4O5CA

Structure of human dna polymerase complexed with n7-mg as the template base in a 1-nucleotide gapped dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5cA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5cA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5cA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5cA03
5KFGA 2BPGA 2PFOA 4C8OA 2BKEA 4EBKA 4M04A 3OJUA 4R64A 4I2HA 2ZH1A 1ZQCA 5HMMA 4DOCA 2DRBA 5CA7A 2VA8A 2PFPA 1QSLA 2IBKA 4EZ6A 4JK1A 4XRHA 2ZH4A 2F1IA 1UT8A 4O3RA 5KFJA 4FH3A 4C8NA 3AQLA 2HHTA 5KFPA 1S0OA 3H38A 3V7LA 1H38A 5DQGA 4RPYA 7ICSA 5DKWA 4JV2A 5J0OA 3GIJA 1V9PA 1WOTA 4X4PA 1K1SA 2FLLA 7ICFA 4RQ7A 2AGPA 3ZDAA 3KHGA 1NJWA 4KLDA 2W9BB 1D9FA 1R8AA 4RUCA 5DDYA 9ICMA 1L5UA 9ICTA 1BPBA 2BE3A 4AT9B 4AT8B 5KFQA 5CR0A 3BQTA 4ECQA 5F2VO 5KT6A 3UXPA 2DRAA 1Z00A 2NRVA 4DOAA 3GV7B 4UD4A 2BCUA 4ED1A 2ZTDA 1XWLA 1ZQVA 3HWTA 4DF4A 3RBDA 3RH6A 3JPSA 4RNOA 3JYYA 4FH5A 3KHHA 4C8LA 2FPLA 4G3IA 4BWMA 1C7YA 5DG9A 4JV0A 5EWGA 4QZIA 4MFAA 2KFZA 7ICUA 5KFTA 1TFWA 1ZQIA 4NM2A 4P4OA 5HRDA 5HR9A 4F2RA 3C5FA 7ICGA 1BNOA 3C23A 3UQ2A 4M9LA 2ALZA 5DGAA 4DFPA 2BPFA 4M9HA 4ZH4A 3GV8B 1EXNA 4O3QA 4QWDA 5J0PA 1WCNA 4RWPA 1CEZA 4UB5A 1U49A 3RTVA 4I2CA 4QWBA 8ICZA 9ICFA 5KFLA 5DLGA 5J29A 2RDJA 4DS5A 2ZTCA 2KN7A 3GFKB 1IM4A 4UB2A 3RJKA 1FA0A 1XU4A 5KFIA 4QWAA 4PGQA 1NK6A 4E7XA 4YCXA 4MF2A 4RQ5A 2JZBB 3OGUA 4I2EA 2ZTEA 4O3SA 4FHVA 5DEDA 4Q8FA 4QZ8A 4F3OA 4FHWA 4ED8A 1KFTA 1YLQA 4P4PA 3PW5A 4Z6EA 3RH5A 3GIKA 4KN4A 2IHMA 4M2YA 1BNPA 3HIYA 1ZQBA 4QZGA 4TUQA 4DL3A 3Q8MA 2XY6A 9ICHA 1NKCA 3PW2A 2DFLA 4FS2A 5D49A 5KT4A 3ISBA 2DVIA 1MQ3A 8ICLA 4Q44A 4ECZA 4FHXA 4QZ9A 2KFNA 4EEYA 4WBYA 1X9MA 3BQ1A 2PFNA 4J9LA 3Q8LA 3Q8KA 4I2GA 4K4IA 3PV8A 4WC2A 2P6UA 1UA1A 2HHVA 9ICRA 4KLJA 4YMNA 4B9SA 5KTQA 1TVAA 4BXOB 3RJJA 3MR2A 4KLHA 4RZRA 4B9TA 4TQRA 1T4GA 2M2TA 4AT7B 5KG4A 2W9AA 5L1IA 3WFPA 3LK9A 4GC7A 1MIWA 4X4RA 4M0AA 4IQUA 3AQNA 4QWCA 2J6SA 4O5EA 5J0WA 2ZH3A 2DR9A 5D46A 5F9NA 1ZQHA 7ICNA 4DL6A 4RUAA 4ED3A 1NK5A 3ZDBA 1NKBA 5KFVA 2KZMA 4KLFA 9ICGA 3H8WA 4UB1A 3OUYB 1VJ7A 4F4WA 1QSYA 4IR9A 1OU5A 5J0QA 8ICIA 3RRHA 3H7IA 5KFNA 5L1LA 5KFZA 2IMWP 9ICWA 8ICUA 4QZHA 4O3OA 3LDAA 3OHAA 3UPQA 4QZEA 3OVAA 3WFRE 4F5RA 3PX0A 9ICAA 8ICSA 2A1JA 3PVXA 4RT2A 2H5XA 3T5LA 4R8UA 1L3SA 1ZQMA 3BQ0A 1JXLA 4M9GA 1N56A 5DG7A 4PPXA 4Z6FA 1TV9A 1NK9A 1HJPA 3K4GA 4DSLA 3ZDDA 5KG6A 5J2IA 5KFUA 5KG1A 3Q8PB 5IINA 1XC9A 1L3UA 1ZQKA 3V72A 2FMSA 1NK7A 5KFXA 1UA0A 3WFOA 3GIIA 2BCVA 3UQ0A 4KMUA 1NK0A 2JEIA 3MDAA 4RWNA 5DQIA 1V4AA 1RXWA 9ICCA 4B9NA 1TAQA 4PGYA 3PY8A 1CUKA 4YFKA 5IIMA 5J2GA 3AQMA 4WC3A 4TURA 1SKRA 4Q8EA 3JPQA 4O3PA 3M9OB 3UXNA 1ZETA 4M6WB 1XSPA 2MAXA 4I2JA 3THVA 4YVZA 2XGPA 4YXMA 1KDHA 3WFQE 4NKTA 1NK8A 2W8LA 2DR5A 5C5JA 1Z00B 8ICHA 2HHXA 4JUZA 3KTQA 4KLOA 2DR8A 3RB0A 7ICOA 5KG0A 5DB9A 4QZDA 2BPCA 3V6HA 4B9LA 4P4MA 3JPRA 4J9OA 3T5KA 1ZQWA 1U48A 4YR2A 3PR4A 4DL2A 4E80A 3BJYA 4K4HA 4WC6A 1S0VA 5KFEA 1XSLA 3MDCA 5JUMA 3H4DA 7ICPA 1ZQDA 3MGIA 3RH4A 2JEGA 8ICGA 1ZQEA 5IILA 1S97A 3RBEA 8ICXA 7ICMA 4WBZA 2AQ0A 1NKEA 1KTQA 4I2AA 9ICJA 3Q8QB 3H3AA 4YD2A 2XO7A 2AQ4A 2FPKA 4BWJA 4FBTA 4K4GA 3M8RA 3UPSA 5J2BA 1HUOA 3C1ZA 4DS4A 5EWEA 5HP4A 2XCPA 4DSEA 4IQWA 3C2KA 1RYSA 9ICBA 1Q79A 3NGDA 2KZZA 2NRTA 5DBBA 3SV3A 4F5PA 1JN3A 3SI8A 5J0SA 1LB2B 4ECTA 3JPTA 4JV1A 2HHUA 1AROP 5DLFA 1TAUA 4GXKA 2PI4A 2JEJA 2AU0A 4JWMA 4FO6A 1S9FA 2PFQA 4ECSA 3ZD9A 4ECYA 3TI0A 4X5VA 1L3VA 2PBEA 2HHSA 4FS1A 2LYHA 4PHEA 1HUZA 4J9KA 1K1QA 3C1YA 3PX4A 1BPZA 4J9NA 3LWMA 1RXVA 2V9WA 1SKSA 4NY8A 1NK4A 1MQ2A 3ZDCA 7ICVA 2ID1A 4F2SA 8ICOA 3NYBA 3TQ1A 4I2IA 4ECWA 2AJQA 1VFGA 4KLMA 3PO4A 4GXJA 1ZYQA 1UEVA 5HRGA 1NJZA 2FLNA 5IIOA 4I2DA 4F5QA 4IR1A 3HX0A 4YG2A 5DG8A 1SL2A 3OHBA 3SYZA 1MIVA 3PX6A 1T7PA 1RZTA 4M47A 4RQ8A 4EBCA 4DQQA 1RYRA 4F5OA 1NJXA 4GXIA 2ZJ5A 2C2DA 4NLGA 2R8HA 4J9SA 3T5JA 2O5AA 2ZH6A 3T3FA 4UBBA 1PX5A 5DGBA 1ZQRA 2ZUCA 4CCHA 2V4RA 9ICOA 4DSFA 2BQUA 2I9GA 9ICXA 4X0AA 2ZUBA 9ICVA 2UVWA 5KT7A 2BQ3A 1NJYA 2W9BA 4O5KA 4QZAA 4QZCA 3JPPA 4J9QA 5KT3A 4AT9A 5KG7A 4AT8A 1A76A 1BPDA 4YQWA 3ZDEA 2V4QA 3G6VA 3TAPA 3TFRA 1L3TA 4XA5A 4ATBB 4RQ2A 4YMOA 5EOZA 4PGXA 4PHDA 1TFRA 2PI5A 4IG8A 3EW9A 3PW7A 4UAWA 7ICJA 3FYHA 4UQGA 2UVUA 4WC4A 2W8KA 2HVIA 3QEBZ 5J2AA 4EYIB 2VA2A 4UAZA 3QZ7A 2ZHAA 3MBYA 4X4UA 2ZUDA 3AU6A 4X4VA 5J0XA 1WCLA 4I27A 4LZGA 8ICMA 9ICKA 4RQ4A 1TKDA 1R89A 3QEAZ 2RFFA 3PW0A 2W9CB 4KLUA 4HYKA 4TQSA 1JX4A 4IQVA 5J2CA 4Q45A 3C5GA 4ED0A 3MFIA 3V7KA 1KLNA 2BDPA 5KFWA 5D4BA 4BDPA 4IRCA 1QLNA 2HW3A 1A77A 1S0MA 4ECUA 3RB3A 7ICIA 1JXEA 3EWAA 5KFYA 5KFFA 2J6TA 1LV5A 1D9DA 9ICEA 3JZ0A 2FMQA 4DSJA 5HRKA 4F4YA 1ZQSA 3EYZA 4B9UA 4NLZA 5CWRA 3G6XA 4WC1A 4EZ9A 5CB1A 2BCRA 5J2FA 3TARA 2R8KA 4NKUA 4R66A 3HPOA 2BQRA 4MF8A 1ZQZA 2GWSA 3M9MB 1KRPA 4DL4A 4NLKA 4UB4A 2JZBA 2F1JA 4B9MA 8ICFA 1DGSA 4RQ0A 4WC5A 1TK5A 3PR5B 1U4BA 3C66A 3TFSA 4KLGA 3HJ1A 4DSKA 8ICEA 1BPYA 3RRGA 1IXRA 8ICPA 4YD1A 4M5DA 3OV7A 4B9VA 3C2LA 1X9WA 3NTUA 4DWIA 5DB7A 2FPMA 4QZBA 1ZQLA 2Y1IA 2ASJA 5CHGA 2C28A 3IM1A 4PH5A 4EP7A 5KFBA 2FMPA 5KFSA 2DR7A 1SL0A 2C2EA 3PNCA 4NXZA 4P2HA 3V7JA 1PZNA 5J2HA 4KLSA 4ED6A 8ICAA 4WC0A 4RT3A 4GC6A 4X4SA 4I2BA 4BXOA 3H39A 4GLXA 1ZQYA 3AUOA 2MUTA 5J0UA 4ECRA 4DEZA 1NOMA 5BOLA 5DBCA 3OJSA 1B43A 4QZFA 5HHHA 2KTQA 3EPGA 4ELVA 4MFCA 4I29A 4EBJA 2ZH2A 1S10A 3EZ5A 1MIYA 1ZQXA 3IHQB 4O0IA 4F4ZA 1U47A 3KHLA 1S0NA 2ZH8A 2RDIA 4EYHB 1QSSA 1ZQQA 4QWEA 4UB3A 3B0XA 4ECXA 2NRKA 8ICKA 4X4QA 3OUYA 2Y1JA 1Y88A 4C8MA 2P6RA 2NRZA 3AQKA 4ELUA 3LQCB 4F93B 4RWQA 2HHWA 4ED7A 3HT3A 2O1PA 1ZQPA 1QTMA 4E8FA 3RR7A 4NLNA 4R63A 1ZQAA 5HRLA 3GQCA 4J9RA 4F4XA 4IRDA 5J2JA 5HC9A 3ZD8A 4M9JA 2C22A 4Z6DA 4XQ8A 1NZPA 4KTQA 2KP7A 4Q43A 2XC9A 5DQHA 4KLEA 2ZHBA 4R65A 3ISCA 4FHPA 3WFSC 4DQSA 3MR3A 2IA6A 4DQRA 3PO5A 3MGHA 4X4NA 4FBUA 4IQTA 1X9SA 2HVHA 1DK3A 1MC8A 4DFKA 3TAQA 3RB4A 4O3NA 1ZJNA 1MSWD 1JIHA 1T3NA 8ICQA 8ICTA 5HREA 2NRXA 2ATLA 5J2EA 2KZ3A 3H8JA 4YP3A 5J2DA 5HHIA 3BQ2A 2FLPA 7ICKA 1SL1A 2HHPA 3RJGA 4DO9A 2J6UA 5HNKA 1DOQA 2UVRA 4IRKA 4F5NA 1R8BA 4M6WA 3PW4A 2P66A 5HRBA 4KITB 5KG5A 2Q0ZX 5HRHA 4F92B 4ELTA 2Q66A 3G6YA 4Z6CA 1BPEA 4DF8A 2M2WA 1X2IA 2ZJAA 4F91B 4NM1A 3RR8A 4QW9A 2C2RA 5KFRA 2F1HA 1Z3EB 3SZ2A 4KLQA 1JAJA 2ZH5A 5F9LA 5CP2A 5KFAA 4YXJA 1D8YA 3RJHA 4J9MA 2ZJ8A 4RWOA 5DBAA 1KEJA 1ZQNA 1ZQOA 3RJIA 4UD5A 3EPIA 2ZH7A 8ICCA 4BGDA 3N4MB 2BCSA 2VA3A 5KFOA 1XO1A 5DB6A 1TK8A 7ICRA 1DK2A 8ICRA 5EWFA 4RQ1A 4F4KA 4I28A 5HMLA 1N48A 7ICLA 2NRWA 2BGWA 3JPNA 4DQIA 9ICPA 4X4OA 4MEXA 3OSNA 4DQPA 4DLEA 4X4TA 3OVBA 2M9NA 5J0YA 3OSPA 1NO5A 3HJ4A 3T5HA 4E0DA 4YR3A 1U45A 3MFHA 4KLTA 2AGOA 4KLLA 7ICHA 3ORYA 4JWNA 3H4BA 4S3NA 9ICSA 2BHNA 4YN4A 3RB6A 4MFFA 1Q78A 2IHNA 2A1JB 3E2EA 1R8CA 2WTFA 4TUPA 1UT5A 5L9XA 4R8UB 3H8SA 5HRIA 4ECVA 4WC7A 4EBEA 3JPOA 3RAQA 3ISDA 1TFYA 2XCAA 4DL5A 5BOMA 4UAYA 3GILA 2AGQA 3SV4A 3GIMA 4ED2A 3RJFA 4F8RA 4O5CA 1UEUA 1ZQUA 4RPZA 5TZVA 5KFKA 3Q8RB 3H40A 5CJ7A 4XUSA 7ICQA 4UBCA 4WCWA 2W9MA 1KFDA 3TANA 7ICTA 5KG2A 3N97B 2DPIA 2XGQA 1ZQTA 4RPXA 1TK0A 3C2MA 5KT5A 4DSIA 4KN7A 4DOBA 4DLGA 3GDXA 2HHQA 3C21A 2MUTB 3HP6A 1KFSA 3AU2A 5KT2A 5J0TA 4KLIA 3B0YA 2PXIA 3C18A 4PHPA 8ICYA 3RJEA 5IIIA 2M2UA 5KFDA 3RAXA 1T8EA 3FDSA 4MEYA 4QW8A 1BGXT 3MR6A 4LZDA 1ZQGA 1UETA 3OVSA 1ZQFA 1ZJMA 2XY5A 3MR5A 1S77D 9ICLA 3ETLA 5J0RA 5L1JA 2DPJA 4M9NA 5HRFA 2OWOA 2R8JA 3BDPA 4XQ7A 9ICUA 4RQ6A 4F50A 9ICNA 2B21A 2BCQA 4TUSA 4RNNA 2XY7A 3QZ8A 3LWLA 4J9PA 3V6JA 4ATBA 1ZQJA 3KHRA 2M2VA 2BR0A 5IIKA 1JQRA 5DECA 1SKWA 4O9MA 7ICEA 4RNMA 5KFMA 9ICIA 5J2KA 4I2FA 9ICQA 3H37A 3HW8A 3V6KA 3Q8SB 2ISPA 2JEFA 5KFHA 3M9NB 4LVSA 5IIJA 5L1KA 1S76D 1BVSA 4YR0A 4DFMA 1COOA 2W9CA 8ICWA 4AT7A 1SZPA 4RU9A 2I1QA 3M8SA 2UVVA 4EBDA 3K75D 3L9DA 4DL7A 5KG3A 2ASLA 1F5AA 1KSPA 4RQ3A 1KNYA 3PMLA 2ZH9A 1RPLA 1U9LA 4FHYA 5DB8A 3PMNA 5DDMA 8ICJA 1XSNA 1XS9D 5KFCA 3MABA 3QE9Y 5BPCA 3GV5B 2ASDA 1D8LA 2ISOA 1B22A 3UXOA 4YMMA 4C8KA 4PHAA 1JMSA 2R8IA 8ICVA 4LT6A 8ICNA 2VANA 4X0BA 1BPXA 2R8GA 4DFJA 8ICBA
chains in the Genus database with same CATH superfamily
4C8OA 4EBKA 3OJUA 2ZH1A 3QNMA 2FJ6A 4OAHA 4EZ6A 5JRTA 3OTQA 4JK1A 2F1IA 4O3RA 4Y2UA 5KFJA 4FH3A 4C8NA 3AQLA 5KFPA 2YTUA 3V7LA 3NVVA 1KKXA 3H38A 5DQGA 4JV2A 2AHOB 4UW9A 1K1SA 2WAQC 7ICFA 3IRUA 1QH9A 2LM1A 1D9FA 4K96A 4ACOA 4AT9B 9ICTA 5CR0A 1Z00A 2NRVA 3GV7B 4UD4A 1OXJA 5B3PA 4ED1A 2ZTDA 4DF4A 3JPSA 2FPLA 3QX7A 4BWMA 5DG9A 1ZQIA 4P4OA 5HRDA 2GO7A 3C5FA 2KV2A 1J2MA 2W7PA 2DKXA 4M9HA 3GV8B 4QWDA 5ALMA 5KFLA 2ZTCA 1IM4A 1RG6A 2QLTA 1NK6A 4E7XA 3F2DA 4YCXA 2DGZA 3WKBA 4I2EA 2ZTEA 4FHVA 5DEDA 2HSZA 4FHWA 4JB3A 1KFTA 4P4PA 2B51A 3H0MB 4QZGA 4CDGA 2XY6A 9ICHA 1NKCA 5KT4A 3AL0B 1MQ3A 4ECZA 2KFNA 4J9LA 2XI9A 1QCKA 3AM9A 4WC2A 4YMNA 5JTIA 4B9SA 5CHEA 1N5XA 3MR2A 2DBYA 2JRZA 1WWVA 1B0XA 5KG4A 2W9AA 1UPHA 1V85A 4IQUA 3AQNA 4QWCA 2J6SA 4O5EA 5J0WA 5AI4A 4CRXA 1ZQHA 3UMGA 4RUAA 5ALFA 2MRLA 3DV9A 2OHFA 2PKEA 5J0QA 3H7IA 2ZXHA 3OHAA 3UPQA 3OVAA 3NRZA 3PX0A 2I6XA 4R8UA 1X66A 4M9GA 2KHQA 5KG6A 1L3UA 5AM2A 2BCVA 2K4IA 5AM4A 2JEIA 4RWNA 1RQLA 4NL9C 5EE9A 9ICCA 5J2GA 4TURA 4Q8EA 4M6WB 4LEZA 4YXMA 4NKTA 2W8LA 1Z00B 8ICHA 4KLOA 2HOQA 5DB9A 4K4HA 1X9XA 8ICGA 4O69A 3Q8QB 4YD2A 2AQ4A 1HUOA 2XCPA 2KZZA 3SV3A 3LVVA 4BUGA 3JPTA 4JV1A 2HHUA 3QU7A 1AROP 5DLFA 1JRPA 5AM0A 4JWMA 2PFQA 4CF4A 4X5VA 1HUZA 4Y2JA 3PX4A 1BPZA 5ALDA 3LWMA 1MQ2A 3TQ1A 4I2IA 1WUDA 4GXJA 1ZYQA 2WFAA 2KJ9A 1NJZA 4I2DA 1YT3A 4F5QA 3LVWA 1MIVA 3F53A 2HBJA 1RYRA 4EBCA 2JH7A 2C2DA 2ZH6A 2R8HA 2E5SA 5DGBA 1ZQRA 4CCHA 9ICOA 1KN5A 2BQ3A 4CF5A 3JPPA 4O67A 3G6VA 2B6GA 4IG8A 4K9AA 2K4EA 3FYHA 1A0PA 2F2AB 2HVIA 2GLEA 2K8CB 4UAZA 3QZ7A 1Z19A 1SWVA 4PZNA 3AU6A 3QUTA 4LZGA 8ICMA 4RQ4A 1TKDA 1R89A 3QEAZ 3NVWA 4QJFB 2W9CB 4IQVA 4BDPA 3V7KA 1QLNA 4IRCA 2YQEA 4ECUA 3EWAA 5KFYA 4DSJA 4F4YA 3BZKA 4EZ9A 3TARA 3RFAA 2BQRA 3M9MB 1KRPA 4UB4A 4B9MA 3TFSA 3HJ1A 8ICEA 1SV4A 4UASA 8ICPA 4ICAA 4YD1A 2IOFK 3CK6A 2WF6A 5DB7A 4UARA 1ZQLA 3C29A 3IM1A 2HBLA 5KFSA 2W7OA 5ALLA 3SQIA 1PZNA 3IDWA 3NASA 3CRXA 3QUCA 3H39A 3AUOA 3QU2A 5J0UA 5DBCA 4QZFA 3CYMA 4MFCA 1N63A 2ZIUA 4EBJA 3IHQB 4MHVA 3KHLA 5E79U 2ZH8A 4EYHB 2NRKA 4OJLA 8ICKA 4X4QA 2P6RA 3AQKA 4ELUA 3LQCB 3HT3A 3GZFA 4R63A 5HRLA 4F4XA 1L7NA 4IRDA 1ECWA 4Q43A 5JTGA 2K8BB 2DWQA 2IA6A 4FBUA 2G06A 4DFKA 1MSWD 1T3NA 4C4RA 4NL9A 5ALNA 3BQ2A 1DOQA 2UVRA 4IRKA 3PW4A 2P66A 5HRBA 2Q0ZX 5AKKA 2Y9UA 3G6YA 4DF8A 1BPEA 4NM1A 4OAGA 4QW9A 2K4HA 5KFRA 4J9MA 5AK4A 3EPIA 1XO1A 2W11A 4F4KA 1N48A 4OAIZ 2KVSA 2NRWA 4X4OA 3OSPA 4E0DA 3B9JA 4KLLA 1RM6C 2DF4B 4MFFA 2F44A 3E2EA 4TUPA 1ZD4A 4EBEA 1TFYA 5BOMA 2EWRA 3SV4A 3GIMA 4O5CA 4F8RA 2QB0B 4USAA 3Q8RB 2KD1A 4FZNA 5CJ7A 4WCWA 5B66U 3QU9A 7ICTA 4RQMA 3QU5A 2XGQA 1ZQTA 4OO1J 1S8OA 4RPXA 1O08A 4DSIA 5KL8B 4HAIA 4DLGA 3GDXA 5J0TA 4K8VA 3KBBA 3RJEA 3RAXA 4EEKA 1UETA 4QW8A 4EEBA 2ZIUB 5F3XB 4LZDA 3IV6A 1ZJMA 3MR5A 9ICLA 3ETLA 4Y2VA 5HRFA 5AKJA 4F72A 3BDPA 2BCQA 4TUSA 2MU2A 2OCEA 2XY7A 4J9PA 3LWLA 3V6JA 1ZQJA 5DECA 3NVYA 4RNMA 3WKAA 9ICQA 3H37A 2W43A 2ISPA 1L7MA 3KKAC 5KFHA 2JEFA 1BVSA 3WKCA 4AT7A 2KEYA 2IUBA 2UVVA 4EBDA 5KG3A 4P0QA 1DRGA 5KFCA 4OJ5A 2ISOA 4C8KA 4PHAA 1JMSA 2WB1F 8ICNA 2P35A 2VANA 3C28A 3N7RC 5GTHU 2BDUA 2PFOA 1IIPA 3D2QA 2BBHA 4R64A 2IOHA 2EAPA 2DRBA 3IG5A 4AP9A 2ZH4A 4XRHA 1UT8A 4NWIA 1S0OA 1T94A 1CI4A 5DKWA 5J0OA 3GIJA 1V9PA 4X4PA 2FLLA 4Y2PA 4RQ7A 1ZD3A 2W9BB 4RUCA 4AT8B 5KFQA 4U6PA 2FI1A 2NO4A 3VCBA 1Z4OA 1XWLA 3RBDA 3WU2U 3KZIU 4FH5A 5D62A 1C7YA 5EWGA 2KFZA 5KFTA 4I0UA 2ZIWB 1BNOA 1V38A 3SAFA 2BPFA 1HEKA 1EXNA 1FFUA 2HOIA 5J0PA 4I2CA 4QWBA 4EENA 5J29A 4FZMA 4UB2A 1FA0A 2B0CA 1XU4A 4PGQA 3QU4A 4RQ5A 2JZBB 3OGUA 4QZ8A 4F3OA 1ZRMA 4ED8A 1YLQA 2B4VA 3RH5A 3HIYA 4KN4A 4WBYA 3AEVA 2F8LA 3Q8MA 2DVIA 3IP4B 4Q44A 4C4SA 4QZ9A 1FO4A 4FHXA 5CRXA 3Q8LA 4EEDA 3PV8A 2HHVA 9ICRA 2KIWA 1TVAA 3RJJA 1LKYB 4KLHA 4B9TA 3ZI4A 3D6JA 4AT7B 3WFPA 4GC7A 2KOBA 5D46A 7ICNA 4OJPA 4DL6A 4ED3A 4Y2TA 2G09A 4OJ6A 5KFVA 1NKBA 9ICGA 2BBJA 3OUYB 2E8NA 1OU5A 1XO0A 1PK1A 5KFNA 2H3VA 5L1LA 5T14A 4QZHA 3WFRE 4F5RA 2H5XA 1ZQMA 1JXLA 1N56A 1TV9A 3K4GA 4DSLA 1XC9A 3V72A 1NK7A 2WB1C 5KFXA 3WFOA 4KMUA 5J8YA 1NK0A 3MDAA 5DQIA 4DCCA 1TAQA 4PGYA 3PY8A 4YFKA 2E8MA 4WC3A 3JPQA 3M9OB 4I2JA 3THVA 1F5SA 2I5HA 2N1RA 4WJ3B 5C5JA 4JUZA 3KTQA 2DR8A 2H3ZA 3RB0A 2BZFA 3V6HA 2ZG6A 4P4MA 1U48A 4YR2A 1ZD2P 1FIQA 1S0VA 2MA1A 5KFEA 2DQNB 3H4DA 7ICPA 1ZQDA 3MGIA 3RH4A 1ZQEA 5KAIU 4WBZA 7ICMA 2AQ0A 9ICJA 2FPKA 3VC8A 4K4GA 4IQWA 3C1ZA 4DS4A 5EWEA 9ICBA 2K60A 2HBKA 2YB1A 3MCRA 4F5PA 1UCVA 2D3DA 1TAUA 2AU0A 5ALGA 1S9FA 4ECSA 1L3VA 3TI0A 4Y2XA 2PBEA 2HHSA 3CNHA 4FS1A 2LYHA 2YX8A 4PHEA 2B56A 1K1QA 3C1YA 2V9WA 2JGAA 4F2SA 1VFGA 1SIJA 3FC4A 3PO4A 4RQNA 1UEVA 1IV8A 2FLNA 4IR1A 3HX0A 4YG2A 3OHBA 4M47A 4RQ8A 2EH9A 4CGZA 3K1ZA 4NLGA 4J9SA 3T3FA 2ZUCA 4DSFA 2BQUA 2I9GA 9ICVA 2UVWA 4J03A 4GFJA 4O5KA 3SD7A 5KG7A 1A76A 5ALJA 2V4QA 3TFRA 1L3TA 5AI9A 4YMOA 5EOZA 4PHDA 4PGXA 5AK5A 3PW7A 4WC4A 2K8AA 5J2AA 2VA2A 4X4UA 1PK3A 2ZHAA 2ZIXB 3NVZA 5J0XA 3K7DA 2EDUA 9ICKA 4Q45A 5J2CA 3AQMA 3KZXA 2BDPA 5D4BA 2HW3A 1S0MA 3RB3A 5AKLA 1Q3VA 2J6TA 9ICEA 1D9DA 5G5HA 2FMQA 4FE3A 5HRKA 5ALZA 3EYZA 5EE1A 4NLZA 2YY6A 1QQ7A 3L4PA 2BCRA 2HN2A 4LEYA 3ETRA 2JHDA 1ZQZA 4NLKA 2F1JA 8ICFA 1DGSA 4WC5A 1TK5A 3PR5B 1BPYA 3OV7A 2LMRA 3NTUA 4UB6U 2OEHA 2KNJA 4QZBA 2ASJA 4PH5A 2VIXA 3UM9A 4MKPA 2DR7A 1SL0A 4NXZA 2W55A 4EX6A 8ICAA 4RT3A 4FFDA 4BXOA 1ZQYA 2MUTA 4DEZA 1B43A 1N5WA 3KD3A 2ZH2A 2VJ5A 3AMZA 1U47A 1ZQQA 4QWEA 3B0XA 4UAVA 4IC9A 1TE2A 4Z6DA 4KTQA 3EF2A 1CRXA 4R65A 3ISCA 3WFSC 2OXOA 3MR3A 3MGHA 3WK8A 4IQTA 1O03A 3RB4A 8ICQA 5AIBA 2NRXA 2ATLA 2KZ3A 3H8JA 3SAGA 5HHIA 3PSFA 4U7CA 1SL1A 4DO9A 3IG8A 2VKQA 4KITB 5KG5A 2KHVA 4ELTA 2M2WA 3SENA 2ZJAA 2EZZA 3RR8A 2C2RA 1N60A 1JAJA 2ZH5A 3N7SC 2KJ8A 1D8YA 3PHZA 3WKEA 1KEJA 3BZCA 2W54A 3RJIA 2XVTA 2ZH7A 7ICRA 4O68A 2LHTA 5DB6A 8ICRA 4I28A 2BGWA 3JPNA 4DQIA 4MEXA 4X4TA 2E3TA 1PUZA 2KKVA 1URJA 1NO5A 1Q3UA 1U45A 4KLTA 2AGOA 3ORYA 3H4BA 2BHNA 4YN4A 1SB3C 5HRIA 1UT5A 5L9XA 3BS5A 3H8SA 4R8UB 1RYUA 4JLXA 2XCAA 5ALEA 3GILA 2AGQA 2JR5A 4ED2A 4QIWF 1ZQUA 5TZVA 3QUBA 5KG2A 3C2MA 4KN7A 4DOBA 5CEHA 3C21A 2MUTB 1KFSA 3AU2A 4OCZA 3C18A 3SR6A 1SGGA 3FDSA 4MEYA 3MR6A 1BGXT 3NRWA 5AI6A 2XY5A 1S77D 1N61A 5J0RA 2DPJA 3D2NA 2OWOA 2R8JA 4NLBA 4XQ7A 4F50A 4C4TA 9ICNA 3FM9A 4ATBA 2IOFA 2M2VA 1JQRA 1T3QA 3M9NB 4LVSA 5AICA 3H0LB 3SEIA 2WF5A 3TACB 2EZXA 1PVQA 3K75D 2WF8A 3M6KA 4LEWA 3L9DA 1F5AA 3R9KA 3PMLA 2CXYA 1RPLA 3ER8C 5EE3A 3MABA 5BPCA 5ALXA 2H3QA 2W04A 3UXOA 4YMMA 2GAFD 4O3MA 4LT6A 4X0BA 2E1EA 2R8GA 4DFJA 1UQVA 5KFGA 3E0FA 3NWIA 2KE7A 4M04A 2LI6A 1ZQCA 2QARA 5AKZA 5CA7A 2VA8A 4CE6A 4LJXA 1F44A 2HHTA 1RDFA 1H38A 4RPYA 7ICSA 5CFSA 2AGPA 5AKHA 2LBOA 1NJWA 4KLDA 1R8AA 5D63A 5DDYA 9ICMA 2KIVA 3SMVA 4WOYA 3WK5A 3BQTA 4ECQA 5KT6A 3IN5A 3HWTA 2KJ5A 3RH6A 4C0ZA 4RNOA 4C8LA 7ICUA 1TFWA 4MFAA 3I1YA 4F2RA 7ICGA 3UQ2A 2ALZA 4ZH4A 4O3QA 1WCNA 4RWPA 3L3FX 4ZOHC 4UB5A 1U49A 3RTVA 4P0PA 1NZBA 4NXTA 5C0YA 5DLGA 2RDJA 4NJ8A 2KN7A 4Y2QA 4BX9C 3KOOA 4MF2A 4QIWC 4JLZA 2ZXIA 2RHFA 4O3SA 4Q8FA 2A19A 2E8PA 4Z6EA 2IHMA 2CN1A 3PSTA 4TUQA 4DL3A 3NVOA 2DFLA 4FS2A 5D49A 4PL2A 1X9MA 2PFNA 4I2GA 4K4IA 1SXEA 2P6UA 2Y0SC 1JALA 2G08A 4TQRA 1T4GA 5L1IA 2HBMA 3LK9A 4M0AA 2DR9A 1MA7A 2WHEA 1NK5A 1SWWA 2EANA 2KZMA 3H8WA 1VJ7A 4F4WA 1QSYA 4QNLA 3RRHA 3NKUA 5KFZA 2CRXA 8ICUA 3LDAA 9ICAA 3TADC 2A1JA 2CPRA 4PZOA 3PVXA 1L3SA 2QARB 3BQ0A 5DG7A 1N62A 1ZOLA 1HJPA 1P7DA 5J2IA 5KG1A 2PMZF 3Q8PB 3ONNA 5IINA 2KVCA 1ZQKA 4K97A 1K5OA 2FMSA 3JCFA 1UA0A 3UQ0A 4CNQA 1RXWA 4B9NA 1CUKA 5IIMA 2H3IA 1X6IA 1XSPA 1ZETA 3UXNA 4YVZA 3WFQE 1KDHA 2DR5A 4NXXA 2HHXA 2KSOA 5KG0A 4JMUA 4QZDA 2BPCA 3JPRA 4J9OA 1ZQWA 4E80A 3BJYA 1QQ5A 3AN1A 3DEEA 1Z1VA 3M7DA 1XSLA 5JUMA 5A0LA 1HIWA 3ERCC 2JMGA 5IILA 1S97A 4FBTA 5HP4A 3HRDD 3NGDA 2NRTA 5DBBA 3PSIA 3SI8A 1M6YA 5J0SA 1LB2B 3GU3A 2WF9A 4GXKA 2JEJA 1A6SA 5ALPA 3ZD9A 3CW2C 1TAMA 5AM3A 4J9KA 4GIBA 4EGWA 4UAUA 4NY8A 8ICOA 2YMPA 4ECWA 2AJQA 1VJ5A 4EV6A 5HRGA 1C20A 5IIOA 2HMXA 2G0AA 1SV0C 1SL2A 3PX6A 1T7PA 4F5OA 1NJXA 2ZJ5A 2O5AA 4UBBA 1PX5A 4X0AA 5KT7A 3ER9B 2YMMA 1PVPA 4QZAA 2FE9A 4QZCA 2ES6A 4AT9A 4YQWA 3TAPA 4RQ2A 4K9BA 2PI5A 3CP8A 7ICJA 2W8KA 3QEBZ 4EYIB 5B5EU 3PW0A 1QQ6A 4HYKA 1JX4A 1YZ7A 3C5GA 4ED0A 3MFIA 4Y2YA 5KFWA 1JI7A 3KFUF 1A77A 1KQQA 5KFFA 4P0QB 4DFDA 1ZQSA 2Y9TA 5CWRA 5CB1A 5J2FA 5D61A 2PMZC 4MF8A 4DL4A 2KSOB 1U4BA 2LYAA 4M5DA 4OD0A 1IXRA 4B9VA 3C2LA 2HI0A 1X9WA 2FPMA 1ZD5A 2Y1IA 4NXWA 5KFBA 2FMPA 4OJOA 5AK3A 1X42A 2C2EA 2L5YA 1YZ6A 5ALSA 1OW5A 3V7JA 4ED6A 4WC0A 4GC6A 4X4SA 4GLXA 1L7PA 4ECRA 3OJSA 5HHHA 3FAHA 3EPGA 3QXGA 1ZQXA 4EELA 3PZPA 2FCLA 1S0NA 2RDIA 4CF3A 2NO5A 3AQFA 4ECXA 4LEVA 2Y1JA 1Y88A 4C8MA 4KX3A 3WK7A 4F93B 3F2CA 2HHWA 4RWQA 4ED7A 3BS7A 3TADA 3WK4A 2GOLA 5J2JA 5HC9A 3ZD8A 4M9JA 2C22A 4XQ8A 3KKAA 2OH2A 1NZPA 2KP7A 2XC9A 4KLEA 2ZHBA 3K1RB 3HKZC 4FHPA 2MSNA 1RQNA 4DQRA 4X4NA 1X9SA 1MC8A 1ZJNA 2HOFA 4O3NA 8ICTA 1JIHA 3SAHA 2NV3A 1ED1A 5HREA 5J2EA 5J2DA 3RJGA 2J6UA 3A0HU 5HNKA 1X6JA 4F5NA 2DUYA 4M6WA 3M1YA 2Q66A 4Z6CA 3A0BU 2F1HA 1Z3EB 4US9A 4KLQA 1OUQA 5F9LA 2ZJ8A 1ZQNA 4PL1A 8ICCA 4BGDA 2AXTU 3N4MB 2BCSA 2VA3A 5KFOA 1DK2A 5AI5A 9ICPA 3D2SA 3ICXA 3TKAA 4DQPA 2JXJA 5ALTA 4DLEA 1PK1B 2ODGA 3OVBA 3O0FA 2M9NA 5J0YA 4N7RA 1FEZA 3HJ4A 3T5HA 4YR3A 3MFHA 4JWNA 4S3NA 5ALHA 2RP5A 3RB6A 5ALVA 5AK6A 1Q46A 5L1MA 2WTFA 4WC7A 4ECVA 2E8OA 3JPOA 3ISDA 4UAYA 3RJFA 1UEUA 3WK9A 3H40A 4XUSA 7ICQA 1SZHA 2W9MA 3TANA 3AQEA 3N97B 4WQKA 2OM6A 1TK0A 5KT5A 2EAOA 2HHQA 1SV0A 3HP6A 1XNSA 3EUB2 3F5EA 2PXIA 1IG6A 4PHPA 5KFDA 1T8EA 2F76X 1ZQGA 3PSPA 3OVSA 5L1JA 4M9NA 2B21A 3F5AA 2H3FA 4RNNA 3QZ8A 3UMCA 1KBUA 5KFMA 3E58A 3HW8A 3V6KA 3Q8SB 1S76D 4O6AA 4DFMA 2W9CA 1SZPA 4RU9A 2I1QA 3M8SA 2ASLA 1KSPA 2ZH9A 2ESEA 4FHYA 5DB8A 2DKZA 3UMBA 3L5KA 2ASDA 3GV5B 4FZLA 5AKEA 8ICVA 4C80A 8ICBA 2BPGA 5HR7A 2BKEA 3T79A 1Z4NA 5GTIU 4I2HA 5HMMA 3N7PD 4DOCA 2PFPA 1QSLA 2IBKA 5B3QA 2QB1A 1VLBA 1WOTA 4NLCA 1Z1BA 3ZDAA 2JH1A 3RF9A 3KHGA 1L5UA 1BPBA 2K4PA 2BE3A 4B6JA 4C7ZA 2G07A 1DGJA 5F2VO 3UXPA 2DRAA 4DOAA 2BCUA 1LVHA 1ZQVA 5K4LA 5AM5A 1COKA 3JYYA 5KL1B 3KHHA 4G3IA 4JV0A 4QZIA 4NM2A 5HR9A 4Y2SA 3C23A 4M9LA 2IHOA 5ALYA 2YB4A 5DGAA 4DFPA 5AI0A 5G5GA 2RQ5A 3J81j 1CEZA 8ICZA 9ICFA 1X40A 4DS5A 3ALRA 3GFKB 3RJKA 5KFIA 4QWAA 2LM4A 2YN4A 4K99A 3PW5A 1L8OA 4WQLA 4M2YA 3GIKA 1BNPA 2R18A 1ZQBA 5AHXA 2ZIVA 3PW2A 3H0RB 3ISBA 8ICLA 4K98A 4EEYA 3BQ1A 2EZYA 3Q8KA 5AIAA 1UA1A 4KLJA 5KTQA 4BXOB 4US8A 1KW4A 4RZRA 4NV0A 2M2TA 1MIWA 3OWGA 2ZH3A 1NI3A 5F9NA 2Y0SF 5AKYA 3ZDBA 4KLFA 5ALKA 4UB1A 4IR9A 8ICIA 2IMWP 2QKQA 9ICWA 4O3OA 4KX5A 4QZEA 3HJEA 8ICSA 4UB8U 3H8MA 4RT2A 3T5LA 4PPXA 4Z6FA 1NK9A 4X4RA 3ZDDA 5KFUA 1UHUA 2QB0A 3GIIA 1L7OA 1V4AA 2JV3A 3DDHA 5EE0A 1SKRA 4KM5A 4EX7A 4O3PA 2MAXA 2XGPA 3MC1A 1NK8A 2W3RA 5ALRA 7ICOA 4B9LA 2RRDA 3T5KA 3PR4A 4DL2A 4WC6A 2XICA 3MDCA 4Y2RA 1MN8A 4C7YA 3HILA 2JEGA 3RBEA 8ICXA 1NKEA 1KTQA 3H3AA 3I76A 2XO7A 1WYGA 4BWJA 3M8RA 3UPSA 5TISU 3I28A 5J2BA 4DSEA 3C2KA 1RYSA 1Q79A 1ZRNA 1JN3A 4ECTA 2PI4A 3BS5B 4FO6A 3ED5A 4ECYA 2ZIVB 4AYBF 2F3NA 4J9NA 1RXVA 1SKSA 1NK4A 3ZDCA 7ICVA 2ID1A 3NYBA 1L8LA 3N28A 4KLMA 2FDRA 1F0MA 3QUQA 1FFVA 5DG8A 3SYZA 2K89A 1RZTA 5AM1A 1GPJA 5ALWA 4DQQA 3QYPA 2Q4TA 4GXIA 2GH1A 3T5JA 2HCFA 2EAMA 2V4RA 3MGVA 9ICXA 1N2XA 2ZUBA 1NJYA 2W9BA 5HR6A 4J9QA 5KT3A 4AT8A 1BPDA 3ZDEA 2GA9D 4XA5A 4ATBB 1TFRA 3EW9A 4UAWA 2UVUA 4UQGA 2D8CA 2RLTA 4X4VA 3MBYA 2ZUDA 1WCLA 4I27A 3BQ7A 5ALOA 2RFFA 4KLUA 1S5LU 4TQSA 2ZIWA 1KLNA 7ICIA 1JXEA 5J8YC 3S6JA 1LV5A 4KB6A 3JZ0A 1VDVA 4B9UA 2DL0A 3G6XA 1JUDA 4WC1A 2OYYA 2R8KA 2NYVA 4NKUA 4R66A 3HPOA 2GWSA 2JZBA 4F71A 4RQ0A 2D6FC 2LKYA 3C66A 4KLGA 4DSKA 2XIDA 3RRGA 3OPXA 4DWIA 3F2BA 3M6ZA 5CHGA 2C28A 2Z7JA 1D8BA 4EP7A 2LYBA 3PNCA 4P2HA 5J2HA 4KLSA 4BJQA 2W3SA 4I2BA 1LKYA 5ALUA 1NOMA 5BOLA 2KTQA 4ELVA 2WF7A 4I29A 1S10A 3EZ5A 1MIYA 4O0IA 4F4ZA 2AH5A 1QSSA 4UB3A 1Q8KA 3OUYA 1V97A 2NRZA 2O1PA 5KAFU 1ZQPA 1QTMA 4E8FA 3RR7A 4NLNA 4P0PB 2W03A 1ZQAA 3GQCA 4J9RA 4OAFA 3WK6A 5DQHA 4AYBC 2F8KA 2M0NA 4DQSA 2HDOA 3PO5A 3NUQA 1DK3A 2HVHA 3TAQA 4IL6U 7ICKA 4YP3A 3HKZF 2EQYA 2KK0A 2FLPA 2HHPA 5H2FU 1R8BA 2VJ4A 1AQ6A 5KNIA 5HRHA 4F92B 1L6NA 2WAQF 1JROA 1X2IA 4A8EA 4F91B 3SZ2A 3WKDA 4WH5A 5CP2A 5KFAA 4YXJA 3RJHA 4RWOA 5DBAA 2G5HB 2HN1A 1ZQOA 4UD5A 2G5IB 3U26A 1TK8A 4NXVA 5EWFA 4RQ1A 7ICLA 5HMLA 2YMLA 3OSNA 4PJ0U 4HX0A 1GO3F 1B4FA 7ICHA 9ICSA 2LPEA 1NNLA 2IHNA 1Q78A 2A1JB 1R8CA 3RAQA 4DL5A 5AKXA 5ALQA 1PVRA 4RPZA 5AKGA 5KFKA 4KMOB 4UBCA 2KKPA 1KFDA 2A3VA 4UATA 5ALIA 2DPIA 4G9BA 1ZQ1C 5CFUA 1J2NA 2KMDA 5KT2A 4KLIA 3B0YA 1WWUA 8ICYA 4NXUA 4XJEA 2A1AA 5IIIA 5AKIA 2M2UA 5AI8A 3LYSA 1ZQFA 2YMQA 9ICUA 4RQ6A 1J97A 4IS7A 3KHRA 2KG5A 2BR0A 5IIKA 1SKWA 4O9MA 1ZXIA 2E1FA 7ICEA 9ICIA 5J2KA 4I2FA 2ZIXA 5FP0A 5IIJA 5L1KA 4FO1A 4YR0A 1COOA 8ICWA 1DXSA 1SXDA 2F77X 5JU5A 4DL7A 4RQ3A 1KNYA 2O6KA 1KL9A 1U9LA 3PMNA 5DDMA 8ICJA 1XSNA 3NS1A 1XS9D 3QE9Y 1D8LA 1B22A 5CFTA 2R8IA 2KICA 1WG8A 1BPXA 4I2AA
chains in the Genus database with same CATH topology
5KFGA 2BPGA 2PFOA 4C8OA 2BKEA 4EBKA 4M04A 3OJUA 4R64A 4I2HA 2ZH1A 1ZQCA 5HMMA 4DOCA 2DRBA 5CA7A 2VA8A 2PFPA 1QSLA 2IBKA 4EZ6A 4JK1A 4XRHA 2ZH4A 2F1IA 1UT8A 4O3RA 5KFJA 4FH3A 4C8NA 3AQLA 2HHTA 5KFPA 1S0OA 3H38A 3V7LA 1H38A 5DQGA 4RPYA 7ICSA 5DKWA 4JV2A 5J0OA 3GIJA 1V9PA 1WOTA 4X4PA 1K1SA 2FLLA 7ICFA 4RQ7A 2AGPA 3ZDAA 3KHGA 1NJWA 4KLDA 2W9BB 1D9FA 1R8AA 4RUCA 5DDYA 9ICMA 1L5UA 9ICTA 1BPBA 2BE3A 4AT9B 4AT8B 5KFQA 5CR0A 3BQTA 4ECQA 5F2VO 5KT6A 3UXPA 2DRAA 1Z00A 2NRVA 4DOAA 3GV7B 4UD4A 2BCUA 4ED1A 2ZTDA 1XWLA 1ZQVA 3HWTA 4DF4A 3RBDA 3RH6A 3JPSA 4RNOA 3JYYA 4FH5A 3KHHA 4C8LA 2FPLA 4G3IA 4BWMA 1C7YA 5DG9A 4JV0A 5EWGA 4QZIA 4MFAA 2KFZA 7ICUA 5KFTA 1TFWA 1ZQIA 4NM2A 4P4OA 5HRDA 5HR9A 4F2RA 3C5FA 7ICGA 1BNOA 3C23A 3UQ2A 4M9LA 2ALZA 5DGAA 4DFPA 2BPFA 4M9HA 4ZH4A 3GV8B 1EXNA 4O3QA 4QWDA 5J0PA 1WCNA 4RWPA 1CEZA 4UB5A 1U49A 3RTVA 4I2CA 4QWBA 8ICZA 9ICFA 5KFLA 5DLGA 5J29A 2RDJA 4DS5A 2ZTCA 2KN7A 3GFKB 1IM4A 4UB2A 3RJKA 1FA0A 1XU4A 5KFIA 4QWAA 4PGQA 1NK6A 4E7XA 4YCXA 4MF2A 4RQ5A 2JZBB 3OGUA 4I2EA 2ZTEA 4O3SA 4FHVA 5DEDA 4Q8FA 4QZ8A 4F3OA 4FHWA 4ED8A 1KFTA 1YLQA 4P4PA 3PW5A 4Z6EA 3RH5A 3GIKA 4KN4A 2IHMA 4M2YA 1BNPA 3HIYA 1ZQBA 4QZGA 4TUQA 4DL3A 3Q8MA 2XY6A 9ICHA 1NKCA 3PW2A 2DFLA 4FS2A 5D49A 5KT4A 3ISBA 2DVIA 1MQ3A 8ICLA 4Q44A 4ECZA 4FHXA 4QZ9A 2KFNA 4EEYA 4WBYA 1X9MA 3BQ1A 2PFNA 4J9LA 3Q8LA 3Q8KA 4I2GA 4K4IA 3PV8A 4WC2A 2P6UA 1UA1A 2HHVA 9ICRA 4KLJA 4YMNA 4B9SA 5KTQA 1TVAA 4BXOB 3RJJA 3MR2A 4KLHA 4RZRA 4B9TA 4TQRA 1T4GA 2M2TA 4AT7B 5KG4A 2W9AA 5L1IA 3WFPA 3LK9A 4GC7A 1MIWA 4X4RA 4M0AA 4IQUA 3AQNA 4QWCA 2J6SA 4O5EA 5J0WA 2ZH3A 2DR9A 5D46A 5F9NA 1ZQHA 7ICNA 4DL6A 4RUAA 4ED3A 1NK5A 3ZDBA 1NKBA 5KFVA 2KZMA 4KLFA 9ICGA 3H8WA 4UB1A 3OUYB 1VJ7A 4F4WA 1QSYA 4IR9A 1OU5A 5J0QA 8ICIA 3RRHA 3H7IA 5KFNA 5L1LA 5KFZA 2IMWP 9ICWA 8ICUA 4QZHA 4O3OA 3LDAA 3OHAA 3UPQA 4QZEA 3OVAA 3WFRE 4F5RA 3PX0A 9ICAA 8ICSA 2A1JA 3PVXA 4RT2A 2H5XA 3T5LA 4R8UA 1L3SA 1ZQMA 3BQ0A 1JXLA 4M9GA 1N56A 5DG7A 4PPXA 4Z6FA 1TV9A 1NK9A 1HJPA 3K4GA 4DSLA 3ZDDA 5KG6A 5J2IA 5KFUA 5KG1A 3Q8PB 5IINA 1XC9A 1L3UA 1ZQKA 3V72A 2FMSA 1NK7A 5KFXA 1UA0A 3WFOA 3GIIA 2BCVA 3UQ0A 4KMUA 1NK0A 2JEIA 3MDAA 4RWNA 5DQIA 1V4AA 1RXWA 9ICCA 4B9NA 1TAQA 4PGYA 3PY8A 1CUKA 4YFKA 5IIMA 5J2GA 3AQMA 4WC3A 4TURA 1SKRA 4Q8EA 3JPQA 4O3PA 3M9OB 3UXNA 1ZETA 4M6WB 1XSPA 2MAXA 4I2JA 3THVA 4YVZA 2XGPA 4YXMA 1KDHA 3WFQE 4NKTA 1NK8A 2W8LA 2DR5A 5C5JA 1Z00B 8ICHA 2HHXA 4JUZA 3KTQA 4KLOA 2DR8A 3RB0A 7ICOA 5KG0A 5DB9A 4QZDA 2BPCA 3V6HA 4B9LA 4P4MA 3JPRA 4J9OA 3T5KA 1ZQWA 1U48A 4YR2A 3PR4A 4DL2A 4E80A 3BJYA 4K4HA 4WC6A 1S0VA 5KFEA 1XSLA 3MDCA 5JUMA 3H4DA 7ICPA 1ZQDA 3MGIA 3RH4A 2JEGA 8ICGA 1ZQEA 5IILA 1S97A 3RBEA 8ICXA 7ICMA 4WBZA 2AQ0A 1NKEA 1KTQA 4I2AA 9ICJA 3Q8QB 3H3AA 4YD2A 2XO7A 2AQ4A 2FPKA 4BWJA 4FBTA 4K4GA 3M8RA 3UPSA 5J2BA 1HUOA 3C1ZA 4DS4A 5EWEA 5HP4A 2XCPA 4DSEA 4IQWA 3C2KA 1RYSA 9ICBA 1Q79A 3NGDA 2KZZA 2NRTA 5DBBA 3SV3A 4F5PA 1JN3A 3SI8A 5J0SA 1LB2B 4ECTA 3JPTA 4JV1A 2HHUA 1AROP 5DLFA 1TAUA 4GXKA 2PI4A 2JEJA 2AU0A 4JWMA 4FO6A 1S9FA 2PFQA 4ECSA 3ZD9A 4ECYA 3TI0A 4X5VA 1L3VA 2PBEA 2HHSA 4FS1A 2LYHA 4PHEA 1HUZA 4J9KA 1K1QA 3C1YA 3PX4A 1BPZA 4J9NA 3LWMA 1RXVA 2V9WA 1SKSA 4NY8A 1NK4A 1MQ2A 3ZDCA 7ICVA 2ID1A 4F2SA 8ICOA 3NYBA 3TQ1A 4I2IA 4ECWA 2AJQA 1VFGA 4KLMA 3PO4A 4GXJA 1ZYQA 1UEVA 5HRGA 1NJZA 2FLNA 5IIOA 4I2DA 4F5QA 4IR1A 3HX0A 4YG2A 5DG8A 1SL2A 3OHBA 3SYZA 1MIVA 3PX6A 1T7PA 1RZTA 4M47A 4RQ8A 4EBCA 4DQQA 1RYRA 4F5OA 1NJXA 4GXIA 2ZJ5A 2C2DA 4NLGA 2R8HA 4J9SA 3T5JA 2O5AA 2ZH6A 3T3FA 4UBBA 1PX5A 5DGBA 1ZQRA 2ZUCA 4CCHA 2V4RA 9ICOA 4DSFA 2BQUA 2I9GA 9ICXA 4X0AA 2ZUBA 9ICVA 2UVWA 5KT7A 2BQ3A 1NJYA 2W9BA 4O5KA 4QZAA 4QZCA 3JPPA 4J9QA 5KT3A 4AT9A 5KG7A 4AT8A 1A76A 1BPDA 4YQWA 3ZDEA 2V4QA 3G6VA 3TAPA 3TFRA 1L3TA 4XA5A 4ATBB 4RQ2A 4YMOA 5EOZA 4PGXA 4PHDA 1TFRA 2PI5A 4IG8A 3EW9A 3PW7A 4UAWA 7ICJA 3FYHA 4UQGA 2UVUA 4WC4A 2W8KA 2HVIA 3QEBZ 5J2AA 4EYIB 2VA2A 4UAZA 3QZ7A 2ZHAA 3MBYA 4X4UA 2ZUDA 3AU6A 4X4VA 5J0XA 1WCLA 4I27A 4LZGA 8ICMA 9ICKA 4RQ4A 1TKDA 1R89A 3QEAZ 2RFFA 3PW0A 2W9CB 4KLUA 4HYKA 4TQSA 1JX4A 4IQVA 5J2CA 4Q45A 3C5GA 4ED0A 3MFIA 3V7KA 1KLNA 2BDPA 5KFWA 5D4BA 4BDPA 4IRCA 1QLNA 2HW3A 1A77A 1S0MA 4ECUA 3RB3A 7ICIA 1JXEA 3EWAA 5KFYA 5KFFA 2J6TA 1LV5A 1D9DA 9ICEA 3JZ0A 2FMQA 4DSJA 5HRKA 4F4YA 1ZQSA 3EYZA 4B9UA 4NLZA 5CWRA 3G6XA 4WC1A 4EZ9A 5CB1A 2BCRA 5J2FA 3TARA 2R8KA 4NKUA 4R66A 3HPOA 2BQRA 4MF8A 1ZQZA 2GWSA 3M9MB 1KRPA 4DL4A 4NLKA 4UB4A 2JZBA 2F1JA 4B9MA 8ICFA 1DGSA 4RQ0A 4WC5A 1TK5A 3PR5B 1U4BA 3C66A 3TFSA 4KLGA 3HJ1A 4DSKA 8ICEA 1BPYA 3RRGA 1IXRA 8ICPA 4YD1A 4M5DA 3OV7A 4B9VA 3C2LA 1X9WA 3NTUA 4DWIA 5DB7A 2FPMA 4QZBA 1ZQLA 2Y1IA 2ASJA 5CHGA 2C28A 3IM1A 4PH5A 4EP7A 5KFBA 2FMPA 5KFSA 2DR7A 1SL0A 2C2EA 3PNCA 4NXZA 4P2HA 3V7JA 1PZNA 5J2HA 4KLSA 4ED6A 8ICAA 4WC0A 4RT3A 4GC6A 4X4SA 4I2BA 4BXOA 3H39A 4GLXA 1ZQYA 3AUOA 2MUTA 5J0UA 4ECRA 4DEZA 1NOMA 5BOLA 5DBCA 3OJSA 1B43A 4QZFA 5HHHA 2KTQA 3EPGA 4ELVA 4MFCA 4I29A 4EBJA 2ZH2A 1S10A 3EZ5A 1MIYA 1ZQXA 3IHQB 4O0IA 4F4ZA 1U47A 3KHLA 1S0NA 2ZH8A 2RDIA 4EYHB 1QSSA 1ZQQA 4QWEA 4UB3A 3B0XA 4ECXA 2NRKA 8ICKA 4X4QA 3OUYA 2Y1JA 1Y88A 4C8MA 2P6RA 2NRZA 3AQKA 4ELUA 3LQCB 4F93B 4RWQA 2HHWA 4ED7A 3HT3A 2O1PA 1ZQPA 1QTMA 4E8FA 3RR7A 4NLNA 4R63A 1ZQAA 5HRLA 3GQCA 4J9RA 4F4XA 4IRDA 5J2JA 5HC9A 3ZD8A 4M9JA 2C22A 4Z6DA 4XQ8A 1NZPA 4KTQA 2KP7A 4Q43A 2XC9A 5DQHA 4KLEA 2ZHBA 4R65A 3ISCA 4FHPA 3WFSC 4DQSA 3MR3A 2IA6A 4DQRA 3PO5A 3MGHA 4X4NA 4FBUA 4IQTA 1X9SA 2HVHA 1DK3A 1MC8A 4DFKA 3TAQA 3RB4A 4O3NA 1ZJNA 1MSWD 1JIHA 1T3NA 8ICQA 8ICTA 5HREA 2NRXA 2ATLA 5J2EA 2KZ3A 3H8JA 4YP3A 5J2DA 5HHIA 3BQ2A 2FLPA 7ICKA 1SL1A 2HHPA 3RJGA 4DO9A 2J6UA 5HNKA 1DOQA 2UVRA 4IRKA 4F5NA 1R8BA 4M6WA 3PW4A 2P66A 5HRBA 4KITB 5KG5A 2Q0ZX 5HRHA 4F92B 4ELTA 2Q66A 3G6YA 4Z6CA 1BPEA 4DF8A 2M2WA 1X2IA 2ZJAA 4F91B 4NM1A 3RR8A 4QW9A 2C2RA 5KFRA 2F1HA 1Z3EB 3SZ2A 4KLQA 1JAJA 2ZH5A 5F9LA 5CP2A 5KFAA 4YXJA 1D8YA 3RJHA 4J9MA 2ZJ8A 4RWOA 5DBAA 1KEJA 1ZQNA 1ZQOA 3RJIA 4UD5A 3EPIA 2ZH7A 8ICCA 4BGDA 3N4MB 2BCSA 2VA3A 5KFOA 1XO1A 5DB6A 1TK8A 7ICRA 1DK2A 8ICRA 5EWFA 4RQ1A 4F4KA 4I28A 5HMLA 1N48A 7ICLA 2NRWA 2BGWA 3JPNA 4DQIA 9ICPA 4X4OA 4MEXA 3OSNA 4DQPA 4DLEA 4X4TA 3OVBA 2M9NA 5J0YA 3OSPA 1NO5A 3HJ4A 3T5HA 4E0DA 4YR3A 1U45A 3MFHA 4KLTA 2AGOA 4KLLA 7ICHA 3ORYA 4JWNA 3H4BA 4S3NA 9ICSA 2BHNA 4YN4A 3RB6A 4MFFA 1Q78A 2IHNA 2A1JB 3E2EA 1R8CA 2WTFA 4TUPA 1UT5A 5L9XA 4R8UB 3H8SA 5HRIA 4ECVA 4WC7A 4EBEA 3JPOA 3RAQA 3ISDA 1TFYA 2XCAA 4DL5A 5BOMA 4UAYA 3GILA 2AGQA 3SV4A 3GIMA 4ED2A 3RJFA 4F8RA 4O5CA 1UEUA 1ZQUA 4RPZA 5TZVA 5KFKA 3Q8RB 3H40A 5CJ7A 4XUSA 7ICQA 4UBCA 4WCWA 2W9MA 1KFDA 3TANA 7ICTA 5KG2A 3N97B 2DPIA 2XGQA 1ZQTA 4RPXA 1TK0A 3C2MA 5KT5A 4DSIA 4KN7A 4DOBA 4DLGA 3GDXA 2HHQA 3C21A 2MUTB 3HP6A 1KFSA 3AU2A 5KT2A 5J0TA 4KLIA 3B0YA 2PXIA 3C18A 4PHPA 8ICYA 3RJEA 5IIIA 2M2UA 5KFDA 3RAXA 1T8EA 3FDSA 4MEYA 4QW8A 1BGXT 3MR6A 4LZDA 1ZQGA 1UETA 3OVSA 1ZQFA 1ZJMA 2XY5A 3MR5A 1S77D 9ICLA 3ETLA 5J0RA 5L1JA 2DPJA 4M9NA 5HRFA 2OWOA 2R8JA 3BDPA 4XQ7A 9ICUA 4RQ6A 4F50A 9ICNA 2B21A 2BCQA 4TUSA 4RNNA 2XY7A 3QZ8A 3LWLA 4J9PA 3V6JA 4ATBA 1ZQJA 3KHRA 2M2VA 2BR0A 5IIKA 1JQRA 5DECA 1SKWA 4O9MA 7ICEA 4RNMA 5KFMA 9ICIA 5J2KA 4I2FA 9ICQA 3H37A 3HW8A 3V6KA 3Q8SB 2ISPA 2JEFA 5KFHA 3M9NB 4LVSA 5IIJA 5L1KA 1S76D 1BVSA 4YR0A 4DFMA 1COOA 2W9CA 8ICWA 4AT7A 1SZPA 4RU9A 2I1QA 3M8SA 2UVVA 4EBDA 3K75D 3L9DA 4DL7A 5KG3A 2ASLA 1F5AA 1KSPA 4RQ3A 1KNYA 3PMLA 2ZH9A 1RPLA 1U9LA 4FHYA 5DB8A 3PMNA 5DDMA 8ICJA 1XSNA 1XS9D 5KFCA 3MABA 3QE9Y 5BPCA 3GV5B 2ASDA 1D8LA 2ISOA 1B22A 3UXOA 4YMMA 4C8KA 4PHAA 1JMSA 2R8IA 8ICVA 4LT6A 8ICNA 2VANA 4X0BA 1BPXA 2R8GA 4DFJA 8ICBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KFG A;  2BPG A;  2PFO A;  4C8O A;  2BKE A;  4EBK A;  4M04 A;  3OJU A;  4R64 A;  4I2H A;  2ZH1 A;  1ZQC A;  5HMM A;  4DOC A;  2DRB A;  5CA7 A;  2VA8 A;  2PFP A;  1QSL A;  2IBK A;  4EZ6 A;  4JK1 A;  4XRH A;  2ZH4 A;  2F1I A;  1UT8 A;  4O3R A;  5KFJ A;  4FH3 A;  4C8N A;  3AQL A;  2HHT A;  5KFP A;  1S0O A;  3H38 A;  3V7L A;  1H38 A;  5DQG A;  4RPY A;  7ICS A;  5DKW A;  4JV2 A;  5J0O A;  3GIJ A;  1V9P A;  1WOT A;  4X4P A;  1K1S A;  2FLL A;  7ICF A;  4RQ7 A;  2AGP A;  3ZDA A;  3KHG A;  1NJW A;  4KLD A;  2W9B B;  1D9F A;  1R8A A;  4RUC A;  5DDY A;  9ICM A;  1L5U A;  9ICT A;  1BPB A;  2BE3 A;  4AT9 B;  4AT8 B;  5KFQ A;  5CR0 A;  3BQT A;  4ECQ A;  5F2V O;  5KT6 A;  3UXP A;  2DRA A;  1Z00 A;  2NRV A;  4DOA A;  3GV7 B;  4UD4 A;  2BCU A;  4ED1 A;  2ZTD A;  1XWL A;  1ZQV A;  3HWT A;  4DF4 A;  3RBD A;  3RH6 A;  3JPS A;  4RNO A;  3JYY A;  4FH5 A;  3KHH A;  4C8L A;  2FPL A;  4G3I A;  4BWM A;  1C7Y A;  5DG9 A;  4JV0 A;  5EWG A;  4QZI A;  4MFA A;  2KFZ A;  7ICU A;  5KFT A;  1TFW A;  1ZQI A;  4NM2 A;  4P4O A;  5HRD A;  5HR9 A;  4F2R A;  3C5F A;  7ICG A;  1BNO A;  3C23 A;  3UQ2 A;  4M9L A;  2ALZ A;  5DGA A;  4DFP A;  2BPF A;  4M9H A;  4ZH4 A;  3GV8 B;  1EXN A;  4O3Q A;  4QWD A;  5J0P A;  1WCN A;  4RWP A;  1CEZ A;  4UB5 A;  1U49 A;  3RTV A;  4I2C A;  4QWB A;  8ICZ A;  9ICF A;  5KFL A;  5DLG A;  5J29 A;  2RDJ A;  4DS5 A;  2ZTC A;  2KN7 A;  3GFK B;  1IM4 A;  4UB2 A;  3RJK A;  1FA0 A;  1XU4 A;  5KFI A;  4QWA A;  4PGQ A;  1NK6 A;  4E7X A;  4YCX A;  4MF2 A;  4RQ5 A;  2JZB B;  3OGU A;  4I2E A;  2ZTE A;  4O3S A;  4FHV A;  5DED A;  4Q8F A;  4QZ8 A;  4F3O A;  4FHW A;  4ED8 A;  1KFT A;  1YLQ A;  4P4P A;  3PW5 A;  4Z6E A;  3RH5 A;  3GIK A;  4KN4 A;  2IHM A;  4M2Y A;  1BNP A;  3HIY A;  1ZQB A;  4QZG A;  4TUQ A;  4DL3 A;  3Q8M A;  2XY6 A;  9ICH A;  1NKC A;  3PW2 A;  2DFL A;  4FS2 A;  5D49 A;  5KT4 A;  3ISB A;  2DVI A;  1MQ3 A;  8ICL A;  4Q44 A;  4ECZ A;  4FHX A;  4QZ9 A;  2KFN A;  4EEY A;  4WBY A;  1X9M A;  3BQ1 A;  2PFN A;  4J9L A;  3Q8L A;  3Q8K A;  4I2G A;  4K4I A;  3PV8 A;  4WC2 A;  2P6U A;  1UA1 A;  2HHV A;  9ICR A;  4KLJ A;  4YMN A;  4B9S A;  5KTQ A;  1TVA A;  4BXO B;  3RJJ A;  3MR2 A;  4KLH A;  4RZR A;  4B9T A;  4TQR A;  1T4G A;  2M2T A;  4AT7 B;  5KG4 A;  2W9A A;  5L1I A;  3WFP A;  3LK9 A;  4GC7 A;  1MIW A;  4X4R A;  4M0A A;  4IQU A;  3AQN A;  4QWC A;  2J6S A;  4O5E A;  5J0W A;  2ZH3 A;  2DR9 A;  5D46 A;  5F9N A;  1ZQH A;  7ICN A;  4DL6 A;  4RUA A;  4ED3 A;  1NK5 A;  3ZDB A;  1NKB A;  5KFV A;  2KZM A;  4KLF A;  9ICG A;  3H8W A;  4UB1 A;  3OUY B;  1VJ7 A;  4F4W A;  1QSY A;  4IR9 A;  1OU5 A;  5J0Q A;  8ICI A;  3RRH A;  3H7I A;  5KFN A;  5L1L A;  5KFZ A;  2IMW P;  9ICW A;  8ICU A;  4QZH A;  4O3O A;  3LDA A;  3OHA A;  3UPQ A;  4QZE A;  3OVA A;  3WFR E;  4F5R A;  3PX0 A;  9ICA A;  8ICS A;  2A1J A;  3PVX A;  4RT2 A;  2H5X A;  3T5L A;  4R8U A;  1L3S A;  1ZQM A;  3BQ0 A;  1JXL A;  4M9G A;  1N56 A;  5DG7 A;  4PPX A;  4Z6F A;  1TV9 A;  1NK9 A;  1HJP A;  3K4G A;  4DSL A;  3ZDD A;  5KG6 A;  5J2I A;  5KFU A;  5KG1 A;  3Q8P B;  5IIN A;  1XC9 A;  1L3U A;  1ZQK A;  3V72 A;  2FMS A;  1NK7 A;  5KFX A;  1UA0 A;  3WFO A;  3GII A;  2BCV A;  3UQ0 A;  4KMU A;  1NK0 A;  2JEI A;  3MDA A;  4RWN A;  5DQI A;  1V4A A;  1RXW A;  9ICC A;  4B9N A;  1TAQ A;  4PGY A;  3PY8 A;  1CUK A;  4YFK A;  5IIM A;  5J2G A;  3AQM A;  4WC3 A;  4TUR A;  1SKR A;  4Q8E A;  3JPQ A;  4O3P A;  3M9O B;  3UXN A;  1ZET A;  4M6W B;  1XSP A;  2MAX A;  4I2J A;  3THV A;  4YVZ A;  2XGP A;  4YXM A;  1KDH A;  3WFQ E;  4NKT A;  1NK8 A;  2W8L A;  2DR5 A;  5C5J A;  1Z00 B;  8ICH A;  2HHX A;  4JUZ A;  3KTQ A;  4KLO A;  2DR8 A;  3RB0 A;  7ICO A;  5KG0 A;  5DB9 A;  4QZD A;  2BPC A;  3V6H A;  4B9L A;  4P4M A;  3JPR A;  4J9O A;  3T5K A;  1ZQW A;  1U48 A;  4YR2 A;  3PR4 A;  4DL2 A;  4E80 A;  3BJY A;  4K4H A;  4WC6 A;  1S0V A;  5KFE A;  1XSL A;  3MDC A;  5JUM A;  3H4D A;  7ICP A;  1ZQD A;  3MGI A;  3RH4 A;  2JEG A;  8ICG A;  1ZQE A;  5IIL A;  1S97 A;  3RBE A;  8ICX A;  7ICM A;  4WBZ A;  2AQ0 A;  1NKE A;  1KTQ A;  4I2A A;  9ICJ A;  3Q8Q B;  3H3A A;  4YD2 A;  2XO7 A;  2AQ4 A;  2FPK A;  4BWJ A;  4FBT A;  4K4G A;  3M8R A;  3UPS A;  5J2B A;  1HUO A;  3C1Z A;  4DS4 A;  5EWE A;  5HP4 A;  2XCP A;  4DSE A;  4IQW A;  3C2K A;  1RYS A;  9ICB A;  1Q79 A;  3NGD A;  2KZZ A;  2NRT A;  5DBB A;  3SV3 A;  4F5P A;  1JN3 A;  3SI8 A;  5J0S A;  1LB2 B;  4ECT A;  3JPT A;  4JV1 A;  2HHU A;  1ARO P;  5DLF A;  1TAU A;  4GXK A;  2PI4 A;  2JEJ A;  2AU0 A;  4JWM A;  4FO6 A;  1S9F A;  2PFQ A;  4ECS A;  3ZD9 A;  4ECY A;  3TI0 A;  4X5V A;  1L3V A;  2PBE A;  2HHS A;  4FS1 A;  2LYH A;  4PHE A;  1HUZ A;  4J9K A;  1K1Q A;  3C1Y A;  3PX4 A;  1BPZ A;  4J9N A;  3LWM A;  1RXV A;  2V9W A;  1SKS A;  4NY8 A;  1NK4 A;  1MQ2 A;  3ZDC A;  7ICV A;  2ID1 A;  4F2S A;  8ICO A;  3NYB A;  3TQ1 A;  4I2I A;  4ECW A;  2AJQ A;  1VFG A;  4KLM A;  3PO4 A;  4GXJ A;  1ZYQ A;  1UEV A;  5HRG A;  1NJZ A;  2FLN A;  5IIO A;  4I2D A;  4F5Q A;  4IR1 A;  3HX0 A;  4YG2 A;  5DG8 A;  1SL2 A;  3OHB A;  3SYZ A;  1MIV A;  3PX6 A;  1T7P A;  1RZT A;  4M47 A;  4RQ8 A;  4EBC A;  4DQQ A;  1RYR A;  4F5O A;  1NJX A;  4GXI A;  2ZJ5 A;  2C2D A;  4NLG A;  2R8H A;  4J9S A;  3T5J A;  2O5A A;  2ZH6 A;  3T3F A;  4UBB A;  1PX5 A;  5DGB A;  1ZQR A;  2ZUC A;  4CCH A;  2V4R A;  9ICO A;  4DSF A;  2BQU A;  2I9G A;  9ICX A;  4X0A A;  2ZUB A;  9ICV A;  2UVW A;  5KT7 A;  2BQ3 A;  1NJY A;  2W9B A;  4O5K A;  4QZA A;  4QZC A;  3JPP A;  4J9Q A;  5KT3 A;  4AT9 A;  5KG7 A;  4AT8 A;  1A76 A;  1BPD A;  4YQW A;  3ZDE A;  2V4Q A;  3G6V A;  3TAP A;  3TFR A;  1L3T A;  4XA5 A;  4ATB B;  4RQ2 A;  4YMO A;  5EOZ A;  4PGX A;  4PHD A;  1TFR A;  2PI5 A;  4IG8 A;  3EW9 A;  3PW7 A;  4UAW A;  7ICJ A;  3FYH A;  4UQG A;  2UVU A;  4WC4 A;  2W8K A;  2HVI A;  3QEB Z;  5J2A A;  4EYI B;  2VA2 A;  4UAZ A;  3QZ7 A;  2ZHA A;  3MBY A;  4X4U A;  2ZUD A;  3AU6 A;  4X4V A;  5J0X A;  1WCL A;  4I27 A;  4LZG A;  8ICM A;  9ICK A;  4RQ4 A;  1TKD A;  1R89 A;  3QEA Z;  2RFF A;  3PW0 A;  2W9C B;  4KLU A;  4HYK A;  4TQS A;  1JX4 A;  4IQV A;  5J2C A;  4Q45 A;  3C5G A;  4ED0 A;  3MFI A;  3V7K A;  1KLN A;  2BDP A;  5KFW A;  5D4B A;  4BDP A;  4IRC A;  1QLN A;  2HW3 A;  1A77 A;  1S0M A;  4ECU A;  3RB3 A;  7ICI A;  1JXE A;  3EWA A;  5KFY A;  5KFF A;  2J6T A;  1LV5 A;  1D9D A;  9ICE A;  3JZ0 A;  2FMQ A;  4DSJ A;  5HRK A;  4F4Y A;  1ZQS A;  3EYZ A;  4B9U A;  4NLZ A;  5CWR A;  3G6X A;  4WC1 A;  4EZ9 A;  5CB1 A;  2BCR A;  5J2F A;  3TAR A;  2R8K A;  4NKU A;  4R66 A;  3HPO A;  2BQR A;  4MF8 A;  1ZQZ A;  2GWS A;  3M9M B;  1KRP A;  4DL4 A;  4NLK A;  4UB4 A;  2JZB A;  2F1J A;  4B9M A;  8ICF A;  1DGS A;  4RQ0 A;  4WC5 A;  1TK5 A;  3PR5 B;  1U4B A;  3C66 A;  3TFS A;  4KLG A;  3HJ1 A;  4DSK A;  8ICE A;  1BPY A;  3RRG A;  1IXR A;  8ICP A;  4YD1 A;  4M5D A;  3OV7 A;  4B9V A;  3C2L A;  1X9W A;  3NTU A;  4DWI A;  5DB7 A;  2FPM A;  4QZB A;  1ZQL A;  2Y1I A;  2ASJ A;  5CHG A;  2C28 A;  3IM1 A;  4PH5 A;  4EP7 A;  5KFB A;  2FMP A;  5KFS A;  2DR7 A;  1SL0 A;  2C2E A;  3PNC A;  4NXZ A;  4P2H A;  3V7J A;  1PZN A;  5J2H A;  4KLS A;  4ED6 A;  8ICA A;  4WC0 A;  4RT3 A;  4GC6 A;  4X4S A;  4I2B A;  4BXO A;  3H39 A;  4GLX A;  1ZQY A;  3AUO A;  2MUT A;  5J0U A;  4ECR A;  4DEZ A;  1NOM A;  5BOL A;  5DBC A;  3OJS A;  1B43 A;  4QZF A;  5HHH A;  2KTQ A;  3EPG A;  4ELV A;  4MFC A;  4I29 A;  4EBJ A;  2ZH2 A;  1S10 A;  3EZ5 A;  1MIY A;  1ZQX A;  3IHQ B;  4O0I A;  4F4Z A;  1U47 A;  3KHL A;  1S0N A;  2ZH8 A;  2RDI A;  4EYH B;  1QSS A;  1ZQQ A;  4QWE A;  4UB3 A;  3B0X A;  4ECX A;  2NRK A;  8ICK A;  4X4Q A;  3OUY A;  2Y1J A;  1Y88 A;  4C8M A;  2P6R A;  2NRZ A;  3AQK A;  4ELU A;  3LQC B;  4F93 B;  4RWQ A;  2HHW A;  4ED7 A;  3HT3 A;  2O1P A;  1ZQP A;  1QTM A;  4E8F A;  3RR7 A;  4NLN A;  4R63 A;  1ZQA A;  5HRL A;  3GQC A;  4J9R A;  4F4X A;  4IRD A;  5J2J A;  5HC9 A;  3ZD8 A;  4M9J A;  2C22 A;  4Z6D A;  4XQ8 A;  1NZP A;  4KTQ A;  2KP7 A;  4Q43 A;  2XC9 A;  5DQH A;  4KLE A;  2ZHB A;  4R65 A;  3ISC A;  4FHP A;  3WFS C;  4DQS A;  3MR3 A;  2IA6 A;  4DQR A;  3PO5 A;  3MGH A;  4X4N A;  4FBU A;  4IQT A;  1X9S A;  2HVH A;  1DK3 A;  1MC8 A;  4DFK A;  3TAQ A;  3RB4 A;  4O3N A;  1ZJN A;  1MSW D;  1JIH A;  1T3N A;  8ICQ A;  8ICT A;  5HRE A;  2NRX A;  2ATL A;  5J2E A;  2KZ3 A;  3H8J A;  4YP3 A;  5J2D A;  5HHI A;  3BQ2 A;  2FLP A;  7ICK A;  1SL1 A;  2HHP A;  3RJG A;  4DO9 A;  2J6U A;  5HNK A;  1DOQ A;  2UVR A;  4IRK A;  4F5N A;  1R8B A;  4M6W A;  3PW4 A;  2P66 A;  5HRB A;  4KIT B;  5KG5 A;  2Q0Z X;  5HRH A;  4F92 B;  4ELT A;  2Q66 A;  3G6Y A;  4Z6C A;  1BPE A;  4DF8 A;  2M2W A;  1X2I A;  2ZJA A;  4F91 B;  4NM1 A;  3RR8 A;  4QW9 A;  2C2R A;  5KFR A;  2F1H A;  1Z3E B;  3SZ2 A;  4KLQ A;  1JAJ A;  2ZH5 A;  5F9L A;  5CP2 A;  5KFA A;  4YXJ A;  1D8Y A;  3RJH A;  4J9M A;  2ZJ8 A;  4RWO A;  5DBA A;  1KEJ A;  1ZQN A;  1ZQO A;  3RJI A;  4UD5 A;  3EPI A;  2ZH7 A;  8ICC A;  4BGD A;  3N4M B;  2BCS A;  2VA3 A;  5KFO A;  1XO1 A;  5DB6 A;  1TK8 A;  7ICR A;  1DK2 A;  8ICR A;  5EWF A;  4RQ1 A;  4F4K A;  4I28 A;  5HML A;  1N48 A;  7ICL A;  2NRW A;  2BGW A;  3JPN A;  4DQI A;  9ICP A;  4X4O A;  4MEX A;  3OSN A;  4DQP A;  4DLE A;  4X4T A;  3OVB A;  2M9N A;  5J0Y A;  3OSP A;  1NO5 A;  3HJ4 A;  3T5H A;  4E0D A;  4YR3 A;  1U45 A;  3MFH A;  4KLT A;  2AGO A;  4KLL A;  7ICH A;  3ORY A;  4JWN A;  3H4B A;  4S3N A;  9ICS A;  2BHN A;  4YN4 A;  3RB6 A;  4MFF A;  1Q78 A;  2IHN A;  2A1J B;  3E2E A;  1R8C A;  2WTF A;  4TUP A;  1UT5 A;  5L9X A;  4R8U B;  3H8S A;  5HRI A;  4ECV A;  4WC7 A;  4EBE A;  3JPO A;  3RAQ A;  3ISD A;  1TFY A;  2XCA A;  4DL5 A;  5BOM A;  4UAY A;  3GIL A;  2AGQ A;  3SV4 A;  3GIM A;  4ED2 A;  3RJF A;  4F8R A;  4O5C A;  1UEU A;  1ZQU A;  4RPZ A;  5TZV A;  5KFK A;  3Q8R B;  3H40 A;  5CJ7 A;  4XUS A;  7ICQ A;  4UBC A;  4WCW A;  2W9M A;  1KFD A;  3TAN A;  7ICT A;  5KG2 A;  3N97 B;  2DPI A;  2XGQ A;  1ZQT A;  4RPX A;  1TK0 A;  3C2M A;  5KT5 A;  4DSI A;  4KN7 A;  4DOB A;  4DLG A;  3GDX A;  2HHQ A;  3C21 A;  2MUT B;  3HP6 A;  1KFS A;  3AU2 A;  5KT2 A;  5J0T A;  4KLI A;  3B0Y A;  2PXI A;  3C18 A;  4PHP A;  8ICY A;  3RJE A;  5III A;  2M2U A;  5KFD A;  3RAX A;  1T8E A;  3FDS A;  4MEY A;  4QW8 A;  1BGX T;  3MR6 A;  4LZD A;  1ZQG A;  1UET A;  3OVS A;  1ZQF A;  1ZJM A;  2XY5 A;  3MR5 A;  1S77 D;  9ICL A;  3ETL A;  5J0R A;  5L1J A;  2DPJ A;  4M9N A;  5HRF A;  2OWO A;  2R8J A;  3BDP A;  4XQ7 A;  9ICU A;  4RQ6 A;  4F50 A;  9ICN A;  2B21 A;  2BCQ A;  4TUS A;  4RNN A;  2XY7 A;  3QZ8 A;  3LWL A;  4J9P A;  3V6J A;  4ATB A;  1ZQJ A;  3KHR A;  2M2V A;  2BR0 A;  5IIK A;  1JQR A;  5DEC A;  1SKW A;  4O9M A;  7ICE A;  4RNM A;  5KFM A;  9ICI A;  5J2K A;  4I2F A;  9ICQ A;  3H37 A;  3HW8 A;  3V6K A;  3Q8S B;  2ISP A;  2JEF A;  5KFH A;  3M9N B;  4LVS A;  5IIJ A;  5L1K A;  1S76 D;  1BVS A;  4YR0 A;  4DFM A;  1COO A;  2W9C A;  8ICW A;  4AT7 A;  1SZP A;  4RU9 A;  2I1Q A;  3M8S A;  2UVV A;  4EBD A;  3K75 D;  3L9D A;  4DL7 A;  5KG3 A;  2ASL A;  1F5A A;  1KSP A;  4RQ3 A;  1KNY A;  3PML A;  2ZH9 A;  1RPL A;  1U9L A;  4FHY A;  5DB8 A;  3PMN A;  5DDM A;  8ICJ A;  1XSN A;  1XS9 D;  5KFC A;  3MAB A;  3QE9 Y;  5BPC A;  3GV5 B;  2ASD A;  1D8L A;  2ISO A;  1B22 A;  3UXO A;  4YMM A;  4C8K A;  4PHA A;  1JMS A;  2R8I A;  8ICV A;  4LT6 A;  8ICN A;  2VAN A;  4X0B A;  1BPX A;  2R8G A;  4DFJ A;  8ICB A; 
#chains in the Genus database with same CATH topology
 4C8O A;  4EBK A;  3OJU A;  2ZH1 A;  3QNM A;  2FJ6 A;  4OAH A;  4EZ6 A;  5JRT A;  3OTQ A;  4JK1 A;  2F1I A;  4O3R A;  4Y2U A;  5KFJ A;  4FH3 A;  4C8N A;  3AQL A;  5KFP A;  2YTU A;  3V7L A;  3NVV A;  1KKX A;  3H38 A;  5DQG A;  4JV2 A;  2AHO B;  4UW9 A;  1K1S A;  2WAQ C;  7ICF A;  3IRU A;  1QH9 A;  2LM1 A;  1D9F A;  4K96 A;  4ACO A;  4AT9 B;  9ICT A;  5CR0 A;  1Z00 A;  2NRV A;  3GV7 B;  4UD4 A;  1OXJ A;  5B3P A;  4ED1 A;  2ZTD A;  4DF4 A;  3JPS A;  2FPL A;  3QX7 A;  4BWM A;  5DG9 A;  1ZQI A;  4P4O A;  5HRD A;  2GO7 A;  3C5F A;  2KV2 A;  1J2M A;  2W7P A;  2DKX A;  4M9H A;  3GV8 B;  4QWD A;  5ALM A;  5KFL A;  2ZTC A;  1IM4 A;  1RG6 A;  2QLT A;  1NK6 A;  4E7X A;  3F2D A;  4YCX A;  2DGZ A;  3WKB A;  4I2E A;  2ZTE A;  4FHV A;  5DED A;  2HSZ A;  4FHW A;  4JB3 A;  1KFT A;  4P4P A;  2B51 A;  3H0M B;  4QZG A;  4CDG A;  2XY6 A;  9ICH A;  1NKC A;  5KT4 A;  3AL0 B;  1MQ3 A;  4ECZ A;  2KFN A;  4J9L A;  2XI9 A;  1QCK A;  3AM9 A;  4WC2 A;  4YMN A;  5JTI A;  4B9S A;  5CHE A;  1N5X A;  3MR2 A;  2DBY A;  2JRZ A;  1WWV A;  1B0X A;  5KG4 A;  2W9A A;  1UPH A;  1V85 A;  4IQU A;  3AQN A;  4QWC A;  2J6S A;  4O5E A;  5J0W A;  5AI4 A;  4CRX A;  1ZQH A;  3UMG A;  4RUA A;  5ALF A;  2MRL A;  3DV9 A;  2OHF A;  2PKE A;  5J0Q A;  3H7I A;  2ZXH A;  3OHA A;  3UPQ A;  3OVA A;  3NRZ A;  3PX0 A;  2I6X A;  4R8U A;  1X66 A;  4M9G A;  2KHQ A;  5KG6 A;  1L3U A;  5AM2 A;  2BCV A;  2K4I A;  5AM4 A;  2JEI A;  4RWN A;  1RQL A;  4NL9 C;  5EE9 A;  9ICC A;  5J2G A;  4TUR A;  4Q8E A;  4M6W B;  4LEZ A;  4YXM A;  4NKT A;  2W8L A;  1Z00 B;  8ICH A;  4KLO A;  2HOQ A;  5DB9 A;  4K4H A;  1X9X A;  8ICG A;  4O69 A;  3Q8Q B;  4YD2 A;  2AQ4 A;  1HUO A;  2XCP A;  2KZZ A;  3SV3 A;  3LVV A;  4BUG A;  3JPT A;  4JV1 A;  2HHU A;  3QU7 A;  1ARO P;  5DLF A;  1JRP A;  5AM0 A;  4JWM A;  2PFQ A;  4CF4 A;  4X5V A;  1HUZ A;  4Y2J A;  3PX4 A;  1BPZ A;  5ALD A;  3LWM A;  1MQ2 A;  3TQ1 A;  4I2I A;  1WUD A;  4GXJ A;  1ZYQ A;  2WFA A;  2KJ9 A;  1NJZ A;  4I2D A;  1YT3 A;  4F5Q A;  3LVW A;  1MIV A;  3F53 A;  2HBJ A;  1RYR A;  4EBC A;  2JH7 A;  2C2D A;  2ZH6 A;  2R8H A;  2E5S A;  5DGB A;  1ZQR A;  4CCH A;  9ICO A;  1KN5 A;  2BQ3 A;  4CF5 A;  3JPP A;  4O67 A;  3G6V A;  2B6G A;  4IG8 A;  4K9A A;  2K4E A;  3FYH A;  1A0P A;  2F2A B;  2HVI A;  2GLE A;  2K8C B;  4UAZ A;  3QZ7 A;  1Z19 A;  1SWV A;  4PZN A;  3AU6 A;  3QUT A;  4LZG A;  8ICM A;  4RQ4 A;  1TKD A;  1R89 A;  3QEA Z;  3NVW A;  4QJF B;  2W9C B;  4IQV A;  4BDP A;  3V7K A;  1QLN A;  4IRC A;  2YQE A;  4ECU A;  3EWA A;  5KFY A;  4DSJ A;  4F4Y A;  3BZK A;  4EZ9 A;  3TAR A;  3RFA A;  2BQR A;  3M9M B;  1KRP A;  4UB4 A;  4B9M A;  3TFS A;  3HJ1 A;  8ICE A;  1SV4 A;  4UAS A;  8ICP A;  4ICA A;  4YD1 A;  2IOF K;  3CK6 A;  2WF6 A;  5DB7 A;  4UAR A;  1ZQL A;  3C29 A;  3IM1 A;  2HBL A;  5KFS A;  2W7O A;  5ALL A;  3SQI A;  1PZN A;  3IDW A;  3NAS A;  3CRX A;  3QUC A;  3H39 A;  3AUO A;  3QU2 A;  5J0U A;  5DBC A;  4QZF A;  3CYM A;  4MFC A;  1N63 A;  2ZIU A;  4EBJ A;  3IHQ B;  4MHV A;  3KHL A;  5E79 U;  2ZH8 A;  4EYH B;  2NRK A;  4OJL A;  8ICK A;  4X4Q A;  2P6R A;  3AQK A;  4ELU A;  3LQC B;  3HT3 A;  3GZF A;  4R63 A;  5HRL A;  4F4X A;  1L7N A;  4IRD A;  1ECW A;  4Q43 A;  5JTG A;  2K8B B;  2DWQ A;  2IA6 A;  4FBU A;  2G06 A;  4DFK A;  1MSW D;  1T3N A;  4C4R A;  4NL9 A;  5ALN A;  3BQ2 A;  1DOQ A;  2UVR A;  4IRK A;  3PW4 A;  2P66 A;  5HRB A;  2Q0Z X;  5AKK A;  2Y9U A;  3G6Y A;  4DF8 A;  1BPE A;  4NM1 A;  4OAG A;  4QW9 A;  2K4H A;  5KFR A;  4J9M A;  5AK4 A;  3EPI A;  1XO1 A;  2W11 A;  4F4K A;  1N48 A;  4OAI Z;  2KVS A;  2NRW A;  4X4O A;  3OSP A;  4E0D A;  3B9J A;  4KLL A;  1RM6 C;  2DF4 B;  4MFF A;  2F44 A;  3E2E A;  4TUP A;  1ZD4 A;  4EBE A;  1TFY A;  5BOM A;  2EWR A;  3SV4 A;  3GIM A;  4O5C A;  4F8R A;  2QB0 B;  4USA A;  3Q8R B;  2KD1 A;  4FZN A;  5CJ7 A;  4WCW A;  5B66 U;  3QU9 A;  7ICT A;  4RQM A;  3QU5 A;  2XGQ A;  1ZQT A;  4OO1 J;  1S8O A;  4RPX A;  1O08 A;  4DSI A;  5KL8 B;  4HAI A;  4DLG A;  3GDX A;  5J0T A;  4K8V A;  3KBB A;  3RJE A;  3RAX A;  4EEK A;  1UET A;  4QW8 A;  4EEB A;  2ZIU B;  5F3X B;  4LZD A;  3IV6 A;  1ZJM A;  3MR5 A;  9ICL A;  3ETL A;  4Y2V A;  5HRF A;  5AKJ A;  4F72 A;  3BDP A;  2BCQ A;  4TUS A;  2MU2 A;  2OCE A;  2XY7 A;  4J9P A;  3LWL A;  3V6J A;  1ZQJ A;  5DEC A;  3NVY A;  4RNM A;  3WKA A;  9ICQ A;  3H37 A;  2W43 A;  2ISP A;  1L7M A;  3KKA C;  5KFH A;  2JEF A;  1BVS A;  3WKC A;  4AT7 A;  2KEY A;  2IUB A;  2UVV A;  4EBD A;  5KG3 A;  4P0Q A;  1DRG A;  5KFC A;  4OJ5 A;  2ISO A;  4C8K A;  4PHA A;  1JMS A;  2WB1 F;  8ICN A;  2P35 A;  2VAN A;  3C28 A;  3N7R C;  5GTH U;  2BDU A;  2PFO A;  1IIP A;  3D2Q A;  2BBH A;  4R64 A;  2IOH A;  2EAP A;  2DRB A;  3IG5 A;  4AP9 A;  2ZH4 A;  4XRH A;  1UT8 A;  4NWI A;  1S0O A;  1T94 A;  1CI4 A;  5DKW A;  5J0O A;  3GIJ A;  1V9P A;  4X4P A;  2FLL A;  4Y2P A;  4RQ7 A;  1ZD3 A;  2W9B B;  4RUC A;  4AT8 B;  5KFQ A;  4U6P A;  2FI1 A;  2NO4 A;  3VCB A;  1Z4O A;  1XWL A;  3RBD A;  3WU2 U;  3KZI U;  4FH5 A;  5D62 A;  1C7Y A;  5EWG A;  2KFZ A;  5KFT A;  4I0U A;  2ZIW B;  1BNO A;  1V38 A;  3SAF A;  2BPF A;  1HEK A;  1EXN A;  1FFU A;  2HOI A;  5J0P A;  4I2C A;  4QWB A;  4EEN A;  5J29 A;  4FZM A;  4UB2 A;  1FA0 A;  2B0C A;  1XU4 A;  4PGQ A;  3QU4 A;  4RQ5 A;  2JZB B;  3OGU A;  4QZ8 A;  4F3O A;  1ZRM A;  4ED8 A;  1YLQ A;  2B4V A;  3RH5 A;  3HIY A;  4KN4 A;  4WBY A;  3AEV A;  2F8L A;  3Q8M A;  2DVI A;  3IP4 B;  4Q44 A;  4C4S A;  4QZ9 A;  1FO4 A;  4FHX A;  5CRX A;  3Q8L A;  4EED A;  3PV8 A;  2HHV A;  9ICR A;  2KIW A;  1TVA A;  3RJJ A;  1LKY B;  4KLH A;  4B9T A;  3ZI4 A;  3D6J A;  4AT7 B;  3WFP A;  4GC7 A;  2KOB A;  5D46 A;  7ICN A;  4OJP A;  4DL6 A;  4ED3 A;  4Y2T A;  2G09 A;  4OJ6 A;  5KFV A;  1NKB A;  9ICG A;  2BBJ A;  3OUY B;  2E8N A;  1OU5 A;  1XO0 A;  1PK1 A;  5KFN A;  2H3V A;  5L1L A;  5T14 A;  4QZH A;  3WFR E;  4F5R A;  2H5X A;  1ZQM A;  1JXL A;  1N56 A;  1TV9 A;  3K4G A;  4DSL A;  1XC9 A;  3V72 A;  1NK7 A;  2WB1 C;  5KFX A;  3WFO A;  4KMU A;  5J8Y A;  1NK0 A;  3MDA A;  5DQI A;  4DCC A;  1TAQ A;  4PGY A;  3PY8 A;  4YFK A;  2E8M A;  4WC3 A;  3JPQ A;  3M9O B;  4I2J A;  3THV A;  1F5S A;  2I5H A;  2N1R A;  4WJ3 B;  5C5J A;  4JUZ A;  3KTQ A;  2DR8 A;  2H3Z A;  3RB0 A;  2BZF A;  3V6H A;  2ZG6 A;  4P4M A;  1U48 A;  4YR2 A;  1ZD2 P;  1FIQ A;  1S0V A;  2MA1 A;  5KFE A;  2DQN B;  3H4D A;  7ICP A;  1ZQD A;  3MGI A;  3RH4 A;  1ZQE A;  5KAI U;  4WBZ A;  7ICM A;  2AQ0 A;  9ICJ A;  2FPK A;  3VC8 A;  4K4G A;  4IQW A;  3C1Z A;  4DS4 A;  5EWE A;  9ICB A;  2K60 A;  2HBK A;  2YB1 A;  3MCR A;  4F5P A;  1UCV A;  2D3D A;  1TAU A;  2AU0 A;  5ALG A;  1S9F A;  4ECS A;  1L3V A;  3TI0 A;  4Y2X A;  2PBE A;  2HHS A;  3CNH A;  4FS1 A;  2LYH A;  2YX8 A;  4PHE A;  2B56 A;  1K1Q A;  3C1Y A;  2V9W A;  2JGA A;  4F2S A;  1VFG A;  1SIJ A;  3FC4 A;  3PO4 A;  4RQN A;  1UEV A;  1IV8 A;  2FLN A;  4IR1 A;  3HX0 A;  4YG2 A;  3OHB A;  4M47 A;  4RQ8 A;  2EH9 A;  4CGZ A;  3K1Z A;  4NLG A;  4J9S A;  3T3F A;  2ZUC A;  4DSF A;  2BQU A;  2I9G A;  9ICV A;  2UVW A;  4J03 A;  4GFJ A;  4O5K A;  3SD7 A;  5KG7 A;  1A76 A;  5ALJ A;  2V4Q A;  3TFR A;  1L3T A;  5AI9 A;  4YMO A;  5EOZ A;  4PHD A;  4PGX A;  5AK5 A;  3PW7 A;  4WC4 A;  2K8A A;  5J2A A;  2VA2 A;  4X4U A;  1PK3 A;  2ZHA A;  2ZIX B;  3NVZ A;  5J0X A;  3K7D A;  2EDU A;  9ICK A;  4Q45 A;  5J2C A;  3AQM A;  3KZX A;  2BDP A;  5D4B A;  2HW3 A;  1S0M A;  3RB3 A;  5AKL A;  1Q3V A;  2J6T A;  9ICE A;  1D9D A;  5G5H A;  2FMQ A;  4FE3 A;  5HRK A;  5ALZ A;  3EYZ A;  5EE1 A;  4NLZ A;  2YY6 A;  1QQ7 A;  3L4P A;  2BCR A;  2HN2 A;  4LEY A;  3ETR A;  2JHD A;  1ZQZ A;  4NLK A;  2F1J A;  8ICF A;  1DGS A;  4WC5 A;  1TK5 A;  3PR5 B;  1BPY A;  3OV7 A;  2LMR A;  3NTU A;  4UB6 U;  2OEH A;  2KNJ A;  4QZB A;  2ASJ A;  4PH5 A;  2VIX A;  3UM9 A;  4MKP A;  2DR7 A;  1SL0 A;  4NXZ A;  2W55 A;  4EX6 A;  8ICA A;  4RT3 A;  4FFD A;  4BXO A;  1ZQY A;  2MUT A;  4DEZ A;  1B43 A;  1N5W A;  3KD3 A;  2ZH2 A;  2VJ5 A;  3AMZ A;  1U47 A;  1ZQQ A;  4QWE A;  3B0X A;  4UAV A;  4IC9 A;  1TE2 A;  4Z6D A;  4KTQ A;  3EF2 A;  1CRX A;  4R65 A;  3ISC A;  3WFS C;  2OXO A;  3MR3 A;  3MGH A;  3WK8 A;  4IQT A;  1O03 A;  3RB4 A;  8ICQ A;  5AIB A;  2NRX A;  2ATL A;  2KZ3 A;  3H8J A;  3SAG A;  5HHI A;  3PSF A;  4U7C A;  1SL1 A;  4DO9 A;  3IG8 A;  2VKQ A;  4KIT B;  5KG5 A;  2KHV A;  4ELT A;  2M2W A;  3SEN A;  2ZJA A;  2EZZ A;  3RR8 A;  2C2R A;  1N60 A;  1JAJ A;  2ZH5 A;  3N7S C;  2KJ8 A;  1D8Y A;  3PHZ A;  3WKE A;  1KEJ A;  3BZC A;  2W54 A;  3RJI A;  2XVT A;  2ZH7 A;  7ICR A;  4O68 A;  2LHT A;  5DB6 A;  8ICR A;  4I28 A;  2BGW A;  3JPN A;  4DQI A;  4MEX A;  4X4T A;  2E3T A;  1PUZ A;  2KKV A;  1URJ A;  1NO5 A;  1Q3U A;  1U45 A;  4KLT A;  2AGO A;  3ORY A;  3H4B A;  2BHN A;  4YN4 A;  1SB3 C;  5HRI A;  1UT5 A;  5L9X A;  3BS5 A;  3H8S A;  4R8U B;  1RYU A;  4JLX A;  2XCA A;  5ALE A;  3GIL A;  2AGQ A;  2JR5 A;  4ED2 A;  4QIW F;  1ZQU A;  5TZV A;  3QUB A;  5KG2 A;  3C2M A;  4KN7 A;  4DOB A;  5CEH A;  3C21 A;  2MUT B;  1KFS A;  3AU2 A;  4OCZ A;  3C18 A;  3SR6 A;  1SGG A;  3FDS A;  4MEY A;  3MR6 A;  1BGX T;  3NRW A;  5AI6 A;  2XY5 A;  1S77 D;  1N61 A;  5J0R A;  2DPJ A;  3D2N A;  2OWO A;  2R8J A;  4NLB A;  4XQ7 A;  4F50 A;  4C4T A;  9ICN A;  3FM9 A;  4ATB A;  2IOF A;  2M2V A;  1JQR A;  1T3Q A;  3M9N B;  4LVS A;  5AIC A;  3H0L B;  3SEI A;  2WF5 A;  3TAC B;  2EZX A;  1PVQ A;  3K75 D;  2WF8 A;  3M6K A;  4LEW A;  3L9D A;  1F5A A;  3R9K A;  3PML A;  2CXY A;  1RPL A;  3ER8 C;  5EE3 A;  3MAB A;  5BPC A;  5ALX A;  2H3Q A;  2W04 A;  3UXO A;  4YMM A;  2GAF D;  4O3M A;  4LT6 A;  4X0B A;  2E1E A;  2R8G A;  4DFJ A;  1UQV A;  5KFG A;  3E0F A;  3NWI A;  2KE7 A;  4M04 A;  2LI6 A;  1ZQC A;  2QAR A;  5AKZ A;  5CA7 A;  2VA8 A;  4CE6 A;  4LJX A;  1F44 A;  2HHT A;  1RDF A;  1H38 A;  4RPY A;  7ICS A;  5CFS A;  2AGP A;  5AKH A;  2LBO A;  1NJW A;  4KLD A;  1R8A A;  5D63 A;  5DDY A;  9ICM A;  2KIV A;  3SMV A;  4WOY A;  3WK5 A;  3BQT A;  4ECQ A;  5KT6 A;  3IN5 A;  3HWT A;  2KJ5 A;  3RH6 A;  4C0Z A;  4RNO A;  4C8L A;  7ICU A;  1TFW A;  4MFA A;  3I1Y A;  4F2R A;  7ICG A;  3UQ2 A;  2ALZ A;  4ZH4 A;  4O3Q A;  1WCN A;  4RWP A;  3L3F X;  4ZOH C;  4UB5 A;  1U49 A;  3RTV A;  4P0P A;  1NZB A;  4NXT A;  5C0Y A;  5DLG A;  2RDJ A;  4NJ8 A;  2KN7 A;  4Y2Q A;  4BX9 C;  3KOO A;  4MF2 A;  4QIW C;  4JLZ A;  2ZXI A;  2RHF A;  4O3S A;  4Q8F A;  2A19 A;  2E8P A;  4Z6E A;  2IHM A;  2CN1 A;  3PST A;  4TUQ A;  4DL3 A;  3NVO A;  2DFL A;  4FS2 A;  5D49 A;  4PL2 A;  1X9M A;  2PFN A;  4I2G A;  4K4I A;  1SXE A;  2P6U A;  2Y0S C;  1JAL A;  2G08 A;  4TQR A;  1T4G A;  5L1I A;  2HBM A;  3LK9 A;  4M0A A;  2DR9 A;  1MA7 A;  2WHE A;  1NK5 A;  1SWW A;  2EAN A;  2KZM A;  3H8W A;  1VJ7 A;  4F4W A;  1QSY A;  4QNL A;  3RRH A;  3NKU A;  5KFZ A;  2CRX A;  8ICU A;  3LDA A;  9ICA A;  3TAD C;  2A1J A;  2CPR A;  4PZO A;  3PVX A;  1L3S A;  2QAR B;  3BQ0 A;  5DG7 A;  1N62 A;  1ZOL A;  1HJP A;  1P7D A;  5J2I A;  5KG1 A;  2PMZ F;  3Q8P B;  3ONN A;  5IIN A;  2KVC A;  1ZQK A;  4K97 A;  1K5O A;  2FMS A;  3JCF A;  1UA0 A;  3UQ0 A;  4CNQ A;  1RXW A;  4B9N A;  1CUK A;  5IIM A;  2H3I A;  1X6I A;  1XSP A;  1ZET A;  3UXN A;  4YVZ A;  3WFQ E;  1KDH A;  2DR5 A;  4NXX A;  2HHX A;  2KSO A;  5KG0 A;  4JMU A;  4QZD A;  2BPC A;  3JPR A;  4J9O A;  1ZQW A;  4E80 A;  3BJY A;  1QQ5 A;  3AN1 A;  3DEE A;  1Z1V A;  3M7D A;  1XSL A;  5JUM A;  5A0L A;  1HIW A;  3ERC C;  2JMG A;  5IIL A;  1S97 A;  4FBT A;  5HP4 A;  3HRD D;  3NGD A;  2NRT A;  5DBB A;  3PSI A;  3SI8 A;  1M6Y A;  5J0S A;  1LB2 B;  3GU3 A;  2WF9 A;  4GXK A;  2JEJ A;  1A6S A;  5ALP A;  3ZD9 A;  3CW2 C;  1TAM A;  5AM3 A;  4J9K A;  4GIB A;  4EGW A;  4UAU A;  4NY8 A;  8ICO A;  2YMP A;  4ECW A;  2AJQ A;  1VJ5 A;  4EV6 A;  5HRG A;  1C20 A;  5IIO A;  2HMX A;  2G0A A;  1SV0 C;  1SL2 A;  3PX6 A;  1T7P A;  4F5O A;  1NJX A;  2ZJ5 A;  2O5A A;  4UBB A;  1PX5 A;  4X0A A;  5KT7 A;  3ER9 B;  2YMM A;  1PVP A;  4QZA A;  2FE9 A;  4QZC A;  2ES6 A;  4AT9 A;  4YQW A;  3TAP A;  4RQ2 A;  4K9B A;  2PI5 A;  3CP8 A;  7ICJ A;  2W8K A;  3QEB Z;  4EYI B;  5B5E U;  3PW0 A;  1QQ6 A;  4HYK A;  1JX4 A;  1YZ7 A;  3C5G A;  4ED0 A;  3MFI A;  4Y2Y A;  5KFW A;  1JI7 A;  3KFU F;  1A77 A;  1KQQ A;  5KFF A;  4P0Q B;  4DFD A;  1ZQS A;  2Y9T A;  5CWR A;  5CB1 A;  5J2F A;  5D61 A;  2PMZ C;  4MF8 A;  4DL4 A;  2KSO B;  1U4B A;  2LYA A;  4M5D A;  4OD0 A;  1IXR A;  4B9V A;  3C2L A;  2HI0 A;  1X9W A;  2FPM A;  1ZD5 A;  2Y1I A;  4NXW A;  5KFB A;  2FMP A;  4OJO A;  5AK3 A;  1X42 A;  2C2E A;  2L5Y A;  1YZ6 A;  5ALS A;  1OW5 A;  3V7J A;  4ED6 A;  4WC0 A;  4GC6 A;  4X4S A;  4GLX A;  1L7P A;  4ECR A;  3OJS A;  5HHH A;  3FAH A;  3EPG A;  3QXG A;  1ZQX A;  4EEL A;  3PZP A;  2FCL A;  1S0N A;  2RDI A;  4CF3 A;  2NO5 A;  3AQF A;  4ECX A;  4LEV A;  2Y1J A;  1Y88 A;  4C8M A;  4KX3 A;  3WK7 A;  4F93 B;  3F2C A;  2HHW A;  4RWQ A;  4ED7 A;  3BS7 A;  3TAD A;  3WK4 A;  2GOL A;  5J2J A;  5HC9 A;  3ZD8 A;  4M9J A;  2C22 A;  4XQ8 A;  3KKA A;  2OH2 A;  1NZP A;  2KP7 A;  2XC9 A;  4KLE A;  2ZHB A;  3K1R B;  3HKZ C;  4FHP A;  2MSN A;  1RQN A;  4DQR A;  4X4N A;  1X9S A;  1MC8 A;  1ZJN A;  2HOF A;  4O3N A;  8ICT A;  1JIH A;  3SAH A;  2NV3 A;  1ED1 A;  5HRE A;  5J2E A;  5J2D A;  3RJG A;  2J6U A;  3A0H U;  5HNK A;  1X6J A;  4F5N A;  2DUY A;  4M6W A;  3M1Y A;  2Q66 A;  4Z6C A;  3A0B U;  2F1H A;  1Z3E B;  4US9 A;  4KLQ A;  1OUQ A;  5F9L A;  2ZJ8 A;  1ZQN A;  4PL1 A;  8ICC A;  4BGD A;  2AXT U;  3N4M B;  2BCS A;  2VA3 A;  5KFO A;  1DK2 A;  5AI5 A;  9ICP A;  3D2S A;  3ICX A;  3TKA A;  4DQP A;  2JXJ A;  5ALT A;  4DLE A;  1PK1 B;  2ODG A;  3OVB A;  3O0F A;  2M9N A;  5J0Y A;  4N7R A;  1FEZ A;  3HJ4 A;  3T5H A;  4YR3 A;  3MFH A;  4JWN A;  4S3N A;  5ALH A;  2RP5 A;  3RB6 A;  5ALV A;  5AK6 A;  1Q46 A;  5L1M A;  2WTF A;  4WC7 A;  4ECV A;  2E8O A;  3JPO A;  3ISD A;  4UAY A;  3RJF A;  1UEU A;  3WK9 A;  3H40 A;  4XUS A;  7ICQ A;  1SZH A;  2W9M A;  3TAN A;  3AQE A;  3N97 B;  4WQK A;  2OM6 A;  1TK0 A;  5KT5 A;  2EAO A;  2HHQ A;  1SV0 A;  3HP6 A;  1XNS A;  3EUB 2;  3F5E A;  2PXI A;  1IG6 A;  4PHP A;  5KFD A;  1T8E A;  2F76 X;  1ZQG A;  3PSP A;  3OVS A;  5L1J A;  4M9N A;  2B21 A;  3F5A A;  2H3F A;  4RNN A;  3QZ8 A;  3UMC A;  1KBU A;  5KFM A;  3E58 A;  3HW8 A;  3V6K A;  3Q8S B;  1S76 D;  4O6A A;  4DFM A;  2W9C A;  1SZP A;  4RU9 A;  2I1Q A;  3M8S A;  2ASL A;  1KSP A;  2ZH9 A;  2ESE A;  4FHY A;  5DB8 A;  2DKZ A;  3UMB A;  3L5K A;  2ASD A;  3GV5 B;  4FZL A;  5AKE A;  8ICV A;  4C80 A;  8ICB A;  2BPG A;  5HR7 A;  2BKE A;  3T79 A;  1Z4N A;  5GTI U;  4I2H A;  5HMM A;  3N7P D;  4DOC A;  2PFP A;  1QSL A;  2IBK A;  5B3Q A;  2QB1 A;  1VLB A;  1WOT A;  4NLC A;  1Z1B A;  3ZDA A;  2JH1 A;  3RF9 A;  3KHG A;  1L5U A;  1BPB A;  2K4P A;  2BE3 A;  4B6J A;  4C7Z A;  2G07 A;  1DGJ A;  5F2V O;  3UXP A;  2DRA A;  4DOA A;  2BCU A;  1LVH A;  1ZQV A;  5K4L A;  5AM5 A;  1COK A;  3JYY A;  5KL1 B;  3KHH A;  4G3I A;  4JV0 A;  4QZI A;  4NM2 A;  5HR9 A;  4Y2S A;  3C23 A;  4M9L A;  2IHO A;  5ALY A;  2YB4 A;  5DGA A;  4DFP A;  5AI0 A;  5G5G A;  2RQ5 A;  3J81 j;  1CEZ A;  8ICZ A;  9ICF A;  1X40 A;  4DS5 A;  3ALR A;  3GFK B;  3RJK A;  5KFI A;  4QWA A;  2LM4 A;  2YN4 A;  4K99 A;  3PW5 A;  1L8O A;  4WQL A;  4M2Y A;  3GIK A;  1BNP A;  2R18 A;  1ZQB A;  5AHX A;  2ZIV A;  3PW2 A;  3H0R B;  3ISB A;  8ICL A;  4K98 A;  4EEY A;  3BQ1 A;  2EZY A;  3Q8K A;  5AIA A;  1UA1 A;  4KLJ A;  5KTQ A;  4BXO B;  4US8 A;  1KW4 A;  4RZR A;  4NV0 A;  2M2T A;  1MIW A;  3OWG A;  2ZH3 A;  1NI3 A;  5F9N A;  2Y0S F;  5AKY A;  3ZDB A;  4KLF A;  5ALK A;  4UB1 A;  4IR9 A;  8ICI A;  2IMW P;  2QKQ A;  9ICW A;  4O3O A;  4KX5 A;  4QZE A;  3HJE A;  8ICS A;  4UB8 U;  3H8M A;  4RT2 A;  3T5L A;  4PPX A;  4Z6F A;  1NK9 A;  4X4R A;  3ZDD A;  5KFU A;  1UHU A;  2QB0 A;  3GII A;  1L7O A;  1V4A A;  2JV3 A;  3DDH A;  5EE0 A;  1SKR A;  4KM5 A;  4EX7 A;  4O3P A;  2MAX A;  2XGP A;  3MC1 A;  1NK8 A;  2W3R A;  5ALR A;  7ICO A;  4B9L A;  2RRD A;  3T5K A;  3PR4 A;  4DL2 A;  4WC6 A;  2XIC A;  3MDC A;  4Y2R A;  1MN8 A;  4C7Y A;  3HIL A;  2JEG A;  3RBE A;  8ICX A;  1NKE A;  1KTQ A;  3H3A A;  3I76 A;  2XO7 A;  1WYG A;  4BWJ A;  3M8R A;  3UPS A;  5TIS U;  3I28 A;  5J2B A;  4DSE A;  3C2K A;  1RYS A;  1Q79 A;  1ZRN A;  1JN3 A;  4ECT A;  2PI4 A;  3BS5 B;  4FO6 A;  3ED5 A;  4ECY A;  2ZIV B;  4AYB F;  2F3N A;  4J9N A;  1RXV A;  1SKS A;  1NK4 A;  3ZDC A;  7ICV A;  2ID1 A;  3NYB A;  1L8L A;  3N28 A;  4KLM A;  2FDR A;  1F0M A;  3QUQ A;  1FFV A;  5DG8 A;  3SYZ A;  2K89 A;  1RZT A;  5AM1 A;  1GPJ A;  5ALW A;  4DQQ A;  3QYP A;  2Q4T A;  4GXI A;  2GH1 A;  3T5J A;  2HCF A;  2EAM A;  2V4R A;  3MGV A;  9ICX A;  1N2X A;  2ZUB A;  1NJY A;  2W9B A;  5HR6 A;  4J9Q A;  5KT3 A;  4AT8 A;  1BPD A;  3ZDE A;  2GA9 D;  4XA5 A;  4ATB B;  1TFR A;  3EW9 A;  4UAW A;  2UVU A;  4UQG A;  2D8C A;  2RLT A;  4X4V A;  3MBY A;  2ZUD A;  1WCL A;  4I27 A;  3BQ7 A;  5ALO A;  2RFF A;  4KLU A;  1S5L U;  4TQS A;  2ZIW A;  1KLN A;  7ICI A;  1JXE A;  5J8Y C;  3S6J A;  1LV5 A;  4KB6 A;  3JZ0 A;  1VDV A;  4B9U A;  2DL0 A;  3G6X A;  1JUD A;  4WC1 A;  2OYY A;  2R8K A;  2NYV A;  4NKU A;  4R66 A;  3HPO A;  2GWS A;  2JZB A;  4F71 A;  4RQ0 A;  2D6F C;  2LKY A;  3C66 A;  4KLG A;  4DSK A;  2XID A;  3RRG A;  3OPX A;  4DWI A;  3F2B A;  3M6Z A;  5CHG A;  2C28 A;  2Z7J A;  1D8B A;  4EP7 A;  2LYB A;  3PNC A;  4P2H A;  5J2H A;  4KLS A;  4BJQ A;  2W3S A;  4I2B A;  1LKY A;  5ALU A;  1NOM A;  5BOL A;  2KTQ A;  4ELV A;  2WF7 A;  4I29 A;  1S10 A;  3EZ5 A;  1MIY A;  4O0I A;  4F4Z A;  2AH5 A;  1QSS A;  4UB3 A;  1Q8K A;  3OUY A;  1V97 A;  2NRZ A;  2O1P A;  5KAF U;  1ZQP A;  1QTM A;  4E8F A;  3RR7 A;  4NLN A;  4P0P B;  2W03 A;  1ZQA A;  3GQC A;  4J9R A;  4OAF A;  3WK6 A;  5DQH A;  4AYB C;  2F8K A;  2M0N A;  4DQS A;  2HDO A;  3PO5 A;  3NUQ A;  1DK3 A;  2HVH A;  3TAQ A;  4IL6 U;  7ICK A;  4YP3 A;  3HKZ F;  2EQY A;  2KK0 A;  2FLP A;  2HHP A;  5H2F U;  1R8B A;  2VJ4 A;  1AQ6 A;  5KNI A;  5HRH A;  4F92 B;  1L6N A;  2WAQ F;  1JRO A;  1X2I A;  4A8E A;  4F91 B;  3SZ2 A;  3WKD A;  4WH5 A;  5CP2 A;  5KFA A;  4YXJ A;  3RJH A;  4RWO A;  5DBA A;  2G5H B;  2HN1 A;  1ZQO A;  4UD5 A;  2G5I B;  3U26 A;  1TK8 A;  4NXV A;  5EWF A;  4RQ1 A;  7ICL A;  5HML A;  2YML A;  3OSN A;  4PJ0 U;  4HX0 A;  1GO3 F;  1B4F A;  7ICH A;  9ICS A;  2LPE A;  1NNL A;  2IHN A;  1Q78 A;  2A1J B;  1R8C A;  3RAQ A;  4DL5 A;  5AKX A;  5ALQ A;  1PVR A;  4RPZ A;  5AKG A;  5KFK A;  4KMO B;  4UBC A;  2KKP A;  1KFD A;  2A3V A;  4UAT A;  5ALI A;  2DPI A;  4G9B A;  1ZQ1 C;  5CFU A;  1J2N A;  2KMD A;  5KT2 A;  4KLI A;  3B0Y A;  1WWU A;  8ICY A;  4NXU A;  4XJE A;  2A1A A;  5III A;  5AKI A;  2M2U A;  5AI8 A;  3LYS A;  1ZQF A;  2YMQ A;  9ICU A;  4RQ6 A;  1J97 A;  4IS7 A;  3KHR A;  2KG5 A;  2BR0 A;  5IIK A;  1SKW A;  4O9M A;  1ZXI A;  2E1F A;  7ICE A;  9ICI A;  5J2K A;  4I2F A;  2ZIX A;  5FP0 A;  5IIJ A;  5L1K A;  4FO1 A;  4YR0 A;  1COO A;  8ICW A;  1DXS A;  1SXD A;  2F77 X;  5JU5 A;  4DL7 A;  4RQ3 A;  1KNY A;  2O6K A;  1KL9 A;  1U9L A;  3PMN A;  5DDM A;  8ICJ A;  1XSN A;  3NS1 A;  1XS9 D;  3QE9 Y;  1D8L A;  1B22 A;  5CFT A;  2R8I A;  2KIC A;  1WG8 A;  1BPX A;  4I2A A; 
#chains in the Genus database with same CATH homology
 5KFG A;  2BPG A;  2PFO A;  4C8O A;  2BKE A;  4EBK A;  4M04 A;  3OJU A;  4R64 A;  4I2H A;  2ZH1 A;  1ZQC A;  5HMM A;  4DOC A;  2DRB A;  5CA7 A;  2VA8 A;  2PFP A;  1QSL A;  2IBK A;  4EZ6 A;  4JK1 A;  4XRH A;  2ZH4 A;  2F1I A;  1UT8 A;  4O3R A;  5KFJ A;  4FH3 A;  4C8N A;  3AQL A;  2HHT A;  5KFP A;  1S0O A;  3H38 A;  3V7L A;  1H38 A;  5DQG A;  4RPY A;  7ICS A;  5DKW A;  4JV2 A;  5J0O A;  3GIJ A;  1V9P A;  1WOT A;  4X4P A;  1K1S A;  2FLL A;  7ICF A;  4RQ7 A;  2AGP A;  3ZDA A;  3KHG A;  1NJW A;  4KLD A;  2W9B B;  1D9F A;  1R8A A;  4RUC A;  5DDY A;  9ICM A;  1L5U A;  9ICT A;  1BPB A;  2BE3 A;  4AT9 B;  4AT8 B;  5KFQ A;  5CR0 A;  3BQT A;  4ECQ A;  5F2V O;  5KT6 A;  3UXP A;  2DRA A;  1Z00 A;  2NRV A;  4DOA A;  3GV7 B;  4UD4 A;  2BCU A;  4ED1 A;  2ZTD A;  1XWL A;  1ZQV A;  3HWT A;  4DF4 A;  3RBD A;  3RH6 A;  3JPS A;  4RNO A;  3JYY A;  4FH5 A;  3KHH A;  4C8L A;  2FPL A;  4G3I A;  4BWM A;  1C7Y A;  5DG9 A;  4JV0 A;  5EWG A;  4QZI A;  4MFA A;  2KFZ A;  7ICU A;  5KFT A;  1TFW A;  1ZQI A;  4NM2 A;  4P4O A;  5HRD A;  5HR9 A;  4F2R A;  3C5F A;  7ICG A;  1BNO A;  3C23 A;  3UQ2 A;  4M9L A;  2ALZ A;  5DGA A;  4DFP A;  2BPF A;  4M9H A;  4ZH4 A;  3GV8 B;  1EXN A;  4O3Q A;  4QWD A;  5J0P A;  1WCN A;  4RWP A;  1CEZ A;  4UB5 A;  1U49 A;  3RTV A;  4I2C A;  4QWB A;  8ICZ A;  9ICF A;  5KFL A;  5DLG A;  5J29 A;  2RDJ A;  4DS5 A;  2ZTC A;  2KN7 A;  3GFK B;  1IM4 A;  4UB2 A;  3RJK A;  1FA0 A;  1XU4 A;  5KFI A;  4QWA A;  4PGQ A;  1NK6 A;  4E7X A;  4YCX A;  4MF2 A;  4RQ5 A;  2JZB B;  3OGU A;  4I2E A;  2ZTE A;  4O3S A;  4FHV A;  5DED A;  4Q8F A;  4QZ8 A;  4F3O A;  4FHW A;  4ED8 A;  1KFT A;  1YLQ A;  4P4P A;  3PW5 A;  4Z6E A;  3RH5 A;  3GIK A;  4KN4 A;  2IHM A;  4M2Y A;  1BNP A;  3HIY A;  1ZQB A;  4QZG A;  4TUQ A;  4DL3 A;  3Q8M A;  2XY6 A;  9ICH A;  1NKC A;  3PW2 A;  2DFL A;  4FS2 A;  5D49 A;  5KT4 A;  3ISB A;  2DVI A;  1MQ3 A;  8ICL A;  4Q44 A;  4ECZ A;  4FHX A;  4QZ9 A;  2KFN A;  4EEY A;  4WBY A;  1X9M A;  3BQ1 A;  2PFN A;  4J9L A;  3Q8L A;  3Q8K A;  4I2G A;  4K4I A;  3PV8 A;  4WC2 A;  2P6U A;  1UA1 A;  2HHV A;  9ICR A;  4KLJ A;  4YMN A;  4B9S A;  5KTQ A;  1TVA A;  4BXO B;  3RJJ A;  3MR2 A;  4KLH A;  4RZR A;  4B9T A;  4TQR A;  1T4G A;  2M2T A;  4AT7 B;  5KG4 A;  2W9A A;  5L1I A;  3WFP A;  3LK9 A;  4GC7 A;  1MIW A;  4X4R A;  4M0A A;  4IQU A;  3AQN A;  4QWC A;  2J6S A;  4O5E A;  5J0W A;  2ZH3 A;  2DR9 A;  5D46 A;  5F9N A;  1ZQH A;  7ICN A;  4DL6 A;  4RUA A;  4ED3 A;  1NK5 A;  3ZDB A;  1NKB A;  5KFV A;  2KZM A;  4KLF A;  9ICG A;  3H8W A;  4UB1 A;  3OUY B;  1VJ7 A;  4F4W A;  1QSY A;  4IR9 A;  1OU5 A;  5J0Q A;  8ICI A;  3RRH A;  3H7I A;  5KFN A;  5L1L A;  5KFZ A;  2IMW P;  9ICW A;  8ICU A;  4QZH A;  4O3O A;  3LDA A;  3OHA A;  3UPQ A;  4QZE A;  3OVA A;  3WFR E;  4F5R A;  3PX0 A;  9ICA A;  8ICS A;  2A1J A;  3PVX A;  4RT2 A;  2H5X A;  3T5L A;  4R8U A;  1L3S A;  1ZQM A;  3BQ0 A;  1JXL A;  4M9G A;  1N56 A;  5DG7 A;  4PPX A;  4Z6F A;  1TV9 A;  1NK9 A;  1HJP A;  3K4G A;  4DSL A;  3ZDD A;  5KG6 A;  5J2I A;  5KFU A;  5KG1 A;  3Q8P B;  5IIN A;  1XC9 A;  1L3U A;  1ZQK A;  3V72 A;  2FMS A;  1NK7 A;  5KFX A;  1UA0 A;  3WFO A;  3GII A;  2BCV A;  3UQ0 A;  4KMU A;  1NK0 A;  2JEI A;  3MDA A;  4RWN A;  5DQI A;  1V4A A;  1RXW A;  9ICC A;  4B9N A;  1TAQ A;  4PGY A;  3PY8 A;  1CUK A;  4YFK A;  5IIM A;  5J2G A;  3AQM A;  4WC3 A;  4TUR A;  1SKR A;  4Q8E A;  3JPQ A;  4O3P A;  3M9O B;  3UXN A;  1ZET A;  4M6W B;  1XSP A;  2MAX A;  4I2J A;  3THV A;  4YVZ A;  2XGP A;  4YXM A;  1KDH A;  3WFQ E;  4NKT A;  1NK8 A;  2W8L A;  2DR5 A;  5C5J A;  1Z00 B;  8ICH A;  2HHX A;  4JUZ A;  3KTQ A;  4KLO A;  2DR8 A;  3RB0 A;  7ICO A;  5KG0 A;  5DB9 A;  4QZD A;  2BPC A;  3V6H A;  4B9L A;  4P4M A;  3JPR A;  4J9O A;  3T5K A;  1ZQW A;  1U48 A;  4YR2 A;  3PR4 A;  4DL2 A;  4E80 A;  3BJY A;  4K4H A;  4WC6 A;  1S0V A;  5KFE A;  1XSL A;  3MDC A;  5JUM A;  3H4D A;  7ICP A;  1ZQD A;  3MGI A;  3RH4 A;  2JEG A;  8ICG A;  1ZQE A;  5IIL A;  1S97 A;  3RBE A;  8ICX A;  7ICM A;  4WBZ A;  2AQ0 A;  1NKE A;  1KTQ A;  4I2A A;  9ICJ A;  3Q8Q B;  3H3A A;  4YD2 A;  2XO7 A;  2AQ4 A;  2FPK A;  4BWJ A;  4FBT A;  4K4G A;  3M8R A;  3UPS A;  5J2B A;  1HUO A;  3C1Z A;  4DS4 A;  5EWE A;  5HP4 A;  2XCP A;  4DSE A;  4IQW A;  3C2K A;  1RYS A;  9ICB A;  1Q79 A;  3NGD A;  2KZZ A;  2NRT A;  5DBB A;  3SV3 A;  4F5P A;  1JN3 A;  3SI8 A;  5J0S A;  1LB2 B;  4ECT A;  3JPT A;  4JV1 A;  2HHU A;  1ARO P;  5DLF A;  1TAU A;  4GXK A;  2PI4 A;  2JEJ A;  2AU0 A;  4JWM A;  4FO6 A;  1S9F A;  2PFQ A;  4ECS A;  3ZD9 A;  4ECY A;  3TI0 A;  4X5V A;  1L3V A;  2PBE A;  2HHS A;  4FS1 A;  2LYH A;  4PHE A;  1HUZ A;  4J9K A;  1K1Q A;  3C1Y A;  3PX4 A;  1BPZ A;  4J9N A;  3LWM A;  1RXV A;  2V9W A;  1SKS A;  4NY8 A;  1NK4 A;  1MQ2 A;  3ZDC A;  7ICV A;  2ID1 A;  4F2S A;  8ICO A;  3NYB A;  3TQ1 A;  4I2I A;  4ECW A;  2AJQ A;  1VFG A;  4KLM A;  3PO4 A;  4GXJ A;  1ZYQ A;  1UEV A;  5HRG A;  1NJZ A;  2FLN A;  5IIO A;  4I2D A;  4F5Q A;  4IR1 A;  3HX0 A;  4YG2 A;  5DG8 A;  1SL2 A;  3OHB A;  3SYZ A;  1MIV A;  3PX6 A;  1T7P A;  1RZT A;  4M47 A;  4RQ8 A;  4EBC A;  4DQQ A;  1RYR A;  4F5O A;  1NJX A;  4GXI A;  2ZJ5 A;  2C2D A;  4NLG A;  2R8H A;  4J9S A;  3T5J A;  2O5A A;  2ZH6 A;  3T3F A;  4UBB A;  1PX5 A;  5DGB A;  1ZQR A;  2ZUC A;  4CCH A;  2V4R A;  9ICO A;  4DSF A;  2BQU A;  2I9G A;  9ICX A;  4X0A A;  2ZUB A;  9ICV A;  2UVW A;  5KT7 A;  2BQ3 A;  1NJY A;  2W9B A;  4O5K A;  4QZA A;  4QZC A;  3JPP A;  4J9Q A;  5KT3 A;  4AT9 A;  5KG7 A;  4AT8 A;  1A76 A;  1BPD A;  4YQW A;  3ZDE A;  2V4Q A;  3G6V A;  3TAP A;  3TFR A;  1L3T A;  4XA5 A;  4ATB B;  4RQ2 A;  4YMO A;  5EOZ A;  4PGX A;  4PHD A;  1TFR A;  2PI5 A;  4IG8 A;  3EW9 A;  3PW7 A;  4UAW A;  7ICJ A;  3FYH A;  4UQG A;  2UVU A;  4WC4 A;  2W8K A;  2HVI A;  3QEB Z;  5J2A A;  4EYI B;  2VA2 A;  4UAZ A;  3QZ7 A;  2ZHA A;  3MBY A;  4X4U A;  2ZUD A;  3AU6 A;  4X4V A;  5J0X A;  1WCL A;  4I27 A;  4LZG A;  8ICM A;  9ICK A;  4RQ4 A;  1TKD A;  1R89 A;  3QEA Z;  2RFF A;  3PW0 A;  2W9C B;  4KLU A;  4HYK A;  4TQS A;  1JX4 A;  4IQV A;  5J2C A;  4Q45 A;  3C5G A;  4ED0 A;  3MFI A;  3V7K A;  1KLN A;  2BDP A;  5KFW A;  5D4B A;  4BDP A;  4IRC A;  1QLN A;  2HW3 A;  1A77 A;  1S0M A;  4ECU A;  3RB3 A;  7ICI A;  1JXE A;  3EWA A;  5KFY A;  5KFF A;  2J6T A;  1LV5 A;  1D9D A;  9ICE A;  3JZ0 A;  2FMQ A;  4DSJ A;  5HRK A;  4F4Y A;  1ZQS A;  3EYZ A;  4B9U A;  4NLZ A;  5CWR A;  3G6X A;  4WC1 A;  4EZ9 A;  5CB1 A;  2BCR A;  5J2F A;  3TAR A;  2R8K A;  4NKU A;  4R66 A;  3HPO A;  2BQR A;  4MF8 A;  1ZQZ A;  2GWS A;  3M9M B;  1KRP A;  4DL4 A;  4NLK A;  4UB4 A;  2JZB A;  2F1J A;  4B9M A;  8ICF A;  1DGS A;  4RQ0 A;  4WC5 A;  1TK5 A;  3PR5 B;  1U4B A;  3C66 A;  3TFS A;  4KLG A;  3HJ1 A;  4DSK A;  8ICE A;  1BPY A;  3RRG A;  1IXR A;  8ICP A;  4YD1 A;  4M5D A;  3OV7 A;  4B9V A;  3C2L A;  1X9W A;  3NTU A;  4DWI A;  5DB7 A;  2FPM A;  4QZB A;  1ZQL A;  2Y1I A;  2ASJ A;  5CHG A;  2C28 A;  3IM1 A;  4PH5 A;  4EP7 A;  5KFB A;  2FMP A;  5KFS A;  2DR7 A;  1SL0 A;  2C2E A;  3PNC A;  4NXZ A;  4P2H A;  3V7J A;  1PZN A;  5J2H A;  4KLS A;  4ED6 A;  8ICA A;  4WC0 A;  4RT3 A;  4GC6 A;  4X4S A;  4I2B A;  4BXO A;  3H39 A;  4GLX A;  1ZQY A;  3AUO A;  2MUT A;  5J0U A;  4ECR A;  4DEZ A;  1NOM A;  5BOL A;  5DBC A;  3OJS A;  1B43 A;  4QZF A;  5HHH A;  2KTQ A;  3EPG A;  4ELV A;  4MFC A;  4I29 A;  4EBJ A;  2ZH2 A;  1S10 A;  3EZ5 A;  1MIY A;  1ZQX A;  3IHQ B;  4O0I A;  4F4Z A;  1U47 A;  3KHL A;  1S0N A;  2ZH8 A;  2RDI A;  4EYH B;  1QSS A;  1ZQQ A;  4QWE A;  4UB3 A;  3B0X A;  4ECX A;  2NRK A;  8ICK A;  4X4Q A;  3OUY A;  2Y1J A;  1Y88 A;  4C8M A;  2P6R A;  2NRZ A;  3AQK A;  4ELU A;  3LQC B;  4F93 B;  4RWQ A;  2HHW A;  4ED7 A;  3HT3 A;  2O1P A;  1ZQP A;  1QTM A;  4E8F A;  3RR7 A;  4NLN A;  4R63 A;  1ZQA A;  5HRL A;  3GQC A;  4J9R A;  4F4X A;  4IRD A;  5J2J A;  5HC9 A;  3ZD8 A;  4M9J A;  2C22 A;  4Z6D A;  4XQ8 A;  1NZP A;  4KTQ A;  2KP7 A;  4Q43 A;  2XC9 A;  5DQH A;  4KLE A;  2ZHB A;  4R65 A;  3ISC A;  4FHP A;  3WFS C;  4DQS A;  3MR3 A;  2IA6 A;  4DQR A;  3PO5 A;  3MGH A;  4X4N A;  4FBU A;  4IQT A;  1X9S A;  2HVH A;  1DK3 A;  1MC8 A;  4DFK A;  3TAQ A;  3RB4 A;  4O3N A;  1ZJN A;  1MSW D;  1JIH A;  1T3N A;  8ICQ A;  8ICT A;  5HRE A;  2NRX A;  2ATL A;  5J2E A;  2KZ3 A;  3H8J A;  4YP3 A;  5J2D A;  5HHI A;  3BQ2 A;  2FLP A;  7ICK A;  1SL1 A;  2HHP A;  3RJG A;  4DO9 A;  2J6U A;  5HNK A;  1DOQ A;  2UVR A;  4IRK A;  4F5N A;  1R8B A;  4M6W A;  3PW4 A;  2P66 A;  5HRB A;  4KIT B;  5KG5 A;  2Q0Z X;  5HRH A;  4F92 B;  4ELT A;  2Q66 A;  3G6Y A;  4Z6C A;  1BPE A;  4DF8 A;  2M2W A;  1X2I A;  2ZJA A;  4F91 B;  4NM1 A;  3RR8 A;  4QW9 A;  2C2R A;  5KFR A;  2F1H A;  1Z3E B;  3SZ2 A;  4KLQ A;  1JAJ A;  2ZH5 A;  5F9L A;  5CP2 A;  5KFA A;  4YXJ A;  1D8Y A;  3RJH A;  4J9M A;  2ZJ8 A;  4RWO A;  5DBA A;  1KEJ A;  1ZQN A;  1ZQO A;  3RJI A;  4UD5 A;  3EPI A;  2ZH7 A;  8ICC A;  4BGD A;  3N4M B;  2BCS A;  2VA3 A;  5KFO A;  1XO1 A;  5DB6 A;  1TK8 A;  7ICR A;  1DK2 A;  8ICR A;  5EWF A;  4RQ1 A;  4F4K A;  4I28 A;  5HML A;  1N48 A;  7ICL A;  2NRW A;  2BGW A;  3JPN A;  4DQI A;  9ICP A;  4X4O A;  4MEX A;  3OSN A;  4DQP A;  4DLE A;  4X4T A;  3OVB A;  2M9N A;  5J0Y A;  3OSP A;  1NO5 A;  3HJ4 A;  3T5H A;  4E0D A;  4YR3 A;  1U45 A;  3MFH A;  4KLT A;  2AGO A;  4KLL A;  7ICH A;  3ORY A;  4JWN A;  3H4B A;  4S3N A;  9ICS A;  2BHN A;  4YN4 A;  3RB6 A;  4MFF A;  1Q78 A;  2IHN A;  2A1J B;  3E2E A;  1R8C A;  2WTF A;  4TUP A;  1UT5 A;  5L9X A;  4R8U B;  3H8S A;  5HRI A;  4ECV A;  4WC7 A;  4EBE A;  3JPO A;  3RAQ A;  3ISD A;  1TFY A;  2XCA A;  4DL5 A;  5BOM A;  4UAY A;  3GIL A;  2AGQ A;  3SV4 A;  3GIM A;  4ED2 A;  3RJF A;  4F8R A;  4O5C A;  1UEU A;  1ZQU A;  4RPZ A;  5TZV A;  5KFK A;  3Q8R B;  3H40 A;  5CJ7 A;  4XUS A;  7ICQ A;  4UBC A;  4WCW A;  2W9M A;  1KFD A;  3TAN A;  7ICT A;  5KG2 A;  3N97 B;  2DPI A;  2XGQ A;  1ZQT A;  4RPX A;  1TK0 A;  3C2M A;  5KT5 A;  4DSI A;  4KN7 A;  4DOB A;  4DLG A;  3GDX A;  2HHQ A;  3C21 A;  2MUT B;  3HP6 A;  1KFS A;  3AU2 A;  5KT2 A;  5J0T A;  4KLI A;  3B0Y A;  2PXI A;  3C18 A;  4PHP A;  8ICY A;  3RJE A;  5III A;  2M2U A;  5KFD A;  3RAX A;  1T8E A;  3FDS A;  4MEY A;  4QW8 A;  1BGX T;  3MR6 A;  4LZD A;  1ZQG A;  1UET A;  3OVS A;  1ZQF A;  1ZJM A;  2XY5 A;  3MR5 A;  1S77 D;  9ICL A;  3ETL A;  5J0R A;  5L1J A;  2DPJ A;  4M9N A;  5HRF A;  2OWO A;  2R8J A;  3BDP A;  4XQ7 A;  9ICU A;  4RQ6 A;  4F50 A;  9ICN A;  2B21 A;  2BCQ A;  4TUS A;  4RNN A;  2XY7 A;  3QZ8 A;  3LWL A;  4J9P A;  3V6J A;  4ATB A;  1ZQJ A;  3KHR A;  2M2V A;  2BR0 A;  5IIK A;  1JQR A;  5DEC A;  1SKW A;  4O9M A;  7ICE A;  4RNM A;  5KFM A;  9ICI A;  5J2K A;  4I2F A;  9ICQ A;  3H37 A;  3HW8 A;  3V6K A;  3Q8S B;  2ISP A;  2JEF A;  5KFH A;  3M9N B;  4LVS A;  5IIJ A;  5L1K A;  1S76 D;  1BVS A;  4YR0 A;  4DFM A;  1COO A;  2W9C A;  8ICW A;  4AT7 A;  1SZP A;  4RU9 A;  2I1Q A;  3M8S A;  2UVV A;  4EBD A;  3K75 D;  3L9D A;  4DL7 A;  5KG3 A;  2ASL A;  1F5A A;  1KSP A;  4RQ3 A;  1KNY A;  3PML A;  2ZH9 A;  1RPL A;  1U9L A;  4FHY A;  5DB8 A;  3PMN A;  5DDM A;  8ICJ A;  1XSN A;  1XS9 D;  5KFC A;  3MAB A;  3QE9 Y;  5BPC A;  3GV5 B;  2ASD A;  1D8L A;  2ISO A;  1B22 A;  3UXO A;  4YMM A;  4C8K A;  4PHA A;  1JMS A;  2R8I A;  8ICV A;  4LT6 A;  8ICN A;  2VAN A;  4X0B A;  1BPX A;  2R8G A;  4DFJ A;  8ICB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...