4O5CA

Structure of human dna polymerase complexed with n7-mg as the template base in a 1-nucleotide gapped dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5cA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5cA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5cA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5cA03
2ZJ5A 1WCNA 4YD1A 3MGIA 3KHLA 4B9UA 4BWJA 3GQCA 8ICSA 3MR2A 4ECXA 2WTFA 3TFSA 5HRBA 1TFRA 2DFLA 2W9BA 3H8WA 3THVA 3H4DA 2PFQA 4DSFA 4F2RA 9ICFA 2O1PA 7ICRA 5KG7A 1NJYA 4XUSA 3RH6A 2ZJ8A 4O3QA 5DLGA 2B21A 4ECQA 4F4KA 4DL3A 3BDPA 3BQ2A 1JQRA 5KFFA 1S9FA 5BOLA 4MF2A 4NM1A 3Q8KA 1XO1A 3C2KA 4QZ9A 5KFJA 4IR1A 4NKTA 4EBKA 2ZHBA 4QZBA 4I27A 3C1YA 5J2AA 9ICGA 5J0OA 3EW9A 2R8HA 1SZPA 2XGQA 3AU2A 7ICJA 4NM2A 4DL6A 4M04A 3RR8A 3OJUA 5HRHA 2C22A 4F4XA 1S77D 4Z6FA 5J0QA 3GIMA 1BVSA 5J0XA 4QW9A 1RYSA 2P6RA 2HHSA 8ICCA 5JUMA 1V9PA 3M8SA 1KNYA 2XY7A 1D9DA 2IHMA 4I2HA 2P66A 3PVXA 3MR5A 1MIYA 3RB6A 2ALZA 1XSLA 1ZQGA 5KFXA 9ICIA 4TQSA 2AU0A 3M9OB 2Y1JA 8ICYA 3H7IA 1TVAA 4F4YA 2A1JB 4RWOA 2XCPA 4JWNA 7ICHA 5HMLA 4YP3A 5IIMA 4JWMA 4YXJA 2W9CB 3V6JA 1BPXA 4JV2A 2JEIA 8ICMA 7ICKA 2BQ3A 3OUYA 3BQTA 5CP2A 5J2DA 4BXOB 1JAJA 3Q8PB 1UT8A 1D8LA 3GV8B 2FPMA 3C21A 8ICNA 5KFKA 2J6SA 3C18A 1ZQKA 2BCQA 4EBEA 3PW2A 8ICXA 4X0BA 4J9RA 4QZFA 1SL2A 4R65A 9ICWA 9ICSA 4F93B 3UQ0A 4UD5A 3Q8MA 1X9MA 3PNCA 3QZ8A 2V4QA 3Q8RB 4DQSA 3OSPA 4P4MA 3MR3A 5HP4A 1L5UA 3RR7A 4B9VA 4I2GA 8ICGA 1ZQVA 4PHAA 1XSNA 9ICTA 4ZH4A 4M2YA 5J2IA 4UB5A 3KHRA 4MEXA 4PPXA 4R8UB 4PGXA 9ICXA 4RQ2A 3HJ1A 4DWIA 2O5AA 1NK8A 3PR5B 2ZHAA 4ELVA 1B22A 4RQ6A 5KFUA 2PFOA 3MBYA 4IQVA 2XGPA 2KP7A 5L1IA 3NYBA 5KFMA 5J0TA 1NJZA 2R8IA 9ICPA 4RUAA 3QEAZ 2M9NA 1A76A 1XWLA 5TZVA 1SKSA 1Q79A 2Y1IA 4WC6A 5KFOA 4G3IA 2AGOA 1U4BA 2DPJA 2ID1A 1BGXT 5KFEA 5DGBA 4NLKA 1MIVA 1KFSA 5J0SA 3T5KA 2ASDA 7ICUA 9ICUA 1UETA 5DB6A 7ICVA 3H39A 4WC5A 5J2EA 1N56A 4RQ0A 4RU9A 5KFAA 2UVUA 2AQ0A 1VFGA 3V7JA 4FO6A 5J2CA 5HRLA 5J2GA 3BQ0A 4EBDA 4RZRA 2F1IA 2ATLA 4X4PA 4KLLA 2XY5A 4IR9A 8ICIA 3PO5A 3PMNA 4ED8A 3FYHA 3RJFA 5HNKA 2PFNA 4RWQA 2RFFA 1X9SA 2JZBA 4KMUA 1F5AA 4EZ6A 2BE3A 4DSIA 5IILA 4CCHA 4I2DA 4KLEA 1SL1A 4LZDA 4Q8FA 4AT9A 3H37A 2UVRA 4JK1A 4BWMA 4RNOA 3MGHA 3RAXA 2KZZA 4IRCA 4DO9A 8ICFA 4XQ7A 4E8FA 3T5JA 3H40A 4M9GA 4YXMA 1S10A 4J9OA 2HHPA 1NJXA 3N97B 8ICOA 4QZAA 5BOMA 4KITB 3GV5B 3G6YA 5J0RA 4DLEA 7ICNA 5CR0A 3H38A 5KFDA 2KFZA 5L1JA 1TKDA 2AGPA 3NGDA 4Q8EA 4QWDA 4FHVA 3OUYB 4WCWA 1BPEA 4TUSA 4UQGA 4FS2A 5DGAA 1ZQRA 2DR7A 2FPKA 4YMNA 3V7LA 2R8GA 1QSSA 4I29A 4I2CA 4LVSA 2ZH1A 4B9SA 4NLNA 5CWRA 1ZQZA 5F9NA 5KFIA 1BPDA 5KFCA 2XC9A 3LWMA 4J9QA 3PX4A 4LZGA 1R8AA 3LK9A 5D4BA 4FHYA 2DR8A 4YMOA 2AGQA 4I2JA 4FHWA 4RQ7A 1JX4A 5DQHA 4C8OA 4WC2A 2PI5A 4KN7A 5DDYA 4O5EA 2AJQA 3OV7A 2ZUCA 4ECYA 4ED1A 5KT6A 4DS5A 3AQMA 5F9LA 9ICOA 3K75D 8ICRA 3UXPA 3L9DA 5J2FA 5BPCA 2XO7A 1NK4A 3C1ZA 3EZ5A 5EWGA 3PW5A 3HWTA 4NKUA 3AQKA 4UAWA 5KFRA 3SI8A 2P6UA 3UXNA 1L3UA 7ICOA 5HC9A 4J9KA 3NTUA 1OU5A 1IM4A 5KFHA 5CJ7A 3H8SA 1TV9A 2ASJA 9ICVA 4QZIA 4B9MA 8ICWA 5J2HA 4F8RA 1ZQNA 2R8JA 3WFPA 4X4OA 2VA8A 4DQPA 5DLFA 4DEZA 2VANA 4C8LA 2ZH4A 2BPCA 4O3OA 3ZD8A 4M0AA 3AU6A 3H8JA 1L3TA 3JPTA 3RRGA 4DL4A 2F1HA 5EWEA 4YFKA 2KFNA 4RNMA 3AQNA 5HRFA 2W8LA 4KLDA 4C8MA 2J6TA 4QW8A 4YCXA 4QZHA 1NK5A 1S97A 4IQWA 4O9MA 4WC4A 3WFRE 2HHXA 7ICTA 4F5NA 3RB0A 1R8CA 4NLGA 2JZBB 3MDCA 3OJSA 3EPGA 1EXNA 3EWAA 9ICNA 4GXKA 2M2WA 4O0IA 1UT5A 4M9HA 4E7XA 2PI4A 1HJPA 8ICBA 3H3AA 4RWNA 2LYHA 4YMMA 4DFPA 1RZTA 4R63A 8ICLA 4RQ1A 4M9LA 1S0VA 9ICEA 5HRGA 4EP7A 5EOZA 5KFPA 1ZQSA 4PH5A 5J2BA 1ZQQA 3B0YA 4DF4A 4LT6A 4AT8B 4F4ZA 2UVWA 4O3RA 2DPIA 1B43A 4ATBA 2BCSA 4RQ3A 1JXLA 1PX5A 4WC7A 4I2IA 1KRPA 3WFQE 3PMLA 3IHQB 4ECVA 3ZDCA 5C5JA 4GXJA 1COOA 4DL5A 4DL2A 2VA2A 4F92B 3RRHA 4UAYA 3MFHA 1L3SA 3EYZA 4KLFA 3WFSC 3HP6A 5KFQA 3M8RA 4KLJA 4M6WA 5DKWA 4ED0A 5KT7A 4E0DA 3HPOA 2UVVA 4UB2A 1R8BA 4Q44A 4RT2A 4FBUA 3C2LA 5CA7A 5DB7A 2ZTEA 5KFGA 2VA3A 1XSPA 9ICBA 4PHEA 2ZH9A 2JEFA 2J6UA 2I1QA 3OGUA 3KHHA 1DGSA 5J2JA 5L9XA 4FHPA 2BCUA 5L1KA 3PX6A 1TFWA 1DK3A 4DS4A 1MIWA 4QWAA 1VJ7A 1BNPA 2KZMA 2W9MA 3JYYA 4R66A 1X9WA 1RXWA 1ZQWA 5KT5A 1MQ3A 4WC1A 4P4OA 7ICMA 5HR9A 4DLGA 1ZJMA 2ZTCA 1ZQFA 1NO5A 3PW0A 3TARA 2ZH7A 1QSLA 2W9BB 1RXVA 1LV5A 1UA0A 2PFPA 4J9NA 1X2IA 4MFAA 3M9NB 2JEGA 1AROP 4GXIA 1D9FA 2NRVA 5IIKA 2ZTDA 5KG2A 4I2BA 8ICJA 3HJ4A 2JEJA 2R8KA 1SKWA 1CEZA 7ICLA 1NOMA 2ZH6A 4Z6CA 1RYRA 2FPLA 4TUQA 3HX0A 3C5FA 2ZH3A 2HVIA 3TANA 4IQTA 2FMSA 4MFCA 4YG2A 9ICHA 4EYIB 1DK2A 4F5OA 3PW7A 3KTQA 8ICEA 4GC7A 4EBCA 3PV8A 1ZQCA 5IIIA 4PGQA 4O3SA 4M9JA 5DDMA 3C23A 2PXIA 5J2KA 2BQUA 4ED2A 4YR0A 4DSJA 2BPFA 4DFJA 4J9SA 1ZQLA 4BDPA 4RUCA 1NK9A 3T5HA 2IMWP 4O5CA 4UD4A 5DECA 9ICMA 3B0XA 4DQQA 5DG9A 3TQ1A 4X5VA 3PW4A 3JZ0A 3PR4A 4GLXA 5D49A 1U47A 2BDPA 3RH5A 4R64A 5KFLA 3SYZA 3GDXA 2GWSA 3V6HA 5IINA 3TI0A 3QEBZ 4EYHB 2ISPA 4KLTA 4DL7A 7ICIA 1BNOA 8ICAA 1DOQA 4QZDA 1SL0A 2BGWA 4WBZA 5KG1A 2BR0A 5DG7A 2HHTA 4I2FA 1NK6A 3C5GA 2ZJAA 3RJEA 1YLQA 4FHXA 4QZ8A 2KTQA 2C2EA 5KG3A 2F1JA 4RPZA 4GC6A 4M6WB 3EPIA 1XC9A 4ECUA 4RQ8A 1IXRA 1TK5A 1TAQA 3Q8LA 2DRAA 4RPXA 4QZEA 8ICUA 2A1JA 1UA1A 4ED3A 4Q45A 3HT3A 3MDAA 3LWLA 2MUTA 4M9NA 3JPSA 1NJWA 2IHNA 4UB3A 4AT7A 4ELUA 2ASLA 4BXOA 1QSYA 4QZGA 4X4TA 4X4SA 4I28A 3KHGA 3G6VA 3ETLA 1Z00A 4XQ8A 4WC0A 4Z6EA 4EBJA 4DQIA 1H38A 3WFOA 2DR5A 5KFZA 1BPZA 3ZDDA 5DEDA 5DG8A 3ISCA 3T3FA 4M5DA 2Q0ZX 1ZQBA 1UEVA 2HVHA 1ZQJA 3GIJA 1CUKA 2V9WA 2W9AA 8ICQA 3LQCB 3ZDBA 3MR6A 4F5PA 4ECRA 2FLPA 4I2EA 4ELTA 2NRKA 5DBCA 1K1SA 3ZDEA 2HW3A 8ICTA 7ICPA 5HRKA 3C2MA 9ICLA 5CB1A 3RBEA 2XY6A 4WC3A 3RJKA 3HIYA 1MSWD 4KLOA 4DQRA 8ICHA 3RJIA 3N4MB 5DBAA 3ISDA 1S76D 4O3PA 1QTMA 4RPYA 1RPLA 4JUZA 5EWFA 2BHNA 3OHAA 4ECZA 2W8KA 1T7PA 9ICKA 1ZQDA 1KFTA 3GIKA 4DSKA 2OWOA 3BJYA 7ICEA 4ED7A 4AT9B 1U45A 1BPBA 1A77A 3RJGA 1KTQA 2M2UA 2XCAA 4DOCA 3AUOA 4YD2A 4PHDA 1Q78A 2DR9A 3UPQA 5KTQA 4K4IA 3SV3A 4X4NA 5HHIA 4NXZA 2Q66A 8ICKA 2I9GA 4MFFA 2HHUA 4B9TA 4IRKA 4DOBA 4F5RA 1V4AA 4ECWA 3OVAA 2BCVA 3RBDA 2ZUBA 4F50A 5KFBA 3H4BA 1KSPA 9ICAA 4RT3A 5KFWA 9ICQA 4J9MA 1XU4A 2BKEA 4MF8A 4TURA 4MEYA 1TK0A 9ICCA 3SZ2A 2M2VA 4X4QA 3ISBA 2C2DA 1ZQOA 4DFKA 2FMQA 1TFYA 3V7KA 5HREA 2FLLA 4KLUA 1Y88A 3UQ2A 2V4RA 3G6XA 4WBYA 2NRWA 1NKCA 1C7YA 4O3NA 4IQUA 3M9MB 1BPYA 1ZQAA 1U9LA 3ORYA 3GIIA 1WCLA 2MUTB 4RQ5A 2IBKA 1KEJA 5KFTA 4AT7B 1MQ2A 1NZPA 4X0AA 3V6KA 1MC8A 4C8NA 3OVBA 3TFRA 4NLZA 7ICFA 4RQ4A 3E2EA 3HW8A 3OHBA 4EEYA 1Z00B 3JPOA 1ZJNA 2RDJA 5J0YA 3JPQA 2KN7A 4KN4A 4DF8A 1U48A 2FLNA 3ZDAA 4DSLA 1Z3EB 1R89A 1XS9D 1N48A 5HMMA 4I2AA 1FA0A 4QWEA 4Z6DA 4XA5A 3TAQA 4QWBA 5KG0A 5KT2A 2DVIA 3PY8A 4HYKA 4KTQA 5KG6A 5KFNA 4M47A 5KFVA 1T4GA 4ED6A 4FH3A 2C2RA 1ZETA 2ZUDA 2DRBA 4QZCA 4F91B 4TQRA 4UB1A 3GILA 3Q8SB 2BCRA 5J29A 1TAUA 3T5LA 4NY8A 1ZQIA 2HHWA 2ISOA 4X4RA 1ZQMA 4XRHA 3FDSA 4RWPA 2NRTA 3ZD9A 5HHHA 5DBBA 5DB9A 1PZNA 4JV0A 3GV7B 1JMSA 4K4GA 7ICSA 3C66A 4KLQA 5HRIA 1WOTA 4ECTA 1ZYQA 3IM1A 3PX0A 4ECSA 4KLGA 4P2HA 1T3NA 1KDHA 4X4UA 2ZH5A 3QZ7A 1JIHA 4JV1A 4F3OA 4KLHA 4PGYA 3RTVA 3RJHA 1S0NA 1K1QA 4O5KA 3RAQA 1ZQUA 3PO4A 1QLNA 5HRDA 3K4GA 1NKEA 2HHQA 1NKBA 1HUZA 8ICZA 4UAZA 1D8YA 1SKRA 3UPSA 4ATBB 8ICVA 4UBBA 2H5XA 4PHPA 3UXOA 1LB2B 4X4VA 3QE9Y 4B9LA 4KLSA 5KFSA 1NK7A 4B9NA 5L1LA 4K4HA 2NRXA 4YR2A 4F2SA 5F2VO 5KT3A 4TUPA 4FS1A 2KZ3A 4IRDA 2FMPA 9ICRA 2HHVA 4J9LA 5D46A 1JN3A 3OVSA 1ZQYA 4F4WA 5CHGA 2C28A 1ZQTA 4AT8A 2MAXA 1T8EA 5KG4A 5DB8A 4F5QA 3SV4A 2W9CA 4FH5A 2IA6A 4UB4A 5DQIA 3GFKB 3MFIA 1KLNA 8ICPA 3AQLA 3RJJA 2ZH2A 3RH4A 2AQ4A 1L3VA 3OSNA 1UEUA 9ICJA 5J0UA 4E80A 1KFDA 2RDIA 5KFYA 4UBCA 4YQWA 3V72A 1S0MA 4YVZA 3BQ1A 3JPRA 5J0PA 4Q43A 4EZ9A 2ZH8A 4KLIA 4BGDA 4YR3A 4QWCA 2NRZA 4YN4A 2BQRA 1HUOA 2PBEA 1ZQPA 4KLMA 7ICQA 1JXEA 4P4PA 3LDAA 3JPNA 4DFMA 1U49A 4S3NA 4IG8A 5IIOA 1ZQXA 5J0WA 3RB3A 7ICGA 1NK0A 4R8UA 1ZQHA 4J9PA 3MABA 5IIJA 5DQGA 5KT4A 3JPPA 1TK8A 2BPGA 4DOAA 4DSEA 1S0OA 4RNNA 4C8KA 4FBTA 5KG5A 3Q8QB 1ZQEA 3RB4A 3TAPA 2M2TA
chains in the Genus database with same CATH superfamily
2MSNA 3MGIA 4B9UA 2WTFA 3TFSA 5K4LA 3THVA 4OJOA 4UB8U 1SXDA 3RH6A 2ZJ8A 4O3QA 5DLGA 2B21A 4ECQA 4F4KA 4DL3A 3BS5A 5KFFA 5BOLA 4MF2A 4NM1A 3Q8KA 2MRLA 1XO1A 4P0PB 4QZ9A 3MCRA 4M04A 4I0UA 3WKAA 5J0QA 1RYSA 5J0XA 4QW9A 3AQFA 3QU2A 5JUMA 2P66A 1MIYA 3RB6A 2ALZA 4CF5A 1OW5A 1RYUA 3H7IA 5HMLA 2F76X 4YP3A 4YXJA 2W9CB 3V6JA 1BPXA 4JV2A 8ICMA 7ICKA 4K9BA 3BQTA 4WJ3B 8ICNA 4EBEA 2LHTA 3PW2A 4X0BA 1SL2A 4R65A 4F93B 4UD5A 5JU5A 3A0HU 3Q8RB 4DQSA 1HEKA 5AI0A 5HP4A 3RR7A 1ZQVA 4CDGA 1XSNA 2E8PA 4ZH4A 2PMZF 2K4IA 2VJ5A 3KHRA 9ICXA 3HJ1A 5KL8B 4RQ2A 2ZHAA 1B22A 5L1IA 9ICPA 4EENA 4OAHA 1SKSA 4WC6A 5ALGA 2NYVA 1WWVA 5ALZA 5KFEA 5TISU 4NLKA 1MIVA 4WC5A 4NJ8A 2ASDA 3H39A 4C4SA 5KFAA 3UMBA 1VFGA 5G5GA 1IIPA 3H0RB 4X4PA 2F1IA 1IV8A 3PMNA 4ED8A 3FYHA 5HNKA 1KN5A 4CCHA 2HBLA 1FFVA 4Q8FA 2I5HA 5GTHU 4JK1A 1QQ7A 5KAFU 3MGHA 2UVRA 4XQ7A 1X6JA 1TE2A 1OUQA 4QZAA 5ALKA 2KVCA 4KITB 3GV5B 5CR0A 4LJXA 5KFDA 2DGZA 2KFZA 4FHVA 1QQ6A 2IOFK 4WCWA 3OUYB 1BPEA 2GA9D 4FS2A 3D2QA 4OAGA 2ZH1A 4PJ0U 4I2CA 1QSSA 5F9NA 2XC9A 2HI0A 4J9QA 1DRGA 3F5EA 4RQ7A 1JX4A 4WC2A 4KN7A 2AJQA 3OWGA 3AQMA 5F9LA 1Z1BA 5J2FA 4QNLA 1JALA 5AKXA 5KFRA 4Y2PA 7ICOA 1OU5A 4NLCA 5KFHA 1O08A 2W03A 5J2HA 3WFPA 5ALPA 4DQPA 5DLFA 2VANA 2BPCA 4O3OA 2HDOA 2DWQA 2G5HB 1L3TA 2JHDA 2LM4A 5AM5A 4YFKA 2KFNA 4KLDA 4C8MA 4QW8A 4YCXA 1NK5A 1S97A 1V38A 1ZRMA 4JLZA 4C0ZA 1R8CA 2PMZC 3NASA 4GXKA 2M2WA 1PK3A 2PI4A 8ICBA 1J97A 4NL9A 1PUZA 4R63A 4M9LA 2G06A 5HRGA 5EOZA 4BUGA 5J2BA 1ZQQA 2OYYA 4LT6A 3H0MB 4ATBA 2DPIA 1B43A 2BCSA 5KNIA 2L5YA 4WC7A 1KRPA 1COOA 2EH9A 3RRHA 3MFHA 1L3SA 3WFSC 4FE3A 2KKPA 4M6WA 5DKWA 4ED0A 3NRZA 5KT7A 1CI4A 5CA7A 3N7RC 5L9XA 2F3NA 3PX6A 1LKYA 2YQEA 2KZMA 2W7PA 4UATA 1ZQWA 1MQ3A 2RLTA 1X9XA 1ZJMA 2ZTCA 2ZH7A 1LV5A 4QJFB 4MFAA 4GXIA 2K89A 1D9FA 2ZTDA 4KX5A 3BS5B 3QUCA 2ZIWA 4Z6CA 3HX0A 2ZH3A 4KMOB 4IQTA 2CN1A 4EYIB 3QUTA 1ZQCA 5J8YA 4ED2A 1L7PA 4YR0A 4RUCA 2IMWP 4UD4A 5DECA 3TQ1A 5AI8A 4CE6A 2G0AA 3PR4A 5D49A 2YMLA 5KFLA 3SYZA 3GDXA 2KVSA 3IN5A 3WKEA 2ISPA 3KKAA 3PHZA 2BGWA 2BR0A 5DG7A 3NVOA 1NK6A 2KTQA 4GC6A 4ECUA 3FM9A 2QB1A 3RF9A 4RPXA 4QZEA 1L7NA 2A1JA 4ED3A 4M9NA 1NJWA 4QZGA 3G6VA 3ETLA 3WFOA 5KFZA 1Q3VA 1CRXA 2E3TA 2Q0ZX 1UEVA 1ZQJA 1CUKA 1VDVA 4OD0A 5ALFA 3MR6A 2NRKA 1K1SA 8ICTA 3WK5A 7ICPA 5CB1A 3RBEA 5AICA 1F0MA 4DQRA 2K8CB 2WF8A 5CFUA 1RPLA 4JUZA 3OHAA 1KW4A 2W8KA 1T7PA 9ICKA 2E1FA 3N7PD 2M2UA 4DOCA 4PHDA 5B3QA 2DR9A 4FFDA 2E5SA 2Q66A 2KE7A 4B9TA 4DOBA 1SV4A 3RBDA 3H4BA 1N5WA 2CPRA 5EE0A 2LBOA 1XNSA 1ZQOA 2EDUA 5HR6A 1Y88A 4WBYA 1ZQAA 2RQ5A 4AT7B 1FIQA 4X0AA 1NZPA 1MC8A 5AKEA 3OVBA 3OHBA 4EEYA 3CK6A 2KJ9A 1ZJNA 1PK1A 3B9JA 1FO4A 2LMRA 2YN4A 3JPQA 3HILA 4KN4A 2KN7A 4C7YA 4DF8A 2FLNA 1L7MA 3ZDAA 1XS9D 1N48A 4Z6DA 4XA5A 5KT2A 3IDWA 2W3RA 5KG6A 4M47A 5KFVA 2RP5A 4O69A 2ZUDA 2JH7A 3EF2A 3Q8SB 3SENA 5J29A 2WB1F 4OJPA 1ZQMA 2NRTA 5DB9A 5DBBA 4K4GA 7ICSA 5GTIU 5JTIA 3PX0A 4ECSA 4P0PA 1KDHA 4JV1A 4F3OA 5H2FU 3RJHA 3RAQA 4PL2A 5HRDA 1NKEA 4U7CA 4ATBB 3UPSA 2H3QA 8ICVA 4UBBA 4PHPA 4X4VA 1S8OA 3ERCC 4K9AA 1HIWA 3R9KA 5F2VO 5KT3A 4TUPA 1IG6A 3OTQA 4J9LA 5D46A 1JN3A 2AXTU 1ZQYA 4F4WA 5CHGA 2KG5A 5DB8A 2W9CA 5ALLA 5DQIA 3GFKB 8ICPA 3RH4A 3QX7A 5ALYA 9ICJA 5J0UA 3PSTA 3JPRA 1TAMA 5J0PA 1LKYB 4EZ9A 1WG8A 4KLIA 4BGDA 4YR3A 1O03A 2NRZA 1HUOA 2PBEA 4RQMA 4P4PA 3AN1A 3RB3A 2WF5A 4OJLA 4I2FA 5IIJA 2BPGA 1TK8A 4RNNA 1ZQEA 5G5HA 2ZIWB 3NVVA 2KOBA 3K1RB 4BWJA 2DFLA 4F2RA 2O1PA 9ICFA 3H4DA 5KG7A 1NJYA 3OPXA 2FE9A 4EBKA 1JQRA 3BDPA 2B6GA 4OCZA 2K4EA 1URJA 4I27A 3EW9A 1A6SA 2R8HA 3AU2A 4JLXA 3OJUA 2D3DA 2CRXA 2HN1A 1S77D 3GIMA 2Y9UA 1KNYA 1V9PA 2XY7A 3PVXA 9ICIA 5ALIA 2AU0A 2Y1JA 2WB1C 2W43A 4F4YA 2A1JB 4RWOA 7ICHA 2KHVA 2YMMA 3OUYA 2JEIA 3QNMA 5CP2A 4NXWA 3C21A 5KFKA 3C18A 8ICXA 4QZFA 1X9MA 3K7DA 4B9VA 3OSPA 8ICGA 2B56A 4I2GA 9ICTA 4M2YA 3K1ZA 2O5AA 2DKZA 3NUQA 5KFUA 2PFOA 1NNLA 5KFMA 1NJZA 1Q46A 2R8IA 5AM4A 1XWLA 2K8AA 5ALNA 1Q8KA 4G3IA 2AGOA 4FZNA 4O3MA 1U4BA 2DPJA 2ID1A 7ICUA 2RHFA 2LYBA 7ICVA 2BBHA 4UB6U 5ALDA 4UAVA 3EUB2 3F2CA 3WK6A 1Z19A 3BQ0A 4EBDA 3F53A 4XJEA 2ATLA 4KLLA 8ICIA 5ALTA 4RWQA 2RFFA 1X9SA 2BE3A 4DSIA 4AT9A 8ICFA 2KZZA 2HN2A 3WU2U 3H40A 4M9GA 3N97B 8ICOA 2GAFD 5ALQA 4F71A 3G6YA 5J0RA 3BS7A 4DLEA 2YMPA 2DF4B 5AKJA 3NGDA 4Q8EA 4QWDA 3RFAA 4UQGA 3ER8C 4I29A 1QH9A 4LVSA 3QXGA 1UCVA 4NLNA 5CWRA 1ZQZA 5KFCA 1BPDA 3PX4A 2DR8A 1PK1B 4LZGA 1R8AA 5D4BA 4YMOA 2AGQA 5AM3A 4O5EA 5DDYA 3OV7A 4ED1A 3S6JA 3TACB 3C1ZA 2H3IA 3EZ5A 4NKUA 3HWTA 3AQKA 4K8VA 5AKYA 4J9KA 3TKAA 1TV9A 1ZRNA 3H8SA 4UW9A 5AIAA 4QZIA 3SEIA 4B9MA 4F8RA 1ZQNA 2VA8A 3SD7A 4PZNA 4M0AA 3AU6A 3JPTA 4RNMA 3AQNA 2J6TA 4QZHA 4Y2XA 4WC4A 3RB0A 1SZHA 4O0IA 4M9HA 4E7XA 2LYHA 4YMMA 8ICLA 9ICEA 2XVTA 5KFPA 1ZQSA 4PH5A 4DF4A 2HOQA 4F4ZA 1PX5A 4I2IA 3IHQB 3CNHA 5C5JA 4GXJA 4DL2A 2VA2A 1ZOLA 4KLFA 3QUQA 3TADA 3M8RA 2RRDA 3DV9A 3HPOA 4EEDA 2EAOA 1R8BA 1DGJA 3PSFA 4FZLA 5KFGA 2VA3A 1ED1A 9ICBA 2P35A 2WF7A 3OGUA 1DK3A 4DS4A 1MIWA 4USAA 1BNPA 1QCKA 2W9MA 2KV2A 4P4OA 2YY6A 4NWIA 4DLGA 5HR9A 1N2XA 3PW0A 1QSLA 2PFPA 1F5SA 3M9NB 2JEGA 3HJ4A 2E8NA 1CEZA 1RYRA 4TUQA 2R18A 2FMSA 2W11A 1DK2A 2FDRA 4F5OA 5AKLA 3PW7A 4GC7A 3KTQA 3PV8A 2JV3A 1KQQA 5IIIA 3WKCA 4M9JA 2QLTA 5DDMA 2BQUA 4JB3A 4HX0A 1VJ5A 1ZQLA 4BDPA 1NK9A 3B0XA 5AI4A 3PW4A 4GLXA 3UM9A 4KM5A 4R64A 1RQLA 5IINA 3QEBZ 2KIVA 4EYHB 7ICIA 1BNOA 8ICAA 1SL0A 4FHXA 3M6ZA 4C7ZA 2C2EA 2B4VA 5KG3A 5L1MA 2MU2A 3DDHA 4RPZA 1XC9A 1IXRA 1N5XA 2EAPA 2K4PA 3Q8LA 1UA1A 3HT3A 4Y2VA 2IHNA 4AT7A 4UB3A 1KL9A 5AKZA 4X4SA 2F77X 5D61A 4XQ8A 4Z6EA 2H3FA 4PL1A 2W9AA 3LQCB 3ZDBA 4ELTA 5DBCA 2WF9A 2KIWA 2XICA 2HMXA 5HRKA 4K96A 9ICLA 2QB0A 3IP4B 2XY6A 1V85A 3HIYA 4WC3A 1J2MA 1MSWD 4KLOA 8ICHA 4AYBF 3ALRA 4RPYA 2A19A 4ECZA 1T3QA 3GIKA 4LEWA 4DSKA 4AT9B 1U45A 1A77A 3FC4A 3ICXA 5ALUA 5HR7A 4YD2A 2F44A 3SV3A 4X4NA 4NXZA 4MFFA 4F5RA 4RT3A 2JR5A 5AKHA 5AM2A 2FCLA 1LVHA 4MEYA 4NXTA 3A0BU 4DFKA 2FMQA 2OEHA 2FLLA 4KLUA 3G6XA 2NRWA 1C7YA 4O3NA 2E8OA 4IQUA 3M9MB 1BPYA 2O6KA 5C0YA 1U9LA 3ORYA 3GIIA 5AM1A 1MQ2A 5ALOA 7ICFA 3GU3A 1Z00B 3F2DA 2OHFA 4ZOHC 1WUDA 2LKYA 3ONNA 4DSLA 4I2AA 5KG0A 2H3VA 4GIBA 4F91B 4UB1A 1L6NA 4LEVA 4X4RA 5HHHA 1JMSA 5HRIA 2ZH5A 1A0PA 2KSOA 4KLHA 3RTVA 1S0NA 3VC8A 2HHQA 1X40A 1HUZA 4UAZA 1LB2B 3WKBA 3WK7A 4B9LA 5KFSA 1NK7A 4K4HA 4YR2A 3NWIA 2G07A 3J81j 3PSPA 4IRDA 2HHVA 3M7DA 4AYBC 4AT8A 5ALHA 4F5QA 2IA6A 4EEBA 1KLNA 4NL9C 2AQ4A 3WK9A 4AP9A 4Y2UA 2RDIA 1YT3A 3V72A 1NI3A 1S0MA 4YVZA 3IG5A 2ZH8A 2G09A 5ALEA 2BQRA 1WYGA 4UAUA 1YZ6A 4DFMA 1U49A 5IIOA 1ZQ1C 2YB1A 2ZIUA 4DOAA 4DSEA 5KG5A 3Q8QB 5JTGA 2DKXA 2ZJ5A 1WCNA 3KHLA 3GQCA 3MR2A 1SWWA 5ALMA 5EE1A 5HRBA 1TFRA 3H8WA 4DSFA 7ICRA 4XUSA 1RQNA 2KEYA 3C2KA 5KFJA 4NKTA 4QZBA 1SZPA 2XGQA 4NM2A 4DL6A 3RR8A 2KMDA 5ALSA 4F4XA 4WQLA 2P6RA 2HHSA 1BVSA 8ICCA 3M8SA 1D9DA 2IHMA 4I2HA 3MR5A 1ZQGA 5J8YC 3M9OB 1FEZA 2XCPA 4JWNA 3HRDD 2ZH2A 2YMQA 3NVYA 4NXXA 5J2DA 1JAJA 1D8LA 1KKXA 2FPMA 3WK8A 2J6SA 1L8LA 4J9RA 9ICWA 9ICSA 3KKAC 1JI7A 3QZ8A 2V4QA 1L5UA 3OVAA 3MR3A 4PHAA 3LYSA 3QUBA 2BZFA 4PGXA 4DWIA 1NK8A 5AK4A 2QB0B 4ELVA 4E8FA 3NYBA 4IQVA 5J0TA 4RUAA 2EWRA 1A76A 1Q79A 2Y1IA 5KFOA 1BGXT 1N60A 9ICUA 1UETA 2JRZA 5J2EA 1N56A 4RU9A 3V7JA 4FO6A 5J2GA 2F8LA 4IR9A 3PO5A 3RJFA 2QKQA 2DUYA 4KMUA 1F5AA 4EZ6A 5IILA 1B0XA 1SV0A 5B66U 3H37A 3RAXA 4IRCA 3T5JA 2EQYA 1S10A 4J9OA 2HHPA 1NJXA 4G9BA 3ZI4A 7ICNA 3H38A 2KK0A 5L1JA 1M6YA 3D2NA 1TKDA 3ED5A 4TUSA 1UPHA 5D62A 2DR7A 5KFIA 4FHYA 3LK9A 5CRXA 4I2JA 2OCEA 4FHWA 2DL0A 5KT6A 4DS5A 3UXPA 1Z4NA 2XO7A 1NK4A 3SAFA 5EWGA 3PW5A 2GOLA 4B6JA 3UXNA 1L3UA 2KHQA 2ASJA 4EEKA 2Q4TA 3M1YA 2M0NA 4DEZA 2ZH4A 3ZD8A 4BJQA 1T94A 4FZMA 2F8KA 2KSOB 3RRGA 2F1HA 1QQ5A 1YZ7A 4O9MA 3WFRE 5AIBA 2HHXA 2E1EA 2CXYA 7ICTA 4F5NA 4IL6U 5B5EU 2JZBB 9ICNA 5FP0A 1UT5A 2KKVA 2YTUA 4RWNA 4RQ1A 1S0VA 5ALWA 2VIXA 2XI9A 4US8A 2WHEA 4AT8B 2VJ4A 2JH1A 4RQ3A 1JXLA 4ECVA 3ZDCA 4UAYA 3EYZA 4KLJA 1PVPA 2FJ6A 4Q44A 3C2LA 4CF3A 1S5LU 1ECWA 2Y0SC 1XSPA 2ZH9A 2JEFA 2ZIUB 3KHHA 1DGSA 4RQNA 5KL1B 5J2JA 4FHPA 2BCUA 5L1KA 2B0CA 3KOOA 4QWAA 2HBMA 4R66A 1RXWA 4WC1A 7ICMA 1NO5A 2MA1A 3TARA 2IOFA 3JCFA 4IS7A 2NRVA 8ICJA 1X42A 2JEJA 3E0FA 7ICLA 1NOMA 2ZH6A 2JMGA 1F44A 2HVIA 3NRWA 4O3SA 4PGQA 2A3VA 2BDUA 3C23A 2PXIA 2ZIVB 2BPFA 3SAGA 4CNQA 3T5HA 9ICMA 5DG9A 2IOHA 4X5VA 1N61A 1U47A 2BDPA 3RH5A 4FO1A 1X66A 2GWSA 3TI0A 3QU5A 4KLTA 4UASA 4QZDA 2XIDA 2HHTA 2NO5A 3C5GA 4GFJA 4RQ8A 1TAQA 2HCFA 3O0FA 5AI5A 2DRAA 8ICUA 4Q45A 3LWLA 1Q3UA 4OJ5A 4ELUA 4JMUA 2ASLA 4BXOA 1QSYA 4O68A 4P0QA 1Z00A 4WC0A 4EBJA 1H38A 3QYPA 5DEDA 4IC9A 3ISCA 4M5DA 3QU7A 3GIJA 1MN8A 1SGGA 3SR6A 2FLPA 4PZOA 2HW3A 3AL0B 2ODGA 2HOFA 1MA7A 5DBAA 4O3PA 3D6JA 1D8BA 5EWFA 2BHNA 1ZQDA 1KFTA 3F5AA 3BJYA 1OXJA 7ICEA 4ED7A 3SMVA 1BPBA 4O67A 1Q78A 4NV0A 3UPQA 5KTQA 4K4IA 5HHIA 8ICKA 4EX7A 2I9GA 2HHUA 4IRKA 4ECWA 4F50A 9ICAA 9ICQA 5AKIA 4J9MA 1RM6C 1VLBA 2LPEA 4MF8A 5CFTA 4QIWF 9ICCA 1N62A 3SZ2A 4X4QA 3ISBA 2C2DA 1TFYA 3V7KA 2KNJA 3UQ2A 1NKCA 3N7SC 2K60A 1WCLA 2ES6A 2MUTB 1KEJA 3V6KA 4OAIZ 3TFRA 4NLZA 3GZFA 3JPOA 3ER9B 5J0YA 1U48A 3WKDA 3CP8A 1Z3EB 3KD3A 1R89A 1FA0A 3TAQA 3PY8A 4KTQA 5KFNA 3KZIU 2JXJA 1T4GA 4ED6A 2K8BB 4FH3A 2C2RA 2DRBA 4QZCA 3GILA 3T5LA 4XRHA 3FDSA 4RWPA 5AM0A 2JGAA 3LVVA 1PZNA 4JV0A 3GV7B 5ALJA 3C66A 4KLQA 1WOTA 1ZYQA 3IM1A 2NV3A 4KLGA 4X4UA 3QZ7A 3I76A 1K1QA 1NZBA 1NKBA 8ICZA 1SKRA 2H5XA 3UXOA 4B9NA 4Y2RA 5L1LA 2NRXA 2OH2A 4CRXA 9ICRA 3IG8A 2FMPA 2ZG6A 5F3XB 2C28A 1ZQTA 2PKEA 1T8EA 4NXVA 3CRXA 4KB6A 4UB4A 3MFIA 3DEEA 3AQLA 3RJJA 3OSNA 4E80A 3MC1A 4YQWA 2W55A 4Q43A 5AHXA 4YN4A 4N7RA 7ICQA 1ZD3A 1JXEA 3JPNA 4IG8A 1ZQXA 3TADC 5J0WA 7ICGA 1NK0A 5CEHA 3L4PA 1ZQHA 3NVWA 4J9PA 5DQGA 1S0OA 3RB4A 3TAPA 3C28A 2M2TA 4QIWC 4YD1A 4EGWA 4HAIA 3VCBA 8ICSA 4ECXA 5ALVA 2W9BA 2PFQA 5D63A 2VKQA 2N1RA 3BQ2A 1S9FA 1JRPA 2ZIXA 1FFUA 4IR1A 2ZHBA 3C1YA 5J2AA 2A1AA 5J0OA 9ICGA 3E58A 7ICJA 1B4FA 4EV6A 2C22A 4Z6FA 4OO1J 3BQ7A 1XSLA 3C29A 2EANA 5KFXA 2F2AB 4TQSA 3PZPA 8ICYA 1TVAA 2IHOA 5IIMA 4JWMA 2ZXIA 2BQ3A 1RDFA 4BXOB 3Q8PB 1UT8A 3GV8B 4P0QB 4C4TA 1ZQKA 4K98A 2BCQA 1N63A 2G08A 3UQ0A 2W7OA 3Q8MA 3PNCA 1SIJA 5KAIU 4PPXA 9ICHA 4P4MA 4OAFA 1J2NA 5J2IA 4UB5A 4MEXA 4R8UB 3PR5B 1PVRA 3AMZA 4RQ6A 2KP7A 3MBYA 2XGPA 4K97A 3QEAZ 2M9NA 5TZVA 3AM9A 3CW2C 5AK5A 5DGBA 3ETRA 1KFSA 5J0SA 3T5KA 5DB6A 2D8CA 3HJEA 3WK4A 3SAHA 4RQ0A 2UVUA 2AQ0A 5J2CA 5HRLA 3M6KA 4RZRA 2XY5A 2GH1A 4F72A 2DQNB 2PFNA 2JZBA 2AH5A 3HKZF 4I2DA 4KLEA 1SL1A 4LZDA 4RNOA 4BWMA 4DO9A 2DBYA 4C80A 2LYAA 4YXMA 5BOMA 2EZYA 4BX9C 1GPJA 2AGPA 4MKPA 2NO4A 4NLBA 5DGAA 2KD1A 1ZQRA 2FPKA 4YMNA 1UQVA 3V7LA 3T79A 2R8GA 4B9SA 4NXUA 3LWMA 1ZD2P 4DFDA 5DQHA 2E8MA 4C8OA 2PI5A 2ESEA 2ZUCA 4ECYA 1L7OA 9ICOA 3K75D 8ICRA 3L9DA 5BPCA 4KX3A 1JROA 4UAWA 3SI8A 2P6UA 5HC9A 3NTUA 1IM4A 5CJ7A 9ICVA 8ICWA 1Z1VA 2R8JA 4X4OA 4C8LA 3U26A 2LM1A 3H8JA 4DL4A 5EWEA 5CFSA 5HRFA 2W8LA 4UARA 4IQWA 4J03A 2ZIVA 3QU4A 4NLGA 3MDCA 3OJSA 3EPGA 1EXNA 2G5IB 3EWAA 1HJPA 2D6FC 3H3AA 4DFPA 1RZTA 5T14A 2QARA 2W3SA 2YB4A 2BBJA 4EP7A 2EZXA 2EAMA 3B0YA 2UVWA 4O3RA 3UMGA 4Y2YA 2B51A 3WFQE 3I28A 1AQ6A 3PMLA 3D2SA 4DL5A 4F92B 5E79U 3HP6A 5KFQA 1X6IA 3H0LB 2W54A 4UB2A 2UVVA 4FBUA 4RT2A 2HBJA 2OM6A 1WWUA 4EX6A 2ZTEA 5DB7A 4PHEA 2J6UA 3HKZC 2I1QA 1TFWA 2WAQF 4OJ6A 3JYYA 1X9WA 5KT5A 1KBUA 1ZQFA 3SQIA 2W9BB 1RXVA 1UA0A 1V97A 1X2IA 4J9NA 2Z7JA 3QU9A 1AROP 2GO7A 4I2BA 5AI9A 5IIKA 4LEYA 5KG2A 2R8KA 2ZIXB 3BZKA 1SKWA 3AQEA 3IRUA 2FPLA 3C5FA 3TANA 4DCCA 4MFCA 4YG2A 2KJ5A 8ICEA 1L8OA 1JUDA 2Y0SF 4EBCA 1SXEA 5J2KA 4Y2TA 4DSJA 4DFJA 2W04A 4J9SA 4O5CA 4DQQA 2IUBA 3JZ0A 3N28A 2EZZA 3MGVA 3V6HA 3LVWA 4DL7A 1DOQA 4WBZA 5KG1A 2ZJAA 3RJEA 1YLQA 4QZ8A 2F1JA 4CF4A 4M6WB 3EPIA 1TK5A 1UHUA 5EE3A 1K5OA 1Z4OA 3MDAA 2MUTA 3JPSA 4X4TA 4I28A 3KHGA 4US9A 2ZXHA 3PSIA 3KZXA 4DQIA 2DR5A 5AI6A 3KBBA 3NKUA 1BPZA 3ZDDA 1P7DA 5DG8A 3T3FA 1ZQBA 2HVHA 2GLEA 2V9WA 8ICQA 5AK6A 4F5PA 4ECRA 4I2EA 4ACOA 1XO0A 5B3PA 3ZDEA 3CYMA 3FAHA 3C2MA 4LEZA 3RJKA 2HBKA 1PVQA 3H8MA 3RJIA 3N4MB 4U6PA 3ISDA 1ZD5A 1S76D 2AHOB 1ZD4A 1QTMA 4MHVA 3NVZA 5ALRA 2OXOA 2KICA 2OWOA 4O6AA 5AK3A 4ICAA 5CHEA 3RJGA 1KTQA 2WAQC 2XCAA 1RG6A 3AUOA 4C4RA 1V4AA 2BCVA 1VJ7A 2ZUBA 1KSPA 2I6XA 5KFBA 5KFWA 1XU4A 2BKEA 4TURA 1TK0A 2M2VA 3KFUF 2YX8A 1SV0C 1DXSA 1SWVA 5HREA 2HSZA 2V4RA 5EE9A 1C20A 2IBKA 4RQ5A 1SB3C 5KFTA 4C8NA 4RQ4A 3E2EA 3HW8A 4Y2QA 2RDJA 2HOIA 3L5KA 5HMMA 4QWEA 4QWBA 2DVIA 3L3FX 4HYKA 4K99A 5A0LA 1ZETA 4TQRA 3UMCA 5JRTA 2BCRA 1TAUA 4NY8A 2HHWA 2KJ8A 1ZQIA 2ISOA 4WH5A 5AKGA 3ZD9A 2WFAA 4Y2SA 4ECTA 3NS1A 4P2HA 1T3NA 1ZXIA 1JIHA 2H3ZA 2QARB 4PGYA 3F2BA 4O5KA 1ZQUA 3PO4A 1QLNA 3K4GA 3BZCA 1D8YA 4WQKA 5ALXA 3QE9Y 4KLSA 4F2SA 1COKA 4Y2JA 5AKKA 4FS1A 2KZ3A 4EELA 3OVSA 2Y9TA 4A8EA 2MAXA 5KG4A 3SV4A 4FH5A 2WF6A 4CGZA 1L3VA 1UEUA 1KFDA 5KFYA 4UBCA 2LI6A 3BQ1A 3I1YA 3AEVA 4WOYA 2FI1A 4QWCA 1ZQPA 3IV6A 4KLMA 4S3NA 3LDAA 2K4HA 4R8UA 1GO3F 5HRHA 3MABA 5KT4A 3JPPA 4E0DA 4FBTA 4C8KA
chains in the Genus database with same CATH topology
2ZJ5A 1WCNA 4YD1A 3MGIA 3KHLA 4B9UA 4BWJA 3GQCA 8ICSA 3MR2A 4ECXA 2WTFA 3TFSA 5HRBA 1TFRA 2DFLA 2W9BA 3H8WA 3THVA 3H4DA 2PFQA 4DSFA 4F2RA 9ICFA 2O1PA 7ICRA 5KG7A 1NJYA 4XUSA 3RH6A 2ZJ8A 4O3QA 5DLGA 2B21A 4ECQA 4F4KA 4DL3A 3BDPA 3BQ2A 1JQRA 5KFFA 1S9FA 5BOLA 4MF2A 4NM1A 3Q8KA 1XO1A 3C2KA 4QZ9A 5KFJA 4IR1A 4NKTA 4EBKA 2ZHBA 4QZBA 4I27A 3C1YA 5J2AA 9ICGA 5J0OA 3EW9A 2R8HA 1SZPA 2XGQA 3AU2A 7ICJA 4NM2A 4DL6A 4M04A 3RR8A 3OJUA 5HRHA 2C22A 4F4XA 1S77D 4Z6FA 5J0QA 3GIMA 1BVSA 5J0XA 4QW9A 1RYSA 2P6RA 2HHSA 8ICCA 5JUMA 1V9PA 3M8SA 1KNYA 2XY7A 1D9DA 2IHMA 4I2HA 2P66A 3PVXA 3MR5A 1MIYA 3RB6A 2ALZA 1XSLA 1ZQGA 5KFXA 9ICIA 4TQSA 2AU0A 3M9OB 2Y1JA 8ICYA 3H7IA 1TVAA 4F4YA 2A1JB 4RWOA 2XCPA 4JWNA 7ICHA 5HMLA 4YP3A 5IIMA 4JWMA 4YXJA 2W9CB 3V6JA 1BPXA 4JV2A 2JEIA 8ICMA 7ICKA 2BQ3A 3OUYA 3BQTA 5CP2A 5J2DA 4BXOB 1JAJA 3Q8PB 1UT8A 1D8LA 3GV8B 2FPMA 3C21A 8ICNA 5KFKA 2J6SA 3C18A 1ZQKA 2BCQA 4EBEA 3PW2A 8ICXA 4X0BA 4J9RA 4QZFA 1SL2A 4R65A 9ICWA 9ICSA 4F93B 3UQ0A 4UD5A 3Q8MA 1X9MA 3PNCA 3QZ8A 2V4QA 3Q8RB 4DQSA 3OSPA 4P4MA 3MR3A 5HP4A 1L5UA 3RR7A 4B9VA 4I2GA 8ICGA 1ZQVA 4PHAA 1XSNA 9ICTA 4ZH4A 4M2YA 5J2IA 4UB5A 3KHRA 4MEXA 4PPXA 4R8UB 4PGXA 9ICXA 4RQ2A 3HJ1A 4DWIA 2O5AA 1NK8A 3PR5B 2ZHAA 4ELVA 1B22A 4RQ6A 5KFUA 2PFOA 3MBYA 4IQVA 2XGPA 2KP7A 5L1IA 3NYBA 5KFMA 5J0TA 1NJZA 2R8IA 9ICPA 4RUAA 3QEAZ 2M9NA 1A76A 1XWLA 5TZVA 1SKSA 1Q79A 2Y1IA 4WC6A 5KFOA 4G3IA 2AGOA 1U4BA 2DPJA 2ID1A 1BGXT 5KFEA 5DGBA 4NLKA 1MIVA 1KFSA 5J0SA 3T5KA 2ASDA 7ICUA 9ICUA 1UETA 5DB6A 7ICVA 3H39A 4WC5A 5J2EA 1N56A 4RQ0A 4RU9A 5KFAA 2UVUA 2AQ0A 1VFGA 3V7JA 4FO6A 5J2CA 5HRLA 5J2GA 3BQ0A 4EBDA 4RZRA 2F1IA 2ATLA 4X4PA 4KLLA 2XY5A 4IR9A 8ICIA 3PO5A 3PMNA 4ED8A 3FYHA 3RJFA 5HNKA 2PFNA 4RWQA 2RFFA 1X9SA 2JZBA 4KMUA 1F5AA 4EZ6A 2BE3A 4DSIA 5IILA 4CCHA 4I2DA 4KLEA 1SL1A 4LZDA 4Q8FA 4AT9A 3H37A 2UVRA 4JK1A 4BWMA 4RNOA 3MGHA 3RAXA 2KZZA 4IRCA 4DO9A 8ICFA 4XQ7A 4E8FA 3T5JA 3H40A 4M9GA 4YXMA 1S10A 4J9OA 2HHPA 1NJXA 3N97B 8ICOA 4QZAA 5BOMA 4KITB 3GV5B 3G6YA 5J0RA 4DLEA 7ICNA 5CR0A 3H38A 5KFDA 2KFZA 5L1JA 1TKDA 2AGPA 3NGDA 4Q8EA 4QWDA 4FHVA 3OUYB 4WCWA 1BPEA 4TUSA 4UQGA 4FS2A 5DGAA 1ZQRA 2DR7A 2FPKA 4YMNA 3V7LA 2R8GA 1QSSA 4I29A 4I2CA 4LVSA 2ZH1A 4B9SA 4NLNA 5CWRA 1ZQZA 5F9NA 5KFIA 1BPDA 5KFCA 2XC9A 3LWMA 4J9QA 3PX4A 4LZGA 1R8AA 3LK9A 5D4BA 4FHYA 2DR8A 4YMOA 2AGQA 4I2JA 4FHWA 4RQ7A 1JX4A 5DQHA 4C8OA 4WC2A 2PI5A 4KN7A 5DDYA 4O5EA 2AJQA 3OV7A 2ZUCA 4ECYA 4ED1A 5KT6A 4DS5A 3AQMA 5F9LA 9ICOA 3K75D 8ICRA 3UXPA 3L9DA 5J2FA 5BPCA 2XO7A 1NK4A 3C1ZA 3EZ5A 5EWGA 3PW5A 3HWTA 4NKUA 3AQKA 4UAWA 5KFRA 3SI8A 2P6UA 3UXNA 1L3UA 7ICOA 5HC9A 4J9KA 3NTUA 1OU5A 1IM4A 5KFHA 5CJ7A 3H8SA 1TV9A 2ASJA 9ICVA 4QZIA 4B9MA 8ICWA 5J2HA 4F8RA 1ZQNA 2R8JA 3WFPA 4X4OA 2VA8A 4DQPA 5DLFA 4DEZA 2VANA 4C8LA 2ZH4A 2BPCA 4O3OA 3ZD8A 4M0AA 3AU6A 3H8JA 1L3TA 3JPTA 3RRGA 4DL4A 2F1HA 5EWEA 4YFKA 2KFNA 4RNMA 3AQNA 5HRFA 2W8LA 4KLDA 4C8MA 2J6TA 4QW8A 4YCXA 4QZHA 1NK5A 1S97A 4IQWA 4O9MA 4WC4A 3WFRE 2HHXA 7ICTA 4F5NA 3RB0A 1R8CA 4NLGA 2JZBB 3MDCA 3OJSA 3EPGA 1EXNA 3EWAA 9ICNA 4GXKA 2M2WA 4O0IA 1UT5A 4M9HA 4E7XA 2PI4A 1HJPA 8ICBA 3H3AA 4RWNA 2LYHA 4YMMA 4DFPA 1RZTA 4R63A 8ICLA 4RQ1A 4M9LA 1S0VA 9ICEA 5HRGA 4EP7A 5EOZA 5KFPA 1ZQSA 4PH5A 5J2BA 1ZQQA 3B0YA 4DF4A 4LT6A 4AT8B 4F4ZA 2UVWA 4O3RA 2DPIA 1B43A 4ATBA 2BCSA 4RQ3A 1JXLA 1PX5A 4WC7A 4I2IA 1KRPA 3WFQE 3PMLA 3IHQB 4ECVA 3ZDCA 5C5JA 4GXJA 1COOA 4DL5A 4DL2A 2VA2A 4F92B 3RRHA 4UAYA 3MFHA 1L3SA 3EYZA 4KLFA 3WFSC 3HP6A 5KFQA 3M8RA 4KLJA 4M6WA 5DKWA 4ED0A 5KT7A 4E0DA 3HPOA 2UVVA 4UB2A 1R8BA 4Q44A 4RT2A 4FBUA 3C2LA 5CA7A 5DB7A 2ZTEA 5KFGA 2VA3A 1XSPA 9ICBA 4PHEA 2ZH9A 2JEFA 2J6UA 2I1QA 3OGUA 3KHHA 1DGSA 5J2JA 5L9XA 4FHPA 2BCUA 5L1KA 3PX6A 1TFWA 1DK3A 4DS4A 1MIWA 4QWAA 1VJ7A 1BNPA 2KZMA 2W9MA 3JYYA 4R66A 1X9WA 1RXWA 1ZQWA 5KT5A 1MQ3A 4WC1A 4P4OA 7ICMA 5HR9A 4DLGA 1ZJMA 2ZTCA 1ZQFA 1NO5A 3PW0A 3TARA 2ZH7A 1QSLA 2W9BB 1RXVA 1LV5A 1UA0A 2PFPA 4J9NA 1X2IA 4MFAA 3M9NB 2JEGA 1AROP 4GXIA 1D9FA 2NRVA 5IIKA 2ZTDA 5KG2A 4I2BA 8ICJA 3HJ4A 2JEJA 2R8KA 1SKWA 1CEZA 7ICLA 1NOMA 2ZH6A 4Z6CA 1RYRA 2FPLA 4TUQA 3HX0A 3C5FA 2ZH3A 2HVIA 3TANA 4IQTA 2FMSA 4MFCA 4YG2A 9ICHA 4EYIB 1DK2A 4F5OA 3PW7A 3KTQA 8ICEA 4GC7A 4EBCA 3PV8A 1ZQCA 5IIIA 4PGQA 4O3SA 4M9JA 5DDMA 3C23A 2PXIA 5J2KA 2BQUA 4ED2A 4YR0A 4DSJA 2BPFA 4DFJA 4J9SA 1ZQLA 4BDPA 4RUCA 1NK9A 3T5HA 2IMWP 4O5CA 4UD4A 5DECA 9ICMA 3B0XA 4DQQA 5DG9A 3TQ1A 4X5VA 3PW4A 3JZ0A 3PR4A 4GLXA 5D49A 1U47A 2BDPA 3RH5A 4R64A 5KFLA 3SYZA 3GDXA 2GWSA 3V6HA 5IINA 3TI0A 3QEBZ 4EYHB 2ISPA 4KLTA 4DL7A 7ICIA 1BNOA 8ICAA 1DOQA 4QZDA 1SL0A 2BGWA 4WBZA 5KG1A 2BR0A 5DG7A 2HHTA 4I2FA 1NK6A 3C5GA 2ZJAA 3RJEA 1YLQA 4FHXA 4QZ8A 2KTQA 2C2EA 5KG3A 2F1JA 4RPZA 4GC6A 4M6WB 3EPIA 1XC9A 4ECUA 4RQ8A 1IXRA 1TK5A 1TAQA 3Q8LA 2DRAA 4RPXA 4QZEA 8ICUA 2A1JA 1UA1A 4ED3A 4Q45A 3HT3A 3MDAA 3LWLA 2MUTA 4M9NA 3JPSA 1NJWA 2IHNA 4UB3A 4AT7A 4ELUA 2ASLA 4BXOA 1QSYA 4QZGA 4X4TA 4X4SA 4I28A 3KHGA 3G6VA 3ETLA 1Z00A 4XQ8A 4WC0A 4Z6EA 4EBJA 4DQIA 1H38A 3WFOA 2DR5A 5KFZA 1BPZA 3ZDDA 5DEDA 5DG8A 3ISCA 3T3FA 4M5DA 2Q0ZX 1ZQBA 1UEVA 2HVHA 1ZQJA 3GIJA 1CUKA 2V9WA 2W9AA 8ICQA 3LQCB 3ZDBA 3MR6A 4F5PA 4ECRA 2FLPA 4I2EA 4ELTA 2NRKA 5DBCA 1K1SA 3ZDEA 2HW3A 8ICTA 7ICPA 5HRKA 3C2MA 9ICLA 5CB1A 3RBEA 2XY6A 4WC3A 3RJKA 3HIYA 1MSWD 4KLOA 4DQRA 8ICHA 3RJIA 3N4MB 5DBAA 3ISDA 1S76D 4O3PA 1QTMA 4RPYA 1RPLA 4JUZA 5EWFA 2BHNA 3OHAA 4ECZA 2W8KA 1T7PA 9ICKA 1ZQDA 1KFTA 3GIKA 4DSKA 2OWOA 3BJYA 7ICEA 4ED7A 4AT9B 1U45A 1BPBA 1A77A 3RJGA 1KTQA 2M2UA 2XCAA 4DOCA 3AUOA 4YD2A 4PHDA 1Q78A 2DR9A 3UPQA 5KTQA 4K4IA 3SV3A 4X4NA 5HHIA 4NXZA 2Q66A 8ICKA 2I9GA 4MFFA 2HHUA 4B9TA 4IRKA 4DOBA 4F5RA 1V4AA 4ECWA 3OVAA 2BCVA 3RBDA 2ZUBA 4F50A 5KFBA 3H4BA 1KSPA 9ICAA 4RT3A 5KFWA 9ICQA 4J9MA 1XU4A 2BKEA 4MF8A 4TURA 4MEYA 1TK0A 9ICCA 3SZ2A 2M2VA 4X4QA 3ISBA 2C2DA 1ZQOA 4DFKA 2FMQA 1TFYA 3V7KA 5HREA 2FLLA 4KLUA 1Y88A 3UQ2A 2V4RA 3G6XA 4WBYA 2NRWA 1NKCA 1C7YA 4O3NA 4IQUA 3M9MB 1BPYA 1ZQAA 1U9LA 3ORYA 3GIIA 1WCLA 2MUTB 4RQ5A 2IBKA 1KEJA 5KFTA 4AT7B 1MQ2A 1NZPA 4X0AA 3V6KA 1MC8A 4C8NA 3OVBA 3TFRA 4NLZA 7ICFA 4RQ4A 3E2EA 3HW8A 3OHBA 4EEYA 1Z00B 3JPOA 1ZJNA 2RDJA 5J0YA 3JPQA 2KN7A 4KN4A 4DF8A 1U48A 2FLNA 3ZDAA 4DSLA 1Z3EB 1R89A 1XS9D 1N48A 5HMMA 4I2AA 1FA0A 4QWEA 4Z6DA 4XA5A 3TAQA 4QWBA 5KG0A 5KT2A 2DVIA 3PY8A 4HYKA 4KTQA 5KG6A 5KFNA 4M47A 5KFVA 1T4GA 4ED6A 4FH3A 2C2RA 1ZETA 2ZUDA 2DRBA 4QZCA 4F91B 4TQRA 4UB1A 3GILA 3Q8SB 2BCRA 5J29A 1TAUA 3T5LA 4NY8A 1ZQIA 2HHWA 2ISOA 4X4RA 1ZQMA 4XRHA 3FDSA 4RWPA 2NRTA 3ZD9A 5HHHA 5DBBA 5DB9A 1PZNA 4JV0A 3GV7B 1JMSA 4K4GA 7ICSA 3C66A 4KLQA 5HRIA 1WOTA 4ECTA 1ZYQA 3IM1A 3PX0A 4ECSA 4KLGA 4P2HA 1T3NA 1KDHA 4X4UA 2ZH5A 3QZ7A 1JIHA 4JV1A 4F3OA 4KLHA 4PGYA 3RTVA 3RJHA 1S0NA 1K1QA 4O5KA 3RAQA 1ZQUA 3PO4A 1QLNA 5HRDA 3K4GA 1NKEA 2HHQA 1NKBA 1HUZA 8ICZA 4UAZA 1D8YA 1SKRA 3UPSA 4ATBB 8ICVA 4UBBA 2H5XA 4PHPA 3UXOA 1LB2B 4X4VA 3QE9Y 4B9LA 4KLSA 5KFSA 1NK7A 4B9NA 5L1LA 4K4HA 2NRXA 4YR2A 4F2SA 5F2VO 5KT3A 4TUPA 4FS1A 2KZ3A 4IRDA 2FMPA 9ICRA 2HHVA 4J9LA 5D46A 1JN3A 3OVSA 1ZQYA 4F4WA 5CHGA 2C28A 1ZQTA 4AT8A 2MAXA 1T8EA 5KG4A 5DB8A 4F5QA 3SV4A 2W9CA 4FH5A 2IA6A 4UB4A 5DQIA 3GFKB 3MFIA 1KLNA 8ICPA 3AQLA 3RJJA 2ZH2A 3RH4A 2AQ4A 1L3VA 3OSNA 1UEUA 9ICJA 5J0UA 4E80A 1KFDA 2RDIA 5KFYA 4UBCA 4YQWA 3V72A 1S0MA 4YVZA 3BQ1A 3JPRA 5J0PA 4Q43A 4EZ9A 2ZH8A 4KLIA 4BGDA 4YR3A 4QWCA 2NRZA 4YN4A 2BQRA 1HUOA 2PBEA 1ZQPA 4KLMA 7ICQA 1JXEA 4P4PA 3LDAA 3JPNA 4DFMA 1U49A 4S3NA 4IG8A 5IIOA 1ZQXA 5J0WA 3RB3A 7ICGA 1NK0A 4R8UA 1ZQHA 4J9PA 3MABA 5IIJA 5DQGA 5KT4A 3JPPA 1TK8A 2BPGA 4DOAA 4DSEA 1S0OA 4RNNA 4C8KA 4FBTA 5KG5A 3Q8QB 1ZQEA 3RB4A 3TAPA 2M2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJ5 A;  1WCN A;  4YD1 A;  3MGI A;  3KHL A;  4B9U A;  4BWJ A;  3GQC A;  8ICS A;  3MR2 A;  4ECX A;  2WTF A;  3TFS A;  5HRB A;  1TFR A;  2DFL A;  2W9B A;  3H8W A;  3THV A;  3H4D A;  2PFQ A;  4DSF A;  4F2R A;  9ICF A;  2O1P A;  7ICR A;  5KG7 A;  1NJY A;  4XUS A;  3RH6 A;  2ZJ8 A;  4O3Q A;  5DLG A;  2B21 A;  4ECQ A;  4F4K A;  4DL3 A;  3BDP A;  3BQ2 A;  1JQR A;  5KFF A;  1S9F A;  5BOL A;  4MF2 A;  4NM1 A;  3Q8K A;  1XO1 A;  3C2K A;  4QZ9 A;  5KFJ A;  4IR1 A;  4NKT A;  4EBK A;  2ZHB A;  4QZB A;  4I27 A;  3C1Y A;  5J2A A;  9ICG A;  5J0O A;  3EW9 A;  2R8H A;  1SZP A;  2XGQ A;  3AU2 A;  7ICJ A;  4NM2 A;  4DL6 A;  4M04 A;  3RR8 A;  3OJU A;  5HRH A;  2C22 A;  4F4X A;  1S77 D;  4Z6F A;  5J0Q A;  3GIM A;  1BVS A;  5J0X A;  4QW9 A;  1RYS A;  2P6R A;  2HHS A;  8ICC A;  5JUM A;  1V9P A;  3M8S A;  1KNY A;  2XY7 A;  1D9D A;  2IHM A;  4I2H A;  2P66 A;  3PVX A;  3MR5 A;  1MIY A;  3RB6 A;  2ALZ A;  1XSL A;  1ZQG A;  5KFX A;  9ICI A;  4TQS A;  2AU0 A;  3M9O B;  2Y1J A;  8ICY A;  3H7I A;  1TVA A;  4F4Y A;  2A1J B;  4RWO A;  2XCP A;  4JWN A;  7ICH A;  5HML A;  4YP3 A;  5IIM A;  4JWM A;  4YXJ A;  2W9C B;  3V6J A;  1BPX A;  4JV2 A;  2JEI A;  8ICM A;  7ICK A;  2BQ3 A;  3OUY A;  3BQT A;  5CP2 A;  5J2D A;  4BXO B;  1JAJ A;  3Q8P B;  1UT8 A;  1D8L A;  3GV8 B;  2FPM A;  3C21 A;  8ICN A;  5KFK A;  2J6S A;  3C18 A;  1ZQK A;  2BCQ A;  4EBE A;  3PW2 A;  8ICX A;  4X0B A;  4J9R A;  4QZF A;  1SL2 A;  4R65 A;  9ICW A;  9ICS A;  4F93 B;  3UQ0 A;  4UD5 A;  3Q8M A;  1X9M A;  3PNC A;  3QZ8 A;  2V4Q A;  3Q8R B;  4DQS A;  3OSP A;  4P4M A;  3MR3 A;  5HP4 A;  1L5U A;  3RR7 A;  4B9V A;  4I2G A;  8ICG A;  1ZQV A;  4PHA A;  1XSN A;  9ICT A;  4ZH4 A;  4M2Y A;  5J2I A;  4UB5 A;  3KHR A;  4MEX A;  4PPX A;  4R8U B;  4PGX A;  9ICX A;  4RQ2 A;  3HJ1 A;  4DWI A;  2O5A A;  1NK8 A;  3PR5 B;  2ZHA A;  4ELV A;  1B22 A;  4RQ6 A;  5KFU A;  2PFO A;  3MBY A;  4IQV A;  2XGP A;  2KP7 A;  5L1I A;  3NYB A;  5KFM A;  5J0T A;  1NJZ A;  2R8I A;  9ICP A;  4RUA A;  3QEA Z;  2M9N A;  1A76 A;  1XWL A;  5TZV A;  1SKS A;  1Q79 A;  2Y1I A;  4WC6 A;  5KFO A;  4G3I A;  2AGO A;  1U4B A;  2DPJ A;  2ID1 A;  1BGX T;  5KFE A;  5DGB A;  4NLK A;  1MIV A;  1KFS A;  5J0S A;  3T5K A;  2ASD A;  7ICU A;  9ICU A;  1UET A;  5DB6 A;  7ICV A;  3H39 A;  4WC5 A;  5J2E A;  1N56 A;  4RQ0 A;  4RU9 A;  5KFA A;  2UVU A;  2AQ0 A;  1VFG A;  3V7J A;  4FO6 A;  5J2C A;  5HRL A;  5J2G A;  3BQ0 A;  4EBD A;  4RZR A;  2F1I A;  2ATL A;  4X4P A;  4KLL A;  2XY5 A;  4IR9 A;  8ICI A;  3PO5 A;  3PMN A;  4ED8 A;  3FYH A;  3RJF A;  5HNK A;  2PFN A;  4RWQ A;  2RFF A;  1X9S A;  2JZB A;  4KMU A;  1F5A A;  4EZ6 A;  2BE3 A;  4DSI A;  5IIL A;  4CCH A;  4I2D A;  4KLE A;  1SL1 A;  4LZD A;  4Q8F A;  4AT9 A;  3H37 A;  2UVR A;  4JK1 A;  4BWM A;  4RNO A;  3MGH A;  3RAX A;  2KZZ A;  4IRC A;  4DO9 A;  8ICF A;  4XQ7 A;  4E8F A;  3T5J A;  3H40 A;  4M9G A;  4YXM A;  1S10 A;  4J9O A;  2HHP A;  1NJX A;  3N97 B;  8ICO A;  4QZA A;  5BOM A;  4KIT B;  3GV5 B;  3G6Y A;  5J0R A;  4DLE A;  7ICN A;  5CR0 A;  3H38 A;  5KFD A;  2KFZ A;  5L1J A;  1TKD A;  2AGP A;  3NGD A;  4Q8E A;  4QWD A;  4FHV A;  3OUY B;  4WCW A;  1BPE A;  4TUS A;  4UQG A;  4FS2 A;  5DGA A;  1ZQR A;  2DR7 A;  2FPK A;  4YMN A;  3V7L A;  2R8G A;  1QSS A;  4I29 A;  4I2C A;  4LVS A;  2ZH1 A;  4B9S A;  4NLN A;  5CWR A;  1ZQZ A;  5F9N A;  5KFI A;  1BPD A;  5KFC A;  2XC9 A;  3LWM A;  4J9Q A;  3PX4 A;  4LZG A;  1R8A A;  3LK9 A;  5D4B A;  4FHY A;  2DR8 A;  4YMO A;  2AGQ A;  4I2J A;  4FHW A;  4RQ7 A;  1JX4 A;  5DQH A;  4C8O A;  4WC2 A;  2PI5 A;  4KN7 A;  5DDY A;  4O5E A;  2AJQ A;  3OV7 A;  2ZUC A;  4ECY A;  4ED1 A;  5KT6 A;  4DS5 A;  3AQM A;  5F9L A;  9ICO A;  3K75 D;  8ICR A;  3UXP A;  3L9D A;  5J2F A;  5BPC A;  2XO7 A;  1NK4 A;  3C1Z A;  3EZ5 A;  5EWG A;  3PW5 A;  3HWT A;  4NKU A;  3AQK A;  4UAW A;  5KFR A;  3SI8 A;  2P6U A;  3UXN A;  1L3U A;  7ICO A;  5HC9 A;  4J9K A;  3NTU A;  1OU5 A;  1IM4 A;  5KFH A;  5CJ7 A;  3H8S A;  1TV9 A;  2ASJ A;  9ICV A;  4QZI A;  4B9M A;  8ICW A;  5J2H A;  4F8R A;  1ZQN A;  2R8J A;  3WFP A;  4X4O A;  2VA8 A;  4DQP A;  5DLF A;  4DEZ A;  2VAN A;  4C8L A;  2ZH4 A;  2BPC A;  4O3O A;  3ZD8 A;  4M0A A;  3AU6 A;  3H8J A;  1L3T A;  3JPT A;  3RRG A;  4DL4 A;  2F1H A;  5EWE A;  4YFK A;  2KFN A;  4RNM A;  3AQN A;  5HRF A;  2W8L A;  4KLD A;  4C8M A;  2J6T A;  4QW8 A;  4YCX A;  4QZH A;  1NK5 A;  1S97 A;  4IQW A;  4O9M A;  4WC4 A;  3WFR E;  2HHX A;  7ICT A;  4F5N A;  3RB0 A;  1R8C A;  4NLG A;  2JZB B;  3MDC A;  3OJS A;  3EPG A;  1EXN A;  3EWA A;  9ICN A;  4GXK A;  2M2W A;  4O0I A;  1UT5 A;  4M9H A;  4E7X A;  2PI4 A;  1HJP A;  8ICB A;  3H3A A;  4RWN A;  2LYH A;  4YMM A;  4DFP A;  1RZT A;  4R63 A;  8ICL A;  4RQ1 A;  4M9L A;  1S0V A;  9ICE A;  5HRG A;  4EP7 A;  5EOZ A;  5KFP A;  1ZQS A;  4PH5 A;  5J2B A;  1ZQQ A;  3B0Y A;  4DF4 A;  4LT6 A;  4AT8 B;  4F4Z A;  2UVW A;  4O3R A;  2DPI A;  1B43 A;  4ATB A;  2BCS A;  4RQ3 A;  1JXL A;  1PX5 A;  4WC7 A;  4I2I A;  1KRP A;  3WFQ E;  3PML A;  3IHQ B;  4ECV A;  3ZDC A;  5C5J A;  4GXJ A;  1COO A;  4DL5 A;  4DL2 A;  2VA2 A;  4F92 B;  3RRH A;  4UAY A;  3MFH A;  1L3S A;  3EYZ A;  4KLF A;  3WFS C;  3HP6 A;  5KFQ A;  3M8R A;  4KLJ A;  4M6W A;  5DKW A;  4ED0 A;  5KT7 A;  4E0D A;  3HPO A;  2UVV A;  4UB2 A;  1R8B A;  4Q44 A;  4RT2 A;  4FBU A;  3C2L A;  5CA7 A;  5DB7 A;  2ZTE A;  5KFG A;  2VA3 A;  1XSP A;  9ICB A;  4PHE A;  2ZH9 A;  2JEF A;  2J6U A;  2I1Q A;  3OGU A;  3KHH A;  1DGS A;  5J2J A;  5L9X A;  4FHP A;  2BCU A;  5L1K A;  3PX6 A;  1TFW A;  1DK3 A;  4DS4 A;  1MIW A;  4QWA A;  1VJ7 A;  1BNP A;  2KZM A;  2W9M A;  3JYY A;  4R66 A;  1X9W A;  1RXW A;  1ZQW A;  5KT5 A;  1MQ3 A;  4WC1 A;  4P4O A;  7ICM A;  5HR9 A;  4DLG A;  1ZJM A;  2ZTC A;  1ZQF A;  1NO5 A;  3PW0 A;  3TAR A;  2ZH7 A;  1QSL A;  2W9B B;  1RXV A;  1LV5 A;  1UA0 A;  2PFP A;  4J9N A;  1X2I A;  4MFA A;  3M9N B;  2JEG A;  1ARO P;  4GXI A;  1D9F A;  2NRV A;  5IIK A;  2ZTD A;  5KG2 A;  4I2B A;  8ICJ A;  3HJ4 A;  2JEJ A;  2R8K A;  1SKW A;  1CEZ A;  7ICL A;  1NOM A;  2ZH6 A;  4Z6C A;  1RYR A;  2FPL A;  4TUQ A;  3HX0 A;  3C5F A;  2ZH3 A;  2HVI A;  3TAN A;  4IQT A;  2FMS A;  4MFC A;  4YG2 A;  9ICH A;  4EYI B;  1DK2 A;  4F5O A;  3PW7 A;  3KTQ A;  8ICE A;  4GC7 A;  4EBC A;  3PV8 A;  1ZQC A;  5III A;  4PGQ A;  4O3S A;  4M9J A;  5DDM A;  3C23 A;  2PXI A;  5J2K A;  2BQU A;  4ED2 A;  4YR0 A;  4DSJ A;  2BPF A;  4DFJ A;  4J9S A;  1ZQL A;  4BDP A;  4RUC A;  1NK9 A;  3T5H A;  2IMW P;  4O5C A;  4UD4 A;  5DEC A;  9ICM A;  3B0X A;  4DQQ A;  5DG9 A;  3TQ1 A;  4X5V A;  3PW4 A;  3JZ0 A;  3PR4 A;  4GLX A;  5D49 A;  1U47 A;  2BDP A;  3RH5 A;  4R64 A;  5KFL A;  3SYZ A;  3GDX A;  2GWS A;  3V6H A;  5IIN A;  3TI0 A;  3QEB Z;  4EYH B;  2ISP A;  4KLT A;  4DL7 A;  7ICI A;  1BNO A;  8ICA A;  1DOQ A;  4QZD A;  1SL0 A;  2BGW A;  4WBZ A;  5KG1 A;  2BR0 A;  5DG7 A;  2HHT A;  4I2F A;  1NK6 A;  3C5G A;  2ZJA A;  3RJE A;  1YLQ A;  4FHX A;  4QZ8 A;  2KTQ A;  2C2E A;  5KG3 A;  2F1J A;  4RPZ A;  4GC6 A;  4M6W B;  3EPI A;  1XC9 A;  4ECU A;  4RQ8 A;  1IXR A;  1TK5 A;  1TAQ A;  3Q8L A;  2DRA A;  4RPX A;  4QZE A;  8ICU A;  2A1J A;  1UA1 A;  4ED3 A;  4Q45 A;  3HT3 A;  3MDA A;  3LWL A;  2MUT A;  4M9N A;  3JPS A;  1NJW A;  2IHN A;  4UB3 A;  4AT7 A;  4ELU A;  2ASL A;  4BXO A;  1QSY A;  4QZG A;  4X4T A;  4X4S A;  4I28 A;  3KHG A;  3G6V A;  3ETL A;  1Z00 A;  4XQ8 A;  4WC0 A;  4Z6E A;  4EBJ A;  4DQI A;  1H38 A;  3WFO A;  2DR5 A;  5KFZ A;  1BPZ A;  3ZDD A;  5DED A;  5DG8 A;  3ISC A;  3T3F A;  4M5D A;  2Q0Z X;  1ZQB A;  1UEV A;  2HVH A;  1ZQJ A;  3GIJ A;  1CUK A;  2V9W A;  2W9A A;  8ICQ A;  3LQC B;  3ZDB A;  3MR6 A;  4F5P A;  4ECR A;  2FLP A;  4I2E A;  4ELT A;  2NRK A;  5DBC A;  1K1S A;  3ZDE A;  2HW3 A;  8ICT A;  7ICP A;  5HRK A;  3C2M A;  9ICL A;  5CB1 A;  3RBE A;  2XY6 A;  4WC3 A;  3RJK A;  3HIY A;  1MSW D;  4KLO A;  4DQR A;  8ICH A;  3RJI A;  3N4M B;  5DBA A;  3ISD A;  1S76 D;  4O3P A;  1QTM A;  4RPY A;  1RPL A;  4JUZ A;  5EWF A;  2BHN A;  3OHA A;  4ECZ A;  2W8K A;  1T7P A;  9ICK A;  1ZQD A;  1KFT A;  3GIK A;  4DSK A;  2OWO A;  3BJY A;  7ICE A;  4ED7 A;  4AT9 B;  1U45 A;  1BPB A;  1A77 A;  3RJG A;  1KTQ A;  2M2U A;  2XCA A;  4DOC A;  3AUO A;  4YD2 A;  4PHD A;  1Q78 A;  2DR9 A;  3UPQ A;  5KTQ A;  4K4I A;  3SV3 A;  4X4N A;  5HHI A;  4NXZ A;  2Q66 A;  8ICK A;  2I9G A;  4MFF A;  2HHU A;  4B9T A;  4IRK A;  4DOB A;  4F5R A;  1V4A A;  4ECW A;  3OVA A;  2BCV A;  3RBD A;  2ZUB A;  4F50 A;  5KFB A;  3H4B A;  1KSP A;  9ICA A;  4RT3 A;  5KFW A;  9ICQ A;  4J9M A;  1XU4 A;  2BKE A;  4MF8 A;  4TUR A;  4MEY A;  1TK0 A;  9ICC A;  3SZ2 A;  2M2V A;  4X4Q A;  3ISB A;  2C2D A;  1ZQO A;  4DFK A;  2FMQ A;  1TFY A;  3V7K A;  5HRE A;  2FLL A;  4KLU A;  1Y88 A;  3UQ2 A;  2V4R A;  3G6X A;  4WBY A;  2NRW A;  1NKC A;  1C7Y A;  4O3N A;  4IQU A;  3M9M B;  1BPY A;  1ZQA A;  1U9L A;  3ORY A;  3GII A;  1WCL A;  2MUT B;  4RQ5 A;  2IBK A;  1KEJ A;  5KFT A;  4AT7 B;  1MQ2 A;  1NZP A;  4X0A A;  3V6K A;  1MC8 A;  4C8N A;  3OVB A;  3TFR A;  4NLZ A;  7ICF A;  4RQ4 A;  3E2E A;  3HW8 A;  3OHB A;  4EEY A;  1Z00 B;  3JPO A;  1ZJN A;  2RDJ A;  5J0Y A;  3JPQ A;  2KN7 A;  4KN4 A;  4DF8 A;  1U48 A;  2FLN A;  3ZDA A;  4DSL A;  1Z3E B;  1R89 A;  1XS9 D;  1N48 A;  5HMM A;  4I2A A;  1FA0 A;  4QWE A;  4Z6D A;  4XA5 A;  3TAQ A;  4QWB A;  5KG0 A;  5KT2 A;  2DVI A;  3PY8 A;  4HYK A;  4KTQ A;  5KG6 A;  5KFN A;  4M47 A;  5KFV A;  1T4G A;  4ED6 A;  4FH3 A;  2C2R A;  1ZET A;  2ZUD A;  2DRB A;  4QZC A;  4F91 B;  4TQR A;  4UB1 A;  3GIL A;  3Q8S B;  2BCR A;  5J29 A;  1TAU A;  3T5L A;  4NY8 A;  1ZQI A;  2HHW A;  2ISO A;  4X4R A;  1ZQM A;  4XRH A;  3FDS A;  4RWP A;  2NRT A;  3ZD9 A;  5HHH A;  5DBB A;  5DB9 A;  1PZN A;  4JV0 A;  3GV7 B;  1JMS A;  4K4G A;  7ICS A;  3C66 A;  4KLQ A;  5HRI A;  1WOT A;  4ECT A;  1ZYQ A;  3IM1 A;  3PX0 A;  4ECS A;  4KLG A;  4P2H A;  1T3N A;  1KDH A;  4X4U A;  2ZH5 A;  3QZ7 A;  1JIH A;  4JV1 A;  4F3O A;  4KLH A;  4PGY A;  3RTV A;  3RJH A;  1S0N A;  1K1Q A;  4O5K A;  3RAQ A;  1ZQU A;  3PO4 A;  1QLN A;  5HRD A;  3K4G A;  1NKE A;  2HHQ A;  1NKB A;  1HUZ A;  8ICZ A;  4UAZ A;  1D8Y A;  1SKR A;  3UPS A;  4ATB B;  8ICV A;  4UBB A;  2H5X A;  4PHP A;  3UXO A;  1LB2 B;  4X4V A;  3QE9 Y;  4B9L A;  4KLS A;  5KFS A;  1NK7 A;  4B9N A;  5L1L A;  4K4H A;  2NRX A;  4YR2 A;  4F2S A;  5F2V O;  5KT3 A;  4TUP A;  4FS1 A;  2KZ3 A;  4IRD A;  2FMP A;  9ICR A;  2HHV A;  4J9L A;  5D46 A;  1JN3 A;  3OVS A;  1ZQY A;  4F4W A;  5CHG A;  2C28 A;  1ZQT A;  4AT8 A;  2MAX A;  1T8E A;  5KG4 A;  5DB8 A;  4F5Q A;  3SV4 A;  2W9C A;  4FH5 A;  2IA6 A;  4UB4 A;  5DQI A;  3GFK B;  3MFI A;  1KLN A;  8ICP A;  3AQL A;  3RJJ A;  2ZH2 A;  3RH4 A;  2AQ4 A;  1L3V A;  3OSN A;  1UEU A;  9ICJ A;  5J0U A;  4E80 A;  1KFD A;  2RDI A;  5KFY A;  4UBC A;  4YQW A;  3V72 A;  1S0M A;  4YVZ A;  3BQ1 A;  3JPR A;  5J0P A;  4Q43 A;  4EZ9 A;  2ZH8 A;  4KLI A;  4BGD A;  4YR3 A;  4QWC A;  2NRZ A;  4YN4 A;  2BQR A;  1HUO A;  2PBE A;  1ZQP A;  4KLM A;  7ICQ A;  1JXE A;  4P4P A;  3LDA A;  3JPN A;  4DFM A;  1U49 A;  4S3N A;  4IG8 A;  5IIO A;  1ZQX A;  5J0W A;  3RB3 A;  7ICG A;  1NK0 A;  4R8U A;  1ZQH A;  4J9P A;  3MAB A;  5IIJ A;  5DQG A;  5KT4 A;  3JPP A;  1TK8 A;  2BPG A;  4DOA A;  4DSE A;  1S0O A;  4RNN A;  4C8K A;  4FBT A;  5KG5 A;  3Q8Q B;  1ZQE A;  3RB4 A;  3TAP A;  2M2T A; 
#chains in the Genus database with same CATH topology
 2MSN A;  3MGI A;  4B9U A;  2WTF A;  3TFS A;  5K4L A;  3THV A;  4OJO A;  4UB8 U;  1SXD A;  3RH6 A;  2ZJ8 A;  4O3Q A;  5DLG A;  2B21 A;  4ECQ A;  4F4K A;  4DL3 A;  3BS5 A;  5KFF A;  5BOL A;  4MF2 A;  4NM1 A;  3Q8K A;  2MRL A;  1XO1 A;  4P0P B;  4QZ9 A;  3MCR A;  4M04 A;  4I0U A;  3WKA A;  5J0Q A;  1RYS A;  5J0X A;  4QW9 A;  3AQF A;  3QU2 A;  5JUM A;  2P66 A;  1MIY A;  3RB6 A;  2ALZ A;  4CF5 A;  1OW5 A;  1RYU A;  3H7I A;  5HML A;  2F76 X;  4YP3 A;  4YXJ A;  2W9C B;  3V6J A;  1BPX A;  4JV2 A;  8ICM A;  7ICK A;  4K9B A;  3BQT A;  4WJ3 B;  8ICN A;  4EBE A;  2LHT A;  3PW2 A;  4X0B A;  1SL2 A;  4R65 A;  4F93 B;  4UD5 A;  5JU5 A;  3A0H U;  3Q8R B;  4DQS A;  1HEK A;  5AI0 A;  5HP4 A;  3RR7 A;  1ZQV A;  4CDG A;  1XSN A;  2E8P A;  4ZH4 A;  2PMZ F;  2K4I A;  2VJ5 A;  3KHR A;  9ICX A;  3HJ1 A;  5KL8 B;  4RQ2 A;  2ZHA A;  1B22 A;  5L1I A;  9ICP A;  4EEN A;  4OAH A;  1SKS A;  4WC6 A;  5ALG A;  2NYV A;  1WWV A;  5ALZ A;  5KFE A;  5TIS U;  4NLK A;  1MIV A;  4WC5 A;  4NJ8 A;  2ASD A;  3H39 A;  4C4S A;  5KFA A;  3UMB A;  1VFG A;  5G5G A;  1IIP A;  3H0R B;  4X4P A;  2F1I A;  1IV8 A;  3PMN A;  4ED8 A;  3FYH A;  5HNK A;  1KN5 A;  4CCH A;  2HBL A;  1FFV A;  4Q8F A;  2I5H A;  5GTH U;  4JK1 A;  1QQ7 A;  5KAF U;  3MGH A;  2UVR A;  4XQ7 A;  1X6J A;  1TE2 A;  1OUQ A;  4QZA A;  5ALK A;  2KVC A;  4KIT B;  3GV5 B;  5CR0 A;  4LJX A;  5KFD A;  2DGZ A;  2KFZ A;  4FHV A;  1QQ6 A;  2IOF K;  4WCW A;  3OUY B;  1BPE A;  2GA9 D;  4FS2 A;  3D2Q A;  4OAG A;  2ZH1 A;  4PJ0 U;  4I2C A;  1QSS A;  5F9N A;  2XC9 A;  2HI0 A;  4J9Q A;  1DRG A;  3F5E A;  4RQ7 A;  1JX4 A;  4WC2 A;  4KN7 A;  2AJQ A;  3OWG A;  3AQM A;  5F9L A;  1Z1B A;  5J2F A;  4QNL A;  1JAL A;  5AKX A;  5KFR A;  4Y2P A;  7ICO A;  1OU5 A;  4NLC A;  5KFH A;  1O08 A;  2W03 A;  5J2H A;  3WFP A;  5ALP A;  4DQP A;  5DLF A;  2VAN A;  2BPC A;  4O3O A;  2HDO A;  2DWQ A;  2G5H B;  1L3T A;  2JHD A;  2LM4 A;  5AM5 A;  4YFK A;  2KFN A;  4KLD A;  4C8M A;  4QW8 A;  4YCX A;  1NK5 A;  1S97 A;  1V38 A;  1ZRM A;  4JLZ A;  4C0Z A;  1R8C A;  2PMZ C;  3NAS A;  4GXK A;  2M2W A;  1PK3 A;  2PI4 A;  8ICB A;  1J97 A;  4NL9 A;  1PUZ A;  4R63 A;  4M9L A;  2G06 A;  5HRG A;  5EOZ A;  4BUG A;  5J2B A;  1ZQQ A;  2OYY A;  4LT6 A;  3H0M B;  4ATB A;  2DPI A;  1B43 A;  2BCS A;  5KNI A;  2L5Y A;  4WC7 A;  1KRP A;  1COO A;  2EH9 A;  3RRH A;  3MFH A;  1L3S A;  3WFS C;  4FE3 A;  2KKP A;  4M6W A;  5DKW A;  4ED0 A;  3NRZ A;  5KT7 A;  1CI4 A;  5CA7 A;  3N7R C;  5L9X A;  2F3N A;  3PX6 A;  1LKY A;  2YQE A;  2KZM A;  2W7P A;  4UAT A;  1ZQW A;  1MQ3 A;  2RLT A;  1X9X A;  1ZJM A;  2ZTC A;  2ZH7 A;  1LV5 A;  4QJF B;  4MFA A;  4GXI A;  2K89 A;  1D9F A;  2ZTD A;  4KX5 A;  3BS5 B;  3QUC A;  2ZIW A;  4Z6C A;  3HX0 A;  2ZH3 A;  4KMO B;  4IQT A;  2CN1 A;  4EYI B;  3QUT A;  1ZQC A;  5J8Y A;  4ED2 A;  1L7P A;  4YR0 A;  4RUC A;  2IMW P;  4UD4 A;  5DEC A;  3TQ1 A;  5AI8 A;  4CE6 A;  2G0A A;  3PR4 A;  5D49 A;  2YML A;  5KFL A;  3SYZ A;  3GDX A;  2KVS A;  3IN5 A;  3WKE A;  2ISP A;  3KKA A;  3PHZ A;  2BGW A;  2BR0 A;  5DG7 A;  3NVO A;  1NK6 A;  2KTQ A;  4GC6 A;  4ECU A;  3FM9 A;  2QB1 A;  3RF9 A;  4RPX A;  4QZE A;  1L7N A;  2A1J A;  4ED3 A;  4M9N A;  1NJW A;  4QZG A;  3G6V A;  3ETL A;  3WFO A;  5KFZ A;  1Q3V A;  1CRX A;  2E3T A;  2Q0Z X;  1UEV A;  1ZQJ A;  1CUK A;  1VDV A;  4OD0 A;  5ALF A;  3MR6 A;  2NRK A;  1K1S A;  8ICT A;  3WK5 A;  7ICP A;  5CB1 A;  3RBE A;  5AIC A;  1F0M A;  4DQR A;  2K8C B;  2WF8 A;  5CFU A;  1RPL A;  4JUZ A;  3OHA A;  1KW4 A;  2W8K A;  1T7P A;  9ICK A;  2E1F A;  3N7P D;  2M2U A;  4DOC A;  4PHD A;  5B3Q A;  2DR9 A;  4FFD A;  2E5S A;  2Q66 A;  2KE7 A;  4B9T A;  4DOB A;  1SV4 A;  3RBD A;  3H4B A;  1N5W A;  2CPR A;  5EE0 A;  2LBO A;  1XNS A;  1ZQO A;  2EDU A;  5HR6 A;  1Y88 A;  4WBY A;  1ZQA A;  2RQ5 A;  4AT7 B;  1FIQ A;  4X0A A;  1NZP A;  1MC8 A;  5AKE A;  3OVB A;  3OHB A;  4EEY A;  3CK6 A;  2KJ9 A;  1ZJN A;  1PK1 A;  3B9J A;  1FO4 A;  2LMR A;  2YN4 A;  3JPQ A;  3HIL A;  4KN4 A;  2KN7 A;  4C7Y A;  4DF8 A;  2FLN A;  1L7M A;  3ZDA A;  1XS9 D;  1N48 A;  4Z6D A;  4XA5 A;  5KT2 A;  3IDW A;  2W3R A;  5KG6 A;  4M47 A;  5KFV A;  2RP5 A;  4O69 A;  2ZUD A;  2JH7 A;  3EF2 A;  3Q8S B;  3SEN A;  5J29 A;  2WB1 F;  4OJP A;  1ZQM A;  2NRT A;  5DB9 A;  5DBB A;  4K4G A;  7ICS A;  5GTI U;  5JTI A;  3PX0 A;  4ECS A;  4P0P A;  1KDH A;  4JV1 A;  4F3O A;  5H2F U;  3RJH A;  3RAQ A;  4PL2 A;  5HRD A;  1NKE A;  4U7C A;  4ATB B;  3UPS A;  2H3Q A;  8ICV A;  4UBB A;  4PHP A;  4X4V A;  1S8O A;  3ERC C;  4K9A A;  1HIW A;  3R9K A;  5F2V O;  5KT3 A;  4TUP A;  1IG6 A;  3OTQ A;  4J9L A;  5D46 A;  1JN3 A;  2AXT U;  1ZQY A;  4F4W A;  5CHG A;  2KG5 A;  5DB8 A;  2W9C A;  5ALL A;  5DQI A;  3GFK B;  8ICP A;  3RH4 A;  3QX7 A;  5ALY A;  9ICJ A;  5J0U A;  3PST A;  3JPR A;  1TAM A;  5J0P A;  1LKY B;  4EZ9 A;  1WG8 A;  4KLI A;  4BGD A;  4YR3 A;  1O03 A;  2NRZ A;  1HUO A;  2PBE A;  4RQM A;  4P4P A;  3AN1 A;  3RB3 A;  2WF5 A;  4OJL A;  4I2F A;  5IIJ A;  2BPG A;  1TK8 A;  4RNN A;  1ZQE A;  5G5H A;  2ZIW B;  3NVV A;  2KOB A;  3K1R B;  4BWJ A;  2DFL A;  4F2R A;  2O1P A;  9ICF A;  3H4D A;  5KG7 A;  1NJY A;  3OPX A;  2FE9 A;  4EBK A;  1JQR A;  3BDP A;  2B6G A;  4OCZ A;  2K4E A;  1URJ A;  4I27 A;  3EW9 A;  1A6S A;  2R8H A;  3AU2 A;  4JLX A;  3OJU A;  2D3D A;  2CRX A;  2HN1 A;  1S77 D;  3GIM A;  2Y9U A;  1KNY A;  1V9P A;  2XY7 A;  3PVX A;  9ICI A;  5ALI A;  2AU0 A;  2Y1J A;  2WB1 C;  2W43 A;  4F4Y A;  2A1J B;  4RWO A;  7ICH A;  2KHV A;  2YMM A;  3OUY A;  2JEI A;  3QNM A;  5CP2 A;  4NXW A;  3C21 A;  5KFK A;  3C18 A;  8ICX A;  4QZF A;  1X9M A;  3K7D A;  4B9V A;  3OSP A;  8ICG A;  2B56 A;  4I2G A;  9ICT A;  4M2Y A;  3K1Z A;  2O5A A;  2DKZ A;  3NUQ A;  5KFU A;  2PFO A;  1NNL A;  5KFM A;  1NJZ A;  1Q46 A;  2R8I A;  5AM4 A;  1XWL A;  2K8A A;  5ALN A;  1Q8K A;  4G3I A;  2AGO A;  4FZN A;  4O3M A;  1U4B A;  2DPJ A;  2ID1 A;  7ICU A;  2RHF A;  2LYB A;  7ICV A;  2BBH A;  4UB6 U;  5ALD A;  4UAV A;  3EUB 2;  3F2C A;  3WK6 A;  1Z19 A;  3BQ0 A;  4EBD A;  3F53 A;  4XJE A;  2ATL A;  4KLL A;  8ICI A;  5ALT A;  4RWQ A;  2RFF A;  1X9S A;  2BE3 A;  4DSI A;  4AT9 A;  8ICF A;  2KZZ A;  2HN2 A;  3WU2 U;  3H40 A;  4M9G A;  3N97 B;  8ICO A;  2GAF D;  5ALQ A;  4F71 A;  3G6Y A;  5J0R A;  3BS7 A;  4DLE A;  2YMP A;  2DF4 B;  5AKJ A;  3NGD A;  4Q8E A;  4QWD A;  3RFA A;  4UQG A;  3ER8 C;  4I29 A;  1QH9 A;  4LVS A;  3QXG A;  1UCV A;  4NLN A;  5CWR A;  1ZQZ A;  5KFC A;  1BPD A;  3PX4 A;  2DR8 A;  1PK1 B;  4LZG A;  1R8A A;  5D4B A;  4YMO A;  2AGQ A;  5AM3 A;  4O5E A;  5DDY A;  3OV7 A;  4ED1 A;  3S6J A;  3TAC B;  3C1Z A;  2H3I A;  3EZ5 A;  4NKU A;  3HWT A;  3AQK A;  4K8V A;  5AKY A;  4J9K A;  3TKA A;  1TV9 A;  1ZRN A;  3H8S A;  4UW9 A;  5AIA A;  4QZI A;  3SEI A;  4B9M A;  4F8R A;  1ZQN A;  2VA8 A;  3SD7 A;  4PZN A;  4M0A A;  3AU6 A;  3JPT A;  4RNM A;  3AQN A;  2J6T A;  4QZH A;  4Y2X A;  4WC4 A;  3RB0 A;  1SZH A;  4O0I A;  4M9H A;  4E7X A;  2LYH A;  4YMM A;  8ICL A;  9ICE A;  2XVT A;  5KFP A;  1ZQS A;  4PH5 A;  4DF4 A;  2HOQ A;  4F4Z A;  1PX5 A;  4I2I A;  3IHQ B;  3CNH A;  5C5J A;  4GXJ A;  4DL2 A;  2VA2 A;  1ZOL A;  4KLF A;  3QUQ A;  3TAD A;  3M8R A;  2RRD A;  3DV9 A;  3HPO A;  4EED A;  2EAO A;  1R8B A;  1DGJ A;  3PSF A;  4FZL A;  5KFG A;  2VA3 A;  1ED1 A;  9ICB A;  2P35 A;  2WF7 A;  3OGU A;  1DK3 A;  4DS4 A;  1MIW A;  4USA A;  1BNP A;  1QCK A;  2W9M A;  2KV2 A;  4P4O A;  2YY6 A;  4NWI A;  4DLG A;  5HR9 A;  1N2X A;  3PW0 A;  1QSL A;  2PFP A;  1F5S A;  3M9N B;  2JEG A;  3HJ4 A;  2E8N A;  1CEZ A;  1RYR A;  4TUQ A;  2R18 A;  2FMS A;  2W11 A;  1DK2 A;  2FDR A;  4F5O A;  5AKL A;  3PW7 A;  4GC7 A;  3KTQ A;  3PV8 A;  2JV3 A;  1KQQ A;  5III A;  3WKC A;  4M9J A;  2QLT A;  5DDM A;  2BQU A;  4JB3 A;  4HX0 A;  1VJ5 A;  1ZQL A;  4BDP A;  1NK9 A;  3B0X A;  5AI4 A;  3PW4 A;  4GLX A;  3UM9 A;  4KM5 A;  4R64 A;  1RQL A;  5IIN A;  3QEB Z;  2KIV A;  4EYH B;  7ICI A;  1BNO A;  8ICA A;  1SL0 A;  4FHX A;  3M6Z A;  4C7Z A;  2C2E A;  2B4V A;  5KG3 A;  5L1M A;  2MU2 A;  3DDH A;  4RPZ A;  1XC9 A;  1IXR A;  1N5X A;  2EAP A;  2K4P A;  3Q8L A;  1UA1 A;  3HT3 A;  4Y2V A;  2IHN A;  4AT7 A;  4UB3 A;  1KL9 A;  5AKZ A;  4X4S A;  2F77 X;  5D61 A;  4XQ8 A;  4Z6E A;  2H3F A;  4PL1 A;  2W9A A;  3LQC B;  3ZDB A;  4ELT A;  5DBC A;  2WF9 A;  2KIW A;  2XIC A;  2HMX A;  5HRK A;  4K96 A;  9ICL A;  2QB0 A;  3IP4 B;  2XY6 A;  1V85 A;  3HIY A;  4WC3 A;  1J2M A;  1MSW D;  4KLO A;  8ICH A;  4AYB F;  3ALR A;  4RPY A;  2A19 A;  4ECZ A;  1T3Q A;  3GIK A;  4LEW A;  4DSK A;  4AT9 B;  1U45 A;  1A77 A;  3FC4 A;  3ICX A;  5ALU A;  5HR7 A;  4YD2 A;  2F44 A;  3SV3 A;  4X4N A;  4NXZ A;  4MFF A;  4F5R A;  4RT3 A;  2JR5 A;  5AKH A;  5AM2 A;  2FCL A;  1LVH A;  4MEY A;  4NXT A;  3A0B U;  4DFK A;  2FMQ A;  2OEH A;  2FLL A;  4KLU A;  3G6X A;  2NRW A;  1C7Y A;  4O3N A;  2E8O A;  4IQU A;  3M9M B;  1BPY A;  2O6K A;  5C0Y A;  1U9L A;  3ORY A;  3GII A;  5AM1 A;  1MQ2 A;  5ALO A;  7ICF A;  3GU3 A;  1Z00 B;  3F2D A;  2OHF A;  4ZOH C;  1WUD A;  2LKY A;  3ONN A;  4DSL A;  4I2A A;  5KG0 A;  2H3V A;  4GIB A;  4F91 B;  4UB1 A;  1L6N A;  4LEV A;  4X4R A;  5HHH A;  1JMS A;  5HRI A;  2ZH5 A;  1A0P A;  2KSO A;  4KLH A;  3RTV A;  1S0N A;  3VC8 A;  2HHQ A;  1X40 A;  1HUZ A;  4UAZ A;  1LB2 B;  3WKB A;  3WK7 A;  4B9L A;  5KFS A;  1NK7 A;  4K4H A;  4YR2 A;  3NWI A;  2G07 A;  3J81 j;  3PSP A;  4IRD A;  2HHV A;  3M7D A;  4AYB C;  4AT8 A;  5ALH A;  4F5Q A;  2IA6 A;  4EEB A;  1KLN A;  4NL9 C;  2AQ4 A;  3WK9 A;  4AP9 A;  4Y2U A;  2RDI A;  1YT3 A;  3V72 A;  1NI3 A;  1S0M A;  4YVZ A;  3IG5 A;  2ZH8 A;  2G09 A;  5ALE A;  2BQR A;  1WYG A;  4UAU A;  1YZ6 A;  4DFM A;  1U49 A;  5IIO A;  1ZQ1 C;  2YB1 A;  2ZIU A;  4DOA A;  4DSE A;  5KG5 A;  3Q8Q B;  5JTG A;  2DKX A;  2ZJ5 A;  1WCN A;  3KHL A;  3GQC A;  3MR2 A;  1SWW A;  5ALM A;  5EE1 A;  5HRB A;  1TFR A;  3H8W A;  4DSF A;  7ICR A;  4XUS A;  1RQN A;  2KEY A;  3C2K A;  5KFJ A;  4NKT A;  4QZB A;  1SZP A;  2XGQ A;  4NM2 A;  4DL6 A;  3RR8 A;  2KMD A;  5ALS A;  4F4X A;  4WQL A;  2P6R A;  2HHS A;  1BVS A;  8ICC A;  3M8S A;  1D9D A;  2IHM A;  4I2H A;  3MR5 A;  1ZQG A;  5J8Y C;  3M9O B;  1FEZ A;  2XCP A;  4JWN A;  3HRD D;  2ZH2 A;  2YMQ A;  3NVY A;  4NXX A;  5J2D A;  1JAJ A;  1D8L A;  1KKX A;  2FPM A;  3WK8 A;  2J6S A;  1L8L A;  4J9R A;  9ICW A;  9ICS A;  3KKA C;  1JI7 A;  3QZ8 A;  2V4Q A;  1L5U A;  3OVA A;  3MR3 A;  4PHA A;  3LYS A;  3QUB A;  2BZF A;  4PGX A;  4DWI A;  1NK8 A;  5AK4 A;  2QB0 B;  4ELV A;  4E8F A;  3NYB A;  4IQV A;  5J0T A;  4RUA A;  2EWR A;  1A76 A;  1Q79 A;  2Y1I A;  5KFO A;  1BGX T;  1N60 A;  9ICU A;  1UET A;  2JRZ A;  5J2E A;  1N56 A;  4RU9 A;  3V7J A;  4FO6 A;  5J2G A;  2F8L A;  4IR9 A;  3PO5 A;  3RJF A;  2QKQ A;  2DUY A;  4KMU A;  1F5A A;  4EZ6 A;  5IIL A;  1B0X A;  1SV0 A;  5B66 U;  3H37 A;  3RAX A;  4IRC A;  3T5J A;  2EQY A;  1S10 A;  4J9O A;  2HHP A;  1NJX A;  4G9B A;  3ZI4 A;  7ICN A;  3H38 A;  2KK0 A;  5L1J A;  1M6Y A;  3D2N A;  1TKD A;  3ED5 A;  4TUS A;  1UPH A;  5D62 A;  2DR7 A;  5KFI A;  4FHY A;  3LK9 A;  5CRX A;  4I2J A;  2OCE A;  4FHW A;  2DL0 A;  5KT6 A;  4DS5 A;  3UXP A;  1Z4N A;  2XO7 A;  1NK4 A;  3SAF A;  5EWG A;  3PW5 A;  2GOL A;  4B6J A;  3UXN A;  1L3U A;  2KHQ A;  2ASJ A;  4EEK A;  2Q4T A;  3M1Y A;  2M0N A;  4DEZ A;  2ZH4 A;  3ZD8 A;  4BJQ A;  1T94 A;  4FZM A;  2F8K A;  2KSO B;  3RRG A;  2F1H A;  1QQ5 A;  1YZ7 A;  4O9M A;  3WFR E;  5AIB A;  2HHX A;  2E1E A;  2CXY A;  7ICT A;  4F5N A;  4IL6 U;  5B5E U;  2JZB B;  9ICN A;  5FP0 A;  1UT5 A;  2KKV A;  2YTU A;  4RWN A;  4RQ1 A;  1S0V A;  5ALW A;  2VIX A;  2XI9 A;  4US8 A;  2WHE A;  4AT8 B;  2VJ4 A;  2JH1 A;  4RQ3 A;  1JXL A;  4ECV A;  3ZDC A;  4UAY A;  3EYZ A;  4KLJ A;  1PVP A;  2FJ6 A;  4Q44 A;  3C2L A;  4CF3 A;  1S5L U;  1ECW A;  2Y0S C;  1XSP A;  2ZH9 A;  2JEF A;  2ZIU B;  3KHH A;  1DGS A;  4RQN A;  5KL1 B;  5J2J A;  4FHP A;  2BCU A;  5L1K A;  2B0C A;  3KOO A;  4QWA A;  2HBM A;  4R66 A;  1RXW A;  4WC1 A;  7ICM A;  1NO5 A;  2MA1 A;  3TAR A;  2IOF A;  3JCF A;  4IS7 A;  2NRV A;  8ICJ A;  1X42 A;  2JEJ A;  3E0F A;  7ICL A;  1NOM A;  2ZH6 A;  2JMG A;  1F44 A;  2HVI A;  3NRW A;  4O3S A;  4PGQ A;  2A3V A;  2BDU A;  3C23 A;  2PXI A;  2ZIV B;  2BPF A;  3SAG A;  4CNQ A;  3T5H A;  9ICM A;  5DG9 A;  2IOH A;  4X5V A;  1N61 A;  1U47 A;  2BDP A;  3RH5 A;  4FO1 A;  1X66 A;  2GWS A;  3TI0 A;  3QU5 A;  4KLT A;  4UAS A;  4QZD A;  2XID A;  2HHT A;  2NO5 A;  3C5G A;  4GFJ A;  4RQ8 A;  1TAQ A;  2HCF A;  3O0F A;  5AI5 A;  2DRA A;  8ICU A;  4Q45 A;  3LWL A;  1Q3U A;  4OJ5 A;  4ELU A;  4JMU A;  2ASL A;  4BXO A;  1QSY A;  4O68 A;  4P0Q A;  1Z00 A;  4WC0 A;  4EBJ A;  1H38 A;  3QYP A;  5DED A;  4IC9 A;  3ISC A;  4M5D A;  3QU7 A;  3GIJ A;  1MN8 A;  1SGG A;  3SR6 A;  2FLP A;  4PZO A;  2HW3 A;  3AL0 B;  2ODG A;  2HOF A;  1MA7 A;  5DBA A;  4O3P A;  3D6J A;  1D8B A;  5EWF A;  2BHN A;  1ZQD A;  1KFT A;  3F5A A;  3BJY A;  1OXJ A;  7ICE A;  4ED7 A;  3SMV A;  1BPB A;  4O67 A;  1Q78 A;  4NV0 A;  3UPQ A;  5KTQ A;  4K4I A;  5HHI A;  8ICK A;  4EX7 A;  2I9G A;  2HHU A;  4IRK A;  4ECW A;  4F50 A;  9ICA A;  9ICQ A;  5AKI A;  4J9M A;  1RM6 C;  1VLB A;  2LPE A;  4MF8 A;  5CFT A;  4QIW F;  9ICC A;  1N62 A;  3SZ2 A;  4X4Q A;  3ISB A;  2C2D A;  1TFY A;  3V7K A;  2KNJ A;  3UQ2 A;  1NKC A;  3N7S C;  2K60 A;  1WCL A;  2ES6 A;  2MUT B;  1KEJ A;  3V6K A;  4OAI Z;  3TFR A;  4NLZ A;  3GZF A;  3JPO A;  3ER9 B;  5J0Y A;  1U48 A;  3WKD A;  3CP8 A;  1Z3E B;  3KD3 A;  1R89 A;  1FA0 A;  3TAQ A;  3PY8 A;  4KTQ A;  5KFN A;  3KZI U;  2JXJ A;  1T4G A;  4ED6 A;  2K8B B;  4FH3 A;  2C2R A;  2DRB A;  4QZC A;  3GIL A;  3T5L A;  4XRH A;  3FDS A;  4RWP A;  5AM0 A;  2JGA A;  3LVV A;  1PZN A;  4JV0 A;  3GV7 B;  5ALJ A;  3C66 A;  4KLQ A;  1WOT A;  1ZYQ A;  3IM1 A;  2NV3 A;  4KLG A;  4X4U A;  3QZ7 A;  3I76 A;  1K1Q A;  1NZB A;  1NKB A;  8ICZ A;  1SKR A;  2H5X A;  3UXO A;  4B9N A;  4Y2R A;  5L1L A;  2NRX A;  2OH2 A;  4CRX A;  9ICR A;  3IG8 A;  2FMP A;  2ZG6 A;  5F3X B;  2C28 A;  1ZQT A;  2PKE A;  1T8E A;  4NXV A;  3CRX A;  4KB6 A;  4UB4 A;  3MFI A;  3DEE A;  3AQL A;  3RJJ A;  3OSN A;  4E80 A;  3MC1 A;  4YQW A;  2W55 A;  4Q43 A;  5AHX A;  4YN4 A;  4N7R A;  7ICQ A;  1ZD3 A;  1JXE A;  3JPN A;  4IG8 A;  1ZQX A;  3TAD C;  5J0W A;  7ICG A;  1NK0 A;  5CEH A;  3L4P A;  1ZQH A;  3NVW A;  4J9P A;  5DQG A;  1S0O A;  3RB4 A;  3TAP A;  3C28 A;  2M2T A;  4QIW C;  4YD1 A;  4EGW A;  4HAI A;  3VCB A;  8ICS A;  4ECX A;  5ALV A;  2W9B A;  2PFQ A;  5D63 A;  2VKQ A;  2N1R A;  3BQ2 A;  1S9F A;  1JRP A;  2ZIX A;  1FFU A;  4IR1 A;  2ZHB A;  3C1Y A;  5J2A A;  2A1A A;  5J0O A;  9ICG A;  3E58 A;  7ICJ A;  1B4F A;  4EV6 A;  2C22 A;  4Z6F A;  4OO1 J;  3BQ7 A;  1XSL A;  3C29 A;  2EAN A;  5KFX A;  2F2A B;  4TQS A;  3PZP A;  8ICY A;  1TVA A;  2IHO A;  5IIM A;  4JWM A;  2ZXI A;  2BQ3 A;  1RDF A;  4BXO B;  3Q8P B;  1UT8 A;  3GV8 B;  4P0Q B;  4C4T A;  1ZQK A;  4K98 A;  2BCQ A;  1N63 A;  2G08 A;  3UQ0 A;  2W7O A;  3Q8M A;  3PNC A;  1SIJ A;  5KAI U;  4PPX A;  9ICH A;  4P4M A;  4OAF A;  1J2N A;  5J2I A;  4UB5 A;  4MEX A;  4R8U B;  3PR5 B;  1PVR A;  3AMZ A;  4RQ6 A;  2KP7 A;  3MBY A;  2XGP A;  4K97 A;  3QEA Z;  2M9N A;  5TZV A;  3AM9 A;  3CW2 C;  5AK5 A;  5DGB A;  3ETR A;  1KFS A;  5J0S A;  3T5K A;  5DB6 A;  2D8C A;  3HJE A;  3WK4 A;  3SAH A;  4RQ0 A;  2UVU A;  2AQ0 A;  5J2C A;  5HRL A;  3M6K A;  4RZR A;  2XY5 A;  2GH1 A;  4F72 A;  2DQN B;  2PFN A;  2JZB A;  2AH5 A;  3HKZ F;  4I2D A;  4KLE A;  1SL1 A;  4LZD A;  4RNO A;  4BWM A;  4DO9 A;  2DBY A;  4C80 A;  2LYA A;  4YXM A;  5BOM A;  2EZY A;  4BX9 C;  1GPJ A;  2AGP A;  4MKP A;  2NO4 A;  4NLB A;  5DGA A;  2KD1 A;  1ZQR A;  2FPK A;  4YMN A;  1UQV A;  3V7L A;  3T79 A;  2R8G A;  4B9S A;  4NXU A;  3LWM A;  1ZD2 P;  4DFD A;  5DQH A;  2E8M A;  4C8O A;  2PI5 A;  2ESE A;  2ZUC A;  4ECY A;  1L7O A;  9ICO A;  3K75 D;  8ICR A;  3L9D A;  5BPC A;  4KX3 A;  1JRO A;  4UAW A;  3SI8 A;  2P6U A;  5HC9 A;  3NTU A;  1IM4 A;  5CJ7 A;  9ICV A;  8ICW A;  1Z1V A;  2R8J A;  4X4O A;  4C8L A;  3U26 A;  2LM1 A;  3H8J A;  4DL4 A;  5EWE A;  5CFS A;  5HRF A;  2W8L A;  4UAR A;  4IQW A;  4J03 A;  2ZIV A;  3QU4 A;  4NLG A;  3MDC A;  3OJS A;  3EPG A;  1EXN A;  2G5I B;  3EWA A;  1HJP A;  2D6F C;  3H3A A;  4DFP A;  1RZT A;  5T14 A;  2QAR A;  2W3S A;  2YB4 A;  2BBJ A;  4EP7 A;  2EZX A;  2EAM A;  3B0Y A;  2UVW A;  4O3R A;  3UMG A;  4Y2Y A;  2B51 A;  3WFQ E;  3I28 A;  1AQ6 A;  3PML A;  3D2S A;  4DL5 A;  4F92 B;  5E79 U;  3HP6 A;  5KFQ A;  1X6I A;  3H0L B;  2W54 A;  4UB2 A;  2UVV A;  4FBU A;  4RT2 A;  2HBJ A;  2OM6 A;  1WWU A;  4EX6 A;  2ZTE A;  5DB7 A;  4PHE A;  2J6U A;  3HKZ C;  2I1Q A;  1TFW A;  2WAQ F;  4OJ6 A;  3JYY A;  1X9W A;  5KT5 A;  1KBU A;  1ZQF A;  3SQI A;  2W9B B;  1RXV A;  1UA0 A;  1V97 A;  1X2I A;  4J9N A;  2Z7J A;  3QU9 A;  1ARO P;  2GO7 A;  4I2B A;  5AI9 A;  5IIK A;  4LEY A;  5KG2 A;  2R8K A;  2ZIX B;  3BZK A;  1SKW A;  3AQE A;  3IRU A;  2FPL A;  3C5F A;  3TAN A;  4DCC A;  4MFC A;  4YG2 A;  2KJ5 A;  8ICE A;  1L8O A;  1JUD A;  2Y0S F;  4EBC A;  1SXE A;  5J2K A;  4Y2T A;  4DSJ A;  4DFJ A;  2W04 A;  4J9S A;  4O5C A;  4DQQ A;  2IUB A;  3JZ0 A;  3N28 A;  2EZZ A;  3MGV A;  3V6H A;  3LVW A;  4DL7 A;  1DOQ A;  4WBZ A;  5KG1 A;  2ZJA A;  3RJE A;  1YLQ A;  4QZ8 A;  2F1J A;  4CF4 A;  4M6W B;  3EPI A;  1TK5 A;  1UHU A;  5EE3 A;  1K5O A;  1Z4O A;  3MDA A;  2MUT A;  3JPS A;  4X4T A;  4I28 A;  3KHG A;  4US9 A;  2ZXH A;  3PSI A;  3KZX A;  4DQI A;  2DR5 A;  5AI6 A;  3KBB A;  3NKU A;  1BPZ A;  3ZDD A;  1P7D A;  5DG8 A;  3T3F A;  1ZQB A;  2HVH A;  2GLE A;  2V9W A;  8ICQ A;  5AK6 A;  4F5P A;  4ECR A;  4I2E A;  4ACO A;  1XO0 A;  5B3P A;  3ZDE A;  3CYM A;  3FAH A;  3C2M A;  4LEZ A;  3RJK A;  2HBK A;  1PVQ A;  3H8M A;  3RJI A;  3N4M B;  4U6P A;  3ISD A;  1ZD5 A;  1S76 D;  2AHO B;  1ZD4 A;  1QTM A;  4MHV A;  3NVZ A;  5ALR A;  2OXO A;  2KIC A;  2OWO A;  4O6A A;  5AK3 A;  4ICA A;  5CHE A;  3RJG A;  1KTQ A;  2WAQ C;  2XCA A;  1RG6 A;  3AUO A;  4C4R A;  1V4A A;  2BCV A;  1VJ7 A;  2ZUB A;  1KSP A;  2I6X A;  5KFB A;  5KFW A;  1XU4 A;  2BKE A;  4TUR A;  1TK0 A;  2M2V A;  3KFU F;  2YX8 A;  1SV0 C;  1DXS A;  1SWV A;  5HRE A;  2HSZ A;  2V4R A;  5EE9 A;  1C20 A;  2IBK A;  4RQ5 A;  1SB3 C;  5KFT A;  4C8N A;  4RQ4 A;  3E2E A;  3HW8 A;  4Y2Q A;  2RDJ A;  2HOI A;  3L5K A;  5HMM A;  4QWE A;  4QWB A;  2DVI A;  3L3F X;  4HYK A;  4K99 A;  5A0L A;  1ZET A;  4TQR A;  3UMC A;  5JRT A;  2BCR A;  1TAU A;  4NY8 A;  2HHW A;  2KJ8 A;  1ZQI A;  2ISO A;  4WH5 A;  5AKG A;  3ZD9 A;  2WFA A;  4Y2S A;  4ECT A;  3NS1 A;  4P2H A;  1T3N A;  1ZXI A;  1JIH A;  2H3Z A;  2QAR B;  4PGY A;  3F2B A;  4O5K A;  1ZQU A;  3PO4 A;  1QLN A;  3K4G A;  3BZC A;  1D8Y A;  4WQK A;  5ALX A;  3QE9 Y;  4KLS A;  4F2S A;  1COK A;  4Y2J A;  5AKK A;  4FS1 A;  2KZ3 A;  4EEL A;  3OVS A;  2Y9T A;  4A8E A;  2MAX A;  5KG4 A;  3SV4 A;  4FH5 A;  2WF6 A;  4CGZ A;  1L3V A;  1UEU A;  1KFD A;  5KFY A;  4UBC A;  2LI6 A;  3BQ1 A;  3I1Y A;  3AEV A;  4WOY A;  2FI1 A;  4QWC A;  1ZQP A;  3IV6 A;  4KLM A;  4S3N A;  3LDA A;  2K4H A;  4R8U A;  1GO3 F;  5HRH A;  3MAB A;  5KT4 A;  3JPP A;  4E0D A;  4FBT A;  4C8K A; 
#chains in the Genus database with same CATH homology
 2ZJ5 A;  1WCN A;  4YD1 A;  3MGI A;  3KHL A;  4B9U A;  4BWJ A;  3GQC A;  8ICS A;  3MR2 A;  4ECX A;  2WTF A;  3TFS A;  5HRB A;  1TFR A;  2DFL A;  2W9B A;  3H8W A;  3THV A;  3H4D A;  2PFQ A;  4DSF A;  4F2R A;  9ICF A;  2O1P A;  7ICR A;  5KG7 A;  1NJY A;  4XUS A;  3RH6 A;  2ZJ8 A;  4O3Q A;  5DLG A;  2B21 A;  4ECQ A;  4F4K A;  4DL3 A;  3BDP A;  3BQ2 A;  1JQR A;  5KFF A;  1S9F A;  5BOL A;  4MF2 A;  4NM1 A;  3Q8K A;  1XO1 A;  3C2K A;  4QZ9 A;  5KFJ A;  4IR1 A;  4NKT A;  4EBK A;  2ZHB A;  4QZB A;  4I27 A;  3C1Y A;  5J2A A;  9ICG A;  5J0O A;  3EW9 A;  2R8H A;  1SZP A;  2XGQ A;  3AU2 A;  7ICJ A;  4NM2 A;  4DL6 A;  4M04 A;  3RR8 A;  3OJU A;  5HRH A;  2C22 A;  4F4X A;  1S77 D;  4Z6F A;  5J0Q A;  3GIM A;  1BVS A;  5J0X A;  4QW9 A;  1RYS A;  2P6R A;  2HHS A;  8ICC A;  5JUM A;  1V9P A;  3M8S A;  1KNY A;  2XY7 A;  1D9D A;  2IHM A;  4I2H A;  2P66 A;  3PVX A;  3MR5 A;  1MIY A;  3RB6 A;  2ALZ A;  1XSL A;  1ZQG A;  5KFX A;  9ICI A;  4TQS A;  2AU0 A;  3M9O B;  2Y1J A;  8ICY A;  3H7I A;  1TVA A;  4F4Y A;  2A1J B;  4RWO A;  2XCP A;  4JWN A;  7ICH A;  5HML A;  4YP3 A;  5IIM A;  4JWM A;  4YXJ A;  2W9C B;  3V6J A;  1BPX A;  4JV2 A;  2JEI A;  8ICM A;  7ICK A;  2BQ3 A;  3OUY A;  3BQT A;  5CP2 A;  5J2D A;  4BXO B;  1JAJ A;  3Q8P B;  1UT8 A;  1D8L A;  3GV8 B;  2FPM A;  3C21 A;  8ICN A;  5KFK A;  2J6S A;  3C18 A;  1ZQK A;  2BCQ A;  4EBE A;  3PW2 A;  8ICX A;  4X0B A;  4J9R A;  4QZF A;  1SL2 A;  4R65 A;  9ICW A;  9ICS A;  4F93 B;  3UQ0 A;  4UD5 A;  3Q8M A;  1X9M A;  3PNC A;  3QZ8 A;  2V4Q A;  3Q8R B;  4DQS A;  3OSP A;  4P4M A;  3MR3 A;  5HP4 A;  1L5U A;  3RR7 A;  4B9V A;  4I2G A;  8ICG A;  1ZQV A;  4PHA A;  1XSN A;  9ICT A;  4ZH4 A;  4M2Y A;  5J2I A;  4UB5 A;  3KHR A;  4MEX A;  4PPX A;  4R8U B;  4PGX A;  9ICX A;  4RQ2 A;  3HJ1 A;  4DWI A;  2O5A A;  1NK8 A;  3PR5 B;  2ZHA A;  4ELV A;  1B22 A;  4RQ6 A;  5KFU A;  2PFO A;  3MBY A;  4IQV A;  2XGP A;  2KP7 A;  5L1I A;  3NYB A;  5KFM A;  5J0T A;  1NJZ A;  2R8I A;  9ICP A;  4RUA A;  3QEA Z;  2M9N A;  1A76 A;  1XWL A;  5TZV A;  1SKS A;  1Q79 A;  2Y1I A;  4WC6 A;  5KFO A;  4G3I A;  2AGO A;  1U4B A;  2DPJ A;  2ID1 A;  1BGX T;  5KFE A;  5DGB A;  4NLK A;  1MIV A;  1KFS A;  5J0S A;  3T5K A;  2ASD A;  7ICU A;  9ICU A;  1UET A;  5DB6 A;  7ICV A;  3H39 A;  4WC5 A;  5J2E A;  1N56 A;  4RQ0 A;  4RU9 A;  5KFA A;  2UVU A;  2AQ0 A;  1VFG A;  3V7J A;  4FO6 A;  5J2C A;  5HRL A;  5J2G A;  3BQ0 A;  4EBD A;  4RZR A;  2F1I A;  2ATL A;  4X4P A;  4KLL A;  2XY5 A;  4IR9 A;  8ICI A;  3PO5 A;  3PMN A;  4ED8 A;  3FYH A;  3RJF A;  5HNK A;  2PFN A;  4RWQ A;  2RFF A;  1X9S A;  2JZB A;  4KMU A;  1F5A A;  4EZ6 A;  2BE3 A;  4DSI A;  5IIL A;  4CCH A;  4I2D A;  4KLE A;  1SL1 A;  4LZD A;  4Q8F A;  4AT9 A;  3H37 A;  2UVR A;  4JK1 A;  4BWM A;  4RNO A;  3MGH A;  3RAX A;  2KZZ A;  4IRC A;  4DO9 A;  8ICF A;  4XQ7 A;  4E8F A;  3T5J A;  3H40 A;  4M9G A;  4YXM A;  1S10 A;  4J9O A;  2HHP A;  1NJX A;  3N97 B;  8ICO A;  4QZA A;  5BOM A;  4KIT B;  3GV5 B;  3G6Y A;  5J0R A;  4DLE A;  7ICN A;  5CR0 A;  3H38 A;  5KFD A;  2KFZ A;  5L1J A;  1TKD A;  2AGP A;  3NGD A;  4Q8E A;  4QWD A;  4FHV A;  3OUY B;  4WCW A;  1BPE A;  4TUS A;  4UQG A;  4FS2 A;  5DGA A;  1ZQR A;  2DR7 A;  2FPK A;  4YMN A;  3V7L A;  2R8G A;  1QSS A;  4I29 A;  4I2C A;  4LVS A;  2ZH1 A;  4B9S A;  4NLN A;  5CWR A;  1ZQZ A;  5F9N A;  5KFI A;  1BPD A;  5KFC A;  2XC9 A;  3LWM A;  4J9Q A;  3PX4 A;  4LZG A;  1R8A A;  3LK9 A;  5D4B A;  4FHY A;  2DR8 A;  4YMO A;  2AGQ A;  4I2J A;  4FHW A;  4RQ7 A;  1JX4 A;  5DQH A;  4C8O A;  4WC2 A;  2PI5 A;  4KN7 A;  5DDY A;  4O5E A;  2AJQ A;  3OV7 A;  2ZUC A;  4ECY A;  4ED1 A;  5KT6 A;  4DS5 A;  3AQM A;  5F9L A;  9ICO A;  3K75 D;  8ICR A;  3UXP A;  3L9D A;  5J2F A;  5BPC A;  2XO7 A;  1NK4 A;  3C1Z A;  3EZ5 A;  5EWG A;  3PW5 A;  3HWT A;  4NKU A;  3AQK A;  4UAW A;  5KFR A;  3SI8 A;  2P6U A;  3UXN A;  1L3U A;  7ICO A;  5HC9 A;  4J9K A;  3NTU A;  1OU5 A;  1IM4 A;  5KFH A;  5CJ7 A;  3H8S A;  1TV9 A;  2ASJ A;  9ICV A;  4QZI A;  4B9M A;  8ICW A;  5J2H A;  4F8R A;  1ZQN A;  2R8J A;  3WFP A;  4X4O A;  2VA8 A;  4DQP A;  5DLF A;  4DEZ A;  2VAN A;  4C8L A;  2ZH4 A;  2BPC A;  4O3O A;  3ZD8 A;  4M0A A;  3AU6 A;  3H8J A;  1L3T A;  3JPT A;  3RRG A;  4DL4 A;  2F1H A;  5EWE A;  4YFK A;  2KFN A;  4RNM A;  3AQN A;  5HRF A;  2W8L A;  4KLD A;  4C8M A;  2J6T A;  4QW8 A;  4YCX A;  4QZH A;  1NK5 A;  1S97 A;  4IQW A;  4O9M A;  4WC4 A;  3WFR E;  2HHX A;  7ICT A;  4F5N A;  3RB0 A;  1R8C A;  4NLG A;  2JZB B;  3MDC A;  3OJS A;  3EPG A;  1EXN A;  3EWA A;  9ICN A;  4GXK A;  2M2W A;  4O0I A;  1UT5 A;  4M9H A;  4E7X A;  2PI4 A;  1HJP A;  8ICB A;  3H3A A;  4RWN A;  2LYH A;  4YMM A;  4DFP A;  1RZT A;  4R63 A;  8ICL A;  4RQ1 A;  4M9L A;  1S0V A;  9ICE A;  5HRG A;  4EP7 A;  5EOZ A;  5KFP A;  1ZQS A;  4PH5 A;  5J2B A;  1ZQQ A;  3B0Y A;  4DF4 A;  4LT6 A;  4AT8 B;  4F4Z A;  2UVW A;  4O3R A;  2DPI A;  1B43 A;  4ATB A;  2BCS A;  4RQ3 A;  1JXL A;  1PX5 A;  4WC7 A;  4I2I A;  1KRP A;  3WFQ E;  3PML A;  3IHQ B;  4ECV A;  3ZDC A;  5C5J A;  4GXJ A;  1COO A;  4DL5 A;  4DL2 A;  2VA2 A;  4F92 B;  3RRH A;  4UAY A;  3MFH A;  1L3S A;  3EYZ A;  4KLF A;  3WFS C;  3HP6 A;  5KFQ A;  3M8R A;  4KLJ A;  4M6W A;  5DKW A;  4ED0 A;  5KT7 A;  4E0D A;  3HPO A;  2UVV A;  4UB2 A;  1R8B A;  4Q44 A;  4RT2 A;  4FBU A;  3C2L A;  5CA7 A;  5DB7 A;  2ZTE A;  5KFG A;  2VA3 A;  1XSP A;  9ICB A;  4PHE A;  2ZH9 A;  2JEF A;  2J6U A;  2I1Q A;  3OGU A;  3KHH A;  1DGS A;  5J2J A;  5L9X A;  4FHP A;  2BCU A;  5L1K A;  3PX6 A;  1TFW A;  1DK3 A;  4DS4 A;  1MIW A;  4QWA A;  1VJ7 A;  1BNP A;  2KZM A;  2W9M A;  3JYY A;  4R66 A;  1X9W A;  1RXW A;  1ZQW A;  5KT5 A;  1MQ3 A;  4WC1 A;  4P4O A;  7ICM A;  5HR9 A;  4DLG A;  1ZJM A;  2ZTC A;  1ZQF A;  1NO5 A;  3PW0 A;  3TAR A;  2ZH7 A;  1QSL A;  2W9B B;  1RXV A;  1LV5 A;  1UA0 A;  2PFP A;  4J9N A;  1X2I A;  4MFA A;  3M9N B;  2JEG A;  1ARO P;  4GXI A;  1D9F A;  2NRV A;  5IIK A;  2ZTD A;  5KG2 A;  4I2B A;  8ICJ A;  3HJ4 A;  2JEJ A;  2R8K A;  1SKW A;  1CEZ A;  7ICL A;  1NOM A;  2ZH6 A;  4Z6C A;  1RYR A;  2FPL A;  4TUQ A;  3HX0 A;  3C5F A;  2ZH3 A;  2HVI A;  3TAN A;  4IQT A;  2FMS A;  4MFC A;  4YG2 A;  9ICH A;  4EYI B;  1DK2 A;  4F5O A;  3PW7 A;  3KTQ A;  8ICE A;  4GC7 A;  4EBC A;  3PV8 A;  1ZQC A;  5III A;  4PGQ A;  4O3S A;  4M9J A;  5DDM A;  3C23 A;  2PXI A;  5J2K A;  2BQU A;  4ED2 A;  4YR0 A;  4DSJ A;  2BPF A;  4DFJ A;  4J9S A;  1ZQL A;  4BDP A;  4RUC A;  1NK9 A;  3T5H A;  2IMW P;  4O5C A;  4UD4 A;  5DEC A;  9ICM A;  3B0X A;  4DQQ A;  5DG9 A;  3TQ1 A;  4X5V A;  3PW4 A;  3JZ0 A;  3PR4 A;  4GLX A;  5D49 A;  1U47 A;  2BDP A;  3RH5 A;  4R64 A;  5KFL A;  3SYZ A;  3GDX A;  2GWS A;  3V6H A;  5IIN A;  3TI0 A;  3QEB Z;  4EYH B;  2ISP A;  4KLT A;  4DL7 A;  7ICI A;  1BNO A;  8ICA A;  1DOQ A;  4QZD A;  1SL0 A;  2BGW A;  4WBZ A;  5KG1 A;  2BR0 A;  5DG7 A;  2HHT A;  4I2F A;  1NK6 A;  3C5G A;  2ZJA A;  3RJE A;  1YLQ A;  4FHX A;  4QZ8 A;  2KTQ A;  2C2E A;  5KG3 A;  2F1J A;  4RPZ A;  4GC6 A;  4M6W B;  3EPI A;  1XC9 A;  4ECU A;  4RQ8 A;  1IXR A;  1TK5 A;  1TAQ A;  3Q8L A;  2DRA A;  4RPX A;  4QZE A;  8ICU A;  2A1J A;  1UA1 A;  4ED3 A;  4Q45 A;  3HT3 A;  3MDA A;  3LWL A;  2MUT A;  4M9N A;  3JPS A;  1NJW A;  2IHN A;  4UB3 A;  4AT7 A;  4ELU A;  2ASL A;  4BXO A;  1QSY A;  4QZG A;  4X4T A;  4X4S A;  4I28 A;  3KHG A;  3G6V A;  3ETL A;  1Z00 A;  4XQ8 A;  4WC0 A;  4Z6E A;  4EBJ A;  4DQI A;  1H38 A;  3WFO A;  2DR5 A;  5KFZ A;  1BPZ A;  3ZDD A;  5DED A;  5DG8 A;  3ISC A;  3T3F A;  4M5D A;  2Q0Z X;  1ZQB A;  1UEV A;  2HVH A;  1ZQJ A;  3GIJ A;  1CUK A;  2V9W A;  2W9A A;  8ICQ A;  3LQC B;  3ZDB A;  3MR6 A;  4F5P A;  4ECR A;  2FLP A;  4I2E A;  4ELT A;  2NRK A;  5DBC A;  1K1S A;  3ZDE A;  2HW3 A;  8ICT A;  7ICP A;  5HRK A;  3C2M A;  9ICL A;  5CB1 A;  3RBE A;  2XY6 A;  4WC3 A;  3RJK A;  3HIY A;  1MSW D;  4KLO A;  4DQR A;  8ICH A;  3RJI A;  3N4M B;  5DBA A;  3ISD A;  1S76 D;  4O3P A;  1QTM A;  4RPY A;  1RPL A;  4JUZ A;  5EWF A;  2BHN A;  3OHA A;  4ECZ A;  2W8K A;  1T7P A;  9ICK A;  1ZQD A;  1KFT A;  3GIK A;  4DSK A;  2OWO A;  3BJY A;  7ICE A;  4ED7 A;  4AT9 B;  1U45 A;  1BPB A;  1A77 A;  3RJG A;  1KTQ A;  2M2U A;  2XCA A;  4DOC A;  3AUO A;  4YD2 A;  4PHD A;  1Q78 A;  2DR9 A;  3UPQ A;  5KTQ A;  4K4I A;  3SV3 A;  4X4N A;  5HHI A;  4NXZ A;  2Q66 A;  8ICK A;  2I9G A;  4MFF A;  2HHU A;  4B9T A;  4IRK A;  4DOB A;  4F5R A;  1V4A A;  4ECW A;  3OVA A;  2BCV A;  3RBD A;  2ZUB A;  4F50 A;  5KFB A;  3H4B A;  1KSP A;  9ICA A;  4RT3 A;  5KFW A;  9ICQ A;  4J9M A;  1XU4 A;  2BKE A;  4MF8 A;  4TUR A;  4MEY A;  1TK0 A;  9ICC A;  3SZ2 A;  2M2V A;  4X4Q A;  3ISB A;  2C2D A;  1ZQO A;  4DFK A;  2FMQ A;  1TFY A;  3V7K A;  5HRE A;  2FLL A;  4KLU A;  1Y88 A;  3UQ2 A;  2V4R A;  3G6X A;  4WBY A;  2NRW A;  1NKC A;  1C7Y A;  4O3N A;  4IQU A;  3M9M B;  1BPY A;  1ZQA A;  1U9L A;  3ORY A;  3GII A;  1WCL A;  2MUT B;  4RQ5 A;  2IBK A;  1KEJ A;  5KFT A;  4AT7 B;  1MQ2 A;  1NZP A;  4X0A A;  3V6K A;  1MC8 A;  4C8N A;  3OVB A;  3TFR A;  4NLZ A;  7ICF A;  4RQ4 A;  3E2E A;  3HW8 A;  3OHB A;  4EEY A;  1Z00 B;  3JPO A;  1ZJN A;  2RDJ A;  5J0Y A;  3JPQ A;  2KN7 A;  4KN4 A;  4DF8 A;  1U48 A;  2FLN A;  3ZDA A;  4DSL A;  1Z3E B;  1R89 A;  1XS9 D;  1N48 A;  5HMM A;  4I2A A;  1FA0 A;  4QWE A;  4Z6D A;  4XA5 A;  3TAQ A;  4QWB A;  5KG0 A;  5KT2 A;  2DVI A;  3PY8 A;  4HYK A;  4KTQ A;  5KG6 A;  5KFN A;  4M47 A;  5KFV A;  1T4G A;  4ED6 A;  4FH3 A;  2C2R A;  1ZET A;  2ZUD A;  2DRB A;  4QZC A;  4F91 B;  4TQR A;  4UB1 A;  3GIL A;  3Q8S B;  2BCR A;  5J29 A;  1TAU A;  3T5L A;  4NY8 A;  1ZQI A;  2HHW A;  2ISO A;  4X4R A;  1ZQM A;  4XRH A;  3FDS A;  4RWP A;  2NRT A;  3ZD9 A;  5HHH A;  5DBB A;  5DB9 A;  1PZN A;  4JV0 A;  3GV7 B;  1JMS A;  4K4G A;  7ICS A;  3C66 A;  4KLQ A;  5HRI A;  1WOT A;  4ECT A;  1ZYQ A;  3IM1 A;  3PX0 A;  4ECS A;  4KLG A;  4P2H A;  1T3N A;  1KDH A;  4X4U A;  2ZH5 A;  3QZ7 A;  1JIH A;  4JV1 A;  4F3O A;  4KLH A;  4PGY A;  3RTV A;  3RJH A;  1S0N A;  1K1Q A;  4O5K A;  3RAQ A;  1ZQU A;  3PO4 A;  1QLN A;  5HRD A;  3K4G A;  1NKE A;  2HHQ A;  1NKB A;  1HUZ A;  8ICZ A;  4UAZ A;  1D8Y A;  1SKR A;  3UPS A;  4ATB B;  8ICV A;  4UBB A;  2H5X A;  4PHP A;  3UXO A;  1LB2 B;  4X4V A;  3QE9 Y;  4B9L A;  4KLS A;  5KFS A;  1NK7 A;  4B9N A;  5L1L A;  4K4H A;  2NRX A;  4YR2 A;  4F2S A;  5F2V O;  5KT3 A;  4TUP A;  4FS1 A;  2KZ3 A;  4IRD A;  2FMP A;  9ICR A;  2HHV A;  4J9L A;  5D46 A;  1JN3 A;  3OVS A;  1ZQY A;  4F4W A;  5CHG A;  2C28 A;  1ZQT A;  4AT8 A;  2MAX A;  1T8E A;  5KG4 A;  5DB8 A;  4F5Q A;  3SV4 A;  2W9C A;  4FH5 A;  2IA6 A;  4UB4 A;  5DQI A;  3GFK B;  3MFI A;  1KLN A;  8ICP A;  3AQL A;  3RJJ A;  2ZH2 A;  3RH4 A;  2AQ4 A;  1L3V A;  3OSN A;  1UEU A;  9ICJ A;  5J0U A;  4E80 A;  1KFD A;  2RDI A;  5KFY A;  4UBC A;  4YQW A;  3V72 A;  1S0M A;  4YVZ A;  3BQ1 A;  3JPR A;  5J0P A;  4Q43 A;  4EZ9 A;  2ZH8 A;  4KLI A;  4BGD A;  4YR3 A;  4QWC A;  2NRZ A;  4YN4 A;  2BQR A;  1HUO A;  2PBE A;  1ZQP A;  4KLM A;  7ICQ A;  1JXE A;  4P4P A;  3LDA A;  3JPN A;  4DFM A;  1U49 A;  4S3N A;  4IG8 A;  5IIO A;  1ZQX A;  5J0W A;  3RB3 A;  7ICG A;  1NK0 A;  4R8U A;  1ZQH A;  4J9P A;  3MAB A;  5IIJ A;  5DQG A;  5KT4 A;  3JPP A;  1TK8 A;  2BPG A;  4DOA A;  4DSE A;  1S0O A;  4RNN A;  4C8K A;  4FBT A;  5KG5 A;  3Q8Q B;  1ZQE A;  3RB4 A;  3TAP A;  2M2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...