5BPCA

Dna polymerase beta ternary complex with a templating 5clc and incoming datp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, ligase/dna
molecule keywords DNA polymerase beta
total genus 111
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bpcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bpcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bpcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bpcA03
3GV5B 2W8KA 4I2CA 2BKEA 3KHGA 9ICCA 4KLQA 5TZVA 2HHXA 4O5CA 3Q8RB 4QWDA 9ICSA 3QEAZ 4I2DA 3KHRA 1ZQPA 4JV0A 3HWTA 5HRIA 5HRFA 4KN4A 4FBTA 2HHPA 3SV4A 4KMUA 1ZQMA 2ISPA 5HRGA 4RQ1A 4UB3A 4J9KA 4NM2A 1L3UA 8ICSA 3QEBZ 4HYKA 8ICAA 5CB1A 2HVHA 3AQLA 1QTMA 1U4BA 3PW2A 1BGXT 3E2EA 2JEIA 2GWSA 5J0XA 4GC7A 3ZD8A 4O9MA 2HHTA 2KZMA 5KFJA 8ICKA 4B9TA 4YN4A 5KT4A 1RXWA 9ICGA 3BQTA 4C8NA 4PHAA 3LQCB 3UPSA 1BVSA 1TK8A 2ZUBA 1U9LA 7ICLA 5J2IA 8ICTA 1KFDA 4YD1A 4PGXA 5DBBA 1VJ7A 2ZH4A 1ZQIA 5DLFA 4YFKA 5EWFA 1NK0A 4RU9A 5DGAA 1ZQKA 1N48A 3JPTA 4RQ5A 3ZDCA 2BCQA 4B9LA 4FHPA 2C28A 3PW4A 4QZHA 1TV9A 5KFLA 4JK1A 3IM1A 4UAZA 3OJUA 3PVXA 2ASDA 1TK5A 4EZ9A 1ZYQA 4RNMA 1ZQRA 4C8OA 3H39A 4FHVA 5L1KA 5KFSA 4QWAA 3MBYA 1BPYA 4X0AA 3OHBA 4FH3A 1NJYA 8ICLA 3JPOA 4X4OA 2DPIA 1KDHA 1JMSA 4GXIA 5HR9A 8ICJA 4I2FA 4WC7A 3Q8LA 1S76D 5IINA 5J2GA 4TUSA 3Q8QB 3C66A 5J2DA 4PH5A 1QLNA 2ZH7A 1ZJMA 2NRXA 5KT7A 5HMMA 3MR6A 2UVWA 1BPDA 3V7LA 4UB5A 3T5JA 4TUPA 1U48A 4Q8EA 7ICPA 4JWNA 3H37A 2NRZA 4I2IA 4YQWA 3OGUA 3M9NB 1IM4A 3EZ5A 1X9MA 1SL2A 1Z00A 4KLSA 3RRGA 3C5FA 5HRDA 4WC4A 1S10A 2W9CA 1ZQJA 4ED7A 3OVBA 2A1JB 3GIMA 4M9HA 2AQ0A 4YMNA 4I2HA 4EP7A 1SZPA 2W9BA 1UT5A 7ICJA 4X5VA 4R66A 2BQUA 3FYHA 5CWRA 4TURA 3H38A 4Z6EA 2HHQA 9ICLA 4AT7B 2AU0A 3NYBA 4R65A 5KG0A 4DOAA 4RNOA 4ECWA 9ICVA 3V6KA 4DS5A 3RB4A 5J2AA 2O1PA 1R8AA 2NRKA 2FPMA 4QZGA 5D49A 4DF4A 4KLMA 1MIWA 3ZD9A 5KT5A 1MIYA 1L3VA 1UETA 5KFBA 4YP3A 1Q79A 1U47A 3HPOA 3MR3A 1Z00B 4J9MA 4M9NA 4YR3A 1LB2B 4K4GA 4FBUA 2JZBA 4DL3A 2PFNA 3GQCA 3PX0A 1NK4A 1X9SA 4QW8A 3QZ8A 1ZQSA 1ZQQA 1B43A 1S0VA 3OVSA 2RDIA 4DSFA 4R64A 2VA8A 3Q8SB 4ED2A 4B9MA 4M9GA 4KLGA 2R8KA 4KLJA 1ZQXA 1D9FA 5KFTA 5J0RA 3HW8A 2IHNA 4EZ6A 3OSNA 4J9NA 2JEFA 2KN7A 4NY8A 5DG9A 5CR0A 4IRKA 3MABA 3PMLA 4J9OA 5HNKA 3PO4A 4F8RA 4WC6A 4M04A 5D4BA 2W9AA 1SKSA 4EBDA 1ZQTA 4J9SA 2R8JA 1SL0A 1KLNA 1ZQFA 4AT9B 2DRAA 1MQ3A 4K4IA 2B21A 5BOMA 3PNCA 4KLDA 8ICMA 1PX5A 4DQIA 3RAXA 2ZH1A 1XWLA 2ZTCA 3SV3A 4E0DA 4EBKA 1HUZA 1TFYA 5L1IA 4B9UA 1K1SA 9ICFA 3BQ2A 1DGSA 3RBDA 4P4MA 3LDAA 1S77D 1TFRA 4F5RA 4AT8A 1D8LA 4I27A 4J9QA 3AU2A 9ICHA 2ASLA 1XC9A 4YVZA 4I2EA 5DQHA 3Q8MA 3ISDA 2ALZA 1NK8A 9ICWA 4JUZA 5J0SA 4RPYA 4KLTA 2KTQA 9ICRA 8ICPA 3AQKA 5KFCA 5F2VO 5KFVA 2W9CB 1NJZA 2DR8A 4F93B 4XUSA 3LWLA 1R8CA 1UT8A 3PR4A 4UD5A 1JIHA 2ZH9A 4Q44A 1NKEA 5DQGA 4XQ8A 3EW9A 3RH4A 4DSKA 3KTQA 1CEZA 8ICZA 4TQSA 4XQ7A 3HJ4A 1ZQLA 3C2KA 4DO9A 3TFRA 4TQRA 4DS4A 2KFNA 2A1JA 2J6UA 1EXNA 4MEXA 3LWMA 4ED6A 3V6HA 3NTUA 4YXJA 4RQ7A 3GDXA 4F5QA 1X2IA 2PFOA 2PI4A 3ZDBA 4RWOA 4WC2A 4RPXA 1ZQDA 3OHAA 3N97B 5F9NA 1SL1A 2ISOA 4X4SA 3V7KA 1T7PA 4M9JA 1UEVA 1CUKA 4F92B 2BHNA 3PW5A 1TAQA 3T3FA 4BDPA 3B0XA 4M9LA 7ICRA 2ZHAA 4XRHA 5DBAA 3HX0A 5IIJA 4FS2A 3N4MB 3B0YA 2ZUDA 5DDMA 4ECTA 4YG2A 4ECZA 2V4RA 1JX4A 3V72A 4IRDA 1H38A 4KLIA 1MSWD 2DRBA 3WFOA 5J0UA 4M0AA 1ZQNA 3OJSA 4YMMA 4JV1A 1D9DA 3TFSA 4O3OA 5KFMA 3MDAA 4FHWA 4B9SA 4BXOA 4X4NA 2XCAA 4KITB 4WBZA 2P6UA 5KFPA 5J0PA 4J9LA 5J0TA 4Z6CA 3NGDA 4F4XA 5J2KA 4DL2A 5KFFA 4QW9A 3ETLA 2DPJA 2BPGA 2R8IA 2BPCA 2R8HA 4KN7A 2XC9A 4DFMA 4F2RA 4ATBA 3K75D 1COOA 3H8SA 2F1HA 4PGYA 4UBBA 3QE9Y 3PY8A 3C18A 3ORYA 2H5XA 5F9LA 4B9VA 3C2LA 2BQ3A 3ISCA 2VA3A 8ICGA 7ICKA 3OUYB 4DL4A 2M2UA 3KHHA 4BGDA 4I2JA 4MFCA 2ZHBA 4M5DA 4NXZA 4I2BA 1ZQZA 4ECUA 1BPEA 4QZEA 1NK7A 4BXOB 5KG5A 5KFWA 4E8FA 1NJWA 4KTQA 4AT9A 2HHVA 5IIMA 4E80A 4QZ8A 8ICEA 2DFLA 3PX6A 1TVAA 1NJXA 4FHXA 1NKBA 4ECRA 4WBYA 1TFWA 5KFAA 5BPCA 1AROP 2XGQA 1RYSA 1KEJA 4I28A 3PV8A 9ICOA 4QZ9A 1DK2A 3JYYA 5KFEA 4UB4A 4DF8A 5IIIA 1C7YA 2UVVA 4KLLA 4O3QA 3UXNA 8ICWA 1X9WA 2P66A 2ZUCA 4Z6FA 5KFRA 2Y1JA 3T5HA 5DG7A 4GXKA 4GC6A 3SYZA 1ZQHA 2C2DA 1RPLA 3H8JA 3GIJA 2UVRA 1JAJA 5J2JA 4O5EA 4Z6DA 5HRLA 3UQ0A 4FS1A 4DQPA 3BQ0A 7ICTA 2DR7A 8ICQA 2BCSA 1NZPA 4CCHA 4ECXA 3K4GA 2FMPA 5HC9A 4RQ3A 4KLEA 3Q8PB 1JN3A 5KFDA 5EWEA 2I1QA 2Q0ZX 3PR5B 4ELUA 2ZTEA 3GILA 4IQTA 5J0QA 8ICNA 2BDPA 1MC8A 3L9DA 3M9OB 4P4OA 2PXIA 1T4GA 4EYHB 3SZ2A 3BJYA 9ICNA 5HP4A 4X4VA 5KFNA 4ZH4A 2BCUA 9ICUA 1L3TA 3GIIA 9ICPA 4M47A 1ZQUA 1RZTA 3RJGA 1B22A 2ZH2A 2KZZA 2UVUA 2NRWA 4DFJA 2XO7A 5KFKA 3IHQB 1FA0A 4LZDA 4IR9A 5KFXA 1NK9A 3RJIA 4GLXA 1VFGA 2J6TA 5J2HA 1RXVA 7ICFA 8ICXA 1KTQA 5DB6A 5CA7A 4DQRA 3H8WA 4DQSA 2P6RA 1V4AA 4ELVA 2LYHA 2HHWA 2FMQA 4O5KA 4KLHA 4RUAA 4DLGA 4FO6A 5DEDA 8ICIA 4I2AA 2C22A 4YR2A 2V4QA 4R8UB 3EWAA 4RT3A 4QZFA 4MF8A 2JEJA 4F5NA 1NK5A 8ICCA 4BWJA 3RR7A 1KRPA 5DG8A 2AGQA 3H4BA 1ZQAA 8ICYA 4NKTA 5J2BA 3ZDAA 4M6WA 4Q8FA 5KTQA 1ZQBA 4F2SA 5HHHA 4RZRA 4DL7A 4RQ2A 4P4PA 3PMNA 2AGOA 3OVAA 5KFOA 5J0OA 4EBCA 1JXLA 2FPLA 1K1QA 3RBEA 3MR2A 4DOCA 3WFPA 4DFPA 4M6WB 2KZ3A 4UAWA 4X4TA 3ISBA 3SI8A 1ZQWA 1S0OA 3MDCA 5J0WA 4DSJA 9ICXA 1KSPA 4IG8A 3RR8A 2KFZA 3PX4A 3WFSC 4AT8B 1SKRA 1UA1A 1NK6A 8ICFA 9ICEA 4MFAA 3BQ1A 3UQ2A 4YR0A 2FMSA 1XSNA 1V9PA 2C2RA 4NLZA 8ICUA 1TAUA 4DL5A 7ICEA 1RYRA 5D46A 5L1LA 8ICRA 9ICMA 5J2EA 3MFIA 4I29A 3AQMA 3JZ0A 4FHYA 4R63A 1S0MA 4RQ8A 3GV8B 4AT7A 2MUTB 4F5OA 4NLNA 1ZQVA 2AQ4A 3HIYA 3FDSA 4IQUA 2BGWA 4Q45A 7ICNA 3EYZA 1U45A 1OU5A 1BPBA 5KG4A 2IBKA 4RT2A 4UB2A 2ASJA 1R89A 4WC3A 8ICBA 2XCPA 4RWNA 4RQ0A 7ICIA 4NKUA 4I2GA 4E7XA 2JEGA 1A76A 4QWBA 3JPNA 2ATLA 1IXRA 4QZCA 3UXPA 4QWEA 1S97A 1QSLA 4G3IA 2ZH6A 4WC0A 1WCLA 2Q66A 1QSYA 3AU6A 3GIKA 3HT3A 2Y1IA 4C8KA 2RFFA 1KFSA 3MR5A 3C5GA 1T3NA 3H3AA 2NRVA 4O3RA 5DKWA 5IILA 4IQVA 4WC1A 2KP7A 5KT3A 3MFHA 4ECSA 2ZTDA 7ICQA 4MEYA 2JZBB 4YMOA 3UXOA 4PGQA 5DLGA 3G6VA 2XY6A 4DSIA 9ICJA 3GFKB 3UPQA 5HRKA 1WCNA 4UB1A 2F1IA 2VANA 3EPGA 4C8LA 4YXMA 3T5LA 5CP2A 1ZQYA 5HHIA 4DSEA 1ZQGA 4IR1A 2XGPA 3C21A 1U49A 4X4UA 2M2TA 4WCWA 4EBJA 5DQIA 4QWCA 3M8RA 5KG7A 1HUOA 2FLLA 2HW3A 8ICHA 7ICSA 3WFRE 4F5PA 2PI5A 2C2EA 4F4YA 1ZQCA 2BCRA 4DEZA 4NM1A 1F5AA 3OSPA 4F4KA 2OWOA 4X4QA 1UEUA 3M8SA 3ZDDA 3C1YA 5DGBA 3TAQA 3QZ7A 1JQRA 3THVA 2W9MA 3G6YA 4DLEA 4ELTA 1WOTA 1T8EA 4NLGA 9ICBA 4QZIA 4FH5A 5KFZA 1MQ2A 3MGIA 3OUYA 1HJPA 1Z3EB 5J2CA 3RH5A 3EPIA 2HHUA 4X4PA 2V9WA 5L9XA 4QZBA 3C23A 2PFQA 1JXEA 3H40A 4QZAA 4P2HA 7ICUA 3JPQA 4RQ6A 2BE3A 5DBCA 2AGPA 5KFHA 3TAPA 4M2YA 4LVSA 4O3PA 1XSLA 4UBCA 2W9BB 7ICVA 4BWMA 4LZGA 1DOQA 4ED1A 4Q43A 4B9NA 4EYIB 9ICIA 4IQWA 5IIOA 5KT6A 4ED3A 3PO5A 5KFQA 3RAQA 5HRHA 4RWQA 1NKCA 4RNNA 4RQ4A 9ICQA 1DK3A 4LT6A 1LV5A 4IRCA 2MUTA 4UD4A 9ICAA 4F50A 2FPKA 4RWPA 2DVIA 3C1ZA 3TANA 4KLOA 4JWMA 3MGHA 1QSSA 3LK9A 4QZDA 4DL6A 5J29A 4DQQA 2DR9A 1ZETA 1UA0A 3RJJA 8ICOA 4J9RA 4ED8A 8ICVA 5KG3A 4EBEA 3V6JA 5CJ7A 5JUMA 2M2VA 5HRBA 1BNPA 5HREA 4JV2A 4ECQA 1NOMA 3TARA 1XSPA 5KFGA 2BPFA 2ZJ8A 2FLPA 3AUOA 5EWGA 1XS9D 2ID1A 7ICOA 4UQGA 1SKWA 2IHMA 7ICGA 1BNOA 4YD2A 3RRHA 3TQ1A 4YCXA 4ECVA 2NRTA 3RB3A 2PBEA 5IIKA 3ZDEA 5EOZA 2DR5A 2M2WA 4DWIA 2J6SA 1R8BA 4NLKA 5KFIA 1TK0A 1Q78A 3HJ1A 2ZH8A 5KFUA 3G6XA 7ICHA 4X4RA 3T5KA 1XU4A 5KFYA 9ICKA 4R8UA 3V7JA 3Q8KA 1BPZA 5KT2A 4O3SA 4F4WA 3BDPA 4MF2A 1L5UA 2F1JA 5KG1A 4ED0A 3H7IA 2I9GA 4ATBB 5CHGA 3M9MB 1S9FA 2XY7A 3RJFA 3PW0A 2BR0A 1N56A 4DFKA 3RJKA 5HMLA 4S3NA 4PHPA 1PZNA 3KHLA 5J2FA 2R8GA 1MIVA 2VA2A 2IA6A 4KLFA 7ICMA 2HHSA 4UAYA 2ZJAA 1XO1A 3RTVA 5DB7A 3C2MA 1ZQEA 2MAXA 3RB6A 4XA5A 3RJHA 1ZQOA 9ICTA 5BOLA 1TKDA 2WTFA 4PHEA 2ZJ5A 2BCVA 1ZJNA 1S0NA 2PFPA 3TI0A 4RUCA 2ZH3A 4GXJA 2XY5A 5L1JA 4WC5A 2M9NA 2ZH5A 4F91B 1YLQA 5DECA 5KG6A 3JPSA 3RB0A 4K4HA 2AJQA 1NO5A 5DB8A 3H4DA 4J9PA 2IMWP 1KNYA 2O5AA 2BQRA 1Y88A 3OV7A 3RJEA 4C8MA 5J0YA 4ECYA 1D8YA 4MFFA 4DSLA 4RPZA 4O0IA 4EEYA 2W8LA 1KFTA 4KLUA 3WFQE 4TUQA 4DOBA 3JPPA 2FLNA 5DB9A 2RDJA 3PW7A 3RH6A 4X0BA 4F4ZA 4F3OA 5C5JA 3HP6A 1A77A 1L3SA 4O3NA 1BPXA 3JPRA 5DDYA 4PHDA 4PPXA 2HVIA 5KG2A 3GV7B 3AQNA
chains in the Genus database with same CATH superfamily
2W8KA 3ZI4A 9ICCA 4O5CA 3RFAA 3Q8RB 2HCFA 2YX8A 3QEAZ 4I2DA 3KHRA 1ZQPA 3HWTA 5HRIA 2W03A 3H0MB 4UB3A 4J9KA 2HVHA 3QYPA 1QTMA 3PW2A 5H2FU 4GC7A 2HHTA 5KFJA 4B9TA 1RXWA 4K99A 1L7MA 8ICTA 2KICA 5EWFA 4B9LA 4FHPA 1TV9A 1N61A 5KFLA 3PVXA 2CXYA 1ZYQA 3F2CA 4RQMA 1ZQRA 2GA9D 3OHBA 8ICLA 1JROA 4X4OA 2DPIA 4GXIA 4TUSA 4PH5A 2LHTA 7ICQA 5KT7A 4WC5A 2H3ZA 4Q8EA 4UB5A 1GO3F 2NRZA 2LYAA 3M9NB 3EZ5A 1X9MA 5AI8A 1VLBA 3OVBA 2OXOA 4M9HA 2AQ0A 4YMNA 4EEDA 4X5VA 5CWRA 4TURA 3IRUA 4JMUA 2HHQA 2AU0A 3DV9A 1DGJA 5KG0A 4ECWA 3V6KA 3TKAA 4DS5A 5G5GA 2NRKA 2FJ6A 4QZGA 3ZD9A 1UETA 3IG8A 2XICA 3IG5A 3HPOA 3MR3A 4J9MA 4M9NA 3NVZA 1JRPA 4R64A 4P0PB 4BX9C 4KLJA 2R8KA 5KFTA 2HOQA 5J0RA 3OSNA 4NY8A 5DG9A 2AH5A 1L6NA 3PMLA 1SKSA 4UARA 2B56A 2W43A 2DRAA 2G5IB 4K4IA 3NVOA 1QQ7A 3ALRA 4KLDA 1PX5A 4DQIA 3RAXA 2RLTA 3HKZF 2ZH1A 4EBKA 3ICXA 9ICFA 1MN8A 2G06A 2DL0A 2OYYA 1D8LA 2ASLA 1XC9A 3Q8MA 4JUZA 5F2VO 1NJZA 3UMBA 3MCRA 4O67A 4XUSA 1R8CA 2ZIVB 4UD5A 1JIHA 2KVCA 2ZH9A 2KVSA 1WUDA 3EW9A 2Q4TA 4DSKA 4RQNA 4QIWF 2HOFA 3F5AA 1ZQLA 3C2KA 1VJ5A 3LVWA 3GDXA 4RPXA 1KKXA 4X4SA 4F92B 4BDPA 1TAQA 2OCEA 4IS7A 1XO0A 1JX4A 2WFAA 3I1YA 4YMMA 3TFSA 4UB6U 4B9SA 5J0PA 3NASA 3NGDA 4DL2A 1PVRA 2CN1A 3M1YA 2R8HA 2XC9A 3K75D 1COOA 3QE9Y 3N7RC 4B9VA 8ICGA 2VA3A 3OUYB 7ICKA 1A6SA 4BUGA 1SWWA 5AIBA 4I2JA 4QZEA 2JMGA 2HHVA 8ICEA 1NKBA 4ECRA 4I28A 1AROP 3QUTA 1PVQA 3JYYA 4DF8A 4NXTA 4O3QA 1X9WA 5KFRA 5DG7A 2I6XA 2Q66A 4Z6DA 2IOFK 4DQPA 3BQ0A 4DCCA 5HC9A 4RQ3A 3Q8PB 2YN4A 2I1QA 2Q0ZX 1T4GA 5HP4A 2KSOA 5KFNA 2Y9UA 2BCUA 4NXXA 9ICUA 4M47A 1RZTA 2KZZA 2NRWA 4NL9A 3UMGA 2YMPA 4IR9A 3UM9A 2J6TA 7ICFA 5DB6A 2P6RA 3SAHA 1X9XA 4ELVA 2DBYA 1F44A 4FO6A 5D61A 8ICIA 3HRDD 4KX5A 4R8UB 5KL8B 4C4SA 5DG8A 1UPHA 3H4BA 1ZQAA 4RZRA 3KZXA 2EZXA 2M0NA 3WFPA 4M6WB 1KSPA 2KFZA 3PX4A 2E1FA 3WU2U 9ICEA 1L8OA 1RYRA 5L1LA 9ICMA 3BZCA 4R63A 1S0MA 2P35A 2MUTB 1K5OA 3NUQA 2AQ4A 3HIYA 3FDSA 2BGWA 7ICNA 2GOLA 1SV4A 4NKUA 2JEGA 1QSLA 1KBUA 4QZCA 1IXRA 1N63A 2NO4A 4QWEA 4QIWC 3K7DA 4NV0A 3MR5A 1T3NA 4O3RA 2E8OA 4KMOB 2W3RA 2ZTDA 1PVPA 5GTHU 2JZBB 3UPQA 2VANA 2B0CA 3TADC 3JCFA 4X4UA 3L4PA 2KHVA 4QWCA 1ECWA 7ICSA 2Y9TA 2C2EA 4F4YA 1ZQCA 3NVVA 2B51A 3OSPA 4F4KA 2OWOA 1UEUA 2H3VA 4CF4A 5DGBA 3TAQA 3THVA 1MQ2A 2HHUA 2V9WA 2OH2A 3C23A 2PFQA 4QZAA 1LKYB 2BE3A 2PMZF 3BS7A 4M2YA 1XSLA 4LZGA 4B9NA 4EYIB 9ICIA 4IQWA 3RAQA 2ZIUB 9ICQA 4RWPA 3TANA 2LM4A 2W7OA 4NL9C 1PK1A 3LK9A 4OAIZ 2DR9A 1UA0A 2FDRA 3RJJA 1L8LA 5JUMA 2M2VA 5HREA 2BPFA 2FLPA 2XIDA 3NYBA 1XS9D 1SKWA 1BNOA 2IHMA 5AM3A 2NRTA 3RB3A 2J6SA 1Q78A 4GIBA 2YB1A 3T5KA 5KFYA 9ICKA 1D8BA 2ZIWB 3F53A 2I9GA 2F1JA 4ATBB 3FM9A 3FC4A 3QU4A 3M9MB 4MKPA 2JH1A 5CRXA 2CRXA 4DFKA 4P0QA 4OD0A 3F2DA 4UAYA 3HILA 4EX6A 3AL0B 3AEVA 4XA5A 1FEZA 2RQ5A 3AM9A 4NLBA 3A0HU 2ZH3A 5L1JA 2M9NA 4F91B 2AJQA 3JPSA 1KQQA 1Y88A 3WK6A 1SGGA 4DSLA 2W8LA 3JPPA 2RDJA 5AM4A 4F4ZA 3HP6A 1A77A 4O3NA 3JPRA 3M7DA 2ESEA 4PPXA 5KG2A 3KHGA 4KLQA 2HHXA 9ICSA 2WF8A 4IG8A 4NXWA 3HJEA 3SV4A 4RQ1A 1L3UA 8ICSA 4HYKA 8ICAA 1U4BA 1BGXT 2BDUA 4MHVA 4O9MA 2EANA 3LQCB 1BVSA 2W3SA 2ZUBA 1U9LA 2DGZA 2H3FA 2ZH4A 1ZQIA 2KIWA 1N48A 3JPTA 3OTQA 4JK1A 3IM1A 4UAZA 4EZ9A 2ASDA 3VCBA 2RP5A 2XVTA 1F0MA 4QWAA 5L1KA 1BPYA 4X0AA 5AKYA 1NJYA 1PK3A 3Q8LA 3C66A 5IINA 5J2GA 3Q8QB 4OJLA 5E79U 5J2DA 1YZ6A 3MR6A 3V7LA 4JWNA 1SL2A 2EDUA 2W9CA 4C4RA 2KKVA 3GIMA 1SZPA 2W9BA 1UT5A 5ALKA 2K4HA 4Z6EA 4AT7B 4JLZA 1HIWA 4OAHA 4R65A 4LEZA 4RNOA 4NWIA 9ICVA 5B5EU 5J2AA 2O1PA 4KLMA 5D49A 5KT5A 1NZBA 1Q79A 1U47A 1Z00B 4UATA 1LB2B 3H0RB 2WHEA 2GLEA 2HMXA 3CW2C 4DL3A 3F2BA 1X9SA 1ZQSA 1ZQQA 1B43A 1S0VA 2RDIA 2EAPA 4EV6A 5ALFA 1D9FA 2WAQC 5ALHA 3HW8A 4J9NA 4IRKA 3MABA 5ALGA 4J9OA 4K9BA 1J97A 4M04A 2W9AA 4EBDA 1N60A 4J9SA 4FE3A 1KLNA 2R8JA 4AT9B 3BS5A 2ZG6A 1RQNA 2B21A 5ALTA 5AKHA 1TAMA 5ALRA 3I76A 3KKAA 5AM0A 3WKCA 5L1IA 1HUZA 1Q3VA 3KOOA 2O6KA 3RBDA 4P4MA 2QARB 1S77D 4F5RA 4J9QA 3NKUA 4I2EA 2W54A 4GFJA 5DQHA 9ICWA 4RPYA 9ICRA 4KM5A 5ALYA 1SZHA 3AQKA 2DR8A 1XNSA 5ALWA 1NKEA 2PMZC 5DQGA 2XI9A 1HEKA 2J6UA 3LWMA 3V6HA 3NTUA 2DRBA 4F5QA 2PI4A 4RWOA 4Y2QA 1ZQDA 1DRGA 3V7KA 1T7PA 4M9JA 1CUKA 2ZHAA 3PW5A 7ICRA 3T3FA 2AXTU 4Y2TA 4XRHA 3HX0A 4FS2A 2ZUDA 5DDMA 4YG2A 4KLIA 1RDFA 3WFOA 4M0AA 1DXSA 4Y2UA 2KSOB 1ZQ1C 4BXOA 4KITB 2P6UA 3PZPA 5J2KA 3ETLA 5JU5A 4ATBA 4EBJA 4UBBA 3H8SA 3C18A 3CRXA 5F9LA 3C2LA 3IN5A 2ZIWA 2WB1C 2HOIA 4MFCA 3E58A 2K8CB 1ZQZA 4BXOB 5KG5A 1L7PA 1NJWA 4KTQA 2E1EA 4QZ8A 4FHXA 4WBYA 5BPCA 2XGQA 3SENA 3QU5A 1DK2A 4US9A 2EAOA 4USAA 2YB4A 2UVVA 2F76X 2HBJA 5ALEA 2ZUCA 4Z6FA 1V38A 2Y1JA 3T5HA 1ZQHA 4GC6A 3H8JA 2UVRA 2KV2A 4K97A 5JTIA 5J2JA 5HRLA 3UQ0A 2DR7A 4OAGA 3KBBA 8ICQA 1NZPA 3K4GA 2FMPA 2JRZA 4KLEA 2MU2A 5KFDA 2K4PA 4QNLA 2ZTEA 8ICNA 5AKEA 1MC8A 9ICNA 3BJYA 1ZD4A 2VKQA 4CGZA 9ICPA 2ZH2A 1B22A 5JTGA 2UVUA 2XO7A 3NRWA 1JUDA 4NXVA 1FA0A 2LYBA 5KFXA 4UB8U 5CA7A 1V4AA 3H8WA 4CDGA 4O5KA 4KLHA 4I2AA 4NLCA 5J8YC 3EWAA 2K8BB 5AKGA 4RT3A 8ICCA 4MF8A 2WB1F 5B3QA 4BWJA 3SAGA 5J2BA 4Q8FA 1UQVA 5KTQA 1ZQBA 4Y2VA 2AGOA 3OVAA 5J0OA 5KAIU 1K1QA 3RBEA 1X42A 3ISBA 1ZQWA 3MDCA 2HBLA 2MA1A 4UAVA 4Y2SA 5ALOA 3K1RB 1ZXIA 4RQ8A 2FE9A 4NLNA 1ZQVA 3LYSA 2EH9A 4Q45A 3EYZA 1Z1VA 1V85A 1R89A 4UB2A 2ASJA 2XCPA 2WF9A 3C29A 4QWBA 3JPNA 2ATLA 3L5KA 1S97A 2HI0A 2ZH6A 2ZIUA 4WC0A 3AU6A 3U26A 1KFSA 3I28A 3H3AA 2KP7A 5KT3A 3MFHA 4ECSA 5KNIA 4YMOA 4PGQA 5HRKA 4XJEA 3GFKB 4F71A 2F1IA 3EPGA 4C8LA 3IV6A 5CP2A 1ZQYA 1ZQGA 5ALJA 2XGPA 1U49A 2QB1A 2M2TA 5DQIA 2G09A 3M8RA 1HUOA 5KG7A 8ICHA 2PI5A 2K4EA 2RRDA 4DEZA 1F5AA 1GPJA 4X4QA 2F8KA 3M8SA 3N28A 3C1YA 2KKPA 3G6YA 5AKXA 4FH5A 1HJPA 4CF5A 2E3TA 2YY6A 4K98A 4QZBA 3H40A 7ICUA 3JPQA 3K1ZA 5DBCA 2AGPA 4O3PA 2W9BB 2DF4B 3QU9A 4BWMA 1DOQA 5HRHA 4KB6A 3NWIA 4LT6A 4C7YA 4RQ4A 4RNNA 2BBJA 2WF7A 1ZRMA 4F50A 2W7PA 3MGHA 1QSSA 3UMCA 5J29A 2QB0A 3AN1A 5ALNA 2F77X 2W55A 4J9RA 5KG3A 1BNPA 4O68A 4JLXA 2A19A 3ED5A 5KFGA 1LVHA 2ZJ8A 3NRZA 3AUOA 5EWGA 2ID1A 7ICOA 4ECVA 5AICA 3BQ7A 2DR5A 4HAIA 3G6XA 3PSIA 3V7JA 2AHOB 5KT2A 3CYMA 2I5HA 3BDPA 4MF2A 4EGWA 1TE2A 1S9FA 2XY7A 5HR7A 2IUBA 4FZMA 3B9JA 5HMLA 4PHPA 2E5SA 3KHLA 1MIVA 2KMDA 4WQKA 4KLFA 2KHQA 1ED1A 2ZJAA 3C2MA 1ZQEA 3RB6A 4IL6U 1ZQOA 2A1AA 5BOLA 2WTFA 2ZJ5A 3TI0A 5A0LA 4GXJA 2ZH5A 5DECA 5KG6A 4K4HA 3H4DA 2QB0B 1JALA 2JGAA 4C8MA 4DFDA 1D8YA 4MFFA 4RPZA 4O0IA 1KFTA 3WFQE 4KLUA 4DOBA 5GTIU 3PSPA 4OJ6A 1X6IA 5DDYA 4FZNA 3GV7B 3GV5B 2BKEA 3M6KA 4AP9A 2CPRA 2LBOA 2HHPA 4KMUA 2NV3A 1ZQMA 2ISPA 2K8AA 5L1MA 4NM2A 4U6PA 5AKLA 3QEBZ 2ZXHA 3AQLA 5AK4A 3KZIU 2JEIA 1RQLA 3ZD8A 2KZMA 5KT4A 9ICGA 3UPSA 1TK8A 5TISU 3ETRA 5DBBA 1VJ7A 1ZQKA 1NK0A 5EE3A 4RU9A 3KFUF 2BCQA 1UHUA 2GH1A 4RNMA 4C8OA 3H39A 5KFSA 3MBYA 5D62A 5EE1A 4FH3A 4WOYA 3JPOA 1KDHA 1JMSA 4WC7A 1QLNA 2DWQA 2NRXA 2UVWA 5HMMA 1BPDA 7ICPA 3H37A 4TUPA 1U48A 1QQ5A 4I2IA 4YQWA 3OGUA 4KLSA 4WC4A 5HRDA 3C5FA 1S10A 2A1JB 3DEEA 2H3QA 4I2HA 2BQUA 3FYHA 3H38A 2GAFD 4DOAA 5ALIA 2K60A 3WK4A 2FPMA 4DF4A 2MRLA 2HN2A 4QJFB 5KFBA 4CRXA 1VDVA 4K4GA 4FBUA 2JZBA 2PFNA 3GQCA 4QW8A 3OVSA 2D3DA 3OPXA 4DSFA 2IOHA 3Q8SB 4ED2A 4B9MA 8ICPA 2IHNA 2KN7A 5CR0A 1UCVA 4F8RA 5HNKA 2DKXA 1F5SA 5D4BA 1SL0A 3FAHA 1ZQFA 5BOMA 3PNCA 8ICMA 1XWLA 4E0DA 4NXUA 2F3NA 4B9UA 3BQ2A 1DGSA 3LDAA 4AT8A 2IHOA 1JI7A 2G5HB 2ALZA 2ZIXA 5KFCA 2W9CB 2B6GA 1URJA 2K4IA 4LEVA 1Z19A 2F44A 3WK5A 1WYGA 3QUBA 1YT3A 4Y2RA 4XQ8A 3RH4A 3KTQA 4TQSA 3HJ4A 3TFRA 4DS4A 2A1JA 1L7NA 4MEXA 3LVVA 4YXJA 1N5WA 4WC2A 3GU3A 3N97B 2KNJA 2ISOA 1UEVA 2IOFA 3SR6A 3B0XA 2YMQA 4M9LA 3N4MB 5FP0A 5AM1A 4IRDA 3V72A 1MSWD 3AMZA 2F2AB 1C20A 5J0UA 1Q8KA 3WKEA 1ZQNA 2EZYA 3OJSA 1N5XA 4FHWA 3GZFA 1SXDA 5AI6A 2XCAA 4WBZA 4EEBA 4X4NA 4KLOA 3SMVA 4J9LA 5KFFA 2BPGA 2BPCA 2MSNA 4KN7A 2F1HA 3PY8A 1B4FA 3ISCA 2M2UA 4OCZA 3KHHA 3M6ZA 1ZOLA 4ECUA 1NK7A 4E8FA 4AT9A 5ALXA 4E80A 2DFLA 1TFWA 1KEJA 4C4TA 4QZ9A 5AK6A 4UB4A 5IIIA 1C7YA 3HKZC 2P66A 3SYZA 1RPLA 1JAJA 4KX3A 7ICTA 5J8YA 4CCHA 5EE9A 3A0BU 3PR5B 5ALDA 4ELUA 3GILA 5J0QA 3L9DA 5EE0A 3M9OB 2PXIA 4EYHB 4X4VA 1B0XA 2ODGA 3D2QA 1L3TA 3GIIA 1ZQUA 4FFDA 5ALQA 1KW4A 3WKAA 2L5YA 4OJOA 4LZDA 1NK9A 1KTQA 4DQRA 4B6JA 2LYHA 4EEKA 2HHWA 2FMQA 2VIXA 4Y2XA 3L3FX 2C22A 2QLTA 2V4QA 1O03A 1Z4NA 3WK8A 2JEJA 4F5NA 1NK5A 5ALZA 5B66U 1KRPA 3TACB 2DUYA 4NKTA 2KK0A 3ZDAA 4M6WA 5HHHA 1SV0A 4DL7A 4RQ2A 4P4PA 1PUZA 4EBCA 1N2XA 4UAWA 3SI8A 1S0OA 4DSJA 2FI1A 3RR8A 4NJ8A 2YMMA 1SKRA 4MFAA 3BQ1A 2C2RA 3VC8A 1IV8A 4DL5A 1TAUA 7ICEA 3AQMA 8ICRA 5J2EA 3MFIA 3JZ0A 4PZNA 5CEHA 4AT7A 1IIPA 2Y0SC 4IQUA 4EX7A 4C80A 4WC1A 1U45A 1BPBA 4WC3A 4RWNA 8ICBA 4RQ0A 7ICIA 1CI4A 5AHXA 1COKA 1SWVA 4I2GA 4E7XA 1A76A 4G3IA 2OM6A 3MC1A 3PSTA 1WCLA 1QSYA 2Y1IA 3HT3A 1X66A 2RFFA 3C5GA 2NRVA 2YTUA 2D6FC 5DKWA 1NI3A 5IILA 2FCLA 9ICJA 3UXOA 1Z4OA 4DSIA 1WCNA 4YXMA 3T5LA 4P0PA 5HHIA 5AI9A 4IR1A 3C21A 3R9KA 5ALSA 4C0ZA 1LKYA 2FLLA 3WFRE 4F5PA 3F5EA 4WJ3B 3ERCC 1MA7A 2W9MA 4DLEA 1T8EA 3E0FA 2G07A 4QZIA 4Y2PA 3MGIA 1Z3EB 2OHFA 3SAFA 2KJ8A 4P2HA 1JXEA 4RQ6A 5KFHA 5CFSA 7ICVA 1P7DA 3BZKA 4ED1A 2JH7A 5IIOA 5KFQA 4K9AA 2JXJA 1DK3A 1NKCA 1CRXA 4IRCA 1WG8A 2FPKA 2DVIA 4JWMA 1WWVA 4UASA 4DL6A 3H8MA 4QZDA 4BJQA 3TADA 1ZETA 2LKYA 3H0LB 8ICOA 8ICVA 4ED8A 3V6JA 5CJ7A 2F8LA 4EENA 5HRBA 4JV2A 4ECQA 1NOMA 2Z7JA 1XSPA 1FFUA 4OO1J 3RRHA 2PBEA 2PKEA 5IIKA 5EOZA 4K96A 2M2WA 1X40A 3KKAC 3QNMA 1R8BA 2ZH8A 1ZRNA 5KFUA 4X4RA 4IC9A 2LM1A 5T14A 4ED0A 3H7IA 5CHGA 3RJFA 2JV3A 2BR0A 1N56A 5JRTA 1ZD5A 1PZNA 3T79A 2IA6A 7ICMA 1XO1A 2JR5A 5DB7A 2GO7A 4ZOHC 2MAXA 2ZIXB 1ZD2P 4ACOA 5D63A 1TKDA 4PHEA 2BCVA 2DQNB 3S6JA 1S0NA 1ZD3A 4RUCA 2XY5A 2Y0SF 4EELA 1NO5A 5DB8A 2IMWP 4JB3A 3OV7A 2QKQA 5J0YA 4ECYA 1SB3C 3ER9B 4EEYA 2FLNA 3QUCA 5DB9A 3RH6A 4X0BA 3RF9A 1NNLA 4F3OA 2LMRA 1L3SA 1QH9A 2KD1A 4AYBC 4I2CA 5TZVA 3MGVA 4QWDA 4G9BA 4JV0A 5HRFA 4KN4A 4FBTA 5HRGA 5CB1A 4K8VA 2OEHA 3E2EA 2QARA 2GWSA 5J0XA 8ICKA 4YN4A 3BQTA 4C8NA 4PHAA 3IDWA 7ICLA 5J2IA 1KFDA 4YD1A 4PGXA 2WF6A 5DLFA 4YFKA 3ZDCA 5DGAA 4RQ5A 2C28A 3EF2A 2ZIVA 3PW4A 3AQEA 4QZHA 3PSFA 1Z1BA 4PL2A 3OJUA 1TK5A 3BS5B 4FHVA 4N7RA 1IG6A 5HR9A 8ICJA 4I2FA 1S76D 5AKIA 2ZH7A 1ZJMA 3NVYA 3T5JA 1S8OA 2RHFA 4O69A 4FO1A 2KJ9A 1IM4A 2JHDA 1Z00A 1YZ7A 3RRGA 2YQEA 1ZQJA 4ED7A 4EP7A 3OWGA 4J03A 7ICJA 4R66A 2HBMA 9ICLA 1KN5A 2LPEA 2D8CA 5AI4A 2E8NA 1M6YA 3DDHA 3RB4A 1R8AA 3SD7A 1MIWA 4U7CA 1MIYA 1L3VA 4YP3A 2B4VA 5CFTA 2BBHA 4YR3A 2HN1A 4A8EA 3PX0A 1NK4A 3QZ8A 4M9GA 4KLGA 2VA8A 1ZQXA 4EZ6A 2JEFA 4OJ5A 2KE7A 1V97A 4WC6A 3PO4A 1ZQTA 1QCKA 1MQ3A 4WQLA 3N7SC 3CK6A 2ZTCA 3SV3A 4P0QB 1TFYA 3J81j 1K1SA 1TFRA 4US8A 4I27A 3AU2A 9ICHA 4YVZA 3ISDA 1NK8A 5J0SA 4KLTA 5AI0A 2KTQA 4HX0A 5KFVA 4F93B 3LWLA 1UT8A 2W04A 3PR4A 4Q44A 1CEZA 4O6AA 8ICZA 4XQ7A 4DO9A 2HBKA 1OUQA 4TQRA 1T3QA 2KFNA 5G5HA 5ALLA 1J2NA 1EXNA 4ICAA 4ED6A 4RQ7A 1FO4A 2PFOA 1X2IA 3ZDBA 3AQFA 2EWRA 2NYVA 2ES6A 1FIQA 3ONNA 3OHAA 5F9NA 1SL1A 1PK1B 2BHNA 5ALUA 3D2NA 5IIJA 5DBAA 3B0YA 2ZXIA 4ECTA 4ECZA 2V4RA 1H38A 2WF5A 5AKZA 4JV1A 1D9DA 4O3OA 5KFMA 3MDAA 4FZLA 5KFPA 3CNHA 5J0TA 4Z6CA 4F4XA 4QW9A 4F72A 2DPJA 2R8IA 1T94A 4DFMA 4F2RA 2KJ5A 4PGYA 3ORYA 2H5XA 2BQ3A 4DL4A 2NO5A 3QU2A 4BGDA 2ZHBA 4M5DA 4NXZA 3NS1A 3SEIA 4I2BA 1BPEA 1RG6A 2N1RA 5KFWA 3QU7A 5IIMA 5KAFU 3PX6A 1TVAA 1NJXA 2HDOA 5KFAA 1RYSA 3PV8A 9ICOA 2H3IA 5KFEA 5AKKA 4KLLA 3UXNA 8ICWA 3ZDDA 4DWIA 4I0UA 4GXKA 2C2DA 3GIJA 1O08A 4O5EA 4FS1A 4PL1A 1S5LU 2KG5A 2BCSA 4ECXA 1WWUA 1JN3A 5EWEA 4IQTA 2WAQF 2BDPA 1FFVA 4P4OA 3SZ2A 5AI5A 4O3MA 4ZH4A 4PZOA 3RJGA 4DFJA 5KFKA 3IHQB 3RJIA 2VJ4A 3QXGA 4GLXA 1VFGA 5J2HA 1RXVA 8ICXA 2EQYA 4DQSA 4CF3A 4UAUA 1L7OA 4RUAA 4DLGA 5DEDA 4YR2A 2VJ5A 3QUQA 2BZFA 5AM5A 4C7ZA 4QZFA 3RR7A 2AGQA 8ICYA 4F2SA 3PMNA 4OAFA 5KFOA 1JXLA 2FPLA 4AYBF 3MR2A 4DOCA 4DFPA 2KZ3A 4X4TA 5J0WA 9ICXA 3WFSC 4AT8B 1A0PA 5KL1B 1UA1A 1NK6A 8ICFA 3UQ2A 4YR0A 2FMSA 1XSNA 1V9PA 4NLZA 2R18A 8ICUA 5D46A 4FHYA 4I29A 3O0FA 2A3VA 3GV8B 4F5OA 3D6JA 1OU5A 2IBKA 5KG4A 4RT2A 3N7PD 4PJ0U 2EAMA 3EUB2 3UXPA 3ER8C 5F3XB 3GIKA 4C8KA 4UW9A 1J2MA 1SV0C 4IQVA 5ALVA 3C28A 4LEYA 4MEYA 5ALPA 3WK7A 2XY6A 5DLGA 3G6VA 4UB1A 5CHEA 3D2SA 2LI6A 4Y2YA 1SXEA 4DSEA 2K89A 2E8PA 4WCWA 2HW3A 2BCRA 1SIJA 4NM1A 3PHZA 1RYUA 5ALMA 3QX7A 3QZ7A 1JQRA 1Q46A 4ELTA 1WOTA 4NLGA 9ICBA 5KFZA 3OUYA 5J2CA 3RH5A 3EPIA 1Q3UA 3WK9A 1N62A 4X4PA 5L9XA 3KD3A 1OW5A 2W11A 3WKBA 3TAPA 4LVSA 4UBCA 2KEYA 5HR6A 2YMLA 1RM6C 5B3PA 4Q43A 5KT6A 4ED3A 3PO5A 4RWQA 1AQ6A 4LJXA 5AIAA 1LV5A 2MUTA 4UD4A 9ICAA 1X6JA 3C1ZA 5AKJA 5AK3A 5AK5A 1OXJA 4DQQA 4EBEA 5AM2A 1KL9A 3TARA 4UQGA 7ICGA 4YD2A 3TQ1A 4YCXA 3ZDEA 4NLKA 5KFIA 1TK0A 3HJ1A 7ICHA 4WH5A 1XU4A 2E8MA 4R8UA 1BPZA 3Q8KA 2KIVA 4O3SA 2G08A 4F4WA 1L5UA 5KG1A 3PW0A 3RJKA 4S3NA 2R8GA 5J2FA 2VA2A 2HHSA 4LEWA 3RTVA 2HSZA 4CNQA 3RJHA 2KOBA 9ICTA 4CE6A 3IP4B 1ZJNA 2PFPA 5K4LA 1YLQA 5C0YA 3RB0A 2EZZA 2DKZA 2O5AA 1KNYA 4J9PA 2BQRA 3RJEA 3CP8A 4Y2JA 4TUQA 3PW7A 3SQIA 5CFUA 5C5JA 2G0AA 3WKDA 3NVWA 1QQ6A 1BPXA 4OJPA 4PHDA 2HVIA 3AQNA
chains in the Genus database with same CATH topology
3GV5B 2W8KA 4I2CA 2BKEA 3KHGA 9ICCA 4KLQA 5TZVA 2HHXA 4O5CA 3Q8RB 4QWDA 9ICSA 3QEAZ 4I2DA 3KHRA 1ZQPA 4JV0A 3HWTA 5HRIA 5HRFA 4KN4A 4FBTA 2HHPA 3SV4A 4KMUA 1ZQMA 2ISPA 5HRGA 4RQ1A 4UB3A 4J9KA 4NM2A 1L3UA 8ICSA 3QEBZ 4HYKA 8ICAA 5CB1A 2HVHA 3AQLA 1QTMA 1U4BA 3PW2A 1BGXT 3E2EA 2JEIA 2GWSA 5J0XA 4GC7A 3ZD8A 4O9MA 2HHTA 2KZMA 5KFJA 8ICKA 4B9TA 4YN4A 5KT4A 1RXWA 9ICGA 3BQTA 4C8NA 4PHAA 3LQCB 3UPSA 1BVSA 1TK8A 2ZUBA 1U9LA 7ICLA 5J2IA 8ICTA 1KFDA 4YD1A 4PGXA 5DBBA 1VJ7A 2ZH4A 1ZQIA 5DLFA 4YFKA 5EWFA 1NK0A 4RU9A 5DGAA 1ZQKA 1N48A 3JPTA 4RQ5A 3ZDCA 2BCQA 4B9LA 4FHPA 2C28A 3PW4A 4QZHA 1TV9A 5KFLA 4JK1A 3IM1A 4UAZA 3OJUA 3PVXA 2ASDA 1TK5A 4EZ9A 1ZYQA 4RNMA 1ZQRA 4C8OA 3H39A 4FHVA 5L1KA 5KFSA 4QWAA 3MBYA 1BPYA 4X0AA 3OHBA 4FH3A 1NJYA 8ICLA 3JPOA 4X4OA 2DPIA 1KDHA 1JMSA 4GXIA 5HR9A 8ICJA 4I2FA 4WC7A 3Q8LA 1S76D 5IINA 5J2GA 4TUSA 3Q8QB 3C66A 5J2DA 4PH5A 1QLNA 2ZH7A 1ZJMA 2NRXA 5KT7A 5HMMA 3MR6A 2UVWA 1BPDA 3V7LA 4UB5A 3T5JA 4TUPA 1U48A 4Q8EA 7ICPA 4JWNA 3H37A 2NRZA 4I2IA 4YQWA 3OGUA 3M9NB 1IM4A 3EZ5A 1X9MA 1SL2A 1Z00A 4KLSA 3RRGA 3C5FA 5HRDA 4WC4A 1S10A 2W9CA 1ZQJA 4ED7A 3OVBA 2A1JB 3GIMA 4M9HA 2AQ0A 4YMNA 4I2HA 4EP7A 1SZPA 2W9BA 1UT5A 7ICJA 4X5VA 4R66A 2BQUA 3FYHA 5CWRA 4TURA 3H38A 4Z6EA 2HHQA 9ICLA 4AT7B 2AU0A 3NYBA 4R65A 5KG0A 4DOAA 4RNOA 4ECWA 9ICVA 3V6KA 4DS5A 3RB4A 5J2AA 2O1PA 1R8AA 2NRKA 2FPMA 4QZGA 5D49A 4DF4A 4KLMA 1MIWA 3ZD9A 5KT5A 1MIYA 1L3VA 1UETA 5KFBA 4YP3A 1Q79A 1U47A 3HPOA 3MR3A 1Z00B 4J9MA 4M9NA 4YR3A 1LB2B 4K4GA 4FBUA 2JZBA 4DL3A 2PFNA 3GQCA 3PX0A 1NK4A 1X9SA 4QW8A 3QZ8A 1ZQSA 1ZQQA 1B43A 1S0VA 3OVSA 2RDIA 4DSFA 4R64A 2VA8A 3Q8SB 4ED2A 4B9MA 4M9GA 4KLGA 2R8KA 4KLJA 1ZQXA 1D9FA 5KFTA 5J0RA 3HW8A 2IHNA 4EZ6A 3OSNA 4J9NA 2JEFA 2KN7A 4NY8A 5DG9A 5CR0A 4IRKA 3MABA 3PMLA 4J9OA 5HNKA 3PO4A 4F8RA 4WC6A 4M04A 5D4BA 2W9AA 1SKSA 4EBDA 1ZQTA 4J9SA 2R8JA 1SL0A 1KLNA 1ZQFA 4AT9B 2DRAA 1MQ3A 4K4IA 2B21A 5BOMA 3PNCA 4KLDA 8ICMA 1PX5A 4DQIA 3RAXA 2ZH1A 1XWLA 2ZTCA 3SV3A 4E0DA 4EBKA 1HUZA 1TFYA 5L1IA 4B9UA 1K1SA 9ICFA 3BQ2A 1DGSA 3RBDA 4P4MA 3LDAA 1S77D 1TFRA 4F5RA 4AT8A 1D8LA 4I27A 4J9QA 3AU2A 9ICHA 2ASLA 1XC9A 4YVZA 4I2EA 5DQHA 3Q8MA 3ISDA 2ALZA 1NK8A 9ICWA 4JUZA 5J0SA 4RPYA 4KLTA 2KTQA 9ICRA 8ICPA 3AQKA 5KFCA 5F2VO 5KFVA 2W9CB 1NJZA 2DR8A 4F93B 4XUSA 3LWLA 1R8CA 1UT8A 3PR4A 4UD5A 1JIHA 2ZH9A 4Q44A 1NKEA 5DQGA 4XQ8A 3EW9A 3RH4A 4DSKA 3KTQA 1CEZA 8ICZA 4TQSA 4XQ7A 3HJ4A 1ZQLA 3C2KA 4DO9A 3TFRA 4TQRA 4DS4A 2KFNA 2A1JA 2J6UA 1EXNA 4MEXA 3LWMA 4ED6A 3V6HA 3NTUA 4YXJA 4RQ7A 3GDXA 4F5QA 1X2IA 2PFOA 2PI4A 3ZDBA 4RWOA 4WC2A 4RPXA 1ZQDA 3OHAA 3N97B 5F9NA 1SL1A 2ISOA 4X4SA 3V7KA 1T7PA 4M9JA 1UEVA 1CUKA 4F92B 2BHNA 3PW5A 1TAQA 3T3FA 4BDPA 3B0XA 4M9LA 7ICRA 2ZHAA 4XRHA 5DBAA 3HX0A 5IIJA 4FS2A 3N4MB 3B0YA 2ZUDA 5DDMA 4ECTA 4YG2A 4ECZA 2V4RA 1JX4A 3V72A 4IRDA 1H38A 4KLIA 1MSWD 2DRBA 3WFOA 5J0UA 4M0AA 1ZQNA 3OJSA 4YMMA 4JV1A 1D9DA 3TFSA 4O3OA 5KFMA 3MDAA 4FHWA 4B9SA 4BXOA 4X4NA 2XCAA 4KITB 4WBZA 2P6UA 5KFPA 5J0PA 4J9LA 5J0TA 4Z6CA 3NGDA 4F4XA 5J2KA 4DL2A 5KFFA 4QW9A 3ETLA 2DPJA 2BPGA 2R8IA 2BPCA 2R8HA 4KN7A 2XC9A 4DFMA 4F2RA 4ATBA 3K75D 1COOA 3H8SA 2F1HA 4PGYA 4UBBA 3QE9Y 3PY8A 3C18A 3ORYA 2H5XA 5F9LA 4B9VA 3C2LA 2BQ3A 3ISCA 2VA3A 8ICGA 7ICKA 3OUYB 4DL4A 2M2UA 3KHHA 4BGDA 4I2JA 4MFCA 2ZHBA 4M5DA 4NXZA 4I2BA 1ZQZA 4ECUA 1BPEA 4QZEA 1NK7A 4BXOB 5KG5A 5KFWA 4E8FA 1NJWA 4KTQA 4AT9A 2HHVA 5IIMA 4E80A 4QZ8A 8ICEA 2DFLA 3PX6A 1TVAA 1NJXA 4FHXA 1NKBA 4ECRA 4WBYA 1TFWA 5KFAA 5BPCA 1AROP 2XGQA 1RYSA 1KEJA 4I28A 3PV8A 9ICOA 4QZ9A 1DK2A 3JYYA 5KFEA 4UB4A 4DF8A 5IIIA 1C7YA 2UVVA 4KLLA 4O3QA 3UXNA 8ICWA 1X9WA 2P66A 2ZUCA 4Z6FA 5KFRA 2Y1JA 3T5HA 5DG7A 4GXKA 4GC6A 3SYZA 1ZQHA 2C2DA 1RPLA 3H8JA 3GIJA 2UVRA 1JAJA 5J2JA 4O5EA 4Z6DA 5HRLA 3UQ0A 4FS1A 4DQPA 3BQ0A 7ICTA 2DR7A 8ICQA 2BCSA 1NZPA 4CCHA 4ECXA 3K4GA 2FMPA 5HC9A 4RQ3A 4KLEA 3Q8PB 1JN3A 5KFDA 5EWEA 2I1QA 2Q0ZX 3PR5B 4ELUA 2ZTEA 3GILA 4IQTA 5J0QA 8ICNA 2BDPA 1MC8A 3L9DA 3M9OB 4P4OA 2PXIA 1T4GA 4EYHB 3SZ2A 3BJYA 9ICNA 5HP4A 4X4VA 5KFNA 4ZH4A 2BCUA 9ICUA 1L3TA 3GIIA 9ICPA 4M47A 1ZQUA 1RZTA 3RJGA 1B22A 2ZH2A 2KZZA 2UVUA 2NRWA 4DFJA 2XO7A 5KFKA 3IHQB 1FA0A 4LZDA 4IR9A 5KFXA 1NK9A 3RJIA 4GLXA 1VFGA 2J6TA 5J2HA 1RXVA 7ICFA 8ICXA 1KTQA 5DB6A 5CA7A 4DQRA 3H8WA 4DQSA 2P6RA 1V4AA 4ELVA 2LYHA 2HHWA 2FMQA 4O5KA 4KLHA 4RUAA 4DLGA 4FO6A 5DEDA 8ICIA 4I2AA 2C22A 4YR2A 2V4QA 4R8UB 3EWAA 4RT3A 4QZFA 4MF8A 2JEJA 4F5NA 1NK5A 8ICCA 4BWJA 3RR7A 1KRPA 5DG8A 2AGQA 3H4BA 1ZQAA 8ICYA 4NKTA 5J2BA 3ZDAA 4M6WA 4Q8FA 5KTQA 1ZQBA 4F2SA 5HHHA 4RZRA 4DL7A 4RQ2A 4P4PA 3PMNA 2AGOA 3OVAA 5KFOA 5J0OA 4EBCA 1JXLA 2FPLA 1K1QA 3RBEA 3MR2A 4DOCA 3WFPA 4DFPA 4M6WB 2KZ3A 4UAWA 4X4TA 3ISBA 3SI8A 1ZQWA 1S0OA 3MDCA 5J0WA 4DSJA 9ICXA 1KSPA 4IG8A 3RR8A 2KFZA 3PX4A 3WFSC 4AT8B 1SKRA 1UA1A 1NK6A 8ICFA 9ICEA 4MFAA 3BQ1A 3UQ2A 4YR0A 2FMSA 1XSNA 1V9PA 2C2RA 4NLZA 8ICUA 1TAUA 4DL5A 7ICEA 1RYRA 5D46A 5L1LA 8ICRA 9ICMA 5J2EA 3MFIA 4I29A 3AQMA 3JZ0A 4FHYA 4R63A 1S0MA 4RQ8A 3GV8B 4AT7A 2MUTB 4F5OA 4NLNA 1ZQVA 2AQ4A 3HIYA 3FDSA 4IQUA 2BGWA 4Q45A 7ICNA 3EYZA 1U45A 1OU5A 1BPBA 5KG4A 2IBKA 4RT2A 4UB2A 2ASJA 1R89A 4WC3A 8ICBA 2XCPA 4RWNA 4RQ0A 7ICIA 4NKUA 4I2GA 4E7XA 2JEGA 1A76A 4QWBA 3JPNA 2ATLA 1IXRA 4QZCA 3UXPA 4QWEA 1S97A 1QSLA 4G3IA 2ZH6A 4WC0A 1WCLA 2Q66A 1QSYA 3AU6A 3GIKA 3HT3A 2Y1IA 4C8KA 2RFFA 1KFSA 3MR5A 3C5GA 1T3NA 3H3AA 2NRVA 4O3RA 5DKWA 5IILA 4IQVA 4WC1A 2KP7A 5KT3A 3MFHA 4ECSA 2ZTDA 7ICQA 4MEYA 2JZBB 4YMOA 3UXOA 4PGQA 5DLGA 3G6VA 2XY6A 4DSIA 9ICJA 3GFKB 3UPQA 5HRKA 1WCNA 4UB1A 2F1IA 2VANA 3EPGA 4C8LA 4YXMA 3T5LA 5CP2A 1ZQYA 5HHIA 4DSEA 1ZQGA 4IR1A 2XGPA 3C21A 1U49A 4X4UA 2M2TA 4WCWA 4EBJA 5DQIA 4QWCA 3M8RA 5KG7A 1HUOA 2FLLA 2HW3A 8ICHA 7ICSA 3WFRE 4F5PA 2PI5A 2C2EA 4F4YA 1ZQCA 2BCRA 4DEZA 4NM1A 1F5AA 3OSPA 4F4KA 2OWOA 4X4QA 1UEUA 3M8SA 3ZDDA 3C1YA 5DGBA 3TAQA 3QZ7A 1JQRA 3THVA 2W9MA 3G6YA 4DLEA 4ELTA 1WOTA 1T8EA 4NLGA 9ICBA 4QZIA 4FH5A 5KFZA 1MQ2A 3MGIA 3OUYA 1HJPA 1Z3EB 5J2CA 3RH5A 3EPIA 2HHUA 4X4PA 2V9WA 5L9XA 4QZBA 3C23A 2PFQA 1JXEA 3H40A 4QZAA 4P2HA 7ICUA 3JPQA 4RQ6A 2BE3A 5DBCA 2AGPA 5KFHA 3TAPA 4M2YA 4LVSA 4O3PA 1XSLA 4UBCA 2W9BB 7ICVA 4BWMA 4LZGA 1DOQA 4ED1A 4Q43A 4B9NA 4EYIB 9ICIA 4IQWA 5IIOA 5KT6A 4ED3A 3PO5A 5KFQA 3RAQA 5HRHA 4RWQA 1NKCA 4RNNA 4RQ4A 9ICQA 1DK3A 4LT6A 1LV5A 4IRCA 2MUTA 4UD4A 9ICAA 4F50A 2FPKA 4RWPA 2DVIA 3C1ZA 3TANA 4KLOA 4JWMA 3MGHA 1QSSA 3LK9A 4QZDA 4DL6A 5J29A 4DQQA 2DR9A 1ZETA 1UA0A 3RJJA 8ICOA 4J9RA 4ED8A 8ICVA 5KG3A 4EBEA 3V6JA 5CJ7A 5JUMA 2M2VA 5HRBA 1BNPA 5HREA 4JV2A 4ECQA 1NOMA 3TARA 1XSPA 5KFGA 2BPFA 2ZJ8A 2FLPA 3AUOA 5EWGA 1XS9D 2ID1A 7ICOA 4UQGA 1SKWA 2IHMA 7ICGA 1BNOA 4YD2A 3RRHA 3TQ1A 4YCXA 4ECVA 2NRTA 3RB3A 2PBEA 5IIKA 3ZDEA 5EOZA 2DR5A 2M2WA 4DWIA 2J6SA 1R8BA 4NLKA 5KFIA 1TK0A 1Q78A 3HJ1A 2ZH8A 5KFUA 3G6XA 7ICHA 4X4RA 3T5KA 1XU4A 5KFYA 9ICKA 4R8UA 3V7JA 3Q8KA 1BPZA 5KT2A 4O3SA 4F4WA 3BDPA 4MF2A 1L5UA 2F1JA 5KG1A 4ED0A 3H7IA 2I9GA 4ATBB 5CHGA 3M9MB 1S9FA 2XY7A 3RJFA 3PW0A 2BR0A 1N56A 4DFKA 3RJKA 5HMLA 4S3NA 4PHPA 1PZNA 3KHLA 5J2FA 2R8GA 1MIVA 2VA2A 2IA6A 4KLFA 7ICMA 2HHSA 4UAYA 2ZJAA 1XO1A 3RTVA 5DB7A 3C2MA 1ZQEA 2MAXA 3RB6A 4XA5A 3RJHA 1ZQOA 9ICTA 5BOLA 1TKDA 2WTFA 4PHEA 2ZJ5A 2BCVA 1ZJNA 1S0NA 2PFPA 3TI0A 4RUCA 2ZH3A 4GXJA 2XY5A 5L1JA 4WC5A 2M9NA 2ZH5A 4F91B 1YLQA 5DECA 5KG6A 3JPSA 3RB0A 4K4HA 2AJQA 1NO5A 5DB8A 3H4DA 4J9PA 2IMWP 1KNYA 2O5AA 2BQRA 1Y88A 3OV7A 3RJEA 4C8MA 5J0YA 4ECYA 1D8YA 4MFFA 4DSLA 4RPZA 4O0IA 4EEYA 2W8LA 1KFTA 4KLUA 3WFQE 4TUQA 4DOBA 3JPPA 2FLNA 5DB9A 2RDJA 3PW7A 3RH6A 4X0BA 4F4ZA 4F3OA 5C5JA 3HP6A 1A77A 1L3SA 4O3NA 1BPXA 3JPRA 5DDYA 4PHDA 4PPXA 2HVIA 5KG2A 3GV7B 3AQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV5 B;  2W8K A;  4I2C A;  2BKE A;  3KHG A;  9ICC A;  4KLQ A;  5TZV A;  2HHX A;  4O5C A;  3Q8R B;  4QWD A;  9ICS A;  3QEA Z;  4I2D A;  3KHR A;  1ZQP A;  4JV0 A;  3HWT A;  5HRI A;  5HRF A;  4KN4 A;  4FBT A;  2HHP A;  3SV4 A;  4KMU A;  1ZQM A;  2ISP A;  5HRG A;  4RQ1 A;  4UB3 A;  4J9K A;  4NM2 A;  1L3U A;  8ICS A;  3QEB Z;  4HYK A;  8ICA A;  5CB1 A;  2HVH A;  3AQL A;  1QTM A;  1U4B A;  3PW2 A;  1BGX T;  3E2E A;  2JEI A;  2GWS A;  5J0X A;  4GC7 A;  3ZD8 A;  4O9M A;  2HHT A;  2KZM A;  5KFJ A;  8ICK A;  4B9T A;  4YN4 A;  5KT4 A;  1RXW A;  9ICG A;  3BQT A;  4C8N A;  4PHA A;  3LQC B;  3UPS A;  1BVS A;  1TK8 A;  2ZUB A;  1U9L A;  7ICL A;  5J2I A;  8ICT A;  1KFD A;  4YD1 A;  4PGX A;  5DBB A;  1VJ7 A;  2ZH4 A;  1ZQI A;  5DLF A;  4YFK A;  5EWF A;  1NK0 A;  4RU9 A;  5DGA A;  1ZQK A;  1N48 A;  3JPT A;  4RQ5 A;  3ZDC A;  2BCQ A;  4B9L A;  4FHP A;  2C28 A;  3PW4 A;  4QZH A;  1TV9 A;  5KFL A;  4JK1 A;  3IM1 A;  4UAZ A;  3OJU A;  3PVX A;  2ASD A;  1TK5 A;  4EZ9 A;  1ZYQ A;  4RNM A;  1ZQR A;  4C8O A;  3H39 A;  4FHV A;  5L1K A;  5KFS A;  4QWA A;  3MBY A;  1BPY A;  4X0A A;  3OHB A;  4FH3 A;  1NJY A;  8ICL A;  3JPO A;  4X4O A;  2DPI A;  1KDH A;  1JMS A;  4GXI A;  5HR9 A;  8ICJ A;  4I2F A;  4WC7 A;  3Q8L A;  1S76 D;  5IIN A;  5J2G A;  4TUS A;  3Q8Q B;  3C66 A;  5J2D A;  4PH5 A;  1QLN A;  2ZH7 A;  1ZJM A;  2NRX A;  5KT7 A;  5HMM A;  3MR6 A;  2UVW A;  1BPD A;  3V7L A;  4UB5 A;  3T5J A;  4TUP A;  1U48 A;  4Q8E A;  7ICP A;  4JWN A;  3H37 A;  2NRZ A;  4I2I A;  4YQW A;  3OGU A;  3M9N B;  1IM4 A;  3EZ5 A;  1X9M A;  1SL2 A;  1Z00 A;  4KLS A;  3RRG A;  3C5F A;  5HRD A;  4WC4 A;  1S10 A;  2W9C A;  1ZQJ A;  4ED7 A;  3OVB A;  2A1J B;  3GIM A;  4M9H A;  2AQ0 A;  4YMN A;  4I2H A;  4EP7 A;  1SZP A;  2W9B A;  1UT5 A;  7ICJ A;  4X5V A;  4R66 A;  2BQU A;  3FYH A;  5CWR A;  4TUR A;  3H38 A;  4Z6E A;  2HHQ A;  9ICL A;  4AT7 B;  2AU0 A;  3NYB A;  4R65 A;  5KG0 A;  4DOA A;  4RNO A;  4ECW A;  9ICV A;  3V6K A;  4DS5 A;  3RB4 A;  5J2A A;  2O1P A;  1R8A A;  2NRK A;  2FPM A;  4QZG A;  5D49 A;  4DF4 A;  4KLM A;  1MIW A;  3ZD9 A;  5KT5 A;  1MIY A;  1L3V A;  1UET A;  5KFB A;  4YP3 A;  1Q79 A;  1U47 A;  3HPO A;  3MR3 A;  1Z00 B;  4J9M A;  4M9N A;  4YR3 A;  1LB2 B;  4K4G A;  4FBU A;  2JZB A;  4DL3 A;  2PFN A;  3GQC A;  3PX0 A;  1NK4 A;  1X9S A;  4QW8 A;  3QZ8 A;  1ZQS A;  1ZQQ A;  1B43 A;  1S0V A;  3OVS A;  2RDI A;  4DSF A;  4R64 A;  2VA8 A;  3Q8S B;  4ED2 A;  4B9M A;  4M9G A;  4KLG A;  2R8K A;  4KLJ A;  1ZQX A;  1D9F A;  5KFT A;  5J0R A;  3HW8 A;  2IHN A;  4EZ6 A;  3OSN A;  4J9N A;  2JEF A;  2KN7 A;  4NY8 A;  5DG9 A;  5CR0 A;  4IRK A;  3MAB A;  3PML A;  4J9O A;  5HNK A;  3PO4 A;  4F8R A;  4WC6 A;  4M04 A;  5D4B A;  2W9A A;  1SKS A;  4EBD A;  1ZQT A;  4J9S A;  2R8J A;  1SL0 A;  1KLN A;  1ZQF A;  4AT9 B;  2DRA A;  1MQ3 A;  4K4I A;  2B21 A;  5BOM A;  3PNC A;  4KLD A;  8ICM A;  1PX5 A;  4DQI A;  3RAX A;  2ZH1 A;  1XWL A;  2ZTC A;  3SV3 A;  4E0D A;  4EBK A;  1HUZ A;  1TFY A;  5L1I A;  4B9U A;  1K1S A;  9ICF A;  3BQ2 A;  1DGS A;  3RBD A;  4P4M A;  3LDA A;  1S77 D;  1TFR A;  4F5R A;  4AT8 A;  1D8L A;  4I27 A;  4J9Q A;  3AU2 A;  9ICH A;  2ASL A;  1XC9 A;  4YVZ A;  4I2E A;  5DQH A;  3Q8M A;  3ISD A;  2ALZ A;  1NK8 A;  9ICW A;  4JUZ A;  5J0S A;  4RPY A;  4KLT A;  2KTQ A;  9ICR A;  8ICP A;  3AQK A;  5KFC A;  5F2V O;  5KFV A;  2W9C B;  1NJZ A;  2DR8 A;  4F93 B;  4XUS A;  3LWL A;  1R8C A;  1UT8 A;  3PR4 A;  4UD5 A;  1JIH A;  2ZH9 A;  4Q44 A;  1NKE A;  5DQG A;  4XQ8 A;  3EW9 A;  3RH4 A;  4DSK A;  3KTQ A;  1CEZ A;  8ICZ A;  4TQS A;  4XQ7 A;  3HJ4 A;  1ZQL A;  3C2K A;  4DO9 A;  3TFR A;  4TQR A;  4DS4 A;  2KFN A;  2A1J A;  2J6U A;  1EXN A;  4MEX A;  3LWM A;  4ED6 A;  3V6H A;  3NTU A;  4YXJ A;  4RQ7 A;  3GDX A;  4F5Q A;  1X2I A;  2PFO A;  2PI4 A;  3ZDB A;  4RWO A;  4WC2 A;  4RPX A;  1ZQD A;  3OHA A;  3N97 B;  5F9N A;  1SL1 A;  2ISO A;  4X4S A;  3V7K A;  1T7P A;  4M9J A;  1UEV A;  1CUK A;  4F92 B;  2BHN A;  3PW5 A;  1TAQ A;  3T3F A;  4BDP A;  3B0X A;  4M9L A;  7ICR A;  2ZHA A;  4XRH A;  5DBA A;  3HX0 A;  5IIJ A;  4FS2 A;  3N4M B;  3B0Y A;  2ZUD A;  5DDM A;  4ECT A;  4YG2 A;  4ECZ A;  2V4R A;  1JX4 A;  3V72 A;  4IRD A;  1H38 A;  4KLI A;  1MSW D;  2DRB A;  3WFO A;  5J0U A;  4M0A A;  1ZQN A;  3OJS A;  4YMM A;  4JV1 A;  1D9D A;  3TFS A;  4O3O A;  5KFM A;  3MDA A;  4FHW A;  4B9S A;  4BXO A;  4X4N A;  2XCA A;  4KIT B;  4WBZ A;  2P6U A;  5KFP A;  5J0P A;  4J9L A;  5J0T A;  4Z6C A;  3NGD A;  4F4X A;  5J2K A;  4DL2 A;  5KFF A;  4QW9 A;  3ETL A;  2DPJ A;  2BPG A;  2R8I A;  2BPC A;  2R8H A;  4KN7 A;  2XC9 A;  4DFM A;  4F2R A;  4ATB A;  3K75 D;  1COO A;  3H8S A;  2F1H A;  4PGY A;  4UBB A;  3QE9 Y;  3PY8 A;  3C18 A;  3ORY A;  2H5X A;  5F9L A;  4B9V A;  3C2L A;  2BQ3 A;  3ISC A;  2VA3 A;  8ICG A;  7ICK A;  3OUY B;  4DL4 A;  2M2U A;  3KHH A;  4BGD A;  4I2J A;  4MFC A;  2ZHB A;  4M5D A;  4NXZ A;  4I2B A;  1ZQZ A;  4ECU A;  1BPE A;  4QZE A;  1NK7 A;  4BXO B;  5KG5 A;  5KFW A;  4E8F A;  1NJW A;  4KTQ A;  4AT9 A;  2HHV A;  5IIM A;  4E80 A;  4QZ8 A;  8ICE A;  2DFL A;  3PX6 A;  1TVA A;  1NJX A;  4FHX A;  1NKB A;  4ECR A;  4WBY A;  1TFW A;  5KFA A;  5BPC A;  1ARO P;  2XGQ A;  1RYS A;  1KEJ A;  4I28 A;  3PV8 A;  9ICO A;  4QZ9 A;  1DK2 A;  3JYY A;  5KFE A;  4UB4 A;  4DF8 A;  5III A;  1C7Y A;  2UVV A;  4KLL A;  4O3Q A;  3UXN A;  8ICW A;  1X9W A;  2P66 A;  2ZUC A;  4Z6F A;  5KFR A;  2Y1J A;  3T5H A;  5DG7 A;  4GXK A;  4GC6 A;  3SYZ A;  1ZQH A;  2C2D A;  1RPL A;  3H8J A;  3GIJ A;  2UVR A;  1JAJ A;  5J2J A;  4O5E A;  4Z6D A;  5HRL A;  3UQ0 A;  4FS1 A;  4DQP A;  3BQ0 A;  7ICT A;  2DR7 A;  8ICQ A;  2BCS A;  1NZP A;  4CCH A;  4ECX A;  3K4G A;  2FMP A;  5HC9 A;  4RQ3 A;  4KLE A;  3Q8P B;  1JN3 A;  5KFD A;  5EWE A;  2I1Q A;  2Q0Z X;  3PR5 B;  4ELU A;  2ZTE A;  3GIL A;  4IQT A;  5J0Q A;  8ICN A;  2BDP A;  1MC8 A;  3L9D A;  3M9O B;  4P4O A;  2PXI A;  1T4G A;  4EYH B;  3SZ2 A;  3BJY A;  9ICN A;  5HP4 A;  4X4V A;  5KFN A;  4ZH4 A;  2BCU A;  9ICU A;  1L3T A;  3GII A;  9ICP A;  4M47 A;  1ZQU A;  1RZT A;  3RJG A;  1B22 A;  2ZH2 A;  2KZZ A;  2UVU A;  2NRW A;  4DFJ A;  2XO7 A;  5KFK A;  3IHQ B;  1FA0 A;  4LZD A;  4IR9 A;  5KFX A;  1NK9 A;  3RJI A;  4GLX A;  1VFG A;  2J6T A;  5J2H A;  1RXV A;  7ICF A;  8ICX A;  1KTQ A;  5DB6 A;  5CA7 A;  4DQR A;  3H8W A;  4DQS A;  2P6R A;  1V4A A;  4ELV A;  2LYH A;  2HHW A;  2FMQ A;  4O5K A;  4KLH A;  4RUA A;  4DLG A;  4FO6 A;  5DED A;  8ICI A;  4I2A A;  2C22 A;  4YR2 A;  2V4Q A;  4R8U B;  3EWA A;  4RT3 A;  4QZF A;  4MF8 A;  2JEJ A;  4F5N A;  1NK5 A;  8ICC A;  4BWJ A;  3RR7 A;  1KRP A;  5DG8 A;  2AGQ A;  3H4B A;  1ZQA A;  8ICY A;  4NKT A;  5J2B A;  3ZDA A;  4M6W A;  4Q8F A;  5KTQ A;  1ZQB A;  4F2S A;  5HHH A;  4RZR A;  4DL7 A;  4RQ2 A;  4P4P A;  3PMN A;  2AGO A;  3OVA A;  5KFO A;  5J0O A;  4EBC A;  1JXL A;  2FPL A;  1K1Q A;  3RBE A;  3MR2 A;  4DOC A;  3WFP A;  4DFP A;  4M6W B;  2KZ3 A;  4UAW A;  4X4T A;  3ISB A;  3SI8 A;  1ZQW A;  1S0O A;  3MDC A;  5J0W A;  4DSJ A;  9ICX A;  1KSP A;  4IG8 A;  3RR8 A;  2KFZ A;  3PX4 A;  3WFS C;  4AT8 B;  1SKR A;  1UA1 A;  1NK6 A;  8ICF A;  9ICE A;  4MFA A;  3BQ1 A;  3UQ2 A;  4YR0 A;  2FMS A;  1XSN A;  1V9P A;  2C2R A;  4NLZ A;  8ICU A;  1TAU A;  4DL5 A;  7ICE A;  1RYR A;  5D46 A;  5L1L A;  8ICR A;  9ICM A;  5J2E A;  3MFI A;  4I29 A;  3AQM A;  3JZ0 A;  4FHY A;  4R63 A;  1S0M A;  4RQ8 A;  3GV8 B;  4AT7 A;  2MUT B;  4F5O A;  4NLN A;  1ZQV A;  2AQ4 A;  3HIY A;  3FDS A;  4IQU A;  2BGW A;  4Q45 A;  7ICN A;  3EYZ A;  1U45 A;  1OU5 A;  1BPB A;  5KG4 A;  2IBK A;  4RT2 A;  4UB2 A;  2ASJ A;  1R89 A;  4WC3 A;  8ICB A;  2XCP A;  4RWN A;  4RQ0 A;  7ICI A;  4NKU A;  4I2G A;  4E7X A;  2JEG A;  1A76 A;  4QWB A;  3JPN A;  2ATL A;  1IXR A;  4QZC A;  3UXP A;  4QWE A;  1S97 A;  1QSL A;  4G3I A;  2ZH6 A;  4WC0 A;  1WCL A;  2Q66 A;  1QSY A;  3AU6 A;  3GIK A;  3HT3 A;  2Y1I A;  4C8K A;  2RFF A;  1KFS A;  3MR5 A;  3C5G A;  1T3N A;  3H3A A;  2NRV A;  4O3R A;  5DKW A;  5IIL A;  4IQV A;  4WC1 A;  2KP7 A;  5KT3 A;  3MFH A;  4ECS A;  2ZTD A;  7ICQ A;  4MEY A;  2JZB B;  4YMO A;  3UXO A;  4PGQ A;  5DLG A;  3G6V A;  2XY6 A;  4DSI A;  9ICJ A;  3GFK B;  3UPQ A;  5HRK A;  1WCN A;  4UB1 A;  2F1I A;  2VAN A;  3EPG A;  4C8L A;  4YXM A;  3T5L A;  5CP2 A;  1ZQY A;  5HHI A;  4DSE A;  1ZQG A;  4IR1 A;  2XGP A;  3C21 A;  1U49 A;  4X4U A;  2M2T A;  4WCW A;  4EBJ A;  5DQI A;  4QWC A;  3M8R A;  5KG7 A;  1HUO A;  2FLL A;  2HW3 A;  8ICH A;  7ICS A;  3WFR E;  4F5P A;  2PI5 A;  2C2E A;  4F4Y A;  1ZQC A;  2BCR A;  4DEZ A;  4NM1 A;  1F5A A;  3OSP A;  4F4K A;  2OWO A;  4X4Q A;  1UEU A;  3M8S A;  3ZDD A;  3C1Y A;  5DGB A;  3TAQ A;  3QZ7 A;  1JQR A;  3THV A;  2W9M A;  3G6Y A;  4DLE A;  4ELT A;  1WOT A;  1T8E A;  4NLG A;  9ICB A;  4QZI A;  4FH5 A;  5KFZ A;  1MQ2 A;  3MGI A;  3OUY A;  1HJP A;  1Z3E B;  5J2C A;  3RH5 A;  3EPI A;  2HHU A;  4X4P A;  2V9W A;  5L9X A;  4QZB A;  3C23 A;  2PFQ A;  1JXE A;  3H40 A;  4QZA A;  4P2H A;  7ICU A;  3JPQ A;  4RQ6 A;  2BE3 A;  5DBC A;  2AGP A;  5KFH A;  3TAP A;  4M2Y A;  4LVS A;  4O3P A;  1XSL A;  4UBC A;  2W9B B;  7ICV A;  4BWM A;  4LZG A;  1DOQ A;  4ED1 A;  4Q43 A;  4B9N A;  4EYI B;  9ICI A;  4IQW A;  5IIO A;  5KT6 A;  4ED3 A;  3PO5 A;  5KFQ A;  3RAQ A;  5HRH A;  4RWQ A;  1NKC A;  4RNN A;  4RQ4 A;  9ICQ A;  1DK3 A;  4LT6 A;  1LV5 A;  4IRC A;  2MUT A;  4UD4 A;  9ICA A;  4F50 A;  2FPK A;  4RWP A;  2DVI A;  3C1Z A;  3TAN A;  4KLO A;  4JWM A;  3MGH A;  1QSS A;  3LK9 A;  4QZD A;  4DL6 A;  5J29 A;  4DQQ A;  2DR9 A;  1ZET A;  1UA0 A;  3RJJ A;  8ICO A;  4J9R A;  4ED8 A;  8ICV A;  5KG3 A;  4EBE A;  3V6J A;  5CJ7 A;  5JUM A;  2M2V A;  5HRB A;  1BNP A;  5HRE A;  4JV2 A;  4ECQ A;  1NOM A;  3TAR A;  1XSP A;  5KFG A;  2BPF A;  2ZJ8 A;  2FLP A;  3AUO A;  5EWG A;  1XS9 D;  2ID1 A;  7ICO A;  4UQG A;  1SKW A;  2IHM A;  7ICG A;  1BNO A;  4YD2 A;  3RRH A;  3TQ1 A;  4YCX A;  4ECV A;  2NRT A;  3RB3 A;  2PBE A;  5IIK A;  3ZDE A;  5EOZ A;  2DR5 A;  2M2W A;  4DWI A;  2J6S A;  1R8B A;  4NLK A;  5KFI A;  1TK0 A;  1Q78 A;  3HJ1 A;  2ZH8 A;  5KFU A;  3G6X A;  7ICH A;  4X4R A;  3T5K A;  1XU4 A;  5KFY A;  9ICK A;  4R8U A;  3V7J A;  3Q8K A;  1BPZ A;  5KT2 A;  4O3S A;  4F4W A;  3BDP A;  4MF2 A;  1L5U A;  2F1J A;  5KG1 A;  4ED0 A;  3H7I A;  2I9G A;  4ATB B;  5CHG A;  3M9M B;  1S9F A;  2XY7 A;  3RJF A;  3PW0 A;  2BR0 A;  1N56 A;  4DFK A;  3RJK A;  5HML A;  4S3N A;  4PHP A;  1PZN A;  3KHL A;  5J2F A;  2R8G A;  1MIV A;  2VA2 A;  2IA6 A;  4KLF A;  7ICM A;  2HHS A;  4UAY A;  2ZJA A;  1XO1 A;  3RTV A;  5DB7 A;  3C2M A;  1ZQE A;  2MAX A;  3RB6 A;  4XA5 A;  3RJH A;  1ZQO A;  9ICT A;  5BOL A;  1TKD A;  2WTF A;  4PHE A;  2ZJ5 A;  2BCV A;  1ZJN A;  1S0N A;  2PFP A;  3TI0 A;  4RUC A;  2ZH3 A;  4GXJ A;  2XY5 A;  5L1J A;  4WC5 A;  2M9N A;  2ZH5 A;  4F91 B;  1YLQ A;  5DEC A;  5KG6 A;  3JPS A;  3RB0 A;  4K4H A;  2AJQ A;  1NO5 A;  5DB8 A;  3H4D A;  4J9P A;  2IMW P;  1KNY A;  2O5A A;  2BQR A;  1Y88 A;  3OV7 A;  3RJE A;  4C8M A;  5J0Y A;  4ECY A;  1D8Y A;  4MFF A;  4DSL A;  4RPZ A;  4O0I A;  4EEY A;  2W8L A;  1KFT A;  4KLU A;  3WFQ E;  4TUQ A;  4DOB A;  3JPP A;  2FLN A;  5DB9 A;  2RDJ A;  3PW7 A;  3RH6 A;  4X0B A;  4F4Z A;  4F3O A;  5C5J A;  3HP6 A;  1A77 A;  1L3S A;  4O3N A;  1BPX A;  3JPR A;  5DDY A;  4PHD A;  4PPX A;  2HVI A;  5KG2 A;  3GV7 B;  3AQN A; 
#chains in the Genus database with same CATH topology
 2W8K A;  3ZI4 A;  9ICC A;  4O5C A;  3RFA A;  3Q8R B;  2HCF A;  2YX8 A;  3QEA Z;  4I2D A;  3KHR A;  1ZQP A;  3HWT A;  5HRI A;  2W03 A;  3H0M B;  4UB3 A;  4J9K A;  2HVH A;  3QYP A;  1QTM A;  3PW2 A;  5H2F U;  4GC7 A;  2HHT A;  5KFJ A;  4B9T A;  1RXW A;  4K99 A;  1L7M A;  8ICT A;  2KIC A;  5EWF A;  4B9L A;  4FHP A;  1TV9 A;  1N61 A;  5KFL A;  3PVX A;  2CXY A;  1ZYQ A;  3F2C A;  4RQM A;  1ZQR A;  2GA9 D;  3OHB A;  8ICL A;  1JRO A;  4X4O A;  2DPI A;  4GXI A;  4TUS A;  4PH5 A;  2LHT A;  7ICQ A;  5KT7 A;  4WC5 A;  2H3Z A;  4Q8E A;  4UB5 A;  1GO3 F;  2NRZ A;  2LYA A;  3M9N B;  3EZ5 A;  1X9M A;  5AI8 A;  1VLB A;  3OVB A;  2OXO A;  4M9H A;  2AQ0 A;  4YMN A;  4EED A;  4X5V A;  5CWR A;  4TUR A;  3IRU A;  4JMU A;  2HHQ A;  2AU0 A;  3DV9 A;  1DGJ A;  5KG0 A;  4ECW A;  3V6K A;  3TKA A;  4DS5 A;  5G5G A;  2NRK A;  2FJ6 A;  4QZG A;  3ZD9 A;  1UET A;  3IG8 A;  2XIC A;  3IG5 A;  3HPO A;  3MR3 A;  4J9M A;  4M9N A;  3NVZ A;  1JRP A;  4R64 A;  4P0P B;  4BX9 C;  4KLJ A;  2R8K A;  5KFT A;  2HOQ A;  5J0R A;  3OSN A;  4NY8 A;  5DG9 A;  2AH5 A;  1L6N A;  3PML A;  1SKS A;  4UAR A;  2B56 A;  2W43 A;  2DRA A;  2G5I B;  4K4I A;  3NVO A;  1QQ7 A;  3ALR A;  4KLD A;  1PX5 A;  4DQI A;  3RAX A;  2RLT A;  3HKZ F;  2ZH1 A;  4EBK A;  3ICX A;  9ICF A;  1MN8 A;  2G06 A;  2DL0 A;  2OYY A;  1D8L A;  2ASL A;  1XC9 A;  3Q8M A;  4JUZ A;  5F2V O;  1NJZ A;  3UMB A;  3MCR A;  4O67 A;  4XUS A;  1R8C A;  2ZIV B;  4UD5 A;  1JIH A;  2KVC A;  2ZH9 A;  2KVS A;  1WUD A;  3EW9 A;  2Q4T A;  4DSK A;  4RQN A;  4QIW F;  2HOF A;  3F5A A;  1ZQL A;  3C2K A;  1VJ5 A;  3LVW A;  3GDX A;  4RPX A;  1KKX A;  4X4S A;  4F92 B;  4BDP A;  1TAQ A;  2OCE A;  4IS7 A;  1XO0 A;  1JX4 A;  2WFA A;  3I1Y A;  4YMM A;  3TFS A;  4UB6 U;  4B9S A;  5J0P A;  3NAS A;  3NGD A;  4DL2 A;  1PVR A;  2CN1 A;  3M1Y A;  2R8H A;  2XC9 A;  3K75 D;  1COO A;  3QE9 Y;  3N7R C;  4B9V A;  8ICG A;  2VA3 A;  3OUY B;  7ICK A;  1A6S A;  4BUG A;  1SWW A;  5AIB A;  4I2J A;  4QZE A;  2JMG A;  2HHV A;  8ICE A;  1NKB A;  4ECR A;  4I28 A;  1ARO P;  3QUT A;  1PVQ A;  3JYY A;  4DF8 A;  4NXT A;  4O3Q A;  1X9W A;  5KFR A;  5DG7 A;  2I6X A;  2Q66 A;  4Z6D A;  2IOF K;  4DQP A;  3BQ0 A;  4DCC A;  5HC9 A;  4RQ3 A;  3Q8P B;  2YN4 A;  2I1Q A;  2Q0Z X;  1T4G A;  5HP4 A;  2KSO A;  5KFN A;  2Y9U A;  2BCU A;  4NXX A;  9ICU A;  4M47 A;  1RZT A;  2KZZ A;  2NRW A;  4NL9 A;  3UMG A;  2YMP A;  4IR9 A;  3UM9 A;  2J6T A;  7ICF A;  5DB6 A;  2P6R A;  3SAH A;  1X9X A;  4ELV A;  2DBY A;  1F44 A;  4FO6 A;  5D61 A;  8ICI A;  3HRD D;  4KX5 A;  4R8U B;  5KL8 B;  4C4S A;  5DG8 A;  1UPH A;  3H4B A;  1ZQA A;  4RZR A;  3KZX A;  2EZX A;  2M0N A;  3WFP A;  4M6W B;  1KSP A;  2KFZ A;  3PX4 A;  2E1F A;  3WU2 U;  9ICE A;  1L8O A;  1RYR A;  5L1L A;  9ICM A;  3BZC A;  4R63 A;  1S0M A;  2P35 A;  2MUT B;  1K5O A;  3NUQ A;  2AQ4 A;  3HIY A;  3FDS A;  2BGW A;  7ICN A;  2GOL A;  1SV4 A;  4NKU A;  2JEG A;  1QSL A;  1KBU A;  4QZC A;  1IXR A;  1N63 A;  2NO4 A;  4QWE A;  4QIW C;  3K7D A;  4NV0 A;  3MR5 A;  1T3N A;  4O3R A;  2E8O A;  4KMO B;  2W3R A;  2ZTD A;  1PVP A;  5GTH U;  2JZB B;  3UPQ A;  2VAN A;  2B0C A;  3TAD C;  3JCF A;  4X4U A;  3L4P A;  2KHV A;  4QWC A;  1ECW A;  7ICS A;  2Y9T A;  2C2E A;  4F4Y A;  1ZQC A;  3NVV A;  2B51 A;  3OSP A;  4F4K A;  2OWO A;  1UEU A;  2H3V A;  4CF4 A;  5DGB A;  3TAQ A;  3THV A;  1MQ2 A;  2HHU A;  2V9W A;  2OH2 A;  3C23 A;  2PFQ A;  4QZA A;  1LKY B;  2BE3 A;  2PMZ F;  3BS7 A;  4M2Y A;  1XSL A;  4LZG A;  4B9N A;  4EYI B;  9ICI A;  4IQW A;  3RAQ A;  2ZIU B;  9ICQ A;  4RWP A;  3TAN A;  2LM4 A;  2W7O A;  4NL9 C;  1PK1 A;  3LK9 A;  4OAI Z;  2DR9 A;  1UA0 A;  2FDR A;  3RJJ A;  1L8L A;  5JUM A;  2M2V A;  5HRE A;  2BPF A;  2FLP A;  2XID A;  3NYB A;  1XS9 D;  1SKW A;  1BNO A;  2IHM A;  5AM3 A;  2NRT A;  3RB3 A;  2J6S A;  1Q78 A;  4GIB A;  2YB1 A;  3T5K A;  5KFY A;  9ICK A;  1D8B A;  2ZIW B;  3F53 A;  2I9G A;  2F1J A;  4ATB B;  3FM9 A;  3FC4 A;  3QU4 A;  3M9M B;  4MKP A;  2JH1 A;  5CRX A;  2CRX A;  4DFK A;  4P0Q A;  4OD0 A;  3F2D A;  4UAY A;  3HIL A;  4EX6 A;  3AL0 B;  3AEV A;  4XA5 A;  1FEZ A;  2RQ5 A;  3AM9 A;  4NLB A;  3A0H U;  2ZH3 A;  5L1J A;  2M9N A;  4F91 B;  2AJQ A;  3JPS A;  1KQQ A;  1Y88 A;  3WK6 A;  1SGG A;  4DSL A;  2W8L A;  3JPP A;  2RDJ A;  5AM4 A;  4F4Z A;  3HP6 A;  1A77 A;  4O3N A;  3JPR A;  3M7D A;  2ESE A;  4PPX A;  5KG2 A;  3KHG A;  4KLQ A;  2HHX A;  9ICS A;  2WF8 A;  4IG8 A;  4NXW A;  3HJE A;  3SV4 A;  4RQ1 A;  1L3U A;  8ICS A;  4HYK A;  8ICA A;  1U4B A;  1BGX T;  2BDU A;  4MHV A;  4O9M A;  2EAN A;  3LQC B;  1BVS A;  2W3S A;  2ZUB A;  1U9L A;  2DGZ A;  2H3F A;  2ZH4 A;  1ZQI A;  2KIW A;  1N48 A;  3JPT A;  3OTQ A;  4JK1 A;  3IM1 A;  4UAZ A;  4EZ9 A;  2ASD A;  3VCB A;  2RP5 A;  2XVT A;  1F0M A;  4QWA A;  5L1K A;  1BPY A;  4X0A A;  5AKY A;  1NJY A;  1PK3 A;  3Q8L A;  3C66 A;  5IIN A;  5J2G A;  3Q8Q B;  4OJL A;  5E79 U;  5J2D A;  1YZ6 A;  3MR6 A;  3V7L A;  4JWN A;  1SL2 A;  2EDU A;  2W9C A;  4C4R A;  2KKV A;  3GIM A;  1SZP A;  2W9B A;  1UT5 A;  5ALK A;  2K4H A;  4Z6E A;  4AT7 B;  4JLZ A;  1HIW A;  4OAH A;  4R65 A;  4LEZ A;  4RNO A;  4NWI A;  9ICV A;  5B5E U;  5J2A A;  2O1P A;  4KLM A;  5D49 A;  5KT5 A;  1NZB A;  1Q79 A;  1U47 A;  1Z00 B;  4UAT A;  1LB2 B;  3H0R B;  2WHE A;  2GLE A;  2HMX A;  3CW2 C;  4DL3 A;  3F2B A;  1X9S A;  1ZQS A;  1ZQQ A;  1B43 A;  1S0V A;  2RDI A;  2EAP A;  4EV6 A;  5ALF A;  1D9F A;  2WAQ C;  5ALH A;  3HW8 A;  4J9N A;  4IRK A;  3MAB A;  5ALG A;  4J9O A;  4K9B A;  1J97 A;  4M04 A;  2W9A A;  4EBD A;  1N60 A;  4J9S A;  4FE3 A;  1KLN A;  2R8J A;  4AT9 B;  3BS5 A;  2ZG6 A;  1RQN A;  2B21 A;  5ALT A;  5AKH A;  1TAM A;  5ALR A;  3I76 A;  3KKA A;  5AM0 A;  3WKC A;  5L1I A;  1HUZ A;  1Q3V A;  3KOO A;  2O6K A;  3RBD A;  4P4M A;  2QAR B;  1S77 D;  4F5R A;  4J9Q A;  3NKU A;  4I2E A;  2W54 A;  4GFJ A;  5DQH A;  9ICW A;  4RPY A;  9ICR A;  4KM5 A;  5ALY A;  1SZH A;  3AQK A;  2DR8 A;  1XNS A;  5ALW A;  1NKE A;  2PMZ C;  5DQG A;  2XI9 A;  1HEK A;  2J6U A;  3LWM A;  3V6H A;  3NTU A;  2DRB A;  4F5Q A;  2PI4 A;  4RWO A;  4Y2Q A;  1ZQD A;  1DRG A;  3V7K A;  1T7P A;  4M9J A;  1CUK A;  2ZHA A;  3PW5 A;  7ICR A;  3T3F A;  2AXT U;  4Y2T A;  4XRH A;  3HX0 A;  4FS2 A;  2ZUD A;  5DDM A;  4YG2 A;  4KLI A;  1RDF A;  3WFO A;  4M0A A;  1DXS A;  4Y2U A;  2KSO B;  1ZQ1 C;  4BXO A;  4KIT B;  2P6U A;  3PZP A;  5J2K A;  3ETL A;  5JU5 A;  4ATB A;  4EBJ A;  4UBB A;  3H8S A;  3C18 A;  3CRX A;  5F9L A;  3C2L A;  3IN5 A;  2ZIW A;  2WB1 C;  2HOI A;  4MFC A;  3E58 A;  2K8C B;  1ZQZ A;  4BXO B;  5KG5 A;  1L7P A;  1NJW A;  4KTQ A;  2E1E A;  4QZ8 A;  4FHX A;  4WBY A;  5BPC A;  2XGQ A;  3SEN A;  3QU5 A;  1DK2 A;  4US9 A;  2EAO A;  4USA A;  2YB4 A;  2UVV A;  2F76 X;  2HBJ A;  5ALE A;  2ZUC A;  4Z6F A;  1V38 A;  2Y1J A;  3T5H A;  1ZQH A;  4GC6 A;  3H8J A;  2UVR A;  2KV2 A;  4K97 A;  5JTI A;  5J2J A;  5HRL A;  3UQ0 A;  2DR7 A;  4OAG A;  3KBB A;  8ICQ A;  1NZP A;  3K4G A;  2FMP A;  2JRZ A;  4KLE A;  2MU2 A;  5KFD A;  2K4P A;  4QNL A;  2ZTE A;  8ICN A;  5AKE A;  1MC8 A;  9ICN A;  3BJY A;  1ZD4 A;  2VKQ A;  4CGZ A;  9ICP A;  2ZH2 A;  1B22 A;  5JTG A;  2UVU A;  2XO7 A;  3NRW A;  1JUD A;  4NXV A;  1FA0 A;  2LYB A;  5KFX A;  4UB8 U;  5CA7 A;  1V4A A;  3H8W A;  4CDG A;  4O5K A;  4KLH A;  4I2A A;  4NLC A;  5J8Y C;  3EWA A;  2K8B B;  5AKG A;  4RT3 A;  8ICC A;  4MF8 A;  2WB1 F;  5B3Q A;  4BWJ A;  3SAG A;  5J2B A;  4Q8F A;  1UQV A;  5KTQ A;  1ZQB A;  4Y2V A;  2AGO A;  3OVA A;  5J0O A;  5KAI U;  1K1Q A;  3RBE A;  1X42 A;  3ISB A;  1ZQW A;  3MDC A;  2HBL A;  2MA1 A;  4UAV A;  4Y2S A;  5ALO A;  3K1R B;  1ZXI A;  4RQ8 A;  2FE9 A;  4NLN A;  1ZQV A;  3LYS A;  2EH9 A;  4Q45 A;  3EYZ A;  1Z1V A;  1V85 A;  1R89 A;  4UB2 A;  2ASJ A;  2XCP A;  2WF9 A;  3C29 A;  4QWB A;  3JPN A;  2ATL A;  3L5K A;  1S97 A;  2HI0 A;  2ZH6 A;  2ZIU A;  4WC0 A;  3AU6 A;  3U26 A;  1KFS A;  3I28 A;  3H3A A;  2KP7 A;  5KT3 A;  3MFH A;  4ECS A;  5KNI A;  4YMO A;  4PGQ A;  5HRK A;  4XJE A;  3GFK B;  4F71 A;  2F1I A;  3EPG A;  4C8L A;  3IV6 A;  5CP2 A;  1ZQY A;  1ZQG A;  5ALJ A;  2XGP A;  1U49 A;  2QB1 A;  2M2T A;  5DQI A;  2G09 A;  3M8R A;  1HUO A;  5KG7 A;  8ICH A;  2PI5 A;  2K4E A;  2RRD A;  4DEZ A;  1F5A A;  1GPJ A;  4X4Q A;  2F8K A;  3M8S A;  3N28 A;  3C1Y A;  2KKP A;  3G6Y A;  5AKX A;  4FH5 A;  1HJP A;  4CF5 A;  2E3T A;  2YY6 A;  4K98 A;  4QZB A;  3H40 A;  7ICU A;  3JPQ A;  3K1Z A;  5DBC A;  2AGP A;  4O3P A;  2W9B B;  2DF4 B;  3QU9 A;  4BWM A;  1DOQ A;  5HRH A;  4KB6 A;  3NWI A;  4LT6 A;  4C7Y A;  4RQ4 A;  4RNN A;  2BBJ A;  2WF7 A;  1ZRM A;  4F50 A;  2W7P A;  3MGH A;  1QSS A;  3UMC A;  5J29 A;  2QB0 A;  3AN1 A;  5ALN A;  2F77 X;  2W55 A;  4J9R A;  5KG3 A;  1BNP A;  4O68 A;  4JLX A;  2A19 A;  3ED5 A;  5KFG A;  1LVH A;  2ZJ8 A;  3NRZ A;  3AUO A;  5EWG A;  2ID1 A;  7ICO A;  4ECV A;  5AIC A;  3BQ7 A;  2DR5 A;  4HAI A;  3G6X A;  3PSI A;  3V7J A;  2AHO B;  5KT2 A;  3CYM A;  2I5H A;  3BDP A;  4MF2 A;  4EGW A;  1TE2 A;  1S9F A;  2XY7 A;  5HR7 A;  2IUB A;  4FZM A;  3B9J A;  5HML A;  4PHP A;  2E5S A;  3KHL A;  1MIV A;  2KMD A;  4WQK A;  4KLF A;  2KHQ A;  1ED1 A;  2ZJA A;  3C2M A;  1ZQE A;  3RB6 A;  4IL6 U;  1ZQO A;  2A1A A;  5BOL A;  2WTF A;  2ZJ5 A;  3TI0 A;  5A0L A;  4GXJ A;  2ZH5 A;  5DEC A;  5KG6 A;  4K4H A;  3H4D A;  2QB0 B;  1JAL A;  2JGA A;  4C8M A;  4DFD A;  1D8Y A;  4MFF A;  4RPZ A;  4O0I A;  1KFT A;  3WFQ E;  4KLU A;  4DOB A;  5GTI U;  3PSP A;  4OJ6 A;  1X6I A;  5DDY A;  4FZN A;  3GV7 B;  3GV5 B;  2BKE A;  3M6K A;  4AP9 A;  2CPR A;  2LBO A;  2HHP A;  4KMU A;  2NV3 A;  1ZQM A;  2ISP A;  2K8A A;  5L1M A;  4NM2 A;  4U6P A;  5AKL A;  3QEB Z;  2ZXH A;  3AQL A;  5AK4 A;  3KZI U;  2JEI A;  1RQL A;  3ZD8 A;  2KZM A;  5KT4 A;  9ICG A;  3UPS A;  1TK8 A;  5TIS U;  3ETR A;  5DBB A;  1VJ7 A;  1ZQK A;  1NK0 A;  5EE3 A;  4RU9 A;  3KFU F;  2BCQ A;  1UHU A;  2GH1 A;  4RNM A;  4C8O A;  3H39 A;  5KFS A;  3MBY A;  5D62 A;  5EE1 A;  4FH3 A;  4WOY A;  3JPO A;  1KDH A;  1JMS A;  4WC7 A;  1QLN A;  2DWQ A;  2NRX A;  2UVW A;  5HMM A;  1BPD A;  7ICP A;  3H37 A;  4TUP A;  1U48 A;  1QQ5 A;  4I2I A;  4YQW A;  3OGU A;  4KLS A;  4WC4 A;  5HRD A;  3C5F A;  1S10 A;  2A1J B;  3DEE A;  2H3Q A;  4I2H A;  2BQU A;  3FYH A;  3H38 A;  2GAF D;  4DOA A;  5ALI A;  2K60 A;  3WK4 A;  2FPM A;  4DF4 A;  2MRL A;  2HN2 A;  4QJF B;  5KFB A;  4CRX A;  1VDV A;  4K4G A;  4FBU A;  2JZB A;  2PFN A;  3GQC A;  4QW8 A;  3OVS A;  2D3D A;  3OPX A;  4DSF A;  2IOH A;  3Q8S B;  4ED2 A;  4B9M A;  8ICP A;  2IHN A;  2KN7 A;  5CR0 A;  1UCV A;  4F8R A;  5HNK A;  2DKX A;  1F5S A;  5D4B A;  1SL0 A;  3FAH A;  1ZQF A;  5BOM A;  3PNC A;  8ICM A;  1XWL A;  4E0D A;  4NXU A;  2F3N A;  4B9U A;  3BQ2 A;  1DGS A;  3LDA A;  4AT8 A;  2IHO A;  1JI7 A;  2G5H B;  2ALZ A;  2ZIX A;  5KFC A;  2W9C B;  2B6G A;  1URJ A;  2K4I A;  4LEV A;  1Z19 A;  2F44 A;  3WK5 A;  1WYG A;  3QUB A;  1YT3 A;  4Y2R A;  4XQ8 A;  3RH4 A;  3KTQ A;  4TQS A;  3HJ4 A;  3TFR A;  4DS4 A;  2A1J A;  1L7N A;  4MEX A;  3LVV A;  4YXJ A;  1N5W A;  4WC2 A;  3GU3 A;  3N97 B;  2KNJ A;  2ISO A;  1UEV A;  2IOF A;  3SR6 A;  3B0X A;  2YMQ A;  4M9L A;  3N4M B;  5FP0 A;  5AM1 A;  4IRD A;  3V72 A;  1MSW D;  3AMZ A;  2F2A B;  1C20 A;  5J0U A;  1Q8K A;  3WKE A;  1ZQN A;  2EZY A;  3OJS A;  1N5X A;  4FHW A;  3GZF A;  1SXD A;  5AI6 A;  2XCA A;  4WBZ A;  4EEB A;  4X4N A;  4KLO A;  3SMV A;  4J9L A;  5KFF A;  2BPG A;  2BPC A;  2MSN A;  4KN7 A;  2F1H A;  3PY8 A;  1B4F A;  3ISC A;  2M2U A;  4OCZ A;  3KHH A;  3M6Z A;  1ZOL A;  4ECU A;  1NK7 A;  4E8F A;  4AT9 A;  5ALX A;  4E80 A;  2DFL A;  1TFW A;  1KEJ A;  4C4T A;  4QZ9 A;  5AK6 A;  4UB4 A;  5III A;  1C7Y A;  3HKZ C;  2P66 A;  3SYZ A;  1RPL A;  1JAJ A;  4KX3 A;  7ICT A;  5J8Y A;  4CCH A;  5EE9 A;  3A0B U;  3PR5 B;  5ALD A;  4ELU A;  3GIL A;  5J0Q A;  3L9D A;  5EE0 A;  3M9O B;  2PXI A;  4EYH B;  4X4V A;  1B0X A;  2ODG A;  3D2Q A;  1L3T A;  3GII A;  1ZQU A;  4FFD A;  5ALQ A;  1KW4 A;  3WKA A;  2L5Y A;  4OJO A;  4LZD A;  1NK9 A;  1KTQ A;  4DQR A;  4B6J A;  2LYH A;  4EEK A;  2HHW A;  2FMQ A;  2VIX A;  4Y2X A;  3L3F X;  2C22 A;  2QLT A;  2V4Q A;  1O03 A;  1Z4N A;  3WK8 A;  2JEJ A;  4F5N A;  1NK5 A;  5ALZ A;  5B66 U;  1KRP A;  3TAC B;  2DUY A;  4NKT A;  2KK0 A;  3ZDA A;  4M6W A;  5HHH A;  1SV0 A;  4DL7 A;  4RQ2 A;  4P4P A;  1PUZ A;  4EBC A;  1N2X A;  4UAW A;  3SI8 A;  1S0O A;  4DSJ A;  2FI1 A;  3RR8 A;  4NJ8 A;  2YMM A;  1SKR A;  4MFA A;  3BQ1 A;  2C2R A;  3VC8 A;  1IV8 A;  4DL5 A;  1TAU A;  7ICE A;  3AQM A;  8ICR A;  5J2E A;  3MFI A;  3JZ0 A;  4PZN A;  5CEH A;  4AT7 A;  1IIP A;  2Y0S C;  4IQU A;  4EX7 A;  4C80 A;  4WC1 A;  1U45 A;  1BPB A;  4WC3 A;  4RWN A;  8ICB A;  4RQ0 A;  7ICI A;  1CI4 A;  5AHX A;  1COK A;  1SWV A;  4I2G A;  4E7X A;  1A76 A;  4G3I A;  2OM6 A;  3MC1 A;  3PST A;  1WCL A;  1QSY A;  2Y1I A;  3HT3 A;  1X66 A;  2RFF A;  3C5G A;  2NRV A;  2YTU A;  2D6F C;  5DKW A;  1NI3 A;  5IIL A;  2FCL A;  9ICJ A;  3UXO A;  1Z4O A;  4DSI A;  1WCN A;  4YXM A;  3T5L A;  4P0P A;  5HHI A;  5AI9 A;  4IR1 A;  3C21 A;  3R9K A;  5ALS A;  4C0Z A;  1LKY A;  2FLL A;  3WFR E;  4F5P A;  3F5E A;  4WJ3 B;  3ERC C;  1MA7 A;  2W9M A;  4DLE A;  1T8E A;  3E0F A;  2G07 A;  4QZI A;  4Y2P A;  3MGI A;  1Z3E B;  2OHF A;  3SAF A;  2KJ8 A;  4P2H A;  1JXE A;  4RQ6 A;  5KFH A;  5CFS A;  7ICV A;  1P7D A;  3BZK A;  4ED1 A;  2JH7 A;  5IIO A;  5KFQ A;  4K9A A;  2JXJ A;  1DK3 A;  1NKC A;  1CRX A;  4IRC A;  1WG8 A;  2FPK A;  2DVI A;  4JWM A;  1WWV A;  4UAS A;  4DL6 A;  3H8M A;  4QZD A;  4BJQ A;  3TAD A;  1ZET A;  2LKY A;  3H0L B;  8ICO A;  8ICV A;  4ED8 A;  3V6J A;  5CJ7 A;  2F8L A;  4EEN A;  5HRB A;  4JV2 A;  4ECQ A;  1NOM A;  2Z7J A;  1XSP A;  1FFU A;  4OO1 J;  3RRH A;  2PBE A;  2PKE A;  5IIK A;  5EOZ A;  4K96 A;  2M2W A;  1X40 A;  3KKA C;  3QNM A;  1R8B A;  2ZH8 A;  1ZRN A;  5KFU A;  4X4R A;  4IC9 A;  2LM1 A;  5T14 A;  4ED0 A;  3H7I A;  5CHG A;  3RJF A;  2JV3 A;  2BR0 A;  1N56 A;  5JRT A;  1ZD5 A;  1PZN A;  3T79 A;  2IA6 A;  7ICM A;  1XO1 A;  2JR5 A;  5DB7 A;  2GO7 A;  4ZOH C;  2MAX A;  2ZIX B;  1ZD2 P;  4ACO A;  5D63 A;  1TKD A;  4PHE A;  2BCV A;  2DQN B;  3S6J A;  1S0N A;  1ZD3 A;  4RUC A;  2XY5 A;  2Y0S F;  4EEL A;  1NO5 A;  5DB8 A;  2IMW P;  4JB3 A;  3OV7 A;  2QKQ A;  5J0Y A;  4ECY A;  1SB3 C;  3ER9 B;  4EEY A;  2FLN A;  3QUC A;  5DB9 A;  3RH6 A;  4X0B A;  3RF9 A;  1NNL A;  4F3O A;  2LMR A;  1L3S A;  1QH9 A;  2KD1 A;  4AYB C;  4I2C A;  5TZV A;  3MGV A;  4QWD A;  4G9B A;  4JV0 A;  5HRF A;  4KN4 A;  4FBT A;  5HRG A;  5CB1 A;  4K8V A;  2OEH A;  3E2E A;  2QAR A;  2GWS A;  5J0X A;  8ICK A;  4YN4 A;  3BQT A;  4C8N A;  4PHA A;  3IDW A;  7ICL A;  5J2I A;  1KFD A;  4YD1 A;  4PGX A;  2WF6 A;  5DLF A;  4YFK A;  3ZDC A;  5DGA A;  4RQ5 A;  2C28 A;  3EF2 A;  2ZIV A;  3PW4 A;  3AQE A;  4QZH A;  3PSF A;  1Z1B A;  4PL2 A;  3OJU A;  1TK5 A;  3BS5 B;  4FHV A;  4N7R A;  1IG6 A;  5HR9 A;  8ICJ A;  4I2F A;  1S76 D;  5AKI A;  2ZH7 A;  1ZJM A;  3NVY A;  3T5J A;  1S8O A;  2RHF A;  4O69 A;  4FO1 A;  2KJ9 A;  1IM4 A;  2JHD A;  1Z00 A;  1YZ7 A;  3RRG A;  2YQE A;  1ZQJ A;  4ED7 A;  4EP7 A;  3OWG A;  4J03 A;  7ICJ A;  4R66 A;  2HBM A;  9ICL A;  1KN5 A;  2LPE A;  2D8C A;  5AI4 A;  2E8N A;  1M6Y A;  3DDH A;  3RB4 A;  1R8A A;  3SD7 A;  1MIW A;  4U7C A;  1MIY A;  1L3V A;  4YP3 A;  2B4V A;  5CFT A;  2BBH A;  4YR3 A;  2HN1 A;  4A8E A;  3PX0 A;  1NK4 A;  3QZ8 A;  4M9G A;  4KLG A;  2VA8 A;  1ZQX A;  4EZ6 A;  2JEF A;  4OJ5 A;  2KE7 A;  1V97 A;  4WC6 A;  3PO4 A;  1ZQT A;  1QCK A;  1MQ3 A;  4WQL A;  3N7S C;  3CK6 A;  2ZTC A;  3SV3 A;  4P0Q B;  1TFY A;  3J81 j;  1K1S A;  1TFR A;  4US8 A;  4I27 A;  3AU2 A;  9ICH A;  4YVZ A;  3ISD A;  1NK8 A;  5J0S A;  4KLT A;  5AI0 A;  2KTQ A;  4HX0 A;  5KFV A;  4F93 B;  3LWL A;  1UT8 A;  2W04 A;  3PR4 A;  4Q44 A;  1CEZ A;  4O6A A;  8ICZ A;  4XQ7 A;  4DO9 A;  2HBK A;  1OUQ A;  4TQR A;  1T3Q A;  2KFN A;  5G5H A;  5ALL A;  1J2N A;  1EXN A;  4ICA A;  4ED6 A;  4RQ7 A;  1FO4 A;  2PFO A;  1X2I A;  3ZDB A;  3AQF A;  2EWR A;  2NYV A;  2ES6 A;  1FIQ A;  3ONN A;  3OHA A;  5F9N A;  1SL1 A;  1PK1 B;  2BHN A;  5ALU A;  3D2N A;  5IIJ A;  5DBA A;  3B0Y A;  2ZXI A;  4ECT A;  4ECZ A;  2V4R A;  1H38 A;  2WF5 A;  5AKZ A;  4JV1 A;  1D9D A;  4O3O A;  5KFM A;  3MDA A;  4FZL A;  5KFP A;  3CNH A;  5J0T A;  4Z6C A;  4F4X A;  4QW9 A;  4F72 A;  2DPJ A;  2R8I A;  1T94 A;  4DFM A;  4F2R A;  2KJ5 A;  4PGY A;  3ORY A;  2H5X A;  2BQ3 A;  4DL4 A;  2NO5 A;  3QU2 A;  4BGD A;  2ZHB A;  4M5D A;  4NXZ A;  3NS1 A;  3SEI A;  4I2B A;  1BPE A;  1RG6 A;  2N1R A;  5KFW A;  3QU7 A;  5IIM A;  5KAF U;  3PX6 A;  1TVA A;  1NJX A;  2HDO A;  5KFA A;  1RYS A;  3PV8 A;  9ICO A;  2H3I A;  5KFE A;  5AKK A;  4KLL A;  3UXN A;  8ICW A;  3ZDD A;  4DWI A;  4I0U A;  4GXK A;  2C2D A;  3GIJ A;  1O08 A;  4O5E A;  4FS1 A;  4PL1 A;  1S5L U;  2KG5 A;  2BCS A;  4ECX A;  1WWU A;  1JN3 A;  5EWE A;  4IQT A;  2WAQ F;  2BDP A;  1FFV A;  4P4O A;  3SZ2 A;  5AI5 A;  4O3M A;  4ZH4 A;  4PZO A;  3RJG A;  4DFJ A;  5KFK A;  3IHQ B;  3RJI A;  2VJ4 A;  3QXG A;  4GLX A;  1VFG A;  5J2H A;  1RXV A;  8ICX A;  2EQY A;  4DQS A;  4CF3 A;  4UAU A;  1L7O A;  4RUA A;  4DLG A;  5DED A;  4YR2 A;  2VJ5 A;  3QUQ A;  2BZF A;  5AM5 A;  4C7Z A;  4QZF A;  3RR7 A;  2AGQ A;  8ICY A;  4F2S A;  3PMN A;  4OAF A;  5KFO A;  1JXL A;  2FPL A;  4AYB F;  3MR2 A;  4DOC A;  4DFP A;  2KZ3 A;  4X4T A;  5J0W A;  9ICX A;  3WFS C;  4AT8 B;  1A0P A;  5KL1 B;  1UA1 A;  1NK6 A;  8ICF A;  3UQ2 A;  4YR0 A;  2FMS A;  1XSN A;  1V9P A;  4NLZ A;  2R18 A;  8ICU A;  5D46 A;  4FHY A;  4I29 A;  3O0F A;  2A3V A;  3GV8 B;  4F5O A;  3D6J A;  1OU5 A;  2IBK A;  5KG4 A;  4RT2 A;  3N7P D;  4PJ0 U;  2EAM A;  3EUB 2;  3UXP A;  3ER8 C;  5F3X B;  3GIK A;  4C8K A;  4UW9 A;  1J2M A;  1SV0 C;  4IQV A;  5ALV A;  3C28 A;  4LEY A;  4MEY A;  5ALP A;  3WK7 A;  2XY6 A;  5DLG A;  3G6V A;  4UB1 A;  5CHE A;  3D2S A;  2LI6 A;  4Y2Y A;  1SXE A;  4DSE A;  2K89 A;  2E8P A;  4WCW A;  2HW3 A;  2BCR A;  1SIJ A;  4NM1 A;  3PHZ A;  1RYU A;  5ALM A;  3QX7 A;  3QZ7 A;  1JQR A;  1Q46 A;  4ELT A;  1WOT A;  4NLG A;  9ICB A;  5KFZ A;  3OUY A;  5J2C A;  3RH5 A;  3EPI A;  1Q3U A;  3WK9 A;  1N62 A;  4X4P A;  5L9X A;  3KD3 A;  1OW5 A;  2W11 A;  3WKB A;  3TAP A;  4LVS A;  4UBC A;  2KEY A;  5HR6 A;  2YML A;  1RM6 C;  5B3P A;  4Q43 A;  5KT6 A;  4ED3 A;  3PO5 A;  4RWQ A;  1AQ6 A;  4LJX A;  5AIA A;  1LV5 A;  2MUT A;  4UD4 A;  9ICA A;  1X6J A;  3C1Z A;  5AKJ A;  5AK3 A;  5AK5 A;  1OXJ A;  4DQQ A;  4EBE A;  5AM2 A;  1KL9 A;  3TAR A;  4UQG A;  7ICG A;  4YD2 A;  3TQ1 A;  4YCX A;  3ZDE A;  4NLK A;  5KFI A;  1TK0 A;  3HJ1 A;  7ICH A;  4WH5 A;  1XU4 A;  2E8M A;  4R8U A;  1BPZ A;  3Q8K A;  2KIV A;  4O3S A;  2G08 A;  4F4W A;  1L5U A;  5KG1 A;  3PW0 A;  3RJK A;  4S3N A;  2R8G A;  5J2F A;  2VA2 A;  2HHS A;  4LEW A;  3RTV A;  2HSZ A;  4CNQ A;  3RJH A;  2KOB A;  9ICT A;  4CE6 A;  3IP4 B;  1ZJN A;  2PFP A;  5K4L A;  1YLQ A;  5C0Y A;  3RB0 A;  2EZZ A;  2DKZ A;  2O5A A;  1KNY A;  4J9P A;  2BQR A;  3RJE A;  3CP8 A;  4Y2J A;  4TUQ A;  3PW7 A;  3SQI A;  5CFU A;  5C5J A;  2G0A A;  3WKD A;  3NVW A;  1QQ6 A;  1BPX A;  4OJP A;  4PHD A;  2HVI A;  3AQN A; 
#chains in the Genus database with same CATH homology
 3GV5 B;  2W8K A;  4I2C A;  2BKE A;  3KHG A;  9ICC A;  4KLQ A;  5TZV A;  2HHX A;  4O5C A;  3Q8R B;  4QWD A;  9ICS A;  3QEA Z;  4I2D A;  3KHR A;  1ZQP A;  4JV0 A;  3HWT A;  5HRI A;  5HRF A;  4KN4 A;  4FBT A;  2HHP A;  3SV4 A;  4KMU A;  1ZQM A;  2ISP A;  5HRG A;  4RQ1 A;  4UB3 A;  4J9K A;  4NM2 A;  1L3U A;  8ICS A;  3QEB Z;  4HYK A;  8ICA A;  5CB1 A;  2HVH A;  3AQL A;  1QTM A;  1U4B A;  3PW2 A;  1BGX T;  3E2E A;  2JEI A;  2GWS A;  5J0X A;  4GC7 A;  3ZD8 A;  4O9M A;  2HHT A;  2KZM A;  5KFJ A;  8ICK A;  4B9T A;  4YN4 A;  5KT4 A;  1RXW A;  9ICG A;  3BQT A;  4C8N A;  4PHA A;  3LQC B;  3UPS A;  1BVS A;  1TK8 A;  2ZUB A;  1U9L A;  7ICL A;  5J2I A;  8ICT A;  1KFD A;  4YD1 A;  4PGX A;  5DBB A;  1VJ7 A;  2ZH4 A;  1ZQI A;  5DLF A;  4YFK A;  5EWF A;  1NK0 A;  4RU9 A;  5DGA A;  1ZQK A;  1N48 A;  3JPT A;  4RQ5 A;  3ZDC A;  2BCQ A;  4B9L A;  4FHP A;  2C28 A;  3PW4 A;  4QZH A;  1TV9 A;  5KFL A;  4JK1 A;  3IM1 A;  4UAZ A;  3OJU A;  3PVX A;  2ASD A;  1TK5 A;  4EZ9 A;  1ZYQ A;  4RNM A;  1ZQR A;  4C8O A;  3H39 A;  4FHV A;  5L1K A;  5KFS A;  4QWA A;  3MBY A;  1BPY A;  4X0A A;  3OHB A;  4FH3 A;  1NJY A;  8ICL A;  3JPO A;  4X4O A;  2DPI A;  1KDH A;  1JMS A;  4GXI A;  5HR9 A;  8ICJ A;  4I2F A;  4WC7 A;  3Q8L A;  1S76 D;  5IIN A;  5J2G A;  4TUS A;  3Q8Q B;  3C66 A;  5J2D A;  4PH5 A;  1QLN A;  2ZH7 A;  1ZJM A;  2NRX A;  5KT7 A;  5HMM A;  3MR6 A;  2UVW A;  1BPD A;  3V7L A;  4UB5 A;  3T5J A;  4TUP A;  1U48 A;  4Q8E A;  7ICP A;  4JWN A;  3H37 A;  2NRZ A;  4I2I A;  4YQW A;  3OGU A;  3M9N B;  1IM4 A;  3EZ5 A;  1X9M A;  1SL2 A;  1Z00 A;  4KLS A;  3RRG A;  3C5F A;  5HRD A;  4WC4 A;  1S10 A;  2W9C A;  1ZQJ A;  4ED7 A;  3OVB A;  2A1J B;  3GIM A;  4M9H A;  2AQ0 A;  4YMN A;  4I2H A;  4EP7 A;  1SZP A;  2W9B A;  1UT5 A;  7ICJ A;  4X5V A;  4R66 A;  2BQU A;  3FYH A;  5CWR A;  4TUR A;  3H38 A;  4Z6E A;  2HHQ A;  9ICL A;  4AT7 B;  2AU0 A;  3NYB A;  4R65 A;  5KG0 A;  4DOA A;  4RNO A;  4ECW A;  9ICV A;  3V6K A;  4DS5 A;  3RB4 A;  5J2A A;  2O1P A;  1R8A A;  2NRK A;  2FPM A;  4QZG A;  5D49 A;  4DF4 A;  4KLM A;  1MIW A;  3ZD9 A;  5KT5 A;  1MIY A;  1L3V A;  1UET A;  5KFB A;  4YP3 A;  1Q79 A;  1U47 A;  3HPO A;  3MR3 A;  1Z00 B;  4J9M A;  4M9N A;  4YR3 A;  1LB2 B;  4K4G A;  4FBU A;  2JZB A;  4DL3 A;  2PFN A;  3GQC A;  3PX0 A;  1NK4 A;  1X9S A;  4QW8 A;  3QZ8 A;  1ZQS A;  1ZQQ A;  1B43 A;  1S0V A;  3OVS A;  2RDI A;  4DSF A;  4R64 A;  2VA8 A;  3Q8S B;  4ED2 A;  4B9M A;  4M9G A;  4KLG A;  2R8K A;  4KLJ A;  1ZQX A;  1D9F A;  5KFT A;  5J0R A;  3HW8 A;  2IHN A;  4EZ6 A;  3OSN A;  4J9N A;  2JEF A;  2KN7 A;  4NY8 A;  5DG9 A;  5CR0 A;  4IRK A;  3MAB A;  3PML A;  4J9O A;  5HNK A;  3PO4 A;  4F8R A;  4WC6 A;  4M04 A;  5D4B A;  2W9A A;  1SKS A;  4EBD A;  1ZQT A;  4J9S A;  2R8J A;  1SL0 A;  1KLN A;  1ZQF A;  4AT9 B;  2DRA A;  1MQ3 A;  4K4I A;  2B21 A;  5BOM A;  3PNC A;  4KLD A;  8ICM A;  1PX5 A;  4DQI A;  3RAX A;  2ZH1 A;  1XWL A;  2ZTC A;  3SV3 A;  4E0D A;  4EBK A;  1HUZ A;  1TFY A;  5L1I A;  4B9U A;  1K1S A;  9ICF A;  3BQ2 A;  1DGS A;  3RBD A;  4P4M A;  3LDA A;  1S77 D;  1TFR A;  4F5R A;  4AT8 A;  1D8L A;  4I27 A;  4J9Q A;  3AU2 A;  9ICH A;  2ASL A;  1XC9 A;  4YVZ A;  4I2E A;  5DQH A;  3Q8M A;  3ISD A;  2ALZ A;  1NK8 A;  9ICW A;  4JUZ A;  5J0S A;  4RPY A;  4KLT A;  2KTQ A;  9ICR A;  8ICP A;  3AQK A;  5KFC A;  5F2V O;  5KFV A;  2W9C B;  1NJZ A;  2DR8 A;  4F93 B;  4XUS A;  3LWL A;  1R8C A;  1UT8 A;  3PR4 A;  4UD5 A;  1JIH A;  2ZH9 A;  4Q44 A;  1NKE A;  5DQG A;  4XQ8 A;  3EW9 A;  3RH4 A;  4DSK A;  3KTQ A;  1CEZ A;  8ICZ A;  4TQS A;  4XQ7 A;  3HJ4 A;  1ZQL A;  3C2K A;  4DO9 A;  3TFR A;  4TQR A;  4DS4 A;  2KFN A;  2A1J A;  2J6U A;  1EXN A;  4MEX A;  3LWM A;  4ED6 A;  3V6H A;  3NTU A;  4YXJ A;  4RQ7 A;  3GDX A;  4F5Q A;  1X2I A;  2PFO A;  2PI4 A;  3ZDB A;  4RWO A;  4WC2 A;  4RPX A;  1ZQD A;  3OHA A;  3N97 B;  5F9N A;  1SL1 A;  2ISO A;  4X4S A;  3V7K A;  1T7P A;  4M9J A;  1UEV A;  1CUK A;  4F92 B;  2BHN A;  3PW5 A;  1TAQ A;  3T3F A;  4BDP A;  3B0X A;  4M9L A;  7ICR A;  2ZHA A;  4XRH A;  5DBA A;  3HX0 A;  5IIJ A;  4FS2 A;  3N4M B;  3B0Y A;  2ZUD A;  5DDM A;  4ECT A;  4YG2 A;  4ECZ A;  2V4R A;  1JX4 A;  3V72 A;  4IRD A;  1H38 A;  4KLI A;  1MSW D;  2DRB A;  3WFO A;  5J0U A;  4M0A A;  1ZQN A;  3OJS A;  4YMM A;  4JV1 A;  1D9D A;  3TFS A;  4O3O A;  5KFM A;  3MDA A;  4FHW A;  4B9S A;  4BXO A;  4X4N A;  2XCA A;  4KIT B;  4WBZ A;  2P6U A;  5KFP A;  5J0P A;  4J9L A;  5J0T A;  4Z6C A;  3NGD A;  4F4X A;  5J2K A;  4DL2 A;  5KFF A;  4QW9 A;  3ETL A;  2DPJ A;  2BPG A;  2R8I A;  2BPC A;  2R8H A;  4KN7 A;  2XC9 A;  4DFM A;  4F2R A;  4ATB A;  3K75 D;  1COO A;  3H8S A;  2F1H A;  4PGY A;  4UBB A;  3QE9 Y;  3PY8 A;  3C18 A;  3ORY A;  2H5X A;  5F9L A;  4B9V A;  3C2L A;  2BQ3 A;  3ISC A;  2VA3 A;  8ICG A;  7ICK A;  3OUY B;  4DL4 A;  2M2U A;  3KHH A;  4BGD A;  4I2J A;  4MFC A;  2ZHB A;  4M5D A;  4NXZ A;  4I2B A;  1ZQZ A;  4ECU A;  1BPE A;  4QZE A;  1NK7 A;  4BXO B;  5KG5 A;  5KFW A;  4E8F A;  1NJW A;  4KTQ A;  4AT9 A;  2HHV A;  5IIM A;  4E80 A;  4QZ8 A;  8ICE A;  2DFL A;  3PX6 A;  1TVA A;  1NJX A;  4FHX A;  1NKB A;  4ECR A;  4WBY A;  1TFW A;  5KFA A;  5BPC A;  1ARO P;  2XGQ A;  1RYS A;  1KEJ A;  4I28 A;  3PV8 A;  9ICO A;  4QZ9 A;  1DK2 A;  3JYY A;  5KFE A;  4UB4 A;  4DF8 A;  5III A;  1C7Y A;  2UVV A;  4KLL A;  4O3Q A;  3UXN A;  8ICW A;  1X9W A;  2P66 A;  2ZUC A;  4Z6F A;  5KFR A;  2Y1J A;  3T5H A;  5DG7 A;  4GXK A;  4GC6 A;  3SYZ A;  1ZQH A;  2C2D A;  1RPL A;  3H8J A;  3GIJ A;  2UVR A;  1JAJ A;  5J2J A;  4O5E A;  4Z6D A;  5HRL A;  3UQ0 A;  4FS1 A;  4DQP A;  3BQ0 A;  7ICT A;  2DR7 A;  8ICQ A;  2BCS A;  1NZP A;  4CCH A;  4ECX A;  3K4G A;  2FMP A;  5HC9 A;  4RQ3 A;  4KLE A;  3Q8P B;  1JN3 A;  5KFD A;  5EWE A;  2I1Q A;  2Q0Z X;  3PR5 B;  4ELU A;  2ZTE A;  3GIL A;  4IQT A;  5J0Q A;  8ICN A;  2BDP A;  1MC8 A;  3L9D A;  3M9O B;  4P4O A;  2PXI A;  1T4G A;  4EYH B;  3SZ2 A;  3BJY A;  9ICN A;  5HP4 A;  4X4V A;  5KFN A;  4ZH4 A;  2BCU A;  9ICU A;  1L3T A;  3GII A;  9ICP A;  4M47 A;  1ZQU A;  1RZT A;  3RJG A;  1B22 A;  2ZH2 A;  2KZZ A;  2UVU A;  2NRW A;  4DFJ A;  2XO7 A;  5KFK A;  3IHQ B;  1FA0 A;  4LZD A;  4IR9 A;  5KFX A;  1NK9 A;  3RJI A;  4GLX A;  1VFG A;  2J6T A;  5J2H A;  1RXV A;  7ICF A;  8ICX A;  1KTQ A;  5DB6 A;  5CA7 A;  4DQR A;  3H8W A;  4DQS A;  2P6R A;  1V4A A;  4ELV A;  2LYH A;  2HHW A;  2FMQ A;  4O5K A;  4KLH A;  4RUA A;  4DLG A;  4FO6 A;  5DED A;  8ICI A;  4I2A A;  2C22 A;  4YR2 A;  2V4Q A;  4R8U B;  3EWA A;  4RT3 A;  4QZF A;  4MF8 A;  2JEJ A;  4F5N A;  1NK5 A;  8ICC A;  4BWJ A;  3RR7 A;  1KRP A;  5DG8 A;  2AGQ A;  3H4B A;  1ZQA A;  8ICY A;  4NKT A;  5J2B A;  3ZDA A;  4M6W A;  4Q8F A;  5KTQ A;  1ZQB A;  4F2S A;  5HHH A;  4RZR A;  4DL7 A;  4RQ2 A;  4P4P A;  3PMN A;  2AGO A;  3OVA A;  5KFO A;  5J0O A;  4EBC A;  1JXL A;  2FPL A;  1K1Q A;  3RBE A;  3MR2 A;  4DOC A;  3WFP A;  4DFP A;  4M6W B;  2KZ3 A;  4UAW A;  4X4T A;  3ISB A;  3SI8 A;  1ZQW A;  1S0O A;  3MDC A;  5J0W A;  4DSJ A;  9ICX A;  1KSP A;  4IG8 A;  3RR8 A;  2KFZ A;  3PX4 A;  3WFS C;  4AT8 B;  1SKR A;  1UA1 A;  1NK6 A;  8ICF A;  9ICE A;  4MFA A;  3BQ1 A;  3UQ2 A;  4YR0 A;  2FMS A;  1XSN A;  1V9P A;  2C2R A;  4NLZ A;  8ICU A;  1TAU A;  4DL5 A;  7ICE A;  1RYR A;  5D46 A;  5L1L A;  8ICR A;  9ICM A;  5J2E A;  3MFI A;  4I29 A;  3AQM A;  3JZ0 A;  4FHY A;  4R63 A;  1S0M A;  4RQ8 A;  3GV8 B;  4AT7 A;  2MUT B;  4F5O A;  4NLN A;  1ZQV A;  2AQ4 A;  3HIY A;  3FDS A;  4IQU A;  2BGW A;  4Q45 A;  7ICN A;  3EYZ A;  1U45 A;  1OU5 A;  1BPB A;  5KG4 A;  2IBK A;  4RT2 A;  4UB2 A;  2ASJ A;  1R89 A;  4WC3 A;  8ICB A;  2XCP A;  4RWN A;  4RQ0 A;  7ICI A;  4NKU A;  4I2G A;  4E7X A;  2JEG A;  1A76 A;  4QWB A;  3JPN A;  2ATL A;  1IXR A;  4QZC A;  3UXP A;  4QWE A;  1S97 A;  1QSL A;  4G3I A;  2ZH6 A;  4WC0 A;  1WCL A;  2Q66 A;  1QSY A;  3AU6 A;  3GIK A;  3HT3 A;  2Y1I A;  4C8K A;  2RFF A;  1KFS A;  3MR5 A;  3C5G A;  1T3N A;  3H3A A;  2NRV A;  4O3R A;  5DKW A;  5IIL A;  4IQV A;  4WC1 A;  2KP7 A;  5KT3 A;  3MFH A;  4ECS A;  2ZTD A;  7ICQ A;  4MEY A;  2JZB B;  4YMO A;  3UXO A;  4PGQ A;  5DLG A;  3G6V A;  2XY6 A;  4DSI A;  9ICJ A;  3GFK B;  3UPQ A;  5HRK A;  1WCN A;  4UB1 A;  2F1I A;  2VAN A;  3EPG A;  4C8L A;  4YXM A;  3T5L A;  5CP2 A;  1ZQY A;  5HHI A;  4DSE A;  1ZQG A;  4IR1 A;  2XGP A;  3C21 A;  1U49 A;  4X4U A;  2M2T A;  4WCW A;  4EBJ A;  5DQI A;  4QWC A;  3M8R A;  5KG7 A;  1HUO A;  2FLL A;  2HW3 A;  8ICH A;  7ICS A;  3WFR E;  4F5P A;  2PI5 A;  2C2E A;  4F4Y A;  1ZQC A;  2BCR A;  4DEZ A;  4NM1 A;  1F5A A;  3OSP A;  4F4K A;  2OWO A;  4X4Q A;  1UEU A;  3M8S A;  3ZDD A;  3C1Y A;  5DGB A;  3TAQ A;  3QZ7 A;  1JQR A;  3THV A;  2W9M A;  3G6Y A;  4DLE A;  4ELT A;  1WOT A;  1T8E A;  4NLG A;  9ICB A;  4QZI A;  4FH5 A;  5KFZ A;  1MQ2 A;  3MGI A;  3OUY A;  1HJP A;  1Z3E B;  5J2C A;  3RH5 A;  3EPI A;  2HHU A;  4X4P A;  2V9W A;  5L9X A;  4QZB A;  3C23 A;  2PFQ A;  1JXE A;  3H40 A;  4QZA A;  4P2H A;  7ICU A;  3JPQ A;  4RQ6 A;  2BE3 A;  5DBC A;  2AGP A;  5KFH A;  3TAP A;  4M2Y A;  4LVS A;  4O3P A;  1XSL A;  4UBC A;  2W9B B;  7ICV A;  4BWM A;  4LZG A;  1DOQ A;  4ED1 A;  4Q43 A;  4B9N A;  4EYI B;  9ICI A;  4IQW A;  5IIO A;  5KT6 A;  4ED3 A;  3PO5 A;  5KFQ A;  3RAQ A;  5HRH A;  4RWQ A;  1NKC A;  4RNN A;  4RQ4 A;  9ICQ A;  1DK3 A;  4LT6 A;  1LV5 A;  4IRC A;  2MUT A;  4UD4 A;  9ICA A;  4F50 A;  2FPK A;  4RWP A;  2DVI A;  3C1Z A;  3TAN A;  4KLO A;  4JWM A;  3MGH A;  1QSS A;  3LK9 A;  4QZD A;  4DL6 A;  5J29 A;  4DQQ A;  2DR9 A;  1ZET A;  1UA0 A;  3RJJ A;  8ICO A;  4J9R A;  4ED8 A;  8ICV A;  5KG3 A;  4EBE A;  3V6J A;  5CJ7 A;  5JUM A;  2M2V A;  5HRB A;  1BNP A;  5HRE A;  4JV2 A;  4ECQ A;  1NOM A;  3TAR A;  1XSP A;  5KFG A;  2BPF A;  2ZJ8 A;  2FLP A;  3AUO A;  5EWG A;  1XS9 D;  2ID1 A;  7ICO A;  4UQG A;  1SKW A;  2IHM A;  7ICG A;  1BNO A;  4YD2 A;  3RRH A;  3TQ1 A;  4YCX A;  4ECV A;  2NRT A;  3RB3 A;  2PBE A;  5IIK A;  3ZDE A;  5EOZ A;  2DR5 A;  2M2W A;  4DWI A;  2J6S A;  1R8B A;  4NLK A;  5KFI A;  1TK0 A;  1Q78 A;  3HJ1 A;  2ZH8 A;  5KFU A;  3G6X A;  7ICH A;  4X4R A;  3T5K A;  1XU4 A;  5KFY A;  9ICK A;  4R8U A;  3V7J A;  3Q8K A;  1BPZ A;  5KT2 A;  4O3S A;  4F4W A;  3BDP A;  4MF2 A;  1L5U A;  2F1J A;  5KG1 A;  4ED0 A;  3H7I A;  2I9G A;  4ATB B;  5CHG A;  3M9M B;  1S9F A;  2XY7 A;  3RJF A;  3PW0 A;  2BR0 A;  1N56 A;  4DFK A;  3RJK A;  5HML A;  4S3N A;  4PHP A;  1PZN A;  3KHL A;  5J2F A;  2R8G A;  1MIV A;  2VA2 A;  2IA6 A;  4KLF A;  7ICM A;  2HHS A;  4UAY A;  2ZJA A;  1XO1 A;  3RTV A;  5DB7 A;  3C2M A;  1ZQE A;  2MAX A;  3RB6 A;  4XA5 A;  3RJH A;  1ZQO A;  9ICT A;  5BOL A;  1TKD A;  2WTF A;  4PHE A;  2ZJ5 A;  2BCV A;  1ZJN A;  1S0N A;  2PFP A;  3TI0 A;  4RUC A;  2ZH3 A;  4GXJ A;  2XY5 A;  5L1J A;  4WC5 A;  2M9N A;  2ZH5 A;  4F91 B;  1YLQ A;  5DEC A;  5KG6 A;  3JPS A;  3RB0 A;  4K4H A;  2AJQ A;  1NO5 A;  5DB8 A;  3H4D A;  4J9P A;  2IMW P;  1KNY A;  2O5A A;  2BQR A;  1Y88 A;  3OV7 A;  3RJE A;  4C8M A;  5J0Y A;  4ECY A;  1D8Y A;  4MFF A;  4DSL A;  4RPZ A;  4O0I A;  4EEY A;  2W8L A;  1KFT A;  4KLU A;  3WFQ E;  4TUQ A;  4DOB A;  3JPP A;  2FLN A;  5DB9 A;  2RDJ A;  3PW7 A;  3RH6 A;  4X0B A;  4F4Z A;  4F3O A;  5C5J A;  3HP6 A;  1A77 A;  1L3S A;  4O3N A;  1BPX A;  3JPR A;  5DDY A;  4PHD A;  4PPX A;  2HVI A;  5KG2 A;  3GV7 B;  3AQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...