4O5CA

Structure of human dna polymerase complexed with n7-mg as the template base in a 1-nucleotide gapped dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase, lyase/dna
source organism Homo sapiens
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5cA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5cA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5cA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5cA03
1BPEA 4EBCA 1SKWA 4Q8FA 3RJJA 2PFPA 1TKDA 4WC0A 3LDAA 5KFHA 4RQ2A 3QE9Y 4DEZA 4R8UB 2BCVA 1KFDA 3KTQA 2PI5A 9ICPA 3AU6A 4ECRA 3M9NB 3BQ0A 4ELUA 4UD5A 4RNOA 1L3UA 3MFIA 1ZQHA 1COOA 2FPMA 3SI8A 3RH6A 2F1JA 1K1SA 2C28A 3ZDCA 4FHPA 4S3NA 3LWLA 1ZQEA 8ICUA 4TQSA 1ZQNA 2BE3A 4FHWA 1SZPA 4KN4A 4LVSA 3TQ1A 1T3NA 4JK1A 4O5KA 2RFFA 4AT9A 4YD1A 1UT5A 3RB6A 3UXPA 2ZHAA 1D8LA 3QZ7A 4M47A 3JPRA 3PR4A 8ICWA 1FA0A 5KFTA 4FHVA 1S0MA 3ZDAA 4GLXA 1KFSA 4Z6CA 1ZQBA 2J6SA 4DSLA 5J0PA 1TK5A 1QLNA 2M2VA 4DOCA 5DEDA 4M9GA 4MFCA 4DFMA 1S10A 2J6TA 5KT6A 3JPQA 1T7PA 4KLEA 3ETLA 3UXOA 3GV7B 1Q79A 4DSFA 4ATBB 3RAQA 1JAJA 4WC4A 3NYBA 4RQ7A 4UQGA 1UETA 1ZQKA 5KFBA 4FBTA 3PO5A 2PFQA 2ZUBA 1R89A 4B9MA 3G6XA 4X4UA 3H8WA 2XO7A 1TVAA 1KFTA 4J9NA 4ED3A 4AT8A 4DFKA 3SYZA 5CB1A 5CWRA 3PVXA 3TFRA 4M04A 3GV8B 2BQUA 2UVRA 3EZ5A 4P2HA 2Y1IA 4F2RA 1YLQA 3MR3A 5J0UA 4J9SA 5HR9A 2DR5A 3OVAA 4DF4A 5DB6A 3OUYB 4QWBA 2ZH1A 4O3NA 8ICZA 4QZBA 4B9UA 2XCPA 2NRZA 3MR5A 4O9MA 1ZQIA 2P66A 4NLKA 4YD2A 4R65A 4PGQA 8ICRA 4ECTA 4X0AA 4IQVA 2XC9A 5HP4A 4PGYA 2ZJAA 4K4GA 3BJYA 1PX5A 4P4PA 2DR8A 2DR9A 5C5JA 4E8FA 1L3VA 4RQ8A 5J29A 5KT7A 1KTQA 4YXMA 5DQGA 3G6YA 1H38A 2V9WA 3GV5B 4YVZA 3PY8A 4X4TA 5DBCA 2ZH5A 4QZEA 3MDCA 5BPCA 3TFSA 1ZQAA 3LQCB 4ECSA 1NKBA 4ECQA 4DL5A 1BPDA 4YCXA 7ICQA 2XY5A 4M6WA 1D8YA 4EZ9A 3C1ZA 3THVA 4TUPA 1MQ2A 3RJGA 2ZJ5A 4ELVA 4KLTA 4PHDA 8ICVA 1RPLA 5KG1A 4I2AA 5J2HA 3V72A 4YP3A 2V4QA 4J9QA 4ECXA 3RJEA 4YR2A 2ATLA 4M9JA 2ZHBA 5IIMA 2PI4A 4KLOA 7ICEA 3JPOA 2RDIA 4TURA 4ED0A 3OUYA 2BCSA 5JUMA 4GXKA 4I2DA 8ICGA 1MIYA 2Q66A 5J0RA 4BXOA 5KG7A 3K4GA 9ICLA 4DL3A 2AQ0A 3PW0A 3PW5A 3MGHA 4X0BA 2JEFA 5DBAA 1ZQZA 1QTMA 1MIVA 1CEZA 1UT8A 3GQCA 4ECUA 4DF8A 4KN7A 1A77A 4MF2A 2HHSA 3ZDEA 4XUSA 1X2IA 1ZQJA 4RQ5A 4UD4A 4EBDA 3M8SA 4DWIA 1ZQPA 3HWTA 4YR3A 3GILA 5F9LA 4BWMA 5KFMA 3SZ2A 2AQ4A 4B9NA 7ICHA 4UBBA 4B9TA 1BVSA 1U49A 1SL0A 1JQRA 3RB4A 2JEGA 5KFYA 3Q8LA 1S0NA 4Q44A 4EYHB 2HVIA 8ICPA 3MGIA 2JEJA 3OGUA 4DSJA 3H37A 4EBEA 4QZCA 1ZYQA 2O1PA 2ID1A 4X4NA 2AGQA 4MEYA 3M8RA 1XSNA 3C2LA 1V4AA 1ZQTA 5DGBA 4F4KA 5KFDA 3GIIA 1QSLA 1KLNA 1KNYA 3V7LA 4F2SA 2FLLA 2UVUA 4WC1A 2VANA 5CA7A 4BXOB 2Q0ZX 5KFJA 3FYHA 4IR9A 2HW3A 4FHXA 4GC6A 4PPXA 4M2YA 5KG4A 3MABA 9ICXA 3H3AA 3BDPA 4RPZA 3GIMA 4DSKA 4UBCA 9ICNA 5KG3A 1S77D 1JMSA 8ICBA 1F5AA 3HT3A 1XSLA 4O3RA 5HREA 5BOLA 3M9OB 1Z3EB 1BNPA 3H8JA 4R8UA 4TUSA 3LWMA 4BWJA 4UB5A 1D9DA 4M9HA 4DLGA 4AT7B 3HW8A 5DGAA 3N97B 1R8CA 2IHNA 4KLDA 1DOQA 5KFEA 9ICUA 1TAUA 1UEUA 4RWQA 4J9MA 1NKEA 5KFVA 3MFHA 8ICSA 4PHPA 4IR1A 4QWDA 2J6UA 4I2IA 2W9BB 3Q8SB 4HYKA 4QWAA 3UQ2A 3PW4A 3PW7A 1ZQOA 4F4XA 4I2FA 3V6KA 2LYHA 5J2IA 1ZQMA 4E80A 2FMPA 1SL1A 1UA1A 2R8JA 3PMNA 3ZD9A 8ICKA 5J0YA 2H5XA 1JX4A 4KITB 2AU0A 1TV9A 1KDHA 9ICBA 2PXIA 4WBZA 7ICGA 1R8BA 7ICNA 1UEVA 3C5FA 3WFQE 2JZBB 5EWFA 5J2BA 4RUAA 4UB4A 4F4YA 4DSEA 4KLUA 2UVWA 8ICOA 4EZ6A 1S97A 4J9RA 3GIKA 2BPGA 2BPCA 2P6RA 2HHPA 4Q43A 4RQ0A 2ZTDA 5IIKA 2C2DA 5KG0A 4E7XA 8ICEA 4QZ8A 4DQQA 3Q8KA 1IM4A 1NOMA 1ZQVA 5J0OA 5J2GA 1TK0A 8ICYA 5IILA 2XY7A 3KHGA 2HHUA 1DK3A 4MF8A 4XRHA 1KSPA 2ZTCA 4UAWA 4I2GA 5DB9A 1ZQWA 4I28A 4IRCA 4FHYA 3BQ1A 4KLLA 1NJZA 1DK2A 3WFPA 4DO9A 4P4OA 4JWNA 1EXNA 2KFZA 3HJ1A 4WC6A 1ZQQA 1ZQSA 3PMLA 1RXVA 2BCUA 1DGSA 5KFOA 2R8GA 4NLNA 2ZH4A 4RU9A 3PV8A 4DQPA 4YFKA 5L1IA 1U45A 5HHHA 4QZIA 4TQRA 4YQWA 3MR2A 7ICJA 1WCNA 2W8LA 3QZ8A 1MIWA 3UXNA 2ZH8A 1N48A 5HRDA 5HRKA 2FLNA 3V7KA 5KFWA 4F8RA 4O3PA 4I2JA 4TUQA 3KHRA 4RWPA 4ED7A 5DLFA 9ICSA 4UAZA 9ICCA 4UB1A 3H40A 4JUZA 1JXEA 5HRLA 3JPSA 2ZUDA 5L1KA 3B0YA 4IRDA 4KLIA 4X4SA 3H39A 4IQUA 2RDJA 4Z6EA 2GWSA 5KT2A 4WBYA 4O0IA 1NJWA 5KT3A 5J0XA 1XS9D 1NK0A 3GDXA 1XSPA 8ICFA 5KG5A 1N56A 1SKRA 5IIIA 4GXIA 4NM1A 7ICIA 9ICIA 2DVIA 4GXJA 8ICXA 5F2VO 4RNMA 1HUOA 1QSSA 3N4MB 4R66A 4RWOA 2ASLA 1NK9A 5KG6A 5KT4A 3RB0A 2MAXA 4M5DA 2NRXA 4RQ3A 4M0AA 3JYYA 4YR0A 5L1LA 2ASJA 1U47A 5IINA 2FLPA 4FO6A 4B9VA 1JXLA 4I2HA 3OSNA 4MFAA 5DQIA 3OJUA 9ICJA 3V6HA 1BPYA 7ICTA 5J2FA 3SV4A 1BPZA 4NY8A 1SKSA 1Q78A 2M2WA 2DR7A 3EPGA 1RYRA 2W9AA 2UVVA 1ZQCA 9ICHA 2DRBA 4NXZA 1U4BA 1RXWA 2XY6A 4RQ6A 1KRPA 3PX0A 2KFNA 2M9NA 5KFRA 3RJHA 1TFRA 4ELTA 4MFFA 1T4GA 3C1YA 4RZRA 8ICLA 4IQWA 4XQ7A 2HVHA 1ZJNA 4QZ9A 4RPYA 3PX4A 5HRFA 3TARA 3OVSA 5IIOA 1IXRA 1VFGA 4DFJA 2XGPA 4Q8EA 5DB8A 3QEBZ 1V9PA 5J0WA 5EOZA 1NJYA 3Q8PB 2BQ3A 4JWMA 4J9OA 1S0VA 2ISOA 1XU4A 2ZH7A 4B9SA 2BCQA 4QZGA 3ISDA 2BKEA 5D4BA 2W9MA 4BGDA 2OWOA 4UB2A 1MSWD 4DS4A 9ICFA 5KT5A 5HRHA 4EP7A 4WC3A 1VJ7A 4P4MA 5DG8A 2IMWP 1NK8A 1ZQXA 2V4RA 4KMUA 3Q8MA 4NM2A 3RAXA 4RQ4A 3AQNA 4FS1A 2PFOA 2DPIA 1Z00A 4J9LA 3RH4A 4RPXA 3NTUA 4NLGA 1WCLA 2W9CB 4R64A 3RBEA 4ZH4A 3JPNA 3OVBA 4RUCA 4C8OA 4RNNA 3BQ2A 1RYSA 4X5VA 4XQ8A 3UQ0A 4KTQA 5HMLA 5KFUA 2HHXA 3UPQA 3RR7A 4ATBA 4YG2A 4ED2A 2ALZA 3WFSC 3IHQB 5J0TA 1BPXA 3TAQA 5J0SA 1SL2A 4QW9A 2R8IA 2VA3A 4FBUA 4I27A 2A1JB 4F4ZA 1ZQLA 4BDPA 2MUTB 2W9BA 1HJPA 3T5HA 4JV2A 1A76A 1L3SA 4IG8A 3RTVA 4YN4A 5DB7A 4KLHA 2ZTEA 5J2KA 4AT8B 3EWAA 3OJSA 4JV1A 4M9NA 5DBBA 4NLZA 3ORYA 4FH5A 4F4WA 3GFKB 9ICVA 3C18A 8ICTA 7ICMA 3RJFA 1ZETA 5KFCA 2JZBA 5DDYA 4X4RA 2Y1JA 4QZFA 2BDPA 4EBJA 2BPFA 3HPOA 1BNOA 3ISCA 4DQIA 2DPJA 4J9KA 3HP6A 4QW8A 3H4DA 4I2CA 9ICQA 3PO4A 1LV5A 5KFXA 9ICRA 1NJXA 7ICSA 5KFGA 5HNKA 5HC9A 1CUKA 4O3OA 9ICOA 4F5RA 1WOTA 4DFPA 1AROP 3AUOA 1ZQUA 1NK4A 4UAYA 4QWEA 4WC7A 1TFYA 2I1QA 4M9LA 3ZD8A 5EWEA 4DQRA 4K4HA 4PHAA 7ICVA 3K75D 1ZQFA 3OV7A 2MUTA 5J0QA 2BHNA 2NRVA 3PNCA 3KHHA 2C2RA 2DFLA 4EYIB 2C2EA 4RT3A 3OHAA 3T5LA 1X9MA 4QZDA 1ZQRA 5IIJA 3H7IA 1L5UA 2IHMA 2ZH6A 4CCHA 2HHVA 2NRKA 1NKCA 4R63A 3H8SA 8ICJA 3NGDA 1B43A 2F1HA 4IRKA 5KG2A 4RWNA 3JPTA 1NZPA 1NO5A 4Z6DA 2XCAA 3EYZA 5KFZA 2F1IA 3OSPA 5BOMA 2HHWA 3ZDBA 5KFNA 4O5CA 2C22A 3PW2A 3PX6A 4ECZA 4X4VA 4DL4A 4B9LA 3EW9A 5KFAA 5DLGA 2ASDA 2KZ3A 2NRWA 3M9MB 2HHTA 2ISPA 3HIYA 4X4QA 4DL2A 5KFQA 1BGXT 4ED1A 4C8NA 2KTQA 3G6VA 5HHIA 5HRBA 5D46A 5DQHA 3MR6A 2IA6A 3JZ0A 5HMMA 3RB3A 1RZTA 3T5KA 2W8KA 4JV0A 1UA0A 5D49A 3MDAA 4KLQA 2HHQA 4C8KA 3FDSA 5L9XA 4UB3A 4FS2A 1U48A 4DS5A 5J2CA 4F3OA 8ICQA 9ICWA 1MC8A 4F93B 5DDMA 4KLSA 4LZDA 5J2DA 3RRHA 2KZZA 1B22A 5KFSA 4DL6A 1T8EA 3UPSA 4ECWA 9ICTA 2PFNA 2AJQA 4ED6A 5DG9A 3AU2A 4KLJA 4ECYA 8ICNA 2KP7A 3H38A 9ICKA 1TK8A 4E0DA 4XA5A 3Q8RB 2DRAA 5EWGA 8ICIA 3SV3A 4DL7A 3PR5B 4F5QA 4F92B 5CJ7A 1JIHA 5J2JA 1S76D 1ZQGA 3ZDDA 3TI0A 4O3QA 4X4OA 3AQMA 5CR0A 1ZQDA 4G3IA 3MBYA 4IQTA 3B0XA 1ZQYA 4Z6FA 3KHLA 3RJIA 9ICGA 4WC2A 2B21A 4YMNA 4F5NA 1OU5A 3HJ4A 2ZJ8A 9ICAA 8ICAA 3QEAZ 4O3SA 4M6WB 1XWLA 1PZNA 2R8HA 4LT6A 3LK9A 4F5PA 8ICCA 4YMOA 2FPKA 1C7YA 3JPPA 3EPIA 3T5JA 4FH3A 2FPLA 4QZHA 3C21A 4I2EA 1R8AA 5HRGA 2KZMA 5DKWA 2JEIA 5J2AA 4GC7A 3OHBA 4DLEA 1XO1A 5F9NA 5DG7A 3RRGA 2IBKA 4NKTA 2BCRA 4WC5A 2M2UA 7ICLA 4F50A 1BPBA 4PHEA 1L3TA 2O5AA 2ZH3A 1ZJMA 4C8LA 5L1JA 4ECVA 3RH5A 1JN3A 3TANA 1Y88A 4PGXA 1U9LA 4EEYA 8ICHA 4EBKA 7ICFA 1D9FA 4YXJA 3BQTA 4RQ1A 4QWCA 3Q8QB 2XGQA 2W9CA 3V7JA 7ICRA 1K1QA 3WFOA 2ZUCA 3C23A 3RJKA 5KFPA 2KN7A 3IM1A 4Q45A 3V6JA 1NK7A 2P6UA 5J2EA 3C2KA 2I9GA 1LB2B 3WFRE 2NRTA 4J9PA 4DOBA 4O5EA 1Z00B 3H4BA 2VA2A 2FMSA 4NKUA 5KFLA 1TAQA 4LZGA 4X4PA 4PH5A 5DECA 4MEXA 7ICKA 3C5GA 5KFKA 2A1JA 3RBDA 2FMQA 3HX0A 1XC9A 4YMMA 1X9WA 3GIJA 2BQRA 8ICMA 4C8MA 1NK5A 3RR8A 2PBEA 3E2EA 1S9FA 1TFWA 5CP2A 4RT2A 5KFFA 1QSYA 2AGPA 1S0OA 4KLMA 9ICEA 2ZH2A 2R8KA 2AGOA 2ZH9A 5KTQA 4K4IA 4ED8A 4KLGA 4I29A 3TAPA 3L9DA 7ICOA 4WCWA 7ICUA 7ICPA 3T3FA 5TZVA 5CHGA 4DSIA 2M2TA 4AT9B 4DOAA 1MQ3A 3ISBA 3C2MA 4DQSA 4KLFA 5HRIA 4F5OA 2BGWA 3AQLA 4F91B 3C66A 1X9SA 4QZAA 1NK6A 2BR0A 9ICMA 1HUZA 4AT7A 1KEJA 4I2BA 2WTFA 3AQKA 2VA8A 5KFIA
chains in the Genus database with same CATH superfamily
1GPJA 3RJJA 4WC0A 1TKDA 3BZCA 3LDAA 5KFHA 4RQ2A 3IDWA 4PZNA 3KTQA 1PUZA 4F71A 3AU6A 5ALZA 3F2CA 1L3UA 3OPXA 2F1JA 4S3NA 3WK5A 3CNHA 2BE3A 4UAUA 2Y9UA 1UQVA 2OM6A 4YD1A 4FHVA 3ZDAA 1XNSA 1KFSA 1VLBA 4Z6CA 1ZQBA 5J0PA 3IV6A 1L7PA 4MFCA 1S10A 2J6TA 4ATBB 4DSFA 3RAQA 4RQ7A 4UQGA 1UETA 1ZQKA 2K8AA 5KFBA 1DXSA 4FBTA 4NLCA 5AKGA 4C7ZA 1J97A 4DFKA 2CXYA 3TFRA 1B0XA 2Y1IA 1T94A 1YLQA 2DR5A 4CDGA 4DF4A 3QUCA 3QU2A 5DB6A 1ED1A 5ALMA 4B9UA 2NRZA 4O9MA 1ZQIA 2F3NA 4PGQA 4ECTA 1KKXA 4X0AA 2XC9A 5HP4A 3L5KA 4P4PA 2YN4A 4E8FA 4YXMA 2WF7A 5ALWA 2V9WA 5AI4A 2Y0SF 2WAQF 3MDCA 2KK0A 1ZQAA 4ECSA 3DV9A 2XY5A 4ELVA 2KVCA 4PHDA 1NI3A 4YP3A 4YR2A 5IIMA 7ICEA 4KLOA 4BJQA 2K4IA 4ED0A 2BCSA 8ICGA 5J0RA 9ICLA 2AQ0A 3PW0A 1Q8KA 3MGHA 4LJXA 1ZQZA 1MIVA 2KJ9A 1UT8A 1N5WA 3GQCA 4DF8A 4UD4A 3ZDEA 3SAGA 2G5IB 3HJEA 1ZQJA 5AKIA 3M8SA 1SXEA 4PPXA 5AIAA 4BWMA 5KFYA 5A0LA 4DSJA 3H37A 4MEYA 3C2LA 1V4AA 5KFDA 1K5OA 2H3ZA 5CA7A 5EE3A 1ECWA 2EH9A 3SQIA 3GIMA 1S77D 3LVVA 2RHFA 3H8JA 1D9DA 3LWMA 4UB5A 2ZIXA 2D3DA 2HCFA 4RWQA 2W7OA 8ICSA 3QNMA 4QWDA 3RF9A 3Q8SB 1XO0A 4I2FA 4O69A 1ZQOA 2LYHA 1ZQMA 5J0YA 4ICAA 1KDHA 2JH7A 1GO3F 7ICGA 1UEVA 3C5FA 5EWFA 4RUAA 1NZBA 4EZ6A 1WWUA 4MHVA 4Q43A 3A0HU 1PVPA 2HHUA 4I2GA 5AM4A 4FHYA 3BQ1A 1DK2A 1NJZA 2K89A 4JWNA 5EE1A 2KFZA 5KFOA 3PV8A 4YFKA 1N5XA 3MR2A 3VC8A 5HRDA 2FLNA 3V7KA 2FJ6A 1ZD5A 2KKPA 1ZD3A 5K4LA 2LM1A 4TUQA 4OJPA 9ICSA 2WFAA 3H40A 4JUZA 5HRLA 4X4SA 4EV6A 4IQUA 5J0XA 3NVOA 5CFSA 3NS1A 4GXJA 3AQEA 8ICXA 4RNMA 1N60A 3N4MB 2ASLA 2OXOA 3RB0A 3I28A 4M5DA 2NRXA 1U47A 5L1LA 4FO6A 2GOLA 1L6NA 3QU9A 2E3TA 9ICJA 5T14A 5J2FA 1BPZA 3MGVA 5AK5A 3EPGA 1RYRA 1ZQCA 4NXZA 3PSTA 1RXWA 3RJHA 5KFRA 1TFRA 4ELTA 1FO4A 1T4GA 4RZRA 2XVTA 5ALNA 2KE7A 5J8YA 4RPYA 1IXRA 3QUBA 3F2BA 2JV3A 5ALQA 2RQ5A 2DF4B 1YZ7A 3UM9A 3WKEA 4B9SA 2WB1C 2W9MA 5HRHA 4UB2A 4DS4A 4WC3A 2K4PA 2V4RA 1L7MA 3O0FA 5KL1B 3AQNA 4RQ4A 2DPIA 1Z00A 4J9LA 3RH4A 4NLGA 1WCLA 3RBEA 4C8OA 4X5VA 3UQ0A 5KFUA 3UPQA 4YG2A 5JTIA 4QW9A 4I27A 2JH1A 2W9BA 3T5HA 4NJ8A 3RTVA 5DB7A 2DBYA 4KLHA 2BZFA 3EWAA 4M9NA 4FH5A 3GFKB 4OD0A 8ICTA 1FEZA 2E1FA 4UAVA 4RQNA 4PL2A 2BPFA 4J9KA 1T3QA 9ICQA 1NNLA 1KBUA 5KFXA 1NJXA 5KFGA 3C29A 4JLXA 3AUOA 1NK4A 2I5HA 2YQEA 1KW4A 2I1QA 5C0YA 3K75D 1ZQFA 3KHHA 4EYIB 2AH5A 1PK1B 2KJ5A 4RT3A 2HHQA 1L5UA 3H7IA 1O08A 4P0PA 1NKCA 8ICJA 3NGDA 2F1HA 5AK6A 1NZPA 1RDFA 3JPTA 1NO5A 2XCAA 2FCLA 2YX8A 5KFZA 3ZI4A 3EW9A 5KFAA 4X4QA 4DL2A 4ED1A 4C8NA 2KTQA 2IA6A 2W8KA 5D49A 4F3OA 2N1RA 2NYVA 4KLSA 2KZZA 5ALIA 4K9AA 9ICTA 2AJQA 2KP7A 2H3FA 1TK8A 2DRAA 5EWGA 1CRXA 3PR5B 3FAHA 3QUQA 3F2DA 3RJIA 3KHLA 3HJ4A 9ICAA 4O3SA 4M6WB 1PZNA 4C4TA 5AKKA 2R8HA 4LT6A 4YMOA 1C7YA 4QZHA 2JEIA 5J2AA 4GC7A 4NKTA 1LKYB 2IBKA 2M2UA 7ICLA 4PHEA 2W3RA 1ZJMA 4C8LA 5L1JA 3IP4B 4PGXA 1U9LA 4OJOA 4EBKA 2CPRA 4YXJA 3BQTA 2R18A 5HR7A 7ICRA 2ZUCA 3RJKA 5KFPA 2KN7A 2P6UA 5J2EA 2ZIWB 1Z00B 3H4BA 2FMSA 4NKUA 5KFLA 2E1EA 2LBOA 3C5GA 5KFKA 3CYMA 2FMQA 3RR8A 4CNQA 2PBEA 2LKYA 2F8LA 5CP2A 3DDHA 4FZLA 1S0OA 2AGOA 2GO7A 4K4IA 4WCWA 3U26A 7ICUA 1QQ7A 3ISBA 2FI1A 5HRIA 1X9SA 1NK6A 1UPHA 4CF4A 9ICMA 1HUZA 2WTFA 1D8BA 3AQKA 5KFIA 3WKBA 1BPEA 4EBCA 3HRDD 4R8UB 2BCVA 1KFDA 1Q3UA 3PHZA 4EX7A 4RNOA 3MFIA 4FHPA 1QCKA 3LWLA 1ZQEA 4TQSA 1ZQNA 4Y2PA 2DKXA 4O5KA 2RFFA 2FE9A 3RB6A 1UT5A 2ZHAA 3QZ7A 3NWIA 3JPRA 3PR4A 8ICWA 1FA0A 5KFTA 2ESEA 1S0MA 1SB3C 4GLXA 3SR6A 4DSLA 3B9JA 4P0QB 1PVQA 1QLNA 4DFMA 1T7PA 4U6PA 3UXOA 3GV7B 4WC4A 1JRPA 3KD3A 3WK9A 3OWGA 5ALGA 4B9MA 4Y2QA 4AT8A 5CB1A 5CWRA 3PVXA 3WK6A 2BQUA 2UVRA 2Q4TA 3EZ5A 4P2HA 5J0UA 5CEHA 5AKXA 2H3VA 1ZD4A 4QWBA 8ICZA 2XCPA 3MR5A 4NLKA 4K4GA 2DR8A 4LEYA 5C5JA 4RQ8A 5DQGA 3L4PA 4X4TA 4QZEA 1BPDA 2QLTA 4YCXA 4O67A 3C1ZA 1MQ2A 2ZJ5A 4GIBA 4UB6U 4DFDA 3GZFA 2ZIUA 3V72A 2W3SA 2ZXIA 2V4QA 4J9QA 3RJEA 4WQLA 4M9JA 4K98A 2PI4A 2FDRA 3OUYA 1TE2A 4I2DA 2Q66A 2XICA 3PW5A 2JEFA 5DBAA 1QTMA 1CEZA 1J2NA 4ECUA 4KN7A 1QH9A 1X2IA 4EBDA 4DWIA 4KMOB 2H3IA 3HWTA 3GILA 3SZ2A 3K7DA 3AMZA 4OAGA 1SL0A 3RB4A 3I1YA 1S0NA 4Q44A 4UASA 3MGIA 2NV3A 3E58A 3N28A 2GAFD 2HSZA 1XSNA 3HILA 1ZQTA 1KLNA 4WC1A 2UVUA 4FHXA 2Q0ZX 5KFJA 2K8BB 4M2YA 4P0PB 3BQ7A 3H3AA 1RQNA 1JMSA 5ALRA 8ICBA 4FE3A 3HT3A 5HREA 5BOLA 5B3PA 4TUSA 4BWJA 4N7RA 4DLGA 1R8CA 3N97B 2WB1F 4KLDA 5ALKA 3ERCC 4J9MA 3MFHA 5H2FU 1P7DA 4HYKA 3PW7A 4F4XA 4E80A 3V6KA 5D63A 2KMDA 1SL1A 3PMNA 2H5XA 5JTGA 2EZZA 1TV9A 5AHXA 1OXJA 2PXIA 2K4HA 1R8BA 4EENA 5EE9A 4F4YA 1SWWA 2UVWA 2B4VA 2BPGA 2BPCA 3KKAA 2ZTDA 5IIKA 2C2DA 3K1ZA 5KG0A 2JR5A 4DQQA 3GU3A 4QIWF 3TKAA 1SXDA 1ZQVA 2LM4A 2WF6A 4XRHA 5F3XB 1SV0A 4IRCA 4DO9A 4NWIA 5AKZA 2WHEA 3HJ1A 4WC6A 1ZQSA 2R8GA 4DQPA 4QZIA 7ICJA 1WCNA 2W8LA 3QZ8A 1N48A 4F8RA 5KFWA 4OJ5A 4ED7A 1RM6C 5DLFA 2W54A 5ALXA 1TFWA 2ZUDA 4KLIA 5ALYA 2QARB 3H39A 2B6GA 4Z6EA 3M6ZA 3RFAA 5KL8B 1XS9D 2E8MA 1SKRA 5IIIA 4GXIA 4NM1A 4NXXA 2JRZA 2QB1A 4QNLA 1HUOA 4JLZA 1QQ5A 5KT4A 2MAXA 1V38A 4RQ3A 4M0AA 2JMGA 4USAA 4PL1A 1YZ6A 4C4SA 7ICTA 3SV4A 4NLBA 1SKSA 2M2WA 1COKA 1KL9A 9ICHA 1U4BA 4RQ6A 1F5SA 1HIWA 3D6JA 3TARA 3OVSA 1VFGA 2XGPA 4CRXA 1V9PA 4KX3A 1ZRNA 2E8PA 2BQ3A 1F0MA 2P35A 2KEYA 4QZGA 2WAQC 2BKEA 5D4BA 4PJ0U 1VJ7A 3NVWA 5JU5A 1DRGA 3Q8MA 5AKLA 3RAXA 4FS1A 1Z1BA 3JPNA 4RUCA 1RYSA 2HDOA 2JGAA 5HMLA 2HHXA 4ATBA 2ALZA 3WFSC 3IHQB 2B0CA 1BPXA 3TAQA 5J0SA 4F4ZA 3HKZC 5ALJA 1A76A 4IG8A 4YN4A 3AEVA 3WKCA 3A0BU 3SAFA 4AT8B 3C28A 3ORYA 3PSFA 1V85A 3QX7A 4X4RA 4EBJA 5AKEA 4K97A 2DPJA 5HC9A 5HNKA 5ALDA 1AROP 4KB6A 3FC4A 4QWEA 2HBKA 3NUQA 1KQQA 1TFYA 2AHOB 2EANA 4M9LA 5ALOA 7ICVA 3OV7A 2MUTA 2DFLA 4NV0A 3EUB2 2IHMA 7ICSA 3QYPA 1S5LU 5IIJA 2ZH6A 2NRKA 4IRKA 4Z6DA 3QU4A 5BOMA 2HHWA 3PW2A 3PX6A 4DL4A 2ASDA 1Q3VA 5DLGA 2HHTA 4I0UA 3M9MB 5KFQA 2RP5A 3G6VA 3JZ0A 1RZTA 3T5KA 4Y2JA 1RQLA 1U48A 4FS2A 4DS5A 1B22A 1MC8A 4LZDA 4DL6A 2PFNA 1LKYA 2A3VA 3KKAC 1M6YA 4XA5A 3SV3A 3EF2A 4F92B 4WOYA 2EZYA 1ZQGA 2F44A 3TI0A 1ZQDA 4US9A 3MBYA 3B0XA 4Z6FA 4WC2A 4YMNA 1OU5A 2O6KA 1XWLA 3IN5A 2IOFA 2IOHA 2PMZF 2FPKA 2G0AA 4LEWA 3JPPA 5KAIU 1R8AA 5CFTA 3OHBA 1XO1A 5F9NA 4Y2VA 3R9KA 4OAFA 3RH5A 1JN3A 4CF3A 5TISU 3TADC 4QWCA 2XGQA 3AL0B 1SWVA 2HOIA 1K1QA 3IM1A 3V6JA 1NK7A 2I9GA 5AK3A 3C2KA 3WFRE 2NRTA 4O5EA 2B51A 4PH5A 7ICKA 2KIWA 2A1JA 3FM9A 3GIJA 2BQRA 1NK5A 2MA1A 2BBHA 5L1MA 1IIPA 3WK7A 4J03A 2ZH2A 9ICEA 3N7PD 2R8KA 5KTQA 4KLGA 3DEEA 5ALUA 3TAPA 3L9DA 5TZVA 1X42A 5CHGA 3AQLA 3CRXA 4F5OA 3KZIU 3SEIA 4QZAA 1Q46A 2XIDA 3J81j 3WKAA 2BR0A 5ALFA 3F5AA 1SKWA 4Q8FA 2PFPA 3KOOA 3VCBA 3QE9Y 9ICPA 2PI5A 4OAIZ 3BQ0A 5ALTA 1URJA 1COOA 2FPMA 1K1SA 3ZDCA 5AM1A 3AQFA 8ICUA 4LVSA 3WK4A 1T3NA 1SV4A 2HBLA 1D8LA 4M47A 1X9XA 1TK5A 1Z4NA 4Y2RA 5DEDA 3MCRA 3ETLA 1Q79A 4JMUA 1JAJA 1ZXIA 3ICXA 3PO5A 2PFQA 1TVAA 4J9NA 1VDVA 3ER9B 2G5HB 5AKYA 4Y2XA 4M04A 3GV8B 2ZIUB 3OVAA 2KHVA 4MKPA 3OUYB 2ZH1A 4O3NA 4Y2UA 5CRXA 2P66A 4IQVA 4PGYA 2YTUA 3GV5B 2OEHA 3WU2U 5DBCA 5BPCA 3IRUA 4AYBC 3LQCB 1NKBA 4ECQA 3NVZA 1D8YA 2VJ4A 4M6WA 1PK1A 3THVA 3L3FX 2YMQA 4CGZA 4KM5A 4I2AA 4WJ3B 2ZHBA 1OW5A 2ATLA 3JPOA 2RDIA 2LYBA 5JUMA 4QIWC 1QQ6A 3K4GA 4DL3A 1X40A 4DCCA 1A77A 3LVWA 4RQ5A 2MSNA 4B9NA 2AQ4A 4EEKA 1SIJA 5KFMA 7ICHA 1U49A 2JEGA 2F2AB 3Q8LA 4EYHB 8ICPA 1Z19A 1ZYQA 1SGGA 2YMMA 3M8RA 3WK8A 4F4KA 1FFVA 3GIIA 1QSLA 3V7LA 2FLLA 3LYSA 2G09A 4IR9A 4IC9A 2HW3A 3IG5A 4GC6A 3H0RB 4QJFB 3MABA 9ICXA 2EQYA 3BDPA 4RPZA 4UBCA 5KG3A 2QB0A 4K99A 5ALSA 3M9OB 4AT7B 3HW8A 5DGAA 4OO1J 1DOQA 2ZXHA 5KFVA 1O03A 4IR1A 2J6UA 4I2IA 1N61A 4QWAA 2KVSA 5J2IA 2FMPA 1UA1A 2R8JA 4FFDA 5AKHA 3ZD9A 4K8VA 9ICBA 5G5GA 7ICNA 3WFQE 2JZBB 4UB4A 4DSEA 4NL9C 4J9RA 5G5HA 3GIKA 3D2QA 2P6RA 4RQ0A 1X6JA 2EDUA 2ZIXB 4QZ8A 3Q8KA 4FZMA 1NOMA 4KX5A 5AI6A 1TK0A 8ICYA 5IILA 3KHGA 2CRXA 4MF8A 2ZTCA 3T79A 3ALRA 2OH2A 3PMLA 3QXGA 1RXVA 2BCUA 4NLNA 1C20A 3M1YA 5HHHA 4TQRA 1MIWA 1V97A 2ZH8A 2EWRA 3KHRA 3NRZA 9ICCA 4UB1A 3JPSA 2RRDA 4Y2TA 4IRDA 1ZD2P 2RDJA 2GWSA 4O0IA 1NJWA 1NK0A 1XSPA 5KG5A 7ICIA 2K60A 3KZXA 5F2VO 1QSSA 4R66A 1NK9A 5KG6A 2A1AA 4YR0A 5AI0A 5IINA 2FLPA 4I2HA 4FO1A 3CP8A 5AM5A 4MFAA 2W04A 3V6HA 1BPYA 1Q78A 2WF9A 3PSPA 1DGJA 2UVVA 4CF5A 2DRBA 1KRPA 4LEVA 3PX0A 2KFNA 4K96A 2M9NA 2ES6A 8ICLA 4IQWA 5AICA 2W11A 4XQ7A 1ZJNA 4QZ9A 5HRFA 5IIOA 4US8A 4Q8EA 3E0FA 3QEBZ 2F76X 2JHDA 5EOZA 1NJYA 1S0VA 4JWMA 1VJ5A 3JCFA 1XU4A 2ZH7A 2KNJA 1MSWD 9ICFA 4BGDA 2OWOA 4AYBF 4P4MA 1S8OA 5DG8A 1WYGA 1NK8A 1ZQXA 2ZIWA 4NM2A 4U7CA 4RPXA 1FIQA 3NTUA 5ALPA 4R64A 4ZH4A 2KG5A 4RNNA 3NVVA 4XQ8A 5ALHA 2BDUA 4Y2YA 2IOFK 3PSIA 1CI4A 2VA3A 2R8IA 4FBUA 1ZQLA 4JV2A 1HJPA 2KIVA 2KHQA 1PK3A 4JB3A 4JV1A 5DBBA 4F4WA 7ICMA 5GTHU 2E8NA 3RJFA 2Y1JA 4QZFA 1ZRMA 2BDPA 3IG8A 3HPOA 3HP6A 4QW8A 5B5EU 1IV8A 3N7SC 1LV5A 3SD7A 9ICOA 1WOTA 4F5RA 4DFPA 2HMXA 2WF8A 1ZQUA 2DQNB 5HR6A 2OCEA 4O6AA 4EELA 4WC7A 5EWEA 4K4HA 4EEDA 2BHNA 3PNCA 2C2RA 2W03A 3K1RB 2C2EA 1MA7A 3T5LA 1X9MA 1ZQRA 4C0ZA 4GFJA 2KOBA 3H8SA 3EYZA 1Z4OA 3OSPA 3ZDBA 5KFNA 4O5CA 5D62A 2YMLA 2C22A 4X4VA 3CK6A 2KZ3A 2NRWA 3HIYA 3QU5A 2YMPA 3MR6A 4JV0A 3TADA 1UA0A 5ALEA 4KLQA 4C8KA 5L9XA 3WFOA 8ICQA 4F93B 5DDMA 3RRHA 2NO4A 2E8OA 2YB1A 5KFSA 1T8EA 4ECWA 3NKUA 3UMGA 2LHTA 3AU2A 4KLJA 4ECYA 1ZQ1C 8ICNA 9ICKA 2JXJA 3Q8RB 4DL7A 3BS5A 1JIHA 1S76D 4X4OA 2LYAA 5CR0A 2RLTA 2DL0A 5GTIU 4IQTA 5FP0A 9ICGA 2B21A 4F5NA 2ZJ8A 8ICAA 3QEAZ 3LK9A 3T5JA 2NO5A 5HRGA 2HOQA 2KZMA 3KBBA 4WC5A 4F50A 1L3TA 2ZH3A 4OJ6A 4ECVA 3TANA 3UMCA 8ICHA 4UB8U 3WKDA 7ICFA 2EAMA 3NVYA 2QARA 2KKVA 4DOBA 2KV2A 3UMBA 1TAQA 4X4PA 4MEXA 3PZPA 1XC9A 8ICMA 2A19A 4C8MA 2GH1A 1S9FA 5CFUA 1QSYA 4KLMA 2ZH9A 4I29A 7ICOA 5B66U 3H0LB 3T3FA 4DSIA 1MQ3A 1L7NA 4DQSA 3C2MA 4KLFA 5D61A 2BGWA 4F91B 4P0QA 2Z7JA 5AM3A 4AT7A 1KEJA 4I2BA 2E5SA 5CHEA 2DUYA 3ER8C 4DEZA 1JI7A 4ECRA 3M9NB 2LPEA 4ELUA 2IUBA 4UD5A 2EAPA 1ZQHA 4HX0A 3SI8A 3RH6A 2C28A 4FHWA 1SZPA 2GLEA 4KN4A 3TQ1A 4JK1A 3NRWA 1YT3A 4AT9A 3UXPA 4OAHA 1L7OA 2CN1A 2J6SA 2VKQA 1WG8A 2M2VA 4DOCA 4IL6U 4M9GA 5KT6A 3JPQA 4KLEA 1A6SA 4EEBA 3I76A 3NYBA 4Y2SA 5AI8A 4NXTA 2ZUBA 1R89A 4X4UA 2YY6A 3G6XA 4EGWA 5AM0A 3H8WA 2XO7A 1KFTA 4ED3A 3SYZA 2D6FC 1HEKA 4IS7A 4F2RA 3MR3A 4J9SA 5HR9A 3ED5A 4WH5A 4QZBA 1N62A 4YD2A 4R65A 1LVHA 8ICRA 3BS5B 2ZJAA 4C7YA 3BJYA 1PX5A 2W55A 2DR9A 1L3VA 5J29A 5KT7A 1KTQA 1H38A 3G6YA 3PY8A 4YVZA 2ZH5A 4O3MA 2KSOB 3TFSA 4DL5A 7ICQA 2VJ5A 2W43A 4EZ9A 4TUPA 3RJGA 3AN1A 4KLTA 8ICVA 2LI6A 1RPLA 5KG1A 5J2HA 4OJLA 1SZHA 3NASA 2PKEA 4NL9A 4ECXA 2HBMA 3D2NA 4TURA 4GXKA 1MIYA 4BXOA 2D8CA 5KG7A 4X0BA 1JROA 3AM9A 3TACB 2HHSA 4MF2A 4XUSA 2G06A 1ZQPA 4YR3A 5F9LA 4UBBA 4B9TA 1BVSA 5AK4A 1JQRA 4ZOHC 2HVIA 2JEJA 3OGUA 3BZKA 4EBEA 4BUGA 4QZCA 2O1PA 4X4NA 2ID1A 5E79U 2AGQA 4B6JA 5DGBA 4F72A 2OHFA 2QKQA 1KNYA 4F2SA 2VANA 4BXOB 4C80A 3FYHA 2G08A 5KG4A 4WQKA 4DSKA 9ICNA 3H8MA 1F5AA 1AQ6A 2WF5A 1XSLA 4O3RA 1Z3EB 1BNPA 4R8UA 2W7PA 4M9HA 4NXWA 2IHNA 5KFEA 2BBJA 9ICUA 1TAUA 3F53A 2B56A 1NKEA 4PHPA 5EE0A 1L8LA 1F44A 2W9BB 3UQ2A 3PW4A 2L5YA 3CW2C 3BS7A 8ICKA 2K4EA 1JX4A 4KITB 2AU0A 4WBZA 2HBJA 5J2BA 1KN5A 1OUQA 4KLUA 4ACOA 8ICOA 1S97A 5B3QA 2HHPA 2MRLA 8ICEA 4E7XA 1IM4A 5J0OA 5J2GA 2XY7A 1DK3A 5KAFU 1KSPA 1RG6A 4UAWA 4I28A 5DB9A 1ZQWA 5JRTA 4KLLA 1ZOLA 3WFPA 4P4OA 4CE6A 1EXNA 1ZQQA 2ZH4A 1DGSA 4RU9A 2G07A 5L1IA 1U45A 4YQWA 3UXNA 5HRKA 4O3PA 4I2JA 4RWPA 4UAZA 1N63A 1JXEA 5L1KA 3B0YA 4WBYA 5KT2A 2ZG6A 5KT3A 3GDXA 8ICFA 1N56A 3SENA 4K9BA 4HAIA 9ICIA 2DVIA 3ETRA 4RWOA 3JYYA 2ASJA 4B9VA 1JXLA 3OSNA 5ALLA 5DQIA 3OJUA 2GA9D 4NY8A 2DR7A 1L8OA 5AIBA 3M6KA 2W9AA 2EAOA 2XY6A 4MFFA 3C1YA 2HI0A 2HVHA 4UW9A 3PX4A 4RQMA 4OCZA 4DFJA 5DB8A 1UHUA 5J0WA 5ALVA 3H0MB 3Q8PB 2VIXA 4J9OA 2ISOA 2BCQA 2AXTU 3ISDA 5KT5A 4EP7A 4O68A 1N2XA 2IMWP 1SV0C 4KMUA 3M7DA 2PFOA 2W9CB 3HKZF 3OVBA 2KSOA 4KTQA 1WUDA 3RR7A 4ED2A 5J0TA 1SL2A 5AI5A 2A1JB 3MC1A 4BDPA 2MUTB 1L3SA 1B4FA 3S6JA 2ZTEA 5J2KA 2M0NA 3OJSA 4NLZA 3C18A 9ICVA 4PZOA 2ZIVA 1ZETA 5KFCA 2JZBA 5DDYA 1IG6A 2DWQA 1BNOA 2EZXA 4UARA 3ISCA 4DQIA 3H4DA 4I2CA 3PO4A 1RYUA 9ICRA 4XJEA 1FFUA 1CUKA 4O3OA 2H3QA 4UAYA 5AI9A 3ZD8A 5AKJA 2Y9TA 4DQRA 2K8CB 4PHAA 3QUTA 5J0QA 2NRVA 3QU7A 4AP9A 3OHAA 4QZDA 4CCHA 5J8YC 2HHVA 4R63A 1B43A 2Y0SC 4NXUA 4RWNA 5KG2A 2QB0B 3ONNA 2F1IA 4G9BA 2LMRA 4LEZA 4ECZA 4B9LA 1WWVA 2ISPA 1BGXT 1X6IA 5HRBA 5HHIA 5D46A 5AM2A 5KNIA 5DQHA 5HMMA 3RB3A 1A0PA 3MDAA 1MN8A 3FDSA 2HOFA 4UB3A 9ICWA 5J2CA 1UEUA 5J2DA 2YB4A 3UPSA 4ED6A 5DG9A 3H38A 2XI9A 4E0DA 8ICIA 3N7RC 2IHOA 4F5QA 5CJ7A 2ODGA 4A8EA 5J2JA 3ZDDA 4O3QA 3OTQA 2F77X 3D2SA 2OYYA 3AQMA 4G3IA 1PVRA 1ZQYA 4F5PA 2DGZA 2F8KA 3SAHA 8ICCA 3EPIA 4FH3A 2FPLA 3C21A 1X66A 4I2EA 5DKWA 4DLEA 5DG7A 3RRGA 2BCRA 4UATA 1BPBA 2O5AA 2PMZC 2MU2A 4C4RA 1Y88A 3SMVA 4EEYA 1D9FA 4RQ1A 3Q8QB 3V7JA 2W9CA 2HN2A 3C23A 2HN1A 2I6XA 3F5EA 4Q45A 1LB2B 4BX9C 1Z1VA 4J9PA 2KD1A 2VA2A 1TAMA 4LZGA 3KFUF 5DECA 2KICA 3RBDA 3HX0A 4YMMA 1X9WA 3E2EA 4NXVA 4FZNA 2DKZA 4RT2A 1J2MA 5KFFA 1JUDA 2AGPA 4EX6A 1UCVA 4ED8A 7ICPA 2M2TA 4AT9B 4DOAA 3C66A 2ZIVB 2VA8A 3BQ2A 2KJ8A 1JALA
chains in the Genus database with same CATH topology
1BPEA 4EBCA 1SKWA 4Q8FA 3RJJA 2PFPA 1TKDA 4WC0A 3LDAA 5KFHA 4RQ2A 3QE9Y 4DEZA 4R8UB 2BCVA 1KFDA 3KTQA 2PI5A 9ICPA 3AU6A 4ECRA 3M9NB 3BQ0A 4ELUA 4UD5A 4RNOA 1L3UA 3MFIA 1ZQHA 1COOA 2FPMA 3SI8A 3RH6A 2F1JA 1K1SA 2C28A 3ZDCA 4FHPA 4S3NA 3LWLA 1ZQEA 8ICUA 4TQSA 1ZQNA 2BE3A 4FHWA 1SZPA 4KN4A 4LVSA 3TQ1A 1T3NA 4JK1A 4O5KA 2RFFA 4AT9A 4YD1A 1UT5A 3RB6A 3UXPA 2ZHAA 1D8LA 3QZ7A 4M47A 3JPRA 3PR4A 8ICWA 1FA0A 5KFTA 4FHVA 1S0MA 3ZDAA 4GLXA 1KFSA 4Z6CA 1ZQBA 2J6SA 4DSLA 5J0PA 1TK5A 1QLNA 2M2VA 4DOCA 5DEDA 4M9GA 4MFCA 4DFMA 1S10A 2J6TA 5KT6A 3JPQA 1T7PA 4KLEA 3ETLA 3UXOA 3GV7B 1Q79A 4DSFA 4ATBB 3RAQA 1JAJA 4WC4A 3NYBA 4RQ7A 4UQGA 1UETA 1ZQKA 5KFBA 4FBTA 3PO5A 2PFQA 2ZUBA 1R89A 4B9MA 3G6XA 4X4UA 3H8WA 2XO7A 1TVAA 1KFTA 4J9NA 4ED3A 4AT8A 4DFKA 3SYZA 5CB1A 5CWRA 3PVXA 3TFRA 4M04A 3GV8B 2BQUA 2UVRA 3EZ5A 4P2HA 2Y1IA 4F2RA 1YLQA 3MR3A 5J0UA 4J9SA 5HR9A 2DR5A 3OVAA 4DF4A 5DB6A 3OUYB 4QWBA 2ZH1A 4O3NA 8ICZA 4QZBA 4B9UA 2XCPA 2NRZA 3MR5A 4O9MA 1ZQIA 2P66A 4NLKA 4YD2A 4R65A 4PGQA 8ICRA 4ECTA 4X0AA 4IQVA 2XC9A 5HP4A 4PGYA 2ZJAA 4K4GA 3BJYA 1PX5A 4P4PA 2DR8A 2DR9A 5C5JA 4E8FA 1L3VA 4RQ8A 5J29A 5KT7A 1KTQA 4YXMA 5DQGA 3G6YA 1H38A 2V9WA 3GV5B 4YVZA 3PY8A 4X4TA 5DBCA 2ZH5A 4QZEA 3MDCA 5BPCA 3TFSA 1ZQAA 3LQCB 4ECSA 1NKBA 4ECQA 4DL5A 1BPDA 4YCXA 7ICQA 2XY5A 4M6WA 1D8YA 4EZ9A 3C1ZA 3THVA 4TUPA 1MQ2A 3RJGA 2ZJ5A 4ELVA 4KLTA 4PHDA 8ICVA 1RPLA 5KG1A 4I2AA 5J2HA 3V72A 4YP3A 2V4QA 4J9QA 4ECXA 3RJEA 4YR2A 2ATLA 4M9JA 2ZHBA 5IIMA 2PI4A 4KLOA 7ICEA 3JPOA 2RDIA 4TURA 4ED0A 3OUYA 2BCSA 5JUMA 4GXKA 4I2DA 8ICGA 1MIYA 2Q66A 5J0RA 4BXOA 5KG7A 3K4GA 9ICLA 4DL3A 2AQ0A 3PW0A 3PW5A 3MGHA 4X0BA 2JEFA 5DBAA 1ZQZA 1QTMA 1MIVA 1CEZA 1UT8A 3GQCA 4ECUA 4DF8A 4KN7A 1A77A 4MF2A 2HHSA 3ZDEA 4XUSA 1X2IA 1ZQJA 4RQ5A 4UD4A 4EBDA 3M8SA 4DWIA 1ZQPA 3HWTA 4YR3A 3GILA 5F9LA 4BWMA 5KFMA 3SZ2A 2AQ4A 4B9NA 7ICHA 4UBBA 4B9TA 1BVSA 1U49A 1SL0A 1JQRA 3RB4A 2JEGA 5KFYA 3Q8LA 1S0NA 4Q44A 4EYHB 2HVIA 8ICPA 3MGIA 2JEJA 3OGUA 4DSJA 3H37A 4EBEA 4QZCA 1ZYQA 2O1PA 2ID1A 4X4NA 2AGQA 4MEYA 3M8RA 1XSNA 3C2LA 1V4AA 1ZQTA 5DGBA 4F4KA 5KFDA 3GIIA 1QSLA 1KLNA 1KNYA 3V7LA 4F2SA 2FLLA 2UVUA 4WC1A 2VANA 5CA7A 4BXOB 2Q0ZX 5KFJA 3FYHA 4IR9A 2HW3A 4FHXA 4GC6A 4PPXA 4M2YA 5KG4A 3MABA 9ICXA 3H3AA 3BDPA 4RPZA 3GIMA 4DSKA 4UBCA 9ICNA 5KG3A 1S77D 1JMSA 8ICBA 1F5AA 3HT3A 1XSLA 4O3RA 5HREA 5BOLA 3M9OB 1Z3EB 1BNPA 3H8JA 4R8UA 4TUSA 3LWMA 4BWJA 4UB5A 1D9DA 4M9HA 4DLGA 4AT7B 3HW8A 5DGAA 3N97B 1R8CA 2IHNA 4KLDA 1DOQA 5KFEA 9ICUA 1TAUA 1UEUA 4RWQA 4J9MA 1NKEA 5KFVA 3MFHA 8ICSA 4PHPA 4IR1A 4QWDA 2J6UA 4I2IA 2W9BB 3Q8SB 4HYKA 4QWAA 3UQ2A 3PW4A 3PW7A 1ZQOA 4F4XA 4I2FA 3V6KA 2LYHA 5J2IA 1ZQMA 4E80A 2FMPA 1SL1A 1UA1A 2R8JA 3PMNA 3ZD9A 8ICKA 5J0YA 2H5XA 1JX4A 4KITB 2AU0A 1TV9A 1KDHA 9ICBA 2PXIA 4WBZA 7ICGA 1R8BA 7ICNA 1UEVA 3C5FA 3WFQE 2JZBB 5EWFA 5J2BA 4RUAA 4UB4A 4F4YA 4DSEA 4KLUA 2UVWA 8ICOA 4EZ6A 1S97A 4J9RA 3GIKA 2BPGA 2BPCA 2P6RA 2HHPA 4Q43A 4RQ0A 2ZTDA 5IIKA 2C2DA 5KG0A 4E7XA 8ICEA 4QZ8A 4DQQA 3Q8KA 1IM4A 1NOMA 1ZQVA 5J0OA 5J2GA 1TK0A 8ICYA 5IILA 2XY7A 3KHGA 2HHUA 1DK3A 4MF8A 4XRHA 1KSPA 2ZTCA 4UAWA 4I2GA 5DB9A 1ZQWA 4I28A 4IRCA 4FHYA 3BQ1A 4KLLA 1NJZA 1DK2A 3WFPA 4DO9A 4P4OA 4JWNA 1EXNA 2KFZA 3HJ1A 4WC6A 1ZQQA 1ZQSA 3PMLA 1RXVA 2BCUA 1DGSA 5KFOA 2R8GA 4NLNA 2ZH4A 4RU9A 3PV8A 4DQPA 4YFKA 5L1IA 1U45A 5HHHA 4QZIA 4TQRA 4YQWA 3MR2A 7ICJA 1WCNA 2W8LA 3QZ8A 1MIWA 3UXNA 2ZH8A 1N48A 5HRDA 5HRKA 2FLNA 3V7KA 5KFWA 4F8RA 4O3PA 4I2JA 4TUQA 3KHRA 4RWPA 4ED7A 5DLFA 9ICSA 4UAZA 9ICCA 4UB1A 3H40A 4JUZA 1JXEA 5HRLA 3JPSA 2ZUDA 5L1KA 3B0YA 4IRDA 4KLIA 4X4SA 3H39A 4IQUA 2RDJA 4Z6EA 2GWSA 5KT2A 4WBYA 4O0IA 1NJWA 5KT3A 5J0XA 1XS9D 1NK0A 3GDXA 1XSPA 8ICFA 5KG5A 1N56A 1SKRA 5IIIA 4GXIA 4NM1A 7ICIA 9ICIA 2DVIA 4GXJA 8ICXA 5F2VO 4RNMA 1HUOA 1QSSA 3N4MB 4R66A 4RWOA 2ASLA 1NK9A 5KG6A 5KT4A 3RB0A 2MAXA 4M5DA 2NRXA 4RQ3A 4M0AA 3JYYA 4YR0A 5L1LA 2ASJA 1U47A 5IINA 2FLPA 4FO6A 4B9VA 1JXLA 4I2HA 3OSNA 4MFAA 5DQIA 3OJUA 9ICJA 3V6HA 1BPYA 7ICTA 5J2FA 3SV4A 1BPZA 4NY8A 1SKSA 1Q78A 2M2WA 2DR7A 3EPGA 1RYRA 2W9AA 2UVVA 1ZQCA 9ICHA 2DRBA 4NXZA 1U4BA 1RXWA 2XY6A 4RQ6A 1KRPA 3PX0A 2KFNA 2M9NA 5KFRA 3RJHA 1TFRA 4ELTA 4MFFA 1T4GA 3C1YA 4RZRA 8ICLA 4IQWA 4XQ7A 2HVHA 1ZJNA 4QZ9A 4RPYA 3PX4A 5HRFA 3TARA 3OVSA 5IIOA 1IXRA 1VFGA 4DFJA 2XGPA 4Q8EA 5DB8A 3QEBZ 1V9PA 5J0WA 5EOZA 1NJYA 3Q8PB 2BQ3A 4JWMA 4J9OA 1S0VA 2ISOA 1XU4A 2ZH7A 4B9SA 2BCQA 4QZGA 3ISDA 2BKEA 5D4BA 2W9MA 4BGDA 2OWOA 4UB2A 1MSWD 4DS4A 9ICFA 5KT5A 5HRHA 4EP7A 4WC3A 1VJ7A 4P4MA 5DG8A 2IMWP 1NK8A 1ZQXA 2V4RA 4KMUA 3Q8MA 4NM2A 3RAXA 4RQ4A 3AQNA 4FS1A 2PFOA 2DPIA 1Z00A 4J9LA 3RH4A 4RPXA 3NTUA 4NLGA 1WCLA 2W9CB 4R64A 3RBEA 4ZH4A 3JPNA 3OVBA 4RUCA 4C8OA 4RNNA 3BQ2A 1RYSA 4X5VA 4XQ8A 3UQ0A 4KTQA 5HMLA 5KFUA 2HHXA 3UPQA 3RR7A 4ATBA 4YG2A 4ED2A 2ALZA 3WFSC 3IHQB 5J0TA 1BPXA 3TAQA 5J0SA 1SL2A 4QW9A 2R8IA 2VA3A 4FBUA 4I27A 2A1JB 4F4ZA 1ZQLA 4BDPA 2MUTB 2W9BA 1HJPA 3T5HA 4JV2A 1A76A 1L3SA 4IG8A 3RTVA 4YN4A 5DB7A 4KLHA 2ZTEA 5J2KA 4AT8B 3EWAA 3OJSA 4JV1A 4M9NA 5DBBA 4NLZA 3ORYA 4FH5A 4F4WA 3GFKB 9ICVA 3C18A 8ICTA 7ICMA 3RJFA 1ZETA 5KFCA 2JZBA 5DDYA 4X4RA 2Y1JA 4QZFA 2BDPA 4EBJA 2BPFA 3HPOA 1BNOA 3ISCA 4DQIA 2DPJA 4J9KA 3HP6A 4QW8A 3H4DA 4I2CA 9ICQA 3PO4A 1LV5A 5KFXA 9ICRA 1NJXA 7ICSA 5KFGA 5HNKA 5HC9A 1CUKA 4O3OA 9ICOA 4F5RA 1WOTA 4DFPA 1AROP 3AUOA 1ZQUA 1NK4A 4UAYA 4QWEA 4WC7A 1TFYA 2I1QA 4M9LA 3ZD8A 5EWEA 4DQRA 4K4HA 4PHAA 7ICVA 3K75D 1ZQFA 3OV7A 2MUTA 5J0QA 2BHNA 2NRVA 3PNCA 3KHHA 2C2RA 2DFLA 4EYIB 2C2EA 4RT3A 3OHAA 3T5LA 1X9MA 4QZDA 1ZQRA 5IIJA 3H7IA 1L5UA 2IHMA 2ZH6A 4CCHA 2HHVA 2NRKA 1NKCA 4R63A 3H8SA 8ICJA 3NGDA 1B43A 2F1HA 4IRKA 5KG2A 4RWNA 3JPTA 1NZPA 1NO5A 4Z6DA 2XCAA 3EYZA 5KFZA 2F1IA 3OSPA 5BOMA 2HHWA 3ZDBA 5KFNA 4O5CA 2C22A 3PW2A 3PX6A 4ECZA 4X4VA 4DL4A 4B9LA 3EW9A 5KFAA 5DLGA 2ASDA 2KZ3A 2NRWA 3M9MB 2HHTA 2ISPA 3HIYA 4X4QA 4DL2A 5KFQA 1BGXT 4ED1A 4C8NA 2KTQA 3G6VA 5HHIA 5HRBA 5D46A 5DQHA 3MR6A 2IA6A 3JZ0A 5HMMA 3RB3A 1RZTA 3T5KA 2W8KA 4JV0A 1UA0A 5D49A 3MDAA 4KLQA 2HHQA 4C8KA 3FDSA 5L9XA 4UB3A 4FS2A 1U48A 4DS5A 5J2CA 4F3OA 8ICQA 9ICWA 1MC8A 4F93B 5DDMA 4KLSA 4LZDA 5J2DA 3RRHA 2KZZA 1B22A 5KFSA 4DL6A 1T8EA 3UPSA 4ECWA 9ICTA 2PFNA 2AJQA 4ED6A 5DG9A 3AU2A 4KLJA 4ECYA 8ICNA 2KP7A 3H38A 9ICKA 1TK8A 4E0DA 4XA5A 3Q8RB 2DRAA 5EWGA 8ICIA 3SV3A 4DL7A 3PR5B 4F5QA 4F92B 5CJ7A 1JIHA 5J2JA 1S76D 1ZQGA 3ZDDA 3TI0A 4O3QA 4X4OA 3AQMA 5CR0A 1ZQDA 4G3IA 3MBYA 4IQTA 3B0XA 1ZQYA 4Z6FA 3KHLA 3RJIA 9ICGA 4WC2A 2B21A 4YMNA 4F5NA 1OU5A 3HJ4A 2ZJ8A 9ICAA 8ICAA 3QEAZ 4O3SA 4M6WB 1XWLA 1PZNA 2R8HA 4LT6A 3LK9A 4F5PA 8ICCA 4YMOA 2FPKA 1C7YA 3JPPA 3EPIA 3T5JA 4FH3A 2FPLA 4QZHA 3C21A 4I2EA 1R8AA 5HRGA 2KZMA 5DKWA 2JEIA 5J2AA 4GC7A 3OHBA 4DLEA 1XO1A 5F9NA 5DG7A 3RRGA 2IBKA 4NKTA 2BCRA 4WC5A 2M2UA 7ICLA 4F50A 1BPBA 4PHEA 1L3TA 2O5AA 2ZH3A 1ZJMA 4C8LA 5L1JA 4ECVA 3RH5A 1JN3A 3TANA 1Y88A 4PGXA 1U9LA 4EEYA 8ICHA 4EBKA 7ICFA 1D9FA 4YXJA 3BQTA 4RQ1A 4QWCA 3Q8QB 2XGQA 2W9CA 3V7JA 7ICRA 1K1QA 3WFOA 2ZUCA 3C23A 3RJKA 5KFPA 2KN7A 3IM1A 4Q45A 3V6JA 1NK7A 2P6UA 5J2EA 3C2KA 2I9GA 1LB2B 3WFRE 2NRTA 4J9PA 4DOBA 4O5EA 1Z00B 3H4BA 2VA2A 2FMSA 4NKUA 5KFLA 1TAQA 4LZGA 4X4PA 4PH5A 5DECA 4MEXA 7ICKA 3C5GA 5KFKA 2A1JA 3RBDA 2FMQA 3HX0A 1XC9A 4YMMA 1X9WA 3GIJA 2BQRA 8ICMA 4C8MA 1NK5A 3RR8A 2PBEA 3E2EA 1S9FA 1TFWA 5CP2A 4RT2A 5KFFA 1QSYA 2AGPA 1S0OA 4KLMA 9ICEA 2ZH2A 2R8KA 2AGOA 2ZH9A 5KTQA 4K4IA 4ED8A 4KLGA 4I29A 3TAPA 3L9DA 7ICOA 4WCWA 7ICUA 7ICPA 3T3FA 5TZVA 5CHGA 4DSIA 2M2TA 4AT9B 4DOAA 1MQ3A 3ISBA 3C2MA 4DQSA 4KLFA 5HRIA 4F5OA 2BGWA 3AQLA 4F91B 3C66A 1X9SA 4QZAA 1NK6A 2BR0A 9ICMA 1HUZA 4AT7A 1KEJA 4I2BA 2WTFA 3AQKA 2VA8A 5KFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPE A;  4EBC A;  1SKW A;  4Q8F A;  3RJJ A;  2PFP A;  1TKD A;  4WC0 A;  3LDA A;  5KFH A;  4RQ2 A;  3QE9 Y;  4DEZ A;  4R8U B;  2BCV A;  1KFD A;  3KTQ A;  2PI5 A;  9ICP A;  3AU6 A;  4ECR A;  3M9N B;  3BQ0 A;  4ELU A;  4UD5 A;  4RNO A;  1L3U A;  3MFI A;  1ZQH A;  1COO A;  2FPM A;  3SI8 A;  3RH6 A;  2F1J A;  1K1S A;  2C28 A;  3ZDC A;  4FHP A;  4S3N A;  3LWL A;  1ZQE A;  8ICU A;  4TQS A;  1ZQN A;  2BE3 A;  4FHW A;  1SZP A;  4KN4 A;  4LVS A;  3TQ1 A;  1T3N A;  4JK1 A;  4O5K A;  2RFF A;  4AT9 A;  4YD1 A;  1UT5 A;  3RB6 A;  3UXP A;  2ZHA A;  1D8L A;  3QZ7 A;  4M47 A;  3JPR A;  3PR4 A;  8ICW A;  1FA0 A;  5KFT A;  4FHV A;  1S0M A;  3ZDA A;  4GLX A;  1KFS A;  4Z6C A;  1ZQB A;  2J6S A;  4DSL A;  5J0P A;  1TK5 A;  1QLN A;  2M2V A;  4DOC A;  5DED A;  4M9G A;  4MFC A;  4DFM A;  1S10 A;  2J6T A;  5KT6 A;  3JPQ A;  1T7P A;  4KLE A;  3ETL A;  3UXO A;  3GV7 B;  1Q79 A;  4DSF A;  4ATB B;  3RAQ A;  1JAJ A;  4WC4 A;  3NYB A;  4RQ7 A;  4UQG A;  1UET A;  1ZQK A;  5KFB A;  4FBT A;  3PO5 A;  2PFQ A;  2ZUB A;  1R89 A;  4B9M A;  3G6X A;  4X4U A;  3H8W A;  2XO7 A;  1TVA A;  1KFT A;  4J9N A;  4ED3 A;  4AT8 A;  4DFK A;  3SYZ A;  5CB1 A;  5CWR A;  3PVX A;  3TFR A;  4M04 A;  3GV8 B;  2BQU A;  2UVR A;  3EZ5 A;  4P2H A;  2Y1I A;  4F2R A;  1YLQ A;  3MR3 A;  5J0U A;  4J9S A;  5HR9 A;  2DR5 A;  3OVA A;  4DF4 A;  5DB6 A;  3OUY B;  4QWB A;  2ZH1 A;  4O3N A;  8ICZ A;  4QZB A;  4B9U A;  2XCP A;  2NRZ A;  3MR5 A;  4O9M A;  1ZQI A;  2P66 A;  4NLK A;  4YD2 A;  4R65 A;  4PGQ A;  8ICR A;  4ECT A;  4X0A A;  4IQV A;  2XC9 A;  5HP4 A;  4PGY A;  2ZJA A;  4K4G A;  3BJY A;  1PX5 A;  4P4P A;  2DR8 A;  2DR9 A;  5C5J A;  4E8F A;  1L3V A;  4RQ8 A;  5J29 A;  5KT7 A;  1KTQ A;  4YXM A;  5DQG A;  3G6Y A;  1H38 A;  2V9W A;  3GV5 B;  4YVZ A;  3PY8 A;  4X4T A;  5DBC A;  2ZH5 A;  4QZE A;  3MDC A;  5BPC A;  3TFS A;  1ZQA A;  3LQC B;  4ECS A;  1NKB A;  4ECQ A;  4DL5 A;  1BPD A;  4YCX A;  7ICQ A;  2XY5 A;  4M6W A;  1D8Y A;  4EZ9 A;  3C1Z A;  3THV A;  4TUP A;  1MQ2 A;  3RJG A;  2ZJ5 A;  4ELV A;  4KLT A;  4PHD A;  8ICV A;  1RPL A;  5KG1 A;  4I2A A;  5J2H A;  3V72 A;  4YP3 A;  2V4Q A;  4J9Q A;  4ECX A;  3RJE A;  4YR2 A;  2ATL A;  4M9J A;  2ZHB A;  5IIM A;  2PI4 A;  4KLO A;  7ICE A;  3JPO A;  2RDI A;  4TUR A;  4ED0 A;  3OUY A;  2BCS A;  5JUM A;  4GXK A;  4I2D A;  8ICG A;  1MIY A;  2Q66 A;  5J0R A;  4BXO A;  5KG7 A;  3K4G A;  9ICL A;  4DL3 A;  2AQ0 A;  3PW0 A;  3PW5 A;  3MGH A;  4X0B A;  2JEF A;  5DBA A;  1ZQZ A;  1QTM A;  1MIV A;  1CEZ A;  1UT8 A;  3GQC A;  4ECU A;  4DF8 A;  4KN7 A;  1A77 A;  4MF2 A;  2HHS A;  3ZDE A;  4XUS A;  1X2I A;  1ZQJ A;  4RQ5 A;  4UD4 A;  4EBD A;  3M8S A;  4DWI A;  1ZQP A;  3HWT A;  4YR3 A;  3GIL A;  5F9L A;  4BWM A;  5KFM A;  3SZ2 A;  2AQ4 A;  4B9N A;  7ICH A;  4UBB A;  4B9T A;  1BVS A;  1U49 A;  1SL0 A;  1JQR A;  3RB4 A;  2JEG A;  5KFY A;  3Q8L A;  1S0N A;  4Q44 A;  4EYH B;  2HVI A;  8ICP A;  3MGI A;  2JEJ A;  3OGU A;  4DSJ A;  3H37 A;  4EBE A;  4QZC A;  1ZYQ A;  2O1P A;  2ID1 A;  4X4N A;  2AGQ A;  4MEY A;  3M8R A;  1XSN A;  3C2L A;  1V4A A;  1ZQT A;  5DGB A;  4F4K A;  5KFD A;  3GII A;  1QSL A;  1KLN A;  1KNY A;  3V7L A;  4F2S A;  2FLL A;  2UVU A;  4WC1 A;  2VAN A;  5CA7 A;  4BXO B;  2Q0Z X;  5KFJ A;  3FYH A;  4IR9 A;  2HW3 A;  4FHX A;  4GC6 A;  4PPX A;  4M2Y A;  5KG4 A;  3MAB A;  9ICX A;  3H3A A;  3BDP A;  4RPZ A;  3GIM A;  4DSK A;  4UBC A;  9ICN A;  5KG3 A;  1S77 D;  1JMS A;  8ICB A;  1F5A A;  3HT3 A;  1XSL A;  4O3R A;  5HRE A;  5BOL A;  3M9O B;  1Z3E B;  1BNP A;  3H8J A;  4R8U A;  4TUS A;  3LWM A;  4BWJ A;  4UB5 A;  1D9D A;  4M9H A;  4DLG A;  4AT7 B;  3HW8 A;  5DGA A;  3N97 B;  1R8C A;  2IHN A;  4KLD A;  1DOQ A;  5KFE A;  9ICU A;  1TAU A;  1UEU A;  4RWQ A;  4J9M A;  1NKE A;  5KFV A;  3MFH A;  8ICS A;  4PHP A;  4IR1 A;  4QWD A;  2J6U A;  4I2I A;  2W9B B;  3Q8S B;  4HYK A;  4QWA A;  3UQ2 A;  3PW4 A;  3PW7 A;  1ZQO A;  4F4X A;  4I2F A;  3V6K A;  2LYH A;  5J2I A;  1ZQM A;  4E80 A;  2FMP A;  1SL1 A;  1UA1 A;  2R8J A;  3PMN A;  3ZD9 A;  8ICK A;  5J0Y A;  2H5X A;  1JX4 A;  4KIT B;  2AU0 A;  1TV9 A;  1KDH A;  9ICB A;  2PXI A;  4WBZ A;  7ICG A;  1R8B A;  7ICN A;  1UEV A;  3C5F A;  3WFQ E;  2JZB B;  5EWF A;  5J2B A;  4RUA A;  4UB4 A;  4F4Y A;  4DSE A;  4KLU A;  2UVW A;  8ICO A;  4EZ6 A;  1S97 A;  4J9R A;  3GIK A;  2BPG A;  2BPC A;  2P6R A;  2HHP A;  4Q43 A;  4RQ0 A;  2ZTD A;  5IIK A;  2C2D A;  5KG0 A;  4E7X A;  8ICE A;  4QZ8 A;  4DQQ A;  3Q8K A;  1IM4 A;  1NOM A;  1ZQV A;  5J0O A;  5J2G A;  1TK0 A;  8ICY A;  5IIL A;  2XY7 A;  3KHG A;  2HHU A;  1DK3 A;  4MF8 A;  4XRH A;  1KSP A;  2ZTC A;  4UAW A;  4I2G A;  5DB9 A;  1ZQW A;  4I28 A;  4IRC A;  4FHY A;  3BQ1 A;  4KLL A;  1NJZ A;  1DK2 A;  3WFP A;  4DO9 A;  4P4O A;  4JWN A;  1EXN A;  2KFZ A;  3HJ1 A;  4WC6 A;  1ZQQ A;  1ZQS A;  3PML A;  1RXV A;  2BCU A;  1DGS A;  5KFO A;  2R8G A;  4NLN A;  2ZH4 A;  4RU9 A;  3PV8 A;  4DQP A;  4YFK A;  5L1I A;  1U45 A;  5HHH A;  4QZI A;  4TQR A;  4YQW A;  3MR2 A;  7ICJ A;  1WCN A;  2W8L A;  3QZ8 A;  1MIW A;  3UXN A;  2ZH8 A;  1N48 A;  5HRD A;  5HRK A;  2FLN A;  3V7K A;  5KFW A;  4F8R A;  4O3P A;  4I2J A;  4TUQ A;  3KHR A;  4RWP A;  4ED7 A;  5DLF A;  9ICS A;  4UAZ A;  9ICC A;  4UB1 A;  3H40 A;  4JUZ A;  1JXE A;  5HRL A;  3JPS A;  2ZUD A;  5L1K A;  3B0Y A;  4IRD A;  4KLI A;  4X4S A;  3H39 A;  4IQU A;  2RDJ A;  4Z6E A;  2GWS A;  5KT2 A;  4WBY A;  4O0I A;  1NJW A;  5KT3 A;  5J0X A;  1XS9 D;  1NK0 A;  3GDX A;  1XSP A;  8ICF A;  5KG5 A;  1N56 A;  1SKR A;  5III A;  4GXI A;  4NM1 A;  7ICI A;  9ICI A;  2DVI A;  4GXJ A;  8ICX A;  5F2V O;  4RNM A;  1HUO A;  1QSS A;  3N4M B;  4R66 A;  4RWO A;  2ASL A;  1NK9 A;  5KG6 A;  5KT4 A;  3RB0 A;  2MAX A;  4M5D A;  2NRX A;  4RQ3 A;  4M0A A;  3JYY A;  4YR0 A;  5L1L A;  2ASJ A;  1U47 A;  5IIN A;  2FLP A;  4FO6 A;  4B9V A;  1JXL A;  4I2H A;  3OSN A;  4MFA A;  5DQI A;  3OJU A;  9ICJ A;  3V6H A;  1BPY A;  7ICT A;  5J2F A;  3SV4 A;  1BPZ A;  4NY8 A;  1SKS A;  1Q78 A;  2M2W A;  2DR7 A;  3EPG A;  1RYR A;  2W9A A;  2UVV A;  1ZQC A;  9ICH A;  2DRB A;  4NXZ A;  1U4B A;  1RXW A;  2XY6 A;  4RQ6 A;  1KRP A;  3PX0 A;  2KFN A;  2M9N A;  5KFR A;  3RJH A;  1TFR A;  4ELT A;  4MFF A;  1T4G A;  3C1Y A;  4RZR A;  8ICL A;  4IQW A;  4XQ7 A;  2HVH A;  1ZJN A;  4QZ9 A;  4RPY A;  3PX4 A;  5HRF A;  3TAR A;  3OVS A;  5IIO A;  1IXR A;  1VFG A;  4DFJ A;  2XGP A;  4Q8E A;  5DB8 A;  3QEB Z;  1V9P A;  5J0W A;  5EOZ A;  1NJY A;  3Q8P B;  2BQ3 A;  4JWM A;  4J9O A;  1S0V A;  2ISO A;  1XU4 A;  2ZH7 A;  4B9S A;  2BCQ A;  4QZG A;  3ISD A;  2BKE A;  5D4B A;  2W9M A;  4BGD A;  2OWO A;  4UB2 A;  1MSW D;  4DS4 A;  9ICF A;  5KT5 A;  5HRH A;  4EP7 A;  4WC3 A;  1VJ7 A;  4P4M A;  5DG8 A;  2IMW P;  1NK8 A;  1ZQX A;  2V4R A;  4KMU A;  3Q8M A;  4NM2 A;  3RAX A;  4RQ4 A;  3AQN A;  4FS1 A;  2PFO A;  2DPI A;  1Z00 A;  4J9L A;  3RH4 A;  4RPX A;  3NTU A;  4NLG A;  1WCL A;  2W9C B;  4R64 A;  3RBE A;  4ZH4 A;  3JPN A;  3OVB A;  4RUC A;  4C8O A;  4RNN A;  3BQ2 A;  1RYS A;  4X5V A;  4XQ8 A;  3UQ0 A;  4KTQ A;  5HML A;  5KFU A;  2HHX A;  3UPQ A;  3RR7 A;  4ATB A;  4YG2 A;  4ED2 A;  2ALZ A;  3WFS C;  3IHQ B;  5J0T A;  1BPX A;  3TAQ A;  5J0S A;  1SL2 A;  4QW9 A;  2R8I A;  2VA3 A;  4FBU A;  4I27 A;  2A1J B;  4F4Z A;  1ZQL A;  4BDP A;  2MUT B;  2W9B A;  1HJP A;  3T5H A;  4JV2 A;  1A76 A;  1L3S A;  4IG8 A;  3RTV A;  4YN4 A;  5DB7 A;  4KLH A;  2ZTE A;  5J2K A;  4AT8 B;  3EWA A;  3OJS A;  4JV1 A;  4M9N A;  5DBB A;  4NLZ A;  3ORY A;  4FH5 A;  4F4W A;  3GFK B;  9ICV A;  3C18 A;  8ICT A;  7ICM A;  3RJF A;  1ZET A;  5KFC A;  2JZB A;  5DDY A;  4X4R A;  2Y1J A;  4QZF A;  2BDP A;  4EBJ A;  2BPF A;  3HPO A;  1BNO A;  3ISC A;  4DQI A;  2DPJ A;  4J9K A;  3HP6 A;  4QW8 A;  3H4D A;  4I2C A;  9ICQ A;  3PO4 A;  1LV5 A;  5KFX A;  9ICR A;  1NJX A;  7ICS A;  5KFG A;  5HNK A;  5HC9 A;  1CUK A;  4O3O A;  9ICO A;  4F5R A;  1WOT A;  4DFP A;  1ARO P;  3AUO A;  1ZQU A;  1NK4 A;  4UAY A;  4QWE A;  4WC7 A;  1TFY A;  2I1Q A;  4M9L A;  3ZD8 A;  5EWE A;  4DQR A;  4K4H A;  4PHA A;  7ICV A;  3K75 D;  1ZQF A;  3OV7 A;  2MUT A;  5J0Q A;  2BHN A;  2NRV A;  3PNC A;  3KHH A;  2C2R A;  2DFL A;  4EYI B;  2C2E A;  4RT3 A;  3OHA A;  3T5L A;  1X9M A;  4QZD A;  1ZQR A;  5IIJ A;  3H7I A;  1L5U A;  2IHM A;  2ZH6 A;  4CCH A;  2HHV A;  2NRK A;  1NKC A;  4R63 A;  3H8S A;  8ICJ A;  3NGD A;  1B43 A;  2F1H A;  4IRK A;  5KG2 A;  4RWN A;  3JPT A;  1NZP A;  1NO5 A;  4Z6D A;  2XCA A;  3EYZ A;  5KFZ A;  2F1I A;  3OSP A;  5BOM A;  2HHW A;  3ZDB A;  5KFN A;  4O5C A;  2C22 A;  3PW2 A;  3PX6 A;  4ECZ A;  4X4V A;  4DL4 A;  4B9L A;  3EW9 A;  5KFA A;  5DLG A;  2ASD A;  2KZ3 A;  2NRW A;  3M9M B;  2HHT A;  2ISP A;  3HIY A;  4X4Q A;  4DL2 A;  5KFQ A;  1BGX T;  4ED1 A;  4C8N A;  2KTQ A;  3G6V A;  5HHI A;  5HRB A;  5D46 A;  5DQH A;  3MR6 A;  2IA6 A;  3JZ0 A;  5HMM A;  3RB3 A;  1RZT A;  3T5K A;  2W8K A;  4JV0 A;  1UA0 A;  5D49 A;  3MDA A;  4KLQ A;  2HHQ A;  4C8K A;  3FDS A;  5L9X A;  4UB3 A;  4FS2 A;  1U48 A;  4DS5 A;  5J2C A;  4F3O A;  8ICQ A;  9ICW A;  1MC8 A;  4F93 B;  5DDM A;  4KLS A;  4LZD A;  5J2D A;  3RRH A;  2KZZ A;  1B22 A;  5KFS A;  4DL6 A;  1T8E A;  3UPS A;  4ECW A;  9ICT A;  2PFN A;  2AJQ A;  4ED6 A;  5DG9 A;  3AU2 A;  4KLJ A;  4ECY A;  8ICN A;  2KP7 A;  3H38 A;  9ICK A;  1TK8 A;  4E0D A;  4XA5 A;  3Q8R B;  2DRA A;  5EWG A;  8ICI A;  3SV3 A;  4DL7 A;  3PR5 B;  4F5Q A;  4F92 B;  5CJ7 A;  1JIH A;  5J2J A;  1S76 D;  1ZQG A;  3ZDD A;  3TI0 A;  4O3Q A;  4X4O A;  3AQM A;  5CR0 A;  1ZQD A;  4G3I A;  3MBY A;  4IQT A;  3B0X A;  1ZQY A;  4Z6F A;  3KHL A;  3RJI A;  9ICG A;  4WC2 A;  2B21 A;  4YMN A;  4F5N A;  1OU5 A;  3HJ4 A;  2ZJ8 A;  9ICA A;  8ICA A;  3QEA Z;  4O3S A;  4M6W B;  1XWL A;  1PZN A;  2R8H A;  4LT6 A;  3LK9 A;  4F5P A;  8ICC A;  4YMO A;  2FPK A;  1C7Y A;  3JPP A;  3EPI A;  3T5J A;  4FH3 A;  2FPL A;  4QZH A;  3C21 A;  4I2E A;  1R8A A;  5HRG A;  2KZM A;  5DKW A;  2JEI A;  5J2A A;  4GC7 A;  3OHB A;  4DLE A;  1XO1 A;  5F9N A;  5DG7 A;  3RRG A;  2IBK A;  4NKT A;  2BCR A;  4WC5 A;  2M2U A;  7ICL A;  4F50 A;  1BPB A;  4PHE A;  1L3T A;  2O5A A;  2ZH3 A;  1ZJM A;  4C8L A;  5L1J A;  4ECV A;  3RH5 A;  1JN3 A;  3TAN A;  1Y88 A;  4PGX A;  1U9L A;  4EEY A;  8ICH A;  4EBK A;  7ICF A;  1D9F A;  4YXJ A;  3BQT A;  4RQ1 A;  4QWC A;  3Q8Q B;  2XGQ A;  2W9C A;  3V7J A;  7ICR A;  1K1Q A;  3WFO A;  2ZUC A;  3C23 A;  3RJK A;  5KFP A;  2KN7 A;  3IM1 A;  4Q45 A;  3V6J A;  1NK7 A;  2P6U A;  5J2E A;  3C2K A;  2I9G A;  1LB2 B;  3WFR E;  2NRT A;  4J9P A;  4DOB A;  4O5E A;  1Z00 B;  3H4B A;  2VA2 A;  2FMS A;  4NKU A;  5KFL A;  1TAQ A;  4LZG A;  4X4P A;  4PH5 A;  5DEC A;  4MEX A;  7ICK A;  3C5G A;  5KFK A;  2A1J A;  3RBD A;  2FMQ A;  3HX0 A;  1XC9 A;  4YMM A;  1X9W A;  3GIJ A;  2BQR A;  8ICM A;  4C8M A;  1NK5 A;  3RR8 A;  2PBE A;  3E2E A;  1S9F A;  1TFW A;  5CP2 A;  4RT2 A;  5KFF A;  1QSY A;  2AGP A;  1S0O A;  4KLM A;  9ICE A;  2ZH2 A;  2R8K A;  2AGO A;  2ZH9 A;  5KTQ A;  4K4I A;  4ED8 A;  4KLG A;  4I29 A;  3TAP A;  3L9D A;  7ICO A;  4WCW A;  7ICU A;  7ICP A;  3T3F A;  5TZV A;  5CHG A;  4DSI A;  2M2T A;  4AT9 B;  4DOA A;  1MQ3 A;  3ISB A;  3C2M A;  4DQS A;  4KLF A;  5HRI A;  4F5O A;  2BGW A;  3AQL A;  4F91 B;  3C66 A;  1X9S A;  4QZA A;  1NK6 A;  2BR0 A;  9ICM A;  1HUZ A;  4AT7 A;  1KEJ A;  4I2B A;  2WTF A;  3AQK A;  2VA8 A;  5KFI A; 
#chains in the Genus database with same CATH topology
 1GPJ A;  3RJJ A;  4WC0 A;  1TKD A;  3BZC A;  3LDA A;  5KFH A;  4RQ2 A;  3IDW A;  4PZN A;  3KTQ A;  1PUZ A;  4F71 A;  3AU6 A;  5ALZ A;  3F2C A;  1L3U A;  3OPX A;  2F1J A;  4S3N A;  3WK5 A;  3CNH A;  2BE3 A;  4UAU A;  2Y9U A;  1UQV A;  2OM6 A;  4YD1 A;  4FHV A;  3ZDA A;  1XNS A;  1KFS A;  1VLB A;  4Z6C A;  1ZQB A;  5J0P A;  3IV6 A;  1L7P A;  4MFC A;  1S10 A;  2J6T A;  4ATB B;  4DSF A;  3RAQ A;  4RQ7 A;  4UQG A;  1UET A;  1ZQK A;  2K8A A;  5KFB A;  1DXS A;  4FBT A;  4NLC A;  5AKG A;  4C7Z A;  1J97 A;  4DFK A;  2CXY A;  3TFR A;  1B0X A;  2Y1I A;  1T94 A;  1YLQ A;  2DR5 A;  4CDG A;  4DF4 A;  3QUC A;  3QU2 A;  5DB6 A;  1ED1 A;  5ALM A;  4B9U A;  2NRZ A;  4O9M A;  1ZQI A;  2F3N A;  4PGQ A;  4ECT A;  1KKX A;  4X0A A;  2XC9 A;  5HP4 A;  3L5K A;  4P4P A;  2YN4 A;  4E8F A;  4YXM A;  2WF7 A;  5ALW A;  2V9W A;  5AI4 A;  2Y0S F;  2WAQ F;  3MDC A;  2KK0 A;  1ZQA A;  4ECS A;  3DV9 A;  2XY5 A;  4ELV A;  2KVC A;  4PHD A;  1NI3 A;  4YP3 A;  4YR2 A;  5IIM A;  7ICE A;  4KLO A;  4BJQ A;  2K4I A;  4ED0 A;  2BCS A;  8ICG A;  5J0R A;  9ICL A;  2AQ0 A;  3PW0 A;  1Q8K A;  3MGH A;  4LJX A;  1ZQZ A;  1MIV A;  2KJ9 A;  1UT8 A;  1N5W A;  3GQC A;  4DF8 A;  4UD4 A;  3ZDE A;  3SAG A;  2G5I B;  3HJE A;  1ZQJ A;  5AKI A;  3M8S A;  1SXE A;  4PPX A;  5AIA A;  4BWM A;  5KFY A;  5A0L A;  4DSJ A;  3H37 A;  4MEY A;  3C2L A;  1V4A A;  5KFD A;  1K5O A;  2H3Z A;  5CA7 A;  5EE3 A;  1ECW A;  2EH9 A;  3SQI A;  3GIM A;  1S77 D;  3LVV A;  2RHF A;  3H8J A;  1D9D A;  3LWM A;  4UB5 A;  2ZIX A;  2D3D A;  2HCF A;  4RWQ A;  2W7O A;  8ICS A;  3QNM A;  4QWD A;  3RF9 A;  3Q8S B;  1XO0 A;  4I2F A;  4O69 A;  1ZQO A;  2LYH A;  1ZQM A;  5J0Y A;  4ICA A;  1KDH A;  2JH7 A;  1GO3 F;  7ICG A;  1UEV A;  3C5F A;  5EWF A;  4RUA A;  1NZB A;  4EZ6 A;  1WWU A;  4MHV A;  4Q43 A;  3A0H U;  1PVP A;  2HHU A;  4I2G A;  5AM4 A;  4FHY A;  3BQ1 A;  1DK2 A;  1NJZ A;  2K89 A;  4JWN A;  5EE1 A;  2KFZ A;  5KFO A;  3PV8 A;  4YFK A;  1N5X A;  3MR2 A;  3VC8 A;  5HRD A;  2FLN A;  3V7K A;  2FJ6 A;  1ZD5 A;  2KKP A;  1ZD3 A;  5K4L A;  2LM1 A;  4TUQ A;  4OJP A;  9ICS A;  2WFA A;  3H40 A;  4JUZ A;  5HRL A;  4X4S A;  4EV6 A;  4IQU A;  5J0X A;  3NVO A;  5CFS A;  3NS1 A;  4GXJ A;  3AQE A;  8ICX A;  4RNM A;  1N60 A;  3N4M B;  2ASL A;  2OXO A;  3RB0 A;  3I28 A;  4M5D A;  2NRX A;  1U47 A;  5L1L A;  4FO6 A;  2GOL A;  1L6N A;  3QU9 A;  2E3T A;  9ICJ A;  5T14 A;  5J2F A;  1BPZ A;  3MGV A;  5AK5 A;  3EPG A;  1RYR A;  1ZQC A;  4NXZ A;  3PST A;  1RXW A;  3RJH A;  5KFR A;  1TFR A;  4ELT A;  1FO4 A;  1T4G A;  4RZR A;  2XVT A;  5ALN A;  2KE7 A;  5J8Y A;  4RPY A;  1IXR A;  3QUB A;  3F2B A;  2JV3 A;  5ALQ A;  2RQ5 A;  2DF4 B;  1YZ7 A;  3UM9 A;  3WKE A;  4B9S A;  2WB1 C;  2W9M A;  5HRH A;  4UB2 A;  4DS4 A;  4WC3 A;  2K4P A;  2V4R A;  1L7M A;  3O0F A;  5KL1 B;  3AQN A;  4RQ4 A;  2DPI A;  1Z00 A;  4J9L A;  3RH4 A;  4NLG A;  1WCL A;  3RBE A;  4C8O A;  4X5V A;  3UQ0 A;  5KFU A;  3UPQ A;  4YG2 A;  5JTI A;  4QW9 A;  4I27 A;  2JH1 A;  2W9B A;  3T5H A;  4NJ8 A;  3RTV A;  5DB7 A;  2DBY A;  4KLH A;  2BZF A;  3EWA A;  4M9N A;  4FH5 A;  3GFK B;  4OD0 A;  8ICT A;  1FEZ A;  2E1F A;  4UAV A;  4RQN A;  4PL2 A;  2BPF A;  4J9K A;  1T3Q A;  9ICQ A;  1NNL A;  1KBU A;  5KFX A;  1NJX A;  5KFG A;  3C29 A;  4JLX A;  3AUO A;  1NK4 A;  2I5H A;  2YQE A;  1KW4 A;  2I1Q A;  5C0Y A;  3K75 D;  1ZQF A;  3KHH A;  4EYI B;  2AH5 A;  1PK1 B;  2KJ5 A;  4RT3 A;  2HHQ A;  1L5U A;  3H7I A;  1O08 A;  4P0P A;  1NKC A;  8ICJ A;  3NGD A;  2F1H A;  5AK6 A;  1NZP A;  1RDF A;  3JPT A;  1NO5 A;  2XCA A;  2FCL A;  2YX8 A;  5KFZ A;  3ZI4 A;  3EW9 A;  5KFA A;  4X4Q A;  4DL2 A;  4ED1 A;  4C8N A;  2KTQ A;  2IA6 A;  2W8K A;  5D49 A;  4F3O A;  2N1R A;  2NYV A;  4KLS A;  2KZZ A;  5ALI A;  4K9A A;  9ICT A;  2AJQ A;  2KP7 A;  2H3F A;  1TK8 A;  2DRA A;  5EWG A;  1CRX A;  3PR5 B;  3FAH A;  3QUQ A;  3F2D A;  3RJI A;  3KHL A;  3HJ4 A;  9ICA A;  4O3S A;  4M6W B;  1PZN A;  4C4T A;  5AKK A;  2R8H A;  4LT6 A;  4YMO A;  1C7Y A;  4QZH A;  2JEI A;  5J2A A;  4GC7 A;  4NKT A;  1LKY B;  2IBK A;  2M2U A;  7ICL A;  4PHE A;  2W3R A;  1ZJM A;  4C8L A;  5L1J A;  3IP4 B;  4PGX A;  1U9L A;  4OJO A;  4EBK A;  2CPR A;  4YXJ A;  3BQT A;  2R18 A;  5HR7 A;  7ICR A;  2ZUC A;  3RJK A;  5KFP A;  2KN7 A;  2P6U A;  5J2E A;  2ZIW B;  1Z00 B;  3H4B A;  2FMS A;  4NKU A;  5KFL A;  2E1E A;  2LBO A;  3C5G A;  5KFK A;  3CYM A;  2FMQ A;  3RR8 A;  4CNQ A;  2PBE A;  2LKY A;  2F8L A;  5CP2 A;  3DDH A;  4FZL A;  1S0O A;  2AGO A;  2GO7 A;  4K4I A;  4WCW A;  3U26 A;  7ICU A;  1QQ7 A;  3ISB A;  2FI1 A;  5HRI A;  1X9S A;  1NK6 A;  1UPH A;  4CF4 A;  9ICM A;  1HUZ A;  2WTF A;  1D8B A;  3AQK A;  5KFI A;  3WKB A;  1BPE A;  4EBC A;  3HRD D;  4R8U B;  2BCV A;  1KFD A;  1Q3U A;  3PHZ A;  4EX7 A;  4RNO A;  3MFI A;  4FHP A;  1QCK A;  3LWL A;  1ZQE A;  4TQS A;  1ZQN A;  4Y2P A;  2DKX A;  4O5K A;  2RFF A;  2FE9 A;  3RB6 A;  1UT5 A;  2ZHA A;  3QZ7 A;  3NWI A;  3JPR A;  3PR4 A;  8ICW A;  1FA0 A;  5KFT A;  2ESE A;  1S0M A;  1SB3 C;  4GLX A;  3SR6 A;  4DSL A;  3B9J A;  4P0Q B;  1PVQ A;  1QLN A;  4DFM A;  1T7P A;  4U6P A;  3UXO A;  3GV7 B;  4WC4 A;  1JRP A;  3KD3 A;  3WK9 A;  3OWG A;  5ALG A;  4B9M A;  4Y2Q A;  4AT8 A;  5CB1 A;  5CWR A;  3PVX A;  3WK6 A;  2BQU A;  2UVR A;  2Q4T A;  3EZ5 A;  4P2H A;  5J0U A;  5CEH A;  5AKX A;  2H3V A;  1ZD4 A;  4QWB A;  8ICZ A;  2XCP A;  3MR5 A;  4NLK A;  4K4G A;  2DR8 A;  4LEY A;  5C5J A;  4RQ8 A;  5DQG A;  3L4P A;  4X4T A;  4QZE A;  1BPD A;  2QLT A;  4YCX A;  4O67 A;  3C1Z A;  1MQ2 A;  2ZJ5 A;  4GIB A;  4UB6 U;  4DFD A;  3GZF A;  2ZIU A;  3V72 A;  2W3S A;  2ZXI A;  2V4Q A;  4J9Q A;  3RJE A;  4WQL A;  4M9J A;  4K98 A;  2PI4 A;  2FDR A;  3OUY A;  1TE2 A;  4I2D A;  2Q66 A;  2XIC A;  3PW5 A;  2JEF A;  5DBA A;  1QTM A;  1CEZ A;  1J2N A;  4ECU A;  4KN7 A;  1QH9 A;  1X2I A;  4EBD A;  4DWI A;  4KMO B;  2H3I A;  3HWT A;  3GIL A;  3SZ2 A;  3K7D A;  3AMZ A;  4OAG A;  1SL0 A;  3RB4 A;  3I1Y A;  1S0N A;  4Q44 A;  4UAS A;  3MGI A;  2NV3 A;  3E58 A;  3N28 A;  2GAF D;  2HSZ A;  1XSN A;  3HIL A;  1ZQT A;  1KLN A;  4WC1 A;  2UVU A;  4FHX A;  2Q0Z X;  5KFJ A;  2K8B B;  4M2Y A;  4P0P B;  3BQ7 A;  3H3A A;  1RQN A;  1JMS A;  5ALR A;  8ICB A;  4FE3 A;  3HT3 A;  5HRE A;  5BOL A;  5B3P A;  4TUS A;  4BWJ A;  4N7R A;  4DLG A;  1R8C A;  3N97 B;  2WB1 F;  4KLD A;  5ALK A;  3ERC C;  4J9M A;  3MFH A;  5H2F U;  1P7D A;  4HYK A;  3PW7 A;  4F4X A;  4E80 A;  3V6K A;  5D63 A;  2KMD A;  1SL1 A;  3PMN A;  2H5X A;  5JTG A;  2EZZ A;  1TV9 A;  5AHX A;  1OXJ A;  2PXI A;  2K4H A;  1R8B A;  4EEN A;  5EE9 A;  4F4Y A;  1SWW A;  2UVW A;  2B4V A;  2BPG A;  2BPC A;  3KKA A;  2ZTD A;  5IIK A;  2C2D A;  3K1Z A;  5KG0 A;  2JR5 A;  4DQQ A;  3GU3 A;  4QIW F;  3TKA A;  1SXD A;  1ZQV A;  2LM4 A;  2WF6 A;  4XRH A;  5F3X B;  1SV0 A;  4IRC A;  4DO9 A;  4NWI A;  5AKZ A;  2WHE A;  3HJ1 A;  4WC6 A;  1ZQS A;  2R8G A;  4DQP A;  4QZI A;  7ICJ A;  1WCN A;  2W8L A;  3QZ8 A;  1N48 A;  4F8R A;  5KFW A;  4OJ5 A;  4ED7 A;  1RM6 C;  5DLF A;  2W54 A;  5ALX A;  1TFW A;  2ZUD A;  4KLI A;  5ALY A;  2QAR B;  3H39 A;  2B6G A;  4Z6E A;  3M6Z A;  3RFA A;  5KL8 B;  1XS9 D;  2E8M A;  1SKR A;  5III A;  4GXI A;  4NM1 A;  4NXX A;  2JRZ A;  2QB1 A;  4QNL A;  1HUO A;  4JLZ A;  1QQ5 A;  5KT4 A;  2MAX A;  1V38 A;  4RQ3 A;  4M0A A;  2JMG A;  4USA A;  4PL1 A;  1YZ6 A;  4C4S A;  7ICT A;  3SV4 A;  4NLB A;  1SKS A;  2M2W A;  1COK A;  1KL9 A;  9ICH A;  1U4B A;  4RQ6 A;  1F5S A;  1HIW A;  3D6J A;  3TAR A;  3OVS A;  1VFG A;  2XGP A;  4CRX A;  1V9P A;  4KX3 A;  1ZRN A;  2E8P A;  2BQ3 A;  1F0M A;  2P35 A;  2KEY A;  4QZG A;  2WAQ C;  2BKE A;  5D4B A;  4PJ0 U;  1VJ7 A;  3NVW A;  5JU5 A;  1DRG A;  3Q8M A;  5AKL A;  3RAX A;  4FS1 A;  1Z1B A;  3JPN A;  4RUC A;  1RYS A;  2HDO A;  2JGA A;  5HML A;  2HHX A;  4ATB A;  2ALZ A;  3WFS C;  3IHQ B;  2B0C A;  1BPX A;  3TAQ A;  5J0S A;  4F4Z A;  3HKZ C;  5ALJ A;  1A76 A;  4IG8 A;  4YN4 A;  3AEV A;  3WKC A;  3A0B U;  3SAF A;  4AT8 B;  3C28 A;  3ORY A;  3PSF A;  1V85 A;  3QX7 A;  4X4R A;  4EBJ A;  5AKE A;  4K97 A;  2DPJ A;  5HC9 A;  5HNK A;  5ALD A;  1ARO P;  4KB6 A;  3FC4 A;  4QWE A;  2HBK A;  3NUQ A;  1KQQ A;  1TFY A;  2AHO B;  2EAN A;  4M9L A;  5ALO A;  7ICV A;  3OV7 A;  2MUT A;  2DFL A;  4NV0 A;  3EUB 2;  2IHM A;  7ICS A;  3QYP A;  1S5L U;  5IIJ A;  2ZH6 A;  2NRK A;  4IRK A;  4Z6D A;  3QU4 A;  5BOM A;  2HHW A;  3PW2 A;  3PX6 A;  4DL4 A;  2ASD A;  1Q3V A;  5DLG A;  2HHT A;  4I0U A;  3M9M B;  5KFQ A;  2RP5 A;  3G6V A;  3JZ0 A;  1RZT A;  3T5K A;  4Y2J A;  1RQL A;  1U48 A;  4FS2 A;  4DS5 A;  1B22 A;  1MC8 A;  4LZD A;  4DL6 A;  2PFN A;  1LKY A;  2A3V A;  3KKA C;  1M6Y A;  4XA5 A;  3SV3 A;  3EF2 A;  4F92 B;  4WOY A;  2EZY A;  1ZQG A;  2F44 A;  3TI0 A;  1ZQD A;  4US9 A;  3MBY A;  3B0X A;  4Z6F A;  4WC2 A;  4YMN A;  1OU5 A;  2O6K A;  1XWL A;  3IN5 A;  2IOF A;  2IOH A;  2PMZ F;  2FPK A;  2G0A A;  4LEW A;  3JPP A;  5KAI U;  1R8A A;  5CFT A;  3OHB A;  1XO1 A;  5F9N A;  4Y2V A;  3R9K A;  4OAF A;  3RH5 A;  1JN3 A;  4CF3 A;  5TIS U;  3TAD C;  4QWC A;  2XGQ A;  3AL0 B;  1SWV A;  2HOI A;  1K1Q A;  3IM1 A;  3V6J A;  1NK7 A;  2I9G A;  5AK3 A;  3C2K A;  3WFR E;  2NRT A;  4O5E A;  2B51 A;  4PH5 A;  7ICK A;  2KIW A;  2A1J A;  3FM9 A;  3GIJ A;  2BQR A;  1NK5 A;  2MA1 A;  2BBH A;  5L1M A;  1IIP A;  3WK7 A;  4J03 A;  2ZH2 A;  9ICE A;  3N7P D;  2R8K A;  5KTQ A;  4KLG A;  3DEE A;  5ALU A;  3TAP A;  3L9D A;  5TZV A;  1X42 A;  5CHG A;  3AQL A;  3CRX A;  4F5O A;  3KZI U;  3SEI A;  4QZA A;  1Q46 A;  2XID A;  3J81 j;  3WKA A;  2BR0 A;  5ALF A;  3F5A A;  1SKW A;  4Q8F A;  2PFP A;  3KOO A;  3VCB A;  3QE9 Y;  9ICP A;  2PI5 A;  4OAI Z;  3BQ0 A;  5ALT A;  1URJ A;  1COO A;  2FPM A;  1K1S A;  3ZDC A;  5AM1 A;  3AQF A;  8ICU A;  4LVS A;  3WK4 A;  1T3N A;  1SV4 A;  2HBL A;  1D8L A;  4M47 A;  1X9X A;  1TK5 A;  1Z4N A;  4Y2R A;  5DED A;  3MCR A;  3ETL A;  1Q79 A;  4JMU A;  1JAJ A;  1ZXI A;  3ICX A;  3PO5 A;  2PFQ A;  1TVA A;  4J9N A;  1VDV A;  3ER9 B;  2G5H B;  5AKY A;  4Y2X A;  4M04 A;  3GV8 B;  2ZIU B;  3OVA A;  2KHV A;  4MKP A;  3OUY B;  2ZH1 A;  4O3N A;  4Y2U A;  5CRX A;  2P66 A;  4IQV A;  4PGY A;  2YTU A;  3GV5 B;  2OEH A;  3WU2 U;  5DBC A;  5BPC A;  3IRU A;  4AYB C;  3LQC B;  1NKB A;  4ECQ A;  3NVZ A;  1D8Y A;  2VJ4 A;  4M6W A;  1PK1 A;  3THV A;  3L3F X;  2YMQ A;  4CGZ A;  4KM5 A;  4I2A A;  4WJ3 B;  2ZHB A;  1OW5 A;  2ATL A;  3JPO A;  2RDI A;  2LYB A;  5JUM A;  4QIW C;  1QQ6 A;  3K4G A;  4DL3 A;  1X40 A;  4DCC A;  1A77 A;  3LVW A;  4RQ5 A;  2MSN A;  4B9N A;  2AQ4 A;  4EEK A;  1SIJ A;  5KFM A;  7ICH A;  1U49 A;  2JEG A;  2F2A B;  3Q8L A;  4EYH B;  8ICP A;  1Z19 A;  1ZYQ A;  1SGG A;  2YMM A;  3M8R A;  3WK8 A;  4F4K A;  1FFV A;  3GII A;  1QSL A;  3V7L A;  2FLL A;  3LYS A;  2G09 A;  4IR9 A;  4IC9 A;  2HW3 A;  3IG5 A;  4GC6 A;  3H0R B;  4QJF B;  3MAB A;  9ICX A;  2EQY A;  3BDP A;  4RPZ A;  4UBC A;  5KG3 A;  2QB0 A;  4K99 A;  5ALS A;  3M9O B;  4AT7 B;  3HW8 A;  5DGA A;  4OO1 J;  1DOQ A;  2ZXH A;  5KFV A;  1O03 A;  4IR1 A;  2J6U A;  4I2I A;  1N61 A;  4QWA A;  2KVS A;  5J2I A;  2FMP A;  1UA1 A;  2R8J A;  4FFD A;  5AKH A;  3ZD9 A;  4K8V A;  9ICB A;  5G5G A;  7ICN A;  3WFQ E;  2JZB B;  4UB4 A;  4DSE A;  4NL9 C;  4J9R A;  5G5H A;  3GIK A;  3D2Q A;  2P6R A;  4RQ0 A;  1X6J A;  2EDU A;  2ZIX B;  4QZ8 A;  3Q8K A;  4FZM A;  1NOM A;  4KX5 A;  5AI6 A;  1TK0 A;  8ICY A;  5IIL A;  3KHG A;  2CRX A;  4MF8 A;  2ZTC A;  3T79 A;  3ALR A;  2OH2 A;  3PML A;  3QXG A;  1RXV A;  2BCU A;  4NLN A;  1C20 A;  3M1Y A;  5HHH A;  4TQR A;  1MIW A;  1V97 A;  2ZH8 A;  2EWR A;  3KHR A;  3NRZ A;  9ICC A;  4UB1 A;  3JPS A;  2RRD A;  4Y2T A;  4IRD A;  1ZD2 P;  2RDJ A;  2GWS A;  4O0I A;  1NJW A;  1NK0 A;  1XSP A;  5KG5 A;  7ICI A;  2K60 A;  3KZX A;  5F2V O;  1QSS A;  4R66 A;  1NK9 A;  5KG6 A;  2A1A A;  4YR0 A;  5AI0 A;  5IIN A;  2FLP A;  4I2H A;  4FO1 A;  3CP8 A;  5AM5 A;  4MFA A;  2W04 A;  3V6H A;  1BPY A;  1Q78 A;  2WF9 A;  3PSP A;  1DGJ A;  2UVV A;  4CF5 A;  2DRB A;  1KRP A;  4LEV A;  3PX0 A;  2KFN A;  4K96 A;  2M9N A;  2ES6 A;  8ICL A;  4IQW A;  5AIC A;  2W11 A;  4XQ7 A;  1ZJN A;  4QZ9 A;  5HRF A;  5IIO A;  4US8 A;  4Q8E A;  3E0F A;  3QEB Z;  2F76 X;  2JHD A;  5EOZ A;  1NJY A;  1S0V A;  4JWM A;  1VJ5 A;  3JCF A;  1XU4 A;  2ZH7 A;  2KNJ A;  1MSW D;  9ICF A;  4BGD A;  2OWO A;  4AYB F;  4P4M A;  1S8O A;  5DG8 A;  1WYG A;  1NK8 A;  1ZQX A;  2ZIW A;  4NM2 A;  4U7C A;  4RPX A;  1FIQ A;  3NTU A;  5ALP A;  4R64 A;  4ZH4 A;  2KG5 A;  4RNN A;  3NVV A;  4XQ8 A;  5ALH A;  2BDU A;  4Y2Y A;  2IOF K;  3PSI A;  1CI4 A;  2VA3 A;  2R8I A;  4FBU A;  1ZQL A;  4JV2 A;  1HJP A;  2KIV A;  2KHQ A;  1PK3 A;  4JB3 A;  4JV1 A;  5DBB A;  4F4W A;  7ICM A;  5GTH U;  2E8N A;  3RJF A;  2Y1J A;  4QZF A;  1ZRM A;  2BDP A;  3IG8 A;  3HPO A;  3HP6 A;  4QW8 A;  5B5E U;  1IV8 A;  3N7S C;  1LV5 A;  3SD7 A;  9ICO A;  1WOT A;  4F5R A;  4DFP A;  2HMX A;  2WF8 A;  1ZQU A;  2DQN B;  5HR6 A;  2OCE A;  4O6A A;  4EEL A;  4WC7 A;  5EWE A;  4K4H A;  4EED A;  2BHN A;  3PNC A;  2C2R A;  2W03 A;  3K1R B;  2C2E A;  1MA7 A;  3T5L A;  1X9M A;  1ZQR A;  4C0Z A;  4GFJ A;  2KOB A;  3H8S A;  3EYZ A;  1Z4O A;  3OSP A;  3ZDB A;  5KFN A;  4O5C A;  5D62 A;  2YML A;  2C22 A;  4X4V A;  3CK6 A;  2KZ3 A;  2NRW A;  3HIY A;  3QU5 A;  2YMP A;  3MR6 A;  4JV0 A;  3TAD A;  1UA0 A;  5ALE A;  4KLQ A;  4C8K A;  5L9X A;  3WFO A;  8ICQ A;  4F93 B;  5DDM A;  3RRH A;  2NO4 A;  2E8O A;  2YB1 A;  5KFS A;  1T8E A;  4ECW A;  3NKU A;  3UMG A;  2LHT A;  3AU2 A;  4KLJ A;  4ECY A;  1ZQ1 C;  8ICN A;  9ICK A;  2JXJ A;  3Q8R B;  4DL7 A;  3BS5 A;  1JIH A;  1S76 D;  4X4O A;  2LYA A;  5CR0 A;  2RLT A;  2DL0 A;  5GTI U;  4IQT A;  5FP0 A;  9ICG A;  2B21 A;  4F5N A;  2ZJ8 A;  8ICA A;  3QEA Z;  3LK9 A;  3T5J A;  2NO5 A;  5HRG A;  2HOQ A;  2KZM A;  3KBB A;  4WC5 A;  4F50 A;  1L3T A;  2ZH3 A;  4OJ6 A;  4ECV A;  3TAN A;  3UMC A;  8ICH A;  4UB8 U;  3WKD A;  7ICF A;  2EAM A;  3NVY A;  2QAR A;  2KKV A;  4DOB A;  2KV2 A;  3UMB A;  1TAQ A;  4X4P A;  4MEX A;  3PZP A;  1XC9 A;  8ICM A;  2A19 A;  4C8M A;  2GH1 A;  1S9F A;  5CFU A;  1QSY A;  4KLM A;  2ZH9 A;  4I29 A;  7ICO A;  5B66 U;  3H0L B;  3T3F A;  4DSI A;  1MQ3 A;  1L7N A;  4DQS A;  3C2M A;  4KLF A;  5D61 A;  2BGW A;  4F91 B;  4P0Q A;  2Z7J A;  5AM3 A;  4AT7 A;  1KEJ A;  4I2B A;  2E5S A;  5CHE A;  2DUY A;  3ER8 C;  4DEZ A;  1JI7 A;  4ECR A;  3M9N B;  2LPE A;  4ELU A;  2IUB A;  4UD5 A;  2EAP A;  1ZQH A;  4HX0 A;  3SI8 A;  3RH6 A;  2C28 A;  4FHW A;  1SZP A;  2GLE A;  4KN4 A;  3TQ1 A;  4JK1 A;  3NRW A;  1YT3 A;  4AT9 A;  3UXP A;  4OAH A;  1L7O A;  2CN1 A;  2J6S A;  2VKQ A;  1WG8 A;  2M2V A;  4DOC A;  4IL6 U;  4M9G A;  5KT6 A;  3JPQ A;  4KLE A;  1A6S A;  4EEB A;  3I76 A;  3NYB A;  4Y2S A;  5AI8 A;  4NXT A;  2ZUB A;  1R89 A;  4X4U A;  2YY6 A;  3G6X A;  4EGW A;  5AM0 A;  3H8W A;  2XO7 A;  1KFT A;  4ED3 A;  3SYZ A;  2D6F C;  1HEK A;  4IS7 A;  4F2R A;  3MR3 A;  4J9S A;  5HR9 A;  3ED5 A;  4WH5 A;  4QZB A;  1N62 A;  4YD2 A;  4R65 A;  1LVH A;  8ICR A;  3BS5 B;  2ZJA A;  4C7Y A;  3BJY A;  1PX5 A;  2W55 A;  2DR9 A;  1L3V A;  5J29 A;  5KT7 A;  1KTQ A;  1H38 A;  3G6Y A;  3PY8 A;  4YVZ A;  2ZH5 A;  4O3M A;  2KSO B;  3TFS A;  4DL5 A;  7ICQ A;  2VJ5 A;  2W43 A;  4EZ9 A;  4TUP A;  3RJG A;  3AN1 A;  4KLT A;  8ICV A;  2LI6 A;  1RPL A;  5KG1 A;  5J2H A;  4OJL A;  1SZH A;  3NAS A;  2PKE A;  4NL9 A;  4ECX A;  2HBM A;  3D2N A;  4TUR A;  4GXK A;  1MIY A;  4BXO A;  2D8C A;  5KG7 A;  4X0B A;  1JRO A;  3AM9 A;  3TAC B;  2HHS A;  4MF2 A;  4XUS A;  2G06 A;  1ZQP A;  4YR3 A;  5F9L A;  4UBB A;  4B9T A;  1BVS A;  5AK4 A;  1JQR A;  4ZOH C;  2HVI A;  2JEJ A;  3OGU A;  3BZK A;  4EBE A;  4BUG A;  4QZC A;  2O1P A;  4X4N A;  2ID1 A;  5E79 U;  2AGQ A;  4B6J A;  5DGB A;  4F72 A;  2OHF A;  2QKQ A;  1KNY A;  4F2S A;  2VAN A;  4BXO B;  4C80 A;  3FYH A;  2G08 A;  5KG4 A;  4WQK A;  4DSK A;  9ICN A;  3H8M A;  1F5A A;  1AQ6 A;  2WF5 A;  1XSL A;  4O3R A;  1Z3E B;  1BNP A;  4R8U A;  2W7P A;  4M9H A;  4NXW A;  2IHN A;  5KFE A;  2BBJ A;  9ICU A;  1TAU A;  3F53 A;  2B56 A;  1NKE A;  4PHP A;  5EE0 A;  1L8L A;  1F44 A;  2W9B B;  3UQ2 A;  3PW4 A;  2L5Y A;  3CW2 C;  3BS7 A;  8ICK A;  2K4E A;  1JX4 A;  4KIT B;  2AU0 A;  4WBZ A;  2HBJ A;  5J2B A;  1KN5 A;  1OUQ A;  4KLU A;  4ACO A;  8ICO A;  1S97 A;  5B3Q A;  2HHP A;  2MRL A;  8ICE A;  4E7X A;  1IM4 A;  5J0O A;  5J2G A;  2XY7 A;  1DK3 A;  5KAF U;  1KSP A;  1RG6 A;  4UAW A;  4I28 A;  5DB9 A;  1ZQW A;  5JRT A;  4KLL A;  1ZOL A;  3WFP A;  4P4O A;  4CE6 A;  1EXN A;  1ZQQ A;  2ZH4 A;  1DGS A;  4RU9 A;  2G07 A;  5L1I A;  1U45 A;  4YQW A;  3UXN A;  5HRK A;  4O3P A;  4I2J A;  4RWP A;  4UAZ A;  1N63 A;  1JXE A;  5L1K A;  3B0Y A;  4WBY A;  5KT2 A;  2ZG6 A;  5KT3 A;  3GDX A;  8ICF A;  1N56 A;  3SEN A;  4K9B A;  4HAI A;  9ICI A;  2DVI A;  3ETR A;  4RWO A;  3JYY A;  2ASJ A;  4B9V A;  1JXL A;  3OSN A;  5ALL A;  5DQI A;  3OJU A;  2GA9 D;  4NY8 A;  2DR7 A;  1L8O A;  5AIB A;  3M6K A;  2W9A A;  2EAO A;  2XY6 A;  4MFF A;  3C1Y A;  2HI0 A;  2HVH A;  4UW9 A;  3PX4 A;  4RQM A;  4OCZ A;  4DFJ A;  5DB8 A;  1UHU A;  5J0W A;  5ALV A;  3H0M B;  3Q8P B;  2VIX A;  4J9O A;  2ISO A;  2BCQ A;  2AXT U;  3ISD A;  5KT5 A;  4EP7 A;  4O68 A;  1N2X A;  2IMW P;  1SV0 C;  4KMU A;  3M7D A;  2PFO A;  2W9C B;  3HKZ F;  3OVB A;  2KSO A;  4KTQ A;  1WUD A;  3RR7 A;  4ED2 A;  5J0T A;  1SL2 A;  5AI5 A;  2A1J B;  3MC1 A;  4BDP A;  2MUT B;  1L3S A;  1B4F A;  3S6J A;  2ZTE A;  5J2K A;  2M0N A;  3OJS A;  4NLZ A;  3C18 A;  9ICV A;  4PZO A;  2ZIV A;  1ZET A;  5KFC A;  2JZB A;  5DDY A;  1IG6 A;  2DWQ A;  1BNO A;  2EZX A;  4UAR A;  3ISC A;  4DQI A;  3H4D A;  4I2C A;  3PO4 A;  1RYU A;  9ICR A;  4XJE A;  1FFU A;  1CUK A;  4O3O A;  2H3Q A;  4UAY A;  5AI9 A;  3ZD8 A;  5AKJ A;  2Y9T A;  4DQR A;  2K8C B;  4PHA A;  3QUT A;  5J0Q A;  2NRV A;  3QU7 A;  4AP9 A;  3OHA A;  4QZD A;  4CCH A;  5J8Y C;  2HHV A;  4R63 A;  1B43 A;  2Y0S C;  4NXU A;  4RWN A;  5KG2 A;  2QB0 B;  3ONN A;  2F1I A;  4G9B A;  2LMR A;  4LEZ A;  4ECZ A;  4B9L A;  1WWV A;  2ISP A;  1BGX T;  1X6I A;  5HRB A;  5HHI A;  5D46 A;  5AM2 A;  5KNI A;  5DQH A;  5HMM A;  3RB3 A;  1A0P A;  3MDA A;  1MN8 A;  3FDS A;  2HOF A;  4UB3 A;  9ICW A;  5J2C A;  1UEU A;  5J2D A;  2YB4 A;  3UPS A;  4ED6 A;  5DG9 A;  3H38 A;  2XI9 A;  4E0D A;  8ICI A;  3N7R C;  2IHO A;  4F5Q A;  5CJ7 A;  2ODG A;  4A8E A;  5J2J A;  3ZDD A;  4O3Q A;  3OTQ A;  2F77 X;  3D2S A;  2OYY A;  3AQM A;  4G3I A;  1PVR A;  1ZQY A;  4F5P A;  2DGZ A;  2F8K A;  3SAH A;  8ICC A;  3EPI A;  4FH3 A;  2FPL A;  3C21 A;  1X66 A;  4I2E A;  5DKW A;  4DLE A;  5DG7 A;  3RRG A;  2BCR A;  4UAT A;  1BPB A;  2O5A A;  2PMZ C;  2MU2 A;  4C4R A;  1Y88 A;  3SMV A;  4EEY A;  1D9F A;  4RQ1 A;  3Q8Q B;  3V7J A;  2W9C A;  2HN2 A;  3C23 A;  2HN1 A;  2I6X A;  3F5E A;  4Q45 A;  1LB2 B;  4BX9 C;  1Z1V A;  4J9P A;  2KD1 A;  2VA2 A;  1TAM A;  4LZG A;  3KFU F;  5DEC A;  2KIC A;  3RBD A;  3HX0 A;  4YMM A;  1X9W A;  3E2E A;  4NXV A;  4FZN A;  2DKZ A;  4RT2 A;  1J2M A;  5KFF A;  1JUD A;  2AGP A;  4EX6 A;  1UCV A;  4ED8 A;  7ICP A;  2M2T A;  4AT9 B;  4DOA A;  3C66 A;  2ZIV B;  2VA8 A;  3BQ2 A;  2KJ8 A;  1JAL A; 
#chains in the Genus database with same CATH homology
 1BPE A;  4EBC A;  1SKW A;  4Q8F A;  3RJJ A;  2PFP A;  1TKD A;  4WC0 A;  3LDA A;  5KFH A;  4RQ2 A;  3QE9 Y;  4DEZ A;  4R8U B;  2BCV A;  1KFD A;  3KTQ A;  2PI5 A;  9ICP A;  3AU6 A;  4ECR A;  3M9N B;  3BQ0 A;  4ELU A;  4UD5 A;  4RNO A;  1L3U A;  3MFI A;  1ZQH A;  1COO A;  2FPM A;  3SI8 A;  3RH6 A;  2F1J A;  1K1S A;  2C28 A;  3ZDC A;  4FHP A;  4S3N A;  3LWL A;  1ZQE A;  8ICU A;  4TQS A;  1ZQN A;  2BE3 A;  4FHW A;  1SZP A;  4KN4 A;  4LVS A;  3TQ1 A;  1T3N A;  4JK1 A;  4O5K A;  2RFF A;  4AT9 A;  4YD1 A;  1UT5 A;  3RB6 A;  3UXP A;  2ZHA A;  1D8L A;  3QZ7 A;  4M47 A;  3JPR A;  3PR4 A;  8ICW A;  1FA0 A;  5KFT A;  4FHV A;  1S0M A;  3ZDA A;  4GLX A;  1KFS A;  4Z6C A;  1ZQB A;  2J6S A;  4DSL A;  5J0P A;  1TK5 A;  1QLN A;  2M2V A;  4DOC A;  5DED A;  4M9G A;  4MFC A;  4DFM A;  1S10 A;  2J6T A;  5KT6 A;  3JPQ A;  1T7P A;  4KLE A;  3ETL A;  3UXO A;  3GV7 B;  1Q79 A;  4DSF A;  4ATB B;  3RAQ A;  1JAJ A;  4WC4 A;  3NYB A;  4RQ7 A;  4UQG A;  1UET A;  1ZQK A;  5KFB A;  4FBT A;  3PO5 A;  2PFQ A;  2ZUB A;  1R89 A;  4B9M A;  3G6X A;  4X4U A;  3H8W A;  2XO7 A;  1TVA A;  1KFT A;  4J9N A;  4ED3 A;  4AT8 A;  4DFK A;  3SYZ A;  5CB1 A;  5CWR A;  3PVX A;  3TFR A;  4M04 A;  3GV8 B;  2BQU A;  2UVR A;  3EZ5 A;  4P2H A;  2Y1I A;  4F2R A;  1YLQ A;  3MR3 A;  5J0U A;  4J9S A;  5HR9 A;  2DR5 A;  3OVA A;  4DF4 A;  5DB6 A;  3OUY B;  4QWB A;  2ZH1 A;  4O3N A;  8ICZ A;  4QZB A;  4B9U A;  2XCP A;  2NRZ A;  3MR5 A;  4O9M A;  1ZQI A;  2P66 A;  4NLK A;  4YD2 A;  4R65 A;  4PGQ A;  8ICR A;  4ECT A;  4X0A A;  4IQV A;  2XC9 A;  5HP4 A;  4PGY A;  2ZJA A;  4K4G A;  3BJY A;  1PX5 A;  4P4P A;  2DR8 A;  2DR9 A;  5C5J A;  4E8F A;  1L3V A;  4RQ8 A;  5J29 A;  5KT7 A;  1KTQ A;  4YXM A;  5DQG A;  3G6Y A;  1H38 A;  2V9W A;  3GV5 B;  4YVZ A;  3PY8 A;  4X4T A;  5DBC A;  2ZH5 A;  4QZE A;  3MDC A;  5BPC A;  3TFS A;  1ZQA A;  3LQC B;  4ECS A;  1NKB A;  4ECQ A;  4DL5 A;  1BPD A;  4YCX A;  7ICQ A;  2XY5 A;  4M6W A;  1D8Y A;  4EZ9 A;  3C1Z A;  3THV A;  4TUP A;  1MQ2 A;  3RJG A;  2ZJ5 A;  4ELV A;  4KLT A;  4PHD A;  8ICV A;  1RPL A;  5KG1 A;  4I2A A;  5J2H A;  3V72 A;  4YP3 A;  2V4Q A;  4J9Q A;  4ECX A;  3RJE A;  4YR2 A;  2ATL A;  4M9J A;  2ZHB A;  5IIM A;  2PI4 A;  4KLO A;  7ICE A;  3JPO A;  2RDI A;  4TUR A;  4ED0 A;  3OUY A;  2BCS A;  5JUM A;  4GXK A;  4I2D A;  8ICG A;  1MIY A;  2Q66 A;  5J0R A;  4BXO A;  5KG7 A;  3K4G A;  9ICL A;  4DL3 A;  2AQ0 A;  3PW0 A;  3PW5 A;  3MGH A;  4X0B A;  2JEF A;  5DBA A;  1ZQZ A;  1QTM A;  1MIV A;  1CEZ A;  1UT8 A;  3GQC A;  4ECU A;  4DF8 A;  4KN7 A;  1A77 A;  4MF2 A;  2HHS A;  3ZDE A;  4XUS A;  1X2I A;  1ZQJ A;  4RQ5 A;  4UD4 A;  4EBD A;  3M8S A;  4DWI A;  1ZQP A;  3HWT A;  4YR3 A;  3GIL A;  5F9L A;  4BWM A;  5KFM A;  3SZ2 A;  2AQ4 A;  4B9N A;  7ICH A;  4UBB A;  4B9T A;  1BVS A;  1U49 A;  1SL0 A;  1JQR A;  3RB4 A;  2JEG A;  5KFY A;  3Q8L A;  1S0N A;  4Q44 A;  4EYH B;  2HVI A;  8ICP A;  3MGI A;  2JEJ A;  3OGU A;  4DSJ A;  3H37 A;  4EBE A;  4QZC A;  1ZYQ A;  2O1P A;  2ID1 A;  4X4N A;  2AGQ A;  4MEY A;  3M8R A;  1XSN A;  3C2L A;  1V4A A;  1ZQT A;  5DGB A;  4F4K A;  5KFD A;  3GII A;  1QSL A;  1KLN A;  1KNY A;  3V7L A;  4F2S A;  2FLL A;  2UVU A;  4WC1 A;  2VAN A;  5CA7 A;  4BXO B;  2Q0Z X;  5KFJ A;  3FYH A;  4IR9 A;  2HW3 A;  4FHX A;  4GC6 A;  4PPX A;  4M2Y A;  5KG4 A;  3MAB A;  9ICX A;  3H3A A;  3BDP A;  4RPZ A;  3GIM A;  4DSK A;  4UBC A;  9ICN A;  5KG3 A;  1S77 D;  1JMS A;  8ICB A;  1F5A A;  3HT3 A;  1XSL A;  4O3R A;  5HRE A;  5BOL A;  3M9O B;  1Z3E B;  1BNP A;  3H8J A;  4R8U A;  4TUS A;  3LWM A;  4BWJ A;  4UB5 A;  1D9D A;  4M9H A;  4DLG A;  4AT7 B;  3HW8 A;  5DGA A;  3N97 B;  1R8C A;  2IHN A;  4KLD A;  1DOQ A;  5KFE A;  9ICU A;  1TAU A;  1UEU A;  4RWQ A;  4J9M A;  1NKE A;  5KFV A;  3MFH A;  8ICS A;  4PHP A;  4IR1 A;  4QWD A;  2J6U A;  4I2I A;  2W9B B;  3Q8S B;  4HYK A;  4QWA A;  3UQ2 A;  3PW4 A;  3PW7 A;  1ZQO A;  4F4X A;  4I2F A;  3V6K A;  2LYH A;  5J2I A;  1ZQM A;  4E80 A;  2FMP A;  1SL1 A;  1UA1 A;  2R8J A;  3PMN A;  3ZD9 A;  8ICK A;  5J0Y A;  2H5X A;  1JX4 A;  4KIT B;  2AU0 A;  1TV9 A;  1KDH A;  9ICB A;  2PXI A;  4WBZ A;  7ICG A;  1R8B A;  7ICN A;  1UEV A;  3C5F A;  3WFQ E;  2JZB B;  5EWF A;  5J2B A;  4RUA A;  4UB4 A;  4F4Y A;  4DSE A;  4KLU A;  2UVW A;  8ICO A;  4EZ6 A;  1S97 A;  4J9R A;  3GIK A;  2BPG A;  2BPC A;  2P6R A;  2HHP A;  4Q43 A;  4RQ0 A;  2ZTD A;  5IIK A;  2C2D A;  5KG0 A;  4E7X A;  8ICE A;  4QZ8 A;  4DQQ A;  3Q8K A;  1IM4 A;  1NOM A;  1ZQV A;  5J0O A;  5J2G A;  1TK0 A;  8ICY A;  5IIL A;  2XY7 A;  3KHG A;  2HHU A;  1DK3 A;  4MF8 A;  4XRH A;  1KSP A;  2ZTC A;  4UAW A;  4I2G A;  5DB9 A;  1ZQW A;  4I28 A;  4IRC A;  4FHY A;  3BQ1 A;  4KLL A;  1NJZ A;  1DK2 A;  3WFP A;  4DO9 A;  4P4O A;  4JWN A;  1EXN A;  2KFZ A;  3HJ1 A;  4WC6 A;  1ZQQ A;  1ZQS A;  3PML A;  1RXV A;  2BCU A;  1DGS A;  5KFO A;  2R8G A;  4NLN A;  2ZH4 A;  4RU9 A;  3PV8 A;  4DQP A;  4YFK A;  5L1I A;  1U45 A;  5HHH A;  4QZI A;  4TQR A;  4YQW A;  3MR2 A;  7ICJ A;  1WCN A;  2W8L A;  3QZ8 A;  1MIW A;  3UXN A;  2ZH8 A;  1N48 A;  5HRD A;  5HRK A;  2FLN A;  3V7K A;  5KFW A;  4F8R A;  4O3P A;  4I2J A;  4TUQ A;  3KHR A;  4RWP A;  4ED7 A;  5DLF A;  9ICS A;  4UAZ A;  9ICC A;  4UB1 A;  3H40 A;  4JUZ A;  1JXE A;  5HRL A;  3JPS A;  2ZUD A;  5L1K A;  3B0Y A;  4IRD A;  4KLI A;  4X4S A;  3H39 A;  4IQU A;  2RDJ A;  4Z6E A;  2GWS A;  5KT2 A;  4WBY A;  4O0I A;  1NJW A;  5KT3 A;  5J0X A;  1XS9 D;  1NK0 A;  3GDX A;  1XSP A;  8ICF A;  5KG5 A;  1N56 A;  1SKR A;  5III A;  4GXI A;  4NM1 A;  7ICI A;  9ICI A;  2DVI A;  4GXJ A;  8ICX A;  5F2V O;  4RNM A;  1HUO A;  1QSS A;  3N4M B;  4R66 A;  4RWO A;  2ASL A;  1NK9 A;  5KG6 A;  5KT4 A;  3RB0 A;  2MAX A;  4M5D A;  2NRX A;  4RQ3 A;  4M0A A;  3JYY A;  4YR0 A;  5L1L A;  2ASJ A;  1U47 A;  5IIN A;  2FLP A;  4FO6 A;  4B9V A;  1JXL A;  4I2H A;  3OSN A;  4MFA A;  5DQI A;  3OJU A;  9ICJ A;  3V6H A;  1BPY A;  7ICT A;  5J2F A;  3SV4 A;  1BPZ A;  4NY8 A;  1SKS A;  1Q78 A;  2M2W A;  2DR7 A;  3EPG A;  1RYR A;  2W9A A;  2UVV A;  1ZQC A;  9ICH A;  2DRB A;  4NXZ A;  1U4B A;  1RXW A;  2XY6 A;  4RQ6 A;  1KRP A;  3PX0 A;  2KFN A;  2M9N A;  5KFR A;  3RJH A;  1TFR A;  4ELT A;  4MFF A;  1T4G A;  3C1Y A;  4RZR A;  8ICL A;  4IQW A;  4XQ7 A;  2HVH A;  1ZJN A;  4QZ9 A;  4RPY A;  3PX4 A;  5HRF A;  3TAR A;  3OVS A;  5IIO A;  1IXR A;  1VFG A;  4DFJ A;  2XGP A;  4Q8E A;  5DB8 A;  3QEB Z;  1V9P A;  5J0W A;  5EOZ A;  1NJY A;  3Q8P B;  2BQ3 A;  4JWM A;  4J9O A;  1S0V A;  2ISO A;  1XU4 A;  2ZH7 A;  4B9S A;  2BCQ A;  4QZG A;  3ISD A;  2BKE A;  5D4B A;  2W9M A;  4BGD A;  2OWO A;  4UB2 A;  1MSW D;  4DS4 A;  9ICF A;  5KT5 A;  5HRH A;  4EP7 A;  4WC3 A;  1VJ7 A;  4P4M A;  5DG8 A;  2IMW P;  1NK8 A;  1ZQX A;  2V4R A;  4KMU A;  3Q8M A;  4NM2 A;  3RAX A;  4RQ4 A;  3AQN A;  4FS1 A;  2PFO A;  2DPI A;  1Z00 A;  4J9L A;  3RH4 A;  4RPX A;  3NTU A;  4NLG A;  1WCL A;  2W9C B;  4R64 A;  3RBE A;  4ZH4 A;  3JPN A;  3OVB A;  4RUC A;  4C8O A;  4RNN A;  3BQ2 A;  1RYS A;  4X5V A;  4XQ8 A;  3UQ0 A;  4KTQ A;  5HML A;  5KFU A;  2HHX A;  3UPQ A;  3RR7 A;  4ATB A;  4YG2 A;  4ED2 A;  2ALZ A;  3WFS C;  3IHQ B;  5J0T A;  1BPX A;  3TAQ A;  5J0S A;  1SL2 A;  4QW9 A;  2R8I A;  2VA3 A;  4FBU A;  4I27 A;  2A1J B;  4F4Z A;  1ZQL A;  4BDP A;  2MUT B;  2W9B A;  1HJP A;  3T5H A;  4JV2 A;  1A76 A;  1L3S A;  4IG8 A;  3RTV A;  4YN4 A;  5DB7 A;  4KLH A;  2ZTE A;  5J2K A;  4AT8 B;  3EWA A;  3OJS A;  4JV1 A;  4M9N A;  5DBB A;  4NLZ A;  3ORY A;  4FH5 A;  4F4W A;  3GFK B;  9ICV A;  3C18 A;  8ICT A;  7ICM A;  3RJF A;  1ZET A;  5KFC A;  2JZB A;  5DDY A;  4X4R A;  2Y1J A;  4QZF A;  2BDP A;  4EBJ A;  2BPF A;  3HPO A;  1BNO A;  3ISC A;  4DQI A;  2DPJ A;  4J9K A;  3HP6 A;  4QW8 A;  3H4D A;  4I2C A;  9ICQ A;  3PO4 A;  1LV5 A;  5KFX A;  9ICR A;  1NJX A;  7ICS A;  5KFG A;  5HNK A;  5HC9 A;  1CUK A;  4O3O A;  9ICO A;  4F5R A;  1WOT A;  4DFP A;  1ARO P;  3AUO A;  1ZQU A;  1NK4 A;  4UAY A;  4QWE A;  4WC7 A;  1TFY A;  2I1Q A;  4M9L A;  3ZD8 A;  5EWE A;  4DQR A;  4K4H A;  4PHA A;  7ICV A;  3K75 D;  1ZQF A;  3OV7 A;  2MUT A;  5J0Q A;  2BHN A;  2NRV A;  3PNC A;  3KHH A;  2C2R A;  2DFL A;  4EYI B;  2C2E A;  4RT3 A;  3OHA A;  3T5L A;  1X9M A;  4QZD A;  1ZQR A;  5IIJ A;  3H7I A;  1L5U A;  2IHM A;  2ZH6 A;  4CCH A;  2HHV A;  2NRK A;  1NKC A;  4R63 A;  3H8S A;  8ICJ A;  3NGD A;  1B43 A;  2F1H A;  4IRK A;  5KG2 A;  4RWN A;  3JPT A;  1NZP A;  1NO5 A;  4Z6D A;  2XCA A;  3EYZ A;  5KFZ A;  2F1I A;  3OSP A;  5BOM A;  2HHW A;  3ZDB A;  5KFN A;  4O5C A;  2C22 A;  3PW2 A;  3PX6 A;  4ECZ A;  4X4V A;  4DL4 A;  4B9L A;  3EW9 A;  5KFA A;  5DLG A;  2ASD A;  2KZ3 A;  2NRW A;  3M9M B;  2HHT A;  2ISP A;  3HIY A;  4X4Q A;  4DL2 A;  5KFQ A;  1BGX T;  4ED1 A;  4C8N A;  2KTQ A;  3G6V A;  5HHI A;  5HRB A;  5D46 A;  5DQH A;  3MR6 A;  2IA6 A;  3JZ0 A;  5HMM A;  3RB3 A;  1RZT A;  3T5K A;  2W8K A;  4JV0 A;  1UA0 A;  5D49 A;  3MDA A;  4KLQ A;  2HHQ A;  4C8K A;  3FDS A;  5L9X A;  4UB3 A;  4FS2 A;  1U48 A;  4DS5 A;  5J2C A;  4F3O A;  8ICQ A;  9ICW A;  1MC8 A;  4F93 B;  5DDM A;  4KLS A;  4LZD A;  5J2D A;  3RRH A;  2KZZ A;  1B22 A;  5KFS A;  4DL6 A;  1T8E A;  3UPS A;  4ECW A;  9ICT A;  2PFN A;  2AJQ A;  4ED6 A;  5DG9 A;  3AU2 A;  4KLJ A;  4ECY A;  8ICN A;  2KP7 A;  3H38 A;  9ICK A;  1TK8 A;  4E0D A;  4XA5 A;  3Q8R B;  2DRA A;  5EWG A;  8ICI A;  3SV3 A;  4DL7 A;  3PR5 B;  4F5Q A;  4F92 B;  5CJ7 A;  1JIH A;  5J2J A;  1S76 D;  1ZQG A;  3ZDD A;  3TI0 A;  4O3Q A;  4X4O A;  3AQM A;  5CR0 A;  1ZQD A;  4G3I A;  3MBY A;  4IQT A;  3B0X A;  1ZQY A;  4Z6F A;  3KHL A;  3RJI A;  9ICG A;  4WC2 A;  2B21 A;  4YMN A;  4F5N A;  1OU5 A;  3HJ4 A;  2ZJ8 A;  9ICA A;  8ICA A;  3QEA Z;  4O3S A;  4M6W B;  1XWL A;  1PZN A;  2R8H A;  4LT6 A;  3LK9 A;  4F5P A;  8ICC A;  4YMO A;  2FPK A;  1C7Y A;  3JPP A;  3EPI A;  3T5J A;  4FH3 A;  2FPL A;  4QZH A;  3C21 A;  4I2E A;  1R8A A;  5HRG A;  2KZM A;  5DKW A;  2JEI A;  5J2A A;  4GC7 A;  3OHB A;  4DLE A;  1XO1 A;  5F9N A;  5DG7 A;  3RRG A;  2IBK A;  4NKT A;  2BCR A;  4WC5 A;  2M2U A;  7ICL A;  4F50 A;  1BPB A;  4PHE A;  1L3T A;  2O5A A;  2ZH3 A;  1ZJM A;  4C8L A;  5L1J A;  4ECV A;  3RH5 A;  1JN3 A;  3TAN A;  1Y88 A;  4PGX A;  1U9L A;  4EEY A;  8ICH A;  4EBK A;  7ICF A;  1D9F A;  4YXJ A;  3BQT A;  4RQ1 A;  4QWC A;  3Q8Q B;  2XGQ A;  2W9C A;  3V7J A;  7ICR A;  1K1Q A;  3WFO A;  2ZUC A;  3C23 A;  3RJK A;  5KFP A;  2KN7 A;  3IM1 A;  4Q45 A;  3V6J A;  1NK7 A;  2P6U A;  5J2E A;  3C2K A;  2I9G A;  1LB2 B;  3WFR E;  2NRT A;  4J9P A;  4DOB A;  4O5E A;  1Z00 B;  3H4B A;  2VA2 A;  2FMS A;  4NKU A;  5KFL A;  1TAQ A;  4LZG A;  4X4P A;  4PH5 A;  5DEC A;  4MEX A;  7ICK A;  3C5G A;  5KFK A;  2A1J A;  3RBD A;  2FMQ A;  3HX0 A;  1XC9 A;  4YMM A;  1X9W A;  3GIJ A;  2BQR A;  8ICM A;  4C8M A;  1NK5 A;  3RR8 A;  2PBE A;  3E2E A;  1S9F A;  1TFW A;  5CP2 A;  4RT2 A;  5KFF A;  1QSY A;  2AGP A;  1S0O A;  4KLM A;  9ICE A;  2ZH2 A;  2R8K A;  2AGO A;  2ZH9 A;  5KTQ A;  4K4I A;  4ED8 A;  4KLG A;  4I29 A;  3TAP A;  3L9D A;  7ICO A;  4WCW A;  7ICU A;  7ICP A;  3T3F A;  5TZV A;  5CHG A;  4DSI A;  2M2T A;  4AT9 B;  4DOA A;  1MQ3 A;  3ISB A;  3C2M A;  4DQS A;  4KLF A;  5HRI A;  4F5O A;  2BGW A;  3AQL A;  4F91 B;  3C66 A;  1X9S A;  4QZA A;  1NK6 A;  2BR0 A;  9ICM A;  1HUZ A;  4AT7 A;  1KEJ A;  4I2B A;  2WTF A;  3AQK A;  2VA8 A;  5KFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...