG A;  2P6R A;  3UPS A;  2C2E A;  5HRD A;  5EWF A;  1CUK A;  3ZD9 A;  1ZQV A;  5DGB A;  4PHP A;  5KFP A;  1TAQ A;  1BGX T;  4B9U A;  4AT7 B;  3AQM A;  1NK8 A;  5J2D A;  2W9A A;  4J9Q A;  1SL2 A;  2NRW A;  4C8L A;  2ZHA A;  4DOC A;  4AT9 B;  5J0W A;  1ZET A;  5IIJ A;  4DQP A;  4I2E A;  2F1I A;  1XU4 A;  3AQL A;  4QZC A;  2C22 A;  1ZQI A;  1NKE A;  1KLN A;  3WFO A;  3RTV A;  1RYS A;  4WC4 A;  2ALZ A;  2NRZ A;  3FDS A;  3T5H A;  7ICN A;  3C5G A;  4EYH B;  5KFZ A;  4DLE A;  2NRK A;  4YXJ A;  2UVW A;  4RWN A;  9ICI A;  4Z6E A;  1JAJ A;  1ZQE A;  5HRK A;  1JXE A;  4QWB A;  4EBJ A;  5DDY A;  4M5D A;  3C21 A;  2W9M A;  4YXM A;  1XS9 D;  7ICE A;  2XY7 A;  8ICU A;  3RBD A;  1MIW A;  3LK9 A;  2ZTC A;  4M2Y A;  3HIY A;  3RAX A;  1D9F A;  4NLN A;  5JUM A;  1COO A;  4MFF A;  3MFH A;  5KFE A;  3GV7 B;  3KHL A;  4BWJ A;  4BXO B;  4RWP A;  5KFL A;  5KT3 A;  5KT7 A;  5KFI A;  4FS1 A;  2I9G A;  5DB8 A;  4MEY A;  9ICV A;  3HJ4 A;  2DR8 A;  1IM4 A;  1ZQN A;  4KLM A;  7ICT A;  4RQ7 A;  4O3R A;  1S0M A;  4YR0 A;  2M9N A;  4UBB A;  2JEG A;  4ECU A;  5HML A;  1ZQH A;  3OVB A;  2ZH5 A;  3TI0 A;  1Z00 A;  2PI4 A;  3RH6 A;  1BPE A;  4XA5 A;  3GV8 B;  3RB6 A;  1CEZ A;  3H8S A;  2HVI A;  2ZH2 A;  2DVI A;  1ZQO A;  3ZDA A;  1KTQ A;  3UXN A;  4HYK A;  4QZ8 A;  1NJZ A;  4ECY A;  2DFL A;  4QZI A;  3GIM A;  9ICQ A;  2FLN A;  1UEU A;  1RYR A;  1JX4 A;  3JPT A;  3ETL A;  4UB1 A;  5KFW A;  1DK2 A;  4KLG A;  4RNN A;  3MGH A;  4FH3 A;  4Z6C A;  5HC9 A;  1ZQY A;  4TUS A;  4ECV A;  4K4G A;  4KLQ A;  1RXW A;  2ZJ5 A;  3GQC A;  2BQR A;  1NJW A;  2PFP A;  5J0S A;  2O5A A;  1S0O A;  3UXP A;  2FPK A;  3MDC A;  4I2B A;  3C2M A;  4DF4 A;  5KFQ A;  3TAR A;  2ASD A;  8ICH A;  3RJH A;  5HRB A;  2OWO A;  3LWL A;  5KG7 A;  2ZH6 A;  4ECS A;  8ICA A;  2DRA A;  3TFR A;  4DS5 A;  3SI8 A;  2JZB A;  3BQT A;  4TUQ A;  3GIK A;  3H4D A;  1TK8 A;  1C7Y A;  3EW9 A;  8ICJ A;  4B9L A;  4B9V A;  3LQC B;  3C23 A;  4UAY A;  2BCR A;  2R8J A;  3BJY A;  4F5R A;  4B9S A;  4I28 A;  9ICM A;  4DSJ A;  4PHA A;  4KLI A;  3SZ2 A;  5IIN A;  4UB3 A;  1S0V A;  3HWT A;  2PFN A;  5KFX A;  5DED A;  5KG3 A;  4AT9 A;  4NLG A;  2Q0Z X;  3PX0 A;  5DEC A;  3GV5 B;  4ELT A;  8ICO A;  5KFC A;  1ZJN A;  1JQR A;  4RQ0 A;  4K4H A;  1DOQ A;  5DLF A;  1SKR A;  2BPG A;  4S3N A;  8ICR A;  3BDP A;  2V4R A;  3HPO A;  4DFJ A;  2KFZ A;  4UB4 A;  2IHN A;  2H5X A;  1NKB A;  3OJU A;  4KLF A;  4J9L A;  2V9W A;  3ISB A;  3JZ0 A;  4XRH A;  5KTQ A;  5KFH A;  2PXI A;  4O3S A;  4G3I A;  8ICS A;  1BPY A;  4M9J A;  2BCU A;  3K4G A;  4UBC A;  5EOZ A;  4DOB A;  4P4P A;  4F5Q A;  2P66 A;  9ICP A;  9ICR A;  1S76 D;  2BR0 A;  3T5J A;  1Z3E B;  3B0Y A;  5KG1 A;  3G6V A;  5DQH A;  3RRH A;  5CP2 A;  4EEY A;  3THV A;  2AQ4 A;  2DPJ A;  2R8G A;  4DSK A;  5L9X A;  4MFA A;  3KHR A;  2C2R A;  1TFW A;  3RR7 A;  1UET A;  4EZ9 A;  4JUZ A;  4UAZ A;  3UPQ A;  2FLP A;  3PW4 A;  1T3N A;  1JMS A;  2PBE A;  2DRB A;  5KFB A;  1T7P A;  2BQ3 A;  1NJY A;  7ICU A;  4MEX A;  1U4B A;  5HRH A;  2HW3 A;  4XQ8 A;  1R8B A;  4XQ7 A;  2ZH7 A;  3H38 A;  1NKC A;  1BNO A;  5DLG A;  4QZD A;  1U9L A;  4DQQ A;  2KP7 A;  4F5O A;  4X0A A;  4Z6F A;  4R65 A;  1A77 A;  4RNO A;  5KFM A;  1U49 A;  4JV2 A;  9ICJ A;  4O3O A;  4WC5 A;  4YMO A;  4GC7 A;  1Q79 A;  3NYB A;  2KTQ A;  9ICC A;  9ICW A;  4DL5 A;  3WFQ E;  1ZQC A;  4P4O A;  4QZG A;  2BHN A;  4R8U B;  4Q44 A;  4RT3 A;  4ECT A;  4YMN A;  2F1J A;  5DBB A;  1ZQQ A;  1S77 D;  1HUO A;  3HW8 A;  4FHX A;  4BDP A;  3Q8Q B;  1ZJM A;  4DSE A;  3SV4 A;  1ZQL A;  4I2A A;  3GIL A;  3Q8S B;  5BOM A;  3M9M B;  4ED8 A;  1KDH A;  3AU2 A;  4J9R A;  2W9C A;  7ICR A;  2UVU A;  4Q8F A;  4DL7 A;  2J6S A;  4FHP A;  4I2I A;  4I2J A;  1IXR A;  5KFG A;  5KG6 A;  4BGD A;  1X9M A;  1BPZ A;  3OHA A;  4O0I A;  2IMW P;  2VA3 A;  2KFN A;  2ZUC A;  2V4Q A;  2BPF A;  4DLG A;  5HRF A;  3RB3 A;  1DK3 A;  3PV8 A;  1U48 A;  2MUT B;  1NK5 A;  4EBD A;  2JEI A;  3EPG A;  2F1H A;  4NXZ A;  3RJG A;  5J2F A;  4I2C A;  2M2V A;  4F4X A;  3RJF A;  4PGY A;  2HHQ A;  2M2U A;  3UQ2 A;  1MC8 A;  3UQ0 A;  2PFQ A;  4EP7 A;  4MF8 A;  2RFF A;  3PO4 A;  1L3U A;  4F2S A;  5IIM A;  4Q8E A;  5J0R A;  1MIV A;  5DB7 A;  5EWE A;  3C1Y A;  1RPL A;  1NO5 A;  3GDX A;  3QZ7 A;  2RDJ A;  3V7J A;  3JPQ A;  5IIO A;  9ICA A;  1S10 A;  3NTU A;  4R66 A;  4NM2 A;  4QWA A;  4B9M A;  9ICL A;  4BWM A;  3OSP A;  4XUS A;  1S97 A;  4ELU A;  4AT7 A;  2Q66 A;  1UA1 A;  4O5K A;  8ICY A;  4TUP A;  4FHV A;  4RQ3 A;  5J2G A;  3Q8P B;  4YVZ A;  5DG7 A;  5DQI A;  5DB6 A;  9ICF A;  4KLE A;  4UD4 A;  4RU9 A;  8ICL A;  2B21 A;  3KTQ A;  1Z00 B;  1BVS A;  2WTF A;  1KSP A;  1QSS A;  1V4A A;  2FPM A;  4J9S A;  3JPO A;  1ZYQ A;  7ICS A;  2R8I A;  3QEB Z;  5TZV A;  1ZQD A;  4RWQ A;  4X4O A;  1TK0 A;  5CA7 A;  4ED2 A;  1UA0 A;  5HP4 A;  8ICW A;  2NRT A;  3ISD A;  4WCW A;  2O1P A;  2PFO A;  3WFP A;  4F4Z A;  4R8U A;  1F5A A;  1XWL A;  4Q43 A;  1R89 A;  3HJ1 A;  3PW7 A;  1H38 A;  4IQT A;  2DR5 A;  4EBE A;  1ZQJ A;  3SV3 A;  3RR8 A;  5KFD A;  8ICV A;  4YN4 A;  3BQ1 A;  1XSN A;  3QZ8 A;  4RQ5 A;  4FS2 A;  3QEA Z;  1KFS A;  4IRD A;  8ICF A;  1OU5 A;  4KLD A;  4PGQ A;  4EZ6 A;  4FHY A;  7ICF A;  4QZE A;  1XSL A;  2J6T A;  3RB0 A;  4UD5 A;  4IQV A;  3AU6 A;  4IG8 A;  4F8R A;  1K1S A;  3G6Y A;  4FH5 A;  3Q8K A;  2NRV A;  3E2E A;  1JXL A;  4WC0 A;  3T5L A;  5J2K A;  2Y1I A;  2AQ0 A;  3PX4 A;  1NK9 A;  1PX5 A;  2FMP A;  4E80 A;  5L1I A;  2XC9 A;  5J2E A;  3RAQ A;  5KG5 A;  4YP3 A;  5J2I A;  4CCH A;  9ICE A;  8ICZ A;  3C66 A;  1VFG A;  4O5C A;  1KNY A;  3T5K A;  5DGA A;  3KHH A;  5IIL A;  4O3Q A;  1TK5 A;  2JEF A;  4I2G A;  3AUO A;  4E0D A;  2ID1 A;  4RQ4 A;  4ED3 A;  4QZH A;  1N48 A;  9ICT A;  4KLT A;  2DR7 A;  3EZ5 A;  4ED7 A;  2MAX A;  4DSI A;  3H3A A;  4RPX A;  4DOA A;  4EBK A;  1HUZ A;  4YFK A;  4QZA A;  3TFS A;  5DBA A;  4O3N A;  4DF8 A;  1MQ3 A;  5DBC A;  8ICI A;  4M04 A;  3GII A;  1SKS A;  4ECQ A;  3JYY A;  3V7L A;  4JWN A;  4J9M A;  3Q8R B;  3OSN A;  4DQS A;  1L3V A;  4NKT A;  2ZTE A;  9ICS A;  5KFN A;  5L1K A;  4M6W A;  1L3T A;  4DS4 A;  2DPI A;  7ICI A;  3OUY B;  3MR3 A;  4KLH A;  7ICO A;  4X4U A;  2ZJ8 A;  4C8N A;  4QWC A;  3MBY A;  4M9L A;  3WFS C;  2DR9 A;  1SKW A;  4O5E A;  1R8A A;  2BCV A;  5KFK A;  4J9P A;  2ZUB A;  2FLL A;  4F93 B;  9ICG A;  4IR9 A;  1K1Q A; 
#chains in the Genus database with same CATH topology
 3H7I A;  3HT3 A;  4J9N A;  2KHV A;  3I76 A;  1WCN A;  5F9N A;  4C8M A;  1FFV A;  1PK1 B;  3PSI A;  4DL6 A;  3EWA A;  2D8C A;  2XCP A;  1KW4 A;  2HHU A;  4FZM A;  3QU4 A;  3Q8L A;  3PW5 A;  2XGP A;  2EZX A;  4U6P A;  1TFR A;  4ECW A;  1FO4 A;  3WFR E;  2K4H A;  4C8O A;  5KG4 A;  1QLN A;  2UVR A;  5III A;  4WC6 A;  4NLK A;  4YR3 A;  4AT8 B;  5BOL A;  2BZF A;  1L5U A;  7ICP A;  2W3S A;  4UQG A;  1L8L A;  5L1M A;  2JZB B;  4F5P A;  5KFO A;  3PVX A;  4OJ6 A;  1HIW A;  3KZI U;  4F92 B;  5HHH A;  4R64 A;  4FZL A;  3KHG A;  4PH5 A;  5J2A A;  4NL9 C;  3RJK A;  4JK1 A;  1WG8 A;  1ZRM A;  2LPE A;  3NUQ A;  4RQ6 A;  1T4G A;  2W9B B;  1NZB A;  3EYZ A;  2IOF A;  1K5O A;  3QE9 Y;  3RBE A;  2FDR A;  4RUA A;  3AQN A;  3B0X A;  4NM1 A;  2HBL A;  2OHF A;  2W3R A;  1WCL A;  3A0H U;  4KN7 A;  3CK6 A;  5AKH A;  3NAS A;  4K97 A;  2H3I A;  1ZQW A;  3OGU A;  2DBY A;  3PR4 A;  5J0U A;  4O9M A;  2F76 X;  3D2S A;  3H8W A;  2VAN A;  4R63 A;  4WC7 A;  9ICN A;  4NKU A;  2W8L A;  3QU5 A;  3RJE A;  4AP9 A;  1BNP A;  3AMZ A;  2VKQ A;  3ZD8 A;  3C18 A;  1D8L A;  1PZN A;  2A1A A;  4CF3 A;  2KZ3 A;  4TQR A;  4DEZ A;  5DKW A;  2EQY A;  2YQE A;  2BCS A;  4KLO A;  4LEY A;  1R8C A;  1D9D A;  3K75 D;  2UVV A;  5HR9 A;  3KBB A;  2ISO A;  2XY5 A;  2E8M A;  1ZD5 A;  5KFR A;  4PPX A;  4F91 B;  2K8B B;  5DDM A;  3PNC A;  4M9G A;  2ZG6 A;  4WBZ A;  5CFS A;  1TFY A;  3SAF A;  1KKX A;  4DL4 A;  5J0X A;  5DB9 A;  5CR0 A;  4RT2 A;  3ORY A;  3PW2 A;  2AGQ A;  1ZQR A;  5HHI A;  2ZIX A;  4C4R A;  1LB2 B;  1QSY A;  2IHM A;  4X0B A;  2K60 A;  5ALI A;  4OAH A;  4KM5 A;  4M9H A;  5CB1 A;  1L7N A;  3NVW A;  2HHT A;  4OAI Z;  4QW9 A;  5ALZ A;  4F4Y A;  2JEJ A;  4DFK A;  4WOY A;  5B3P A;  4M0A A;  8ICP A;  5T14 A;  4X4N A;  4AT9 B;  3WU2 U;  3HX0 A;  4KLJ A;  1S5L U;  4Q45 A;  7ICH A;  9ICU A;  4X4R A;  1VDV A;  2ZJA A;  1MQ2 A;  3AQE A;  1KFT A;  5DG9 A;  4J03 A;  2GOL A;  4QZB A;  3EPI A;  2LM1 A;  1D8B A;  3GZF A;  2Y0S C;  3CRX A;  2K89 A;  2VJ5 A;  5CEH A;  2HHW A;  4K4I A;  3RJJ A;  1ZQA A;  1BPX A;  4OCZ A;  4MF2 A;  1ED1 A;  3MDA A;  4IR1 A;  1J2M A;  4NXU A;  7ICV A;  2E8N A;  1PVR A;  4X4S A;  3AN1 A;  1MA7 A;  3WKD A;  3MFI A;  4JMU A;  4PHE A;  2P6R A;  2G5I B;  5HRD A;  1CUK A;  5DGB A;  2LMR A;  1CRX A;  2NYV A;  1SL2 A;  2NRW A;  4DOC A;  3SEI A;  4DQP A;  5AI8 A;  4I2E A;  3QUC A;  1OW5 A;  1KLN A;  3RTV A;  2QAR A;  5KFZ A;  2HSZ A;  4YXJ A;  4RWN A;  9ICI A;  4QWB A;  3ZI4 A;  4EBJ A;  1Q8K A;  5DDY A;  7ICE A;  3ERC C;  2ZTC A;  3RAX A;  4NXX A;  1COO A;  3MFH A;  4RWP A;  2HI0 A;  9ICV A;  5KT7 A;  3H8M A;  3H0L B;  1RQN A;  4GFJ A;  2JEG A;  5HML A;  1M6Y A;  3SAG A;  3RH6 A;  1CEZ A;  3H8S A;  1ZQO A;  3UXN A;  4NXW A;  2W03 A;  4QZ8 A;  2KV2 A;  2DFL A;  3GIM A;  3HKZ F;  1X6I A;  4Y2T A;  2OM6 A;  4LJX A;  4FH3 A;  4Z6C A;  4ECV A;  4K4G A;  4KLQ A;  2H3V A;  2YMM A;  2BQR A;  1ZOL A;  1NJW A;  1S0O A;  3C2M A;  4DF4 A;  2ASD A;  3TAR A;  2GAF D;  8ICH A;  2AHO B;  3LWL A;  3VC8 A;  4KX3 A;  2RHF A;  8ICI A;  2JZB A;  3BQT A;  1RM6 C;  3GIK A;  4Y2V A;  2BCR A;  2O6K A;  4I28 A;  4DSJ A;  5ALL A;  2KG5 A;  4BUG A;  4RQN A;  2LBO A;  2DKX A;  5KFX A;  4AT9 A;  4NLG A;  5DEC A;  8ICO A;  5KFC A;  2KNJ A;  4K4H A;  4DCC A;  1X40 A;  8ICR A;  3BDP A;  3DDH A;  1NKB A;  3OJU A;  2B6G A;  1J2N A;  2PXI A;  4G3I A;  1F5S A;  9ICR A;  4F5Q A;  1L3V A;  5AKX A;  2DPJ A;  1PK1 A;  1TFW A;  1UET A;  3PW4 A;  2BQ3 A;  1NJY A;  5HRH A;  1V97 A;  1COK A;  3S6J A;  5DLG A;  1ECW A;  4F5O A;  4R65 A;  5AIA A;  3O0F A;  1N2X A;  4YMO A;  3NYB A;  9ICC A;  4P4O A;  4EEB A;  4RT3 A;  2F1J A;  1S77 D;  4FHX A;  3Q8Q B;  2Y9U A;  3C29 A;  1MN8 A;  4I2I A;  1O03 A;  2AXT U;  2VA3 A;  4CRX A;  4A8E A;  3RB3 A;  2MUT B;  4G9B A;  3RJG A;  4F4X A;  2G0A A;  4PGY A;  2PFQ A;  3PO4 A;  2HN2 A;  5DB7 A;  5EWE A;  2W43 A;  5AKE A;  2QKQ A;  5ALG A;  5AKJ A;  1S97 A;  2KSO A;  4FHV A;  4RQ3 A;  5J2G A;  5DQI A;  4UD4 A;  1SIJ A;  1V4A A;  1QSS A;  4OJL A;  1ZQD A;  4RWQ A;  4ED2 A;  3M6K A;  2OEH A;  2O1P A;  2H3Z A;  2K4I A;  4Q43 A;  3HJ1 A;  3PHZ A;  4IQT A;  2DR5 A;  8ICV A;  5ALR A;  4IRD A;  4P0P B;  5H2F U;  1OU5 A;  4PGQ A;  3N28 A;  7ICF A;  2VIX A;  3RB0 A;  1L7P A;  2WF5 A;  3FC4 A;  4FH5 A;  5D62 A;  5ALH A;  3KKA C;  1JXL A;  3T5L A;  1L6N A;  2Y1I A;  2WB1 C;  1NK9 A;  3M6Z A;  4E80 A;  1JRO A;  3AL0 B;  2BBJ A;  2XC9 A;  5J2E A;  3RAQ A;  5F3X B;  4YP3 A;  4Y2U A;  1VFG A;  4O5C A;  1KNY A;  5ALE A;  1A0P A;  3FAH A;  4C80 A;  4I2G A;  2ID1 A;  3EF2 A;  1JUD A;  4QZH A;  4KLT A;  3EZ5 A;  4KB6 A;  2DGZ A;  1N63 A;  2EH9 A;  4F72 A;  3OUY B;  3GU3 A;  4C8N A;  1SKW A;  4AT8 A;  1VJ7 A;  4RPY A;  1EXN A;  3G6X A;  7ICM A;  5B66 U;  2HMX A;  3QUB A;  3C2L A;  4K8V A;  3D2Q A;  4Y2Q A;  2IOF K;  3ISC A;  4DFP A;  4FO1 A;  3ZDB A;  2FJ6 A;  2HOF A;  3AQK A;  4NXT A;  4WC2 A;  2LYH A;  2NV3 A;  3WK9 A;  4N7R A;  2MUT A;  4UAW A;  2MA1 A;  4YR2 A;  4KTQ A;  3SQI A;  1P7D A;  3QU9 A;  1URJ A;  4NLZ A;  4OAG A;  1J97 A;  1FFU A;  5GTI U;  4M6W B;  2K4E A;  4O3P A;  2ZXH A;  2PMZ F;  3PW0 A;  4RQ8 A;  5D46 A;  4RPZ A;  5J0T A;  1FEZ A;  4FBT A;  2JRZ A;  4KIT B;  3FM9 A;  2ZH4 A;  1QTM A;  5ALV A;  1ZQF A;  3MAB A;  8ICQ A;  2ZIX B;  3EUB 2;  5AK3 A;  5HMM A;  4DWI A;  3GIJ A;  2PI5 A;  4DQI A;  2OYY A;  3PML A;  4YQW A;  5AI6 A;  1RZT A;  4NY8 A;  2C2D A;  5D63 A;  4WQL A;  3I1Y A;  1N61 A;  5K4L A;  2R8K A;  5AKI A;  4EED A;  3WKA A;  4MFC A;  2BE3 A;  2YMQ A;  2AU0 A;  7ICK A;  1ZQ1 C;  4EX7 A;  4WJ3 B;  5D49 A;  2HHP A;  2KJ8 A;  2BCQ A;  5FP0 A;  5KFA A;  3C2K A;  5D4B A;  2ES6 A;  4FBU A;  1B0X A;  1NK0 A;  1PVP A;  4YCX A;  4M9N A;  4IRC A;  1ZQS A;  3SR6 A;  4F3O A;  3ZDE A;  3A0B U;  1ZQU A;  2N1R A;  5J2B A;  1KFD A;  1QSL A;  4GIB A;  2KHQ A;  3HRD D;  4NJ8 A;  3N4M B;  4DSL A;  1B22 A;  4J9K A;  2LKY A;  5HRE A;  1L7M A;  2YN4 A;  1CI4 A;  4LZD A;  4C7Z A;  4Y2Y A;  5KNI A;  4KLS A;  4FFD A;  2W9C B;  1YZ6 A;  1U47 A;  2ATL A;  4UB2 A;  4ZOH C;  4I2H A;  3H37 A;  2G5H B;  2WFA A;  4DO9 A;  1TKD A;  2KVC A;  3OUY A;  4LZG A;  5KL1 B;  4C0Z A;  2AGP A;  2IBK A;  5HRG A;  4EEL A;  1TE2 A;  3IV6 A;  2EWR A;  3H40 A;  2WB1 F;  2I1Q A;  4E7X A;  4C7Y A;  1RXV A;  1HJP A;  2JH7 A;  3SEN A;  3RF9 A;  4I29 A;  4Y2R A;  4WH5 A;  2KZM A;  2C28 A;  8ICT A;  2BDP A;  3PSF A;  4UW9 A;  3JPN A;  1UHU A;  4BX9 C;  2NRX A;  1SWV A;  3QNM A;  3M1Y A;  1NK7 A;  3JPS A;  5EE1 A;  2HHS A;  1SWW A;  3BS5 A;  1KEJ A;  1UT5 A;  3N7P D;  3V6J A;  2W9B A;  1KRP A;  2R8H A;  2GWS A;  1KQQ A;  4B6J A;  2HHX A;  3BS5 B;  3UXO A;  5ALP A;  4GLX A;  1V38 A;  5JTI A;  3LWM A;  4TUR A;  3PY8 A;  3RRG A;  4ATB B;  5HR7 A;  2M2T A;  1XC9 A;  8ICG A;  1S9F A;  4JV0 A;  3M8S A;  5CHG A;  4C8K A;  3E0F A;  4EEN A;  1QQ6 A;  1PUZ A;  5KT4 A;  4NXV A;  4NLB A;  5EWF A;  1FIQ A;  2W55 A;  4PHP A;  5KFP A;  1TAQ A;  4B9U A;  2W9A A;  4J9Q A;  2ZHA A;  2B56 A;  1ZET A;  1XU4 A;  2G06 A;  3DEE A;  3AQL A;  2LHT A;  1ZQI A;  1Z19 A;  3WFO A;  4WC4 A;  2ALZ A;  4Z6E A;  5HRK A;  2KVS A;  5AKZ A;  4CE6 A;  2W9M A;  4M5D A;  2IHO A;  3K7D A;  3RBD A;  1MIW A;  3LK9 A;  5JUM A;  5AM4 A;  3KHL A;  4BXO B;  2CRX A;  2ZIU B;  5KT3 A;  2YX8 A;  2I9G A;  2DR8 A;  3PZP A;  1ZQN A;  4RQ7 A;  5ALD A;  4O3R A;  1ZQH A;  3TI0 A;  1JAL A;  1BPE A;  2DVI A;  3ZDA A;  4UB6 U;  2KE7 A;  4QZI A;  2F2A B;  1UEU A;  1RYR A;  3J81 j;  4KLG A;  4PZN A;  4RNN A;  2ZJ5 A;  2EZZ A;  5ALM A;  2OWO A;  4ECS A;  2DRA A;  5KL8 B;  4DS5 A;  1ZRN A;  4B9V A;  2DQN B;  1RDF A;  3C23 A;  4UAY A;  9ICM A;  2MSN A;  4F5R A;  4PHA A;  3SZ2 A;  5IIN A;  3CW2 C;  4K96 A;  3HWT A;  2PFN A;  3PX0 A;  1JQR A;  2F44 A;  3ER9 B;  2I6X A;  3KFU F;  4UB4 A;  4J9L A;  4XRH A;  5KTQ A;  4O3S A;  1BPY A;  5E79 U;  2P66 A;  1Z3E B;  2EAM A;  3G6V A;  5L9X A;  3KHR A;  4JUZ A;  1JMS A;  2PBE A;  2ZH7 A;  1R8B A;  3NVY A;  2F8K A;  4Y2S A;  4K9B A;  1PK3 A;  4X0A A;  4P0P A;  4O3O A;  1ZQC A;  3SAH A;  4R8U B;  4ECT A;  2QAR B;  4RQM A;  4YMN A;  1ZQQ A;  3HW8 A;  2DUY A;  3ALR A;  4I2J A;  1IXR A;  4BGD A;  1BPZ A;  2KFN A;  4O0I A;  4DLG A;  1DK3 A;  3PV8 A;  1U48 A;  1RQL A;  2HHQ A;  2E5S A;  4F2S A;  5J0R A;  1DRG A;  3F5E A;  3C1Y A;  1RPL A;  2H3Q A;  4PL1 A;  1NO5 A;  2RDJ A;  3V7J A;  3D6J A;  1GO3 F;  4NM2 A;  2K4P A;  2P35 A;  4QWA A;  9ICL A;  5AI4 A;  3CYM A;  4O5K A;  4O67 A;  5AM1 A;  3KKA A;  4TUP A;  3Q8P B;  9ICF A;  5DB6 A;  3KTQ A;  2L5Y A;  3ER8 C;  2BDU A;  2ZXI A;  4J9S A;  2DKZ A;  2Y0S F;  7ICS A;  4JLX A;  4O69 A;  1UA0 A;  4DFD A;  3ISD A;  4WCW A;  2OH2 A;  4FZN A;  4F4Z A;  2BBH A;  1H38 A;  1ZQJ A;  1X66 A;  5KFD A;  4YN4 A;  3BQ1 A;  4P0Q A;  4U7C A;  5CRX A;  2ZIU A;  1HEK A;  4KLD A;  1ZD3 A;  4ACO A;  4QZE A;  1XSL A;  2J6T A;  4UD5 A;  4OJ5 A;  4F8R A;  3G6Y A;  3WK5 A;  2W11 A;  5J2K A;  5AHX A;  3NVZ A;  1PX5 A;  5L1I A;  2WAQ F;  3DV9 A;  3C66 A;  5J2I A;  4C4T A;  4Y2X A;  1TK5 A;  4O3Q A;  1IIP A;  3AUO A;  4US9 A;  5AI9 A;  4ED3 A;  3NWI A;  4DSI A;  2MAX A;  4EBK A;  4RPX A;  1HUZ A;  2K8A A;  3TFS A;  5DBA A;  4O3N A;  4CDG A;  4QJF B;  3Q8R B;  4DQS A;  4K99 A;  1L7O A;  1DXS A;  3KOO A;  2YTU A;  4DS4 A;  2DPI A;  3MR3 A;  4KLH A;  3MBY A;  3L3F X;  1QQ5 A;  5KAI U;  4O5E A;  1R8A A;  4J9P A;  2ZUB A;  1VLB A;  5GTH U;  3F5A A;  2JH1 A;  4B9T A;  4KMU A;  9ICX A;  4QIW F;  4IQU A;  2ZH9 A;  8ICE A;  2XGQ A;  5C0Y A;  1SZP A;  4CGZ A;  1Q3V A;  4I2F A;  1O08 A;  2AJQ A;  5L1L A;  1RYU A;  3TQ1 A;  2QB1 A;  3C1Z A;  5J0O A;  2KN7 A;  4GXJ A;  3QXG A;  3GFK B;  4X4T A;  4ED0 A;  1JIH A;  2HDO A;  1YLQ A;  2JV3 A;  4BJQ A;  5KFF A;  5J2H A;  3N97 B;  3F2D A;  5KFT A;  4GXK A;  2KIC A;  2HCF A;  2KSO B;  4UB8 U;  1WWV A;  2IUB A;  1ZD4 A;  3WK4 A;  1A76 A;  4IRK A;  2A1J B;  2B4V A;  4IQW A;  1RG6 A;  2XY6 A;  4X4Q A;  7ICG A;  2BPC A;  2ZHB A;  1N62 A;  5J0Y A;  1JI7 A;  5EWG A;  5IIK A;  2EAO A;  4F50 A;  4YD1 A;  1DGS A;  2RDI A;  2ASL A;  3MR6 A;  4RZR A;  5J0P A;  2ZTD A;  1V9P A;  1ZQT A;  1IG6 A;  2RQ5 A;  5G5G A;  1QQ7 A;  1MSW D;  4WQK A;  3LVW A;  4O6A A;  2PKE A;  2IA6 A;  4EX6 A;  2KJ9 A;  3C28 A;  3M9N B;  1D8Y A;  2FI1 A;  4DQR A;  2JHD A;  4I0U A;  3F2C A;  4K9A A;  4ELV A;  3WKC A;  1UQV A;  4LVS A;  1UT8 A;  1ZQX A;  1L3S A;  4F2R A;  5ALW A;  1NNL A;  2ZIW A;  3B9J A;  3PR5 B;  3BQ0 A;  4FHW A;  4DSF A;  5KFY A;  3M8R A;  4RQ1 A;  1T8E A;  4P2H A;  4UAU A;  4KN4 A;  4F71 A;  5J2J A;  2KKV A;  4F4W A;  3Q8M A;  5KG0 A;  3LDA A;  3H4B A;  2YY6 A;  2XID A;  2KZZ A;  2KIW A;  3PSP A;  4JV1 A;  5F9L A;  2W8K A;  2VA8 A;  1ZQP A;  1WYG A;  2FMS A;  1F5A A;  5DQG A;  5KG2 A;  3BZK A;  4DL2 A;  4ECX A;  3IRU A;  4UAS A;  3H39 A;  3TAQ A;  4X4P A;  2DF4 B;  4I2D A;  3HIL A;  1MIY A;  5AI0 A;  4GC6 A;  2DWQ A;  1U45 A;  4F4K A;  3RH5 A;  2GLE A;  3M7D A;  1TAU A;  2FCL A;  2D3D A;  1F44 A;  2ESE A;  2E8O A;  5HNK A;  2HHV A;  2ZH8 A;  1B4F A;  4IL6 U;  3RB4 A;  3IN5 A;  2FMQ A;  4QZF A;  4PJ0 U;  4ECR A;  4QWE A;  3MR2 A;  1WOT A;  2RLT A;  5J0Q A;  4ED1 A;  4FO6 A;  5KFV A;  2VA2 A;  4C4S A;  3SMV A;  2W04 A;  3MGV A;  3IP4 B;  5ALT A;  4WC3 A;  5JU5 A;  4LT6 A;  3PX6 A;  4QZ9 A;  3JPP A;  5CJ7 A;  1Z4N A;  1X9X A;  2WHE A;  3ICX A;  5G5H A;  3RH4 A;  3AM9 A;  4LEV A;  4FE3 A;  5KT5 A;  4I27 A;  5AK5 A;  4XJE A;  5L1J A;  5KAF U;  4PGX A;  3QYP A;  8ICK A;  2H3F A;  9ICO A;  1X2I A;  4YG2 A;  5ALX A;  4TQS A;  4KLL A;  2W7O A;  2J6U A;  1PVQ A;  4AYB C;  5C5J A;  4ED6 A;  1ZQB A;  1ZQG A;  3UPS A;  2C2E A;  2XIC A;  3ZD9 A;  3F53 A;  1BGX T;  2JXJ A;  1NK8 A;  4C8L A;  4NWI A;  5IIJ A;  2F1I A;  4QZC A;  1NKE A;  2NRZ A;  3T5H A;  3C5G A;  4EYH B;  1JRP A;  2NRK A;  1JAJ A;  1JXE A;  2HBK A;  2LYA A;  8ICU A;  4EGW A;  4USA A;  2GA9 D;  4MFF A;  5KFE A;  3GV7 B;  1N5X A;  4BWJ A;  5KFL A;  5KFI A;  5DB8 A;  2KJ5 A;  1IM4 A;  7ICT A;  5ALJ A;  2OCE A;  1ZXI A;  1Z00 A;  4XA5 A;  3IG5 A;  2KIV A;  1KTQ A;  4ECY A;  3LVV A;  9ICQ A;  2FLN A;  3NRZ A;  1JX4 A;  3ETL A;  5KFW A;  3MGH A;  1ZQY A;  2OXO A;  4TUS A;  1RXW A;  3GQC A;  5AKG A;  2O5A A;  4CF5 A;  3UXP A;  3MDC A;  4UAT A;  3RJH A;  2ZH6 A;  5KG7 A;  5AM5 A;  3TFR A;  3SI8 A;  3H4D A;  3LQC B;  4QNL A;  2GH1 A;  4B9S A;  1VJ5 A;  3BJY A;  2R8J A;  4KLI A;  4UB3 A;  2EZY A;  1OXJ A;  5DED A;  5KG3 A;  4IS7 A;  4ELT A;  1Z1B A;  4RQ0 A;  4S3N A;  5ALY A;  3TAD C;  2V4R A;  3HPO A;  4DFJ A;  4AYB F;  2D6F C;  1SV0 A;  2V9W A;  3ISB A;  3JZ0 A;  8ICS A;  5AKY A;  4M9J A;  3K4G A;  4DOB A;  4P4P A;  9ICP A;  1S76 D;  5AIB A;  4MKP A;  3T5J A;  3RRH A;  4NV0 A;  5KG1 A;  2AQ4 A;  5CP2 A;  3THV A;  4EEY A;  2R8G A;  2ZH2 A;  3BZC A;  4MFA A;  5AM0 A;  4MHV A;  3TAC B;  3UPQ A;  2HBJ A;  2Y9T A;  7ICU A;  5JRT A;  1U9L A;  4HAI A;  1U49 A;  4JV2 A;  9ICJ A;  2LM4 A;  4DL5 A;  4OJP A;  4QZG A;  2BHN A;  1HUO A;  5ALQ A;  5CHE A;  4BDP A;  4IC9 A;  1ZJM A;  2W7P A;  1ZQL A;  4I2A A;  3GIL A;  5BOM A;  3M9M B;  3AU2 A;  4J9R A;  2UVU A;  4Q8F A;  4DL7 A;  4FHP A;  1SXE A;  5KFG A;  1X9M A;  2IMW P;  3OHA A;  2WF9 A;  2BPF A;  5HRF A;  2JEI A;  3EPG A;  4I2C A;  5J2F A;  4K98 A;  3RJF A;  2M2U A;  2RFF A;  1LVH A;  5IIM A;  5EE9 A;  3KD3 A;  4OD0 A;  2JMG A;  5IIO A;  9ICA A;  3NTU A;  3OSP A;  4ELU A;  2Q66 A;  2B0C A;  1UA1 A;  2EAN A;  1YZ7 A;  4YVZ A;  1IV8 A;  8ICL A;  2B21 A;  1WUD A;  2WTF A;  2HBM A;  5EE0 A;  3JPO A;  3QEB Z;  1L8O A;  2XVT A;  3IG8 A;  1TK0 A;  5CA7 A;  5HR6 A;  5HP4 A;  2PFO A;  3WFP A;  4R8U A;  1XWL A;  1R89 A;  3PW7 A;  4EBE A;  1WWU A;  2PMZ C;  3SV3 A;  3RR8 A;  4KMO B;  1XSN A;  4EZ6 A;  2A19 A;  3AU6 A;  3HJE A;  4IG8 A;  1K1S A;  3Q8K A;  2NRV A;  2A3V A;  3E2E A;  3PX4 A;  2FMP A;  2R18 A;  9ICE A;  8ICZ A;  3D2N A;  5KG5 A;  1C20 A;  3OPX A;  1N48 A;  9ICT A;  3MCR A;  2DR7 A;  4DOA A;  4YFK A;  3QX7 A;  4DF8 A;  1MQ3 A;  4M04 A;  3GII A;  1SKS A;  4ECQ A;  4JWN A;  4J9M A;  1KL9 A;  2ZTE A;  2AH5 A;  5KFN A;  5L1K A;  1X42 A;  7ICI A;  2ZJ8 A;  4QWC A;  3WFS C;  2LYB A;  1OUQ A;  2DR9 A;  1X6J A;  2BCV A;  2FLL A;  9ICG A;  4IR9 A;  1QCK A;  1K1Q A;  1LKY A;  3ED5 A;  3OVA A;  3IDW A;  4JLZ A;  1S0N A;  1NK6 A;  4KLU A;  4WC1 A;  1NOM A;  4WBY A;  2Y1J A;  1LKY B;  1SB3 C;  1AQ6 A;  4YD2 A;  4HX0 A;  4NLC A;  5TIS U;  4JB3 A;  4QWD A;  4ZH4 A;  1XNS A;  4UAR A;  2ZUD A;  5B3Q A;  2ZIV B;  3IHQ B;  1ZQK A;  1XO1 A;  3TAN A;  3V6H A;  3AEV A;  2ASJ A;  3JPR A;  4GXI A;  1QH9 A;  1JN3 A;  2YB1 A;  3UMB A;  3TAD A;  4PHD A;  4Z6D A;  3K1R B;  1SL1 A;  4DFM A;  4UAV A;  4LEZ A;  9ICH A;  3WK7 A;  4CF4 A;  7ICL A;  2CXY A;  3L9D A;  2ISP A;  5CWR A;  4DL3 A;  5KT2 A;  2XI9 A;  5HRI A;  3OJS A;  5EE3 A;  3R9K A;  2NO4 A;  4RUC A;  4O68 A;  1TV9 A;  8ICX A;  5BPC A;  3H8J A;  2HVH A;  2HOI A;  5KT6 A;  2JGA A;  5KFS A;  2XO7 A;  3TAP A;  3RJI A;  5ALK A;  5HRL A;  2MU2 A;  8ICC A;  1B43 A;  2P6U A;  3T3F A;  3OWG A;  1XSP A;  1SZH A;  3PMN A;  2AGO A;  2E8P A;  1ZD2 P;  1N56 A;  4ICA A;  4LEW A;  1FA0 A;  3BQ7 A;  3OV7 A;  3WKB A;  4ECZ A;  3N7R C;  3MR5 A;  1BPD A;  2G07 A;  3OHB A;  2E3T A;  3BS7 A;  3OVS A;  4YMM A;  5AM2 A;  4UB5 A;  5ALF A;  3V7K A;  1ARO P;  3HP6 A;  3FYH A;  1NZP A;  3LYS A;  1T94 A;  1ZQM A;  5AM3 A;  2M0N A;  8ICM A;  9ICB A;  5A0L A;  1Z1V A;  1V85 A;  2BGW A;  3VCB A;  5AIC A;  7ICQ A;  3IM1 A;  2EDU A;  2HOQ A;  3C5F A;  2Q4T A;  3V6K A;  4RWO A;  4QW8 A;  2KOB A;  4X5V A;  5J29 A;  3SYZ A;  3QU2 A;  3NGD A;  5KFJ A;  1Z4O A;  1NK4 A;  3H0R B;  2G09 A;  9ICK A;  2RRD A;  3SD7 A;  4RNM A;  8ICN A;  4M47 A;  1LV5 A;  3ZDC A;  4PZO A;  4F5N A;  3F2B A;  1BPB A;  4P4M A;  2NO5 A;  3WKE A;  5DG8 A;  7ICJ A;  4RQ2 A;  4J9O A;  1ZQZ A;  2BKE A;  2JR5 A;  3V72 A;  5J2C A;  5D61 A;  3M9O B;  2M2W A;  2A1J A;  1UEV A;  1X9W A;  4ATB A;  2FPL A;  3BQ2 A;  2RP5 A;  2DL0 A;  4EYI B;  4EBC A;  3H0M B;  1SL0 A;  2BQU A;  3N7S C;  3ZDD A;  2F77 X;  4BXO A;  5AKK A;  4X4V A;  2WAQ C;  4JWM A;  2WF6 A;  2ZH1 A;  3KZX A;  3CNH A;  1Q78 A;  1TVA A;  3UM9 A;  3PO5 A;  1NJX A;  3HKZ C;  3MGI A;  1Y88 A;  2XCA A;  3NRW A;  1A6S A;  8ICB A;  2YB4 A;  5KFU A;  2F8L A;  2ZH3 A;  1X9S A;  4NL9 A;  4B9N A;  3QU7 A;  1YT3 A;  1SV4 A;  1KN5 A;  3U26 A;  1UCV A;  1ZQV A;  1SV0 C;  4AT7 B;  3AQM A;  5J2D A;  2CPR A;  4QIW C;  5J0W A;  5AKL A;  2C22 A;  1RYS A;  3FDS A;  7ICN A;  4DLE A;  2KKP A;  2UVW A;  1ZQE A;  4CNQ A;  4E8F A;  3C21 A;  4YXM A;  1XS9 D;  2XY7 A;  4M2Y A;  3HIY A;  4KX5 A;  1D9F A;  4NLN A;  4FS1 A;  5F2V O;  4MEY A;  3HJ4 A;  4KLM A;  1S0M A;  3L4P A;  2M9N A;  4YR0 A;  4UBB A;  4ECU A;  3OVB A;  2ZH5 A;  1UPH A;  2PI4 A;  3GV8 B;  2FE9 A;  3RB6 A;  2HVI A;  3ETR A;  4HYK A;  1NJZ A;  3JPT A;  2CN1 A;  4UB1 A;  1DK2 A;  2IOH A;  4O3M A;  2VJ4 A;  5HC9 A;  3AQF A;  3K1Z A;  3NKU A;  1F0M A;  3UMG A;  2PFP A;  5J0S A;  3NVO A;  2FPK A;  5HRB A;  4I2B A;  5KFQ A;  3JCF A;  8ICA A;  1C7Y A;  2ODG A;  1TK8 A;  4TUQ A;  3EW9 A;  8ICJ A;  4B9L A;  5ALU A;  5AK6 A;  3QUQ A;  5AI5 A;  3PST A;  3CP8 A;  1S0V A;  3T79 A;  1KBU A;  2YMP A;  3I28 A;  2Q0Z X;  4US8 A;  3GV5 B;  4EV6 A;  1ZJN A;  2MRL A;  1DOQ A;  5DLF A;  1SKR A;  5ALO A;  2BPG A;  3UMC A;  2KEY A;  2KFZ A;  2K8C B;  2H5X A;  2KK0 A;  2IHN A;  3RFA A;  4KLF A;  5KFH A;  1GPJ A;  2BCU A;  2QB0 A;  4UBC A;  5EOZ A;  2LI6 A;  2BR0 A;  1T3Q A;  3B0Y A;  5DQH A;  4OO1 J;  1N60 A;  1SXD A;  4DSK A;  3OTQ A;  2I5H A;  2C2R A;  3RR7 A;  4EZ9 A;  5B5E U;  4UAZ A;  3NVV A;  2FLP A;  1T3N A;  2DRB A;  5KFB A;  1T7P A;  4MEX A;  1U4B A;  2HW3 A;  4XQ8 A;  3H38 A;  1NKC A;  1BNO A;  4QZD A;  5ALS A;  4DQQ A;  2KP7 A;  4Z6F A;  1A77 A;  4RNO A;  1N5W A;  5AK4 A;  5KFM A;  2Z7J A;  1Q3U A;  1XO0 A;  4WC5 A;  4GC7 A;  1Q79 A;  2KTQ A;  9ICW A;  3WFQ E;  2ZIW B;  5ALN A;  4Q44 A;  2WF7 A;  2KMD A;  5DBB A;  2E1F A;  1DGJ A;  3SV4 A;  4DSE A;  3Q8S B;  4ED8 A;  1KDH A;  5J8Y A;  7ICR A;  2W9C A;  2J6S A;  4OAF A;  2QB0 B;  5KG6 A;  1NI3 A;  2ZUC A;  3E58 A;  2V4Q A;  1NK5 A;  2F3N A;  4EBD A;  2M2V A;  2F1H A;  4NXZ A;  1Q46 A;  3NS1 A;  3UQ2 A;  1MC8 A;  3UQ0 A;  4EP7 A;  4MF8 A;  1L3U A;  3TKA A;  2GO7 A;  4Q8E A;  5J8Y C;  1MIV A;  4Y2P A;  3GDX A;  3QZ7 A;  3JPQ A;  1S10 A;  4R66 A;  4B9M A;  4BWM A;  4XUS A;  4AT7 A;  3WK6 A;  8ICY A;  2KD1 A;  5DG7 A;  5CFU A;  2YML A;  4KLE A;  4RU9 A;  2HN1 A;  1Z00 B;  1BVS A;  1KSP A;  3L5K A;  2FPM A;  3QUT A;  1ZYQ A;  2R8I A;  4X4O A;  5TZV A;  8ICW A;  2NRT A;  1S8O A;  2G08 A;  4EEK A;  5JTG A;  3QZ8 A;  4RQ5 A;  4FS2 A;  3QEA Z;  1KFS A;  8ICF A;  2QLT A;  4FHY A;  4IQV A;  2EAP A;  4WC0 A;  2B51 A;  2AQ0 A;  4PL2 A;  2ZIV A;  4CCH A;  1SGG A;  2E1E A;  3MC1 A;  3ONN A;  3T5K A;  5DGA A;  3KHH A;  5IIL A;  2JEF A;  4XQ7 A;  4E0D A;  4RQ4 A;  4ED7 A;  3H3A A;  4QZA A;  5CFT A;  4Y2J A;  5DBC A;  1TAM A;  3JYY A;  3V7L A;  3OSN A;  4OJO A;  4NKT A;  9ICS A;  4M6W A;  1L3T A;  2W54 A;  4X4U A;  4P0Q B;  7ICO A;  4M9L A;  3WK8 A;  5KFK A;  4F93 B;  2WF8 A; 
#chains in the Genus database with same CATH homology
 1VJ7 A;  4RPY A;  1EXN A;  3H7I A;  3HT3 A;  4B9T A;  3OVA A;  4KMU A;  4J9N A;  1WCN A;  1S0N A;  5F9N A;  1NK6 A;  4KLU A;  9ICX A;  3G6X A;  4C8M A;  4IQU A;  4DL6 A;  1NOM A;  7ICM A;  4WC1 A;  2ZH9 A;  3EWA A;  8ICE A;  4WBY A;  2XCP A;  2Y1J A;  2HHU A;  2XGQ A;  3C2L A;  4YD2 A;  1SZP A;  3Q8L A;  3PW5 A;  4QWD A;  4I2F A;  4ZH4 A;  2XGP A;  3ISC A;  4DFP A;  3ZDB A;  2AJQ A;  5L1L A;  3TQ1 A;  3AQK A;  3C1Z A;  5J0O A;  2KN7 A;  2ZUD A;  4GXJ A;  1TFR A;  4ECW A;  3GFK B;  4WC2 A;  4X4T A;  2LYH A;  4ED0 A;  1JIH A;  3IHQ B;  1TFY A;  1ZQK A;  1YLQ A;  1XO1 A;  5KFF A;  5J2H A;  3WFR E;  3TAN A;  3V6H A;  3N97 B;  2ASJ A;  4C8O A;  5KG4 A;  1QLN A;  3JPR A;  2MUT A;  5III A;  4UAW A;  4YR2 A;  5KFT A;  4GXI A;  4GXK A;  2UVR A;  4KTQ A;  4WC6 A;  4NLK A;  4YR3 A;  1JN3 A;  4AT8 B;  5BOL A;  1L5U A;  7ICP A;  4UQG A;  4PHD A;  4NLZ A;  4F5P A;  2JZB B;  1A76 A;  4Z6D A;  1SL1 A;  4DFM A;  5KFO A;  4IRK A;  3PVX A;  4F92 B;  9ICH A;  5HHH A;  2A1J B;  7ICL A;  4M6W B;  4O3P A;  4R64 A;  4IQW A;  3PW0 A;  4RQ8 A;  5D46 A;  4RPZ A;  5J0T A;  3L9D A;  3KHG A;  2XY6 A;  4PH5 A;  4FBT A;  4X4Q A;  2ISP A;  5CWR A;  2BPC A;  4KIT B;  5J2A A;  7ICG A;  2ZHB A;  5J0Y A;  4DL3 A;  3RJK A;  5KT2 A;  4JK1 A;  5EWG A;  5HRI A;  3OJS A;  2ZH4 A;  5IIK A;  1QTM A;  4RQ6 A;  1ZQF A;  4F50 A;  1T4G A;  2W9B B;  4YD1 A;  1DGS A;  3MAB A;  3EYZ A;  2RDI A;  4RUC A;  2ASL A;  8ICQ A;  3MR6 A;  1TV9 A;  3QE9 Y;  8ICX A;  5BPC A;  3H8J A;  5HMM A;  3RBE A;  4DWI A;  4RZR A;  2HVH A;  5F2V O;  3GIJ A;  4RUA A;  5KT6 A;  2PI5 A;  4DQI A;  5J0P A;  3AQN A;  3B0X A;  2ZTD A;  4NM1 A;  3PML A;  1V9P A;  5KFS A;  2XO7 A;  1ZQT A;  4YQW A;  3TAP A;  3RJI A;  1RZT A;  1WCL A;  4KN7 A;  4NY8 A;  5HRL A;  1MSW D;  8ICC A;  1B43 A;  2P6U A;  2C2D A;  3T3F A;  2IA6 A;  1XSP A;  1ZQW A;  3PMN A;  3OGU A;  2AGO A;  3M9N B;  1D8Y A;  3PR4 A;  5J0U A;  2R8K A;  4DQR A;  4O9M A;  1N56 A;  4MFC A;  4ELV A;  2BE3 A;  1FA0 A;  2AU0 A;  7ICK A;  3H8W A;  4LVS A;  2VAN A;  3OV7 A;  1UT8 A;  1ZQX A;  4ECZ A;  1L3S A;  4F2R A;  3MR5 A;  1BPD A;  5D49 A;  2HHP A;  3OHB A;  2BCQ A;  3PR5 B;  3BQ0 A;  5KFA A;  3C2K A;  4R63 A;  5D4B A;  4FHW A;  3OVS A;  4DSF A;  5KFY A;  4WC7 A;  4YMM A;  3M8R A;  4FBU A;  4RQ1 A;  9ICN A;  2W8L A;  1T8E A;  4UB5 A;  1NK0 A;  4NKU A;  4YCX A;  3RJE A;  4M9N A;  3V7K A;  1ARO P;  4IRC A;  4P2H A;  1ZQS A;  4F3O A;  3ZDE A;  1BNP A;  1ZQU A;  3HP6 A;  3FYH A;  1NZP A;  1ZQM A;  5J2B A;  1KFD A;  3ZD8 A;  4KN4 A;  1QSL A;  5J2J A;  3C18 A;  1D8L A;  4F4W A;  8ICM A;  1PZN A;  9ICB A;  2BGW A;  3Q8M A;  5KG0 A;  7ICQ A;  3LDA A;  3N4M B;  4DSL A;  2KZ3 A;  3IM1 A;  1B22 A;  4TQR A;  3C5F A;  4J9K A;  3H4B A;  5HRE A;  4DEZ A;  3V6K A;  5DKW A;  2BCS A;  4KLO A;  4QW8 A;  4RWO A;  1R8C A;  2KZZ A;  4AT8 A;  1D9D A;  3K75 D;  4LZD A;  4X5V A;  2UVV A;  4JV1 A;  4KLS A;  5HR9 A;  5F9L A;  5J29 A;  2VA8 A;  2W8K A;  3SYZ A;  2XY5 A;  1ZQP A;  2ISO A;  3NGD A;  4X4N A;  5KFR A;  5KFJ A;  4PPX A;  2FMS A;  4F91 B;  5DDM A;  5DQG A;  5KG2 A;  3PNC A;  2W9C B;  4DL2 A;  1U47 A;  2ATL A;  4UB2 A;  4M9G A;  4I2H A;  4ECX A;  3H37 A;  4E8F A;  4DL4 A;  4DO9 A;  1NK4 A;  1TKD A;  3H39 A;  3OUY A;  5J0X A;  9ICK A;  4LZG A;  3TAQ A;  5DB9 A;  2AGP A;  5CR0 A;  4RT2 A;  4RNM A;  2IBK A;  3ORY A;  8ICN A;  4M47 A;  3PW2 A;  2AGQ A;  4X4P A;  5HRG A;  1ZQR A;  5HHI A;  3H40 A;  1LV5 A;  1LB2 B;  1QSY A;  4I2D A;  3ZDC A;  1MIY A;  2I1Q A;  2IHM A;  4E7X A;  4X0B A;  1RXV A;  4F5N A;  1HJP A;  4GC6 A;  1U45 A;  4F4K A;  4M9H A;  3RH5 A;  5CB1 A;  4I29 A;  1TAU A;  1BPB A;  4P4M A;  2HHT A;  4QW9 A;  2KZM A;  5DG8 A;  4F4Y A;  2JEJ A;  2C28 A;  7ICJ A;  4DFK A;  8ICT A;  2BDP A;  4RQ2 A;  4J9O A;  4M0A A;  1ZQZ A;  2BKE A;  3JPN A;  3V72 A;  5HNK A;  2HHV A;  8ICP A;  2ZH8 A;  5J2C A;  3RB4 A;  2FMQ A;  4QZF A;  3M9O B;  2M2W A;  2A1J A;  3HX0 A;  4KLJ A;  2NRX A;  1UEV A;  1X9W A;  4ATB A;  2FPL A;  4ECR A;  1NK7 A;  3BQ2 A;  4QWE A;  4Q45 A;  7ICH A;  3JPS A;  3MR2 A;  9ICU A;  4EYI B;  4X4R A;  1WOT A;  4EBC A;  2ZJA A;  2HHS A;  1MQ2 A;  4FO6 A;  5J0Q A;  4ED1 A;  1SL0 A;  1KFT A;  5KFV A;  5DG9 A;  2VA2 A;  1KEJ A;  2BQU A;  1UT5 A;  4QZB A;  3EPI A;  3V6J A;  2W9B A;  4WC3 A;  2HHW A;  1KRP A;  2R8H A;  3PX6 A;  2GWS A;  4K4I A;  4LT6 A;  3ZDD A;  4QZ9 A;  3JPP A;  2HHX A;  4BXO A;  5CJ7 A;  1ZQA A;  3RJJ A;  4X4V A;  3UXO A;  1BPX A;  4JWM A;  4GLX A;  3RH4 A;  2ZH1 A;  5KT5 A;  4MF2 A;  1Q78 A;  1TVA A;  3PO5 A;  4I27 A;  1NJX A;  3LWM A;  4TUR A;  5L1J A;  3PY8 A;  3RRG A;  4ATB B;  3MGI A;  1Y88 A;  4PGX A;  2XCA A;  2M2T A;  8ICK A;  3MDA A;  1XC9 A;  8ICG A;  1S9F A;  8ICB A;  9ICO A;  1X2I A;  4YG2 A;  4JV0 A;  4TQS A;  5CHG A;  5KFU A;  3M8S A;  4IR1 A;  4KLL A;  7ICV A;  4C8K A;  4X4S A;  2J6U A;  4WBZ A;  2ZH3 A;  5C5J A;  1X9S A;  4B9N A;  5KT4 A;  3MFI A;  4ED6 A;  4PHE A;  1ZQB A;  1ZQG A;  2P6R A;  3UPS A;  2C2E A;  5HRD A;  5EWF A;  1CUK A;  3ZD9 A;  1ZQV A;  5DGB A;  4PHP A;  5KFP A;  1TAQ A;  1BGX T;  4B9U A;  4AT7 B;  3AQM A;  1NK8 A;  5J2D A;  2W9A A;  4J9Q A;  1SL2 A;  2NRW A;  4C8L A;  2ZHA A;  4DOC A;  4AT9 B;  5J0W A;  1ZET A;  5IIJ A;  4DQP A;  4I2E A;  2F1I A;  1XU4 A;  3AQL A;  4QZC A;  2C22 A;  1ZQI A;  1NKE A;  1KLN A;  3WFO A;  3RTV A;  1RYS A;  4WC4 A;  2ALZ A;  2NRZ A;  3FDS A;  3T5H A;  7ICN A;  3C5G A;  4EYH B;  5KFZ A;  4DLE A;  2NRK A;  4YXJ A;  2UVW A;  4RWN A;  9ICI A;  4Z6E A;  1JAJ A;  1ZQE A;  5HRK A;  1JXE A;  4QWB A;  4EBJ A;  5DDY A;  4M5D A;  3C21 A;  2W9M A;  4YXM A;  1XS9 D;  7ICE A;  2XY7 A;  8ICU A;  3RBD A;  1MIW A;  3LK9 A;  2ZTC A;  4M2Y A;  3HIY A;  3RAX A;  1D9F A;  4NLN A;  5JUM A;  1COO A;  4MFF A;  3MFH A;  5KFE A;  3GV7 B;  3KHL A;  4BWJ A;  4BXO B;  4RWP A;  5KFL A;  5KT3 A;  5KT7 A;  5KFI A;  4FS1 A;  2I9G A;  5DB8 A;  4MEY A;  9ICV A;  3HJ4 A;  2DR8 A;  1IM4 A;  1ZQN A;  4KLM A;  7ICT A;  4RQ7 A;  4O3R A;  1S0M A;  4YR0 A;  2M9N A;  4UBB A;  2JEG A;  4ECU A;  5HML A;  1ZQH A;  3OVB A;  2ZH5 A;  3TI0 A;  1Z00 A;  2PI4 A;  3RH6 A;  1BPE A;  4XA5 A;  3GV8 B;  3RB6 A;  1CEZ A;  3H8S A;  2HVI A;  2ZH2 A;  2DVI A;  1ZQO A;  3ZDA A;  1KTQ A;  3UXN A;  4HYK A;  4QZ8 A;  1NJZ A;  4ECY A;  2DFL A;  4QZI A;  3GIM A;  9ICQ A;  2FLN A;  1UEU A;  1RYR A;  1JX4 A;  3JPT A;  3ETL A;  4UB1 A;  5KFW A;  1DK2 A;  4KLG A;  4RNN A;  3MGH A;  4FH3 A;  4Z6C A;  5HC9 A;  1ZQY A;  4TUS A;  4ECV A;  4K4G A;  4KLQ A;  1RXW A;  2ZJ5 A;  3GQC A;  2BQR A;  1NJW A;  2PFP A;  5J0S A;  2O5A A;  1S0O A;  3UXP A;  2FPK A;  3MDC A;  4I2B A;  3C2M A;  4DF4 A;  5KFQ A;  3TAR A;  2ASD A;  8ICH A;  3RJH A;  5HRB A;  2OWO A;  3LWL A;  5KG7 A;  2ZH6 A;  4ECS A;  8ICA A;  2DRA A;  3TFR A;  4DS5 A;  3SI8 A;  2JZB A;  3BQT A;  4TUQ A;  3GIK A;  3H4D A;  1TK8 A;  1C7Y A;  3EW9 A;  8ICJ A;  4B9L A;  4B9V A;  3LQC B;  3C23 A;  4UAY A;  2BCR A;  2R8J A;  3BJY A;  4F5R A;  4B9S A;  4I28 A;  9ICM A;  4DSJ A;  4PHA A;  4KLI A;  3SZ2 A;  5IIN A;  4UB3 A;  1S0V A;  3HWT A;  2PFN A;  5KFX A;  5DED A;  5KG3 A;  4AT9 A;  4NLG A;  2Q0Z X;  3PX0 A;  5DEC A;  3GV5 B;  4ELT A;  8ICO A;  5KFC A;  1ZJN A;  1JQR A;  4RQ0 A;  4K4H A;  1DOQ A;  5DLF A;  1SKR A;  2BPG A;  4S3N A;  8ICR A;  3BDP A;  2V4R A;  3HPO A;  4DFJ A;  2KFZ A;  4UB4 A;  2IHN A;  2H5X A;  1NKB A;  3OJU A;  4KLF A;  4J9L A;  2V9W A;  3ISB A;  3JZ0 A;  4XRH A;  5KTQ A;  5KFH A;  2PXI A;  4O3S A;  4G3I A;  8ICS A;  1BPY A;  4M9J A;  2BCU A;  3K4G A;  4UBC A;  5EOZ A;  4DOB A;  4P4P A;  4F5Q A;  2P66 A;  9ICP A;  9ICR A;  1S76 D;  2BR0 A;  3T5J A;  1Z3E B;  3B0Y A;  5KG1 A;  3G6V A;  5DQH A;  3RRH A;  5CP2 A;  4EEY A;  3THV A;  2AQ4 A;  2DPJ A;  2R8G A;  4DSK A;  5L9X A;  4MFA A;  3KHR A;  2C2R A;  1TFW A;  3RR7 A;  1UET A;  4EZ9 A;  4JUZ A;  4UAZ A;  3UPQ A;  2FLP A;  3PW4 A;  1T3N A;  1JMS A;  2PBE A;  2DRB A;  5KFB A;  1T7P A;  2BQ3 A;  1NJY A;  7ICU A;  4MEX A;  1U4B A;  5HRH A;  2HW3 A;  4XQ8 A;  1R8B A;  4XQ7 A;  2ZH7 A;  3H38 A;  1NKC A;  1BNO A;  5DLG A;  4QZD A;  1U9L A;  4DQQ A;  2KP7 A;  4F5O A;  4X0A A;  4Z6F A;  4R65 A;  1A77 A;  4RNO A;  5KFM A;  1U49 A;  4JV2 A;  9ICJ A;  4O3O A;  4WC5 A;  4YMO A;  4GC7 A;  1Q79 A;  3NYB A;  2KTQ A;  9ICC A;  9ICW A;  4DL5 A;  3WFQ E;  1ZQC A;  4P4O A;  4QZG A;  2BHN A;  4R8U B;  4Q44 A;  4RT3 A;  4ECT A;  4YMN A;  2F1J A;  5DBB A;  1ZQQ A;  1S77 D;  1HUO A;  3HW8 A;  4FHX A;  4BDP A;  3Q8Q B;  1ZJM A;  4DSE A;  3SV4 A;  1ZQL A;  4I2A A;  3GIL A;  3Q8S B;  5BOM A;  3M9M B;  4ED8 A;  1KDH A;  3AU2 A;  4J9R A;  2W9C A;  7ICR A;  2UVU A;  4Q8F A;  4DL7 A;  2J6S A;  4FHP A;  4I2I A;  4I2J A;  1IXR A;  5KFG A;  5KG6 A;  4BGD A;  1X9M A;  1BPZ A;  3OHA A;  4O0I A;  2IMW P;  2VA3 A;  2KFN A;  2ZUC A;  2V4Q A;  2BPF A;  4DLG A;  5HRF A;  3RB3 A;  1DK3 A;  3PV8 A;  1U48 A;  2MUT B;  1NK5 A;  4EBD A;  2JEI A;  3EPG A;  2F1H A;  4NXZ A;  3RJG A;  5J2F A;  4I2C A;  2M2V A;  4F4X A;  3RJF A;  4PGY A;  2HHQ A;  2M2U A;  3UQ2 A;  1MC8 A;  3UQ0 A;  2PFQ A;  4EP7 A;  4MF8 A;  2RFF A;  3PO4 A;  1L3U A;  4F2S A;  5IIM A;  4Q8E A;  5J0R A;  1MIV A;  5DB7 A;  5EWE A;  3C1Y A;  1RPL A;  1NO5 A;  3GDX A;  3QZ7 A;  2RDJ A;  3V7J A;  3JPQ A;  5IIO A;  9ICA A;  1S10 A;  3NTU A;  4R66 A;  4NM2 A;  4QWA A;  4B9M A;  9ICL A;  4BWM A;  3OSP A;  4XUS A;  1S97 A;  4ELU A;  4AT7 A;  2Q66 A;  1UA1 A;  4O5K A;  8ICY A;  4TUP A;  4FHV A;  4RQ3 A;  5J2G A;  3Q8P B;  4YVZ A;  5DG7 A;  5DQI A;  5DB6 A;  9ICF A;  4KLE A;  4UD4 A;  4RU9 A;  8ICL A;  2B21 A;  3KTQ A;  1Z00 B;  1BVS A;  2WTF A;  1KSP A;  1QSS A;  1V4A A;  2FPM A;  4J9S A;  3JPO A;  1ZYQ A;  7ICS A;  2R8I A;  3QEB Z;  5TZV A;  1ZQD A;  4RWQ A;  4X4O A;  1TK0 A;  5CA7 A;  4ED2 A;  1UA0 A;  5HP4 A;  8ICW A;  2NRT A;  3ISD A;  4WCW A;  2O1P A;  2PFO A;  3WFP A;  4F4Z A;  4R8U A;  1F5A A;  1XWL A;  4Q43 A;  1R89 A;  3HJ1 A;  3PW7 A;  1H38 A;  4IQT A;  2DR5 A;  4EBE A;  1ZQJ A;  3SV3 A;  3RR8 A;  5KFD A;  8ICV A;  4YN4 A;  3BQ1 A;  1XSN A;  3QZ8 A;  4RQ5 A;  4FS2 A;  3QEA Z;  1KFS A;  4IRD A;  8ICF A;  1OU5 A;  4KLD A;  4PGQ A;  4EZ6 A;  4FHY A;  7ICF A;  4QZE A;  1XSL A;  2J6T A;  3RB0 A;  4UD5 A;  4IQV A;  3AU6 A;  4IG8 A;  4F8R A;  1K1S A;  3G6Y A;  4FH5 A;  3Q8K A;  2NRV A;  3E2E A;  1JXL A;  4WC0 A;  3T5L A;  5J2K A;  2Y1I A;  2AQ0 A;  3PX4 A;  1NK9 A;  1PX5 A;  2FMP A;  4E80 A;  5L1I A;  2XC9 A;  5J2E A;  3RAQ A;  5KG5 A;  4YP3 A;  5J2I A;  4CCH A;  9ICE A;  8ICZ A;  3C66 A;  1VFG A;  4O5C A;  1KNY A;  3T5K A;  5DGA A;  3KHH A;  5IIL A;  4O3Q A;  1TK5 A;  2JEF A;  4I2G A;  3AUO A;  4E0D A;  2ID1 A;  4RQ4 A;  4ED3 A;  4QZH A;  1N48 A;  9ICT A;  4KLT A;  2DR7 A;  3EZ5 A;  4ED7 A;  2MAX A;  4DSI A;  3H3A A;  4RPX A;  4DOA A;  4EBK A;  1HUZ A;  4YFK A;  4QZA A;  3TFS A;  5DBA A;  4O3N A;  4DF8 A;  1MQ3 A;  5DBC A;  8ICI A;  4M04 A;  3GII A;  1SKS A;  4ECQ A;  3JYY A;  3V7L A;  4JWN A;  4J9M A;  3Q8R B;  3OSN A;  4DQS A;  1L3V A;  4NKT A;  2ZTE A;  9ICS A;  5KFN A;  5L1K A;  4M6W A;  1L3T A;  4DS4 A;  2DPI A;  7ICI A;  3OUY B;  3MR3 A;  4KLH A;  7ICO A;  4X4U A;  2ZJ8 A;  4C8N A;  4QWC A;  3MBY A;  4M9L A;  3WFS C;  2DR9 A;  1SKW A;  4O5E A;  1R8A A;  2BCV A;  5KFK A;  4J9P A;  2ZUB A;  2FLL A;  4F93 B;  9ICG A;  4IR9 A;  1K1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...