4O5CA

Structure of human dna polymerase complexed with n7-mg as the template base in a 1-nucleotide gapped dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5cA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5cA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5cA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5cA03
4BWJA 1DOQA 4R63A 7ICIA 1ZQHA 4KN7A 4F5NA 1F5AA 3TI0A 2ZHAA 3MR5A 2BQRA 3HPOA 4JV1A 1BNOA 1MIWA 4AT8A 3EPGA 1S77D 1ZQGA 4EP7A 1ZQMA 4KLTA 2ZHBA 1EXNA 2I1QA 3RRGA 4LZGA 5KFUA 4FHYA 3QZ7A 3GV5B 4O3NA 4M6WA 4QZGA 3LDAA 3MR2A 3V72A 5J0QA 5IIKA 5BOLA 9ICMA 2M2TA 4WCWA 3OHBA 3M9NB 1DGSA 4B9TA 4QZIA 8ICXA 3UPSA 3H37A 4QZBA 4EYHB 3NYBA 3M8RA 1XWLA 3OVSA 2F1HA 3GIKA 1UEUA 1BPZA 4YR0A 5IIMA 1ZETA 4P4PA 4YR3A 3KHHA 4M04A 5KG2A 4YG2A 4XA5A 5KFKA 2C28A 5KG7A 4M9JA 2ASDA 2O5AA 4AT7B 2BQUA 5CJ7A 3PV8A 2PI5A 1H38A 5J2CA 5CP2A 4X4QA 4F4ZA 2ZH5A 2W9CB 5HP4A 4X5VA 1NO5A 7ICGA 5EWGA 2HHXA 3MGHA 4WC2A 4O3OA 4I2AA 4O3SA 2W9MA 3C2MA 1NKEA 5J2AA 4WBYA 1TKDA 4R66A 3UQ2A 2KP7A 4ECXA 3PR5B 1KFDA 3ETLA 8ICJA 4NLZA 5HC9A 4RQ4A 2VA2A 4ECTA 2KTQA 4J9QA 4XRHA 1SL2A 3N4MB 3PX0A 3AQMA 4DL7A 3Q8RB 2V4RA 4C8OA 4KLMA 4DFPA 2M2WA 1ZQYA 3OGUA 3GQCA 4WC6A 3SZ2A 4KITB 4JWMA 3H8SA 1XU4A 5HRBA 1JQRA 2PI4A 5DKWA 3BQ2A 3RR7A 4O3RA 5HRKA 4Q8EA 1ZQTA 2GWSA 2PFOA 4UB3A 4AT8B 4X4VA 4Q44A 1L3VA 2VA8A 1HUOA 1D9DA 4ED0A 4R8UA 2Y1JA 5F2VO 4PGQA 4FH3A 5CHGA 3JPPA 4FHVA 2HHSA 4RQ6A 3MDCA 4ELTA 4J9NA 4DSFA 4RQ1A 4RZRA 5KG6A 5J2EA 1TK8A 1ZQZA 1NK0A 2BKEA 4LVSA 3UXPA 1XSLA 4UB5A 4RQ2A 3IM1A 4P4OA 4RQ7A 3RB0A 4QZDA 5L1LA 3UPQA 1X9SA 1ZQAA 1C7YA 9ICKA 4EBJA 1JN3A 4RNNA 4P2HA 3AQKA 3PMLA 4QZAA 3HWTA 4AT9A 5CA7A 5L1KA 3FDSA 2HHUA 4DSEA 1U4BA 2Q0ZX 1TFRA 5KFMA 1FA0A 5KFFA 4YXJA 2HVIA 2BE3A 2KFZA 1ZQVA 4JV0A 4J9MA 3JPOA 2BPCA 4TQSA 3BQ1A 1JAJA 3B0YA 3TQ1A 2BCSA 5J2DA 7ICQA 3TAQA 4F92B 4RNOA 3C2LA 4NKTA 1S9FA 4RWQA 1RZTA 2BDPA 2DR9A 4O9MA 2W9BB 3T5KA 2BCVA 1KSPA 7ICPA 4K4IA 4M5DA 3H40A 4WC7A 4YMNA 4ED7A 1ZQFA 4RQ8A 3MABA 3V6KA 4IRCA 5J2KA 2ZH4A 4BDPA 8ICLA 2C2RA 5HHIA 5D49A 9ICXA 1A76A 4KMUA 4UAYA 2C2DA 3RAQA 4TUPA 1U48A 1WCLA 4O5CA 8ICFA 5KFTA 2RFFA 4F2SA 1NZPA 5J2BA 5HRLA 9ICAA 4FBUA 4R8UB 2KZZA 8ICEA 5DBCA 4KLEA 4DQPA 4I2GA 4NM1A 1U47A 3BQ0A 1R8BA 4FHWA 4J9OA 1SKWA 1NK5A 5EWEA 4PHEA 1BPBA 5BOMA 1NKCA 2AJQA 3OVAA 2BCUA 9ICOA 2ALZA 5HMMA 5DG9A 4F5RA 4KLUA 4UD4A 1JIHA 1X2IA 5KFVA 5DB6A 1RPLA 5DBBA 4RNMA 7ICLA 4WC3A 4P4MA 4KLHA 4B9UA 2JZBB 5L1JA 4J9SA 4EBEA 4AT9B 5DLGA 3PMNA 4YP3A 1U49A 4GC6A 1MQ2A 4DQRA 4DSIA 4I2EA 4KLJA 7ICOA 4QZ9A 3ISDA 4J9KA 4XQ7A 4IG8A 2XC9A 8ICRA 1U9LA 4X4RA 2W8LA 3K4GA 1JXLA 4ED8A 3H4BA 2JEIA 2NRTA 4I2JA 4YN4A 1NJZA 1CUKA 2IHMA 3GDXA 2ZUBA 4IR1A 3G6XA 4K4GA 2I9GA 5HRDA 4ATBB 4ZH4A 5J29A 4E0DA 3HJ1A 4NM2A 4F5PA 4F5OA 3OJSA 4C8LA 5KFEA 1VFGA 4PHDA 1U45A 3UXNA 7ICJA 2AU0A 3RBDA 1DK3A 4DQQA 4RWOA 5C5JA 1NOMA 2NRZA 2IA6A 4J9LA 2UVWA 4I27A 3OUYA 3ZDBA 1D9FA 3TFRA 2HHTA 2BR0A 4F2RA 2ZUDA 1T4GA 2J6TA 1TFYA 2HHQA 5JUMA 2FMQA 3V6JA 3V7LA 3B0XA 4KLSA 4EBCA 4ECQA 1OU5A 4QZFA 3GILA 2ZTDA 3PW5A 3QZ8A 5KFBA 4DS4A 3ZDCA 4X4SA 3KHLA 2R8GA 4QWBA 1ZQIA 3TFSA 2BGWA 3SYZA 2AGPA 4X0AA 3H4DA 2R8IA 4RQ0A 8ICBA 2PBEA 4GXIA 1D8LA 2P66A 4ECWA 3HT3A 4KLDA 4PH5A 4R64A 1COOA 2R8HA 1ZQJA 1LB2B 9ICCA 3C18A 5J2IA 5DB9A 5DLFA 2BQ3A 3BQTA 4DSKA 9ICNA 1N56A 4MFFA 4FHPA 5HNKA 5J0XA 5DGBA 1S10A 2O1PA 5KFHA 3MBYA 4DFMA 1ZQBA 9ICPA 2IBKA 3V6HA 3RB3A 3QEAZ 7ICTA 4QZEA 5DECA 1X9MA 8ICCA 5KFIA 5KFDA 5CWRA 3TANA 1ZYQA 4QZCA 4ECZA 4DQSA 4YCXA 5KT6A 2W9BA 4EBDA 4Z6EA 5KT7A 2FMSA 1S76D 5IIJA 2V9WA 4ECRA 1MSWD 1QLNA 1ZQUA 1NK4A 1Z00B 3OSPA 4LT6A 4DF4A 4YFKA 4WC4A 5J0YA 4QZHA 4WC1A 4Z6DA 4QWDA 4MF8A 3MR6A 1MIVA 3EYZA 2DRBA 5KFPA 4YD1A 2XCPA 3V7JA 4I29A 1QSSA 2MUTA 5HHHA 4ECSA 1TV9A 8ICHA 3AQNA 4DLEA 5J2GA 4E8FA 4X4TA 2R8JA 3OUYB 5KFLA 4UD5A 1D8YA 9ICFA 3IHQB 1Z3EB 2FPLA 5J2HA 3M8SA 4DFJA 3ZD9A 1JMSA 4BWMA 3GV7B 1ZQNA 3RR8A 4RU9A 2ZTCA 4RT3A 4UB1A 4MF2A 4ED1A 1NK6A 4DQIA 4DOAA 1TK0A 1NJYA 1KRPA 2DPJA 5F9LA 3KTQA 1BPYA 3ISBA 3Q8LA 4QW9A 1ZQOA 2BPGA 2ZTEA 4M2YA 2BCRA 5IINA 3EWAA 3SV3A 1CEZA 9ICSA 2XGQA 1S0NA 4MFCA 2JZBA 4UB2A 4F50A 5KT5A 1ZQKA 5EOZA 5HRHA 1NKBA 4DL5A 5KFGA 3C5FA 3T5LA 4KLIA 2P6RA 5KFYA 3GV8B 5KFCA 3EPIA 3WFPA 4RPXA 1S97A 4DO9A 3ZD8A 4FO6A 9ICLA 7ICVA 2DR8A 1RXVA 1KTQA 3PW7A 3PVXA 5KG0A 1BGXT 1TK5A 4KLFA 2HVHA 8ICSA 4IQTA 8ICUA 4K4HA 2UVUA 1KFTA 2WTFA 1K1SA 2DFLA 5KG4A 2DPIA 4RPZA 4FBTA 3C66A 3WFOA 5EWFA 4RUAA 1NJWA 1T7PA 4EZ6A 3TARA 4DSJA 4EYIB 4IRDA 4NXZA 4XUSA 4YQWA 1L3SA 3KHGA 3WFQE 2ASJA 1KLNA 3RJIA 4F4KA 4JWNA 3OVBA 5F9NA 3ISCA 2RDIA 3RRHA 1RXWA 2FMPA 3PO5A 2M9NA 2ASLA 4PPXA 4QWCA 2F1JA 5KFNA 5J0TA 3PW0A 1L3UA 1R89A 9ICIA 2ZH9A 3WFRE 2DR7A 5J2JA 3HW8A 1XO1A 2MUTB 5KG1A 4F4XA 3LK9A 4EEYA 3SI8A 1MIYA 2AGQA 3V7KA 4E80A 2IMWP 2FPMA 5DQIA 2BPFA 9ICEA 3LWLA 2KFNA 3RJHA 2R8KA 4S3NA 2ZH3A 4RPYA 3Q8SB 2XO7A 2BHNA 5KFJA 3UQ0A 1QSLA 3ZDAA 2LYHA 3RAXA 1ZQRA 3AU6A 2JEFA 1KNYA 3PNCA 1IM4A 2W8KA 4DLGA 4QWAA 2J6UA 2XCAA 1BPXA 5KG3A 4DOBA 4DF8A 4M9LA 3RTVA 1MQ3A 2J6SA 2NRXA 5DDMA 2B21A 3Q8KA 7ICUA 3UXOA 4X4OA 1B43A 4TURA 2PFNA 5D46A 2A1JA 3H3AA 3RJKA 1ZQDA 4O0IA 9ICGA 4WBZA 4UB4A 1HUZA 3AQLA 4QZ8A 3FYHA 4LZDA 4FS2A 4MEXA 3HIYA 3BDPA 3M9OB 4ED6A 4TUQA 4Q43A 2W9AA 1BNPA 4ED3A 3JPTA 1PX5A 5D4BA 5L9XA 4ELVA 1Z00A 3Q8QB 4QW8A 4F4WA 2V4QA 5J0WA 2FLPA 5DQGA 4YXMA 2ZJ8A 5J0UA 3T5JA 5L1IA 2VA3A 4M9NA 4YVZA 4RWNA 4C8MA 1XSPA 1SL0A 1ZQEA 4KLLA 8ICZA 1Q78A 2Q66A 3OSNA 3RJFA 4I2FA 4NKUA 3C1ZA 5DEDA 1R8CA 2ISOA 5J2FA 3JZ0A 4X4PA 3MFHA 3PR4A 3HX0A 2XY5A 1T8EA 5HRFA 1Q79A 3RB4A 3MGIA 2NRWA 3N97B 4RUCA 1ZQSA 1S0VA 1XSNA 1JXEA 4JK1A 3GIJA 4ED2A 4B9NA 4JUZA 3QEBZ 8ICTA 4B9LA 4C8KA 4CCHA 1ZQXA 3G6VA 3THVA 3H7IA 1VJ7A 2C2EA 1NK9A 2AQ0A 3KHRA 1SKRA 2H5XA 2XY7A 3EW9A 1WOTA 2KZ3A 4YMOA 2ISPA 4DSLA 1NK8A 4QWEA 3MFIA 3HP6A 4PGYA 3SV4A 4B9MA 2ZH1A 3MDAA 2KZMA 2XY6A 7ICKA 2Y1IA 4GXKA 4DOCA 4C8NA 5KFZA 1TAQA 8ICOA 1BPDA 1K1QA 4PHPA 4F93B 2FLNA 4JV2A 4BGDA 3H8JA 4IQUA 4DEZA 5TZVA 1X9WA 4M9GA 4NLGA 2ZH8A 5KT4A 2A1JB 5HMLA 7ICNA 9ICTA 4IR9A 3EZ5A 4KLGA 4YD2A 4WC5A 2ZH2A 3JPRA 1B22A 8ICIA 2PFQA 4DWIA 1DK2A 2M2VA 5IIOA 1TAUA 4UAWA 4DL4A 1ZQWA 3ZDDA 3H38A 4B9SA 4DFKA 9ICBA 4B9VA 8ICPA 2KN7A 4R65A 4RQ3A 2ZJ5A 5KFQA 5DB7A 1L3TA 1V4AA 4YMMA 4O5KA 3H8WA 4FHXA 4NLKA 4KLOA 3WFSC 3E2EA 3RJGA 3NTUA 2ATLA 1SL1A 1WCNA 4BXOA 8ICWA 4I28A 5HR9A 3PY8A 2JEGA 1A77A 1ZQQA 3GIMA 1BPEA 3RH6A 5DDYA 4Z6CA 3C23A 2ZUCA 2XGPA 3RH4A 5KFAA 4DL2A 1S0OA 3OV7A 4MFAA 3OHAA 4O5EA 3C21A 5DQHA 1V9PA 3C2KA 3ORYA 1RYSA 2MAXA 3M9MB 3JPQA 4DL3A 4X0BA 4PHAA 4M47A 9ICJA 4GC7A 3RH5A 4IQVA 5J0RA 2AGOA 4I2BA 2JEJA 2P6UA 3C1YA 4TQRA 4WC0A 3L9DA 1NJXA 1TVAA 1N48A 7ICEA 4F3OA 3JYYA 4KLQA 8ICVA 4I2DA 1ZQPA 4M0AA 2HHWA 3H39A 3PO4A 1PZNA 2HW3A 4XQ8A 4Q45A 4J9PA 4DL6A 5KFRA 2DRAA 9ICHA 5DB8A 4M6WB 2PFPA 5KFXA 4F8RA 4UBCA 3LWMA 1MC8A 3AUOA 3RJEA 3T5HA 2RDJA 8ICAA 4DS5A 8ICMA 2DVIA 2UVVA 4F91B 5KT3A 4KTQA 8ICQA 9ICVA 3Q8MA 1UEVA 2HHVA 4UAZA 5KFSA 1AROP 1NK7A 4IRKA 2ZH7A 4EBKA 4O3QA 3OJUA 9ICRA 3HJ4A 2IHNA 5HRIA 3RB6A 4FS1A 4J9RA 2ZH6A 5CB1A 3GFKB 3BJYA 4UQGA 9ICWA 4Z6FA 4X4UA 3AU2A 1SKSA 1LV5A 1KFSA 1UETA 1UT8A 5KFWA 3Q8PB 8ICGA 4BXOB 1SZPA 5IILA 1XC9A 2UVRA 3MR3A 1XS9D 3K75D 4YR2A 4RT2A 5KFOA 2BCQA 5HREA 4UBBA 9ICQA 1HJPA 5CR0A 1Y88A 4F4YA 5J0OA 4PGXA 2C22A 4M9HA 4ELUA 3RJJA 8ICNA 2PXIA 1BVSA 3NGDA 5DG8A 4F5QA 5DG7A 3GIIA 4GLXA 9ICUA 1TFWA 1UT5A 4FH5A 1IXRA 7ICMA 1YLQA 4I2IA 4ECUA 3PX4A 5DGAA 1T3NA 5J0PA 4IQWA 2NRVA 4KN4A 2M2UA 1R8AA 4RWPA 5KT2A 5KTQA 1UA0A 2FLLA 3JPNA 4GXJA 1ZQLA 7ICRA 4X4NA 1ZJNA 1RYRA 2VANA 5DBAA 3ZDEA 4G3IA 4I2CA 1ZJMA 8ICYA 4EZ9A 2AQ4A 3C5GA 3PW2A 2OWOA 5IIIA 4TUSA 1JX4A 3PW4A 4MEYA 4AT7A 4O3PA 1UA1A 3T3FA 7ICSA 2FPKA 5HRGA 7ICHA 4ATBA 5BPCA 1S0MA 1QTMA 2W9CA 3RBEA 7ICFA 3LQCB 1L5UA 2DR5A 5KG5A 5J0SA 4I2HA 4E7XA 1QSYA 2NRKA 4ECVA 3PX6A 3TAPA 4NY8A 3JPSA 4NLNA 4ECYA 2HHPA 2ID1A 1KEJA 4HYKA 2ZJAA 4RQ5A 2F1IA 1KDHA 3G6YA 1ZQCA 4Q8FA 8ICKA 3QE9Y
chains in the Genus database with same CATH superfamily
3I76A 4R63A 3WK6A 1KBUA 3MR5A 4JV1A 4AT8A 2RHFA 5AK4A 5AKZA 4EP7A 1FIQA 1ZQMA 2ZHBA 3BZCA 4O3NA 1MA7A 2AHOB 3LDAA 5J0QA 5IIKA 5BOLA 4B9TA 4QZBA 5JTIA 2LM4A 4M04A 1F44A 2D3DA 3M7DA 1H38A 4F4ZA 2ZH5A 3N28A 2W9CB 2FI1A 4K96A 8ICJA 2ES6A 4XRHA 3L4PA 4DL7A 3CW2C 2V4RA 4KLMA 4DFPA 1ZQYA 2MU2A 4WC6A 1QCKA 1JQRA 3GZFA 5DKWA 4UAVA 2N1RA 2RRDA 5HR7A 4AT8B 4Q44A 1HUOA 5ALNA 5F2VO 2DQNB 4RQ6A 2VJ4A 4DSFA 4US8A 4U7CA 1XSLA 3IM1A 5ALFA 1ZQAA 2A3VA 1DRGA 5AM4A 2OHFA 3PMLA 1RM6C 3O0FA 3A0HU 4QZAA 4LEZA 4AYBC 2HHUA 3NKUA 3K7DA 4YXJA 2HVIA 2KFZA 3JPOA 3B0YA 3PSFA 2BCSA 5KAFU 1J2MA 4O9MA 3HRDD 3SENA 4M5DA 4YMNA 3MABA 4IRCA 2C2RA 2IOHA 5D49A 3RAQA 1P7DA 1WCLA 3J81j 8ICFA 4EX7A 2RFFA 3QUBA 1NZPA 3NASA 3QU4A 4KLEA 4J9OA 1SKWA 5BOMA 3OVAA 2BCUA 1COKA 4UD4A 4KLUA 5ALHA 1RPLA 4WC3A 4P4MA 4KLHA 4B9UA 4J9SA 5DLGA 3PMNA 4YP3A 1U49A 1SB3C 5AI8A 2XC9A 8ICRA 2G09A 2IHMA 3G6XA 4J03A 5J29A 1ED1A 4F5PA 4F5OA 3OJSA 4PHDA 3KD3A 3UXNA 7ICJA 1DK3A 4DQQA 2I5HA 1X9XA 3TFRA 2BR0A 2ZUDA 2J6TA 3QYPA 5JUMA 2E8NA 4CGZA 3PW5A 3KOOA 3QZ8A 1PK3A 3N7RC 4X4SA 2K89A 4QWBA 3SYZA 2HBJA 4G9BA 1RQLA 4PH5A 4R64A 2CPRA 1ZRNA 5ALZA 9ICNA 1S10A 2O1PA 4Y2RA 1DGJA 9ICPA 3V6HA 2W9BA 1Q3UA 3C29A 4Z6EA 5KT7A 4EBDA 2FMSA 3UM9A 2K8CB 1NK4A 3OSPA 4LT6A 2DKZA 4DF4A 4WC4A 5J0YA 2DUYA 4YD1A 2XCPA 2W04A 4I29A 5HHHA 4ECSA 8ICHA 5J2GA 5AKHA 1D8YA 9ICFA 3LVWA 5E79U 4DFJA 1JMSA 1ZQNA 3RR8A 4RT3A 1NK6A 1TK0A 1KRPA 5AI5A 3KTQA 2Y0SC 3QNMA 3ISBA 1ZQOA 4OJLA 2BPGA 2BCRA 3EWAA 4AP9A 1VJ5A 2XGQA 4UB2A 4F50A 5KT5A 1NKBA 5KFGA 2P6RA 4UB8U 2KOBA 1PUZA 3SR6A 2DR8A 2HDOA 1RXVA 3NVYA 1JI7A 2HVHA 4ATBA 8ICUA 4C4RA 2UVUA 1K1SA 2NYVA 2RP5A 4O6AA 1T7PA 4FHVA 3UMBA 4IRDA 2CN1A 3WFQE 1NI3A 2FE9A 3ALRA 4JWNA 2A19A 2K4IA 1L3UA 3WFRE 3V7KA 3LWLA 4S3NA 4RPYA 3Q8SB 2BHNA 1V85A 1O03A 2LYHA 3RAXA 2W8KA 2J6UA 1F0MA 4DOBA 3RTVA 7ICUA 3Q8KA 2B21A 1B43A 2PFNA 2ZIUA 5D46A 4FZMA 3RJKA 2ZXIA 4QZ8A 3FYHA 4LZDA 3NUQA 3M9OB 4Q43A 3JPTA 4Y2VA 5D4BA 1Z00A 4DCCA 5J0UA 3T5JA 5L1IA 2IHOA 1ZD5A 2G5HB 1L7NA 1V97A 1R8CA 2ISOA 2YY6A 1M6YA 3HX0A 2XY5A 2FDRA 3ER9B 1JXEA 3E0FA 4JK1A 5AI4A 4ED2A 4C8KA 3RFAA 3NVOA 2C2EA 1WOTA 2WF8A 3EW9A 4YMOA 5ALTA 1UPHA 3SAHA 3ER8C 2KNJA 4DOCA 1K1QA 1BPDA 1SXDA 2HOQA 2Z7JA 4NLZA 4IC9A 4IQUA 1X9WA 3SAFA 4NLGA 3ICXA 9ICTA 4IR9A 1URJA 4CRXA 3IN5A 5ALOA 3WK4A 4QJFB 2H3IA 2XVTA 2M2VA 2LBOA 4Y2YA 2RQ5A 5AI6A 4UAWA 2HOIA 4PJ0U 2KD1A 3PSIA 4JMUA 1V4AA 4YMMA 3WKDA 3E2EA 2ATLA 1SL1A 4BXOA 1WCNA 4Y2JA 4I28A 1IIPA 3WKBA 2JEGA 1A77A 1ZQQA 2LKYA 2ZIVA 4OAIZ 2ZUCA 3QXGA 5EE1A 5KFAA 4DL2A 3RH4A 3C21A 4NL9A 3QX7A 3ETRA 3JPQA 4DL3A 4PHAA 3RH5A 5J0RA 4NLBA 5CRXA 5D62A 4PL1A 3BS5A 2WF9A 4TQRA 5KL1B 1TVAA 1N48A 2GLEA 5ALIA 8ICVA 1ZQPA 4U6PA 4IS7A 1PZNA 3PO4A 4XQ8A 5KFXA 1TFYA 1MC8A 3AUOA 4DS5A 5KT3A 1UEVA 3Q8MA 2HHVA 2GH1A 4C0ZA 4CDGA 5T14A 5CB1A 3GFKB 3BJYA 1QH9A 2F3NA 4Y2XA 4K98A 4X4UA 1SKSA 1KFSA 1UT8A 5KFWA 1FEZA 4BXOB 5D61A 3BQ7A 4UASA 2YMPA 5JU5A 2GOLA 5CR0A 4F4YA 1L7OA 1TAMA 3NGDA 9ICUA 2HBKA 4F5QA 4GLXA 5DG7A 2WF7A 3VCBA 2IUBA 1T3NA 5DGAA 4RWPA 2NRVA 4JB3A 3A0BU 1RDFA 3QU5A 5EE0A 2F44A 1JX4A 3BZKA 4CF5A 7ICSA 2KKVA 5AKXA 5BPCA 1QTMA 5J8YC 4DFDA 5J0SA 3NVWA 2GA9D 1WG8A 4ECYA 4N7RA 2D8CA 2L5YA 8ICKA 3F2BA 3QE9Y 4BWJA 7ICIA 3F2CA 3KKAA 4F5NA 3TI0A 2BQRA 3L3FX 3HPOA 1S77D 4KLTA 3F5AA 1S8OA 3RRGA 4LZGA 2HBMA 5KFUA 4FHYA 3QZ7A 4M6WA 4QZGA 3S6JA 4QZIA 2ZXHA 5EE9A 5KFKA 4M9JA 4X4QA 5AK3A 2JV3A 4X5VA 3EUB2 2QARA 7ICGA 2HSZA 3MGHA 4WC2A 4O3OA 4O3SA 4WBYA 1NKEA 2W3SA 4RQ4A 2KTQA 3NRWA 4J9QA 3NS1A 4C8OA 1L6NA 1F5SA 3K1ZA 4WOYA 1SIJA 3GQCA 4LEYA 4KITB 2F76X 3D2NA 1XU4A 4JWMA 3BQ2A 2IOFA 4X4VA 4Q8EA 2PFOA 5AIBA 2GWSA 4UB3A 2YX8A 4R8UA 1A6SA 4ICAA 4OD0A 2EDUA 2H3FA 4ELTA 4RZRA 5J2EA 1TK8A 4LVSA 1ZQZA 3OWGA 2OXOA 4RQ2A 5CFSA 1N62A 4QZDA 3UPQA 1X9SA 4EBJA 1C7YA 1JN3A 4P2HA 2EZZA 5L1KA 3FDSA 1SXEA 4RQMA 4DSEA 2W7PA 1FA0A 4J9MA 2YTUA 2QARB 4UAUA 4USAA 4F92B 4RNOA 3C2LA 4NKTA 1S9FA 4RWQA 1RZTA 3SQIA 2W54A 4K4IA 4O69A 3H40A 4RQ8A 5J2KA 1MN8A 1ZD3A 1N61A 1X66A 2E8OA 5AICA 8ICLA 3CP8A 1A76A 4UAYA 2C2DA 1U48A 4O5CA 5KFTA 2D6FC 9ICAA 1IV8A 5HRLA 4R8UB 4DQPA 2B51A 1R8BA 4WJ3B 1IG6A 2ALZA 1Q8KA 2K60A 1PVQA 1J97A 7ICLA 5L1JA 3PHZA 2W03A 4GC6A 7ICOA 2EANA 4J9KA 2OH2A 2Y0SF 4P0QA 2W8LA 1JXLA 4ED8A 3H4BA 4YN4A 3GDXA 2ZUBA 2I9GA 5HRDA 3HJ1A 4LEVA 1L7MA 1U45A 3RBDA 1NOMA 2IA6A 4I27A 3OUYA 3ZDBA 2HHTA 1T4GA 2Q4TA 3V7LA 4NXUA 3D2QA 4EBCA 4ECQA 4QZFA 3GILA 2ZTDA 3NRZA 3TFSA 8ICBA 4GXIA 5J2IA 4DSKA 4MFFA 4Y2TA 3QU9A 5KFHA 1ZQBA 1HEKA 4KX5A 5ALDA 3QEAZ 7ICTA 3KBBA 8ICCA 5KFDA 2HOFA 2B6GA 4DQSA 5IIJA 4P0QB 1QLNA 1L8OA 4YFKA 5ALJA 4QZHA 2NV3A 3H8MA 4Z6DA 4QWDA 3MR6A 3EYZA 3WKAA 3V7JA 2XIDA 3OUYB 5KFLA 1VLBA 1Z3EB 2FPLA 2ZTCA 2YMMA 3Q8LA 4EX6A 4JLZA 2P35A 1XNSA 3C5FA 4KLIA 3GV8B 3EPIA 4NJ8A 4HAIA 7ICVA 1CRXA 4EELA 4C7YA 3AM9A 1KTQA 1TK5A 2WTFA 2DFLA 5KG4A 5EWFA 1NJWA 1S76D 4EZ6A 4EYIB 4BJQA 3RJIA 4F4KA 4ACOA 1PK1A 5C0YA 4K9AA 3OVBA 1T3QA 4B6JA 5KNIA 5KFNA 2LYBA 2ZH9A 5J2JA 3HW8A 3LK9A 3AMZA 4E80A 5DQIA 2BPFA 2JXJA 2R8KA 2ZH3A 2XO7A 3CK6A 3ZDAA 4DLGA 3I1YA 3WK7A 5KG3A 5DDMA 1X6JA 4HX0A 4OJ5A 4NLCA 3LVVA 2A1JA 9ICGA 4UB4A 1BNPA 4ED3A 4KB6A 4F4WA 4MKPA 2FLPA 4EEDA 2VJ5A 2VA3A 4M9NA 1XSPA 1SL0A 2DBYA 4NKUA 4PL2A 3RJFA 1PK1B 5CFTA 3JZ0A 5J2FA 1Z1VA 4NWIA 1OXJA 2KSOA 5HRFA 1HIWA 1T8EA 1ECWA 4F71A 2KV2A 2QB0B 3N97B 2I6XA 1ZXIA 2DKXA 1DXSA 3QEBZ 4B9LA 2QLTA 5FP0A 3THVA 3QUQA 5AKIA 1VJ7A 2WFAA 1KL9A 3KHRA 2KZ3A 2AXTU 3IG5A 1ZOLA 3MDAA 2F8KA 2XY6A 2BZFA 4GFJA 4US9A 3H8JA 2ZH8A 2A1JB 5HMLA 7ICNA 2BDUA 1B22A 1DK2A 1TAUA 4B9VA 2KEYA 4RQ3A 4O5KA 4PZOA 4KLOA 5L1MA 3D2SA 4O3MA 8ICWA 4XJEA 2KSOB 2QKQA 4OJPA 3RH6A 5DDYA 2B4VA 1CI4A 1FO4A 3C23A 2XGPA 1S0OA 3OV7A 3OHAA 4O5EA 4OCZA 3C2KA 3WK5A 4GC7A 4FZNA 2G0AA 3LYSA 1NJXA 4F3OA 2JH7A 3H39A 2HW3A 4Y2PA 4Q45A 3HIYA 3RJEA 3T5HA 3BS7A 2XI9A 5KFSA 4EBKA 4O3QA 3RB6A 4C4TA 3Q8PB 8ICGA 2KK0A 2K4PA 1XC9A 5IILA 5ALWA 5ALXA 4OAGA 2UVRA 3MR3A 1XS9D 1OUQA 5KFOA 2BCQA 9ICQA 4PGXA 3WK8A 8ICNA 5DG8A 1UT5A 1IXRA 7ICMA 3PX4A 2VKQA 1R8AA 2M2UA 2BBJA 5KT2A 5KTQA 5EE3A 3JPNA 4GXJA 7ICRA 3KFUF 5KAIU 1RYRA 3ZDEA 4I2CA 4UB6U 3C5GA 3QUCA 2HMXA 4ZOHC 2QB1A 7ICFA 2DR5A 1L5UA 2ODGA 1QQ5A 5KG5A 4E7XA 4NY8A 1KEJA 4HYKA 2F1IA 1KDHA 3G6YA 1ZQCA 4QIWC 3KZXA 1DOQA 1F5AA 4OAHA 3AL0B 5F3XB 3EPGA 1S5LU 2OCEA 1EXNA 2I1QA 2B56A 1JROA 4CF3A 2W7OA 1FFVA 9ICMA 3MR2A 2M2TA 1DGSA 1KW4A 3UPSA 4LJXA 3H37A 3MCRA 3DEEA 3M8RA 3GIKA 1UEUA 5IIMA 1ZETA 4P4PA 4YR3A 4YG2A 4XA5A 2C28A 2ASDA 2O5AA 2BQUA 1GO3F 5J2CA 2F77X 5EWGA 3HJEA 1D8BA 4I2AA 4Y2SA 3C2MA 2KP7A 4ECXA 3PR5B 3ETLA 5HC9A 2YQEA 4ECTA 1SL2A 3AQMA 5CFUA 3ED5A 5AK5A 2M2WA 3OGUA 3SZ2A 2PI4A 5J8YA 5HRKA 2K4EA 1L3VA 2VA8A 1D9DA 4ED0A 2Y1JA 3PSTA 4FH3A 1RQNA 5AI9A 1N60A 2HHSA 5AKLA 2KVCA 2YMLA 1NK0A 3UXPA 3RB0A 4RQ7A 3M6ZA 5L1LA 3AQKA 1PVPA 3HWTA 4I0UA 1U4BA 2Q0ZX 4CE6A 1B0XA 1KN5A 2BPCA 4TQSA 1JAJA 3TQ1A 2DGZA 2DR9A 3WKCA 2BCVA 3WU2U 4WC7A 7ICPA 1ZQFA 4OJOA 3V6KA 3EF2A 4CNQA 3VC8A 5HHIA 9ICXA 4KMUA 4TUPA 8ICEA 4A8EA 5DBCA 4NM1A 3BQ0A 1NK5A 2MRLA 5EWEA 1BPBA 1NKCA 2W3RA 1TFWA 2WAQF 2GAFD 5DG9A 4F5RA 5CHEA 1JIHA 1X40A 1X2IA 5ALRA 2OEHA 5DB6A 5DBBA 5HR6A 2JZBB 4KLJA 4DSIA 4I2EA 4QZ9A 1U9LA 1RG6A 3K4GA 4FFDA 2JEIA 2NRTA 4I2JA 4CF4A 1NJZA 1CUKA 4K4GA 4ZH4A 4NM2A 4C8LA 5KFEA 2AU0A 1WWVA 2PMZC 2NRZA 2UVWA 1D9FA 4F2RA 2HHQA 2FMQA 5KFBA 2DWQA 2G5IB 3ZDCA 3KHLA 2R8GA 2VIXA 2BGWA 2AGPA 3H4DA 2PBEA 1D8LA 2P66A 4IL6U 1COOA 1JUDA 5DB9A 2BQ3A 3F53A 1N56A 4FHPA 5HNKA 1K5OA 2KJ9A 3HKZC 5DGBA 1JALA 2RLTA 1B4FA 3MBYA 4DFMA 2IBKA 2YN4A 1X9MA 5CWRA 1ZYQA 4QZCA 3AQEA 5KT6A 2KE7A 4UARA 2V9WA 1MSWD 3ERCC 4WC1A 5D63A 4BX9C 1MIVA 1RYUA 1UQVA 5KFPA 3M6KA 1QSSA 2MUTA 1TV9A 3AQNA 1WWUA 4DLEA 4X4TA 2E1EA 3AN1A 2R8JA 5J2HA 3M8SA 3ZD9A 4BWMA 4MF2A 4UB1A 4DQIA 4OJ6A 1YZ7A 4DOAA 2R18A 2EQYA 5F9LA 1BPYA 4QW9A 2YMQA 2ZTEA 4K97A 5IINA 1CEZA 3CNHA 9ICSA 5HRHA 3D6JA 3WFPA 1LVHA 4RPXA 3ZD8A 4FO6A 5KL8B 3C28A 3PW7A 5KG0A 4KLFA 8ICSA 4Y2UA 3C66A 2DPIA 4RPZA 1SZHA 4RUAA 1Z19A 1WUDA 4XUSA 4YQWA 4F72A 3KHGA 2ASJA 1KLNA 2H3ZA 3DDHA 5F9NA 3ISCA 2RDIA 1RXWA 3PO5A 2FMPA 4PPXA 5J0TA 1XO1A 2MUTB 5KG1A 4F4XA 4EEYA 3FC4A 2AGQA 1VDVA 9ICEA 3RJHA 3UQ0A 1QSLA 5KFJA 2EZYA 1ZQRA 1KNYA 4DF8A 4M9LA 1V38A 1MQ3A 3UXOA 3N7PD 4X4OA 3H3AA 1GPJA 1HUZA 1QQ7A 3BDPA 1PX5A 4TUQA 2W9AA 3CYMA 2CXYA 2G08A 5L9XA 4ELVA 3Q8QB 4QW8A 5DQGA 4YVZA 4C8MA 1SV0A 3UMGA 8ICZA 2Q66A 5AHXA 1FFUA 2WF6A 4K9BA 1L8LA 3OTQA 2IOFK 3PR4A 4EEBA 3MGIA 2JMGA 2NRWA 5AM2A 1ZQSA 2JH1A 5AIAA 4B9NA 4JUZA 3JCFA 4CCHA 2AQ0A 2AH5A 1Q3VA 2H5XA 2BBHA 4DSLA 2ISPA 1NK8A 3HP6A 3SV4A 4B9MA 2ZH1A 4GXKA 4C8NA 5KFZA 1TAQA 4PHPA 4F93B 3NVZA 5ALUA 2YB4A 5TZVA 4M9GA 5ALSA 5KT4A 2NO4A 3EZ5A 2KICA 4YD2A 1X42A 2PFQA 1YZ6A 2EAOA 4LEWA 5IIOA 4DL4A 1ZQWA 4B9SA 4DFKA 2WAQC 2ZJ5A 5KFQA 5DB7A 4NXWA 3H8WA 3WFSC 4BUGA 2FJ6A 3NTUA 1Z4OA 3PY8A 5AK6A 1BPEA 4Z6CA 3L5KA 2HN1A 1N63A 2DL0A 1SV0C 2MAXA 3R9KA 3M9MB 4RQNA 1SV4A 9ICJA 5ALLA 2AGOA 2WB1F 3K1RB 2P6UA 4WC0A 2MA1A 5ALEA 2W43A 4I2DA 4QIWF 5ALYA 2HHWA 4DL6A 2HCFA 5KFRA 9ICHA 5DB8A 2PFPA 3LWMA 2RDJA 4EENA 8ICMA 5AM1A 4IRKA 9ICRA 3HJ4A 4J9RA 2ZH6A 2QB0A 4UQGA 3AU2A 2E8MA 3N7SC 1Z4NA 3MC1A 4NXXA 5H2FU 4YR2A 4RT2A 5HREA 4UBBA 3F5EA 1Y88A 4M9HA 2PXIA 1KKXA 3GIIA 4FH5A 4NXVA 5J0PA 4IQWA 2KKPA 3M1YA 1UA0A 2GO7A 2ZIXA 1ZJNA 2VANA 4K8VA 5DBAA 4G3IA 1ZJMA 4FO1A 2LYAA 3PW4A 4AT7A 4O3PA 3WK9A 2NO5A 1J2NA 2ZIWA 4OO1J 4I2HA 2NRKA 3FM9A 4ECVA 3PX6A 3TAPA 4NLNA 2HHPA 3WKEA 2ZJAA 4RQ5A 1ZD2P 4P0PA 4KMOB 2M0NA 2K8AA 1ZRMA 1ZQHA 4KN7A 2F8LA 2ZHAA 1BNOA 1MIWA 5GTHU 2KIWA 1ZQGA 2WF5A 5JRTA 2LHTA 3AEVA 3GV5B 3V72A 4WCWA 3OHBA 3M9NB 8ICXA 3F2DA 4EV6A 4EYHB 3NYBA 2ZIXB 1XWLA 3OVSA 2F1HA 1BPZA 4YR0A 4NV0A 5B66U 3KHHA 3QU7A 5KG2A 5KG7A 2OM6A 4AT7B 5CJ7A 3PV8A 2PI5A 5CP2A 2ZIWB 1N5XA 5HP4A 2LM1A 2E8PA 1NO5A 2HHXA 2W9MA 5J2AA 1TKDA 4R66A 3UQ2A 1KFDA 3RF9A 1O08A 2E3TA 2VA2A 2F2AB 3N4MB 3PX0A 5ALQA 5CEHA 3Q8RB 4P0PB 4Y2QA 5TISU 3H8SA 4WH5A 5HRBA 2YB1A 2ZH2A 3RR7A 4O3RA 1ZQTA 3QUTA 4PGQA 5AKYA 2HN2A 1SWVA 5AI0A 5CHGA 3JPPA 3MDCA 4J9NA 4RQ1A 5KG6A 2BKEA 4UB5A 2PMZF 4P4OA 9ICKA 3DV9A 2HI0A 4RNNA 4AT9A 5CA7A 1TFRA 5KFMA 5KFFA 2BE3A 1ZQVA 4JV0A 3TADA 3BQ1A 7ICQA 5J2DA 3TAQA 3IP4B 2BDPA 2W9BB 3T5KA 1Q46A 1KSPA 4ED7A 5AKJA 3HKZF 2ZH4A 4BDPA 3OPXA 3NWIA 3ZI4A 4F2SA 2E1FA 5J2BA 4FBUA 2KZZA 4I2GA 4FHWA 1U47A 3UMCA 1XO0A 2WHEA 4PHEA 2AJQA 5B3QA 9ICOA 5HMMA 3TKAA 1T94A 5KFVA 4RNMA 1X6IA 4EBEA 4JLXA 4AT9B 3HILA 3SEIA 1MQ2A 4DQRA 2WB1C 2Y9TA 2OYYA 3ISDA 4XQ7A 4IG8A 4PZNA 4X4RA 1JRPA 1SWWA 4ATBB 4IR1A 2EH9A 2W55A 4E0DA 1VFGA 4RWOA 5C5JA 4J9LA 1Z1BA 4NXTA 2HBLA 3U26A 5ALPA 3TADC 3V6JA 3B0XA 4KLSA 5B5EU 3B9JA 4DS4A 2EWRA 1ZQIA 4X0AA 2R8IA 4RQ0A 2ZG6A 4ECWA 3HT3A 4KLDA 2R8HA 1ZQJA 9ICCA 1LB2B 4EGWA 3C18A 2LMRA 5DLFA 3BQTA 4C4SA 4UW9A 5J0XA 2DF4B 1N5WA 2K8BB 3RB3A 1UHUA 5DECA 2ZIUB 4QZEA 5KFIA 3TANA 4ECZA 4YCXA 2G06A 4ECRA 1ZQUA 1Z00B 3SAGA 3IDWA 4MF8A 2DRBA 2KG5A 3IG8A 4E8FA 4UATA 1YT3A 1UCVA 4KX3A 4UD5A 3IHQB 3GV7B 4RU9A 4ED1A 3PSPA 1NJYA 5AKKA 2DPJA 3IRUA 2EAPA 4M2YA 2PKEA 3SV3A 2KIVA 1S0NA 4MFCA 2JZBA 1ZQKA 5EOZA 2JHDA 4DL5A 3T5LA 1C20A 5KFYA 3SMVA 5KFCA 1S97A 4DO9A 9ICLA 3H0MB 5AKGA 3PVXA 1BGXT 2CRXA 1KFTA 4IQTA 4K4HA 4FBTA 3WFOA 4O67A 5JTGA 3TARA 4DSJA 4NXZA 1L3SA 2JR5A 2LI6A 4K99A 2KMDA 3RRHA 3KZIU 2M9NA 2ASLA 4QWCA 2F1JA 5A0LA 3T79A 3PW0A 1R89A 9ICIA 3FAHA 3SI8A 1MIYA 2ESEA 3MGVA 2IMWP 2FPMA 2KFNA 5G5HA 5B3PA 2FCLA 2ZIVB 2K4HA 5ALVA 1KQQA 1ZD4A 4FE3A 2JEFA 3AU6A 3PNCA 1IM4A 4QWAA 2XCAA 1BPXA 4WQLA 2H3VA 2J6SA 2NRXA 1A0PA 4TURA 1AQ6A 1ZQDA 4O0IA 4WBZA 3AQLA 1LKYA 3BS5B 4OAFA 1L7PA 4FS2A 4MEXA 3I28A 4ED6A 2V4QA 2KJ8A 4NL9C 2JGAA 5J0WA 3QU2A 4YXMA 2ZJ8A 4C7ZA 4RWNA 5GTIU 1ZQEA 4KLLA 1Q78A 3OSNA 4I2FA 3C1ZA 4O68A 5DEDA 3TACB 2EAMA 4X4PA 3MFHA 1Q79A 3RB4A 4RUCA 1S0VA 1XSNA 3GIJA 1NZBA 2XICA 8ICTA 5G5GA 1ZQXA 3G6VA 3H7IA 1TE2A 3ONNA 3SD7A 1NK9A 2DR7A 1SKRA 2XY7A 4QWEA 3MFIA 2EZXA 2KHVA 4EEKA 4PGYA 4AYBF 2KZMA 3H0RB 4C80A 5ALMA 2Y1IA 7ICKA 8ICOA 1ZQ1C 4JV2A 2FLNA 4BGDA 4DEZA 2DRAA 2H3QA 4KLGA 1LKYB 4WC5A 2E5SA 1NNLA 3JPRA 8ICIA 4DWIA 1SGGA 3ZDDA 3H38A 3E58A 2O6KA 9ICBA 1PVRA 2KN7A 2A1AA 8ICPA 4R65A 3CRXA 1L3TA 2KVSA 4WQKA 4FHXA 4NLKA 2KHQA 3RJGA 4MHVA 2Y9UA 5HR9A 3H0LB 3GIMA 4MFAA 5DQHA 1V9PA 3ORYA 1RYSA 4X0BA 4M47A 4IQVA 4I2BA 2JEJA 3C1YA 3L9DA 2JRZA 7ICEA 3JYYA 4KLQA 4M0AA 4J9PA 1QQ6A 5AKEA 4FZLA 4M6WB 4F8RA 4UBCA 8ICAA 2DVIA 2UVVA 4F91B 4KTQA 3AQFA 8ICQA 9ICVA 3KKAC 5AM0A 4UAZA 1NK7A 1AROP 2ZH7A 3OJUA 2IHNA 5HRIA 4FS1A 9ICWA 4Z6FA 1LV5A 1UETA 5ALGA 1SZPA 2KJ5A 3K75D 1OW5A 1WYGA 1HJPA 5J0OA 3NVVA 2C22A 4ELUA 4QNLA 3RJJA 1BVSA 3IV6A 1YLQA 4I2IA 5AM3A 4ECUA 4KN4A 2FLLA 1ZQLA 4X4NA 5AM5A 2B0CA 3GU3A 4GIBA 8ICYA 4EZ9A 2AQ4A 5ALKA 3PW2A 2OWOA 5IIIA 4TUSA 4MEYA 2G07A 3T3FA 1UA1A 2FPKA 2MSNA 5HRGA 7ICHA 1S0MA 5K4LA 2W9CA 3RBEA 3LQCB 4KM5A 2W11A 1QSYA 3PZPA 3JPSA 2ID1A 4Q8FA 2LPEA 1OU5A 1N2XA
chains in the Genus database with same CATH topology
4BWJA 1DOQA 4R63A 7ICIA 1ZQHA 4KN7A 4F5NA 1F5AA 3TI0A 2ZHAA 3MR5A 2BQRA 3HPOA 4JV1A 1BNOA 1MIWA 4AT8A 3EPGA 1S77D 1ZQGA 4EP7A 1ZQMA 4KLTA 2ZHBA 1EXNA 2I1QA 3RRGA 4LZGA 5KFUA 4FHYA 3QZ7A 3GV5B 4O3NA 4M6WA 4QZGA 3LDAA 3MR2A 3V72A 5J0QA 5IIKA 5BOLA 9ICMA 2M2TA 4WCWA 3OHBA 3M9NB 1DGSA 4B9TA 4QZIA 8ICXA 3UPSA 3H37A 4QZBA 4EYHB 3NYBA 3M8RA 1XWLA 3OVSA 2F1HA 3GIKA 1UEUA 1BPZA 4YR0A 5IIMA 1ZETA 4P4PA 4YR3A 3KHHA 4M04A 5KG2A 4YG2A 4XA5A 5KFKA 2C28A 5KG7A 4M9JA 2ASDA 2O5AA 4AT7B 2BQUA 5CJ7A 3PV8A 2PI5A 1H38A 5J2CA 5CP2A 4X4QA 4F4ZA 2ZH5A 2W9CB 5HP4A 4X5VA 1NO5A 7ICGA 5EWGA 2HHXA 3MGHA 4WC2A 4O3OA 4I2AA 4O3SA 2W9MA 3C2MA 1NKEA 5J2AA 4WBYA 1TKDA 4R66A 3UQ2A 2KP7A 4ECXA 3PR5B 1KFDA 3ETLA 8ICJA 4NLZA 5HC9A 4RQ4A 2VA2A 4ECTA 2KTQA 4J9QA 4XRHA 1SL2A 3N4MB 3PX0A 3AQMA 4DL7A 3Q8RB 2V4RA 4C8OA 4KLMA 4DFPA 2M2WA 1ZQYA 3OGUA 3GQCA 4WC6A 3SZ2A 4KITB 4JWMA 3H8SA 1XU4A 5HRBA 1JQRA 2PI4A 5DKWA 3BQ2A 3RR7A 4O3RA 5HRKA 4Q8EA 1ZQTA 2GWSA 2PFOA 4UB3A 4AT8B 4X4VA 4Q44A 1L3VA 2VA8A 1HUOA 1D9DA 4ED0A 4R8UA 2Y1JA 5F2VO 4PGQA 4FH3A 5CHGA 3JPPA 4FHVA 2HHSA 4RQ6A 3MDCA 4ELTA 4J9NA 4DSFA 4RQ1A 4RZRA 5KG6A 5J2EA 1TK8A 1ZQZA 1NK0A 2BKEA 4LVSA 3UXPA 1XSLA 4UB5A 4RQ2A 3IM1A 4P4OA 4RQ7A 3RB0A 4QZDA 5L1LA 3UPQA 1X9SA 1ZQAA 1C7YA 9ICKA 4EBJA 1JN3A 4RNNA 4P2HA 3AQKA 3PMLA 4QZAA 3HWTA 4AT9A 5CA7A 5L1KA 3FDSA 2HHUA 4DSEA 1U4BA 2Q0ZX 1TFRA 5KFMA 1FA0A 5KFFA 4YXJA 2HVIA 2BE3A 2KFZA 1ZQVA 4JV0A 4J9MA 3JPOA 2BPCA 4TQSA 3BQ1A 1JAJA 3B0YA 3TQ1A 2BCSA 5J2DA 7ICQA 3TAQA 4F92B 4RNOA 3C2LA 4NKTA 1S9FA 4RWQA 1RZTA 2BDPA 2DR9A 4O9MA 2W9BB 3T5KA 2BCVA 1KSPA 7ICPA 4K4IA 4M5DA 3H40A 4WC7A 4YMNA 4ED7A 1ZQFA 4RQ8A 3MABA 3V6KA 4IRCA 5J2KA 2ZH4A 4BDPA 8ICLA 2C2RA 5HHIA 5D49A 9ICXA 1A76A 4KMUA 4UAYA 2C2DA 3RAQA 4TUPA 1U48A 1WCLA 4O5CA 8ICFA 5KFTA 2RFFA 4F2SA 1NZPA 5J2BA 5HRLA 9ICAA 4FBUA 4R8UB 2KZZA 8ICEA 5DBCA 4KLEA 4DQPA 4I2GA 4NM1A 1U47A 3BQ0A 1R8BA 4FHWA 4J9OA 1SKWA 1NK5A 5EWEA 4PHEA 1BPBA 5BOMA 1NKCA 2AJQA 3OVAA 2BCUA 9ICOA 2ALZA 5HMMA 5DG9A 4F5RA 4KLUA 4UD4A 1JIHA 1X2IA 5KFVA 5DB6A 1RPLA 5DBBA 4RNMA 7ICLA 4WC3A 4P4MA 4KLHA 4B9UA 2JZBB 5L1JA 4J9SA 4EBEA 4AT9B 5DLGA 3PMNA 4YP3A 1U49A 4GC6A 1MQ2A 4DQRA 4DSIA 4I2EA 4KLJA 7ICOA 4QZ9A 3ISDA 4J9KA 4XQ7A 4IG8A 2XC9A 8ICRA 1U9LA 4X4RA 2W8LA 3K4GA 1JXLA 4ED8A 3H4BA 2JEIA 2NRTA 4I2JA 4YN4A 1NJZA 1CUKA 2IHMA 3GDXA 2ZUBA 4IR1A 3G6XA 4K4GA 2I9GA 5HRDA 4ATBB 4ZH4A 5J29A 4E0DA 3HJ1A 4NM2A 4F5PA 4F5OA 3OJSA 4C8LA 5KFEA 1VFGA 4PHDA 1U45A 3UXNA 7ICJA 2AU0A 3RBDA 1DK3A 4DQQA 4RWOA 5C5JA 1NOMA 2NRZA 2IA6A 4J9LA 2UVWA 4I27A 3OUYA 3ZDBA 1D9FA 3TFRA 2HHTA 2BR0A 4F2RA 2ZUDA 1T4GA 2J6TA 1TFYA 2HHQA 5JUMA 2FMQA 3V6JA 3V7LA 3B0XA 4KLSA 4EBCA 4ECQA 1OU5A 4QZFA 3GILA 2ZTDA 3PW5A 3QZ8A 5KFBA 4DS4A 3ZDCA 4X4SA 3KHLA 2R8GA 4QWBA 1ZQIA 3TFSA 2BGWA 3SYZA 2AGPA 4X0AA 3H4DA 2R8IA 4RQ0A 8ICBA 2PBEA 4GXIA 1D8LA 2P66A 4ECWA 3HT3A 4KLDA 4PH5A 4R64A 1COOA 2R8HA 1ZQJA 1LB2B 9ICCA 3C18A 5J2IA 5DB9A 5DLFA 2BQ3A 3BQTA 4DSKA 9ICNA 1N56A 4MFFA 4FHPA 5HNKA 5J0XA 5DGBA 1S10A 2O1PA 5KFHA 3MBYA 4DFMA 1ZQBA 9ICPA 2IBKA 3V6HA 3RB3A 3QEAZ 7ICTA 4QZEA 5DECA 1X9MA 8ICCA 5KFIA 5KFDA 5CWRA 3TANA 1ZYQA 4QZCA 4ECZA 4DQSA 4YCXA 5KT6A 2W9BA 4EBDA 4Z6EA 5KT7A 2FMSA 1S76D 5IIJA 2V9WA 4ECRA 1MSWD 1QLNA 1ZQUA 1NK4A 1Z00B 3OSPA 4LT6A 4DF4A 4YFKA 4WC4A 5J0YA 4QZHA 4WC1A 4Z6DA 4QWDA 4MF8A 3MR6A 1MIVA 3EYZA 2DRBA 5KFPA 4YD1A 2XCPA 3V7JA 4I29A 1QSSA 2MUTA 5HHHA 4ECSA 1TV9A 8ICHA 3AQNA 4DLEA 5J2GA 4E8FA 4X4TA 2R8JA 3OUYB 5KFLA 4UD5A 1D8YA 9ICFA 3IHQB 1Z3EB 2FPLA 5J2HA 3M8SA 4DFJA 3ZD9A 1JMSA 4BWMA 3GV7B 1ZQNA 3RR8A 4RU9A 2ZTCA 4RT3A 4UB1A 4MF2A 4ED1A 1NK6A 4DQIA 4DOAA 1TK0A 1NJYA 1KRPA 2DPJA 5F9LA 3KTQA 1BPYA 3ISBA 3Q8LA 4QW9A 1ZQOA 2BPGA 2ZTEA 4M2YA 2BCRA 5IINA 3EWAA 3SV3A 1CEZA 9ICSA 2XGQA 1S0NA 4MFCA 2JZBA 4UB2A 4F50A 5KT5A 1ZQKA 5EOZA 5HRHA 1NKBA 4DL5A 5KFGA 3C5FA 3T5LA 4KLIA 2P6RA 5KFYA 3GV8B 5KFCA 3EPIA 3WFPA 4RPXA 1S97A 4DO9A 3ZD8A 4FO6A 9ICLA 7ICVA 2DR8A 1RXVA 1KTQA 3PW7A 3PVXA 5KG0A 1BGXT 1TK5A 4KLFA 2HVHA 8ICSA 4IQTA 8ICUA 4K4HA 2UVUA 1KFTA 2WTFA 1K1SA 2DFLA 5KG4A 2DPIA 4RPZA 4FBTA 3C66A 3WFOA 5EWFA 4RUAA 1NJWA 1T7PA 4EZ6A 3TARA 4DSJA 4EYIB 4IRDA 4NXZA 4XUSA 4YQWA 1L3SA 3KHGA 3WFQE 2ASJA 1KLNA 3RJIA 4F4KA 4JWNA 3OVBA 5F9NA 3ISCA 2RDIA 3RRHA 1RXWA 2FMPA 3PO5A 2M9NA 2ASLA 4PPXA 4QWCA 2F1JA 5KFNA 5J0TA 3PW0A 1L3UA 1R89A 9ICIA 2ZH9A 3WFRE 2DR7A 5J2JA 3HW8A 1XO1A 2MUTB 5KG1A 4F4XA 3LK9A 4EEYA 3SI8A 1MIYA 2AGQA 3V7KA 4E80A 2IMWP 2FPMA 5DQIA 2BPFA 9ICEA 3LWLA 2KFNA 3RJHA 2R8KA 4S3NA 2ZH3A 4RPYA 3Q8SB 2XO7A 2BHNA 5KFJA 3UQ0A 1QSLA 3ZDAA 2LYHA 3RAXA 1ZQRA 3AU6A 2JEFA 1KNYA 3PNCA 1IM4A 2W8KA 4DLGA 4QWAA 2J6UA 2XCAA 1BPXA 5KG3A 4DOBA 4DF8A 4M9LA 3RTVA 1MQ3A 2J6SA 2NRXA 5DDMA 2B21A 3Q8KA 7ICUA 3UXOA 4X4OA 1B43A 4TURA 2PFNA 5D46A 2A1JA 3H3AA 3RJKA 1ZQDA 4O0IA 9ICGA 4WBZA 4UB4A 1HUZA 3AQLA 4QZ8A 3FYHA 4LZDA 4FS2A 4MEXA 3HIYA 3BDPA 3M9OB 4ED6A 4TUQA 4Q43A 2W9AA 1BNPA 4ED3A 3JPTA 1PX5A 5D4BA 5L9XA 4ELVA 1Z00A 3Q8QB 4QW8A 4F4WA 2V4QA 5J0WA 2FLPA 5DQGA 4YXMA 2ZJ8A 5J0UA 3T5JA 5L1IA 2VA3A 4M9NA 4YVZA 4RWNA 4C8MA 1XSPA 1SL0A 1ZQEA 4KLLA 8ICZA 1Q78A 2Q66A 3OSNA 3RJFA 4I2FA 4NKUA 3C1ZA 5DEDA 1R8CA 2ISOA 5J2FA 3JZ0A 4X4PA 3MFHA 3PR4A 3HX0A 2XY5A 1T8EA 5HRFA 1Q79A 3RB4A 3MGIA 2NRWA 3N97B 4RUCA 1ZQSA 1S0VA 1XSNA 1JXEA 4JK1A 3GIJA 4ED2A 4B9NA 4JUZA 3QEBZ 8ICTA 4B9LA 4C8KA 4CCHA 1ZQXA 3G6VA 3THVA 3H7IA 1VJ7A 2C2EA 1NK9A 2AQ0A 3KHRA 1SKRA 2H5XA 2XY7A 3EW9A 1WOTA 2KZ3A 4YMOA 2ISPA 4DSLA 1NK8A 4QWEA 3MFIA 3HP6A 4PGYA 3SV4A 4B9MA 2ZH1A 3MDAA 2KZMA 2XY6A 7ICKA 2Y1IA 4GXKA 4DOCA 4C8NA 5KFZA 1TAQA 8ICOA 1BPDA 1K1QA 4PHPA 4F93B 2FLNA 4JV2A 4BGDA 3H8JA 4IQUA 4DEZA 5TZVA 1X9WA 4M9GA 4NLGA 2ZH8A 5KT4A 2A1JB 5HMLA 7ICNA 9ICTA 4IR9A 3EZ5A 4KLGA 4YD2A 4WC5A 2ZH2A 3JPRA 1B22A 8ICIA 2PFQA 4DWIA 1DK2A 2M2VA 5IIOA 1TAUA 4UAWA 4DL4A 1ZQWA 3ZDDA 3H38A 4B9SA 4DFKA 9ICBA 4B9VA 8ICPA 2KN7A 4R65A 4RQ3A 2ZJ5A 5KFQA 5DB7A 1L3TA 1V4AA 4YMMA 4O5KA 3H8WA 4FHXA 4NLKA 4KLOA 3WFSC 3E2EA 3RJGA 3NTUA 2ATLA 1SL1A 1WCNA 4BXOA 8ICWA 4I28A 5HR9A 3PY8A 2JEGA 1A77A 1ZQQA 3GIMA 1BPEA 3RH6A 5DDYA 4Z6CA 3C23A 2ZUCA 2XGPA 3RH4A 5KFAA 4DL2A 1S0OA 3OV7A 4MFAA 3OHAA 4O5EA 3C21A 5DQHA 1V9PA 3C2KA 3ORYA 1RYSA 2MAXA 3M9MB 3JPQA 4DL3A 4X0BA 4PHAA 4M47A 9ICJA 4GC7A 3RH5A 4IQVA 5J0RA 2AGOA 4I2BA 2JEJA 2P6UA 3C1YA 4TQRA 4WC0A 3L9DA 1NJXA 1TVAA 1N48A 7ICEA 4F3OA 3JYYA 4KLQA 8ICVA 4I2DA 1ZQPA 4M0AA 2HHWA 3H39A 3PO4A 1PZNA 2HW3A 4XQ8A 4Q45A 4J9PA 4DL6A 5KFRA 2DRAA 9ICHA 5DB8A 4M6WB 2PFPA 5KFXA 4F8RA 4UBCA 3LWMA 1MC8A 3AUOA 3RJEA 3T5HA 2RDJA 8ICAA 4DS5A 8ICMA 2DVIA 2UVVA 4F91B 5KT3A 4KTQA 8ICQA 9ICVA 3Q8MA 1UEVA 2HHVA 4UAZA 5KFSA 1AROP 1NK7A 4IRKA 2ZH7A 4EBKA 4O3QA 3OJUA 9ICRA 3HJ4A 2IHNA 5HRIA 3RB6A 4FS1A 4J9RA 2ZH6A 5CB1A 3GFKB 3BJYA 4UQGA 9ICWA 4Z6FA 4X4UA 3AU2A 1SKSA 1LV5A 1KFSA 1UETA 1UT8A 5KFWA 3Q8PB 8ICGA 4BXOB 1SZPA 5IILA 1XC9A 2UVRA 3MR3A 1XS9D 3K75D 4YR2A 4RT2A 5KFOA 2BCQA 5HREA 4UBBA 9ICQA 1HJPA 5CR0A 1Y88A 4F4YA 5J0OA 4PGXA 2C22A 4M9HA 4ELUA 3RJJA 8ICNA 2PXIA 1BVSA 3NGDA 5DG8A 4F5QA 5DG7A 3GIIA 4GLXA 9ICUA 1TFWA 1UT5A 4FH5A 1IXRA 7ICMA 1YLQA 4I2IA 4ECUA 3PX4A 5DGAA 1T3NA 5J0PA 4IQWA 2NRVA 4KN4A 2M2UA 1R8AA 4RWPA 5KT2A 5KTQA 1UA0A 2FLLA 3JPNA 4GXJA 1ZQLA 7ICRA 4X4NA 1ZJNA 1RYRA 2VANA 5DBAA 3ZDEA 4G3IA 4I2CA 1ZJMA 8ICYA 4EZ9A 2AQ4A 3C5GA 3PW2A 2OWOA 5IIIA 4TUSA 1JX4A 3PW4A 4MEYA 4AT7A 4O3PA 1UA1A 3T3FA 7ICSA 2FPKA 5HRGA 7ICHA 4ATBA 5BPCA 1S0MA 1QTMA 2W9CA 3RBEA 7ICFA 3LQCB 1L5UA 2DR5A 5KG5A 5J0SA 4I2HA 4E7XA 1QSYA 2NRKA 4ECVA 3PX6A 3TAPA 4NY8A 3JPSA 4NLNA 4ECYA 2HHPA 2ID1A 1KEJA 4HYKA 2ZJAA 4RQ5A 2F1IA 1KDHA 3G6YA 1ZQCA 4Q8FA 8ICKA 3QE9Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWJ A;  1DOQ A;  4R63 A;  7ICI A;  1ZQH A;  4KN7 A;  4F5N A;  1F5A A;  3TI0 A;  2ZHA A;  3MR5 A;  2BQR A;  3HPO A;  4JV1 A;  1BNO A;  1MIW A;  4AT8 A;  3EPG A;  1S77 D;  1ZQG A;  4EP7 A;  1ZQM A;  4KLT A;  2ZHB A;  1EXN A;  2I1Q A;  3RRG A;  4LZG A;  5KFU A;  4FHY A;  3QZ7 A;  3GV5 B;  4O3N A;  4M6W A;  4QZG A;  3LDA A;  3MR2 A;  3V72 A;  5J0Q A;  5IIK A;  5BOL A;  9ICM A;  2M2T A;  4WCW A;  3OHB A;  3M9N B;  1DGS A;  4B9T A;  4QZI A;  8ICX A;  3UPS A;  3H37 A;  4QZB A;  4EYH B;  3NYB A;  3M8R A;  1XWL A;  3OVS A;  2F1H A;  3GIK A;  1UEU A;  1BPZ A;  4YR0 A;  5IIM A;  1ZET A;  4P4P A;  4YR3 A;  3KHH A;  4M04 A;  5KG2 A;  4YG2 A;  4XA5 A;  5KFK A;  2C28 A;  5KG7 A;  4M9J A;  2ASD A;  2O5A A;  4AT7 B;  2BQU A;  5CJ7 A;  3PV8 A;  2PI5 A;  1H38 A;  5J2C A;  5CP2 A;  4X4Q A;  4F4Z A;  2ZH5 A;  2W9C B;  5HP4 A;  4X5V A;  1NO5 A;  7ICG A;  5EWG A;  2HHX A;  3MGH A;  4WC2 A;  4O3O A;  4I2A A;  4O3S A;  2W9M A;  3C2M A;  1NKE A;  5J2A A;  4WBY A;  1TKD A;  4R66 A;  3UQ2 A;  2KP7 A;  4ECX A;  3PR5 B;  1KFD A;  3ETL A;  8ICJ A;  4NLZ A;  5HC9 A;  4RQ4 A;  2VA2 A;  4ECT A;  2KTQ A;  4J9Q A;  4XRH A;  1SL2 A;  3N4M B;  3PX0 A;  3AQM A;  4DL7 A;  3Q8R B;  2V4R A;  4C8O A;  4KLM A;  4DFP A;  2M2W A;  1ZQY A;  3OGU A;  3GQC A;  4WC6 A;  3SZ2 A;  4KIT B;  4JWM A;  3H8S A;  1XU4 A;  5HRB A;  1JQR A;  2PI4 A;  5DKW A;  3BQ2 A;  3RR7 A;  4O3R A;  5HRK A;  4Q8E A;  1ZQT A;  2GWS A;  2PFO A;  4UB3 A;  4AT8 B;  4X4V A;  4Q44 A;  1L3V A;  2VA8 A;  1HUO A;  1D9D A;  4ED0 A;  4R8U A;  2Y1J A;  5F2V O;  4PGQ A;  4FH3 A;  5CHG A;  3JPP A;  4FHV A;  2HHS A;  4RQ6 A;  3MDC A;  4ELT A;  4J9N A;  4DSF A;  4RQ1 A;  4RZR A;  5KG6 A;  5J2E A;  1TK8 A;  1ZQZ A;  1NK0 A;  2BKE A;  4LVS A;  3UXP A;  1XSL A;  4UB5 A;  4RQ2 A;  3IM1 A;  4P4O A;  4RQ7 A;  3RB0 A;  4QZD A;  5L1L A;  3UPQ A;  1X9S A;  1ZQA A;  1C7Y A;  9ICK A;  4EBJ A;  1JN3 A;  4RNN A;  4P2H A;  3AQK A;  3PML A;  4QZA A;  3HWT A;  4AT9 A;  5CA7 A;  5L1K A;  3FDS A;  2HHU A;  4DSE A;  1U4B A;  2Q0Z X;  1TFR A;  5KFM A;  1FA0 A;  5KFF A;  4YXJ A;  2HVI A;  2BE3 A;  2KFZ A;  1ZQV A;  4JV0 A;  4J9M A;  3JPO A;  2BPC A;  4TQS A;  3BQ1 A;  1JAJ A;  3B0Y A;  3TQ1 A;  2BCS A;  5J2D A;  7ICQ A;  3TAQ A;  4F92 B;  4RNO A;  3C2L A;  4NKT A;  1S9F A;  4RWQ A;  1RZT A;  2BDP A;  2DR9 A;  4O9M A;  2W9B B;  3T5K A;  2BCV A;  1KSP A;  7ICP A;  4K4I A;  4M5D A;  3H40 A;  4WC7 A;  4YMN A;  4ED7 A;  1ZQF A;  4RQ8 A;  3MAB A;  3V6K A;  4IRC A;  5J2K A;  2ZH4 A;  4BDP A;  8ICL A;  2C2R A;  5HHI A;  5D49 A;  9ICX A;  1A76 A;  4KMU A;  4UAY A;  2C2D A;  3RAQ A;  4TUP A;  1U48 A;  1WCL A;  4O5C A;  8ICF A;  5KFT A;  2RFF A;  4F2S A;  1NZP A;  5J2B A;  5HRL A;  9ICA A;  4FBU A;  4R8U B;  2KZZ A;  8ICE A;  5DBC A;  4KLE A;  4DQP A;  4I2G A;  4NM1 A;  1U47 A;  3BQ0 A;  1R8B A;  4FHW A;  4J9O A;  1SKW A;  1NK5 A;  5EWE A;  4PHE A;  1BPB A;  5BOM A;  1NKC A;  2AJQ A;  3OVA A;  2BCU A;  9ICO A;  2ALZ A;  5HMM A;  5DG9 A;  4F5R A;  4KLU A;  4UD4 A;  1JIH A;  1X2I A;  5KFV A;  5DB6 A;  1RPL A;  5DBB A;  4RNM A;  7ICL A;  4WC3 A;  4P4M A;  4KLH A;  4B9U A;  2JZB B;  5L1J A;  4J9S A;  4EBE A;  4AT9 B;  5DLG A;  3PMN A;  4YP3 A;  1U49 A;  4GC6 A;  1MQ2 A;  4DQR A;  4DSI A;  4I2E A;  4KLJ A;  7ICO A;  4QZ9 A;  3ISD A;  4J9K A;  4XQ7 A;  4IG8 A;  2XC9 A;  8ICR A;  1U9L A;  4X4R A;  2W8L A;  3K4G A;  1JXL A;  4ED8 A;  3H4B A;  2JEI A;  2NRT A;  4I2J A;  4YN4 A;  1NJZ A;  1CUK A;  2IHM A;  3GDX A;  2ZUB A;  4IR1 A;  3G6X A;  4K4G A;  2I9G A;  5HRD A;  4ATB B;  4ZH4 A;  5J29 A;  4E0D A;  3HJ1 A;  4NM2 A;  4F5P A;  4F5O A;  3OJS A;  4C8L A;  5KFE A;  1VFG A;  4PHD A;  1U45 A;  3UXN A;  7ICJ A;  2AU0 A;  3RBD A;  1DK3 A;  4DQQ A;  4RWO A;  5C5J A;  1NOM A;  2NRZ A;  2IA6 A;  4J9L A;  2UVW A;  4I27 A;  3OUY A;  3ZDB A;  1D9F A;  3TFR A;  2HHT A;  2BR0 A;  4F2R A;  2ZUD A;  1T4G A;  2J6T A;  1TFY A;  2HHQ A;  5JUM A;  2FMQ A;  3V6J A;  3V7L A;  3B0X A;  4KLS A;  4EBC A;  4ECQ A;  1OU5 A;  4QZF A;  3GIL A;  2ZTD A;  3PW5 A;  3QZ8 A;  5KFB A;  4DS4 A;  3ZDC A;  4X4S A;  3KHL A;  2R8G A;  4QWB A;  1ZQI A;  3TFS A;  2BGW A;  3SYZ A;  2AGP A;  4X0A A;  3H4D A;  2R8I A;  4RQ0 A;  8ICB A;  2PBE A;  4GXI A;  1D8L A;  2P66 A;  4ECW A;  3HT3 A;  4KLD A;  4PH5 A;  4R64 A;  1COO A;  2R8H A;  1ZQJ A;  1LB2 B;  9ICC A;  3C18 A;  5J2I A;  5DB9 A;  5DLF A;  2BQ3 A;  3BQT A;  4DSK A;  9ICN A;  1N56 A;  4MFF A;  4FHP A;  5HNK A;  5J0X A;  5DGB A;  1S10 A;  2O1P A;  5KFH A;  3MBY A;  4DFM A;  1ZQB A;  9ICP A;  2IBK A;  3V6H A;  3RB3 A;  3QEA Z;  7ICT A;  4QZE A;  5DEC A;  1X9M A;  8ICC A;  5KFI A;  5KFD A;  5CWR A;  3TAN A;  1ZYQ A;  4QZC A;  4ECZ A;  4DQS A;  4YCX A;  5KT6 A;  2W9B A;  4EBD A;  4Z6E A;  5KT7 A;  2FMS A;  1S76 D;  5IIJ A;  2V9W A;  4ECR A;  1MSW D;  1QLN A;  1ZQU A;  1NK4 A;  1Z00 B;  3OSP A;  4LT6 A;  4DF4 A;  4YFK A;  4WC4 A;  5J0Y A;  4QZH A;  4WC1 A;  4Z6D A;  4QWD A;  4MF8 A;  3MR6 A;  1MIV A;  3EYZ A;  2DRB A;  5KFP A;  4YD1 A;  2XCP A;  3V7J A;  4I29 A;  1QSS A;  2MUT A;  5HHH A;  4ECS A;  1TV9 A;  8ICH A;  3AQN A;  4DLE A;  5J2G A;  4E8F A;  4X4T A;  2R8J A;  3OUY B;  5KFL A;  4UD5 A;  1D8Y A;  9ICF A;  3IHQ B;  1Z3E B;  2FPL A;  5J2H A;  3M8S A;  4DFJ A;  3ZD9 A;  1JMS A;  4BWM A;  3GV7 B;  1ZQN A;  3RR8 A;  4RU9 A;  2ZTC A;  4RT3 A;  4UB1 A;  4MF2 A;  4ED1 A;  1NK6 A;  4DQI A;  4DOA A;  1TK0 A;  1NJY A;  1KRP A;  2DPJ A;  5F9L A;  3KTQ A;  1BPY A;  3ISB A;  3Q8L A;  4QW9 A;  1ZQO A;  2BPG A;  2ZTE A;  4M2Y A;  2BCR A;  5IIN A;  3EWA A;  3SV3 A;  1CEZ A;  9ICS A;  2XGQ A;  1S0N A;  4MFC A;  2JZB A;  4UB2 A;  4F50 A;  5KT5 A;  1ZQK A;  5EOZ A;  5HRH A;  1NKB A;  4DL5 A;  5KFG A;  3C5F A;  3T5L A;  4KLI A;  2P6R A;  5KFY A;  3GV8 B;  5KFC A;  3EPI A;  3WFP A;  4RPX A;  1S97 A;  4DO9 A;  3ZD8 A;  4FO6 A;  9ICL A;  7ICV A;  2DR8 A;  1RXV A;  1KTQ A;  3PW7 A;  3PVX A;  5KG0 A;  1BGX T;  1TK5 A;  4KLF A;  2HVH A;  8ICS A;  4IQT A;  8ICU A;  4K4H A;  2UVU A;  1KFT A;  2WTF A;  1K1S A;  2DFL A;  5KG4 A;  2DPI A;  4RPZ A;  4FBT A;  3C66 A;  3WFO A;  5EWF A;  4RUA A;  1NJW A;  1T7P A;  4EZ6 A;  3TAR A;  4DSJ A;  4EYI B;  4IRD A;  4NXZ A;  4XUS A;  4YQW A;  1L3S A;  3KHG A;  3WFQ E;  2ASJ A;  1KLN A;  3RJI A;  4F4K A;  4JWN A;  3OVB A;  5F9N A;  3ISC A;  2RDI A;  3RRH A;  1RXW A;  2FMP A;  3PO5 A;  2M9N A;  2ASL A;  4PPX A;  4QWC A;  2F1J A;  5KFN A;  5J0T A;  3PW0 A;  1L3U A;  1R89 A;  9ICI A;  2ZH9 A;  3WFR E;  2DR7 A;  5J2J A;  3HW8 A;  1XO1 A;  2MUT B;  5KG1 A;  4F4X A;  3LK9 A;  4EEY A;  3SI8 A;  1MIY A;  2AGQ A;  3V7K A;  4E80 A;  2IMW P;  2FPM A;  5DQI A;  2BPF A;  9ICE A;  3LWL A;  2KFN A;  3RJH A;  2R8K A;  4S3N A;  2ZH3 A;  4RPY A;  3Q8S B;  2XO7 A;  2BHN A;  5KFJ A;  3UQ0 A;  1QSL A;  3ZDA A;  2LYH A;  3RAX A;  1ZQR A;  3AU6 A;  2JEF A;  1KNY A;  3PNC A;  1IM4 A;  2W8K A;  4DLG A;  4QWA A;  2J6U A;  2XCA A;  1BPX A;  5KG3 A;  4DOB A;  4DF8 A;  4M9L A;  3RTV A;  1MQ3 A;  2J6S A;  2NRX A;  5DDM A;  2B21 A;  3Q8K A;  7ICU A;  3UXO A;  4X4O A;  1B43 A;  4TUR A;  2PFN A;  5D46 A;  2A1J A;  3H3A A;  3RJK A;  1ZQD A;  4O0I A;  9ICG A;  4WBZ A;  4UB4 A;  1HUZ A;  3AQL A;  4QZ8 A;  3FYH A;  4LZD A;  4FS2 A;  4MEX A;  3HIY A;  3BDP A;  3M9O B;  4ED6 A;  4TUQ A;  4Q43 A;  2W9A A;  1BNP A;  4ED3 A;  3JPT A;  1PX5 A;  5D4B A;  5L9X A;  4ELV A;  1Z00 A;  3Q8Q B;  4QW8 A;  4F4W A;  2V4Q A;  5J0W A;  2FLP A;  5DQG A;  4YXM A;  2ZJ8 A;  5J0U A;  3T5J A;  5L1I A;  2VA3 A;  4M9N A;  4YVZ A;  4RWN A;  4C8M A;  1XSP A;  1SL0 A;  1ZQE A;  4KLL A;  8ICZ A;  1Q78 A;  2Q66 A;  3OSN A;  3RJF A;  4I2F A;  4NKU A;  3C1Z A;  5DED A;  1R8C A;  2ISO A;  5J2F A;  3JZ0 A;  4X4P A;  3MFH A;  3PR4 A;  3HX0 A;  2XY5 A;  1T8E A;  5HRF A;  1Q79 A;  3RB4 A;  3MGI A;  2NRW A;  3N97 B;  4RUC A;  1ZQS A;  1S0V A;  1XSN A;  1JXE A;  4JK1 A;  3GIJ A;  4ED2 A;  4B9N A;  4JUZ A;  3QEB Z;  8ICT A;  4B9L A;  4C8K A;  4CCH A;  1ZQX A;  3G6V A;  3THV A;  3H7I A;  1VJ7 A;  2C2E A;  1NK9 A;  2AQ0 A;  3KHR A;  1SKR A;  2H5X A;  2XY7 A;  3EW9 A;  1WOT A;  2KZ3 A;  4YMO A;  2ISP A;  4DSL A;  1NK8 A;  4QWE A;  3MFI A;  3HP6 A;  4PGY A;  3SV4 A;  4B9M A;  2ZH1 A;  3MDA A;  2KZM A;  2XY6 A;  7ICK A;  2Y1I A;  4GXK A;  4DOC A;  4C8N A;  5KFZ A;  1TAQ A;  8ICO A;  1BPD A;  1K1Q A;  4PHP A;  4F93 B;  2FLN A;  4JV2 A;  4BGD A;  3H8J A;  4IQU A;  4DEZ A;  5TZV A;  1X9W A;  4M9G A;  4NLG A;  2ZH8 A;  5KT4 A;  2A1J B;  5HML A;  7ICN A;  9ICT A;  4IR9 A;  3EZ5 A;  4KLG A;  4YD2 A;  4WC5 A;  2ZH2 A;  3JPR A;  1B22 A;  8ICI A;  2PFQ A;  4DWI A;  1DK2 A;  2M2V A;  5IIO A;  1TAU A;  4UAW A;  4DL4 A;  1ZQW A;  3ZDD A;  3H38 A;  4B9S A;  4DFK A;  9ICB A;  4B9V A;  8ICP A;  2KN7 A;  4R65 A;  4RQ3 A;  2ZJ5 A;  5KFQ A;  5DB7 A;  1L3T A;  1V4A A;  4YMM A;  4O5K A;  3H8W A;  4FHX A;  4NLK A;  4KLO A;  3WFS C;  3E2E A;  3RJG A;  3NTU A;  2ATL A;  1SL1 A;  1WCN A;  4BXO A;  8ICW A;  4I28 A;  5HR9 A;  3PY8 A;  2JEG A;  1A77 A;  1ZQQ A;  3GIM A;  1BPE A;  3RH6 A;  5DDY A;  4Z6C A;  3C23 A;  2ZUC A;  2XGP A;  3RH4 A;  5KFA A;  4DL2 A;  1S0O A;  3OV7 A;  4MFA A;  3OHA A;  4O5E A;  3C21 A;  5DQH A;  1V9P A;  3C2K A;  3ORY A;  1RYS A;  2MAX A;  3M9M B;  3JPQ A;  4DL3 A;  4X0B A;  4PHA A;  4M47 A;  9ICJ A;  4GC7 A;  3RH5 A;  4IQV A;  5J0R A;  2AGO A;  4I2B A;  2JEJ A;  2P6U A;  3C1Y A;  4TQR A;  4WC0 A;  3L9D A;  1NJX A;  1TVA A;  1N48 A;  7ICE A;  4F3O A;  3JYY A;  4KLQ A;  8ICV A;  4I2D A;  1ZQP A;  4M0A A;  2HHW A;  3H39 A;  3PO4 A;  1PZN A;  2HW3 A;  4XQ8 A;  4Q45 A;  4J9P A;  4DL6 A;  5KFR A;  2DRA A;  9ICH A;  5DB8 A;  4M6W B;  2PFP A;  5KFX A;  4F8R A;  4UBC A;  3LWM A;  1MC8 A;  3AUO A;  3RJE A;  3T5H A;  2RDJ A;  8ICA A;  4DS5 A;  8ICM A;  2DVI A;  2UVV A;  4F91 B;  5KT3 A;  4KTQ A;  8ICQ A;  9ICV A;  3Q8M A;  1UEV A;  2HHV A;  4UAZ A;  5KFS A;  1ARO P;  1NK7 A;  4IRK A;  2ZH7 A;  4EBK A;  4O3Q A;  3OJU A;  9ICR A;  3HJ4 A;  2IHN A;  5HRI A;  3RB6 A;  4FS1 A;  4J9R A;  2ZH6 A;  5CB1 A;  3GFK B;  3BJY A;  4UQG A;  9ICW A;  4Z6F A;  4X4U A;  3AU2 A;  1SKS A;  1LV5 A;  1KFS A;  1UET A;  1UT8 A;  5KFW A;  3Q8P B;  8ICG A;  4BXO B;  1SZP A;  5IIL A;  1XC9 A;  2UVR A;  3MR3 A;  1XS9 D;  3K75 D;  4YR2 A;  4RT2 A;  5KFO A;  2BCQ A;  5HRE A;  4UBB A;  9ICQ A;  1HJP A;  5CR0 A;  1Y88 A;  4F4Y A;  5J0O A;  4PGX A;  2C22 A;  4M9H A;  4ELU A;  3RJJ A;  8ICN A;  2PXI A;  1BVS A;  3NGD A;  5DG8 A;  4F5Q A;  5DG7 A;  3GII A;  4GLX A;  9ICU A;  1TFW A;  1UT5 A;  4FH5 A;  1IXR A;  7ICM A;  1YLQ A;  4I2I A;  4ECU A;  3PX4 A;  5DGA A;  1T3N A;  5J0P A;  4IQW A;  2NRV A;  4KN4 A;  2M2U A;  1R8A A;  4RWP A;  5KT2 A;  5KTQ A;  1UA0 A;  2FLL A;  3JPN A;  4GXJ A;  1ZQL A;  7ICR A;  4X4N A;  1ZJN A;  1RYR A;  2VAN A;  5DBA A;  3ZDE A;  4G3I A;  4I2C A;  1ZJM A;  8ICY A;  4EZ9 A;  2AQ4 A;  3C5G A;  3PW2 A;  2OWO A;  5III A;  4TUS A;  1JX4 A;  3PW4 A;  4MEY A;  4AT7 A;  4O3P A;  1UA1 A;  3T3F A;  7ICS A;  2FPK A;  5HRG A;  7ICH A;  4ATB A;  5BPC A;  1S0M A;  1QTM A;  2W9C A;  3RBE A;  7ICF A;  3LQC B;  1L5U A;  2DR5 A;  5KG5 A;  5J0S A;  4I2H A;  4E7X A;  1QSY A;  2NRK A;  4ECV A;  3PX6 A;  3TAP A;  4NY8 A;  3JPS A;  4NLN A;  4ECY A;  2HHP A;  2ID1 A;  1KEJ A;  4HYK A;  2ZJA A;  4RQ5 A;  2F1I A;  1KDH A;  3G6Y A;  1ZQC A;  4Q8F A;  8ICK A;  3QE9 Y; 
#chains in the Genus database with same CATH topology
 3I76 A;  4R63 A;  3WK6 A;  1KBU A;  3MR5 A;  4JV1 A;  4AT8 A;  2RHF A;  5AK4 A;  5AKZ A;  4EP7 A;  1FIQ A;  1ZQM A;  2ZHB A;  3BZC A;  4O3N A;  1MA7 A;  2AHO B;  3LDA A;  5J0Q A;  5IIK A;  5BOL A;  4B9T A;  4QZB A;  5JTI A;  2LM4 A;  4M04 A;  1F44 A;  2D3D A;  3M7D A;  1H38 A;  4F4Z A;  2ZH5 A;  3N28 A;  2W9C B;  2FI1 A;  4K96 A;  8ICJ A;  2ES6 A;  4XRH A;  3L4P A;  4DL7 A;  3CW2 C;  2V4R A;  4KLM A;  4DFP A;  1ZQY A;  2MU2 A;  4WC6 A;  1QCK A;  1JQR A;  3GZF A;  5DKW A;  4UAV A;  2N1R A;  2RRD A;  5HR7 A;  4AT8 B;  4Q44 A;  1HUO A;  5ALN A;  5F2V O;  2DQN B;  4RQ6 A;  2VJ4 A;  4DSF A;  4US8 A;  4U7C A;  1XSL A;  3IM1 A;  5ALF A;  1ZQA A;  2A3V A;  1DRG A;  5AM4 A;  2OHF A;  3PML A;  1RM6 C;  3O0F A;  3A0H U;  4QZA A;  4LEZ A;  4AYB C;  2HHU A;  3NKU A;  3K7D A;  4YXJ A;  2HVI A;  2KFZ A;  3JPO A;  3B0Y A;  3PSF A;  2BCS A;  5KAF U;  1J2M A;  4O9M A;  3HRD D;  3SEN A;  4M5D A;  4YMN A;  3MAB A;  4IRC A;  2C2R A;  2IOH A;  5D49 A;  3RAQ A;  1P7D A;  1WCL A;  3J81 j;  8ICF A;  4EX7 A;  2RFF A;  3QUB A;  1NZP A;  3NAS A;  3QU4 A;  4KLE A;  4J9O A;  1SKW A;  5BOM A;  3OVA A;  2BCU A;  1COK A;  4UD4 A;  4KLU A;  5ALH A;  1RPL A;  4WC3 A;  4P4M A;  4KLH A;  4B9U A;  4J9S A;  5DLG A;  3PMN A;  4YP3 A;  1U49 A;  1SB3 C;  5AI8 A;  2XC9 A;  8ICR A;  2G09 A;  2IHM A;  3G6X A;  4J03 A;  5J29 A;  1ED1 A;  4F5P A;  4F5O A;  3OJS A;  4PHD A;  3KD3 A;  3UXN A;  7ICJ A;  1DK3 A;  4DQQ A;  2I5H A;  1X9X A;  3TFR A;  2BR0 A;  2ZUD A;  2J6T A;  3QYP A;  5JUM A;  2E8N A;  4CGZ A;  3PW5 A;  3KOO A;  3QZ8 A;  1PK3 A;  3N7R C;  4X4S A;  2K89 A;  4QWB A;  3SYZ A;  2HBJ A;  4G9B A;  1RQL A;  4PH5 A;  4R64 A;  2CPR A;  1ZRN A;  5ALZ A;  9ICN A;  1S10 A;  2O1P A;  4Y2R A;  1DGJ A;  9ICP A;  3V6H A;  2W9B A;  1Q3U A;  3C29 A;  4Z6E A;  5KT7 A;  4EBD A;  2FMS A;  3UM9 A;  2K8C B;  1NK4 A;  3OSP A;  4LT6 A;  2DKZ A;  4DF4 A;  4WC4 A;  5J0Y A;  2DUY A;  4YD1 A;  2XCP A;  2W04 A;  4I29 A;  5HHH A;  4ECS A;  8ICH A;  5J2G A;  5AKH A;  1D8Y A;  9ICF A;  3LVW A;  5E79 U;  4DFJ A;  1JMS A;  1ZQN A;  3RR8 A;  4RT3 A;  1NK6 A;  1TK0 A;  1KRP A;  5AI5 A;  3KTQ A;  2Y0S C;  3QNM A;  3ISB A;  1ZQO A;  4OJL A;  2BPG A;  2BCR A;  3EWA A;  4AP9 A;  1VJ5 A;  2XGQ A;  4UB2 A;  4F50 A;  5KT5 A;  1NKB A;  5KFG A;  2P6R A;  4UB8 U;  2KOB A;  1PUZ A;  3SR6 A;  2DR8 A;  2HDO A;  1RXV A;  3NVY A;  1JI7 A;  2HVH A;  4ATB A;  8ICU A;  4C4R A;  2UVU A;  1K1S A;  2NYV A;  2RP5 A;  4O6A A;  1T7P A;  4FHV A;  3UMB A;  4IRD A;  2CN1 A;  3WFQ E;  1NI3 A;  2FE9 A;  3ALR A;  4JWN A;  2A19 A;  2K4I A;  1L3U A;  3WFR E;  3V7K A;  3LWL A;  4S3N A;  4RPY A;  3Q8S B;  2BHN A;  1V85 A;  1O03 A;  2LYH A;  3RAX A;  2W8K A;  2J6U A;  1F0M A;  4DOB A;  3RTV A;  7ICU A;  3Q8K A;  2B21 A;  1B43 A;  2PFN A;  2ZIU A;  5D46 A;  4FZM A;  3RJK A;  2ZXI A;  4QZ8 A;  3FYH A;  4LZD A;  3NUQ A;  3M9O B;  4Q43 A;  3JPT A;  4Y2V A;  5D4B A;  1Z00 A;  4DCC A;  5J0U A;  3T5J A;  5L1I A;  2IHO A;  1ZD5 A;  2G5H B;  1L7N A;  1V97 A;  1R8C A;  2ISO A;  2YY6 A;  1M6Y A;  3HX0 A;  2XY5 A;  2FDR A;  3ER9 B;  1JXE A;  3E0F A;  4JK1 A;  5AI4 A;  4ED2 A;  4C8K A;  3RFA A;  3NVO A;  2C2E A;  1WOT A;  2WF8 A;  3EW9 A;  4YMO A;  5ALT A;  1UPH A;  3SAH A;  3ER8 C;  2KNJ A;  4DOC A;  1K1Q A;  1BPD A;  1SXD A;  2HOQ A;  2Z7J A;  4NLZ A;  4IC9 A;  4IQU A;  1X9W A;  3SAF A;  4NLG A;  3ICX A;  9ICT A;  4IR9 A;  1URJ A;  4CRX A;  3IN5 A;  5ALO A;  3WK4 A;  4QJF B;  2H3I A;  2XVT A;  2M2V A;  2LBO A;  4Y2Y A;  2RQ5 A;  5AI6 A;  4UAW A;  2HOI A;  4PJ0 U;  2KD1 A;  3PSI A;  4JMU A;  1V4A A;  4YMM A;  3WKD A;  3E2E A;  2ATL A;  1SL1 A;  4BXO A;  1WCN A;  4Y2J A;  4I28 A;  1IIP A;  3WKB A;  2JEG A;  1A77 A;  1ZQQ A;  2LKY A;  2ZIV A;  4OAI Z;  2ZUC A;  3QXG A;  5EE1 A;  5KFA A;  4DL2 A;  3RH4 A;  3C21 A;  4NL9 A;  3QX7 A;  3ETR A;  3JPQ A;  4DL3 A;  4PHA A;  3RH5 A;  5J0R A;  4NLB A;  5CRX A;  5D62 A;  4PL1 A;  3BS5 A;  2WF9 A;  4TQR A;  5KL1 B;  1TVA A;  1N48 A;  2GLE A;  5ALI A;  8ICV A;  1ZQP A;  4U6P A;  4IS7 A;  1PZN A;  3PO4 A;  4XQ8 A;  5KFX A;  1TFY A;  1MC8 A;  3AUO A;  4DS5 A;  5KT3 A;  1UEV A;  3Q8M A;  2HHV A;  2GH1 A;  4C0Z A;  4CDG A;  5T14 A;  5CB1 A;  3GFK B;  3BJY A;  1QH9 A;  2F3N A;  4Y2X A;  4K98 A;  4X4U A;  1SKS A;  1KFS A;  1UT8 A;  5KFW A;  1FEZ A;  4BXO B;  5D61 A;  3BQ7 A;  4UAS A;  2YMP A;  5JU5 A;  2GOL A;  5CR0 A;  4F4Y A;  1L7O A;  1TAM A;  3NGD A;  9ICU A;  2HBK A;  4F5Q A;  4GLX A;  5DG7 A;  2WF7 A;  3VCB A;  2IUB A;  1T3N A;  5DGA A;  4RWP A;  2NRV A;  4JB3 A;  3A0B U;  1RDF A;  3QU5 A;  5EE0 A;  2F44 A;  1JX4 A;  3BZK A;  4CF5 A;  7ICS A;  2KKV A;  5AKX A;  5BPC A;  1QTM A;  5J8Y C;  4DFD A;  5J0S A;  3NVW A;  2GA9 D;  1WG8 A;  4ECY A;  4N7R A;  2D8C A;  2L5Y A;  8ICK A;  3F2B A;  3QE9 Y;  4BWJ A;  7ICI A;  3F2C A;  3KKA A;  4F5N A;  3TI0 A;  2BQR A;  3L3F X;  3HPO A;  1S77 D;  4KLT A;  3F5A A;  1S8O A;  3RRG A;  4LZG A;  2HBM A;  5KFU A;  4FHY A;  3QZ7 A;  4M6W A;  4QZG A;  3S6J A;  4QZI A;  2ZXH A;  5EE9 A;  5KFK A;  4M9J A;  4X4Q A;  5AK3 A;  2JV3 A;  4X5V A;  3EUB 2;  2QAR A;  7ICG A;  2HSZ A;  3MGH A;  4WC2 A;  4O3O A;  4O3S A;  4WBY A;  1NKE A;  2W3S A;  4RQ4 A;  2KTQ A;  3NRW A;  4J9Q A;  3NS1 A;  4C8O A;  1L6N A;  1F5S A;  3K1Z A;  4WOY A;  1SIJ A;  3GQC A;  4LEY A;  4KIT B;  2F76 X;  3D2N A;  1XU4 A;  4JWM A;  3BQ2 A;  2IOF A;  4X4V A;  4Q8E A;  2PFO A;  5AIB A;  2GWS A;  4UB3 A;  2YX8 A;  4R8U A;  1A6S A;  4ICA A;  4OD0 A;  2EDU A;  2H3F A;  4ELT A;  4RZR A;  5J2E A;  1TK8 A;  4LVS A;  1ZQZ A;  3OWG A;  2OXO A;  4RQ2 A;  5CFS A;  1N62 A;  4QZD A;  3UPQ A;  1X9S A;  4EBJ A;  1C7Y A;  1JN3 A;  4P2H A;  2EZZ A;  5L1K A;  3FDS A;  1SXE A;  4RQM A;  4DSE A;  2W7P A;  1FA0 A;  4J9M A;  2YTU A;  2QAR B;  4UAU A;  4USA A;  4F92 B;  4RNO A;  3C2L A;  4NKT A;  1S9F A;  4RWQ A;  1RZT A;  3SQI A;  2W54 A;  4K4I A;  4O69 A;  3H40 A;  4RQ8 A;  5J2K A;  1MN8 A;  1ZD3 A;  1N61 A;  1X66 A;  2E8O A;  5AIC A;  8ICL A;  3CP8 A;  1A76 A;  4UAY A;  2C2D A;  1U48 A;  4O5C A;  5KFT A;  2D6F C;  9ICA A;  1IV8 A;  5HRL A;  4R8U B;  4DQP A;  2B51 A;  1R8B A;  4WJ3 B;  1IG6 A;  2ALZ A;  1Q8K A;  2K60 A;  1PVQ A;  1J97 A;  7ICL A;  5L1J A;  3PHZ A;  2W03 A;  4GC6 A;  7ICO A;  2EAN A;  4J9K A;  2OH2 A;  2Y0S F;  4P0Q A;  2W8L A;  1JXL A;  4ED8 A;  3H4B A;  4YN4 A;  3GDX A;  2ZUB A;  2I9G A;  5HRD A;  3HJ1 A;  4LEV A;  1L7M A;  1U45 A;  3RBD A;  1NOM A;  2IA6 A;  4I27 A;  3OUY A;  3ZDB A;  2HHT A;  1T4G A;  2Q4T A;  3V7L A;  4NXU A;  3D2Q A;  4EBC A;  4ECQ A;  4QZF A;  3GIL A;  2ZTD A;  3NRZ A;  3TFS A;  8ICB A;  4GXI A;  5J2I A;  4DSK A;  4MFF A;  4Y2T A;  3QU9 A;  5KFH A;  1ZQB A;  1HEK A;  4KX5 A;  5ALD A;  3QEA Z;  7ICT A;  3KBB A;  8ICC A;  5KFD A;  2HOF A;  2B6G A;  4DQS A;  5IIJ A;  4P0Q B;  1QLN A;  1L8O A;  4YFK A;  5ALJ A;  4QZH A;  2NV3 A;  3H8M A;  4Z6D A;  4QWD A;  3MR6 A;  3EYZ A;  3WKA A;  3V7J A;  2XID A;  3OUY B;  5KFL A;  1VLB A;  1Z3E B;  2FPL A;  2ZTC A;  2YMM A;  3Q8L A;  4EX6 A;  4JLZ A;  2P35 A;  1XNS A;  3C5F A;  4KLI A;  3GV8 B;  3EPI A;  4NJ8 A;  4HAI A;  7ICV A;  1CRX A;  4EEL A;  4C7Y A;  3AM9 A;  1KTQ A;  1TK5 A;  2WTF A;  2DFL A;  5KG4 A;  5EWF A;  1NJW A;  1S76 D;  4EZ6 A;  4EYI B;  4BJQ A;  3RJI A;  4F4K A;  4ACO A;  1PK1 A;  5C0Y A;  4K9A A;  3OVB A;  1T3Q A;  4B6J A;  5KNI A;  5KFN A;  2LYB A;  2ZH9 A;  5J2J A;  3HW8 A;  3LK9 A;  3AMZ A;  4E80 A;  5DQI A;  2BPF A;  2JXJ A;  2R8K A;  2ZH3 A;  2XO7 A;  3CK6 A;  3ZDA A;  4DLG A;  3I1Y A;  3WK7 A;  5KG3 A;  5DDM A;  1X6J A;  4HX0 A;  4OJ5 A;  4NLC A;  3LVV A;  2A1J A;  9ICG A;  4UB4 A;  1BNP A;  4ED3 A;  4KB6 A;  4F4W A;  4MKP A;  2FLP A;  4EED A;  2VJ5 A;  2VA3 A;  4M9N A;  1XSP A;  1SL0 A;  2DBY A;  4NKU A;  4PL2 A;  3RJF A;  1PK1 B;  5CFT A;  3JZ0 A;  5J2F A;  1Z1V A;  4NWI A;  1OXJ A;  2KSO A;  5HRF A;  1HIW A;  1T8E A;  1ECW A;  4F71 A;  2KV2 A;  2QB0 B;  3N97 B;  2I6X A;  1ZXI A;  2DKX A;  1DXS A;  3QEB Z;  4B9L A;  2QLT A;  5FP0 A;  3THV A;  3QUQ A;  5AKI A;  1VJ7 A;  2WFA A;  1KL9 A;  3KHR A;  2KZ3 A;  2AXT U;  3IG5 A;  1ZOL A;  3MDA A;  2F8K A;  2XY6 A;  2BZF A;  4GFJ A;  4US9 A;  3H8J A;  2ZH8 A;  2A1J B;  5HML A;  7ICN A;  2BDU A;  1B22 A;  1DK2 A;  1TAU A;  4B9V A;  2KEY A;  4RQ3 A;  4O5K A;  4PZO A;  4KLO A;  5L1M A;  3D2S A;  4O3M A;  8ICW A;  4XJE A;  2KSO B;  2QKQ A;  4OJP A;  3RH6 A;  5DDY A;  2B4V A;  1CI4 A;  1FO4 A;  3C23 A;  2XGP A;  1S0O A;  3OV7 A;  3OHA A;  4O5E A;  4OCZ A;  3C2K A;  3WK5 A;  4GC7 A;  4FZN A;  2G0A A;  3LYS A;  1NJX A;  4F3O A;  2JH7 A;  3H39 A;  2HW3 A;  4Y2P A;  4Q45 A;  3HIY A;  3RJE A;  3T5H A;  3BS7 A;  2XI9 A;  5KFS A;  4EBK A;  4O3Q A;  3RB6 A;  4C4T A;  3Q8P B;  8ICG A;  2KK0 A;  2K4P A;  1XC9 A;  5IIL A;  5ALW A;  5ALX A;  4OAG A;  2UVR A;  3MR3 A;  1XS9 D;  1OUQ A;  5KFO A;  2BCQ A;  9ICQ A;  4PGX A;  3WK8 A;  8ICN A;  5DG8 A;  1UT5 A;  1IXR A;  7ICM A;  3PX4 A;  2VKQ A;  1R8A A;  2M2U A;  2BBJ A;  5KT2 A;  5KTQ A;  5EE3 A;  3JPN A;  4GXJ A;  7ICR A;  3KFU F;  5KAI U;  1RYR A;  3ZDE A;  4I2C A;  4UB6 U;  3C5G A;  3QUC A;  2HMX A;  4ZOH C;  2QB1 A;  7ICF A;  2DR5 A;  1L5U A;  2ODG A;  1QQ5 A;  5KG5 A;  4E7X A;  4NY8 A;  1KEJ A;  4HYK A;  2F1I A;  1KDH A;  3G6Y A;  1ZQC A;  4QIW C;  3KZX A;  1DOQ A;  1F5A A;  4OAH A;  3AL0 B;  5F3X B;  3EPG A;  1S5L U;  2OCE A;  1EXN A;  2I1Q A;  2B56 A;  1JRO A;  4CF3 A;  2W7O A;  1FFV A;  9ICM A;  3MR2 A;  2M2T A;  1DGS A;  1KW4 A;  3UPS A;  4LJX A;  3H37 A;  3MCR A;  3DEE A;  3M8R A;  3GIK A;  1UEU A;  5IIM A;  1ZET A;  4P4P A;  4YR3 A;  4YG2 A;  4XA5 A;  2C28 A;  2ASD A;  2O5A A;  2BQU A;  1GO3 F;  5J2C A;  2F77 X;  5EWG A;  3HJE A;  1D8B A;  4I2A A;  4Y2S A;  3C2M A;  2KP7 A;  4ECX A;  3PR5 B;  3ETL A;  5HC9 A;  2YQE A;  4ECT A;  1SL2 A;  3AQM A;  5CFU A;  3ED5 A;  5AK5 A;  2M2W A;  3OGU A;  3SZ2 A;  2PI4 A;  5J8Y A;  5HRK A;  2K4E A;  1L3V A;  2VA8 A;  1D9D A;  4ED0 A;  2Y1J A;  3PST A;  4FH3 A;  1RQN A;  5AI9 A;  1N60 A;  2HHS A;  5AKL A;  2KVC A;  2YML A;  1NK0 A;  3UXP A;  3RB0 A;  4RQ7 A;  3M6Z A;  5L1L A;  3AQK A;  1PVP A;  3HWT A;  4I0U A;  1U4B A;  2Q0Z X;  4CE6 A;  1B0X A;  1KN5 A;  2BPC A;  4TQS A;  1JAJ A;  3TQ1 A;  2DGZ A;  2DR9 A;  3WKC A;  2BCV A;  3WU2 U;  4WC7 A;  7ICP A;  1ZQF A;  4OJO A;  3V6K A;  3EF2 A;  4CNQ A;  3VC8 A;  5HHI A;  9ICX A;  4KMU A;  4TUP A;  8ICE A;  4A8E A;  5DBC A;  4NM1 A;  3BQ0 A;  1NK5 A;  2MRL A;  5EWE A;  1BPB A;  1NKC A;  2W3R A;  1TFW A;  2WAQ F;  2GAF D;  5DG9 A;  4F5R A;  5CHE A;  1JIH A;  1X40 A;  1X2I A;  5ALR A;  2OEH A;  5DB6 A;  5DBB A;  5HR6 A;  2JZB B;  4KLJ A;  4DSI A;  4I2E A;  4QZ9 A;  1U9L A;  1RG6 A;  3K4G A;  4FFD A;  2JEI A;  2NRT A;  4I2J A;  4CF4 A;  1NJZ A;  1CUK A;  4K4G A;  4ZH4 A;  4NM2 A;  4C8L A;  5KFE A;  2AU0 A;  1WWV A;  2PMZ C;  2NRZ A;  2UVW A;  1D9F A;  4F2R A;  2HHQ A;  2FMQ A;  5KFB A;  2DWQ A;  2G5I B;  3ZDC A;  3KHL A;  2R8G A;  2VIX A;  2BGW A;  2AGP A;  3H4D A;  2PBE A;  1D8L A;  2P66 A;  4IL6 U;  1COO A;  1JUD A;  5DB9 A;  2BQ3 A;  3F53 A;  1N56 A;  4FHP A;  5HNK A;  1K5O A;  2KJ9 A;  3HKZ C;  5DGB A;  1JAL A;  2RLT A;  1B4F A;  3MBY A;  4DFM A;  2IBK A;  2YN4 A;  1X9M A;  5CWR A;  1ZYQ A;  4QZC A;  3AQE A;  5KT6 A;  2KE7 A;  4UAR A;  2V9W A;  1MSW D;  3ERC C;  4WC1 A;  5D63 A;  4BX9 C;  1MIV A;  1RYU A;  1UQV A;  5KFP A;  3M6K A;  1QSS A;  2MUT A;  1TV9 A;  3AQN A;  1WWU A;  4DLE A;  4X4T A;  2E1E A;  3AN1 A;  2R8J A;  5J2H A;  3M8S A;  3ZD9 A;  4BWM A;  4MF2 A;  4UB1 A;  4DQI A;  4OJ6 A;  1YZ7 A;  4DOA A;  2R18 A;  2EQY A;  5F9L A;  1BPY A;  4QW9 A;  2YMQ A;  2ZTE A;  4K97 A;  5IIN A;  1CEZ A;  3CNH A;  9ICS A;  5HRH A;  3D6J A;  3WFP A;  1LVH A;  4RPX A;  3ZD8 A;  4FO6 A;  5KL8 B;  3C28 A;  3PW7 A;  5KG0 A;  4KLF A;  8ICS A;  4Y2U A;  3C66 A;  2DPI A;  4RPZ A;  1SZH A;  4RUA A;  1Z19 A;  1WUD A;  4XUS A;  4YQW A;  4F72 A;  3KHG A;  2ASJ A;  1KLN A;  2H3Z A;  3DDH A;  5F9N A;  3ISC A;  2RDI A;  1RXW A;  3PO5 A;  2FMP A;  4PPX A;  5J0T A;  1XO1 A;  2MUT B;  5KG1 A;  4F4X A;  4EEY A;  3FC4 A;  2AGQ A;  1VDV A;  9ICE A;  3RJH A;  3UQ0 A;  1QSL A;  5KFJ A;  2EZY A;  1ZQR A;  1KNY A;  4DF8 A;  4M9L A;  1V38 A;  1MQ3 A;  3UXO A;  3N7P D;  4X4O A;  3H3A A;  1GPJ A;  1HUZ A;  1QQ7 A;  3BDP A;  1PX5 A;  4TUQ A;  2W9A A;  3CYM A;  2CXY A;  2G08 A;  5L9X A;  4ELV A;  3Q8Q B;  4QW8 A;  5DQG A;  4YVZ A;  4C8M A;  1SV0 A;  3UMG A;  8ICZ A;  2Q66 A;  5AHX A;  1FFU A;  2WF6 A;  4K9B A;  1L8L A;  3OTQ A;  2IOF K;  3PR4 A;  4EEB A;  3MGI A;  2JMG A;  2NRW A;  5AM2 A;  1ZQS A;  2JH1 A;  5AIA A;  4B9N A;  4JUZ A;  3JCF A;  4CCH A;  2AQ0 A;  2AH5 A;  1Q3V A;  2H5X A;  2BBH A;  4DSL A;  2ISP A;  1NK8 A;  3HP6 A;  3SV4 A;  4B9M A;  2ZH1 A;  4GXK A;  4C8N A;  5KFZ A;  1TAQ A;  4PHP A;  4F93 B;  3NVZ A;  5ALU A;  2YB4 A;  5TZV A;  4M9G A;  5ALS A;  5KT4 A;  2NO4 A;  3EZ5 A;  2KIC A;  4YD2 A;  1X42 A;  2PFQ A;  1YZ6 A;  2EAO A;  4LEW A;  5IIO A;  4DL4 A;  1ZQW A;  4B9S A;  4DFK A;  2WAQ C;  2ZJ5 A;  5KFQ A;  5DB7 A;  4NXW A;  3H8W A;  3WFS C;  4BUG A;  2FJ6 A;  3NTU A;  1Z4O A;  3PY8 A;  5AK6 A;  1BPE A;  4Z6C A;  3L5K A;  2HN1 A;  1N63 A;  2DL0 A;  1SV0 C;  2MAX A;  3R9K A;  3M9M B;  4RQN A;  1SV4 A;  9ICJ A;  5ALL A;  2AGO A;  2WB1 F;  3K1R B;  2P6U A;  4WC0 A;  2MA1 A;  5ALE A;  2W43 A;  4I2D A;  4QIW F;  5ALY A;  2HHW A;  4DL6 A;  2HCF A;  5KFR A;  9ICH A;  5DB8 A;  2PFP A;  3LWM A;  2RDJ A;  4EEN A;  8ICM A;  5AM1 A;  4IRK A;  9ICR A;  3HJ4 A;  4J9R A;  2ZH6 A;  2QB0 A;  4UQG A;  3AU2 A;  2E8M A;  3N7S C;  1Z4N A;  3MC1 A;  4NXX A;  5H2F U;  4YR2 A;  4RT2 A;  5HRE A;  4UBB A;  3F5E A;  1Y88 A;  4M9H A;  2PXI A;  1KKX A;  3GII A;  4FH5 A;  4NXV A;  5J0P A;  4IQW A;  2KKP A;  3M1Y A;  1UA0 A;  2GO7 A;  2ZIX A;  1ZJN A;  2VAN A;  4K8V A;  5DBA A;  4G3I A;  1ZJM A;  4FO1 A;  2LYA A;  3PW4 A;  4AT7 A;  4O3P A;  3WK9 A;  2NO5 A;  1J2N A;  2ZIW A;  4OO1 J;  4I2H A;  2NRK A;  3FM9 A;  4ECV A;  3PX6 A;  3TAP A;  4NLN A;  2HHP A;  3WKE A;  2ZJA A;  4RQ5 A;  1ZD2 P;  4P0P A;  4KMO B;  2M0N A;  2K8A A;  1ZRM A;  1ZQH A;  4KN7 A;  2F8L A;  2ZHA A;  1BNO A;  1MIW A;  5GTH U;  2KIW A;  1ZQG A;  2WF5 A;  5JRT A;  2LHT A;  3AEV A;  3GV5 B;  3V72 A;  4WCW A;  3OHB A;  3M9N B;  8ICX A;  3F2D A;  4EV6 A;  4EYH B;  3NYB A;  2ZIX B;  1XWL A;  3OVS A;  2F1H A;  1BPZ A;  4YR0 A;  4NV0 A;  5B66 U;  3KHH A;  3QU7 A;  5KG2 A;  5KG7 A;  2OM6 A;  4AT7 B;  5CJ7 A;  3PV8 A;  2PI5 A;  5CP2 A;  2ZIW B;  1N5X A;  5HP4 A;  2LM1 A;  2E8P A;  1NO5 A;  2HHX A;  2W9M A;  5J2A A;  1TKD A;  4R66 A;  3UQ2 A;  1KFD A;  3RF9 A;  1O08 A;  2E3T A;  2VA2 A;  2F2A B;  3N4M B;  3PX0 A;  5ALQ A;  5CEH A;  3Q8R B;  4P0P B;  4Y2Q A;  5TIS U;  3H8S A;  4WH5 A;  5HRB A;  2YB1 A;  2ZH2 A;  3RR7 A;  4O3R A;  1ZQT A;  3QUT A;  4PGQ A;  5AKY A;  2HN2 A;  1SWV A;  5AI0 A;  5CHG A;  3JPP A;  3MDC A;  4J9N A;  4RQ1 A;  5KG6 A;  2BKE A;  4UB5 A;  2PMZ F;  4P4O A;  9ICK A;  3DV9 A;  2HI0 A;  4RNN A;  4AT9 A;  5CA7 A;  1TFR A;  5KFM A;  5KFF A;  2BE3 A;  1ZQV A;  4JV0 A;  3TAD A;  3BQ1 A;  7ICQ A;  5J2D A;  3TAQ A;  3IP4 B;  2BDP A;  2W9B B;  3T5K A;  1Q46 A;  1KSP A;  4ED7 A;  5AKJ A;  3HKZ F;  2ZH4 A;  4BDP A;  3OPX A;  3NWI A;  3ZI4 A;  4F2S A;  2E1F A;  5J2B A;  4FBU A;  2KZZ A;  4I2G A;  4FHW A;  1U47 A;  3UMC A;  1XO0 A;  2WHE A;  4PHE A;  2AJQ A;  5B3Q A;  9ICO A;  5HMM A;  3TKA A;  1T94 A;  5KFV A;  4RNM A;  1X6I A;  4EBE A;  4JLX A;  4AT9 B;  3HIL A;  3SEI A;  1MQ2 A;  4DQR A;  2WB1 C;  2Y9T A;  2OYY A;  3ISD A;  4XQ7 A;  4IG8 A;  4PZN A;  4X4R A;  1JRP A;  1SWW A;  4ATB B;  4IR1 A;  2EH9 A;  2W55 A;  4E0D A;  1VFG A;  4RWO A;  5C5J A;  4J9L A;  1Z1B A;  4NXT A;  2HBL A;  3U26 A;  5ALP A;  3TAD C;  3V6J A;  3B0X A;  4KLS A;  5B5E U;  3B9J A;  4DS4 A;  2EWR A;  1ZQI A;  4X0A A;  2R8I A;  4RQ0 A;  2ZG6 A;  4ECW A;  3HT3 A;  4KLD A;  2R8H A;  1ZQJ A;  9ICC A;  1LB2 B;  4EGW A;  3C18 A;  2LMR A;  5DLF A;  3BQT A;  4C4S A;  4UW9 A;  5J0X A;  2DF4 B;  1N5W A;  2K8B B;  3RB3 A;  1UHU A;  5DEC A;  2ZIU B;  4QZE A;  5KFI A;  3TAN A;  4ECZ A;  4YCX A;  2G06 A;  4ECR A;  1ZQU A;  1Z00 B;  3SAG A;  3IDW A;  4MF8 A;  2DRB A;  2KG5 A;  3IG8 A;  4E8F A;  4UAT A;  1YT3 A;  1UCV A;  4KX3 A;  4UD5 A;  3IHQ B;  3GV7 B;  4RU9 A;  4ED1 A;  3PSP A;  1NJY A;  5AKK A;  2DPJ A;  3IRU A;  2EAP A;  4M2Y A;  2PKE A;  3SV3 A;  2KIV A;  1S0N A;  4MFC A;  2JZB A;  1ZQK A;  5EOZ A;  2JHD A;  4DL5 A;  3T5L A;  1C20 A;  5KFY A;  3SMV A;  5KFC A;  1S97 A;  4DO9 A;  9ICL A;  3H0M B;  5AKG A;  3PVX A;  1BGX T;  2CRX A;  1KFT A;  4IQT A;  4K4H A;  4FBT A;  3WFO A;  4O67 A;  5JTG A;  3TAR A;  4DSJ A;  4NXZ A;  1L3S A;  2JR5 A;  2LI6 A;  4K99 A;  2KMD A;  3RRH A;  3KZI U;  2M9N A;  2ASL A;  4QWC A;  2F1J A;  5A0L A;  3T79 A;  3PW0 A;  1R89 A;  9ICI A;  3FAH A;  3SI8 A;  1MIY A;  2ESE A;  3MGV A;  2IMW P;  2FPM A;  2KFN A;  5G5H A;  5B3P A;  2FCL A;  2ZIV B;  2K4H A;  5ALV A;  1KQQ A;  1ZD4 A;  4FE3 A;  2JEF A;  3AU6 A;  3PNC A;  1IM4 A;  4QWA A;  2XCA A;  1BPX A;  4WQL A;  2H3V A;  2J6S A;  2NRX A;  1A0P A;  4TUR A;  1AQ6 A;  1ZQD A;  4O0I A;  4WBZ A;  3AQL A;  1LKY A;  3BS5 B;  4OAF A;  1L7P A;  4FS2 A;  4MEX A;  3I28 A;  4ED6 A;  2V4Q A;  2KJ8 A;  4NL9 C;  2JGA A;  5J0W A;  3QU2 A;  4YXM A;  2ZJ8 A;  4C7Z A;  4RWN A;  5GTI U;  1ZQE A;  4KLL A;  1Q78 A;  3OSN A;  4I2F A;  3C1Z A;  4O68 A;  5DED A;  3TAC B;  2EAM A;  4X4P A;  3MFH A;  1Q79 A;  3RB4 A;  4RUC A;  1S0V A;  1XSN A;  3GIJ A;  1NZB A;  2XIC A;  8ICT A;  5G5G A;  1ZQX A;  3G6V A;  3H7I A;  1TE2 A;  3ONN A;  3SD7 A;  1NK9 A;  2DR7 A;  1SKR A;  2XY7 A;  4QWE A;  3MFI A;  2EZX A;  2KHV A;  4EEK A;  4PGY A;  4AYB F;  2KZM A;  3H0R B;  4C80 A;  5ALM A;  2Y1I A;  7ICK A;  8ICO A;  1ZQ1 C;  4JV2 A;  2FLN A;  4BGD A;  4DEZ A;  2DRA A;  2H3Q A;  4KLG A;  1LKY B;  4WC5 A;  2E5S A;  1NNL A;  3JPR A;  8ICI A;  4DWI A;  1SGG A;  3ZDD A;  3H38 A;  3E58 A;  2O6K A;  9ICB A;  1PVR A;  2KN7 A;  2A1A A;  8ICP A;  4R65 A;  3CRX A;  1L3T A;  2KVS A;  4WQK A;  4FHX A;  4NLK A;  2KHQ A;  3RJG A;  4MHV A;  2Y9U A;  5HR9 A;  3H0L B;  3GIM A;  4MFA A;  5DQH A;  1V9P A;  3ORY A;  1RYS A;  4X0B A;  4M47 A;  4IQV A;  4I2B A;  2JEJ A;  3C1Y A;  3L9D A;  2JRZ A;  7ICE A;  3JYY A;  4KLQ A;  4M0A A;  4J9P A;  1QQ6 A;  5AKE A;  4FZL A;  4M6W B;  4F8R A;  4UBC A;  8ICA A;  2DVI A;  2UVV A;  4F91 B;  4KTQ A;  3AQF A;  8ICQ A;  9ICV A;  3KKA C;  5AM0 A;  4UAZ A;  1NK7 A;  1ARO P;  2ZH7 A;  3OJU A;  2IHN A;  5HRI A;  4FS1 A;  9ICW A;  4Z6F A;  1LV5 A;  1UET A;  5ALG A;  1SZP A;  2KJ5 A;  3K75 D;  1OW5 A;  1WYG A;  1HJP A;  5J0O A;  3NVV A;  2C22 A;  4ELU A;  4QNL A;  3RJJ A;  1BVS A;  3IV6 A;  1YLQ A;  4I2I A;  5AM3 A;  4ECU A;  4KN4 A;  2FLL A;  1ZQL A;  4X4N A;  5AM5 A;  2B0C A;  3GU3 A;  4GIB A;  8ICY A;  4EZ9 A;  2AQ4 A;  5ALK A;  3PW2 A;  2OWO A;  5III A;  4TUS A;  4MEY A;  2G07 A;  3T3F A;  1UA1 A;  2FPK A;  2MSN A;  5HRG A;  7ICH A;  1S0M A;  5K4L A;  2W9C A;  3RBE A;  3LQC B;  4KM5 A;  2W11 A;  1QSY A;  3PZP A;  3JPS A;  2ID1 A;  4Q8F A;  2LPE A;  1OU5 A;  1N2X A; 
#chains in the Genus database with same CATH homology
 4BWJ A;  1DOQ A;  4R63 A;  7ICI A;  1ZQH A;  4KN7 A;  4F5N A;  1F5A A;  3TI0 A;  2ZHA A;  3MR5 A;  2BQR A;  3HPO A;  4JV1 A;  1BNO A;  1MIW A;  4AT8 A;  3EPG A;  1S77 D;  1ZQG A;  4EP7 A;  1ZQM A;  4KLT A;  2ZHB A;  1EXN A;  2I1Q A;  3RRG A;  4LZG A;  5KFU A;  4FHY A;  3QZ7 A;  3GV5 B;  4O3N A;  4M6W A;  4QZG A;  3LDA A;  3MR2 A;  3V72 A;  5J0Q A;  5IIK A;  5BOL A;  9ICM A;  2M2T A;  4WCW A;  3OHB A;  3M9N B;  1DGS A;  4B9T A;  4QZI A;  8ICX A;  3UPS A;  3H37 A;  4QZB A;  4EYH B;  3NYB A;  3M8R A;  1XWL A;  3OVS A;  2F1H A;  3GIK A;  1UEU A;  1BPZ A;  4YR0 A;  5IIM A;  1ZET A;  4P4P A;  4YR3 A;  3KHH A;  4M04 A;  5KG2 A;  4YG2 A;  4XA5 A;  5KFK A;  2C28 A;  5KG7 A;  4M9J A;  2ASD A;  2O5A A;  4AT7 B;  2BQU A;  5CJ7 A;  3PV8 A;  2PI5 A;  1H38 A;  5J2C A;  5CP2 A;  4X4Q A;  4F4Z A;  2ZH5 A;  2W9C B;  5HP4 A;  4X5V A;  1NO5 A;  7ICG A;  5EWG A;  2HHX A;  3MGH A;  4WC2 A;  4O3O A;  4I2A A;  4O3S A;  2W9M A;  3C2M A;  1NKE A;  5J2A A;  4WBY A;  1TKD A;  4R66 A;  3UQ2 A;  2KP7 A;  4ECX A;  3PR5 B;  1KFD A;  3ETL A;  8ICJ A;  4NLZ A;  5HC9 A;  4RQ4 A;  2VA2 A;  4ECT A;  2KTQ A;  4J9Q A;  4XRH A;  1SL2 A;  3N4M B;  3PX0 A;  3AQM A;  4DL7 A;  3Q8R B;  2V4R A;  4C8O A;  4KLM A;  4DFP A;  2M2W A;  1ZQY A;  3OGU A;  3GQC A;  4WC6 A;  3SZ2 A;  4KIT B;  4JWM A;  3H8S A;  1XU4 A;  5HRB A;  1JQR A;  2PI4 A;  5DKW A;  3BQ2 A;  3RR7 A;  4O3R A;  5HRK A;  4Q8E A;  1ZQT A;  2GWS A;  2PFO A;  4UB3 A;  4AT8 B;  4X4V A;  4Q44 A;  1L3V A;  2VA8 A;  1HUO A;  1D9D A;  4ED0 A;  4R8U A;  2Y1J A;  5F2V O;  4PGQ A;  4FH3 A;  5CHG A;  3JPP A;  4FHV A;  2HHS A;  4RQ6 A;  3MDC A;  4ELT A;  4J9N A;  4DSF A;  4RQ1 A;  4RZR A;  5KG6 A;  5J2E A;  1TK8 A;  1ZQZ A;  1NK0 A;  2BKE A;  4LVS A;  3UXP A;  1XSL A;  4UB5 A;  4RQ2 A;  3IM1 A;  4P4O A;  4RQ7 A;  3RB0 A;  4QZD A;  5L1L A;  3UPQ A;  1X9S A;  1ZQA A;  1C7Y A;  9ICK A;  4EBJ A;  1JN3 A;  4RNN A;  4P2H A;  3AQK A;  3PML A;  4QZA A;  3HWT A;  4AT9 A;  5CA7 A;  5L1K A;  3FDS A;  2HHU A;  4DSE A;  1U4B A;  2Q0Z X;  1TFR A;  5KFM A;  1FA0 A;  5KFF A;  4YXJ A;  2HVI A;  2BE3 A;  2KFZ A;  1ZQV A;  4JV0 A;  4J9M A;  3JPO A;  2BPC A;  4TQS A;  3BQ1 A;  1JAJ A;  3B0Y A;  3TQ1 A;  2BCS A;  5J2D A;  7ICQ A;  3TAQ A;  4F92 B;  4RNO A;  3C2L A;  4NKT A;  1S9F A;  4RWQ A;  1RZT A;  2BDP A;  2DR9 A;  4O9M A;  2W9B B;  3T5K A;  2BCV A;  1KSP A;  7ICP A;  4K4I A;  4M5D A;  3H40 A;  4WC7 A;  4YMN A;  4ED7 A;  1ZQF A;  4RQ8 A;  3MAB A;  3V6K A;  4IRC A;  5J2K A;  2ZH4 A;  4BDP A;  8ICL A;  2C2R A;  5HHI A;  5D49 A;  9ICX A;  1A76 A;  4KMU A;  4UAY A;  2C2D A;  3RAQ A;  4TUP A;  1U48 A;  1WCL A;  4O5C A;  8ICF A;  5KFT A;  2RFF A;  4F2S A;  1NZP A;  5J2B A;  5HRL A;  9ICA A;  4FBU A;  4R8U B;  2KZZ A;  8ICE A;  5DBC A;  4KLE A;  4DQP A;  4I2G A;  4NM1 A;  1U47 A;  3BQ0 A;  1R8B A;  4FHW A;  4J9O A;  1SKW A;  1NK5 A;  5EWE A;  4PHE A;  1BPB A;  5BOM A;  1NKC A;  2AJQ A;  3OVA A;  2BCU A;  9ICO A;  2ALZ A;  5HMM A;  5DG9 A;  4F5R A;  4KLU A;  4UD4 A;  1JIH A;  1X2I A;  5KFV A;  5DB6 A;  1RPL A;  5DBB A;  4RNM A;  7ICL A;  4WC3 A;  4P4M A;  4KLH A;  4B9U A;  2JZB B;  5L1J A;  4J9S A;  4EBE A;  4AT9 B;  5DLG A;  3PMN A;  4YP3 A;  1U49 A;  4GC6 A;  1MQ2 A;  4DQR A;  4DSI A;  4I2E A;  4KLJ A;  7ICO A;  4QZ9 A;  3ISD A;  4J9K A;  4XQ7 A;  4IG8 A;  2XC9 A;  8ICR A;  1U9L A;  4X4R A;  2W8L A;  3K4G A;  1JXL A;  4ED8 A;  3H4B A;  2JEI A;  2NRT A;  4I2J A;  4YN4 A;  1NJZ A;  1CUK A;  2IHM A;  3GDX A;  2ZUB A;  4IR1 A;  3G6X A;  4K4G A;  2I9G A;  5HRD A;  4ATB B;  4ZH4 A;  5J29 A;  4E0D A;  3HJ1 A;  4NM2 A;  4F5P A;  4F5O A;  3OJS A;  4C8L A;  5KFE A;  1VFG A;  4PHD A;  1U45 A;  3UXN A;  7ICJ A;  2AU0 A;  3RBD A;  1DK3 A;  4DQQ A;  4RWO A;  5C5J A;  1NOM A;  2NRZ A;  2IA6 A;  4J9L A;  2UVW A;  4I27 A;  3OUY A;  3ZDB A;  1D9F A;  3TFR A;  2HHT A;  2BR0 A;  4F2R A;  2ZUD A;  1T4G A;  2J6T A;  1TFY A;  2HHQ A;  5JUM A;  2FMQ A;  3V6J A;  3V7L A;  3B0X A;  4KLS A;  4EBC A;  4ECQ A;  1OU5 A;  4QZF A;  3GIL A;  2ZTD A;  3PW5 A;  3QZ8 A;  5KFB A;  4DS4 A;  3ZDC A;  4X4S A;  3KHL A;  2R8G A;  4QWB A;  1ZQI A;  3TFS A;  2BGW A;  3SYZ A;  2AGP A;  4X0A A;  3H4D A;  2R8I A;  4RQ0 A;  8ICB A;  2PBE A;  4GXI A;  1D8L A;  2P66 A;  4ECW A;  3HT3 A;  4KLD A;  4PH5 A;  4R64 A;  1COO A;  2R8H A;  1ZQJ A;  1LB2 B;  9ICC A;  3C18 A;  5J2I A;  5DB9 A;  5DLF A;  2BQ3 A;  3BQT A;  4DSK A;  9ICN A;  1N56 A;  4MFF A;  4FHP A;  5HNK A;  5J0X A;  5DGB A;  1S10 A;  2O1P A;  5KFH A;  3MBY A;  4DFM A;  1ZQB A;  9ICP A;  2IBK A;  3V6H A;  3RB3 A;  3QEA Z;  7ICT A;  4QZE A;  5DEC A;  1X9M A;  8ICC A;  5KFI A;  5KFD A;  5CWR A;  3TAN A;  1ZYQ A;  4QZC A;  4ECZ A;  4DQS A;  4YCX A;  5KT6 A;  2W9B A;  4EBD A;  4Z6E A;  5KT7 A;  2FMS A;  1S76 D;  5IIJ A;  2V9W A;  4ECR A;  1MSW D;  1QLN A;  1ZQU A;  1NK4 A;  1Z00 B;  3OSP A;  4LT6 A;  4DF4 A;  4YFK A;  4WC4 A;  5J0Y A;  4QZH A;  4WC1 A;  4Z6D A;  4QWD A;  4MF8 A;  3MR6 A;  1MIV A;  3EYZ A;  2DRB A;  5KFP A;  4YD1 A;  2XCP A;  3V7J A;  4I29 A;  1QSS A;  2MUT A;  5HHH A;  4ECS A;  1TV9 A;  8ICH A;  3AQN A;  4DLE A;  5J2G A;  4E8F A;  4X4T A;  2R8J A;  3OUY B;  5KFL A;  4UD5 A;  1D8Y A;  9ICF A;  3IHQ B;  1Z3E B;  2FPL A;  5J2H A;  3M8S A;  4DFJ A;  3ZD9 A;  1JMS A;  4BWM A;  3GV7 B;  1ZQN A;  3RR8 A;  4RU9 A;  2ZTC A;  4RT3 A;  4UB1 A;  4MF2 A;  4ED1 A;  1NK6 A;  4DQI A;  4DOA A;  1TK0 A;  1NJY A;  1KRP A;  2DPJ A;  5F9L A;  3KTQ A;  1BPY A;  3ISB A;  3Q8L A;  4QW9 A;  1ZQO A;  2BPG A;  2ZTE A;  4M2Y A;  2BCR A;  5IIN A;  3EWA A;  3SV3 A;  1CEZ A;  9ICS A;  2XGQ A;  1S0N A;  4MFC A;  2JZB A;  4UB2 A;  4F50 A;  5KT5 A;  1ZQK A;  5EOZ A;  5HRH A;  1NKB A;  4DL5 A;  5KFG A;  3C5F A;  3T5L A;  4KLI A;  2P6R A;  5KFY A;  3GV8 B;  5KFC A;  3EPI A;  3WFP A;  4RPX A;  1S97 A;  4DO9 A;  3ZD8 A;  4FO6 A;  9ICL A;  7ICV A;  2DR8 A;  1RXV A;  1KTQ A;  3PW7 A;  3PVX A;  5KG0 A;  1BGX T;  1TK5 A;  4KLF A;  2HVH A;  8ICS A;  4IQT A;  8ICU A;  4K4H A;  2UVU A;  1KFT A;  2WTF A;  1K1S A;  2DFL A;  5KG4 A;  2DPI A;  4RPZ A;  4FBT A;  3C66 A;  3WFO A;  5EWF A;  4RUA A;  1NJW A;  1T7P A;  4EZ6 A;  3TAR A;  4DSJ A;  4EYI B;  4IRD A;  4NXZ A;  4XUS A;  4YQW A;  1L3S A;  3KHG A;  3WFQ E;  2ASJ A;  1KLN A;  3RJI A;  4F4K A;  4JWN A;  3OVB A;  5F9N A;  3ISC A;  2RDI A;  3RRH A;  1RXW A;  2FMP A;  3PO5 A;  2M9N A;  2ASL A;  4PPX A;  4QWC A;  2F1J A;  5KFN A;  5J0T A;  3PW0 A;  1L3U A;  1R89 A;  9ICI A;  2ZH9 A;  3WFR E;  2DR7 A;  5J2J A;  3HW8 A;  1XO1 A;  2MUT B;  5KG1 A;  4F4X A;  3LK9 A;  4EEY A;  3SI8 A;  1MIY A;  2AGQ A;  3V7K A;  4E80 A;  2IMW P;  2FPM A;  5DQI A;  2BPF A;  9ICE A;  3LWL A;  2KFN A;  3RJH A;  2R8K A;  4S3N A;  2ZH3 A;  4RPY A;  3Q8S B;  2XO7 A;  2BHN A;  5KFJ A;  3UQ0 A;  1QSL A;  3ZDA A;  2LYH A;  3RAX A;  1ZQR A;  3AU6 A;  2JEF A;  1KNY A;  3PNC A;  1IM4 A;  2W8K A;  4DLG A;  4QWA A;  2J6U A;  2XCA A;  1BPX A;  5KG3 A;  4DOB A;  4DF8 A;  4M9L A;  3RTV A;  1MQ3 A;  2J6S A;  2NRX A;  5DDM A;  2B21 A;  3Q8K A;  7ICU A;  3UXO A;  4X4O A;  1B43 A;  4TUR A;  2PFN A;  5D46 A;  2A1J A;  3H3A A;  3RJK A;  1ZQD A;  4O0I A;  9ICG A;  4WBZ A;  4UB4 A;  1HUZ A;  3AQL A;  4QZ8 A;  3FYH A;  4LZD A;  4FS2 A;  4MEX A;  3HIY A;  3BDP A;  3M9O B;  4ED6 A;  4TUQ A;  4Q43 A;  2W9A A;  1BNP A;  4ED3 A;  3JPT A;  1PX5 A;  5D4B A;  5L9X A;  4ELV A;  1Z00 A;  3Q8Q B;  4QW8 A;  4F4W A;  2V4Q A;  5J0W A;  2FLP A;  5DQG A;  4YXM A;  2ZJ8 A;  5J0U A;  3T5J A;  5L1I A;  2VA3 A;  4M9N A;  4YVZ A;  4RWN A;  4C8M A;  1XSP A;  1SL0 A;  1ZQE A;  4KLL A;  8ICZ A;  1Q78 A;  2Q66 A;  3OSN A;  3RJF A;  4I2F A;  4NKU A;  3C1Z A;  5DED A;  1R8C A;  2ISO A;  5J2F A;  3JZ0 A;  4X4P A;  3MFH A;  3PR4 A;  3HX0 A;  2XY5 A;  1T8E A;  5HRF A;  1Q79 A;  3RB4 A;  3MGI A;  2NRW A;  3N97 B;  4RUC A;  1ZQS A;  1S0V A;  1XSN A;  1JXE A;  4JK1 A;  3GIJ A;  4ED2 A;  4B9N A;  4JUZ A;  3QEB Z;  8ICT A;  4B9L A;  4C8K A;  4CCH A;  1ZQX A;  3G6V A;  3THV A;  3H7I A;  1VJ7 A;  2C2E A;  1NK9 A;  2AQ0 A;  3KHR A;  1SKR A;  2H5X A;  2XY7 A;  3EW9 A;  1WOT A;  2KZ3 A;  4YMO A;  2ISP A;  4DSL A;  1NK8 A;  4QWE A;  3MFI A;  3HP6 A;  4PGY A;  3SV4 A;  4B9M A;  2ZH1 A;  3MDA A;  2KZM A;  2XY6 A;  7ICK A;  2Y1I A;  4GXK A;  4DOC A;  4C8N A;  5KFZ A;  1TAQ A;  8ICO A;  1BPD A;  1K1Q A;  4PHP A;  4F93 B;  2FLN A;  4JV2 A;  4BGD A;  3H8J A;  4IQU A;  4DEZ A;  5TZV A;  1X9W A;  4M9G A;  4NLG A;  2ZH8 A;  5KT4 A;  2A1J B;  5HML A;  7ICN A;  9ICT A;  4IR9 A;  3EZ5 A;  4KLG A;  4YD2 A;  4WC5 A;  2ZH2 A;  3JPR A;  1B22 A;  8ICI A;  2PFQ A;  4DWI A;  1DK2 A;  2M2V A;  5IIO A;  1TAU A;  4UAW A;  4DL4 A;  1ZQW A;  3ZDD A;  3H38 A;  4B9S A;  4DFK A;  9ICB A;  4B9V A;  8ICP A;  2KN7 A;  4R65 A;  4RQ3 A;  2ZJ5 A;  5KFQ A;  5DB7 A;  1L3T A;  1V4A A;  4YMM A;  4O5K A;  3H8W A;  4FHX A;  4NLK A;  4KLO A;  3WFS C;  3E2E A;  3RJG A;  3NTU A;  2ATL A;  1SL1 A;  1WCN A;  4BXO A;  8ICW A;  4I28 A;  5HR9 A;  3PY8 A;  2JEG A;  1A77 A;  1ZQQ A;  3GIM A;  1BPE A;  3RH6 A;  5DDY A;  4Z6C A;  3C23 A;  2ZUC A;  2XGP A;  3RH4 A;  5KFA A;  4DL2 A;  1S0O A;  3OV7 A;  4MFA A;  3OHA A;  4O5E A;  3C21 A;  5DQH A;  1V9P A;  3C2K A;  3ORY A;  1RYS A;  2MAX A;  3M9M B;  3JPQ A;  4DL3 A;  4X0B A;  4PHA A;  4M47 A;  9ICJ A;  4GC7 A;  3RH5 A;  4IQV A;  5J0R A;  2AGO A;  4I2B A;  2JEJ A;  2P6U A;  3C1Y A;  4TQR A;  4WC0 A;  3L9D A;  1NJX A;  1TVA A;  1N48 A;  7ICE A;  4F3O A;  3JYY A;  4KLQ A;  8ICV A;  4I2D A;  1ZQP A;  4M0A A;  2HHW A;  3H39 A;  3PO4 A;  1PZN A;  2HW3 A;  4XQ8 A;  4Q45 A;  4J9P A;  4DL6 A;  5KFR A;  2DRA A;  9ICH A;  5DB8 A;  4M6W B;  2PFP A;  5KFX A;  4F8R A;  4UBC A;  3LWM A;  1MC8 A;  3AUO A;  3RJE A;  3T5H A;  2RDJ A;  8ICA A;  4DS5 A;  8ICM A;  2DVI A;  2UVV A;  4F91 B;  5KT3 A;  4KTQ A;  8ICQ A;  9ICV A;  3Q8M A;  1UEV A;  2HHV A;  4UAZ A;  5KFS A;  1ARO P;  1NK7 A;  4IRK A;  2ZH7 A;  4EBK A;  4O3Q A;  3OJU A;  9ICR A;  3HJ4 A;  2IHN A;  5HRI A;  3RB6 A;  4FS1 A;  4J9R A;  2ZH6 A;  5CB1 A;  3GFK B;  3BJY A;  4UQG A;  9ICW A;  4Z6F A;  4X4U A;  3AU2 A;  1SKS A;  1LV5 A;  1KFS A;  1UET A;  1UT8 A;  5KFW A;  3Q8P B;  8ICG A;  4BXO B;  1SZP A;  5IIL A;  1XC9 A;  2UVR A;  3MR3 A;  1XS9 D;  3K75 D;  4YR2 A;  4RT2 A;  5KFO A;  2BCQ A;  5HRE A;  4UBB A;  9ICQ A;  1HJP A;  5CR0 A;  1Y88 A;  4F4Y A;  5J0O A;  4PGX A;  2C22 A;  4M9H A;  4ELU A;  3RJJ A;  8ICN A;  2PXI A;  1BVS A;  3NGD A;  5DG8 A;  4F5Q A;  5DG7 A;  3GII A;  4GLX A;  9ICU A;  1TFW A;  1UT5 A;  4FH5 A;  1IXR A;  7ICM A;  1YLQ A;  4I2I A;  4ECU A;  3PX4 A;  5DGA A;  1T3N A;  5J0P A;  4IQW A;  2NRV A;  4KN4 A;  2M2U A;  1R8A A;  4RWP A;  5KT2 A;  5KTQ A;  1UA0 A;  2FLL A;  3JPN A;  4GXJ A;  1ZQL A;  7ICR A;  4X4N A;  1ZJN A;  1RYR A;  2VAN A;  5DBA A;  3ZDE A;  4G3I A;  4I2C A;  1ZJM A;  8ICY A;  4EZ9 A;  2AQ4 A;  3C5G A;  3PW2 A;  2OWO A;  5III A;  4TUS A;  1JX4 A;  3PW4 A;  4MEY A;  4AT7 A;  4O3P A;  1UA1 A;  3T3F A;  7ICS A;  2FPK A;  5HRG A;  7ICH A;  4ATB A;  5BPC A;  1S0M A;  1QTM A;  2W9C A;  3RBE A;  7ICF A;  3LQC B;  1L5U A;  2DR5 A;  5KG5 A;  5J0S A;  4I2H A;  4E7X A;  1QSY A;  2NRK A;  4ECV A;  3PX6 A;  3TAP A;  4NY8 A;  3JPS A;  4NLN A;  4ECY A;  2HHP A;  2ID1 A;  1KEJ A;  4HYK A;  2ZJA A;  4RQ5 A;  2F1I A;  1KDH A;  3G6Y A;  1ZQC A;  4Q8F A;  8ICK A;  3QE9 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...