4UD4A

Structural plasticity of cid1 provides a basis for its rna terminal uridylyl transferase activity
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
324
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGAFLQAARIPIIKLTSDGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFAFYAYAFEPREKVVTFRRPDGYLTKQEKGWTKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity of Cid1 provides a basis for its distributive RNA terminal uridylyl transferase activity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords POLY(A) RNA POLYMERASE PROTEIN CID1
total genus 107
structure length 324
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4ud4A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ud4A02
4NXZA 2BCSA 2B4VA 7ICGA 4PPXA 4F5NA 4MFFA 8ICBA 5DECA 4FH3A 4RQ2A 1PX5A 1TFWA 4RQ1A 4UB3A 4FHVA 2M2WA 3UPSA 2RFFA 4RWQA 1ZJNA 4ATBB 4E80A 4I2AA 3C2KA 8ICXA 1ZQEA 8ICYA 5IILA 3UXNA 4TUQA 3V7JA 9ICUA 4UD5A 4AT9A 5IIOA 3LK9A 4O5EA 3C18A 3UXOA 5HRLA 5J2AA 1ZQQA 1JN3A 5D46A 1ZQAA 4GXIA 4X4QA 1R8AA 1JMSA 3K75D 1ZQFA 2BCRA 4UBCA 5F2VO 4P4OA 2ZH9A 4FO6A 9ICCA 4QZGA 2FMQA 4RT3A 3UXPA 4YCXA 1MIVA 2ZH6A 1ZQDA 5J2HA 5J0QA 4TURA 4F5QA 4O9MA 4K4HA 1ZQGA 4KLTA 8ICEA 7ICIA 4M9GA 3AUOA 3MGHA 7ICTA 1XSLA 4I2CA 8ICPA 3H37A 4X4PA 3C5GA 2GWSA 4RWNA 1Q78A 4F5RA 7ICHA 3ISCA 5J0YA 1ZQSA 7ICOA 5HC9A 2FMSA 4M9LA 4PHPA 4TUSA 2BCQA 4LZDA 8ICJA 3V7LA 5DB9A 5DEDA 1ZQMA 4GXJA 4Z6FA 1V4AA 4I28A 3WFOA 1BPXA 1KDHA 5HRHA 4JWMA 3RJEA 3HX0A 5J0RA 1XSPA 8ICKA 5D49A 3MBYA 3H3AA 4I29A 5DDMA 5J0UA 4M0AA 4NM2A 3AQNA 4Z6CA 1BPBA 4X0BA 9ICSA 4KLFA 4WC2A 9ICKA 3UQ2A 3OUYB 4YMNA 1HUOA 4NM1A 4M9NA 4X0AA 2Q66A 4WC6A 2DR5A 3AU6A 1JAJA 4I2IA 2VANA 4QZ9A 4RQ7A 1TV9A 4I2DA 4M5DA 4UBBA 5CJ7A 3H38A 4K4GA 4I2EA 3WFRE 5CA7A 4RQ0A 4KLDA 4I2BA 8ICWA 4R64A 4QZHA 3JPQA 4DO9A 1ZQXA 1VFGA 1WOTA 2DRAA 1BPEA 4WBZA 2ZH3A 4RWPA 3AU2A 1FA0A 5DBCA 4KLMA 4M2YA 5HRGA 4UB1A 4YD1A 5HR9A 5J2FA 4RQ8A 1RZTA 5J0SA 4E7XA 4AT8B 3JPTA 4RPZA 9ICAA 7ICPA 1JQRA 3MDAA 3JYYA 3TFRA 1UETA 1ZQCA 5J2GA 3MDCA 2O5AA 4EBJA 1UEVA 4UB5A 4XA5A 3HWTA 4P4MA 4AT7B 8ICHA 2PFPA 2ZH7A 4FHXA 4DOCA 4E8FA 1ZQZA 4QZ8A 4ATBA 4RQ3A 3C2MA 4AT9B 3RH5A 5J2JA 4WC1A 4KLIA 8ICTA 1KNYA 5DKWA 4JWNA 4PHEA 5J2KA 4FHPA 4EP7A 4O5CA 4PGQA 5DB7A 4YMMA 1ZQLA 4X4RA 2FMPA 2NRKA 4QZFA 4QZIA 4F5OA 9ICXA 5IIKA 4PGYA 3LQCB 4P4PA 8ICRA 2ISOA 4WC0A 4RQ6A 5TZVA 5BOLA 4NLKA 5EOZA 4NKTA 4GXKA 5IIMA 4I2HA 3ISBA 4NLZA 8ICIA 2DRBA 3JPNA 5DBAA 5CB1A 4DOAA 4I2GA 4YMOA 4YD2A 4R63A 1RPLA 9ICQA 4M47A 2ZHBA 3GDXA 4XUSA 9ICWA 4FH5A 2DR8A 5D4BA 4WC3A 1TFYA 3OVAA 4I2FA 4M9HA 4X4SA 4P2HA 4K4IA 3OVSA 4MFAA 4KLOA 1YLQA 7ICMA 8ICNA 2B56A 3RH6A 5HRFA 7ICFA 4EBKA 7ICVA 3L9DA 3OV7A 4WBYA 4LT6A 4PH5A 5HRIA 9ICTA 2ZH5A 5J2CA 1BPZA 3AQLA 8ICOA 5J0XA 3C2LA 1ZQRA 5DBBA 1TVAA 5HRKA 2M2TA 1ZQVA 4R65A 1R8BA 1ZQIA 3WFSC 4UAWA 3B0XA 3TFSA 4KLEA 4QZAA 3ISDA 4YN4A 2ZHAA 4I27A 1KEJA 1Q79A 8ICZA 5J2BA 1ZQHA 4WC4A 9ICJA 5BOMA 3JPSA 3JZ0A 2PFOA 5HHHA 9ICVA 4Z6EA 2BPCA 8ICFA 4KLHA 4NKUA 2PXIA 1BPDA 1ZQNA 4M9JA 3V7KA 4X4NA 3AQKA 4X4UA 1ZQJA 4RT2A 3RJKA 3OGUA 3RJFA 4WC7A 4PHAA 4MF2A 2BE3A 5CP2A 5HREA 3OVBA 1ZQYA 2M2VA 9ICGA 4QZCA 4TUPA 4UB4A 5DDYA 2BCUA 1ZQBA 3UPQA 2PFQA 9ICNA 4RPXA 2ZH1A 7ICNA 5J0OA 2ID1A 4XQ8A 8ICQA 5J0TA 1ZJMA 8ICGA 5HHIA 5IINA 4QZBA 3HIYA 5CWRA 2O1PA 2ZH2A 4X4TA 4PHDA 2DR9A 3WFPA 1VJ7A 4AT8A 1ZQPA 7ICLA 1NOMA 4LZGA 2BPFA 3PMNA 7ICJA 4M04A 2I9GA 2ZH8A 1NO5A 1R89A 4NLNA 9ICPA 4UB2A 4KLUA 4UAZA 4PGXA 4KLJA 4LVSA 5J2DA 4I2JA 3RH4A 1MIWA 4QZEA 5CHGA 3UQ0A 4FHYA 4WC5A 4KLQA 4MF8A 2W9MA 3AQMA 1ZQKA 5DB6A 4X5VA 9ICFA 1XSNA 9ICIA 2HHPA 7ICUA 5J2IA 1BPYA 8ICAA 4IQUA 5J29A 5J0PA 2PFNA 3RJGA 4WCWA 4UAYA 5HRDA 5CR0A 2BPGA 9ICOA 8ICLA 2ISPA 8ICSA 1HUZA 1ZQWA 2DVIA 2DR7A 3RJIA 9ICBA 2BCVA 5HRBA 4RWOA 9ICLA 4RQ5A 3HW8A 8ICCA 3JPPA 3V72A 3RJJA 5BPCA 2PBEA 4IG8A 1F5AA 4MFCA 3C5FA 3H39A 4RPYA 9ICHA 4KLGA 3PNCA 8ICVA 4DOBA 3OUYA 4RQ4A 1R8CA 1OU5A 1ZQUA 1MIYA 2P66A 9ICRA 4R66A 8ICMA 3C66A 4IQWA 9ICEA 4O5KA 7ICEA 4FHWA 4XQ7A 7ICRA 1MQ2A 7ICKA 4NY8A 3NYBA 5J0WA 4QZDA 2B51A 4S3NA 1MQ3A 5DB8A 3JPOA 1ZQOA 4UD4A 2IHMA 7ICSA 5IIJA 3WFQE 5IIIA 1ZQTA 4IQTA 4XRHA 4Z6DA 4AT7A 2M2UA 4KLLA 5J2EA 3JPRA 3B0YA 4KLSA 8ICUA 3HJ4A 3MGIA 1UEUA 4F5PA 3HJ1A 3RJHA 2ZH4A 7ICQA 9ICMA 4IQVA 4X4VA 3PMLA 4X4OA
chains in the Genus database with same CATH superfamily
4NXZA 2BCSA 2B4VA 7ICGA 4PPXA 2FCLA 5B3PA 4F5NA 4MFFA 4HX0A 8ICBA 5DECA 4FH3A 4RQ2A 1PX5A 1TFWA 4RQ1A 4UB3A 4FHVA 2M2WA 3UPSA 2RFFA 4RWQA 1ZJNA 4ATBB 4LEZA 2GAFD 2HN2A 4E80A 4I2AA 3C2KA 8ICXA 1ZQEA 5D62A 5CFUA 8ICYA 5IILA 3UXNA 4TUQA 3V7JA 5CFTA 9ICUA 4UD5A 4AT9A 5IIOA 3LK9A 4O5EA 3C18A 3UXOA 4O67A 5HRLA 5J2AA 1ZQQA 1JN3A 4EEBA 5D46A 1ZQAA 4GXIA 4X4QA 1R8AA 1JMSA 3K75D 1ZQFA 2BCRA 4UBCA 5F2VO 4P4OA 2ZH9A 4FO6A 9ICCA 4QZGA 2FMQA 4RT3A 3UXPA 4YCXA 1MIVA 2ZH6A 1ZQDA 5J2HA 5J0QA 5B3QA 4TURA 4F5QA 4O9MA 4K4HA 1ZQGA 4KLTA 8ICEA 7ICIA 4M9GA 3AUOA 4I0UA 3MGHA 7ICTA 1XSLA 4I2CA 8ICPA 3H37A 4X4PA 3C5GA 2GWSA 4RWNA 1Q78A 4NXXA 4F5RA 7ICHA 3ISCA 5J0YA 1ZQSA 7ICOA 5HC9A 2FMSA 4M9LA 4PHPA 4TUSA 2BCQA 4LZDA 8ICJA 3V7LA 5DB9A 3ERCC 4LEYA 2IHOA 5DEDA 1ZQMA 4GXJA 4Z6FA 1V4AA 4I28A 3WFOA 1BPXA 1KDHA 5HRHA 4JWMA 3RJEA 3HX0A 5J0RA 1XSPA 8ICKA 5D49A 3MBYA 3H3AA 4I29A 5DDMA 5J0UA 4M0AA 3K7DA 4O69A 3AQNA 4NM2A 1BPBA 4Z6CA 4X0BA 9ICSA 4KLFA 4WC2A 9ICKA 3UQ2A 4WH5A 3OUYB 4YMNA 1HUOA 4NM1A 4LEWA 4M9NA 4X0AA 2Q66A 3PHZA 4WC6A 2DR5A 3AU6A 1JAJA 4OAIZ 1GPJA 4I2IA 3ER9B 2VANA 4QZ9A 4RQ7A 1TV9A 4I2DA 4M5DA 4UBBA 4K96A 5CJ7A 3H38A 4K4GA 4I2EA 3WFRE 5CA7A 4RQ0A 4KLDA 4I2BA 8ICWA 4R64A 4QZHA 3EF2A 3JPQA 4DO9A 1ZQXA 4K9AA 1VFGA 1WOTA 2DRAA 1BPEA 4WBZA 2ZH3A 4RWPA 3AU2A 1FA0A 5DBCA 4KLMA 4M2YA 4K9BA 5HRGA 4UB1A 4YD1A 5HR9A 5J2FA 4RQ8A 1RZTA 5J0SA 4FO1A 4E7XA 4AT8B 3JPTA 4RPZA 9ICAA 7ICPA 1JQRA 2GA9D 3MDAA 3JYYA 3TFRA 5D63A 1UETA 5JTGA 1ZQCA 5J2GA 3MDCA 2O5AA 4EBJA 1UEVA 4UB5A 4XA5A 3HWTA 4P4MA 4AT7B 8ICHA 2PFPA 2ZH7A 4FHXA 4DOCA 4E8FA 1ZQZA 4QZ8A 4ATBA 4RQ3A 3C2MA 4AT9B 3RH5A 5J2JA 4WC1A 4KLIA 8ICTA 1KNYA 5DKWA 4JWNA 4PHEA 5J2KA 2BBJA 4FHPA 4EP7A 4O5CA 3CK6A 4PGQA 5DB7A 4YMMA 1ZQLA 4X4RA 4O6AA 2FMPA 2NRKA 4QZFA 4QZIA 4F5OA 9ICXA 5IIKA 4PGYA 3LQCB 4NXWA 4P4PA 8ICRA 2ISOA 4MKPA 4WC0A 4K97A 4RQ6A 5TZVA 4K99A 2EWRA 5BOLA 4NLKA 5EOZA 4NKTA 4GXKA 5IIMA 4I2HA 3ISBA 4NLZA 8ICIA 4JLXA 2DRBA 5D61A 3JPNA 5DBAA 5CB1A 4DOAA 4N7RA 4I2GA 4YMOA 4YD2A 4R63A 1RPLA 9ICQA 4M47A 2BBHA 2ZHBA 3GDXA 4XUSA 9ICWA 4FH5A 2DR8A 5D4BA 4WC3A 1TFYA 2IUBA 4K8VA 3OVAA 4I2FA 4M9HA 4X4SA 4P2HA 4K4IA 3OVSA 4MFAA 4KLOA 1YLQA 7ICMA 8ICNA 2B56A 3RH6A 5HRFA 7ICFA 4EBKA 7ICVA 3OV7A 3L9DA 4WBYA 4LT6A 4PH5A 5HRIA 9ICTA 2ZH5A 5J2CA 1BPZA 3AQLA 8ICOA 5J0XA 3C2LA 1ZQRA 5DBBA 1TVAA 5HRKA 4NXUA 2M2TA 1ZQVA 4EV6A 1R8BA 4R65A 1ZQIA 3WFSC 4UAWA 3B0XA 3TFSA 4KLEA 4QZAA 3ISDA 4WQKA 4YN4A 2ZHAA 4I27A 1KEJA 1Q79A 8ICZA 5J2BA 1ZQHA 4WC4A 9ICJA 5BOMA 3JPSA 3JZ0A 2PFOA 5HHHA 9ICVA 4Z6EA 2BPCA 5CHEA 8ICFA 4KLHA 4NKUA 2PXIA 1BPDA 1ZQNA 4M9JA 3V7KA 4X4NA 3AQKA 4X4UA 1ZQJA 4RT2A 3RJKA 3OGUA 3RJFA 4WC7A 3OVBA 4PHAA 2BE3A 5CP2A 5HREA 4MF2A 1ZQYA 2M2VA 9ICGA 4QZCA 4TUPA 4UB4A 5DDYA 2BCUA 1ZQBA 3UPQA 2PFQA 3ER8C 9ICNA 2ZH1A 4RPXA 7ICNA 5J0OA 2ID1A 4XQ8A 8ICQA 5J0TA 1ZJMA 8ICGA 5HHIA 5IINA 4QZBA 5CWRA 3HIYA 2O1PA 2ZH2A 4X4TA 4PHDA 2DR9A 4AT8A 1VJ7A 3WFPA 1ZQPA 7ICLA 1NOMA 4LZGA 2BPFA 3PMNA 4EEDA 7ICJA 4M04A 3JCFA 4JLZA 2I9GA 2ZH8A 1NO5A 1R89A 4NLNA 9ICPA 4UB2A 4KLUA 4UAZA 4PGXA 4KLJA 4LVSA 5J2DA 4I2JA 3RH4A 1MIWA 4QZEA 5CHGA 2HN1A 4FHYA 4WC5A 3UQ0A 4KLQA 4OAGA 4KM5A 4MF8A 2W9MA 3AQMA 1ZQKA 5DB6A 4X5VA 9ICFA 1XSNA 9ICIA 2HHPA 7ICUA 5J2IA 1BPYA 8ICAA 4IQUA 5J29A 5J0PA 2PFNA 3RJGA 4WCWA 4UAYA 5HRDA 5CR0A 2BPGA 4OAHA 8ICLA 9ICOA 2ISPA 8ICSA 2DVIA 1ZQWA 1HUZA 3OWGA 4KB6A 2DR7A 3RJIA 9ICBA 2BCVA 5HRBA 4RWOA 9ICLA 4RQ5A 3HW8A 8ICCA 3NVOA 3JPPA 3V72A 3RJJA 5BPCA 2PBEA 4IG8A 1F5AA 4MFCA 3C5FA 3H39A 4RPYA 3NKUA 9ICHA 4KLGA 3PNCA 4NXTA 4WOYA 8ICVA 4DOBA 3OUYA 4RQ4A 1R8CA 1OU5A 1ZQUA 1MIYA 2P66A 9ICRA 4EGWA 4R66A 4XJEA 4K98A 5CFSA 8ICMA 3C66A 4IQWA 9ICEA 4O5KA 4WQLA 7ICEA 4FHWA 4XQ7A 7ICRA 4OAFA 1MQ2A 7ICKA 4NY8A 3NWIA 3NYBA 5J0WA 4S3NA 2B51A 4QZDA 1MQ3A 5DB8A 3JPOA 1ZQOA 4O68A 4UD4A 3MCRA 2IHMA 7ICSA 5IIJA 3WFQE 5IIIA 1ZQTA 4IQTA 4XRHA 4Z6DA 4AT7A 2M2UA 4KLLA 5J2EA 3JPRA 3B0YA 4KLSA 8ICUA 3HJ4A 3MGIA 1UEUA 4F5PA 3HJ1A 3RJHA 2ZH4A 7ICQA 9ICMA 4IQVA 4X4VA 3PMLA 4NXVA 4LEVA 4X4OA
chains in the Genus database with same CATH topology
4NXZA 2BCSA 2B4VA 7ICGA 4PPXA 4F5NA 4MFFA 8ICBA 5DECA 4FH3A 4RQ2A 1TFWA 1PX5A 4RQ1A 4UB3A 4FHVA 2M2WA 3UPSA 2RFFA 4RWQA 1ZJNA 4ATBB 4LEZA 4E80A 4I2AA 3C2KA 8ICXA 1ZQEA 8ICYA 5IILA 3UXNA 4TUQA 3V7JA 9ICUA 4UD5A 4AT9A 5IIOA 3LK9A 4O5EA 3C18A 3UXOA 4O67A 5HRLA 5J2AA 1ZQQA 1JN3A 5D46A 1ZQAA 4GXIA 4X4QA 1R8AA 1JMSA 3K75D 1ZQFA 2BCRA 4UBCA 5F2VO 4P4OA 2ZH9A 4FO6A 9ICCA 4QZGA 2FMQA 4RT3A 3UXPA 4YCXA 1MIVA 2ZH6A 1ZQDA 5J2HA 5J0QA 4TURA 4F5QA 4O9MA 4K4HA 1ZQGA 4KLTA 8ICEA 7ICIA 4M9GA 3AUOA 3MGHA 7ICTA 1XSLA 4I2CA 8ICPA 3H37A 4X4PA 3C5GA 2GWSA 4RWNA 1Q78A 4NXXA 4F5RA 7ICHA 3ISCA 5J0YA 1ZQSA 7ICOA 5HC9A 2FMSA 4M9LA 4PHPA 4TUSA 2BCQA 4LZDA 8ICJA 3V7LA 5DB9A 4LEYA 5DEDA 1ZQMA 4GXJA 4Z6FA 1V4AA 4I28A 3WFOA 1BPXA 1KDHA 5HRHA 4JWMA 3RJEA 3HX0A 5J0RA 1XSPA 8ICKA 5D49A 3MBYA 3H3AA 4I29A 5DDMA 5J0UA 4M0AA 4O69A 3AQNA 4NM2A 1BPBA 4Z6CA 4X0BA 9ICSA 4KLFA 4WC2A 9ICKA 3UQ2A 3OUYB 4YMNA 1HUOA 4NM1A 4LEWA 4M9NA 4X0AA 2Q66A 4WC6A 2DR5A 3AU6A 1JAJA 4OAIZ 4I2IA 2VANA 4QZ9A 4RQ7A 1TV9A 4I2DA 4M5DA 4UBBA 4K96A 5CJ7A 3H38A 4K4GA 4I2EA 3WFRE 5CA7A 4RQ0A 4KLDA 4I2BA 8ICWA 4R64A 4QZHA 3JPQA 4DO9A 1ZQXA 4K9AA 1VFGA 1WOTA 2DRAA 1BPEA 4WBZA 2ZH3A 4RWPA 3AU2A 1FA0A 5DBCA 4KLMA 4M2YA 4K9BA 5HRGA 4UB1A 4YD1A 5HR9A 5J2FA 4RQ8A 1RZTA 5J0SA 4E7XA 4AT8B 3JPTA 4RPZA 9ICAA 7ICPA 1JQRA 3MDAA 3JYYA 3TFRA 1UETA 1ZQCA 5J2GA 3MDCA 2O5AA 4EBJA 1UEVA 4UB5A 4XA5A 3HWTA 4P4MA 4AT7B 8ICHA 2PFPA 2ZH7A 4FHXA 4DOCA 4E8FA 1ZQZA 4QZ8A 4ATBA 4RQ3A 3C2MA 4AT9B 3RH5A 5J2JA 4WC1A 4KLIA 8ICTA 1KNYA 5DKWA 4JWNA 4PHEA 5J2KA 4FHPA 4EP7A 4O5CA 4PGQA 5DB7A 4YMMA 1ZQLA 4X4RA 4O6AA 2FMPA 2NRKA 4QZFA 4QZIA 4F5OA 9ICXA 5IIKA 4PGYA 3LQCB 4NXWA 4P4PA 8ICRA 2ISOA 4MKPA 4WC0A 4K97A 4RQ6A 5TZVA 4K99A 5BOLA 4NLKA 5EOZA 4NKTA 4GXKA 5IIMA 4I2HA 3ISBA 4NLZA 8ICIA 4JLXA 2DRBA 3JPNA 5DBAA 5CB1A 4DOAA 4I2GA 4YMOA 4YD2A 4R63A 1RPLA 9ICQA 4M47A 2ZHBA 3GDXA 4XUSA 9ICWA 4FH5A 2DR8A 5D4BA 4WC3A 1TFYA 4K8VA 3OVAA 4I2FA 4M9HA 4X4SA 4P2HA 4K4IA 3OVSA 4MFAA 4KLOA 1YLQA 7ICMA 8ICNA 2B56A 3RH6A 5HRFA 7ICFA 4EBKA 7ICVA 3OV7A 3L9DA 4WBYA 4LT6A 4PH5A 5HRIA 9ICTA 2ZH5A 5J2CA 1BPZA 3AQLA 8ICOA 5J0XA 3C2LA 1ZQRA 5DBBA 1TVAA 5HRKA 4NXUA 2M2TA 1ZQVA 4R65A 1R8BA 1ZQIA 3WFSC 4UAWA 3B0XA 3TFSA 4KLEA 4QZAA 3ISDA 4YN4A 2ZHAA 4I27A 1KEJA 1Q79A 8ICZA 5J2BA 1ZQHA 4WC4A 9ICJA 5BOMA 3JPSA 3JZ0A 2PFOA 5HHHA 9ICVA 4Z6EA 2BPCA 8ICFA 4KLHA 4NKUA 2PXIA 1BPDA 1ZQNA 4M9JA 3V7KA 4X4NA 3AQKA 4X4UA 1ZQJA 4RT2A 3RJKA 3OGUA 3RJFA 4WC7A 3OVBA 4PHAA 2BE3A 5CP2A 5HREA 4MF2A 1ZQYA 2M2VA 9ICGA 4QZCA 4TUPA 4UB4A 5DDYA 2BCUA 1ZQBA 3UPQA 2PFQA 9ICNA 2ZH1A 4RPXA 7ICNA 5J0OA 2ID1A 4XQ8A 8ICQA 5J0TA 1ZJMA 8ICGA 5HHIA 5IINA 4QZBA 5CWRA 3HIYA 2O1PA 2ZH2A 4X4TA 4PHDA 2DR9A 4AT8A 1VJ7A 3WFPA 1ZQPA 7ICLA 1NOMA 4LZGA 2BPFA 3PMNA 7ICJA 4M04A 4JLZA 2I9GA 2ZH8A 1NO5A 1R89A 4NLNA 9ICPA 4UB2A 4KLUA 4UAZA 4PGXA 4KLJA 4LVSA 5J2DA 4I2JA 3RH4A 1MIWA 4QZEA 5CHGA 3UQ0A 4FHYA 4WC5A 4KLQA 4OAGA 4KM5A 4MF8A 2W9MA 3AQMA 1ZQKA 5DB6A 4X5VA 9ICFA 1XSNA 9ICIA 2HHPA 7ICUA 5J2IA 1BPYA 8ICAA 4IQUA 5J29A 5J0PA 2PFNA 3RJGA 4WCWA 4UAYA 5HRDA 5CR0A 2BPGA 4OAHA 8ICLA 9ICOA 2ISPA 8ICSA 2DVIA 1ZQWA 1HUZA 4KB6A 2DR7A 3RJIA 9ICBA 2BCVA 5HRBA 4RWOA 9ICLA 4RQ5A 3HW8A 8ICCA 3JPPA 3V72A 3RJJA 5BPCA 2PBEA 4IG8A 1F5AA 4MFCA 3C5FA 3H39A 4RPYA 9ICHA 4KLGA 3PNCA 4NXTA 4WOYA 8ICVA 4DOBA 3OUYA 4RQ4A 1R8CA 1OU5A 1ZQUA 1MIYA 2P66A 9ICRA 4R66A 4K98A 8ICMA 3C66A 4IQWA 9ICEA 4O5KA 7ICEA 4FHWA 4XQ7A 7ICRA 4OAFA 1MQ2A 7ICKA 4NY8A 3NYBA 5J0WA 4QZDA 2B51A 4S3NA 1MQ3A 5DB8A 3JPOA 1ZQOA 4O68A 4UD4A 2IHMA 7ICSA 5IIJA 3WFQE 5IIIA 1ZQTA 4IQTA 4XRHA 4Z6DA 4AT7A 2M2UA 4KLLA 5J2EA 3JPRA 3B0YA 4KLSA 8ICUA 3HJ4A 3MGIA 1UEUA 4F5PA 3HJ1A 3RJHA 2ZH4A 7ICQA 9ICMA 4IQVA 4X4VA 3PMLA 4NXVA 4LEVA 4X4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXZ A;  2BCS A;  2B4V A;  7ICG A;  4PPX A;  4F5N A;  4MFF A;  8ICB A;  5DEC A;  4FH3 A;  4RQ2 A;  1PX5 A;  1TFW A;  4RQ1 A;  4UB3 A;  4FHV A;  2M2W A;  3UPS A;  2RFF A;  4RWQ A;  1ZJN A;  4ATB B;  4E80 A;  4I2A A;  3C2K A;  8ICX A;  1ZQE A;  8ICY A;  5IIL A;  3UXN A;  4TUQ A;  3V7J A;  9ICU A;  4UD5 A;  4AT9 A;  5IIO A;  3LK9 A;  4O5E A;  3C18 A;  3UXO A;  5HRL A;  5J2A A;  1ZQQ A;  1JN3 A;  5D46 A;  1ZQA A;  4GXI A;  4X4Q A;  1R8A A;  1JMS A;  3K75 D;  1ZQF A;  2BCR A;  4UBC A;  5F2V O;  4P4O A;  2ZH9 A;  4FO6 A;  9ICC A;  4QZG A;  2FMQ A;  4RT3 A;  3UXP A;  4YCX A;  1MIV A;  2ZH6 A;  1ZQD A;  5J2H A;  5J0Q A;  4TUR A;  4F5Q A;  4O9M A;  4K4H A;  1ZQG A;  4KLT A;  8ICE A;  7ICI A;  4M9G A;  3AUO A;  3MGH A;  7ICT A;  1XSL A;  4I2C A;  8ICP A;  3H37 A;  4X4P A;  3C5G A;  2GWS A;  4RWN A;  1Q78 A;  4F5R A;  7ICH A;  3ISC A;  5J0Y A;  1ZQS A;  7ICO A;  5HC9 A;  2FMS A;  4M9L A;  4PHP A;  4TUS A;  2BCQ A;  4LZD A;  8ICJ A;  3V7L A;  5DB9 A;  5DED A;  1ZQM A;  4GXJ A;  4Z6F A;  1V4A A;  4I28 A;  3WFO A;  1BPX A;  1KDH A;  5HRH A;  4JWM A;  3RJE A;  3HX0 A;  5J0R A;  1XSP A;  8ICK A;  5D49 A;  3MBY A;  3H3A A;  4I29 A;  5DDM A;  5J0U A;  4M0A A;  4NM2 A;  3AQN A;  4Z6C A;  1BPB A;  4X0B A;  9ICS A;  4KLF A;  4WC2 A;  9ICK A;  3UQ2 A;  3OUY B;  4YMN A;  1HUO A;  4NM1 A;  4M9N A;  4X0A A;  2Q66 A;  4WC6 A;  2DR5 A;  3AU6 A;  1JAJ A;  4I2I A;  2VAN A;  4QZ9 A;  4RQ7 A;  1TV9 A;  4I2D A;  4M5D A;  4UBB A;  5CJ7 A;  3H38 A;  4K4G A;  4I2E A;  3WFR E;  5CA7 A;  4RQ0 A;  4KLD A;  4I2B A;  8ICW A;  4R64 A;  4QZH A;  3JPQ A;  4DO9 A;  1ZQX A;  1VFG A;  1WOT A;  2DRA A;  1BPE A;  4WBZ A;  2ZH3 A;  4RWP A;  3AU2 A;  1FA0 A;  5DBC A;  4KLM A;  4M2Y A;  5HRG A;  4UB1 A;  4YD1 A;  5HR9 A;  5J2F A;  4RQ8 A;  1RZT A;  5J0S A;  4E7X A;  4AT8 B;  3JPT A;  4RPZ A;  9ICA A;  7ICP A;  1JQR A;  3MDA A;  3JYY A;  3TFR A;  1UET A;  1ZQC A;  5J2G A;  3MDC A;  2O5A A;  4EBJ A;  1UEV A;  4UB5 A;  4XA5 A;  3HWT A;  4P4M A;  4AT7 B;  8ICH A;  2PFP A;  2ZH7 A;  4FHX A;  4DOC A;  4E8F A;  1ZQZ A;  4QZ8 A;  4ATB A;  4RQ3 A;  3C2M A;  4AT9 B;  3RH5 A;  5J2J A;  4WC1 A;  4KLI A;  8ICT A;  1KNY A;  5DKW A;  4JWN A;  4PHE A;  5J2K A;  4FHP A;  4EP7 A;  4O5C A;  4PGQ A;  5DB7 A;  4YMM A;  1ZQL A;  4X4R A;  2FMP A;  2NRK A;  4QZF A;  4QZI A;  4F5O A;  9ICX A;  5IIK A;  4PGY A;  3LQC B;  4P4P A;  8ICR A;  2ISO A;  4WC0 A;  4RQ6 A;  5TZV A;  5BOL A;  4NLK A;  5EOZ A;  4NKT A;  4GXK A;  5IIM A;  4I2H A;  3ISB A;  4NLZ A;  8ICI A;  2DRB A;  3JPN A;  5DBA A;  5CB1 A;  4DOA A;  4I2G A;  4YMO A;  4YD2 A;  4R63 A;  1RPL A;  9ICQ A;  4M47 A;  2ZHB A;  3GDX A;  4XUS A;  9ICW A;  4FH5 A;  2DR8 A;  5D4B A;  4WC3 A;  1TFY A;  3OVA A;  4I2F A;  4M9H A;  4X4S A;  4P2H A;  4K4I A;  3OVS A;  4MFA A;  4KLO A;  1YLQ A;  7ICM A;  8ICN A;  2B56 A;  3RH6 A;  5HRF A;  7ICF A;  4EBK A;  7ICV A;  3L9D A;  3OV7 A;  4WBY A;  4LT6 A;  4PH5 A;  5HRI A;  9ICT A;  2ZH5 A;  5J2C A;  1BPZ A;  3AQL A;  8ICO A;  5J0X A;  3C2L A;  1ZQR A;  5DBB A;  1TVA A;  5HRK A;  2M2T A;  1ZQV A;  4R65 A;  1R8B A;  1ZQI A;  3WFS C;  4UAW A;  3B0X A;  3TFS A;  4KLE A;  4QZA A;  3ISD A;  4YN4 A;  2ZHA A;  4I27 A;  1KEJ A;  1Q79 A;  8ICZ A;  5J2B A;  1ZQH A;  4WC4 A;  9ICJ A;  5BOM A;  3JPS A;  3JZ0 A;  2PFO A;  5HHH A;  9ICV A;  4Z6E A;  2BPC A;  8ICF A;  4KLH A;  4NKU A;  2PXI A;  1BPD A;  1ZQN A;  4M9J A;  3V7K A;  4X4N A;  3AQK A;  4X4U A;  1ZQJ A;  4RT2 A;  3RJK A;  3OGU A;  3RJF A;  4WC7 A;  4PHA A;  4MF2 A;  2BE3 A;  5CP2 A;  5HRE A;  3OVB A;  1ZQY A;  2M2V A;  9ICG A;  4QZC A;  4TUP A;  4UB4 A;  5DDY A;  2BCU A;  1ZQB A;  3UPQ A;  2PFQ A;  9ICN A;  4RPX A;  2ZH1 A;  7ICN A;  5J0O A;  2ID1 A;  4XQ8 A;  8ICQ A;  5J0T A;  1ZJM A;  8ICG A;  5HHI A;  5IIN A;  4QZB A;  3HIY A;  5CWR A;  2O1P A;  2ZH2 A;  4X4T A;  4PHD A;  2DR9 A;  3WFP A;  1VJ7 A;  4AT8 A;  1ZQP A;  7ICL A;  1NOM A;  4LZG A;  2BPF A;  3PMN A;  7ICJ A;  4M04 A;  2I9G A;  2ZH8 A;  1NO5 A;  1R89 A;  4NLN A;  9ICP A;  4UB2 A;  4KLU A;  4UAZ A;  4PGX A;  4KLJ A;  4LVS A;  5J2D A;  4I2J A;  3RH4 A;  1MIW A;  4QZE A;  5CHG A;  3UQ0 A;  4FHY A;  4WC5 A;  4KLQ A;  4MF8 A;  2W9M A;  3AQM A;  1ZQK A;  5DB6 A;  4X5V A;  9ICF A;  1XSN A;  9ICI A;  2HHP A;  7ICU A;  5J2I A;  1BPY A;  8ICA A;  4IQU A;  5J29 A;  5J0P A;  2PFN A;  3RJG A;  4WCW A;  4UAY A;  5HRD A;  5CR0 A;  2BPG A;  9ICO A;  8ICL A;  2ISP A;  8ICS A;  1HUZ A;  1ZQW A;  2DVI A;  2DR7 A;  3RJI A;  9ICB A;  2BCV A;  5HRB A;  4RWO A;  9ICL A;  4RQ5 A;  3HW8 A;  8ICC A;  3JPP A;  3V72 A;  3RJJ A;  5BPC A;  2PBE A;  4IG8 A;  1F5A A;  4MFC A;  3C5F A;  3H39 A;  4RPY A;  9ICH A;  4KLG A;  3PNC A;  8ICV A;  4DOB A;  3OUY A;  4RQ4 A;  1R8C A;  1OU5 A;  1ZQU A;  1MIY A;  2P66 A;  9ICR A;  4R66 A;  8ICM A;  3C66 A;  4IQW A;  9ICE A;  4O5K A;  7ICE A;  4FHW A;  4XQ7 A;  7ICR A;  1MQ2 A;  7ICK A;  4NY8 A;  3NYB A;  5J0W A;  4QZD A;  2B51 A;  4S3N A;  1MQ3 A;  5DB8 A;  3JPO A;  1ZQO A;  4UD4 A;  2IHM A;  7ICS A;  5IIJ A;  3WFQ E;  5III A;  1ZQT A;  4IQT A;  4XRH A;  4Z6D A;  4AT7 A;  2M2U A;  4KLL A;  5J2E A;  3JPR A;  3B0Y A;  4KLS A;  8ICU A;  3HJ4 A;  3MGI A;  1UEU A;  4F5P A;  3HJ1 A;  3RJH A;  2ZH4 A;  7ICQ A;  9ICM A;  4IQV A;  4X4V A;  3PML A;  4X4O A; 
#chains in the Genus database with same CATH topology
 4NXZ A;  2BCS A;  2B4V A;  7ICG A;  4PPX A;  2FCL A;  5B3P A;  4F5N A;  4MFF A;  4HX0 A;  8ICB A;  5DEC A;  4FH3 A;  4RQ2 A;  1PX5 A;  1TFW A;  4RQ1 A;  4UB3 A;  4FHV A;  2M2W A;  3UPS A;  2RFF A;  4RWQ A;  1ZJN A;  4ATB B;  4LEZ A;  2GAF D;  2HN2 A;  4E80 A;  4I2A A;  3C2K A;  8ICX A;  1ZQE A;  5D62 A;  5CFU A;  8ICY A;  5IIL A;  3UXN A;  4TUQ A;  3V7J A;  5CFT A;  9ICU A;  4UD5 A;  4AT9 A;  5IIO A;  3LK9 A;  4O5E A;  3C18 A;  3UXO A;  4O67 A;  5HRL A;  5J2A A;  1ZQQ A;  1JN3 A;  4EEB A;  5D46 A;  1ZQA A;  4GXI A;  4X4Q A;  1R8A A;  1JMS A;  3K75 D;  1ZQF A;  2BCR A;  4UBC A;  5F2V O;  4P4O A;  2ZH9 A;  4FO6 A;  9ICC A;  4QZG A;  2FMQ A;  4RT3 A;  3UXP A;  4YCX A;  1MIV A;  2ZH6 A;  1ZQD A;  5J2H A;  5J0Q A;  5B3Q A;  4TUR A;  4F5Q A;  4O9M A;  4K4H A;  1ZQG A;  4KLT A;  8ICE A;  7ICI A;  4M9G A;  3AUO A;  4I0U A;  3MGH A;  7ICT A;  1XSL A;  4I2C A;  8ICP A;  3H37 A;  4X4P A;  3C5G A;  2GWS A;  4RWN A;  1Q78 A;  4NXX A;  4F5R A;  7ICH A;  3ISC A;  5J0Y A;  1ZQS A;  7ICO A;  5HC9 A;  2FMS A;  4M9L A;  4PHP A;  4TUS A;  2BCQ A;  4LZD A;  8ICJ A;  3V7L A;  5DB9 A;  3ERC C;  4LEY A;  2IHO A;  5DED A;  1ZQM A;  4GXJ A;  4Z6F A;  1V4A A;  4I28 A;  3WFO A;  1BPX A;  1KDH A;  5HRH A;  4JWM A;  3RJE A;  3HX0 A;  5J0R A;  1XSP A;  8ICK A;  5D49 A;  3MBY A;  3H3A A;  4I29 A;  5DDM A;  5J0U A;  4M0A A;  3K7D A;  4O69 A;  3AQN A;  4NM2 A;  1BPB A;  4Z6C A;  4X0B A;  9ICS A;  4KLF A;  4WC2 A;  9ICK A;  3UQ2 A;  4WH5 A;  3OUY B;  4YMN A;  1HUO A;  4NM1 A;  4LEW A;  4M9N A;  4X0A A;  2Q66 A;  3PHZ A;  4WC6 A;  2DR5 A;  3AU6 A;  1JAJ A;  4OAI Z;  1GPJ A;  4I2I A;  3ER9 B;  2VAN A;  4QZ9 A;  4RQ7 A;  1TV9 A;  4I2D A;  4M5D A;  4UBB A;  4K96 A;  5CJ7 A;  3H38 A;  4K4G A;  4I2E A;  3WFR E;  5CA7 A;  4RQ0 A;  4KLD A;  4I2B A;  8ICW A;  4R64 A;  4QZH A;  3EF2 A;  3JPQ A;  4DO9 A;  1ZQX A;  4K9A A;  1VFG A;  1WOT A;  2DRA A;  1BPE A;  4WBZ A;  2ZH3 A;  4RWP A;  3AU2 A;  1FA0 A;  5DBC A;  4KLM A;  4M2Y A;  4K9B A;  5HRG A;  4UB1 A;  4YD1 A;  5HR9 A;  5J2F A;  4RQ8 A;  1RZT A;  5J0S A;  4FO1 A;  4E7X A;  4AT8 B;  3JPT A;  4RPZ A;  9ICA A;  7ICP A;  1JQR A;  2GA9 D;  3MDA A;  3JYY A;  3TFR A;  5D63 A;  1UET A;  5JTG A;  1ZQC A;  5J2G A;  3MDC A;  2O5A A;  4EBJ A;  1UEV A;  4UB5 A;  4XA5 A;  3HWT A;  4P4M A;  4AT7 B;  8ICH A;  2PFP A;  2ZH7 A;  4FHX A;  4DOC A;  4E8F A;  1ZQZ A;  4QZ8 A;  4ATB A;  4RQ3 A;  3C2M A;  4AT9 B;  3RH5 A;  5J2J A;  4WC1 A;  4KLI A;  8ICT A;  1KNY A;  5DKW A;  4JWN A;  4PHE A;  5J2K A;  2BBJ A;  4FHP A;  4EP7 A;  4O5C A;  3CK6 A;  4PGQ A;  5DB7 A;  4YMM A;  1ZQL A;  4X4R A;  4O6A A;  2FMP A;  2NRK A;  4QZF A;  4QZI A;  4F5O A;  9ICX A;  5IIK A;  4PGY A;  3LQC B;  4NXW A;  4P4P A;  8ICR A;  2ISO A;  4MKP A;  4WC0 A;  4K97 A;  4RQ6 A;  5TZV A;  4K99 A;  2EWR A;  5BOL A;  4NLK A;  5EOZ A;  4NKT A;  4GXK A;  5IIM A;  4I2H A;  3ISB A;  4NLZ A;  8ICI A;  4JLX A;  2DRB A;  5D61 A;  3JPN A;  5DBA A;  5CB1 A;  4DOA A;  4N7R A;  4I2G A;  4YMO A;  4YD2 A;  4R63 A;  1RPL A;  9ICQ A;  4M47 A;  2BBH A;  2ZHB A;  3GDX A;  4XUS A;  9ICW A;  4FH5 A;  2DR8 A;  5D4B A;  4WC3 A;  1TFY A;  2IUB A;  4K8V A;  3OVA A;  4I2F A;  4M9H A;  4X4S A;  4P2H A;  4K4I A;  3OVS A;  4MFA A;  4KLO A;  1YLQ A;  7ICM A;  8ICN A;  2B56 A;  3RH6 A;  5HRF A;  7ICF A;  4EBK A;  7ICV A;  3OV7 A;  3L9D A;  4WBY A;  4LT6 A;  4PH5 A;  5HRI A;  9ICT A;  2ZH5 A;  5J2C A;  1BPZ A;  3AQL A;  8ICO A;  5J0X A;  3C2L A;  1ZQR A;  5DBB A;  1TVA A;  5HRK A;  4NXU A;  2M2T A;  1ZQV A;  4EV6 A;  1R8B A;  4R65 A;  1ZQI A;  3WFS C;  4UAW A;  3B0X A;  3TFS A;  4KLE A;  4QZA A;  3ISD A;  4WQK A;  4YN4 A;  2ZHA A;  4I27 A;  1KEJ A;  1Q79 A;  8ICZ A;  5J2B A;  1ZQH A;  4WC4 A;  9ICJ A;  5BOM A;  3JPS A;  3JZ0 A;  2PFO A;  5HHH A;  9ICV A;  4Z6E A;  2BPC A;  5CHE A;  8ICF A;  4KLH A;  4NKU A;  2PXI A;  1BPD A;  1ZQN A;  4M9J A;  3V7K A;  4X4N A;  3AQK A;  4X4U A;  1ZQJ A;  4RT2 A;  3RJK A;  3OGU A;  3RJF A;  4WC7 A;  3OVB A;  4PHA A;  2BE3 A;  5CP2 A;  5HRE A;  4MF2 A;  1ZQY A;  2M2V A;  9ICG A;  4QZC A;  4TUP A;  4UB4 A;  5DDY A;  2BCU A;  1ZQB A;  3UPQ A;  2PFQ A;  3ER8 C;  9ICN A;  2ZH1 A;  4RPX A;  7ICN A;  5J0O A;  2ID1 A;  4XQ8 A;  8ICQ A;  5J0T A;  1ZJM A;  8ICG A;  5HHI A;  5IIN A;  4QZB A;  5CWR A;  3HIY A;  2O1P A;  2ZH2 A;  4X4T A;  4PHD A;  2DR9 A;  4AT8 A;  1VJ7 A;  3WFP A;  1ZQP A;  7ICL A;  1NOM A;  4LZG A;  2BPF A;  3PMN A;  4EED A;  7ICJ A;  4M04 A;  3JCF A;  4JLZ A;  2I9G A;  2ZH8 A;  1NO5 A;  1R89 A;  4NLN A;  9ICP A;  4UB2 A;  4KLU A;  4UAZ A;  4PGX A;  4KLJ A;  4LVS A;  5J2D A;  4I2J A;  3RH4 A;  1MIW A;  4QZE A;  5CHG A;  2HN1 A;  4FHY A;  4WC5 A;  3UQ0 A;  4KLQ A;  4OAG A;  4KM5 A;  4MF8 A;  2W9M A;  3AQM A;  1ZQK A;  5DB6 A;  4X5V A;  9ICF A;  1XSN A;  9ICI A;  2HHP A;  7ICU A;  5J2I A;  1BPY A;  8ICA A;  4IQU A;  5J29 A;  5J0P A;  2PFN A;  3RJG A;  4WCW A;  4UAY A;  5HRD A;  5CR0 A;  2BPG A;  4OAH A;  8ICL A;  9ICO A;  2ISP A;  8ICS A;  2DVI A;  1ZQW A;  1HUZ A;  3OWG A;  4KB6 A;  2DR7 A;  3RJI A;  9ICB A;  2BCV A;  5HRB A;  4RWO A;  9ICL A;  4RQ5 A;  3HW8 A;  8ICC A;  3NVO A;  3JPP A;  3V72 A;  3RJJ A;  5BPC A;  2PBE A;  4IG8 A;  1F5A A;  4MFC A;  3C5F A;  3H39 A;  4RPY A;  3NKU A;  9ICH A;  4KLG A;  3PNC A;  4NXT A;  4WOY A;  8ICV A;  4DOB A;  3OUY A;  4RQ4 A;  1R8C A;  1OU5 A;  1ZQU A;  1MIY A;  2P66 A;  9ICR A;  4EGW A;  4R66 A;  4XJE A;  4K98 A;  5CFS A;  8ICM A;  3C66 A;  4IQW A;  9ICE A;  4O5K A;  4WQL A;  7ICE A;  4FHW A;  4XQ7 A;  7ICR A;  4OAF A;  1MQ2 A;  7ICK A;  4NY8 A;  3NWI A;  3NYB A;  5J0W A;  4S3N A;  2B51 A;  4QZD A;  1MQ3 A;  5DB8 A;  3JPO A;  1ZQO A;  4O68 A;  4UD4 A;  3MCR A;  2IHM A;  7ICS A;  5IIJ A;  3WFQ E;  5III A;  1ZQT A;  4IQT A;  4XRH A;  4Z6D A;  4AT7 A;  2M2U A;  4KLL A;  5J2E A;  3JPR A;  3B0Y A;  4KLS A;  8ICU A;  3HJ4 A;  3MGI A;  1UEU A;  4F5P A;  3HJ1 A;  3RJH A;  2ZH4 A;  7ICQ A;  9ICM A;  4IQV A;  4X4V A;  3PML A;  4NXV A;  4LEV A;  4X4O A; 
#chains in the Genus database with same CATH homology
 4NXZ A;  2BCS A;  2B4V A;  7ICG A;  4PPX A;  4F5N A;  4MFF A;  8ICB A;  5DEC A;  4FH3 A;  4RQ2 A;  1TFW A;  1PX5 A;  4RQ1 A;  4UB3 A;  4FHV A;  2M2W A;  3UPS A;  2RFF A;  4RWQ A;  1ZJN A;  4ATB B;  4LEZ A;  4E80 A;  4I2A A;  3C2K A;  8ICX A;  1ZQE A;  8ICY A;  5IIL A;  3UXN A;  4TUQ A;  3V7J A;  9ICU A;  4UD5 A;  4AT9 A;  5IIO A;  3LK9 A;  4O5E A;  3C18 A;  3UXO A;  4O67 A;  5HRL A;  5J2A A;  1ZQQ A;  1JN3 A;  5D46 A;  1ZQA A;  4GXI A;  4X4Q A;  1R8A A;  1JMS A;  3K75 D;  1ZQF A;  2BCR A;  4UBC A;  5F2V O;  4P4O A;  2ZH9 A;  4FO6 A;  9ICC A;  4QZG A;  2FMQ A;  4RT3 A;  3UXP A;  4YCX A;  1MIV A;  2ZH6 A;  1ZQD A;  5J2H A;  5J0Q A;  4TUR A;  4F5Q A;  4O9M A;  4K4H A;  1ZQG A;  4KLT A;  8ICE A;  7ICI A;  4M9G A;  3AUO A;  3MGH A;  7ICT A;  1XSL A;  4I2C A;  8ICP A;  3H37 A;  4X4P A;  3C5G A;  2GWS A;  4RWN A;  1Q78 A;  4NXX A;  4F5R A;  7ICH A;  3ISC A;  5J0Y A;  1ZQS A;  7ICO A;  5HC9 A;  2FMS A;  4M9L A;  4PHP A;  4TUS A;  2BCQ A;  4LZD A;  8ICJ A;  3V7L A;  5DB9 A;  4LEY A;  5DED A;  1ZQM A;  4GXJ A;  4Z6F A;  1V4A A;  4I28 A;  3WFO A;  1BPX A;  1KDH A;  5HRH A;  4JWM A;  3RJE A;  3HX0 A;  5J0R A;  1XSP A;  8ICK A;  5D49 A;  3MBY A;  3H3A A;  4I29 A;  5DDM A;  5J0U A;  4M0A A;  4O69 A;  3AQN A;  4NM2 A;  1BPB A;  4Z6C A;  4X0B A;  9ICS A;  4KLF A;  4WC2 A;  9ICK A;  3UQ2 A;  3OUY B;  4YMN A;  1HUO A;  4NM1 A;  4LEW A;  4M9N A;  4X0A A;  2Q66 A;  4WC6 A;  2DR5 A;  3AU6 A;  1JAJ A;  4OAI Z;  4I2I A;  2VAN A;  4QZ9 A;  4RQ7 A;  1TV9 A;  4I2D A;  4M5D A;  4UBB A;  4K96 A;  5CJ7 A;  3H38 A;  4K4G A;  4I2E A;  3WFR E;  5CA7 A;  4RQ0 A;  4KLD A;  4I2B A;  8ICW A;  4R64 A;  4QZH A;  3JPQ A;  4DO9 A;  1ZQX A;  4K9A A;  1VFG A;  1WOT A;  2DRA A;  1BPE A;  4WBZ A;  2ZH3 A;  4RWP A;  3AU2 A;  1FA0 A;  5DBC A;  4KLM A;  4M2Y A;  4K9B A;  5HRG A;  4UB1 A;  4YD1 A;  5HR9 A;  5J2F A;  4RQ8 A;  1RZT A;  5J0S A;  4E7X A;  4AT8 B;  3JPT A;  4RPZ A;  9ICA A;  7ICP A;  1JQR A;  3MDA A;  3JYY A;  3TFR A;  1UET A;  1ZQC A;  5J2G A;  3MDC A;  2O5A A;  4EBJ A;  1UEV A;  4UB5 A;  4XA5 A;  3HWT A;  4P4M A;  4AT7 B;  8ICH A;  2PFP A;  2ZH7 A;  4FHX A;  4DOC A;  4E8F A;  1ZQZ A;  4QZ8 A;  4ATB A;  4RQ3 A;  3C2M A;  4AT9 B;  3RH5 A;  5J2J A;  4WC1 A;  4KLI A;  8ICT A;  1KNY A;  5DKW A;  4JWN A;  4PHE A;  5J2K A;  4FHP A;  4EP7 A;  4O5C A;  4PGQ A;  5DB7 A;  4YMM A;  1ZQL A;  4X4R A;  4O6A A;  2FMP A;  2NRK A;  4QZF A;  4QZI A;  4F5O A;  9ICX A;  5IIK A;  4PGY A;  3LQC B;  4NXW A;  4P4P A;  8ICR A;  2ISO A;  4MKP A;  4WC0 A;  4K97 A;  4RQ6 A;  5TZV A;  4K99 A;  5BOL A;  4NLK A;  5EOZ A;  4NKT A;  4GXK A;  5IIM A;  4I2H A;  3ISB A;  4NLZ A;  8ICI A;  4JLX A;  2DRB A;  3JPN A;  5DBA A;  5CB1 A;  4DOA A;  4I2G A;  4YMO A;  4YD2 A;  4R63 A;  1RPL A;  9ICQ A;  4M47 A;  2ZHB A;  3GDX A;  4XUS A;  9ICW A;  4FH5 A;  2DR8 A;  5D4B A;  4WC3 A;  1TFY A;  4K8V A;  3OVA A;  4I2F A;  4M9H A;  4X4S A;  4P2H A;  4K4I A;  3OVS A;  4MFA A;  4KLO A;  1YLQ A;  7ICM A;  8ICN A;  2B56 A;  3RH6 A;  5HRF A;  7ICF A;  4EBK A;  7ICV A;  3OV7 A;  3L9D A;  4WBY A;  4LT6 A;  4PH5 A;  5HRI A;  9ICT A;  2ZH5 A;  5J2C A;  1BPZ A;  3AQL A;  8ICO A;  5J0X A;  3C2L A;  1ZQR A;  5DBB A;  1TVA A;  5HRK A;  4NXU A;  2M2T A;  1ZQV A;  4R65 A;  1R8B A;  1ZQI A;  3WFS C;  4UAW A;  3B0X A;  3TFS A;  4KLE A;  4QZA A;  3ISD A;  4YN4 A;  2ZHA A;  4I27 A;  1KEJ A;  1Q79 A;  8ICZ A;  5J2B A;  1ZQH A;  4WC4 A;  9ICJ A;  5BOM A;  3JPS A;  3JZ0 A;  2PFO A;  5HHH A;  9ICV A;  4Z6E A;  2BPC A;  8ICF A;  4KLH A;  4NKU A;  2PXI A;  1BPD A;  1ZQN A;  4M9J A;  3V7K A;  4X4N A;  3AQK A;  4X4U A;  1ZQJ A;  4RT2 A;  3RJK A;  3OGU A;  3RJF A;  4WC7 A;  3OVB A;  4PHA A;  2BE3 A;  5CP2 A;  5HRE A;  4MF2 A;  1ZQY A;  2M2V A;  9ICG A;  4QZC A;  4TUP A;  4UB4 A;  5DDY A;  2BCU A;  1ZQB A;  3UPQ A;  2PFQ A;  9ICN A;  2ZH1 A;  4RPX A;  7ICN A;  5J0O A;  2ID1 A;  4XQ8 A;  8ICQ A;  5J0T A;  1ZJM A;  8ICG A;  5HHI A;  5IIN A;  4QZB A;  5CWR A;  3HIY A;  2O1P A;  2ZH2 A;  4X4T A;  4PHD A;  2DR9 A;  4AT8 A;  1VJ7 A;  3WFP A;  1ZQP A;  7ICL A;  1NOM A;  4LZG A;  2BPF A;  3PMN A;  7ICJ A;  4M04 A;  4JLZ A;  2I9G A;  2ZH8 A;  1NO5 A;  1R89 A;  4NLN A;  9ICP A;  4UB2 A;  4KLU A;  4UAZ A;  4PGX A;  4KLJ A;  4LVS A;  5J2D A;  4I2J A;  3RH4 A;  1MIW A;  4QZE A;  5CHG A;  3UQ0 A;  4FHY A;  4WC5 A;  4KLQ A;  4OAG A;  4KM5 A;  4MF8 A;  2W9M A;  3AQM A;  1ZQK A;  5DB6 A;  4X5V A;  9ICF A;  1XSN A;  9ICI A;  2HHP A;  7ICU A;  5J2I A;  1BPY A;  8ICA A;  4IQU A;  5J29 A;  5J0P A;  2PFN A;  3RJG A;  4WCW A;  4UAY A;  5HRD A;  5CR0 A;  2BPG A;  4OAH A;  8ICL A;  9ICO A;  2ISP A;  8ICS A;  2DVI A;  1ZQW A;  1HUZ A;  4KB6 A;  2DR7 A;  3RJI A;  9ICB A;  2BCV A;  5HRB A;  4RWO A;  9ICL A;  4RQ5 A;  3HW8 A;  8ICC A;  3JPP A;  3V72 A;  3RJJ A;  5BPC A;  2PBE A;  4IG8 A;  1F5A A;  4MFC A;  3C5F A;  3H39 A;  4RPY A;  9ICH A;  4KLG A;  3PNC A;  4NXT A;  4WOY A;  8ICV A;  4DOB A;  3OUY A;  4RQ4 A;  1R8C A;  1OU5 A;  1ZQU A;  1MIY A;  2P66 A;  9ICR A;  4R66 A;  4K98 A;  8ICM A;  3C66 A;  4IQW A;  9ICE A;  4O5K A;  7ICE A;  4FHW A;  4XQ7 A;  7ICR A;  4OAF A;  1MQ2 A;  7ICK A;  4NY8 A;  3NYB A;  5J0W A;  4QZD A;  2B51 A;  4S3N A;  1MQ3 A;  5DB8 A;  3JPO A;  1ZQO A;  4O68 A;  4UD4 A;  2IHM A;  7ICS A;  5IIJ A;  3WFQ E;  5III A;  1ZQT A;  4IQT A;  4XRH A;  4Z6D A;  4AT7 A;  2M2U A;  4KLL A;  5J2E A;  3JPR A;  3B0Y A;  4KLS A;  8ICU A;  3HJ4 A;  3MGI A;  1UEU A;  4F5P A;  3HJ1 A;  3RJH A;  2ZH4 A;  7ICQ A;  9ICM A;  4IQV A;  4X4V A;  3PML A;  4NXV A;  4LEV A;  4X4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...