4UD4A

Structural plasticity of cid1 provides a basis for its rna terminal uridylyl transferase activity
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
324
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGAFLQAARIPIIKLTSDGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFAFYAYAFEPREKVVTFRRPDGYLTKQEKGWTKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(A) RNA POLYMERASE PROTEIN CID1
publication title Structural plasticity of Cid1 provides a basis for its distributive RNA terminal uridylyl transferase activity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 107
structure length 324
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ud4A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ud4A02
2PBEA 3H3AA 1ZQXA 4IQWA 4QZAA 4QZBA 4NM1A 2B56A 3RJHA 3UQ2A 5HRBA 3RJFA 4PHEA 2ZH6A 9ICCA 3C18A 2BCSA 5J0YA 9ICLA 3NYBA 5J2DA 4TURA 8ICQA 3V7KA 4EBJA 4KLMA 4K4HA 8ICXA 4E8FA 3AQKA 3OVAA 4NLNA 4KLTA 2PFOA 2M2WA 4O9MA 5J0RA 2DR8A 3WFOA 4YN4A 3RJJA 5J0QA 1RZTA 1ZQJA 3H38A 3C66A 2BCRA 3K75D 4YCXA 4KLUA 5TZVA 8ICBA 4KLJA 3UXOA 4QZCA 4P4MA 3JPQA 9ICBA 4M47A 8ICJA 2VANA 2ZHBA 3HJ4A 1TFWA 2DR9A 4WBZA 5HRLA 2DR7A 4X4PA 1BPBA 4XQ7A 4QZIA 4UB3A 4PH5A 3H39A 4F5QA 4TUQA 1OU5A 4UB1A 1ZQBA 4F5OA 3HW8A 3RH5A 9ICQA 7ICVA 4MFCA 4QZHA 4X4SA 4YMOA 5DECA 4RWPA 3HJ1A 5DB6A 3HWTA 3AUOA 3AU2A 4TUPA 1HUOA 4RQ5A 4KLFA 5HHIA 1TV9A 3MDAA 1TFYA 5J0XA 4PHPA 1ZQVA 4PHDA 1ZJNA 4UBCA 2ZH7A 4F5PA 1MIYA 3UPSA 8ICKA 4M9HA 1ZQCA 2ZH5A 1ZQSA 4KLDA 2ID1A 3JPPA 1ZQDA 8ICYA 5IIOA 9ICUA 4NKTA 5HR9A 2Q66A 1UEVA 3AQNA 9ICXA 1VFGA 3OVBA 2ZH1A 4X4RA 7ICMA 4Z6CA 9ICRA 5DB8A 1WOTA 9ICAA 4M04A 5J29A 9ICEA 2ZH2A 9ICJA 9ICWA 2B51A 1ZQMA 1VJ7A 4RPYA 3MGIA 8ICIA 4KLEA 4R66A 3ISCA 1ZQYA 4M9LA 2BE3A 4I2DA 2NRKA 4GXKA 8ICOA 4RQ1A 4I2CA 5IILA 1KNYA 5DB7A 4UB2A 4QZFA 5DBBA 5HRGA 3WFSC 1ZQTA 8ICSA 3UXPA 4RQ8A 2DRAA 8ICNA 4NY8A 4O5EA 1RPLA 4RQ4A 3RJGA 3H37A 3V7JA 4MFFA 4YD1A 1BPXA 1R8BA 9ICIA 4X5VA 4KLQA 2ZH9A 3UPQA 9ICKA 4WBYA 2ISPA 4LVSA 3AU6A 1MIWA 8ICAA 4RPZA 4AT9A 3PNCA 4RQ3A 1JAJA 4XUSA 5J0SA 3RJKA 4Z6DA 4KLOA 8ICUA 1ZQGA 4XRHA 5HRDA 3JPTA 9ICHA 4RQ6A 3PMNA 1FA0A 1ZQAA 4YMNA 4WC1A 5J2JA 4IG8A 4WC3A 7ICEA 1PX5A 4RQ7A 4RT3A 3C2KA 1ZQWA 5J2IA 4KLHA 3C2MA 4WC5A 8ICFA 3ISDA 4UBBA 4AT8A 4I2IA 9ICTA 3WFQE 4E80A 2PFNA 9ICPA 7ICQA 8ICCA 4DOCA 4P4PA 4JWMA 4IQUA 4UAYA 8ICTA 4S3NA 3V7LA 1ZQLA 5D46A 2BPGA 1KEJA 4X4OA 4NM2A 4DO9A 4LT6A 5CWRA 1ZQQA 2M2UA 4X4VA 7ICUA 4QZ9A 2GWSA 4R63A 5J2CA 2M2VA 4WC6A 1BPEA 3RH6A 8ICPA 4P2HA 4I2BA 5F2VO 4O5CA 3MDCA 1TVAA 4GXIA 3AQMA 7ICJA 3C5FA 1R8AA 7ICFA 5CA7A 4UB5A 3MBYA 1JN3A 4X4NA 3LQCB 4DOBA 3AQLA 5J0WA 4KLSA 4EBKA 4QZGA 8ICWA 5J2EA 5J2BA 3HX0A 9ICGA 7ICSA 5J2GA 4WC4A 1BPYA 4M2YA 1ZQPA 4EP7A 4R65A 5DB9A 4FH5A 4RQ0A 3ISBA 9ICSA 1YLQA 4NLZA 5IIMA 5D4BA 7ICPA 2ZHAA 2P66A 1JMSA 1ZJMA 1NOMA 4LZDA 5BPCA 3B0YA 4ATBA 3OVSA 8ICLA 9ICFA 4ATBB 4E7XA 4X0AA 5BOMA 7ICKA 1HUZA 5J0TA 3L9DA 8ICZA 5J0PA 2I9GA 8ICEA 4PGYA 4FHWA 4I27A 5HREA 2ISOA 5DBAA 4I29A 4UD5A 4NKUA 8ICMA 4QZEA 3LK9A 4YMMA 4FHXA 4X4UA 5CHGA 2W9MA 2O5AA 3TFRA 4K4GA 4M9NA 5HRKA 4QZ8A 4FHYA 4RT2A 1ZQOA 3OV7A 5DBCA 1MQ2A 3JPSA 4UAZA 1XSNA 1BPZA 3JPOA 5HC9A 4FHVA 2BCVA 1R89A 1ZQFA 5HHHA 4PPXA 4AT9B 1ZQZA 2BPCA 4I2EA 4KLLA 4NXZA 5J2KA 5J2AA 4UD4A 4FO6A 2PFQA 3RJIA 5DDYA 5DDMA 4MF8A 4I2HA 4F5RA 1ZQHA 2PFPA 1ZQUA 7ICHA 1MIVA 3MGHA 4IQTA 4YD2A 2IHMA 2RFFA 4WC0A 5IIJA 7ICRA 1UEUA 9ICMA 3JPRA 7ICTA 4M9GA 4LZGA 1Q79A 5DEDA 1XSLA 7ICIA 5BOLA 4AT8B 2ZH4A 3HIYA 5CB1A 8ICGA 4M9JA 1ZQEA 1BPDA 3B0XA 1XSPA 9ICOA 3V72A 4FH3A 5EOZA 2HHPA 2B4VA 3C5GA 4WC7A 2FMQA 1F5AA 4RPXA 3JPNA 4O5KA 1ZQKA 4M5DA 5J0OA 4X0BA 1R8CA 4QZDA 9ICVA 3WFPA 5IINA 5IIIA 4R64A 3JZ0A 3RH4A 4I2AA 4Z6FA 4X4TA 4NLKA 3OUYA 2PXIA 5J2HA 2M2TA 4AT7A 3C2LA 4I2GA 3OUYB 2ZH3A 2DR5A 4P4OA 3TFSA 4AT7B 5HRFA 1ZQRA 2BCQA 4K4IA 4I28A 7ICGA 1MQ3A 7ICLA 3OGUA 3UQ0A 2BPFA 5D49A 3WFRE 1ZQNA 5J2FA 2DRBA 4PGQA 3PMLA 1Q78A 4TUSA 9ICNA 4UAWA 3GDXA 4F5NA 4M0AA 4I2JA 1V4AA 4WC2A 1ZQIA 4GXJA 3JYYA 4I2FA 4WCWA 5J0UA 4IQVA 5CP2A 5CJ7A 2BCUA 4XA5A 2O1PA 4UB4A 4JWNA 4X4QA 2ZH8A 4KLIA 8ICRA 7ICNA 1KDHA 3UXNA 4XQ8A 4MFAA 4PGXA 8ICHA 3RJEA 4MF2A 4RWNA 4RWQA 5IIKA 4DOAA 2FMSA 1NO5A 4RQ2A 5CR0A 1UETA 2DVIA 7ICOA 8ICVA 4FHPA 4RWOA 5HRIA 2FMPA 4Z6EA 5DKWA 5HRHA 4KLGA 1JQRA 4PHAA
chains in the Genus database with same CATH superfamily
2PBEA 3H3AA 1ZQXA 4IQWA 4QZAA 4QZBA 4NM1A 2B56A 4LEWA 3RJHA 5D62A 3UQ2A 5HRBA 4K98A 3RJFA 4PHEA 2ZH6A 4O69A 9ICCA 3C18A 2BCSA 5J0YA 3OWGA 9ICLA 3NYBA 5J2DA 4TURA 8ICQA 3V7KA 4EBJA 4KLMA 4K4HA 8ICXA 4E8FA 3OVAA 2HN1A 3AQKA 4NLNA 4KLTA 2PFOA 2M2WA 4O9MA 5J0RA 2DR8A 3WFOA 3ER8C 4YN4A 3RJJA 5J0QA 1RZTA 1ZQJA 3H38A 3C66A 2BCRA 4O67A 3K75D 4YCXA 4KLUA 5TZVA 8ICBA 4KLJA 4KB6A 3UXOA 4QZCA 4P4MA 3JPQA 9ICBA 4M47A 8ICJA 2VANA 2ZHBA 3HJ4A 1TFWA 2DR9A 4WBZA 5HRLA 2DR7A 4X4PA 1BPBA 4XQ7A 4QZIA 4UB3A 4PH5A 3H39A 4F5QA 4TUQA 1OU5A 4UB1A 1ZQBA 4F5OA 3HW8A 3RH5A 4O6AA 9ICQA 7ICVA 4MFCA 4QZHA 4X4SA 4RWPA 5DECA 4YMOA 3HJ1A 5DB6A 4NXXA 3HWTA 4OAHA 3AUOA 4JLXA 4OAGA 5JTGA 3AU2A 4TUPA 1HUOA 4RQ5A 3PHZA 4KLFA 5HHIA 1TV9A 3MDAA 1TFYA 5J0XA 4PHPA 1ZQVA 4PHDA 1ZJNA 4UBCA 4EEDA 2ZH7A 4LEZA 2BBHA 4F5PA 1MIYA 3UPSA 8ICKA 4M9HA 1ZQCA 2ZH5A 1ZQSA 4KLDA 2ID1A 3JPPA 1ZQDA 8ICYA 5IIOA 9ICUA 4NKTA 5HR9A 4K97A 2Q66A 1UEVA 3AQNA 9ICXA 1VFGA 3OVBA 2ZH1A 4X4RA 7ICMA 4Z6CA 9ICRA 5DB8A 1WOTA 9ICAA 4M04A 5J29A 9ICEA 2ZH2A 9ICJA 9ICWA 2B51A 1ZQMA 1VJ7A 4RPYA 4FO1A 3MGIA 8ICIA 4KLEA 4R66A 3ER9B 3ISCA 1ZQYA 4M9LA 2BE3A 4I2DA 2NRKA 4WQLA 4GXKA 8ICOA 4RQ1A 5CFTA 4I2CA 5IILA 1KNYA 5DB7A 4UB2A 4QZFA 5DBBA 5HRGA 3WFSC 1ZQTA 4WOYA 8ICSA 3UXPA 4RQ8A 2DRAA 8ICNA 4NY8A 4O5EA 1RPLA 4RQ4A 3RJGA 3H37A 3V7JA 2FCLA 4MFFA 4YD1A 1BPXA 1R8BA 9ICIA 4X5VA 4HX0A 4KLQA 2ZH9A 3UPQA 9ICKA 4WBYA 2ISPA 4LVSA 3AU6A 1MIWA 8ICAA 4RPZA 4AT9A 3PNCA 4RQ3A 1JAJA 4XUSA 5J0SA 3RJKA 4Z6DA 4KLOA 8ICUA 4K8VA 4K96A 5B3QA 4XRHA 1ZQGA 5HRDA 3JPTA 9ICHA 4RQ6A 4K99A 3PMNA 1FA0A 1ZQAA 4YMNA 3EF2A 4WC1A 5J2JA 3NWIA 4IG8A 4WC3A 7ICEA 1PX5A 4RQ7A 4RT3A 3C2KA 1ZQWA 5J2IA 4KLHA 3C2MA 4WC5A 8ICFA 3ISDA 4UBBA 4OAFA 4EGWA 4AT8A 4I2IA 9ICTA 3WFQE 2GAFD 5CHEA 4E80A 3NVOA 2PFNA 9ICPA 7ICQA 8ICCA 4DOCA 4P4PA 4JWMA 4IQUA 4UAYA 8ICTA 4S3NA 3V7LA 1ZQLA 5D46A 2BPGA 1KEJA 4X4OA 4NM2A 4DO9A 4LT6A 5CWRA 1ZQQA 4X4VA 2M2UA 7ICUA 4QZ9A 2GWSA 2M2VA 5J2CA 4R63A 4WC6A 1GPJA 1BPEA 3RH6A 8ICPA 4P2HA 4K9BA 4I2BA 5F2VO 4O5CA 3MDCA 1TVAA 4GXIA 4WQKA 3AQMA 7ICJA 3C5FA 1R8AA 7ICFA 5CA7A 4UB5A 3MBYA 1JN3A 4X4NA 4KM5A 3LQCB 4DOBA 3AQLA 5J0WA 4KLSA 4EBKA 4QZGA 8ICWA 5J2EA 5J2BA 3HX0A 9ICGA 7ICSA 5J2GA 4WC4A 1BPYA 4M2YA 1ZQPA 4EP7A 4R65A 5DB9A 4FH5A 4RQ0A 3ISBA 9ICSA 1YLQA 4NLZA 4K9AA 5IIMA 5D4BA 7ICPA 2ZHAA 2P66A 5CFSA 1JMSA 1NOMA 4LZDA 5BPCA 1ZJMA 4ATBA 3OVSA 3B0YA 8ICLA 9ICFA 4ATBB 4JLZA 4E7XA 4X0AA 5BOMA 7ICKA 1HUZA 5J0TA 3L9DA 8ICZA 5J0PA 2I9GA 8ICEA 4PGYA 4FHWA 3K7DA 4I27A 5HREA 2ISOA 5DBAA 4I29A 4UD5A 4NKUA 8ICMA 4QZEA 3LK9A 4YMMA 4FHXA 4X4UA 5CHGA 2W9MA 2O5AA 3TFRA 4K4GA 4M9NA 5HRKA 4QZ8A 4FHYA 4RT2A 1ZQOA 3OV7A 5DBCA 4OAIZ 1MQ2A 3JPSA 4UAZA 1XSNA 1BPZA 3JPOA 5HC9A 4FHVA 2BCVA 1R89A 1ZQFA 4O68A 4LEVA 5HHHA 4AT9B 4PPXA 3ERCC 4N7RA 1ZQZA 2BPCA 2GA9D 4I2EA 4KLLA 5D61A 2EWRA 4NXZA 5J2AA 5J2KA 4UD4A 4FO6A 2PFQA 3RJIA 5DDYA 5DDMA 4MF8A 4I2HA 4F5RA 1ZQHA 2PFPA 1ZQUA 4NXUA 7ICHA 1MIVA 3MGHA 4YD2A 4IQTA 2IHMA 2RFFA 4WC0A 5IIJA 4XJEA 1UEUA 7ICRA 9ICMA 3JPRA 3MCRA 7ICTA 4M9GA 4LZGA 1Q79A 5DEDA 1XSLA 4EV6A 4LEYA 7ICIA 5BOLA 4AT8B 2ZH4A 3HIYA 4I0UA 5CB1A 2IHOA 8ICGA 4M9JA 4NXWA 1ZQEA 1BPDA 3B0XA 1XSPA 9ICOA 3V72A 3CK6A 4FH3A 5EOZA 2HHPA 2B4VA 3C5GA 4WC7A 2FMQA 1F5AA 4RPXA 3JPNA 4O5KA 1ZQKA 4M5DA 5J0OA 4X0BA 1R8CA 4QZDA 9ICVA 3WFPA 5IINA 5IIIA 4R64A 3JZ0A 3RH4A 4I2AA 4MKPA 4Z6FA 4X4TA 4NLKA 3OUYA 2PXIA 5D63A 5J2HA 4AT7A 2M2TA 3C2LA 4I2GA 3OUYB 2ZH3A 2DR5A 4P4OA 3TFSA 4AT7B 5HRFA 1ZQRA 2BCQA 4K4IA 4I28A 7ICGA 3NKUA 1MQ3A 7ICLA 3OGUA 3UQ0A 2BPFA 5D49A 3WFRE 1ZQNA 5J2FA 2DRBA 4PGQA 3PMLA 1Q78A 4TUSA 9ICNA 4UAWA 3GDXA 4WH5A 4F5NA 4M0AA 4I2JA 1V4AA 4NXVA 4WC2A 1ZQIA 4GXJA 3JYYA 4I2FA 4WCWA 5J0UA 5CFUA 4IQVA 2HN2A 4NXTA 5CP2A 5CJ7A 2BCUA 4EEBA 4XA5A 2O1PA 4UB4A 4JWNA 4X4QA 2IUBA 2ZH8A 4KLIA 8ICRA 7ICNA 5B3PA 1KDHA 2BBJA 3UXNA 4XQ8A 4MFAA 4PGXA 8ICHA 3RJEA 4MF2A 4RWNA 4RWQA 5IIKA 4DOAA 2FMSA 1NO5A 4RQ2A 2DVIA 1UETA 5CR0A 7ICOA 8ICVA 4FHPA 4RWOA 5HRIA 2FMPA 4Z6EA 3JCFA 5DKWA 5HRHA 4KLGA 1JQRA 4PHAA
chains in the Genus database with same CATH topology
2PBEA 3H3AA 1ZQXA 4IQWA 4QZAA 4QZBA 4NM1A 2B56A 4LEWA 3RJHA 3UQ2A 5HRBA 4K98A 3RJFA 4PHEA 2ZH6A 4O69A 9ICCA 3C18A 2BCSA 5J0YA 9ICLA 3NYBA 5J2DA 4TURA 8ICQA 3V7KA 4EBJA 4KLMA 4K4HA 8ICXA 4E8FA 3OVAA 3AQKA 4NLNA 4KLTA 2PFOA 2M2WA 4O9MA 5J0RA 2DR8A 3WFOA 4YN4A 3RJJA 5J0QA 1RZTA 1ZQJA 3H38A 3C66A 2BCRA 4O67A 3K75D 4YCXA 4KLUA 5TZVA 8ICBA 4KLJA 4KB6A 3UXOA 4QZCA 4P4MA 3JPQA 9ICBA 4M47A 8ICJA 2VANA 2ZHBA 3HJ4A 1TFWA 2DR9A 4WBZA 5HRLA 2DR7A 4X4PA 1BPBA 4XQ7A 4QZIA 4UB3A 4PH5A 3H39A 4F5QA 4TUQA 1OU5A 4UB1A 1ZQBA 4F5OA 3HW8A 3RH5A 4O6AA 9ICQA 7ICVA 4MFCA 4QZHA 4X4SA 4RWPA 4YMOA 5DECA 3HJ1A 5DB6A 4NXXA 3HWTA 4OAHA 3AUOA 4JLXA 4OAGA 3AU2A 4TUPA 1HUOA 4RQ5A 4KLFA 5HHIA 1TV9A 3MDAA 1TFYA 5J0XA 4PHPA 1ZQVA 4PHDA 1ZJNA 4UBCA 2ZH7A 4LEZA 4F5PA 1MIYA 3UPSA 8ICKA 4M9HA 1ZQCA 2ZH5A 1ZQSA 4KLDA 2ID1A 3JPPA 1ZQDA 8ICYA 5IIOA 9ICUA 4NKTA 5HR9A 4K97A 2Q66A 1UEVA 3AQNA 9ICXA 1VFGA 3OVBA 2ZH1A 4X4RA 7ICMA 4Z6CA 9ICRA 5DB8A 1WOTA 9ICAA 4M04A 5J29A 9ICEA 2ZH2A 9ICJA 9ICWA 2B51A 1ZQMA 1VJ7A 4RPYA 3MGIA 8ICIA 4KLEA 4R66A 3ISCA 1ZQYA 4M9LA 2BE3A 4I2DA 2NRKA 4GXKA 8ICOA 4RQ1A 4I2CA 5IILA 1KNYA 5DB7A 4UB2A 4QZFA 5DBBA 5HRGA 3WFSC 1ZQTA 4WOYA 8ICSA 3UXPA 4RQ8A 2DRAA 8ICNA 4NY8A 4O5EA 1RPLA 4RQ4A 3RJGA 3H37A 3V7JA 4MFFA 4YD1A 1BPXA 1R8BA 9ICIA 4X5VA 4KLQA 2ZH9A 3UPQA 9ICKA 4WBYA 2ISPA 4LVSA 3AU6A 1MIWA 8ICAA 4RPZA 4AT9A 3PNCA 4RQ3A 1JAJA 4XUSA 5J0SA 3RJKA 4Z6DA 4KLOA 8ICUA 4K8VA 4K96A 1ZQGA 4XRHA 5HRDA 3JPTA 9ICHA 4RQ6A 4K99A 3PMNA 1FA0A 1ZQAA 4YMNA 4WC1A 5J2JA 4IG8A 4WC3A 7ICEA 1PX5A 4RQ7A 4RT3A 3C2KA 1ZQWA 5J2IA 4KLHA 3C2MA 4WC5A 8ICFA 3ISDA 4UBBA 4OAFA 4AT8A 4I2IA 9ICTA 3WFQE 4E80A 2PFNA 9ICPA 7ICQA 8ICCA 4DOCA 4P4PA 4JWMA 4IQUA 4UAYA 8ICTA 4S3NA 3V7LA 1ZQLA 5D46A 2BPGA 1KEJA 4X4OA 4NM2A 4DO9A 4LT6A 5CWRA 1ZQQA 4X4VA 2M2UA 7ICUA 4QZ9A 2GWSA 5J2CA 2M2VA 4R63A 4WC6A 1BPEA 3RH6A 8ICPA 4P2HA 4K9BA 4I2BA 5F2VO 4O5CA 3MDCA 1TVAA 4GXIA 3AQMA 7ICJA 3C5FA 1R8AA 7ICFA 5CA7A 4UB5A 3MBYA 1JN3A 4X4NA 4KM5A 3LQCB 4DOBA 3AQLA 5J0WA 4KLSA 4EBKA 4QZGA 8ICWA 5J2EA 5J2BA 3HX0A 9ICGA 7ICSA 5J2GA 4WC4A 1BPYA 4M2YA 1ZQPA 4EP7A 4R65A 5DB9A 4FH5A 4RQ0A 3ISBA 9ICSA 1YLQA 4NLZA 4K9AA 5IIMA 5D4BA 7ICPA 2ZHAA 2P66A 1JMSA 1ZJMA 1NOMA 4LZDA 5BPCA 4ATBA 3OVSA 3B0YA 8ICLA 9ICFA 4ATBB 4JLZA 4E7XA 4X0AA 5BOMA 7ICKA 1HUZA 5J0TA 3L9DA 8ICZA 5J0PA 2I9GA 8ICEA 4PGYA 4FHWA 4I27A 5HREA 2ISOA 5DBAA 4I29A 4UD5A 4NKUA 8ICMA 4QZEA 3LK9A 4YMMA 4FHXA 4X4UA 5CHGA 2W9MA 2O5AA 3TFRA 4K4GA 4M9NA 5HRKA 4QZ8A 4FHYA 4RT2A 1ZQOA 3OV7A 5DBCA 4OAIZ 1MQ2A 3JPSA 4UAZA 1XSNA 1BPZA 3JPOA 5HC9A 4FHVA 2BCVA 1R89A 1ZQFA 4O68A 4LEVA 5HHHA 4AT9B 4PPXA 1ZQZA 2BPCA 4I2EA 4KLLA 4NXZA 5J2KA 5J2AA 4UD4A 4FO6A 2PFQA 3RJIA 5DDYA 5DDMA 4MF8A 4I2HA 4F5RA 1ZQHA 2PFPA 1ZQUA 4NXUA 7ICHA 1MIVA 3MGHA 4IQTA 4YD2A 2IHMA 2RFFA 4WC0A 5IIJA 7ICRA 1UEUA 9ICMA 3JPRA 7ICTA 4M9GA 4LZGA 1Q79A 5DEDA 1XSLA 4LEYA 7ICIA 5BOLA 4AT8B 2ZH4A 3HIYA 5CB1A 8ICGA 4M9JA 4NXWA 1ZQEA 1BPDA 3B0XA 1XSPA 9ICOA 3V72A 4FH3A 5EOZA 2HHPA 2B4VA 3C5GA 4WC7A 2FMQA 1F5AA 4RPXA 3JPNA 4O5KA 1ZQKA 4M5DA 5J0OA 4X0BA 1R8CA 4QZDA 9ICVA 3WFPA 5IINA 5IIIA 4R64A 3JZ0A 3RH4A 4I2AA 4MKPA 4Z6FA 4X4TA 4NLKA 3OUYA 2PXIA 5J2HA 4AT7A 2M2TA 3C2LA 4I2GA 3OUYB 2ZH3A 2DR5A 4P4OA 3TFSA 4AT7B 5HRFA 1ZQRA 2BCQA 4K4IA 4I28A 7ICGA 1MQ3A 7ICLA 3OGUA 3UQ0A 2BPFA 5D49A 3WFRE 1ZQNA 5J2FA 2DRBA 4PGQA 3PMLA 1Q78A 4TUSA 9ICNA 4UAWA 3GDXA 4F5NA 4M0AA 4I2JA 1V4AA 4NXVA 4WC2A 1ZQIA 4GXJA 3JYYA 4I2FA 4WCWA 5J0UA 4IQVA 4NXTA 5CP2A 5CJ7A 2BCUA 4XA5A 2O1PA 4UB4A 4JWNA 4X4QA 2ZH8A 4KLIA 8ICRA 7ICNA 1KDHA 3UXNA 4XQ8A 4MFAA 4PGXA 8ICHA 3RJEA 4MF2A 4RWNA 4RWQA 5IIKA 4DOAA 2FMSA 1NO5A 4RQ2A 2DVIA 1UETA 5CR0A 7ICOA 8ICVA 4FHPA 4RWOA 5HRIA 2FMPA 4Z6EA 5DKWA 5HRHA 4KLGA 1JQRA 4PHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBE A;  3H3A A;  1ZQX A;  4IQW A;  4QZA A;  4QZB A;  4NM1 A;  2B56 A;  3RJH A;  3UQ2 A;  5HRB A;  3RJF A;  4PHE A;  2ZH6 A;  9ICC A;  3C18 A;  2BCS A;  5J0Y A;  9ICL A;  3NYB A;  5J2D A;  4TUR A;  8ICQ A;  3V7K A;  4EBJ A;  4KLM A;  4K4H A;  8ICX A;  4E8F A;  3AQK A;  3OVA A;  4NLN A;  4KLT A;  2PFO A;  2M2W A;  4O9M A;  5J0R A;  2DR8 A;  3WFO A;  4YN4 A;  3RJJ A;  5J0Q A;  1RZT A;  1ZQJ A;  3H38 A;  3C66 A;  2BCR A;  3K75 D;  4YCX A;  4KLU A;  5TZV A;  8ICB A;  4KLJ A;  3UXO A;  4QZC A;  4P4M A;  3JPQ A;  9ICB A;  4M47 A;  8ICJ A;  2VAN A;  2ZHB A;  3HJ4 A;  1TFW A;  2DR9 A;  4WBZ A;  5HRL A;  2DR7 A;  4X4P A;  1BPB A;  4XQ7 A;  4QZI A;  4UB3 A;  4PH5 A;  3H39 A;  4F5Q A;  4TUQ A;  1OU5 A;  4UB1 A;  1ZQB A;  4F5O A;  3HW8 A;  3RH5 A;  9ICQ A;  7ICV A;  4MFC A;  4QZH A;  4X4S A;  4YMO A;  5DEC A;  4RWP A;  3HJ1 A;  5DB6 A;  3HWT A;  3AUO A;  3AU2 A;  4TUP A;  1HUO A;  4RQ5 A;  4KLF A;  5HHI A;  1TV9 A;  3MDA A;  1TFY A;  5J0X A;  4PHP A;  1ZQV A;  4PHD A;  1ZJN A;  4UBC A;  2ZH7 A;  4F5P A;  1MIY A;  3UPS A;  8ICK A;  4M9H A;  1ZQC A;  2ZH5 A;  1ZQS A;  4KLD A;  2ID1 A;  3JPP A;  1ZQD A;  8ICY A;  5IIO A;  9ICU A;  4NKT A;  5HR9 A;  2Q66 A;  1UEV A;  3AQN A;  9ICX A;  1VFG A;  3OVB A;  2ZH1 A;  4X4R A;  7ICM A;  4Z6C A;  9ICR A;  5DB8 A;  1WOT A;  9ICA A;  4M04 A;  5J29 A;  9ICE A;  2ZH2 A;  9ICJ A;  9ICW A;  2B51 A;  1ZQM A;  1VJ7 A;  4RPY A;  3MGI A;  8ICI A;  4KLE A;  4R66 A;  3ISC A;  1ZQY A;  4M9L A;  2BE3 A;  4I2D A;  2NRK A;  4GXK A;  8ICO A;  4RQ1 A;  4I2C A;  5IIL A;  1KNY A;  5DB7 A;  4UB2 A;  4QZF A;  5DBB A;  5HRG A;  3WFS C;  1ZQT A;  8ICS A;  3UXP A;  4RQ8 A;  2DRA A;  8ICN A;  4NY8 A;  4O5E A;  1RPL A;  4RQ4 A;  3RJG A;  3H37 A;  3V7J A;  4MFF A;  4YD1 A;  1BPX A;  1R8B A;  9ICI A;  4X5V A;  4KLQ A;  2ZH9 A;  3UPQ A;  9ICK A;  4WBY A;  2ISP A;  4LVS A;  3AU6 A;  1MIW A;  8ICA A;  4RPZ A;  4AT9 A;  3PNC A;  4RQ3 A;  1JAJ A;  4XUS A;  5J0S A;  3RJK A;  4Z6D A;  4KLO A;  8ICU A;  1ZQG A;  4XRH A;  5HRD A;  3JPT A;  9ICH A;  4RQ6 A;  3PMN A;  1FA0 A;  1ZQA A;  4YMN A;  4WC1 A;  5J2J A;  4IG8 A;  4WC3 A;  7ICE A;  1PX5 A;  4RQ7 A;  4RT3 A;  3C2K A;  1ZQW A;  5J2I A;  4KLH A;  3C2M A;  4WC5 A;  8ICF A;  3ISD A;  4UBB A;  4AT8 A;  4I2I A;  9ICT A;  3WFQ E;  4E80 A;  2PFN A;  9ICP A;  7ICQ A;  8ICC A;  4DOC A;  4P4P A;  4JWM A;  4IQU A;  4UAY A;  8ICT A;  4S3N A;  3V7L A;  1ZQL A;  5D46 A;  2BPG A;  1KEJ A;  4X4O A;  4NM2 A;  4DO9 A;  4LT6 A;  5CWR A;  1ZQQ A;  2M2U A;  4X4V A;  7ICU A;  4QZ9 A;  2GWS A;  4R63 A;  5J2C A;  2M2V A;  4WC6 A;  1BPE A;  3RH6 A;  8ICP A;  4P2H A;  4I2B A;  5F2V O;  4O5C A;  3MDC A;  1TVA A;  4GXI A;  3AQM A;  7ICJ A;  3C5F A;  1R8A A;  7ICF A;  5CA7 A;  4UB5 A;  3MBY A;  1JN3 A;  4X4N A;  3LQC B;  4DOB A;  3AQL A;  5J0W A;  4KLS A;  4EBK A;  4QZG A;  8ICW A;  5J2E A;  5J2B A;  3HX0 A;  9ICG A;  7ICS A;  5J2G A;  4WC4 A;  1BPY A;  4M2Y A;  1ZQP A;  4EP7 A;  4R65 A;  5DB9 A;  4FH5 A;  4RQ0 A;  3ISB A;  9ICS A;  1YLQ A;  4NLZ A;  5IIM A;  5D4B A;  7ICP A;  2ZHA A;  2P66 A;  1JMS A;  1ZJM A;  1NOM A;  4LZD A;  5BPC A;  3B0Y A;  4ATB A;  3OVS A;  8ICL A;  9ICF A;  4ATB B;  4E7X A;  4X0A A;  5BOM A;  7ICK A;  1HUZ A;  5J0T A;  3L9D A;  8ICZ A;  5J0P A;  2I9G A;  8ICE A;  4PGY A;  4FHW A;  4I27 A;  5HRE A;  2ISO A;  5DBA A;  4I29 A;  4UD5 A;  4NKU A;  8ICM A;  4QZE A;  3LK9 A;  4YMM A;  4FHX A;  4X4U A;  5CHG A;  2W9M A;  2O5A A;  3TFR A;  4K4G A;  4M9N A;  5HRK A;  4QZ8 A;  4FHY A;  4RT2 A;  1ZQO A;  3OV7 A;  5DBC A;  1MQ2 A;  3JPS A;  4UAZ A;  1XSN A;  1BPZ A;  3JPO A;  5HC9 A;  4FHV A;  2BCV A;  1R89 A;  1ZQF A;  5HHH A;  4PPX A;  4AT9 B;  1ZQZ A;  2BPC A;  4I2E A;  4KLL A;  4NXZ A;  5J2K A;  5J2A A;  4UD4 A;  4FO6 A;  2PFQ A;  3RJI A;  5DDY A;  5DDM A;  4MF8 A;  4I2H A;  4F5R A;  1ZQH A;  2PFP A;  1ZQU A;  7ICH A;  1MIV A;  3MGH A;  4IQT A;  4YD2 A;  2IHM A;  2RFF A;  4WC0 A;  5IIJ A;  7ICR A;  1UEU A;  9ICM A;  3JPR A;  7ICT A;  4M9G A;  4LZG A;  1Q79 A;  5DED A;  1XSL A;  7ICI A;  5BOL A;  4AT8 B;  2ZH4 A;  3HIY A;  5CB1 A;  8ICG A;  4M9J A;  1ZQE A;  1BPD A;  3B0X A;  1XSP A;  9ICO A;  3V72 A;  4FH3 A;  5EOZ A;  2HHP A;  2B4V A;  3C5G A;  4WC7 A;  2FMQ A;  1F5A A;  4RPX A;  3JPN A;  4O5K A;  1ZQK A;  4M5D A;  5J0O A;  4X0B A;  1R8C A;  4QZD A;  9ICV A;  3WFP A;  5IIN A;  5III A;  4R64 A;  3JZ0 A;  3RH4 A;  4I2A A;  4Z6F A;  4X4T A;  4NLK A;  3OUY A;  2PXI A;  5J2H A;  2M2T A;  4AT7 A;  3C2L A;  4I2G A;  3OUY B;  2ZH3 A;  2DR5 A;  4P4O A;  3TFS A;  4AT7 B;  5HRF A;  1ZQR A;  2BCQ A;  4K4I A;  4I28 A;  7ICG A;  1MQ3 A;  7ICL A;  3OGU A;  3UQ0 A;  2BPF A;  5D49 A;  3WFR E;  1ZQN A;  5J2F A;  2DRB A;  4PGQ A;  3PML A;  1Q78 A;  4TUS A;  9ICN A;  4UAW A;  3GDX A;  4F5N A;  4M0A A;  4I2J A;  1V4A A;  4WC2 A;  1ZQI A;  4GXJ A;  3JYY A;  4I2F A;  4WCW A;  5J0U A;  4IQV A;  5CP2 A;  5CJ7 A;  2BCU A;  4XA5 A;  2O1P A;  4UB4 A;  4JWN A;  4X4Q A;  2ZH8 A;  4KLI A;  8ICR A;  7ICN A;  1KDH A;  3UXN A;  4XQ8 A;  4MFA A;  4PGX A;  8ICH A;  3RJE A;  4MF2 A;  4RWN A;  4RWQ A;  5IIK A;  4DOA A;  2FMS A;  1NO5 A;  4RQ2 A;  5CR0 A;  1UET A;  2DVI A;  7ICO A;  8ICV A;  4FHP A;  4RWO A;  5HRI A;  2FMP A;  4Z6E A;  5DKW A;  5HRH A;  4KLG A;  1JQR A;  4PHA A; 
#chains in the Genus database with same CATH topology
 2PBE A;  3H3A A;  1ZQX A;  4IQW A;  4QZA A;  4QZB A;  4NM1 A;  2B56 A;  4LEW A;  3RJH A;  5D62 A;  3UQ2 A;  5HRB A;  4K98 A;  3RJF A;  4PHE A;  2ZH6 A;  4O69 A;  9ICC A;  3C18 A;  2BCS A;  5J0Y A;  3OWG A;  9ICL A;  3NYB A;  5J2D A;  4TUR A;  8ICQ A;  3V7K A;  4EBJ A;  4KLM A;  4K4H A;  8ICX A;  4E8F A;  3OVA A;  2HN1 A;  3AQK A;  4NLN A;  4KLT A;  2PFO A;  2M2W A;  4O9M A;  5J0R A;  2DR8 A;  3WFO A;  3ER8 C;  4YN4 A;  3RJJ A;  5J0Q A;  1RZT A;  1ZQJ A;  3H38 A;  3C66 A;  2BCR A;  4O67 A;  3K75 D;  4YCX A;  4KLU A;  5TZV A;  8ICB A;  4KLJ A;  4KB6 A;  3UXO A;  4QZC A;  4P4M A;  3JPQ A;  9ICB A;  4M47 A;  8ICJ A;  2VAN A;  2ZHB A;  3HJ4 A;  1TFW A;  2DR9 A;  4WBZ A;  5HRL A;  2DR7 A;  4X4P A;  1BPB A;  4XQ7 A;  4QZI A;  4UB3 A;  4PH5 A;  3H39 A;  4F5Q A;  4TUQ A;  1OU5 A;  4UB1 A;  1ZQB A;  4F5O A;  3HW8 A;  3RH5 A;  4O6A A;  9ICQ A;  7ICV A;  4MFC A;  4QZH A;  4X4S A;  4RWP A;  5DEC A;  4YMO A;  3HJ1 A;  5DB6 A;  4NXX A;  3HWT A;  4OAH A;  3AUO A;  4JLX A;  4OAG A;  5JTG A;  3AU2 A;  4TUP A;  1HUO A;  4RQ5 A;  3PHZ A;  4KLF A;  5HHI A;  1TV9 A;  3MDA A;  1TFY A;  5J0X A;  4PHP A;  1ZQV A;  4PHD A;  1ZJN A;  4UBC A;  4EED A;  2ZH7 A;  4LEZ A;  2BBH A;  4F5P A;  1MIY A;  3UPS A;  8ICK A;  4M9H A;  1ZQC A;  2ZH5 A;  1ZQS A;  4KLD A;  2ID1 A;  3JPP A;  1ZQD A;  8ICY A;  5IIO A;  9ICU A;  4NKT A;  5HR9 A;  4K97 A;  2Q66 A;  1UEV A;  3AQN A;  9ICX A;  1VFG A;  3OVB A;  2ZH1 A;  4X4R A;  7ICM A;  4Z6C A;  9ICR A;  5DB8 A;  1WOT A;  9ICA A;  4M04 A;  5J29 A;  9ICE A;  2ZH2 A;  9ICJ A;  9ICW A;  2B51 A;  1ZQM A;  1VJ7 A;  4RPY A;  4FO1 A;  3MGI A;  8ICI A;  4KLE A;  4R66 A;  3ER9 B;  3ISC A;  1ZQY A;  4M9L A;  2BE3 A;  4I2D A;  2NRK A;  4WQL A;  4GXK A;  8ICO A;  4RQ1 A;  5CFT A;  4I2C A;  5IIL A;  1KNY A;  5DB7 A;  4UB2 A;  4QZF A;  5DBB A;  5HRG A;  3WFS C;  1ZQT A;  4WOY A;  8ICS A;  3UXP A;  4RQ8 A;  2DRA A;  8ICN A;  4NY8 A;  4O5E A;  1RPL A;  4RQ4 A;  3RJG A;  3H37 A;  3V7J A;  2FCL A;  4MFF A;  4YD1 A;  1BPX A;  1R8B A;  9ICI A;  4X5V A;  4HX0 A;  4KLQ A;  2ZH9 A;  3UPQ A;  9ICK A;  4WBY A;  2ISP A;  4LVS A;  3AU6 A;  1MIW A;  8ICA A;  4RPZ A;  4AT9 A;  3PNC A;  4RQ3 A;  1JAJ A;  4XUS A;  5J0S A;  3RJK A;  4Z6D A;  4KLO A;  8ICU A;  4K8V A;  4K96 A;  5B3Q A;  4XRH A;  1ZQG A;  5HRD A;  3JPT A;  9ICH A;  4RQ6 A;  4K99 A;  3PMN A;  1FA0 A;  1ZQA A;  4YMN A;  3EF2 A;  4WC1 A;  5J2J A;  3NWI A;  4IG8 A;  4WC3 A;  7ICE A;  1PX5 A;  4RQ7 A;  4RT3 A;  3C2K A;  1ZQW A;  5J2I A;  4KLH A;  3C2M A;  4WC5 A;  8ICF A;  3ISD A;  4UBB A;  4OAF A;  4EGW A;  4AT8 A;  4I2I A;  9ICT A;  3WFQ E;  2GAF D;  5CHE A;  4E80 A;  3NVO A;  2PFN A;  9ICP A;  7ICQ A;  8ICC A;  4DOC A;  4P4P A;  4JWM A;  4IQU A;  4UAY A;  8ICT A;  4S3N A;  3V7L A;  1ZQL A;  5D46 A;  2BPG A;  1KEJ A;  4X4O A;  4NM2 A;  4DO9 A;  4LT6 A;  5CWR A;  1ZQQ A;  4X4V A;  2M2U A;  7ICU A;  4QZ9 A;  2GWS A;  2M2V A;  5J2C A;  4R63 A;  4WC6 A;  1GPJ A;  1BPE A;  3RH6 A;  8ICP A;  4P2H A;  4K9B A;  4I2B A;  5F2V O;  4O5C A;  3MDC A;  1TVA A;  4GXI A;  4WQK A;  3AQM A;  7ICJ A;  3C5F A;  1R8A A;  7ICF A;  5CA7 A;  4UB5 A;  3MBY A;  1JN3 A;  4X4N A;  4KM5 A;  3LQC B;  4DOB A;  3AQL A;  5J0W A;  4KLS A;  4EBK A;  4QZG A;  8ICW A;  5J2E A;  5J2B A;  3HX0 A;  9ICG A;  7ICS A;  5J2G A;  4WC4 A;  1BPY A;  4M2Y A;  1ZQP A;  4EP7 A;  4R65 A;  5DB9 A;  4FH5 A;  4RQ0 A;  3ISB A;  9ICS A;  1YLQ A;  4NLZ A;  4K9A A;  5IIM A;  5D4B A;  7ICP A;  2ZHA A;  2P66 A;  5CFS A;  1JMS A;  1NOM A;  4LZD A;  5BPC A;  1ZJM A;  4ATB A;  3OVS A;  3B0Y A;  8ICL A;  9ICF A;  4ATB B;  4JLZ A;  4E7X A;  4X0A A;  5BOM A;  7ICK A;  1HUZ A;  5J0T A;  3L9D A;  8ICZ A;  5J0P A;  2I9G A;  8ICE A;  4PGY A;  4FHW A;  3K7D A;  4I27 A;  5HRE A;  2ISO A;  5DBA A;  4I29 A;  4UD5 A;  4NKU A;  8ICM A;  4QZE A;  3LK9 A;  4YMM A;  4FHX A;  4X4U A;  5CHG A;  2W9M A;  2O5A A;  3TFR A;  4K4G A;  4M9N A;  5HRK A;  4QZ8 A;  4FHY A;  4RT2 A;  1ZQO A;  3OV7 A;  5DBC A;  4OAI Z;  1MQ2 A;  3JPS A;  4UAZ A;  1XSN A;  1BPZ A;  3JPO A;  5HC9 A;  4FHV A;  2BCV A;  1R89 A;  1ZQF A;  4O68 A;  4LEV A;  5HHH A;  4AT9 B;  4PPX A;  3ERC C;  4N7R A;  1ZQZ A;  2BPC A;  2GA9 D;  4I2E A;  4KLL A;  5D61 A;  2EWR A;  4NXZ A;  5J2A A;  5J2K A;  4UD4 A;  4FO6 A;  2PFQ A;  3RJI A;  5DDY A;  5DDM A;  4MF8 A;  4I2H A;  4F5R A;  1ZQH A;  2PFP A;  1ZQU A;  4NXU A;  7ICH A;  1MIV A;  3MGH A;  4YD2 A;  4IQT A;  2IHM A;  2RFF A;  4WC0 A;  5IIJ A;  4XJE A;  1UEU A;  7ICR A;  9ICM A;  3JPR A;  3MCR A;  7ICT A;  4M9G A;  4LZG A;  1Q79 A;  5DED A;  1XSL A;  4EV6 A;  4LEY A;  7ICI A;  5BOL A;  4AT8 B;  2ZH4 A;  3HIY A;  4I0U A;  5CB1 A;  2IHO A;  8ICG A;  4M9J A;  4NXW A;  1ZQE A;  1BPD A;  3B0X A;  1XSP A;  9ICO A;  3V72 A;  3CK6 A;  4FH3 A;  5EOZ A;  2HHP A;  2B4V A;  3C5G A;  4WC7 A;  2FMQ A;  1F5A A;  4RPX A;  3JPN A;  4O5K A;  1ZQK A;  4M5D A;  5J0O A;  4X0B A;  1R8C A;  4QZD A;  9ICV A;  3WFP A;  5IIN A;  5III A;  4R64 A;  3JZ0 A;  3RH4 A;  4I2A A;  4MKP A;  4Z6F A;  4X4T A;  4NLK A;  3OUY A;  2PXI A;  5D63 A;  5J2H A;  4AT7 A;  2M2T A;  3C2L A;  4I2G A;  3OUY B;  2ZH3 A;  2DR5 A;  4P4O A;  3TFS A;  4AT7 B;  5HRF A;  1ZQR A;  2BCQ A;  4K4I A;  4I28 A;  7ICG A;  3NKU A;  1MQ3 A;  7ICL A;  3OGU A;  3UQ0 A;  2BPF A;  5D49 A;  3WFR E;  1ZQN A;  5J2F A;  2DRB A;  4PGQ A;  3PML A;  1Q78 A;  4TUS A;  9ICN A;  4UAW A;  3GDX A;  4WH5 A;  4F5N A;  4M0A A;  4I2J A;  1V4A A;  4NXV A;  4WC2 A;  1ZQI A;  4GXJ A;  3JYY A;  4I2F A;  4WCW A;  5J0U A;  5CFU A;  4IQV A;  2HN2 A;  4NXT A;  5CP2 A;  5CJ7 A;  2BCU A;  4EEB A;  4XA5 A;  2O1P A;  4UB4 A;  4JWN A;  4X4Q A;  2IUB A;  2ZH8 A;  4KLI A;  8ICR A;  7ICN A;  5B3P A;  1KDH A;  2BBJ A;  3UXN A;  4XQ8 A;  4MFA A;  4PGX A;  8ICH A;  3RJE A;  4MF2 A;  4RWN A;  4RWQ A;  5IIK A;  4DOA A;  2FMS A;  1NO5 A;  4RQ2 A;  2DVI A;  1UET A;  5CR0 A;  7ICO A;  8ICV A;  4FHP A;  4RWO A;  5HRI A;  2FMP A;  4Z6E A;  3JCF A;  5DKW A;  5HRH A;  4KLG A;  1JQR A;  4PHA A; 
#chains in the Genus database with same CATH homology
 2PBE A;  3H3A A;  1ZQX A;  4IQW A;  4QZA A;  4QZB A;  4NM1 A;  2B56 A;  4LEW A;  3RJH A;  3UQ2 A;  5HRB A;  4K98 A;  3RJF A;  4PHE A;  2ZH6 A;  4O69 A;  9ICC A;  3C18 A;  2BCS A;  5J0Y A;  9ICL A;  3NYB A;  5J2D A;  4TUR A;  8ICQ A;  3V7K A;  4EBJ A;  4KLM A;  4K4H A;  8ICX A;  4E8F A;  3OVA A;  3AQK A;  4NLN A;  4KLT A;  2PFO A;  2M2W A;  4O9M A;  5J0R A;  2DR8 A;  3WFO A;  4YN4 A;  3RJJ A;  5J0Q A;  1RZT A;  1ZQJ A;  3H38 A;  3C66 A;  2BCR A;  4O67 A;  3K75 D;  4YCX A;  4KLU A;  5TZV A;  8ICB A;  4KLJ A;  4KB6 A;  3UXO A;  4QZC A;  4P4M A;  3JPQ A;  9ICB A;  4M47 A;  8ICJ A;  2VAN A;  2ZHB A;  3HJ4 A;  1TFW A;  2DR9 A;  4WBZ A;  5HRL A;  2DR7 A;  4X4P A;  1BPB A;  4XQ7 A;  4QZI A;  4UB3 A;  4PH5 A;  3H39 A;  4F5Q A;  4TUQ A;  1OU5 A;  4UB1 A;  1ZQB A;  4F5O A;  3HW8 A;  3RH5 A;  4O6A A;  9ICQ A;  7ICV A;  4MFC A;  4QZH A;  4X4S A;  4RWP A;  4YMO A;  5DEC A;  3HJ1 A;  5DB6 A;  4NXX A;  3HWT A;  4OAH A;  3AUO A;  4JLX A;  4OAG A;  3AU2 A;  4TUP A;  1HUO A;  4RQ5 A;  4KLF A;  5HHI A;  1TV9 A;  3MDA A;  1TFY A;  5J0X A;  4PHP A;  1ZQV A;  4PHD A;  1ZJN A;  4UBC A;  2ZH7 A;  4LEZ A;  4F5P A;  1MIY A;  3UPS A;  8ICK A;  4M9H A;  1ZQC A;  2ZH5 A;  1ZQS A;  4KLD A;  2ID1 A;  3JPP A;  1ZQD A;  8ICY A;  5IIO A;  9ICU A;  4NKT A;  5HR9 A;  4K97 A;  2Q66 A;  1UEV A;  3AQN A;  9ICX A;  1VFG A;  3OVB A;  2ZH1 A;  4X4R A;  7ICM A;  4Z6C A;  9ICR A;  5DB8 A;  1WOT A;  9ICA A;  4M04 A;  5J29 A;  9ICE A;  2ZH2 A;  9ICJ A;  9ICW A;  2B51 A;  1ZQM A;  1VJ7 A;  4RPY A;  3MGI A;  8ICI A;  4KLE A;  4R66 A;  3ISC A;  1ZQY A;  4M9L A;  2BE3 A;  4I2D A;  2NRK A;  4GXK A;  8ICO A;  4RQ1 A;  4I2C A;  5IIL A;  1KNY A;  5DB7 A;  4UB2 A;  4QZF A;  5DBB A;  5HRG A;  3WFS C;  1ZQT A;  4WOY A;  8ICS A;  3UXP A;  4RQ8 A;  2DRA A;  8ICN A;  4NY8 A;  4O5E A;  1RPL A;  4RQ4 A;  3RJG A;  3H37 A;  3V7J A;  4MFF A;  4YD1 A;  1BPX A;  1R8B A;  9ICI A;  4X5V A;  4KLQ A;  2ZH9 A;  3UPQ A;  9ICK A;  4WBY A;  2ISP A;  4LVS A;  3AU6 A;  1MIW A;  8ICA A;  4RPZ A;  4AT9 A;  3PNC A;  4RQ3 A;  1JAJ A;  4XUS A;  5J0S A;  3RJK A;  4Z6D A;  4KLO A;  8ICU A;  4K8V A;  4K96 A;  1ZQG A;  4XRH A;  5HRD A;  3JPT A;  9ICH A;  4RQ6 A;  4K99 A;  3PMN A;  1FA0 A;  1ZQA A;  4YMN A;  4WC1 A;  5J2J A;  4IG8 A;  4WC3 A;  7ICE A;  1PX5 A;  4RQ7 A;  4RT3 A;  3C2K A;  1ZQW A;  5J2I A;  4KLH A;  3C2M A;  4WC5 A;  8ICF A;  3ISD A;  4UBB A;  4OAF A;  4AT8 A;  4I2I A;  9ICT A;  3WFQ E;  4E80 A;  2PFN A;  9ICP A;  7ICQ A;  8ICC A;  4DOC A;  4P4P A;  4JWM A;  4IQU A;  4UAY A;  8ICT A;  4S3N A;  3V7L A;  1ZQL A;  5D46 A;  2BPG A;  1KEJ A;  4X4O A;  4NM2 A;  4DO9 A;  4LT6 A;  5CWR A;  1ZQQ A;  4X4V A;  2M2U A;  7ICU A;  4QZ9 A;  2GWS A;  5J2C A;  2M2V A;  4R63 A;  4WC6 A;  1BPE A;  3RH6 A;  8ICP A;  4P2H A;  4K9B A;  4I2B A;  5F2V O;  4O5C A;  3MDC A;  1TVA A;  4GXI A;  3AQM A;  7ICJ A;  3C5F A;  1R8A A;  7ICF A;  5CA7 A;  4UB5 A;  3MBY A;  1JN3 A;  4X4N A;  4KM5 A;  3LQC B;  4DOB A;  3AQL A;  5J0W A;  4KLS A;  4EBK A;  4QZG A;  8ICW A;  5J2E A;  5J2B A;  3HX0 A;  9ICG A;  7ICS A;  5J2G A;  4WC4 A;  1BPY A;  4M2Y A;  1ZQP A;  4EP7 A;  4R65 A;  5DB9 A;  4FH5 A;  4RQ0 A;  3ISB A;  9ICS A;  1YLQ A;  4NLZ A;  4K9A A;  5IIM A;  5D4B A;  7ICP A;  2ZHA A;  2P66 A;  1JMS A;  1ZJM A;  1NOM A;  4LZD A;  5BPC A;  4ATB A;  3OVS A;  3B0Y A;  8ICL A;  9ICF A;  4ATB B;  4JLZ A;  4E7X A;  4X0A A;  5BOM A;  7ICK A;  1HUZ A;  5J0T A;  3L9D A;  8ICZ A;  5J0P A;  2I9G A;  8ICE A;  4PGY A;  4FHW A;  4I27 A;  5HRE A;  2ISO A;  5DBA A;  4I29 A;  4UD5 A;  4NKU A;  8ICM A;  4QZE A;  3LK9 A;  4YMM A;  4FHX A;  4X4U A;  5CHG A;  2W9M A;  2O5A A;  3TFR A;  4K4G A;  4M9N A;  5HRK A;  4QZ8 A;  4FHY A;  4RT2 A;  1ZQO A;  3OV7 A;  5DBC A;  4OAI Z;  1MQ2 A;  3JPS A;  4UAZ A;  1XSN A;  1BPZ A;  3JPO A;  5HC9 A;  4FHV A;  2BCV A;  1R89 A;  1ZQF A;  4O68 A;  4LEV A;  5HHH A;  4AT9 B;  4PPX A;  1ZQZ A;  2BPC A;  4I2E A;  4KLL A;  4NXZ A;  5J2K A;  5J2A A;  4UD4 A;  4FO6 A;  2PFQ A;  3RJI A;  5DDY A;  5DDM A;  4MF8 A;  4I2H A;  4F5R A;  1ZQH A;  2PFP A;  1ZQU A;  4NXU A;  7ICH A;  1MIV A;  3MGH A;  4IQT A;  4YD2 A;  2IHM A;  2RFF A;  4WC0 A;  5IIJ A;  7ICR A;  1UEU A;  9ICM A;  3JPR A;  7ICT A;  4M9G A;  4LZG A;  1Q79 A;  5DED A;  1XSL A;  4LEY A;  7ICI A;  5BOL A;  4AT8 B;  2ZH4 A;  3HIY A;  5CB1 A;  8ICG A;  4M9J A;  4NXW A;  1ZQE A;  1BPD A;  3B0X A;  1XSP A;  9ICO A;  3V72 A;  4FH3 A;  5EOZ A;  2HHP A;  2B4V A;  3C5G A;  4WC7 A;  2FMQ A;  1F5A A;  4RPX A;  3JPN A;  4O5K A;  1ZQK A;  4M5D A;  5J0O A;  4X0B A;  1R8C A;  4QZD A;  9ICV A;  3WFP A;  5IIN A;  5III A;  4R64 A;  3JZ0 A;  3RH4 A;  4I2A A;  4MKP A;  4Z6F A;  4X4T A;  4NLK A;  3OUY A;  2PXI A;  5J2H A;  4AT7 A;  2M2T A;  3C2L A;  4I2G A;  3OUY B;  2ZH3 A;  2DR5 A;  4P4O A;  3TFS A;  4AT7 B;  5HRF A;  1ZQR A;  2BCQ A;  4K4I A;  4I28 A;  7ICG A;  1MQ3 A;  7ICL A;  3OGU A;  3UQ0 A;  2BPF A;  5D49 A;  3WFR E;  1ZQN A;  5J2F A;  2DRB A;  4PGQ A;  3PML A;  1Q78 A;  4TUS A;  9ICN A;  4UAW A;  3GDX A;  4F5N A;  4M0A A;  4I2J A;  1V4A A;  4NXV A;  4WC2 A;  1ZQI A;  4GXJ A;  3JYY A;  4I2F A;  4WCW A;  5J0U A;  4IQV A;  4NXT A;  5CP2 A;  5CJ7 A;  2BCU A;  4XA5 A;  2O1P A;  4UB4 A;  4JWN A;  4X4Q A;  2ZH8 A;  4KLI A;  8ICR A;  7ICN A;  1KDH A;  3UXN A;  4XQ8 A;  4MFA A;  4PGX A;  8ICH A;  3RJE A;  4MF2 A;  4RWN A;  4RWQ A;  5IIK A;  4DOA A;  2FMS A;  1NO5 A;  4RQ2 A;  2DVI A;  1UET A;  5CR0 A;  7ICO A;  8ICV A;  4FHP A;  4RWO A;  5HRI A;  2FMP A;  4Z6E A;  5DKW A;  5HRH A;  4KLG A;  1JQR A;  4PHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...