2P66A

Human dna polymerase beta complexed with tetrahydrofuran (abasic site) containing dna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*CP*GP*AP*CP*AP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3
publication title Structural insight into the DNA Polymerase beta deoxyribose phosphate lyase mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 101
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2p66A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2p66A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2p66A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2p66A03
3RH6A 8ICRA 4NM2A 2XGQA 5CJ7A 2HHWA 1D9DA 2BQ3A 1JIHA 2B21A 4K4GA 3KHLA 3SZ2A 4DQSA 5DLFA 1KTQA 4YXJA 4IQWA 3V7LA 3UXNA 5D4BA 1UETA 3FDSA 3C2MA 4E80A 3OV7A 1MIVA 3QE9Y 3G6XA 3M8SA 3TFRA 2C28A 4M6WA 4ECQA 5KT6A 4FS2A 2FLNA 5D49A 4JUZA 2HW3A 5BOLA 4F8RA 4B9TA 5IIJA 5KFFA 3V7KA 1TFRA 4F4WA 3QEBZ 1SZPA 2FPMA 2XCPA 2UVWA 3GIIA 4FS1A 3WFSC 3IHQB 4R63A 3H7IA 4YMOA 2HHSA 3UPSA 2AGPA 5F2VO 4K4HA 2PFQA 4UD4A 4G3IA 5DBCA 3JPSA 1ZQUA 3HT3A 1L3VA 7ICUA 1DK2A 2J6SA 3T5JA 4DQPA 5TZVA 4EBKA 3HIYA 4X4NA 5J2BA 2ALZA 1S0NA 3TI0A 1RXWA 5J0YA 4IQVA 1COOA 4RT3A 1D8YA 1U45A 5EWEA 1NK4A 9ICJA 5HREA 4UD5A 4YVZA 1VJ7A 4J9KA 1U47A 1KEJA 3PW7A 4RWPA 3H4BA 3TARA 4BGDA 1BPDA 4NLZA 5HRFA 1KFSA 3PV8A 4IR9A 2W8LA 3TAQA 2DR7A 4EYIB 4EEYA 3OUYA 4DL4A 2NRZA 3RJIA 1L3SA 5BOMA 4EBEA 4IRKA 1MIWA 1MIYA 2ZH7A 5KT5A 1L3UA 9ICTA 4NM1A 5HHIA 3NYBA 4UAZA 2V4QA 1ZYQA 2AGOA 4ECYA 5IIKA 2Q66A 1TKDA 3ZDBA 4QWBA 4KLIA 2JEGA 9ICKA 4P4PA 1HJPA 4FHPA 3OGUA 1RXVA 8ICXA 4IQUA 4WCWA 1X2IA 1ZQRA 4C8OA 4QZ8A 4F2SA 4I2FA 1MQ3A 9ICUA 5KFGA 2RFFA 5J2FA 4ECXA 7ICPA 1UEUA 3TAPA 1DOQA 3LDAA 9ICCA 4KN4A 3GV5B 2ASDA 3ISDA 4RT2A 1NZPA 3HPOA 1NKCA 2ZHBA 4K4IA 4X4SA 4GXKA 2I1QA 3GQCA 2LYHA 5KFPA 4F4KA 5IILA 3H37A 5KFCA 5KFJA 1ZQZA 4TURA 2BCQA 1NO5A 3RTVA 2KN7A 3C1ZA 3UPQA 4ECWA 8ICJA 3PNCA 2BR0A 5DEDA 2W9CA 1MQ2A 2BPFA 2ISPA 2PI4A 2RDIA 3MFIA 1AROP 2PXIA 4PHPA 4ED0A 4E8FA 3Q8QB 3RH5A 2C22A 1XWLA 1Q79A 3PMNA 1LB2B 1A77A 8ICNA 5DQGA 1ZQWA 5J2JA 4RQ0A 3PMLA 1H38A 4J9LA 4DOCA 3GDXA 4YMNA 4Z6CA 5DB8A 3QZ7A 4QZDA 3AUOA 1ZQCA 2PFOA 2UVVA 4B9LA 2ID1A 4FH5A 1JMSA 4DL7A 1QLNA 3HX0A 4I2GA 5J2AA 5J0PA 4B9SA 1MC8A 2NRXA 3MDAA 4M9GA 4KLOA 1VFGA 4O0IA 4O3SA 2ISOA 4Q8EA 7ICKA 5KFLA 4ATBA 1SKRA 1KRPA 1JAJA 3MR2A 1QSYA 1S97A 4ECRA 4AT9A 5KG1A 4DFMA 3ZDEA 5KFEA 2VANA 2OWOA 2HHTA 2W9BB 2KZMA 4DL5A 1U48A 2AU0A 7ICMA 4RWOA 1CUKA 1NJZA 2R8JA 8ICIA 5DG9A 2ZH4A 4R66A 4O3NA 3N97B 2H5XA 4MEYA 3RRHA 9ICQA 3Q8LA 4DQRA 2ZH9A 2M2UA 5HRLA 2NRKA 3RJEA 5HMMA 5J2KA 4DSFA 4RQ2A 5DKWA 4UQGA 1TAUA 2M9NA 5KT4A 1TFWA 4F5RA 2FLPA 2Q0ZX 1XSLA 3H8WA 1ZQTA 3ISBA 4JV0A 8ICQA 5HRHA 3G6YA 3C23A 4ELVA 4NKTA 4KLMA 4I29A 5KFHA 3SV3A 4I2CA 4DQQA 3GFKB 5KFMA 2DR8A 3WFPA 2ASLA 4JV1A 4YXMA 8ICPA 1UT8A 1NK0A 2FMPA 5EOZA 1XSPA 3H39A 1UA0A 1R8AA 5KFKA 5J2GA 4UB2A 4LVSA 4MF2A 1CEZA 5J0UA 4PGQA 4QZHA 3PW2A 4Q8FA 2HVIA 2PBEA 1QSLA 4ECZA 2DFLA 3JPRA 3JPTA 4DSIA 5DGAA 4QZAA 4RUAA 2JZBA 4XA5A 1F5AA 4BWJA 2A1JB 3AQLA 8ICCA 5DB6A 3RJHA 2ZTEA 1IM4A 2BPCA 2KZ3A 5KFIA 2WTFA 2ZUCA 4DS4A 4I2DA 2JEIA 4GLXA 8ICVA 4WC6A 4GXIA 3OSNA 4BDPA 2HHXA 3K4GA 5DB9A 4ELTA 2FMSA 4R8UB 5KT2A 1DGSA 4GXJA 8ICTA 3E2EA 8ICGA 9ICMA 2V4RA 4P4MA 1XO1A 5L1IA 9ICRA 4X0AA 4LZGA 3RRGA 5KG4A 1ZQVA 4RQ6A 4X5VA 9ICWA 4QZ9A 1X9SA 1TFYA 4O9MA 1T3NA 1U49A 2ZH5A 4RU9A 9ICIA 4Q43A 2MUTA 3H8SA 5KFOA 3MGIA 4M9JA 1IXRA 5KFVA 1SKWA 3OHAA 3Q8PB 2KFZA 3H3AA 1ZJMA 4ECTA 4DWIA 4AT7B 4EBCA 4TUQA 4EYHB 4DF8A 3M9NB 1C7YA 1ZQHA 4KLLA 4YFKA 5KG3A 5J0QA 4XQ7A 3ETLA 3M9OB 4FHYA 4PGYA 2BDPA 2JEFA 9ICGA 1KFTA 4LT6A 2DVIA 5HRIA 4DLGA 3EPGA 1PZNA 3KHRA 3NGDA 5KT3A 1BGXT 1XSNA 5J2CA 2ZHAA 1S0OA 4DL2A 2DR9A 4DFJA 5HHHA 9ICAA 2KFNA 2J6TA 4WC1A 4O3RA 4PPXA 1WOTA 5CR0A 3T3FA 3PO5A 4AT8B 5JUMA 4FBUA 1D8LA 4DSJA 2W9MA 3PX6A 4BXOB 5CHGA 4QZFA 3PR4A 5HC9A 1NK7A 4FH3A 5KFWA 4TQSA 3C5GA 2MAXA 5DECA 4QZCA 3TFSA 5KG7A 4M04A 4NLKA 1TV9A 4FHWA 2R8HA 4PHDA 3EW9A 4DO9A 3RJFA 8ICZA 3RB4A 1KDHA 1T8EA 1Z3EB 1T7PA 2P6UA 4UBBA 1S76D 4F91B 4NKUA 2HHPA 3G6VA 4Z6EA 3V6JA 5DGBA 2BCRA 2HHVA 1K1SA 1ZQDA 3HW8A 1B22A 4X4PA 4O3PA 4KLGA 5J0RA 4UB4A 4QW8A 3MBYA 3MABA 4DSLA 4WC7A 4WC5A 2C2DA 4F4ZA 5DBAA 1BPZA 5KFQA 2V9WA 4J9MA 4F5NA 2ZTCA 5J0XA 1BNPA 3RH4A 4J9NA 4KN7A 1KNYA 4I2AA 3ISCA 4ED1A 1S9FA 1NK5A 1ZQKA 4MFFA 2HHQA 3WFRE 4F2RA 7ICVA 3KHHA 3C18A 3H38A 2KZZA 4RUCA 4F3OA 2AQ4A 8ICAA 4FBTA 4DOBA 2BQRA 7ICGA 3T5KA 9ICSA 1FA0A 4F4XA 4I2BA 3MFHA 4RPXA 1QSSA 4X0BA 4YMMA 4WC3A 4RNOA 4B9UA 7ICEA 2JEJA 1QTMA 5L9XA 4QWAA 4KLQA 3RJKA 4GC6A 1K1QA 1Z00B 1S0MA 4NY8A 4DL6A 4O5CA 1BVSA 3GIKA 3KTQA 3GV7B 5CP2A 3THVA 1R89A 3AQMA 4J9OA 4KMUA 5C5JA 4UAYA 4NLGA 4C8NA 1TK5A 1ZQFA 5BPCA 4EZ9A 1JN3A 3OJUA 7ICIA 5J2HA 4M5DA 4F92B 5HR9A 3Q8SB 2IBKA 8ICKA 4B9MA 4UB5A 4I2IA 4WC2A 2BCUA 4BWMA 1X9MA 4YCXA 4F93B 4YR3A 3C5FA 3SI8A 1HUOA 3H8JA 4YN4A 3H40A 8ICBA 2GWSA 4R64A 4FHVA 4J9RA 8ICHA 4M6WB 2FPLA 4KLEA 4ELUA 1D9FA 2BHNA 4O5EA 1UEVA 4YD2A 5L1JA 4HYKA 3PW4A 1A76A 3PW0A 2ZJAA 3PX4A 1SL2A 4KLHA 5KFNA 2XY6A 1NK6A 2BCVA 2IHNA 3BDPA 4RQ5A 4DEZA 3RBDA 4DS5A 1ZQJA 5HNKA 3JPOA 4ED8A 1JXLA 2VA8A 3JZ0A 3IM1A 5KTQA 1U9LA 3MR6A 3PVXA 1TVAA 2FMQA 4B9VA 2UVUA 5KFRA 3GILA 4YR2A 5J0TA 4RWQA 5EWGA 4PH5A 3ZDCA 2P6RA 2HHUA 7ICSA 3UXPA 2UVRA 2F1IA 1SL1A 4IRDA 4I28A 1NJXA 3RJJA 3C21A 4IRCA 4DFPA 5IINA 4J9PA 4ECSA 3PW5A 4QZIA 2J6UA 4M0AA 7ICTA 5DG8A 5J2EA 3JPQA 4UB3A 3M9MB 3BQTA 3OHBA 4F5PA 1JX4A 4RNNA 5DG7A 4X4OA 1EXNA 4QZBA 1RYSA 1UT5A 2ZUDA 5KFDA 4S3NA 1S77D 5J0WA 3GV8B 5HRKA 5KFBA 3GIJA 1T4GA 3Q8RB 4O3OA 2DPJA 9ICNA 2XCAA 7ICQA 1RPLA 2M2VA 3OUYB 2PFPA 2XY7A 4KLSA 2AGQA 7ICOA 4C8MA 1KFDA 2FLLA 4M9NA 4RPZA 4YR0A 4DSKA 1NOMA 3UXOA 8ICOA 4UB1A 1ZQPA 4RPYA 3KHGA 2ZH8A 2ZJ8A 1BPYA 7ICJA 4JWMA 2XGPA 3EZ5A 9ICFA 2ZH2A 4I2JA 4XRHA 3Q8KA 2XC9A 3LWMA 1TAQA 1LV5A 4C8LA 2W8KA 1DK3A 3JYYA 2W9BA 5CA7A 1BNOA 8ICYA 1Y88A 4IQTA 1ZQQA 3ZDDA 1WCLA 1UA1A 5KFAA 2HVHA 3LQCB 4E0DA 4O5KA 2M2TA 3OJSA 2BPGA 5J0SA 4XQ8A 3LWLA 2I9GA 2M2WA 9ICPA 4I27A 1WCNA 5IIOA 5J2DA 7ICFA 3UQ2A 3C2KA 3Q8MA 3T5LA 2BCSA 5F9NA 3MDCA 1ZQOA 8ICMA 2O5AA 4PHEA 2W9CB 7ICLA 4R65A 1XS9D 1ZQEA 4F5OA 4QWCA 5KFYA 5DDYA 3RAXA 1TK8A 1RYRA 5KFTA 5HRGA 3PY8A 4RQ4A 3LK9A 2C2RA 1SL0A 4C8KA 3OVBA 4NXZA 3OVSA 3AQKA 3AU6A 2XY5A 4O3QA 4MF8A 3N4MB 2P66A 4WC0A 2NRWA 1HUZA 3BQ0A 2R8KA 4DFKA 4TQRA 4MFCA 4MFAA 3RAQA 1B43A 1U4BA 4F4YA 9ICBA 5F9LA 7ICNA 4QZEA 1R8CA 1JQRA 4ED6A 5KG2A 4DSEA 2ZJ5A 1N48A 3ZDAA 4ATBB 2PI5A 8ICWA 4JK1A 4X4VA 1BPEA 4J9SA 4KLUA 2DRBA 3HJ1A 5KFXA 5HMLA 4RNMA 2IHMA 4AT9B 2AJQA 2A1JA 1SKSA 4IG8A 3OSPA 5DBBA 4X4TA 3B0YA 4QW9A 3HWTA 4RQ3A 1ZQSA 2XO7A 1NKEA 4R8UA 4XUSA 4ECVA 3RB3A 1XC9A 4ZH4A 3PX0A 3B0XA 3BJYA 4J9QA 1NJWA 4B9NA 4DLEA 4QWDA 3RR7A 3BQ1A 5J0OA 2NRVA 1BPBA 4RZRA 5CWRA 1ZQIA 1ZQXA 3ZD9A 4I2EA 9ICHA 5EWFA 5HRDA 4M2YA 1ZQMA 4ECUA 3UQ0A 1N56A 4DL3A 1YLQA 1KSPA 4WBZA 3WFQE 4RQ1A 3RB0A 2PFNA 1ZQAA 4F5QA 4ED3A 1NK8A 1PX5A 4AT7A 1XU4A 3FYHA 4P4OA 3JPNA 5IIMA 3T5HA 2ZUBA 5HP4A 4ED2A 3RR8A 4DQIA 4RQ8A 3EPIA 1L5UA 2VA3A 4M47A 2KP7A 2BGWA 4MEXA 2BE3A 3QZ8A 5DB7A 4F50A 3BQ2A 5D46A 2DR5A 2W9AA 2Y1JA 3L9DA 2AQ0A 5KG5A 3SYZA 3MGHA 2C2EA 3ORYA 1KLNA 4UAWA 3M8RA 3WFOA 2ASJA 1ZQBA 2F1JA 5DDMA 1X9WA 4KITB 4X4RA 1JXEA 1BPXA 1ZQGA 4AT8A 7ICRA 3HJ4A 2JZBB 4QZGA 5L1KA 4Q45A 4UBCA 4BXOA 4Q44A 1Q78A 5KG6A 3PR5B 4KLTA 4EZ6A 5DQIA 5CB1A 5IIIA 3EYZA 9ICEA 4WC4A 4WBYA 3SV4A 2DRAA 2ZH1A 5DLGA 2ATLA 2NRTA 8ICFA 9ICOA 1MSWD 4DF4A 3NTUA 4TUSA 3PO4A 3TQ1A 1V4AA 1S10A 4GC7A 9ICXA 4RWNA 4EBDA 2KTQA 3ZD8A 5KT7A 1L3TA 4IR1A 2FPKA 4NLNA 3C2LA 5HRBA 3AU2A 3V72A 1RZTA 3RJGA 4X4UA 2MUTB 4FO6A 4DOAA 2ZH6A 3HP6A 2IA6A 4JWNA 3TANA 9ICLA 4Z6DA 4QWEA 3JPPA 2R8IA 3EWAA 1ZJNA 3OVAA 2ZH3A 7ICHA 2O1PA 5J2IA 3K75D 1TK0A 9ICVA 1NK9A 3MR5A 4CCHA 8ICSA 4RQ7A 3V6KA 2R8GA 3H4DA 3QEAZ 4KLDA 2DPIA 3AQNA 2BQUA 2VA2A 4M9HA 1V9PA 4P2HA 8ICLA 5KFUA 2IMWP 4FHXA 4EP7A 2ZTDA 4M9LA 4I2HA 4JV2A 3V7JA 4PHAA 4YQWA 4KTQA 4ED7A 4KLJA 5KFSA 1R8BA 3C66A 4PGXA 1OU5A 1NJYA 5KFZA 2Y1IA 2BKEA 1ZQLA 4E7XA 1Z00A 4TUPA 2F1HA 4KLFA 5J29A 4EBJA 3C1YA 3V6HA 4YD1A 4YG2A 4YP3A 3RB6A 1NKBA 5L1LA 1S0VA 8ICEA 3GIMA 8ICUA 4X4QA 4Z6FA 1ZQNA 3RBEA 1ZETA 1ZQYA 3MR3A 4LZDA 5KG0A 2RDJA 5DQHA
chains in the Genus database with same CATH superfamily
3I1YA 2XGQA 5CJ7A 1QH9A 2NYVA 2BQ3A 2B21A 4K4GA 4DQSA 5DLFA 2K4EA 2L5YA 1KTQA 4YXJA 5D4BA 3UXNA 3C2MA 3OV7A 3QE9Y 3G6XA 2HDOA 2HW3A 5IIJA 4F4WA 2FPMA 3GIIA 2HHSA 3ER9B 4NWIA 4K4HA 4UD4A 1VLBA 2XI9A 3UMBA 3M7DA 4CF4A 3T5JA 4X4NA 1S0NA 1PK3A 4G9BA 4C4RA 1NK4A 9ICJA 4YVZA 1VJ7A 4J9KA 1U47A 3TARA 4BGDA 1BPDA 5HRFA 5ALDA 1KFSA 4IR9A 4KX5A 3TAQA 3ER8C 3OUYA 4DL4A 3A0BU 3QUTA 1MIWA 1L3UA 4FZMA 1ZYQA 5IIKA 2Q66A 5AIAA 1WYGA 4QWBA 3ZDBA 9ICKA 4UW9A 3E58A 4IQUA 2W7PA 4EEKA 3QNMA 4QZ8A 4ECXA 3TAPA 2ASDA 2E8NA 3HPOA 2GLEA 2I1QA 2LYHA 2YTUA 3VC8A 3QU5A 5KFCA 4TURA 2PXIA 1RG6A 3RH5A 1LB2B 2Y0SF 1L7MA 4FZNA 5AI8A 1BPZA 2MA1A 2PFOA 5ALNA 3U26A 1RM6C 2AHOB 4M9GA 4O0IA 4O3MA 2GA9D 1PUZA 5ALXA 3ZDEA 5JTIA 5AM5A 2F44A 5K4LA 2G5IB 4DL5A 4UASA 7ICMA 2YMMA 1CUKA 5FP0A 1NJZA 2R8JA 2H5XA 5G5GA 3FM9A 2NRKA 4C7YA 3RJEA 5HMMA 1TAUA 2FLPA 1ZQTA 4EEDA 3ISBA 4JV0A 3C23A 3QX7A 3SV3A 3WKAA 4DQQA 1Q3UA 4JV1A 4YXMA 8ICPA 3ED5A 1UA0A 2OHFA 5J2GA 5J0UA 2HVIA 1J2MA 4DSIA 2JZBA 3AQLA 2ZTEA 1IM4A 4DS4A 1RYUA 3OSNA 2HHXA 3BQ7A 4R8UB 4GXJA 1XO1A 4LZGA 3RRGA 4X5VA 4QZ9A 5D63A 2ZH5A 4WQKA 2MUTA 3H8SA 1IXRA 5KFVA 4OJOA 2KFZA 2CPRA 1ZJMA 2OXOA 3MGVA 3BS7A 5AKHA 4EYHB 3I76A 3M9NB 4DF8A 1C7YA 1P7DA 3KKAA 4XQ7A 5KNIA 1DRGA 4LT6A 3F53A 3NGDA 4Y2QA 4DFJA 2KFNA 1GPJA 5JUMA 1D8LA 2ODGA 2W9MA 1NK7A 3C5GA 5DECA 4NXTA 1XNSA 3EW9A 1CRXA 3RJFA 2HN1A 2Y9UA 1KDHA 1T8EA 1SWWA 4BX9C 2HHPA 3G6VA 3D2NA 5HR7A 3V6JA 5DGBA 1B22A 2CN1A 5J0RA 4PJ0U 3JCFA 2GO7A 3MBYA 4LJXA 3SAFA 2C2DA 5DBAA 5KFQA 1NK5A 1YT3A 7ICVA 2ZXHA 3WK7A 3N7SC 4X0BA 4RPXA 1QSSA 2B56A 5L9XA 4QWAA 4HAIA 4U6PA 4GC6A 3RJKA 4DL6A 3GV7B 1R89A 3FC4A 4J9OA 4UAYA 1ZQFA 5BPCA 1JN3A 7ICIA 4UAVA 5J2HA 4F92B 2IBKA 4B9MA 1X9MA 3C5FA 4UB8U 3SI8A 8ICBA 4YN4A 5AKKA 2GWSA 4R64A 8ICHA 3QU7A 4KLEA 4ELUA 1UEVA 4O5EA 5L1JA 3PSPA 4F71A 1A76A 3BZCA 3PW0A 4KLHA 2XY6A 1NK6A 4DEZA 1ZD2P 2HN2A 2ZIUB 3JPOA 1JXLA 4EGWA 1IIPA 3IM1A 5ALFA 1FO4A 5J0TA 5ALOA 2HHUA 7ICSA 1SL1A 3RJJA 4DFPA 4ECSA 5DG8A 2NV3A 4UB3A 4F5PA 2EAMA 4KMOB 4RNNA 1EXNA 1RYSA 2ZUDA 5HRKA 9ICNA 2HBMA 1N5XA 2PFPA 2XY7A 4KLSA 3EF2A 2AGQA 3DV9A 4RPZA 4DSKA 4UB1A 1ZQPA 4RPYA 3QU4A 1KL9A 2ZJ8A 2RHFA 1M6YA 1KQQA 3H0LB 3HILA 4I2JA 3Q8KA 4NLCA 5ALSA 2DR7A 3JYYA 2ZIXA 3AQEA 1BNOA 2W9BA 1Y88A 2K4IA 4J03A 3F2DA 2OCEA 2HVHA 2EAPA 2H3QA 2KEYA 5J0SA 2ZIWB 3GU3A 9ICPA 2FDRA 5IIOA 3M6ZA 7ICFA 3UQ2A 1ZQEA 4F5OA 4C4SA 3RAXA 4NXZA 3N4MB 4TQRA 1PK1B 3RAQA 1B43A 4F4YA 3QUQA 3I28A 3D2SA 3C28A 4P0PB 5KG2A 3UM9A 1FIQA 1N48A 3IV6A 4JK1A 2DRBA 5HMLA 4RNMA 5AI5A 4AT9B 2QB0A 3EUB2 1SKSA 4IG8A 2DUYA 2IOHA 3IG5A 4JLXA 2W3SA 1ZQSA 1NKEA 4XUSA 4DFDA 3PX0A 5JU5A 1VDVA 2M0NA 3BJYA 1NJWA 3BS5A 5A0LA 3NASA 5ALYA 5J0OA 1BPBA 4I2EA 4K98A 1ZQMA 4ECUA 2PFNA 3RB0A 4F5QA 2LPEA 1XU4A 5HP4A 5IIMA 3T5HA 1L5UA 2VA3A 1L8LA 3A0HU 1V85A 5KAFU 1KLNA 1COKA 4UAWA 1ZQBA 1BPXA 7ICRA 3SQIA 2VIXA 5AI9A 4Q45A 2RP5A 5DQIA 5CB1A 5IIIA 3EYZA 5DLGA 2ATLA 1O03A 4DF4A 2D8CA 4GC7A 2YY6A 4EBDA 1L3TA 1B0XA 4C4TA 4NLNA 3RFAA 1RZTA 4X4UA 2G09A 3NVVA 2ZH6A 3HP6A 4QWEA 2R8IA 7ICHA 2O1PA 3MR5A 8ICSA 4RQ7A 3V6KA 3KZXA 5ALPA 2BQUA 4N7RA 4M9LA 2BZFA 3HKZC 2KE7A 2I5HA 1FFUA 3IRUA 2F1HA 2G07A 3L3FX 3E0FA 3RB6A 1NKBA 1S0VA 2D3DA 1QQ6A 1X6IA 1ZQNA 4JLZA 3PSFA 4LZDA 1HIWA 5DQHA 8ICRA 4NM2A 5ALQA 2HHWA 1D9DA 1JIHA 4E80A 4IQWA 5T14A 1MIVA 3TFRA 5KT6A 2KVSA 5CHEA 5ALRA 4FE3A 1ED1A 4OAFA 1TFRA 3QEBZ 3WFSC 1SXEA 4R63A 3B9JA 4YMOA 4GIBA 5AKLA 1MA7A 3UPSA 4AP9A 5F2VO 1QCKA 4OJ6A 4G3IA 1PVQA 4Y2YA 1RXWA 5AKZA 1COOA 1UPHA 4K97A 4A8EA 4UD5A 4FO1A 4Y2VA 1KEJA 1V38A 2OEHA 4NLZA 3ALRA 5ALMA 4OAGA 2K4HA 1L3SA 5BOMA 4IRKA 2ZH7A 5KT5A 9ICTA 2MRLA 5AKXA 1HEKA 4FHPA 4KLIA 1RXVA 3AN1A 2K8AA 3PHZA 4C8OA 4F2SA 2RFFA 2ESEA 1UEUA 2WF8A 3ISDA 2R18A 4RT2A 1NKCA 2ZHBA 2KNJA 5IILA 5KFJA 4P0QB 3UPQA 8ICJA 2W9CA 2PI4A 3NVWA 3MFIA 1AROP 4ED0A 4PHPA 3Q8QB 3WK5A 2W55A 1PVRA 5J2JA 1H38A 3GDXA 1ZQCA 2ID1A 4Y2UA 4QZDA 3K1RB 1Z4OA 5EE3A 1WWVA 2CXYA 5J2AA 1JROA 4B9SA 1MC8A 3N7PD 3MDAA 4KLOA 1VFGA 1JI7A 2ISOA 1K5OA 4Q8EA 5KFLA 1SKRA 3CNHA 3MR2A 1S97A 4ECRA 3K1ZA 5KFEA 1ZD4A 4NL9A 1U48A 2AU0A 4R66A 3N97B 4EX7A 4OJLA 1N2XA 1S8OA 2ZH9A 2QB1A 2M2UA 4RQ2A 5DKWA 5F3XB 2M9NA 2Q0ZX 3H8WA 5HRHA 3L4PA 3G6YA 2PMZC 4KLMA 4FZLA 5KFMA 2DR8A 3IP4B 5ALLA 1UT8A 2FMPA 5EOZA 1XSPA 4CGZA 2JR5A 1UHUA 4PGQA 3PW2A 4Q8FA 1QSLA 3JPRA 2EZZA 5AM4A 4RUAA 2WAQC 8ICCA 2YB1A 2KZ3A 3RF9A 5KFIA 2ZUCA 2WTFA 1NZBA 5DB9A 1DGSA 1KN5A 8ICGA 9ICMA 9ICRA 1ZQVA 1X9SA 2HI0A 3MGIA 5AKGA 3OHAA 3Q8PB 3WKDA 4EBCA 4TUQA 4OD0A 3WKEA 5KG3A 4EEBA 1XO0A 9ICGA 1KFTA 5AM3A 5HRIA 2BBJA 1X9XA 5KT3A 5J2CA 1S0OA 5HHHA 9ICAA 2J6TA 2W11A 4O3RA 4AT8B 2HOIA 2JHDA 5CHGA 5HC9A 3PR4A 5KFWA 4TQSA 3TFSA 4NLKA 1TV9A 4FHWA 3SMVA 2B6GA 4DO9A 2MU2A 5AM1A 1T7PA 4UBBA 3F5EA 2HHVA 1K1SA 4KLGA 2DL0A 4UB4A 2V9WA 2ZTCA 3RH4A 5AKIA 3NKUA 1F5SA 3WFRE 1SV0A 3H38A 4F3OA 2AQ4A 1ZD3A 4DOBA 4C7ZA 3T5KA 4RNOA 4CE6A 2QKQA 3AQMA 5CP2A 4Y2PA 4NLGA 4C8NA 4LEVA 4EZ9A 3OJUA 3H0RB 4M5DA 4RQNA 5HR9A 4K96A 8ICKA 2LKYA 2F77X 2BCUA 2JH7A 4BWMA 4YCXA 3H8JA 3NUQA 4K99A 5EE1A 4J9RA 2HBJA 4HYKA 2DWQA 4O67A 2ZJAA 5KFNA 2IHNA 3IN5A 4EV6A 5AIBA 1ZQJA 3UMCA 2VA8A 5GTIU 4B9VA 5KTQA 1U9LA 1X6JA 3PVXA 4NXVA 2UVUA 3GILA 4RWQA 3LVVA 3QYPA 2F1IA 2H3ZA 5IINA 2J6UA 4M0AA 7ICTA 2LMRA 5AK6A 1ZQ1C 5J2EA 3M9MB 3BQTA 4QZBA 5ALHA 5J0WA 3GV8B 5KFBA 3GIJA 1T4GA 4O3OA 2DPJA 1Z4NA 3OUYB 4Y2TA 3VCBA 2KHQA 4C80A 4YR0A 3UXOA 1BPYA 3OWGA 4JWMA 4XRHA 3LWMA 1LV5A 2W03A 1WCLA 1UA1A 2I9GA 4MKPA 4QIWF 2ZIVA 2KSOA 3T5LA 1ZQOA 5AKJA 4QWCA 1TK8A 3OVSA 3AQKA 3SAGA 4MF8A 2JRZA 3AQFA 4MFCA 3KBBA 1U4BA 9ICBA 3KFUF 3SEIA 4ED6A 1O08A 4DSEA 1OUQA 2GAFD 2QARA 4IC9A 3WK9A 1JUDA 4Y2RA 3HJ1A 2IHMA 2A1JA 5ALJA 4X4TA 3HKZF 3HWTA 4RQ3A 1SWVA 4PL1A 4ECVA 5AICA 3SAHA 4B9NA 3RR7A 2K4PA 4QWDA 2K89A 1KBUA 4RZRA 1ZQIA 3QU9A 5TISU 9ICHA 5EWFA 5HRDA 4M2YA 5CFUA 4OJPA 1KSPA 3CK6A 1AQ6A 4RQ1A 4ED3A 4AT7A 2DKZA 3FYHA 4DQIA 4RQ8A 4M47A 3TADA 2BGWA 5ALTA 3QZ8A 2DR5A 2Y1JA 3L9DA 1SV0C 1DXSA 3ORYA 1UQVA 3CW2C 2ASJA 4WJ3B 3NVZA 4X4RA 2HOQA 2N1RA 3HJ4A 2JZBB 2WB1C 4QZGA 2LYAA 4BXOA 3WKCA 3C29A 3PR5B 4KLTA 4EZ6A 1PK1A 8ICFA 1LKYA 1MSWD 3PO4A 1V4AA 4RWNA 2AH5A 2HCFA 5KT7A 4IR1A 5AHXA 2MUTB 5JTGA 3BZKA 3NRZA 4K9BA 2W7OA 5J2IA 3K75D 1TK0A 3NWIA 4CCHA 5KAIU 3QEAZ 4KLDA 3ZI4A 4M9HA 3CYMA 2F8KA 4EP7A 2ZTDA 4YQWA 3C66A 4PGXA 2BKEA 4E7XA 1F44A 2KK0A 1Z00A 2B0CA 4QJFB 2Y9TA 2DQNB 3SD7A 4YP3A 8ICUA 4Z6FA 3RBEA 4UB6U 5AI0A 5KG0A 4ICAA 4CDGA 3SZ2A 3V7LA 3FDSA 3CRXA 4B6JA 3M8SA 2C28A 4M6WA 2EAOA 4FS2A 4WOYA 4PZNA 5J8YA 1T94A 5D49A 2JXJA 2ZH1A 1SZPA 2XCPA 2UVWA 4FS1A 2AXTU 2HOFA 2AGPA 2DBYA 2PFQA 3JPSA 1DK2A 2J6SA 4DQPA 3ERCC 5TZVA 3TI0A 5J0YA 4IQVA 5AM0A 3KKAC 2JGAA 1U45A 5HREA 4EX6A 3PW7A 1LVHA 4Y2SA 4RWPA 2LM4A 3PV8A 3QXGA 4EYIB 5CFSA 3RJIA 1MIYA 4NM1A 5HHIA 5B3PA 2PMZF 3LVWA 2JEGA 4P4PA 8ICXA 3IG8A 2KJ9A 4I2FA 3OTQA 2P35A 3LDAA 4CNQA 4KN4A 1NZPA 3MC1A 4US8A 4K4IA 3HJEA 4GXKA 2A19A 2WAQF 4CF3A 4F4KA 1QQ5A 2BCQA 1NO5A 3RTVA 3C1ZA 3PNCA 1MQ2A 2BPFA 2RDIA 4E8FA 2K8BB 1Q79A 4ELVA 4J9LA 4DOCA 4YMNA 3QZ7A 3AUOA 4B9LA 2UVVA 4FH5A 4QIWC 2OYYA 4DL7A 2WHEA 4AYBF 1QLNA 3WK4A 2NRXA 2BBHA 4EENA 4O3SA 3OPXA 4HX0A 7ICKA 4ATBA 1KRPA 1JAJA 5AM2A 5KG1A 4DFMA 2VANA 2OWOA 3IDWA 2W9BB 1TAMA 4RWOA 1N61A 5EE0A 4CF5A 2ZH4A 5DG9A 2MSNA 4MEYA 3R9KA 3GZFA 1QQ7A 2A1AA 4LEYA 1N5WA 5HR6A 4XJEA 4DSFA 1MN8A 4F5RA 5KL8B 1XSLA 8ICQA 3ETRA 2EZXA 4I29A 4BJQA 5KFHA 1ZRNA 4I2CA 3GFKB 5ALWA 4Y2XA 2W43A 1NK0A 2DKXA 3ONNA 4QZHA 4Y2JA 4ECZA 1N62A 4QZAA 1F5AA 2QB0B 2RLTA 3RJHA 4OJ5A 2BPCA 2CRXA 2JEIA 4I2DA 5ALUA 4GXIA 2EANA 2ZG6A 5KT2A 8ICTA 3PSIA 3BS5B 1TFYA 3N7RC 1U49A 4Q43A 5AK5A 4M9JA 2OM6A 4DWIA 3WK8A 4KLLA 4YFKA 5J0QA 5J8YC 2WF5A 2YMQA 4DLGA 3KHRA 2DR9A 3DEEA 2ZHAA 1L7PA 1YZ6A 2I6XA 4WC1A 4PPXA 5CR0A 3T3FA 3H0MB 4FBUA 5L1MA 4DSJA 4QZFA 4FH3A 4JMUA 2EQYA 3RB4A 5AK4A 1Z3EB 1OW5A 4NKUA 2WF9A 2YX8A 3QUCA 4Z6EA 3NRWA 3HW8A 4X4PA 4O3PA 4KB6A 4QW8A 3MABA 4WC7A 4WC5A 4F4ZA 3KOOA 4F5NA 2H3VA 5J0XA 1BNPA 4J9NA 2GH1A 3ISCA 4PL2A 1ZQKA 4MFFA 2H3FA 2HHQA 3C18A 4RUCA 8ICAA 4FBTA 1ZRMA 1FA0A 2FI1A 4F4XA 3MFHA 4I2BA 1X40A 4WC3A 5B5EU 7ICEA 4JB3A 2EH9A 1K1QA 4NY8A 2WF6A 1BVSA 3GIKA 3NS1A 5C5JA 4IL6U 3O0FA 4UATA 3Q8SB 4PZOA 2ES6A 4UB5A 4WC2A 1HUOA 3H40A 4FHVA 1SL2A 3BDPA 2F2AB 4I0UA 2XVTA 5ALVA 4RQ5A 1FEZA 2B51A 3RBDA 2E3TA 2W54A 2B4VA 3MR6A 4NJ8A 2HMXA 5KFRA 4YR2A 3ZDCA 4PH5A 4BUGA 3UXPA 3LYSA 3C21A 2HBKA 4IRCA 4J9PA 4QZIA 2O6KA 4O68A 4NXWA 1JRPA 1JX4A 4X4OA 5ALEA 4S3NA 3Q8RB 7ICQA 2XCAA 1RPLA 2M2VA 7ICOA 2JV3A 2VJ5A 1NOMA 8ICOA 2PKEA 4OAHA 2ZH8A 4CRXA 3FAHA 3EZ5A 4AYBC 8ICYA 4IQTA 3ZDDA 5KFAA 3LQCB 2BPGA 2YQEA 4XQ8A 2WB1F 3LWLA 2W3RA 5J2DA 3C2KA 3Q8MA 8ICMA 5F9NA 2O5AA 7ICLA 3L5KA 2F8LA 2W9CB 1XS9D 5DDYA 5KFTA 4RQ4A 2C2RA 3OVBA 2IOFA 2XY5A 3BQ0A 2R8KA 1B4FA 4DFKA 4O6AA 4MFAA 3WKBA 4K9AA 5F9LA 7ICNA 1R8CA 1WUDA 1JQRA 2ZJ5A 3ZDAA 4MHVA 8ICWA 4X4VA 4KLUA 5KFXA 2AJQA 3DDHA 3D6JA 5H2FU 5GTHU 3OSPA 1Z1BA 4QW9A 4R8UA 3RB3A 2XIDA 1N63A 4C0ZA 4KM5A 3B0XA 2LBOA 4DLEA 3S6JA 2NRVA 1ZQXA 3WFQE 1YLQA 3UQ0A 4WBZA 4UARA 2FJ6A 1YZ7A 1ZQAA 1CI4A 1NK8A 1PX5A 1ZXIA 3JPNA 2ZUBA 1KW4A 4ED2A 3RR8A 1D8BA 5DB7A 4F50A 3BQ2A 3HRDD 5KG5A 3MGHA 2C2EA 3M8RA 3WFOA 5DDMA 4KITB 4KX3A 1JXEA 5L1KA 2Q4TA 4Q44A 5KG6A 4NXXA 9ICEA 4WC4A 4WBYA 1V97A 3SV4A 2DRAA 2LM1A 9ICOA 2EZYA 3ZD8A 2FPKA 2WFAA 1ECWA 3AU2A 4WQLA 3NVYA 4DOAA 4NL9C 4EELA 4Z6DA 3JPPA 1N60A 4U7CA 2KJ5A 4DCCA 3H4DA 1C20A 3AQNA 8ICLA 5KFUA 2IMWP 4FHXA 4LEZA 4KTQA 4ED7A 5KFSA 1OU5A 5KFZA 1ZQLA 4TUPA 5J29A 4YG2A 2LYBA 8ICEA 3GIMA 1ZQYA 3MR3A 4NXUA 1GO3F 3RH6A 2E8MA 2HSZA 4USAA 3KHLA 2A3VA 2KVCA 2OH2A 5ALKA 1UETA 3CP8A 5D61A 4NV0A 1ZOLA 4ECQA 2FLNA 4JUZA 4FFDA 5BOLA 4F8RA 4B9TA 5KFFA 3V7KA 2FE9A 3IHQB 3H7IA 2ZIUA 5CEHA 2KICA 5DBCA 1ZQUA 3HT3A 1L3VA 7ICUA 4EBKA 5C0YA 3HIYA 5J2BA 2ALZA 4RT3A 1D8YA 5B3QA 5EWEA 1L7NA 3H4BA 1Q8KA 2W8LA 4EEYA 2NRZA 4EBEA 3PSTA 2E8PA 1T3QA 2KV2A 4UAZA 2V4QA 3NYBA 2AGOA 4ECYA 1TKDA 1HJPA 3OGUA 2FCLA 4WCWA 1X2IA 1ZQRA 2IUBA 9ICUA 3AM9A 1MQ3A 5D62A 5KFGA 5J2FA 7ICPA 3M1YA 1DOQA 9ICCA 3GV5B 4X4SA 2ZIWA 3GQCA 2E8OA 5KFPA 1SGGA 3H37A 1ZQZA 5DEDA 4ECWA 2KN7A 2YMPA 1L6NA 4RQMA 2BR0A 2ISPA 4IS7A 3PZPA 3QU2A 2C22A 1XWLA 3PMNA 1RDFA 1A77A 8ICNA 5DQGA 1ZQWA 4RQ0A 3PMLA 2BDUA 4Z6CA 5DB8A 1JMSA 2F3NA 1TE2A 2RQ5A 3F2CA 3HX0A 4I2GA 5J0PA 5EE9A 4QNLA 1Z1VA 4P0PA 5ALGA 1QSYA 1X66A 4AT9A 2EDUA 2KZMA 2HHTA 1IV8A 4F72A 8ICIA 4O3NA 3RRHA 9ICQA 3Q8LA 2ZIVB 4DQRA 2KSOB 5HRLA 3AMZA 1S5LU 1WG8A 2YB4A 3N28A 5J2KA 4UQGA 5KT4A 1TFWA 4NKTA 2ZXIA 3WFPA 2ASLA 3H39A 1R8AA 5KFKA 4UB2A 4LVSA 4MF2A 2EWRA 1CEZA 1X42A 2QARB 2PBEA 1VJ5A 2DFLA 3JPTA 1JALA 1RQNA 5DGAA 4XA5A 4US9A 4BWJA 2A1JB 5DB6A 2VJ4A 8ICVA 4WC6A 2KG5A 4GLXA 4BDPA 3K4GA 4ELTA 2FMSA 1DGJA 3E2EA 2V4RA 4P4MA 2Y0SC 5L1IA 4X0AA 2YMLA 5KG4A 4RQ6A 9ICWA 4O9MA 1T3NA 4RU9A 9ICIA 2KMDA 5KFOA 3H3AA 1SKWA 4ECTA 4AT7B 3ICXA 1J2NA 1F0MA 1ZQHA 1KKXA 2HBLA 3ETLA 3H8MA 3M9OB 4PGYA 2BDPA 2JEFA 5KL1B 4FHYA 2DVIA 2G08A 1Q46A 3EPGA 1PZNA 1BGXT 3WU2U 1XSNA 5AKYA 4DL2A 2DGZA 1WOTA 3PO5A 1SB3C 3PX6A 2QLTA 4BXOB 2DF4B 2MAXA 4QZCA 3MCRA 3SENA 5KG7A 4M04A 2R8HA 4PHDA 3M6KA 1SXDA 1LKYB 8ICZA 2KKVA 2P6UA 2WF7A 4F91B 2BCRA 1ZQDA 2YN4A 1WWUA 4DSLA 1J97A 4J9MA 1PVPA 4KN7A 1KNYA 4I2AA 4ED1A 1S9FA 4F2RA 3F2BA 3KHHA 2IOFK 2KZZA 2E1EA 2BQRA 5CFTA 7ICGA 9ICSA 5ALIA 4YMMA 4B9UA 2JEJA 1QTMA 4KLQA 1ZD5A 2K8CB 1Z00B 2KOBA 1S0MA 4O5CA 3KTQA 3THVA 3TADC 4KMUA 4UAUA 1TK5A 1SV4A 4K8VA 2ZIXB 4I2IA 1A6SA 4F93B 4YR3A 2LHTA 4M6WB 2FPLA 1D9FA 4OAIZ 2BHNA 2XICA 4YD2A 3PW4A 3PX4A 2BCVA 2W04A 5B66U 1NI3A 4DS5A 5HNKA 1URJA 4ED8A 3JZ0A 2FMQA 1TVAA 5EWGA 2P6RA 2KIVA 1Z19A 2UVRA 4IRDA 4I28A 1NJXA 5ALZA 3PW5A 4P0QA 3JPQA 3OHBA 5DG7A 1FFVA 1UT5A 5KFDA 1S77D 4NLBA 1RQLA 1SIJA 4C8MA 1KFDA 2FLLA 4M9NA 2G5HB 5E79U 2NO4A 3KHGA 7ICJA 3AL0B 2NO5A 2XGPA 3AEVA 9ICFA 2ZH2A 2XC9A 1DK3A 1TAQA 4C8LA 2W8KA 5CA7A 2VKQA 1ZQQA 4GFJA 1A0PA 4E0DA 4O5KA 2M2TA 3OJSA 2M2WA 3D2QA 5JRTA 4I27A 1NNLA 1WCNA 3UMGA 1SZHA 2F76X 2BCSA 3MDCA 2GOLA 4PHEA 4R65A 5KFYA 1RYRA 5HRGA 3PY8A 3LK9A 4C8KA 4OO1J 2IHOA 3AU6A 2H3IA 4O3QA 2P66A 4WC0A 2NRWA 1HUZA 1L8OA 4QZEA 4ATBB 2KJ8A 2PI5A 1BPEA 4J9SA 3F5AA 3T79A 5DBBA 3B0YA 2K60A 4WH5A 2XO7A 1XC9A 5AK3A 2G0AA 4ZH4A 5AI4A 4J9QA 3BQ1A 5CWRA 5AKEA 3K7DA 3ZD9A 2Z7JA 3KZIU 3TKAA 4ACOA 3NVOA 3SR6A 1N56A 4DL3A 2D6FC 4P4OA 1S76D 1L7OA 2KIWA 3EPIA 2KP7A 2BE3A 4MEXA 2JMGA 5D46A 3J81j 2W9AA 2AQ0A 3SYZA 2KD1A 2LI6A 2F1JA 1X9WA 2KHVA 1ZQGA 4AT8A 4LEWA 3KD3A 2E1FA 4UBCA 1Q78A 4OCZA 2E5SA 2JH1A 2NRTA 3NTUA 4TUSA 3TQ1A 1S10A 9ICXA 2KTQA 3TACB 3C2LA 5HRBA 4O69A 2RRDA 2KKPA 3V72A 3RJGA 4ZOHC 5AI6A 4FO6A 2IA6A 4JWNA 3TANA 9ICLA 1ZJNA 3EWAA 3OVAA 2ZH3A 9ICVA 1NK9A 1IG6A 2R8GA 2G06A 2DPIA 2VA2A 1V9PA 4P2HA 3WK6A 4I2HA 4JV2A 3V7JA 4PHAA 4KLJA 1R8BA 1Q3VA 1NJYA 2Y1IA 3QUBA 4KLFA 1OXJA 4EBJA 3C1YA 3V6HA 4YD1A 5CRXA 5L1LA 4X4QA 5G5HA 1ZETA 1UCVA 2RDJA 1SL0A
chains in the Genus database with same CATH topology
3RH6A 8ICRA 4NM2A 2XGQA 5CJ7A 2HHWA 1D9DA 2BQ3A 1JIHA 2B21A 4K4GA 3KHLA 3SZ2A 4DQSA 5DLFA 1KTQA 4YXJA 4IQWA 3V7LA 3UXNA 5D4BA 1UETA 3FDSA 3C2MA 4E80A 3OV7A 1MIVA 3QE9Y 3G6XA 3M8SA 3TFRA 2C28A 4M6WA 4ECQA 5KT6A 4FS2A 2FLNA 5D49A 4JUZA 2HW3A 5BOLA 4F8RA 4B9TA 5IIJA 5KFFA 3V7KA 1TFRA 4F4WA 3QEBZ 1SZPA 2FPMA 2XCPA 2UVWA 3GIIA 4FS1A 3WFSC 3IHQB 4R63A 3H7IA 4YMOA 2HHSA 3UPSA 2AGPA 5F2VO 4K4HA 2PFQA 4UD4A 4G3IA 5DBCA 3JPSA 1ZQUA 3HT3A 1L3VA 7ICUA 1DK2A 2J6SA 3T5JA 4DQPA 5TZVA 4EBKA 3HIYA 4X4NA 5J2BA 2ALZA 1S0NA 3TI0A 1RXWA 5J0YA 4IQVA 1COOA 4RT3A 1D8YA 1U45A 5EWEA 1NK4A 9ICJA 5HREA 4UD5A 4YVZA 1VJ7A 4J9KA 1U47A 1KEJA 3PW7A 4RWPA 3H4BA 3TARA 4BGDA 1BPDA 4NLZA 5HRFA 1KFSA 3PV8A 4IR9A 2W8LA 3TAQA 2DR7A 4EYIB 4EEYA 3OUYA 4DL4A 2NRZA 3RJIA 1L3SA 5BOMA 4EBEA 4IRKA 1MIWA 1MIYA 2ZH7A 5KT5A 1L3UA 9ICTA 4NM1A 5HHIA 3NYBA 4UAZA 2V4QA 1ZYQA 2AGOA 4ECYA 5IIKA 2Q66A 1TKDA 3ZDBA 4QWBA 4KLIA 2JEGA 9ICKA 4P4PA 1HJPA 4FHPA 3OGUA 1RXVA 8ICXA 4IQUA 4WCWA 1X2IA 1ZQRA 4C8OA 4QZ8A 4F2SA 4I2FA 1MQ3A 9ICUA 5KFGA 2RFFA 5J2FA 4ECXA 7ICPA 1UEUA 3TAPA 1DOQA 3LDAA 9ICCA 4KN4A 3GV5B 2ASDA 3ISDA 4RT2A 1NZPA 3HPOA 1NKCA 2ZHBA 4K4IA 4X4SA 4GXKA 2I1QA 3GQCA 2LYHA 5KFPA 4F4KA 5IILA 3H37A 5KFCA 5KFJA 1ZQZA 4TURA 2BCQA 1NO5A 3RTVA 2KN7A 3C1ZA 3UPQA 4ECWA 8ICJA 3PNCA 2BR0A 5DEDA 2W9CA 1MQ2A 2BPFA 2ISPA 2PI4A 2RDIA 3MFIA 1AROP 2PXIA 4PHPA 4ED0A 4E8FA 3Q8QB 3RH5A 2C22A 1XWLA 1Q79A 3PMNA 1LB2B 1A77A 8ICNA 5DQGA 1ZQWA 5J2JA 4RQ0A 3PMLA 1H38A 4J9LA 4DOCA 3GDXA 4YMNA 4Z6CA 5DB8A 3QZ7A 4QZDA 3AUOA 1ZQCA 2PFOA 2UVVA 4B9LA 2ID1A 4FH5A 1JMSA 4DL7A 1QLNA 3HX0A 4I2GA 5J2AA 5J0PA 4B9SA 1MC8A 2NRXA 3MDAA 4M9GA 4KLOA 1VFGA 4O0IA 4O3SA 2ISOA 4Q8EA 7ICKA 5KFLA 4ATBA 1SKRA 1KRPA 1JAJA 3MR2A 1QSYA 1S97A 4ECRA 4AT9A 5KG1A 4DFMA 3ZDEA 5KFEA 2VANA 2OWOA 2HHTA 2W9BB 2KZMA 4DL5A 1U48A 2AU0A 7ICMA 4RWOA 1CUKA 1NJZA 2R8JA 8ICIA 5DG9A 2ZH4A 4R66A 4O3NA 3N97B 2H5XA 4MEYA 3RRHA 9ICQA 3Q8LA 4DQRA 2ZH9A 2M2UA 5HRLA 2NRKA 3RJEA 5HMMA 5J2KA 4DSFA 4RQ2A 5DKWA 4UQGA 1TAUA 2M9NA 5KT4A 1TFWA 4F5RA 2FLPA 2Q0ZX 1XSLA 3H8WA 1ZQTA 3ISBA 4JV0A 8ICQA 5HRHA 3G6YA 3C23A 4ELVA 4NKTA 4KLMA 4I29A 5KFHA 3SV3A 4I2CA 4DQQA 3GFKB 5KFMA 2DR8A 3WFPA 2ASLA 4JV1A 4YXMA 8ICPA 1UT8A 1NK0A 2FMPA 5EOZA 1XSPA 3H39A 1UA0A 1R8AA 5KFKA 5J2GA 4UB2A 4LVSA 4MF2A 1CEZA 5J0UA 4PGQA 4QZHA 3PW2A 4Q8FA 2HVIA 2PBEA 1QSLA 4ECZA 2DFLA 3JPRA 3JPTA 4DSIA 5DGAA 4QZAA 4RUAA 2JZBA 4XA5A 1F5AA 4BWJA 2A1JB 3AQLA 8ICCA 5DB6A 3RJHA 2ZTEA 1IM4A 2BPCA 2KZ3A 5KFIA 2WTFA 2ZUCA 4DS4A 4I2DA 2JEIA 4GLXA 8ICVA 4WC6A 4GXIA 3OSNA 4BDPA 2HHXA 3K4GA 5DB9A 4ELTA 2FMSA 4R8UB 5KT2A 1DGSA 4GXJA 8ICTA 3E2EA 8ICGA 9ICMA 2V4RA 4P4MA 1XO1A 5L1IA 9ICRA 4X0AA 4LZGA 3RRGA 5KG4A 1ZQVA 4RQ6A 4X5VA 9ICWA 4QZ9A 1X9SA 1TFYA 4O9MA 1T3NA 1U49A 2ZH5A 4RU9A 9ICIA 4Q43A 2MUTA 3H8SA 5KFOA 3MGIA 4M9JA 1IXRA 5KFVA 1SKWA 3OHAA 3Q8PB 2KFZA 3H3AA 1ZJMA 4ECTA 4DWIA 4AT7B 4EBCA 4TUQA 4EYHB 4DF8A 3M9NB 1C7YA 1ZQHA 4KLLA 4YFKA 5KG3A 5J0QA 4XQ7A 3ETLA 3M9OB 4FHYA 4PGYA 2BDPA 2JEFA 9ICGA 1KFTA 4LT6A 2DVIA 5HRIA 4DLGA 3EPGA 1PZNA 3KHRA 3NGDA 5KT3A 1BGXT 1XSNA 5J2CA 2ZHAA 1S0OA 4DL2A 2DR9A 4DFJA 5HHHA 9ICAA 2KFNA 2J6TA 4WC1A 4O3RA 4PPXA 1WOTA 5CR0A 3T3FA 3PO5A 4AT8B 5JUMA 4FBUA 1D8LA 4DSJA 2W9MA 3PX6A 4BXOB 5CHGA 4QZFA 3PR4A 5HC9A 1NK7A 4FH3A 5KFWA 4TQSA 3C5GA 2MAXA 5DECA 4QZCA 3TFSA 5KG7A 4M04A 4NLKA 1TV9A 4FHWA 2R8HA 4PHDA 3EW9A 4DO9A 3RJFA 8ICZA 3RB4A 1KDHA 1T8EA 1Z3EB 1T7PA 2P6UA 4UBBA 1S76D 4F91B 4NKUA 2HHPA 3G6VA 4Z6EA 3V6JA 5DGBA 2BCRA 2HHVA 1K1SA 1ZQDA 3HW8A 1B22A 4X4PA 4O3PA 4KLGA 5J0RA 4UB4A 4QW8A 3MBYA 3MABA 4DSLA 4WC7A 4WC5A 2C2DA 4F4ZA 5DBAA 1BPZA 5KFQA 2V9WA 4J9MA 4F5NA 2ZTCA 5J0XA 1BNPA 3RH4A 4J9NA 4KN7A 1KNYA 4I2AA 3ISCA 4ED1A 1S9FA 1NK5A 1ZQKA 4MFFA 2HHQA 3WFRE 4F2RA 7ICVA 3KHHA 3C18A 3H38A 2KZZA 4RUCA 4F3OA 2AQ4A 8ICAA 4FBTA 4DOBA 2BQRA 7ICGA 3T5KA 9ICSA 1FA0A 4F4XA 4I2BA 3MFHA 4RPXA 1QSSA 4X0BA 4YMMA 4WC3A 4RNOA 4B9UA 7ICEA 2JEJA 1QTMA 5L9XA 4QWAA 4KLQA 3RJKA 4GC6A 1K1QA 1Z00B 1S0MA 4NY8A 4DL6A 4O5CA 1BVSA 3GIKA 3KTQA 3GV7B 5CP2A 3THVA 1R89A 3AQMA 4J9OA 4KMUA 5C5JA 4UAYA 4NLGA 4C8NA 1TK5A 1ZQFA 5BPCA 4EZ9A 1JN3A 3OJUA 7ICIA 5J2HA 4M5DA 4F92B 5HR9A 3Q8SB 2IBKA 8ICKA 4B9MA 4UB5A 4I2IA 4WC2A 2BCUA 4BWMA 1X9MA 4YCXA 4F93B 4YR3A 3C5FA 3SI8A 1HUOA 3H8JA 4YN4A 3H40A 8ICBA 2GWSA 4R64A 4FHVA 4J9RA 8ICHA 4M6WB 2FPLA 4KLEA 4ELUA 1D9FA 2BHNA 4O5EA 1UEVA 4YD2A 5L1JA 4HYKA 3PW4A 1A76A 3PW0A 2ZJAA 3PX4A 1SL2A 4KLHA 5KFNA 2XY6A 1NK6A 2BCVA 2IHNA 3BDPA 4RQ5A 4DEZA 3RBDA 4DS5A 1ZQJA 5HNKA 3JPOA 4ED8A 1JXLA 2VA8A 3JZ0A 3IM1A 5KTQA 1U9LA 3MR6A 3PVXA 1TVAA 2FMQA 4B9VA 2UVUA 5KFRA 3GILA 4YR2A 5J0TA 4RWQA 5EWGA 4PH5A 3ZDCA 2P6RA 2HHUA 7ICSA 3UXPA 2UVRA 2F1IA 1SL1A 4IRDA 4I28A 1NJXA 3RJJA 3C21A 4IRCA 4DFPA 5IINA 4J9PA 4ECSA 3PW5A 4QZIA 2J6UA 4M0AA 7ICTA 5DG8A 5J2EA 3JPQA 4UB3A 3M9MB 3BQTA 3OHBA 4F5PA 1JX4A 4RNNA 5DG7A 4X4OA 1EXNA 4QZBA 1RYSA 1UT5A 2ZUDA 5KFDA 4S3NA 1S77D 5J0WA 3GV8B 5HRKA 5KFBA 3GIJA 1T4GA 3Q8RB 4O3OA 2DPJA 9ICNA 2XCAA 7ICQA 1RPLA 2M2VA 3OUYB 2PFPA 2XY7A 4KLSA 2AGQA 7ICOA 4C8MA 1KFDA 2FLLA 4M9NA 4RPZA 4YR0A 4DSKA 1NOMA 3UXOA 8ICOA 4UB1A 1ZQPA 4RPYA 3KHGA 2ZH8A 2ZJ8A 1BPYA 7ICJA 4JWMA 2XGPA 3EZ5A 9ICFA 2ZH2A 4I2JA 4XRHA 3Q8KA 2XC9A 3LWMA 1TAQA 1LV5A 4C8LA 2W8KA 1DK3A 3JYYA 2W9BA 5CA7A 1BNOA 8ICYA 1Y88A 4IQTA 1ZQQA 3ZDDA 1WCLA 1UA1A 5KFAA 2HVHA 3LQCB 4E0DA 4O5KA 2M2TA 3OJSA 2BPGA 5J0SA 4XQ8A 3LWLA 2I9GA 2M2WA 9ICPA 4I27A 1WCNA 5IIOA 5J2DA 7ICFA 3UQ2A 3C2KA 3Q8MA 3T5LA 2BCSA 5F9NA 3MDCA 1ZQOA 8ICMA 2O5AA 4PHEA 2W9CB 7ICLA 4R65A 1XS9D 1ZQEA 4F5OA 4QWCA 5KFYA 5DDYA 3RAXA 1TK8A 1RYRA 5KFTA 5HRGA 3PY8A 4RQ4A 3LK9A 2C2RA 1SL0A 4C8KA 3OVBA 4NXZA 3OVSA 3AQKA 3AU6A 2XY5A 4O3QA 4MF8A 3N4MB 2P66A 4WC0A 2NRWA 1HUZA 3BQ0A 2R8KA 4DFKA 4TQRA 4MFCA 4MFAA 3RAQA 1B43A 1U4BA 4F4YA 9ICBA 5F9LA 7ICNA 4QZEA 1R8CA 1JQRA 4ED6A 5KG2A 4DSEA 2ZJ5A 1N48A 3ZDAA 4ATBB 2PI5A 8ICWA 4JK1A 4X4VA 1BPEA 4J9SA 4KLUA 2DRBA 3HJ1A 5KFXA 5HMLA 4RNMA 2IHMA 4AT9B 2AJQA 2A1JA 1SKSA 4IG8A 3OSPA 5DBBA 4X4TA 3B0YA 4QW9A 3HWTA 4RQ3A 1ZQSA 2XO7A 1NKEA 4R8UA 4XUSA 4ECVA 3RB3A 1XC9A 4ZH4A 3PX0A 3B0XA 3BJYA 4J9QA 1NJWA 4B9NA 4DLEA 4QWDA 3RR7A 3BQ1A 5J0OA 2NRVA 1BPBA 4RZRA 5CWRA 1ZQIA 1ZQXA 3ZD9A 4I2EA 9ICHA 5EWFA 5HRDA 4M2YA 1ZQMA 4ECUA 3UQ0A 1N56A 4DL3A 1YLQA 1KSPA 4WBZA 3WFQE 4RQ1A 3RB0A 2PFNA 1ZQAA 4F5QA 4ED3A 1NK8A 1PX5A 4AT7A 1XU4A 3FYHA 4P4OA 3JPNA 5IIMA 3T5HA 2ZUBA 5HP4A 4ED2A 3RR8A 4DQIA 4RQ8A 3EPIA 1L5UA 2VA3A 4M47A 2KP7A 2BGWA 4MEXA 2BE3A 3QZ8A 5DB7A 4F50A 3BQ2A 5D46A 2DR5A 2W9AA 2Y1JA 3L9DA 2AQ0A 5KG5A 3SYZA 3MGHA 2C2EA 3ORYA 1KLNA 4UAWA 3M8RA 3WFOA 2ASJA 1ZQBA 2F1JA 5DDMA 1X9WA 4KITB 4X4RA 1JXEA 1BPXA 1ZQGA 4AT8A 7ICRA 3HJ4A 2JZBB 4QZGA 5L1KA 4Q45A 4UBCA 4BXOA 4Q44A 1Q78A 5KG6A 3PR5B 4KLTA 4EZ6A 5DQIA 5CB1A 5IIIA 3EYZA 9ICEA 4WC4A 4WBYA 3SV4A 2DRAA 2ZH1A 5DLGA 2ATLA 2NRTA 8ICFA 9ICOA 1MSWD 4DF4A 3NTUA 4TUSA 3PO4A 3TQ1A 1V4AA 1S10A 4GC7A 9ICXA 4RWNA 4EBDA 2KTQA 3ZD8A 5KT7A 1L3TA 4IR1A 2FPKA 4NLNA 3C2LA 5HRBA 3AU2A 3V72A 1RZTA 3RJGA 4X4UA 2MUTB 4FO6A 4DOAA 2ZH6A 3HP6A 2IA6A 4JWNA 3TANA 9ICLA 4Z6DA 4QWEA 3JPPA 2R8IA 3EWAA 1ZJNA 3OVAA 2ZH3A 7ICHA 2O1PA 5J2IA 3K75D 1TK0A 9ICVA 1NK9A 3MR5A 4CCHA 8ICSA 4RQ7A 3V6KA 2R8GA 3H4DA 3QEAZ 4KLDA 2DPIA 3AQNA 2BQUA 2VA2A 4M9HA 1V9PA 4P2HA 8ICLA 5KFUA 2IMWP 4FHXA 4EP7A 2ZTDA 4M9LA 4I2HA 4JV2A 3V7JA 4PHAA 4YQWA 4KTQA 4ED7A 4KLJA 5KFSA 1R8BA 3C66A 4PGXA 1OU5A 1NJYA 5KFZA 2Y1IA 2BKEA 1ZQLA 4E7XA 1Z00A 4TUPA 2F1HA 4KLFA 5J29A 4EBJA 3C1YA 3V6HA 4YD1A 4YG2A 4YP3A 3RB6A 1NKBA 5L1LA 1S0VA 8ICEA 3GIMA 8ICUA 4X4QA 4Z6FA 1ZQNA 3RBEA 1ZETA 1ZQYA 3MR3A 4LZDA 5KG0A 2RDJA 5DQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH6 A;  8ICR A;  4NM2 A;  2XGQ A;  5CJ7 A;  2HHW A;  1D9D A;  2BQ3 A;  1JIH A;  2B21 A;  4K4G A;  3KHL A;  3SZ2 A;  4DQS A;  5DLF A;  1KTQ A;  4YXJ A;  4IQW A;  3V7L A;  3UXN A;  5D4B A;  1UET A;  3FDS A;  3C2M A;  4E80 A;  3OV7 A;  1MIV A;  3QE9 Y;  3G6X A;  3M8S A;  3TFR A;  2C28 A;  4M6W A;  4ECQ A;  5KT6 A;  4FS2 A;  2FLN A;  5D49 A;  4JUZ A;  2HW3 A;  5BOL A;  4F8R A;  4B9T A;  5IIJ A;  5KFF A;  3V7K A;  1TFR A;  4F4W A;  3QEB Z;  1SZP A;  2FPM A;  2XCP A;  2UVW A;  3GII A;  4FS1 A;  3WFS C;  3IHQ B;  4R63 A;  3H7I A;  4YMO A;  2HHS A;  3UPS A;  2AGP A;  5F2V O;  4K4H A;  2PFQ A;  4UD4 A;  4G3I A;  5DBC A;  3JPS A;  1ZQU A;  3HT3 A;  1L3V A;  7ICU A;  1DK2 A;  2J6S A;  3T5J A;  4DQP A;  5TZV A;  4EBK A;  3HIY A;  4X4N A;  5J2B A;  2ALZ A;  1S0N A;  3TI0 A;  1RXW A;  5J0Y A;  4IQV A;  1COO A;  4RT3 A;  1D8Y A;  1U45 A;  5EWE A;  1NK4 A;  9ICJ A;  5HRE A;  4UD5 A;  4YVZ A;  1VJ7 A;  4J9K A;  1U47 A;  1KEJ A;  3PW7 A;  4RWP A;  3H4B A;  3TAR A;  4BGD A;  1BPD A;  4NLZ A;  5HRF A;  1KFS A;  3PV8 A;  4IR9 A;  2W8L A;  3TAQ A;  2DR7 A;  4EYI B;  4EEY A;  3OUY A;  4DL4 A;  2NRZ A;  3RJI A;  1L3S A;  5BOM A;  4EBE A;  4IRK A;  1MIW A;  1MIY A;  2ZH7 A;  5KT5 A;  1L3U A;  9ICT A;  4NM1 A;  5HHI A;  3NYB A;  4UAZ A;  2V4Q A;  1ZYQ A;  2AGO A;  4ECY A;  5IIK A;  2Q66 A;  1TKD A;  3ZDB A;  4QWB A;  4KLI A;  2JEG A;  9ICK A;  4P4P A;  1HJP A;  4FHP A;  3OGU A;  1RXV A;  8ICX A;  4IQU A;  4WCW A;  1X2I A;  1ZQR A;  4C8O A;  4QZ8 A;  4F2S A;  4I2F A;  1MQ3 A;  9ICU A;  5KFG A;  2RFF A;  5J2F A;  4ECX A;  7ICP A;  1UEU A;  3TAP A;  1DOQ A;  3LDA A;  9ICC A;  4KN4 A;  3GV5 B;  2ASD A;  3ISD A;  4RT2 A;  1NZP A;  3HPO A;  1NKC A;  2ZHB A;  4K4I A;  4X4S A;  4GXK A;  2I1Q A;  3GQC A;  2LYH A;  5KFP A;  4F4K A;  5IIL A;  3H37 A;  5KFC A;  5KFJ A;  1ZQZ A;  4TUR A;  2BCQ A;  1NO5 A;  3RTV A;  2KN7 A;  3C1Z A;  3UPQ A;  4ECW A;  8ICJ A;  3PNC A;  2BR0 A;  5DED A;  2W9C A;  1MQ2 A;  2BPF A;  2ISP A;  2PI4 A;  2RDI A;  3MFI A;  1ARO P;  2PXI A;  4PHP A;  4ED0 A;  4E8F A;  3Q8Q B;  3RH5 A;  2C22 A;  1XWL A;  1Q79 A;  3PMN A;  1LB2 B;  1A77 A;  8ICN A;  5DQG A;  1ZQW A;  5J2J A;  4RQ0 A;  3PML A;  1H38 A;  4J9L A;  4DOC A;  3GDX A;  4YMN A;  4Z6C A;  5DB8 A;  3QZ7 A;  4QZD A;  3AUO A;  1ZQC A;  2PFO A;  2UVV A;  4B9L A;  2ID1 A;  4FH5 A;  1JMS A;  4DL7 A;  1QLN A;  3HX0 A;  4I2G A;  5J2A A;  5J0P A;  4B9S A;  1MC8 A;  2NRX A;  3MDA A;  4M9G A;  4KLO A;  1VFG A;  4O0I A;  4O3S A;  2ISO A;  4Q8E A;  7ICK A;  5KFL A;  4ATB A;  1SKR A;  1KRP A;  1JAJ A;  3MR2 A;  1QSY A;  1S97 A;  4ECR A;  4AT9 A;  5KG1 A;  4DFM A;  3ZDE A;  5KFE A;  2VAN A;  2OWO A;  2HHT A;  2W9B B;  2KZM A;  4DL5 A;  1U48 A;  2AU0 A;  7ICM A;  4RWO A;  1CUK A;  1NJZ A;  2R8J A;  8ICI A;  5DG9 A;  2ZH4 A;  4R66 A;  4O3N A;  3N97 B;  2H5X A;  4MEY A;  3RRH A;  9ICQ A;  3Q8L A;  4DQR A;  2ZH9 A;  2M2U A;  5HRL A;  2NRK A;  3RJE A;  5HMM A;  5J2K A;  4DSF A;  4RQ2 A;  5DKW A;  4UQG A;  1TAU A;  2M9N A;  5KT4 A;  1TFW A;  4F5R A;  2FLP A;  2Q0Z X;  1XSL A;  3H8W A;  1ZQT A;  3ISB A;  4JV0 A;  8ICQ A;  5HRH A;  3G6Y A;  3C23 A;  4ELV A;  4NKT A;  4KLM A;  4I29 A;  5KFH A;  3SV3 A;  4I2C A;  4DQQ A;  3GFK B;  5KFM A;  2DR8 A;  3WFP A;  2ASL A;  4JV1 A;  4YXM A;  8ICP A;  1UT8 A;  1NK0 A;  2FMP A;  5EOZ A;  1XSP A;  3H39 A;  1UA0 A;  1R8A A;  5KFK A;  5J2G A;  4UB2 A;  4LVS A;  4MF2 A;  1CEZ A;  5J0U A;  4PGQ A;  4QZH A;  3PW2 A;  4Q8F A;  2HVI A;  2PBE A;  1QSL A;  4ECZ A;  2DFL A;  3JPR A;  3JPT A;  4DSI A;  5DGA A;  4QZA A;  4RUA A;  2JZB A;  4XA5 A;  1F5A A;  4BWJ A;  2A1J B;  3AQL A;  8ICC A;  5DB6 A;  3RJH A;  2ZTE A;  1IM4 A;  2BPC A;  2KZ3 A;  5KFI A;  2WTF A;  2ZUC A;  4DS4 A;  4I2D A;  2JEI A;  4GLX A;  8ICV A;  4WC6 A;  4GXI A;  3OSN A;  4BDP A;  2HHX A;  3K4G A;  5DB9 A;  4ELT A;  2FMS A;  4R8U B;  5KT2 A;  1DGS A;  4GXJ A;  8ICT A;  3E2E A;  8ICG A;  9ICM A;  2V4R A;  4P4M A;  1XO1 A;  5L1I A;  9ICR A;  4X0A A;  4LZG A;  3RRG A;  5KG4 A;  1ZQV A;  4RQ6 A;  4X5V A;  9ICW A;  4QZ9 A;  1X9S A;  1TFY A;  4O9M A;  1T3N A;  1U49 A;  2ZH5 A;  4RU9 A;  9ICI A;  4Q43 A;  2MUT A;  3H8S A;  5KFO A;  3MGI A;  4M9J A;  1IXR A;  5KFV A;  1SKW A;  3OHA A;  3Q8P B;  2KFZ A;  3H3A A;  1ZJM A;  4ECT A;  4DWI A;  4AT7 B;  4EBC A;  4TUQ A;  4EYH B;  4DF8 A;  3M9N B;  1C7Y A;  1ZQH A;  4KLL A;  4YFK A;  5KG3 A;  5J0Q A;  4XQ7 A;  3ETL A;  3M9O B;  4FHY A;  4PGY A;  2BDP A;  2JEF A;  9ICG A;  1KFT A;  4LT6 A;  2DVI A;  5HRI A;  4DLG A;  3EPG A;  1PZN A;  3KHR A;  3NGD A;  5KT3 A;  1BGX T;  1XSN A;  5J2C A;  2ZHA A;  1S0O A;  4DL2 A;  2DR9 A;  4DFJ A;  5HHH A;  9ICA A;  2KFN A;  2J6T A;  4WC1 A;  4O3R A;  4PPX A;  1WOT A;  5CR0 A;  3T3F A;  3PO5 A;  4AT8 B;  5JUM A;  4FBU A;  1D8L A;  4DSJ A;  2W9M A;  3PX6 A;  4BXO B;  5CHG A;  4QZF A;  3PR4 A;  5HC9 A;  1NK7 A;  4FH3 A;  5KFW A;  4TQS A;  3C5G A;  2MAX A;  5DEC A;  4QZC A;  3TFS A;  5KG7 A;  4M04 A;  4NLK A;  1TV9 A;  4FHW A;  2R8H A;  4PHD A;  3EW9 A;  4DO9 A;  3RJF A;  8ICZ A;  3RB4 A;  1KDH A;  1T8E A;  1Z3E B;  1T7P A;  2P6U A;  4UBB A;  1S76 D;  4F91 B;  4NKU A;  2HHP A;  3G6V A;  4Z6E A;  3V6J A;  5DGB A;  2BCR A;  2HHV A;  1K1S A;  1ZQD A;  3HW8 A;  1B22 A;  4X4P A;  4O3P A;  4KLG A;  5J0R A;  4UB4 A;  4QW8 A;  3MBY A;  3MAB A;  4DSL A;  4WC7 A;  4WC5 A;  2C2D A;  4F4Z A;  5DBA A;  1BPZ A;  5KFQ A;  2V9W A;  4J9M A;  4F5N A;  2ZTC A;  5J0X A;  1BNP A;  3RH4 A;  4J9N A;  4KN7 A;  1KNY A;  4I2A A;  3ISC A;  4ED1 A;  1S9F A;  1NK5 A;  1ZQK A;  4MFF A;  2HHQ A;  3WFR E;  4F2R A;  7ICV A;  3KHH A;  3C18 A;  3H38 A;  2KZZ A;  4RUC A;  4F3O A;  2AQ4 A;  8ICA A;  4FBT A;  4DOB A;  2BQR A;  7ICG A;  3T5K A;  9ICS A;  1FA0 A;  4F4X A;  4I2B A;  3MFH A;  4RPX A;  1QSS A;  4X0B A;  4YMM A;  4WC3 A;  4RNO A;  4B9U A;  7ICE A;  2JEJ A;  1QTM A;  5L9X A;  4QWA A;  4KLQ A;  3RJK A;  4GC6 A;  1K1Q A;  1Z00 B;  1S0M A;  4NY8 A;  4DL6 A;  4O5C A;  1BVS A;  3GIK A;  3KTQ A;  3GV7 B;  5CP2 A;  3THV A;  1R89 A;  3AQM A;  4J9O A;  4KMU A;  5C5J A;  4UAY A;  4NLG A;  4C8N A;  1TK5 A;  1ZQF A;  5BPC A;  4EZ9 A;  1JN3 A;  3OJU A;  7ICI A;  5J2H A;  4M5D A;  4F92 B;  5HR9 A;  3Q8S B;  2IBK A;  8ICK A;  4B9M A;  4UB5 A;  4I2I A;  4WC2 A;  2BCU A;  4BWM A;  1X9M A;  4YCX A;  4F93 B;  4YR3 A;  3C5F A;  3SI8 A;  1HUO A;  3H8J A;  4YN4 A;  3H40 A;  8ICB A;  2GWS A;  4R64 A;  4FHV A;  4J9R A;  8ICH A;  4M6W B;  2FPL A;  4KLE A;  4ELU A;  1D9F A;  2BHN A;  4O5E A;  1UEV A;  4YD2 A;  5L1J A;  4HYK A;  3PW4 A;  1A76 A;  3PW0 A;  2ZJA A;  3PX4 A;  1SL2 A;  4KLH A;  5KFN A;  2XY6 A;  1NK6 A;  2BCV A;  2IHN A;  3BDP A;  4RQ5 A;  4DEZ A;  3RBD A;  4DS5 A;  1ZQJ A;  5HNK A;  3JPO A;  4ED8 A;  1JXL A;  2VA8 A;  3JZ0 A;  3IM1 A;  5KTQ A;  1U9L A;  3MR6 A;  3PVX A;  1TVA A;  2FMQ A;  4B9V A;  2UVU A;  5KFR A;  3GIL A;  4YR2 A;  5J0T A;  4RWQ A;  5EWG A;  4PH5 A;  3ZDC A;  2P6R A;  2HHU A;  7ICS A;  3UXP A;  2UVR A;  2F1I A;  1SL1 A;  4IRD A;  4I28 A;  1NJX A;  3RJJ A;  3C21 A;  4IRC A;  4DFP A;  5IIN A;  4J9P A;  4ECS A;  3PW5 A;  4QZI A;  2J6U A;  4M0A A;  7ICT A;  5DG8 A;  5J2E A;  3JPQ A;  4UB3 A;  3M9M B;  3BQT A;  3OHB A;  4F5P A;  1JX4 A;  4RNN A;  5DG7 A;  4X4O A;  1EXN A;  4QZB A;  1RYS A;  1UT5 A;  2ZUD A;  5KFD A;  4S3N A;  1S77 D;  5J0W A;  3GV8 B;  5HRK A;  5KFB A;  3GIJ A;  1T4G A;  3Q8R B;  4O3O A;  2DPJ A;  9ICN A;  2XCA A;  7ICQ A;  1RPL A;  2M2V A;  3OUY B;  2PFP A;  2XY7 A;  4KLS A;  2AGQ A;  7ICO A;  4C8M A;  1KFD A;  2FLL A;  4M9N A;  4RPZ A;  4YR0 A;  4DSK A;  1NOM A;  3UXO A;  8ICO A;  4UB1 A;  1ZQP A;  4RPY A;  3KHG A;  2ZH8 A;  2ZJ8 A;  1BPY A;  7ICJ A;  4JWM A;  2XGP A;  3EZ5 A;  9ICF A;  2ZH2 A;  4I2J A;  4XRH A;  3Q8K A;  2XC9 A;  3LWM A;  1TAQ A;  1LV5 A;  4C8L A;  2W8K A;  1DK3 A;  3JYY A;  2W9B A;  5CA7 A;  1BNO A;  8ICY A;  1Y88 A;  4IQT A;  1ZQQ A;  3ZDD A;  1WCL A;  1UA1 A;  5KFA A;  2HVH A;  3LQC B;  4E0D A;  4O5K A;  2M2T A;  3OJS A;  2BPG A;  5J0S A;  4XQ8 A;  3LWL A;  2I9G A;  2M2W A;  9ICP A;  4I27 A;  1WCN A;  5IIO A;  5J2D A;  7ICF A;  3UQ2 A;  3C2K A;  3Q8M A;  3T5L A;  2BCS A;  5F9N A;  3MDC A;  1ZQO A;  8ICM A;  2O5A A;  4PHE A;  2W9C B;  7ICL A;  4R65 A;  1XS9 D;  1ZQE A;  4F5O A;  4QWC A;  5KFY A;  5DDY A;  3RAX A;  1TK8 A;  1RYR A;  5KFT A;  5HRG A;  3PY8 A;  4RQ4 A;  3LK9 A;  2C2R A;  1SL0 A;  4C8K A;  3OVB A;  4NXZ A;  3OVS A;  3AQK A;  3AU6 A;  2XY5 A;  4O3Q A;  4MF8 A;  3N4M B;  2P66 A;  4WC0 A;  2NRW A;  1HUZ A;  3BQ0 A;  2R8K A;  4DFK A;  4TQR A;  4MFC A;  4MFA A;  3RAQ A;  1B43 A;  1U4B A;  4F4Y A;  9ICB A;  5F9L A;  7ICN A;  4QZE A;  1R8C A;  1JQR A;  4ED6 A;  5KG2 A;  4DSE A;  2ZJ5 A;  1N48 A;  3ZDA A;  4ATB B;  2PI5 A;  8ICW A;  4JK1 A;  4X4V A;  1BPE A;  4J9S A;  4KLU A;  2DRB A;  3HJ1 A;  5KFX A;  5HML A;  4RNM A;  2IHM A;  4AT9 B;  2AJQ A;  2A1J A;  1SKS A;  4IG8 A;  3OSP A;  5DBB A;  4X4T A;  3B0Y A;  4QW9 A;  3HWT A;  4RQ3 A;  1ZQS A;  2XO7 A;  1NKE A;  4R8U A;  4XUS A;  4ECV A;  3RB3 A;  1XC9 A;  4ZH4 A;  3PX0 A;  3B0X A;  3BJY A;  4J9Q A;  1NJW A;  4B9N A;  4DLE A;  4QWD A;  3RR7 A;  3BQ1 A;  5J0O A;  2NRV A;  1BPB A;  4RZR A;  5CWR A;  1ZQI A;  1ZQX A;  3ZD9 A;  4I2E A;  9ICH A;  5EWF A;  5HRD A;  4M2Y A;  1ZQM A;  4ECU A;  3UQ0 A;  1N56 A;  4DL3 A;  1YLQ A;  1KSP A;  4WBZ A;  3WFQ E;  4RQ1 A;  3RB0 A;  2PFN A;  1ZQA A;  4F5Q A;  4ED3 A;  1NK8 A;  1PX5 A;  4AT7 A;  1XU4 A;  3FYH A;  4P4O A;  3JPN A;  5IIM A;  3T5H A;  2ZUB A;  5HP4 A;  4ED2 A;  3RR8 A;  4DQI A;  4RQ8 A;  3EPI A;  1L5U A;  2VA3 A;  4M47 A;  2KP7 A;  2BGW A;  4MEX A;  2BE3 A;  3QZ8 A;  5DB7 A;  4F50 A;  3BQ2 A;  5D46 A;  2DR5 A;  2W9A A;  2Y1J A;  3L9D A;  2AQ0 A;  5KG5 A;  3SYZ A;  3MGH A;  2C2E A;  3ORY A;  1KLN A;  4UAW A;  3M8R A;  3WFO A;  2ASJ A;  1ZQB A;  2F1J A;  5DDM A;  1X9W A;  4KIT B;  4X4R A;  1JXE A;  1BPX A;  1ZQG A;  4AT8 A;  7ICR A;  3HJ4 A;  2JZB B;  4QZG A;  5L1K A;  4Q45 A;  4UBC A;  4BXO A;  4Q44 A;  1Q78 A;  5KG6 A;  3PR5 B;  4KLT A;  4EZ6 A;  5DQI A;  5CB1 A;  5III A;  3EYZ A;  9ICE A;  4WC4 A;  4WBY A;  3SV4 A;  2DRA A;  2ZH1 A;  5DLG A;  2ATL A;  2NRT A;  8ICF A;  9ICO A;  1MSW D;  4DF4 A;  3NTU A;  4TUS A;  3PO4 A;  3TQ1 A;  1V4A A;  1S10 A;  4GC7 A;  9ICX A;  4RWN A;  4EBD A;  2KTQ A;  3ZD8 A;  5KT7 A;  1L3T A;  4IR1 A;  2FPK A;  4NLN A;  3C2L A;  5HRB A;  3AU2 A;  3V72 A;  1RZT A;  3RJG A;  4X4U A;  2MUT B;  4FO6 A;  4DOA A;  2ZH6 A;  3HP6 A;  2IA6 A;  4JWN A;  3TAN A;  9ICL A;  4Z6D A;  4QWE A;  3JPP A;  2R8I A;  3EWA A;  1ZJN A;  3OVA A;  2ZH3 A;  7ICH A;  2O1P A;  5J2I A;  3K75 D;  1TK0 A;  9ICV A;  1NK9 A;  3MR5 A;  4CCH A;  8ICS A;  4RQ7 A;  3V6K A;  2R8G A;  3H4D A;  3QEA Z;  4KLD A;  2DPI A;  3AQN A;  2BQU A;  2VA2 A;  4M9H A;  1V9P A;  4P2H A;  8ICL A;  5KFU A;  2IMW P;  4FHX A;  4EP7 A;  2ZTD A;  4M9L A;  4I2H A;  4JV2 A;  3V7J A;  4PHA A;  4YQW A;  4KTQ A;  4ED7 A;  4KLJ A;  5KFS A;  1R8B A;  3C66 A;  4PGX A;  1OU5 A;  1NJY A;  5KFZ A;  2Y1I A;  2BKE A;  1ZQL A;  4E7X A;  1Z00 A;  4TUP A;  2F1H A;  4KLF A;  5J29 A;  4EBJ A;  3C1Y A;  3V6H A;  4YD1 A;  4YG2 A;  4YP3 A;  3RB6 A;  1NKB A;  5L1L A;  1S0V A;  8ICE A;  3GIM A;  8ICU A;  4X4Q A;  4Z6F A;  1ZQN A;  3RBE A;  1ZET A;  1ZQY A;  3MR3 A;  4LZD A;  5KG0 A;  2RDJ A;  5DQH A; 
#chains in the Genus database with same CATH topology
 3I1Y A;  2XGQ A;  5CJ7 A;  1QH9 A;  2NYV A;  2BQ3 A;  2B21 A;  4K4G A;  4DQS A;  5DLF A;  2K4E A;  2L5Y A;  1KTQ A;  4YXJ A;  5D4B A;  3UXN A;  3C2M A;  3OV7 A;  3QE9 Y;  3G6X A;  2HDO A;  2HW3 A;  5IIJ A;  4F4W A;  2FPM A;  3GII A;  2HHS A;  3ER9 B;  4NWI A;  4K4H A;  4UD4 A;  1VLB A;  2XI9 A;  3UMB A;  3M7D A;  4CF4 A;  3T5J A;  4X4N A;  1S0N A;  1PK3 A;  4G9B A;  4C4R A;  1NK4 A;  9ICJ A;  4YVZ A;  1VJ7 A;  4J9K A;  1U47 A;  3TAR A;  4BGD A;  1BPD A;  5HRF A;  5ALD A;  1KFS A;  4IR9 A;  4KX5 A;  3TAQ A;  3ER8 C;  3OUY A;  4DL4 A;  3A0B U;  3QUT A;  1MIW A;  1L3U A;  4FZM A;  1ZYQ A;  5IIK A;  2Q66 A;  5AIA A;  1WYG A;  4QWB A;  3ZDB A;  9ICK A;  4UW9 A;  3E58 A;  4IQU A;  2W7P A;  4EEK A;  3QNM A;  4QZ8 A;  4ECX A;  3TAP A;  2ASD A;  2E8N A;  3HPO A;  2GLE A;  2I1Q A;  2LYH A;  2YTU A;  3VC8 A;  3QU5 A;  5KFC A;  4TUR A;  2PXI A;  1RG6 A;  3RH5 A;  1LB2 B;  2Y0S F;  1L7M A;  4FZN A;  5AI8 A;  1BPZ A;  2MA1 A;  2PFO A;  5ALN A;  3U26 A;  1RM6 C;  2AHO B;  4M9G A;  4O0I A;  4O3M A;  2GA9 D;  1PUZ A;  5ALX A;  3ZDE A;  5JTI A;  5AM5 A;  2F44 A;  5K4L A;  2G5I B;  4DL5 A;  4UAS A;  7ICM A;  2YMM A;  1CUK A;  5FP0 A;  1NJZ A;  2R8J A;  2H5X A;  5G5G A;  3FM9 A;  2NRK A;  4C7Y A;  3RJE A;  5HMM A;  1TAU A;  2FLP A;  1ZQT A;  4EED A;  3ISB A;  4JV0 A;  3C23 A;  3QX7 A;  3SV3 A;  3WKA A;  4DQQ A;  1Q3U A;  4JV1 A;  4YXM A;  8ICP A;  3ED5 A;  1UA0 A;  2OHF A;  5J2G A;  5J0U A;  2HVI A;  1J2M A;  4DSI A;  2JZB A;  3AQL A;  2ZTE A;  1IM4 A;  4DS4 A;  1RYU A;  3OSN A;  2HHX A;  3BQ7 A;  4R8U B;  4GXJ A;  1XO1 A;  4LZG A;  3RRG A;  4X5V A;  4QZ9 A;  5D63 A;  2ZH5 A;  4WQK A;  2MUT A;  3H8S A;  1IXR A;  5KFV A;  4OJO A;  2KFZ A;  2CPR A;  1ZJM A;  2OXO A;  3MGV A;  3BS7 A;  5AKH A;  4EYH B;  3I76 A;  3M9N B;  4DF8 A;  1C7Y A;  1P7D A;  3KKA A;  4XQ7 A;  5KNI A;  1DRG A;  4LT6 A;  3F53 A;  3NGD A;  4Y2Q A;  4DFJ A;  2KFN A;  1GPJ A;  5JUM A;  1D8L A;  2ODG A;  2W9M A;  1NK7 A;  3C5G A;  5DEC A;  4NXT A;  1XNS A;  3EW9 A;  1CRX A;  3RJF A;  2HN1 A;  2Y9U A;  1KDH A;  1T8E A;  1SWW A;  4BX9 C;  2HHP A;  3G6V A;  3D2N A;  5HR7 A;  3V6J A;  5DGB A;  1B22 A;  2CN1 A;  5J0R A;  4PJ0 U;  3JCF A;  2GO7 A;  3MBY A;  4LJX A;  3SAF A;  2C2D A;  5DBA A;  5KFQ A;  1NK5 A;  1YT3 A;  7ICV A;  2ZXH A;  3WK7 A;  3N7S C;  4X0B A;  4RPX A;  1QSS A;  2B56 A;  5L9X A;  4QWA A;  4HAI A;  4U6P A;  4GC6 A;  3RJK A;  4DL6 A;  3GV7 B;  1R89 A;  3FC4 A;  4J9O A;  4UAY A;  1ZQF A;  5BPC A;  1JN3 A;  7ICI A;  4UAV A;  5J2H A;  4F92 B;  2IBK A;  4B9M A;  1X9M A;  3C5F A;  4UB8 U;  3SI8 A;  8ICB A;  4YN4 A;  5AKK A;  2GWS A;  4R64 A;  8ICH A;  3QU7 A;  4KLE A;  4ELU A;  1UEV A;  4O5E A;  5L1J A;  3PSP A;  4F71 A;  1A76 A;  3BZC A;  3PW0 A;  4KLH A;  2XY6 A;  1NK6 A;  4DEZ A;  1ZD2 P;  2HN2 A;  2ZIU B;  3JPO A;  1JXL A;  4EGW A;  1IIP A;  3IM1 A;  5ALF A;  1FO4 A;  5J0T A;  5ALO A;  2HHU A;  7ICS A;  1SL1 A;  3RJJ A;  4DFP A;  4ECS A;  5DG8 A;  2NV3 A;  4UB3 A;  4F5P A;  2EAM A;  4KMO B;  4RNN A;  1EXN A;  1RYS A;  2ZUD A;  5HRK A;  9ICN A;  2HBM A;  1N5X A;  2PFP A;  2XY7 A;  4KLS A;  3EF2 A;  2AGQ A;  3DV9 A;  4RPZ A;  4DSK A;  4UB1 A;  1ZQP A;  4RPY A;  3QU4 A;  1KL9 A;  2ZJ8 A;  2RHF A;  1M6Y A;  1KQQ A;  3H0L B;  3HIL A;  4I2J A;  3Q8K A;  4NLC A;  5ALS A;  2DR7 A;  3JYY A;  2ZIX A;  3AQE A;  1BNO A;  2W9B A;  1Y88 A;  2K4I A;  4J03 A;  3F2D A;  2OCE A;  2HVH A;  2EAP A;  2H3Q A;  2KEY A;  5J0S A;  2ZIW B;  3GU3 A;  9ICP A;  2FDR A;  5IIO A;  3M6Z A;  7ICF A;  3UQ2 A;  1ZQE A;  4F5O A;  4C4S A;  3RAX A;  4NXZ A;  3N4M B;  4TQR A;  1PK1 B;  3RAQ A;  1B43 A;  4F4Y A;  3QUQ A;  3I28 A;  3D2S A;  3C28 A;  4P0P B;  5KG2 A;  3UM9 A;  1FIQ A;  1N48 A;  3IV6 A;  4JK1 A;  2DRB A;  5HML A;  4RNM A;  5AI5 A;  4AT9 B;  2QB0 A;  3EUB 2;  1SKS A;  4IG8 A;  2DUY A;  2IOH A;  3IG5 A;  4JLX A;  2W3S A;  1ZQS A;  1NKE A;  4XUS A;  4DFD A;  3PX0 A;  5JU5 A;  1VDV A;  2M0N A;  3BJY A;  1NJW A;  3BS5 A;  5A0L A;  3NAS A;  5ALY A;  5J0O A;  1BPB A;  4I2E A;  4K98 A;  1ZQM A;  4ECU A;  2PFN A;  3RB0 A;  4F5Q A;  2LPE A;  1XU4 A;  5HP4 A;  5IIM A;  3T5H A;  1L5U A;  2VA3 A;  1L8L A;  3A0H U;  1V85 A;  5KAF U;  1KLN A;  1COK A;  4UAW A;  1ZQB A;  1BPX A;  7ICR A;  3SQI A;  2VIX A;  5AI9 A;  4Q45 A;  2RP5 A;  5DQI A;  5CB1 A;  5III A;  3EYZ A;  5DLG A;  2ATL A;  1O03 A;  4DF4 A;  2D8C A;  4GC7 A;  2YY6 A;  4EBD A;  1L3T A;  1B0X A;  4C4T A;  4NLN A;  3RFA A;  1RZT A;  4X4U A;  2G09 A;  3NVV A;  2ZH6 A;  3HP6 A;  4QWE A;  2R8I A;  7ICH A;  2O1P A;  3MR5 A;  8ICS A;  4RQ7 A;  3V6K A;  3KZX A;  5ALP A;  2BQU A;  4N7R A;  4M9L A;  2BZF A;  3HKZ C;  2KE7 A;  2I5H A;  1FFU A;  3IRU A;  2F1H A;  2G07 A;  3L3F X;  3E0F A;  3RB6 A;  1NKB A;  1S0V A;  2D3D A;  1QQ6 A;  1X6I A;  1ZQN A;  4JLZ A;  3PSF A;  4LZD A;  1HIW A;  5DQH A;  8ICR A;  4NM2 A;  5ALQ A;  2HHW A;  1D9D A;  1JIH A;  4E80 A;  4IQW A;  5T14 A;  1MIV A;  3TFR A;  5KT6 A;  2KVS A;  5CHE A;  5ALR A;  4FE3 A;  1ED1 A;  4OAF A;  1TFR A;  3QEB Z;  3WFS C;  1SXE A;  4R63 A;  3B9J A;  4YMO A;  4GIB A;  5AKL A;  1MA7 A;  3UPS A;  4AP9 A;  5F2V O;  1QCK A;  4OJ6 A;  4G3I A;  1PVQ A;  4Y2Y A;  1RXW A;  5AKZ A;  1COO A;  1UPH A;  4K97 A;  4A8E A;  4UD5 A;  4FO1 A;  4Y2V A;  1KEJ A;  1V38 A;  2OEH A;  4NLZ A;  3ALR A;  5ALM A;  4OAG A;  2K4H A;  1L3S A;  5BOM A;  4IRK A;  2ZH7 A;  5KT5 A;  9ICT A;  2MRL A;  5AKX A;  1HEK A;  4FHP A;  4KLI A;  1RXV A;  3AN1 A;  2K8A A;  3PHZ A;  4C8O A;  4F2S A;  2RFF A;  2ESE A;  1UEU A;  2WF8 A;  3ISD A;  2R18 A;  4RT2 A;  1NKC A;  2ZHB A;  2KNJ A;  5IIL A;  5KFJ A;  4P0Q B;  3UPQ A;  8ICJ A;  2W9C A;  2PI4 A;  3NVW A;  3MFI A;  1ARO P;  4ED0 A;  4PHP A;  3Q8Q B;  3WK5 A;  2W55 A;  1PVR A;  5J2J A;  1H38 A;  3GDX A;  1ZQC A;  2ID1 A;  4Y2U A;  4QZD A;  3K1R B;  1Z4O A;  5EE3 A;  1WWV A;  2CXY A;  5J2A A;  1JRO A;  4B9S A;  1MC8 A;  3N7P D;  3MDA A;  4KLO A;  1VFG A;  1JI7 A;  2ISO A;  1K5O A;  4Q8E A;  5KFL A;  1SKR A;  3CNH A;  3MR2 A;  1S97 A;  4ECR A;  3K1Z A;  5KFE A;  1ZD4 A;  4NL9 A;  1U48 A;  2AU0 A;  4R66 A;  3N97 B;  4EX7 A;  4OJL A;  1N2X A;  1S8O A;  2ZH9 A;  2QB1 A;  2M2U A;  4RQ2 A;  5DKW A;  5F3X B;  2M9N A;  2Q0Z X;  3H8W A;  5HRH A;  3L4P A;  3G6Y A;  2PMZ C;  4KLM A;  4FZL A;  5KFM A;  2DR8 A;  3IP4 B;  5ALL A;  1UT8 A;  2FMP A;  5EOZ A;  1XSP A;  4CGZ A;  2JR5 A;  1UHU A;  4PGQ A;  3PW2 A;  4Q8F A;  1QSL A;  3JPR A;  2EZZ A;  5AM4 A;  4RUA A;  2WAQ C;  8ICC A;  2YB1 A;  2KZ3 A;  3RF9 A;  5KFI A;  2ZUC A;  2WTF A;  1NZB A;  5DB9 A;  1DGS A;  1KN5 A;  8ICG A;  9ICM A;  9ICR A;  1ZQV A;  1X9S A;  2HI0 A;  3MGI A;  5AKG A;  3OHA A;  3Q8P B;  3WKD A;  4EBC A;  4TUQ A;  4OD0 A;  3WKE A;  5KG3 A;  4EEB A;  1XO0 A;  9ICG A;  1KFT A;  5AM3 A;  5HRI A;  2BBJ A;  1X9X A;  5KT3 A;  5J2C A;  1S0O A;  5HHH A;  9ICA A;  2J6T A;  2W11 A;  4O3R A;  4AT8 B;  2HOI A;  2JHD A;  5CHG A;  5HC9 A;  3PR4 A;  5KFW A;  4TQS A;  3TFS A;  4NLK A;  1TV9 A;  4FHW A;  3SMV A;  2B6G A;  4DO9 A;  2MU2 A;  5AM1 A;  1T7P A;  4UBB A;  3F5E A;  2HHV A;  1K1S A;  4KLG A;  2DL0 A;  4UB4 A;  2V9W A;  2ZTC A;  3RH4 A;  5AKI A;  3NKU A;  1F5S A;  3WFR E;  1SV0 A;  3H38 A;  4F3O A;  2AQ4 A;  1ZD3 A;  4DOB A;  4C7Z A;  3T5K A;  4RNO A;  4CE6 A;  2QKQ A;  3AQM A;  5CP2 A;  4Y2P A;  4NLG A;  4C8N A;  4LEV A;  4EZ9 A;  3OJU A;  3H0R B;  4M5D A;  4RQN A;  5HR9 A;  4K96 A;  8ICK A;  2LKY A;  2F77 X;  2BCU A;  2JH7 A;  4BWM A;  4YCX A;  3H8J A;  3NUQ A;  4K99 A;  5EE1 A;  4J9R A;  2HBJ A;  4HYK A;  2DWQ A;  4O67 A;  2ZJA A;  5KFN A;  2IHN A;  3IN5 A;  4EV6 A;  5AIB A;  1ZQJ A;  3UMC A;  2VA8 A;  5GTI U;  4B9V A;  5KTQ A;  1U9L A;  1X6J A;  3PVX A;  4NXV A;  2UVU A;  3GIL A;  4RWQ A;  3LVV A;  3QYP A;  2F1I A;  2H3Z A;  5IIN A;  2J6U A;  4M0A A;  7ICT A;  2LMR A;  5AK6 A;  1ZQ1 C;  5J2E A;  3M9M B;  3BQT A;  4QZB A;  5ALH A;  5J0W A;  3GV8 B;  5KFB A;  3GIJ A;  1T4G A;  4O3O A;  2DPJ A;  1Z4N A;  3OUY B;  4Y2T A;  3VCB A;  2KHQ A;  4C80 A;  4YR0 A;  3UXO A;  1BPY A;  3OWG A;  4JWM A;  4XRH A;  3LWM A;  1LV5 A;  2W03 A;  1WCL A;  1UA1 A;  2I9G A;  4MKP A;  4QIW F;  2ZIV A;  2KSO A;  3T5L A;  1ZQO A;  5AKJ A;  4QWC A;  1TK8 A;  3OVS A;  3AQK A;  3SAG A;  4MF8 A;  2JRZ A;  3AQF A;  4MFC A;  3KBB A;  1U4B A;  9ICB A;  3KFU F;  3SEI A;  4ED6 A;  1O08 A;  4DSE A;  1OUQ A;  2GAF D;  2QAR A;  4IC9 A;  3WK9 A;  1JUD A;  4Y2R A;  3HJ1 A;  2IHM A;  2A1J A;  5ALJ A;  4X4T A;  3HKZ F;  3HWT A;  4RQ3 A;  1SWV A;  4PL1 A;  4ECV A;  5AIC A;  3SAH A;  4B9N A;  3RR7 A;  2K4P A;  4QWD A;  2K89 A;  1KBU A;  4RZR A;  1ZQI A;  3QU9 A;  5TIS U;  9ICH A;  5EWF A;  5HRD A;  4M2Y A;  5CFU A;  4OJP A;  1KSP A;  3CK6 A;  1AQ6 A;  4RQ1 A;  4ED3 A;  4AT7 A;  2DKZ A;  3FYH A;  4DQI A;  4RQ8 A;  4M47 A;  3TAD A;  2BGW A;  5ALT A;  3QZ8 A;  2DR5 A;  2Y1J A;  3L9D A;  1SV0 C;  1DXS A;  3ORY A;  1UQV A;  3CW2 C;  2ASJ A;  4WJ3 B;  3NVZ A;  4X4R A;  2HOQ A;  2N1R A;  3HJ4 A;  2JZB B;  2WB1 C;  4QZG A;  2LYA A;  4BXO A;  3WKC A;  3C29 A;  3PR5 B;  4KLT A;  4EZ6 A;  1PK1 A;  8ICF A;  1LKY A;  1MSW D;  3PO4 A;  1V4A A;  4RWN A;  2AH5 A;  2HCF A;  5KT7 A;  4IR1 A;  5AHX A;  2MUT B;  5JTG A;  3BZK A;  3NRZ A;  4K9B A;  2W7O A;  5J2I A;  3K75 D;  1TK0 A;  3NWI A;  4CCH A;  5KAI U;  3QEA Z;  4KLD A;  3ZI4 A;  4M9H A;  3CYM A;  2F8K A;  4EP7 A;  2ZTD A;  4YQW A;  3C66 A;  4PGX A;  2BKE A;  4E7X A;  1F44 A;  2KK0 A;  1Z00 A;  2B0C A;  4QJF B;  2Y9T A;  2DQN B;  3SD7 A;  4YP3 A;  8ICU A;  4Z6F A;  3RBE A;  4UB6 U;  5AI0 A;  5KG0 A;  4ICA A;  4CDG A;  3SZ2 A;  3V7L A;  3FDS A;  3CRX A;  4B6J A;  3M8S A;  2C28 A;  4M6W A;  2EAO A;  4FS2 A;  4WOY A;  4PZN A;  5J8Y A;  1T94 A;  5D49 A;  2JXJ A;  2ZH1 A;  1SZP A;  2XCP A;  2UVW A;  4FS1 A;  2AXT U;  2HOF A;  2AGP A;  2DBY A;  2PFQ A;  3JPS A;  1DK2 A;  2J6S A;  4DQP A;  3ERC C;  5TZV A;  3TI0 A;  5J0Y A;  4IQV A;  5AM0 A;  3KKA C;  2JGA A;  1U45 A;  5HRE A;  4EX6 A;  3PW7 A;  1LVH A;  4Y2S A;  4RWP A;  2LM4 A;  3PV8 A;  3QXG A;  4EYI B;  5CFS A;  3RJI A;  1MIY A;  4NM1 A;  5HHI A;  5B3P A;  2PMZ F;  3LVW A;  2JEG A;  4P4P A;  8ICX A;  3IG8 A;  2KJ9 A;  4I2F A;  3OTQ A;  2P35 A;  3LDA A;  4CNQ A;  4KN4 A;  1NZP A;  3MC1 A;  4US8 A;  4K4I A;  3HJE A;  4GXK A;  2A19 A;  2WAQ F;  4CF3 A;  4F4K A;  1QQ5 A;  2BCQ A;  1NO5 A;  3RTV A;  3C1Z A;  3PNC A;  1MQ2 A;  2BPF A;  2RDI A;  4E8F A;  2K8B B;  1Q79 A;  4ELV A;  4J9L A;  4DOC A;  4YMN A;  3QZ7 A;  3AUO A;  4B9L A;  2UVV A;  4FH5 A;  4QIW C;  2OYY A;  4DL7 A;  2WHE A;  4AYB F;  1QLN A;  3WK4 A;  2NRX A;  2BBH A;  4EEN A;  4O3S A;  3OPX A;  4HX0 A;  7ICK A;  4ATB A;  1KRP A;  1JAJ A;  5AM2 A;  5KG1 A;  4DFM A;  2VAN A;  2OWO A;  3IDW A;  2W9B B;  1TAM A;  4RWO A;  1N61 A;  5EE0 A;  4CF5 A;  2ZH4 A;  5DG9 A;  2MSN A;  4MEY A;  3R9K A;  3GZF A;  1QQ7 A;  2A1A A;  4LEY A;  1N5W A;  5HR6 A;  4XJE A;  4DSF A;  1MN8 A;  4F5R A;  5KL8 B;  1XSL A;  8ICQ A;  3ETR A;  2EZX A;  4I29 A;  4BJQ A;  5KFH A;  1ZRN A;  4I2C A;  3GFK B;  5ALW A;  4Y2X A;  2W43 A;  1NK0 A;  2DKX A;  3ONN A;  4QZH A;  4Y2J A;  4ECZ A;  1N62 A;  4QZA A;  1F5A A;  2QB0 B;  2RLT A;  3RJH A;  4OJ5 A;  2BPC A;  2CRX A;  2JEI A;  4I2D A;  5ALU A;  4GXI A;  2EAN A;  2ZG6 A;  5KT2 A;  8ICT A;  3PSI A;  3BS5 B;  1TFY A;  3N7R C;  1U49 A;  4Q43 A;  5AK5 A;  4M9J A;  2OM6 A;  4DWI A;  3WK8 A;  4KLL A;  4YFK A;  5J0Q A;  5J8Y C;  2WF5 A;  2YMQ A;  4DLG A;  3KHR A;  2DR9 A;  3DEE A;  2ZHA A;  1L7P A;  1YZ6 A;  2I6X A;  4WC1 A;  4PPX A;  5CR0 A;  3T3F A;  3H0M B;  4FBU A;  5L1M A;  4DSJ A;  4QZF A;  4FH3 A;  4JMU A;  2EQY A;  3RB4 A;  5AK4 A;  1Z3E B;  1OW5 A;  4NKU A;  2WF9 A;  2YX8 A;  3QUC A;  4Z6E A;  3NRW A;  3HW8 A;  4X4P A;  4O3P A;  4KB6 A;  4QW8 A;  3MAB A;  4WC7 A;  4WC5 A;  4F4Z A;  3KOO A;  4F5N A;  2H3V A;  5J0X A;  1BNP A;  4J9N A;  2GH1 A;  3ISC A;  4PL2 A;  1ZQK A;  4MFF A;  2H3F A;  2HHQ A;  3C18 A;  4RUC A;  8ICA A;  4FBT A;  1ZRM A;  1FA0 A;  2FI1 A;  4F4X A;  3MFH A;  4I2B A;  1X40 A;  4WC3 A;  5B5E U;  7ICE A;  4JB3 A;  2EH9 A;  1K1Q A;  4NY8 A;  2WF6 A;  1BVS A;  3GIK A;  3NS1 A;  5C5J A;  4IL6 U;  3O0F A;  4UAT A;  3Q8S B;  4PZO A;  2ES6 A;  4UB5 A;  4WC2 A;  1HUO A;  3H40 A;  4FHV A;  1SL2 A;  3BDP A;  2F2A B;  4I0U A;  2XVT A;  5ALV A;  4RQ5 A;  1FEZ A;  2B51 A;  3RBD A;  2E3T A;  2W54 A;  2B4V A;  3MR6 A;  4NJ8 A;  2HMX A;  5KFR A;  4YR2 A;  3ZDC A;  4PH5 A;  4BUG A;  3UXP A;  3LYS A;  3C21 A;  2HBK A;  4IRC A;  4J9P A;  4QZI A;  2O6K A;  4O68 A;  4NXW A;  1JRP A;  1JX4 A;  4X4O A;  5ALE A;  4S3N A;  3Q8R B;  7ICQ A;  2XCA A;  1RPL A;  2M2V A;  7ICO A;  2JV3 A;  2VJ5 A;  1NOM A;  8ICO A;  2PKE A;  4OAH A;  2ZH8 A;  4CRX A;  3FAH A;  3EZ5 A;  4AYB C;  8ICY A;  4IQT A;  3ZDD A;  5KFA A;  3LQC B;  2BPG A;  2YQE A;  4XQ8 A;  2WB1 F;  3LWL A;  2W3R A;  5J2D A;  3C2K A;  3Q8M A;  8ICM A;  5F9N A;  2O5A A;  7ICL A;  3L5K A;  2F8L A;  2W9C B;  1XS9 D;  5DDY A;  5KFT A;  4RQ4 A;  2C2R A;  3OVB A;  2IOF A;  2XY5 A;  3BQ0 A;  2R8K A;  1B4F A;  4DFK A;  4O6A A;  4MFA A;  3WKB A;  4K9A A;  5F9L A;  7ICN A;  1R8C A;  1WUD A;  1JQR A;  2ZJ5 A;  3ZDA A;  4MHV A;  8ICW A;  4X4V A;  4KLU A;  5KFX A;  2AJQ A;  3DDH A;  3D6J A;  5H2F U;  5GTH U;  3OSP A;  1Z1B A;  4QW9 A;  4R8U A;  3RB3 A;  2XID A;  1N63 A;  4C0Z A;  4KM5 A;  3B0X A;  2LBO A;  4DLE A;  3S6J A;  2NRV A;  1ZQX A;  3WFQ E;  1YLQ A;  3UQ0 A;  4WBZ A;  4UAR A;  2FJ6 A;  1YZ7 A;  1ZQA A;  1CI4 A;  1NK8 A;  1PX5 A;  1ZXI A;  3JPN A;  2ZUB A;  1KW4 A;  4ED2 A;  3RR8 A;  1D8B A;  5DB7 A;  4F50 A;  3BQ2 A;  3HRD D;  5KG5 A;  3MGH A;  2C2E A;  3M8R A;  3WFO A;  5DDM A;  4KIT B;  4KX3 A;  1JXE A;  5L1K A;  2Q4T A;  4Q44 A;  5KG6 A;  4NXX A;  9ICE A;  4WC4 A;  4WBY A;  1V97 A;  3SV4 A;  2DRA A;  2LM1 A;  9ICO A;  2EZY A;  3ZD8 A;  2FPK A;  2WFA A;  1ECW A;  3AU2 A;  4WQL A;  3NVY A;  4DOA A;  4NL9 C;  4EEL A;  4Z6D A;  3JPP A;  1N60 A;  4U7C A;  2KJ5 A;  4DCC A;  3H4D A;  1C20 A;  3AQN A;  8ICL A;  5KFU A;  2IMW P;  4FHX A;  4LEZ A;  4KTQ A;  4ED7 A;  5KFS A;  1OU5 A;  5KFZ A;  1ZQL A;  4TUP A;  5J29 A;  4YG2 A;  2LYB A;  8ICE A;  3GIM A;  1ZQY A;  3MR3 A;  4NXU A;  1GO3 F;  3RH6 A;  2E8M A;  2HSZ A;  4USA A;  3KHL A;  2A3V A;  2KVC A;  2OH2 A;  5ALK A;  1UET A;  3CP8 A;  5D61 A;  4NV0 A;  1ZOL A;  4ECQ A;  2FLN A;  4JUZ A;  4FFD A;  5BOL A;  4F8R A;  4B9T A;  5KFF A;  3V7K A;  2FE9 A;  3IHQ B;  3H7I A;  2ZIU A;  5CEH A;  2KIC A;  5DBC A;  1ZQU A;  3HT3 A;  1L3V A;  7ICU A;  4EBK A;  5C0Y A;  3HIY A;  5J2B A;  2ALZ A;  4RT3 A;  1D8Y A;  5B3Q A;  5EWE A;  1L7N A;  3H4B A;  1Q8K A;  2W8L A;  4EEY A;  2NRZ A;  4EBE A;  3PST A;  2E8P A;  1T3Q A;  2KV2 A;  4UAZ A;  2V4Q A;  3NYB A;  2AGO A;  4ECY A;  1TKD A;  1HJP A;  3OGU A;  2FCL A;  4WCW A;  1X2I A;  1ZQR A;  2IUB A;  9ICU A;  3AM9 A;  1MQ3 A;  5D62 A;  5KFG A;  5J2F A;  7ICP A;  3M1Y A;  1DOQ A;  9ICC A;  3GV5 B;  4X4S A;  2ZIW A;  3GQC A;  2E8O A;  5KFP A;  1SGG A;  3H37 A;  1ZQZ A;  5DED A;  4ECW A;  2KN7 A;  2YMP A;  1L6N A;  4RQM A;  2BR0 A;  2ISP A;  4IS7 A;  3PZP A;  3QU2 A;  2C22 A;  1XWL A;  3PMN A;  1RDF A;  1A77 A;  8ICN A;  5DQG A;  1ZQW A;  4RQ0 A;  3PML A;  2BDU A;  4Z6C A;  5DB8 A;  1JMS A;  2F3N A;  1TE2 A;  2RQ5 A;  3F2C A;  3HX0 A;  4I2G A;  5J0P A;  5EE9 A;  4QNL A;  1Z1V A;  4P0P A;  5ALG A;  1QSY A;  1X66 A;  4AT9 A;  2EDU A;  2KZM A;  2HHT A;  1IV8 A;  4F72 A;  8ICI A;  4O3N A;  3RRH A;  9ICQ A;  3Q8L A;  2ZIV B;  4DQR A;  2KSO B;  5HRL A;  3AMZ A;  1S5L U;  1WG8 A;  2YB4 A;  3N28 A;  5J2K A;  4UQG A;  5KT4 A;  1TFW A;  4NKT A;  2ZXI A;  3WFP A;  2ASL A;  3H39 A;  1R8A A;  5KFK A;  4UB2 A;  4LVS A;  4MF2 A;  2EWR A;  1CEZ A;  1X42 A;  2QAR B;  2PBE A;  1VJ5 A;  2DFL A;  3JPT A;  1JAL A;  1RQN A;  5DGA A;  4XA5 A;  4US9 A;  4BWJ A;  2A1J B;  5DB6 A;  2VJ4 A;  8ICV A;  4WC6 A;  2KG5 A;  4GLX A;  4BDP A;  3K4G A;  4ELT A;  2FMS A;  1DGJ A;  3E2E A;  2V4R A;  4P4M A;  2Y0S C;  5L1I A;  4X0A A;  2YML A;  5KG4 A;  4RQ6 A;  9ICW A;  4O9M A;  1T3N A;  4RU9 A;  9ICI A;  2KMD A;  5KFO A;  3H3A A;  1SKW A;  4ECT A;  4AT7 B;  3ICX A;  1J2N A;  1F0M A;  1ZQH A;  1KKX A;  2HBL A;  3ETL A;  3H8M A;  3M9O B;  4PGY A;  2BDP A;  2JEF A;  5KL1 B;  4FHY A;  2DVI A;  2G08 A;  1Q46 A;  3EPG A;  1PZN A;  1BGX T;  3WU2 U;  1XSN A;  5AKY A;  4DL2 A;  2DGZ A;  1WOT A;  3PO5 A;  1SB3 C;  3PX6 A;  2QLT A;  4BXO B;  2DF4 B;  2MAX A;  4QZC A;  3MCR A;  3SEN A;  5KG7 A;  4M04 A;  2R8H A;  4PHD A;  3M6K A;  1SXD A;  1LKY B;  8ICZ A;  2KKV A;  2P6U A;  2WF7 A;  4F91 B;  2BCR A;  1ZQD A;  2YN4 A;  1WWU A;  4DSL A;  1J97 A;  4J9M A;  1PVP A;  4KN7 A;  1KNY A;  4I2A A;  4ED1 A;  1S9F A;  4F2R A;  3F2B A;  3KHH A;  2IOF K;  2KZZ A;  2E1E A;  2BQR A;  5CFT A;  7ICG A;  9ICS A;  5ALI A;  4YMM A;  4B9U A;  2JEJ A;  1QTM A;  4KLQ A;  1ZD5 A;  2K8C B;  1Z00 B;  2KOB A;  1S0M A;  4O5C A;  3KTQ A;  3THV A;  3TAD C;  4KMU A;  4UAU A;  1TK5 A;  1SV4 A;  4K8V A;  2ZIX B;  4I2I A;  1A6S A;  4F93 B;  4YR3 A;  2LHT A;  4M6W B;  2FPL A;  1D9F A;  4OAI Z;  2BHN A;  2XIC A;  4YD2 A;  3PW4 A;  3PX4 A;  2BCV A;  2W04 A;  5B66 U;  1NI3 A;  4DS5 A;  5HNK A;  1URJ A;  4ED8 A;  3JZ0 A;  2FMQ A;  1TVA A;  5EWG A;  2P6R A;  2KIV A;  1Z19 A;  2UVR A;  4IRD A;  4I28 A;  1NJX A;  5ALZ A;  3PW5 A;  4P0Q A;  3JPQ A;  3OHB A;  5DG7 A;  1FFV A;  1UT5 A;  5KFD A;  1S77 D;  4NLB A;  1RQL A;  1SIJ A;  4C8M A;  1KFD A;  2FLL A;  4M9N A;  2G5H B;  5E79 U;  2NO4 A;  3KHG A;  7ICJ A;  3AL0 B;  2NO5 A;  2XGP A;  3AEV A;  9ICF A;  2ZH2 A;  2XC9 A;  1DK3 A;  1TAQ A;  4C8L A;  2W8K A;  5CA7 A;  2VKQ A;  1ZQQ A;  4GFJ A;  1A0P A;  4E0D A;  4O5K A;  2M2T A;  3OJS A;  2M2W A;  3D2Q A;  5JRT A;  4I27 A;  1NNL A;  1WCN A;  3UMG A;  1SZH A;  2F76 X;  2BCS A;  3MDC A;  2GOL A;  4PHE A;  4R65 A;  5KFY A;  1RYR A;  5HRG A;  3PY8 A;  3LK9 A;  4C8K A;  4OO1 J;  2IHO A;  3AU6 A;  2H3I A;  4O3Q A;  2P66 A;  4WC0 A;  2NRW A;  1HUZ A;  1L8O A;  4QZE A;  4ATB B;  2KJ8 A;  2PI5 A;  1BPE A;  4J9S A;  3F5A A;  3T79 A;  5DBB A;  3B0Y A;  2K60 A;  4WH5 A;  2XO7 A;  1XC9 A;  5AK3 A;  2G0A A;  4ZH4 A;  5AI4 A;  4J9Q A;  3BQ1 A;  5CWR A;  5AKE A;  3K7D A;  3ZD9 A;  2Z7J A;  3KZI U;  3TKA A;  4ACO A;  3NVO A;  3SR6 A;  1N56 A;  4DL3 A;  2D6F C;  4P4O A;  1S76 D;  1L7O A;  2KIW A;  3EPI A;  2KP7 A;  2BE3 A;  4MEX A;  2JMG A;  5D46 A;  3J81 j;  2W9A A;  2AQ0 A;  3SYZ A;  2KD1 A;  2LI6 A;  2F1J A;  1X9W A;  2KHV A;  1ZQG A;  4AT8 A;  4LEW A;  3KD3 A;  2E1F A;  4UBC A;  1Q78 A;  4OCZ A;  2E5S A;  2JH1 A;  2NRT A;  3NTU A;  4TUS A;  3TQ1 A;  1S10 A;  9ICX A;  2KTQ A;  3TAC B;  3C2L A;  5HRB A;  4O69 A;  2RRD A;  2KKP A;  3V72 A;  3RJG A;  4ZOH C;  5AI6 A;  4FO6 A;  2IA6 A;  4JWN A;  3TAN A;  9ICL A;  1ZJN A;  3EWA A;  3OVA A;  2ZH3 A;  9ICV A;  1NK9 A;  1IG6 A;  2R8G A;  2G06 A;  2DPI A;  2VA2 A;  1V9P A;  4P2H A;  3WK6 A;  4I2H A;  4JV2 A;  3V7J A;  4PHA A;  4KLJ A;  1R8B A;  1Q3V A;  1NJY A;  2Y1I A;  3QUB A;  4KLF A;  1OXJ A;  4EBJ A;  3C1Y A;  3V6H A;  4YD1 A;  5CRX A;  5L1L A;  4X4Q A;  5G5H A;  1ZET A;  1UCV A;  2RDJ A;  1SL0 A; 
#chains in the Genus database with same CATH homology
 3RH6 A;  8ICR A;  4NM2 A;  2XGQ A;  5CJ7 A;  2HHW A;  1D9D A;  2BQ3 A;  1JIH A;  2B21 A;  4K4G A;  3KHL A;  3SZ2 A;  4DQS A;  5DLF A;  1KTQ A;  4YXJ A;  4IQW A;  3V7L A;  3UXN A;  5D4B A;  1UET A;  3FDS A;  3C2M A;  4E80 A;  3OV7 A;  1MIV A;  3QE9 Y;  3G6X A;  3M8S A;  3TFR A;  2C28 A;  4M6W A;  4ECQ A;  5KT6 A;  4FS2 A;  2FLN A;  5D49 A;  4JUZ A;  2HW3 A;  5BOL A;  4F8R A;  4B9T A;  5IIJ A;  5KFF A;  3V7K A;  1TFR A;  4F4W A;  3QEB Z;  1SZP A;  2FPM A;  2XCP A;  2UVW A;  3GII A;  4FS1 A;  3WFS C;  3IHQ B;  4R63 A;  3H7I A;  4YMO A;  2HHS A;  3UPS A;  2AGP A;  5F2V O;  4K4H A;  2PFQ A;  4UD4 A;  4G3I A;  5DBC A;  3JPS A;  1ZQU A;  3HT3 A;  1L3V A;  7ICU A;  1DK2 A;  2J6S A;  3T5J A;  4DQP A;  5TZV A;  4EBK A;  3HIY A;  4X4N A;  5J2B A;  2ALZ A;  1S0N A;  3TI0 A;  1RXW A;  5J0Y A;  4IQV A;  1COO A;  4RT3 A;  1D8Y A;  1U45 A;  5EWE A;  1NK4 A;  9ICJ A;  5HRE A;  4UD5 A;  4YVZ A;  1VJ7 A;  4J9K A;  1U47 A;  1KEJ A;  3PW7 A;  4RWP A;  3H4B A;  3TAR A;  4BGD A;  1BPD A;  4NLZ A;  5HRF A;  1KFS A;  3PV8 A;  4IR9 A;  2W8L A;  3TAQ A;  2DR7 A;  4EYI B;  4EEY A;  3OUY A;  4DL4 A;  2NRZ A;  3RJI A;  1L3S A;  5BOM A;  4EBE A;  4IRK A;  1MIW A;  1MIY A;  2ZH7 A;  5KT5 A;  1L3U A;  9ICT A;  4NM1 A;  5HHI A;  3NYB A;  4UAZ A;  2V4Q A;  1ZYQ A;  2AGO A;  4ECY A;  5IIK A;  2Q66 A;  1TKD A;  3ZDB A;  4QWB A;  4KLI A;  2JEG A;  9ICK A;  4P4P A;  1HJP A;  4FHP A;  3OGU A;  1RXV A;  8ICX A;  4IQU A;  4WCW A;  1X2I A;  1ZQR A;  4C8O A;  4QZ8 A;  4F2S A;  4I2F A;  1MQ3 A;  9ICU A;  5KFG A;  2RFF A;  5J2F A;  4ECX A;  7ICP A;  1UEU A;  3TAP A;  1DOQ A;  3LDA A;  9ICC A;  4KN4 A;  3GV5 B;  2ASD A;  3ISD A;  4RT2 A;  1NZP A;  3HPO A;  1NKC A;  2ZHB A;  4K4I A;  4X4S A;  4GXK A;  2I1Q A;  3GQC A;  2LYH A;  5KFP A;  4F4K A;  5IIL A;  3H37 A;  5KFC A;  5KFJ A;  1ZQZ A;  4TUR A;  2BCQ A;  1NO5 A;  3RTV A;  2KN7 A;  3C1Z A;  3UPQ A;  4ECW A;  8ICJ A;  3PNC A;  2BR0 A;  5DED A;  2W9C A;  1MQ2 A;  2BPF A;  2ISP A;  2PI4 A;  2RDI A;  3MFI A;  1ARO P;  2PXI A;  4PHP A;  4ED0 A;  4E8F A;  3Q8Q B;  3RH5 A;  2C22 A;  1XWL A;  1Q79 A;  3PMN A;  1LB2 B;  1A77 A;  8ICN A;  5DQG A;  1ZQW A;  5J2J A;  4RQ0 A;  3PML A;  1H38 A;  4J9L A;  4DOC A;  3GDX A;  4YMN A;  4Z6C A;  5DB8 A;  3QZ7 A;  4QZD A;  3AUO A;  1ZQC A;  2PFO A;  2UVV A;  4B9L A;  2ID1 A;  4FH5 A;  1JMS A;  4DL7 A;  1QLN A;  3HX0 A;  4I2G A;  5J2A A;  5J0P A;  4B9S A;  1MC8 A;  2NRX A;  3MDA A;  4M9G A;  4KLO A;  1VFG A;  4O0I A;  4O3S A;  2ISO A;  4Q8E A;  7ICK A;  5KFL A;  4ATB A;  1SKR A;  1KRP A;  1JAJ A;  3MR2 A;  1QSY A;  1S97 A;  4ECR A;  4AT9 A;  5KG1 A;  4DFM A;  3ZDE A;  5KFE A;  2VAN A;  2OWO A;  2HHT A;  2W9B B;  2KZM A;  4DL5 A;  1U48 A;  2AU0 A;  7ICM A;  4RWO A;  1CUK A;  1NJZ A;  2R8J A;  8ICI A;  5DG9 A;  2ZH4 A;  4R66 A;  4O3N A;  3N97 B;  2H5X A;  4MEY A;  3RRH A;  9ICQ A;  3Q8L A;  4DQR A;  2ZH9 A;  2M2U A;  5HRL A;  2NRK A;  3RJE A;  5HMM A;  5J2K A;  4DSF A;  4RQ2 A;  5DKW A;  4UQG A;  1TAU A;  2M9N A;  5KT4 A;  1TFW A;  4F5R A;  2FLP A;  2Q0Z X;  1XSL A;  3H8W A;  1ZQT A;  3ISB A;  4JV0 A;  8ICQ A;  5HRH A;  3G6Y A;  3C23 A;  4ELV A;  4NKT A;  4KLM A;  4I29 A;  5KFH A;  3SV3 A;  4I2C A;  4DQQ A;  3GFK B;  5KFM A;  2DR8 A;  3WFP A;  2ASL A;  4JV1 A;  4YXM A;  8ICP A;  1UT8 A;  1NK0 A;  2FMP A;  5EOZ A;  1XSP A;  3H39 A;  1UA0 A;  1R8A A;  5KFK A;  5J2G A;  4UB2 A;  4LVS A;  4MF2 A;  1CEZ A;  5J0U A;  4PGQ A;  4QZH A;  3PW2 A;  4Q8F A;  2HVI A;  2PBE A;  1QSL A;  4ECZ A;  2DFL A;  3JPR A;  3JPT A;  4DSI A;  5DGA A;  4QZA A;  4RUA A;  2JZB A;  4XA5 A;  1F5A A;  4BWJ A;  2A1J B;  3AQL A;  8ICC A;  5DB6 A;  3RJH A;  2ZTE A;  1IM4 A;  2BPC A;  2KZ3 A;  5KFI A;  2WTF A;  2ZUC A;  4DS4 A;  4I2D A;  2JEI A;  4GLX A;  8ICV A;  4WC6 A;  4GXI A;  3OSN A;  4BDP A;  2HHX A;  3K4G A;  5DB9 A;  4ELT A;  2FMS A;  4R8U B;  5KT2 A;  1DGS A;  4GXJ A;  8ICT A;  3E2E A;  8ICG A;  9ICM A;  2V4R A;  4P4M A;  1XO1 A;  5L1I A;  9ICR A;  4X0A A;  4LZG A;  3RRG A;  5KG4 A;  1ZQV A;  4RQ6 A;  4X5V A;  9ICW A;  4QZ9 A;  1X9S A;  1TFY A;  4O9M A;  1T3N A;  1U49 A;  2ZH5 A;  4RU9 A;  9ICI A;  4Q43 A;  2MUT A;  3H8S A;  5KFO A;  3MGI A;  4M9J A;  1IXR A;  5KFV A;  1SKW A;  3OHA A;  3Q8P B;  2KFZ A;  3H3A A;  1ZJM A;  4ECT A;  4DWI A;  4AT7 B;  4EBC A;  4TUQ A;  4EYH B;  4DF8 A;  3M9N B;  1C7Y A;  1ZQH A;  4KLL A;  4YFK A;  5KG3 A;  5J0Q A;  4XQ7 A;  3ETL A;  3M9O B;  4FHY A;  4PGY A;  2BDP A;  2JEF A;  9ICG A;  1KFT A;  4LT6 A;  2DVI A;  5HRI A;  4DLG A;  3EPG A;  1PZN A;  3KHR A;  3NGD A;  5KT3 A;  1BGX T;  1XSN A;  5J2C A;  2ZHA A;  1S0O A;  4DL2 A;  2DR9 A;  4DFJ A;  5HHH A;  9ICA A;  2KFN A;  2J6T A;  4WC1 A;  4O3R A;  4PPX A;  1WOT A;  5CR0 A;  3T3F A;  3PO5 A;  4AT8 B;  5JUM A;  4FBU A;  1D8L A;  4DSJ A;  2W9M A;  3PX6 A;  4BXO B;  5CHG A;  4QZF A;  3PR4 A;  5HC9 A;  1NK7 A;  4FH3 A;  5KFW A;  4TQS A;  3C5G A;  2MAX A;  5DEC A;  4QZC A;  3TFS A;  5KG7 A;  4M04 A;  4NLK A;  1TV9 A;  4FHW A;  2R8H A;  4PHD A;  3EW9 A;  4DO9 A;  3RJF A;  8ICZ A;  3RB4 A;  1KDH A;  1T8E A;  1Z3E B;  1T7P A;  2P6U A;  4UBB A;  1S76 D;  4F91 B;  4NKU A;  2HHP A;  3G6V A;  4Z6E A;  3V6J A;  5DGB A;  2BCR A;  2HHV A;  1K1S A;  1ZQD A;  3HW8 A;  1B22 A;  4X4P A;  4O3P A;  4KLG A;  5J0R A;  4UB4 A;  4QW8 A;  3MBY A;  3MAB A;  4DSL A;  4WC7 A;  4WC5 A;  2C2D A;  4F4Z A;  5DBA A;  1BPZ A;  5KFQ A;  2V9W A;  4J9M A;  4F5N A;  2ZTC A;  5J0X A;  1BNP A;  3RH4 A;  4J9N A;  4KN7 A;  1KNY A;  4I2A A;  3ISC A;  4ED1 A;  1S9F A;  1NK5 A;  1ZQK A;  4MFF A;  2HHQ A;  3WFR E;  4F2R A;  7ICV A;  3KHH A;  3C18 A;  3H38 A;  2KZZ A;  4RUC A;  4F3O A;  2AQ4 A;  8ICA A;  4FBT A;  4DOB A;  2BQR A;  7ICG A;  3T5K A;  9ICS A;  1FA0 A;  4F4X A;  4I2B A;  3MFH A;  4RPX A;  1QSS A;  4X0B A;  4YMM A;  4WC3 A;  4RNO A;  4B9U A;  7ICE A;  2JEJ A;  1QTM A;  5L9X A;  4QWA A;  4KLQ A;  3RJK A;  4GC6 A;  1K1Q A;  1Z00 B;  1S0M A;  4NY8 A;  4DL6 A;  4O5C A;  1BVS A;  3GIK A;  3KTQ A;  3GV7 B;  5CP2 A;  3THV A;  1R89 A;  3AQM A;  4J9O A;  4KMU A;  5C5J A;  4UAY A;  4NLG A;  4C8N A;  1TK5 A;  1ZQF A;  5BPC A;  4EZ9 A;  1JN3 A;  3OJU A;  7ICI A;  5J2H A;  4M5D A;  4F92 B;  5HR9 A;  3Q8S B;  2IBK A;  8ICK A;  4B9M A;  4UB5 A;  4I2I A;  4WC2 A;  2BCU A;  4BWM A;  1X9M A;  4YCX A;  4F93 B;  4YR3 A;  3C5F A;  3SI8 A;  1HUO A;  3H8J A;  4YN4 A;  3H40 A;  8ICB A;  2GWS A;  4R64 A;  4FHV A;  4J9R A;  8ICH A;  4M6W B;  2FPL A;  4KLE A;  4ELU A;  1D9F A;  2BHN A;  4O5E A;  1UEV A;  4YD2 A;  5L1J A;  4HYK A;  3PW4 A;  1A76 A;  3PW0 A;  2ZJA A;  3PX4 A;  1SL2 A;  4KLH A;  5KFN A;  2XY6 A;  1NK6 A;  2BCV A;  2IHN A;  3BDP A;  4RQ5 A;  4DEZ A;  3RBD A;  4DS5 A;  1ZQJ A;  5HNK A;  3JPO A;  4ED8 A;  1JXL A;  2VA8 A;  3JZ0 A;  3IM1 A;  5KTQ A;  1U9L A;  3MR6 A;  3PVX A;  1TVA A;  2FMQ A;  4B9V A;  2UVU A;  5KFR A;  3GIL A;  4YR2 A;  5J0T A;  4RWQ A;  5EWG A;  4PH5 A;  3ZDC A;  2P6R A;  2HHU A;  7ICS A;  3UXP A;  2UVR A;  2F1I A;  1SL1 A;  4IRD A;  4I28 A;  1NJX A;  3RJJ A;  3C21 A;  4IRC A;  4DFP A;  5IIN A;  4J9P A;  4ECS A;  3PW5 A;  4QZI A;  2J6U A;  4M0A A;  7ICT A;  5DG8 A;  5J2E A;  3JPQ A;  4UB3 A;  3M9M B;  3BQT A;  3OHB A;  4F5P A;  1JX4 A;  4RNN A;  5DG7 A;  4X4O A;  1EXN A;  4QZB A;  1RYS A;  1UT5 A;  2ZUD A;  5KFD A;  4S3N A;  1S77 D;  5J0W A;  3GV8 B;  5HRK A;  5KFB A;  3GIJ A;  1T4G A;  3Q8R B;  4O3O A;  2DPJ A;  9ICN A;  2XCA A;  7ICQ A;  1RPL A;  2M2V A;  3OUY B;  2PFP A;  2XY7 A;  4KLS A;  2AGQ A;  7ICO A;  4C8M A;  1KFD A;  2FLL A;  4M9N A;  4RPZ A;  4YR0 A;  4DSK A;  1NOM A;  3UXO A;  8ICO A;  4UB1 A;  1ZQP A;  4RPY A;  3KHG A;  2ZH8 A;  2ZJ8 A;  1BPY A;  7ICJ A;  4JWM A;  2XGP A;  3EZ5 A;  9ICF A;  2ZH2 A;  4I2J A;  4XRH A;  3Q8K A;  2XC9 A;  3LWM A;  1TAQ A;  1LV5 A;  4C8L A;  2W8K A;  1DK3 A;  3JYY A;  2W9B A;  5CA7 A;  1BNO A;  8ICY A;  1Y88 A;  4IQT A;  1ZQQ A;  3ZDD A;  1WCL A;  1UA1 A;  5KFA A;  2HVH A;  3LQC B;  4E0D A;  4O5K A;  2M2T A;  3OJS A;  2BPG A;  5J0S A;  4XQ8 A;  3LWL A;  2I9G A;  2M2W A;  9ICP A;  4I27 A;  1WCN A;  5IIO A;  5J2D A;  7ICF A;  3UQ2 A;  3C2K A;  3Q8M A;  3T5L A;  2BCS A;  5F9N A;  3MDC A;  1ZQO A;  8ICM A;  2O5A A;  4PHE A;  2W9C B;  7ICL A;  4R65 A;  1XS9 D;  1ZQE A;  4F5O A;  4QWC A;  5KFY A;  5DDY A;  3RAX A;  1TK8 A;  1RYR A;  5KFT A;  5HRG A;  3PY8 A;  4RQ4 A;  3LK9 A;  2C2R A;  1SL0 A;  4C8K A;  3OVB A;  4NXZ A;  3OVS A;  3AQK A;  3AU6 A;  2XY5 A;  4O3Q A;  4MF8 A;  3N4M B;  2P66 A;  4WC0 A;  2NRW A;  1HUZ A;  3BQ0 A;  2R8K A;  4DFK A;  4TQR A;  4MFC A;  4MFA A;  3RAQ A;  1B43 A;  1U4B A;  4F4Y A;  9ICB A;  5F9L A;  7ICN A;  4QZE A;  1R8C A;  1JQR A;  4ED6 A;  5KG2 A;  4DSE A;  2ZJ5 A;  1N48 A;  3ZDA A;  4ATB B;  2PI5 A;  8ICW A;  4JK1 A;  4X4V A;  1BPE A;  4J9S A;  4KLU A;  2DRB A;  3HJ1 A;  5KFX A;  5HML A;  4RNM A;  2IHM A;  4AT9 B;  2AJQ A;  2A1J A;  1SKS A;  4IG8 A;  3OSP A;  5DBB A;  4X4T A;  3B0Y A;  4QW9 A;  3HWT A;  4RQ3 A;  1ZQS A;  2XO7 A;  1NKE A;  4R8U A;  4XUS A;  4ECV A;  3RB3 A;  1XC9 A;  4ZH4 A;  3PX0 A;  3B0X A;  3BJY A;  4J9Q A;  1NJW A;  4B9N A;  4DLE A;  4QWD A;  3RR7 A;  3BQ1 A;  5J0O A;  2NRV A;  1BPB A;  4RZR A;  5CWR A;  1ZQI A;  1ZQX A;  3ZD9 A;  4I2E A;  9ICH A;  5EWF A;  5HRD A;  4M2Y A;  1ZQM A;  4ECU A;  3UQ0 A;  1N56 A;  4DL3 A;  1YLQ A;  1KSP A;  4WBZ A;  3WFQ E;  4RQ1 A;  3RB0 A;  2PFN A;  1ZQA A;  4F5Q A;  4ED3 A;  1NK8 A;  1PX5 A;  4AT7 A;  1XU4 A;  3FYH A;  4P4O A;  3JPN A;  5IIM A;  3T5H A;  2ZUB A;  5HP4 A;  4ED2 A;  3RR8 A;  4DQI A;  4RQ8 A;  3EPI A;  1L5U A;  2VA3 A;  4M47 A;  2KP7 A;  2BGW A;  4MEX A;  2BE3 A;  3QZ8 A;  5DB7 A;  4F50 A;  3BQ2 A;  5D46 A;  2DR5 A;  2W9A A;  2Y1J A;  3L9D A;  2AQ0 A;  5KG5 A;  3SYZ A;  3MGH A;  2C2E A;  3ORY A;  1KLN A;  4UAW A;  3M8R A;  3WFO A;  2ASJ A;  1ZQB A;  2F1J A;  5DDM A;  1X9W A;  4KIT B;  4X4R A;  1JXE A;  1BPX A;  1ZQG A;  4AT8 A;  7ICR A;  3HJ4 A;  2JZB B;  4QZG A;  5L1K A;  4Q45 A;  4UBC A;  4BXO A;  4Q44 A;  1Q78 A;  5KG6 A;  3PR5 B;  4KLT A;  4EZ6 A;  5DQI A;  5CB1 A;  5III A;  3EYZ A;  9ICE A;  4WC4 A;  4WBY A;  3SV4 A;  2DRA A;  2ZH1 A;  5DLG A;  2ATL A;  2NRT A;  8ICF A;  9ICO A;  1MSW D;  4DF4 A;  3NTU A;  4TUS A;  3PO4 A;  3TQ1 A;  1V4A A;  1S10 A;  4GC7 A;  9ICX A;  4RWN A;  4EBD A;  2KTQ A;  3ZD8 A;  5KT7 A;  1L3T A;  4IR1 A;  2FPK A;  4NLN A;  3C2L A;  5HRB A;  3AU2 A;  3V72 A;  1RZT A;  3RJG A;  4X4U A;  2MUT B;  4FO6 A;  4DOA A;  2ZH6 A;  3HP6 A;  2IA6 A;  4JWN A;  3TAN A;  9ICL A;  4Z6D A;  4QWE A;  3JPP A;  2R8I A;  3EWA A;  1ZJN A;  3OVA A;  2ZH3 A;  7ICH A;  2O1P A;  5J2I A;  3K75 D;  1TK0 A;  9ICV A;  1NK9 A;  3MR5 A;  4CCH A;  8ICS A;  4RQ7 A;  3V6K A;  2R8G A;  3H4D A;  3QEA Z;  4KLD A;  2DPI A;  3AQN A;  2BQU A;  2VA2 A;  4M9H A;  1V9P A;  4P2H A;  8ICL A;  5KFU A;  2IMW P;  4FHX A;  4EP7 A;  2ZTD A;  4M9L A;  4I2H A;  4JV2 A;  3V7J A;  4PHA A;  4YQW A;  4KTQ A;  4ED7 A;  4KLJ A;  5KFS A;  1R8B A;  3C66 A;  4PGX A;  1OU5 A;  1NJY A;  5KFZ A;  2Y1I A;  2BKE A;  1ZQL A;  4E7X A;  1Z00 A;  4TUP A;  2F1H A;  4KLF A;  5J29 A;  4EBJ A;  3C1Y A;  3V6H A;  4YD1 A;  4YG2 A;  4YP3 A;  3RB6 A;  1NKB A;  5L1L A;  1S0V A;  8ICE A;  3GIM A;  8ICU A;  4X4Q A;  4Z6F A;  1ZQN A;  3RBE A;  1ZET A;  1ZQY A;  3MR3 A;  4LZD A;  5KG0 A;  2RDJ A;  5DQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...