2VANA

Nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
245
structure length
240
Chain Sequence
b'DDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLQPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERSE BETA
publication title Mismatched Dntp Incorporation by DNA Polymerase Beta Does not Proceed Via Globally Different Conformational Pathways.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 82
structure length 240
sequence length 245
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2vanA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2vanA03
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2vanA02
2BDPA 4NKUA 4X4UA 2BR0A 3JYYA 4ECQA 1T3NA 2I9GA 4QZFA 1S9FA 4B9MA 2IMWP 4F8RA 1KSPA 4DO9A 1XSNA 1TKDA 2FMPA 2FLLA 4KLDA 2HHUA 2KZZA 5J29A 3AU2A 2DR5A 5KFMA 5EWGA 2M9NA 3C2LA 1XC9A 9ICSA 5J0YA 4UAWA 3PO4A 3ISDA 3PW4A 8ICXA 1F5AA 4P2HA 2C22A 3RAXA 4KN4A 4M6WB 1D9FA 4M9GA 4KLIA 1D9DA 4KLUA 1U49A 3UXNA 2BGWA 4TQRA 1XSPA 4I29A 5F9LA 2ATLA 9ICBA 1NJZA 5KT6A 1JAJA 4RNNA 2R8IA 3RJHA 4O0IA 4O5EA 2KFNA 4ED0A 5J0WA 4M9NA 1JMSA 4F92B 2BQUA 2AQ0A 4C8KA 3GV5B 4KLHA 1U48A 2RFFA 1XWLA 4KITB 5J2DA 1SKWA 4CCHA 4Z6DA 4PGYA 1ZJMA 4MFAA 5KFBA 3UPQA 1U45A 3UQ0A 5DQIA 1ZQFA 4E80A 3RB3A 4UD4A 4F5QA 5KFPA 5HREA 1ZQCA 4YMOA 1ZQEA 5HRBA 3JPNA 7ICRA 4DSIA 2PI4A 1NKEA 8ICQA 3WFSC 1N48A 1EXNA 3AU6A 4DQSA 2R8JA 2F1JA 4ECTA 4M47A 2JZBA 3LDAA 3PR5B 2HHTA 1TK8A 4TQSA 4MEYA 4QWCA 3QZ8A 2LYHA 4GC6A 5J0UA 5HP4A 5DDMA 2R8KA 7ICSA 3HJ4A 3C1ZA 3M8SA 3HJ1A 2W9BB 3H8SA 5EOZA 3L9DA 2ZJAA 1PX5A 2PI5A 8ICRA 5HR9A 1SL2A 1YLQA 3Q8KA 4NM2A 3UXPA 1ZJNA 4FH5A 5IIJA 4PHAA 3IHQB 3H4DA 2BCRA 1NK9A 4PHDA 5F2VO 5J0QA 4YR3A 1BPDA 2ID1A 2J6TA 4I2FA 3PW5A 3GIIA 9ICTA 3GDXA 3C21A 5DGBA 5D46A 4P4PA 2Y1JA 4X0AA 4IQUA 3PW2A 5KFYA 3H3AA 2UVWA 9ICVA 2ZH2A 5J2BA 4R64A 4WCWA 4ZH4A 5L1LA 4RQ2A 4QZAA 2XC9A 7ICFA 1MSWD 1MIVA 2W8LA 2JEJA 4BWMA 3NGDA 3EWAA 4R8UA 4F5NA 2O5AA 1TAQA 1Z00A 1KNYA 4DFMA 9ICLA 4FHWA 4XQ7A 3HPOA 1ZQQA 2ASLA 1T7PA 4UAZA 2O1PA 3H4BA 5KG2A 2BQRA 4RZRA 3RR7A 5L1JA 1N56A 1L3SA 5DG7A 2ZH4A 1NK6A 4BGDA 4YVZA 3JPPA 5DG9A 4J9PA 8ICCA 5KG5A 4YD1A 4QZ9A 7ICVA 4ECYA 2JEGA 1SZPA 4EBDA 3TFSA 3KHRA 4NLGA 4YXJA 3ETLA 2FPLA 1SL1A 8ICTA 3RH5A 3BJYA 1ZQIA 2Y1IA 3SYZA 4UB4A 1ZQPA 4X0BA 4XQ8A 4B9LA 5JUMA 2BE3A 4RQ6A 4QWAA 1NK0A 4YQWA 1Y88A 4IR1A 4XA5A 4AT7B 3GQCA 4LZDA 4FBUA 8ICZA 3ZD8A 4GLXA 3SV3A 4C8LA 3FYHA 1SKSA 4DOBA 4F5RA 4DL5A 2FLNA 2ISOA 4DL2A 4RNMA 2ASJA 3AUOA 4J9QA 1XU4A 2M2TA 5KG1A 3MBYA 3GV7B 4RWPA 2FLPA 2ZUDA 2NRZA 5J0RA 4B9SA 4X4VA 4XRHA 5KG6A 3G6XA 4JK1A 4DSLA 4DFKA 2MAXA 5J2JA 2KZMA 4S3NA 5KG0A 4FH3A 2PXIA 4J9RA 4I2IA 5HMLA 1JXEA 4YXMA 4MEXA 4DF4A 1MC8A 4C8MA 4O3OA 8ICLA 2R8HA 4FHVA 8ICKA 4E7XA 1TV9A 5HRHA 5DBAA 4Q43A 4I2BA 7ICUA 7ICHA 2FPKA 5KFGA 5KFRA 3ZDAA 5KT5A 4DL6A 4X4SA 8ICIA 3OUYA 1JQRA 4UB3A 3THVA 1ZQWA 4QZCA 4ED2A 1ZQOA 1TAUA 1NOMA 3Q8SB 3GIKA 4EBKA 4BXOB 1Z00B 5KFWA 3M9OB 3OSPA 1S97A 5KFUA 4QZGA 4RU9A 4TUQA 2C2DA 4NLKA 9ICJA 5KFFA 4DOCA 1VFGA 1AROP 4O5CA 7ICPA 2XCPA 3WFOA 5CR0A 1V4AA 1ZQNA 3LWLA 1CEZA 5KFAA 4I2GA 8ICVA 2ZHAA 1KFTA 3TAQA 3H7IA 9ICCA 3RR8A 4AT8A 4J9KA 1Z3EB 3JPSA 3BQTA 5HRIA 1UA1A 4JUZA 8ICUA 2V4RA 2P6RA 1ZQKA 4RUCA 4LZGA 2VA8A 1S77D 9ICHA 2XY6A 9ICAA 3OVBA 7ICLA 3HW8A 1X9MA 1L5UA 5CHGA 7ICQA 1B22A 3GFKB 4Q8FA 1S76D 3ZDCA 9ICOA 4AT9B 4QZDA 5HNKA 1RYSA 1S0VA 5KFJA 2GWSA 5KFZA 4NM1A 9ICMA 4DS4A 5DQGA 5HMMA 4PHPA 4UB2A 5HRKA 3UPSA 4YR2A 4KLTA 3M9NB 2ZH1A 5DDYA 1BPXA 1PZNA 5J0XA 4PGQA 4QZEA 3Q8QB 4MF8A 4O5KA 3Q8MA 5DB7A 5CB1A 1ZQJA 8ICAA 1KDHA 4IQTA 3QEBZ 2JEFA 3OJUA 9ICXA 5KG4A 5HRLA 2DVIA 2BPFA 4KLQA 2A1JA 1QSYA 4NKTA 1ZQLA 2IBKA 3C18A 2JEIA 4X4NA 4RQ0A 5CJ7A 4KLJA 5HRFA 2BPCA 4Q8EA 7ICIA 1R8BA 5D4BA 1TFRA 1JN3A 3C23A 3B0YA 5DB8A 3ORYA 4RQ3A 5J2IA 3RBDA 4KLLA 7ICMA 4X4RA 5J2KA 2ZJ8A 3HWTA 1NK7A 3KHLA 2W9CA 3V6JA 4I28A 3EZ5A 5CA7A 4DQIA 3MABA 1MQ2A 5D49A 2ASDA 5KT4A 3C2KA 5KFDA 2XGPA 3UXOA 3H38A 3T5KA 1D8LA 4QW9A 4RT2A 5HHHA 1MIWA 2PFQA 1S0MA 4IRCA 4UAYA 4IQVA 4QWEA 4F4XA 4DQRA 5DGAA 1ZYQA 4ECRA 4DS5A 5IILA 1QTMA 9ICUA 4WC4A 2RDJA 3M9MB 2W9AA 8ICFA 3H39A 5DQHA 1IXRA 3OSNA 2B21A 2AGPA 8ICNA 4X4PA 3K4GA 4M9LA 4ECZA 2DR9A 1ZQHA 4YP3A 4J9NA 3TANA 3MR3A 4I2JA 4IRKA 1T4GA 1RPLA 5BPCA 4DLEA 4EEYA 4I2EA 9ICGA 4DQQA 1DGSA 5KFHA 3PVXA 4RWNA 1A77A 3C1YA 5HRDA 2HHQA 3UQ2A 1Q79A 1K1QA 1KRPA 3Q8PB 2XCAA 3RJFA 4ED3A 4ED6A 4F4KA 4R63A 1ZQXA 3BQ1A 2DPIA 4FBTA 2V9WA 4ECXA 2BCQA 4UD5A 4ECUA 3PO5A 4RPZA 1V9PA 4BWJA 4R65A 2KN7A 3H8WA 3OJSA 2KZ3A 3GV8B 5L1KA 3PW7A 4YCXA 4I2HA 2KTQA 1MIYA 1U9LA 2HHVA 4RQ7A 5DECA 3JZ0A 1HUZA 3N97B 1ZQGA 1ZQZA 8ICGA 1DOQA 2F1HA 3C5GA 8ICHA 3WFPA 2DRBA 2A1JB 2BHNA 3MR2A 1TK5A 5KFCA 5CP2A 4IQWA 3OV7A 2DR7A 2JZBB 4YN4A 3ISCA 2WTFA 8ICBA 4F3OA 1NK8A 1HUOA 5J0TA 3GIMA 4ED8A 4YD2A 4EP7A 4QZBA 1L3TA 3PV8A 5KG3A 1KLNA 1ZQUA 2DRAA 2FMSA 1BPYA 5DBBA 2W9CB 3AQKA 4ECSA 4M6WA 3JPTA 2ZH9A 4I2DA 3HT3A 3PX6A 4P4OA 3MR5A 4FS1A 1VJ7A 5DB9A 2FMQA 4GXIA 3WFRE 5J0SA 4KMUA 4ELTA 3TFRA 8ICJA 2DR8A 3SZ2A 4M9JA 4TUPA 3RJJA 7ICKA 4F5OA 1QSLA 1Q78A 3FDSA 1XSLA 4WC6A 9ICQA 8ICOA 3RJEA 3H8JA 4K4HA 1UT8A 4DSFA 4M0AA 4KLFA 4TUSA 8ICWA 4GXKA 1ZQDA 4QZHA 4KN7A 4B9NA 2ZTEA 4X5VA 3ZDEA 3SI8A 3M8RA 2J6SA 4IRDA 5KT2A 3RBEA 3HX0A 1KFDA 5J2FA 3B0XA 4R8UB 2AGQA 2C2EA 3RRHA 5KFVA 1RXVA 3RB4A 1QSSA 2V4QA 2IHMA 2IHNA 2ZH5A 2XO7A 4EZ6A 2ZH8A 2J6UA 3LQCB 5C5JA 3EPGA 4F50A 4ECVA 1LB2B 3HIYA 5DBCA 4X4OA 4P4MA 9ICKA 4M5DA 3AQNA 4RWQA 3JPQA 4DFJA 1UT5A 2HHXA 4M04A 4WC0A 4ATBA 9ICEA 4MFCA 2RDIA 4O9MA 3NTUA 4QW8A 3T5JA 1NJWA 3WFQE 2PFNA 3JPOA 2C28A 4DL3A 1NK5A 1S10A 1RXWA 3RRGA 7ICJA 3MDAA 4RPXA 4JWMA 9ICNA 7ICTA 2BCUA 4RQ1A 3LWMA 4ED7A 9ICPA 1BPEA 2XGQA 3NYBA 3C5FA 5KFTA 5TZVA 5J0OA 4R66A 4DEZA 3C2MA 3BQ0A 1TVAA 1UA0A 1S0NA 3BDPA 3H37A 2W9BA 4WC5A 2NRTA 4ELVA 5HRGA 3RJKA 3V6HA 3EW9A 4NXZA 5L1IA 2FPMA 4O3NA 1ZQMA 4PGXA 4DLGA 3OVAA 3PNCA 3AQMA 1H38A 1BVSA 1UEVA 4X4TA 4F2RA 5J0PA 1C7YA 2HVIA 4IG8A 5EWFA 1ZQYA 1MQ3A 2F1IA 4DFPA 3K75D 1HJPA 5IIOA 5CWRA 2VANA 2NRWA 5L9XA 3QEAZ 4F2SA 2MUTA 4K4IA 2XY5A 3RB6A 2ZH6A 2BCSA 1BGXT 1ZETA 3T3FA 7ICNA 1XO1A 3V7LA 1KTQA 4F4YA 4BDPA 5IIKA 5BOMA 3G6YA 5BOLA 7ICGA 5KFLA 2Q0ZX 3KHHA 4M9HA 2P66A 4KLGA 1U4BA 4J9LA 2BQ3A 4C8OA 4KTQA 9ICFA 5HHIA 4O3SA 3EYZA 4EYIB 2HHSA 4YFKA 4E0DA 1UETA 5KFNA 4J9SA 1T8EA 3MFIA 1ZQSA 4J9OA 3PR4A 4DSKA 4MFFA 4NLNA 4GXJA 1JX4A 4PH5A 7ICOA 3OUYB 3OHAA 4YMNA 4RQ4A 5DLFA 2ALZA 5IIMA 3V7KA 4EBJA 4NLZA 5J2AA 4PPXA 4PHEA 4G3IA 2M2UA 1BPBA 4RPYA 3ISBA 2PFOA 1RYRA 5DKWA 4RNOA 2R8GA 1R8CA 8ICPA 2PBEA 3PMLA 2UVRA 2HVHA 3TQ1A 4DSJA 2ZUCA 4FHYA 3ZDBA 4Q45A 1X9SA 1OU5A 4ATBB 4AT7A 3QZ7A 3MGHA 2ZTCA 4GC7A 1KFSA 4K4GA 4UQGA 2M2WA 1QLNA 1D8YA 4F91B 4LVSA 3OHBA 1S0OA 5DB6A 2NRKA 4AT8B 5HC9A 4WBYA 5KFEA 2ZJ5A 1ZQTA 2W9MA 3PMNA 2ZHBA 1WCNA 4DQPA 4UB1A 1R89A 3TARA 9ICIA 4RT3A 4DOAA 2ZH3A 5J2HA 8ICSA 2UVUA 3GIJA 4DF8A 4EZ9A 8ICMA 1COOA 2NRVA 2P6UA 3RTVA 8ICYA 4UBBA 4Z6EA 2VA2A 5EWEA 1X9WA 5J2CA 3GILA 2M2VA 4YMMA 1NJYA 3LK9A 3N4MB 4QZIA 4FO6A 5KFKA 1RZTA 3PX0A 1K1SA 4YR0A 2MUTB 2AGOA 3Q8LA 1SKRA 2PFPA 9ICRA 1UEUA 4QZ8A 5KT3A 1NO5A 5KFSA 2OWOA 3AQLA 4I27A 4HYKA 3V6KA 4B9VA 2IA6A 5KFXA 1TFWA 4JV0A 4DWIA 3MDCA 3ZDDA 4KLOA 4KLSA 1BPZA 4E8FA 3MFHA 4BXOA 7ICEA 4C8NA 5KFIA 1CUKA 2ZUBA 1A76A 3RH4A 4F5PA 3RJGA 4ED1A 2BKEA 4DL7A 3PW0A 3OGUA 4UBCA 5KTQA 3T5LA 1L3VA 4I2AA 4WC7A 1WOTA 4RWOA 4XUSA 4RUAA 4DL4A 1B43A 3SV4A 2NRXA 4MF2A 4B9TA 3QE9Y 4F93B 1NJXA 4KLEA 4FHXA 2AU0A 1ZQRA 4RQ5A 3V72A 2ZTDA 3RAQA 3H40A 3G6VA 1XS9D 2VA3A 4JWNA 5DG8A 4EYHB 5J2GA 3PY8A 5F9NA 4WC3A 1TFYA 5IINA 3PX4A 5DLGA 3IM1A 1TK0A 4EBEA 4O3PA 4FS2A 3JPRA 3T5HA 4F4ZA 3RJIA 3RH6A 1NK4A 1ZQAA 2DPJA 1R8AA 2KFZA 3KHGA 4ELUA 3C66A 4AT9A 3RB0A 1JXLA 3Q8RB 4I2CA 5KFQA 4NY8A 2XY7A 3BQ2A 4EBCA 2C2RA 1WCLA 1SL0A 5KT7A 1L3UA 2W8KA 3HP6A 4M2YA 2DFLA 5KFOA 2HHPA 2I1QA 4FHPA 4WC2A 2AQ4A 2ZH7A 4RQ8A 4KLMA 3OVSA 1ZQVA 2ISPA 5J2EA 4QWDA 3MR6A 1FA0A 4TURA 1NKBA 3MGIA 5IIIA 4QWBA 4F4WA 4B9UA 4DSEA 4O3RA 3ZD9A 1KEJA 1JIHA 1IM4A 3TI0A 2BPGA 1LV5A 4IR9A 8ICEA 1X2IA 4Z6FA 9ICWA 2AJQA 5DEDA 4X4QA 4YG2A 2HHWA 2H5XA 5KG7A 4Z6CA 3E2EA 1U47A 4WBZA 2HW3A 4UB5A 3EPIA 4O3QA 2UVVA 3KTQA 4LT6A 4JV1A 1ZQBA 2BCVA 4J9MA 2Q66A 4ECWA 3V7JA 1NKCA 4JV2A 3TAPA 4WC1A 4Q44A
chains in the Genus database with same CATH superfamily
4Y2YA 2F44A 3VC8A 1XSNA 4KLDA 3AU2A 2M9NA 2K8BB 5J0YA 4C7ZA 5B66U 2C22A 5FP0A 4KN4A 2FDRA 4M6WB 3RAXA 1PK3A 3UXNA 3RJHA 2YTUA 3BS7A 4M9NA 1JMSA 2BQUA 2AQ0A 4KLHA 3JCFA 5J2DA 3ETRA 5J8YC 5J8YA 1U45A 2JV3A 3UQ0A 5DQIA 5ALOA 2A3VA 5HR7A 1ZQCA 4DSIA 3BZCA 2PI4A 3QUCA 2QB0B 4OCZA 1DRGA 3AU6A 4DQSA 2F1JA 3LDAA 4TQSA 2R8KA 1ZOLA 3HJ4A 2ZJAA 1OUQA 1PX5A 2DKZA 3AEVA 4WQKA 1DGJA 4FH5A 4YR3A 3SQIA 3ONNA 4I2FA 3PW5A 3GIIA 5TISU 3MGVA 3HKZC 3PW2A 3O0FA 2W04A 4ZH4A 2AHOB 3BS5A 2HOIA 5L1LA 4QZAA 2XC9A 4ZOHC 7ICFA 1MIVA 2JEJA 4BWMA 3NGDA 3EWAA 4R8UA 2O5AA 1TAQA 2W54A 1NZBA 1T7PA 4DCCA 2O1PA 5KG2A 3KD3A 4WQLA 2PKEA 4J9PA 4QZ9A 1Q3UA 1SZPA 4EBDA 3TFSA 1WYGA 1ZQPA 3MC1A 1KQQA 1Y88A 4XA5A 3WKBA 2D6FC 3GQCA 4LZDA 4FBUA 1YZ6A 4C8LA 3FYHA 3ICXA 3TACB 4DL2A 4RNMA 3AUOA 5KG1A 5E79U 2NRZA 4JK1A 2KZMA 4DFKA 2MAXA 4NLBA 2PXIA 4J9RA 4I2IA 1JXEA 5HR6A 4YXMA 4MEXA 2KJ5A 4PZNA 3KKAC 3KKAA 3UMGA 8ICLA 2M0NA 4PL1A 4I2BA 2FPKA 3ZDAA 3NVYA 3THVA 1ZQWA 4QZCA 1ZQOA 3PSTA 4U6PA 5B3PA 5KNIA 5KFUA 4TUQA 2C2DA 4DOCA 2EWRA 1ZQNA 1F0MA 3LWLA 1TE2A 1RYUA 2ZHAA 4OJ5A 5ALRA 4AT8A 2FI1A 2NV3A 3D2SA 3BQTA 5HRIA 8ICUA 2V4RA 2P6RA 1ZQKA 4RUCA 9ICHA 2XY6A 1PK1B 4Q8FA 4QZDA 5HNKA 5HMMA 4PHPA 2ESEA 1JI7A 1BPXA 5J0XA 4O5KA 3Q8MA 1KDHA 2KIWA 3QEBZ 3WU2U 2EZYA 1QSYA 5CJ7A 3PHZA 4AYBC 5D4BA 1TFRA 1JN3A 3B0YA 3ORYA 5J2IA 2G5HB 5J2KA 2VJ5A 3R9KA 3HWTA 1NK7A 3EZ5A 5D49A 5KT4A 2KK0A 5KFDA 3UXOA 3T5KA 4QW9A 2YB4A 4F4XA 5DGAA 1F5SA 5AM5A 1QTMA 5IILA 3M9MB 3H39A 4NL9C 3RFAA 2B21A 4X4PA 4M9LA 1ZQHA 5AM4A 2N1RA 4I2JA 2ZIXB 1RPLA 1WWVA 4DLEA 4I2EA 2WB1C 1S5LU 4DQQA 3C1YA 3UQ2A 1Q79A 1K1QA 3E58A 1KRPA 2XCAA 1JALA 1DXSA 4FBTA 2V9WA 2BCQA 1QQ6A 3OJSA 1Z1VA 4RQ7A 1ZQGA 1ZQZA 2WHEA 2KSOA 2WF8A 4OJOA 1TK5A 5D63A 3ISCA 4F3OA 1NK8A 5J0TA 1FEZA 3GIMA 3PV8A 5KG3A 4JLZA 2W9CB 2KHQA 4M6WA 3JPTA 3MR5A 3U26A 4FS1A 1UQVA 4LEYA 4PZOA 4TUPA 3RJJA 7ICKA 4EEDA 2EAPA 4NXWA 3NUQA 9ICQA 2LKYA 1F44A 4K4HA 1UT8A 2JXJA 4GXKA 4QZHA 4KN7A 3RBEA 5J2FA 4O67A 5L1MA 3RRHA 4EZ6A 4X4OA 4ECVA 3SR6A 1FIQA 4P4MA 4HX0A 9ICKA 4M5DA 3AQNA 2QB0A 4DFJA 1C20A 9ICEA 2RDIA 4MKPA 3HRDD 7ICJA 2E8MA 4ED7A 4LEWA 1BPEA 2A19A 5KFTA 5TZVA 5J0OA 3C2MA 1S0NA 3H0LB 1SWWA 2W7OA 4ELVA 5HRGA 4EEBA 3V6HA 3WK5A 4O3NA 4PGXA 3AQMA 1C7YA 4IG8A 2VANA 2ZH6A 3SMVA 5ALZA 7ICNA 1XO1A 2HOFA 3S6JA 3I1YA 2AH5A 5BOLA 5KFLA 1L8OA 2Q0ZX 5AIBA 9ICFA 2E1EA 1U4BA 4J9LA 1HEKA 4O3SA 3EYZA 1ZQSA 4MFFA 3NWIA 4USAA 4PH5A 3OHAA 1X9XA 5DLFA 2NYVA 4KX3A 3KZIU 3V7KA 4EBJA 4NLZA 3CYMA 4PPXA 4RPYA 2YMPA 4RNOA 3IN5A 2ZIUB 4C4TA 3TADC 3WK7A 2H3FA 4QNLA 5KAFU 3D2QA 2KMDA 2F76X 4F91B 5DB6A 2E8PA 2P35A 4WBYA 2ZJ5A 3C29A 2Z7JA 2ZHBA 3GZFA 5ALYA 4UB1A 2ZH3A 2NRVA 4UATA 8ICYA 4Z6EA 2VA2A 2IUBA 2R18A 4FO6A 1K1SA 4YR0A 1SKRA 3QX7A 3Q8LA 2HCFA 1NO5A 4C0ZA 2G0AA 4HYKA 2VKQA 5KFXA 4JV0A 4E8FA 3MDCA 7ICEA 1PVQA 1DK2A 4I2AA 2OM6A 2EANA 2GAFD 3V72A 5AI5A 1IV8A 3RAQA 1ZD5A 4EYHB 4WC3A 3KZXA 5AK6A 2B56A 5ALGA 3PX4A 1TK0A 3GU3A 4EBEA 1NK4A 4FS2A 2ID1A 1PK1A 1R8AA 2IOFA 1WWUA 1JXLA 5KFQA 1WCLA 4FHPA 1SXEA 2W8KA 3HP6A 3CNHA 2I1QA 3N7SC 1FA0A 4TURA 4F4WA 2H3ZA 1IM4A 4IR9A 5JTGA 3WK6A 2H5XA 2DUYA 1U47A 3SD7A 2HW3A 3ALRA 1COKA 4O3QA 4NLCA 3KTQA 4LT6A 1L7MA 1OXJA 1X42A 1NKCA 5EE0A 3TAPA 4PHDA 3JPQA 4NKUA 4ECQA 1V38A 1T3NA 4QZFA 1S9FA 4B9MA 2GA9D 2HHUA 4OAGA 2HOQA 1Z4OA 5KFMA 1XC9A 4UAWA 3ISDA 3WKEA 1D9DA 1T3QA 1U49A 2LPEA 4TQRA 2LBOA 5KL1B 2ZIXA 4MHVA 4RQNA 4RNNA 2R8IA 1IIPA 3F2DA 5CFTA 1U48A 1XWLA 1ZD2P 4KITB 1SKWA 2BBHA 4PGYA 4MFAA 3UPQA 4E80A 3RB3A 3EUB2 3QYPA 1ZQEA 3JPNA 2KE7A 1NKEA 3WFSC 4M47A 1TK8A 4QWCA 7ICSA 5J0UA 5DDMA 2YMMA 1HIWA 3HJ1A 5EOZA 4IC9A 5AKGA 8ICRA 4F71A 5HR9A 3IP4B 3UXPA 1ZJNA 5AM1A 2KD1A 5F2VO 3H4DA 1NK9A 3C21A 4IQUA 1X40A 1SXDA 2UVWA 3LVWA 4RQ2A 4UB8U 4US8A 3QU7A 1MSWD 4F5NA 1Z00A 2YMLA 4DFMA 4XQ7A 3HPOA 1ZQQA 2BQRA 1Z4NA 2KIVA 5L1JA 1L3SA 3QU9A 5DG7A 1NK6A 2ZH4A 4YD1A 4LEVA 4NLGA 3ETLA 1LKYA 2XI9A 5H2FU 3BJYA 3AN1A 4UB4A 2BE3A 4QWAA 2W3RA 1MA7A 2WF7A 3ZD8A 2FLNA 4DOBA 2F8KA 1XU4A 2NO5A 4NV0A 2ZUDA 5KG6A 3G6XA 3K1RB 4AP9A 5HMLA 3H8MA 1FFVA 2W43A 4FHVA 1CI4A 3F2CA 4E7XA 7ICHA 3MCRA 3SAFA 2FJ6A 8ICIA 4KX5A 1TAUA 4EBKA 3Q8SB 2EAOA 2JH1A 4QZGA 2RLTA 4RU9A 9ICJA 2LMRA 5KFFA 2ZIUA 4O5CA 7ICPA 3WFOA 5CRXA 2H3VA 1UA1A 4JUZA 1S77D 2VA8A 3HW8A 1X9MA 1L5UA 5CHGA 1B22A 9ICOA 1PUZA 2KVSA 1RYSA 5KFZA 4NM1A 1X66A 5DQGA 4YR2A 3NRZA 3Q8QB 5DB7A 1ZQJA 8ICAA 1JROA 5EE9A 4IQTA 9ICXA 1ZD4A 3SENA 4QIWF 2JEIA 1JRPA 1SGGA 4KLJA 4Q8EA 2D3DA 5A0LA 7ICIA 1CRXA 4RQ3A 7ICMA 4X4RA 2ZJ8A 5CA7A 5AI8A 1MQ2A 3AQFA 2XGPA 2WF5A 3QNMA 4OJLA 4U7CA 2KEYA 1S0MA 5AHXA 4WC4A 3H0MB 2W9AA 3CP8A 1IXRA 8ICNA 2DR9A 1UHUA 4G9BA 3NASA 2JMGA 1T4GA 5BPCA 4Y2QA 2W7PA 3PVXA 3QU2A 3AL0B 4JLXA 2QKQA 5CFUA 4ED3A 2KJ8A 4F4KA 4R63A 1Z19A 1GPJA 3BQ1A 4FO1A 4BWJA 3GV8B 5L1KA 2KTQA 3UMCA 5T14A 3F5EA 1DOQA 3C5GA 1T94A 2OCEA 3WFPA 2A1JB 2GH1A 3IV6A 3OV7A 2XIDA 8ICBA 1HUOA 2K4IA 2G09A 1XNSA 1L3TA 2F2AB 1ZQUA 2DRAA 5DBBA 4US9A 4ECSA 4P4OA 2FMQA 4OAIZ 5J0SA 3TFRA 3SZ2A 2HMXA 4M9JA 3K1ZA 1QSLA 3HJEA 3FDSA 1XSLA 3RF9A 8ICOA 4M0AA 2IHOA 4OO1J 3PSIA 2ZTEA 4X5VA 2J6SA 3SI8A 5KT2A 2F77X 3HX0A 3B0XA 2AGQA 1RXVA 3NRWA 4O68A 2ZH5A 2IHMA 4UARA 2RP5A 1MN8A 3HIYA 5DBCA 4GFJA 4RWQA 4EX7A 1UT5A 2E8NA 4ATBA 5AKEA 4O9MA 5ALWA 1M6YA 1NJWA 4Y2SA 1S10A 1NK5A 5CEHA 1A6SA 3C5FA 4DEZA 3BDPA 5AI6A 1AQ6A 2NRTA 3EW9A 2L5YA 2ES6A 4DLGA 1ZQMA 4CF3A 1BVSA 1UEVA 2ZXHA 4P0QB 3M1YA 5EWFA 2CRXA 4Y2JA 1HJPA 3QEAZ 2NRWA 4F2SA 4K4IA 2MUTA 1VLBA 2OYYA 2BCSA 1BGXT 1ZETA 3T3FA 5AI4A 5IIKA 5BOMA 4M9HA 4KLGA 2BQ3A 1A0PA 4EYIB 4K9BA 4YFKA 4J9SA 3HKZF 4GXJA 7ICOA 3NVWA 5JRTA 5IIMA 2E3TA 2KICA 1ZD3A 2PFOA 1R8CA 5DKWA 8ICPA 5AKKA 2HVHA 4DSJA 2ZUCA 4FHYA 3ZDBA 2MA1A 1ED1A 4GC7A 3AMZA 1RQLA 4KMOB 4LVSA 4FZMA 1S0OA 4O69A 5HC9A 3PSFA 4P0PB 2Y0SC 3TARA 2WAQC 2UVUA 3GIJA 8ICMA 2XICA 4UBBA 3SAHA 2M2VA 3LK9A 2D8CA 2GOLA 2E5SA 2BZFA 1UCVA 2PFPA 4QZ8A 1NI3A 3KBBA 1TFWA 1Q8KA 3D2NA 3ZDDA 2ZIWB 1CUKA 4WJ3B 4F5PA 4ED1A 4DL7A 3NVOA 5AKXA 5KTQA 1Q3VA 4XUSA 4RUAA 4NJ8A 3QE9Y 3WKAA 4F93B 1NJXA 2AU0A 1ZQRA 4RQ5A 4IS7A 1XS9D 5DG8A 3PY8A 1QQ5A 5F9NA 5ALIA 2DBYA 5DLGA 4UB6U 1J2MA 3BZKA 4O3PA 3PZPA 2DPJA 1ZQAA 3C66A 4FZNA 3KHGA 4ELUA 1PVRA 2XY7A 4EBCA 2C2RA 2ODGA 1SL0A 4M2YA 3K7DA 5KFOA 2HHPA 5ALUA 3M6KA 3MR6A 1NKBA 3MGIA 4O3RA 2Y9UA 4QWBA 4DSEA 3TI0A 2BPGA 8ICEA 5AK4A 2H3IA 1B4FA 2YN4A 5AKIA 4UB5A 2UVVA 5ALQA 2BCVA 4UW9A 2BDPA 2HBJA 4X4UA 2HBLA 1S8OA 5GTIU 2I9GA 2IMWP 4F8RA 4DO9A 3M7DA 5ALTA 2FMPA 2FLLA 4AYBF 3C2LA 2W11A 8ICXA 1F5AA 4KLUA 2BBJA 4I29A 5F9LA 2ATLA 5ALVA 9ICBA 2HBKA 5K4LA 5KT6A 1JAJA 2EZXA 2FCLA 4O0IA 3EF2A 3I28A 4C8KA 1ZJMA 3IG8A 2LYAA 2K4PA 2W03A 2Y0SF 2WB1F 3OPXA 4F5QA 2NO4A 2OEHA 7ICRA 8ICQA 2JGAA 4A8EA 3IG5A 4ECTA 3D6JA 5JU5A 1RM6C 4DFDA 4MEYA 4WH5A 3QZ8A 2KV2A 2LYHA 5ALFA 5HP4A 3M8SA 3DV9A 3N28A 2W9BB 3H8SA 4JMUA 4OAHA 1SL2A 1YLQA 3Q8KA 4LJXA 4NM2A 3IHQB 5J0QA 1BPDA 3GDXA 5DGBA 4HAIA 3H3AA 3DDHA 2ZH2A 5J2BA 2PMZC 4WOYA 2K8AA 4FE3A 3IRUA 1KL9A 4UAVA 1L7NA 4FHWA 1KNYA 1KBUA 9ICLA 4NXXA 2ASLA 1RG6A 3H4BA 4RZRA 1N56A 4BGDA 2JEGA 2YY6A 3KHRA 2Y9TA 4YXJA 3RH5A 1ZQIA 1WUDA 2DL0A 4X0BA 2KVCA 5JUMA 5ALMA 4RQ6A 1O08A 4AT7B 3SV3A 4DL5A 2ISOA 2ASJA 2ZXIA 4N7RA 5AI9A 3LYSA 4P0QA 5J0RA 4B9SA 5J2JA 5KG0A 4BX9C 2CPRA 4PL2A 4DF4A 1MC8A 5C0YA 1TV9A 5HRHA 5DBAA 4Q43A 5KFGA 4X4SA 4RQMA 2WFAA 1O03A 1N2XA 4ED2A 3GIKA 2RQ5A 5KFWA 1S97A 1VFGA 1AROP 5AI0A 2XCPA 1V4AA 4J03A 2HBMA 2OHFA 5KFAA 4I2GA 8ICVA 1KFTA 3H7IA 3RR8A 4J9KA 1Z3EB 3JPSA 4KB6A 2QLTA 2GO7A 1RDFA 1V97A 7ICQA 3F2BA 3GFKB 4AT9B 1P7DA 5KFJA 2B4VA 5CFSA 3UPSA 4K96A 1NZPA 5DDYA 4Y2TA 4QZEA 3OJUA 1Z1BA 5HRLA 4BJQA 2DVIA 2ZIWA 3WKCA 2BPFA 3DEEA 4KLQA 4X4NA 2BPCA 1X6JA 1R8BA 4KLLA 1URJA 3RBDA 5DB8A 5CHEA 4EX6A 2PMZF 4F72A 2W9CA 3V6JA 4I28A 3QUTA 4DQIA 3C2KA 4NXTA 4RT2A 4C4SA 2G06A 5AKJA 4UAYA 4IQVA 4DQRA 1ZYQA 9ICUA 4ECRA 4DS5A 2RHFA 8ICFA 3OWGA 3OSNA 3HILA 2AGPA 3K4GA 4IL6U 3MR3A 4EEYA 5KFHA 2KG5A 1A77A 3CW2C 4CDGA 5HRDA 3Q8PB 2DPIA 2EAMA 4ECXA 2I5HA 4ECUA 3PO5A 4RPZA 2KN7A 3PW7A 3H8WA 2KZ3A 4I2HA 4YCXA 1N61A 1MIYA 2HHVA 3JZ0A 2WF9A 3N97B 3E0FA 2K60A 4K99A 2F1HA 4KM5A 1ZXIA 2DR7A 5CP2A 5G5HA 4IQWA 2JZBB 3QUBA 4EP7A 4ED8A 4QZBA 4C80A 2FMSA 1BPYA 3AQKA 3HT3A 3PX6A 1VJ7A 5AM3A 1YZ7A 3NS1A 4KMUA 3FC4A 2KHVA 8ICJA 4F5OA 2AXTU 3H8JA 4DSFA 4TUSA 8ICWA 1ZQDA 4B9NA 3ZDEA 3M8RA 4IRDA 1KFDA 3QU5A 1QSSA 4X4VA 3RB4A 2LM4A 2IHNA 5C5JA 4F50A 1LB2B 3IDWA 3QUQA 3NVZA 2HHXA 4M04A 4MFCA 2EDUA 3VCBA 2H3QA 3NTUA 4Y2VA 3T5JA 3WFQE 2PFNA 3JPOA 2C28A 4DL3A 4GIBA 3RRGA 2HI0A 9ICNA 2YQEA 9ICPA 7ICTA 4RQ1A 3LWMA 2XGQA 1UA0A 4I27A 4R66A 3H37A 2KSOB 2W9BA 2DF4B 2OXOA 4FZLA 1UPHA 2FPMA 3PNCA 5J0PA 2HVIA 3ER9B 2EZZA 2YB1A 1MQ3A 3K75D 9ICMA 5CWRA 5L9XA 2XY5A 1KTQA 5D61A 3G6YA 3AM9A 3T79A 2YX8A 3KHHA 2P66A 5AKZA 4EEKA 4E0DA 5KFNA 2Q4TA 4JB3A 4J9OA 4NLNA 3OUYB 4YMNA 4RQ4A 2ALZA 5J2AA 1TAMA 4PHEA 2M2UA 1SV0C 1SV0A 2R8GA 1RYRA 4K8VA 5ALDA 2PBEA 3PMLA 3A0HU 2UVRA 1D8BA 2DGZA 2JH7A 4Q45A 4AT7A 2ZTCA 1L6NA 2M2WA 4Y2XA 1D8YA 2NRKA 1ZQTA 3PMNA 4DQPA 4DOAA 1SV4A 8ICSA 4DF8A 3CK6A 3QXGA 3RTVA 5AK3A 3ER8C 3GILA 4YMMA 3BQ7A 3ERCC 4QZIA 5KFKA 2QARB 5F3XB 1RZTA 3PX0A 9ICRA 2AGOA 1PVPA 2KKPA 5KFSA 4K9AA 4B9VA 5ALLA 4DWIA 4KLSA 1BPZA 3MFHA 2JR5A 5KFIA 1A76A 3RJGA 3PW0A 2BKEA 4UBCA 2F3NA 2NRXA 5AICA 4O3MA 2G5IB 5D62A 3G6VA 3NVVA 4JWNA 1VDVA 3IM1A 3RH6A 3JPRA 3T5HA 3RJIA 5AK5A 4AT9A 2KFZA 3RB0A 3BQ2A 2HDOA 1L7PA 5KT7A 1IG6A 4WC2A 2AQ4A 4LEZA 4RQ8A 4KLMA 1ZQVA 2ISPA 2MU2A 2HN1A 1JIHA 1LV5A 1X2IA 4Z6FA 9ICWA 5KG7A 4Z6CA 1VJ5A 4JV1A 4J9MA 2CXYA 4JV2A 2BR0A 3JYYA 1KW4A 1KSPA 1KN5A 1TKDA 3UM9A 2KZZA 5J29A 2OH2A 2DR5A 5EWGA 1UEUA 3PO4A 3PW4A 4P2HA 4M9GA 1D9FA 1LVHA 2EH9A 4KLIA 2BGWA 1XSPA 2LI6A 1K5OA 1NJZA 4K98A 4EELA 2BDUA 1ZQ1C 4O5EA 5B5EU 2K8CB 2O6KA 2KFNA 4ED0A 5J0WA 4F92B 1X6IA 2ZIVB 3GV5B 2RFFA 4CCHA 4Z6DA 5KFBA 3SAGA 1RQNA 1ZQFA 4UD4A 4CF4A 5KFPA 5HREA 5HRBA 4YMOA 1N48A 1EXNA 2R8JA 2JZBA 3PR5B 2HHTA 3KFUF 1NNLA 2GLEA 1L7OA 2A1AA 4GC6A 5AKHA 3AQEA 3C1ZA 3L9DA 2G07A 2PI5A 5IIJA 4PHAA 2BCRA 2J6TA 9ICTA 5D46A 4P4PA 2Y1JA 4X0AA 4NL9A 5KFYA 9ICVA 4R64A 4WCWA 2W8LA 5EE1A 4OD0A 2KNJA 4UAZA 1JUDA 3RR7A 3PSPA 4YVZA 3JPPA 5DG9A 8ICCA 5KG5A 7ICVA 4ECYA 2KOBA 1J97A 2FPLA 1SL1A 8ICTA 2Y1IA 3SYZA 4XQ8A 4B9LA 1SB3C 2VIXA 1NK0A 4YQWA 4OAFA 4IR1A 3ED5A 8ICZA 4GLXA 3OTQA 1SKSA 4F5RA 4J9QA 5ALPA 2M2TA 3MBYA 3GV7B 2I6XA 2FLPA 4XRHA 4S3NA 3F5AA 4FH3A 3CRXA 4C8MA 4O3OA 2R8HA 3FM9A 5G5GA 8ICKA 2FE9A 7ICUA 1ZRMA 5KFRA 4XJEA 5KT5A 4DL6A 3OUYA 1OW5A 1JQRA 3ZI4A 4UB3A 1NOMA 4BXOB 1Z00B 3M9OB 3OSPA 4NLKA 5AKLA 5CR0A 2KJ9A 1CEZA 5ALJA 3LVVA 3TAQA 1LKYB 9ICCA 1SWVA 2VJ4A 4LZGA 9ICAA 3OVBA 3B9JA 7ICLA 1S76D 3ZDCA 2B6GA 1S0VA 2GWSA 4EV6A 4DS4A 4UB2A 5HRKA 5B3QA 2K89A 3KOOA 5ALKA 2QARA 3M9NB 4KLTA 2ZH1A 2KP7A 4NXVA 1PZNA 4PGQA 2IOHA 2WAQF 4MF8A 5CB1A 2HN2A 2B0CA 2JEFA 5KG4A 4C7YA 4NKTA 2A1JA 3A0BU 1ZQLA 2IBKA 3C18A 4RQ0A 3M6ZA 5HRFA 5ALXA 3C23A 1BNOA 4K97A 3KHLA 3C28A 3MABA 3QU4A 1FO4A 4CF5A 2ASDA 3H38A 1D8LA 2WF6A 5HHHA 2PFQA 1MIWA 5ALNA 3TADA 4IRCA 2DWQA 4QWEA 2RDJA 5DQHA 5ALHA 1KKXA 4ECZA 4YP3A 4J9NA 3TANA 4IRKA 9ICGA 1DGSA 4RWNA 2DKXA 2HHQA 2EQYA 4Y2RA 3RJFA 4ED6A 1ZQXA 4UAUA 4UD5A 4DSLA 1V9PA 4R65A 5DECA 2B51A 1U9LA 1HUZA 4NXUA 5KL8B 8ICGA 4Y2UA 8ICHA 2DRBA 3MR2A 2BHNA 2CN1A 5KFCA 4B6JA 4YN4A 2WTFA 3N7PD 4YD2A 2MSNA 1KLNA 2ZH9A 4I2DA 2F8LA 5JTIA 2ZG6A 5DB9A 4GXIA 3WFRE 1FFUA 4ELTA 2DR8A 2LM1A 1Q78A 4WC6A 3TKAA 3WKDA 3RJEA 1N60A 4PJ0U 4KLFA 2LHTA 2ZIVA 3BS5B 4C4RA 9ICSA 2C2EA 4R8UB 5KFVA 2V4QA 2ZH8A 2XO7A 2J6UA 3LQCB 3EPGA 4CRXA 2IOFK 5ALSA 4CGZA 4OJPA 4WC0A 4EENA 4QW8A 1RXWA 3MDAA 4RPXA 4JWMA 1XO0A 2BCUA 3NYBA 1ZRNA 4RWPA 1TVAA 4P0PA 3BQ0A 4WC5A 3N7RC 4FFDA 2W3SA 3RJKA 4NXZA 5L1IA 3OVAA 1H38A 3L3FX 4UASA 4X4TA 4F2RA 1ZQYA 2F1IA 4DFPA 1OU5A 5IIOA 1QH9A 3RB6A 1N63A 3I76A 3V7LA 4BDPA 4F4YA 1J2NA 2JHDA 7ICGA 4C8OA 4KTQA 5HHIA 1UETA 2HHSA 5AM2A 1SIJA 1N5WA 1T8EA 3MFIA 3PR4A 4DSKA 1JX4A 2E8OA 2DQNB 4G3IA 4ACOA 1BPBA 3ISBA 2YMQA 2XVTA 4OJ6A 3TQ1A 1Q46A 3SEIA 1QCKA 1X9SA 4ATBB 3QZ7A 3MGHA 1KFSA 4K4GA 5EE3A 4UQGA 1QLNA 3FAHA 4AT8B 3OHBA 1YT3A 3J81j 2K4HA 5KFEA 4NWIA 2W9MA 1WCNA 1R89A 1B0XA 4CE6A 4RT3A 9ICIA 5J2HA 4EGWA 1ECWA 3WK9A 4EZ9A 2RRDA 1COOA 3WK8A 2LYBA 2P6UA 2K4EA 5EWEA 1X9WA 5AM0A 2E1FA 5J2CA 4QIWC 1NJYA 3N4MB 2MUTB 3UMBA 5KT3A 2OWOA 3AQLA 3V6KA 2W55A 2IA6A 5AKYA 4KLOA 4BXOA 4C8NA 3L5KA 2ZUBA 3RH4A 4WC7A 3OGUA 3T5LA 1L3VA 1WOTA 4RWOA 5ALEA 2HSZA 4DL4A 1B43A 3SV4A 4MF2A 4B9TA 1DK3A 1QQ7A 4KLEA 4FHXA 3H0RB 2ZTDA 3H40A 2VA3A 2KKVA 5J2GA 1TFYA 5IINA 4QJFB 3NKUA 5KAIU 1N62A 4F4ZA 1GO3F 2G08A 3L4PA 4CNQA 4BUGA 4I2CA 3Q8RB 4NY8A 1L3UA 2ZH7A 2DFLA 1L8LA 3WK4A 1V85A 3OVSA 5J2EA 4QWDA 4ICAA 4Y2PA 5IIIA 2MRLA 4B9UA 3ZD9A 1KEJA 5AIAA 4O6AA 2AJQA 5DEDA 4X4QA 4YG2A 2HHWA 3F53A 4I0UA 3E2EA 2JRZA 1N5XA 4WBZA 3EPIA 1BNPA 1WG8A 5GTHU 1ZQBA 2Q66A 4ECWA 1SZHA 2QB1A 3V7JA 4WC1A 4Q44A
chains in the Genus database with same CATH topology
2BDPA 4NKUA 4X4UA 2BR0A 3JYYA 4ECQA 1T3NA 2I9GA 4QZFA 1S9FA 4B9MA 2IMWP 4F8RA 1KSPA 4DO9A 1XSNA 1TKDA 2FMPA 2FLLA 4KLDA 2HHUA 2KZZA 5J29A 3AU2A 2DR5A 5KFMA 5EWGA 2M9NA 3C2LA 1XC9A 9ICSA 5J0YA 4UAWA 3PO4A 3ISDA 3PW4A 8ICXA 1F5AA 4P2HA 2C22A 3RAXA 4KN4A 4M6WB 1D9FA 4M9GA 4KLIA 1D9DA 4KLUA 1U49A 3UXNA 2BGWA 4TQRA 1XSPA 4I29A 5F9LA 2ATLA 9ICBA 1NJZA 5KT6A 1JAJA 4RNNA 2R8IA 3RJHA 4O0IA 4O5EA 2KFNA 4ED0A 5J0WA 4M9NA 1JMSA 4F92B 2BQUA 2AQ0A 4C8KA 3GV5B 4KLHA 1U48A 2RFFA 1XWLA 4KITB 5J2DA 1SKWA 4CCHA 4Z6DA 4PGYA 1ZJMA 4MFAA 5KFBA 3UPQA 1U45A 3UQ0A 5DQIA 1ZQFA 4E80A 3RB3A 4UD4A 4F5QA 5KFPA 5HREA 1ZQCA 4YMOA 1ZQEA 5HRBA 3JPNA 7ICRA 4DSIA 2PI4A 1NKEA 8ICQA 3WFSC 1N48A 1EXNA 3AU6A 4DQSA 2R8JA 2F1JA 4ECTA 4M47A 2JZBA 3LDAA 3PR5B 2HHTA 1TK8A 4TQSA 4MEYA 4QWCA 3QZ8A 2LYHA 4GC6A 5J0UA 5HP4A 5DDMA 2R8KA 7ICSA 3HJ4A 3C1ZA 3M8SA 3HJ1A 2W9BB 3H8SA 5EOZA 3L9DA 2ZJAA 1PX5A 2PI5A 8ICRA 5HR9A 1SL2A 1YLQA 3Q8KA 4NM2A 3UXPA 1ZJNA 4FH5A 5IIJA 4PHAA 3IHQB 3H4DA 2BCRA 1NK9A 4PHDA 5F2VO 5J0QA 4YR3A 1BPDA 2ID1A 2J6TA 4I2FA 3PW5A 3GIIA 9ICTA 3GDXA 3C21A 5DGBA 5D46A 4P4PA 2Y1JA 4X0AA 4IQUA 3PW2A 5KFYA 3H3AA 2UVWA 9ICVA 2ZH2A 5J2BA 4R64A 4WCWA 4ZH4A 5L1LA 4RQ2A 4QZAA 2XC9A 7ICFA 1MSWD 1MIVA 2W8LA 2JEJA 4BWMA 3NGDA 3EWAA 4R8UA 4F5NA 2O5AA 1TAQA 1Z00A 1KNYA 4DFMA 9ICLA 4FHWA 4XQ7A 3HPOA 1ZQQA 2ASLA 1T7PA 4UAZA 2O1PA 3H4BA 5KG2A 2BQRA 4RZRA 3RR7A 5L1JA 1N56A 1L3SA 5DG7A 2ZH4A 1NK6A 4BGDA 4YVZA 3JPPA 5DG9A 4J9PA 8ICCA 5KG5A 4YD1A 4QZ9A 7ICVA 4ECYA 2JEGA 1SZPA 4EBDA 3TFSA 3KHRA 4NLGA 4YXJA 3ETLA 2FPLA 1SL1A 8ICTA 3RH5A 3BJYA 1ZQIA 2Y1IA 3SYZA 4UB4A 1ZQPA 4X0BA 4XQ8A 4B9LA 5JUMA 2BE3A 4RQ6A 4QWAA 1NK0A 4YQWA 1Y88A 4IR1A 4XA5A 4AT7B 3GQCA 4LZDA 4FBUA 8ICZA 3ZD8A 4GLXA 3SV3A 4C8LA 3FYHA 1SKSA 4DOBA 4F5RA 4DL5A 2FLNA 2ISOA 4DL2A 4RNMA 2ASJA 3AUOA 4J9QA 1XU4A 2M2TA 5KG1A 3MBYA 3GV7B 4RWPA 2FLPA 2ZUDA 2NRZA 5J0RA 4B9SA 4X4VA 4XRHA 5KG6A 3G6XA 4JK1A 4DSLA 4DFKA 2MAXA 5J2JA 2KZMA 4S3NA 5KG0A 4FH3A 2PXIA 4J9RA 4I2IA 5HMLA 1JXEA 4YXMA 4MEXA 4DF4A 1MC8A 4C8MA 4O3OA 8ICLA 2R8HA 4FHVA 8ICKA 4E7XA 1TV9A 5HRHA 5DBAA 4Q43A 4I2BA 7ICUA 7ICHA 2FPKA 5KFGA 5KFRA 3ZDAA 5KT5A 4DL6A 4X4SA 8ICIA 3OUYA 1JQRA 4UB3A 3THVA 1ZQWA 4QZCA 4ED2A 1ZQOA 1TAUA 1NOMA 3Q8SB 3GIKA 4EBKA 4BXOB 1Z00B 5KFWA 3M9OB 3OSPA 1S97A 5KFUA 4QZGA 4RU9A 4TUQA 2C2DA 4NLKA 9ICJA 5KFFA 4DOCA 1VFGA 1AROP 4O5CA 7ICPA 2XCPA 3WFOA 5CR0A 1V4AA 1ZQNA 3LWLA 1CEZA 5KFAA 4I2GA 8ICVA 2ZHAA 1KFTA 3TAQA 3H7IA 9ICCA 3RR8A 4AT8A 4J9KA 1Z3EB 3JPSA 3BQTA 5HRIA 1UA1A 4JUZA 8ICUA 2V4RA 2P6RA 1ZQKA 4RUCA 4LZGA 2VA8A 1S77D 9ICHA 2XY6A 9ICAA 3OVBA 7ICLA 3HW8A 1X9MA 1L5UA 5CHGA 7ICQA 1B22A 3GFKB 4Q8FA 1S76D 3ZDCA 9ICOA 4AT9B 4QZDA 5HNKA 1RYSA 1S0VA 5KFJA 2GWSA 5KFZA 4NM1A 9ICMA 4DS4A 5DQGA 5HMMA 4PHPA 4UB2A 5HRKA 3UPSA 4YR2A 4KLTA 3M9NB 2ZH1A 5DDYA 1BPXA 1PZNA 5J0XA 4PGQA 4QZEA 3Q8QB 4MF8A 4O5KA 3Q8MA 5DB7A 5CB1A 1ZQJA 8ICAA 1KDHA 4IQTA 3QEBZ 2JEFA 3OJUA 9ICXA 5KG4A 5HRLA 2DVIA 2BPFA 4KLQA 2A1JA 1QSYA 4NKTA 1ZQLA 2IBKA 3C18A 2JEIA 4X4NA 4RQ0A 5CJ7A 4KLJA 5HRFA 2BPCA 4Q8EA 7ICIA 1R8BA 5D4BA 1TFRA 1JN3A 3C23A 3B0YA 5DB8A 3ORYA 4RQ3A 5J2IA 3RBDA 4KLLA 7ICMA 4X4RA 5J2KA 2ZJ8A 3HWTA 1NK7A 3KHLA 2W9CA 3V6JA 4I28A 3EZ5A 5CA7A 4DQIA 3MABA 1MQ2A 5D49A 2ASDA 5KT4A 3C2KA 5KFDA 2XGPA 3UXOA 3H38A 3T5KA 1D8LA 4QW9A 4RT2A 5HHHA 1MIWA 2PFQA 1S0MA 4IRCA 4UAYA 4IQVA 4QWEA 4F4XA 4DQRA 5DGAA 1ZYQA 4ECRA 4DS5A 5IILA 1QTMA 9ICUA 4WC4A 2RDJA 3M9MB 2W9AA 8ICFA 3H39A 5DQHA 1IXRA 3OSNA 2B21A 2AGPA 8ICNA 4X4PA 3K4GA 4M9LA 4ECZA 2DR9A 1ZQHA 4YP3A 4J9NA 3TANA 3MR3A 4I2JA 4IRKA 1T4GA 1RPLA 5BPCA 4DLEA 4EEYA 4I2EA 9ICGA 4DQQA 1DGSA 5KFHA 3PVXA 4RWNA 1A77A 3C1YA 5HRDA 2HHQA 3UQ2A 1Q79A 1K1QA 1KRPA 3Q8PB 2XCAA 3RJFA 4ED3A 4ED6A 4F4KA 4R63A 1ZQXA 3BQ1A 2DPIA 4FBTA 2V9WA 4ECXA 2BCQA 4UD5A 4ECUA 3PO5A 4RPZA 1V9PA 4BWJA 4R65A 2KN7A 3H8WA 3OJSA 2KZ3A 3GV8B 5L1KA 3PW7A 4YCXA 4I2HA 2KTQA 1MIYA 1U9LA 2HHVA 4RQ7A 5DECA 3JZ0A 1HUZA 3N97B 1ZQGA 1ZQZA 8ICGA 1DOQA 2F1HA 3C5GA 8ICHA 3WFPA 2DRBA 2A1JB 2BHNA 3MR2A 1TK5A 5KFCA 5CP2A 4IQWA 3OV7A 2DR7A 2JZBB 4YN4A 3ISCA 2WTFA 8ICBA 4F3OA 1NK8A 1HUOA 5J0TA 3GIMA 4ED8A 4YD2A 4EP7A 4QZBA 1L3TA 3PV8A 5KG3A 1KLNA 1ZQUA 2DRAA 2FMSA 1BPYA 5DBBA 2W9CB 3AQKA 4ECSA 4M6WA 3JPTA 2ZH9A 4I2DA 3HT3A 3PX6A 4P4OA 3MR5A 4FS1A 1VJ7A 5DB9A 2FMQA 4GXIA 3WFRE 5J0SA 4KMUA 4ELTA 3TFRA 8ICJA 2DR8A 3SZ2A 4M9JA 4TUPA 3RJJA 7ICKA 4F5OA 1QSLA 1Q78A 3FDSA 1XSLA 4WC6A 9ICQA 8ICOA 3RJEA 3H8JA 4K4HA 1UT8A 4DSFA 4M0AA 4KLFA 4TUSA 8ICWA 4GXKA 1ZQDA 4QZHA 4KN7A 4B9NA 2ZTEA 4X5VA 3ZDEA 3SI8A 3M8RA 2J6SA 4IRDA 5KT2A 3RBEA 3HX0A 1KFDA 5J2FA 3B0XA 4R8UB 2AGQA 2C2EA 3RRHA 5KFVA 1RXVA 3RB4A 1QSSA 2V4QA 2IHMA 2IHNA 2ZH5A 2XO7A 4EZ6A 2ZH8A 2J6UA 3LQCB 5C5JA 3EPGA 4F50A 4ECVA 1LB2B 3HIYA 5DBCA 4X4OA 4P4MA 9ICKA 4M5DA 3AQNA 4RWQA 3JPQA 4DFJA 1UT5A 2HHXA 4M04A 4WC0A 4ATBA 9ICEA 4MFCA 2RDIA 4O9MA 3NTUA 4QW8A 3T5JA 1NJWA 3WFQE 2PFNA 3JPOA 2C28A 4DL3A 1NK5A 1S10A 1RXWA 3RRGA 7ICJA 3MDAA 4RPXA 4JWMA 9ICNA 7ICTA 2BCUA 4RQ1A 3LWMA 4ED7A 9ICPA 1BPEA 2XGQA 3NYBA 3C5FA 5KFTA 5TZVA 5J0OA 4R66A 4DEZA 3C2MA 3BQ0A 1TVAA 1UA0A 1S0NA 3BDPA 3H37A 2W9BA 4WC5A 2NRTA 4ELVA 5HRGA 3RJKA 3V6HA 3EW9A 4NXZA 5L1IA 2FPMA 4O3NA 1ZQMA 4PGXA 4DLGA 3OVAA 3PNCA 3AQMA 1H38A 1BVSA 1UEVA 4X4TA 4F2RA 5J0PA 1C7YA 2HVIA 4IG8A 5EWFA 1ZQYA 1MQ3A 2F1IA 4DFPA 3K75D 1HJPA 5IIOA 5CWRA 2VANA 2NRWA 5L9XA 3QEAZ 4F2SA 2MUTA 4K4IA 2XY5A 3RB6A 2ZH6A 2BCSA 1BGXT 1ZETA 3T3FA 7ICNA 1XO1A 3V7LA 1KTQA 4F4YA 4BDPA 5IIKA 5BOMA 3G6YA 5BOLA 7ICGA 5KFLA 2Q0ZX 3KHHA 4M9HA 2P66A 4KLGA 1U4BA 4J9LA 2BQ3A 4C8OA 4KTQA 9ICFA 5HHIA 4O3SA 3EYZA 4EYIB 2HHSA 4YFKA 4E0DA 1UETA 5KFNA 4J9SA 1T8EA 3MFIA 1ZQSA 4J9OA 3PR4A 4DSKA 4MFFA 4NLNA 4GXJA 1JX4A 4PH5A 7ICOA 3OUYB 3OHAA 4YMNA 4RQ4A 5DLFA 2ALZA 5IIMA 3V7KA 4EBJA 4NLZA 5J2AA 4PPXA 4PHEA 4G3IA 2M2UA 1BPBA 4RPYA 3ISBA 2PFOA 1RYRA 5DKWA 4RNOA 2R8GA 1R8CA 8ICPA 2PBEA 3PMLA 2UVRA 2HVHA 3TQ1A 4DSJA 2ZUCA 4FHYA 3ZDBA 4Q45A 1X9SA 1OU5A 4ATBB 4AT7A 3QZ7A 3MGHA 2ZTCA 4GC7A 1KFSA 4K4GA 4UQGA 2M2WA 1QLNA 1D8YA 4F91B 4LVSA 3OHBA 1S0OA 5DB6A 2NRKA 4AT8B 5HC9A 4WBYA 5KFEA 2ZJ5A 1ZQTA 2W9MA 3PMNA 2ZHBA 1WCNA 4DQPA 4UB1A 1R89A 3TARA 9ICIA 4RT3A 4DOAA 2ZH3A 5J2HA 8ICSA 2UVUA 3GIJA 4DF8A 4EZ9A 8ICMA 1COOA 2NRVA 2P6UA 3RTVA 8ICYA 4UBBA 4Z6EA 2VA2A 5EWEA 1X9WA 5J2CA 3GILA 2M2VA 4YMMA 1NJYA 3LK9A 3N4MB 4QZIA 4FO6A 5KFKA 1RZTA 3PX0A 1K1SA 4YR0A 2MUTB 2AGOA 3Q8LA 1SKRA 2PFPA 9ICRA 1UEUA 4QZ8A 5KT3A 1NO5A 5KFSA 2OWOA 3AQLA 4I27A 4HYKA 3V6KA 4B9VA 2IA6A 5KFXA 1TFWA 4JV0A 4DWIA 3MDCA 3ZDDA 4KLOA 4KLSA 1BPZA 4E8FA 3MFHA 4BXOA 7ICEA 4C8NA 5KFIA 1CUKA 2ZUBA 1A76A 3RH4A 4F5PA 3RJGA 4ED1A 2BKEA 4DL7A 3PW0A 3OGUA 4UBCA 5KTQA 3T5LA 1L3VA 4I2AA 4WC7A 1WOTA 4RWOA 4XUSA 4RUAA 4DL4A 1B43A 3SV4A 2NRXA 4MF2A 4B9TA 3QE9Y 4F93B 1NJXA 4KLEA 4FHXA 2AU0A 1ZQRA 4RQ5A 3V72A 2ZTDA 3RAQA 3H40A 3G6VA 1XS9D 2VA3A 4JWNA 5DG8A 4EYHB 5J2GA 3PY8A 5F9NA 4WC3A 1TFYA 5IINA 3PX4A 5DLGA 3IM1A 1TK0A 4EBEA 4O3PA 4FS2A 3JPRA 3T5HA 4F4ZA 3RJIA 3RH6A 1NK4A 1ZQAA 2DPJA 1R8AA 2KFZA 3KHGA 4ELUA 3C66A 4AT9A 3RB0A 1JXLA 3Q8RB 4I2CA 5KFQA 4NY8A 2XY7A 3BQ2A 4EBCA 2C2RA 1WCLA 1SL0A 5KT7A 1L3UA 2W8KA 3HP6A 4M2YA 2DFLA 5KFOA 2HHPA 2I1QA 4FHPA 4WC2A 2AQ4A 2ZH7A 4RQ8A 4KLMA 3OVSA 1ZQVA 2ISPA 5J2EA 4QWDA 3MR6A 1FA0A 4TURA 1NKBA 3MGIA 5IIIA 4QWBA 4F4WA 4B9UA 4DSEA 4O3RA 3ZD9A 1KEJA 1JIHA 1IM4A 3TI0A 2BPGA 1LV5A 4IR9A 8ICEA 1X2IA 4Z6FA 9ICWA 2AJQA 5DEDA 4X4QA 4YG2A 2HHWA 2H5XA 5KG7A 4Z6CA 3E2EA 1U47A 4WBZA 2HW3A 4UB5A 3EPIA 4O3QA 2UVVA 3KTQA 4LT6A 4JV1A 1ZQBA 2BCVA 4J9MA 2Q66A 4ECWA 3V7JA 1NKCA 4JV2A 3TAPA 4WC1A 4Q44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDP A;  4NKU A;  4X4U A;  2BR0 A;  3JYY A;  4ECQ A;  1T3N A;  2I9G A;  4QZF A;  1S9F A;  4B9M A;  2IMW P;  4F8R A;  1KSP A;  4DO9 A;  1XSN A;  1TKD A;  2FMP A;  2FLL A;  4KLD A;  2HHU A;  2KZZ A;  5J29 A;  3AU2 A;  2DR5 A;  5KFM A;  5EWG A;  2M9N A;  3C2L A;  1XC9 A;  9ICS A;  5J0Y A;  4UAW A;  3PO4 A;  3ISD A;  3PW4 A;  8ICX A;  1F5A A;  4P2H A;  2C22 A;  3RAX A;  4KN4 A;  4M6W B;  1D9F A;  4M9G A;  4KLI A;  1D9D A;  4KLU A;  1U49 A;  3UXN A;  2BGW A;  4TQR A;  1XSP A;  4I29 A;  5F9L A;  2ATL A;  9ICB A;  1NJZ A;  5KT6 A;  1JAJ A;  4RNN A;  2R8I A;  3RJH A;  4O0I A;  4O5E A;  2KFN A;  4ED0 A;  5J0W A;  4M9N A;  1JMS A;  4F92 B;  2BQU A;  2AQ0 A;  4C8K A;  3GV5 B;  4KLH A;  1U48 A;  2RFF A;  1XWL A;  4KIT B;  5J2D A;  1SKW A;  4CCH A;  4Z6D A;  4PGY A;  1ZJM A;  4MFA A;  5KFB A;  3UPQ A;  1U45 A;  3UQ0 A;  5DQI A;  1ZQF A;  4E80 A;  3RB3 A;  4UD4 A;  4F5Q A;  5KFP A;  5HRE A;  1ZQC A;  4YMO A;  1ZQE A;  5HRB A;  3JPN A;  7ICR A;  4DSI A;  2PI4 A;  1NKE A;  8ICQ A;  3WFS C;  1N48 A;  1EXN A;  3AU6 A;  4DQS A;  2R8J A;  2F1J A;  4ECT A;  4M47 A;  2JZB A;  3LDA A;  3PR5 B;  2HHT A;  1TK8 A;  4TQS A;  4MEY A;  4QWC A;  3QZ8 A;  2LYH A;  4GC6 A;  5J0U A;  5HP4 A;  5DDM A;  2R8K A;  7ICS A;  3HJ4 A;  3C1Z A;  3M8S A;  3HJ1 A;  2W9B B;  3H8S A;  5EOZ A;  3L9D A;  2ZJA A;  1PX5 A;  2PI5 A;  8ICR A;  5HR9 A;  1SL2 A;  1YLQ A;  3Q8K A;  4NM2 A;  3UXP A;  1ZJN A;  4FH5 A;  5IIJ A;  4PHA A;  3IHQ B;  3H4D A;  2BCR A;  1NK9 A;  4PHD A;  5F2V O;  5J0Q A;  4YR3 A;  1BPD A;  2ID1 A;  2J6T A;  4I2F A;  3PW5 A;  3GII A;  9ICT A;  3GDX A;  3C21 A;  5DGB A;  5D46 A;  4P4P A;  2Y1J A;  4X0A A;  4IQU A;  3PW2 A;  5KFY A;  3H3A A;  2UVW A;  9ICV A;  2ZH2 A;  5J2B A;  4R64 A;  4WCW A;  4ZH4 A;  5L1L A;  4RQ2 A;  4QZA A;  2XC9 A;  7ICF A;  1MSW D;  1MIV A;  2W8L A;  2JEJ A;  4BWM A;  3NGD A;  3EWA A;  4R8U A;  4F5N A;  2O5A A;  1TAQ A;  1Z00 A;  1KNY A;  4DFM A;  9ICL A;  4FHW A;  4XQ7 A;  3HPO A;  1ZQQ A;  2ASL A;  1T7P A;  4UAZ A;  2O1P A;  3H4B A;  5KG2 A;  2BQR A;  4RZR A;  3RR7 A;  5L1J A;  1N56 A;  1L3S A;  5DG7 A;  2ZH4 A;  1NK6 A;  4BGD A;  4YVZ A;  3JPP A;  5DG9 A;  4J9P A;  8ICC A;  5KG5 A;  4YD1 A;  4QZ9 A;  7ICV A;  4ECY A;  2JEG A;  1SZP A;  4EBD A;  3TFS A;  3KHR A;  4NLG A;  4YXJ A;  3ETL A;  2FPL A;  1SL1 A;  8ICT A;  3RH5 A;  3BJY A;  1ZQI A;  2Y1I A;  3SYZ A;  4UB4 A;  1ZQP A;  4X0B A;  4XQ8 A;  4B9L A;  5JUM A;  2BE3 A;  4RQ6 A;  4QWA A;  1NK0 A;  4YQW A;  1Y88 A;  4IR1 A;  4XA5 A;  4AT7 B;  3GQC A;  4LZD A;  4FBU A;  8ICZ A;  3ZD8 A;  4GLX A;  3SV3 A;  4C8L A;  3FYH A;  1SKS A;  4DOB A;  4F5R A;  4DL5 A;  2FLN A;  2ISO A;  4DL2 A;  4RNM A;  2ASJ A;  3AUO A;  4J9Q A;  1XU4 A;  2M2T A;  5KG1 A;  3MBY A;  3GV7 B;  4RWP A;  2FLP A;  2ZUD A;  2NRZ A;  5J0R A;  4B9S A;  4X4V A;  4XRH A;  5KG6 A;  3G6X A;  4JK1 A;  4DSL A;  4DFK A;  2MAX A;  5J2J A;  2KZM A;  4S3N A;  5KG0 A;  4FH3 A;  2PXI A;  4J9R A;  4I2I A;  5HML A;  1JXE A;  4YXM A;  4MEX A;  4DF4 A;  1MC8 A;  4C8M A;  4O3O A;  8ICL A;  2R8H A;  4FHV A;  8ICK A;  4E7X A;  1TV9 A;  5HRH A;  5DBA A;  4Q43 A;  4I2B A;  7ICU A;  7ICH A;  2FPK A;  5KFG A;  5KFR A;  3ZDA A;  5KT5 A;  4DL6 A;  4X4S A;  8ICI A;  3OUY A;  1JQR A;  4UB3 A;  3THV A;  1ZQW A;  4QZC A;  4ED2 A;  1ZQO A;  1TAU A;  1NOM A;  3Q8S B;  3GIK A;  4EBK A;  4BXO B;  1Z00 B;  5KFW A;  3M9O B;  3OSP A;  1S97 A;  5KFU A;  4QZG A;  4RU9 A;  4TUQ A;  2C2D A;  4NLK A;  9ICJ A;  5KFF A;  4DOC A;  1VFG A;  1ARO P;  4O5C A;  7ICP A;  2XCP A;  3WFO A;  5CR0 A;  1V4A A;  1ZQN A;  3LWL A;  1CEZ A;  5KFA A;  4I2G A;  8ICV A;  2ZHA A;  1KFT A;  3TAQ A;  3H7I A;  9ICC A;  3RR8 A;  4AT8 A;  4J9K A;  1Z3E B;  3JPS A;  3BQT A;  5HRI A;  1UA1 A;  4JUZ A;  8ICU A;  2V4R A;  2P6R A;  1ZQK A;  4RUC A;  4LZG A;  2VA8 A;  1S77 D;  9ICH A;  2XY6 A;  9ICA A;  3OVB A;  7ICL A;  3HW8 A;  1X9M A;  1L5U A;  5CHG A;  7ICQ A;  1B22 A;  3GFK B;  4Q8F A;  1S76 D;  3ZDC A;  9ICO A;  4AT9 B;  4QZD A;  5HNK A;  1RYS A;  1S0V A;  5KFJ A;  2GWS A;  5KFZ A;  4NM1 A;  9ICM A;  4DS4 A;  5DQG A;  5HMM A;  4PHP A;  4UB2 A;  5HRK A;  3UPS A;  4YR2 A;  4KLT A;  3M9N B;  2ZH1 A;  5DDY A;  1BPX A;  1PZN A;  5J0X A;  4PGQ A;  4QZE A;  3Q8Q B;  4MF8 A;  4O5K A;  3Q8M A;  5DB7 A;  5CB1 A;  1ZQJ A;  8ICA A;  1KDH A;  4IQT A;  3QEB Z;  2JEF A;  3OJU A;  9ICX A;  5KG4 A;  5HRL A;  2DVI A;  2BPF A;  4KLQ A;  2A1J A;  1QSY A;  4NKT A;  1ZQL A;  2IBK A;  3C18 A;  2JEI A;  4X4N A;  4RQ0 A;  5CJ7 A;  4KLJ A;  5HRF A;  2BPC A;  4Q8E A;  7ICI A;  1R8B A;  5D4B A;  1TFR A;  1JN3 A;  3C23 A;  3B0Y A;  5DB8 A;  3ORY A;  4RQ3 A;  5J2I A;  3RBD A;  4KLL A;  7ICM A;  4X4R A;  5J2K A;  2ZJ8 A;  3HWT A;  1NK7 A;  3KHL A;  2W9C A;  3V6J A;  4I28 A;  3EZ5 A;  5CA7 A;  4DQI A;  3MAB A;  1MQ2 A;  5D49 A;  2ASD A;  5KT4 A;  3C2K A;  5KFD A;  2XGP A;  3UXO A;  3H38 A;  3T5K A;  1D8L A;  4QW9 A;  4RT2 A;  5HHH A;  1MIW A;  2PFQ A;  1S0M A;  4IRC A;  4UAY A;  4IQV A;  4QWE A;  4F4X A;  4DQR A;  5DGA A;  1ZYQ A;  4ECR A;  4DS5 A;  5IIL A;  1QTM A;  9ICU A;  4WC4 A;  2RDJ A;  3M9M B;  2W9A A;  8ICF A;  3H39 A;  5DQH A;  1IXR A;  3OSN A;  2B21 A;  2AGP A;  8ICN A;  4X4P A;  3K4G A;  4M9L A;  4ECZ A;  2DR9 A;  1ZQH A;  4YP3 A;  4J9N A;  3TAN A;  3MR3 A;  4I2J A;  4IRK A;  1T4G A;  1RPL A;  5BPC A;  4DLE A;  4EEY A;  4I2E A;  9ICG A;  4DQQ A;  1DGS A;  5KFH A;  3PVX A;  4RWN A;  1A77 A;  3C1Y A;  5HRD A;  2HHQ A;  3UQ2 A;  1Q79 A;  1K1Q A;  1KRP A;  3Q8P B;  2XCA A;  3RJF A;  4ED3 A;  4ED6 A;  4F4K A;  4R63 A;  1ZQX A;  3BQ1 A;  2DPI A;  4FBT A;  2V9W A;  4ECX A;  2BCQ A;  4UD5 A;  4ECU A;  3PO5 A;  4RPZ A;  1V9P A;  4BWJ A;  4R65 A;  2KN7 A;  3H8W A;  3OJS A;  2KZ3 A;  3GV8 B;  5L1K A;  3PW7 A;  4YCX A;  4I2H A;  2KTQ A;  1MIY A;  1U9L A;  2HHV A;  4RQ7 A;  5DEC A;  3JZ0 A;  1HUZ A;  3N97 B;  1ZQG A;  1ZQZ A;  8ICG A;  1DOQ A;  2F1H A;  3C5G A;  8ICH A;  3WFP A;  2DRB A;  2A1J B;  2BHN A;  3MR2 A;  1TK5 A;  5KFC A;  5CP2 A;  4IQW A;  3OV7 A;  2DR7 A;  2JZB B;  4YN4 A;  3ISC A;  2WTF A;  8ICB A;  4F3O A;  1NK8 A;  1HUO A;  5J0T A;  3GIM A;  4ED8 A;  4YD2 A;  4EP7 A;  4QZB A;  1L3T A;  3PV8 A;  5KG3 A;  1KLN A;  1ZQU A;  2DRA A;  2FMS A;  1BPY A;  5DBB A;  2W9C B;  3AQK A;  4ECS A;  4M6W A;  3JPT A;  2ZH9 A;  4I2D A;  3HT3 A;  3PX6 A;  4P4O A;  3MR5 A;  4FS1 A;  1VJ7 A;  5DB9 A;  2FMQ A;  4GXI A;  3WFR E;  5J0S A;  4KMU A;  4ELT A;  3TFR A;  8ICJ A;  2DR8 A;  3SZ2 A;  4M9J A;  4TUP A;  3RJJ A;  7ICK A;  4F5O A;  1QSL A;  1Q78 A;  3FDS A;  1XSL A;  4WC6 A;  9ICQ A;  8ICO A;  3RJE A;  3H8J A;  4K4H A;  1UT8 A;  4DSF A;  4M0A A;  4KLF A;  4TUS A;  8ICW A;  4GXK A;  1ZQD A;  4QZH A;  4KN7 A;  4B9N A;  2ZTE A;  4X5V A;  3ZDE A;  3SI8 A;  3M8R A;  2J6S A;  4IRD A;  5KT2 A;  3RBE A;  3HX0 A;  1KFD A;  5J2F A;  3B0X A;  4R8U B;  2AGQ A;  2C2E A;  3RRH A;  5KFV A;  1RXV A;  3RB4 A;  1QSS A;  2V4Q A;  2IHM A;  2IHN A;  2ZH5 A;  2XO7 A;  4EZ6 A;  2ZH8 A;  2J6U A;  3LQC B;  5C5J A;  3EPG A;  4F50 A;  4ECV A;  1LB2 B;  3HIY A;  5DBC A;  4X4O A;  4P4M A;  9ICK A;  4M5D A;  3AQN A;  4RWQ A;  3JPQ A;  4DFJ A;  1UT5 A;  2HHX A;  4M04 A;  4WC0 A;  4ATB A;  9ICE A;  4MFC A;  2RDI A;  4O9M A;  3NTU A;  4QW8 A;  3T5J A;  1NJW A;  3WFQ E;  2PFN A;  3JPO A;  2C28 A;  4DL3 A;  1NK5 A;  1S10 A;  1RXW A;  3RRG A;  7ICJ A;  3MDA A;  4RPX A;  4JWM A;  9ICN A;  7ICT A;  2BCU A;  4RQ1 A;  3LWM A;  4ED7 A;  9ICP A;  1BPE A;  2XGQ A;  3NYB A;  3C5F A;  5KFT A;  5TZV A;  5J0O A;  4R66 A;  4DEZ A;  3C2M A;  3BQ0 A;  1TVA A;  1UA0 A;  1S0N A;  3BDP A;  3H37 A;  2W9B A;  4WC5 A;  2NRT A;  4ELV A;  5HRG A;  3RJK A;  3V6H A;  3EW9 A;  4NXZ A;  5L1I A;  2FPM A;  4O3N A;  1ZQM A;  4PGX A;  4DLG A;  3OVA A;  3PNC A;  3AQM A;  1H38 A;  1BVS A;  1UEV A;  4X4T A;  4F2R A;  5J0P A;  1C7Y A;  2HVI A;  4IG8 A;  5EWF A;  1ZQY A;  1MQ3 A;  2F1I A;  4DFP A;  3K75 D;  1HJP A;  5IIO A;  5CWR A;  2VAN A;  2NRW A;  5L9X A;  3QEA Z;  4F2S A;  2MUT A;  4K4I A;  2XY5 A;  3RB6 A;  2ZH6 A;  2BCS A;  1BGX T;  1ZET A;  3T3F A;  7ICN A;  1XO1 A;  3V7L A;  1KTQ A;  4F4Y A;  4BDP A;  5IIK A;  5BOM A;  3G6Y A;  5BOL A;  7ICG A;  5KFL A;  2Q0Z X;  3KHH A;  4M9H A;  2P66 A;  4KLG A;  1U4B A;  4J9L A;  2BQ3 A;  4C8O A;  4KTQ A;  9ICF A;  5HHI A;  4O3S A;  3EYZ A;  4EYI B;  2HHS A;  4YFK A;  4E0D A;  1UET A;  5KFN A;  4J9S A;  1T8E A;  3MFI A;  1ZQS A;  4J9O A;  3PR4 A;  4DSK A;  4MFF A;  4NLN A;  4GXJ A;  1JX4 A;  4PH5 A;  7ICO A;  3OUY B;  3OHA A;  4YMN A;  4RQ4 A;  5DLF A;  2ALZ A;  5IIM A;  3V7K A;  4EBJ A;  4NLZ A;  5J2A A;  4PPX A;  4PHE A;  4G3I A;  2M2U A;  1BPB A;  4RPY A;  3ISB A;  2PFO A;  1RYR A;  5DKW A;  4RNO A;  2R8G A;  1R8C A;  8ICP A;  2PBE A;  3PML A;  2UVR A;  2HVH A;  3TQ1 A;  4DSJ A;  2ZUC A;  4FHY A;  3ZDB A;  4Q45 A;  1X9S A;  1OU5 A;  4ATB B;  4AT7 A;  3QZ7 A;  3MGH A;  2ZTC A;  4GC7 A;  1KFS A;  4K4G A;  4UQG A;  2M2W A;  1QLN A;  1D8Y A;  4F91 B;  4LVS A;  3OHB A;  1S0O A;  5DB6 A;  2NRK A;  4AT8 B;  5HC9 A;  4WBY A;  5KFE A;  2ZJ5 A;  1ZQT A;  2W9M A;  3PMN A;  2ZHB A;  1WCN A;  4DQP A;  4UB1 A;  1R89 A;  3TAR A;  9ICI A;  4RT3 A;  4DOA A;  2ZH3 A;  5J2H A;  8ICS A;  2UVU A;  3GIJ A;  4DF8 A;  4EZ9 A;  8ICM A;  1COO A;  2NRV A;  2P6U A;  3RTV A;  8ICY A;  4UBB A;  4Z6E A;  2VA2 A;  5EWE A;  1X9W A;  5J2C A;  3GIL A;  2M2V A;  4YMM A;  1NJY A;  3LK9 A;  3N4M B;  4QZI A;  4FO6 A;  5KFK A;  1RZT A;  3PX0 A;  1K1S A;  4YR0 A;  2MUT B;  2AGO A;  3Q8L A;  1SKR A;  2PFP A;  9ICR A;  1UEU A;  4QZ8 A;  5KT3 A;  1NO5 A;  5KFS A;  2OWO A;  3AQL A;  4I27 A;  4HYK A;  3V6K A;  4B9V A;  2IA6 A;  5KFX A;  1TFW A;  4JV0 A;  4DWI A;  3MDC A;  3ZDD A;  4KLO A;  4KLS A;  1BPZ A;  4E8F A;  3MFH A;  4BXO A;  7ICE A;  4C8N A;  5KFI A;  1CUK A;  2ZUB A;  1A76 A;  3RH4 A;  4F5P A;  3RJG A;  4ED1 A;  2BKE A;  4DL7 A;  3PW0 A;  3OGU A;  4UBC A;  5KTQ A;  3T5L A;  1L3V A;  4I2A A;  4WC7 A;  1WOT A;  4RWO A;  4XUS A;  4RUA A;  4DL4 A;  1B43 A;  3SV4 A;  2NRX A;  4MF2 A;  4B9T A;  3QE9 Y;  4F93 B;  1NJX A;  4KLE A;  4FHX A;  2AU0 A;  1ZQR A;  4RQ5 A;  3V72 A;  2ZTD A;  3RAQ A;  3H40 A;  3G6V A;  1XS9 D;  2VA3 A;  4JWN A;  5DG8 A;  4EYH B;  5J2G A;  3PY8 A;  5F9N A;  4WC3 A;  1TFY A;  5IIN A;  3PX4 A;  5DLG A;  3IM1 A;  1TK0 A;  4EBE A;  4O3P A;  4FS2 A;  3JPR A;  3T5H A;  4F4Z A;  3RJI A;  3RH6 A;  1NK4 A;  1ZQA A;  2DPJ A;  1R8A A;  2KFZ A;  3KHG A;  4ELU A;  3C66 A;  4AT9 A;  3RB0 A;  1JXL A;  3Q8R B;  4I2C A;  5KFQ A;  4NY8 A;  2XY7 A;  3BQ2 A;  4EBC A;  2C2R A;  1WCL A;  1SL0 A;  5KT7 A;  1L3U A;  2W8K A;  3HP6 A;  4M2Y A;  2DFL A;  5KFO A;  2HHP A;  2I1Q A;  4FHP A;  4WC2 A;  2AQ4 A;  2ZH7 A;  4RQ8 A;  4KLM A;  3OVS A;  1ZQV A;  2ISP A;  5J2E A;  4QWD A;  3MR6 A;  1FA0 A;  4TUR A;  1NKB A;  3MGI A;  5III A;  4QWB A;  4F4W A;  4B9U A;  4DSE A;  4O3R A;  3ZD9 A;  1KEJ A;  1JIH A;  1IM4 A;  3TI0 A;  2BPG A;  1LV5 A;  4IR9 A;  8ICE A;  1X2I A;  4Z6F A;  9ICW A;  2AJQ A;  5DED A;  4X4Q A;  4YG2 A;  2HHW A;  2H5X A;  5KG7 A;  4Z6C A;  3E2E A;  1U47 A;  4WBZ A;  2HW3 A;  4UB5 A;  3EPI A;  4O3Q A;  2UVV A;  3KTQ A;  4LT6 A;  4JV1 A;  1ZQB A;  2BCV A;  4J9M A;  2Q66 A;  4ECW A;  3V7J A;  1NKC A;  4JV2 A;  3TAP A;  4WC1 A;  4Q44 A; 
#chains in the Genus database with same CATH topology
 4Y2Y A;  2F44 A;  3VC8 A;  1XSN A;  4KLD A;  3AU2 A;  2M9N A;  2K8B B;  5J0Y A;  4C7Z A;  5B66 U;  2C22 A;  5FP0 A;  4KN4 A;  2FDR A;  4M6W B;  3RAX A;  1PK3 A;  3UXN A;  3RJH A;  2YTU A;  3BS7 A;  4M9N A;  1JMS A;  2BQU A;  2AQ0 A;  4KLH A;  3JCF A;  5J2D A;  3ETR A;  5J8Y C;  5J8Y A;  1U45 A;  2JV3 A;  3UQ0 A;  5DQI A;  5ALO A;  2A3V A;  5HR7 A;  1ZQC A;  4DSI A;  3BZC A;  2PI4 A;  3QUC A;  2QB0 B;  4OCZ A;  1DRG A;  3AU6 A;  4DQS A;  2F1J A;  3LDA A;  4TQS A;  2R8K A;  1ZOL A;  3HJ4 A;  2ZJA A;  1OUQ A;  1PX5 A;  2DKZ A;  3AEV A;  4WQK A;  1DGJ A;  4FH5 A;  4YR3 A;  3SQI A;  3ONN A;  4I2F A;  3PW5 A;  3GII A;  5TIS U;  3MGV A;  3HKZ C;  3PW2 A;  3O0F A;  2W04 A;  4ZH4 A;  2AHO B;  3BS5 A;  2HOI A;  5L1L A;  4QZA A;  2XC9 A;  4ZOH C;  7ICF A;  1MIV A;  2JEJ A;  4BWM A;  3NGD A;  3EWA A;  4R8U A;  2O5A A;  1TAQ A;  2W54 A;  1NZB A;  1T7P A;  4DCC A;  2O1P A;  5KG2 A;  3KD3 A;  4WQL A;  2PKE A;  4J9P A;  4QZ9 A;  1Q3U A;  1SZP A;  4EBD A;  3TFS A;  1WYG A;  1ZQP A;  3MC1 A;  1KQQ A;  1Y88 A;  4XA5 A;  3WKB A;  2D6F C;  3GQC A;  4LZD A;  4FBU A;  1YZ6 A;  4C8L A;  3FYH A;  3ICX A;  3TAC B;  4DL2 A;  4RNM A;  3AUO A;  5KG1 A;  5E79 U;  2NRZ A;  4JK1 A;  2KZM A;  4DFK A;  2MAX A;  4NLB A;  2PXI A;  4J9R A;  4I2I A;  1JXE A;  5HR6 A;  4YXM A;  4MEX A;  2KJ5 A;  4PZN A;  3KKA C;  3KKA A;  3UMG A;  8ICL A;  2M0N A;  4PL1 A;  4I2B A;  2FPK A;  3ZDA A;  3NVY A;  3THV A;  1ZQW A;  4QZC A;  1ZQO A;  3PST A;  4U6P A;  5B3P A;  5KNI A;  5KFU A;  4TUQ A;  2C2D A;  4DOC A;  2EWR A;  1ZQN A;  1F0M A;  3LWL A;  1TE2 A;  1RYU A;  2ZHA A;  4OJ5 A;  5ALR A;  4AT8 A;  2FI1 A;  2NV3 A;  3D2S A;  3BQT A;  5HRI A;  8ICU A;  2V4R A;  2P6R A;  1ZQK A;  4RUC A;  9ICH A;  2XY6 A;  1PK1 B;  4Q8F A;  4QZD A;  5HNK A;  5HMM A;  4PHP A;  2ESE A;  1JI7 A;  1BPX A;  5J0X A;  4O5K A;  3Q8M A;  1KDH A;  2KIW A;  3QEB Z;  3WU2 U;  2EZY A;  1QSY A;  5CJ7 A;  3PHZ A;  4AYB C;  5D4B A;  1TFR A;  1JN3 A;  3B0Y A;  3ORY A;  5J2I A;  2G5H B;  5J2K A;  2VJ5 A;  3R9K A;  3HWT A;  1NK7 A;  3EZ5 A;  5D49 A;  5KT4 A;  2KK0 A;  5KFD A;  3UXO A;  3T5K A;  4QW9 A;  2YB4 A;  4F4X A;  5DGA A;  1F5S A;  5AM5 A;  1QTM A;  5IIL A;  3M9M B;  3H39 A;  4NL9 C;  3RFA A;  2B21 A;  4X4P A;  4M9L A;  1ZQH A;  5AM4 A;  2N1R A;  4I2J A;  2ZIX B;  1RPL A;  1WWV A;  4DLE A;  4I2E A;  2WB1 C;  1S5L U;  4DQQ A;  3C1Y A;  3UQ2 A;  1Q79 A;  1K1Q A;  3E58 A;  1KRP A;  2XCA A;  1JAL A;  1DXS A;  4FBT A;  2V9W A;  2BCQ A;  1QQ6 A;  3OJS A;  1Z1V A;  4RQ7 A;  1ZQG A;  1ZQZ A;  2WHE A;  2KSO A;  2WF8 A;  4OJO A;  1TK5 A;  5D63 A;  3ISC A;  4F3O A;  1NK8 A;  5J0T A;  1FEZ A;  3GIM A;  3PV8 A;  5KG3 A;  4JLZ A;  2W9C B;  2KHQ A;  4M6W A;  3JPT A;  3MR5 A;  3U26 A;  4FS1 A;  1UQV A;  4LEY A;  4PZO A;  4TUP A;  3RJJ A;  7ICK A;  4EED A;  2EAP A;  4NXW A;  3NUQ A;  9ICQ A;  2LKY A;  1F44 A;  4K4H A;  1UT8 A;  2JXJ A;  4GXK A;  4QZH A;  4KN7 A;  3RBE A;  5J2F A;  4O67 A;  5L1M A;  3RRH A;  4EZ6 A;  4X4O A;  4ECV A;  3SR6 A;  1FIQ A;  4P4M A;  4HX0 A;  9ICK A;  4M5D A;  3AQN A;  2QB0 A;  4DFJ A;  1C20 A;  9ICE A;  2RDI A;  4MKP A;  3HRD D;  7ICJ A;  2E8M A;  4ED7 A;  4LEW A;  1BPE A;  2A19 A;  5KFT A;  5TZV A;  5J0O A;  3C2M A;  1S0N A;  3H0L B;  1SWW A;  2W7O A;  4ELV A;  5HRG A;  4EEB A;  3V6H A;  3WK5 A;  4O3N A;  4PGX A;  3AQM A;  1C7Y A;  4IG8 A;  2VAN A;  2ZH6 A;  3SMV A;  5ALZ A;  7ICN A;  1XO1 A;  2HOF A;  3S6J A;  3I1Y A;  2AH5 A;  5BOL A;  5KFL A;  1L8O A;  2Q0Z X;  5AIB A;  9ICF A;  2E1E A;  1U4B A;  4J9L A;  1HEK A;  4O3S A;  3EYZ A;  1ZQS A;  4MFF A;  3NWI A;  4USA A;  4PH5 A;  3OHA A;  1X9X A;  5DLF A;  2NYV A;  4KX3 A;  3KZI U;  3V7K A;  4EBJ A;  4NLZ A;  3CYM A;  4PPX A;  4RPY A;  2YMP A;  4RNO A;  3IN5 A;  2ZIU B;  4C4T A;  3TAD C;  3WK7 A;  2H3F A;  4QNL A;  5KAF U;  3D2Q A;  2KMD A;  2F76 X;  4F91 B;  5DB6 A;  2E8P A;  2P35 A;  4WBY A;  2ZJ5 A;  3C29 A;  2Z7J A;  2ZHB A;  3GZF A;  5ALY A;  4UB1 A;  2ZH3 A;  2NRV A;  4UAT A;  8ICY A;  4Z6E A;  2VA2 A;  2IUB A;  2R18 A;  4FO6 A;  1K1S A;  4YR0 A;  1SKR A;  3QX7 A;  3Q8L A;  2HCF A;  1NO5 A;  4C0Z A;  2G0A A;  4HYK A;  2VKQ A;  5KFX A;  4JV0 A;  4E8F A;  3MDC A;  7ICE A;  1PVQ A;  1DK2 A;  4I2A A;  2OM6 A;  2EAN A;  2GAF D;  3V72 A;  5AI5 A;  1IV8 A;  3RAQ A;  1ZD5 A;  4EYH B;  4WC3 A;  3KZX A;  5AK6 A;  2B56 A;  5ALG A;  3PX4 A;  1TK0 A;  3GU3 A;  4EBE A;  1NK4 A;  4FS2 A;  2ID1 A;  1PK1 A;  1R8A A;  2IOF A;  1WWU A;  1JXL A;  5KFQ A;  1WCL A;  4FHP A;  1SXE A;  2W8K A;  3HP6 A;  3CNH A;  2I1Q A;  3N7S C;  1FA0 A;  4TUR A;  4F4W A;  2H3Z A;  1IM4 A;  4IR9 A;  5JTG A;  3WK6 A;  2H5X A;  2DUY A;  1U47 A;  3SD7 A;  2HW3 A;  3ALR A;  1COK A;  4O3Q A;  4NLC A;  3KTQ A;  4LT6 A;  1L7M A;  1OXJ A;  1X42 A;  1NKC A;  5EE0 A;  3TAP A;  4PHD A;  3JPQ A;  4NKU A;  4ECQ A;  1V38 A;  1T3N A;  4QZF A;  1S9F A;  4B9M A;  2GA9 D;  2HHU A;  4OAG A;  2HOQ A;  1Z4O A;  5KFM A;  1XC9 A;  4UAW A;  3ISD A;  3WKE A;  1D9D A;  1T3Q A;  1U49 A;  2LPE A;  4TQR A;  2LBO A;  5KL1 B;  2ZIX A;  4MHV A;  4RQN A;  4RNN A;  2R8I A;  1IIP A;  3F2D A;  5CFT A;  1U48 A;  1XWL A;  1ZD2 P;  4KIT B;  1SKW A;  2BBH A;  4PGY A;  4MFA A;  3UPQ A;  4E80 A;  3RB3 A;  3EUB 2;  3QYP A;  1ZQE A;  3JPN A;  2KE7 A;  1NKE A;  3WFS C;  4M47 A;  1TK8 A;  4QWC A;  7ICS A;  5J0U A;  5DDM A;  2YMM A;  1HIW A;  3HJ1 A;  5EOZ A;  4IC9 A;  5AKG A;  8ICR A;  4F71 A;  5HR9 A;  3IP4 B;  3UXP A;  1ZJN A;  5AM1 A;  2KD1 A;  5F2V O;  3H4D A;  1NK9 A;  3C21 A;  4IQU A;  1X40 A;  1SXD A;  2UVW A;  3LVW A;  4RQ2 A;  4UB8 U;  4US8 A;  3QU7 A;  1MSW D;  4F5N A;  1Z00 A;  2YML A;  4DFM A;  4XQ7 A;  3HPO A;  1ZQQ A;  2BQR A;  1Z4N A;  2KIV A;  5L1J A;  1L3S A;  3QU9 A;  5DG7 A;  1NK6 A;  2ZH4 A;  4YD1 A;  4LEV A;  4NLG A;  3ETL A;  1LKY A;  2XI9 A;  5H2F U;  3BJY A;  3AN1 A;  4UB4 A;  2BE3 A;  4QWA A;  2W3R A;  1MA7 A;  2WF7 A;  3ZD8 A;  2FLN A;  4DOB A;  2F8K A;  1XU4 A;  2NO5 A;  4NV0 A;  2ZUD A;  5KG6 A;  3G6X A;  3K1R B;  4AP9 A;  5HML A;  3H8M A;  1FFV A;  2W43 A;  4FHV A;  1CI4 A;  3F2C A;  4E7X A;  7ICH A;  3MCR A;  3SAF A;  2FJ6 A;  8ICI A;  4KX5 A;  1TAU A;  4EBK A;  3Q8S B;  2EAO A;  2JH1 A;  4QZG A;  2RLT A;  4RU9 A;  9ICJ A;  2LMR A;  5KFF A;  2ZIU A;  4O5C A;  7ICP A;  3WFO A;  5CRX A;  2H3V A;  1UA1 A;  4JUZ A;  1S77 D;  2VA8 A;  3HW8 A;  1X9M A;  1L5U A;  5CHG A;  1B22 A;  9ICO A;  1PUZ A;  2KVS A;  1RYS A;  5KFZ A;  4NM1 A;  1X66 A;  5DQG A;  4YR2 A;  3NRZ A;  3Q8Q B;  5DB7 A;  1ZQJ A;  8ICA A;  1JRO A;  5EE9 A;  4IQT A;  9ICX A;  1ZD4 A;  3SEN A;  4QIW F;  2JEI A;  1JRP A;  1SGG A;  4KLJ A;  4Q8E A;  2D3D A;  5A0L A;  7ICI A;  1CRX A;  4RQ3 A;  7ICM A;  4X4R A;  2ZJ8 A;  5CA7 A;  5AI8 A;  1MQ2 A;  3AQF A;  2XGP A;  2WF5 A;  3QNM A;  4OJL A;  4U7C A;  2KEY A;  1S0M A;  5AHX A;  4WC4 A;  3H0M B;  2W9A A;  3CP8 A;  1IXR A;  8ICN A;  2DR9 A;  1UHU A;  4G9B A;  3NAS A;  2JMG A;  1T4G A;  5BPC A;  4Y2Q A;  2W7P A;  3PVX A;  3QU2 A;  3AL0 B;  4JLX A;  2QKQ A;  5CFU A;  4ED3 A;  2KJ8 A;  4F4K A;  4R63 A;  1Z19 A;  1GPJ A;  3BQ1 A;  4FO1 A;  4BWJ A;  3GV8 B;  5L1K A;  2KTQ A;  3UMC A;  5T14 A;  3F5E A;  1DOQ A;  3C5G A;  1T94 A;  2OCE A;  3WFP A;  2A1J B;  2GH1 A;  3IV6 A;  3OV7 A;  2XID A;  8ICB A;  1HUO A;  2K4I A;  2G09 A;  1XNS A;  1L3T A;  2F2A B;  1ZQU A;  2DRA A;  5DBB A;  4US9 A;  4ECS A;  4P4O A;  2FMQ A;  4OAI Z;  5J0S A;  3TFR A;  3SZ2 A;  2HMX A;  4M9J A;  3K1Z A;  1QSL A;  3HJE A;  3FDS A;  1XSL A;  3RF9 A;  8ICO A;  4M0A A;  2IHO A;  4OO1 J;  3PSI A;  2ZTE A;  4X5V A;  2J6S A;  3SI8 A;  5KT2 A;  2F77 X;  3HX0 A;  3B0X A;  2AGQ A;  1RXV A;  3NRW A;  4O68 A;  2ZH5 A;  2IHM A;  4UAR A;  2RP5 A;  1MN8 A;  3HIY A;  5DBC A;  4GFJ A;  4RWQ A;  4EX7 A;  1UT5 A;  2E8N A;  4ATB A;  5AKE A;  4O9M A;  5ALW A;  1M6Y A;  1NJW A;  4Y2S A;  1S10 A;  1NK5 A;  5CEH A;  1A6S A;  3C5F A;  4DEZ A;  3BDP A;  5AI6 A;  1AQ6 A;  2NRT A;  3EW9 A;  2L5Y A;  2ES6 A;  4DLG A;  1ZQM A;  4CF3 A;  1BVS A;  1UEV A;  2ZXH A;  4P0Q B;  3M1Y A;  5EWF A;  2CRX A;  4Y2J A;  1HJP A;  3QEA Z;  2NRW A;  4F2S A;  4K4I A;  2MUT A;  1VLB A;  2OYY A;  2BCS A;  1BGX T;  1ZET A;  3T3F A;  5AI4 A;  5IIK A;  5BOM A;  4M9H A;  4KLG A;  2BQ3 A;  1A0P A;  4EYI B;  4K9B A;  4YFK A;  4J9S A;  3HKZ F;  4GXJ A;  7ICO A;  3NVW A;  5JRT A;  5IIM A;  2E3T A;  2KIC A;  1ZD3 A;  2PFO A;  1R8C A;  5DKW A;  8ICP A;  5AKK A;  2HVH A;  4DSJ A;  2ZUC A;  4FHY A;  3ZDB A;  2MA1 A;  1ED1 A;  4GC7 A;  3AMZ A;  1RQL A;  4KMO B;  4LVS A;  4FZM A;  1S0O A;  4O69 A;  5HC9 A;  3PSF A;  4P0P B;  2Y0S C;  3TAR A;  2WAQ C;  2UVU A;  3GIJ A;  8ICM A;  2XIC A;  4UBB A;  3SAH A;  2M2V A;  3LK9 A;  2D8C A;  2GOL A;  2E5S A;  2BZF A;  1UCV A;  2PFP A;  4QZ8 A;  1NI3 A;  3KBB A;  1TFW A;  1Q8K A;  3D2N A;  3ZDD A;  2ZIW B;  1CUK A;  4WJ3 B;  4F5P A;  4ED1 A;  4DL7 A;  3NVO A;  5AKX A;  5KTQ A;  1Q3V A;  4XUS A;  4RUA A;  4NJ8 A;  3QE9 Y;  3WKA A;  4F93 B;  1NJX A;  2AU0 A;  1ZQR A;  4RQ5 A;  4IS7 A;  1XS9 D;  5DG8 A;  3PY8 A;  1QQ5 A;  5F9N A;  5ALI A;  2DBY A;  5DLG A;  4UB6 U;  1J2M A;  3BZK A;  4O3P A;  3PZP A;  2DPJ A;  1ZQA A;  3C66 A;  4FZN A;  3KHG A;  4ELU A;  1PVR A;  2XY7 A;  4EBC A;  2C2R A;  2ODG A;  1SL0 A;  4M2Y A;  3K7D A;  5KFO A;  2HHP A;  5ALU A;  3M6K A;  3MR6 A;  1NKB A;  3MGI A;  4O3R A;  2Y9U A;  4QWB A;  4DSE A;  3TI0 A;  2BPG A;  8ICE A;  5AK4 A;  2H3I A;  1B4F A;  2YN4 A;  5AKI A;  4UB5 A;  2UVV A;  5ALQ A;  2BCV A;  4UW9 A;  2BDP A;  2HBJ A;  4X4U A;  2HBL A;  1S8O A;  5GTI U;  2I9G A;  2IMW P;  4F8R A;  4DO9 A;  3M7D A;  5ALT A;  2FMP A;  2FLL A;  4AYB F;  3C2L A;  2W11 A;  8ICX A;  1F5A A;  4KLU A;  2BBJ A;  4I29 A;  5F9L A;  2ATL A;  5ALV A;  9ICB A;  2HBK A;  5K4L A;  5KT6 A;  1JAJ A;  2EZX A;  2FCL A;  4O0I A;  3EF2 A;  3I28 A;  4C8K A;  1ZJM A;  3IG8 A;  2LYA A;  2K4P A;  2W03 A;  2Y0S F;  2WB1 F;  3OPX A;  4F5Q A;  2NO4 A;  2OEH A;  7ICR A;  8ICQ A;  2JGA A;  4A8E A;  3IG5 A;  4ECT A;  3D6J A;  5JU5 A;  1RM6 C;  4DFD A;  4MEY A;  4WH5 A;  3QZ8 A;  2KV2 A;  2LYH A;  5ALF A;  5HP4 A;  3M8S A;  3DV9 A;  3N28 A;  2W9B B;  3H8S A;  4JMU A;  4OAH A;  1SL2 A;  1YLQ A;  3Q8K A;  4LJX A;  4NM2 A;  3IHQ B;  5J0Q A;  1BPD A;  3GDX A;  5DGB A;  4HAI A;  3H3A A;  3DDH A;  2ZH2 A;  5J2B A;  2PMZ C;  4WOY A;  2K8A A;  4FE3 A;  3IRU A;  1KL9 A;  4UAV A;  1L7N A;  4FHW A;  1KNY A;  1KBU A;  9ICL A;  4NXX A;  2ASL A;  1RG6 A;  3H4B A;  4RZR A;  1N56 A;  4BGD A;  2JEG A;  2YY6 A;  3KHR A;  2Y9T A;  4YXJ A;  3RH5 A;  1ZQI A;  1WUD A;  2DL0 A;  4X0B A;  2KVC A;  5JUM A;  5ALM A;  4RQ6 A;  1O08 A;  4AT7 B;  3SV3 A;  4DL5 A;  2ISO A;  2ASJ A;  2ZXI A;  4N7R A;  5AI9 A;  3LYS A;  4P0Q A;  5J0R A;  4B9S A;  5J2J A;  5KG0 A;  4BX9 C;  2CPR A;  4PL2 A;  4DF4 A;  1MC8 A;  5C0Y A;  1TV9 A;  5HRH A;  5DBA A;  4Q43 A;  5KFG A;  4X4S A;  4RQM A;  2WFA A;  1O03 A;  1N2X A;  4ED2 A;  3GIK A;  2RQ5 A;  5KFW A;  1S97 A;  1VFG A;  1ARO P;  5AI0 A;  2XCP A;  1V4A A;  4J03 A;  2HBM A;  2OHF A;  5KFA A;  4I2G A;  8ICV A;  1KFT A;  3H7I A;  3RR8 A;  4J9K A;  1Z3E B;  3JPS A;  4KB6 A;  2QLT A;  2GO7 A;  1RDF A;  1V97 A;  7ICQ A;  3F2B A;  3GFK B;  4AT9 B;  1P7D A;  5KFJ A;  2B4V A;  5CFS A;  3UPS A;  4K96 A;  1NZP A;  5DDY A;  4Y2T A;  4QZE A;  3OJU A;  1Z1B A;  5HRL A;  4BJQ A;  2DVI A;  2ZIW A;  3WKC A;  2BPF A;  3DEE A;  4KLQ A;  4X4N A;  2BPC A;  1X6J A;  1R8B A;  4KLL A;  1URJ A;  3RBD A;  5DB8 A;  5CHE A;  4EX6 A;  2PMZ F;  4F72 A;  2W9C A;  3V6J A;  4I28 A;  3QUT A;  4DQI A;  3C2K A;  4NXT A;  4RT2 A;  4C4S A;  2G06 A;  5AKJ A;  4UAY A;  4IQV A;  4DQR A;  1ZYQ A;  9ICU A;  4ECR A;  4DS5 A;  2RHF A;  8ICF A;  3OWG A;  3OSN A;  3HIL A;  2AGP A;  3K4G A;  4IL6 U;  3MR3 A;  4EEY A;  5KFH A;  2KG5 A;  1A77 A;  3CW2 C;  4CDG A;  5HRD A;  3Q8P B;  2DPI A;  2EAM A;  4ECX A;  2I5H A;  4ECU A;  3PO5 A;  4RPZ A;  2KN7 A;  3PW7 A;  3H8W A;  2KZ3 A;  4I2H A;  4YCX A;  1N61 A;  1MIY A;  2HHV A;  3JZ0 A;  2WF9 A;  3N97 B;  3E0F A;  2K60 A;  4K99 A;  2F1H A;  4KM5 A;  1ZXI A;  2DR7 A;  5CP2 A;  5G5H A;  4IQW A;  2JZB B;  3QUB A;  4EP7 A;  4ED8 A;  4QZB A;  4C80 A;  2FMS A;  1BPY A;  3AQK A;  3HT3 A;  3PX6 A;  1VJ7 A;  5AM3 A;  1YZ7 A;  3NS1 A;  4KMU A;  3FC4 A;  2KHV A;  8ICJ A;  4F5O A;  2AXT U;  3H8J A;  4DSF A;  4TUS A;  8ICW A;  1ZQD A;  4B9N A;  3ZDE A;  3M8R A;  4IRD A;  1KFD A;  3QU5 A;  1QSS A;  4X4V A;  3RB4 A;  2LM4 A;  2IHN A;  5C5J A;  4F50 A;  1LB2 B;  3IDW A;  3QUQ A;  3NVZ A;  2HHX A;  4M04 A;  4MFC A;  2EDU A;  3VCB A;  2H3Q A;  3NTU A;  4Y2V A;  3T5J A;  3WFQ E;  2PFN A;  3JPO A;  2C28 A;  4DL3 A;  4GIB A;  3RRG A;  2HI0 A;  9ICN A;  2YQE A;  9ICP A;  7ICT A;  4RQ1 A;  3LWM A;  2XGQ A;  1UA0 A;  4I27 A;  4R66 A;  3H37 A;  2KSO B;  2W9B A;  2DF4 B;  2OXO A;  4FZL A;  1UPH A;  2FPM A;  3PNC A;  5J0P A;  2HVI A;  3ER9 B;  2EZZ A;  2YB1 A;  1MQ3 A;  3K75 D;  9ICM A;  5CWR A;  5L9X A;  2XY5 A;  1KTQ A;  5D61 A;  3G6Y A;  3AM9 A;  3T79 A;  2YX8 A;  3KHH A;  2P66 A;  5AKZ A;  4EEK A;  4E0D A;  5KFN A;  2Q4T A;  4JB3 A;  4J9O A;  4NLN A;  3OUY B;  4YMN A;  4RQ4 A;  2ALZ A;  5J2A A;  1TAM A;  4PHE A;  2M2U A;  1SV0 C;  1SV0 A;  2R8G A;  1RYR A;  4K8V A;  5ALD A;  2PBE A;  3PML A;  3A0H U;  2UVR A;  1D8B A;  2DGZ A;  2JH7 A;  4Q45 A;  4AT7 A;  2ZTC A;  1L6N A;  2M2W A;  4Y2X A;  1D8Y A;  2NRK A;  1ZQT A;  3PMN A;  4DQP A;  4DOA A;  1SV4 A;  8ICS A;  4DF8 A;  3CK6 A;  3QXG A;  3RTV A;  5AK3 A;  3ER8 C;  3GIL A;  4YMM A;  3BQ7 A;  3ERC C;  4QZI A;  5KFK A;  2QAR B;  5F3X B;  1RZT A;  3PX0 A;  9ICR A;  2AGO A;  1PVP A;  2KKP A;  5KFS A;  4K9A A;  4B9V A;  5ALL A;  4DWI A;  4KLS A;  1BPZ A;  3MFH A;  2JR5 A;  5KFI A;  1A76 A;  3RJG A;  3PW0 A;  2BKE A;  4UBC A;  2F3N A;  2NRX A;  5AIC A;  4O3M A;  2G5I B;  5D62 A;  3G6V A;  3NVV A;  4JWN A;  1VDV A;  3IM1 A;  3RH6 A;  3JPR A;  3T5H A;  3RJI A;  5AK5 A;  4AT9 A;  2KFZ A;  3RB0 A;  3BQ2 A;  2HDO A;  1L7P A;  5KT7 A;  1IG6 A;  4WC2 A;  2AQ4 A;  4LEZ A;  4RQ8 A;  4KLM A;  1ZQV A;  2ISP A;  2MU2 A;  2HN1 A;  1JIH A;  1LV5 A;  1X2I A;  4Z6F A;  9ICW A;  5KG7 A;  4Z6C A;  1VJ5 A;  4JV1 A;  4J9M A;  2CXY A;  4JV2 A;  2BR0 A;  3JYY A;  1KW4 A;  1KSP A;  1KN5 A;  1TKD A;  3UM9 A;  2KZZ A;  5J29 A;  2OH2 A;  2DR5 A;  5EWG A;  1UEU A;  3PO4 A;  3PW4 A;  4P2H A;  4M9G A;  1D9F A;  1LVH A;  2EH9 A;  4KLI A;  2BGW A;  1XSP A;  2LI6 A;  1K5O A;  1NJZ A;  4K98 A;  4EEL A;  2BDU A;  1ZQ1 C;  4O5E A;  5B5E U;  2K8C B;  2O6K A;  2KFN A;  4ED0 A;  5J0W A;  4F92 B;  1X6I A;  2ZIV B;  3GV5 B;  2RFF A;  4CCH A;  4Z6D A;  5KFB A;  3SAG A;  1RQN A;  1ZQF A;  4UD4 A;  4CF4 A;  5KFP A;  5HRE A;  5HRB A;  4YMO A;  1N48 A;  1EXN A;  2R8J A;  2JZB A;  3PR5 B;  2HHT A;  3KFU F;  1NNL A;  2GLE A;  1L7O A;  2A1A A;  4GC6 A;  5AKH A;  3AQE A;  3C1Z A;  3L9D A;  2G07 A;  2PI5 A;  5IIJ A;  4PHA A;  2BCR A;  2J6T A;  9ICT A;  5D46 A;  4P4P A;  2Y1J A;  4X0A A;  4NL9 A;  5KFY A;  9ICV A;  4R64 A;  4WCW A;  2W8L A;  5EE1 A;  4OD0 A;  2KNJ A;  4UAZ A;  1JUD A;  3RR7 A;  3PSP A;  4YVZ A;  3JPP A;  5DG9 A;  8ICC A;  5KG5 A;  7ICV A;  4ECY A;  2KOB A;  1J97 A;  2FPL A;  1SL1 A;  8ICT A;  2Y1I A;  3SYZ A;  4XQ8 A;  4B9L A;  1SB3 C;  2VIX A;  1NK0 A;  4YQW A;  4OAF A;  4IR1 A;  3ED5 A;  8ICZ A;  4GLX A;  3OTQ A;  1SKS A;  4F5R A;  4J9Q A;  5ALP A;  2M2T A;  3MBY A;  3GV7 B;  2I6X A;  2FLP A;  4XRH A;  4S3N A;  3F5A A;  4FH3 A;  3CRX A;  4C8M A;  4O3O A;  2R8H A;  3FM9 A;  5G5G A;  8ICK A;  2FE9 A;  7ICU A;  1ZRM A;  5KFR A;  4XJE A;  5KT5 A;  4DL6 A;  3OUY A;  1OW5 A;  1JQR A;  3ZI4 A;  4UB3 A;  1NOM A;  4BXO B;  1Z00 B;  3M9O B;  3OSP A;  4NLK A;  5AKL A;  5CR0 A;  2KJ9 A;  1CEZ A;  5ALJ A;  3LVV A;  3TAQ A;  1LKY B;  9ICC A;  1SWV A;  2VJ4 A;  4LZG A;  9ICA A;  3OVB A;  3B9J A;  7ICL A;  1S76 D;  3ZDC A;  2B6G A;  1S0V A;  2GWS A;  4EV6 A;  4DS4 A;  4UB2 A;  5HRK A;  5B3Q A;  2K89 A;  3KOO A;  5ALK A;  2QAR A;  3M9N B;  4KLT A;  2ZH1 A;  2KP7 A;  4NXV A;  1PZN A;  4PGQ A;  2IOH A;  2WAQ F;  4MF8 A;  5CB1 A;  2HN2 A;  2B0C A;  2JEF A;  5KG4 A;  4C7Y A;  4NKT A;  2A1J A;  3A0B U;  1ZQL A;  2IBK A;  3C18 A;  4RQ0 A;  3M6Z A;  5HRF A;  5ALX A;  3C23 A;  1BNO A;  4K97 A;  3KHL A;  3C28 A;  3MAB A;  3QU4 A;  1FO4 A;  4CF5 A;  2ASD A;  3H38 A;  1D8L A;  2WF6 A;  5HHH A;  2PFQ A;  1MIW A;  5ALN A;  3TAD A;  4IRC A;  2DWQ A;  4QWE A;  2RDJ A;  5DQH A;  5ALH A;  1KKX A;  4ECZ A;  4YP3 A;  4J9N A;  3TAN A;  4IRK A;  9ICG A;  1DGS A;  4RWN A;  2DKX A;  2HHQ A;  2EQY A;  4Y2R A;  3RJF A;  4ED6 A;  1ZQX A;  4UAU A;  4UD5 A;  4DSL A;  1V9P A;  4R65 A;  5DEC A;  2B51 A;  1U9L A;  1HUZ A;  4NXU A;  5KL8 B;  8ICG A;  4Y2U A;  8ICH A;  2DRB A;  3MR2 A;  2BHN A;  2CN1 A;  5KFC A;  4B6J A;  4YN4 A;  2WTF A;  3N7P D;  4YD2 A;  2MSN A;  1KLN A;  2ZH9 A;  4I2D A;  2F8L A;  5JTI A;  2ZG6 A;  5DB9 A;  4GXI A;  3WFR E;  1FFU A;  4ELT A;  2DR8 A;  2LM1 A;  1Q78 A;  4WC6 A;  3TKA A;  3WKD A;  3RJE A;  1N60 A;  4PJ0 U;  4KLF A;  2LHT A;  2ZIV A;  3BS5 B;  4C4R A;  9ICS A;  2C2E A;  4R8U B;  5KFV A;  2V4Q A;  2ZH8 A;  2XO7 A;  2J6U A;  3LQC B;  3EPG A;  4CRX A;  2IOF K;  5ALS A;  4CGZ A;  4OJP A;  4WC0 A;  4EEN A;  4QW8 A;  1RXW A;  3MDA A;  4RPX A;  4JWM A;  1XO0 A;  2BCU A;  3NYB A;  1ZRN A;  4RWP A;  1TVA A;  4P0P A;  3BQ0 A;  4WC5 A;  3N7R C;  4FFD A;  2W3S A;  3RJK A;  4NXZ A;  5L1I A;  3OVA A;  1H38 A;  3L3F X;  4UAS A;  4X4T A;  4F2R A;  1ZQY A;  2F1I A;  4DFP A;  1OU5 A;  5IIO A;  1QH9 A;  3RB6 A;  1N63 A;  3I76 A;  3V7L A;  4BDP A;  4F4Y A;  1J2N A;  2JHD A;  7ICG A;  4C8O A;  4KTQ A;  5HHI A;  1UET A;  2HHS A;  5AM2 A;  1SIJ A;  1N5W A;  1T8E A;  3MFI A;  3PR4 A;  4DSK A;  1JX4 A;  2E8O A;  2DQN B;  4G3I A;  4ACO A;  1BPB A;  3ISB A;  2YMQ A;  2XVT A;  4OJ6 A;  3TQ1 A;  1Q46 A;  3SEI A;  1QCK A;  1X9S A;  4ATB B;  3QZ7 A;  3MGH A;  1KFS A;  4K4G A;  5EE3 A;  4UQG A;  1QLN A;  3FAH A;  4AT8 B;  3OHB A;  1YT3 A;  3J81 j;  2K4H A;  5KFE A;  4NWI A;  2W9M A;  1WCN A;  1R89 A;  1B0X A;  4CE6 A;  4RT3 A;  9ICI A;  5J2H A;  4EGW A;  1ECW A;  3WK9 A;  4EZ9 A;  2RRD A;  1COO A;  3WK8 A;  2LYB A;  2P6U A;  2K4E A;  5EWE A;  1X9W A;  5AM0 A;  2E1F A;  5J2C A;  4QIW C;  1NJY A;  3N4M B;  2MUT B;  3UMB A;  5KT3 A;  2OWO A;  3AQL A;  3V6K A;  2W55 A;  2IA6 A;  5AKY A;  4KLO A;  4BXO A;  4C8N A;  3L5K A;  2ZUB A;  3RH4 A;  4WC7 A;  3OGU A;  3T5L A;  1L3V A;  1WOT A;  4RWO A;  5ALE A;  2HSZ A;  4DL4 A;  1B43 A;  3SV4 A;  4MF2 A;  4B9T A;  1DK3 A;  1QQ7 A;  4KLE A;  4FHX A;  3H0R B;  2ZTD A;  3H40 A;  2VA3 A;  2KKV A;  5J2G A;  1TFY A;  5IIN A;  4QJF B;  3NKU A;  5KAI U;  1N62 A;  4F4Z A;  1GO3 F;  2G08 A;  3L4P A;  4CNQ A;  4BUG A;  4I2C A;  3Q8R B;  4NY8 A;  1L3U A;  2ZH7 A;  2DFL A;  1L8L A;  3WK4 A;  1V85 A;  3OVS A;  5J2E A;  4QWD A;  4ICA A;  4Y2P A;  5III A;  2MRL A;  4B9U A;  3ZD9 A;  1KEJ A;  5AIA A;  4O6A A;  2AJQ A;  5DED A;  4X4Q A;  4YG2 A;  2HHW A;  3F53 A;  4I0U A;  3E2E A;  2JRZ A;  1N5X A;  4WBZ A;  3EPI A;  1BNP A;  1WG8 A;  5GTH U;  1ZQB A;  2Q66 A;  4ECW A;  1SZH A;  2QB1 A;  3V7J A;  4WC1 A;  4Q44 A; 
#chains in the Genus database with same CATH homology
 2BDP A;  4NKU A;  4X4U A;  2BR0 A;  3JYY A;  4ECQ A;  1T3N A;  2I9G A;  4QZF A;  1S9F A;  4B9M A;  2IMW P;  4F8R A;  1KSP A;  4DO9 A;  1XSN A;  1TKD A;  2FMP A;  2FLL A;  4KLD A;  2HHU A;  2KZZ A;  5J29 A;  3AU2 A;  2DR5 A;  5KFM A;  5EWG A;  2M9N A;  3C2L A;  1XC9 A;  9ICS A;  5J0Y A;  4UAW A;  3PO4 A;  3ISD A;  3PW4 A;  8ICX A;  1F5A A;  4P2H A;  2C22 A;  3RAX A;  4KN4 A;  4M6W B;  1D9F A;  4M9G A;  4KLI A;  1D9D A;  4KLU A;  1U49 A;  3UXN A;  2BGW A;  4TQR A;  1XSP A;  4I29 A;  5F9L A;  2ATL A;  9ICB A;  1NJZ A;  5KT6 A;  1JAJ A;  4RNN A;  2R8I A;  3RJH A;  4O0I A;  4O5E A;  2KFN A;  4ED0 A;  5J0W A;  4M9N A;  1JMS A;  4F92 B;  2BQU A;  2AQ0 A;  4C8K A;  3GV5 B;  4KLH A;  1U48 A;  2RFF A;  1XWL A;  4KIT B;  5J2D A;  1SKW A;  4CCH A;  4Z6D A;  4PGY A;  1ZJM A;  4MFA A;  5KFB A;  3UPQ A;  1U45 A;  3UQ0 A;  5DQI A;  1ZQF A;  4E80 A;  3RB3 A;  4UD4 A;  4F5Q A;  5KFP A;  5HRE A;  1ZQC A;  4YMO A;  1ZQE A;  5HRB A;  3JPN A;  7ICR A;  4DSI A;  2PI4 A;  1NKE A;  8ICQ A;  3WFS C;  1N48 A;  1EXN A;  3AU6 A;  4DQS A;  2R8J A;  2F1J A;  4ECT A;  4M47 A;  2JZB A;  3LDA A;  3PR5 B;  2HHT A;  1TK8 A;  4TQS A;  4MEY A;  4QWC A;  3QZ8 A;  2LYH A;  4GC6 A;  5J0U A;  5HP4 A;  5DDM A;  2R8K A;  7ICS A;  3HJ4 A;  3C1Z A;  3M8S A;  3HJ1 A;  2W9B B;  3H8S A;  5EOZ A;  3L9D A;  2ZJA A;  1PX5 A;  2PI5 A;  8ICR A;  5HR9 A;  1SL2 A;  1YLQ A;  3Q8K A;  4NM2 A;  3UXP A;  1ZJN A;  4FH5 A;  5IIJ A;  4PHA A;  3IHQ B;  3H4D A;  2BCR A;  1NK9 A;  4PHD A;  5F2V O;  5J0Q A;  4YR3 A;  1BPD A;  2ID1 A;  2J6T A;  4I2F A;  3PW5 A;  3GII A;  9ICT A;  3GDX A;  3C21 A;  5DGB A;  5D46 A;  4P4P A;  2Y1J A;  4X0A A;  4IQU A;  3PW2 A;  5KFY A;  3H3A A;  2UVW A;  9ICV A;  2ZH2 A;  5J2B A;  4R64 A;  4WCW A;  4ZH4 A;  5L1L A;  4RQ2 A;  4QZA A;  2XC9 A;  7ICF A;  1MSW D;  1MIV A;  2W8L A;  2JEJ A;  4BWM A;  3NGD A;  3EWA A;  4R8U A;  4F5N A;  2O5A A;  1TAQ A;  1Z00 A;  1KNY A;  4DFM A;  9ICL A;  4FHW A;  4XQ7 A;  3HPO A;  1ZQQ A;  2ASL A;  1T7P A;  4UAZ A;  2O1P A;  3H4B A;  5KG2 A;  2BQR A;  4RZR A;  3RR7 A;  5L1J A;  1N56 A;  1L3S A;  5DG7 A;  2ZH4 A;  1NK6 A;  4BGD A;  4YVZ A;  3JPP A;  5DG9 A;  4J9P A;  8ICC A;  5KG5 A;  4YD1 A;  4QZ9 A;  7ICV A;  4ECY A;  2JEG A;  1SZP A;  4EBD A;  3TFS A;  3KHR A;  4NLG A;  4YXJ A;  3ETL A;  2FPL A;  1SL1 A;  8ICT A;  3RH5 A;  3BJY A;  1ZQI A;  2Y1I A;  3SYZ A;  4UB4 A;  1ZQP A;  4X0B A;  4XQ8 A;  4B9L A;  5JUM A;  2BE3 A;  4RQ6 A;  4QWA A;  1NK0 A;  4YQW A;  1Y88 A;  4IR1 A;  4XA5 A;  4AT7 B;  3GQC A;  4LZD A;  4FBU A;  8ICZ A;  3ZD8 A;  4GLX A;  3SV3 A;  4C8L A;  3FYH A;  1SKS A;  4DOB A;  4F5R A;  4DL5 A;  2FLN A;  2ISO A;  4DL2 A;  4RNM A;  2ASJ A;  3AUO A;  4J9Q A;  1XU4 A;  2M2T A;  5KG1 A;  3MBY A;  3GV7 B;  4RWP A;  2FLP A;  2ZUD A;  2NRZ A;  5J0R A;  4B9S A;  4X4V A;  4XRH A;  5KG6 A;  3G6X A;  4JK1 A;  4DSL A;  4DFK A;  2MAX A;  5J2J A;  2KZM A;  4S3N A;  5KG0 A;  4FH3 A;  2PXI A;  4J9R A;  4I2I A;  5HML A;  1JXE A;  4YXM A;  4MEX A;  4DF4 A;  1MC8 A;  4C8M A;  4O3O A;  8ICL A;  2R8H A;  4FHV A;  8ICK A;  4E7X A;  1TV9 A;  5HRH A;  5DBA A;  4Q43 A;  4I2B A;  7ICU A;  7ICH A;  2FPK A;  5KFG A;  5KFR A;  3ZDA A;  5KT5 A;  4DL6 A;  4X4S A;  8ICI A;  3OUY A;  1JQR A;  4UB3 A;  3THV A;  1ZQW A;  4QZC A;  4ED2 A;  1ZQO A;  1TAU A;  1NOM A;  3Q8S B;  3GIK A;  4EBK A;  4BXO B;  1Z00 B;  5KFW A;  3M9O B;  3OSP A;  1S97 A;  5KFU A;  4QZG A;  4RU9 A;  4TUQ A;  2C2D A;  4NLK A;  9ICJ A;  5KFF A;  4DOC A;  1VFG A;  1ARO P;  4O5C A;  7ICP A;  2XCP A;  3WFO A;  5CR0 A;  1V4A A;  1ZQN A;  3LWL A;  1CEZ A;  5KFA A;  4I2G A;  8ICV A;  2ZHA A;  1KFT A;  3TAQ A;  3H7I A;  9ICC A;  3RR8 A;  4AT8 A;  4J9K A;  1Z3E B;  3JPS A;  3BQT A;  5HRI A;  1UA1 A;  4JUZ A;  8ICU A;  2V4R A;  2P6R A;  1ZQK A;  4RUC A;  4LZG A;  2VA8 A;  1S77 D;  9ICH A;  2XY6 A;  9ICA A;  3OVB A;  7ICL A;  3HW8 A;  1X9M A;  1L5U A;  5CHG A;  7ICQ A;  1B22 A;  3GFK B;  4Q8F A;  1S76 D;  3ZDC A;  9ICO A;  4AT9 B;  4QZD A;  5HNK A;  1RYS A;  1S0V A;  5KFJ A;  2GWS A;  5KFZ A;  4NM1 A;  9ICM A;  4DS4 A;  5DQG A;  5HMM A;  4PHP A;  4UB2 A;  5HRK A;  3UPS A;  4YR2 A;  4KLT A;  3M9N B;  2ZH1 A;  5DDY A;  1BPX A;  1PZN A;  5J0X A;  4PGQ A;  4QZE A;  3Q8Q B;  4MF8 A;  4O5K A;  3Q8M A;  5DB7 A;  5CB1 A;  1ZQJ A;  8ICA A;  1KDH A;  4IQT A;  3QEB Z;  2JEF A;  3OJU A;  9ICX A;  5KG4 A;  5HRL A;  2DVI A;  2BPF A;  4KLQ A;  2A1J A;  1QSY A;  4NKT A;  1ZQL A;  2IBK A;  3C18 A;  2JEI A;  4X4N A;  4RQ0 A;  5CJ7 A;  4KLJ A;  5HRF A;  2BPC A;  4Q8E A;  7ICI A;  1R8B A;  5D4B A;  1TFR A;  1JN3 A;  3C23 A;  3B0Y A;  5DB8 A;  3ORY A;  4RQ3 A;  5J2I A;  3RBD A;  4KLL A;  7ICM A;  4X4R A;  5J2K A;  2ZJ8 A;  3HWT A;  1NK7 A;  3KHL A;  2W9C A;  3V6J A;  4I28 A;  3EZ5 A;  5CA7 A;  4DQI A;  3MAB A;  1MQ2 A;  5D49 A;  2ASD A;  5KT4 A;  3C2K A;  5KFD A;  2XGP A;  3UXO A;  3H38 A;  3T5K A;  1D8L A;  4QW9 A;  4RT2 A;  5HHH A;  1MIW A;  2PFQ A;  1S0M A;  4IRC A;  4UAY A;  4IQV A;  4QWE A;  4F4X A;  4DQR A;  5DGA A;  1ZYQ A;  4ECR A;  4DS5 A;  5IIL A;  1QTM A;  9ICU A;  4WC4 A;  2RDJ A;  3M9M B;  2W9A A;  8ICF A;  3H39 A;  5DQH A;  1IXR A;  3OSN A;  2B21 A;  2AGP A;  8ICN A;  4X4P A;  3K4G A;  4M9L A;  4ECZ A;  2DR9 A;  1ZQH A;  4YP3 A;  4J9N A;  3TAN A;  3MR3 A;  4I2J A;  4IRK A;  1T4G A;  1RPL A;  5BPC A;  4DLE A;  4EEY A;  4I2E A;  9ICG A;  4DQQ A;  1DGS A;  5KFH A;  3PVX A;  4RWN A;  1A77 A;  3C1Y A;  5HRD A;  2HHQ A;  3UQ2 A;  1Q79 A;  1K1Q A;  1KRP A;  3Q8P B;  2XCA A;  3RJF A;  4ED3 A;  4ED6 A;  4F4K A;  4R63 A;  1ZQX A;  3BQ1 A;  2DPI A;  4FBT A;  2V9W A;  4ECX A;  2BCQ A;  4UD5 A;  4ECU A;  3PO5 A;  4RPZ A;  1V9P A;  4BWJ A;  4R65 A;  2KN7 A;  3H8W A;  3OJS A;  2KZ3 A;  3GV8 B;  5L1K A;  3PW7 A;  4YCX A;  4I2H A;  2KTQ A;  1MIY A;  1U9L A;  2HHV A;  4RQ7 A;  5DEC A;  3JZ0 A;  1HUZ A;  3N97 B;  1ZQG A;  1ZQZ A;  8ICG A;  1DOQ A;  2F1H A;  3C5G A;  8ICH A;  3WFP A;  2DRB A;  2A1J B;  2BHN A;  3MR2 A;  1TK5 A;  5KFC A;  5CP2 A;  4IQW A;  3OV7 A;  2DR7 A;  2JZB B;  4YN4 A;  3ISC A;  2WTF A;  8ICB A;  4F3O A;  1NK8 A;  1HUO A;  5J0T A;  3GIM A;  4ED8 A;  4YD2 A;  4EP7 A;  4QZB A;  1L3T A;  3PV8 A;  5KG3 A;  1KLN A;  1ZQU A;  2DRA A;  2FMS A;  1BPY A;  5DBB A;  2W9C B;  3AQK A;  4ECS A;  4M6W A;  3JPT A;  2ZH9 A;  4I2D A;  3HT3 A;  3PX6 A;  4P4O A;  3MR5 A;  4FS1 A;  1VJ7 A;  5DB9 A;  2FMQ A;  4GXI A;  3WFR E;  5J0S A;  4KMU A;  4ELT A;  3TFR A;  8ICJ A;  2DR8 A;  3SZ2 A;  4M9J A;  4TUP A;  3RJJ A;  7ICK A;  4F5O A;  1QSL A;  1Q78 A;  3FDS A;  1XSL A;  4WC6 A;  9ICQ A;  8ICO A;  3RJE A;  3H8J A;  4K4H A;  1UT8 A;  4DSF A;  4M0A A;  4KLF A;  4TUS A;  8ICW A;  4GXK A;  1ZQD A;  4QZH A;  4KN7 A;  4B9N A;  2ZTE A;  4X5V A;  3ZDE A;  3SI8 A;  3M8R A;  2J6S A;  4IRD A;  5KT2 A;  3RBE A;  3HX0 A;  1KFD A;  5J2F A;  3B0X A;  4R8U B;  2AGQ A;  2C2E A;  3RRH A;  5KFV A;  1RXV A;  3RB4 A;  1QSS A;  2V4Q A;  2IHM A;  2IHN A;  2ZH5 A;  2XO7 A;  4EZ6 A;  2ZH8 A;  2J6U A;  3LQC B;  5C5J A;  3EPG A;  4F50 A;  4ECV A;  1LB2 B;  3HIY A;  5DBC A;  4X4O A;  4P4M A;  9ICK A;  4M5D A;  3AQN A;  4RWQ A;  3JPQ A;  4DFJ A;  1UT5 A;  2HHX A;  4M04 A;  4WC0 A;  4ATB A;  9ICE A;  4MFC A;  2RDI A;  4O9M A;  3NTU A;  4QW8 A;  3T5J A;  1NJW A;  3WFQ E;  2PFN A;  3JPO A;  2C28 A;  4DL3 A;  1NK5 A;  1S10 A;  1RXW A;  3RRG A;  7ICJ A;  3MDA A;  4RPX A;  4JWM A;  9ICN A;  7ICT A;  2BCU A;  4RQ1 A;  3LWM A;  4ED7 A;  9ICP A;  1BPE A;  2XGQ A;  3NYB A;  3C5F A;  5KFT A;  5TZV A;  5J0O A;  4R66 A;  4DEZ A;  3C2M A;  3BQ0 A;  1TVA A;  1UA0 A;  1S0N A;  3BDP A;  3H37 A;  2W9B A;  4WC5 A;  2NRT A;  4ELV A;  5HRG A;  3RJK A;  3V6H A;  3EW9 A;  4NXZ A;  5L1I A;  2FPM A;  4O3N A;  1ZQM A;  4PGX A;  4DLG A;  3OVA A;  3PNC A;  3AQM A;  1H38 A;  1BVS A;  1UEV A;  4X4T A;  4F2R A;  5J0P A;  1C7Y A;  2HVI A;  4IG8 A;  5EWF A;  1ZQY A;  1MQ3 A;  2F1I A;  4DFP A;  3K75 D;  1HJP A;  5IIO A;  5CWR A;  2VAN A;  2NRW A;  5L9X A;  3QEA Z;  4F2S A;  2MUT A;  4K4I A;  2XY5 A;  3RB6 A;  2ZH6 A;  2BCS A;  1BGX T;  1ZET A;  3T3F A;  7ICN A;  1XO1 A;  3V7L A;  1KTQ A;  4F4Y A;  4BDP A;  5IIK A;  5BOM A;  3G6Y A;  5BOL A;  7ICG A;  5KFL A;  2Q0Z X;  3KHH A;  4M9H A;  2P66 A;  4KLG A;  1U4B A;  4J9L A;  2BQ3 A;  4C8O A;  4KTQ A;  9ICF A;  5HHI A;  4O3S A;  3EYZ A;  4EYI B;  2HHS A;  4YFK A;  4E0D A;  1UET A;  5KFN A;  4J9S A;  1T8E A;  3MFI A;  1ZQS A;  4J9O A;  3PR4 A;  4DSK A;  4MFF A;  4NLN A;  4GXJ A;  1JX4 A;  4PH5 A;  7ICO A;  3OUY B;  3OHA A;  4YMN A;  4RQ4 A;  5DLF A;  2ALZ A;  5IIM A;  3V7K A;  4EBJ A;  4NLZ A;  5J2A A;  4PPX A;  4PHE A;  4G3I A;  2M2U A;  1BPB A;  4RPY A;  3ISB A;  2PFO A;  1RYR A;  5DKW A;  4RNO A;  2R8G A;  1R8C A;  8ICP A;  2PBE A;  3PML A;  2UVR A;  2HVH A;  3TQ1 A;  4DSJ A;  2ZUC A;  4FHY A;  3ZDB A;  4Q45 A;  1X9S A;  1OU5 A;  4ATB B;  4AT7 A;  3QZ7 A;  3MGH A;  2ZTC A;  4GC7 A;  1KFS A;  4K4G A;  4UQG A;  2M2W A;  1QLN A;  1D8Y A;  4F91 B;  4LVS A;  3OHB A;  1S0O A;  5DB6 A;  2NRK A;  4AT8 B;  5HC9 A;  4WBY A;  5KFE A;  2ZJ5 A;  1ZQT A;  2W9M A;  3PMN A;  2ZHB A;  1WCN A;  4DQP A;  4UB1 A;  1R89 A;  3TAR A;  9ICI A;  4RT3 A;  4DOA A;  2ZH3 A;  5J2H A;  8ICS A;  2UVU A;  3GIJ A;  4DF8 A;  4EZ9 A;  8ICM A;  1COO A;  2NRV A;  2P6U A;  3RTV A;  8ICY A;  4UBB A;  4Z6E A;  2VA2 A;  5EWE A;  1X9W A;  5J2C A;  3GIL A;  2M2V A;  4YMM A;  1NJY A;  3LK9 A;  3N4M B;  4QZI A;  4FO6 A;  5KFK A;  1RZT A;  3PX0 A;  1K1S A;  4YR0 A;  2MUT B;  2AGO A;  3Q8L A;  1SKR A;  2PFP A;  9ICR A;  1UEU A;  4QZ8 A;  5KT3 A;  1NO5 A;  5KFS A;  2OWO A;  3AQL A;  4I27 A;  4HYK A;  3V6K A;  4B9V A;  2IA6 A;  5KFX A;  1TFW A;  4JV0 A;  4DWI A;  3MDC A;  3ZDD A;  4KLO A;  4KLS A;  1BPZ A;  4E8F A;  3MFH A;  4BXO A;  7ICE A;  4C8N A;  5KFI A;  1CUK A;  2ZUB A;  1A76 A;  3RH4 A;  4F5P A;  3RJG A;  4ED1 A;  2BKE A;  4DL7 A;  3PW0 A;  3OGU A;  4UBC A;  5KTQ A;  3T5L A;  1L3V A;  4I2A A;  4WC7 A;  1WOT A;  4RWO A;  4XUS A;  4RUA A;  4DL4 A;  1B43 A;  3SV4 A;  2NRX A;  4MF2 A;  4B9T A;  3QE9 Y;  4F93 B;  1NJX A;  4KLE A;  4FHX A;  2AU0 A;  1ZQR A;  4RQ5 A;  3V72 A;  2ZTD A;  3RAQ A;  3H40 A;  3G6V A;  1XS9 D;  2VA3 A;  4JWN A;  5DG8 A;  4EYH B;  5J2G A;  3PY8 A;  5F9N A;  4WC3 A;  1TFY A;  5IIN A;  3PX4 A;  5DLG A;  3IM1 A;  1TK0 A;  4EBE A;  4O3P A;  4FS2 A;  3JPR A;  3T5H A;  4F4Z A;  3RJI A;  3RH6 A;  1NK4 A;  1ZQA A;  2DPJ A;  1R8A A;  2KFZ A;  3KHG A;  4ELU A;  3C66 A;  4AT9 A;  3RB0 A;  1JXL A;  3Q8R B;  4I2C A;  5KFQ A;  4NY8 A;  2XY7 A;  3BQ2 A;  4EBC A;  2C2R A;  1WCL A;  1SL0 A;  5KT7 A;  1L3U A;  2W8K A;  3HP6 A;  4M2Y A;  2DFL A;  5KFO A;  2HHP A;  2I1Q A;  4FHP A;  4WC2 A;  2AQ4 A;  2ZH7 A;  4RQ8 A;  4KLM A;  3OVS A;  1ZQV A;  2ISP A;  5J2E A;  4QWD A;  3MR6 A;  1FA0 A;  4TUR A;  1NKB A;  3MGI A;  5III A;  4QWB A;  4F4W A;  4B9U A;  4DSE A;  4O3R A;  3ZD9 A;  1KEJ A;  1JIH A;  1IM4 A;  3TI0 A;  2BPG A;  1LV5 A;  4IR9 A;  8ICE A;  1X2I A;  4Z6F A;  9ICW A;  2AJQ A;  5DED A;  4X4Q A;  4YG2 A;  2HHW A;  2H5X A;  5KG7 A;  4Z6C A;  3E2E A;  1U47 A;  4WBZ A;  2HW3 A;  4UB5 A;  3EPI A;  4O3Q A;  2UVV A;  3KTQ A;  4LT6 A;  4JV1 A;  1ZQB A;  2BCV A;  4J9M A;  2Q66 A;  4ECW A;  3V7J A;  1NKC A;  4JV2 A;  3TAP A;  4WC1 A;  4Q44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...