5BPCA

Dna polymerase beta ternary complex with a templating 5clc and incoming datp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, ligase/dna
molecule keywords DNA polymerase beta
total genus 111
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bpcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bpcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bpcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bpcA03
5KFCA 3OHBA 4RNNA 4AT8B 4WBYA 4AT9B 4Z6EA 8ICLA 5HMLA 4DS5A 1LV5A 9ICJA 4QZCA 3SI8A 3TARA 4B9UA 2BPFA 3IHQB 4WCWA 3HJ4A 1ZQXA 4RQ8A 5IIJA 2AU0A 2OWOA 5BOLA 2HHVA 4DL7A 1NZPA 2W9CB 1HUOA 4B9NA 1IM4A 4J9KA 2IHNA 4I2EA 2ZH1A 4B9LA 3RH6A 1Q78A 2PI5A 3QEAZ 2ALZA 4UD4A 3PW2A 2Y1JA 3OUYA 3RBDA 1NJXA 1DOQA 4NM2A 2ZTDA 4EBDA 3WFRE 5KFFA 1UEVA 2XGPA 2PFNA 7ICHA 4RU9A 4DOAA 5KT4A 3RAQA 2KTQA 3AQKA 4MF8A 4PGYA 2DRAA 1JX4A 1TK8A 4C8OA 1XSLA 1ZQWA 2UVVA 3C1ZA 1VFGA 3NTUA 2DVIA 4K4GA 3UPQA 1OU5A 4M9GA 1SL1A 3RB6A 4YMOA 1ZQVA 3H39A 2JEIA 1S0OA 5KFLA 3MR5A 8ICGA 1SKSA 2W8KA 4KLJA 4PGQA 1TAUA 8ICFA 4JV0A 4RQ6A 4DL5A 4F4KA 4DWIA 1RYRA 3V6JA 3M9MB 8ICXA 5KT5A 4PGXA 5IIMA 4M04A 3SV4A 4O5KA 9ICNA 4DSJA 4PHPA 2C28A 4KLLA 1S77D 4J9RA 2LYHA 4TQSA 2BKEA 3SYZA 3RR8A 5D4BA 2AQ0A 1KDHA 2BCSA 4NLGA 9ICFA 5J0XA 4PHEA 3B0YA 5HNKA 4DLEA 3PNCA 4ECSA 2W9MA 3PMNA 3V7KA 1TVAA 2O1PA 1ZQYA 4AT7A 4ECQA 4DF4A 5DGAA 3BDPA 1L3TA 3GDXA 1RXVA 2ZH6A 4GLXA 4RQ5A 4F93B 2V4QA 3RJFA 4ZH4A 2BGWA 1XO1A 4NLKA 2KFZA 5DB9A 3TI0A 4KN4A 4M9NA 3JPQA 1YLQA 4RUCA 4I29A 4P4MA 2DFLA 3HW8A 3PW5A 1MQ2A 4RWOA 3MR6A 4M5DA 4RUAA 1KFTA 4YN4A 2VANA 5KG2A 4DFPA 2F1JA 4Q43A 4ECUA 1SL0A 4RQ1A 3ZDBA 2PI4A 3JPTA 8ICBA 3AQMA 2AJQA 2W9CA 5BPCA 2ZH9A 4QWCA 5DBBA 4X4QA 4P4PA 4JV1A 1XS9D 1DGSA 2FPLA 2R8JA 2DR8A 3G6XA 3PW7A 5J2IA 8ICYA 4IQUA 5J0RA 4J9QA 3V6HA 1QSLA 5KFAA 2HHPA 4ELTA 5HRBA 2ZTEA 1N48A 3Q8RB 1ZQAA 2UVRA 4X0AA 1FA0A 5KFMA 8ICSA 3AU2A 1BPZA 8ICPA 1KTQA 4DL3A 5KT3A 4GC7A 5L9XA 1SKWA 4LVSA 3AQLA 3C66A 7ICLA 2FMQA 3OSNA 3C2LA 3N4MB 2C22A 8ICQA 1B22A 4DS4A 1ZQJA 2KN7A 1COOA 2KP7A 3QE9Y 2ASLA 4WC2A 1TFYA 4O5EA 3GIMA 1K1SA 5DLFA 3PY8A 4CCHA 3JZ0A 1T3NA 3WFSC 2RFFA 7ICMA 4O0IA 3HPOA 1Z3EB 4RT2A 4EYIB 9ICGA 4FHVA 4AT7B 4X4OA 1CEZA 1JXEA 2P6RA 4R8UB 4F4YA 4FS2A 9ICMA 5HREA 4FH3A 2ZJ8A 4QZBA 3UXNA 7ICOA 4PH5A 4YMMA 3Q8MA 8ICMA 8ICZA 4DL4A 1QSYA 2KZZA 7ICSA 5HRLA 1RZTA 2ZJAA 1CUKA 1BGXT 3EW9A 4F91B 3BQ1A 4UB2A 1X9WA 1MIVA 4M0AA 1NK5A 4DQPA 5HRHA 1R8CA 4X4SA 4KN7A 3MBYA 9ICSA 3Q8PB 3Q8QB 2VA8A 2M2TA 3RRHA 3L9DA 1C7YA 4M9JA 4DFKA 2ZH2A 5D49A 4C8MA 4GXJA 3OVAA 5IIOA 4DL2A 2ZTCA 1MSWD 9ICLA 5KFGA 4TUPA 2DRBA 5EWGA 4ED3A 5DKWA 5J0PA 4KLFA 2NRZA 4YR3A 4I2AA 5JUMA 5EWFA 1KNYA 4DSLA 4F2RA 1KFDA 1D9FA 1Z00A 4QZ9A 8ICWA 4ED8A 4B9VA 4EP7A 5KFDA 2I9GA 1X9SA 1SKRA 4DOCA 4QZDA 2C2EA 2MAXA 4J9OA 1BNOA 4DO9A 5DQIA 3NYBA 2WTFA 3K75D 9ICOA 3LWLA 4YR2A 1L3SA 1U49A 2ATLA 4TUSA 9ICKA 4K4IA 1JMSA 4BDPA 3ZDEA 2ZH5A 4K4HA 2NRWA 3PX4A 2R8IA 5DECA 2BPCA 3BQ0A 4FS1A 5DEDA 1NK0A 2BE3A 1ZQSA 4IRDA 1SZPA 4KLMA 2DR7A 8ICVA 4WC7A 4YMNA 5J2BA 2R8KA 3RJJA 8ICEA 4YP3A 4X4PA 3PR5B 4F4XA 4F4ZA 1ZQPA 2W9BB 1BPXA 3V72A 4WC6A 5KG6A 4RNMA 2AGPA 3ZD8A 3QZ7A 1N56A 3RJHA 5IINA 4JV2A 3RJKA 4YXJA 5J2JA 4DQQA 7ICVA 5KFRA 5J2GA 5BOMA 1ZQLA 4P2HA 4QWBA 2ZUDA 4R66A 2HHWA 2FPMA 1KLNA 9ICXA 5KFQA 4X4RA 8ICKA 2J6UA 4I27A 2HVIA 4C8NA 4XQ8A 4R63A 3EPIA 4GC6A 5J0YA 5TZVA 4M6WB 5J0WA 2XC9A 1T8EA 1SL2A 7ICNA 2Q66A 4O3NA 5DB6A 4RWQA 3ZDCA 9ICAA 3RH5A 3RJEA 4UAZA 4RPXA 3C5GA 5KG1A 1ZQCA 4RPYA 4WC1A 3ETLA 1ZQKA 5C5JA 4KITB 3M9NB 2P6UA 1TAQA 1BPEA 1BVSA 5J0QA 3RTVA 4J9LA 7ICUA 4FHWA 5EWEA 4KLHA 4M9HA 7ICPA 1ZQNA 1V4AA 4ELVA 1JAJA 1KSPA 1WCLA 4AT8A 5KFPA 1RYSA 3H7IA 4RWPA 2W8LA 4O3OA 5DQHA 3TQ1A 1ZJNA 2GWSA 7ICIA 4J9NA 7ICKA 5HRFA 4I2IA 2HVHA 3C18A 4WC5A 1U47A 2XGQA 4NY8A 1V9PA 4NLNA 1MIWA 4DOBA 4QZAA 2BR0A 4IQVA 1S0NA 4X0BA 4R64A 9ICBA 3JYYA 3WFPA 1WCNA 1IXRA 2C2DA 1NK7A 3V7JA 4UAWA 4KLSA 4QZIA 2BDPA 5F9LA 3JPOA 3G6VA 5KFIA 4RPZA 4M2YA 3H8WA 3PO5A 3HWTA 9ICIA 4EEYA 4F5PA 4J9SA 2BQ3A 5KG7A 5CA7A 1MC8A 2ZUBA 1NOMA 5DG9A 1KFSA 2UVUA 4NKTA 3MFHA 2BQUA 1U48A 4BWJA 1QTMA 4DQIA 4I2CA 1MIYA 3HJ1A 5KT6A 2ZH3A 4QZ8A 5HC9A 4KMUA 1PZNA 4FHXA 4XQ7A 2KZ3A 4JK1A 5DQGA 7ICJA 3V6KA 3TFSA 2VA3A 3THVA 1L3VA 8ICRA 1KEJA 3OHAA 1VJ7A 2IBKA 3OSPA 2FLPA 4ATBA 1TK5A 4ECXA 1D9DA 4JWNA 3T5KA 4M9LA 3H4DA 4E8FA 4F5OA 3MDAA 2M9NA 3MFIA 2BPGA 5L1JA 2W9AA 3C21A 5DG7A 3OGUA 3RAXA 1TFWA 4QZFA 1UA1A 3UPSA 4MFFA 3H8SA 2A1JB 4WBZA 4XA5A 1TFRA 3JPSA 1TK0A 4KLOA 4DL6A 5KFUA 4Z6DA 9ICEA 5KG3A 3KHRA 3ZD9A 4PHDA 3T3FA 5F2VO 5KFYA 2Y1IA 3GIIA 2Q0ZX 1UETA 5CP2A 4B9SA 4UB4A 2DR5A 4KLTA 2PFQA 3PVXA 4I2HA 5CB1A 4LZGA 3C2KA 5J2FA 5DBAA 2AGQA 1KRPA 4RQ0A 4KTQA 1DK3A 5HRKA 3RB0A 3T5LA 3IM1A 3RJIA 4NXZA 5J0TA 1ZQMA 1ZQEA 4O9MA 1Q79A 4QZHA 3GILA 3ZDDA 1JN3A 5HHIA 8ICHA 5KFSA 3GV5B 4S3NA 4Z6CA 3H40A 1ZQGA 9ICHA 2BHNA 5KFEA 4F50A 2PFPA 2ZH8A 3K4GA 1EXNA 1U45A 1RXWA 1NK4A 5DLGA 2FMSA 4MFAA 1Y88A 8ICJA 2ZHAA 5IILA 4DFJA 3FYHA 2M2WA 3PV8A 5KT2A 1LB2B 2NRVA 1XU4A 3UXOA 4HYKA 3KHHA 1ZJMA 4FBTA 2NRKA 3FDSA 4XRHA 1UEUA 2HW3A 2ZH7A 1S10A 1NKEA 3V7LA 4LT6A 2JEFA 4UB5A 3MABA 4QWAA 2XY6A 2BQRA 4I2FA 4RQ3A 5KFKA 4YD2A 5J2KA 4DF8A 2B21A 5DB7A 4XUSA 5IIIA 3HX0A 4RQ2A 4DSKA 4MF2A 5CWRA 3GIJA 9ICQA 3RH4A 2H5XA 4X4UA 5L1LA 5HRGA 5HP4A 2DR9A 4ATBB 4I2GA 4KLEA 4PHAA 3H3AA 3QEBZ 1BPYA 2ZHBA 3ISCA 4BXOA 1BPDA 4LZDA 3NGDA 1S76D 3MGIA 3LWMA 2ASDA 4ELUA 4R8UA 3OJSA 5KFJA 2NRXA 4DEZA 3T5HA 3SZ2A 5DGBA 2FLNA 3TFRA 2ZJ5A 1UA0A 4B9MA 1BPBA 1NKBA 4X5VA 3OUYB 4UBCA 4EBEA 1S97A 3UQ2A 1R89A 4FO6A 2PXIA 4ECRA 3AU6A 7ICFA 2R8HA 2O5AA 3ISBA 1ZQUA 5DDMA 9ICCA 4J9PA 3RRGA 2R8GA 3HP6A 4F2SA 1K1QA 1D8YA 4I2JA 5KFZA 3EPGA 4YCXA 4Q45A 2DPIA 2ISOA 8ICUA 1MQ3A 4UB3A 5KG4A 3RR7A 2IMWP 3PX0A 4KLIA 4ECVA 1ZQTA 4NKUA 4GXIA 4EZ6A 4TUQA 3KHGA 4C8KA 8ICIA 4YG2A 1Z00B 3B0XA 4E80A 4ECYA 4IR9A 3E2EA 4F4WA 3PMLA 4TQRA 1S0VA 2HHUA 3EYZA 5KTQA 2KFNA 2JZBB 2PBEA 3PW4A 3MR2A 2I1QA 5KFBA 4KLDA 8ICAA 3RJGA 1S9FA 1ZQDA 9ICTA 4O3PA 3M8SA 5J0OA 2MUTB 4BXOB 5CJ7A 4F3OA 3H38A 2FPKA 3Q8KA 3RB3A 2C2RA 2V9WA 2UVWA 4PPXA 2HHXA 1JQRA 7ICEA 2ZH4A 4EYHB 4IQWA 2AQ4A 9ICVA 4YQWA 3Q8SB 3AQNA 3BQ2A 3GQCA 1S0MA 4Q8FA 2P66A 2J6SA 2W9BA 7ICTA 2NRTA 5CR0A 4RZRA 3PX6A 2HHSA 1HUZA 4Q8EA 3HIYA 4X4NA 4QWDA 2V4RA 4YVZA 4KLGA 5HRIA 4M47A 1QLNA 5KT7A 3UQ0A 5DDYA 3T5JA 5L1IA 2DPJA 3KTQA 1WOTA 4AT9A 4EZ9A 5KFXA 2ID1A 5F9NA 5KFOA 2ISPA 1F5AA 3OVBA 4QW8A 4O5CA 2HHTA 4ED1A 1U4BA 1D8LA 2XO7A 3ZDAA 4UAYA 5J0UA 1BNPA 4UD5A 1ZQFA 4C8LA 4ED7A 4J9MA 2BCRA 2XCPA 4IR1A 8ICTA 3BJYA 7ICQA 4YFKA 3C23A 3AUOA 3H8JA 2XY7A 3MDCA 1XSPA 1T7PA 1JXLA 1NK8A 5KG0A 4Z6FA 2JEGA 1R8AA 3OVSA 3QZ8A 3M8RA 3MGHA 1ZQBA 1NKCA 3PO4A 5L1KA 4ED2A 4I2BA 4ECWA 1X9MA 4EBKA 5HRDA 2F1HA 2M2UA 1X2IA 2M2VA 2IA6A 4FBUA 4X4TA 2F1IA 2AGOA 5J2CA 9ICRA 4RQ4A 3GV7B 3LDAA 2JZBA 1A76A 5HMMA 3JPNA 5KG5A 4Q44A 3PW0A 4IRKA 1NK9A 4IQTA 1QSSA 4X4VA 5DB8A 4I2DA 3LK9A 3EZ5A 4KLUA 2HHQA 4E7XA 3KHLA 4QZEA 2FLLA 4F5RA 1NJZA 4KLQA 5KFWA 7ICGA 4MEXA 4MEYA 4ED0A 4EBJA 4FHPA 3WFQE 1NJWA 5IIKA 4WC3A 4F92B 5KFHA 1PX5A 9ICUA 5J2AA 2KZMA 4RQ7A 4F8RA 9ICPA 3TAPA 4JUZA 3C2MA 5J29A 2VA2A 1ZQRA 4MFCA 2XCAA 5DG8A 4FHYA 4O3SA 1JIHA 4UBBA 5J2HA 3BQTA 2RDJA 4RT3A 4NM1A 4WC0A 1L5UA 2PFOA 1NO5A 4YD1A 4DLGA 5KFTA 2RDIA 3Q8LA 1UT8A 5KFNA 1ZYQA 4DSEA 4F5QA 3TANA 1T4GA 3M9OB 2JEJA 4DSIA 3C5FA 4G3IA 4IG8A 1TKDA 1H38A 4UB1A 4O3RA 1XSNA 3HT3A 4QWEA 4QZGA 1ZQQA 4YXMA 1L3UA 3GFKB 3JPPA 3C1YA 4ECZA 3RBEA 5EOZA 1XWLA 4JWMA 3SV3A 4ECTA 1ZQZA 2FMPA 9ICWA 1B43A 8ICOA 4WC4A 1XC9A 2J6TA 4ED6A 2XY5A 4NLZA 8ICCA 4EBCA 4B9TA 4I28A 1NJYA 4BGDA 4YR0A 3GIKA 3H37A 3WFOA 8ICNA 4R65A 4E0DA 4BWMA 4UQGA 4P4OA 3GV8B 5HHHA 3PR4A 3ORYA 2ASJA 1UT5A 4DQRA 2BCQA 4TURA 4DQSA 1A77A 4RNOA 2ZUCA 1ZETA 4O3QA 3UXPA 4QW9A 2MUTA 5D46A 5J2EA 5HR9A 3OJUA 3RB4A 5J2DA 2BCVA 4IRCA 1HJPA 4GXKA 1TV9A 3TAQA 2IHMA 3H4BA 2A1JA 1ZQOA 1U9LA 5KFVA 1ZQHA 5CHGA 7ICRA 3LQCB 3JPRA 3ISDA 4DSFA 1AROP 1ZQIA 5J0SA 1RPLA 3EWAA 3MR3A 1R8BA 4RWNA 4F5NA 3G6YA 1NK6A 5DBCA 4FH5A 4M6WA 3N97B 3OV7A 2BCUA 4DFMA 1DK2A
chains in the Genus database with same CATH superfamily
4AT8B 2E3TA 2YMQA 4AT9B 4DS5A 5FP0A 4QZCA 2OWOA 2HHVA 4DL7A 1IM4A 4J9KA 4B9LA 3RH6A 3F2DA 4UD4A 3PW2A 1A0PA 2EQYA 1DOQA 3WFRE 5E79U 5KT4A 4KX5A 4PGYA 1J2MA 4C8OA 2VKQA 3C1ZA 5AKGA 3LVVA 5CFTA 4JMUA 8ICGA 2VJ5A 4JV0A 4RQ6A 3V6JA 3SENA 5KT5A 9ICNA 5ALMA 4KLLA 3M1YA 2RQ5A 3AL0B 2BCSA 9ICFA 4NLGA 3D6JA 3IDWA 5HNKA 4ECSA 1TVAA 2O1PA 2W9MA 1ZQYA 1L3TA 1RXVA 4GLXA 2QB1A 1XO1A 2KE7A 5DB9A 1QQ6A 4KN4A 4OJOA 1UQVA 1YLQA 4I29A 1MQ2A 4NWIA 4RUAA 3CNHA 5AKYA 1KFTA 3ZDBA 2VANA 4DFPA 2PI4A 2F3NA 3AQMA 5B3QA 3UMBA 5DBBA 3D2QA 4X4QA 3QUTA 8ICYA 3PW7A 5J2IA 4ELTA 1N48A 1ZQAA 5KFMA 3AU2A 2DWQA 5D61A 1N5XA 4GC7A 3AQLA 2W43A 2FMQA 3NVWA 2KN7A 2KKVA 3QE9Y 4CCHA 3NASA 7ICMA 2RFFA 4RT2A 4EYIB 1JI7A 5CEHA 1CEZA 1JXEA 2P6RA 2A19A 4R8UB 2EAOA 5TISU 1RM6C 4DL4A 5HRLA 1SV0A 1CUKA 5B3PA 2L5YA 1NK5A 5AM5A 4DQPA 4PZNA 5AIBA 3QX7A 4OJPA 2ESEA 5ALZA 2ZH2A 1ZD4A 4C8MA 2KEYA 1IIPA 5KFGA 2DRBA 4ED3A 4KLFA 2G06A 5EWFA 1KNYA 1SKRA 4AYBC 4DOCA 1ZD3A 1P7DA 2ZIVB 1L3SA 3I28A 4K4IA 4BDPA 2IOFK 2EWRA 1CI4A 2BPCA 4KLMA 4YMNA 3RJJA 1WYGA 4YP3A 4F4XA 4F4ZA 3QU7A 5KG6A 1AQ6A 2AGPA 3QZ7A 5IINA 4JV2A 5J2JA 9ICXA 4P2HA 4C8NA 4GC6A 2B56A 5J0YA 2XC9A 1T8EA 1SL2A 2Q66A 4O3NA 2QKQA 3F53A 2JV3A 4RPXA 2KIVA 5KG1A 4EEKA 4WC1A 3ETLA 4KITB 7ICUA 1BPEA 3RTVA 5J0QA 2W3RA 2H3QA 1KSPA 1WCLA 4AT8A 1VJ5A 1ZJNA 1ED1A 3AMZA 5DQHA 7ICKA 5HRFA 3JYYA 4WC5A 3DV9A 4UAVA 4NLNA 3CK6A 4IQVA 1S0NA 9ICBA 3WFPA 2KOBA 2BDPA 2BBHA 3CRXA 4J9SA 2BQ3A 5CA7A 4FFDA 2UVUA 3MFHA 3F2BA 4DQIA 2DGZA 3HJ1A 4QZ8A 5ALQA 3IN5A 2JR5A 4JK1A 2F76X 5DQGA 1UCVA 3V6KA 1KEJA 2YB1A 2FLPA 3AEVA 1TK5A 2HMXA 1X42A 4ECXA 1D9DA 5H2FU 5EE9A 5AM2A 2H3IA 1B0XA 2E8PA 4KLOA 1N61A 4DL6A 9ICEA 3UMCA 3ZD9A 3KHRA 3T3FA 2GLEA 5KFYA 3VC8A 2Y1IA 1QH9A 5CP2A 5AHXA 4UB4A 1L7MA 4EV6A 3PVXA 4I2HA 2JH1A 1KRPA 2W03A 5HRKA 3ER8C 4RQ0A 1RQNA 5AM3A 5J0TA 1Q79A 4O9MA 1D8BA 1L7OA 4C4TA 4QZHA 5HHIA 4BX9C 3IP4B 3GV5B 3ONNA 4S3NA 4Z6CA 2KHQA 3SAHA 2BHNA 5KFEA 2PFPA 2AXTU 3K4GA 5DLGA 1V85A 2NRVA 4FBTA 4XRHA 2HW3A 1RG6A 4NLCA 4QIWC 3MABA 4O68A 4RQ3A 5KFKA 4YD2A 3JCFA 5DB7A 4XUSA 4DSKA 4MF2A 4RQ2A 2NV3A 9ICQA 2H5XA 3BS7A 4FO1A 4ATBB 1ZRNA 4I2GA 4KLEA 3QUBA 5CFSA 2ZHBA 3F5AA 2JXJA 2ASDA 4ELUA 3OJSA 4DEZA 2JHDA 2KNJA 4B9MA 2E8OA 4X5VA 4UBCA 1S97A 1X6IA 4ECRA 3KBBA 3ISBA 1F5SA 9ICCA 3UM9A 1K1QA 2QARB 3WK9A 1D8YA 5HR7A 2F8KA 4UB3A 5KG4A 4KLIA 4GXIA 5ALUA 3DDHA 2G07A 3B0XA 4E80A 2FDRA 3H8MA 5D63A 4F4WA 5L1MA 2HHUA 2PBEA 3E0FA 4UARA 5KFBA 4KLDA 3RJGA 2KVCA 5J0OA 4BXOB 3WK6A 3RB3A 2HHXA 4EYHB 3AQNA 2J6SA 7ICTA 3KZXA 5CR0A 3PX6A 2HHSA 4Q8EA 2DBYA 4QWDA 2V4RA 1KBUA 4KLGA 4M47A 4ICAA 2M0NA 5KT7A 3UQ0A 2DPJA 3ALRA 5KFXA 2WFAA 5KFOA 1F5AA 3OWGA 4IC9A 4O5CA 2HHTA 1U4BA 4QJFB 4UAYA 4UD5A 1PK3A 1MN8A 1X6JA 4J9MA 4IR1A 7ICQA 3AUOA 3H8JA 8ICZA 2JEGA 4Z6FA 4EBKA 1X9MA 1XNSA 2F1HA 4EENA 5CFUA 5J2CA 5AICA 3QXGA 3LDAA 2JZBA 5GTIU 5B5EU 3F5EA 2EANA 1NK9A 4IQTA 1QSSA 3MCRA 3LK9A 3EZ5A 4KLUA 3KHLA 4QZEA 4EBJA 5AI0A 4MEYA 4ED0A 4MEXA 3PHZA 5AKEA 9ICUA 2XI9A 9ICPA 3TAPA 1ZQRA 4PL1A 5DG8A 4O3SA 1JIHA 3BQTA 2RDJA 4RT3A 4DLGA 5KFTA 2RDIA 3Q8LA 2JEJA 4F5QA 3WKEA 3TANA 1VDVA 4G3IA 2E8MA 4IG8A 1H38A 4UB1A 4K96A 1LKYA 4WJ3B 3KKAC 5EOZA 1XWLA 4JWMA 1ZQZA 2ZIUB 3LVWA 2J6TA 2KJ8A 2QB0A 1L8LA 3GIKA 3H37A 2VJ4A 4R65A 4UQGA 2ASJA 4DQRA 4DQSA 4RNOA 3NVZA 1ZETA 2MUTA 5D46A 3OJUA 1WWUA 4Y2SA 4GXKA 1TV9A 5ALJA 3K1RB 3H4BA 4FZMA 1ZQHA 5CHGA 7ICRA 3JPRA 4DSFA 1ZQIA 3N28A 4PZOA 5J0SA 4RQNA 3G6YA 4M6WA 1DK2A 3OHBA 4RNNA 5D62A 1LVHA 3TARA 4B9UA 3IHQB 2ZIUA 3HJ4A 1ZQXA 5BOLA 4PJ0U 2EZZA 1HUOA 4I2EA 4CRXA 2ALZA 2MSNA 2Y1JA 3U26A 3RBDA 2HN1A 3KFUF 4EBDA 1ZD5A 5CHEA 4DOAA 3AQKA 1JX4A 3HILA 1DRGA 2YMPA 1OUQA 1ZQWA 5F3XB 4NXVA 1VFGA 3NTUA 4USAA 4K4GA 1SL1A 2CRXA 4YMOA 3I1YA 3MR5A 2W8KA 4PGQA 8ICFA 2GO7A 4DL5A 4CF5A 2B4VA 4F4KA 4IS7A 4DWIA 8ICXA 3M9MB 4PGXA 5IIMA 1OXJA 3SV4A 4M04A 3SEIA 2C28A 2JRZA 3TKAA 3SYZA 3RR8A 2AQ0A 1KDHA 3CP8A 1SXDA 3FM9A 4PHEA 3PNCA 3L4PA 4ECQA 3BDPA 4F93B 2V4QA 2BDUA 4NLKA 2KFZA 3SAFA 2RP5A 5AKJA 4RUCA 4RWOA 2HCFA 2F1JA 3JPTA 3BQ7A 2AJQA 4Y2YA 4P4PA 4JV1A 1DGSA 2DR8A 4IL6U 4J9QA 5KFAA 1YZ7A 5ALWA 1A6SA 2UVRA 4X0AA 1FA0A 5KT3A 3C66A 5L9XA 2WF9A 1SKWA 2MA1A 5GTHU 2C22A 1ZQJA 1COOA 4WC2A 1TFYA 5DLFA 2ZIWA 2KMDA 3WFSC 4O0IA 3HKZF 3HPOA 4FHVA 3IG5A 5AKHA 2AH5A 5ALKA 9ICMA 4QZBA 8ICMA 3Q8MA 4J03A 1RZTA 2ZJAA 1X9WA 3BQ1A 4UB2A 1TAMA 1R8CA 1YT3A 3ETRA 4KN7A 9ICSA 2M2TA 2HDOA 5IIOA 9ICLA 4TUPA 5EWGA 5J0PA 2NRZA 4GFJA 5JUMA 4F2RA 4QZ9A 8ICWA 4B9VA 2YTUA 2KICA 4DO9A 5DQIA 5K4LA 2WTFA 3K75D 3LWLA 3WK8A 2ZH5A 4K4HA 2R8IA 3H0RB 4WH5A 1HIWA 1NK0A 3B9JA 5AKIA 4WC7A 2R8KA 8ICEA 3PR5B 1ZQPA 3SR6A 1BPXA 4RNMA 3ZD8A 3ICXA 1SV4A 2E1EA 3RJKA 4YXJA 2WF8A 4DQQA 5ALGA 5BOMA 2W3SA 3R9KA 4K9BA 8ICKA 3PSFA 4XQ8A 2W7PA 4M6WB 4RWQA 9ICAA 5ALSA 1ZQKA 5C5JA 5J8YC 1TAQA 1J97A 4KLHA 4M9HA 3VCBA 1V4AA 4ELVA 1JAJA 5KFPA 7ICIA 1SIJA 4J9NA 3C18A 4I2IA 1U47A 4NY8A 1MIWA 4DOBA 4X0BA 1DGJA 1ECWA 2DKZA 2C2DA 3UMGA 5EE0A 3PO5A 3HWTA 9ICIA 3AM9A 1NOMA 2LPEA 4KB6A 1PVRA 4NKTA 1U48A 1QTMA 5HC9A 1L6NA 2KZ3A 4MHVA 2VA3A 3TFSA 4ATBA 3BS5B 4F5OA 5T14A 3MDAA 3RAXA 5DG7A 4QZFA 1Q3VA 3D2SA 4WBZA 1TFRA 3JPSA 1IG6A 5KG3A 5F2VO 1UETA 2Q0ZX 2DR5A 2KSOA 4KLTA 1X66A 3C2KA 2K89A 5DBAA 3T5LA 1ZQMA 2WAQC 3GILA 3ZDDA 5KFSA 2F8LA 9ICHA 4F50A 1S8OA 1EXNA 2K4EA 1U45A 2I6XA 1NK4A 5KNIA 1Y88A 4DFJA 1XU4A 3KHHA 3WK4A 3FDSA 1UEUA 2ZH7A 1NKEA 2JEFA 1B4FA 2XY6A 2BQRA 4EX7A 1T94A 2B21A 4X4UA 1SV0C 3NVVA 3H3AA 1BPYA 3ISCA 1BPDA 3NGDA 2HBLA 2K8CB 3LWMA 4ZOHC 1DXSA 3M6KA 5DGBA 2GAFD 1UA0A 1BPBA 3OUYB 5AI4A 3WK7A 4F71A 2DKXA 1ZQUA 4Y2JA 5DDMA 4F2SA 4I2JA 2A1AA 2R18A 4Q45A 2DPIA 8ICUA 1MQ3A 1RDFA 2Y9UA 2K4HA 1SGGA 8ICIA 4YG2A 1S0VA 2HOIA 3NRWA 1S9FA 4O3PA 3H38A 2UVWA 3Q8KA 3BZKA 2B51A 4PPXA 7ICEA 2ZIXA 2AQ4A 9ICVA 3Q8SB 1ZQ1C 2P66A 2W9BA 2NRTA 4X4NA 5HRIA 4JB3A 4NXWA 5DDYA 3AQEA 1WOTA 2O6KA 3OPXA 2G5IB 2XO7A 3ZDAA 1BNPA 2XCPA 2GA9D 5KG0A 2N1RA 1Z1VA 4C0ZA 4CNQA 3QZ8A 3M8RA 1Z19A 4I2BA 5L1KA 3RF9A 2KD1A 2M2UA 2WHEA 4NL9C 4FBUA 2EDUA 3AQFA 5JRTA 2AGOA 9ICRA 5CRXA 2GOLA 4US9A 3GV7B 5AIAA 3JPNA 3PW0A 4UB6U 4X4VA 3SQIA 5DB8A 1TE2A 2HHQA 4E7XA 1NJZA 4KLQA 7ICGA 4FHPA 1NJWA 4WC3A 3TACB 1PX5A 5KFHA 2KZMA 1L8OA 3C2MA 2QLTA 2VA2A 1Z1BA 4K97A 4YD1A 3BS5A 4UASA 1UT8A 5KFNA 2H3ZA 2KV2A 4XJEA 4NV0A 4QWEA 4QZGA 1Q46A 1ZQQA 2DL0A 3GFKB 2W55A 2G08A 3C1YA 4ECZA 2HOFA 5G5HA 9ICWA 1FEZA 3SV3A 4ECTA 4WC4A 1XC9A 2XY5A 8ICCA 4EBCA 4BGDA 5AI5A 1Z4OA 3GV8B 3ORYA 2D6FC 1KN5A 3UXPA 4QW9A 5J2EA 5HR9A 3RB4A 2A1JA 1FFUA 3E58A 1ZQOA 5KFVA 3LQCB 3EWAA 3MR3A 4RWNA 1QQ5A 2IOHA 1SWVA 4FH5A 2OH2A 1FIQA 5KFCA 2WF6A 4LEYA 2VIXA 2YN4A 4WBYA 2EZYA 1LV5A 9ICJA 4Y2PA 1JROA 3SI8A 2BPFA 2AU0A 5IIJA 3ZI4A 1UHUA 4B9NA 2IHNA 4ACOA 2ZH1A 2PI5A 4CF3A 3OUYA 2CN1A 5AK6A 4NM2A 2ZTDA 1L7PA 5KFFA 2XGPA 2PFNA 4RU9A 3RAQA 2KTQA 4MF8A 2DRAA 1XSLA 2UVVA 2DVIA 3UPQA 1OU5A 3H39A 2DQNB 1SKSA 4KLJA 5EE3A 1RYRA 4O5KA 4DSJA 4PHPA 1S77D 2BKEA 4P0PA 5D4BA 1V38A 5J0XA 4DLEA 3PMNA 4AT7A 3DEEA 2ZH6A 3GDXA 2Z7JA 2F77X 2BGWA 2HN2A 3TI0A 4M9NA 3HRDD 1COKA 3PSPA 2DFLA 4P4MA 3HW8A 3MR6A 3NKUA 5AKKA 4YN4A 1SL0A 4K98A 2P35A 8ICBA 3K7DA 2W9CA 2FPLA 4IQUA 5J0RA 3V6HA 1C20A 1QSLA 2HHPA 5HRBA 2ZTEA 3Q8RB 3SD7A 1KTQA 4DL3A 4LVSA 3J81j 3OSNA 3C2LA 8ICQA 3SMVA 4EX6A 3TADC 4O5EA 3GIMA 3PY8A 3JZ0A 1T3NA 1PVQA 2B0CA 1Z3EB 9ICGA 4AT7B 4X4OA 1RYUA 3WKAA 2XICA 4FS2A 2WAQF 4F4YA 7ICOA 3UXNA 4YMMA 4QIWF 5JTGA 2KZZA 3NUQA 1BGXT 4F91B 1MIVA 2XVTA 5HRHA 4X4SA 4AYBF 3Q8PB 2IHOA 3Q8QB 5AKZA 3RRHA 3L9DA 3LYSA 4DFKA 5D49A 4GXJA 2ZTCA 1MSWD 4LEWA 2D3DA 4EELA 2XIDA 5HR6A 5DKWA 1O03A 4I2AA 2DF4B 1KFDA 1Z00A 3KKAA 4ED8A 4EP7A 2MRLA 3QU4A 5KFDA 4QZDA 2MAXA 3QUCA 3NYBA 4YR2A 1U49A 4TUSA 9ICKA 1JMSA 3ZDEA 2JGAA 5DEDA 1ZQSA 2CPRA 5J2BA 2Q4TA 1N2XA 3N7SC 3V72A 4WC6A 1N56A 3RJHA 1NNLA 4QWBA 4R66A 5KFQA 2J6UA 3OTQA 2IOFA 2HVIA 1S5LU 4R63A 5AI9A 5J0WA 3PZPA 3ZDCA 1J2NA 5AKXA 3RH5A 3RJEA 3C5GA 2P6UA 4FHWA 3K1ZA 1RYSA 3H7IA 4RWPA 3ED5A 2W8LA 3TQ1A 2RHFA 2GWSA 5AK3A 2XGQA 1V9PA 1RQLA 1KQQA 1IXRA 1NK7A 3V7JA 4UAWA 3EF2A 4K99A 5KAFU 4QZIA 3NVOA 3MGVA 5KFIA 4RPZA 1L7NA 4F5PA 5KG7A 5DG9A 2ZUBA 4CDGA 1KFSA 2YX8A 2EAMA 2BQUA 4KMUA 1PZNA 4FHXA 2FJ6A 3OHAA 1VJ7A 4JWNA 3QYPA 3H4DA 4E8FA 2DUYA 3MFIA 3OGUA 3UPSA 4MFFA 5A0LA 4K8VA 4XA5A 3QNMA 1TK0A 4PHDA 1GPJA 4HX0A 4B9SA 1ZOLA 2PFQA 4PL2A 4LZGA 5J2FA 5ALFA 1DK3A 3IM1A 3KD3A 8ICHA 2W7OA 4O69A 2EAPA 1ZQGA 5ALYA 4WOYA 1N60A 4A8EA 3RFAA 5AK5A 8ICJA 2ZHAA 4LEZA 4MFAA 4DCCA 4NL9A 4RQMA 3PV8A 3I76A 1ZJMA 2EH9A 2NRKA 3PSTA 3TADA 4LT6A 4QWAA 4I2FA 5J2KA 9ICOA 2ZIXB 5CWRA 3GIJA 4Y2UA 5L1LA 5HRGA 2DR9A 2AHOB 4BXOA 4U6PA 4LZDA 2LM1A 1S76D 3MGIA 2BBJA 2E5SA 4WQLA 4R8UA 1URJA 2NRXA 3T5HA 3SZ2A 2FLNA 2LBOA 1HEKA 3F2CA 1NKBA 4CF4A 4EBEA 3KOOA 3WU2U 2PXIA 3AU6A 3RRGA 3HP6A 1WWVA 5ALNA 2IMWP 4OAGA 1ZQTA 4NKUA 2KJ5A 2LHTA 4EZ6A 3EUB2 2EZXA 1ZD2P 1Z00B 3QUQA 1V97A 4ECYA 4TQRA 3EYZA 5KTQA 3PW4A 2I1QA 8ICAA 1ZRMA 9ICTA 3M8SA 5CJ7A 2OM6A 1IV8A 2FPKA 2V9WA 4NJ8A 2ZH4A 1SB3C 2PMZF 4Q8FA 1S0MA 1HUZA 3HIYA 4YVZA 1QLNA 5L1IA 2JMGA 3KTQA 5J8YA 4AT9A 4EZ9A 1JRPA 2ID1A 5F9NA 3OVBA 4QW8A 4AP9A 2KSOB 4ED1A 4B6JA 5J0UA 1ZQFA 4C8LA 2WB1C 2BCRA 4C7YA 1ZXIA 8ICTA 3BJYA 4YFKA 1XSPA 1R8AA 3OVSA 1JXLA 2ES6A 1NK8A 1ZQBA 4OO1J 1NKCA 5HRDA 2IUBA 4X4TA 2F1IA 3HJEA 5ALLA 1A76A 5HMMA 2ZXIA 5KG5A 4IRKA 4Y2VA 2QB0B 2FLLA 4F92B 4FZNA 4P0QA 5J2AA 2KK0A 2PMZC 2LYBA 4JUZA 4MFCA 2F44A 1OW5A 4WC0A 1L5UA 1NO5A 3QU5A 4DSIA 1ZYQA 1T4GA 2OCEA 1XSNA 2E1FA 4FE3A 5EE1A 2K60A 3GU3A 5ALOA 3RBEA 5AM0A 2FMPA 8ICOA 4Y2TA 2D8CA 4NLZA 1NJYA 4YR0A 1X40A 2NYVA 4BWMA 4P4OA 2BCQA 3C29A 4TURA 4NXUA 4P0QB 2B6GA 5ALHA 4BUGA 1HJPA 2KJ9A 2IHMA 2LM4A 3ISDA 1AROP 1RPLA 1R8BA 4F5NA 4WQKA 5DBCA 4OJ5A 3N97B 3OV7A 2KIWA 4DFMA 3M6ZA 3L5KA 4FZLA 5ALTA 4Z6EA 8ICLA 5HMLA 1N5WA 4WCWA 1NZBA 3T79A 4RQ8A 2YMLA 1NZPA 2W9CB 1Q78A 4I0UA 3QEAZ 5AM4A 5G5GA 4C4SA 1NJXA 1UEVA 7ICHA 4GIBA 1TK8A 1T3QA 1KL9A 4M9GA 3RB6A 3H0LB 1ZQVA 2JEIA 1S0OA 5KFLA 1TAUA 2I5HA 3NWIA 2F2AB 4HAIA 3WKDA 4J9RA 4NLBA 2LYHA 4BJQA 4C80A 4TQSA 1PVPA 3B0YA 2JH7A 3V7KA 4DF4A 5DGAA 2KVSA 2YMMA 4RQ5A 3RJFA 4ZH4A 2CXYA 3JPQA 2K8BB 3ERCC 3PW5A 5C0YA 5ALDA 4M5DA 5KG2A 4Q43A 4ECUA 4RQ1A 2ZH9A 5BPCA 4QWCA 2ZXHA 1XS9D 2R8JA 4Y2XA 3G6XA 4U7CA 3GZFA 3BZCA 4LEVA 5AM1A 2Y0SC 8ICSA 1BPZA 8ICPA 3IRUA 4Y2RA 2NO4A 7ICLA 3N4MB 1B22A 4DS4A 2HSZA 2KP7A 2ASLA 1K1SA 2H3FA 1WUDA 3O0FA 1SZHA 3A0HU 1M6YA 4DFDA 2K4PA 1Z4NA 4FH3A 5HREA 2ZJ8A 4P0PB 4PH5A 1QSYA 7ICSA 3FC4A 3EW9A 4UB8U 4M0AA 3WKCA 3MBYA 3CYMA 1WG8A 2VA8A 1C7YA 4M9JA 4UW9A 3OVAA 3A0BU 4DL2A 4F72A 4YR3A 2HI0A 4DSLA 1N62A 2FE9A 1D9FA 1F0MA 3N7PD 2I9GA 1X9SA 2C2EA 4J9OA 2LYAA 2RLTA 5KAIU 3NVYA 2ATLA 3SAGA 3AN1A 2NRWA 3PX4A 5DECA 4KX3A 3BQ0A 4FS1A 1QCKA 2BE3A 4IRDA 1SZPA 2KKPA 2FI1A 2DR7A 8ICVA 1MA7A 4O6AA 4X4PA 5ALXA 4OJ6A 5JTIA 4LJXA 2W9BB 2YY6A 4QNLA 7ICVA 5KFRA 5J2GA 1ZQLA 2HHWA 2ZUDA 2FPMA 5KL1B 1KLNA 4X4RA 4I27A 3EPIA 7ICNA 5TZVA 5DB6A 3ER9B 4UAZA 1ZQCA 4RPYA 1BNOA 3M9NB 1BVSA 4J9LA 5EWEA 7ICPA 1ZQNA 4O3OA 4MKPA 5AKLA 2HVHA 2BZFA 3L3FX 1SWWA 3CW2C 4QZAA 2BR0A 2ZG6A 4R64A 4KMOB 1WCNA 4KLSA 5F9LA 3JPOA 3G6VA 4M2YA 3H8WA 2E8NA 4EEYA 1MC8A 2Y9TA 3KZIU 4NXXA 5AI6A 2W54A 3WK5A 4I2CA 4BWJA 1MIYA 2ZH3A 5KT6A 4XQ7A 7ICJA 8ICRA 3THVA 1L3VA 2IBKA 3OSPA 4M9LA 3T5KA 3NS1A 2M9NA 2BPGA 1TFWA 2G09A 2YB4A 3C21A 2W9AA 5L1JA 2H3VA 1UA1A 2A1JB 3H8SA 4OCZA 2MU2A 5KFUA 4Z6DA 3QU9A 3GIIA 4N7RA 1XO0A 5CB1A 4UATA 2AGQA 4KTQA 1PK1A 3RB0A 4UAUA 3RJIA 4NXZA 1ZQEA 1KW4A 2WF5A 1JN3A 3H40A 1YZ6A 2ZH8A 2HBJA 1RXWA 3NRZA 2FMSA 5IILA 3FYHA 2M2WA 5KT2A 1LB2B 3UXOA 4HYKA 5ALIA 4C7ZA 2ZIWB 1QQ7A 1S10A 3V7LA 3H0MB 4UB5A 4E0DA 4DF8A 3HX0A 3D2NA 5IIIA 2HBKA 3RH4A 5HP4A 4PHAA 3QEBZ 4G9BA 5KFJA 3S6JA 2WF7A 5KL8B 1F44A 2G0AA 3HKZC 3TFRA 1GO3F 2ZJ5A 2Y0SF 3UQ2A 1R89A 4FO6A 2A3VA 4KM5A 7ICFA 2R8HA 2O5AA 1SXEA 4J9PA 3N7RC 4Y2QA 2KG5A 2R8GA 1LKYB 5KFZA 3EPGA 2ISOA 4YCXA 2HOQA 4OAHA 2GH1A 2K8AA 3RR7A 2KHVA 3PX0A 4ECVA 3QU2A 4TUQA 3KHGA 4C8KA 1UPHA 3FAHA 1PUZA 2W11A 4IR9A 3E2EA 3PMLA 2FCLA 2KFNA 5ALPA 2JZBB 3M7DA 3MR2A 1ZQDA 4EGWA 2MUTB 4F3OA 3WKBA 4CGZA 2C2RA 1JALA 1X9XA 2RRDA 1JQRA 1Q8KA 4IQWA 2OEHA 4YQWA 3BQ2A 3GQCA 1CRXA 4RZRA 4CE6A 1NI3A 2WB1F 3T5JA 3IG8A 2ISPA 4O67A 4O3MA 1D8LA 1K5OA 3MC1A 4ED7A 2OXOA 3C23A 2XY7A 1T7PA 3MDCA 4US8A 3MGHA 3PO4A 2LMRA 4ED2A 5JU5A 4ECWA 1X2IA 2M2VA 2IA6A 2OHFA 2NO5A 5AI8A 1JUDA 2ZIVA 4RQ4A 2K4IA 3IV6A 4Q44A 4I2DA 4F5RA 4EEDA 4NXTA 5KFWA 3WFQE 2HBMA 5IIKA 2LI6A 4RQ7A 4JLXA 2PKEA 1KKXA 4F8RA 2G5HB 5J29A 1FO4A 5B66U 2XCAA 2W04A 4FHYA 4UBBA 5J2HA 3PSIA 4NM1A 2PFOA 2LKYA 4OD0A 1Q3UA 4JLZA 4DSEA 3M9OB 3C5FA 1VLBA 1TKDA 4EEBA 4O3RA 3HT3A 1FFVA 4YXMA 4OAFA 1L3UA 2QARA 3JPPA 5ALVA 1O08A 4C4RA 1B43A 1N63A 4ED6A 5ALEA 5AK4A 4B9TA 4I28A 3WFOA 8ICNA 4K9AA 5HHHA 3PR4A 1UT5A 2YQEA 1A77A 2ZUCA 4O3QA 2ODGA 2BCVA 5J2DA 4IRCA 4OAIZ 2OYYA 3TAQA 1U9LA 1NK6A 5ALRA 3C28A 2BCUA 4OJLA 1PK1B
chains in the Genus database with same CATH topology
5KFCA 3OHBA 4RNNA 4AT8B 4WBYA 4AT9B 4Z6EA 8ICLA 5HMLA 4DS5A 1LV5A 9ICJA 4QZCA 3SI8A 3TARA 4B9UA 2BPFA 3IHQB 4WCWA 3HJ4A 1ZQXA 4RQ8A 5IIJA 2AU0A 2OWOA 5BOLA 2HHVA 4DL7A 1NZPA 2W9CB 1HUOA 4B9NA 1IM4A 4J9KA 2IHNA 4I2EA 2ZH1A 4B9LA 3RH6A 1Q78A 2PI5A 3QEAZ 2ALZA 4UD4A 3PW2A 2Y1JA 3OUYA 3RBDA 1NJXA 1DOQA 4NM2A 2ZTDA 4EBDA 3WFRE 5KFFA 1UEVA 2XGPA 2PFNA 7ICHA 4RU9A 4DOAA 5KT4A 3RAQA 2KTQA 3AQKA 4MF8A 4PGYA 2DRAA 1JX4A 1TK8A 4C8OA 1XSLA 1ZQWA 2UVVA 3C1ZA 1VFGA 3NTUA 2DVIA 4K4GA 3UPQA 1OU5A 4M9GA 1SL1A 3RB6A 4YMOA 1ZQVA 3H39A 2JEIA 1S0OA 5KFLA 3MR5A 8ICGA 1SKSA 2W8KA 4KLJA 4PGQA 1TAUA 8ICFA 4JV0A 4RQ6A 4DL5A 4F4KA 4DWIA 1RYRA 3V6JA 3M9MB 8ICXA 5KT5A 4PGXA 5IIMA 4M04A 3SV4A 4O5KA 9ICNA 4DSJA 4PHPA 2C28A 4KLLA 1S77D 4J9RA 2LYHA 4TQSA 2BKEA 3SYZA 3RR8A 5D4BA 2AQ0A 1KDHA 2BCSA 4NLGA 9ICFA 5J0XA 4PHEA 3B0YA 5HNKA 4DLEA 3PNCA 4ECSA 2W9MA 3PMNA 3V7KA 1TVAA 2O1PA 1ZQYA 4AT7A 4ECQA 4DF4A 5DGAA 3BDPA 1L3TA 3GDXA 1RXVA 2ZH6A 4GLXA 4RQ5A 4F93B 2V4QA 3RJFA 4ZH4A 2BGWA 1XO1A 4NLKA 2KFZA 5DB9A 3TI0A 4KN4A 4M9NA 3JPQA 1YLQA 4RUCA 4I29A 4P4MA 2DFLA 3HW8A 3PW5A 1MQ2A 4RWOA 3MR6A 4M5DA 4RUAA 1KFTA 4YN4A 2VANA 5KG2A 4DFPA 2F1JA 4Q43A 4ECUA 1SL0A 4RQ1A 3ZDBA 2PI4A 3JPTA 8ICBA 3AQMA 2AJQA 2W9CA 5BPCA 2ZH9A 4QWCA 5DBBA 4X4QA 4P4PA 4JV1A 1XS9D 1DGSA 2FPLA 2R8JA 2DR8A 3G6XA 3PW7A 5J2IA 8ICYA 4IQUA 5J0RA 4J9QA 3V6HA 1QSLA 5KFAA 2HHPA 4ELTA 5HRBA 2ZTEA 1N48A 3Q8RB 1ZQAA 2UVRA 4X0AA 1FA0A 5KFMA 8ICSA 3AU2A 1BPZA 8ICPA 1KTQA 4DL3A 5KT3A 4GC7A 5L9XA 1SKWA 4LVSA 3AQLA 3C66A 7ICLA 2FMQA 3OSNA 3C2LA 3N4MB 2C22A 8ICQA 1B22A 4DS4A 1ZQJA 2KN7A 1COOA 2KP7A 3QE9Y 2ASLA 4WC2A 1TFYA 4O5EA 3GIMA 1K1SA 5DLFA 3PY8A 4CCHA 3JZ0A 1T3NA 3WFSC 2RFFA 7ICMA 4O0IA 3HPOA 1Z3EB 4RT2A 4EYIB 9ICGA 4FHVA 4AT7B 4X4OA 1CEZA 1JXEA 2P6RA 4R8UB 4F4YA 4FS2A 9ICMA 5HREA 4FH3A 2ZJ8A 4QZBA 3UXNA 7ICOA 4PH5A 4YMMA 3Q8MA 8ICMA 8ICZA 4DL4A 1QSYA 2KZZA 7ICSA 5HRLA 1RZTA 2ZJAA 1CUKA 1BGXT 3EW9A 4F91B 3BQ1A 4UB2A 1X9WA 1MIVA 4M0AA 1NK5A 4DQPA 5HRHA 1R8CA 4X4SA 4KN7A 3MBYA 9ICSA 3Q8PB 3Q8QB 2VA8A 2M2TA 3RRHA 3L9DA 1C7YA 4M9JA 4DFKA 2ZH2A 5D49A 4C8MA 4GXJA 3OVAA 5IIOA 4DL2A 2ZTCA 1MSWD 9ICLA 5KFGA 4TUPA 2DRBA 5EWGA 4ED3A 5DKWA 5J0PA 4KLFA 2NRZA 4YR3A 4I2AA 5JUMA 5EWFA 1KNYA 4DSLA 4F2RA 1KFDA 1D9FA 1Z00A 4QZ9A 8ICWA 4ED8A 4B9VA 4EP7A 5KFDA 2I9GA 1X9SA 1SKRA 4DOCA 4QZDA 2C2EA 2MAXA 4J9OA 1BNOA 4DO9A 5DQIA 3NYBA 2WTFA 3K75D 9ICOA 3LWLA 4YR2A 1L3SA 1U49A 2ATLA 4TUSA 9ICKA 4K4IA 1JMSA 4BDPA 3ZDEA 2ZH5A 4K4HA 2NRWA 3PX4A 2R8IA 5DECA 2BPCA 3BQ0A 4FS1A 5DEDA 1NK0A 2BE3A 1ZQSA 4IRDA 1SZPA 4KLMA 2DR7A 8ICVA 4WC7A 4YMNA 5J2BA 2R8KA 3RJJA 8ICEA 4YP3A 4X4PA 3PR5B 4F4XA 4F4ZA 1ZQPA 2W9BB 1BPXA 3V72A 4WC6A 5KG6A 4RNMA 2AGPA 3ZD8A 3QZ7A 1N56A 3RJHA 5IINA 4JV2A 3RJKA 4YXJA 5J2JA 4DQQA 7ICVA 5KFRA 5J2GA 5BOMA 1ZQLA 4P2HA 4QWBA 2ZUDA 4R66A 2HHWA 2FPMA 1KLNA 9ICXA 5KFQA 4X4RA 8ICKA 2J6UA 4I27A 2HVIA 4C8NA 4XQ8A 4R63A 3EPIA 4GC6A 5J0YA 5TZVA 4M6WB 5J0WA 2XC9A 1T8EA 1SL2A 7ICNA 2Q66A 4O3NA 5DB6A 4RWQA 3ZDCA 9ICAA 3RH5A 3RJEA 4UAZA 4RPXA 3C5GA 5KG1A 1ZQCA 4RPYA 4WC1A 3ETLA 1ZQKA 5C5JA 4KITB 3M9NB 2P6UA 1TAQA 1BPEA 1BVSA 5J0QA 3RTVA 4J9LA 7ICUA 4FHWA 5EWEA 4KLHA 4M9HA 7ICPA 1ZQNA 1V4AA 4ELVA 1JAJA 1KSPA 1WCLA 4AT8A 5KFPA 1RYSA 3H7IA 4RWPA 2W8LA 4O3OA 5DQHA 3TQ1A 1ZJNA 2GWSA 7ICIA 4J9NA 7ICKA 5HRFA 4I2IA 2HVHA 3C18A 4WC5A 1U47A 2XGQA 4NY8A 1V9PA 4NLNA 1MIWA 4DOBA 4QZAA 2BR0A 4IQVA 1S0NA 4X0BA 4R64A 9ICBA 3JYYA 3WFPA 1WCNA 1IXRA 2C2DA 1NK7A 3V7JA 4UAWA 4KLSA 4QZIA 2BDPA 5F9LA 3JPOA 3G6VA 5KFIA 4RPZA 4M2YA 3H8WA 3PO5A 3HWTA 9ICIA 4EEYA 4F5PA 4J9SA 2BQ3A 5KG7A 5CA7A 1MC8A 2ZUBA 1NOMA 5DG9A 1KFSA 2UVUA 4NKTA 3MFHA 2BQUA 1U48A 4BWJA 1QTMA 4DQIA 4I2CA 1MIYA 3HJ1A 5KT6A 2ZH3A 4QZ8A 5HC9A 4KMUA 1PZNA 4FHXA 4XQ7A 2KZ3A 4JK1A 5DQGA 7ICJA 3V6KA 3TFSA 2VA3A 3THVA 1L3VA 8ICRA 1KEJA 3OHAA 1VJ7A 2IBKA 3OSPA 2FLPA 4ATBA 1TK5A 4ECXA 1D9DA 4JWNA 3T5KA 4M9LA 3H4DA 4E8FA 4F5OA 3MDAA 2M9NA 3MFIA 2BPGA 5L1JA 2W9AA 3C21A 5DG7A 3OGUA 3RAXA 1TFWA 4QZFA 1UA1A 3UPSA 4MFFA 3H8SA 2A1JB 4WBZA 4XA5A 1TFRA 3JPSA 1TK0A 4KLOA 4DL6A 5KFUA 4Z6DA 9ICEA 5KG3A 3KHRA 3ZD9A 4PHDA 3T3FA 5F2VO 5KFYA 2Y1IA 3GIIA 2Q0ZX 1UETA 5CP2A 4B9SA 4UB4A 2DR5A 4KLTA 2PFQA 3PVXA 4I2HA 5CB1A 4LZGA 3C2KA 5J2FA 5DBAA 2AGQA 1KRPA 4RQ0A 4KTQA 1DK3A 5HRKA 3RB0A 3T5LA 3IM1A 3RJIA 4NXZA 5J0TA 1ZQMA 1ZQEA 4O9MA 1Q79A 4QZHA 3GILA 3ZDDA 1JN3A 5HHIA 8ICHA 5KFSA 3GV5B 4S3NA 4Z6CA 3H40A 1ZQGA 9ICHA 2BHNA 5KFEA 4F50A 2PFPA 2ZH8A 3K4GA 1EXNA 1U45A 1RXWA 1NK4A 5DLGA 2FMSA 4MFAA 1Y88A 8ICJA 2ZHAA 5IILA 4DFJA 3FYHA 2M2WA 3PV8A 5KT2A 1LB2B 2NRVA 1XU4A 3UXOA 4HYKA 3KHHA 1ZJMA 4FBTA 2NRKA 3FDSA 4XRHA 1UEUA 2HW3A 2ZH7A 1S10A 1NKEA 3V7LA 4LT6A 2JEFA 4UB5A 3MABA 4QWAA 2XY6A 2BQRA 4I2FA 4RQ3A 5KFKA 4YD2A 5J2KA 4DF8A 2B21A 5DB7A 4XUSA 5IIIA 3HX0A 4RQ2A 4DSKA 4MF2A 5CWRA 3GIJA 9ICQA 3RH4A 2H5XA 4X4UA 5L1LA 5HRGA 5HP4A 2DR9A 4ATBB 4I2GA 4KLEA 4PHAA 3H3AA 3QEBZ 1BPYA 2ZHBA 3ISCA 4BXOA 1BPDA 4LZDA 3NGDA 1S76D 3MGIA 3LWMA 2ASDA 4ELUA 4R8UA 3OJSA 5KFJA 2NRXA 4DEZA 3T5HA 3SZ2A 5DGBA 2FLNA 3TFRA 2ZJ5A 1UA0A 4B9MA 1BPBA 1NKBA 4X5VA 3OUYB 4UBCA 4EBEA 1S97A 3UQ2A 1R89A 4FO6A 2PXIA 4ECRA 3AU6A 7ICFA 2R8HA 2O5AA 3ISBA 1ZQUA 5DDMA 9ICCA 4J9PA 3RRGA 2R8GA 3HP6A 4F2SA 1K1QA 1D8YA 4I2JA 5KFZA 3EPGA 4YCXA 4Q45A 2DPIA 2ISOA 8ICUA 1MQ3A 4UB3A 5KG4A 3RR7A 2IMWP 3PX0A 4KLIA 4ECVA 1ZQTA 4NKUA 4GXIA 4EZ6A 4TUQA 3KHGA 4C8KA 8ICIA 4YG2A 1Z00B 3B0XA 4E80A 4ECYA 4IR9A 3E2EA 4F4WA 3PMLA 4TQRA 1S0VA 2HHUA 3EYZA 5KTQA 2KFNA 2JZBB 2PBEA 3PW4A 3MR2A 2I1QA 5KFBA 4KLDA 8ICAA 3RJGA 1S9FA 1ZQDA 9ICTA 4O3PA 3M8SA 5J0OA 2MUTB 4BXOB 5CJ7A 4F3OA 3H38A 2FPKA 3Q8KA 3RB3A 2C2RA 2V9WA 2UVWA 4PPXA 2HHXA 1JQRA 7ICEA 2ZH4A 4EYHB 4IQWA 2AQ4A 9ICVA 4YQWA 3Q8SB 3AQNA 3BQ2A 3GQCA 1S0MA 4Q8FA 2P66A 2J6SA 2W9BA 7ICTA 2NRTA 5CR0A 4RZRA 3PX6A 2HHSA 1HUZA 4Q8EA 3HIYA 4X4NA 4QWDA 2V4RA 4YVZA 4KLGA 5HRIA 4M47A 1QLNA 5KT7A 3UQ0A 5DDYA 3T5JA 5L1IA 2DPJA 3KTQA 1WOTA 4AT9A 4EZ9A 5KFXA 2ID1A 5F9NA 5KFOA 2ISPA 1F5AA 3OVBA 4QW8A 4O5CA 2HHTA 4ED1A 1U4BA 1D8LA 2XO7A 3ZDAA 4UAYA 5J0UA 1BNPA 4UD5A 1ZQFA 4C8LA 4ED7A 4J9MA 2BCRA 2XCPA 4IR1A 8ICTA 3BJYA 7ICQA 4YFKA 3C23A 3AUOA 3H8JA 2XY7A 3MDCA 1XSPA 1T7PA 1JXLA 1NK8A 5KG0A 4Z6FA 2JEGA 1R8AA 3OVSA 3QZ8A 3M8RA 3MGHA 1ZQBA 1NKCA 3PO4A 5L1KA 4ED2A 4I2BA 4ECWA 1X9MA 4EBKA 5HRDA 2F1HA 2M2UA 1X2IA 2M2VA 2IA6A 4FBUA 4X4TA 2F1IA 2AGOA 5J2CA 9ICRA 4RQ4A 3GV7B 3LDAA 2JZBA 1A76A 5HMMA 3JPNA 5KG5A 4Q44A 3PW0A 4IRKA 1NK9A 4IQTA 1QSSA 4X4VA 5DB8A 4I2DA 3LK9A 3EZ5A 4KLUA 2HHQA 4E7XA 3KHLA 4QZEA 2FLLA 4F5RA 1NJZA 4KLQA 5KFWA 7ICGA 4MEXA 4MEYA 4ED0A 4EBJA 4FHPA 3WFQE 1NJWA 5IIKA 4WC3A 4F92B 5KFHA 1PX5A 9ICUA 5J2AA 2KZMA 4RQ7A 4F8RA 9ICPA 3TAPA 4JUZA 3C2MA 5J29A 2VA2A 1ZQRA 4MFCA 2XCAA 5DG8A 4FHYA 4O3SA 1JIHA 4UBBA 5J2HA 3BQTA 2RDJA 4RT3A 4NM1A 4WC0A 1L5UA 2PFOA 1NO5A 4YD1A 4DLGA 5KFTA 2RDIA 3Q8LA 1UT8A 5KFNA 1ZYQA 4DSEA 4F5QA 3TANA 1T4GA 3M9OB 2JEJA 4DSIA 3C5FA 4G3IA 4IG8A 1TKDA 1H38A 4UB1A 4O3RA 1XSNA 3HT3A 4QWEA 4QZGA 1ZQQA 4YXMA 1L3UA 3GFKB 3JPPA 3C1YA 4ECZA 3RBEA 5EOZA 1XWLA 4JWMA 3SV3A 4ECTA 1ZQZA 2FMPA 9ICWA 1B43A 8ICOA 4WC4A 1XC9A 2J6TA 4ED6A 2XY5A 4NLZA 8ICCA 4EBCA 4B9TA 4I28A 1NJYA 4BGDA 4YR0A 3GIKA 3H37A 3WFOA 8ICNA 4R65A 4E0DA 4BWMA 4UQGA 4P4OA 3GV8B 5HHHA 3PR4A 3ORYA 2ASJA 1UT5A 4DQRA 2BCQA 4TURA 4DQSA 1A77A 4RNOA 2ZUCA 1ZETA 4O3QA 3UXPA 4QW9A 2MUTA 5D46A 5J2EA 5HR9A 3OJUA 3RB4A 5J2DA 2BCVA 4IRCA 1HJPA 4GXKA 1TV9A 3TAQA 2IHMA 3H4BA 2A1JA 1ZQOA 1U9LA 5KFVA 1ZQHA 5CHGA 7ICRA 3LQCB 3JPRA 3ISDA 4DSFA 1AROP 1ZQIA 5J0SA 1RPLA 3EWAA 3MR3A 1R8BA 4RWNA 4F5NA 3G6YA 1NK6A 5DBCA 4FH5A 4M6WA 3N97B 3OV7A 2BCUA 4DFMA 1DK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KFC A;  3OHB A;  4RNN A;  4AT8 B;  4WBY A;  4AT9 B;  4Z6E A;  8ICL A;  5HML A;  4DS5 A;  1LV5 A;  9ICJ A;  4QZC A;  3SI8 A;  3TAR A;  4B9U A;  2BPF A;  3IHQ B;  4WCW A;  3HJ4 A;  1ZQX A;  4RQ8 A;  5IIJ A;  2AU0 A;  2OWO A;  5BOL A;  2HHV A;  4DL7 A;  1NZP A;  2W9C B;  1HUO A;  4B9N A;  1IM4 A;  4J9K A;  2IHN A;  4I2E A;  2ZH1 A;  4B9L A;  3RH6 A;  1Q78 A;  2PI5 A;  3QEA Z;  2ALZ A;  4UD4 A;  3PW2 A;  2Y1J A;  3OUY A;  3RBD A;  1NJX A;  1DOQ A;  4NM2 A;  2ZTD A;  4EBD A;  3WFR E;  5KFF A;  1UEV A;  2XGP A;  2PFN A;  7ICH A;  4RU9 A;  4DOA A;  5KT4 A;  3RAQ A;  2KTQ A;  3AQK A;  4MF8 A;  4PGY A;  2DRA A;  1JX4 A;  1TK8 A;  4C8O A;  1XSL A;  1ZQW A;  2UVV A;  3C1Z A;  1VFG A;  3NTU A;  2DVI A;  4K4G A;  3UPQ A;  1OU5 A;  4M9G A;  1SL1 A;  3RB6 A;  4YMO A;  1ZQV A;  3H39 A;  2JEI A;  1S0O A;  5KFL A;  3MR5 A;  8ICG A;  1SKS A;  2W8K A;  4KLJ A;  4PGQ A;  1TAU A;  8ICF A;  4JV0 A;  4RQ6 A;  4DL5 A;  4F4K A;  4DWI A;  1RYR A;  3V6J A;  3M9M B;  8ICX A;  5KT5 A;  4PGX A;  5IIM A;  4M04 A;  3SV4 A;  4O5K A;  9ICN A;  4DSJ A;  4PHP A;  2C28 A;  4KLL A;  1S77 D;  4J9R A;  2LYH A;  4TQS A;  2BKE A;  3SYZ A;  3RR8 A;  5D4B A;  2AQ0 A;  1KDH A;  2BCS A;  4NLG A;  9ICF A;  5J0X A;  4PHE A;  3B0Y A;  5HNK A;  4DLE A;  3PNC A;  4ECS A;  2W9M A;  3PMN A;  3V7K A;  1TVA A;  2O1P A;  1ZQY A;  4AT7 A;  4ECQ A;  4DF4 A;  5DGA A;  3BDP A;  1L3T A;  3GDX A;  1RXV A;  2ZH6 A;  4GLX A;  4RQ5 A;  4F93 B;  2V4Q A;  3RJF A;  4ZH4 A;  2BGW A;  1XO1 A;  4NLK A;  2KFZ A;  5DB9 A;  3TI0 A;  4KN4 A;  4M9N A;  3JPQ A;  1YLQ A;  4RUC A;  4I29 A;  4P4M A;  2DFL A;  3HW8 A;  3PW5 A;  1MQ2 A;  4RWO A;  3MR6 A;  4M5D A;  4RUA A;  1KFT A;  4YN4 A;  2VAN A;  5KG2 A;  4DFP A;  2F1J A;  4Q43 A;  4ECU A;  1SL0 A;  4RQ1 A;  3ZDB A;  2PI4 A;  3JPT A;  8ICB A;  3AQM A;  2AJQ A;  2W9C A;  5BPC A;  2ZH9 A;  4QWC A;  5DBB A;  4X4Q A;  4P4P A;  4JV1 A;  1XS9 D;  1DGS A;  2FPL A;  2R8J A;  2DR8 A;  3G6X A;  3PW7 A;  5J2I A;  8ICY A;  4IQU A;  5J0R A;  4J9Q A;  3V6H A;  1QSL A;  5KFA A;  2HHP A;  4ELT A;  5HRB A;  2ZTE A;  1N48 A;  3Q8R B;  1ZQA A;  2UVR A;  4X0A A;  1FA0 A;  5KFM A;  8ICS A;  3AU2 A;  1BPZ A;  8ICP A;  1KTQ A;  4DL3 A;  5KT3 A;  4GC7 A;  5L9X A;  1SKW A;  4LVS A;  3AQL A;  3C66 A;  7ICL A;  2FMQ A;  3OSN A;  3C2L A;  3N4M B;  2C22 A;  8ICQ A;  1B22 A;  4DS4 A;  1ZQJ A;  2KN7 A;  1COO A;  2KP7 A;  3QE9 Y;  2ASL A;  4WC2 A;  1TFY A;  4O5E A;  3GIM A;  1K1S A;  5DLF A;  3PY8 A;  4CCH A;  3JZ0 A;  1T3N A;  3WFS C;  2RFF A;  7ICM A;  4O0I A;  3HPO A;  1Z3E B;  4RT2 A;  4EYI B;  9ICG A;  4FHV A;  4AT7 B;  4X4O A;  1CEZ A;  1JXE A;  2P6R A;  4R8U B;  4F4Y A;  4FS2 A;  9ICM A;  5HRE A;  4FH3 A;  2ZJ8 A;  4QZB A;  3UXN A;  7ICO A;  4PH5 A;  4YMM A;  3Q8M A;  8ICM A;  8ICZ A;  4DL4 A;  1QSY A;  2KZZ A;  7ICS A;  5HRL A;  1RZT A;  2ZJA A;  1CUK A;  1BGX T;  3EW9 A;  4F91 B;  3BQ1 A;  4UB2 A;  1X9W A;  1MIV A;  4M0A A;  1NK5 A;  4DQP A;  5HRH A;  1R8C A;  4X4S A;  4KN7 A;  3MBY A;  9ICS A;  3Q8P B;  3Q8Q B;  2VA8 A;  2M2T A;  3RRH A;  3L9D A;  1C7Y A;  4M9J A;  4DFK A;  2ZH2 A;  5D49 A;  4C8M A;  4GXJ A;  3OVA A;  5IIO A;  4DL2 A;  2ZTC A;  1MSW D;  9ICL A;  5KFG A;  4TUP A;  2DRB A;  5EWG A;  4ED3 A;  5DKW A;  5J0P A;  4KLF A;  2NRZ A;  4YR3 A;  4I2A A;  5JUM A;  5EWF A;  1KNY A;  4DSL A;  4F2R A;  1KFD A;  1D9F A;  1Z00 A;  4QZ9 A;  8ICW A;  4ED8 A;  4B9V A;  4EP7 A;  5KFD A;  2I9G A;  1X9S A;  1SKR A;  4DOC A;  4QZD A;  2C2E A;  2MAX A;  4J9O A;  1BNO A;  4DO9 A;  5DQI A;  3NYB A;  2WTF A;  3K75 D;  9ICO A;  3LWL A;  4YR2 A;  1L3S A;  1U49 A;  2ATL A;  4TUS A;  9ICK A;  4K4I A;  1JMS A;  4BDP A;  3ZDE A;  2ZH5 A;  4K4H A;  2NRW A;  3PX4 A;  2R8I A;  5DEC A;  2BPC A;  3BQ0 A;  4FS1 A;  5DED A;  1NK0 A;  2BE3 A;  1ZQS A;  4IRD A;  1SZP A;  4KLM A;  2DR7 A;  8ICV A;  4WC7 A;  4YMN A;  5J2B A;  2R8K A;  3RJJ A;  8ICE A;  4YP3 A;  4X4P A;  3PR5 B;  4F4X A;  4F4Z A;  1ZQP A;  2W9B B;  1BPX A;  3V72 A;  4WC6 A;  5KG6 A;  4RNM A;  2AGP A;  3ZD8 A;  3QZ7 A;  1N56 A;  3RJH A;  5IIN A;  4JV2 A;  3RJK A;  4YXJ A;  5J2J A;  4DQQ A;  7ICV A;  5KFR A;  5J2G A;  5BOM A;  1ZQL A;  4P2H A;  4QWB A;  2ZUD A;  4R66 A;  2HHW A;  2FPM A;  1KLN A;  9ICX A;  5KFQ A;  4X4R A;  8ICK A;  2J6U A;  4I27 A;  2HVI A;  4C8N A;  4XQ8 A;  4R63 A;  3EPI A;  4GC6 A;  5J0Y A;  5TZV A;  4M6W B;  5J0W A;  2XC9 A;  1T8E A;  1SL2 A;  7ICN A;  2Q66 A;  4O3N A;  5DB6 A;  4RWQ A;  3ZDC A;  9ICA A;  3RH5 A;  3RJE A;  4UAZ A;  4RPX A;  3C5G A;  5KG1 A;  1ZQC A;  4RPY A;  4WC1 A;  3ETL A;  1ZQK A;  5C5J A;  4KIT B;  3M9N B;  2P6U A;  1TAQ A;  1BPE A;  1BVS A;  5J0Q A;  3RTV A;  4J9L A;  7ICU A;  4FHW A;  5EWE A;  4KLH A;  4M9H A;  7ICP A;  1ZQN A;  1V4A A;  4ELV A;  1JAJ A;  1KSP A;  1WCL A;  4AT8 A;  5KFP A;  1RYS A;  3H7I A;  4RWP A;  2W8L A;  4O3O A;  5DQH A;  3TQ1 A;  1ZJN A;  2GWS A;  7ICI A;  4J9N A;  7ICK A;  5HRF A;  4I2I A;  2HVH A;  3C18 A;  4WC5 A;  1U47 A;  2XGQ A;  4NY8 A;  1V9P A;  4NLN A;  1MIW A;  4DOB A;  4QZA A;  2BR0 A;  4IQV A;  1S0N A;  4X0B A;  4R64 A;  9ICB A;  3JYY A;  3WFP A;  1WCN A;  1IXR A;  2C2D A;  1NK7 A;  3V7J A;  4UAW A;  4KLS A;  4QZI A;  2BDP A;  5F9L A;  3JPO A;  3G6V A;  5KFI A;  4RPZ A;  4M2Y A;  3H8W A;  3PO5 A;  3HWT A;  9ICI A;  4EEY A;  4F5P A;  4J9S A;  2BQ3 A;  5KG7 A;  5CA7 A;  1MC8 A;  2ZUB A;  1NOM A;  5DG9 A;  1KFS A;  2UVU A;  4NKT A;  3MFH A;  2BQU A;  1U48 A;  4BWJ A;  1QTM A;  4DQI A;  4I2C A;  1MIY A;  3HJ1 A;  5KT6 A;  2ZH3 A;  4QZ8 A;  5HC9 A;  4KMU A;  1PZN A;  4FHX A;  4XQ7 A;  2KZ3 A;  4JK1 A;  5DQG A;  7ICJ A;  3V6K A;  3TFS A;  2VA3 A;  3THV A;  1L3V A;  8ICR A;  1KEJ A;  3OHA A;  1VJ7 A;  2IBK A;  3OSP A;  2FLP A;  4ATB A;  1TK5 A;  4ECX A;  1D9D A;  4JWN A;  3T5K A;  4M9L A;  3H4D A;  4E8F A;  4F5O A;  3MDA A;  2M9N A;  3MFI A;  2BPG A;  5L1J A;  2W9A A;  3C21 A;  5DG7 A;  3OGU A;  3RAX A;  1TFW A;  4QZF A;  1UA1 A;  3UPS A;  4MFF A;  3H8S A;  2A1J B;  4WBZ A;  4XA5 A;  1TFR A;  3JPS A;  1TK0 A;  4KLO A;  4DL6 A;  5KFU A;  4Z6D A;  9ICE A;  5KG3 A;  3KHR A;  3ZD9 A;  4PHD A;  3T3F A;  5F2V O;  5KFY A;  2Y1I A;  3GII A;  2Q0Z X;  1UET A;  5CP2 A;  4B9S A;  4UB4 A;  2DR5 A;  4KLT A;  2PFQ A;  3PVX A;  4I2H A;  5CB1 A;  4LZG A;  3C2K A;  5J2F A;  5DBA A;  2AGQ A;  1KRP A;  4RQ0 A;  4KTQ A;  1DK3 A;  5HRK A;  3RB0 A;  3T5L A;  3IM1 A;  3RJI A;  4NXZ A;  5J0T A;  1ZQM A;  1ZQE A;  4O9M A;  1Q79 A;  4QZH A;  3GIL A;  3ZDD A;  1JN3 A;  5HHI A;  8ICH A;  5KFS A;  3GV5 B;  4S3N A;  4Z6C A;  3H40 A;  1ZQG A;  9ICH A;  2BHN A;  5KFE A;  4F50 A;  2PFP A;  2ZH8 A;  3K4G A;  1EXN A;  1U45 A;  1RXW A;  1NK4 A;  5DLG A;  2FMS A;  4MFA A;  1Y88 A;  8ICJ A;  2ZHA A;  5IIL A;  4DFJ A;  3FYH A;  2M2W A;  3PV8 A;  5KT2 A;  1LB2 B;  2NRV A;  1XU4 A;  3UXO A;  4HYK A;  3KHH A;  1ZJM A;  4FBT A;  2NRK A;  3FDS A;  4XRH A;  1UEU A;  2HW3 A;  2ZH7 A;  1S10 A;  1NKE A;  3V7L A;  4LT6 A;  2JEF A;  4UB5 A;  3MAB A;  4QWA A;  2XY6 A;  2BQR A;  4I2F A;  4RQ3 A;  5KFK A;  4YD2 A;  5J2K A;  4DF8 A;  2B21 A;  5DB7 A;  4XUS A;  5III A;  3HX0 A;  4RQ2 A;  4DSK A;  4MF2 A;  5CWR A;  3GIJ A;  9ICQ A;  3RH4 A;  2H5X A;  4X4U A;  5L1L A;  5HRG A;  5HP4 A;  2DR9 A;  4ATB B;  4I2G A;  4KLE A;  4PHA A;  3H3A A;  3QEB Z;  1BPY A;  2ZHB A;  3ISC A;  4BXO A;  1BPD A;  4LZD A;  3NGD A;  1S76 D;  3MGI A;  3LWM A;  2ASD A;  4ELU A;  4R8U A;  3OJS A;  5KFJ A;  2NRX A;  4DEZ A;  3T5H A;  3SZ2 A;  5DGB A;  2FLN A;  3TFR A;  2ZJ5 A;  1UA0 A;  4B9M A;  1BPB A;  1NKB A;  4X5V A;  3OUY B;  4UBC A;  4EBE A;  1S97 A;  3UQ2 A;  1R89 A;  4FO6 A;  2PXI A;  4ECR A;  3AU6 A;  7ICF A;  2R8H A;  2O5A A;  3ISB A;  1ZQU A;  5DDM A;  9ICC A;  4J9P A;  3RRG A;  2R8G A;  3HP6 A;  4F2S A;  1K1Q A;  1D8Y A;  4I2J A;  5KFZ A;  3EPG A;  4YCX A;  4Q45 A;  2DPI A;  2ISO A;  8ICU A;  1MQ3 A;  4UB3 A;  5KG4 A;  3RR7 A;  2IMW P;  3PX0 A;  4KLI A;  4ECV A;  1ZQT A;  4NKU A;  4GXI A;  4EZ6 A;  4TUQ A;  3KHG A;  4C8K A;  8ICI A;  4YG2 A;  1Z00 B;  3B0X A;  4E80 A;  4ECY A;  4IR9 A;  3E2E A;  4F4W A;  3PML A;  4TQR A;  1S0V A;  2HHU A;  3EYZ A;  5KTQ A;  2KFN A;  2JZB B;  2PBE A;  3PW4 A;  3MR2 A;  2I1Q A;  5KFB A;  4KLD A;  8ICA A;  3RJG A;  1S9F A;  1ZQD A;  9ICT A;  4O3P A;  3M8S A;  5J0O A;  2MUT B;  4BXO B;  5CJ7 A;  4F3O A;  3H38 A;  2FPK A;  3Q8K A;  3RB3 A;  2C2R A;  2V9W A;  2UVW A;  4PPX A;  2HHX A;  1JQR A;  7ICE A;  2ZH4 A;  4EYH B;  4IQW A;  2AQ4 A;  9ICV A;  4YQW A;  3Q8S B;  3AQN A;  3BQ2 A;  3GQC A;  1S0M A;  4Q8F A;  2P66 A;  2J6S A;  2W9B A;  7ICT A;  2NRT A;  5CR0 A;  4RZR A;  3PX6 A;  2HHS A;  1HUZ A;  4Q8E A;  3HIY A;  4X4N A;  4QWD A;  2V4R A;  4YVZ A;  4KLG A;  5HRI A;  4M47 A;  1QLN A;  5KT7 A;  3UQ0 A;  5DDY A;  3T5J A;  5L1I A;  2DPJ A;  3KTQ A;  1WOT A;  4AT9 A;  4EZ9 A;  5KFX A;  2ID1 A;  5F9N A;  5KFO A;  2ISP A;  1F5A A;  3OVB A;  4QW8 A;  4O5C A;  2HHT A;  4ED1 A;  1U4B A;  1D8L A;  2XO7 A;  3ZDA A;  4UAY A;  5J0U A;  1BNP A;  4UD5 A;  1ZQF A;  4C8L A;  4ED7 A;  4J9M A;  2BCR A;  2XCP A;  4IR1 A;  8ICT A;  3BJY A;  7ICQ A;  4YFK A;  3C23 A;  3AUO A;  3H8J A;  2XY7 A;  3MDC A;  1XSP A;  1T7P A;  1JXL A;  1NK8 A;  5KG0 A;  4Z6F A;  2JEG A;  1R8A A;  3OVS A;  3QZ8 A;  3M8R A;  3MGH A;  1ZQB A;  1NKC A;  3PO4 A;  5L1K A;  4ED2 A;  4I2B A;  4ECW A;  1X9M A;  4EBK A;  5HRD A;  2F1H A;  2M2U A;  1X2I A;  2M2V A;  2IA6 A;  4FBU A;  4X4T A;  2F1I A;  2AGO A;  5J2C A;  9ICR A;  4RQ4 A;  3GV7 B;  3LDA A;  2JZB A;  1A76 A;  5HMM A;  3JPN A;  5KG5 A;  4Q44 A;  3PW0 A;  4IRK A;  1NK9 A;  4IQT A;  1QSS A;  4X4V A;  5DB8 A;  4I2D A;  3LK9 A;  3EZ5 A;  4KLU A;  2HHQ A;  4E7X A;  3KHL A;  4QZE A;  2FLL A;  4F5R A;  1NJZ A;  4KLQ A;  5KFW A;  7ICG A;  4MEX A;  4MEY A;  4ED0 A;  4EBJ A;  4FHP A;  3WFQ E;  1NJW A;  5IIK A;  4WC3 A;  4F92 B;  5KFH A;  1PX5 A;  9ICU A;  5J2A A;  2KZM A;  4RQ7 A;  4F8R A;  9ICP A;  3TAP A;  4JUZ A;  3C2M A;  5J29 A;  2VA2 A;  1ZQR A;  4MFC A;  2XCA A;  5DG8 A;  4FHY A;  4O3S A;  1JIH A;  4UBB A;  5J2H A;  3BQT A;  2RDJ A;  4RT3 A;  4NM1 A;  4WC0 A;  1L5U A;  2PFO A;  1NO5 A;  4YD1 A;  4DLG A;  5KFT A;  2RDI A;  3Q8L A;  1UT8 A;  5KFN A;  1ZYQ A;  4DSE A;  4F5Q A;  3TAN A;  1T4G A;  3M9O B;  2JEJ A;  4DSI A;  3C5F A;  4G3I A;  4IG8 A;  1TKD A;  1H38 A;  4UB1 A;  4O3R A;  1XSN A;  3HT3 A;  4QWE A;  4QZG A;  1ZQQ A;  4YXM A;  1L3U A;  3GFK B;  3JPP A;  3C1Y A;  4ECZ A;  3RBE A;  5EOZ A;  1XWL A;  4JWM A;  3SV3 A;  4ECT A;  1ZQZ A;  2FMP A;  9ICW A;  1B43 A;  8ICO A;  4WC4 A;  1XC9 A;  2J6T A;  4ED6 A;  2XY5 A;  4NLZ A;  8ICC A;  4EBC A;  4B9T A;  4I28 A;  1NJY A;  4BGD A;  4YR0 A;  3GIK A;  3H37 A;  3WFO A;  8ICN A;  4R65 A;  4E0D A;  4BWM A;  4UQG A;  4P4O A;  3GV8 B;  5HHH A;  3PR4 A;  3ORY A;  2ASJ A;  1UT5 A;  4DQR A;  2BCQ A;  4TUR A;  4DQS A;  1A77 A;  4RNO A;  2ZUC A;  1ZET A;  4O3Q A;  3UXP A;  4QW9 A;  2MUT A;  5D46 A;  5J2E A;  5HR9 A;  3OJU A;  3RB4 A;  5J2D A;  2BCV A;  4IRC A;  1HJP A;  4GXK A;  1TV9 A;  3TAQ A;  2IHM A;  3H4B A;  2A1J A;  1ZQO A;  1U9L A;  5KFV A;  1ZQH A;  5CHG A;  7ICR A;  3LQC B;  3JPR A;  3ISD A;  4DSF A;  1ARO P;  1ZQI A;  5J0S A;  1RPL A;  3EWA A;  3MR3 A;  1R8B A;  4RWN A;  4F5N A;  3G6Y A;  1NK6 A;  5DBC A;  4FH5 A;  4M6W A;  3N97 B;  3OV7 A;  2BCU A;  4DFM A;  1DK2 A; 
#chains in the Genus database with same CATH topology
 4AT8 B;  2E3T A;  2YMQ A;  4AT9 B;  4DS5 A;  5FP0 A;  4QZC A;  2OWO A;  2HHV A;  4DL7 A;  1IM4 A;  4J9K A;  4B9L A;  3RH6 A;  3F2D A;  4UD4 A;  3PW2 A;  1A0P A;  2EQY A;  1DOQ A;  3WFR E;  5E79 U;  5KT4 A;  4KX5 A;  4PGY A;  1J2M A;  4C8O A;  2VKQ A;  3C1Z A;  5AKG A;  3LVV A;  5CFT A;  4JMU A;  8ICG A;  2VJ5 A;  4JV0 A;  4RQ6 A;  3V6J A;  3SEN A;  5KT5 A;  9ICN A;  5ALM A;  4KLL A;  3M1Y A;  2RQ5 A;  3AL0 B;  2BCS A;  9ICF A;  4NLG A;  3D6J A;  3IDW A;  5HNK A;  4ECS A;  1TVA A;  2O1P A;  2W9M A;  1ZQY A;  1L3T A;  1RXV A;  4GLX A;  2QB1 A;  1XO1 A;  2KE7 A;  5DB9 A;  1QQ6 A;  4KN4 A;  4OJO A;  1UQV A;  1YLQ A;  4I29 A;  1MQ2 A;  4NWI A;  4RUA A;  3CNH A;  5AKY A;  1KFT A;  3ZDB A;  2VAN A;  4DFP A;  2PI4 A;  2F3N A;  3AQM A;  5B3Q A;  3UMB A;  5DBB A;  3D2Q A;  4X4Q A;  3QUT A;  8ICY A;  3PW7 A;  5J2I A;  4ELT A;  1N48 A;  1ZQA A;  5KFM A;  3AU2 A;  2DWQ A;  5D61 A;  1N5X A;  4GC7 A;  3AQL A;  2W43 A;  2FMQ A;  3NVW A;  2KN7 A;  2KKV A;  3QE9 Y;  4CCH A;  3NAS A;  7ICM A;  2RFF A;  4RT2 A;  4EYI B;  1JI7 A;  5CEH A;  1CEZ A;  1JXE A;  2P6R A;  2A19 A;  4R8U B;  2EAO A;  5TIS U;  1RM6 C;  4DL4 A;  5HRL A;  1SV0 A;  1CUK A;  5B3P A;  2L5Y A;  1NK5 A;  5AM5 A;  4DQP A;  4PZN A;  5AIB A;  3QX7 A;  4OJP A;  2ESE A;  5ALZ A;  2ZH2 A;  1ZD4 A;  4C8M A;  2KEY A;  1IIP A;  5KFG A;  2DRB A;  4ED3 A;  4KLF A;  2G06 A;  5EWF A;  1KNY A;  1SKR A;  4AYB C;  4DOC A;  1ZD3 A;  1P7D A;  2ZIV B;  1L3S A;  3I28 A;  4K4I A;  4BDP A;  2IOF K;  2EWR A;  1CI4 A;  2BPC A;  4KLM A;  4YMN A;  3RJJ A;  1WYG A;  4YP3 A;  4F4X A;  4F4Z A;  3QU7 A;  5KG6 A;  1AQ6 A;  2AGP A;  3QZ7 A;  5IIN A;  4JV2 A;  5J2J A;  9ICX A;  4P2H A;  4C8N A;  4GC6 A;  2B56 A;  5J0Y A;  2XC9 A;  1T8E A;  1SL2 A;  2Q66 A;  4O3N A;  2QKQ A;  3F53 A;  2JV3 A;  4RPX A;  2KIV A;  5KG1 A;  4EEK A;  4WC1 A;  3ETL A;  4KIT B;  7ICU A;  1BPE A;  3RTV A;  5J0Q A;  2W3R A;  2H3Q A;  1KSP A;  1WCL A;  4AT8 A;  1VJ5 A;  1ZJN A;  1ED1 A;  3AMZ A;  5DQH A;  7ICK A;  5HRF A;  3JYY A;  4WC5 A;  3DV9 A;  4UAV A;  4NLN A;  3CK6 A;  4IQV A;  1S0N A;  9ICB A;  3WFP A;  2KOB A;  2BDP A;  2BBH A;  3CRX A;  4J9S A;  2BQ3 A;  5CA7 A;  4FFD A;  2UVU A;  3MFH A;  3F2B A;  4DQI A;  2DGZ A;  3HJ1 A;  4QZ8 A;  5ALQ A;  3IN5 A;  2JR5 A;  4JK1 A;  2F76 X;  5DQG A;  1UCV A;  3V6K A;  1KEJ A;  2YB1 A;  2FLP A;  3AEV A;  1TK5 A;  2HMX A;  1X42 A;  4ECX A;  1D9D A;  5H2F U;  5EE9 A;  5AM2 A;  2H3I A;  1B0X A;  2E8P A;  4KLO A;  1N61 A;  4DL6 A;  9ICE A;  3UMC A;  3ZD9 A;  3KHR A;  3T3F A;  2GLE A;  5KFY A;  3VC8 A;  2Y1I A;  1QH9 A;  5CP2 A;  5AHX A;  4UB4 A;  1L7M A;  4EV6 A;  3PVX A;  4I2H A;  2JH1 A;  1KRP A;  2W03 A;  5HRK A;  3ER8 C;  4RQ0 A;  1RQN A;  5AM3 A;  5J0T A;  1Q79 A;  4O9M A;  1D8B A;  1L7O A;  4C4T A;  4QZH A;  5HHI A;  4BX9 C;  3IP4 B;  3GV5 B;  3ONN A;  4S3N A;  4Z6C A;  2KHQ A;  3SAH A;  2BHN A;  5KFE A;  2PFP A;  2AXT U;  3K4G A;  5DLG A;  1V85 A;  2NRV A;  4FBT A;  4XRH A;  2HW3 A;  1RG6 A;  4NLC A;  4QIW C;  3MAB A;  4O68 A;  4RQ3 A;  5KFK A;  4YD2 A;  3JCF A;  5DB7 A;  4XUS A;  4DSK A;  4MF2 A;  4RQ2 A;  2NV3 A;  9ICQ A;  2H5X A;  3BS7 A;  4FO1 A;  4ATB B;  1ZRN A;  4I2G A;  4KLE A;  3QUB A;  5CFS A;  2ZHB A;  3F5A A;  2JXJ A;  2ASD A;  4ELU A;  3OJS A;  4DEZ A;  2JHD A;  2KNJ A;  4B9M A;  2E8O A;  4X5V A;  4UBC A;  1S97 A;  1X6I A;  4ECR A;  3KBB A;  3ISB A;  1F5S A;  9ICC A;  3UM9 A;  1K1Q A;  2QAR B;  3WK9 A;  1D8Y A;  5HR7 A;  2F8K A;  4UB3 A;  5KG4 A;  4KLI A;  4GXI A;  5ALU A;  3DDH A;  2G07 A;  3B0X A;  4E80 A;  2FDR A;  3H8M A;  5D63 A;  4F4W A;  5L1M A;  2HHU A;  2PBE A;  3E0F A;  4UAR A;  5KFB A;  4KLD A;  3RJG A;  2KVC A;  5J0O A;  4BXO B;  3WK6 A;  3RB3 A;  2HHX A;  4EYH B;  3AQN A;  2J6S A;  7ICT A;  3KZX A;  5CR0 A;  3PX6 A;  2HHS A;  4Q8E A;  2DBY A;  4QWD A;  2V4R A;  1KBU A;  4KLG A;  4M47 A;  4ICA A;  2M0N A;  5KT7 A;  3UQ0 A;  2DPJ A;  3ALR A;  5KFX A;  2WFA A;  5KFO A;  1F5A A;  3OWG A;  4IC9 A;  4O5C A;  2HHT A;  1U4B A;  4QJF B;  4UAY A;  4UD5 A;  1PK3 A;  1MN8 A;  1X6J A;  4J9M A;  4IR1 A;  7ICQ A;  3AUO A;  3H8J A;  8ICZ A;  2JEG A;  4Z6F A;  4EBK A;  1X9M A;  1XNS A;  2F1H A;  4EEN A;  5CFU A;  5J2C A;  5AIC A;  3QXG A;  3LDA A;  2JZB A;  5GTI U;  5B5E U;  3F5E A;  2EAN A;  1NK9 A;  4IQT A;  1QSS A;  3MCR A;  3LK9 A;  3EZ5 A;  4KLU A;  3KHL A;  4QZE A;  4EBJ A;  5AI0 A;  4MEY A;  4ED0 A;  4MEX A;  3PHZ A;  5AKE A;  9ICU A;  2XI9 A;  9ICP A;  3TAP A;  1ZQR A;  4PL1 A;  5DG8 A;  4O3S A;  1JIH A;  3BQT A;  2RDJ A;  4RT3 A;  4DLG A;  5KFT A;  2RDI A;  3Q8L A;  2JEJ A;  4F5Q A;  3WKE A;  3TAN A;  1VDV A;  4G3I A;  2E8M A;  4IG8 A;  1H38 A;  4UB1 A;  4K96 A;  1LKY A;  4WJ3 B;  3KKA C;  5EOZ A;  1XWL A;  4JWM A;  1ZQZ A;  2ZIU B;  3LVW A;  2J6T A;  2KJ8 A;  2QB0 A;  1L8L A;  3GIK A;  3H37 A;  2VJ4 A;  4R65 A;  4UQG A;  2ASJ A;  4DQR A;  4DQS A;  4RNO A;  3NVZ A;  1ZET A;  2MUT A;  5D46 A;  3OJU A;  1WWU A;  4Y2S A;  4GXK A;  1TV9 A;  5ALJ A;  3K1R B;  3H4B A;  4FZM A;  1ZQH A;  5CHG A;  7ICR A;  3JPR A;  4DSF A;  1ZQI A;  3N28 A;  4PZO A;  5J0S A;  4RQN A;  3G6Y A;  4M6W A;  1DK2 A;  3OHB A;  4RNN A;  5D62 A;  1LVH A;  3TAR A;  4B9U A;  3IHQ B;  2ZIU A;  3HJ4 A;  1ZQX A;  5BOL A;  4PJ0 U;  2EZZ A;  1HUO A;  4I2E A;  4CRX A;  2ALZ A;  2MSN A;  2Y1J A;  3U26 A;  3RBD A;  2HN1 A;  3KFU F;  4EBD A;  1ZD5 A;  5CHE A;  4DOA A;  3AQK A;  1JX4 A;  3HIL A;  1DRG A;  2YMP A;  1OUQ A;  1ZQW A;  5F3X B;  4NXV A;  1VFG A;  3NTU A;  4USA A;  4K4G A;  1SL1 A;  2CRX A;  4YMO A;  3I1Y A;  3MR5 A;  2W8K A;  4PGQ A;  8ICF A;  2GO7 A;  4DL5 A;  4CF5 A;  2B4V A;  4F4K A;  4IS7 A;  4DWI A;  8ICX A;  3M9M B;  4PGX A;  5IIM A;  1OXJ A;  3SV4 A;  4M04 A;  3SEI A;  2C28 A;  2JRZ A;  3TKA A;  3SYZ A;  3RR8 A;  2AQ0 A;  1KDH A;  3CP8 A;  1SXD A;  3FM9 A;  4PHE A;  3PNC A;  3L4P A;  4ECQ A;  3BDP A;  4F93 B;  2V4Q A;  2BDU A;  4NLK A;  2KFZ A;  3SAF A;  2RP5 A;  5AKJ A;  4RUC A;  4RWO A;  2HCF A;  2F1J A;  3JPT A;  3BQ7 A;  2AJQ A;  4Y2Y A;  4P4P A;  4JV1 A;  1DGS A;  2DR8 A;  4IL6 U;  4J9Q A;  5KFA A;  1YZ7 A;  5ALW A;  1A6S A;  2UVR A;  4X0A A;  1FA0 A;  5KT3 A;  3C66 A;  5L9X A;  2WF9 A;  1SKW A;  2MA1 A;  5GTH U;  2C22 A;  1ZQJ A;  1COO A;  4WC2 A;  1TFY A;  5DLF A;  2ZIW A;  2KMD A;  3WFS C;  4O0I A;  3HKZ F;  3HPO A;  4FHV A;  3IG5 A;  5AKH A;  2AH5 A;  5ALK A;  9ICM A;  4QZB A;  8ICM A;  3Q8M A;  4J03 A;  1RZT A;  2ZJA A;  1X9W A;  3BQ1 A;  4UB2 A;  1TAM A;  1R8C A;  1YT3 A;  3ETR A;  4KN7 A;  9ICS A;  2M2T A;  2HDO A;  5IIO A;  9ICL A;  4TUP A;  5EWG A;  5J0P A;  2NRZ A;  4GFJ A;  5JUM A;  4F2R A;  4QZ9 A;  8ICW A;  4B9V A;  2YTU A;  2KIC A;  4DO9 A;  5DQI A;  5K4L A;  2WTF A;  3K75 D;  3LWL A;  3WK8 A;  2ZH5 A;  4K4H A;  2R8I A;  3H0R B;  4WH5 A;  1HIW A;  1NK0 A;  3B9J A;  5AKI A;  4WC7 A;  2R8K A;  8ICE A;  3PR5 B;  1ZQP A;  3SR6 A;  1BPX A;  4RNM A;  3ZD8 A;  3ICX A;  1SV4 A;  2E1E A;  3RJK A;  4YXJ A;  2WF8 A;  4DQQ A;  5ALG A;  5BOM A;  2W3S A;  3R9K A;  4K9B A;  8ICK A;  3PSF A;  4XQ8 A;  2W7P A;  4M6W B;  4RWQ A;  9ICA A;  5ALS A;  1ZQK A;  5C5J A;  5J8Y C;  1TAQ A;  1J97 A;  4KLH A;  4M9H A;  3VCB A;  1V4A A;  4ELV A;  1JAJ A;  5KFP A;  7ICI A;  1SIJ A;  4J9N A;  3C18 A;  4I2I A;  1U47 A;  4NY8 A;  1MIW A;  4DOB A;  4X0B A;  1DGJ A;  1ECW A;  2DKZ A;  2C2D A;  3UMG A;  5EE0 A;  3PO5 A;  3HWT A;  9ICI A;  3AM9 A;  1NOM A;  2LPE A;  4KB6 A;  1PVR A;  4NKT A;  1U48 A;  1QTM A;  5HC9 A;  1L6N A;  2KZ3 A;  4MHV A;  2VA3 A;  3TFS A;  4ATB A;  3BS5 B;  4F5O A;  5T14 A;  3MDA A;  3RAX A;  5DG7 A;  4QZF A;  1Q3V A;  3D2S A;  4WBZ A;  1TFR A;  3JPS A;  1IG6 A;  5KG3 A;  5F2V O;  1UET A;  2Q0Z X;  2DR5 A;  2KSO A;  4KLT A;  1X66 A;  3C2K A;  2K89 A;  5DBA A;  3T5L A;  1ZQM A;  2WAQ C;  3GIL A;  3ZDD A;  5KFS A;  2F8L A;  9ICH A;  4F50 A;  1S8O A;  1EXN A;  2K4E A;  1U45 A;  2I6X A;  1NK4 A;  5KNI A;  1Y88 A;  4DFJ A;  1XU4 A;  3KHH A;  3WK4 A;  3FDS A;  1UEU A;  2ZH7 A;  1NKE A;  2JEF A;  1B4F A;  2XY6 A;  2BQR A;  4EX7 A;  1T94 A;  2B21 A;  4X4U A;  1SV0 C;  3NVV A;  3H3A A;  1BPY A;  3ISC A;  1BPD A;  3NGD A;  2HBL A;  2K8C B;  3LWM A;  4ZOH C;  1DXS A;  3M6K A;  5DGB A;  2GAF D;  1UA0 A;  1BPB A;  3OUY B;  5AI4 A;  3WK7 A;  4F71 A;  2DKX A;  1ZQU A;  4Y2J A;  5DDM A;  4F2S A;  4I2J A;  2A1A A;  2R18 A;  4Q45 A;  2DPI A;  8ICU A;  1MQ3 A;  1RDF A;  2Y9U A;  2K4H A;  1SGG A;  8ICI A;  4YG2 A;  1S0V A;  2HOI A;  3NRW A;  1S9F A;  4O3P A;  3H38 A;  2UVW A;  3Q8K A;  3BZK A;  2B51 A;  4PPX A;  7ICE A;  2ZIX A;  2AQ4 A;  9ICV A;  3Q8S B;  1ZQ1 C;  2P66 A;  2W9B A;  2NRT A;  4X4N A;  5HRI A;  4JB3 A;  4NXW A;  5DDY A;  3AQE A;  1WOT A;  2O6K A;  3OPX A;  2G5I B;  2XO7 A;  3ZDA A;  1BNP A;  2XCP A;  2GA9 D;  5KG0 A;  2N1R A;  1Z1V A;  4C0Z A;  4CNQ A;  3QZ8 A;  3M8R A;  1Z19 A;  4I2B A;  5L1K A;  3RF9 A;  2KD1 A;  2M2U A;  2WHE A;  4NL9 C;  4FBU A;  2EDU A;  3AQF A;  5JRT A;  2AGO A;  9ICR A;  5CRX A;  2GOL A;  4US9 A;  3GV7 B;  5AIA A;  3JPN A;  3PW0 A;  4UB6 U;  4X4V A;  3SQI A;  5DB8 A;  1TE2 A;  2HHQ A;  4E7X A;  1NJZ A;  4KLQ A;  7ICG A;  4FHP A;  1NJW A;  4WC3 A;  3TAC B;  1PX5 A;  5KFH A;  2KZM A;  1L8O A;  3C2M A;  2QLT A;  2VA2 A;  1Z1B A;  4K97 A;  4YD1 A;  3BS5 A;  4UAS A;  1UT8 A;  5KFN A;  2H3Z A;  2KV2 A;  4XJE A;  4NV0 A;  4QWE A;  4QZG A;  1Q46 A;  1ZQQ A;  2DL0 A;  3GFK B;  2W55 A;  2G08 A;  3C1Y A;  4ECZ A;  2HOF A;  5G5H A;  9ICW A;  1FEZ A;  3SV3 A;  4ECT A;  4WC4 A;  1XC9 A;  2XY5 A;  8ICC A;  4EBC A;  4BGD A;  5AI5 A;  1Z4O A;  3GV8 B;  3ORY A;  2D6F C;  1KN5 A;  3UXP A;  4QW9 A;  5J2E A;  5HR9 A;  3RB4 A;  2A1J A;  1FFU A;  3E58 A;  1ZQO A;  5KFV A;  3LQC B;  3EWA A;  3MR3 A;  4RWN A;  1QQ5 A;  2IOH A;  1SWV A;  4FH5 A;  2OH2 A;  1FIQ A;  5KFC A;  2WF6 A;  4LEY A;  2VIX A;  2YN4 A;  4WBY A;  2EZY A;  1LV5 A;  9ICJ A;  4Y2P A;  1JRO A;  3SI8 A;  2BPF A;  2AU0 A;  5IIJ A;  3ZI4 A;  1UHU A;  4B9N A;  2IHN A;  4ACO A;  2ZH1 A;  2PI5 A;  4CF3 A;  3OUY A;  2CN1 A;  5AK6 A;  4NM2 A;  2ZTD A;  1L7P A;  5KFF A;  2XGP A;  2PFN A;  4RU9 A;  3RAQ A;  2KTQ A;  4MF8 A;  2DRA A;  1XSL A;  2UVV A;  2DVI A;  3UPQ A;  1OU5 A;  3H39 A;  2DQN B;  1SKS A;  4KLJ A;  5EE3 A;  1RYR A;  4O5K A;  4DSJ A;  4PHP A;  1S77 D;  2BKE A;  4P0P A;  5D4B A;  1V38 A;  5J0X A;  4DLE A;  3PMN A;  4AT7 A;  3DEE A;  2ZH6 A;  3GDX A;  2Z7J A;  2F77 X;  2BGW A;  2HN2 A;  3TI0 A;  4M9N A;  3HRD D;  1COK A;  3PSP A;  2DFL A;  4P4M A;  3HW8 A;  3MR6 A;  3NKU A;  5AKK A;  4YN4 A;  1SL0 A;  4K98 A;  2P35 A;  8ICB A;  3K7D A;  2W9C A;  2FPL A;  4IQU A;  5J0R A;  3V6H A;  1C20 A;  1QSL A;  2HHP A;  5HRB A;  2ZTE A;  3Q8R B;  3SD7 A;  1KTQ A;  4DL3 A;  4LVS A;  3J81 j;  3OSN A;  3C2L A;  8ICQ A;  3SMV A;  4EX6 A;  3TAD C;  4O5E A;  3GIM A;  3PY8 A;  3JZ0 A;  1T3N A;  1PVQ A;  2B0C A;  1Z3E B;  9ICG A;  4AT7 B;  4X4O A;  1RYU A;  3WKA A;  2XIC A;  4FS2 A;  2WAQ F;  4F4Y A;  7ICO A;  3UXN A;  4YMM A;  4QIW F;  5JTG A;  2KZZ A;  3NUQ A;  1BGX T;  4F91 B;  1MIV A;  2XVT A;  5HRH A;  4X4S A;  4AYB F;  3Q8P B;  2IHO A;  3Q8Q B;  5AKZ A;  3RRH A;  3L9D A;  3LYS A;  4DFK A;  5D49 A;  4GXJ A;  2ZTC A;  1MSW D;  4LEW A;  2D3D A;  4EEL A;  2XID A;  5HR6 A;  5DKW A;  1O03 A;  4I2A A;  2DF4 B;  1KFD A;  1Z00 A;  3KKA A;  4ED8 A;  4EP7 A;  2MRL A;  3QU4 A;  5KFD A;  4QZD A;  2MAX A;  3QUC A;  3NYB A;  4YR2 A;  1U49 A;  4TUS A;  9ICK A;  1JMS A;  3ZDE A;  2JGA A;  5DED A;  1ZQS A;  2CPR A;  5J2B A;  2Q4T A;  1N2X A;  3N7S C;  3V72 A;  4WC6 A;  1N56 A;  3RJH A;  1NNL A;  4QWB A;  4R66 A;  5KFQ A;  2J6U A;  3OTQ A;  2IOF A;  2HVI A;  1S5L U;  4R63 A;  5AI9 A;  5J0W A;  3PZP A;  3ZDC A;  1J2N A;  5AKX A;  3RH5 A;  3RJE A;  3C5G A;  2P6U A;  4FHW A;  3K1Z A;  1RYS A;  3H7I A;  4RWP A;  3ED5 A;  2W8L A;  3TQ1 A;  2RHF A;  2GWS A;  5AK3 A;  2XGQ A;  1V9P A;  1RQL A;  1KQQ A;  1IXR A;  1NK7 A;  3V7J A;  4UAW A;  3EF2 A;  4K99 A;  5KAF U;  4QZI A;  3NVO A;  3MGV A;  5KFI A;  4RPZ A;  1L7N A;  4F5P A;  5KG7 A;  5DG9 A;  2ZUB A;  4CDG A;  1KFS A;  2YX8 A;  2EAM A;  2BQU A;  4KMU A;  1PZN A;  4FHX A;  2FJ6 A;  3OHA A;  1VJ7 A;  4JWN A;  3QYP A;  3H4D A;  4E8F A;  2DUY A;  3MFI A;  3OGU A;  3UPS A;  4MFF A;  5A0L A;  4K8V A;  4XA5 A;  3QNM A;  1TK0 A;  4PHD A;  1GPJ A;  4HX0 A;  4B9S A;  1ZOL A;  2PFQ A;  4PL2 A;  4LZG A;  5J2F A;  5ALF A;  1DK3 A;  3IM1 A;  3KD3 A;  8ICH A;  2W7O A;  4O69 A;  2EAP A;  1ZQG A;  5ALY A;  4WOY A;  1N60 A;  4A8E A;  3RFA A;  5AK5 A;  8ICJ A;  2ZHA A;  4LEZ A;  4MFA A;  4DCC A;  4NL9 A;  4RQM A;  3PV8 A;  3I76 A;  1ZJM A;  2EH9 A;  2NRK A;  3PST A;  3TAD A;  4LT6 A;  4QWA A;  4I2F A;  5J2K A;  9ICO A;  2ZIX B;  5CWR A;  3GIJ A;  4Y2U A;  5L1L A;  5HRG A;  2DR9 A;  2AHO B;  4BXO A;  4U6P A;  4LZD A;  2LM1 A;  1S76 D;  3MGI A;  2BBJ A;  2E5S A;  4WQL A;  4R8U A;  1URJ A;  2NRX A;  3T5H A;  3SZ2 A;  2FLN A;  2LBO A;  1HEK A;  3F2C A;  1NKB A;  4CF4 A;  4EBE A;  3KOO A;  3WU2 U;  2PXI A;  3AU6 A;  3RRG A;  3HP6 A;  1WWV A;  5ALN A;  2IMW P;  4OAG A;  1ZQT A;  4NKU A;  2KJ5 A;  2LHT A;  4EZ6 A;  3EUB 2;  2EZX A;  1ZD2 P;  1Z00 B;  3QUQ A;  1V97 A;  4ECY A;  4TQR A;  3EYZ A;  5KTQ A;  3PW4 A;  2I1Q A;  8ICA A;  1ZRM A;  9ICT A;  3M8S A;  5CJ7 A;  2OM6 A;  1IV8 A;  2FPK A;  2V9W A;  4NJ8 A;  2ZH4 A;  1SB3 C;  2PMZ F;  4Q8F A;  1S0M A;  1HUZ A;  3HIY A;  4YVZ A;  1QLN A;  5L1I A;  2JMG A;  3KTQ A;  5J8Y A;  4AT9 A;  4EZ9 A;  1JRP A;  2ID1 A;  5F9N A;  3OVB A;  4QW8 A;  4AP9 A;  2KSO B;  4ED1 A;  4B6J A;  5J0U A;  1ZQF A;  4C8L A;  2WB1 C;  2BCR A;  4C7Y A;  1ZXI A;  8ICT A;  3BJY A;  4YFK A;  1XSP A;  1R8A A;  3OVS A;  1JXL A;  2ES6 A;  1NK8 A;  1ZQB A;  4OO1 J;  1NKC A;  5HRD A;  2IUB A;  4X4T A;  2F1I A;  3HJE A;  5ALL A;  1A76 A;  5HMM A;  2ZXI A;  5KG5 A;  4IRK A;  4Y2V A;  2QB0 B;  2FLL A;  4F92 B;  4FZN A;  4P0Q A;  5J2A A;  2KK0 A;  2PMZ C;  2LYB A;  4JUZ A;  4MFC A;  2F44 A;  1OW5 A;  4WC0 A;  1L5U A;  1NO5 A;  3QU5 A;  4DSI A;  1ZYQ A;  1T4G A;  2OCE A;  1XSN A;  2E1F A;  4FE3 A;  5EE1 A;  2K60 A;  3GU3 A;  5ALO A;  3RBE A;  5AM0 A;  2FMP A;  8ICO A;  4Y2T A;  2D8C A;  4NLZ A;  1NJY A;  4YR0 A;  1X40 A;  2NYV A;  4BWM A;  4P4O A;  2BCQ A;  3C29 A;  4TUR A;  4NXU A;  4P0Q B;  2B6G A;  5ALH A;  4BUG A;  1HJP A;  2KJ9 A;  2IHM A;  2LM4 A;  3ISD A;  1ARO P;  1RPL A;  1R8B A;  4F5N A;  4WQK A;  5DBC A;  4OJ5 A;  3N97 B;  3OV7 A;  2KIW A;  4DFM A;  3M6Z A;  3L5K A;  4FZL A;  5ALT A;  4Z6E A;  8ICL A;  5HML A;  1N5W A;  4WCW A;  1NZB A;  3T79 A;  4RQ8 A;  2YML A;  1NZP A;  2W9C B;  1Q78 A;  4I0U A;  3QEA Z;  5AM4 A;  5G5G A;  4C4S A;  1NJX A;  1UEV A;  7ICH A;  4GIB A;  1TK8 A;  1T3Q A;  1KL9 A;  4M9G A;  3RB6 A;  3H0L B;  1ZQV A;  2JEI A;  1S0O A;  5KFL A;  1TAU A;  2I5H A;  3NWI A;  2F2A B;  4HAI A;  3WKD A;  4J9R A;  4NLB A;  2LYH A;  4BJQ A;  4C80 A;  4TQS A;  1PVP A;  3B0Y A;  2JH7 A;  3V7K A;  4DF4 A;  5DGA A;  2KVS A;  2YMM A;  4RQ5 A;  3RJF A;  4ZH4 A;  2CXY A;  3JPQ A;  2K8B B;  3ERC C;  3PW5 A;  5C0Y A;  5ALD A;  4M5D A;  5KG2 A;  4Q43 A;  4ECU A;  4RQ1 A;  2ZH9 A;  5BPC A;  4QWC A;  2ZXH A;  1XS9 D;  2R8J A;  4Y2X A;  3G6X A;  4U7C A;  3GZF A;  3BZC A;  4LEV A;  5AM1 A;  2Y0S C;  8ICS A;  1BPZ A;  8ICP A;  3IRU A;  4Y2R A;  2NO4 A;  7ICL A;  3N4M B;  1B22 A;  4DS4 A;  2HSZ A;  2KP7 A;  2ASL A;  1K1S A;  2H3F A;  1WUD A;  3O0F A;  1SZH A;  3A0H U;  1M6Y A;  4DFD A;  2K4P A;  1Z4N A;  4FH3 A;  5HRE A;  2ZJ8 A;  4P0P B;  4PH5 A;  1QSY A;  7ICS A;  3FC4 A;  3EW9 A;  4UB8 U;  4M0A A;  3WKC A;  3MBY A;  3CYM A;  1WG8 A;  2VA8 A;  1C7Y A;  4M9J A;  4UW9 A;  3OVA A;  3A0B U;  4DL2 A;  4F72 A;  4YR3 A;  2HI0 A;  4DSL A;  1N62 A;  2FE9 A;  1D9F A;  1F0M A;  3N7P D;  2I9G A;  1X9S A;  2C2E A;  4J9O A;  2LYA A;  2RLT A;  5KAI U;  3NVY A;  2ATL A;  3SAG A;  3AN1 A;  2NRW A;  3PX4 A;  5DEC A;  4KX3 A;  3BQ0 A;  4FS1 A;  1QCK A;  2BE3 A;  4IRD A;  1SZP A;  2KKP A;  2FI1 A;  2DR7 A;  8ICV A;  1MA7 A;  4O6A A;  4X4P A;  5ALX A;  4OJ6 A;  5JTI A;  4LJX A;  2W9B B;  2YY6 A;  4QNL A;  7ICV A;  5KFR A;  5J2G A;  1ZQL A;  2HHW A;  2ZUD A;  2FPM A;  5KL1 B;  1KLN A;  4X4R A;  4I27 A;  3EPI A;  7ICN A;  5TZV A;  5DB6 A;  3ER9 B;  4UAZ A;  1ZQC A;  4RPY A;  1BNO A;  3M9N B;  1BVS A;  4J9L A;  5EWE A;  7ICP A;  1ZQN A;  4O3O A;  4MKP A;  5AKL A;  2HVH A;  2BZF A;  3L3F X;  1SWW A;  3CW2 C;  4QZA A;  2BR0 A;  2ZG6 A;  4R64 A;  4KMO B;  1WCN A;  4KLS A;  5F9L A;  3JPO A;  3G6V A;  4M2Y A;  3H8W A;  2E8N A;  4EEY A;  1MC8 A;  2Y9T A;  3KZI U;  4NXX A;  5AI6 A;  2W54 A;  3WK5 A;  4I2C A;  4BWJ A;  1MIY A;  2ZH3 A;  5KT6 A;  4XQ7 A;  7ICJ A;  8ICR A;  3THV A;  1L3V A;  2IBK A;  3OSP A;  4M9L A;  3T5K A;  3NS1 A;  2M9N A;  2BPG A;  1TFW A;  2G09 A;  2YB4 A;  3C21 A;  2W9A A;  5L1J A;  2H3V A;  1UA1 A;  2A1J B;  3H8S A;  4OCZ A;  2MU2 A;  5KFU A;  4Z6D A;  3QU9 A;  3GII A;  4N7R A;  1XO0 A;  5CB1 A;  4UAT A;  2AGQ A;  4KTQ A;  1PK1 A;  3RB0 A;  4UAU A;  3RJI A;  4NXZ A;  1ZQE A;  1KW4 A;  2WF5 A;  1JN3 A;  3H40 A;  1YZ6 A;  2ZH8 A;  2HBJ A;  1RXW A;  3NRZ A;  2FMS A;  5IIL A;  3FYH A;  2M2W A;  5KT2 A;  1LB2 B;  3UXO A;  4HYK A;  5ALI A;  4C7Z A;  2ZIW B;  1QQ7 A;  1S10 A;  3V7L A;  3H0M B;  4UB5 A;  4E0D A;  4DF8 A;  3HX0 A;  3D2N A;  5III A;  2HBK A;  3RH4 A;  5HP4 A;  4PHA A;  3QEB Z;  4G9B A;  5KFJ A;  3S6J A;  2WF7 A;  5KL8 B;  1F44 A;  2G0A A;  3HKZ C;  3TFR A;  1GO3 F;  2ZJ5 A;  2Y0S F;  3UQ2 A;  1R89 A;  4FO6 A;  2A3V A;  4KM5 A;  7ICF A;  2R8H A;  2O5A A;  1SXE A;  4J9P A;  3N7R C;  4Y2Q A;  2KG5 A;  2R8G A;  1LKY B;  5KFZ A;  3EPG A;  2ISO A;  4YCX A;  2HOQ A;  4OAH A;  2GH1 A;  2K8A A;  3RR7 A;  2KHV A;  3PX0 A;  4ECV A;  3QU2 A;  4TUQ A;  3KHG A;  4C8K A;  1UPH A;  3FAH A;  1PUZ A;  2W11 A;  4IR9 A;  3E2E A;  3PML A;  2FCL A;  2KFN A;  5ALP A;  2JZB B;  3M7D A;  3MR2 A;  1ZQD A;  4EGW A;  2MUT B;  4F3O A;  3WKB A;  4CGZ A;  2C2R A;  1JAL A;  1X9X A;  2RRD A;  1JQR A;  1Q8K A;  4IQW A;  2OEH A;  4YQW A;  3BQ2 A;  3GQC A;  1CRX A;  4RZR A;  4CE6 A;  1NI3 A;  2WB1 F;  3T5J A;  3IG8 A;  2ISP A;  4O67 A;  4O3M A;  1D8L A;  1K5O A;  3MC1 A;  4ED7 A;  2OXO A;  3C23 A;  2XY7 A;  1T7P A;  3MDC A;  4US8 A;  3MGH A;  3PO4 A;  2LMR A;  4ED2 A;  5JU5 A;  4ECW A;  1X2I A;  2M2V A;  2IA6 A;  2OHF A;  2NO5 A;  5AI8 A;  1JUD A;  2ZIV A;  4RQ4 A;  2K4I A;  3IV6 A;  4Q44 A;  4I2D A;  4F5R A;  4EED A;  4NXT A;  5KFW A;  3WFQ E;  2HBM A;  5IIK A;  2LI6 A;  4RQ7 A;  4JLX A;  2PKE A;  1KKX A;  4F8R A;  2G5H B;  5J29 A;  1FO4 A;  5B66 U;  2XCA A;  2W04 A;  4FHY A;  4UBB A;  5J2H A;  3PSI A;  4NM1 A;  2PFO A;  2LKY A;  4OD0 A;  1Q3U A;  4JLZ A;  4DSE A;  3M9O B;  3C5F A;  1VLB A;  1TKD A;  4EEB A;  4O3R A;  3HT3 A;  1FFV A;  4YXM A;  4OAF A;  1L3U A;  2QAR A;  3JPP A;  5ALV A;  1O08 A;  4C4R A;  1B43 A;  1N63 A;  4ED6 A;  5ALE A;  5AK4 A;  4B9T A;  4I28 A;  3WFO A;  8ICN A;  4K9A A;  5HHH A;  3PR4 A;  1UT5 A;  2YQE A;  1A77 A;  2ZUC A;  4O3Q A;  2ODG A;  2BCV A;  5J2D A;  4IRC A;  4OAI Z;  2OYY A;  3TAQ A;  1U9L A;  1NK6 A;  5ALR A;  3C28 A;  2BCU A;  4OJL A;  1PK1 B; 
#chains in the Genus database with same CATH homology
 5KFC A;  3OHB A;  4RNN A;  4AT8 B;  4WBY A;  4AT9 B;  4Z6E A;  8ICL A;  5HML A;  4DS5 A;  1LV5 A;  9ICJ A;  4QZC A;  3SI8 A;  3TAR A;  4B9U A;  2BPF A;  3IHQ B;  4WCW A;  3HJ4 A;  1ZQX A;  4RQ8 A;  5IIJ A;  2AU0 A;  2OWO A;  5BOL A;  2HHV A;  4DL7 A;  1NZP A;  2W9C B;  1HUO A;  4B9N A;  1IM4 A;  4J9K A;  2IHN A;  4I2E A;  2ZH1 A;  4B9L A;  3RH6 A;  1Q78 A;  2PI5 A;  3QEA Z;  2ALZ A;  4UD4 A;  3PW2 A;  2Y1J A;  3OUY A;  3RBD A;  1NJX A;  1DOQ A;  4NM2 A;  2ZTD A;  4EBD A;  3WFR E;  5KFF A;  1UEV A;  2XGP A;  2PFN A;  7ICH A;  4RU9 A;  4DOA A;  5KT4 A;  3RAQ A;  2KTQ A;  3AQK A;  4MF8 A;  4PGY A;  2DRA A;  1JX4 A;  1TK8 A;  4C8O A;  1XSL A;  1ZQW A;  2UVV A;  3C1Z A;  1VFG A;  3NTU A;  2DVI A;  4K4G A;  3UPQ A;  1OU5 A;  4M9G A;  1SL1 A;  3RB6 A;  4YMO A;  1ZQV A;  3H39 A;  2JEI A;  1S0O A;  5KFL A;  3MR5 A;  8ICG A;  1SKS A;  2W8K A;  4KLJ A;  4PGQ A;  1TAU A;  8ICF A;  4JV0 A;  4RQ6 A;  4DL5 A;  4F4K A;  4DWI A;  1RYR A;  3V6J A;  3M9M B;  8ICX A;  5KT5 A;  4PGX A;  5IIM A;  4M04 A;  3SV4 A;  4O5K A;  9ICN A;  4DSJ A;  4PHP A;  2C28 A;  4KLL A;  1S77 D;  4J9R A;  2LYH A;  4TQS A;  2BKE A;  3SYZ A;  3RR8 A;  5D4B A;  2AQ0 A;  1KDH A;  2BCS A;  4NLG A;  9ICF A;  5J0X A;  4PHE A;  3B0Y A;  5HNK A;  4DLE A;  3PNC A;  4ECS A;  2W9M A;  3PMN A;  3V7K A;  1TVA A;  2O1P A;  1ZQY A;  4AT7 A;  4ECQ A;  4DF4 A;  5DGA A;  3BDP A;  1L3T A;  3GDX A;  1RXV A;  2ZH6 A;  4GLX A;  4RQ5 A;  4F93 B;  2V4Q A;  3RJF A;  4ZH4 A;  2BGW A;  1XO1 A;  4NLK A;  2KFZ A;  5DB9 A;  3TI0 A;  4KN4 A;  4M9N A;  3JPQ A;  1YLQ A;  4RUC A;  4I29 A;  4P4M A;  2DFL A;  3HW8 A;  3PW5 A;  1MQ2 A;  4RWO A;  3MR6 A;  4M5D A;  4RUA A;  1KFT A;  4YN4 A;  2VAN A;  5KG2 A;  4DFP A;  2F1J A;  4Q43 A;  4ECU A;  1SL0 A;  4RQ1 A;  3ZDB A;  2PI4 A;  3JPT A;  8ICB A;  3AQM A;  2AJQ A;  2W9C A;  5BPC A;  2ZH9 A;  4QWC A;  5DBB A;  4X4Q A;  4P4P A;  4JV1 A;  1XS9 D;  1DGS A;  2FPL A;  2R8J A;  2DR8 A;  3G6X A;  3PW7 A;  5J2I A;  8ICY A;  4IQU A;  5J0R A;  4J9Q A;  3V6H A;  1QSL A;  5KFA A;  2HHP A;  4ELT A;  5HRB A;  2ZTE A;  1N48 A;  3Q8R B;  1ZQA A;  2UVR A;  4X0A A;  1FA0 A;  5KFM A;  8ICS A;  3AU2 A;  1BPZ A;  8ICP A;  1KTQ A;  4DL3 A;  5KT3 A;  4GC7 A;  5L9X A;  1SKW A;  4LVS A;  3AQL A;  3C66 A;  7ICL A;  2FMQ A;  3OSN A;  3C2L A;  3N4M B;  2C22 A;  8ICQ A;  1B22 A;  4DS4 A;  1ZQJ A;  2KN7 A;  1COO A;  2KP7 A;  3QE9 Y;  2ASL A;  4WC2 A;  1TFY A;  4O5E A;  3GIM A;  1K1S A;  5DLF A;  3PY8 A;  4CCH A;  3JZ0 A;  1T3N A;  3WFS C;  2RFF A;  7ICM A;  4O0I A;  3HPO A;  1Z3E B;  4RT2 A;  4EYI B;  9ICG A;  4FHV A;  4AT7 B;  4X4O A;  1CEZ A;  1JXE A;  2P6R A;  4R8U B;  4F4Y A;  4FS2 A;  9ICM A;  5HRE A;  4FH3 A;  2ZJ8 A;  4QZB A;  3UXN A;  7ICO A;  4PH5 A;  4YMM A;  3Q8M A;  8ICM A;  8ICZ A;  4DL4 A;  1QSY A;  2KZZ A;  7ICS A;  5HRL A;  1RZT A;  2ZJA A;  1CUK A;  1BGX T;  3EW9 A;  4F91 B;  3BQ1 A;  4UB2 A;  1X9W A;  1MIV A;  4M0A A;  1NK5 A;  4DQP A;  5HRH A;  1R8C A;  4X4S A;  4KN7 A;  3MBY A;  9ICS A;  3Q8P B;  3Q8Q B;  2VA8 A;  2M2T A;  3RRH A;  3L9D A;  1C7Y A;  4M9J A;  4DFK A;  2ZH2 A;  5D49 A;  4C8M A;  4GXJ A;  3OVA A;  5IIO A;  4DL2 A;  2ZTC A;  1MSW D;  9ICL A;  5KFG A;  4TUP A;  2DRB A;  5EWG A;  4ED3 A;  5DKW A;  5J0P A;  4KLF A;  2NRZ A;  4YR3 A;  4I2A A;  5JUM A;  5EWF A;  1KNY A;  4DSL A;  4F2R A;  1KFD A;  1D9F A;  1Z00 A;  4QZ9 A;  8ICW A;  4ED8 A;  4B9V A;  4EP7 A;  5KFD A;  2I9G A;  1X9S A;  1SKR A;  4DOC A;  4QZD A;  2C2E A;  2MAX A;  4J9O A;  1BNO A;  4DO9 A;  5DQI A;  3NYB A;  2WTF A;  3K75 D;  9ICO A;  3LWL A;  4YR2 A;  1L3S A;  1U49 A;  2ATL A;  4TUS A;  9ICK A;  4K4I A;  1JMS A;  4BDP A;  3ZDE A;  2ZH5 A;  4K4H A;  2NRW A;  3PX4 A;  2R8I A;  5DEC A;  2BPC A;  3BQ0 A;  4FS1 A;  5DED A;  1NK0 A;  2BE3 A;  1ZQS A;  4IRD A;  1SZP A;  4KLM A;  2DR7 A;  8ICV A;  4WC7 A;  4YMN A;  5J2B A;  2R8K A;  3RJJ A;  8ICE A;  4YP3 A;  4X4P A;  3PR5 B;  4F4X A;  4F4Z A;  1ZQP A;  2W9B B;  1BPX A;  3V72 A;  4WC6 A;  5KG6 A;  4RNM A;  2AGP A;  3ZD8 A;  3QZ7 A;  1N56 A;  3RJH A;  5IIN A;  4JV2 A;  3RJK A;  4YXJ A;  5J2J A;  4DQQ A;  7ICV A;  5KFR A;  5J2G A;  5BOM A;  1ZQL A;  4P2H A;  4QWB A;  2ZUD A;  4R66 A;  2HHW A;  2FPM A;  1KLN A;  9ICX A;  5KFQ A;  4X4R A;  8ICK A;  2J6U A;  4I27 A;  2HVI A;  4C8N A;  4XQ8 A;  4R63 A;  3EPI A;  4GC6 A;  5J0Y A;  5TZV A;  4M6W B;  5J0W A;  2XC9 A;  1T8E A;  1SL2 A;  7ICN A;  2Q66 A;  4O3N A;  5DB6 A;  4RWQ A;  3ZDC A;  9ICA A;  3RH5 A;  3RJE A;  4UAZ A;  4RPX A;  3C5G A;  5KG1 A;  1ZQC A;  4RPY A;  4WC1 A;  3ETL A;  1ZQK A;  5C5J A;  4KIT B;  3M9N B;  2P6U A;  1TAQ A;  1BPE A;  1BVS A;  5J0Q A;  3RTV A;  4J9L A;  7ICU A;  4FHW A;  5EWE A;  4KLH A;  4M9H A;  7ICP A;  1ZQN A;  1V4A A;  4ELV A;  1JAJ A;  1KSP A;  1WCL A;  4AT8 A;  5KFP A;  1RYS A;  3H7I A;  4RWP A;  2W8L A;  4O3O A;  5DQH A;  3TQ1 A;  1ZJN A;  2GWS A;  7ICI A;  4J9N A;  7ICK A;  5HRF A;  4I2I A;  2HVH A;  3C18 A;  4WC5 A;  1U47 A;  2XGQ A;  4NY8 A;  1V9P A;  4NLN A;  1MIW A;  4DOB A;  4QZA A;  2BR0 A;  4IQV A;  1S0N A;  4X0B A;  4R64 A;  9ICB A;  3JYY A;  3WFP A;  1WCN A;  1IXR A;  2C2D A;  1NK7 A;  3V7J A;  4UAW A;  4KLS A;  4QZI A;  2BDP A;  5F9L A;  3JPO A;  3G6V A;  5KFI A;  4RPZ A;  4M2Y A;  3H8W A;  3PO5 A;  3HWT A;  9ICI A;  4EEY A;  4F5P A;  4J9S A;  2BQ3 A;  5KG7 A;  5CA7 A;  1MC8 A;  2ZUB A;  1NOM A;  5DG9 A;  1KFS A;  2UVU A;  4NKT A;  3MFH A;  2BQU A;  1U48 A;  4BWJ A;  1QTM A;  4DQI A;  4I2C A;  1MIY A;  3HJ1 A;  5KT6 A;  2ZH3 A;  4QZ8 A;  5HC9 A;  4KMU A;  1PZN A;  4FHX A;  4XQ7 A;  2KZ3 A;  4JK1 A;  5DQG A;  7ICJ A;  3V6K A;  3TFS A;  2VA3 A;  3THV A;  1L3V A;  8ICR A;  1KEJ A;  3OHA A;  1VJ7 A;  2IBK A;  3OSP A;  2FLP A;  4ATB A;  1TK5 A;  4ECX A;  1D9D A;  4JWN A;  3T5K A;  4M9L A;  3H4D A;  4E8F A;  4F5O A;  3MDA A;  2M9N A;  3MFI A;  2BPG A;  5L1J A;  2W9A A;  3C21 A;  5DG7 A;  3OGU A;  3RAX A;  1TFW A;  4QZF A;  1UA1 A;  3UPS A;  4MFF A;  3H8S A;  2A1J B;  4WBZ A;  4XA5 A;  1TFR A;  3JPS A;  1TK0 A;  4KLO A;  4DL6 A;  5KFU A;  4Z6D A;  9ICE A;  5KG3 A;  3KHR A;  3ZD9 A;  4PHD A;  3T3F A;  5F2V O;  5KFY A;  2Y1I A;  3GII A;  2Q0Z X;  1UET A;  5CP2 A;  4B9S A;  4UB4 A;  2DR5 A;  4KLT A;  2PFQ A;  3PVX A;  4I2H A;  5CB1 A;  4LZG A;  3C2K A;  5J2F A;  5DBA A;  2AGQ A;  1KRP A;  4RQ0 A;  4KTQ A;  1DK3 A;  5HRK A;  3RB0 A;  3T5L A;  3IM1 A;  3RJI A;  4NXZ A;  5J0T A;  1ZQM A;  1ZQE A;  4O9M A;  1Q79 A;  4QZH A;  3GIL A;  3ZDD A;  1JN3 A;  5HHI A;  8ICH A;  5KFS A;  3GV5 B;  4S3N A;  4Z6C A;  3H40 A;  1ZQG A;  9ICH A;  2BHN A;  5KFE A;  4F50 A;  2PFP A;  2ZH8 A;  3K4G A;  1EXN A;  1U45 A;  1RXW A;  1NK4 A;  5DLG A;  2FMS A;  4MFA A;  1Y88 A;  8ICJ A;  2ZHA A;  5IIL A;  4DFJ A;  3FYH A;  2M2W A;  3PV8 A;  5KT2 A;  1LB2 B;  2NRV A;  1XU4 A;  3UXO A;  4HYK A;  3KHH A;  1ZJM A;  4FBT A;  2NRK A;  3FDS A;  4XRH A;  1UEU A;  2HW3 A;  2ZH7 A;  1S10 A;  1NKE A;  3V7L A;  4LT6 A;  2JEF A;  4UB5 A;  3MAB A;  4QWA A;  2XY6 A;  2BQR A;  4I2F A;  4RQ3 A;  5KFK A;  4YD2 A;  5J2K A;  4DF8 A;  2B21 A;  5DB7 A;  4XUS A;  5III A;  3HX0 A;  4RQ2 A;  4DSK A;  4MF2 A;  5CWR A;  3GIJ A;  9ICQ A;  3RH4 A;  2H5X A;  4X4U A;  5L1L A;  5HRG A;  5HP4 A;  2DR9 A;  4ATB B;  4I2G A;  4KLE A;  4PHA A;  3H3A A;  3QEB Z;  1BPY A;  2ZHB A;  3ISC A;  4BXO A;  1BPD A;  4LZD A;  3NGD A;  1S76 D;  3MGI A;  3LWM A;  2ASD A;  4ELU A;  4R8U A;  3OJS A;  5KFJ A;  2NRX A;  4DEZ A;  3T5H A;  3SZ2 A;  5DGB A;  2FLN A;  3TFR A;  2ZJ5 A;  1UA0 A;  4B9M A;  1BPB A;  1NKB A;  4X5V A;  3OUY B;  4UBC A;  4EBE A;  1S97 A;  3UQ2 A;  1R89 A;  4FO6 A;  2PXI A;  4ECR A;  3AU6 A;  7ICF A;  2R8H A;  2O5A A;  3ISB A;  1ZQU A;  5DDM A;  9ICC A;  4J9P A;  3RRG A;  2R8G A;  3HP6 A;  4F2S A;  1K1Q A;  1D8Y A;  4I2J A;  5KFZ A;  3EPG A;  4YCX A;  4Q45 A;  2DPI A;  2ISO A;  8ICU A;  1MQ3 A;  4UB3 A;  5KG4 A;  3RR7 A;  2IMW P;  3PX0 A;  4KLI A;  4ECV A;  1ZQT A;  4NKU A;  4GXI A;  4EZ6 A;  4TUQ A;  3KHG A;  4C8K A;  8ICI A;  4YG2 A;  1Z00 B;  3B0X A;  4E80 A;  4ECY A;  4IR9 A;  3E2E A;  4F4W A;  3PML A;  4TQR A;  1S0V A;  2HHU A;  3EYZ A;  5KTQ A;  2KFN A;  2JZB B;  2PBE A;  3PW4 A;  3MR2 A;  2I1Q A;  5KFB A;  4KLD A;  8ICA A;  3RJG A;  1S9F A;  1ZQD A;  9ICT A;  4O3P A;  3M8S A;  5J0O A;  2MUT B;  4BXO B;  5CJ7 A;  4F3O A;  3H38 A;  2FPK A;  3Q8K A;  3RB3 A;  2C2R A;  2V9W A;  2UVW A;  4PPX A;  2HHX A;  1JQR A;  7ICE A;  2ZH4 A;  4EYH B;  4IQW A;  2AQ4 A;  9ICV A;  4YQW A;  3Q8S B;  3AQN A;  3BQ2 A;  3GQC A;  1S0M A;  4Q8F A;  2P66 A;  2J6S A;  2W9B A;  7ICT A;  2NRT A;  5CR0 A;  4RZR A;  3PX6 A;  2HHS A;  1HUZ A;  4Q8E A;  3HIY A;  4X4N A;  4QWD A;  2V4R A;  4YVZ A;  4KLG A;  5HRI A;  4M47 A;  1QLN A;  5KT7 A;  3UQ0 A;  5DDY A;  3T5J A;  5L1I A;  2DPJ A;  3KTQ A;  1WOT A;  4AT9 A;  4EZ9 A;  5KFX A;  2ID1 A;  5F9N A;  5KFO A;  2ISP A;  1F5A A;  3OVB A;  4QW8 A;  4O5C A;  2HHT A;  4ED1 A;  1U4B A;  1D8L A;  2XO7 A;  3ZDA A;  4UAY A;  5J0U A;  1BNP A;  4UD5 A;  1ZQF A;  4C8L A;  4ED7 A;  4J9M A;  2BCR A;  2XCP A;  4IR1 A;  8ICT A;  3BJY A;  7ICQ A;  4YFK A;  3C23 A;  3AUO A;  3H8J A;  2XY7 A;  3MDC A;  1XSP A;  1T7P A;  1JXL A;  1NK8 A;  5KG0 A;  4Z6F A;  2JEG A;  1R8A A;  3OVS A;  3QZ8 A;  3M8R A;  3MGH A;  1ZQB A;  1NKC A;  3PO4 A;  5L1K A;  4ED2 A;  4I2B A;  4ECW A;  1X9M A;  4EBK A;  5HRD A;  2F1H A;  2M2U A;  1X2I A;  2M2V A;  2IA6 A;  4FBU A;  4X4T A;  2F1I A;  2AGO A;  5J2C A;  9ICR A;  4RQ4 A;  3GV7 B;  3LDA A;  2JZB A;  1A76 A;  5HMM A;  3JPN A;  5KG5 A;  4Q44 A;  3PW0 A;  4IRK A;  1NK9 A;  4IQT A;  1QSS A;  4X4V A;  5DB8 A;  4I2D A;  3LK9 A;  3EZ5 A;  4KLU A;  2HHQ A;  4E7X A;  3KHL A;  4QZE A;  2FLL A;  4F5R A;  1NJZ A;  4KLQ A;  5KFW A;  7ICG A;  4MEX A;  4MEY A;  4ED0 A;  4EBJ A;  4FHP A;  3WFQ E;  1NJW A;  5IIK A;  4WC3 A;  4F92 B;  5KFH A;  1PX5 A;  9ICU A;  5J2A A;  2KZM A;  4RQ7 A;  4F8R A;  9ICP A;  3TAP A;  4JUZ A;  3C2M A;  5J29 A;  2VA2 A;  1ZQR A;  4MFC A;  2XCA A;  5DG8 A;  4FHY A;  4O3S A;  1JIH A;  4UBB A;  5J2H A;  3BQT A;  2RDJ A;  4RT3 A;  4NM1 A;  4WC0 A;  1L5U A;  2PFO A;  1NO5 A;  4YD1 A;  4DLG A;  5KFT A;  2RDI A;  3Q8L A;  1UT8 A;  5KFN A;  1ZYQ A;  4DSE A;  4F5Q A;  3TAN A;  1T4G A;  3M9O B;  2JEJ A;  4DSI A;  3C5F A;  4G3I A;  4IG8 A;  1TKD A;  1H38 A;  4UB1 A;  4O3R A;  1XSN A;  3HT3 A;  4QWE A;  4QZG A;  1ZQQ A;  4YXM A;  1L3U A;  3GFK B;  3JPP A;  3C1Y A;  4ECZ A;  3RBE A;  5EOZ A;  1XWL A;  4JWM A;  3SV3 A;  4ECT A;  1ZQZ A;  2FMP A;  9ICW A;  1B43 A;  8ICO A;  4WC4 A;  1XC9 A;  2J6T A;  4ED6 A;  2XY5 A;  4NLZ A;  8ICC A;  4EBC A;  4B9T A;  4I28 A;  1NJY A;  4BGD A;  4YR0 A;  3GIK A;  3H37 A;  3WFO A;  8ICN A;  4R65 A;  4E0D A;  4BWM A;  4UQG A;  4P4O A;  3GV8 B;  5HHH A;  3PR4 A;  3ORY A;  2ASJ A;  1UT5 A;  4DQR A;  2BCQ A;  4TUR A;  4DQS A;  1A77 A;  4RNO A;  2ZUC A;  1ZET A;  4O3Q A;  3UXP A;  4QW9 A;  2MUT A;  5D46 A;  5J2E A;  5HR9 A;  3OJU A;  3RB4 A;  5J2D A;  2BCV A;  4IRC A;  1HJP A;  4GXK A;  1TV9 A;  3TAQ A;  2IHM A;  3H4B A;  2A1J A;  1ZQO A;  1U9L A;  5KFV A;  1ZQH A;  5CHG A;  7ICR A;  3LQC B;  3JPR A;  3ISD A;  4DSF A;  1ARO P;  1ZQI A;  5J0S A;  1RPL A;  3EWA A;  3MR3 A;  1R8B A;  4RWN A;  4F5N A;  3G6Y A;  1NK6 A;  5DBC A;  4FH5 A;  4M6W A;  3N97 B;  3OV7 A;  2BCU A;  4DFM A;  1DK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...