5BPCA

Dna polymerase beta ternary complex with a templating 5clc and incoming datp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, ligase/dna
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bpcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bpcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bpcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bpcA03
3OVBA 1UEUA 4QZHA 4UB2A 5HRBA 3BQ2A 2ZJAA 3V7KA 1V9PA 3JPTA 3JPQA 1ZETA 1WCLA 1KDHA 4BXOB 3HX0A 3AQNA 2DFLA 4KLLA 4IQTA 3UXOA 3Q8QB 3TARA 1T4GA 4UAWA 4DL2A 3EW9A 4E0DA 2B21A 4RQ3A 2W9MA 1L3TA 1H38A 4Q8EA 1F5AA 3B0XA 4P4OA 5KFGA 4DF4A 1DOQA 3THVA 2BCRA 5KFUA 2R8IA 3OUYB 3FYHA 3C66A 1EXNA 3RH4A 4UB4A 4BDPA 4M9GA 3UPQA 3T5JA 3C21A 4KLTA 3TFSA 4DLGA 4J9LA 4F4XA 2BQRA 1XS9D 2Q0ZX 4Z6DA 5KT5A 4EEYA 2NRXA 3PMNA 5EWGA 3AQMA 3MR6A 4M9HA 4RPYA 4GXKA 2IHNA 3RRGA 1NKBA 5KFWA 2RDIA 4UB3A 3JPRA 1N56A 2J6SA 4E8FA 3EZ5A 2ZHAA 5HHIA 1JMSA 4QWBA 3PMLA 4BGDA 1S77D 9ICXA 4YG2A 1Y88A 4P4PA 2BGWA 4X0BA 4J9MA 4MFCA 1XSLA 4ED0A 1OU5A 4RQ5A 4F8RA 5DG7A 7ICJA 4PHEA 4ECWA 2O5AA 1NK7A 4EZ6A 4M5DA 1ZQZA 1S76D 3RJHA 4QZDA 1S9FA 2FLNA 9ICSA 1SL1A 3PW4A 4RZRA 2ZH3A 4O3PA 3G6VA 2DR8A 2WTFA 3ORYA 4X5VA 4FHXA 3JPNA 4F2SA 1NJWA 4QW8A 1DK2A 2ZH7A 1U49A 4PHPA 4DOAA 1MQ2A 3H8SA 4F2RA 8ICPA 4FS2A 5KFVA 4JWNA 4GLXA 2UVUA 3C23A 2ZH6A 2V4QA 4J9PA 3T5LA 3Q8KA 2A1JA 3Q8RB 5L1KA 3HJ1A 5KFQA 3MFHA 4MF8A 5J0WA 2JZBB 4DSJA 4KLMA 7ICKA 4KITB 3EPGA 1XSPA 4KLOA 4MF2A 3MDCA 1JQRA 4ECRA 2MAXA 2BCVA 2OWOA 4ELUA 4NLZA 2KZMA 4KLHA 9ICCA 4KLJA 2AQ4A 2HVIA 9ICNA 2KP7A 1BNPA 3WFPA 4I2IA 3RAQA 5L1JA 9ICWA 4IQUA 4FHVA 1HUZA 3LWLA 2DRBA 1KRPA 3MGHA 5KTQA 4PGYA 4NY8A 4QZFA 2BE3A 4RWOA 4FHYA 3H37A 3RR7A 2W9BB 8ICEA 4R64A 4HYKA 4WC2A 4YXMA 1FA0A 4X4UA 1RPLA 3MBYA 4ED3A 5KFZA 3B0YA 3KHLA 4DFMA 4FO6A 4DS5A 2PFOA 3EPIA 4KN4A 4YQWA 4F5PA 1TKDA 4YXJA 2VA2A 2LYHA 4J9RA 2PFNA 1XU4A 5CP2A 5KFOA 5HREA 4WCWA 4YR0A 5D4BA 3ZD8A 2JEGA 5KT7A 4DSFA 3ISDA 4B9SA 4IRKA 3PVXA 4IR9A 5HRLA 2J6TA 2HHXA 2GWSA 5J0RA 1RYRA 4X4RA 4F4KA 1JXLA 7ICQA 2BHNA 5DGBA 2Y1IA 3KTQA 3PV8A 3TFRA 3C1YA 2UVVA 2HHSA 3PX4A 1KFSA 3Q8PB 4DL7A 5DBCA 2VA8A 4PGXA 5DLGA 4RPXA 3GV7B 3JPSA 1NK4A 2HW3A 5HRIA 1U45A 3LK9A 3OGUA 2ZJ5A 3ZDEA 2I9GA 1D9DA 1BPZA 2UVRA 3HJ4A 4F5NA 4I2CA 9ICEA 4B9TA 2HVHA 4XUSA 4RQ4A 3PR4A 5DQGA 4F4ZA 1C7YA 2IBKA 2FMPA 2PBEA 5KFDA 1Z00B 4QWDA 3JZ0A 1B43A 4F4WA 5HP4A 3TAQA 3V6KA 4IG8A 3QZ8A 1XO1A 3OJSA 4RNNA 4DOCA 1NJXA 4DL3A 5HRKA 7ICLA 2P6UA 3BJYA 5KG0A 7ICHA 9ICTA 5KFBA 1UT5A 3SZ2A 1B22A 4J9KA 4I2BA 2HHVA 2BPFA 3PX0A 3C5GA 1L3UA 2BPGA 4FHWA 4LZDA 1DGSA 4PHDA 1S0NA 2PFPA 8ICNA 3WFQE 1ZQMA 3H8WA 3JPOA 4EBEA 1TK8A 1ZQIA 3PW2A 4WC1A 4LZGA 9ICKA 2PI4A 4AT8B 4GC7A 4RQ6A 2XGPA 4CCHA 4BXOA 4RUAA 2NRKA 4M9NA 1RYSA 3UXPA 5KFMA 5KFEA 3HWTA 4LVSA 4EBJA 4YFKA 3FDSA 4F3OA 3RAXA 3RRHA 1CUKA 5HMLA 2W9CB 2XY5A 5DB6A 4RQ8A 3OSPA 5HNKA 5KFAA 3SYZA 3RB4A 1D8YA 4I2EA 4NKTA 4J9NA 4ECTA 3OUYA 4F5RA 5J2GA 2W8KA 3AU6A 2R8JA 2KZZA 3LQCB 1R8CA 3AQKA 1SKWA 5TZVA 4DFPA 5HMMA 1NK0A 5KFTA 4MFFA 1HJPA 4O0IA 5DG8A 3H7IA 5J0XA 2J6UA 2XY6A 5J2AA 4Q8FA 2FLPA 4XQ7A 1RXVA 5BOMA 4AT7B 1ZQAA 1ZQWA 1U4BA 3GIKA 1TK5A 5DDMA 3WFOA 1UEVA 4DS4A 3PO4A 2ZTCA 4NXZA 7ICPA 3K75D 4RQ7A 4ED2A 3OVSA 4O3QA 2JEJA 1XC9A 4DFJA 2ZH2A 5F9NA 1UA0A 4M6WB 1BPBA 5KFXA 4EYIB 1MQ3A 8ICJA 8ICMA 4XRHA 3PW7A 1TVAA 1U48A 2R8GA 2XY7A 5J2HA 5IINA 4KN7A 5J29A 3RJIA 3HP6A 4KLGA 1KEJA 1VFGA 3RH5A 5L1IA 5L9XA 5BPCA 5KFCA 1X9SA 4DO9A 5DBAA 5KFYA 4TUQA 4YN4A 4RWNA 1QSYA 4KLEA 8ICLA 4YMOA 4M47A 7ICNA 5KFFA 1WCNA 1ZQGA 4IRCA 4I2AA 8ICQA 3RJJA 4YR3A 4F93B 5J2BA 5L1LA 4EYHB 3GIJA 3GQCA 1XSNA 4B9NA 1CEZA 5DB7A 1SKSA 2ALZA 2DVIA 2ZUCA 1D8LA 1SZPA 8ICZA 2VA3A 2FPKA 4ELTA 2RDJA 5CWRA 4YR2A 1ZQHA 1T3NA 2ID1A 3UXNA 5DB9A 4F4YA 3T5HA 2R8KA 2XC9A 1N48A 2P6RA 3M9NB 4ECVA 1ZQYA 4DQIA 5HRGA 1NO5A 2ZH5A 4Z6FA 1ZQUA 3G6XA 4C8OA 2NRTA 1A77A 3GV8B 4IQVA 3RJGA 4PPXA 5HRDA 4QW9A 1ZQXA 5D46A 3RJKA 4C8LA 2V9WA 4X4NA 5IIMA 4XA5A 2BPCA 7ICUA 3H4DA 2PFQA 1IM4A 5EWEA 5DGAA 4K4IA 4NM1A 3H3AA 1BGXT 5IILA 2NRWA 1JXEA 1K1SA 1BPEA 7ICEA 2IHMA 1RZTA 3TANA 1ZQBA 1NK9A 5IIJA 4QZ9A 1SL0A 3ZDBA 4C8NA 5D49A 3SV3A 3UQ2A 3T5KA 3Q8MA 7ICMA 4RQ0A 4E80A 3C1ZA 1UA1A 1BPYA 5KG6A 2AU0A 3IHQB 9ICLA 4R8UA 5JUMA 4AT9B 4F92B 2ASJA 4X4PA 8ICHA 1TFWA 3KHRA 4DQPA 4ELVA 5BOLA 2DPJA 4X4VA 3UQ0A 1WOTA 3JPPA 3ZDAA 4Q45A 1LB2B 4O3NA 4KLSA 4DEZA 1TFRA 3ETLA 1U9LA 5J0UA 4FBTA 1RXWA 3PW5A 2ZHBA 4DL4A 3PX6A 1KSPA 1Z3EB 3C2MA 5DEDA 4ATBA 2BCSA 2I1QA 2Q66A 4RWPA 4MFAA 2W9AA 2KFNA 1U47A 1NJYA 4B9MA 3TI0A 2VANA 5KFIA 1ZQLA 1KFDA 5C5JA 1TAQA 5KT3A 2BKEA 5KFJA 4RUCA 1BPXA 3NTUA 2DR7A 4O5EA 8ICTA 4F5QA 4K4HA 3MDAA 3G6YA 3UPSA 3EYZA 3PW0A 2Y1JA 4QZ8A 2DPIA 4GXIA 4PGQA 1X9WA 9ICGA 3RTVA 2O1PA 3L9DA 3LDAA 3KHGA 4O3RA 2C2EA 4RNOA 3RJFA 4BWMA 4Z6EA 2F1IA 3V7LA 4ECXA 1L3VA 4IRDA 4M0AA 5HRFA 4X4SA 4QZBA 1ZQOA 4RQ2A 3OJUA 3RB0A 4UBBA 1NOMA 1S0VA 5KFPA 4ZH4A 3H40A 3NYBA 1ZQDA 3M8RA 5CR0A 1PX5A 4KLFA 4EBCA 4LT6A 1ZQRA 2MUTB 1TAUA 1MIVA 3ZD9A 1QLNA 4NLKA 3TQ1A 2ZH8A 4EBKA 3RBEA 4QZGA 4B9VA 2AGQA 5DECA 2AQ0A 4WC5A 3BQ0A 4RU9A 1BPDA 3KHHA 4C8MA 5J0SA 4X4TA 2ZH4A 4PH5A 5J2IA 1ZJMA 4NKUA 8ICBA 1TFYA 4TQRA 3M9OB 4WC3A 5CA7A 4E7XA 1TV9A 5J2EA 1NJZA 4PHAA 4ECZA 1NKEA 2UVWA 4JV0A 4ED1A 3EWAA 5KFRA 5CB1A 5J0YA 3MR2A 3QZ7A 1MIWA 1MIYA 1PZNA 4I2DA 1KLNA 8ICWA 1S0MA 3MFIA 4DSIA 3RB3A 1ZQNA 4QZCA 4YMNA 5KFHA 2KN7A 4ECSA 4DQSA 4DF8A 2P66A 3BDPA 4UQGA 3H4BA 3N4MB 8ICOA 1R8BA 8ICGA 2KZ3A 5KFLA 4M9JA 4O5KA 1JIHA 2R8HA 2FMQA 4F5OA 4DSEA 4KMUA 2RFFA 3TAPA 5F9LA 4RPZA 9ICHA 2C2DA 3OVAA 2IMWP 9ICRA 1IXRA 4R63A 1COOA 4R66A 1ZQSA 2M9NA 3RJEA 3IM1A 1Q79A 8ICYA 8ICUA 8ICCA 1ZQFA 4MEXA 5KG4A 5IIOA 1KNYA 4FBUA 1ZYQA 3WFRE 5J2DA 2PXIA 4YD1A 3NGDA 3OHBA 4ECYA 4I28A 2AJQA 3GIIA 1ZQCA 3V72A 4JV1A 2ZUDA 5J0OA 5J2CA 4QZIA 3Q8LA 1S97A 1S0OA 4RT3A 1QSSA 5HR9A 4MEYA 5IIIA 2XGQA 1NK8A 1LV5A 4X4QA 4X4OA 4RT2A 9ICBA 3SI8A 1SL2A 1BNOA 3ZDCA 4S3NA 4QWEA 2BDPA 3RBDA 2ASDA 2V4RA 5DLFA 1T8EA 4M9LA 1NKCA 4JV2A 1BVSA 5DKWA 1MC8A 4RQ1A 2XO7A 4R65A 4ECUA 2JEIA 7ICOA 4DL6A 1V4AA 2F1HA 2JZBA 4IQWA 4NLNA 4TQSA 4TUSA 5CHGA 3V7JA 1SKRA 1AROP 4Q44A 4DWIA 7ICFA 4TURA 2ZTDA 2IA6A 4WC6A 3C5FA 1NK5A 3AUOA 3BQTA 3JYYA 7ICRA 4UAYA 8ICFA 4WC0A 2ISPA 4EZ9A 4NM2A 3OV7A 2HHQA 2KFZA 7ICVA 5KG5A 2NRZA 1L5UA 3GIMA 4EBDA 4KLIA 4B9UA 4YMMA 4KLDA 4P2HA 4QWAA 2W9BA 3T3FA 5KFSA 2BR0A 1ZQEA 5KT6A 2KTQA 9ICPA 4I2GA 4AT9A 2BCUA 4YP3A 2C28A 4KLUA 1ZQTA 8ICRA 2ZH1A 7ICGA 7ICTA 1ZQVA 8ICXA 4J9OA 4I2HA 3H39A 5KG7A 5J0TA 3AQLA 4TUPA 2F1JA 8ICKA 5KG1A 4GXJA 4FS1A 4GC6A 2M2VA 4QZAA 4UAZA 2BQUA 4J9SA 3M8SA 4ED7A 2ATLA 1NK6A 2BQ3A 4O3OA 2M2WA 2C2RA 1JAJA 1ZQKA 4Z6CA 2ISOA 3MABA 3AU2A 4BWJA 4JUZA 5J2KA 1L3SA 4DSLA 4JWMA 1X9MA 9ICVA 3GDXA 7ICSA 1TK0A 4O3SA 7ICIA 9ICQA 3H38A 4B9LA 2DRAA 2ZH9A 4KTQA 1S10A 3MGIA 3OHAA 2A1JB 3PNCA 2HHWA 2HHPA 3ZDDA 4WC4A 3RH6A 5DQIA 9ICAA 4DSKA 4X0AA 2M2TA 3HPOA 3QEBZ 9ICFA 4UB5A 4UD5A 1Z00A 5DQHA 5F2VO 2FPMA 1ZQPA 3LWMA 4RNMA 4O5CA 4RWQA 4DOBA 5KT4A 2HHUA 9ICUA 3PY8A 8ICAA 2ZTEA 1A76A 2XCAA 5KFKA 2MUTA 4G3IA 5KG3A 4WBYA 1XWLA 4J9QA 4UB1A 4DLEA 5KFNA 4R8UB 3RB6A 4Q43A 4YD2A 3WFSC 5EWFA 2FLLA 2PI5A 2W8LA 4AT8A 5KG2A 5J2JA 4M2YA 1ZJNA 3H8JA 4O9MA 5DBBA 5DB8A 3QEAZ 2FMSA 5HHHA 4ED6A 8ICSA 4DQQA 1JN3A 3GILA 4EP7A 4F91B 1UT8A 2DR5A 2BCQA 4ATBB 2C22A 2W9CA 2NRVA 4QZEA 1DK3A 3GFKB 3ISCA 3GV5B 3N97B 4IR1A 4KLQA 9ICIA 3MR5A 1QTMA 3OSNA 3PR5B 4DL5A 3M9MB 2AGOA 1ZQQA 3PO5A 3RR8A 4FH3A 1YLQA 3C18A 3ISBA 1T7PA 5KT2A 4UBCA 2JEFA 5J2FA 3C2KA 1R89A 1UETA 3MR3A 2AGPA 9ICJA 4WBZA 9ICMA 5DDYA 4I2JA 4AT7A 3Q8SB 1R8AA 2FPLA 4XQ8A 5DG9A 3V6JA 4I2FA 3V6HA 5EOZA 4F50A 5IIKA 4P4MA 1D9FA 4ECQA 4YVZA 4C8KA 4FHPA 4UD4A 8ICVA 4WC7A 5J0PA 3HW8A 3HIYA 4DFKA 4DQRA 1MSWD 1JX4A 4I27A 2DR9A 1K1QA 4NLGA 1Q78A 3QE9Y 4K4GA 3HT3A 5HC9A 2ZJ8A 2ASLA 2HHTA 4QWCA 4ED8A 4YCXA 1X2IA 9ICOA 3C2LA 5HRHA 4JK1A 4M6WA 5CJ7A 3SV4A 8ICIA 3BQ1A 5J0QA 1ZQJA 1KTQA 1KFTA 3E2EA 1NZPA 2ZUBA 2M2UA 1VJ7A 1HUOA 4FH5A 1QSLA 2XCPA 3K4GA 4I29A 4M04A 2H5XA
chains in the Genus database with same CATH superfamily
1UEUA 4QZHA 4FFDA 3V7KA 1V9PA 3HX0A 3AQNA 2JHDA 4IQTA 4DL2A 1S8OA 3EW9A 4EX6A 2FCLA 4O69A 2ODGA 1L3TA 1H38A 5CRXA 1F5AA 2BCRA 3N28A 3OUYB 3RH4A 4UB4A 3UPQA 4PL1A 4LJXA 1ZRNA 2BQRA 1PVPA 2Q0ZX 5KT5A 3PMNA 5EWGA 4RPYA 4I2EA 5KFWA 2RDIA 2J6SA 3EZ5A 5HHIA 2BGWA 4BUGA 4J9MA 3B9JA 1XSLA 7ICJA 4ECWA 2IOFK 2RLTA 3AQEA 5ALTA 4M5DA 1ZQZA 3RJHA 4RZRA 3MGVA 3IRUA 3ORYA 4X5VA 4Y2RA 1U49A 4PHPA 4DOAA 4F2RA 3H8SA 3F53A 3KKAC 4LEVA 2UVUA 3C23A 2ZH6A 2V4QA 4J9PA 3Q8RB 3HJ1A 3MFHA 5J0WA 4MF2A 2MAXA 5AK5A 4NLZA 3IDWA 9ICNA 3WFPA 9ICWA 1SV0C 1NNLA 4NY8A 3H37A 3M7DA 3RR7A 1L6NA 2KSOA 3N7RC 4CF3A 1RPLA 2PFOA 3B0YA 4KN4A 4YXJA 2PFNA 5KFOA 2JEGA 4F4KA 4P0PB 5DGBA 2UVVA 2N1RA 1V38A 1KFSA 3Q8PB 1PK1A 1NK4A 2ZH1A 3GV7B 4RPXA 3ZDEA 3HJ4A 2I9GA 4B9TA 4XUSA 5KL1B 1C7YA 3TADC 2FMPA 5ALLA 4HX0A 2MRLA 4NXXA 5HP4A 3OJSA 3KD3A 1NJXA 2KHVA 5KG0A 3BJYA 9ICTA 2DF4B 3SZ2A 2HHVA 2BPFA 4FHWA 2D3DA 2BPGA 1DGSA 1S0NA 2K4IA 1ZQMA 3H8WA 4WC1A 3PW2A 9ICKA 2PI4A 2ES6A 4RQ6A 4GC7A 4CCHA 3EUB2 1MN8A 3UXPA 4EBJA 4MHVA 3RFAA 3HWTA 4LVSA 3FDSA 3RAXA 5AM3A 3AQFA 2XY5A 3MCRA 4RQ8A 1DRGA 5JTGA 3L5KA 2KZZA 1SKWA 1NK0A 4MFFA 5HMMA 2LMRA 4ZOHC 2F3NA 5DG8A 4XQ7A 2FLPA 2EAOA 1RXVA 3VCBA 3LVVA 1TK5A 3WFOA 3QU5A 4DS4A 3PO4A 4NXZA 3K75D 3NVWA 4RQ7A 4O3QA 2IUBA 3BZCA 1RQLA 4DFJA 5F9NA 4Y2JA 1MQ3A 1ZQ1C 2CPRA 3PW7A 5J2HA 2I5HA 4OJ5A 5ALMA 5L1IA 1X9SA 4YN4A 1QSYA 2HBMA 4UAUA 1SB3C 2PMZF 5TISU 4F72A 4I2AA 2O6KA 4EYHB 4B9NA 1LKYA 1CEZA 1SKSA 1J2NA 2RDJA 1C20A 4YR2A 3UXNA 3T5HA 2G5HB 4DQIA 5HRGA 2GLEA 2WF7A 7ICHA 4C8OA 4QW9A 2W03A 3RJKA 4C8LA 2FDRA 7ICUA 2PFQA 1BGXT 4OAGA 1X6IA 1ECWA 1BPEA 7ICEA 3WK6A 5AM5A 5FP0A 5C0YA 4PL2A 3QUBA 4XJEA 3JCFA 2ZIWB 5D49A 2DR8A 4RQ0A 3C1ZA 3WKAA 1BPYA 1CRXA 4R8UA 5BOLA 3JPPA 1YT3A 4Q45A 2ZIVA 1TFRA 1U9LA 4FBTA 3PW5A 2Y9TA 3PX6A 5ALEA 3C2MA 5DEDA 2VJ5A 4RWPA 2W9AA 4P0QB 2RQ5A 2G09A 1ZD2P 1ZQLA 5C5JA 2BKEA 2GOLA 2DR7A 2E1EA 2OH2A 4NV0A 3NRWA 4O3RA 2C2EA 4RNOA 2F1IA 1AQ6A 1QH9A 5HRFA 4X4SA 1ZQOA 4RQ2A 3OJUA 3WKEA 5KFPA 1S0VA 3SR6A 3DEEA 1PX5A 2MUTB 1MIVA 2H3QA 5AI4A 2H3ZA 3RBEA 4B9VA 2AGQA 5DECA 4WC5A 4RU9A 3KHHA 5AI8A 3K1ZA 1A6SA 4UB6U 4CNQA 4ED1A 4EEKA 1MIYA 2YB1A 1KLNA 5AKHA 2LYBA 4DQSA 4ECSA 4DF8A 3BDPA 8ICOA 3H4BA 4GFJA 4M9JA 1S5LU 4DSEA 4KMUA 3TAPA 9ICHA 9ICRA 4R66A 3ERCC 1ZQSA 3QU2A 1Q79A 8ICUA 1ZQFA 1SWVA 3ALRA 4FBUA 2K8CB 3NGDA 3OHBA 3GIIA 1ZQCA 3SAGA 4K97A 3QU7A 5J0OA 4QZIA 1N5WA 2E1FA 3AN1A 2YMMA 9ICBA 5D63A 1B4FA 4JB3A 4UB8U 1BVSA 3NVOA 4R65A 7ICOA 5AM1A 4QNLA 2BBJA 4TQSA 1SKRA 4Q44A 1ZD3A 1M6YA 2YTUA 3IG8A 1X9XA 2HHQA 7ICVA 5KG5A 2WF9A 4QWAA 4PJ0U 5KFSA 5KT6A 4AT9A 4CF5A 1ZQTA 1MA7A 3HILA 2F8LA 4I2HA 4TUPA 3SAFA 2BQUA 4ED7A 2M2WA 2BQ3A 2C2RA 1JAJA 1VJ5A 7ICSA 4DSLA 4P0PA 1WWVA 2DRAA 2GO7A 2Z7JA 1S10A 4WC4A 1V97A 1OUQA 1FFVA 9ICFA 5KT4A 4WJ3B 8ICAA 2Y0SF 5KFKA 4G3IA 1XWLA 2KSOB 2FLLA 2D6FC 1FFUA 2W8LA 4BJQA 4O9MA 3H8JA 2LHTA 4AP9A 2DUYA 3GILA 2BCQA 3F5EA 4NL9C 2NRVA 4LEWA 3CW2C 3GFKB 3GV5B 2W3RA 3MR5A 3OSNA 1YLQA 3C18A 1T7PA 9ICJA 4WBZA 2MU2A 3Q8SB 1R8AA 4XQ8A 3WK8A 5IIKA 4YVZA 4WC7A 3HW8A 2K4EA 1PVRA 4I27A 4K9AA 1Q3VA 1Q78A 3QE9Y 4K4GA 3HT3A 2ZJ8A 2ASLA 9ICOA 4JK1A 2WFAA 5JRTA 1NZPA 4FH5A 1N63A 2H5XA 2DWQA 2K4HA 1UHUA 5HRBA 1WCLA 5AK3A 4KLLA 3Q8QB 3TARA 4UAWA 2NYVA 1QCKA 2W9MA 3B0XA 4P4OA 1DOQA 2R8IA 3C66A 2KJ8A 5A0LA 1QQ5A 4FZMA 4BDPA 1WYGA 1QQ6A 3TFSA 3AL0B 4F4XA 4EEYA 2NRXA 3CRXA 4M9HA 1NKBA 3JPRA 1N56A 4RQNA 4E8FA 1YZ7A 4DFDA 1WUDA 4QWBA 1Y88A 2DKZA 4X0BA 3CYMA 4ED0A 5DG7A 1P7DA 4NXUA 4PHEA 3D2SA 2CRXA 3KOOA 5ALNA 1N62A 1S76D 3WK9A 3QNMA 1S9FA 2ZIWA 1SL1A 1WG8A 5AK6A 2ZH3A 4O3PA 3JPNA 4F2SA 1NJWA 2YB4A 1IV8A 4Y2QA 3ETRA 1KQQA 4FS2A 4GLXA 2KJ9A 3F5AA 4I0UA 3T5LA 2A1JA 1JUDA 1DGJA 2KEYA 4DSJA 4KITB 4ECRA 2OWOA 2KVSA 2KIWA 4KLHA 2HVIA 2KP7A 4I2IA 5L1JA 3MGHA 2BE3A 4QZFA 1N60A 4HYKA 3AMZA 1FA0A 3MBYA 4ED3A 5KFZA 4DS5A 5G5HA 3BQ7A 2VA2A 4J9RA 4WCWA 5KT7A 4DSFA 4IRKA 2HSZA 2HHXA 4X4RA 2QB0B 4K98A 2HHSA 3JPSA 1U45A 3OGUA 1BPZA 5ALVA 9ICEA 4UAVA 4AYBC 2RRDA 1Z00B 4F4WA 2YMLA 4DL3A 2KKPA 2P6UA 5KFBA 2XICA 1VLBA 3PX0A 1Q8KA 4CDGA 4O6AA 4OCZA 4OJOA 2PFPA 4IC9A 3WFQE 2HBJA 4BXOA 4PZOA 4USAA 2G07A 2EAMA 2W9CB 5DB6A 3OSPA 5HNKA 1D8YA 1R8CA 2KD1A 5J2GA 3AQKA 3H8MA 5TZVA 3DV9A 1HJPA 1HEKA 3BS7A 3H7IA 2J6UA 5J2AA 2R18A 5BOMA 1ZQAA 1U4BA 1RYUA 4KX5A 5KNIA 4ED2A 4M6WB 1BPBA 2NO5A 8ICMA 3VC8A 1U48A 1OW5A 5J29A 4KLGA 4AYBF 5KFYA 4TUQA 3M1YA 2DQNB 4KLEA 3L4PA 8ICLA 4M47A 1Z19A 8ICQA 1CI4A 3I28A 5AKYA 4MKPA 2HBLA 3GQCA 4LEYA 1D8LA 3TKAA 1T3NA 5B5EU 4F4YA 1NO5A 4OJLA 1ZQYA 2ZH5A 4Z6FA 3G6XA 3GV8B 3RJGA 2V9WA 5IIMA 5EWEA 4NM1A 5DGAA 2NRWA 1K1SA 1ZXIA 1RZTA 3TANA 1ZQBA 3ZDBA 4Y2PA 3PSPA 4C8NA 4CE6A 2AXTU 3SV3A 3T5KA 4E80A 9ICLA 1KW4A 3D6JA 4F92B 2HOIA 4AT9B 1TFWA 3KHRA 4DQPA 4K96A 5F3XB 1L7OA 5JU5A 3UQ0A 4DEZA 3ETLA 2HN1A 2ZHBA 4DL4A 1Z3EB 2BCSA 2K8AA 4B9MA 1SWWA 5KFIA 1N5XA 1TAQA 5KT3A 4Y2XA 4RUCA 1F5SA 4O5EA 4OO1J 2CXYA 3F2CA 5ALDA 3G6YA 3EYZA 4QZ8A 1X9WA 2O1PA 2IOFA 3KHGA 2FE9A 4BWMA 3V7LA 1L3VA 4IRDA 3IG5A 2BDUA 3SENA 3FC4A 4DCCA 4EBCA 1XNSA 2YY6A 3ZD9A 4NLKA 4QZGA 1HIWA 2DGZA 4J03A 1KKXA 1JRPA 5J0SA 2KG5A 1ZJMA 1TFYA 3ER8C 5KAIU 4C4TA 5J2EA 4PHAA 2HI0A 4ECZA 1NKEA 3S6JA 3EWAA 3QZ7A 4I2DA 3LYSA 2WF8A 1S0MA 1ZQNA 3WKDA 1FO4A 2HBKA 2P66A 5CFSA 2A19A 1R8BA 5EE1A 1RG6A 2KZ3A 1SGGA 2RFFA 4QIWC 3M6KA 1L8LA 4UASA 4US8A 2G0AA 5KL8B 1IXRA 2NO4A 4R63A 2W04A 2M9NA 3IM1A 4ACOA 8ICYA 8ICCA 3L3FX 1NI3A 2A3VA 4YD1A 2BZFA 2AJQA 4ECYA 2Q4TA 1L7PA 5J2CA 1S0OA 1S97A 3CNHA 1QSSA 3O0FA 1NK8A 2CN1A 4RT2A 3SI8A 3QYPA 2VIXA 2V4RA 1T8EA 4OD0A 4JV2A 2XO7A 2JEIA 3ER9B 4DL6A 1V4AA 2MA1A 4NLNA 2QKQA 3D2QA 3T79A 4DWIA 4TURA 2IA6A 2EZXA 3C5FA 1NK5A 3JYYA 7ICRA 3PSIA 2ISPA 2KNJA 4NM2A 2KFZA 2M0NA 4KLIA 4YMMA 4KLDA 2HCFA 9ICPA 4Y2UA 1ZQEA 3NVYA 2C28A 4KLUA 7ICGA 1ZQVA 3H39A 4GC6A 4QIWF 2ATLA 1NK6A 4O3OA 3UMBA 2ISOA 3MABA 4JUZA 4JWMA 2QB0A 3H38A 4B9LA 2ZH9A 2HHWA 2A1JB 3ZDDA 3RH6A 4Y2SA 4X0AA 2YX8A 4KX3A 3HPOA 2KHQA 2PKEA 1Z00A 3BS5A 4HAIA 4RNMA 2HHUA 4O68A 5AKZA 9ICUA 3PY8A 2XCAA 1A76A 4WBYA 1J2MA 2OM6A 4YD2A 5J2JA 2FMSA 4ED6A 2DR5A 4ATBB 2C22A 2W9CA 1F44A 4QZEA 3N97B 2W55A 2YN4A 1QTMA 3PR5B 4DL5A 3M9MB 3K1RB 4GIBA 4EEDA 2JEFA 3MR3A 9ICMA 5DDYA 2EAPA 2FPLA 5DG9A 5EOZA 1D9FA 4P4MA 2FI1A 8ICVA 5JTIA 3AEVA 1JX4A 2JXJA 2XIDA 2E8MA 4ED8A 4N7RA 4O67A 4M6WA 3SV4A 3H0RB 5J0QA 1KTQA 3E2EA 2ZUBA 2XCPA 4M04A 3KFUF 3BQ2A 3JPQA 4BXOB 1OXJA 1T4GA 2E8NA 4E0DA 2B21A 4Q8EA 1WWUA 3THVA 5KFUA 1EXNA 2OEHA 4UARA 3C21A 4DLGA 2E3TA 1PUZA 4J9LA 4Z6DA 3AQMA 4C80A 3MR6A 4GXKA 4UB3A 1JMSA 4BGDA 1S77D 9ICXA 4YG2A 4P4PA 5J8YA 4EZ6A 1LVHA 4QZDA 2FLNA 9ICSA 4JLXA 4FHXA 4QW8A 1DK2A 1MQ2A 5ALFA 2E8PA 8ICPA 5KFVA 4JWNA 2W11A 3Q8KA 5L1KA 3SQIA 4MF8A 2DKXA 2KE7A 2ESEA 4KLMA 3EPGA 1XSPA 4KLOA 3MDCA 4ELUA 2AQ4A 2W43A 3QUTA 1HUZA 3LWLA 2XVTA 2DRBA 1KRPA 5KTQA 5ALSA 4PGYA 4RWOA 1GO3F 2W9BB 1O03A 5AKEA 4WC2A 4YXMA 4X4UA 4DFMA 4FO6A 3EPIA 3PSFA 1TKDA 2LYHA 1XU4A 4YR0A 5D4BA 3ZD8A 5HRLA 3PVXA 4IR9A 2GWSA 3QUCA 1JXLA 7ICQA 2ZIXB 2BHNA 4EX7A 3TFRA 3C1YA 3IP4B 3PX4A 2GA9D 5DBCA 4ICAA 3LK9A 1D9DA 4I2CA 4RQ4A 5ALUA 4F4ZA 2PBEA 4K9BA 3GU3A 3JZ0A 1B43A 4K8VA 3TAQA 5CFUA 4IG8A 3QZ8A 4C4RA 2W3SA 1UT5A 1B22A 4J9KA 2WF5A 3C5GA 1L3UA 1JALA 5AM2A 4PHDA 8ICNA 2KV2A 3JPOA 1ZQIA 3C28A 2XGPA 5ALWA 2NRKA 5KFMA 5KFEA 4YFKA 4F3OA 3RRHA 5HMLA 5B3QA 5KFAA 3LVWA 4J9NA 2W8KA 2E5SA 1ZD5A 5GTIU 4Q8FA 5J0XA 4AT7B 2XY6A 1FEZA 1ZQWA 4EGWA 3NWIA 7ICPA 3ICXA 3OVSA 2JEJA 1XC9A 1UA0A 2EDUA 2JR5A 4BX9C 8ICJA 5D61A 3SD7A 1TVAA 5IINA 1FIQA 4KN7A 2WB1C 1KEJA 3K7DA 1VFGA 3RH5A 5BPCA 3QUQA 2AHOB 5KFCA 5DBAA 2G06A 3KBBA 4KMOB 5ALIA 2F8KA 4RWNA 1K5OA 3NASA 4UATA 1ZQGA 2F2AB 4US9A 3RJJA 3FM9A 5L1LA 1XSNA 5DB7A 2ALZA 2ZUCA 8ICZA 5E79U 4NXTA 1ZQHA 1J97A 2F77X 2R8KA 2XC9A 1N48A 3M9NB 2EZYA 2KVCA 4PPXA 4IQVA 1ZQXA 4XA5A 2BPCA 3H4DA 1IM4A 5ALGA 3NVZA 5AKIA 2XI9A 2LKYA 3OTQA 2IHMA 5ALRA 3ONNA 1PVQA 4QZ9A 1SL0A 3UQ2A 7ICMA 5G5GA 1UA1A 5KG6A 2AU0A 3IHQB 1IIPA 5JUMA 8ICHA 5AKKA 1LB2B 4KM5A 5J0UA 1RXWA 5AI6A 2LI6A 4ATBA 2HN2A 4MFAA 5T14A 2KFNA 3ED5A 1NJYA 2VANA 1KFDA 4EENA 5KFJA 3NTUA 8ICTA 5ALZA 4K4HA 2VKQA 2Y1JA 4GXIA 3L9DA 3RTVA 3AM9A 3BS5B 2W7PA 4M0AA 4Z6EA 4QZBA 3EF2A 4UBBA 1NOMA 4ZH4A 3H40A 5CR0A 1TAUA 1QLNA 5EE3A 3WK5A 4Y2VA 3BQ0A 1BPDA 4PZNA 2BBHA 4X4TA 1JI7A 4PH5A 4NXVA 8ICBA 3M9OB 5CA7A 4E7XA 2HMXA 1NJZA 1X40A 4JV0A 5KFRA 3MR2A 1PZNA 4C7ZA 8ICWA 3MFIA 2OYYA 4DSIA 1KN5A 4QZCA 4YMNA 5KFHA 8ICGA 2JH7A 2R8HA 2FMQA 4RPZA 2KICA 3H0MB 3I76A 4FZNA 5KG4A 3KKAA 1Z1VA 5J2DA 2PXIA 3WFRE 1SIJA 1XO0A 4I28A 3V72A 3Q8LA 4RT3A 4LEZA 4MEYA 1LV5A 4X4QA 1PK3A 1X6JA 1L8OA 1SL2A 3GZFA 3ZDCA 4S3NA 3QX7A 2BDPA 1O08A 1TE2A 1ZRMA 4RQ1A 5DKWA 1YZ6A 1SV0A 3PZPA 2F1HA 2OXOA 1URJA 4A8EA 3OPXA 2B51A 3V7JA 2YMPA 1RQNA 4WC6A 4UAYA 8ICFA 3OV7A 2EQYA 1L5UA 3GIMA 4EBDA 1UQVA 4B9UA 3WKBA 2W9BA 5ALHA 3T3FA 2BR0A 3QU9A 4I2GA 4YP3A 3N7SC 8ICRA 7ICTA 8ICXA 2B4VA 2G08A 4J9OA 5KG7A 2A1AA 2W54A 1QQ7A 4QZAA 4KB6A 3N7PD 3PSTA 1ZQKA 3AU2A 5J2KA 3TADA 9ICVA 2ZIXA 1X9MA 1SXDA 3MGIA 2EZZA 3OHAA 2HHPA 2QARB 5B3PA 5DQIA 9ICAA 4DSKA 3SMVA 2M2TA 3QEBZ 5DQHA 2FPMA 4NLBA 4O5CA 4CGZA 2VJ4A 3UM9A 3PHZA 4Y2TA 2OCEA 5B66U 3NKUA 4J9QA 4UB1A 4DLEA 3KZXA 4JMUA 3RB6A 3WFSC 5EWFA 5CHEA 2ZXHA 5DBBA 5DB8A 8ICSA 5CFTA 5H2FU 1UT8A 1DK3A 2E8OA 4WQLA 4KLQA 2JV3A 3PO5A 2AGOA 4FH3A 3ISBA 2ZIUB 5KT2A 4Y2YA 4UBCA 3C2KA 2PMZC 2H3FA 4AT7A 4M9LA 4I2FA 3V6JA 4C8KA 4FHPA 4C4SA 2OHFA 3SEIA 3F2BA 2DR9A 3UMCA 1D8BA 5HC9A 2HHTA 4NWIA 1X2IA 3C2LA 5CJ7A 5ALJA 2LPEA 2LBOA 3K4GA 4B9SA 2WF6A 5D62A 3OVBA 4UB2A 2ZJAA 1ZETA 3JPTA 1KDHA 4IS7A 5AKGA 2DFLA 5ALPA 3UXOA 2JGAA 4OAFA 4RQ3A 2GAFD 3C29A 2LYAA 5KFGA 4DF4A 3FYHA 1L7MA 2YQEA 2WHEA 3U26A 4M9GA 3T5JA 4KLTA 1XS9D 2L5YA 5AKXA 1KBUA 2I6XA 2IHNA 3RRGA 2ZHAA 3NRZA 3PMLA 3J81j 4OAIZ 4MFCA 1OU5A 4RQ5A 4F8RA 3TACB 2O5AA 1NK7A 3E0FA 2H3IA 3PW4A 4O3MA 3G6VA 2IHOA 2WTFA 4CRXA 4WH5A 2ZH7A 2HOQA 5AI5A 4U6PA 5KFQA 2JZBB 3A0HU 2JH1A 7ICKA 2KOBA 1V85A 1JQRA 3I1YA 2RHFA 2BCVA 2KZMA 4NKUA 1BNPA 2DL0A 4KLJA 9ICCA 1IG6A 3RAQA 4FHVA 4IQUA 1SV4A 4K99A 5AICA 4OJ6A 4FHYA 2QB1A 8ICEA 4R64A 3KHLA 2EWRA 2GH1A 1UPHA 4YQWA 4F5PA 5AIAA 5CP2A 5HREA 1N61A 3ISDA 2J6TA 5J0RA 1RYRA 2Y1IA 3KTQA 3PV8A 4DL7A 3WKCA 4PGXA 2VA8A 5HRIA 5DLGA 2HW3A 2ZJ5A 2UVRA 4F5NA 4CF4A 2HVHA 3PR4A 3IV6A 5DQGA 3OWGA 2ZXIA 2IBKA 5KFDA 4QWDA 2KJ5A 2HDOA 3V6KA 1XO1A 4DOCA 4RNNA 5HRKA 7ICLA 4I2BA 3IN5A 4LZDA 4UW9A 5AM0A 4EBEA 1TK8A 4AT8B 4LZGA 2G5IB 4EELA 1NZBA 4RUAA 4M9NA 1RYSA 3R9KA 1SXEA 1CUKA 4FO1A 5GTHU 2KMDA 5AK4A 4UD4A 3SYZA 3RB4A 5HR6A 4NKTA 4ECTA 3OUYA 4F5RA 2LM1A 3AU6A 4FE3A 5AKJA 3QU4A 2R8JA 3LQCB 1DXSA 4DFPA 2DBYA 5KFTA 5AI0A 4O0IA 2EH9A 1GPJA 1JROA 1ZOLA 2D8CA 4C7YA 1L7NA 3GIKA 1A0PA 5DDMA 2B6GA 1UEVA 2JMGA 2ZTCA 3QXGA 4IL6U 2ZH2A 5KFXA 4EYIB 4XRHA 2R8GA 2XY7A 4RQMA 4FZLA 3E58A 3RJIA 3HP6A 3CP8A 3H0LB 5L9XA 3HRDD 3DDHA 4DO9A 4YMOA 7ICNA 5KFFA 1WCNA 4IRCA 4EV6A 4YR3A 4F93B 5J2BA 2Y0SC 3GIJA 1X42A 1F0MA 2DVIA 1SZPA 4U7CA 2VA3A 5ALYA 2YMQA 2FPKA 4ELTA 5CWRA 2ID1A 3WK7A 5DB9A 2NV3A 2P6RA 4ECVA 1ZQUA 5HRDA 2NRTA 1A77A 3UMGA 2QARA 5D46A 1VDVA 4X4NA 4K4IA 3H3AA 5ALKA 5K4LA 5IILA 2MSNA 1JXEA 1RDFA 2K4PA 3KZIU 1NK9A 3NS1A 5IIJA 3Q8MA 4NL9A 2FJ6A 4X4PA 2ASJA 4ELVA 1Z4OA 5J8YC 2DPJA 4X4VA 1WOTA 3ZDAA 4O3NA 5AIBA 4KLSA 1T3QA 3FAHA 5HR7A 1KSPA 4OAHA 2RP5A 2I1QA 4QJFB 4F71A 2Q66A 1U47A 5AI9A 3TI0A 2ZIUA 3ZI4A 1BPXA 1SZHA 4F5QA 3MDAA 3UPSA 3PW0A 2DPIA 4PGQA 9ICGA 2WAQC 3LDAA 2QLTA 1UCVA 3RJFA 4ECXA 3WK4A 3RB0A 3NYBA 1ZQDA 3M8RA 4KLFA 4LT6A 1ZQRA 2W7OA 3TQ1A 2ZH8A 4EBKA 2AQ0A 1Q46A 4NLCA 5CEHA 4C8MA 2ZH4A 5J2IA 4TQRA 1PK1B 2HOFA 4WC3A 1TV9A 1Z1BA 1T94A 2EANA 2UVWA 2P35A 3A0BU 5CB1A 5J0YA 3NUQA 1MIWA 2JRZA 4EEBA 3RB3A 2KN7A 4UQGA 3N4MB 1ED1A 5KFLA 4O5KA 1JIHA 4F5OA 4WOYA 3HKZC 2H3VA 5F9LA 2C2DA 4JLZA 3OVAA 2IMWP 1COOA 4WQKA 5AHXA 3D2NA 3RJEA 1RM6C 4MEXA 5KAFU 5IIOA 1KNYA 1ZYQA 3MC1A 4JV1A 2ZUDA 2WAQF 5HR9A 2XGQA 5IIIA 5L1MA 4X4OA 1BNOA 4QWEA 3RBDA 2ASDA 5DLFA 1NKCA 1MC8A 4ECUA 5ALOA 2LM4A 2KK0A 1KL9A 2JZBA 4IQWA 3CK6A 4TUSA 5CHGA 1AROP 7ICFA 2ZTDA 2K60A 1Z4NA 2B0CA 4WC0A 3AUOA 3BQTA 2AH5A 4EZ9A 1TAMA 2NRZA 4P2HA 2KTQA 3RF9A 2BCUA 2ZG6A 2F76X 5J0TA 3AQLA 2F1JA 8ICKA 5KG1A 4GXJA 4FS1A 2M2VA 5ALXA 1LKYB 4UAZA 4J9SA 3M8SA 3HKZF 3SAHA 4Z6CA 4BWJA 1L3SA 4P0QA 3GDXA 1TK0A 4O3SA 5EE9A 7ICIA 9ICQA 2KKVA 2IOHA 4KTQA 2K8BB 3PNCA 1COKA 2WB1F 4UD5A 4UB5A 1ZD4A 5F2VO 5EE0A 1ZQPA 3LWMA 3F2DA 4RWQA 4DOBA 2ZTEA 1Q3UA 5AKLA 2MUTA 5KG3A 2Y9UA 1B0XA 5KFNA 4R8UB 4C0ZA 4Q43A 2F44A 2PI5A 4AT8A 5KG2A 4M2YA 1ZJNA 3HJEA 3QEAZ 5HHHA 4DQQA 2ZIVB 1JN3A 4EP7A 4F91B 3WU2U 3ISCA 4IR1A 9ICIA 1ZQQA 3RR8A 4B6JA 5ALQA 1UETA 5J2FA 1R89A 2AGPA 2K89A 3M6ZA 4I2JA 3V6HA 4F50A 4ECQA 5J0PA 4NXWA 3NVVA 3BZKA 4DFKA 4DQRA 1MSWD 3HIYA 1K1QA 4NLGA 4QWCA 4YCXA 5HRHA 4NJ8A 2KIVA 8ICIA 1N2XA 1X66A 3BQ1A 1ZQJA 1KFTA 4OJPA 2M2UA 1VJ7A 2B56A 1HUOA 1QSLA 5AM4A 4G9BA 4I29A
chains in the Genus database with same CATH topology
3OVBA 1UEUA 4QZHA 4UB2A 5HRBA 3BQ2A 2ZJAA 3V7KA 1V9PA 3JPTA 3JPQA 1ZETA 1WCLA 1KDHA 4BXOB 3HX0A 3AQNA 2DFLA 4KLLA 4IQTA 3UXOA 3Q8QB 3TARA 1T4GA 4UAWA 4DL2A 3EW9A 4E0DA 2B21A 4RQ3A 2W9MA 1L3TA 1H38A 4Q8EA 1F5AA 3B0XA 4P4OA 5KFGA 4DF4A 1DOQA 3THVA 2BCRA 5KFUA 2R8IA 3OUYB 3FYHA 3C66A 1EXNA 3RH4A 4UB4A 4BDPA 4M9GA 3UPQA 3T5JA 3C21A 4KLTA 3TFSA 4DLGA 4J9LA 4F4XA 2BQRA 1XS9D 2Q0ZX 4Z6DA 5KT5A 4EEYA 2NRXA 3PMNA 5EWGA 3AQMA 3MR6A 4M9HA 4RPYA 4GXKA 2IHNA 3RRGA 1NKBA 5KFWA 2RDIA 4UB3A 3JPRA 1N56A 2J6SA 4E8FA 3EZ5A 2ZHAA 5HHIA 1JMSA 4QWBA 3PMLA 4BGDA 1S77D 9ICXA 4YG2A 1Y88A 4P4PA 2BGWA 4X0BA 4J9MA 4MFCA 1XSLA 4ED0A 1OU5A 4RQ5A 4F8RA 5DG7A 7ICJA 4PHEA 4ECWA 2O5AA 1NK7A 4EZ6A 4M5DA 1ZQZA 1S76D 3RJHA 4QZDA 1S9FA 2FLNA 9ICSA 1SL1A 3PW4A 4RZRA 2ZH3A 4O3PA 3G6VA 2DR8A 2WTFA 3ORYA 4X5VA 4FHXA 3JPNA 4F2SA 1NJWA 4QW8A 1DK2A 2ZH7A 1U49A 4PHPA 4DOAA 1MQ2A 3H8SA 4F2RA 8ICPA 4FS2A 5KFVA 4JWNA 4GLXA 2UVUA 3C23A 2ZH6A 2V4QA 4J9PA 3T5LA 3Q8KA 2A1JA 3Q8RB 5L1KA 3HJ1A 5KFQA 3MFHA 4MF8A 5J0WA 2JZBB 4DSJA 4KLMA 7ICKA 4KITB 3EPGA 1XSPA 4KLOA 4MF2A 3MDCA 1JQRA 4ECRA 2MAXA 2BCVA 2OWOA 4ELUA 4NLZA 2KZMA 4KLHA 9ICCA 4KLJA 2AQ4A 2HVIA 9ICNA 2KP7A 1BNPA 3WFPA 4I2IA 3RAQA 5L1JA 9ICWA 4IQUA 4FHVA 1HUZA 3LWLA 2DRBA 1KRPA 3MGHA 5KTQA 4PGYA 4NY8A 4QZFA 2BE3A 4RWOA 4FHYA 3H37A 3RR7A 2W9BB 8ICEA 4R64A 4HYKA 4WC2A 4YXMA 1FA0A 4X4UA 1RPLA 3MBYA 4ED3A 5KFZA 3B0YA 3KHLA 4DFMA 4FO6A 4DS5A 2PFOA 3EPIA 4KN4A 4YQWA 4F5PA 1TKDA 4YXJA 2VA2A 2LYHA 4J9RA 2PFNA 1XU4A 5CP2A 5KFOA 5HREA 4WCWA 4YR0A 5D4BA 3ZD8A 2JEGA 5KT7A 4DSFA 3ISDA 4B9SA 4IRKA 3PVXA 4IR9A 5HRLA 2J6TA 2HHXA 2GWSA 5J0RA 1RYRA 4X4RA 4F4KA 1JXLA 7ICQA 2BHNA 5DGBA 2Y1IA 3KTQA 3PV8A 3TFRA 3C1YA 2UVVA 2HHSA 3PX4A 1KFSA 3Q8PB 4DL7A 5DBCA 2VA8A 4PGXA 5DLGA 4RPXA 3GV7B 3JPSA 1NK4A 2HW3A 5HRIA 1U45A 3LK9A 3OGUA 2ZJ5A 3ZDEA 2I9GA 1D9DA 1BPZA 2UVRA 3HJ4A 4F5NA 4I2CA 9ICEA 4B9TA 2HVHA 4XUSA 4RQ4A 3PR4A 5DQGA 4F4ZA 1C7YA 2IBKA 2FMPA 2PBEA 5KFDA 1Z00B 4QWDA 3JZ0A 1B43A 4F4WA 5HP4A 3TAQA 3V6KA 4IG8A 3QZ8A 1XO1A 3OJSA 4RNNA 4DOCA 1NJXA 4DL3A 5HRKA 7ICLA 2P6UA 3BJYA 5KG0A 7ICHA 9ICTA 5KFBA 1UT5A 3SZ2A 1B22A 4J9KA 4I2BA 2HHVA 2BPFA 3PX0A 3C5GA 1L3UA 2BPGA 4FHWA 4LZDA 1DGSA 4PHDA 1S0NA 2PFPA 8ICNA 3WFQE 1ZQMA 3H8WA 3JPOA 4EBEA 1TK8A 1ZQIA 3PW2A 4WC1A 4LZGA 9ICKA 2PI4A 4AT8B 4GC7A 4RQ6A 2XGPA 4CCHA 4BXOA 4RUAA 2NRKA 4M9NA 1RYSA 3UXPA 5KFMA 5KFEA 3HWTA 4LVSA 4EBJA 4YFKA 3FDSA 4F3OA 3RAXA 3RRHA 1CUKA 5HMLA 2W9CB 2XY5A 5DB6A 4RQ8A 3OSPA 5HNKA 5KFAA 3SYZA 3RB4A 1D8YA 4I2EA 4NKTA 4J9NA 4ECTA 3OUYA 4F5RA 5J2GA 2W8KA 3AU6A 2R8JA 2KZZA 3LQCB 1R8CA 3AQKA 1SKWA 5TZVA 4DFPA 5HMMA 1NK0A 5KFTA 4MFFA 1HJPA 4O0IA 5DG8A 3H7IA 5J0XA 2J6UA 2XY6A 5J2AA 4Q8FA 2FLPA 4XQ7A 1RXVA 5BOMA 4AT7B 1ZQAA 1ZQWA 1U4BA 3GIKA 1TK5A 5DDMA 3WFOA 1UEVA 4DS4A 3PO4A 2ZTCA 4NXZA 7ICPA 3K75D 4RQ7A 4ED2A 3OVSA 4O3QA 2JEJA 1XC9A 4DFJA 2ZH2A 5F9NA 1UA0A 4M6WB 1BPBA 5KFXA 4EYIB 1MQ3A 8ICJA 8ICMA 4XRHA 3PW7A 1TVAA 1U48A 2R8GA 2XY7A 5J2HA 5IINA 4KN7A 5J29A 3RJIA 3HP6A 4KLGA 1KEJA 1VFGA 3RH5A 5L1IA 5L9XA 5BPCA 5KFCA 1X9SA 4DO9A 5DBAA 5KFYA 4TUQA 4YN4A 4RWNA 1QSYA 4KLEA 8ICLA 4YMOA 4M47A 7ICNA 5KFFA 1WCNA 1ZQGA 4IRCA 4I2AA 8ICQA 3RJJA 4YR3A 4F93B 5J2BA 5L1LA 4EYHB 3GIJA 3GQCA 1XSNA 4B9NA 1CEZA 5DB7A 1SKSA 2ALZA 2DVIA 2ZUCA 1D8LA 1SZPA 8ICZA 2VA3A 2FPKA 4ELTA 2RDJA 5CWRA 4YR2A 1ZQHA 1T3NA 2ID1A 3UXNA 5DB9A 4F4YA 3T5HA 2R8KA 2XC9A 1N48A 2P6RA 3M9NB 4ECVA 1ZQYA 4DQIA 5HRGA 1NO5A 2ZH5A 4Z6FA 1ZQUA 3G6XA 4C8OA 2NRTA 1A77A 3GV8B 4IQVA 3RJGA 4PPXA 5HRDA 4QW9A 1ZQXA 5D46A 3RJKA 4C8LA 2V9WA 4X4NA 5IIMA 4XA5A 2BPCA 7ICUA 3H4DA 2PFQA 1IM4A 5EWEA 5DGAA 4K4IA 4NM1A 3H3AA 1BGXT 5IILA 2NRWA 1JXEA 1K1SA 1BPEA 7ICEA 2IHMA 1RZTA 3TANA 1ZQBA 1NK9A 5IIJA 4QZ9A 1SL0A 3ZDBA 4C8NA 5D49A 3SV3A 3UQ2A 3T5KA 3Q8MA 7ICMA 4RQ0A 4E80A 3C1ZA 1UA1A 1BPYA 5KG6A 2AU0A 3IHQB 9ICLA 4R8UA 5JUMA 4AT9B 4F92B 2ASJA 4X4PA 8ICHA 1TFWA 3KHRA 4DQPA 4ELVA 5BOLA 2DPJA 4X4VA 3UQ0A 1WOTA 3JPPA 3ZDAA 4Q45A 1LB2B 4O3NA 4KLSA 4DEZA 1TFRA 3ETLA 1U9LA 5J0UA 4FBTA 1RXWA 3PW5A 2ZHBA 4DL4A 3PX6A 1KSPA 1Z3EB 3C2MA 5DEDA 4ATBA 2BCSA 2I1QA 2Q66A 4RWPA 4MFAA 2W9AA 2KFNA 1U47A 1NJYA 4B9MA 3TI0A 2VANA 5KFIA 1ZQLA 1KFDA 5C5JA 1TAQA 5KT3A 2BKEA 5KFJA 4RUCA 1BPXA 3NTUA 2DR7A 4O5EA 8ICTA 4F5QA 4K4HA 3MDAA 3G6YA 3UPSA 3EYZA 3PW0A 2Y1JA 4QZ8A 2DPIA 4GXIA 4PGQA 1X9WA 9ICGA 3RTVA 2O1PA 3L9DA 3LDAA 3KHGA 4O3RA 2C2EA 4RNOA 3RJFA 4BWMA 4Z6EA 2F1IA 3V7LA 4ECXA 1L3VA 4IRDA 4M0AA 5HRFA 4X4SA 4QZBA 1ZQOA 4RQ2A 3OJUA 3RB0A 4UBBA 1NOMA 1S0VA 5KFPA 4ZH4A 3H40A 3NYBA 1ZQDA 3M8RA 5CR0A 1PX5A 4KLFA 4EBCA 4LT6A 1ZQRA 2MUTB 1TAUA 1MIVA 3ZD9A 1QLNA 4NLKA 3TQ1A 2ZH8A 4EBKA 3RBEA 4QZGA 4B9VA 2AGQA 5DECA 2AQ0A 4WC5A 3BQ0A 4RU9A 1BPDA 3KHHA 4C8MA 5J0SA 4X4TA 2ZH4A 4PH5A 5J2IA 1ZJMA 4NKUA 8ICBA 1TFYA 4TQRA 3M9OB 4WC3A 5CA7A 4E7XA 1TV9A 5J2EA 1NJZA 4PHAA 4ECZA 1NKEA 2UVWA 4JV0A 4ED1A 3EWAA 5KFRA 5CB1A 5J0YA 3MR2A 3QZ7A 1MIWA 1MIYA 1PZNA 4I2DA 1KLNA 8ICWA 1S0MA 3MFIA 4DSIA 3RB3A 1ZQNA 4QZCA 4YMNA 5KFHA 2KN7A 4ECSA 4DQSA 4DF8A 2P66A 3BDPA 4UQGA 3H4BA 3N4MB 8ICOA 1R8BA 8ICGA 2KZ3A 5KFLA 4M9JA 4O5KA 1JIHA 2R8HA 2FMQA 4F5OA 4DSEA 4KMUA 2RFFA 3TAPA 5F9LA 4RPZA 9ICHA 2C2DA 3OVAA 2IMWP 9ICRA 1IXRA 4R63A 1COOA 4R66A 1ZQSA 2M9NA 3RJEA 3IM1A 1Q79A 8ICYA 8ICUA 8ICCA 1ZQFA 4MEXA 5KG4A 5IIOA 1KNYA 4FBUA 1ZYQA 3WFRE 5J2DA 2PXIA 4YD1A 3NGDA 3OHBA 4ECYA 4I28A 2AJQA 3GIIA 1ZQCA 3V72A 4JV1A 2ZUDA 5J0OA 5J2CA 4QZIA 3Q8LA 1S97A 1S0OA 4RT3A 1QSSA 5HR9A 4MEYA 5IIIA 2XGQA 1NK8A 1LV5A 4X4QA 4X4OA 4RT2A 9ICBA 3SI8A 1SL2A 1BNOA 3ZDCA 4S3NA 4QWEA 2BDPA 3RBDA 2ASDA 2V4RA 5DLFA 1T8EA 4M9LA 1NKCA 4JV2A 1BVSA 5DKWA 1MC8A 4RQ1A 2XO7A 4R65A 4ECUA 2JEIA 7ICOA 4DL6A 1V4AA 2F1HA 2JZBA 4IQWA 4NLNA 4TQSA 4TUSA 5CHGA 3V7JA 1SKRA 1AROP 4Q44A 4DWIA 7ICFA 4TURA 2ZTDA 2IA6A 4WC6A 3C5FA 1NK5A 3AUOA 3BQTA 3JYYA 7ICRA 4UAYA 8ICFA 4WC0A 2ISPA 4EZ9A 4NM2A 3OV7A 2HHQA 2KFZA 7ICVA 5KG5A 2NRZA 1L5UA 3GIMA 4EBDA 4KLIA 4B9UA 4YMMA 4KLDA 4P2HA 4QWAA 2W9BA 3T3FA 5KFSA 2BR0A 1ZQEA 5KT6A 2KTQA 9ICPA 4I2GA 4AT9A 2BCUA 4YP3A 2C28A 4KLUA 1ZQTA 8ICRA 2ZH1A 7ICGA 7ICTA 1ZQVA 8ICXA 4J9OA 4I2HA 3H39A 5KG7A 5J0TA 3AQLA 4TUPA 2F1JA 8ICKA 5KG1A 4GXJA 4FS1A 4GC6A 2M2VA 4QZAA 4UAZA 2BQUA 4J9SA 3M8SA 4ED7A 2ATLA 1NK6A 2BQ3A 4O3OA 2M2WA 2C2RA 1JAJA 1ZQKA 4Z6CA 2ISOA 3MABA 3AU2A 4BWJA 4JUZA 5J2KA 1L3SA 4DSLA 4JWMA 1X9MA 9ICVA 3GDXA 7ICSA 1TK0A 4O3SA 7ICIA 9ICQA 3H38A 4B9LA 2DRAA 2ZH9A 4KTQA 1S10A 3MGIA 3OHAA 2A1JB 3PNCA 2HHWA 2HHPA 3ZDDA 4WC4A 3RH6A 5DQIA 9ICAA 4DSKA 4X0AA 2M2TA 3HPOA 3QEBZ 9ICFA 4UB5A 4UD5A 1Z00A 5DQHA 5F2VO 2FPMA 1ZQPA 3LWMA 4RNMA 4O5CA 4RWQA 4DOBA 5KT4A 2HHUA 9ICUA 3PY8A 8ICAA 2ZTEA 1A76A 2XCAA 5KFKA 2MUTA 4G3IA 5KG3A 4WBYA 1XWLA 4J9QA 4UB1A 4DLEA 5KFNA 4R8UB 3RB6A 4Q43A 4YD2A 3WFSC 5EWFA 2FLLA 2PI5A 2W8LA 4AT8A 5KG2A 5J2JA 4M2YA 1ZJNA 3H8JA 4O9MA 5DBBA 5DB8A 3QEAZ 2FMSA 5HHHA 4ED6A 8ICSA 4DQQA 1JN3A 3GILA 4EP7A 4F91B 1UT8A 2DR5A 2BCQA 4ATBB 2C22A 2W9CA 2NRVA 4QZEA 1DK3A 3GFKB 3ISCA 3GV5B 3N97B 4IR1A 4KLQA 9ICIA 3MR5A 1QTMA 3OSNA 3PR5B 4DL5A 3M9MB 2AGOA 1ZQQA 3PO5A 3RR8A 4FH3A 1YLQA 3C18A 3ISBA 1T7PA 5KT2A 4UBCA 2JEFA 5J2FA 3C2KA 1R89A 1UETA 3MR3A 2AGPA 9ICJA 4WBZA 9ICMA 5DDYA 4I2JA 4AT7A 3Q8SB 1R8AA 2FPLA 4XQ8A 5DG9A 3V6JA 4I2FA 3V6HA 5EOZA 4F50A 5IIKA 4P4MA 1D9FA 4ECQA 4YVZA 4C8KA 4FHPA 4UD4A 8ICVA 4WC7A 5J0PA 3HW8A 3HIYA 4DFKA 4DQRA 1MSWD 1JX4A 4I27A 2DR9A 1K1QA 4NLGA 1Q78A 3QE9Y 4K4GA 3HT3A 5HC9A 2ZJ8A 2ASLA 2HHTA 4QWCA 4ED8A 4YCXA 1X2IA 9ICOA 3C2LA 5HRHA 4JK1A 4M6WA 5CJ7A 3SV4A 8ICIA 3BQ1A 5J0QA 1ZQJA 1KTQA 1KFTA 3E2EA 1NZPA 2ZUBA 2M2UA 1VJ7A 1HUOA 4FH5A 1QSLA 2XCPA 3K4GA 4I29A 4M04A 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVB A;  1UEU A;  4QZH A;  4UB2 A;  5HRB A;  3BQ2 A;  2ZJA A;  3V7K A;  1V9P A;  3JPT A;  3JPQ A;  1ZET A;  1WCL A;  1KDH A;  4BXO B;  3HX0 A;  3AQN A;  2DFL A;  4KLL A;  4IQT A;  3UXO A;  3Q8Q B;  3TAR A;  1T4G A;  4UAW A;  4DL2 A;  3EW9 A;  4E0D A;  2B21 A;  4RQ3 A;  2W9M A;  1L3T A;  1H38 A;  4Q8E A;  1F5A A;  3B0X A;  4P4O A;  5KFG A;  4DF4 A;  1DOQ A;  3THV A;  2BCR A;  5KFU A;  2R8I A;  3OUY B;  3FYH A;  3C66 A;  1EXN A;  3RH4 A;  4UB4 A;  4BDP A;  4M9G A;  3UPQ A;  3T5J A;  3C21 A;  4KLT A;  3TFS A;  4DLG A;  4J9L A;  4F4X A;  2BQR A;  1XS9 D;  2Q0Z X;  4Z6D A;  5KT5 A;  4EEY A;  2NRX A;  3PMN A;  5EWG A;  3AQM A;  3MR6 A;  4M9H A;  4RPY A;  4GXK A;  2IHN A;  3RRG A;  1NKB A;  5KFW A;  2RDI A;  4UB3 A;  3JPR A;  1N56 A;  2J6S A;  4E8F A;  3EZ5 A;  2ZHA A;  5HHI A;  1JMS A;  4QWB A;  3PML A;  4BGD A;  1S77 D;  9ICX A;  4YG2 A;  1Y88 A;  4P4P A;  2BGW A;  4X0B A;  4J9M A;  4MFC A;  1XSL A;  4ED0 A;  1OU5 A;  4RQ5 A;  4F8R A;  5DG7 A;  7ICJ A;  4PHE A;  4ECW A;  2O5A A;  1NK7 A;  4EZ6 A;  4M5D A;  1ZQZ A;  1S76 D;  3RJH A;  4QZD A;  1S9F A;  2FLN A;  9ICS A;  1SL1 A;  3PW4 A;  4RZR A;  2ZH3 A;  4O3P A;  3G6V A;  2DR8 A;  2WTF A;  3ORY A;  4X5V A;  4FHX A;  3JPN A;  4F2S A;  1NJW A;  4QW8 A;  1DK2 A;  2ZH7 A;  1U49 A;  4PHP A;  4DOA A;  1MQ2 A;  3H8S A;  4F2R A;  8ICP A;  4FS2 A;  5KFV A;  4JWN A;  4GLX A;  2UVU A;  3C23 A;  2ZH6 A;  2V4Q A;  4J9P A;  3T5L A;  3Q8K A;  2A1J A;  3Q8R B;  5L1K A;  3HJ1 A;  5KFQ A;  3MFH A;  4MF8 A;  5J0W A;  2JZB B;  4DSJ A;  4KLM A;  7ICK A;  4KIT B;  3EPG A;  1XSP A;  4KLO A;  4MF2 A;  3MDC A;  1JQR A;  4ECR A;  2MAX A;  2BCV A;  2OWO A;  4ELU A;  4NLZ A;  2KZM A;  4KLH A;  9ICC A;  4KLJ A;  2AQ4 A;  2HVI A;  9ICN A;  2KP7 A;  1BNP A;  3WFP A;  4I2I A;  3RAQ A;  5L1J A;  9ICW A;  4IQU A;  4FHV A;  1HUZ A;  3LWL A;  2DRB A;  1KRP A;  3MGH A;  5KTQ A;  4PGY A;  4NY8 A;  4QZF A;  2BE3 A;  4RWO A;  4FHY A;  3H37 A;  3RR7 A;  2W9B B;  8ICE A;  4R64 A;  4HYK A;  4WC2 A;  4YXM A;  1FA0 A;  4X4U A;  1RPL A;  3MBY A;  4ED3 A;  5KFZ A;  3B0Y A;  3KHL A;  4DFM A;  4FO6 A;  4DS5 A;  2PFO A;  3EPI A;  4KN4 A;  4YQW A;  4F5P A;  1TKD A;  4YXJ A;  2VA2 A;  2LYH A;  4J9R A;  2PFN A;  1XU4 A;  5CP2 A;  5KFO A;  5HRE A;  4WCW A;  4YR0 A;  5D4B A;  3ZD8 A;  2JEG A;  5KT7 A;  4DSF A;  3ISD A;  4B9S A;  4IRK A;  3PVX A;  4IR9 A;  5HRL A;  2J6T A;  2HHX A;  2GWS A;  5J0R A;  1RYR A;  4X4R A;  4F4K A;  1JXL A;  7ICQ A;  2BHN A;  5DGB A;  2Y1I A;  3KTQ A;  3PV8 A;  3TFR A;  3C1Y A;  2UVV A;  2HHS A;  3PX4 A;  1KFS A;  3Q8P B;  4DL7 A;  5DBC A;  2VA8 A;  4PGX A;  5DLG A;  4RPX A;  3GV7 B;  3JPS A;  1NK4 A;  2HW3 A;  5HRI A;  1U45 A;  3LK9 A;  3OGU A;  2ZJ5 A;  3ZDE A;  2I9G A;  1D9D A;  1BPZ A;  2UVR A;  3HJ4 A;  4F5N A;  4I2C A;  9ICE A;  4B9T A;  2HVH A;  4XUS A;  4RQ4 A;  3PR4 A;  5DQG A;  4F4Z A;  1C7Y A;  2IBK A;  2FMP A;  2PBE A;  5KFD A;  1Z00 B;  4QWD A;  3JZ0 A;  1B43 A;  4F4W A;  5HP4 A;  3TAQ A;  3V6K A;  4IG8 A;  3QZ8 A;  1XO1 A;  3OJS A;  4RNN A;  4DOC A;  1NJX A;  4DL3 A;  5HRK A;  7ICL A;  2P6U A;  3BJY A;  5KG0 A;  7ICH A;  9ICT A;  5KFB A;  1UT5 A;  3SZ2 A;  1B22 A;  4J9K A;  4I2B A;  2HHV A;  2BPF A;  3PX0 A;  3C5G A;  1L3U A;  2BPG A;  4FHW A;  4LZD A;  1DGS A;  4PHD A;  1S0N A;  2PFP A;  8ICN A;  3WFQ E;  1ZQM A;  3H8W A;  3JPO A;  4EBE A;  1TK8 A;  1ZQI A;  3PW2 A;  4WC1 A;  4LZG A;  9ICK A;  2PI4 A;  4AT8 B;  4GC7 A;  4RQ6 A;  2XGP A;  4CCH A;  4BXO A;  4RUA A;  2NRK A;  4M9N A;  1RYS A;  3UXP A;  5KFM A;  5KFE A;  3HWT A;  4LVS A;  4EBJ A;  4YFK A;  3FDS A;  4F3O A;  3RAX A;  3RRH A;  1CUK A;  5HML A;  2W9C B;  2XY5 A;  5DB6 A;  4RQ8 A;  3OSP A;  5HNK A;  5KFA A;  3SYZ A;  3RB4 A;  1D8Y A;  4I2E A;  4NKT A;  4J9N A;  4ECT A;  3OUY A;  4F5R A;  5J2G A;  2W8K A;  3AU6 A;  2R8J A;  2KZZ A;  3LQC B;  1R8C A;  3AQK A;  1SKW A;  5TZV A;  4DFP A;  5HMM A;  1NK0 A;  5KFT A;  4MFF A;  1HJP A;  4O0I A;  5DG8 A;  3H7I A;  5J0X A;  2J6U A;  2XY6 A;  5J2A A;  4Q8F A;  2FLP A;  4XQ7 A;  1RXV A;  5BOM A;  4AT7 B;  1ZQA A;  1ZQW A;  1U4B A;  3GIK A;  1TK5 A;  5DDM A;  3WFO A;  1UEV A;  4DS4 A;  3PO4 A;  2ZTC A;  4NXZ A;  7ICP A;  3K75 D;  4RQ7 A;  4ED2 A;  3OVS A;  4O3Q A;  2JEJ A;  1XC9 A;  4DFJ A;  2ZH2 A;  5F9N A;  1UA0 A;  4M6W B;  1BPB A;  5KFX A;  4EYI B;  1MQ3 A;  8ICJ A;  8ICM A;  4XRH A;  3PW7 A;  1TVA A;  1U48 A;  2R8G A;  2XY7 A;  5J2H A;  5IIN A;  4KN7 A;  5J29 A;  3RJI A;  3HP6 A;  4KLG A;  1KEJ A;  1VFG A;  3RH5 A;  5L1I A;  5L9X A;  5BPC A;  5KFC A;  1X9S A;  4DO9 A;  5DBA A;  5KFY A;  4TUQ A;  4YN4 A;  4RWN A;  1QSY A;  4KLE A;  8ICL A;  4YMO A;  4M47 A;  7ICN A;  5KFF A;  1WCN A;  1ZQG A;  4IRC A;  4I2A A;  8ICQ A;  3RJJ A;  4YR3 A;  4F93 B;  5J2B A;  5L1L A;  4EYH B;  3GIJ A;  3GQC A;  1XSN A;  4B9N A;  1CEZ A;  5DB7 A;  1SKS A;  2ALZ A;  2DVI A;  2ZUC A;  1D8L A;  1SZP A;  8ICZ A;  2VA3 A;  2FPK A;  4ELT A;  2RDJ A;  5CWR A;  4YR2 A;  1ZQH A;  1T3N A;  2ID1 A;  3UXN A;  5DB9 A;  4F4Y A;  3T5H A;  2R8K A;  2XC9 A;  1N48 A;  2P6R A;  3M9N B;  4ECV A;  1ZQY A;  4DQI A;  5HRG A;  1NO5 A;  2ZH5 A;  4Z6F A;  1ZQU A;  3G6X A;  4C8O A;  2NRT A;  1A77 A;  3GV8 B;  4IQV A;  3RJG A;  4PPX A;  5HRD A;  4QW9 A;  1ZQX A;  5D46 A;  3RJK A;  4C8L A;  2V9W A;  4X4N A;  5IIM A;  4XA5 A;  2BPC A;  7ICU A;  3H4D A;  2PFQ A;  1IM4 A;  5EWE A;  5DGA A;  4K4I A;  4NM1 A;  3H3A A;  1BGX T;  5IIL A;  2NRW A;  1JXE A;  1K1S A;  1BPE A;  7ICE A;  2IHM A;  1RZT A;  3TAN A;  1ZQB A;  1NK9 A;  5IIJ A;  4QZ9 A;  1SL0 A;  3ZDB A;  4C8N A;  5D49 A;  3SV3 A;  3UQ2 A;  3T5K A;  3Q8M A;  7ICM A;  4RQ0 A;  4E80 A;  3C1Z A;  1UA1 A;  1BPY A;  5KG6 A;  2AU0 A;  3IHQ B;  9ICL A;  4R8U A;  5JUM A;  4AT9 B;  4F92 B;  2ASJ A;  4X4P A;  8ICH A;  1TFW A;  3KHR A;  4DQP A;  4ELV A;  5BOL A;  2DPJ A;  4X4V A;  3UQ0 A;  1WOT A;  3JPP A;  3ZDA A;  4Q45 A;  1LB2 B;  4O3N A;  4KLS A;  4DEZ A;  1TFR A;  3ETL A;  1U9L A;  5J0U A;  4FBT A;  1RXW A;  3PW5 A;  2ZHB A;  4DL4 A;  3PX6 A;  1KSP A;  1Z3E B;  3C2M A;  5DED A;  4ATB A;  2BCS A;  2I1Q A;  2Q66 A;  4RWP A;  4MFA A;  2W9A A;  2KFN A;  1U47 A;  1NJY A;  4B9M A;  3TI0 A;  2VAN A;  5KFI A;  1ZQL A;  1KFD A;  5C5J A;  1TAQ A;  5KT3 A;  2BKE A;  5KFJ A;  4RUC A;  1BPX A;  3NTU A;  2DR7 A;  4O5E A;  8ICT A;  4F5Q A;  4K4H A;  3MDA A;  3G6Y A;  3UPS A;  3EYZ A;  3PW0 A;  2Y1J A;  4QZ8 A;  2DPI A;  4GXI A;  4PGQ A;  1X9W A;  9ICG A;  3RTV A;  2O1P A;  3L9D A;  3LDA A;  3KHG A;  4O3R A;  2C2E A;  4RNO A;  3RJF A;  4BWM A;  4Z6E A;  2F1I A;  3V7L A;  4ECX A;  1L3V A;  4IRD A;  4M0A A;  5HRF A;  4X4S A;  4QZB A;  1ZQO A;  4RQ2 A;  3OJU A;  3RB0 A;  4UBB A;  1NOM A;  1S0V A;  5KFP A;  4ZH4 A;  3H40 A;  3NYB A;  1ZQD A;  3M8R A;  5CR0 A;  1PX5 A;  4KLF A;  4EBC A;  4LT6 A;  1ZQR A;  2MUT B;  1TAU A;  1MIV A;  3ZD9 A;  1QLN A;  4NLK A;  3TQ1 A;  2ZH8 A;  4EBK A;  3RBE A;  4QZG A;  4B9V A;  2AGQ A;  5DEC A;  2AQ0 A;  4WC5 A;  3BQ0 A;  4RU9 A;  1BPD A;  3KHH A;  4C8M A;  5J0S A;  4X4T A;  2ZH4 A;  4PH5 A;  5J2I A;  1ZJM A;  4NKU A;  8ICB A;  1TFY A;  4TQR A;  3M9O B;  4WC3 A;  5CA7 A;  4E7X A;  1TV9 A;  5J2E A;  1NJZ A;  4PHA A;  4ECZ A;  1NKE A;  2UVW A;  4JV0 A;  4ED1 A;  3EWA A;  5KFR A;  5CB1 A;  5J0Y A;  3MR2 A;  3QZ7 A;  1MIW A;  1MIY A;  1PZN A;  4I2D A;  1KLN A;  8ICW A;  1S0M A;  3MFI A;  4DSI A;  3RB3 A;  1ZQN A;  4QZC A;  4YMN A;  5KFH A;  2KN7 A;  4ECS A;  4DQS A;  4DF8 A;  2P66 A;  3BDP A;  4UQG A;  3H4B A;  3N4M B;  8ICO A;  1R8B A;  8ICG A;  2KZ3 A;  5KFL A;  4M9J A;  4O5K A;  1JIH A;  2R8H A;  2FMQ A;  4F5O A;  4DSE A;  4KMU A;  2RFF A;  3TAP A;  5F9L A;  4RPZ A;  9ICH A;  2C2D A;  3OVA A;  2IMW P;  9ICR A;  1IXR A;  4R63 A;  1COO A;  4R66 A;  1ZQS A;  2M9N A;  3RJE A;  3IM1 A;  1Q79 A;  8ICY A;  8ICU A;  8ICC A;  1ZQF A;  4MEX A;  5KG4 A;  5IIO A;  1KNY A;  4FBU A;  1ZYQ A;  3WFR E;  5J2D A;  2PXI A;  4YD1 A;  3NGD A;  3OHB A;  4ECY A;  4I28 A;  2AJQ A;  3GII A;  1ZQC A;  3V72 A;  4JV1 A;  2ZUD A;  5J0O A;  5J2C A;  4QZI A;  3Q8L A;  1S97 A;  1S0O A;  4RT3 A;  1QSS A;  5HR9 A;  4MEY A;  5III A;  2XGQ A;  1NK8 A;  1LV5 A;  4X4Q A;  4X4O A;  4RT2 A;  9ICB A;  3SI8 A;  1SL2 A;  1BNO A;  3ZDC A;  4S3N A;  4QWE A;  2BDP A;  3RBD A;  2ASD A;  2V4R A;  5DLF A;  1T8E A;  4M9L A;  1NKC A;  4JV2 A;  1BVS A;  5DKW A;  1MC8 A;  4RQ1 A;  2XO7 A;  4R65 A;  4ECU A;  2JEI A;  7ICO A;  4DL6 A;  1V4A A;  2F1H A;  2JZB A;  4IQW A;  4NLN A;  4TQS A;  4TUS A;  5CHG A;  3V7J A;  1SKR A;  1ARO P;  4Q44 A;  4DWI A;  7ICF A;  4TUR A;  2ZTD A;  2IA6 A;  4WC6 A;  3C5F A;  1NK5 A;  3AUO A;  3BQT A;  3JYY A;  7ICR A;  4UAY A;  8ICF A;  4WC0 A;  2ISP A;  4EZ9 A;  4NM2 A;  3OV7 A;  2HHQ A;  2KFZ A;  7ICV A;  5KG5 A;  2NRZ A;  1L5U A;  3GIM A;  4EBD A;  4KLI A;  4B9U A;  4YMM A;  4KLD A;  4P2H A;  4QWA A;  2W9B A;  3T3F A;  5KFS A;  2BR0 A;  1ZQE A;  5KT6 A;  2KTQ A;  9ICP A;  4I2G A;  4AT9 A;  2BCU A;  4YP3 A;  2C28 A;  4KLU A;  1ZQT A;  8ICR A;  2ZH1 A;  7ICG A;  7ICT A;  1ZQV A;  8ICX A;  4J9O A;  4I2H A;  3H39 A;  5KG7 A;  5J0T A;  3AQL A;  4TUP A;  2F1J A;  8ICK A;  5KG1 A;  4GXJ A;  4FS1 A;  4GC6 A;  2M2V A;  4QZA A;  4UAZ A;  2BQU A;  4J9S A;  3M8S A;  4ED7 A;  2ATL A;  1NK6 A;  2BQ3 A;  4O3O A;  2M2W A;  2C2R A;  1JAJ A;  1ZQK A;  4Z6C A;  2ISO A;  3MAB A;  3AU2 A;  4BWJ A;  4JUZ A;  5J2K A;  1L3S A;  4DSL A;  4JWM A;  1X9M A;  9ICV A;  3GDX A;  7ICS A;  1TK0 A;  4O3S A;  7ICI A;  9ICQ A;  3H38 A;  4B9L A;  2DRA A;  2ZH9 A;  4KTQ A;  1S10 A;  3MGI A;  3OHA A;  2A1J B;  3PNC A;  2HHW A;  2HHP A;  3ZDD A;  4WC4 A;  3RH6 A;  5DQI A;  9ICA A;  4DSK A;  4X0A A;  2M2T A;  3HPO A;  3QEB Z;  9ICF A;  4UB5 A;  4UD5 A;  1Z00 A;  5DQH A;  5F2V O;  2FPM A;  1ZQP A;  3LWM A;  4RNM A;  4O5C A;  4RWQ A;  4DOB A;  5KT4 A;  2HHU A;  9ICU A;  3PY8 A;  8ICA A;  2ZTE A;  1A76 A;  2XCA A;  5KFK A;  2MUT A;  4G3I A;  5KG3 A;  4WBY A;  1XWL A;  4J9Q A;  4UB1 A;  4DLE A;  5KFN A;  4R8U B;  3RB6 A;  4Q43 A;  4YD2 A;  3WFS C;  5EWF A;  2FLL A;  2PI5 A;  2W8L A;  4AT8 A;  5KG2 A;  5J2J A;  4M2Y A;  1ZJN A;  3H8J A;  4O9M A;  5DBB A;  5DB8 A;  3QEA Z;  2FMS A;  5HHH A;  4ED6 A;  8ICS A;  4DQQ A;  1JN3 A;  3GIL A;  4EP7 A;  4F91 B;  1UT8 A;  2DR5 A;  2BCQ A;  4ATB B;  2C22 A;  2W9C A;  2NRV A;  4QZE A;  1DK3 A;  3GFK B;  3ISC A;  3GV5 B;  3N97 B;  4IR1 A;  4KLQ A;  9ICI A;  3MR5 A;  1QTM A;  3OSN A;  3PR5 B;  4DL5 A;  3M9M B;  2AGO A;  1ZQQ A;  3PO5 A;  3RR8 A;  4FH3 A;  1YLQ A;  3C18 A;  3ISB A;  1T7P A;  5KT2 A;  4UBC A;  2JEF A;  5J2F A;  3C2K A;  1R89 A;  1UET A;  3MR3 A;  2AGP A;  9ICJ A;  4WBZ A;  9ICM A;  5DDY A;  4I2J A;  4AT7 A;  3Q8S B;  1R8A A;  2FPL A;  4XQ8 A;  5DG9 A;  3V6J A;  4I2F A;  3V6H A;  5EOZ A;  4F50 A;  5IIK A;  4P4M A;  1D9F A;  4ECQ A;  4YVZ A;  4C8K A;  4FHP A;  4UD4 A;  8ICV A;  4WC7 A;  5J0P A;  3HW8 A;  3HIY A;  4DFK A;  4DQR A;  1MSW D;  1JX4 A;  4I27 A;  2DR9 A;  1K1Q A;  4NLG A;  1Q78 A;  3QE9 Y;  4K4G A;  3HT3 A;  5HC9 A;  2ZJ8 A;  2ASL A;  2HHT A;  4QWC A;  4ED8 A;  4YCX A;  1X2I A;  9ICO A;  3C2L A;  5HRH A;  4JK1 A;  4M6W A;  5CJ7 A;  3SV4 A;  8ICI A;  3BQ1 A;  5J0Q A;  1ZQJ A;  1KTQ A;  1KFT A;  3E2E A;  1NZP A;  2ZUB A;  2M2U A;  1VJ7 A;  1HUO A;  4FH5 A;  1QSL A;  2XCP A;  3K4G A;  4I29 A;  4M04 A;  2H5X A; 
#chains in the Genus database with same CATH topology
 1UEU A;  4QZH A;  4FFD A;  3V7K A;  1V9P A;  3HX0 A;  3AQN A;  2JHD A;  4IQT A;  4DL2 A;  1S8O A;  3EW9 A;  4EX6 A;  2FCL A;  4O69 A;  2ODG A;  1L3T A;  1H38 A;  5CRX A;  1F5A A;  2BCR A;  3N28 A;  3OUY B;  3RH4 A;  4UB4 A;  3UPQ A;  4PL1 A;  4LJX A;  1ZRN A;  2BQR A;  1PVP A;  2Q0Z X;  5KT5 A;  3PMN A;  5EWG A;  4RPY A;  4I2E A;  5KFW A;  2RDI A;  2J6S A;  3EZ5 A;  5HHI A;  2BGW A;  4BUG A;  4J9M A;  3B9J A;  1XSL A;  7ICJ A;  4ECW A;  2IOF K;  2RLT A;  3AQE A;  5ALT A;  4M5D A;  1ZQZ A;  3RJH A;  4RZR A;  3MGV A;  3IRU A;  3ORY A;  4X5V A;  4Y2R A;  1U49 A;  4PHP A;  4DOA A;  4F2R A;  3H8S A;  3F53 A;  3KKA C;  4LEV A;  2UVU A;  3C23 A;  2ZH6 A;  2V4Q A;  4J9P A;  3Q8R B;  3HJ1 A;  3MFH A;  5J0W A;  4MF2 A;  2MAX A;  5AK5 A;  4NLZ A;  3IDW A;  9ICN A;  3WFP A;  9ICW A;  1SV0 C;  1NNL A;  4NY8 A;  3H37 A;  3M7D A;  3RR7 A;  1L6N A;  2KSO A;  3N7R C;  4CF3 A;  1RPL A;  2PFO A;  3B0Y A;  4KN4 A;  4YXJ A;  2PFN A;  5KFO A;  2JEG A;  4F4K A;  4P0P B;  5DGB A;  2UVV A;  2N1R A;  1V38 A;  1KFS A;  3Q8P B;  1PK1 A;  1NK4 A;  2ZH1 A;  3GV7 B;  4RPX A;  3ZDE A;  3HJ4 A;  2I9G A;  4B9T A;  4XUS A;  5KL1 B;  1C7Y A;  3TAD C;  2FMP A;  5ALL A;  4HX0 A;  2MRL A;  4NXX A;  5HP4 A;  3OJS A;  3KD3 A;  1NJX A;  2KHV A;  5KG0 A;  3BJY A;  9ICT A;  2DF4 B;  3SZ2 A;  2HHV A;  2BPF A;  4FHW A;  2D3D A;  2BPG A;  1DGS A;  1S0N A;  2K4I A;  1ZQM A;  3H8W A;  4WC1 A;  3PW2 A;  9ICK A;  2PI4 A;  2ES6 A;  4RQ6 A;  4GC7 A;  4CCH A;  3EUB 2;  1MN8 A;  3UXP A;  4EBJ A;  4MHV A;  3RFA A;  3HWT A;  4LVS A;  3FDS A;  3RAX A;  5AM3 A;  3AQF A;  2XY5 A;  3MCR A;  4RQ8 A;  1DRG A;  5JTG A;  3L5K A;  2KZZ A;  1SKW A;  1NK0 A;  4MFF A;  5HMM A;  2LMR A;  4ZOH C;  2F3N A;  5DG8 A;  4XQ7 A;  2FLP A;  2EAO A;  1RXV A;  3VCB A;  3LVV A;  1TK5 A;  3WFO A;  3QU5 A;  4DS4 A;  3PO4 A;  4NXZ A;  3K75 D;  3NVW A;  4RQ7 A;  4O3Q A;  2IUB A;  3BZC A;  1RQL A;  4DFJ A;  5F9N A;  4Y2J A;  1MQ3 A;  1ZQ1 C;  2CPR A;  3PW7 A;  5J2H A;  2I5H A;  4OJ5 A;  5ALM A;  5L1I A;  1X9S A;  4YN4 A;  1QSY A;  2HBM A;  4UAU A;  1SB3 C;  2PMZ F;  5TIS U;  4F72 A;  4I2A A;  2O6K A;  4EYH B;  4B9N A;  1LKY A;  1CEZ A;  1SKS A;  1J2N A;  2RDJ A;  1C20 A;  4YR2 A;  3UXN A;  3T5H A;  2G5H B;  4DQI A;  5HRG A;  2GLE A;  2WF7 A;  7ICH A;  4C8O A;  4QW9 A;  2W03 A;  3RJK A;  4C8L A;  2FDR A;  7ICU A;  2PFQ A;  1BGX T;  4OAG A;  1X6I A;  1ECW A;  1BPE A;  7ICE A;  3WK6 A;  5AM5 A;  5FP0 A;  5C0Y A;  4PL2 A;  3QUB A;  4XJE A;  3JCF A;  2ZIW B;  5D49 A;  2DR8 A;  4RQ0 A;  3C1Z A;  3WKA A;  1BPY A;  1CRX A;  4R8U A;  5BOL A;  3JPP A;  1YT3 A;  4Q45 A;  2ZIV A;  1TFR A;  1U9L A;  4FBT A;  3PW5 A;  2Y9T A;  3PX6 A;  5ALE A;  3C2M A;  5DED A;  2VJ5 A;  4RWP A;  2W9A A;  4P0Q B;  2RQ5 A;  2G09 A;  1ZD2 P;  1ZQL A;  5C5J A;  2BKE A;  2GOL A;  2DR7 A;  2E1E A;  2OH2 A;  4NV0 A;  3NRW A;  4O3R A;  2C2E A;  4RNO A;  2F1I A;  1AQ6 A;  1QH9 A;  5HRF A;  4X4S A;  1ZQO A;  4RQ2 A;  3OJU A;  3WKE A;  5KFP A;  1S0V A;  3SR6 A;  3DEE A;  1PX5 A;  2MUT B;  1MIV A;  2H3Q A;  5AI4 A;  2H3Z A;  3RBE A;  4B9V A;  2AGQ A;  5DEC A;  4WC5 A;  4RU9 A;  3KHH A;  5AI8 A;  3K1Z A;  1A6S A;  4UB6 U;  4CNQ A;  4ED1 A;  4EEK A;  1MIY A;  2YB1 A;  1KLN A;  5AKH A;  2LYB A;  4DQS A;  4ECS A;  4DF8 A;  3BDP A;  8ICO A;  3H4B A;  4GFJ A;  4M9J A;  1S5L U;  4DSE A;  4KMU A;  3TAP A;  9ICH A;  9ICR A;  4R66 A;  3ERC C;  1ZQS A;  3QU2 A;  1Q79 A;  8ICU A;  1ZQF A;  1SWV A;  3ALR A;  4FBU A;  2K8C B;  3NGD A;  3OHB A;  3GII A;  1ZQC A;  3SAG A;  4K97 A;  3QU7 A;  5J0O A;  4QZI A;  1N5W A;  2E1F A;  3AN1 A;  2YMM A;  9ICB A;  5D63 A;  1B4F A;  4JB3 A;  4UB8 U;  1BVS A;  3NVO A;  4R65 A;  7ICO A;  5AM1 A;  4QNL A;  2BBJ A;  4TQS A;  1SKR A;  4Q44 A;  1ZD3 A;  1M6Y A;  2YTU A;  3IG8 A;  1X9X A;  2HHQ A;  7ICV A;  5KG5 A;  2WF9 A;  4QWA A;  4PJ0 U;  5KFS A;  5KT6 A;  4AT9 A;  4CF5 A;  1ZQT A;  1MA7 A;  3HIL A;  2F8L A;  4I2H A;  4TUP A;  3SAF A;  2BQU A;  4ED7 A;  2M2W A;  2BQ3 A;  2C2R A;  1JAJ A;  1VJ5 A;  7ICS A;  4DSL A;  4P0P A;  1WWV A;  2DRA A;  2GO7 A;  2Z7J A;  1S10 A;  4WC4 A;  1V97 A;  1OUQ A;  1FFV A;  9ICF A;  5KT4 A;  4WJ3 B;  8ICA A;  2Y0S F;  5KFK A;  4G3I A;  1XWL A;  2KSO B;  2FLL A;  2D6F C;  1FFU A;  2W8L A;  4BJQ A;  4O9M A;  3H8J A;  2LHT A;  4AP9 A;  2DUY A;  3GIL A;  2BCQ A;  3F5E A;  4NL9 C;  2NRV A;  4LEW A;  3CW2 C;  3GFK B;  3GV5 B;  2W3R A;  3MR5 A;  3OSN A;  1YLQ A;  3C18 A;  1T7P A;  9ICJ A;  4WBZ A;  2MU2 A;  3Q8S B;  1R8A A;  4XQ8 A;  3WK8 A;  5IIK A;  4YVZ A;  4WC7 A;  3HW8 A;  2K4E A;  1PVR A;  4I27 A;  4K9A A;  1Q3V A;  1Q78 A;  3QE9 Y;  4K4G A;  3HT3 A;  2ZJ8 A;  2ASL A;  9ICO A;  4JK1 A;  2WFA A;  5JRT A;  1NZP A;  4FH5 A;  1N63 A;  2H5X A;  2DWQ A;  2K4H A;  1UHU A;  5HRB A;  1WCL A;  5AK3 A;  4KLL A;  3Q8Q B;  3TAR A;  4UAW A;  2NYV A;  1QCK A;  2W9M A;  3B0X A;  4P4O A;  1DOQ A;  2R8I A;  3C66 A;  2KJ8 A;  5A0L A;  1QQ5 A;  4FZM A;  4BDP A;  1WYG A;  1QQ6 A;  3TFS A;  3AL0 B;  4F4X A;  4EEY A;  2NRX A;  3CRX A;  4M9H A;  1NKB A;  3JPR A;  1N56 A;  4RQN A;  4E8F A;  1YZ7 A;  4DFD A;  1WUD A;  4QWB A;  1Y88 A;  2DKZ A;  4X0B A;  3CYM A;  4ED0 A;  5DG7 A;  1P7D A;  4NXU A;  4PHE A;  3D2S A;  2CRX A;  3KOO A;  5ALN A;  1N62 A;  1S76 D;  3WK9 A;  3QNM A;  1S9F A;  2ZIW A;  1SL1 A;  1WG8 A;  5AK6 A;  2ZH3 A;  4O3P A;  3JPN A;  4F2S A;  1NJW A;  2YB4 A;  1IV8 A;  4Y2Q A;  3ETR A;  1KQQ A;  4FS2 A;  4GLX A;  2KJ9 A;  3F5A A;  4I0U A;  3T5L A;  2A1J A;  1JUD A;  1DGJ A;  2KEY A;  4DSJ A;  4KIT B;  4ECR A;  2OWO A;  2KVS A;  2KIW A;  4KLH A;  2HVI A;  2KP7 A;  4I2I A;  5L1J A;  3MGH A;  2BE3 A;  4QZF A;  1N60 A;  4HYK A;  3AMZ A;  1FA0 A;  3MBY A;  4ED3 A;  5KFZ A;  4DS5 A;  5G5H A;  3BQ7 A;  2VA2 A;  4J9R A;  4WCW A;  5KT7 A;  4DSF A;  4IRK A;  2HSZ A;  2HHX A;  4X4R A;  2QB0 B;  4K98 A;  2HHS A;  3JPS A;  1U45 A;  3OGU A;  1BPZ A;  5ALV A;  9ICE A;  4UAV A;  4AYB C;  2RRD A;  1Z00 B;  4F4W A;  2YML A;  4DL3 A;  2KKP A;  2P6U A;  5KFB A;  2XIC A;  1VLB A;  3PX0 A;  1Q8K A;  4CDG A;  4O6A A;  4OCZ A;  4OJO A;  2PFP A;  4IC9 A;  3WFQ E;  2HBJ A;  4BXO A;  4PZO A;  4USA A;  2G07 A;  2EAM A;  2W9C B;  5DB6 A;  3OSP A;  5HNK A;  1D8Y A;  1R8C A;  2KD1 A;  5J2G A;  3AQK A;  3H8M A;  5TZV A;  3DV9 A;  1HJP A;  1HEK A;  3BS7 A;  3H7I A;  2J6U A;  5J2A A;  2R18 A;  5BOM A;  1ZQA A;  1U4B A;  1RYU A;  4KX5 A;  5KNI A;  4ED2 A;  4M6W B;  1BPB A;  2NO5 A;  8ICM A;  3VC8 A;  1U48 A;  1OW5 A;  5J29 A;  4KLG A;  4AYB F;  5KFY A;  4TUQ A;  3M1Y A;  2DQN B;  4KLE A;  3L4P A;  8ICL A;  4M47 A;  1Z19 A;  8ICQ A;  1CI4 A;  3I28 A;  5AKY A;  4MKP A;  2HBL A;  3GQC A;  4LEY A;  1D8L A;  3TKA A;  1T3N A;  5B5E U;  4F4Y A;  1NO5 A;  4OJL A;  1ZQY A;  2ZH5 A;  4Z6F A;  3G6X A;  3GV8 B;  3RJG A;  2V9W A;  5IIM A;  5EWE A;  4NM1 A;  5DGA A;  2NRW A;  1K1S A;  1ZXI A;  1RZT A;  3TAN A;  1ZQB A;  3ZDB A;  4Y2P A;  3PSP A;  4C8N A;  4CE6 A;  2AXT U;  3SV3 A;  3T5K A;  4E80 A;  9ICL A;  1KW4 A;  3D6J A;  4F92 B;  2HOI A;  4AT9 B;  1TFW A;  3KHR A;  4DQP A;  4K96 A;  5F3X B;  1L7O A;  5JU5 A;  3UQ0 A;  4DEZ A;  3ETL A;  2HN1 A;  2ZHB A;  4DL4 A;  1Z3E B;  2BCS A;  2K8A A;  4B9M A;  1SWW A;  5KFI A;  1N5X A;  1TAQ A;  5KT3 A;  4Y2X A;  4RUC A;  1F5S A;  4O5E A;  4OO1 J;  2CXY A;  3F2C A;  5ALD A;  3G6Y A;  3EYZ A;  4QZ8 A;  1X9W A;  2O1P A;  2IOF A;  3KHG A;  2FE9 A;  4BWM A;  3V7L A;  1L3V A;  4IRD A;  3IG5 A;  2BDU A;  3SEN A;  3FC4 A;  4DCC A;  4EBC A;  1XNS A;  2YY6 A;  3ZD9 A;  4NLK A;  4QZG A;  1HIW A;  2DGZ A;  4J03 A;  1KKX A;  1JRP A;  5J0S A;  2KG5 A;  1ZJM A;  1TFY A;  3ER8 C;  5KAI U;  4C4T A;  5J2E A;  4PHA A;  2HI0 A;  4ECZ A;  1NKE A;  3S6J A;  3EWA A;  3QZ7 A;  4I2D A;  3LYS A;  2WF8 A;  1S0M A;  1ZQN A;  3WKD A;  1FO4 A;  2HBK A;  2P66 A;  5CFS A;  2A19 A;  1R8B A;  5EE1 A;  1RG6 A;  2KZ3 A;  1SGG A;  2RFF A;  4QIW C;  3M6K A;  1L8L A;  4UAS A;  4US8 A;  2G0A A;  5KL8 B;  1IXR A;  2NO4 A;  4R63 A;  2W04 A;  2M9N A;  3IM1 A;  4ACO A;  8ICY A;  8ICC A;  3L3F X;  1NI3 A;  2A3V A;  4YD1 A;  2BZF A;  2AJQ A;  4ECY A;  2Q4T A;  1L7P A;  5J2C A;  1S0O A;  1S97 A;  3CNH A;  1QSS A;  3O0F A;  1NK8 A;  2CN1 A;  4RT2 A;  3SI8 A;  3QYP A;  2VIX A;  2V4R A;  1T8E A;  4OD0 A;  4JV2 A;  2XO7 A;  2JEI A;  3ER9 B;  4DL6 A;  1V4A A;  2MA1 A;  4NLN A;  2QKQ A;  3D2Q A;  3T79 A;  4DWI A;  4TUR A;  2IA6 A;  2EZX A;  3C5F A;  1NK5 A;  3JYY A;  7ICR A;  3PSI A;  2ISP A;  2KNJ A;  4NM2 A;  2KFZ A;  2M0N A;  4KLI A;  4YMM A;  4KLD A;  2HCF A;  9ICP A;  4Y2U A;  1ZQE A;  3NVY A;  2C28 A;  4KLU A;  7ICG A;  1ZQV A;  3H39 A;  4GC6 A;  4QIW F;  2ATL A;  1NK6 A;  4O3O A;  3UMB A;  2ISO A;  3MAB A;  4JUZ A;  4JWM A;  2QB0 A;  3H38 A;  4B9L A;  2ZH9 A;  2HHW A;  2A1J B;  3ZDD A;  3RH6 A;  4Y2S A;  4X0A A;  2YX8 A;  4KX3 A;  3HPO A;  2KHQ A;  2PKE A;  1Z00 A;  3BS5 A;  4HAI A;  4RNM A;  2HHU A;  4O68 A;  5AKZ A;  9ICU A;  3PY8 A;  2XCA A;  1A76 A;  4WBY A;  1J2M A;  2OM6 A;  4YD2 A;  5J2J A;  2FMS A;  4ED6 A;  2DR5 A;  4ATB B;  2C22 A;  2W9C A;  1F44 A;  4QZE A;  3N97 B;  2W55 A;  2YN4 A;  1QTM A;  3PR5 B;  4DL5 A;  3M9M B;  3K1R B;  4GIB A;  4EED A;  2JEF A;  3MR3 A;  9ICM A;  5DDY A;  2EAP A;  2FPL A;  5DG9 A;  5EOZ A;  1D9F A;  4P4M A;  2FI1 A;  8ICV A;  5JTI A;  3AEV A;  1JX4 A;  2JXJ A;  2XID A;  2E8M A;  4ED8 A;  4N7R A;  4O67 A;  4M6W A;  3SV4 A;  3H0R B;  5J0Q A;  1KTQ A;  3E2E A;  2ZUB A;  2XCP A;  4M04 A;  3KFU F;  3BQ2 A;  3JPQ A;  4BXO B;  1OXJ A;  1T4G A;  2E8N A;  4E0D A;  2B21 A;  4Q8E A;  1WWU A;  3THV A;  5KFU A;  1EXN A;  2OEH A;  4UAR A;  3C21 A;  4DLG A;  2E3T A;  1PUZ A;  4J9L A;  4Z6D A;  3AQM A;  4C80 A;  3MR6 A;  4GXK A;  4UB3 A;  1JMS A;  4BGD A;  1S77 D;  9ICX A;  4YG2 A;  4P4P A;  5J8Y A;  4EZ6 A;  1LVH A;  4QZD A;  2FLN A;  9ICS A;  4JLX A;  4FHX A;  4QW8 A;  1DK2 A;  1MQ2 A;  5ALF A;  2E8P A;  8ICP A;  5KFV A;  4JWN A;  2W11 A;  3Q8K A;  5L1K A;  3SQI A;  4MF8 A;  2DKX A;  2KE7 A;  2ESE A;  4KLM A;  3EPG A;  1XSP A;  4KLO A;  3MDC A;  4ELU A;  2AQ4 A;  2W43 A;  3QUT A;  1HUZ A;  3LWL A;  2XVT A;  2DRB A;  1KRP A;  5KTQ A;  5ALS A;  4PGY A;  4RWO A;  1GO3 F;  2W9B B;  1O03 A;  5AKE A;  4WC2 A;  4YXM A;  4X4U A;  4DFM A;  4FO6 A;  3EPI A;  3PSF A;  1TKD A;  2LYH A;  1XU4 A;  4YR0 A;  5D4B A;  3ZD8 A;  5HRL A;  3PVX A;  4IR9 A;  2GWS A;  3QUC A;  1JXL A;  7ICQ A;  2ZIX B;  2BHN A;  4EX7 A;  3TFR A;  3C1Y A;  3IP4 B;  3PX4 A;  2GA9 D;  5DBC A;  4ICA A;  3LK9 A;  1D9D A;  4I2C A;  4RQ4 A;  5ALU A;  4F4Z A;  2PBE A;  4K9B A;  3GU3 A;  3JZ0 A;  1B43 A;  4K8V A;  3TAQ A;  5CFU A;  4IG8 A;  3QZ8 A;  4C4R A;  2W3S A;  1UT5 A;  1B22 A;  4J9K A;  2WF5 A;  3C5G A;  1L3U A;  1JAL A;  5AM2 A;  4PHD A;  8ICN A;  2KV2 A;  3JPO A;  1ZQI A;  3C28 A;  2XGP A;  5ALW A;  2NRK A;  5KFM A;  5KFE A;  4YFK A;  4F3O A;  3RRH A;  5HML A;  5B3Q A;  5KFA A;  3LVW A;  4J9N A;  2W8K A;  2E5S A;  1ZD5 A;  5GTI U;  4Q8F A;  5J0X A;  4AT7 B;  2XY6 A;  1FEZ A;  1ZQW A;  4EGW A;  3NWI A;  7ICP A;  3ICX A;  3OVS A;  2JEJ A;  1XC9 A;  1UA0 A;  2EDU A;  2JR5 A;  4BX9 C;  8ICJ A;  5D61 A;  3SD7 A;  1TVA A;  5IIN A;  1FIQ A;  4KN7 A;  2WB1 C;  1KEJ A;  3K7D A;  1VFG A;  3RH5 A;  5BPC A;  3QUQ A;  2AHO B;  5KFC A;  5DBA A;  2G06 A;  3KBB A;  4KMO B;  5ALI A;  2F8K A;  4RWN A;  1K5O A;  3NAS A;  4UAT A;  1ZQG A;  2F2A B;  4US9 A;  3RJJ A;  3FM9 A;  5L1L A;  1XSN A;  5DB7 A;  2ALZ A;  2ZUC A;  8ICZ A;  5E79 U;  4NXT A;  1ZQH A;  1J97 A;  2F77 X;  2R8K A;  2XC9 A;  1N48 A;  3M9N B;  2EZY A;  2KVC A;  4PPX A;  4IQV A;  1ZQX A;  4XA5 A;  2BPC A;  3H4D A;  1IM4 A;  5ALG A;  3NVZ A;  5AKI A;  2XI9 A;  2LKY A;  3OTQ A;  2IHM A;  5ALR A;  3ONN A;  1PVQ A;  4QZ9 A;  1SL0 A;  3UQ2 A;  7ICM A;  5G5G A;  1UA1 A;  5KG6 A;  2AU0 A;  3IHQ B;  1IIP A;  5JUM A;  8ICH A;  5AKK A;  1LB2 B;  4KM5 A;  5J0U A;  1RXW A;  5AI6 A;  2LI6 A;  4ATB A;  2HN2 A;  4MFA A;  5T14 A;  2KFN A;  3ED5 A;  1NJY A;  2VAN A;  1KFD A;  4EEN A;  5KFJ A;  3NTU A;  8ICT A;  5ALZ A;  4K4H A;  2VKQ A;  2Y1J A;  4GXI A;  3L9D A;  3RTV A;  3AM9 A;  3BS5 B;  2W7P A;  4M0A A;  4Z6E A;  4QZB A;  3EF2 A;  4UBB A;  1NOM A;  4ZH4 A;  3H40 A;  5CR0 A;  1TAU A;  1QLN A;  5EE3 A;  3WK5 A;  4Y2V A;  3BQ0 A;  1BPD A;  4PZN A;  2BBH A;  4X4T A;  1JI7 A;  4PH5 A;  4NXV A;  8ICB A;  3M9O B;  5CA7 A;  4E7X A;  2HMX A;  1NJZ A;  1X40 A;  4JV0 A;  5KFR A;  3MR2 A;  1PZN A;  4C7Z A;  8ICW A;  3MFI A;  2OYY A;  4DSI A;  1KN5 A;  4QZC A;  4YMN A;  5KFH A;  8ICG A;  2JH7 A;  2R8H A;  2FMQ A;  4RPZ A;  2KIC A;  3H0M B;  3I76 A;  4FZN A;  5KG4 A;  3KKA A;  1Z1V A;  5J2D A;  2PXI A;  3WFR E;  1SIJ A;  1XO0 A;  4I28 A;  3V72 A;  3Q8L A;  4RT3 A;  4LEZ A;  4MEY A;  1LV5 A;  4X4Q A;  1PK3 A;  1X6J A;  1L8O A;  1SL2 A;  3GZF A;  3ZDC A;  4S3N A;  3QX7 A;  2BDP A;  1O08 A;  1TE2 A;  1ZRM A;  4RQ1 A;  5DKW A;  1YZ6 A;  1SV0 A;  3PZP A;  2F1H A;  2OXO A;  1URJ A;  4A8E A;  3OPX A;  2B51 A;  3V7J A;  2YMP A;  1RQN A;  4WC6 A;  4UAY A;  8ICF A;  3OV7 A;  2EQY A;  1L5U A;  3GIM A;  4EBD A;  1UQV A;  4B9U A;  3WKB A;  2W9B A;  5ALH A;  3T3F A;  2BR0 A;  3QU9 A;  4I2G A;  4YP3 A;  3N7S C;  8ICR A;  7ICT A;  8ICX A;  2B4V A;  2G08 A;  4J9O A;  5KG7 A;  2A1A A;  2W54 A;  1QQ7 A;  4QZA A;  4KB6 A;  3N7P D;  3PST A;  1ZQK A;  3AU2 A;  5J2K A;  3TAD A;  9ICV A;  2ZIX A;  1X9M A;  1SXD A;  3MGI A;  2EZZ A;  3OHA A;  2HHP A;  2QAR B;  5B3P A;  5DQI A;  9ICA A;  4DSK A;  3SMV A;  2M2T A;  3QEB Z;  5DQH A;  2FPM A;  4NLB A;  4O5C A;  4CGZ A;  2VJ4 A;  3UM9 A;  3PHZ A;  4Y2T A;  2OCE A;  5B66 U;  3NKU A;  4J9Q A;  4UB1 A;  4DLE A;  3KZX A;  4JMU A;  3RB6 A;  3WFS C;  5EWF A;  5CHE A;  2ZXH A;  5DBB A;  5DB8 A;  8ICS A;  5CFT A;  5H2F U;  1UT8 A;  1DK3 A;  2E8O A;  4WQL A;  4KLQ A;  2JV3 A;  3PO5 A;  2AGO A;  4FH3 A;  3ISB A;  2ZIU B;  5KT2 A;  4Y2Y A;  4UBC A;  3C2K A;  2PMZ C;  2H3F A;  4AT7 A;  4M9L A;  4I2F A;  3V6J A;  4C8K A;  4FHP A;  4C4S A;  2OHF A;  3SEI A;  3F2B A;  2DR9 A;  3UMC A;  1D8B A;  5HC9 A;  2HHT A;  4NWI A;  1X2I A;  3C2L A;  5CJ7 A;  5ALJ A;  2LPE A;  2LBO A;  3K4G A;  4B9S A;  2WF6 A;  5D62 A;  3OVB A;  4UB2 A;  2ZJA A;  1ZET A;  3JPT A;  1KDH A;  4IS7 A;  5AKG A;  2DFL A;  5ALP A;  3UXO A;  2JGA A;  4OAF A;  4RQ3 A;  2GAF D;  3C29 A;  2LYA A;  5KFG A;  4DF4 A;  3FYH A;  1L7M A;  2YQE A;  2WHE A;  3U26 A;  4M9G A;  3T5J A;  4KLT A;  1XS9 D;  2L5Y A;  5AKX A;  1KBU A;  2I6X A;  2IHN A;  3RRG A;  2ZHA A;  3NRZ A;  3PML A;  3J81 j;  4OAI Z;  4MFC A;  1OU5 A;  4RQ5 A;  4F8R A;  3TAC B;  2O5A A;  1NK7 A;  3E0F A;  2H3I A;  3PW4 A;  4O3M A;  3G6V A;  2IHO A;  2WTF A;  4CRX A;  4WH5 A;  2ZH7 A;  2HOQ A;  5AI5 A;  4U6P A;  5KFQ A;  2JZB B;  3A0H U;  2JH1 A;  7ICK A;  2KOB A;  1V85 A;  1JQR A;  3I1Y A;  2RHF A;  2BCV A;  2KZM A;  4NKU A;  1BNP A;  2DL0 A;  4KLJ A;  9ICC A;  1IG6 A;  3RAQ A;  4FHV A;  4IQU A;  1SV4 A;  4K99 A;  5AIC A;  4OJ6 A;  4FHY A;  2QB1 A;  8ICE A;  4R64 A;  3KHL A;  2EWR A;  2GH1 A;  1UPH A;  4YQW A;  4F5P A;  5AIA A;  5CP2 A;  5HRE A;  1N61 A;  3ISD A;  2J6T A;  5J0R A;  1RYR A;  2Y1I A;  3KTQ A;  3PV8 A;  4DL7 A;  3WKC A;  4PGX A;  2VA8 A;  5HRI A;  5DLG A;  2HW3 A;  2ZJ5 A;  2UVR A;  4F5N A;  4CF4 A;  2HVH A;  3PR4 A;  3IV6 A;  5DQG A;  3OWG A;  2ZXI A;  2IBK A;  5KFD A;  4QWD A;  2KJ5 A;  2HDO A;  3V6K A;  1XO1 A;  4DOC A;  4RNN A;  5HRK A;  7ICL A;  4I2B A;  3IN5 A;  4LZD A;  4UW9 A;  5AM0 A;  4EBE A;  1TK8 A;  4AT8 B;  4LZG A;  2G5I B;  4EEL A;  1NZB A;  4RUA A;  4M9N A;  1RYS A;  3R9K A;  1SXE A;  1CUK A;  4FO1 A;  5GTH U;  2KMD A;  5AK4 A;  4UD4 A;  3SYZ A;  3RB4 A;  5HR6 A;  4NKT A;  4ECT A;  3OUY A;  4F5R A;  2LM1 A;  3AU6 A;  4FE3 A;  5AKJ A;  3QU4 A;  2R8J A;  3LQC B;  1DXS A;  4DFP A;  2DBY A;  5KFT A;  5AI0 A;  4O0I A;  2EH9 A;  1GPJ A;  1JRO A;  1ZOL A;  2D8C A;  4C7Y A;  1L7N A;  3GIK A;  1A0P A;  5DDM A;  2B6G A;  1UEV A;  2JMG A;  2ZTC A;  3QXG A;  4IL6 U;  2ZH2 A;  5KFX A;  4EYI B;  4XRH A;  2R8G A;  2XY7 A;  4RQM A;  4FZL A;  3E58 A;  3RJI A;  3HP6 A;  3CP8 A;  3H0L B;  5L9X A;  3HRD D;  3DDH A;  4DO9 A;  4YMO A;  7ICN A;  5KFF A;  1WCN A;  4IRC A;  4EV6 A;  4YR3 A;  4F93 B;  5J2B A;  2Y0S C;  3GIJ A;  1X42 A;  1F0M A;  2DVI A;  1SZP A;  4U7C A;  2VA3 A;  5ALY A;  2YMQ A;  2FPK A;  4ELT A;  5CWR A;  2ID1 A;  3WK7 A;  5DB9 A;  2NV3 A;  2P6R A;  4ECV A;  1ZQU A;  5HRD A;  2NRT A;  1A77 A;  3UMG A;  2QAR A;  5D46 A;  1VDV A;  4X4N A;  4K4I A;  3H3A A;  5ALK A;  5K4L A;  5IIL A;  2MSN A;  1JXE A;  1RDF A;  2K4P A;  3KZI U;  1NK9 A;  3NS1 A;  5IIJ A;  3Q8M A;  4NL9 A;  2FJ6 A;  4X4P A;  2ASJ A;  4ELV A;  1Z4O A;  5J8Y C;  2DPJ A;  4X4V A;  1WOT A;  3ZDA A;  4O3N A;  5AIB A;  4KLS A;  1T3Q A;  3FAH A;  5HR7 A;  1KSP A;  4OAH A;  2RP5 A;  2I1Q A;  4QJF B;  4F71 A;  2Q66 A;  1U47 A;  5AI9 A;  3TI0 A;  2ZIU A;  3ZI4 A;  1BPX A;  1SZH A;  4F5Q A;  3MDA A;  3UPS A;  3PW0 A;  2DPI A;  4PGQ A;  9ICG A;  2WAQ C;  3LDA A;  2QLT A;  1UCV A;  3RJF A;  4ECX A;  3WK4 A;  3RB0 A;  3NYB A;  1ZQD A;  3M8R A;  4KLF A;  4LT6 A;  1ZQR A;  2W7O A;  3TQ1 A;  2ZH8 A;  4EBK A;  2AQ0 A;  1Q46 A;  4NLC A;  5CEH A;  4C8M A;  2ZH4 A;  5J2I A;  4TQR A;  1PK1 B;  2HOF A;  4WC3 A;  1TV9 A;  1Z1B A;  1T94 A;  2EAN A;  2UVW A;  2P35 A;  3A0B U;  5CB1 A;  5J0Y A;  3NUQ A;  1MIW A;  2JRZ A;  4EEB A;  3RB3 A;  2KN7 A;  4UQG A;  3N4M B;  1ED1 A;  5KFL A;  4O5K A;  1JIH A;  4F5O A;  4WOY A;  3HKZ C;  2H3V A;  5F9L A;  2C2D A;  4JLZ A;  3OVA A;  2IMW P;  1COO A;  4WQK A;  5AHX A;  3D2N A;  3RJE A;  1RM6 C;  4MEX A;  5KAF U;  5IIO A;  1KNY A;  1ZYQ A;  3MC1 A;  4JV1 A;  2ZUD A;  2WAQ F;  5HR9 A;  2XGQ A;  5III A;  5L1M A;  4X4O A;  1BNO A;  4QWE A;  3RBD A;  2ASD A;  5DLF A;  1NKC A;  1MC8 A;  4ECU A;  5ALO A;  2LM4 A;  2KK0 A;  1KL9 A;  2JZB A;  4IQW A;  3CK6 A;  4TUS A;  5CHG A;  1ARO P;  7ICF A;  2ZTD A;  2K60 A;  1Z4N A;  2B0C A;  4WC0 A;  3AUO A;  3BQT A;  2AH5 A;  4EZ9 A;  1TAM A;  2NRZ A;  4P2H A;  2KTQ A;  3RF9 A;  2BCU A;  2ZG6 A;  2F76 X;  5J0T A;  3AQL A;  2F1J A;  8ICK A;  5KG1 A;  4GXJ A;  4FS1 A;  2M2V A;  5ALX A;  1LKY B;  4UAZ A;  4J9S A;  3M8S A;  3HKZ F;  3SAH A;  4Z6C A;  4BWJ A;  1L3S A;  4P0Q A;  3GDX A;  1TK0 A;  4O3S A;  5EE9 A;  7ICI A;  9ICQ A;  2KKV A;  2IOH A;  4KTQ A;  2K8B B;  3PNC A;  1COK A;  2WB1 F;  4UD5 A;  4UB5 A;  1ZD4 A;  5F2V O;  5EE0 A;  1ZQP A;  3LWM A;  3F2D A;  4RWQ A;  4DOB A;  2ZTE A;  1Q3U A;  5AKL A;  2MUT A;  5KG3 A;  2Y9U A;  1B0X A;  5KFN A;  4R8U B;  4C0Z A;  4Q43 A;  2F44 A;  2PI5 A;  4AT8 A;  5KG2 A;  4M2Y A;  1ZJN A;  3HJE A;  3QEA Z;  5HHH A;  4DQQ A;  2ZIV B;  1JN3 A;  4EP7 A;  4F91 B;  3WU2 U;  3ISC A;  4IR1 A;  9ICI A;  1ZQQ A;  3RR8 A;  4B6J A;  5ALQ A;  1UET A;  5J2F A;  1R89 A;  2AGP A;  2K89 A;  3M6Z A;  4I2J A;  3V6H A;  4F50 A;  4ECQ A;  5J0P A;  4NXW A;  3NVV A;  3BZK A;  4DFK A;  4DQR A;  1MSW D;  3HIY A;  1K1Q A;  4NLG A;  4QWC A;  4YCX A;  5HRH A;  4NJ8 A;  2KIV A;  8ICI A;  1N2X A;  1X66 A;  3BQ1 A;  1ZQJ A;  1KFT A;  4OJP A;  2M2U A;  1VJ7 A;  2B56 A;  1HUO A;  1QSL A;  5AM4 A;  4G9B A;  4I29 A; 
#chains in the Genus database with same CATH homology
 3OVB A;  1UEU A;  4QZH A;  4UB2 A;  5HRB A;  3BQ2 A;  2ZJA A;  3V7K A;  1V9P A;  3JPT A;  3JPQ A;  1ZET A;  1WCL A;  1KDH A;  4BXO B;  3HX0 A;  3AQN A;  2DFL A;  4KLL A;  4IQT A;  3UXO A;  3Q8Q B;  3TAR A;  1T4G A;  4UAW A;  4DL2 A;  3EW9 A;  4E0D A;  2B21 A;  4RQ3 A;  2W9M A;  1L3T A;  1H38 A;  4Q8E A;  1F5A A;  3B0X A;  4P4O A;  5KFG A;  4DF4 A;  1DOQ A;  3THV A;  2BCR A;  5KFU A;  2R8I A;  3OUY B;  3FYH A;  3C66 A;  1EXN A;  3RH4 A;  4UB4 A;  4BDP A;  4M9G A;  3UPQ A;  3T5J A;  3C21 A;  4KLT A;  3TFS A;  4DLG A;  4J9L A;  4F4X A;  2BQR A;  1XS9 D;  2Q0Z X;  4Z6D A;  5KT5 A;  4EEY A;  2NRX A;  3PMN A;  5EWG A;  3AQM A;  3MR6 A;  4M9H A;  4RPY A;  4GXK A;  2IHN A;  3RRG A;  1NKB A;  5KFW A;  2RDI A;  4UB3 A;  3JPR A;  1N56 A;  2J6S A;  4E8F A;  3EZ5 A;  2ZHA A;  5HHI A;  1JMS A;  4QWB A;  3PML A;  4BGD A;  1S77 D;  9ICX A;  4YG2 A;  1Y88 A;  4P4P A;  2BGW A;  4X0B A;  4J9M A;  4MFC A;  1XSL A;  4ED0 A;  1OU5 A;  4RQ5 A;  4F8R A;  5DG7 A;  7ICJ A;  4PHE A;  4ECW A;  2O5A A;  1NK7 A;  4EZ6 A;  4M5D A;  1ZQZ A;  1S76 D;  3RJH A;  4QZD A;  1S9F A;  2FLN A;  9ICS A;  1SL1 A;  3PW4 A;  4RZR A;  2ZH3 A;  4O3P A;  3G6V A;  2DR8 A;  2WTF A;  3ORY A;  4X5V A;  4FHX A;  3JPN A;  4F2S A;  1NJW A;  4QW8 A;  1DK2 A;  2ZH7 A;  1U49 A;  4PHP A;  4DOA A;  1MQ2 A;  3H8S A;  4F2R A;  8ICP A;  4FS2 A;  5KFV A;  4JWN A;  4GLX A;  2UVU A;  3C23 A;  2ZH6 A;  2V4Q A;  4J9P A;  3T5L A;  3Q8K A;  2A1J A;  3Q8R B;  5L1K A;  3HJ1 A;  5KFQ A;  3MFH A;  4MF8 A;  5J0W A;  2JZB B;  4DSJ A;  4KLM A;  7ICK A;  4KIT B;  3EPG A;  1XSP A;  4KLO A;  4MF2 A;  3MDC A;  1JQR A;  4ECR A;  2MAX A;  2BCV A;  2OWO A;  4ELU A;  4NLZ A;  2KZM A;  4KLH A;  9ICC A;  4KLJ A;  2AQ4 A;  2HVI A;  9ICN A;  2KP7 A;  1BNP A;  3WFP A;  4I2I A;  3RAQ A;  5L1J A;  9ICW A;  4IQU A;  4FHV A;  1HUZ A;  3LWL A;  2DRB A;  1KRP A;  3MGH A;  5KTQ A;  4PGY A;  4NY8 A;  4QZF A;  2BE3 A;  4RWO A;  4FHY A;  3H37 A;  3RR7 A;  2W9B B;  8ICE A;  4R64 A;  4HYK A;  4WC2 A;  4YXM A;  1FA0 A;  4X4U A;  1RPL A;  3MBY A;  4ED3 A;  5KFZ A;  3B0Y A;  3KHL A;  4DFM A;  4FO6 A;  4DS5 A;  2PFO A;  3EPI A;  4KN4 A;  4YQW A;  4F5P A;  1TKD A;  4YXJ A;  2VA2 A;  2LYH A;  4J9R A;  2PFN A;  1XU4 A;  5CP2 A;  5KFO A;  5HRE A;  4WCW A;  4YR0 A;  5D4B A;  3ZD8 A;  2JEG A;  5KT7 A;  4DSF A;  3ISD A;  4B9S A;  4IRK A;  3PVX A;  4IR9 A;  5HRL A;  2J6T A;  2HHX A;  2GWS A;  5J0R A;  1RYR A;  4X4R A;  4F4K A;  1JXL A;  7ICQ A;  2BHN A;  5DGB A;  2Y1I A;  3KTQ A;  3PV8 A;  3TFR A;  3C1Y A;  2UVV A;  2HHS A;  3PX4 A;  1KFS A;  3Q8P B;  4DL7 A;  5DBC A;  2VA8 A;  4PGX A;  5DLG A;  4RPX A;  3GV7 B;  3JPS A;  1NK4 A;  2HW3 A;  5HRI A;  1U45 A;  3LK9 A;  3OGU A;  2ZJ5 A;  3ZDE A;  2I9G A;  1D9D A;  1BPZ A;  2UVR A;  3HJ4 A;  4F5N A;  4I2C A;  9ICE A;  4B9T A;  2HVH A;  4XUS A;  4RQ4 A;  3PR4 A;  5DQG A;  4F4Z A;  1C7Y A;  2IBK A;  2FMP A;  2PBE A;  5KFD A;  1Z00 B;  4QWD A;  3JZ0 A;  1B43 A;  4F4W A;  5HP4 A;  3TAQ A;  3V6K A;  4IG8 A;  3QZ8 A;  1XO1 A;  3OJS A;  4RNN A;  4DOC A;  1NJX A;  4DL3 A;  5HRK A;  7ICL A;  2P6U A;  3BJY A;  5KG0 A;  7ICH A;  9ICT A;  5KFB A;  1UT5 A;  3SZ2 A;  1B22 A;  4J9K A;  4I2B A;  2HHV A;  2BPF A;  3PX0 A;  3C5G A;  1L3U A;  2BPG A;  4FHW A;  4LZD A;  1DGS A;  4PHD A;  1S0N A;  2PFP A;  8ICN A;  3WFQ E;  1ZQM A;  3H8W A;  3JPO A;  4EBE A;  1TK8 A;  1ZQI A;  3PW2 A;  4WC1 A;  4LZG A;  9ICK A;  2PI4 A;  4AT8 B;  4GC7 A;  4RQ6 A;  2XGP A;  4CCH A;  4BXO A;  4RUA A;  2NRK A;  4M9N A;  1RYS A;  3UXP A;  5KFM A;  5KFE A;  3HWT A;  4LVS A;  4EBJ A;  4YFK A;  3FDS A;  4F3O A;  3RAX A;  3RRH A;  1CUK A;  5HML A;  2W9C B;  2XY5 A;  5DB6 A;  4RQ8 A;  3OSP A;  5HNK A;  5KFA A;  3SYZ A;  3RB4 A;  1D8Y A;  4I2E A;  4NKT A;  4J9N A;  4ECT A;  3OUY A;  4F5R A;  5J2G A;  2W8K A;  3AU6 A;  2R8J A;  2KZZ A;  3LQC B;  1R8C A;  3AQK A;  1SKW A;  5TZV A;  4DFP A;  5HMM A;  1NK0 A;  5KFT A;  4MFF A;  1HJP A;  4O0I A;  5DG8 A;  3H7I A;  5J0X A;  2J6U A;  2XY6 A;  5J2A A;  4Q8F A;  2FLP A;  4XQ7 A;  1RXV A;  5BOM A;  4AT7 B;  1ZQA A;  1ZQW A;  1U4B A;  3GIK A;  1TK5 A;  5DDM A;  3WFO A;  1UEV A;  4DS4 A;  3PO4 A;  2ZTC A;  4NXZ A;  7ICP A;  3K75 D;  4RQ7 A;  4ED2 A;  3OVS A;  4O3Q A;  2JEJ A;  1XC9 A;  4DFJ A;  2ZH2 A;  5F9N A;  1UA0 A;  4M6W B;  1BPB A;  5KFX A;  4EYI B;  1MQ3 A;  8ICJ A;  8ICM A;  4XRH A;  3PW7 A;  1TVA A;  1U48 A;  2R8G A;  2XY7 A;  5J2H A;  5IIN A;  4KN7 A;  5J29 A;  3RJI A;  3HP6 A;  4KLG A;  1KEJ A;  1VFG A;  3RH5 A;  5L1I A;  5L9X A;  5BPC A;  5KFC A;  1X9S A;  4DO9 A;  5DBA A;  5KFY A;  4TUQ A;  4YN4 A;  4RWN A;  1QSY A;  4KLE A;  8ICL A;  4YMO A;  4M47 A;  7ICN A;  5KFF A;  1WCN A;  1ZQG A;  4IRC A;  4I2A A;  8ICQ A;  3RJJ A;  4YR3 A;  4F93 B;  5J2B A;  5L1L A;  4EYH B;  3GIJ A;  3GQC A;  1XSN A;  4B9N A;  1CEZ A;  5DB7 A;  1SKS A;  2ALZ A;  2DVI A;  2ZUC A;  1D8L A;  1SZP A;  8ICZ A;  2VA3 A;  2FPK A;  4ELT A;  2RDJ A;  5CWR A;  4YR2 A;  1ZQH A;  1T3N A;  2ID1 A;  3UXN A;  5DB9 A;  4F4Y A;  3T5H A;  2R8K A;  2XC9 A;  1N48 A;  2P6R A;  3M9N B;  4ECV A;  1ZQY A;  4DQI A;  5HRG A;  1NO5 A;  2ZH5 A;  4Z6F A;  1ZQU A;  3G6X A;  4C8O A;  2NRT A;  1A77 A;  3GV8 B;  4IQV A;  3RJG A;  4PPX A;  5HRD A;  4QW9 A;  1ZQX A;  5D46 A;  3RJK A;  4C8L A;  2V9W A;  4X4N A;  5IIM A;  4XA5 A;  2BPC A;  7ICU A;  3H4D A;  2PFQ A;  1IM4 A;  5EWE A;  5DGA A;  4K4I A;  4NM1 A;  3H3A A;  1BGX T;  5IIL A;  2NRW A;  1JXE A;  1K1S A;  1BPE A;  7ICE A;  2IHM A;  1RZT A;  3TAN A;  1ZQB A;  1NK9 A;  5IIJ A;  4QZ9 A;  1SL0 A;  3ZDB A;  4C8N A;  5D49 A;  3SV3 A;  3UQ2 A;  3T5K A;  3Q8M A;  7ICM A;  4RQ0 A;  4E80 A;  3C1Z A;  1UA1 A;  1BPY A;  5KG6 A;  2AU0 A;  3IHQ B;  9ICL A;  4R8U A;  5JUM A;  4AT9 B;  4F92 B;  2ASJ A;  4X4P A;  8ICH A;  1TFW A;  3KHR A;  4DQP A;  4ELV A;  5BOL A;  2DPJ A;  4X4V A;  3UQ0 A;  1WOT A;  3JPP A;  3ZDA A;  4Q45 A;  1LB2 B;  4O3N A;  4KLS A;  4DEZ A;  1TFR A;  3ETL A;  1U9L A;  5J0U A;  4FBT A;  1RXW A;  3PW5 A;  2ZHB A;  4DL4 A;  3PX6 A;  1KSP A;  1Z3E B;  3C2M A;  5DED A;  4ATB A;  2BCS A;  2I1Q A;  2Q66 A;  4RWP A;  4MFA A;  2W9A A;  2KFN A;  1U47 A;  1NJY A;  4B9M A;  3TI0 A;  2VAN A;  5KFI A;  1ZQL A;  1KFD A;  5C5J A;  1TAQ A;  5KT3 A;  2BKE A;  5KFJ A;  4RUC A;  1BPX A;  3NTU A;  2DR7 A;  4O5E A;  8ICT A;  4F5Q A;  4K4H A;  3MDA A;  3G6Y A;  3UPS A;  3EYZ A;  3PW0 A;  2Y1J A;  4QZ8 A;  2DPI A;  4GXI A;  4PGQ A;  1X9W A;  9ICG A;  3RTV A;  2O1P A;  3L9D A;  3LDA A;  3KHG A;  4O3R A;  2C2E A;  4RNO A;  3RJF A;  4BWM A;  4Z6E A;  2F1I A;  3V7L A;  4ECX A;  1L3V A;  4IRD A;  4M0A A;  5HRF A;  4X4S A;  4QZB A;  1ZQO A;  4RQ2 A;  3OJU A;  3RB0 A;  4UBB A;  1NOM A;  1S0V A;  5KFP A;  4ZH4 A;  3H40 A;  3NYB A;  1ZQD A;  3M8R A;  5CR0 A;  1PX5 A;  4KLF A;  4EBC A;  4LT6 A;  1ZQR A;  2MUT B;  1TAU A;  1MIV A;  3ZD9 A;  1QLN A;  4NLK A;  3TQ1 A;  2ZH8 A;  4EBK A;  3RBE A;  4QZG A;  4B9V A;  2AGQ A;  5DEC A;  2AQ0 A;  4WC5 A;  3BQ0 A;  4RU9 A;  1BPD A;  3KHH A;  4C8M A;  5J0S A;  4X4T A;  2ZH4 A;  4PH5 A;  5J2I A;  1ZJM A;  4NKU A;  8ICB A;  1TFY A;  4TQR A;  3M9O B;  4WC3 A;  5CA7 A;  4E7X A;  1TV9 A;  5J2E A;  1NJZ A;  4PHA A;  4ECZ A;  1NKE A;  2UVW A;  4JV0 A;  4ED1 A;  3EWA A;  5KFR A;  5CB1 A;  5J0Y A;  3MR2 A;  3QZ7 A;  1MIW A;  1MIY A;  1PZN A;  4I2D A;  1KLN A;  8ICW A;  1S0M A;  3MFI A;  4DSI A;  3RB3 A;  1ZQN A;  4QZC A;  4YMN A;  5KFH A;  2KN7 A;  4ECS A;  4DQS A;  4DF8 A;  2P66 A;  3BDP A;  4UQG A;  3H4B A;  3N4M B;  8ICO A;  1R8B A;  8ICG A;  2KZ3 A;  5KFL A;  4M9J A;  4O5K A;  1JIH A;  2R8H A;  2FMQ A;  4F5O A;  4DSE A;  4KMU A;  2RFF A;  3TAP A;  5F9L A;  4RPZ A;  9ICH A;  2C2D A;  3OVA A;  2IMW P;  9ICR A;  1IXR A;  4R63 A;  1COO A;  4R66 A;  1ZQS A;  2M9N A;  3RJE A;  3IM1 A;  1Q79 A;  8ICY A;  8ICU A;  8ICC A;  1ZQF A;  4MEX A;  5KG4 A;  5IIO A;  1KNY A;  4FBU A;  1ZYQ A;  3WFR E;  5J2D A;  2PXI A;  4YD1 A;  3NGD A;  3OHB A;  4ECY A;  4I28 A;  2AJQ A;  3GII A;  1ZQC A;  3V72 A;  4JV1 A;  2ZUD A;  5J0O A;  5J2C A;  4QZI A;  3Q8L A;  1S97 A;  1S0O A;  4RT3 A;  1QSS A;  5HR9 A;  4MEY A;  5III A;  2XGQ A;  1NK8 A;  1LV5 A;  4X4Q A;  4X4O A;  4RT2 A;  9ICB A;  3SI8 A;  1SL2 A;  1BNO A;  3ZDC A;  4S3N A;  4QWE A;  2BDP A;  3RBD A;  2ASD A;  2V4R A;  5DLF A;  1T8E A;  4M9L A;  1NKC A;  4JV2 A;  1BVS A;  5DKW A;  1MC8 A;  4RQ1 A;  2XO7 A;  4R65 A;  4ECU A;  2JEI A;  7ICO A;  4DL6 A;  1V4A A;  2F1H A;  2JZB A;  4IQW A;  4NLN A;  4TQS A;  4TUS A;  5CHG A;  3V7J A;  1SKR A;  1ARO P;  4Q44 A;  4DWI A;  7ICF A;  4TUR A;  2ZTD A;  2IA6 A;  4WC6 A;  3C5F A;  1NK5 A;  3AUO A;  3BQT A;  3JYY A;  7ICR A;  4UAY A;  8ICF A;  4WC0 A;  2ISP A;  4EZ9 A;  4NM2 A;  3OV7 A;  2HHQ A;  2KFZ A;  7ICV A;  5KG5 A;  2NRZ A;  1L5U A;  3GIM A;  4EBD A;  4KLI A;  4B9U A;  4YMM A;  4KLD A;  4P2H A;  4QWA A;  2W9B A;  3T3F A;  5KFS A;  2BR0 A;  1ZQE A;  5KT6 A;  2KTQ A;  9ICP A;  4I2G A;  4AT9 A;  2BCU A;  4YP3 A;  2C28 A;  4KLU A;  1ZQT A;  8ICR A;  2ZH1 A;  7ICG A;  7ICT A;  1ZQV A;  8ICX A;  4J9O A;  4I2H A;  3H39 A;  5KG7 A;  5J0T A;  3AQL A;  4TUP A;  2F1J A;  8ICK A;  5KG1 A;  4GXJ A;  4FS1 A;  4GC6 A;  2M2V A;  4QZA A;  4UAZ A;  2BQU A;  4J9S A;  3M8S A;  4ED7 A;  2ATL A;  1NK6 A;  2BQ3 A;  4O3O A;  2M2W A;  2C2R A;  1JAJ A;  1ZQK A;  4Z6C A;  2ISO A;  3MAB A;  3AU2 A;  4BWJ A;  4JUZ A;  5J2K A;  1L3S A;  4DSL A;  4JWM A;  1X9M A;  9ICV A;  3GDX A;  7ICS A;  1TK0 A;  4O3S A;  7ICI A;  9ICQ A;  3H38 A;  4B9L A;  2DRA A;  2ZH9 A;  4KTQ A;  1S10 A;  3MGI A;  3OHA A;  2A1J B;  3PNC A;  2HHW A;  2HHP A;  3ZDD A;  4WC4 A;  3RH6 A;  5DQI A;  9ICA A;  4DSK A;  4X0A A;  2M2T A;  3HPO A;  3QEB Z;  9ICF A;  4UB5 A;  4UD5 A;  1Z00 A;  5DQH A;  5F2V O;  2FPM A;  1ZQP A;  3LWM A;  4RNM A;  4O5C A;  4RWQ A;  4DOB A;  5KT4 A;  2HHU A;  9ICU A;  3PY8 A;  8ICA A;  2ZTE A;  1A76 A;  2XCA A;  5KFK A;  2MUT A;  4G3I A;  5KG3 A;  4WBY A;  1XWL A;  4J9Q A;  4UB1 A;  4DLE A;  5KFN A;  4R8U B;  3RB6 A;  4Q43 A;  4YD2 A;  3WFS C;  5EWF A;  2FLL A;  2PI5 A;  2W8L A;  4AT8 A;  5KG2 A;  5J2J A;  4M2Y A;  1ZJN A;  3H8J A;  4O9M A;  5DBB A;  5DB8 A;  3QEA Z;  2FMS A;  5HHH A;  4ED6 A;  8ICS A;  4DQQ A;  1JN3 A;  3GIL A;  4EP7 A;  4F91 B;  1UT8 A;  2DR5 A;  2BCQ A;  4ATB B;  2C22 A;  2W9C A;  2NRV A;  4QZE A;  1DK3 A;  3GFK B;  3ISC A;  3GV5 B;  3N97 B;  4IR1 A;  4KLQ A;  9ICI A;  3MR5 A;  1QTM A;  3OSN A;  3PR5 B;  4DL5 A;  3M9M B;  2AGO A;  1ZQQ A;  3PO5 A;  3RR8 A;  4FH3 A;  1YLQ A;  3C18 A;  3ISB A;  1T7P A;  5KT2 A;  4UBC A;  2JEF A;  5J2F A;  3C2K A;  1R89 A;  1UET A;  3MR3 A;  2AGP A;  9ICJ A;  4WBZ A;  9ICM A;  5DDY A;  4I2J A;  4AT7 A;  3Q8S B;  1R8A A;  2FPL A;  4XQ8 A;  5DG9 A;  3V6J A;  4I2F A;  3V6H A;  5EOZ A;  4F50 A;  5IIK A;  4P4M A;  1D9F A;  4ECQ A;  4YVZ A;  4C8K A;  4FHP A;  4UD4 A;  8ICV A;  4WC7 A;  5J0P A;  3HW8 A;  3HIY A;  4DFK A;  4DQR A;  1MSW D;  1JX4 A;  4I27 A;  2DR9 A;  1K1Q A;  4NLG A;  1Q78 A;  3QE9 Y;  4K4G A;  3HT3 A;  5HC9 A;  2ZJ8 A;  2ASL A;  2HHT A;  4QWC A;  4ED8 A;  4YCX A;  1X2I A;  9ICO A;  3C2L A;  5HRH A;  4JK1 A;  4M6W A;  5CJ7 A;  3SV4 A;  8ICI A;  3BQ1 A;  5J0Q A;  1ZQJ A;  1KTQ A;  1KFT A;  3E2E A;  1NZP A;  2ZUB A;  2M2U A;  1VJ7 A;  1HUO A;  4FH5 A;  1QSL A;  2XCP A;  3K4G A;  4I29 A;  4M04 A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...