2P66A

Human dna polymerase beta complexed with tetrahydrofuran (abasic site) containing dna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
publication title Structural insight into the DNA Polymerase beta deoxyribose phosphate lyase mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2p66A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2p66A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2p66A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2p66A03
1QSYA 5J29A 5KFRA 4RQ1A 2ZTDA 3KHGA 3M8RA 4JV1A 5KT5A 1Q78A 4WC0A 3BQTA 3JPSA 5KG4A 2PI4A 3T3FA 4C8KA 3H39A 1ZYQA 2ZH4A 4QZDA 3PX4A 2HHSA 1DK2A 3PO5A 3Q8RB 2UVUA 4BXOA 2JZBB 2ZH2A 1TFYA 4RPXA 3BQ0A 2ASDA 8ICWA 4PGQA 2NRVA 4X4SA 2IHNA 3E2EA 5DB7A 4QW8A 3AQKA 4DSJA 4RWPA 4X4VA 4I2IA 1NZPA 3LWLA 5KT3A 5DDMA 5L1LA 1B43A 2W9BA 3MR6A 4TUQA 4DOCA 3GIIA 1IXRA 4DSLA 3MGIA 5J0YA 7ICGA 3MABA 3EWAA 4RQ4A 4ED6A 2ISPA 5KFUA 1MQ2A 5CJ7A 3HT3A 4S3NA 1UA0A 7ICUA 1DOQA 7ICLA 4EYIB 7ICIA 2ZH6A 3RJIA 4F8RA 1H38A 2DR7A 4DSEA 1VFGA 1XSLA 3QEAZ 5KFNA 4J9SA 4F2SA 4MF8A 1XS9D 9ICHA 2NRKA 1T3NA 3MR3A 5D49A 2AQ0A 4M6WB 4QWCA 3EYZA 5HHHA 4F4XA 3SI8A 2KP7A 3AQMA 4WC1A 3H8JA 4DS4A 4O0IA 4DFJA 3Q8KA 4NLKA 3RAXA 1ZQHA 2C2RA 3SV4A 4M04A 4F92B 5KTQA 4KN4A 1ZJNA 2ALZA 2V4QA 1A77A 4Z6CA 3V72A 2ZHAA 2I9GA 1BVSA 4FS2A 4KLQA 4I2CA 4ECUA 4FS1A 5KFXA 3JPQA 5KFYA 4PGYA 3QZ7A 3MFHA 4R8UB 4KLFA 2AU0A 4AT9A 4DQIA 4DFKA 3RRHA 3RH4A 3V7LA 4F4WA 2A1JA 2BE3A 1WCNA 2WTFA 3M9MB 4M0AA 2JEJA 9ICUA 4QZIA 1NJZA 2ZUCA 3ETLA 4HYKA 4DSKA 1Q79A 1X9WA 3RR8A 2KZMA 4C8MA 1UETA 2UVWA 4RT3A 3WFSC 2XY7A 4F2RA 4B9TA 5J2FA 3OVBA 1TKDA 4J9NA 3RB4A 4I2DA 2JZBA 5L9XA 9ICQA 3IM1A 1ZQEA 4E80A 1TK5A 2HW3A 1OU5A 9ICRA 7ICOA 8ICXA 2M2WA 1MIYA 2J6TA 4M47A 3FDSA 4DOAA 9ICAA 2W8KA 3RJHA 4WC7A 4YXMA 4RPYA 5HRBA 4F4KA 3K4GA 1D8LA 7ICHA 2RDJA 4X4OA 4WC5A 5KG5A 3Q8MA 4WBZA 2C2DA 4YR0A 5DBCA 3OGUA 4F93B 3ZD8A 3N97B 2IA6A 4B9LA 1BNPA 2O5AA 5KT4A 4ED0A 3OSPA 4G3IA 3OVAA 2KFNA 5D46A 5KFHA 3UXPA 5J0SA 5DB8A 1RXVA 1U48A 1KDHA 3GIMA 4PGXA 3SV3A 4YFKA 4NM1A 2Q0ZX 4JV2A 1T4GA 5KFQA 2Y1IA 4NLNA 4YR3A 2JEIA 4DF8A 2AGQA 3NGDA 4QZFA 4KITB 5EWEA 4AT7A 3ISDA 1V4AA 4KLJA 3B0XA 1NOMA 4ED7A 4QWAA 4MFCA 1KFSA 4QZ8A 3AU2A 5J0OA 4PPXA 3C18A 2DRBA 4FBTA 9ICWA 4X4NA 5J2AA 3HIYA 2JEGA 2FPMA 1S76D 4X0BA 8ICTA 5HC9A 1NK0A 1TFWA 3KHHA 5KFWA 8ICOA 5HMLA 1JXLA 4ECXA 9ICPA 4R63A 3H3AA 5DLGA 4I27A 4R8UA 2BPGA 5HRFA 4E7XA 4JV0A 8ICFA 3PR4A 4RZRA 3HJ1A 3MBYA 5CR0A 4K4HA 2VA3A 4E8FA 2ZTCA 5KFGA 5KFMA 5D4BA 5KG3A 2ASJA 1NJWA 1ZQPA 4KLHA 5KG1A 4TURA 3QE9Y 3PW7A 3RH6A 5BPCA 5F9NA 5HRLA 5HRIA 5DLFA 2H5XA 1NK7A 1HUZA 5KG7A 1R8AA 2AQ4A 2BPFA 4Z6FA 7ICVA 1Z00B 4K4GA 4KLDA 3RBEA 5IIKA 4QZ9A 2ISOA 4EBJA 3LK9A 1R8BA 4UAZA 2ZUDA 2NRXA 5IIOA 1ZETA 5KFBA 4KLMA 2DPIA 2HHUA 5J2BA 4GLXA 2AGPA 4NKUA 4WCWA 4DFMA 2FMPA 9ICLA 5KFCA 2XY5A 4J9OA 3RJKA 1R89A 8ICGA 4I2FA 4AT8B 4X4QA 4DQSA 5J0XA 2DFLA 2PXIA 7ICKA 1AROP 1U49A 5DG8A 4ED8A 2M2UA 1L5UA 3GIJA 4ECYA 4KLSA 1UEUA 2HHVA 5DECA 3TQ1A 2P66A 3PW4A 4YP3A 3BJYA 4X4RA 1MSWD 3ZDAA 3HPOA 5J0QA 4R66A 2OWOA 1ZQWA 2J6UA 2ZHBA 1CUKA 2IBKA 4EP7A 2FLPA 3RJGA 4O5EA 5HR9A 3G6VA 1ZQMA 4FH5A 4FHPA 5JUMA 3BQ2A 3GIKA 8ICMA 1MIVA 4C8NA 7ICMA 5KFVA 1IM4A 7ICEA 3UPQA 4TQRA 3THVA 4I2BA 1ZQXA 4F91B 2AJQA 2FPKA 3HP6A 4IQTA 3SYZA 4O5CA 2ZJ5A 1ZQFA 8ICVA 5J0UA 5KFLA 5DB6A 4UB3A 2KFZA 3H38A 1C7YA 4RWQA 1V9PA 4IRKA 3V6HA 2MUTB 5DDYA 2ZH1A 1WOTA 4NXZA 4AT7B 3SZ2A 4RQ7A 4DQPA 3RR7A 1L3TA 3JPRA 3C1ZA 9ICMA 4RU9A 3FYHA 2C2EA 3Q8QB 4O9MA 4RQ0A 5DGBA 4ELTA 9ICBA 4JWNA 5CB1A 5DG7A 1NJXA 4RQ3A 4F5RA 5KT6A 4DF4A 4DFPA 4KLTA 3C5FA 4YN4A 1KEJA 4I2AA 4YMMA 3C23A 2XCAA 3IHQB 2ZH7A 4P4OA 4EEYA 5KT7A 4IG8A 3ZD9A 1KRPA 5J2GA 4UB4A 1BPBA 4NY8A 8ICKA 3M8SA 9ICJA 2Q66A 2XO7A 4UBCA 4DL4A 3HWTA 2FMQA 4P4PA 9ICCA 1Z00A 2BHNA 2PFQA 1TV9A 2HHPA 4UD4A 4PHAA 4QZCA 3JPTA 4TUSA 3G6YA 2C28A 2F1IA 3KHRA 4ELUA 4NLZA 2PI5A 5CP2A 1Z3EB 1KFTA 5HRGA 1DGSA 5J2IA 3TANA 1S0NA 4DSIA 3JYYA 3H8SA 3H4BA 2Y1JA 3ZDCA 1TAUA 4FHVA 4AT8A 4RPZA 2BR0A 1SKRA 1ZQSA 4DL7A 4ZH4A 3LWMA 1D8YA 2FLNA 4I2GA 2HVHA 1K1QA 4FHYA 4NKTA 2C22A 3PX6A 3RRGA 5KFZA 5F2VO 4QWDA 3WFRE 4O3NA 5CHGA 1JXEA 5KFOA 3C1YA 4M9JA 9ICGA 5CA7A 4YMNA 4KMUA 4QZAA 1ZQCA 7ICTA 7ICRA 2RFFA 4GXJA 8ICSA 1K1SA 5DGAA 1TK0A 3OHBA 1L3VA 2IHMA 1CEZA 4LZDA 3EW9A 3Q8LA 4J9PA 1N48A 4Q45A 3L9DA 3PVXA 3N4MB 4ED2A 2DPJA 4O5KA 3OVSA 2HHWA 2NRTA 4R65A 4DOBA 4XUSA 4YCXA 5KFPA 2R8KA 4RWOA 3AU6A 5J2CA 4DWIA 5KFEA 4B9MA 4F4YA 4P4MA 2BCUA 3OUYB 4F5QA 4QZBA 4MFFA 2MUTA 9ICVA 2VA8A 2DRAA 4DSFA 4YD1A 2W9CB 3BQ1A 4I2HA 9ICIA 4YMOA 5C5JA 1BPDA 5DQIA 3PV8A 4XA5A 1SKWA 5KFDA 1LV5A 1ZQKA 3WFQE 1TFRA 2W9AA 4J9MA 2BQRA 1NKBA 3ZDDA 2M2TA 3MR5A 4FHXA 2DR9A 3RAQA 1XU4A 5IIJA 4RNNA 1S97A 5L1JA 1NK9A 4F3OA 1S77D 2M9NA 4EYHB 1RYRA 1BPXA 4IQWA 1SZPA 8ICCA 4R64A 5IIMA 2B21A 4IRCA 5HP4A 2F1HA 1JIHA 3GQCA 4DL2A 3PW0A 1KSPA 4O3QA 3EZ5A 1DK3A 1SL1A 4DL3A 4ED3A 3MR2A 4F5NA 4TUPA 4DS5A 3ISCA 2ATLA 4KLUA 8ICRA 1KLNA 4X0AA 4DL6A 4YD2A 4M9NA 2FPLA 8ICEA 4KLGA 4Z6EA 3JPOA 4EBKA 2W9MA 5DQGA 1A76A 3OSNA 9ICSA 4MEYA 3MDCA 2ZH8A 4IR9A 4BDPA 1ZQTA 1ZQIA 4FBUA 5KFAA 1D9FA 5F9LA 1U47A 3NYBA 1X2IA 1N56A 1RZTA 1ZQNA 3OHAA 3C2KA 5BOMA 4ECSA 3WFPA 1BPZA 2PFPA 5HRHA 5KG2A 5HNKA 4QZGA 4WC4A 1XSNA 4Q8EA 8ICLA 2KTQA 1QLNA 4F5PA 4I28A 5EWFA 1UT8A 1NJYA 2UVVA 4GC7A 4LT6A 3TI0A 1XWLA 4RUCA 4XQ7A 4RQ6A 9ICEA 4ECQA 4GC6A 4EBDA 1X9MA 1L3SA 4EBCA 5J0TA 4DLGA 3H37A 2DR8A 2V4RA 1X9SA 5J2EA 1NK4A 3QEBZ 3TARA 5KFFA 5DBBA 4DL5A 3GFKB 1JMSA 2ZH9A 3MFIA 1RXWA 3T5HA 3PR5B 3OJUA 3GV7B 1ZQLA 5KT2A 7ICJA 7ICQA 3HX0A 2DR5A 3Q8SB 9ICFA 3JZ0A 1U9LA 1UT5A 1ZJMA 4FH3A 4RNMA 8ICNA 3OUYA 4WC6A 4PHDA 2UVRA 8ICZA 2KZ3A 5TZVA 3Q8PB 1S10A 5DG9A 2W9CA 1MQ3A 4M9GA 3RB0A 4KLLA 2HHQA 1NKCA 2VA2A 8ICIA 3RH5A 1HUOA 5KFSA 4M2YA 3WFOA 3V6JA 4P2HA 5DEDA 3UPSA 3NTUA 1ZQZA 5HHIA 4JUZA 4B9UA 1LB2B 4ATBB 4RT2A 1B22A 1S0MA 5IINA 3PO4A 1ZQGA 1FA0A 4QZHA 1QTMA 3RJEA 4DQQA 4DO9A 1COOA 4NLGA 2XGQA 2XY6A 2IMWP 1KNYA 4ECTA 2ZJAA 2P6UA 8ICQA 3OV7A 4J9LA 7ICFA 1YLQA 3GV5B 3ORYA 2PBEA 4ELVA 1UA1A 3JPPA 5J2JA 2BPCA 1QSLA 1S0OA 4YVZA 4J9RA 2BDPA 1ZQRA 2J6SA 4XQ8A 1PZNA 1ZQQA 4JWMA 2XCPA 3GDXA 1ZQAA 1NK8A 4EZ6A 4M9LA 8ICJA 2XGPA 4C8LA 8ICBA 1NK5A 2HHXA 4PHPA 3RBDA 1TK8A 3RJFA 3B0YA 3PW2A 5KFTA 1BNOA 1JQRA 4JK1A 5L1KA 1F5AA 3TAQA 5L1IA 1UEVA 4Q8FA 4YXJA 3AQLA 4Q44A 4ECVA 3RB6A 4IQUA 3MGHA 1SKSA 3QZ8A 4LVSA 4I2JA 5KFIA 2R8IA 3AUOA 3PW5A 8ICUA 3T5LA 3M9NB 1T8EA 4BGDA 1NK6A 2P6RA 4UB5A 3TFSA 1ZQDA 2KZZA 4KTQA 2ZH3A 1ZQJA 4KLOA 4M9HA 1SL0A 3TAPA 3H7IA 5KG6A 4PHEA 9ICXA 4X4TA 1JN3A 1SL2A 4Q43A 3V7KA 2W8LA 2R8GA 1EXNA 5HREA 4FHWA 4GXKA 4XRHA 2HHTA 5J0WA 3G6XA 1ZQOA 1NO5A 3C66A 1RPLA 4TQSA 4B9NA 2VANA 3PX0A 3PMLA 1RYSA 2BGWA 3BDPA 4WC2A 2ZTEA 3K75D 4ECZA 4J9QA 4QWBA 4QW9A 2PFNA 2M2VA 2BCRA 1MC8A 4NM2A 1U45A 2BCSA 1U4BA 4O3RA 4MFAA 7ICNA 1XC9A 4EZ9A 4FO6A 5DQHA 4K4IA 4IQVA 1TAQA 1ZQYA 1KFDA 3V7JA 4F50A 2BCVA 1D9DA 4B9VA 4KLIA 2HVIA 4QZEA 2AGOA 4BXOB 4ATBA 2DVIA 3OJSA 2ZUBA 4BWMA 3C2MA 3H8WA 4I2EA 5J2HA 4X5VA 4RNOA 2V9WA 1HJPA 7ICPA 4C8OA 4DLEA 4IRDA 4O3SA 4O3PA 1BPYA 5J2KA 3EPIA 1QSSA 2FMSA 3HJ4A 2XC9A 3GV8B 1WCLA 2BQUA 9ICTA 1JAJA 1PX5A 4F5OA 1KTQA 1MIWA 2ASLA 3ISBA 2JEFA 3UXNA 4CCHA 2BQ3A 4O3OA 2W9BB 1XSPA 5HRKA 3UQ2A 1BGXT 1BPEA 1XO1A 4UAYA 3KHLA 4IR1A 3V6KA 4YR2A 2R8HA 1L3UA 4WC3A 3PMNA 3C21A 5KG0A 4DEZA 1Y88A 4ECWA 9ICOA 4ECRA 2ZH5A 4YG2A 3MDAA 4X4UA 2ID1A 2GWSA 5HMMA 3RB3A 5EWGA 3RTVA 8ICHA 8ICYA 4UB2A 4I29A 4M6WA 3H40A 4QWEA 3T5KA 4RQ5A 4B9SA 4RUAA 4UBBA 5BOLA 1ZQBA 3TFRA 3ZDEA 3C2LA 4DQRA 4E0DA 1R8CA 4UB1A 4UQGA 1TVAA 2BKEA 1ZQUA 3EPGA 3C5GA 4PH5A 5DB9A 3H4DA 2BCQA 4UAWA 8ICAA 5J2DA 1NKEA 5J0RA 4YQWA 5J0PA 9ICNA 4RWNA 4RQ2A 5EOZA 2I1QA 2KN7A 4MF2A 1S0VA 3GILA 3LDAA 4Z6DA 4GXIA 3PNCA 2PFOA 3RJJA 1S9FA 4WBYA 3PY8A 4ED1A 1JX4A 2F1JA 2LYHA 7ICSA 4KLEA 2NRWA 1T7PA 4UD5A 2RDIA 4KN7A 5IIIA 5DKWA 2MAXA 4MEXA 3AQNA 4X4PA 2NRZA 5KFKA 3M9OB 4F4ZA 4EBEA 9ICKA 3LQCB 4LZGA 3JPNA 4AT9B 3T5JA 2FLLA 5IILA 4J9KA 2ZJ8A 4BWJA 5KFJA 5CWRA 3HW8A 3KTQA 8ICPA 1VJ7A 2O1PA 5DBAA 2A1JB 3ZDBA 1ZQVA 2R8JA 4RQ8A 4M5DA 3UXOA 5HRDA 3UQ0A
chains in the Genus database with same CATH superfamily
1NZBA 5KFRA 2KHVA 3JPSA 4C8KA 3F53A 1ZYQA 3PO5A 2ZH2A 1TFYA 2ASDA 2KKVA 5B3QA 4X4SA 4UB8U 5EE1A 2Y0SC 4RWPA 3MR6A 3GIIA 3MGIA 4ED6A 1MQ2A 3ICXA 1NI3A 1DOQA 7ICLA 7ICIA 2F8KA 3RJIA 4DSEA 1VFGA 4F2SA 2HBKA 9ICHA 2NRKA 1T3NA 5G5GA 5D49A 1PUZA 1L7PA 4QWCA 3EYZA 5HHHA 4F4XA 1SZHA 2KJ5A 3H8JA 3SR6A 4DS4A 4O0IA 2C2RA 4KN4A 5ALKA 4Z6CA 2I9GA 2GH1A 1BVSA 4FS2A 4KLQA 4FS1A 3JPQA 3TADA 4PGYA 3QZ7A 4KLFA 4R8UB 2AU0A 4DQIA 4DFKA 5KAIU 3FC4A 2BE3A 1WCNA 4U7CA 4OJ6A 2G06A 4DSKA 5ALGA 4I0UA 2UVWA 3ER9B 2XY7A 1SWVA 2G07A 4F2RA 3H0RB 3RB4A 5L9XA 2JZBA 1KQQA 5ALRA 2HW3A 8ICXA 2M2WA 3KZXA 4M47A 2G5IB 2JH1A 4RPYA 5HRBA 3I1YA 4WC5A 4X4OA 2WF6A 3OGUA 1MN8A 3N97B 3KFUF 2O5AA 4G3IA 5D46A 5CEHA 5KFHA 5J0SA 3NVOA 3D2SA 1KDHA 5KFQA 2JEIA 2HMXA 5EWEA 2EAPA 3B0XA 2N1RA 5AKIA 3AU2A 3HIYA 1S76D 2ZXIA 4X0BA 2FI1A 9ICPA 5AK4A 3E0FA 3OVBA 4K4HA 5KFMA 5HRIA 1N63A 4JLXA 2H5XA 2KEYA 1HUZA 1R8AA 4CGZA 4Z6FA 4WOYA 2LM1A 1RDFA 3C28A 1ZETA 2EH9A 4KLMA 2DPIA 2AGPA 4NKUA 3IG5A 3RJKA 1R89A 4EX7A 4AT8B 2ZIUB 5J0XA 1RG6A 4N7RA 4DFDA 2MSNA 2ZXHA 4KLSA 3NS1A 2HHVA 1UEUA 5DECA 5EE9A 2RQ5A 3EF2A 4OAIZ 5JTIA 2I5HA 3G6VA 4FH5A 4EEKA 1SXDA 5D61A 1GO3F 2KSOB 4PZNA 3SYZA 4UB3A 2KFZA 4EV6A 1Z4NA 2AH5A 4IRKA 2K60A 2E8PA 4NXZA 1L3TA 9ICMA 5AM5A 4ELTA 5CB1A 1NJXA 4RQ3A 4F5RA 4KLTA 4A8EA 4YMMA 1HIWA 3IHQB 2ZH7A 4IG8A 2ZIXA 5KT7A 3ZD9A 2DGZA 4EGWA 1N5WA 4NY8A 2XO7A 3CNHA 4P4PA 5AM1A 2PFQA 3NRZA 4USAA 4KX3A 2GO7A 2C28A 3KHRA 4EEDA 5CP2A 1DGSA 2Y9TA 3TANA 1S0NA 1YT3A 3H8SA 1ZRMA 2HI0A 4FHVA 4RPZA 2MU2A 4ZH4A 3WK4A 4FHYA 3RRGA 3C1YA 2YTUA 1PK1A 5CA7A 4YMNA 3ER8C 4KMUA 3N7SC 3HKZF 1OUQA 3Q8LA 2LHTA 1M6YA 4O5KA 4US8A 2FCLA 4RWOA 4B9MA 2LM4A 3M1YA 4P4MA 1V97A 4QZBA 2MUTA 4MKPA 3D2NA 2VA8A 9ICIA 2W9CB 5C5JA 3PV8A 5DQIA 1LV5A 3WFQE 5AICA 1TFRA 2W9AA 2BQRA 3ZDDA 5AK3A 1OW5A 1YZ7A 3CYMA 2FJ6A 5ALOA 2M9NA 1RYRA 1BPXA 1N5XA 8ICCA 1KKXA 2B21A 2KOBA 3QU2A 1LVHA 3GQCA 1KSPA 4O3QA 4DL3A 3MR2A 4F5NA 4TUPA 3ISCA 2ATLA 4KLUA 4M9NA 2W7PA 3A0HU 4KLGA 4EBKA 1A76A 5B3PA 2KNJA 3MDCA 3IV6A 3K1ZA 4CE6A 4FBUA 2KD1A 3NYBA 5F9LA 1ZQNA 3C2KA 5BOMA 4ECSA 1PK3A 3EUB2 2A3VA 1ZQ1C 4WC4A 2B6GA 8ICLA 4LT6A 2F44A 1V85A 1NJYA 4HAIA 4XQ7A 4RUCA 4UAUA 3H37A 1Q3UA 4BJQA 1RXWA 3PR5B 3GV7B 1ZQLA 7ICQA 5KT2A 3Q8SB 2W7OA 2G0AA 1ZJMA 3ALRA 4RNMA 3OUYA 2UVRA 4KLLA 2DF4B 2H3ZA 5KFSA 4P2HA 1ZQZA 5HHIA 4ATBB 4RT2A 2KKPA 2DQNB 3ERCC 2F3NA 1FFUA 1QQ6A 2XGQA 5AIAA 3OV7A 2VKQA 7ICFA 3GV5B 2PBEA 3JPPA 1OXJA 5J2JA 4O67A 4FZNA 4J9RA 3BS5A 2BDPA 3U26A 1ZD4A 2XCPA 3GDXA 4EZ6A 4MHVA 4PHPA 3RBDA 3B0YA 3PW2A 1JQRA 4JK1A 3M6ZA 5L1IA 4Q8FA 3QZ8A 2R8IA 3PW5A 4EELA 1JUDA 1ZQJA 1X40A 3L5KA 3H7IA 4X4TA 1SL2A 4FHWA 4Q43A 5HREA 3N7RC 4GXKA 1NO5A 3M7DA 3QNMA 4TQSA 3AL0B 3PX0A 2YY6A 1T94A 3PSPA 2EAMA 2WF9A 2QKQA 1XC9A 5DQHA 5D62A 4F50A 2CXYA 2F2AB 2BCVA 2D3DA 2E5SA 4KLIA 1RQNA 2DVIA 3OJSA 2ZUBA 4BWMA 1WYGA 5CFSA 4RNOA 4C8OA 2LPEA 4IRDA 4O3PA 1QSSA 2FMSA 1WCLA 2W55A 9ICTA 2NV3A 1MIWA 3ISBA 2BQ3A 5AI0A 4O3OA 1ECWA 3KHLA 1XO1A 4UAYA 4F71A 3C21A 5KG0A 4DEZA 4ECWA 9ICOA 1D8BA 4YG2A 3RTVA 8ICYA 3T5KA 2G08A 2ESEA 4E0DA 3TFRA 4PZOA 2BCQA 4EX6A 4YQWA 4Z6DA 4GXIA 3RJJA 5AI9A 2HN1A 4KLEA 5IIIA 4MEXA 2MAXA 4O3MA 1WUDA 1TAMA 2NRZA 5KFKA 3M9OB 9ICKA 3RFAA 4LZGA 3JPNA 3T5JA 4J9KA 2O1PA 2WF5A 5DBAA 4K96A 3K7DA 1JI7A 3BQTA 2PI4A 4UAVA 3PX4A 1UHUA 3Q8RB 1QQ5A 2H3QA 2BBJA 3E2EA 1JROA 3FM9A 3QU7A 4K97A 4I2IA 1NZPA 3LWLA 5KT3A 5DDMA 2W9BA 5AHXA 5J0YA 4LEYA 1XO0A 4J03A 4S3NA 4NJ8A 2W43A 7ICUA 2K4EA 2DR7A 1Z1BA 4K99A 1XS9D 4P0PA 3MR3A 4JB3A 4GIBA 4AYBF 4O69A 3SI8A 4WC1A 4DFJA 3Q8KA 4NLKA 3RAXA 1ZQHA 4F92B 5ALMA 1A77A 1SV0C 4PL2A 2QB0B 2QARB 4I2CA 4ECUA 1L8OA 3RRHA 2B51A 1ZD5A 5ALJA 4F4WA 2A1JA 1NJZA 2ZUCA 4HYKA 1X9WA 2H3IA 4CNQA 3RR8A 4C8MA 4RT3A 3UMCA 2ZIUA 4I2DA 3IM1A 4E80A 1TK5A 2EDUA 3KD3A 7ICOA 3FDSA 9ICAA 4YXMA 3PZPA 4F4KA 1RYUA 1FO4A 4YR0A 2XIDA 1ED1A 3KOOA 4F93B 3ZD8A 5KT4A 4ED0A 4OAFA 4CRXA 3TKAA 5DB8A 2EANA 1RXVA 1B4FA 4PGXA 3D6JA 3KZIU 2Q0ZX 5AKYA 2Y1IA 3H0LB 2ZIVA 4YR3A 3NGDA 4WQLA 4QZFA 3ISDA 1V4AA 4KLJA 4ED7A 4QWAA 4PPXA 1KFSA 2LYAA 2DRBA 3AMZA 4NV0A 5KFWA 1JALA 2YMQA 5AM3A 3H3AA 3S6JA 5HRFA 3I76A 4JV0A 3PR4A 2K4IA 2JHDA 2VA3A 4KLHA 2KJ9A 5KG1A 3PW7A 5HRLA 2B4VA 4K9BA 4C4SA 2HBMA 4UARA 2VJ4A 3N28A 3RBEA 5IIKA 2ISOA 1R8BA 4UAZA 2ZUDA 2NRXA 5KFBA 4Y2YA 2OYYA 1J97A 5KFCA 1V38A 3OPXA 2PXIA 2G5HB 2M2UA 4ED8A 2LBOA 1L5UA 4ECYA 3TQ1A 2P66A 3FAHA 3PW4A 4X4RA 1MSWD 3HPOA 2J6UA 5HR9A 2H3VA 3TADC 1VLBA 5GTHU 3GIKA 4C4RA 1IIPA 7ICEA 3UPQA 3THVA 1DXSA 1ZQXA 4F91B 2DL0A 3HP6A 2BZFA 4Y2VA 2CRXA 4P0QB 2HBLA 5DB6A 1V9PA 3V6HA 5DDYA 2HDOA 4AT7B 4RQ7A 3RR7A 3OTQA 2W11A 3Q8QB 4RQ0A 3GU3A 5KT6A 1KEJA 2JR5A 4I2AA 2XCAA 4LEWA 5J2GA 2PKEA 4JLZA 2Q66A 4CDGA 4DL4A 1DGJA 9ICCA 1Z00A 2HBJA 4TUSA 3PSFA 3G6YA 4ELUA 3QXGA 1F5SA 1KFTA 2IUBA 4OAHA 5KAFU 5CFTA 2BR0A 1ZQSA 4NL9A 2FLNA 2C22A 5F2VO 5ALVA 1JXEA 1ZQCA 4OJLA 7ICTA 2RFFA 4GXJA 1K1SA 1O03A 1TK0A 2IHMA 4Q45A 2VJ5A 2DBYA 4ED2A 5AKEA 2NRTA 2WHEA 5ALPA 2R8KA 4F72A 5ALFA 3AU6A 3VC8A 5J2CA 4DWIA 4F4YA 2H3FA 4F5QA 4MFFA 4DSFA 5AIBA 4J9MA 2M2TA 2DR9A 4LEVA 4QIWF 4RNNA 1WWUA 1NK9A 4F3OA 1S77D 2KJ8A 4K8VA 1P7DA 5IIMA 3DV9A 5HP4A 1JIHA 4ICAA 1DK3A 3EZ5A 4DS5A 3IRUA 4YD2A 2FPLA 3JPOA 2ZG6A 2W9MA 5AI8A 3AN1A 5JTGA 2NO4A 5KFAA 1D9FA 1N56A 3OHAA 1KL9A 2JV3A 5HNKA 4QZGA 2KTQA 1WG8A 3NWIA 4I28A 1L3SA 1UQVA 3L4PA 5AKGA 3GZFA 1GPJA 5KFFA 3H0MB 4DL5A 2WB1F 1JMSA 3OJUA 7ICJA 2DR5A 2K8CB 3HKZC 8ICNA 4C7ZA 2E8MA 4PHDA 5TZVA 1MQ3A 3RB0A 8ICIA 3RH5A 4KM5A 4JUZA 1LB2B 2KG5A 5IINA 2KVSA 3UM9A 3RJEA 1COOA 5ALUA 2ZJAA 5KL1B 8ICQA 3WK6A 1YLQA 2OH2A 3WKCA 4YVZA 5AI6A 4XQ8A 1PZNA 1NK8A 8ICBA 5H2FU 3QUQA 2KIWA 3RB6A 8ICFA 1SKSA 3T5LA 4BGDA 2KZZA 4KLOA 2ZIWA 1SL0A 4M9HA 2HSZA 4PHEA 3V7KA 1EXNA 2QLTA 2HHTA 1K5OA 3C66A 4EENA 2ZTEA 3K75D 4J9QA 2BCSA 5F3XB 7ICNA 4EZ9A 4K4IA 5E79U 2YQEA 1D9DA 4QZEA 5ALYA 4QJFB 4FO1A 3H8WA 4I2EA 5J2HA 4X5VA 7ICPA 4O3SA 2Y9UA 5J2KA 2OM6A 1PX5A 2K8BB 2JEFA 4CCHA 2W3RA 4IR1A 4AP9A 1Y88A 2E8OA 4ECRA 5EWGA 2W54A 4UB2A 4I29A 4QWEA 4B9SA 4RQ5A 5BOLA 4DQRA 3BQ7A 4UB1A 4UQGA 1TVAA 3EPGA 3WKAA 4PH5A 5DB9A 3H4DA 2B0CA 4NLBA 5J0PA 9ICNA 4C7YA 1S0VA 4MF2A 3LDAA 1Q3VA 4PL1A 1S9FA 4WBYA 3PY8A 4B6JA 2F1JA 4IC9A 1RM6C 1T7PA 4UD5A 2RDIA 5DKWA 3AQNA 5AK6A 4EBEA 4F4ZA 3LQCB 3KKAA 2FLLA 3KTQA 4BWJA 1VJ7A 4K98A 3ZDBA 1ZQVA 3C29A 3UXOA 5HRDA 3UQ0A 1ZQDA 5J29A 4RQ1A 3KHGA 4WC0A 3T3FA 4QZDA 4BXOA 2JZBB 4RPXA 3BQ0A 8ICWA 2NRVA 3NVYA 2IHNA 5DB7A 2FDRA 3AQKA 4DSLA 7ICGA 2WF8A 3MABA 5KFUA 1UA0A 5J8YA 4EYIB 5JRTA 3QEAZ 5KFNA 3AQEA 2KP7A 3J81j 4M04A 3SV4A 5KTQA 4QNLA 3V72A 2B56A 2PMZF 4EEBA 3MFHA 4U6PA 1X6IA 4AT9A 1LKYA 3V7LA 4C4TA 1KBUA 2WTFA 3BS7A 2XVTA 3ETLA 3ZI4A 2YB4A 3SMVA 2KZMA 1C20A 1UETA 3WFSC 5J2FA 1PVQA 1TKDA 4J9NA 1ZQEA 5HR7A 9ICRA 4DOAA 2W8KA 3RJHA 4WC7A 3Q8MA 4WBZA 2KE7A 1IV8A 5DBCA 4OO1J 2IA6A 4B9LA 5AI5A 3OSPA 3OVAA 1J2NA 3QU5A 2NYVA 2IOFK 4YFKA 5ALWA 4NLNA 2AGQA 4AT7A 2A1AA 1NOMA 4X4NA 3CP8A 9ICWA 2FPMA 5HC9A 1NK0A 2GOLA 1TFWA 1JXLA 2GAFD 4ECXA 1KN5A 2KHQA 4R63A 1L8LA 4AYBC 5ALNA 4R8UA 2YX8A 2BPGA 2KMDA 4RZRA 3HJ1A 3MBYA 5CR0A 4E8FA 3L3FX 2ZTCA 2EZXA 2WFAA 4GFJA 5KG3A 1NJWA 1ZQPA 2F76X 3A0BU 2NO5A 3RH6A 5BPCA 4OCZA 5DLFA 4PJ0U 7ICVA 4K4GA 4QZ9A 4EBJA 5AKKA 3LK9A 5IIOA 5HR6A 2HHUA 1J2MA 4GLXA 2IHOA 9ICLA 2XY5A 1F0MA 4LJXA 4X4QA 3PSIA 1QCKA 2DFLA 1X6JA 5DG8A 3GIJA 3K1RB 3BJYA 1PVRA 3ZDAA 5J0QA 4R66A 2OWOA 2FLPA 4O5EA 1ZQMA 2DKXA 4FHPA 8ICMA 3BQ2A 7ICMA 1S8OA 3LVWA 4TQRA 4I2BA 1ZRNA 2FPKA 2EZYA 1ZQFA 8ICVA 5KFLA 3H38A 3UMGA 4LEZA 2MUTB 2ZH1A 3SZ2A 4DQPA 5DGBA 9ICBA 5DG7A 5B5EU 2LKYA 3AQFA 4YN4A 4Y2SA 4Y2PA 3C23A 5FP0A 3SAHA 3M8SA 9ICJA 4NXUA 4UBCA 3SAGA 3HWTA 2FMQA 1Z19A 2HHPA 4UD4A 4QZCA 4NLZA 1Z3EB 5J2IA 4DSIA 3JYYA 3PHZA 5KL8B 3H4BA 2Y1JA 4AT8A 4OAGA 2HVHA 4I2GA 3LWMA 4NKTA 1K1QA 3PX6A 3WFRE 5KFZA 2XI9A 4QWDA 4O3NA 5CHGA 9ICGA 5KFOA 4M9JA 4QZAA 7ICRA 2M0NA 3HRDD 5DGAA 3OHBA 3EW9A 5B66U 1N48A 3PVXA 3N4MB 4R65A 4XUSA 4YCXA 4ACOA 2KSOA 4UW9A 5KFEA 3MC1A 3OUYB 4C80A 3B9JA 2EZZA 3F2BA 9ICVA 3WK5A 4YD1A 4I2HA 5ALTA 1BPDA 1SKWA 1ZQKA 4UB6U 5KFDA 1NKBA 3RAQA 1RQLA 1XU4A 2E1FA 3CK6A 4DCCA 4DL2A 5CRXA 4X0AA 4DL6A 1F44A 4OJ5A 3BS5B 3OSNA 9ICSA 4MEYA 2ZH8A 4BDPA 3NKUA 1U47A 1X2IA 3WFPA 2DKZA 2JH7A 1BPZA 2HOIA 2EQYA 1XSNA 2P35A 3SQIA 2K89A 5EWFA 2UVVA 4GC7A 3TI0A 4RQ6A 4ECQA 4EBDA 2I6XA 5J0TA 4EBCA 1NK4A 3QEBZ 5EE0A 5DBBA 2ZH9A 3OWGA 5ALXA 3MFIA 4ZOHC 4UATA 2D8CA 3HX0A 1U9LA 4FH3A 4IL6U 4RQMA 3LYSA 8ICZA 5AI4A 5DG9A 2W9CA 2HHQA 2RHFA 2VA2A 4M2YA 2D6FC 3V6JA 3UPSA 1N62A 4NXVA 4B9UA 4Y2XA 1ZQGA 5AM0A 1FA0A 4QZHA 4NL9C 4NLGA 1KNYA 5GTIU 1L7MA 1X66A 5ALDA 3ORYA 4ELVA 1X42A 1B0XA 4QIWC 1S0OA 5AM2A 2F77X 3NVWA 1ZQRA 8ICJA 1COKA 2CN1A 4UASA 1NK5A 2HHXA 3RJFA 1TK8A 5KFTA 1BNOA 4BX9C 5L1KA 2WAQF 3TAQA 1F5AA 4KB6A 3AQLA 4ECVA 1A0PA 3NVZA 4IQUA 2DWQA 4I2JA 5KFIA 4C0ZA 3AUOA 1QQ7A 1T8EA 1NK6A 2P6RA 3TACB 4UB5A 4XJEA 1VDVA 2KICA 2QB1A 4KTQA 2ZH3A 4KX5A 3N7PD 2OEHA 5KG6A 3QX7A 1JN3A 4JMUA 3RF9A 2O6KA 4XRHA 1ZQOA 2VANA 2K4PA 1VJ5A 5JU5A 4WC2A 4CF4A 4ECZA 2VIXA 4QW9A 2ES6A 2Y0SF 1MC8A 2BCRA 2M2VA 1U45A 3E58A 1U4BA 2WB1C 4FO6A 3F2CA 3T79A 4IQVA 1TAQA 1KFDA 4ATBA 3CW2C 2IOFA 1HJPA 3O0FA 3EPIA 2XC9A 1JRPA 2BQUA 1JAJA 4F5OA 3UXNA 1QH9A 2R18A 2W9BB 4O68A 1XSPA 3IG8A 3UQ2A 4WQKA 3V6KA 2R8HA 4YR2A 1L3UA 5T14A 3PMNA 4WC3A 2ZH5A 3MDAA 2ID1A 1WWVA 2GWSA 3WK7A 3IDWA 3H40A 4RUAA 4UBBA 1R8CA 1ZQUA 2BKEA 3C5GA 4P0PB 5J2DA 1NKEA 5J0RA 4RWNA 2I1QA 2KN7A 3M6KA 4ED1A 1DRGA 1T3QA 5ALZA 2LYHA 3WK8A 1JX4A 5AKHA 2NRWA 4KN7A 3SD7A 1ZXIA 5IILA 5KFJA 5CWRA 3HW8A 3VCBA 2GA9D 2A1JB 1L7NA 7ICSA 4OJPA 1QSYA 2ZTDA 3M8RA 1ZOLA 5KT5A 4JV1A 1Q78A 5KG4A 3QUBA 3H39A 2ZH4A 2HHSA 1DK2A 2UVUA 3D2QA 4PGQA 4QW8A 4DSJA 4X4VA 5L1LA 1B43A 4TUQA 4DOCA 1IXRA 3EWAA 4RQ4A 2ISPA 5CJ7A 3HT3A 2ZH6A 4F8RA 1H38A 1XSLA 2F8LA 4J9SA 3QUTA 1SIJA 4MF8A 2ZIVB 2AQ0A 4M6WB 3AQMA 1ZD2P 5L1MA 2A19A 1Z4OA 1ZJNA 2ALZA 2V4QA 2YMLA 2W3SA 3IP4B 2ZHAA 1S5LU 5KFXA 5KFYA 3RH4A 3WKEA 1HEKA 3M9MB 4M0AA 2JEJA 9ICUA 4QZIA 1Q79A 3AEVA 2HCFA 3PSTA 4B9TA 4RQNA 1NNLA 5AKZA 3F5EA 9ICQA 1OU5A 3ETRA 1MIYA 2J6TA 2RRDA 3H8MA 2YN4A 4Y2TA 3K4GA 1D8LA 7ICHA 2RDJA 5KG5A 2C2DA 1KW4A 1BNPA 4HX0A 5CFUA 4FFDA 2WF7A 2MRLA 2KFNA 3UXPA 3SENA 2MA1A 1Q8KA 2AHOB 3KKAC 1U48A 2OCEA 3GIMA 3SV3A 4NM1A 4JV2A 4K9AA 1T4GA 5G5HA 4NXTA 4DF8A 5ALSA 4KITB 3SEIA 1N60A 4MFCA 3C18A 4QZ8A 5J0OA 4FBTA 1URJA 5J2AA 2JEGA 3WK9A 3BZKA 8ICTA 3KHHA 8ICOA 2QB0A 2QARA 5HMLA 2CPRA 5DLGA 1N2XA 2LMRA 4I27A 2E1EA 4E7XA 1FFVA 2ASJA 5KFGA 5D4BA 1YZ6A 4TURA 3QE9Y 4US9A 3LVVA 5F9NA 1NK7A 5KG7A 2AQ4A 2PMZC 2BPFA 1Z00B 4KLDA 2YB1A 2RP5A 5J8YC 5J2BA 4CF3A 5D63A 4WCWA 4DFMA 2FMPA 4J9OA 8ICGA 4I2FA 4DQSA 7ICKA 1AROP 1U49A 3HILA 1TE2A 4WH5A 2W04A 4YP3A 1ZQWA 2ZHBA 1CUKA 2IBKA 4EP7A 3RJGA 3WKDA 2E3TA 1O08A 3ONNA 5JUMA 2ODGA 1MIVA 2LYBA 4C8NA 2KVCA 5KFVA 1IM4A 5K4LA 2AJQA 3MCRA 5ALEA 4IQTA 4O5CA 4Y2UA 2ZJ5A 5J0UA 3SAFA 1C7YA 4RWQA 1WOTA 3JPRA 3C1ZA 4RU9A 3FYHA 2C2EA 4O9MA 1SXEA 2YMPA 2Z7JA 4JWNA 4DF4A 3BZCA 4DFPA 3C5FA 2JXJA 2G09A 3UMBA 2W03A 3QU4A 4P4OA 4EEYA 4FZMA 1KRPA 1N61A 4UB4A 1BPBA 8ICKA 2BHNA 1TV9A 1AQ6A 4PHAA 3JPTA 4O6AA 2BDUA 2F1IA 2PI5A 5HRGA 3KBBA 5ALHA 3ZDCA 1X9XA 1TAUA 4G9BA 1SKRA 4DL7A 1D8YA 5ALLA 1CI4A 4NXXA 3MGVA 8ICSA 1L3VA 1CEZA 3JCFA 4LZDA 3QYPA 4Y2RA 4J9PA 3L9DA 4OD0A 2DPJA 3OVSA 2HHWA 4DOBA 5KFPA 1UPHA 1IG6A 1SGGA 3DDHA 4P0QA 2BCUA 3NVVA 5C0YA 2DRAA 2EWRA 3BQ1A 4YMOA 4XA5A 4FHXA 3MR5A 5IIJA 1S97A 4CF5A 5L1JA 1ZD3A 3CRXA 4EYHB 4IQWA 1SZPA 4R64A 4IRCA 1L6NA 2F1HA 3PW0A 1SL1A 4ED3A 8ICRA 1KLNA 2ZIXB 5ALQA 8ICEA 2KIVA 3AM9A 4Z6EA 5DQGA 4OJOA 4IR9A 1ZQTA 1ZQIA 5AKXA 4Y2QA 1FIQA 1RZTA 5CHEA 1PVPA 2PFPA 4NLCA 5HRHA 5KG2A 4Q8EA 1FEZA 2K4HA 1QLNA 4F5PA 1UT8A 3R9KA 1XWLA 9ICEA 4GC6A 1X9MA 2DR8A 2AXTU 4DLGA 2ZIWB 2V4RA 1X9SA 5J2EA 4WJ3B 1PK1B 3TARA 3QU9A 2Q4TA 1A6SA 3GFKB 2BBHA 3T5HA 4FE3A 1Q46A 9ICFA 3ED5A 5AK5A 1UT5A 3JZ0A 4WC6A 2KZ3A 3Q8PB 1S10A 3HJ4A 4M9GA 2HN2A 1NKCA 1HUOA 3WFOA 5DEDA 3NTUA 2KK0A 1B22A 1S0MA 3PO4A 1QTMA 4DQQA 2DUYA 4DO9A 2XY6A 2IMWP 4ECTA 2P6UA 4J9LA 3HJEA 1UA1A 2BPCA 1QSLA 1SV4A 1UCVA 2J6SA 4JWMA 1ZQQA 1ZQAA 4M9LA 2XGPA 4C8LA 2XICA 1UEVA 1Z1VA 4YXJA 3NUQA 4Q44A 1CRXA 3MGHA 5A0LA 4LVSA 4X4PA 8ICUA 3M9NB 2GLEA 3TFSA 1L7OA 3F5AA 3TAPA 9ICXA 2R8GA 2W8LA 2K8AA 5J0WA 3G6XA 1MA7A 2HOFA 1RPLA 2JGAA 4B9NA 1RYSA 3PMLA 2BGWA 3QUCA 3IN5A 3BDPA 2EAOA 4QWBA 2PFNA 1SWWA 3I28A 4NM2A 5KNIA 4O3RA 4MFAA 5TISU 2JRZA 3DEEA 1SV0A 2FE9A 1ZQYA 3V7JA 4FZLA 4B9VA 2HVIA 2AGOA 4BXOB 3C2MA 5AM4A 2V9WA 4DLEA 1BPYA 2E8NA 3GV8B 3WKBA 1KTQA 2OXOA 2ASLA 2RLTA 5EE3A 5HRKA 1BGXT 1BPEA 4KMOB 2KV2A 4X4UA 3WU2U 5HMMA 3RB3A 8ICHA 2IOHA 2YMMA 4IS7A 4M6WA 1ZQBA 3ZDEA 3C2LA 1XNSA 4UAWA 8ICAA 5AKLA 4RQ2A 5EOZA 3GILA 2LI6A 3PNCA 1SB3C 2PFOA 5AKJA 3F2DA 4NXWA 4BUGA 2WAQC 2HOQA 4NWIA 4AT9B 1LKYB 2JMGA 2L5YA 2OHFA 2ZJ8A 8ICPA 5ALIA 4M5DA 4Y2JA 2R8JA 4RQ8A 3NASA 3NRWA
chains in the Genus database with same CATH topology
1QSYA 5J29A 5KFRA 4RQ1A 2ZTDA 3KHGA 3M8RA 4JV1A 5KT5A 1Q78A 4WC0A 3BQTA 3JPSA 5KG4A 2PI4A 3T3FA 4C8KA 3H39A 1ZYQA 2ZH4A 4QZDA 3PX4A 2HHSA 1DK2A 3PO5A 3Q8RB 2UVUA 4BXOA 2JZBB 2ZH2A 1TFYA 4RPXA 3BQ0A 2ASDA 8ICWA 4PGQA 2NRVA 4X4SA 2IHNA 3E2EA 5DB7A 4QW8A 3AQKA 4DSJA 4RWPA 4X4VA 4I2IA 1NZPA 3LWLA 5KT3A 5DDMA 5L1LA 1B43A 2W9BA 3MR6A 4TUQA 4DOCA 3GIIA 1IXRA 4DSLA 3MGIA 5J0YA 7ICGA 3MABA 3EWAA 4RQ4A 4ED6A 2ISPA 5KFUA 1MQ2A 5CJ7A 3HT3A 4S3NA 1UA0A 7ICUA 1DOQA 7ICLA 4EYIB 7ICIA 2ZH6A 3RJIA 4F8RA 1H38A 2DR7A 4DSEA 1VFGA 1XSLA 3QEAZ 5KFNA 4J9SA 4F2SA 4MF8A 1XS9D 9ICHA 2NRKA 1T3NA 3MR3A 5D49A 2AQ0A 4M6WB 4QWCA 3EYZA 5HHHA 4F4XA 3SI8A 2KP7A 3AQMA 4WC1A 3H8JA 4DS4A 4O0IA 4DFJA 3Q8KA 4NLKA 3RAXA 1ZQHA 2C2RA 3SV4A 4M04A 4F92B 5KTQA 4KN4A 1ZJNA 2ALZA 2V4QA 1A77A 4Z6CA 3V72A 2ZHAA 2I9GA 1BVSA 4FS2A 4KLQA 4I2CA 4ECUA 4FS1A 5KFXA 3JPQA 5KFYA 4PGYA 3QZ7A 3MFHA 4R8UB 4KLFA 2AU0A 4AT9A 4DQIA 4DFKA 3RRHA 3RH4A 3V7LA 4F4WA 2A1JA 2BE3A 1WCNA 2WTFA 3M9MB 4M0AA 2JEJA 9ICUA 4QZIA 1NJZA 2ZUCA 3ETLA 4HYKA 4DSKA 1Q79A 1X9WA 3RR8A 2KZMA 4C8MA 1UETA 2UVWA 4RT3A 3WFSC 2XY7A 4F2RA 4B9TA 5J2FA 3OVBA 1TKDA 4J9NA 3RB4A 4I2DA 2JZBA 5L9XA 9ICQA 3IM1A 1ZQEA 4E80A 1TK5A 2HW3A 1OU5A 9ICRA 7ICOA 8ICXA 2M2WA 1MIYA 2J6TA 4M47A 3FDSA 4DOAA 9ICAA 2W8KA 3RJHA 4WC7A 4YXMA 4RPYA 5HRBA 4F4KA 3K4GA 1D8LA 7ICHA 2RDJA 4X4OA 4WC5A 5KG5A 3Q8MA 4WBZA 2C2DA 4YR0A 5DBCA 3OGUA 4F93B 3ZD8A 3N97B 2IA6A 4B9LA 1BNPA 2O5AA 5KT4A 4ED0A 3OSPA 4G3IA 3OVAA 2KFNA 5D46A 5KFHA 3UXPA 5J0SA 5DB8A 1RXVA 1U48A 1KDHA 3GIMA 4PGXA 3SV3A 4YFKA 4NM1A 2Q0ZX 4JV2A 1T4GA 5KFQA 2Y1IA 4NLNA 4YR3A 2JEIA 4DF8A 2AGQA 3NGDA 4QZFA 4KITB 5EWEA 4AT7A 3ISDA 1V4AA 4KLJA 3B0XA 1NOMA 4ED7A 4QWAA 4MFCA 1KFSA 4QZ8A 3AU2A 5J0OA 4PPXA 3C18A 2DRBA 4FBTA 9ICWA 4X4NA 5J2AA 3HIYA 2JEGA 2FPMA 1S76D 4X0BA 8ICTA 5HC9A 1NK0A 1TFWA 3KHHA 5KFWA 8ICOA 5HMLA 1JXLA 4ECXA 9ICPA 4R63A 3H3AA 5DLGA 4I27A 4R8UA 2BPGA 5HRFA 4E7XA 4JV0A 8ICFA 3PR4A 4RZRA 3HJ1A 3MBYA 5CR0A 4K4HA 2VA3A 4E8FA 2ZTCA 5KFGA 5KFMA 5D4BA 5KG3A 2ASJA 1NJWA 1ZQPA 4KLHA 5KG1A 4TURA 3QE9Y 3PW7A 3RH6A 5BPCA 5F9NA 5HRLA 5HRIA 5DLFA 2H5XA 1NK7A 1HUZA 5KG7A 1R8AA 2AQ4A 2BPFA 4Z6FA 7ICVA 1Z00B 4K4GA 4KLDA 3RBEA 5IIKA 4QZ9A 2ISOA 4EBJA 3LK9A 1R8BA 4UAZA 2ZUDA 2NRXA 5IIOA 1ZETA 5KFBA 4KLMA 2DPIA 2HHUA 5J2BA 4GLXA 2AGPA 4NKUA 4WCWA 4DFMA 2FMPA 9ICLA 5KFCA 2XY5A 4J9OA 3RJKA 1R89A 8ICGA 4I2FA 4AT8B 4X4QA 4DQSA 5J0XA 2DFLA 2PXIA 7ICKA 1AROP 1U49A 5DG8A 4ED8A 2M2UA 1L5UA 3GIJA 4ECYA 4KLSA 1UEUA 2HHVA 5DECA 3TQ1A 2P66A 3PW4A 4YP3A 3BJYA 4X4RA 1MSWD 3ZDAA 3HPOA 5J0QA 4R66A 2OWOA 1ZQWA 2J6UA 2ZHBA 1CUKA 2IBKA 4EP7A 2FLPA 3RJGA 4O5EA 5HR9A 3G6VA 1ZQMA 4FH5A 4FHPA 5JUMA 3BQ2A 3GIKA 8ICMA 1MIVA 4C8NA 7ICMA 5KFVA 1IM4A 7ICEA 3UPQA 4TQRA 3THVA 4I2BA 1ZQXA 4F91B 2AJQA 2FPKA 3HP6A 4IQTA 3SYZA 4O5CA 2ZJ5A 1ZQFA 8ICVA 5J0UA 5KFLA 5DB6A 4UB3A 2KFZA 3H38A 1C7YA 4RWQA 1V9PA 4IRKA 3V6HA 2MUTB 5DDYA 2ZH1A 1WOTA 4NXZA 4AT7B 3SZ2A 4RQ7A 4DQPA 3RR7A 1L3TA 3JPRA 3C1ZA 9ICMA 4RU9A 3FYHA 2C2EA 3Q8QB 4O9MA 4RQ0A 5DGBA 4ELTA 9ICBA 4JWNA 5CB1A 5DG7A 1NJXA 4RQ3A 4F5RA 5KT6A 4DF4A 4DFPA 4KLTA 3C5FA 4YN4A 1KEJA 4I2AA 4YMMA 3C23A 2XCAA 3IHQB 2ZH7A 4P4OA 4EEYA 5KT7A 4IG8A 3ZD9A 1KRPA 5J2GA 4UB4A 1BPBA 4NY8A 8ICKA 3M8SA 9ICJA 2Q66A 2XO7A 4UBCA 4DL4A 3HWTA 2FMQA 4P4PA 9ICCA 1Z00A 2BHNA 2PFQA 1TV9A 2HHPA 4UD4A 4PHAA 4QZCA 3JPTA 4TUSA 3G6YA 2C28A 2F1IA 3KHRA 4ELUA 4NLZA 2PI5A 5CP2A 1Z3EB 1KFTA 5HRGA 1DGSA 5J2IA 3TANA 1S0NA 4DSIA 3JYYA 3H8SA 3H4BA 2Y1JA 3ZDCA 1TAUA 4FHVA 4AT8A 4RPZA 2BR0A 1SKRA 1ZQSA 4DL7A 4ZH4A 3LWMA 1D8YA 2FLNA 4I2GA 2HVHA 1K1QA 4FHYA 4NKTA 2C22A 3PX6A 3RRGA 5KFZA 5F2VO 4QWDA 3WFRE 4O3NA 5CHGA 1JXEA 5KFOA 3C1YA 4M9JA 9ICGA 5CA7A 4YMNA 4KMUA 4QZAA 1ZQCA 7ICTA 7ICRA 2RFFA 4GXJA 8ICSA 1K1SA 5DGAA 1TK0A 3OHBA 1L3VA 2IHMA 1CEZA 4LZDA 3EW9A 3Q8LA 4J9PA 1N48A 4Q45A 3L9DA 3PVXA 3N4MB 4ED2A 2DPJA 4O5KA 3OVSA 2HHWA 2NRTA 4R65A 4DOBA 4XUSA 4YCXA 5KFPA 2R8KA 4RWOA 3AU6A 5J2CA 4DWIA 5KFEA 4B9MA 4F4YA 4P4MA 2BCUA 3OUYB 4F5QA 4QZBA 4MFFA 2MUTA 9ICVA 2VA8A 2DRAA 4DSFA 4YD1A 2W9CB 3BQ1A 4I2HA 9ICIA 4YMOA 5C5JA 1BPDA 5DQIA 3PV8A 4XA5A 1SKWA 5KFDA 1LV5A 1ZQKA 3WFQE 1TFRA 2W9AA 4J9MA 2BQRA 1NKBA 3ZDDA 2M2TA 3MR5A 4FHXA 2DR9A 3RAQA 1XU4A 5IIJA 4RNNA 1S97A 5L1JA 1NK9A 4F3OA 1S77D 2M9NA 4EYHB 1RYRA 1BPXA 4IQWA 1SZPA 8ICCA 4R64A 5IIMA 2B21A 4IRCA 5HP4A 2F1HA 1JIHA 3GQCA 4DL2A 3PW0A 1KSPA 4O3QA 3EZ5A 1DK3A 1SL1A 4DL3A 4ED3A 3MR2A 4F5NA 4TUPA 4DS5A 3ISCA 2ATLA 4KLUA 8ICRA 1KLNA 4X0AA 4DL6A 4YD2A 4M9NA 2FPLA 8ICEA 4KLGA 4Z6EA 3JPOA 4EBKA 2W9MA 5DQGA 1A76A 3OSNA 9ICSA 4MEYA 3MDCA 2ZH8A 4IR9A 4BDPA 1ZQTA 1ZQIA 4FBUA 5KFAA 1D9FA 5F9LA 1U47A 3NYBA 1X2IA 1N56A 1RZTA 1ZQNA 3OHAA 3C2KA 5BOMA 4ECSA 3WFPA 1BPZA 2PFPA 5HRHA 5KG2A 5HNKA 4QZGA 4WC4A 1XSNA 4Q8EA 8ICLA 2KTQA 1QLNA 4F5PA 4I28A 5EWFA 1UT8A 1NJYA 2UVVA 4GC7A 4LT6A 3TI0A 1XWLA 4RUCA 4XQ7A 4RQ6A 9ICEA 4ECQA 4GC6A 4EBDA 1X9MA 1L3SA 4EBCA 5J0TA 4DLGA 3H37A 2DR8A 2V4RA 1X9SA 5J2EA 1NK4A 3QEBZ 3TARA 5KFFA 5DBBA 4DL5A 3GFKB 1JMSA 2ZH9A 3MFIA 1RXWA 3T5HA 3PR5B 3OJUA 3GV7B 1ZQLA 5KT2A 7ICJA 7ICQA 3HX0A 2DR5A 3Q8SB 9ICFA 3JZ0A 1U9LA 1UT5A 1ZJMA 4FH3A 4RNMA 8ICNA 3OUYA 4WC6A 4PHDA 2UVRA 8ICZA 2KZ3A 5TZVA 3Q8PB 1S10A 5DG9A 2W9CA 1MQ3A 4M9GA 3RB0A 4KLLA 2HHQA 1NKCA 2VA2A 8ICIA 3RH5A 1HUOA 5KFSA 4M2YA 3WFOA 3V6JA 4P2HA 5DEDA 3UPSA 3NTUA 1ZQZA 5HHIA 4JUZA 4B9UA 1LB2B 4ATBB 4RT2A 1B22A 1S0MA 5IINA 3PO4A 1ZQGA 1FA0A 4QZHA 1QTMA 3RJEA 4DQQA 4DO9A 1COOA 4NLGA 2XGQA 2XY6A 2IMWP 1KNYA 4ECTA 2ZJAA 2P6UA 8ICQA 3OV7A 4J9LA 7ICFA 1YLQA 3GV5B 3ORYA 2PBEA 4ELVA 1UA1A 3JPPA 5J2JA 2BPCA 1QSLA 1S0OA 4YVZA 4J9RA 2BDPA 1ZQRA 2J6SA 4XQ8A 1PZNA 1ZQQA 4JWMA 2XCPA 3GDXA 1ZQAA 1NK8A 4EZ6A 4M9LA 8ICJA 2XGPA 4C8LA 8ICBA 1NK5A 2HHXA 4PHPA 3RBDA 1TK8A 3RJFA 3B0YA 3PW2A 5KFTA 1BNOA 1JQRA 4JK1A 5L1KA 1F5AA 3TAQA 5L1IA 1UEVA 4Q8FA 4YXJA 3AQLA 4Q44A 4ECVA 3RB6A 4IQUA 3MGHA 1SKSA 3QZ8A 4LVSA 4I2JA 5KFIA 2R8IA 3AUOA 3PW5A 8ICUA 3T5LA 3M9NB 1T8EA 4BGDA 1NK6A 2P6RA 4UB5A 3TFSA 1ZQDA 2KZZA 4KTQA 2ZH3A 1ZQJA 4KLOA 4M9HA 1SL0A 3TAPA 3H7IA 5KG6A 4PHEA 9ICXA 4X4TA 1JN3A 1SL2A 4Q43A 3V7KA 2W8LA 2R8GA 1EXNA 5HREA 4FHWA 4GXKA 4XRHA 2HHTA 5J0WA 3G6XA 1ZQOA 1NO5A 3C66A 1RPLA 4TQSA 4B9NA 2VANA 3PX0A 3PMLA 1RYSA 2BGWA 3BDPA 4WC2A 2ZTEA 3K75D 4ECZA 4J9QA 4QWBA 4QW9A 2PFNA 2M2VA 2BCRA 1MC8A 4NM2A 1U45A 2BCSA 1U4BA 4O3RA 4MFAA 7ICNA 1XC9A 4EZ9A 4FO6A 5DQHA 4K4IA 4IQVA 1TAQA 1ZQYA 1KFDA 3V7JA 4F50A 2BCVA 1D9DA 4B9VA 4KLIA 2HVIA 4QZEA 2AGOA 4BXOB 4ATBA 2DVIA 3OJSA 2ZUBA 4BWMA 3C2MA 3H8WA 4I2EA 5J2HA 4X5VA 4RNOA 2V9WA 1HJPA 7ICPA 4C8OA 4DLEA 4IRDA 4O3SA 4O3PA 1BPYA 5J2KA 3EPIA 1QSSA 2FMSA 3HJ4A 2XC9A 3GV8B 1WCLA 2BQUA 9ICTA 1JAJA 1PX5A 4F5OA 1KTQA 1MIWA 2ASLA 3ISBA 2JEFA 3UXNA 4CCHA 2BQ3A 4O3OA 2W9BB 1XSPA 5HRKA 3UQ2A 1BGXT 1BPEA 1XO1A 4UAYA 3KHLA 4IR1A 3V6KA 4YR2A 2R8HA 1L3UA 4WC3A 3PMNA 3C21A 5KG0A 4DEZA 1Y88A 4ECWA 9ICOA 4ECRA 2ZH5A 4YG2A 3MDAA 4X4UA 2ID1A 2GWSA 5HMMA 3RB3A 5EWGA 3RTVA 8ICHA 8ICYA 4UB2A 4I29A 4M6WA 3H40A 4QWEA 3T5KA 4RQ5A 4B9SA 4RUAA 4UBBA 5BOLA 1ZQBA 3TFRA 3ZDEA 3C2LA 4DQRA 4E0DA 1R8CA 4UB1A 4UQGA 1TVAA 2BKEA 1ZQUA 3EPGA 3C5GA 4PH5A 5DB9A 3H4DA 2BCQA 4UAWA 8ICAA 5J2DA 1NKEA 5J0RA 4YQWA 5J0PA 9ICNA 4RWNA 4RQ2A 5EOZA 2I1QA 2KN7A 4MF2A 1S0VA 3GILA 3LDAA 4Z6DA 4GXIA 3PNCA 2PFOA 3RJJA 1S9FA 4WBYA 3PY8A 4ED1A 1JX4A 2F1JA 2LYHA 7ICSA 4KLEA 2NRWA 1T7PA 4UD5A 2RDIA 4KN7A 5IIIA 5DKWA 2MAXA 4MEXA 3AQNA 4X4PA 2NRZA 5KFKA 3M9OB 4F4ZA 4EBEA 9ICKA 3LQCB 4LZGA 3JPNA 4AT9B 3T5JA 2FLLA 5IILA 4J9KA 2ZJ8A 4BWJA 5KFJA 5CWRA 3HW8A 3KTQA 8ICPA 1VJ7A 2O1PA 5DBAA 2A1JB 3ZDBA 1ZQVA 2R8JA 4RQ8A 4M5DA 3UXOA 5HRDA 3UQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSY A;  5J29 A;  5KFR A;  4RQ1 A;  2ZTD A;  3KHG A;  3M8R A;  4JV1 A;  5KT5 A;  1Q78 A;  4WC0 A;  3BQT A;  3JPS A;  5KG4 A;  2PI4 A;  3T3F A;  4C8K A;  3H39 A;  1ZYQ A;  2ZH4 A;  4QZD A;  3PX4 A;  2HHS A;  1DK2 A;  3PO5 A;  3Q8R B;  2UVU A;  4BXO A;  2JZB B;  2ZH2 A;  1TFY A;  4RPX A;  3BQ0 A;  2ASD A;  8ICW A;  4PGQ A;  2NRV A;  4X4S A;  2IHN A;  3E2E A;  5DB7 A;  4QW8 A;  3AQK A;  4DSJ A;  4RWP A;  4X4V A;  4I2I A;  1NZP A;  3LWL A;  5KT3 A;  5DDM A;  5L1L A;  1B43 A;  2W9B A;  3MR6 A;  4TUQ A;  4DOC A;  3GII A;  1IXR A;  4DSL A;  3MGI A;  5J0Y A;  7ICG A;  3MAB A;  3EWA A;  4RQ4 A;  4ED6 A;  2ISP A;  5KFU A;  1MQ2 A;  5CJ7 A;  3HT3 A;  4S3N A;  1UA0 A;  7ICU A;  1DOQ A;  7ICL A;  4EYI B;  7ICI A;  2ZH6 A;  3RJI A;  4F8R A;  1H38 A;  2DR7 A;  4DSE A;  1VFG A;  1XSL A;  3QEA Z;  5KFN A;  4J9S A;  4F2S A;  4MF8 A;  1XS9 D;  9ICH A;  2NRK A;  1T3N A;  3MR3 A;  5D49 A;  2AQ0 A;  4M6W B;  4QWC A;  3EYZ A;  5HHH A;  4F4X A;  3SI8 A;  2KP7 A;  3AQM A;  4WC1 A;  3H8J A;  4DS4 A;  4O0I A;  4DFJ A;  3Q8K A;  4NLK A;  3RAX A;  1ZQH A;  2C2R A;  3SV4 A;  4M04 A;  4F92 B;  5KTQ A;  4KN4 A;  1ZJN A;  2ALZ A;  2V4Q A;  1A77 A;  4Z6C A;  3V72 A;  2ZHA A;  2I9G A;  1BVS A;  4FS2 A;  4KLQ A;  4I2C A;  4ECU A;  4FS1 A;  5KFX A;  3JPQ A;  5KFY A;  4PGY A;  3QZ7 A;  3MFH A;  4R8U B;  4KLF A;  2AU0 A;  4AT9 A;  4DQI A;  4DFK A;  3RRH A;  3RH4 A;  3V7L A;  4F4W A;  2A1J A;  2BE3 A;  1WCN A;  2WTF A;  3M9M B;  4M0A A;  2JEJ A;  9ICU A;  4QZI A;  1NJZ A;  2ZUC A;  3ETL A;  4HYK A;  4DSK A;  1Q79 A;  1X9W A;  3RR8 A;  2KZM A;  4C8M A;  1UET A;  2UVW A;  4RT3 A;  3WFS C;  2XY7 A;  4F2R A;  4B9T A;  5J2F A;  3OVB A;  1TKD A;  4J9N A;  3RB4 A;  4I2D A;  2JZB A;  5L9X A;  9ICQ A;  3IM1 A;  1ZQE A;  4E80 A;  1TK5 A;  2HW3 A;  1OU5 A;  9ICR A;  7ICO A;  8ICX A;  2M2W A;  1MIY A;  2J6T A;  4M47 A;  3FDS A;  4DOA A;  9ICA A;  2W8K A;  3RJH A;  4WC7 A;  4YXM A;  4RPY A;  5HRB A;  4F4K A;  3K4G A;  1D8L A;  7ICH A;  2RDJ A;  4X4O A;  4WC5 A;  5KG5 A;  3Q8M A;  4WBZ A;  2C2D A;  4YR0 A;  5DBC A;  3OGU A;  4F93 B;  3ZD8 A;  3N97 B;  2IA6 A;  4B9L A;  1BNP A;  2O5A A;  5KT4 A;  4ED0 A;  3OSP A;  4G3I A;  3OVA A;  2KFN A;  5D46 A;  5KFH A;  3UXP A;  5J0S A;  5DB8 A;  1RXV A;  1U48 A;  1KDH A;  3GIM A;  4PGX A;  3SV3 A;  4YFK A;  4NM1 A;  2Q0Z X;  4JV2 A;  1T4G A;  5KFQ A;  2Y1I A;  4NLN A;  4YR3 A;  2JEI A;  4DF8 A;  2AGQ A;  3NGD A;  4QZF A;  4KIT B;  5EWE A;  4AT7 A;  3ISD A;  1V4A A;  4KLJ A;  3B0X A;  1NOM A;  4ED7 A;  4QWA A;  4MFC A;  1KFS A;  4QZ8 A;  3AU2 A;  5J0O A;  4PPX A;  3C18 A;  2DRB A;  4FBT A;  9ICW A;  4X4N A;  5J2A A;  3HIY A;  2JEG A;  2FPM A;  1S76 D;  4X0B A;  8ICT A;  5HC9 A;  1NK0 A;  1TFW A;  3KHH A;  5KFW A;  8ICO A;  5HML A;  1JXL A;  4ECX A;  9ICP A;  4R63 A;  3H3A A;  5DLG A;  4I27 A;  4R8U A;  2BPG A;  5HRF A;  4E7X A;  4JV0 A;  8ICF A;  3PR4 A;  4RZR A;  3HJ1 A;  3MBY A;  5CR0 A;  4K4H A;  2VA3 A;  4E8F A;  2ZTC A;  5KFG A;  5KFM A;  5D4B A;  5KG3 A;  2ASJ A;  1NJW A;  1ZQP A;  4KLH A;  5KG1 A;  4TUR A;  3QE9 Y;  3PW7 A;  3RH6 A;  5BPC A;  5F9N A;  5HRL A;  5HRI A;  5DLF A;  2H5X A;  1NK7 A;  1HUZ A;  5KG7 A;  1R8A A;  2AQ4 A;  2BPF A;  4Z6F A;  7ICV A;  1Z00 B;  4K4G A;  4KLD A;  3RBE A;  5IIK A;  4QZ9 A;  2ISO A;  4EBJ A;  3LK9 A;  1R8B A;  4UAZ A;  2ZUD A;  2NRX A;  5IIO A;  1ZET A;  5KFB A;  4KLM A;  2DPI A;  2HHU A;  5J2B A;  4GLX A;  2AGP A;  4NKU A;  4WCW A;  4DFM A;  2FMP A;  9ICL A;  5KFC A;  2XY5 A;  4J9O A;  3RJK A;  1R89 A;  8ICG A;  4I2F A;  4AT8 B;  4X4Q A;  4DQS A;  5J0X A;  2DFL A;  2PXI A;  7ICK A;  1ARO P;  1U49 A;  5DG8 A;  4ED8 A;  2M2U A;  1L5U A;  3GIJ A;  4ECY A;  4KLS A;  1UEU A;  2HHV A;  5DEC A;  3TQ1 A;  2P66 A;  3PW4 A;  4YP3 A;  3BJY A;  4X4R A;  1MSW D;  3ZDA A;  3HPO A;  5J0Q A;  4R66 A;  2OWO A;  1ZQW A;  2J6U A;  2ZHB A;  1CUK A;  2IBK A;  4EP7 A;  2FLP A;  3RJG A;  4O5E A;  5HR9 A;  3G6V A;  1ZQM A;  4FH5 A;  4FHP A;  5JUM A;  3BQ2 A;  3GIK A;  8ICM A;  1MIV A;  4C8N A;  7ICM A;  5KFV A;  1IM4 A;  7ICE A;  3UPQ A;  4TQR A;  3THV A;  4I2B A;  1ZQX A;  4F91 B;  2AJQ A;  2FPK A;  3HP6 A;  4IQT A;  3SYZ A;  4O5C A;  2ZJ5 A;  1ZQF A;  8ICV A;  5J0U A;  5KFL A;  5DB6 A;  4UB3 A;  2KFZ A;  3H38 A;  1C7Y A;  4RWQ A;  1V9P A;  4IRK A;  3V6H A;  2MUT B;  5DDY A;  2ZH1 A;  1WOT A;  4NXZ A;  4AT7 B;  3SZ2 A;  4RQ7 A;  4DQP A;  3RR7 A;  1L3T A;  3JPR A;  3C1Z A;  9ICM A;  4RU9 A;  3FYH A;  2C2E A;  3Q8Q B;  4O9M A;  4RQ0 A;  5DGB A;  4ELT A;  9ICB A;  4JWN A;  5CB1 A;  5DG7 A;  1NJX A;  4RQ3 A;  4F5R A;  5KT6 A;  4DF4 A;  4DFP A;  4KLT A;  3C5F A;  4YN4 A;  1KEJ A;  4I2A A;  4YMM A;  3C23 A;  2XCA A;  3IHQ B;  2ZH7 A;  4P4O A;  4EEY A;  5KT7 A;  4IG8 A;  3ZD9 A;  1KRP A;  5J2G A;  4UB4 A;  1BPB A;  4NY8 A;  8ICK A;  3M8S A;  9ICJ A;  2Q66 A;  2XO7 A;  4UBC A;  4DL4 A;  3HWT A;  2FMQ A;  4P4P A;  9ICC A;  1Z00 A;  2BHN A;  2PFQ A;  1TV9 A;  2HHP A;  4UD4 A;  4PHA A;  4QZC A;  3JPT A;  4TUS A;  3G6Y A;  2C28 A;  2F1I A;  3KHR A;  4ELU A;  4NLZ A;  2PI5 A;  5CP2 A;  1Z3E B;  1KFT A;  5HRG A;  1DGS A;  5J2I A;  3TAN A;  1S0N A;  4DSI A;  3JYY A;  3H8S A;  3H4B A;  2Y1J A;  3ZDC A;  1TAU A;  4FHV A;  4AT8 A;  4RPZ A;  2BR0 A;  1SKR A;  1ZQS A;  4DL7 A;  4ZH4 A;  3LWM A;  1D8Y A;  2FLN A;  4I2G A;  2HVH A;  1K1Q A;  4FHY A;  4NKT A;  2C22 A;  3PX6 A;  3RRG A;  5KFZ A;  5F2V O;  4QWD A;  3WFR E;  4O3N A;  5CHG A;  1JXE A;  5KFO A;  3C1Y A;  4M9J A;  9ICG A;  5CA7 A;  4YMN A;  4KMU A;  4QZA A;  1ZQC A;  7ICT A;  7ICR A;  2RFF A;  4GXJ A;  8ICS A;  1K1S A;  5DGA A;  1TK0 A;  3OHB A;  1L3V A;  2IHM A;  1CEZ A;  4LZD A;  3EW9 A;  3Q8L A;  4J9P A;  1N48 A;  4Q45 A;  3L9D A;  3PVX A;  3N4M B;  4ED2 A;  2DPJ A;  4O5K A;  3OVS A;  2HHW A;  2NRT A;  4R65 A;  4DOB A;  4XUS A;  4YCX A;  5KFP A;  2R8K A;  4RWO A;  3AU6 A;  5J2C A;  4DWI A;  5KFE A;  4B9M A;  4F4Y A;  4P4M A;  2BCU A;  3OUY B;  4F5Q A;  4QZB A;  4MFF A;  2MUT A;  9ICV A;  2VA8 A;  2DRA A;  4DSF A;  4YD1 A;  2W9C B;  3BQ1 A;  4I2H A;  9ICI A;  4YMO A;  5C5J A;  1BPD A;  5DQI A;  3PV8 A;  4XA5 A;  1SKW A;  5KFD A;  1LV5 A;  1ZQK A;  3WFQ E;  1TFR A;  2W9A A;  4J9M A;  2BQR A;  1NKB A;  3ZDD A;  2M2T A;  3MR5 A;  4FHX A;  2DR9 A;  3RAQ A;  1XU4 A;  5IIJ A;  4RNN A;  1S97 A;  5L1J A;  1NK9 A;  4F3O A;  1S77 D;  2M9N A;  4EYH B;  1RYR A;  1BPX A;  4IQW A;  1SZP A;  8ICC A;  4R64 A;  5IIM A;  2B21 A;  4IRC A;  5HP4 A;  2F1H A;  1JIH A;  3GQC A;  4DL2 A;  3PW0 A;  1KSP A;  4O3Q A;  3EZ5 A;  1DK3 A;  1SL1 A;  4DL3 A;  4ED3 A;  3MR2 A;  4F5N A;  4TUP A;  4DS5 A;  3ISC A;  2ATL A;  4KLU A;  8ICR A;  1KLN A;  4X0A A;  4DL6 A;  4YD2 A;  4M9N A;  2FPL A;  8ICE A;  4KLG A;  4Z6E A;  3JPO A;  4EBK A;  2W9M A;  5DQG A;  1A76 A;  3OSN A;  9ICS A;  4MEY A;  3MDC A;  2ZH8 A;  4IR9 A;  4BDP A;  1ZQT A;  1ZQI A;  4FBU A;  5KFA A;  1D9F A;  5F9L A;  1U47 A;  3NYB A;  1X2I A;  1N56 A;  1RZT A;  1ZQN A;  3OHA A;  3C2K A;  5BOM A;  4ECS A;  3WFP A;  1BPZ A;  2PFP A;  5HRH A;  5KG2 A;  5HNK A;  4QZG A;  4WC4 A;  1XSN A;  4Q8E A;  8ICL A;  2KTQ A;  1QLN A;  4F5P A;  4I28 A;  5EWF A;  1UT8 A;  1NJY A;  2UVV A;  4GC7 A;  4LT6 A;  3TI0 A;  1XWL A;  4RUC A;  4XQ7 A;  4RQ6 A;  9ICE A;  4ECQ A;  4GC6 A;  4EBD A;  1X9M A;  1L3S A;  4EBC A;  5J0T A;  4DLG A;  3H37 A;  2DR8 A;  2V4R A;  1X9S A;  5J2E A;  1NK4 A;  3QEB Z;  3TAR A;  5KFF A;  5DBB A;  4DL5 A;  3GFK B;  1JMS A;  2ZH9 A;  3MFI A;  1RXW A;  3T5H A;  3PR5 B;  3OJU A;  3GV7 B;  1ZQL A;  5KT2 A;  7ICJ A;  7ICQ A;  3HX0 A;  2DR5 A;  3Q8S B;  9ICF A;  3JZ0 A;  1U9L A;  1UT5 A;  1ZJM A;  4FH3 A;  4RNM A;  8ICN A;  3OUY A;  4WC6 A;  4PHD A;  2UVR A;  8ICZ A;  2KZ3 A;  5TZV A;  3Q8P B;  1S10 A;  5DG9 A;  2W9C A;  1MQ3 A;  4M9G A;  3RB0 A;  4KLL A;  2HHQ A;  1NKC A;  2VA2 A;  8ICI A;  3RH5 A;  1HUO A;  5KFS A;  4M2Y A;  3WFO A;  3V6J A;  4P2H A;  5DED A;  3UPS A;  3NTU A;  1ZQZ A;  5HHI A;  4JUZ A;  4B9U A;  1LB2 B;  4ATB B;  4RT2 A;  1B22 A;  1S0M A;  5IIN A;  3PO4 A;  1ZQG A;  1FA0 A;  4QZH A;  1QTM A;  3RJE A;  4DQQ A;  4DO9 A;  1COO A;  4NLG A;  2XGQ A;  2XY6 A;  2IMW P;  1KNY A;  4ECT A;  2ZJA A;  2P6U A;  8ICQ A;  3OV7 A;  4J9L A;  7ICF A;  1YLQ A;  3GV5 B;  3ORY A;  2PBE A;  4ELV A;  1UA1 A;  3JPP A;  5J2J A;  2BPC A;  1QSL A;  1S0O A;  4YVZ A;  4J9R A;  2BDP A;  1ZQR A;  2J6S A;  4XQ8 A;  1PZN A;  1ZQQ A;  4JWM A;  2XCP A;  3GDX A;  1ZQA A;  1NK8 A;  4EZ6 A;  4M9L A;  8ICJ A;  2XGP A;  4C8L A;  8ICB A;  1NK5 A;  2HHX A;  4PHP A;  3RBD A;  1TK8 A;  3RJF A;  3B0Y A;  3PW2 A;  5KFT A;  1BNO A;  1JQR A;  4JK1 A;  5L1K A;  1F5A A;  3TAQ A;  5L1I A;  1UEV A;  4Q8F A;  4YXJ A;  3AQL A;  4Q44 A;  4ECV A;  3RB6 A;  4IQU A;  3MGH A;  1SKS A;  3QZ8 A;  4LVS A;  4I2J A;  5KFI A;  2R8I A;  3AUO A;  3PW5 A;  8ICU A;  3T5L A;  3M9N B;  1T8E A;  4BGD A;  1NK6 A;  2P6R A;  4UB5 A;  3TFS A;  1ZQD A;  2KZZ A;  4KTQ A;  2ZH3 A;  1ZQJ A;  4KLO A;  4M9H A;  1SL0 A;  3TAP A;  3H7I A;  5KG6 A;  4PHE A;  9ICX A;  4X4T A;  1JN3 A;  1SL2 A;  4Q43 A;  3V7K A;  2W8L A;  2R8G A;  1EXN A;  5HRE A;  4FHW A;  4GXK A;  4XRH A;  2HHT A;  5J0W A;  3G6X A;  1ZQO A;  1NO5 A;  3C66 A;  1RPL A;  4TQS A;  4B9N A;  2VAN A;  3PX0 A;  3PML A;  1RYS A;  2BGW A;  3BDP A;  4WC2 A;  2ZTE A;  3K75 D;  4ECZ A;  4J9Q A;  4QWB A;  4QW9 A;  2PFN A;  2M2V A;  2BCR A;  1MC8 A;  4NM2 A;  1U45 A;  2BCS A;  1U4B A;  4O3R A;  4MFA A;  7ICN A;  1XC9 A;  4EZ9 A;  4FO6 A;  5DQH A;  4K4I A;  4IQV A;  1TAQ A;  1ZQY A;  1KFD A;  3V7J A;  4F50 A;  2BCV A;  1D9D A;  4B9V A;  4KLI A;  2HVI A;  4QZE A;  2AGO A;  4BXO B;  4ATB A;  2DVI A;  3OJS A;  2ZUB A;  4BWM A;  3C2M A;  3H8W A;  4I2E A;  5J2H A;  4X5V A;  4RNO A;  2V9W A;  1HJP A;  7ICP A;  4C8O A;  4DLE A;  4IRD A;  4O3S A;  4O3P A;  1BPY A;  5J2K A;  3EPI A;  1QSS A;  2FMS A;  3HJ4 A;  2XC9 A;  3GV8 B;  1WCL A;  2BQU A;  9ICT A;  1JAJ A;  1PX5 A;  4F5O A;  1KTQ A;  1MIW A;  2ASL A;  3ISB A;  2JEF A;  3UXN A;  4CCH A;  2BQ3 A;  4O3O A;  2W9B B;  1XSP A;  5HRK A;  3UQ2 A;  1BGX T;  1BPE A;  1XO1 A;  4UAY A;  3KHL A;  4IR1 A;  3V6K A;  4YR2 A;  2R8H A;  1L3U A;  4WC3 A;  3PMN A;  3C21 A;  5KG0 A;  4DEZ A;  1Y88 A;  4ECW A;  9ICO A;  4ECR A;  2ZH5 A;  4YG2 A;  3MDA A;  4X4U A;  2ID1 A;  2GWS A;  5HMM A;  3RB3 A;  5EWG A;  3RTV A;  8ICH A;  8ICY A;  4UB2 A;  4I29 A;  4M6W A;  3H40 A;  4QWE A;  3T5K A;  4RQ5 A;  4B9S A;  4RUA A;  4UBB A;  5BOL A;  1ZQB A;  3TFR A;  3ZDE A;  3C2L A;  4DQR A;  4E0D A;  1R8C A;  4UB1 A;  4UQG A;  1TVA A;  2BKE A;  1ZQU A;  3EPG A;  3C5G A;  4PH5 A;  5DB9 A;  3H4D A;  2BCQ A;  4UAW A;  8ICA A;  5J2D A;  1NKE A;  5J0R A;  4YQW A;  5J0P A;  9ICN A;  4RWN A;  4RQ2 A;  5EOZ A;  2I1Q A;  2KN7 A;  4MF2 A;  1S0V A;  3GIL A;  3LDA A;  4Z6D A;  4GXI A;  3PNC A;  2PFO A;  3RJJ A;  1S9F A;  4WBY A;  3PY8 A;  4ED1 A;  1JX4 A;  2F1J A;  2LYH A;  7ICS A;  4KLE A;  2NRW A;  1T7P A;  4UD5 A;  2RDI A;  4KN7 A;  5III A;  5DKW A;  2MAX A;  4MEX A;  3AQN A;  4X4P A;  2NRZ A;  5KFK A;  3M9O B;  4F4Z A;  4EBE A;  9ICK A;  3LQC B;  4LZG A;  3JPN A;  4AT9 B;  3T5J A;  2FLL A;  5IIL A;  4J9K A;  2ZJ8 A;  4BWJ A;  5KFJ A;  5CWR A;  3HW8 A;  3KTQ A;  8ICP A;  1VJ7 A;  2O1P A;  5DBA A;  2A1J B;  3ZDB A;  1ZQV A;  2R8J A;  4RQ8 A;  4M5D A;  3UXO A;  5HRD A;  3UQ0 A; 
#chains in the Genus database with same CATH topology
 1NZB A;  5KFR A;  2KHV A;  3JPS A;  4C8K A;  3F53 A;  1ZYQ A;  3PO5 A;  2ZH2 A;  1TFY A;  2ASD A;  2KKV A;  5B3Q A;  4X4S A;  4UB8 U;  5EE1 A;  2Y0S C;  4RWP A;  3MR6 A;  3GII A;  3MGI A;  4ED6 A;  1MQ2 A;  3ICX A;  1NI3 A;  1DOQ A;  7ICL A;  7ICI A;  2F8K A;  3RJI A;  4DSE A;  1VFG A;  4F2S A;  2HBK A;  9ICH A;  2NRK A;  1T3N A;  5G5G A;  5D49 A;  1PUZ A;  1L7P A;  4QWC A;  3EYZ A;  5HHH A;  4F4X A;  1SZH A;  2KJ5 A;  3H8J A;  3SR6 A;  4DS4 A;  4O0I A;  2C2R A;  4KN4 A;  5ALK A;  4Z6C A;  2I9G A;  2GH1 A;  1BVS A;  4FS2 A;  4KLQ A;  4FS1 A;  3JPQ A;  3TAD A;  4PGY A;  3QZ7 A;  4KLF A;  4R8U B;  2AU0 A;  4DQI A;  4DFK A;  5KAI U;  3FC4 A;  2BE3 A;  1WCN A;  4U7C A;  4OJ6 A;  2G06 A;  4DSK A;  5ALG A;  4I0U A;  2UVW A;  3ER9 B;  2XY7 A;  1SWV A;  2G07 A;  4F2R A;  3H0R B;  3RB4 A;  5L9X A;  2JZB A;  1KQQ A;  5ALR A;  2HW3 A;  8ICX A;  2M2W A;  3KZX A;  4M47 A;  2G5I B;  2JH1 A;  4RPY A;  5HRB A;  3I1Y A;  4WC5 A;  4X4O A;  2WF6 A;  3OGU A;  1MN8 A;  3N97 B;  3KFU F;  2O5A A;  4G3I A;  5D46 A;  5CEH A;  5KFH A;  5J0S A;  3NVO A;  3D2S A;  1KDH A;  5KFQ A;  2JEI A;  2HMX A;  5EWE A;  2EAP A;  3B0X A;  2N1R A;  5AKI A;  3AU2 A;  3HIY A;  1S76 D;  2ZXI A;  4X0B A;  2FI1 A;  9ICP A;  5AK4 A;  3E0F A;  3OVB A;  4K4H A;  5KFM A;  5HRI A;  1N63 A;  4JLX A;  2H5X A;  2KEY A;  1HUZ A;  1R8A A;  4CGZ A;  4Z6F A;  4WOY A;  2LM1 A;  1RDF A;  3C28 A;  1ZET A;  2EH9 A;  4KLM A;  2DPI A;  2AGP A;  4NKU A;  3IG5 A;  3RJK A;  1R89 A;  4EX7 A;  4AT8 B;  2ZIU B;  5J0X A;  1RG6 A;  4N7R A;  4DFD A;  2MSN A;  2ZXH A;  4KLS A;  3NS1 A;  2HHV A;  1UEU A;  5DEC A;  5EE9 A;  2RQ5 A;  3EF2 A;  4OAI Z;  5JTI A;  2I5H A;  3G6V A;  4FH5 A;  4EEK A;  1SXD A;  5D61 A;  1GO3 F;  2KSO B;  4PZN A;  3SYZ A;  4UB3 A;  2KFZ A;  4EV6 A;  1Z4N A;  2AH5 A;  4IRK A;  2K60 A;  2E8P A;  4NXZ A;  1L3T A;  9ICM A;  5AM5 A;  4ELT A;  5CB1 A;  1NJX A;  4RQ3 A;  4F5R A;  4KLT A;  4A8E A;  4YMM A;  1HIW A;  3IHQ B;  2ZH7 A;  4IG8 A;  2ZIX A;  5KT7 A;  3ZD9 A;  2DGZ A;  4EGW A;  1N5W A;  4NY8 A;  2XO7 A;  3CNH A;  4P4P A;  5AM1 A;  2PFQ A;  3NRZ A;  4USA A;  4KX3 A;  2GO7 A;  2C28 A;  3KHR A;  4EED A;  5CP2 A;  1DGS A;  2Y9T A;  3TAN A;  1S0N A;  1YT3 A;  3H8S A;  1ZRM A;  2HI0 A;  4FHV A;  4RPZ A;  2MU2 A;  4ZH4 A;  3WK4 A;  4FHY A;  3RRG A;  3C1Y A;  2YTU A;  1PK1 A;  5CA7 A;  4YMN A;  3ER8 C;  4KMU A;  3N7S C;  3HKZ F;  1OUQ A;  3Q8L A;  2LHT A;  1M6Y A;  4O5K A;  4US8 A;  2FCL A;  4RWO A;  4B9M A;  2LM4 A;  3M1Y A;  4P4M A;  1V97 A;  4QZB A;  2MUT A;  4MKP A;  3D2N A;  2VA8 A;  9ICI A;  2W9C B;  5C5J A;  3PV8 A;  5DQI A;  1LV5 A;  3WFQ E;  5AIC A;  1TFR A;  2W9A A;  2BQR A;  3ZDD A;  5AK3 A;  1OW5 A;  1YZ7 A;  3CYM A;  2FJ6 A;  5ALO A;  2M9N A;  1RYR A;  1BPX A;  1N5X A;  8ICC A;  1KKX A;  2B21 A;  2KOB A;  3QU2 A;  1LVH A;  3GQC A;  1KSP A;  4O3Q A;  4DL3 A;  3MR2 A;  4F5N A;  4TUP A;  3ISC A;  2ATL A;  4KLU A;  4M9N A;  2W7P A;  3A0H U;  4KLG A;  4EBK A;  1A76 A;  5B3P A;  2KNJ A;  3MDC A;  3IV6 A;  3K1Z A;  4CE6 A;  4FBU A;  2KD1 A;  3NYB A;  5F9L A;  1ZQN A;  3C2K A;  5BOM A;  4ECS A;  1PK3 A;  3EUB 2;  2A3V A;  1ZQ1 C;  4WC4 A;  2B6G A;  8ICL A;  4LT6 A;  2F44 A;  1V85 A;  1NJY A;  4HAI A;  4XQ7 A;  4RUC A;  4UAU A;  3H37 A;  1Q3U A;  4BJQ A;  1RXW A;  3PR5 B;  3GV7 B;  1ZQL A;  7ICQ A;  5KT2 A;  3Q8S B;  2W7O A;  2G0A A;  1ZJM A;  3ALR A;  4RNM A;  3OUY A;  2UVR A;  4KLL A;  2DF4 B;  2H3Z A;  5KFS A;  4P2H A;  1ZQZ A;  5HHI A;  4ATB B;  4RT2 A;  2KKP A;  2DQN B;  3ERC C;  2F3N A;  1FFU A;  1QQ6 A;  2XGQ A;  5AIA A;  3OV7 A;  2VKQ A;  7ICF A;  3GV5 B;  2PBE A;  3JPP A;  1OXJ A;  5J2J A;  4O67 A;  4FZN A;  4J9R A;  3BS5 A;  2BDP A;  3U26 A;  1ZD4 A;  2XCP A;  3GDX A;  4EZ6 A;  4MHV A;  4PHP A;  3RBD A;  3B0Y A;  3PW2 A;  1JQR A;  4JK1 A;  3M6Z A;  5L1I A;  4Q8F A;  3QZ8 A;  2R8I A;  3PW5 A;  4EEL A;  1JUD A;  1ZQJ A;  1X40 A;  3L5K A;  3H7I A;  4X4T A;  1SL2 A;  4FHW A;  4Q43 A;  5HRE A;  3N7R C;  4GXK A;  1NO5 A;  3M7D A;  3QNM A;  4TQS A;  3AL0 B;  3PX0 A;  2YY6 A;  1T94 A;  3PSP A;  2EAM A;  2WF9 A;  2QKQ A;  1XC9 A;  5DQH A;  5D62 A;  4F50 A;  2CXY A;  2F2A B;  2BCV A;  2D3D A;  2E5S A;  4KLI A;  1RQN A;  2DVI A;  3OJS A;  2ZUB A;  4BWM A;  1WYG A;  5CFS A;  4RNO A;  4C8O A;  2LPE A;  4IRD A;  4O3P A;  1QSS A;  2FMS A;  1WCL A;  2W55 A;  9ICT A;  2NV3 A;  1MIW A;  3ISB A;  2BQ3 A;  5AI0 A;  4O3O A;  1ECW A;  3KHL A;  1XO1 A;  4UAY A;  4F71 A;  3C21 A;  5KG0 A;  4DEZ A;  4ECW A;  9ICO A;  1D8B A;  4YG2 A;  3RTV A;  8ICY A;  3T5K A;  2G08 A;  2ESE A;  4E0D A;  3TFR A;  4PZO A;  2BCQ A;  4EX6 A;  4YQW A;  4Z6D A;  4GXI A;  3RJJ A;  5AI9 A;  2HN1 A;  4KLE A;  5III A;  4MEX A;  2MAX A;  4O3M A;  1WUD A;  1TAM A;  2NRZ A;  5KFK A;  3M9O B;  9ICK A;  3RFA A;  4LZG A;  3JPN A;  3T5J A;  4J9K A;  2O1P A;  2WF5 A;  5DBA A;  4K96 A;  3K7D A;  1JI7 A;  3BQT A;  2PI4 A;  4UAV A;  3PX4 A;  1UHU A;  3Q8R B;  1QQ5 A;  2H3Q A;  2BBJ A;  3E2E A;  1JRO A;  3FM9 A;  3QU7 A;  4K97 A;  4I2I A;  1NZP A;  3LWL A;  5KT3 A;  5DDM A;  2W9B A;  5AHX A;  5J0Y A;  4LEY A;  1XO0 A;  4J03 A;  4S3N A;  4NJ8 A;  2W43 A;  7ICU A;  2K4E A;  2DR7 A;  1Z1B A;  4K99 A;  1XS9 D;  4P0P A;  3MR3 A;  4JB3 A;  4GIB A;  4AYB F;  4O69 A;  3SI8 A;  4WC1 A;  4DFJ A;  3Q8K A;  4NLK A;  3RAX A;  1ZQH A;  4F92 B;  5ALM A;  1A77 A;  1SV0 C;  4PL2 A;  2QB0 B;  2QAR B;  4I2C A;  4ECU A;  1L8O A;  3RRH A;  2B51 A;  1ZD5 A;  5ALJ A;  4F4W A;  2A1J A;  1NJZ A;  2ZUC A;  4HYK A;  1X9W A;  2H3I A;  4CNQ A;  3RR8 A;  4C8M A;  4RT3 A;  3UMC A;  2ZIU A;  4I2D A;  3IM1 A;  4E80 A;  1TK5 A;  2EDU A;  3KD3 A;  7ICO A;  3FDS A;  9ICA A;  4YXM A;  3PZP A;  4F4K A;  1RYU A;  1FO4 A;  4YR0 A;  2XID A;  1ED1 A;  3KOO A;  4F93 B;  3ZD8 A;  5KT4 A;  4ED0 A;  4OAF A;  4CRX A;  3TKA A;  5DB8 A;  2EAN A;  1RXV A;  1B4F A;  4PGX A;  3D6J A;  3KZI U;  2Q0Z X;  5AKY A;  2Y1I A;  3H0L B;  2ZIV A;  4YR3 A;  3NGD A;  4WQL A;  4QZF A;  3ISD A;  1V4A A;  4KLJ A;  4ED7 A;  4QWA A;  4PPX A;  1KFS A;  2LYA A;  2DRB A;  3AMZ A;  4NV0 A;  5KFW A;  1JAL A;  2YMQ A;  5AM3 A;  3H3A A;  3S6J A;  5HRF A;  3I76 A;  4JV0 A;  3PR4 A;  2K4I A;  2JHD A;  2VA3 A;  4KLH A;  2KJ9 A;  5KG1 A;  3PW7 A;  5HRL A;  2B4V A;  4K9B A;  4C4S A;  2HBM A;  4UAR A;  2VJ4 A;  3N28 A;  3RBE A;  5IIK A;  2ISO A;  1R8B A;  4UAZ A;  2ZUD A;  2NRX A;  5KFB A;  4Y2Y A;  2OYY A;  1J97 A;  5KFC A;  1V38 A;  3OPX A;  2PXI A;  2G5H B;  2M2U A;  4ED8 A;  2LBO A;  1L5U A;  4ECY A;  3TQ1 A;  2P66 A;  3FAH A;  3PW4 A;  4X4R A;  1MSW D;  3HPO A;  2J6U A;  5HR9 A;  2H3V A;  3TAD C;  1VLB A;  5GTH U;  3GIK A;  4C4R A;  1IIP A;  7ICE A;  3UPQ A;  3THV A;  1DXS A;  1ZQX A;  4F91 B;  2DL0 A;  3HP6 A;  2BZF A;  4Y2V A;  2CRX A;  4P0Q B;  2HBL A;  5DB6 A;  1V9P A;  3V6H A;  5DDY A;  2HDO A;  4AT7 B;  4RQ7 A;  3RR7 A;  3OTQ A;  2W11 A;  3Q8Q B;  4RQ0 A;  3GU3 A;  5KT6 A;  1KEJ A;  2JR5 A;  4I2A A;  2XCA A;  4LEW A;  5J2G A;  2PKE A;  4JLZ A;  2Q66 A;  4CDG A;  4DL4 A;  1DGJ A;  9ICC A;  1Z00 A;  2HBJ A;  4TUS A;  3PSF A;  3G6Y A;  4ELU A;  3QXG A;  1F5S A;  1KFT A;  2IUB A;  4OAH A;  5KAF U;  5CFT A;  2BR0 A;  1ZQS A;  4NL9 A;  2FLN A;  2C22 A;  5F2V O;  5ALV A;  1JXE A;  1ZQC A;  4OJL A;  7ICT A;  2RFF A;  4GXJ A;  1K1S A;  1O03 A;  1TK0 A;  2IHM A;  4Q45 A;  2VJ5 A;  2DBY A;  4ED2 A;  5AKE A;  2NRT A;  2WHE A;  5ALP A;  2R8K A;  4F72 A;  5ALF A;  3AU6 A;  3VC8 A;  5J2C A;  4DWI A;  4F4Y A;  2H3F A;  4F5Q A;  4MFF A;  4DSF A;  5AIB A;  4J9M A;  2M2T A;  2DR9 A;  4LEV A;  4QIW F;  4RNN A;  1WWU A;  1NK9 A;  4F3O A;  1S77 D;  2KJ8 A;  4K8V A;  1P7D A;  5IIM A;  3DV9 A;  5HP4 A;  1JIH A;  4ICA A;  1DK3 A;  3EZ5 A;  4DS5 A;  3IRU A;  4YD2 A;  2FPL A;  3JPO A;  2ZG6 A;  2W9M A;  5AI8 A;  3AN1 A;  5JTG A;  2NO4 A;  5KFA A;  1D9F A;  1N56 A;  3OHA A;  1KL9 A;  2JV3 A;  5HNK A;  4QZG A;  2KTQ A;  1WG8 A;  3NWI A;  4I28 A;  1L3S A;  1UQV A;  3L4P A;  5AKG A;  3GZF A;  1GPJ A;  5KFF A;  3H0M B;  4DL5 A;  2WB1 F;  1JMS A;  3OJU A;  7ICJ A;  2DR5 A;  2K8C B;  3HKZ C;  8ICN A;  4C7Z A;  2E8M A;  4PHD A;  5TZV A;  1MQ3 A;  3RB0 A;  8ICI A;  3RH5 A;  4KM5 A;  4JUZ A;  1LB2 B;  2KG5 A;  5IIN A;  2KVS A;  3UM9 A;  3RJE A;  1COO A;  5ALU A;  2ZJA A;  5KL1 B;  8ICQ A;  3WK6 A;  1YLQ A;  2OH2 A;  3WKC A;  4YVZ A;  5AI6 A;  4XQ8 A;  1PZN A;  1NK8 A;  8ICB A;  5H2F U;  3QUQ A;  2KIW A;  3RB6 A;  8ICF A;  1SKS A;  3T5L A;  4BGD A;  2KZZ A;  4KLO A;  2ZIW A;  1SL0 A;  4M9H A;  2HSZ A;  4PHE A;  3V7K A;  1EXN A;  2QLT A;  2HHT A;  1K5O A;  3C66 A;  4EEN A;  2ZTE A;  3K75 D;  4J9Q A;  2BCS A;  5F3X B;  7ICN A;  4EZ9 A;  4K4I A;  5E79 U;  2YQE A;  1D9D A;  4QZE A;  5ALY A;  4QJF B;  4FO1 A;  3H8W A;  4I2E A;  5J2H A;  4X5V A;  7ICP A;  4O3S A;  2Y9U A;  5J2K A;  2OM6 A;  1PX5 A;  2K8B B;  2JEF A;  4CCH A;  2W3R A;  4IR1 A;  4AP9 A;  1Y88 A;  2E8O A;  4ECR A;  5EWG A;  2W54 A;  4UB2 A;  4I29 A;  4QWE A;  4B9S A;  4RQ5 A;  5BOL A;  4DQR A;  3BQ7 A;  4UB1 A;  4UQG A;  1TVA A;  3EPG A;  3WKA A;  4PH5 A;  5DB9 A;  3H4D A;  2B0C A;  4NLB A;  5J0P A;  9ICN A;  4C7Y A;  1S0V A;  4MF2 A;  3LDA A;  1Q3V A;  4PL1 A;  1S9F A;  4WBY A;  3PY8 A;  4B6J A;  2F1J A;  4IC9 A;  1RM6 C;  1T7P A;  4UD5 A;  2RDI A;  5DKW A;  3AQN A;  5AK6 A;  4EBE A;  4F4Z A;  3LQC B;  3KKA A;  2FLL A;  3KTQ A;  4BWJ A;  1VJ7 A;  4K98 A;  3ZDB A;  1ZQV A;  3C29 A;  3UXO A;  5HRD A;  3UQ0 A;  1ZQD A;  5J29 A;  4RQ1 A;  3KHG A;  4WC0 A;  3T3F A;  4QZD A;  4BXO A;  2JZB B;  4RPX A;  3BQ0 A;  8ICW A;  2NRV A;  3NVY A;  2IHN A;  5DB7 A;  2FDR A;  3AQK A;  4DSL A;  7ICG A;  2WF8 A;  3MAB A;  5KFU A;  1UA0 A;  5J8Y A;  4EYI B;  5JRT A;  3QEA Z;  5KFN A;  3AQE A;  2KP7 A;  3J81 j;  4M04 A;  3SV4 A;  5KTQ A;  4QNL A;  3V72 A;  2B56 A;  2PMZ F;  4EEB A;  3MFH A;  4U6P A;  1X6I A;  4AT9 A;  1LKY A;  3V7L A;  4C4T A;  1KBU A;  2WTF A;  3BS7 A;  2XVT A;  3ETL A;  3ZI4 A;  2YB4 A;  3SMV A;  2KZM A;  1C20 A;  1UET A;  3WFS C;  5J2F A;  1PVQ A;  1TKD A;  4J9N A;  1ZQE A;  5HR7 A;  9ICR A;  4DOA A;  2W8K A;  3RJH A;  4WC7 A;  3Q8M A;  4WBZ A;  2KE7 A;  1IV8 A;  5DBC A;  4OO1 J;  2IA6 A;  4B9L A;  5AI5 A;  3OSP A;  3OVA A;  1J2N A;  3QU5 A;  2NYV A;  2IOF K;  4YFK A;  5ALW A;  4NLN A;  2AGQ A;  4AT7 A;  2A1A A;  1NOM A;  4X4N A;  3CP8 A;  9ICW A;  2FPM A;  5HC9 A;  1NK0 A;  2GOL A;  1TFW A;  1JXL A;  2GAF D;  4ECX A;  1KN5 A;  2KHQ A;  4R63 A;  1L8L A;  4AYB C;  5ALN A;  4R8U A;  2YX8 A;  2BPG A;  2KMD A;  4RZR A;  3HJ1 A;  3MBY A;  5CR0 A;  4E8F A;  3L3F X;  2ZTC A;  2EZX A;  2WFA A;  4GFJ A;  5KG3 A;  1NJW A;  1ZQP A;  2F76 X;  3A0B U;  2NO5 A;  3RH6 A;  5BPC A;  4OCZ A;  5DLF A;  4PJ0 U;  7ICV A;  4K4G A;  4QZ9 A;  4EBJ A;  5AKK A;  3LK9 A;  5IIO A;  5HR6 A;  2HHU A;  1J2M A;  4GLX A;  2IHO A;  9ICL A;  2XY5 A;  1F0M A;  4LJX A;  4X4Q A;  3PSI A;  1QCK A;  2DFL A;  1X6J A;  5DG8 A;  3GIJ A;  3K1R B;  3BJY A;  1PVR A;  3ZDA A;  5J0Q A;  4R66 A;  2OWO A;  2FLP A;  4O5E A;  1ZQM A;  2DKX A;  4FHP A;  8ICM A;  3BQ2 A;  7ICM A;  1S8O A;  3LVW A;  4TQR A;  4I2B A;  1ZRN A;  2FPK A;  2EZY A;  1ZQF A;  8ICV A;  5KFL A;  3H38 A;  3UMG A;  4LEZ A;  2MUT B;  2ZH1 A;  3SZ2 A;  4DQP A;  5DGB A;  9ICB A;  5DG7 A;  5B5E U;  2LKY A;  3AQF A;  4YN4 A;  4Y2S A;  4Y2P A;  3C23 A;  5FP0 A;  3SAH A;  3M8S A;  9ICJ A;  4NXU A;  4UBC A;  3SAG A;  3HWT A;  2FMQ A;  1Z19 A;  2HHP A;  4UD4 A;  4QZC A;  4NLZ A;  1Z3E B;  5J2I A;  4DSI A;  3JYY A;  3PHZ A;  5KL8 B;  3H4B A;  2Y1J A;  4AT8 A;  4OAG A;  2HVH A;  4I2G A;  3LWM A;  4NKT A;  1K1Q A;  3PX6 A;  3WFR E;  5KFZ A;  2XI9 A;  4QWD A;  4O3N A;  5CHG A;  9ICG A;  5KFO A;  4M9J A;  4QZA A;  7ICR A;  2M0N A;  3HRD D;  5DGA A;  3OHB A;  3EW9 A;  5B66 U;  1N48 A;  3PVX A;  3N4M B;  4R65 A;  4XUS A;  4YCX A;  4ACO A;  2KSO A;  4UW9 A;  5KFE A;  3MC1 A;  3OUY B;  4C80 A;  3B9J A;  2EZZ A;  3F2B A;  9ICV A;  3WK5 A;  4YD1 A;  4I2H A;  5ALT A;  1BPD A;  1SKW A;  1ZQK A;  4UB6 U;  5KFD A;  1NKB A;  3RAQ A;  1RQL A;  1XU4 A;  2E1F A;  3CK6 A;  4DCC A;  4DL2 A;  5CRX A;  4X0A A;  4DL6 A;  1F44 A;  4OJ5 A;  3BS5 B;  3OSN A;  9ICS A;  4MEY A;  2ZH8 A;  4BDP A;  3NKU A;  1U47 A;  1X2I A;  3WFP A;  2DKZ A;  2JH7 A;  1BPZ A;  2HOI A;  2EQY A;  1XSN A;  2P35 A;  3SQI A;  2K89 A;  5EWF A;  2UVV A;  4GC7 A;  3TI0 A;  4RQ6 A;  4ECQ A;  4EBD A;  2I6X A;  5J0T A;  4EBC A;  1NK4 A;  3QEB Z;  5EE0 A;  5DBB A;  2ZH9 A;  3OWG A;  5ALX A;  3MFI A;  4ZOH C;  4UAT A;  2D8C A;  3HX0 A;  1U9L A;  4FH3 A;  4IL6 U;  4RQM A;  3LYS A;  8ICZ A;  5AI4 A;  5DG9 A;  2W9C A;  2HHQ A;  2RHF A;  2VA2 A;  4M2Y A;  2D6F C;  3V6J A;  3UPS A;  1N62 A;  4NXV A;  4B9U A;  4Y2X A;  1ZQG A;  5AM0 A;  1FA0 A;  4QZH A;  4NL9 C;  4NLG A;  1KNY A;  5GTI U;  1L7M A;  1X66 A;  5ALD A;  3ORY A;  4ELV A;  1X42 A;  1B0X A;  4QIW C;  1S0O A;  5AM2 A;  2F77 X;  3NVW A;  1ZQR A;  8ICJ A;  1COK A;  2CN1 A;  4UAS A;  1NK5 A;  2HHX A;  3RJF A;  1TK8 A;  5KFT A;  1BNO A;  4BX9 C;  5L1K A;  2WAQ F;  3TAQ A;  1F5A A;  4KB6 A;  3AQL A;  4ECV A;  1A0P A;  3NVZ A;  4IQU A;  2DWQ A;  4I2J A;  5KFI A;  4C0Z A;  3AUO A;  1QQ7 A;  1T8E A;  1NK6 A;  2P6R A;  3TAC B;  4UB5 A;  4XJE A;  1VDV A;  2KIC A;  2QB1 A;  4KTQ A;  2ZH3 A;  4KX5 A;  3N7P D;  2OEH A;  5KG6 A;  3QX7 A;  1JN3 A;  4JMU A;  3RF9 A;  2O6K A;  4XRH A;  1ZQO A;  2VAN A;  2K4P A;  1VJ5 A;  5JU5 A;  4WC2 A;  4CF4 A;  4ECZ A;  2VIX A;  4QW9 A;  2ES6 A;  2Y0S F;  1MC8 A;  2BCR A;  2M2V A;  1U45 A;  3E58 A;  1U4B A;  2WB1 C;  4FO6 A;  3F2C A;  3T79 A;  4IQV A;  1TAQ A;  1KFD A;  4ATB A;  3CW2 C;  2IOF A;  1HJP A;  3O0F A;  3EPI A;  2XC9 A;  1JRP A;  2BQU A;  1JAJ A;  4F5O A;  3UXN A;  1QH9 A;  2R18 A;  2W9B B;  4O68 A;  1XSP A;  3IG8 A;  3UQ2 A;  4WQK A;  3V6K A;  2R8H A;  4YR2 A;  1L3U A;  5T14 A;  3PMN A;  4WC3 A;  2ZH5 A;  3MDA A;  2ID1 A;  1WWV A;  2GWS A;  3WK7 A;  3IDW A;  3H40 A;  4RUA A;  4UBB A;  1R8C A;  1ZQU A;  2BKE A;  3C5G A;  4P0P B;  5J2D A;  1NKE A;  5J0R A;  4RWN A;  2I1Q A;  2KN7 A;  3M6K A;  4ED1 A;  1DRG A;  1T3Q A;  5ALZ A;  2LYH A;  3WK8 A;  1JX4 A;  5AKH A;  2NRW A;  4KN7 A;  3SD7 A;  1ZXI A;  5IIL A;  5KFJ A;  5CWR A;  3HW8 A;  3VCB A;  2GA9 D;  2A1J B;  1L7N A;  7ICS A;  4OJP A;  1QSY A;  2ZTD A;  3M8R A;  1ZOL A;  5KT5 A;  4JV1 A;  1Q78 A;  5KG4 A;  3QUB A;  3H39 A;  2ZH4 A;  2HHS A;  1DK2 A;  2UVU A;  3D2Q A;  4PGQ A;  4QW8 A;  4DSJ A;  4X4V A;  5L1L A;  1B43 A;  4TUQ A;  4DOC A;  1IXR A;  3EWA A;  4RQ4 A;  2ISP A;  5CJ7 A;  3HT3 A;  2ZH6 A;  4F8R A;  1H38 A;  1XSL A;  2F8L A;  4J9S A;  3QUT A;  1SIJ A;  4MF8 A;  2ZIV B;  2AQ0 A;  4M6W B;  3AQM A;  1ZD2 P;  5L1M A;  2A19 A;  1Z4O A;  1ZJN A;  2ALZ A;  2V4Q A;  2YML A;  2W3S A;  3IP4 B;  2ZHA A;  1S5L U;  5KFX A;  5KFY A;  3RH4 A;  3WKE A;  1HEK A;  3M9M B;  4M0A A;  2JEJ A;  9ICU A;  4QZI A;  1Q79 A;  3AEV A;  2HCF A;  3PST A;  4B9T A;  4RQN A;  1NNL A;  5AKZ A;  3F5E A;  9ICQ A;  1OU5 A;  3ETR A;  1MIY A;  2J6T A;  2RRD A;  3H8M A;  2YN4 A;  4Y2T A;  3K4G A;  1D8L A;  7ICH A;  2RDJ A;  5KG5 A;  2C2D A;  1KW4 A;  1BNP A;  4HX0 A;  5CFU A;  4FFD A;  2WF7 A;  2MRL A;  2KFN A;  3UXP A;  3SEN A;  2MA1 A;  1Q8K A;  2AHO B;  3KKA C;  1U48 A;  2OCE A;  3GIM A;  3SV3 A;  4NM1 A;  4JV2 A;  4K9A A;  1T4G A;  5G5H A;  4NXT A;  4DF8 A;  5ALS A;  4KIT B;  3SEI A;  1N60 A;  4MFC A;  3C18 A;  4QZ8 A;  5J0O A;  4FBT A;  1URJ A;  5J2A A;  2JEG A;  3WK9 A;  3BZK A;  8ICT A;  3KHH A;  8ICO A;  2QB0 A;  2QAR A;  5HML A;  2CPR A;  5DLG A;  1N2X A;  2LMR A;  4I27 A;  2E1E A;  4E7X A;  1FFV A;  2ASJ A;  5KFG A;  5D4B A;  1YZ6 A;  4TUR A;  3QE9 Y;  4US9 A;  3LVV A;  5F9N A;  1NK7 A;  5KG7 A;  2AQ4 A;  2PMZ C;  2BPF A;  1Z00 B;  4KLD A;  2YB1 A;  2RP5 A;  5J8Y C;  5J2B A;  4CF3 A;  5D63 A;  4WCW A;  4DFM A;  2FMP A;  4J9O A;  8ICG A;  4I2F A;  4DQS A;  7ICK A;  1ARO P;  1U49 A;  3HIL A;  1TE2 A;  4WH5 A;  2W04 A;  4YP3 A;  1ZQW A;  2ZHB A;  1CUK A;  2IBK A;  4EP7 A;  3RJG A;  3WKD A;  2E3T A;  1O08 A;  3ONN A;  5JUM A;  2ODG A;  1MIV A;  2LYB A;  4C8N A;  2KVC A;  5KFV A;  1IM4 A;  5K4L A;  2AJQ A;  3MCR A;  5ALE A;  4IQT A;  4O5C A;  4Y2U A;  2ZJ5 A;  5J0U A;  3SAF A;  1C7Y A;  4RWQ A;  1WOT A;  3JPR A;  3C1Z A;  4RU9 A;  3FYH A;  2C2E A;  4O9M A;  1SXE A;  2YMP A;  2Z7J A;  4JWN A;  4DF4 A;  3BZC A;  4DFP A;  3C5F A;  2JXJ A;  2G09 A;  3UMB A;  2W03 A;  3QU4 A;  4P4O A;  4EEY A;  4FZM A;  1KRP A;  1N61 A;  4UB4 A;  1BPB A;  8ICK A;  2BHN A;  1TV9 A;  1AQ6 A;  4PHA A;  3JPT A;  4O6A A;  2BDU A;  2F1I A;  2PI5 A;  5HRG A;  3KBB A;  5ALH A;  3ZDC A;  1X9X A;  1TAU A;  4G9B A;  1SKR A;  4DL7 A;  1D8Y A;  5ALL A;  1CI4 A;  4NXX A;  3MGV A;  8ICS A;  1L3V A;  1CEZ A;  3JCF A;  4LZD A;  3QYP A;  4Y2R A;  4J9P A;  3L9D A;  4OD0 A;  2DPJ A;  3OVS A;  2HHW A;  4DOB A;  5KFP A;  1UPH A;  1IG6 A;  1SGG A;  3DDH A;  4P0Q A;  2BCU A;  3NVV A;  5C0Y A;  2DRA A;  2EWR A;  3BQ1 A;  4YMO A;  4XA5 A;  4FHX A;  3MR5 A;  5IIJ A;  1S97 A;  4CF5 A;  5L1J A;  1ZD3 A;  3CRX A;  4EYH B;  4IQW A;  1SZP A;  4R64 A;  4IRC A;  1L6N A;  2F1H A;  3PW0 A;  1SL1 A;  4ED3 A;  8ICR A;  1KLN A;  2ZIX B;  5ALQ A;  8ICE A;  2KIV A;  3AM9 A;  4Z6E A;  5DQG A;  4OJO A;  4IR9 A;  1ZQT A;  1ZQI A;  5AKX A;  4Y2Q A;  1FIQ A;  1RZT A;  5CHE A;  1PVP A;  2PFP A;  4NLC A;  5HRH A;  5KG2 A;  4Q8E A;  1FEZ A;  2K4H A;  1QLN A;  4F5P A;  1UT8 A;  3R9K A;  1XWL A;  9ICE A;  4GC6 A;  1X9M A;  2DR8 A;  2AXT U;  4DLG A;  2ZIW B;  2V4R A;  1X9S A;  5J2E A;  4WJ3 B;  1PK1 B;  3TAR A;  3QU9 A;  2Q4T A;  1A6S A;  3GFK B;  2BBH A;  3T5H A;  4FE3 A;  1Q46 A;  9ICF A;  3ED5 A;  5AK5 A;  1UT5 A;  3JZ0 A;  4WC6 A;  2KZ3 A;  3Q8P B;  1S10 A;  3HJ4 A;  4M9G A;  2HN2 A;  1NKC A;  1HUO A;  3WFO A;  5DED A;  3NTU A;  2KK0 A;  1B22 A;  1S0M A;  3PO4 A;  1QTM A;  4DQQ A;  2DUY A;  4DO9 A;  2XY6 A;  2IMW P;  4ECT A;  2P6U A;  4J9L A;  3HJE A;  1UA1 A;  2BPC A;  1QSL A;  1SV4 A;  1UCV A;  2J6S A;  4JWM A;  1ZQQ A;  1ZQA A;  4M9L A;  2XGP A;  4C8L A;  2XIC A;  1UEV A;  1Z1V A;  4YXJ A;  3NUQ A;  4Q44 A;  1CRX A;  3MGH A;  5A0L A;  4LVS A;  4X4P A;  8ICU A;  3M9N B;  2GLE A;  3TFS A;  1L7O A;  3F5A A;  3TAP A;  9ICX A;  2R8G A;  2W8L A;  2K8A A;  5J0W A;  3G6X A;  1MA7 A;  2HOF A;  1RPL A;  2JGA A;  4B9N A;  1RYS A;  3PML A;  2BGW A;  3QUC A;  3IN5 A;  3BDP A;  2EAO A;  4QWB A;  2PFN A;  1SWW A;  3I28 A;  4NM2 A;  5KNI A;  4O3R A;  4MFA A;  5TIS U;  2JRZ A;  3DEE A;  1SV0 A;  2FE9 A;  1ZQY A;  3V7J A;  4FZL A;  4B9V A;  2HVI A;  2AGO A;  4BXO B;  3C2M A;  5AM4 A;  2V9W A;  4DLE A;  1BPY A;  2E8N A;  3GV8 B;  3WKB A;  1KTQ A;  2OXO A;  2ASL A;  2RLT A;  5EE3 A;  5HRK A;  1BGX T;  1BPE A;  4KMO B;  2KV2 A;  4X4U A;  3WU2 U;  5HMM A;  3RB3 A;  8ICH A;  2IOH A;  2YMM A;  4IS7 A;  4M6W A;  1ZQB A;  3ZDE A;  3C2L A;  1XNS A;  4UAW A;  8ICA A;  5AKL A;  4RQ2 A;  5EOZ A;  3GIL A;  2LI6 A;  3PNC A;  1SB3 C;  2PFO A;  5AKJ A;  3F2D A;  4NXW A;  4BUG A;  2WAQ C;  2HOQ A;  4NWI A;  4AT9 B;  1LKY B;  2JMG A;  2L5Y A;  2OHF A;  2ZJ8 A;  8ICP A;  5ALI A;  4M5D A;  4Y2J A;  2R8J A;  4RQ8 A;  3NAS A;  3NRW A; 
#chains in the Genus database with same CATH homology
 1QSY A;  5J29 A;  5KFR A;  4RQ1 A;  2ZTD A;  3KHG A;  3M8R A;  4JV1 A;  5KT5 A;  1Q78 A;  4WC0 A;  3BQT A;  3JPS A;  5KG4 A;  2PI4 A;  3T3F A;  4C8K A;  3H39 A;  1ZYQ A;  2ZH4 A;  4QZD A;  3PX4 A;  2HHS A;  1DK2 A;  3PO5 A;  3Q8R B;  2UVU A;  4BXO A;  2JZB B;  2ZH2 A;  1TFY A;  4RPX A;  3BQ0 A;  2ASD A;  8ICW A;  4PGQ A;  2NRV A;  4X4S A;  2IHN A;  3E2E A;  5DB7 A;  4QW8 A;  3AQK A;  4DSJ A;  4RWP A;  4X4V A;  4I2I A;  1NZP A;  3LWL A;  5KT3 A;  5DDM A;  5L1L A;  1B43 A;  2W9B A;  3MR6 A;  4TUQ A;  4DOC A;  3GII A;  1IXR A;  4DSL A;  3MGI A;  5J0Y A;  7ICG A;  3MAB A;  3EWA A;  4RQ4 A;  4ED6 A;  2ISP A;  5KFU A;  1MQ2 A;  5CJ7 A;  3HT3 A;  4S3N A;  1UA0 A;  7ICU A;  1DOQ A;  7ICL A;  4EYI B;  7ICI A;  2ZH6 A;  3RJI A;  4F8R A;  1H38 A;  2DR7 A;  4DSE A;  1VFG A;  1XSL A;  3QEA Z;  5KFN A;  4J9S A;  4F2S A;  4MF8 A;  1XS9 D;  9ICH A;  2NRK A;  1T3N A;  3MR3 A;  5D49 A;  2AQ0 A;  4M6W B;  4QWC A;  3EYZ A;  5HHH A;  4F4X A;  3SI8 A;  2KP7 A;  3AQM A;  4WC1 A;  3H8J A;  4DS4 A;  4O0I A;  4DFJ A;  3Q8K A;  4NLK A;  3RAX A;  1ZQH A;  2C2R A;  3SV4 A;  4M04 A;  4F92 B;  5KTQ A;  4KN4 A;  1ZJN A;  2ALZ A;  2V4Q A;  1A77 A;  4Z6C A;  3V72 A;  2ZHA A;  2I9G A;  1BVS A;  4FS2 A;  4KLQ A;  4I2C A;  4ECU A;  4FS1 A;  5KFX A;  3JPQ A;  5KFY A;  4PGY A;  3QZ7 A;  3MFH A;  4R8U B;  4KLF A;  2AU0 A;  4AT9 A;  4DQI A;  4DFK A;  3RRH A;  3RH4 A;  3V7L A;  4F4W A;  2A1J A;  2BE3 A;  1WCN A;  2WTF A;  3M9M B;  4M0A A;  2JEJ A;  9ICU A;  4QZI A;  1NJZ A;  2ZUC A;  3ETL A;  4HYK A;  4DSK A;  1Q79 A;  1X9W A;  3RR8 A;  2KZM A;  4C8M A;  1UET A;  2UVW A;  4RT3 A;  3WFS C;  2XY7 A;  4F2R A;  4B9T A;  5J2F A;  3OVB A;  1TKD A;  4J9N A;  3RB4 A;  4I2D A;  2JZB A;  5L9X A;  9ICQ A;  3IM1 A;  1ZQE A;  4E80 A;  1TK5 A;  2HW3 A;  1OU5 A;  9ICR A;  7ICO A;  8ICX A;  2M2W A;  1MIY A;  2J6T A;  4M47 A;  3FDS A;  4DOA A;  9ICA A;  2W8K A;  3RJH A;  4WC7 A;  4YXM A;  4RPY A;  5HRB A;  4F4K A;  3K4G A;  1D8L A;  7ICH A;  2RDJ A;  4X4O A;  4WC5 A;  5KG5 A;  3Q8M A;  4WBZ A;  2C2D A;  4YR0 A;  5DBC A;  3OGU A;  4F93 B;  3ZD8 A;  3N97 B;  2IA6 A;  4B9L A;  1BNP A;  2O5A A;  5KT4 A;  4ED0 A;  3OSP A;  4G3I A;  3OVA A;  2KFN A;  5D46 A;  5KFH A;  3UXP A;  5J0S A;  5DB8 A;  1RXV A;  1U48 A;  1KDH A;  3GIM A;  4PGX A;  3SV3 A;  4YFK A;  4NM1 A;  2Q0Z X;  4JV2 A;  1T4G A;  5KFQ A;  2Y1I A;  4NLN A;  4YR3 A;  2JEI A;  4DF8 A;  2AGQ A;  3NGD A;  4QZF A;  4KIT B;  5EWE A;  4AT7 A;  3ISD A;  1V4A A;  4KLJ A;  3B0X A;  1NOM A;  4ED7 A;  4QWA A;  4MFC A;  1KFS A;  4QZ8 A;  3AU2 A;  5J0O A;  4PPX A;  3C18 A;  2DRB A;  4FBT A;  9ICW A;  4X4N A;  5J2A A;  3HIY A;  2JEG A;  2FPM A;  1S76 D;  4X0B A;  8ICT A;  5HC9 A;  1NK0 A;  1TFW A;  3KHH A;  5KFW A;  8ICO A;  5HML A;  1JXL A;  4ECX A;  9ICP A;  4R63 A;  3H3A A;  5DLG A;  4I27 A;  4R8U A;  2BPG A;  5HRF A;  4E7X A;  4JV0 A;  8ICF A;  3PR4 A;  4RZR A;  3HJ1 A;  3MBY A;  5CR0 A;  4K4H A;  2VA3 A;  4E8F A;  2ZTC A;  5KFG A;  5KFM A;  5D4B A;  5KG3 A;  2ASJ A;  1NJW A;  1ZQP A;  4KLH A;  5KG1 A;  4TUR A;  3QE9 Y;  3PW7 A;  3RH6 A;  5BPC A;  5F9N A;  5HRL A;  5HRI A;  5DLF A;  2H5X A;  1NK7 A;  1HUZ A;  5KG7 A;  1R8A A;  2AQ4 A;  2BPF A;  4Z6F A;  7ICV A;  1Z00 B;  4K4G A;  4KLD A;  3RBE A;  5IIK A;  4QZ9 A;  2ISO A;  4EBJ A;  3LK9 A;  1R8B A;  4UAZ A;  2ZUD A;  2NRX A;  5IIO A;  1ZET A;  5KFB A;  4KLM A;  2DPI A;  2HHU A;  5J2B A;  4GLX A;  2AGP A;  4NKU A;  4WCW A;  4DFM A;  2FMP A;  9ICL A;  5KFC A;  2XY5 A;  4J9O A;  3RJK A;  1R89 A;  8ICG A;  4I2F A;  4AT8 B;  4X4Q A;  4DQS A;  5J0X A;  2DFL A;  2PXI A;  7ICK A;  1ARO P;  1U49 A;  5DG8 A;  4ED8 A;  2M2U A;  1L5U A;  3GIJ A;  4ECY A;  4KLS A;  1UEU A;  2HHV A;  5DEC A;  3TQ1 A;  2P66 A;  3PW4 A;  4YP3 A;  3BJY A;  4X4R A;  1MSW D;  3ZDA A;  3HPO A;  5J0Q A;  4R66 A;  2OWO A;  1ZQW A;  2J6U A;  2ZHB A;  1CUK A;  2IBK A;  4EP7 A;  2FLP A;  3RJG A;  4O5E A;  5HR9 A;  3G6V A;  1ZQM A;  4FH5 A;  4FHP A;  5JUM A;  3BQ2 A;  3GIK A;  8ICM A;  1MIV A;  4C8N A;  7ICM A;  5KFV A;  1IM4 A;  7ICE A;  3UPQ A;  4TQR A;  3THV A;  4I2B A;  1ZQX A;  4F91 B;  2AJQ A;  2FPK A;  3HP6 A;  4IQT A;  3SYZ A;  4O5C A;  2ZJ5 A;  1ZQF A;  8ICV A;  5J0U A;  5KFL A;  5DB6 A;  4UB3 A;  2KFZ A;  3H38 A;  1C7Y A;  4RWQ A;  1V9P A;  4IRK A;  3V6H A;  2MUT B;  5DDY A;  2ZH1 A;  1WOT A;  4NXZ A;  4AT7 B;  3SZ2 A;  4RQ7 A;  4DQP A;  3RR7 A;  1L3T A;  3JPR A;  3C1Z A;  9ICM A;  4RU9 A;  3FYH A;  2C2E A;  3Q8Q B;  4O9M A;  4RQ0 A;  5DGB A;  4ELT A;  9ICB A;  4JWN A;  5CB1 A;  5DG7 A;  1NJX A;  4RQ3 A;  4F5R A;  5KT6 A;  4DF4 A;  4DFP A;  4KLT A;  3C5F A;  4YN4 A;  1KEJ A;  4I2A A;  4YMM A;  3C23 A;  2XCA A;  3IHQ B;  2ZH7 A;  4P4O A;  4EEY A;  5KT7 A;  4IG8 A;  3ZD9 A;  1KRP A;  5J2G A;  4UB4 A;  1BPB A;  4NY8 A;  8ICK A;  3M8S A;  9ICJ A;  2Q66 A;  2XO7 A;  4UBC A;  4DL4 A;  3HWT A;  2FMQ A;  4P4P A;  9ICC A;  1Z00 A;  2BHN A;  2PFQ A;  1TV9 A;  2HHP A;  4UD4 A;  4PHA A;  4QZC A;  3JPT A;  4TUS A;  3G6Y A;  2C28 A;  2F1I A;  3KHR A;  4ELU A;  4NLZ A;  2PI5 A;  5CP2 A;  1Z3E B;  1KFT A;  5HRG A;  1DGS A;  5J2I A;  3TAN A;  1S0N A;  4DSI A;  3JYY A;  3H8S A;  3H4B A;  2Y1J A;  3ZDC A;  1TAU A;  4FHV A;  4AT8 A;  4RPZ A;  2BR0 A;  1SKR A;  1ZQS A;  4DL7 A;  4ZH4 A;  3LWM A;  1D8Y A;  2FLN A;  4I2G A;  2HVH A;  1K1Q A;  4FHY A;  4NKT A;  2C22 A;  3PX6 A;  3RRG A;  5KFZ A;  5F2V O;  4QWD A;  3WFR E;  4O3N A;  5CHG A;  1JXE A;  5KFO A;  3C1Y A;  4M9J A;  9ICG A;  5CA7 A;  4YMN A;  4KMU A;  4QZA A;  1ZQC A;  7ICT A;  7ICR A;  2RFF A;  4GXJ A;  8ICS A;  1K1S A;  5DGA A;  1TK0 A;  3OHB A;  1L3V A;  2IHM A;  1CEZ A;  4LZD A;  3EW9 A;  3Q8L A;  4J9P A;  1N48 A;  4Q45 A;  3L9D A;  3PVX A;  3N4M B;  4ED2 A;  2DPJ A;  4O5K A;  3OVS A;  2HHW A;  2NRT A;  4R65 A;  4DOB A;  4XUS A;  4YCX A;  5KFP A;  2R8K A;  4RWO A;  3AU6 A;  5J2C A;  4DWI A;  5KFE A;  4B9M A;  4F4Y A;  4P4M A;  2BCU A;  3OUY B;  4F5Q A;  4QZB A;  4MFF A;  2MUT A;  9ICV A;  2VA8 A;  2DRA A;  4DSF A;  4YD1 A;  2W9C B;  3BQ1 A;  4I2H A;  9ICI A;  4YMO A;  5C5J A;  1BPD A;  5DQI A;  3PV8 A;  4XA5 A;  1SKW A;  5KFD A;  1LV5 A;  1ZQK A;  3WFQ E;  1TFR A;  2W9A A;  4J9M A;  2BQR A;  1NKB A;  3ZDD A;  2M2T A;  3MR5 A;  4FHX A;  2DR9 A;  3RAQ A;  1XU4 A;  5IIJ A;  4RNN A;  1S97 A;  5L1J A;  1NK9 A;  4F3O A;  1S77 D;  2M9N A;  4EYH B;  1RYR A;  1BPX A;  4IQW A;  1SZP A;  8ICC A;  4R64 A;  5IIM A;  2B21 A;  4IRC A;  5HP4 A;  2F1H A;  1JIH A;  3GQC A;  4DL2 A;  3PW0 A;  1KSP A;  4O3Q A;  3EZ5 A;  1DK3 A;  1SL1 A;  4DL3 A;  4ED3 A;  3MR2 A;  4F5N A;  4TUP A;  4DS5 A;  3ISC A;  2ATL A;  4KLU A;  8ICR A;  1KLN A;  4X0A A;  4DL6 A;  4YD2 A;  4M9N A;  2FPL A;  8ICE A;  4KLG A;  4Z6E A;  3JPO A;  4EBK A;  2W9M A;  5DQG A;  1A76 A;  3OSN A;  9ICS A;  4MEY A;  3MDC A;  2ZH8 A;  4IR9 A;  4BDP A;  1ZQT A;  1ZQI A;  4FBU A;  5KFA A;  1D9F A;  5F9L A;  1U47 A;  3NYB A;  1X2I A;  1N56 A;  1RZT A;  1ZQN A;  3OHA A;  3C2K A;  5BOM A;  4ECS A;  3WFP A;  1BPZ A;  2PFP A;  5HRH A;  5KG2 A;  5HNK A;  4QZG A;  4WC4 A;  1XSN A;  4Q8E A;  8ICL A;  2KTQ A;  1QLN A;  4F5P A;  4I28 A;  5EWF A;  1UT8 A;  1NJY A;  2UVV A;  4GC7 A;  4LT6 A;  3TI0 A;  1XWL A;  4RUC A;  4XQ7 A;  4RQ6 A;  9ICE A;  4ECQ A;  4GC6 A;  4EBD A;  1X9M A;  1L3S A;  4EBC A;  5J0T A;  4DLG A;  3H37 A;  2DR8 A;  2V4R A;  1X9S A;  5J2E A;  1NK4 A;  3QEB Z;  3TAR A;  5KFF A;  5DBB A;  4DL5 A;  3GFK B;  1JMS A;  2ZH9 A;  3MFI A;  1RXW A;  3T5H A;  3PR5 B;  3OJU A;  3GV7 B;  1ZQL A;  5KT2 A;  7ICJ A;  7ICQ A;  3HX0 A;  2DR5 A;  3Q8S B;  9ICF A;  3JZ0 A;  1U9L A;  1UT5 A;  1ZJM A;  4FH3 A;  4RNM A;  8ICN A;  3OUY A;  4WC6 A;  4PHD A;  2UVR A;  8ICZ A;  2KZ3 A;  5TZV A;  3Q8P B;  1S10 A;  5DG9 A;  2W9C A;  1MQ3 A;  4M9G A;  3RB0 A;  4KLL A;  2HHQ A;  1NKC A;  2VA2 A;  8ICI A;  3RH5 A;  1HUO A;  5KFS A;  4M2Y A;  3WFO A;  3V6J A;  4P2H A;  5DED A;  3UPS A;  3NTU A;  1ZQZ A;  5HHI A;  4JUZ A;  4B9U A;  1LB2 B;  4ATB B;  4RT2 A;  1B22 A;  1S0M A;  5IIN A;  3PO4 A;  1ZQG A;  1FA0 A;  4QZH A;  1QTM A;  3RJE A;  4DQQ A;  4DO9 A;  1COO A;  4NLG A;  2XGQ A;  2XY6 A;  2IMW P;  1KNY A;  4ECT A;  2ZJA A;  2P6U A;  8ICQ A;  3OV7 A;  4J9L A;  7ICF A;  1YLQ A;  3GV5 B;  3ORY A;  2PBE A;  4ELV A;  1UA1 A;  3JPP A;  5J2J A;  2BPC A;  1QSL A;  1S0O A;  4YVZ A;  4J9R A;  2BDP A;  1ZQR A;  2J6S A;  4XQ8 A;  1PZN A;  1ZQQ A;  4JWM A;  2XCP A;  3GDX A;  1ZQA A;  1NK8 A;  4EZ6 A;  4M9L A;  8ICJ A;  2XGP A;  4C8L A;  8ICB A;  1NK5 A;  2HHX A;  4PHP A;  3RBD A;  1TK8 A;  3RJF A;  3B0Y A;  3PW2 A;  5KFT A;  1BNO A;  1JQR A;  4JK1 A;  5L1K A;  1F5A A;  3TAQ A;  5L1I A;  1UEV A;  4Q8F A;  4YXJ A;  3AQL A;  4Q44 A;  4ECV A;  3RB6 A;  4IQU A;  3MGH A;  1SKS A;  3QZ8 A;  4LVS A;  4I2J A;  5KFI A;  2R8I A;  3AUO A;  3PW5 A;  8ICU A;  3T5L A;  3M9N B;  1T8E A;  4BGD A;  1NK6 A;  2P6R A;  4UB5 A;  3TFS A;  1ZQD A;  2KZZ A;  4KTQ A;  2ZH3 A;  1ZQJ A;  4KLO A;  4M9H A;  1SL0 A;  3TAP A;  3H7I A;  5KG6 A;  4PHE A;  9ICX A;  4X4T A;  1JN3 A;  1SL2 A;  4Q43 A;  3V7K A;  2W8L A;  2R8G A;  1EXN A;  5HRE A;  4FHW A;  4GXK A;  4XRH A;  2HHT A;  5J0W A;  3G6X A;  1ZQO A;  1NO5 A;  3C66 A;  1RPL A;  4TQS A;  4B9N A;  2VAN A;  3PX0 A;  3PML A;  1RYS A;  2BGW A;  3BDP A;  4WC2 A;  2ZTE A;  3K75 D;  4ECZ A;  4J9Q A;  4QWB A;  4QW9 A;  2PFN A;  2M2V A;  2BCR A;  1MC8 A;  4NM2 A;  1U45 A;  2BCS A;  1U4B A;  4O3R A;  4MFA A;  7ICN A;  1XC9 A;  4EZ9 A;  4FO6 A;  5DQH A;  4K4I A;  4IQV A;  1TAQ A;  1ZQY A;  1KFD A;  3V7J A;  4F50 A;  2BCV A;  1D9D A;  4B9V A;  4KLI A;  2HVI A;  4QZE A;  2AGO A;  4BXO B;  4ATB A;  2DVI A;  3OJS A;  2ZUB A;  4BWM A;  3C2M A;  3H8W A;  4I2E A;  5J2H A;  4X5V A;  4RNO A;  2V9W A;  1HJP A;  7ICP A;  4C8O A;  4DLE A;  4IRD A;  4O3S A;  4O3P A;  1BPY A;  5J2K A;  3EPI A;  1QSS A;  2FMS A;  3HJ4 A;  2XC9 A;  3GV8 B;  1WCL A;  2BQU A;  9ICT A;  1JAJ A;  1PX5 A;  4F5O A;  1KTQ A;  1MIW A;  2ASL A;  3ISB A;  2JEF A;  3UXN A;  4CCH A;  2BQ3 A;  4O3O A;  2W9B B;  1XSP A;  5HRK A;  3UQ2 A;  1BGX T;  1BPE A;  1XO1 A;  4UAY A;  3KHL A;  4IR1 A;  3V6K A;  4YR2 A;  2R8H A;  1L3U A;  4WC3 A;  3PMN A;  3C21 A;  5KG0 A;  4DEZ A;  1Y88 A;  4ECW A;  9ICO A;  4ECR A;  2ZH5 A;  4YG2 A;  3MDA A;  4X4U A;  2ID1 A;  2GWS A;  5HMM A;  3RB3 A;  5EWG A;  3RTV A;  8ICH A;  8ICY A;  4UB2 A;  4I29 A;  4M6W A;  3H40 A;  4QWE A;  3T5K A;  4RQ5 A;  4B9S A;  4RUA A;  4UBB A;  5BOL A;  1ZQB A;  3TFR A;  3ZDE A;  3C2L A;  4DQR A;  4E0D A;  1R8C A;  4UB1 A;  4UQG A;  1TVA A;  2BKE A;  1ZQU A;  3EPG A;  3C5G A;  4PH5 A;  5DB9 A;  3H4D A;  2BCQ A;  4UAW A;  8ICA A;  5J2D A;  1NKE A;  5J0R A;  4YQW A;  5J0P A;  9ICN A;  4RWN A;  4RQ2 A;  5EOZ A;  2I1Q A;  2KN7 A;  4MF2 A;  1S0V A;  3GIL A;  3LDA A;  4Z6D A;  4GXI A;  3PNC A;  2PFO A;  3RJJ A;  1S9F A;  4WBY A;  3PY8 A;  4ED1 A;  1JX4 A;  2F1J A;  2LYH A;  7ICS A;  4KLE A;  2NRW A;  1T7P A;  4UD5 A;  2RDI A;  4KN7 A;  5III A;  5DKW A;  2MAX A;  4MEX A;  3AQN A;  4X4P A;  2NRZ A;  5KFK A;  3M9O B;  4F4Z A;  4EBE A;  9ICK A;  3LQC B;  4LZG A;  3JPN A;  4AT9 B;  3T5J A;  2FLL A;  5IIL A;  4J9K A;  2ZJ8 A;  4BWJ A;  5KFJ A;  5CWR A;  3HW8 A;  3KTQ A;  8ICP A;  1VJ7 A;  2O1P A;  5DBA A;  2A1J B;  3ZDB A;  1ZQV A;  2R8J A;  4RQ8 A;  4M5D A;  3UXO A;  5HRD A;  3UQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...