5BPCA

Dna polymerase beta ternary complex with a templating 5clc and incoming datp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, ligase/dna
total genus 111
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bpcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bpcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bpcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bpcA03
2ZJAA 1ZQYA 4MFAA 3PR4A 4MFFA 5DBBA 3HJ4A 5HRIA 4E80A 4RUAA 3JPRA 3ZD9A 9ICOA 4KLOA 3LDAA 3B0XA 2PFQA 8ICTA 4PHDA 5KFYA 1H38A 9ICQA 1K1SA 4YP3A 9ICEA 1X9WA 3MR2A 4F4KA 4F92B 1XC9A 4DFJA 2F1JA 4B9UA 2ZHBA 1HUOA 3OSPA 3RAQA 1NJWA 2PXIA 1ZQFA 1Q78A 4DLGA 5J0PA 2Q0ZX 1QSLA 2HHXA 3RAXA 4LZGA 1MSWD 1S97A 4YMNA 4HYKA 3M8RA 3GQCA 8ICFA 1COOA 9ICMA 5CWRA 3TAPA 4F2RA 4DL6A 1X2IA 2VA3A 3H38A 2KTQA 4K4GA 1BPYA 2KFNA 1RPLA 4C8LA 4M9JA 4KLHA 1R8BA 4ECVA 2VANA 4FBUA 2AQ0A 8ICPA 4BWJA 2RDIA 9ICBA 3FDSA 1KDHA 4XUSA 3RH4A 3RR7A 4YQWA 1ZQWA 4DLEA 4ED7A 1UA1A 1ZQRA 2PI4A 7ICHA 1ZQTA 3JZ0A 1NO5A 4O3PA 4J9QA 4J9RA 2M2TA 5BOMA 3GIMA 2H5XA 4J9NA 4DWIA 8ICLA 3NGDA 5KFNA 4DQQA 8ICYA 1VFGA 3KTQA 4RUCA 1KEJA 2W9BA 2BQUA 1ZQNA 4QZCA 4QZFA 4I2IA 1B22A 1UEVA 3G6YA 4MF8A 3GDXA 3OV7A 4JUZA 3JPQA 4X4TA 2FLNA 2DPJA 4QZBA 4EEYA 3Q8LA 1JX4A 5KFFA 3IM1A 4EBEA 2JEGA 4E0DA 3TARA 5HRDA 4F93B 3GILA 2MUTA 1XWLA 1TK0A 4WC3A 1TAQA 2I1QA 5J2EA 3ISCA 4JWMA 4UBCA 5F9LA 1ZQOA 3PMNA 2DRAA 3HT3A 1R89A 1BNPA 4G3IA 3PR5B 2XO7A 3HIYA 4RQ3A 4Z6EA 3HPOA 4DL3A 1ZQMA 3MABA 5DBAA 4EZ6A 7ICSA 4QZDA 4QZAA 3KHHA 4NLNA 4X4VA 1NJZA 7ICQA 3MR6A 4TUSA 8ICIA 4F4ZA 8ICVA 3AQMA 9ICGA 2NRTA 4ED8A 4C8NA 2R8HA 5KFXA 5DLFA 1N48A 2GWSA 4X4RA 1MC8A 4IQWA 4M9LA 2W9BB 2R8IA 5EWEA 2BCQA 4NM2A 4I2BA 3GIIA 5CJ7A 4DS4A 3AQKA 1L5UA 1U49A 3RBEA 2DPIA 4S3NA 1JN3A 2PBEA 5TZVA 5HP4A 2IHNA 3T5HA 4DL4A 1JXEA 1F5AA 4TUPA 4X0AA 3H40A 4DS5A 7ICPA 4FHXA 5DEDA 1NK4A 1BPZA 1MIYA 2MUTB 3BQ2A 1TFYA 4PGQA 3TFRA 3G6VA 4KLFA 1NK9A 4GC7A 4Q45A 4UB4A 2NRWA 3B0YA 4J9PA 4EBCA 2V9WA 1LB2B 3H4DA 3EPGA 3C2MA 2PFPA 4I28A 5HREA 5D49A 2JEIA 2ZJ5A 2ASJA 4QW8A 5CHGA 9ICSA 4YXJA 1V9PA 2BCUA 5DB8A 5KFZA 5J29A 1V4AA 5J2KA 3GIKA 4DFPA 3TI0A 1IM4A 5J2GA 3V7JA 1L3VA 3BDPA 4UB5A 5DQHA 2C2DA 1T3NA 4BDPA 1NKCA 8ICWA 4YMMA 3MGHA 4IR9A 9ICHA 1ZQVA 8ICGA 3PW7A 5KT5A 2F1IA 1S0VA 8ICMA 4X4PA 4UAWA 4WC2A 4FS2A 3E2EA 1MIVA 2ZUCA 4RPYA 4UAZA 2BE3A 2KZ3A 2OWOA 4R64A 5KFRA 1UT8A 4DQSA 5IIJA 4ELTA 4IRDA 3PNCA 3QZ7A 4FS1A 8ICBA 2BKEA 3ZDCA 2XGPA 7ICOA 3TQ1A 4BGDA 5J0SA 8ICSA 5D4BA 5JUMA 3IHQB 5J2HA 3PV8A 3QE9Y 1D9FA 1TAUA 2BHNA 2ZUBA 5CB1A 4P4MA 5EWGA 5J2IA 4IQUA 1XSPA 2UVVA 3BQ0A 4I2HA 1XO1A 4UQGA 4DSIA 4JWNA 3OHBA 9ICFA 9ICTA 2ZTDA 1MQ3A 3EW9A 4CCHA 4O9MA 3V6JA 7ICTA 4QWEA 7ICVA 4RQ6A 5F2VO 4FH5A 2DR8A 5HRHA 4UB1A 2ALZA 4M9GA 3ETLA 3UXNA 1AROP 2KZMA 5J2CA 1HUZA 5KTQA 1BNOA 3AUOA 4UAYA 4UD5A 4WC6A 5DQIA 3RJJA 9ICVA 1ZETA 2P6UA 3OUYA 3JYYA 3WFRE 3OGUA 5HRGA 4RNOA 4P4OA 3RJFA 4WBZA 3Q8QB 4ECSA 2W9CA 1D8LA 4PGYA 1S0MA 5KG6A 3PW0A 4NM1A 4O0IA 5J2DA 3PX0A 5DBCA 5HR9A 5DB7A 4F5QA 2O5AA 4E7XA 1U9LA 5DDYA 3RTVA 4Q8EA 4I2AA 4QWDA 1BGXT 3MR5A 7ICFA 8ICXA 1X9SA 1S0OA 4M5DA 3WFOA 3HW8A 7ICGA 2HHQA 4JV0A 3PW5A 1LV5A 2V4QA 3ZDAA 2RDJA 5KG3A 5KFCA 4J9MA 2C22A 4WCWA 4XRHA 3V7KA 3M9MB 3SZ2A 3GV5B 4QZHA 1U47A 4R65A 9ICPA 4ELVA 5L9XA 2W9AA 1T4GA 3ISBA 4YCXA 4I2JA 4YFKA 4B9NA 4KLUA 4F8RA 4PHEA 2HHUA 4KLJA 5C5JA 2W8KA 4DOAA 4R63A 4RWNA 4J9LA 4KLDA 2LYHA 1PX5A 3UPQA 4KLMA 4O5EA 1WCLA 3Q8KA 1IXRA 1KFSA 4ELUA 1L3UA 4Q8FA 5J0OA 2JEJA 3C2KA 4IG8A 5BOLA 2UVUA 1R8CA 2W9CB 3MFHA 4RU9A 3RB3A 4I27A 1Q79A 4EBJA 3UQ2A 5KFEA 9ICCA 5KFTA 9ICLA 4DO9A 4F4WA 2KZZA 3Q8SB 4X4SA 3T5LA 4IR1A 5HHHA 1ZQEA 1A76A 2JEFA 3C2LA 5KFBA 1FA0A 3OUYB 4O3OA 4EBDA 3RJIA 1ZJMA 3QEAZ 1SL1A 5J0XA 5KFSA 3TANA 4NLGA 5KFGA 7ICRA 3RJHA 3L9DA 3KHLA 4GXKA 4M6WA 2ZUDA 4YR2A 1X9MA 1MQ2A 2P6RA 2HVHA 4NLZA 2ZHAA 4ECTA 5DLGA 4ZH4A 3N4MB 3PX4A 3TAQA 3RBDA 2PFOA 4AT8A 3V7LA 1QSSA 5IINA 2AGPA 4KLEA 5L1IA 5DB6A 4LT6A 4ED2A 4P2HA 4B9SA 5KG5A 5HRKA 4I29A 4TURA 2HHVA 4DL2A 2FLLA 5CR0A 2ASDA 5KT2A 4K4HA 4WC5A 3C21A 3NTUA 4FO6A 4RQ4A 3H8SA 2RFFA 2V4RA 1JXLA 4F91B 5KT7A 4KLSA 1SKWA 4Z6DA 3EPIA 2KP7A 3ZDDA 1S76D 4WC1A 1ZQLA 3NYBA 1XS9D 1MIWA 1EXNA 2PFNA 3H8JA 3JPTA 2C28A 4QZ9A 2BDPA 4YD1A 1CUKA 4KN4A 4YR0A 4F5OA 3V6HA 3Q8MA 4KLLA 4EP7A 4ED6A 3PW2A 4MEXA 4O3SA 1CEZA 2JZBA 4RWOA 4YXMA 7ICEA 4M6WB 1L3SA 4DEZA 1NKEA 4KLTA 8ICKA 3WFPA 3PVXA 3WFSC 1ZJNA 1BPXA 5J0WA 4ECWA 4AT8B 4JV2A 2PI5A 1D8YA 5IIOA 1S9FA 1DK2A 1ZQGA 4I2CA 4BWMA 5IILA 2M2WA 5EWFA 2BQ3A 2BCVA 4MFCA 4EYHB 1QTMA 5KG1A 3SV4A 1RYRA 3PO5A 3ZDEA 4KLQA 3HJ1A 5J0TA 2W8LA 4YMOA 1RXWA 2R8GA 5J0YA 5HHIA 4DQPA 4YR3A 9ICKA 1KNYA 2KN7A 4O5KA 4RZRA 2UVWA 4QZEA 3M8SA 4DL7A 2BGWA 1JAJA 4O3QA 1QSYA 2FLPA 8ICUA 2DR9A 4KMUA 4KLIA 4I2FA 2ZH6A 1ZQZA 3GV7B 4GXIA 4ECZA 4RQ8A 4FBTA 2ZH8A 2FPMA 5EOZA 4GLXA 1RXVA 4TQSA 4DSEA 2VA2A 3C1YA 2Y1IA 2M2VA 4NKTA 5KFOA 4TUQA 5KFAA 1NJXA 2NRXA 4M9HA 5KFHA 5J2JA 4DQIA 4ED3A 5L1JA 4NXZA 5IIMA 3GV8B 1D9DA 4X4OA 4FH3A 1ZQSA 2JZBB 4RPXA 5DG8A 2A1JA 3JPSA 4ECQA 2HHWA 4RWQA 4QZIA 8ICQA 2ZH9A 5L1LA 1Z00A 3LK9A 5DKWA 3H4BA 4ED1A 2HW3A 4FHPA 4DQRA 5KFDA 9ICRA 5DECA 4DF8A 4BXOA 3PMLA 2IMWP 4DFMA 5L1KA 2ZH7A 4X4UA 3UPSA 2XY5A 1NZPA 2WTFA 4PH5A 4TQRA 1ZQKA 3RR8A 3C5GA 2Y1JA 2J6TA 1ZQQA 2BR0A 4DF4A 4X4QA 3ZD8A 1XSLA 2IBKA 7ICJA 4X4NA 8ICOA 4B9LA 1Z3EB 3V6KA 4ECXA 3N97B 3RRGA 1S10A 5HRLA 1TV9A 1UT5A 1BPBA 4ED0A 3T5KA 2NRVA 3H8WA 2C2RA 2ZH4A 1ZQUA 1U48A 3EZ5A 5KFPA 1N56A 8ICZA 5DB9A 3OJUA 3THVA 3MDCA 4C8MA 2A1JB 3RB0A 5J0UA 2FMPA 4RNMA 3BJYA 2XC9A 4C8KA 1YLQA 1Z00B 5DGBA 3G6XA 4XA5A 4ATBA 2MAXA 1VJ7A 4M47A 5J2BA 4F4YA 4BXOB 5KFJA 4NKUA 2BPGA 3EWAA 4WBYA 2DVIA 1NJYA 1KFTA 9ICAA 4PHAA 4R66A 3Q8PB 1SKRA 5KFKA 5HRBA 4F2SA 4DSLA 1BVSA 4PPXA 1A77A 4PGXA 2M9NA 1TFRA 5DGAA 4WC0A 4M04A 4Z6CA 1T8EA 4JK1A 2XY7A 7ICUA 1DOQA 2R8JA 9ICJA 3OSNA 4EBKA 4WC7A 4RNNA 4JV1A 3PX6A 2XGQA 1BPEA 1ZQIA 2ZH3A 1JMSA 1JQRA 5KFVA 2ZTEA 4O3RA 1UETA 4RPZA 1TK5A 2FMSA 1SZPA 4FHWA 3AU2A 2ISOA 1NKBA 1WCNA 4DOBA 1NK6A 3FYHA 3QEBZ 1RZTA 9ICIA 7ICKA 4Q44A 4J9OA 4I2GA 7ICNA 4ATBB 5KG4A 3M9NB 3KHGA 5IIIA 3PY8A 1TK8A 5HC9A 3OHAA 1RYSA 1JIHA 2XY6A 5DQGA 4I2EA 1NOMA 3MBYA 1QLNA 2Q66A 4EYIB 7ICMA 2J6UA 4KITB 2ZJ8A 3LQCB 5BPCA 2DFLA 2ZTCA 3SYZA 5KFQA 4RQ1A 2XCPA 1ZQJA 4KLGA 4E8FA 3GFKB 4DFKA 1WOTA 3JPOA 1ZQCA 8ICCA 4MEYA 5J0QA 3T3FA 3SI8A 2AU0A 3C66A 5F9NA 3OVAA 4M2YA 1TFWA 3HP6A 1ZYQA 3RJEA 1SL0A 5J2AA 4DSFA 1PZNA 4K4IA 1KLNA 3UXOA 5J0RA 3C23A 4UBBA 1SL2A 3SV3A 1HJPA 4B9MA 2O1PA 5HMMA 1SKSA 1KRPA 4J9KA 4GXJA 3WFQE 3EYZA 1TVAA 4RQ0A 2AGQA 3H3AA 4KN7A 1ZQHA 2NRZA 8ICJA 3C1ZA 4O3NA 3RH6A 2J6SA 1OU5A 4FHYA 4F3OA 3K75D 1ZQBA 5KFMA 5KG0A 2XCAA 3HX0A 4AT9A 1K1QA 5KFIA 4F50A 4ECRA 5KT3A 4RQ5A 5DG9A 2W9MA 4ECUA 3K4GA 4F5RA 2BCRA 3JPPA 1ZQAA 5KFWA 3Q8RB 9ICUA 4IQTA 2BQRA 9ICXA 3H39A 4UD4A 4YD2A 1DGSA 1XSNA 1UA0A 2FMQA 4MF2A 3UQ0A 1NK5A 4RT3A 4B9TA 4QW9A 1R8AA 4I2DA 4DSJA 4R8UA 4B9VA 3UXPA 3LWMA 5IIKA 2R8KA 8ICAA 3PW4A 4RWPA 4EZ9A 5DDMA 4F5NA 2BCSA 1DK3A 3ORYA 5KFLA 3PO4A 1S0NA 3OJSA 4DL5A 5D46A 4UB2A 9ICNA 2ZH1A 2ZH5A 7ICLA 2B21A 3H7IA 4DOCA 2VA8A 3AU6A 4IRKA 8ICHA 4QWAA 4YN4A 3RJKA 2UVRA 4AT9B 2C2EA 4QZ8A 4IRCA 4AT7A 4FHVA 4X5VA 1BPDA 3ISDA 3JPNA 2AJQA 4J9SA 1NK0A 3RB4A 1T7PA 3C18A 2F1HA 1B43A 3C5FA 2ATLA 3M9OB 4X0BA 3OVBA 5KFUA 1NK7A 2BPCA 4QWCA 2AQ4A 2IA6A 2HVIA 4WC4A 2ZH2A 3RJGA 4KTQA 1XU4A 4RT2A 5CP2A 1Y88A 3TFSA 3RH5A 4QWBA 1U45A 1S77D 9ICWA 7ICIA 8ICRA 5J2FA 5KG7A 5HNKA 3LWLA 4LZDA 2ISPA 3HWTA 4NLKA 2IHMA 1NK8A 3QZ8A 4R8UB 4C8OA 2ID1A 4XQ7A 3MFIA 4GC6A 2FPLA 3T5JA 3ZDBA 2KFZA 3RB6A 3V72A 3H37A 2I9GA 3BQTA 2BPFA 4IQVA 1KTQA 4Z6FA 8ICNA 3MDAA 1ZQDA 1UEUA 2HHPA 1U4BA 4F4XA 3RRHA 3MGIA 4Q43A 4DSKA 3OVSA 4F5PA 4QZGA 3AQNA 4ECYA 4RQ2A 4PHPA 5KT4A 5HRFA 8ICEA 2DR7A 4O5CA 2P66A 5HMLA 3MR3A 4LVSA 4AT7B 4RQ7A 4P4PA 3GIJA 5KG2A 3BQ1A 2AGOA 4YG2A 4XQ8A 5CA7A 4YVZA 1ZQXA 5DG7A 2HHSA 4UB3A 4NY8A 1KSPA 1TKDA 2M2UA 1C7YA 1L3TA 2HHTA 3KHRA 4M0AA 2NRKA 1KFDA 3AQLA 5KT6A 2DR5A 2DRBA 4M9NA 2ASLA 2FPKA 1ZQPA
chains in the Genus database with same CATH superfamily
4RWNA 4MFAA 2I6XA 4K9AA 4RUAA 5J8YA 4KLOA 5KFYA 9ICEA 3KZXA 3MGVA 2F1JA 4EEBA 4OAFA 3OSPA 3RAQA 1Q78A 2PXIA 3RAXA 4LZGA 3HJEA 4HYKA 3GQCA 1COOA 4P0PB 4F2RA 3H38A 1N2XA 4M9JA 4ECVA 2VANA 4FBUA 8ICPA 1KDHA 1ZQWA 4JLXA 2PI4A 2HBJA 1PK3A 1NO5A 4J9QA 4QNLA 2M2TA 5BOMA 3GIMA 4DWIA 4CF3A 2BZFA 1CRXA 3WKAA 4RUCA 1KEJA 1ZQNA 3IV6A 4I2IA 4JUZA 3NVYA 4X4TA 3Q8LA 3IM1A 3I76A 4F93B 2HOFA 2I1QA 1FEZA 5J2EA 1PVRA 1P7DA 2B4VA 4UBCA 1ZQOA 4O68A 1BNPA 4G3IA 3HPOA 2ZIWA 4QZAA 2Q4TA 9ICGA 2YN4A 1N48A 1MC8A 4IQWA 4M9LA 2W9BB 3IG5A 5EWEA 3DV9A 2D8CA 2GAFD 2PBEA 4P0QB 4DL4A 1F5AA 2ZHAA 7ICPA 4EEKA 1BPZA 1WYGA 2MUTB 4PGQA 4UB4A 4EBCA 2MU2A 2QB0B 3EPGA 1LB2B 4O67A 5AM1A 2ZJ5A 2ASJA 5CHGA 4KM5A 4YXJA 1V9PA 2HI0A 5KFZA 5DB8A 3V7JA 4K9BA 4IL6U 4UB5A 8ICWA 5G5HA 2KG5A 4CF4A 5KT5A 1S0VA 4X4PA 2W11A 2YY6A 3E2EA 2ZUCA 3WKEA 2DGZA 2BE3A 2BDUA 1FIQA 3LVWA 1UT8A 4ELTA 4UASA 3PNCA 4WH5A 2BKEA 2XGPA 7ICOA 1D8BA 3TQ1A 4BGDA 4MKPA 3PV8A 4FE3A 3SENA 1D9FA 1YZ6A 4P4MA 2K4EA 2UVVA 3BQ0A 4JWNA 3F5AA 1XNSA 4RQ6A 5AKEA 2K60A 4M9GA 5ALHA 1AROP 2KZMA 5KTQA 4UD5A 3OUYA 3RJJA 3A0HU 1ZETA 3WFRE 5HRGA 4CF5A 4PGYA 2H3VA 3PX0A 5L1MA 3NWIA 4Y2RA 4Q8EA 1RYUA 1X9XA 2BBHA 7ICFA 1XO0A 4M5DA 7ICGA 3PW5A 5KG3A 5KFCA 2PKEA 1M6YA 3KFUF 1HEKA 2LPEA 3LVVA 3R9KA 4QZHA 1T4GA 4YCXA 1RG6A 1S8OA 4DOAA 2W8KA 1PX5A 3UPQA 2YMMA 4ELUA 1L3UA 3C2KA 5BOLA 2UVUA 4ZOHC 4OJPA 5F3XB 4EBJA 3UQ2A 2P35A 5KFEA 4DO9A 2KZZA 3Q8SB 1IV8A 4IR1A 2D6FC 2HBMA 4O3OA 1ZJMA 4NLGA 3RJHA 2ZUDA 1X9MA 5AKHA 2HVHA 5B3QA 4NLZA 4CDGA 5AHXA 3CRXA 1C20A 1WUDA 5IINA 5DB6A 2OYYA 5HRKA 2MSNA 2HHVA 4DL2A 2LBOA 5KT2A 1JXLA 4F91B 1ZQLA 3NYBA 3JPTA 1JROA 2W3RA 1ZRMA 2JZBA 3F2BA 4YXMA 3WFSC 1V97A 2OXOA 4AT8B 4NXUA 5IILA 2AHOB 5EWFA 2DKZA 4EYHB 1RYRA 2KKVA 4IC9A 2W8LA 4X4OA 4YMOA 1KNYA 4YR3A 4O5KA 4DCCA 3B9JA 1JAJA 4O3QA 1QSYA 4HAIA 2FLPA 8ICUA 3GV7B 2A1AA 4FBTA 5AKGA 2FPMA 2KSOA 4GLXA 1RXVA 4NXVA 3C1YA 2M2VA 4NKTA 5KFOA 3T79A 1COKA 1RQNA 4NXZA 4ECQA 2A1JA 3JPSA 2HHWA 2ZH9A 4ED1A 5DKWA 2XIDA 4BXOA 3SAFA 4CGZA 2GLEA 3UPSA 2XY5A 2H3QA 3C5GA 1ZQQA 2BR0A 4X4QA 3V6KA 3NRZA 3N97B 2W55A 2K89A 1BPBA 4OJLA 1ZQUA 1N56A 2DL0A 5DB9A 1YT3A 3RB0A 3BJYA 1YLQA 5DGBA 1OXJA 3ED5A 2JGAA 1SV0C 3D6JA 9ICAA 3Q8PB 2ES6A 5HRBA 4F2SA 4DSLA 1A77A 3A0BU 1TFRA 5DGAA 4M04A 4K97A 4FO1A 2R8JA 4WC7A 3OSNA 1L8OA 3KZIU 2ZH3A 4RPZA 1DXSA 3AU2A 2CN1A 1RZTA 4J9OA 4I2GA 5EE9A 2B56A 1RM6C 4ATBB 5KG4A 2YMQA 1TK8A 3ONNA 4EYIB 1F44A 4KITB 2ZJ8A 4O6AA 2DFLA 3NVWA 4E8FA 2FE9A 1FFVA 1PK1A 3QNMA 2DBYA 5J0QA 3C66A 2EAMA 5F9NA 2PMZC 2RLTA 1KLNA 2G5HB 2G06A 5J0RA 4OAHA 4C4RA 4UBBA 3SV3A 4J9KA 2CXYA 5AIBA 1TVAA 1ZQHA 2NRZA 8ICJA 1QQ7A 3IDWA 2ZIVA 5KFMA 4AT9A 2EAOA 4ECRA 4OAIZ 1B4FA 4PZNA 1UPHA 4RQNA 5DG9A 5G5GA 2BCRA 1S5LU 3JPPA 9ICUA 4LEZA 9ICXA 1DGSA 1XSNA 2FMQA 1NK5A 3E58A 4RT3A 4XJEA 2KJ8A 4I2DA 4R8UA 3DDHA 3UXPA 2EQYA 3LWMA 5IIKA 1UQVA 2BCSA 5KFLA 3HILA 1SGGA 4DL5A 2K8BB 5D46A 4UB2A 1FFUA 2KIVA 4DOCA 3AU6A 2VA8A 8ICHA 1SXDA 4FHVA 4J9SA 1B43A 5J8YC 4X0BA 3OVBA 5KFUA 2BPCA 2HVIA 2IA6A 4WC4A 2ZH2A 1XU4A 3QU4A 5CP2A 5B5EU 2EH9A 4QWBA 3LWLA 2ISPA 1NK8A 2EWRA 3V72A 3BQTA 2HN1A 3MDAA 1UEUA 4GIBA 4F4XA 3MGIA 2PMZF 3RRHA 5AI6A 4F5PA 4ECYA 4PHPA 5HRFA 8ICEA 2P66A 3MR3A 5ALKA 4LVSA 4AT7B 3BQ1A 2AGOA 4UB3A 2ZXIA 1C7YA 1L3TA 4RQMA 2WFAA 3AL0B 5ALXA 1KFDA 2EZXA 3AQLA 4M9NA 2ASLA 2ODGA 2ZXHA 2FPKA 5AICA 2ZJAA 1ZQYA 2D3DA 3B0XA 8ICTA 1K1SA 3MR2A 1LKYA 4F92B 3WKBA 4B9UA 4EEDA 1A6SA 2Q0ZX 2QARB 1N62A 3M8RA 3NRWA 2G0AA 5CWRA 2HDOA 2KFNA 4C8LA 4EENA 4KLHA 4WOYA 2RDIA 4Y2VA 3RR7A 4YQWA 3WK4A 3WU2U 1ZQRA 3SQIA 3JZ0A 4O3PA 5KL8B 1VLBA 1MA7A 8ICLA 3NGDA 8ICYA 1VFGA 1N5XA 1SV0A 4PJ0U 2M0NA 1UEVA 3OV7A 3JPQA 5KFFA 4EBEA 3CW2C 4WC3A 2B6GA 5F9LA 4US8A 2DRAA 3KBBA 4OAGA 4DL3A 4EZ6A 5DBAA 2JMGA 5ALTA 7ICSA 4X4VA 3L4PA 8ICIA 4CE6A 3NS1A 4F4ZA 2YTUA 4ED8A 1RQLA 5KFXA 3PSFA 2GWSA 4I2BA 5C0YA 5AI0A 4DS4A 3AQKA 2NYVA 3RBEA 4LEVA 2IHNA 3T5HA 1JXEA 4X0AA 4TUPA 4DS5A 2AXTU 1MIYA 2HCFA 3G6VA 2G5IB 3B0YA 2PFPA 5HREA 4Y2TA 2BCUA 5J29A 1V4AA 4NXXA 4BDPA 4IR9A 1ZQVA 8ICGA 3PW7A 8ICMA 2F1IA 4NXTA 3H0LB 4DQSA 4IRDA 4FS1A 4OD0A 2FJ6A 2LM1A 5J0SA 5D4BA 3QE9Y 4C80A 5CB1A 5J2IA 1XO1A 2ZTDA 5AKLA 3EW9A 5AM0A 4KMOB 3V6JA 1MQ3A 4QWEA 1PUZA 5HRHA 2FDRA 1K5OA 3ETLA 2LMRA 1BNOA 3AUOA 2E8NA 5ALQA 2JH7A 5DQIA 5B3PA 3S6JA 4WBZA 2W9CA 3PW0A 3JCFA 4O0IA 2O5AA 2E8PA 1O03A 2HN2A 1X9SA 3WFOA 4QIWC 1LV5A 1Q8KA 4WCWA 3V7KA 2B51A 1U47A 3GV5B 3ISBA 4R63A 2LYHA 4KLMA 4O5EA 1WCLA 4NV0A 5J0OA 2JEJA 3FAHA 3MFHA 2HMXA 4RU9A 4I27A 1Q79A 9ICCA 4C4SA 5T14A 4F4WA 3BZKA 3T5LA 5HHHA 1ZQEA 4UARA 3SMVA 4EBDA 1SL1A 1UHUA 4GXKA 4M6WA 4YR2A 3NKUA 4ECTA 3N4MB 3IRUA 3PX4A 3RBDA 2PFOA 2GO7A 2E1EA 4LT6A 1HIWA 4B9SA 3RFAA 2LI6A 3C21A 3NTUA 1X6JA 4RQ4A 2RFFA 5KT7A 4KLSA 4Z6DA 4ACOA 4WC1A 3F53A 4YD1A 1CUKA 4YR0A 4F5OA 3V6HA 4EP7A 2L5YA 4ED6A 4RWOA 4MEXA 1L3SA 4DEZA 4KLTA 8ICKA 2GH1A 2YB1A 5D63A 4Y2PA 1X66A 2PI5A 4BWMA 2M2WA 2BCVA 5CEHA 2BQ3A 2N1RA 4MFCA 1QTMA 5KG1A 3PO5A 4KLQA 4QIWF 3HJ1A 3AQFA 3QYPA 4UB8U 5J0TA 1RXWA 2R8GA 5J0YA 3IG8A 2KEYA 4QZEA 3M8SA 4DL7A 3PSIA 4KLIA 2ZH6A 2W7OA 2ZH8A 1LVHA 4I0UA 5ALFA 2LYAA 1KW4A 1F0MA 5AKYA 2GOLA 5KFHA 4ED3A 2ESEA 2BBJA 2NV3A 5L1LA 3H4BA 4EGWA 3ER9B 3PMLA 2ZH7A 3I28A 1ZOLA 2VJ4A 4PH5A 2Y1JA 5AKIA 2J6TA 1ZD3A 1FO4A 2IBKA 7ICJA 4X4NA 1Z4OA 8ICOA 2YQEA 2ZIUA 5HRLA 3KD3A 4UW9A 2W7PA 4ED0A 2ZH4A 4EELA 3OJUA 2FMPA 5J0UA 4RNMA 2XC9A 1Z00B 2MAXA 4M47A 5KFJA 4WBYA 2F8KA 2DVIA 1NJYA 1SKRA 1ZD5A 5KFKA 3AN1A 1L7PA 2F44A 4K8VA 4WC0A 4Z6CA 7ICUA 4JK1A 2XY7A 3PX6A 3N7RC 5KFVA 2ZTEA 3K1ZA 5AK5A 1MN8A 1SZPA 1NK6A 3FYHA 1IIPA 5AKXA 4O3MA 2HSZA 2WF8A 3N7SC 5HC9A 1ED1A 1QLNA 1NOMA 2ZIXB 4AYBC 3M7DA 3CK6A 3SYZA 5CRXA 4KLGA 2XCPA 1ZQJA 3GFKB 1J2NA 1ZQCA 4MEYA 4Y2SA 1Z4NA 3OVAA 4K4IA 1SL0A 1PZNA 5ALNA 3C23A 5D61A 1SL2A 3HKZC 5HMMA 1KRPA 3WKDA 3C1ZA 3RH6A 5ALWA 3K75D 3HX0A 5KG0A 2XCAA 3LYSA 5KFIA 4UATA 1J2MA 5ALEA 4ECUA 2IHOA 3K4GA 1ZQAA 3Q8RB 5ALYA 1L8LA 2HOQA 2BQRA 4GFJA 4MF2A 1X6IA 4QW9A 4B9VA 4RWPA 5DDMA 4F5NA 1DK3A 3ORYA 3KKAA 3OJSA 3I1YA 9ICNA 3M6KA 3HRDD 4IRKA 4QWAA 4X5VA 3C29A 2F3NA 1BPDA 3ISDA 2XVTA 5EE1A 1T7PA 2KHQA 3M9OB 1L7NA 4RT2A 3BS5B 1UCVA 3TFSA 1S77D 3RH5A 1U45A 1TE2A 5HNKA 4NLKA 4AYBF 2OCEA 2Y9UA 4C8OA 3MFIA 4XQ7A 4GC6A 2FPLA 2WAQC 2K8AA 1GPJA 2F77X 4IQVA 4Z6FA 1ZQDA 1U4BA 2FI1A 5KAIU 4QZGA 1NZBA 3AQNA 4Y2YA 5KT4A 2KD1A 4N7RA 5HMLA 3HKZF 4RQ7A 3GIJA 5KG2A 4YG2A 4JLZA 2K4IA 2WF6A 4NY8A 2M2UA 4P0PA 5ALPA 4WQLA 1L7OA 5AKKA 2HHTA 3KHRA 4M0AA 5EE0A 5KT6A 2DR5A 3SAHA 4E80A 9ICOA 3ZD9A 1OW5A 5KNIA 2PFQA 4PHDA 3PSPA 4YP3A 1X9WA 4F4KA 1XC9A 5ALDA 1ZQFA 2G09A 2YX8A 4DLGA 1QSLA 5GTHU 9ICMA 2W3SA 4DL6A 1X2IA 2VA3A 4K4GA 1BPYA 1RPLA 1R8BA 2FCLA 2IOFK 2AQ0A 3FDSA 5AKZA 1UA1A 4J9RA 1VDVA 4DQQA 3KTQA 2W9BA 2BQUA 4QZCA 4QZFA 1B22A 3G6YA 4MF8A 4EV6A 3FM9A 2WAQF 2FLNA 2DPJA 4QZBA 4EEYA 1JX4A 4P0QA 1QQ6A 2JEGA 4E0DA 3BQ7A 3TARA 3GILA 2MUTA 1TK0A 1N60A 3ISCA 4JWMA 2QB0A 4A8EA 3HT3A 4RQ3A 1ZQMA 4QZDA 4NLNA 1NJZA 7ICQA 8ICVA 2EAPA 4C8NA 5DLFA 4X4RA 3D2NA 5ALRA 2BCQA 4NM2A 3GIIA 5CJ7A 4S3NA 2WB1C 1U49A 1L5UA 2W43A 2DPIA 5TZVA 5HP4A 3NVVA 2KVSA 1SWWA 5DEDA 1NK4A 1TFYA 3TFRA 4KLFA 1NK9A 4GC7A 4Q45A 2V9WA 2NRWA 2XI9A 3H4DA 2JRZA 4BUGA 4QW8A 2ZIWB 1KBUA 2E1FA 2QLTA 1SWVA 5AKJA 4DFPA 1IM4A 5J2GA 1L3VA 4U7CA 3BDPA 2DWQA 4YMMA 5B66U 1OUQA 4OJ6A 4O69A 4UAWA 4WC2A 4FS2A 1MIVA 4UAZA 4RPYA 2KZ3A 5JU5A 5KFRA 8ICBA 3ZDCA 5JUMA 3IHQB 5J2HA 4B6JA 9ICFA 4UQGA 3ALRA 5KL1B 4CCHA 4O9MA 5F2VO 4FH5A 3VCBA 2EDUA 3UMCA 2JXJA 3U26A 5J2CA 5TISU 3OWGA 4WC6A 9ICVA 3OGUA 3CNHA 3RJFA 1D8LA 4FZMA 1S0MA 5KG6A 2W54A 4NM1A 2LYBA 5AI5A 3BS7A 4MHVA 2JHDA 5DB7A 4E7XA 4C7ZA 1U9LA 5DDYA 4FFDA 4I2AA 4QWDA 1BGXT 2WB1F 3H0MB 3TKAA 1S0OA 3HW8A 3CP8A 4FZLA 2KICA 1PVQA 4XRHA 3M9MB 3SZ2A 9ICPA 4R65A 4B9NA 3QU2A 3DEEA 4I2JA 4YFKA 4WQKA 4KLJA 5C5JA 4J9LA 4NLCA 4KLDA 1QCKA 2DR8A 3OUYB 3Q8KA 1IXRA 4IG8A 2K4HA 5AI9A 5KFTA 9ICLA 4X4SA 5K4LA 3C2LA 1FA0A 3RJIA 3QEAZ 5J0XA 2KJ5A 3TANA 2DF4B 7ICRA 2RP5A 2KNJA 3KHLA 1MQ2A 2P6RA 2QB1A 4KX5A 4UAUA 4AT8A 3V7LA 2AGPA 5L1IA 4ED2A 4P2HA 4NXWA 3TADA 5KG5A 2AH5A 4I29A 3UMBA 2FLLA 4WC5A 3H8SA 2G07A 2WF7A 3EPIA 2KP7A 2A3VA 1S76D 3EUB2 1MIWA 2LHTA 4LEYA 4QZ9A 2LM4A 4KN4A 3Q8MA 4KLLA 3WK7A 5CFUA 3PW2A 4O3SA 7ICEA 1NKEA 4UAVA 3QX7A 1BPXA 4ECWA 4JV2A 1DK2A 5IIOA 4I2CA 3HIYA 1ZQ1C 9ICKA 1J97A 2KN7A 2BGWA 2DR9A 4I2FA 1ZQZA 4GXIA 4ECZA 1JRPA 4DSEA 2VA2A 2Y1IA 4TUQA 5KFAA 1ZD4A 2NRXA 4M9HA 5J2JA 4KX3A 5L1JA 1D9DA 1ZQSA 2JZBB 4RPXA 5DG8A 4NWIA 4QZIA 2HW3A 5ALSA 5KFDA 1SZHA 4DF8A 2W04A 4PL2A 4DFMA 5L1KA 5JTIA 1NZPA 2WTFA 5EE3A 3RR8A 3K1RB 3ZD8A 1XSLA 4OO1J 2VIXA 2KSOB 1S10A 1UT5A 2KKPA 3T5KA 4NL9A 5AK3A 3EZ5A 5KFPA 1NI3A 2E3TA 3THVA 3PSTA 3MDCA 4C8MA 2A1JB 4J03A 4C8KA 3NUQA 4JMUA 3MC1A 4XA5A 4ATBA 1Z1VA 5J2BA 4F4YA 4BXOB 2YMPA 2BPGA 3EWAA 3M6ZA 1AQ6A 4R66A 2JV3A 2F8LA 2M9NA 1DOQA 4EBKA 2I5HA 4JV1A 2XGQA 1BPEA 4G9BA 1KKXA 1JQRA 4O3RA 1IG6A 2FMSA 2ISOA 2Y9TA 1WCNA 4DOBA 3MCRA 3K7DA 3IP4B 3QEBZ 7ICNA 1DRGA 2XICA 3M9NB 5IIIA 3OHAA 1JIHA 2XY6A 5DQGA 3QU9A 4I2EA 7ICMA 3QUCA 3LQCB 5ALVA 2ZTCA 1Z19A 2E8OA 3SR6A 4RQ1A 5E79U 4DFKA 2IUBA 3KKAC 8ICCA 2DUYA 3SI8A 3HP6A 3RJEA 4DSFA 5JRTA 4B9MA 2O1PA 4CRXA 1SKSA 4GXJA 3WK9A 1N61A 3EYZA 4RQ0A 2AGQA 3H3AA 2WHEA 4O3NA 4F3OA 4Y2XA 1CI4A 4F50A 2R18A 5AM4A 5KT3A 4RQ5A 4PL1A 3OPXA 1PK1B 1ZD2P 3H39A 4OJOA 4YD2A 4Y2JA 5A0LA 5AIAA 4JB3A 8ICAA 4F72A 4CNQA 4OCZA 5AM2A 2ZH1A 3M1YA 2NO4A 3L5KA 2B21A 2ZIVB 4AT9B 2QKQA 4QZ8A 4AT7A 2AJQA 3C18A 3RB4A 2K8CB 4BX9C 2F1HA 3C5FA 1KQQA 2HOIA 4QWCA 2AQ4A 4C0ZA 3RJGA 2Y0SC 8ICRA 5J2FA 5KG7A 1SB3C 4R8UB 1WG8A 2ID1A 3EF2A 2VJ5A 3T5JA 2H3ZA 3E0FA 3RB6A 3H37A 2BPFA 5AK4A 3D2SA 1KTQA 1X42A 8ICNA 2HHPA 1DGJA 3RF9A 3OVSA 3F2CA 4O5CA 3CYMA 1ZXIA 2QARA 1TAMA 2HHSA 1ZQXA 2KMDA 5DG7A 1TKDA 2K4PA 3QUQA 4F71A 3AM9A 1Z1BA 2DRBA 1KN5A 4MFFA 3PR4A 3HJ4A 5DBBA 5HRIA 4AP9A 3JPRA 4KB6A 3LDAA 1H38A 9ICQA 2JH1A 4FZNA 3BZCA 4DFJA 2ZHBA 1HUOA 1NJWA 5ALOA 5J0PA 2HHXA 1MSWD 1S97A 4YMNA 2DKXA 8ICFA 3TAPA 2CRXA 2KTQA 5FP0A 2MA1A 4BWJA 9ICBA 4XUSA 3RH4A 4ED7A 4DLEA 7ICHA 2YB4A 1ZQTA 2H5XA 4J9NA 2HBKA 5KFNA 4BJQA 2Y0SF 1LKYB 5H2FU 4U6PA 2RRDA 4EX6A 3C28A 4K98A 5ALLA 2KE7A 3D2QA 3J81j 3GDXA 2OHFA 5JTGA 5HRDA 1XWLA 1TAQA 3WK6A 4K96A 4DFDA 3PMNA 3ER8C 2HBLA 1R89A 3PR5B 2XO7A 4Z6EA 3MABA 3OTQA 3KHHA 1KL9A 3MR6A 4TUSA 3AQMA 3SAGA 2NRTA 1T94A 2R8HA 2GA9D 5AI4A 5AM3A 5ALMA 5AI8A 2R8IA 4US9A 2CPRA 1JN3A 1WWVA 3H40A 4FHXA 3BQ2A 2KIWA 3AQEA 4J9PA 1Q3UA 3C2MA 4I28A 5D49A 2JEIA 9ICSA 3WK8A 5J2KA 3GIKA 3TI0A 5DQHA 2C2DA 1ZRNA 1NKCA 3MGHA 9ICHA 1A0PA 4EX7A 4LEWA 4C4TA 2OWOA 4R64A 1JUDA 2KVCA 5IIJA 3ZI4A 1Q46A 3QZ7A 5CFSA 1TAUA 2BHNA 2ZUBA 1XSPA 2MRLA 3QU5A 5EWGA 4IQUA 4I2HA 4DSIA 9ICTA 3UMGA 3OHBA 3QUBA 7ICTA 3SEIA 7ICVA 1O08A 4Y2UA 4UB1A 2NO5A 3ERCC 2ALZA 3UXNA 2RHFA 1HUZA 2A19A 4UAYA 2P6UA 3JYYA 4RNOA 4P4OA 1Q3VA 3Q8QB 4ECSA 8ICSA 5J2DA 5HR9A 5DBCA 4F5QA 3RTVA 2OH2A 3MR5A 8ICXA 3TADC 2HHQA 4JV0A 4PZOA 2V4QA 3ZDAA 3QXGA 2RDJA 4J9MA 1F5SA 2C22A 2ZG6A 4ELVA 5L9XA 2W9AA 4KLUA 4F8RA 4PHEA 2HHUA 3ICXA 2OEHA 1SIJA 1SV4A 4Q8FA 1KFSA 2RQ5A 2O6KA 4ICAA 4C7YA 2KOBA 1R8CA 2EZYA 2W9CB 5HR7A 3RB3A 2WF9A 3H8MA 2EZZA 1N63A 3O0FA 1A76A 2JEFA 5KFBA 4UB6U 2VKQA 5KFSA 3IN5A 5KFGA 3L9DA 2OM6A 2E5SA 5DLGA 4ZH4A 5ALIA 3TAQA 3NASA 2JR5A 1QSSA 4KLEA 2YMLA 3NVOA 4TURA 5AM5A 5CR0A 2ASDA 4K4HA 4FO6A 4NJ8A 2V4RA 1YZ7A 1SKWA 3ZDDA 5ALGA 1XS9D 1EXNA 2PFNA 3H8JA 2C28A 2BDPA 1T3QA 1CEZA 4M6WB 3WFPA 3PVXA 1ZJNA 5J0WA 4LJXA 1D8YA 1S9FA 1ZQGA 1QH9A 3SV4A 3ZDEA 4NL9C 1JI7A 4DQPA 3FC4A 5HHIA 4RZRA 2UVWA 2F2AB 2WF5A 4KMUA 1B0XA 4RQ8A 5EOZA 4TQSA 1NJXA 3WKCA 4DQIA 3F5EA 5IIMA 3GV8B 3PHZA 4FH3A 4RWQA 8ICQA 1Z00A 3LK9A 4FHPA 4DQRA 5DECA 9ICRA 1WWUA 2IMWP 4X4UA 2IOHA 1ZQKA 4TQRA 5KAFU 3F2DA 3QUTA 4DF4A 4B9LA 1Z3EB 4ECXA 3RRGA 2Z7JA 1TV9A 2C2RA 2NRVA 3H8WA 1U48A 8ICZA 4K99A 5ALZA 3G6XA 1VJ7A 2KK0A 4NKUA 2ZIXA 3WK5A 4OJ5A 1KFTA 4PHAA 1BVSA 4PPXA 5CHEA 4PGXA 3QU7A 1T8EA 9ICJA 4RNNA 2ZIUB 1L7MA 1ZQIA 5HR6A 1JMSA 1UETA 1QQ5A 1TK5A 1URJA 4FHWA 1NKBA 9ICIA 7ICKA 3PZPA 4Q44A 3KHGA 3PY8A 3TACB 3VC8A 1RYSA 1GO3F 3AEVA 2Q66A 3MBYA 1V85A 2DQNB 2J6UA 5BPCA 5ALJA 5KFQA 1WOTA 3JPOA 3T3FA 3SD7A 2AU0A 3AMZA 3H0RB 4M2YA 1TFWA 4WJ3B 1ZYQA 5J2AA 1X40A 3UXOA 4Y2QA 1HJPA 2LKYA 2KJ9A 3WFQE 4KN7A 1OU5A 1VJ5A 2J6SA 4FHYA 1PVPA 1ZQBA 5CFTA 1K1QA 2H3FA 5GTIU 3N7PD 4USAA 2W9MA 2IOFA 4F5RA 4NLBA 5KFWA 1L6NA 2H3IA 4IQTA 2KHVA 3BS5A 4UD4A 2F76X 1UA0A 1SXEA 3NVZA 3UQ0A 3UM9A 2B0CA 4B9TA 3ETRA 1R8AA 4DSJA 3KOOA 2R8KA 3PW4A 4EZ9A 3GZFA 3PO4A 1S0NA 5AK6A 2ZH5A 2W03A 7ICLA 3H7IA 3RJKA 4YN4A 2UVRA 2C2EA 4IRCA 3JPNA 1NK0A 2ATLA 1N5WA 1NK7A 1JALA 2EANA 4KTQA 5D62A 1Y88A 9ICWA 7ICIA 3L3FX 4LZDA 3HWTA 2IHMA 3QZ8A 2E8MA 3ZDBA 2KFZA 2I9GA 4DSKA 4Q43A 4RQ2A 4HX0A 2DR7A 2G08A 4IS7A 4P4PA 4QJFB 5CA7A 4XQ8A 3N28A 4YVZA 1KSPA 1ECWA 2KV2A 1RDFA 1V38A 2NRKA 3GU3A 1NNLA 1T3NA 5ALUA 1ZQPA
chains in the Genus database with same CATH topology
2ZJAA 1ZQYA 4MFAA 3PR4A 4MFFA 5DBBA 3HJ4A 5HRIA 4E80A 4RUAA 3JPRA 3ZD9A 9ICOA 4KLOA 3LDAA 3B0XA 2PFQA 8ICTA 4PHDA 5KFYA 1H38A 9ICQA 1K1SA 4YP3A 9ICEA 1X9WA 3MR2A 4F4KA 4F92B 1XC9A 4DFJA 2F1JA 4B9UA 2ZHBA 1HUOA 3OSPA 3RAQA 1NJWA 2PXIA 1ZQFA 1Q78A 4DLGA 5J0PA 2Q0ZX 1QSLA 2HHXA 3RAXA 4LZGA 1MSWD 1S97A 4YMNA 4HYKA 3M8RA 3GQCA 8ICFA 1COOA 9ICMA 5CWRA 3TAPA 4F2RA 4DL6A 1X2IA 2VA3A 3H38A 2KTQA 4K4GA 1BPYA 2KFNA 1RPLA 4C8LA 4M9JA 4KLHA 1R8BA 4ECVA 2VANA 4FBUA 2AQ0A 8ICPA 4BWJA 2RDIA 9ICBA 3FDSA 1KDHA 4XUSA 3RH4A 3RR7A 4YQWA 1ZQWA 4DLEA 4ED7A 1UA1A 1ZQRA 2PI4A 7ICHA 1ZQTA 3JZ0A 1NO5A 4O3PA 4J9QA 4J9RA 2M2TA 5BOMA 3GIMA 2H5XA 4J9NA 4DWIA 8ICLA 3NGDA 5KFNA 4DQQA 8ICYA 1VFGA 3KTQA 4RUCA 1KEJA 2W9BA 2BQUA 1ZQNA 4QZCA 4QZFA 4I2IA 1B22A 1UEVA 3G6YA 4MF8A 3GDXA 3OV7A 4JUZA 3JPQA 4X4TA 2FLNA 2DPJA 4QZBA 4EEYA 3Q8LA 1JX4A 5KFFA 3IM1A 4EBEA 2JEGA 4E0DA 3TARA 5HRDA 4F93B 3GILA 2MUTA 1XWLA 1TK0A 4WC3A 1TAQA 2I1QA 5J2EA 3ISCA 4JWMA 4UBCA 5F9LA 1ZQOA 3PMNA 2DRAA 3HT3A 1R89A 1BNPA 4G3IA 3PR5B 2XO7A 3HIYA 4RQ3A 4Z6EA 3HPOA 4DL3A 1ZQMA 3MABA 5DBAA 4EZ6A 7ICSA 4QZDA 4QZAA 3KHHA 4NLNA 4X4VA 1NJZA 7ICQA 3MR6A 4TUSA 8ICIA 4F4ZA 8ICVA 3AQMA 9ICGA 2NRTA 4ED8A 4C8NA 2R8HA 5KFXA 5DLFA 1N48A 2GWSA 4X4RA 1MC8A 4IQWA 4M9LA 2W9BB 2R8IA 5EWEA 2BCQA 4NM2A 4I2BA 3GIIA 5CJ7A 4DS4A 3AQKA 1L5UA 1U49A 3RBEA 2DPIA 4S3NA 1JN3A 2PBEA 5TZVA 5HP4A 2IHNA 3T5HA 4DL4A 1JXEA 1F5AA 4TUPA 4X0AA 3H40A 4DS5A 7ICPA 4FHXA 5DEDA 1NK4A 1BPZA 1MIYA 2MUTB 3BQ2A 1TFYA 4PGQA 3TFRA 3G6VA 4KLFA 1NK9A 4GC7A 4Q45A 4UB4A 2NRWA 3B0YA 4J9PA 4EBCA 2V9WA 1LB2B 3H4DA 3EPGA 3C2MA 2PFPA 4I28A 5HREA 5D49A 2JEIA 2ZJ5A 2ASJA 4QW8A 5CHGA 9ICSA 4YXJA 1V9PA 2BCUA 5DB8A 5KFZA 5J29A 1V4AA 5J2KA 3GIKA 4DFPA 3TI0A 1IM4A 5J2GA 3V7JA 1L3VA 3BDPA 4UB5A 5DQHA 2C2DA 1T3NA 4BDPA 1NKCA 8ICWA 4YMMA 3MGHA 4IR9A 9ICHA 1ZQVA 8ICGA 3PW7A 5KT5A 2F1IA 1S0VA 8ICMA 4X4PA 4UAWA 4WC2A 4FS2A 3E2EA 1MIVA 2ZUCA 4RPYA 4UAZA 2BE3A 2KZ3A 2OWOA 4R64A 5KFRA 1UT8A 4DQSA 5IIJA 4ELTA 4IRDA 3PNCA 3QZ7A 4FS1A 8ICBA 2BKEA 3ZDCA 2XGPA 7ICOA 3TQ1A 4BGDA 5J0SA 8ICSA 5D4BA 5JUMA 3IHQB 5J2HA 3PV8A 3QE9Y 1D9FA 1TAUA 2BHNA 2ZUBA 5CB1A 4P4MA 5EWGA 5J2IA 4IQUA 1XSPA 2UVVA 3BQ0A 4I2HA 1XO1A 4UQGA 4DSIA 4JWNA 3OHBA 9ICFA 9ICTA 2ZTDA 1MQ3A 3EW9A 4CCHA 4O9MA 3V6JA 7ICTA 4QWEA 7ICVA 4RQ6A 5F2VO 4FH5A 2DR8A 5HRHA 4UB1A 2ALZA 4M9GA 3ETLA 3UXNA 1AROP 2KZMA 5J2CA 1HUZA 5KTQA 1BNOA 3AUOA 4UAYA 4UD5A 4WC6A 5DQIA 3RJJA 9ICVA 1ZETA 2P6UA 3OUYA 3JYYA 3WFRE 3OGUA 5HRGA 4RNOA 4P4OA 3RJFA 4WBZA 3Q8QB 4ECSA 2W9CA 1D8LA 4PGYA 1S0MA 5KG6A 3PW0A 4NM1A 4O0IA 5J2DA 3PX0A 5DBCA 5HR9A 5DB7A 4F5QA 2O5AA 4E7XA 1U9LA 5DDYA 3RTVA 4Q8EA 4I2AA 4QWDA 1BGXT 3MR5A 7ICFA 8ICXA 1X9SA 1S0OA 4M5DA 3WFOA 3HW8A 7ICGA 2HHQA 4JV0A 3PW5A 1LV5A 2V4QA 3ZDAA 2RDJA 5KG3A 5KFCA 4J9MA 2C22A 4WCWA 4XRHA 3V7KA 3M9MB 3SZ2A 3GV5B 4QZHA 1U47A 4R65A 9ICPA 4ELVA 5L9XA 2W9AA 1T4GA 3ISBA 4YCXA 4I2JA 4YFKA 4B9NA 4KLUA 4F8RA 4PHEA 2HHUA 4KLJA 5C5JA 2W8KA 4DOAA 4R63A 4RWNA 4J9LA 4KLDA 2LYHA 1PX5A 3UPQA 4KLMA 4O5EA 1WCLA 3Q8KA 1IXRA 1KFSA 4ELUA 1L3UA 4Q8FA 5J0OA 2JEJA 3C2KA 4IG8A 5BOLA 2UVUA 1R8CA 2W9CB 3MFHA 4RU9A 3RB3A 4I27A 1Q79A 4EBJA 3UQ2A 5KFEA 9ICCA 5KFTA 9ICLA 4DO9A 4F4WA 2KZZA 3Q8SB 4X4SA 3T5LA 4IR1A 5HHHA 1ZQEA 1A76A 2JEFA 3C2LA 5KFBA 1FA0A 3OUYB 4O3OA 4EBDA 3RJIA 1ZJMA 3QEAZ 1SL1A 5J0XA 5KFSA 3TANA 4NLGA 5KFGA 7ICRA 3RJHA 3L9DA 3KHLA 4GXKA 4M6WA 2ZUDA 4YR2A 1X9MA 1MQ2A 2P6RA 2HVHA 4NLZA 2ZHAA 4ECTA 5DLGA 4ZH4A 3N4MB 3PX4A 3TAQA 3RBDA 2PFOA 4AT8A 3V7LA 1QSSA 5IINA 2AGPA 4KLEA 5L1IA 5DB6A 4LT6A 4ED2A 4P2HA 4B9SA 5KG5A 5HRKA 4I29A 4TURA 2HHVA 4DL2A 2FLLA 5CR0A 2ASDA 5KT2A 4K4HA 4WC5A 3C21A 3NTUA 4FO6A 4RQ4A 3H8SA 2RFFA 2V4RA 1JXLA 4F91B 5KT7A 4KLSA 1SKWA 4Z6DA 3EPIA 2KP7A 3ZDDA 1S76D 4WC1A 1ZQLA 3NYBA 1XS9D 1MIWA 1EXNA 2PFNA 3H8JA 3JPTA 2C28A 4QZ9A 2BDPA 4YD1A 1CUKA 4KN4A 4YR0A 4F5OA 3V6HA 3Q8MA 4KLLA 4EP7A 4ED6A 3PW2A 4MEXA 4O3SA 1CEZA 2JZBA 4RWOA 4YXMA 7ICEA 4M6WB 1L3SA 4DEZA 1NKEA 4KLTA 8ICKA 3WFPA 3PVXA 3WFSC 1ZJNA 1BPXA 5J0WA 4ECWA 4AT8B 4JV2A 2PI5A 1D8YA 5IIOA 1S9FA 1DK2A 1ZQGA 4I2CA 4BWMA 5IILA 2M2WA 5EWFA 2BQ3A 2BCVA 4MFCA 4EYHB 1QTMA 5KG1A 3SV4A 1RYRA 3PO5A 3ZDEA 4KLQA 3HJ1A 5J0TA 2W8LA 4YMOA 1RXWA 2R8GA 5J0YA 5HHIA 4DQPA 4YR3A 9ICKA 1KNYA 2KN7A 4O5KA 4RZRA 2UVWA 4QZEA 3M8SA 4DL7A 2BGWA 1JAJA 4O3QA 1QSYA 2FLPA 8ICUA 2DR9A 4KMUA 4KLIA 4I2FA 2ZH6A 1ZQZA 3GV7B 4GXIA 4ECZA 4RQ8A 4FBTA 2ZH8A 2FPMA 5EOZA 4GLXA 1RXVA 4TQSA 4DSEA 2VA2A 3C1YA 2Y1IA 2M2VA 4NKTA 5KFOA 4TUQA 5KFAA 1NJXA 2NRXA 4M9HA 5KFHA 5J2JA 4DQIA 4ED3A 5L1JA 4NXZA 5IIMA 3GV8B 1D9DA 4X4OA 4FH3A 1ZQSA 2JZBB 4RPXA 5DG8A 2A1JA 3JPSA 4ECQA 2HHWA 4RWQA 4QZIA 8ICQA 2ZH9A 5L1LA 1Z00A 3LK9A 5DKWA 3H4BA 4ED1A 2HW3A 4FHPA 4DQRA 5KFDA 9ICRA 5DECA 4DF8A 4BXOA 3PMLA 2IMWP 4DFMA 5L1KA 2ZH7A 4X4UA 3UPSA 2XY5A 1NZPA 2WTFA 4PH5A 4TQRA 1ZQKA 3RR8A 3C5GA 2Y1JA 2J6TA 1ZQQA 2BR0A 4DF4A 4X4QA 3ZD8A 1XSLA 2IBKA 7ICJA 4X4NA 8ICOA 4B9LA 1Z3EB 3V6KA 4ECXA 3N97B 3RRGA 1S10A 5HRLA 1TV9A 1UT5A 1BPBA 4ED0A 3T5KA 2NRVA 3H8WA 2C2RA 2ZH4A 1ZQUA 1U48A 3EZ5A 5KFPA 1N56A 8ICZA 5DB9A 3OJUA 3THVA 3MDCA 4C8MA 2A1JB 3RB0A 5J0UA 2FMPA 4RNMA 3BJYA 2XC9A 4C8KA 1YLQA 1Z00B 5DGBA 3G6XA 4XA5A 4ATBA 2MAXA 1VJ7A 4M47A 5J2BA 4F4YA 4BXOB 5KFJA 4NKUA 2BPGA 3EWAA 4WBYA 2DVIA 1NJYA 1KFTA 9ICAA 4PHAA 4R66A 3Q8PB 1SKRA 5KFKA 5HRBA 4F2SA 4DSLA 1BVSA 4PPXA 1A77A 4PGXA 2M9NA 1TFRA 5DGAA 4WC0A 4M04A 4Z6CA 1T8EA 4JK1A 2XY7A 7ICUA 1DOQA 2R8JA 9ICJA 3OSNA 4EBKA 4WC7A 4RNNA 4JV1A 3PX6A 2XGQA 1BPEA 1ZQIA 2ZH3A 1JMSA 1JQRA 5KFVA 2ZTEA 4O3RA 1UETA 4RPZA 1TK5A 2FMSA 1SZPA 4FHWA 3AU2A 2ISOA 1NKBA 1WCNA 4DOBA 1NK6A 3FYHA 3QEBZ 1RZTA 9ICIA 7ICKA 4Q44A 4J9OA 4I2GA 7ICNA 4ATBB 5KG4A 3M9NB 3KHGA 5IIIA 3PY8A 1TK8A 5HC9A 3OHAA 1RYSA 1JIHA 2XY6A 5DQGA 4I2EA 1NOMA 3MBYA 1QLNA 2Q66A 4EYIB 7ICMA 2J6UA 4KITB 2ZJ8A 3LQCB 5BPCA 2DFLA 2ZTCA 3SYZA 5KFQA 4RQ1A 2XCPA 1ZQJA 4KLGA 4E8FA 3GFKB 4DFKA 1WOTA 3JPOA 1ZQCA 8ICCA 4MEYA 5J0QA 3T3FA 3SI8A 2AU0A 3C66A 5F9NA 3OVAA 4M2YA 1TFWA 3HP6A 1ZYQA 3RJEA 1SL0A 5J2AA 4DSFA 1PZNA 4K4IA 1KLNA 3UXOA 5J0RA 3C23A 4UBBA 1SL2A 3SV3A 1HJPA 4B9MA 2O1PA 5HMMA 1SKSA 1KRPA 4J9KA 4GXJA 3WFQE 3EYZA 1TVAA 4RQ0A 2AGQA 3H3AA 4KN7A 1ZQHA 2NRZA 8ICJA 3C1ZA 4O3NA 3RH6A 2J6SA 1OU5A 4FHYA 4F3OA 3K75D 1ZQBA 5KFMA 5KG0A 2XCAA 3HX0A 4AT9A 1K1QA 5KFIA 4F50A 4ECRA 5KT3A 4RQ5A 5DG9A 2W9MA 4ECUA 3K4GA 4F5RA 2BCRA 3JPPA 1ZQAA 5KFWA 3Q8RB 9ICUA 4IQTA 2BQRA 9ICXA 3H39A 4UD4A 4YD2A 1DGSA 1XSNA 1UA0A 2FMQA 4MF2A 3UQ0A 1NK5A 4RT3A 4B9TA 4QW9A 1R8AA 4I2DA 4DSJA 4R8UA 4B9VA 3UXPA 3LWMA 5IIKA 2R8KA 8ICAA 3PW4A 4RWPA 4EZ9A 5DDMA 4F5NA 2BCSA 1DK3A 3ORYA 5KFLA 3PO4A 1S0NA 3OJSA 4DL5A 5D46A 4UB2A 9ICNA 2ZH1A 2ZH5A 7ICLA 2B21A 3H7IA 4DOCA 2VA8A 3AU6A 4IRKA 8ICHA 4QWAA 4YN4A 3RJKA 2UVRA 4AT9B 2C2EA 4QZ8A 4IRCA 4AT7A 4FHVA 4X5VA 1BPDA 3ISDA 3JPNA 2AJQA 4J9SA 1NK0A 3RB4A 1T7PA 3C18A 2F1HA 1B43A 3C5FA 2ATLA 3M9OB 4X0BA 3OVBA 5KFUA 1NK7A 2BPCA 4QWCA 2AQ4A 2IA6A 2HVIA 4WC4A 2ZH2A 3RJGA 4KTQA 1XU4A 4RT2A 5CP2A 1Y88A 3TFSA 3RH5A 4QWBA 1U45A 1S77D 9ICWA 7ICIA 8ICRA 5J2FA 5KG7A 5HNKA 3LWLA 4LZDA 2ISPA 3HWTA 4NLKA 2IHMA 1NK8A 3QZ8A 4R8UB 4C8OA 2ID1A 4XQ7A 3MFIA 4GC6A 2FPLA 3T5JA 3ZDBA 2KFZA 3RB6A 3V72A 3H37A 2I9GA 3BQTA 2BPFA 4IQVA 1KTQA 4Z6FA 8ICNA 3MDAA 1ZQDA 1UEUA 2HHPA 1U4BA 4F4XA 3RRHA 3MGIA 4Q43A 4DSKA 3OVSA 4F5PA 4QZGA 3AQNA 4ECYA 4RQ2A 4PHPA 5KT4A 5HRFA 8ICEA 2DR7A 4O5CA 2P66A 5HMLA 3MR3A 4LVSA 4AT7B 4RQ7A 4P4PA 3GIJA 5KG2A 3BQ1A 2AGOA 4YG2A 4XQ8A 5CA7A 4YVZA 1ZQXA 5DG7A 2HHSA 4UB3A 4NY8A 1KSPA 1TKDA 2M2UA 1C7YA 1L3TA 2HHTA 3KHRA 4M0AA 2NRKA 1KFDA 3AQLA 5KT6A 2DR5A 2DRBA 4M9NA 2ASLA 2FPKA 1ZQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJA A;  1ZQY A;  4MFA A;  3PR4 A;  4MFF A;  5DBB A;  3HJ4 A;  5HRI A;  4E80 A;  4RUA A;  3JPR A;  3ZD9 A;  9ICO A;  4KLO A;  3LDA A;  3B0X A;  2PFQ A;  8ICT A;  4PHD A;  5KFY A;  1H38 A;  9ICQ A;  1K1S A;  4YP3 A;  9ICE A;  1X9W A;  3MR2 A;  4F4K A;  4F92 B;  1XC9 A;  4DFJ A;  2F1J A;  4B9U A;  2ZHB A;  1HUO A;  3OSP A;  3RAQ A;  1NJW A;  2PXI A;  1ZQF A;  1Q78 A;  4DLG A;  5J0P A;  2Q0Z X;  1QSL A;  2HHX A;  3RAX A;  4LZG A;  1MSW D;  1S97 A;  4YMN A;  4HYK A;  3M8R A;  3GQC A;  8ICF A;  1COO A;  9ICM A;  5CWR A;  3TAP A;  4F2R A;  4DL6 A;  1X2I A;  2VA3 A;  3H38 A;  2KTQ A;  4K4G A;  1BPY A;  2KFN A;  1RPL A;  4C8L A;  4M9J A;  4KLH A;  1R8B A;  4ECV A;  2VAN A;  4FBU A;  2AQ0 A;  8ICP A;  4BWJ A;  2RDI A;  9ICB A;  3FDS A;  1KDH A;  4XUS A;  3RH4 A;  3RR7 A;  4YQW A;  1ZQW A;  4DLE A;  4ED7 A;  1UA1 A;  1ZQR A;  2PI4 A;  7ICH A;  1ZQT A;  3JZ0 A;  1NO5 A;  4O3P A;  4J9Q A;  4J9R A;  2M2T A;  5BOM A;  3GIM A;  2H5X A;  4J9N A;  4DWI A;  8ICL A;  3NGD A;  5KFN A;  4DQQ A;  8ICY A;  1VFG A;  3KTQ A;  4RUC A;  1KEJ A;  2W9B A;  2BQU A;  1ZQN A;  4QZC A;  4QZF A;  4I2I A;  1B22 A;  1UEV A;  3G6Y A;  4MF8 A;  3GDX A;  3OV7 A;  4JUZ A;  3JPQ A;  4X4T A;  2FLN A;  2DPJ A;  4QZB A;  4EEY A;  3Q8L A;  1JX4 A;  5KFF A;  3IM1 A;  4EBE A;  2JEG A;  4E0D A;  3TAR A;  5HRD A;  4F93 B;  3GIL A;  2MUT A;  1XWL A;  1TK0 A;  4WC3 A;  1TAQ A;  2I1Q A;  5J2E A;  3ISC A;  4JWM A;  4UBC A;  5F9L A;  1ZQO A;  3PMN A;  2DRA A;  3HT3 A;  1R89 A;  1BNP A;  4G3I A;  3PR5 B;  2XO7 A;  3HIY A;  4RQ3 A;  4Z6E A;  3HPO A;  4DL3 A;  1ZQM A;  3MAB A;  5DBA A;  4EZ6 A;  7ICS A;  4QZD A;  4QZA A;  3KHH A;  4NLN A;  4X4V A;  1NJZ A;  7ICQ A;  3MR6 A;  4TUS A;  8ICI A;  4F4Z A;  8ICV A;  3AQM A;  9ICG A;  2NRT A;  4ED8 A;  4C8N A;  2R8H A;  5KFX A;  5DLF A;  1N48 A;  2GWS A;  4X4R A;  1MC8 A;  4IQW A;  4M9L A;  2W9B B;  2R8I A;  5EWE A;  2BCQ A;  4NM2 A;  4I2B A;  3GII A;  5CJ7 A;  4DS4 A;  3AQK A;  1L5U A;  1U49 A;  3RBE A;  2DPI A;  4S3N A;  1JN3 A;  2PBE A;  5TZV A;  5HP4 A;  2IHN A;  3T5H A;  4DL4 A;  1JXE A;  1F5A A;  4TUP A;  4X0A A;  3H40 A;  4DS5 A;  7ICP A;  4FHX A;  5DED A;  1NK4 A;  1BPZ A;  1MIY A;  2MUT B;  3BQ2 A;  1TFY A;  4PGQ A;  3TFR A;  3G6V A;  4KLF A;  1NK9 A;  4GC7 A;  4Q45 A;  4UB4 A;  2NRW A;  3B0Y A;  4J9P A;  4EBC A;  2V9W A;  1LB2 B;  3H4D A;  3EPG A;  3C2M A;  2PFP A;  4I28 A;  5HRE A;  5D49 A;  2JEI A;  2ZJ5 A;  2ASJ A;  4QW8 A;  5CHG A;  9ICS A;  4YXJ A;  1V9P A;  2BCU A;  5DB8 A;  5KFZ A;  5J29 A;  1V4A A;  5J2K A;  3GIK A;  4DFP A;  3TI0 A;  1IM4 A;  5J2G A;  3V7J A;  1L3V A;  3BDP A;  4UB5 A;  5DQH A;  2C2D A;  1T3N A;  4BDP A;  1NKC A;  8ICW A;  4YMM A;  3MGH A;  4IR9 A;  9ICH A;  1ZQV A;  8ICG A;  3PW7 A;  5KT5 A;  2F1I A;  1S0V A;  8ICM A;  4X4P A;  4UAW A;  4WC2 A;  4FS2 A;  3E2E A;  1MIV A;  2ZUC A;  4RPY A;  4UAZ A;  2BE3 A;  2KZ3 A;  2OWO A;  4R64 A;  5KFR A;  1UT8 A;  4DQS A;  5IIJ A;  4ELT A;  4IRD A;  3PNC A;  3QZ7 A;  4FS1 A;  8ICB A;  2BKE A;  3ZDC A;  2XGP A;  7ICO A;  3TQ1 A;  4BGD A;  5J0S A;  8ICS A;  5D4B A;  5JUM A;  3IHQ B;  5J2H A;  3PV8 A;  3QE9 Y;  1D9F A;  1TAU A;  2BHN A;  2ZUB A;  5CB1 A;  4P4M A;  5EWG A;  5J2I A;  4IQU A;  1XSP A;  2UVV A;  3BQ0 A;  4I2H A;  1XO1 A;  4UQG A;  4DSI A;  4JWN A;  3OHB A;  9ICF A;  9ICT A;  2ZTD A;  1MQ3 A;  3EW9 A;  4CCH A;  4O9M A;  3V6J A;  7ICT A;  4QWE A;  7ICV A;  4RQ6 A;  5F2V O;  4FH5 A;  2DR8 A;  5HRH A;  4UB1 A;  2ALZ A;  4M9G A;  3ETL A;  3UXN A;  1ARO P;  2KZM A;  5J2C A;  1HUZ A;  5KTQ A;  1BNO A;  3AUO A;  4UAY A;  4UD5 A;  4WC6 A;  5DQI A;  3RJJ A;  9ICV A;  1ZET A;  2P6U A;  3OUY A;  3JYY A;  3WFR E;  3OGU A;  5HRG A;  4RNO A;  4P4O A;  3RJF A;  4WBZ A;  3Q8Q B;  4ECS A;  2W9C A;  1D8L A;  4PGY A;  1S0M A;  5KG6 A;  3PW0 A;  4NM1 A;  4O0I A;  5J2D A;  3PX0 A;  5DBC A;  5HR9 A;  5DB7 A;  4F5Q A;  2O5A A;  4E7X A;  1U9L A;  5DDY A;  3RTV A;  4Q8E A;  4I2A A;  4QWD A;  1BGX T;  3MR5 A;  7ICF A;  8ICX A;  1X9S A;  1S0O A;  4M5D A;  3WFO A;  3HW8 A;  7ICG A;  2HHQ A;  4JV0 A;  3PW5 A;  1LV5 A;  2V4Q A;  3ZDA A;  2RDJ A;  5KG3 A;  5KFC A;  4J9M A;  2C22 A;  4WCW A;  4XRH A;  3V7K A;  3M9M B;  3SZ2 A;  3GV5 B;  4QZH A;  1U47 A;  4R65 A;  9ICP A;  4ELV A;  5L9X A;  2W9A A;  1T4G A;  3ISB A;  4YCX A;  4I2J A;  4YFK A;  4B9N A;  4KLU A;  4F8R A;  4PHE A;  2HHU A;  4KLJ A;  5C5J A;  2W8K A;  4DOA A;  4R63 A;  4RWN A;  4J9L A;  4KLD A;  2LYH A;  1PX5 A;  3UPQ A;  4KLM A;  4O5E A;  1WCL A;  3Q8K A;  1IXR A;  1KFS A;  4ELU A;  1L3U A;  4Q8F A;  5J0O A;  2JEJ A;  3C2K A;  4IG8 A;  5BOL A;  2UVU A;  1R8C A;  2W9C B;  3MFH A;  4RU9 A;  3RB3 A;  4I27 A;  1Q79 A;  4EBJ A;  3UQ2 A;  5KFE A;  9ICC A;  5KFT A;  9ICL A;  4DO9 A;  4F4W A;  2KZZ A;  3Q8S B;  4X4S A;  3T5L A;  4IR1 A;  5HHH A;  1ZQE A;  1A76 A;  2JEF A;  3C2L A;  5KFB A;  1FA0 A;  3OUY B;  4O3O A;  4EBD A;  3RJI A;  1ZJM A;  3QEA Z;  1SL1 A;  5J0X A;  5KFS A;  3TAN A;  4NLG A;  5KFG A;  7ICR A;  3RJH A;  3L9D A;  3KHL A;  4GXK A;  4M6W A;  2ZUD A;  4YR2 A;  1X9M A;  1MQ2 A;  2P6R A;  2HVH A;  4NLZ A;  2ZHA A;  4ECT A;  5DLG A;  4ZH4 A;  3N4M B;  3PX4 A;  3TAQ A;  3RBD A;  2PFO A;  4AT8 A;  3V7L A;  1QSS A;  5IIN A;  2AGP A;  4KLE A;  5L1I A;  5DB6 A;  4LT6 A;  4ED2 A;  4P2H A;  4B9S A;  5KG5 A;  5HRK A;  4I29 A;  4TUR A;  2HHV A;  4DL2 A;  2FLL A;  5CR0 A;  2ASD A;  5KT2 A;  4K4H A;  4WC5 A;  3C21 A;  3NTU A;  4FO6 A;  4RQ4 A;  3H8S A;  2RFF A;  2V4R A;  1JXL A;  4F91 B;  5KT7 A;  4KLS A;  1SKW A;  4Z6D A;  3EPI A;  2KP7 A;  3ZDD A;  1S76 D;  4WC1 A;  1ZQL A;  3NYB A;  1XS9 D;  1MIW A;  1EXN A;  2PFN A;  3H8J A;  3JPT A;  2C28 A;  4QZ9 A;  2BDP A;  4YD1 A;  1CUK A;  4KN4 A;  4YR0 A;  4F5O A;  3V6H A;  3Q8M A;  4KLL A;  4EP7 A;  4ED6 A;  3PW2 A;  4MEX A;  4O3S A;  1CEZ A;  2JZB A;  4RWO A;  4YXM A;  7ICE A;  4M6W B;  1L3S A;  4DEZ A;  1NKE A;  4KLT A;  8ICK A;  3WFP A;  3PVX A;  3WFS C;  1ZJN A;  1BPX A;  5J0W A;  4ECW A;  4AT8 B;  4JV2 A;  2PI5 A;  1D8Y A;  5IIO A;  1S9F A;  1DK2 A;  1ZQG A;  4I2C A;  4BWM A;  5IIL A;  2M2W A;  5EWF A;  2BQ3 A;  2BCV A;  4MFC A;  4EYH B;  1QTM A;  5KG1 A;  3SV4 A;  1RYR A;  3PO5 A;  3ZDE A;  4KLQ A;  3HJ1 A;  5J0T A;  2W8L A;  4YMO A;  1RXW A;  2R8G A;  5J0Y A;  5HHI A;  4DQP A;  4YR3 A;  9ICK A;  1KNY A;  2KN7 A;  4O5K A;  4RZR A;  2UVW A;  4QZE A;  3M8S A;  4DL7 A;  2BGW A;  1JAJ A;  4O3Q A;  1QSY A;  2FLP A;  8ICU A;  2DR9 A;  4KMU A;  4KLI A;  4I2F A;  2ZH6 A;  1ZQZ A;  3GV7 B;  4GXI A;  4ECZ A;  4RQ8 A;  4FBT A;  2ZH8 A;  2FPM A;  5EOZ A;  4GLX A;  1RXV A;  4TQS A;  4DSE A;  2VA2 A;  3C1Y A;  2Y1I A;  2M2V A;  4NKT A;  5KFO A;  4TUQ A;  5KFA A;  1NJX A;  2NRX A;  4M9H A;  5KFH A;  5J2J A;  4DQI A;  4ED3 A;  5L1J A;  4NXZ A;  5IIM A;  3GV8 B;  1D9D A;  4X4O A;  4FH3 A;  1ZQS A;  2JZB B;  4RPX A;  5DG8 A;  2A1J A;  3JPS A;  4ECQ A;  2HHW A;  4RWQ A;  4QZI A;  8ICQ A;  2ZH9 A;  5L1L A;  1Z00 A;  3LK9 A;  5DKW A;  3H4B A;  4ED1 A;  2HW3 A;  4FHP A;  4DQR A;  5KFD A;  9ICR A;  5DEC A;  4DF8 A;  4BXO A;  3PML A;  2IMW P;  4DFM A;  5L1K A;  2ZH7 A;  4X4U A;  3UPS A;  2XY5 A;  1NZP A;  2WTF A;  4PH5 A;  4TQR A;  1ZQK A;  3RR8 A;  3C5G A;  2Y1J A;  2J6T A;  1ZQQ A;  2BR0 A;  4DF4 A;  4X4Q A;  3ZD8 A;  1XSL A;  2IBK A;  7ICJ A;  4X4N A;  8ICO A;  4B9L A;  1Z3E B;  3V6K A;  4ECX A;  3N97 B;  3RRG A;  1S10 A;  5HRL A;  1TV9 A;  1UT5 A;  1BPB A;  4ED0 A;  3T5K A;  2NRV A;  3H8W A;  2C2R A;  2ZH4 A;  1ZQU A;  1U48 A;  3EZ5 A;  5KFP A;  1N56 A;  8ICZ A;  5DB9 A;  3OJU A;  3THV A;  3MDC A;  4C8M A;  2A1J B;  3RB0 A;  5J0U A;  2FMP A;  4RNM A;  3BJY A;  2XC9 A;  4C8K A;  1YLQ A;  1Z00 B;  5DGB A;  3G6X A;  4XA5 A;  4ATB A;  2MAX A;  1VJ7 A;  4M47 A;  5J2B A;  4F4Y A;  4BXO B;  5KFJ A;  4NKU A;  2BPG A;  3EWA A;  4WBY A;  2DVI A;  1NJY A;  1KFT A;  9ICA A;  4PHA A;  4R66 A;  3Q8P B;  1SKR A;  5KFK A;  5HRB A;  4F2S A;  4DSL A;  1BVS A;  4PPX A;  1A77 A;  4PGX A;  2M9N A;  1TFR A;  5DGA A;  4WC0 A;  4M04 A;  4Z6C A;  1T8E A;  4JK1 A;  2XY7 A;  7ICU A;  1DOQ A;  2R8J A;  9ICJ A;  3OSN A;  4EBK A;  4WC7 A;  4RNN A;  4JV1 A;  3PX6 A;  2XGQ A;  1BPE A;  1ZQI A;  2ZH3 A;  1JMS A;  1JQR A;  5KFV A;  2ZTE A;  4O3R A;  1UET A;  4RPZ A;  1TK5 A;  2FMS A;  1SZP A;  4FHW A;  3AU2 A;  2ISO A;  1NKB A;  1WCN A;  4DOB A;  1NK6 A;  3FYH A;  3QEB Z;  1RZT A;  9ICI A;  7ICK A;  4Q44 A;  4J9O A;  4I2G A;  7ICN A;  4ATB B;  5KG4 A;  3M9N B;  3KHG A;  5III A;  3PY8 A;  1TK8 A;  5HC9 A;  3OHA A;  1RYS A;  1JIH A;  2XY6 A;  5DQG A;  4I2E A;  1NOM A;  3MBY A;  1QLN A;  2Q66 A;  4EYI B;  7ICM A;  2J6U A;  4KIT B;  2ZJ8 A;  3LQC B;  5BPC A;  2DFL A;  2ZTC A;  3SYZ A;  5KFQ A;  4RQ1 A;  2XCP A;  1ZQJ A;  4KLG A;  4E8F A;  3GFK B;  4DFK A;  1WOT A;  3JPO A;  1ZQC A;  8ICC A;  4MEY A;  5J0Q A;  3T3F A;  3SI8 A;  2AU0 A;  3C66 A;  5F9N A;  3OVA A;  4M2Y A;  1TFW A;  3HP6 A;  1ZYQ A;  3RJE A;  1SL0 A;  5J2A A;  4DSF A;  1PZN A;  4K4I A;  1KLN A;  3UXO A;  5J0R A;  3C23 A;  4UBB A;  1SL2 A;  3SV3 A;  1HJP A;  4B9M A;  2O1P A;  5HMM A;  1SKS A;  1KRP A;  4J9K A;  4GXJ A;  3WFQ E;  3EYZ A;  1TVA A;  4RQ0 A;  2AGQ A;  3H3A A;  4KN7 A;  1ZQH A;  2NRZ A;  8ICJ A;  3C1Z A;  4O3N A;  3RH6 A;  2J6S A;  1OU5 A;  4FHY A;  4F3O A;  3K75 D;  1ZQB A;  5KFM A;  5KG0 A;  2XCA A;  3HX0 A;  4AT9 A;  1K1Q A;  5KFI A;  4F50 A;  4ECR A;  5KT3 A;  4RQ5 A;  5DG9 A;  2W9M A;  4ECU A;  3K4G A;  4F5R A;  2BCR A;  3JPP A;  1ZQA A;  5KFW A;  3Q8R B;  9ICU A;  4IQT A;  2BQR A;  9ICX A;  3H39 A;  4UD4 A;  4YD2 A;  1DGS A;  1XSN A;  1UA0 A;  2FMQ A;  4MF2 A;  3UQ0 A;  1NK5 A;  4RT3 A;  4B9T A;  4QW9 A;  1R8A A;  4I2D A;  4DSJ A;  4R8U A;  4B9V A;  3UXP A;  3LWM A;  5IIK A;  2R8K A;  8ICA A;  3PW4 A;  4RWP A;  4EZ9 A;  5DDM A;  4F5N A;  2BCS A;  1DK3 A;  3ORY A;  5KFL A;  3PO4 A;  1S0N A;  3OJS A;  4DL5 A;  5D46 A;  4UB2 A;  9ICN A;  2ZH1 A;  2ZH5 A;  7ICL A;  2B21 A;  3H7I A;  4DOC A;  2VA8 A;  3AU6 A;  4IRK A;  8ICH A;  4QWA A;  4YN4 A;  3RJK A;  2UVR A;  4AT9 B;  2C2E A;  4QZ8 A;  4IRC A;  4AT7 A;  4FHV A;  4X5V A;  1BPD A;  3ISD A;  3JPN A;  2AJQ A;  4J9S A;  1NK0 A;  3RB4 A;  1T7P A;  3C18 A;  2F1H A;  1B43 A;  3C5F A;  2ATL A;  3M9O B;  4X0B A;  3OVB A;  5KFU A;  1NK7 A;  2BPC A;  4QWC A;  2AQ4 A;  2IA6 A;  2HVI A;  4WC4 A;  2ZH2 A;  3RJG A;  4KTQ A;  1XU4 A;  4RT2 A;  5CP2 A;  1Y88 A;  3TFS A;  3RH5 A;  4QWB A;  1U45 A;  1S77 D;  9ICW A;  7ICI A;  8ICR A;  5J2F A;  5KG7 A;  5HNK A;  3LWL A;  4LZD A;  2ISP A;  3HWT A;  4NLK A;  2IHM A;  1NK8 A;  3QZ8 A;  4R8U B;  4C8O A;  2ID1 A;  4XQ7 A;  3MFI A;  4GC6 A;  2FPL A;  3T5J A;  3ZDB A;  2KFZ A;  3RB6 A;  3V72 A;  3H37 A;  2I9G A;  3BQT A;  2BPF A;  4IQV A;  1KTQ A;  4Z6F A;  8ICN A;  3MDA A;  1ZQD A;  1UEU A;  2HHP A;  1U4B A;  4F4X A;  3RRH A;  3MGI A;  4Q43 A;  4DSK A;  3OVS A;  4F5P A;  4QZG A;  3AQN A;  4ECY A;  4RQ2 A;  4PHP A;  5KT4 A;  5HRF A;  8ICE A;  2DR7 A;  4O5C A;  2P66 A;  5HML A;  3MR3 A;  4LVS A;  4AT7 B;  4RQ7 A;  4P4P A;  3GIJ A;  5KG2 A;  3BQ1 A;  2AGO A;  4YG2 A;  4XQ8 A;  5CA7 A;  4YVZ A;  1ZQX A;  5DG7 A;  2HHS A;  4UB3 A;  4NY8 A;  1KSP A;  1TKD A;  2M2U A;  1C7Y A;  1L3T A;  2HHT A;  3KHR A;  4M0A A;  2NRK A;  1KFD A;  3AQL A;  5KT6 A;  2DR5 A;  2DRB A;  4M9N A;  2ASL A;  2FPK A;  1ZQP A; 
#chains in the Genus database with same CATH topology
 4RWN A;  4MFA A;  2I6X A;  4K9A A;  4RUA A;  5J8Y A;  4KLO A;  5KFY A;  9ICE A;  3KZX A;  3MGV A;  2F1J A;  4EEB A;  4OAF A;  3OSP A;  3RAQ A;  1Q78 A;  2PXI A;  3RAX A;  4LZG A;  3HJE A;  4HYK A;  3GQC A;  1COO A;  4P0P B;  4F2R A;  3H38 A;  1N2X A;  4M9J A;  4ECV A;  2VAN A;  4FBU A;  8ICP A;  1KDH A;  1ZQW A;  4JLX A;  2PI4 A;  2HBJ A;  1PK3 A;  1NO5 A;  4J9Q A;  4QNL A;  2M2T A;  5BOM A;  3GIM A;  4DWI A;  4CF3 A;  2BZF A;  1CRX A;  3WKA A;  4RUC A;  1KEJ A;  1ZQN A;  3IV6 A;  4I2I A;  4JUZ A;  3NVY A;  4X4T A;  3Q8L A;  3IM1 A;  3I76 A;  4F93 B;  2HOF A;  2I1Q A;  1FEZ A;  5J2E A;  1PVR A;  1P7D A;  2B4V A;  4UBC A;  1ZQO A;  4O68 A;  1BNP A;  4G3I A;  3HPO A;  2ZIW A;  4QZA A;  2Q4T A;  9ICG A;  2YN4 A;  1N48 A;  1MC8 A;  4IQW A;  4M9L A;  2W9B B;  3IG5 A;  5EWE A;  3DV9 A;  2D8C A;  2GAF D;  2PBE A;  4P0Q B;  4DL4 A;  1F5A A;  2ZHA A;  7ICP A;  4EEK A;  1BPZ A;  1WYG A;  2MUT B;  4PGQ A;  4UB4 A;  4EBC A;  2MU2 A;  2QB0 B;  3EPG A;  1LB2 B;  4O67 A;  5AM1 A;  2ZJ5 A;  2ASJ A;  5CHG A;  4KM5 A;  4YXJ A;  1V9P A;  2HI0 A;  5KFZ A;  5DB8 A;  3V7J A;  4K9B A;  4IL6 U;  4UB5 A;  8ICW A;  5G5H A;  2KG5 A;  4CF4 A;  5KT5 A;  1S0V A;  4X4P A;  2W11 A;  2YY6 A;  3E2E A;  2ZUC A;  3WKE A;  2DGZ A;  2BE3 A;  2BDU A;  1FIQ A;  3LVW A;  1UT8 A;  4ELT A;  4UAS A;  3PNC A;  4WH5 A;  2BKE A;  2XGP A;  7ICO A;  1D8B A;  3TQ1 A;  4BGD A;  4MKP A;  3PV8 A;  4FE3 A;  3SEN A;  1D9F A;  1YZ6 A;  4P4M A;  2K4E A;  2UVV A;  3BQ0 A;  4JWN A;  3F5A A;  1XNS A;  4RQ6 A;  5AKE A;  2K60 A;  4M9G A;  5ALH A;  1ARO P;  2KZM A;  5KTQ A;  4UD5 A;  3OUY A;  3RJJ A;  3A0H U;  1ZET A;  3WFR E;  5HRG A;  4CF5 A;  4PGY A;  2H3V A;  3PX0 A;  5L1M A;  3NWI A;  4Y2R A;  4Q8E A;  1RYU A;  1X9X A;  2BBH A;  7ICF A;  1XO0 A;  4M5D A;  7ICG A;  3PW5 A;  5KG3 A;  5KFC A;  2PKE A;  1M6Y A;  3KFU F;  1HEK A;  2LPE A;  3LVV A;  3R9K A;  4QZH A;  1T4G A;  4YCX A;  1RG6 A;  1S8O A;  4DOA A;  2W8K A;  1PX5 A;  3UPQ A;  2YMM A;  4ELU A;  1L3U A;  3C2K A;  5BOL A;  2UVU A;  4ZOH C;  4OJP A;  5F3X B;  4EBJ A;  3UQ2 A;  2P35 A;  5KFE A;  4DO9 A;  2KZZ A;  3Q8S B;  1IV8 A;  4IR1 A;  2D6F C;  2HBM A;  4O3O A;  1ZJM A;  4NLG A;  3RJH A;  2ZUD A;  1X9M A;  5AKH A;  2HVH A;  5B3Q A;  4NLZ A;  4CDG A;  5AHX A;  3CRX A;  1C20 A;  1WUD A;  5IIN A;  5DB6 A;  2OYY A;  5HRK A;  2MSN A;  2HHV A;  4DL2 A;  2LBO A;  5KT2 A;  1JXL A;  4F91 B;  1ZQL A;  3NYB A;  3JPT A;  1JRO A;  2W3R A;  1ZRM A;  2JZB A;  3F2B A;  4YXM A;  3WFS C;  1V97 A;  2OXO A;  4AT8 B;  4NXU A;  5IIL A;  2AHO B;  5EWF A;  2DKZ A;  4EYH B;  1RYR A;  2KKV A;  4IC9 A;  2W8L A;  4X4O A;  4YMO A;  1KNY A;  4YR3 A;  4O5K A;  4DCC A;  3B9J A;  1JAJ A;  4O3Q A;  1QSY A;  4HAI A;  2FLP A;  8ICU A;  3GV7 B;  2A1A A;  4FBT A;  5AKG A;  2FPM A;  2KSO A;  4GLX A;  1RXV A;  4NXV A;  3C1Y A;  2M2V A;  4NKT A;  5KFO A;  3T79 A;  1COK A;  1RQN A;  4NXZ A;  4ECQ A;  2A1J A;  3JPS A;  2HHW A;  2ZH9 A;  4ED1 A;  5DKW A;  2XID A;  4BXO A;  3SAF A;  4CGZ A;  2GLE A;  3UPS A;  2XY5 A;  2H3Q A;  3C5G A;  1ZQQ A;  2BR0 A;  4X4Q A;  3V6K A;  3NRZ A;  3N97 B;  2W55 A;  2K89 A;  1BPB A;  4OJL A;  1ZQU A;  1N56 A;  2DL0 A;  5DB9 A;  1YT3 A;  3RB0 A;  3BJY A;  1YLQ A;  5DGB A;  1OXJ A;  3ED5 A;  2JGA A;  1SV0 C;  3D6J A;  9ICA A;  3Q8P B;  2ES6 A;  5HRB A;  4F2S A;  4DSL A;  1A77 A;  3A0B U;  1TFR A;  5DGA A;  4M04 A;  4K97 A;  4FO1 A;  2R8J A;  4WC7 A;  3OSN A;  1L8O A;  3KZI U;  2ZH3 A;  4RPZ A;  1DXS A;  3AU2 A;  2CN1 A;  1RZT A;  4J9O A;  4I2G A;  5EE9 A;  2B56 A;  1RM6 C;  4ATB B;  5KG4 A;  2YMQ A;  1TK8 A;  3ONN A;  4EYI B;  1F44 A;  4KIT B;  2ZJ8 A;  4O6A A;  2DFL A;  3NVW A;  4E8F A;  2FE9 A;  1FFV A;  1PK1 A;  3QNM A;  2DBY A;  5J0Q A;  3C66 A;  2EAM A;  5F9N A;  2PMZ C;  2RLT A;  1KLN A;  2G5H B;  2G06 A;  5J0R A;  4OAH A;  4C4R A;  4UBB A;  3SV3 A;  4J9K A;  2CXY A;  5AIB A;  1TVA A;  1ZQH A;  2NRZ A;  8ICJ A;  1QQ7 A;  3IDW A;  2ZIV A;  5KFM A;  4AT9 A;  2EAO A;  4ECR A;  4OAI Z;  1B4F A;  4PZN A;  1UPH A;  4RQN A;  5DG9 A;  5G5G A;  2BCR A;  1S5L U;  3JPP A;  9ICU A;  4LEZ A;  9ICX A;  1DGS A;  1XSN A;  2FMQ A;  1NK5 A;  3E58 A;  4RT3 A;  4XJE A;  2KJ8 A;  4I2D A;  4R8U A;  3DDH A;  3UXP A;  2EQY A;  3LWM A;  5IIK A;  1UQV A;  2BCS A;  5KFL A;  3HIL A;  1SGG A;  4DL5 A;  2K8B B;  5D46 A;  4UB2 A;  1FFU A;  2KIV A;  4DOC A;  3AU6 A;  2VA8 A;  8ICH A;  1SXD A;  4FHV A;  4J9S A;  1B43 A;  5J8Y C;  4X0B A;  3OVB A;  5KFU A;  2BPC A;  2HVI A;  2IA6 A;  4WC4 A;  2ZH2 A;  1XU4 A;  3QU4 A;  5CP2 A;  5B5E U;  2EH9 A;  4QWB A;  3LWL A;  2ISP A;  1NK8 A;  2EWR A;  3V72 A;  3BQT A;  2HN1 A;  3MDA A;  1UEU A;  4GIB A;  4F4X A;  3MGI A;  2PMZ F;  3RRH A;  5AI6 A;  4F5P A;  4ECY A;  4PHP A;  5HRF A;  8ICE A;  2P66 A;  3MR3 A;  5ALK A;  4LVS A;  4AT7 B;  3BQ1 A;  2AGO A;  4UB3 A;  2ZXI A;  1C7Y A;  1L3T A;  4RQM A;  2WFA A;  3AL0 B;  5ALX A;  1KFD A;  2EZX A;  3AQL A;  4M9N A;  2ASL A;  2ODG A;  2ZXH A;  2FPK A;  5AIC A;  2ZJA A;  1ZQY A;  2D3D A;  3B0X A;  8ICT A;  1K1S A;  3MR2 A;  1LKY A;  4F92 B;  3WKB A;  4B9U A;  4EED A;  1A6S A;  2Q0Z X;  2QAR B;  1N62 A;  3M8R A;  3NRW A;  2G0A A;  5CWR A;  2HDO A;  2KFN A;  4C8L A;  4EEN A;  4KLH A;  4WOY A;  2RDI A;  4Y2V A;  3RR7 A;  4YQW A;  3WK4 A;  3WU2 U;  1ZQR A;  3SQI A;  3JZ0 A;  4O3P A;  5KL8 B;  1VLB A;  1MA7 A;  8ICL A;  3NGD A;  8ICY A;  1VFG A;  1N5X A;  1SV0 A;  4PJ0 U;  2M0N A;  1UEV A;  3OV7 A;  3JPQ A;  5KFF A;  4EBE A;  3CW2 C;  4WC3 A;  2B6G A;  5F9L A;  4US8 A;  2DRA A;  3KBB A;  4OAG A;  4DL3 A;  4EZ6 A;  5DBA A;  2JMG A;  5ALT A;  7ICS A;  4X4V A;  3L4P A;  8ICI A;  4CE6 A;  3NS1 A;  4F4Z A;  2YTU A;  4ED8 A;  1RQL A;  5KFX A;  3PSF A;  2GWS A;  4I2B A;  5C0Y A;  5AI0 A;  4DS4 A;  3AQK A;  2NYV A;  3RBE A;  4LEV A;  2IHN A;  3T5H A;  1JXE A;  4X0A A;  4TUP A;  4DS5 A;  2AXT U;  1MIY A;  2HCF A;  3G6V A;  2G5I B;  3B0Y A;  2PFP A;  5HRE A;  4Y2T A;  2BCU A;  5J29 A;  1V4A A;  4NXX A;  4BDP A;  4IR9 A;  1ZQV A;  8ICG A;  3PW7 A;  8ICM A;  2F1I A;  4NXT A;  3H0L B;  4DQS A;  4IRD A;  4FS1 A;  4OD0 A;  2FJ6 A;  2LM1 A;  5J0S A;  5D4B A;  3QE9 Y;  4C80 A;  5CB1 A;  5J2I A;  1XO1 A;  2ZTD A;  5AKL A;  3EW9 A;  5AM0 A;  4KMO B;  3V6J A;  1MQ3 A;  4QWE A;  1PUZ A;  5HRH A;  2FDR A;  1K5O A;  3ETL A;  2LMR A;  1BNO A;  3AUO A;  2E8N A;  5ALQ A;  2JH7 A;  5DQI A;  5B3P A;  3S6J A;  4WBZ A;  2W9C A;  3PW0 A;  3JCF A;  4O0I A;  2O5A A;  2E8P A;  1O03 A;  2HN2 A;  1X9S A;  3WFO A;  4QIW C;  1LV5 A;  1Q8K A;  4WCW A;  3V7K A;  2B51 A;  1U47 A;  3GV5 B;  3ISB A;  4R63 A;  2LYH A;  4KLM A;  4O5E A;  1WCL A;  4NV0 A;  5J0O A;  2JEJ A;  3FAH A;  3MFH A;  2HMX A;  4RU9 A;  4I27 A;  1Q79 A;  9ICC A;  4C4S A;  5T14 A;  4F4W A;  3BZK A;  3T5L A;  5HHH A;  1ZQE A;  4UAR A;  3SMV A;  4EBD A;  1SL1 A;  1UHU A;  4GXK A;  4M6W A;  4YR2 A;  3NKU A;  4ECT A;  3N4M B;  3IRU A;  3PX4 A;  3RBD A;  2PFO A;  2GO7 A;  2E1E A;  4LT6 A;  1HIW A;  4B9S A;  3RFA A;  2LI6 A;  3C21 A;  3NTU A;  1X6J A;  4RQ4 A;  2RFF A;  5KT7 A;  4KLS A;  4Z6D A;  4ACO A;  4WC1 A;  3F53 A;  4YD1 A;  1CUK A;  4YR0 A;  4F5O A;  3V6H A;  4EP7 A;  2L5Y A;  4ED6 A;  4RWO A;  4MEX A;  1L3S A;  4DEZ A;  4KLT A;  8ICK A;  2GH1 A;  2YB1 A;  5D63 A;  4Y2P A;  1X66 A;  2PI5 A;  4BWM A;  2M2W A;  2BCV A;  5CEH A;  2BQ3 A;  2N1R A;  4MFC A;  1QTM A;  5KG1 A;  3PO5 A;  4KLQ A;  4QIW F;  3HJ1 A;  3AQF A;  3QYP A;  4UB8 U;  5J0T A;  1RXW A;  2R8G A;  5J0Y A;  3IG8 A;  2KEY A;  4QZE A;  3M8S A;  4DL7 A;  3PSI A;  4KLI A;  2ZH6 A;  2W7O A;  2ZH8 A;  1LVH A;  4I0U A;  5ALF A;  2LYA A;  1KW4 A;  1F0M A;  5AKY A;  2GOL A;  5KFH A;  4ED3 A;  2ESE A;  2BBJ A;  2NV3 A;  5L1L A;  3H4B A;  4EGW A;  3ER9 B;  3PML A;  2ZH7 A;  3I28 A;  1ZOL A;  2VJ4 A;  4PH5 A;  2Y1J A;  5AKI A;  2J6T A;  1ZD3 A;  1FO4 A;  2IBK A;  7ICJ A;  4X4N A;  1Z4O A;  8ICO A;  2YQE A;  2ZIU A;  5HRL A;  3KD3 A;  4UW9 A;  2W7P A;  4ED0 A;  2ZH4 A;  4EEL A;  3OJU A;  2FMP A;  5J0U A;  4RNM A;  2XC9 A;  1Z00 B;  2MAX A;  4M47 A;  5KFJ A;  4WBY A;  2F8K A;  2DVI A;  1NJY A;  1SKR A;  1ZD5 A;  5KFK A;  3AN1 A;  1L7P A;  2F44 A;  4K8V A;  4WC0 A;  4Z6C A;  7ICU A;  4JK1 A;  2XY7 A;  3PX6 A;  3N7R C;  5KFV A;  2ZTE A;  3K1Z A;  5AK5 A;  1MN8 A;  1SZP A;  1NK6 A;  3FYH A;  1IIP A;  5AKX A;  4O3M A;  2HSZ A;  2WF8 A;  3N7S C;  5HC9 A;  1ED1 A;  1QLN A;  1NOM A;  2ZIX B;  4AYB C;  3M7D A;  3CK6 A;  3SYZ A;  5CRX A;  4KLG A;  2XCP A;  1ZQJ A;  3GFK B;  1J2N A;  1ZQC A;  4MEY A;  4Y2S A;  1Z4N A;  3OVA A;  4K4I A;  1SL0 A;  1PZN A;  5ALN A;  3C23 A;  5D61 A;  1SL2 A;  3HKZ C;  5HMM A;  1KRP A;  3WKD A;  3C1Z A;  3RH6 A;  5ALW A;  3K75 D;  3HX0 A;  5KG0 A;  2XCA A;  3LYS A;  5KFI A;  4UAT A;  1J2M A;  5ALE A;  4ECU A;  2IHO A;  3K4G A;  1ZQA A;  3Q8R B;  5ALY A;  1L8L A;  2HOQ A;  2BQR A;  4GFJ A;  4MF2 A;  1X6I A;  4QW9 A;  4B9V A;  4RWP A;  5DDM A;  4F5N A;  1DK3 A;  3ORY A;  3KKA A;  3OJS A;  3I1Y A;  9ICN A;  3M6K A;  3HRD D;  4IRK A;  4QWA A;  4X5V A;  3C29 A;  2F3N A;  1BPD A;  3ISD A;  2XVT A;  5EE1 A;  1T7P A;  2KHQ A;  3M9O B;  1L7N A;  4RT2 A;  3BS5 B;  1UCV A;  3TFS A;  1S77 D;  3RH5 A;  1U45 A;  1TE2 A;  5HNK A;  4NLK A;  4AYB F;  2OCE A;  2Y9U A;  4C8O A;  3MFI A;  4XQ7 A;  4GC6 A;  2FPL A;  2WAQ C;  2K8A A;  1GPJ A;  2F77 X;  4IQV A;  4Z6F A;  1ZQD A;  1U4B A;  2FI1 A;  5KAI U;  4QZG A;  1NZB A;  3AQN A;  4Y2Y A;  5KT4 A;  2KD1 A;  4N7R A;  5HML A;  3HKZ F;  4RQ7 A;  3GIJ A;  5KG2 A;  4YG2 A;  4JLZ A;  2K4I A;  2WF6 A;  4NY8 A;  2M2U A;  4P0P A;  5ALP A;  4WQL A;  1L7O A;  5AKK A;  2HHT A;  3KHR A;  4M0A A;  5EE0 A;  5KT6 A;  2DR5 A;  3SAH A;  4E80 A;  9ICO A;  3ZD9 A;  1OW5 A;  5KNI A;  2PFQ A;  4PHD A;  3PSP A;  4YP3 A;  1X9W A;  4F4K A;  1XC9 A;  5ALD A;  1ZQF A;  2G09 A;  2YX8 A;  4DLG A;  1QSL A;  5GTH U;  9ICM A;  2W3S A;  4DL6 A;  1X2I A;  2VA3 A;  4K4G A;  1BPY A;  1RPL A;  1R8B A;  2FCL A;  2IOF K;  2AQ0 A;  3FDS A;  5AKZ A;  1UA1 A;  4J9R A;  1VDV A;  4DQQ A;  3KTQ A;  2W9B A;  2BQU A;  4QZC A;  4QZF A;  1B22 A;  3G6Y A;  4MF8 A;  4EV6 A;  3FM9 A;  2WAQ F;  2FLN A;  2DPJ A;  4QZB A;  4EEY A;  1JX4 A;  4P0Q A;  1QQ6 A;  2JEG A;  4E0D A;  3BQ7 A;  3TAR A;  3GIL A;  2MUT A;  1TK0 A;  1N60 A;  3ISC A;  4JWM A;  2QB0 A;  4A8E A;  3HT3 A;  4RQ3 A;  1ZQM A;  4QZD A;  4NLN A;  1NJZ A;  7ICQ A;  8ICV A;  2EAP A;  4C8N A;  5DLF A;  4X4R A;  3D2N A;  5ALR A;  2BCQ A;  4NM2 A;  3GII A;  5CJ7 A;  4S3N A;  2WB1 C;  1U49 A;  1L5U A;  2W43 A;  2DPI A;  5TZV A;  5HP4 A;  3NVV A;  2KVS A;  1SWW A;  5DED A;  1NK4 A;  1TFY A;  3TFR A;  4KLF A;  1NK9 A;  4GC7 A;  4Q45 A;  2V9W A;  2NRW A;  2XI9 A;  3H4D A;  2JRZ A;  4BUG A;  4QW8 A;  2ZIW B;  1KBU A;  2E1F A;  2QLT A;  1SWV A;  5AKJ A;  4DFP A;  1IM4 A;  5J2G A;  1L3V A;  4U7C A;  3BDP A;  2DWQ A;  4YMM A;  5B66 U;  1OUQ A;  4OJ6 A;  4O69 A;  4UAW A;  4WC2 A;  4FS2 A;  1MIV A;  4UAZ A;  4RPY A;  2KZ3 A;  5JU5 A;  5KFR A;  8ICB A;  3ZDC A;  5JUM A;  3IHQ B;  5J2H A;  4B6J A;  9ICF A;  4UQG A;  3ALR A;  5KL1 B;  4CCH A;  4O9M A;  5F2V O;  4FH5 A;  3VCB A;  2EDU A;  3UMC A;  2JXJ A;  3U26 A;  5J2C A;  5TIS U;  3OWG A;  4WC6 A;  9ICV A;  3OGU A;  3CNH A;  3RJF A;  1D8L A;  4FZM A;  1S0M A;  5KG6 A;  2W54 A;  4NM1 A;  2LYB A;  5AI5 A;  3BS7 A;  4MHV A;  2JHD A;  5DB7 A;  4E7X A;  4C7Z A;  1U9L A;  5DDY A;  4FFD A;  4I2A A;  4QWD A;  1BGX T;  2WB1 F;  3H0M B;  3TKA A;  1S0O A;  3HW8 A;  3CP8 A;  4FZL A;  2KIC A;  1PVQ A;  4XRH A;  3M9M B;  3SZ2 A;  9ICP A;  4R65 A;  4B9N A;  3QU2 A;  3DEE A;  4I2J A;  4YFK A;  4WQK A;  4KLJ A;  5C5J A;  4J9L A;  4NLC A;  4KLD A;  1QCK A;  2DR8 A;  3OUY B;  3Q8K A;  1IXR A;  4IG8 A;  2K4H A;  5AI9 A;  5KFT A;  9ICL A;  4X4S A;  5K4L A;  3C2L A;  1FA0 A;  3RJI A;  3QEA Z;  5J0X A;  2KJ5 A;  3TAN A;  2DF4 B;  7ICR A;  2RP5 A;  2KNJ A;  3KHL A;  1MQ2 A;  2P6R A;  2QB1 A;  4KX5 A;  4UAU A;  4AT8 A;  3V7L A;  2AGP A;  5L1I A;  4ED2 A;  4P2H A;  4NXW A;  3TAD A;  5KG5 A;  2AH5 A;  4I29 A;  3UMB A;  2FLL A;  4WC5 A;  3H8S A;  2G07 A;  2WF7 A;  3EPI A;  2KP7 A;  2A3V A;  1S76 D;  3EUB 2;  1MIW A;  2LHT A;  4LEY A;  4QZ9 A;  2LM4 A;  4KN4 A;  3Q8M A;  4KLL A;  3WK7 A;  5CFU A;  3PW2 A;  4O3S A;  7ICE A;  1NKE A;  4UAV A;  3QX7 A;  1BPX A;  4ECW A;  4JV2 A;  1DK2 A;  5IIO A;  4I2C A;  3HIY A;  1ZQ1 C;  9ICK A;  1J97 A;  2KN7 A;  2BGW A;  2DR9 A;  4I2F A;  1ZQZ A;  4GXI A;  4ECZ A;  1JRP A;  4DSE A;  2VA2 A;  2Y1I A;  4TUQ A;  5KFA A;  1ZD4 A;  2NRX A;  4M9H A;  5J2J A;  4KX3 A;  5L1J A;  1D9D A;  1ZQS A;  2JZB B;  4RPX A;  5DG8 A;  4NWI A;  4QZI A;  2HW3 A;  5ALS A;  5KFD A;  1SZH A;  4DF8 A;  2W04 A;  4PL2 A;  4DFM A;  5L1K A;  5JTI A;  1NZP A;  2WTF A;  5EE3 A;  3RR8 A;  3K1R B;  3ZD8 A;  1XSL A;  4OO1 J;  2VIX A;  2KSO B;  1S10 A;  1UT5 A;  2KKP A;  3T5K A;  4NL9 A;  5AK3 A;  3EZ5 A;  5KFP A;  1NI3 A;  2E3T A;  3THV A;  3PST A;  3MDC A;  4C8M A;  2A1J B;  4J03 A;  4C8K A;  3NUQ A;  4JMU A;  3MC1 A;  4XA5 A;  4ATB A;  1Z1V A;  5J2B A;  4F4Y A;  4BXO B;  2YMP A;  2BPG A;  3EWA A;  3M6Z A;  1AQ6 A;  4R66 A;  2JV3 A;  2F8L A;  2M9N A;  1DOQ A;  4EBK A;  2I5H A;  4JV1 A;  2XGQ A;  1BPE A;  4G9B A;  1KKX A;  1JQR A;  4O3R A;  1IG6 A;  2FMS A;  2ISO A;  2Y9T A;  1WCN A;  4DOB A;  3MCR A;  3K7D A;  3IP4 B;  3QEB Z;  7ICN A;  1DRG A;  2XIC A;  3M9N B;  5III A;  3OHA A;  1JIH A;  2XY6 A;  5DQG A;  3QU9 A;  4I2E A;  7ICM A;  3QUC A;  3LQC B;  5ALV A;  2ZTC A;  1Z19 A;  2E8O A;  3SR6 A;  4RQ1 A;  5E79 U;  4DFK A;  2IUB A;  3KKA C;  8ICC A;  2DUY A;  3SI8 A;  3HP6 A;  3RJE A;  4DSF A;  5JRT A;  4B9M A;  2O1P A;  4CRX A;  1SKS A;  4GXJ A;  3WK9 A;  1N61 A;  3EYZ A;  4RQ0 A;  2AGQ A;  3H3A A;  2WHE A;  4O3N A;  4F3O A;  4Y2X A;  1CI4 A;  4F50 A;  2R18 A;  5AM4 A;  5KT3 A;  4RQ5 A;  4PL1 A;  3OPX A;  1PK1 B;  1ZD2 P;  3H39 A;  4OJO A;  4YD2 A;  4Y2J A;  5A0L A;  5AIA A;  4JB3 A;  8ICA A;  4F72 A;  4CNQ A;  4OCZ A;  5AM2 A;  2ZH1 A;  3M1Y A;  2NO4 A;  3L5K A;  2B21 A;  2ZIV B;  4AT9 B;  2QKQ A;  4QZ8 A;  4AT7 A;  2AJQ A;  3C18 A;  3RB4 A;  2K8C B;  4BX9 C;  2F1H A;  3C5F A;  1KQQ A;  2HOI A;  4QWC A;  2AQ4 A;  4C0Z A;  3RJG A;  2Y0S C;  8ICR A;  5J2F A;  5KG7 A;  1SB3 C;  4R8U B;  1WG8 A;  2ID1 A;  3EF2 A;  2VJ5 A;  3T5J A;  2H3Z A;  3E0F A;  3RB6 A;  3H37 A;  2BPF A;  5AK4 A;  3D2S A;  1KTQ A;  1X42 A;  8ICN A;  2HHP A;  1DGJ A;  3RF9 A;  3OVS A;  3F2C A;  4O5C A;  3CYM A;  1ZXI A;  2QAR A;  1TAM A;  2HHS A;  1ZQX A;  2KMD A;  5DG7 A;  1TKD A;  2K4P A;  3QUQ A;  4F71 A;  3AM9 A;  1Z1B A;  2DRB A;  1KN5 A;  4MFF A;  3PR4 A;  3HJ4 A;  5DBB A;  5HRI A;  4AP9 A;  3JPR A;  4KB6 A;  3LDA A;  1H38 A;  9ICQ A;  2JH1 A;  4FZN A;  3BZC A;  4DFJ A;  2ZHB A;  1HUO A;  1NJW A;  5ALO A;  5J0P A;  2HHX A;  1MSW D;  1S97 A;  4YMN A;  2DKX A;  8ICF A;  3TAP A;  2CRX A;  2KTQ A;  5FP0 A;  2MA1 A;  4BWJ A;  9ICB A;  4XUS A;  3RH4 A;  4ED7 A;  4DLE A;  7ICH A;  2YB4 A;  1ZQT A;  2H5X A;  4J9N A;  2HBK A;  5KFN A;  4BJQ A;  2Y0S F;  1LKY B;  5H2F U;  4U6P A;  2RRD A;  4EX6 A;  3C28 A;  4K98 A;  5ALL A;  2KE7 A;  3D2Q A;  3J81 j;  3GDX A;  2OHF A;  5JTG A;  5HRD A;  1XWL A;  1TAQ A;  3WK6 A;  4K96 A;  4DFD A;  3PMN A;  3ER8 C;  2HBL A;  1R89 A;  3PR5 B;  2XO7 A;  4Z6E A;  3MAB A;  3OTQ A;  3KHH A;  1KL9 A;  3MR6 A;  4TUS A;  3AQM A;  3SAG A;  2NRT A;  1T94 A;  2R8H A;  2GA9 D;  5AI4 A;  5AM3 A;  5ALM A;  5AI8 A;  2R8I A;  4US9 A;  2CPR A;  1JN3 A;  1WWV A;  3H40 A;  4FHX A;  3BQ2 A;  2KIW A;  3AQE A;  4J9P A;  1Q3U A;  3C2M A;  4I28 A;  5D49 A;  2JEI A;  9ICS A;  3WK8 A;  5J2K A;  3GIK A;  3TI0 A;  5DQH A;  2C2D A;  1ZRN A;  1NKC A;  3MGH A;  9ICH A;  1A0P A;  4EX7 A;  4LEW A;  4C4T A;  2OWO A;  4R64 A;  1JUD A;  2KVC A;  5IIJ A;  3ZI4 A;  1Q46 A;  3QZ7 A;  5CFS A;  1TAU A;  2BHN A;  2ZUB A;  1XSP A;  2MRL A;  3QU5 A;  5EWG A;  4IQU A;  4I2H A;  4DSI A;  9ICT A;  3UMG A;  3OHB A;  3QUB A;  7ICT A;  3SEI A;  7ICV A;  1O08 A;  4Y2U A;  4UB1 A;  2NO5 A;  3ERC C;  2ALZ A;  3UXN A;  2RHF A;  1HUZ A;  2A19 A;  4UAY A;  2P6U A;  3JYY A;  4RNO A;  4P4O A;  1Q3V A;  3Q8Q B;  4ECS A;  8ICS A;  5J2D A;  5HR9 A;  5DBC A;  4F5Q A;  3RTV A;  2OH2 A;  3MR5 A;  8ICX A;  3TAD C;  2HHQ A;  4JV0 A;  4PZO A;  2V4Q A;  3ZDA A;  3QXG A;  2RDJ A;  4J9M A;  1F5S A;  2C22 A;  2ZG6 A;  4ELV A;  5L9X A;  2W9A A;  4KLU A;  4F8R A;  4PHE A;  2HHU A;  3ICX A;  2OEH A;  1SIJ A;  1SV4 A;  4Q8F A;  1KFS A;  2RQ5 A;  2O6K A;  4ICA A;  4C7Y A;  2KOB A;  1R8C A;  2EZY A;  2W9C B;  5HR7 A;  3RB3 A;  2WF9 A;  3H8M A;  2EZZ A;  1N63 A;  3O0F A;  1A76 A;  2JEF A;  5KFB A;  4UB6 U;  2VKQ A;  5KFS A;  3IN5 A;  5KFG A;  3L9D A;  2OM6 A;  2E5S A;  5DLG A;  4ZH4 A;  5ALI A;  3TAQ A;  3NAS A;  2JR5 A;  1QSS A;  4KLE A;  2YML A;  3NVO A;  4TUR A;  5AM5 A;  5CR0 A;  2ASD A;  4K4H A;  4FO6 A;  4NJ8 A;  2V4R A;  1YZ7 A;  1SKW A;  3ZDD A;  5ALG A;  1XS9 D;  1EXN A;  2PFN A;  3H8J A;  2C28 A;  2BDP A;  1T3Q A;  1CEZ A;  4M6W B;  3WFP A;  3PVX A;  1ZJN A;  5J0W A;  4LJX A;  1D8Y A;  1S9F A;  1ZQG A;  1QH9 A;  3SV4 A;  3ZDE A;  4NL9 C;  1JI7 A;  4DQP A;  3FC4 A;  5HHI A;  4RZR A;  2UVW A;  2F2A B;  2WF5 A;  4KMU A;  1B0X A;  4RQ8 A;  5EOZ A;  4TQS A;  1NJX A;  3WKC A;  4DQI A;  3F5E A;  5IIM A;  3GV8 B;  3PHZ A;  4FH3 A;  4RWQ A;  8ICQ A;  1Z00 A;  3LK9 A;  4FHP A;  4DQR A;  5DEC A;  9ICR A;  1WWU A;  2IMW P;  4X4U A;  2IOH A;  1ZQK A;  4TQR A;  5KAF U;  3F2D A;  3QUT A;  4DF4 A;  4B9L A;  1Z3E B;  4ECX A;  3RRG A;  2Z7J A;  1TV9 A;  2C2R A;  2NRV A;  3H8W A;  1U48 A;  8ICZ A;  4K99 A;  5ALZ A;  3G6X A;  1VJ7 A;  2KK0 A;  4NKU A;  2ZIX A;  3WK5 A;  4OJ5 A;  1KFT A;  4PHA A;  1BVS A;  4PPX A;  5CHE A;  4PGX A;  3QU7 A;  1T8E A;  9ICJ A;  4RNN A;  2ZIU B;  1L7M A;  1ZQI A;  5HR6 A;  1JMS A;  1UET A;  1QQ5 A;  1TK5 A;  1URJ A;  4FHW A;  1NKB A;  9ICI A;  7ICK A;  3PZP A;  4Q44 A;  3KHG A;  3PY8 A;  3TAC B;  3VC8 A;  1RYS A;  1GO3 F;  3AEV A;  2Q66 A;  3MBY A;  1V85 A;  2DQN B;  2J6U A;  5BPC A;  5ALJ A;  5KFQ A;  1WOT A;  3JPO A;  3T3F A;  3SD7 A;  2AU0 A;  3AMZ A;  3H0R B;  4M2Y A;  1TFW A;  4WJ3 B;  1ZYQ A;  5J2A A;  1X40 A;  3UXO A;  4Y2Q A;  1HJP A;  2LKY A;  2KJ9 A;  3WFQ E;  4KN7 A;  1OU5 A;  1VJ5 A;  2J6S A;  4FHY A;  1PVP A;  1ZQB A;  5CFT A;  1K1Q A;  2H3F A;  5GTI U;  3N7P D;  4USA A;  2W9M A;  2IOF A;  4F5R A;  4NLB A;  5KFW A;  1L6N A;  2H3I A;  4IQT A;  2KHV A;  3BS5 A;  4UD4 A;  2F76 X;  1UA0 A;  1SXE A;  3NVZ A;  3UQ0 A;  3UM9 A;  2B0C A;  4B9T A;  3ETR A;  1R8A A;  4DSJ A;  3KOO A;  2R8K A;  3PW4 A;  4EZ9 A;  3GZF A;  3PO4 A;  1S0N A;  5AK6 A;  2ZH5 A;  2W03 A;  7ICL A;  3H7I A;  3RJK A;  4YN4 A;  2UVR A;  2C2E A;  4IRC A;  3JPN A;  1NK0 A;  2ATL A;  1N5W A;  1NK7 A;  1JAL A;  2EAN A;  4KTQ A;  5D62 A;  1Y88 A;  9ICW A;  7ICI A;  3L3F X;  4LZD A;  3HWT A;  2IHM A;  3QZ8 A;  2E8M A;  3ZDB A;  2KFZ A;  2I9G A;  4DSK A;  4Q43 A;  4RQ2 A;  4HX0 A;  2DR7 A;  2G08 A;  4IS7 A;  4P4P A;  4QJF B;  5CA7 A;  4XQ8 A;  3N28 A;  4YVZ A;  1KSP A;  1ECW A;  2KV2 A;  1RDF A;  1V38 A;  2NRK A;  3GU3 A;  1NNL A;  1T3N A;  5ALU A;  1ZQP A; 
#chains in the Genus database with same CATH homology
 2ZJA A;  1ZQY A;  4MFA A;  3PR4 A;  4MFF A;  5DBB A;  3HJ4 A;  5HRI A;  4E80 A;  4RUA A;  3JPR A;  3ZD9 A;  9ICO A;  4KLO A;  3LDA A;  3B0X A;  2PFQ A;  8ICT A;  4PHD A;  5KFY A;  1H38 A;  9ICQ A;  1K1S A;  4YP3 A;  9ICE A;  1X9W A;  3MR2 A;  4F4K A;  4F92 B;  1XC9 A;  4DFJ A;  2F1J A;  4B9U A;  2ZHB A;  1HUO A;  3OSP A;  3RAQ A;  1NJW A;  2PXI A;  1ZQF A;  1Q78 A;  4DLG A;  5J0P A;  2Q0Z X;  1QSL A;  2HHX A;  3RAX A;  4LZG A;  1MSW D;  1S97 A;  4YMN A;  4HYK A;  3M8R A;  3GQC A;  8ICF A;  1COO A;  9ICM A;  5CWR A;  3TAP A;  4F2R A;  4DL6 A;  1X2I A;  2VA3 A;  3H38 A;  2KTQ A;  4K4G A;  1BPY A;  2KFN A;  1RPL A;  4C8L A;  4M9J A;  4KLH A;  1R8B A;  4ECV A;  2VAN A;  4FBU A;  2AQ0 A;  8ICP A;  4BWJ A;  2RDI A;  9ICB A;  3FDS A;  1KDH A;  4XUS A;  3RH4 A;  3RR7 A;  4YQW A;  1ZQW A;  4DLE A;  4ED7 A;  1UA1 A;  1ZQR A;  2PI4 A;  7ICH A;  1ZQT A;  3JZ0 A;  1NO5 A;  4O3P A;  4J9Q A;  4J9R A;  2M2T A;  5BOM A;  3GIM A;  2H5X A;  4J9N A;  4DWI A;  8ICL A;  3NGD A;  5KFN A;  4DQQ A;  8ICY A;  1VFG A;  3KTQ A;  4RUC A;  1KEJ A;  2W9B A;  2BQU A;  1ZQN A;  4QZC A;  4QZF A;  4I2I A;  1B22 A;  1UEV A;  3G6Y A;  4MF8 A;  3GDX A;  3OV7 A;  4JUZ A;  3JPQ A;  4X4T A;  2FLN A;  2DPJ A;  4QZB A;  4EEY A;  3Q8L A;  1JX4 A;  5KFF A;  3IM1 A;  4EBE A;  2JEG A;  4E0D A;  3TAR A;  5HRD A;  4F93 B;  3GIL A;  2MUT A;  1XWL A;  1TK0 A;  4WC3 A;  1TAQ A;  2I1Q A;  5J2E A;  3ISC A;  4JWM A;  4UBC A;  5F9L A;  1ZQO A;  3PMN A;  2DRA A;  3HT3 A;  1R89 A;  1BNP A;  4G3I A;  3PR5 B;  2XO7 A;  3HIY A;  4RQ3 A;  4Z6E A;  3HPO A;  4DL3 A;  1ZQM A;  3MAB A;  5DBA A;  4EZ6 A;  7ICS A;  4QZD A;  4QZA A;  3KHH A;  4NLN A;  4X4V A;  1NJZ A;  7ICQ A;  3MR6 A;  4TUS A;  8ICI A;  4F4Z A;  8ICV A;  3AQM A;  9ICG A;  2NRT A;  4ED8 A;  4C8N A;  2R8H A;  5KFX A;  5DLF A;  1N48 A;  2GWS A;  4X4R A;  1MC8 A;  4IQW A;  4M9L A;  2W9B B;  2R8I A;  5EWE A;  2BCQ A;  4NM2 A;  4I2B A;  3GII A;  5CJ7 A;  4DS4 A;  3AQK A;  1L5U A;  1U49 A;  3RBE A;  2DPI A;  4S3N A;  1JN3 A;  2PBE A;  5TZV A;  5HP4 A;  2IHN A;  3T5H A;  4DL4 A;  1JXE A;  1F5A A;  4TUP A;  4X0A A;  3H40 A;  4DS5 A;  7ICP A;  4FHX A;  5DED A;  1NK4 A;  1BPZ A;  1MIY A;  2MUT B;  3BQ2 A;  1TFY A;  4PGQ A;  3TFR A;  3G6V A;  4KLF A;  1NK9 A;  4GC7 A;  4Q45 A;  4UB4 A;  2NRW A;  3B0Y A;  4J9P A;  4EBC A;  2V9W A;  1LB2 B;  3H4D A;  3EPG A;  3C2M A;  2PFP A;  4I28 A;  5HRE A;  5D49 A;  2JEI A;  2ZJ5 A;  2ASJ A;  4QW8 A;  5CHG A;  9ICS A;  4YXJ A;  1V9P A;  2BCU A;  5DB8 A;  5KFZ A;  5J29 A;  1V4A A;  5J2K A;  3GIK A;  4DFP A;  3TI0 A;  1IM4 A;  5J2G A;  3V7J A;  1L3V A;  3BDP A;  4UB5 A;  5DQH A;  2C2D A;  1T3N A;  4BDP A;  1NKC A;  8ICW A;  4YMM A;  3MGH A;  4IR9 A;  9ICH A;  1ZQV A;  8ICG A;  3PW7 A;  5KT5 A;  2F1I A;  1S0V A;  8ICM A;  4X4P A;  4UAW A;  4WC2 A;  4FS2 A;  3E2E A;  1MIV A;  2ZUC A;  4RPY A;  4UAZ A;  2BE3 A;  2KZ3 A;  2OWO A;  4R64 A;  5KFR A;  1UT8 A;  4DQS A;  5IIJ A;  4ELT A;  4IRD A;  3PNC A;  3QZ7 A;  4FS1 A;  8ICB A;  2BKE A;  3ZDC A;  2XGP A;  7ICO A;  3TQ1 A;  4BGD A;  5J0S A;  8ICS A;  5D4B A;  5JUM A;  3IHQ B;  5J2H A;  3PV8 A;  3QE9 Y;  1D9F A;  1TAU A;  2BHN A;  2ZUB A;  5CB1 A;  4P4M A;  5EWG A;  5J2I A;  4IQU A;  1XSP A;  2UVV A;  3BQ0 A;  4I2H A;  1XO1 A;  4UQG A;  4DSI A;  4JWN A;  3OHB A;  9ICF A;  9ICT A;  2ZTD A;  1MQ3 A;  3EW9 A;  4CCH A;  4O9M A;  3V6J A;  7ICT A;  4QWE A;  7ICV A;  4RQ6 A;  5F2V O;  4FH5 A;  2DR8 A;  5HRH A;  4UB1 A;  2ALZ A;  4M9G A;  3ETL A;  3UXN A;  1ARO P;  2KZM A;  5J2C A;  1HUZ A;  5KTQ A;  1BNO A;  3AUO A;  4UAY A;  4UD5 A;  4WC6 A;  5DQI A;  3RJJ A;  9ICV A;  1ZET A;  2P6U A;  3OUY A;  3JYY A;  3WFR E;  3OGU A;  5HRG A;  4RNO A;  4P4O A;  3RJF A;  4WBZ A;  3Q8Q B;  4ECS A;  2W9C A;  1D8L A;  4PGY A;  1S0M A;  5KG6 A;  3PW0 A;  4NM1 A;  4O0I A;  5J2D A;  3PX0 A;  5DBC A;  5HR9 A;  5DB7 A;  4F5Q A;  2O5A A;  4E7X A;  1U9L A;  5DDY A;  3RTV A;  4Q8E A;  4I2A A;  4QWD A;  1BGX T;  3MR5 A;  7ICF A;  8ICX A;  1X9S A;  1S0O A;  4M5D A;  3WFO A;  3HW8 A;  7ICG A;  2HHQ A;  4JV0 A;  3PW5 A;  1LV5 A;  2V4Q A;  3ZDA A;  2RDJ A;  5KG3 A;  5KFC A;  4J9M A;  2C22 A;  4WCW A;  4XRH A;  3V7K A;  3M9M B;  3SZ2 A;  3GV5 B;  4QZH A;  1U47 A;  4R65 A;  9ICP A;  4ELV A;  5L9X A;  2W9A A;  1T4G A;  3ISB A;  4YCX A;  4I2J A;  4YFK A;  4B9N A;  4KLU A;  4F8R A;  4PHE A;  2HHU A;  4KLJ A;  5C5J A;  2W8K A;  4DOA A;  4R63 A;  4RWN A;  4J9L A;  4KLD A;  2LYH A;  1PX5 A;  3UPQ A;  4KLM A;  4O5E A;  1WCL A;  3Q8K A;  1IXR A;  1KFS A;  4ELU A;  1L3U A;  4Q8F A;  5J0O A;  2JEJ A;  3C2K A;  4IG8 A;  5BOL A;  2UVU A;  1R8C A;  2W9C B;  3MFH A;  4RU9 A;  3RB3 A;  4I27 A;  1Q79 A;  4EBJ A;  3UQ2 A;  5KFE A;  9ICC A;  5KFT A;  9ICL A;  4DO9 A;  4F4W A;  2KZZ A;  3Q8S B;  4X4S A;  3T5L A;  4IR1 A;  5HHH A;  1ZQE A;  1A76 A;  2JEF A;  3C2L A;  5KFB A;  1FA0 A;  3OUY B;  4O3O A;  4EBD A;  3RJI A;  1ZJM A;  3QEA Z;  1SL1 A;  5J0X A;  5KFS A;  3TAN A;  4NLG A;  5KFG A;  7ICR A;  3RJH A;  3L9D A;  3KHL A;  4GXK A;  4M6W A;  2ZUD A;  4YR2 A;  1X9M A;  1MQ2 A;  2P6R A;  2HVH A;  4NLZ A;  2ZHA A;  4ECT A;  5DLG A;  4ZH4 A;  3N4M B;  3PX4 A;  3TAQ A;  3RBD A;  2PFO A;  4AT8 A;  3V7L A;  1QSS A;  5IIN A;  2AGP A;  4KLE A;  5L1I A;  5DB6 A;  4LT6 A;  4ED2 A;  4P2H A;  4B9S A;  5KG5 A;  5HRK A;  4I29 A;  4TUR A;  2HHV A;  4DL2 A;  2FLL A;  5CR0 A;  2ASD A;  5KT2 A;  4K4H A;  4WC5 A;  3C21 A;  3NTU A;  4FO6 A;  4RQ4 A;  3H8S A;  2RFF A;  2V4R A;  1JXL A;  4F91 B;  5KT7 A;  4KLS A;  1SKW A;  4Z6D A;  3EPI A;  2KP7 A;  3ZDD A;  1S76 D;  4WC1 A;  1ZQL A;  3NYB A;  1XS9 D;  1MIW A;  1EXN A;  2PFN A;  3H8J A;  3JPT A;  2C28 A;  4QZ9 A;  2BDP A;  4YD1 A;  1CUK A;  4KN4 A;  4YR0 A;  4F5O A;  3V6H A;  3Q8M A;  4KLL A;  4EP7 A;  4ED6 A;  3PW2 A;  4MEX A;  4O3S A;  1CEZ A;  2JZB A;  4RWO A;  4YXM A;  7ICE A;  4M6W B;  1L3S A;  4DEZ A;  1NKE A;  4KLT A;  8ICK A;  3WFP A;  3PVX A;  3WFS C;  1ZJN A;  1BPX A;  5J0W A;  4ECW A;  4AT8 B;  4JV2 A;  2PI5 A;  1D8Y A;  5IIO A;  1S9F A;  1DK2 A;  1ZQG A;  4I2C A;  4BWM A;  5IIL A;  2M2W A;  5EWF A;  2BQ3 A;  2BCV A;  4MFC A;  4EYH B;  1QTM A;  5KG1 A;  3SV4 A;  1RYR A;  3PO5 A;  3ZDE A;  4KLQ A;  3HJ1 A;  5J0T A;  2W8L A;  4YMO A;  1RXW A;  2R8G A;  5J0Y A;  5HHI A;  4DQP A;  4YR3 A;  9ICK A;  1KNY A;  2KN7 A;  4O5K A;  4RZR A;  2UVW A;  4QZE A;  3M8S A;  4DL7 A;  2BGW A;  1JAJ A;  4O3Q A;  1QSY A;  2FLP A;  8ICU A;  2DR9 A;  4KMU A;  4KLI A;  4I2F A;  2ZH6 A;  1ZQZ A;  3GV7 B;  4GXI A;  4ECZ A;  4RQ8 A;  4FBT A;  2ZH8 A;  2FPM A;  5EOZ A;  4GLX A;  1RXV A;  4TQS A;  4DSE A;  2VA2 A;  3C1Y A;  2Y1I A;  2M2V A;  4NKT A;  5KFO A;  4TUQ A;  5KFA A;  1NJX A;  2NRX A;  4M9H A;  5KFH A;  5J2J A;  4DQI A;  4ED3 A;  5L1J A;  4NXZ A;  5IIM A;  3GV8 B;  1D9D A;  4X4O A;  4FH3 A;  1ZQS A;  2JZB B;  4RPX A;  5DG8 A;  2A1J A;  3JPS A;  4ECQ A;  2HHW A;  4RWQ A;  4QZI A;  8ICQ A;  2ZH9 A;  5L1L A;  1Z00 A;  3LK9 A;  5DKW A;  3H4B A;  4ED1 A;  2HW3 A;  4FHP A;  4DQR A;  5KFD A;  9ICR A;  5DEC A;  4DF8 A;  4BXO A;  3PML A;  2IMW P;  4DFM A;  5L1K A;  2ZH7 A;  4X4U A;  3UPS A;  2XY5 A;  1NZP A;  2WTF A;  4PH5 A;  4TQR A;  1ZQK A;  3RR8 A;  3C5G A;  2Y1J A;  2J6T A;  1ZQQ A;  2BR0 A;  4DF4 A;  4X4Q A;  3ZD8 A;  1XSL A;  2IBK A;  7ICJ A;  4X4N A;  8ICO A;  4B9L A;  1Z3E B;  3V6K A;  4ECX A;  3N97 B;  3RRG A;  1S10 A;  5HRL A;  1TV9 A;  1UT5 A;  1BPB A;  4ED0 A;  3T5K A;  2NRV A;  3H8W A;  2C2R A;  2ZH4 A;  1ZQU A;  1U48 A;  3EZ5 A;  5KFP A;  1N56 A;  8ICZ A;  5DB9 A;  3OJU A;  3THV A;  3MDC A;  4C8M A;  2A1J B;  3RB0 A;  5J0U A;  2FMP A;  4RNM A;  3BJY A;  2XC9 A;  4C8K A;  1YLQ A;  1Z00 B;  5DGB A;  3G6X A;  4XA5 A;  4ATB A;  2MAX A;  1VJ7 A;  4M47 A;  5J2B A;  4F4Y A;  4BXO B;  5KFJ A;  4NKU A;  2BPG A;  3EWA A;  4WBY A;  2DVI A;  1NJY A;  1KFT A;  9ICA A;  4PHA A;  4R66 A;  3Q8P B;  1SKR A;  5KFK A;  5HRB A;  4F2S A;  4DSL A;  1BVS A;  4PPX A;  1A77 A;  4PGX A;  2M9N A;  1TFR A;  5DGA A;  4WC0 A;  4M04 A;  4Z6C A;  1T8E A;  4JK1 A;  2XY7 A;  7ICU A;  1DOQ A;  2R8J A;  9ICJ A;  3OSN A;  4EBK A;  4WC7 A;  4RNN A;  4JV1 A;  3PX6 A;  2XGQ A;  1BPE A;  1ZQI A;  2ZH3 A;  1JMS A;  1JQR A;  5KFV A;  2ZTE A;  4O3R A;  1UET A;  4RPZ A;  1TK5 A;  2FMS A;  1SZP A;  4FHW A;  3AU2 A;  2ISO A;  1NKB A;  1WCN A;  4DOB A;  1NK6 A;  3FYH A;  3QEB Z;  1RZT A;  9ICI A;  7ICK A;  4Q44 A;  4J9O A;  4I2G A;  7ICN A;  4ATB B;  5KG4 A;  3M9N B;  3KHG A;  5III A;  3PY8 A;  1TK8 A;  5HC9 A;  3OHA A;  1RYS A;  1JIH A;  2XY6 A;  5DQG A;  4I2E A;  1NOM A;  3MBY A;  1QLN A;  2Q66 A;  4EYI B;  7ICM A;  2J6U A;  4KIT B;  2ZJ8 A;  3LQC B;  5BPC A;  2DFL A;  2ZTC A;  3SYZ A;  5KFQ A;  4RQ1 A;  2XCP A;  1ZQJ A;  4KLG A;  4E8F A;  3GFK B;  4DFK A;  1WOT A;  3JPO A;  1ZQC A;  8ICC A;  4MEY A;  5J0Q A;  3T3F A;  3SI8 A;  2AU0 A;  3C66 A;  5F9N A;  3OVA A;  4M2Y A;  1TFW A;  3HP6 A;  1ZYQ A;  3RJE A;  1SL0 A;  5J2A A;  4DSF A;  1PZN A;  4K4I A;  1KLN A;  3UXO A;  5J0R A;  3C23 A;  4UBB A;  1SL2 A;  3SV3 A;  1HJP A;  4B9M A;  2O1P A;  5HMM A;  1SKS A;  1KRP A;  4J9K A;  4GXJ A;  3WFQ E;  3EYZ A;  1TVA A;  4RQ0 A;  2AGQ A;  3H3A A;  4KN7 A;  1ZQH A;  2NRZ A;  8ICJ A;  3C1Z A;  4O3N A;  3RH6 A;  2J6S A;  1OU5 A;  4FHY A;  4F3O A;  3K75 D;  1ZQB A;  5KFM A;  5KG0 A;  2XCA A;  3HX0 A;  4AT9 A;  1K1Q A;  5KFI A;  4F50 A;  4ECR A;  5KT3 A;  4RQ5 A;  5DG9 A;  2W9M A;  4ECU A;  3K4G A;  4F5R A;  2BCR A;  3JPP A;  1ZQA A;  5KFW A;  3Q8R B;  9ICU A;  4IQT A;  2BQR A;  9ICX A;  3H39 A;  4UD4 A;  4YD2 A;  1DGS A;  1XSN A;  1UA0 A;  2FMQ A;  4MF2 A;  3UQ0 A;  1NK5 A;  4RT3 A;  4B9T A;  4QW9 A;  1R8A A;  4I2D A;  4DSJ A;  4R8U A;  4B9V A;  3UXP A;  3LWM A;  5IIK A;  2R8K A;  8ICA A;  3PW4 A;  4RWP A;  4EZ9 A;  5DDM A;  4F5N A;  2BCS A;  1DK3 A;  3ORY A;  5KFL A;  3PO4 A;  1S0N A;  3OJS A;  4DL5 A;  5D46 A;  4UB2 A;  9ICN A;  2ZH1 A;  2ZH5 A;  7ICL A;  2B21 A;  3H7I A;  4DOC A;  2VA8 A;  3AU6 A;  4IRK A;  8ICH A;  4QWA A;  4YN4 A;  3RJK A;  2UVR A;  4AT9 B;  2C2E A;  4QZ8 A;  4IRC A;  4AT7 A;  4FHV A;  4X5V A;  1BPD A;  3ISD A;  3JPN A;  2AJQ A;  4J9S A;  1NK0 A;  3RB4 A;  1T7P A;  3C18 A;  2F1H A;  1B43 A;  3C5F A;  2ATL A;  3M9O B;  4X0B A;  3OVB A;  5KFU A;  1NK7 A;  2BPC A;  4QWC A;  2AQ4 A;  2IA6 A;  2HVI A;  4WC4 A;  2ZH2 A;  3RJG A;  4KTQ A;  1XU4 A;  4RT2 A;  5CP2 A;  1Y88 A;  3TFS A;  3RH5 A;  4QWB A;  1U45 A;  1S77 D;  9ICW A;  7ICI A;  8ICR A;  5J2F A;  5KG7 A;  5HNK A;  3LWL A;  4LZD A;  2ISP A;  3HWT A;  4NLK A;  2IHM A;  1NK8 A;  3QZ8 A;  4R8U B;  4C8O A;  2ID1 A;  4XQ7 A;  3MFI A;  4GC6 A;  2FPL A;  3T5J A;  3ZDB A;  2KFZ A;  3RB6 A;  3V72 A;  3H37 A;  2I9G A;  3BQT A;  2BPF A;  4IQV A;  1KTQ A;  4Z6F A;  8ICN A;  3MDA A;  1ZQD A;  1UEU A;  2HHP A;  1U4B A;  4F4X A;  3RRH A;  3MGI A;  4Q43 A;  4DSK A;  3OVS A;  4F5P A;  4QZG A;  3AQN A;  4ECY A;  4RQ2 A;  4PHP A;  5KT4 A;  5HRF A;  8ICE A;  2DR7 A;  4O5C A;  2P66 A;  5HML A;  3MR3 A;  4LVS A;  4AT7 B;  4RQ7 A;  4P4P A;  3GIJ A;  5KG2 A;  3BQ1 A;  2AGO A;  4YG2 A;  4XQ8 A;  5CA7 A;  4YVZ A;  1ZQX A;  5DG7 A;  2HHS A;  4UB3 A;  4NY8 A;  1KSP A;  1TKD A;  2M2U A;  1C7Y A;  1L3T A;  2HHT A;  3KHR A;  4M0A A;  2NRK A;  1KFD A;  3AQL A;  5KT6 A;  2DR5 A;  2DRB A;  4M9N A;  2ASL A;  2FPK A;  1ZQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...