2VANA

Nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
245
structure length
240
Chain Sequence
DDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLQPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERSE BETA
publication title Mismatched Dntp Incorporation by DNA Polymerase Beta Does not Proceed Via Globally Different Conformational Pathways.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 82
structure length 240
sequence length 245
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2vanA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2vanA03
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2vanA02
1L3TA 5DLFA 2J6UA 1ZQAA 4RQ8A 3JPOA 1RZTA 3ORYA 4KLTA 2HHTA 1R89A 5DBAA 4IQWA 3EWAA 4AT7B 4X4OA 1NK6A 8ICQA 2RDJA 4RPYA 4QZCA 1BPEA 4MEXA 4UAZA 9ICIA 1ZQZA 4X4VA 3PO5A 1ZQEA 4NKUA 5HMMA 4MF2A 2BQUA 5CB1A 2M2UA 4DSFA 1ZYQA 3Q8LA 4UB2A 3RJJA 4I2JA 5J29A 3RRGA 4J9OA 1B22A 4R8UB 3MR2A 2W9AA 4PHAA 3T5HA 4RQ6A 5IILA 2JEJA 4M6WA 4FHXA 1DOQA 5HNKA 4F4XA 8ICLA 5BOLA 1Y88A 2AGPA 4MFFA 3K4GA 1MIWA 3OUYB 3TFRA 4WCWA 1A77A 9ICSA 1OU5A 2XGPA 9ICCA 3NYBA 3BJYA 2HHUA 1U9LA 4EZ6A 4DQSA 3PW7A 3GIKA 4DL3A 3JZ0A 3T3FA 2J6SA 4Q8EA 3TAQA 5IIOA 1RXVA 4E0DA 3LDAA 5L1JA 4NLZA 2BQRA 4RWOA 4AT9A 1TAQA 3ZDBA 3C1YA 4M9JA 2ZUCA 1ZQIA 4I2AA 9ICQA 4DLGA 3GIIA 1JAJA 4ATBA 3RH4A 3ZDCA 3IM1A 5J0YA 3BQ0A 4ECTA 3TQ1A 1NKBA 4JV2A 5KFCA 4TUSA 2UVRA 4O3PA 4UB5A 5HRFA 4Q45A 5HMLA 3Q8SB 3TANA 2O5AA 5BOMA 4ELTA 1TFRA 1ZQQA 4KITB 3SI8A 9ICBA 4QWEA 5KFHA 1RYSA 2KN7A 3PW2A 3T5LA 4K4HA 1ZQDA 2ZJ5A 4E80A 5DBBA 3C66A 1XO1A 3MR6A 2I9GA 3JYYA 2O1PA 3QEBZ 4YR3A 2P6UA 1ZQWA 4F5OA 3PO4A 1WOTA 5DECA 5DDMA 3C23A 5J0RA 4FS1A 1ZJNA 2OWOA 4J9QA 2H5XA 2ASDA 1XC9A 1UT8A 2FLNA 4I2FA 4FHPA 3ZDAA 4QWAA 2BGWA 3H39A 4GXIA 1ZQCA 1C7YA 1QLNA 2ISOA 9ICUA 4XUSA 4M04A 5DB8A 4UB4A 2XY7A 2XY6A 3ZDDA 7ICGA 4RQ3A 9ICGA 3RAXA 3PV8A 1V9PA 5KG2A 1ZQHA 3LWLA 4I2GA 4IRKA 3JPPA 5KFQA 8ICPA 9ICVA 4IQVA 1MQ2A 4EBEA 4M5DA 4AT7A 4QWBA 1KFSA 3RR8A 7ICMA 3PX6A 4FHVA 4M0AA 5DKWA 8ICAA 1UETA 2PFPA 5KFIA 4RNMA 3HWTA 4DFPA 1NJWA 4X4RA 1QSLA 3Q8QB 5KFBA 5HHIA 1TAUA 3EYZA 3H38A 3GV5B 4PHDA 1NJZA 2Q66A 4P4MA 3GIJA 1QSYA 5KFWA 3BQ2A 4DSIA 3TAPA 3OUYA 2DR9A 3H4DA 5HR9A 3UXOA 4QZDA 3LWMA 4NLGA 4F93B 4Q8FA 1MIVA 4M6WB 4DOBA 4F92B 4ED0A 1SL0A 3G6XA 4O3OA 5HRGA 4I2IA 3V7LA 4QWDA 4Z6FA 4UB3A 3Q8KA 8ICXA 5KT7A 5DEDA 4ECVA 5J0TA 3SZ2A 1NK0A 1LV5A 4BXOA 1X9WA 3ISCA 3UQ2A 4P2HA 4DO9A 4C8NA 3RBDA 1S77D 4ZH4A 4WBZA 5CWRA 1RYRA 5F9NA 2ZH2A 2KFNA 4QZEA 2FMQA 3C5FA 4AT9B 5KFNA 4J9LA 1L3VA 4GLXA 4X4NA 2PI5A 3C2LA 4C8LA 5HRHA 1TKDA 5DG7A 1NKEA 4ATBB 3OVBA 3L9DA 2ZH3A 2JEIA 5HHHA 1TK0A 4IR1A 4KLHA 4RQ5A 1L5UA 4I29A 4Q44A 3OVSA 9ICRA 3C21A 3MGIA 1ZQNA 4WC0A 1UT5A 4YCXA 3EW9A 8ICRA 4KMUA 5L1KA 1NJXA 4I2DA 9ICHA 3EPGA 1U48A 3JPSA 3UXPA 1PZNA 5KFVA 1VFGA 4DL5A 3G6VA 3ZD8A 4FHYA 2WTFA 4DL6A 5CA7A 3RJKA 2XC9A 1Z00A 5KFYA 2F1HA 4TQRA 2ASLA 2FLPA 2ZH4A 4X4PA 4DL2A 3BQ1A 4DOAA 3RBEA 1SL1A 1MIYA 2DR8A 4YFKA 2IHNA 5IIKA 3GDXA 4J9RA 4PGXA 1X2IA 4RNOA 1S97A 3KHLA 4JV1A 4DFJA 3RJIA 5KFTA 5HRLA 2XCAA 4S3NA 4RQ2A 1ZQGA 8ICGA 3RR7A 4KLIA 3H8JA 4UD4A 2V4QA 3V6HA 4I27A 4YR0A 4DSEA 4DLEA 5KFJA 5KFDA 7ICVA 4EYHB 5DGAA 4HYKA 2ZUDA 2KTQA 2R8JA 1ZJMA 5J2BA 2PXIA 3MDAA 1NJYA 3GILA 2BE3A 1ZQPA 3ZDEA 4R63A 2IMWP 2ZJAA 3KHGA 4Z6DA 5KT5A 3MBYA 1PX5A 3KHRA 1SZPA 3HP6A 3M9OB 7ICKA 2DPJA 1HUOA 3C18A 1LB2B 3QEAZ 4DSJA 5HC9A 8ICIA 3M9NB 1ZETA 4KN7A 4YVZA 2DRAA 4F50A 2P66A 9ICAA 4BWJA 2HVIA 2ZUBA 5J0UA 2Q0ZX 3FDSA 1ZQXA 3H40A 5KG5A 4Q43A 4EYIB 1JQRA 4RWPA 3GQCA 4FBTA 5KFLA 4MEYA 3QZ8A 1TFYA 4F4ZA 1ZQYA 2FMSA 3RJEA 4FHWA 4E7XA 4BXOB 5J0OA 5KG4A 1SKWA 4RQ4A 4FO6A 2XGQA 1ZQJA 9ICKA 5KFUA 3OVAA 4RUAA 1SKSA 4DWIA 2F1JA 4XQ7A 1N48A 3N4MB 3OSNA 1U45A 4DSLA 4KLDA 5DQIA 2BHNA 4WC7A 1CUKA 4UBCA 5DG8A 3V72A 4F5QA 4X4QA 4Z6CA 3UPQA 3GV8B 1K1SA 3UQ0A 8ICHA 3OHAA 2R8IA 1NO5A 4QZFA 7ICOA 1RXWA 7ICQA 4B9VA 3RB4A 3M8SA 1TFWA 1XWLA 2ZJ8A 3HJ4A 1K1QA 2BR0A 3RJFA 5KT4A 4UAYA 3GIMA 1NK7A 7ICJA 5J2EA 2C2EA 8ICVA 2I1QA 1MSWD 2HHPA 4XA5A 1Q79A 4FH5A 4ECUA 3ISDA 2NRZA 4PH5A 4B9SA 5KFRA 2ZTEA 4EZ9A 2HHWA 2VANA 2R8HA 1Z00B 4GC6A 2M2VA 3V7KA 3AQKA 5DQGA 7ICHA 4F8RA 4TUQA 3K75D 4QZHA 2M2WA 4DSKA 1QTMA 3M8RA 1UA1A 1T7PA 2AQ0A 4DF8A 5CP2A 1F5AA 7ICUA 4O3NA 5EOZA 4F2SA 1Q78A 5J2FA 4O5EA 2BQ3A 1WCLA 4DS4A 4F3OA 1BGXT 2KZZA 9ICMA 3PMLA 4WC2A 4C8KA 2DR7A 1MC8A 4ED8A 7ICFA 4RQ0A 4B9LA 1JN3A 3LQCB 1BPZA 4EEYA 5J2JA 2AJQA 1S0VA 4DF4A 3OJSA 5KG3A 4BGDA 5DQHA 3RH5A 4ED6A 4KN4A 5D46A 2C2RA 2PFOA 4WC4A 1HJPA 1X9SA 4KLJA 4DQQA 2IA6A 4YXJA 8ICKA 2DRBA 4QW9A 2FMPA 4IRDA 2HVHA 4UD5A 4B9NA 5CR0A 4ECSA 4RNNA 4NLKA 3PW5A 1BVSA 2NRTA 3PX4A 3WFSC 5JUMA 1D9FA 3PY8A 4XRHA 3Q8PB 2AQ4A 1HUZA 5HREA 5KFMA 1V4AA 3OHBA 5L9XA 4X0BA 2A1JB 4KLOA 3HT3A 4R64A 9ICXA 4YQWA 2ZHBA 5J2CA 2BPCA 1D8YA 3HIYA 1TVAA 4E8FA 2PFQA 4B9MA 1WCNA 4KLUA 4YG2A 3M9MB 4M47A 2NRXA 4JWNA 3FYHA 5J0XA 4YP3A 5DG9A 2NRWA 5CHGA 1MQ3A 1R8AA 4RPZA 2J6TA 2HHSA 5C5JA 4F4WA 5KG7A 4ED3A 8ICOA 3B0YA 4IG8A 4AT8A 4F91B 3BDPA 3ETLA 5D49A 5EWFA 1X9MA 2BCVA 3AQNA 5IIJA 3OSPA 4M2YA 4X0AA 2Y1IA 1JIHA 4R65A 4R66A 3G6YA 4F4YA 5DDYA 2BDPA 3E2EA 5TZVA 1R8CA 1UEVA 3ISBA 2P6RA 4GXJA 2PI4A 2MUTB 4NM2A 5KFOA 3PR5B 4M9HA 1XU4A 3OGUA 1UA0A 5HP4A 2NRKA 1ZQLA 1KDHA 3AU2A 3V7JA 3B0XA 4RWNA 2LYHA 1BPXA 4I2HA 1N56A 4O5CA 3ZD9A 3NGDA 2KZMA 1ZQTA 3WFRE 3RB3A 1ZQMA 1S76D 4ED2A 4TURA 2ID1A 4F2RA 4KLGA 2VA2A 4WBYA 1FA0A 4O3RA 5CJ7A 3AU6A 5J0WA 3RH6A 4K4GA 3BQTA 5HRKA 4RPXA 1ZQOA 7ICRA 4J9MA 2ZH8A 3Q8MA 4O5KA 7ICNA 8ICFA 2W9CA 1JX4A 5J2AA 2BCQA 2KFZA 3PX0A 7ICIA 3V6JA 3AQMA 1ZQKA 2Y1JA 4LZGA 1KNYA 7ICTA 4KLMA 3NTUA 4DS5A 1D8LA 4UBBA 3HW8A 4ECYA 4YMNA 4YN4A 3GV7B 4ECXA 4XQ8A 4RUCA 4YD1A 5KFEA 2HHXA 3C2MA 3T5JA 3AUOA 1S10A 4ELUA 5KT2A 2BCUA 4NXZA 5KT6A 2VA8A 2JZBA 1XSNA 3SYZA 4ECQA 4DQIA 3RRHA 4J9SA 5F2VO 4K4IA 3MGHA 4YD2A 5J0QA 1ZQUA 2A1JA 3RTVA 3H8WA 4RQ7A 3MR3A 3RJHA 5HRDA 4WC5A 1COOA 1L3UA 1KFTA 1KLNA 4DFMA 4I2BA 1U47A 1TK8A 3MFHA 4X4TA 8ICTA 2BPGA 3H7IA 2V9WA 2JEFA 1A76A 5KFAA 2AGQA 3RAQA 3H37A 3C2KA 4P4PA 1XSPA 9ICEA 2ALZA 1S0MA 3OJUA 4EBJA 2V4RA 4RT3A 1SL2A 4X4UA 4F5PA 4DQRA 3JPNA 3PW0A 4P4OA 4ED1A 5IIMA 8ICEA 4FBUA 5KFZA 4KLLA 4GXKA 4AT8B 3RB0A 2BCRA 2VA3A 9ICWA 3AQLA 2ZTCA 4YMMA 4ED7A 2R8KA 2MUTA 4ECRA 1QSSA 7ICLA 9ICTA 5KT3A 3PNCA 1ZQVA 5BPCA 4RZRA 1KEJA 2FPLA 2ZH1A 2B21A 7ICPA 4BDPA 4I2EA 1NK8A 3SV4A 2UVUA 4QZAA 4KLEA 5J0SA 3KHHA 4I2CA 8ICCA 3PVXA 8ICNA 9ICLA 3SV3A 4F5RA 4QZBA 4O3SA 4KTQA 2M2TA 2UVWA 2ZTDA 2ZH9A 4LVSA 2IHMA 4UQGA 3RJGA 4X4SA 4YR2A 1L3SA 9ICJA 2ZHAA 4QZIA 2M9NA 2HHQA 9ICPA 3EPIA 5KG0A 1AROP 1XS9D 9ICOA 2W8KA 1ZQBA 4GC7A 4F4KA 5KFFA 1XSLA 4B9TA 1KSPA 1RPLA 3PMNA 4C8MA 5KTQA 4FS2A 4BWMA 2BPFA 2DR5A 1SKRA 2W9CB 4NKTA 4J9KA 5DB6A 4C8OA 4J9NA 1UEUA 4B9UA 4WC1A 3TFSA 4DEZA 4PGQA 5J2HA 1S9FA 3LK9A 3QE9Y 4DFKA 2C22A 4J9PA 1T4GA 2NRVA 5DB7A 5KFSA 4TUPA 1TK5A 1ZQSA 4M9LA 4WC3A 4PGYA 5L1LA 1D9DA 4M9GA 1TV9A 2PBEA 3OV7A 3N97B 2PFNA 2R8GA 4UAWA 2W9BA 2AU0A 3QZ7A 1S0OA 2XY5A 3TARA 5KFKA 3THVA 1KRPA 2JZBB 3KTQA 5KFGA 3Q8RB 4JWMA 5L1IA 1IXRA 2ZH6A 4QZ9A 3HJ1A 5J2IA 2JEGA 8ICBA 7ICSA 4LT6A 4EBKA 4RWQA 3C5GA 1CEZA 2RFFA 3MR5A 2W8LA 1R8BA 1NK9A 2F1IA 2W9MA 5KFPA 4DOCA 4R8UA 3JPTA 4O3QA 5J2DA 4QZ8A 4KLSA 2ISPA 1YLQA 4UB1A 2MAXA 3H4BA 5KG1A 3RB6A 1KFDA 4QWCA 5IIIA 2UVVA 3HX0A 1S0NA 4NLNA 2XO7A 4EBDA 3GFKB 5HRBA 4LZDA 3V6KA 2GWSA 1T8EA 2FPMA 3C1ZA 4IR9A 4IQTA 3MABA 4FH3A 2DVIA 3WFQE 4WC6A 4DL7A 8ICMA 9ICFA 8ICUA 2ATLA 5DGBA 4CCHA 3IHQB 8ICYA 5HRIA 3H3AA 3PR4A 3MFIA 4IRCA 2BCSA 4QW8A 4DQPA 2RDIA 5J2GA 2ASJA 5J2KA 3H8SA 1H38A 1IM4A 3HPOA 3UXNA 3UPSA 8ICSA 4Z6EA 5J0PA 2FPKA 4M9NA 1JXLA 2BKEA 5DB9A 1NK4A 4YMOA 3WFOA 5DBCA 5KG6A 4EBCA 4RQ1A 4YXMA 3JPQA 5D4BA 4G3IA 1EXNA 4EP7A 3WFPA 4JUZA 4ECWA 5IINA 2FLLA 4ELVA 4X5VA 4PHEA 1NK5A 4QZGA 4RU9A 7ICEA 8ICJA 4DL4A 4JK1A 5KFXA 5DLGA 4KLQA 9ICNA 1JXEA 3JPRA 2AGOA 1KTQA 1U4BA 1NKCA 2HW3A 4MFCA 2ZH7A 1BPBA 4IQUA 5F9LA 2DPIA 4O9MA 3MDCA 4PPXA 1B43A 4PHPA 4KLFA 2HHVA 1JMSA 8ICWA 1ZQFA 2C28A 4NY8A 1Z3EB 4NM1A 2KZ3A 1U49A 4MF8A 4JV0A 2DFLA 1ZQRA 1NOMA 5EWGA 3TI0A 3EZ5A 4F5NA 2IBKA 4I28A 3T5KA 1DGSA 3PW4A 1T3NA 4MFAA 8ICZA 1BPYA 2ZH5A 1BPDA 4ECZA 4TQSA 4RT2A 5EWEA 2XCPA 1VJ7A 2C2DA 2W9BB 4O0IA
chains in the Genus database with same CATH superfamily
1L3TA 4C7YA 3N7PD 1SWWA 5AM4A 5DBAA 4AT7B 5D62A 9ICIA 3FAHA 4UAZA 3NVYA 4NKUA 3RJJA 4I2JA 4BX9C 2LYAA 3T5HA 4FHXA 1Q8KA 4USAA 5HNKA 4NXVA 4MFFA 2AGPA 1MIWA 4WCWA 1A77A 2XGPA 2HHUA 1Z19A 3T3FA 4E0DA 4RWOA 5L1JA 4NLZA 4AT9A 3C1YA 4M9JA 2HBKA 2ZUCA 4ATBA 4DLGA 3RH4A 4ECTA 3TQ1A 1KKXA 4TUSA 4O3PA 4UB5A 4I0UA 4WJ3B 4Q45A 3Q8SB 4QJFB 1ZQQA 3SI8A 9ICBA 1HIWA 5KFHA 2KN7A 4K4HA 3T5LA 4OJLA 2F44A 3QEBZ 2BBJA 1ZQWA 1PVQA 2HN1A 1WOTA 2W03A 5J0RA 1UPHA 2ASDA 1XC9A 4FHPA 4GXIA 4O69A 5AI0A 5ALIA 3NASA 5DB8A 2XY6A 4EEKA 5KG2A 2GO7A 4AT7A 4IQVA 4M5DA 2DF4B 7ICMA 4FHVA 2GH1A 3WU2U 2PFPA 5KFIA 4RNMA 5KFBA 4NLCA 3H38A 2WB1F 4P4MA 3GIJA 3BQ2A 2LI6A 3H4DA 3TADA 3LWMA 3BS5A 4F92B 4ED0A 2FJ6A 3G6XA 4CGZA 2CXYA 4UB3A 4BXOA 5J0TA 3LVVA 4NXUA 4ZH4A 4WBZA 1RYRA 4Y2TA 3C5FA 4ZOHC 4GLXA 2PI5A 4C8LA 4IR1A 4RQ5A 4LEVA 5B66U 1ZQNA 8ICRA 4KMUA 5L1KA 2D6FC 9ICHA 1QQ7A 4U6PA 3JPSA 5KFVA 1VFGA 4FHYA 2WTFA 3RJKA 2ASLA 1SL1A 1RM6C 3ETRA 4LJXA 2KMDA 1X2IA 4RNOA 3F2CA 5HRLA 2G08A 2XI9A 4RQ2A 1VLBA 2G09A 5AM5A 4I27A 4DLEA 5KFDA 2W3RA 2H3VA 2KTQA 2R8JA 3MDAA 3IP4B 2F76X 5KT5A 1PX5A 3M9OB 7ICKA 5HC9A 3M9NB 4US8A 2HVIA 3HKZC 5J0UA 4EYIB 5KFLA 4MEYA 1ZQYA 5KG4A 5B5EU 4RQ4A 2FDRA 4CDGA 4GIBA 4UAVA 2WF9A 1N48A 3N4MB 1U45A 1LVHA 4DSLA 5DQIA 4KLDA 4UBCA 4Z6CA 1M6YA 1K1SA 3OHAA 4CF4A 4CE6A 4QZFA 1RXWA 3NRWA 5ALHA 2E5SA 2ZJ8A 1K1QA 3RJFA 7ICJA 5J2EA 2I1QA 2HHPA 2KNJA 2K4IA 3WK6A 5KFRA 1NNLA 1Z00B 4GC6A 2M2VA 4C0ZA 3V7KA 5DQGA 2KP7A 4TUQA 3K75D 4QZHA 4EGWA 5AK5A 4DSKA 1F5AA 5AKGA 7ICUA 3S6JA 3E0FA 4O5EA 1WCLA 4DS4A 4F3OA 3PMLA 4C8KA 1MC8A 4ED8A 3GU3A 3LQCB 2XVTA 4EEYA 4ED6A 4WC4A 2OCEA 1DGJA 2IA6A 4K96A 3UMCA 2DRBA 4IRDA 5CR0A 2EQYA 4RNNA 2NRTA 3PY8A 3Q8PB 5HREA 5KAFU 3OHBA 4KLOA 4NXTA 4YQWA 2ZHBA 3HIYA 4YP3A 1TAMA 1R8AA 4RPZA 2J6TA 4ED3A 2FE9A 4F91B 3AQNA 1JIHA 5TZVA 1QQ6A 2PI4A 2K4HA 2MUTB 3OGUA 5HP4A 2NRKA 1KDHA 5AI8A 3ZD9A 2KZMA 5AKHA 3WFRE 2BBHA 3RB3A 1S76D 4ED2A 4KLGA 2VA2A 4FFDA 2HMXA 1FA0A 5CJ7A 4K4GA 4C4TA 1ZQOA 5ALDA 4J9MA 4O5KA 5AKZA 2KFZA 3SENA 3PX0A 1RG6A 4LZGA 2JH1A 3BZCA 4DS5A 1D8LA 3M1YA 3LVWA 3HW8A 5ALOA 2HHXA 3C2MA 2FCLA 4ELUA 5E79U 3B9JA 2W11A 4ECQA 3RRHA 3TKAA 4J9SA 2OH2A 4Y2YA 1ECWA 4RQ7A 1BNPA 3SEIA 5D61A 1B4FA 5TISU 4I2BA 1PK1B 4KX5A 3MFHA 2LKYA 3H37A 2ZH2A 3C2KA 4P4PA 1XSPA 2V4RA 4K97A 3PW0A 3JPNA 4P4OA 8ICEA 4FBUA 3H8MA 5H2FU 2RRDA 3RB0A 2MUTA 4ECRA 1ZQVA 1WG8A 2F3NA 2B21A 7ICPA 2NO4A 3SV4A 4KM5A 8ICNA 3SV3A 4QZBA 4O3SA 2UVWA 2ZH9A 3RJGA 3K1ZA 1L3SA 2ZIVA 1Z4OA 2YMPA 2W8KA 1ZQBA 2F8LA 1L6NA 5KFFA 1KSPA 3SAHA 1RPLA 5AI9A 3CK6A 3I28A 1L7MA 3PSPA 4BWMA 2ZIUB 2W9CB 1RDFA 4J9KA 5DB6A 5JTGA 4J9NA 3F5AA 3HKZF 3NVZA 5J2HA 1S9FA 4OAGA 3QE9Y 1TK5A 2G06A 5AKKA 4WC3A 4M9GA 2RP5A 2KKPA 5KFKA 3THVA 4KMOB 2JZBB 4F71A 3AL0B 1IXRA 5ALWA 2VJ4A 1L7NA 1QH9A 4QIWC 2O6KA 3C5GA 3MR5A 4DOCA 5J2DA 4QZ8A 1T94A 2QARB 5KG1A 4QWCA 1N63A 3CP8A 2UVVA 2QB0A 2XO7A 3V6KA 1P7DA 1Q3VA 2XICA 1WUDA 4IR9A 4WC6A 2Y9UA 8ICMA 3IHQB 3H3AA 2HCFA 3MFIA 1H38A 4C7ZA 5ALUA 3WFOA 5CHEA 5DBCA 4Y2XA 3QU4A 4G3IA 3IDWA 4ECWA 7ICEA 4X5VA 1NK5A 4QZGA 8ICJA 2ZIUA 5DLGA 1JXEA 3JPRA 4O9MA 4J03A 2EAOA 1UHUA 2HHVA 2P35A 2ZXHA 1Z3EB 2KZ3A 2DFLA 1NOMA 3HRDD 3TI0A 5ALLA 4F5NA 4I28A 1DGSA 2LM4A 5ALVA 1VJ7A 2W9BB 5DLFA 3BS7A 4PZOA 1ZQAA 3ORYA 3AEVA 3EWAA 4X4OA 2RDJA 3BQ7A 4MEXA 1ZQEA 5HMMA 1KBUA 4AP9A 4MF2A 3RRGA 4F4XA 4LEZA 3TFRA 1OW5A 9ICCA 2WB1C 2IUBA 2JMGA 3TAQA 2BQRA 3ZDBA 3WK8A 3O0FA 2E1FA 4JV2A 5KFCA 2UVRA 3QXGA 5HMLA 4DFDA 3TANA 5BOMA 4ELTA 5FP0A 4KITB 3FM9A 4E80A 1Q3UA 3NWIA 2I9GA 3JYYA 2P6UA 5DECA 5DDMA 2H5XA 2ZXIA 1UT8A 2KSOA 4I2FA 3AN1A 2BGWA 3H39A 4M04A 7ICGA 2KG5A 3PV8A 1V9PA 4IRKA 1V38A 3JPPA 4LEWA 4O68A 2KV2A 3UMBA 3PX6A 4X4RA 1QSLA 1JALA 1TAUA 3EYZA 3K1RB 3GV5B 1NJZA 1QSYA 2K4EA 4DSIA 2DR9A 2DGZA 1JROA 4QZDA 4Q8FA 4F93B 4Y2JA 4EX7A 2E8NA 1SL0A 4O3OA 5HRGA 4I2IA 4QWDA 5KT7A 4ECVA 3SZ2A 1NK0A 4P2HA 2YQEA 3UQ2A 2ZIXA 3QYPA 3UMGA 5CWRA 4NL9C 5F9NA 4AT9B 5KFNA 1Q46A 4X4NA 3C2LA 4ATBB 1T3QA 5DG7A 2E8PA 3L9DA 4I29A 1SZHA 2W7PA 3C21A 3MGIA 3EW9A 3UXPA 5J8YA 4DL6A 2ZH4A 2FLPA 2EWRA 4K99A 1HEKA 4DOAA 1MIYA 2DR8A 5IIKA 4PGXA 3KHLA 5KFTA 2HI0A 4S3NA 1ZQGA 3RR7A 4UD4A 4YR0A 2IOFK 4N7RA 4LEYA 2DBYA 3IG5A 1ZJMA 2PXIA 3GILA 2BE3A 1ZQPA 1SZPA 1LB2B 3QEAZ 5AIBA 1ZETA 4KN7A 2ZUBA 1WWVA 2Q0ZX 5KG5A 4RWPA 3GQCA 3MCRA 2IOFA 3BS5B 1NI3A 4F4ZA 2FMSA 3VCBA 2H3QA 4FHWA 3AQEA 3D2NA 4BXOB 1SKWA 4FO6A 2XGQA 3LYSA 5KFUA 3OVAA 3M7DA 4HX0A 4DWIA 2F1JA 4NV0A 2OM6A 3ICXA 2BHNA 4WC7A 4BUGA 4F5QA 1NZBA 5HR7A 1PUZA 1NO5A 7ICQA 4O6AA 1XWLA 2BR0A 1KNYA 5KT4A 1NK7A 8ICVA 2WFAA 4EEBA 1JUDA 2NRZA 2ZTEA 1YZ6A 7ICHA 1L7OA 2DL0A 1T7PA 5CP2A 4O3NA 5EOZA 3SD7A 4US9A 9ICMA 3KKAC 1JN3A 5J2JA 2AJQA 4DF4A 1KQQA 5DQHA 3N7RC 4KN4A 5D46A 2JRZA 4DQQA 4YXJA 1C20A 4UD5A 1BVSA 4XRHA 1V4AA 5L9XA 4X0BA 2EDUA 4R64A 4IC9A 4E8FA 4KLUA 4YG2A 2DUYA 3M9MB 4JWNA 2NRWA 5KG7A 8ICOA 3B0YA 3BDPA 3ETLA 5D49A 2KJ8A 1X9MA 2F77X 4M2YA 4R65A 2BDPA 3E2EA 3ISBA 5KFOA 1UA0A 1ZQLA 5AM3A 4P0PA 1N56A 2HOQA 1ZQMA 4WBYA 4O3RA 5A0LA 3BQTA 2JHDA 2KE7A 2EZZA 3ALRA 2BCQA 5AK3A 3AQMA 1ZQKA 4Y2UA 5ALYA 4UBBA 4ECYA 3QUQA 4RUCA 4YD1A 5KFEA 5ALMA 4OAFA 4DCCA 3OPXA 1S10A 5KT6A 1KW4A 1CRXA 1Z4NA 5F2VO 4DQIA 2IOHA 5AKXA 5AM0A 3MGHA 1ZQUA 3RTVA 3H8WA 3MR3A 3RJHA 5HRDA 4DFMA 2BPGA 5ALXA 4CRXA 4UB6U 2ALZA 1S0MA 1BNOA 1SL2A 4ED1A 1SV0A 5KL1B 5KFZA 4GXKA 3AQLA 1XO0A 3TACB 4ED7A 4F72A 4I2EA 3OWGA 1PK3A 2UVUA 1N5WA 3KHHA 4I2CA 1F5SA 3SAFA 2M2TA 2IHMA 4UQGA 2ZHAA 3D2QA 1AROP 2AH5A 2MU2A 1Z1VA 1N5XA 4B9TA 2B4VA 2NO5A 2KICA 3NVWA 3PMNA 4C4SA 2BPFA 1SKRA 2JGAA 4NKTA 2K8CB 4K98A 5EE1A 2B0CA 4WC1A 2HSZA 2JH7A 4DEZA 5DB7A 5KFSA 4M9LA 1YZ7A 2HBJA 3SMVA 5L1LA 1D9DA 3OV7A 5ALEA 2PFNA 1FIQA 2R8GA 2AU0A 3KTQA 5KFGA 3I76A 4QZ9A 3N28A 5J2IA 1L8LA 8ICBA 4EBKA 4RWQA 3H0RB 2RFFA 1R8BA 5AKEA 1NK9A 2N1RA 2W9MA 4R8UA 4Y2PA 2ISPA 4UB1A 2MAXA 3RB6A 1KFDA 4NLNA 3JCFA 4EBDA 3GFKB 4JMUA 2GWSA 8ICUA 4PL2A 8ICYA 4IRCA 3EF2A 4B6JA 1YT3A 3H8SA 1IM4A 3UXNA 1DRGA 3UPSA 4M9NA 2FPKA 1JXLA 4KX3A 1O08A 5KG6A 4EBCA 2ZIVB 5CRXA 5D4BA 1EXNA 5IINA 4PHEA 1ZD3A 4DL4A 9ICNA 3QU9A 4OAHA 2AGOA 1KTQA 3PSIA 1S8OA 5F9LA 3L5KA 2B56A 4KLFA 1JMSA 2C28A 2R18A 4NY8A 4NM1A 4P0QA 3D2SA 2ODGA 3GZFA 1T3NA 1BPYA 1BPDA 1SXEA 5CFSA 2XCPA 5AHXA 3NUQA 2J6UA 4KLTA 3JPOA 3D6JA 4RQ8A 3UM9A 4EX6A 5L1MA 2HHTA 1NK6A 4QZCA 1BPEA 2I6XA 4X4VA 1ZQZA 1XNSA 3CRXA 2YMQA 3RF9A 5K4LA 2PMZF 3IRUA 3WKAA 5CB1A 1F0MA 2BDUA 4XJEA 1ZYQA 1FFVA 4EV6A 3Q8LA 4UB2A 2Y9TA 5J29A 4J9OA 4UB8U 4PHAA 2YMLA 5IILA 4M6WA 1DOQA 1Y88A 3NS1A 9ICSA 1OU5A 3NYBA 2QB0B 4FZMA 4EZ6A 3GIKA 4DL3A 3JZ0A 2CN1A 4Q8EA 5IIOA 3LDAA 1TAQA 3TADC 4A8EA 4I2AA 1ZQIA 3GIIA 2KK0A 5J0YA 1NKBA 4NXXA 5HRFA 2O5AA 5ALNA 4QWEA 1ZQDA 2RLTA 3H0MB 4F5OA 3PO4A 4WQLA 1ZJNA 3C23A 5B3QA 3ZDAA 1C7YA 1QLNA 2ISOA 4XUSA 4Y2RA 4O67A 3C29A 2XY7A 4RQ3A 3RAXA 4I2GA 5KFQA 8ICPA 1MQ2A 4EBEA 2WF6A 2W3SA 4QWBA 3RR8A 4M0AA 5DKWA 8ICAA 2WAQF 3QU2A 1UETA 2WF8A 1NJWA 5HHIA 2Q66A 3HJEA 5KFWA 3TAPA 2E8MA 5HR9A 4NLGA 1MIVA 4PZNA 3V7LA 3Q8KA 4Z6FA 5DEDA 1A6SA 1LV5A 1X9WA 4DO9A 2YB4A 3RBDA 1PVPA 2W54A 2E1EA 2JR5A 3FC4A 4Y2SA 5JU5A 2KFNA 1L3VA 1OUQA 5HRHA 1TKDA 1FO4A 3OVBA 2ZH3A 2JEIA 1L5UA 3T79A 5HR6A 9ICRA 4WC0A 3EPGA 1U48A 2Z7JA 4DL5A 2G5HB 3ZD8A 3CNHA 2XC9A 5KFYA 2F1HA 1X6JA 4X4PA 3BQ1A 4WQKA 5ALKA 4YFKA 2IHNA 3KKAA 3GDXA 1IIPA 5ALJA 2KSOB 2EZYA 1S97A 5KAIU 4DFJA 3RJIA 2XCAA 3H8JA 2V4QA 5JRTA 1ZXIA 2E3TA 2FI1A 4HYKA 3NVVA 2KJ5A 3WK4A 2L5YA 1NJYA 2F8KA 2IMWP 2ZJAA 2KIVA 4Z6DA 2I5HA 3AQFA 1SIJA 3IV6A 1HUOA 2DPJA 4YVZA 2P66A 9ICAA 3H40A 4Q43A 3QZ8A 1OXJA 1ED1A 1DK3A 3KZXA 4E7XA 5J0OA 5ALSA 2ZIXB 1DXSA 4RUAA 1SKSA 4EELA 2YTUA 3OSNA 1ZD4A 2NYVA 1CUKA 4X4QA 1X6IA 2VKQA 3UQ0A 2R8IA 3F5EA 4FZLA 4C80A 2VJ5A 2Y0SF 4JLZA 4B9VA 3M8SA 2C2EA 1MA7A 1MSWD 4XA5A 1Q79A 4FH5A 4ECUA 2G5IB 4EZ9A 2HHWA 2VANA 1IV8A 3AQKA 1ZOLA 1N2XA 2M2WA 3KZIU 1QTMA 1UA1A 2QLTA 1Q78A 5CFTA 5J2FA 4CNQA 3ED5A 1SV4A 2KZZA 3I1YA 2PKEA 3QNMA 2DR7A 3WKEA 2ZIWB 4RQ0A 5D63A 1ZRNA 1BPZA 1S0VA 3OJSA 5KG3A 2C2RA 2PFOA 4Y2QA 1HJPA 4KLJA 8ICKA 4QW9A 2HVHA 3QUCA 4NLKA 3PX4A 2KIWA 1D9FA 2AQ4A 5CEHA 2G0AA 5J2CA 1D8YA 1TVAA 2PFQA 4M47A 3K7DA 2HHSA 4F4WA 5AKIA 4IG8A 4AT8A 5KL8B 5EWFA 2BCVA 3OSPA 2EANA 2ZG6A 3G6YA 4F4YA 1UEVA 2LYBA 2P6RA 4M9HA 4NM2A 2KKVA 3B0XA 4RWNA 2LYHA 1BPXA 4O5CA 3NGDA 4AYBC 1O03A 4TURA 2ID1A 1V85A 3AU6A 3RH6A 5HRKA 4K9AA 2ZH8A 3Q8MA 7ICNA 8ICFA 5J2AA 4BJQA 7ICIA 3V6JA 3M6ZA 2ZIWA 2K60A 7ICTA 4KLMA 3NTUA 3J81j 1L8OA 4YMNA 4YN4A 2GAFD 4XQ8A 4UARA 3KFUF 1RQNA 3WK9A 3T5JA 4NXZA 2VA8A 2KOBA 5ALFA 1UQVA 5J0QA 4OCZA 2Q4TA 4WC5A 1COOA 1L3UA 1KFTA 1U47A 4X4TA 8ICTA 2AHOB 2V9WA 5KFAA 2AGQA 3RAQA 1ZD2P 2A19A 9ICEA 3OJUA 2W43A 3AM9A 1X66A 4KLLA 2GLEA 2VA3A 9ICWA 4YMMA 2R8KA 1QSSA 7ICLA 3PNCA 2W04A 5KT3A 5AK4A 4RZRA 5BPCA 2ZH1A 4BDPA 2MA1A 4QZAA 3HILA 8ICCA 4F5RA 4KTQA 2D3DA 4P0PB 4LVSA 9ICJA 2M9NA 2HHQA 4PL1A 5KG0A 2DKXA 4ACOA 2W7OA 4C4RA 4C8MA 2DR5A 3L4PA 5ALTA 4C8OA 2A3VA 4OJOA 3TFSA 4PGQA 4Y2VA 3PSFA 4DFKA 2C22A 4J9PA 1T4GA 1ZQSA 4TUPA 3IN5A 1TV9A 3ER8C 2XIDA 3TARA 2BZFA 3DV9A 3Q8RB 2HOFA 5L1IA 2K8AA 3WK5A 4EEDA 5ALZA 7ICSA 4PJ0U 5ALRA 1JRPA 1CEZA 2C2DA 2W8LA 5ALGA 2H3FA 2F1IA 3JPTA 4O3QA 3SAGA 1WYGA 1YLQA 5IIIA 4GFJA 3HX0A 2PMZC 3E58A 4OJPA 4LZDA 2KEYA 2A1AA 2OEHA 4IQTA 3WFQE 1Z1BA 2EAMA 5HRIA 5KNIA 2ATLA 4U7CA 3PR4A 4DQPA 2WF5A 2RDIA 2ASJA 4WH5A 4Z6EA 5J0PA 2BKEA 4YMOA 5JTIA 2RQ5A 4JUZA 2FLLA 2PBEA 4RU9A 4KLQA 2HW3A 2ES6A 1F44A 1U4BA 1BPBA 4IQUA 4PPXA 2DPIA 3MDCA 4UASA 2EH9A 8ICWA 5EE9A 2KHQA 1ZQFA 3PSTA 4UAUA 3WKDA 4MF8A 4JV0A 1ZQRA 3CW2C 3DEEA 3EZ5A 3PW4A 2ZH5A 4ECZA 5EWEA 4O0IA 2LBOA 1RZTA 1R89A 4IQWA 4KB6A 4OJ6A 8ICQA 4RPYA 1N62A 3PO5A 2KVCA 2BQUA 5AM2A 2M2UA 4DSFA 1NZPA 3WKBA 3KBBA 1B22A 4R8UB 3MR2A 2W9AA 2JEJA 4RQ6A 2WAQC 8ICLA 3OUYB 5BOLA 3K4GA 4WC2A 3A0HU 3BJYA 1U9LA 4DQSA 3PW7A 1GO3F 4AYBF 2J6SA 2E8OA 1RXVA 3QUBA 2YY6A 9ICQA 3NVOA 1JAJA 1J2NA 1JI7A 2KJ9A 3ZDCA 3IM1A 3BQ0A 2DVIA 3WFSC 2HBMA 1TFRA 3MGVA 1RYSA 4FE3A 3PW2A 2ZJ5A 5DBBA 3C66A 1XO1A 3MR6A 2O1PA 4YR3A 3AMZA 4FS1A 2OWOA 4J9QA 2FLNA 4OAIZ 4JB3A 4QWAA 1ZQCA 9ICUA 5J8YC 5AM1A 4UB4A 4P0QB 3ZDDA 2QKQA 9ICGA 3KOOA 1ZQHA 3LWLA 9ICVA 1KFSA 4O3MA 3OTQA 4DFPA 3HWTA 5G5HA 3QX7A 3Q8QB 2W55A 2HN2A 4PHDA 1KL9A 3F53A 3OUYA 1RYUA 5EE0A 4CF3A 3UXOA 5AI5A 4FO1A 1K5OA 4M6WB 4DOBA 1J2MA 8ICXA 5T14A 3ISCA 4UATA 1SB3C 4C8NA 1S77D 1PVRA 4QZEA 2FMQA 4J9LA 3RFAA 1NKEA 4NXWA 3WK7A 5HHHA 1TK0A 4KLHA 4Q44A 1CI4A 3OVSA 2K89A 1UT5A 4YCXA 1QQ5A 1NJXA 4I2DA 3ERCC 1PZNA 3G6VA 5CA7A 3NRZA 1Z00A 4TQRA 2Y0SC 2EZXA 4DL2A 3RBEA 1AQ6A 3N7SC 1N61A 4J9RA 3M6KA 2LHTA 4JV1A 2AXTU 5EE3A 8ICGA 3QUTA 4KLIA 2JV3A 2CPRA 3V6HA 4DSEA 7ICVA 5KFJA 4EYHB 5DGAA 1QCKA 2ZUDA 5J2BA 2KVSA 3ZDEA 4R63A 3KHGA 3MBYA 1SXDA 3KHRA 1FFUA 3HP6A 3C18A 4DSJA 8ICIA 3ZI4A 2DRAA 4F50A 4NL9A 4BWJA 2M0NA 3FDSA 1ZQXA 5CFUA 2YB1A 4QNLA 1JQRA 4FBTA 2RHFA 2OYYA 1TFYA 3IG8A 4IL6U 3SQIA 4EENA 3RJEA 1SGGA 3R9KA 5GTHU 1ZQJA 9ICKA 1LKYB 4XQ7A 2WF7A 5F3XB 5AI6A 3PHZA 3U26A 3V72A 5DG8A 3UPQA 3GV8B 4NWIA 8ICHA 7ICOA 3VC8A 4HAIA 3RB4A 1TFWA 3HJ4A 4UAYA 3GIMA 2OHFA 3C28A 4OO1J 3ISDA 5AKJA 4PH5A 4B9SA 1B0XA 2YX8A 3SR6A 2R8HA 3L3FX 1X40A 4F8RA 1UCVA 1TE2A 3M8RA 2AQ0A 4DF8A 1X42A 4F2SA 2BQ3A 2OXOA 1URJA 3EUB2 4FZNA 1BGXT 2QB1A 1ZD5A 4IS7A 2HBLA 2HOIA 7ICFA 4B9LA 4BGDA 3RH5A 5AICA 2WHEA 3DDHA 1X9SA 3ONNA 2FMPA 4CF5A 3QU5A 4B9NA 3ER9B 4ECSA 3PW5A 2K8BB 2KD1A 5JUMA 4OJ5A 1HUZA 5KFMA 1PK1A 2A1JB 3HT3A 5C0YA 9ICXA 1LKYA 2BPCA 2LMRA 4B9MA 1WCNA 2NRXA 4RQNA 3FYHA 5J0XA 1IG6A 5DG9A 5CHGA 1MQ3A 1SWVA 2F2AB 5C5JA 2LM1A 4X0AA 5IIJA 2Y1IA 1R8CA 4R66A 5DDYA 5AK6A 4GXJA 3PR5B 5B3PA 1XU4A 1S5LU 3AU2A 3V7JA 1SV0C 4I2HA 1ZQTA 4G9BA 3WKCA 4F2RA 2H3ZA 5J0WA 4RPXA 1ZRMA 2G07A 7ICRA 2W9CA 1JX4A 2Y1JA 2DQNB 3F2BA 1DK2A 4ICAA 3GV7B 4ECXA 5G5GA 3AUOA 5ALPA 5KT2A 2BCUA 1MN8A 4MHVA 5AIAA 2JZBA 1XSNA 4UW9A 3SYZA 1GPJA 4K4IA 2DKZA 4WOYA 4RQMA 4YD2A 3KD3A 2A1JA 2ESEA 1KLNA 2HDOA 1TK8A 3H7IA 1N60A 2JEFA 1A76A 2QARA 4EBJA 4OD0A 1X9XA 4RT3A 4X4UA 4F5PA 4DQRA 3BZKA 5IIMA 4AT8B 2BCRA 3F2DA 4JLXA 2ZTCA 4NLBA 9ICTA 1KEJA 2FPLA 1NK8A 4KLEA 5J0SA 3PVXA 2YMMA 9ICLA 2GA9D 2K4PA 4K8VA 2ZTDA 4X4SA 4YR2A 4QZIA 9ICPA 1FEZA 3EPIA 1XS9D 9ICOA 2YN4A 1L7PA 4GC7A 4F4KA 1XSLA 3NKUA 1VJ5A 5KTQA 4FS2A 1WWUA 1UEUA 4B9UA 3LK9A 2NRVA 2MSNA 4PGYA 3N97B 4UAWA 2W9BA 3QZ7A 1S0OA 2XY5A 1KRPA 4JWMA 2ZH6A 3HJ1A 2JEGA 4LT6A 2KHVA 2LPEA 3QU7A 2NV3A 5KFPA 1COKA 3H0LB 4KLSA 1J97A 5GTIU 2VIXA 3H4BA 2MRLA 1A0PA 1S0NA 2B51A 5HRBA 1T8EA 2FPMA 3C1ZA 4FH3A 3MABA 4DL7A 1RQLA 9ICFA 5DGBA 4CCHA 2BCSA 4QW8A 3PZPA 2D8CA 5J2GA 5J2KA 5AKLA 3HPOA 8ICSA 3MC1A 5DB9A 1NK4A 1V97A 2DWQA 4RQ1A 4YXMA 3JPQA 1D8BA 4EP7A 3WFPA 5ALQA 4ELVA 2IHOA 1VDVA 2H3IA 4JK1A 5KFXA 2ZH7A 1NKCA 4MFCA 1ZQ1C 2GOLA 1KN5A 5AI4A 1B43A 4PHPA 4K9BA 2CRXA 4NJ8A 1U49A 4MKPA 5EWGA 3A0BU 2IBKA 5AKYA 3T5KA 2EAPA 3CYMA 4MFAA 2B6GA 8ICZA 4QIWF 4TQSA 4RT2A 2JXJA
chains in the Genus database with same CATH topology
1L3TA 5DLFA 2J6UA 1ZQAA 4RQ8A 3JPOA 1RZTA 3ORYA 4KLTA 2HHTA 1R89A 5DBAA 4IQWA 3EWAA 4AT7B 4X4OA 1NK6A 8ICQA 2RDJA 4RPYA 4QZCA 1BPEA 4MEXA 4UAZA 9ICIA 1ZQZA 4X4VA 3PO5A 1ZQEA 4NKUA 5HMMA 4MF2A 2BQUA 5CB1A 2M2UA 4DSFA 1ZYQA 3Q8LA 4UB2A 3RJJA 4I2JA 5J29A 3RRGA 4J9OA 1B22A 4R8UB 3MR2A 2W9AA 4PHAA 3T5HA 4RQ6A 5IILA 2JEJA 4M6WA 4FHXA 1DOQA 5HNKA 4F4XA 8ICLA 5BOLA 1Y88A 2AGPA 4MFFA 3K4GA 1MIWA 3OUYB 3TFRA 4WCWA 1A77A 9ICSA 1OU5A 2XGPA 9ICCA 3NYBA 3BJYA 2HHUA 1U9LA 4EZ6A 4DQSA 3PW7A 3GIKA 4DL3A 3JZ0A 3T3FA 2J6SA 4Q8EA 3TAQA 5IIOA 1RXVA 4E0DA 3LDAA 5L1JA 4NLZA 2BQRA 4RWOA 4AT9A 1TAQA 3ZDBA 3C1YA 4M9JA 2ZUCA 1ZQIA 4I2AA 9ICQA 4DLGA 3GIIA 1JAJA 4ATBA 3RH4A 3ZDCA 3IM1A 5J0YA 3BQ0A 4ECTA 3TQ1A 1NKBA 4JV2A 5KFCA 4TUSA 2UVRA 4O3PA 4UB5A 5HRFA 4Q45A 5HMLA 3Q8SB 3TANA 2O5AA 5BOMA 4ELTA 1TFRA 1ZQQA 4KITB 3SI8A 9ICBA 4QWEA 5KFHA 1RYSA 2KN7A 3PW2A 3T5LA 4K4HA 1ZQDA 2ZJ5A 4E80A 5DBBA 3C66A 1XO1A 3MR6A 2I9GA 3JYYA 2O1PA 3QEBZ 4YR3A 2P6UA 1ZQWA 4F5OA 3PO4A 1WOTA 5DECA 5DDMA 3C23A 5J0RA 4FS1A 1ZJNA 2OWOA 4J9QA 2H5XA 2ASDA 1XC9A 1UT8A 2FLNA 4I2FA 4FHPA 3ZDAA 4QWAA 2BGWA 3H39A 4GXIA 1ZQCA 1C7YA 1QLNA 2ISOA 9ICUA 4XUSA 4M04A 5DB8A 4UB4A 2XY7A 2XY6A 3ZDDA 7ICGA 4RQ3A 9ICGA 3RAXA 3PV8A 1V9PA 5KG2A 1ZQHA 3LWLA 4I2GA 4IRKA 3JPPA 5KFQA 8ICPA 9ICVA 4IQVA 1MQ2A 4EBEA 4M5DA 4AT7A 4QWBA 1KFSA 3RR8A 7ICMA 3PX6A 4FHVA 4M0AA 5DKWA 8ICAA 1UETA 2PFPA 5KFIA 4RNMA 3HWTA 4DFPA 1NJWA 4X4RA 1QSLA 3Q8QB 5KFBA 5HHIA 1TAUA 3EYZA 3H38A 3GV5B 4PHDA 1NJZA 2Q66A 4P4MA 3GIJA 1QSYA 5KFWA 3BQ2A 4DSIA 3TAPA 3OUYA 2DR9A 3H4DA 5HR9A 3UXOA 4QZDA 3LWMA 4NLGA 4F93B 4Q8FA 1MIVA 4M6WB 4DOBA 4F92B 4ED0A 1SL0A 3G6XA 4O3OA 5HRGA 4I2IA 3V7LA 4QWDA 4Z6FA 4UB3A 3Q8KA 8ICXA 5KT7A 5DEDA 4ECVA 5J0TA 3SZ2A 1NK0A 1LV5A 4BXOA 1X9WA 3ISCA 3UQ2A 4P2HA 4DO9A 4C8NA 3RBDA 1S77D 4ZH4A 4WBZA 5CWRA 1RYRA 5F9NA 2ZH2A 2KFNA 4QZEA 2FMQA 3C5FA 4AT9B 5KFNA 4J9LA 1L3VA 4GLXA 4X4NA 2PI5A 3C2LA 4C8LA 5HRHA 1TKDA 5DG7A 1NKEA 4ATBB 3OVBA 3L9DA 2ZH3A 2JEIA 5HHHA 1TK0A 4IR1A 4KLHA 4RQ5A 1L5UA 4I29A 4Q44A 3OVSA 9ICRA 3C21A 3MGIA 1ZQNA 4WC0A 1UT5A 4YCXA 3EW9A 8ICRA 4KMUA 5L1KA 1NJXA 4I2DA 9ICHA 3EPGA 1U48A 3JPSA 3UXPA 1PZNA 5KFVA 1VFGA 4DL5A 3G6VA 3ZD8A 4FHYA 2WTFA 4DL6A 5CA7A 3RJKA 2XC9A 1Z00A 5KFYA 2F1HA 4TQRA 2ASLA 2FLPA 2ZH4A 4X4PA 4DL2A 3BQ1A 4DOAA 3RBEA 1SL1A 1MIYA 2DR8A 4YFKA 2IHNA 5IIKA 3GDXA 4J9RA 4PGXA 1X2IA 4RNOA 1S97A 3KHLA 4JV1A 4DFJA 3RJIA 5KFTA 5HRLA 2XCAA 4S3NA 4RQ2A 1ZQGA 8ICGA 3RR7A 4KLIA 3H8JA 4UD4A 2V4QA 3V6HA 4I27A 4YR0A 4DSEA 4DLEA 5KFJA 5KFDA 7ICVA 4EYHB 5DGAA 4HYKA 2ZUDA 2KTQA 2R8JA 1ZJMA 5J2BA 2PXIA 3MDAA 1NJYA 3GILA 2BE3A 1ZQPA 3ZDEA 4R63A 2IMWP 2ZJAA 3KHGA 4Z6DA 5KT5A 3MBYA 1PX5A 3KHRA 1SZPA 3HP6A 3M9OB 7ICKA 2DPJA 1HUOA 3C18A 1LB2B 3QEAZ 4DSJA 5HC9A 8ICIA 3M9NB 1ZETA 4KN7A 4YVZA 2DRAA 4F50A 2P66A 9ICAA 4BWJA 2HVIA 2ZUBA 5J0UA 2Q0ZX 3FDSA 1ZQXA 3H40A 5KG5A 4Q43A 4EYIB 1JQRA 4RWPA 3GQCA 4FBTA 5KFLA 4MEYA 3QZ8A 1TFYA 4F4ZA 1ZQYA 2FMSA 3RJEA 4FHWA 4E7XA 4BXOB 5J0OA 5KG4A 1SKWA 4RQ4A 4FO6A 2XGQA 1ZQJA 9ICKA 5KFUA 3OVAA 4RUAA 1SKSA 4DWIA 2F1JA 4XQ7A 1N48A 3N4MB 3OSNA 1U45A 4DSLA 4KLDA 5DQIA 2BHNA 4WC7A 1CUKA 4UBCA 5DG8A 3V72A 4F5QA 4X4QA 4Z6CA 3UPQA 3GV8B 1K1SA 3UQ0A 8ICHA 3OHAA 2R8IA 1NO5A 4QZFA 7ICOA 1RXWA 7ICQA 4B9VA 3RB4A 3M8SA 1TFWA 1XWLA 2ZJ8A 3HJ4A 1K1QA 2BR0A 3RJFA 5KT4A 4UAYA 3GIMA 1NK7A 7ICJA 5J2EA 2C2EA 8ICVA 2I1QA 1MSWD 2HHPA 4XA5A 1Q79A 4FH5A 4ECUA 3ISDA 2NRZA 4PH5A 4B9SA 5KFRA 2ZTEA 4EZ9A 2HHWA 2VANA 2R8HA 1Z00B 4GC6A 2M2VA 3V7KA 3AQKA 5DQGA 7ICHA 4F8RA 4TUQA 3K75D 4QZHA 2M2WA 4DSKA 1QTMA 3M8RA 1UA1A 1T7PA 2AQ0A 4DF8A 5CP2A 1F5AA 7ICUA 4O3NA 5EOZA 4F2SA 1Q78A 5J2FA 4O5EA 2BQ3A 1WCLA 4DS4A 4F3OA 1BGXT 2KZZA 9ICMA 3PMLA 4WC2A 4C8KA 2DR7A 1MC8A 4ED8A 7ICFA 4RQ0A 4B9LA 1JN3A 3LQCB 1BPZA 4EEYA 5J2JA 2AJQA 1S0VA 4DF4A 3OJSA 5KG3A 4BGDA 5DQHA 3RH5A 4ED6A 4KN4A 5D46A 2C2RA 2PFOA 4WC4A 1HJPA 1X9SA 4KLJA 4DQQA 2IA6A 4YXJA 8ICKA 2DRBA 4QW9A 2FMPA 4IRDA 2HVHA 4UD5A 4B9NA 5CR0A 4ECSA 4RNNA 4NLKA 3PW5A 1BVSA 2NRTA 3PX4A 3WFSC 5JUMA 1D9FA 3PY8A 4XRHA 3Q8PB 2AQ4A 1HUZA 5HREA 5KFMA 1V4AA 3OHBA 5L9XA 4X0BA 2A1JB 4KLOA 3HT3A 4R64A 9ICXA 4YQWA 2ZHBA 5J2CA 2BPCA 1D8YA 3HIYA 1TVAA 4E8FA 2PFQA 4B9MA 1WCNA 4KLUA 4YG2A 3M9MB 4M47A 2NRXA 4JWNA 3FYHA 5J0XA 4YP3A 5DG9A 2NRWA 5CHGA 1MQ3A 1R8AA 4RPZA 2J6TA 2HHSA 5C5JA 4F4WA 5KG7A 4ED3A 8ICOA 3B0YA 4IG8A 4AT8A 4F91B 3BDPA 3ETLA 5D49A 5EWFA 1X9MA 2BCVA 3AQNA 5IIJA 3OSPA 4M2YA 4X0AA 2Y1IA 1JIHA 4R65A 4R66A 3G6YA 4F4YA 5DDYA 2BDPA 3E2EA 5TZVA 1R8CA 1UEVA 3ISBA 2P6RA 4GXJA 2PI4A 2MUTB 4NM2A 5KFOA 3PR5B 4M9HA 1XU4A 3OGUA 1UA0A 5HP4A 2NRKA 1ZQLA 1KDHA 3AU2A 3V7JA 3B0XA 4RWNA 2LYHA 1BPXA 4I2HA 1N56A 4O5CA 3ZD9A 3NGDA 2KZMA 1ZQTA 3WFRE 3RB3A 1ZQMA 1S76D 4ED2A 4TURA 2ID1A 4F2RA 4KLGA 2VA2A 4WBYA 1FA0A 4O3RA 5CJ7A 3AU6A 5J0WA 3RH6A 4K4GA 3BQTA 5HRKA 4RPXA 1ZQOA 7ICRA 4J9MA 2ZH8A 3Q8MA 4O5KA 7ICNA 8ICFA 2W9CA 1JX4A 5J2AA 2BCQA 2KFZA 3PX0A 7ICIA 3V6JA 3AQMA 1ZQKA 2Y1JA 4LZGA 1KNYA 7ICTA 4KLMA 3NTUA 4DS5A 1D8LA 4UBBA 3HW8A 4ECYA 4YMNA 4YN4A 3GV7B 4ECXA 4XQ8A 4RUCA 4YD1A 5KFEA 2HHXA 3C2MA 3T5JA 3AUOA 1S10A 4ELUA 5KT2A 2BCUA 4NXZA 5KT6A 2VA8A 2JZBA 1XSNA 3SYZA 4ECQA 4DQIA 3RRHA 4J9SA 5F2VO 4K4IA 3MGHA 4YD2A 5J0QA 1ZQUA 2A1JA 3RTVA 3H8WA 4RQ7A 3MR3A 3RJHA 5HRDA 4WC5A 1COOA 1L3UA 1KFTA 1KLNA 4DFMA 4I2BA 1U47A 1TK8A 3MFHA 4X4TA 8ICTA 2BPGA 3H7IA 2V9WA 2JEFA 1A76A 5KFAA 2AGQA 3RAQA 3H37A 3C2KA 4P4PA 1XSPA 9ICEA 2ALZA 1S0MA 3OJUA 4EBJA 2V4RA 4RT3A 1SL2A 4X4UA 4F5PA 4DQRA 3JPNA 3PW0A 4P4OA 4ED1A 5IIMA 8ICEA 4FBUA 5KFZA 4KLLA 4GXKA 4AT8B 3RB0A 2BCRA 2VA3A 9ICWA 3AQLA 2ZTCA 4YMMA 4ED7A 2R8KA 2MUTA 4ECRA 1QSSA 7ICLA 9ICTA 5KT3A 3PNCA 1ZQVA 5BPCA 4RZRA 1KEJA 2FPLA 2ZH1A 2B21A 7ICPA 4BDPA 4I2EA 1NK8A 3SV4A 2UVUA 4QZAA 4KLEA 5J0SA 3KHHA 4I2CA 8ICCA 3PVXA 8ICNA 9ICLA 3SV3A 4F5RA 4QZBA 4O3SA 4KTQA 2M2TA 2UVWA 2ZTDA 2ZH9A 4LVSA 2IHMA 4UQGA 3RJGA 4X4SA 4YR2A 1L3SA 9ICJA 2ZHAA 4QZIA 2M9NA 2HHQA 9ICPA 3EPIA 5KG0A 1AROP 1XS9D 9ICOA 2W8KA 1ZQBA 4GC7A 4F4KA 5KFFA 1XSLA 4B9TA 1KSPA 1RPLA 3PMNA 4C8MA 5KTQA 4FS2A 4BWMA 2BPFA 2DR5A 1SKRA 2W9CB 4NKTA 4J9KA 5DB6A 4C8OA 4J9NA 1UEUA 4B9UA 4WC1A 3TFSA 4DEZA 4PGQA 5J2HA 1S9FA 3LK9A 3QE9Y 4DFKA 2C22A 4J9PA 1T4GA 2NRVA 5DB7A 5KFSA 4TUPA 1TK5A 1ZQSA 4M9LA 4WC3A 4PGYA 5L1LA 1D9DA 4M9GA 1TV9A 2PBEA 3OV7A 3N97B 2PFNA 2R8GA 4UAWA 2W9BA 2AU0A 3QZ7A 1S0OA 2XY5A 3TARA 5KFKA 3THVA 1KRPA 2JZBB 3KTQA 5KFGA 3Q8RB 4JWMA 5L1IA 1IXRA 2ZH6A 4QZ9A 3HJ1A 5J2IA 2JEGA 8ICBA 7ICSA 4LT6A 4EBKA 4RWQA 3C5GA 1CEZA 2RFFA 3MR5A 2W8LA 1R8BA 1NK9A 2F1IA 2W9MA 5KFPA 4DOCA 4R8UA 3JPTA 4O3QA 5J2DA 4QZ8A 4KLSA 2ISPA 1YLQA 4UB1A 2MAXA 3H4BA 5KG1A 3RB6A 1KFDA 4QWCA 5IIIA 2UVVA 3HX0A 1S0NA 4NLNA 2XO7A 4EBDA 3GFKB 5HRBA 4LZDA 3V6KA 2GWSA 1T8EA 2FPMA 3C1ZA 4IR9A 4IQTA 3MABA 4FH3A 2DVIA 3WFQE 4WC6A 4DL7A 8ICMA 9ICFA 8ICUA 2ATLA 5DGBA 4CCHA 3IHQB 8ICYA 5HRIA 3H3AA 3PR4A 3MFIA 4IRCA 2BCSA 4QW8A 4DQPA 2RDIA 5J2GA 2ASJA 5J2KA 3H8SA 1H38A 1IM4A 3HPOA 3UXNA 3UPSA 8ICSA 4Z6EA 5J0PA 2FPKA 4M9NA 1JXLA 2BKEA 5DB9A 1NK4A 4YMOA 3WFOA 5DBCA 5KG6A 4EBCA 4RQ1A 4YXMA 3JPQA 5D4BA 4G3IA 1EXNA 4EP7A 3WFPA 4JUZA 4ECWA 5IINA 2FLLA 4ELVA 4X5VA 4PHEA 1NK5A 4QZGA 4RU9A 7ICEA 8ICJA 4DL4A 4JK1A 5KFXA 5DLGA 4KLQA 9ICNA 1JXEA 3JPRA 2AGOA 1KTQA 1U4BA 1NKCA 2HW3A 4MFCA 2ZH7A 1BPBA 4IQUA 5F9LA 2DPIA 4O9MA 3MDCA 4PPXA 1B43A 4PHPA 4KLFA 2HHVA 1JMSA 8ICWA 1ZQFA 2C28A 4NY8A 1Z3EB 4NM1A 2KZ3A 1U49A 4MF8A 4JV0A 2DFLA 1ZQRA 1NOMA 5EWGA 3TI0A 3EZ5A 4F5NA 2IBKA 4I28A 3T5KA 1DGSA 3PW4A 1T3NA 4MFAA 8ICZA 1BPYA 2ZH5A 1BPDA 4ECZA 4TQSA 4RT2A 5EWEA 2XCPA 1VJ7A 2C2DA 2W9BB 4O0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3T A;  5DLF A;  2J6U A;  1ZQA A;  4RQ8 A;  3JPO A;  1RZT A;  3ORY A;  4KLT A;  2HHT A;  1R89 A;  5DBA A;  4IQW A;  3EWA A;  4AT7 B;  4X4O A;  1NK6 A;  8ICQ A;  2RDJ A;  4RPY A;  4QZC A;  1BPE A;  4MEX A;  4UAZ A;  9ICI A;  1ZQZ A;  4X4V A;  3PO5 A;  1ZQE A;  4NKU A;  5HMM A;  4MF2 A;  2BQU A;  5CB1 A;  2M2U A;  4DSF A;  1ZYQ A;  3Q8L A;  4UB2 A;  3RJJ A;  4I2J A;  5J29 A;  3RRG A;  4J9O A;  1B22 A;  4R8U B;  3MR2 A;  2W9A A;  4PHA A;  3T5H A;  4RQ6 A;  5IIL A;  2JEJ A;  4M6W A;  4FHX A;  1DOQ A;  5HNK A;  4F4X A;  8ICL A;  5BOL A;  1Y88 A;  2AGP A;  4MFF A;  3K4G A;  1MIW A;  3OUY B;  3TFR A;  4WCW A;  1A77 A;  9ICS A;  1OU5 A;  2XGP A;  9ICC A;  3NYB A;  3BJY A;  2HHU A;  1U9L A;  4EZ6 A;  4DQS A;  3PW7 A;  3GIK A;  4DL3 A;  3JZ0 A;  3T3F A;  2J6S A;  4Q8E A;  3TAQ A;  5IIO A;  1RXV A;  4E0D A;  3LDA A;  5L1J A;  4NLZ A;  2BQR A;  4RWO A;  4AT9 A;  1TAQ A;  3ZDB A;  3C1Y A;  4M9J A;  2ZUC A;  1ZQI A;  4I2A A;  9ICQ A;  4DLG A;  3GII A;  1JAJ A;  4ATB A;  3RH4 A;  3ZDC A;  3IM1 A;  5J0Y A;  3BQ0 A;  4ECT A;  3TQ1 A;  1NKB A;  4JV2 A;  5KFC A;  4TUS A;  2UVR A;  4O3P A;  4UB5 A;  5HRF A;  4Q45 A;  5HML A;  3Q8S B;  3TAN A;  2O5A A;  5BOM A;  4ELT A;  1TFR A;  1ZQQ A;  4KIT B;  3SI8 A;  9ICB A;  4QWE A;  5KFH A;  1RYS A;  2KN7 A;  3PW2 A;  3T5L A;  4K4H A;  1ZQD A;  2ZJ5 A;  4E80 A;  5DBB A;  3C66 A;  1XO1 A;  3MR6 A;  2I9G A;  3JYY A;  2O1P A;  3QEB Z;  4YR3 A;  2P6U A;  1ZQW A;  4F5O A;  3PO4 A;  1WOT A;  5DEC A;  5DDM A;  3C23 A;  5J0R A;  4FS1 A;  1ZJN A;  2OWO A;  4J9Q A;  2H5X A;  2ASD A;  1XC9 A;  1UT8 A;  2FLN A;  4I2F A;  4FHP A;  3ZDA A;  4QWA A;  2BGW A;  3H39 A;  4GXI A;  1ZQC A;  1C7Y A;  1QLN A;  2ISO A;  9ICU A;  4XUS A;  4M04 A;  5DB8 A;  4UB4 A;  2XY7 A;  2XY6 A;  3ZDD A;  7ICG A;  4RQ3 A;  9ICG A;  3RAX A;  3PV8 A;  1V9P A;  5KG2 A;  1ZQH A;  3LWL A;  4I2G A;  4IRK A;  3JPP A;  5KFQ A;  8ICP A;  9ICV A;  4IQV A;  1MQ2 A;  4EBE A;  4M5D A;  4AT7 A;  4QWB A;  1KFS A;  3RR8 A;  7ICM A;  3PX6 A;  4FHV A;  4M0A A;  5DKW A;  8ICA A;  1UET A;  2PFP A;  5KFI A;  4RNM A;  3HWT A;  4DFP A;  1NJW A;  4X4R A;  1QSL A;  3Q8Q B;  5KFB A;  5HHI A;  1TAU A;  3EYZ A;  3H38 A;  3GV5 B;  4PHD A;  1NJZ A;  2Q66 A;  4P4M A;  3GIJ A;  1QSY A;  5KFW A;  3BQ2 A;  4DSI A;  3TAP A;  3OUY A;  2DR9 A;  3H4D A;  5HR9 A;  3UXO A;  4QZD A;  3LWM A;  4NLG A;  4F93 B;  4Q8F A;  1MIV A;  4M6W B;  4DOB A;  4F92 B;  4ED0 A;  1SL0 A;  3G6X A;  4O3O A;  5HRG A;  4I2I A;  3V7L A;  4QWD A;  4Z6F A;  4UB3 A;  3Q8K A;  8ICX A;  5KT7 A;  5DED A;  4ECV A;  5J0T A;  3SZ2 A;  1NK0 A;  1LV5 A;  4BXO A;  1X9W A;  3ISC A;  3UQ2 A;  4P2H A;  4DO9 A;  4C8N A;  3RBD A;  1S77 D;  4ZH4 A;  4WBZ A;  5CWR A;  1RYR A;  5F9N A;  2ZH2 A;  2KFN A;  4QZE A;  2FMQ A;  3C5F A;  4AT9 B;  5KFN A;  4J9L A;  1L3V A;  4GLX A;  4X4N A;  2PI5 A;  3C2L A;  4C8L A;  5HRH A;  1TKD A;  5DG7 A;  1NKE A;  4ATB B;  3OVB A;  3L9D A;  2ZH3 A;  2JEI A;  5HHH A;  1TK0 A;  4IR1 A;  4KLH A;  4RQ5 A;  1L5U A;  4I29 A;  4Q44 A;  3OVS A;  9ICR A;  3C21 A;  3MGI A;  1ZQN A;  4WC0 A;  1UT5 A;  4YCX A;  3EW9 A;  8ICR A;  4KMU A;  5L1K A;  1NJX A;  4I2D A;  9ICH A;  3EPG A;  1U48 A;  3JPS A;  3UXP A;  1PZN A;  5KFV A;  1VFG A;  4DL5 A;  3G6V A;  3ZD8 A;  4FHY A;  2WTF A;  4DL6 A;  5CA7 A;  3RJK A;  2XC9 A;  1Z00 A;  5KFY A;  2F1H A;  4TQR A;  2ASL A;  2FLP A;  2ZH4 A;  4X4P A;  4DL2 A;  3BQ1 A;  4DOA A;  3RBE A;  1SL1 A;  1MIY A;  2DR8 A;  4YFK A;  2IHN A;  5IIK A;  3GDX A;  4J9R A;  4PGX A;  1X2I A;  4RNO A;  1S97 A;  3KHL A;  4JV1 A;  4DFJ A;  3RJI A;  5KFT A;  5HRL A;  2XCA A;  4S3N A;  4RQ2 A;  1ZQG A;  8ICG A;  3RR7 A;  4KLI A;  3H8J A;  4UD4 A;  2V4Q A;  3V6H A;  4I27 A;  4YR0 A;  4DSE A;  4DLE A;  5KFJ A;  5KFD A;  7ICV A;  4EYH B;  5DGA A;  4HYK A;  2ZUD A;  2KTQ A;  2R8J A;  1ZJM A;  5J2B A;  2PXI A;  3MDA A;  1NJY A;  3GIL A;  2BE3 A;  1ZQP A;  3ZDE A;  4R63 A;  2IMW P;  2ZJA A;  3KHG A;  4Z6D A;  5KT5 A;  3MBY A;  1PX5 A;  3KHR A;  1SZP A;  3HP6 A;  3M9O B;  7ICK A;  2DPJ A;  1HUO A;  3C18 A;  1LB2 B;  3QEA Z;  4DSJ A;  5HC9 A;  8ICI A;  3M9N B;  1ZET A;  4KN7 A;  4YVZ A;  2DRA A;  4F50 A;  2P66 A;  9ICA A;  4BWJ A;  2HVI A;  2ZUB A;  5J0U A;  2Q0Z X;  3FDS A;  1ZQX A;  3H40 A;  5KG5 A;  4Q43 A;  4EYI B;  1JQR A;  4RWP A;  3GQC A;  4FBT A;  5KFL A;  4MEY A;  3QZ8 A;  1TFY A;  4F4Z A;  1ZQY A;  2FMS A;  3RJE A;  4FHW A;  4E7X A;  4BXO B;  5J0O A;  5KG4 A;  1SKW A;  4RQ4 A;  4FO6 A;  2XGQ A;  1ZQJ A;  9ICK A;  5KFU A;  3OVA A;  4RUA A;  1SKS A;  4DWI A;  2F1J A;  4XQ7 A;  1N48 A;  3N4M B;  3OSN A;  1U45 A;  4DSL A;  4KLD A;  5DQI A;  2BHN A;  4WC7 A;  1CUK A;  4UBC A;  5DG8 A;  3V72 A;  4F5Q A;  4X4Q A;  4Z6C A;  3UPQ A;  3GV8 B;  1K1S A;  3UQ0 A;  8ICH A;  3OHA A;  2R8I A;  1NO5 A;  4QZF A;  7ICO A;  1RXW A;  7ICQ A;  4B9V A;  3RB4 A;  3M8S A;  1TFW A;  1XWL A;  2ZJ8 A;  3HJ4 A;  1K1Q A;  2BR0 A;  3RJF A;  5KT4 A;  4UAY A;  3GIM A;  1NK7 A;  7ICJ A;  5J2E A;  2C2E A;  8ICV A;  2I1Q A;  1MSW D;  2HHP A;  4XA5 A;  1Q79 A;  4FH5 A;  4ECU A;  3ISD A;  2NRZ A;  4PH5 A;  4B9S A;  5KFR A;  2ZTE A;  4EZ9 A;  2HHW A;  2VAN A;  2R8H A;  1Z00 B;  4GC6 A;  2M2V A;  3V7K A;  3AQK A;  5DQG A;  7ICH A;  4F8R A;  4TUQ A;  3K75 D;  4QZH A;  2M2W A;  4DSK A;  1QTM A;  3M8R A;  1UA1 A;  1T7P A;  2AQ0 A;  4DF8 A;  5CP2 A;  1F5A A;  7ICU A;  4O3N A;  5EOZ A;  4F2S A;  1Q78 A;  5J2F A;  4O5E A;  2BQ3 A;  1WCL A;  4DS4 A;  4F3O A;  1BGX T;  2KZZ A;  9ICM A;  3PML A;  4WC2 A;  4C8K A;  2DR7 A;  1MC8 A;  4ED8 A;  7ICF A;  4RQ0 A;  4B9L A;  1JN3 A;  3LQC B;  1BPZ A;  4EEY A;  5J2J A;  2AJQ A;  1S0V A;  4DF4 A;  3OJS A;  5KG3 A;  4BGD A;  5DQH A;  3RH5 A;  4ED6 A;  4KN4 A;  5D46 A;  2C2R A;  2PFO A;  4WC4 A;  1HJP A;  1X9S A;  4KLJ A;  4DQQ A;  2IA6 A;  4YXJ A;  8ICK A;  2DRB A;  4QW9 A;  2FMP A;  4IRD A;  2HVH A;  4UD5 A;  4B9N A;  5CR0 A;  4ECS A;  4RNN A;  4NLK A;  3PW5 A;  1BVS A;  2NRT A;  3PX4 A;  3WFS C;  5JUM A;  1D9F A;  3PY8 A;  4XRH A;  3Q8P B;  2AQ4 A;  1HUZ A;  5HRE A;  5KFM A;  1V4A A;  3OHB A;  5L9X A;  4X0B A;  2A1J B;  4KLO A;  3HT3 A;  4R64 A;  9ICX A;  4YQW A;  2ZHB A;  5J2C A;  2BPC A;  1D8Y A;  3HIY A;  1TVA A;  4E8F A;  2PFQ A;  4B9M A;  1WCN A;  4KLU A;  4YG2 A;  3M9M B;  4M47 A;  2NRX A;  4JWN A;  3FYH A;  5J0X A;  4YP3 A;  5DG9 A;  2NRW A;  5CHG A;  1MQ3 A;  1R8A A;  4RPZ A;  2J6T A;  2HHS A;  5C5J A;  4F4W A;  5KG7 A;  4ED3 A;  8ICO A;  3B0Y A;  4IG8 A;  4AT8 A;  4F91 B;  3BDP A;  3ETL A;  5D49 A;  5EWF A;  1X9M A;  2BCV A;  3AQN A;  5IIJ A;  3OSP A;  4M2Y A;  4X0A A;  2Y1I A;  1JIH A;  4R65 A;  4R66 A;  3G6Y A;  4F4Y A;  5DDY A;  2BDP A;  3E2E A;  5TZV A;  1R8C A;  1UEV A;  3ISB A;  2P6R A;  4GXJ A;  2PI4 A;  2MUT B;  4NM2 A;  5KFO A;  3PR5 B;  4M9H A;  1XU4 A;  3OGU A;  1UA0 A;  5HP4 A;  2NRK A;  1ZQL A;  1KDH A;  3AU2 A;  3V7J A;  3B0X A;  4RWN A;  2LYH A;  1BPX A;  4I2H A;  1N56 A;  4O5C A;  3ZD9 A;  3NGD A;  2KZM A;  1ZQT A;  3WFR E;  3RB3 A;  1ZQM A;  1S76 D;  4ED2 A;  4TUR A;  2ID1 A;  4F2R A;  4KLG A;  2VA2 A;  4WBY A;  1FA0 A;  4O3R A;  5CJ7 A;  3AU6 A;  5J0W A;  3RH6 A;  4K4G A;  3BQT A;  5HRK A;  4RPX A;  1ZQO A;  7ICR A;  4J9M A;  2ZH8 A;  3Q8M A;  4O5K A;  7ICN A;  8ICF A;  2W9C A;  1JX4 A;  5J2A A;  2BCQ A;  2KFZ A;  3PX0 A;  7ICI A;  3V6J A;  3AQM A;  1ZQK A;  2Y1J A;  4LZG A;  1KNY A;  7ICT A;  4KLM A;  3NTU A;  4DS5 A;  1D8L A;  4UBB A;  3HW8 A;  4ECY A;  4YMN A;  4YN4 A;  3GV7 B;  4ECX A;  4XQ8 A;  4RUC A;  4YD1 A;  5KFE A;  2HHX A;  3C2M A;  3T5J A;  3AUO A;  1S10 A;  4ELU A;  5KT2 A;  2BCU A;  4NXZ A;  5KT6 A;  2VA8 A;  2JZB A;  1XSN A;  3SYZ A;  4ECQ A;  4DQI A;  3RRH A;  4J9S A;  5F2V O;  4K4I A;  3MGH A;  4YD2 A;  5J0Q A;  1ZQU A;  2A1J A;  3RTV A;  3H8W A;  4RQ7 A;  3MR3 A;  3RJH A;  5HRD A;  4WC5 A;  1COO A;  1L3U A;  1KFT A;  1KLN A;  4DFM A;  4I2B A;  1U47 A;  1TK8 A;  3MFH A;  4X4T A;  8ICT A;  2BPG A;  3H7I A;  2V9W A;  2JEF A;  1A76 A;  5KFA A;  2AGQ A;  3RAQ A;  3H37 A;  3C2K A;  4P4P A;  1XSP A;  9ICE A;  2ALZ A;  1S0M A;  3OJU A;  4EBJ A;  2V4R A;  4RT3 A;  1SL2 A;  4X4U A;  4F5P A;  4DQR A;  3JPN A;  3PW0 A;  4P4O A;  4ED1 A;  5IIM A;  8ICE A;  4FBU A;  5KFZ A;  4KLL A;  4GXK A;  4AT8 B;  3RB0 A;  2BCR A;  2VA3 A;  9ICW A;  3AQL A;  2ZTC A;  4YMM A;  4ED7 A;  2R8K A;  2MUT A;  4ECR A;  1QSS A;  7ICL A;  9ICT A;  5KT3 A;  3PNC A;  1ZQV A;  5BPC A;  4RZR A;  1KEJ A;  2FPL A;  2ZH1 A;  2B21 A;  7ICP A;  4BDP A;  4I2E A;  1NK8 A;  3SV4 A;  2UVU A;  4QZA A;  4KLE A;  5J0S A;  3KHH A;  4I2C A;  8ICC A;  3PVX A;  8ICN A;  9ICL A;  3SV3 A;  4F5R A;  4QZB A;  4O3S A;  4KTQ A;  2M2T A;  2UVW A;  2ZTD A;  2ZH9 A;  4LVS A;  2IHM A;  4UQG A;  3RJG A;  4X4S A;  4YR2 A;  1L3S A;  9ICJ A;  2ZHA A;  4QZI A;  2M9N A;  2HHQ A;  9ICP A;  3EPI A;  5KG0 A;  1ARO P;  1XS9 D;  9ICO A;  2W8K A;  1ZQB A;  4GC7 A;  4F4K A;  5KFF A;  1XSL A;  4B9T A;  1KSP A;  1RPL A;  3PMN A;  4C8M A;  5KTQ A;  4FS2 A;  4BWM A;  2BPF A;  2DR5 A;  1SKR A;  2W9C B;  4NKT A;  4J9K A;  5DB6 A;  4C8O A;  4J9N A;  1UEU A;  4B9U A;  4WC1 A;  3TFS A;  4DEZ A;  4PGQ A;  5J2H A;  1S9F A;  3LK9 A;  3QE9 Y;  4DFK A;  2C22 A;  4J9P A;  1T4G A;  2NRV A;  5DB7 A;  5KFS A;  4TUP A;  1TK5 A;  1ZQS A;  4M9L A;  4WC3 A;  4PGY A;  5L1L A;  1D9D A;  4M9G A;  1TV9 A;  2PBE A;  3OV7 A;  3N97 B;  2PFN A;  2R8G A;  4UAW A;  2W9B A;  2AU0 A;  3QZ7 A;  1S0O A;  2XY5 A;  3TAR A;  5KFK A;  3THV A;  1KRP A;  2JZB B;  3KTQ A;  5KFG A;  3Q8R B;  4JWM A;  5L1I A;  1IXR A;  2ZH6 A;  4QZ9 A;  3HJ1 A;  5J2I A;  2JEG A;  8ICB A;  7ICS A;  4LT6 A;  4EBK A;  4RWQ A;  3C5G A;  1CEZ A;  2RFF A;  3MR5 A;  2W8L A;  1R8B A;  1NK9 A;  2F1I A;  2W9M A;  5KFP A;  4DOC A;  4R8U A;  3JPT A;  4O3Q A;  5J2D A;  4QZ8 A;  4KLS A;  2ISP A;  1YLQ A;  4UB1 A;  2MAX A;  3H4B A;  5KG1 A;  3RB6 A;  1KFD A;  4QWC A;  5III A;  2UVV A;  3HX0 A;  1S0N A;  4NLN A;  2XO7 A;  4EBD A;  3GFK B;  5HRB A;  4LZD A;  3V6K A;  2GWS A;  1T8E A;  2FPM A;  3C1Z A;  4IR9 A;  4IQT A;  3MAB A;  4FH3 A;  2DVI A;  3WFQ E;  4WC6 A;  4DL7 A;  8ICM A;  9ICF A;  8ICU A;  2ATL A;  5DGB A;  4CCH A;  3IHQ B;  8ICY A;  5HRI A;  3H3A A;  3PR4 A;  3MFI A;  4IRC A;  2BCS A;  4QW8 A;  4DQP A;  2RDI A;  5J2G A;  2ASJ A;  5J2K A;  3H8S A;  1H38 A;  1IM4 A;  3HPO A;  3UXN A;  3UPS A;  8ICS A;  4Z6E A;  5J0P A;  2FPK A;  4M9N A;  1JXL A;  2BKE A;  5DB9 A;  1NK4 A;  4YMO A;  3WFO A;  5DBC A;  5KG6 A;  4EBC A;  4RQ1 A;  4YXM A;  3JPQ A;  5D4B A;  4G3I A;  1EXN A;  4EP7 A;  3WFP A;  4JUZ A;  4ECW A;  5IIN A;  2FLL A;  4ELV A;  4X5V A;  4PHE A;  1NK5 A;  4QZG A;  4RU9 A;  7ICE A;  8ICJ A;  4DL4 A;  4JK1 A;  5KFX A;  5DLG A;  4KLQ A;  9ICN A;  1JXE A;  3JPR A;  2AGO A;  1KTQ A;  1U4B A;  1NKC A;  2HW3 A;  4MFC A;  2ZH7 A;  1BPB A;  4IQU A;  5F9L A;  2DPI A;  4O9M A;  3MDC A;  4PPX A;  1B43 A;  4PHP A;  4KLF A;  2HHV A;  1JMS A;  8ICW A;  1ZQF A;  2C28 A;  4NY8 A;  1Z3E B;  4NM1 A;  2KZ3 A;  1U49 A;  4MF8 A;  4JV0 A;  2DFL A;  1ZQR A;  1NOM A;  5EWG A;  3TI0 A;  3EZ5 A;  4F5N A;  2IBK A;  4I28 A;  3T5K A;  1DGS A;  3PW4 A;  1T3N A;  4MFA A;  8ICZ A;  1BPY A;  2ZH5 A;  1BPD A;  4ECZ A;  4TQS A;  4RT2 A;  5EWE A;  2XCP A;  1VJ7 A;  2C2D A;  2W9B B;  4O0I A; 
#chains in the Genus database with same CATH topology
 1L3T A;  4C7Y A;  3N7P D;  1SWW A;  5AM4 A;  5DBA A;  4AT7 B;  5D62 A;  9ICI A;  3FAH A;  4UAZ A;  3NVY A;  4NKU A;  3RJJ A;  4I2J A;  4BX9 C;  2LYA A;  3T5H A;  4FHX A;  1Q8K A;  4USA A;  5HNK A;  4NXV A;  4MFF A;  2AGP A;  1MIW A;  4WCW A;  1A77 A;  2XGP A;  2HHU A;  1Z19 A;  3T3F A;  4E0D A;  4RWO A;  5L1J A;  4NLZ A;  4AT9 A;  3C1Y A;  4M9J A;  2HBK A;  2ZUC A;  4ATB A;  4DLG A;  3RH4 A;  4ECT A;  3TQ1 A;  1KKX A;  4TUS A;  4O3P A;  4UB5 A;  4I0U A;  4WJ3 B;  4Q45 A;  3Q8S B;  4QJF B;  1ZQQ A;  3SI8 A;  9ICB A;  1HIW A;  5KFH A;  2KN7 A;  4K4H A;  3T5L A;  4OJL A;  2F44 A;  3QEB Z;  2BBJ A;  1ZQW A;  1PVQ A;  2HN1 A;  1WOT A;  2W03 A;  5J0R A;  1UPH A;  2ASD A;  1XC9 A;  4FHP A;  4GXI A;  4O69 A;  5AI0 A;  5ALI A;  3NAS A;  5DB8 A;  2XY6 A;  4EEK A;  5KG2 A;  2GO7 A;  4AT7 A;  4IQV A;  4M5D A;  2DF4 B;  7ICM A;  4FHV A;  2GH1 A;  3WU2 U;  2PFP A;  5KFI A;  4RNM A;  5KFB A;  4NLC A;  3H38 A;  2WB1 F;  4P4M A;  3GIJ A;  3BQ2 A;  2LI6 A;  3H4D A;  3TAD A;  3LWM A;  3BS5 A;  4F92 B;  4ED0 A;  2FJ6 A;  3G6X A;  4CGZ A;  2CXY A;  4UB3 A;  4BXO A;  5J0T A;  3LVV A;  4NXU A;  4ZH4 A;  4WBZ A;  1RYR A;  4Y2T A;  3C5F A;  4ZOH C;  4GLX A;  2PI5 A;  4C8L A;  4IR1 A;  4RQ5 A;  4LEV A;  5B66 U;  1ZQN A;  8ICR A;  4KMU A;  5L1K A;  2D6F C;  9ICH A;  1QQ7 A;  4U6P A;  3JPS A;  5KFV A;  1VFG A;  4FHY A;  2WTF A;  3RJK A;  2ASL A;  1SL1 A;  1RM6 C;  3ETR A;  4LJX A;  2KMD A;  1X2I A;  4RNO A;  3F2C A;  5HRL A;  2G08 A;  2XI9 A;  4RQ2 A;  1VLB A;  2G09 A;  5AM5 A;  4I27 A;  4DLE A;  5KFD A;  2W3R A;  2H3V A;  2KTQ A;  2R8J A;  3MDA A;  3IP4 B;  2F76 X;  5KT5 A;  1PX5 A;  3M9O B;  7ICK A;  5HC9 A;  3M9N B;  4US8 A;  2HVI A;  3HKZ C;  5J0U A;  4EYI B;  5KFL A;  4MEY A;  1ZQY A;  5KG4 A;  5B5E U;  4RQ4 A;  2FDR A;  4CDG A;  4GIB A;  4UAV A;  2WF9 A;  1N48 A;  3N4M B;  1U45 A;  1LVH A;  4DSL A;  5DQI A;  4KLD A;  4UBC A;  4Z6C A;  1M6Y A;  1K1S A;  3OHA A;  4CF4 A;  4CE6 A;  4QZF A;  1RXW A;  3NRW A;  5ALH A;  2E5S A;  2ZJ8 A;  1K1Q A;  3RJF A;  7ICJ A;  5J2E A;  2I1Q A;  2HHP A;  2KNJ A;  2K4I A;  3WK6 A;  5KFR A;  1NNL A;  1Z00 B;  4GC6 A;  2M2V A;  4C0Z A;  3V7K A;  5DQG A;  2KP7 A;  4TUQ A;  3K75 D;  4QZH A;  4EGW A;  5AK5 A;  4DSK A;  1F5A A;  5AKG A;  7ICU A;  3S6J A;  3E0F A;  4O5E A;  1WCL A;  4DS4 A;  4F3O A;  3PML A;  4C8K A;  1MC8 A;  4ED8 A;  3GU3 A;  3LQC B;  2XVT A;  4EEY A;  4ED6 A;  4WC4 A;  2OCE A;  1DGJ A;  2IA6 A;  4K96 A;  3UMC A;  2DRB A;  4IRD A;  5CR0 A;  2EQY A;  4RNN A;  2NRT A;  3PY8 A;  3Q8P B;  5HRE A;  5KAF U;  3OHB A;  4KLO A;  4NXT A;  4YQW A;  2ZHB A;  3HIY A;  4YP3 A;  1TAM A;  1R8A A;  4RPZ A;  2J6T A;  4ED3 A;  2FE9 A;  4F91 B;  3AQN A;  1JIH A;  5TZV A;  1QQ6 A;  2PI4 A;  2K4H A;  2MUT B;  3OGU A;  5HP4 A;  2NRK A;  1KDH A;  5AI8 A;  3ZD9 A;  2KZM A;  5AKH A;  3WFR E;  2BBH A;  3RB3 A;  1S76 D;  4ED2 A;  4KLG A;  2VA2 A;  4FFD A;  2HMX A;  1FA0 A;  5CJ7 A;  4K4G A;  4C4T A;  1ZQO A;  5ALD A;  4J9M A;  4O5K A;  5AKZ A;  2KFZ A;  3SEN A;  3PX0 A;  1RG6 A;  4LZG A;  2JH1 A;  3BZC A;  4DS5 A;  1D8L A;  3M1Y A;  3LVW A;  3HW8 A;  5ALO A;  2HHX A;  3C2M A;  2FCL A;  4ELU A;  5E79 U;  3B9J A;  2W11 A;  4ECQ A;  3RRH A;  3TKA A;  4J9S A;  2OH2 A;  4Y2Y A;  1ECW A;  4RQ7 A;  1BNP A;  3SEI A;  5D61 A;  1B4F A;  5TIS U;  4I2B A;  1PK1 B;  4KX5 A;  3MFH A;  2LKY A;  3H37 A;  2ZH2 A;  3C2K A;  4P4P A;  1XSP A;  2V4R A;  4K97 A;  3PW0 A;  3JPN A;  4P4O A;  8ICE A;  4FBU A;  3H8M A;  5H2F U;  2RRD A;  3RB0 A;  2MUT A;  4ECR A;  1ZQV A;  1WG8 A;  2F3N A;  2B21 A;  7ICP A;  2NO4 A;  3SV4 A;  4KM5 A;  8ICN A;  3SV3 A;  4QZB A;  4O3S A;  2UVW A;  2ZH9 A;  3RJG A;  3K1Z A;  1L3S A;  2ZIV A;  1Z4O A;  2YMP A;  2W8K A;  1ZQB A;  2F8L A;  1L6N A;  5KFF A;  1KSP A;  3SAH A;  1RPL A;  5AI9 A;  3CK6 A;  3I28 A;  1L7M A;  3PSP A;  4BWM A;  2ZIU B;  2W9C B;  1RDF A;  4J9K A;  5DB6 A;  5JTG A;  4J9N A;  3F5A A;  3HKZ F;  3NVZ A;  5J2H A;  1S9F A;  4OAG A;  3QE9 Y;  1TK5 A;  2G06 A;  5AKK A;  4WC3 A;  4M9G A;  2RP5 A;  2KKP A;  5KFK A;  3THV A;  4KMO B;  2JZB B;  4F71 A;  3AL0 B;  1IXR A;  5ALW A;  2VJ4 A;  1L7N A;  1QH9 A;  4QIW C;  2O6K A;  3C5G A;  3MR5 A;  4DOC A;  5J2D A;  4QZ8 A;  1T94 A;  2QAR B;  5KG1 A;  4QWC A;  1N63 A;  3CP8 A;  2UVV A;  2QB0 A;  2XO7 A;  3V6K A;  1P7D A;  1Q3V A;  2XIC A;  1WUD A;  4IR9 A;  4WC6 A;  2Y9U A;  8ICM A;  3IHQ B;  3H3A A;  2HCF A;  3MFI A;  1H38 A;  4C7Z A;  5ALU A;  3WFO A;  5CHE A;  5DBC A;  4Y2X A;  3QU4 A;  4G3I A;  3IDW A;  4ECW A;  7ICE A;  4X5V A;  1NK5 A;  4QZG A;  8ICJ A;  2ZIU A;  5DLG A;  1JXE A;  3JPR A;  4O9M A;  4J03 A;  2EAO A;  1UHU A;  2HHV A;  2P35 A;  2ZXH A;  1Z3E B;  2KZ3 A;  2DFL A;  1NOM A;  3HRD D;  3TI0 A;  5ALL A;  4F5N A;  4I28 A;  1DGS A;  2LM4 A;  5ALV A;  1VJ7 A;  2W9B B;  5DLF A;  3BS7 A;  4PZO A;  1ZQA A;  3ORY A;  3AEV A;  3EWA A;  4X4O A;  2RDJ A;  3BQ7 A;  4MEX A;  1ZQE A;  5HMM A;  1KBU A;  4AP9 A;  4MF2 A;  3RRG A;  4F4X A;  4LEZ A;  3TFR A;  1OW5 A;  9ICC A;  2WB1 C;  2IUB A;  2JMG A;  3TAQ A;  2BQR A;  3ZDB A;  3WK8 A;  3O0F A;  2E1F A;  4JV2 A;  5KFC A;  2UVR A;  3QXG A;  5HML A;  4DFD A;  3TAN A;  5BOM A;  4ELT A;  5FP0 A;  4KIT B;  3FM9 A;  4E80 A;  1Q3U A;  3NWI A;  2I9G A;  3JYY A;  2P6U A;  5DEC A;  5DDM A;  2H5X A;  2ZXI A;  1UT8 A;  2KSO A;  4I2F A;  3AN1 A;  2BGW A;  3H39 A;  4M04 A;  7ICG A;  2KG5 A;  3PV8 A;  1V9P A;  4IRK A;  1V38 A;  3JPP A;  4LEW A;  4O68 A;  2KV2 A;  3UMB A;  3PX6 A;  4X4R A;  1QSL A;  1JAL A;  1TAU A;  3EYZ A;  3K1R B;  3GV5 B;  1NJZ A;  1QSY A;  2K4E A;  4DSI A;  2DR9 A;  2DGZ A;  1JRO A;  4QZD A;  4Q8F A;  4F93 B;  4Y2J A;  4EX7 A;  2E8N A;  1SL0 A;  4O3O A;  5HRG A;  4I2I A;  4QWD A;  5KT7 A;  4ECV A;  3SZ2 A;  1NK0 A;  4P2H A;  2YQE A;  3UQ2 A;  2ZIX A;  3QYP A;  3UMG A;  5CWR A;  4NL9 C;  5F9N A;  4AT9 B;  5KFN A;  1Q46 A;  4X4N A;  3C2L A;  4ATB B;  1T3Q A;  5DG7 A;  2E8P A;  3L9D A;  4I29 A;  1SZH A;  2W7P A;  3C21 A;  3MGI A;  3EW9 A;  3UXP A;  5J8Y A;  4DL6 A;  2ZH4 A;  2FLP A;  2EWR A;  4K99 A;  1HEK A;  4DOA A;  1MIY A;  2DR8 A;  5IIK A;  4PGX A;  3KHL A;  5KFT A;  2HI0 A;  4S3N A;  1ZQG A;  3RR7 A;  4UD4 A;  4YR0 A;  2IOF K;  4N7R A;  4LEY A;  2DBY A;  3IG5 A;  1ZJM A;  2PXI A;  3GIL A;  2BE3 A;  1ZQP A;  1SZP A;  1LB2 B;  3QEA Z;  5AIB A;  1ZET A;  4KN7 A;  2ZUB A;  1WWV A;  2Q0Z X;  5KG5 A;  4RWP A;  3GQC A;  3MCR A;  2IOF A;  3BS5 B;  1NI3 A;  4F4Z A;  2FMS A;  3VCB A;  2H3Q A;  4FHW A;  3AQE A;  3D2N A;  4BXO B;  1SKW A;  4FO6 A;  2XGQ A;  3LYS A;  5KFU A;  3OVA A;  3M7D A;  4HX0 A;  4DWI A;  2F1J A;  4NV0 A;  2OM6 A;  3ICX A;  2BHN A;  4WC7 A;  4BUG A;  4F5Q A;  1NZB A;  5HR7 A;  1PUZ A;  1NO5 A;  7ICQ A;  4O6A A;  1XWL A;  2BR0 A;  1KNY A;  5KT4 A;  1NK7 A;  8ICV A;  2WFA A;  4EEB A;  1JUD A;  2NRZ A;  2ZTE A;  1YZ6 A;  7ICH A;  1L7O A;  2DL0 A;  1T7P A;  5CP2 A;  4O3N A;  5EOZ A;  3SD7 A;  4US9 A;  9ICM A;  3KKA C;  1JN3 A;  5J2J A;  2AJQ A;  4DF4 A;  1KQQ A;  5DQH A;  3N7R C;  4KN4 A;  5D46 A;  2JRZ A;  4DQQ A;  4YXJ A;  1C20 A;  4UD5 A;  1BVS A;  4XRH A;  1V4A A;  5L9X A;  4X0B A;  2EDU A;  4R64 A;  4IC9 A;  4E8F A;  4KLU A;  4YG2 A;  2DUY A;  3M9M B;  4JWN A;  2NRW A;  5KG7 A;  8ICO A;  3B0Y A;  3BDP A;  3ETL A;  5D49 A;  2KJ8 A;  1X9M A;  2F77 X;  4M2Y A;  4R65 A;  2BDP A;  3E2E A;  3ISB A;  5KFO A;  1UA0 A;  1ZQL A;  5AM3 A;  4P0P A;  1N56 A;  2HOQ A;  1ZQM A;  4WBY A;  4O3R A;  5A0L A;  3BQT A;  2JHD A;  2KE7 A;  2EZZ A;  3ALR A;  2BCQ A;  5AK3 A;  3AQM A;  1ZQK A;  4Y2U A;  5ALY A;  4UBB A;  4ECY A;  3QUQ A;  4RUC A;  4YD1 A;  5KFE A;  5ALM A;  4OAF A;  4DCC A;  3OPX A;  1S10 A;  5KT6 A;  1KW4 A;  1CRX A;  1Z4N A;  5F2V O;  4DQI A;  2IOH A;  5AKX A;  5AM0 A;  3MGH A;  1ZQU A;  3RTV A;  3H8W A;  3MR3 A;  3RJH A;  5HRD A;  4DFM A;  2BPG A;  5ALX A;  4CRX A;  4UB6 U;  2ALZ A;  1S0M A;  1BNO A;  1SL2 A;  4ED1 A;  1SV0 A;  5KL1 B;  5KFZ A;  4GXK A;  3AQL A;  1XO0 A;  3TAC B;  4ED7 A;  4F72 A;  4I2E A;  3OWG A;  1PK3 A;  2UVU A;  1N5W A;  3KHH A;  4I2C A;  1F5S A;  3SAF A;  2M2T A;  2IHM A;  4UQG A;  2ZHA A;  3D2Q A;  1ARO P;  2AH5 A;  2MU2 A;  1Z1V A;  1N5X A;  4B9T A;  2B4V A;  2NO5 A;  2KIC A;  3NVW A;  3PMN A;  4C4S A;  2BPF A;  1SKR A;  2JGA A;  4NKT A;  2K8C B;  4K98 A;  5EE1 A;  2B0C A;  4WC1 A;  2HSZ A;  2JH7 A;  4DEZ A;  5DB7 A;  5KFS A;  4M9L A;  1YZ7 A;  2HBJ A;  3SMV A;  5L1L A;  1D9D A;  3OV7 A;  5ALE A;  2PFN A;  1FIQ A;  2R8G A;  2AU0 A;  3KTQ A;  5KFG A;  3I76 A;  4QZ9 A;  3N28 A;  5J2I A;  1L8L A;  8ICB A;  4EBK A;  4RWQ A;  3H0R B;  2RFF A;  1R8B A;  5AKE A;  1NK9 A;  2N1R A;  2W9M A;  4R8U A;  4Y2P A;  2ISP A;  4UB1 A;  2MAX A;  3RB6 A;  1KFD A;  4NLN A;  3JCF A;  4EBD A;  3GFK B;  4JMU A;  2GWS A;  8ICU A;  4PL2 A;  8ICY A;  4IRC A;  3EF2 A;  4B6J A;  1YT3 A;  3H8S A;  1IM4 A;  3UXN A;  1DRG A;  3UPS A;  4M9N A;  2FPK A;  1JXL A;  4KX3 A;  1O08 A;  5KG6 A;  4EBC A;  2ZIV B;  5CRX A;  5D4B A;  1EXN A;  5IIN A;  4PHE A;  1ZD3 A;  4DL4 A;  9ICN A;  3QU9 A;  4OAH A;  2AGO A;  1KTQ A;  3PSI A;  1S8O A;  5F9L A;  3L5K A;  2B56 A;  4KLF A;  1JMS A;  2C28 A;  2R18 A;  4NY8 A;  4NM1 A;  4P0Q A;  3D2S A;  2ODG A;  3GZF A;  1T3N A;  1BPY A;  1BPD A;  1SXE A;  5CFS A;  2XCP A;  5AHX A;  3NUQ A;  2J6U A;  4KLT A;  3JPO A;  3D6J A;  4RQ8 A;  3UM9 A;  4EX6 A;  5L1M A;  2HHT A;  1NK6 A;  4QZC A;  1BPE A;  2I6X A;  4X4V A;  1ZQZ A;  1XNS A;  3CRX A;  2YMQ A;  3RF9 A;  5K4L A;  2PMZ F;  3IRU A;  3WKA A;  5CB1 A;  1F0M A;  2BDU A;  4XJE A;  1ZYQ A;  1FFV A;  4EV6 A;  3Q8L A;  4UB2 A;  2Y9T A;  5J29 A;  4J9O A;  4UB8 U;  4PHA A;  2YML A;  5IIL A;  4M6W A;  1DOQ A;  1Y88 A;  3NS1 A;  9ICS A;  1OU5 A;  3NYB A;  2QB0 B;  4FZM A;  4EZ6 A;  3GIK A;  4DL3 A;  3JZ0 A;  2CN1 A;  4Q8E A;  5IIO A;  3LDA A;  1TAQ A;  3TAD C;  4A8E A;  4I2A A;  1ZQI A;  3GII A;  2KK0 A;  5J0Y A;  1NKB A;  4NXX A;  5HRF A;  2O5A A;  5ALN A;  4QWE A;  1ZQD A;  2RLT A;  3H0M B;  4F5O A;  3PO4 A;  4WQL A;  1ZJN A;  3C23 A;  5B3Q A;  3ZDA A;  1C7Y A;  1QLN A;  2ISO A;  4XUS A;  4Y2R A;  4O67 A;  3C29 A;  2XY7 A;  4RQ3 A;  3RAX A;  4I2G A;  5KFQ A;  8ICP A;  1MQ2 A;  4EBE A;  2WF6 A;  2W3S A;  4QWB A;  3RR8 A;  4M0A A;  5DKW A;  8ICA A;  2WAQ F;  3QU2 A;  1UET A;  2WF8 A;  1NJW A;  5HHI A;  2Q66 A;  3HJE A;  5KFW A;  3TAP A;  2E8M A;  5HR9 A;  4NLG A;  1MIV A;  4PZN A;  3V7L A;  3Q8K A;  4Z6F A;  5DED A;  1A6S A;  1LV5 A;  1X9W A;  4DO9 A;  2YB4 A;  3RBD A;  1PVP A;  2W54 A;  2E1E A;  2JR5 A;  3FC4 A;  4Y2S A;  5JU5 A;  2KFN A;  1L3V A;  1OUQ A;  5HRH A;  1TKD A;  1FO4 A;  3OVB A;  2ZH3 A;  2JEI A;  1L5U A;  3T79 A;  5HR6 A;  9ICR A;  4WC0 A;  3EPG A;  1U48 A;  2Z7J A;  4DL5 A;  2G5H B;  3ZD8 A;  3CNH A;  2XC9 A;  5KFY A;  2F1H A;  1X6J A;  4X4P A;  3BQ1 A;  4WQK A;  5ALK A;  4YFK A;  2IHN A;  3KKA A;  3GDX A;  1IIP A;  5ALJ A;  2KSO B;  2EZY A;  1S97 A;  5KAI U;  4DFJ A;  3RJI A;  2XCA A;  3H8J A;  2V4Q A;  5JRT A;  1ZXI A;  2E3T A;  2FI1 A;  4HYK A;  3NVV A;  2KJ5 A;  3WK4 A;  2L5Y A;  1NJY A;  2F8K A;  2IMW P;  2ZJA A;  2KIV A;  4Z6D A;  2I5H A;  3AQF A;  1SIJ A;  3IV6 A;  1HUO A;  2DPJ A;  4YVZ A;  2P66 A;  9ICA A;  3H40 A;  4Q43 A;  3QZ8 A;  1OXJ A;  1ED1 A;  1DK3 A;  3KZX A;  4E7X A;  5J0O A;  5ALS A;  2ZIX B;  1DXS A;  4RUA A;  1SKS A;  4EEL A;  2YTU A;  3OSN A;  1ZD4 A;  2NYV A;  1CUK A;  4X4Q A;  1X6I A;  2VKQ A;  3UQ0 A;  2R8I A;  3F5E A;  4FZL A;  4C80 A;  2VJ5 A;  2Y0S F;  4JLZ A;  4B9V A;  3M8S A;  2C2E A;  1MA7 A;  1MSW D;  4XA5 A;  1Q79 A;  4FH5 A;  4ECU A;  2G5I B;  4EZ9 A;  2HHW A;  2VAN A;  1IV8 A;  3AQK A;  1ZOL A;  1N2X A;  2M2W A;  3KZI U;  1QTM A;  1UA1 A;  2QLT A;  1Q78 A;  5CFT A;  5J2F A;  4CNQ A;  3ED5 A;  1SV4 A;  2KZZ A;  3I1Y A;  2PKE A;  3QNM A;  2DR7 A;  3WKE A;  2ZIW B;  4RQ0 A;  5D63 A;  1ZRN A;  1BPZ A;  1S0V A;  3OJS A;  5KG3 A;  2C2R A;  2PFO A;  4Y2Q A;  1HJP A;  4KLJ A;  8ICK A;  4QW9 A;  2HVH A;  3QUC A;  4NLK A;  3PX4 A;  2KIW A;  1D9F A;  2AQ4 A;  5CEH A;  2G0A A;  5J2C A;  1D8Y A;  1TVA A;  2PFQ A;  4M47 A;  3K7D A;  2HHS A;  4F4W A;  5AKI A;  4IG8 A;  4AT8 A;  5KL8 B;  5EWF A;  2BCV A;  3OSP A;  2EAN A;  2ZG6 A;  3G6Y A;  4F4Y A;  1UEV A;  2LYB A;  2P6R A;  4M9H A;  4NM2 A;  2KKV A;  3B0X A;  4RWN A;  2LYH A;  1BPX A;  4O5C A;  3NGD A;  4AYB C;  1O03 A;  4TUR A;  2ID1 A;  1V85 A;  3AU6 A;  3RH6 A;  5HRK A;  4K9A A;  2ZH8 A;  3Q8M A;  7ICN A;  8ICF A;  5J2A A;  4BJQ A;  7ICI A;  3V6J A;  3M6Z A;  2ZIW A;  2K60 A;  7ICT A;  4KLM A;  3NTU A;  3J81 j;  1L8O A;  4YMN A;  4YN4 A;  2GAF D;  4XQ8 A;  4UAR A;  3KFU F;  1RQN A;  3WK9 A;  3T5J A;  4NXZ A;  2VA8 A;  2KOB A;  5ALF A;  1UQV A;  5J0Q A;  4OCZ A;  2Q4T A;  4WC5 A;  1COO A;  1L3U A;  1KFT A;  1U47 A;  4X4T A;  8ICT A;  2AHO B;  2V9W A;  5KFA A;  2AGQ A;  3RAQ A;  1ZD2 P;  2A19 A;  9ICE A;  3OJU A;  2W43 A;  3AM9 A;  1X66 A;  4KLL A;  2GLE A;  2VA3 A;  9ICW A;  4YMM A;  2R8K A;  1QSS A;  7ICL A;  3PNC A;  2W04 A;  5KT3 A;  5AK4 A;  4RZR A;  5BPC A;  2ZH1 A;  4BDP A;  2MA1 A;  4QZA A;  3HIL A;  8ICC A;  4F5R A;  4KTQ A;  2D3D A;  4P0P B;  4LVS A;  9ICJ A;  2M9N A;  2HHQ A;  4PL1 A;  5KG0 A;  2DKX A;  4ACO A;  2W7O A;  4C4R A;  4C8M A;  2DR5 A;  3L4P A;  5ALT A;  4C8O A;  2A3V A;  4OJO A;  3TFS A;  4PGQ A;  4Y2V A;  3PSF A;  4DFK A;  2C22 A;  4J9P A;  1T4G A;  1ZQS A;  4TUP A;  3IN5 A;  1TV9 A;  3ER8 C;  2XID A;  3TAR A;  2BZF A;  3DV9 A;  3Q8R B;  2HOF A;  5L1I A;  2K8A A;  3WK5 A;  4EED A;  5ALZ A;  7ICS A;  4PJ0 U;  5ALR A;  1JRP A;  1CEZ A;  2C2D A;  2W8L A;  5ALG A;  2H3F A;  2F1I A;  3JPT A;  4O3Q A;  3SAG A;  1WYG A;  1YLQ A;  5III A;  4GFJ A;  3HX0 A;  2PMZ C;  3E58 A;  4OJP A;  4LZD A;  2KEY A;  2A1A A;  2OEH A;  4IQT A;  3WFQ E;  1Z1B A;  2EAM A;  5HRI A;  5KNI A;  2ATL A;  4U7C A;  3PR4 A;  4DQP A;  2WF5 A;  2RDI A;  2ASJ A;  4WH5 A;  4Z6E A;  5J0P A;  2BKE A;  4YMO A;  5JTI A;  2RQ5 A;  4JUZ A;  2FLL A;  2PBE A;  4RU9 A;  4KLQ A;  2HW3 A;  2ES6 A;  1F44 A;  1U4B A;  1BPB A;  4IQU A;  4PPX A;  2DPI A;  3MDC A;  4UAS A;  2EH9 A;  8ICW A;  5EE9 A;  2KHQ A;  1ZQF A;  3PST A;  4UAU A;  3WKD A;  4MF8 A;  4JV0 A;  1ZQR A;  3CW2 C;  3DEE A;  3EZ5 A;  3PW4 A;  2ZH5 A;  4ECZ A;  5EWE A;  4O0I A;  2LBO A;  1RZT A;  1R89 A;  4IQW A;  4KB6 A;  4OJ6 A;  8ICQ A;  4RPY A;  1N62 A;  3PO5 A;  2KVC A;  2BQU A;  5AM2 A;  2M2U A;  4DSF A;  1NZP A;  3WKB A;  3KBB A;  1B22 A;  4R8U B;  3MR2 A;  2W9A A;  2JEJ A;  4RQ6 A;  2WAQ C;  8ICL A;  3OUY B;  5BOL A;  3K4G A;  4WC2 A;  3A0H U;  3BJY A;  1U9L A;  4DQS A;  3PW7 A;  1GO3 F;  4AYB F;  2J6S A;  2E8O A;  1RXV A;  3QUB A;  2YY6 A;  9ICQ A;  3NVO A;  1JAJ A;  1J2N A;  1JI7 A;  2KJ9 A;  3ZDC A;  3IM1 A;  3BQ0 A;  2DVI A;  3WFS C;  2HBM A;  1TFR A;  3MGV A;  1RYS A;  4FE3 A;  3PW2 A;  2ZJ5 A;  5DBB A;  3C66 A;  1XO1 A;  3MR6 A;  2O1P A;  4YR3 A;  3AMZ A;  4FS1 A;  2OWO A;  4J9Q A;  2FLN A;  4OAI Z;  4JB3 A;  4QWA A;  1ZQC A;  9ICU A;  5J8Y C;  5AM1 A;  4UB4 A;  4P0Q B;  3ZDD A;  2QKQ A;  9ICG A;  3KOO A;  1ZQH A;  3LWL A;  9ICV A;  1KFS A;  4O3M A;  3OTQ A;  4DFP A;  3HWT A;  5G5H A;  3QX7 A;  3Q8Q B;  2W55 A;  2HN2 A;  4PHD A;  1KL9 A;  3F53 A;  3OUY A;  1RYU A;  5EE0 A;  4CF3 A;  3UXO A;  5AI5 A;  4FO1 A;  1K5O A;  4M6W B;  4DOB A;  1J2M A;  8ICX A;  5T14 A;  3ISC A;  4UAT A;  1SB3 C;  4C8N A;  1S77 D;  1PVR A;  4QZE A;  2FMQ A;  4J9L A;  3RFA A;  1NKE A;  4NXW A;  3WK7 A;  5HHH A;  1TK0 A;  4KLH A;  4Q44 A;  1CI4 A;  3OVS A;  2K89 A;  1UT5 A;  4YCX A;  1QQ5 A;  1NJX A;  4I2D A;  3ERC C;  1PZN A;  3G6V A;  5CA7 A;  3NRZ A;  1Z00 A;  4TQR A;  2Y0S C;  2EZX A;  4DL2 A;  3RBE A;  1AQ6 A;  3N7S C;  1N61 A;  4J9R A;  3M6K A;  2LHT A;  4JV1 A;  2AXT U;  5EE3 A;  8ICG A;  3QUT A;  4KLI A;  2JV3 A;  2CPR A;  3V6H A;  4DSE A;  7ICV A;  5KFJ A;  4EYH B;  5DGA A;  1QCK A;  2ZUD A;  5J2B A;  2KVS A;  3ZDE A;  4R63 A;  3KHG A;  3MBY A;  1SXD A;  3KHR A;  1FFU A;  3HP6 A;  3C18 A;  4DSJ A;  8ICI A;  3ZI4 A;  2DRA A;  4F50 A;  4NL9 A;  4BWJ A;  2M0N A;  3FDS A;  1ZQX A;  5CFU A;  2YB1 A;  4QNL A;  1JQR A;  4FBT A;  2RHF A;  2OYY A;  1TFY A;  3IG8 A;  4IL6 U;  3SQI A;  4EEN A;  3RJE A;  1SGG A;  3R9K A;  5GTH U;  1ZQJ A;  9ICK A;  1LKY B;  4XQ7 A;  2WF7 A;  5F3X B;  5AI6 A;  3PHZ A;  3U26 A;  3V72 A;  5DG8 A;  3UPQ A;  3GV8 B;  4NWI A;  8ICH A;  7ICO A;  3VC8 A;  4HAI A;  3RB4 A;  1TFW A;  3HJ4 A;  4UAY A;  3GIM A;  2OHF A;  3C28 A;  4OO1 J;  3ISD A;  5AKJ A;  4PH5 A;  4B9S A;  1B0X A;  2YX8 A;  3SR6 A;  2R8H A;  3L3F X;  1X40 A;  4F8R A;  1UCV A;  1TE2 A;  3M8R A;  2AQ0 A;  4DF8 A;  1X42 A;  4F2S A;  2BQ3 A;  2OXO A;  1URJ A;  3EUB 2;  4FZN A;  1BGX T;  2QB1 A;  1ZD5 A;  4IS7 A;  2HBL A;  2HOI A;  7ICF A;  4B9L A;  4BGD A;  3RH5 A;  5AIC A;  2WHE A;  3DDH A;  1X9S A;  3ONN A;  2FMP A;  4CF5 A;  3QU5 A;  4B9N A;  3ER9 B;  4ECS A;  3PW5 A;  2K8B B;  2KD1 A;  5JUM A;  4OJ5 A;  1HUZ A;  5KFM A;  1PK1 A;  2A1J B;  3HT3 A;  5C0Y A;  9ICX A;  1LKY A;  2BPC A;  2LMR A;  4B9M A;  1WCN A;  2NRX A;  4RQN A;  3FYH A;  5J0X A;  1IG6 A;  5DG9 A;  5CHG A;  1MQ3 A;  1SWV A;  2F2A B;  5C5J A;  2LM1 A;  4X0A A;  5IIJ A;  2Y1I A;  1R8C A;  4R66 A;  5DDY A;  5AK6 A;  4GXJ A;  3PR5 B;  5B3P A;  1XU4 A;  1S5L U;  3AU2 A;  3V7J A;  1SV0 C;  4I2H A;  1ZQT A;  4G9B A;  3WKC A;  4F2R A;  2H3Z A;  5J0W A;  4RPX A;  1ZRM A;  2G07 A;  7ICR A;  2W9C A;  1JX4 A;  2Y1J A;  2DQN B;  3F2B A;  1DK2 A;  4ICA A;  3GV7 B;  4ECX A;  5G5G A;  3AUO A;  5ALP A;  5KT2 A;  2BCU A;  1MN8 A;  4MHV A;  5AIA A;  2JZB A;  1XSN A;  4UW9 A;  3SYZ A;  1GPJ A;  4K4I A;  2DKZ A;  4WOY A;  4RQM A;  4YD2 A;  3KD3 A;  2A1J A;  2ESE A;  1KLN A;  2HDO A;  1TK8 A;  3H7I A;  1N60 A;  2JEF A;  1A76 A;  2QAR A;  4EBJ A;  4OD0 A;  1X9X A;  4RT3 A;  4X4U A;  4F5P A;  4DQR A;  3BZK A;  5IIM A;  4AT8 B;  2BCR A;  3F2D A;  4JLX A;  2ZTC A;  4NLB A;  9ICT A;  1KEJ A;  2FPL A;  1NK8 A;  4KLE A;  5J0S A;  3PVX A;  2YMM A;  9ICL A;  2GA9 D;  2K4P A;  4K8V A;  2ZTD A;  4X4S A;  4YR2 A;  4QZI A;  9ICP A;  1FEZ A;  3EPI A;  1XS9 D;  9ICO A;  2YN4 A;  1L7P A;  4GC7 A;  4F4K A;  1XSL A;  3NKU A;  1VJ5 A;  5KTQ A;  4FS2 A;  1WWU A;  1UEU A;  4B9U A;  3LK9 A;  2NRV A;  2MSN A;  4PGY A;  3N97 B;  4UAW A;  2W9B A;  3QZ7 A;  1S0O A;  2XY5 A;  1KRP A;  4JWM A;  2ZH6 A;  3HJ1 A;  2JEG A;  4LT6 A;  2KHV A;  2LPE A;  3QU7 A;  2NV3 A;  5KFP A;  1COK A;  3H0L B;  4KLS A;  1J97 A;  5GTI U;  2VIX A;  3H4B A;  2MRL A;  1A0P A;  1S0N A;  2B51 A;  5HRB A;  1T8E A;  2FPM A;  3C1Z A;  4FH3 A;  3MAB A;  4DL7 A;  1RQL A;  9ICF A;  5DGB A;  4CCH A;  2BCS A;  4QW8 A;  3PZP A;  2D8C A;  5J2G A;  5J2K A;  5AKL A;  3HPO A;  8ICS A;  3MC1 A;  5DB9 A;  1NK4 A;  1V97 A;  2DWQ A;  4RQ1 A;  4YXM A;  3JPQ A;  1D8B A;  4EP7 A;  3WFP A;  5ALQ A;  4ELV A;  2IHO A;  1VDV A;  2H3I A;  4JK1 A;  5KFX A;  2ZH7 A;  1NKC A;  4MFC A;  1ZQ1 C;  2GOL A;  1KN5 A;  5AI4 A;  1B43 A;  4PHP A;  4K9B A;  2CRX A;  4NJ8 A;  1U49 A;  4MKP A;  5EWG A;  3A0B U;  2IBK A;  5AKY A;  3T5K A;  2EAP A;  3CYM A;  4MFA A;  2B6G A;  8ICZ A;  4QIW F;  4TQS A;  4RT2 A;  2JXJ A; 
#chains in the Genus database with same CATH homology
 1L3T A;  5DLF A;  2J6U A;  1ZQA A;  4RQ8 A;  3JPO A;  1RZT A;  3ORY A;  4KLT A;  2HHT A;  1R89 A;  5DBA A;  4IQW A;  3EWA A;  4AT7 B;  4X4O A;  1NK6 A;  8ICQ A;  2RDJ A;  4RPY A;  4QZC A;  1BPE A;  4MEX A;  4UAZ A;  9ICI A;  1ZQZ A;  4X4V A;  3PO5 A;  1ZQE A;  4NKU A;  5HMM A;  4MF2 A;  2BQU A;  5CB1 A;  2M2U A;  4DSF A;  1ZYQ A;  3Q8L A;  4UB2 A;  3RJJ A;  4I2J A;  5J29 A;  3RRG A;  4J9O A;  1B22 A;  4R8U B;  3MR2 A;  2W9A A;  4PHA A;  3T5H A;  4RQ6 A;  5IIL A;  2JEJ A;  4M6W A;  4FHX A;  1DOQ A;  5HNK A;  4F4X A;  8ICL A;  5BOL A;  1Y88 A;  2AGP A;  4MFF A;  3K4G A;  1MIW A;  3OUY B;  3TFR A;  4WCW A;  1A77 A;  9ICS A;  1OU5 A;  2XGP A;  9ICC A;  3NYB A;  3BJY A;  2HHU A;  1U9L A;  4EZ6 A;  4DQS A;  3PW7 A;  3GIK A;  4DL3 A;  3JZ0 A;  3T3F A;  2J6S A;  4Q8E A;  3TAQ A;  5IIO A;  1RXV A;  4E0D A;  3LDA A;  5L1J A;  4NLZ A;  2BQR A;  4RWO A;  4AT9 A;  1TAQ A;  3ZDB A;  3C1Y A;  4M9J A;  2ZUC A;  1ZQI A;  4I2A A;  9ICQ A;  4DLG A;  3GII A;  1JAJ A;  4ATB A;  3RH4 A;  3ZDC A;  3IM1 A;  5J0Y A;  3BQ0 A;  4ECT A;  3TQ1 A;  1NKB A;  4JV2 A;  5KFC A;  4TUS A;  2UVR A;  4O3P A;  4UB5 A;  5HRF A;  4Q45 A;  5HML A;  3Q8S B;  3TAN A;  2O5A A;  5BOM A;  4ELT A;  1TFR A;  1ZQQ A;  4KIT B;  3SI8 A;  9ICB A;  4QWE A;  5KFH A;  1RYS A;  2KN7 A;  3PW2 A;  3T5L A;  4K4H A;  1ZQD A;  2ZJ5 A;  4E80 A;  5DBB A;  3C66 A;  1XO1 A;  3MR6 A;  2I9G A;  3JYY A;  2O1P A;  3QEB Z;  4YR3 A;  2P6U A;  1ZQW A;  4F5O A;  3PO4 A;  1WOT A;  5DEC A;  5DDM A;  3C23 A;  5J0R A;  4FS1 A;  1ZJN A;  2OWO A;  4J9Q A;  2H5X A;  2ASD A;  1XC9 A;  1UT8 A;  2FLN A;  4I2F A;  4FHP A;  3ZDA A;  4QWA A;  2BGW A;  3H39 A;  4GXI A;  1ZQC A;  1C7Y A;  1QLN A;  2ISO A;  9ICU A;  4XUS A;  4M04 A;  5DB8 A;  4UB4 A;  2XY7 A;  2XY6 A;  3ZDD A;  7ICG A;  4RQ3 A;  9ICG A;  3RAX A;  3PV8 A;  1V9P A;  5KG2 A;  1ZQH A;  3LWL A;  4I2G A;  4IRK A;  3JPP A;  5KFQ A;  8ICP A;  9ICV A;  4IQV A;  1MQ2 A;  4EBE A;  4M5D A;  4AT7 A;  4QWB A;  1KFS A;  3RR8 A;  7ICM A;  3PX6 A;  4FHV A;  4M0A A;  5DKW A;  8ICA A;  1UET A;  2PFP A;  5KFI A;  4RNM A;  3HWT A;  4DFP A;  1NJW A;  4X4R A;  1QSL A;  3Q8Q B;  5KFB A;  5HHI A;  1TAU A;  3EYZ A;  3H38 A;  3GV5 B;  4PHD A;  1NJZ A;  2Q66 A;  4P4M A;  3GIJ A;  1QSY A;  5KFW A;  3BQ2 A;  4DSI A;  3TAP A;  3OUY A;  2DR9 A;  3H4D A;  5HR9 A;  3UXO A;  4QZD A;  3LWM A;  4NLG A;  4F93 B;  4Q8F A;  1MIV A;  4M6W B;  4DOB A;  4F92 B;  4ED0 A;  1SL0 A;  3G6X A;  4O3O A;  5HRG A;  4I2I A;  3V7L A;  4QWD A;  4Z6F A;  4UB3 A;  3Q8K A;  8ICX A;  5KT7 A;  5DED A;  4ECV A;  5J0T A;  3SZ2 A;  1NK0 A;  1LV5 A;  4BXO A;  1X9W A;  3ISC A;  3UQ2 A;  4P2H A;  4DO9 A;  4C8N A;  3RBD A;  1S77 D;  4ZH4 A;  4WBZ A;  5CWR A;  1RYR A;  5F9N A;  2ZH2 A;  2KFN A;  4QZE A;  2FMQ A;  3C5F A;  4AT9 B;  5KFN A;  4J9L A;  1L3V A;  4GLX A;  4X4N A;  2PI5 A;  3C2L A;  4C8L A;  5HRH A;  1TKD A;  5DG7 A;  1NKE A;  4ATB B;  3OVB A;  3L9D A;  2ZH3 A;  2JEI A;  5HHH A;  1TK0 A;  4IR1 A;  4KLH A;  4RQ5 A;  1L5U A;  4I29 A;  4Q44 A;  3OVS A;  9ICR A;  3C21 A;  3MGI A;  1ZQN A;  4WC0 A;  1UT5 A;  4YCX A;  3EW9 A;  8ICR A;  4KMU A;  5L1K A;  1NJX A;  4I2D A;  9ICH A;  3EPG A;  1U48 A;  3JPS A;  3UXP A;  1PZN A;  5KFV A;  1VFG A;  4DL5 A;  3G6V A;  3ZD8 A;  4FHY A;  2WTF A;  4DL6 A;  5CA7 A;  3RJK A;  2XC9 A;  1Z00 A;  5KFY A;  2F1H A;  4TQR A;  2ASL A;  2FLP A;  2ZH4 A;  4X4P A;  4DL2 A;  3BQ1 A;  4DOA A;  3RBE A;  1SL1 A;  1MIY A;  2DR8 A;  4YFK A;  2IHN A;  5IIK A;  3GDX A;  4J9R A;  4PGX A;  1X2I A;  4RNO A;  1S97 A;  3KHL A;  4JV1 A;  4DFJ A;  3RJI A;  5KFT A;  5HRL A;  2XCA A;  4S3N A;  4RQ2 A;  1ZQG A;  8ICG A;  3RR7 A;  4KLI A;  3H8J A;  4UD4 A;  2V4Q A;  3V6H A;  4I27 A;  4YR0 A;  4DSE A;  4DLE A;  5KFJ A;  5KFD A;  7ICV A;  4EYH B;  5DGA A;  4HYK A;  2ZUD A;  2KTQ A;  2R8J A;  1ZJM A;  5J2B A;  2PXI A;  3MDA A;  1NJY A;  3GIL A;  2BE3 A;  1ZQP A;  3ZDE A;  4R63 A;  2IMW P;  2ZJA A;  3KHG A;  4Z6D A;  5KT5 A;  3MBY A;  1PX5 A;  3KHR A;  1SZP A;  3HP6 A;  3M9O B;  7ICK A;  2DPJ A;  1HUO A;  3C18 A;  1LB2 B;  3QEA Z;  4DSJ A;  5HC9 A;  8ICI A;  3M9N B;  1ZET A;  4KN7 A;  4YVZ A;  2DRA A;  4F50 A;  2P66 A;  9ICA A;  4BWJ A;  2HVI A;  2ZUB A;  5J0U A;  2Q0Z X;  3FDS A;  1ZQX A;  3H40 A;  5KG5 A;  4Q43 A;  4EYI B;  1JQR A;  4RWP A;  3GQC A;  4FBT A;  5KFL A;  4MEY A;  3QZ8 A;  1TFY A;  4F4Z A;  1ZQY A;  2FMS A;  3RJE A;  4FHW A;  4E7X A;  4BXO B;  5J0O A;  5KG4 A;  1SKW A;  4RQ4 A;  4FO6 A;  2XGQ A;  1ZQJ A;  9ICK A;  5KFU A;  3OVA A;  4RUA A;  1SKS A;  4DWI A;  2F1J A;  4XQ7 A;  1N48 A;  3N4M B;  3OSN A;  1U45 A;  4DSL A;  4KLD A;  5DQI A;  2BHN A;  4WC7 A;  1CUK A;  4UBC A;  5DG8 A;  3V72 A;  4F5Q A;  4X4Q A;  4Z6C A;  3UPQ A;  3GV8 B;  1K1S A;  3UQ0 A;  8ICH A;  3OHA A;  2R8I A;  1NO5 A;  4QZF A;  7ICO A;  1RXW A;  7ICQ A;  4B9V A;  3RB4 A;  3M8S A;  1TFW A;  1XWL A;  2ZJ8 A;  3HJ4 A;  1K1Q A;  2BR0 A;  3RJF A;  5KT4 A;  4UAY A;  3GIM A;  1NK7 A;  7ICJ A;  5J2E A;  2C2E A;  8ICV A;  2I1Q A;  1MSW D;  2HHP A;  4XA5 A;  1Q79 A;  4FH5 A;  4ECU A;  3ISD A;  2NRZ A;  4PH5 A;  4B9S A;  5KFR A;  2ZTE A;  4EZ9 A;  2HHW A;  2VAN A;  2R8H A;  1Z00 B;  4GC6 A;  2M2V A;  3V7K A;  3AQK A;  5DQG A;  7ICH A;  4F8R A;  4TUQ A;  3K75 D;  4QZH A;  2M2W A;  4DSK A;  1QTM A;  3M8R A;  1UA1 A;  1T7P A;  2AQ0 A;  4DF8 A;  5CP2 A;  1F5A A;  7ICU A;  4O3N A;  5EOZ A;  4F2S A;  1Q78 A;  5J2F A;  4O5E A;  2BQ3 A;  1WCL A;  4DS4 A;  4F3O A;  1BGX T;  2KZZ A;  9ICM A;  3PML A;  4WC2 A;  4C8K A;  2DR7 A;  1MC8 A;  4ED8 A;  7ICF A;  4RQ0 A;  4B9L A;  1JN3 A;  3LQC B;  1BPZ A;  4EEY A;  5J2J A;  2AJQ A;  1S0V A;  4DF4 A;  3OJS A;  5KG3 A;  4BGD A;  5DQH A;  3RH5 A;  4ED6 A;  4KN4 A;  5D46 A;  2C2R A;  2PFO A;  4WC4 A;  1HJP A;  1X9S A;  4KLJ A;  4DQQ A;  2IA6 A;  4YXJ A;  8ICK A;  2DRB A;  4QW9 A;  2FMP A;  4IRD A;  2HVH A;  4UD5 A;  4B9N A;  5CR0 A;  4ECS A;  4RNN A;  4NLK A;  3PW5 A;  1BVS A;  2NRT A;  3PX4 A;  3WFS C;  5JUM A;  1D9F A;  3PY8 A;  4XRH A;  3Q8P B;  2AQ4 A;  1HUZ A;  5HRE A;  5KFM A;  1V4A A;  3OHB A;  5L9X A;  4X0B A;  2A1J B;  4KLO A;  3HT3 A;  4R64 A;  9ICX A;  4YQW A;  2ZHB A;  5J2C A;  2BPC A;  1D8Y A;  3HIY A;  1TVA A;  4E8F A;  2PFQ A;  4B9M A;  1WCN A;  4KLU A;  4YG2 A;  3M9M B;  4M47 A;  2NRX A;  4JWN A;  3FYH A;  5J0X A;  4YP3 A;  5DG9 A;  2NRW A;  5CHG A;  1MQ3 A;  1R8A A;  4RPZ A;  2J6T A;  2HHS A;  5C5J A;  4F4W A;  5KG7 A;  4ED3 A;  8ICO A;  3B0Y A;  4IG8 A;  4AT8 A;  4F91 B;  3BDP A;  3ETL A;  5D49 A;  5EWF A;  1X9M A;  2BCV A;  3AQN A;  5IIJ A;  3OSP A;  4M2Y A;  4X0A A;  2Y1I A;  1JIH A;  4R65 A;  4R66 A;  3G6Y A;  4F4Y A;  5DDY A;  2BDP A;  3E2E A;  5TZV A;  1R8C A;  1UEV A;  3ISB A;  2P6R A;  4GXJ A;  2PI4 A;  2MUT B;  4NM2 A;  5KFO A;  3PR5 B;  4M9H A;  1XU4 A;  3OGU A;  1UA0 A;  5HP4 A;  2NRK A;  1ZQL A;  1KDH A;  3AU2 A;  3V7J A;  3B0X A;  4RWN A;  2LYH A;  1BPX A;  4I2H A;  1N56 A;  4O5C A;  3ZD9 A;  3NGD A;  2KZM A;  1ZQT A;  3WFR E;  3RB3 A;  1ZQM A;  1S76 D;  4ED2 A;  4TUR A;  2ID1 A;  4F2R A;  4KLG A;  2VA2 A;  4WBY A;  1FA0 A;  4O3R A;  5CJ7 A;  3AU6 A;  5J0W A;  3RH6 A;  4K4G A;  3BQT A;  5HRK A;  4RPX A;  1ZQO A;  7ICR A;  4J9M A;  2ZH8 A;  3Q8M A;  4O5K A;  7ICN A;  8ICF A;  2W9C A;  1JX4 A;  5J2A A;  2BCQ A;  2KFZ A;  3PX0 A;  7ICI A;  3V6J A;  3AQM A;  1ZQK A;  2Y1J A;  4LZG A;  1KNY A;  7ICT A;  4KLM A;  3NTU A;  4DS5 A;  1D8L A;  4UBB A;  3HW8 A;  4ECY A;  4YMN A;  4YN4 A;  3GV7 B;  4ECX A;  4XQ8 A;  4RUC A;  4YD1 A;  5KFE A;  2HHX A;  3C2M A;  3T5J A;  3AUO A;  1S10 A;  4ELU A;  5KT2 A;  2BCU A;  4NXZ A;  5KT6 A;  2VA8 A;  2JZB A;  1XSN A;  3SYZ A;  4ECQ A;  4DQI A;  3RRH A;  4J9S A;  5F2V O;  4K4I A;  3MGH A;  4YD2 A;  5J0Q A;  1ZQU A;  2A1J A;  3RTV A;  3H8W A;  4RQ7 A;  3MR3 A;  3RJH A;  5HRD A;  4WC5 A;  1COO A;  1L3U A;  1KFT A;  1KLN A;  4DFM A;  4I2B A;  1U47 A;  1TK8 A;  3MFH A;  4X4T A;  8ICT A;  2BPG A;  3H7I A;  2V9W A;  2JEF A;  1A76 A;  5KFA A;  2AGQ A;  3RAQ A;  3H37 A;  3C2K A;  4P4P A;  1XSP A;  9ICE A;  2ALZ A;  1S0M A;  3OJU A;  4EBJ A;  2V4R A;  4RT3 A;  1SL2 A;  4X4U A;  4F5P A;  4DQR A;  3JPN A;  3PW0 A;  4P4O A;  4ED1 A;  5IIM A;  8ICE A;  4FBU A;  5KFZ A;  4KLL A;  4GXK A;  4AT8 B;  3RB0 A;  2BCR A;  2VA3 A;  9ICW A;  3AQL A;  2ZTC A;  4YMM A;  4ED7 A;  2R8K A;  2MUT A;  4ECR A;  1QSS A;  7ICL A;  9ICT A;  5KT3 A;  3PNC A;  1ZQV A;  5BPC A;  4RZR A;  1KEJ A;  2FPL A;  2ZH1 A;  2B21 A;  7ICP A;  4BDP A;  4I2E A;  1NK8 A;  3SV4 A;  2UVU A;  4QZA A;  4KLE A;  5J0S A;  3KHH A;  4I2C A;  8ICC A;  3PVX A;  8ICN A;  9ICL A;  3SV3 A;  4F5R A;  4QZB A;  4O3S A;  4KTQ A;  2M2T A;  2UVW A;  2ZTD A;  2ZH9 A;  4LVS A;  2IHM A;  4UQG A;  3RJG A;  4X4S A;  4YR2 A;  1L3S A;  9ICJ A;  2ZHA A;  4QZI A;  2M9N A;  2HHQ A;  9ICP A;  3EPI A;  5KG0 A;  1ARO P;  1XS9 D;  9ICO A;  2W8K A;  1ZQB A;  4GC7 A;  4F4K A;  5KFF A;  1XSL A;  4B9T A;  1KSP A;  1RPL A;  3PMN A;  4C8M A;  5KTQ A;  4FS2 A;  4BWM A;  2BPF A;  2DR5 A;  1SKR A;  2W9C B;  4NKT A;  4J9K A;  5DB6 A;  4C8O A;  4J9N A;  1UEU A;  4B9U A;  4WC1 A;  3TFS A;  4DEZ A;  4PGQ A;  5J2H A;  1S9F A;  3LK9 A;  3QE9 Y;  4DFK A;  2C22 A;  4J9P A;  1T4G A;  2NRV A;  5DB7 A;  5KFS A;  4TUP A;  1TK5 A;  1ZQS A;  4M9L A;  4WC3 A;  4PGY A;  5L1L A;  1D9D A;  4M9G A;  1TV9 A;  2PBE A;  3OV7 A;  3N97 B;  2PFN A;  2R8G A;  4UAW A;  2W9B A;  2AU0 A;  3QZ7 A;  1S0O A;  2XY5 A;  3TAR A;  5KFK A;  3THV A;  1KRP A;  2JZB B;  3KTQ A;  5KFG A;  3Q8R B;  4JWM A;  5L1I A;  1IXR A;  2ZH6 A;  4QZ9 A;  3HJ1 A;  5J2I A;  2JEG A;  8ICB A;  7ICS A;  4LT6 A;  4EBK A;  4RWQ A;  3C5G A;  1CEZ A;  2RFF A;  3MR5 A;  2W8L A;  1R8B A;  1NK9 A;  2F1I A;  2W9M A;  5KFP A;  4DOC A;  4R8U A;  3JPT A;  4O3Q A;  5J2D A;  4QZ8 A;  4KLS A;  2ISP A;  1YLQ A;  4UB1 A;  2MAX A;  3H4B A;  5KG1 A;  3RB6 A;  1KFD A;  4QWC A;  5III A;  2UVV A;  3HX0 A;  1S0N A;  4NLN A;  2XO7 A;  4EBD A;  3GFK B;  5HRB A;  4LZD A;  3V6K A;  2GWS A;  1T8E A;  2FPM A;  3C1Z A;  4IR9 A;  4IQT A;  3MAB A;  4FH3 A;  2DVI A;  3WFQ E;  4WC6 A;  4DL7 A;  8ICM A;  9ICF A;  8ICU A;  2ATL A;  5DGB A;  4CCH A;  3IHQ B;  8ICY A;  5HRI A;  3H3A A;  3PR4 A;  3MFI A;  4IRC A;  2BCS A;  4QW8 A;  4DQP A;  2RDI A;  5J2G A;  2ASJ A;  5J2K A;  3H8S A;  1H38 A;  1IM4 A;  3HPO A;  3UXN A;  3UPS A;  8ICS A;  4Z6E A;  5J0P A;  2FPK A;  4M9N A;  1JXL A;  2BKE A;  5DB9 A;  1NK4 A;  4YMO A;  3WFO A;  5DBC A;  5KG6 A;  4EBC A;  4RQ1 A;  4YXM A;  3JPQ A;  5D4B A;  4G3I A;  1EXN A;  4EP7 A;  3WFP A;  4JUZ A;  4ECW A;  5IIN A;  2FLL A;  4ELV A;  4X5V A;  4PHE A;  1NK5 A;  4QZG A;  4RU9 A;  7ICE A;  8ICJ A;  4DL4 A;  4JK1 A;  5KFX A;  5DLG A;  4KLQ A;  9ICN A;  1JXE A;  3JPR A;  2AGO A;  1KTQ A;  1U4B A;  1NKC A;  2HW3 A;  4MFC A;  2ZH7 A;  1BPB A;  4IQU A;  5F9L A;  2DPI A;  4O9M A;  3MDC A;  4PPX A;  1B43 A;  4PHP A;  4KLF A;  2HHV A;  1JMS A;  8ICW A;  1ZQF A;  2C28 A;  4NY8 A;  1Z3E B;  4NM1 A;  2KZ3 A;  1U49 A;  4MF8 A;  4JV0 A;  2DFL A;  1ZQR A;  1NOM A;  5EWG A;  3TI0 A;  3EZ5 A;  4F5N A;  2IBK A;  4I28 A;  3T5K A;  1DGS A;  3PW4 A;  1T3N A;  4MFA A;  8ICZ A;  1BPY A;  2ZH5 A;  1BPD A;  4ECZ A;  4TQS A;  4RT2 A;  5EWE A;  2XCP A;  1VJ7 A;  2C2D A;  2W9B B;  4O0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...