5BPCA

Dna polymerase beta ternary complex with a templating 5clc and incoming datp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, ligase/dna
total genus 111
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bpcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bpcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bpcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bpcA03
1JN3A 1RXVA 1MIWA 2AU0A 2BCVA 1XSLA 4Q45A 4C8MA 4DL2A 4QZHA 4QZAA 2LYHA 1YLQA 2Y1JA 9ICBA 3B0YA 4I2BA 1X2IA 5KFXA 3UXNA 4R65A 1U4BA 3UPQA 3SI8A 4XQ7A 2HHTA 1N48A 3QE9Y 4R8UA 4PHPA 3PR4A 4X4VA 4FBUA 4YD2A 1KDHA 1R89A 4UQGA 1ZQIA 1DK3A 5J0RA 5KFDA 4YMMA 3ISCA 1RYRA 4I2CA 5IIIA 5DB6A 4RQ8A 1UA0A 1DGSA 4IQUA 4WBYA 3M9OB 4ED1A 3V7KA 3MFHA 1NK9A 2KZMA 4MF2A 2F1JA 1ZQEA 9ICKA 4XRHA 4F93B 1T7PA 3BJYA 4YCXA 3FYHA 4RU9A 5DBCA 2XGQA 5J2BA 2FLPA 3H8SA 2I9GA 9ICVA 4BGDA 5KG3A 4DF4A 3LWMA 1QSLA 4M47A 8ICRA 5KG7A 2UVRA 7ICSA 3PV8A 4WBZA 3TANA 3C1YA 4EYIB 2JEJA 4E0DA 4EBDA 5KG5A 4ECUA 4QWAA 1ZQLA 2JEIA 4RQ4A 2FLLA 4R63A 2A1JA 1NJZA 1KSPA 1S77D 3AQNA 2DR8A 4X0BA 3V7JA 2J6UA 5HRKA 3MR5A 1Q78A 2W9MA 4TURA 2BCSA 1D9DA 2VANA 3HPOA 1L3TA 2ATLA 5D46A 3G6VA 4IR9A 5J29A 4I2EA 4PGQA 4PHAA 4O3SA 4M9NA 2FLNA 3Q8RB 4B9VA 5KFUA 4KN7A 1XO1A 4KLHA 7ICRA 3GDXA 1BGXT 7ICNA 2C2EA 2FMQA 9ICHA 3PW4A 2M2TA 5DB9A 3ISDA 9ICNA 3EW9A 1UT5A 1T4GA 1CEZA 3PW5A 4KLEA 4ELUA 8ICNA 5KFBA 2NRXA 4Z6CA 1ZQUA 4MF8A 1RYSA 4JWNA 8ICUA 3K75D 1HJPA 9ICIA 2BKEA 1ZQMA 2W9BA 5EOZA 5KT6A 2P6UA 5HNKA 1ZQDA 5KT3A 4K4IA 5KFGA 4FBTA 4M2YA 3H37A 4X4TA 5BOMA 1ZQSA 3RJHA 3ZDCA 5KFEA 4YR3A 1U45A 3RR8A 5DQGA 4Z6EA 3HP6A 4KLFA 5HRIA 8ICQA 3C66A 3OJUA 5J2GA 3M8SA 1X9SA 3PR5B 4RWQA 5KFWA 2V9WA 5DQIA 3H3AA 4IR1A 1S0NA 1A76A 4IQTA 1FA0A 2O1PA 3GV8B 2NRWA 5DG8A 4F91B 4X5VA 4F4WA 1NKEA 5IIOA 3OJSA 9ICCA 5HRLA 4S3NA 1NK5A 4QZCA 3ZD9A 5HRBA 4IQVA 4J9KA 3RJGA 2F1HA 4DQIA 3RJKA 1NK4A 1ZQBA 5J0PA 2ZTCA 2BCRA 3BQ0A 3AU2A 2MUTA 4M6WB 4JUZA 4J9LA 4ED0A 1UEVA 1UT8A 3MBYA 2FPLA 3PW0A 5HP4A 4X0AA 2BPCA 1XWLA 4XQ8A 3RH6A 4UD5A 9ICWA 5KFZA 4LVSA 4NKTA 2DVIA 4XUSA 1VFGA 5J0YA 1R8CA 3OGUA 1JX4A 4DSFA 2NRKA 8ICTA 2ASDA 3M9NB 2BPFA 5KFKA 4F5PA 3SYZA 1MSWD 4FHVA 1U49A 1RZTA 3GV7B 4FH3A 3H8JA 1X9MA 3H8WA 1ZQWA 5KFVA 4ECYA 4JV1A 2Y1IA 3UXPA 4RZRA 3GIKA 4JV2A 4MFCA 2UVWA 1KNYA 4ECWA 3OVAA 1BVSA 3N4MB 1ZQFA 1KLNA 4P4OA 2ZUBA 4EEYA 4F2RA 4QZEA 4ECXA 2F1IA 1ZQJA 3C23A 2ZH1A 1NJYA 4IRDA 1OU5A 3OSNA 4DLGA 4JWMA 4AT9B 2W8LA 1PX5A 4O3QA 4UB5A 4DOAA 1MIVA 3GIIA 4QWBA 4YP3A 4YQWA 1T3NA 5KG1A 5J0OA 1TK5A 1TKDA 1S97A 2PFPA 4KLOA 4DQPA 4Z6DA 8ICGA 3SV4A 4UAZA 2HHXA 2C28A 9ICSA 4QZ9A 4IRKA 2RFFA 3G6YA 1S0OA 3PNCA 2BR0A 3PMNA 1SL2A 2BGWA 4EYHB 4FO6A 4DFKA 5KFPA 1BPXA 1ZQHA 1QTMA 2KZZA 1ZYQA 1KFSA 8ICCA 3PO5A 3EWAA 4YMNA 4KLMA 3V6KA 4MEXA 4EBCA 4FS2A 3Q8MA 4WC1A 3MABA 3AQKA 5KFIA 4O3PA 1ZQPA 2B21A 4C8NA 1T8EA 4BXOB 3QEAZ 4Q8FA 5KFMA 2PFQA 5DECA 3M8RA 1JIHA 5D4BA 3RAXA 9ICPA 3HW8A 4YFKA 4TUPA 1EXNA 5IINA 9ICTA 3PO4A 4J9OA 3THVA 9ICOA 4WCWA 3NTUA 2ZTDA 2BHNA 4KLUA 4RPZA 4B9LA 9ICRA 4BWJA 5J2HA 4QZFA 2Q66A 1V9PA 5F9NA 1LB2B 3WFOA 3OUYB 4DWIA 7ICEA 2RDIA 4QZIA 4O0IA 4NKUA 8ICKA 3H4DA 1F5AA 4NM2A 4RQ0A 4NM1A 2R8IA 4WC3A 5DKWA 2HHSA 4GC6A 3GV5B 4GXKA 2RDJA 1ZQKA 2GWSA 5CP2A 8ICZA 2ZH2A 3WFRE 5HREA 5J2IA 4GC7A 4IRCA 3EZ5A 4I2HA 5KFHA 3UQ2A 5BOLA 2KFNA 4MFAA 8ICFA 3GILA 4F4KA 5F9LA 2C2RA 4WC6A 2VA3A 3MFIA 4YMOA 8ICEA 4WC4A 5JUMA 5DGBA 4O5EA 4KTQA 7ICUA 3LDAA 4IQWA 4UB4A 4YVZA 3GIMA 3IHQB 4DLEA 3T5HA 4F5NA 4DFJA 3NGDA 2BQRA 1BPDA 4KLIA 4B9SA 2XO7A 3G6XA 5J2JA 8ICHA 2MAXA 5L1JA 5J2EA 2HHPA 4ZH4A 2NRZA 3KHRA 5C5JA 3HWTA 4LZGA 3TI0A 5DG7A 3UQ0A 1DOQA 1TFRA 1H38A 2JEGA 3TFRA 5J0UA 9ICAA 2FPKA 2ISPA 5DEDA 5BPCA 4AT8B 3T5LA 5HMMA 4Q44A 3ZDDA 4WC7A 2XY5A 1NK7A 1U48A 4QZBA 4J9RA 4DSEA 1K1SA 4F4YA 4QZDA 4TUQA 2ALZA 8ICJA 4LZDA 4RQ3A 4DOCA 7ICVA 2R8KA 1JXEA 1ZJMA 4ECSA 2NRVA 2P6RA 4EZ9A 4X4NA 1SKSA 4YD1A 3JPPA 3T5KA 5EWGA 5KFSA 4QZ8A 2ZUDA 4DL3A 1L5UA 4P4PA 5KFRA 1ZQOA 5J0TA 2OWOA 4B9MA 5CR0A 1A77A 1AROP 7ICHA 3MR3A 4FS1A 3LK9A 4HYKA 2ZTEA 5KTQA 1BPBA 3ZDBA 4M04A 3TARA 1S0VA 4KN4A 1XU4A 1ZQTA 9ICXA 1DK2A 2AGQA 2I1QA 1MC8A 3V6JA 2XY7A 2ZH3A 5KFYA 5D49A 4QWEA 4DFPA 4J9PA 4DSIA 3JPTA 1S10A 4C8KA 2ZUCA 2C22A 5KT7A 3BDPA 3KTQA 4NLKA 9ICUA 3JPSA 5DGAA 5IILA 5HHIA 4F5OA 3RB4A 1ZQZA 4NY8A 4KLQA 4WC5A 1UETA 2ZJ8A 2AGOA 5KFOA 4R64A 1TAQA 1SL1A 3EPIA 1JXLA 4YG2A 2W9CB 4KLTA 4ECZA 4ELTA 4I28A 4ED8A 4NLZA 3EPGA 4BWMA 5IIMA 2BCUA 2PFNA 5L9XA 5CJ7A 3MR6A 2C2DA 4C8OA 1R8AA 1RXWA 7ICIA 4EBKA 5J0QA 3WFPA 5DDMA 3V72A 5KT5A 4FHYA 4DQSA 5KG6A 8ICSA 5L1IA 4F3OA 3RH5A 2M2WA 4M6WA 8ICOA 3HJ1A 4ECRA 1XSNA 1LV5A 2HHUA 4QWCA 2DFLA 2VA8A 3OVSA 1V4AA 4F4ZA 4ED2A 3OHBA 1JMSA 7ICQA 3JYYA 3Q8SB 2JZBA 3RR7A 1NOMA 4O3NA 2VA2A 8ICBA 3QEBZ 3OSPA 4I2FA 1Z00B 2BQ3A 1ZQCA 4M9HA 5KT2A 5KG2A 7ICLA 4X4OA 4KMUA 5KFAA 1TK8A 2ZHBA 4EZ6A 2ZJAA 4PHEA 1XSPA 1TK0A 1D8LA 1D8YA 2H5XA 4RQ1A 4DL6A 4EBJA 5DDYA 3RBEA 1B43A 2ZJ5A 2BE3A 4UAYA 4TQSA 2R8HA 4X4SA 3BQTA 3MDAA 1XC9A 4IG8A 5CA7A 3UPSA 3JPNA 4AT9A 4X4PA 5EWFA 4ATBB 2FPMA 1KTQA 5J2AA 3RBDA 4DSLA 3N97B 4DEZA 3KHGA 4EP7A 5IIKA 1S76D 4RQ7A 2UVUA 4AT7B 1RPLA 4RUCA 2PXIA 5HMLA 4YN4A 2XY6A 1S9FA 4FH5A 2AQ4A 3H38A 3C2KA 4TQRA 2R8JA 1NJWA 4X4RA 3RB6A 3PY8A 5J0WA 4RUAA 4CCHA 2IHMA 2AQ0A 5HRGA 2M9NA 3MGIA 3PX4A 3Q8QB 2XCPA 7ICPA 2W9AA 2M2VA 4ED3A 5KFNA 4F50A 3TFSA 9ICJA 4F4XA 3PX0A 1NKBA 4RWPA 4F2SA 4UBCA 4TUSA 2DPJA 9ICQA 2PBEA 2KN7A 4BXOA 3T3FA 2BCQA 2ASLA 1JQRA 2HHVA 4K4GA 5J2CA 1PZNA 2ASJA 2DRBA 5DLGA 5IIJA 3LWLA 4B9UA 1KEJA 2ZHAA 3ZD8A 1XS9D 5TZVA 4LT6A 3FDSA 4GXIA 2HVHA 1Z3EB 5CHGA 4M9GA 4ED7A 3MGHA 3LQCB 3OUYA 4QW9A 2AJQA 4R8UB 4YR2A 1D9FA 1X9WA 2IHNA 3HJ4A 1TAUA 2JEFA 4F5RA 4ECTA 5HHHA 1CUKA 1HUZA 4M9JA 8ICYA 3RJEA 2P66A 2DR7A 1HUOA 4DS4A 4QWDA 5KG0A 4PGXA 4R66A 4I29A 1NK6A 3RRGA 1BNPA 3WFSC 5J0XA 5HRDA 5KT4A 2XC9A 2V4QA 9ICMA 1MIYA 3MR2A 1WOTA 4J9NA 4NLGA 4O9MA 3JPQA 7ICOA 2ZH7A 4KLSA 1SL0A 3OV7A 4F92B 3RRHA 3KHLA 3ZDEA 1SKWA 1ZQRA 5L1LA 4B9TA 4M5DA 1KFTA 4WC2A 1ZQXA 1WCLA 3V7LA 3TQ1A 2J6SA 3C21A 5KFJA 5HR9A 1ZQGA 3C2MA 3C18A 4RNOA 4J9SA 3SV3A 4E80A 5HRHA 1TVAA 5DB7A 8ICXA 4G3IA 4FHPA 4DL5A 4DQQA 5CB1A 4RQ6A 1C7YA 1BPYA 2FMSA 3GQCA 2HHQA 5KFTA 4UBBA 4AT8A 2BQUA 2A1JB 2IA6A 8ICAA 4WC0A 3PW2A 2DR5A 3RH4A 3RTVA 3AU6A 4Q8EA 2DRAA 5L1KA 4JV0A 3JZ0A 3V6HA 4UB3A 4PH5A 3EYZA 3RB3A 4P2HA 7ICMA 1ZJNA 4K4HA 1VJ7A 4RQ5A 3OHAA 1MQ3A 4O5KA 3Q8KA 1R8BA 4UD4A 4MEYA 4NXZA 4QW8A 5KFLA 4YXJA 4RT3A 3BQ2A 5CWRA 1ZQVA 3RAQA 1MQ2A 2BDPA 4I2GA 5DB8A 4NLNA 4RNMA 5J2KA 1N56A 7ICFA 1SZPA 3JPOA 3C5FA 4RPXA 2HW3A 9ICGA 3AQLA 3TAQA 2PFOA 4B9NA 1ZQYA 3QZ7A 1NJXA 8ICPA 3WFQE 1ZETA 5DBAA 7ICGA 3Q8PB 1WCNA 3AQMA 1ZQNA 2W9BB 2ZH8A 8ICIA 4UAWA 4M9LA 9ICEA 8ICLA 4DQRA 3ETLA 3H39A 3L9DA 3C1ZA 3PMLA 4O5CA 3C5GA 4XA5A 4KITB 3MDCA 3E2EA 1IM4A 4JK1A 5DG9A 3HX0A 2W9CA 7ICJA 2KP7A 1NKCA 2PI4A 5EWEA 3QZ8A 4GLXA 4YXMA 1QSSA 3ZDAA 2KFZA 3C2LA 1U9LA 2V4RA 2O5AA 1S0MA 3B0XA 4E7XA 3PW7A 1KFDA 2ZH9A 4O3OA 4GXJA 2PI5A 3TAPA 1ZQQA 4E8FA 4ED6A 4DL4A 4Q43A 4I2JA 4DSJA 3K4GA 2MUTB 3ISBA 5KFQA 2R8GA 2WTFA 4J9MA 3BQ1A 2HHWA 8ICVA 2XGPA 5DQHA 3ORYA 5J2FA 4X4QA 1NZPA 1COOA 2M2UA 4EBEA 1Z00A 4UB1A 4KLDA 4RPYA 1K1QA 2UVVA 1UEUA 2W8KA 3PX6A 2KTQA 4KLLA 1JAJA 1NK8A 1L3VA 2JZBB 4P4MA 4I2IA 2FMPA 4ELVA 2HVIA 4ECVA 4RT2A 4QZGA 4DFMA 2XCAA 4I27A 1TV9A 2Q0ZX 9ICLA 5KFCA 1NO5A 5KG4A 1BPEA 2NRTA 4UB2A 1ZQAA 1SKRA 2IMWP 4BDPA 3HT3A 4O3RA 3AUOA 3RJIA 3NYBA 4KLGA 1Y88A 4I2AA 1B22A 4ATBA 4RWOA 2ZH5A 1TFWA 4DO9A 5DBBA 4YR0A 1BPZA 1Q79A 3HIYA 1NK0A 4C8LA 8ICWA 4AT7A 2ZH4A 4FHWA 4X4UA 1U47A 1TFYA 3T5JA 3H7IA 4RNNA 3PVXA 4PPXA 4DOBA 3GIJA 5F2VO 5J0SA 1L3UA 3RJFA 3UXOA 3RJJA 2IBKA 4F8RA 4FHXA 4PHDA 2ID1A 4Z6FA 4RQ2A 2J6TA 4RWNA 3GFKB 7ICTA 4J9QA 2DPIA 3OVBA 4ECQA 2ZH6A 2BPGA 3M9MB 4DS5A 3H40A 4F5QA 3Q8LA 4DF8A 3RB0A 4M0AA 5HC9A 3IM1A 2DR9A 3JPRA 3H4BA 2AGPA 4DL7A 1KRPA 5KFFA 5DLFA 1IXRA 4KLJA 8ICMA 2ISOA 1QLNA 4DSKA 1UA1A 2KZ3A 3SZ2A 4I2DA 1L3SA 4MFFA 7ICKA 9ICFA 5J2DA 1QSYA 5HRFA 4PGYA 3KHHA 1BNOA
chains in the Genus database with same CATH superfamily
1MIWA 1XSLA 4Q45A 4DL2A 1YLQA 1FFUA 5KFXA 4R65A 2KHQA 3ER8C 3PR4A 2K8CB 1KN5A 5KFDA 4YMMA 3ISCA 2OM6A 1UA0A 4HX0A 3M9OB 3V7KA 1NK9A 2KZMA 4MF2A 4CGZA 5EE1A 1ZQEA 1T7PA 3FYHA 3AMZA 1PVQA 4EX6A 5KNIA 2FLPA 3VCBA 4BGDA 3QUBA 5KG3A 2EAMA 5KG7A 3NVZA 7ICSA 1L6NA 4ECUA 1RQNA 2A1JA 1KSPA 1S77D 1RG6A 3AQNA 3V7JA 5HRKA 1Q78A 4I2EA 2B56A 5TISU 2FLNA 5AI5A 5KFUA 4KLHA 7ICNA 1RM6C 3DDHA 4OCZA 4DCCA 5DB9A 3AQEA 3PW5A 5FP0A 5KFBA 5HNKA 1ZQDA 2KVSA 4X4TA 3PSPA 1ZQSA 3ZDCA 4UAVA 4YR3A 3RR8A 5AKHA 2ESEA 3C66A 3OJUA 5J2GA 4CRXA 3M8SA 3H3AA 4IQTA 5DG8A 5HRLA 4F91B 4KM5A 4F4WA 9ICCA 4S3NA 1KBUA 5HRBA 3RJGA 5AK3A 2EZXA 1NK4A 3F5EA 2ZTCA 2BCRA 3AU2A 4JUZA 3MBYA 2FPLA 2HBMA 4XQ8A 5KFZA 1A6SA 3NVOA 1VFGA 3C28A 2ASDA 4FHVA 2ZIVA 2M0NA 2DUYA 3GV7B 4FH3A 1X9MA 1ZQWA 2HI0A 3GIKA 1BVSA 1XNSA 4EEYA 4F2RA 4ECXA 2F1IA 5AM0A 3OSNA 2RLTA 3O0FA 2E8PA 5EE9A 4O3QA 1MIVA 1D8BA 4QWBA 1C20A 1T3NA 5J0OA 2PFPA 3WK9A 1WWVA 4DQPA 4Z6DA 1N63A 3H8MA 2F76X 3PNCA 4UD4A 1J2NA 2K4HA 4N7RA 4KLMA 3CNHA 3QU4A 3DV9A 3MABA 2BDUA 3AQKA 4O3PA 4C8NA 1T8EA 2IOFK 4I0UA 2PFQA 4KX3A 4TUPA 9ICTA 9ICOA 1SV4A 2KKPA 4C4SA 4OAIZ 2QB0B 4HAIA 4B9LA 9ICRA 4QZFA 4DWIA 2RDIA 8ICKA 3H4DA 1F5AA 4K97A 4NLCA 2IHOA 2GWSA 1ZQKA 5CP2A 2H3FA 5CFSA 3ALRA 4I2HA 4MFAA 3GILA 2CXYA 4WC4A 5DGBA 4O5EA 5D62A 4IQWA 4OAFA 2EZYA 3T5HA 3LVWA 2BQRA 2AHOB 1BPDA 2XO7A 4FZNA 8ICHA 5G5GA 5L1JA 4ZH4A 3KHRA 5C5JA 3HWTA 5AIAA 3TI0A 9ICAA 3TFRA 4Q44A 3ZDDA 2MRLA 4F4YA 2GAFD 3GZFA 2L5YA 8ICJA 3UMGA 4RQ3A 4Y2SA 4K9AA 4YD1A 4QZ8A 2EAOA 2OWOA 3AM9A 5KTQA 5HR7A 2AGQA 3FC4A 5JRTA 4J9PA 3JPTA 4C8KA 4JB3A 3BDPA 4EGWA 2K4EA 3ONNA 3PHZA 1ZQZA 1OW5A 5KFOA 1DGJA 4YG2A 4ECZA 4ED8A 4BWMA 3AN1A 4EENA 5CJ7A 3MR6A 4C8OA 1PVRA 1Q3UA 8ICSA 4F3OA 8ICOA 1LV5A 2VA8A 3OVSA 3S6JA 3WKBA 1NOMA 4FE3A 1YZ6A 3OSPA 4I2FA 1Z00B 1ZQCA 2PMZF 5KT2A 4KMUA 3F2CA 1X42A 2WF7A 1L7MA 1XSPA 2H5XA 3M7DA 4EBJA 1J2MA 5ALUA 4UAYA 4X4SA 2Q4TA 3UPSA 3RBDA 2KIVA 4DEZA 1B4FA 2WHEA 4RUCA 3D2NA 4FH5A 2WF9A 3C2KA 4TQRA 5KAFU 1NJWA 3RB6A 1KKXA 5J0WA 4RUAA 4CCHA 2M9NA 3PX4A 2XCPA 4ED3A 3WK4A 9ICJA 3PX0A 4F2SA 9ICQA 2KN7A 2ASLA 2CN1A 4K4GA 2ASJA 4O3MA 2DRBA 2ZHAA 4NXWA 3BS7A 2QB0A 3FDSA 1GO3F 4IC9A 2AJQA 2WAQF 1D9FA 2JEFA 1CUKA 3A0HU 4MKPA 1HUOA 4DS4A 4BJQA 4QWDA 2F2AB 4Y2XA 5HRDA 2V4QA 9ICMA 3MR2A 3K1ZA 1TE2A 4J9NA 4Y2YA 3JPQA 1KL9A 3KHLA 5H2FU 1OUQA 1SIJA 2J6SA 5KFJA 4RNOA 1TVAA 8ICXA 2DKZA 1C7YA 2JMGA 3GQCA 2BQUA 8ICAA 1HEKA 3AU6A 1PK1B 5L1KA 4RQ5A 3RFAA 3BQ2A 1MQ2A 4RT3A 2BDPA 4IL6U 1FO4A 3HKZF 1SZPA 3JPOA 3C5FA 4OJ5A 9ICGA 2QLTA 2MSNA 8ICPA 5T14A 3WFQE 1Z1BA 3T79A 1WCNA 3AQMA 1ZQNA 1ZRMA 2W9BB 2ZH8A 8ICIA 4M9LA 3SAHA 9ICEA 2EDUA 3IG8A 5B3PA 2W03A 1QSSA 4OJPA 3ZDAA 2CPRA 4E7XA 2D3DA 1KFDA 2ZH9A 2PI5A 3TAPA 3WK7A 1ZQQA 4E8FA 4ED6A 3EF2A 1TAMA 4DSJA 8ICVA 1KW4A 2WTFA 2WB1C 2W55A 4X4QA 1NZPA 3WKDA 3L3FX 4EBEA 3FAHA 1Z00A 5ALOA 3TKAA 4UB1A 2LKYA 5EE0A 4P4MA 2W7OA 2FMPA 5L1MA 4I27A 2Q0ZX 1NO5A 4K96A 3N7RC 2NRTA 4UB2A 2BZFA 4QJFB 3HT3A 4O3RA 3AUOA 1Y88A 2I5HA 1B22A 1TFWA 1BPZA 3NS1A 8ICWA 4X4UA 1U47A 1TFYA 3T5JA 4PPXA 5J0SA 4OJ6A 3UXOA 1IIPA 4F8RA 1DRGA 7ICTA 3PSTA 4M0AA 3Q8LA 3IM1A 2DR9A 2AGPA 3J81j 4DL7A 5KFFA 2OXOA 8ICMA 4LEYA 1ZD4A 4I2DA 4MFFA 2K4IA 1N62A 1JN3A 4C8MA 4QZAA 2LYHA 2Y1JA 3B0YA 4I2BA 1U4BA 3SI8A 2HHTA 1N48A 3QE9Y 4FBUA 4AYBF 1DK3A 5AI0A 4I2CA 1DGSA 4IQUA 2KJ5A 2KKVA 4ED1A 9ICKA 4CF3A 1KQQA 1F44A 2XGQA 5JTIA 4JLXA 4K9BA 9ICVA 2UVRA 2WF5A 1N5WA 1V85A 2YMLA 4RQ4A 2FLLA 1NJZA 2DR8A 2D6FC 1K5OA 2J6UA 5AM3A 3MR5A 1PK1A 2DBYA 2BCSA 1D9DA 5D63A 5ALVA 2VANA 3D2SA 5B66U 4PHAA 4M9NA 3KZIU 4UW9A 4KN7A 2EH9A 2EZZA 2FDRA 1T4GA 4ELUA 4Z6CA 1ZQUA 1Q8KA 3K75D 5EE3A 3SQIA 2W9BA 5EOZA 5ALJA 1Z19A 5KT3A 1L7NA 2LHTA 2LI6A 1U45A 1QQ7A 3HP6A 8ICQA 4C80A 4RWQA 2V9WA 1S0NA 1FA0A 2O1PA 2NRWA 1NKEA 1SWVA 2O6KA 4IQVA 2W3RA 5KAIU 1ZQBA 2XIDA 5J0PA 2IUBA 3KOOA 3QUQA 1UEVA 4J9LA 4NXUA 1UT8A 3R9KA 4RQNA 5HP4A 2G0AA 4X0AA 3RH6A 4UD5A 3BS5B 2DVIA 4XUSA 2Z7JA 4WJ3B 3OGUA 1R8CA 1JX4A 8ICTA 2BPFA 3ERCC 3SYZA 2E8NA 4US8A 5KL1B 4ECYA 5KFVA 4JV1A 1KNYA 3OVAA 3N4MB 1UCVA 2KOBA 1NJYA 4IRDA 1OU5A 1QQ6A 3WK5A 4UB5A 3GIIA 5KG1A 1TK5A 4NV0A 5ALSA 3SV4A 4RQMA 2RFFA 3PMNA 4O68A 1Z4NA 4EYHB 4DFKA 1BPXA 5ALTA 3L5KA 1ZQHA 1QTMA 8ICCA 2JH7A 5KL8B 4WC1A 4FS2A 4LEWA 1ZQPA 1ZD3A 4BXOB 3QEAZ 2G5IB 5DECA 4G9BA 1JIHA 9ICPA 1EXNA 3THVA 2BHNA 1L8LA 5F9NA 3WFOA 3OUYB 4QZIA 5E79U 2G08A 4NM2A 4RQ0A 4NM1A 5AK5A 2ZH2A 3WFRE 3EZ5A 8ICFA 3NVWA 2C2RA 4WC6A 1SV0A 8ICEA 4YMOA 3QU9A 5JUMA 4KTQA 3GIMA 4YVZA 3GU3A 3HRDD 3IHQB 4WQKA 4F5NA 4DFJA 4B9SA 4F72A 1HIWA 2NRZA 5AI8A 1DOQA 1TFRA 4ZOHC 4AT8B 5AHXA 4WC7A 2HCFA 2B0CA 1U48A 3QU5A 4QZBA 2ALZA 3I1YA 7ICVA 4PZNA 4Y2VA 5AI6A 1JXEA 4ECSA 2WF6A 2P6RA 4OAHA 3T5KA 7ICHA 5KFSA 3WU2U 2ZUDA 4P4PA 3KKAA 5KFRA 4OJLA 3NWIA 4HYKA 2H3VA 1S0VA 4M04A 4FO1A 1ZQTA 1XU4A 2H3IA 3V6JA 3L4PA 2ZH3A 4DFPA 2G5HB 4DSIA 2LBOA 1S10A 5KT7A 3KTQA 9ICUA 5B3QA 4F5OA 3SD7A 2WAQC 2AGOA 4R64A 2W9CB 1QQ5A 4I28A 3H0LB 2C2DA 4EBKA 3CRXA 3V72A 4FHYA 2K8AA 1VLBA 5KG6A 3RH5A 2GLEA 1XSNA 3UMBA 4O69A 1V4AA 4ED2A 3OHBA 7ICQA 2K8BB 3Q8SB 2JZBA 1N5XA 4O3NA 3BS5A 2VA2A 8ICBA 5ALLA 3QEBZ 3AL0B 3JCFA 2BQ3A 3N7PD 5AKXA 4QIWF 2KV2A 4EZ6A 2ZHBA 3N28A 1UHUA 4PHEA 1D8LA 4DL6A 2ZJ5A 4TQSA 1XC9A 3MDAA 5CA7A 3H0RB 4DSLA 3QU2A 4CNQA 3KHGA 1RPLA 5HMLA 2Y9TA 2OCEA 5ALIA 3WK8A 4Y2UA 5HRGA 2VJ4A 3MGIA 3QNMA 4RWPA 2F8KA 2HBKA 3T3FA 4BXOA 3C29A 5J8YA 4B9UA 1KEJA 1XS9D 5TZVA 2XVTA 2Y0SF 5CHGA 4CE6A 3MGHA 3OUYA 4QW9A 2LYBA 2IHNA 1X9WA 3HJ4A 4M9JA 2DR7A 4Y2RA 4KMOB 1S8OA 4Y2QA 3ICXA 2HBJA 1FIQA 3WFSC 1SWWA 2ZIXB 2XC9A 4NLGA 3UM9A 2N1RA 2DL0A 4KLSA 1SKWA 4B9TA 3TQ1A 1LKYB 2E1EA 2YY6A 4DFDA 3SV3A 2DKXA 4G3IA 4FHPA 4DL5A 3U26A 4DQQA 5CB1A 4RQ6A 1BPYA 2B51A 2YMMA 2FMSA 4AT8A 2YMPA 2NO5A 3PW2A 3I28A 4BUGA 2RQ5A 1AQ6A 3EYZA 7ICMA 3SAGA 4P2HA 2F8LA 3OHAA 4O5KA 1R8BA 3Q8KA 4NXZA 1ZQVA 5DB8A 2KNJA 4NLNA 4RNMA 7ICFA 1SV0C 4UB6U 4RPXA 3TAQA 4US9A 3QZ7A 2W43A 3MC1A 2Y9UA 1LVHA 4UAWA 8ICLA 1JUDA 3PMLA 3OWGA 4AYBC 3MDCA 2W9CA 3SEIA 1NKCA 3DEEA 4YXMA 1U9LA 5ALEA 2V4RA 4CDGA 4DL4A 1T3QA 3ISBA 2DF4B 2HHWA 3BQ1A 1SXEA 5J2FA 1YT3A 1COOA 2M2UA 3F5AA 2W8KA 1X6JA 2YX8A 4I2IA 2F3NA 5AM5A 4QZGA 4DFMA 5KFCA 3M6ZA 4O6AA 1SKRA 2IMWP 2ZH5A 2YN4A 4I2AA 5DBBA 4YR0A 5ALDA 4C8LA 2HMXA 3N7SC 3F2BA 3WKCA 3H7IA 4RNNA 4UATA 2LPEA 2KICA 3RJFA 2IBKA 4Z6FA 2J6TA 2DPIA 2ZH6A 4DS5A 1ED1A 3JPRA 1NI3A 1NNLA 5DLFA 4DSKA 9ICFA 2KZ3A 3SZ2A 5HRFA 1L3SA 5J2DA 1QSYA 2AU0A 2BCVA 2NO4A 2DGZA 3ED5A 1Z1VA 3UXNA 3UPQA 4XQ7A 4PHPA 1KDHA 1ZQIA 1RYRA 5ALMA 5IIIA 5ALGA 3F53A 3MFHA 3QXGA 2ZIXA 3BJYA 4YCXA 1N61A 4RU9A 1LKYA 5J2BA 2R18A 3H8SA 2I9GA 5J8YC 3K7DA 4DF4A 4M47A 8ICRA 3QUCA 2KG5A 1MN8A 3TANA 2H3QA 2JEJA 2HBLA 1N2XA 5KG5A 5AM4A 1ECWA 2JEIA 2QKQA 2GO7A 4WQLA 4R63A 4USAA 1IV8A 5F3XB 4X0BA 2W9MA 2IOFA 5J29A 5ALHA 4B9VA 7ICRA 5B5EU 3GDXA 1V97A 2C2EA 2FMQA 5HR6A 1NZBA 2K4PA 3HILA 9ICNA 3EW9A 4KLEA 8ICNA 2NRXA 4MF8A 1RYSA 2BBJA 1HJPA 9ICIA 2BKEA 1ZQMA 2P6UA 4K4IA 4M2YA 3SAFA 3RJHA 4KLFA 2ZXIA 5HRIA 4EX7A 5KFWA 5DQIA 5AKKA 1A76A 3GV8B 4X5VA 3OJSA 1NK5A 4QZCA 1QH9A 2KIWA 1L7OA 4NXXA 3SR6A 5JU5A 4ED0A 2YB1A 2EWRA 2CRXA 1VDVA 4NKTA 4LVSA 3E58A 2K60A 4Y2PA 3SMVA 5J0YA 2MA1A 2NRKA 1MSWD 1U49A 1RZTA 3H8JA 3H8WA 3UXPA 4JV2A 2UVWA 4ECWA 4P4OA 3C23A 4AT9B 1PX5A 4YP3A 4YQWA 2JH1A 1TKDA 1S97A 2G09A 4UAZA 2HHXA 2C28A 9ICSA 1ZXIA 1S0OA 2A1AA 4KLUA 1SL2A 4FO6A 5KFPA 5AI4A 1ZYQA 3EWAA 4YMNA 3V6KA 4MEXA 1PK3A 2E1FA 3Q8MA 2B21A 4Q8FA 3M8RA 3RAXA 5IINA 1Q3VA 3NTUA 2ZTDA 4RPZA 1JALA 4BWJA 2Q66A 1V9PA 1LB2B 4O0IA 3WKEA 5DKWA 2HHSA 3GV5B 3M6KA 2FCLA 5BOLA 2KFNA 2WF8A 5F9LA 3EUB2 3MFIA 7ICUA 4QIWC 1X40A 4UB4A 3D6JA 4KLIA 3NGDA 4KB6A 1F5SA 2HHPA 1VJ5A 4JMUA 5DG7A 3UQ0A 2NYVA 5DEDA 4C4RA 2FPKA 2I6XA 3M1YA 2XY5A 3MGVA 4J9RA 2KD1A 4QZDA 4TUQA 4LZDA 1PUZA 4DOCA 2NRVA 3IG5A 4EZ9A 4X4NA 1SKSA 4DL3A 2PKEA 5EWGA 4NJ8A 1L5UA 5J0TA 1X9XA 1AROP 3MR3A 4FS1A 2LMRA 3ZDBA 1BPBA 3TARA 1WUDA 4IS7A 2XY7A 5KFYA 5D49A 4QWEA 5CHEA 3ZI4A 2ZUCA 2C22A 4B6JA 4NLKA 5DGAA 5IILA 5HHIA 5ALPA 3RB4A 4NY8A 4WC5A 1UETA 2ZJ8A 1SL1A 1TAQA 4KLTA 2BCUA 5IIMA 1CI4A 3KBBA 1R8AA 4Y2JA 1RXWA 3KD3A 2A19A 2VJ5A 3WFPA 5DDMA 2OH2A 4DQSA 2KSOB 2AH5A 5CFTA 2M2WA 2W3SA 1JI7A 4ECRA 2HHUA 4F4ZA 2KHVA 1ZQ1C 5CEHA 2KVCA 7ICLA 4X4OA 1RQLA 1TK8A 2ZJAA 1TK0A 4RQ1A 4PL2A 5DDYA 2BE3A 4IG8A 4AT9A 3JPNA 2FPMA 1KTQA 4EP7A 4UAUA 3N97B 1S76D 4RQ7A 2UVUA 4AT7B 3BZKA 2PXIA 3I76A 4YN4A 2XY6A 1S9FA 2AQ4A 3H38A 3B9JA 4X4RA 2ZIWB 4UASA 2IHMA 2AQ0A 4LEVA 2EQYA 5ALQA 7ICPA 2W9AA 5KFNA 4NKUA 1NKBA 4UBCA 4TUSA 2DPJA 2PBEA 4O67A 5J2CA 1PZNA 5DLGA 5IIJA 3LWLA 1SZHA 1MA7A 3IRUA 4GXIA 2HVHA 2EANA 5AK6A 3CYMA 4NL9A 4ED7A 2YTUA 5AM2A 4R8UB 4YR2A 2ODGA 1TAUA 4ECTA 5HHHA 3D2QA 1B0XA 2PMZC 5ALZA 5KG0A 4R66A 3A0BU 3RRGA 2W11A 2JGAA 1MIYA 4OAGA 1WOTA 4NXVA 4O9MA 2G06A 7ICOA 2ZH7A 1SL0A 4F92B 1ZQRA 3WKAA 3ZDEA 4M5DA 4WC2A 4MHVA 2F77X 3C21A 3C2MA 4J9SA 1JROA 5DB7A 1FFVA 3QX7A 5ALXA 1X6IA 2WB1F 5KFTA 2IA6A 2OHFA 4WC0A 2QARB 3RH4A 4Q8EA 4JV0A 3JZ0A 3V6HA 2D8CA 3KFUF 1ZJNA 1MQ3A 4QW8A 4YXJA 3RAQA 4EEKA 3TACB 5J2KA 1Z4OA 3AQLA 2PFOA 5A0LA 4B9NA 2KJ8A 1NJXA 7ICGA 4PZOA 2FI1A 3OPXA 1A0PA 4NXTA 2KE7A 3C5GA 4XA5A 3E2EA 1IM4A 4JK1A 5DG9A 3HX0A 3AQFA 4UB8U 5EWEA 2PI4A 3QZ8A 3C2LA 3PW7A 3OTQA 4GXJA 4CF5A 2KSOA 4Q43A 4I2JA 2GH1A 1GPJA 2MUTB 2DQNB 4JLZA 1UEUA 3PX6A 1YZ7A 1JAJA 4KLLA 2HVIA 4ELVA 1O08A 2JV3A 3NKUA 2OYYA 1TV9A 3HKZC 5KG4A 1BPEA 1ZQAA 4P0PB 3NRZA 2MU2A 4BDPA 4KLGA 1UPHA 3WK6A 4RWOA 4DO9A 2EAPA 5AKLA 1Q79A 3HIYA 5ALYA 1NK0A 4AT7A 2ZH4A 4FHWA 1SB3C 3PVXA 5F2VO 4DOBA 3GIJA 1L3UA 2VKQA 3RJJA 4FHXA 4GIBA 2HOFA 3GFKB 2ZIWA 4J9QA 5HC9A 3H40A 4DF8A 3RB0A 1ZRNA 3H4BA 4KLJA 5AKJA 2ISOA 1QLNA 2ZXHA 1UA1A 4PGYA 3IP4B 3KHHA 1M6YA 1BNOA 1RXVA 4QZHA 1UQVA 4U7CA 2OEHA 9ICBA 1J97A 1X2IA 4C7YA 5ALKA 4R8UA 4X4VA 4YD2A 1R89A 4UQGA 5J0RA 1XO0A 2K89A 2KK0A 5DB6A 4RQ8A 1RDFA 4WBYA 5JTGA 2W54A 2YB4A 1QCKA 2F1JA 4XRHA 4F93B 2XICA 4A8EA 5DBCA 4EV6A 3AEVA 3LWMA 1QSLA 2E8OA 3PV8A 4WBZA 3C1YA 4EYIB 5AKZA 4E0DA 4EBDA 4QWAA 1ZQLA 3KZXA 4NL9C 2LM1A 2QARA 3BZCA 4TURA 3HPOA 1L3TA 2ATLA 5D46A 3G6VA 4IR9A 4PGQA 4O3SA 4C0ZA 3NVVA 3Q8RB 5CRXA 1XO1A 1BGXT 9ICHA 3PW4A 2M2TA 2QB1A 3ISDA 2ES6A 1UT5A 2HDOA 1CEZA 5GTHU 8ICUA 4JWNA 1IG6A 4PJ0U 5KT6A 3K1RB 5KFGA 4FBTA 2IOHA 5BOMA 2GOLA 2P35A 5KFEA 5DQGA 4Z6EA 2XI9A 3KKAC 1X9SA 3PR5B 1FEZA 3E0FA 4ACOA 4IR1A 5IIOA 5AICA 1CRXA 3ZD9A 2BBHA 5AM1A 4J9KA 4DQIA 2F1HA 2HOIA 3RJKA 1O03A 5C0YA 2HN1A 3BQ0A 2RP5A 2MUTA 4M6WB 1WWUA 4C4TA 4QNLA 3PW0A 2ZIUB 2BPCA 1XWLA 4C7ZA 1Q46A 9ICWA 4DSFA 3M9NB 5KFKA 4F5PA 4NWIA 2FE9A 4XJEA 3H37A 1OXJA 2Y1IA 4RZRA 4MFCA 1ZQFA 4P0PA 1KLNA 2ZH1A 2ZUBA 4QZEA 1ZQJA 4JWMA 4DLGA 2W8LA 4DOAA 2HN2A 4PL1A 4KLOA 8ICGA 4P0QB 4QZ9A 4IRKA 3G6YA 2BR0A 2BGWA 2KZZA 1KFSA 3PO5A 2G07A 1SXDA 4EBCA 5KFIA 3QU7A 2B4VA 5KFMA 5GTIU 5D4BA 1ZD2P 1URJA 3HW8A 4YFKA 1JRPA 3PO4A 1ZOLA 4J9OA 4WCWA 2JR5A 5J2HA 7ICEA 1SGGA 2LM4A 4OJOA 1DXSA 2R8IA 4WC3A 4GC6A 4GXKA 2RDJA 8ICZA 5HREA 5J2IA 4GC7A 3NUQA 1RYUA 4IRCA 5KFHA 3UQ2A 2WFAA 3MCRA 4F4KA 5G5HA 2VA3A 2KJ9A 3LDAA 4DLEA 5AKGA 3G6XA 5J2JA 2MAXA 3HJEA 3BQ7A 5J2EA 3NRWA 4LZGA 1H38A 2JEGA 4WH5A 5J0UA 2ISPA 5BPCA 3T5LA 5HMMA 1NK7A 4DSEA 3LVVA 1K1SA 2R8KA 1ZJMA 3TADA 3JPPA 2E5SA 5AK4A 1ZQOA 3IDWA 1T94A 4B9MA 5CR0A 1A77A 4FZLA 3LK9A 2ZTEA 9ICXA 4KN4A 3F2DA 1DK2A 2I1QA 1MC8A 2GA9D 2KEYA 4J03A 2JXJA 4CF4A 1WG8A 5AKYA 3JPSA 4KLQA 3PSIA 3NVYA 1JXLA 2F44A 3EPIA 4NLZA 4ELTA 3EPGA 5D61A 4LEZA 3RF9A 2PFNA 5L9XA 4OO1J 7ICIA 2YMQA 5J0QA 5KT5A 2RHFA 3PSFA 5L1IA 2RRDA 4M6WA 3HJ1A 4QWCA 2DFLA 1JMSA 2ZIUA 5AI9A 3RR7A 3JYYA 2LYAA 4ICAA 2DWQA 4EELA 4M9HA 5KG2A 5KFAA 1L7PA 3FM9A 1D8YA 1P7DA 5ALFA 3RBEA 1B43A 4WOYA 2H3ZA 2R8HA 3BQTA 4X4PA 5EWFA 4OD0A 4ATBB 5ALWA 5J2AA 1X66A 2E8MA 5IIKA 2FJ6A 4LJXA 2HSZA 4P0QA 1COKA 2R8JA 3PY8A 1ZD5A 3CK6A 3Q8QB 2M2VA 2W7PA 3TFSA 4F50A 4F4XA 4KX5A 5ALNA 3SENA 1V38A 2BCQA 1JQRA 2HHVA 3VC8A 3CP8A 3ETRA 3ZD8A 5ALRA 4LT6A 1Z3EB 4M9GA 3LQCB 4UARA 4F5RA 5AIBA 1HUZA 4K98A 8ICYA 3RJEA 2P66A 2W04A 4PGXA 4U6PA 4I29A 1NK6A 1BNPA 5J0XA 5KT4A 5CFUA 1N60A 3OV7A 3RRHA 5L1LA 1KFTA 1ZQXA 1WCLA 3V7LA 5AKEA 5HR9A 1ZQGA 3C18A 4F71A 4K8VA 4AP9A 4E80A 5HRHA 2HOQA 2HHQA 1L8OA 4UBBA 2A1JB 2KMDA 2DR5A 3H0MB 3RTVA 4EEBA 2DRAA 2B6GA 3ER9B 4UB3A 4PH5A 3RB3A 4K4HA 1VJ7A 4MEYA 5KFLA 3PZPA 5CWRA 4I2GA 1N56A 2HW3A 2YQEA 3IV6A 3QYPA 1WYGA 1ZQYA 2Y0SC 1ZETA 5DBAA 3Q8PB 2E3TA 3CW2C 4DQRA 3ETLA 3H39A 3L9DA 3C1ZA 4O5CA 3NASA 4KITB 2KP7A 7ICJA 2JRZA 4GLXA 4GFJA 3TADC 2KFZA 3QUTA 2O5AA 4Y2TA 3B0XA 1S0MA 2NV3A 4O3OA 5AKIA 4NLBA 3K4GA 2R8GA 5KFQA 4J9MA 2XGPA 5DQHA 3ORYA 4FZMA 3UMCA 3IN5A 4KLDA 4RPYA 1K1QA 1PVPA 2UVVA 2KTQA 1F0MA 1NK8A 1L3VA 2JZBB 4FFDA 4ECVA 4RT2A 2ZIVB 2XCAA 9ICLA 3RJIA 3NYBA 4ATBA 4K99A 1S5LU 4PHDA 2JHDA 2ID1A 4RQ2A 4EEDA 4RWNA 2VIXA 2A3VA 3OVBA 4ECQA 2BPGA 3M9MB 3LYSA 4F5QA 1KRPA 1IXRA 5K4LA 4BX9C 2AXTU 2ZG6A 7ICKA
chains in the Genus database with same CATH topology
1JN3A 1RXVA 1MIWA 2AU0A 2BCVA 1XSLA 4Q45A 4C8MA 4DL2A 4QZHA 4QZAA 2LYHA 1YLQA 2Y1JA 9ICBA 3B0YA 4I2BA 1X2IA 5KFXA 3UXNA 4R65A 1U4BA 3UPQA 3SI8A 4XQ7A 2HHTA 1N48A 3QE9Y 4R8UA 4PHPA 3PR4A 4X4VA 4FBUA 4YD2A 1KDHA 1R89A 4UQGA 1ZQIA 1DK3A 5J0RA 5KFDA 4YMMA 3ISCA 1RYRA 4I2CA 5IIIA 5DB6A 4RQ8A 1UA0A 1DGSA 4IQUA 4WBYA 3M9OB 4ED1A 3V7KA 3MFHA 1NK9A 2KZMA 4MF2A 2F1JA 1ZQEA 9ICKA 4XRHA 4F93B 1T7PA 3BJYA 4YCXA 3FYHA 4RU9A 5DBCA 2XGQA 5J2BA 2FLPA 3H8SA 2I9GA 9ICVA 4BGDA 5KG3A 4DF4A 3LWMA 1QSLA 4M47A 8ICRA 5KG7A 2UVRA 7ICSA 3PV8A 4WBZA 3TANA 3C1YA 4EYIB 2JEJA 4E0DA 4EBDA 5KG5A 4ECUA 4QWAA 1ZQLA 2JEIA 4RQ4A 2FLLA 4R63A 2A1JA 1NJZA 1KSPA 1S77D 3AQNA 2DR8A 4X0BA 3V7JA 2J6UA 5HRKA 3MR5A 1Q78A 2W9MA 4TURA 2BCSA 1D9DA 2VANA 3HPOA 1L3TA 2ATLA 5D46A 3G6VA 4IR9A 5J29A 4I2EA 4PGQA 4PHAA 4O3SA 4M9NA 2FLNA 3Q8RB 4B9VA 5KFUA 4KN7A 1XO1A 4KLHA 7ICRA 3GDXA 1BGXT 7ICNA 2C2EA 2FMQA 9ICHA 3PW4A 2M2TA 5DB9A 3ISDA 9ICNA 3EW9A 1UT5A 1T4GA 1CEZA 3PW5A 4KLEA 4ELUA 8ICNA 5KFBA 2NRXA 4Z6CA 1ZQUA 4MF8A 1RYSA 4JWNA 8ICUA 3K75D 1HJPA 9ICIA 2BKEA 1ZQMA 2W9BA 5EOZA 5KT6A 2P6UA 5HNKA 1ZQDA 5KT3A 4K4IA 5KFGA 4FBTA 4M2YA 3H37A 4X4TA 5BOMA 1ZQSA 3RJHA 3ZDCA 5KFEA 4YR3A 1U45A 3RR8A 5DQGA 4Z6EA 3HP6A 4KLFA 5HRIA 8ICQA 3C66A 3OJUA 5J2GA 3M8SA 1X9SA 3PR5B 4RWQA 5KFWA 2V9WA 5DQIA 3H3AA 4IR1A 1S0NA 1A76A 4IQTA 1FA0A 2O1PA 3GV8B 2NRWA 5DG8A 4F91B 4X5VA 4F4WA 1NKEA 5IIOA 3OJSA 9ICCA 5HRLA 4S3NA 1NK5A 4QZCA 3ZD9A 5HRBA 4IQVA 4J9KA 3RJGA 2F1HA 4DQIA 3RJKA 1NK4A 1ZQBA 5J0PA 2ZTCA 2BCRA 3BQ0A 3AU2A 2MUTA 4M6WB 4JUZA 4J9LA 4ED0A 1UEVA 1UT8A 3MBYA 2FPLA 3PW0A 5HP4A 4X0AA 2BPCA 1XWLA 4XQ8A 3RH6A 4UD5A 9ICWA 5KFZA 4LVSA 4NKTA 2DVIA 4XUSA 1VFGA 5J0YA 1R8CA 3OGUA 1JX4A 4DSFA 2NRKA 8ICTA 2ASDA 3M9NB 2BPFA 5KFKA 4F5PA 3SYZA 1MSWD 4FHVA 1U49A 1RZTA 3GV7B 4FH3A 3H8JA 1X9MA 3H8WA 1ZQWA 5KFVA 4ECYA 4JV1A 2Y1IA 3UXPA 4RZRA 3GIKA 4JV2A 4MFCA 2UVWA 1KNYA 4ECWA 3OVAA 1BVSA 3N4MB 1ZQFA 1KLNA 4P4OA 2ZUBA 4EEYA 4F2RA 4QZEA 4ECXA 2F1IA 1ZQJA 3C23A 2ZH1A 1NJYA 4IRDA 1OU5A 3OSNA 4DLGA 4JWMA 4AT9B 2W8LA 1PX5A 4O3QA 4UB5A 4DOAA 1MIVA 3GIIA 4QWBA 4YP3A 4YQWA 1T3NA 5KG1A 5J0OA 1TK5A 1TKDA 1S97A 2PFPA 4KLOA 4DQPA 4Z6DA 8ICGA 3SV4A 4UAZA 2HHXA 2C28A 9ICSA 4QZ9A 4IRKA 2RFFA 3G6YA 1S0OA 3PNCA 2BR0A 3PMNA 1SL2A 2BGWA 4EYHB 4FO6A 4DFKA 5KFPA 1BPXA 1ZQHA 1QTMA 2KZZA 1ZYQA 1KFSA 8ICCA 3PO5A 3EWAA 4YMNA 4KLMA 3V6KA 4MEXA 4EBCA 4FS2A 3Q8MA 4WC1A 3MABA 3AQKA 5KFIA 4O3PA 1ZQPA 2B21A 4C8NA 1T8EA 4BXOB 3QEAZ 4Q8FA 5KFMA 2PFQA 5DECA 3M8RA 1JIHA 5D4BA 3RAXA 9ICPA 3HW8A 4YFKA 4TUPA 1EXNA 5IINA 9ICTA 3PO4A 4J9OA 3THVA 9ICOA 4WCWA 3NTUA 2ZTDA 2BHNA 4KLUA 4RPZA 4B9LA 9ICRA 4BWJA 5J2HA 4QZFA 2Q66A 1V9PA 5F9NA 1LB2B 3WFOA 3OUYB 4DWIA 7ICEA 2RDIA 4QZIA 4O0IA 4NKUA 8ICKA 3H4DA 1F5AA 4NM2A 4RQ0A 4NM1A 2R8IA 4WC3A 5DKWA 2HHSA 4GC6A 3GV5B 4GXKA 2RDJA 1ZQKA 2GWSA 5CP2A 8ICZA 2ZH2A 3WFRE 5HREA 5J2IA 4GC7A 4IRCA 3EZ5A 4I2HA 5KFHA 3UQ2A 5BOLA 2KFNA 4MFAA 8ICFA 3GILA 4F4KA 5F9LA 2C2RA 4WC6A 2VA3A 3MFIA 4YMOA 8ICEA 4WC4A 5JUMA 5DGBA 4O5EA 4KTQA 7ICUA 3LDAA 4IQWA 4UB4A 4YVZA 3GIMA 3IHQB 4DLEA 3T5HA 4F5NA 4DFJA 3NGDA 2BQRA 1BPDA 4KLIA 4B9SA 2XO7A 3G6XA 5J2JA 8ICHA 2MAXA 5L1JA 5J2EA 2HHPA 4ZH4A 2NRZA 3KHRA 5C5JA 3HWTA 4LZGA 3TI0A 5DG7A 3UQ0A 1DOQA 1TFRA 1H38A 2JEGA 3TFRA 5J0UA 9ICAA 2FPKA 2ISPA 5DEDA 5BPCA 4AT8B 3T5LA 5HMMA 4Q44A 3ZDDA 4WC7A 2XY5A 1NK7A 1U48A 4QZBA 4J9RA 4DSEA 1K1SA 4F4YA 4QZDA 4TUQA 2ALZA 8ICJA 4LZDA 4RQ3A 4DOCA 7ICVA 2R8KA 1JXEA 1ZJMA 4ECSA 2NRVA 2P6RA 4EZ9A 4X4NA 1SKSA 4YD1A 3JPPA 3T5KA 5EWGA 5KFSA 4QZ8A 2ZUDA 4DL3A 1L5UA 4P4PA 5KFRA 1ZQOA 5J0TA 2OWOA 4B9MA 5CR0A 1A77A 1AROP 7ICHA 3MR3A 4FS1A 3LK9A 4HYKA 2ZTEA 5KTQA 1BPBA 3ZDBA 4M04A 3TARA 1S0VA 4KN4A 1XU4A 1ZQTA 9ICXA 1DK2A 2AGQA 2I1QA 1MC8A 3V6JA 2XY7A 2ZH3A 5KFYA 5D49A 4QWEA 4DFPA 4J9PA 4DSIA 3JPTA 1S10A 4C8KA 2ZUCA 2C22A 5KT7A 3BDPA 3KTQA 4NLKA 9ICUA 3JPSA 5DGAA 5IILA 5HHIA 4F5OA 3RB4A 1ZQZA 4NY8A 4KLQA 4WC5A 1UETA 2ZJ8A 2AGOA 5KFOA 4R64A 1TAQA 1SL1A 3EPIA 1JXLA 4YG2A 2W9CB 4KLTA 4ECZA 4ELTA 4I28A 4ED8A 4NLZA 3EPGA 4BWMA 5IIMA 2BCUA 2PFNA 5L9XA 5CJ7A 3MR6A 2C2DA 4C8OA 1R8AA 1RXWA 7ICIA 4EBKA 5J0QA 3WFPA 5DDMA 3V72A 5KT5A 4FHYA 4DQSA 5KG6A 8ICSA 5L1IA 4F3OA 3RH5A 2M2WA 4M6WA 8ICOA 3HJ1A 4ECRA 1XSNA 1LV5A 2HHUA 4QWCA 2DFLA 2VA8A 3OVSA 1V4AA 4F4ZA 4ED2A 3OHBA 1JMSA 7ICQA 3JYYA 3Q8SB 2JZBA 3RR7A 1NOMA 4O3NA 2VA2A 8ICBA 3QEBZ 3OSPA 4I2FA 1Z00B 2BQ3A 1ZQCA 4M9HA 5KT2A 5KG2A 7ICLA 4X4OA 4KMUA 5KFAA 1TK8A 2ZHBA 4EZ6A 2ZJAA 4PHEA 1XSPA 1TK0A 1D8LA 1D8YA 2H5XA 4RQ1A 4DL6A 4EBJA 5DDYA 3RBEA 1B43A 2ZJ5A 2BE3A 4UAYA 4TQSA 2R8HA 4X4SA 3BQTA 3MDAA 1XC9A 4IG8A 5CA7A 3UPSA 3JPNA 4AT9A 4X4PA 5EWFA 4ATBB 2FPMA 1KTQA 5J2AA 3RBDA 4DSLA 3N97B 4DEZA 3KHGA 4EP7A 5IIKA 1S76D 4RQ7A 2UVUA 4AT7B 1RPLA 4RUCA 2PXIA 5HMLA 4YN4A 2XY6A 1S9FA 4FH5A 2AQ4A 3H38A 3C2KA 4TQRA 2R8JA 1NJWA 4X4RA 3RB6A 3PY8A 5J0WA 4RUAA 4CCHA 2IHMA 2AQ0A 5HRGA 2M9NA 3MGIA 3PX4A 3Q8QB 2XCPA 7ICPA 2W9AA 2M2VA 4ED3A 5KFNA 4F50A 3TFSA 9ICJA 4F4XA 3PX0A 1NKBA 4RWPA 4F2SA 4UBCA 4TUSA 2DPJA 9ICQA 2PBEA 2KN7A 4BXOA 3T3FA 2BCQA 2ASLA 1JQRA 2HHVA 4K4GA 5J2CA 1PZNA 2ASJA 2DRBA 5DLGA 5IIJA 3LWLA 4B9UA 1KEJA 2ZHAA 3ZD8A 1XS9D 5TZVA 4LT6A 3FDSA 4GXIA 2HVHA 1Z3EB 5CHGA 4M9GA 4ED7A 3MGHA 3LQCB 3OUYA 4QW9A 2AJQA 4R8UB 4YR2A 1D9FA 1X9WA 2IHNA 3HJ4A 1TAUA 2JEFA 4F5RA 4ECTA 5HHHA 1CUKA 1HUZA 4M9JA 8ICYA 3RJEA 2P66A 2DR7A 1HUOA 4DS4A 4QWDA 5KG0A 4PGXA 4R66A 4I29A 1NK6A 3RRGA 1BNPA 3WFSC 5J0XA 5HRDA 5KT4A 2XC9A 2V4QA 9ICMA 1MIYA 3MR2A 1WOTA 4J9NA 4NLGA 4O9MA 3JPQA 7ICOA 2ZH7A 4KLSA 1SL0A 3OV7A 4F92B 3RRHA 3KHLA 3ZDEA 1SKWA 1ZQRA 5L1LA 4B9TA 4M5DA 1KFTA 4WC2A 1ZQXA 1WCLA 3V7LA 3TQ1A 2J6SA 3C21A 5KFJA 5HR9A 1ZQGA 3C2MA 3C18A 4RNOA 4J9SA 3SV3A 4E80A 5HRHA 1TVAA 5DB7A 8ICXA 4G3IA 4FHPA 4DL5A 4DQQA 5CB1A 4RQ6A 1C7YA 1BPYA 2FMSA 3GQCA 2HHQA 5KFTA 4UBBA 4AT8A 2BQUA 2A1JB 2IA6A 8ICAA 4WC0A 3PW2A 2DR5A 3RH4A 3RTVA 3AU6A 4Q8EA 2DRAA 5L1KA 4JV0A 3JZ0A 3V6HA 4UB3A 4PH5A 3EYZA 3RB3A 4P2HA 7ICMA 1ZJNA 4K4HA 1VJ7A 4RQ5A 3OHAA 1MQ3A 4O5KA 3Q8KA 1R8BA 4UD4A 4MEYA 4NXZA 4QW8A 5KFLA 4YXJA 4RT3A 3BQ2A 5CWRA 1ZQVA 3RAQA 1MQ2A 2BDPA 4I2GA 5DB8A 4NLNA 4RNMA 5J2KA 1N56A 7ICFA 1SZPA 3JPOA 3C5FA 4RPXA 2HW3A 9ICGA 3AQLA 3TAQA 2PFOA 4B9NA 1ZQYA 3QZ7A 1NJXA 8ICPA 3WFQE 1ZETA 5DBAA 7ICGA 3Q8PB 1WCNA 3AQMA 1ZQNA 2W9BB 2ZH8A 8ICIA 4UAWA 4M9LA 9ICEA 8ICLA 4DQRA 3ETLA 3H39A 3L9DA 3C1ZA 3PMLA 4O5CA 3C5GA 4XA5A 4KITB 3MDCA 3E2EA 1IM4A 4JK1A 5DG9A 3HX0A 2W9CA 7ICJA 2KP7A 1NKCA 2PI4A 5EWEA 3QZ8A 4GLXA 4YXMA 1QSSA 3ZDAA 2KFZA 3C2LA 1U9LA 2V4RA 2O5AA 1S0MA 3B0XA 4E7XA 3PW7A 1KFDA 2ZH9A 4O3OA 4GXJA 2PI5A 3TAPA 1ZQQA 4E8FA 4ED6A 4DL4A 4Q43A 4I2JA 4DSJA 3K4GA 2MUTB 3ISBA 5KFQA 2R8GA 2WTFA 4J9MA 3BQ1A 2HHWA 8ICVA 2XGPA 5DQHA 3ORYA 5J2FA 4X4QA 1NZPA 1COOA 2M2UA 4EBEA 1Z00A 4UB1A 4KLDA 4RPYA 1K1QA 2UVVA 1UEUA 2W8KA 3PX6A 2KTQA 4KLLA 1JAJA 1NK8A 1L3VA 2JZBB 4P4MA 4I2IA 2FMPA 4ELVA 2HVIA 4ECVA 4RT2A 4QZGA 4DFMA 2XCAA 4I27A 1TV9A 2Q0ZX 9ICLA 5KFCA 1NO5A 5KG4A 1BPEA 2NRTA 4UB2A 1ZQAA 1SKRA 2IMWP 4BDPA 3HT3A 4O3RA 3AUOA 3RJIA 3NYBA 4KLGA 1Y88A 4I2AA 1B22A 4ATBA 4RWOA 2ZH5A 1TFWA 4DO9A 5DBBA 4YR0A 1BPZA 1Q79A 3HIYA 1NK0A 4C8LA 8ICWA 4AT7A 2ZH4A 4FHWA 4X4UA 1U47A 1TFYA 3T5JA 3H7IA 4RNNA 3PVXA 4PPXA 4DOBA 3GIJA 5F2VO 5J0SA 1L3UA 3RJFA 3UXOA 3RJJA 2IBKA 4F8RA 4FHXA 4PHDA 2ID1A 4Z6FA 4RQ2A 2J6TA 4RWNA 3GFKB 7ICTA 4J9QA 2DPIA 3OVBA 4ECQA 2ZH6A 2BPGA 3M9MB 4DS5A 3H40A 4F5QA 3Q8LA 4DF8A 3RB0A 4M0AA 5HC9A 3IM1A 2DR9A 3JPRA 3H4BA 2AGPA 4DL7A 1KRPA 5KFFA 5DLFA 1IXRA 4KLJA 8ICMA 2ISOA 1QLNA 4DSKA 1UA1A 2KZ3A 3SZ2A 4I2DA 1L3SA 4MFFA 7ICKA 9ICFA 5J2DA 1QSYA 5HRFA 4PGYA 3KHHA 1BNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN3 A;  1RXV A;  1MIW A;  2AU0 A;  2BCV A;  1XSL A;  4Q45 A;  4C8M A;  4DL2 A;  4QZH A;  4QZA A;  2LYH A;  1YLQ A;  2Y1J A;  9ICB A;  3B0Y A;  4I2B A;  1X2I A;  5KFX A;  3UXN A;  4R65 A;  1U4B A;  3UPQ A;  3SI8 A;  4XQ7 A;  2HHT A;  1N48 A;  3QE9 Y;  4R8U A;  4PHP A;  3PR4 A;  4X4V A;  4FBU A;  4YD2 A;  1KDH A;  1R89 A;  4UQG A;  1ZQI A;  1DK3 A;  5J0R A;  5KFD A;  4YMM A;  3ISC A;  1RYR A;  4I2C A;  5III A;  5DB6 A;  4RQ8 A;  1UA0 A;  1DGS A;  4IQU A;  4WBY A;  3M9O B;  4ED1 A;  3V7K A;  3MFH A;  1NK9 A;  2KZM A;  4MF2 A;  2F1J A;  1ZQE A;  9ICK A;  4XRH A;  4F93 B;  1T7P A;  3BJY A;  4YCX A;  3FYH A;  4RU9 A;  5DBC A;  2XGQ A;  5J2B A;  2FLP A;  3H8S A;  2I9G A;  9ICV A;  4BGD A;  5KG3 A;  4DF4 A;  3LWM A;  1QSL A;  4M47 A;  8ICR A;  5KG7 A;  2UVR A;  7ICS A;  3PV8 A;  4WBZ A;  3TAN A;  3C1Y A;  4EYI B;  2JEJ A;  4E0D A;  4EBD A;  5KG5 A;  4ECU A;  4QWA A;  1ZQL A;  2JEI A;  4RQ4 A;  2FLL A;  4R63 A;  2A1J A;  1NJZ A;  1KSP A;  1S77 D;  3AQN A;  2DR8 A;  4X0B A;  3V7J A;  2J6U A;  5HRK A;  3MR5 A;  1Q78 A;  2W9M A;  4TUR A;  2BCS A;  1D9D A;  2VAN A;  3HPO A;  1L3T A;  2ATL A;  5D46 A;  3G6V A;  4IR9 A;  5J29 A;  4I2E A;  4PGQ A;  4PHA A;  4O3S A;  4M9N A;  2FLN A;  3Q8R B;  4B9V A;  5KFU A;  4KN7 A;  1XO1 A;  4KLH A;  7ICR A;  3GDX A;  1BGX T;  7ICN A;  2C2E A;  2FMQ A;  9ICH A;  3PW4 A;  2M2T A;  5DB9 A;  3ISD A;  9ICN A;  3EW9 A;  1UT5 A;  1T4G A;  1CEZ A;  3PW5 A;  4KLE A;  4ELU A;  8ICN A;  5KFB A;  2NRX A;  4Z6C A;  1ZQU A;  4MF8 A;  1RYS A;  4JWN A;  8ICU A;  3K75 D;  1HJP A;  9ICI A;  2BKE A;  1ZQM A;  2W9B A;  5EOZ A;  5KT6 A;  2P6U A;  5HNK A;  1ZQD A;  5KT3 A;  4K4I A;  5KFG A;  4FBT A;  4M2Y A;  3H37 A;  4X4T A;  5BOM A;  1ZQS A;  3RJH A;  3ZDC A;  5KFE A;  4YR3 A;  1U45 A;  3RR8 A;  5DQG A;  4Z6E A;  3HP6 A;  4KLF A;  5HRI A;  8ICQ A;  3C66 A;  3OJU A;  5J2G A;  3M8S A;  1X9S A;  3PR5 B;  4RWQ A;  5KFW A;  2V9W A;  5DQI A;  3H3A A;  4IR1 A;  1S0N A;  1A76 A;  4IQT A;  1FA0 A;  2O1P A;  3GV8 B;  2NRW A;  5DG8 A;  4F91 B;  4X5V A;  4F4W A;  1NKE A;  5IIO A;  3OJS A;  9ICC A;  5HRL A;  4S3N A;  1NK5 A;  4QZC A;  3ZD9 A;  5HRB A;  4IQV A;  4J9K A;  3RJG A;  2F1H A;  4DQI A;  3RJK A;  1NK4 A;  1ZQB A;  5J0P A;  2ZTC A;  2BCR A;  3BQ0 A;  3AU2 A;  2MUT A;  4M6W B;  4JUZ A;  4J9L A;  4ED0 A;  1UEV A;  1UT8 A;  3MBY A;  2FPL A;  3PW0 A;  5HP4 A;  4X0A A;  2BPC A;  1XWL A;  4XQ8 A;  3RH6 A;  4UD5 A;  9ICW A;  5KFZ A;  4LVS A;  4NKT A;  2DVI A;  4XUS A;  1VFG A;  5J0Y A;  1R8C A;  3OGU A;  1JX4 A;  4DSF A;  2NRK A;  8ICT A;  2ASD A;  3M9N B;  2BPF A;  5KFK A;  4F5P A;  3SYZ A;  1MSW D;  4FHV A;  1U49 A;  1RZT A;  3GV7 B;  4FH3 A;  3H8J A;  1X9M A;  3H8W A;  1ZQW A;  5KFV A;  4ECY A;  4JV1 A;  2Y1I A;  3UXP A;  4RZR A;  3GIK A;  4JV2 A;  4MFC A;  2UVW A;  1KNY A;  4ECW A;  3OVA A;  1BVS A;  3N4M B;  1ZQF A;  1KLN A;  4P4O A;  2ZUB A;  4EEY A;  4F2R A;  4QZE A;  4ECX A;  2F1I A;  1ZQJ A;  3C23 A;  2ZH1 A;  1NJY A;  4IRD A;  1OU5 A;  3OSN A;  4DLG A;  4JWM A;  4AT9 B;  2W8L A;  1PX5 A;  4O3Q A;  4UB5 A;  4DOA A;  1MIV A;  3GII A;  4QWB A;  4YP3 A;  4YQW A;  1T3N A;  5KG1 A;  5J0O A;  1TK5 A;  1TKD A;  1S97 A;  2PFP A;  4KLO A;  4DQP A;  4Z6D A;  8ICG A;  3SV4 A;  4UAZ A;  2HHX A;  2C28 A;  9ICS A;  4QZ9 A;  4IRK A;  2RFF A;  3G6Y A;  1S0O A;  3PNC A;  2BR0 A;  3PMN A;  1SL2 A;  2BGW A;  4EYH B;  4FO6 A;  4DFK A;  5KFP A;  1BPX A;  1ZQH A;  1QTM A;  2KZZ A;  1ZYQ A;  1KFS A;  8ICC A;  3PO5 A;  3EWA A;  4YMN A;  4KLM A;  3V6K A;  4MEX A;  4EBC A;  4FS2 A;  3Q8M A;  4WC1 A;  3MAB A;  3AQK A;  5KFI A;  4O3P A;  1ZQP A;  2B21 A;  4C8N A;  1T8E A;  4BXO B;  3QEA Z;  4Q8F A;  5KFM A;  2PFQ A;  5DEC A;  3M8R A;  1JIH A;  5D4B A;  3RAX A;  9ICP A;  3HW8 A;  4YFK A;  4TUP A;  1EXN A;  5IIN A;  9ICT A;  3PO4 A;  4J9O A;  3THV A;  9ICO A;  4WCW A;  3NTU A;  2ZTD A;  2BHN A;  4KLU A;  4RPZ A;  4B9L A;  9ICR A;  4BWJ A;  5J2H A;  4QZF A;  2Q66 A;  1V9P A;  5F9N A;  1LB2 B;  3WFO A;  3OUY B;  4DWI A;  7ICE A;  2RDI A;  4QZI A;  4O0I A;  4NKU A;  8ICK A;  3H4D A;  1F5A A;  4NM2 A;  4RQ0 A;  4NM1 A;  2R8I A;  4WC3 A;  5DKW A;  2HHS A;  4GC6 A;  3GV5 B;  4GXK A;  2RDJ A;  1ZQK A;  2GWS A;  5CP2 A;  8ICZ A;  2ZH2 A;  3WFR E;  5HRE A;  5J2I A;  4GC7 A;  4IRC A;  3EZ5 A;  4I2H A;  5KFH A;  3UQ2 A;  5BOL A;  2KFN A;  4MFA A;  8ICF A;  3GIL A;  4F4K A;  5F9L A;  2C2R A;  4WC6 A;  2VA3 A;  3MFI A;  4YMO A;  8ICE A;  4WC4 A;  5JUM A;  5DGB A;  4O5E A;  4KTQ A;  7ICU A;  3LDA A;  4IQW A;  4UB4 A;  4YVZ A;  3GIM A;  3IHQ B;  4DLE A;  3T5H A;  4F5N A;  4DFJ A;  3NGD A;  2BQR A;  1BPD A;  4KLI A;  4B9S A;  2XO7 A;  3G6X A;  5J2J A;  8ICH A;  2MAX A;  5L1J A;  5J2E A;  2HHP A;  4ZH4 A;  2NRZ A;  3KHR A;  5C5J A;  3HWT A;  4LZG A;  3TI0 A;  5DG7 A;  3UQ0 A;  1DOQ A;  1TFR A;  1H38 A;  2JEG A;  3TFR A;  5J0U A;  9ICA A;  2FPK A;  2ISP A;  5DED A;  5BPC A;  4AT8 B;  3T5L A;  5HMM A;  4Q44 A;  3ZDD A;  4WC7 A;  2XY5 A;  1NK7 A;  1U48 A;  4QZB A;  4J9R A;  4DSE A;  1K1S A;  4F4Y A;  4QZD A;  4TUQ A;  2ALZ A;  8ICJ A;  4LZD A;  4RQ3 A;  4DOC A;  7ICV A;  2R8K A;  1JXE A;  1ZJM A;  4ECS A;  2NRV A;  2P6R A;  4EZ9 A;  4X4N A;  1SKS A;  4YD1 A;  3JPP A;  3T5K A;  5EWG A;  5KFS A;  4QZ8 A;  2ZUD A;  4DL3 A;  1L5U A;  4P4P A;  5KFR A;  1ZQO A;  5J0T A;  2OWO A;  4B9M A;  5CR0 A;  1A77 A;  1ARO P;  7ICH A;  3MR3 A;  4FS1 A;  3LK9 A;  4HYK A;  2ZTE A;  5KTQ A;  1BPB A;  3ZDB A;  4M04 A;  3TAR A;  1S0V A;  4KN4 A;  1XU4 A;  1ZQT A;  9ICX A;  1DK2 A;  2AGQ A;  2I1Q A;  1MC8 A;  3V6J A;  2XY7 A;  2ZH3 A;  5KFY A;  5D49 A;  4QWE A;  4DFP A;  4J9P A;  4DSI A;  3JPT A;  1S10 A;  4C8K A;  2ZUC A;  2C22 A;  5KT7 A;  3BDP A;  3KTQ A;  4NLK A;  9ICU A;  3JPS A;  5DGA A;  5IIL A;  5HHI A;  4F5O A;  3RB4 A;  1ZQZ A;  4NY8 A;  4KLQ A;  4WC5 A;  1UET A;  2ZJ8 A;  2AGO A;  5KFO A;  4R64 A;  1TAQ A;  1SL1 A;  3EPI A;  1JXL A;  4YG2 A;  2W9C B;  4KLT A;  4ECZ A;  4ELT A;  4I28 A;  4ED8 A;  4NLZ A;  3EPG A;  4BWM A;  5IIM A;  2BCU A;  2PFN A;  5L9X A;  5CJ7 A;  3MR6 A;  2C2D A;  4C8O A;  1R8A A;  1RXW A;  7ICI A;  4EBK A;  5J0Q A;  3WFP A;  5DDM A;  3V72 A;  5KT5 A;  4FHY A;  4DQS A;  5KG6 A;  8ICS A;  5L1I A;  4F3O A;  3RH5 A;  2M2W A;  4M6W A;  8ICO A;  3HJ1 A;  4ECR A;  1XSN A;  1LV5 A;  2HHU A;  4QWC A;  2DFL A;  2VA8 A;  3OVS A;  1V4A A;  4F4Z A;  4ED2 A;  3OHB A;  1JMS A;  7ICQ A;  3JYY A;  3Q8S B;  2JZB A;  3RR7 A;  1NOM A;  4O3N A;  2VA2 A;  8ICB A;  3QEB Z;  3OSP A;  4I2F A;  1Z00 B;  2BQ3 A;  1ZQC A;  4M9H A;  5KT2 A;  5KG2 A;  7ICL A;  4X4O A;  4KMU A;  5KFA A;  1TK8 A;  2ZHB A;  4EZ6 A;  2ZJA A;  4PHE A;  1XSP A;  1TK0 A;  1D8L A;  1D8Y A;  2H5X A;  4RQ1 A;  4DL6 A;  4EBJ A;  5DDY A;  3RBE A;  1B43 A;  2ZJ5 A;  2BE3 A;  4UAY A;  4TQS A;  2R8H A;  4X4S A;  3BQT A;  3MDA A;  1XC9 A;  4IG8 A;  5CA7 A;  3UPS A;  3JPN A;  4AT9 A;  4X4P A;  5EWF A;  4ATB B;  2FPM A;  1KTQ A;  5J2A A;  3RBD A;  4DSL A;  3N97 B;  4DEZ A;  3KHG A;  4EP7 A;  5IIK A;  1S76 D;  4RQ7 A;  2UVU A;  4AT7 B;  1RPL A;  4RUC A;  2PXI A;  5HML A;  4YN4 A;  2XY6 A;  1S9F A;  4FH5 A;  2AQ4 A;  3H38 A;  3C2K A;  4TQR A;  2R8J A;  1NJW A;  4X4R A;  3RB6 A;  3PY8 A;  5J0W A;  4RUA A;  4CCH A;  2IHM A;  2AQ0 A;  5HRG A;  2M9N A;  3MGI A;  3PX4 A;  3Q8Q B;  2XCP A;  7ICP A;  2W9A A;  2M2V A;  4ED3 A;  5KFN A;  4F50 A;  3TFS A;  9ICJ A;  4F4X A;  3PX0 A;  1NKB A;  4RWP A;  4F2S A;  4UBC A;  4TUS A;  2DPJ A;  9ICQ A;  2PBE A;  2KN7 A;  4BXO A;  3T3F A;  2BCQ A;  2ASL A;  1JQR A;  2HHV A;  4K4G A;  5J2C A;  1PZN A;  2ASJ A;  2DRB A;  5DLG A;  5IIJ A;  3LWL A;  4B9U A;  1KEJ A;  2ZHA A;  3ZD8 A;  1XS9 D;  5TZV A;  4LT6 A;  3FDS A;  4GXI A;  2HVH A;  1Z3E B;  5CHG A;  4M9G A;  4ED7 A;  3MGH A;  3LQC B;  3OUY A;  4QW9 A;  2AJQ A;  4R8U B;  4YR2 A;  1D9F A;  1X9W A;  2IHN A;  3HJ4 A;  1TAU A;  2JEF A;  4F5R A;  4ECT A;  5HHH A;  1CUK A;  1HUZ A;  4M9J A;  8ICY A;  3RJE A;  2P66 A;  2DR7 A;  1HUO A;  4DS4 A;  4QWD A;  5KG0 A;  4PGX A;  4R66 A;  4I29 A;  1NK6 A;  3RRG A;  1BNP A;  3WFS C;  5J0X A;  5HRD A;  5KT4 A;  2XC9 A;  2V4Q A;  9ICM A;  1MIY A;  3MR2 A;  1WOT A;  4J9N A;  4NLG A;  4O9M A;  3JPQ A;  7ICO A;  2ZH7 A;  4KLS A;  1SL0 A;  3OV7 A;  4F92 B;  3RRH A;  3KHL A;  3ZDE A;  1SKW A;  1ZQR A;  5L1L A;  4B9T A;  4M5D A;  1KFT A;  4WC2 A;  1ZQX A;  1WCL A;  3V7L A;  3TQ1 A;  2J6S A;  3C21 A;  5KFJ A;  5HR9 A;  1ZQG A;  3C2M A;  3C18 A;  4RNO A;  4J9S A;  3SV3 A;  4E80 A;  5HRH A;  1TVA A;  5DB7 A;  8ICX A;  4G3I A;  4FHP A;  4DL5 A;  4DQQ A;  5CB1 A;  4RQ6 A;  1C7Y A;  1BPY A;  2FMS A;  3GQC A;  2HHQ A;  5KFT A;  4UBB A;  4AT8 A;  2BQU A;  2A1J B;  2IA6 A;  8ICA A;  4WC0 A;  3PW2 A;  2DR5 A;  3RH4 A;  3RTV A;  3AU6 A;  4Q8E A;  2DRA A;  5L1K A;  4JV0 A;  3JZ0 A;  3V6H A;  4UB3 A;  4PH5 A;  3EYZ A;  3RB3 A;  4P2H A;  7ICM A;  1ZJN A;  4K4H A;  1VJ7 A;  4RQ5 A;  3OHA A;  1MQ3 A;  4O5K A;  3Q8K A;  1R8B A;  4UD4 A;  4MEY A;  4NXZ A;  4QW8 A;  5KFL A;  4YXJ A;  4RT3 A;  3BQ2 A;  5CWR A;  1ZQV A;  3RAQ A;  1MQ2 A;  2BDP A;  4I2G A;  5DB8 A;  4NLN A;  4RNM A;  5J2K A;  1N56 A;  7ICF A;  1SZP A;  3JPO A;  3C5F A;  4RPX A;  2HW3 A;  9ICG A;  3AQL A;  3TAQ A;  2PFO A;  4B9N A;  1ZQY A;  3QZ7 A;  1NJX A;  8ICP A;  3WFQ E;  1ZET A;  5DBA A;  7ICG A;  3Q8P B;  1WCN A;  3AQM A;  1ZQN A;  2W9B B;  2ZH8 A;  8ICI A;  4UAW A;  4M9L A;  9ICE A;  8ICL A;  4DQR A;  3ETL A;  3H39 A;  3L9D A;  3C1Z A;  3PML A;  4O5C A;  3C5G A;  4XA5 A;  4KIT B;  3MDC A;  3E2E A;  1IM4 A;  4JK1 A;  5DG9 A;  3HX0 A;  2W9C A;  7ICJ A;  2KP7 A;  1NKC A;  2PI4 A;  5EWE A;  3QZ8 A;  4GLX A;  4YXM A;  1QSS A;  3ZDA A;  2KFZ A;  3C2L A;  1U9L A;  2V4R A;  2O5A A;  1S0M A;  3B0X A;  4E7X A;  3PW7 A;  1KFD A;  2ZH9 A;  4O3O A;  4GXJ A;  2PI5 A;  3TAP A;  1ZQQ A;  4E8F A;  4ED6 A;  4DL4 A;  4Q43 A;  4I2J A;  4DSJ A;  3K4G A;  2MUT B;  3ISB A;  5KFQ A;  2R8G A;  2WTF A;  4J9M A;  3BQ1 A;  2HHW A;  8ICV A;  2XGP A;  5DQH A;  3ORY A;  5J2F A;  4X4Q A;  1NZP A;  1COO A;  2M2U A;  4EBE A;  1Z00 A;  4UB1 A;  4KLD A;  4RPY A;  1K1Q A;  2UVV A;  1UEU A;  2W8K A;  3PX6 A;  2KTQ A;  4KLL A;  1JAJ A;  1NK8 A;  1L3V A;  2JZB B;  4P4M A;  4I2I A;  2FMP A;  4ELV A;  2HVI A;  4ECV A;  4RT2 A;  4QZG A;  4DFM A;  2XCA A;  4I27 A;  1TV9 A;  2Q0Z X;  9ICL A;  5KFC A;  1NO5 A;  5KG4 A;  1BPE A;  2NRT A;  4UB2 A;  1ZQA A;  1SKR A;  2IMW P;  4BDP A;  3HT3 A;  4O3R A;  3AUO A;  3RJI A;  3NYB A;  4KLG A;  1Y88 A;  4I2A A;  1B22 A;  4ATB A;  4RWO A;  2ZH5 A;  1TFW A;  4DO9 A;  5DBB A;  4YR0 A;  1BPZ A;  1Q79 A;  3HIY A;  1NK0 A;  4C8L A;  8ICW A;  4AT7 A;  2ZH4 A;  4FHW A;  4X4U A;  1U47 A;  1TFY A;  3T5J A;  3H7I A;  4RNN A;  3PVX A;  4PPX A;  4DOB A;  3GIJ A;  5F2V O;  5J0S A;  1L3U A;  3RJF A;  3UXO A;  3RJJ A;  2IBK A;  4F8R A;  4FHX A;  4PHD A;  2ID1 A;  4Z6F A;  4RQ2 A;  2J6T A;  4RWN A;  3GFK B;  7ICT A;  4J9Q A;  2DPI A;  3OVB A;  4ECQ A;  2ZH6 A;  2BPG A;  3M9M B;  4DS5 A;  3H40 A;  4F5Q A;  3Q8L A;  4DF8 A;  3RB0 A;  4M0A A;  5HC9 A;  3IM1 A;  2DR9 A;  3JPR A;  3H4B A;  2AGP A;  4DL7 A;  1KRP A;  5KFF A;  5DLF A;  1IXR A;  4KLJ A;  8ICM A;  2ISO A;  1QLN A;  4DSK A;  1UA1 A;  2KZ3 A;  3SZ2 A;  4I2D A;  1L3S A;  4MFF A;  7ICK A;  9ICF A;  5J2D A;  1QSY A;  5HRF A;  4PGY A;  3KHH A;  1BNO A; 
#chains in the Genus database with same CATH topology
 1MIW A;  1XSL A;  4Q45 A;  4DL2 A;  1YLQ A;  1FFU A;  5KFX A;  4R65 A;  2KHQ A;  3ER8 C;  3PR4 A;  2K8C B;  1KN5 A;  5KFD A;  4YMM A;  3ISC A;  2OM6 A;  1UA0 A;  4HX0 A;  3M9O B;  3V7K A;  1NK9 A;  2KZM A;  4MF2 A;  4CGZ A;  5EE1 A;  1ZQE A;  1T7P A;  3FYH A;  3AMZ A;  1PVQ A;  4EX6 A;  5KNI A;  2FLP A;  3VCB A;  4BGD A;  3QUB A;  5KG3 A;  2EAM A;  5KG7 A;  3NVZ A;  7ICS A;  1L6N A;  4ECU A;  1RQN A;  2A1J A;  1KSP A;  1S77 D;  1RG6 A;  3AQN A;  3V7J A;  5HRK A;  1Q78 A;  4I2E A;  2B56 A;  5TIS U;  2FLN A;  5AI5 A;  5KFU A;  4KLH A;  7ICN A;  1RM6 C;  3DDH A;  4OCZ A;  4DCC A;  5DB9 A;  3AQE A;  3PW5 A;  5FP0 A;  5KFB A;  5HNK A;  1ZQD A;  2KVS A;  4X4T A;  3PSP A;  1ZQS A;  3ZDC A;  4UAV A;  4YR3 A;  3RR8 A;  5AKH A;  2ESE A;  3C66 A;  3OJU A;  5J2G A;  4CRX A;  3M8S A;  3H3A A;  4IQT A;  5DG8 A;  5HRL A;  4F91 B;  4KM5 A;  4F4W A;  9ICC A;  4S3N A;  1KBU A;  5HRB A;  3RJG A;  5AK3 A;  2EZX A;  1NK4 A;  3F5E A;  2ZTC A;  2BCR A;  3AU2 A;  4JUZ A;  3MBY A;  2FPL A;  2HBM A;  4XQ8 A;  5KFZ A;  1A6S A;  3NVO A;  1VFG A;  3C28 A;  2ASD A;  4FHV A;  2ZIV A;  2M0N A;  2DUY A;  3GV7 B;  4FH3 A;  1X9M A;  1ZQW A;  2HI0 A;  3GIK A;  1BVS A;  1XNS A;  4EEY A;  4F2R A;  4ECX A;  2F1I A;  5AM0 A;  3OSN A;  2RLT A;  3O0F A;  2E8P A;  5EE9 A;  4O3Q A;  1MIV A;  1D8B A;  4QWB A;  1C20 A;  1T3N A;  5J0O A;  2PFP A;  3WK9 A;  1WWV A;  4DQP A;  4Z6D A;  1N63 A;  3H8M A;  2F76 X;  3PNC A;  4UD4 A;  1J2N A;  2K4H A;  4N7R A;  4KLM A;  3CNH A;  3QU4 A;  3DV9 A;  3MAB A;  2BDU A;  3AQK A;  4O3P A;  4C8N A;  1T8E A;  2IOF K;  4I0U A;  2PFQ A;  4KX3 A;  4TUP A;  9ICT A;  9ICO A;  1SV4 A;  2KKP A;  4C4S A;  4OAI Z;  2QB0 B;  4HAI A;  4B9L A;  9ICR A;  4QZF A;  4DWI A;  2RDI A;  8ICK A;  3H4D A;  1F5A A;  4K97 A;  4NLC A;  2IHO A;  2GWS A;  1ZQK A;  5CP2 A;  2H3F A;  5CFS A;  3ALR A;  4I2H A;  4MFA A;  3GIL A;  2CXY A;  4WC4 A;  5DGB A;  4O5E A;  5D62 A;  4IQW A;  4OAF A;  2EZY A;  3T5H A;  3LVW A;  2BQR A;  2AHO B;  1BPD A;  2XO7 A;  4FZN A;  8ICH A;  5G5G A;  5L1J A;  4ZH4 A;  3KHR A;  5C5J A;  3HWT A;  5AIA A;  3TI0 A;  9ICA A;  3TFR A;  4Q44 A;  3ZDD A;  2MRL A;  4F4Y A;  2GAF D;  3GZF A;  2L5Y A;  8ICJ A;  3UMG A;  4RQ3 A;  4Y2S A;  4K9A A;  4YD1 A;  4QZ8 A;  2EAO A;  2OWO A;  3AM9 A;  5KTQ A;  5HR7 A;  2AGQ A;  3FC4 A;  5JRT A;  4J9P A;  3JPT A;  4C8K A;  4JB3 A;  3BDP A;  4EGW A;  2K4E A;  3ONN A;  3PHZ A;  1ZQZ A;  1OW5 A;  5KFO A;  1DGJ A;  4YG2 A;  4ECZ A;  4ED8 A;  4BWM A;  3AN1 A;  4EEN A;  5CJ7 A;  3MR6 A;  4C8O A;  1PVR A;  1Q3U A;  8ICS A;  4F3O A;  8ICO A;  1LV5 A;  2VA8 A;  3OVS A;  3S6J A;  3WKB A;  1NOM A;  4FE3 A;  1YZ6 A;  3OSP A;  4I2F A;  1Z00 B;  1ZQC A;  2PMZ F;  5KT2 A;  4KMU A;  3F2C A;  1X42 A;  2WF7 A;  1L7M A;  1XSP A;  2H5X A;  3M7D A;  4EBJ A;  1J2M A;  5ALU A;  4UAY A;  4X4S A;  2Q4T A;  3UPS A;  3RBD A;  2KIV A;  4DEZ A;  1B4F A;  2WHE A;  4RUC A;  3D2N A;  4FH5 A;  2WF9 A;  3C2K A;  4TQR A;  5KAF U;  1NJW A;  3RB6 A;  1KKX A;  5J0W A;  4RUA A;  4CCH A;  2M9N A;  3PX4 A;  2XCP A;  4ED3 A;  3WK4 A;  9ICJ A;  3PX0 A;  4F2S A;  9ICQ A;  2KN7 A;  2ASL A;  2CN1 A;  4K4G A;  2ASJ A;  4O3M A;  2DRB A;  2ZHA A;  4NXW A;  3BS7 A;  2QB0 A;  3FDS A;  1GO3 F;  4IC9 A;  2AJQ A;  2WAQ F;  1D9F A;  2JEF A;  1CUK A;  3A0H U;  4MKP A;  1HUO A;  4DS4 A;  4BJQ A;  4QWD A;  2F2A B;  4Y2X A;  5HRD A;  2V4Q A;  9ICM A;  3MR2 A;  3K1Z A;  1TE2 A;  4J9N A;  4Y2Y A;  3JPQ A;  1KL9 A;  3KHL A;  5H2F U;  1OUQ A;  1SIJ A;  2J6S A;  5KFJ A;  4RNO A;  1TVA A;  8ICX A;  2DKZ A;  1C7Y A;  2JMG A;  3GQC A;  2BQU A;  8ICA A;  1HEK A;  3AU6 A;  1PK1 B;  5L1K A;  4RQ5 A;  3RFA A;  3BQ2 A;  1MQ2 A;  4RT3 A;  2BDP A;  4IL6 U;  1FO4 A;  3HKZ F;  1SZP A;  3JPO A;  3C5F A;  4OJ5 A;  9ICG A;  2QLT A;  2MSN A;  8ICP A;  5T14 A;  3WFQ E;  1Z1B A;  3T79 A;  1WCN A;  3AQM A;  1ZQN A;  1ZRM A;  2W9B B;  2ZH8 A;  8ICI A;  4M9L A;  3SAH A;  9ICE A;  2EDU A;  3IG8 A;  5B3P A;  2W03 A;  1QSS A;  4OJP A;  3ZDA A;  2CPR A;  4E7X A;  2D3D A;  1KFD A;  2ZH9 A;  2PI5 A;  3TAP A;  3WK7 A;  1ZQQ A;  4E8F A;  4ED6 A;  3EF2 A;  1TAM A;  4DSJ A;  8ICV A;  1KW4 A;  2WTF A;  2WB1 C;  2W55 A;  4X4Q A;  1NZP A;  3WKD A;  3L3F X;  4EBE A;  3FAH A;  1Z00 A;  5ALO A;  3TKA A;  4UB1 A;  2LKY A;  5EE0 A;  4P4M A;  2W7O A;  2FMP A;  5L1M A;  4I27 A;  2Q0Z X;  1NO5 A;  4K96 A;  3N7R C;  2NRT A;  4UB2 A;  2BZF A;  4QJF B;  3HT3 A;  4O3R A;  3AUO A;  1Y88 A;  2I5H A;  1B22 A;  1TFW A;  1BPZ A;  3NS1 A;  8ICW A;  4X4U A;  1U47 A;  1TFY A;  3T5J A;  4PPX A;  5J0S A;  4OJ6 A;  3UXO A;  1IIP A;  4F8R A;  1DRG A;  7ICT A;  3PST A;  4M0A A;  3Q8L A;  3IM1 A;  2DR9 A;  2AGP A;  3J81 j;  4DL7 A;  5KFF A;  2OXO A;  8ICM A;  4LEY A;  1ZD4 A;  4I2D A;  4MFF A;  2K4I A;  1N62 A;  1JN3 A;  4C8M A;  4QZA A;  2LYH A;  2Y1J A;  3B0Y A;  4I2B A;  1U4B A;  3SI8 A;  2HHT A;  1N48 A;  3QE9 Y;  4FBU A;  4AYB F;  1DK3 A;  5AI0 A;  4I2C A;  1DGS A;  4IQU A;  2KJ5 A;  2KKV A;  4ED1 A;  9ICK A;  4CF3 A;  1KQQ A;  1F44 A;  2XGQ A;  5JTI A;  4JLX A;  4K9B A;  9ICV A;  2UVR A;  2WF5 A;  1N5W A;  1V85 A;  2YML A;  4RQ4 A;  2FLL A;  1NJZ A;  2DR8 A;  2D6F C;  1K5O A;  2J6U A;  5AM3 A;  3MR5 A;  1PK1 A;  2DBY A;  2BCS A;  1D9D A;  5D63 A;  5ALV A;  2VAN A;  3D2S A;  5B66 U;  4PHA A;  4M9N A;  3KZI U;  4UW9 A;  4KN7 A;  2EH9 A;  2EZZ A;  2FDR A;  1T4G A;  4ELU A;  4Z6C A;  1ZQU A;  1Q8K A;  3K75 D;  5EE3 A;  3SQI A;  2W9B A;  5EOZ A;  5ALJ A;  1Z19 A;  5KT3 A;  1L7N A;  2LHT A;  2LI6 A;  1U45 A;  1QQ7 A;  3HP6 A;  8ICQ A;  4C80 A;  4RWQ A;  2V9W A;  1S0N A;  1FA0 A;  2O1P A;  2NRW A;  1NKE A;  1SWV A;  2O6K A;  4IQV A;  2W3R A;  5KAI U;  1ZQB A;  2XID A;  5J0P A;  2IUB A;  3KOO A;  3QUQ A;  1UEV A;  4J9L A;  4NXU A;  1UT8 A;  3R9K A;  4RQN A;  5HP4 A;  2G0A A;  4X0A A;  3RH6 A;  4UD5 A;  3BS5 B;  2DVI A;  4XUS A;  2Z7J A;  4WJ3 B;  3OGU A;  1R8C A;  1JX4 A;  8ICT A;  2BPF A;  3ERC C;  3SYZ A;  2E8N A;  4US8 A;  5KL1 B;  4ECY A;  5KFV A;  4JV1 A;  1KNY A;  3OVA A;  3N4M B;  1UCV A;  2KOB A;  1NJY A;  4IRD A;  1OU5 A;  1QQ6 A;  3WK5 A;  4UB5 A;  3GII A;  5KG1 A;  1TK5 A;  4NV0 A;  5ALS A;  3SV4 A;  4RQM A;  2RFF A;  3PMN A;  4O68 A;  1Z4N A;  4EYH B;  4DFK A;  1BPX A;  5ALT A;  3L5K A;  1ZQH A;  1QTM A;  8ICC A;  2JH7 A;  5KL8 B;  4WC1 A;  4FS2 A;  4LEW A;  1ZQP A;  1ZD3 A;  4BXO B;  3QEA Z;  2G5I B;  5DEC A;  4G9B A;  1JIH A;  9ICP A;  1EXN A;  3THV A;  2BHN A;  1L8L A;  5F9N A;  3WFO A;  3OUY B;  4QZI A;  5E79 U;  2G08 A;  4NM2 A;  4RQ0 A;  4NM1 A;  5AK5 A;  2ZH2 A;  3WFR E;  3EZ5 A;  8ICF A;  3NVW A;  2C2R A;  4WC6 A;  1SV0 A;  8ICE A;  4YMO A;  3QU9 A;  5JUM A;  4KTQ A;  3GIM A;  4YVZ A;  3GU3 A;  3HRD D;  3IHQ B;  4WQK A;  4F5N A;  4DFJ A;  4B9S A;  4F72 A;  1HIW A;  2NRZ A;  5AI8 A;  1DOQ A;  1TFR A;  4ZOH C;  4AT8 B;  5AHX A;  4WC7 A;  2HCF A;  2B0C A;  1U48 A;  3QU5 A;  4QZB A;  2ALZ A;  3I1Y A;  7ICV A;  4PZN A;  4Y2V A;  5AI6 A;  1JXE A;  4ECS A;  2WF6 A;  2P6R A;  4OAH A;  3T5K A;  7ICH A;  5KFS A;  3WU2 U;  2ZUD A;  4P4P A;  3KKA A;  5KFR A;  4OJL A;  3NWI A;  4HYK A;  2H3V A;  1S0V A;  4M04 A;  4FO1 A;  1ZQT A;  1XU4 A;  2H3I A;  3V6J A;  3L4P A;  2ZH3 A;  4DFP A;  2G5H B;  4DSI A;  2LBO A;  1S10 A;  5KT7 A;  3KTQ A;  9ICU A;  5B3Q A;  4F5O A;  3SD7 A;  2WAQ C;  2AGO A;  4R64 A;  2W9C B;  1QQ5 A;  4I28 A;  3H0L B;  2C2D A;  4EBK A;  3CRX A;  3V72 A;  4FHY A;  2K8A A;  1VLB A;  5KG6 A;  3RH5 A;  2GLE A;  1XSN A;  3UMB A;  4O69 A;  1V4A A;  4ED2 A;  3OHB A;  7ICQ A;  2K8B B;  3Q8S B;  2JZB A;  1N5X A;  4O3N A;  3BS5 A;  2VA2 A;  8ICB A;  5ALL A;  3QEB Z;  3AL0 B;  3JCF A;  2BQ3 A;  3N7P D;  5AKX A;  4QIW F;  2KV2 A;  4EZ6 A;  2ZHB A;  3N28 A;  1UHU A;  4PHE A;  1D8L A;  4DL6 A;  2ZJ5 A;  4TQS A;  1XC9 A;  3MDA A;  5CA7 A;  3H0R B;  4DSL A;  3QU2 A;  4CNQ A;  3KHG A;  1RPL A;  5HML A;  2Y9T A;  2OCE A;  5ALI A;  3WK8 A;  4Y2U A;  5HRG A;  2VJ4 A;  3MGI A;  3QNM A;  4RWP A;  2F8K A;  2HBK A;  3T3F A;  4BXO A;  3C29 A;  5J8Y A;  4B9U A;  1KEJ A;  1XS9 D;  5TZV A;  2XVT A;  2Y0S F;  5CHG A;  4CE6 A;  3MGH A;  3OUY A;  4QW9 A;  2LYB A;  2IHN A;  1X9W A;  3HJ4 A;  4M9J A;  2DR7 A;  4Y2R A;  4KMO B;  1S8O A;  4Y2Q A;  3ICX A;  2HBJ A;  1FIQ A;  3WFS C;  1SWW A;  2ZIX B;  2XC9 A;  4NLG A;  3UM9 A;  2N1R A;  2DL0 A;  4KLS A;  1SKW A;  4B9T A;  3TQ1 A;  1LKY B;  2E1E A;  2YY6 A;  4DFD A;  3SV3 A;  2DKX A;  4G3I A;  4FHP A;  4DL5 A;  3U26 A;  4DQQ A;  5CB1 A;  4RQ6 A;  1BPY A;  2B51 A;  2YMM A;  2FMS A;  4AT8 A;  2YMP A;  2NO5 A;  3PW2 A;  3I28 A;  4BUG A;  2RQ5 A;  1AQ6 A;  3EYZ A;  7ICM A;  3SAG A;  4P2H A;  2F8L A;  3OHA A;  4O5K A;  1R8B A;  3Q8K A;  4NXZ A;  1ZQV A;  5DB8 A;  2KNJ A;  4NLN A;  4RNM A;  7ICF A;  1SV0 C;  4UB6 U;  4RPX A;  3TAQ A;  4US9 A;  3QZ7 A;  2W43 A;  3MC1 A;  2Y9U A;  1LVH A;  4UAW A;  8ICL A;  1JUD A;  3PML A;  3OWG A;  4AYB C;  3MDC A;  2W9C A;  3SEI A;  1NKC A;  3DEE A;  4YXM A;  1U9L A;  5ALE A;  2V4R A;  4CDG A;  4DL4 A;  1T3Q A;  3ISB A;  2DF4 B;  2HHW A;  3BQ1 A;  1SXE A;  5J2F A;  1YT3 A;  1COO A;  2M2U A;  3F5A A;  2W8K A;  1X6J A;  2YX8 A;  4I2I A;  2F3N A;  5AM5 A;  4QZG A;  4DFM A;  5KFC A;  3M6Z A;  4O6A A;  1SKR A;  2IMW P;  2ZH5 A;  2YN4 A;  4I2A A;  5DBB A;  4YR0 A;  5ALD A;  4C8L A;  2HMX A;  3N7S C;  3F2B A;  3WKC A;  3H7I A;  4RNN A;  4UAT A;  2LPE A;  2KIC A;  3RJF A;  2IBK A;  4Z6F A;  2J6T A;  2DPI A;  2ZH6 A;  4DS5 A;  1ED1 A;  3JPR A;  1NI3 A;  1NNL A;  5DLF A;  4DSK A;  9ICF A;  2KZ3 A;  3SZ2 A;  5HRF A;  1L3S A;  5J2D A;  1QSY A;  2AU0 A;  2BCV A;  2NO4 A;  2DGZ A;  3ED5 A;  1Z1V A;  3UXN A;  3UPQ A;  4XQ7 A;  4PHP A;  1KDH A;  1ZQI A;  1RYR A;  5ALM A;  5III A;  5ALG A;  3F53 A;  3MFH A;  3QXG A;  2ZIX A;  3BJY A;  4YCX A;  1N61 A;  4RU9 A;  1LKY A;  5J2B A;  2R18 A;  3H8S A;  2I9G A;  5J8Y C;  3K7D A;  4DF4 A;  4M47 A;  8ICR A;  3QUC A;  2KG5 A;  1MN8 A;  3TAN A;  2H3Q A;  2JEJ A;  2HBL A;  1N2X A;  5KG5 A;  5AM4 A;  1ECW A;  2JEI A;  2QKQ A;  2GO7 A;  4WQL A;  4R63 A;  4USA A;  1IV8 A;  5F3X B;  4X0B A;  2W9M A;  2IOF A;  5J29 A;  5ALH A;  4B9V A;  7ICR A;  5B5E U;  3GDX A;  1V97 A;  2C2E A;  2FMQ A;  5HR6 A;  1NZB A;  2K4P A;  3HIL A;  9ICN A;  3EW9 A;  4KLE A;  8ICN A;  2NRX A;  4MF8 A;  1RYS A;  2BBJ A;  1HJP A;  9ICI A;  2BKE A;  1ZQM A;  2P6U A;  4K4I A;  4M2Y A;  3SAF A;  3RJH A;  4KLF A;  2ZXI A;  5HRI A;  4EX7 A;  5KFW A;  5DQI A;  5AKK A;  1A76 A;  3GV8 B;  4X5V A;  3OJS A;  1NK5 A;  4QZC A;  1QH9 A;  2KIW A;  1L7O A;  4NXX A;  3SR6 A;  5JU5 A;  4ED0 A;  2YB1 A;  2EWR A;  2CRX A;  1VDV A;  4NKT A;  4LVS A;  3E58 A;  2K60 A;  4Y2P A;  3SMV A;  5J0Y A;  2MA1 A;  2NRK A;  1MSW D;  1U49 A;  1RZT A;  3H8J A;  3H8W A;  3UXP A;  4JV2 A;  2UVW A;  4ECW A;  4P4O A;  3C23 A;  4AT9 B;  1PX5 A;  4YP3 A;  4YQW A;  2JH1 A;  1TKD A;  1S97 A;  2G09 A;  4UAZ A;  2HHX A;  2C28 A;  9ICS A;  1ZXI A;  1S0O A;  2A1A A;  4KLU A;  1SL2 A;  4FO6 A;  5KFP A;  5AI4 A;  1ZYQ A;  3EWA A;  4YMN A;  3V6K A;  4MEX A;  1PK3 A;  2E1F A;  3Q8M A;  2B21 A;  4Q8F A;  3M8R A;  3RAX A;  5IIN A;  1Q3V A;  3NTU A;  2ZTD A;  4RPZ A;  1JAL A;  4BWJ A;  2Q66 A;  1V9P A;  1LB2 B;  4O0I A;  3WKE A;  5DKW A;  2HHS A;  3GV5 B;  3M6K A;  2FCL A;  5BOL A;  2KFN A;  2WF8 A;  5F9L A;  3EUB 2;  3MFI A;  7ICU A;  4QIW C;  1X40 A;  4UB4 A;  3D6J A;  4KLI A;  3NGD A;  4KB6 A;  1F5S A;  2HHP A;  1VJ5 A;  4JMU A;  5DG7 A;  3UQ0 A;  2NYV A;  5DED A;  4C4R A;  2FPK A;  2I6X A;  3M1Y A;  2XY5 A;  3MGV A;  4J9R A;  2KD1 A;  4QZD A;  4TUQ A;  4LZD A;  1PUZ A;  4DOC A;  2NRV A;  3IG5 A;  4EZ9 A;  4X4N A;  1SKS A;  4DL3 A;  2PKE A;  5EWG A;  4NJ8 A;  1L5U A;  5J0T A;  1X9X A;  1ARO P;  3MR3 A;  4FS1 A;  2LMR A;  3ZDB A;  1BPB A;  3TAR A;  1WUD A;  4IS7 A;  2XY7 A;  5KFY A;  5D49 A;  4QWE A;  5CHE A;  3ZI4 A;  2ZUC A;  2C22 A;  4B6J A;  4NLK A;  5DGA A;  5IIL A;  5HHI A;  5ALP A;  3RB4 A;  4NY8 A;  4WC5 A;  1UET A;  2ZJ8 A;  1SL1 A;  1TAQ A;  4KLT A;  2BCU A;  5IIM A;  1CI4 A;  3KBB A;  1R8A A;  4Y2J A;  1RXW A;  3KD3 A;  2A19 A;  2VJ5 A;  3WFP A;  5DDM A;  2OH2 A;  4DQS A;  2KSO B;  2AH5 A;  5CFT A;  2M2W A;  2W3S A;  1JI7 A;  4ECR A;  2HHU A;  4F4Z A;  2KHV A;  1ZQ1 C;  5CEH A;  2KVC A;  7ICL A;  4X4O A;  1RQL A;  1TK8 A;  2ZJA A;  1TK0 A;  4RQ1 A;  4PL2 A;  5DDY A;  2BE3 A;  4IG8 A;  4AT9 A;  3JPN A;  2FPM A;  1KTQ A;  4EP7 A;  4UAU A;  3N97 B;  1S76 D;  4RQ7 A;  2UVU A;  4AT7 B;  3BZK A;  2PXI A;  3I76 A;  4YN4 A;  2XY6 A;  1S9F A;  2AQ4 A;  3H38 A;  3B9J A;  4X4R A;  2ZIW B;  4UAS A;  2IHM A;  2AQ0 A;  4LEV A;  2EQY A;  5ALQ A;  7ICP A;  2W9A A;  5KFN A;  4NKU A;  1NKB A;  4UBC A;  4TUS A;  2DPJ A;  2PBE A;  4O67 A;  5J2C A;  1PZN A;  5DLG A;  5IIJ A;  3LWL A;  1SZH A;  1MA7 A;  3IRU A;  4GXI A;  2HVH A;  2EAN A;  5AK6 A;  3CYM A;  4NL9 A;  4ED7 A;  2YTU A;  5AM2 A;  4R8U B;  4YR2 A;  2ODG A;  1TAU A;  4ECT A;  5HHH A;  3D2Q A;  1B0X A;  2PMZ C;  5ALZ A;  5KG0 A;  4R66 A;  3A0B U;  3RRG A;  2W11 A;  2JGA A;  1MIY A;  4OAG A;  1WOT A;  4NXV A;  4O9M A;  2G06 A;  7ICO A;  2ZH7 A;  1SL0 A;  4F92 B;  1ZQR A;  3WKA A;  3ZDE A;  4M5D A;  4WC2 A;  4MHV A;  2F77 X;  3C21 A;  3C2M A;  4J9S A;  1JRO A;  5DB7 A;  1FFV A;  3QX7 A;  5ALX A;  1X6I A;  2WB1 F;  5KFT A;  2IA6 A;  2OHF A;  4WC0 A;  2QAR B;  3RH4 A;  4Q8E A;  4JV0 A;  3JZ0 A;  3V6H A;  2D8C A;  3KFU F;  1ZJN A;  1MQ3 A;  4QW8 A;  4YXJ A;  3RAQ A;  4EEK A;  3TAC B;  5J2K A;  1Z4O A;  3AQL A;  2PFO A;  5A0L A;  4B9N A;  2KJ8 A;  1NJX A;  7ICG A;  4PZO A;  2FI1 A;  3OPX A;  1A0P A;  4NXT A;  2KE7 A;  3C5G A;  4XA5 A;  3E2E A;  1IM4 A;  4JK1 A;  5DG9 A;  3HX0 A;  3AQF A;  4UB8 U;  5EWE A;  2PI4 A;  3QZ8 A;  3C2L A;  3PW7 A;  3OTQ A;  4GXJ A;  4CF5 A;  2KSO A;  4Q43 A;  4I2J A;  2GH1 A;  1GPJ A;  2MUT B;  2DQN B;  4JLZ A;  1UEU A;  3PX6 A;  1YZ7 A;  1JAJ A;  4KLL A;  2HVI A;  4ELV A;  1O08 A;  2JV3 A;  3NKU A;  2OYY A;  1TV9 A;  3HKZ C;  5KG4 A;  1BPE A;  1ZQA A;  4P0P B;  3NRZ A;  2MU2 A;  4BDP A;  4KLG A;  1UPH A;  3WK6 A;  4RWO A;  4DO9 A;  2EAP A;  5AKL A;  1Q79 A;  3HIY A;  5ALY A;  1NK0 A;  4AT7 A;  2ZH4 A;  4FHW A;  1SB3 C;  3PVX A;  5F2V O;  4DOB A;  3GIJ A;  1L3U A;  2VKQ A;  3RJJ A;  4FHX A;  4GIB A;  2HOF A;  3GFK B;  2ZIW A;  4J9Q A;  5HC9 A;  3H40 A;  4DF8 A;  3RB0 A;  1ZRN A;  3H4B A;  4KLJ A;  5AKJ A;  2ISO A;  1QLN A;  2ZXH A;  1UA1 A;  4PGY A;  3IP4 B;  3KHH A;  1M6Y A;  1BNO A;  1RXV A;  4QZH A;  1UQV A;  4U7C A;  2OEH A;  9ICB A;  1J97 A;  1X2I A;  4C7Y A;  5ALK A;  4R8U A;  4X4V A;  4YD2 A;  1R89 A;  4UQG A;  5J0R A;  1XO0 A;  2K89 A;  2KK0 A;  5DB6 A;  4RQ8 A;  1RDF A;  4WBY A;  5JTG A;  2W54 A;  2YB4 A;  1QCK A;  2F1J A;  4XRH A;  4F93 B;  2XIC A;  4A8E A;  5DBC A;  4EV6 A;  3AEV A;  3LWM A;  1QSL A;  2E8O A;  3PV8 A;  4WBZ A;  3C1Y A;  4EYI B;  5AKZ A;  4E0D A;  4EBD A;  4QWA A;  1ZQL A;  3KZX A;  4NL9 C;  2LM1 A;  2QAR A;  3BZC A;  4TUR A;  3HPO A;  1L3T A;  2ATL A;  5D46 A;  3G6V A;  4IR9 A;  4PGQ A;  4O3S A;  4C0Z A;  3NVV A;  3Q8R B;  5CRX A;  1XO1 A;  1BGX T;  9ICH A;  3PW4 A;  2M2T A;  2QB1 A;  3ISD A;  2ES6 A;  1UT5 A;  2HDO A;  1CEZ A;  5GTH U;  8ICU A;  4JWN A;  1IG6 A;  4PJ0 U;  5KT6 A;  3K1R B;  5KFG A;  4FBT A;  2IOH A;  5BOM A;  2GOL A;  2P35 A;  5KFE A;  5DQG A;  4Z6E A;  2XI9 A;  3KKA C;  1X9S A;  3PR5 B;  1FEZ A;  3E0F A;  4ACO A;  4IR1 A;  5IIO A;  5AIC A;  1CRX A;  3ZD9 A;  2BBH A;  5AM1 A;  4J9K A;  4DQI A;  2F1H A;  2HOI A;  3RJK A;  1O03 A;  5C0Y A;  2HN1 A;  3BQ0 A;  2RP5 A;  2MUT A;  4M6W B;  1WWU A;  4C4T A;  4QNL A;  3PW0 A;  2ZIU B;  2BPC A;  1XWL A;  4C7Z A;  1Q46 A;  9ICW A;  4DSF A;  3M9N B;  5KFK A;  4F5P A;  4NWI A;  2FE9 A;  4XJE A;  3H37 A;  1OXJ A;  2Y1I A;  4RZR A;  4MFC A;  1ZQF A;  4P0P A;  1KLN A;  2ZH1 A;  2ZUB A;  4QZE A;  1ZQJ A;  4JWM A;  4DLG A;  2W8L A;  4DOA A;  2HN2 A;  4PL1 A;  4KLO A;  8ICG A;  4P0Q B;  4QZ9 A;  4IRK A;  3G6Y A;  2BR0 A;  2BGW A;  2KZZ A;  1KFS A;  3PO5 A;  2G07 A;  1SXD A;  4EBC A;  5KFI A;  3QU7 A;  2B4V A;  5KFM A;  5GTI U;  5D4B A;  1ZD2 P;  1URJ A;  3HW8 A;  4YFK A;  1JRP A;  3PO4 A;  1ZOL A;  4J9O A;  4WCW A;  2JR5 A;  5J2H A;  7ICE A;  1SGG A;  2LM4 A;  4OJO A;  1DXS A;  2R8I A;  4WC3 A;  4GC6 A;  4GXK A;  2RDJ A;  8ICZ A;  5HRE A;  5J2I A;  4GC7 A;  3NUQ A;  1RYU A;  4IRC A;  5KFH A;  3UQ2 A;  2WFA A;  3MCR A;  4F4K A;  5G5H A;  2VA3 A;  2KJ9 A;  3LDA A;  4DLE A;  5AKG A;  3G6X A;  5J2J A;  2MAX A;  3HJE A;  3BQ7 A;  5J2E A;  3NRW A;  4LZG A;  1H38 A;  2JEG A;  4WH5 A;  5J0U A;  2ISP A;  5BPC A;  3T5L A;  5HMM A;  1NK7 A;  4DSE A;  3LVV A;  1K1S A;  2R8K A;  1ZJM A;  3TAD A;  3JPP A;  2E5S A;  5AK4 A;  1ZQO A;  3IDW A;  1T94 A;  4B9M A;  5CR0 A;  1A77 A;  4FZL A;  3LK9 A;  2ZTE A;  9ICX A;  4KN4 A;  3F2D A;  1DK2 A;  2I1Q A;  1MC8 A;  2GA9 D;  2KEY A;  4J03 A;  2JXJ A;  4CF4 A;  1WG8 A;  5AKY A;  3JPS A;  4KLQ A;  3PSI A;  3NVY A;  1JXL A;  2F44 A;  3EPI A;  4NLZ A;  4ELT A;  3EPG A;  5D61 A;  4LEZ A;  3RF9 A;  2PFN A;  5L9X A;  4OO1 J;  7ICI A;  2YMQ A;  5J0Q A;  5KT5 A;  2RHF A;  3PSF A;  5L1I A;  2RRD A;  4M6W A;  3HJ1 A;  4QWC A;  2DFL A;  1JMS A;  2ZIU A;  5AI9 A;  3RR7 A;  3JYY A;  2LYA A;  4ICA A;  2DWQ A;  4EEL A;  4M9H A;  5KG2 A;  5KFA A;  1L7P A;  3FM9 A;  1D8Y A;  1P7D A;  5ALF A;  3RBE A;  1B43 A;  4WOY A;  2H3Z A;  2R8H A;  3BQT A;  4X4P A;  5EWF A;  4OD0 A;  4ATB B;  5ALW A;  5J2A A;  1X66 A;  2E8M A;  5IIK A;  2FJ6 A;  4LJX A;  2HSZ A;  4P0Q A;  1COK A;  2R8J A;  3PY8 A;  1ZD5 A;  3CK6 A;  3Q8Q B;  2M2V A;  2W7P A;  3TFS A;  4F50 A;  4F4X A;  4KX5 A;  5ALN A;  3SEN A;  1V38 A;  2BCQ A;  1JQR A;  2HHV A;  3VC8 A;  3CP8 A;  3ETR A;  3ZD8 A;  5ALR A;  4LT6 A;  1Z3E B;  4M9G A;  3LQC B;  4UAR A;  4F5R A;  5AIB A;  1HUZ A;  4K98 A;  8ICY A;  3RJE A;  2P66 A;  2W04 A;  4PGX A;  4U6P A;  4I29 A;  1NK6 A;  1BNP A;  5J0X A;  5KT4 A;  5CFU A;  1N60 A;  3OV7 A;  3RRH A;  5L1L A;  1KFT A;  1ZQX A;  1WCL A;  3V7L A;  5AKE A;  5HR9 A;  1ZQG A;  3C18 A;  4F71 A;  4K8V A;  4AP9 A;  4E80 A;  5HRH A;  2HOQ A;  2HHQ A;  1L8O A;  4UBB A;  2A1J B;  2KMD A;  2DR5 A;  3H0M B;  3RTV A;  4EEB A;  2DRA A;  2B6G A;  3ER9 B;  4UB3 A;  4PH5 A;  3RB3 A;  4K4H A;  1VJ7 A;  4MEY A;  5KFL A;  3PZP A;  5CWR A;  4I2G A;  1N56 A;  2HW3 A;  2YQE A;  3IV6 A;  3QYP A;  1WYG A;  1ZQY A;  2Y0S C;  1ZET A;  5DBA A;  3Q8P B;  2E3T A;  3CW2 C;  4DQR A;  3ETL A;  3H39 A;  3L9D A;  3C1Z A;  4O5C A;  3NAS A;  4KIT B;  2KP7 A;  7ICJ A;  2JRZ A;  4GLX A;  4GFJ A;  3TAD C;  2KFZ A;  3QUT A;  2O5A A;  4Y2T A;  3B0X A;  1S0M A;  2NV3 A;  4O3O A;  5AKI A;  4NLB A;  3K4G A;  2R8G A;  5KFQ A;  4J9M A;  2XGP A;  5DQH A;  3ORY A;  4FZM A;  3UMC A;  3IN5 A;  4KLD A;  4RPY A;  1K1Q A;  1PVP A;  2UVV A;  2KTQ A;  1F0M A;  1NK8 A;  1L3V A;  2JZB B;  4FFD A;  4ECV A;  4RT2 A;  2ZIV B;  2XCA A;  9ICL A;  3RJI A;  3NYB A;  4ATB A;  4K99 A;  1S5L U;  4PHD A;  2JHD A;  2ID1 A;  4RQ2 A;  4EED A;  4RWN A;  2VIX A;  2A3V A;  3OVB A;  4ECQ A;  2BPG A;  3M9M B;  3LYS A;  4F5Q A;  1KRP A;  1IXR A;  5K4L A;  4BX9 C;  2AXT U;  2ZG6 A;  7ICK A; 
#chains in the Genus database with same CATH homology
 1JN3 A;  1RXV A;  1MIW A;  2AU0 A;  2BCV A;  1XSL A;  4Q45 A;  4C8M A;  4DL2 A;  4QZH A;  4QZA A;  2LYH A;  1YLQ A;  2Y1J A;  9ICB A;  3B0Y A;  4I2B A;  1X2I A;  5KFX A;  3UXN A;  4R65 A;  1U4B A;  3UPQ A;  3SI8 A;  4XQ7 A;  2HHT A;  1N48 A;  3QE9 Y;  4R8U A;  4PHP A;  3PR4 A;  4X4V A;  4FBU A;  4YD2 A;  1KDH A;  1R89 A;  4UQG A;  1ZQI A;  1DK3 A;  5J0R A;  5KFD A;  4YMM A;  3ISC A;  1RYR A;  4I2C A;  5III A;  5DB6 A;  4RQ8 A;  1UA0 A;  1DGS A;  4IQU A;  4WBY A;  3M9O B;  4ED1 A;  3V7K A;  3MFH A;  1NK9 A;  2KZM A;  4MF2 A;  2F1J A;  1ZQE A;  9ICK A;  4XRH A;  4F93 B;  1T7P A;  3BJY A;  4YCX A;  3FYH A;  4RU9 A;  5DBC A;  2XGQ A;  5J2B A;  2FLP A;  3H8S A;  2I9G A;  9ICV A;  4BGD A;  5KG3 A;  4DF4 A;  3LWM A;  1QSL A;  4M47 A;  8ICR A;  5KG7 A;  2UVR A;  7ICS A;  3PV8 A;  4WBZ A;  3TAN A;  3C1Y A;  4EYI B;  2JEJ A;  4E0D A;  4EBD A;  5KG5 A;  4ECU A;  4QWA A;  1ZQL A;  2JEI A;  4RQ4 A;  2FLL A;  4R63 A;  2A1J A;  1NJZ A;  1KSP A;  1S77 D;  3AQN A;  2DR8 A;  4X0B A;  3V7J A;  2J6U A;  5HRK A;  3MR5 A;  1Q78 A;  2W9M A;  4TUR A;  2BCS A;  1D9D A;  2VAN A;  3HPO A;  1L3T A;  2ATL A;  5D46 A;  3G6V A;  4IR9 A;  5J29 A;  4I2E A;  4PGQ A;  4PHA A;  4O3S A;  4M9N A;  2FLN A;  3Q8R B;  4B9V A;  5KFU A;  4KN7 A;  1XO1 A;  4KLH A;  7ICR A;  3GDX A;  1BGX T;  7ICN A;  2C2E A;  2FMQ A;  9ICH A;  3PW4 A;  2M2T A;  5DB9 A;  3ISD A;  9ICN A;  3EW9 A;  1UT5 A;  1T4G A;  1CEZ A;  3PW5 A;  4KLE A;  4ELU A;  8ICN A;  5KFB A;  2NRX A;  4Z6C A;  1ZQU A;  4MF8 A;  1RYS A;  4JWN A;  8ICU A;  3K75 D;  1HJP A;  9ICI A;  2BKE A;  1ZQM A;  2W9B A;  5EOZ A;  5KT6 A;  2P6U A;  5HNK A;  1ZQD A;  5KT3 A;  4K4I A;  5KFG A;  4FBT A;  4M2Y A;  3H37 A;  4X4T A;  5BOM A;  1ZQS A;  3RJH A;  3ZDC A;  5KFE A;  4YR3 A;  1U45 A;  3RR8 A;  5DQG A;  4Z6E A;  3HP6 A;  4KLF A;  5HRI A;  8ICQ A;  3C66 A;  3OJU A;  5J2G A;  3M8S A;  1X9S A;  3PR5 B;  4RWQ A;  5KFW A;  2V9W A;  5DQI A;  3H3A A;  4IR1 A;  1S0N A;  1A76 A;  4IQT A;  1FA0 A;  2O1P A;  3GV8 B;  2NRW A;  5DG8 A;  4F91 B;  4X5V A;  4F4W A;  1NKE A;  5IIO A;  3OJS A;  9ICC A;  5HRL A;  4S3N A;  1NK5 A;  4QZC A;  3ZD9 A;  5HRB A;  4IQV A;  4J9K A;  3RJG A;  2F1H A;  4DQI A;  3RJK A;  1NK4 A;  1ZQB A;  5J0P A;  2ZTC A;  2BCR A;  3BQ0 A;  3AU2 A;  2MUT A;  4M6W B;  4JUZ A;  4J9L A;  4ED0 A;  1UEV A;  1UT8 A;  3MBY A;  2FPL A;  3PW0 A;  5HP4 A;  4X0A A;  2BPC A;  1XWL A;  4XQ8 A;  3RH6 A;  4UD5 A;  9ICW A;  5KFZ A;  4LVS A;  4NKT A;  2DVI A;  4XUS A;  1VFG A;  5J0Y A;  1R8C A;  3OGU A;  1JX4 A;  4DSF A;  2NRK A;  8ICT A;  2ASD A;  3M9N B;  2BPF A;  5KFK A;  4F5P A;  3SYZ A;  1MSW D;  4FHV A;  1U49 A;  1RZT A;  3GV7 B;  4FH3 A;  3H8J A;  1X9M A;  3H8W A;  1ZQW A;  5KFV A;  4ECY A;  4JV1 A;  2Y1I A;  3UXP A;  4RZR A;  3GIK A;  4JV2 A;  4MFC A;  2UVW A;  1KNY A;  4ECW A;  3OVA A;  1BVS A;  3N4M B;  1ZQF A;  1KLN A;  4P4O A;  2ZUB A;  4EEY A;  4F2R A;  4QZE A;  4ECX A;  2F1I A;  1ZQJ A;  3C23 A;  2ZH1 A;  1NJY A;  4IRD A;  1OU5 A;  3OSN A;  4DLG A;  4JWM A;  4AT9 B;  2W8L A;  1PX5 A;  4O3Q A;  4UB5 A;  4DOA A;  1MIV A;  3GII A;  4QWB A;  4YP3 A;  4YQW A;  1T3N A;  5KG1 A;  5J0O A;  1TK5 A;  1TKD A;  1S97 A;  2PFP A;  4KLO A;  4DQP A;  4Z6D A;  8ICG A;  3SV4 A;  4UAZ A;  2HHX A;  2C28 A;  9ICS A;  4QZ9 A;  4IRK A;  2RFF A;  3G6Y A;  1S0O A;  3PNC A;  2BR0 A;  3PMN A;  1SL2 A;  2BGW A;  4EYH B;  4FO6 A;  4DFK A;  5KFP A;  1BPX A;  1ZQH A;  1QTM A;  2KZZ A;  1ZYQ A;  1KFS A;  8ICC A;  3PO5 A;  3EWA A;  4YMN A;  4KLM A;  3V6K A;  4MEX A;  4EBC A;  4FS2 A;  3Q8M A;  4WC1 A;  3MAB A;  3AQK A;  5KFI A;  4O3P A;  1ZQP A;  2B21 A;  4C8N A;  1T8E A;  4BXO B;  3QEA Z;  4Q8F A;  5KFM A;  2PFQ A;  5DEC A;  3M8R A;  1JIH A;  5D4B A;  3RAX A;  9ICP A;  3HW8 A;  4YFK A;  4TUP A;  1EXN A;  5IIN A;  9ICT A;  3PO4 A;  4J9O A;  3THV A;  9ICO A;  4WCW A;  3NTU A;  2ZTD A;  2BHN A;  4KLU A;  4RPZ A;  4B9L A;  9ICR A;  4BWJ A;  5J2H A;  4QZF A;  2Q66 A;  1V9P A;  5F9N A;  1LB2 B;  3WFO A;  3OUY B;  4DWI A;  7ICE A;  2RDI A;  4QZI A;  4O0I A;  4NKU A;  8ICK A;  3H4D A;  1F5A A;  4NM2 A;  4RQ0 A;  4NM1 A;  2R8I A;  4WC3 A;  5DKW A;  2HHS A;  4GC6 A;  3GV5 B;  4GXK A;  2RDJ A;  1ZQK A;  2GWS A;  5CP2 A;  8ICZ A;  2ZH2 A;  3WFR E;  5HRE A;  5J2I A;  4GC7 A;  4IRC A;  3EZ5 A;  4I2H A;  5KFH A;  3UQ2 A;  5BOL A;  2KFN A;  4MFA A;  8ICF A;  3GIL A;  4F4K A;  5F9L A;  2C2R A;  4WC6 A;  2VA3 A;  3MFI A;  4YMO A;  8ICE A;  4WC4 A;  5JUM A;  5DGB A;  4O5E A;  4KTQ A;  7ICU A;  3LDA A;  4IQW A;  4UB4 A;  4YVZ A;  3GIM A;  3IHQ B;  4DLE A;  3T5H A;  4F5N A;  4DFJ A;  3NGD A;  2BQR A;  1BPD A;  4KLI A;  4B9S A;  2XO7 A;  3G6X A;  5J2J A;  8ICH A;  2MAX A;  5L1J A;  5J2E A;  2HHP A;  4ZH4 A;  2NRZ A;  3KHR A;  5C5J A;  3HWT A;  4LZG A;  3TI0 A;  5DG7 A;  3UQ0 A;  1DOQ A;  1TFR A;  1H38 A;  2JEG A;  3TFR A;  5J0U A;  9ICA A;  2FPK A;  2ISP A;  5DED A;  5BPC A;  4AT8 B;  3T5L A;  5HMM A;  4Q44 A;  3ZDD A;  4WC7 A;  2XY5 A;  1NK7 A;  1U48 A;  4QZB A;  4J9R A;  4DSE A;  1K1S A;  4F4Y A;  4QZD A;  4TUQ A;  2ALZ A;  8ICJ A;  4LZD A;  4RQ3 A;  4DOC A;  7ICV A;  2R8K A;  1JXE A;  1ZJM A;  4ECS A;  2NRV A;  2P6R A;  4EZ9 A;  4X4N A;  1SKS A;  4YD1 A;  3JPP A;  3T5K A;  5EWG A;  5KFS A;  4QZ8 A;  2ZUD A;  4DL3 A;  1L5U A;  4P4P A;  5KFR A;  1ZQO A;  5J0T A;  2OWO A;  4B9M A;  5CR0 A;  1A77 A;  1ARO P;  7ICH A;  3MR3 A;  4FS1 A;  3LK9 A;  4HYK A;  2ZTE A;  5KTQ A;  1BPB A;  3ZDB A;  4M04 A;  3TAR A;  1S0V A;  4KN4 A;  1XU4 A;  1ZQT A;  9ICX A;  1DK2 A;  2AGQ A;  2I1Q A;  1MC8 A;  3V6J A;  2XY7 A;  2ZH3 A;  5KFY A;  5D49 A;  4QWE A;  4DFP A;  4J9P A;  4DSI A;  3JPT A;  1S10 A;  4C8K A;  2ZUC A;  2C22 A;  5KT7 A;  3BDP A;  3KTQ A;  4NLK A;  9ICU A;  3JPS A;  5DGA A;  5IIL A;  5HHI A;  4F5O A;  3RB4 A;  1ZQZ A;  4NY8 A;  4KLQ A;  4WC5 A;  1UET A;  2ZJ8 A;  2AGO A;  5KFO A;  4R64 A;  1TAQ A;  1SL1 A;  3EPI A;  1JXL A;  4YG2 A;  2W9C B;  4KLT A;  4ECZ A;  4ELT A;  4I28 A;  4ED8 A;  4NLZ A;  3EPG A;  4BWM A;  5IIM A;  2BCU A;  2PFN A;  5L9X A;  5CJ7 A;  3MR6 A;  2C2D A;  4C8O A;  1R8A A;  1RXW A;  7ICI A;  4EBK A;  5J0Q A;  3WFP A;  5DDM A;  3V72 A;  5KT5 A;  4FHY A;  4DQS A;  5KG6 A;  8ICS A;  5L1I A;  4F3O A;  3RH5 A;  2M2W A;  4M6W A;  8ICO A;  3HJ1 A;  4ECR A;  1XSN A;  1LV5 A;  2HHU A;  4QWC A;  2DFL A;  2VA8 A;  3OVS A;  1V4A A;  4F4Z A;  4ED2 A;  3OHB A;  1JMS A;  7ICQ A;  3JYY A;  3Q8S B;  2JZB A;  3RR7 A;  1NOM A;  4O3N A;  2VA2 A;  8ICB A;  3QEB Z;  3OSP A;  4I2F A;  1Z00 B;  2BQ3 A;  1ZQC A;  4M9H A;  5KT2 A;  5KG2 A;  7ICL A;  4X4O A;  4KMU A;  5KFA A;  1TK8 A;  2ZHB A;  4EZ6 A;  2ZJA A;  4PHE A;  1XSP A;  1TK0 A;  1D8L A;  1D8Y A;  2H5X A;  4RQ1 A;  4DL6 A;  4EBJ A;  5DDY A;  3RBE A;  1B43 A;  2ZJ5 A;  2BE3 A;  4UAY A;  4TQS A;  2R8H A;  4X4S A;  3BQT A;  3MDA A;  1XC9 A;  4IG8 A;  5CA7 A;  3UPS A;  3JPN A;  4AT9 A;  4X4P A;  5EWF A;  4ATB B;  2FPM A;  1KTQ A;  5J2A A;  3RBD A;  4DSL A;  3N97 B;  4DEZ A;  3KHG A;  4EP7 A;  5IIK A;  1S76 D;  4RQ7 A;  2UVU A;  4AT7 B;  1RPL A;  4RUC A;  2PXI A;  5HML A;  4YN4 A;  2XY6 A;  1S9F A;  4FH5 A;  2AQ4 A;  3H38 A;  3C2K A;  4TQR A;  2R8J A;  1NJW A;  4X4R A;  3RB6 A;  3PY8 A;  5J0W A;  4RUA A;  4CCH A;  2IHM A;  2AQ0 A;  5HRG A;  2M9N A;  3MGI A;  3PX4 A;  3Q8Q B;  2XCP A;  7ICP A;  2W9A A;  2M2V A;  4ED3 A;  5KFN A;  4F50 A;  3TFS A;  9ICJ A;  4F4X A;  3PX0 A;  1NKB A;  4RWP A;  4F2S A;  4UBC A;  4TUS A;  2DPJ A;  9ICQ A;  2PBE A;  2KN7 A;  4BXO A;  3T3F A;  2BCQ A;  2ASL A;  1JQR A;  2HHV A;  4K4G A;  5J2C A;  1PZN A;  2ASJ A;  2DRB A;  5DLG A;  5IIJ A;  3LWL A;  4B9U A;  1KEJ A;  2ZHA A;  3ZD8 A;  1XS9 D;  5TZV A;  4LT6 A;  3FDS A;  4GXI A;  2HVH A;  1Z3E B;  5CHG A;  4M9G A;  4ED7 A;  3MGH A;  3LQC B;  3OUY A;  4QW9 A;  2AJQ A;  4R8U B;  4YR2 A;  1D9F A;  1X9W A;  2IHN A;  3HJ4 A;  1TAU A;  2JEF A;  4F5R A;  4ECT A;  5HHH A;  1CUK A;  1HUZ A;  4M9J A;  8ICY A;  3RJE A;  2P66 A;  2DR7 A;  1HUO A;  4DS4 A;  4QWD A;  5KG0 A;  4PGX A;  4R66 A;  4I29 A;  1NK6 A;  3RRG A;  1BNP A;  3WFS C;  5J0X A;  5HRD A;  5KT4 A;  2XC9 A;  2V4Q A;  9ICM A;  1MIY A;  3MR2 A;  1WOT A;  4J9N A;  4NLG A;  4O9M A;  3JPQ A;  7ICO A;  2ZH7 A;  4KLS A;  1SL0 A;  3OV7 A;  4F92 B;  3RRH A;  3KHL A;  3ZDE A;  1SKW A;  1ZQR A;  5L1L A;  4B9T A;  4M5D A;  1KFT A;  4WC2 A;  1ZQX A;  1WCL A;  3V7L A;  3TQ1 A;  2J6S A;  3C21 A;  5KFJ A;  5HR9 A;  1ZQG A;  3C2M A;  3C18 A;  4RNO A;  4J9S A;  3SV3 A;  4E80 A;  5HRH A;  1TVA A;  5DB7 A;  8ICX A;  4G3I A;  4FHP A;  4DL5 A;  4DQQ A;  5CB1 A;  4RQ6 A;  1C7Y A;  1BPY A;  2FMS A;  3GQC A;  2HHQ A;  5KFT A;  4UBB A;  4AT8 A;  2BQU A;  2A1J B;  2IA6 A;  8ICA A;  4WC0 A;  3PW2 A;  2DR5 A;  3RH4 A;  3RTV A;  3AU6 A;  4Q8E A;  2DRA A;  5L1K A;  4JV0 A;  3JZ0 A;  3V6H A;  4UB3 A;  4PH5 A;  3EYZ A;  3RB3 A;  4P2H A;  7ICM A;  1ZJN A;  4K4H A;  1VJ7 A;  4RQ5 A;  3OHA A;  1MQ3 A;  4O5K A;  3Q8K A;  1R8B A;  4UD4 A;  4MEY A;  4NXZ A;  4QW8 A;  5KFL A;  4YXJ A;  4RT3 A;  3BQ2 A;  5CWR A;  1ZQV A;  3RAQ A;  1MQ2 A;  2BDP A;  4I2G A;  5DB8 A;  4NLN A;  4RNM A;  5J2K A;  1N56 A;  7ICF A;  1SZP A;  3JPO A;  3C5F A;  4RPX A;  2HW3 A;  9ICG A;  3AQL A;  3TAQ A;  2PFO A;  4B9N A;  1ZQY A;  3QZ7 A;  1NJX A;  8ICP A;  3WFQ E;  1ZET A;  5DBA A;  7ICG A;  3Q8P B;  1WCN A;  3AQM A;  1ZQN A;  2W9B B;  2ZH8 A;  8ICI A;  4UAW A;  4M9L A;  9ICE A;  8ICL A;  4DQR A;  3ETL A;  3H39 A;  3L9D A;  3C1Z A;  3PML A;  4O5C A;  3C5G A;  4XA5 A;  4KIT B;  3MDC A;  3E2E A;  1IM4 A;  4JK1 A;  5DG9 A;  3HX0 A;  2W9C A;  7ICJ A;  2KP7 A;  1NKC A;  2PI4 A;  5EWE A;  3QZ8 A;  4GLX A;  4YXM A;  1QSS A;  3ZDA A;  2KFZ A;  3C2L A;  1U9L A;  2V4R A;  2O5A A;  1S0M A;  3B0X A;  4E7X A;  3PW7 A;  1KFD A;  2ZH9 A;  4O3O A;  4GXJ A;  2PI5 A;  3TAP A;  1ZQQ A;  4E8F A;  4ED6 A;  4DL4 A;  4Q43 A;  4I2J A;  4DSJ A;  3K4G A;  2MUT B;  3ISB A;  5KFQ A;  2R8G A;  2WTF A;  4J9M A;  3BQ1 A;  2HHW A;  8ICV A;  2XGP A;  5DQH A;  3ORY A;  5J2F A;  4X4Q A;  1NZP A;  1COO A;  2M2U A;  4EBE A;  1Z00 A;  4UB1 A;  4KLD A;  4RPY A;  1K1Q A;  2UVV A;  1UEU A;  2W8K A;  3PX6 A;  2KTQ A;  4KLL A;  1JAJ A;  1NK8 A;  1L3V A;  2JZB B;  4P4M A;  4I2I A;  2FMP A;  4ELV A;  2HVI A;  4ECV A;  4RT2 A;  4QZG A;  4DFM A;  2XCA A;  4I27 A;  1TV9 A;  2Q0Z X;  9ICL A;  5KFC A;  1NO5 A;  5KG4 A;  1BPE A;  2NRT A;  4UB2 A;  1ZQA A;  1SKR A;  2IMW P;  4BDP A;  3HT3 A;  4O3R A;  3AUO A;  3RJI A;  3NYB A;  4KLG A;  1Y88 A;  4I2A A;  1B22 A;  4ATB A;  4RWO A;  2ZH5 A;  1TFW A;  4DO9 A;  5DBB A;  4YR0 A;  1BPZ A;  1Q79 A;  3HIY A;  1NK0 A;  4C8L A;  8ICW A;  4AT7 A;  2ZH4 A;  4FHW A;  4X4U A;  1U47 A;  1TFY A;  3T5J A;  3H7I A;  4RNN A;  3PVX A;  4PPX A;  4DOB A;  3GIJ A;  5F2V O;  5J0S A;  1L3U A;  3RJF A;  3UXO A;  3RJJ A;  2IBK A;  4F8R A;  4FHX A;  4PHD A;  2ID1 A;  4Z6F A;  4RQ2 A;  2J6T A;  4RWN A;  3GFK B;  7ICT A;  4J9Q A;  2DPI A;  3OVB A;  4ECQ A;  2ZH6 A;  2BPG A;  3M9M B;  4DS5 A;  3H40 A;  4F5Q A;  3Q8L A;  4DF8 A;  3RB0 A;  4M0A A;  5HC9 A;  3IM1 A;  2DR9 A;  3JPR A;  3H4B A;  2AGP A;  4DL7 A;  1KRP A;  5KFF A;  5DLF A;  1IXR A;  4KLJ A;  8ICM A;  2ISO A;  1QLN A;  4DSK A;  1UA1 A;  2KZ3 A;  3SZ2 A;  4I2D A;  1L3S A;  4MFF A;  7ICK A;  9ICF A;  5J2D A;  1QSY A;  5HRF A;  4PGY A;  3KHH A;  1BNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...