2VANA

Nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
245
structure length
240
Chain Sequence
DDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLQPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA POLYMERSE BETA
publication title Mismatched Dntp Incorporation by DNA Polymerase Beta Does not Proceed Via Globally Different Conformational Pathways.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 82
structure length 240
sequence length 245
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2vanA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2vanA03
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2vanA02
1TVAA 3QEBZ 4LZDA 4P4MA 3PR5B 1ZQKA 2HHUA 8ICHA 3PMNA 1WCNA 3PV8A 5KFLA 4QZAA 4J9MA 3UPQA 4C8KA 4DEZA 8ICYA 4BGDA 3ISCA 4I28A 4JV2A 1UT8A 3OHAA 4MFFA 4GXJA 2XY7A 1PZNA 1U9LA 1B22A 4WC2A 1TFWA 4UB2A 3RJIA 4AT9B 4FHXA 8ICRA 3PMLA 7ICFA 5CJ7A 8ICCA 4XQ8A 3RJKA 2DR9A 4Q44A 3MDAA 4Z6CA 3SYZA 3PVXA 2UVUA 5DQGA 4C8OA 2ZH5A 4UB5A 4RWOA 4P4OA 4RQ1A 4RNNA 3T5JA 4M9HA 3N97B 3GIKA 4AT7B 4F8RA 1HUOA 2JZBA 1ZQGA 2V9WA 3KHLA 5J2DA 5J0XA 4KLMA 4C8NA 3BQ1A 3HW8A 4FO6A 4YG2A 3PR4A 2ASJA 2Q66A 4TQSA 4DO9A 1ZQPA 3MDCA 5HMMA 3AUOA 4FBTA 1S76D 3HIYA 4WCWA 5J0TA 3B0YA 4ECVA 7ICQA 1NO5A 4DSEA 4QZDA 3RJFA 4FBUA 4F2RA 8ICOA 3C1ZA 3V7KA 4DSLA 2HHTA 9ICGA 4DFKA 1N48A 1A76A 4AT7A 5J2GA 4DL4A 5KFQA 2BPGA 2ZH1A 2RDIA 5EWEA 4GXKA 5KFZA 4QZCA 4NKUA 5KG4A 3THVA 3RAXA 3TFRA 4WC3A 4YXMA 4YN4A 3GQCA 3PX0A 2O5AA 1NK6A 3RRGA 4I2JA 3MR3A 2P6RA 3E2EA 5HR9A 4ECRA 8ICWA 3C2LA 1ZYQA 5HNKA 2ZJAA 2ZUDA 5KFFA 1FA0A 2KZZA 5J0YA 4J9PA 4DQPA 7ICIA 5HRFA 1OU5A 3WFRE 4QZFA 3UXOA 1DOQA 4ECSA 4F4KA 3HWTA 3OGUA 3V6KA 1ZQYA 5DQIA 2ZTEA 1L3UA 2P66A 4PHEA 5CP2A 3RH6A 5CA7A 4KLTA 5HREA 4X4RA 1BPEA 4YXJA 4RPXA 4DQQA 3RJEA 4K4IA 4F5PA 4YMNA 1KFSA 4EYHB 5EWGA 2HHPA 4KLUA 4ECZA 3ZD8A 3H3AA 5J0OA 4EBJA 4K4HA 1H38A 5KT7A 3IM1A 1QSYA 5DG9A 2P6UA 4B9UA 4I29A 2ZH6A 1S97A 2UVWA 4IRCA 2R8IA 4EBCA 4KLLA 4UAYA 8ICUA 3OHBA 4I2IA 3EWAA 2KN7A 4JUZA 4NM1A 1NK4A 4UD5A 5DBAA 3G6VA 3BQTA 2ZTDA 4FS1A 2NRVA 5BOLA 1S0OA 4J9QA 5J0WA 2NRTA 5J2BA 4DQSA 4E7XA 5KTQA 4JV1A 3RTVA 3MFIA 2IMWP 8ICMA 2M2UA 1U47A 4RNMA 1NK8A 4I2FA 1XSPA 3JPPA 2BHNA 1NK9A 4RT2A 2A1JA 3Q8LA 1S10A 3NTUA 4ATBA 4WC6A 4Z6FA 3N4MB 4DLGA 5HHHA 4IR1A 5IIKA 5KFPA 2JEJA 2ZH9A 2ZH8A 1KEJA 2FPKA 7ICJA 1RXWA 5CR0A 4ECYA 5KFKA 1ZJMA 1WCLA 1XWLA 4PGXA 1C7YA 1ZQBA 4KLFA 4M0AA 4KLQA 2KFZA 4RQ0A 4UBBA 3OV7A 3ZD9A 1SL2A 1R8CA 5HMLA 4ECTA 2C2RA 1JIHA 4I2DA 5KFIA 3M8RA 4DQIA 5TZVA 3LQCB 3NYBA 1JX4A 4I2GA 4I2CA 2HVHA 5KFYA 3TI0A 4KLDA 2F1IA 4MEYA 2BQUA 1UETA 1JXEA 2FLLA 4R66A 1BPXA 3OSNA 8ICEA 5HRBA 9ICRA 4BWMA 2W8LA 4I2EA 3Q8MA 1ZQXA 3OVSA 2NRXA 4QWDA 4O3NA 2FLPA 1TKDA 2BCQA 3KHHA 1X9MA 4IQWA 5KFVA 8ICAA 1XSNA 1ZQFA 4O3RA 5HRKA 1TAUA 4EP7A 1NJXA 3H4DA 2JEFA 1S0NA 3UXPA 3JPRA 1ZQSA 7ICHA 5KFGA 2HHVA 3ZDEA 3GV7B 2XY5A 3OUYB 4BWJA 4GXIA 2UVVA 1F5AA 1Q79A 2W9BB 4BDPA 3OVAA 2HHXA 1RYRA 2BQRA 1LB2B 2R8HA 2FPLA 3HJ4A 3TQ1A 1MQ3A 1KDHA 5J2JA 4YR3A 4ECQA 2ZH7A 2BQ3A 2R8KA 5HRLA 2HW3A 3TARA 2C28A 4WC0A 1KFTA 3RB0A 7ICTA 1NKEA 3RBDA 3T5LA 3OUYA 4DWIA 5DGAA 2ALZA 7ICGA 3PW0A 4MFAA 9ICUA 3HJ1A 2DR7A 3JPTA 2W9BA 1TFYA 3H7IA 9ICCA 2DPIA 1HJPA 4ED0A 2JZBB 4F2SA 4IQTA 7ICLA 3V7LA 4M47A 4IRKA 3FDSA 4PGYA 5DQHA 4Q45A 2VANA 3PW7A 1XO1A 4RNOA 4UAZA 4J9KA 1NK7A 3RJHA 4RPYA 1ZQZA 5L1IA 3JYYA 4M5DA 2ZJ8A 2XGQA 4WC5A 5DLFA 3K4GA 1BPYA 3NGDA 3Q8QB 1EXNA 4YQWA 2Y1IA 1NJWA 4P4PA 3G6YA 2AGPA 1ZQNA 2IA6A 5DG8A 3GV8B 2PI5A 4RPZA 4HYKA 5J0SA 4UB3A 1VJ7A 2W9MA 5IIJA 4BXOB 4YD1A 3AU2A 1D9FA 1PX5A 2NRKA 3H8WA 3V7JA 1XS9D 4JWMA 3GILA 1S0VA 5DDYA 3TAQA 3UQ2A 1X9SA 7ICEA 1KNYA 2FMQA 8ICNA 4JWNA 3UQ0A 1L3SA 3JZ0A 4NY8A 1R8BA 3SZ2A 2J6TA 4G3IA 4PH5A 5KFEA 3EPIA 4F5QA 5KFCA 4DQRA 1XSLA 1CEZA 5KT6A 1D8YA 4BXOA 3RR7A 2BKEA 1BPBA 4DOBA 4RWNA 1BPDA 7ICPA 1BPZA 2O1PA 4WC7A 2GWSA 4X4PA 3C18A 2JEGA 2C2DA 2BR0A 4RWQA 5KT3A 1S77D 4QZ9A 4X0AA 4DOAA 4YVZA 5IIIA 3ORYA 3LK9A 4F4XA 2F1JA 8ICGA 4ED3A 2BCVA 4M9LA 7ICVA 1TK5A 5KG2A 3HP6A 4UB4A 2DRBA 4IG8A 4EBDA 5F2VO 3H4BA 4GLXA 4QZ8A 3WFQE 9ICBA 3PO4A 5HP4A 8ICVA 5KFNA 3G6XA 4IRDA 4ED2A 3JPSA 1QSSA 1UEVA 4FHPA 4M9JA 4O3QA 4RQ5A 8ICJA 1MIWA 8ICQA 1NKCA 2AQ0A 3PX6A 4DL7A 3TANA 4TUPA 5KFWA 5DBBA 4WC4A 5EWFA 4PPXA 4RWPA 3GFKB 4O3OA 3V72A 1U48A 5IILA 2Y1JA 1KRPA 7ICKA 1A77A 2ZHAA 5HC9A 3MGIA 3LWLA 3RR8A 3C66A 1ZQVA 3PW4A 4QZBA 4ELVA 5KFMA 4K4GA 4F50A 5DECA 5KFXA 1T8EA 3T5HA 4M9GA 5KFTA 9ICTA 3OJUA 4E80A 4PHDA 2JEIA 1KTQA 1BGXT 2WTFA 1UA1A 2HVIA 4X0BA 5KFJA 2C22A 5BPCA 5IIMA 1JQRA 3GIMA 9ICHA 2A1JB 2AGOA 4O5KA 4ATBB 3GV5B 2ISPA 4PHPA 1TV9A 2C2EA 3KHGA 4DL2A 1MSWD 9ICQA 1ZQOA 3ISBA 4O3PA 4M6WA 1JN3A 2PXIA 2B21A 2XO7A 1ZETA 1X9WA 1NK0A 2LYHA 3ETLA 4DFJA 4KLIA 4QWCA 4KLEA 2BGWA 1Z3EB 4ED7A 3BDPA 1KLNA 4NXZA 8ICSA 2XC9A 5KFBA 4ED1A 4I2AA 5L1LA 3JPNA 1SZPA 2IHNA 4Q8FA 9ICEA 8ICKA 4IR9A 3LWMA 9ICSA 2ISOA 9ICJA 5J0QA 9ICIA 4RQ3A 4XUSA 1SKRA 7ICMA 5KFUA 4KLSA 9ICFA 3Q8SB 1TFRA 5HHIA 4ED8A 3RB6A 2W8KA 4O5EA 1V9PA 5DB8A 5KT4A 4B9NA 2VA2A 5JUMA 1KFDA 3OVBA 5EOZA 4UBCA 5J29A 1ZQWA 2XGPA 3AU6A 5L9XA 4PHAA 5HRIA 3H8SA 5KFOA 3PO5A 1ZQRA 5J2AA 3C2KA 1XC9A 2FMPA 4O0IA 4Z6EA 3BQ0A 4ZH4A 5HRHA 1L5UA 3WFOA 4AT8A 5DDMA 4E0DA 4FH5A 1ZQCA 1ZQUA 4M2YA 2MUTB 4ELUA 2BCSA 1MIVA 4S3NA 4O5CA 4F93B 5D46A 5J2CA 2M2TA 2ATLA 4RQ2A 2KTQA 5J0UA 3ISDA 4F4ZA 4X5VA 5J2HA 4Q8EA 5J0RA 2I9GA 2W9CB 2PBEA 4EYIB 4JK1A 3SV4A 1SKWA 5DEDA 9ICKA 9ICPA 1VFGA 2J6UA 5KFHA 4YMOA 3KHRA 2ZUCA 1ZQJA 4KLHA 1K1SA 2MUTA 4EBKA 3C5GA 4X4NA 2ZH3A 4UB1A 3PW5A 4B9MA 5KG1A 3ZDDA 4KLJA 4NLNA 5D4BA 1MIYA 2DRAA 3GDXA 3C21A 2W9CA 4YR0A 3H40A 3C5FA 4ECUA 3V6JA 7ICRA 4NM2A 1B43A 2ZH4A 9ICXA 3M9OB 4DL3A 3MFHA 4NKTA 4MF2A 4EEYA 4DFPA 1ZQHA 3ZDBA 9ICAA 4X4OA 2OWOA 4I2BA 4DF8A 1S9FA 3UPSA 2M2VA 5DB7A 3PNCA 5CWRA 4GC6A 5KFSA 4GC7A 4F3OA 1D8LA 4J9OA 1ZQDA 5L1KA 8ICIA 3H39A 4C8MA 4Z6DA 3H38A 4DS5A 4TQRA 1K1QA 4DSIA 2KZ3A 4X4UA 2BE3A 1S0MA 2XCAA 5DG7A 1RYSA 4X4VA 5CB1A 5KG7A 2M9NA 4XA5A 5DB9A 3V6HA 2RFFA 5KFRA 5J2FA 4F4YA 2DVIA 4B9LA 1HUZA 2IBKA 3ZDCA 2Q0ZX 1TK0A 1TAQA 4QW8A 2M2WA 2HHSA 3RH4A 4MF8A 4KLGA 5KT2A 4MFCA 1JXLA 3C2MA 4KMUA 3L9DA 1BVSA 3EW9A 4YP3A 1UT5A 2FLNA 1U45A 3FYHA 5F9LA 3RBEA 1QLNA 4R65A 4QZEA 4WBYA 3RJGA 3K75D 1QTMA 4R8UB 4XRHA 4F91B 4QW9A 3HT3A 4QWEA 4LVSA 1R89A 3PW2A 2DFLA 3QZ8A 3HX0A 2BCUA 4F5NA 1LV5A 2I1QA 3EZ5A 3OSPA 5D49A 4TUSA 2XCPA 3PX4A 1AROP 4B9VA 1L3VA 1R8AA 4AT9A 4RUAA 3C1YA 2BDPA 5IINA 3EPGA 2ZUBA 5DBCA 4EBEA 2DR5A 3GIIA 2BPCA 4R8UA 3TFSA 4DFMA 3H8JA 4DS4A 2KZMA 1ZQAA 1ZQIA 1NJYA 3AQLA 4F4WA 1T4GA 3ZDAA 5HRDA 3UXNA 1SL1A 2PFPA 4LT6A 2BCRA 4LZGA 1SL0A 3GIJA 3RH5A 1MQ2A 4FH3A 3M9NB 2VA8A 1Q78A 1ZQTA 4RUCA 3HPOA 1V4AA 4ECXA 3QZ7A 1Y88A 4DL6A 1N56A 4M04A 1NOMA 2HHWA 4M6WB 8ICTA 2AJQA 3TAPA 2R8JA 4F5RA 4RQ8A 2DR8A 4R64A 1IXRA 3MBYA 4F5OA 1U4BA 2VA3A 4C8LA 2ZHBA 2ZTCA 4KITB 2DPJA 1MC8A 4WC1A 4YR2A 3Q8PB 8ICXA 5KG3A 4RZRA 9ICMA 3PY8A 4KN4A 4YCXA 2ASDA 5F9NA 1IM4A 4RQ7A 4NLGA 4FHVA 9ICOA 1ZQLA 4IQUA 4QZHA 4FHWA 4QWBA 2AU0A 5KG5A 2KFNA 4FHYA 3WFSC 3SV3A 3MABA 1Z00B 3JPOA 1D9DA 2MAXA 5L1JA 1SKSA 1QSLA 1UEUA 3WFPA 2PFOA 2J6SA 5J0PA 2XY6A 1T7PA 1UA0A 2ASLA 9ICLA 1JAJA 1ZJNA 1NK5A 3T5KA 4DSJA 5IIOA 2PFQA 1XU4A 2H5XA 1L3TA 5KG0A 4YFKA 3RB4A 4UQGA 8ICBA 4ELTA 5KFDA 5DLGA 4ECWA 4O9MA 4AT8B 5CHGA 1Z00A 4RU9A 3BJYA 1COOA 4J9NA 3M9MB 4X4TA 5J2IA 7ICUA 4YMMA 4RQ4A 4UD4A 3JPQA 3QE9Y 4J9LA 3C23A 4KN7A 4QZGA 1RPLA 3Q8KA 3BQ2A 1ZQMA 4E8FA 4QZIA 7ICOA 1T3NA 3AQKA 4X4SA 1U49A 5HRGA 4DSKA 3MGHA 2PFNA 4WBZA 4UAWA 5DB6A 8ICLA 3KTQA 4DOCA 2AGQA 4RQ6A 4ED6A 1NKBA 1YLQA 3EYZA 5C5JA 3QEAZ 2W9AA 4PGQA 2F1HA 2NRZA 3RRHA 4DF4A 4NLKA 5KFAA 7ICNA 9ICNA 4TUQA 8ICZA 3RB3A 4RT3A 5DKWA 4EZ9A 2UVRA 2NRWA 3T3FA 4DLEA 3AQMA 1ZQEA 9ICVA 1JMSA 3MR2A 4Q43A 4XQ7A 1NJZA 4X4QA 4TURA 2RDJA 4P2HA 8ICFA 4KLOA 3B0XA 3MR5A 4EZ6A 1CUKA 3Q8RB 4NLZA 5KG6A 7ICSA 4FS2A 3AQNA 1RZTA 2R8GA 1TK8A 5J2KA 5J2EA 1DGSA 2AQ4A 1KSPA 2PI4A 4IQVA 2ID1A 9ICWA 2V4RA 3M8SA 1ZQQA 5BOMA 3RAQA 4KTQA 4J9SA 2FPMA 1RXVA 4R63A 2FMSA 4B9SA 4M9NA 3LDAA 3RJJA 4I27A 3H37A 5DGBA 1WOTA 4YD2A 4I2HA 2ZH2A 4J9RA 4DSFA 4JV0A 5KT5A 1X2IA 3SI8A 2ZJ5A 4B9TA 2HHQA 4CCHA 3OJSA 2V4QA 4O3SA 4QWAA 8ICPA 2BPFA 4F92B 3MR6A 2IHMA 4MEXA 3IHQB 4DL5A
chains in the Genus database with same CATH superfamily
1TVAA 1ZQKA 3PV8A 1WYGA 3L5KA 4EEBA 4B6JA 4C8KA 4UW9A 4BGDA 3ISCA 4I28A 3PMLA 2ZIVB 2K89A 4C0ZA 5ALXA 4RNNA 3T5JA 2YTUA 2JGAA 3N97B 2JZBA 5J0XA 3BQ1A 2Q66A 4DO9A 4U7CA 4MHVA 3HIYA 5J0TA 8ICOA 1R8BA 3C1ZA 3V7KA 1N48A 4AT7A 3THVA 3TFRA 3PX0A 2O5AA 2P6RA 4O69A 3C2LA 5HNKA 2ZJAA 3TKAA 5ALDA 2PMZC 1FEZA 2FDRA 5G5GA 3UXOA 3ERCC 2QB0B 1ZQYA 5CP2A 3SQIA 1BPEA 4NLBA 4DQQA 4K4IA 5AKZA 4NXXA 1FFVA 4BX9C 2HHPA 5AKLA 4ECZA 1H38A 2KJ9A 2ZH6A 5DG9A 3WU2U 2DKXA 3M6KA 8ICUA 4UD5A 5DBAA 2IHOA 2NRTA 5KTQA 2IMWP 3ZI4A 3QUQA 1U47A 3JPPA 2BHNA 3FAHA 1O08A 1P7DA 4RT2A 2YY6A 3Q8LA 4ATBA 4WC6A 3N4MB 5KFPA 2JEJA 2ZH9A 5CHEA 5AHXA 7ICJA 1RXWA 5CR0A 1ZJMA 2IOHA 3OV7A 4UBBA 1JIHA 5KFIA 1HEKA 1YZ7A 2F76X 4I2GA 2HVHA 3H0RB 4HAIA 1BPXA 5EE1A 3OVSA 3AMZA 2FLPA 2K8CB 2RHFA 4OJPA 3PSFA 8ICAA 5HRKA 5AI0A 1NJXA 3H4DA 3UXPA 1QQ6A 2HHVA 3TADC 3GV7B 1SV0C 4OO1J 1UCVA 1Q79A 4GXIA 2BQRA 2R8HA 3NVVA 1KDHA 4ECQA 3S6JA 2R8KA 5AM2A 3RB0A 1NKEA 5AM0A 2ALZA 3JPTA 1URJA 1HJPA 2JZBB 1PVRA 4Y2UA 1KL9A 2HSZA 4IRKA 3RJHA 3JYYA 4RNOA 4J9KA 1ZQZA 1J2MA 2XGQA 1B4FA 2Y0SC 3PSPA 1IV8A 2IOFA 2NO4A 2ZXIA 3G6YA 2AGPA 2AHOB 5J0SA 1VJ7A 4YD1A 3AU2A 1PX5A 1Q46A 1NZBA 2ODGA 1X9SA 2J6TA 5KL8B 2Z7JA 4F5QA 2NYVA 2ESEA 4BXOA 4O67A 1NI3A 7ICPA 2JH7A 2NV3A 4X4PA 4EV6A 2JEGA 2LM4A 5IIIA 1ED1A 2KMDA 8ICGA 2BCVA 4EGWA 3HP6A 4UB4A 5KFNA 3G6XA 4IRDA 1UEVA 4FHPA 4RQ5A 8ICQA 2AQ0A 4UB8U 4DL7A 3PX6A 2F77X 2HI0A 5IILA 7ICKA 1A77A 2JMGA 3PSIA 3ETRA 4QZBA 4OJ5A 5KFMA 4K4GA 3OJUA 1L8LA 4CF4A 1KTQA 1UA1A 2WTFA 1JQRA 3GIMA 9ICHA 2KSOA 4ATBB 3KHGA 4UB6U 2IOFK 3ISBA 2HCFA 4O3PA 1JN3A 3H8MA 3ETLA 4KLIA 2BBJA 1FO4A 8ICSA 2QB1A 2PKEA 2E3TA 2A1AA 3VCBA 3JPNA 8ICKA 3PHZA 1RYUA 2EANA 3WKAA 5AK5A 1V9PA 2G5IB 4B9NA 2EAMA 2VA2A 5JUMA 1KFDA 5EOZA 5J29A 3H8SA 5KFOA 1Z1BA 4JMUA 4O0IA 1L5UA 4Y2VA 1ZQCA 4FH5A 2MUTB 5CRXA 1JROA 2KTQA 3ISDA 5EE9A 5DEDA 2W9CB 1VFGA 2J6UA 5KFHA 1V85A 3H0MB 1ZQJA 4EBKA 4X4NA 4B9MA 5KAFU 4NLNA 5D4BA 4ICAA 4CF3A 4ECUA 3H40A 1B43A 3M9OB 3MFHA 3ZDBA 3QUTA 1OUQA 2M2VA 1D8LA 3D2SA 1KW4A 4DS5A 5ALOA 1J97A 1S0MA 2XCAA 2R18A 5KG7A 2M9NA 3V6HA 2CN1A 2OCEA 4F4YA 2DVIA 1HUZA 4G9BA 4QW8A 4MFCA 5KNIA 3L9DA 4KMUA 2FLNA 3RBEA 4CRXA 4IL6U 3RJGA 1QTMA 4QW9A 4QWEA 2DFLA 2EDUA 3JCFA 4OJ6A 1SWVA 3OSPA 2XCPA 2JRZA 2ZUBA 2BPCA 4DS4A 1ZQAA 3KZXA 5AKIA 1D8BA 1T4GA 3ZDAA 1PK3A 4NL9A 4LZGA 1V4AA 2VA8A 5ALMA 4RUCA 3QZ7A 1Y88A 2HHWA 1SB3C 4OAGA 4NLCA 2QLTA 4R64A 1IXRA 2VA3A 5ALPA 3Q8PB 5ALKA 5AKJA 2EH9A 1MA7A 4NLGA 4FHYA 1QSLA 3MABA 2MAXA 1UEUA 3WFPA 2PFOA 2OYYA 2J6SA 1JAJA 4OCZA 1NK5A 3T5KA 5IIOA 2PFQA 1XU4A 3N7PD 4YFKA 4OJOA 2LBOA 3RB4A 5DLGA 4ECWA 2ZIUB 1Z00A 4YMMA 1LKYA 4IC9A 5T14A 3KZIU 4E8FA 7ICOA 3AL0B 5FP0A 3AQKA 4X4SA 4DSKA 4WBZA 5DB6A 3KTQA 4PZOA 5B3PA 5CFTA 1YLQA 4PGQA 3RRHA 3PSTA 4NXUA 7ICSA 3AQNA 1RZTA 5J2KA 3N7SC 4IQVA 5AM4A 1JALA 9ICWA 2ID1A 2E1FA 3M8SA 4KTQA 4J9SA 2G08A 1RXVA 2B0CA 3LDAA 3RJJA 5AKXA 4YD2A 4I2HA 1N61A 4JV0A 1KN5A 2ZJ5A 4CCHA 4RQNA 2RQ5A 2W03A 5ALRA 2IHMA 3SAHA 2XC9A 5ALVA 4LZDA 3PR5B 4J9MA 5EE3A 8ICYA 1N62A 4Y2PA 3OHAA 2ZIXA 2XY7A 1B22A 8ICRA 4BJQA 5CJ7A 4Q44A 3SYZA 4C8OA 3QU9A 4UB5A 4P4OA 4AP9A 4RQ1A 2Y0SF 3CW2C 4F8RA 5J2DA 1L6NA 4C8NA 3OWGA 3KD3A 4TQSA 4A8EA 3BQ7A 3MDCA 5HMMA 1ZQPA 1S76D 2ZIVA 3B0YA 7ICQA 4DSEA 4QZDA 3RJFA 4C4SA 1VJ5A 4DSLA 9ICGA 4DFKA 4EX7A 5J2GA 4DL4A 5EWEA 4GXKA 3RAXA 4YXMA 3F5EA 3RRGA 4I2JA 1PVPA 3E2EA 1NZPA 5HR9A 2KD1A 2ZUDA 5KFFA 3RFAA 2MSNA 5J0YA 4US9A 3WFRE 1OU5A 4QZFA 1DOQA 4ECSA 3B9JA 3HWTA 2P66A 5DQIA 5AI9A 4ACOA 5CA7A 3N7RC 4KLTA 2JV3A 3H3AA 3K1ZA 5J0OA 4K4HA 2QB0A 4I29A 4P0PB 2UVWA 2A19A 4IRCA 2R8IA 2WAQC 4EBCA 2DGZA 4I2IA 2KN7A 4NM1A 3BQTA 2ZTDA 4FS1A 2AXTU 3C28A 2NRVA 4OD0A 1S0OA 3NUQA 3IG5A 5J0WA 4J9QA 4PL2A 3RTVA 3MFIA 2GH1A 8ICMA 4EX6A 1NK8A 5ALGA 1RDFA 1B0XA 1NK9A 2A1JA 1S10A 1Z1VA 4DLGA 5HHHA 4IR1A 2H3VA 1KEJA 2FPKA 4Y2YA 4ECYA 2B6GA 5ALNA 1XWLA 5G5HA 4KLQA 4DFDA 4I2DA 2EZYA 3LQCB 3NYBA 5AI8A 1JX4A 1WWUA 1UETA 1JXEA 3OSNA 5HRBA 3Q8MA 1ZQXA 3D6JA 4QWDA 5AKEA 5KFVA 1XSNA 1CI4A 2LMRA 3H0LB 4EP7A 7ICHA 5KFGA 5AKKA 3ZDEA 2XY5A 4JLZA 4BWJA 1F5AA 2W9BB 2FPLA 4YR3A 2ZH7A 2HW3A 1WUDA 3KOOA 4C7YA 2W11A 3RBDA 3F2CA 4C4TA 5DGAA 3KKAA 3PW0A 3HJ1A 3H7IA 4F2SA 1Q3UA 4M47A 5DQHA 5AI6A 4KLDA 4UAZA 2LYBA 2HBMA 4FE3A 2YQEA 3K4GA 5AM5A 3NGDA 5GTHU 4YQWA 2LM1A 2Y1IA 4P4PA 3MCRA 2W55A 4HYKA 4UB3A 1D9FA 2NRKA 4QIWC 1XS9D 1LVHA 4JWMA 3UQ2A 8ICNA 5D61A 3SZ2A 5AKHA 2YN4A 4G3IA 4PH5A 5KFCA 4DQRA 4NJ8A 2BKEA 3HRDD 4RWNA 1A0PA 2ES6A 2O1PA 2E8MA 4X0AA 3ORYA 4F4XA 4ED3A 1TK5A 3PO4A 3JPSA 1QSSA 1RG6A 4O3QA 5AIBA 8ICJA 3T79A 1NKCA 4WC4A 2MRLA 5EWFA 1KRPA 2ZHAA 3C66A 4J03A 1ZQVA 3PW4A 3ALRA 4M9GA 5KFTA 5AM3A 5L1MA 2A1JB 2FI1A 4DL2A 2W3RA 3ONNA 2PXIA 2B21A 4WH5A 2LYHA 3C29A 3MC1A 4DFJA 4KLEA 3BDPA 2HOIA 3BS7A 9ICJA 3WK8A 2D8CA 1SKRA 5ALIA 2W04A 5KFUA 3Q8SB 1TFRA 2WF6A 5KT4A 3OVBA 2I5HA 3PO5A 1ZQRA 3C2KA 1XC9A 3UMCA 3SMVA 1MIVA 4ELUA 4F93B 2ATLA 3HKZF 4XJEA 2OH2A 1ZQ1C 4Q8EA 2KKVA 2LYAA 5J0RA 1SKWA 9ICKA 2MUTA 2HMXA 2K4IA 2GO7A 3ZDDA 2I6XA 3GDXA 2W9CA 4YR0A 3V6JA 2BBHA 4C4RA 4EEYA 2WF5A 9ICAA 4X4OA 2OWOA 3M6ZA 5DB7A 3PNCA 3H39A 1F0MA 4TQRA 4CDGA 3AQFA 3E58A 5KAIU 2K60A 1UQVA 3RH4A 5KT2A 1IG6A 1AQ6A 4R65A 2LHTA 4R8UB 4XRHA 3HT3A 2VKQA 4LVSA 1L7NA 3HX0A 4F5NA 1LV5A 2I1QA 2W3SA 4K99A 3EZ5A 4TUSA 3PX4A 3WK6A 4B9VA 4AT9A 1L3VA 1R8AA 4RUAA 2GAFD 1QQ5A 3EPGA 4EBEA 4DFMA 3H8JA 4F4WA 3CP8A 2FJ6A 2PFPA 4LT6A 2BCRA 3KBBA 1Q78A 1ZQTA 3HPOA 2AJQA 2R8JA 4F5RA 4RQ8A 4US8A 2Q4TA 3MBYA 4F5OA 2DPJA 4YR2A 2WB1C 5KG3A 3N28A 5J8YA 4AYBF 9ICOA 1ZQLA 4FHWA 1OW5A 2VIXA 5KG5A 3JPOA 1D9DA 5L1JA 1SKSA 3QX7A 5J0PA 2ASLA 4DSJA 2KHQA 2M0NA 3UMBA 4NXVA 1L3TA 8ICBA 2WAQF 4O9MA 4EEKA 1SZHA 5CHGA 3AN1A 4RU9A 3BJYA 4X4TA 4UD4A 2QARA 3JPQA 2KVSA 4J9LA 3C23A 4KN7A 3EUB2 1RPLA 3BQ2A 1ZXIA 1T3NA 2D6FC 2PFNA 2ZIUA 5C5JA 3NWIA 2F1HA 9ICNA 5KFAA 2W54A 3RB3A 2KP7A 2UVRA 3T3FA 1ZQEA 1JMSA 4X4QA 4P2HA 5HR6A 8ICFA 4FFDA 1N60A 4I0UA 1SWWA 2OEHA 3IDWA 1TK8A 3VC8A 3WK5A 1KSPA 1DGSA 2PI4A 2HN2A 1ZQQA 3IG8A 1A6SA 2FPMA 4OJLA 4M9NA 1WOTA 4UAUA 2HHQA 4Y2TA 4QWAA 5D62A 4UAVA 3K1RB 3IHQB 5D63A 3QEBZ 4P4MA 2HHUA 1RQLA 3EF2A 1WCNA 2DUYA 3UPQA 3AEVA 4DEZA 4MFFA 4GXJA 1U9LA 4WC2A 2VJ5A 4UB2A 3RJIA 4AT9B 4FHXA 7ICFA 3RJKA 2DR9A 3MDAA 1ZRNA 2ZH5A 4RWOA 4M9HA 1GO3F 3DV9A 2V9WA 2N1RA 2G06A 3KHLA 4NL9C 3HW8A 4FO6A 1JRPA 4YG2A 4QIWF 1QH9A 2ASJA 1TAMA 2O6KA 3AUOA 5ALSA 2NO5A 4ECVA 1NO5A 3I76A 4FBUA 2H3FA 1A76A 5KFQA 2BPGA 2E1EA 2RDIA 4IS7A 3AM9A 3QXGA 5KG4A 1SIJA 4YN4A 3NVZA 4ECRA 1L7PA 8ICWA 3BS5B 1ZYQA 4CGZA 3NS1A 2GLEA 7ICIA 2PMZF 3OGUA 3V6KA 2ZTEA 2YMQA 5HREA 4EEDA 4YXJA 1XO0A 4F5PA 2AH5A 1KFSA 4EYHB 3WK4A 2DF4B 4KLUA 3GZFA 3ZD8A 2QARB 5KT7A 1QSYA 4BUGA 4KLLA 1VLBA 4UAYA 3EWAA 4KX3A 4JUZA 3DDHA 1NK4A 5BOLA 4DQSA 4E7XA 4JV1A 2M2UA 4P0PA 2XI9A 4RNMA 1L7OA 4Z6FA 4K96A 1V97A 3WKEA 2BZFA 1C7YA 1WCLA 1ZQBA 1Z4NA 3F5AA 4M0AA 3M1YA 3ZD9A 1R8CA 2KE7A 2C2RA 3M8RA 4DQIA 5TZVA 3ER9B 2F3NA 5F3XB 1CRXA 2F1IA 1X40A 4MEYA 2FLLA 4R66A 8ICEA 2FCLA 1ZD4A 9ICRA 4BWMA 2E8NA 4I2EA 2K4EA 2NRXA 4O3NA 3KFUF 1TKDA 2BCQA 3KHHA 1X9MA 1ZQFA 2BDUA 2JEFA 1S0NA 3JPRA 2YB1A 3OUYB 4HX0A 2UVVA 3NRZA 1L7MA 1N63A 3OVAA 1RYRA 3HJ4A 1L8OA 5ALYA 3TQ1A 2GOLA 2BQ3A 5HRLA 3TARA 1KFTA 1C20A 7ICGA 9ICUA 2DR7A 3D2NA 2W9BA 9ICCA 2DPIA 4ED0A 4K98A 4IQTA 1ZOLA 3NVWA 3V7LA 3FDSA 3PW7A 4Q45A 2VANA 1NK7A 1XO1A 4RPYA 5L1IA 3LYSA 2B4VA 3Q8QB 1EXNA 1NJWA 2IA6A 3BZKA 5DG8A 3GV8B 5AI5A 4RPZA 3DEEA 5JRTA 4ZOHC 3H8WA 1KKXA 3GILA 5DDYA 7ICEA 2RP5A 3UQ0A 1L3SA 4NY8A 3JZ0A 2LPEA 5KL1B 4LEVA 1XSLA 2F8KA 4Y2RA 1D8YA 4DOBA 1BPDA 5H2FU 1BPZA 2DBYA 1N2XA 2GWSA 4CNQA 3C18A 5KT3A 4YVZA 2ZXHA 5KG2A 2DL0A 5HR7A 5F2VO 4GLXA 3CK6A 4QZ8A 3WFQE 3HILA 4ED2A 1QQ7A 2OM6A 4M9JA 1MIWA 2E8PA 1ZD2P 4TUPA 5DBBA 3RF9A 4PPXA 3SR6A 4O3OA 3V72A 3QNMA 2Y1JA 3LWLA 3RR8A 4ELVA 4F50A 5DECA 4E80A 4DCCA 9ICTA 5ALZA 4PHDA 2JEIA 5ALFA 4X0BA 4JLXA 2AGOA 2KIWA 3GV5B 4PHPA 2C2EA 9ICQA 2XO7A 1X9WA 4QWCA 2BGWA 1YZ6A 1KLNA 4NXZA 5KFBA 4Y2XA 5AI4A 3E0FA 2MA1A 2OHFA 2ZIWB 2HOFA 2IHNA 1JI7A 4Q8FA 9ICEA 4Y2SA 2KKPA 3LWMA 4IR9A 2ISOA 9ICSA 4XUSA 9ICFA 5HHIA 4ED8A 2WF8A 5DB8A 4PL1A 1ZQWA 2WHEA 2XGPA 3AU6A 3SAFA 1MN8A 5J2AA 2EAPA 4ZH4A 4K97A 1T3QA 2G09A 1ZQUA 4M2YA 3CYMA 1ECWA 4O5CA 5D46A 4RQ2A 4WQLA 5J0UA 4F4ZA 4X5VA 4MKPA 3CNHA 4EYIB 3KKAC 9ICPA 5ALEA 4YMOA 1DRGA 1ZD3A 1K1SA 2HOQA 4KLJA 4F72A 1MIYA 3C21A 1SGGA 2H3IA 2E8OA 2ZH4A 9ICXA 4DL3A 4NKTA 4MF2A 4EELA 1Z4OA 4CE6A 1S9FA 1DK3A 5CWRA 5KFSA 4F3OA 1ZQDA 5L1KA 4C8MA 4Z6DA 1K1QA 2KNJA 2JXJA 2KZ3A 4X4UA 1X66A 5DG7A 2EZXA 1RYSA 4X4VA 2YB4A 5CB1A 3UMGA 4XA5A 5ALQA 4B9LA 2IBKA 2M2WA 1J2NA 4KLGA 3C2MA 1BVSA 1DXSA 3EW9A 4YP3A 1UT5A 1U45A 3FYHA 1PK1A 1PVQA 4K8VA 4WBYA 3K75D 4F91B 4Y2QA 2RRDA 3QZ8A 4WJ3B 5D49A 3C1YA 1FFUA 5IINA 5DBCA 3GIIA 4R8UA 1ZQIA 1NJYA 3AQLA 2W43A 4KB6A 4USAA 5HRDA 4OAIZ 3UXNA 2VJ4A 4N7RA 4FH3A 3M9NB 4ECXA 1N56A 4M04A 4DL6A 8ICTA 1NOMA 2F2AB 3FM9A 4C8LA 2ZHBA 2ZTCA 4KITB 4C80A 2JH1A 8ICXA 4RZRA 3LVWA 9ICMA 3PY8A 2WF9A 2KOBA 4QZHA 2EQYA 4QWBA 2AU0A 1O03A 3WFSC 3SV3A 1T7PA 2W7PA 1ZJNA 1SXDA 4QJFB 5TISU 2H5XA 5KG0A 5K4LA 5KFDA 4NWIA 4O68A 5JU5A 3M9MB 3SAGA 2A3VA 7ICUA 1X6JA 4RQ4A 3QE9Y 4O6AA 1OXJA 4QZGA 3U26A 1U49A 1QCKA 5HRGA 3MGHA 4UAWA 2EAOA 2AGQA 4F71A 1NKBA 3EYZA 2G07A 2W9AA 1T94A 2NRZA 4DF4A 1TE2A 2KG5A 5DKWA 3AQMA 2NRWA 3PZPA 4DLEA 9ICVA 3MR2A 5AKGA 4XQ7A 3AQEA 1NJZA 4TURA 2RDJA 3TACB 3NVYA 3MR5A 1CUKA 3L4PA 3Q8RB 3MGVA 2KVCA 5KG6A 4JB3A 2KEYA 4GIBA 4KX5A 5AK3A 2EZZA 1Q8KA 2V4RA 2DR8A 5BOMA 1IIPA 3RAQA 3IV6A 2FMSA 2CXYA 2HN1A 4I27A 5AK6A 1SV4A 2ZH2A 4KMOB 4J9RA 5KT5A 1X2IA 4B9TA 2KJ5A 3OJSA 4O3SA 2BPFA 4MEXA 1PK1B 8ICHA 1WG8A 3TADA 3PMNA 1SV0A 4P0QA 5KFLA 3F53A 4QZAA 4JV2A 1UT8A 4FO1A 2GA9D 1PZNA 1TFWA 4WOYA 3D2QA 3ICXA 8ICCA 4KM5A 4XQ8A 2UVUA 4Z6CA 3PVXA 5DQGA 2KIVA 3GIKA 4AT7B 1HUOA 1UPHA 1ZQGA 4KLMA 2P35A 3PR4A 4FBTA 3WK9A 5ALLA 4WCWA 4F2RA 1KQQA 2HHTA 2ZH1A 1S8OA 5KFZA 4QZCA 4NKUA 4WC3A 3GQCA 2ZG6A 2G0AA 1NK6A 3MR3A 5J8YC 3R9KA 2FE9A 1FA0A 3QU5A 4CF5A 2KZZA 4J9PA 2L5YA 4DQPA 5HRFA 4LEYA 1L3UA 3J81j 4PHEA 3RH6A 2WFAA 3BS5A 4X4RA 4RPXA 3RJEA 3QUCA 4YMNA 5EWGA 1VDVA 4EBJA 3IM1A 4B9UA 1WWVA 2P6UA 1BNOA 5CFUA 4UARA 1S97A 1UHUA 3OHBA 3G6VA 2HBJA 2B56A 4NXTA 5J2BA 2HBKA 3SENA 4WQKA 2YMPA 4I2FA 1XSPA 3OTQA 2B51A 2K4PA 3NTUA 2Y9UA 5IIKA 1GPJA 2D3DA 1KBUA 2ZH8A 2RLTA 5KFKA 2QKQA 2K4HA 4KLFA 4PGXA 2CRXA 2KFZA 3O0FA 3K7DA 4RQ0A 1SL2A 1HIWA 5HMLA 2E5SA 4ECTA 4I2CA 5KFYA 3TI0A 2MU2A 2BQUA 1K5OA 2W8LA 1N5XA 4IQWA 3NVOA 4O3RA 1TAUA 2HDOA 2DKZA 4PJ0U 1ZQSA 4P0QB 4BDPA 2HHXA 1LB2B 1X6IA 1MQ3A 5ALJA 2LI6A 5J2JA 2G5HB 2WF7A 3WK7A 2H3ZA 2C28A 4WC0A 7ICTA 3T5LA 3OUYA 4DWIA 4LJXA 4MFAA 2YX8A 1TFYA 7ICLA 4PGYA 4M5DA 2ZJ8A 4WC5A 5DLFA 1BPYA 1ZQNA 3NRWA 4F4KA 2PI5A 5AICA 2W9MA 5IIJA 4BXOB 1COKA 2OXOA 1DGJA 4LEWA 3V7JA 1S0VA 3TAQA 1KNYA 5ALWA 2FMQA 4JWNA 2KK0A 3HJEA 5KFEA 3EPIA 1CEZA 5KT6A 3RR7A 1BPBA 4WC7A 3CRXA 2C2DA 2BR0A 4RWQA 1S77D 1DK2A 4QZ9A 4FZNA 4DOAA 3LK9A 3OPXA 2F1JA 4M9LA 7ICVA 2DRBA 4IG8A 2HBLA 4EBDA 3H4BA 9ICBA 5HP4A 8ICVA 3QU7A 3QUBA 1Z19A 2CPRA 2EWRA 5B3QA 5E79U 2KICA 3TANA 5KFWA 2KSOB 4RWPA 3GFKB 1U48A 5HC9A 3MGIA 2K8BB 2LKYA 5KFXA 3T5HA 1T8EA 3ER8C 1BGXT 2HVIA 5KFJA 2C22A 1PUZA 5BPCA 5IIMA 4O5KA 2ISPA 5JTIA 1TV9A 1MSWD 2KV2A 1ZQOA 1FIQA 3NKUA 4M6WA 1ZETA 1NK0A 1Z3EB 4ED7A 4ED1A 3WKBA 4I2AA 5L1LA 1SZPA 1V38A 9ICIA 5J0QA 4RQ3A 7ICMA 5AM1A 4KLSA 1X9XA 3RB6A 1ZRMA 2W8KA 4O5EA 4PZNA 2ZIWA 4UBCA 5L9XA 4PHAA 5HRIA 1NNLA 2FMPA 4Z6EA 3BQ0A 5HRHA 3WFOA 2W7OA 4AT8A 5DDMA 4E0DA 3HKZC 4S3NA 1YT3A 2BCSA 3BZCA 5J2CA 2M2TA 5J2HA 3A0HU 4FZMA 3SD7A 2I9GA 3QU2A 2PBEA 4JK1A 1F5SA 3SV4A 3KHRA 2ZUCA 4KLHA 3NASA 3C5GA 2ZH3A 4UB1A 3PW5A 4UATA 5KG1A 1JUDA 2DWQA 4U6PA 4OAHA 2DRAA 7ICRA 3C5FA 4NM2A 4DFPA 1ZQHA 4K9AA 2XIDA 1RM6C 3WKCA 1ZD5A 3WKDA 4I2BA 4DF8A 5CFSA 3F2BA 4GC6A 4OAFA 4GC7A 3GU3A 1BNPA 4J9OA 8ICIA 3H38A 2IUBA 1S5LU 4DSIA 2BE3A 5GTIU 2XVTA 3UM9A 5DB9A 2RFFA 5KFRA 5J2FA 3I1YA 3ZDCA 2Q0ZX 1M6YA 1TK0A 1TAQA 2HHSA 4MF8A 1N5WA 2F8LA 1JXLA 5F9LA 1QLNA 4QZEA 1R89A 3PW2A 5C0YA 2BCUA 1AROP 3IP4B 2BDPA 5A0LA 2DR5A 4UASA 1Q3VA 3TFSA 1XNSA 2KZMA 5AKYA 4EENA 2JHDA 1SL1A 2XICA 5ALHA 1SL0A 3GIJA 3RH5A 3A0BU 1MQ2A 4C7ZA 4M6WB 5AK4A 3TAPA 2KHVA 1U4BA 5AIAA 5B5EU 1MC8A 4WC1A 4AYBC 4KN4A 4YCXA 2ASDA 2WB1F 5F9NA 1IM4A 4RQ7A 3ED5A 4FHVA 4IQUA 2DQNB 2YMLA 2KFNA 3UPSA 3SEIA 1Z00B 2KJ8A 1X42A 2K8AA 2XY6A 1LKYB 9ICLA 1UA0A 5EE0A 3L3FX 1F44A 4UQGA 4NV0A 4ELTA 4O3MA 4AT8B 4J9NA 1COOA 5J2IA 3Q8KA 5ALTA 1ZQMA 4QZIA 3LVVA 1SXEA 8ICLA 3FC4A 4DOCA 3IRUA 2H3QA 4RQ6A 4ED6A 2YMMA 3QEAZ 4GFJA 3IN5A 3F2DA 4K9BA 4NLKA 7ICNA 4TUQA 8ICZA 4NXWA 4RT3A 2Y9TA 4EZ9A 4RQMA 5CEHA 4Q43A 5ALUA 4KLOA 5JTGA 3B0XA 4EZ6A 4LEZA 2F44A 3QU4A 4NLZA 4FS2A 3M7DA 2R8GA 4FZLA 5J2EA 2AQ4A 2JR5A 1RQNA 4R63A 4B9SA 3H37A 5DGBA 4DSFA 3SI8A 2ZIXB 4QNLA 4Y2JA 2V4QA 8ICPA 3I28A 5B66U 4F92B 3MR6A 3QYPA 4DL5A
chains in the Genus database with same CATH topology
1TVAA 3QEBZ 4LZDA 4P4MA 3PR5B 1ZQKA 2HHUA 8ICHA 3PMNA 1WCNA 3PV8A 5KFLA 4QZAA 4J9MA 3UPQA 4C8KA 4DEZA 8ICYA 4BGDA 3ISCA 4I28A 4JV2A 1UT8A 3OHAA 4MFFA 4GXJA 2XY7A 1PZNA 1U9LA 1B22A 4WC2A 1TFWA 4UB2A 3RJIA 4AT9B 4FHXA 8ICRA 3PMLA 7ICFA 5CJ7A 8ICCA 4XQ8A 3RJKA 2DR9A 4Q44A 3MDAA 4Z6CA 3SYZA 3PVXA 2UVUA 5DQGA 4C8OA 2ZH5A 4UB5A 4RWOA 4P4OA 4RQ1A 4RNNA 3T5JA 4M9HA 3N97B 3GIKA 4AT7B 4F8RA 1HUOA 2JZBA 1ZQGA 2V9WA 3KHLA 5J2DA 5J0XA 4KLMA 4C8NA 3BQ1A 3HW8A 4FO6A 4YG2A 3PR4A 2ASJA 2Q66A 4TQSA 4DO9A 1ZQPA 3MDCA 5HMMA 3AUOA 4FBTA 1S76D 3HIYA 4WCWA 5J0TA 3B0YA 4ECVA 7ICQA 1NO5A 4DSEA 4QZDA 3RJFA 4FBUA 4F2RA 8ICOA 3C1ZA 3V7KA 4DSLA 2HHTA 9ICGA 4DFKA 1N48A 1A76A 4AT7A 5J2GA 4DL4A 5KFQA 2BPGA 2ZH1A 2RDIA 5EWEA 4GXKA 5KFZA 4QZCA 4NKUA 5KG4A 3THVA 3RAXA 3TFRA 4WC3A 4YXMA 4YN4A 3GQCA 3PX0A 2O5AA 1NK6A 3RRGA 4I2JA 3MR3A 2P6RA 3E2EA 5HR9A 4ECRA 8ICWA 3C2LA 1ZYQA 5HNKA 2ZJAA 2ZUDA 5KFFA 1FA0A 2KZZA 5J0YA 4J9PA 4DQPA 7ICIA 5HRFA 1OU5A 3WFRE 4QZFA 3UXOA 1DOQA 4ECSA 4F4KA 3HWTA 3OGUA 3V6KA 1ZQYA 5DQIA 2ZTEA 1L3UA 2P66A 4PHEA 5CP2A 3RH6A 5CA7A 4KLTA 5HREA 4X4RA 1BPEA 4YXJA 4RPXA 4DQQA 3RJEA 4K4IA 4F5PA 4YMNA 1KFSA 4EYHB 5EWGA 2HHPA 4KLUA 4ECZA 3ZD8A 3H3AA 5J0OA 4EBJA 4K4HA 1H38A 5KT7A 3IM1A 1QSYA 5DG9A 2P6UA 4B9UA 4I29A 2ZH6A 1S97A 2UVWA 4IRCA 2R8IA 4EBCA 4KLLA 4UAYA 8ICUA 3OHBA 4I2IA 3EWAA 2KN7A 4JUZA 4NM1A 1NK4A 4UD5A 5DBAA 3G6VA 3BQTA 2ZTDA 4FS1A 2NRVA 5BOLA 1S0OA 4J9QA 5J0WA 2NRTA 5J2BA 4DQSA 4E7XA 5KTQA 4JV1A 3RTVA 3MFIA 2IMWP 8ICMA 2M2UA 1U47A 4RNMA 1NK8A 4I2FA 1XSPA 3JPPA 2BHNA 1NK9A 4RT2A 2A1JA 3Q8LA 1S10A 3NTUA 4ATBA 4WC6A 4Z6FA 3N4MB 4DLGA 5HHHA 4IR1A 5IIKA 5KFPA 2JEJA 2ZH9A 2ZH8A 1KEJA 2FPKA 7ICJA 1RXWA 5CR0A 4ECYA 5KFKA 1ZJMA 1WCLA 1XWLA 4PGXA 1C7YA 1ZQBA 4KLFA 4M0AA 4KLQA 2KFZA 4RQ0A 4UBBA 3OV7A 3ZD9A 1SL2A 1R8CA 5HMLA 4ECTA 2C2RA 1JIHA 4I2DA 5KFIA 3M8RA 4DQIA 5TZVA 3LQCB 3NYBA 1JX4A 4I2GA 4I2CA 2HVHA 5KFYA 3TI0A 4KLDA 2F1IA 4MEYA 2BQUA 1UETA 1JXEA 2FLLA 4R66A 1BPXA 3OSNA 8ICEA 5HRBA 9ICRA 4BWMA 2W8LA 4I2EA 3Q8MA 1ZQXA 3OVSA 2NRXA 4QWDA 4O3NA 2FLPA 1TKDA 2BCQA 3KHHA 1X9MA 4IQWA 5KFVA 8ICAA 1XSNA 1ZQFA 4O3RA 5HRKA 1TAUA 4EP7A 1NJXA 3H4DA 2JEFA 1S0NA 3UXPA 3JPRA 1ZQSA 7ICHA 5KFGA 2HHVA 3ZDEA 3GV7B 2XY5A 3OUYB 4BWJA 4GXIA 2UVVA 1F5AA 1Q79A 2W9BB 4BDPA 3OVAA 2HHXA 1RYRA 2BQRA 1LB2B 2R8HA 2FPLA 3HJ4A 3TQ1A 1MQ3A 1KDHA 5J2JA 4YR3A 4ECQA 2ZH7A 2BQ3A 2R8KA 5HRLA 2HW3A 3TARA 2C28A 4WC0A 1KFTA 3RB0A 7ICTA 1NKEA 3RBDA 3T5LA 3OUYA 4DWIA 5DGAA 2ALZA 7ICGA 3PW0A 4MFAA 9ICUA 3HJ1A 2DR7A 3JPTA 2W9BA 1TFYA 3H7IA 9ICCA 2DPIA 1HJPA 4ED0A 2JZBB 4F2SA 4IQTA 7ICLA 3V7LA 4M47A 4IRKA 3FDSA 4PGYA 5DQHA 4Q45A 2VANA 3PW7A 1XO1A 4RNOA 4UAZA 4J9KA 1NK7A 3RJHA 4RPYA 1ZQZA 5L1IA 3JYYA 4M5DA 2ZJ8A 2XGQA 4WC5A 5DLFA 3K4GA 1BPYA 3NGDA 3Q8QB 1EXNA 4YQWA 2Y1IA 1NJWA 4P4PA 3G6YA 2AGPA 1ZQNA 2IA6A 5DG8A 3GV8B 2PI5A 4RPZA 4HYKA 5J0SA 4UB3A 1VJ7A 2W9MA 5IIJA 4BXOB 4YD1A 3AU2A 1D9FA 1PX5A 2NRKA 3H8WA 3V7JA 1XS9D 4JWMA 3GILA 1S0VA 5DDYA 3TAQA 3UQ2A 1X9SA 7ICEA 1KNYA 2FMQA 8ICNA 4JWNA 3UQ0A 1L3SA 3JZ0A 4NY8A 1R8BA 3SZ2A 2J6TA 4G3IA 4PH5A 5KFEA 3EPIA 4F5QA 5KFCA 4DQRA 1XSLA 1CEZA 5KT6A 1D8YA 4BXOA 3RR7A 2BKEA 1BPBA 4DOBA 4RWNA 1BPDA 7ICPA 1BPZA 2O1PA 4WC7A 2GWSA 4X4PA 3C18A 2JEGA 2C2DA 2BR0A 4RWQA 5KT3A 1S77D 4QZ9A 4X0AA 4DOAA 4YVZA 5IIIA 3ORYA 3LK9A 4F4XA 2F1JA 8ICGA 4ED3A 2BCVA 4M9LA 7ICVA 1TK5A 5KG2A 3HP6A 4UB4A 2DRBA 4IG8A 4EBDA 5F2VO 3H4BA 4GLXA 4QZ8A 3WFQE 9ICBA 3PO4A 5HP4A 8ICVA 5KFNA 3G6XA 4IRDA 4ED2A 3JPSA 1QSSA 1UEVA 4FHPA 4M9JA 4O3QA 4RQ5A 8ICJA 1MIWA 8ICQA 1NKCA 2AQ0A 3PX6A 4DL7A 3TANA 4TUPA 5KFWA 5DBBA 4WC4A 5EWFA 4PPXA 4RWPA 3GFKB 4O3OA 3V72A 1U48A 5IILA 2Y1JA 1KRPA 7ICKA 1A77A 2ZHAA 5HC9A 3MGIA 3LWLA 3RR8A 3C66A 1ZQVA 3PW4A 4QZBA 4ELVA 5KFMA 4K4GA 4F50A 5DECA 5KFXA 1T8EA 3T5HA 4M9GA 5KFTA 9ICTA 3OJUA 4E80A 4PHDA 2JEIA 1KTQA 1BGXT 2WTFA 1UA1A 2HVIA 4X0BA 5KFJA 2C22A 5BPCA 5IIMA 1JQRA 3GIMA 9ICHA 2A1JB 2AGOA 4O5KA 4ATBB 3GV5B 2ISPA 4PHPA 1TV9A 2C2EA 3KHGA 4DL2A 1MSWD 9ICQA 1ZQOA 3ISBA 4O3PA 4M6WA 1JN3A 2PXIA 2B21A 2XO7A 1ZETA 1X9WA 1NK0A 2LYHA 3ETLA 4DFJA 4KLIA 4QWCA 4KLEA 2BGWA 1Z3EB 4ED7A 3BDPA 1KLNA 4NXZA 8ICSA 2XC9A 5KFBA 4ED1A 4I2AA 5L1LA 3JPNA 1SZPA 2IHNA 4Q8FA 9ICEA 8ICKA 4IR9A 3LWMA 9ICSA 2ISOA 9ICJA 5J0QA 9ICIA 4RQ3A 4XUSA 1SKRA 7ICMA 5KFUA 4KLSA 9ICFA 3Q8SB 1TFRA 5HHIA 4ED8A 3RB6A 2W8KA 4O5EA 1V9PA 5DB8A 5KT4A 4B9NA 2VA2A 5JUMA 1KFDA 3OVBA 5EOZA 4UBCA 5J29A 1ZQWA 2XGPA 3AU6A 5L9XA 4PHAA 5HRIA 3H8SA 5KFOA 3PO5A 1ZQRA 5J2AA 3C2KA 1XC9A 2FMPA 4O0IA 4Z6EA 3BQ0A 4ZH4A 5HRHA 1L5UA 3WFOA 4AT8A 5DDMA 4E0DA 4FH5A 1ZQCA 1ZQUA 4M2YA 2MUTB 4ELUA 2BCSA 1MIVA 4S3NA 4O5CA 4F93B 5D46A 5J2CA 2M2TA 2ATLA 4RQ2A 2KTQA 5J0UA 3ISDA 4F4ZA 4X5VA 5J2HA 4Q8EA 5J0RA 2I9GA 2W9CB 2PBEA 4EYIB 4JK1A 3SV4A 1SKWA 5DEDA 9ICKA 9ICPA 1VFGA 2J6UA 5KFHA 4YMOA 3KHRA 2ZUCA 1ZQJA 4KLHA 1K1SA 2MUTA 4EBKA 3C5GA 4X4NA 2ZH3A 4UB1A 3PW5A 4B9MA 5KG1A 3ZDDA 4KLJA 4NLNA 5D4BA 1MIYA 2DRAA 3GDXA 3C21A 2W9CA 4YR0A 3H40A 3C5FA 4ECUA 3V6JA 7ICRA 4NM2A 1B43A 2ZH4A 9ICXA 3M9OB 4DL3A 3MFHA 4NKTA 4MF2A 4EEYA 4DFPA 1ZQHA 3ZDBA 9ICAA 4X4OA 2OWOA 4I2BA 4DF8A 1S9FA 3UPSA 2M2VA 5DB7A 3PNCA 5CWRA 4GC6A 5KFSA 4GC7A 4F3OA 1D8LA 4J9OA 1ZQDA 5L1KA 8ICIA 3H39A 4C8MA 4Z6DA 3H38A 4DS5A 4TQRA 1K1QA 4DSIA 2KZ3A 4X4UA 2BE3A 1S0MA 2XCAA 5DG7A 1RYSA 4X4VA 5CB1A 5KG7A 2M9NA 4XA5A 5DB9A 3V6HA 2RFFA 5KFRA 5J2FA 4F4YA 2DVIA 4B9LA 1HUZA 2IBKA 3ZDCA 2Q0ZX 1TK0A 1TAQA 4QW8A 2M2WA 2HHSA 3RH4A 4MF8A 4KLGA 5KT2A 4MFCA 1JXLA 3C2MA 4KMUA 3L9DA 1BVSA 3EW9A 4YP3A 1UT5A 2FLNA 1U45A 3FYHA 5F9LA 3RBEA 1QLNA 4R65A 4QZEA 4WBYA 3RJGA 3K75D 1QTMA 4R8UB 4XRHA 4F91B 4QW9A 3HT3A 4QWEA 4LVSA 1R89A 3PW2A 2DFLA 3QZ8A 3HX0A 2BCUA 4F5NA 1LV5A 2I1QA 3EZ5A 3OSPA 5D49A 4TUSA 2XCPA 3PX4A 1AROP 4B9VA 1L3VA 1R8AA 4AT9A 4RUAA 3C1YA 2BDPA 5IINA 3EPGA 2ZUBA 5DBCA 4EBEA 2DR5A 3GIIA 2BPCA 4R8UA 3TFSA 4DFMA 3H8JA 4DS4A 2KZMA 1ZQAA 1ZQIA 1NJYA 3AQLA 4F4WA 1T4GA 3ZDAA 5HRDA 3UXNA 1SL1A 2PFPA 4LT6A 2BCRA 4LZGA 1SL0A 3GIJA 3RH5A 1MQ2A 4FH3A 3M9NB 2VA8A 1Q78A 1ZQTA 4RUCA 3HPOA 1V4AA 4ECXA 3QZ7A 1Y88A 4DL6A 1N56A 4M04A 1NOMA 2HHWA 4M6WB 8ICTA 2AJQA 3TAPA 2R8JA 4F5RA 4RQ8A 2DR8A 4R64A 1IXRA 3MBYA 4F5OA 1U4BA 2VA3A 4C8LA 2ZHBA 2ZTCA 4KITB 2DPJA 1MC8A 4WC1A 4YR2A 3Q8PB 8ICXA 5KG3A 4RZRA 9ICMA 3PY8A 4KN4A 4YCXA 2ASDA 5F9NA 1IM4A 4RQ7A 4NLGA 4FHVA 9ICOA 1ZQLA 4IQUA 4QZHA 4FHWA 4QWBA 2AU0A 5KG5A 2KFNA 4FHYA 3WFSC 3SV3A 3MABA 1Z00B 3JPOA 1D9DA 2MAXA 5L1JA 1SKSA 1QSLA 1UEUA 3WFPA 2PFOA 2J6SA 5J0PA 2XY6A 1T7PA 1UA0A 2ASLA 9ICLA 1JAJA 1ZJNA 1NK5A 3T5KA 4DSJA 5IIOA 2PFQA 1XU4A 2H5XA 1L3TA 5KG0A 4YFKA 3RB4A 4UQGA 8ICBA 4ELTA 5KFDA 5DLGA 4ECWA 4O9MA 4AT8B 5CHGA 1Z00A 4RU9A 3BJYA 1COOA 4J9NA 3M9MB 4X4TA 5J2IA 7ICUA 4YMMA 4RQ4A 4UD4A 3JPQA 3QE9Y 4J9LA 3C23A 4KN7A 4QZGA 1RPLA 3Q8KA 3BQ2A 1ZQMA 4E8FA 4QZIA 7ICOA 1T3NA 3AQKA 4X4SA 1U49A 5HRGA 4DSKA 3MGHA 2PFNA 4WBZA 4UAWA 5DB6A 8ICLA 3KTQA 4DOCA 2AGQA 4RQ6A 4ED6A 1NKBA 1YLQA 3EYZA 5C5JA 3QEAZ 2W9AA 4PGQA 2F1HA 2NRZA 3RRHA 4DF4A 4NLKA 5KFAA 7ICNA 9ICNA 4TUQA 8ICZA 3RB3A 4RT3A 5DKWA 4EZ9A 2UVRA 2NRWA 3T3FA 4DLEA 3AQMA 1ZQEA 9ICVA 1JMSA 3MR2A 4Q43A 4XQ7A 1NJZA 4X4QA 4TURA 2RDJA 4P2HA 8ICFA 4KLOA 3B0XA 3MR5A 4EZ6A 1CUKA 3Q8RB 4NLZA 5KG6A 7ICSA 4FS2A 3AQNA 1RZTA 2R8GA 1TK8A 5J2KA 5J2EA 1DGSA 2AQ4A 1KSPA 2PI4A 4IQVA 2ID1A 9ICWA 2V4RA 3M8SA 1ZQQA 5BOMA 3RAQA 4KTQA 4J9SA 2FPMA 1RXVA 4R63A 2FMSA 4B9SA 4M9NA 3LDAA 3RJJA 4I27A 3H37A 5DGBA 1WOTA 4YD2A 4I2HA 2ZH2A 4J9RA 4DSFA 4JV0A 5KT5A 1X2IA 3SI8A 2ZJ5A 4B9TA 2HHQA 4CCHA 3OJSA 2V4QA 4O3SA 4QWAA 8ICPA 2BPFA 4F92B 3MR6A 2IHMA 4MEXA 3IHQB 4DL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVA A;  3QEB Z;  4LZD A;  4P4M A;  3PR5 B;  1ZQK A;  2HHU A;  8ICH A;  3PMN A;  1WCN A;  3PV8 A;  5KFL A;  4QZA A;  4J9M A;  3UPQ A;  4C8K A;  4DEZ A;  8ICY A;  4BGD A;  3ISC A;  4I28 A;  4JV2 A;  1UT8 A;  3OHA A;  4MFF A;  4GXJ A;  2XY7 A;  1PZN A;  1U9L A;  1B22 A;  4WC2 A;  1TFW A;  4UB2 A;  3RJI A;  4AT9 B;  4FHX A;  8ICR A;  3PML A;  7ICF A;  5CJ7 A;  8ICC A;  4XQ8 A;  3RJK A;  2DR9 A;  4Q44 A;  3MDA A;  4Z6C A;  3SYZ A;  3PVX A;  2UVU A;  5DQG A;  4C8O A;  2ZH5 A;  4UB5 A;  4RWO A;  4P4O A;  4RQ1 A;  4RNN A;  3T5J A;  4M9H A;  3N97 B;  3GIK A;  4AT7 B;  4F8R A;  1HUO A;  2JZB A;  1ZQG A;  2V9W A;  3KHL A;  5J2D A;  5J0X A;  4KLM A;  4C8N A;  3BQ1 A;  3HW8 A;  4FO6 A;  4YG2 A;  3PR4 A;  2ASJ A;  2Q66 A;  4TQS A;  4DO9 A;  1ZQP A;  3MDC A;  5HMM A;  3AUO A;  4FBT A;  1S76 D;  3HIY A;  4WCW A;  5J0T A;  3B0Y A;  4ECV A;  7ICQ A;  1NO5 A;  4DSE A;  4QZD A;  3RJF A;  4FBU A;  4F2R A;  8ICO A;  3C1Z A;  3V7K A;  4DSL A;  2HHT A;  9ICG A;  4DFK A;  1N48 A;  1A76 A;  4AT7 A;  5J2G A;  4DL4 A;  5KFQ A;  2BPG A;  2ZH1 A;  2RDI A;  5EWE A;  4GXK A;  5KFZ A;  4QZC A;  4NKU A;  5KG4 A;  3THV A;  3RAX A;  3TFR A;  4WC3 A;  4YXM A;  4YN4 A;  3GQC A;  3PX0 A;  2O5A A;  1NK6 A;  3RRG A;  4I2J A;  3MR3 A;  2P6R A;  3E2E A;  5HR9 A;  4ECR A;  8ICW A;  3C2L A;  1ZYQ A;  5HNK A;  2ZJA A;  2ZUD A;  5KFF A;  1FA0 A;  2KZZ A;  5J0Y A;  4J9P A;  4DQP A;  7ICI A;  5HRF A;  1OU5 A;  3WFR E;  4QZF A;  3UXO A;  1DOQ A;  4ECS A;  4F4K A;  3HWT A;  3OGU A;  3V6K A;  1ZQY A;  5DQI A;  2ZTE A;  1L3U A;  2P66 A;  4PHE A;  5CP2 A;  3RH6 A;  5CA7 A;  4KLT A;  5HRE A;  4X4R A;  1BPE A;  4YXJ A;  4RPX A;  4DQQ A;  3RJE A;  4K4I A;  4F5P A;  4YMN A;  1KFS A;  4EYH B;  5EWG A;  2HHP A;  4KLU A;  4ECZ A;  3ZD8 A;  3H3A A;  5J0O A;  4EBJ A;  4K4H A;  1H38 A;  5KT7 A;  3IM1 A;  1QSY A;  5DG9 A;  2P6U A;  4B9U A;  4I29 A;  2ZH6 A;  1S97 A;  2UVW A;  4IRC A;  2R8I A;  4EBC A;  4KLL A;  4UAY A;  8ICU A;  3OHB A;  4I2I A;  3EWA A;  2KN7 A;  4JUZ A;  4NM1 A;  1NK4 A;  4UD5 A;  5DBA A;  3G6V A;  3BQT A;  2ZTD A;  4FS1 A;  2NRV A;  5BOL A;  1S0O A;  4J9Q A;  5J0W A;  2NRT A;  5J2B A;  4DQS A;  4E7X A;  5KTQ A;  4JV1 A;  3RTV A;  3MFI A;  2IMW P;  8ICM A;  2M2U A;  1U47 A;  4RNM A;  1NK8 A;  4I2F A;  1XSP A;  3JPP A;  2BHN A;  1NK9 A;  4RT2 A;  2A1J A;  3Q8L A;  1S10 A;  3NTU A;  4ATB A;  4WC6 A;  4Z6F A;  3N4M B;  4DLG A;  5HHH A;  4IR1 A;  5IIK A;  5KFP A;  2JEJ A;  2ZH9 A;  2ZH8 A;  1KEJ A;  2FPK A;  7ICJ A;  1RXW A;  5CR0 A;  4ECY A;  5KFK A;  1ZJM A;  1WCL A;  1XWL A;  4PGX A;  1C7Y A;  1ZQB A;  4KLF A;  4M0A A;  4KLQ A;  2KFZ A;  4RQ0 A;  4UBB A;  3OV7 A;  3ZD9 A;  1SL2 A;  1R8C A;  5HML A;  4ECT A;  2C2R A;  1JIH A;  4I2D A;  5KFI A;  3M8R A;  4DQI A;  5TZV A;  3LQC B;  3NYB A;  1JX4 A;  4I2G A;  4I2C A;  2HVH A;  5KFY A;  3TI0 A;  4KLD A;  2F1I A;  4MEY A;  2BQU A;  1UET A;  1JXE A;  2FLL A;  4R66 A;  1BPX A;  3OSN A;  8ICE A;  5HRB A;  9ICR A;  4BWM A;  2W8L A;  4I2E A;  3Q8M A;  1ZQX A;  3OVS A;  2NRX A;  4QWD A;  4O3N A;  2FLP A;  1TKD A;  2BCQ A;  3KHH A;  1X9M A;  4IQW A;  5KFV A;  8ICA A;  1XSN A;  1ZQF A;  4O3R A;  5HRK A;  1TAU A;  4EP7 A;  1NJX A;  3H4D A;  2JEF A;  1S0N A;  3UXP A;  3JPR A;  1ZQS A;  7ICH A;  5KFG A;  2HHV A;  3ZDE A;  3GV7 B;  2XY5 A;  3OUY B;  4BWJ A;  4GXI A;  2UVV A;  1F5A A;  1Q79 A;  2W9B B;  4BDP A;  3OVA A;  2HHX A;  1RYR A;  2BQR A;  1LB2 B;  2R8H A;  2FPL A;  3HJ4 A;  3TQ1 A;  1MQ3 A;  1KDH A;  5J2J A;  4YR3 A;  4ECQ A;  2ZH7 A;  2BQ3 A;  2R8K A;  5HRL A;  2HW3 A;  3TAR A;  2C28 A;  4WC0 A;  1KFT A;  3RB0 A;  7ICT A;  1NKE A;  3RBD A;  3T5L A;  3OUY A;  4DWI A;  5DGA A;  2ALZ A;  7ICG A;  3PW0 A;  4MFA A;  9ICU A;  3HJ1 A;  2DR7 A;  3JPT A;  2W9B A;  1TFY A;  3H7I A;  9ICC A;  2DPI A;  1HJP A;  4ED0 A;  2JZB B;  4F2S A;  4IQT A;  7ICL A;  3V7L A;  4M47 A;  4IRK A;  3FDS A;  4PGY A;  5DQH A;  4Q45 A;  2VAN A;  3PW7 A;  1XO1 A;  4RNO A;  4UAZ A;  4J9K A;  1NK7 A;  3RJH A;  4RPY A;  1ZQZ A;  5L1I A;  3JYY A;  4M5D A;  2ZJ8 A;  2XGQ A;  4WC5 A;  5DLF A;  3K4G A;  1BPY A;  3NGD A;  3Q8Q B;  1EXN A;  4YQW A;  2Y1I A;  1NJW A;  4P4P A;  3G6Y A;  2AGP A;  1ZQN A;  2IA6 A;  5DG8 A;  3GV8 B;  2PI5 A;  4RPZ A;  4HYK A;  5J0S A;  4UB3 A;  1VJ7 A;  2W9M A;  5IIJ A;  4BXO B;  4YD1 A;  3AU2 A;  1D9F A;  1PX5 A;  2NRK A;  3H8W A;  3V7J A;  1XS9 D;  4JWM A;  3GIL A;  1S0V A;  5DDY A;  3TAQ A;  3UQ2 A;  1X9S A;  7ICE A;  1KNY A;  2FMQ A;  8ICN A;  4JWN A;  3UQ0 A;  1L3S A;  3JZ0 A;  4NY8 A;  1R8B A;  3SZ2 A;  2J6T A;  4G3I A;  4PH5 A;  5KFE A;  3EPI A;  4F5Q A;  5KFC A;  4DQR A;  1XSL A;  1CEZ A;  5KT6 A;  1D8Y A;  4BXO A;  3RR7 A;  2BKE A;  1BPB A;  4DOB A;  4RWN A;  1BPD A;  7ICP A;  1BPZ A;  2O1P A;  4WC7 A;  2GWS A;  4X4P A;  3C18 A;  2JEG A;  2C2D A;  2BR0 A;  4RWQ A;  5KT3 A;  1S77 D;  4QZ9 A;  4X0A A;  4DOA A;  4YVZ A;  5III A;  3ORY A;  3LK9 A;  4F4X A;  2F1J A;  8ICG A;  4ED3 A;  2BCV A;  4M9L A;  7ICV A;  1TK5 A;  5KG2 A;  3HP6 A;  4UB4 A;  2DRB A;  4IG8 A;  4EBD A;  5F2V O;  3H4B A;  4GLX A;  4QZ8 A;  3WFQ E;  9ICB A;  3PO4 A;  5HP4 A;  8ICV A;  5KFN A;  3G6X A;  4IRD A;  4ED2 A;  3JPS A;  1QSS A;  1UEV A;  4FHP A;  4M9J A;  4O3Q A;  4RQ5 A;  8ICJ A;  1MIW A;  8ICQ A;  1NKC A;  2AQ0 A;  3PX6 A;  4DL7 A;  3TAN A;  4TUP A;  5KFW A;  5DBB A;  4WC4 A;  5EWF A;  4PPX A;  4RWP A;  3GFK B;  4O3O A;  3V72 A;  1U48 A;  5IIL A;  2Y1J A;  1KRP A;  7ICK A;  1A77 A;  2ZHA A;  5HC9 A;  3MGI A;  3LWL A;  3RR8 A;  3C66 A;  1ZQV A;  3PW4 A;  4QZB A;  4ELV A;  5KFM A;  4K4G A;  4F50 A;  5DEC A;  5KFX A;  1T8E A;  3T5H A;  4M9G A;  5KFT A;  9ICT A;  3OJU A;  4E80 A;  4PHD A;  2JEI A;  1KTQ A;  1BGX T;  2WTF A;  1UA1 A;  2HVI A;  4X0B A;  5KFJ A;  2C22 A;  5BPC A;  5IIM A;  1JQR A;  3GIM A;  9ICH A;  2A1J B;  2AGO A;  4O5K A;  4ATB B;  3GV5 B;  2ISP A;  4PHP A;  1TV9 A;  2C2E A;  3KHG A;  4DL2 A;  1MSW D;  9ICQ A;  1ZQO A;  3ISB A;  4O3P A;  4M6W A;  1JN3 A;  2PXI A;  2B21 A;  2XO7 A;  1ZET A;  1X9W A;  1NK0 A;  2LYH A;  3ETL A;  4DFJ A;  4KLI A;  4QWC A;  4KLE A;  2BGW A;  1Z3E B;  4ED7 A;  3BDP A;  1KLN A;  4NXZ A;  8ICS A;  2XC9 A;  5KFB A;  4ED1 A;  4I2A A;  5L1L A;  3JPN A;  1SZP A;  2IHN A;  4Q8F A;  9ICE A;  8ICK A;  4IR9 A;  3LWM A;  9ICS A;  2ISO A;  9ICJ A;  5J0Q A;  9ICI A;  4RQ3 A;  4XUS A;  1SKR A;  7ICM A;  5KFU A;  4KLS A;  9ICF A;  3Q8S B;  1TFR A;  5HHI A;  4ED8 A;  3RB6 A;  2W8K A;  4O5E A;  1V9P A;  5DB8 A;  5KT4 A;  4B9N A;  2VA2 A;  5JUM A;  1KFD A;  3OVB A;  5EOZ A;  4UBC A;  5J29 A;  1ZQW A;  2XGP A;  3AU6 A;  5L9X A;  4PHA A;  5HRI A;  3H8S A;  5KFO A;  3PO5 A;  1ZQR A;  5J2A A;  3C2K A;  1XC9 A;  2FMP A;  4O0I A;  4Z6E A;  3BQ0 A;  4ZH4 A;  5HRH A;  1L5U A;  3WFO A;  4AT8 A;  5DDM A;  4E0D A;  4FH5 A;  1ZQC A;  1ZQU A;  4M2Y A;  2MUT B;  4ELU A;  2BCS A;  1MIV A;  4S3N A;  4O5C A;  4F93 B;  5D46 A;  5J2C A;  2M2T A;  2ATL A;  4RQ2 A;  2KTQ A;  5J0U A;  3ISD A;  4F4Z A;  4X5V A;  5J2H A;  4Q8E A;  5J0R A;  2I9G A;  2W9C B;  2PBE A;  4EYI B;  4JK1 A;  3SV4 A;  1SKW A;  5DED A;  9ICK A;  9ICP A;  1VFG A;  2J6U A;  5KFH A;  4YMO A;  3KHR A;  2ZUC A;  1ZQJ A;  4KLH A;  1K1S A;  2MUT A;  4EBK A;  3C5G A;  4X4N A;  2ZH3 A;  4UB1 A;  3PW5 A;  4B9M A;  5KG1 A;  3ZDD A;  4KLJ A;  4NLN A;  5D4B A;  1MIY A;  2DRA A;  3GDX A;  3C21 A;  2W9C A;  4YR0 A;  3H40 A;  3C5F A;  4ECU A;  3V6J A;  7ICR A;  4NM2 A;  1B43 A;  2ZH4 A;  9ICX A;  3M9O B;  4DL3 A;  3MFH A;  4NKT A;  4MF2 A;  4EEY A;  4DFP A;  1ZQH A;  3ZDB A;  9ICA A;  4X4O A;  2OWO A;  4I2B A;  4DF8 A;  1S9F A;  3UPS A;  2M2V A;  5DB7 A;  3PNC A;  5CWR A;  4GC6 A;  5KFS A;  4GC7 A;  4F3O A;  1D8L A;  4J9O A;  1ZQD A;  5L1K A;  8ICI A;  3H39 A;  4C8M A;  4Z6D A;  3H38 A;  4DS5 A;  4TQR A;  1K1Q A;  4DSI A;  2KZ3 A;  4X4U A;  2BE3 A;  1S0M A;  2XCA A;  5DG7 A;  1RYS A;  4X4V A;  5CB1 A;  5KG7 A;  2M9N A;  4XA5 A;  5DB9 A;  3V6H A;  2RFF A;  5KFR A;  5J2F A;  4F4Y A;  2DVI A;  4B9L A;  1HUZ A;  2IBK A;  3ZDC A;  2Q0Z X;  1TK0 A;  1TAQ A;  4QW8 A;  2M2W A;  2HHS A;  3RH4 A;  4MF8 A;  4KLG A;  5KT2 A;  4MFC A;  1JXL A;  3C2M A;  4KMU A;  3L9D A;  1BVS A;  3EW9 A;  4YP3 A;  1UT5 A;  2FLN A;  1U45 A;  3FYH A;  5F9L A;  3RBE A;  1QLN A;  4R65 A;  4QZE A;  4WBY A;  3RJG A;  3K75 D;  1QTM A;  4R8U B;  4XRH A;  4F91 B;  4QW9 A;  3HT3 A;  4QWE A;  4LVS A;  1R89 A;  3PW2 A;  2DFL A;  3QZ8 A;  3HX0 A;  2BCU A;  4F5N A;  1LV5 A;  2I1Q A;  3EZ5 A;  3OSP A;  5D49 A;  4TUS A;  2XCP A;  3PX4 A;  1ARO P;  4B9V A;  1L3V A;  1R8A A;  4AT9 A;  4RUA A;  3C1Y A;  2BDP A;  5IIN A;  3EPG A;  2ZUB A;  5DBC A;  4EBE A;  2DR5 A;  3GII A;  2BPC A;  4R8U A;  3TFS A;  4DFM A;  3H8J A;  4DS4 A;  2KZM A;  1ZQA A;  1ZQI A;  1NJY A;  3AQL A;  4F4W A;  1T4G A;  3ZDA A;  5HRD A;  3UXN A;  1SL1 A;  2PFP A;  4LT6 A;  2BCR A;  4LZG A;  1SL0 A;  3GIJ A;  3RH5 A;  1MQ2 A;  4FH3 A;  3M9N B;  2VA8 A;  1Q78 A;  1ZQT A;  4RUC A;  3HPO A;  1V4A A;  4ECX A;  3QZ7 A;  1Y88 A;  4DL6 A;  1N56 A;  4M04 A;  1NOM A;  2HHW A;  4M6W B;  8ICT A;  2AJQ A;  3TAP A;  2R8J A;  4F5R A;  4RQ8 A;  2DR8 A;  4R64 A;  1IXR A;  3MBY A;  4F5O A;  1U4B A;  2VA3 A;  4C8L A;  2ZHB A;  2ZTC A;  4KIT B;  2DPJ A;  1MC8 A;  4WC1 A;  4YR2 A;  3Q8P B;  8ICX A;  5KG3 A;  4RZR A;  9ICM A;  3PY8 A;  4KN4 A;  4YCX A;  2ASD A;  5F9N A;  1IM4 A;  4RQ7 A;  4NLG A;  4FHV A;  9ICO A;  1ZQL A;  4IQU A;  4QZH A;  4FHW A;  4QWB A;  2AU0 A;  5KG5 A;  2KFN A;  4FHY A;  3WFS C;  3SV3 A;  3MAB A;  1Z00 B;  3JPO A;  1D9D A;  2MAX A;  5L1J A;  1SKS A;  1QSL A;  1UEU A;  3WFP A;  2PFO A;  2J6S A;  5J0P A;  2XY6 A;  1T7P A;  1UA0 A;  2ASL A;  9ICL A;  1JAJ A;  1ZJN A;  1NK5 A;  3T5K A;  4DSJ A;  5IIO A;  2PFQ A;  1XU4 A;  2H5X A;  1L3T A;  5KG0 A;  4YFK A;  3RB4 A;  4UQG A;  8ICB A;  4ELT A;  5KFD A;  5DLG A;  4ECW A;  4O9M A;  4AT8 B;  5CHG A;  1Z00 A;  4RU9 A;  3BJY A;  1COO A;  4J9N A;  3M9M B;  4X4T A;  5J2I A;  7ICU A;  4YMM A;  4RQ4 A;  4UD4 A;  3JPQ A;  3QE9 Y;  4J9L A;  3C23 A;  4KN7 A;  4QZG A;  1RPL A;  3Q8K A;  3BQ2 A;  1ZQM A;  4E8F A;  4QZI A;  7ICO A;  1T3N A;  3AQK A;  4X4S A;  1U49 A;  5HRG A;  4DSK A;  3MGH A;  2PFN A;  4WBZ A;  4UAW A;  5DB6 A;  8ICL A;  3KTQ A;  4DOC A;  2AGQ A;  4RQ6 A;  4ED6 A;  1NKB A;  1YLQ A;  3EYZ A;  5C5J A;  3QEA Z;  2W9A A;  4PGQ A;  2F1H A;  2NRZ A;  3RRH A;  4DF4 A;  4NLK A;  5KFA A;  7ICN A;  9ICN A;  4TUQ A;  8ICZ A;  3RB3 A;  4RT3 A;  5DKW A;  4EZ9 A;  2UVR A;  2NRW A;  3T3F A;  4DLE A;  3AQM A;  1ZQE A;  9ICV A;  1JMS A;  3MR2 A;  4Q43 A;  4XQ7 A;  1NJZ A;  4X4Q A;  4TUR A;  2RDJ A;  4P2H A;  8ICF A;  4KLO A;  3B0X A;  3MR5 A;  4EZ6 A;  1CUK A;  3Q8R B;  4NLZ A;  5KG6 A;  7ICS A;  4FS2 A;  3AQN A;  1RZT A;  2R8G A;  1TK8 A;  5J2K A;  5J2E A;  1DGS A;  2AQ4 A;  1KSP A;  2PI4 A;  4IQV A;  2ID1 A;  9ICW A;  2V4R A;  3M8S A;  1ZQQ A;  5BOM A;  3RAQ A;  4KTQ A;  4J9S A;  2FPM A;  1RXV A;  4R63 A;  2FMS A;  4B9S A;  4M9N A;  3LDA A;  3RJJ A;  4I27 A;  3H37 A;  5DGB A;  1WOT A;  4YD2 A;  4I2H A;  2ZH2 A;  4J9R A;  4DSF A;  4JV0 A;  5KT5 A;  1X2I A;  3SI8 A;  2ZJ5 A;  4B9T A;  2HHQ A;  4CCH A;  3OJS A;  2V4Q A;  4O3S A;  4QWA A;  8ICP A;  2BPF A;  4F92 B;  3MR6 A;  2IHM A;  4MEX A;  3IHQ B;  4DL5 A; 
#chains in the Genus database with same CATH topology
 1TVA A;  1ZQK A;  3PV8 A;  1WYG A;  3L5K A;  4EEB A;  4B6J A;  4C8K A;  4UW9 A;  4BGD A;  3ISC A;  4I28 A;  3PML A;  2ZIV B;  2K89 A;  4C0Z A;  5ALX A;  4RNN A;  3T5J A;  2YTU A;  2JGA A;  3N97 B;  2JZB A;  5J0X A;  3BQ1 A;  2Q66 A;  4DO9 A;  4U7C A;  4MHV A;  3HIY A;  5J0T A;  8ICO A;  1R8B A;  3C1Z A;  3V7K A;  1N48 A;  4AT7 A;  3THV A;  3TFR A;  3PX0 A;  2O5A A;  2P6R A;  4O69 A;  3C2L A;  5HNK A;  2ZJA A;  3TKA A;  5ALD A;  2PMZ C;  1FEZ A;  2FDR A;  5G5G A;  3UXO A;  3ERC C;  2QB0 B;  1ZQY A;  5CP2 A;  3SQI A;  1BPE A;  4NLB A;  4DQQ A;  4K4I A;  5AKZ A;  4NXX A;  1FFV A;  4BX9 C;  2HHP A;  5AKL A;  4ECZ A;  1H38 A;  2KJ9 A;  2ZH6 A;  5DG9 A;  3WU2 U;  2DKX A;  3M6K A;  8ICU A;  4UD5 A;  5DBA A;  2IHO A;  2NRT A;  5KTQ A;  2IMW P;  3ZI4 A;  3QUQ A;  1U47 A;  3JPP A;  2BHN A;  3FAH A;  1O08 A;  1P7D A;  4RT2 A;  2YY6 A;  3Q8L A;  4ATB A;  4WC6 A;  3N4M B;  5KFP A;  2JEJ A;  2ZH9 A;  5CHE A;  5AHX A;  7ICJ A;  1RXW A;  5CR0 A;  1ZJM A;  2IOH A;  3OV7 A;  4UBB A;  1JIH A;  5KFI A;  1HEK A;  1YZ7 A;  2F76 X;  4I2G A;  2HVH A;  3H0R B;  4HAI A;  1BPX A;  5EE1 A;  3OVS A;  3AMZ A;  2FLP A;  2K8C B;  2RHF A;  4OJP A;  3PSF A;  8ICA A;  5HRK A;  5AI0 A;  1NJX A;  3H4D A;  3UXP A;  1QQ6 A;  2HHV A;  3TAD C;  3GV7 B;  1SV0 C;  4OO1 J;  1UCV A;  1Q79 A;  4GXI A;  2BQR A;  2R8H A;  3NVV A;  1KDH A;  4ECQ A;  3S6J A;  2R8K A;  5AM2 A;  3RB0 A;  1NKE A;  5AM0 A;  2ALZ A;  3JPT A;  1URJ A;  1HJP A;  2JZB B;  1PVR A;  4Y2U A;  1KL9 A;  2HSZ A;  4IRK A;  3RJH A;  3JYY A;  4RNO A;  4J9K A;  1ZQZ A;  1J2M A;  2XGQ A;  1B4F A;  2Y0S C;  3PSP A;  1IV8 A;  2IOF A;  2NO4 A;  2ZXI A;  3G6Y A;  2AGP A;  2AHO B;  5J0S A;  1VJ7 A;  4YD1 A;  3AU2 A;  1PX5 A;  1Q46 A;  1NZB A;  2ODG A;  1X9S A;  2J6T A;  5KL8 B;  2Z7J A;  4F5Q A;  2NYV A;  2ESE A;  4BXO A;  4O67 A;  1NI3 A;  7ICP A;  2JH7 A;  2NV3 A;  4X4P A;  4EV6 A;  2JEG A;  2LM4 A;  5III A;  1ED1 A;  2KMD A;  8ICG A;  2BCV A;  4EGW A;  3HP6 A;  4UB4 A;  5KFN A;  3G6X A;  4IRD A;  1UEV A;  4FHP A;  4RQ5 A;  8ICQ A;  2AQ0 A;  4UB8 U;  4DL7 A;  3PX6 A;  2F77 X;  2HI0 A;  5IIL A;  7ICK A;  1A77 A;  2JMG A;  3PSI A;  3ETR A;  4QZB A;  4OJ5 A;  5KFM A;  4K4G A;  3OJU A;  1L8L A;  4CF4 A;  1KTQ A;  1UA1 A;  2WTF A;  1JQR A;  3GIM A;  9ICH A;  2KSO A;  4ATB B;  3KHG A;  4UB6 U;  2IOF K;  3ISB A;  2HCF A;  4O3P A;  1JN3 A;  3H8M A;  3ETL A;  4KLI A;  2BBJ A;  1FO4 A;  8ICS A;  2QB1 A;  2PKE A;  2E3T A;  2A1A A;  3VCB A;  3JPN A;  8ICK A;  3PHZ A;  1RYU A;  2EAN A;  3WKA A;  5AK5 A;  1V9P A;  2G5I B;  4B9N A;  2EAM A;  2VA2 A;  5JUM A;  1KFD A;  5EOZ A;  5J29 A;  3H8S A;  5KFO A;  1Z1B A;  4JMU A;  4O0I A;  1L5U A;  4Y2V A;  1ZQC A;  4FH5 A;  2MUT B;  5CRX A;  1JRO A;  2KTQ A;  3ISD A;  5EE9 A;  5DED A;  2W9C B;  1VFG A;  2J6U A;  5KFH A;  1V85 A;  3H0M B;  1ZQJ A;  4EBK A;  4X4N A;  4B9M A;  5KAF U;  4NLN A;  5D4B A;  4ICA A;  4CF3 A;  4ECU A;  3H40 A;  1B43 A;  3M9O B;  3MFH A;  3ZDB A;  3QUT A;  1OUQ A;  2M2V A;  1D8L A;  3D2S A;  1KW4 A;  4DS5 A;  5ALO A;  1J97 A;  1S0M A;  2XCA A;  2R18 A;  5KG7 A;  2M9N A;  3V6H A;  2CN1 A;  2OCE A;  4F4Y A;  2DVI A;  1HUZ A;  4G9B A;  4QW8 A;  4MFC A;  5KNI A;  3L9D A;  4KMU A;  2FLN A;  3RBE A;  4CRX A;  4IL6 U;  3RJG A;  1QTM A;  4QW9 A;  4QWE A;  2DFL A;  2EDU A;  3JCF A;  4OJ6 A;  1SWV A;  3OSP A;  2XCP A;  2JRZ A;  2ZUB A;  2BPC A;  4DS4 A;  1ZQA A;  3KZX A;  5AKI A;  1D8B A;  1T4G A;  3ZDA A;  1PK3 A;  4NL9 A;  4LZG A;  1V4A A;  2VA8 A;  5ALM A;  4RUC A;  3QZ7 A;  1Y88 A;  2HHW A;  1SB3 C;  4OAG A;  4NLC A;  2QLT A;  4R64 A;  1IXR A;  2VA3 A;  5ALP A;  3Q8P B;  5ALK A;  5AKJ A;  2EH9 A;  1MA7 A;  4NLG A;  4FHY A;  1QSL A;  3MAB A;  2MAX A;  1UEU A;  3WFP A;  2PFO A;  2OYY A;  2J6S A;  1JAJ A;  4OCZ A;  1NK5 A;  3T5K A;  5IIO A;  2PFQ A;  1XU4 A;  3N7P D;  4YFK A;  4OJO A;  2LBO A;  3RB4 A;  5DLG A;  4ECW A;  2ZIU B;  1Z00 A;  4YMM A;  1LKY A;  4IC9 A;  5T14 A;  3KZI U;  4E8F A;  7ICO A;  3AL0 B;  5FP0 A;  3AQK A;  4X4S A;  4DSK A;  4WBZ A;  5DB6 A;  3KTQ A;  4PZO A;  5B3P A;  5CFT A;  1YLQ A;  4PGQ A;  3RRH A;  3PST A;  4NXU A;  7ICS A;  3AQN A;  1RZT A;  5J2K A;  3N7S C;  4IQV A;  5AM4 A;  1JAL A;  9ICW A;  2ID1 A;  2E1F A;  3M8S A;  4KTQ A;  4J9S A;  2G08 A;  1RXV A;  2B0C A;  3LDA A;  3RJJ A;  5AKX A;  4YD2 A;  4I2H A;  1N61 A;  4JV0 A;  1KN5 A;  2ZJ5 A;  4CCH A;  4RQN A;  2RQ5 A;  2W03 A;  5ALR A;  2IHM A;  3SAH A;  2XC9 A;  5ALV A;  4LZD A;  3PR5 B;  4J9M A;  5EE3 A;  8ICY A;  1N62 A;  4Y2P A;  3OHA A;  2ZIX A;  2XY7 A;  1B22 A;  8ICR A;  4BJQ A;  5CJ7 A;  4Q44 A;  3SYZ A;  4C8O A;  3QU9 A;  4UB5 A;  4P4O A;  4AP9 A;  4RQ1 A;  2Y0S F;  3CW2 C;  4F8R A;  5J2D A;  1L6N A;  4C8N A;  3OWG A;  3KD3 A;  4TQS A;  4A8E A;  3BQ7 A;  3MDC A;  5HMM A;  1ZQP A;  1S76 D;  2ZIV A;  3B0Y A;  7ICQ A;  4DSE A;  4QZD A;  3RJF A;  4C4S A;  1VJ5 A;  4DSL A;  9ICG A;  4DFK A;  4EX7 A;  5J2G A;  4DL4 A;  5EWE A;  4GXK A;  3RAX A;  4YXM A;  3F5E A;  3RRG A;  4I2J A;  1PVP A;  3E2E A;  1NZP A;  5HR9 A;  2KD1 A;  2ZUD A;  5KFF A;  3RFA A;  2MSN A;  5J0Y A;  4US9 A;  3WFR E;  1OU5 A;  4QZF A;  1DOQ A;  4ECS A;  3B9J A;  3HWT A;  2P66 A;  5DQI A;  5AI9 A;  4ACO A;  5CA7 A;  3N7R C;  4KLT A;  2JV3 A;  3H3A A;  3K1Z A;  5J0O A;  4K4H A;  2QB0 A;  4I29 A;  4P0P B;  2UVW A;  2A19 A;  4IRC A;  2R8I A;  2WAQ C;  4EBC A;  2DGZ A;  4I2I A;  2KN7 A;  4NM1 A;  3BQT A;  2ZTD A;  4FS1 A;  2AXT U;  3C28 A;  2NRV A;  4OD0 A;  1S0O A;  3NUQ A;  3IG5 A;  5J0W A;  4J9Q A;  4PL2 A;  3RTV A;  3MFI A;  2GH1 A;  8ICM A;  4EX6 A;  1NK8 A;  5ALG A;  1RDF A;  1B0X A;  1NK9 A;  2A1J A;  1S10 A;  1Z1V A;  4DLG A;  5HHH A;  4IR1 A;  2H3V A;  1KEJ A;  2FPK A;  4Y2Y A;  4ECY A;  2B6G A;  5ALN A;  1XWL A;  5G5H A;  4KLQ A;  4DFD A;  4I2D A;  2EZY A;  3LQC B;  3NYB A;  5AI8 A;  1JX4 A;  1WWU A;  1UET A;  1JXE A;  3OSN A;  5HRB A;  3Q8M A;  1ZQX A;  3D6J A;  4QWD A;  5AKE A;  5KFV A;  1XSN A;  1CI4 A;  2LMR A;  3H0L B;  4EP7 A;  7ICH A;  5KFG A;  5AKK A;  3ZDE A;  2XY5 A;  4JLZ A;  4BWJ A;  1F5A A;  2W9B B;  2FPL A;  4YR3 A;  2ZH7 A;  2HW3 A;  1WUD A;  3KOO A;  4C7Y A;  2W11 A;  3RBD A;  3F2C A;  4C4T A;  5DGA A;  3KKA A;  3PW0 A;  3HJ1 A;  3H7I A;  4F2S A;  1Q3U A;  4M47 A;  5DQH A;  5AI6 A;  4KLD A;  4UAZ A;  2LYB A;  2HBM A;  4FE3 A;  2YQE A;  3K4G A;  5AM5 A;  3NGD A;  5GTH U;  4YQW A;  2LM1 A;  2Y1I A;  4P4P A;  3MCR A;  2W55 A;  4HYK A;  4UB3 A;  1D9F A;  2NRK A;  4QIW C;  1XS9 D;  1LVH A;  4JWM A;  3UQ2 A;  8ICN A;  5D61 A;  3SZ2 A;  5AKH A;  2YN4 A;  4G3I A;  4PH5 A;  5KFC A;  4DQR A;  4NJ8 A;  2BKE A;  3HRD D;  4RWN A;  1A0P A;  2ES6 A;  2O1P A;  2E8M A;  4X0A A;  3ORY A;  4F4X A;  4ED3 A;  1TK5 A;  3PO4 A;  3JPS A;  1QSS A;  1RG6 A;  4O3Q A;  5AIB A;  8ICJ A;  3T79 A;  1NKC A;  4WC4 A;  2MRL A;  5EWF A;  1KRP A;  2ZHA A;  3C66 A;  4J03 A;  1ZQV A;  3PW4 A;  3ALR A;  4M9G A;  5KFT A;  5AM3 A;  5L1M A;  2A1J B;  2FI1 A;  4DL2 A;  2W3R A;  3ONN A;  2PXI A;  2B21 A;  4WH5 A;  2LYH A;  3C29 A;  3MC1 A;  4DFJ A;  4KLE A;  3BDP A;  2HOI A;  3BS7 A;  9ICJ A;  3WK8 A;  2D8C A;  1SKR A;  5ALI A;  2W04 A;  5KFU A;  3Q8S B;  1TFR A;  2WF6 A;  5KT4 A;  3OVB A;  2I5H A;  3PO5 A;  1ZQR A;  3C2K A;  1XC9 A;  3UMC A;  3SMV A;  1MIV A;  4ELU A;  4F93 B;  2ATL A;  3HKZ F;  4XJE A;  2OH2 A;  1ZQ1 C;  4Q8E A;  2KKV A;  2LYA A;  5J0R A;  1SKW A;  9ICK A;  2MUT A;  2HMX A;  2K4I A;  2GO7 A;  3ZDD A;  2I6X A;  3GDX A;  2W9C A;  4YR0 A;  3V6J A;  2BBH A;  4C4R A;  4EEY A;  2WF5 A;  9ICA A;  4X4O A;  2OWO A;  3M6Z A;  5DB7 A;  3PNC A;  3H39 A;  1F0M A;  4TQR A;  4CDG A;  3AQF A;  3E58 A;  5KAI U;  2K60 A;  1UQV A;  3RH4 A;  5KT2 A;  1IG6 A;  1AQ6 A;  4R65 A;  2LHT A;  4R8U B;  4XRH A;  3HT3 A;  2VKQ A;  4LVS A;  1L7N A;  3HX0 A;  4F5N A;  1LV5 A;  2I1Q A;  2W3S A;  4K99 A;  3EZ5 A;  4TUS A;  3PX4 A;  3WK6 A;  4B9V A;  4AT9 A;  1L3V A;  1R8A A;  4RUA A;  2GAF D;  1QQ5 A;  3EPG A;  4EBE A;  4DFM A;  3H8J A;  4F4W A;  3CP8 A;  2FJ6 A;  2PFP A;  4LT6 A;  2BCR A;  3KBB A;  1Q78 A;  1ZQT A;  3HPO A;  2AJQ A;  2R8J A;  4F5R A;  4RQ8 A;  4US8 A;  2Q4T A;  3MBY A;  4F5O A;  2DPJ A;  4YR2 A;  2WB1 C;  5KG3 A;  3N28 A;  5J8Y A;  4AYB F;  9ICO A;  1ZQL A;  4FHW A;  1OW5 A;  2VIX A;  5KG5 A;  3JPO A;  1D9D A;  5L1J A;  1SKS A;  3QX7 A;  5J0P A;  2ASL A;  4DSJ A;  2KHQ A;  2M0N A;  3UMB A;  4NXV A;  1L3T A;  8ICB A;  2WAQ F;  4O9M A;  4EEK A;  1SZH A;  5CHG A;  3AN1 A;  4RU9 A;  3BJY A;  4X4T A;  4UD4 A;  2QAR A;  3JPQ A;  2KVS A;  4J9L A;  3C23 A;  4KN7 A;  3EUB 2;  1RPL A;  3BQ2 A;  1ZXI A;  1T3N A;  2D6F C;  2PFN A;  2ZIU A;  5C5J A;  3NWI A;  2F1H A;  9ICN A;  5KFA A;  2W54 A;  3RB3 A;  2KP7 A;  2UVR A;  3T3F A;  1ZQE A;  1JMS A;  4X4Q A;  4P2H A;  5HR6 A;  8ICF A;  4FFD A;  1N60 A;  4I0U A;  1SWW A;  2OEH A;  3IDW A;  1TK8 A;  3VC8 A;  3WK5 A;  1KSP A;  1DGS A;  2PI4 A;  2HN2 A;  1ZQQ A;  3IG8 A;  1A6S A;  2FPM A;  4OJL A;  4M9N A;  1WOT A;  4UAU A;  2HHQ A;  4Y2T A;  4QWA A;  5D62 A;  4UAV A;  3K1R B;  3IHQ B;  5D63 A;  3QEB Z;  4P4M A;  2HHU A;  1RQL A;  3EF2 A;  1WCN A;  2DUY A;  3UPQ A;  3AEV A;  4DEZ A;  4MFF A;  4GXJ A;  1U9L A;  4WC2 A;  2VJ5 A;  4UB2 A;  3RJI A;  4AT9 B;  4FHX A;  7ICF A;  3RJK A;  2DR9 A;  3MDA A;  1ZRN A;  2ZH5 A;  4RWO A;  4M9H A;  1GO3 F;  3DV9 A;  2V9W A;  2N1R A;  2G06 A;  3KHL A;  4NL9 C;  3HW8 A;  4FO6 A;  1JRP A;  4YG2 A;  4QIW F;  1QH9 A;  2ASJ A;  1TAM A;  2O6K A;  3AUO A;  5ALS A;  2NO5 A;  4ECV A;  1NO5 A;  3I76 A;  4FBU A;  2H3F A;  1A76 A;  5KFQ A;  2BPG A;  2E1E A;  2RDI A;  4IS7 A;  3AM9 A;  3QXG A;  5KG4 A;  1SIJ A;  4YN4 A;  3NVZ A;  4ECR A;  1L7P A;  8ICW A;  3BS5 B;  1ZYQ A;  4CGZ A;  3NS1 A;  2GLE A;  7ICI A;  2PMZ F;  3OGU A;  3V6K A;  2ZTE A;  2YMQ A;  5HRE A;  4EED A;  4YXJ A;  1XO0 A;  4F5P A;  2AH5 A;  1KFS A;  4EYH B;  3WK4 A;  2DF4 B;  4KLU A;  3GZF A;  3ZD8 A;  2QAR B;  5KT7 A;  1QSY A;  4BUG A;  4KLL A;  1VLB A;  4UAY A;  3EWA A;  4KX3 A;  4JUZ A;  3DDH A;  1NK4 A;  5BOL A;  4DQS A;  4E7X A;  4JV1 A;  2M2U A;  4P0P A;  2XI9 A;  4RNM A;  1L7O A;  4Z6F A;  4K96 A;  1V97 A;  3WKE A;  2BZF A;  1C7Y A;  1WCL A;  1ZQB A;  1Z4N A;  3F5A A;  4M0A A;  3M1Y A;  3ZD9 A;  1R8C A;  2KE7 A;  2C2R A;  3M8R A;  4DQI A;  5TZV A;  3ER9 B;  2F3N A;  5F3X B;  1CRX A;  2F1I A;  1X40 A;  4MEY A;  2FLL A;  4R66 A;  8ICE A;  2FCL A;  1ZD4 A;  9ICR A;  4BWM A;  2E8N A;  4I2E A;  2K4E A;  2NRX A;  4O3N A;  3KFU F;  1TKD A;  2BCQ A;  3KHH A;  1X9M A;  1ZQF A;  2BDU A;  2JEF A;  1S0N A;  3JPR A;  2YB1 A;  3OUY B;  4HX0 A;  2UVV A;  3NRZ A;  1L7M A;  1N63 A;  3OVA A;  1RYR A;  3HJ4 A;  1L8O A;  5ALY A;  3TQ1 A;  2GOL A;  2BQ3 A;  5HRL A;  3TAR A;  1KFT A;  1C20 A;  7ICG A;  9ICU A;  2DR7 A;  3D2N A;  2W9B A;  9ICC A;  2DPI A;  4ED0 A;  4K98 A;  4IQT A;  1ZOL A;  3NVW A;  3V7L A;  3FDS A;  3PW7 A;  4Q45 A;  2VAN A;  1NK7 A;  1XO1 A;  4RPY A;  5L1I A;  3LYS A;  2B4V A;  3Q8Q B;  1EXN A;  1NJW A;  2IA6 A;  3BZK A;  5DG8 A;  3GV8 B;  5AI5 A;  4RPZ A;  3DEE A;  5JRT A;  4ZOH C;  3H8W A;  1KKX A;  3GIL A;  5DDY A;  7ICE A;  2RP5 A;  3UQ0 A;  1L3S A;  4NY8 A;  3JZ0 A;  2LPE A;  5KL1 B;  4LEV A;  1XSL A;  2F8K A;  4Y2R A;  1D8Y A;  4DOB A;  1BPD A;  5H2F U;  1BPZ A;  2DBY A;  1N2X A;  2GWS A;  4CNQ A;  3C18 A;  5KT3 A;  4YVZ A;  2ZXH A;  5KG2 A;  2DL0 A;  5HR7 A;  5F2V O;  4GLX A;  3CK6 A;  4QZ8 A;  3WFQ E;  3HIL A;  4ED2 A;  1QQ7 A;  2OM6 A;  4M9J A;  1MIW A;  2E8P A;  1ZD2 P;  4TUP A;  5DBB A;  3RF9 A;  4PPX A;  3SR6 A;  4O3O A;  3V72 A;  3QNM A;  2Y1J A;  3LWL A;  3RR8 A;  4ELV A;  4F50 A;  5DEC A;  4E80 A;  4DCC A;  9ICT A;  5ALZ A;  4PHD A;  2JEI A;  5ALF A;  4X0B A;  4JLX A;  2AGO A;  2KIW A;  3GV5 B;  4PHP A;  2C2E A;  9ICQ A;  2XO7 A;  1X9W A;  4QWC A;  2BGW A;  1YZ6 A;  1KLN A;  4NXZ A;  5KFB A;  4Y2X A;  5AI4 A;  3E0F A;  2MA1 A;  2OHF A;  2ZIW B;  2HOF A;  2IHN A;  1JI7 A;  4Q8F A;  9ICE A;  4Y2S A;  2KKP A;  3LWM A;  4IR9 A;  2ISO A;  9ICS A;  4XUS A;  9ICF A;  5HHI A;  4ED8 A;  2WF8 A;  5DB8 A;  4PL1 A;  1ZQW A;  2WHE A;  2XGP A;  3AU6 A;  3SAF A;  1MN8 A;  5J2A A;  2EAP A;  4ZH4 A;  4K97 A;  1T3Q A;  2G09 A;  1ZQU A;  4M2Y A;  3CYM A;  1ECW A;  4O5C A;  5D46 A;  4RQ2 A;  4WQL A;  5J0U A;  4F4Z A;  4X5V A;  4MKP A;  3CNH A;  4EYI B;  3KKA C;  9ICP A;  5ALE A;  4YMO A;  1DRG A;  1ZD3 A;  1K1S A;  2HOQ A;  4KLJ A;  4F72 A;  1MIY A;  3C21 A;  1SGG A;  2H3I A;  2E8O A;  2ZH4 A;  9ICX A;  4DL3 A;  4NKT A;  4MF2 A;  4EEL A;  1Z4O A;  4CE6 A;  1S9F A;  1DK3 A;  5CWR A;  5KFS A;  4F3O A;  1ZQD A;  5L1K A;  4C8M A;  4Z6D A;  1K1Q A;  2KNJ A;  2JXJ A;  2KZ3 A;  4X4U A;  1X66 A;  5DG7 A;  2EZX A;  1RYS A;  4X4V A;  2YB4 A;  5CB1 A;  3UMG A;  4XA5 A;  5ALQ A;  4B9L A;  2IBK A;  2M2W A;  1J2N A;  4KLG A;  3C2M A;  1BVS A;  1DXS A;  3EW9 A;  4YP3 A;  1UT5 A;  1U45 A;  3FYH A;  1PK1 A;  1PVQ A;  4K8V A;  4WBY A;  3K75 D;  4F91 B;  4Y2Q A;  2RRD A;  3QZ8 A;  4WJ3 B;  5D49 A;  3C1Y A;  1FFU A;  5IIN A;  5DBC A;  3GII A;  4R8U A;  1ZQI A;  1NJY A;  3AQL A;  2W43 A;  4KB6 A;  4USA A;  5HRD A;  4OAI Z;  3UXN A;  2VJ4 A;  4N7R A;  4FH3 A;  3M9N B;  4ECX A;  1N56 A;  4M04 A;  4DL6 A;  8ICT A;  1NOM A;  2F2A B;  3FM9 A;  4C8L A;  2ZHB A;  2ZTC A;  4KIT B;  4C80 A;  2JH1 A;  8ICX A;  4RZR A;  3LVW A;  9ICM A;  3PY8 A;  2WF9 A;  2KOB A;  4QZH A;  2EQY A;  4QWB A;  2AU0 A;  1O03 A;  3WFS C;  3SV3 A;  1T7P A;  2W7P A;  1ZJN A;  1SXD A;  4QJF B;  5TIS U;  2H5X A;  5KG0 A;  5K4L A;  5KFD A;  4NWI A;  4O68 A;  5JU5 A;  3M9M B;  3SAG A;  2A3V A;  7ICU A;  1X6J A;  4RQ4 A;  3QE9 Y;  4O6A A;  1OXJ A;  4QZG A;  3U26 A;  1U49 A;  1QCK A;  5HRG A;  3MGH A;  4UAW A;  2EAO A;  2AGQ A;  4F71 A;  1NKB A;  3EYZ A;  2G07 A;  2W9A A;  1T94 A;  2NRZ A;  4DF4 A;  1TE2 A;  2KG5 A;  5DKW A;  3AQM A;  2NRW A;  3PZP A;  4DLE A;  9ICV A;  3MR2 A;  5AKG A;  4XQ7 A;  3AQE A;  1NJZ A;  4TUR A;  2RDJ A;  3TAC B;  3NVY A;  3MR5 A;  1CUK A;  3L4P A;  3Q8R B;  3MGV A;  2KVC A;  5KG6 A;  4JB3 A;  2KEY A;  4GIB A;  4KX5 A;  5AK3 A;  2EZZ A;  1Q8K A;  2V4R A;  2DR8 A;  5BOM A;  1IIP A;  3RAQ A;  3IV6 A;  2FMS A;  2CXY A;  2HN1 A;  4I27 A;  5AK6 A;  1SV4 A;  2ZH2 A;  4KMO B;  4J9R A;  5KT5 A;  1X2I A;  4B9T A;  2KJ5 A;  3OJS A;  4O3S A;  2BPF A;  4MEX A;  1PK1 B;  8ICH A;  1WG8 A;  3TAD A;  3PMN A;  1SV0 A;  4P0Q A;  5KFL A;  3F53 A;  4QZA A;  4JV2 A;  1UT8 A;  4FO1 A;  2GA9 D;  1PZN A;  1TFW A;  4WOY A;  3D2Q A;  3ICX A;  8ICC A;  4KM5 A;  4XQ8 A;  2UVU A;  4Z6C A;  3PVX A;  5DQG A;  2KIV A;  3GIK A;  4AT7 B;  1HUO A;  1UPH A;  1ZQG A;  4KLM A;  2P35 A;  3PR4 A;  4FBT A;  3WK9 A;  5ALL A;  4WCW A;  4F2R A;  1KQQ A;  2HHT A;  2ZH1 A;  1S8O A;  5KFZ A;  4QZC A;  4NKU A;  4WC3 A;  3GQC A;  2ZG6 A;  2G0A A;  1NK6 A;  3MR3 A;  5J8Y C;  3R9K A;  2FE9 A;  1FA0 A;  3QU5 A;  4CF5 A;  2KZZ A;  4J9P A;  2L5Y A;  4DQP A;  5HRF A;  4LEY A;  1L3U A;  3J81 j;  4PHE A;  3RH6 A;  2WFA A;  3BS5 A;  4X4R A;  4RPX A;  3RJE A;  3QUC A;  4YMN A;  5EWG A;  1VDV A;  4EBJ A;  3IM1 A;  4B9U A;  1WWV A;  2P6U A;  1BNO A;  5CFU A;  4UAR A;  1S97 A;  1UHU A;  3OHB A;  3G6V A;  2HBJ A;  2B56 A;  4NXT A;  5J2B A;  2HBK A;  3SEN A;  4WQK A;  2YMP A;  4I2F A;  1XSP A;  3OTQ A;  2B51 A;  2K4P A;  3NTU A;  2Y9U A;  5IIK A;  1GPJ A;  2D3D A;  1KBU A;  2ZH8 A;  2RLT A;  5KFK A;  2QKQ A;  2K4H A;  4KLF A;  4PGX A;  2CRX A;  2KFZ A;  3O0F A;  3K7D A;  4RQ0 A;  1SL2 A;  1HIW A;  5HML A;  2E5S A;  4ECT A;  4I2C A;  5KFY A;  3TI0 A;  2MU2 A;  2BQU A;  1K5O A;  2W8L A;  1N5X A;  4IQW A;  3NVO A;  4O3R A;  1TAU A;  2HDO A;  2DKZ A;  4PJ0 U;  1ZQS A;  4P0Q B;  4BDP A;  2HHX A;  1LB2 B;  1X6I A;  1MQ3 A;  5ALJ A;  2LI6 A;  5J2J A;  2G5H B;  2WF7 A;  3WK7 A;  2H3Z A;  2C28 A;  4WC0 A;  7ICT A;  3T5L A;  3OUY A;  4DWI A;  4LJX A;  4MFA A;  2YX8 A;  1TFY A;  7ICL A;  4PGY A;  4M5D A;  2ZJ8 A;  4WC5 A;  5DLF A;  1BPY A;  1ZQN A;  3NRW A;  4F4K A;  2PI5 A;  5AIC A;  2W9M A;  5IIJ A;  4BXO B;  1COK A;  2OXO A;  1DGJ A;  4LEW A;  3V7J A;  1S0V A;  3TAQ A;  1KNY A;  5ALW A;  2FMQ A;  4JWN A;  2KK0 A;  3HJE A;  5KFE A;  3EPI A;  1CEZ A;  5KT6 A;  3RR7 A;  1BPB A;  4WC7 A;  3CRX A;  2C2D A;  2BR0 A;  4RWQ A;  1S77 D;  1DK2 A;  4QZ9 A;  4FZN A;  4DOA A;  3LK9 A;  3OPX A;  2F1J A;  4M9L A;  7ICV A;  2DRB A;  4IG8 A;  2HBL A;  4EBD A;  3H4B A;  9ICB A;  5HP4 A;  8ICV A;  3QU7 A;  3QUB A;  1Z19 A;  2CPR A;  2EWR A;  5B3Q A;  5E79 U;  2KIC A;  3TAN A;  5KFW A;  2KSO B;  4RWP A;  3GFK B;  1U48 A;  5HC9 A;  3MGI A;  2K8B B;  2LKY A;  5KFX A;  3T5H A;  1T8E A;  3ER8 C;  1BGX T;  2HVI A;  5KFJ A;  2C22 A;  1PUZ A;  5BPC A;  5IIM A;  4O5K A;  2ISP A;  5JTI A;  1TV9 A;  1MSW D;  2KV2 A;  1ZQO A;  1FIQ A;  3NKU A;  4M6W A;  1ZET A;  1NK0 A;  1Z3E B;  4ED7 A;  4ED1 A;  3WKB A;  4I2A A;  5L1L A;  1SZP A;  1V38 A;  9ICI A;  5J0Q A;  4RQ3 A;  7ICM A;  5AM1 A;  4KLS A;  1X9X A;  3RB6 A;  1ZRM A;  2W8K A;  4O5E A;  4PZN A;  2ZIW A;  4UBC A;  5L9X A;  4PHA A;  5HRI A;  1NNL A;  2FMP A;  4Z6E A;  3BQ0 A;  5HRH A;  3WFO A;  2W7O A;  4AT8 A;  5DDM A;  4E0D A;  3HKZ C;  4S3N A;  1YT3 A;  2BCS A;  3BZC A;  5J2C A;  2M2T A;  5J2H A;  3A0H U;  4FZM A;  3SD7 A;  2I9G A;  3QU2 A;  2PBE A;  4JK1 A;  1F5S A;  3SV4 A;  3KHR A;  2ZUC A;  4KLH A;  3NAS A;  3C5G A;  2ZH3 A;  4UB1 A;  3PW5 A;  4UAT A;  5KG1 A;  1JUD A;  2DWQ A;  4U6P A;  4OAH A;  2DRA A;  7ICR A;  3C5F A;  4NM2 A;  4DFP A;  1ZQH A;  4K9A A;  2XID A;  1RM6 C;  3WKC A;  1ZD5 A;  3WKD A;  4I2B A;  4DF8 A;  5CFS A;  3F2B A;  4GC6 A;  4OAF A;  4GC7 A;  3GU3 A;  1BNP A;  4J9O A;  8ICI A;  3H38 A;  2IUB A;  1S5L U;  4DSI A;  2BE3 A;  5GTI U;  2XVT A;  3UM9 A;  5DB9 A;  2RFF A;  5KFR A;  5J2F A;  3I1Y A;  3ZDC A;  2Q0Z X;  1M6Y A;  1TK0 A;  1TAQ A;  2HHS A;  4MF8 A;  1N5W A;  2F8L A;  1JXL A;  5F9L A;  1QLN A;  4QZE A;  1R89 A;  3PW2 A;  5C0Y A;  2BCU A;  1ARO P;  3IP4 B;  2BDP A;  5A0L A;  2DR5 A;  4UAS A;  1Q3V A;  3TFS A;  1XNS A;  2KZM A;  5AKY A;  4EEN A;  2JHD A;  1SL1 A;  2XIC A;  5ALH A;  1SL0 A;  3GIJ A;  3RH5 A;  3A0B U;  1MQ2 A;  4C7Z A;  4M6W B;  5AK4 A;  3TAP A;  2KHV A;  1U4B A;  5AIA A;  5B5E U;  1MC8 A;  4WC1 A;  4AYB C;  4KN4 A;  4YCX A;  2ASD A;  2WB1 F;  5F9N A;  1IM4 A;  4RQ7 A;  3ED5 A;  4FHV A;  4IQU A;  2DQN B;  2YML A;  2KFN A;  3UPS A;  3SEI A;  1Z00 B;  2KJ8 A;  1X42 A;  2K8A A;  2XY6 A;  1LKY B;  9ICL A;  1UA0 A;  5EE0 A;  3L3F X;  1F44 A;  4UQG A;  4NV0 A;  4ELT A;  4O3M A;  4AT8 B;  4J9N A;  1COO A;  5J2I A;  3Q8K A;  5ALT A;  1ZQM A;  4QZI A;  3LVV A;  1SXE A;  8ICL A;  3FC4 A;  4DOC A;  3IRU A;  2H3Q A;  4RQ6 A;  4ED6 A;  2YMM A;  3QEA Z;  4GFJ A;  3IN5 A;  3F2D A;  4K9B A;  4NLK A;  7ICN A;  4TUQ A;  8ICZ A;  4NXW A;  4RT3 A;  2Y9T A;  4EZ9 A;  4RQM A;  5CEH A;  4Q43 A;  5ALU A;  4KLO A;  5JTG A;  3B0X A;  4EZ6 A;  4LEZ A;  2F44 A;  3QU4 A;  4NLZ A;  4FS2 A;  3M7D A;  2R8G A;  4FZL A;  5J2E A;  2AQ4 A;  2JR5 A;  1RQN A;  4R63 A;  4B9S A;  3H37 A;  5DGB A;  4DSF A;  3SI8 A;  2ZIX B;  4QNL A;  4Y2J A;  2V4Q A;  8ICP A;  3I28 A;  5B66 U;  4F92 B;  3MR6 A;  3QYP A;  4DL5 A; 
#chains in the Genus database with same CATH homology
 1TVA A;  3QEB Z;  4LZD A;  4P4M A;  3PR5 B;  1ZQK A;  2HHU A;  8ICH A;  3PMN A;  1WCN A;  3PV8 A;  5KFL A;  4QZA A;  4J9M A;  3UPQ A;  4C8K A;  4DEZ A;  8ICY A;  4BGD A;  3ISC A;  4I28 A;  4JV2 A;  1UT8 A;  3OHA A;  4MFF A;  4GXJ A;  2XY7 A;  1PZN A;  1U9L A;  1B22 A;  4WC2 A;  1TFW A;  4UB2 A;  3RJI A;  4AT9 B;  4FHX A;  8ICR A;  3PML A;  7ICF A;  5CJ7 A;  8ICC A;  4XQ8 A;  3RJK A;  2DR9 A;  4Q44 A;  3MDA A;  4Z6C A;  3SYZ A;  3PVX A;  2UVU A;  5DQG A;  4C8O A;  2ZH5 A;  4UB5 A;  4RWO A;  4P4O A;  4RQ1 A;  4RNN A;  3T5J A;  4M9H A;  3N97 B;  3GIK A;  4AT7 B;  4F8R A;  1HUO A;  2JZB A;  1ZQG A;  2V9W A;  3KHL A;  5J2D A;  5J0X A;  4KLM A;  4C8N A;  3BQ1 A;  3HW8 A;  4FO6 A;  4YG2 A;  3PR4 A;  2ASJ A;  2Q66 A;  4TQS A;  4DO9 A;  1ZQP A;  3MDC A;  5HMM A;  3AUO A;  4FBT A;  1S76 D;  3HIY A;  4WCW A;  5J0T A;  3B0Y A;  4ECV A;  7ICQ A;  1NO5 A;  4DSE A;  4QZD A;  3RJF A;  4FBU A;  4F2R A;  8ICO A;  3C1Z A;  3V7K A;  4DSL A;  2HHT A;  9ICG A;  4DFK A;  1N48 A;  1A76 A;  4AT7 A;  5J2G A;  4DL4 A;  5KFQ A;  2BPG A;  2ZH1 A;  2RDI A;  5EWE A;  4GXK A;  5KFZ A;  4QZC A;  4NKU A;  5KG4 A;  3THV A;  3RAX A;  3TFR A;  4WC3 A;  4YXM A;  4YN4 A;  3GQC A;  3PX0 A;  2O5A A;  1NK6 A;  3RRG A;  4I2J A;  3MR3 A;  2P6R A;  3E2E A;  5HR9 A;  4ECR A;  8ICW A;  3C2L A;  1ZYQ A;  5HNK A;  2ZJA A;  2ZUD A;  5KFF A;  1FA0 A;  2KZZ A;  5J0Y A;  4J9P A;  4DQP A;  7ICI A;  5HRF A;  1OU5 A;  3WFR E;  4QZF A;  3UXO A;  1DOQ A;  4ECS A;  4F4K A;  3HWT A;  3OGU A;  3V6K A;  1ZQY A;  5DQI A;  2ZTE A;  1L3U A;  2P66 A;  4PHE A;  5CP2 A;  3RH6 A;  5CA7 A;  4KLT A;  5HRE A;  4X4R A;  1BPE A;  4YXJ A;  4RPX A;  4DQQ A;  3RJE A;  4K4I A;  4F5P A;  4YMN A;  1KFS A;  4EYH B;  5EWG A;  2HHP A;  4KLU A;  4ECZ A;  3ZD8 A;  3H3A A;  5J0O A;  4EBJ A;  4K4H A;  1H38 A;  5KT7 A;  3IM1 A;  1QSY A;  5DG9 A;  2P6U A;  4B9U A;  4I29 A;  2ZH6 A;  1S97 A;  2UVW A;  4IRC A;  2R8I A;  4EBC A;  4KLL A;  4UAY A;  8ICU A;  3OHB A;  4I2I A;  3EWA A;  2KN7 A;  4JUZ A;  4NM1 A;  1NK4 A;  4UD5 A;  5DBA A;  3G6V A;  3BQT A;  2ZTD A;  4FS1 A;  2NRV A;  5BOL A;  1S0O A;  4J9Q A;  5J0W A;  2NRT A;  5J2B A;  4DQS A;  4E7X A;  5KTQ A;  4JV1 A;  3RTV A;  3MFI A;  2IMW P;  8ICM A;  2M2U A;  1U47 A;  4RNM A;  1NK8 A;  4I2F A;  1XSP A;  3JPP A;  2BHN A;  1NK9 A;  4RT2 A;  2A1J A;  3Q8L A;  1S10 A;  3NTU A;  4ATB A;  4WC6 A;  4Z6F A;  3N4M B;  4DLG A;  5HHH A;  4IR1 A;  5IIK A;  5KFP A;  2JEJ A;  2ZH9 A;  2ZH8 A;  1KEJ A;  2FPK A;  7ICJ A;  1RXW A;  5CR0 A;  4ECY A;  5KFK A;  1ZJM A;  1WCL A;  1XWL A;  4PGX A;  1C7Y A;  1ZQB A;  4KLF A;  4M0A A;  4KLQ A;  2KFZ A;  4RQ0 A;  4UBB A;  3OV7 A;  3ZD9 A;  1SL2 A;  1R8C A;  5HML A;  4ECT A;  2C2R A;  1JIH A;  4I2D A;  5KFI A;  3M8R A;  4DQI A;  5TZV A;  3LQC B;  3NYB A;  1JX4 A;  4I2G A;  4I2C A;  2HVH A;  5KFY A;  3TI0 A;  4KLD A;  2F1I A;  4MEY A;  2BQU A;  1UET A;  1JXE A;  2FLL A;  4R66 A;  1BPX A;  3OSN A;  8ICE A;  5HRB A;  9ICR A;  4BWM A;  2W8L A;  4I2E A;  3Q8M A;  1ZQX A;  3OVS A;  2NRX A;  4QWD A;  4O3N A;  2FLP A;  1TKD A;  2BCQ A;  3KHH A;  1X9M A;  4IQW A;  5KFV A;  8ICA A;  1XSN A;  1ZQF A;  4O3R A;  5HRK A;  1TAU A;  4EP7 A;  1NJX A;  3H4D A;  2JEF A;  1S0N A;  3UXP A;  3JPR A;  1ZQS A;  7ICH A;  5KFG A;  2HHV A;  3ZDE A;  3GV7 B;  2XY5 A;  3OUY B;  4BWJ A;  4GXI A;  2UVV A;  1F5A A;  1Q79 A;  2W9B B;  4BDP A;  3OVA A;  2HHX A;  1RYR A;  2BQR A;  1LB2 B;  2R8H A;  2FPL A;  3HJ4 A;  3TQ1 A;  1MQ3 A;  1KDH A;  5J2J A;  4YR3 A;  4ECQ A;  2ZH7 A;  2BQ3 A;  2R8K A;  5HRL A;  2HW3 A;  3TAR A;  2C28 A;  4WC0 A;  1KFT A;  3RB0 A;  7ICT A;  1NKE A;  3RBD A;  3T5L A;  3OUY A;  4DWI A;  5DGA A;  2ALZ A;  7ICG A;  3PW0 A;  4MFA A;  9ICU A;  3HJ1 A;  2DR7 A;  3JPT A;  2W9B A;  1TFY A;  3H7I A;  9ICC A;  2DPI A;  1HJP A;  4ED0 A;  2JZB B;  4F2S A;  4IQT A;  7ICL A;  3V7L A;  4M47 A;  4IRK A;  3FDS A;  4PGY A;  5DQH A;  4Q45 A;  2VAN A;  3PW7 A;  1XO1 A;  4RNO A;  4UAZ A;  4J9K A;  1NK7 A;  3RJH A;  4RPY A;  1ZQZ A;  5L1I A;  3JYY A;  4M5D A;  2ZJ8 A;  2XGQ A;  4WC5 A;  5DLF A;  3K4G A;  1BPY A;  3NGD A;  3Q8Q B;  1EXN A;  4YQW A;  2Y1I A;  1NJW A;  4P4P A;  3G6Y A;  2AGP A;  1ZQN A;  2IA6 A;  5DG8 A;  3GV8 B;  2PI5 A;  4RPZ A;  4HYK A;  5J0S A;  4UB3 A;  1VJ7 A;  2W9M A;  5IIJ A;  4BXO B;  4YD1 A;  3AU2 A;  1D9F A;  1PX5 A;  2NRK A;  3H8W A;  3V7J A;  1XS9 D;  4JWM A;  3GIL A;  1S0V A;  5DDY A;  3TAQ A;  3UQ2 A;  1X9S A;  7ICE A;  1KNY A;  2FMQ A;  8ICN A;  4JWN A;  3UQ0 A;  1L3S A;  3JZ0 A;  4NY8 A;  1R8B A;  3SZ2 A;  2J6T A;  4G3I A;  4PH5 A;  5KFE A;  3EPI A;  4F5Q A;  5KFC A;  4DQR A;  1XSL A;  1CEZ A;  5KT6 A;  1D8Y A;  4BXO A;  3RR7 A;  2BKE A;  1BPB A;  4DOB A;  4RWN A;  1BPD A;  7ICP A;  1BPZ A;  2O1P A;  4WC7 A;  2GWS A;  4X4P A;  3C18 A;  2JEG A;  2C2D A;  2BR0 A;  4RWQ A;  5KT3 A;  1S77 D;  4QZ9 A;  4X0A A;  4DOA A;  4YVZ A;  5III A;  3ORY A;  3LK9 A;  4F4X A;  2F1J A;  8ICG A;  4ED3 A;  2BCV A;  4M9L A;  7ICV A;  1TK5 A;  5KG2 A;  3HP6 A;  4UB4 A;  2DRB A;  4IG8 A;  4EBD A;  5F2V O;  3H4B A;  4GLX A;  4QZ8 A;  3WFQ E;  9ICB A;  3PO4 A;  5HP4 A;  8ICV A;  5KFN A;  3G6X A;  4IRD A;  4ED2 A;  3JPS A;  1QSS A;  1UEV A;  4FHP A;  4M9J A;  4O3Q A;  4RQ5 A;  8ICJ A;  1MIW A;  8ICQ A;  1NKC A;  2AQ0 A;  3PX6 A;  4DL7 A;  3TAN A;  4TUP A;  5KFW A;  5DBB A;  4WC4 A;  5EWF A;  4PPX A;  4RWP A;  3GFK B;  4O3O A;  3V72 A;  1U48 A;  5IIL A;  2Y1J A;  1KRP A;  7ICK A;  1A77 A;  2ZHA A;  5HC9 A;  3MGI A;  3LWL A;  3RR8 A;  3C66 A;  1ZQV A;  3PW4 A;  4QZB A;  4ELV A;  5KFM A;  4K4G A;  4F50 A;  5DEC A;  5KFX A;  1T8E A;  3T5H A;  4M9G A;  5KFT A;  9ICT A;  3OJU A;  4E80 A;  4PHD A;  2JEI A;  1KTQ A;  1BGX T;  2WTF A;  1UA1 A;  2HVI A;  4X0B A;  5KFJ A;  2C22 A;  5BPC A;  5IIM A;  1JQR A;  3GIM A;  9ICH A;  2A1J B;  2AGO A;  4O5K A;  4ATB B;  3GV5 B;  2ISP A;  4PHP A;  1TV9 A;  2C2E A;  3KHG A;  4DL2 A;  1MSW D;  9ICQ A;  1ZQO A;  3ISB A;  4O3P A;  4M6W A;  1JN3 A;  2PXI A;  2B21 A;  2XO7 A;  1ZET A;  1X9W A;  1NK0 A;  2LYH A;  3ETL A;  4DFJ A;  4KLI A;  4QWC A;  4KLE A;  2BGW A;  1Z3E B;  4ED7 A;  3BDP A;  1KLN A;  4NXZ A;  8ICS A;  2XC9 A;  5KFB A;  4ED1 A;  4I2A A;  5L1L A;  3JPN A;  1SZP A;  2IHN A;  4Q8F A;  9ICE A;  8ICK A;  4IR9 A;  3LWM A;  9ICS A;  2ISO A;  9ICJ A;  5J0Q A;  9ICI A;  4RQ3 A;  4XUS A;  1SKR A;  7ICM A;  5KFU A;  4KLS A;  9ICF A;  3Q8S B;  1TFR A;  5HHI A;  4ED8 A;  3RB6 A;  2W8K A;  4O5E A;  1V9P A;  5DB8 A;  5KT4 A;  4B9N A;  2VA2 A;  5JUM A;  1KFD A;  3OVB A;  5EOZ A;  4UBC A;  5J29 A;  1ZQW A;  2XGP A;  3AU6 A;  5L9X A;  4PHA A;  5HRI A;  3H8S A;  5KFO A;  3PO5 A;  1ZQR A;  5J2A A;  3C2K A;  1XC9 A;  2FMP A;  4O0I A;  4Z6E A;  3BQ0 A;  4ZH4 A;  5HRH A;  1L5U A;  3WFO A;  4AT8 A;  5DDM A;  4E0D A;  4FH5 A;  1ZQC A;  1ZQU A;  4M2Y A;  2MUT B;  4ELU A;  2BCS A;  1MIV A;  4S3N A;  4O5C A;  4F93 B;  5D46 A;  5J2C A;  2M2T A;  2ATL A;  4RQ2 A;  2KTQ A;  5J0U A;  3ISD A;  4F4Z A;  4X5V A;  5J2H A;  4Q8E A;  5J0R A;  2I9G A;  2W9C B;  2PBE A;  4EYI B;  4JK1 A;  3SV4 A;  1SKW A;  5DED A;  9ICK A;  9ICP A;  1VFG A;  2J6U A;  5KFH A;  4YMO A;  3KHR A;  2ZUC A;  1ZQJ A;  4KLH A;  1K1S A;  2MUT A;  4EBK A;  3C5G A;  4X4N A;  2ZH3 A;  4UB1 A;  3PW5 A;  4B9M A;  5KG1 A;  3ZDD A;  4KLJ A;  4NLN A;  5D4B A;  1MIY A;  2DRA A;  3GDX A;  3C21 A;  2W9C A;  4YR0 A;  3H40 A;  3C5F A;  4ECU A;  3V6J A;  7ICR A;  4NM2 A;  1B43 A;  2ZH4 A;  9ICX A;  3M9O B;  4DL3 A;  3MFH A;  4NKT A;  4MF2 A;  4EEY A;  4DFP A;  1ZQH A;  3ZDB A;  9ICA A;  4X4O A;  2OWO A;  4I2B A;  4DF8 A;  1S9F A;  3UPS A;  2M2V A;  5DB7 A;  3PNC A;  5CWR A;  4GC6 A;  5KFS A;  4GC7 A;  4F3O A;  1D8L A;  4J9O A;  1ZQD A;  5L1K A;  8ICI A;  3H39 A;  4C8M A;  4Z6D A;  3H38 A;  4DS5 A;  4TQR A;  1K1Q A;  4DSI A;  2KZ3 A;  4X4U A;  2BE3 A;  1S0M A;  2XCA A;  5DG7 A;  1RYS A;  4X4V A;  5CB1 A;  5KG7 A;  2M9N A;  4XA5 A;  5DB9 A;  3V6H A;  2RFF A;  5KFR A;  5J2F A;  4F4Y A;  2DVI A;  4B9L A;  1HUZ A;  2IBK A;  3ZDC A;  2Q0Z X;  1TK0 A;  1TAQ A;  4QW8 A;  2M2W A;  2HHS A;  3RH4 A;  4MF8 A;  4KLG A;  5KT2 A;  4MFC A;  1JXL A;  3C2M A;  4KMU A;  3L9D A;  1BVS A;  3EW9 A;  4YP3 A;  1UT5 A;  2FLN A;  1U45 A;  3FYH A;  5F9L A;  3RBE A;  1QLN A;  4R65 A;  4QZE A;  4WBY A;  3RJG A;  3K75 D;  1QTM A;  4R8U B;  4XRH A;  4F91 B;  4QW9 A;  3HT3 A;  4QWE A;  4LVS A;  1R89 A;  3PW2 A;  2DFL A;  3QZ8 A;  3HX0 A;  2BCU A;  4F5N A;  1LV5 A;  2I1Q A;  3EZ5 A;  3OSP A;  5D49 A;  4TUS A;  2XCP A;  3PX4 A;  1ARO P;  4B9V A;  1L3V A;  1R8A A;  4AT9 A;  4RUA A;  3C1Y A;  2BDP A;  5IIN A;  3EPG A;  2ZUB A;  5DBC A;  4EBE A;  2DR5 A;  3GII A;  2BPC A;  4R8U A;  3TFS A;  4DFM A;  3H8J A;  4DS4 A;  2KZM A;  1ZQA A;  1ZQI A;  1NJY A;  3AQL A;  4F4W A;  1T4G A;  3ZDA A;  5HRD A;  3UXN A;  1SL1 A;  2PFP A;  4LT6 A;  2BCR A;  4LZG A;  1SL0 A;  3GIJ A;  3RH5 A;  1MQ2 A;  4FH3 A;  3M9N B;  2VA8 A;  1Q78 A;  1ZQT A;  4RUC A;  3HPO A;  1V4A A;  4ECX A;  3QZ7 A;  1Y88 A;  4DL6 A;  1N56 A;  4M04 A;  1NOM A;  2HHW A;  4M6W B;  8ICT A;  2AJQ A;  3TAP A;  2R8J A;  4F5R A;  4RQ8 A;  2DR8 A;  4R64 A;  1IXR A;  3MBY A;  4F5O A;  1U4B A;  2VA3 A;  4C8L A;  2ZHB A;  2ZTC A;  4KIT B;  2DPJ A;  1MC8 A;  4WC1 A;  4YR2 A;  3Q8P B;  8ICX A;  5KG3 A;  4RZR A;  9ICM A;  3PY8 A;  4KN4 A;  4YCX A;  2ASD A;  5F9N A;  1IM4 A;  4RQ7 A;  4NLG A;  4FHV A;  9ICO A;  1ZQL A;  4IQU A;  4QZH A;  4FHW A;  4QWB A;  2AU0 A;  5KG5 A;  2KFN A;  4FHY A;  3WFS C;  3SV3 A;  3MAB A;  1Z00 B;  3JPO A;  1D9D A;  2MAX A;  5L1J A;  1SKS A;  1QSL A;  1UEU A;  3WFP A;  2PFO A;  2J6S A;  5J0P A;  2XY6 A;  1T7P A;  1UA0 A;  2ASL A;  9ICL A;  1JAJ A;  1ZJN A;  1NK5 A;  3T5K A;  4DSJ A;  5IIO A;  2PFQ A;  1XU4 A;  2H5X A;  1L3T A;  5KG0 A;  4YFK A;  3RB4 A;  4UQG A;  8ICB A;  4ELT A;  5KFD A;  5DLG A;  4ECW A;  4O9M A;  4AT8 B;  5CHG A;  1Z00 A;  4RU9 A;  3BJY A;  1COO A;  4J9N A;  3M9M B;  4X4T A;  5J2I A;  7ICU A;  4YMM A;  4RQ4 A;  4UD4 A;  3JPQ A;  3QE9 Y;  4J9L A;  3C23 A;  4KN7 A;  4QZG A;  1RPL A;  3Q8K A;  3BQ2 A;  1ZQM A;  4E8F A;  4QZI A;  7ICO A;  1T3N A;  3AQK A;  4X4S A;  1U49 A;  5HRG A;  4DSK A;  3MGH A;  2PFN A;  4WBZ A;  4UAW A;  5DB6 A;  8ICL A;  3KTQ A;  4DOC A;  2AGQ A;  4RQ6 A;  4ED6 A;  1NKB A;  1YLQ A;  3EYZ A;  5C5J A;  3QEA Z;  2W9A A;  4PGQ A;  2F1H A;  2NRZ A;  3RRH A;  4DF4 A;  4NLK A;  5KFA A;  7ICN A;  9ICN A;  4TUQ A;  8ICZ A;  3RB3 A;  4RT3 A;  5DKW A;  4EZ9 A;  2UVR A;  2NRW A;  3T3F A;  4DLE A;  3AQM A;  1ZQE A;  9ICV A;  1JMS A;  3MR2 A;  4Q43 A;  4XQ7 A;  1NJZ A;  4X4Q A;  4TUR A;  2RDJ A;  4P2H A;  8ICF A;  4KLO A;  3B0X A;  3MR5 A;  4EZ6 A;  1CUK A;  3Q8R B;  4NLZ A;  5KG6 A;  7ICS A;  4FS2 A;  3AQN A;  1RZT A;  2R8G A;  1TK8 A;  5J2K A;  5J2E A;  1DGS A;  2AQ4 A;  1KSP A;  2PI4 A;  4IQV A;  2ID1 A;  9ICW A;  2V4R A;  3M8S A;  1ZQQ A;  5BOM A;  3RAQ A;  4KTQ A;  4J9S A;  2FPM A;  1RXV A;  4R63 A;  2FMS A;  4B9S A;  4M9N A;  3LDA A;  3RJJ A;  4I27 A;  3H37 A;  5DGB A;  1WOT A;  4YD2 A;  4I2H A;  2ZH2 A;  4J9R A;  4DSF A;  4JV0 A;  5KT5 A;  1X2I A;  3SI8 A;  2ZJ5 A;  4B9T A;  2HHQ A;  4CCH A;  3OJS A;  2V4Q A;  4O3S A;  4QWA A;  8ICP A;  2BPF A;  4F92 B;  3MR6 A;  2IHM A;  4MEX A;  3IHQ B;  4DL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...