2P66A

Human dna polymerase beta complexed with tetrahydrofuran (abasic site) containing dna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
326
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
publication title Structural insight into the DNA Polymerase beta deoxyribose phosphate lyase mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 101
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2p66A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2p66A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2p66A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2p66A03
2HHWA 4KTQA 4KLIA 3Q8LA 5HHHA 5KT3A 4UAYA 1LB2B 1DOQA 3H8JA 3BDPA 4YN4A 4AT8A 4DOCA 4KLTA 5HRHA 3C1YA 2V9WA 1K1SA 5KFOA 4I2AA 1RYRA 9ICQA 7ICIA 2VANA 3GILA 5DQGA 1X9MA 4RQ3A 2BCVA 1R89A 2ZH8A 3RH6A 3HWTA 4Q43A 1ZQEA 3RTVA 4DSKA 1R8CA 3KHGA 2VA2A 3PY8A 8ICFA 5DLFA 9ICXA 2V4RA 4KLHA 3TAPA 4Z6DA 1BVSA 4TQSA 1PX5A 2HVIA 3Q8KA 5KT2A 5C5JA 1BPDA 4Q44A 4DL2A 7ICGA 9ICRA 2XCPA 1ZQRA 3EW9A 2KZZA 2DPIA 4WC5A 3UXNA 3LWLA 3K75D 4DL5A 4X5VA 1QSSA 9ICVA 1F5AA 2KP7A 4O3OA 5KFGA 1X2IA 5J0OA 4O9MA 1S0OA 9ICBA 5DECA 4EBKA 4RUAA 4DQQA 1NOMA 7ICKA 4UD5A 4BGDA 9ICWA 4QZAA 2W8KA 5KFUA 4F92B 4NM2A 4FH5A 4KLGA 1ZQJA 2HHSA 4F5PA 3OVBA 3UPQA 9ICTA 1TKDA 3HJ1A 4LZDA 3V6KA 4DO9A 4EBEA 4ED0A 4HYKA 4RPYA 4MF8A 4RQ0A 5HP4A 5KFIA 1BPXA 3HJ4A 2DR7A 3L9DA 4MEYA 5KFXA 7ICJA 3BQ2A 1WCLA 4R65A 3IM1A 1U45A 3PMLA 2M2TA 5DQIA 2FMPA 2IHMA 2HHQA 1JMSA 2DR9A 4DL7A 4NLKA 1U48A 1NKBA 1JXLA 1RZTA 2ASLA 4YD1A 4ED1A 4EZ9A 2BE3A 4RNOA 2HHPA 4TQRA 3RB3A 5J2AA 2FLPA 1JIHA 4RQ6A 8ICQA 2A1JB 1U9LA 4FS1A 2ZJ8A 3MFIA 4ATBB 3PX6A 4F5OA 3RJIA 5J2BA 4EEYA 3C2KA 4AT9B 4UAWA 4KLSA 9ICNA 5J2EA 1TAUA 8ICRA 3PV8A 4LT6A 4M6WA 4X0BA 5KT4A 2AGPA 2ZH5A 1T4GA 5L1KA 1K1QA 2ASDA 4R64A 4UB5A 2IMWP 2Q66A 4M2YA 1HUZA 1NZPA 3H7IA 3OSNA 2R8IA 2NRTA 1JAJA 1UT8A 2BCQA 3WFRE 4RNNA 2ZH9A 3OHAA 5L1JA 3GIIA 4EBDA 1ZETA 1ZQCA 4C8OA 4F2SA 5KFHA 4MFCA 4UAZA 2UVRA 4ECTA 1KFTA 4IR1A 8ICHA 2MUTB 4O3QA 3EPGA 3JPOA 4FS2A 4DS5A 1S97A 4I28A 4O5EA 1UA1A 3JPNA 1ZJMA 2ZUCA 5J0QA 1DK3A 5KFLA 1ZQFA 2V4QA 3ETLA 4K4GA 4QWCA 5D49A 1S0NA 4DOBA 3LDAA 4AT8B 2F1JA 5BPCA 3BQ0A 4Q8EA 4ED7A 5D4BA 5DG8A 3WFOA 2ZH6A 1MIWA 5KG2A 1TK8A 2NRKA 5J0SA 4J9MA 3ZDEA 4R8UA 2XO7A 1XS9D 3LWMA 5HRFA 2ZJ5A 4YCXA 1N56A 5DBBA 5DG9A 1KLNA 3M8SA 4F5QA 3T5LA 3PW5A 4M5DA 5KFZA 2C2DA 1LV5A 4IRDA 4KLJA 4ECXA 4TUQA 2AGQA 2ZH7A 2R8KA 2BGWA 5HMLA 2BQUA 4IQTA 4NLNA 1XSLA 2C28A 4F4XA 3V7LA 4QZDA 7ICUA 4UB1A 3Q8QB 1TVAA 4ED3A 2ZHAA 2I9GA 2DPJA 4WC3A 5BOMA 4J9OA 4QZ8A 2KFNA 3C2MA 3TAQA 3V6HA 4KMUA 4FHPA 3PX0A 3SYZA 4AT9A 2HHTA 1OU5A 4B9SA 4I2BA 1ZQQA 2XGPA 2BCSA 4X4VA 4XQ8A 1L3SA 2Y1JA 3NYBA 1ZYQA 4FHWA 4EP7A 4QW9A 3RB4A 4KLLA 4I2IA 4QZIA 3GIKA 2J6SA 4PH5A 1JN3A 3MABA 4P4OA 1T3NA 4XRHA 1N48A 2DR8A 1RXVA 4EBCA 3M9OB 4IG8A 1ZQZA 4ZH4A 3OUYA 3RRGA 1D9DA 2M9NA 2AU0A 1SKRA 1L5UA 4PGQA 4GLXA 1COOA 5HRKA 3UQ2A 1Q78A 9ICCA 4YR3A 2P6UA 8ICMA 1SZPA 3V6JA 2W9AA 1KFSA 5F2VO 5EWFA 7ICSA 2PBEA 4J9KA 3ZDAA 4DFJA 5KG1A 1TAQA 3H40A 5J0YA 4C8MA 1L3VA 9ICJA 4Z6EA 4B9VA 5KFYA 2R8GA 4M6WB 5KFNA 2PXIA 5DDMA 4DQPA 8ICUA 1XSNA 4R63A 2PFPA 1S10A 1Z00A 1NKCA 3AQNA 3G6VA 5IIMA 1QLNA 1S0VA 4B9NA 1KSPA 1R8BA 4JV0A 3RH4A 2DR5A 7ICVA 1NK7A 5CR0A 7ICOA 1ZQNA 2M2VA 4QZBA 5EWEA 1AROP 2NRVA 2XY5A 2NRZA 4X4SA 1U4BA 3QZ8A 5D46A 4YMOA 5KFBA 5DGBA 3RJFA 3ISBA 4XQ7A 1QSYA 5BOLA 3M8RA 2BPFA 4F50A 4C8KA 4TURA 4WC7A 4Q8FA 4DOAA 2J6UA 3RAQA 4P2HA 3H4BA 2ZHBA 4J9LA 1BNPA 4BXOA 4YXJA 4O0IA 3RJKA 2FMSA 4S3NA 4RZRA 1KRPA 3WFQE 5IIKA 4J9QA 4UBCA 5KTQA 3E2EA 3UPSA 3K4GA 4R8UB 2ZJAA 4DQRA 3LQCB 4M9HA 3M9NB 4E0DA 4FBUA 5KFKA 5KFMA 1NJZA 3AU6A 3FDSA 5KFSA 4ED8A 1TFYA 8ICYA 9ICGA 8ICPA 8ICWA 4ECVA 5HMMA 1EXNA 5J0XA 2HHUA 1ZQYA 1ZQOA 3PR5B 2P6RA 4ELVA 2ZH2A 4MEXA 4RQ7A 4PGXA 3HPOA 1SL0A 4RQ4A 4YQWA 1NK5A 2GWSA 5IINA 4JWNA 5J2DA 4B9TA 3PO4A 1UEVA 4IQWA 4FHYA 4J9SA 4DSLA 4KLDA 4GXJA 3TANA 1MIYA 5HRLA 2LYHA 4UQGA 4EYIB 3N97B 4DLEA 4DL3A 1XU4A 1NK4A 4QWEA 5DEDA 5IIJA 4TUPA 4ED6A 4RWOA 4DQSA 9ICIA 2F1IA 5KT5A 2BKEA 2ZTCA 1TK0A 5KG3A 4Z6CA 2AQ4A 4WC4A 4FH3A 3JPTA 1QSLA 3GV8B 4O3PA 4EZ6A 4PPXA 2O1PA 4WC2A 1ZQPA 3SZ2A 4M9LA 3FYHA 5KFAA 3EZ5A 3SV3A 2ASJA 1SKWA 2IBKA 8ICNA 1VFGA 2JEGA 3OUYB 4QZ9A 4QWAA 4RPZA 3GIJA 3ORYA 5KT6A 3PMNA 5CB1A 4ECUA 4DS4A 4DFMA 3EYZA 2C2EA 4RQ8A 4YR0A 4BDPA 4O5CA 2O5AA 4RQ1A 5J2CA 4DL4A 1XWLA 4X4TA 9ICHA 3H8WA 1KDHA 5F9LA 2PI5A 4ECRA 2JEIA 1IXRA 4GC7A 2BPGA 2ZH3A 1HUOA 4M0AA 4IRKA 1KEJA 5HC9A 2BR0A 1L3TA 3JPSA 3PVXA 1ZQVA 1ZJNA 7ICFA 1BNOA 9ICSA 9ICFA 1NK6A 1Z00B 5KFPA 2HHVA 7ICMA 3RJJA 1RXWA 1DK2A 4I2EA 4KN7A 3UXOA 3Q8PB 4ECYA 4I2GA 1NJYA 3PW4A 3UXPA 4UBBA 1NJWA 4MF2A 3H38A 4NKUA 5F9NA 4I2DA 2KN7A 1MQ2A 9ICOA 5J0WA 5KG7A 4RT3A 7ICLA 4F4WA 3KHRA 2W9MA 1HJPA 2W9CA 4X4QA 2XY7A 8ICZA 2R8JA 1T8EA 2XGQA 5HRDA 8ICBA 1MQ3A 4QW8A 3JZ0A 2UVWA 4BXOB 5DB8A 2BPCA 1XSPA 4F3OA 2JEJA 1UEUA 1BGXT 1RPLA 1MIVA 4RWNA 1Y88A 3V72A 4J9NA 1D9FA 2AJQA 1YLQA 5L9XA 4GC6A 3H4DA 4QZFA 4E80A 9ICPA 3C21A 2BCUA 5J2FA 1ZQUA 2IA6A 2ID1A 4JK1A 3GDXA 2AGOA 4QZEA 4M9GA 4O5KA 4QZGA 7ICEA 1UETA 4RWQA 2DRAA 3B0YA 1R8AA 5CP2A 3MDCA 4NY8A 2XCAA 4I29A 8ICOA 2HHXA 3QEBZ 4MFAA 3OJSA 1V4AA 4WCWA 1ZQAA 1DGSA 4Z6FA 8ICJA 3RJEA 4RQ2A 4F4ZA 4JV2A 5CHGA 4X4OA 4LZGA 3RH5A 4QZCA 3MGIA 2UVVA 2FPLA 4YMNA 4F5NA 3RBDA 4ELUA 3BQTA 1ZQKA 3SV4A 4KLUA 5KFVA 7ICRA 4PHAA 2PI4A 4FHVA 3WFSC 5KFQA 3LK9A 4ECWA 9ICKA 4YR2A 4GXIA 4O3NA 3NGDA 1X9SA 1WCNA 3JPQA 4ECZA 1UT5A 4UB3A 2C22A 4DWIA 3GV7B 1V9PA 2VA3A 1T7PA 2I1QA 4J9PA 3M9MB 3ZDCA 2M2UA 3OV7A 3KHLA 3ZD8A 3RB6A 4M9JA 9ICAA 5J29A 2RDIA 3AQLA 4XUSA 4C8NA 3T5HA 8ICGA 3QZ7A 1CUKA 5J0RA 1TK5A 5HRBA 3HX0A 4I2CA 4YD2A 4RWPA 2DRBA 5IIIA 2BQ3A 3TFSA 1KFDA 1D8LA 4BWMA 5J0UA 4RU9A 1X9WA 3MFHA 1BPZA 5CA7A 2FMQA 2BDPA 4F5RA 4DF8A 5DB7A 1ZQMA 1MSWD 5KG5A 1NKEA 4LVSA 1JQRA 3PW2A 3ZD9A 4PGYA 4E8FA 2WTFA 3QE9Y 1UA0A 3OHBA 2BCRA 3MR2A 3RJGA 4XA5A 3Q8MA 3T5KA 2FLNA 5HHIA 2UVUA 4F4KA 4WC0A 4IRCA 2OWOA 1KTQA 4F2RA 5KFTA 4AT7A 4FO6A 4PHPA 1BPEA 1ZQIA 2PFOA 4K4HA 3N4MB 2ZUDA 5HRIA 2IHNA 4QZHA 4WBZA 3PR4A 1XO1A 1Z3EB 1U47A 4UB2A 1NK8A 2AQ0A 3WFPA 2R8HA 4IQVA 4NLZA 3G6YA 1MC8A 4KLFA 4X0AA 2JZBA 3HP6A 4G3IA 3GIMA 3IHQB 1NJXA 4KLEA 3THVA 2RFFA 3PNCA 2W9CB 5KT7A 7ICNA 5HRGA 5KFDA 1S77D 4IQUA 4DFKA 2ZTEA 4KLQA 1S0MA 2BQRA 4FBTA 2HW3A 4PHDA 3KHHA 5IIOA 2ISOA 3G6XA 5CWRA 3BQ1A 2H5XA 1C7YA 5J2GA 2ALZA 2PFNA 3ZDBA 7ICPA 4E7XA 3RRHA 2B21A 3MR6A 4M9NA 3C18A 4ECQA 5DB9A 4F4YA 3B0XA 5J2HA 5TZVA 4DF4A 3QEAZ 4B9MA 5DQHA 4RUCA 1RYSA 3Q8SB 1VJ7A 4YG2A 2ISPA 4X4UA 4YMMA 5L1IA 3PX4A 3HW8A 2C2RA 1S76D 8ICKA 3ZDDA 8ICCA 1ZQSA 2W9BA 8ICSA 4K4IA 3V7JA 3RAXA 2FPMA 4DSEA 2Q0ZX 4TUSA 3JPPA 3RB0A 5DBAA 1ZQGA 2J6TA 3C23A 3MDAA 1BPBA 2ATLA 4X4PA 8ICEA 1A77A 4RT2A 2F1HA 2ZH4A 4ELTA 3C5GA 4JWMA 2MAXA 4UD4A 3C2LA 3SI8A 3T5JA 3EPIA 4CCHA 1ZQXA 4J9RA 4DLGA 3TARA 4KLOA 1B22A 3GQCA 2NRWA 8ICXA 3C5FA 4I2JA 3TI0A 1SKSA 1BPYA 2JEFA 4DL6A 3EWAA 2P66A 1TFRA 2KZ3A 3UQ0A 3KTQA 1ZQLA 2XC9A 4YVZA 1FA0A 3OVSA 2ZTDA 1XC9A 4EYHB 5DGAA 5DB6A 3GFKB 1JXEA 1ZQDA 4I27A 4M47A 5HR9A 4R66A 7ICTA 8ICIA 4WC1A 9ICEA 1TV9A 4F8RA 1B43A 5DBCA 5JUMA 3HIYA 1ZQWA 4KITB 4X4RA 3H3AA 3RR7A 2FLLA 5KG6A 2W8LA 2VA8A 3ISDA 3PW7A 1L3UA 2XY6A 5IILA 3ISCA 1U49A 2BHNA 4YFKA 5HNKA 5KFRA 2PFQA 5KFCA 4Q45A 4YP3A 4NXZA 1WOTA 5KG4A 4UB4A 3H39A 4DSJA 4B9LA 4DQIA 5DKWA 2DFLA 3PW0A 2Y1IA 1CEZA 4ED2A 5L1LA 4NLGA 8ICTA 1S9FA 4AT7B 5KFEA 4P4MA 3OJUA 2FPKA 3MBYA 3AQMA 4C8LA 3H8SA 3JPRA 4ECSA 3H37A 3OVAA 3OSPA 3AQKA 4F93B 2ZH1A 5DLGA 3AU2A 3C1ZA 1SL2A 1D8YA 4JV1A 1KNYA 1NO5A 3MR5A 4O3RA 4JUZA 4F91B 5HREA 2JZBB 4I2FA 1PZNA 3C66A 4GXKA 2RDJA 3GV5B 5KFWA 4B9UA 4I2HA 1QTMA 1ZQTA 4DFPA 3BJYA 3PO5A 8ICVA 1Q79A 5J0TA 4X4NA 4WBYA 3HT3A 3JYYA 1NK9A 1H38A 2A1JA 4ATBA 4FHXA 5J2IA 5J2JA 5KG0A 3RBEA 2KTQA 2KFZA 2HVHA 9ICMA 8ICAA 1A76A 1ZQBA 4O3SA 2DVIA 3T3FA 5J0PA 1ZQHA 3TFRA 4KLMA 9ICLA 4PHEA 9ICUA 4NM1A 4BWJA 3OGUA 4M04A 1IM4A 3MR3A 3RJHA 3TQ1A 7ICQA 4KN4A 2M2WA 4QWBA 5DDYA 5DG7A 4DSIA 5EWGA 4QWDA 1TFWA 5EOZA 4YXMA 1NK0A 4P4PA 4MFFA 5KFFA 2KZMA 4WC6A 2MUTA 4RNMA 2W9BB 4EBJA 4RQ5A 3Q8RB 2NRXA 4DSFA 5CJ7A 4NKTA 1SL1A 2ZUBA 3V7KA 3NTUA 5J2KA 4DEZA 4RPXA 5KFJA 3MGHA 3AUOA 3RR8A 8ICLA 7ICHA 1JX4A 4IR9A
chains in the Genus database with same CATH superfamily
2YTUA 4KTQA 4KLIA 3Q8LA 5HHHA 5KT3A 1DOQA 3H8JA 3BDPA 2BDUA 1N60A 2V9WA 5KFOA 3SQIA 2VIXA 9ICQA 7ICIA 1R89A 4Q43A 3K1ZA 2V4RA 4Z6DA 1BVSA 4TQSA 4DL2A 3ZI4A 2XCPA 5KL1B 1ZQRA 4IC9A 2EH9A 2KP7A 5J0OA 1NOMA 1RDFA 1Z19A 1Q46A 4KLGA 4EEBA 2YB4A 4AYBC 2LBOA 3RF9A 2MU2A 3UPQA 3V6KA 3HJ4A 5AKXA 2A3VA 3IM1A 2LKYA 2RP5A 4MHVA 2M2TA 3NVWA 5DQIA 2IHMA 2HHQA 2DR9A 4DL7A 2FI1A 1JXLA 4YD1A 3PSTA 4ED1A 3WKAA 4EZ9A 2KJ5A 4RNOA 5J2AA 1F5SA 1V97A 1U9LA 1ZD2P 2G0AA 3AQEA 4ATBB 1MN8A 1TAUA 2AGPA 1T4GA 3NVVA 4UAVA 4M2YA 3OSNA 2NRTA 2Y0SC 1UT8A 3F2DA 5L1JA 4EBDA 1ZETA 4F2SA 2A19A 1KFTA 3QU9A 1YZ7A 1L7MA 4CF3A 3PHZA 2HDOA 2EZXA 1S0NA 4J03A 4WQLA 4ED7A 4PZNA 5J0SA 3ZDEA 2KIVA 3LWMA 4F5QA 3T5LA 3PW5A 2OH2A 4ECXA 5ALPA 2R8KA 2BGWA 1XSLA 2C28A 4UB1A 1TVAA 2DPJA 5ALWA 3F2BA 4P0QA 3UMCA 4C0ZA 5ALNA 2HI0A 4UAUA 1N48A 4P4OA 4XRHA 4EBCA 1ZQZA 3OUYA 5JTGA 1D9DA 2XICA 4PGQA 4GLXA 1COOA 3ED5A 5AKZA 1N2XA 2DUYA 2YN4A 9ICCA 4YR3A 4IS7A 4JLZA 3V6JA 2W9AA 5EWFA 4J9KA 3ZDAA 4Z6EA 5KFYA 2R8GA 5ALDA 5KFNA 2PXIA 3NWIA 1A6SA 4R63A 5AIBA 1NKCA 2WF8A 3G6VA 1QLNA 1NK7A 3SENA 3LYSA 1QQ6A 5EWEA 1AROP 2NRZA 4X4SA 3QZ8A 4YMOA 5KFBA 3K1RB 4XQ7A 2J6UA 4GFJA 3H4BA 2EQYA 5AKHA 5K4LA 1BNPA 3AEVA 4RZRA 3WFQE 4J9QA 3UPSA 2QARA 3K4GA 4R8UB 4DQRA 3KZIU 3U26A 2H3ZA 4ED8A 8ICYA 8ICPA 3HRDD 2ODGA 1ZRMA 5AI9A 1QQ7A 1X9XA 4RQ7A 2E5SA 4JWNA 5J2DA 3QUQA 4J9SA 3QUBA 3SAGA 5HRLA 4UQGA 1HIWA 1XU4A 5IIJA 4RWOA 2F1IA 2ZTCA 2DKXA 1TK0A 4Z6CA 4EZ6A 2ZIXA 1ZQPA 3SV3A 2Z7JA 4O5CA 4A8EA 2O5AA 4DL4A 3H8WA 1IXRA 2BPGA 1TE2A 3C28A 1HUOA 4M0AA 3D2SA 1L3TA 7ICFA 2E3TA 2HHVA 3RJJA 1DK2A 5AKJA 4ECYA 3WK4A 3PW4A 2KEYA 3N7SC 4U6PA 1JROA 4RT3A 3ERCC 4ACOA 4X4QA 2XY7A 2R8JA 4OJOA 5CRXA 2YX8A 1T8EA 3H0MB 4CRXA 4NV0A 8ICBA 2VJ4A 4BXOB 2BPCA 4F3OA 1BGXT 1V85A 4J9NA 2CRXA 3AQFA 1YLQA 4GC6A 9ICPA 5J2FA 1ZQUA 2ID1A 4NL9C 3GDXA 1KBUA 3LVVA 2WF9A 2DRAA 4JLXA 3B0YA 3BQ7A 2K4HA 4MFAA 4WCWA 1DGSA 4Z6FA 4JV2A 3MGIA 5EE9A 4YMNA 3KBBA 2EWRA 5KFQA 3SAHA 5B3QA 3A0HU 4ECZA 2C22A 5AIAA 1T7PA 4J9PA 3OV7A 3RB6A 5D61A 4XJEA 1TK5A 5HRBA 4I2CA 5IIIA 5D62A 2HOQA 2E8OA 3QU5A 1COKA 4BWMA 4RU9A 5DB7A 4LVSA 2BBHA 3ZD9A 4E8FA 3OHBA 3Q8MA 4F4KA 5ALVA 4NXUA 3CP8A 3DDHA 4C4TA 4PHPA 1BPEA 1K5OA 2H3FA 4WBZA 2R8HA 4MKPA 4NLZA 4P0PA 1MC8A 3HP6A 4Y2JA 3IHQB 2RFFA 2W9CB 1S0MA 4PHDA 4I2HA 4RQMA 5CWRA 1C7YA 1PK1A 2IUBA 2B21A 5DB9A 2YMPA 4WH5A 5J2HA 3EUB2 3QEAZ 4PL1A 1VJ7A 1SGGA 2KKVA 4HAIA 2DWQA 3PX4A 2FJ6A 1S76D 3SMVA 5AI6A 2W55A 3JCFA 2FPMA 2J6TA 4TUSA 3JPPA 1PK3A 4RT2A 2QLTA 2ZH4A 3C5GA 4JWMA 4KLOA 1B22A 2HOFA 5AM2A 1SKSA 2YY6A 4DL6A 3UQ0A 2GAFD 4YVZA 5AM1A 4EYHB 2RQ5A 4B6JA 4I27A 4M47A 4U7CA 7ICTA 8ICIA 4WC1A 3WU2U 1TV9A 1DXSA 5DBCA 4KITB 3H3AA 3IG5A 2VA8A 3PW7A 3ISCA 2BHNA 5HR6A 2DQNB 5HNKA 2DF4B 2NO5A 3QX7A 5H2FU 4OAHA 3AN1A 3H39A 3SD7A 4ED2A 8ICTA 3IV6A 3AQMA 3OJUA 3H37A 5AK6A 4F93B 3K7DA 3AU2A 1J97A 1KNYA 4JUZA 5HREA 1PZNA 5ALTA 1QTMA 2ZIWB 4ICAA 3PO5A 4WBYA 3JYYA 2WFAA 5J2IA 2KFZA 2KSOA 3J81j 1FIQA 2YMQA 3I1YA 5EWGA 4QWDA 1TFWA 4YXMA 1GPJA 4P4PA 2MUTA 4RNMA 2GH1A 3V7KA 3DV9A 2WF7A 2ZIUB 4NXWA 3AL0B 5AHXA 1K1SA 1RYRA 2VANA 3WK7A 2ZH8A 1ZQEA 3RTVA 3KHGA 2VA2A 3PY8A 9ICXA 4KLHA 1RYUA 1PX5A 5KT2A 1BPDA 3WK8A 3A0BU 3EW9A 4WC5A 9ICVA 4LJXA 4O3OA 1X2IA 4O9MA 1S0OA 2JXJA 7ICKA 4UD5A 2KK0A 4NM2A 1OW5A 3FAHA 4UW9A 3ICXA 4LZDA 4DO9A 4EBEA 4HYKA 4RQ0A 5KFIA 3DEEA 3L5KA 7ICJA 4Y2QA 4CGZA 2OHFA 2ZXIA 1U45A 2FMPA 1JMSA 2EZYA 4NJ8A 1U48A 1NKBA 2ASLA 2BE3A 4K9AA 2HHPA 3TADC 4RQ6A 8ICQA 3HKZF 2H3IA 4KLSA 8ICRA 4LT6A 4X0BA 5KT4A 2ZH5A 4USAA 5JTIA 1N63A 2IMWP 4I0UA 4UB5A 4UB8U 1HUZA 1NZPA 2R8IA 2BCQA 2W04A 4RNNA 5AM4A 2ZH9A 1J2NA 1UA1A 2JHDA 2K4EA 2ZUCA 2KG5A 5KFLA 3ETLA 4K4GA 4DOBA 4AT8B 2F1JA 5D4BA 1WWVA 1MIWA 2NRKA 4M5DA 5HRFA 3N7PD 1B0XA 4NLCA 2WHEA 5DBBA 2NV3A 1LV5A 4IRDA 3ALRA 1DGJA 2ZH7A 4NLNA 1WWUA 2HMXA 4QZDA 1X40A 4J9OA 3C2MA 3TAQA 3V6HA 4KMUA 4AT9A 2HHTA 4K99A 5ALKA 3NS1A 1L3SA 4FHWA 4GIBA 2H3VA 4I2IA 4Y2TA 4QZIA 1FFUA 4OCZA 3GIKA 2DR8A 1ED1A 1VJ5A 2YMMA 3M6ZA 4ZH4A 2AU0A 1Q78A 2XI9A 3R9KA 2PBEA 1O08A 4DFJA 1TAQA 3H40A 9ICJA 4B9VA 4M6WB 4DQPA 2PFPA 5IIMA 1R8BA 4JV0A 7ICVA 2GLEA 4UB6U 1KQQA 5AM3A 2G06A 3E0FA 1U4BA 1AQ6A 4F50A 4WC7A 4P2HA 3RAQA 4YXJA 2OYYA 4UBCA 3LQCB 2B56A 1IV8A 2ZJAA 4M9HA 2W7OA 5ALHA 4FBUA 5KFKA 1TFYA 3FDSA 5KFSA 4Y2YA 4ECVA 1ZD5A 1ZQYA 4K96A 5CEHA 4ELVA 3HPOA 4HX0A 3E58A 4RQ4A 1KKXA 2GWSA 1UEVA 3PO4A 4KLDA 5AKGA 3KKAC 2LYHA 3PZPA 4DL3A 4DQSA 9ICIA 2BKEA 2AQ4A 4WC4A 4FH3A 2O1PA 3KZXA 4O69A 8ICNA 2JEGA 1VDVA 4QWAA 4O67A 3KOOA 4DS4A 5EE1A 5J2CA 4IL6U 1L8OA 1SV0A 9ICHA 4GC7A 5AI5A 3IRUA 2BR0A 4DCCA 9ICSA 1NK6A 4LEYA 1Z00B 4I2EA 4KN7A 5J8YC 1CRXA 3Q8PB 4I2GA 1B4FA 4UBBA 5J0WA 4F4WA 1ZOLA 2ZIVB 8ICZA 2XGQA 3M1YA 3HKZC 3JZ0A 2F77X 4QIWF 4OJPA 1ECWA 2AJQA 2QB0A 1ZD3A 4E80A 3C21A 3NUQA 1UETA 4QZEA 4RWQA 2MRLA 3CRXA 4WJ3B 3QEBZ 3OJSA 1ZQAA 8ICJA 4EX7A 4F4ZA 4X4OA 4LZGA 3F5AA 2FPLA 4KLUA 1ZQKA 3SV4A 7ICRA 4FHVA 3WFSC 2E8MA 4YR2A 5EE3A 2WAQF 2A1AA 1UT5A 2QKQA 2VA3A 5KAIU 2HBJA 4ZOHC 3M9MB 3KHLA 5GTIU 4M9JA 9ICAA 4XUSA 4C8NA 2RHFA 3HX0A 4YD2A 5T14A 2DRBA 2KD1A 2CN1A 2RRDA 1KFDA 5ALXA 5J0UA 4FZLA 3NASA 2FMQA 2K4IA 3OWGA 1ZQMA 2WTFA 1UA0A 3MR2A 1A0PA 1O03A 4XA5A 3T5KA 4WC0A 2OWOA 3BS5B 5KFTA 4AT7A 3NKUA 3BZCA 4K4HA 2B0CA 4US9A 2NO4A 3PR4A 1XO1A 4CNQA 3ONNA 2QB1A 4KLFA 4X0AA 4KLEA 1L7PA 5ALGA 5HRGA 5KFDA 4FE3A 2HW3A 5AKIA 2PFNA 3G6XA 2ZH6A 2H5XA 4E7XA 4PJ0U 4F72A 2KVCA 5E79U 4M9NA 3C18A 4JB3A 5EE0A 4ECQA 4F4YA 5TZVA 5ALRA 2EAMA 4YMMA 5L1IA 1WYGA 5JU5A 2C2RA 3ZDDA 8ICCA 3V7JA 3RAXA 1UHUA 1ZQGA 3C23A 3TADA 1BPBA 2F1HA 4ELTA 3C2LA 3SI8A 3EPIA 2JV3A 8ICXA 3C5FA 4I2JA 3TI0A 2JEFA 5CFUA 3EWAA 1UCVA 2KZ3A 2O6KA 2XC9A 3OVSA 5ALYA 2ZTDA 5DGAA 3GFKB 1JXEA 5HR9A 4R66A 3GU3A 4F8RA 5JUMA 1X6IA 4OJLA 5IILA 4YFKA 2K8BB 1LKYB 1SWWA 5KFRA 2PFQA 3FM9A 5AK5A 3QU7A 2PKEA 5KG4A 4DSJA 1CI4A 4P4MA 1KW4A 3JPRA 3SAFA 1GO3F 4ECSA 2HBMA 1LVHA 5DLGA 1D8YA 4K8VA 3QNMA 2DL0A 4JMUA 4JV1A 1NO5A 4O3RA 4F91B 2JZBB 4C4SA 2RDJA 4N7RA 1ZQTA 4DFPA 8ICVA 4ATBA 5J2JA 5KG0A 3RBEA 2KTQA 9ICMA 1ZQBA 2DVIA 5J0PA 1QCKA 1ZQHA 4G9BA 4BWJA 3OGUA 4M04A 3MR3A 3H0RB 3TQ1A 4KN4A 4QWBA 5DDYA 2W9BB 5CJ7A 2ZUBA 5J2KA 3MGHA 2W3SA 8ICSA 1JX4A 4IR9A 2HHWA 4UAYA 4KX5A 1LB2B 1SIJA 4DOCA 3C1YA 4I2AA 1X9MA 4RQ3A 2BCVA 3RH6A 3WK9A 4DSKA 1R8CA 8ICFA 5ALFA 5DLFA 5ALJA 3TAPA 5L1MA 2HVIA 4Q44A 5C5JA 7ICGA 3B9JA 4NXTA 3UXNA 3LWLA 4DL5A 4X5VA 1F5AA 5KFGA 1X66A 4BGDA 1ZQ1C 9ICWA 2LI6A 2CPRA 2W8KA 4F92B 2PMZF 1ZQJA 2WAQC 1PVQA 9ICTA 3HJ1A 3T79A 4ED0A 4RPYA 5HP4A 1BPXA 4MEYA 5KFXA 3AM9A 1WCLA 4RQNA 4NLKA 2G5IB 1RZTA 4TQRA 3RB3A 2FLPA 2DGZA 1JIHA 2A1JB 4FS1A 1X6JA 3KKAA 3MFIA 4AT9B 4UAWA 3PV8A 3BS7A 5L1KA 1K1QA 2ASDA 2Q66A 4K98A 1JAJA 3GIIA 2LMRA 5KFHA 4UAZA 4IR1A 8ICHA 1HEKA 4O3QA 2FCLA 3JPOA 4FS2A 1S97A 4O5EA 3JPNA 1ZJMA 4CF4A 3I28A 2YQEA 2V4QA 1V38A 4QWCA 5D49A 4PZOA 2IOFK 3LDAA 4FFDA 2YMLA 3BQ0A 4Q8EA 5DG8A 2AHOB 4R8UA 2XO7A 2H3QA 2ZJ5A 1N56A 5DG9A 1KLNA 5KFZA 2C2DA 2WB1F 4O6AA 2AGQA 2BQUA 4IQTA 3V7LA 3Q8QB 4ED3A 1Q3UA 4LEWA 4WC3A 2ZHAA 4EEKA 2KIWA 1TAMA 4FHPA 3PX0A 1NZBA 2ZXHA 2BCSA 3NYBA 3BZKA 5ALZA 1ZYQA 2HBKA 4QW9A 3RB4A 1RXVA 4IG8A 1MA7A 2M9NA 1L5UA 3UQ2A 2P6UA 8ICMA 1SZPA 2MA1A 1RM6C 2HN1A 4C8MA 4AYBF 5DDMA 8ICUA 3AQNA 1JRPA 4C80A 1KSPA 2DR5A 3KFUF 5CHEA 7ICOA 1ZQNA 3QUCA 4Y2VA 3NVZA 2NRVA 2XY5A 5D46A 5DGBA 3RJFA 2F2AB 2BPFA 2ZHBA 4J9LA 4BXOA 4S3NA 2IOHA 5KTQA 2Q4TA 3M9NB 2JR5A 1NJZA 3AU6A 2KNJA 5HMMA 1EXNA 5J0XA 5D63A 4MEXA 3D6JA 1SL0A 1NK5A 4LEZA 4FHYA 1YZ6A 4Y2PA 4DSLA 1MIYA 4GXJA 4P0QB 3ER8C 4EYIB 1NK4A 3AMZA 4QWEA 4AP9A 1Z1VA 2K8AA 3JPTA 4NXVA 3GV8B 4PPXA 4C7YA 5KL8B 1C20A 4WC2A 1Q3VA 1DRGA 5AKYA 3SZ2A 3FYHA 3EZ5A 2ASJA 1SKWA 4M9LA 4LEVA 1VFGA 3OUYB 1SWVA 2AH5A 4QZ9A 3GIJA 2ISPA 2LHTA 4RQ8A 2L5YA 2OM6A 4YR0A 5HR7A 1L6NA 4RQ1A 2K8CB 1S5LU 4X4TA 3OTQA 1KDHA 4ECRA 1X42A 2K89A 4IRKA 2R18A 1KEJA 3H8MA 5HC9A 5GTHU 3JPSA 3UMBA 1BNOA 9ICFA 4KB6A 2W03A 1RXWA 3WK5A 3QU2A 5AKLA 4MF2A 3H38A 2E8PA 1L8LA 2HOIA 4NKUA 4I2DA 2KN7A 1MQ2A 5KG7A 3KHRA 2W9CA 1HJPA 4BUGA 2XIDA 1MQ3A 4QW8A 1ZXIA 2UVWA 3NRZA 2AXTU 5DB8A 1UEUA 1MIVA 1RPLA 1Y88A 2QARB 3V72A 3H4DA 4QZFA 3F5EA 4NL9A 7ICEA 5B3PA 1URJA 2JMGA 1R8AA 4O68A 8ICOA 2XCAA 2HHXA 1V4AA 1T94A 3RJEA 5CHGA 4QZCA 4OAGA 2UVVA 3RBDA 4ELUA 4F5NA 5KFVA 3LK9A 4ECWA 4GXIA 4O3NA 2FE9A 3F53A 1WCNA 3NGDA 1X9SA 3JPQA 5G5HA 4DWIA 3GV7B 1V9PA 1WG8A 3PSPA 2I1QA 2M2UA 3IG8A 4C4RA 4F71A 5J29A 8ICGA 2WB1C 2ZIXB 3QZ7A 5J0RA 4RWPA 2KKPA 3WKDA 4FO1A 1FO4A 3LVWA 1X9WA 3MFHA 5CA7A 4DF8A 1MSWD 2G08A 5KG5A 1NKEA 4O3MA 3PW2A 4PGYA 2BCRA 4KMOB 1IG6A 4WQKA 4F2RA 4FO6A 2I6XA 2PFOA 2I5HA 5G5GA 3N4MB 4OO1J 5HRIA 4QZHA 1U47A 4EX6A 5ALEA 3M6KA 4UB2A 1NK8A 4IQVA 3G6YA 4K97A 2ZIWA 3THVA 1Q8KA 2KVSA 3PNCA 1S77D 2ZTEA 4KLQA 2BQRA 5F3XB 3KHHA 2ISOA 3BQ1A 2K60A 1KN5A 2ALZA 3ZDBA 7ICPA 3MR6A 3CK6A 1VLBA 3B0XA 4DF4A 4YG2A 4X4UA 2WF5A 8ICKA 4K4IA 5AKEA 1Z4NA 5ALQA 4DSEA 4EELA 3RB0A 5DBAA 2KHVA 3MDAA 3IP4B 8ICEA 1A77A 2ZIUA 1SXDA 2D3DA 2MAXA 3T5JA 5AI8A 4J9RA 3TARA 3GQCA 2NRWA 1BPYA 2NYVA 2RLTA 1TFRA 4FZNA 2BZFA 5DB6A 1J2MA 1ZQDA 3MGVA 2HBLA 2LYAA 2WF6A 4C7ZA 2E8NA 3UMGA 1YT3A 1ZQWA 5AK4A 3HIYA 4X4RA 3RR7A 2FLLA 5KG6A 3ISDA 1U49A 4PL2A 2KE7A 5KFCA 4Q45A 4YP3A 4UB4A 1F44A 3PW0A 3D2QA 1CEZA 5L1LA 4NLGA 4OD0A 1PVPA 3H8SA 3AQKA 2ZH1A 2KICA 3C1ZA 1SL2A 4P0PB 4CF5A 3ER9B 4I2FA 4B9UA 3M7DA 3BJYA 5AI0A 5J0TA 2LM1A 4X4NA 3HT3A 1NK9A 1H38A 1NI3A 1PK1B 1A76A 9ICLA 3TFRA 4PHEA 1N5WA 4NM1A 3GZFA 1IM4A 3H0LB 1WUDA 7ICQA 2M0NA 5DG7A 2KZMA 4MFFA 3VC8A 5KFFA 4EBJA 3N28A 4Y2RA 4DSFA 4NKTA 4OJ5A 5B5EU 3AUOA 8ICLA 4DEZA 4RPXA 5KFJA 2XVTA 1F0MA 4YN4A 4AT8A 4KLTA 5HRHA 2LM4A 2ESEA 3GILA 5DQGA 1UPHA 1N61A 3HWTA 4BX9C 2KV2A 1RQLA 3L4PA 5AICA 3NRWA 3N7RC 3Q8KA 9ICRA 3CW2C 2KZZA 2N1RA 2DPIA 1S8OA 3K75D 4Y2SA 1QSSA 5DECA 9ICBA 4EBKA 4RUAA 4DQQA 4QZAA 5KFUA 4FH5A 4KM5A 2HHSA 4F5PA 3OVBA 2F44A 1TKDA 1P7DA 4MF8A 2LPEA 2DR7A 3L9DA 4OJ6A 3BQ2A 4R65A 1UQVA 3WKCA 3PMLA 2HSZA 3MCRA 1OXJA 3TKAA 2W43A 2ZJ8A 3PX6A 4DFDA 4F5OA 5J2BA 4EEYA 3C2KA 3RJIA 1Z1BA 9ICNA 5J2EA 2YB1A 3PSFA 4M6WA 2KSOB 4R64A 3D2NA 3H7IA 2G07A 5C0YA 3WFRE 3OHAA 1ZQCA 4C8OA 4MFCA 2UVRA 4ECTA 2MUTB 3EPGA 4DS5A 4I28A 2IHOA 1T3QA 5J0QA 1DK3A 4BJQA 1ZQFA 3FC4A 1PUZA 5TISU 4UARA 2LYBA 4NXXA 5BPCA 3WFOA 5KG2A 1TK8A 4J9MA 1XS9D 4YCXA 3M8SA 5FP0A 4KLJA 4TUQA 2W3RA 5HMLA 5KNIA 4F4XA 7ICUA 2ZG6A 2I9GA 5BOMA 2KFNA 4QZ8A 3VCBA 3SYZA 1SXEA 1OU5A 4B9SA 4I2BA 1ZQQA 2XGPA 4XQ8A 2W7PA 2OXOA 3QU4A 2Y1JA 4EP7A 4KLLA 1XNSA 2J6SA 4PH5A 1JN3A 3MABA 1T3NA 3QYPA 5KAFU 3M9OB 5AK3A 2Y9UA 3RRGA 2F8KA 5HRKA 1SKRA 2F3NA 5AI4A 4EEDA 2HN2A 5F2VO 1KFSA 3SEIA 3NVYA 7ICSA 5KG1A 5J0YA 1L3VA 4UATA 3QUTA 1XSNA 4QIWC 1S10A 1Z00A 4WOYA 1XO0A 3WKBA 1S0VA 2JGAA 4B9NA 3RH4A 5CR0A 2M2VA 3RFAA 4QZBA 1ZD4A 2ZIVA 3ISBA 1QSYA 5BOLA 3M8RA 4C8KA 2HCFA 4TURA 4Q8FA 4DOAA 4O0IA 3RJKA 2FMSA 1KRPA 5IIKA 3E2EA 4OAIZ 1FFVA 4E0DA 2FDRA 4US8A 5KFMA 9ICGA 8ICWA 5ALIA 2HHUA 2DBYA 1ZQOA 4Y2UA 3PR5B 5A0LA 2P6RA 2ZH2A 4CDGA 4PGXA 2DKZA 4YQWA 5IINA 4B9TA 4IQWA 3TANA 4CE6A 3N97B 2P35A 4DLEA 2ES6A 5DEDA 4TUPA 4ED6A 1QH9A 5KT5A 3EF2A 5KG3A 1QSLA 4O3PA 2Y9TA 1JI7A 5KFAA 2IBKA 4RPZA 3ORYA 3CYMA 5KT6A 5CB1A 3PMNA 4ECUA 4DFMA 3EYZA 2C2EA 4BDPA 2KOBA 4K9BA 2IOFA 1XWLA 2GOLA 1SV0C 5F9LA 2GO7A 2PI5A 1PVRA 2JEIA 1M6YA 2ZH3A 3WK6A 4NWIA 3BS5A 3PVXA 1ZQVA 1ZJNA 1RG6A 4KX3A 5KFPA 7ICMA 4UASA 2B6GA 1L7OA 5J8YA 3UXOA 3KD3A 1NJYA 3UXPA 2KJ8A 1NJWA 5F9NA 9ICOA 1SB3C 7ICLA 2W9MA 1NNLA 5HRDA 4NLBA 4Y2XA 5ALUA 5ALSA 1XSPA 1N62A 2JEJA 1QQ5A 4RWNA 1D9FA 1Z4OA 5L9XA 3IN5A 1SZHA 3SR6A 2BCUA 2IA6A 2VJ5A 4JK1A 2AGOA 4O5KA 4M9GA 4QZGA 5AKKA 5CP2A 3MDCA 4NY8A 4I29A 4QNLA 4RQ2A 3ETRA 3RH5A 2W11A 1D8BA 3BQTA 4PHAA 2PI4A 9ICKA 3HJEA 4UB3A 2EANA 3ZD8A 5CFSA 2RDIA 3AQLA 3T5HA 1CUKA 3I76A 2JH7A 2BQ3A 3TFSA 5CFTA 1D8LA 1BPZA 3ZDCA 2BDPA 4F5RA 1LKYA 5AM0A 1JQRA 3C29A 3QE9Y 5ALOA 3RJGA 2FLNA 2UVUA 5HHIA 2OEHA 4IRCA 1JUDA 1KTQA 5ALMA 2KMDA 1ZQIA 3S6JA 2ZUDA 2IHNA 2Y0SF 2BBJA 4FZMA 1Z3EB 3TACB 3WFPA 2AQ0A 3F2CA 2GA9D 3OPXA 2JZBA 4G3IA 3GIMA 2D6FC 1NJXA 3CNHA 5KT7A 7ICNA 4IQUA 4DFKA 1ZRNA 2KHQA 4FBTA 2KJ9A 5IIOA 5J2GA 2G5HB 3RRHA 1RQNA 4B9MA 5DQHA 4RUCA 1RYSA 3Q8SB 3QXGA 2QB0B 3HW8A 2B51A 5AM5A 1OUQA 1ZQSA 2W9BA 2Q0ZX 4X4VA 2VKQA 3OVAA 2ATLA 4X4PA 2B4VA 2EDUA 3HILA 4UD4A 4CCHA 2W54A 1ZQXA 4DLGA 3MC1A 1IIPA 2P66A 3KTQA 4EENA 4OAFA 1ZQLA 1FA0A 2PMZC 3O0FA 2G09A 5JRTA 1XC9A 3PSIA 1JALA 2D8CA 9ICEA 2EZZA 1B43A 2CXYA 2EAPA 2W8LA 3NVOA 1L3UA 2XY6A 3WKEA 2JH1A 4NXZA 1WOTA 4B9LA 4DQIA 2F76X 2DFLA 5DKWA 2Y1IA 4EGWA 1S9FA 4AT7B 2MSNA 3MBYA 5KFEA 2E1FA 2FPKA 1KL9A 2EAOA 4C8LA 2F8LA 4EV6A 3UM9A 3OSPA 3L3FX 2E1EA 1FEZA 3MR5A 3C66A 4GXKA 3GV5B 5KFWA 5B66U 1Q79A 2A1JA 4FHXA 4QJFB 8ICAA 2HVHA 2OCEA 4O3SA 3T3FA 4KLMA 9ICUA 3RJHA 2M2WA 4DSIA 1L7NA 2K4PA 5EOZA 1N5XA 1NK0A 4WC6A 1SV4A 5ALLA 4RQ5A 3Q8RB 2NRXA 3IDWA 2JRZA 1SL1A 3NTUA 3RR8A 7ICHA
chains in the Genus database with same CATH topology
2HHWA 4KTQA 4KLIA 3Q8LA 5HHHA 5KT3A 4UAYA 1LB2B 1DOQA 3H8JA 3BDPA 4YN4A 4AT8A 4DOCA 4KLTA 5HRHA 3C1YA 2V9WA 1K1SA 5KFOA 4I2AA 1RYRA 9ICQA 7ICIA 2VANA 3GILA 5DQGA 1X9MA 4RQ3A 2BCVA 1R89A 2ZH8A 3RH6A 3HWTA 4Q43A 1ZQEA 3RTVA 4DSKA 1R8CA 3KHGA 2VA2A 3PY8A 8ICFA 5DLFA 9ICXA 2V4RA 4KLHA 3TAPA 4Z6DA 1BVSA 4TQSA 1PX5A 2HVIA 3Q8KA 5KT2A 5C5JA 1BPDA 4Q44A 4DL2A 7ICGA 9ICRA 2XCPA 1ZQRA 3EW9A 2KZZA 2DPIA 4WC5A 3UXNA 3LWLA 3K75D 4DL5A 4X5VA 1QSSA 9ICVA 1F5AA 2KP7A 4O3OA 5KFGA 1X2IA 5J0OA 4O9MA 1S0OA 9ICBA 5DECA 4EBKA 4RUAA 4DQQA 1NOMA 7ICKA 4UD5A 4BGDA 9ICWA 4QZAA 2W8KA 5KFUA 4F92B 4NM2A 4FH5A 4KLGA 1ZQJA 2HHSA 4F5PA 3OVBA 3UPQA 9ICTA 1TKDA 3HJ1A 4LZDA 3V6KA 4DO9A 4EBEA 4ED0A 4HYKA 4RPYA 4MF8A 4RQ0A 5HP4A 5KFIA 1BPXA 3HJ4A 2DR7A 3L9DA 4MEYA 5KFXA 7ICJA 3BQ2A 1WCLA 4R65A 3IM1A 1U45A 3PMLA 2M2TA 5DQIA 2FMPA 2IHMA 2HHQA 1JMSA 2DR9A 4DL7A 4NLKA 1U48A 1NKBA 1JXLA 1RZTA 2ASLA 4YD1A 4ED1A 4EZ9A 2BE3A 4RNOA 2HHPA 4TQRA 3RB3A 5J2AA 2FLPA 1JIHA 4RQ6A 8ICQA 2A1JB 1U9LA 4FS1A 2ZJ8A 3MFIA 4ATBB 3PX6A 4F5OA 3RJIA 5J2BA 4EEYA 3C2KA 4AT9B 4UAWA 4KLSA 9ICNA 5J2EA 1TAUA 8ICRA 3PV8A 4LT6A 4M6WA 4X0BA 5KT4A 2AGPA 2ZH5A 1T4GA 5L1KA 1K1QA 2ASDA 4R64A 4UB5A 2IMWP 2Q66A 4M2YA 1HUZA 1NZPA 3H7IA 3OSNA 2R8IA 2NRTA 1JAJA 1UT8A 2BCQA 3WFRE 4RNNA 2ZH9A 3OHAA 5L1JA 3GIIA 4EBDA 1ZETA 1ZQCA 4C8OA 4F2SA 5KFHA 4MFCA 4UAZA 2UVRA 4ECTA 1KFTA 4IR1A 8ICHA 2MUTB 4O3QA 3EPGA 3JPOA 4FS2A 4DS5A 1S97A 4I28A 4O5EA 1UA1A 3JPNA 1ZJMA 2ZUCA 5J0QA 1DK3A 5KFLA 1ZQFA 2V4QA 3ETLA 4K4GA 4QWCA 5D49A 1S0NA 4DOBA 3LDAA 4AT8B 2F1JA 5BPCA 3BQ0A 4Q8EA 4ED7A 5D4BA 5DG8A 3WFOA 2ZH6A 1MIWA 5KG2A 1TK8A 2NRKA 5J0SA 4J9MA 3ZDEA 4R8UA 2XO7A 1XS9D 3LWMA 5HRFA 2ZJ5A 4YCXA 1N56A 5DBBA 5DG9A 1KLNA 3M8SA 4F5QA 3T5LA 3PW5A 4M5DA 5KFZA 2C2DA 1LV5A 4IRDA 4KLJA 4ECXA 4TUQA 2AGQA 2ZH7A 2R8KA 2BGWA 5HMLA 2BQUA 4IQTA 4NLNA 1XSLA 2C28A 4F4XA 3V7LA 4QZDA 7ICUA 4UB1A 3Q8QB 1TVAA 4ED3A 2ZHAA 2I9GA 2DPJA 4WC3A 5BOMA 4J9OA 4QZ8A 2KFNA 3C2MA 3TAQA 3V6HA 4KMUA 4FHPA 3PX0A 3SYZA 4AT9A 2HHTA 1OU5A 4B9SA 4I2BA 1ZQQA 2XGPA 2BCSA 4X4VA 4XQ8A 1L3SA 2Y1JA 3NYBA 1ZYQA 4FHWA 4EP7A 4QW9A 3RB4A 4KLLA 4I2IA 4QZIA 3GIKA 2J6SA 4PH5A 1JN3A 3MABA 4P4OA 1T3NA 4XRHA 1N48A 2DR8A 1RXVA 4EBCA 3M9OB 4IG8A 1ZQZA 4ZH4A 3OUYA 3RRGA 1D9DA 2M9NA 2AU0A 1SKRA 1L5UA 4PGQA 4GLXA 1COOA 5HRKA 3UQ2A 1Q78A 9ICCA 4YR3A 2P6UA 8ICMA 1SZPA 3V6JA 2W9AA 1KFSA 5F2VO 5EWFA 7ICSA 2PBEA 4J9KA 3ZDAA 4DFJA 5KG1A 1TAQA 3H40A 5J0YA 4C8MA 1L3VA 9ICJA 4Z6EA 4B9VA 5KFYA 2R8GA 4M6WB 5KFNA 2PXIA 5DDMA 4DQPA 8ICUA 1XSNA 4R63A 2PFPA 1S10A 1Z00A 1NKCA 3AQNA 3G6VA 5IIMA 1QLNA 1S0VA 4B9NA 1KSPA 1R8BA 4JV0A 3RH4A 2DR5A 7ICVA 1NK7A 5CR0A 7ICOA 1ZQNA 2M2VA 4QZBA 5EWEA 1AROP 2NRVA 2XY5A 2NRZA 4X4SA 1U4BA 3QZ8A 5D46A 4YMOA 5KFBA 5DGBA 3RJFA 3ISBA 4XQ7A 1QSYA 5BOLA 3M8RA 2BPFA 4F50A 4C8KA 4TURA 4WC7A 4Q8FA 4DOAA 2J6UA 3RAQA 4P2HA 3H4BA 2ZHBA 4J9LA 1BNPA 4BXOA 4YXJA 4O0IA 3RJKA 2FMSA 4S3NA 4RZRA 1KRPA 3WFQE 5IIKA 4J9QA 4UBCA 5KTQA 3E2EA 3UPSA 3K4GA 4R8UB 2ZJAA 4DQRA 3LQCB 4M9HA 3M9NB 4E0DA 4FBUA 5KFKA 5KFMA 1NJZA 3AU6A 3FDSA 5KFSA 4ED8A 1TFYA 8ICYA 9ICGA 8ICPA 8ICWA 4ECVA 5HMMA 1EXNA 5J0XA 2HHUA 1ZQYA 1ZQOA 3PR5B 2P6RA 4ELVA 2ZH2A 4MEXA 4RQ7A 4PGXA 3HPOA 1SL0A 4RQ4A 4YQWA 1NK5A 2GWSA 5IINA 4JWNA 5J2DA 4B9TA 3PO4A 1UEVA 4IQWA 4FHYA 4J9SA 4DSLA 4KLDA 4GXJA 3TANA 1MIYA 5HRLA 2LYHA 4UQGA 4EYIB 3N97B 4DLEA 4DL3A 1XU4A 1NK4A 4QWEA 5DEDA 5IIJA 4TUPA 4ED6A 4RWOA 4DQSA 9ICIA 2F1IA 5KT5A 2BKEA 2ZTCA 1TK0A 5KG3A 4Z6CA 2AQ4A 4WC4A 4FH3A 3JPTA 1QSLA 3GV8B 4O3PA 4EZ6A 4PPXA 2O1PA 4WC2A 1ZQPA 3SZ2A 4M9LA 3FYHA 5KFAA 3EZ5A 3SV3A 2ASJA 1SKWA 2IBKA 8ICNA 1VFGA 2JEGA 3OUYB 4QZ9A 4QWAA 4RPZA 3GIJA 3ORYA 5KT6A 3PMNA 5CB1A 4ECUA 4DS4A 4DFMA 3EYZA 2C2EA 4RQ8A 4YR0A 4BDPA 4O5CA 2O5AA 4RQ1A 5J2CA 4DL4A 1XWLA 4X4TA 9ICHA 3H8WA 1KDHA 5F9LA 2PI5A 4ECRA 2JEIA 1IXRA 4GC7A 2BPGA 2ZH3A 1HUOA 4M0AA 4IRKA 1KEJA 5HC9A 2BR0A 1L3TA 3JPSA 3PVXA 1ZQVA 1ZJNA 7ICFA 1BNOA 9ICSA 9ICFA 1NK6A 1Z00B 5KFPA 2HHVA 7ICMA 3RJJA 1RXWA 1DK2A 4I2EA 4KN7A 3UXOA 3Q8PB 4ECYA 4I2GA 1NJYA 3PW4A 3UXPA 4UBBA 1NJWA 4MF2A 3H38A 4NKUA 5F9NA 4I2DA 2KN7A 1MQ2A 9ICOA 5J0WA 5KG7A 4RT3A 7ICLA 4F4WA 3KHRA 2W9MA 1HJPA 2W9CA 4X4QA 2XY7A 8ICZA 2R8JA 1T8EA 2XGQA 5HRDA 8ICBA 1MQ3A 4QW8A 3JZ0A 2UVWA 4BXOB 5DB8A 2BPCA 1XSPA 4F3OA 2JEJA 1UEUA 1BGXT 1RPLA 1MIVA 4RWNA 1Y88A 3V72A 4J9NA 1D9FA 2AJQA 1YLQA 5L9XA 4GC6A 3H4DA 4QZFA 4E80A 9ICPA 3C21A 2BCUA 5J2FA 1ZQUA 2IA6A 2ID1A 4JK1A 3GDXA 2AGOA 4QZEA 4M9GA 4O5KA 4QZGA 7ICEA 1UETA 4RWQA 2DRAA 3B0YA 1R8AA 5CP2A 3MDCA 4NY8A 2XCAA 4I29A 8ICOA 2HHXA 3QEBZ 4MFAA 3OJSA 1V4AA 4WCWA 1ZQAA 1DGSA 4Z6FA 8ICJA 3RJEA 4RQ2A 4F4ZA 4JV2A 5CHGA 4X4OA 4LZGA 3RH5A 4QZCA 3MGIA 2UVVA 2FPLA 4YMNA 4F5NA 3RBDA 4ELUA 3BQTA 1ZQKA 3SV4A 4KLUA 5KFVA 7ICRA 4PHAA 2PI4A 4FHVA 3WFSC 5KFQA 3LK9A 4ECWA 9ICKA 4YR2A 4GXIA 4O3NA 3NGDA 1X9SA 1WCNA 3JPQA 4ECZA 1UT5A 4UB3A 2C22A 4DWIA 3GV7B 1V9PA 2VA3A 1T7PA 2I1QA 4J9PA 3M9MB 3ZDCA 2M2UA 3OV7A 3KHLA 3ZD8A 3RB6A 4M9JA 9ICAA 5J29A 2RDIA 3AQLA 4XUSA 4C8NA 3T5HA 8ICGA 3QZ7A 1CUKA 5J0RA 1TK5A 5HRBA 3HX0A 4I2CA 4YD2A 4RWPA 2DRBA 5IIIA 2BQ3A 3TFSA 1KFDA 1D8LA 4BWMA 5J0UA 4RU9A 1X9WA 3MFHA 1BPZA 5CA7A 2FMQA 2BDPA 4F5RA 4DF8A 5DB7A 1ZQMA 1MSWD 5KG5A 1NKEA 4LVSA 1JQRA 3PW2A 3ZD9A 4PGYA 4E8FA 2WTFA 3QE9Y 1UA0A 3OHBA 2BCRA 3MR2A 3RJGA 4XA5A 3Q8MA 3T5KA 2FLNA 5HHIA 2UVUA 4F4KA 4WC0A 4IRCA 2OWOA 1KTQA 4F2RA 5KFTA 4AT7A 4FO6A 4PHPA 1BPEA 1ZQIA 2PFOA 4K4HA 3N4MB 2ZUDA 5HRIA 2IHNA 4QZHA 4WBZA 3PR4A 1XO1A 1Z3EB 1U47A 4UB2A 1NK8A 2AQ0A 3WFPA 2R8HA 4IQVA 4NLZA 3G6YA 1MC8A 4KLFA 4X0AA 2JZBA 3HP6A 4G3IA 3GIMA 3IHQB 1NJXA 4KLEA 3THVA 2RFFA 3PNCA 2W9CB 5KT7A 7ICNA 5HRGA 5KFDA 1S77D 4IQUA 4DFKA 2ZTEA 4KLQA 1S0MA 2BQRA 4FBTA 2HW3A 4PHDA 3KHHA 5IIOA 2ISOA 3G6XA 5CWRA 3BQ1A 2H5XA 1C7YA 5J2GA 2ALZA 2PFNA 3ZDBA 7ICPA 4E7XA 3RRHA 2B21A 3MR6A 4M9NA 3C18A 4ECQA 5DB9A 4F4YA 3B0XA 5J2HA 5TZVA 4DF4A 3QEAZ 4B9MA 5DQHA 4RUCA 1RYSA 3Q8SB 1VJ7A 4YG2A 2ISPA 4X4UA 4YMMA 5L1IA 3PX4A 3HW8A 2C2RA 1S76D 8ICKA 3ZDDA 8ICCA 1ZQSA 2W9BA 8ICSA 4K4IA 3V7JA 3RAXA 2FPMA 4DSEA 2Q0ZX 4TUSA 3JPPA 3RB0A 5DBAA 1ZQGA 2J6TA 3C23A 3MDAA 1BPBA 2ATLA 4X4PA 8ICEA 1A77A 4RT2A 2F1HA 2ZH4A 4ELTA 3C5GA 4JWMA 2MAXA 4UD4A 3C2LA 3SI8A 3T5JA 3EPIA 4CCHA 1ZQXA 4J9RA 4DLGA 3TARA 4KLOA 1B22A 3GQCA 2NRWA 8ICXA 3C5FA 4I2JA 3TI0A 1SKSA 1BPYA 2JEFA 4DL6A 3EWAA 2P66A 1TFRA 2KZ3A 3UQ0A 3KTQA 1ZQLA 2XC9A 4YVZA 1FA0A 3OVSA 2ZTDA 1XC9A 4EYHB 5DGAA 5DB6A 3GFKB 1JXEA 1ZQDA 4I27A 4M47A 5HR9A 4R66A 7ICTA 8ICIA 4WC1A 9ICEA 1TV9A 4F8RA 1B43A 5DBCA 5JUMA 3HIYA 1ZQWA 4KITB 4X4RA 3H3AA 3RR7A 2FLLA 5KG6A 2W8LA 2VA8A 3ISDA 3PW7A 1L3UA 2XY6A 5IILA 3ISCA 1U49A 2BHNA 4YFKA 5HNKA 5KFRA 2PFQA 5KFCA 4Q45A 4YP3A 4NXZA 1WOTA 5KG4A 4UB4A 3H39A 4DSJA 4B9LA 4DQIA 5DKWA 2DFLA 3PW0A 2Y1IA 1CEZA 4ED2A 5L1LA 4NLGA 8ICTA 1S9FA 4AT7B 5KFEA 4P4MA 3OJUA 2FPKA 3MBYA 3AQMA 4C8LA 3H8SA 3JPRA 4ECSA 3H37A 3OVAA 3OSPA 3AQKA 4F93B 2ZH1A 5DLGA 3AU2A 3C1ZA 1SL2A 1D8YA 4JV1A 1KNYA 1NO5A 3MR5A 4O3RA 4JUZA 4F91B 5HREA 2JZBB 4I2FA 1PZNA 3C66A 4GXKA 2RDJA 3GV5B 5KFWA 4B9UA 4I2HA 1QTMA 1ZQTA 4DFPA 3BJYA 3PO5A 8ICVA 1Q79A 5J0TA 4X4NA 4WBYA 3HT3A 3JYYA 1NK9A 1H38A 2A1JA 4ATBA 4FHXA 5J2IA 5J2JA 5KG0A 3RBEA 2KTQA 2KFZA 2HVHA 9ICMA 8ICAA 1A76A 1ZQBA 4O3SA 2DVIA 3T3FA 5J0PA 1ZQHA 3TFRA 4KLMA 9ICLA 4PHEA 9ICUA 4NM1A 4BWJA 3OGUA 4M04A 1IM4A 3MR3A 3RJHA 3TQ1A 7ICQA 4KN4A 2M2WA 4QWBA 5DDYA 5DG7A 4DSIA 5EWGA 4QWDA 1TFWA 5EOZA 4YXMA 1NK0A 4P4PA 4MFFA 5KFFA 2KZMA 4WC6A 2MUTA 4RNMA 2W9BB 4EBJA 4RQ5A 3Q8RB 2NRXA 4DSFA 5CJ7A 4NKTA 1SL1A 2ZUBA 3V7KA 3NTUA 5J2KA 4DEZA 4RPXA 5KFJA 3MGHA 3AUOA 3RR8A 8ICLA 7ICHA 1JX4A 4IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHW A;  4KTQ A;  4KLI A;  3Q8L A;  5HHH A;  5KT3 A;  4UAY A;  1LB2 B;  1DOQ A;  3H8J A;  3BDP A;  4YN4 A;  4AT8 A;  4DOC A;  4KLT A;  5HRH A;  3C1Y A;  2V9W A;  1K1S A;  5KFO A;  4I2A A;  1RYR A;  9ICQ A;  7ICI A;  2VAN A;  3GIL A;  5DQG A;  1X9M A;  4RQ3 A;  2BCV A;  1R89 A;  2ZH8 A;  3RH6 A;  3HWT A;  4Q43 A;  1ZQE A;  3RTV A;  4DSK A;  1R8C A;  3KHG A;  2VA2 A;  3PY8 A;  8ICF A;  5DLF A;  9ICX A;  2V4R A;  4KLH A;  3TAP A;  4Z6D A;  1BVS A;  4TQS A;  1PX5 A;  2HVI A;  3Q8K A;  5KT2 A;  5C5J A;  1BPD A;  4Q44 A;  4DL2 A;  7ICG A;  9ICR A;  2XCP A;  1ZQR A;  3EW9 A;  2KZZ A;  2DPI A;  4WC5 A;  3UXN A;  3LWL A;  3K75 D;  4DL5 A;  4X5V A;  1QSS A;  9ICV A;  1F5A A;  2KP7 A;  4O3O A;  5KFG A;  1X2I A;  5J0O A;  4O9M A;  1S0O A;  9ICB A;  5DEC A;  4EBK A;  4RUA A;  4DQQ A;  1NOM A;  7ICK A;  4UD5 A;  4BGD A;  9ICW A;  4QZA A;  2W8K A;  5KFU A;  4F92 B;  4NM2 A;  4FH5 A;  4KLG A;  1ZQJ A;  2HHS A;  4F5P A;  3OVB A;  3UPQ A;  9ICT A;  1TKD A;  3HJ1 A;  4LZD A;  3V6K A;  4DO9 A;  4EBE A;  4ED0 A;  4HYK A;  4RPY A;  4MF8 A;  4RQ0 A;  5HP4 A;  5KFI A;  1BPX A;  3HJ4 A;  2DR7 A;  3L9D A;  4MEY A;  5KFX A;  7ICJ A;  3BQ2 A;  1WCL A;  4R65 A;  3IM1 A;  1U45 A;  3PML A;  2M2T A;  5DQI A;  2FMP A;  2IHM A;  2HHQ A;  1JMS A;  2DR9 A;  4DL7 A;  4NLK A;  1U48 A;  1NKB A;  1JXL A;  1RZT A;  2ASL A;  4YD1 A;  4ED1 A;  4EZ9 A;  2BE3 A;  4RNO A;  2HHP A;  4TQR A;  3RB3 A;  5J2A A;  2FLP A;  1JIH A;  4RQ6 A;  8ICQ A;  2A1J B;  1U9L A;  4FS1 A;  2ZJ8 A;  3MFI A;  4ATB B;  3PX6 A;  4F5O A;  3RJI A;  5J2B A;  4EEY A;  3C2K A;  4AT9 B;  4UAW A;  4KLS A;  9ICN A;  5J2E A;  1TAU A;  8ICR A;  3PV8 A;  4LT6 A;  4M6W A;  4X0B A;  5KT4 A;  2AGP A;  2ZH5 A;  1T4G A;  5L1K A;  1K1Q A;  2ASD A;  4R64 A;  4UB5 A;  2IMW P;  2Q66 A;  4M2Y A;  1HUZ A;  1NZP A;  3H7I A;  3OSN A;  2R8I A;  2NRT A;  1JAJ A;  1UT8 A;  2BCQ A;  3WFR E;  4RNN A;  2ZH9 A;  3OHA A;  5L1J A;  3GII A;  4EBD A;  1ZET A;  1ZQC A;  4C8O A;  4F2S A;  5KFH A;  4MFC A;  4UAZ A;  2UVR A;  4ECT A;  1KFT A;  4IR1 A;  8ICH A;  2MUT B;  4O3Q A;  3EPG A;  3JPO A;  4FS2 A;  4DS5 A;  1S97 A;  4I28 A;  4O5E A;  1UA1 A;  3JPN A;  1ZJM A;  2ZUC A;  5J0Q A;  1DK3 A;  5KFL A;  1ZQF A;  2V4Q A;  3ETL A;  4K4G A;  4QWC A;  5D49 A;  1S0N A;  4DOB A;  3LDA A;  4AT8 B;  2F1J A;  5BPC A;  3BQ0 A;  4Q8E A;  4ED7 A;  5D4B A;  5DG8 A;  3WFO A;  2ZH6 A;  1MIW A;  5KG2 A;  1TK8 A;  2NRK A;  5J0S A;  4J9M A;  3ZDE A;  4R8U A;  2XO7 A;  1XS9 D;  3LWM A;  5HRF A;  2ZJ5 A;  4YCX A;  1N56 A;  5DBB A;  5DG9 A;  1KLN A;  3M8S A;  4F5Q A;  3T5L A;  3PW5 A;  4M5D A;  5KFZ A;  2C2D A;  1LV5 A;  4IRD A;  4KLJ A;  4ECX A;  4TUQ A;  2AGQ A;  2ZH7 A;  2R8K A;  2BGW A;  5HML A;  2BQU A;  4IQT A;  4NLN A;  1XSL A;  2C28 A;  4F4X A;  3V7L A;  4QZD A;  7ICU A;  4UB1 A;  3Q8Q B;  1TVA A;  4ED3 A;  2ZHA A;  2I9G A;  2DPJ A;  4WC3 A;  5BOM A;  4J9O A;  4QZ8 A;  2KFN A;  3C2M A;  3TAQ A;  3V6H A;  4KMU A;  4FHP A;  3PX0 A;  3SYZ A;  4AT9 A;  2HHT A;  1OU5 A;  4B9S A;  4I2B A;  1ZQQ A;  2XGP A;  2BCS A;  4X4V A;  4XQ8 A;  1L3S A;  2Y1J A;  3NYB A;  1ZYQ A;  4FHW A;  4EP7 A;  4QW9 A;  3RB4 A;  4KLL A;  4I2I A;  4QZI A;  3GIK A;  2J6S A;  4PH5 A;  1JN3 A;  3MAB A;  4P4O A;  1T3N A;  4XRH A;  1N48 A;  2DR8 A;  1RXV A;  4EBC A;  3M9O B;  4IG8 A;  1ZQZ A;  4ZH4 A;  3OUY A;  3RRG A;  1D9D A;  2M9N A;  2AU0 A;  1SKR A;  1L5U A;  4PGQ A;  4GLX A;  1COO A;  5HRK A;  3UQ2 A;  1Q78 A;  9ICC A;  4YR3 A;  2P6U A;  8ICM A;  1SZP A;  3V6J A;  2W9A A;  1KFS A;  5F2V O;  5EWF A;  7ICS A;  2PBE A;  4J9K A;  3ZDA A;  4DFJ A;  5KG1 A;  1TAQ A;  3H40 A;  5J0Y A;  4C8M A;  1L3V A;  9ICJ A;  4Z6E A;  4B9V A;  5KFY A;  2R8G A;  4M6W B;  5KFN A;  2PXI A;  5DDM A;  4DQP A;  8ICU A;  1XSN A;  4R63 A;  2PFP A;  1S10 A;  1Z00 A;  1NKC A;  3AQN A;  3G6V A;  5IIM A;  1QLN A;  1S0V A;  4B9N A;  1KSP A;  1R8B A;  4JV0 A;  3RH4 A;  2DR5 A;  7ICV A;  1NK7 A;  5CR0 A;  7ICO A;  1ZQN A;  2M2V A;  4QZB A;  5EWE A;  1ARO P;  2NRV A;  2XY5 A;  2NRZ A;  4X4S A;  1U4B A;  3QZ8 A;  5D46 A;  4YMO A;  5KFB A;  5DGB A;  3RJF A;  3ISB A;  4XQ7 A;  1QSY A;  5BOL A;  3M8R A;  2BPF A;  4F50 A;  4C8K A;  4TUR A;  4WC7 A;  4Q8F A;  4DOA A;  2J6U A;  3RAQ A;  4P2H A;  3H4B A;  2ZHB A;  4J9L A;  1BNP A;  4BXO A;  4YXJ A;  4O0I A;  3RJK A;  2FMS A;  4S3N A;  4RZR A;  1KRP A;  3WFQ E;  5IIK A;  4J9Q A;  4UBC A;  5KTQ A;  3E2E A;  3UPS A;  3K4G A;  4R8U B;  2ZJA A;  4DQR A;  3LQC B;  4M9H A;  3M9N B;  4E0D A;  4FBU A;  5KFK A;  5KFM A;  1NJZ A;  3AU6 A;  3FDS A;  5KFS A;  4ED8 A;  1TFY A;  8ICY A;  9ICG A;  8ICP A;  8ICW A;  4ECV A;  5HMM A;  1EXN A;  5J0X A;  2HHU A;  1ZQY A;  1ZQO A;  3PR5 B;  2P6R A;  4ELV A;  2ZH2 A;  4MEX A;  4RQ7 A;  4PGX A;  3HPO A;  1SL0 A;  4RQ4 A;  4YQW A;  1NK5 A;  2GWS A;  5IIN A;  4JWN A;  5J2D A;  4B9T A;  3PO4 A;  1UEV A;  4IQW A;  4FHY A;  4J9S A;  4DSL A;  4KLD A;  4GXJ A;  3TAN A;  1MIY A;  5HRL A;  2LYH A;  4UQG A;  4EYI B;  3N97 B;  4DLE A;  4DL3 A;  1XU4 A;  1NK4 A;  4QWE A;  5DED A;  5IIJ A;  4TUP A;  4ED6 A;  4RWO A;  4DQS A;  9ICI A;  2F1I A;  5KT5 A;  2BKE A;  2ZTC A;  1TK0 A;  5KG3 A;  4Z6C A;  2AQ4 A;  4WC4 A;  4FH3 A;  3JPT A;  1QSL A;  3GV8 B;  4O3P A;  4EZ6 A;  4PPX A;  2O1P A;  4WC2 A;  1ZQP A;  3SZ2 A;  4M9L A;  3FYH A;  5KFA A;  3EZ5 A;  3SV3 A;  2ASJ A;  1SKW A;  2IBK A;  8ICN A;  1VFG A;  2JEG A;  3OUY B;  4QZ9 A;  4QWA A;  4RPZ A;  3GIJ A;  3ORY A;  5KT6 A;  3PMN A;  5CB1 A;  4ECU A;  4DS4 A;  4DFM A;  3EYZ A;  2C2E A;  4RQ8 A;  4YR0 A;  4BDP A;  4O5C A;  2O5A A;  4RQ1 A;  5J2C A;  4DL4 A;  1XWL A;  4X4T A;  9ICH A;  3H8W A;  1KDH A;  5F9L A;  2PI5 A;  4ECR A;  2JEI A;  1IXR A;  4GC7 A;  2BPG A;  2ZH3 A;  1HUO A;  4M0A A;  4IRK A;  1KEJ A;  5HC9 A;  2BR0 A;  1L3T A;  3JPS A;  3PVX A;  1ZQV A;  1ZJN A;  7ICF A;  1BNO A;  9ICS A;  9ICF A;  1NK6 A;  1Z00 B;  5KFP A;  2HHV A;  7ICM A;  3RJJ A;  1RXW A;  1DK2 A;  4I2E A;  4KN7 A;  3UXO A;  3Q8P B;  4ECY A;  4I2G A;  1NJY A;  3PW4 A;  3UXP A;  4UBB A;  1NJW A;  4MF2 A;  3H38 A;  4NKU A;  5F9N A;  4I2D A;  2KN7 A;  1MQ2 A;  9ICO A;  5J0W A;  5KG7 A;  4RT3 A;  7ICL A;  4F4W A;  3KHR A;  2W9M A;  1HJP A;  2W9C A;  4X4Q A;  2XY7 A;  8ICZ A;  2R8J A;  1T8E A;  2XGQ A;  5HRD A;  8ICB A;  1MQ3 A;  4QW8 A;  3JZ0 A;  2UVW A;  4BXO B;  5DB8 A;  2BPC A;  1XSP A;  4F3O A;  2JEJ A;  1UEU A;  1BGX T;  1RPL A;  1MIV A;  4RWN A;  1Y88 A;  3V72 A;  4J9N A;  1D9F A;  2AJQ A;  1YLQ A;  5L9X A;  4GC6 A;  3H4D A;  4QZF A;  4E80 A;  9ICP A;  3C21 A;  2BCU A;  5J2F A;  1ZQU A;  2IA6 A;  2ID1 A;  4JK1 A;  3GDX A;  2AGO A;  4QZE A;  4M9G A;  4O5K A;  4QZG A;  7ICE A;  1UET A;  4RWQ A;  2DRA A;  3B0Y A;  1R8A A;  5CP2 A;  3MDC A;  4NY8 A;  2XCA A;  4I29 A;  8ICO A;  2HHX A;  3QEB Z;  4MFA A;  3OJS A;  1V4A A;  4WCW A;  1ZQA A;  1DGS A;  4Z6F A;  8ICJ A;  3RJE A;  4RQ2 A;  4F4Z A;  4JV2 A;  5CHG A;  4X4O A;  4LZG A;  3RH5 A;  4QZC A;  3MGI A;  2UVV A;  2FPL A;  4YMN A;  4F5N A;  3RBD A;  4ELU A;  3BQT A;  1ZQK A;  3SV4 A;  4KLU A;  5KFV A;  7ICR A;  4PHA A;  2PI4 A;  4FHV A;  3WFS C;  5KFQ A;  3LK9 A;  4ECW A;  9ICK A;  4YR2 A;  4GXI A;  4O3N A;  3NGD A;  1X9S A;  1WCN A;  3JPQ A;  4ECZ A;  1UT5 A;  4UB3 A;  2C22 A;  4DWI A;  3GV7 B;  1V9P A;  2VA3 A;  1T7P A;  2I1Q A;  4J9P A;  3M9M B;  3ZDC A;  2M2U A;  3OV7 A;  3KHL A;  3ZD8 A;  3RB6 A;  4M9J A;  9ICA A;  5J29 A;  2RDI A;  3AQL A;  4XUS A;  4C8N A;  3T5H A;  8ICG A;  3QZ7 A;  1CUK A;  5J0R A;  1TK5 A;  5HRB A;  3HX0 A;  4I2C A;  4YD2 A;  4RWP A;  2DRB A;  5III A;  2BQ3 A;  3TFS A;  1KFD A;  1D8L A;  4BWM A;  5J0U A;  4RU9 A;  1X9W A;  3MFH A;  1BPZ A;  5CA7 A;  2FMQ A;  2BDP A;  4F5R A;  4DF8 A;  5DB7 A;  1ZQM A;  1MSW D;  5KG5 A;  1NKE A;  4LVS A;  1JQR A;  3PW2 A;  3ZD9 A;  4PGY A;  4E8F A;  2WTF A;  3QE9 Y;  1UA0 A;  3OHB A;  2BCR A;  3MR2 A;  3RJG A;  4XA5 A;  3Q8M A;  3T5K A;  2FLN A;  5HHI A;  2UVU A;  4F4K A;  4WC0 A;  4IRC A;  2OWO A;  1KTQ A;  4F2R A;  5KFT A;  4AT7 A;  4FO6 A;  4PHP A;  1BPE A;  1ZQI A;  2PFO A;  4K4H A;  3N4M B;  2ZUD A;  5HRI A;  2IHN A;  4QZH A;  4WBZ A;  3PR4 A;  1XO1 A;  1Z3E B;  1U47 A;  4UB2 A;  1NK8 A;  2AQ0 A;  3WFP A;  2R8H A;  4IQV A;  4NLZ A;  3G6Y A;  1MC8 A;  4KLF A;  4X0A A;  2JZB A;  3HP6 A;  4G3I A;  3GIM A;  3IHQ B;  1NJX A;  4KLE A;  3THV A;  2RFF A;  3PNC A;  2W9C B;  5KT7 A;  7ICN A;  5HRG A;  5KFD A;  1S77 D;  4IQU A;  4DFK A;  2ZTE A;  4KLQ A;  1S0M A;  2BQR A;  4FBT A;  2HW3 A;  4PHD A;  3KHH A;  5IIO A;  2ISO A;  3G6X A;  5CWR A;  3BQ1 A;  2H5X A;  1C7Y A;  5J2G A;  2ALZ A;  2PFN A;  3ZDB A;  7ICP A;  4E7X A;  3RRH A;  2B21 A;  3MR6 A;  4M9N A;  3C18 A;  4ECQ A;  5DB9 A;  4F4Y A;  3B0X A;  5J2H A;  5TZV A;  4DF4 A;  3QEA Z;  4B9M A;  5DQH A;  4RUC A;  1RYS A;  3Q8S B;  1VJ7 A;  4YG2 A;  2ISP A;  4X4U A;  4YMM A;  5L1I A;  3PX4 A;  3HW8 A;  2C2R A;  1S76 D;  8ICK A;  3ZDD A;  8ICC A;  1ZQS A;  2W9B A;  8ICS A;  4K4I A;  3V7J A;  3RAX A;  2FPM A;  4DSE A;  2Q0Z X;  4TUS A;  3JPP A;  3RB0 A;  5DBA A;  1ZQG A;  2J6T A;  3C23 A;  3MDA A;  1BPB A;  2ATL A;  4X4P A;  8ICE A;  1A77 A;  4RT2 A;  2F1H A;  2ZH4 A;  4ELT A;  3C5G A;  4JWM A;  2MAX A;  4UD4 A;  3C2L A;  3SI8 A;  3T5J A;  3EPI A;  4CCH A;  1ZQX A;  4J9R A;  4DLG A;  3TAR A;  4KLO A;  1B22 A;  3GQC A;  2NRW A;  8ICX A;  3C5F A;  4I2J A;  3TI0 A;  1SKS A;  1BPY A;  2JEF A;  4DL6 A;  3EWA A;  2P66 A;  1TFR A;  2KZ3 A;  3UQ0 A;  3KTQ A;  1ZQL A;  2XC9 A;  4YVZ A;  1FA0 A;  3OVS A;  2ZTD A;  1XC9 A;  4EYH B;  5DGA A;  5DB6 A;  3GFK B;  1JXE A;  1ZQD A;  4I27 A;  4M47 A;  5HR9 A;  4R66 A;  7ICT A;  8ICI A;  4WC1 A;  9ICE A;  1TV9 A;  4F8R A;  1B43 A;  5DBC A;  5JUM A;  3HIY A;  1ZQW A;  4KIT B;  4X4R A;  3H3A A;  3RR7 A;  2FLL A;  5KG6 A;  2W8L A;  2VA8 A;  3ISD A;  3PW7 A;  1L3U A;  2XY6 A;  5IIL A;  3ISC A;  1U49 A;  2BHN A;  4YFK A;  5HNK A;  5KFR A;  2PFQ A;  5KFC A;  4Q45 A;  4YP3 A;  4NXZ A;  1WOT A;  5KG4 A;  4UB4 A;  3H39 A;  4DSJ A;  4B9L A;  4DQI A;  5DKW A;  2DFL A;  3PW0 A;  2Y1I A;  1CEZ A;  4ED2 A;  5L1L A;  4NLG A;  8ICT A;  1S9F A;  4AT7 B;  5KFE A;  4P4M A;  3OJU A;  2FPK A;  3MBY A;  3AQM A;  4C8L A;  3H8S A;  3JPR A;  4ECS A;  3H37 A;  3OVA A;  3OSP A;  3AQK A;  4F93 B;  2ZH1 A;  5DLG A;  3AU2 A;  3C1Z A;  1SL2 A;  1D8Y A;  4JV1 A;  1KNY A;  1NO5 A;  3MR5 A;  4O3R A;  4JUZ A;  4F91 B;  5HRE A;  2JZB B;  4I2F A;  1PZN A;  3C66 A;  4GXK A;  2RDJ A;  3GV5 B;  5KFW A;  4B9U A;  4I2H A;  1QTM A;  1ZQT A;  4DFP A;  3BJY A;  3PO5 A;  8ICV A;  1Q79 A;  5J0T A;  4X4N A;  4WBY A;  3HT3 A;  3JYY A;  1NK9 A;  1H38 A;  2A1J A;  4ATB A;  4FHX A;  5J2I A;  5J2J A;  5KG0 A;  3RBE A;  2KTQ A;  2KFZ A;  2HVH A;  9ICM A;  8ICA A;  1A76 A;  1ZQB A;  4O3S A;  2DVI A;  3T3F A;  5J0P A;  1ZQH A;  3TFR A;  4KLM A;  9ICL A;  4PHE A;  9ICU A;  4NM1 A;  4BWJ A;  3OGU A;  4M04 A;  1IM4 A;  3MR3 A;  3RJH A;  3TQ1 A;  7ICQ A;  4KN4 A;  2M2W A;  4QWB A;  5DDY A;  5DG7 A;  4DSI A;  5EWG A;  4QWD A;  1TFW A;  5EOZ A;  4YXM A;  1NK0 A;  4P4P A;  4MFF A;  5KFF A;  2KZM A;  4WC6 A;  2MUT A;  4RNM A;  2W9B B;  4EBJ A;  4RQ5 A;  3Q8R B;  2NRX A;  4DSF A;  5CJ7 A;  4NKT A;  1SL1 A;  2ZUB A;  3V7K A;  3NTU A;  5J2K A;  4DEZ A;  4RPX A;  5KFJ A;  3MGH A;  3AUO A;  3RR8 A;  8ICL A;  7ICH A;  1JX4 A;  4IR9 A; 
#chains in the Genus database with same CATH topology
 2YTU A;  4KTQ A;  4KLI A;  3Q8L A;  5HHH A;  5KT3 A;  1DOQ A;  3H8J A;  3BDP A;  2BDU A;  1N60 A;  2V9W A;  5KFO A;  3SQI A;  2VIX A;  9ICQ A;  7ICI A;  1R89 A;  4Q43 A;  3K1Z A;  2V4R A;  4Z6D A;  1BVS A;  4TQS A;  4DL2 A;  3ZI4 A;  2XCP A;  5KL1 B;  1ZQR A;  4IC9 A;  2EH9 A;  2KP7 A;  5J0O A;  1NOM A;  1RDF A;  1Z19 A;  1Q46 A;  4KLG A;  4EEB A;  2YB4 A;  4AYB C;  2LBO A;  3RF9 A;  2MU2 A;  3UPQ A;  3V6K A;  3HJ4 A;  5AKX A;  2A3V A;  3IM1 A;  2LKY A;  2RP5 A;  4MHV A;  2M2T A;  3NVW A;  5DQI A;  2IHM A;  2HHQ A;  2DR9 A;  4DL7 A;  2FI1 A;  1JXL A;  4YD1 A;  3PST A;  4ED1 A;  3WKA A;  4EZ9 A;  2KJ5 A;  4RNO A;  5J2A A;  1F5S A;  1V97 A;  1U9L A;  1ZD2 P;  2G0A A;  3AQE A;  4ATB B;  1MN8 A;  1TAU A;  2AGP A;  1T4G A;  3NVV A;  4UAV A;  4M2Y A;  3OSN A;  2NRT A;  2Y0S C;  1UT8 A;  3F2D A;  5L1J A;  4EBD A;  1ZET A;  4F2S A;  2A19 A;  1KFT A;  3QU9 A;  1YZ7 A;  1L7M A;  4CF3 A;  3PHZ A;  2HDO A;  2EZX A;  1S0N A;  4J03 A;  4WQL A;  4ED7 A;  4PZN A;  5J0S A;  3ZDE A;  2KIV A;  3LWM A;  4F5Q A;  3T5L A;  3PW5 A;  2OH2 A;  4ECX A;  5ALP A;  2R8K A;  2BGW A;  1XSL A;  2C28 A;  4UB1 A;  1TVA A;  2DPJ A;  5ALW A;  3F2B A;  4P0Q A;  3UMC A;  4C0Z A;  5ALN A;  2HI0 A;  4UAU A;  1N48 A;  4P4O A;  4XRH A;  4EBC A;  1ZQZ A;  3OUY A;  5JTG A;  1D9D A;  2XIC A;  4PGQ A;  4GLX A;  1COO A;  3ED5 A;  5AKZ A;  1N2X A;  2DUY A;  2YN4 A;  9ICC A;  4YR3 A;  4IS7 A;  4JLZ A;  3V6J A;  2W9A A;  5EWF A;  4J9K A;  3ZDA A;  4Z6E A;  5KFY A;  2R8G A;  5ALD A;  5KFN A;  2PXI A;  3NWI A;  1A6S A;  4R63 A;  5AIB A;  1NKC A;  2WF8 A;  3G6V A;  1QLN A;  1NK7 A;  3SEN A;  3LYS A;  1QQ6 A;  5EWE A;  1ARO P;  2NRZ A;  4X4S A;  3QZ8 A;  4YMO A;  5KFB A;  3K1R B;  4XQ7 A;  2J6U A;  4GFJ A;  3H4B A;  2EQY A;  5AKH A;  5K4L A;  1BNP A;  3AEV A;  4RZR A;  3WFQ E;  4J9Q A;  3UPS A;  2QAR A;  3K4G A;  4R8U B;  4DQR A;  3KZI U;  3U26 A;  2H3Z A;  4ED8 A;  8ICY A;  8ICP A;  3HRD D;  2ODG A;  1ZRM A;  5AI9 A;  1QQ7 A;  1X9X A;  4RQ7 A;  2E5S A;  4JWN A;  5J2D A;  3QUQ A;  4J9S A;  3QUB A;  3SAG A;  5HRL A;  4UQG A;  1HIW A;  1XU4 A;  5IIJ A;  4RWO A;  2F1I A;  2ZTC A;  2DKX A;  1TK0 A;  4Z6C A;  4EZ6 A;  2ZIX A;  1ZQP A;  3SV3 A;  2Z7J A;  4O5C A;  4A8E A;  2O5A A;  4DL4 A;  3H8W A;  1IXR A;  2BPG A;  1TE2 A;  3C28 A;  1HUO A;  4M0A A;  3D2S A;  1L3T A;  7ICF A;  2E3T A;  2HHV A;  3RJJ A;  1DK2 A;  5AKJ A;  4ECY A;  3WK4 A;  3PW4 A;  2KEY A;  3N7S C;  4U6P A;  1JRO A;  4RT3 A;  3ERC C;  4ACO A;  4X4Q A;  2XY7 A;  2R8J A;  4OJO A;  5CRX A;  2YX8 A;  1T8E A;  3H0M B;  4CRX A;  4NV0 A;  8ICB A;  2VJ4 A;  4BXO B;  2BPC A;  4F3O A;  1BGX T;  1V85 A;  4J9N A;  2CRX A;  3AQF A;  1YLQ A;  4GC6 A;  9ICP A;  5J2F A;  1ZQU A;  2ID1 A;  4NL9 C;  3GDX A;  1KBU A;  3LVV A;  2WF9 A;  2DRA A;  4JLX A;  3B0Y A;  3BQ7 A;  2K4H A;  4MFA A;  4WCW A;  1DGS A;  4Z6F A;  4JV2 A;  3MGI A;  5EE9 A;  4YMN A;  3KBB A;  2EWR A;  5KFQ A;  3SAH A;  5B3Q A;  3A0H U;  4ECZ A;  2C22 A;  5AIA A;  1T7P A;  4J9P A;  3OV7 A;  3RB6 A;  5D61 A;  4XJE A;  1TK5 A;  5HRB A;  4I2C A;  5III A;  5D62 A;  2HOQ A;  2E8O A;  3QU5 A;  1COK A;  4BWM A;  4RU9 A;  5DB7 A;  4LVS A;  2BBH A;  3ZD9 A;  4E8F A;  3OHB A;  3Q8M A;  4F4K A;  5ALV A;  4NXU A;  3CP8 A;  3DDH A;  4C4T A;  4PHP A;  1BPE A;  1K5O A;  2H3F A;  4WBZ A;  2R8H A;  4MKP A;  4NLZ A;  4P0P A;  1MC8 A;  3HP6 A;  4Y2J A;  3IHQ B;  2RFF A;  2W9C B;  1S0M A;  4PHD A;  4I2H A;  4RQM A;  5CWR A;  1C7Y A;  1PK1 A;  2IUB A;  2B21 A;  5DB9 A;  2YMP A;  4WH5 A;  5J2H A;  3EUB 2;  3QEA Z;  4PL1 A;  1VJ7 A;  1SGG A;  2KKV A;  4HAI A;  2DWQ A;  3PX4 A;  2FJ6 A;  1S76 D;  3SMV A;  5AI6 A;  2W55 A;  3JCF A;  2FPM A;  2J6T A;  4TUS A;  3JPP A;  1PK3 A;  4RT2 A;  2QLT A;  2ZH4 A;  3C5G A;  4JWM A;  4KLO A;  1B22 A;  2HOF A;  5AM2 A;  1SKS A;  2YY6 A;  4DL6 A;  3UQ0 A;  2GAF D;  4YVZ A;  5AM1 A;  4EYH B;  2RQ5 A;  4B6J A;  4I27 A;  4M47 A;  4U7C A;  7ICT A;  8ICI A;  4WC1 A;  3WU2 U;  1TV9 A;  1DXS A;  5DBC A;  4KIT B;  3H3A A;  3IG5 A;  2VA8 A;  3PW7 A;  3ISC A;  2BHN A;  5HR6 A;  2DQN B;  5HNK A;  2DF4 B;  2NO5 A;  3QX7 A;  5H2F U;  4OAH A;  3AN1 A;  3H39 A;  3SD7 A;  4ED2 A;  8ICT A;  3IV6 A;  3AQM A;  3OJU A;  3H37 A;  5AK6 A;  4F93 B;  3K7D A;  3AU2 A;  1J97 A;  1KNY A;  4JUZ A;  5HRE A;  1PZN A;  5ALT A;  1QTM A;  2ZIW B;  4ICA A;  3PO5 A;  4WBY A;  3JYY A;  2WFA A;  5J2I A;  2KFZ A;  2KSO A;  3J81 j;  1FIQ A;  2YMQ A;  3I1Y A;  5EWG A;  4QWD A;  1TFW A;  4YXM A;  1GPJ A;  4P4P A;  2MUT A;  4RNM A;  2GH1 A;  3V7K A;  3DV9 A;  2WF7 A;  2ZIU B;  4NXW A;  3AL0 B;  5AHX A;  1K1S A;  1RYR A;  2VAN A;  3WK7 A;  2ZH8 A;  1ZQE A;  3RTV A;  3KHG A;  2VA2 A;  3PY8 A;  9ICX A;  4KLH A;  1RYU A;  1PX5 A;  5KT2 A;  1BPD A;  3WK8 A;  3A0B U;  3EW9 A;  4WC5 A;  9ICV A;  4LJX A;  4O3O A;  1X2I A;  4O9M A;  1S0O A;  2JXJ A;  7ICK A;  4UD5 A;  2KK0 A;  4NM2 A;  1OW5 A;  3FAH A;  4UW9 A;  3ICX A;  4LZD A;  4DO9 A;  4EBE A;  4HYK A;  4RQ0 A;  5KFI A;  3DEE A;  3L5K A;  7ICJ A;  4Y2Q A;  4CGZ A;  2OHF A;  2ZXI A;  1U45 A;  2FMP A;  1JMS A;  2EZY A;  4NJ8 A;  1U48 A;  1NKB A;  2ASL A;  2BE3 A;  4K9A A;  2HHP A;  3TAD C;  4RQ6 A;  8ICQ A;  3HKZ F;  2H3I A;  4KLS A;  8ICR A;  4LT6 A;  4X0B A;  5KT4 A;  2ZH5 A;  4USA A;  5JTI A;  1N63 A;  2IMW P;  4I0U A;  4UB5 A;  4UB8 U;  1HUZ A;  1NZP A;  2R8I A;  2BCQ A;  2W04 A;  4RNN A;  5AM4 A;  2ZH9 A;  1J2N A;  1UA1 A;  2JHD A;  2K4E A;  2ZUC A;  2KG5 A;  5KFL A;  3ETL A;  4K4G A;  4DOB A;  4AT8 B;  2F1J A;  5D4B A;  1WWV A;  1MIW A;  2NRK A;  4M5D A;  5HRF A;  3N7P D;  1B0X A;  4NLC A;  2WHE A;  5DBB A;  2NV3 A;  1LV5 A;  4IRD A;  3ALR A;  1DGJ A;  2ZH7 A;  4NLN A;  1WWU A;  2HMX A;  4QZD A;  1X40 A;  4J9O A;  3C2M A;  3TAQ A;  3V6H A;  4KMU A;  4AT9 A;  2HHT A;  4K99 A;  5ALK A;  3NS1 A;  1L3S A;  4FHW A;  4GIB A;  2H3V A;  4I2I A;  4Y2T A;  4QZI A;  1FFU A;  4OCZ A;  3GIK A;  2DR8 A;  1ED1 A;  1VJ5 A;  2YMM A;  3M6Z A;  4ZH4 A;  2AU0 A;  1Q78 A;  2XI9 A;  3R9K A;  2PBE A;  1O08 A;  4DFJ A;  1TAQ A;  3H40 A;  9ICJ A;  4B9V A;  4M6W B;  4DQP A;  2PFP A;  5IIM A;  1R8B A;  4JV0 A;  7ICV A;  2GLE A;  4UB6 U;  1KQQ A;  5AM3 A;  2G06 A;  3E0F A;  1U4B A;  1AQ6 A;  4F50 A;  4WC7 A;  4P2H A;  3RAQ A;  4YXJ A;  2OYY A;  4UBC A;  3LQC B;  2B56 A;  1IV8 A;  2ZJA A;  4M9H A;  2W7O A;  5ALH A;  4FBU A;  5KFK A;  1TFY A;  3FDS A;  5KFS A;  4Y2Y A;  4ECV A;  1ZD5 A;  1ZQY A;  4K96 A;  5CEH A;  4ELV A;  3HPO A;  4HX0 A;  3E58 A;  4RQ4 A;  1KKX A;  2GWS A;  1UEV A;  3PO4 A;  4KLD A;  5AKG A;  3KKA C;  2LYH A;  3PZP A;  4DL3 A;  4DQS A;  9ICI A;  2BKE A;  2AQ4 A;  4WC4 A;  4FH3 A;  2O1P A;  3KZX A;  4O69 A;  8ICN A;  2JEG A;  1VDV A;  4QWA A;  4O67 A;  3KOO A;  4DS4 A;  5EE1 A;  5J2C A;  4IL6 U;  1L8O A;  1SV0 A;  9ICH A;  4GC7 A;  5AI5 A;  3IRU A;  2BR0 A;  4DCC A;  9ICS A;  1NK6 A;  4LEY A;  1Z00 B;  4I2E A;  4KN7 A;  5J8Y C;  1CRX A;  3Q8P B;  4I2G A;  1B4F A;  4UBB A;  5J0W A;  4F4W A;  1ZOL A;  2ZIV B;  8ICZ A;  2XGQ A;  3M1Y A;  3HKZ C;  3JZ0 A;  2F77 X;  4QIW F;  4OJP A;  1ECW A;  2AJQ A;  2QB0 A;  1ZD3 A;  4E80 A;  3C21 A;  3NUQ A;  1UET A;  4QZE A;  4RWQ A;  2MRL A;  3CRX A;  4WJ3 B;  3QEB Z;  3OJS A;  1ZQA A;  8ICJ A;  4EX7 A;  4F4Z A;  4X4O A;  4LZG A;  3F5A A;  2FPL A;  4KLU A;  1ZQK A;  3SV4 A;  7ICR A;  4FHV A;  3WFS C;  2E8M A;  4YR2 A;  5EE3 A;  2WAQ F;  2A1A A;  1UT5 A;  2QKQ A;  2VA3 A;  5KAI U;  2HBJ A;  4ZOH C;  3M9M B;  3KHL A;  5GTI U;  4M9J A;  9ICA A;  4XUS A;  4C8N A;  2RHF A;  3HX0 A;  4YD2 A;  5T14 A;  2DRB A;  2KD1 A;  2CN1 A;  2RRD A;  1KFD A;  5ALX A;  5J0U A;  4FZL A;  3NAS A;  2FMQ A;  2K4I A;  3OWG A;  1ZQM A;  2WTF A;  1UA0 A;  3MR2 A;  1A0P A;  1O03 A;  4XA5 A;  3T5K A;  4WC0 A;  2OWO A;  3BS5 B;  5KFT A;  4AT7 A;  3NKU A;  3BZC A;  4K4H A;  2B0C A;  4US9 A;  2NO4 A;  3PR4 A;  1XO1 A;  4CNQ A;  3ONN A;  2QB1 A;  4KLF A;  4X0A A;  4KLE A;  1L7P A;  5ALG A;  5HRG A;  5KFD A;  4FE3 A;  2HW3 A;  5AKI A;  2PFN A;  3G6X A;  2ZH6 A;  2H5X A;  4E7X A;  4PJ0 U;  4F72 A;  2KVC A;  5E79 U;  4M9N A;  3C18 A;  4JB3 A;  5EE0 A;  4ECQ A;  4F4Y A;  5TZV A;  5ALR A;  2EAM A;  4YMM A;  5L1I A;  1WYG A;  5JU5 A;  2C2R A;  3ZDD A;  8ICC A;  3V7J A;  3RAX A;  1UHU A;  1ZQG A;  3C23 A;  3TAD A;  1BPB A;  2F1H A;  4ELT A;  3C2L A;  3SI8 A;  3EPI A;  2JV3 A;  8ICX A;  3C5F A;  4I2J A;  3TI0 A;  2JEF A;  5CFU A;  3EWA A;  1UCV A;  2KZ3 A;  2O6K A;  2XC9 A;  3OVS A;  5ALY A;  2ZTD A;  5DGA A;  3GFK B;  1JXE A;  5HR9 A;  4R66 A;  3GU3 A;  4F8R A;  5JUM A;  1X6I A;  4OJL A;  5IIL A;  4YFK A;  2K8B B;  1LKY B;  1SWW A;  5KFR A;  2PFQ A;  3FM9 A;  5AK5 A;  3QU7 A;  2PKE A;  5KG4 A;  4DSJ A;  1CI4 A;  4P4M A;  1KW4 A;  3JPR A;  3SAF A;  1GO3 F;  4ECS A;  2HBM A;  1LVH A;  5DLG A;  1D8Y A;  4K8V A;  3QNM A;  2DL0 A;  4JMU A;  4JV1 A;  1NO5 A;  4O3R A;  4F91 B;  2JZB B;  4C4S A;  2RDJ A;  4N7R A;  1ZQT A;  4DFP A;  8ICV A;  4ATB A;  5J2J A;  5KG0 A;  3RBE A;  2KTQ A;  9ICM A;  1ZQB A;  2DVI A;  5J0P A;  1QCK A;  1ZQH A;  4G9B A;  4BWJ A;  3OGU A;  4M04 A;  3MR3 A;  3H0R B;  3TQ1 A;  4KN4 A;  4QWB A;  5DDY A;  2W9B B;  5CJ7 A;  2ZUB A;  5J2K A;  3MGH A;  2W3S A;  8ICS A;  1JX4 A;  4IR9 A;  2HHW A;  4UAY A;  4KX5 A;  1LB2 B;  1SIJ A;  4DOC A;  3C1Y A;  4I2A A;  1X9M A;  4RQ3 A;  2BCV A;  3RH6 A;  3WK9 A;  4DSK A;  1R8C A;  8ICF A;  5ALF A;  5DLF A;  5ALJ A;  3TAP A;  5L1M A;  2HVI A;  4Q44 A;  5C5J A;  7ICG A;  3B9J A;  4NXT A;  3UXN A;  3LWL A;  4DL5 A;  4X5V A;  1F5A A;  5KFG A;  1X66 A;  4BGD A;  1ZQ1 C;  9ICW A;  2LI6 A;  2CPR A;  2W8K A;  4F92 B;  2PMZ F;  1ZQJ A;  2WAQ C;  1PVQ A;  9ICT A;  3HJ1 A;  3T79 A;  4ED0 A;  4RPY A;  5HP4 A;  1BPX A;  4MEY A;  5KFX A;  3AM9 A;  1WCL A;  4RQN A;  4NLK A;  2G5I B;  1RZT A;  4TQR A;  3RB3 A;  2FLP A;  2DGZ A;  1JIH A;  2A1J B;  4FS1 A;  1X6J A;  3KKA A;  3MFI A;  4AT9 B;  4UAW A;  3PV8 A;  3BS7 A;  5L1K A;  1K1Q A;  2ASD A;  2Q66 A;  4K98 A;  1JAJ A;  3GII A;  2LMR A;  5KFH A;  4UAZ A;  4IR1 A;  8ICH A;  1HEK A;  4O3Q A;  2FCL A;  3JPO A;  4FS2 A;  1S97 A;  4O5E A;  3JPN A;  1ZJM A;  4CF4 A;  3I28 A;  2YQE A;  2V4Q A;  1V38 A;  4QWC A;  5D49 A;  4PZO A;  2IOF K;  3LDA A;  4FFD A;  2YML A;  3BQ0 A;  4Q8E A;  5DG8 A;  2AHO B;  4R8U A;  2XO7 A;  2H3Q A;  2ZJ5 A;  1N56 A;  5DG9 A;  1KLN A;  5KFZ A;  2C2D A;  2WB1 F;  4O6A A;  2AGQ A;  2BQU A;  4IQT A;  3V7L A;  3Q8Q B;  4ED3 A;  1Q3U A;  4LEW A;  4WC3 A;  2ZHA A;  4EEK A;  2KIW A;  1TAM A;  4FHP A;  3PX0 A;  1NZB A;  2ZXH A;  2BCS A;  3NYB A;  3BZK A;  5ALZ A;  1ZYQ A;  2HBK A;  4QW9 A;  3RB4 A;  1RXV A;  4IG8 A;  1MA7 A;  2M9N A;  1L5U A;  3UQ2 A;  2P6U A;  8ICM A;  1SZP A;  2MA1 A;  1RM6 C;  2HN1 A;  4C8M A;  4AYB F;  5DDM A;  8ICU A;  3AQN A;  1JRP A;  4C80 A;  1KSP A;  2DR5 A;  3KFU F;  5CHE A;  7ICO A;  1ZQN A;  3QUC A;  4Y2V A;  3NVZ A;  2NRV A;  2XY5 A;  5D46 A;  5DGB A;  3RJF A;  2F2A B;  2BPF A;  2ZHB A;  4J9L A;  4BXO A;  4S3N A;  2IOH A;  5KTQ A;  2Q4T A;  3M9N B;  2JR5 A;  1NJZ A;  3AU6 A;  2KNJ A;  5HMM A;  1EXN A;  5J0X A;  5D63 A;  4MEX A;  3D6J A;  1SL0 A;  1NK5 A;  4LEZ A;  4FHY A;  1YZ6 A;  4Y2P A;  4DSL A;  1MIY A;  4GXJ A;  4P0Q B;  3ER8 C;  4EYI B;  1NK4 A;  3AMZ A;  4QWE A;  4AP9 A;  1Z1V A;  2K8A A;  3JPT A;  4NXV A;  3GV8 B;  4PPX A;  4C7Y A;  5KL8 B;  1C20 A;  4WC2 A;  1Q3V A;  1DRG A;  5AKY A;  3SZ2 A;  3FYH A;  3EZ5 A;  2ASJ A;  1SKW A;  4M9L A;  4LEV A;  1VFG A;  3OUY B;  1SWV A;  2AH5 A;  4QZ9 A;  3GIJ A;  2ISP A;  2LHT A;  4RQ8 A;  2L5Y A;  2OM6 A;  4YR0 A;  5HR7 A;  1L6N A;  4RQ1 A;  2K8C B;  1S5L U;  4X4T A;  3OTQ A;  1KDH A;  4ECR A;  1X42 A;  2K89 A;  4IRK A;  2R18 A;  1KEJ A;  3H8M A;  5HC9 A;  5GTH U;  3JPS A;  3UMB A;  1BNO A;  9ICF A;  4KB6 A;  2W03 A;  1RXW A;  3WK5 A;  3QU2 A;  5AKL A;  4MF2 A;  3H38 A;  2E8P A;  1L8L A;  2HOI A;  4NKU A;  4I2D A;  2KN7 A;  1MQ2 A;  5KG7 A;  3KHR A;  2W9C A;  1HJP A;  4BUG A;  2XID A;  1MQ3 A;  4QW8 A;  1ZXI A;  2UVW A;  3NRZ A;  2AXT U;  5DB8 A;  1UEU A;  1MIV A;  1RPL A;  1Y88 A;  2QAR B;  3V72 A;  3H4D A;  4QZF A;  3F5E A;  4NL9 A;  7ICE A;  5B3P A;  1URJ A;  2JMG A;  1R8A A;  4O68 A;  8ICO A;  2XCA A;  2HHX A;  1V4A A;  1T94 A;  3RJE A;  5CHG A;  4QZC A;  4OAG A;  2UVV A;  3RBD A;  4ELU A;  4F5N A;  5KFV A;  3LK9 A;  4ECW A;  4GXI A;  4O3N A;  2FE9 A;  3F53 A;  1WCN A;  3NGD A;  1X9S A;  3JPQ A;  5G5H A;  4DWI A;  3GV7 B;  1V9P A;  1WG8 A;  3PSP A;  2I1Q A;  2M2U A;  3IG8 A;  4C4R A;  4F71 A;  5J29 A;  8ICG A;  2WB1 C;  2ZIX B;  3QZ7 A;  5J0R A;  4RWP A;  2KKP A;  3WKD A;  4FO1 A;  1FO4 A;  3LVW A;  1X9W A;  3MFH A;  5CA7 A;  4DF8 A;  1MSW D;  2G08 A;  5KG5 A;  1NKE A;  4O3M A;  3PW2 A;  4PGY A;  2BCR A;  4KMO B;  1IG6 A;  4WQK A;  4F2R A;  4FO6 A;  2I6X A;  2PFO A;  2I5H A;  5G5G A;  3N4M B;  4OO1 J;  5HRI A;  4QZH A;  1U47 A;  4EX6 A;  5ALE A;  3M6K A;  4UB2 A;  1NK8 A;  4IQV A;  3G6Y A;  4K97 A;  2ZIW A;  3THV A;  1Q8K A;  2KVS A;  3PNC A;  1S77 D;  2ZTE A;  4KLQ A;  2BQR A;  5F3X B;  3KHH A;  2ISO A;  3BQ1 A;  2K60 A;  1KN5 A;  2ALZ A;  3ZDB A;  7ICP A;  3MR6 A;  3CK6 A;  1VLB A;  3B0X A;  4DF4 A;  4YG2 A;  4X4U A;  2WF5 A;  8ICK A;  4K4I A;  5AKE A;  1Z4N A;  5ALQ A;  4DSE A;  4EEL A;  3RB0 A;  5DBA A;  2KHV A;  3MDA A;  3IP4 B;  8ICE A;  1A77 A;  2ZIU A;  1SXD A;  2D3D A;  2MAX A;  3T5J A;  5AI8 A;  4J9R A;  3TAR A;  3GQC A;  2NRW A;  1BPY A;  2NYV A;  2RLT A;  1TFR A;  4FZN A;  2BZF A;  5DB6 A;  1J2M A;  1ZQD A;  3MGV A;  2HBL A;  2LYA A;  2WF6 A;  4C7Z A;  2E8N A;  3UMG A;  1YT3 A;  1ZQW A;  5AK4 A;  3HIY A;  4X4R A;  3RR7 A;  2FLL A;  5KG6 A;  3ISD A;  1U49 A;  4PL2 A;  2KE7 A;  5KFC A;  4Q45 A;  4YP3 A;  4UB4 A;  1F44 A;  3PW0 A;  3D2Q A;  1CEZ A;  5L1L A;  4NLG A;  4OD0 A;  1PVP A;  3H8S A;  3AQK A;  2ZH1 A;  2KIC A;  3C1Z A;  1SL2 A;  4P0P B;  4CF5 A;  3ER9 B;  4I2F A;  4B9U A;  3M7D A;  3BJY A;  5AI0 A;  5J0T A;  2LM1 A;  4X4N A;  3HT3 A;  1NK9 A;  1H38 A;  1NI3 A;  1PK1 B;  1A76 A;  9ICL A;  3TFR A;  4PHE A;  1N5W A;  4NM1 A;  3GZF A;  1IM4 A;  3H0L B;  1WUD A;  7ICQ A;  2M0N A;  5DG7 A;  2KZM A;  4MFF A;  3VC8 A;  5KFF A;  4EBJ A;  3N28 A;  4Y2R A;  4DSF A;  4NKT A;  4OJ5 A;  5B5E U;  3AUO A;  8ICL A;  4DEZ A;  4RPX A;  5KFJ A;  2XVT A;  1F0M A;  4YN4 A;  4AT8 A;  4KLT A;  5HRH A;  2LM4 A;  2ESE A;  3GIL A;  5DQG A;  1UPH A;  1N61 A;  3HWT A;  4BX9 C;  2KV2 A;  1RQL A;  3L4P A;  5AIC A;  3NRW A;  3N7R C;  3Q8K A;  9ICR A;  3CW2 C;  2KZZ A;  2N1R A;  2DPI A;  1S8O A;  3K75 D;  4Y2S A;  1QSS A;  5DEC A;  9ICB A;  4EBK A;  4RUA A;  4DQQ A;  4QZA A;  5KFU A;  4FH5 A;  4KM5 A;  2HHS A;  4F5P A;  3OVB A;  2F44 A;  1TKD A;  1P7D A;  4MF8 A;  2LPE A;  2DR7 A;  3L9D A;  4OJ6 A;  3BQ2 A;  4R65 A;  1UQV A;  3WKC A;  3PML A;  2HSZ A;  3MCR A;  1OXJ A;  3TKA A;  2W43 A;  2ZJ8 A;  3PX6 A;  4DFD A;  4F5O A;  5J2B A;  4EEY A;  3C2K A;  3RJI A;  1Z1B A;  9ICN A;  5J2E A;  2YB1 A;  3PSF A;  4M6W A;  2KSO B;  4R64 A;  3D2N A;  3H7I A;  2G07 A;  5C0Y A;  3WFR E;  3OHA A;  1ZQC A;  4C8O A;  4MFC A;  2UVR A;  4ECT A;  2MUT B;  3EPG A;  4DS5 A;  4I28 A;  2IHO A;  1T3Q A;  5J0Q A;  1DK3 A;  4BJQ A;  1ZQF A;  3FC4 A;  1PUZ A;  5TIS U;  4UAR A;  2LYB A;  4NXX A;  5BPC A;  3WFO A;  5KG2 A;  1TK8 A;  4J9M A;  1XS9 D;  4YCX A;  3M8S A;  5FP0 A;  4KLJ A;  4TUQ A;  2W3R A;  5HML A;  5KNI A;  4F4X A;  7ICU A;  2ZG6 A;  2I9G A;  5BOM A;  2KFN A;  4QZ8 A;  3VCB A;  3SYZ A;  1SXE A;  1OU5 A;  4B9S A;  4I2B A;  1ZQQ A;  2XGP A;  4XQ8 A;  2W7P A;  2OXO A;  3QU4 A;  2Y1J A;  4EP7 A;  4KLL A;  1XNS A;  2J6S A;  4PH5 A;  1JN3 A;  3MAB A;  1T3N A;  3QYP A;  5KAF U;  3M9O B;  5AK3 A;  2Y9U A;  3RRG A;  2F8K A;  5HRK A;  1SKR A;  2F3N A;  5AI4 A;  4EED A;  2HN2 A;  5F2V O;  1KFS A;  3SEI A;  3NVY A;  7ICS A;  5KG1 A;  5J0Y A;  1L3V A;  4UAT A;  3QUT A;  1XSN A;  4QIW C;  1S10 A;  1Z00 A;  4WOY A;  1XO0 A;  3WKB A;  1S0V A;  2JGA A;  4B9N A;  3RH4 A;  5CR0 A;  2M2V A;  3RFA A;  4QZB A;  1ZD4 A;  2ZIV A;  3ISB A;  1QSY A;  5BOL A;  3M8R A;  4C8K A;  2HCF A;  4TUR A;  4Q8F A;  4DOA A;  4O0I A;  3RJK A;  2FMS A;  1KRP A;  5IIK A;  3E2E A;  4OAI Z;  1FFV A;  4E0D A;  2FDR A;  4US8 A;  5KFM A;  9ICG A;  8ICW A;  5ALI A;  2HHU A;  2DBY A;  1ZQO A;  4Y2U A;  3PR5 B;  5A0L A;  2P6R A;  2ZH2 A;  4CDG A;  4PGX A;  2DKZ A;  4YQW A;  5IIN A;  4B9T A;  4IQW A;  3TAN A;  4CE6 A;  3N97 B;  2P35 A;  4DLE A;  2ES6 A;  5DED A;  4TUP A;  4ED6 A;  1QH9 A;  5KT5 A;  3EF2 A;  5KG3 A;  1QSL A;  4O3P A;  2Y9T A;  1JI7 A;  5KFA A;  2IBK A;  4RPZ A;  3ORY A;  3CYM A;  5KT6 A;  5CB1 A;  3PMN A;  4ECU A;  4DFM A;  3EYZ A;  2C2E A;  4BDP A;  2KOB A;  4K9B A;  2IOF A;  1XWL A;  2GOL A;  1SV0 C;  5F9L A;  2GO7 A;  2PI5 A;  1PVR A;  2JEI A;  1M6Y A;  2ZH3 A;  3WK6 A;  4NWI A;  3BS5 A;  3PVX A;  1ZQV A;  1ZJN A;  1RG6 A;  4KX3 A;  5KFP A;  7ICM A;  4UAS A;  2B6G A;  1L7O A;  5J8Y A;  3UXO A;  3KD3 A;  1NJY A;  3UXP A;  2KJ8 A;  1NJW A;  5F9N A;  9ICO A;  1SB3 C;  7ICL A;  2W9M A;  1NNL A;  5HRD A;  4NLB A;  4Y2X A;  5ALU A;  5ALS A;  1XSP A;  1N62 A;  2JEJ A;  1QQ5 A;  4RWN A;  1D9F A;  1Z4O A;  5L9X A;  3IN5 A;  1SZH A;  3SR6 A;  2BCU A;  2IA6 A;  2VJ5 A;  4JK1 A;  2AGO A;  4O5K A;  4M9G A;  4QZG A;  5AKK A;  5CP2 A;  3MDC A;  4NY8 A;  4I29 A;  4QNL A;  4RQ2 A;  3ETR A;  3RH5 A;  2W11 A;  1D8B A;  3BQT A;  4PHA A;  2PI4 A;  9ICK A;  3HJE A;  4UB3 A;  2EAN A;  3ZD8 A;  5CFS A;  2RDI A;  3AQL A;  3T5H A;  1CUK A;  3I76 A;  2JH7 A;  2BQ3 A;  3TFS A;  5CFT A;  1D8L A;  1BPZ A;  3ZDC A;  2BDP A;  4F5R A;  1LKY A;  5AM0 A;  1JQR A;  3C29 A;  3QE9 Y;  5ALO A;  3RJG A;  2FLN A;  2UVU A;  5HHI A;  2OEH A;  4IRC A;  1JUD A;  1KTQ A;  5ALM A;  2KMD A;  1ZQI A;  3S6J A;  2ZUD A;  2IHN A;  2Y0S F;  2BBJ A;  4FZM A;  1Z3E B;  3TAC B;  3WFP A;  2AQ0 A;  3F2C A;  2GA9 D;  3OPX A;  2JZB A;  4G3I A;  3GIM A;  2D6F C;  1NJX A;  3CNH A;  5KT7 A;  7ICN A;  4IQU A;  4DFK A;  1ZRN A;  2KHQ A;  4FBT A;  2KJ9 A;  5IIO A;  5J2G A;  2G5H B;  3RRH A;  1RQN A;  4B9M A;  5DQH A;  4RUC A;  1RYS A;  3Q8S B;  3QXG A;  2QB0 B;  3HW8 A;  2B51 A;  5AM5 A;  1OUQ A;  1ZQS A;  2W9B A;  2Q0Z X;  4X4V A;  2VKQ A;  3OVA A;  2ATL A;  4X4P A;  2B4V A;  2EDU A;  3HIL A;  4UD4 A;  4CCH A;  2W54 A;  1ZQX A;  4DLG A;  3MC1 A;  1IIP A;  2P66 A;  3KTQ A;  4EEN A;  4OAF A;  1ZQL A;  1FA0 A;  2PMZ C;  3O0F A;  2G09 A;  5JRT A;  1XC9 A;  3PSI A;  1JAL A;  2D8C A;  9ICE A;  2EZZ A;  1B43 A;  2CXY A;  2EAP A;  2W8L A;  3NVO A;  1L3U A;  2XY6 A;  3WKE A;  2JH1 A;  4NXZ A;  1WOT A;  4B9L A;  4DQI A;  2F76 X;  2DFL A;  5DKW A;  2Y1I A;  4EGW A;  1S9F A;  4AT7 B;  2MSN A;  3MBY A;  5KFE A;  2E1F A;  2FPK A;  1KL9 A;  2EAO A;  4C8L A;  2F8L A;  4EV6 A;  3UM9 A;  3OSP A;  3L3F X;  2E1E A;  1FEZ A;  3MR5 A;  3C66 A;  4GXK A;  3GV5 B;  5KFW A;  5B66 U;  1Q79 A;  2A1J A;  4FHX A;  4QJF B;  8ICA A;  2HVH A;  2OCE A;  4O3S A;  3T3F A;  4KLM A;  9ICU A;  3RJH A;  2M2W A;  4DSI A;  1L7N A;  2K4P A;  5EOZ A;  1N5X A;  1NK0 A;  4WC6 A;  1SV4 A;  5ALL A;  4RQ5 A;  3Q8R B;  2NRX A;  3IDW A;  2JRZ A;  1SL1 A;  3NTU A;  3RR8 A;  7ICH A; 
#chains in the Genus database with same CATH homology
 2HHW A;  4KTQ A;  4KLI A;  3Q8L A;  5HHH A;  5KT3 A;  4UAY A;  1LB2 B;  1DOQ A;  3H8J A;  3BDP A;  4YN4 A;  4AT8 A;  4DOC A;  4KLT A;  5HRH A;  3C1Y A;  2V9W A;  1K1S A;  5KFO A;  4I2A A;  1RYR A;  9ICQ A;  7ICI A;  2VAN A;  3GIL A;  5DQG A;  1X9M A;  4RQ3 A;  2BCV A;  1R89 A;  2ZH8 A;  3RH6 A;  3HWT A;  4Q43 A;  1ZQE A;  3RTV A;  4DSK A;  1R8C A;  3KHG A;  2VA2 A;  3PY8 A;  8ICF A;  5DLF A;  9ICX A;  2V4R A;  4KLH A;  3TAP A;  4Z6D A;  1BVS A;  4TQS A;  1PX5 A;  2HVI A;  3Q8K A;  5KT2 A;  5C5J A;  1BPD A;  4Q44 A;  4DL2 A;  7ICG A;  9ICR A;  2XCP A;  1ZQR A;  3EW9 A;  2KZZ A;  2DPI A;  4WC5 A;  3UXN A;  3LWL A;  3K75 D;  4DL5 A;  4X5V A;  1QSS A;  9ICV A;  1F5A A;  2KP7 A;  4O3O A;  5KFG A;  1X2I A;  5J0O A;  4O9M A;  1S0O A;  9ICB A;  5DEC A;  4EBK A;  4RUA A;  4DQQ A;  1NOM A;  7ICK A;  4UD5 A;  4BGD A;  9ICW A;  4QZA A;  2W8K A;  5KFU A;  4F92 B;  4NM2 A;  4FH5 A;  4KLG A;  1ZQJ A;  2HHS A;  4F5P A;  3OVB A;  3UPQ A;  9ICT A;  1TKD A;  3HJ1 A;  4LZD A;  3V6K A;  4DO9 A;  4EBE A;  4ED0 A;  4HYK A;  4RPY A;  4MF8 A;  4RQ0 A;  5HP4 A;  5KFI A;  1BPX A;  3HJ4 A;  2DR7 A;  3L9D A;  4MEY A;  5KFX A;  7ICJ A;  3BQ2 A;  1WCL A;  4R65 A;  3IM1 A;  1U45 A;  3PML A;  2M2T A;  5DQI A;  2FMP A;  2IHM A;  2HHQ A;  1JMS A;  2DR9 A;  4DL7 A;  4NLK A;  1U48 A;  1NKB A;  1JXL A;  1RZT A;  2ASL A;  4YD1 A;  4ED1 A;  4EZ9 A;  2BE3 A;  4RNO A;  2HHP A;  4TQR A;  3RB3 A;  5J2A A;  2FLP A;  1JIH A;  4RQ6 A;  8ICQ A;  2A1J B;  1U9L A;  4FS1 A;  2ZJ8 A;  3MFI A;  4ATB B;  3PX6 A;  4F5O A;  3RJI A;  5J2B A;  4EEY A;  3C2K A;  4AT9 B;  4UAW A;  4KLS A;  9ICN A;  5J2E A;  1TAU A;  8ICR A;  3PV8 A;  4LT6 A;  4M6W A;  4X0B A;  5KT4 A;  2AGP A;  2ZH5 A;  1T4G A;  5L1K A;  1K1Q A;  2ASD A;  4R64 A;  4UB5 A;  2IMW P;  2Q66 A;  4M2Y A;  1HUZ A;  1NZP A;  3H7I A;  3OSN A;  2R8I A;  2NRT A;  1JAJ A;  1UT8 A;  2BCQ A;  3WFR E;  4RNN A;  2ZH9 A;  3OHA A;  5L1J A;  3GII A;  4EBD A;  1ZET A;  1ZQC A;  4C8O A;  4F2S A;  5KFH A;  4MFC A;  4UAZ A;  2UVR A;  4ECT A;  1KFT A;  4IR1 A;  8ICH A;  2MUT B;  4O3Q A;  3EPG A;  3JPO A;  4FS2 A;  4DS5 A;  1S97 A;  4I28 A;  4O5E A;  1UA1 A;  3JPN A;  1ZJM A;  2ZUC A;  5J0Q A;  1DK3 A;  5KFL A;  1ZQF A;  2V4Q A;  3ETL A;  4K4G A;  4QWC A;  5D49 A;  1S0N A;  4DOB A;  3LDA A;  4AT8 B;  2F1J A;  5BPC A;  3BQ0 A;  4Q8E A;  4ED7 A;  5D4B A;  5DG8 A;  3WFO A;  2ZH6 A;  1MIW A;  5KG2 A;  1TK8 A;  2NRK A;  5J0S A;  4J9M A;  3ZDE A;  4R8U A;  2XO7 A;  1XS9 D;  3LWM A;  5HRF A;  2ZJ5 A;  4YCX A;  1N56 A;  5DBB A;  5DG9 A;  1KLN A;  3M8S A;  4F5Q A;  3T5L A;  3PW5 A;  4M5D A;  5KFZ A;  2C2D A;  1LV5 A;  4IRD A;  4KLJ A;  4ECX A;  4TUQ A;  2AGQ A;  2ZH7 A;  2R8K A;  2BGW A;  5HML A;  2BQU A;  4IQT A;  4NLN A;  1XSL A;  2C28 A;  4F4X A;  3V7L A;  4QZD A;  7ICU A;  4UB1 A;  3Q8Q B;  1TVA A;  4ED3 A;  2ZHA A;  2I9G A;  2DPJ A;  4WC3 A;  5BOM A;  4J9O A;  4QZ8 A;  2KFN A;  3C2M A;  3TAQ A;  3V6H A;  4KMU A;  4FHP A;  3PX0 A;  3SYZ A;  4AT9 A;  2HHT A;  1OU5 A;  4B9S A;  4I2B A;  1ZQQ A;  2XGP A;  2BCS A;  4X4V A;  4XQ8 A;  1L3S A;  2Y1J A;  3NYB A;  1ZYQ A;  4FHW A;  4EP7 A;  4QW9 A;  3RB4 A;  4KLL A;  4I2I A;  4QZI A;  3GIK A;  2J6S A;  4PH5 A;  1JN3 A;  3MAB A;  4P4O A;  1T3N A;  4XRH A;  1N48 A;  2DR8 A;  1RXV A;  4EBC A;  3M9O B;  4IG8 A;  1ZQZ A;  4ZH4 A;  3OUY A;  3RRG A;  1D9D A;  2M9N A;  2AU0 A;  1SKR A;  1L5U A;  4PGQ A;  4GLX A;  1COO A;  5HRK A;  3UQ2 A;  1Q78 A;  9ICC A;  4YR3 A;  2P6U A;  8ICM A;  1SZP A;  3V6J A;  2W9A A;  1KFS A;  5F2V O;  5EWF A;  7ICS A;  2PBE A;  4J9K A;  3ZDA A;  4DFJ A;  5KG1 A;  1TAQ A;  3H40 A;  5J0Y A;  4C8M A;  1L3V A;  9ICJ A;  4Z6E A;  4B9V A;  5KFY A;  2R8G A;  4M6W B;  5KFN A;  2PXI A;  5DDM A;  4DQP A;  8ICU A;  1XSN A;  4R63 A;  2PFP A;  1S10 A;  1Z00 A;  1NKC A;  3AQN A;  3G6V A;  5IIM A;  1QLN A;  1S0V A;  4B9N A;  1KSP A;  1R8B A;  4JV0 A;  3RH4 A;  2DR5 A;  7ICV A;  1NK7 A;  5CR0 A;  7ICO A;  1ZQN A;  2M2V A;  4QZB A;  5EWE A;  1ARO P;  2NRV A;  2XY5 A;  2NRZ A;  4X4S A;  1U4B A;  3QZ8 A;  5D46 A;  4YMO A;  5KFB A;  5DGB A;  3RJF A;  3ISB A;  4XQ7 A;  1QSY A;  5BOL A;  3M8R A;  2BPF A;  4F50 A;  4C8K A;  4TUR A;  4WC7 A;  4Q8F A;  4DOA A;  2J6U A;  3RAQ A;  4P2H A;  3H4B A;  2ZHB A;  4J9L A;  1BNP A;  4BXO A;  4YXJ A;  4O0I A;  3RJK A;  2FMS A;  4S3N A;  4RZR A;  1KRP A;  3WFQ E;  5IIK A;  4J9Q A;  4UBC A;  5KTQ A;  3E2E A;  3UPS A;  3K4G A;  4R8U B;  2ZJA A;  4DQR A;  3LQC B;  4M9H A;  3M9N B;  4E0D A;  4FBU A;  5KFK A;  5KFM A;  1NJZ A;  3AU6 A;  3FDS A;  5KFS A;  4ED8 A;  1TFY A;  8ICY A;  9ICG A;  8ICP A;  8ICW A;  4ECV A;  5HMM A;  1EXN A;  5J0X A;  2HHU A;  1ZQY A;  1ZQO A;  3PR5 B;  2P6R A;  4ELV A;  2ZH2 A;  4MEX A;  4RQ7 A;  4PGX A;  3HPO A;  1SL0 A;  4RQ4 A;  4YQW A;  1NK5 A;  2GWS A;  5IIN A;  4JWN A;  5J2D A;  4B9T A;  3PO4 A;  1UEV A;  4IQW A;  4FHY A;  4J9S A;  4DSL A;  4KLD A;  4GXJ A;  3TAN A;  1MIY A;  5HRL A;  2LYH A;  4UQG A;  4EYI B;  3N97 B;  4DLE A;  4DL3 A;  1XU4 A;  1NK4 A;  4QWE A;  5DED A;  5IIJ A;  4TUP A;  4ED6 A;  4RWO A;  4DQS A;  9ICI A;  2F1I A;  5KT5 A;  2BKE A;  2ZTC A;  1TK0 A;  5KG3 A;  4Z6C A;  2AQ4 A;  4WC4 A;  4FH3 A;  3JPT A;  1QSL A;  3GV8 B;  4O3P A;  4EZ6 A;  4PPX A;  2O1P A;  4WC2 A;  1ZQP A;  3SZ2 A;  4M9L A;  3FYH A;  5KFA A;  3EZ5 A;  3SV3 A;  2ASJ A;  1SKW A;  2IBK A;  8ICN A;  1VFG A;  2JEG A;  3OUY B;  4QZ9 A;  4QWA A;  4RPZ A;  3GIJ A;  3ORY A;  5KT6 A;  3PMN A;  5CB1 A;  4ECU A;  4DS4 A;  4DFM A;  3EYZ A;  2C2E A;  4RQ8 A;  4YR0 A;  4BDP A;  4O5C A;  2O5A A;  4RQ1 A;  5J2C A;  4DL4 A;  1XWL A;  4X4T A;  9ICH A;  3H8W A;  1KDH A;  5F9L A;  2PI5 A;  4ECR A;  2JEI A;  1IXR A;  4GC7 A;  2BPG A;  2ZH3 A;  1HUO A;  4M0A A;  4IRK A;  1KEJ A;  5HC9 A;  2BR0 A;  1L3T A;  3JPS A;  3PVX A;  1ZQV A;  1ZJN A;  7ICF A;  1BNO A;  9ICS A;  9ICF A;  1NK6 A;  1Z00 B;  5KFP A;  2HHV A;  7ICM A;  3RJJ A;  1RXW A;  1DK2 A;  4I2E A;  4KN7 A;  3UXO A;  3Q8P B;  4ECY A;  4I2G A;  1NJY A;  3PW4 A;  3UXP A;  4UBB A;  1NJW A;  4MF2 A;  3H38 A;  4NKU A;  5F9N A;  4I2D A;  2KN7 A;  1MQ2 A;  9ICO A;  5J0W A;  5KG7 A;  4RT3 A;  7ICL A;  4F4W A;  3KHR A;  2W9M A;  1HJP A;  2W9C A;  4X4Q A;  2XY7 A;  8ICZ A;  2R8J A;  1T8E A;  2XGQ A;  5HRD A;  8ICB A;  1MQ3 A;  4QW8 A;  3JZ0 A;  2UVW A;  4BXO B;  5DB8 A;  2BPC A;  1XSP A;  4F3O A;  2JEJ A;  1UEU A;  1BGX T;  1RPL A;  1MIV A;  4RWN A;  1Y88 A;  3V72 A;  4J9N A;  1D9F A;  2AJQ A;  1YLQ A;  5L9X A;  4GC6 A;  3H4D A;  4QZF A;  4E80 A;  9ICP A;  3C21 A;  2BCU A;  5J2F A;  1ZQU A;  2IA6 A;  2ID1 A;  4JK1 A;  3GDX A;  2AGO A;  4QZE A;  4M9G A;  4O5K A;  4QZG A;  7ICE A;  1UET A;  4RWQ A;  2DRA A;  3B0Y A;  1R8A A;  5CP2 A;  3MDC A;  4NY8 A;  2XCA A;  4I29 A;  8ICO A;  2HHX A;  3QEB Z;  4MFA A;  3OJS A;  1V4A A;  4WCW A;  1ZQA A;  1DGS A;  4Z6F A;  8ICJ A;  3RJE A;  4RQ2 A;  4F4Z A;  4JV2 A;  5CHG A;  4X4O A;  4LZG A;  3RH5 A;  4QZC A;  3MGI A;  2UVV A;  2FPL A;  4YMN A;  4F5N A;  3RBD A;  4ELU A;  3BQT A;  1ZQK A;  3SV4 A;  4KLU A;  5KFV A;  7ICR A;  4PHA A;  2PI4 A;  4FHV A;  3WFS C;  5KFQ A;  3LK9 A;  4ECW A;  9ICK A;  4YR2 A;  4GXI A;  4O3N A;  3NGD A;  1X9S A;  1WCN A;  3JPQ A;  4ECZ A;  1UT5 A;  4UB3 A;  2C22 A;  4DWI A;  3GV7 B;  1V9P A;  2VA3 A;  1T7P A;  2I1Q A;  4J9P A;  3M9M B;  3ZDC A;  2M2U A;  3OV7 A;  3KHL A;  3ZD8 A;  3RB6 A;  4M9J A;  9ICA A;  5J29 A;  2RDI A;  3AQL A;  4XUS A;  4C8N A;  3T5H A;  8ICG A;  3QZ7 A;  1CUK A;  5J0R A;  1TK5 A;  5HRB A;  3HX0 A;  4I2C A;  4YD2 A;  4RWP A;  2DRB A;  5III A;  2BQ3 A;  3TFS A;  1KFD A;  1D8L A;  4BWM A;  5J0U A;  4RU9 A;  1X9W A;  3MFH A;  1BPZ A;  5CA7 A;  2FMQ A;  2BDP A;  4F5R A;  4DF8 A;  5DB7 A;  1ZQM A;  1MSW D;  5KG5 A;  1NKE A;  4LVS A;  1JQR A;  3PW2 A;  3ZD9 A;  4PGY A;  4E8F A;  2WTF A;  3QE9 Y;  1UA0 A;  3OHB A;  2BCR A;  3MR2 A;  3RJG A;  4XA5 A;  3Q8M A;  3T5K A;  2FLN A;  5HHI A;  2UVU A;  4F4K A;  4WC0 A;  4IRC A;  2OWO A;  1KTQ A;  4F2R A;  5KFT A;  4AT7 A;  4FO6 A;  4PHP A;  1BPE A;  1ZQI A;  2PFO A;  4K4H A;  3N4M B;  2ZUD A;  5HRI A;  2IHN A;  4QZH A;  4WBZ A;  3PR4 A;  1XO1 A;  1Z3E B;  1U47 A;  4UB2 A;  1NK8 A;  2AQ0 A;  3WFP A;  2R8H A;  4IQV A;  4NLZ A;  3G6Y A;  1MC8 A;  4KLF A;  4X0A A;  2JZB A;  3HP6 A;  4G3I A;  3GIM A;  3IHQ B;  1NJX A;  4KLE A;  3THV A;  2RFF A;  3PNC A;  2W9C B;  5KT7 A;  7ICN A;  5HRG A;  5KFD A;  1S77 D;  4IQU A;  4DFK A;  2ZTE A;  4KLQ A;  1S0M A;  2BQR A;  4FBT A;  2HW3 A;  4PHD A;  3KHH A;  5IIO A;  2ISO A;  3G6X A;  5CWR A;  3BQ1 A;  2H5X A;  1C7Y A;  5J2G A;  2ALZ A;  2PFN A;  3ZDB A;  7ICP A;  4E7X A;  3RRH A;  2B21 A;  3MR6 A;  4M9N A;  3C18 A;  4ECQ A;  5DB9 A;  4F4Y A;  3B0X A;  5J2H A;  5TZV A;  4DF4 A;  3QEA Z;  4B9M A;  5DQH A;  4RUC A;  1RYS A;  3Q8S B;  1VJ7 A;  4YG2 A;  2ISP A;  4X4U A;  4YMM A;  5L1I A;  3PX4 A;  3HW8 A;  2C2R A;  1S76 D;  8ICK A;  3ZDD A;  8ICC A;  1ZQS A;  2W9B A;  8ICS A;  4K4I A;  3V7J A;  3RAX A;  2FPM A;  4DSE A;  2Q0Z X;  4TUS A;  3JPP A;  3RB0 A;  5DBA A;  1ZQG A;  2J6T A;  3C23 A;  3MDA A;  1BPB A;  2ATL A;  4X4P A;  8ICE A;  1A77 A;  4RT2 A;  2F1H A;  2ZH4 A;  4ELT A;  3C5G A;  4JWM A;  2MAX A;  4UD4 A;  3C2L A;  3SI8 A;  3T5J A;  3EPI A;  4CCH A;  1ZQX A;  4J9R A;  4DLG A;  3TAR A;  4KLO A;  1B22 A;  3GQC A;  2NRW A;  8ICX A;  3C5F A;  4I2J A;  3TI0 A;  1SKS A;  1BPY A;  2JEF A;  4DL6 A;  3EWA A;  2P66 A;  1TFR A;  2KZ3 A;  3UQ0 A;  3KTQ A;  1ZQL A;  2XC9 A;  4YVZ A;  1FA0 A;  3OVS A;  2ZTD A;  1XC9 A;  4EYH B;  5DGA A;  5DB6 A;  3GFK B;  1JXE A;  1ZQD A;  4I27 A;  4M47 A;  5HR9 A;  4R66 A;  7ICT A;  8ICI A;  4WC1 A;  9ICE A;  1TV9 A;  4F8R A;  1B43 A;  5DBC A;  5JUM A;  3HIY A;  1ZQW A;  4KIT B;  4X4R A;  3H3A A;  3RR7 A;  2FLL A;  5KG6 A;  2W8L A;  2VA8 A;  3ISD A;  3PW7 A;  1L3U A;  2XY6 A;  5IIL A;  3ISC A;  1U49 A;  2BHN A;  4YFK A;  5HNK A;  5KFR A;  2PFQ A;  5KFC A;  4Q45 A;  4YP3 A;  4NXZ A;  1WOT A;  5KG4 A;  4UB4 A;  3H39 A;  4DSJ A;  4B9L A;  4DQI A;  5DKW A;  2DFL A;  3PW0 A;  2Y1I A;  1CEZ A;  4ED2 A;  5L1L A;  4NLG A;  8ICT A;  1S9F A;  4AT7 B;  5KFE A;  4P4M A;  3OJU A;  2FPK A;  3MBY A;  3AQM A;  4C8L A;  3H8S A;  3JPR A;  4ECS A;  3H37 A;  3OVA A;  3OSP A;  3AQK A;  4F93 B;  2ZH1 A;  5DLG A;  3AU2 A;  3C1Z A;  1SL2 A;  1D8Y A;  4JV1 A;  1KNY A;  1NO5 A;  3MR5 A;  4O3R A;  4JUZ A;  4F91 B;  5HRE A;  2JZB B;  4I2F A;  1PZN A;  3C66 A;  4GXK A;  2RDJ A;  3GV5 B;  5KFW A;  4B9U A;  4I2H A;  1QTM A;  1ZQT A;  4DFP A;  3BJY A;  3PO5 A;  8ICV A;  1Q79 A;  5J0T A;  4X4N A;  4WBY A;  3HT3 A;  3JYY A;  1NK9 A;  1H38 A;  2A1J A;  4ATB A;  4FHX A;  5J2I A;  5J2J A;  5KG0 A;  3RBE A;  2KTQ A;  2KFZ A;  2HVH A;  9ICM A;  8ICA A;  1A76 A;  1ZQB A;  4O3S A;  2DVI A;  3T3F A;  5J0P A;  1ZQH A;  3TFR A;  4KLM A;  9ICL A;  4PHE A;  9ICU A;  4NM1 A;  4BWJ A;  3OGU A;  4M04 A;  1IM4 A;  3MR3 A;  3RJH A;  3TQ1 A;  7ICQ A;  4KN4 A;  2M2W A;  4QWB A;  5DDY A;  5DG7 A;  4DSI A;  5EWG A;  4QWD A;  1TFW A;  5EOZ A;  4YXM A;  1NK0 A;  4P4P A;  4MFF A;  5KFF A;  2KZM A;  4WC6 A;  2MUT A;  4RNM A;  2W9B B;  4EBJ A;  4RQ5 A;  3Q8R B;  2NRX A;  4DSF A;  5CJ7 A;  4NKT A;  1SL1 A;  2ZUB A;  3V7K A;  3NTU A;  5J2K A;  4DEZ A;  4RPX A;  5KFJ A;  3MGH A;  3AUO A;  3RR8 A;  8ICL A;  7ICH A;  1JX4 A;  4IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...