4UD4A

Structural plasticity of cid1 provides a basis for its rna terminal uridylyl transferase activity
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
324
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGAFLQAARIPIIKLTSDGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFAFYAYAFEPREKVVTFRRPDGYLTKQEKGWTKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POLY(A) RNA POLYMERASE PROTEIN CID1
publication title Structural plasticity of Cid1 provides a basis for its distributive RNA terminal uridylyl transferase activity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 107
structure length 324
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ud4A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ud4A02
4WC3A 5TZVA 5DBAA 5J2HA 4M04A 2Q66A 1ZQXA 4S3NA 4YN4A 3WFPA 1ZQVA 2ZH6A 4MF2A 2ZH4A 1JMSA 9ICTA 1ZQIA 3OUYB 4KLGA 5CP2A 8ICRA 1ZQRA 8ICTA 2B51A 5EOZA 4DOAA 2B4VA 4WC6A 5HHIA 1ZQAA 2PFOA 3OVAA 4TUQA 1UETA 3UPSA 1BPXA 1WOTA 2FMSA 4PH5A 5HRLA 2BCQA 7ICUA 3OVSA 5J0PA 4I2BA 4NKTA 4Z6FA 3JPNA 4RWQA 4O5EA 1ZQBA 4I29A 2PFQA 4X4QA 4YMNA 3MDAA 4DOCA 1MQ2A 4I2HA 3MDCA 3JYYA 5DBCA 9ICLA 4Z6CA 3AQLA 3PNCA 2BPCA 1OU5A 4RWNA 7ICNA 4RT2A 4XUSA 5J2GA 1RPLA 4GXIA 2BE3A 9ICSA 3HWTA 2O1PA 8ICEA 4M9LA 5J0WA 3RJIA 5DDYA 2RFFA 8ICBA 1TVAA 4X4TA 9ICWA 5DEDA 3ISDA 9ICXA 4FHWA 4R65A 2DR8A 4YMOA 4KLLA 8ICSA 4EP7A 4NM2A 4RQ3A 9ICKA 4FH3A 4KLEA 7ICJA 4UB2A 3AU2A 4JWNA 4UD5A 4P4MA 3RJGA 4Z6EA 3C2LA 4O5CA 7ICFA 1BPEA 4KLOA 5J0TA 1BPDA 3GDXA 5HRFA 4WC7A 1BPZA 2BPFA 5DBBA 3WFOA 5J0UA 1YLQA 2B56A 1XSPA 1ZQHA 2PFPA 4QZ9A 1MIWA 4IQUA 7ICTA 3V72A 4X4OA 3H3AA 4RPXA 4FH5A 3TFSA 3ISBA 9ICBA 4KLUA 2HHPA 4KLFA 8ICHA 7ICSA 4M5DA 5DB9A 4I2JA 4PHPA 1KDHA 4LZGA 4IQTA 4QZAA 4KLTA 9ICAA 8ICQA 1TFYA 8ICKA 4RWOA 4K4GA 5BPCA 5HRHA 2NRKA 4XRHA 3C66A 2O5AA 4GXJA 1XSLA 9ICVA 2ID1A 8ICVA 5J0QA 5BOMA 2I9GA 1ZQQA 4IQVA 3C5GA 4F5OA 4UBBA 4NM1A 5IIJA 5HRBA 4LZDA 4F5RA 4QZFA 4MF8A 4WC4A 4NY8A 4M2YA 8ICJA 8ICAA 3C18A 5J2BA 5J2CA 4I2IA 3V7KA 5CB1A 3WFSC 4X4NA 4I2GA 5CHGA 1MIYA 3HW8A 7ICLA 4RQ7A 4QZEA 4E8FA 4YD1A 5J29A 8ICWA 3V7LA 4QZCA 3RJEA 4NKUA 4QZGA 4X4PA 3H38A 8ICIA 4I28A 3RJFA 3LQCB 4AT7A 1TV9A 4I2DA 5D49A 4M9HA 2ZH7A 4UBCA 4JWMA 2P66A 9ICOA 5D46A 1ZQJA 4X4VA 4AT8A 4MFCA 4YCXA 4O5KA 4YD2A 3AU6A 3AUOA 8ICFA 4XQ7A 5J2JA 3OV7A 4FO6A 4UB5A 9ICEA 2BCVA 4X4SA 8ICXA 5HHHA 4FHYA 1TFWA 2ZHBA 5IIIA 9ICQA 4TUPA 4WC2A 4NLKA 3RH4A 4X5VA 4I2FA 4I27A 3JPOA 4EBKA 4I2EA 2DVIA 4M9NA 4F5PA 2ZH5A 1NOMA 3UPQA 7ICRA 1R8AA 8ICUA 2FMQA 5J2EA 4IQWA 1BPBA 4PHDA 3HJ4A 1MQ3A 2IHMA 4KLDA 2GWSA 1UEVA 2PFNA 5F2VO 4PGXA 4AT7B 1ZQEA 2PXIA 3C2MA 8ICGA 5J2KA 2ISPA 5HRIA 3JPTA 4XQ8A 1R8CA 9ICIA 1HUZA 4RWPA 9ICJA 4AT8B 4FHPA 3RH6A 2ZH3A 4K4IA 4KLHA 3JZ0A 7ICEA 4RQ4A 3AQNA 7ICGA 3RJKA 5IIOA 5HC9A 1Q79A 9ICGA 3UXNA 8ICCA 4X0AA 4UB3A 1ZQUA 4TUSA 3AQMA 3L9DA 1V4AA 5HREA 1MIVA 9ICUA 3TFRA 2DRAA 8ICLA 4XA5A 9ICHA 4PHAA 1KNYA 5HRDA 4WC0A 5DDMA 3HJ1A 4UAZA 4O9MA 4UAYA 1KEJA 4P4PA 1ZQPA 2DR7A 4NXZA 4K4HA 3AQKA 4DO9A 1ZQGA 4E7XA 4Z6DA 2DR5A 1ZQZA 1ZQTA 2BCRA 3JPQA 1VFGA 4UB4A 3JPPA 4FHXA 1ZQDA 9ICNA 3LK9A 7ICMA 5D4BA 4X0BA 4UB1A 3WFQE 1XSNA 4RQ2A 4TURA 3RJJA 4RT3A 5DB8A 4ATBA 8ICOA 3MGHA 1RZTA 4RQ6A 4GXKA 4P2HA 1Q78A 4QZDA 1F5AA 1PX5A 4RQ0A 1ZJMA 2ZHAA 1ZQFA 8ICNA 9ICFA 1R8BA 3MBYA 2BCSA 1ZJNA 4LT6A 5J0XA 4PGYA 5DB7A 2ZH2A 4WCWA 7ICQA 4R64A 3B0YA 7ICIA 1BPYA 4X4RA 3UQ2A 5IINA 4AT9A 3K75D 4RPYA 5IIMA 4X4UA 1ZQOA 1ZQWA 4YMMA 1R89A 1UEUA 5J0RA 2M2UA 2ZH9A 4PGQA 4IG8A 3MGIA 3HIYA 4I2AA 4RPZA 4E80A 4WBYA 1JN3A 5DB6A 1ZQMA 9ICCA 3RJHA 9ICRA 3H39A 2BCUA 4WC1A 4NLZA 4QZIA 1NO5A 4KLSA 8ICZA 4KLIA 4ATBB 3B0XA 1JAJA 3ISCA 4WC5A 4NLNA 4M9GA 4KLMA 1ZQYA 2ZH8A 2W9MA 3PMLA 3JPSA 3NYBA 2DR9A 5J0SA 3V7JA 4MFFA 1VJ7A 5CR0A 4KLJA 4QZHA 1ZQKA 4M47A 4UAWA 1JQRA 5J2IA 3OGUA 4PHEA 5DECA 3RH5A 5J0OA 5HR9A 3UXPA 4M0AA 2ISOA 3UXOA 1ZQSA 4AT9B 7ICPA 1ZQLA 3OUYA 1FA0A 4QZ8A 4UD4A 2FMPA 4M9JA 9ICPA 3H37A 2M2WA 3JPRA 2ZH1A 4I2CA 3PMNA 7ICHA 9ICMA 4WBZA 7ICVA 4R66A 3OVBA 7ICKA 2PBEA 4EBJA 4F5QA 2BPGA 1HUOA 4QZBA 3WFRE 1ZQCA 4LVSA 5CJ7A 5J2FA 2VANA 4P4OA 2M2VA 4F5NA 3UQ0A 8ICYA 4DOBA 5HRKA 4RQ8A 5J2DA 4KLQA 3C2KA 8ICMA 3HX0A 1ZQNA 7ICOA 3C5FA 4RQ5A 5IILA 4MFAA 8ICPA 2M2TA 5CA7A 5J0YA 5IIKA 4PPXA 4FHVA 5DKWA 2DRBA 5BOLA 5HRGA 4RQ1A 5J2AA 4R63A 5CWRA
chains in the Genus database with same CATH superfamily
4WC3A 4OAGA 5TZVA 5DBAA 4LEYA 5J2HA 4M04A 2Q66A 4S3NA 1ZQXA 4YN4A 3WFPA 1ZQVA 2ZH6A 4MF2A 3NVOA 2ZH4A 1JMSA 9ICTA 1ZQIA 3OUYB 4KLGA 5CP2A 8ICRA 1ZQRA 8ICTA 2B51A 2BBHA 5EOZA 4DOAA 2B4VA 4WC6A 5HHIA 1ZQAA 2PFOA 3OVAA 4TUQA 1UETA 3UPSA 1BPXA 1WOTA 2FMSA 4PH5A 5HRLA 2BCQA 7ICUA 3OVSA 5J0PA 4I2BA 4NKTA 4Z6FA 3JPNA 4RWQA 4O5EA 1ZQBA 4I29A 2PFQA 4X4QA 4YMNA 3MDAA 4DOCA 1MQ2A 4I2HA 5CFTA 4KB6A 3MDCA 3JYYA 5DBCA 9ICLA 4Z6CA 3AQLA 3PNCA 2FCLA 2BPCA 1OU5A 4RWNA 7ICNA 4RT2A 4XUSA 5J2GA 1RPLA 4GXIA 2BE3A 9ICSA 3HWTA 2O1PA 8ICEA 5B3PA 4M9LA 5J0WA 3RJIA 4O6AA 5DDYA 2RFFA 3OWGA 4EGWA 8ICBA 1TVAA 4X4TA 3NWIA 9ICWA 5DEDA 3ISDA 9ICXA 4FHWA 4R65A 2DR8A 4YMOA 5CFSA 4KLLA 8ICSA 4EP7A 4NM2A 4RQ3A 9ICKA 4HX0A 4N7RA 4FH3A 4KLEA 3JCFA 4I0UA 7ICJA 4UB2A 3AU2A 4JWNA 4UD5A 4P4MA 3RJGA 4LEVA 4Z6EA 3C2LA 4O5CA 7ICFA 1BPEA 4KLOA 5J0TA 1BPDA 3GDXA 5HRFA 4WC7A 1BPZA 2BPFA 5DBBA 3WFOA 5CHEA 2GA9D 5J0UA 1YLQA 2B56A 1XSPA 1ZQHA 2PFPA 4QZ9A 1MIWA 4IQUA 7ICTA 3V72A 4X4OA 3H3AA 4RPXA 4FH5A 3TFSA 3ISBA 2IHOA 9ICBA 4KLUA 2HHPA 4KLFA 8ICHA 7ICSA 4M5DA 5DB9A 4I2JA 4PHPA 1KDHA 4LZGA 2BBJA 4IQTA 4FO1A 4QZAA 4KLTA 9ICAA 4WQLA 8ICQA 1TFYA 4LEWA 8ICKA 4RWOA 4K4GA 5BPCA 5HRHA 2NRKA 4XRHA 3C66A 2O5AA 4GXJA 1XSLA 4NXXA 9ICVA 2ID1A 8ICVA 5J0QA 5BOMA 3ER9B 1ZQQA 2I9GA 4IQVA 4EEBA 3C5GA 4WOYA 4F5OA 4UBBA 4NM1A 5IIJA 5HRBA 4LZDA 4F5RA 4QZFA 4MF8A 4WC4A 4NY8A 4M2YA 8ICJA 8ICAA 3C18A 5J2BA 5J2CA 4I2IA 3V7KA 5CB1A 4X4NA 3WFSC 4I2GA 5CHGA 1MIYA 4OAIZ 3HW8A 7ICLA 4RQ7A 4K9BA 4QZEA 4E8FA 4YD1A 5J29A 8ICWA 3V7LA 4QZCA 3RJEA 4NKUA 4QZGA 4X4PA 2GAFD 3H38A 8ICIA 4I28A 3RJFA 3LQCB 4MKPA 4AT7A 1TV9A 4I2DA 5D49A 4M9HA 2ZH7A 4UBCA 4JWMA 2P66A 9ICOA 4X4VA 5D46A 1ZQJA 4AT8A 4MFCA 4YCXA 4O5KA 4JLXA 4YD2A 3PHZA 3AU6A 3AUOA 8ICFA 4XQ7A 4KM5A 5J2JA 3OV7A 4FO6A 4UB5A 9ICEA 4O67A 2BCVA 4X4SA 8ICXA 4K9AA 1TFWA 4FHYA 5HHHA 2ZHBA 5IIIA 9ICQA 3CK6A 4TUPA 4WC2A 4NLKA 3RH4A 4X5VA 4I2FA 4I27A 3JPOA 4EBKA 4I2EA 2DVIA 4K99A 4M9NA 4F5PA 2ZH5A 1NOMA 3UPQA 4OAHA 7ICRA 1R8AA 8ICUA 2FMQA 5J2EA 4IQWA 1BPBA 4PHDA 3HJ4A 1MQ3A 2IHMA 5D61A 4KLDA 2GWSA 1UEVA 2PFNA 5F2VO 4PGXA 4AT7B 1ZQEA 2PXIA 3C2MA 8ICGA 5J2KA 2ISPA 5HRIA 3JPTA 4XQ8A 1R8CA 9ICIA 1HUZA 4RWPA 9ICJA 4AT8B 4FHPA 3RH6A 2ZH3A 4K4IA 4KLHA 3JZ0A 7ICEA 4RQ4A 3AQNA 7ICGA 3RJKA 5IIOA 2HN1A 5HC9A 1Q79A 9ICGA 4K98A 3UXNA 8ICCA 4X0AA 4UB3A 1ZQUA 4K8VA 2IUBA 3AQMA 3L9DA 4TUSA 1V4AA 5HREA 1MIVA 9ICUA 3TFRA 2DRAA 4K97A 8ICLA 4XA5A 4NXVA 9ICHA 4PHAA 1KNYA 5HRDA 4WC0A 5DDMA 3MCRA 3HJ1A 4OAFA 4UAZA 4O9MA 4UAYA 1KEJA 4P4PA 2DR7A 1ZQPA 4NXZA 2HN2A 4K4HA 3AQKA 4DO9A 1ZQGA 4E7XA 4Z6DA 2DR5A 5D62A 4WQKA 1ZQZA 1ZQTA 2BCRA 3JPQA 5D63A 1VFGA 4O68A 4UB4A 3JPPA 4FHXA 1ZQDA 9ICNA 3LK9A 7ICMA 5D4BA 4X0BA 4UB1A 3WFQE 1XSNA 4RQ2A 3EF2A 4TURA 3RJJA 4RT3A 5DB8A 4ATBA 8ICOA 3MGHA 1RZTA 4RQ6A 4GXKA 4P2HA 1Q78A 4QZDA 1F5AA 1PX5A 4RQ0A 1ZJMA 2ZHAA 1ZQFA 8ICNA 9ICFA 1R8BA 3MBYA 2BCSA 1ZJNA 4O69A 4LT6A 5J0XA 4PGYA 5DB7A 2ZH2A 3ER8C 4WCWA 7ICQA 3B0YA 4R64A 7ICIA 5B3QA 1BPYA 4X4RA 3UQ2A 5IINA 4AT9A 3K75D 4RPYA 5IIMA 4X4UA 5CFUA 1ZQOA 1ZQWA 4XJEA 4YMMA 1R89A 1UEUA 5J0RA 2ZH9A 2M2UA 4PGQA 4IG8A 3MGIA 3HIYA 4I2AA 4RPZA 4E80A 4NXUA 4WBYA 1JN3A 5DB6A 1ZQMA 9ICCA 3RJHA 3ERCC 9ICRA 3H39A 2BCUA 4WC1A 4NLZA 4QZIA 5JTGA 2EWRA 1NO5A 4KLSA 8ICZA 4KLIA 4EV6A 4ATBB 3B0XA 1JAJA 3ISCA 4WC5A 4NLNA 4M9GA 4KLMA 1ZQYA 2ZH8A 2W9MA 3PMLA 4JLZA 3JPSA 3NYBA 2DR9A 5J0SA 3V7JA 4MFFA 1VJ7A 5CR0A 4KLJA 4QZHA 1ZQKA 4M47A 4UAWA 1JQRA 5J2IA 3OGUA 4PHEA 5DECA 3RH5A 5J0OA 5HR9A 3UXPA 4M0AA 2ISOA 3UXOA 1ZQSA 4AT9B 7ICPA 1ZQLA 3OUYA 1FA0A 4QZ8A 4UD4A 2FMPA 3K7DA 4M9JA 9ICPA 3H37A 2M2WA 3JPRA 2ZH1A 4I2CA 3PMNA 7ICHA 9ICMA 4K96A 4WBZA 4WH5A 4R66A 7ICVA 3OVBA 7ICKA 1GPJA 2PBEA 4NXTA 4EBJA 4F5QA 2BPGA 1HUOA 4QZBA 3WFRE 1ZQCA 4LVSA 5CJ7A 5J2FA 2VANA 4P4OA 2M2VA 4F5NA 3UQ0A 8ICYA 4DOBA 5HRKA 4RQ8A 5J2DA 4KLQA 3C2KA 8ICMA 3HX0A 1ZQNA 7ICOA 4NXWA 3C5FA 4RQ5A 5IILA 4MFAA 8ICPA 2M2TA 5CA7A 5J0YA 5IIKA 4PPXA 4FHVA 4LEZA 5DKWA 2DRBA 5BOLA 3NKUA 5HRGA 4EEDA 4RQ1A 5J2AA 4R63A 5CWRA
chains in the Genus database with same CATH topology
4WC3A 4OAGA 5TZVA 5DBAA 4LEYA 5J2HA 4M04A 2Q66A 1ZQXA 4S3NA 4YN4A 3WFPA 1ZQVA 2ZH6A 4MF2A 2ZH4A 1JMSA 9ICTA 1ZQIA 3OUYB 4KLGA 5CP2A 8ICRA 1ZQRA 8ICTA 2B51A 5EOZA 4DOAA 2B4VA 4WC6A 5HHIA 1ZQAA 2PFOA 3OVAA 4TUQA 1UETA 3UPSA 1BPXA 1WOTA 2FMSA 4PH5A 5HRLA 2BCQA 7ICUA 3OVSA 5J0PA 4I2BA 4NKTA 4Z6FA 3JPNA 4RWQA 4O5EA 1ZQBA 4I29A 2PFQA 4X4QA 4YMNA 3MDAA 4DOCA 1MQ2A 4I2HA 4KB6A 3MDCA 3JYYA 5DBCA 9ICLA 4Z6CA 3AQLA 3PNCA 2BPCA 1OU5A 4RWNA 7ICNA 4RT2A 4XUSA 5J2GA 1RPLA 4GXIA 2BE3A 9ICSA 3HWTA 2O1PA 8ICEA 4M9LA 5J0WA 3RJIA 4O6AA 5DDYA 2RFFA 8ICBA 1TVAA 4X4TA 9ICWA 5DEDA 3ISDA 9ICXA 4FHWA 4R65A 2DR8A 4YMOA 4KLLA 8ICSA 4EP7A 4NM2A 4RQ3A 9ICKA 4FH3A 4KLEA 7ICJA 4UB2A 3AU2A 4JWNA 4UD5A 4P4MA 3RJGA 4LEVA 4Z6EA 3C2LA 4O5CA 7ICFA 1BPEA 4KLOA 5J0TA 1BPDA 3GDXA 5HRFA 4WC7A 1BPZA 2BPFA 5DBBA 3WFOA 5J0UA 1YLQA 2B56A 1XSPA 1ZQHA 2PFPA 4QZ9A 1MIWA 4IQUA 7ICTA 3V72A 4X4OA 3H3AA 4RPXA 4FH5A 3TFSA 3ISBA 9ICBA 4KLUA 2HHPA 4KLFA 8ICHA 7ICSA 4M5DA 5DB9A 4I2JA 4PHPA 1KDHA 4LZGA 4IQTA 4QZAA 4KLTA 9ICAA 8ICQA 1TFYA 4LEWA 8ICKA 4RWOA 4K4GA 5BPCA 5HRHA 2NRKA 4XRHA 3C66A 2O5AA 4GXJA 1XSLA 4NXXA 9ICVA 2ID1A 8ICVA 5J0QA 5BOMA 2I9GA 1ZQQA 4IQVA 3C5GA 4WOYA 4F5OA 4UBBA 4NM1A 5IIJA 5HRBA 4LZDA 4F5RA 4QZFA 4MF8A 4WC4A 4NY8A 4M2YA 8ICJA 8ICAA 3C18A 5J2BA 5J2CA 4I2IA 3V7KA 5CB1A 4X4NA 3WFSC 4I2GA 5CHGA 1MIYA 4OAIZ 3HW8A 7ICLA 4RQ7A 4K9BA 4QZEA 4E8FA 4YD1A 5J29A 8ICWA 3V7LA 4QZCA 3RJEA 4NKUA 4QZGA 4X4PA 3H38A 8ICIA 4I28A 3RJFA 3LQCB 4MKPA 4AT7A 1TV9A 4I2DA 5D49A 4M9HA 2ZH7A 4UBCA 4JWMA 2P66A 9ICOA 4X4VA 5D46A 1ZQJA 4AT8A 4MFCA 4YCXA 4O5KA 4JLXA 4YD2A 3AU6A 3AUOA 8ICFA 4XQ7A 4KM5A 5J2JA 3OV7A 4FO6A 4UB5A 9ICEA 4O67A 2BCVA 4X4SA 8ICXA 4K9AA 1TFWA 4FHYA 5HHHA 2ZHBA 5IIIA 9ICQA 4TUPA 4WC2A 4NLKA 3RH4A 4X5VA 4I2FA 4I27A 3JPOA 4EBKA 4I2EA 2DVIA 4K99A 4M9NA 4F5PA 2ZH5A 1NOMA 3UPQA 4OAHA 7ICRA 1R8AA 8ICUA 2FMQA 5J2EA 4IQWA 1BPBA 4PHDA 3HJ4A 1MQ3A 2IHMA 4KLDA 2GWSA 1UEVA 2PFNA 5F2VO 4PGXA 4AT7B 1ZQEA 2PXIA 3C2MA 8ICGA 5J2KA 2ISPA 5HRIA 3JPTA 4XQ8A 1R8CA 9ICIA 1HUZA 4RWPA 9ICJA 4AT8B 4FHPA 3RH6A 2ZH3A 4K4IA 4KLHA 3JZ0A 7ICEA 4RQ4A 3AQNA 7ICGA 3RJKA 5IIOA 5HC9A 1Q79A 9ICGA 4K98A 3UXNA 8ICCA 4X0AA 4UB3A 1ZQUA 4K8VA 3AQMA 4TUSA 3L9DA 1V4AA 5HREA 1MIVA 9ICUA 3TFRA 2DRAA 4K97A 8ICLA 4XA5A 4NXVA 9ICHA 4PHAA 1KNYA 5HRDA 4WC0A 5DDMA 3HJ1A 4OAFA 4UAZA 4O9MA 4UAYA 1KEJA 4P4PA 2DR7A 1ZQPA 4NXZA 4K4HA 3AQKA 4DO9A 1ZQGA 4E7XA 4Z6DA 2DR5A 1ZQZA 1ZQTA 2BCRA 3JPQA 1VFGA 4O68A 4UB4A 3JPPA 4FHXA 1ZQDA 9ICNA 3LK9A 7ICMA 5D4BA 4X0BA 4UB1A 3WFQE 1XSNA 4RQ2A 4TURA 3RJJA 4RT3A 5DB8A 4ATBA 8ICOA 3MGHA 1RZTA 4RQ6A 4GXKA 4P2HA 1Q78A 4QZDA 1F5AA 1PX5A 4RQ0A 1ZJMA 2ZHAA 1ZQFA 8ICNA 9ICFA 1R8BA 3MBYA 2BCSA 1ZJNA 4O69A 4LT6A 5J0XA 4PGYA 5DB7A 2ZH2A 4WCWA 7ICQA 3B0YA 4R64A 7ICIA 1BPYA 4X4RA 3UQ2A 5IINA 4AT9A 3K75D 4RPYA 5IIMA 4X4UA 1ZQOA 1ZQWA 4YMMA 1R89A 1UEUA 5J0RA 2ZH9A 2M2UA 4PGQA 4IG8A 3MGIA 3HIYA 4I2AA 4RPZA 4E80A 4NXUA 4WBYA 1JN3A 5DB6A 1ZQMA 9ICCA 3RJHA 9ICRA 3H39A 2BCUA 4WC1A 4NLZA 4QZIA 1NO5A 4KLSA 8ICZA 4KLIA 4ATBB 3B0XA 1JAJA 3ISCA 4WC5A 4NLNA 4M9GA 4KLMA 1ZQYA 2ZH8A 2W9MA 3PMLA 4JLZA 3JPSA 3NYBA 2DR9A 5J0SA 3V7JA 4MFFA 1VJ7A 5CR0A 4KLJA 4QZHA 1ZQKA 4M47A 4UAWA 1JQRA 5J2IA 3OGUA 4PHEA 5DECA 3RH5A 5J0OA 5HR9A 3UXPA 4M0AA 2ISOA 3UXOA 1ZQSA 4AT9B 7ICPA 1ZQLA 3OUYA 1FA0A 4QZ8A 4UD4A 2FMPA 4M9JA 9ICPA 3H37A 2M2WA 3JPRA 2ZH1A 4I2CA 3PMNA 7ICHA 9ICMA 4K96A 4WBZA 7ICVA 4R66A 3OVBA 7ICKA 2PBEA 4NXTA 4EBJA 4F5QA 2BPGA 1HUOA 4QZBA 3WFRE 1ZQCA 4LVSA 5CJ7A 5J2FA 2VANA 4P4OA 2M2VA 4F5NA 3UQ0A 8ICYA 4DOBA 5HRKA 4RQ8A 5J2DA 4KLQA 3C2KA 8ICMA 3HX0A 1ZQNA 7ICOA 4NXWA 3C5FA 4RQ5A 5IILA 4MFAA 8ICPA 2M2TA 5CA7A 5J0YA 5IIKA 4PPXA 4FHVA 4LEZA 5DKWA 2DRBA 5BOLA 5HRGA 4RQ1A 5J2AA 4R63A 5CWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC3 A;  5TZV A;  5DBA A;  5J2H A;  4M04 A;  2Q66 A;  1ZQX A;  4S3N A;  4YN4 A;  3WFP A;  1ZQV A;  2ZH6 A;  4MF2 A;  2ZH4 A;  1JMS A;  9ICT A;  1ZQI A;  3OUY B;  4KLG A;  5CP2 A;  8ICR A;  1ZQR A;  8ICT A;  2B51 A;  5EOZ A;  4DOA A;  2B4V A;  4WC6 A;  5HHI A;  1ZQA A;  2PFO A;  3OVA A;  4TUQ A;  1UET A;  3UPS A;  1BPX A;  1WOT A;  2FMS A;  4PH5 A;  5HRL A;  2BCQ A;  7ICU A;  3OVS A;  5J0P A;  4I2B A;  4NKT A;  4Z6F A;  3JPN A;  4RWQ A;  4O5E A;  1ZQB A;  4I29 A;  2PFQ A;  4X4Q A;  4YMN A;  3MDA A;  4DOC A;  1MQ2 A;  4I2H A;  3MDC A;  3JYY A;  5DBC A;  9ICL A;  4Z6C A;  3AQL A;  3PNC A;  2BPC A;  1OU5 A;  4RWN A;  7ICN A;  4RT2 A;  4XUS A;  5J2G A;  1RPL A;  4GXI A;  2BE3 A;  9ICS A;  3HWT A;  2O1P A;  8ICE A;  4M9L A;  5J0W A;  3RJI A;  5DDY A;  2RFF A;  8ICB A;  1TVA A;  4X4T A;  9ICW A;  5DED A;  3ISD A;  9ICX A;  4FHW A;  4R65 A;  2DR8 A;  4YMO A;  4KLL A;  8ICS A;  4EP7 A;  4NM2 A;  4RQ3 A;  9ICK A;  4FH3 A;  4KLE A;  7ICJ A;  4UB2 A;  3AU2 A;  4JWN A;  4UD5 A;  4P4M A;  3RJG A;  4Z6E A;  3C2L A;  4O5C A;  7ICF A;  1BPE A;  4KLO A;  5J0T A;  1BPD A;  3GDX A;  5HRF A;  4WC7 A;  1BPZ A;  2BPF A;  5DBB A;  3WFO A;  5J0U A;  1YLQ A;  2B56 A;  1XSP A;  1ZQH A;  2PFP A;  4QZ9 A;  1MIW A;  4IQU A;  7ICT A;  3V72 A;  4X4O A;  3H3A A;  4RPX A;  4FH5 A;  3TFS A;  3ISB A;  9ICB A;  4KLU A;  2HHP A;  4KLF A;  8ICH A;  7ICS A;  4M5D A;  5DB9 A;  4I2J A;  4PHP A;  1KDH A;  4LZG A;  4IQT A;  4QZA A;  4KLT A;  9ICA A;  8ICQ A;  1TFY A;  8ICK A;  4RWO A;  4K4G A;  5BPC A;  5HRH A;  2NRK A;  4XRH A;  3C66 A;  2O5A A;  4GXJ A;  1XSL A;  9ICV A;  2ID1 A;  8ICV A;  5J0Q A;  5BOM A;  2I9G A;  1ZQQ A;  4IQV A;  3C5G A;  4F5O A;  4UBB A;  4NM1 A;  5IIJ A;  5HRB A;  4LZD A;  4F5R A;  4QZF A;  4MF8 A;  4WC4 A;  4NY8 A;  4M2Y A;  8ICJ A;  8ICA A;  3C18 A;  5J2B A;  5J2C A;  4I2I A;  3V7K A;  5CB1 A;  3WFS C;  4X4N A;  4I2G A;  5CHG A;  1MIY A;  3HW8 A;  7ICL A;  4RQ7 A;  4QZE A;  4E8F A;  4YD1 A;  5J29 A;  8ICW A;  3V7L A;  4QZC A;  3RJE A;  4NKU A;  4QZG A;  4X4P A;  3H38 A;  8ICI A;  4I28 A;  3RJF A;  3LQC B;  4AT7 A;  1TV9 A;  4I2D A;  5D49 A;  4M9H A;  2ZH7 A;  4UBC A;  4JWM A;  2P66 A;  9ICO A;  5D46 A;  1ZQJ A;  4X4V A;  4AT8 A;  4MFC A;  4YCX A;  4O5K A;  4YD2 A;  3AU6 A;  3AUO A;  8ICF A;  4XQ7 A;  5J2J A;  3OV7 A;  4FO6 A;  4UB5 A;  9ICE A;  2BCV A;  4X4S A;  8ICX A;  5HHH A;  4FHY A;  1TFW A;  2ZHB A;  5III A;  9ICQ A;  4TUP A;  4WC2 A;  4NLK A;  3RH4 A;  4X5V A;  4I2F A;  4I27 A;  3JPO A;  4EBK A;  4I2E A;  2DVI A;  4M9N A;  4F5P A;  2ZH5 A;  1NOM A;  3UPQ A;  7ICR A;  1R8A A;  8ICU A;  2FMQ A;  5J2E A;  4IQW A;  1BPB A;  4PHD A;  3HJ4 A;  1MQ3 A;  2IHM A;  4KLD A;  2GWS A;  1UEV A;  2PFN A;  5F2V O;  4PGX A;  4AT7 B;  1ZQE A;  2PXI A;  3C2M A;  8ICG A;  5J2K A;  2ISP A;  5HRI A;  3JPT A;  4XQ8 A;  1R8C A;  9ICI A;  1HUZ A;  4RWP A;  9ICJ A;  4AT8 B;  4FHP A;  3RH6 A;  2ZH3 A;  4K4I A;  4KLH A;  3JZ0 A;  7ICE A;  4RQ4 A;  3AQN A;  7ICG A;  3RJK A;  5IIO A;  5HC9 A;  1Q79 A;  9ICG A;  3UXN A;  8ICC A;  4X0A A;  4UB3 A;  1ZQU A;  4TUS A;  3AQM A;  3L9D A;  1V4A A;  5HRE A;  1MIV A;  9ICU A;  3TFR A;  2DRA A;  8ICL A;  4XA5 A;  9ICH A;  4PHA A;  1KNY A;  5HRD A;  4WC0 A;  5DDM A;  3HJ1 A;  4UAZ A;  4O9M A;  4UAY A;  1KEJ A;  4P4P A;  1ZQP A;  2DR7 A;  4NXZ A;  4K4H A;  3AQK A;  4DO9 A;  1ZQG A;  4E7X A;  4Z6D A;  2DR5 A;  1ZQZ A;  1ZQT A;  2BCR A;  3JPQ A;  1VFG A;  4UB4 A;  3JPP A;  4FHX A;  1ZQD A;  9ICN A;  3LK9 A;  7ICM A;  5D4B A;  4X0B A;  4UB1 A;  3WFQ E;  1XSN A;  4RQ2 A;  4TUR A;  3RJJ A;  4RT3 A;  5DB8 A;  4ATB A;  8ICO A;  3MGH A;  1RZT A;  4RQ6 A;  4GXK A;  4P2H A;  1Q78 A;  4QZD A;  1F5A A;  1PX5 A;  4RQ0 A;  1ZJM A;  2ZHA A;  1ZQF A;  8ICN A;  9ICF A;  1R8B A;  3MBY A;  2BCS A;  1ZJN A;  4LT6 A;  5J0X A;  4PGY A;  5DB7 A;  2ZH2 A;  4WCW A;  7ICQ A;  4R64 A;  3B0Y A;  7ICI A;  1BPY A;  4X4R A;  3UQ2 A;  5IIN A;  4AT9 A;  3K75 D;  4RPY A;  5IIM A;  4X4U A;  1ZQO A;  1ZQW A;  4YMM A;  1R89 A;  1UEU A;  5J0R A;  2M2U A;  2ZH9 A;  4PGQ A;  4IG8 A;  3MGI A;  3HIY A;  4I2A A;  4RPZ A;  4E80 A;  4WBY A;  1JN3 A;  5DB6 A;  1ZQM A;  9ICC A;  3RJH A;  9ICR A;  3H39 A;  2BCU A;  4WC1 A;  4NLZ A;  4QZI A;  1NO5 A;  4KLS A;  8ICZ A;  4KLI A;  4ATB B;  3B0X A;  1JAJ A;  3ISC A;  4WC5 A;  4NLN A;  4M9G A;  4KLM A;  1ZQY A;  2ZH8 A;  2W9M A;  3PML A;  3JPS A;  3NYB A;  2DR9 A;  5J0S A;  3V7J A;  4MFF A;  1VJ7 A;  5CR0 A;  4KLJ A;  4QZH A;  1ZQK A;  4M47 A;  4UAW A;  1JQR A;  5J2I A;  3OGU A;  4PHE A;  5DEC A;  3RH5 A;  5J0O A;  5HR9 A;  3UXP A;  4M0A A;  2ISO A;  3UXO A;  1ZQS A;  4AT9 B;  7ICP A;  1ZQL A;  3OUY A;  1FA0 A;  4QZ8 A;  4UD4 A;  2FMP A;  4M9J A;  9ICP A;  3H37 A;  2M2W A;  3JPR A;  2ZH1 A;  4I2C A;  3PMN A;  7ICH A;  9ICM A;  4WBZ A;  7ICV A;  4R66 A;  3OVB A;  7ICK A;  2PBE A;  4EBJ A;  4F5Q A;  2BPG A;  1HUO A;  4QZB A;  3WFR E;  1ZQC A;  4LVS A;  5CJ7 A;  5J2F A;  2VAN A;  4P4O A;  2M2V A;  4F5N A;  3UQ0 A;  8ICY A;  4DOB A;  5HRK A;  4RQ8 A;  5J2D A;  4KLQ A;  3C2K A;  8ICM A;  3HX0 A;  1ZQN A;  7ICO A;  3C5F A;  4RQ5 A;  5IIL A;  4MFA A;  8ICP A;  2M2T A;  5CA7 A;  5J0Y A;  5IIK A;  4PPX A;  4FHV A;  5DKW A;  2DRB A;  5BOL A;  5HRG A;  4RQ1 A;  5J2A A;  4R63 A;  5CWR A; 
#chains in the Genus database with same CATH topology
 4WC3 A;  4OAG A;  5TZV A;  5DBA A;  4LEY A;  5J2H A;  4M04 A;  2Q66 A;  4S3N A;  1ZQX A;  4YN4 A;  3WFP A;  1ZQV A;  2ZH6 A;  4MF2 A;  3NVO A;  2ZH4 A;  1JMS A;  9ICT A;  1ZQI A;  3OUY B;  4KLG A;  5CP2 A;  8ICR A;  1ZQR A;  8ICT A;  2B51 A;  2BBH A;  5EOZ A;  4DOA A;  2B4V A;  4WC6 A;  5HHI A;  1ZQA A;  2PFO A;  3OVA A;  4TUQ A;  1UET A;  3UPS A;  1BPX A;  1WOT A;  2FMS A;  4PH5 A;  5HRL A;  2BCQ A;  7ICU A;  3OVS A;  5J0P A;  4I2B A;  4NKT A;  4Z6F A;  3JPN A;  4RWQ A;  4O5E A;  1ZQB A;  4I29 A;  2PFQ A;  4X4Q A;  4YMN A;  3MDA A;  4DOC A;  1MQ2 A;  4I2H A;  5CFT A;  4KB6 A;  3MDC A;  3JYY A;  5DBC A;  9ICL A;  4Z6C A;  3AQL A;  3PNC A;  2FCL A;  2BPC A;  1OU5 A;  4RWN A;  7ICN A;  4RT2 A;  4XUS A;  5J2G A;  1RPL A;  4GXI A;  2BE3 A;  9ICS A;  3HWT A;  2O1P A;  8ICE A;  5B3P A;  4M9L A;  5J0W A;  3RJI A;  4O6A A;  5DDY A;  2RFF A;  3OWG A;  4EGW A;  8ICB A;  1TVA A;  4X4T A;  3NWI A;  9ICW A;  5DED A;  3ISD A;  9ICX A;  4FHW A;  4R65 A;  2DR8 A;  4YMO A;  5CFS A;  4KLL A;  8ICS A;  4EP7 A;  4NM2 A;  4RQ3 A;  9ICK A;  4HX0 A;  4N7R A;  4FH3 A;  4KLE A;  3JCF A;  4I0U A;  7ICJ A;  4UB2 A;  3AU2 A;  4JWN A;  4UD5 A;  4P4M A;  3RJG A;  4LEV A;  4Z6E A;  3C2L A;  4O5C A;  7ICF A;  1BPE A;  4KLO A;  5J0T A;  1BPD A;  3GDX A;  5HRF A;  4WC7 A;  1BPZ A;  2BPF A;  5DBB A;  3WFO A;  5CHE A;  2GA9 D;  5J0U A;  1YLQ A;  2B56 A;  1XSP A;  1ZQH A;  2PFP A;  4QZ9 A;  1MIW A;  4IQU A;  7ICT A;  3V72 A;  4X4O A;  3H3A A;  4RPX A;  4FH5 A;  3TFS A;  3ISB A;  2IHO A;  9ICB A;  4KLU A;  2HHP A;  4KLF A;  8ICH A;  7ICS A;  4M5D A;  5DB9 A;  4I2J A;  4PHP A;  1KDH A;  4LZG A;  2BBJ A;  4IQT A;  4FO1 A;  4QZA A;  4KLT A;  9ICA A;  4WQL A;  8ICQ A;  1TFY A;  4LEW A;  8ICK A;  4RWO A;  4K4G A;  5BPC A;  5HRH A;  2NRK A;  4XRH A;  3C66 A;  2O5A A;  4GXJ A;  1XSL A;  4NXX A;  9ICV A;  2ID1 A;  8ICV A;  5J0Q A;  5BOM A;  3ER9 B;  1ZQQ A;  2I9G A;  4IQV A;  4EEB A;  3C5G A;  4WOY A;  4F5O A;  4UBB A;  4NM1 A;  5IIJ A;  5HRB A;  4LZD A;  4F5R A;  4QZF A;  4MF8 A;  4WC4 A;  4NY8 A;  4M2Y A;  8ICJ A;  8ICA A;  3C18 A;  5J2B A;  5J2C A;  4I2I A;  3V7K A;  5CB1 A;  4X4N A;  3WFS C;  4I2G A;  5CHG A;  1MIY A;  4OAI Z;  3HW8 A;  7ICL A;  4RQ7 A;  4K9B A;  4QZE A;  4E8F A;  4YD1 A;  5J29 A;  8ICW A;  3V7L A;  4QZC A;  3RJE A;  4NKU A;  4QZG A;  4X4P A;  2GAF D;  3H38 A;  8ICI A;  4I28 A;  3RJF A;  3LQC B;  4MKP A;  4AT7 A;  1TV9 A;  4I2D A;  5D49 A;  4M9H A;  2ZH7 A;  4UBC A;  4JWM A;  2P66 A;  9ICO A;  4X4V A;  5D46 A;  1ZQJ A;  4AT8 A;  4MFC A;  4YCX A;  4O5K A;  4JLX A;  4YD2 A;  3PHZ A;  3AU6 A;  3AUO A;  8ICF A;  4XQ7 A;  4KM5 A;  5J2J A;  3OV7 A;  4FO6 A;  4UB5 A;  9ICE A;  4O67 A;  2BCV A;  4X4S A;  8ICX A;  4K9A A;  1TFW A;  4FHY A;  5HHH A;  2ZHB A;  5III A;  9ICQ A;  3CK6 A;  4TUP A;  4WC2 A;  4NLK A;  3RH4 A;  4X5V A;  4I2F A;  4I27 A;  3JPO A;  4EBK A;  4I2E A;  2DVI A;  4K99 A;  4M9N A;  4F5P A;  2ZH5 A;  1NOM A;  3UPQ A;  4OAH A;  7ICR A;  1R8A A;  8ICU A;  2FMQ A;  5J2E A;  4IQW A;  1BPB A;  4PHD A;  3HJ4 A;  1MQ3 A;  2IHM A;  5D61 A;  4KLD A;  2GWS A;  1UEV A;  2PFN A;  5F2V O;  4PGX A;  4AT7 B;  1ZQE A;  2PXI A;  3C2M A;  8ICG A;  5J2K A;  2ISP A;  5HRI A;  3JPT A;  4XQ8 A;  1R8C A;  9ICI A;  1HUZ A;  4RWP A;  9ICJ A;  4AT8 B;  4FHP A;  3RH6 A;  2ZH3 A;  4K4I A;  4KLH A;  3JZ0 A;  7ICE A;  4RQ4 A;  3AQN A;  7ICG A;  3RJK A;  5IIO A;  2HN1 A;  5HC9 A;  1Q79 A;  9ICG A;  4K98 A;  3UXN A;  8ICC A;  4X0A A;  4UB3 A;  1ZQU A;  4K8V A;  2IUB A;  3AQM A;  3L9D A;  4TUS A;  1V4A A;  5HRE A;  1MIV A;  9ICU A;  3TFR A;  2DRA A;  4K97 A;  8ICL A;  4XA5 A;  4NXV A;  9ICH A;  4PHA A;  1KNY A;  5HRD A;  4WC0 A;  5DDM A;  3MCR A;  3HJ1 A;  4OAF A;  4UAZ A;  4O9M A;  4UAY A;  1KEJ A;  4P4P A;  2DR7 A;  1ZQP A;  4NXZ A;  2HN2 A;  4K4H A;  3AQK A;  4DO9 A;  1ZQG A;  4E7X A;  4Z6D A;  2DR5 A;  5D62 A;  4WQK A;  1ZQZ A;  1ZQT A;  2BCR A;  3JPQ A;  5D63 A;  1VFG A;  4O68 A;  4UB4 A;  3JPP A;  4FHX A;  1ZQD A;  9ICN A;  3LK9 A;  7ICM A;  5D4B A;  4X0B A;  4UB1 A;  3WFQ E;  1XSN A;  4RQ2 A;  3EF2 A;  4TUR A;  3RJJ A;  4RT3 A;  5DB8 A;  4ATB A;  8ICO A;  3MGH A;  1RZT A;  4RQ6 A;  4GXK A;  4P2H A;  1Q78 A;  4QZD A;  1F5A A;  1PX5 A;  4RQ0 A;  1ZJM A;  2ZHA A;  1ZQF A;  8ICN A;  9ICF A;  1R8B A;  3MBY A;  2BCS A;  1ZJN A;  4O69 A;  4LT6 A;  5J0X A;  4PGY A;  5DB7 A;  2ZH2 A;  3ER8 C;  4WCW A;  7ICQ A;  3B0Y A;  4R64 A;  7ICI A;  5B3Q A;  1BPY A;  4X4R A;  3UQ2 A;  5IIN A;  4AT9 A;  3K75 D;  4RPY A;  5IIM A;  4X4U A;  5CFU A;  1ZQO A;  1ZQW A;  4XJE A;  4YMM A;  1R89 A;  1UEU A;  5J0R A;  2ZH9 A;  2M2U A;  4PGQ A;  4IG8 A;  3MGI A;  3HIY A;  4I2A A;  4RPZ A;  4E80 A;  4NXU A;  4WBY A;  1JN3 A;  5DB6 A;  1ZQM A;  9ICC A;  3RJH A;  3ERC C;  9ICR A;  3H39 A;  2BCU A;  4WC1 A;  4NLZ A;  4QZI A;  5JTG A;  2EWR A;  1NO5 A;  4KLS A;  8ICZ A;  4KLI A;  4EV6 A;  4ATB B;  3B0X A;  1JAJ A;  3ISC A;  4WC5 A;  4NLN A;  4M9G A;  4KLM A;  1ZQY A;  2ZH8 A;  2W9M A;  3PML A;  4JLZ A;  3JPS A;  3NYB A;  2DR9 A;  5J0S A;  3V7J A;  4MFF A;  1VJ7 A;  5CR0 A;  4KLJ A;  4QZH A;  1ZQK A;  4M47 A;  4UAW A;  1JQR A;  5J2I A;  3OGU A;  4PHE A;  5DEC A;  3RH5 A;  5J0O A;  5HR9 A;  3UXP A;  4M0A A;  2ISO A;  3UXO A;  1ZQS A;  4AT9 B;  7ICP A;  1ZQL A;  3OUY A;  1FA0 A;  4QZ8 A;  4UD4 A;  2FMP A;  3K7D A;  4M9J A;  9ICP A;  3H37 A;  2M2W A;  3JPR A;  2ZH1 A;  4I2C A;  3PMN A;  7ICH A;  9ICM A;  4K96 A;  4WBZ A;  4WH5 A;  4R66 A;  7ICV A;  3OVB A;  7ICK A;  1GPJ A;  2PBE A;  4NXT A;  4EBJ A;  4F5Q A;  2BPG A;  1HUO A;  4QZB A;  3WFR E;  1ZQC A;  4LVS A;  5CJ7 A;  5J2F A;  2VAN A;  4P4O A;  2M2V A;  4F5N A;  3UQ0 A;  8ICY A;  4DOB A;  5HRK A;  4RQ8 A;  5J2D A;  4KLQ A;  3C2K A;  8ICM A;  3HX0 A;  1ZQN A;  7ICO A;  4NXW A;  3C5F A;  4RQ5 A;  5IIL A;  4MFA A;  8ICP A;  2M2T A;  5CA7 A;  5J0Y A;  5IIK A;  4PPX A;  4FHV A;  4LEZ A;  5DKW A;  2DRB A;  5BOL A;  3NKU A;  5HRG A;  4EED A;  4RQ1 A;  5J2A A;  4R63 A;  5CWR A; 
#chains in the Genus database with same CATH homology
 4WC3 A;  4OAG A;  5TZV A;  5DBA A;  4LEY A;  5J2H A;  4M04 A;  2Q66 A;  1ZQX A;  4S3N A;  4YN4 A;  3WFP A;  1ZQV A;  2ZH6 A;  4MF2 A;  2ZH4 A;  1JMS A;  9ICT A;  1ZQI A;  3OUY B;  4KLG A;  5CP2 A;  8ICR A;  1ZQR A;  8ICT A;  2B51 A;  5EOZ A;  4DOA A;  2B4V A;  4WC6 A;  5HHI A;  1ZQA A;  2PFO A;  3OVA A;  4TUQ A;  1UET A;  3UPS A;  1BPX A;  1WOT A;  2FMS A;  4PH5 A;  5HRL A;  2BCQ A;  7ICU A;  3OVS A;  5J0P A;  4I2B A;  4NKT A;  4Z6F A;  3JPN A;  4RWQ A;  4O5E A;  1ZQB A;  4I29 A;  2PFQ A;  4X4Q A;  4YMN A;  3MDA A;  4DOC A;  1MQ2 A;  4I2H A;  4KB6 A;  3MDC A;  3JYY A;  5DBC A;  9ICL A;  4Z6C A;  3AQL A;  3PNC A;  2BPC A;  1OU5 A;  4RWN A;  7ICN A;  4RT2 A;  4XUS A;  5J2G A;  1RPL A;  4GXI A;  2BE3 A;  9ICS A;  3HWT A;  2O1P A;  8ICE A;  4M9L A;  5J0W A;  3RJI A;  4O6A A;  5DDY A;  2RFF A;  8ICB A;  1TVA A;  4X4T A;  9ICW A;  5DED A;  3ISD A;  9ICX A;  4FHW A;  4R65 A;  2DR8 A;  4YMO A;  4KLL A;  8ICS A;  4EP7 A;  4NM2 A;  4RQ3 A;  9ICK A;  4FH3 A;  4KLE A;  7ICJ A;  4UB2 A;  3AU2 A;  4JWN A;  4UD5 A;  4P4M A;  3RJG A;  4LEV A;  4Z6E A;  3C2L A;  4O5C A;  7ICF A;  1BPE A;  4KLO A;  5J0T A;  1BPD A;  3GDX A;  5HRF A;  4WC7 A;  1BPZ A;  2BPF A;  5DBB A;  3WFO A;  5J0U A;  1YLQ A;  2B56 A;  1XSP A;  1ZQH A;  2PFP A;  4QZ9 A;  1MIW A;  4IQU A;  7ICT A;  3V72 A;  4X4O A;  3H3A A;  4RPX A;  4FH5 A;  3TFS A;  3ISB A;  9ICB A;  4KLU A;  2HHP A;  4KLF A;  8ICH A;  7ICS A;  4M5D A;  5DB9 A;  4I2J A;  4PHP A;  1KDH A;  4LZG A;  4IQT A;  4QZA A;  4KLT A;  9ICA A;  8ICQ A;  1TFY A;  4LEW A;  8ICK A;  4RWO A;  4K4G A;  5BPC A;  5HRH A;  2NRK A;  4XRH A;  3C66 A;  2O5A A;  4GXJ A;  1XSL A;  4NXX A;  9ICV A;  2ID1 A;  8ICV A;  5J0Q A;  5BOM A;  2I9G A;  1ZQQ A;  4IQV A;  3C5G A;  4WOY A;  4F5O A;  4UBB A;  4NM1 A;  5IIJ A;  5HRB A;  4LZD A;  4F5R A;  4QZF A;  4MF8 A;  4WC4 A;  4NY8 A;  4M2Y A;  8ICJ A;  8ICA A;  3C18 A;  5J2B A;  5J2C A;  4I2I A;  3V7K A;  5CB1 A;  4X4N A;  3WFS C;  4I2G A;  5CHG A;  1MIY A;  4OAI Z;  3HW8 A;  7ICL A;  4RQ7 A;  4K9B A;  4QZE A;  4E8F A;  4YD1 A;  5J29 A;  8ICW A;  3V7L A;  4QZC A;  3RJE A;  4NKU A;  4QZG A;  4X4P A;  3H38 A;  8ICI A;  4I28 A;  3RJF A;  3LQC B;  4MKP A;  4AT7 A;  1TV9 A;  4I2D A;  5D49 A;  4M9H A;  2ZH7 A;  4UBC A;  4JWM A;  2P66 A;  9ICO A;  4X4V A;  5D46 A;  1ZQJ A;  4AT8 A;  4MFC A;  4YCX A;  4O5K A;  4JLX A;  4YD2 A;  3AU6 A;  3AUO A;  8ICF A;  4XQ7 A;  4KM5 A;  5J2J A;  3OV7 A;  4FO6 A;  4UB5 A;  9ICE A;  4O67 A;  2BCV A;  4X4S A;  8ICX A;  4K9A A;  1TFW A;  4FHY A;  5HHH A;  2ZHB A;  5III A;  9ICQ A;  4TUP A;  4WC2 A;  4NLK A;  3RH4 A;  4X5V A;  4I2F A;  4I27 A;  3JPO A;  4EBK A;  4I2E A;  2DVI A;  4K99 A;  4M9N A;  4F5P A;  2ZH5 A;  1NOM A;  3UPQ A;  4OAH A;  7ICR A;  1R8A A;  8ICU A;  2FMQ A;  5J2E A;  4IQW A;  1BPB A;  4PHD A;  3HJ4 A;  1MQ3 A;  2IHM A;  4KLD A;  2GWS A;  1UEV A;  2PFN A;  5F2V O;  4PGX A;  4AT7 B;  1ZQE A;  2PXI A;  3C2M A;  8ICG A;  5J2K A;  2ISP A;  5HRI A;  3JPT A;  4XQ8 A;  1R8C A;  9ICI A;  1HUZ A;  4RWP A;  9ICJ A;  4AT8 B;  4FHP A;  3RH6 A;  2ZH3 A;  4K4I A;  4KLH A;  3JZ0 A;  7ICE A;  4RQ4 A;  3AQN A;  7ICG A;  3RJK A;  5IIO A;  5HC9 A;  1Q79 A;  9ICG A;  4K98 A;  3UXN A;  8ICC A;  4X0A A;  4UB3 A;  1ZQU A;  4K8V A;  3AQM A;  4TUS A;  3L9D A;  1V4A A;  5HRE A;  1MIV A;  9ICU A;  3TFR A;  2DRA A;  4K97 A;  8ICL A;  4XA5 A;  4NXV A;  9ICH A;  4PHA A;  1KNY A;  5HRD A;  4WC0 A;  5DDM A;  3HJ1 A;  4OAF A;  4UAZ A;  4O9M A;  4UAY A;  1KEJ A;  4P4P A;  2DR7 A;  1ZQP A;  4NXZ A;  4K4H A;  3AQK A;  4DO9 A;  1ZQG A;  4E7X A;  4Z6D A;  2DR5 A;  1ZQZ A;  1ZQT A;  2BCR A;  3JPQ A;  1VFG A;  4O68 A;  4UB4 A;  3JPP A;  4FHX A;  1ZQD A;  9ICN A;  3LK9 A;  7ICM A;  5D4B A;  4X0B A;  4UB1 A;  3WFQ E;  1XSN A;  4RQ2 A;  4TUR A;  3RJJ A;  4RT3 A;  5DB8 A;  4ATB A;  8ICO A;  3MGH A;  1RZT A;  4RQ6 A;  4GXK A;  4P2H A;  1Q78 A;  4QZD A;  1F5A A;  1PX5 A;  4RQ0 A;  1ZJM A;  2ZHA A;  1ZQF A;  8ICN A;  9ICF A;  1R8B A;  3MBY A;  2BCS A;  1ZJN A;  4O69 A;  4LT6 A;  5J0X A;  4PGY A;  5DB7 A;  2ZH2 A;  4WCW A;  7ICQ A;  3B0Y A;  4R64 A;  7ICI A;  1BPY A;  4X4R A;  3UQ2 A;  5IIN A;  4AT9 A;  3K75 D;  4RPY A;  5IIM A;  4X4U A;  1ZQO A;  1ZQW A;  4YMM A;  1R89 A;  1UEU A;  5J0R A;  2ZH9 A;  2M2U A;  4PGQ A;  4IG8 A;  3MGI A;  3HIY A;  4I2A A;  4RPZ A;  4E80 A;  4NXU A;  4WBY A;  1JN3 A;  5DB6 A;  1ZQM A;  9ICC A;  3RJH A;  9ICR A;  3H39 A;  2BCU A;  4WC1 A;  4NLZ A;  4QZI A;  1NO5 A;  4KLS A;  8ICZ A;  4KLI A;  4ATB B;  3B0X A;  1JAJ A;  3ISC A;  4WC5 A;  4NLN A;  4M9G A;  4KLM A;  1ZQY A;  2ZH8 A;  2W9M A;  3PML A;  4JLZ A;  3JPS A;  3NYB A;  2DR9 A;  5J0S A;  3V7J A;  4MFF A;  1VJ7 A;  5CR0 A;  4KLJ A;  4QZH A;  1ZQK A;  4M47 A;  4UAW A;  1JQR A;  5J2I A;  3OGU A;  4PHE A;  5DEC A;  3RH5 A;  5J0O A;  5HR9 A;  3UXP A;  4M0A A;  2ISO A;  3UXO A;  1ZQS A;  4AT9 B;  7ICP A;  1ZQL A;  3OUY A;  1FA0 A;  4QZ8 A;  4UD4 A;  2FMP A;  4M9J A;  9ICP A;  3H37 A;  2M2W A;  3JPR A;  2ZH1 A;  4I2C A;  3PMN A;  7ICH A;  9ICM A;  4K96 A;  4WBZ A;  7ICV A;  4R66 A;  3OVB A;  7ICK A;  2PBE A;  4NXT A;  4EBJ A;  4F5Q A;  2BPG A;  1HUO A;  4QZB A;  3WFR E;  1ZQC A;  4LVS A;  5CJ7 A;  5J2F A;  2VAN A;  4P4O A;  2M2V A;  4F5N A;  3UQ0 A;  8ICY A;  4DOB A;  5HRK A;  4RQ8 A;  5J2D A;  4KLQ A;  3C2K A;  8ICM A;  3HX0 A;  1ZQN A;  7ICO A;  4NXW A;  3C5F A;  4RQ5 A;  5IIL A;  4MFA A;  8ICP A;  2M2T A;  5CA7 A;  5J0Y A;  5IIK A;  4PPX A;  4FHV A;  4LEZ A;  5DKW A;  2DRB A;  5BOL A;  5HRG A;  4RQ1 A;  5J2A A;  4R63 A;  5CWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...