4UD4A

Structural plasticity of cid1 provides a basis for its rna terminal uridylyl transferase activity
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
324
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGAFLQAARIPIIKLTSDGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFAFYAYAFEPREKVVTFRRPDGYLTKQEKGWTKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity of Cid1 provides a basis for its distributive RNA terminal uridylyl transferase activity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords POLY(A) RNA POLYMERASE PROTEIN CID1
total genus 107
structure length 324
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ud4A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ud4A02
4Z6FA 5DBCA 5J0YA 4UB2A 4DOBA 4I28A 4K4GA 4MFCA 4TUSA 4Z6DA 1MIYA 4UD4A 7ICNA 1TV9A 2M2VA 4LZDA 2ZHAA 4EBJA 5HRGA 5DDMA 4E8FA 4WC2A 4YMOA 2ZH1A 1FA0A 4WC1A 4AT7B 1BPEA 2DRAA 2O5AA 3OVSA 4AT8B 4PHEA 4GXKA 4IQWA 1XSPA 8ICCA 3AQKA 1BPZA 4GXJA 2RFFA 3MDAA 4P4PA 4XQ8A 8ICVA 3WFSC 7ICKA 4QZAA 4P4MA 4RQ1A 1MIWA 4WCWA 9ICHA 4I2BA 3AQNA 8ICOA 4P2HA 4RWOA 4LZGA 4FO6A 3HWTA 4UAWA 4F5OA 7ICLA 4KLEA 2ID1A 1ZQGA 9ICRA 4TUQA 4IG8A 4KLHA 4KLQA 5DB7A 2M2TA 4X4SA 4RQ7A 1JAJA 4M9LA 4X0AA 5J0RA 3V7LA 3LK9A 1XSLA 3RJKA 2Q66A 5HRFA 5CA7A 8ICTA 3C2MA 4RT3A 5CHGA 5DB6A 2BCUA 5J2CA 1TVAA 2P66A 2ZH8A 3AUOA 1RPLA 1Q78A 3GDXA 4RQ5A 9ICNA 4YD1A 5CB1A 3WFQE 4XUSA 8ICYA 3OUYA 5DBBA 5HRDA 4QZHA 3ISDA 4PGQA 4NM1A 4NKUA 4S3NA 4KLOA 4I29A 1ZQKA 4KLDA 3WFRE 8ICQA 4I2IA 4K4IA 7ICMA 5HR9A 2BPGA 9ICLA 5F2VO 8ICBA 4RQ3A 5BOLA 4QZ8A 3OUYB 2BCQA 7ICEA 5J0OA 9ICBA 4WC4A 2BCSA 3LQCB 5J0UA 5J2GA 4RQ6A 2FMQA 4AT8A 7ICRA 1R8AA 1ZQVA 4YMNA 4R66A 3PMLA 4UB5A 2PFQA 2FMPA 9ICAA 1ZQHA 3TFRA 3RJHA 3AU2A 3K75D 5HRLA 4F5NA 5J2KA 4IQTA 3RJFA 1ZQYA 1RZTA 8ICPA 8ICUA 4M5DA 4RQ0A 4AT7A 5CWRA 4O5CA 4KLUA 4RWNA 3RJIA 4M9NA 9ICMA 4XQ7A 2ZH7A 4WC0A 4RWPA 4UB1A 4JWMA 5HRHA 2B51A 4I2JA 4R63A 2FMSA 7ICJA 2DRBA 4UD5A 4KLFA 5HREA 3JPOA 4M0AA 3AU6A 1NO5A 4RPYA 3PNCA 2GWSA 4LT6A 4TUPA 4KLJA 5D46A 4XRHA 5HHIA 1ZQBA 7ICFA 4YN4A 4I2GA 2BE3A 3UXNA 4QZBA 9ICTA 5HRBA 4NLZA 2B56A 4I2CA 1NOMA 3HJ1A 2W9MA 2PXIA 3WFOA 3UPQA 5IIKA 4P4OA 1OU5A 1HUZA 3H39A 5J2HA 4Z6CA 3RH5A 2IHMA 2VANA 3V72A 3UQ2A 4X4UA 5J2IA 1KNYA 1PX5A 4WC7A 3RJGA 4NY8A 4WC3A 3HJ4A 4O5EA 3JPPA 7ICGA 1R89A 4UBCA 4PPXA 4X4NA 4KLSA 4KLTA 9ICQA 2HHPA 2NRKA 4PHDA 1HUOA 3H38A 5D4BA 1ZQWA 8ICFA 4X5VA 8ICRA 3JYYA 1R8CA 2BCRA 3ISBA 4QZIA 5HC9A 5J2JA 4M9GA 8ICEA 1TFYA 8ICMA 8ICWA 4O5KA 1ZQLA 2BCVA 5CR0A 5J0QA 4IQVA 9ICPA 4QZDA 3MBYA 4NXZA 3C66A 1ZQQA 4R65A 4M2YA 4DOCA 3JPSA 7ICOA 4ATBA 9ICUA 1ZQFA 1JMSA 4M9HA 1ZQMA 3C5FA 5IIMA 4X4RA 4DO9A 9ICGA 1ZQCA 5J0TA 7ICSA 4M04A 7ICVA 4YMMA 2M2WA 3MGHA 4MF8A 7ICQA 4NM2A 4RT2A 4X4OA 1Q79A 2DR7A 1TFWA 1MQ3A 4F5RA 1UEUA 4RPXA 2DR5A 1V4AA 1KDHA 8ICNA 1ZQRA 3B0YA 4FHPA 8ICAA 4QZ9A 3C18A 3JZ0A 2I9GA 3C5GA 2ZH2A 5J29A 2ZH5A 4TURA 2ZH4A 4I2FA 4I2DA 4K4HA 1R8BA 3UPSA 1XSNA 5DDYA 5CJ7A 9ICCA 3HW8A 4QZCA 3H37A 4O9MA 5IIJA 4LVSA 4UB4A 4DOAA 4XA5A 4QZEA 2ISOA 5DKWA 3C2KA 4FHXA 4I2AA 2M2UA 5J0PA 4QZFA 2ZHBA 2DVIA 2ZH6A 4RWQA 5IINA 5DBAA 5D49A 2PFOA 8ICXA 4X4QA 5DEDA 1F5AA 4RPZA 9ICSA 9ICJA 4MFFA 9ICFA 4FH5A 5HRKA 4X4VA 5EOZA 5DB9A 3JPTA 3RH6A 4MF2A 8ICGA 4UAYA 1ZQAA 4NLNA 2PBEA 5TZVA 8ICZA 3JPQA 4FHVA 5HHHA 1ZQUA 4QZGA 2O1PA 4KLIA 8ICSA 1ZQEA 4PGXA 1ZQOA 4KLMA 3C2LA 1ZQZA 1ZQPA 7ICIA 1BPBA 7ICTA 4AT9B 1ZJNA 3OGUA 3RJJA 1KEJA 4F5QA 5J2FA 2PFPA 3PMNA 7ICUA 7ICPA 5CP2A 5J2BA 7ICHA 1UEVA 4E80A 5DB8A 4WC5A 4AT9A 3JPNA 1ZQXA 3V7KA 1ZJMA 2DR9A 1MIVA 4FHWA 2BPFA 4WBYA 3B0XA 4X4TA 4UBBA 3JPRA 4IQUA 2DR8A 4MFAA 4PHAA 4UB3A 3HX0A 4RQ4A 9ICVA 5IIIA 4YD2A 1ZQIA 3OV7A 4YCXA 5BOMA 5HRIA 4I2HA 3MGIA 3UQ0A 4PH5A 4I2EA 3HIYA 8ICKA 2ISPA 1ZQTA 4E7XA 4Z6EA 5IILA 3UXOA 1WOTA 2ZH9A 4FHYA 4F5PA 8ICLA 4PGYA 1ZQDA 5DECA 5J0XA 3OVBA 5J2AA 3RH4A 3AQLA 4FH3A 3H3AA 1UETA 4X0BA 9ICXA 3RJEA 4M9JA 9ICKA 4PHPA 4JWNA 4M47A 5J2DA 3TFSA 3OVAA 4NLKA 4KLGA 1VJ7A 4EBKA 4GXIA 2ZH3A 4WC6A 1MQ2A 1ZQJA 4ATBB 9ICEA 3L9DA 4WBZA 1BPDA 5J0SA 5IIOA 3ISCA 1VFGA 4KLLA 2BPCA 3WFPA 4RQ8A 1ZQNA 4I27A 4EP7A 1ZQSA 4R64A 1JQRA 1BPXA 1BPYA 8ICHA 4NKTA 1JN3A 3V7JA 9ICIA 4RQ2A 5J2EA 5J0WA 5BPCA 1YLQA 2PFNA 9ICOA 4X4PA 2B4VA 8ICJA 8ICIA 4UAZA 3NYBA 3MDCA 9ICWA 3UXPA 3AQMA
chains in the Genus database with same CATH superfamily
4Z6FA 5DBCA 5J0YA 4UB2A 4DOBA 4I28A 4K4GA 4MFCA 4TUSA 4Z6DA 1MIYA 4UD4A 3NVOA 7ICNA 1TV9A 2M2VA 4LZDA 4OAFA 2ZHAA 4EBJA 5HRGA 5DDMA 4E8FA 4WC2A 4WQKA 4YMOA 2ZH1A 1FA0A 4O68A 4EEDA 4WC1A 4AT7B 1BPEA 2DRAA 2O5AA 3OVSA 4LEZA 4AT8B 4PHEA 4GXKA 4IQWA 1XSPA 8ICCA 3AQKA 1BPZA 4GXJA 2RFFA 3MDAA 4P4PA 4XQ8A 8ICVA 3WFSC 7ICKA 4QZAA 4P4MA 4RQ1A 1MIWA 4WCWA 9ICHA 4I2BA 4LEVA 3AQNA 3ER8C 8ICOA 4P2HA 4RWOA 4LZGA 4FO6A 3HWTA 4UAWA 4KM5A 4F5OA 7ICLA 4KLEA 2ID1A 1ZQGA 4K96A 9ICRA 4TUQA 4IG8A 4KLHA 4KLQA 4LEYA 5DB7A 2M2TA 4OAGA 4X4SA 5B3PA 4RQ7A 1JAJA 4M9LA 4X0AA 5J0RA 3V7LA 3LK9A 1XSLA 3RJKA 2Q66A 5HRFA 5CA7A 8ICTA 3C2MA 4RT3A 5CHGA 5DB6A 2EWRA 3NKUA 2BCUA 5J2CA 1TVAA 2P66A 2ZH8A 3AUOA 1RPLA 1Q78A 3GDXA 4RQ5A 9ICNA 3EF2A 4YD1A 5CB1A 3WFQE 4XUSA 8ICYA 3OUYA 5DBBA 5HRDA 4QZHA 3ISDA 4PGQA 4NM1A 4NKUA 4S3NA 4KLOA 4I29A 1ZQKA 4KLDA 4XJEA 3WFRE 8ICQA 4I2IA 4K4IA 7ICMA 5HR9A 2BPGA 9ICLA 5F2VO 8ICBA 5CHEA 5BOLA 3OUYB 4QZ8A 4RQ3A 2BCQA 7ICEA 5J0OA 9ICBA 4WC4A 2BCSA 3LQCB 5J0UA 5J2GA 4RQ6A 3OWGA 2FMQA 4AT8A 3ERCC 7ICRA 1R8AA 1ZQVA 4YMNA 4R66A 3PMLA 4UB5A 2PFQA 2FMPA 9ICAA 1ZQHA 3TFRA 3RJHA 3AU2A 3K75D 5HRLA 4F5NA 5J2KA 4IQTA 3RJFA 1ZQYA 1RZTA 8ICPA 5JTGA 8ICUA 4M5DA 4RQ0A 4N7RA 4AT7A 5CWRA 4RWNA 4O5CA 4KLUA 3RJIA 4M9NA 9ICMA 4XQ7A 2ZH7A 4RWPA 4WC0A 4UB1A 4JWMA 5HRHA 2B51A 4I2JA 4R63A 2FMSA 7ICJA 2DRBA 4UD5A 4KLFA 5HREA 3JPOA 4M0AA 4NXTA 3AU6A 1NO5A 4RPYA 3PNCA 2GWSA 4LT6A 4TUPA 4KLJA 5D46A 4XRHA 5HHIA 1ZQBA 7ICFA 4YN4A 4I2GA 2BE3A 3UXNA 4QZBA 9ICTA 5HRBA 4NLZA 2B56A 4I2CA 1NOMA 3HJ1A 2W9MA 2PXIA 1GPJA 3WFOA 3UPQA 5IIKA 4P4OA 1OU5A 4K98A 1HUZA 3H39A 5B3QA 5J2HA 4Z6CA 3RH5A 4NXXA 2HN2A 4FO1A 2IHMA 2VANA 4X4UA 3UQ2A 3V72A 4O67A 5J2IA 4EGWA 4I0UA 1KNYA 1PX5A 4WC7A 3RJGA 4NY8A 4WC3A 3HJ4A 4O5EA 3JPPA 3ER9B 7ICGA 1R89A 4UBCA 4PPXA 4X4NA 4KLSA 4KLTA 5CFUA 9ICQA 2HHPA 2NRKA 4PHDA 1HUOA 3H38A 5D4BA 1ZQWA 2IHOA 8ICFA 4X5VA 8ICRA 3JYYA 4LEWA 1R8CA 2BCRA 3ISBA 4QZIA 5HC9A 5J2JA 4OAIZ 1TFYA 4M9GA 8ICEA 8ICMA 8ICWA 4O5KA 1ZQLA 2BCVA 5CR0A 5J0QA 4IQVA 9ICPA 4QZDA 3MBYA 4NXZA 3C66A 1ZQQA 4R65A 4M2YA 4DOCA 3JPSA 7ICOA 4ATBA 2GAFD 1ZQFA 9ICUA 1JMSA 4M9HA 1ZQMA 3C5FA 5IIMA 4X4RA 4DO9A 9ICGA 1ZQCA 4KB6A 5J0TA 7ICSA 4M04A 7ICVA 4YMMA 2M2WA 3MGHA 4MF8A 7ICQA 4NM2A 4RT2A 4X4OA 1Q79A 2DR7A 1TFWA 2HN1A 1MQ3A 4F5RA 1UEUA 2DR5A 4RPXA 3K7DA 1V4AA 1KDHA 8ICNA 1ZQRA 3B0YA 4HX0A 4FHPA 8ICAA 4QZ9A 3C18A 3JZ0A 2I9GA 3C5GA 2ZH2A 5J29A 2ZH5A 2BBJA 4TURA 2ZH4A 4I2FA 4I2DA 4K4HA 1R8BA 3UPSA 1XSNA 5DDYA 5CJ7A 9ICCA 3HW8A 4QZCA 3H37A 2GA9D 5IIJA 4O9MA 4K8VA 4LVSA 4UB4A 4DOAA 4XA5A 4QZEA 3NWIA 2ISOA 5DKWA 3C2KA 4FHXA 4I2AA 2M2UA 5J0PA 4QZFA 2ZHBA 2DVIA 2ZH6A 4RWQA 5IINA 5DBAA 5D49A 2PFOA 8ICXA 4X4QA 5DEDA 1F5AA 4RPZA 9ICSA 9ICJA 4MFFA 9ICFA 4FH5A 5HRKA 4X4VA 5EOZA 5DB9A 3JPTA 3RH6A 4MF2A 8ICGA 4UAYA 1ZQAA 5D63A 4NLNA 2PBEA 5TZVA 8ICZA 4MKPA 3PHZA 3JPQA 4FHVA 5HHHA 1ZQUA 4QZGA 2O1PA 4KLIA 8ICSA 1ZQEA 5CFSA 2BBHA 4PGXA 1ZQOA 4KLMA 3C2LA 4EEBA 2FCLA 1ZQZA 1ZQPA 7ICIA 1BPBA 7ICTA 5D62A 4AT9B 1ZJNA 4K97A 3OGUA 3RJJA 1KEJA 4F5QA 5J2FA 2PFPA 3PMNA 7ICUA 7ICPA 5CP2A 4K9BA 5J2BA 7ICHA 1UEVA 4E80A 5DB8A 4WC5A 4AT9A 3JPNA 1ZQXA 3V7KA 1ZJMA 2DR9A 1MIVA 4FHWA 2BPFA 4WBYA 3B0XA 4X4TA 4UBBA 4O6AA 3JPRA 4IQUA 2DR8A 4MFAA 4JLZA 4PHAA 5D61A 4UB3A 3CK6A 3HX0A 4RQ4A 9ICVA 5IIIA 4YD2A 1ZQIA 3OV7A 4YCXA 5BOMA 5HRIA 4I2HA 3MGIA 3UQ0A 4PH5A 4I2EA 3HIYA 8ICKA 2ISPA 4EV6A 1ZQTA 3JCFA 4E7XA 4Z6EA 5IILA 3UXOA 4K9AA 3MCRA 1WOTA 2ZH9A 4FHYA 4F5PA 8ICLA 3OVBA 4PGYA 5DECA 5J0XA 1ZQDA 5J2AA 3RH4A 4FH3A 3AQLA 3H3AA 1UETA 4WOYA 4X0BA 9ICXA 3RJEA 4M9JA 9ICKA 4PHPA 4JWNA 4M47A 5J2DA 3TFSA 4O69A 3OVAA 4NLKA 4KLGA 1VJ7A 4EBKA 4GXIA 4NXUA 2ZH3A 4WC6A 4NXWA 1MQ2A 1ZQJA 4ATBB 9ICEA 3L9DA 4WBZA 1BPDA 5J0SA 5IIOA 3ISCA 4JLXA 1VFGA 4WQLA 4KLLA 2BPCA 3WFPA 4RQ8A 1ZQNA 4I27A 4EP7A 1ZQSA 4R64A 1JQRA 1BPXA 2IUBA 4NXVA 4NKTA 1BPYA 8ICHA 4K99A 1JN3A 3V7JA 9ICIA 4RQ2A 5J2EA 5J0WA 5BPCA 1YLQA 4OAHA 2PFNA 9ICOA 4X4PA 2B4VA 8ICJA 8ICIA 4UAZA 3NYBA 4WH5A 3MDCA 9ICWA 5CFTA 3UXPA 3AQMA
chains in the Genus database with same CATH topology
4Z6FA 5DBCA 5J0YA 4UB2A 4DOBA 4I28A 4K4GA 4MFCA 4TUSA 4Z6DA 1MIYA 4UD4A 7ICNA 1TV9A 2M2VA 4LZDA 4OAFA 2ZHAA 4EBJA 5HRGA 5DDMA 4E8FA 4WC2A 4YMOA 2ZH1A 1FA0A 4O68A 4WC1A 4AT7B 1BPEA 2DRAA 2O5AA 3OVSA 4LEZA 4AT8B 4PHEA 4GXKA 4IQWA 1XSPA 8ICCA 3AQKA 1BPZA 4GXJA 2RFFA 3MDAA 4P4PA 4XQ8A 8ICVA 3WFSC 7ICKA 4QZAA 4P4MA 4RQ1A 1MIWA 4WCWA 9ICHA 4I2BA 4LEVA 3AQNA 8ICOA 4P2HA 4RWOA 4LZGA 4FO6A 3HWTA 4UAWA 4KM5A 4F5OA 7ICLA 4KLEA 2ID1A 1ZQGA 4K96A 9ICRA 4TUQA 4IG8A 4KLHA 4KLQA 4LEYA 5DB7A 2M2TA 4OAGA 4X4SA 4RQ7A 1JAJA 4M9LA 4X0AA 5J0RA 3V7LA 3LK9A 1XSLA 3RJKA 2Q66A 5HRFA 5CA7A 8ICTA 3C2MA 4RT3A 5CHGA 5DB6A 2BCUA 5J2CA 1TVAA 2P66A 2ZH8A 3AUOA 1RPLA 1Q78A 3GDXA 4RQ5A 9ICNA 4YD1A 5CB1A 3WFQE 4XUSA 8ICYA 3OUYA 5DBBA 5HRDA 4QZHA 3ISDA 4PGQA 4NM1A 4NKUA 4S3NA 4KLOA 4I29A 1ZQKA 4KLDA 3WFRE 8ICQA 4I2IA 4K4IA 7ICMA 5HR9A 2BPGA 9ICLA 5F2VO 8ICBA 4RQ3A 3OUYB 4QZ8A 5BOLA 2BCQA 7ICEA 5J0OA 9ICBA 4WC4A 2BCSA 3LQCB 5J0UA 5J2GA 4RQ6A 2FMQA 4AT8A 7ICRA 1R8AA 1ZQVA 4YMNA 4R66A 3PMLA 4UB5A 2PFQA 2FMPA 9ICAA 1ZQHA 3TFRA 3RJHA 3AU2A 3K75D 5HRLA 4F5NA 5J2KA 4IQTA 3RJFA 1ZQYA 1RZTA 8ICPA 8ICUA 4M5DA 4RQ0A 4AT7A 5CWRA 4O5CA 4KLUA 4RWNA 3RJIA 4M9NA 9ICMA 4XQ7A 2ZH7A 4WC0A 4RWPA 4UB1A 4JWMA 5HRHA 2B51A 4I2JA 4R63A 2FMSA 7ICJA 2DRBA 4UD5A 4KLFA 5HREA 3JPOA 4M0AA 4NXTA 3AU6A 1NO5A 4RPYA 3PNCA 2GWSA 4LT6A 4TUPA 4KLJA 5D46A 4XRHA 5HHIA 1ZQBA 7ICFA 4YN4A 4I2GA 2BE3A 3UXNA 4QZBA 9ICTA 5HRBA 4NLZA 2B56A 4I2CA 1NOMA 3HJ1A 2W9MA 2PXIA 3WFOA 3UPQA 5IIKA 4P4OA 1OU5A 4K98A 1HUZA 3H39A 5J2HA 4Z6CA 3RH5A 4NXXA 2IHMA 2VANA 4X4UA 3UQ2A 3V72A 4O67A 5J2IA 1KNYA 1PX5A 4WC7A 3RJGA 4NY8A 4WC3A 3HJ4A 4O5EA 3JPPA 7ICGA 1R89A 4UBCA 4PPXA 4X4NA 4KLSA 4KLTA 9ICQA 2HHPA 2NRKA 4PHDA 1HUOA 3H38A 5D4BA 1ZQWA 8ICFA 4X5VA 8ICRA 3JYYA 4LEWA 1R8CA 2BCRA 3ISBA 4QZIA 5HC9A 5J2JA 4OAIZ 1TFYA 4M9GA 8ICEA 8ICMA 8ICWA 4O5KA 1ZQLA 2BCVA 5CR0A 5J0QA 4IQVA 9ICPA 4QZDA 3MBYA 4NXZA 3C66A 1ZQQA 4R65A 4M2YA 4DOCA 3JPSA 7ICOA 4ATBA 9ICUA 1ZQFA 1JMSA 4M9HA 1ZQMA 3C5FA 5IIMA 4X4RA 4DO9A 9ICGA 1ZQCA 4KB6A 5J0TA 7ICSA 4M04A 7ICVA 4YMMA 2M2WA 3MGHA 4MF8A 7ICQA 4NM2A 4RT2A 4X4OA 1Q79A 2DR7A 1TFWA 1MQ3A 4F5RA 1UEUA 2DR5A 4RPXA 1V4AA 1KDHA 8ICNA 1ZQRA 3B0YA 4FHPA 8ICAA 4QZ9A 3C18A 3JZ0A 2I9GA 3C5GA 2ZH2A 5J29A 2ZH5A 4TURA 2ZH4A 4I2FA 4I2DA 4K4HA 1R8BA 3UPSA 1XSNA 5DDYA 5CJ7A 9ICCA 3HW8A 4QZCA 3H37A 4O9MA 5IIJA 4K8VA 4LVSA 4UB4A 4DOAA 4XA5A 4QZEA 2ISOA 5DKWA 3C2KA 4FHXA 4I2AA 2M2UA 5J0PA 4QZFA 2ZHBA 2DVIA 2ZH6A 4RWQA 5IINA 5DBAA 5D49A 2PFOA 8ICXA 4X4QA 5DEDA 1F5AA 4RPZA 9ICSA 9ICJA 4MFFA 9ICFA 4FH5A 5HRKA 4X4VA 5EOZA 5DB9A 3JPTA 3RH6A 4MF2A 8ICGA 4UAYA 1ZQAA 4NLNA 2PBEA 5TZVA 8ICZA 4MKPA 3JPQA 4FHVA 5HHHA 1ZQUA 4QZGA 2O1PA 4KLIA 8ICSA 1ZQEA 4PGXA 1ZQOA 4KLMA 3C2LA 1ZQZA 1ZQPA 7ICIA 1BPBA 7ICTA 4AT9B 1ZJNA 4K97A 3OGUA 3RJJA 1KEJA 4F5QA 5J2FA 2PFPA 3PMNA 7ICUA 7ICPA 5CP2A 4K9BA 5J2BA 7ICHA 1UEVA 4E80A 5DB8A 4WC5A 4AT9A 3JPNA 1ZQXA 3V7KA 1ZJMA 2DR9A 1MIVA 4FHWA 2BPFA 4WBYA 3B0XA 4X4TA 4UBBA 4O6AA 3JPRA 4IQUA 2DR8A 4MFAA 4JLZA 4PHAA 4UB3A 3HX0A 4RQ4A 9ICVA 5IIIA 4YD2A 1ZQIA 3OV7A 4YCXA 5BOMA 5HRIA 4I2HA 3MGIA 3UQ0A 4PH5A 4I2EA 3HIYA 8ICKA 2ISPA 1ZQTA 4E7XA 4Z6EA 5IILA 3UXOA 4K9AA 1WOTA 2ZH9A 4FHYA 4F5PA 8ICLA 3OVBA 4PGYA 5DECA 5J0XA 1ZQDA 5J2AA 3RH4A 4FH3A 3AQLA 3H3AA 1UETA 4WOYA 4X0BA 9ICXA 3RJEA 4M9JA 9ICKA 4PHPA 4JWNA 4M47A 5J2DA 3TFSA 4O69A 3OVAA 4NLKA 4KLGA 1VJ7A 4EBKA 4GXIA 4NXUA 2ZH3A 4WC6A 4NXWA 1MQ2A 1ZQJA 4ATBB 9ICEA 3L9DA 4WBZA 1BPDA 5J0SA 5IIOA 3ISCA 4JLXA 1VFGA 4KLLA 2BPCA 3WFPA 4RQ8A 1ZQNA 4I27A 4EP7A 1ZQSA 4R64A 1JQRA 1BPXA 1BPYA 4NXVA 4NKTA 8ICHA 4K99A 1JN3A 3V7JA 9ICIA 4RQ2A 5J2EA 5J0WA 5BPCA 1YLQA 4OAHA 2PFNA 9ICOA 4X4PA 2B4VA 8ICJA 8ICIA 4UAZA 3NYBA 3MDCA 9ICWA 3UXPA 3AQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6F A;  5DBC A;  5J0Y A;  4UB2 A;  4DOB A;  4I28 A;  4K4G A;  4MFC A;  4TUS A;  4Z6D A;  1MIY A;  4UD4 A;  7ICN A;  1TV9 A;  2M2V A;  4LZD A;  2ZHA A;  4EBJ A;  5HRG A;  5DDM A;  4E8F A;  4WC2 A;  4YMO A;  2ZH1 A;  1FA0 A;  4WC1 A;  4AT7 B;  1BPE A;  2DRA A;  2O5A A;  3OVS A;  4AT8 B;  4PHE A;  4GXK A;  4IQW A;  1XSP A;  8ICC A;  3AQK A;  1BPZ A;  4GXJ A;  2RFF A;  3MDA A;  4P4P A;  4XQ8 A;  8ICV A;  3WFS C;  7ICK A;  4QZA A;  4P4M A;  4RQ1 A;  1MIW A;  4WCW A;  9ICH A;  4I2B A;  3AQN A;  8ICO A;  4P2H A;  4RWO A;  4LZG A;  4FO6 A;  3HWT A;  4UAW A;  4F5O A;  7ICL A;  4KLE A;  2ID1 A;  1ZQG A;  9ICR A;  4TUQ A;  4IG8 A;  4KLH A;  4KLQ A;  5DB7 A;  2M2T A;  4X4S A;  4RQ7 A;  1JAJ A;  4M9L A;  4X0A A;  5J0R A;  3V7L A;  3LK9 A;  1XSL A;  3RJK A;  2Q66 A;  5HRF A;  5CA7 A;  8ICT A;  3C2M A;  4RT3 A;  5CHG A;  5DB6 A;  2BCU A;  5J2C A;  1TVA A;  2P66 A;  2ZH8 A;  3AUO A;  1RPL A;  1Q78 A;  3GDX A;  4RQ5 A;  9ICN A;  4YD1 A;  5CB1 A;  3WFQ E;  4XUS A;  8ICY A;  3OUY A;  5DBB A;  5HRD A;  4QZH A;  3ISD A;  4PGQ A;  4NM1 A;  4NKU A;  4S3N A;  4KLO A;  4I29 A;  1ZQK A;  4KLD A;  3WFR E;  8ICQ A;  4I2I A;  4K4I A;  7ICM A;  5HR9 A;  2BPG A;  9ICL A;  5F2V O;  8ICB A;  4RQ3 A;  5BOL A;  4QZ8 A;  3OUY B;  2BCQ A;  7ICE A;  5J0O A;  9ICB A;  4WC4 A;  2BCS A;  3LQC B;  5J0U A;  5J2G A;  4RQ6 A;  2FMQ A;  4AT8 A;  7ICR A;  1R8A A;  1ZQV A;  4YMN A;  4R66 A;  3PML A;  4UB5 A;  2PFQ A;  2FMP A;  9ICA A;  1ZQH A;  3TFR A;  3RJH A;  3AU2 A;  3K75 D;  5HRL A;  4F5N A;  5J2K A;  4IQT A;  3RJF A;  1ZQY A;  1RZT A;  8ICP A;  8ICU A;  4M5D A;  4RQ0 A;  4AT7 A;  5CWR A;  4O5C A;  4KLU A;  4RWN A;  3RJI A;  4M9N A;  9ICM A;  4XQ7 A;  2ZH7 A;  4WC0 A;  4RWP A;  4UB1 A;  4JWM A;  5HRH A;  2B51 A;  4I2J A;  4R63 A;  2FMS A;  7ICJ A;  2DRB A;  4UD5 A;  4KLF A;  5HRE A;  3JPO A;  4M0A A;  3AU6 A;  1NO5 A;  4RPY A;  3PNC A;  2GWS A;  4LT6 A;  4TUP A;  4KLJ A;  5D46 A;  4XRH A;  5HHI A;  1ZQB A;  7ICF A;  4YN4 A;  4I2G A;  2BE3 A;  3UXN A;  4QZB A;  9ICT A;  5HRB A;  4NLZ A;  2B56 A;  4I2C A;  1NOM A;  3HJ1 A;  2W9M A;  2PXI A;  3WFO A;  3UPQ A;  5IIK A;  4P4O A;  1OU5 A;  1HUZ A;  3H39 A;  5J2H A;  4Z6C A;  3RH5 A;  2IHM A;  2VAN A;  3V72 A;  3UQ2 A;  4X4U A;  5J2I A;  1KNY A;  1PX5 A;  4WC7 A;  3RJG A;  4NY8 A;  4WC3 A;  3HJ4 A;  4O5E A;  3JPP A;  7ICG A;  1R89 A;  4UBC A;  4PPX A;  4X4N A;  4KLS A;  4KLT A;  9ICQ A;  2HHP A;  2NRK A;  4PHD A;  1HUO A;  3H38 A;  5D4B A;  1ZQW A;  8ICF A;  4X5V A;  8ICR A;  3JYY A;  1R8C A;  2BCR A;  3ISB A;  4QZI A;  5HC9 A;  5J2J A;  4M9G A;  8ICE A;  1TFY A;  8ICM A;  8ICW A;  4O5K A;  1ZQL A;  2BCV A;  5CR0 A;  5J0Q A;  4IQV A;  9ICP A;  4QZD A;  3MBY A;  4NXZ A;  3C66 A;  1ZQQ A;  4R65 A;  4M2Y A;  4DOC A;  3JPS A;  7ICO A;  4ATB A;  9ICU A;  1ZQF A;  1JMS A;  4M9H A;  1ZQM A;  3C5F A;  5IIM A;  4X4R A;  4DO9 A;  9ICG A;  1ZQC A;  5J0T A;  7ICS A;  4M04 A;  7ICV A;  4YMM A;  2M2W A;  3MGH A;  4MF8 A;  7ICQ A;  4NM2 A;  4RT2 A;  4X4O A;  1Q79 A;  2DR7 A;  1TFW A;  1MQ3 A;  4F5R A;  1UEU A;  4RPX A;  2DR5 A;  1V4A A;  1KDH A;  8ICN A;  1ZQR A;  3B0Y A;  4FHP A;  8ICA A;  4QZ9 A;  3C18 A;  3JZ0 A;  2I9G A;  3C5G A;  2ZH2 A;  5J29 A;  2ZH5 A;  4TUR A;  2ZH4 A;  4I2F A;  4I2D A;  4K4H A;  1R8B A;  3UPS A;  1XSN A;  5DDY A;  5CJ7 A;  9ICC A;  3HW8 A;  4QZC A;  3H37 A;  4O9M A;  5IIJ A;  4LVS A;  4UB4 A;  4DOA A;  4XA5 A;  4QZE A;  2ISO A;  5DKW A;  3C2K A;  4FHX A;  4I2A A;  2M2U A;  5J0P A;  4QZF A;  2ZHB A;  2DVI A;  2ZH6 A;  4RWQ A;  5IIN A;  5DBA A;  5D49 A;  2PFO A;  8ICX A;  4X4Q A;  5DED A;  1F5A A;  4RPZ A;  9ICS A;  9ICJ A;  4MFF A;  9ICF A;  4FH5 A;  5HRK A;  4X4V A;  5EOZ A;  5DB9 A;  3JPT A;  3RH6 A;  4MF2 A;  8ICG A;  4UAY A;  1ZQA A;  4NLN A;  2PBE A;  5TZV A;  8ICZ A;  3JPQ A;  4FHV A;  5HHH A;  1ZQU A;  4QZG A;  2O1P A;  4KLI A;  8ICS A;  1ZQE A;  4PGX A;  1ZQO A;  4KLM A;  3C2L A;  1ZQZ A;  1ZQP A;  7ICI A;  1BPB A;  7ICT A;  4AT9 B;  1ZJN A;  3OGU A;  3RJJ A;  1KEJ A;  4F5Q A;  5J2F A;  2PFP A;  3PMN A;  7ICU A;  7ICP A;  5CP2 A;  5J2B A;  7ICH A;  1UEV A;  4E80 A;  5DB8 A;  4WC5 A;  4AT9 A;  3JPN A;  1ZQX A;  3V7K A;  1ZJM A;  2DR9 A;  1MIV A;  4FHW A;  2BPF A;  4WBY A;  3B0X A;  4X4T A;  4UBB A;  3JPR A;  4IQU A;  2DR8 A;  4MFA A;  4PHA A;  4UB3 A;  3HX0 A;  4RQ4 A;  9ICV A;  5III A;  4YD2 A;  1ZQI A;  3OV7 A;  4YCX A;  5BOM A;  5HRI A;  4I2H A;  3MGI A;  3UQ0 A;  4PH5 A;  4I2E A;  3HIY A;  8ICK A;  2ISP A;  1ZQT A;  4E7X A;  4Z6E A;  5IIL A;  3UXO A;  1WOT A;  2ZH9 A;  4FHY A;  4F5P A;  8ICL A;  4PGY A;  1ZQD A;  5DEC A;  5J0X A;  3OVB A;  5J2A A;  3RH4 A;  3AQL A;  4FH3 A;  3H3A A;  1UET A;  4X0B A;  9ICX A;  3RJE A;  4M9J A;  9ICK A;  4PHP A;  4JWN A;  4M47 A;  5J2D A;  3TFS A;  3OVA A;  4NLK A;  4KLG A;  1VJ7 A;  4EBK A;  4GXI A;  2ZH3 A;  4WC6 A;  1MQ2 A;  1ZQJ A;  4ATB B;  9ICE A;  3L9D A;  4WBZ A;  1BPD A;  5J0S A;  5IIO A;  3ISC A;  1VFG A;  4KLL A;  2BPC A;  3WFP A;  4RQ8 A;  1ZQN A;  4I27 A;  4EP7 A;  1ZQS A;  4R64 A;  1JQR A;  1BPX A;  1BPY A;  8ICH A;  4NKT A;  1JN3 A;  3V7J A;  9ICI A;  4RQ2 A;  5J2E A;  5J0W A;  5BPC A;  1YLQ A;  2PFN A;  9ICO A;  4X4P A;  2B4V A;  8ICJ A;  8ICI A;  4UAZ A;  3NYB A;  3MDC A;  9ICW A;  3UXP A;  3AQM A; 
#chains in the Genus database with same CATH topology
 4Z6F A;  5DBC A;  5J0Y A;  4UB2 A;  4DOB A;  4I28 A;  4K4G A;  4MFC A;  4TUS A;  4Z6D A;  1MIY A;  4UD4 A;  3NVO A;  7ICN A;  1TV9 A;  2M2V A;  4LZD A;  4OAF A;  2ZHA A;  4EBJ A;  5HRG A;  5DDM A;  4E8F A;  4WC2 A;  4WQK A;  4YMO A;  2ZH1 A;  1FA0 A;  4O68 A;  4EED A;  4WC1 A;  4AT7 B;  1BPE A;  2DRA A;  2O5A A;  3OVS A;  4LEZ A;  4AT8 B;  4PHE A;  4GXK A;  4IQW A;  1XSP A;  8ICC A;  3AQK A;  1BPZ A;  4GXJ A;  2RFF A;  3MDA A;  4P4P A;  4XQ8 A;  8ICV A;  3WFS C;  7ICK A;  4QZA A;  4P4M A;  4RQ1 A;  1MIW A;  4WCW A;  9ICH A;  4I2B A;  4LEV A;  3AQN A;  3ER8 C;  8ICO A;  4P2H A;  4RWO A;  4LZG A;  4FO6 A;  3HWT A;  4UAW A;  4KM5 A;  4F5O A;  7ICL A;  4KLE A;  2ID1 A;  1ZQG A;  4K96 A;  9ICR A;  4TUQ A;  4IG8 A;  4KLH A;  4KLQ A;  4LEY A;  5DB7 A;  2M2T A;  4OAG A;  4X4S A;  5B3P A;  4RQ7 A;  1JAJ A;  4M9L A;  4X0A A;  5J0R A;  3V7L A;  3LK9 A;  1XSL A;  3RJK A;  2Q66 A;  5HRF A;  5CA7 A;  8ICT A;  3C2M A;  4RT3 A;  5CHG A;  5DB6 A;  2EWR A;  3NKU A;  2BCU A;  5J2C A;  1TVA A;  2P66 A;  2ZH8 A;  3AUO A;  1RPL A;  1Q78 A;  3GDX A;  4RQ5 A;  9ICN A;  3EF2 A;  4YD1 A;  5CB1 A;  3WFQ E;  4XUS A;  8ICY A;  3OUY A;  5DBB A;  5HRD A;  4QZH A;  3ISD A;  4PGQ A;  4NM1 A;  4NKU A;  4S3N A;  4KLO A;  4I29 A;  1ZQK A;  4KLD A;  4XJE A;  3WFR E;  8ICQ A;  4I2I A;  4K4I A;  7ICM A;  5HR9 A;  2BPG A;  9ICL A;  5F2V O;  8ICB A;  5CHE A;  5BOL A;  3OUY B;  4QZ8 A;  4RQ3 A;  2BCQ A;  7ICE A;  5J0O A;  9ICB A;  4WC4 A;  2BCS A;  3LQC B;  5J0U A;  5J2G A;  4RQ6 A;  3OWG A;  2FMQ A;  4AT8 A;  3ERC C;  7ICR A;  1R8A A;  1ZQV A;  4YMN A;  4R66 A;  3PML A;  4UB5 A;  2PFQ A;  2FMP A;  9ICA A;  1ZQH A;  3TFR A;  3RJH A;  3AU2 A;  3K75 D;  5HRL A;  4F5N A;  5J2K A;  4IQT A;  3RJF A;  1ZQY A;  1RZT A;  8ICP A;  5JTG A;  8ICU A;  4M5D A;  4RQ0 A;  4N7R A;  4AT7 A;  5CWR A;  4RWN A;  4O5C A;  4KLU A;  3RJI A;  4M9N A;  9ICM A;  4XQ7 A;  2ZH7 A;  4RWP A;  4WC0 A;  4UB1 A;  4JWM A;  5HRH A;  2B51 A;  4I2J A;  4R63 A;  2FMS A;  7ICJ A;  2DRB A;  4UD5 A;  4KLF A;  5HRE A;  3JPO A;  4M0A A;  4NXT A;  3AU6 A;  1NO5 A;  4RPY A;  3PNC A;  2GWS A;  4LT6 A;  4TUP A;  4KLJ A;  5D46 A;  4XRH A;  5HHI A;  1ZQB A;  7ICF A;  4YN4 A;  4I2G A;  2BE3 A;  3UXN A;  4QZB A;  9ICT A;  5HRB A;  4NLZ A;  2B56 A;  4I2C A;  1NOM A;  3HJ1 A;  2W9M A;  2PXI A;  1GPJ A;  3WFO A;  3UPQ A;  5IIK A;  4P4O A;  1OU5 A;  4K98 A;  1HUZ A;  3H39 A;  5B3Q A;  5J2H A;  4Z6C A;  3RH5 A;  4NXX A;  2HN2 A;  4FO1 A;  2IHM A;  2VAN A;  4X4U A;  3UQ2 A;  3V72 A;  4O67 A;  5J2I A;  4EGW A;  4I0U A;  1KNY A;  1PX5 A;  4WC7 A;  3RJG A;  4NY8 A;  4WC3 A;  3HJ4 A;  4O5E A;  3JPP A;  3ER9 B;  7ICG A;  1R89 A;  4UBC A;  4PPX A;  4X4N A;  4KLS A;  4KLT A;  5CFU A;  9ICQ A;  2HHP A;  2NRK A;  4PHD A;  1HUO A;  3H38 A;  5D4B A;  1ZQW A;  2IHO A;  8ICF A;  4X5V A;  8ICR A;  3JYY A;  4LEW A;  1R8C A;  2BCR A;  3ISB A;  4QZI A;  5HC9 A;  5J2J A;  4OAI Z;  1TFY A;  4M9G A;  8ICE A;  8ICM A;  8ICW A;  4O5K A;  1ZQL A;  2BCV A;  5CR0 A;  5J0Q A;  4IQV A;  9ICP A;  4QZD A;  3MBY A;  4NXZ A;  3C66 A;  1ZQQ A;  4R65 A;  4M2Y A;  4DOC A;  3JPS A;  7ICO A;  4ATB A;  2GAF D;  1ZQF A;  9ICU A;  1JMS A;  4M9H A;  1ZQM A;  3C5F A;  5IIM A;  4X4R A;  4DO9 A;  9ICG A;  1ZQC A;  4KB6 A;  5J0T A;  7ICS A;  4M04 A;  7ICV A;  4YMM A;  2M2W A;  3MGH A;  4MF8 A;  7ICQ A;  4NM2 A;  4RT2 A;  4X4O A;  1Q79 A;  2DR7 A;  1TFW A;  2HN1 A;  1MQ3 A;  4F5R A;  1UEU A;  2DR5 A;  4RPX A;  3K7D A;  1V4A A;  1KDH A;  8ICN A;  1ZQR A;  3B0Y A;  4HX0 A;  4FHP A;  8ICA A;  4QZ9 A;  3C18 A;  3JZ0 A;  2I9G A;  3C5G A;  2ZH2 A;  5J29 A;  2ZH5 A;  2BBJ A;  4TUR A;  2ZH4 A;  4I2F A;  4I2D A;  4K4H A;  1R8B A;  3UPS A;  1XSN A;  5DDY A;  5CJ7 A;  9ICC A;  3HW8 A;  4QZC A;  3H37 A;  2GA9 D;  5IIJ A;  4O9M A;  4K8V A;  4LVS A;  4UB4 A;  4DOA A;  4XA5 A;  4QZE A;  3NWI A;  2ISO A;  5DKW A;  3C2K A;  4FHX A;  4I2A A;  2M2U A;  5J0P A;  4QZF A;  2ZHB A;  2DVI A;  2ZH6 A;  4RWQ A;  5IIN A;  5DBA A;  5D49 A;  2PFO A;  8ICX A;  4X4Q A;  5DED A;  1F5A A;  4RPZ A;  9ICS A;  9ICJ A;  4MFF A;  9ICF A;  4FH5 A;  5HRK A;  4X4V A;  5EOZ A;  5DB9 A;  3JPT A;  3RH6 A;  4MF2 A;  8ICG A;  4UAY A;  1ZQA A;  5D63 A;  4NLN A;  2PBE A;  5TZV A;  8ICZ A;  4MKP A;  3PHZ A;  3JPQ A;  4FHV A;  5HHH A;  1ZQU A;  4QZG A;  2O1P A;  4KLI A;  8ICS A;  1ZQE A;  5CFS A;  2BBH A;  4PGX A;  1ZQO A;  4KLM A;  3C2L A;  4EEB A;  2FCL A;  1ZQZ A;  1ZQP A;  7ICI A;  1BPB A;  7ICT A;  5D62 A;  4AT9 B;  1ZJN A;  4K97 A;  3OGU A;  3RJJ A;  1KEJ A;  4F5Q A;  5J2F A;  2PFP A;  3PMN A;  7ICU A;  7ICP A;  5CP2 A;  4K9B A;  5J2B A;  7ICH A;  1UEV A;  4E80 A;  5DB8 A;  4WC5 A;  4AT9 A;  3JPN A;  1ZQX A;  3V7K A;  1ZJM A;  2DR9 A;  1MIV A;  4FHW A;  2BPF A;  4WBY A;  3B0X A;  4X4T A;  4UBB A;  4O6A A;  3JPR A;  4IQU A;  2DR8 A;  4MFA A;  4JLZ A;  4PHA A;  5D61 A;  4UB3 A;  3CK6 A;  3HX0 A;  4RQ4 A;  9ICV A;  5III A;  4YD2 A;  1ZQI A;  3OV7 A;  4YCX A;  5BOM A;  5HRI A;  4I2H A;  3MGI A;  3UQ0 A;  4PH5 A;  4I2E A;  3HIY A;  8ICK A;  2ISP A;  4EV6 A;  1ZQT A;  3JCF A;  4E7X A;  4Z6E A;  5IIL A;  3UXO A;  4K9A A;  3MCR A;  1WOT A;  2ZH9 A;  4FHY A;  4F5P A;  8ICL A;  3OVB A;  4PGY A;  5DEC A;  5J0X A;  1ZQD A;  5J2A A;  3RH4 A;  4FH3 A;  3AQL A;  3H3A A;  1UET A;  4WOY A;  4X0B A;  9ICX A;  3RJE A;  4M9J A;  9ICK A;  4PHP A;  4JWN A;  4M47 A;  5J2D A;  3TFS A;  4O69 A;  3OVA A;  4NLK A;  4KLG A;  1VJ7 A;  4EBK A;  4GXI A;  4NXU A;  2ZH3 A;  4WC6 A;  4NXW A;  1MQ2 A;  1ZQJ A;  4ATB B;  9ICE A;  3L9D A;  4WBZ A;  1BPD A;  5J0S A;  5IIO A;  3ISC A;  4JLX A;  1VFG A;  4WQL A;  4KLL A;  2BPC A;  3WFP A;  4RQ8 A;  1ZQN A;  4I27 A;  4EP7 A;  1ZQS A;  4R64 A;  1JQR A;  1BPX A;  2IUB A;  4NXV A;  4NKT A;  1BPY A;  8ICH A;  4K99 A;  1JN3 A;  3V7J A;  9ICI A;  4RQ2 A;  5J2E A;  5J0W A;  5BPC A;  1YLQ A;  4OAH A;  2PFN A;  9ICO A;  4X4P A;  2B4V A;  8ICJ A;  8ICI A;  4UAZ A;  3NYB A;  4WH5 A;  3MDC A;  9ICW A;  5CFT A;  3UXP A;  3AQM A; 
#chains in the Genus database with same CATH homology
 4Z6F A;  5DBC A;  5J0Y A;  4UB2 A;  4DOB A;  4I28 A;  4K4G A;  4MFC A;  4TUS A;  4Z6D A;  1MIY A;  4UD4 A;  7ICN A;  1TV9 A;  2M2V A;  4LZD A;  4OAF A;  2ZHA A;  4EBJ A;  5HRG A;  5DDM A;  4E8F A;  4WC2 A;  4YMO A;  2ZH1 A;  1FA0 A;  4O68 A;  4WC1 A;  4AT7 B;  1BPE A;  2DRA A;  2O5A A;  3OVS A;  4LEZ A;  4AT8 B;  4PHE A;  4GXK A;  4IQW A;  1XSP A;  8ICC A;  3AQK A;  1BPZ A;  4GXJ A;  2RFF A;  3MDA A;  4P4P A;  4XQ8 A;  8ICV A;  3WFS C;  7ICK A;  4QZA A;  4P4M A;  4RQ1 A;  1MIW A;  4WCW A;  9ICH A;  4I2B A;  4LEV A;  3AQN A;  8ICO A;  4P2H A;  4RWO A;  4LZG A;  4FO6 A;  3HWT A;  4UAW A;  4KM5 A;  4F5O A;  7ICL A;  4KLE A;  2ID1 A;  1ZQG A;  4K96 A;  9ICR A;  4TUQ A;  4IG8 A;  4KLH A;  4KLQ A;  4LEY A;  5DB7 A;  2M2T A;  4OAG A;  4X4S A;  4RQ7 A;  1JAJ A;  4M9L A;  4X0A A;  5J0R A;  3V7L A;  3LK9 A;  1XSL A;  3RJK A;  2Q66 A;  5HRF A;  5CA7 A;  8ICT A;  3C2M A;  4RT3 A;  5CHG A;  5DB6 A;  2BCU A;  5J2C A;  1TVA A;  2P66 A;  2ZH8 A;  3AUO A;  1RPL A;  1Q78 A;  3GDX A;  4RQ5 A;  9ICN A;  4YD1 A;  5CB1 A;  3WFQ E;  4XUS A;  8ICY A;  3OUY A;  5DBB A;  5HRD A;  4QZH A;  3ISD A;  4PGQ A;  4NM1 A;  4NKU A;  4S3N A;  4KLO A;  4I29 A;  1ZQK A;  4KLD A;  3WFR E;  8ICQ A;  4I2I A;  4K4I A;  7ICM A;  5HR9 A;  2BPG A;  9ICL A;  5F2V O;  8ICB A;  4RQ3 A;  3OUY B;  4QZ8 A;  5BOL A;  2BCQ A;  7ICE A;  5J0O A;  9ICB A;  4WC4 A;  2BCS A;  3LQC B;  5J0U A;  5J2G A;  4RQ6 A;  2FMQ A;  4AT8 A;  7ICR A;  1R8A A;  1ZQV A;  4YMN A;  4R66 A;  3PML A;  4UB5 A;  2PFQ A;  2FMP A;  9ICA A;  1ZQH A;  3TFR A;  3RJH A;  3AU2 A;  3K75 D;  5HRL A;  4F5N A;  5J2K A;  4IQT A;  3RJF A;  1ZQY A;  1RZT A;  8ICP A;  8ICU A;  4M5D A;  4RQ0 A;  4AT7 A;  5CWR A;  4O5C A;  4KLU A;  4RWN A;  3RJI A;  4M9N A;  9ICM A;  4XQ7 A;  2ZH7 A;  4WC0 A;  4RWP A;  4UB1 A;  4JWM A;  5HRH A;  2B51 A;  4I2J A;  4R63 A;  2FMS A;  7ICJ A;  2DRB A;  4UD5 A;  4KLF A;  5HRE A;  3JPO A;  4M0A A;  4NXT A;  3AU6 A;  1NO5 A;  4RPY A;  3PNC A;  2GWS A;  4LT6 A;  4TUP A;  4KLJ A;  5D46 A;  4XRH A;  5HHI A;  1ZQB A;  7ICF A;  4YN4 A;  4I2G A;  2BE3 A;  3UXN A;  4QZB A;  9ICT A;  5HRB A;  4NLZ A;  2B56 A;  4I2C A;  1NOM A;  3HJ1 A;  2W9M A;  2PXI A;  3WFO A;  3UPQ A;  5IIK A;  4P4O A;  1OU5 A;  4K98 A;  1HUZ A;  3H39 A;  5J2H A;  4Z6C A;  3RH5 A;  4NXX A;  2IHM A;  2VAN A;  4X4U A;  3UQ2 A;  3V72 A;  4O67 A;  5J2I A;  1KNY A;  1PX5 A;  4WC7 A;  3RJG A;  4NY8 A;  4WC3 A;  3HJ4 A;  4O5E A;  3JPP A;  7ICG A;  1R89 A;  4UBC A;  4PPX A;  4X4N A;  4KLS A;  4KLT A;  9ICQ A;  2HHP A;  2NRK A;  4PHD A;  1HUO A;  3H38 A;  5D4B A;  1ZQW A;  8ICF A;  4X5V A;  8ICR A;  3JYY A;  4LEW A;  1R8C A;  2BCR A;  3ISB A;  4QZI A;  5HC9 A;  5J2J A;  4OAI Z;  1TFY A;  4M9G A;  8ICE A;  8ICM A;  8ICW A;  4O5K A;  1ZQL A;  2BCV A;  5CR0 A;  5J0Q A;  4IQV A;  9ICP A;  4QZD A;  3MBY A;  4NXZ A;  3C66 A;  1ZQQ A;  4R65 A;  4M2Y A;  4DOC A;  3JPS A;  7ICO A;  4ATB A;  9ICU A;  1ZQF A;  1JMS A;  4M9H A;  1ZQM A;  3C5F A;  5IIM A;  4X4R A;  4DO9 A;  9ICG A;  1ZQC A;  4KB6 A;  5J0T A;  7ICS A;  4M04 A;  7ICV A;  4YMM A;  2M2W A;  3MGH A;  4MF8 A;  7ICQ A;  4NM2 A;  4RT2 A;  4X4O A;  1Q79 A;  2DR7 A;  1TFW A;  1MQ3 A;  4F5R A;  1UEU A;  2DR5 A;  4RPX A;  1V4A A;  1KDH A;  8ICN A;  1ZQR A;  3B0Y A;  4FHP A;  8ICA A;  4QZ9 A;  3C18 A;  3JZ0 A;  2I9G A;  3C5G A;  2ZH2 A;  5J29 A;  2ZH5 A;  4TUR A;  2ZH4 A;  4I2F A;  4I2D A;  4K4H A;  1R8B A;  3UPS A;  1XSN A;  5DDY A;  5CJ7 A;  9ICC A;  3HW8 A;  4QZC A;  3H37 A;  4O9M A;  5IIJ A;  4K8V A;  4LVS A;  4UB4 A;  4DOA A;  4XA5 A;  4QZE A;  2ISO A;  5DKW A;  3C2K A;  4FHX A;  4I2A A;  2M2U A;  5J0P A;  4QZF A;  2ZHB A;  2DVI A;  2ZH6 A;  4RWQ A;  5IIN A;  5DBA A;  5D49 A;  2PFO A;  8ICX A;  4X4Q A;  5DED A;  1F5A A;  4RPZ A;  9ICS A;  9ICJ A;  4MFF A;  9ICF A;  4FH5 A;  5HRK A;  4X4V A;  5EOZ A;  5DB9 A;  3JPT A;  3RH6 A;  4MF2 A;  8ICG A;  4UAY A;  1ZQA A;  4NLN A;  2PBE A;  5TZV A;  8ICZ A;  4MKP A;  3JPQ A;  4FHV A;  5HHH A;  1ZQU A;  4QZG A;  2O1P A;  4KLI A;  8ICS A;  1ZQE A;  4PGX A;  1ZQO A;  4KLM A;  3C2L A;  1ZQZ A;  1ZQP A;  7ICI A;  1BPB A;  7ICT A;  4AT9 B;  1ZJN A;  4K97 A;  3OGU A;  3RJJ A;  1KEJ A;  4F5Q A;  5J2F A;  2PFP A;  3PMN A;  7ICU A;  7ICP A;  5CP2 A;  4K9B A;  5J2B A;  7ICH A;  1UEV A;  4E80 A;  5DB8 A;  4WC5 A;  4AT9 A;  3JPN A;  1ZQX A;  3V7K A;  1ZJM A;  2DR9 A;  1MIV A;  4FHW A;  2BPF A;  4WBY A;  3B0X A;  4X4T A;  4UBB A;  4O6A A;  3JPR A;  4IQU A;  2DR8 A;  4MFA A;  4JLZ A;  4PHA A;  4UB3 A;  3HX0 A;  4RQ4 A;  9ICV A;  5III A;  4YD2 A;  1ZQI A;  3OV7 A;  4YCX A;  5BOM A;  5HRI A;  4I2H A;  3MGI A;  3UQ0 A;  4PH5 A;  4I2E A;  3HIY A;  8ICK A;  2ISP A;  1ZQT A;  4E7X A;  4Z6E A;  5IIL A;  3UXO A;  4K9A A;  1WOT A;  2ZH9 A;  4FHY A;  4F5P A;  8ICL A;  3OVB A;  4PGY A;  5DEC A;  5J0X A;  1ZQD A;  5J2A A;  3RH4 A;  4FH3 A;  3AQL A;  3H3A A;  1UET A;  4WOY A;  4X0B A;  9ICX A;  3RJE A;  4M9J A;  9ICK A;  4PHP A;  4JWN A;  4M47 A;  5J2D A;  3TFS A;  4O69 A;  3OVA A;  4NLK A;  4KLG A;  1VJ7 A;  4EBK A;  4GXI A;  4NXU A;  2ZH3 A;  4WC6 A;  4NXW A;  1MQ2 A;  1ZQJ A;  4ATB B;  9ICE A;  3L9D A;  4WBZ A;  1BPD A;  5J0S A;  5IIO A;  3ISC A;  4JLX A;  1VFG A;  4KLL A;  2BPC A;  3WFP A;  4RQ8 A;  1ZQN A;  4I27 A;  4EP7 A;  1ZQS A;  4R64 A;  1JQR A;  1BPX A;  1BPY A;  4NXV A;  4NKT A;  8ICH A;  4K99 A;  1JN3 A;  3V7J A;  9ICI A;  4RQ2 A;  5J2E A;  5J0W A;  5BPC A;  1YLQ A;  4OAH A;  2PFN A;  9ICO A;  4X4P A;  2B4V A;  8ICJ A;  8ICI A;  4UAZ A;  3NYB A;  3MDC A;  9ICW A;  3UXP A;  3AQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...