4UD4A

Structural plasticity of cid1 provides a basis for its rna terminal uridylyl transferase activity
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
324
Chain Sequence
b'SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGAFLQAARIPIIKLTSDGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFAFYAYAFEPREKVVTFRRPDGYLTKQEKGWTKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(A) RNA POLYMERASE PROTEIN CID1
publication title Structural plasticity of Cid1 provides a basis for its distributive RNA terminal uridylyl transferase activity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 107
structure length 324
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ud4A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ud4A02
2PXIA 5IIJA 4Z6EA 4UB5A 4PHEA 5DBAA 4GXIA 9ICQA 2ZH6A 4PPXA 3RH5A 9ICPA 2M2UA 4M5DA 8ICOA 4UAZA 9ICVA 2M2TA 3RJKA 7ICFA 3WFPA 4MF8A 8ICEA 4KLUA 9ICOA 4KLEA 3WFRE 8ICCA 4UB2A 1ZQYA 2BPFA 1JAJA 1V4AA 8ICLA 4NKUA 4WBYA 4RPZA 3V7LA 2BCUA 3HX0A 2PFNA 3C2LA 7ICMA 1ZJMA 5IIOA 1XSNA 4O5EA 4M9JA 2BCRA 4WBZA 5HR9A 1MIWA 4O9MA 9ICSA 1HUZA 4FHVA 4KLGA 2BE3A 1BPZA 2ZH2A 4M9HA 4P4MA 4PGXA 3UQ2A 1MIYA 1VJ7A 5DECA 4I2EA 5D49A 4GXJA 3AQLA 1BPYA 4Z6DA 3RJIA 1ZQBA 8ICVA 4QZ8A 7ICSA 1BPEA 4WC2A 3C66A 3OUYB 9ICTA 4QZHA 4AT7A 2DR5A 4NY8A 9ICLA 5EOZA 3HW8A 2DRBA 1ZJNA 3OV7A 1R8CA 2O1PA 1KEJA 4M2YA 5BOLA 4RT3A 1NOMA 4RWNA 3L9DA 2BCQA 4FHYA 1ZQMA 4I2CA 4YMNA 4FO6A 4RT2A 3C5GA 4YD1A 4MFAA 4I2JA 1TV9A 3V72A 2M2VA 8ICXA 4YN4A 4QZDA 4FH3A 4F5PA 4IQWA 1ZQXA 2B51A 4KLLA 3AQNA 9ICIA 2IHMA 9ICCA 1UEUA 1WOTA 3WFSC 4LZDA 2BPGA 3ISBA 5J2JA 4UBBA 1ZQWA 3RH4A 4YMOA 3JPNA 1ZQLA 5DB6A 2HHPA 3C18A 4KLHA 2PFOA 4NM1A 4E7XA 1NO5A 4I2DA 5J0SA 1JMSA 9ICFA 4TUQA 8ICNA 3UPQA 1BPDA 3LQCB 3ISDA 5BOMA 4M0AA 5J2KA 2ZH7A 4TUPA 1ZQKA 4EP7A 4M04A 1OU5A 2ID1A 5DDYA 4KLSA 5HRLA 5HRHA 1RPLA 3WFOA 3C2KA 4XQ8A 1F5AA 3K75D 4K4HA 1UEVA 3UPSA 3OVAA 1ZQJA 1ZQTA 5DDMA 3B0YA 7ICLA 7ICUA 4KLIA 5J2AA 1ZQZA 4WC6A 3B0XA 4YCXA 3PMNA 3AU6A 3C5FA 1HUOA 4NKTA 3V7JA 2BPCA 3RJJA 4DO9A 3WFQE 5CP2A 3JPSA 3OGUA 4Z6FA 8ICRA 4QZEA 1JQRA 3OUYA 4WCWA 5J2CA 3UXOA 3RJGA 5F2VO 5J0OA 2Q66A 5J0RA 4X4QA 1ZQUA 5IILA 4QZAA 3ISCA 4FH5A 5J0UA 4X4RA 1ZQFA 4R66A 4P4OA 4DOCA 4RQ1A 4I29A 1ZQGA 2O5AA 4K4GA 4IQVA 9ICNA 1BPXA 5J2EA 2ZH4A 3OVSA 3HIYA 1RZTA 4I2AA 3H39A 5IINA 3MDCA 2I9GA 4RQ5A 1TVAA 8ICIA 1ZQNA 4R63A 3TFRA 5CR0A 3H3AA 1Q79A 4LZGA 4UB4A 4NLNA 3JPPA 4RQ0A 4DOBA 5DKWA 4RPYA 9ICJA 5J0WA 3RH6A 5J2DA 5J0XA 4RQ2A 3UXNA 5J2GA 4GXKA 9ICGA 4KLOA 4FHWA 4E80A 7ICVA 7ICIA 4I2IA 5HRFA 7ICOA 4UAWA 4ATBB 4X0BA 8ICTA 3RJEA 4NM2A 3JPQA 1ZQCA 4KLJA 9ICAA 4RQ4A 5IIKA 4IQTA 2GWSA 1FA0A 4X4VA 2VANA 3AQKA 4AT8B 5HHHA 2BCSA 4AT9B 7ICJA 5HRDA 1XSLA 5CHGA 1PX5A 5HRBA 4LVSA 7ICKA 1MIVA 4R65A 4UB1A 4EBKA 1KDHA 5J2HA 1ZQRA 7ICNA 4KLDA 4I2BA 1MQ3A 7ICPA 1ZQAA 3HWTA 1ZQPA 4I2GA 2W9MA 2ISPA 7ICQA 4F5OA 4KLTA 5DBBA 5HC9A 2B56A 4FHPA 3MGHA 3JZ0A 2BCVA 1ZQHA 1KNYA 3UQ0A 4PGYA 5HREA 1R8BA 1ZQOA 4RQ3A 5CB1A 1TFYA 4RQ6A 4X4SA 4PHAA 1UETA 8ICQA 4F5NA 4UD5A 1ZQEA 2DR7A 4JWMA 4F5RA 4MFFA 9ICWA 1YLQA 7ICGA 4O5KA 3NYBA 2M2WA 4RWOA 3AUOA 3JYYA 1ZQQA 1ZQDA 4MFCA 2ZHBA 5DEDA 3RJHA 4X4TA 7ICHA 3MBYA 4F5QA 4RWPA 1ZQVA 3AU2A 4PGQA 8ICKA 4NLZA 7ICEA 8ICMA 5CWRA 4WC4A 5J2IA 1R8AA 1Q78A 4MF2A 4I2FA 5IIIA 4QZ9A 2DR9A 2PFQA 3UXPA 4X4NA 4I27A 1ZQSA 5CA7A 5J0YA 1BPBA 2PBEA 4IG8A 4QZGA 4LT6A 3JPRA 8ICZA 1XSPA 4XQ7A 4WC3A 4XUSA 4WC1A 1R89A 4QZBA 3C2MA 3HJ4A 9ICKA 4RQ7A 3PMLA 4DOAA 2ZH3A 2DR8A 4WC7A 3H38A 4RWQA 1JN3A 4KLMA 4YMMA 4UD4A 4M47A 2ZH9A 2ZH1A 1ZQIA 4XRHA 3H37A 4K4IA 9ICRA 4IQUA 4RQ8A 3RJFA 5J29A 4EBJA 5HRKA 4ATBA 3OVBA 8ICFA 3TFSA 5J0TA 5TZVA 9ICEA 5J2BA 4QZIA 2FMQA 2ISOA 4AT8A 4XA5A 4X4OA 4TUSA 4UAYA 4PHPA 5J0QA 4AT9A 2ZH5A 3V7KA 8ICBA 8ICGA 2B4VA 4I2HA 9ICUA 8ICSA 4M9LA 7ICRA 5HHIA 4R64A 5J2FA 4WC0A 7ICTA 3PNCA 4TURA 4I28A 5D4BA 4AT7B 5DBCA 4M9GA 4O5CA 5DB9A 1TFWA 9ICXA 5HRGA 4YD2A 3HJ1A 5BPCA 3MDAA 4JWNA 4KLQA 2DRAA 3GDXA 5J0PA 9ICHA 9ICMA 3MGIA 4NXZA 4M9NA 3JPOA 2ZHAA 2FMSA 4UBCA 4FHXA 2DVIA 8ICYA 4NLKA 2ZH8A 5HRIA 4E8FA 4P2HA 4X4PA 2NRKA 4X4UA 3AQMA 4QZFA 4PHDA 4Z6CA 8ICWA 4QZCA 2P66A 2FMPA 4X0AA 3LK9A 1MQ2A 4S3NA 2RFFA 5D46A 8ICPA 8ICHA 5CJ7A 2PFPA 4X5VA 3JPTA 9ICBA 4RPXA 5IIMA 4WC5A 8ICUA 8ICAA 4P4PA 1VFGA 4PH5A 4UB3A 4KLFA 5DB7A 5DB8A 8ICJA
chains in the Genus database with same CATH superfamily
2PXIA 5IIJA 4Z6EA 4UB5A 4PHEA 5DBAA 4GXIA 9ICQA 2ZH6A 4PPXA 4LEVA 3RH5A 9ICPA 2M2UA 3OWGA 4M5DA 4K99A 8ICOA 4UAZA 9ICVA 2M2TA 3RJKA 7ICFA 3WFPA 4MF8A 8ICEA 4KLUA 5CFUA 9ICOA 4KLEA 4OAIZ 3WFRE 4LEZA 8ICCA 4UB2A 1ZQYA 2BPFA 1JAJA 1V4AA 8ICLA 4NKUA 4WBYA 4RPZA 3V7LA 2BCUA 3HX0A 2PFNA 3C2LA 7ICMA 1ZJMA 5IIOA 1XSNA 4O5EA 4M9JA 2BCRA 4WBZA 5HR9A 1MIWA 4O9MA 9ICSA 1HUZA 4FHVA 4KLGA 2BE3A 1BPZA 2ZH2A 4M9HA 5JTGA 4P4MA 4PGXA 3UQ2A 1MIYA 1VJ7A 5DECA 4I2EA 5D49A 4GXJA 3AQLA 1BPYA 4Z6DA 3RJIA 1ZQBA 8ICVA 4QZ8A 7ICSA 1BPEA 4WC2A 4NXUA 3C66A 3OUYB 9ICTA 4QZHA 4AT7A 2DR5A 4NY8A 9ICLA 5EOZA 3HW8A 4NXTA 2DRBA 1ZJNA 2GAFD 4EGWA 3OV7A 1R8CA 2O1PA 1KEJA 4M2YA 5BOLA 4RT3A 1NOMA 2BBJA 4RWNA 3L9DA 2BCQA 4FHYA 1ZQMA 4I2CA 4YMNA 4FO6A 4RT2A 3C5GA 4YD1A 4MFAA 4I2JA 1TV9A 3V72A 2M2VA 8ICXA 3ER9B 4YN4A 4QZDA 4FH3A 4F5PA 4IQWA 1ZQXA 2B51A 4KLLA 4EV6A 3AQNA 9ICIA 4K8VA 2IHMA 9ICCA 1UEUA 1WOTA 3WFSC 4K96A 4LZDA 2BPGA 4WQLA 2BBHA 3ISBA 5J2JA 4UBBA 1ZQWA 3RH4A 4YMOA 3JPNA 1ZQLA 5DB6A 4WQKA 4I0UA 2HHPA 3C18A 4KLHA 3K7DA 2PFOA 4NM1A 4E7XA 1NO5A 4I2DA 5J0SA 5D62A 1JMSA 9ICFA 4TUQA 4EEDA 8ICNA 3UPQA 1BPDA 3LQCB 3ISDA 4EEBA 5BOMA 4M0AA 4O69A 5J2KA 2ZH7A 4TUPA 1ZQKA 4EP7A 4M04A 1OU5A 2ID1A 5DDYA 4KLSA 5HRLA 5HRHA 1RPLA 3WFOA 3C2KA 4XQ8A 1F5AA 3K75D 4K4HA 1UEVA 3UPSA 3OVAA 1ZQJA 1ZQTA 5DDMA 3B0YA 7ICLA 7ICUA 4KLIA 5J2AA 1ZQZA 4WC6A 3B0XA 4YCXA 3PMNA 3AU6A 3C5FA 4OAGA 1HUOA 4NKTA 3V7JA 2BPCA 3RJJA 4DO9A 5CFSA 3WFQE 5CP2A 3JPSA 3OGUA 4Z6FA 8ICRA 4QZEA 1JQRA 3OUYA 4WCWA 5J2CA 3UXOA 2GA9D 3RJGA 5F2VO 5J0OA 2Q66A 4X4QA 5J0RA 1ZQUA 4O68A 5IILA 4QZAA 3ISCA 4FH5A 4X4RA 5J0UA 1ZQFA 3JCFA 4R66A 4P4OA 4DOCA 4OAHA 4RQ1A 4I29A 1ZQGA 2O5AA 4K4GA 4NXXA 4IQVA 9ICNA 1BPXA 5J2EA 2ZH4A 3OVSA 3HIYA 1RZTA 4I2AA 3H39A 5IINA 3MDCA 2IUBA 2I9GA 4RQ5A 1TVAA 8ICIA 1ZQNA 4R63A 3TFRA 5CR0A 3H3AA 1Q79A 4LZGA 4UB4A 4NLNA 3JPPA 4RQ0A 4DOBA 5DKWA 4RPYA 9ICJA 5J0WA 3RH6A 5J2DA 5J0XA 4RQ2A 5CHEA 3UXNA 5J2GA 4GXKA 9ICGA 4KLOA 5D61A 4FHWA 4E80A 4HX0A 7ICVA 7ICIA 4I2IA 5HRFA 7ICOA 4UAWA 4ATBB 4X0BA 8ICTA 4WOYA 3RJEA 4NM2A 3JPQA 1ZQCA 4KLJA 9ICAA 4O6AA 4RQ4A 5IIKA 4IQTA 2GWSA 1FA0A 4X4VA 2VANA 3CK6A 3AQKA 4AT8B 5HHHA 4FO1A 2BCSA 4AT9B 7ICJA 5HRDA 1XSLA 5CHGA 1PX5A 5HRBA 4LVSA 7ICKA 1MIVA 4R65A 4UB1A 4EBKA 1KDHA 3MCRA 5J2HA 1ZQRA 4KLDA 7ICNA 4I2BA 1MQ3A 7ICPA 1ZQAA 1GPJA 3HWTA 1ZQPA 3NKUA 4I2GA 4K9AA 2W9MA 2ISPA 7ICQA 3EF2A 4F5OA 4KLTA 5DBBA 5HC9A 2B56A 4FHPA 3MGHA 3JZ0A 2BCVA 1ZQHA 1KNYA 3UQ0A 4PGYA 5HREA 1R8BA 1TFYA 4RQ3A 5CB1A 1ZQOA 4X4SA 4RQ6A 4OAFA 1UETA 4PHAA 8ICQA 4F5NA 4UD5A 1ZQEA 2DR7A 4JWMA 4F5RA 4MFFA 9ICWA 1YLQA 7ICGA 4O5KA 3NYBA 2M2WA 4RWOA 3AUOA 3JYYA 1ZQQA 1ZQDA 4MFCA 4JLZA 2ZHBA 5DEDA 3RJHA 4NXWA 2EWRA 4X4TA 7ICHA 3MBYA 4F5QA 4RWPA 1ZQVA 3AU2A 4PGQA 8ICKA 4NLZA 7ICEA 8ICMA 5CWRA 4WC4A 5J2IA 1R8AA 1Q78A 4MF2A 4XJEA 4I2FA 5IIIA 3ER8C 4QZ9A 4KM5A 4NXVA 2DR9A 3UXPA 2PFQA 4X4NA 4I27A 1ZQSA 5CA7A 5J0YA 1BPBA 4IG8A 2PBEA 4QZGA 4LT6A 3JPRA 8ICZA 1XSPA 4XQ7A 4WC3A 4XUSA 4WC1A 1R89A 4QZBA 4K97A 3C2MA 3HJ4A 9ICKA 4RQ7A 3PMLA 2IHOA 4DOAA 2ZH3A 2DR8A 4WC7A 3H38A 4RWQA 1JN3A 4KLMA 4YMMA 4UD4A 4M47A 2ZH9A 2ZH1A 1ZQIA 4XRHA 3H37A 4K4IA 3NWIA 9ICRA 3NVOA 4IQUA 4RQ8A 4N7RA 3RJFA 5J29A 4EBJA 5HRKA 4ATBA 3OVBA 8ICFA 4O67A 3TFSA 5J0TA 5TZVA 9ICEA 5J2BA 4QZIA 2FMQA 4WH5A 2ISOA 4AT8A 4XA5A 4X4OA 4TUSA 4UAYA 4PHPA 5J0QA 4AT9A 2ZH5A 3V7KA 8ICBA 2FCLA 8ICGA 2B4VA 4I2HA 9ICUA 8ICSA 4M9LA 5CFTA 7ICRA 5HHIA 5B3QA 2HN2A 5J2FA 4WC0A 4R64A 4MKPA 7ICTA 3PNCA 4KB6A 4TURA 5B3PA 4LEWA 4K98A 4I28A 5D4BA 4AT7B 5DBCA 3PHZA 4M9GA 4O5CA 5DB9A 1TFWA 9ICXA 5HRGA 4YD2A 3HJ1A 5BPCA 3MDAA 4LEYA 4JWNA 4KLQA 2DRAA 3GDXA 4K9BA 5J0PA 9ICHA 9ICMA 3MGIA 4JLXA 4NXZA 4M9NA 3JPOA 2ZHAA 2FMSA 4UBCA 4FHXA 2DVIA 8ICYA 4NLKA 2ZH8A 5HRIA 4E8FA 5D63A 4P2HA 4X4PA 2NRKA 4X4UA 2HN1A 3AQMA 4QZFA 4PHDA 4Z6CA 8ICWA 4QZCA 2P66A 2FMPA 4X0AA 3LK9A 1MQ2A 4S3NA 2RFFA 5D46A 8ICPA 8ICHA 5CJ7A 3ERCC 2PFPA 4X5VA 3JPTA 9ICBA 4RPXA 5IIMA 4WC5A 8ICUA 8ICAA 4P4PA 1VFGA 4PH5A 4UB3A 4KLFA 5DB7A 5DB8A 8ICJA
chains in the Genus database with same CATH topology
2PXIA 5IIJA 4Z6EA 4UB5A 4PHEA 5DBAA 4GXIA 9ICQA 2ZH6A 4PPXA 4LEVA 3RH5A 9ICPA 2M2UA 4M5DA 4K99A 8ICOA 4UAZA 9ICVA 2M2TA 3RJKA 7ICFA 3WFPA 4MF8A 8ICEA 4KLUA 9ICOA 4KLEA 4OAIZ 3WFRE 4LEZA 8ICCA 4UB2A 1ZQYA 2BPFA 1JAJA 1V4AA 8ICLA 4NKUA 4WBYA 4RPZA 3V7LA 2BCUA 3HX0A 2PFNA 3C2LA 7ICMA 1ZJMA 5IIOA 1XSNA 4O5EA 4M9JA 2BCRA 4WBZA 5HR9A 1MIWA 4O9MA 9ICSA 1HUZA 4FHVA 4KLGA 2BE3A 1BPZA 2ZH2A 4M9HA 4P4MA 4PGXA 3UQ2A 1MIYA 1VJ7A 5DECA 4I2EA 5D49A 4GXJA 3AQLA 1BPYA 4Z6DA 3RJIA 1ZQBA 8ICVA 4QZ8A 7ICSA 1BPEA 4WC2A 4NXUA 3C66A 3OUYB 9ICTA 4QZHA 4AT7A 2DR5A 4NY8A 9ICLA 5EOZA 3HW8A 4NXTA 2DRBA 1ZJNA 3OV7A 1R8CA 2O1PA 1KEJA 4M2YA 5BOLA 4RT3A 1NOMA 4RWNA 3L9DA 2BCQA 4FHYA 1ZQMA 4I2CA 4YMNA 4FO6A 4RT2A 3C5GA 4YD1A 4MFAA 4I2JA 1TV9A 3V72A 2M2VA 8ICXA 4YN4A 4QZDA 4FH3A 4F5PA 4IQWA 1ZQXA 2B51A 4KLLA 3AQNA 9ICIA 4K8VA 2IHMA 9ICCA 1UEUA 1WOTA 3WFSC 4K96A 4LZDA 2BPGA 3ISBA 5J2JA 4UBBA 1ZQWA 3RH4A 4YMOA 3JPNA 1ZQLA 5DB6A 2HHPA 3C18A 4KLHA 2PFOA 4NM1A 4E7XA 1NO5A 4I2DA 5J0SA 1JMSA 9ICFA 4TUQA 8ICNA 3UPQA 1BPDA 3LQCB 3ISDA 5BOMA 4M0AA 4O69A 5J2KA 2ZH7A 4TUPA 1ZQKA 4EP7A 4M04A 1OU5A 2ID1A 5DDYA 4KLSA 5HRLA 5HRHA 1RPLA 3WFOA 3C2KA 4XQ8A 1F5AA 3K75D 4K4HA 1UEVA 3UPSA 3OVAA 1ZQJA 1ZQTA 5DDMA 3B0YA 7ICLA 7ICUA 4KLIA 5J2AA 1ZQZA 4WC6A 3B0XA 4YCXA 3PMNA 3AU6A 3C5FA 4OAGA 1HUOA 4NKTA 3V7JA 2BPCA 3RJJA 4DO9A 3WFQE 5CP2A 3JPSA 3OGUA 4Z6FA 8ICRA 4QZEA 1JQRA 3OUYA 4WCWA 5J2CA 3UXOA 3RJGA 5F2VO 5J0OA 2Q66A 4X4QA 5J0RA 1ZQUA 4O68A 5IILA 4QZAA 3ISCA 4FH5A 4X4RA 5J0UA 1ZQFA 4R66A 4P4OA 4DOCA 4OAHA 4RQ1A 4I29A 1ZQGA 2O5AA 4K4GA 4NXXA 4IQVA 9ICNA 1BPXA 5J2EA 2ZH4A 3OVSA 3HIYA 1RZTA 4I2AA 3H39A 5IINA 3MDCA 2I9GA 4RQ5A 1TVAA 8ICIA 1ZQNA 4R63A 3TFRA 5CR0A 3H3AA 1Q79A 4LZGA 4UB4A 4NLNA 3JPPA 4RQ0A 4DOBA 5DKWA 4RPYA 9ICJA 5J0WA 3RH6A 5J2DA 5J0XA 4RQ2A 3UXNA 5J2GA 4GXKA 9ICGA 4KLOA 4FHWA 4E80A 7ICVA 7ICIA 4I2IA 5HRFA 7ICOA 4UAWA 4ATBB 4X0BA 8ICTA 4WOYA 3RJEA 4NM2A 3JPQA 1ZQCA 4KLJA 9ICAA 4O6AA 4RQ4A 5IIKA 4IQTA 2GWSA 1FA0A 4X4VA 2VANA 3AQKA 4AT8B 5HHHA 2BCSA 4AT9B 7ICJA 5HRDA 1XSLA 5CHGA 1PX5A 5HRBA 4LVSA 7ICKA 1MIVA 4R65A 4UB1A 4EBKA 1KDHA 5J2HA 1ZQRA 7ICNA 4KLDA 4I2BA 1MQ3A 7ICPA 1ZQAA 3HWTA 1ZQPA 4I2GA 4K9AA 2W9MA 2ISPA 7ICQA 4F5OA 4KLTA 5DBBA 5HC9A 2B56A 4FHPA 3MGHA 3JZ0A 2BCVA 1ZQHA 1KNYA 3UQ0A 4PGYA 5HREA 1R8BA 1TFYA 4RQ3A 5CB1A 1ZQOA 4X4SA 4RQ6A 4OAFA 1UETA 4PHAA 8ICQA 4F5NA 4UD5A 1ZQEA 2DR7A 4JWMA 4F5RA 4MFFA 9ICWA 1YLQA 7ICGA 4O5KA 3NYBA 2M2WA 4RWOA 3AUOA 3JYYA 1ZQQA 1ZQDA 4MFCA 4JLZA 2ZHBA 5DEDA 3RJHA 4NXWA 4X4TA 7ICHA 3MBYA 4F5QA 4RWPA 1ZQVA 3AU2A 4PGQA 8ICKA 4NLZA 7ICEA 8ICMA 5CWRA 4WC4A 5J2IA 1R8AA 1Q78A 4MF2A 4I2FA 5IIIA 4QZ9A 4KM5A 4NXVA 2DR9A 3UXPA 2PFQA 4X4NA 4I27A 1ZQSA 5CA7A 5J0YA 1BPBA 2PBEA 4IG8A 4QZGA 4LT6A 3JPRA 8ICZA 1XSPA 4XQ7A 4WC3A 4XUSA 4WC1A 1R89A 4QZBA 4K97A 3C2MA 3HJ4A 9ICKA 4RQ7A 3PMLA 4DOAA 2ZH3A 2DR8A 4WC7A 3H38A 4RWQA 1JN3A 4KLMA 4YMMA 4UD4A 4M47A 2ZH9A 2ZH1A 1ZQIA 4XRHA 3H37A 4K4IA 9ICRA 4IQUA 4RQ8A 3RJFA 5J29A 4EBJA 5HRKA 4ATBA 3OVBA 8ICFA 4O67A 3TFSA 5J0TA 5TZVA 9ICEA 5J2BA 4QZIA 2FMQA 2ISOA 4AT8A 4XA5A 4X4OA 4TUSA 4UAYA 4PHPA 5J0QA 4AT9A 2ZH5A 3V7KA 8ICBA 8ICGA 2B4VA 4I2HA 9ICUA 8ICSA 4M9LA 7ICRA 5HHIA 5J2FA 4R64A 4WC0A 4MKPA 7ICTA 3PNCA 4KB6A 4TURA 4LEWA 4K98A 4I28A 5D4BA 4AT7B 5DBCA 4M9GA 4O5CA 5DB9A 1TFWA 9ICXA 5HRGA 4YD2A 3HJ1A 5BPCA 3MDAA 4LEYA 4JWNA 4KLQA 2DRAA 3GDXA 4K9BA 5J0PA 9ICHA 9ICMA 3MGIA 4JLXA 4NXZA 4M9NA 3JPOA 2ZHAA 2FMSA 4UBCA 4FHXA 2DVIA 8ICYA 4NLKA 2ZH8A 5HRIA 4E8FA 4P2HA 4X4PA 2NRKA 4X4UA 3AQMA 4QZFA 4PHDA 4Z6CA 8ICWA 4QZCA 2P66A 2FMPA 4X0AA 3LK9A 1MQ2A 4S3NA 2RFFA 5D46A 8ICPA 8ICHA 5CJ7A 2PFPA 4X5VA 3JPTA 9ICBA 4RPXA 5IIMA 4WC5A 8ICUA 8ICAA 4P4PA 1VFGA 4PH5A 4UB3A 4KLFA 5DB7A 5DB8A 8ICJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXI A;  5IIJ A;  4Z6E A;  4UB5 A;  4PHE A;  5DBA A;  4GXI A;  9ICQ A;  2ZH6 A;  4PPX A;  3RH5 A;  9ICP A;  2M2U A;  4M5D A;  8ICO A;  4UAZ A;  9ICV A;  2M2T A;  3RJK A;  7ICF A;  3WFP A;  4MF8 A;  8ICE A;  4KLU A;  9ICO A;  4KLE A;  3WFR E;  8ICC A;  4UB2 A;  1ZQY A;  2BPF A;  1JAJ A;  1V4A A;  8ICL A;  4NKU A;  4WBY A;  4RPZ A;  3V7L A;  2BCU A;  3HX0 A;  2PFN A;  3C2L A;  7ICM A;  1ZJM A;  5IIO A;  1XSN A;  4O5E A;  4M9J A;  2BCR A;  4WBZ A;  5HR9 A;  1MIW A;  4O9M A;  9ICS A;  1HUZ A;  4FHV A;  4KLG A;  2BE3 A;  1BPZ A;  2ZH2 A;  4M9H A;  4P4M A;  4PGX A;  3UQ2 A;  1MIY A;  1VJ7 A;  5DEC A;  4I2E A;  5D49 A;  4GXJ A;  3AQL A;  1BPY A;  4Z6D A;  3RJI A;  1ZQB A;  8ICV A;  4QZ8 A;  7ICS A;  1BPE A;  4WC2 A;  3C66 A;  3OUY B;  9ICT A;  4QZH A;  4AT7 A;  2DR5 A;  4NY8 A;  9ICL A;  5EOZ A;  3HW8 A;  2DRB A;  1ZJN A;  3OV7 A;  1R8C A;  2O1P A;  1KEJ A;  4M2Y A;  5BOL A;  4RT3 A;  1NOM A;  4RWN A;  3L9D A;  2BCQ A;  4FHY A;  1ZQM A;  4I2C A;  4YMN A;  4FO6 A;  4RT2 A;  3C5G A;  4YD1 A;  4MFA A;  4I2J A;  1TV9 A;  3V72 A;  2M2V A;  8ICX A;  4YN4 A;  4QZD A;  4FH3 A;  4F5P A;  4IQW A;  1ZQX A;  2B51 A;  4KLL A;  3AQN A;  9ICI A;  2IHM A;  9ICC A;  1UEU A;  1WOT A;  3WFS C;  4LZD A;  2BPG A;  3ISB A;  5J2J A;  4UBB A;  1ZQW A;  3RH4 A;  4YMO A;  3JPN A;  1ZQL A;  5DB6 A;  2HHP A;  3C18 A;  4KLH A;  2PFO A;  4NM1 A;  4E7X A;  1NO5 A;  4I2D A;  5J0S A;  1JMS A;  9ICF A;  4TUQ A;  8ICN A;  3UPQ A;  1BPD A;  3LQC B;  3ISD A;  5BOM A;  4M0A A;  5J2K A;  2ZH7 A;  4TUP A;  1ZQK A;  4EP7 A;  4M04 A;  1OU5 A;  2ID1 A;  5DDY A;  4KLS A;  5HRL A;  5HRH A;  1RPL A;  3WFO A;  3C2K A;  4XQ8 A;  1F5A A;  3K75 D;  4K4H A;  1UEV A;  3UPS A;  3OVA A;  1ZQJ A;  1ZQT A;  5DDM A;  3B0Y A;  7ICL A;  7ICU A;  4KLI A;  5J2A A;  1ZQZ A;  4WC6 A;  3B0X A;  4YCX A;  3PMN A;  3AU6 A;  3C5F A;  1HUO A;  4NKT A;  3V7J A;  2BPC A;  3RJJ A;  4DO9 A;  3WFQ E;  5CP2 A;  3JPS A;  3OGU A;  4Z6F A;  8ICR A;  4QZE A;  1JQR A;  3OUY A;  4WCW A;  5J2C A;  3UXO A;  3RJG A;  5F2V O;  5J0O A;  2Q66 A;  5J0R A;  4X4Q A;  1ZQU A;  5IIL A;  4QZA A;  3ISC A;  4FH5 A;  5J0U A;  4X4R A;  1ZQF A;  4R66 A;  4P4O A;  4DOC A;  4RQ1 A;  4I29 A;  1ZQG A;  2O5A A;  4K4G A;  4IQV A;  9ICN A;  1BPX A;  5J2E A;  2ZH4 A;  3OVS A;  3HIY A;  1RZT A;  4I2A A;  3H39 A;  5IIN A;  3MDC A;  2I9G A;  4RQ5 A;  1TVA A;  8ICI A;  1ZQN A;  4R63 A;  3TFR A;  5CR0 A;  3H3A A;  1Q79 A;  4LZG A;  4UB4 A;  4NLN A;  3JPP A;  4RQ0 A;  4DOB A;  5DKW A;  4RPY A;  9ICJ A;  5J0W A;  3RH6 A;  5J2D A;  5J0X A;  4RQ2 A;  3UXN A;  5J2G A;  4GXK A;  9ICG A;  4KLO A;  4FHW A;  4E80 A;  7ICV A;  7ICI A;  4I2I A;  5HRF A;  7ICO A;  4UAW A;  4ATB B;  4X0B A;  8ICT A;  3RJE A;  4NM2 A;  3JPQ A;  1ZQC A;  4KLJ A;  9ICA A;  4RQ4 A;  5IIK A;  4IQT A;  2GWS A;  1FA0 A;  4X4V A;  2VAN A;  3AQK A;  4AT8 B;  5HHH A;  2BCS A;  4AT9 B;  7ICJ A;  5HRD A;  1XSL A;  5CHG A;  1PX5 A;  5HRB A;  4LVS A;  7ICK A;  1MIV A;  4R65 A;  4UB1 A;  4EBK A;  1KDH A;  5J2H A;  1ZQR A;  7ICN A;  4KLD A;  4I2B A;  1MQ3 A;  7ICP A;  1ZQA A;  3HWT A;  1ZQP A;  4I2G A;  2W9M A;  2ISP A;  7ICQ A;  4F5O A;  4KLT A;  5DBB A;  5HC9 A;  2B56 A;  4FHP A;  3MGH A;  3JZ0 A;  2BCV A;  1ZQH A;  1KNY A;  3UQ0 A;  4PGY A;  5HRE A;  1R8B A;  1ZQO A;  4RQ3 A;  5CB1 A;  1TFY A;  4RQ6 A;  4X4S A;  4PHA A;  1UET A;  8ICQ A;  4F5N A;  4UD5 A;  1ZQE A;  2DR7 A;  4JWM A;  4F5R A;  4MFF A;  9ICW A;  1YLQ A;  7ICG A;  4O5K A;  3NYB A;  2M2W A;  4RWO A;  3AUO A;  3JYY A;  1ZQQ A;  1ZQD A;  4MFC A;  2ZHB A;  5DED A;  3RJH A;  4X4T A;  7ICH A;  3MBY A;  4F5Q A;  4RWP A;  1ZQV A;  3AU2 A;  4PGQ A;  8ICK A;  4NLZ A;  7ICE A;  8ICM A;  5CWR A;  4WC4 A;  5J2I A;  1R8A A;  1Q78 A;  4MF2 A;  4I2F A;  5III A;  4QZ9 A;  2DR9 A;  2PFQ A;  3UXP A;  4X4N A;  4I27 A;  1ZQS A;  5CA7 A;  5J0Y A;  1BPB A;  2PBE A;  4IG8 A;  4QZG A;  4LT6 A;  3JPR A;  8ICZ A;  1XSP A;  4XQ7 A;  4WC3 A;  4XUS A;  4WC1 A;  1R89 A;  4QZB A;  3C2M A;  3HJ4 A;  9ICK A;  4RQ7 A;  3PML A;  4DOA A;  2ZH3 A;  2DR8 A;  4WC7 A;  3H38 A;  4RWQ A;  1JN3 A;  4KLM A;  4YMM A;  4UD4 A;  4M47 A;  2ZH9 A;  2ZH1 A;  1ZQI A;  4XRH A;  3H37 A;  4K4I A;  9ICR A;  4IQU A;  4RQ8 A;  3RJF A;  5J29 A;  4EBJ A;  5HRK A;  4ATB A;  3OVB A;  8ICF A;  3TFS A;  5J0T A;  5TZV A;  9ICE A;  5J2B A;  4QZI A;  2FMQ A;  2ISO A;  4AT8 A;  4XA5 A;  4X4O A;  4TUS A;  4UAY A;  4PHP A;  5J0Q A;  4AT9 A;  2ZH5 A;  3V7K A;  8ICB A;  8ICG A;  2B4V A;  4I2H A;  9ICU A;  8ICS A;  4M9L A;  7ICR A;  5HHI A;  4R64 A;  5J2F A;  4WC0 A;  7ICT A;  3PNC A;  4TUR A;  4I28 A;  5D4B A;  4AT7 B;  5DBC A;  4M9G A;  4O5C A;  5DB9 A;  1TFW A;  9ICX A;  5HRG A;  4YD2 A;  3HJ1 A;  5BPC A;  3MDA A;  4JWN A;  4KLQ A;  2DRA A;  3GDX A;  5J0P A;  9ICH A;  9ICM A;  3MGI A;  4NXZ A;  4M9N A;  3JPO A;  2ZHA A;  2FMS A;  4UBC A;  4FHX A;  2DVI A;  8ICY A;  4NLK A;  2ZH8 A;  5HRI A;  4E8F A;  4P2H A;  4X4P A;  2NRK A;  4X4U A;  3AQM A;  4QZF A;  4PHD A;  4Z6C A;  8ICW A;  4QZC A;  2P66 A;  2FMP A;  4X0A A;  3LK9 A;  1MQ2 A;  4S3N A;  2RFF A;  5D46 A;  8ICP A;  8ICH A;  5CJ7 A;  2PFP A;  4X5V A;  3JPT A;  9ICB A;  4RPX A;  5IIM A;  4WC5 A;  8ICU A;  8ICA A;  4P4P A;  1VFG A;  4PH5 A;  4UB3 A;  4KLF A;  5DB7 A;  5DB8 A;  8ICJ A; 
#chains in the Genus database with same CATH topology
 2PXI A;  5IIJ A;  4Z6E A;  4UB5 A;  4PHE A;  5DBA A;  4GXI A;  9ICQ A;  2ZH6 A;  4PPX A;  4LEV A;  3RH5 A;  9ICP A;  2M2U A;  3OWG A;  4M5D A;  4K99 A;  8ICO A;  4UAZ A;  9ICV A;  2M2T A;  3RJK A;  7ICF A;  3WFP A;  4MF8 A;  8ICE A;  4KLU A;  5CFU A;  9ICO A;  4KLE A;  4OAI Z;  3WFR E;  4LEZ A;  8ICC A;  4UB2 A;  1ZQY A;  2BPF A;  1JAJ A;  1V4A A;  8ICL A;  4NKU A;  4WBY A;  4RPZ A;  3V7L A;  2BCU A;  3HX0 A;  2PFN A;  3C2L A;  7ICM A;  1ZJM A;  5IIO A;  1XSN A;  4O5E A;  4M9J A;  2BCR A;  4WBZ A;  5HR9 A;  1MIW A;  4O9M A;  9ICS A;  1HUZ A;  4FHV A;  4KLG A;  2BE3 A;  1BPZ A;  2ZH2 A;  4M9H A;  5JTG A;  4P4M A;  4PGX A;  3UQ2 A;  1MIY A;  1VJ7 A;  5DEC A;  4I2E A;  5D49 A;  4GXJ A;  3AQL A;  1BPY A;  4Z6D A;  3RJI A;  1ZQB A;  8ICV A;  4QZ8 A;  7ICS A;  1BPE A;  4WC2 A;  4NXU A;  3C66 A;  3OUY B;  9ICT A;  4QZH A;  4AT7 A;  2DR5 A;  4NY8 A;  9ICL A;  5EOZ A;  3HW8 A;  4NXT A;  2DRB A;  1ZJN A;  2GAF D;  4EGW A;  3OV7 A;  1R8C A;  2O1P A;  1KEJ A;  4M2Y A;  5BOL A;  4RT3 A;  1NOM A;  2BBJ A;  4RWN A;  3L9D A;  2BCQ A;  4FHY A;  1ZQM A;  4I2C A;  4YMN A;  4FO6 A;  4RT2 A;  3C5G A;  4YD1 A;  4MFA A;  4I2J A;  1TV9 A;  3V72 A;  2M2V A;  8ICX A;  3ER9 B;  4YN4 A;  4QZD A;  4FH3 A;  4F5P A;  4IQW A;  1ZQX A;  2B51 A;  4KLL A;  4EV6 A;  3AQN A;  9ICI A;  4K8V A;  2IHM A;  9ICC A;  1UEU A;  1WOT A;  3WFS C;  4K96 A;  4LZD A;  2BPG A;  4WQL A;  2BBH A;  3ISB A;  5J2J A;  4UBB A;  1ZQW A;  3RH4 A;  4YMO A;  3JPN A;  1ZQL A;  5DB6 A;  4WQK A;  4I0U A;  2HHP A;  3C18 A;  4KLH A;  3K7D A;  2PFO A;  4NM1 A;  4E7X A;  1NO5 A;  4I2D A;  5J0S A;  5D62 A;  1JMS A;  9ICF A;  4TUQ A;  4EED A;  8ICN A;  3UPQ A;  1BPD A;  3LQC B;  3ISD A;  4EEB A;  5BOM A;  4M0A A;  4O69 A;  5J2K A;  2ZH7 A;  4TUP A;  1ZQK A;  4EP7 A;  4M04 A;  1OU5 A;  2ID1 A;  5DDY A;  4KLS A;  5HRL A;  5HRH A;  1RPL A;  3WFO A;  3C2K A;  4XQ8 A;  1F5A A;  3K75 D;  4K4H A;  1UEV A;  3UPS A;  3OVA A;  1ZQJ A;  1ZQT A;  5DDM A;  3B0Y A;  7ICL A;  7ICU A;  4KLI A;  5J2A A;  1ZQZ A;  4WC6 A;  3B0X A;  4YCX A;  3PMN A;  3AU6 A;  3C5F A;  4OAG A;  1HUO A;  4NKT A;  3V7J A;  2BPC A;  3RJJ A;  4DO9 A;  5CFS A;  3WFQ E;  5CP2 A;  3JPS A;  3OGU A;  4Z6F A;  8ICR A;  4QZE A;  1JQR A;  3OUY A;  4WCW A;  5J2C A;  3UXO A;  2GA9 D;  3RJG A;  5F2V O;  5J0O A;  2Q66 A;  4X4Q A;  5J0R A;  1ZQU A;  4O68 A;  5IIL A;  4QZA A;  3ISC A;  4FH5 A;  4X4R A;  5J0U A;  1ZQF A;  3JCF A;  4R66 A;  4P4O A;  4DOC A;  4OAH A;  4RQ1 A;  4I29 A;  1ZQG A;  2O5A A;  4K4G A;  4NXX A;  4IQV A;  9ICN A;  1BPX A;  5J2E A;  2ZH4 A;  3OVS A;  3HIY A;  1RZT A;  4I2A A;  3H39 A;  5IIN A;  3MDC A;  2IUB A;  2I9G A;  4RQ5 A;  1TVA A;  8ICI A;  1ZQN A;  4R63 A;  3TFR A;  5CR0 A;  3H3A A;  1Q79 A;  4LZG A;  4UB4 A;  4NLN A;  3JPP A;  4RQ0 A;  4DOB A;  5DKW A;  4RPY A;  9ICJ A;  5J0W A;  3RH6 A;  5J2D A;  5J0X A;  4RQ2 A;  5CHE A;  3UXN A;  5J2G A;  4GXK A;  9ICG A;  4KLO A;  5D61 A;  4FHW A;  4E80 A;  4HX0 A;  7ICV A;  7ICI A;  4I2I A;  5HRF A;  7ICO A;  4UAW A;  4ATB B;  4X0B A;  8ICT A;  4WOY A;  3RJE A;  4NM2 A;  3JPQ A;  1ZQC A;  4KLJ A;  9ICA A;  4O6A A;  4RQ4 A;  5IIK A;  4IQT A;  2GWS A;  1FA0 A;  4X4V A;  2VAN A;  3CK6 A;  3AQK A;  4AT8 B;  5HHH A;  4FO1 A;  2BCS A;  4AT9 B;  7ICJ A;  5HRD A;  1XSL A;  5CHG A;  1PX5 A;  5HRB A;  4LVS A;  7ICK A;  1MIV A;  4R65 A;  4UB1 A;  4EBK A;  1KDH A;  3MCR A;  5J2H A;  1ZQR A;  4KLD A;  7ICN A;  4I2B A;  1MQ3 A;  7ICP A;  1ZQA A;  1GPJ A;  3HWT A;  1ZQP A;  3NKU A;  4I2G A;  4K9A A;  2W9M A;  2ISP A;  7ICQ A;  3EF2 A;  4F5O A;  4KLT A;  5DBB A;  5HC9 A;  2B56 A;  4FHP A;  3MGH A;  3JZ0 A;  2BCV A;  1ZQH A;  1KNY A;  3UQ0 A;  4PGY A;  5HRE A;  1R8B A;  1TFY A;  4RQ3 A;  5CB1 A;  1ZQO A;  4X4S A;  4RQ6 A;  4OAF A;  1UET A;  4PHA A;  8ICQ A;  4F5N A;  4UD5 A;  1ZQE A;  2DR7 A;  4JWM A;  4F5R A;  4MFF A;  9ICW A;  1YLQ A;  7ICG A;  4O5K A;  3NYB A;  2M2W A;  4RWO A;  3AUO A;  3JYY A;  1ZQQ A;  1ZQD A;  4MFC A;  4JLZ A;  2ZHB A;  5DED A;  3RJH A;  4NXW A;  2EWR A;  4X4T A;  7ICH A;  3MBY A;  4F5Q A;  4RWP A;  1ZQV A;  3AU2 A;  4PGQ A;  8ICK A;  4NLZ A;  7ICE A;  8ICM A;  5CWR A;  4WC4 A;  5J2I A;  1R8A A;  1Q78 A;  4MF2 A;  4XJE A;  4I2F A;  5III A;  3ER8 C;  4QZ9 A;  4KM5 A;  4NXV A;  2DR9 A;  3UXP A;  2PFQ A;  4X4N A;  4I27 A;  1ZQS A;  5CA7 A;  5J0Y A;  1BPB A;  4IG8 A;  2PBE A;  4QZG A;  4LT6 A;  3JPR A;  8ICZ A;  1XSP A;  4XQ7 A;  4WC3 A;  4XUS A;  4WC1 A;  1R89 A;  4QZB A;  4K97 A;  3C2M A;  3HJ4 A;  9ICK A;  4RQ7 A;  3PML A;  2IHO A;  4DOA A;  2ZH3 A;  2DR8 A;  4WC7 A;  3H38 A;  4RWQ A;  1JN3 A;  4KLM A;  4YMM A;  4UD4 A;  4M47 A;  2ZH9 A;  2ZH1 A;  1ZQI A;  4XRH A;  3H37 A;  4K4I A;  3NWI A;  9ICR A;  3NVO A;  4IQU A;  4RQ8 A;  4N7R A;  3RJF A;  5J29 A;  4EBJ A;  5HRK A;  4ATB A;  3OVB A;  8ICF A;  4O67 A;  3TFS A;  5J0T A;  5TZV A;  9ICE A;  5J2B A;  4QZI A;  2FMQ A;  4WH5 A;  2ISO A;  4AT8 A;  4XA5 A;  4X4O A;  4TUS A;  4UAY A;  4PHP A;  5J0Q A;  4AT9 A;  2ZH5 A;  3V7K A;  8ICB A;  2FCL A;  8ICG A;  2B4V A;  4I2H A;  9ICU A;  8ICS A;  4M9L A;  5CFT A;  7ICR A;  5HHI A;  5B3Q A;  2HN2 A;  5J2F A;  4WC0 A;  4R64 A;  4MKP A;  7ICT A;  3PNC A;  4KB6 A;  4TUR A;  5B3P A;  4LEW A;  4K98 A;  4I28 A;  5D4B A;  4AT7 B;  5DBC A;  3PHZ A;  4M9G A;  4O5C A;  5DB9 A;  1TFW A;  9ICX A;  5HRG A;  4YD2 A;  3HJ1 A;  5BPC A;  3MDA A;  4LEY A;  4JWN A;  4KLQ A;  2DRA A;  3GDX A;  4K9B A;  5J0P A;  9ICH A;  9ICM A;  3MGI A;  4JLX A;  4NXZ A;  4M9N A;  3JPO A;  2ZHA A;  2FMS A;  4UBC A;  4FHX A;  2DVI A;  8ICY A;  4NLK A;  2ZH8 A;  5HRI A;  4E8F A;  5D63 A;  4P2H A;  4X4P A;  2NRK A;  4X4U A;  2HN1 A;  3AQM A;  4QZF A;  4PHD A;  4Z6C A;  8ICW A;  4QZC A;  2P66 A;  2FMP A;  4X0A A;  3LK9 A;  1MQ2 A;  4S3N A;  2RFF A;  5D46 A;  8ICP A;  8ICH A;  5CJ7 A;  3ERC C;  2PFP A;  4X5V A;  3JPT A;  9ICB A;  4RPX A;  5IIM A;  4WC5 A;  8ICU A;  8ICA A;  4P4P A;  1VFG A;  4PH5 A;  4UB3 A;  4KLF A;  5DB7 A;  5DB8 A;  8ICJ A; 
#chains in the Genus database with same CATH homology
 2PXI A;  5IIJ A;  4Z6E A;  4UB5 A;  4PHE A;  5DBA A;  4GXI A;  9ICQ A;  2ZH6 A;  4PPX A;  4LEV A;  3RH5 A;  9ICP A;  2M2U A;  4M5D A;  4K99 A;  8ICO A;  4UAZ A;  9ICV A;  2M2T A;  3RJK A;  7ICF A;  3WFP A;  4MF8 A;  8ICE A;  4KLU A;  9ICO A;  4KLE A;  4OAI Z;  3WFR E;  4LEZ A;  8ICC A;  4UB2 A;  1ZQY A;  2BPF A;  1JAJ A;  1V4A A;  8ICL A;  4NKU A;  4WBY A;  4RPZ A;  3V7L A;  2BCU A;  3HX0 A;  2PFN A;  3C2L A;  7ICM A;  1ZJM A;  5IIO A;  1XSN A;  4O5E A;  4M9J A;  2BCR A;  4WBZ A;  5HR9 A;  1MIW A;  4O9M A;  9ICS A;  1HUZ A;  4FHV A;  4KLG A;  2BE3 A;  1BPZ A;  2ZH2 A;  4M9H A;  4P4M A;  4PGX A;  3UQ2 A;  1MIY A;  1VJ7 A;  5DEC A;  4I2E A;  5D49 A;  4GXJ A;  3AQL A;  1BPY A;  4Z6D A;  3RJI A;  1ZQB A;  8ICV A;  4QZ8 A;  7ICS A;  1BPE A;  4WC2 A;  4NXU A;  3C66 A;  3OUY B;  9ICT A;  4QZH A;  4AT7 A;  2DR5 A;  4NY8 A;  9ICL A;  5EOZ A;  3HW8 A;  4NXT A;  2DRB A;  1ZJN A;  3OV7 A;  1R8C A;  2O1P A;  1KEJ A;  4M2Y A;  5BOL A;  4RT3 A;  1NOM A;  4RWN A;  3L9D A;  2BCQ A;  4FHY A;  1ZQM A;  4I2C A;  4YMN A;  4FO6 A;  4RT2 A;  3C5G A;  4YD1 A;  4MFA A;  4I2J A;  1TV9 A;  3V72 A;  2M2V A;  8ICX A;  4YN4 A;  4QZD A;  4FH3 A;  4F5P A;  4IQW A;  1ZQX A;  2B51 A;  4KLL A;  3AQN A;  9ICI A;  4K8V A;  2IHM A;  9ICC A;  1UEU A;  1WOT A;  3WFS C;  4K96 A;  4LZD A;  2BPG A;  3ISB A;  5J2J A;  4UBB A;  1ZQW A;  3RH4 A;  4YMO A;  3JPN A;  1ZQL A;  5DB6 A;  2HHP A;  3C18 A;  4KLH A;  2PFO A;  4NM1 A;  4E7X A;  1NO5 A;  4I2D A;  5J0S A;  1JMS A;  9ICF A;  4TUQ A;  8ICN A;  3UPQ A;  1BPD A;  3LQC B;  3ISD A;  5BOM A;  4M0A A;  4O69 A;  5J2K A;  2ZH7 A;  4TUP A;  1ZQK A;  4EP7 A;  4M04 A;  1OU5 A;  2ID1 A;  5DDY A;  4KLS A;  5HRL A;  5HRH A;  1RPL A;  3WFO A;  3C2K A;  4XQ8 A;  1F5A A;  3K75 D;  4K4H A;  1UEV A;  3UPS A;  3OVA A;  1ZQJ A;  1ZQT A;  5DDM A;  3B0Y A;  7ICL A;  7ICU A;  4KLI A;  5J2A A;  1ZQZ A;  4WC6 A;  3B0X A;  4YCX A;  3PMN A;  3AU6 A;  3C5F A;  4OAG A;  1HUO A;  4NKT A;  3V7J A;  2BPC A;  3RJJ A;  4DO9 A;  3WFQ E;  5CP2 A;  3JPS A;  3OGU A;  4Z6F A;  8ICR A;  4QZE A;  1JQR A;  3OUY A;  4WCW A;  5J2C A;  3UXO A;  3RJG A;  5F2V O;  5J0O A;  2Q66 A;  4X4Q A;  5J0R A;  1ZQU A;  4O68 A;  5IIL A;  4QZA A;  3ISC A;  4FH5 A;  4X4R A;  5J0U A;  1ZQF A;  4R66 A;  4P4O A;  4DOC A;  4OAH A;  4RQ1 A;  4I29 A;  1ZQG A;  2O5A A;  4K4G A;  4NXX A;  4IQV A;  9ICN A;  1BPX A;  5J2E A;  2ZH4 A;  3OVS A;  3HIY A;  1RZT A;  4I2A A;  3H39 A;  5IIN A;  3MDC A;  2I9G A;  4RQ5 A;  1TVA A;  8ICI A;  1ZQN A;  4R63 A;  3TFR A;  5CR0 A;  3H3A A;  1Q79 A;  4LZG A;  4UB4 A;  4NLN A;  3JPP A;  4RQ0 A;  4DOB A;  5DKW A;  4RPY A;  9ICJ A;  5J0W A;  3RH6 A;  5J2D A;  5J0X A;  4RQ2 A;  3UXN A;  5J2G A;  4GXK A;  9ICG A;  4KLO A;  4FHW A;  4E80 A;  7ICV A;  7ICI A;  4I2I A;  5HRF A;  7ICO A;  4UAW A;  4ATB B;  4X0B A;  8ICT A;  4WOY A;  3RJE A;  4NM2 A;  3JPQ A;  1ZQC A;  4KLJ A;  9ICA A;  4O6A A;  4RQ4 A;  5IIK A;  4IQT A;  2GWS A;  1FA0 A;  4X4V A;  2VAN A;  3AQK A;  4AT8 B;  5HHH A;  2BCS A;  4AT9 B;  7ICJ A;  5HRD A;  1XSL A;  5CHG A;  1PX5 A;  5HRB A;  4LVS A;  7ICK A;  1MIV A;  4R65 A;  4UB1 A;  4EBK A;  1KDH A;  5J2H A;  1ZQR A;  7ICN A;  4KLD A;  4I2B A;  1MQ3 A;  7ICP A;  1ZQA A;  3HWT A;  1ZQP A;  4I2G A;  4K9A A;  2W9M A;  2ISP A;  7ICQ A;  4F5O A;  4KLT A;  5DBB A;  5HC9 A;  2B56 A;  4FHP A;  3MGH A;  3JZ0 A;  2BCV A;  1ZQH A;  1KNY A;  3UQ0 A;  4PGY A;  5HRE A;  1R8B A;  1TFY A;  4RQ3 A;  5CB1 A;  1ZQO A;  4X4S A;  4RQ6 A;  4OAF A;  1UET A;  4PHA A;  8ICQ A;  4F5N A;  4UD5 A;  1ZQE A;  2DR7 A;  4JWM A;  4F5R A;  4MFF A;  9ICW A;  1YLQ A;  7ICG A;  4O5K A;  3NYB A;  2M2W A;  4RWO A;  3AUO A;  3JYY A;  1ZQQ A;  1ZQD A;  4MFC A;  4JLZ A;  2ZHB A;  5DED A;  3RJH A;  4NXW A;  4X4T A;  7ICH A;  3MBY A;  4F5Q A;  4RWP A;  1ZQV A;  3AU2 A;  4PGQ A;  8ICK A;  4NLZ A;  7ICE A;  8ICM A;  5CWR A;  4WC4 A;  5J2I A;  1R8A A;  1Q78 A;  4MF2 A;  4I2F A;  5III A;  4QZ9 A;  4KM5 A;  4NXV A;  2DR9 A;  3UXP A;  2PFQ A;  4X4N A;  4I27 A;  1ZQS A;  5CA7 A;  5J0Y A;  1BPB A;  2PBE A;  4IG8 A;  4QZG A;  4LT6 A;  3JPR A;  8ICZ A;  1XSP A;  4XQ7 A;  4WC3 A;  4XUS A;  4WC1 A;  1R89 A;  4QZB A;  4K97 A;  3C2M A;  3HJ4 A;  9ICK A;  4RQ7 A;  3PML A;  4DOA A;  2ZH3 A;  2DR8 A;  4WC7 A;  3H38 A;  4RWQ A;  1JN3 A;  4KLM A;  4YMM A;  4UD4 A;  4M47 A;  2ZH9 A;  2ZH1 A;  1ZQI A;  4XRH A;  3H37 A;  4K4I A;  9ICR A;  4IQU A;  4RQ8 A;  3RJF A;  5J29 A;  4EBJ A;  5HRK A;  4ATB A;  3OVB A;  8ICF A;  4O67 A;  3TFS A;  5J0T A;  5TZV A;  9ICE A;  5J2B A;  4QZI A;  2FMQ A;  2ISO A;  4AT8 A;  4XA5 A;  4X4O A;  4TUS A;  4UAY A;  4PHP A;  5J0Q A;  4AT9 A;  2ZH5 A;  3V7K A;  8ICB A;  8ICG A;  2B4V A;  4I2H A;  9ICU A;  8ICS A;  4M9L A;  7ICR A;  5HHI A;  5J2F A;  4R64 A;  4WC0 A;  4MKP A;  7ICT A;  3PNC A;  4KB6 A;  4TUR A;  4LEW A;  4K98 A;  4I28 A;  5D4B A;  4AT7 B;  5DBC A;  4M9G A;  4O5C A;  5DB9 A;  1TFW A;  9ICX A;  5HRG A;  4YD2 A;  3HJ1 A;  5BPC A;  3MDA A;  4LEY A;  4JWN A;  4KLQ A;  2DRA A;  3GDX A;  4K9B A;  5J0P A;  9ICH A;  9ICM A;  3MGI A;  4JLX A;  4NXZ A;  4M9N A;  3JPO A;  2ZHA A;  2FMS A;  4UBC A;  4FHX A;  2DVI A;  8ICY A;  4NLK A;  2ZH8 A;  5HRI A;  4E8F A;  4P2H A;  4X4P A;  2NRK A;  4X4U A;  3AQM A;  4QZF A;  4PHD A;  4Z6C A;  8ICW A;  4QZC A;  2P66 A;  2FMP A;  4X0A A;  3LK9 A;  1MQ2 A;  4S3N A;  2RFF A;  5D46 A;  8ICP A;  8ICH A;  5CJ7 A;  2PFP A;  4X5V A;  3JPT A;  9ICB A;  4RPX A;  5IIM A;  4WC5 A;  8ICU A;  8ICA A;  4P4P A;  1VFG A;  4PH5 A;  4UB3 A;  4KLF A;  5DB7 A;  5DB8 A;  8ICJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...