4O5CA

Structure of human dna polymerase complexed with n7-mg as the template base in a 1-nucleotide gapped dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5cA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5cA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5cA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5cA03
1UEUA 4JUZA 1CUKA 2HHQA 4X5VA 5KTQA 4O3RA 2DVIA 4MF2A 3PMLA 2V4RA 1RPLA 4KN7A 4C8KA 4YCXA 2XO7A 5J2KA 4YR3A 4TQSA 3OUYA 4DQSA 3PO5A 9ICKA 3TARA 1WCNA 9ICWA 3PR4A 3Q8KA 3JPRA 4IR1A 4KITB 4J9RA 3RH6A 1NK8A 1MQ3A 4XA5A 4O5EA 4F4XA 3KHLA 4F4KA 2OWOA 2W8LA 4ELUA 4MFAA 4YD2A 5J2IA 1NJZA 3PW7A 3HJ1A 4AT7A 5JUMA 4LVSA 3RRGA 5J0PA 8ICWA 2HHSA 4C8MA 5KG4A 3GILA 1Z00B 2BCVA 3V72A 1N56A 1NK7A 3QE9Y 5HRFA 2R8JA 3ORYA 4KLQA 4K4GA 4O5KA 7ICRA 1L3UA 4UAYA 5KFQA 5HR9A 5J2AA 1V4AA 1U4BA 4TURA 3GV8B 4RUAA 4J9QA 1UA0A 2IBKA 4C8NA 5TZVA 5DGAA 4DF8A 2NRKA 2P6UA 1WOTA 1T3NA 5HREA 2PFQA 1XU4A 5KG5A 3KHRA 3H38A 4O0IA 4WC0A 2M9NA 3QEBZ 2BCSA 1Q79A 2KFNA 2KFZA 3MR3A 1DOQA 1BVSA 3H8WA 3T5HA 4CCHA 4WC7A 3TAQA 4UB2A 4J9NA 3BQTA 5KFUA 4F5NA 1HUZA 2BR0A 1TFWA 2IMWP 4O3OA 5HC9A 4TUSA 4B9MA 4PGXA 3WFQE 1BNOA 2FLPA 2ZHAA 1JX4A 4R64A 4DSJA 2O1PA 5KFAA 3H7IA 5HHHA 4X4RA 3Q8QB 1NOMA 4IQVA 1BPXA 4I2DA 7ICIA 5J2JA 4ELTA 3BQ1A 3LDAA 4BDPA 2FLNA 4P4MA 3EYZA 4QWEA 1D8YA 2FMQA 2VA3A 4KLSA 9ICBA 2ALZA 9ICIA 3M9OB 4KLFA 2DR8A 4DL6A 1L5UA 8ICKA 1COOA 1L3VA 2BPCA 3M9MB 2HHUA 2C28A 2A1JB 5HHIA 4R8UB 3MBYA 4ECUA 1D9DA 3OJUA 9ICXA 1ZQZA 4M9GA 2JEGA 5KFIA 4F8RA 4G3IA 7ICNA 4S3NA 4ED7A 5DB8A 4F4WA 4EBEA 2AGQA 2BPFA 1XS9D 4QZCA 2KZ3A 3Q8SB 9ICEA 1Q78A 2AU0A 4UB1A 4YFKA 3QZ8A 1JXLA 9ICGA 9ICTA 4RWNA 2NRXA 4RU9A 2XCAA 5IIKA 3C5GA 1TFYA 4DFPA 4KN4A 5KFOA 1DGSA 3ISBA 3LWLA 2BCUA 1UT5A 4RQ3A 9ICHA 5HMMA 5DBAA 4F4ZA 4ELVA 5D46A 4RQ6A 5KG0A 3ZDAA 4E0DA 3C23A 4ECTA 2JEIA 1JIHA 1JXEA 5J0XA 3ZDCA 3H4DA 2W9MA 4DEZA 3RB3A 4MFCA 3OUYB 5L9XA 4Z6EA 8ICLA 3AQLA 1RYRA 1QSYA 5EWEA 4QWAA 1ZQOA 1ZQUA 4RQ7A 5HP4A 3GIIA 1SKSA 4PPXA 3H8SA 4B9NA 1Y88A 2XY5A 1UETA 4UQGA 4ECVA 1NK5A 4O3QA 3NYBA 4Q45A 1ZQMA 2J6SA 1S97A 4F3OA 4O3SA 3OHAA 3OV7A 5DG8A 4PH5A 3THVA 4O9MA 1S0OA 4KLIA 4NY8A 4NLZA 1ZQQA 4X4QA 4R65A 2HHTA 4RQ8A 8ICZA 5C5JA 2W8KA 5DLFA 1ZETA 5KFTA 1NJWA 3HIYA 2C2RA 3M9NB 5KFWA 4P4OA 4F91B 3HT3A 4RNMA 4F93B 5L1JA 5DG7A 4I2BA 3BQ0A 4YN4A 5J0RA 9ICNA 2NRVA 2FPKA 4GLXA 5DECA 1ZQXA 1KRPA 4EBDA 3PO4A 4DL3A 3JPSA 4EBCA 1X9SA 9ICFA 1DK2A 1KEJA 5BOMA 2W9BA 1VJ7A 4DS5A 4DFMA 2JEFA 2PI4A 2XGQA 4M9JA 4LZDA 5CHGA 4P2HA 2Y1IA 8ICGA 8ICSA 3ZDBA 4IQTA 1ZQHA 1DK3A 1XC9A 4ED1A 4YR2A 3TI0A 1B22A 5KFGA 4PHPA 3RB6A 2J6TA 2W9AA 5IIMA 3PW2A 5DBBA 4QZBA 1X9MA 5DB9A 1ZQDA 9ICLA 1N48A 7ICEA 4QW8A 3RH5A 4BXOA 4WC2A 3SYZA 4RWOA 5J0YA 5IILA 3N4MB 4MEXA 4ATBA 3G6YA 5HMLA 4F4YA 4IRCA 2LYHA 5EWFA 4M47A 4X4TA 3C2LA 2NRTA 4UB3A 4AT9A 2Y1JA 2W9BB 1TVAA 2DRAA 4AT7B 4XQ8A 5CR0A 5EOZA 4M04A 4JK1A 5HRBA 3HJ4A 1KFDA 4DL5A 4GC7A 2MUTB 1A77A 1QLNA 4IQWA 9ICJA 5DLGA 4WC3A 3ETLA 5DQHA 3H37A 3RJEA 1AROP 4KLOA 9ICMA 7ICKA 5KFKA 7ICSA 4F2RA 3RJKA 1Z3EB 2H5XA 1MSWD 4UBBA 1U49A 3RR8A 1D8LA 4J9LA 1XO1A 1SKRA 5J0TA 2PFOA 8ICMA 1MC8A 3PW5A 3MDCA 7ICTA 2Q66A 2ZH8A 1OU5A 3WFOA 3PX6A 5HRIA 3RB4A 4FBTA 1NO5A 2AJQA 3C18A 3GFKB 4DLGA 4E8FA 9ICCA 1F5AA 5J0SA 1JN3A 1K1QA 4QZEA 3UXNA 3H8JA 4PHAA 3UXPA 2ZUCA 2UVVA 5KT2A 4NXZA 3PNCA 3BDPA 4B9SA 3M8SA 7ICGA 3OGUA 3GDXA 4J9OA 3EWAA 9ICVA 3C2KA 1TV9A 4NLGA 1L3SA 4C8LA 1IXRA 2A1JA 4YXMA 1S0VA 4ECQA 3PX0A 4Q43A 2NRWA 3SZ2A 8ICQA 4RQ4A 3FYHA 2UVRA 2R8IA 4M6WB 4PGQA 3EW9A 2XGPA 3IM1A 5L1IA 2AQ4A 4TUQA 1KFTA 2FPLA 3UQ0A 4M9NA 9ICPA 4WC5A 4AT9B 3WFSC 4FHVA 3Q8PB 4O3PA 3LQCB 5DDMA 4J9SA 1NJYA 2C2EA 1T7PA 5L1LA 1BPZA 7ICVA 5KT5A 3HW8A 4ECZA 1ZQAA 4YG2A 4E80A 4DSFA 4I2FA 4YMMA 4RWQA 4Q8FA 3JPNA 2R8HA 4QZAA 4RPXA 4M5DA 4WCWA 1ZJMA 2ZTDA 2R8KA 4GC6A 8ICEA 3ZDEA 1NJXA 3NGDA 1ZQWA 8ICIA 3HP6A 3GIJA 1ZQBA 2DRBA 4DLEA 4YMOA 3LWMA 4FH5A 4EYIB 3C66A 2W9CB 3TFRA 3ZD8A 3Q8MA 2PFNA 4QWBA 1T8EA 2KZMA 4F5OA 1L3TA 4LT6A 4WC4A 2ZH4A 4AT8B 4UAWA 1ZQKA 4I2GA 7ICLA 4RPZA 4Q44A 3RBDA 8ICXA 4PGYA 3EZ5A 4NLNA 4IQUA 1ZJNA 4KLEA 4XQ7A 1S0NA 2V4QA 2AGPA 3V6KA 8ICTA 1R8AA 1BGXT 3OVSA 1ZQRA 2RDIA 5IINA 4RQ0A 8ICRA 5J2CA 3SI8A 2FLLA 4ECYA 5J2DA 2F1JA 2MAXA 2FPMA 3H40A 4DQRA 2C2DA 5KG1A 4O3NA 2HHXA 4YP3A 1QSSA 2PFPA 2M2WA 4EEYA 4I2HA 5KFJA 3FDSA 3K75D 3V6HA 4JV0A 4IRKA 4Z6CA 4DQQA 4I28A 4DFJA 5KG3A 4HYKA 4FS2A 5F2VO 3KTQA 4X4UA 1SL2A 1UEVA 3L9DA 4KLTA 1ZQSA 7ICMA 4FHXA 3PW4A 1FA0A 1ZQPA 4F2SA 5KT7A 1PZNA 1MQ2A 9ICSA 4QZFA 8ICOA 2BQ3A 1RXVA 2BHNA 4PHEA 1ZQIA 4R8UA 4M6WA 4EBKA 2ZUBA 5J0QA 2JZBA 8ICBA 4IG8A 4FO6A 2F1IA 3MGHA 4KMUA 4JWNA 3ZDDA 3G6VA 3AQKA 5KFBA 5J0OA 4B9UA 3RH4A 3N97B 4KLHA 1XSNA 3E2EA 2ZHBA 1KNYA 1C7YA 4J9KA 4GXKA 4KLJA 8ICNA 8ICHA 2ZJ5A 4YR0A 1TKDA 5KFMA 2DR5A 4NKTA 5IIOA 3RR7A 4WBYA 2HHPA 4B9VA 3GV7B 2BKEA 4BGDA 3OSNA 3SV3A 1BPYA 5J2BA 4C8OA 3Q8RB 4ED8A 5KFNA 5KT3A 3HWTA 1SL1A 2ZTEA 4AT8A 3NTUA 4NM2A 1QSLA 3AQNA 3UXOA 4ED3A 1U47A 2ZH9A 2BQUA 8ICCA 1ZQJA 4I2JA 5DQGA 2J6UA 3LK9A 3MR6A 5KT4A 2R8GA 4KLLA 3RJHA 9ICAA 2VA2A 1UA1A 2MUTA 7ICHA 5DEDA 3RB0A 3MFHA 4DO9A 3T3FA 4KLUA 4F92B 5DDYA 5HRKA 4YQWA 4BWMA 2IHMA 3C1ZA 4F5PA 4EP7A 2KZZA 2DFLA 4YXJA 3MGIA 3EPGA 4DF4A 7ICOA 4XUSA 3JPQA 1U9LA 2GWSA 1RYSA 1R8BA 2ATLA 5KFYA 4X0BA 3PY8A 1X2IA 2HVIA 2NRZA 3UPQA 4TQRA 4ECXA 4RT2A 4X4NA 1U48A 2BCQA 1TFRA 8ICVA 2ZJ8A 4M0AA 1SL0A 2RDJA 3Q8LA 5DB7A 4JWMA 4I2EA 4K4HA 1MIWA 5KFCA 2ZH5A 3MABA 5KFZA 1ZQLA 3PMNA 1A76A 5DG9A 3MFIA 3GV5B 3JPPA 4I2CA 3G6XA 4MFFA 4M2YA 1RZTA 1U45A 5KG6A 2BGWA 4RQ2A 1TAUA 5D49A 4I27A 5IIIA 5DQIA 4EBJA 3MDAA 1TK5A 1XSPA 1KLNA 5HRDA 3RAXA 4FH3A 4Z6FA 3RJGA 1BPBA 4ECWA 4I2IA 5J2GA 2HW3A 4RT3A 4QZ9A 4DL7A 1NK4A 4LZGA 2ZH6A 4QZ8A 3TANA 2UVWA 4M9LA 1R8CA 4WC1A 3WFRE 3V7LA 3OJSA 1ZQGA 4ED0A 1SZPA 3OVAA 4B9TA 5KT6A 5J0UA 1LB2B 2XC9A 4EZ9A 4IR9A 5CB1A 2PBEA 4ZH4A 4F5RA 3T5JA 1NKBA 2O5AA 5J0WA 4TUPA 4NLKA 3M8RA 1KDHA 2I9GA 4Q8EA 2HHWA 4UD5A 3PX4A 2ISPA 4I29A 2F1HA 5DBCA 2Q0ZX 3RRHA 4X4OA 1UT8A 1ZQYA 5DB6A 3JZ0A 2P66A 2DPIA 3RBEA 7ICQA 4NKUA 4KTQA 3SV4A 5KFEA 4UB4A 1S77D 3OVBA 4ATBB 4YVZA 2WTFA 1S10A 1JQRA 4RNNA 4GXIA 1XWLA 4FS1A 4QZDA 2BQRA 1KSPA 3JPOA 2DPJA 4F50A 2BPGA 4FBUA 3QZ7A 2M2VA 3KHGA 3KHHA 7ICJA 4DQPA 1BNPA 4FHWA 3RTVA 4KLGA 2VANA 4B9LA 4DSIA 3B0YA 4I2AA 7ICFA 4DOCA 3UPSA 3V7KA 4X0AA 1NZPA 3PR5B 4RNOA 3UQ2A 2KTQA 1YLQA 5HNKA 3BJYA 3RJIA 3PV8A 8ICJA 3AUOA 1ZQFA 4E7XA 4ED6A 4X4PA 4XRHA 5KFDA 3OHBA 3T5LA 5KG2A 1XSLA 2P6RA 2ID1A 5EWGA 3PVXA 2C22A 1H38A 5KFPA 1K1SA 5IIJA 1NKCA 1BPDA 1EXNA 4UBCA 3EPIA 3QEAZ 4NM1A 3TQ1A 4P4PA 3OSPA 4UD4A 5J2FA 3RAQA 3C2MA 4ED2A 4JV2A 8ICUA 4KLMA 1KTQA 4YD1A 2BDPA 2PI5A 4DOBA 4KLDA 1HJPA 8ICYA 4WC6A 2ZH7A 3AQMA 3C1YA 3BQ2A 3IHQB 5KFXA 4QZHA 2XCPA 4RZRA 2KN7A 3PW0A 1S76D 1MIYA 1ZYQA 4FHYA 3V7JA 4DL2A 5F9LA 4PHDA 2ASJA 1ZQEA 4DFKA 2ISOA 1S0MA 5F9NA 4QZIA 4ECSA 1JMSA 5KFFA 2I1QA 2ASDA 2V9WA 5DGBA 2XY6A 4DSLA 5HRGA 3H4BA 2IHNA 1D9FA 1ZQCA 2AQ0A 1IM4A 3ISDA 2HHVA 5HRLA 1JAJA 2DR7A 4QWCA 3K4GA 4DS4A 3T5KA 4YMNA 2JZBB 5CA7A 4QWDA 1TK8A 5HRHA 4QZGA 1ZQVA 5J2EA 4UAZA 2ZH1A 2XY7A 3C21A 1PX5A 1CEZA 9ICUA 4DWIA 3JYYA 1V9PA 3TAPA 1QTMA 2IA6A 1HUOA 4BWJA 2ZH2A 3AU6A 5J2HA 8ICAA 3B0XA 3GIMA 2FMSA 4DOAA 2B21A 3C5FA 1KFSA 4ECRA 4FHPA 2VA8A 4M9HA 2ZJAA 5KFVA 3MR5A 4MEYA 3GIKA 5CJ7A 1Z00A 1ZQTA 1WCLA 3HPOA 3HX0A 3ZD9A 4R63A 4WBZA 2HVHA 5KFSA 9ICOA 4O5CA 9ICRA 2M2UA 5KFHA 4RQ5A 3RJFA 4MF8A 2KP7A 1NK6A 4BXOB 2M2TA 2BE3A 2ZTCA 5BPCA 1ZQNA 2JEJA 1LV5A 4K4IA 3AU2A 4DQIA 3WFPA 4QW9A 8ICFA 1TK0A 1TAQA 3H3AA 4R66A 1S9FA 1B43A 2ZH3A 4DSKA 5D4BA 5CP2A 1X9WA 4IRDA 4F5QA 3V6JA 3H39A 4RWPA 3MR2A 1NK0A 3JPTA 4JV1A 5J29A 3ISCA 4J9MA 4EYHB 1R89A 2ZUDA 4GXJA 3RJJA 5KG7A 5DKWA 4DL4A 2UVUA 4RPYA 7ICUA 4DSEA 1RXWA 3GQCA 2FMPA 2AGOA 1SKWA 8ICPA 2ASLA 4RQ1A 4UB5A 1MIVA 1NKEA 5L1KA 4J9PA 5CWRA 2DR9A 2W9CA 4X4VA 5KFRA 4Z6DA 1VFGA 5KFLA 4RUCA 2RFFA 4EZ6A 4X4SA 7ICPA 1BPEA 5BOLA 2BCRA 2PXIA 3TFSA 1T4GA 1NK9A 9ICQA
chains in the Genus database with same CATH superfamily
2HHQA 1NNLA 4X5VA 4O3RA 2PMZF 5EE1A 1RPLA 1CRXA 2EAMA 3IN5A 3TARA 1X42A 3JPRA 1PVQA 4IR1A 4KITB 3HJEA 1UHUA 2W8LA 4MFAA 1NJZA 5JUMA 3WKDA 4NL9C 3V72A 2BCVA 3QU7A 3CYMA 3I76A 2R8JA 4C4TA 2G5HB 4O5KA 3L3FX 5KFQA 4TURA 1UA0A 2DF4B 5DGAA 2P6UA 1WOTA 2H3VA 3H38A 2I5HA 3QEBZ 3WK5A 3H8WA 4CCHA 4UB2A 4O67A 1HUZA 4O3OA 4B9MA 2B56A 4PGXA 3WFQE 2GOLA 5AM4A 3H7IA 3Q8QB 7ICIA 2FMQA 1KN5A 9ICBA 3M9OB 1A6SA 8ICKA 2BPCA 3OJUA 2Z7JA 2JEGA 4M9GA 2K4EA 4QZCA 3Q8SB 3QZ8A 1JXLA 4RWNA 1K5OA 5KFOA 4DFPA 4RQ3A 1UT5A 4ELVA 5DBAA 2YMQA 2HOIA 1L6NA 3PHZA 5CFTA 2ZIUB 5F3XB 4DEZA 3B9JA 3ETRA 2KSOA 4RQ7A 2LMRA 1Y88A 1UETA 2J6SA 1S97A 3OHAA 5DG8A 3THVA 1S0OA 2HHTA 2EZZA 2W8KA 3H8MA 4RNMA 4I2BA 3FAHA 5J0RA 5ALEA 2FPKA 4GLXA 5AKKA 1ZQXA 4O68A 3SQIA 4DL3A 1DK2A 4EBCA 2RHFA 4Y2QA 4DS5A 4DFMA 2XGQA 8ICGA 2N1RA 5ALKA 2Y1IA 1B22A 2KJ9A 5KFGA 1X9MA 4ACOA 2JR5A 1N48A 4LEWA 4NLCA 4QW8A 3RH5A 2YTUA 2IUBA 4NXVA 3D6JA 2LYHA 1L7PA 5EWFA 4M47A 5AI8A 3C2LA 4JMUA 1TVAA 4WJ3B 1N5XA 4ATBA 3ER8C 2F8LA 3HJ4A 1QLNA 1A77A 1C20A 3PSFA 1N61A 7ICKA 7ICSA 3ERCC 4OJPA 3RJKA 2H5XA 1JUDA 5AI5A 7ICTA 2Q66A 3ONNA 2VIXA 5EE0A 5HRIA 3QUQA 3RB4A 1B4FA 3BZKA 3AMZA 4AYBF 3DEEA 4E8FA 9ICCA 1K1QA 1OUQA 3UXNA 3AM9A 3UXPA 5KT2A 2YN4A 2LKYA 1TV9A 4C8LA 1IXRA 2A1JA 2HN2A 1S0VA 4Q43A 3GU3A 2YB4A 2R8IA 3EW9A 2AQ4A 4IS7A 3AEVA 3SR6A 3WFSC 2KEYA 4PL1A 3I28A 2W03A 3Q8PB 5DDMA 1NJYA 2BBHA 1JI7A 5ALFA 4RWQA 1WWVA 4QZAA 4RPXA 2D6FC 5J8YC 4K9AA 4GC6A 2RP5A 2DRBA 4DLEA 3IG8A 4FH5A 4EYIB 3TFRA 3ZD8A 3Q8MA 4WQKA 1T8EA 4GIBA 4LT6A 2YMMA 7ICLA 1ZQKA 4I2GA 4Q44A 2E8NA 8ICTA 5IINA 4RQ0A 3SI8A 2KKVA 4ECYA 2F1JA 2C2DA 2HHXA 1DXSA 2M2WA 4I2HA 5KFJA 3FDSA 5ALZA 3K75D 3V6HA 4JV0A 4IRKA 4Z6CA 4FS2A 1ZQSA 3NVYA 4FZMA 2W04A 3T79A 1ZQPA 5KT7A 5A0LA 4QZFA 2BQ3A 2A1AA 4M6WA 1N60A 1XNSA 3J81j 2JZBA 2Y0SF 4FO6A 4KMUA 5J0OA 2A19A 1Z1VA 2GO7A 1C7YA 4NV0A 2JH7A 5D62A 3QU5A 5J2BA 2A3VA 3GZFA 1QSLA 3UXOA 5ALGA 8ICCA 1ZQJA 2J6UA 3E58A 4KLLA 4O3MA 1ZD4A 2WF7A 5DDYA 2DGZA 4YQWA 2IHMA 5AI9A 4DF4A 4JLXA 4XUSA 3M7DA 3AQEA 1X2IA 2HVIA 2NRZA 2K60A 4TQRA 1SV4A 4X4NA 2BCQA 2ZJ8A 1SL0A 3Q8LA 5DB7A 4P0PA 5GTIU 4K4HA 2ZH5A 5KFZA 1A76A 2RLTA 4MFFA 2DL0A 3G6XA 5KG6A 2JGAA 2BGWA 5DQIA 2FDRA 1J97A 1TK5A 5HRDA 2KOBA 5J2GA 2DQNB 4JB3A 4RT3A 3VC8A 4QZ8A 2UVWA 4N7RA 4WC1A 2LBOA 2WAQF 4F5RA 4QJFB 4TUPA 2HCFA 3NASA 1OXJA 5AM1A 2F1HA 5DBCA 1ZQYA 3JZ0A 2P66A 4UB4A 3OVBA 4UB6U 4YVZA 1JQRA 4GXIA 1KSPA 4F50A 3QZ7A 3IDWA 1BNPA 4KLGA 3NKUA 2FJ6A 2B0CA 2E8OA 1YLQA 5TISU 4USAA 3BJYA 3PV8A 3AUOA 1ZQFA 3BS7A 4X4PA 3T5LA 5ALNA 5EWGA 1FO4A 1NKCA 1BPDA 4UBCA 3EPIA 1DRGA 4NM1A 4UD4A 4ED2A 8ICUA 1KTQA 4YD1A 2W7PA 2PI5A 5J8YA 4WC6A 3C1YA 3BQ2A 5KFXA 4G9BA 2ASJA 2ASDA 5KFFA 2I1QA 4DSLA 4OD0A 2IHNA 2KNJA 2AQ0A 3UMCA 4EX6A 3ISDA 1ZQCA 3K4GA 4YMNA 1ZQVA 5J2EA 2ZH1A 2XY7A 1CEZA 2ZH2A 3TAPA 1HUOA 4BWJA 8ICAA 2E1EA 3GIMA 2B21A 3C5FA 2G5IB 3PSPA 3A0BU 1CI4A 4ECRA 4FHPA 4M9HA 3QU9A 4MEYA 5CJ7A 5KFSA 2KE7A 1NK6A 3ER9B 1LV5A 4DQIA 4QW9A 5AM3A 4Y2XA 4R66A 1S9FA 3NWIA 5CP2A 5CFSA 3H39A 1X6IA 3JPTA 4K96A 5ALOA 4EYHB 3ISCA 2ZUDA 4GXJA 4QIWF 2UVUA 7ICUA 5AKLA 2GH1A 2AGOA 5AM0A 4RQ1A 2VJ5A 2WF9A 1NKEA 5L1KA 2W7OA 5KFRA 4RUCA 4X4SA 7ICPA 1BPEA 1SV0C 2BCRA 3TFSA 1NK9A 9ICQA 1UEUA 1SB3C 4MF2A 4YCXA 4WH5A 5J2KA 3KBBA 3OUYA 3PO5A 2KK0A 1WCNA 2LHTA 1ZRMA 3PR4A 3Q8KA 3WK6A 4A8EA 1NK8A 3N7RC 3KHLA 2ZXHA 2OWOA 4UASA 3HJ1A 4AT7A 5J0PA 2HHSA 2HOQA 4UB8U 5KG4A 4U7CA 1N63A 5HRFA 4K4GA 1L3UA 1U4BA 2IBKA 2Y0SC 1T3NA 1YT3A 2H3QA 4O0IA 4WC0A 2M9NA 1Q79A 3MCRA 2K4IA 2EANA 4C7YA 2Y9TA 4WC7A 3TAQA 2KG5A 4J9NA 2H3IA 2IMWP 1OW5A 4TUSA 4PL2A 3LVVA 4DSJA 5HHHA 4IQVA 3N7PD 4BDPA 4QWEA 4KLSA 4Y2TA 3AQFA 5B3QA 4OAIZ 1COOA 3MC1A 2C28A 4R8UB 4Y2VA 5KFIA 4S3NA 4ED7A 2G08A 1SIJA 1SZHA 1XS9D 2KZ3A 2PKEA 9ICGA 2F44A 2NRXA 1TFYA 2HBMA 2K89A 3ISBA 3LWLA 3AQNA 3NRWA 4F4ZA 4E0DA 5D46A 4Y2YA 4CNQA 1JXEA 5J0XA 4NL9A 3ZDCA 2KIVA 4MFCA 4AP9A 8ICLA 9ICNA 5EWEA 2IOHA 4PPXA 1ZXIA 4B9NA 5CEHA 4UQGA 4ECVA 5B66U 3S6JA 4Q45A 1ZQMA 4PH5A 4KLIA 4NY8A 3D2SA 5DLFA 5KFTA 4K97A 5EE3A 5EE9A 5KFWA 3HT3A 5DG7A 1SV0A 2HBLA 4AYBC 5DECA 4FZNA 1KRPA 4NXXA 3PO4A 1X9SA 4K98A 9ICFA 2W9BA 4P0QB 2JEFA 2CPRA 2PI4A 2RRDA 4P2HA 4LZDA 1DK3A 2RQ5A 3RB6A 5IIMA 3PW2A 4QZBA 4DFDA 3M6ZA 3TADC 3UM9A 4BXOA 4RWOA 4MEXA 4F4YA 4IRCA 3H0LB 2HN1A 4NLBA 2QB1A 5ALYA 4AT7B 1IIPA 5CR0A 4JK1A 1KFDA 4GC7A 2MUTB 2E8MA 4IQWA 1ZRNA 5ALDA 5DQHA 3VCBA 1Z1BA 1MSWD 3KOOA 3A0HU 5ALWA 1U49A 1JRPA 2PFOA 1XO1A 3PW5A 3MDCA 3WFOA 1NO5A 4CDGA 2QB0B 5AHXA 3H8JA 2UVVA 3KKAA 3BDPA 4B9SA 5ALPA 3M8SA 2G0AA 1HIWA 1L3SA 4O69A 1UQVA 1J2NA 2L5YA 2YB1A 4ICAA 2NRWA 3E0FA 2XGPA 3IM1A 4U6PA 5L1IA 1KFTA 2FPLA 3UQ0A 2LI6A 5ALXA 5ALJA 3LQCB 4J9SA 1T7PA 2O1PA 1BPZA 2EZXA 4YG2A 4E80A 4Q8FA 3JPNA 5AKIA 1ZJMA 2ZTDA 1LKYA 2R8KA 2MA1A 3ZDEA 1WG8A 4YMOA 3IP4B 3C66A 2ZH4A 1PK3A 4F5OA 3KD3A 8ICXA 4BX9C 4IQUA 1ZJNA 4HAIA 1BGXT 4C4RA 8ICRA 1PK1A 2FLLA 5J2DA 2OH2A 4I28A 4DFJA 5KG3A 5F2VO 4X4UA 1UEVA 3BS5A 7ICMA 1FA0A 2HOFA 1Q46A 1MQ2A 3FC4A 8ICOA 1ZQIA 4R8UA 3QXGA 5J0QA 8ICBA 3MGHA 5AKGA 3N97B 4KLHA 1XSNA 1KNYA 4J9KA 8ICNA 1UCVA 2ZJ5A 2DR5A 5JTGA 4NKTA 5IIOA 4WBYA 2HHPA 3SV3A 4UW9A 4ED8A 5KT3A 1FFUA 3HWTA 1SL1A 4ED3A 1U47A 2BQUA 5ALQA 5KT4A 2R8GA 4CGZA 1UA1A 2MUTA 5DEDA 2YX8A 2ATLA 5KFYA 2WHEA 3PY8A 1YZ6A 4ECXA 4OJ6A 1U48A 3BS5B 3KKAC 2CN1A 8ICVA 4JWMA 4I2EA 3MFIA 3GV5B 2OM6A 2G07A 5D49A 1Q3UA 3L4PA 1XSPA 2H3FA 1KLNA 3RAXA 4FH3A 4Z6FA 2K4PA 3RJGA 1BPBA 2F2AB 4I2IA 2D8CA 2KMDA 2HW3A 4DL7A 2ZH6A 4LZGA 1R8CA 3TANA 2G09A 5AM2A 3V7LA 1ZQGA 1QQ7A 4B9TA 5KT6A 4EZ9A 4IR9A 4ZH4A 4CE6A 3T5JA 2O5AA 1UPHA 4NLKA 2AH5A 2I9GA 4Q8EA 2ISPA 3IRUA 2DPIA 2NO5A 4KTQA 5KFEA 3WKCA 1ECWA 3CP8A 3H0RB 4RNNA 2BQRA 2E8PA 2BPGA 2M2VA 3KHGA 7ICJA 5AKZA 5E79U 4B9LA 4I2AA 4X0AA 1NZPA 3PR5B 5AK4A 4B6JA 4RNOA 2NV3A 3QYPA 8ICJA 2AHOB 1P7DA 1RDFA 3OHBA 2ESEA 2C22A 5IIJA 1EXNA 4OAFA 3OSPA 5J2FA 4JV2A 4KLMA 2BDPA 4DOBA 1HJPA 4FZLA 3IHQB 2XCPA 1MIYA 3QUCA 2KN7A 2OEHA 5F9LA 1Q8KA 4PHDA 1ZQEA 2ISOA 5HC9A 1S0MA 2V9WA 2PMZC 1LKYB 3H4BA 3HRDD 2DR7A 4DS4A 3T5KA 2JZBB 5HRHA 2JXJA 3UMGA 9ICUA 3JYYA 1X40A 3MR5A 1ZQTA 2KIWA 3HPOA 4CF4A 4DCCA 4RQ5A 2BE3A 5G5HA 2ZTCA 5BPCA 3AU2A 3WFPA 8ICFA 1TAQA 2ZH3A 2EAOA 3HILA 4IRDA 3V6JA 4K99A 4OJOA 1NK0A 5AKJA 5AI4A 1R89A 4J9MA 1PVPA 4DSEA 4UATA 1X9XA 1SKWA 1MIVA 4J9PA 5CWRA 2RFFA 1X6JA 4JUZA 1CUKA 5AKHA 2JMGA 2DVIA 2V4RA 4KN7A 4C8KA 4YR3A 4TQSA 2EZYA 5HR6A 9ICKA 3NVZA 4CRXA 4J9RA 5FP0A 1MQ3A 4XA5A 4O5EA 4F4XA 4P0PB 4ELUA 4YD2A 3PW7A 4LVSA 8ICWA 4C8MA 3GILA 3K1ZA 1N56A 1NK7A 4KLQA 5B5EU 7ICRA 4UAYA 2IHOA 2W54A 1Q3VA 4RUAA 4J9QA 2B4VA 4EGWA 2ZXIA 5KNIA 5HREA 5KG5A 3WKBA 1KW4A 1MN8A 3ZI4A 3WK7A 2KFNA 1DOQA 1BVSA 5KL1B 1FIQA 1NZBA 3T5HA 2FI1A 3BQTA 5KFUA 5G5GA 4CF5A 2WB1F 1JALA 4BUGA 5ALTA 1BNOA 5AKEA 2ZHAA 1JX4A 1QH9A 1BPXA 1AQ6A 4I2DA 5AKXA 4US9A 4ELTA 3BQ1A 3LDAA 2FLNA 4P4MA 3EYZA 2M0NA 1D8YA 2VA3A 3MGVA 2ALZA 9ICIA 4KLFA 2KVCA 1L5UA 3AN1A 1L3VA 2HHUA 4ECUA 1D9DA 9ICXA 1ZQZA 7ICNA 4G3IA 2QKQA 4RQNA 4J03A 5AICA 5DB8A 2AGQA 2BPFA 1Z19A 1F0MA 1Q78A 2AU0A 2GLEA 4YFKA 9ICTA 1L8OA 3U26A 5IIKA 2E5SA 2BCUA 1DGSA 5HMMA 3TKAA 4RQ6A 5KG0A 1JIHA 2F3NA 3HKZF 2AXTU 4MKPA 3OUYB 5L9XA 4OJ5A 1TAMA 1SXEA 2B6GA 5AK5A 1ZQOA 1ZQUA 1QSYA 3GIIA 2KHQA 2XY5A 1NK5A 2CRXA 4X4QA 5C5JA 5GTHU 1ZETA 3KZIU 2EAPA 3HIYA 3K7DA 2C2RA 3N28A 4F91B 5ALIA 4F93B 5L1JA 1TE2A 2NRVA 2Q4TA 4EBDA 3JPSA 5KAIU 1WYGA 1KEJA 2BZFA 2B51A 3F2DA 4M9JA 5CHGA 8ICSA 3NS1A 1XC9A 4ED1A 4YR2A 3TI0A 4OAGA 2J6TA 4PJ0U 1ZQDA 9ICLA 1ZD3A 2HSZA 4WC2A 1V38A 5IILA 3N4MB 3G6YA 4KX3A 4P0QA 4X4TA 2DUYA 4UB3A 4AT9A 4UARA 2Y1JA 1PUZA 4XQ8A 1O03A 5DLGA 1S5LU 1AROP 3D2QA 2DKXA 4KLOA 9ICMA 2WAQC 4F2RA 4UBBA 3RR8A 1PK1B 1SKRA 8ICMA 4FBTA 2AJQA 3C18A 3GFKB 2KVSA 1F5AA 5J0SA 4QZEA 4HX0A 2ZUCA 4NXZA 3PNCA 5JRTA 2KJ8A 4J9OA 3EWAA 9ICVA 4NLGA 2XICA 4YXMA 4ECQA 3SEIA 1SWWA 8ICQA 4RQ4A 2P35A 2UVRA 4M6WB 4PGQA 4WC5A 4TUQA 3HW8A 4DSFA 3TADA 2R8HA 4M5DA 2JRZA 4WCWA 8ICEA 2O6KA 3GIJA 1ZQBA 3LWMA 2W9CB 1DGJA 2KZMA 4WC4A 2DWQA 4AT8B 4UAWA 2OHFA 5H2FU 4RPZA 4KLEA 2V4QA 2AGPA 3V6KA 1R8AA 1ZQ1C 4CF3A 1ZQRA 2RDIA 3PSIA 5J2CA 1ED1A 3H40A 4DQRA 3D2NA 5KG1A 3WK8A 4YP3A 1QSSA 4DQQA 3ICXA 4HYKA 2OCEA 3SD7A 3KTQA 4FFDA 1SL2A 4FHXA 4F2SA 1RXVA 3CRXA 4NXTA 2FE9A 2G06A 4EBKA 2ZUBA 1KKXA 3NVOA 4IG8A 2F1IA 4JWNA 3G6VA 3AQKA 3C28A 5KFBA 4B9UA 4OAHA 3RH4A 2VJ4A 1LVHA 2ZHBA 4EENA 1RYUA 4KLJA 4YR0A 2YMPA 1SXDA 3RR7A 5L1MA 4GFJA 4B9VA 2BKEA 4BGDA 3OSNA 1BPYA 2LPEA 2ZTEA 3DV9A 3NTUA 2ZH9A 4I2JA 2HBKA 3LK9A 2IOFA 3MR6A 2HI0A 2VA2A 3JCFA 7ICHA 3RB0A 3MFHA 5ALRA 4KLUA 4F92B 5HRKA 4BWMA 3C1ZA 4F5PA 4K8VA 2KZZA 4YXJA 2KSOB 7ICOA 3F53A 1R8BA 1U9LA 2GWSA 1Z4NA 2CXYA 1F5SA 4M0AA 1MIWA 5HR7A 5DG9A 5KL8B 4I2CA 5T14A 2HDOA 1ZD2P 5IIIA 4EBJA 3MDAA 4OO1J 3PZPA 4NWIA 4ECWA 2ZIVA 3QUBA 3TACB 4M9LA 4I0UA 3OJSA 2KKPA 4ED0A 4FE3A 1ZOLA 5CB1A 1NKBA 5J0WA 1KDHA 2HHWA 4UD5A 3PX4A 4EV6A 2F77X 3RRHA 3O0FA 1UT8A 4QNLA 5DB6A 2WF6A 5JTIA 3IV6A 4IC9A 2NO4A 1GO3F 1J2MA 1XWLA 2XVTA 3JPOA 4EEBA 3KHHA 4DQPA 4FHWA 3RTVA 2MSNA 4DOCA 4FO1A 3V7KA 1URJA 3UQ2A 2KJ5A 5HNKA 2XI9A 3RJIA 3WKAA 4ED6A 4C0ZA 4XRHA 5KFDA 5C0YA 1H38A 3PVXA 5KAFU 1K1SA 5AM5A 4PZOA 3C2MA 4KLDA 8ICYA 2EWRA 2ZH7A 3AQMA 1S76D 4QZHA 4RZRA 2WB1C 3UMBA 1ZYQA 4I29A 5F9NA 4QZIA 1JMSA 2XY6A 1JAJA 2KHVA 2HHVA 1JROA 5HRLA 4QWDA 1TK8A 5ALMA 3C21A 3OWGA 4DWIA 1QTMA 5AI0A 2BDUA 3B0XA 2W11A 2VA8A 2F76X 1WCLA 3HX0A 4Y2JA 9ICOA 9ICRA 5KFHA 4MF8A 4BXOB 2QARA 4BJQA 1ZQNA 1B0XA 4K4IA 5AIAA 1XO0A 3NRZA 1TK0A 2DBYA 1FFVA 4DSKA 5D4BA 1X9WA 2EQYA 4KM5A 3KFUF 5J29A 2OXOA 5DKWA 1VLBA 4O6AA 1RXWA 3GQCA 8ICPA 2ASLA 4F72A 2LM1A 4UB5A 1KL9A 2DR9A 1L7MA 2W9CA 4X4VA 3F5EA 2YMLA 1HEKA 3L5KA 4EZ6A 5CHEA 2XIDA 3K1RB 5KTQA 4K9BA 4OJLA 4UAVA 3PMLA 2MU2A 2XO7A 4DQSA 9ICWA 2W3RA 1QCKA 2EH9A 1L8LA 3RH6A 2NYVA 4F4KA 5J2IA 3CW2C 4Y2SA 2W55A 3RRGA 1Z00B 2LYAA 3QE9Y 3ORYA 2E1FA 5J2AA 1V4AA 1N5WA 4EEKA 3GV8B 4WQLA 4C8NA 5TZVA 2NRKA 4DF8A 2K8CB 2PFQA 1XU4A 2WFAA 3KHRA 3WKEA 2BCSA 2KFZA 3MR3A 1QQ5A 4F5NA 2BR0A 1TFWA 2ZIVB 3OTQA 4EELA 2WF8A 2FLPA 1O08A 4LEVA 4R64A 3ALRA 5KFAA 3LYSA 4X4RA 1NOMA 3QU4A 5J2JA 5JU5A 3NUQA 3WK4A 3NVVA 2IOFK 2DR8A 4DL6A 3M9MB 4EX7A 2A1JB 5HHIA 3MBYA 4F8RA 3SAFA 4F4WA 4EBEA 1GPJA 3RFAA 9ICEA 1RM6C 4UB1A 4RU9A 2XCAA 3C5GA 2FCLA 4KN4A 2YQEA 9ICHA 5HR9A 3EUB2 3BQ7A 3QX7A 5ALLA 2JEIA 3ZDAA 3C23A 4UAUA 1SGGA 4ECTA 3H4DA 2W9MA 3RB3A 4Z6EA 3AQLA 1RYRA 4QWAA 5HP4A 2QB0A 1SKSA 3H8SA 2K8AA 3NYBA 4O3QA 4F3OA 3ED5A 4O3SA 3OV7A 4O9MA 2VKQA 3SAGA 4NLZA 1ZQQA 4R65A 4RQ8A 8ICZA 5CRXA 2JH1A 1NJWA 4C7ZA 1Z4OA 3M9NB 4P4OA 4F71A 5K4LA 3BQ0A 4YN4A 5ALVA 3KZXA 2JHDA 1D8BA 1VJ7A 5ALSA 2E3TA 4KX5A 5BOMA 1VDVA 1M6YA 2KICA 3ZDBA 4IQTA 1ZQHA 3OPXA 1A0PA 1YZ7A 4PHPA 2W9AA 2H3ZA 5DBBA 1F44A 3LVWA 5DB9A 1WUDA 7ICEA 3SYZA 5J0YA 4KMOB 1PVRA 5HMLA 3C29A 3HKZC 3M6KA 3EF2A 5AKYA 2NRTA 2W9BB 2DRAA 5AIBA 5EOZA 4M04A 5HRBA 4JLZA 4DL5A 4Y2RA 3R9KA 3WU2U 9ICJA 4WC3A 3ETLA 3H37A 3RJEA 5KFKA 4KB6A 1Z3EB 1D8LA 4J9LA 2ZIUA 5J0TA 1MC8A 1OU5A 3PX6A 2R18A 4DLGA 1IG6A 2HMXA 2W3SA 1JN3A 2K4HA 4PHAA 7ICGA 3OGUA 3GDXA 1N62A 3C2KA 3PX0A 3SZ2A 2QARB 3FYHA 2ZH8A 4M9NA 9ICPA 4AT9B 4FHVA 4O3PA 7ICVA 2C2EA 5L1LA 5KT5A 4ECZA 1ZQAA 3NVWA 4XJEA 4I2FA 4YMMA 1RQNA 4PZNA 2ZIXA 3H0MB 1NJXA 8ICIA 3NGDA 1ZQWA 3N7SC 3HP6A 4WOYA 4C4SA 1MA7A 2PFNA 4QWBA 1L3TA 1KQQA 3RBDA 4PGYA 3EZ5A 4NLNA 4XQ7A 1T94A 1S0NA 4OCZA 3OVSA 5AK3A 1N2XA 2MAXA 2FPMA 5AI6A 4O3NA 2PFPA 4EEYA 2ZIWB 1V97A 3F2CA 3I1YA 1IV8A 3L9DA 4KLTA 1T3QA 2EDUA 3PW4A 1PZNA 9ICSA 2BHNA 4RQMA 5ALHA 4PHEA 2LM4A 2ES6A 5ALUA 3SAHA 3ZDDA 2LYBA 2I6XA 3E2EA 5D61A 4GXKA 2F8KA 8ICHA 3F5AA 1TKDA 5KFMA 3SENA 2MRLA 2HBJA 3GV7B 2JV3A 3CK6A 4C8OA 3Q8RB 5KFNA 4AT8A 4NM2A 5DQGA 3RJHA 9ICAA 1QQ6A 2YY6A 2GAFD 4DO9A 3T3FA 4QIWC 4EP7A 2DFLA 3MGIA 3EPGA 3JPQA 3FM9A 1RYSA 4X0BA 2Y9UA 3UPQA 4RT2A 1TFRA 4LJXA 2RDJA 5AK6A 5KFCA 1COKA 3MABA 1ZQLA 3PMNA 3JPPA 4M2YA 1RZTA 2KD1A 1SWVA 1U45A 4RQ2A 3BZCA 1TAUA 4I27A 2K8BB 3QU2A 1ZD5A 2ZIWA 4QZ9A 3F2BA 1NK4A 3WFRE 4Y2UA 3OVAA 1SZPA 5J0UA 1LB2B 2PBEA 2XC9A 4NXUA 3M8RA 1NI3A 2ZIXB 5D63A 3AL0B 1RG6A 3SMVA 4X4OA 2Q0ZX 4NKUA 7ICQA 3RBEA 3SV4A 1S77D 4ATBB 2OYYA 2WTFA 1S10A 4FS1A 4QZDA 3QNMA 2DPJA 4FBUA 1V85A 1X66A 2KV2A 3M1YA 1S8OA 2VANA 1KBUA 3B0YA 4DSIA 2W43A 7ICFA 3UPSA 2KTQA 2DKZA 4E7XA 3WK9A 1XSLA 5KG2A 2P6RA 2ID1A 3QUTA 5KFPA 3QEAZ 3TQ1A 4P4PA 3RAQA 4EEDA 3PW0A 4FHYA 3V7JA 4DL2A 2ZG6A 4DFKA 5CFUA 4ECSA 5DGBA 1L7NA 2ODGA 5HRGA 4Y2PA 1D9FA 1IM4A 4QWCA 4ZOHC 5CA7A 4QZGA 4UAZA 1PX5A 1V9PA 2IA6A 3AU6A 5J2HA 2FMSA 4DOAA 3CNHA 1KFSA 4US8A 2ZJAA 5KFVA 2D3DA 3IG5A 3PSTA 3GIKA 1Z00A 1WWUA 3ZD9A 4R63A 4WBZA 2HVHA 4O5CA 2M2UA 2WF5A 3RJFA 2KP7A 2M2TA 2QLTA 1L7OA 2GA9D 2JEJA 5B3PA 4LEZA 1RQLA 3H3AA 1B43A 4C80A 1VJ5A 4F5QA 4RWPA 3MR2A 4JV1A 4IL6U 3RJJA 5KG7A 4NJ8A 4DL4A 4RPYA 4NXWA 1FEZA 2FMPA 2BBJA 4Z6DA 4MHVA 1VFGA 5KFLA 3RF9A 3DDHA 4LEYA 5BOLA 2PXIA 1T4GA
chains in the Genus database with same CATH topology
1UEUA 4JUZA 1CUKA 2HHQA 4X5VA 5KTQA 4O3RA 2DVIA 4MF2A 3PMLA 2V4RA 1RPLA 4KN7A 4C8KA 4YCXA 2XO7A 5J2KA 4YR3A 4TQSA 3OUYA 4DQSA 3PO5A 9ICKA 3TARA 1WCNA 9ICWA 3PR4A 3Q8KA 3JPRA 4IR1A 4KITB 4J9RA 3RH6A 1NK8A 1MQ3A 4XA5A 4O5EA 4F4XA 3KHLA 4F4KA 2OWOA 2W8LA 4ELUA 4MFAA 4YD2A 5J2IA 1NJZA 3PW7A 3HJ1A 4AT7A 5JUMA 4LVSA 3RRGA 5J0PA 8ICWA 2HHSA 4C8MA 5KG4A 3GILA 1Z00B 2BCVA 3V72A 1N56A 1NK7A 3QE9Y 5HRFA 2R8JA 3ORYA 4KLQA 4K4GA 4O5KA 7ICRA 1L3UA 4UAYA 5KFQA 5HR9A 5J2AA 1V4AA 1U4BA 4TURA 3GV8B 4RUAA 4J9QA 1UA0A 2IBKA 4C8NA 5TZVA 5DGAA 4DF8A 2NRKA 2P6UA 1WOTA 1T3NA 5HREA 2PFQA 1XU4A 5KG5A 3KHRA 3H38A 4O0IA 4WC0A 2M9NA 3QEBZ 2BCSA 1Q79A 2KFNA 2KFZA 3MR3A 1DOQA 1BVSA 3H8WA 3T5HA 4CCHA 4WC7A 3TAQA 4UB2A 4J9NA 3BQTA 5KFUA 4F5NA 1HUZA 2BR0A 1TFWA 2IMWP 4O3OA 5HC9A 4TUSA 4B9MA 4PGXA 3WFQE 1BNOA 2FLPA 2ZHAA 1JX4A 4R64A 4DSJA 2O1PA 5KFAA 3H7IA 5HHHA 4X4RA 3Q8QB 1NOMA 4IQVA 1BPXA 4I2DA 7ICIA 5J2JA 4ELTA 3BQ1A 3LDAA 4BDPA 2FLNA 4P4MA 3EYZA 4QWEA 1D8YA 2FMQA 2VA3A 4KLSA 9ICBA 2ALZA 9ICIA 3M9OB 4KLFA 2DR8A 4DL6A 1L5UA 8ICKA 1COOA 1L3VA 2BPCA 3M9MB 2HHUA 2C28A 2A1JB 5HHIA 4R8UB 3MBYA 4ECUA 1D9DA 3OJUA 9ICXA 1ZQZA 4M9GA 2JEGA 5KFIA 4F8RA 4G3IA 7ICNA 4S3NA 4ED7A 5DB8A 4F4WA 4EBEA 2AGQA 2BPFA 1XS9D 4QZCA 2KZ3A 3Q8SB 9ICEA 1Q78A 2AU0A 4UB1A 4YFKA 3QZ8A 1JXLA 9ICGA 9ICTA 4RWNA 2NRXA 4RU9A 2XCAA 5IIKA 3C5GA 1TFYA 4DFPA 4KN4A 5KFOA 1DGSA 3ISBA 3LWLA 2BCUA 1UT5A 4RQ3A 9ICHA 5HMMA 5DBAA 4F4ZA 4ELVA 5D46A 4RQ6A 5KG0A 3ZDAA 4E0DA 3C23A 4ECTA 2JEIA 1JIHA 1JXEA 5J0XA 3ZDCA 3H4DA 2W9MA 4DEZA 3RB3A 4MFCA 3OUYB 5L9XA 4Z6EA 8ICLA 3AQLA 1RYRA 1QSYA 5EWEA 4QWAA 1ZQOA 1ZQUA 4RQ7A 5HP4A 3GIIA 1SKSA 4PPXA 3H8SA 4B9NA 1Y88A 2XY5A 1UETA 4UQGA 4ECVA 1NK5A 4O3QA 3NYBA 4Q45A 1ZQMA 2J6SA 1S97A 4F3OA 4O3SA 3OHAA 3OV7A 5DG8A 4PH5A 3THVA 4O9MA 1S0OA 4KLIA 4NY8A 4NLZA 1ZQQA 4X4QA 4R65A 2HHTA 4RQ8A 8ICZA 5C5JA 2W8KA 5DLFA 1ZETA 5KFTA 1NJWA 3HIYA 2C2RA 3M9NB 5KFWA 4P4OA 4F91B 3HT3A 4RNMA 4F93B 5L1JA 5DG7A 4I2BA 3BQ0A 4YN4A 5J0RA 9ICNA 2NRVA 2FPKA 4GLXA 5DECA 1ZQXA 1KRPA 4EBDA 3PO4A 4DL3A 3JPSA 4EBCA 1X9SA 9ICFA 1DK2A 1KEJA 5BOMA 2W9BA 1VJ7A 4DS5A 4DFMA 2JEFA 2PI4A 2XGQA 4M9JA 4LZDA 5CHGA 4P2HA 2Y1IA 8ICGA 8ICSA 3ZDBA 4IQTA 1ZQHA 1DK3A 1XC9A 4ED1A 4YR2A 3TI0A 1B22A 5KFGA 4PHPA 3RB6A 2J6TA 2W9AA 5IIMA 3PW2A 5DBBA 4QZBA 1X9MA 5DB9A 1ZQDA 9ICLA 1N48A 7ICEA 4QW8A 3RH5A 4BXOA 4WC2A 3SYZA 4RWOA 5J0YA 5IILA 3N4MB 4MEXA 4ATBA 3G6YA 5HMLA 4F4YA 4IRCA 2LYHA 5EWFA 4M47A 4X4TA 3C2LA 2NRTA 4UB3A 4AT9A 2Y1JA 2W9BB 1TVAA 2DRAA 4AT7B 4XQ8A 5CR0A 5EOZA 4M04A 4JK1A 5HRBA 3HJ4A 1KFDA 4DL5A 4GC7A 2MUTB 1A77A 1QLNA 4IQWA 9ICJA 5DLGA 4WC3A 3ETLA 5DQHA 3H37A 3RJEA 1AROP 4KLOA 9ICMA 7ICKA 5KFKA 7ICSA 4F2RA 3RJKA 1Z3EB 2H5XA 1MSWD 4UBBA 1U49A 3RR8A 1D8LA 4J9LA 1XO1A 1SKRA 5J0TA 2PFOA 8ICMA 1MC8A 3PW5A 3MDCA 7ICTA 2Q66A 2ZH8A 1OU5A 3WFOA 3PX6A 5HRIA 3RB4A 4FBTA 1NO5A 2AJQA 3C18A 3GFKB 4DLGA 4E8FA 9ICCA 1F5AA 5J0SA 1JN3A 1K1QA 4QZEA 3UXNA 3H8JA 4PHAA 3UXPA 2ZUCA 2UVVA 5KT2A 4NXZA 3PNCA 3BDPA 4B9SA 3M8SA 7ICGA 3OGUA 3GDXA 4J9OA 3EWAA 9ICVA 3C2KA 1TV9A 4NLGA 1L3SA 4C8LA 1IXRA 2A1JA 4YXMA 1S0VA 4ECQA 3PX0A 4Q43A 2NRWA 3SZ2A 8ICQA 4RQ4A 3FYHA 2UVRA 2R8IA 4M6WB 4PGQA 3EW9A 2XGPA 3IM1A 5L1IA 2AQ4A 4TUQA 1KFTA 2FPLA 3UQ0A 4M9NA 9ICPA 4WC5A 4AT9B 3WFSC 4FHVA 3Q8PB 4O3PA 3LQCB 5DDMA 4J9SA 1NJYA 2C2EA 1T7PA 5L1LA 1BPZA 7ICVA 5KT5A 3HW8A 4ECZA 1ZQAA 4YG2A 4E80A 4DSFA 4I2FA 4YMMA 4RWQA 4Q8FA 3JPNA 2R8HA 4QZAA 4RPXA 4M5DA 4WCWA 1ZJMA 2ZTDA 2R8KA 4GC6A 8ICEA 3ZDEA 1NJXA 3NGDA 1ZQWA 8ICIA 3HP6A 3GIJA 1ZQBA 2DRBA 4DLEA 4YMOA 3LWMA 4FH5A 4EYIB 3C66A 2W9CB 3TFRA 3ZD8A 3Q8MA 2PFNA 4QWBA 1T8EA 2KZMA 4F5OA 1L3TA 4LT6A 4WC4A 2ZH4A 4AT8B 4UAWA 1ZQKA 4I2GA 7ICLA 4RPZA 4Q44A 3RBDA 8ICXA 4PGYA 3EZ5A 4NLNA 4IQUA 1ZJNA 4KLEA 4XQ7A 1S0NA 2V4QA 2AGPA 3V6KA 8ICTA 1R8AA 1BGXT 3OVSA 1ZQRA 2RDIA 5IINA 4RQ0A 8ICRA 5J2CA 3SI8A 2FLLA 4ECYA 5J2DA 2F1JA 2MAXA 2FPMA 3H40A 4DQRA 2C2DA 5KG1A 4O3NA 2HHXA 4YP3A 1QSSA 2PFPA 2M2WA 4EEYA 4I2HA 5KFJA 3FDSA 3K75D 3V6HA 4JV0A 4IRKA 4Z6CA 4DQQA 4I28A 4DFJA 5KG3A 4HYKA 4FS2A 5F2VO 3KTQA 4X4UA 1SL2A 1UEVA 3L9DA 4KLTA 1ZQSA 7ICMA 4FHXA 3PW4A 1FA0A 1ZQPA 4F2SA 5KT7A 1PZNA 1MQ2A 9ICSA 4QZFA 8ICOA 2BQ3A 1RXVA 2BHNA 4PHEA 1ZQIA 4R8UA 4M6WA 4EBKA 2ZUBA 5J0QA 2JZBA 8ICBA 4IG8A 4FO6A 2F1IA 3MGHA 4KMUA 4JWNA 3ZDDA 3G6VA 3AQKA 5KFBA 5J0OA 4B9UA 3RH4A 3N97B 4KLHA 1XSNA 3E2EA 2ZHBA 1KNYA 1C7YA 4J9KA 4GXKA 4KLJA 8ICNA 8ICHA 2ZJ5A 4YR0A 1TKDA 5KFMA 2DR5A 4NKTA 5IIOA 3RR7A 4WBYA 2HHPA 4B9VA 3GV7B 2BKEA 4BGDA 3OSNA 3SV3A 1BPYA 5J2BA 4C8OA 3Q8RB 4ED8A 5KFNA 5KT3A 3HWTA 1SL1A 2ZTEA 4AT8A 3NTUA 4NM2A 1QSLA 3AQNA 3UXOA 4ED3A 1U47A 2ZH9A 2BQUA 8ICCA 1ZQJA 4I2JA 5DQGA 2J6UA 3LK9A 3MR6A 5KT4A 2R8GA 4KLLA 3RJHA 9ICAA 2VA2A 1UA1A 2MUTA 7ICHA 5DEDA 3RB0A 3MFHA 4DO9A 3T3FA 4KLUA 4F92B 5DDYA 5HRKA 4YQWA 4BWMA 2IHMA 3C1ZA 4F5PA 4EP7A 2KZZA 2DFLA 4YXJA 3MGIA 3EPGA 4DF4A 7ICOA 4XUSA 3JPQA 1U9LA 2GWSA 1RYSA 1R8BA 2ATLA 5KFYA 4X0BA 3PY8A 1X2IA 2HVIA 2NRZA 3UPQA 4TQRA 4ECXA 4RT2A 4X4NA 1U48A 2BCQA 1TFRA 8ICVA 2ZJ8A 4M0AA 1SL0A 2RDJA 3Q8LA 5DB7A 4JWMA 4I2EA 4K4HA 1MIWA 5KFCA 2ZH5A 3MABA 5KFZA 1ZQLA 3PMNA 1A76A 5DG9A 3MFIA 3GV5B 3JPPA 4I2CA 3G6XA 4MFFA 4M2YA 1RZTA 1U45A 5KG6A 2BGWA 4RQ2A 1TAUA 5D49A 4I27A 5IIIA 5DQIA 4EBJA 3MDAA 1TK5A 1XSPA 1KLNA 5HRDA 3RAXA 4FH3A 4Z6FA 3RJGA 1BPBA 4ECWA 4I2IA 5J2GA 2HW3A 4RT3A 4QZ9A 4DL7A 1NK4A 4LZGA 2ZH6A 4QZ8A 3TANA 2UVWA 4M9LA 1R8CA 4WC1A 3WFRE 3V7LA 3OJSA 1ZQGA 4ED0A 1SZPA 3OVAA 4B9TA 5KT6A 5J0UA 1LB2B 2XC9A 4EZ9A 4IR9A 5CB1A 2PBEA 4ZH4A 4F5RA 3T5JA 1NKBA 2O5AA 5J0WA 4TUPA 4NLKA 3M8RA 1KDHA 2I9GA 4Q8EA 2HHWA 4UD5A 3PX4A 2ISPA 4I29A 2F1HA 5DBCA 2Q0ZX 3RRHA 4X4OA 1UT8A 1ZQYA 5DB6A 3JZ0A 2P66A 2DPIA 3RBEA 7ICQA 4NKUA 4KTQA 3SV4A 5KFEA 4UB4A 1S77D 3OVBA 4ATBB 4YVZA 2WTFA 1S10A 1JQRA 4RNNA 4GXIA 1XWLA 4FS1A 4QZDA 2BQRA 1KSPA 3JPOA 2DPJA 4F50A 2BPGA 4FBUA 3QZ7A 2M2VA 3KHGA 3KHHA 7ICJA 4DQPA 1BNPA 4FHWA 3RTVA 4KLGA 2VANA 4B9LA 4DSIA 3B0YA 4I2AA 7ICFA 4DOCA 3UPSA 3V7KA 4X0AA 1NZPA 3PR5B 4RNOA 3UQ2A 2KTQA 1YLQA 5HNKA 3BJYA 3RJIA 3PV8A 8ICJA 3AUOA 1ZQFA 4E7XA 4ED6A 4X4PA 4XRHA 5KFDA 3OHBA 3T5LA 5KG2A 1XSLA 2P6RA 2ID1A 5EWGA 3PVXA 2C22A 1H38A 5KFPA 1K1SA 5IIJA 1NKCA 1BPDA 1EXNA 4UBCA 3EPIA 3QEAZ 4NM1A 3TQ1A 4P4PA 3OSPA 4UD4A 5J2FA 3RAQA 3C2MA 4ED2A 4JV2A 8ICUA 4KLMA 1KTQA 4YD1A 2BDPA 2PI5A 4DOBA 4KLDA 1HJPA 8ICYA 4WC6A 2ZH7A 3AQMA 3C1YA 3BQ2A 3IHQB 5KFXA 4QZHA 2XCPA 4RZRA 2KN7A 3PW0A 1S76D 1MIYA 1ZYQA 4FHYA 3V7JA 4DL2A 5F9LA 4PHDA 2ASJA 1ZQEA 4DFKA 2ISOA 1S0MA 5F9NA 4QZIA 4ECSA 1JMSA 5KFFA 2I1QA 2ASDA 2V9WA 5DGBA 2XY6A 4DSLA 5HRGA 3H4BA 2IHNA 1D9FA 1ZQCA 2AQ0A 1IM4A 3ISDA 2HHVA 5HRLA 1JAJA 2DR7A 4QWCA 3K4GA 4DS4A 3T5KA 4YMNA 2JZBB 5CA7A 4QWDA 1TK8A 5HRHA 4QZGA 1ZQVA 5J2EA 4UAZA 2ZH1A 2XY7A 3C21A 1PX5A 1CEZA 9ICUA 4DWIA 3JYYA 1V9PA 3TAPA 1QTMA 2IA6A 1HUOA 4BWJA 2ZH2A 3AU6A 5J2HA 8ICAA 3B0XA 3GIMA 2FMSA 4DOAA 2B21A 3C5FA 1KFSA 4ECRA 4FHPA 2VA8A 4M9HA 2ZJAA 5KFVA 3MR5A 4MEYA 3GIKA 5CJ7A 1Z00A 1ZQTA 1WCLA 3HPOA 3HX0A 3ZD9A 4R63A 4WBZA 2HVHA 5KFSA 9ICOA 4O5CA 9ICRA 2M2UA 5KFHA 4RQ5A 3RJFA 4MF8A 2KP7A 1NK6A 4BXOB 2M2TA 2BE3A 2ZTCA 5BPCA 1ZQNA 2JEJA 1LV5A 4K4IA 3AU2A 4DQIA 3WFPA 4QW9A 8ICFA 1TK0A 1TAQA 3H3AA 4R66A 1S9FA 1B43A 2ZH3A 4DSKA 5D4BA 5CP2A 1X9WA 4IRDA 4F5QA 3V6JA 3H39A 4RWPA 3MR2A 1NK0A 3JPTA 4JV1A 5J29A 3ISCA 4J9MA 4EYHB 1R89A 2ZUDA 4GXJA 3RJJA 5KG7A 5DKWA 4DL4A 2UVUA 4RPYA 7ICUA 4DSEA 1RXWA 3GQCA 2FMPA 2AGOA 1SKWA 8ICPA 2ASLA 4RQ1A 4UB5A 1MIVA 1NKEA 5L1KA 4J9PA 5CWRA 2DR9A 2W9CA 4X4VA 5KFRA 4Z6DA 1VFGA 5KFLA 4RUCA 2RFFA 4EZ6A 4X4SA 7ICPA 1BPEA 5BOLA 2BCRA 2PXIA 3TFSA 1T4GA 1NK9A 9ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEU A;  4JUZ A;  1CUK A;  2HHQ A;  4X5V A;  5KTQ A;  4O3R A;  2DVI A;  4MF2 A;  3PML A;  2V4R A;  1RPL A;  4KN7 A;  4C8K A;  4YCX A;  2XO7 A;  5J2K A;  4YR3 A;  4TQS A;  3OUY A;  4DQS A;  3PO5 A;  9ICK A;  3TAR A;  1WCN A;  9ICW A;  3PR4 A;  3Q8K A;  3JPR A;  4IR1 A;  4KIT B;  4J9R A;  3RH6 A;  1NK8 A;  1MQ3 A;  4XA5 A;  4O5E A;  4F4X A;  3KHL A;  4F4K A;  2OWO A;  2W8L A;  4ELU A;  4MFA A;  4YD2 A;  5J2I A;  1NJZ A;  3PW7 A;  3HJ1 A;  4AT7 A;  5JUM A;  4LVS A;  3RRG A;  5J0P A;  8ICW A;  2HHS A;  4C8M A;  5KG4 A;  3GIL A;  1Z00 B;  2BCV A;  3V72 A;  1N56 A;  1NK7 A;  3QE9 Y;  5HRF A;  2R8J A;  3ORY A;  4KLQ A;  4K4G A;  4O5K A;  7ICR A;  1L3U A;  4UAY A;  5KFQ A;  5HR9 A;  5J2A A;  1V4A A;  1U4B A;  4TUR A;  3GV8 B;  4RUA A;  4J9Q A;  1UA0 A;  2IBK A;  4C8N A;  5TZV A;  5DGA A;  4DF8 A;  2NRK A;  2P6U A;  1WOT A;  1T3N A;  5HRE A;  2PFQ A;  1XU4 A;  5KG5 A;  3KHR A;  3H38 A;  4O0I A;  4WC0 A;  2M9N A;  3QEB Z;  2BCS A;  1Q79 A;  2KFN A;  2KFZ A;  3MR3 A;  1DOQ A;  1BVS A;  3H8W A;  3T5H A;  4CCH A;  4WC7 A;  3TAQ A;  4UB2 A;  4J9N A;  3BQT A;  5KFU A;  4F5N A;  1HUZ A;  2BR0 A;  1TFW A;  2IMW P;  4O3O A;  5HC9 A;  4TUS A;  4B9M A;  4PGX A;  3WFQ E;  1BNO A;  2FLP A;  2ZHA A;  1JX4 A;  4R64 A;  4DSJ A;  2O1P A;  5KFA A;  3H7I A;  5HHH A;  4X4R A;  3Q8Q B;  1NOM A;  4IQV A;  1BPX A;  4I2D A;  7ICI A;  5J2J A;  4ELT A;  3BQ1 A;  3LDA A;  4BDP A;  2FLN A;  4P4M A;  3EYZ A;  4QWE A;  1D8Y A;  2FMQ A;  2VA3 A;  4KLS A;  9ICB A;  2ALZ A;  9ICI A;  3M9O B;  4KLF A;  2DR8 A;  4DL6 A;  1L5U A;  8ICK A;  1COO A;  1L3V A;  2BPC A;  3M9M B;  2HHU A;  2C28 A;  2A1J B;  5HHI A;  4R8U B;  3MBY A;  4ECU A;  1D9D A;  3OJU A;  9ICX A;  1ZQZ A;  4M9G A;  2JEG A;  5KFI A;  4F8R A;  4G3I A;  7ICN A;  4S3N A;  4ED7 A;  5DB8 A;  4F4W A;  4EBE A;  2AGQ A;  2BPF A;  1XS9 D;  4QZC A;  2KZ3 A;  3Q8S B;  9ICE A;  1Q78 A;  2AU0 A;  4UB1 A;  4YFK A;  3QZ8 A;  1JXL A;  9ICG A;  9ICT A;  4RWN A;  2NRX A;  4RU9 A;  2XCA A;  5IIK A;  3C5G A;  1TFY A;  4DFP A;  4KN4 A;  5KFO A;  1DGS A;  3ISB A;  3LWL A;  2BCU A;  1UT5 A;  4RQ3 A;  9ICH A;  5HMM A;  5DBA A;  4F4Z A;  4ELV A;  5D46 A;  4RQ6 A;  5KG0 A;  3ZDA A;  4E0D A;  3C23 A;  4ECT A;  2JEI A;  1JIH A;  1JXE A;  5J0X A;  3ZDC A;  3H4D A;  2W9M A;  4DEZ A;  3RB3 A;  4MFC A;  3OUY B;  5L9X A;  4Z6E A;  8ICL A;  3AQL A;  1RYR A;  1QSY A;  5EWE A;  4QWA A;  1ZQO A;  1ZQU A;  4RQ7 A;  5HP4 A;  3GII A;  1SKS A;  4PPX A;  3H8S A;  4B9N A;  1Y88 A;  2XY5 A;  1UET A;  4UQG A;  4ECV A;  1NK5 A;  4O3Q A;  3NYB A;  4Q45 A;  1ZQM A;  2J6S A;  1S97 A;  4F3O A;  4O3S A;  3OHA A;  3OV7 A;  5DG8 A;  4PH5 A;  3THV A;  4O9M A;  1S0O A;  4KLI A;  4NY8 A;  4NLZ A;  1ZQQ A;  4X4Q A;  4R65 A;  2HHT A;  4RQ8 A;  8ICZ A;  5C5J A;  2W8K A;  5DLF A;  1ZET A;  5KFT A;  1NJW A;  3HIY A;  2C2R A;  3M9N B;  5KFW A;  4P4O A;  4F91 B;  3HT3 A;  4RNM A;  4F93 B;  5L1J A;  5DG7 A;  4I2B A;  3BQ0 A;  4YN4 A;  5J0R A;  9ICN A;  2NRV A;  2FPK A;  4GLX A;  5DEC A;  1ZQX A;  1KRP A;  4EBD A;  3PO4 A;  4DL3 A;  3JPS A;  4EBC A;  1X9S A;  9ICF A;  1DK2 A;  1KEJ A;  5BOM A;  2W9B A;  1VJ7 A;  4DS5 A;  4DFM A;  2JEF A;  2PI4 A;  2XGQ A;  4M9J A;  4LZD A;  5CHG A;  4P2H A;  2Y1I A;  8ICG A;  8ICS A;  3ZDB A;  4IQT A;  1ZQH A;  1DK3 A;  1XC9 A;  4ED1 A;  4YR2 A;  3TI0 A;  1B22 A;  5KFG A;  4PHP A;  3RB6 A;  2J6T A;  2W9A A;  5IIM A;  3PW2 A;  5DBB A;  4QZB A;  1X9M A;  5DB9 A;  1ZQD A;  9ICL A;  1N48 A;  7ICE A;  4QW8 A;  3RH5 A;  4BXO A;  4WC2 A;  3SYZ A;  4RWO A;  5J0Y A;  5IIL A;  3N4M B;  4MEX A;  4ATB A;  3G6Y A;  5HML A;  4F4Y A;  4IRC A;  2LYH A;  5EWF A;  4M47 A;  4X4T A;  3C2L A;  2NRT A;  4UB3 A;  4AT9 A;  2Y1J A;  2W9B B;  1TVA A;  2DRA A;  4AT7 B;  4XQ8 A;  5CR0 A;  5EOZ A;  4M04 A;  4JK1 A;  5HRB A;  3HJ4 A;  1KFD A;  4DL5 A;  4GC7 A;  2MUT B;  1A77 A;  1QLN A;  4IQW A;  9ICJ A;  5DLG A;  4WC3 A;  3ETL A;  5DQH A;  3H37 A;  3RJE A;  1ARO P;  4KLO A;  9ICM A;  7ICK A;  5KFK A;  7ICS A;  4F2R A;  3RJK A;  1Z3E B;  2H5X A;  1MSW D;  4UBB A;  1U49 A;  3RR8 A;  1D8L A;  4J9L A;  1XO1 A;  1SKR A;  5J0T A;  2PFO A;  8ICM A;  1MC8 A;  3PW5 A;  3MDC A;  7ICT A;  2Q66 A;  2ZH8 A;  1OU5 A;  3WFO A;  3PX6 A;  5HRI A;  3RB4 A;  4FBT A;  1NO5 A;  2AJQ A;  3C18 A;  3GFK B;  4DLG A;  4E8F A;  9ICC A;  1F5A A;  5J0S A;  1JN3 A;  1K1Q A;  4QZE A;  3UXN A;  3H8J A;  4PHA A;  3UXP A;  2ZUC A;  2UVV A;  5KT2 A;  4NXZ A;  3PNC A;  3BDP A;  4B9S A;  3M8S A;  7ICG A;  3OGU A;  3GDX A;  4J9O A;  3EWA A;  9ICV A;  3C2K A;  1TV9 A;  4NLG A;  1L3S A;  4C8L A;  1IXR A;  2A1J A;  4YXM A;  1S0V A;  4ECQ A;  3PX0 A;  4Q43 A;  2NRW A;  3SZ2 A;  8ICQ A;  4RQ4 A;  3FYH A;  2UVR A;  2R8I A;  4M6W B;  4PGQ A;  3EW9 A;  2XGP A;  3IM1 A;  5L1I A;  2AQ4 A;  4TUQ A;  1KFT A;  2FPL A;  3UQ0 A;  4M9N A;  9ICP A;  4WC5 A;  4AT9 B;  3WFS C;  4FHV A;  3Q8P B;  4O3P A;  3LQC B;  5DDM A;  4J9S A;  1NJY A;  2C2E A;  1T7P A;  5L1L A;  1BPZ A;  7ICV A;  5KT5 A;  3HW8 A;  4ECZ A;  1ZQA A;  4YG2 A;  4E80 A;  4DSF A;  4I2F A;  4YMM A;  4RWQ A;  4Q8F A;  3JPN A;  2R8H A;  4QZA A;  4RPX A;  4M5D A;  4WCW A;  1ZJM A;  2ZTD A;  2R8K A;  4GC6 A;  8ICE A;  3ZDE A;  1NJX A;  3NGD A;  1ZQW A;  8ICI A;  3HP6 A;  3GIJ A;  1ZQB A;  2DRB A;  4DLE A;  4YMO A;  3LWM A;  4FH5 A;  4EYI B;  3C66 A;  2W9C B;  3TFR A;  3ZD8 A;  3Q8M A;  2PFN A;  4QWB A;  1T8E A;  2KZM A;  4F5O A;  1L3T A;  4LT6 A;  4WC4 A;  2ZH4 A;  4AT8 B;  4UAW A;  1ZQK A;  4I2G A;  7ICL A;  4RPZ A;  4Q44 A;  3RBD A;  8ICX A;  4PGY A;  3EZ5 A;  4NLN A;  4IQU A;  1ZJN A;  4KLE A;  4XQ7 A;  1S0N A;  2V4Q A;  2AGP A;  3V6K A;  8ICT A;  1R8A A;  1BGX T;  3OVS A;  1ZQR A;  2RDI A;  5IIN A;  4RQ0 A;  8ICR A;  5J2C A;  3SI8 A;  2FLL A;  4ECY A;  5J2D A;  2F1J A;  2MAX A;  2FPM A;  3H40 A;  4DQR A;  2C2D A;  5KG1 A;  4O3N A;  2HHX A;  4YP3 A;  1QSS A;  2PFP A;  2M2W A;  4EEY A;  4I2H A;  5KFJ A;  3FDS A;  3K75 D;  3V6H A;  4JV0 A;  4IRK A;  4Z6C A;  4DQQ A;  4I28 A;  4DFJ A;  5KG3 A;  4HYK A;  4FS2 A;  5F2V O;  3KTQ A;  4X4U A;  1SL2 A;  1UEV A;  3L9D A;  4KLT A;  1ZQS A;  7ICM A;  4FHX A;  3PW4 A;  1FA0 A;  1ZQP A;  4F2S A;  5KT7 A;  1PZN A;  1MQ2 A;  9ICS A;  4QZF A;  8ICO A;  2BQ3 A;  1RXV A;  2BHN A;  4PHE A;  1ZQI A;  4R8U A;  4M6W A;  4EBK A;  2ZUB A;  5J0Q A;  2JZB A;  8ICB A;  4IG8 A;  4FO6 A;  2F1I A;  3MGH A;  4KMU A;  4JWN A;  3ZDD A;  3G6V A;  3AQK A;  5KFB A;  5J0O A;  4B9U A;  3RH4 A;  3N97 B;  4KLH A;  1XSN A;  3E2E A;  2ZHB A;  1KNY A;  1C7Y A;  4J9K A;  4GXK A;  4KLJ A;  8ICN A;  8ICH A;  2ZJ5 A;  4YR0 A;  1TKD A;  5KFM A;  2DR5 A;  4NKT A;  5IIO A;  3RR7 A;  4WBY A;  2HHP A;  4B9V A;  3GV7 B;  2BKE A;  4BGD A;  3OSN A;  3SV3 A;  1BPY A;  5J2B A;  4C8O A;  3Q8R B;  4ED8 A;  5KFN A;  5KT3 A;  3HWT A;  1SL1 A;  2ZTE A;  4AT8 A;  3NTU A;  4NM2 A;  1QSL A;  3AQN A;  3UXO A;  4ED3 A;  1U47 A;  2ZH9 A;  2BQU A;  8ICC A;  1ZQJ A;  4I2J A;  5DQG A;  2J6U A;  3LK9 A;  3MR6 A;  5KT4 A;  2R8G A;  4KLL A;  3RJH A;  9ICA A;  2VA2 A;  1UA1 A;  2MUT A;  7ICH A;  5DED A;  3RB0 A;  3MFH A;  4DO9 A;  3T3F A;  4KLU A;  4F92 B;  5DDY A;  5HRK A;  4YQW A;  4BWM A;  2IHM A;  3C1Z A;  4F5P A;  4EP7 A;  2KZZ A;  2DFL A;  4YXJ A;  3MGI A;  3EPG A;  4DF4 A;  7ICO A;  4XUS A;  3JPQ A;  1U9L A;  2GWS A;  1RYS A;  1R8B A;  2ATL A;  5KFY A;  4X0B A;  3PY8 A;  1X2I A;  2HVI A;  2NRZ A;  3UPQ A;  4TQR A;  4ECX A;  4RT2 A;  4X4N A;  1U48 A;  2BCQ A;  1TFR A;  8ICV A;  2ZJ8 A;  4M0A A;  1SL0 A;  2RDJ A;  3Q8L A;  5DB7 A;  4JWM A;  4I2E A;  4K4H A;  1MIW A;  5KFC A;  2ZH5 A;  3MAB A;  5KFZ A;  1ZQL A;  3PMN A;  1A76 A;  5DG9 A;  3MFI A;  3GV5 B;  3JPP A;  4I2C A;  3G6X A;  4MFF A;  4M2Y A;  1RZT A;  1U45 A;  5KG6 A;  2BGW A;  4RQ2 A;  1TAU A;  5D49 A;  4I27 A;  5III A;  5DQI A;  4EBJ A;  3MDA A;  1TK5 A;  1XSP A;  1KLN A;  5HRD A;  3RAX A;  4FH3 A;  4Z6F A;  3RJG A;  1BPB A;  4ECW A;  4I2I A;  5J2G A;  2HW3 A;  4RT3 A;  4QZ9 A;  4DL7 A;  1NK4 A;  4LZG A;  2ZH6 A;  4QZ8 A;  3TAN A;  2UVW A;  4M9L A;  1R8C A;  4WC1 A;  3WFR E;  3V7L A;  3OJS A;  1ZQG A;  4ED0 A;  1SZP A;  3OVA A;  4B9T A;  5KT6 A;  5J0U A;  1LB2 B;  2XC9 A;  4EZ9 A;  4IR9 A;  5CB1 A;  2PBE A;  4ZH4 A;  4F5R A;  3T5J A;  1NKB A;  2O5A A;  5J0W A;  4TUP A;  4NLK A;  3M8R A;  1KDH A;  2I9G A;  4Q8E A;  2HHW A;  4UD5 A;  3PX4 A;  2ISP A;  4I29 A;  2F1H A;  5DBC A;  2Q0Z X;  3RRH A;  4X4O A;  1UT8 A;  1ZQY A;  5DB6 A;  3JZ0 A;  2P66 A;  2DPI A;  3RBE A;  7ICQ A;  4NKU A;  4KTQ A;  3SV4 A;  5KFE A;  4UB4 A;  1S77 D;  3OVB A;  4ATB B;  4YVZ A;  2WTF A;  1S10 A;  1JQR A;  4RNN A;  4GXI A;  1XWL A;  4FS1 A;  4QZD A;  2BQR A;  1KSP A;  3JPO A;  2DPJ A;  4F50 A;  2BPG A;  4FBU A;  3QZ7 A;  2M2V A;  3KHG A;  3KHH A;  7ICJ A;  4DQP A;  1BNP A;  4FHW A;  3RTV A;  4KLG A;  2VAN A;  4B9L A;  4DSI A;  3B0Y A;  4I2A A;  7ICF A;  4DOC A;  3UPS A;  3V7K A;  4X0A A;  1NZP A;  3PR5 B;  4RNO A;  3UQ2 A;  2KTQ A;  1YLQ A;  5HNK A;  3BJY A;  3RJI A;  3PV8 A;  8ICJ A;  3AUO A;  1ZQF A;  4E7X A;  4ED6 A;  4X4P A;  4XRH A;  5KFD A;  3OHB A;  3T5L A;  5KG2 A;  1XSL A;  2P6R A;  2ID1 A;  5EWG A;  3PVX A;  2C22 A;  1H38 A;  5KFP A;  1K1S A;  5IIJ A;  1NKC A;  1BPD A;  1EXN A;  4UBC A;  3EPI A;  3QEA Z;  4NM1 A;  3TQ1 A;  4P4P A;  3OSP A;  4UD4 A;  5J2F A;  3RAQ A;  3C2M A;  4ED2 A;  4JV2 A;  8ICU A;  4KLM A;  1KTQ A;  4YD1 A;  2BDP A;  2PI5 A;  4DOB A;  4KLD A;  1HJP A;  8ICY A;  4WC6 A;  2ZH7 A;  3AQM A;  3C1Y A;  3BQ2 A;  3IHQ B;  5KFX A;  4QZH A;  2XCP A;  4RZR A;  2KN7 A;  3PW0 A;  1S76 D;  1MIY A;  1ZYQ A;  4FHY A;  3V7J A;  4DL2 A;  5F9L A;  4PHD A;  2ASJ A;  1ZQE A;  4DFK A;  2ISO A;  1S0M A;  5F9N A;  4QZI A;  4ECS A;  1JMS A;  5KFF A;  2I1Q A;  2ASD A;  2V9W A;  5DGB A;  2XY6 A;  4DSL A;  5HRG A;  3H4B A;  2IHN A;  1D9F A;  1ZQC A;  2AQ0 A;  1IM4 A;  3ISD A;  2HHV A;  5HRL A;  1JAJ A;  2DR7 A;  4QWC A;  3K4G A;  4DS4 A;  3T5K A;  4YMN A;  2JZB B;  5CA7 A;  4QWD A;  1TK8 A;  5HRH A;  4QZG A;  1ZQV A;  5J2E A;  4UAZ A;  2ZH1 A;  2XY7 A;  3C21 A;  1PX5 A;  1CEZ A;  9ICU A;  4DWI A;  3JYY A;  1V9P A;  3TAP A;  1QTM A;  2IA6 A;  1HUO A;  4BWJ A;  2ZH2 A;  3AU6 A;  5J2H A;  8ICA A;  3B0X A;  3GIM A;  2FMS A;  4DOA A;  2B21 A;  3C5F A;  1KFS A;  4ECR A;  4FHP A;  2VA8 A;  4M9H A;  2ZJA A;  5KFV A;  3MR5 A;  4MEY A;  3GIK A;  5CJ7 A;  1Z00 A;  1ZQT A;  1WCL A;  3HPO A;  3HX0 A;  3ZD9 A;  4R63 A;  4WBZ A;  2HVH A;  5KFS A;  9ICO A;  4O5C A;  9ICR A;  2M2U A;  5KFH A;  4RQ5 A;  3RJF A;  4MF8 A;  2KP7 A;  1NK6 A;  4BXO B;  2M2T A;  2BE3 A;  2ZTC A;  5BPC A;  1ZQN A;  2JEJ A;  1LV5 A;  4K4I A;  3AU2 A;  4DQI A;  3WFP A;  4QW9 A;  8ICF A;  1TK0 A;  1TAQ A;  3H3A A;  4R66 A;  1S9F A;  1B43 A;  2ZH3 A;  4DSK A;  5D4B A;  5CP2 A;  1X9W A;  4IRD A;  4F5Q A;  3V6J A;  3H39 A;  4RWP A;  3MR2 A;  1NK0 A;  3JPT A;  4JV1 A;  5J29 A;  3ISC A;  4J9M A;  4EYH B;  1R89 A;  2ZUD A;  4GXJ A;  3RJJ A;  5KG7 A;  5DKW A;  4DL4 A;  2UVU A;  4RPY A;  7ICU A;  4DSE A;  1RXW A;  3GQC A;  2FMP A;  2AGO A;  1SKW A;  8ICP A;  2ASL A;  4RQ1 A;  4UB5 A;  1MIV A;  1NKE A;  5L1K A;  4J9P A;  5CWR A;  2DR9 A;  2W9C A;  4X4V A;  5KFR A;  4Z6D A;  1VFG A;  5KFL A;  4RUC A;  2RFF A;  4EZ6 A;  4X4S A;  7ICP A;  1BPE A;  5BOL A;  2BCR A;  2PXI A;  3TFS A;  1T4G A;  1NK9 A;  9ICQ A; 
#chains in the Genus database with same CATH topology
 2HHQ A;  1NNL A;  4X5V A;  4O3R A;  2PMZ F;  5EE1 A;  1RPL A;  1CRX A;  2EAM A;  3IN5 A;  3TAR A;  1X42 A;  3JPR A;  1PVQ A;  4IR1 A;  4KIT B;  3HJE A;  1UHU A;  2W8L A;  4MFA A;  1NJZ A;  5JUM A;  3WKD A;  4NL9 C;  3V72 A;  2BCV A;  3QU7 A;  3CYM A;  3I76 A;  2R8J A;  4C4T A;  2G5H B;  4O5K A;  3L3F X;  5KFQ A;  4TUR A;  1UA0 A;  2DF4 B;  5DGA A;  2P6U A;  1WOT A;  2H3V A;  3H38 A;  2I5H A;  3QEB Z;  3WK5 A;  3H8W A;  4CCH A;  4UB2 A;  4O67 A;  1HUZ A;  4O3O A;  4B9M A;  2B56 A;  4PGX A;  3WFQ E;  2GOL A;  5AM4 A;  3H7I A;  3Q8Q B;  7ICI A;  2FMQ A;  1KN5 A;  9ICB A;  3M9O B;  1A6S A;  8ICK A;  2BPC A;  3OJU A;  2Z7J A;  2JEG A;  4M9G A;  2K4E A;  4QZC A;  3Q8S B;  3QZ8 A;  1JXL A;  4RWN A;  1K5O A;  5KFO A;  4DFP A;  4RQ3 A;  1UT5 A;  4ELV A;  5DBA A;  2YMQ A;  2HOI A;  1L6N A;  3PHZ A;  5CFT A;  2ZIU B;  5F3X B;  4DEZ A;  3B9J A;  3ETR A;  2KSO A;  4RQ7 A;  2LMR A;  1Y88 A;  1UET A;  2J6S A;  1S97 A;  3OHA A;  5DG8 A;  3THV A;  1S0O A;  2HHT A;  2EZZ A;  2W8K A;  3H8M A;  4RNM A;  4I2B A;  3FAH A;  5J0R A;  5ALE A;  2FPK A;  4GLX A;  5AKK A;  1ZQX A;  4O68 A;  3SQI A;  4DL3 A;  1DK2 A;  4EBC A;  2RHF A;  4Y2Q A;  4DS5 A;  4DFM A;  2XGQ A;  8ICG A;  2N1R A;  5ALK A;  2Y1I A;  1B22 A;  2KJ9 A;  5KFG A;  1X9M A;  4ACO A;  2JR5 A;  1N48 A;  4LEW A;  4NLC A;  4QW8 A;  3RH5 A;  2YTU A;  2IUB A;  4NXV A;  3D6J A;  2LYH A;  1L7P A;  5EWF A;  4M47 A;  5AI8 A;  3C2L A;  4JMU A;  1TVA A;  4WJ3 B;  1N5X A;  4ATB A;  3ER8 C;  2F8L A;  3HJ4 A;  1QLN A;  1A77 A;  1C20 A;  3PSF A;  1N61 A;  7ICK A;  7ICS A;  3ERC C;  4OJP A;  3RJK A;  2H5X A;  1JUD A;  5AI5 A;  7ICT A;  2Q66 A;  3ONN A;  2VIX A;  5EE0 A;  5HRI A;  3QUQ A;  3RB4 A;  1B4F A;  3BZK A;  3AMZ A;  4AYB F;  3DEE A;  4E8F A;  9ICC A;  1K1Q A;  1OUQ A;  3UXN A;  3AM9 A;  3UXP A;  5KT2 A;  2YN4 A;  2LKY A;  1TV9 A;  4C8L A;  1IXR A;  2A1J A;  2HN2 A;  1S0V A;  4Q43 A;  3GU3 A;  2YB4 A;  2R8I A;  3EW9 A;  2AQ4 A;  4IS7 A;  3AEV A;  3SR6 A;  3WFS C;  2KEY A;  4PL1 A;  3I28 A;  2W03 A;  3Q8P B;  5DDM A;  1NJY A;  2BBH A;  1JI7 A;  5ALF A;  4RWQ A;  1WWV A;  4QZA A;  4RPX A;  2D6F C;  5J8Y C;  4K9A A;  4GC6 A;  2RP5 A;  2DRB A;  4DLE A;  3IG8 A;  4FH5 A;  4EYI B;  3TFR A;  3ZD8 A;  3Q8M A;  4WQK A;  1T8E A;  4GIB A;  4LT6 A;  2YMM A;  7ICL A;  1ZQK A;  4I2G A;  4Q44 A;  2E8N A;  8ICT A;  5IIN A;  4RQ0 A;  3SI8 A;  2KKV A;  4ECY A;  2F1J A;  2C2D A;  2HHX A;  1DXS A;  2M2W A;  4I2H A;  5KFJ A;  3FDS A;  5ALZ A;  3K75 D;  3V6H A;  4JV0 A;  4IRK A;  4Z6C A;  4FS2 A;  1ZQS A;  3NVY A;  4FZM A;  2W04 A;  3T79 A;  1ZQP A;  5KT7 A;  5A0L A;  4QZF A;  2BQ3 A;  2A1A A;  4M6W A;  1N60 A;  1XNS A;  3J81 j;  2JZB A;  2Y0S F;  4FO6 A;  4KMU A;  5J0O A;  2A19 A;  1Z1V A;  2GO7 A;  1C7Y A;  4NV0 A;  2JH7 A;  5D62 A;  3QU5 A;  5J2B A;  2A3V A;  3GZF A;  1QSL A;  3UXO A;  5ALG A;  8ICC A;  1ZQJ A;  2J6U A;  3E58 A;  4KLL A;  4O3M A;  1ZD4 A;  2WF7 A;  5DDY A;  2DGZ A;  4YQW A;  2IHM A;  5AI9 A;  4DF4 A;  4JLX A;  4XUS A;  3M7D A;  3AQE A;  1X2I A;  2HVI A;  2NRZ A;  2K60 A;  4TQR A;  1SV4 A;  4X4N A;  2BCQ A;  2ZJ8 A;  1SL0 A;  3Q8L A;  5DB7 A;  4P0P A;  5GTI U;  4K4H A;  2ZH5 A;  5KFZ A;  1A76 A;  2RLT A;  4MFF A;  2DL0 A;  3G6X A;  5KG6 A;  2JGA A;  2BGW A;  5DQI A;  2FDR A;  1J97 A;  1TK5 A;  5HRD A;  2KOB A;  5J2G A;  2DQN B;  4JB3 A;  4RT3 A;  3VC8 A;  4QZ8 A;  2UVW A;  4N7R A;  4WC1 A;  2LBO A;  2WAQ F;  4F5R A;  4QJF B;  4TUP A;  2HCF A;  3NAS A;  1OXJ A;  5AM1 A;  2F1H A;  5DBC A;  1ZQY A;  3JZ0 A;  2P66 A;  4UB4 A;  3OVB A;  4UB6 U;  4YVZ A;  1JQR A;  4GXI A;  1KSP A;  4F50 A;  3QZ7 A;  3IDW A;  1BNP A;  4KLG A;  3NKU A;  2FJ6 A;  2B0C A;  2E8O A;  1YLQ A;  5TIS U;  4USA A;  3BJY A;  3PV8 A;  3AUO A;  1ZQF A;  3BS7 A;  4X4P A;  3T5L A;  5ALN A;  5EWG A;  1FO4 A;  1NKC A;  1BPD A;  4UBC A;  3EPI A;  1DRG A;  4NM1 A;  4UD4 A;  4ED2 A;  8ICU A;  1KTQ A;  4YD1 A;  2W7P A;  2PI5 A;  5J8Y A;  4WC6 A;  3C1Y A;  3BQ2 A;  5KFX A;  4G9B A;  2ASJ A;  2ASD A;  5KFF A;  2I1Q A;  4DSL A;  4OD0 A;  2IHN A;  2KNJ A;  2AQ0 A;  3UMC A;  4EX6 A;  3ISD A;  1ZQC A;  3K4G A;  4YMN A;  1ZQV A;  5J2E A;  2ZH1 A;  2XY7 A;  1CEZ A;  2ZH2 A;  3TAP A;  1HUO A;  4BWJ A;  8ICA A;  2E1E A;  3GIM A;  2B21 A;  3C5F A;  2G5I B;  3PSP A;  3A0B U;  1CI4 A;  4ECR A;  4FHP A;  4M9H A;  3QU9 A;  4MEY A;  5CJ7 A;  5KFS A;  2KE7 A;  1NK6 A;  3ER9 B;  1LV5 A;  4DQI A;  4QW9 A;  5AM3 A;  4Y2X A;  4R66 A;  1S9F A;  3NWI A;  5CP2 A;  5CFS A;  3H39 A;  1X6I A;  3JPT A;  4K96 A;  5ALO A;  4EYH B;  3ISC A;  2ZUD A;  4GXJ A;  4QIW F;  2UVU A;  7ICU A;  5AKL A;  2GH1 A;  2AGO A;  5AM0 A;  4RQ1 A;  2VJ5 A;  2WF9 A;  1NKE A;  5L1K A;  2W7O A;  5KFR A;  4RUC A;  4X4S A;  7ICP A;  1BPE A;  1SV0 C;  2BCR A;  3TFS A;  1NK9 A;  9ICQ A;  1UEU A;  1SB3 C;  4MF2 A;  4YCX A;  4WH5 A;  5J2K A;  3KBB A;  3OUY A;  3PO5 A;  2KK0 A;  1WCN A;  2LHT A;  1ZRM A;  3PR4 A;  3Q8K A;  3WK6 A;  4A8E A;  1NK8 A;  3N7R C;  3KHL A;  2ZXH A;  2OWO A;  4UAS A;  3HJ1 A;  4AT7 A;  5J0P A;  2HHS A;  2HOQ A;  4UB8 U;  5KG4 A;  4U7C A;  1N63 A;  5HRF A;  4K4G A;  1L3U A;  1U4B A;  2IBK A;  2Y0S C;  1T3N A;  1YT3 A;  2H3Q A;  4O0I A;  4WC0 A;  2M9N A;  1Q79 A;  3MCR A;  2K4I A;  2EAN A;  4C7Y A;  2Y9T A;  4WC7 A;  3TAQ A;  2KG5 A;  4J9N A;  2H3I A;  2IMW P;  1OW5 A;  4TUS A;  4PL2 A;  3LVV A;  4DSJ A;  5HHH A;  4IQV A;  3N7P D;  4BDP A;  4QWE A;  4KLS A;  4Y2T A;  3AQF A;  5B3Q A;  4OAI Z;  1COO A;  3MC1 A;  2C28 A;  4R8U B;  4Y2V A;  5KFI A;  4S3N A;  4ED7 A;  2G08 A;  1SIJ A;  1SZH A;  1XS9 D;  2KZ3 A;  2PKE A;  9ICG A;  2F44 A;  2NRX A;  1TFY A;  2HBM A;  2K89 A;  3ISB A;  3LWL A;  3AQN A;  3NRW A;  4F4Z A;  4E0D A;  5D46 A;  4Y2Y A;  4CNQ A;  1JXE A;  5J0X A;  4NL9 A;  3ZDC A;  2KIV A;  4MFC A;  4AP9 A;  8ICL A;  9ICN A;  5EWE A;  2IOH A;  4PPX A;  1ZXI A;  4B9N A;  5CEH A;  4UQG A;  4ECV A;  5B66 U;  3S6J A;  4Q45 A;  1ZQM A;  4PH5 A;  4KLI A;  4NY8 A;  3D2S A;  5DLF A;  5KFT A;  4K97 A;  5EE3 A;  5EE9 A;  5KFW A;  3HT3 A;  5DG7 A;  1SV0 A;  2HBL A;  4AYB C;  5DEC A;  4FZN A;  1KRP A;  4NXX A;  3PO4 A;  1X9S A;  4K98 A;  9ICF A;  2W9B A;  4P0Q B;  2JEF A;  2CPR A;  2PI4 A;  2RRD A;  4P2H A;  4LZD A;  1DK3 A;  2RQ5 A;  3RB6 A;  5IIM A;  3PW2 A;  4QZB A;  4DFD A;  3M6Z A;  3TAD C;  3UM9 A;  4BXO A;  4RWO A;  4MEX A;  4F4Y A;  4IRC A;  3H0L B;  2HN1 A;  4NLB A;  2QB1 A;  5ALY A;  4AT7 B;  1IIP A;  5CR0 A;  4JK1 A;  1KFD A;  4GC7 A;  2MUT B;  2E8M A;  4IQW A;  1ZRN A;  5ALD A;  5DQH A;  3VCB A;  1Z1B A;  1MSW D;  3KOO A;  3A0H U;  5ALW A;  1U49 A;  1JRP A;  2PFO A;  1XO1 A;  3PW5 A;  3MDC A;  3WFO A;  1NO5 A;  4CDG A;  2QB0 B;  5AHX A;  3H8J A;  2UVV A;  3KKA A;  3BDP A;  4B9S A;  5ALP A;  3M8S A;  2G0A A;  1HIW A;  1L3S A;  4O69 A;  1UQV A;  1J2N A;  2L5Y A;  2YB1 A;  4ICA A;  2NRW A;  3E0F A;  2XGP A;  3IM1 A;  4U6P A;  5L1I A;  1KFT A;  2FPL A;  3UQ0 A;  2LI6 A;  5ALX A;  5ALJ A;  3LQC B;  4J9S A;  1T7P A;  2O1P A;  1BPZ A;  2EZX A;  4YG2 A;  4E80 A;  4Q8F A;  3JPN A;  5AKI A;  1ZJM A;  2ZTD A;  1LKY A;  2R8K A;  2MA1 A;  3ZDE A;  1WG8 A;  4YMO A;  3IP4 B;  3C66 A;  2ZH4 A;  1PK3 A;  4F5O A;  3KD3 A;  8ICX A;  4BX9 C;  4IQU A;  1ZJN A;  4HAI A;  1BGX T;  4C4R A;  8ICR A;  1PK1 A;  2FLL A;  5J2D A;  2OH2 A;  4I28 A;  4DFJ A;  5KG3 A;  5F2V O;  4X4U A;  1UEV A;  3BS5 A;  7ICM A;  1FA0 A;  2HOF A;  1Q46 A;  1MQ2 A;  3FC4 A;  8ICO A;  1ZQI A;  4R8U A;  3QXG A;  5J0Q A;  8ICB A;  3MGH A;  5AKG A;  3N97 B;  4KLH A;  1XSN A;  1KNY A;  4J9K A;  8ICN A;  1UCV A;  2ZJ5 A;  2DR5 A;  5JTG A;  4NKT A;  5IIO A;  4WBY A;  2HHP A;  3SV3 A;  4UW9 A;  4ED8 A;  5KT3 A;  1FFU A;  3HWT A;  1SL1 A;  4ED3 A;  1U47 A;  2BQU A;  5ALQ A;  5KT4 A;  2R8G A;  4CGZ A;  1UA1 A;  2MUT A;  5DED A;  2YX8 A;  2ATL A;  5KFY A;  2WHE A;  3PY8 A;  1YZ6 A;  4ECX A;  4OJ6 A;  1U48 A;  3BS5 B;  3KKA C;  2CN1 A;  8ICV A;  4JWM A;  4I2E A;  3MFI A;  3GV5 B;  2OM6 A;  2G07 A;  5D49 A;  1Q3U A;  3L4P A;  1XSP A;  2H3F A;  1KLN A;  3RAX A;  4FH3 A;  4Z6F A;  2K4P A;  3RJG A;  1BPB A;  2F2A B;  4I2I A;  2D8C A;  2KMD A;  2HW3 A;  4DL7 A;  2ZH6 A;  4LZG A;  1R8C A;  3TAN A;  2G09 A;  5AM2 A;  3V7L A;  1ZQG A;  1QQ7 A;  4B9T A;  5KT6 A;  4EZ9 A;  4IR9 A;  4ZH4 A;  4CE6 A;  3T5J A;  2O5A A;  1UPH A;  4NLK A;  2AH5 A;  2I9G A;  4Q8E A;  2ISP A;  3IRU A;  2DPI A;  2NO5 A;  4KTQ A;  5KFE A;  3WKC A;  1ECW A;  3CP8 A;  3H0R B;  4RNN A;  2BQR A;  2E8P A;  2BPG A;  2M2V A;  3KHG A;  7ICJ A;  5AKZ A;  5E79 U;  4B9L A;  4I2A A;  4X0A A;  1NZP A;  3PR5 B;  5AK4 A;  4B6J A;  4RNO A;  2NV3 A;  3QYP A;  8ICJ A;  2AHO B;  1P7D A;  1RDF A;  3OHB A;  2ESE A;  2C22 A;  5IIJ A;  1EXN A;  4OAF A;  3OSP A;  5J2F A;  4JV2 A;  4KLM A;  2BDP A;  4DOB A;  1HJP A;  4FZL A;  3IHQ B;  2XCP A;  1MIY A;  3QUC A;  2KN7 A;  2OEH A;  5F9L A;  1Q8K A;  4PHD A;  1ZQE A;  2ISO A;  5HC9 A;  1S0M A;  2V9W A;  2PMZ C;  1LKY B;  3H4B A;  3HRD D;  2DR7 A;  4DS4 A;  3T5K A;  2JZB B;  5HRH A;  2JXJ A;  3UMG A;  9ICU A;  3JYY A;  1X40 A;  3MR5 A;  1ZQT A;  2KIW A;  3HPO A;  4CF4 A;  4DCC A;  4RQ5 A;  2BE3 A;  5G5H A;  2ZTC A;  5BPC A;  3AU2 A;  3WFP A;  8ICF A;  1TAQ A;  2ZH3 A;  2EAO A;  3HIL A;  4IRD A;  3V6J A;  4K99 A;  4OJO A;  1NK0 A;  5AKJ A;  5AI4 A;  1R89 A;  4J9M A;  1PVP A;  4DSE A;  4UAT A;  1X9X A;  1SKW A;  1MIV A;  4J9P A;  5CWR A;  2RFF A;  1X6J A;  4JUZ A;  1CUK A;  5AKH A;  2JMG A;  2DVI A;  2V4R A;  4KN7 A;  4C8K A;  4YR3 A;  4TQS A;  2EZY A;  5HR6 A;  9ICK A;  3NVZ A;  4CRX A;  4J9R A;  5FP0 A;  1MQ3 A;  4XA5 A;  4O5E A;  4F4X A;  4P0P B;  4ELU A;  4YD2 A;  3PW7 A;  4LVS A;  8ICW A;  4C8M A;  3GIL A;  3K1Z A;  1N56 A;  1NK7 A;  4KLQ A;  5B5E U;  7ICR A;  4UAY A;  2IHO A;  2W54 A;  1Q3V A;  4RUA A;  4J9Q A;  2B4V A;  4EGW A;  2ZXI A;  5KNI A;  5HRE A;  5KG5 A;  3WKB A;  1KW4 A;  1MN8 A;  3ZI4 A;  3WK7 A;  2KFN A;  1DOQ A;  1BVS A;  5KL1 B;  1FIQ A;  1NZB A;  3T5H A;  2FI1 A;  3BQT A;  5KFU A;  5G5G A;  4CF5 A;  2WB1 F;  1JAL A;  4BUG A;  5ALT A;  1BNO A;  5AKE A;  2ZHA A;  1JX4 A;  1QH9 A;  1BPX A;  1AQ6 A;  4I2D A;  5AKX A;  4US9 A;  4ELT A;  3BQ1 A;  3LDA A;  2FLN A;  4P4M A;  3EYZ A;  2M0N A;  1D8Y A;  2VA3 A;  3MGV A;  2ALZ A;  9ICI A;  4KLF A;  2KVC A;  1L5U A;  3AN1 A;  1L3V A;  2HHU A;  4ECU A;  1D9D A;  9ICX A;  1ZQZ A;  7ICN A;  4G3I A;  2QKQ A;  4RQN A;  4J03 A;  5AIC A;  5DB8 A;  2AGQ A;  2BPF A;  1Z19 A;  1F0M A;  1Q78 A;  2AU0 A;  2GLE A;  4YFK A;  9ICT A;  1L8O A;  3U26 A;  5IIK A;  2E5S A;  2BCU A;  1DGS A;  5HMM A;  3TKA A;  4RQ6 A;  5KG0 A;  1JIH A;  2F3N A;  3HKZ F;  2AXT U;  4MKP A;  3OUY B;  5L9X A;  4OJ5 A;  1TAM A;  1SXE A;  2B6G A;  5AK5 A;  1ZQO A;  1ZQU A;  1QSY A;  3GII A;  2KHQ A;  2XY5 A;  1NK5 A;  2CRX A;  4X4Q A;  5C5J A;  5GTH U;  1ZET A;  3KZI U;  2EAP A;  3HIY A;  3K7D A;  2C2R A;  3N28 A;  4F91 B;  5ALI A;  4F93 B;  5L1J A;  1TE2 A;  2NRV A;  2Q4T A;  4EBD A;  3JPS A;  5KAI U;  1WYG A;  1KEJ A;  2BZF A;  2B51 A;  3F2D A;  4M9J A;  5CHG A;  8ICS A;  3NS1 A;  1XC9 A;  4ED1 A;  4YR2 A;  3TI0 A;  4OAG A;  2J6T A;  4PJ0 U;  1ZQD A;  9ICL A;  1ZD3 A;  2HSZ A;  4WC2 A;  1V38 A;  5IIL A;  3N4M B;  3G6Y A;  4KX3 A;  4P0Q A;  4X4T A;  2DUY A;  4UB3 A;  4AT9 A;  4UAR A;  2Y1J A;  1PUZ A;  4XQ8 A;  1O03 A;  5DLG A;  1S5L U;  1ARO P;  3D2Q A;  2DKX A;  4KLO A;  9ICM A;  2WAQ C;  4F2R A;  4UBB A;  3RR8 A;  1PK1 B;  1SKR A;  8ICM A;  4FBT A;  2AJQ A;  3C18 A;  3GFK B;  2KVS A;  1F5A A;  5J0S A;  4QZE A;  4HX0 A;  2ZUC A;  4NXZ A;  3PNC A;  5JRT A;  2KJ8 A;  4J9O A;  3EWA A;  9ICV A;  4NLG A;  2XIC A;  4YXM A;  4ECQ A;  3SEI A;  1SWW A;  8ICQ A;  4RQ4 A;  2P35 A;  2UVR A;  4M6W B;  4PGQ A;  4WC5 A;  4TUQ A;  3HW8 A;  4DSF A;  3TAD A;  2R8H A;  4M5D A;  2JRZ A;  4WCW A;  8ICE A;  2O6K A;  3GIJ A;  1ZQB A;  3LWM A;  2W9C B;  1DGJ A;  2KZM A;  4WC4 A;  2DWQ A;  4AT8 B;  4UAW A;  2OHF A;  5H2F U;  4RPZ A;  4KLE A;  2V4Q A;  2AGP A;  3V6K A;  1R8A A;  1ZQ1 C;  4CF3 A;  1ZQR A;  2RDI A;  3PSI A;  5J2C A;  1ED1 A;  3H40 A;  4DQR A;  3D2N A;  5KG1 A;  3WK8 A;  4YP3 A;  1QSS A;  4DQQ A;  3ICX A;  4HYK A;  2OCE A;  3SD7 A;  3KTQ A;  4FFD A;  1SL2 A;  4FHX A;  4F2S A;  1RXV A;  3CRX A;  4NXT A;  2FE9 A;  2G06 A;  4EBK A;  2ZUB A;  1KKX A;  3NVO A;  4IG8 A;  2F1I A;  4JWN A;  3G6V A;  3AQK A;  3C28 A;  5KFB A;  4B9U A;  4OAH A;  3RH4 A;  2VJ4 A;  1LVH A;  2ZHB A;  4EEN A;  1RYU A;  4KLJ A;  4YR0 A;  2YMP A;  1SXD A;  3RR7 A;  5L1M A;  4GFJ A;  4B9V A;  2BKE A;  4BGD A;  3OSN A;  1BPY A;  2LPE A;  2ZTE A;  3DV9 A;  3NTU A;  2ZH9 A;  4I2J A;  2HBK A;  3LK9 A;  2IOF A;  3MR6 A;  2HI0 A;  2VA2 A;  3JCF A;  7ICH A;  3RB0 A;  3MFH A;  5ALR A;  4KLU A;  4F92 B;  5HRK A;  4BWM A;  3C1Z A;  4F5P A;  4K8V A;  2KZZ A;  4YXJ A;  2KSO B;  7ICO A;  3F53 A;  1R8B A;  1U9L A;  2GWS A;  1Z4N A;  2CXY A;  1F5S A;  4M0A A;  1MIW A;  5HR7 A;  5DG9 A;  5KL8 B;  4I2C A;  5T14 A;  2HDO A;  1ZD2 P;  5III A;  4EBJ A;  3MDA A;  4OO1 J;  3PZP A;  4NWI A;  4ECW A;  2ZIV A;  3QUB A;  3TAC B;  4M9L A;  4I0U A;  3OJS A;  2KKP A;  4ED0 A;  4FE3 A;  1ZOL A;  5CB1 A;  1NKB A;  5J0W A;  1KDH A;  2HHW A;  4UD5 A;  3PX4 A;  4EV6 A;  2F77 X;  3RRH A;  3O0F A;  1UT8 A;  4QNL A;  5DB6 A;  2WF6 A;  5JTI A;  3IV6 A;  4IC9 A;  2NO4 A;  1GO3 F;  1J2M A;  1XWL A;  2XVT A;  3JPO A;  4EEB A;  3KHH A;  4DQP A;  4FHW A;  3RTV A;  2MSN A;  4DOC A;  4FO1 A;  3V7K A;  1URJ A;  3UQ2 A;  2KJ5 A;  5HNK A;  2XI9 A;  3RJI A;  3WKA A;  4ED6 A;  4C0Z A;  4XRH A;  5KFD A;  5C0Y A;  1H38 A;  3PVX A;  5KAF U;  1K1S A;  5AM5 A;  4PZO A;  3C2M A;  4KLD A;  8ICY A;  2EWR A;  2ZH7 A;  3AQM A;  1S76 D;  4QZH A;  4RZR A;  2WB1 C;  3UMB A;  1ZYQ A;  4I29 A;  5F9N A;  4QZI A;  1JMS A;  2XY6 A;  1JAJ A;  2KHV A;  2HHV A;  1JRO A;  5HRL A;  4QWD A;  1TK8 A;  5ALM A;  3C21 A;  3OWG A;  4DWI A;  1QTM A;  5AI0 A;  2BDU A;  3B0X A;  2W11 A;  2VA8 A;  2F76 X;  1WCL A;  3HX0 A;  4Y2J A;  9ICO A;  9ICR A;  5KFH A;  4MF8 A;  4BXO B;  2QAR A;  4BJQ A;  1ZQN A;  1B0X A;  4K4I A;  5AIA A;  1XO0 A;  3NRZ A;  1TK0 A;  2DBY A;  1FFV A;  4DSK A;  5D4B A;  1X9W A;  2EQY A;  4KM5 A;  3KFU F;  5J29 A;  2OXO A;  5DKW A;  1VLB A;  4O6A A;  1RXW A;  3GQC A;  8ICP A;  2ASL A;  4F72 A;  2LM1 A;  4UB5 A;  1KL9 A;  2DR9 A;  1L7M A;  2W9C A;  4X4V A;  3F5E A;  2YML A;  1HEK A;  3L5K A;  4EZ6 A;  5CHE A;  2XID A;  3K1R B;  5KTQ A;  4K9B A;  4OJL A;  4UAV A;  3PML A;  2MU2 A;  2XO7 A;  4DQS A;  9ICW A;  2W3R A;  1QCK A;  2EH9 A;  1L8L A;  3RH6 A;  2NYV A;  4F4K A;  5J2I A;  3CW2 C;  4Y2S A;  2W55 A;  3RRG A;  1Z00 B;  2LYA A;  3QE9 Y;  3ORY A;  2E1F A;  5J2A A;  1V4A A;  1N5W A;  4EEK A;  3GV8 B;  4WQL A;  4C8N A;  5TZV A;  2NRK A;  4DF8 A;  2K8C B;  2PFQ A;  1XU4 A;  2WFA A;  3KHR A;  3WKE A;  2BCS A;  2KFZ A;  3MR3 A;  1QQ5 A;  4F5N A;  2BR0 A;  1TFW A;  2ZIV B;  3OTQ A;  4EEL A;  2WF8 A;  2FLP A;  1O08 A;  4LEV A;  4R64 A;  3ALR A;  5KFA A;  3LYS A;  4X4R A;  1NOM A;  3QU4 A;  5J2J A;  5JU5 A;  3NUQ A;  3WK4 A;  3NVV A;  2IOF K;  2DR8 A;  4DL6 A;  3M9M B;  4EX7 A;  2A1J B;  5HHI A;  3MBY A;  4F8R A;  3SAF A;  4F4W A;  4EBE A;  1GPJ A;  3RFA A;  9ICE A;  1RM6 C;  4UB1 A;  4RU9 A;  2XCA A;  3C5G A;  2FCL A;  4KN4 A;  2YQE A;  9ICH A;  5HR9 A;  3EUB 2;  3BQ7 A;  3QX7 A;  5ALL A;  2JEI A;  3ZDA A;  3C23 A;  4UAU A;  1SGG A;  4ECT A;  3H4D A;  2W9M A;  3RB3 A;  4Z6E A;  3AQL A;  1RYR A;  4QWA A;  5HP4 A;  2QB0 A;  1SKS A;  3H8S A;  2K8A A;  3NYB A;  4O3Q A;  4F3O A;  3ED5 A;  4O3S A;  3OV7 A;  4O9M A;  2VKQ A;  3SAG A;  4NLZ A;  1ZQQ A;  4R65 A;  4RQ8 A;  8ICZ A;  5CRX A;  2JH1 A;  1NJW A;  4C7Z A;  1Z4O A;  3M9N B;  4P4O A;  4F71 A;  5K4L A;  3BQ0 A;  4YN4 A;  5ALV A;  3KZX A;  2JHD A;  1D8B A;  1VJ7 A;  5ALS A;  2E3T A;  4KX5 A;  5BOM A;  1VDV A;  1M6Y A;  2KIC A;  3ZDB A;  4IQT A;  1ZQH A;  3OPX A;  1A0P A;  1YZ7 A;  4PHP A;  2W9A A;  2H3Z A;  5DBB A;  1F44 A;  3LVW A;  5DB9 A;  1WUD A;  7ICE A;  3SYZ A;  5J0Y A;  4KMO B;  1PVR A;  5HML A;  3C29 A;  3HKZ C;  3M6K A;  3EF2 A;  5AKY A;  2NRT A;  2W9B B;  2DRA A;  5AIB A;  5EOZ A;  4M04 A;  5HRB A;  4JLZ A;  4DL5 A;  4Y2R A;  3R9K A;  3WU2 U;  9ICJ A;  4WC3 A;  3ETL A;  3H37 A;  3RJE A;  5KFK A;  4KB6 A;  1Z3E B;  1D8L A;  4J9L A;  2ZIU A;  5J0T A;  1MC8 A;  1OU5 A;  3PX6 A;  2R18 A;  4DLG A;  1IG6 A;  2HMX A;  2W3S A;  1JN3 A;  2K4H A;  4PHA A;  7ICG A;  3OGU A;  3GDX A;  1N62 A;  3C2K A;  3PX0 A;  3SZ2 A;  2QAR B;  3FYH A;  2ZH8 A;  4M9N A;  9ICP A;  4AT9 B;  4FHV A;  4O3P A;  7ICV A;  2C2E A;  5L1L A;  5KT5 A;  4ECZ A;  1ZQA A;  3NVW A;  4XJE A;  4I2F A;  4YMM A;  1RQN A;  4PZN A;  2ZIX A;  3H0M B;  1NJX A;  8ICI A;  3NGD A;  1ZQW A;  3N7S C;  3HP6 A;  4WOY A;  4C4S A;  1MA7 A;  2PFN A;  4QWB A;  1L3T A;  1KQQ A;  3RBD A;  4PGY A;  3EZ5 A;  4NLN A;  4XQ7 A;  1T94 A;  1S0N A;  4OCZ A;  3OVS A;  5AK3 A;  1N2X A;  2MAX A;  2FPM A;  5AI6 A;  4O3N A;  2PFP A;  4EEY A;  2ZIW B;  1V97 A;  3F2C A;  3I1Y A;  1IV8 A;  3L9D A;  4KLT A;  1T3Q A;  2EDU A;  3PW4 A;  1PZN A;  9ICS A;  2BHN A;  4RQM A;  5ALH A;  4PHE A;  2LM4 A;  2ES6 A;  5ALU A;  3SAH A;  3ZDD A;  2LYB A;  2I6X A;  3E2E A;  5D61 A;  4GXK A;  2F8K A;  8ICH A;  3F5A A;  1TKD A;  5KFM A;  3SEN A;  2MRL A;  2HBJ A;  3GV7 B;  2JV3 A;  3CK6 A;  4C8O A;  3Q8R B;  5KFN A;  4AT8 A;  4NM2 A;  5DQG A;  3RJH A;  9ICA A;  1QQ6 A;  2YY6 A;  2GAF D;  4DO9 A;  3T3F A;  4QIW C;  4EP7 A;  2DFL A;  3MGI A;  3EPG A;  3JPQ A;  3FM9 A;  1RYS A;  4X0B A;  2Y9U A;  3UPQ A;  4RT2 A;  1TFR A;  4LJX A;  2RDJ A;  5AK6 A;  5KFC A;  1COK A;  3MAB A;  1ZQL A;  3PMN A;  3JPP A;  4M2Y A;  1RZT A;  2KD1 A;  1SWV A;  1U45 A;  4RQ2 A;  3BZC A;  1TAU A;  4I27 A;  2K8B B;  3QU2 A;  1ZD5 A;  2ZIW A;  4QZ9 A;  3F2B A;  1NK4 A;  3WFR E;  4Y2U A;  3OVA A;  1SZP A;  5J0U A;  1LB2 B;  2PBE A;  2XC9 A;  4NXU A;  3M8R A;  1NI3 A;  2ZIX B;  5D63 A;  3AL0 B;  1RG6 A;  3SMV A;  4X4O A;  2Q0Z X;  4NKU A;  7ICQ A;  3RBE A;  3SV4 A;  1S77 D;  4ATB B;  2OYY A;  2WTF A;  1S10 A;  4FS1 A;  4QZD A;  3QNM A;  2DPJ A;  4FBU A;  1V85 A;  1X66 A;  2KV2 A;  3M1Y A;  1S8O A;  2VAN A;  1KBU A;  3B0Y A;  4DSI A;  2W43 A;  7ICF A;  3UPS A;  2KTQ A;  2DKZ A;  4E7X A;  3WK9 A;  1XSL A;  5KG2 A;  2P6R A;  2ID1 A;  3QUT A;  5KFP A;  3QEA Z;  3TQ1 A;  4P4P A;  3RAQ A;  4EED A;  3PW0 A;  4FHY A;  3V7J A;  4DL2 A;  2ZG6 A;  4DFK A;  5CFU A;  4ECS A;  5DGB A;  1L7N A;  2ODG A;  5HRG A;  4Y2P A;  1D9F A;  1IM4 A;  4QWC A;  4ZOH C;  5CA7 A;  4QZG A;  4UAZ A;  1PX5 A;  1V9P A;  2IA6 A;  3AU6 A;  5J2H A;  2FMS A;  4DOA A;  3CNH A;  1KFS A;  4US8 A;  2ZJA A;  5KFV A;  2D3D A;  3IG5 A;  3PST A;  3GIK A;  1Z00 A;  1WWU A;  3ZD9 A;  4R63 A;  4WBZ A;  2HVH A;  4O5C A;  2M2U A;  2WF5 A;  3RJF A;  2KP7 A;  2M2T A;  2QLT A;  1L7O A;  2GA9 D;  2JEJ A;  5B3P A;  4LEZ A;  1RQL A;  3H3A A;  1B43 A;  4C80 A;  1VJ5 A;  4F5Q A;  4RWP A;  3MR2 A;  4JV1 A;  4IL6 U;  3RJJ A;  5KG7 A;  4NJ8 A;  4DL4 A;  4RPY A;  4NXW A;  1FEZ A;  2FMP A;  2BBJ A;  4Z6D A;  4MHV A;  1VFG A;  5KFL A;  3RF9 A;  3DDH A;  4LEY A;  5BOL A;  2PXI A;  1T4G A; 
#chains in the Genus database with same CATH homology
 1UEU A;  4JUZ A;  1CUK A;  2HHQ A;  4X5V A;  5KTQ A;  4O3R A;  2DVI A;  4MF2 A;  3PML A;  2V4R A;  1RPL A;  4KN7 A;  4C8K A;  4YCX A;  2XO7 A;  5J2K A;  4YR3 A;  4TQS A;  3OUY A;  4DQS A;  3PO5 A;  9ICK A;  3TAR A;  1WCN A;  9ICW A;  3PR4 A;  3Q8K A;  3JPR A;  4IR1 A;  4KIT B;  4J9R A;  3RH6 A;  1NK8 A;  1MQ3 A;  4XA5 A;  4O5E A;  4F4X A;  3KHL A;  4F4K A;  2OWO A;  2W8L A;  4ELU A;  4MFA A;  4YD2 A;  5J2I A;  1NJZ A;  3PW7 A;  3HJ1 A;  4AT7 A;  5JUM A;  4LVS A;  3RRG A;  5J0P A;  8ICW A;  2HHS A;  4C8M A;  5KG4 A;  3GIL A;  1Z00 B;  2BCV A;  3V72 A;  1N56 A;  1NK7 A;  3QE9 Y;  5HRF A;  2R8J A;  3ORY A;  4KLQ A;  4K4G A;  4O5K A;  7ICR A;  1L3U A;  4UAY A;  5KFQ A;  5HR9 A;  5J2A A;  1V4A A;  1U4B A;  4TUR A;  3GV8 B;  4RUA A;  4J9Q A;  1UA0 A;  2IBK A;  4C8N A;  5TZV A;  5DGA A;  4DF8 A;  2NRK A;  2P6U A;  1WOT A;  1T3N A;  5HRE A;  2PFQ A;  1XU4 A;  5KG5 A;  3KHR A;  3H38 A;  4O0I A;  4WC0 A;  2M9N A;  3QEB Z;  2BCS A;  1Q79 A;  2KFN A;  2KFZ A;  3MR3 A;  1DOQ A;  1BVS A;  3H8W A;  3T5H A;  4CCH A;  4WC7 A;  3TAQ A;  4UB2 A;  4J9N A;  3BQT A;  5KFU A;  4F5N A;  1HUZ A;  2BR0 A;  1TFW A;  2IMW P;  4O3O A;  5HC9 A;  4TUS A;  4B9M A;  4PGX A;  3WFQ E;  1BNO A;  2FLP A;  2ZHA A;  1JX4 A;  4R64 A;  4DSJ A;  2O1P A;  5KFA A;  3H7I A;  5HHH A;  4X4R A;  3Q8Q B;  1NOM A;  4IQV A;  1BPX A;  4I2D A;  7ICI A;  5J2J A;  4ELT A;  3BQ1 A;  3LDA A;  4BDP A;  2FLN A;  4P4M A;  3EYZ A;  4QWE A;  1D8Y A;  2FMQ A;  2VA3 A;  4KLS A;  9ICB A;  2ALZ A;  9ICI A;  3M9O B;  4KLF A;  2DR8 A;  4DL6 A;  1L5U A;  8ICK A;  1COO A;  1L3V A;  2BPC A;  3M9M B;  2HHU A;  2C28 A;  2A1J B;  5HHI A;  4R8U B;  3MBY A;  4ECU A;  1D9D A;  3OJU A;  9ICX A;  1ZQZ A;  4M9G A;  2JEG A;  5KFI A;  4F8R A;  4G3I A;  7ICN A;  4S3N A;  4ED7 A;  5DB8 A;  4F4W A;  4EBE A;  2AGQ A;  2BPF A;  1XS9 D;  4QZC A;  2KZ3 A;  3Q8S B;  9ICE A;  1Q78 A;  2AU0 A;  4UB1 A;  4YFK A;  3QZ8 A;  1JXL A;  9ICG A;  9ICT A;  4RWN A;  2NRX A;  4RU9 A;  2XCA A;  5IIK A;  3C5G A;  1TFY A;  4DFP A;  4KN4 A;  5KFO A;  1DGS A;  3ISB A;  3LWL A;  2BCU A;  1UT5 A;  4RQ3 A;  9ICH A;  5HMM A;  5DBA A;  4F4Z A;  4ELV A;  5D46 A;  4RQ6 A;  5KG0 A;  3ZDA A;  4E0D A;  3C23 A;  4ECT A;  2JEI A;  1JIH A;  1JXE A;  5J0X A;  3ZDC A;  3H4D A;  2W9M A;  4DEZ A;  3RB3 A;  4MFC A;  3OUY B;  5L9X A;  4Z6E A;  8ICL A;  3AQL A;  1RYR A;  1QSY A;  5EWE A;  4QWA A;  1ZQO A;  1ZQU A;  4RQ7 A;  5HP4 A;  3GII A;  1SKS A;  4PPX A;  3H8S A;  4B9N A;  1Y88 A;  2XY5 A;  1UET A;  4UQG A;  4ECV A;  1NK5 A;  4O3Q A;  3NYB A;  4Q45 A;  1ZQM A;  2J6S A;  1S97 A;  4F3O A;  4O3S A;  3OHA A;  3OV7 A;  5DG8 A;  4PH5 A;  3THV A;  4O9M A;  1S0O A;  4KLI A;  4NY8 A;  4NLZ A;  1ZQQ A;  4X4Q A;  4R65 A;  2HHT A;  4RQ8 A;  8ICZ A;  5C5J A;  2W8K A;  5DLF A;  1ZET A;  5KFT A;  1NJW A;  3HIY A;  2C2R A;  3M9N B;  5KFW A;  4P4O A;  4F91 B;  3HT3 A;  4RNM A;  4F93 B;  5L1J A;  5DG7 A;  4I2B A;  3BQ0 A;  4YN4 A;  5J0R A;  9ICN A;  2NRV A;  2FPK A;  4GLX A;  5DEC A;  1ZQX A;  1KRP A;  4EBD A;  3PO4 A;  4DL3 A;  3JPS A;  4EBC A;  1X9S A;  9ICF A;  1DK2 A;  1KEJ A;  5BOM A;  2W9B A;  1VJ7 A;  4DS5 A;  4DFM A;  2JEF A;  2PI4 A;  2XGQ A;  4M9J A;  4LZD A;  5CHG A;  4P2H A;  2Y1I A;  8ICG A;  8ICS A;  3ZDB A;  4IQT A;  1ZQH A;  1DK3 A;  1XC9 A;  4ED1 A;  4YR2 A;  3TI0 A;  1B22 A;  5KFG A;  4PHP A;  3RB6 A;  2J6T A;  2W9A A;  5IIM A;  3PW2 A;  5DBB A;  4QZB A;  1X9M A;  5DB9 A;  1ZQD A;  9ICL A;  1N48 A;  7ICE A;  4QW8 A;  3RH5 A;  4BXO A;  4WC2 A;  3SYZ A;  4RWO A;  5J0Y A;  5IIL A;  3N4M B;  4MEX A;  4ATB A;  3G6Y A;  5HML A;  4F4Y A;  4IRC A;  2LYH A;  5EWF A;  4M47 A;  4X4T A;  3C2L A;  2NRT A;  4UB3 A;  4AT9 A;  2Y1J A;  2W9B B;  1TVA A;  2DRA A;  4AT7 B;  4XQ8 A;  5CR0 A;  5EOZ A;  4M04 A;  4JK1 A;  5HRB A;  3HJ4 A;  1KFD A;  4DL5 A;  4GC7 A;  2MUT B;  1A77 A;  1QLN A;  4IQW A;  9ICJ A;  5DLG A;  4WC3 A;  3ETL A;  5DQH A;  3H37 A;  3RJE A;  1ARO P;  4KLO A;  9ICM A;  7ICK A;  5KFK A;  7ICS A;  4F2R A;  3RJK A;  1Z3E B;  2H5X A;  1MSW D;  4UBB A;  1U49 A;  3RR8 A;  1D8L A;  4J9L A;  1XO1 A;  1SKR A;  5J0T A;  2PFO A;  8ICM A;  1MC8 A;  3PW5 A;  3MDC A;  7ICT A;  2Q66 A;  2ZH8 A;  1OU5 A;  3WFO A;  3PX6 A;  5HRI A;  3RB4 A;  4FBT A;  1NO5 A;  2AJQ A;  3C18 A;  3GFK B;  4DLG A;  4E8F A;  9ICC A;  1F5A A;  5J0S A;  1JN3 A;  1K1Q A;  4QZE A;  3UXN A;  3H8J A;  4PHA A;  3UXP A;  2ZUC A;  2UVV A;  5KT2 A;  4NXZ A;  3PNC A;  3BDP A;  4B9S A;  3M8S A;  7ICG A;  3OGU A;  3GDX A;  4J9O A;  3EWA A;  9ICV A;  3C2K A;  1TV9 A;  4NLG A;  1L3S A;  4C8L A;  1IXR A;  2A1J A;  4YXM A;  1S0V A;  4ECQ A;  3PX0 A;  4Q43 A;  2NRW A;  3SZ2 A;  8ICQ A;  4RQ4 A;  3FYH A;  2UVR A;  2R8I A;  4M6W B;  4PGQ A;  3EW9 A;  2XGP A;  3IM1 A;  5L1I A;  2AQ4 A;  4TUQ A;  1KFT A;  2FPL A;  3UQ0 A;  4M9N A;  9ICP A;  4WC5 A;  4AT9 B;  3WFS C;  4FHV A;  3Q8P B;  4O3P A;  3LQC B;  5DDM A;  4J9S A;  1NJY A;  2C2E A;  1T7P A;  5L1L A;  1BPZ A;  7ICV A;  5KT5 A;  3HW8 A;  4ECZ A;  1ZQA A;  4YG2 A;  4E80 A;  4DSF A;  4I2F A;  4YMM A;  4RWQ A;  4Q8F A;  3JPN A;  2R8H A;  4QZA A;  4RPX A;  4M5D A;  4WCW A;  1ZJM A;  2ZTD A;  2R8K A;  4GC6 A;  8ICE A;  3ZDE A;  1NJX A;  3NGD A;  1ZQW A;  8ICI A;  3HP6 A;  3GIJ A;  1ZQB A;  2DRB A;  4DLE A;  4YMO A;  3LWM A;  4FH5 A;  4EYI B;  3C66 A;  2W9C B;  3TFR A;  3ZD8 A;  3Q8M A;  2PFN A;  4QWB A;  1T8E A;  2KZM A;  4F5O A;  1L3T A;  4LT6 A;  4WC4 A;  2ZH4 A;  4AT8 B;  4UAW A;  1ZQK A;  4I2G A;  7ICL A;  4RPZ A;  4Q44 A;  3RBD A;  8ICX A;  4PGY A;  3EZ5 A;  4NLN A;  4IQU A;  1ZJN A;  4KLE A;  4XQ7 A;  1S0N A;  2V4Q A;  2AGP A;  3V6K A;  8ICT A;  1R8A A;  1BGX T;  3OVS A;  1ZQR A;  2RDI A;  5IIN A;  4RQ0 A;  8ICR A;  5J2C A;  3SI8 A;  2FLL A;  4ECY A;  5J2D A;  2F1J A;  2MAX A;  2FPM A;  3H40 A;  4DQR A;  2C2D A;  5KG1 A;  4O3N A;  2HHX A;  4YP3 A;  1QSS A;  2PFP A;  2M2W A;  4EEY A;  4I2H A;  5KFJ A;  3FDS A;  3K75 D;  3V6H A;  4JV0 A;  4IRK A;  4Z6C A;  4DQQ A;  4I28 A;  4DFJ A;  5KG3 A;  4HYK A;  4FS2 A;  5F2V O;  3KTQ A;  4X4U A;  1SL2 A;  1UEV A;  3L9D A;  4KLT A;  1ZQS A;  7ICM A;  4FHX A;  3PW4 A;  1FA0 A;  1ZQP A;  4F2S A;  5KT7 A;  1PZN A;  1MQ2 A;  9ICS A;  4QZF A;  8ICO A;  2BQ3 A;  1RXV A;  2BHN A;  4PHE A;  1ZQI A;  4R8U A;  4M6W A;  4EBK A;  2ZUB A;  5J0Q A;  2JZB A;  8ICB A;  4IG8 A;  4FO6 A;  2F1I A;  3MGH A;  4KMU A;  4JWN A;  3ZDD A;  3G6V A;  3AQK A;  5KFB A;  5J0O A;  4B9U A;  3RH4 A;  3N97 B;  4KLH A;  1XSN A;  3E2E A;  2ZHB A;  1KNY A;  1C7Y A;  4J9K A;  4GXK A;  4KLJ A;  8ICN A;  8ICH A;  2ZJ5 A;  4YR0 A;  1TKD A;  5KFM A;  2DR5 A;  4NKT A;  5IIO A;  3RR7 A;  4WBY A;  2HHP A;  4B9V A;  3GV7 B;  2BKE A;  4BGD A;  3OSN A;  3SV3 A;  1BPY A;  5J2B A;  4C8O A;  3Q8R B;  4ED8 A;  5KFN A;  5KT3 A;  3HWT A;  1SL1 A;  2ZTE A;  4AT8 A;  3NTU A;  4NM2 A;  1QSL A;  3AQN A;  3UXO A;  4ED3 A;  1U47 A;  2ZH9 A;  2BQU A;  8ICC A;  1ZQJ A;  4I2J A;  5DQG A;  2J6U A;  3LK9 A;  3MR6 A;  5KT4 A;  2R8G A;  4KLL A;  3RJH A;  9ICA A;  2VA2 A;  1UA1 A;  2MUT A;  7ICH A;  5DED A;  3RB0 A;  3MFH A;  4DO9 A;  3T3F A;  4KLU A;  4F92 B;  5DDY A;  5HRK A;  4YQW A;  4BWM A;  2IHM A;  3C1Z A;  4F5P A;  4EP7 A;  2KZZ A;  2DFL A;  4YXJ A;  3MGI A;  3EPG A;  4DF4 A;  7ICO A;  4XUS A;  3JPQ A;  1U9L A;  2GWS A;  1RYS A;  1R8B A;  2ATL A;  5KFY A;  4X0B A;  3PY8 A;  1X2I A;  2HVI A;  2NRZ A;  3UPQ A;  4TQR A;  4ECX A;  4RT2 A;  4X4N A;  1U48 A;  2BCQ A;  1TFR A;  8ICV A;  2ZJ8 A;  4M0A A;  1SL0 A;  2RDJ A;  3Q8L A;  5DB7 A;  4JWM A;  4I2E A;  4K4H A;  1MIW A;  5KFC A;  2ZH5 A;  3MAB A;  5KFZ A;  1ZQL A;  3PMN A;  1A76 A;  5DG9 A;  3MFI A;  3GV5 B;  3JPP A;  4I2C A;  3G6X A;  4MFF A;  4M2Y A;  1RZT A;  1U45 A;  5KG6 A;  2BGW A;  4RQ2 A;  1TAU A;  5D49 A;  4I27 A;  5III A;  5DQI A;  4EBJ A;  3MDA A;  1TK5 A;  1XSP A;  1KLN A;  5HRD A;  3RAX A;  4FH3 A;  4Z6F A;  3RJG A;  1BPB A;  4ECW A;  4I2I A;  5J2G A;  2HW3 A;  4RT3 A;  4QZ9 A;  4DL7 A;  1NK4 A;  4LZG A;  2ZH6 A;  4QZ8 A;  3TAN A;  2UVW A;  4M9L A;  1R8C A;  4WC1 A;  3WFR E;  3V7L A;  3OJS A;  1ZQG A;  4ED0 A;  1SZP A;  3OVA A;  4B9T A;  5KT6 A;  5J0U A;  1LB2 B;  2XC9 A;  4EZ9 A;  4IR9 A;  5CB1 A;  2PBE A;  4ZH4 A;  4F5R A;  3T5J A;  1NKB A;  2O5A A;  5J0W A;  4TUP A;  4NLK A;  3M8R A;  1KDH A;  2I9G A;  4Q8E A;  2HHW A;  4UD5 A;  3PX4 A;  2ISP A;  4I29 A;  2F1H A;  5DBC A;  2Q0Z X;  3RRH A;  4X4O A;  1UT8 A;  1ZQY A;  5DB6 A;  3JZ0 A;  2P66 A;  2DPI A;  3RBE A;  7ICQ A;  4NKU A;  4KTQ A;  3SV4 A;  5KFE A;  4UB4 A;  1S77 D;  3OVB A;  4ATB B;  4YVZ A;  2WTF A;  1S10 A;  1JQR A;  4RNN A;  4GXI A;  1XWL A;  4FS1 A;  4QZD A;  2BQR A;  1KSP A;  3JPO A;  2DPJ A;  4F50 A;  2BPG A;  4FBU A;  3QZ7 A;  2M2V A;  3KHG A;  3KHH A;  7ICJ A;  4DQP A;  1BNP A;  4FHW A;  3RTV A;  4KLG A;  2VAN A;  4B9L A;  4DSI A;  3B0Y A;  4I2A A;  7ICF A;  4DOC A;  3UPS A;  3V7K A;  4X0A A;  1NZP A;  3PR5 B;  4RNO A;  3UQ2 A;  2KTQ A;  1YLQ A;  5HNK A;  3BJY A;  3RJI A;  3PV8 A;  8ICJ A;  3AUO A;  1ZQF A;  4E7X A;  4ED6 A;  4X4P A;  4XRH A;  5KFD A;  3OHB A;  3T5L A;  5KG2 A;  1XSL A;  2P6R A;  2ID1 A;  5EWG A;  3PVX A;  2C22 A;  1H38 A;  5KFP A;  1K1S A;  5IIJ A;  1NKC A;  1BPD A;  1EXN A;  4UBC A;  3EPI A;  3QEA Z;  4NM1 A;  3TQ1 A;  4P4P A;  3OSP A;  4UD4 A;  5J2F A;  3RAQ A;  3C2M A;  4ED2 A;  4JV2 A;  8ICU A;  4KLM A;  1KTQ A;  4YD1 A;  2BDP A;  2PI5 A;  4DOB A;  4KLD A;  1HJP A;  8ICY A;  4WC6 A;  2ZH7 A;  3AQM A;  3C1Y A;  3BQ2 A;  3IHQ B;  5KFX A;  4QZH A;  2XCP A;  4RZR A;  2KN7 A;  3PW0 A;  1S76 D;  1MIY A;  1ZYQ A;  4FHY A;  3V7J A;  4DL2 A;  5F9L A;  4PHD A;  2ASJ A;  1ZQE A;  4DFK A;  2ISO A;  1S0M A;  5F9N A;  4QZI A;  4ECS A;  1JMS A;  5KFF A;  2I1Q A;  2ASD A;  2V9W A;  5DGB A;  2XY6 A;  4DSL A;  5HRG A;  3H4B A;  2IHN A;  1D9F A;  1ZQC A;  2AQ0 A;  1IM4 A;  3ISD A;  2HHV A;  5HRL A;  1JAJ A;  2DR7 A;  4QWC A;  3K4G A;  4DS4 A;  3T5K A;  4YMN A;  2JZB B;  5CA7 A;  4QWD A;  1TK8 A;  5HRH A;  4QZG A;  1ZQV A;  5J2E A;  4UAZ A;  2ZH1 A;  2XY7 A;  3C21 A;  1PX5 A;  1CEZ A;  9ICU A;  4DWI A;  3JYY A;  1V9P A;  3TAP A;  1QTM A;  2IA6 A;  1HUO A;  4BWJ A;  2ZH2 A;  3AU6 A;  5J2H A;  8ICA A;  3B0X A;  3GIM A;  2FMS A;  4DOA A;  2B21 A;  3C5F A;  1KFS A;  4ECR A;  4FHP A;  2VA8 A;  4M9H A;  2ZJA A;  5KFV A;  3MR5 A;  4MEY A;  3GIK A;  5CJ7 A;  1Z00 A;  1ZQT A;  1WCL A;  3HPO A;  3HX0 A;  3ZD9 A;  4R63 A;  4WBZ A;  2HVH A;  5KFS A;  9ICO A;  4O5C A;  9ICR A;  2M2U A;  5KFH A;  4RQ5 A;  3RJF A;  4MF8 A;  2KP7 A;  1NK6 A;  4BXO B;  2M2T A;  2BE3 A;  2ZTC A;  5BPC A;  1ZQN A;  2JEJ A;  1LV5 A;  4K4I A;  3AU2 A;  4DQI A;  3WFP A;  4QW9 A;  8ICF A;  1TK0 A;  1TAQ A;  3H3A A;  4R66 A;  1S9F A;  1B43 A;  2ZH3 A;  4DSK A;  5D4B A;  5CP2 A;  1X9W A;  4IRD A;  4F5Q A;  3V6J A;  3H39 A;  4RWP A;  3MR2 A;  1NK0 A;  3JPT A;  4JV1 A;  5J29 A;  3ISC A;  4J9M A;  4EYH B;  1R89 A;  2ZUD A;  4GXJ A;  3RJJ A;  5KG7 A;  5DKW A;  4DL4 A;  2UVU A;  4RPY A;  7ICU A;  4DSE A;  1RXW A;  3GQC A;  2FMP A;  2AGO A;  1SKW A;  8ICP A;  2ASL A;  4RQ1 A;  4UB5 A;  1MIV A;  1NKE A;  5L1K A;  4J9P A;  5CWR A;  2DR9 A;  2W9C A;  4X4V A;  5KFR A;  4Z6D A;  1VFG A;  5KFL A;  4RUC A;  2RFF A;  4EZ6 A;  4X4S A;  7ICP A;  1BPE A;  5BOL A;  2BCR A;  2PXI A;  3TFS A;  1T4G A;  1NK9 A;  9ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...