2VANA

Nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
245
structure length
240
Chain Sequence
DDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLQPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERSE BETA
publication title Mismatched Dntp Incorporation by DNA Polymerase Beta Does not Proceed Via Globally Different Conformational Pathways.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 82
structure length 240
sequence length 245
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2vanA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2vanA03
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2vanA02
4YQWA 3SI8A 3HJ4A 2BCUA 5J2IA 4AT9B 4J9KA 1NOMA 5CR0A 5EWEA 4NM1A 3H3AA 8ICHA 2XCPA 9ICMA 1SKWA 4Z6FA 4QWEA 4RQ4A 1S0OA 4BXOA 1SL1A 1ZJNA 4JV0A 5DB6A 5KFEA 8ICXA 5KFUA 4F4YA 3V72A 8ICIA 2HHVA 4ATBB 4RQ5A 4YN4A 2KN7A 4TURA 3WFRE 1K1QA 3RJFA 2I9GA 2NRTA 2DPIA 1S0VA 3AQNA 5CJ7A 1XSNA 1R89A 4J9SA 4RNNA 2KFNA 3UQ2A 9ICTA 2ZH3A 1ZJMA 4YG2A 2BPFA 4C8KA 3AU6A 3PW0A 1B43A 1BPXA 1ZQDA 1IM4A 2VA3A 3OVAA 9ICIA 9ICQA 8ICGA 7ICNA 4DOCA 4DS4A 1ZQTA 3PX6A 4C8LA 3H8JA 4MFCA 3RB4A 5DB9A 2FPLA 3LDAA 5BOLA 2JEJA 1DOQA 4P2HA 2R8JA 4RPXA 4WC1A 4XQ7A 4NM2A 5J0RA 4X4RA 4KLLA 3PO5A 5HHHA 1RPLA 1XWLA 3B0YA 2A1JA 5KG4A 3PX4A 5HREA 4FHXA 4EBCA 4ED7A 4DSLA 4QZGA 2W9BB 2BDPA 4PPXA 1ZQUA 4J9MA 2AGQA 1CEZA 1EXNA 1PZNA 2XGPA 7ICSA 5KT3A 4RQ2A 2ASDA 4DF4A 4UD5A 1U4BA 1TV9A 5KFZA 5C5JA 5KFYA 3QZ7A 4CCHA 4NKUA 8ICAA 1X9SA 2M9NA 3AQMA 3TAQA 4KLIA 4M04A 3GILA 4UBBA 4PHAA 4EZ6A 4TQRA 4FBUA 1TK5A 4I2CA 2FPMA 3RR8A 4WC5A 1S10A 4O3QA 3ZDEA 1MQ2A 1R8CA 3BQ1A 3ZD8A 4KLQA 1ZQWA 4X5VA 2ZH8A 3LK9A 4O3NA 4FHVA 3JZ0A 4IRKA 9ICKA 2DRAA 3BJYA 3PMLA 9ICNA 4I28A 4O5EA 4R8UA 7ICGA 2FPKA 7ICOA 7ICLA 1IXRA 5DB8A 2HHUA 1ZQPA 4F4ZA 2BQUA 5KFVA 5CHGA 4EBKA 3OSPA 2OWOA 2PI4A 2BCVA 5J2KA 4HYKA 4KLFA 4RWPA 4J9PA 3THVA 7ICFA 8ICZA 4WBYA 1XO1A 3UXNA 4RQ7A 5F9LA 1U47A 5IIIA 1ZQCA 4O3SA 5KFWA 2PFPA 1MSWD 3T5JA 3TFRA 2M2UA 3LWLA 1Z00A 3RH5A 4RT2A 3T5HA 3JPSA 1ZQQA 2A1JB 1COOA 3ISDA 2BPGA 2ZH1A 2XY7A 4I2GA 3PR4A 4EYIB 1Q78A 2ZTEA 3SV3A 3RJEA 4UQGA 2ZHAA 5J2EA 4YR3A 1CUKA 5KT2A 1T4GA 3C2MA 5KT6A 1RXWA 5DEDA 1V4AA 2DR8A 3OSNA 5KG6A 4ED8A 8ICFA 1L3VA 9ICAA 1RYRA 4YR0A 4X4PA 4WCWA 8ICJA 4F4WA 4G3IA 4PGQA 5DLFA 5KG1A 2J6SA 4Q8EA 4F4XA 4E0DA 3C1YA 1TAUA 2C22A 2HW3A 4ECUA 5DGBA 3UPSA 1BVSA 1BPBA 2DFLA 4QZEA 4F5PA 2BCSA 4WC0A 2XGQA 5BPCA 1SKSA 4FH3A 4K4GA 1LV5A 1KFTA 1JX4A 3PX0A 3RJHA 3SV4A 4DOAA 2BE3A 4AT7A 5KG7A 3N4MB 5J0SA 1MQ3A 2KTQA 3RJJA 9ICUA 3RTVA 1KFDA 4PHDA 3GV7B 1V9PA 5L1LA 3IHQB 2JEIA 4YVZA 4RZRA 4O0IA 4EEYA 1KDHA 1K1SA 2ALZA 1BPZA 1D8YA 5KFMA 3M9MB 3H8SA 4ECWA 2PFNA 2AJQA 1Q79A 1ZQXA 2BCQA 1UEUA 1YLQA 4XRHA 1SL2A 2VA2A 4P4OA 3JPNA 3AUOA 2RDJA 3RB0A 5KFFA 3C2LA 2BPCA 2C2EA 8ICMA 3RH6A 2JZBB 4YMMA 4J9NA 1F5AA 5KFRA 4RNOA 2ZUDA 2R8IA 2W9AA 4XA5A 2IMWP 3UXOA 4LZGA 4KLHA 3JPTA 9ICGA 5HRLA 3RBDA 4YXMA 2BKEA 5J2CA 1NKBA 3HW8A 5D4BA 4DQPA 2KFZA 8ICLA 4ED6A 4O5KA 3H37A 4I29A 7ICRA 2PFQA 4DEZA 2W9CA 4RPYA 4IQWA 4KLGA 4KLTA 4YMNA 5IIKA 5J2GA 2ISOA 5DGAA 3EPGA 5IIMA 4ED3A 4JV2A 1TFRA 2VA8A 2BQRA 5KFHA 5DDYA 4ECXA 4X4OA 2NRXA 4DSFA 4DQSA 4PHEA 5KG2A 4B9NA 4QZHA 1ZQSA 3Q8QB 1UA1A 3V7KA 3ISBA 3C1ZA 2J6UA 3H8WA 8ICSA 4QZ9A 5L1JA 1D9FA 2IHNA 3UPQA 3Q8KA 1FA0A 2C2DA 1TK8A 2AGOA 1ZQJA 1JXEA 1QTMA 4EYHB 5DKWA 1KFSA 4Q8FA 2ZJ5A 3H4DA 1S97A 1SL0A 3E2EA 3M9OB 5J0QA 7ICIA 4F4KA 4J9QA 4E8FA 1KEJA 2PFOA 4F3OA 3LQCB 1BPDA 4IQVA 3M8RA 5DBBA 3ETLA 5EWGA 1UEVA 4JUZA 2ZH2A 4RQ3A 3MDCA 2R8GA 3V6HA 1ZQOA 3Q8RB 4X4VA 5HRFA 2HHPA 4BDPA 3FDSA 4KLJA 5HMLA 4KN4A 4WC6A 1MIYA 4QWDA 3MBYA 3EPIA 2ID1A 4JK1A 1ZQEA 2NRZA 1L3TA 1ZQLA 4DQQA 1H38A 2R8KA 4UAYA 2BQ3A 4IRDA 4JV1A 2HHQA 1MC8A 4DLGA 7ICQA 5KFBA 8ICCA 2P6RA 5DECA 4DL2A 3C18A 4M6WA 3C23A 4QZBA 4B9SA 5D49A 3QEBZ 2MUTA 1JXLA 9ICWA 2JEGA 5J0YA 4ECZA 1T3NA 1KNYA 5DQGA 4DLEA 1U45A 2ASLA 2PXIA 4BXOB 4ELUA 4F5RA 4ECSA 3BQ2A 4DL7A 4I2EA 8ICWA 3RR7A 1JIHA 1ZQGA 9ICLA 4KMUA 4RWQA 4I2DA 1AROP 1U49A 7ICMA 3MR2A 5KFXA 5KFIA 3TFSA 8ICUA 5HRBA 2NRKA 1NK6A 5KTQA 2ZH5A 4KLOA 1ZETA 4X4UA 1N48A 1WOTA 5DG7A 2ZH7A 2BHNA 1BPYA 4QW9A 3H7IA 2V4RA 4LVSA 1JAJA 3WFQE 4EZ9A 5L1KA 3ZDDA 3JYYA 5KG3A 4DF8A 8ICQA 4BWJA 4C8MA 5J0OA 4MEXA 3IM1A 2HHTA 5IIOA 3PY8A 4DSJA 3PNCA 3MABA 4IRCA 5DQIA 3HWTA 3KHGA 1S77D 4M9JA 3MR6A 5DG9A 3EZ5A 4EBJA 3EWAA 3GV5B 2F1JA 5KFDA 3PR5B 4ECRA 3WFPA 4Q43A 4YCXA 2ZUBA 3T5KA 2ZTCA 3TARA 4B9MA 5J0UA 1HJPA 4FS1A 3KHRA 4IG8A 1ZQKA 3TANA 4NXZA 5CP2A 2IA6A 4MEYA 4MFFA 5CB1A 2JEFA 3RH4A 9ICBA 4O3OA 5HRIA 5KT5A 4P4PA 4NLKA 5HRKA 3GFKB 5J29A 4QZFA 4UBCA 3AQKA 1NK0A 4FBTA 4RQ1A 2MUTB 4R65A 2XC9A 3H4BA 2FMSA 3MR3A 1T7PA 2NRWA 4DQIA 4I2AA 1MIWA 1OU5A 3HIYA 5J2HA 4ZH4A 4X4TA 1SZPA 5JUMA 4Z6CA 3GIIA 3MR5A 3OUYA 3ZD9A 3QEAZ 4E80A 3MFIA 3RB6A 3PV8A 2HVHA 2M2TA 4NY8A 5KG0A 4R8UB 3V6KA 1N56A 4XUSA 5KFKA 4Q45A 3NGDA 1NK8A 1WCNA 5J2DA 4F91B 1JMSA 4Q44A 4R63A 1ZQIA 4AT9A 4ELTA 5KT7A 3WFSC 2R8HA 2MAXA 3HP6A 1NJYA 3ORYA 7ICVA 4NLGA 4M9LA 9ICCA 4MFAA 2J6TA 3TI0A 1L3UA 1DGSA 4BWMA 3GDXA 2Y1JA 3UQ0A 4DWIA 2UVWA 1ZQHA 4ECTA 2ISPA 4I2FA 2V9WA 3HT3A 7ICPA 2O1PA 4ATBA 4NLNA 8ICBA 3RRGA 2NRVA 4RWOA 3K4GA 3RRHA 3RAXA 3H40A 4J9OA 7ICTA 4J9LA 5CA7A 4GXIA 1Z00B 5J0XA 1QSYA 3PMNA 4UB3A 3NTUA 3JPPA 4F50A 4B9TA 5J2JA 5DDMA 4ED2A 3N97B 3TQ1A 4WC2A 2HVIA 4YD2A 4QZCA 4DL3A 4DL4A 3PW2A 4B9LA 4KLSA 3EYZA 3FYHA 9ICJA 4M0AA 3T5LA 3KTQA 2XCAA 3KHLA 4ED0A 4GC6A 1ZQYA 1ZQAA 9ICPA 4GXJA 4F92B 3NYBA 7ICUA 4GXKA 4S3NA 5EOZA 4RNMA 2BR0A 4LZDA 4PGXA 1XSLA 3PO4A 7ICJA 1ZQRA 4NLZA 9ICVA 4FH5A 4LT6A 4YXJA 1PX5A 2XY6A 5D46A 4ELVA 5HNKA 2AU0A 1TKDA 3ZDBA 4ECVA 2LYHA 3MFHA 1L3SA 2P66A 3OHAA 1RYSA 2HHSA 1X9WA 5EWFA 5HR9A 1KTQA 4RWNA 4GC7A 2ASJA 2IBKA 4RQ0A 4O9MA 8ICYA 5HRDA 4AT7B 5KFLA 2W9MA 4DFPA 1L5UA 4M5DA 4FO6A 4DSKA 4IQTA 2RDIA 3SZ2A 4QZIA 3Q8PB 4M9HA 4UAWA 2VANA 4JWMA 2P6UA 3HJ1A 1Z3EB 4UD4A 4UB4A 8ICRA 2ZH4A 4M2YA 4I27A 9ICRA 4UAZA 4M9NA 2KZMA 5HRGA 3Q8SB 2W8KA 4QWAA 1ZQZA 1SKRA 4WC7A 1XC9A 3GQCA 1ZQNA 3M8SA 4F5OA 4EBDA 1XSPA 3EW9A 1KLNA 1KRPA 3OVSA 3OV7A 5KT4A 7ICKA 5HC9A 1NK9A 1S0MA 4R66A 3PVXA 5CWRA 1NK5A 2WTFA 1RXVA 4XQ8A 4BGDA 1UA0A 4TUQA 4ED1A 2W9CB 1S9FA 4O5CA 9ICOA 3RAQA 3RB3A 2M2WA 4Z6DA 4ECYA 1A76A 2H5XA 4MF8A 4PGYA 4QWCA 3HX0A 1TVAA 3G6XA 4O3PA 1D9DA 1R8AA 5BOMA 3T3FA 4E7XA 5DBCA 7ICEA 3RBEA 4RUCA 1ZQMA 4KTQA 4FHWA 4QZAA 8ICKA 3C5GA 3AU2A 4DOBA 1NO5A 4YMOA 8ICVA 4M9GA 5J0TA 4F5QA 2FMPA 1NK7A 2PBEA 2ZH6A 3BQTA 4X0AA 4ECQA 3GIJA 4DL6A 4UB1A 4I2HA 5KFQA 3V7LA 3QE9Y 3H39A 5KFTA 3UXPA 1MIVA 4C8NA 4UB2A 1NKCA 4M47A 4KLUA 2DPJA 2Q0ZX 4PH5A 1U9LA 1UT5A 4TUPA 3OHBA 1XS9D 1ZQFA 1BPEA 2FLLA 4C8OA 2FLPA 5J0WA 3H38A 4YFKA 1KSPA 3B0XA 4P4MA 3HPOA 5DLGA 3QZ8A 5DB7A 5IILA 2M2VA 4IQUA 1ZQVA 3C5FA 2F1IA 5KFJA 4RQ8A 4AT8A 4EP7A 4EBEA 5IINA 2AQ0A 5IIJA 5J0PA 4RPZA 1BGXT 4QWBA 4GLXA 3PW4A 2ZH9A 4K4HA 1R8BA 4IR9A 5KFAA 4MF2A 3Q8LA 4NKTA 3KHHA 9ICSA 2ZJAA 4DO9A 4KITB 1NJXA 8ICNA 4WBZA 4IR1A 4M6WB 3JPOA 2ZTDA 3SYZA 2FLNA 2UVRA 2KZZA 5L1IA 4UB5A 4DFKA 3TAPA 2IHMA 2O5AA 5KFNA 1D8LA 5L9XA 2PI5A 5KFGA 2DR5A 5F9NA 4DS5A 1TK0A 3RJKA 4KLDA 1X2IA 2C28A 2JZBA 9ICEA 8ICTA 4R64A 1S76D 5KFOA 1RZTA 2AGPA 4B9UA 4I2IA 5TZVA 2ZHBA 4JWNA 4WC4A 5HHIA 2HHWA 2XO7A 5F2VO 2DVIA 1WCLA 4WC3A 4F2SA 2XY5A 3PW5A 4RT3A 4RU9A 3M9NB 2DR9A 4RUAA 3C2KA 3JPRA 1UT8A 1Y88A 4I2BA 2BCRA 3BDPA 5KG5A 4DFMA 8ICPA 4QW8A 5KFCA 3LWMA 2C2RA 1UETA 5J2FA 5HMMA 1A77A 3RJGA 4F93B 1NJWA 9ICFA 3OVBA 3L9DA 4DSEA 1TFYA 2AQ4A 8ICEA 5DG8A 2ZJ8A 5KFPA 3G6VA 3MGHA 4QZ8A 4FHYA 3GV8B 5HRHA 2DR7A 2I1QA 4F2RA 1VJ7A 4TQSA 1VFGA 3WFOA 5J2AA 3OJUA 1QSSA 1NKEA 3AQLA 1TFWA 1NK4A 9ICXA 3GIKA 4X4NA 2HHXA 4F8RA 1C7YA 2RFFA 2F1HA 3OJSA 3PW7A 4AT8B 4YD1A 1B22A 1S0NA 4K4IA 3JPQA 4KLMA 5DQHA 3V6JA 4KN7A 4FS2A 4DQRA 4Z6EA 1JN3A 4B9VA 1JQRA 2KZ3A 1U48A 3MDAA 2B21A 3C21A 4YP3A 4F5NA 4O3RA 1TAQA 2ATLA 4J9RA 3C66A 4FHPA 4X0BA 5HP4A 2Y1IA 4X4SA 2DRBA 4KLEA 2ZUCA 3RJIA 4DSIA 3V7JA 1HUOA 1XU4A 4QZDA 4YR2A 3GIMA 4RQ6A 1ZYQA 1QSLA 5J2BA 3OGUA 4DL5A 2BGWA 2GWSA 2UVUA 8ICOA 2Q66A 3MGIA 3Q8MA 2UVVA 4PHPA 4DFJA 1LB2B 2W9BA 3BQ0A 3ZDAA 3K75D 1NJZA 4TUSA 2W8LA 3OUYB 4X4QA 4I2JA 1QLNA 1HUZA 3ISCA 5DBAA 1ZQBA 3G6YA 1T8EA 5KFSA 2FMQA 3ZDCA 1X9MA 9ICHA 7ICHA 2V4QA
chains in the Genus database with same CATH superfamily
4BJQA 5J2IA 2MSNA 4AT9B 2DL0A 4OJ5A 3BQ7A 5KAFU 4J9KA 4NM1A 4OJOA 1TAMA 4F4YA 3V72A 8ICIA 2HHVA 3BZCA 4RQ5A 4TURA 1K1QA 2RHFA 4MHVA 1S0VA 5ALIA 1R89A 4J9SA 1JALA 2IOHA 3UQ2A 2ZH3A 1SWWA 4YG2A 2BPFA 4FZLA 1IM4A 2VA3A 9ICIA 1M6YA 4C8LA 5DB9A 3AQEA 2R8JA 5CFSA 5J0RA 3PO5A 1SV0A 5KG4A 5ALWA 2BDUA 4QZGA 2GAFD 1ZQUA 3QU9A 5KT3A 2HBJA 4RQ2A 4DF4A 1U4BA 4NKUA 8ICAA 2M9NA 3AQMA 2EWRA 3TAQA 2GOLA 4UBBA 4I2CA 4WC5A 3RR8A 2DQNB 1R8CA 1GPJA 4IRKA 9ICKA 3BS5A 3AMZA 7ICGA 3IG8A 3A0BU 7ICOA 1IXRA 5DB8A 5L1MA 5KFVA 7ICFA 4NLCA 4WBYA 2EZXA 5IIIA 1ZQCA 2HDOA 1Q8KA 3LWLA 1ZQQA 2A1JB 3ISDA 3PR4A 4EYIB 4YR3A 1CUKA 5KT6A 3KKAC 3OSNA 5KG6A 1L3VA 4YR0A 4G3IA 2J6SA 5J8YC 1TAUA 3O0FA 2HW3A 5DGBA 3UPSA 1BVSA 1BPBA 2KHVA 4QZEA 5AKZA 2BCSA 2HOFA 1SKSA 1LV5A 1BNPA 3PX0A 2BE3A 1SWVA 2LKYA 3GV7B 4YVZA 3CK6A 1K1SA 4ECWA 2PFNA 3WK4A 3WK5A 4DFDA 1ZQXA 1YLQA 4XRHA 1SL2A 3AUOA 2W04A 1S5LU 1YT3A 3M6KA 5AM5A 2IMWP 4DQPA 5J2CA 3HW8A 4O5KA 2JR5A 2EAPA 4BX9C 3EPGA 4ED3A 2DKZA 5ALSA 4ECXA 2VJ4A 4CRXA 3V7KA 3H8WA 3ZI4A 4Y2VA 1D9FA 1TK8A 1V85A 1ZRNA 3I28A 1KFSA 2AXTU 1JUDA 1KEJA 2PFOA 4JLZA 2W43A 4IQVA 4LJXA 3ETLA 2WF6A 2ZIWB 4RQ3A 5AM0A 3V6HA 2MU2A 3Q8RB 2KP7A 5HRFA 3ER8C 3NVZA 3AM9A 3D2NA 1ZQEA 2NRZA 1PVPA 1L3TA 4PJ0U 4IRDA 3IV6A 2VJ5A 8ICCA 4DL2A 4M6WA 5H2FU 9ICWA 3QEBZ 2W3SA 3H0MB 2KOBA 2GH1A 2KIVA 4ELUA 2D8CA 3IN5A 2DWQA 1OW5A 9ICLA 4KMUA 5AIBA 1AROP 1SGGA 5C0YA 2E8MA 2OHFA 4KLOA 2ZXIA 1L7NA 2ZH7A 2BHNA 1PVQA 3H7IA 2V4RA 2E1EA 2YQEA 4EZ9A 3JYYA 2HSZA 2B0CA 2QARA 3MABA 5KNIA 5DQIA 1NZBA 1S77D 3MR6A 5DG9A 3EZ5A 3GV5B 2F1JA 1FEZA 2KKPA 1HJPA 2RRDA 4UAVA 2JEFA 2KV2A 2Y9UA 4UBCA 2MUTB 2FMSA 3MR3A 3HIYA 2ZIVA 4B6JA 2H3VA 1SZPA 4C4RA 1DGJA 5AI4A 2EAMA 3RB6A 3PV8A 2HVHA 4R8UB 2KK0A 2Q4TA 3NGDA 1NK8A 4F91B 4Q44A 4AT9A 1ZQIA 5KT7A 2R8HA 2MAXA 4Y2PA 9ICCA 4MFAA 1L3UA 4O3MA 2IHOA 3LVWA 2WAQC 2V9WA 1SB3C 3HT3A 4OAIZ 3RRGA 4RWOA 3L3FX 3RAXA 4J9OA 2WHEA 5CA7A 4GXIA 1ZD5A 3K7DA 4UB3A 4ED2A 4Y2RA 2A1AA 3FYHA 4M0AA 3KHLA 5JRTA 4C4TA 4GXJA 9ICPA 4S3NA 2BR0A 4LZDA 4PGXA 4OJ6A 4YXJA 1TKDA 4ECVA 2YX8A 3OHAA 2HHSA 1X9WA 1F5SA 2O6KA 4RQ0A 4DFPA 2N1RA 4FO6A 4IQTA 4QZIA 4M9HA 4UAWA 2VANA 4M2YA 2OXOA 2XVTA 3N7SC 1SXDA 4EELA 2W8KA 4QWAA 4Y2JA 1XC9A 3M8SA 1KRPA 3EW9A 2MA1A 5AHXA 1KLNA 3OV7A 5KT4A 1NK5A 3SD7A 4XQ8A 4BGDA 4K97A 9ICOA 2W9CB 1S9FA 3MCRA 4ECYA 4K96A 1A76A 1TVAA 7ICEA 4KTQA 4CF3A 4FHWA 2P35A 3C5GA 3AU2A 4IS7A 4M9GA 1LKYB 3SAFA 2HMXA 1NK7A 2F77X 3V7LA 4C0ZA 2JHDA 3UXPA 4C80A 2ZG6A 4UB2A 1QQ5A 4UW9A 1NKCA 1MIVA 1PK3A 2W7OA 4KLUA 2DPJA 4PH5A 3OHBA 4TUPA 1UT5A 1SV4A 2CXYA 1Q3VA 4YFKA 3L5KA 5CEHA 5DB7A 3A0HU 4EP7A 5KFJA 4RQ8A 4RPZA 5A0LA 4K4HA 4FO1A 5KFAA 3E0FA 1IIPA 3FAHA 2KVCA 4GFJA 3AEVA 9ICSA 4KITB 3JPOA 5AKEA 4UB5A 2IHMA 5KFNA 2PI5A 2DR5A 1TK0A 1X2IA 2YN4A 2C28A 2EH9A 4R64A 5KFOA 2ZHBA 4P0QB 5E79U 2LM4A 4RU9A 3M9NB 4GIBA 3C2KA 2VKQA 3CW2C 3SQIA 2BCRA 4DFMA 4QW8A 5HMMA 1A77A 1ZOLA 3OVBA 4DSEA 2AQ4A 3VC8A 5HRHA 2DR7A 4F2RA 1VJ7A 3L4PA 3OJUA 1NKEA 9ICXA 4X4NA 3NWIA 2E3TA 4EX6A 1AQ6A 4K4IA 4KN7A 3QUCA 2ZIWA 1JQRA 2KZ3A 1U48A 2KG5A 4J9RA 5K4LA 5AKJA 4LEWA 4KLEA 3V7JA 3ETRA 4QZDA 3PSFA 3GIMA 4DL5A 2GWSA 8ICOA 5ALYA 3MGIA 2UVVA 5AM3A 2W9BA 3ZDAA 1NZPA 1Q3UA 4TUSA 3G6YA 1T8EA 9ICHA 4NXUA 1X9MA 4NJ8A 3HJ4A 3H3AA 2KEYA 1SKWA 3MGVA 5KFEA 4ATBB 1J2NA 3WFRE 4OCZA 2NRTA 2DPIA 2I9GA 1V38A 2KVSA 4RQMA 2KFNA 9ICTA 3DEEA 3RF9A 1F0MA 3PW0A 2IOFK 1BPXA 2OYYA 3E58A 8ICGA 4DOCA 2KNJA 3H8JA 3NRWA 3RB4A 2FPLA 4RPXA 4Y2SA 5HHHA 2D6FC 1RPLA 1XWLA 5HREA 4BUGA 4O68A 4EBCA 4K9AA 1EXNA 2ASDA 1TV9A 2B51A 2NO4A 4KLIA 3GILA 4MKPA 2FPMA 1KQQA 1MQ2A 4O3QA 2K89A 3ZDEA 3SAHA 3ZD8A 3BQ1A 2ZH8A 1Z4NA 4FHVA 3C29A 1DRGA 3JZ0A 2DRAA 3UM9A 4R8UA 2FPKA 2ZIXB 3D2QA 1SXEA 1KBUA 1X40A 4F4ZA 4EBKA 5J2KA 4KLFA 1UPHA 4J9PA 2B56A 3HKZC 1XO1A 3TADC 3UXNA 4WOYA 3M6ZA 3KOOA 1U47A 4LEVA 5ALMA 2Y0SC 2PFPA 3S6JA 1MSWD 1COOA 2XY7A 4F71A 4U7CA 3QX7A 3SV3A 1X6JA 5KT2A 3C2MA 2DR8A 4WCWA 8ICJA 2QB1A 4FE3A 4PGQA 5DLFA 4Q8EA 3AL0B 4F4XA 3C1YA 4NXVA 4QNLA 4NWIA 4ECUA 2DFLA 4WC0A 2XGQA 5BPCA 4K4GA 3N4MB 2KTQA 3RJJA 1Z4OA 2WB1C 3N7RC 1KFDA 4FFDA 3OTQA 4K98A 3IHQB 1D8YA 4RZRA 2ALZA 1BPZA 2AJQA 3H8SA 1B4FA 3PHZA 2JV3A 3RB0A 3C2LA 2HBKA 8ICMA 1FO4A 3DDHA 3RH6A 1X66A 4YMMA 2ZUDA 2R8IA 9ICGA 3UXOA 3JPTA 5HRLA 1NKBA 5D4BA 3NUQA 1KW4A 2PFQA 2K4IA 2W9CA 4KLTA 5IIKA 2ISOA 1TFRA 5KFHA 5DDYA 4OJLA 4DQSA 2DF4B 5KG2A 4QZHA 1ZQSA 3Q8QB 2W11A 2J6UA 8ICSA 4QZ9A 5L1JA 2IHNA 5AKGA 3UPQA 3Q8KA 1ZQJA 2NO5A 2E5SA 1JXEA 4Q8FA 4OAGA 3E2EA 2ZJ5A 1SL0A 5J0QA 7ICIA 4F4KA 4J9QA 4E8FA 1UEVA 2ZH2A 2DBYA 2R8GA 3QU7A 1ZQOA 2R18A 2HHPA 4KLJA 4AYBC 4KN4A 4WC6A 1MIYA 4QWDA 2E8OA 3EPIA 4JK1A 4EEKA 4DQQA 1H38A 4UAYA 4JV1A 2P6RA 4ACOA 3C18A 3ALRA 3QU4A 3QUQA 4B9SA 2ODGA 1JXLA 3OWGA 3NVVA 1GO3F 4ECZA 1T3NA 5DQGA 4DLEA 4BXOB 4DL7A 4RWQA 5HRBA 2ZH5A 3TFSA 1NK6A 3R9KA 5KL1B 5ALNA 1ZETA 1N48A 1WOTA 1JAJA 4JLXA 4LVSA 3SMVA 2BBJA 3WFQE 3F2CA 5L1KA 2KHQA 4KMOB 3GZFA 5J0OA 3IM1A 2HHTA 1V97A 4FZMA 4NXWA 3HWTA 4Y2XA 2HN2A 4M9JA 4ECRA 3PR5B 2G08A 1RG6A 3KFUF 4YCXA 3TARA 2KSOB 1ZQKA 2IA6A 2EAOA 4MFFA 4O3OA 3UMGA 4QZFA 4RQ1A 3H4BA 4R65A 4RQNA 1MIWA 1OU5A 5CFUA 4ZH4A 5JUMA 4Z6CA 3GIIA 3MR5A 3KD3A 2ESEA 3MFIA 4NY8A 5KG0A 2QLTA 4Q45A 1JMSA 4JB3A 4ELTA 4NLGA 1L8LA 4CGZA 3TI0A 2MRLA 4BWMA 2RQ5A 3UQ0A 2UVWA 1ZQHA 4ECTA 2YMMA 4ATBA 2O1PA 1URJA 4NLNA 8ICBA 1L7PA 7ICTA 4FZNA 5J0XA 1QSYA 3JPPA 4B9TA 4WC2A 2ZIUB 4QZCA 3EYZA 1ZQYA 2K4PA 4F92B 4GXKA 4RNMA 2FCLA 9ICVA 7ICJA 1PX5A 4ELVA 5HR6A 5AM2A 5EWFA 5AKXA 2F44A 4RWNA 2HBMA 5HRDA 8ICYA 4AT7B 5KFLA 1L5UA 1ZQ1C 4DSKA 4LEZA 2RDIA 3Q8PB 3HJ1A 4UD4A 4UB4A 8ICRA 2ZH4A 2EZZA 1PK1A 1T3QA 4UAZA 1ZQZA 4EBDA 2DGZA 1S0MA 4R66A 5CWRA 2WTFA 1SV0C 4WH5A 4TUQA 1FFUA 4KM5A 3RAQA 2M2WA 3BS7A 3HX0A 1D9DA 3WKBA 5BOMA 5DBCA 5B5EU 5B3QA 5ALQA 4DOBA 2FMPA 3BQTA 4UB1A 2G5IB 3H39A 5KFTA 4G9BA 2RP5A 3AQFA 4M47A 2Q0ZX 4C8OA 3H8MA 1VJ5A 2FLLA 2LM1A 4EENA 2EQYA 1KSPA 5ALLA 4O6AA 4O67A 1YZ6A 1O03A 2M2VA 4AT8A 1ZQVA 2KD1A 3TKAA 4EBEA 5IIJA 5J0PA 2W03A 1BGXT 4GLXA 1XO0A 2G0AA 3Q8LA 4NKTA 3KHHA 2ZJAA 4WBZA 2ZTDA 1ED1A 2FLNA 4QIWC 2F2AB 5L9XA 5KFGA 4DS5A 9ICEA 5TISU 1S76D 1RZTA 2AGPA 4I2IA 5HHIA 3J81j 1WCLA 2PMZF 2XY5A 3PW5A 2RLTA 5AK5A 1Y88A 3T79A 5AICA 1OXJA 5AKHA 5KFCA 1UHUA 5J2FA 3RJGA 9ICFA 4F93B 2ES6A 1N5WA 3L9DA 1TFYA 5AKLA 2JRZA 1L7MA 3KZIU 4FHYA 3GV8B 2K8CB 5ALFA 1ZXIA 5ALHA 3WFOA 3WKEA 1QSSA 1TFWA 4OO1J 1C7YA 2RFFA 4XJEA 1S0NA 3V6JA 2DUYA 2F76X 3QYPA 4B9VA 1JROA 3C21A 4PZOA 4F5NA 2ATLA 4X4SA 2LHTA 4DSIA 2UVUA 3OGUA 2W54A 3BQ0A 3NKUA 1NJZA 4I2JA 1HUZA 3IG5A 5KFSA 3ZDCA 2XI9A 1N60A 3WK7A 3RBDA 3SI8A 4NLBA 2KKVA 5CR0A 5EWEA 3M7DA 2XCPA 9ICMA 4AP9A 4Z6FA 4RQ4A 4BXOA 1SL1A 1ZJNA 5DB6A 8ICXA 5KFUA 3FM9A 2KN7A 3AQNA 3RJFA 3IDWA 3MC1A 1ZJMA 2YTUA 3AU6A 5ALEA 1ZQDA 9ICQA 2NYVA 7ICNA 4DS4A 1ZQTA 3PX6A 3LDAA 5BOLA 2JEJA 1DOQA 4XQ7A 1X42A 4X4RA 4KLLA 3F2BA 2A1JA 3QNMA 2QB0B 1SIJA 4ED7A 2D3DA 4PPXA 7ICSA 2XGPA 3F5EA 4USAA 5KFYA 4PL2A 4CCHA 1X9SA 3SR6A 4M04A 4NXXA 4EZ6A 4FBUA 1TK5A 1L6NA 1S10A 4KLQA 2WF8A 4IL6U 3BJYA 4I28A 4O5EA 4UARA 4K9BA 7ICLA 2BQUA 2OWOA 3THVA 4RQ7A 4O3SA 2GA9D 4CE6A 1N5XA 5KFWA 3TFRA 2IOFA 3ER9B 3RH5A 3T5HA 5AIAA 1HIWA 2ZTEA 3HRDD 2ZIUA 1QH9A 2YB1A 4UQGA 1T4GA 1RXWA 1V4AA 1WG8A 3BZKA 2ZXHA 9ICAA 1RYRA 3QUBA 4X4PA 1ZRMA 2C22A 3D2SA 4F5PA 1QCKA 3WK9A 3F5AA 1JX4A 3BS5B 3SV4A 4DOAA 4AT7A 5KG7A 4HAIA 3RTVA 1Q46A 1V9PA 2YMQA 2JEIA 2LI6A 1KDHA 2BCQA 1UEUA 3FC4A 4P0PB 2VA2A 3JPNA 5KFFA 2BPCA 1K5OA 2GO7A 1F5AA 5KFRA 4RNOA 3I1YA 2YMPA 2W9AA 1N62A 1YZ7A 5G5HA 1NNLA 3EUB2 4YXMA 2BKEA 8ICLA 3F2DA 1N61A 1WWVA 2KFZA 4ED6A 3H37A 5B3PA 4Y2TA 4I29A 4DEZA 1BNOA 4KLGA 5DGAA 5IIMA 2KICA 3K1ZA 2NRXA 4DSFA 4PHEA 2FI1A 4B9NA 3EF2A 3C1ZA 4EV6A 5ALUA 1FA0A 2C2DA 3IP4B 1QTMA 4EYHB 3CYMA 3H4DA 1S97A 3M9OB 4C4SA 4F3OA 1BPDA 4JUZA 3MDCA 1J97A 5HMLA 2YMLA 2BBHA 3OPXA 2ID1A 2R8KA 2BQ3A 4DLGA 4C7YA 5DECA 3HKZF 4US8A 5D49A 2MUTA 3AN1A 1T94A 5J0YA 1KNYA 2KJ9A 1ZD4A 2PXIA 2LYBA 8ICWA 1P7DA 2F3NA 1ZQGA 4I2DA 1U49A 5KFXA 2H3QA 2JH1A 5KTQA 5AK4A 2OH2A 4JMUA 5DG7A 1BPYA 4QW9A 1C20A 3ZDDA 1WWUA 3LYSA 4DF8A 2HOQA 3PZPA 4BWJA 2HCFA 2L5YA 4EEDA 4MEXA 5JTIA 3PNCA 3KHGA 4EBJA 5KFDA 2ZUBA 2WB1F 3TANA 5CP2A 4MEYA 5CB1A 3RH4A 9ICBA 5HRIA 5HRKA 4P4PA 4NLKA 5KL8B 5AI5A 5F3XB 3AQKA 1RM6C 1NK0A 5D61A 2K8AA 3KBBA 1T7PA 4K99A 3QU2A 1KN5A 4X4TA 3KKAA 4OJPA 3ZD9A 3QEAZ 4E80A 2WF9A 1CRXA 3WU2U 1N56A 5J2DA 4R63A 3ICXA 2GLEA 7ICVA 3HP6A 1NJYA 2G09A 2Y1JA 2ISPA 7ICPA 4I2FA 3H40A 4J9LA 5HR7A 4CNQA 1Z00B 3PMNA 5J2JA 5DDMA 3N97B 2HVIA 4YD2A 4DL3A 4DL4A 3PW2A 4KLSA 4WQLA 5KAIU 2XCAA 1MA7A 1OUQA 3JCFA 3NYBA 4AYBF 1ZD3A 5AK6A 3PO4A 5ALGA 1ZQRA 4NLZA 2EANA 4ZOHC 2XY6A 2QB0A 2ZIVB 2CPRA 3ZDBA 2LYHA 3MFHA 1LKYA 1L3SA 5ALTA 5EE9A 1RYSA 2JXJA 5HR9A 1KTQA 4I0UA 2ASJA 2IBKA 4US9A 4O9MA 5CHEA 3DV9A 4JWMA 1Z3EB 1PVRA 5ALZA 4I27A 9ICRA 2KZMA 5HRGA 1SKRA 4CDGA 3GQCA 4HX0A 1ZQNA 4F5OA 1XSPA 7ICKA 3PVXA 3H0LB 1A0PA 1RXVA 5ALRA 4ED1A 3RB3A 4Z6DA 2H5XA 4QWCA 3G6XA 1ECWA 3T3FA 4E7XA 3RBEA 4P0QA 2A3VA 4QZAA 8ICKA 2HN1A 1NO5A 4F5QA 4DL6A 4I2HA 5KFQA 3QE9Y 2I6XA 4EX7A 1MN8A 4CF4A 3H0RB 2NV3A 1BPEA 5J0WA 4P4MA 3HPOA 5DLGA 3F53A 4IQUA 3C5FA 2F1IA 3PSPA 5IINA 2AQ0A 4QWBA 3PW4A 3IRUA 2JH7A 1R8BA 4IR9A 4MF2A 4UATA 2W3RA 2BZFA 1NJXA 3HILA 2UVRA 3ONNA 5L1IA 4P0PA 2YB4A 4DFKA 3TAPA 2O5AA 2IUBA 3RJKA 1DXSA 8ICTA 3GU3A 4B9UA 2YY6A 2A19A 2B4VA 3K1RB 5GTIU 2DVIA 4PZNA 4RT3A 3NVOA 4Y2YA 1UT8A 3RFAA 3BDPA 1UETA 2KJ5A 1N2XA 2K8BB 5EE0A 8ICEA 2ZJ8A 4PL1A 5CRXA 3G6VA 3MGHA 2I1QA 4KX3A 3SAGA 1VFGA 5J2AA 3U26A 3AQLA 1NK4A 4F8RA 5ALJA 2F1HA 1VDVA 5ALDA 3JPQA 4KLMA 4DCCA 5DQHA 3TACB 4DQRA 3NRZA 2KIWA 3WKCA 4YP3A 1TAQA 4FHPA 1XNSA 4X0BA 3PSTA 2DRBA 1IV8A 2ZUCA 5AKYA 1HUOA 1XU4A 4RQ6A 5J2BA 2W55A 2Q66A 3I76A 4PHPA 3WKAA 3WK6A 1RQLA 2W8LA 3OUYB 2XIDA 4CF5A 1QLNA 1RQNA 5AI0A 2JGAA 2V4QA 2BDPA 4YQWA 2KE7A 2BCUA 1X6IA 1NOMA 1O08A 4NL9A 3QUTA 8ICHA 1KKXA 4QWEA 1S0OA 2PKEA 4JV0A 1IG6A 4YN4A 2ZIXA 2JMGA 5CJ7A 1XSNA 4RNNA 2LBOA 4C8KA 1B43A 4KB6A 3OVAA 4MFCA 4OAHA 4P2HA 4WC1A 4NM2A 3B0YA 3PX4A 5GTHU 3KZXA 4FHXA 4DSLA 2W9BB 2OCEA 4J9MA 2AGQA 1CEZA 1PZNA 2WF5A 2AHOB 4UD5A 5KFZA 5C5JA 3QZ7A 4UAUA 4QIWF 5ALKA 4PHAA 4TQRA 4Y2QA 1JRPA 3HJEA 4QJFB 1ZQWA 4X5VA 3LK9A 4O3NA 2H3FA 3PMLA 9ICNA 1WUDA 2G5HB 2HHUA 1ZQPA 5EE3A 5CHGA 3OSPA 2PI4A 2BCVA 4HYKA 3N7PD 4RWPA 2K4EA 1WYGA 8ICZA 2AH5A 2WAQF 5F9LA 3QU5A 3ED5A 3T5JA 1Z00A 1X9XA 4RT2A 3JPSA 2BPGA 2ZH1A 5AKKA 4I2GA 1Q78A 5T14A 3RJEA 5AI9A 5J2EA 2M0NA 5DEDA 5EE1A 1HEKA 8ICFA 4ED8A 2F8KA 2H3IA 2FJ6A 4F4WA 4OD0A 5KG1A 2G07A 4E0DA 4KX5A 5CFTA 1RDFA 4FH3A 1KFTA 2VIXA 3RJHA 1CI4A 5J0SA 1MQ3A 9ICUA 4U6PA 5AK3A 1B0XA 4EEBA 3D6JA 3M1YA 4PHDA 5AKIA 5L1LA 4EEYA 4O0IA 2M2TA 3LVVA 3WK8A 5KFMA 3M9MB 1SZHA 1Q79A 4P4OA 2RDJA 1FFVA 2C2EA 2JZBB 4J9NA 1PUZA 4XA5A 4KLHA 4LZGA 5ALPA 1A6SA 2PMZC 7ICRA 4IQWA 4RPYA 4YMNA 5AI6A 5J2GA 4WQKA 4JV2A 2EZYA 2VA8A 2BQRA 4X4OA 5G5GA 2M2UA 1UA1A 3ISBA 3UMBA 2E8NA 4O69A 2W7PA 2AGOA 4NL9C 5DKWA 3LQCB 5D62A 3VCBA 3M8RA 5DBBA 5EWGA 4X4VA 4BDPA 3FDSA 3MBYA 2KSOA 1ZQLA 2HHQA 1MC8A 7ICQA 5KFBA 2E1FA 4C7ZA 2LPEA 1Z19A 3C23A 4QZBA 2LMRA 1KL9A 2JEGA 1U45A 2CN1A 2QKQA 2ASLA 4EGWA 4F5RA 4ECSA 3BQ2A 4I2EA 1COKA 3RR7A 1JIHA 7ICMA 3MR2A 8ICUA 5KFIA 2ZH6A 2NRKA 2FE9A 3NS1A 3CP8A 2LYAA 2E8PA 2K4HA 5KG3A 4IC9A 8ICQA 4C8MA 4NXTA 5IIOA 3PY8A 4DSJA 3B9JA 4IRCA 3EWAA 3WFPA 4Q43A 3T5KA 2ZTCA 3TADA 2WFAA 4B9MA 5J0UA 4FS1A 3KHRA 4IG8A 4NXZA 1DK2A 5KT5A 1N63A 3GFKB 5J29A 4WJ3B 1JI7A 4FBTA 2XC9A 4DQIA 2ZH9A 2ZHAA 4I2AA 3N28A 2NRWA 5ALVA 5J2HA 3OUYA 1J2MA 4LEYA 2OEHA 4UB6U 3V6KA 4XUSA 5KFKA 2CRXA 1WCNA 4UB8U 2KJ8A 3WFSC 3ORYA 4M9LA 2J6TA 1DGSA 3GDXA 3QXGA 4DWIA 2Y9TA 2NRVA 5AI8A 3K4GA 3RRHA 1L7OA 3CRXA 3NVYA 3NTUA 4F50A 4NV0A 3TQ1A 9ICJA 4B9LA 5JU5A 1QQ7A 3T5LA 3KTQA 4ED0A 4GC6A 1ZQAA 7ICUA 5EOZA 1QQ6A 1XSLA 4LT6A 4FH5A 5D46A 5HNKA 2AU0A 1F44A 2P66A 3CNHA 3NASA 4GC7A 5ALOA 2W9MA 4M5DA 3SZ2A 2KMDA 2P6UA 4ICAA 4M9NA 2FDRA 3Q8SB 5JTGA 4WC7A 3OVSA 2Z7JA 5HC9A 1NK9A 1UA0A 3PSIA 3SEIA 2WF7A 4O5CA 4MF8A 4PGYA 4O3PA 1R8AA 1ZD2P 2Y0SF 1Z1VA 3WKDA 4RUCA 1ZQMA 1UCVA 2EDUA 4N7RA 3SENA 4YMOA 8ICVA 5J0TA 2PBEA 2HOIA 4X0AA 4ECQA 3GIJA 4OAFA 3C28A 4C8NA 2HI0A 1U9LA 1ZQFA 1XS9D 2FLPA 3H38A 1L8OA 3B0XA 1FIQA 1PK1B 3QZ8A 5IILA 1S8OA 4J03A 2OM6A 1RYUA 5ALXA 4K8VA 5D63A 4DO9A 8ICNA 4IR1A 4M6WB 1Z1BA 2KZZA 3SYZA 1D8LA 2XICA 5F9NA 4KLDA 2JZBA 1DK3A 5TZVA 4JWNA 5AM1A 4WC4A 1LVHA 2HHWA 2XO7A 5F2VO 4Y2UA 5J8YA 4WC3A 4F2SA 2DR9A 4RUAA 3JPRA 4I2BA 2DKXA 2H3ZA 3UMCA 8ICPA 5KG5A 3LWMA 4A8EA 2C2RA 2G06A 1NJWA 5DG8A 5KFPA 4QZ8A 2QARB 4TQSA 3GIKA 2HHXA 2K60A 5B66U 1UQVA 3OJSA 3PW7A 4AT8B 1NI3A 2HBLA 4YD1A 1B22A 4FS2A 4Z6EA 3ERCC 1JN3A 1D8BA 2I5HA 2F8LA 3MDAA 2B21A 4O3RA 3C66A 5HP4A 2Y1IA 4UASA 3RJIA 1VLBA 2B6GA 4YR2A 1QSLA 4X4UA 1ZYQA 2BGWA 3Q8MA 1TE2A 5FP0A 4DFJA 1LB2B 3K75D 5AM4A 4X4QA 3NVWA 3ISCA 5DBAA 1ZQBA 2FMQA 4F72A 7ICHA
chains in the Genus database with same CATH topology
4YQWA 3SI8A 3HJ4A 2BCUA 5J2IA 4AT9B 4J9KA 1NOMA 5CR0A 5EWEA 4NM1A 3H3AA 8ICHA 2XCPA 9ICMA 1SKWA 4Z6FA 4QWEA 4RQ4A 1S0OA 4BXOA 1SL1A 1ZJNA 4JV0A 5DB6A 5KFEA 8ICXA 5KFUA 4F4YA 3V72A 8ICIA 2HHVA 4ATBB 4RQ5A 4YN4A 2KN7A 4TURA 3WFRE 1K1QA 3RJFA 2I9GA 2NRTA 2DPIA 1S0VA 3AQNA 5CJ7A 1XSNA 1R89A 4J9SA 4RNNA 2KFNA 3UQ2A 9ICTA 2ZH3A 1ZJMA 4YG2A 2BPFA 4C8KA 3AU6A 3PW0A 1B43A 1BPXA 1ZQDA 1IM4A 2VA3A 3OVAA 9ICIA 9ICQA 8ICGA 7ICNA 4DOCA 4DS4A 1ZQTA 3PX6A 4C8LA 3H8JA 4MFCA 3RB4A 5DB9A 2FPLA 3LDAA 5BOLA 2JEJA 1DOQA 4P2HA 2R8JA 4RPXA 4WC1A 4XQ7A 4NM2A 5J0RA 4X4RA 4KLLA 3PO5A 5HHHA 1RPLA 1XWLA 3B0YA 2A1JA 5KG4A 3PX4A 5HREA 4FHXA 4EBCA 4ED7A 4DSLA 4QZGA 2W9BB 2BDPA 4PPXA 1ZQUA 4J9MA 2AGQA 1CEZA 1EXNA 1PZNA 2XGPA 7ICSA 5KT3A 4RQ2A 2ASDA 4DF4A 4UD5A 1U4BA 1TV9A 5KFZA 5C5JA 5KFYA 3QZ7A 4CCHA 4NKUA 8ICAA 1X9SA 2M9NA 3AQMA 3TAQA 4KLIA 4M04A 3GILA 4UBBA 4PHAA 4EZ6A 4TQRA 4FBUA 1TK5A 4I2CA 2FPMA 3RR8A 4WC5A 1S10A 4O3QA 3ZDEA 1MQ2A 1R8CA 3BQ1A 3ZD8A 4KLQA 1ZQWA 4X5VA 2ZH8A 3LK9A 4O3NA 4FHVA 3JZ0A 4IRKA 9ICKA 2DRAA 3BJYA 3PMLA 9ICNA 4I28A 4O5EA 4R8UA 7ICGA 2FPKA 7ICOA 7ICLA 1IXRA 5DB8A 2HHUA 1ZQPA 4F4ZA 2BQUA 5KFVA 5CHGA 4EBKA 3OSPA 2OWOA 2PI4A 2BCVA 5J2KA 4HYKA 4KLFA 4RWPA 4J9PA 3THVA 7ICFA 8ICZA 4WBYA 1XO1A 3UXNA 4RQ7A 5F9LA 1U47A 5IIIA 1ZQCA 4O3SA 5KFWA 2PFPA 1MSWD 3T5JA 3TFRA 2M2UA 3LWLA 1Z00A 3RH5A 4RT2A 3T5HA 3JPSA 1ZQQA 2A1JB 1COOA 3ISDA 2BPGA 2ZH1A 2XY7A 4I2GA 3PR4A 4EYIB 1Q78A 2ZTEA 3SV3A 3RJEA 4UQGA 2ZHAA 5J2EA 4YR3A 1CUKA 5KT2A 1T4GA 3C2MA 5KT6A 1RXWA 5DEDA 1V4AA 2DR8A 3OSNA 5KG6A 4ED8A 8ICFA 1L3VA 9ICAA 1RYRA 4YR0A 4X4PA 4WCWA 8ICJA 4F4WA 4G3IA 4PGQA 5DLFA 5KG1A 2J6SA 4Q8EA 4F4XA 4E0DA 3C1YA 1TAUA 2C22A 2HW3A 4ECUA 5DGBA 3UPSA 1BVSA 1BPBA 2DFLA 4QZEA 4F5PA 2BCSA 4WC0A 2XGQA 5BPCA 1SKSA 4FH3A 4K4GA 1LV5A 1KFTA 1JX4A 3PX0A 3RJHA 3SV4A 4DOAA 2BE3A 4AT7A 5KG7A 3N4MB 5J0SA 1MQ3A 2KTQA 3RJJA 9ICUA 3RTVA 1KFDA 4PHDA 3GV7B 1V9PA 5L1LA 3IHQB 2JEIA 4YVZA 4RZRA 4O0IA 4EEYA 1KDHA 1K1SA 2ALZA 1BPZA 1D8YA 5KFMA 3M9MB 3H8SA 4ECWA 2PFNA 2AJQA 1Q79A 1ZQXA 2BCQA 1UEUA 1YLQA 4XRHA 1SL2A 2VA2A 4P4OA 3JPNA 3AUOA 2RDJA 3RB0A 5KFFA 3C2LA 2BPCA 2C2EA 8ICMA 3RH6A 2JZBB 4YMMA 4J9NA 1F5AA 5KFRA 4RNOA 2ZUDA 2R8IA 2W9AA 4XA5A 2IMWP 3UXOA 4LZGA 4KLHA 3JPTA 9ICGA 5HRLA 3RBDA 4YXMA 2BKEA 5J2CA 1NKBA 3HW8A 5D4BA 4DQPA 2KFZA 8ICLA 4ED6A 4O5KA 3H37A 4I29A 7ICRA 2PFQA 4DEZA 2W9CA 4RPYA 4IQWA 4KLGA 4KLTA 4YMNA 5IIKA 5J2GA 2ISOA 5DGAA 3EPGA 5IIMA 4ED3A 4JV2A 1TFRA 2VA8A 2BQRA 5KFHA 5DDYA 4ECXA 4X4OA 2NRXA 4DSFA 4DQSA 4PHEA 5KG2A 4B9NA 4QZHA 1ZQSA 3Q8QB 1UA1A 3V7KA 3ISBA 3C1ZA 2J6UA 3H8WA 8ICSA 4QZ9A 5L1JA 1D9FA 2IHNA 3UPQA 3Q8KA 1FA0A 2C2DA 1TK8A 2AGOA 1ZQJA 1JXEA 1QTMA 4EYHB 5DKWA 1KFSA 4Q8FA 2ZJ5A 3H4DA 1S97A 1SL0A 3E2EA 3M9OB 5J0QA 7ICIA 4F4KA 4J9QA 4E8FA 1KEJA 2PFOA 4F3OA 3LQCB 1BPDA 4IQVA 3M8RA 5DBBA 3ETLA 5EWGA 1UEVA 4JUZA 2ZH2A 4RQ3A 3MDCA 2R8GA 3V6HA 1ZQOA 3Q8RB 4X4VA 5HRFA 2HHPA 4BDPA 3FDSA 4KLJA 5HMLA 4KN4A 4WC6A 1MIYA 4QWDA 3MBYA 3EPIA 2ID1A 4JK1A 1ZQEA 2NRZA 1L3TA 1ZQLA 4DQQA 1H38A 2R8KA 4UAYA 2BQ3A 4IRDA 4JV1A 2HHQA 1MC8A 4DLGA 7ICQA 5KFBA 8ICCA 2P6RA 5DECA 4DL2A 3C18A 4M6WA 3C23A 4QZBA 4B9SA 5D49A 3QEBZ 2MUTA 1JXLA 9ICWA 2JEGA 5J0YA 4ECZA 1T3NA 1KNYA 5DQGA 4DLEA 1U45A 2ASLA 2PXIA 4BXOB 4ELUA 4F5RA 4ECSA 3BQ2A 4DL7A 4I2EA 8ICWA 3RR7A 1JIHA 1ZQGA 9ICLA 4KMUA 4RWQA 4I2DA 1AROP 1U49A 7ICMA 3MR2A 5KFXA 5KFIA 3TFSA 8ICUA 5HRBA 2NRKA 1NK6A 5KTQA 2ZH5A 4KLOA 1ZETA 4X4UA 1N48A 1WOTA 5DG7A 2ZH7A 2BHNA 1BPYA 4QW9A 3H7IA 2V4RA 4LVSA 1JAJA 3WFQE 4EZ9A 5L1KA 3ZDDA 3JYYA 5KG3A 4DF8A 8ICQA 4BWJA 4C8MA 5J0OA 4MEXA 3IM1A 2HHTA 5IIOA 3PY8A 4DSJA 3PNCA 3MABA 4IRCA 5DQIA 3HWTA 3KHGA 1S77D 4M9JA 3MR6A 5DG9A 3EZ5A 4EBJA 3EWAA 3GV5B 2F1JA 5KFDA 3PR5B 4ECRA 3WFPA 4Q43A 4YCXA 2ZUBA 3T5KA 2ZTCA 3TARA 4B9MA 5J0UA 1HJPA 4FS1A 3KHRA 4IG8A 1ZQKA 3TANA 4NXZA 5CP2A 2IA6A 4MEYA 4MFFA 5CB1A 2JEFA 3RH4A 9ICBA 4O3OA 5HRIA 5KT5A 4P4PA 4NLKA 5HRKA 3GFKB 5J29A 4QZFA 4UBCA 3AQKA 1NK0A 4FBTA 4RQ1A 2MUTB 4R65A 2XC9A 3H4BA 2FMSA 3MR3A 1T7PA 2NRWA 4DQIA 4I2AA 1MIWA 1OU5A 3HIYA 5J2HA 4ZH4A 4X4TA 1SZPA 5JUMA 4Z6CA 3GIIA 3MR5A 3OUYA 3ZD9A 3QEAZ 4E80A 3MFIA 3RB6A 3PV8A 2HVHA 2M2TA 4NY8A 5KG0A 4R8UB 3V6KA 1N56A 4XUSA 5KFKA 4Q45A 3NGDA 1NK8A 1WCNA 5J2DA 4F91B 1JMSA 4Q44A 4R63A 1ZQIA 4AT9A 4ELTA 5KT7A 3WFSC 2R8HA 2MAXA 3HP6A 1NJYA 3ORYA 7ICVA 4NLGA 4M9LA 9ICCA 4MFAA 2J6TA 3TI0A 1L3UA 1DGSA 4BWMA 3GDXA 2Y1JA 3UQ0A 4DWIA 2UVWA 1ZQHA 4ECTA 2ISPA 4I2FA 2V9WA 3HT3A 7ICPA 2O1PA 4ATBA 4NLNA 8ICBA 3RRGA 2NRVA 4RWOA 3K4GA 3RRHA 3RAXA 3H40A 4J9OA 7ICTA 4J9LA 5CA7A 4GXIA 1Z00B 5J0XA 1QSYA 3PMNA 4UB3A 3NTUA 3JPPA 4F50A 4B9TA 5J2JA 5DDMA 4ED2A 3N97B 3TQ1A 4WC2A 2HVIA 4YD2A 4QZCA 4DL3A 4DL4A 3PW2A 4B9LA 4KLSA 3EYZA 3FYHA 9ICJA 4M0AA 3T5LA 3KTQA 2XCAA 3KHLA 4ED0A 4GC6A 1ZQYA 1ZQAA 9ICPA 4GXJA 4F92B 3NYBA 7ICUA 4GXKA 4S3NA 5EOZA 4RNMA 2BR0A 4LZDA 4PGXA 1XSLA 3PO4A 7ICJA 1ZQRA 4NLZA 9ICVA 4FH5A 4LT6A 4YXJA 1PX5A 2XY6A 5D46A 4ELVA 5HNKA 2AU0A 1TKDA 3ZDBA 4ECVA 2LYHA 3MFHA 1L3SA 2P66A 3OHAA 1RYSA 2HHSA 1X9WA 5EWFA 5HR9A 1KTQA 4RWNA 4GC7A 2ASJA 2IBKA 4RQ0A 4O9MA 8ICYA 5HRDA 4AT7B 5KFLA 2W9MA 4DFPA 1L5UA 4M5DA 4FO6A 4DSKA 4IQTA 2RDIA 3SZ2A 4QZIA 3Q8PB 4M9HA 4UAWA 2VANA 4JWMA 2P6UA 3HJ1A 1Z3EB 4UD4A 4UB4A 8ICRA 2ZH4A 4M2YA 4I27A 9ICRA 4UAZA 4M9NA 2KZMA 5HRGA 3Q8SB 2W8KA 4QWAA 1ZQZA 1SKRA 4WC7A 1XC9A 3GQCA 1ZQNA 3M8SA 4F5OA 4EBDA 1XSPA 3EW9A 1KLNA 1KRPA 3OVSA 3OV7A 5KT4A 7ICKA 5HC9A 1NK9A 1S0MA 4R66A 3PVXA 5CWRA 1NK5A 2WTFA 1RXVA 4XQ8A 4BGDA 1UA0A 4TUQA 4ED1A 2W9CB 1S9FA 4O5CA 9ICOA 3RAQA 3RB3A 2M2WA 4Z6DA 4ECYA 1A76A 2H5XA 4MF8A 4PGYA 4QWCA 3HX0A 1TVAA 3G6XA 4O3PA 1D9DA 1R8AA 5BOMA 3T3FA 4E7XA 5DBCA 7ICEA 3RBEA 4RUCA 1ZQMA 4KTQA 4FHWA 4QZAA 8ICKA 3C5GA 3AU2A 4DOBA 1NO5A 4YMOA 8ICVA 4M9GA 5J0TA 4F5QA 2FMPA 1NK7A 2PBEA 2ZH6A 3BQTA 4X0AA 4ECQA 3GIJA 4DL6A 4UB1A 4I2HA 5KFQA 3V7LA 3QE9Y 3H39A 5KFTA 3UXPA 1MIVA 4C8NA 4UB2A 1NKCA 4M47A 4KLUA 2DPJA 2Q0ZX 4PH5A 1U9LA 1UT5A 4TUPA 3OHBA 1XS9D 1ZQFA 1BPEA 2FLLA 4C8OA 2FLPA 5J0WA 3H38A 4YFKA 1KSPA 3B0XA 4P4MA 3HPOA 5DLGA 3QZ8A 5DB7A 5IILA 2M2VA 4IQUA 1ZQVA 3C5FA 2F1IA 5KFJA 4RQ8A 4AT8A 4EP7A 4EBEA 5IINA 2AQ0A 5IIJA 5J0PA 4RPZA 1BGXT 4QWBA 4GLXA 3PW4A 2ZH9A 4K4HA 1R8BA 4IR9A 5KFAA 4MF2A 3Q8LA 4NKTA 3KHHA 9ICSA 2ZJAA 4DO9A 4KITB 1NJXA 8ICNA 4WBZA 4IR1A 4M6WB 3JPOA 2ZTDA 3SYZA 2FLNA 2UVRA 2KZZA 5L1IA 4UB5A 4DFKA 3TAPA 2IHMA 2O5AA 5KFNA 1D8LA 5L9XA 2PI5A 5KFGA 2DR5A 5F9NA 4DS5A 1TK0A 3RJKA 4KLDA 1X2IA 2C28A 2JZBA 9ICEA 8ICTA 4R64A 1S76D 5KFOA 1RZTA 2AGPA 4B9UA 4I2IA 5TZVA 2ZHBA 4JWNA 4WC4A 5HHIA 2HHWA 2XO7A 5F2VO 2DVIA 1WCLA 4WC3A 4F2SA 2XY5A 3PW5A 4RT3A 4RU9A 3M9NB 2DR9A 4RUAA 3C2KA 3JPRA 1UT8A 1Y88A 4I2BA 2BCRA 3BDPA 5KG5A 4DFMA 8ICPA 4QW8A 5KFCA 3LWMA 2C2RA 1UETA 5J2FA 5HMMA 1A77A 3RJGA 4F93B 1NJWA 9ICFA 3OVBA 3L9DA 4DSEA 1TFYA 2AQ4A 8ICEA 5DG8A 2ZJ8A 5KFPA 3G6VA 3MGHA 4QZ8A 4FHYA 3GV8B 5HRHA 2DR7A 2I1QA 4F2RA 1VJ7A 4TQSA 1VFGA 3WFOA 5J2AA 3OJUA 1QSSA 1NKEA 3AQLA 1TFWA 1NK4A 9ICXA 3GIKA 4X4NA 2HHXA 4F8RA 1C7YA 2RFFA 2F1HA 3OJSA 3PW7A 4AT8B 4YD1A 1B22A 1S0NA 4K4IA 3JPQA 4KLMA 5DQHA 3V6JA 4KN7A 4FS2A 4DQRA 4Z6EA 1JN3A 4B9VA 1JQRA 2KZ3A 1U48A 3MDAA 2B21A 3C21A 4YP3A 4F5NA 4O3RA 1TAQA 2ATLA 4J9RA 3C66A 4FHPA 4X0BA 5HP4A 2Y1IA 4X4SA 2DRBA 4KLEA 2ZUCA 3RJIA 4DSIA 3V7JA 1HUOA 1XU4A 4QZDA 4YR2A 3GIMA 4RQ6A 1ZYQA 1QSLA 5J2BA 3OGUA 4DL5A 2BGWA 2GWSA 2UVUA 8ICOA 2Q66A 3MGIA 3Q8MA 2UVVA 4PHPA 4DFJA 1LB2B 2W9BA 3BQ0A 3ZDAA 3K75D 1NJZA 4TUSA 2W8LA 3OUYB 4X4QA 4I2JA 1QLNA 1HUZA 3ISCA 5DBAA 1ZQBA 3G6YA 1T8EA 5KFSA 2FMQA 3ZDCA 1X9MA 9ICHA 7ICHA 2V4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQW A;  3SI8 A;  3HJ4 A;  2BCU A;  5J2I A;  4AT9 B;  4J9K A;  1NOM A;  5CR0 A;  5EWE A;  4NM1 A;  3H3A A;  8ICH A;  2XCP A;  9ICM A;  1SKW A;  4Z6F A;  4QWE A;  4RQ4 A;  1S0O A;  4BXO A;  1SL1 A;  1ZJN A;  4JV0 A;  5DB6 A;  5KFE A;  8ICX A;  5KFU A;  4F4Y A;  3V72 A;  8ICI A;  2HHV A;  4ATB B;  4RQ5 A;  4YN4 A;  2KN7 A;  4TUR A;  3WFR E;  1K1Q A;  3RJF A;  2I9G A;  2NRT A;  2DPI A;  1S0V A;  3AQN A;  5CJ7 A;  1XSN A;  1R89 A;  4J9S A;  4RNN A;  2KFN A;  3UQ2 A;  9ICT A;  2ZH3 A;  1ZJM A;  4YG2 A;  2BPF A;  4C8K A;  3AU6 A;  3PW0 A;  1B43 A;  1BPX A;  1ZQD A;  1IM4 A;  2VA3 A;  3OVA A;  9ICI A;  9ICQ A;  8ICG A;  7ICN A;  4DOC A;  4DS4 A;  1ZQT A;  3PX6 A;  4C8L A;  3H8J A;  4MFC A;  3RB4 A;  5DB9 A;  2FPL A;  3LDA A;  5BOL A;  2JEJ A;  1DOQ A;  4P2H A;  2R8J A;  4RPX A;  4WC1 A;  4XQ7 A;  4NM2 A;  5J0R A;  4X4R A;  4KLL A;  3PO5 A;  5HHH A;  1RPL A;  1XWL A;  3B0Y A;  2A1J A;  5KG4 A;  3PX4 A;  5HRE A;  4FHX A;  4EBC A;  4ED7 A;  4DSL A;  4QZG A;  2W9B B;  2BDP A;  4PPX A;  1ZQU A;  4J9M A;  2AGQ A;  1CEZ A;  1EXN A;  1PZN A;  2XGP A;  7ICS A;  5KT3 A;  4RQ2 A;  2ASD A;  4DF4 A;  4UD5 A;  1U4B A;  1TV9 A;  5KFZ A;  5C5J A;  5KFY A;  3QZ7 A;  4CCH A;  4NKU A;  8ICA A;  1X9S A;  2M9N A;  3AQM A;  3TAQ A;  4KLI A;  4M04 A;  3GIL A;  4UBB A;  4PHA A;  4EZ6 A;  4TQR A;  4FBU A;  1TK5 A;  4I2C A;  2FPM A;  3RR8 A;  4WC5 A;  1S10 A;  4O3Q A;  3ZDE A;  1MQ2 A;  1R8C A;  3BQ1 A;  3ZD8 A;  4KLQ A;  1ZQW A;  4X5V A;  2ZH8 A;  3LK9 A;  4O3N A;  4FHV A;  3JZ0 A;  4IRK A;  9ICK A;  2DRA A;  3BJY A;  3PML A;  9ICN A;  4I28 A;  4O5E A;  4R8U A;  7ICG A;  2FPK A;  7ICO A;  7ICL A;  1IXR A;  5DB8 A;  2HHU A;  1ZQP A;  4F4Z A;  2BQU A;  5KFV A;  5CHG A;  4EBK A;  3OSP A;  2OWO A;  2PI4 A;  2BCV A;  5J2K A;  4HYK A;  4KLF A;  4RWP A;  4J9P A;  3THV A;  7ICF A;  8ICZ A;  4WBY A;  1XO1 A;  3UXN A;  4RQ7 A;  5F9L A;  1U47 A;  5III A;  1ZQC A;  4O3S A;  5KFW A;  2PFP A;  1MSW D;  3T5J A;  3TFR A;  2M2U A;  3LWL A;  1Z00 A;  3RH5 A;  4RT2 A;  3T5H A;  3JPS A;  1ZQQ A;  2A1J B;  1COO A;  3ISD A;  2BPG A;  2ZH1 A;  2XY7 A;  4I2G A;  3PR4 A;  4EYI B;  1Q78 A;  2ZTE A;  3SV3 A;  3RJE A;  4UQG A;  2ZHA A;  5J2E A;  4YR3 A;  1CUK A;  5KT2 A;  1T4G A;  3C2M A;  5KT6 A;  1RXW A;  5DED A;  1V4A A;  2DR8 A;  3OSN A;  5KG6 A;  4ED8 A;  8ICF A;  1L3V A;  9ICA A;  1RYR A;  4YR0 A;  4X4P A;  4WCW A;  8ICJ A;  4F4W A;  4G3I A;  4PGQ A;  5DLF A;  5KG1 A;  2J6S A;  4Q8E A;  4F4X A;  4E0D A;  3C1Y A;  1TAU A;  2C22 A;  2HW3 A;  4ECU A;  5DGB A;  3UPS A;  1BVS A;  1BPB A;  2DFL A;  4QZE A;  4F5P A;  2BCS A;  4WC0 A;  2XGQ A;  5BPC A;  1SKS A;  4FH3 A;  4K4G A;  1LV5 A;  1KFT A;  1JX4 A;  3PX0 A;  3RJH A;  3SV4 A;  4DOA A;  2BE3 A;  4AT7 A;  5KG7 A;  3N4M B;  5J0S A;  1MQ3 A;  2KTQ A;  3RJJ A;  9ICU A;  3RTV A;  1KFD A;  4PHD A;  3GV7 B;  1V9P A;  5L1L A;  3IHQ B;  2JEI A;  4YVZ A;  4RZR A;  4O0I A;  4EEY A;  1KDH A;  1K1S A;  2ALZ A;  1BPZ A;  1D8Y A;  5KFM A;  3M9M B;  3H8S A;  4ECW A;  2PFN A;  2AJQ A;  1Q79 A;  1ZQX A;  2BCQ A;  1UEU A;  1YLQ A;  4XRH A;  1SL2 A;  2VA2 A;  4P4O A;  3JPN A;  3AUO A;  2RDJ A;  3RB0 A;  5KFF A;  3C2L A;  2BPC A;  2C2E A;  8ICM A;  3RH6 A;  2JZB B;  4YMM A;  4J9N A;  1F5A A;  5KFR A;  4RNO A;  2ZUD A;  2R8I A;  2W9A A;  4XA5 A;  2IMW P;  3UXO A;  4LZG A;  4KLH A;  3JPT A;  9ICG A;  5HRL A;  3RBD A;  4YXM A;  2BKE A;  5J2C A;  1NKB A;  3HW8 A;  5D4B A;  4DQP A;  2KFZ A;  8ICL A;  4ED6 A;  4O5K A;  3H37 A;  4I29 A;  7ICR A;  2PFQ A;  4DEZ A;  2W9C A;  4RPY A;  4IQW A;  4KLG A;  4KLT A;  4YMN A;  5IIK A;  5J2G A;  2ISO A;  5DGA A;  3EPG A;  5IIM A;  4ED3 A;  4JV2 A;  1TFR A;  2VA8 A;  2BQR A;  5KFH A;  5DDY A;  4ECX A;  4X4O A;  2NRX A;  4DSF A;  4DQS A;  4PHE A;  5KG2 A;  4B9N A;  4QZH A;  1ZQS A;  3Q8Q B;  1UA1 A;  3V7K A;  3ISB A;  3C1Z A;  2J6U A;  3H8W A;  8ICS A;  4QZ9 A;  5L1J A;  1D9F A;  2IHN A;  3UPQ A;  3Q8K A;  1FA0 A;  2C2D A;  1TK8 A;  2AGO A;  1ZQJ A;  1JXE A;  1QTM A;  4EYH B;  5DKW A;  1KFS A;  4Q8F A;  2ZJ5 A;  3H4D A;  1S97 A;  1SL0 A;  3E2E A;  3M9O B;  5J0Q A;  7ICI A;  4F4K A;  4J9Q A;  4E8F A;  1KEJ A;  2PFO A;  4F3O A;  3LQC B;  1BPD A;  4IQV A;  3M8R A;  5DBB A;  3ETL A;  5EWG A;  1UEV A;  4JUZ A;  2ZH2 A;  4RQ3 A;  3MDC A;  2R8G A;  3V6H A;  1ZQO A;  3Q8R B;  4X4V A;  5HRF A;  2HHP A;  4BDP A;  3FDS A;  4KLJ A;  5HML A;  4KN4 A;  4WC6 A;  1MIY A;  4QWD A;  3MBY A;  3EPI A;  2ID1 A;  4JK1 A;  1ZQE A;  2NRZ A;  1L3T A;  1ZQL A;  4DQQ A;  1H38 A;  2R8K A;  4UAY A;  2BQ3 A;  4IRD A;  4JV1 A;  2HHQ A;  1MC8 A;  4DLG A;  7ICQ A;  5KFB A;  8ICC A;  2P6R A;  5DEC A;  4DL2 A;  3C18 A;  4M6W A;  3C23 A;  4QZB A;  4B9S A;  5D49 A;  3QEB Z;  2MUT A;  1JXL A;  9ICW A;  2JEG A;  5J0Y A;  4ECZ A;  1T3N A;  1KNY A;  5DQG A;  4DLE A;  1U45 A;  2ASL A;  2PXI A;  4BXO B;  4ELU A;  4F5R A;  4ECS A;  3BQ2 A;  4DL7 A;  4I2E A;  8ICW A;  3RR7 A;  1JIH A;  1ZQG A;  9ICL A;  4KMU A;  4RWQ A;  4I2D A;  1ARO P;  1U49 A;  7ICM A;  3MR2 A;  5KFX A;  5KFI A;  3TFS A;  8ICU A;  5HRB A;  2NRK A;  1NK6 A;  5KTQ A;  2ZH5 A;  4KLO A;  1ZET A;  4X4U A;  1N48 A;  1WOT A;  5DG7 A;  2ZH7 A;  2BHN A;  1BPY A;  4QW9 A;  3H7I A;  2V4R A;  4LVS A;  1JAJ A;  3WFQ E;  4EZ9 A;  5L1K A;  3ZDD A;  3JYY A;  5KG3 A;  4DF8 A;  8ICQ A;  4BWJ A;  4C8M A;  5J0O A;  4MEX A;  3IM1 A;  2HHT A;  5IIO A;  3PY8 A;  4DSJ A;  3PNC A;  3MAB A;  4IRC A;  5DQI A;  3HWT A;  3KHG A;  1S77 D;  4M9J A;  3MR6 A;  5DG9 A;  3EZ5 A;  4EBJ A;  3EWA A;  3GV5 B;  2F1J A;  5KFD A;  3PR5 B;  4ECR A;  3WFP A;  4Q43 A;  4YCX A;  2ZUB A;  3T5K A;  2ZTC A;  3TAR A;  4B9M A;  5J0U A;  1HJP A;  4FS1 A;  3KHR A;  4IG8 A;  1ZQK A;  3TAN A;  4NXZ A;  5CP2 A;  2IA6 A;  4MEY A;  4MFF A;  5CB1 A;  2JEF A;  3RH4 A;  9ICB A;  4O3O A;  5HRI A;  5KT5 A;  4P4P A;  4NLK A;  5HRK A;  3GFK B;  5J29 A;  4QZF A;  4UBC A;  3AQK A;  1NK0 A;  4FBT A;  4RQ1 A;  2MUT B;  4R65 A;  2XC9 A;  3H4B A;  2FMS A;  3MR3 A;  1T7P A;  2NRW A;  4DQI A;  4I2A A;  1MIW A;  1OU5 A;  3HIY A;  5J2H A;  4ZH4 A;  4X4T A;  1SZP A;  5JUM A;  4Z6C A;  3GII A;  3MR5 A;  3OUY A;  3ZD9 A;  3QEA Z;  4E80 A;  3MFI A;  3RB6 A;  3PV8 A;  2HVH A;  2M2T A;  4NY8 A;  5KG0 A;  4R8U B;  3V6K A;  1N56 A;  4XUS A;  5KFK A;  4Q45 A;  3NGD A;  1NK8 A;  1WCN A;  5J2D A;  4F91 B;  1JMS A;  4Q44 A;  4R63 A;  1ZQI A;  4AT9 A;  4ELT A;  5KT7 A;  3WFS C;  2R8H A;  2MAX A;  3HP6 A;  1NJY A;  3ORY A;  7ICV A;  4NLG A;  4M9L A;  9ICC A;  4MFA A;  2J6T A;  3TI0 A;  1L3U A;  1DGS A;  4BWM A;  3GDX A;  2Y1J A;  3UQ0 A;  4DWI A;  2UVW A;  1ZQH A;  4ECT A;  2ISP A;  4I2F A;  2V9W A;  3HT3 A;  7ICP A;  2O1P A;  4ATB A;  4NLN A;  8ICB A;  3RRG A;  2NRV A;  4RWO A;  3K4G A;  3RRH A;  3RAX A;  3H40 A;  4J9O A;  7ICT A;  4J9L A;  5CA7 A;  4GXI A;  1Z00 B;  5J0X A;  1QSY A;  3PMN A;  4UB3 A;  3NTU A;  3JPP A;  4F50 A;  4B9T A;  5J2J A;  5DDM A;  4ED2 A;  3N97 B;  3TQ1 A;  4WC2 A;  2HVI A;  4YD2 A;  4QZC A;  4DL3 A;  4DL4 A;  3PW2 A;  4B9L A;  4KLS A;  3EYZ A;  3FYH A;  9ICJ A;  4M0A A;  3T5L A;  3KTQ A;  2XCA A;  3KHL A;  4ED0 A;  4GC6 A;  1ZQY A;  1ZQA A;  9ICP A;  4GXJ A;  4F92 B;  3NYB A;  7ICU A;  4GXK A;  4S3N A;  5EOZ A;  4RNM A;  2BR0 A;  4LZD A;  4PGX A;  1XSL A;  3PO4 A;  7ICJ A;  1ZQR A;  4NLZ A;  9ICV A;  4FH5 A;  4LT6 A;  4YXJ A;  1PX5 A;  2XY6 A;  5D46 A;  4ELV A;  5HNK A;  2AU0 A;  1TKD A;  3ZDB A;  4ECV A;  2LYH A;  3MFH A;  1L3S A;  2P66 A;  3OHA A;  1RYS A;  2HHS A;  1X9W A;  5EWF A;  5HR9 A;  1KTQ A;  4RWN A;  4GC7 A;  2ASJ A;  2IBK A;  4RQ0 A;  4O9M A;  8ICY A;  5HRD A;  4AT7 B;  5KFL A;  2W9M A;  4DFP A;  1L5U A;  4M5D A;  4FO6 A;  4DSK A;  4IQT A;  2RDI A;  3SZ2 A;  4QZI A;  3Q8P B;  4M9H A;  4UAW A;  2VAN A;  4JWM A;  2P6U A;  3HJ1 A;  1Z3E B;  4UD4 A;  4UB4 A;  8ICR A;  2ZH4 A;  4M2Y A;  4I27 A;  9ICR A;  4UAZ A;  4M9N A;  2KZM A;  5HRG A;  3Q8S B;  2W8K A;  4QWA A;  1ZQZ A;  1SKR A;  4WC7 A;  1XC9 A;  3GQC A;  1ZQN A;  3M8S A;  4F5O A;  4EBD A;  1XSP A;  3EW9 A;  1KLN A;  1KRP A;  3OVS A;  3OV7 A;  5KT4 A;  7ICK A;  5HC9 A;  1NK9 A;  1S0M A;  4R66 A;  3PVX A;  5CWR A;  1NK5 A;  2WTF A;  1RXV A;  4XQ8 A;  4BGD A;  1UA0 A;  4TUQ A;  4ED1 A;  2W9C B;  1S9F A;  4O5C A;  9ICO A;  3RAQ A;  3RB3 A;  2M2W A;  4Z6D A;  4ECY A;  1A76 A;  2H5X A;  4MF8 A;  4PGY A;  4QWC A;  3HX0 A;  1TVA A;  3G6X A;  4O3P A;  1D9D A;  1R8A A;  5BOM A;  3T3F A;  4E7X A;  5DBC A;  7ICE A;  3RBE A;  4RUC A;  1ZQM A;  4KTQ A;  4FHW A;  4QZA A;  8ICK A;  3C5G A;  3AU2 A;  4DOB A;  1NO5 A;  4YMO A;  8ICV A;  4M9G A;  5J0T A;  4F5Q A;  2FMP A;  1NK7 A;  2PBE A;  2ZH6 A;  3BQT A;  4X0A A;  4ECQ A;  3GIJ A;  4DL6 A;  4UB1 A;  4I2H A;  5KFQ A;  3V7L A;  3QE9 Y;  3H39 A;  5KFT A;  3UXP A;  1MIV A;  4C8N A;  4UB2 A;  1NKC A;  4M47 A;  4KLU A;  2DPJ A;  2Q0Z X;  4PH5 A;  1U9L A;  1UT5 A;  4TUP A;  3OHB A;  1XS9 D;  1ZQF A;  1BPE A;  2FLL A;  4C8O A;  2FLP A;  5J0W A;  3H38 A;  4YFK A;  1KSP A;  3B0X A;  4P4M A;  3HPO A;  5DLG A;  3QZ8 A;  5DB7 A;  5IIL A;  2M2V A;  4IQU A;  1ZQV A;  3C5F A;  2F1I A;  5KFJ A;  4RQ8 A;  4AT8 A;  4EP7 A;  4EBE A;  5IIN A;  2AQ0 A;  5IIJ A;  5J0P A;  4RPZ A;  1BGX T;  4QWB A;  4GLX A;  3PW4 A;  2ZH9 A;  4K4H A;  1R8B A;  4IR9 A;  5KFA A;  4MF2 A;  3Q8L A;  4NKT A;  3KHH A;  9ICS A;  2ZJA A;  4DO9 A;  4KIT B;  1NJX A;  8ICN A;  4WBZ A;  4IR1 A;  4M6W B;  3JPO A;  2ZTD A;  3SYZ A;  2FLN A;  2UVR A;  2KZZ A;  5L1I A;  4UB5 A;  4DFK A;  3TAP A;  2IHM A;  2O5A A;  5KFN A;  1D8L A;  5L9X A;  2PI5 A;  5KFG A;  2DR5 A;  5F9N A;  4DS5 A;  1TK0 A;  3RJK A;  4KLD A;  1X2I A;  2C28 A;  2JZB A;  9ICE A;  8ICT A;  4R64 A;  1S76 D;  5KFO A;  1RZT A;  2AGP A;  4B9U A;  4I2I A;  5TZV A;  2ZHB A;  4JWN A;  4WC4 A;  5HHI A;  2HHW A;  2XO7 A;  5F2V O;  2DVI A;  1WCL A;  4WC3 A;  4F2S A;  2XY5 A;  3PW5 A;  4RT3 A;  4RU9 A;  3M9N B;  2DR9 A;  4RUA A;  3C2K A;  3JPR A;  1UT8 A;  1Y88 A;  4I2B A;  2BCR A;  3BDP A;  5KG5 A;  4DFM A;  8ICP A;  4QW8 A;  5KFC A;  3LWM A;  2C2R A;  1UET A;  5J2F A;  5HMM A;  1A77 A;  3RJG A;  4F93 B;  1NJW A;  9ICF A;  3OVB A;  3L9D A;  4DSE A;  1TFY A;  2AQ4 A;  8ICE A;  5DG8 A;  2ZJ8 A;  5KFP A;  3G6V A;  3MGH A;  4QZ8 A;  4FHY A;  3GV8 B;  5HRH A;  2DR7 A;  2I1Q A;  4F2R A;  1VJ7 A;  4TQS A;  1VFG A;  3WFO A;  5J2A A;  3OJU A;  1QSS A;  1NKE A;  3AQL A;  1TFW A;  1NK4 A;  9ICX A;  3GIK A;  4X4N A;  2HHX A;  4F8R A;  1C7Y A;  2RFF A;  2F1H A;  3OJS A;  3PW7 A;  4AT8 B;  4YD1 A;  1B22 A;  1S0N A;  4K4I A;  3JPQ A;  4KLM A;  5DQH A;  3V6J A;  4KN7 A;  4FS2 A;  4DQR A;  4Z6E A;  1JN3 A;  4B9V A;  1JQR A;  2KZ3 A;  1U48 A;  3MDA A;  2B21 A;  3C21 A;  4YP3 A;  4F5N A;  4O3R A;  1TAQ A;  2ATL A;  4J9R A;  3C66 A;  4FHP A;  4X0B A;  5HP4 A;  2Y1I A;  4X4S A;  2DRB A;  4KLE A;  2ZUC A;  3RJI A;  4DSI A;  3V7J A;  1HUO A;  1XU4 A;  4QZD A;  4YR2 A;  3GIM A;  4RQ6 A;  1ZYQ A;  1QSL A;  5J2B A;  3OGU A;  4DL5 A;  2BGW A;  2GWS A;  2UVU A;  8ICO A;  2Q66 A;  3MGI A;  3Q8M A;  2UVV A;  4PHP A;  4DFJ A;  1LB2 B;  2W9B A;  3BQ0 A;  3ZDA A;  3K75 D;  1NJZ A;  4TUS A;  2W8L A;  3OUY B;  4X4Q A;  4I2J A;  1QLN A;  1HUZ A;  3ISC A;  5DBA A;  1ZQB A;  3G6Y A;  1T8E A;  5KFS A;  2FMQ A;  3ZDC A;  1X9M A;  9ICH A;  7ICH A;  2V4Q A; 
#chains in the Genus database with same CATH topology
 4BJQ A;  5J2I A;  2MSN A;  4AT9 B;  2DL0 A;  4OJ5 A;  3BQ7 A;  5KAF U;  4J9K A;  4NM1 A;  4OJO A;  1TAM A;  4F4Y A;  3V72 A;  8ICI A;  2HHV A;  3BZC A;  4RQ5 A;  4TUR A;  1K1Q A;  2RHF A;  4MHV A;  1S0V A;  5ALI A;  1R89 A;  4J9S A;  1JAL A;  2IOH A;  3UQ2 A;  2ZH3 A;  1SWW A;  4YG2 A;  2BPF A;  4FZL A;  1IM4 A;  2VA3 A;  9ICI A;  1M6Y A;  4C8L A;  5DB9 A;  3AQE A;  2R8J A;  5CFS A;  5J0R A;  3PO5 A;  1SV0 A;  5KG4 A;  5ALW A;  2BDU A;  4QZG A;  2GAF D;  1ZQU A;  3QU9 A;  5KT3 A;  2HBJ A;  4RQ2 A;  4DF4 A;  1U4B A;  4NKU A;  8ICA A;  2M9N A;  3AQM A;  2EWR A;  3TAQ A;  2GOL A;  4UBB A;  4I2C A;  4WC5 A;  3RR8 A;  2DQN B;  1R8C A;  1GPJ A;  4IRK A;  9ICK A;  3BS5 A;  3AMZ A;  7ICG A;  3IG8 A;  3A0B U;  7ICO A;  1IXR A;  5DB8 A;  5L1M A;  5KFV A;  7ICF A;  4NLC A;  4WBY A;  2EZX A;  5III A;  1ZQC A;  2HDO A;  1Q8K A;  3LWL A;  1ZQQ A;  2A1J B;  3ISD A;  3PR4 A;  4EYI B;  4YR3 A;  1CUK A;  5KT6 A;  3KKA C;  3OSN A;  5KG6 A;  1L3V A;  4YR0 A;  4G3I A;  2J6S A;  5J8Y C;  1TAU A;  3O0F A;  2HW3 A;  5DGB A;  3UPS A;  1BVS A;  1BPB A;  2KHV A;  4QZE A;  5AKZ A;  2BCS A;  2HOF A;  1SKS A;  1LV5 A;  1BNP A;  3PX0 A;  2BE3 A;  1SWV A;  2LKY A;  3GV7 B;  4YVZ A;  3CK6 A;  1K1S A;  4ECW A;  2PFN A;  3WK4 A;  3WK5 A;  4DFD A;  1ZQX A;  1YLQ A;  4XRH A;  1SL2 A;  3AUO A;  2W04 A;  1S5L U;  1YT3 A;  3M6K A;  5AM5 A;  2IMW P;  4DQP A;  5J2C A;  3HW8 A;  4O5K A;  2JR5 A;  2EAP A;  4BX9 C;  3EPG A;  4ED3 A;  2DKZ A;  5ALS A;  4ECX A;  2VJ4 A;  4CRX A;  3V7K A;  3H8W A;  3ZI4 A;  4Y2V A;  1D9F A;  1TK8 A;  1V85 A;  1ZRN A;  3I28 A;  1KFS A;  2AXT U;  1JUD A;  1KEJ A;  2PFO A;  4JLZ A;  2W43 A;  4IQV A;  4LJX A;  3ETL A;  2WF6 A;  2ZIW B;  4RQ3 A;  5AM0 A;  3V6H A;  2MU2 A;  3Q8R B;  2KP7 A;  5HRF A;  3ER8 C;  3NVZ A;  3AM9 A;  3D2N A;  1ZQE A;  2NRZ A;  1PVP A;  1L3T A;  4PJ0 U;  4IRD A;  3IV6 A;  2VJ5 A;  8ICC A;  4DL2 A;  4M6W A;  5H2F U;  9ICW A;  3QEB Z;  2W3S A;  3H0M B;  2KOB A;  2GH1 A;  2KIV A;  4ELU A;  2D8C A;  3IN5 A;  2DWQ A;  1OW5 A;  9ICL A;  4KMU A;  5AIB A;  1ARO P;  1SGG A;  5C0Y A;  2E8M A;  2OHF A;  4KLO A;  2ZXI A;  1L7N A;  2ZH7 A;  2BHN A;  1PVQ A;  3H7I A;  2V4R A;  2E1E A;  2YQE A;  4EZ9 A;  3JYY A;  2HSZ A;  2B0C A;  2QAR A;  3MAB A;  5KNI A;  5DQI A;  1NZB A;  1S77 D;  3MR6 A;  5DG9 A;  3EZ5 A;  3GV5 B;  2F1J A;  1FEZ A;  2KKP A;  1HJP A;  2RRD A;  4UAV A;  2JEF A;  2KV2 A;  2Y9U A;  4UBC A;  2MUT B;  2FMS A;  3MR3 A;  3HIY A;  2ZIV A;  4B6J A;  2H3V A;  1SZP A;  4C4R A;  1DGJ A;  5AI4 A;  2EAM A;  3RB6 A;  3PV8 A;  2HVH A;  4R8U B;  2KK0 A;  2Q4T A;  3NGD A;  1NK8 A;  4F91 B;  4Q44 A;  4AT9 A;  1ZQI A;  5KT7 A;  2R8H A;  2MAX A;  4Y2P A;  9ICC A;  4MFA A;  1L3U A;  4O3M A;  2IHO A;  3LVW A;  2WAQ C;  2V9W A;  1SB3 C;  3HT3 A;  4OAI Z;  3RRG A;  4RWO A;  3L3F X;  3RAX A;  4J9O A;  2WHE A;  5CA7 A;  4GXI A;  1ZD5 A;  3K7D A;  4UB3 A;  4ED2 A;  4Y2R A;  2A1A A;  3FYH A;  4M0A A;  3KHL A;  5JRT A;  4C4T A;  4GXJ A;  9ICP A;  4S3N A;  2BR0 A;  4LZD A;  4PGX A;  4OJ6 A;  4YXJ A;  1TKD A;  4ECV A;  2YX8 A;  3OHA A;  2HHS A;  1X9W A;  1F5S A;  2O6K A;  4RQ0 A;  4DFP A;  2N1R A;  4FO6 A;  4IQT A;  4QZI A;  4M9H A;  4UAW A;  2VAN A;  4M2Y A;  2OXO A;  2XVT A;  3N7S C;  1SXD A;  4EEL A;  2W8K A;  4QWA A;  4Y2J A;  1XC9 A;  3M8S A;  1KRP A;  3EW9 A;  2MA1 A;  5AHX A;  1KLN A;  3OV7 A;  5KT4 A;  1NK5 A;  3SD7 A;  4XQ8 A;  4BGD A;  4K97 A;  9ICO A;  2W9C B;  1S9F A;  3MCR A;  4ECY A;  4K96 A;  1A76 A;  1TVA A;  7ICE A;  4KTQ A;  4CF3 A;  4FHW A;  2P35 A;  3C5G A;  3AU2 A;  4IS7 A;  4M9G A;  1LKY B;  3SAF A;  2HMX A;  1NK7 A;  2F77 X;  3V7L A;  4C0Z A;  2JHD A;  3UXP A;  4C80 A;  2ZG6 A;  4UB2 A;  1QQ5 A;  4UW9 A;  1NKC A;  1MIV A;  1PK3 A;  2W7O A;  4KLU A;  2DPJ A;  4PH5 A;  3OHB A;  4TUP A;  1UT5 A;  1SV4 A;  2CXY A;  1Q3V A;  4YFK A;  3L5K A;  5CEH A;  5DB7 A;  3A0H U;  4EP7 A;  5KFJ A;  4RQ8 A;  4RPZ A;  5A0L A;  4K4H A;  4FO1 A;  5KFA A;  3E0F A;  1IIP A;  3FAH A;  2KVC A;  4GFJ A;  3AEV A;  9ICS A;  4KIT B;  3JPO A;  5AKE A;  4UB5 A;  2IHM A;  5KFN A;  2PI5 A;  2DR5 A;  1TK0 A;  1X2I A;  2YN4 A;  2C28 A;  2EH9 A;  4R64 A;  5KFO A;  2ZHB A;  4P0Q B;  5E79 U;  2LM4 A;  4RU9 A;  3M9N B;  4GIB A;  3C2K A;  2VKQ A;  3CW2 C;  3SQI A;  2BCR A;  4DFM A;  4QW8 A;  5HMM A;  1A77 A;  1ZOL A;  3OVB A;  4DSE A;  2AQ4 A;  3VC8 A;  5HRH A;  2DR7 A;  4F2R A;  1VJ7 A;  3L4P A;  3OJU A;  1NKE A;  9ICX A;  4X4N A;  3NWI A;  2E3T A;  4EX6 A;  1AQ6 A;  4K4I A;  4KN7 A;  3QUC A;  2ZIW A;  1JQR A;  2KZ3 A;  1U48 A;  2KG5 A;  4J9R A;  5K4L A;  5AKJ A;  4LEW A;  4KLE A;  3V7J A;  3ETR A;  4QZD A;  3PSF A;  3GIM A;  4DL5 A;  2GWS A;  8ICO A;  5ALY A;  3MGI A;  2UVV A;  5AM3 A;  2W9B A;  3ZDA A;  1NZP A;  1Q3U A;  4TUS A;  3G6Y A;  1T8E A;  9ICH A;  4NXU A;  1X9M A;  4NJ8 A;  3HJ4 A;  3H3A A;  2KEY A;  1SKW A;  3MGV A;  5KFE A;  4ATB B;  1J2N A;  3WFR E;  4OCZ A;  2NRT A;  2DPI A;  2I9G A;  1V38 A;  2KVS A;  4RQM A;  2KFN A;  9ICT A;  3DEE A;  3RF9 A;  1F0M A;  3PW0 A;  2IOF K;  1BPX A;  2OYY A;  3E58 A;  8ICG A;  4DOC A;  2KNJ A;  3H8J A;  3NRW A;  3RB4 A;  2FPL A;  4RPX A;  4Y2S A;  5HHH A;  2D6F C;  1RPL A;  1XWL A;  5HRE A;  4BUG A;  4O68 A;  4EBC A;  4K9A A;  1EXN A;  2ASD A;  1TV9 A;  2B51 A;  2NO4 A;  4KLI A;  3GIL A;  4MKP A;  2FPM A;  1KQQ A;  1MQ2 A;  4O3Q A;  2K89 A;  3ZDE A;  3SAH A;  3ZD8 A;  3BQ1 A;  2ZH8 A;  1Z4N A;  4FHV A;  3C29 A;  1DRG A;  3JZ0 A;  2DRA A;  3UM9 A;  4R8U A;  2FPK A;  2ZIX B;  3D2Q A;  1SXE A;  1KBU A;  1X40 A;  4F4Z A;  4EBK A;  5J2K A;  4KLF A;  1UPH A;  4J9P A;  2B56 A;  3HKZ C;  1XO1 A;  3TAD C;  3UXN A;  4WOY A;  3M6Z A;  3KOO A;  1U47 A;  4LEV A;  5ALM A;  2Y0S C;  2PFP A;  3S6J A;  1MSW D;  1COO A;  2XY7 A;  4F71 A;  4U7C A;  3QX7 A;  3SV3 A;  1X6J A;  5KT2 A;  3C2M A;  2DR8 A;  4WCW A;  8ICJ A;  2QB1 A;  4FE3 A;  4PGQ A;  5DLF A;  4Q8E A;  3AL0 B;  4F4X A;  3C1Y A;  4NXV A;  4QNL A;  4NWI A;  4ECU A;  2DFL A;  4WC0 A;  2XGQ A;  5BPC A;  4K4G A;  3N4M B;  2KTQ A;  3RJJ A;  1Z4O A;  2WB1 C;  3N7R C;  1KFD A;  4FFD A;  3OTQ A;  4K98 A;  3IHQ B;  1D8Y A;  4RZR A;  2ALZ A;  1BPZ A;  2AJQ A;  3H8S A;  1B4F A;  3PHZ A;  2JV3 A;  3RB0 A;  3C2L A;  2HBK A;  8ICM A;  1FO4 A;  3DDH A;  3RH6 A;  1X66 A;  4YMM A;  2ZUD A;  2R8I A;  9ICG A;  3UXO A;  3JPT A;  5HRL A;  1NKB A;  5D4B A;  3NUQ A;  1KW4 A;  2PFQ A;  2K4I A;  2W9C A;  4KLT A;  5IIK A;  2ISO A;  1TFR A;  5KFH A;  5DDY A;  4OJL A;  4DQS A;  2DF4 B;  5KG2 A;  4QZH A;  1ZQS A;  3Q8Q B;  2W11 A;  2J6U A;  8ICS A;  4QZ9 A;  5L1J A;  2IHN A;  5AKG A;  3UPQ A;  3Q8K A;  1ZQJ A;  2NO5 A;  2E5S A;  1JXE A;  4Q8F A;  4OAG A;  3E2E A;  2ZJ5 A;  1SL0 A;  5J0Q A;  7ICI A;  4F4K A;  4J9Q A;  4E8F A;  1UEV A;  2ZH2 A;  2DBY A;  2R8G A;  3QU7 A;  1ZQO A;  2R18 A;  2HHP A;  4KLJ A;  4AYB C;  4KN4 A;  4WC6 A;  1MIY A;  4QWD A;  2E8O A;  3EPI A;  4JK1 A;  4EEK A;  4DQQ A;  1H38 A;  4UAY A;  4JV1 A;  2P6R A;  4ACO A;  3C18 A;  3ALR A;  3QU4 A;  3QUQ A;  4B9S A;  2ODG A;  1JXL A;  3OWG A;  3NVV A;  1GO3 F;  4ECZ A;  1T3N A;  5DQG A;  4DLE A;  4BXO B;  4DL7 A;  4RWQ A;  5HRB A;  2ZH5 A;  3TFS A;  1NK6 A;  3R9K A;  5KL1 B;  5ALN A;  1ZET A;  1N48 A;  1WOT A;  1JAJ A;  4JLX A;  4LVS A;  3SMV A;  2BBJ A;  3WFQ E;  3F2C A;  5L1K A;  2KHQ A;  4KMO B;  3GZF A;  5J0O A;  3IM1 A;  2HHT A;  1V97 A;  4FZM A;  4NXW A;  3HWT A;  4Y2X A;  2HN2 A;  4M9J A;  4ECR A;  3PR5 B;  2G08 A;  1RG6 A;  3KFU F;  4YCX A;  3TAR A;  2KSO B;  1ZQK A;  2IA6 A;  2EAO A;  4MFF A;  4O3O A;  3UMG A;  4QZF A;  4RQ1 A;  3H4B A;  4R65 A;  4RQN A;  1MIW A;  1OU5 A;  5CFU A;  4ZH4 A;  5JUM A;  4Z6C A;  3GII A;  3MR5 A;  3KD3 A;  2ESE A;  3MFI A;  4NY8 A;  5KG0 A;  2QLT A;  4Q45 A;  1JMS A;  4JB3 A;  4ELT A;  4NLG A;  1L8L A;  4CGZ A;  3TI0 A;  2MRL A;  4BWM A;  2RQ5 A;  3UQ0 A;  2UVW A;  1ZQH A;  4ECT A;  2YMM A;  4ATB A;  2O1P A;  1URJ A;  4NLN A;  8ICB A;  1L7P A;  7ICT A;  4FZN A;  5J0X A;  1QSY A;  3JPP A;  4B9T A;  4WC2 A;  2ZIU B;  4QZC A;  3EYZ A;  1ZQY A;  2K4P A;  4F92 B;  4GXK A;  4RNM A;  2FCL A;  9ICV A;  7ICJ A;  1PX5 A;  4ELV A;  5HR6 A;  5AM2 A;  5EWF A;  5AKX A;  2F44 A;  4RWN A;  2HBM A;  5HRD A;  8ICY A;  4AT7 B;  5KFL A;  1L5U A;  1ZQ1 C;  4DSK A;  4LEZ A;  2RDI A;  3Q8P B;  3HJ1 A;  4UD4 A;  4UB4 A;  8ICR A;  2ZH4 A;  2EZZ A;  1PK1 A;  1T3Q A;  4UAZ A;  1ZQZ A;  4EBD A;  2DGZ A;  1S0M A;  4R66 A;  5CWR A;  2WTF A;  1SV0 C;  4WH5 A;  4TUQ A;  1FFU A;  4KM5 A;  3RAQ A;  2M2W A;  3BS7 A;  3HX0 A;  1D9D A;  3WKB A;  5BOM A;  5DBC A;  5B5E U;  5B3Q A;  5ALQ A;  4DOB A;  2FMP A;  3BQT A;  4UB1 A;  2G5I B;  3H39 A;  5KFT A;  4G9B A;  2RP5 A;  3AQF A;  4M47 A;  2Q0Z X;  4C8O A;  3H8M A;  1VJ5 A;  2FLL A;  2LM1 A;  4EEN A;  2EQY A;  1KSP A;  5ALL A;  4O6A A;  4O67 A;  1YZ6 A;  1O03 A;  2M2V A;  4AT8 A;  1ZQV A;  2KD1 A;  3TKA A;  4EBE A;  5IIJ A;  5J0P A;  2W03 A;  1BGX T;  4GLX A;  1XO0 A;  2G0A A;  3Q8L A;  4NKT A;  3KHH A;  2ZJA A;  4WBZ A;  2ZTD A;  1ED1 A;  2FLN A;  4QIW C;  2F2A B;  5L9X A;  5KFG A;  4DS5 A;  9ICE A;  5TIS U;  1S76 D;  1RZT A;  2AGP A;  4I2I A;  5HHI A;  3J81 j;  1WCL A;  2PMZ F;  2XY5 A;  3PW5 A;  2RLT A;  5AK5 A;  1Y88 A;  3T79 A;  5AIC A;  1OXJ A;  5AKH A;  5KFC A;  1UHU A;  5J2F A;  3RJG A;  9ICF A;  4F93 B;  2ES6 A;  1N5W A;  3L9D A;  1TFY A;  5AKL A;  2JRZ A;  1L7M A;  3KZI U;  4FHY A;  3GV8 B;  2K8C B;  5ALF A;  1ZXI A;  5ALH A;  3WFO A;  3WKE A;  1QSS A;  1TFW A;  4OO1 J;  1C7Y A;  2RFF A;  4XJE A;  1S0N A;  3V6J A;  2DUY A;  2F76 X;  3QYP A;  4B9V A;  1JRO A;  3C21 A;  4PZO A;  4F5N A;  2ATL A;  4X4S A;  2LHT A;  4DSI A;  2UVU A;  3OGU A;  2W54 A;  3BQ0 A;  3NKU A;  1NJZ A;  4I2J A;  1HUZ A;  3IG5 A;  5KFS A;  3ZDC A;  2XI9 A;  1N60 A;  3WK7 A;  3RBD A;  3SI8 A;  4NLB A;  2KKV A;  5CR0 A;  5EWE A;  3M7D A;  2XCP A;  9ICM A;  4AP9 A;  4Z6F A;  4RQ4 A;  4BXO A;  1SL1 A;  1ZJN A;  5DB6 A;  8ICX A;  5KFU A;  3FM9 A;  2KN7 A;  3AQN A;  3RJF A;  3IDW A;  3MC1 A;  1ZJM A;  2YTU A;  3AU6 A;  5ALE A;  1ZQD A;  9ICQ A;  2NYV A;  7ICN A;  4DS4 A;  1ZQT A;  3PX6 A;  3LDA A;  5BOL A;  2JEJ A;  1DOQ A;  4XQ7 A;  1X42 A;  4X4R A;  4KLL A;  3F2B A;  2A1J A;  3QNM A;  2QB0 B;  1SIJ A;  4ED7 A;  2D3D A;  4PPX A;  7ICS A;  2XGP A;  3F5E A;  4USA A;  5KFY A;  4PL2 A;  4CCH A;  1X9S A;  3SR6 A;  4M04 A;  4NXX A;  4EZ6 A;  4FBU A;  1TK5 A;  1L6N A;  1S10 A;  4KLQ A;  2WF8 A;  4IL6 U;  3BJY A;  4I28 A;  4O5E A;  4UAR A;  4K9B A;  7ICL A;  2BQU A;  2OWO A;  3THV A;  4RQ7 A;  4O3S A;  2GA9 D;  4CE6 A;  1N5X A;  5KFW A;  3TFR A;  2IOF A;  3ER9 B;  3RH5 A;  3T5H A;  5AIA A;  1HIW A;  2ZTE A;  3HRD D;  2ZIU A;  1QH9 A;  2YB1 A;  4UQG A;  1T4G A;  1RXW A;  1V4A A;  1WG8 A;  3BZK A;  2ZXH A;  9ICA A;  1RYR A;  3QUB A;  4X4P A;  1ZRM A;  2C22 A;  3D2S A;  4F5P A;  1QCK A;  3WK9 A;  3F5A A;  1JX4 A;  3BS5 B;  3SV4 A;  4DOA A;  4AT7 A;  5KG7 A;  4HAI A;  3RTV A;  1Q46 A;  1V9P A;  2YMQ A;  2JEI A;  2LI6 A;  1KDH A;  2BCQ A;  1UEU A;  3FC4 A;  4P0P B;  2VA2 A;  3JPN A;  5KFF A;  2BPC A;  1K5O A;  2GO7 A;  1F5A A;  5KFR A;  4RNO A;  3I1Y A;  2YMP A;  2W9A A;  1N62 A;  1YZ7 A;  5G5H A;  1NNL A;  3EUB 2;  4YXM A;  2BKE A;  8ICL A;  3F2D A;  1N61 A;  1WWV A;  2KFZ A;  4ED6 A;  3H37 A;  5B3P A;  4Y2T A;  4I29 A;  4DEZ A;  1BNO A;  4KLG A;  5DGA A;  5IIM A;  2KIC A;  3K1Z A;  2NRX A;  4DSF A;  4PHE A;  2FI1 A;  4B9N A;  3EF2 A;  3C1Z A;  4EV6 A;  5ALU A;  1FA0 A;  2C2D A;  3IP4 B;  1QTM A;  4EYH B;  3CYM A;  3H4D A;  1S97 A;  3M9O B;  4C4S A;  4F3O A;  1BPD A;  4JUZ A;  3MDC A;  1J97 A;  5HML A;  2YML A;  2BBH A;  3OPX A;  2ID1 A;  2R8K A;  2BQ3 A;  4DLG A;  4C7Y A;  5DEC A;  3HKZ F;  4US8 A;  5D49 A;  2MUT A;  3AN1 A;  1T94 A;  5J0Y A;  1KNY A;  2KJ9 A;  1ZD4 A;  2PXI A;  2LYB A;  8ICW A;  1P7D A;  2F3N A;  1ZQG A;  4I2D A;  1U49 A;  5KFX A;  2H3Q A;  2JH1 A;  5KTQ A;  5AK4 A;  2OH2 A;  4JMU A;  5DG7 A;  1BPY A;  4QW9 A;  1C20 A;  3ZDD A;  1WWU A;  3LYS A;  4DF8 A;  2HOQ A;  3PZP A;  4BWJ A;  2HCF A;  2L5Y A;  4EED A;  4MEX A;  5JTI A;  3PNC A;  3KHG A;  4EBJ A;  5KFD A;  2ZUB A;  2WB1 F;  3TAN A;  5CP2 A;  4MEY A;  5CB1 A;  3RH4 A;  9ICB A;  5HRI A;  5HRK A;  4P4P A;  4NLK A;  5KL8 B;  5AI5 A;  5F3X B;  3AQK A;  1RM6 C;  1NK0 A;  5D61 A;  2K8A A;  3KBB A;  1T7P A;  4K99 A;  3QU2 A;  1KN5 A;  4X4T A;  3KKA A;  4OJP A;  3ZD9 A;  3QEA Z;  4E80 A;  2WF9 A;  1CRX A;  3WU2 U;  1N56 A;  5J2D A;  4R63 A;  3ICX A;  2GLE A;  7ICV A;  3HP6 A;  1NJY A;  2G09 A;  2Y1J A;  2ISP A;  7ICP A;  4I2F A;  3H40 A;  4J9L A;  5HR7 A;  4CNQ A;  1Z00 B;  3PMN A;  5J2J A;  5DDM A;  3N97 B;  2HVI A;  4YD2 A;  4DL3 A;  4DL4 A;  3PW2 A;  4KLS A;  4WQL A;  5KAI U;  2XCA A;  1MA7 A;  1OUQ A;  3JCF A;  3NYB A;  4AYB F;  1ZD3 A;  5AK6 A;  3PO4 A;  5ALG A;  1ZQR A;  4NLZ A;  2EAN A;  4ZOH C;  2XY6 A;  2QB0 A;  2ZIV B;  2CPR A;  3ZDB A;  2LYH A;  3MFH A;  1LKY A;  1L3S A;  5ALT A;  5EE9 A;  1RYS A;  2JXJ A;  5HR9 A;  1KTQ A;  4I0U A;  2ASJ A;  2IBK A;  4US9 A;  4O9M A;  5CHE A;  3DV9 A;  4JWM A;  1Z3E B;  1PVR A;  5ALZ A;  4I27 A;  9ICR A;  2KZM A;  5HRG A;  1SKR A;  4CDG A;  3GQC A;  4HX0 A;  1ZQN A;  4F5O A;  1XSP A;  7ICK A;  3PVX A;  3H0L B;  1A0P A;  1RXV A;  5ALR A;  4ED1 A;  3RB3 A;  4Z6D A;  2H5X A;  4QWC A;  3G6X A;  1ECW A;  3T3F A;  4E7X A;  3RBE A;  4P0Q A;  2A3V A;  4QZA A;  8ICK A;  2HN1 A;  1NO5 A;  4F5Q A;  4DL6 A;  4I2H A;  5KFQ A;  3QE9 Y;  2I6X A;  4EX7 A;  1MN8 A;  4CF4 A;  3H0R B;  2NV3 A;  1BPE A;  5J0W A;  4P4M A;  3HPO A;  5DLG A;  3F53 A;  4IQU A;  3C5F A;  2F1I A;  3PSP A;  5IIN A;  2AQ0 A;  4QWB A;  3PW4 A;  3IRU A;  2JH7 A;  1R8B A;  4IR9 A;  4MF2 A;  4UAT A;  2W3R A;  2BZF A;  1NJX A;  3HIL A;  2UVR A;  3ONN A;  5L1I A;  4P0P A;  2YB4 A;  4DFK A;  3TAP A;  2O5A A;  2IUB A;  3RJK A;  1DXS A;  8ICT A;  3GU3 A;  4B9U A;  2YY6 A;  2A19 A;  2B4V A;  3K1R B;  5GTI U;  2DVI A;  4PZN A;  4RT3 A;  3NVO A;  4Y2Y A;  1UT8 A;  3RFA A;  3BDP A;  1UET A;  2KJ5 A;  1N2X A;  2K8B B;  5EE0 A;  8ICE A;  2ZJ8 A;  4PL1 A;  5CRX A;  3G6V A;  3MGH A;  2I1Q A;  4KX3 A;  3SAG A;  1VFG A;  5J2A A;  3U26 A;  3AQL A;  1NK4 A;  4F8R A;  5ALJ A;  2F1H A;  1VDV A;  5ALD A;  3JPQ A;  4KLM A;  4DCC A;  5DQH A;  3TAC B;  4DQR A;  3NRZ A;  2KIW A;  3WKC A;  4YP3 A;  1TAQ A;  4FHP A;  1XNS A;  4X0B A;  3PST A;  2DRB A;  1IV8 A;  2ZUC A;  5AKY A;  1HUO A;  1XU4 A;  4RQ6 A;  5J2B A;  2W55 A;  2Q66 A;  3I76 A;  4PHP A;  3WKA A;  3WK6 A;  1RQL A;  2W8L A;  3OUY B;  2XID A;  4CF5 A;  1QLN A;  1RQN A;  5AI0 A;  2JGA A;  2V4Q A;  2BDP A;  4YQW A;  2KE7 A;  2BCU A;  1X6I A;  1NOM A;  1O08 A;  4NL9 A;  3QUT A;  8ICH A;  1KKX A;  4QWE A;  1S0O A;  2PKE A;  4JV0 A;  1IG6 A;  4YN4 A;  2ZIX A;  2JMG A;  5CJ7 A;  1XSN A;  4RNN A;  2LBO A;  4C8K A;  1B43 A;  4KB6 A;  3OVA A;  4MFC A;  4OAH A;  4P2H A;  4WC1 A;  4NM2 A;  3B0Y A;  3PX4 A;  5GTH U;  3KZX A;  4FHX A;  4DSL A;  2W9B B;  2OCE A;  4J9M A;  2AGQ A;  1CEZ A;  1PZN A;  2WF5 A;  2AHO B;  4UD5 A;  5KFZ A;  5C5J A;  3QZ7 A;  4UAU A;  4QIW F;  5ALK A;  4PHA A;  4TQR A;  4Y2Q A;  1JRP A;  3HJE A;  4QJF B;  1ZQW A;  4X5V A;  3LK9 A;  4O3N A;  2H3F A;  3PML A;  9ICN A;  1WUD A;  2G5H B;  2HHU A;  1ZQP A;  5EE3 A;  5CHG A;  3OSP A;  2PI4 A;  2BCV A;  4HYK A;  3N7P D;  4RWP A;  2K4E A;  1WYG A;  8ICZ A;  2AH5 A;  2WAQ F;  5F9L A;  3QU5 A;  3ED5 A;  3T5J A;  1Z00 A;  1X9X A;  4RT2 A;  3JPS A;  2BPG A;  2ZH1 A;  5AKK A;  4I2G A;  1Q78 A;  5T14 A;  3RJE A;  5AI9 A;  5J2E A;  2M0N A;  5DED A;  5EE1 A;  1HEK A;  8ICF A;  4ED8 A;  2F8K A;  2H3I A;  2FJ6 A;  4F4W A;  4OD0 A;  5KG1 A;  2G07 A;  4E0D A;  4KX5 A;  5CFT A;  1RDF A;  4FH3 A;  1KFT A;  2VIX A;  3RJH A;  1CI4 A;  5J0S A;  1MQ3 A;  9ICU A;  4U6P A;  5AK3 A;  1B0X A;  4EEB A;  3D6J A;  3M1Y A;  4PHD A;  5AKI A;  5L1L A;  4EEY A;  4O0I A;  2M2T A;  3LVV A;  3WK8 A;  5KFM A;  3M9M B;  1SZH A;  1Q79 A;  4P4O A;  2RDJ A;  1FFV A;  2C2E A;  2JZB B;  4J9N A;  1PUZ A;  4XA5 A;  4KLH A;  4LZG A;  5ALP A;  1A6S A;  2PMZ C;  7ICR A;  4IQW A;  4RPY A;  4YMN A;  5AI6 A;  5J2G A;  4WQK A;  4JV2 A;  2EZY A;  2VA8 A;  2BQR A;  4X4O A;  5G5G A;  2M2U A;  1UA1 A;  3ISB A;  3UMB A;  2E8N A;  4O69 A;  2W7P A;  2AGO A;  4NL9 C;  5DKW A;  3LQC B;  5D62 A;  3VCB A;  3M8R A;  5DBB A;  5EWG A;  4X4V A;  4BDP A;  3FDS A;  3MBY A;  2KSO A;  1ZQL A;  2HHQ A;  1MC8 A;  7ICQ A;  5KFB A;  2E1F A;  4C7Z A;  2LPE A;  1Z19 A;  3C23 A;  4QZB A;  2LMR A;  1KL9 A;  2JEG A;  1U45 A;  2CN1 A;  2QKQ A;  2ASL A;  4EGW A;  4F5R A;  4ECS A;  3BQ2 A;  4I2E A;  1COK A;  3RR7 A;  1JIH A;  7ICM A;  3MR2 A;  8ICU A;  5KFI A;  2ZH6 A;  2NRK A;  2FE9 A;  3NS1 A;  3CP8 A;  2LYA A;  2E8P A;  2K4H A;  5KG3 A;  4IC9 A;  8ICQ A;  4C8M A;  4NXT A;  5IIO A;  3PY8 A;  4DSJ A;  3B9J A;  4IRC A;  3EWA A;  3WFP A;  4Q43 A;  3T5K A;  2ZTC A;  3TAD A;  2WFA A;  4B9M A;  5J0U A;  4FS1 A;  3KHR A;  4IG8 A;  4NXZ A;  1DK2 A;  5KT5 A;  1N63 A;  3GFK B;  5J29 A;  4WJ3 B;  1JI7 A;  4FBT A;  2XC9 A;  4DQI A;  2ZH9 A;  2ZHA A;  4I2A A;  3N28 A;  2NRW A;  5ALV A;  5J2H A;  3OUY A;  1J2M A;  4LEY A;  2OEH A;  4UB6 U;  3V6K A;  4XUS A;  5KFK A;  2CRX A;  1WCN A;  4UB8 U;  2KJ8 A;  3WFS C;  3ORY A;  4M9L A;  2J6T A;  1DGS A;  3GDX A;  3QXG A;  4DWI A;  2Y9T A;  2NRV A;  5AI8 A;  3K4G A;  3RRH A;  1L7O A;  3CRX A;  3NVY A;  3NTU A;  4F50 A;  4NV0 A;  3TQ1 A;  9ICJ A;  4B9L A;  5JU5 A;  1QQ7 A;  3T5L A;  3KTQ A;  4ED0 A;  4GC6 A;  1ZQA A;  7ICU A;  5EOZ A;  1QQ6 A;  1XSL A;  4LT6 A;  4FH5 A;  5D46 A;  5HNK A;  2AU0 A;  1F44 A;  2P66 A;  3CNH A;  3NAS A;  4GC7 A;  5ALO A;  2W9M A;  4M5D A;  3SZ2 A;  2KMD A;  2P6U A;  4ICA A;  4M9N A;  2FDR A;  3Q8S B;  5JTG A;  4WC7 A;  3OVS A;  2Z7J A;  5HC9 A;  1NK9 A;  1UA0 A;  3PSI A;  3SEI A;  2WF7 A;  4O5C A;  4MF8 A;  4PGY A;  4O3P A;  1R8A A;  1ZD2 P;  2Y0S F;  1Z1V A;  3WKD A;  4RUC A;  1ZQM A;  1UCV A;  2EDU A;  4N7R A;  3SEN A;  4YMO A;  8ICV A;  5J0T A;  2PBE A;  2HOI A;  4X0A A;  4ECQ A;  3GIJ A;  4OAF A;  3C28 A;  4C8N A;  2HI0 A;  1U9L A;  1ZQF A;  1XS9 D;  2FLP A;  3H38 A;  1L8O A;  3B0X A;  1FIQ A;  1PK1 B;  3QZ8 A;  5IIL A;  1S8O A;  4J03 A;  2OM6 A;  1RYU A;  5ALX A;  4K8V A;  5D63 A;  4DO9 A;  8ICN A;  4IR1 A;  4M6W B;  1Z1B A;  2KZZ A;  3SYZ A;  1D8L A;  2XIC A;  5F9N A;  4KLD A;  2JZB A;  1DK3 A;  5TZV A;  4JWN A;  5AM1 A;  4WC4 A;  1LVH A;  2HHW A;  2XO7 A;  5F2V O;  4Y2U A;  5J8Y A;  4WC3 A;  4F2S A;  2DR9 A;  4RUA A;  3JPR A;  4I2B A;  2DKX A;  2H3Z A;  3UMC A;  8ICP A;  5KG5 A;  3LWM A;  4A8E A;  2C2R A;  2G06 A;  1NJW A;  5DG8 A;  5KFP A;  4QZ8 A;  2QAR B;  4TQS A;  3GIK A;  2HHX A;  2K60 A;  5B66 U;  1UQV A;  3OJS A;  3PW7 A;  4AT8 B;  1NI3 A;  2HBL A;  4YD1 A;  1B22 A;  4FS2 A;  4Z6E A;  3ERC C;  1JN3 A;  1D8B A;  2I5H A;  2F8L A;  3MDA A;  2B21 A;  4O3R A;  3C66 A;  5HP4 A;  2Y1I A;  4UAS A;  3RJI A;  1VLB A;  2B6G A;  4YR2 A;  1QSL A;  4X4U A;  1ZYQ A;  2BGW A;  3Q8M A;  1TE2 A;  5FP0 A;  4DFJ A;  1LB2 B;  3K75 D;  5AM4 A;  4X4Q A;  3NVW A;  3ISC A;  5DBA A;  1ZQB A;  2FMQ A;  4F72 A;  7ICH A; 
#chains in the Genus database with same CATH homology
 4YQW A;  3SI8 A;  3HJ4 A;  2BCU A;  5J2I A;  4AT9 B;  4J9K A;  1NOM A;  5CR0 A;  5EWE A;  4NM1 A;  3H3A A;  8ICH A;  2XCP A;  9ICM A;  1SKW A;  4Z6F A;  4QWE A;  4RQ4 A;  1S0O A;  4BXO A;  1SL1 A;  1ZJN A;  4JV0 A;  5DB6 A;  5KFE A;  8ICX A;  5KFU A;  4F4Y A;  3V72 A;  8ICI A;  2HHV A;  4ATB B;  4RQ5 A;  4YN4 A;  2KN7 A;  4TUR A;  3WFR E;  1K1Q A;  3RJF A;  2I9G A;  2NRT A;  2DPI A;  1S0V A;  3AQN A;  5CJ7 A;  1XSN A;  1R89 A;  4J9S A;  4RNN A;  2KFN A;  3UQ2 A;  9ICT A;  2ZH3 A;  1ZJM A;  4YG2 A;  2BPF A;  4C8K A;  3AU6 A;  3PW0 A;  1B43 A;  1BPX A;  1ZQD A;  1IM4 A;  2VA3 A;  3OVA A;  9ICI A;  9ICQ A;  8ICG A;  7ICN A;  4DOC A;  4DS4 A;  1ZQT A;  3PX6 A;  4C8L A;  3H8J A;  4MFC A;  3RB4 A;  5DB9 A;  2FPL A;  3LDA A;  5BOL A;  2JEJ A;  1DOQ A;  4P2H A;  2R8J A;  4RPX A;  4WC1 A;  4XQ7 A;  4NM2 A;  5J0R A;  4X4R A;  4KLL A;  3PO5 A;  5HHH A;  1RPL A;  1XWL A;  3B0Y A;  2A1J A;  5KG4 A;  3PX4 A;  5HRE A;  4FHX A;  4EBC A;  4ED7 A;  4DSL A;  4QZG A;  2W9B B;  2BDP A;  4PPX A;  1ZQU A;  4J9M A;  2AGQ A;  1CEZ A;  1EXN A;  1PZN A;  2XGP A;  7ICS A;  5KT3 A;  4RQ2 A;  2ASD A;  4DF4 A;  4UD5 A;  1U4B A;  1TV9 A;  5KFZ A;  5C5J A;  5KFY A;  3QZ7 A;  4CCH A;  4NKU A;  8ICA A;  1X9S A;  2M9N A;  3AQM A;  3TAQ A;  4KLI A;  4M04 A;  3GIL A;  4UBB A;  4PHA A;  4EZ6 A;  4TQR A;  4FBU A;  1TK5 A;  4I2C A;  2FPM A;  3RR8 A;  4WC5 A;  1S10 A;  4O3Q A;  3ZDE A;  1MQ2 A;  1R8C A;  3BQ1 A;  3ZD8 A;  4KLQ A;  1ZQW A;  4X5V A;  2ZH8 A;  3LK9 A;  4O3N A;  4FHV A;  3JZ0 A;  4IRK A;  9ICK A;  2DRA A;  3BJY A;  3PML A;  9ICN A;  4I28 A;  4O5E A;  4R8U A;  7ICG A;  2FPK A;  7ICO A;  7ICL A;  1IXR A;  5DB8 A;  2HHU A;  1ZQP A;  4F4Z A;  2BQU A;  5KFV A;  5CHG A;  4EBK A;  3OSP A;  2OWO A;  2PI4 A;  2BCV A;  5J2K A;  4HYK A;  4KLF A;  4RWP A;  4J9P A;  3THV A;  7ICF A;  8ICZ A;  4WBY A;  1XO1 A;  3UXN A;  4RQ7 A;  5F9L A;  1U47 A;  5III A;  1ZQC A;  4O3S A;  5KFW A;  2PFP A;  1MSW D;  3T5J A;  3TFR A;  2M2U A;  3LWL A;  1Z00 A;  3RH5 A;  4RT2 A;  3T5H A;  3JPS A;  1ZQQ A;  2A1J B;  1COO A;  3ISD A;  2BPG A;  2ZH1 A;  2XY7 A;  4I2G A;  3PR4 A;  4EYI B;  1Q78 A;  2ZTE A;  3SV3 A;  3RJE A;  4UQG A;  2ZHA A;  5J2E A;  4YR3 A;  1CUK A;  5KT2 A;  1T4G A;  3C2M A;  5KT6 A;  1RXW A;  5DED A;  1V4A A;  2DR8 A;  3OSN A;  5KG6 A;  4ED8 A;  8ICF A;  1L3V A;  9ICA A;  1RYR A;  4YR0 A;  4X4P A;  4WCW A;  8ICJ A;  4F4W A;  4G3I A;  4PGQ A;  5DLF A;  5KG1 A;  2J6S A;  4Q8E A;  4F4X A;  4E0D A;  3C1Y A;  1TAU A;  2C22 A;  2HW3 A;  4ECU A;  5DGB A;  3UPS A;  1BVS A;  1BPB A;  2DFL A;  4QZE A;  4F5P A;  2BCS A;  4WC0 A;  2XGQ A;  5BPC A;  1SKS A;  4FH3 A;  4K4G A;  1LV5 A;  1KFT A;  1JX4 A;  3PX0 A;  3RJH A;  3SV4 A;  4DOA A;  2BE3 A;  4AT7 A;  5KG7 A;  3N4M B;  5J0S A;  1MQ3 A;  2KTQ A;  3RJJ A;  9ICU A;  3RTV A;  1KFD A;  4PHD A;  3GV7 B;  1V9P A;  5L1L A;  3IHQ B;  2JEI A;  4YVZ A;  4RZR A;  4O0I A;  4EEY A;  1KDH A;  1K1S A;  2ALZ A;  1BPZ A;  1D8Y A;  5KFM A;  3M9M B;  3H8S A;  4ECW A;  2PFN A;  2AJQ A;  1Q79 A;  1ZQX A;  2BCQ A;  1UEU A;  1YLQ A;  4XRH A;  1SL2 A;  2VA2 A;  4P4O A;  3JPN A;  3AUO A;  2RDJ A;  3RB0 A;  5KFF A;  3C2L A;  2BPC A;  2C2E A;  8ICM A;  3RH6 A;  2JZB B;  4YMM A;  4J9N A;  1F5A A;  5KFR A;  4RNO A;  2ZUD A;  2R8I A;  2W9A A;  4XA5 A;  2IMW P;  3UXO A;  4LZG A;  4KLH A;  3JPT A;  9ICG A;  5HRL A;  3RBD A;  4YXM A;  2BKE A;  5J2C A;  1NKB A;  3HW8 A;  5D4B A;  4DQP A;  2KFZ A;  8ICL A;  4ED6 A;  4O5K A;  3H37 A;  4I29 A;  7ICR A;  2PFQ A;  4DEZ A;  2W9C A;  4RPY A;  4IQW A;  4KLG A;  4KLT A;  4YMN A;  5IIK A;  5J2G A;  2ISO A;  5DGA A;  3EPG A;  5IIM A;  4ED3 A;  4JV2 A;  1TFR A;  2VA8 A;  2BQR A;  5KFH A;  5DDY A;  4ECX A;  4X4O A;  2NRX A;  4DSF A;  4DQS A;  4PHE A;  5KG2 A;  4B9N A;  4QZH A;  1ZQS A;  3Q8Q B;  1UA1 A;  3V7K A;  3ISB A;  3C1Z A;  2J6U A;  3H8W A;  8ICS A;  4QZ9 A;  5L1J A;  1D9F A;  2IHN A;  3UPQ A;  3Q8K A;  1FA0 A;  2C2D A;  1TK8 A;  2AGO A;  1ZQJ A;  1JXE A;  1QTM A;  4EYH B;  5DKW A;  1KFS A;  4Q8F A;  2ZJ5 A;  3H4D A;  1S97 A;  1SL0 A;  3E2E A;  3M9O B;  5J0Q A;  7ICI A;  4F4K A;  4J9Q A;  4E8F A;  1KEJ A;  2PFO A;  4F3O A;  3LQC B;  1BPD A;  4IQV A;  3M8R A;  5DBB A;  3ETL A;  5EWG A;  1UEV A;  4JUZ A;  2ZH2 A;  4RQ3 A;  3MDC A;  2R8G A;  3V6H A;  1ZQO A;  3Q8R B;  4X4V A;  5HRF A;  2HHP A;  4BDP A;  3FDS A;  4KLJ A;  5HML A;  4KN4 A;  4WC6 A;  1MIY A;  4QWD A;  3MBY A;  3EPI A;  2ID1 A;  4JK1 A;  1ZQE A;  2NRZ A;  1L3T A;  1ZQL A;  4DQQ A;  1H38 A;  2R8K A;  4UAY A;  2BQ3 A;  4IRD A;  4JV1 A;  2HHQ A;  1MC8 A;  4DLG A;  7ICQ A;  5KFB A;  8ICC A;  2P6R A;  5DEC A;  4DL2 A;  3C18 A;  4M6W A;  3C23 A;  4QZB A;  4B9S A;  5D49 A;  3QEB Z;  2MUT A;  1JXL A;  9ICW A;  2JEG A;  5J0Y A;  4ECZ A;  1T3N A;  1KNY A;  5DQG A;  4DLE A;  1U45 A;  2ASL A;  2PXI A;  4BXO B;  4ELU A;  4F5R A;  4ECS A;  3BQ2 A;  4DL7 A;  4I2E A;  8ICW A;  3RR7 A;  1JIH A;  1ZQG A;  9ICL A;  4KMU A;  4RWQ A;  4I2D A;  1ARO P;  1U49 A;  7ICM A;  3MR2 A;  5KFX A;  5KFI A;  3TFS A;  8ICU A;  5HRB A;  2NRK A;  1NK6 A;  5KTQ A;  2ZH5 A;  4KLO A;  1ZET A;  4X4U A;  1N48 A;  1WOT A;  5DG7 A;  2ZH7 A;  2BHN A;  1BPY A;  4QW9 A;  3H7I A;  2V4R A;  4LVS A;  1JAJ A;  3WFQ E;  4EZ9 A;  5L1K A;  3ZDD A;  3JYY A;  5KG3 A;  4DF8 A;  8ICQ A;  4BWJ A;  4C8M A;  5J0O A;  4MEX A;  3IM1 A;  2HHT A;  5IIO A;  3PY8 A;  4DSJ A;  3PNC A;  3MAB A;  4IRC A;  5DQI A;  3HWT A;  3KHG A;  1S77 D;  4M9J A;  3MR6 A;  5DG9 A;  3EZ5 A;  4EBJ A;  3EWA A;  3GV5 B;  2F1J A;  5KFD A;  3PR5 B;  4ECR A;  3WFP A;  4Q43 A;  4YCX A;  2ZUB A;  3T5K A;  2ZTC A;  3TAR A;  4B9M A;  5J0U A;  1HJP A;  4FS1 A;  3KHR A;  4IG8 A;  1ZQK A;  3TAN A;  4NXZ A;  5CP2 A;  2IA6 A;  4MEY A;  4MFF A;  5CB1 A;  2JEF A;  3RH4 A;  9ICB A;  4O3O A;  5HRI A;  5KT5 A;  4P4P A;  4NLK A;  5HRK A;  3GFK B;  5J29 A;  4QZF A;  4UBC A;  3AQK A;  1NK0 A;  4FBT A;  4RQ1 A;  2MUT B;  4R65 A;  2XC9 A;  3H4B A;  2FMS A;  3MR3 A;  1T7P A;  2NRW A;  4DQI A;  4I2A A;  1MIW A;  1OU5 A;  3HIY A;  5J2H A;  4ZH4 A;  4X4T A;  1SZP A;  5JUM A;  4Z6C A;  3GII A;  3MR5 A;  3OUY A;  3ZD9 A;  3QEA Z;  4E80 A;  3MFI A;  3RB6 A;  3PV8 A;  2HVH A;  2M2T A;  4NY8 A;  5KG0 A;  4R8U B;  3V6K A;  1N56 A;  4XUS A;  5KFK A;  4Q45 A;  3NGD A;  1NK8 A;  1WCN A;  5J2D A;  4F91 B;  1JMS A;  4Q44 A;  4R63 A;  1ZQI A;  4AT9 A;  4ELT A;  5KT7 A;  3WFS C;  2R8H A;  2MAX A;  3HP6 A;  1NJY A;  3ORY A;  7ICV A;  4NLG A;  4M9L A;  9ICC A;  4MFA A;  2J6T A;  3TI0 A;  1L3U A;  1DGS A;  4BWM A;  3GDX A;  2Y1J A;  3UQ0 A;  4DWI A;  2UVW A;  1ZQH A;  4ECT A;  2ISP A;  4I2F A;  2V9W A;  3HT3 A;  7ICP A;  2O1P A;  4ATB A;  4NLN A;  8ICB A;  3RRG A;  2NRV A;  4RWO A;  3K4G A;  3RRH A;  3RAX A;  3H40 A;  4J9O A;  7ICT A;  4J9L A;  5CA7 A;  4GXI A;  1Z00 B;  5J0X A;  1QSY A;  3PMN A;  4UB3 A;  3NTU A;  3JPP A;  4F50 A;  4B9T A;  5J2J A;  5DDM A;  4ED2 A;  3N97 B;  3TQ1 A;  4WC2 A;  2HVI A;  4YD2 A;  4QZC A;  4DL3 A;  4DL4 A;  3PW2 A;  4B9L A;  4KLS A;  3EYZ A;  3FYH A;  9ICJ A;  4M0A A;  3T5L A;  3KTQ A;  2XCA A;  3KHL A;  4ED0 A;  4GC6 A;  1ZQY A;  1ZQA A;  9ICP A;  4GXJ A;  4F92 B;  3NYB A;  7ICU A;  4GXK A;  4S3N A;  5EOZ A;  4RNM A;  2BR0 A;  4LZD A;  4PGX A;  1XSL A;  3PO4 A;  7ICJ A;  1ZQR A;  4NLZ A;  9ICV A;  4FH5 A;  4LT6 A;  4YXJ A;  1PX5 A;  2XY6 A;  5D46 A;  4ELV A;  5HNK A;  2AU0 A;  1TKD A;  3ZDB A;  4ECV A;  2LYH A;  3MFH A;  1L3S A;  2P66 A;  3OHA A;  1RYS A;  2HHS A;  1X9W A;  5EWF A;  5HR9 A;  1KTQ A;  4RWN A;  4GC7 A;  2ASJ A;  2IBK A;  4RQ0 A;  4O9M A;  8ICY A;  5HRD A;  4AT7 B;  5KFL A;  2W9M A;  4DFP A;  1L5U A;  4M5D A;  4FO6 A;  4DSK A;  4IQT A;  2RDI A;  3SZ2 A;  4QZI A;  3Q8P B;  4M9H A;  4UAW A;  2VAN A;  4JWM A;  2P6U A;  3HJ1 A;  1Z3E B;  4UD4 A;  4UB4 A;  8ICR A;  2ZH4 A;  4M2Y A;  4I27 A;  9ICR A;  4UAZ A;  4M9N A;  2KZM A;  5HRG A;  3Q8S B;  2W8K A;  4QWA A;  1ZQZ A;  1SKR A;  4WC7 A;  1XC9 A;  3GQC A;  1ZQN A;  3M8S A;  4F5O A;  4EBD A;  1XSP A;  3EW9 A;  1KLN A;  1KRP A;  3OVS A;  3OV7 A;  5KT4 A;  7ICK A;  5HC9 A;  1NK9 A;  1S0M A;  4R66 A;  3PVX A;  5CWR A;  1NK5 A;  2WTF A;  1RXV A;  4XQ8 A;  4BGD A;  1UA0 A;  4TUQ A;  4ED1 A;  2W9C B;  1S9F A;  4O5C A;  9ICO A;  3RAQ A;  3RB3 A;  2M2W A;  4Z6D A;  4ECY A;  1A76 A;  2H5X A;  4MF8 A;  4PGY A;  4QWC A;  3HX0 A;  1TVA A;  3G6X A;  4O3P A;  1D9D A;  1R8A A;  5BOM A;  3T3F A;  4E7X A;  5DBC A;  7ICE A;  3RBE A;  4RUC A;  1ZQM A;  4KTQ A;  4FHW A;  4QZA A;  8ICK A;  3C5G A;  3AU2 A;  4DOB A;  1NO5 A;  4YMO A;  8ICV A;  4M9G A;  5J0T A;  4F5Q A;  2FMP A;  1NK7 A;  2PBE A;  2ZH6 A;  3BQT A;  4X0A A;  4ECQ A;  3GIJ A;  4DL6 A;  4UB1 A;  4I2H A;  5KFQ A;  3V7L A;  3QE9 Y;  3H39 A;  5KFT A;  3UXP A;  1MIV A;  4C8N A;  4UB2 A;  1NKC A;  4M47 A;  4KLU A;  2DPJ A;  2Q0Z X;  4PH5 A;  1U9L A;  1UT5 A;  4TUP A;  3OHB A;  1XS9 D;  1ZQF A;  1BPE A;  2FLL A;  4C8O A;  2FLP A;  5J0W A;  3H38 A;  4YFK A;  1KSP A;  3B0X A;  4P4M A;  3HPO A;  5DLG A;  3QZ8 A;  5DB7 A;  5IIL A;  2M2V A;  4IQU A;  1ZQV A;  3C5F A;  2F1I A;  5KFJ A;  4RQ8 A;  4AT8 A;  4EP7 A;  4EBE A;  5IIN A;  2AQ0 A;  5IIJ A;  5J0P A;  4RPZ A;  1BGX T;  4QWB A;  4GLX A;  3PW4 A;  2ZH9 A;  4K4H A;  1R8B A;  4IR9 A;  5KFA A;  4MF2 A;  3Q8L A;  4NKT A;  3KHH A;  9ICS A;  2ZJA A;  4DO9 A;  4KIT B;  1NJX A;  8ICN A;  4WBZ A;  4IR1 A;  4M6W B;  3JPO A;  2ZTD A;  3SYZ A;  2FLN A;  2UVR A;  2KZZ A;  5L1I A;  4UB5 A;  4DFK A;  3TAP A;  2IHM A;  2O5A A;  5KFN A;  1D8L A;  5L9X A;  2PI5 A;  5KFG A;  2DR5 A;  5F9N A;  4DS5 A;  1TK0 A;  3RJK A;  4KLD A;  1X2I A;  2C28 A;  2JZB A;  9ICE A;  8ICT A;  4R64 A;  1S76 D;  5KFO A;  1RZT A;  2AGP A;  4B9U A;  4I2I A;  5TZV A;  2ZHB A;  4JWN A;  4WC4 A;  5HHI A;  2HHW A;  2XO7 A;  5F2V O;  2DVI A;  1WCL A;  4WC3 A;  4F2S A;  2XY5 A;  3PW5 A;  4RT3 A;  4RU9 A;  3M9N B;  2DR9 A;  4RUA A;  3C2K A;  3JPR A;  1UT8 A;  1Y88 A;  4I2B A;  2BCR A;  3BDP A;  5KG5 A;  4DFM A;  8ICP A;  4QW8 A;  5KFC A;  3LWM A;  2C2R A;  1UET A;  5J2F A;  5HMM A;  1A77 A;  3RJG A;  4F93 B;  1NJW A;  9ICF A;  3OVB A;  3L9D A;  4DSE A;  1TFY A;  2AQ4 A;  8ICE A;  5DG8 A;  2ZJ8 A;  5KFP A;  3G6V A;  3MGH A;  4QZ8 A;  4FHY A;  3GV8 B;  5HRH A;  2DR7 A;  2I1Q A;  4F2R A;  1VJ7 A;  4TQS A;  1VFG A;  3WFO A;  5J2A A;  3OJU A;  1QSS A;  1NKE A;  3AQL A;  1TFW A;  1NK4 A;  9ICX A;  3GIK A;  4X4N A;  2HHX A;  4F8R A;  1C7Y A;  2RFF A;  2F1H A;  3OJS A;  3PW7 A;  4AT8 B;  4YD1 A;  1B22 A;  1S0N A;  4K4I A;  3JPQ A;  4KLM A;  5DQH A;  3V6J A;  4KN7 A;  4FS2 A;  4DQR A;  4Z6E A;  1JN3 A;  4B9V A;  1JQR A;  2KZ3 A;  1U48 A;  3MDA A;  2B21 A;  3C21 A;  4YP3 A;  4F5N A;  4O3R A;  1TAQ A;  2ATL A;  4J9R A;  3C66 A;  4FHP A;  4X0B A;  5HP4 A;  2Y1I A;  4X4S A;  2DRB A;  4KLE A;  2ZUC A;  3RJI A;  4DSI A;  3V7J A;  1HUO A;  1XU4 A;  4QZD A;  4YR2 A;  3GIM A;  4RQ6 A;  1ZYQ A;  1QSL A;  5J2B A;  3OGU A;  4DL5 A;  2BGW A;  2GWS A;  2UVU A;  8ICO A;  2Q66 A;  3MGI A;  3Q8M A;  2UVV A;  4PHP A;  4DFJ A;  1LB2 B;  2W9B A;  3BQ0 A;  3ZDA A;  3K75 D;  1NJZ A;  4TUS A;  2W8L A;  3OUY B;  4X4Q A;  4I2J A;  1QLN A;  1HUZ A;  3ISC A;  5DBA A;  1ZQB A;  3G6Y A;  1T8E A;  5KFS A;  2FMQ A;  3ZDC A;  1X9M A;  9ICH A;  7ICH A;  2V4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...