5BPCA

Dna polymerase beta ternary complex with a templating 5clc and incoming datp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
313
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Intrinsic mutagenic properties of 5-chlorocytosine: A mechanistic connection between chronic inflammation and cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, ligase/dna
total genus 111
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5bpcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5bpcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5bpcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5bpcA03
3ZDBA 2W9CB 4I2GA 4X4SA 2R8IA 1UEUA 4TURA 3HW8A 1JIHA 2ZJAA 3TAPA 1XSNA 1DOQA 3T5JA 9ICUA 1ZQOA 2ASLA 5KFIA 4UB5A 4TUSA 1S77D 4O3QA 4X0AA 1V9PA 2V4RA 4X5VA 4EBCA 2ASJA 3H4BA 4DQPA 7ICPA 4C8KA 4F2SA 5DQHA 4WCWA 1JX4A 4UB2A 3EPIA 3EW9A 4Q44A 4EZ6A 5J0OA 4O5EA 1ZQFA 4K4HA 2M2TA 2R8GA 2MAXA 1TK8A 2ZH6A 3QEAZ 3Q8MA 2GWSA 3NYBA 1ZQCA 1U49A 4RPZA 2V9WA 2DRBA 4R64A 2XY7A 4GC6A 3ZD8A 1S97A 3AUOA 4G3IA 9ICNA 1R8BA 5DB8A 1Z3EB 3GIMA 2AGPA 1U4BA 1NKEA 2ZH9A 3UPQA 4Z6DA 4DWIA 1UETA 4WBZA 3LDAA 5KTQA 2V4QA 5TZVA 4QZIA 3RRHA 2PI5A 4WC2A 1BPDA 3HIYA 1JQRA 1XS9D 4X4UA 2PXIA 5IIOA 1KNYA 4NM2A 2IHMA 4DF4A 4J9KA 3LK9A 2LYHA 3MFIA 4I2HA 1MIWA 3ZD9A 4WBYA 4JV1A 4F93B 4YN4A 1U47A 2Q66A 1ZQTA 5J0QA 1PZNA 4FBUA 3V7LA 2XGPA 4NY8A 4DQSA 4FHYA 2FPMA 3SYZA 4FS1A 3RB4A 1NK7A 3RR7A 4EP7A 3G6XA 3OUYA 1VFGA 2BGWA 3ZDCA 9ICBA 1EXNA 3TARA 1L3TA 2C2EA 3PO5A 2HHQA 2ID1A 5HMMA 4O5KA 2F1HA 3AU2A 4ED8A 3LWLA 7ICLA 4Z6CA 4YQWA 4ECRA 2J6TA 4I2CA 1V4AA 3PX6A 1ZQQA 4YXMA 3OGUA 2VANA 4KTQA 2O5AA 2PBEA 8ICVA 4PGYA 2W9CA 5KG4A 4KLGA 1CUKA 4QZGA 4Q45A 4DSIA 1ZQAA 2NRTA 4MFCA 3ETLA 1QLNA 2XC9A 1X9MA 5J0UA 5BOLA 3TI0A 5IIKA 4QWAA 5KG6A 4DSJA 4KLFA 5J0SA 4RUCA 4RWNA 4RWPA 5J2BA 3PW4A 2B21A 5KFOA 4GXJA 4X4OA 4RQ8A 4DQRA 3OJSA 1MQ2A 2C2DA 7ICKA 8ICJA 3PY8A 7ICEA 3OJUA 3AQNA 2I1QA 4JK1A 2BQ3A 2IMWP 4PH5A 4PGQA 3PW0A 4IRDA 2W9BB 3IM1A 3PW2A 1QTMA 4UBCA 4F4YA 4E0DA 4BXOB 3M8SA 4IQUA 2BCRA 2HHTA 4TQRA 3WFRE 9ICLA 3MR5A 4ED7A 4E80A 3KHHA 4PHAA 4ECYA 4M9JA 3SI8A 2IA6A 4KLUA 4DSFA 3RB6A 5KFPA 8ICPA 4DFKA 2DR9A 4ELVA 4XA5A 4P4MA 1IM4A 3GDXA 2W8KA 4IRCA 1YLQA 1B22A 4KLEA 1F5AA 3HJ1A 2ZUCA 3RH5A 9ICIA 3NTUA 1NJWA 4WC4A 3V6HA 4XQ7A 2ZH1A 3RRGA 5L9XA 1TAQA 4C8MA 4I2FA 2KTQA 2ISOA 5KFJA 1ZQIA 2AJQA 3GFKB 3PMNA 3BQ1A 2HHSA 4K4IA 8ICRA 1KLNA 2BCVA 3M9MB 1TKDA 4RQ5A 5KFMA 1MC8A 5J2KA 4ED3A 3GV5B 4FBTA 3TQ1A 4BWJA 1KFSA 3UQ0A 4WC5A 3THVA 3QZ7A 5JUMA 1N56A 4UAYA 3V7JA 4IR9A 4RUAA 1ZQXA 4EBKA 5KFUA 3HWTA 3AU6A 2P6UA 4UB1A 1XSLA 2XY6A 4F5OA 3Q8KA 1TVAA 5KFCA 2VA2A 2HHVA 3JPPA 9ICSA 4O3PA 1D9DA 3MBYA 3C2MA 3RJHA 9ICMA 4RNOA 7ICGA 8ICBA 1UA1A 4J9MA 4YP3A 3PW5A 1T4GA 4NM1A 9ICHA 4TUPA 1ZQUA 4BGDA 1R89A 2HHUA 4I2DA 4QZEA 3OV7A 4NKTA 4GLXA 7ICJA 1XU4A 4ZH4A 1SKSA 1QSSA 1UT8A 4NLNA 9ICAA 4P4OA 4F4ZA 4IQVA 2XCAA 2R8HA 3JYYA 1BNPA 3V6KA 4MF8A 4X4TA 1DK2A 1KFDA 3EYZA 1L3UA 2ZH4A 1AROP 3RB3A 1LV5A 2W9BA 2M2WA 2ZHAA 5KFVA 4F4XA 1BPXA 4BXOA 2IBKA 4M5DA 4M9HA 5KG1A 4KMUA 1ZJNA 3HX0A 2NRZA 8ICYA 1K1QA 5DBAA 1T7PA 4I27A 5KFXA 5KT4A 3KHRA 8ICTA 2KP7A 3C21A 8ICWA 2BPCA 4YMNA 3SZ2A 3ORYA 1NJZA 3HP6A 4M47A 5DQGA 2ZHBA 4F50A 2FMPA 2DR7A 3ISDA 5KFHA 4ECZA 4KLLA 4J9NA 1DGSA 1WCNA 4Z6FA 4YCXA 5DG9A 3OHBA 3RTVA 4DF8A 1T3NA 1ZQLA 8ICEA 1MIVA 4RWQA 3JZ0A 5DDMA 4DSLA 2R8JA 5DGAA 5J0XA 1D9FA 2FMSA 8ICXA 4X0BA 5L1LA 4F4WA 5KFKA 2KN7A 4Q43A 5IINA 5CR0A 4RQ7A 4FO6A 2RDIA 2Y1IA 1Z00B 4QZ8A 4I28A 5HHIA 5D46A 1NKBA 7ICRA 1IXRA 3Q8QB 4F92B 1NKCA 2WTFA 5D49A 1NK4A 1MIYA 1U9LA 4DL6A 3OHAA 5J0WA 2C28A 2BCQA 2RDJA 4DSEA 3KHLA 5J2GA 1L3VA 4UAWA 4DS5A 1ZQZA 3G6YA 1SZPA 3K4GA 3RBDA 1KSPA 4ECVA 4KLIA 4X4NA 3H8SA 3ISBA 4O5CA 3N4MB 4PHEA 9ICVA 9ICPA 1NO5A 2ZTDA 4RPYA 7ICSA 4E7XA 5HRGA 5DB9A 1SL1A 1ZQKA 2FPLA 4PGXA 5HP4A 3JPRA 3RBEA 1RYRA 1HUZA 3WFQE 4NLKA 4TUQA 2R8KA 1BPYA 1SL2A 3NGDA 1CEZA 5HRLA 4GXKA 4ED2A 1S0NA 3AQMA 5F9NA 3GV7B 3RH4A 4O3RA 4QW8A 3UXPA 4RQ0A 2ATLA 1RXWA 2W9MA 2OWOA 4FH5A 5KG5A 2C22A 4DFMA 2FPKA 8ICCA 4QZAA 4AT9B 3C1YA 3Q8SB 4YFKA 4PHDA 4F5QA 1UT5A 2BR0A 1TFRA 1L5UA 2FLNA 4DLGA 8ICHA 4X4VA 4UBBA 2BCSA 4NKUA 4IG8A 3TFRA 3C2KA 4X4RA 2PFPA 4LZGA 1ZQYA 2UVWA 4M04A 3H8JA 1ZQDA 4M9LA 3EZ5A 3EPGA 5HRHA 3OVBA 5J2FA 8ICZA 5BOMA 5HC9A 5HHHA 4YR2A 1MQ3A 5KFAA 4MEXA 1ZQNA 2ZH2A 4B9MA 4C8OA 3QE9Y 5HRIA 2NRKA 2F1JA 3MR3A 3MGHA 3V7KA 2HVIA 3Q8LA 3H37A 5EWEA 2ZH8A 3PX4A 5IIJA 1NJXA 4B9LA 4M9NA 3HJ4A 4UD5A 2W8LA 5KT7A 2BCUA 4F5RA 5KFWA 5J0YA 3C2LA 3ZDAA 4B9NA 5J2IA 1S0VA 3GV8B 7ICFA 4QWDA 1Z00A 3G6VA 4YMMA 4F91B 3B0YA 3UQ2A 5KFYA 4MFAA 2W9AA 4DO9A 1NK8A 2XO7A 4ECTA 3QEBZ 4PHPA 2JEIA 5KFFA 1R8AA 1UEVA 3UXNA 1SKRA 4QWEA 1QSYA 4KLOA 2FLLA 3JPSA 3C66A 4EEYA 1X9WA 2PFOA 4KLQA 1NK6A 3WFPA 2ZTCA 2BPGA 3Q8RB 2ZTEA 2BDPA 3PNCA 3MDAA 4ECQA 8ICSA 4B9VA 5HRFA 3SV4A 5DG7A 1KRPA 4CCHA 7ICOA 4P4PA 8ICKA 3RJJA 4K4GA 2ZJ8A 4UAZA 5DBBA 4B9TA 5CHGA 5J2HA 2PFNA 1WCLA 7ICUA 4Q8EA 4RQ1A 3WFSC 3H4DA 1ZQHA 8ICLA 4LT6A 3C5GA 4IRKA 4LZDA 5J2DA 4FH3A 5DLGA 4ED0A 5KFGA 4FHPA 5IILA 5KFQA 2ISPA 4NLGA 1B43A 4O0IA 4B9SA 5HRKA 1BPEA 3ZDEA 4I2BA 5HRDA 2KFNA 4WC6A 2ASDA 2XCPA 2FMQA 2KZ3A 5J0PA 2JZBB 8ICOA 4AT9A 3MGIA 4KITB 3M8RA 1XC9A 4ELTA 8ICFA 3PR4A 2BQUA 1KEJA 3ISCA 4ECWA 8ICNA 1VJ7A 5F2VO 3PW7A 2O1PA 2P6RA 2DR5A 2A1JB 4RQ2A 4GC7A 3IHQB 4J9QA 5J29A 5CP2A 5CJ7A 3T3FA 4KLTA 1U45A 2NRXA 3PR5B 3QZ8A 2XY5A 1ZQMA 4XRHA 3MR2A 4J9SA 4RZRA 1S0MA 3H39A 4I29A 8ICIA 4C8NA 4KLJA 4Z6EA 3C1ZA 5KT2A 4E8FA 1KTQA 4YXJA 2XGQA 4FS2A 4DOCA 3RAQA 5C5JA 3HT3A 4DOAA 1NK9A 4M2YA 4X4PA 1JXEA 4P2HA 3JPTA 3GQCA 4AT8B 4KLHA 1ZQRA 4IR1A 3FDSA 2J6SA 4O9MA 2BKEA 4DEZA 2DFLA 1TV9A 4DOBA 1DK3A 4MEYA 4UB3A 4EBDA 3PO4A 2M2VA 3H7IA 4QZDA 5DLFA 1ZJMA 5HRBA 1R8CA 5KFZA 2NRWA 4AT7B 4M6WB 3SV3A 4JWNA 1LB2B 5DG8A 5J2EA 4NLZA 2KFZA 4WC0A 1BPZA 8ICUA 4KN4A 4UB4A 2PI4A 1NK5A 1A76A 1ZQWA 4ECSA 1ZQJA 4FHVA 4BDPA 3ZDDA 9ICTA 9ICCA 1UA0A 1Q79A 3M9NB 4RQ4A 3RAXA 9ICRA 2HHWA 3WFOA 4WC3A 4DL5A 3UPSA 5EWGA 4EBJA 7ICMA 3T5LA 5KG7A 4R66A 2KZZA 1HUOA 2JEGA 5HMLA 4YG2A 1JXLA 5KFSA 7ICQA 1H38A 4DQIA 1JAJA 3V72A 1BGXT 2AQ0A 5KFNA 4QWCA 5DB7A 3OSPA 5KFDA 1COOA 1U48A 1SKWA 4DL7A 2JZBA 3BJYA 5KFEA 3N97B 9ICWA 4RWOA 3T5KA 4ECXA 5L1IA 4M9GA 4J9OA 5KFLA 2P66A 2ZJ5A 2DPIA 2BHNA 3K75D 3BQTA 3TAQA 4QZBA 2A1JA 4R8UB 5CWRA 4F2RA 3AQKA 5DB6A 3OVSA 9ICXA 4S3NA 4DL2A 2ZUBA 4UQGA 4J9PA 4GXIA 2HVHA 3RJIA 2AGOA 4TQSA 5HNKA 2MUTB 3E2EA 4JV2A 9ICGA 3JPNA 3JPOA 1KFTA 3L9DA 2DR8A 2HW3A 4RT2A 1S76D 1NOMA 3GILA 4ELUA 4O3OA 2AQ4A 2F1IA 3KHGA 1ZQPA 1KDHA 5HREA 1QSLA 4FHWA 4AT8A 3H8WA 5F9LA 4DLEA 4EBEA 1TK0A 4EZ9A 5KG0A 3B0XA 8ICMA 1NZPA 4WC7A 2DVIA 5J2AA 3RJEA 4M0AA 3RH6A 4B9UA 4NXZA 3TFSA 2HHPA 2ZUDA 4QZCA 4RNNA 4QW9A 2ALZA 2ZH3A 1A77A 2AGQA 8ICQA 4AT7A 4M6WA 4WC1A 9ICKA 3MR6A 5KT6A 1K1SA 5DKWA 5IIMA 3PV8A 2J6UA 4YD1A 2UVVA 3MABA 5J0TA 1WOTA 3H3AA 3C23A 4R65A 1TAUA 4I2IA 7ICHA 3C5FA 4EYHB 2NRVA 1C7YA 3JPQA 1RPLA 2BE3A 4F5NA 3TANA 3RJFA 4J9RA 1X9SA 4HYKA 1T8EA 4YD2A 5DBCA 1XSPA 3RJGA 3OSNA 1TFWA 3UXOA 1JMSA 5DEDA 4QZFA 4KLMA 5CA7A 2BQRA 4RNMA 3RR8A 4DSKA 7ICVA 4ATBB 4F8RA 4R63A 4YR0A 2IHNA 4JV0A 1S10A 4JWMA 3LQCB 4KLSA 8ICAA 7ICNA 5KT3A 1PX5A 3GIIA 2Q0ZX 3HPOA 4I2AA 5BPCA 1MSWD 8ICGA 1JN3A 4R8UA 3V6JA 1N48A 1BVSA 4DL4A 2AU0A 3BDPA 4DS4A 3FYHA 5KFBA 2Y1JA 1ZQEA 3RB0A 4MFFA 2ZH7A 1ZQVA 2C2RA 2MUTA 2ZH5A 4DL3A 2RFFA 4IQTA 5L1KA 3AQLA 1RZTA 4YMOA 4ED1A 4ED6A 3H38A 4RU9A 9ICEA 5CB1A 5DGBA 5DQIA 3MDCA 2DPJA 3KTQA 5DECA 4LVSA 3PMLA 4J9LA 1TFYA 4I2JA 3M9OB 4X4QA 1ZYQA 4DFJA 3OVAA 2DRAA 4JUZA 1RYSA 4EYIB 3H40A 5KFTA 4QZHA 4IQWA 5HR9A 4Q8FA 3OUYB 4I2EA 4KN7A 2KZMA 2JEFA 3RJKA 4KLDA 3EWAA 9ICQA 5J2CA 5EOZA 4FHXA 4RQ3A 4XQ8A 4RT3A 3MFHA 2BPFA 1BPBA 1HJPA 1X2IA 4C8LA 4YVZA 9ICJA 2I9GA 1D8YA 4BWMA 1XO1A 4PPXA 3LWMA 2M9NA 1SL0A 1RXVA 2HHXA 4RQ6A 9ICFA 7ICTA 1BNOA 4RPXA 4ECUA 5EWFA 5J2JA 4O3NA 5L1JA 5J0RA 5KT5A 1ZQSA 4UD4A 2VA8A 5KFRA 4DQQA 1ZQBA 1L3SA 1Y88A 5DDYA 4XUSA 1ZQGA 1FA0A 2PFQA 2H5XA 5D4BA 1S9FA 4O3SA 1TK5A 1XWLA 1S0OA 2FLPA 9ICOA 3BQ2A 5IIIA 2UVRA 5KG2A 2UVUA 4QZ9A 4F4KA 7ICIA 2M2UA 3C18A 4ATBA 3BQ0A 3GIKA 4F5PA 4DFPA 3PVXA 1Q78A 4F3OA 3T5HA 3Q8PB 3GIJA 3PX0A 2VA3A 1NJYA 4QWBA 2JEJA 1OU5A 1D8LA 1ZETA 1NK0A 4YR3A 5KG3A 4MF2A
chains in the Genus database with same CATH superfamily
3ZDBA 2W9CB 4I2GA 3CW2C 2W04A 3LYSA 3HW8A 1JIHA 3TAPA 1L7OA 1DOQA 4CF5A 9ICUA 1V9PA 3HKZC 2ASJA 3NVWA 4DQPA 7ICPA 4F2SA 3M7DA 4Q44A 5J0OA 5B5EU 4K4HA 2HCFA 2ZXHA 3QEAZ 3NYBA 4RPZA 2MRLA 4P0QA 2W11A 4G3IA 5ALTA 5DB8A 3GIMA 2HI0A 3UPQA 4QIWF 4Z6DA 4DWIA 4WBZA 3LDAA 2YY6A 3RRHA 2PI5A 3SD7A 1BPDA 1TE2A 1JQRA 1XS9D 4UW9A 2IHMA 3LK9A 2LYHA 4I2HA 4WBYA 4JV1A 4YN4A 1U47A 2Q66A 1ZQTA 3AM9A 4DQSA 3SYZA 1NK7A 3RB4A 3AEVA 3G6XA 5ALMA 1QQ6A 2CXYA 4PZOA 1L3TA 2C2EA 1N2XA 5AM5A 2F1HA 4O5KA 2Y9TA 4ECRA 3OGUA 1Q8KA 1WWUA 1A0PA 5KG4A 1CUKA 2GO7A 5D63A 3ETLA 1QLNA 2XC9A 3M1YA 3TI0A 5IIKA 5AI6A 4CNQA 4RUCA 4X4OA 8ICJA 5AKYA 3OJUA 2HBKA 2F8KA 2BQ3A 2IMWP 4PH5A 2G0AA 2JH1A 4E0DA 2KJ9A 4TQRA 2W54A 4E80A 4ED7A 4PHAA 4ECYA 4M9JA 5ALZA 4KLUA 1KBUA 2KJ8A 8ICPA 2DR9A 4ELVA 1B22A 4UB8U 2ZUCA 1NJWA 3V6HA 2HN2A 4C8MA 4CF4A 2HHSA 8ICRA 2AH5A 2BCVA 1TKDA 4RQ5A 3UQ0A 3THVA 5JUMA 4UAYA 1ZQXA 3H0MB 1TVAA 2HHVA 2VA2A 5AM3A 3JPPA 4O3PA 1D9DA 4FZMA 5AM4A 3C2MA 1FFUA 3K1ZA 4Y2YA 1ZQUA 3KBBA 4NXTA 3HRDD 4ZH4A 9ICAA 4P4OA 3WKDA 1BNPA 3V6KA 4X4TA 2KKVA 1KFDA 4CGZA 3EYZA 1L3UA 1LV5A 2W9BA 1LKYB 2KICA 1C20A 2YMMA 2IBKA 5CHEA 4M9HA 4NXXA 1ZJNA 2HN1A 2HDOA 5AK5A 3S6JA 5KFXA 3FC4A 4C4TA 8ICTA 2NYVA 2NO4A 1L7PA 5KL1B 2A3VA 4YMNA 2KOBA 3I76A 5DQGA 2FMPA 3ISDA 4J9NA 4YCXA 3BZKA 4Z6FA 1JRPA 4DF8A 1T3NA 3JZ0A 4DSLA 2R8JA 4X0BA 2NO5A 3WKBA 5IINA 5CR0A 4RQ7A 4I28A 2G07A 2RDIA 4G9BA 1AQ6A 5D46A 7ICRA 2EDUA 1NK4A 5D49A 4KMOB 2D6FC 2JXJA 4UAWA 3G6YA 5ALHA 2DUYA 4X4NA 4O67A 3N4MB 4PHEA 9ICVA 4RPYA 5HRGA 4WQKA 4PGXA 3JPRA 4NLKA 5D61A 4ZOHC 1S0NA 5F9NA 1M6YA 4KLTA 3UXPA 4OCZA 5KG5A 4HAIA 2FPKA 2IOFK 4PHDA 1L5UA 2BCSA 1HEKA 4X4RA 3F5AA 2PFPA 1ZQYA 2GA9D 3EPGA 1Z1BA 5HC9A 4YR2A 1MQ3A 2ZH2A 4B9MA 3DDHA 4C8OA 5HRIA 3QU5A 2E3TA 3MR3A 3H37A 1HIWA 2EQYA 2KNJA 5KT7A 4F5RA 3C2LA 3ZDAA 7ICFA 4QWDA 1Z00A 3G6VA 1F44A 1NK8A 3QEBZ 4Y2JA 4PHPA 5KFFA 3J81j 1SKRA 3JPSA 4EEYA 2ZTCA 2BDPA 3PSIA 4ECQA 2DBYA 4LEVA 4B9VA 1Q46A 5DG7A 5ALYA 2ZJ8A 5DBBA 4QJFB 5J2HA 2XVTA 2PFNA 4OJ6A 4Q8EA 4QIWC 4Y2VA 4NLGA 1B43A 1PK1B 5HRKA 4LEYA 2EZZA 3ZDEA 1IG6A 2KFNA 4WC6A 1PVRA 5J0PA 4KITB 3M8RA 1L6NA 3PR4A 1JI7A 2BQUA 2WB1F 5F2VO 2F77X 3PW7A 2DR5A 3ALRA 2EAMA 3IHQB 1RQLA 3PR5B 2XY5A 4XRHA 3MR2A 5ALRA 4I29A 3H39A 4C8NA 4KLJA 4US9A 3C1ZA 3SR6A 4E8FA 1FFVA 4M2YA 2LPEA 3RAQA 4X4PA 5CRXA 4AT8B 3JPTA 3GQCA 4O9MA 2J6SA 2KSOA 1DK3A 3TACB 4UB3A 4DOBA 2M2VA 3H7IA 4MHVA 5DLFA 2WFAA 3SV3A 1LB2B 2KFZA 1NK5A 1ZQJA 1ZQWA 2RHFA 4BDPA 9ICCA 3WKEA 4RQ4A 9ICRA 2H3ZA 3UPSA 4K8VA 7ICMA 3T5LA 3HJEA 1HUOA 4YG2A 5KFSA 1Z19A 4RWOA 5G5HA 4J9OA 2ZJ5A 3K75D 3TAQA 4O68A 4QZBA 1GPJA 4S3NA 4I0UA 2PMZF 5GTIU 3ETRA 3L9DA 5CFSA 4JV2A 4EV6A 3JPNA 1KFTA 1JUDA 2HW3A 1B4FA 5AIBA 2K4HA 3GILA 4ELUA 2F1IA 3KHGA 1T94A 1KDHA 4OAGA 2F76X 8ICMA 2DVIA 1ZQ1C 4RNNA 4QW9A 2IOHA 2AGQA 4AT7A 3VC8A 4JLXA 5KT6A 3PV8A 2UVVA 4YD1A 3IV6A 4I2IA 5ALNA 4U6PA 3E58A 2NRVA 4F5NA 1XO0A 2G08A 5DBCA 3RJGA 1TFWA 3SAFA 4RNMA 3RR8A 4F8RA 3D2SA 8ICAA 2OCEA 1L7NA 5L1MA 3KZXA 2G5IB 1ZOLA 4R8UA 1N48A 2WF7A 2AU0A 1YT3A 1Z4OA 3FYHA 5KFBA 5ALJA 1ZQVA 2C2RA 1RZTA 4ED1A 2I5HA 3LVVA 3PMLA 4UATA 4WJ3B 1RYUA 2YN4A 4X4QA 2DRAA 4DFJA 3AL0B 4EELA 4EYIB 3H40A 5KFTA 2KIWA 4QZHA 4P0QB 4I2EA 1QQ7A 2KZMA 3RJKA 4KLDA 3B9JA 3EWAA 5EE0A 1CI4A 3MFHA 1BPBA 1X2IA 3AQEA 1D8YA 1N5XA 2M9NA 9ICFA 7ICTA 2LBOA 4UAVA 5L1JA 4BUGA 5AI5A 3N28A 3SAGA 1FA0A 1XWLA 2UVUA 7ICIA 4QZ9A 2HBJA 4ATBA 3Q8PB 3BS5A 4QWBA 4C0ZA 1OU5A 5JTIA 1NK0A 3BS7A 4MF2A 5HR6A 1WUDA 2R18A 1S77D 4X0AA 1F5SA 2V4RA 4X5VA 4WCWA 4C8KA 1JX4A 1V38A 4O5EA 2M2TA 2R8GA 2GWSA 1U49A 3EUB2 3QNMA 4OAIZ 9ICNA 1R8BA 1UETA 2B56A 3OTQA 3ICXA 3HIYA 4X4UA 5IIOA 4NM2A 2QKQA 3MFIA 4F93B 3BZCA 4OD0A 4WH5A 2WB1C 1KQQA 2RLTA 5J0QA 3SEIA 4DCCA 4FHYA 2FPMA 3RR7A 4FS1A 5A0LA 3OUYA 1YZ7A 9ICBA 2VKQA 2ZIXA 3PO5A 2ID1A 3AU2A 3LWLA 4BJQA 2J6TA 4I2CA 4KTQA 2PBEA 3UM9A 4PGYA 5ALLA 3QU9A 2GLEA 2JGAA 5E79U 4DSJA 5KAFU 4JB3A 1SWVA 3PW4A 2GAFD 2W7OA 5KFOA 4RQ8A 1URJA 4USAA 2B51A 2C2DA 7ICKA 3PY8A 3AQNA 2W9BB 3IM1A 3PW2A 4F4YA 3M8SA 4MKPA 2BCRA 3H0LB 9ICLA 2LMRA 1X40A 2F44A 3SI8A 4DSFA 3RB6A 2CRXA 1IM4A 4IRCA 1NI3A 3WU2U 3NTUA 4WC4A 2ZH1A 2XI9A 5F3XB 1SV4A 5KFJA 2AJQA 3GFKB 5KL8B 4K4IA 2PMZC 1KLNA 5KNIA 1LVHA 2MA1A 5J2KA 4UASA 3V7JA 2D8CA 2P6UA 4F5OA 3KFUF 2K60A 4FO1A 3MBYA 4Y2XA 2G5HB 7ICGA 4J9MA 2K8AA 3GZFA 4TUPA 1R89A 4I2DA 4QZEA 3OWGA 4NKTA 4GLXA 1XU4A 1SKSA 2Y0SF 2XCAA 3SAHA 5B66U 1SWWA 4Y2QA 1OXJA 2F2AB 3RB3A 2ZHAA 4BXOA 2NRZA 8ICYA 2ZIVA 1SIJA 5KT4A 2KP7A 1NJZA 3ORYA 4NLBA 4M47A 5KFHA 4PL1A 1WCNA 4RWQA 1ZQLA 5DGAA 1D9FA 5KFKA 4Q43A 4FO6A 1NNLA 1Z00B 1NKBA 4O6AA 1PUZA 5AKHA 1IXRA 3MCRA 2EAPA 1MIYA 4DL6A 5J0WA 2C28A 5J2GA 3RBDA 4DS5A 1ZQZA 3ISBA 2DKXA 4E7XA 1ZD3A 1ZQKA 2FPLA 5HP4A 1RYRA 4PZNA 4ED2A 3CNHA 3GV7B 4O3RA 4QW8A 4BX9C 4RQ0A 2ATLA 4Y2SA 2W9MA 4A8EA 3CK6A 4F5QA 1Q3VA 2P35A 5ALKA 2HSZA 4DLGA 5D62A 3BQ7A 4IG8A 3TFRA 4LZGA 4M04A 5HRHA 1ZQDA 1Z1VA 5J2FA 5HHHA 4MEXA 3Q8LA 3PX4A 5IIJA 1NJXA 4M9NA 3HJ4A 3JCFA 4UD5A 2W8LA 5KFWA 3KOOA 2LYAA 2EAOA 5JRTA 3UQ2A 1QCKA 2Y9UA 4MFAA 2XO7A 2KSOB 2D3DA 2FI1A 5AKLA 3VCBA 1RQNA 3WFPA 2BPGA 2WF6A 2JMGA 4P4PA 3PHZA 5AI9A 4IS7A 3NWIA 7ICUA 1UQVA 4RQ1A 3WFSC 8ICLA 3C5GA 4FH3A 3M6ZA 4LZDA 2N1RA 5DLGA 4ED0A 4FHPA 5KFQA 4JLZA 2KHQA 4B9SA 4O69A 2KKPA 4I2BA 5TISU 2XCPA 4OJLA 8ICOA 4AT9A 4OAHA 2YMQA 5ALEA 4ECWA 4GC7A 5CP2A 1ZXIA 4J9SA 3AN1A 3WK6A 1RDFA 4Z6EA 2XGQA 1S5LU 3FAHA 3HT3A 4DOAA 5AM0A 4P2HA 2YB1A 1ZQRA 2BKEA 4KX3A 4EBDA 1R8CA 4QZDA 2RQ5A 5KFZA 4AT7B 5H2FU 4NLZA 1BPZA 8ICUA 4UB4A 5EE1A 3C28A 4ECSA 2LHTA 4EEKA 3NRZA 3M9NB 3WFOA 2HHWA 5KAIU 4WC3A 4DL5A 1J97A 2KZZA 4EGWA 3K7DA 7ICQA 5AKZA 5KFNA 2AQ0A 2PKEA 1U48A 5AKIA 2BZFA 4R8UB 2DWQA 4DL2A 4UQGA 4J9PA 4GXIA 3NUQA 2EWRA 4B6JA 4EENA 4TQSA 9ICGA 4F71A 2DR8A 4RT2A 2EZXA 1NZBA 4K98A 4O3OA 5AK6A 3NKUA 3H8WA 4DLEA 4EBEA 1TK0A 4EZ9A 1NZPA 3QU2A 4WC7A 5J2AA 4M0AA 4NXZA 1N63A 4K9AA 2ZH3A 4M6WA 2Y0SC 2FJ6A 5IIMA 2J6UA 3H3AA 3QX7A 7ICHA 3C29A 2W7PA 2BE3A 1DGJA 3RJFA 1X9SA 1T8EA 3QUCA 1XSPA 3UXOA 5DEDA 5CA7A 3A0BU 2F8LA 2OM6A 7ICVA 4ATBB 4R63A 2IHNA 3BS5B 1S10A 1VDVA 4FFDA 4KLSA 3A0HU 5ALDA 5KT3A 1PX5A 2Q0ZX 4I2AA 4CE6A 5BPCA 3ER9B 8ICGA 1L7MA 4DS4A 1ZQEA 2ZH7A 2RFFA 4IQTA 1KL9A 2EZYA 2H3IA 5AM2A 3MDCA 3KTQA 4I2JA 3M9OB 1ZYQA 1P7DA 4JUZA 4CF3A 1QH9A 5J2CA 1UHUA 4RQ3A 1IV8A 1HJPA 4C8LA 2KHVA 3KKAA 4UB6U 4BWMA 1XO1A 4PPXA 2FE9A 4OJ5A 4KX5A 4RPXA 2A1AA 2WHEA 1L3SA 1Y88A 5DDYA 5ALOA 1ZQBA 1ZQGA 3OUYB 2H5XA 5D4BA 2OEHA 4EX7A 2DKZA 1TK5A 4O3SA 3BQ2A 3C18A 2M2UA 2ZIXB 1Q78A 3T5HA 3GIJA 2VA3A 1YZ6A 2EANA 3PSPA 4X4SA 2XICA 5AM1A 1COKA 1XSNA 2ASLA 4UB5A 4TUSA 1GO3F 4EBCA 3H4BA 3EPIA 2OH2A 3EW9A 2ZH6A 4Y2TA 2MAXA 3Q8MA 2YMPA 1KN5A 1ZQCA 4GIBA 2DRBA 3AUOA 4AP9A 4FZLA 2WAQF 1Z3EB 1NKEA 1U4BA 5KTQA 2V4QA 1VJ5A 2LKYA 2PXIA 1KNYA 4J9KA 3ZD9A 2FCLA 1PZNA 2XGPA 4NY8A 1VFGA 4EP7A 2GH1A 2BGWA 3ZDCA 1EXNA 3TARA 2KE7A 4ED8A 2YMLA 7ICLA 2VANA 3UMCA 1B0XA 5ALXA 2RRDA 5ALSA 4Q45A 4QZGA 4DSIA 1ZQAA 2B4VA 4MFCA 1X9MA 3NS1A 5J0UA 3RF9A 3F53A 4KLFA 5J0SA 5J2BA 2B21A 1WWVA 1D8BA 2Q4TA 2I1QA 5AKKA 3PW0A 4IRDA 4UBCA 4BXOB 2HHTA 3WFRE 3KHHA 2KG5A 4RQNA 2IA6A 4PL2A 5KFPA 2ZIVB 4DFKA 4XA5A 3MGVA 3RH5A 9ICIA 3R9KA 3RRGA 5L9XA 1TAQA 1ZRMA 2JH7A 5HR7A 2K4EA 2QARA 3M9MB 1DRGA 4ED3A 4K9BA 1KFSA 4WC5A 3WK7A 2CN1A 5C0YA 1ECWA 4RUAA 4IR9A 1A6SA 2JHDA 3AU6A 4UB1A 1L8LA 3TADA 2XY6A 3Q8KA 5KFCA 4UAUA 1X6JA 2LM4A 4RNOA 8ICBA 1UA1A 4YP3A 1T4GA 3M6KA 4BGDA 2HHUA 3OV7A 2QB0A 1UT8A 4F4ZA 2R8HA 2QB1A 5EE3A 4MF8A 2K8CB 5EE9A 1DK2A 2ZH4A 2KMDA 4M5DA 5KG1A 3HX0A 4WQLA 1OUQA 3C21A 8ICWA 2BPCA 2OXOA 3HP6A 4ECZA 1DGSA 3RTVA 4KM5A 1MIVA 3QXGA 3NVOA 2FMSA 4F4WA 2Y1IA 2K4PA 4CDGA 2ES6A 2DF4B 5ALPA 1U9LA 1N61A 1ZD4A 5JTGA 2BCQA 3KHLA 1KSPA 1SZPA 1X66A 4ECVA 3SQIA 2XIDA 7ICSA 1SL1A 3RBEA 1K5OA 4LEWA 3H0RB 1BPYA 1FO4A 1CEZA 5HRLA 1X6IA 3IDWA 1SV0A 2OWOA 3E0FA 4DFMA 8ICCA 4QZAA 1PVPA 2OYYA 3C1YA 4AT9B 4YFKA 1UT5A 1TFRA 2FLNA 3NVVA 4NKUA 3I28A 3KKAC 3C2KA 3KZIU 3H8JA 4M9LA 3OVBA 5CEHA 5B3QA 3QE9Y 2NRKA 2F1JA 4K99A 3V7KA 4C7ZA 3QUBA 5J8YA 4B9NA 5J0YA 1S0VA 3N7PD 5FP0A 4IC9A 4C7YA 4YMMA 4F91B 5KFYA 4ECTA 1OW5A 1R8AA 2MSNA 1UEVA 4QWEA 4DFDA 1QSYA 2FLLA 5G5GA 4KLQA 3Q8RB 1Z4NA 3MDAA 5HRFA 3SV4A 4C4RA 1KRPA 4CCHA 4B9TA 3DEEA 2WAQC 2KD1A 1WCLA 4LT6A 4IRKA 5J2DA 5KFGA 4N7RA 1T3QA 2FMQA 2KZ3A 4FE3A 8ICFA 2YQEA 1XC9A 1JALA 2MU2A 1VJ7A 3ISCA 8ICNA 2O1PA 4RQ2A 4J9QA 5J29A 4O3MA 3T3FA 5ALWA 1SXDA 2NRXA 3QZ8A 1S0MA 2FDRA 2HBMA 8ICIA 5KT2A 4FS2A 4YXJA 1NK9A 2ZIWA 1RG6A 4KLHA 4IR1A 1TV9A 4MEYA 3PO4A 2NRWA 4M6WB 3AMZA 3WKAA 5DG8A 3F2DA 5ALFA 4HX0A 2E8NA 1N5WA 1A76A 4FHVA 2YTUA 5K4LA 2KJ5A 3ZDDA 1Q79A 1PK3A 5EWGA 1V97A 2BBJA 2JEGA 1H38A 4DQIA 1UCVA 5AI0A 3OSPA 5KFDA 1COOA 1SKWA 4DL7A 2JZBA 3WKCA 3N97B 5KFEA 9ICWA 5L1IA 4EEBA 1ZD2P 2DQNB 5AIAA 2A1JA 5CWRA 4F2RA 4K97A 2H3QA 2ZUBA 5HNKA 3E2EA 3JPOA 2VJ4A 1S76D 1NOMA 5ALQA 1QSLA 4FHWA 5F9LA 3B0XA 3OPXA 3N7SC 3RJEA 2HHPA 2ZUDA 1QQ5A 4QZCA 3NVYA 2HMXA 2ODGA 3TADC 1A77A 1SB3C 4FZNA 4WC1A 9ICKA 3MABA 4R65A 5AKJA 1TAUA 3SENA 3CRXA 3C5FA 3SMVA 3F2BA 4EYHB 1C7YA 3JPQA 1RPLA 4J9RA 4YD2A 4P0PA 3OSNA 2A19A 4QZFA 2ZG6A 1MN8A 4DSKA 3IP4B 3CP8A 4YR0A 4JV0A 4AYBF 4JWMA 3LQCB 3IG8A 4ICAA 3GIIA 1JN3A 3V6JA 1BVSA 4DL4A 3BDPA 2MUTA 4DL3A 5L1KA 4RQMA 2AHOB 1V85A 2W03A 2E1FA 5DQIA 5DECA 4J9LA 5B3PA 4JMUA 3ZI4A 4OO1J 5AK4A 4IQWA 4Q8FA 3IN5A 2JEFA 3IRUA 2L5YA 5ALVA 4RT3A 2BPFA 4YVZA 9ICJA 3QU4A 3LWMA 3QYPA 4ECUA 3K1RB 5J2JA 1S8OA 5KT5A 4UD4A 5KFRA 1SV0C 9ICOA 2FLPA 1S0OA 2UVRA 4F4KA 2NV3A 2H3FA 3PVXA 5AI8A 1NJYA 2JEJA 1D8LA 2ISPA 4FH5A 2ZIUA 1FEZA 2R8IA 4TURA 2ZJAA 3PZPA 3T5JA 1ZQOA 5KFIA 4O3QA 5AHXA 5J8YC 5DQHA 4UB2A 3QU7A 1UEUA 4EZ6A 1ZQFA 1TK8A 2JV3A 2EH9A 1L8OA 2V9WA 4KB6A 4R64A 2F3NA 2XY7A 4GC6A 3ZD8A 1S97A 4NLCA 2AGPA 2E8OA 2ZH9A 5TZVA 4EX6A 2IHOA 4QZIA 4WC2A 2KV2A 3IG5A 1SGGA 1MIWA 4DF4A 1O08A 4FBUA 3V7LA 2DL0A 2QARB 2GOLA 2HHQA 5HMMA 3WK5A 1SZHA 4Z6CA 4YQWA 4NXVA 1V4AA 3PX6A 1ZQQA 4YXMA 2O5AA 8ICVA 2RP5A 2M0NA 2W9CA 3H8MA 4KLGA 2NRTA 2HOQA 5BOLA 3FM9A 4QWAA 5KG6A 2O6KA 2KVCA 4RWNA 2QB0B 4RWPA 4GXJA 4DQRA 3OJSA 1MQ2A 7ICEA 3WK9A 4JK1A 4PGQA 1QTMA 3L3FX 4PJ0U 4IQUA 3MR5A 3PSFA 5AKEA 2W3SA 2H3VA 4NL9A 2LI6A 4P4MA 3GDXA 2W8KA 1YLQA 5AICA 4KLEA 1F5AA 3HJ1A 4EEDA 2E5SA 4XQ7A 4CRXA 4I2FA 2KTQA 2YB4A 2ISOA 3PMNA 3BQ1A 2WF5A 5KFMA 1MC8A 3D6JA 3GV5B 4FBTA 3TQ1A 4BWJA 2VIXA 3O0FA 3QZ7A 1N56A 4EBKA 5KFUA 3HWTA 1XSLA 3D2NA 9ICSA 3WK4A 2I6XA 4Y2RA 3RJHA 9ICMA 1X9XA 3GU3A 3PW5A 4NM1A 9ICHA 4GFJA 7ICJA 2ESEA 3NRWA 1QSSA 4NLNA 3JYYA 4IQVA 3N7RC 2G09A 4ACOA 1AROP 2M2WA 5KFVA 4F4XA 1BPXA 3EF2A 4KMUA 1K1QA 5DBAA 1T7PA 4I27A 3KHRA 4WOYA 5CFUA 2AXTU 4AYBC 3SZ2A 2ZHBA 4F50A 2DR7A 1UPHA 4KLLA 3AQLA 5DG9A 3OHBA 8ICEA 1KW4A 5DDMA 8ICXA 5J0XA 4OAFA 5L1LA 4NXUA 2KN7A 4QZ8A 5HHIA 3Q8QB 4F92B 1NKCA 3L4PA 2WTFA 2K8BB 3OHAA 2K4IA 1N62A 2ZXIA 3QUQA 2RDJA 4DSEA 1XNSA 1L3VA 2OHFA 3K4GA 4KLIA 2Z7JA 3H8SA 4O5CA 3WK8A 9ICPA 4C4SA 1NO5A 2ZTDA 5DB9A 4Y2UA 2KK0A 1HUZA 3WFQE 4TUQA 2E1EA 2R8KA 1SL2A 3NGDA 2KIVA 4Y2PA 4GXKA 1CRXA 3AQMA 3RH4A 2WF8A 1ED1A 1RXWA 3TKAA 2C22A 5GTHU 1LKYA 3Q8SB 8ICHA 4X4VA 2BR0A 3L5KA 4UBBA 3ER8C 1DXSA 2UVWA 4US8A 3EZ5A 8ICZA 5BOMA 5KFAA 1ZQNA 3MGHA 2HVIA 2ZH8A 5EWEA 4J03A 4B9LA 2BCUA 3PSTA 2ZIWB 5J2IA 4C80A 3GV8B 2JRZA 3B0YA 4DO9A 2W9AA 5ALIA 2B6GA 2JEIA 3ED5A 3QUTA 4QNLA 3UXNA 4KLOA 3HKZF 3C66A 1X9WA 2PFOA 4NWIA 1NK6A 2ZTEA 2LM1A 3PNCA 8ICSA 7ICOA 2K89A 8ICKA 3RJJA 4K4GA 4UAZA 5CHGA 2W3RA 3H4DA 1ZQHA 2IUBA 1O03A 5IILA 4O0IA 2JR5A 1BPEA 5HRDA 2ASDA 3F5EA 2JZBB 4IL6U 3MGIA 4ELTA 3D2QA 1F0MA 1WYGA 1KEJA 3MC1A 2P6RA 2HOFA 2A1JB 5CJ7A 1U45A 2QLTA 1ZQMA 1SXEA 4RZRA 3ERCC 1KTQA 3CYMA 4DOCA 3LVWA 5C5JA 1JXEA 2E8PA 3NASA 3FDSA 4DEZA 3ONNA 2DFLA 5AKGA 1ZJMA 5HRBA 5CFTA 4JWNA 1TAMA 3UMGA 5J2EA 5JU5A 4WC0A 4KN4A 2PI4A 2W43A 1PVQA 9ICTA 1UA0A 4XJEA 3RAXA 4P0PB 4LEZA 4EBJA 1J2NA 5KG7A 4R66A 5HMLA 1JXLA 1PK1A 1ZRNA 2LYBA 1JAJA 3KD3A 3V72A 1BGXT 4QWCA 5DB7A 2VJ5A 3BJYA 3T5KA 4ECXA 4M9GA 4NV0A 1RM6C 4NJ8A 5KFLA 4U7CA 1J2MA 2P66A 1MA7A 4NL9C 2DPIA 2BHNA 3BQTA 3AQKA 5DB6A 3OVSA 9ICXA 5AI4A 5ALUA 2E8MA 2HVHA 1ZD5A 1FIQA 3RJIA 2AGOA 2MUTB 4LJXA 3RFAA 2AQ4A 5HREA 1ZQPA 4NXWA 4AT8A 5KG0A 4K96A 3RH6A 4B9UA 3TFSA 2BBHA 2ALZA 2KVSA 8ICQA 3MR6A 1K1SA 5DKWA 2CPRA 1WOTA 1N60A 5J0TA 3C23A 2DGZA 3DV9A 5T14A 3HILA 3TANA 1JROA 2WF9A 4HYKA 1JMSA 4KLMA 2BQRA 3T79A 5AKXA 1KKXA 7ICNA 1X42A 3HPOA 2ZIUB 1IIPA 2IOFA 1MSWD 3U26A 2B0CA 2Y1JA 3I1YA 3RB0A 2BDUA 4MFFA 2ZH5A 1VLBA 4YMOA 4ED6A 3H38A 4RU9A 9ICEA 5CB1A 5DGBA 2DPJA 4LVSA 1TFYA 2G06A 3OVAA 1RYSA 2W55A 5HR9A 4KN7A 9ICQA 5EOZA 4FHXA 4OJPA 4XQ8A 5ALGA 2I9GA 4F72A 1SL0A 4UARA 5AK3A 3NVZA 1RXVA 2HHXA 4RQ6A 1BNOA 5EWFA 2HBLA 4O3NA 2YX8A 5J0RA 4OJOA 1ZQSA 2VA8A 4DQQA 3F2CA 3AQFA 4XUSA 2PFQA 1S9FA 2KEYA 5IIIA 5KG2A 3BQ0A 3GIKA 4F5PA 4DFPA 2HOIA 4F3OA 1Q3UA 3PX0A 1WG8A 5KG3A 1ZETA 1ZQIA 4YR3A 3UMBA
chains in the Genus database with same CATH topology
3ZDBA 2W9CB 4I2GA 4X4SA 2R8IA 1UEUA 4TURA 3HW8A 1JIHA 2ZJAA 3TAPA 1XSNA 1DOQA 3T5JA 9ICUA 1ZQOA 2ASLA 5KFIA 4UB5A 4TUSA 1S77D 4O3QA 4X0AA 1V9PA 2V4RA 4X5VA 4EBCA 2ASJA 3H4BA 4DQPA 7ICPA 4C8KA 4F2SA 5DQHA 4WCWA 1JX4A 4UB2A 3EPIA 3EW9A 4Q44A 4EZ6A 5J0OA 4O5EA 1ZQFA 4K4HA 2M2TA 2R8GA 2MAXA 1TK8A 2ZH6A 3QEAZ 3Q8MA 2GWSA 3NYBA 1ZQCA 1U49A 4RPZA 2V9WA 2DRBA 4R64A 2XY7A 4GC6A 3ZD8A 1S97A 3AUOA 4G3IA 9ICNA 1R8BA 5DB8A 1Z3EB 3GIMA 2AGPA 1U4BA 1NKEA 2ZH9A 3UPQA 4Z6DA 4DWIA 1UETA 4WBZA 3LDAA 5KTQA 2V4QA 5TZVA 4QZIA 3RRHA 2PI5A 4WC2A 1BPDA 3HIYA 1JQRA 1XS9D 4X4UA 2PXIA 5IIOA 1KNYA 4NM2A 2IHMA 4DF4A 4J9KA 3LK9A 2LYHA 3MFIA 4I2HA 1MIWA 3ZD9A 4WBYA 4JV1A 4F93B 4YN4A 1U47A 2Q66A 1ZQTA 5J0QA 1PZNA 4FBUA 3V7LA 2XGPA 4NY8A 4DQSA 4FHYA 2FPMA 3SYZA 4FS1A 3RB4A 1NK7A 3RR7A 4EP7A 3G6XA 3OUYA 1VFGA 2BGWA 3ZDCA 9ICBA 1EXNA 3TARA 1L3TA 2C2EA 3PO5A 2HHQA 2ID1A 5HMMA 4O5KA 2F1HA 3AU2A 4ED8A 3LWLA 7ICLA 4Z6CA 4YQWA 4ECRA 2J6TA 4I2CA 1V4AA 3PX6A 1ZQQA 4YXMA 3OGUA 2VANA 4KTQA 2O5AA 2PBEA 8ICVA 4PGYA 2W9CA 5KG4A 4KLGA 1CUKA 4QZGA 4Q45A 4DSIA 1ZQAA 2NRTA 4MFCA 3ETLA 1QLNA 2XC9A 1X9MA 5J0UA 5BOLA 3TI0A 5IIKA 4QWAA 5KG6A 4DSJA 4KLFA 5J0SA 4RUCA 4RWNA 4RWPA 5J2BA 3PW4A 2B21A 5KFOA 4GXJA 4X4OA 4RQ8A 4DQRA 3OJSA 1MQ2A 2C2DA 7ICKA 8ICJA 3PY8A 7ICEA 3OJUA 3AQNA 2I1QA 4JK1A 2BQ3A 2IMWP 4PH5A 4PGQA 3PW0A 4IRDA 2W9BB 3IM1A 3PW2A 1QTMA 4UBCA 4F4YA 4E0DA 4BXOB 3M8SA 4IQUA 2BCRA 2HHTA 4TQRA 3WFRE 9ICLA 3MR5A 4ED7A 4E80A 3KHHA 4PHAA 4ECYA 4M9JA 3SI8A 2IA6A 4KLUA 4DSFA 3RB6A 5KFPA 8ICPA 4DFKA 2DR9A 4ELVA 4XA5A 4P4MA 1IM4A 3GDXA 2W8KA 4IRCA 1YLQA 1B22A 4KLEA 1F5AA 3HJ1A 2ZUCA 3RH5A 9ICIA 3NTUA 1NJWA 4WC4A 3V6HA 4XQ7A 2ZH1A 3RRGA 5L9XA 1TAQA 4C8MA 4I2FA 2KTQA 2ISOA 5KFJA 1ZQIA 2AJQA 3GFKB 3PMNA 3BQ1A 2HHSA 4K4IA 8ICRA 1KLNA 2BCVA 3M9MB 1TKDA 4RQ5A 5KFMA 1MC8A 5J2KA 4ED3A 3GV5B 4FBTA 3TQ1A 4BWJA 1KFSA 3UQ0A 4WC5A 3THVA 3QZ7A 5JUMA 1N56A 4UAYA 3V7JA 4IR9A 4RUAA 1ZQXA 4EBKA 5KFUA 3HWTA 3AU6A 2P6UA 4UB1A 1XSLA 2XY6A 4F5OA 3Q8KA 1TVAA 5KFCA 2VA2A 2HHVA 3JPPA 9ICSA 4O3PA 1D9DA 3MBYA 3C2MA 3RJHA 9ICMA 4RNOA 7ICGA 8ICBA 1UA1A 4J9MA 4YP3A 3PW5A 1T4GA 4NM1A 9ICHA 4TUPA 1ZQUA 4BGDA 1R89A 2HHUA 4I2DA 4QZEA 3OV7A 4NKTA 4GLXA 7ICJA 1XU4A 4ZH4A 1SKSA 1QSSA 1UT8A 4NLNA 9ICAA 4P4OA 4F4ZA 4IQVA 2XCAA 2R8HA 3JYYA 1BNPA 3V6KA 4MF8A 4X4TA 1DK2A 1KFDA 3EYZA 1L3UA 2ZH4A 1AROP 3RB3A 1LV5A 2W9BA 2M2WA 2ZHAA 5KFVA 4F4XA 1BPXA 4BXOA 2IBKA 4M5DA 4M9HA 5KG1A 4KMUA 1ZJNA 3HX0A 2NRZA 8ICYA 1K1QA 5DBAA 1T7PA 4I27A 5KFXA 5KT4A 3KHRA 8ICTA 2KP7A 3C21A 8ICWA 2BPCA 4YMNA 3SZ2A 3ORYA 1NJZA 3HP6A 4M47A 5DQGA 2ZHBA 4F50A 2FMPA 2DR7A 3ISDA 5KFHA 4ECZA 4KLLA 4J9NA 1DGSA 1WCNA 4Z6FA 4YCXA 5DG9A 3OHBA 3RTVA 4DF8A 1T3NA 1ZQLA 8ICEA 1MIVA 4RWQA 3JZ0A 5DDMA 4DSLA 2R8JA 5DGAA 5J0XA 1D9FA 2FMSA 8ICXA 4X0BA 5L1LA 4F4WA 5KFKA 2KN7A 4Q43A 5IINA 5CR0A 4RQ7A 4FO6A 2RDIA 2Y1IA 1Z00B 4QZ8A 4I28A 5HHIA 5D46A 1NKBA 7ICRA 1IXRA 3Q8QB 4F92B 1NKCA 2WTFA 5D49A 1NK4A 1MIYA 1U9LA 4DL6A 3OHAA 5J0WA 2C28A 2BCQA 2RDJA 4DSEA 3KHLA 5J2GA 1L3VA 4UAWA 4DS5A 1ZQZA 3G6YA 1SZPA 3K4GA 3RBDA 1KSPA 4ECVA 4KLIA 4X4NA 3H8SA 3ISBA 4O5CA 3N4MB 4PHEA 9ICVA 9ICPA 1NO5A 2ZTDA 4RPYA 7ICSA 4E7XA 5HRGA 5DB9A 1SL1A 1ZQKA 2FPLA 4PGXA 5HP4A 3JPRA 3RBEA 1RYRA 1HUZA 3WFQE 4NLKA 4TUQA 2R8KA 1BPYA 1SL2A 3NGDA 1CEZA 5HRLA 4GXKA 4ED2A 1S0NA 3AQMA 5F9NA 3GV7B 3RH4A 4O3RA 4QW8A 3UXPA 4RQ0A 2ATLA 1RXWA 2W9MA 2OWOA 4FH5A 5KG5A 2C22A 4DFMA 2FPKA 8ICCA 4QZAA 4AT9B 3C1YA 3Q8SB 4YFKA 4PHDA 4F5QA 1UT5A 2BR0A 1TFRA 1L5UA 2FLNA 4DLGA 8ICHA 4X4VA 4UBBA 2BCSA 4NKUA 4IG8A 3TFRA 3C2KA 4X4RA 2PFPA 4LZGA 1ZQYA 2UVWA 4M04A 3H8JA 1ZQDA 4M9LA 3EZ5A 3EPGA 5HRHA 3OVBA 5J2FA 8ICZA 5BOMA 5HC9A 5HHHA 4YR2A 1MQ3A 5KFAA 4MEXA 1ZQNA 2ZH2A 4B9MA 4C8OA 3QE9Y 5HRIA 2NRKA 2F1JA 3MR3A 3MGHA 3V7KA 2HVIA 3Q8LA 3H37A 5EWEA 2ZH8A 3PX4A 5IIJA 1NJXA 4B9LA 4M9NA 3HJ4A 4UD5A 2W8LA 5KT7A 2BCUA 4F5RA 5KFWA 5J0YA 3C2LA 3ZDAA 4B9NA 5J2IA 1S0VA 3GV8B 7ICFA 4QWDA 1Z00A 3G6VA 4YMMA 4F91B 3B0YA 3UQ2A 5KFYA 4MFAA 2W9AA 4DO9A 1NK8A 2XO7A 4ECTA 3QEBZ 4PHPA 2JEIA 5KFFA 1R8AA 1UEVA 3UXNA 1SKRA 4QWEA 1QSYA 4KLOA 2FLLA 3JPSA 3C66A 4EEYA 1X9WA 2PFOA 4KLQA 1NK6A 3WFPA 2ZTCA 2BPGA 3Q8RB 2ZTEA 2BDPA 3PNCA 3MDAA 4ECQA 8ICSA 4B9VA 5HRFA 3SV4A 5DG7A 1KRPA 4CCHA 7ICOA 4P4PA 8ICKA 3RJJA 4K4GA 2ZJ8A 4UAZA 5DBBA 4B9TA 5CHGA 5J2HA 2PFNA 1WCLA 7ICUA 4Q8EA 4RQ1A 3WFSC 3H4DA 1ZQHA 8ICLA 4LT6A 3C5GA 4IRKA 4LZDA 5J2DA 4FH3A 5DLGA 4ED0A 5KFGA 4FHPA 5IILA 5KFQA 2ISPA 4NLGA 1B43A 4O0IA 4B9SA 5HRKA 1BPEA 3ZDEA 4I2BA 5HRDA 2KFNA 4WC6A 2ASDA 2XCPA 2FMQA 2KZ3A 5J0PA 2JZBB 8ICOA 4AT9A 3MGIA 4KITB 3M8RA 1XC9A 4ELTA 8ICFA 3PR4A 2BQUA 1KEJA 3ISCA 4ECWA 8ICNA 1VJ7A 5F2VO 3PW7A 2O1PA 2P6RA 2DR5A 2A1JB 4RQ2A 4GC7A 3IHQB 4J9QA 5J29A 5CP2A 5CJ7A 3T3FA 4KLTA 1U45A 2NRXA 3PR5B 3QZ8A 2XY5A 1ZQMA 4XRHA 3MR2A 4J9SA 4RZRA 1S0MA 3H39A 4I29A 8ICIA 4C8NA 4KLJA 4Z6EA 3C1ZA 5KT2A 4E8FA 1KTQA 4YXJA 2XGQA 4FS2A 4DOCA 3RAQA 5C5JA 3HT3A 4DOAA 1NK9A 4M2YA 4X4PA 1JXEA 4P2HA 3JPTA 3GQCA 4AT8B 4KLHA 1ZQRA 4IR1A 3FDSA 2J6SA 4O9MA 2BKEA 4DEZA 2DFLA 1TV9A 4DOBA 1DK3A 4MEYA 4UB3A 4EBDA 3PO4A 2M2VA 3H7IA 4QZDA 5DLFA 1ZJMA 5HRBA 1R8CA 5KFZA 2NRWA 4AT7B 4M6WB 3SV3A 4JWNA 1LB2B 5DG8A 5J2EA 4NLZA 2KFZA 4WC0A 1BPZA 8ICUA 4KN4A 4UB4A 2PI4A 1NK5A 1A76A 1ZQWA 4ECSA 1ZQJA 4FHVA 4BDPA 3ZDDA 9ICTA 9ICCA 1UA0A 1Q79A 3M9NB 4RQ4A 3RAXA 9ICRA 2HHWA 3WFOA 4WC3A 4DL5A 3UPSA 5EWGA 4EBJA 7ICMA 3T5LA 5KG7A 4R66A 2KZZA 1HUOA 2JEGA 5HMLA 4YG2A 1JXLA 5KFSA 7ICQA 1H38A 4DQIA 1JAJA 3V72A 1BGXT 2AQ0A 5KFNA 4QWCA 5DB7A 3OSPA 5KFDA 1COOA 1U48A 1SKWA 4DL7A 2JZBA 3BJYA 5KFEA 3N97B 9ICWA 4RWOA 3T5KA 4ECXA 5L1IA 4M9GA 4J9OA 5KFLA 2P66A 2ZJ5A 2DPIA 2BHNA 3K75D 3BQTA 3TAQA 4QZBA 2A1JA 4R8UB 5CWRA 4F2RA 3AQKA 5DB6A 3OVSA 9ICXA 4S3NA 4DL2A 2ZUBA 4UQGA 4J9PA 4GXIA 2HVHA 3RJIA 2AGOA 4TQSA 5HNKA 2MUTB 3E2EA 4JV2A 9ICGA 3JPNA 3JPOA 1KFTA 3L9DA 2DR8A 2HW3A 4RT2A 1S76D 1NOMA 3GILA 4ELUA 4O3OA 2AQ4A 2F1IA 3KHGA 1ZQPA 1KDHA 5HREA 1QSLA 4FHWA 4AT8A 3H8WA 5F9LA 4DLEA 4EBEA 1TK0A 4EZ9A 5KG0A 3B0XA 8ICMA 1NZPA 4WC7A 2DVIA 5J2AA 3RJEA 4M0AA 3RH6A 4B9UA 4NXZA 3TFSA 2HHPA 2ZUDA 4QZCA 4RNNA 4QW9A 2ALZA 2ZH3A 1A77A 2AGQA 8ICQA 4AT7A 4M6WA 4WC1A 9ICKA 3MR6A 5KT6A 1K1SA 5DKWA 5IIMA 3PV8A 2J6UA 4YD1A 2UVVA 3MABA 5J0TA 1WOTA 3H3AA 3C23A 4R65A 1TAUA 4I2IA 7ICHA 3C5FA 4EYHB 2NRVA 1C7YA 3JPQA 1RPLA 2BE3A 4F5NA 3TANA 3RJFA 4J9RA 1X9SA 4HYKA 1T8EA 4YD2A 5DBCA 1XSPA 3RJGA 3OSNA 1TFWA 3UXOA 1JMSA 5DEDA 4QZFA 4KLMA 5CA7A 2BQRA 4RNMA 3RR8A 4DSKA 7ICVA 4ATBB 4F8RA 4R63A 4YR0A 2IHNA 4JV0A 1S10A 4JWMA 3LQCB 4KLSA 8ICAA 7ICNA 5KT3A 1PX5A 3GIIA 2Q0ZX 3HPOA 4I2AA 5BPCA 1MSWD 8ICGA 1JN3A 4R8UA 3V6JA 1N48A 1BVSA 4DL4A 2AU0A 3BDPA 4DS4A 3FYHA 5KFBA 2Y1JA 1ZQEA 3RB0A 4MFFA 2ZH7A 1ZQVA 2C2RA 2MUTA 2ZH5A 4DL3A 2RFFA 4IQTA 5L1KA 3AQLA 1RZTA 4YMOA 4ED1A 4ED6A 3H38A 4RU9A 9ICEA 5CB1A 5DGBA 5DQIA 3MDCA 2DPJA 3KTQA 5DECA 4LVSA 3PMLA 4J9LA 1TFYA 4I2JA 3M9OB 4X4QA 1ZYQA 4DFJA 3OVAA 2DRAA 4JUZA 1RYSA 4EYIB 3H40A 5KFTA 4QZHA 4IQWA 5HR9A 4Q8FA 3OUYB 4I2EA 4KN7A 2KZMA 2JEFA 3RJKA 4KLDA 3EWAA 9ICQA 5J2CA 5EOZA 4FHXA 4RQ3A 4XQ8A 4RT3A 3MFHA 2BPFA 1BPBA 1HJPA 1X2IA 4C8LA 4YVZA 9ICJA 2I9GA 1D8YA 4BWMA 1XO1A 4PPXA 3LWMA 2M9NA 1SL0A 1RXVA 2HHXA 4RQ6A 9ICFA 7ICTA 1BNOA 4RPXA 4ECUA 5EWFA 5J2JA 4O3NA 5L1JA 5J0RA 5KT5A 1ZQSA 4UD4A 2VA8A 5KFRA 4DQQA 1ZQBA 1L3SA 1Y88A 5DDYA 4XUSA 1ZQGA 1FA0A 2PFQA 2H5XA 5D4BA 1S9FA 4O3SA 1TK5A 1XWLA 1S0OA 2FLPA 9ICOA 3BQ2A 5IIIA 2UVRA 5KG2A 2UVUA 4QZ9A 4F4KA 7ICIA 2M2UA 3C18A 4ATBA 3BQ0A 3GIKA 4F5PA 4DFPA 3PVXA 1Q78A 4F3OA 3T5HA 3Q8PB 3GIJA 3PX0A 2VA3A 1NJYA 4QWBA 2JEJA 1OU5A 1D8LA 1ZETA 1NK0A 4YR3A 5KG3A 4MF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDB A;  2W9C B;  4I2G A;  4X4S A;  2R8I A;  1UEU A;  4TUR A;  3HW8 A;  1JIH A;  2ZJA A;  3TAP A;  1XSN A;  1DOQ A;  3T5J A;  9ICU A;  1ZQO A;  2ASL A;  5KFI A;  4UB5 A;  4TUS A;  1S77 D;  4O3Q A;  4X0A A;  1V9P A;  2V4R A;  4X5V A;  4EBC A;  2ASJ A;  3H4B A;  4DQP A;  7ICP A;  4C8K A;  4F2S A;  5DQH A;  4WCW A;  1JX4 A;  4UB2 A;  3EPI A;  3EW9 A;  4Q44 A;  4EZ6 A;  5J0O A;  4O5E A;  1ZQF A;  4K4H A;  2M2T A;  2R8G A;  2MAX A;  1TK8 A;  2ZH6 A;  3QEA Z;  3Q8M A;  2GWS A;  3NYB A;  1ZQC A;  1U49 A;  4RPZ A;  2V9W A;  2DRB A;  4R64 A;  2XY7 A;  4GC6 A;  3ZD8 A;  1S97 A;  3AUO A;  4G3I A;  9ICN A;  1R8B A;  5DB8 A;  1Z3E B;  3GIM A;  2AGP A;  1U4B A;  1NKE A;  2ZH9 A;  3UPQ A;  4Z6D A;  4DWI A;  1UET A;  4WBZ A;  3LDA A;  5KTQ A;  2V4Q A;  5TZV A;  4QZI A;  3RRH A;  2PI5 A;  4WC2 A;  1BPD A;  3HIY A;  1JQR A;  1XS9 D;  4X4U A;  2PXI A;  5IIO A;  1KNY A;  4NM2 A;  2IHM A;  4DF4 A;  4J9K A;  3LK9 A;  2LYH A;  3MFI A;  4I2H A;  1MIW A;  3ZD9 A;  4WBY A;  4JV1 A;  4F93 B;  4YN4 A;  1U47 A;  2Q66 A;  1ZQT A;  5J0Q A;  1PZN A;  4FBU A;  3V7L A;  2XGP A;  4NY8 A;  4DQS A;  4FHY A;  2FPM A;  3SYZ A;  4FS1 A;  3RB4 A;  1NK7 A;  3RR7 A;  4EP7 A;  3G6X A;  3OUY A;  1VFG A;  2BGW A;  3ZDC A;  9ICB A;  1EXN A;  3TAR A;  1L3T A;  2C2E A;  3PO5 A;  2HHQ A;  2ID1 A;  5HMM A;  4O5K A;  2F1H A;  3AU2 A;  4ED8 A;  3LWL A;  7ICL A;  4Z6C A;  4YQW A;  4ECR A;  2J6T A;  4I2C A;  1V4A A;  3PX6 A;  1ZQQ A;  4YXM A;  3OGU A;  2VAN A;  4KTQ A;  2O5A A;  2PBE A;  8ICV A;  4PGY A;  2W9C A;  5KG4 A;  4KLG A;  1CUK A;  4QZG A;  4Q45 A;  4DSI A;  1ZQA A;  2NRT A;  4MFC A;  3ETL A;  1QLN A;  2XC9 A;  1X9M A;  5J0U A;  5BOL A;  3TI0 A;  5IIK A;  4QWA A;  5KG6 A;  4DSJ A;  4KLF A;  5J0S A;  4RUC A;  4RWN A;  4RWP A;  5J2B A;  3PW4 A;  2B21 A;  5KFO A;  4GXJ A;  4X4O A;  4RQ8 A;  4DQR A;  3OJS A;  1MQ2 A;  2C2D A;  7ICK A;  8ICJ A;  3PY8 A;  7ICE A;  3OJU A;  3AQN A;  2I1Q A;  4JK1 A;  2BQ3 A;  2IMW P;  4PH5 A;  4PGQ A;  3PW0 A;  4IRD A;  2W9B B;  3IM1 A;  3PW2 A;  1QTM A;  4UBC A;  4F4Y A;  4E0D A;  4BXO B;  3M8S A;  4IQU A;  2BCR A;  2HHT A;  4TQR A;  3WFR E;  9ICL A;  3MR5 A;  4ED7 A;  4E80 A;  3KHH A;  4PHA A;  4ECY A;  4M9J A;  3SI8 A;  2IA6 A;  4KLU A;  4DSF A;  3RB6 A;  5KFP A;  8ICP A;  4DFK A;  2DR9 A;  4ELV A;  4XA5 A;  4P4M A;  1IM4 A;  3GDX A;  2W8K A;  4IRC A;  1YLQ A;  1B22 A;  4KLE A;  1F5A A;  3HJ1 A;  2ZUC A;  3RH5 A;  9ICI A;  3NTU A;  1NJW A;  4WC4 A;  3V6H A;  4XQ7 A;  2ZH1 A;  3RRG A;  5L9X A;  1TAQ A;  4C8M A;  4I2F A;  2KTQ A;  2ISO A;  5KFJ A;  1ZQI A;  2AJQ A;  3GFK B;  3PMN A;  3BQ1 A;  2HHS A;  4K4I A;  8ICR A;  1KLN A;  2BCV A;  3M9M B;  1TKD A;  4RQ5 A;  5KFM A;  1MC8 A;  5J2K A;  4ED3 A;  3GV5 B;  4FBT A;  3TQ1 A;  4BWJ A;  1KFS A;  3UQ0 A;  4WC5 A;  3THV A;  3QZ7 A;  5JUM A;  1N56 A;  4UAY A;  3V7J A;  4IR9 A;  4RUA A;  1ZQX A;  4EBK A;  5KFU A;  3HWT A;  3AU6 A;  2P6U A;  4UB1 A;  1XSL A;  2XY6 A;  4F5O A;  3Q8K A;  1TVA A;  5KFC A;  2VA2 A;  2HHV A;  3JPP A;  9ICS A;  4O3P A;  1D9D A;  3MBY A;  3C2M A;  3RJH A;  9ICM A;  4RNO A;  7ICG A;  8ICB A;  1UA1 A;  4J9M A;  4YP3 A;  3PW5 A;  1T4G A;  4NM1 A;  9ICH A;  4TUP A;  1ZQU A;  4BGD A;  1R89 A;  2HHU A;  4I2D A;  4QZE A;  3OV7 A;  4NKT A;  4GLX A;  7ICJ A;  1XU4 A;  4ZH4 A;  1SKS A;  1QSS A;  1UT8 A;  4NLN A;  9ICA A;  4P4O A;  4F4Z A;  4IQV A;  2XCA A;  2R8H A;  3JYY A;  1BNP A;  3V6K A;  4MF8 A;  4X4T A;  1DK2 A;  1KFD A;  3EYZ A;  1L3U A;  2ZH4 A;  1ARO P;  3RB3 A;  1LV5 A;  2W9B A;  2M2W A;  2ZHA A;  5KFV A;  4F4X A;  1BPX A;  4BXO A;  2IBK A;  4M5D A;  4M9H A;  5KG1 A;  4KMU A;  1ZJN A;  3HX0 A;  2NRZ A;  8ICY A;  1K1Q A;  5DBA A;  1T7P A;  4I27 A;  5KFX A;  5KT4 A;  3KHR A;  8ICT A;  2KP7 A;  3C21 A;  8ICW A;  2BPC A;  4YMN A;  3SZ2 A;  3ORY A;  1NJZ A;  3HP6 A;  4M47 A;  5DQG A;  2ZHB A;  4F50 A;  2FMP A;  2DR7 A;  3ISD A;  5KFH A;  4ECZ A;  4KLL A;  4J9N A;  1DGS A;  1WCN A;  4Z6F A;  4YCX A;  5DG9 A;  3OHB A;  3RTV A;  4DF8 A;  1T3N A;  1ZQL A;  8ICE A;  1MIV A;  4RWQ A;  3JZ0 A;  5DDM A;  4DSL A;  2R8J A;  5DGA A;  5J0X A;  1D9F A;  2FMS A;  8ICX A;  4X0B A;  5L1L A;  4F4W A;  5KFK A;  2KN7 A;  4Q43 A;  5IIN A;  5CR0 A;  4RQ7 A;  4FO6 A;  2RDI A;  2Y1I A;  1Z00 B;  4QZ8 A;  4I28 A;  5HHI A;  5D46 A;  1NKB A;  7ICR A;  1IXR A;  3Q8Q B;  4F92 B;  1NKC A;  2WTF A;  5D49 A;  1NK4 A;  1MIY A;  1U9L A;  4DL6 A;  3OHA A;  5J0W A;  2C28 A;  2BCQ A;  2RDJ A;  4DSE A;  3KHL A;  5J2G A;  1L3V A;  4UAW A;  4DS5 A;  1ZQZ A;  3G6Y A;  1SZP A;  3K4G A;  3RBD A;  1KSP A;  4ECV A;  4KLI A;  4X4N A;  3H8S A;  3ISB A;  4O5C A;  3N4M B;  4PHE A;  9ICV A;  9ICP A;  1NO5 A;  2ZTD A;  4RPY A;  7ICS A;  4E7X A;  5HRG A;  5DB9 A;  1SL1 A;  1ZQK A;  2FPL A;  4PGX A;  5HP4 A;  3JPR A;  3RBE A;  1RYR A;  1HUZ A;  3WFQ E;  4NLK A;  4TUQ A;  2R8K A;  1BPY A;  1SL2 A;  3NGD A;  1CEZ A;  5HRL A;  4GXK A;  4ED2 A;  1S0N A;  3AQM A;  5F9N A;  3GV7 B;  3RH4 A;  4O3R A;  4QW8 A;  3UXP A;  4RQ0 A;  2ATL A;  1RXW A;  2W9M A;  2OWO A;  4FH5 A;  5KG5 A;  2C22 A;  4DFM A;  2FPK A;  8ICC A;  4QZA A;  4AT9 B;  3C1Y A;  3Q8S B;  4YFK A;  4PHD A;  4F5Q A;  1UT5 A;  2BR0 A;  1TFR A;  1L5U A;  2FLN A;  4DLG A;  8ICH A;  4X4V A;  4UBB A;  2BCS A;  4NKU A;  4IG8 A;  3TFR A;  3C2K A;  4X4R A;  2PFP A;  4LZG A;  1ZQY A;  2UVW A;  4M04 A;  3H8J A;  1ZQD A;  4M9L A;  3EZ5 A;  3EPG A;  5HRH A;  3OVB A;  5J2F A;  8ICZ A;  5BOM A;  5HC9 A;  5HHH A;  4YR2 A;  1MQ3 A;  5KFA A;  4MEX A;  1ZQN A;  2ZH2 A;  4B9M A;  4C8O A;  3QE9 Y;  5HRI A;  2NRK A;  2F1J A;  3MR3 A;  3MGH A;  3V7K A;  2HVI A;  3Q8L A;  3H37 A;  5EWE A;  2ZH8 A;  3PX4 A;  5IIJ A;  1NJX A;  4B9L A;  4M9N A;  3HJ4 A;  4UD5 A;  2W8L A;  5KT7 A;  2BCU A;  4F5R A;  5KFW A;  5J0Y A;  3C2L A;  3ZDA A;  4B9N A;  5J2I A;  1S0V A;  3GV8 B;  7ICF A;  4QWD A;  1Z00 A;  3G6V A;  4YMM A;  4F91 B;  3B0Y A;  3UQ2 A;  5KFY A;  4MFA A;  2W9A A;  4DO9 A;  1NK8 A;  2XO7 A;  4ECT A;  3QEB Z;  4PHP A;  2JEI A;  5KFF A;  1R8A A;  1UEV A;  3UXN A;  1SKR A;  4QWE A;  1QSY A;  4KLO A;  2FLL A;  3JPS A;  3C66 A;  4EEY A;  1X9W A;  2PFO A;  4KLQ A;  1NK6 A;  3WFP A;  2ZTC A;  2BPG A;  3Q8R B;  2ZTE A;  2BDP A;  3PNC A;  3MDA A;  4ECQ A;  8ICS A;  4B9V A;  5HRF A;  3SV4 A;  5DG7 A;  1KRP A;  4CCH A;  7ICO A;  4P4P A;  8ICK A;  3RJJ A;  4K4G A;  2ZJ8 A;  4UAZ A;  5DBB A;  4B9T A;  5CHG A;  5J2H A;  2PFN A;  1WCL A;  7ICU A;  4Q8E A;  4RQ1 A;  3WFS C;  3H4D A;  1ZQH A;  8ICL A;  4LT6 A;  3C5G A;  4IRK A;  4LZD A;  5J2D A;  4FH3 A;  5DLG A;  4ED0 A;  5KFG A;  4FHP A;  5IIL A;  5KFQ A;  2ISP A;  4NLG A;  1B43 A;  4O0I A;  4B9S A;  5HRK A;  1BPE A;  3ZDE A;  4I2B A;  5HRD A;  2KFN A;  4WC6 A;  2ASD A;  2XCP A;  2FMQ A;  2KZ3 A;  5J0P A;  2JZB B;  8ICO A;  4AT9 A;  3MGI A;  4KIT B;  3M8R A;  1XC9 A;  4ELT A;  8ICF A;  3PR4 A;  2BQU A;  1KEJ A;  3ISC A;  4ECW A;  8ICN A;  1VJ7 A;  5F2V O;  3PW7 A;  2O1P A;  2P6R A;  2DR5 A;  2A1J B;  4RQ2 A;  4GC7 A;  3IHQ B;  4J9Q A;  5J29 A;  5CP2 A;  5CJ7 A;  3T3F A;  4KLT A;  1U45 A;  2NRX A;  3PR5 B;  3QZ8 A;  2XY5 A;  1ZQM A;  4XRH A;  3MR2 A;  4J9S A;  4RZR A;  1S0M A;  3H39 A;  4I29 A;  8ICI A;  4C8N A;  4KLJ A;  4Z6E A;  3C1Z A;  5KT2 A;  4E8F A;  1KTQ A;  4YXJ A;  2XGQ A;  4FS2 A;  4DOC A;  3RAQ A;  5C5J A;  3HT3 A;  4DOA A;  1NK9 A;  4M2Y A;  4X4P A;  1JXE A;  4P2H A;  3JPT A;  3GQC A;  4AT8 B;  4KLH A;  1ZQR A;  4IR1 A;  3FDS A;  2J6S A;  4O9M A;  2BKE A;  4DEZ A;  2DFL A;  1TV9 A;  4DOB A;  1DK3 A;  4MEY A;  4UB3 A;  4EBD A;  3PO4 A;  2M2V A;  3H7I A;  4QZD A;  5DLF A;  1ZJM A;  5HRB A;  1R8C A;  5KFZ A;  2NRW A;  4AT7 B;  4M6W B;  3SV3 A;  4JWN A;  1LB2 B;  5DG8 A;  5J2E A;  4NLZ A;  2KFZ A;  4WC0 A;  1BPZ A;  8ICU A;  4KN4 A;  4UB4 A;  2PI4 A;  1NK5 A;  1A76 A;  1ZQW A;  4ECS A;  1ZQJ A;  4FHV A;  4BDP A;  3ZDD A;  9ICT A;  9ICC A;  1UA0 A;  1Q79 A;  3M9N B;  4RQ4 A;  3RAX A;  9ICR A;  2HHW A;  3WFO A;  4WC3 A;  4DL5 A;  3UPS A;  5EWG A;  4EBJ A;  7ICM A;  3T5L A;  5KG7 A;  4R66 A;  2KZZ A;  1HUO A;  2JEG A;  5HML A;  4YG2 A;  1JXL A;  5KFS A;  7ICQ A;  1H38 A;  4DQI A;  1JAJ A;  3V72 A;  1BGX T;  2AQ0 A;  5KFN A;  4QWC A;  5DB7 A;  3OSP A;  5KFD A;  1COO A;  1U48 A;  1SKW A;  4DL7 A;  2JZB A;  3BJY A;  5KFE A;  3N97 B;  9ICW A;  4RWO A;  3T5K A;  4ECX A;  5L1I A;  4M9G A;  4J9O A;  5KFL A;  2P66 A;  2ZJ5 A;  2DPI A;  2BHN A;  3K75 D;  3BQT A;  3TAQ A;  4QZB A;  2A1J A;  4R8U B;  5CWR A;  4F2R A;  3AQK A;  5DB6 A;  3OVS A;  9ICX A;  4S3N A;  4DL2 A;  2ZUB A;  4UQG A;  4J9P A;  4GXI A;  2HVH A;  3RJI A;  2AGO A;  4TQS A;  5HNK A;  2MUT B;  3E2E A;  4JV2 A;  9ICG A;  3JPN A;  3JPO A;  1KFT A;  3L9D A;  2DR8 A;  2HW3 A;  4RT2 A;  1S76 D;  1NOM A;  3GIL A;  4ELU A;  4O3O A;  2AQ4 A;  2F1I A;  3KHG A;  1ZQP A;  1KDH A;  5HRE A;  1QSL A;  4FHW A;  4AT8 A;  3H8W A;  5F9L A;  4DLE A;  4EBE A;  1TK0 A;  4EZ9 A;  5KG0 A;  3B0X A;  8ICM A;  1NZP A;  4WC7 A;  2DVI A;  5J2A A;  3RJE A;  4M0A A;  3RH6 A;  4B9U A;  4NXZ A;  3TFS A;  2HHP A;  2ZUD A;  4QZC A;  4RNN A;  4QW9 A;  2ALZ A;  2ZH3 A;  1A77 A;  2AGQ A;  8ICQ A;  4AT7 A;  4M6W A;  4WC1 A;  9ICK A;  3MR6 A;  5KT6 A;  1K1S A;  5DKW A;  5IIM A;  3PV8 A;  2J6U A;  4YD1 A;  2UVV A;  3MAB A;  5J0T A;  1WOT A;  3H3A A;  3C23 A;  4R65 A;  1TAU A;  4I2I A;  7ICH A;  3C5F A;  4EYH B;  2NRV A;  1C7Y A;  3JPQ A;  1RPL A;  2BE3 A;  4F5N A;  3TAN A;  3RJF A;  4J9R A;  1X9S A;  4HYK A;  1T8E A;  4YD2 A;  5DBC A;  1XSP A;  3RJG A;  3OSN A;  1TFW A;  3UXO A;  1JMS A;  5DED A;  4QZF A;  4KLM A;  5CA7 A;  2BQR A;  4RNM A;  3RR8 A;  4DSK A;  7ICV A;  4ATB B;  4F8R A;  4R63 A;  4YR0 A;  2IHN A;  4JV0 A;  1S10 A;  4JWM A;  3LQC B;  4KLS A;  8ICA A;  7ICN A;  5KT3 A;  1PX5 A;  3GII A;  2Q0Z X;  3HPO A;  4I2A A;  5BPC A;  1MSW D;  8ICG A;  1JN3 A;  4R8U A;  3V6J A;  1N48 A;  1BVS A;  4DL4 A;  2AU0 A;  3BDP A;  4DS4 A;  3FYH A;  5KFB A;  2Y1J A;  1ZQE A;  3RB0 A;  4MFF A;  2ZH7 A;  1ZQV A;  2C2R A;  2MUT A;  2ZH5 A;  4DL3 A;  2RFF A;  4IQT A;  5L1K A;  3AQL A;  1RZT A;  4YMO A;  4ED1 A;  4ED6 A;  3H38 A;  4RU9 A;  9ICE A;  5CB1 A;  5DGB A;  5DQI A;  3MDC A;  2DPJ A;  3KTQ A;  5DEC A;  4LVS A;  3PML A;  4J9L A;  1TFY A;  4I2J A;  3M9O B;  4X4Q A;  1ZYQ A;  4DFJ A;  3OVA A;  2DRA A;  4JUZ A;  1RYS A;  4EYI B;  3H40 A;  5KFT A;  4QZH A;  4IQW A;  5HR9 A;  4Q8F A;  3OUY B;  4I2E A;  4KN7 A;  2KZM A;  2JEF A;  3RJK A;  4KLD A;  3EWA A;  9ICQ A;  5J2C A;  5EOZ A;  4FHX A;  4RQ3 A;  4XQ8 A;  4RT3 A;  3MFH A;  2BPF A;  1BPB A;  1HJP A;  1X2I A;  4C8L A;  4YVZ A;  9ICJ A;  2I9G A;  1D8Y A;  4BWM A;  1XO1 A;  4PPX A;  3LWM A;  2M9N A;  1SL0 A;  1RXV A;  2HHX A;  4RQ6 A;  9ICF A;  7ICT A;  1BNO A;  4RPX A;  4ECU A;  5EWF A;  5J2J A;  4O3N A;  5L1J A;  5J0R A;  5KT5 A;  1ZQS A;  4UD4 A;  2VA8 A;  5KFR A;  4DQQ A;  1ZQB A;  1L3S A;  1Y88 A;  5DDY A;  4XUS A;  1ZQG A;  1FA0 A;  2PFQ A;  2H5X A;  5D4B A;  1S9F A;  4O3S A;  1TK5 A;  1XWL A;  1S0O A;  2FLP A;  9ICO A;  3BQ2 A;  5III A;  2UVR A;  5KG2 A;  2UVU A;  4QZ9 A;  4F4K A;  7ICI A;  2M2U A;  3C18 A;  4ATB A;  3BQ0 A;  3GIK A;  4F5P A;  4DFP A;  3PVX A;  1Q78 A;  4F3O A;  3T5H A;  3Q8P B;  3GIJ A;  3PX0 A;  2VA3 A;  1NJY A;  4QWB A;  2JEJ A;  1OU5 A;  1D8L A;  1ZET A;  1NK0 A;  4YR3 A;  5KG3 A;  4MF2 A; 
#chains in the Genus database with same CATH topology
 3ZDB A;  2W9C B;  4I2G A;  3CW2 C;  2W04 A;  3LYS A;  3HW8 A;  1JIH A;  3TAP A;  1L7O A;  1DOQ A;  4CF5 A;  9ICU A;  1V9P A;  3HKZ C;  2ASJ A;  3NVW A;  4DQP A;  7ICP A;  4F2S A;  3M7D A;  4Q44 A;  5J0O A;  5B5E U;  4K4H A;  2HCF A;  2ZXH A;  3QEA Z;  3NYB A;  4RPZ A;  2MRL A;  4P0Q A;  2W11 A;  4G3I A;  5ALT A;  5DB8 A;  3GIM A;  2HI0 A;  3UPQ A;  4QIW F;  4Z6D A;  4DWI A;  4WBZ A;  3LDA A;  2YY6 A;  3RRH A;  2PI5 A;  3SD7 A;  1BPD A;  1TE2 A;  1JQR A;  1XS9 D;  4UW9 A;  2IHM A;  3LK9 A;  2LYH A;  4I2H A;  4WBY A;  4JV1 A;  4YN4 A;  1U47 A;  2Q66 A;  1ZQT A;  3AM9 A;  4DQS A;  3SYZ A;  1NK7 A;  3RB4 A;  3AEV A;  3G6X A;  5ALM A;  1QQ6 A;  2CXY A;  4PZO A;  1L3T A;  2C2E A;  1N2X A;  5AM5 A;  2F1H A;  4O5K A;  2Y9T A;  4ECR A;  3OGU A;  1Q8K A;  1WWU A;  1A0P A;  5KG4 A;  1CUK A;  2GO7 A;  5D63 A;  3ETL A;  1QLN A;  2XC9 A;  3M1Y A;  3TI0 A;  5IIK A;  5AI6 A;  4CNQ A;  4RUC A;  4X4O A;  8ICJ A;  5AKY A;  3OJU A;  2HBK A;  2F8K A;  2BQ3 A;  2IMW P;  4PH5 A;  2G0A A;  2JH1 A;  4E0D A;  2KJ9 A;  4TQR A;  2W54 A;  4E80 A;  4ED7 A;  4PHA A;  4ECY A;  4M9J A;  5ALZ A;  4KLU A;  1KBU A;  2KJ8 A;  8ICP A;  2DR9 A;  4ELV A;  1B22 A;  4UB8 U;  2ZUC A;  1NJW A;  3V6H A;  2HN2 A;  4C8M A;  4CF4 A;  2HHS A;  8ICR A;  2AH5 A;  2BCV A;  1TKD A;  4RQ5 A;  3UQ0 A;  3THV A;  5JUM A;  4UAY A;  1ZQX A;  3H0M B;  1TVA A;  2HHV A;  2VA2 A;  5AM3 A;  3JPP A;  4O3P A;  1D9D A;  4FZM A;  5AM4 A;  3C2M A;  1FFU A;  3K1Z A;  4Y2Y A;  1ZQU A;  3KBB A;  4NXT A;  3HRD D;  4ZH4 A;  9ICA A;  4P4O A;  3WKD A;  1BNP A;  3V6K A;  4X4T A;  2KKV A;  1KFD A;  4CGZ A;  3EYZ A;  1L3U A;  1LV5 A;  2W9B A;  1LKY B;  2KIC A;  1C20 A;  2YMM A;  2IBK A;  5CHE A;  4M9H A;  4NXX A;  1ZJN A;  2HN1 A;  2HDO A;  5AK5 A;  3S6J A;  5KFX A;  3FC4 A;  4C4T A;  8ICT A;  2NYV A;  2NO4 A;  1L7P A;  5KL1 B;  2A3V A;  4YMN A;  2KOB A;  3I76 A;  5DQG A;  2FMP A;  3ISD A;  4J9N A;  4YCX A;  3BZK A;  4Z6F A;  1JRP A;  4DF8 A;  1T3N A;  3JZ0 A;  4DSL A;  2R8J A;  4X0B A;  2NO5 A;  3WKB A;  5IIN A;  5CR0 A;  4RQ7 A;  4I28 A;  2G07 A;  2RDI A;  4G9B A;  1AQ6 A;  5D46 A;  7ICR A;  2EDU A;  1NK4 A;  5D49 A;  4KMO B;  2D6F C;  2JXJ A;  4UAW A;  3G6Y A;  5ALH A;  2DUY A;  4X4N A;  4O67 A;  3N4M B;  4PHE A;  9ICV A;  4RPY A;  5HRG A;  4WQK A;  4PGX A;  3JPR A;  4NLK A;  5D61 A;  4ZOH C;  1S0N A;  5F9N A;  1M6Y A;  4KLT A;  3UXP A;  4OCZ A;  5KG5 A;  4HAI A;  2FPK A;  2IOF K;  4PHD A;  1L5U A;  2BCS A;  1HEK A;  4X4R A;  3F5A A;  2PFP A;  1ZQY A;  2GA9 D;  3EPG A;  1Z1B A;  5HC9 A;  4YR2 A;  1MQ3 A;  2ZH2 A;  4B9M A;  3DDH A;  4C8O A;  5HRI A;  3QU5 A;  2E3T A;  3MR3 A;  3H37 A;  1HIW A;  2EQY A;  2KNJ A;  5KT7 A;  4F5R A;  3C2L A;  3ZDA A;  7ICF A;  4QWD A;  1Z00 A;  3G6V A;  1F44 A;  1NK8 A;  3QEB Z;  4Y2J A;  4PHP A;  5KFF A;  3J81 j;  1SKR A;  3JPS A;  4EEY A;  2ZTC A;  2BDP A;  3PSI A;  4ECQ A;  2DBY A;  4LEV A;  4B9V A;  1Q46 A;  5DG7 A;  5ALY A;  2ZJ8 A;  5DBB A;  4QJF B;  5J2H A;  2XVT A;  2PFN A;  4OJ6 A;  4Q8E A;  4QIW C;  4Y2V A;  4NLG A;  1B43 A;  1PK1 B;  5HRK A;  4LEY A;  2EZZ A;  3ZDE A;  1IG6 A;  2KFN A;  4WC6 A;  1PVR A;  5J0P A;  4KIT B;  3M8R A;  1L6N A;  3PR4 A;  1JI7 A;  2BQU A;  2WB1 F;  5F2V O;  2F77 X;  3PW7 A;  2DR5 A;  3ALR A;  2EAM A;  3IHQ B;  1RQL A;  3PR5 B;  2XY5 A;  4XRH A;  3MR2 A;  5ALR A;  4I29 A;  3H39 A;  4C8N A;  4KLJ A;  4US9 A;  3C1Z A;  3SR6 A;  4E8F A;  1FFV A;  4M2Y A;  2LPE A;  3RAQ A;  4X4P A;  5CRX A;  4AT8 B;  3JPT A;  3GQC A;  4O9M A;  2J6S A;  2KSO A;  1DK3 A;  3TAC B;  4UB3 A;  4DOB A;  2M2V A;  3H7I A;  4MHV A;  5DLF A;  2WFA A;  3SV3 A;  1LB2 B;  2KFZ A;  1NK5 A;  1ZQJ A;  1ZQW A;  2RHF A;  4BDP A;  9ICC A;  3WKE A;  4RQ4 A;  9ICR A;  2H3Z A;  3UPS A;  4K8V A;  7ICM A;  3T5L A;  3HJE A;  1HUO A;  4YG2 A;  5KFS A;  1Z19 A;  4RWO A;  5G5H A;  4J9O A;  2ZJ5 A;  3K75 D;  3TAQ A;  4O68 A;  4QZB A;  1GPJ A;  4S3N A;  4I0U A;  2PMZ F;  5GTI U;  3ETR A;  3L9D A;  5CFS A;  4JV2 A;  4EV6 A;  3JPN A;  1KFT A;  1JUD A;  2HW3 A;  1B4F A;  5AIB A;  2K4H A;  3GIL A;  4ELU A;  2F1I A;  3KHG A;  1T94 A;  1KDH A;  4OAG A;  2F76 X;  8ICM A;  2DVI A;  1ZQ1 C;  4RNN A;  4QW9 A;  2IOH A;  2AGQ A;  4AT7 A;  3VC8 A;  4JLX A;  5KT6 A;  3PV8 A;  2UVV A;  4YD1 A;  3IV6 A;  4I2I A;  5ALN A;  4U6P A;  3E58 A;  2NRV A;  4F5N A;  1XO0 A;  2G08 A;  5DBC A;  3RJG A;  1TFW A;  3SAF A;  4RNM A;  3RR8 A;  4F8R A;  3D2S A;  8ICA A;  2OCE A;  1L7N A;  5L1M A;  3KZX A;  2G5I B;  1ZOL A;  4R8U A;  1N48 A;  2WF7 A;  2AU0 A;  1YT3 A;  1Z4O A;  3FYH A;  5KFB A;  5ALJ A;  1ZQV A;  2C2R A;  1RZT A;  4ED1 A;  2I5H A;  3LVV A;  3PML A;  4UAT A;  4WJ3 B;  1RYU A;  2YN4 A;  4X4Q A;  2DRA A;  4DFJ A;  3AL0 B;  4EEL A;  4EYI B;  3H40 A;  5KFT A;  2KIW A;  4QZH A;  4P0Q B;  4I2E A;  1QQ7 A;  2KZM A;  3RJK A;  4KLD A;  3B9J A;  3EWA A;  5EE0 A;  1CI4 A;  3MFH A;  1BPB A;  1X2I A;  3AQE A;  1D8Y A;  1N5X A;  2M9N A;  9ICF A;  7ICT A;  2LBO A;  4UAV A;  5L1J A;  4BUG A;  5AI5 A;  3N28 A;  3SAG A;  1FA0 A;  1XWL A;  2UVU A;  7ICI A;  4QZ9 A;  2HBJ A;  4ATB A;  3Q8P B;  3BS5 A;  4QWB A;  4C0Z A;  1OU5 A;  5JTI A;  1NK0 A;  3BS7 A;  4MF2 A;  5HR6 A;  1WUD A;  2R18 A;  1S77 D;  4X0A A;  1F5S A;  2V4R A;  4X5V A;  4WCW A;  4C8K A;  1JX4 A;  1V38 A;  4O5E A;  2M2T A;  2R8G A;  2GWS A;  1U49 A;  3EUB 2;  3QNM A;  4OAI Z;  9ICN A;  1R8B A;  1UET A;  2B56 A;  3OTQ A;  3ICX A;  3HIY A;  4X4U A;  5IIO A;  4NM2 A;  2QKQ A;  3MFI A;  4F93 B;  3BZC A;  4OD0 A;  4WH5 A;  2WB1 C;  1KQQ A;  2RLT A;  5J0Q A;  3SEI A;  4DCC A;  4FHY A;  2FPM A;  3RR7 A;  4FS1 A;  5A0L A;  3OUY A;  1YZ7 A;  9ICB A;  2VKQ A;  2ZIX A;  3PO5 A;  2ID1 A;  3AU2 A;  3LWL A;  4BJQ A;  2J6T A;  4I2C A;  4KTQ A;  2PBE A;  3UM9 A;  4PGY A;  5ALL A;  3QU9 A;  2GLE A;  2JGA A;  5E79 U;  4DSJ A;  5KAF U;  4JB3 A;  1SWV A;  3PW4 A;  2GAF D;  2W7O A;  5KFO A;  4RQ8 A;  1URJ A;  4USA A;  2B51 A;  2C2D A;  7ICK A;  3PY8 A;  3AQN A;  2W9B B;  3IM1 A;  3PW2 A;  4F4Y A;  3M8S A;  4MKP A;  2BCR A;  3H0L B;  9ICL A;  2LMR A;  1X40 A;  2F44 A;  3SI8 A;  4DSF A;  3RB6 A;  2CRX A;  1IM4 A;  4IRC A;  1NI3 A;  3WU2 U;  3NTU A;  4WC4 A;  2ZH1 A;  2XI9 A;  5F3X B;  1SV4 A;  5KFJ A;  2AJQ A;  3GFK B;  5KL8 B;  4K4I A;  2PMZ C;  1KLN A;  5KNI A;  1LVH A;  2MA1 A;  5J2K A;  4UAS A;  3V7J A;  2D8C A;  2P6U A;  4F5O A;  3KFU F;  2K60 A;  4FO1 A;  3MBY A;  4Y2X A;  2G5H B;  7ICG A;  4J9M A;  2K8A A;  3GZF A;  4TUP A;  1R89 A;  4I2D A;  4QZE A;  3OWG A;  4NKT A;  4GLX A;  1XU4 A;  1SKS A;  2Y0S F;  2XCA A;  3SAH A;  5B66 U;  1SWW A;  4Y2Q A;  1OXJ A;  2F2A B;  3RB3 A;  2ZHA A;  4BXO A;  2NRZ A;  8ICY A;  2ZIV A;  1SIJ A;  5KT4 A;  2KP7 A;  1NJZ A;  3ORY A;  4NLB A;  4M47 A;  5KFH A;  4PL1 A;  1WCN A;  4RWQ A;  1ZQL A;  5DGA A;  1D9F A;  5KFK A;  4Q43 A;  4FO6 A;  1NNL A;  1Z00 B;  1NKB A;  4O6A A;  1PUZ A;  5AKH A;  1IXR A;  3MCR A;  2EAP A;  1MIY A;  4DL6 A;  5J0W A;  2C28 A;  5J2G A;  3RBD A;  4DS5 A;  1ZQZ A;  3ISB A;  2DKX A;  4E7X A;  1ZD3 A;  1ZQK A;  2FPL A;  5HP4 A;  1RYR A;  4PZN A;  4ED2 A;  3CNH A;  3GV7 B;  4O3R A;  4QW8 A;  4BX9 C;  4RQ0 A;  2ATL A;  4Y2S A;  2W9M A;  4A8E A;  3CK6 A;  4F5Q A;  1Q3V A;  2P35 A;  5ALK A;  2HSZ A;  4DLG A;  5D62 A;  3BQ7 A;  4IG8 A;  3TFR A;  4LZG A;  4M04 A;  5HRH A;  1ZQD A;  1Z1V A;  5J2F A;  5HHH A;  4MEX A;  3Q8L A;  3PX4 A;  5IIJ A;  1NJX A;  4M9N A;  3HJ4 A;  3JCF A;  4UD5 A;  2W8L A;  5KFW A;  3KOO A;  2LYA A;  2EAO A;  5JRT A;  3UQ2 A;  1QCK A;  2Y9U A;  4MFA A;  2XO7 A;  2KSO B;  2D3D A;  2FI1 A;  5AKL A;  3VCB A;  1RQN A;  3WFP A;  2BPG A;  2WF6 A;  2JMG A;  4P4P A;  3PHZ A;  5AI9 A;  4IS7 A;  3NWI A;  7ICU A;  1UQV A;  4RQ1 A;  3WFS C;  8ICL A;  3C5G A;  4FH3 A;  3M6Z A;  4LZD A;  2N1R A;  5DLG A;  4ED0 A;  4FHP A;  5KFQ A;  4JLZ A;  2KHQ A;  4B9S A;  4O69 A;  2KKP A;  4I2B A;  5TIS U;  2XCP A;  4OJL A;  8ICO A;  4AT9 A;  4OAH A;  2YMQ A;  5ALE A;  4ECW A;  4GC7 A;  5CP2 A;  1ZXI A;  4J9S A;  3AN1 A;  3WK6 A;  1RDF A;  4Z6E A;  2XGQ A;  1S5L U;  3FAH A;  3HT3 A;  4DOA A;  5AM0 A;  4P2H A;  2YB1 A;  1ZQR A;  2BKE A;  4KX3 A;  4EBD A;  1R8C A;  4QZD A;  2RQ5 A;  5KFZ A;  4AT7 B;  5H2F U;  4NLZ A;  1BPZ A;  8ICU A;  4UB4 A;  5EE1 A;  3C28 A;  4ECS A;  2LHT A;  4EEK A;  3NRZ A;  3M9N B;  3WFO A;  2HHW A;  5KAI U;  4WC3 A;  4DL5 A;  1J97 A;  2KZZ A;  4EGW A;  3K7D A;  7ICQ A;  5AKZ A;  5KFN A;  2AQ0 A;  2PKE A;  1U48 A;  5AKI A;  2BZF A;  4R8U B;  2DWQ A;  4DL2 A;  4UQG A;  4J9P A;  4GXI A;  3NUQ A;  2EWR A;  4B6J A;  4EEN A;  4TQS A;  9ICG A;  4F71 A;  2DR8 A;  4RT2 A;  2EZX A;  1NZB A;  4K98 A;  4O3O A;  5AK6 A;  3NKU A;  3H8W A;  4DLE A;  4EBE A;  1TK0 A;  4EZ9 A;  1NZP A;  3QU2 A;  4WC7 A;  5J2A A;  4M0A A;  4NXZ A;  1N63 A;  4K9A A;  2ZH3 A;  4M6W A;  2Y0S C;  2FJ6 A;  5IIM A;  2J6U A;  3H3A A;  3QX7 A;  7ICH A;  3C29 A;  2W7P A;  2BE3 A;  1DGJ A;  3RJF A;  1X9S A;  1T8E A;  3QUC A;  1XSP A;  3UXO A;  5DED A;  5CA7 A;  3A0B U;  2F8L A;  2OM6 A;  7ICV A;  4ATB B;  4R63 A;  2IHN A;  3BS5 B;  1S10 A;  1VDV A;  4FFD A;  4KLS A;  3A0H U;  5ALD A;  5KT3 A;  1PX5 A;  2Q0Z X;  4I2A A;  4CE6 A;  5BPC A;  3ER9 B;  8ICG A;  1L7M A;  4DS4 A;  1ZQE A;  2ZH7 A;  2RFF A;  4IQT A;  1KL9 A;  2EZY A;  2H3I A;  5AM2 A;  3MDC A;  3KTQ A;  4I2J A;  3M9O B;  1ZYQ A;  1P7D A;  4JUZ A;  4CF3 A;  1QH9 A;  5J2C A;  1UHU A;  4RQ3 A;  1IV8 A;  1HJP A;  4C8L A;  2KHV A;  3KKA A;  4UB6 U;  4BWM A;  1XO1 A;  4PPX A;  2FE9 A;  4OJ5 A;  4KX5 A;  4RPX A;  2A1A A;  2WHE A;  1L3S A;  1Y88 A;  5DDY A;  5ALO A;  1ZQB A;  1ZQG A;  3OUY B;  2H5X A;  5D4B A;  2OEH A;  4EX7 A;  2DKZ A;  1TK5 A;  4O3S A;  3BQ2 A;  3C18 A;  2M2U A;  2ZIX B;  1Q78 A;  3T5H A;  3GIJ A;  2VA3 A;  1YZ6 A;  2EAN A;  3PSP A;  4X4S A;  2XIC A;  5AM1 A;  1COK A;  1XSN A;  2ASL A;  4UB5 A;  4TUS A;  1GO3 F;  4EBC A;  3H4B A;  3EPI A;  2OH2 A;  3EW9 A;  2ZH6 A;  4Y2T A;  2MAX A;  3Q8M A;  2YMP A;  1KN5 A;  1ZQC A;  4GIB A;  2DRB A;  3AUO A;  4AP9 A;  4FZL A;  2WAQ F;  1Z3E B;  1NKE A;  1U4B A;  5KTQ A;  2V4Q A;  1VJ5 A;  2LKY A;  2PXI A;  1KNY A;  4J9K A;  3ZD9 A;  2FCL A;  1PZN A;  2XGP A;  4NY8 A;  1VFG A;  4EP7 A;  2GH1 A;  2BGW A;  3ZDC A;  1EXN A;  3TAR A;  2KE7 A;  4ED8 A;  2YML A;  7ICL A;  2VAN A;  3UMC A;  1B0X A;  5ALX A;  2RRD A;  5ALS A;  4Q45 A;  4QZG A;  4DSI A;  1ZQA A;  2B4V A;  4MFC A;  1X9M A;  3NS1 A;  5J0U A;  3RF9 A;  3F53 A;  4KLF A;  5J0S A;  5J2B A;  2B21 A;  1WWV A;  1D8B A;  2Q4T A;  2I1Q A;  5AKK A;  3PW0 A;  4IRD A;  4UBC A;  4BXO B;  2HHT A;  3WFR E;  3KHH A;  2KG5 A;  4RQN A;  2IA6 A;  4PL2 A;  5KFP A;  2ZIV B;  4DFK A;  4XA5 A;  3MGV A;  3RH5 A;  9ICI A;  3R9K A;  3RRG A;  5L9X A;  1TAQ A;  1ZRM A;  2JH7 A;  5HR7 A;  2K4E A;  2QAR A;  3M9M B;  1DRG A;  4ED3 A;  4K9B A;  1KFS A;  4WC5 A;  3WK7 A;  2CN1 A;  5C0Y A;  1ECW A;  4RUA A;  4IR9 A;  1A6S A;  2JHD A;  3AU6 A;  4UB1 A;  1L8L A;  3TAD A;  2XY6 A;  3Q8K A;  5KFC A;  4UAU A;  1X6J A;  2LM4 A;  4RNO A;  8ICB A;  1UA1 A;  4YP3 A;  1T4G A;  3M6K A;  4BGD A;  2HHU A;  3OV7 A;  2QB0 A;  1UT8 A;  4F4Z A;  2R8H A;  2QB1 A;  5EE3 A;  4MF8 A;  2K8C B;  5EE9 A;  1DK2 A;  2ZH4 A;  2KMD A;  4M5D A;  5KG1 A;  3HX0 A;  4WQL A;  1OUQ A;  3C21 A;  8ICW A;  2BPC A;  2OXO A;  3HP6 A;  4ECZ A;  1DGS A;  3RTV A;  4KM5 A;  1MIV A;  3QXG A;  3NVO A;  2FMS A;  4F4W A;  2Y1I A;  2K4P A;  4CDG A;  2ES6 A;  2DF4 B;  5ALP A;  1U9L A;  1N61 A;  1ZD4 A;  5JTG A;  2BCQ A;  3KHL A;  1KSP A;  1SZP A;  1X66 A;  4ECV A;  3SQI A;  2XID A;  7ICS A;  1SL1 A;  3RBE A;  1K5O A;  4LEW A;  3H0R B;  1BPY A;  1FO4 A;  1CEZ A;  5HRL A;  1X6I A;  3IDW A;  1SV0 A;  2OWO A;  3E0F A;  4DFM A;  8ICC A;  4QZA A;  1PVP A;  2OYY A;  3C1Y A;  4AT9 B;  4YFK A;  1UT5 A;  1TFR A;  2FLN A;  3NVV A;  4NKU A;  3I28 A;  3KKA C;  3C2K A;  3KZI U;  3H8J A;  4M9L A;  3OVB A;  5CEH A;  5B3Q A;  3QE9 Y;  2NRK A;  2F1J A;  4K99 A;  3V7K A;  4C7Z A;  3QUB A;  5J8Y A;  4B9N A;  5J0Y A;  1S0V A;  3N7P D;  5FP0 A;  4IC9 A;  4C7Y A;  4YMM A;  4F91 B;  5KFY A;  4ECT A;  1OW5 A;  1R8A A;  2MSN A;  1UEV A;  4QWE A;  4DFD A;  1QSY A;  2FLL A;  5G5G A;  4KLQ A;  3Q8R B;  1Z4N A;  3MDA A;  5HRF A;  3SV4 A;  4C4R A;  1KRP A;  4CCH A;  4B9T A;  3DEE A;  2WAQ C;  2KD1 A;  1WCL A;  4LT6 A;  4IRK A;  5J2D A;  5KFG A;  4N7R A;  1T3Q A;  2FMQ A;  2KZ3 A;  4FE3 A;  8ICF A;  2YQE A;  1XC9 A;  1JAL A;  2MU2 A;  1VJ7 A;  3ISC A;  8ICN A;  2O1P A;  4RQ2 A;  4J9Q A;  5J29 A;  4O3M A;  3T3F A;  5ALW A;  1SXD A;  2NRX A;  3QZ8 A;  1S0M A;  2FDR A;  2HBM A;  8ICI A;  5KT2 A;  4FS2 A;  4YXJ A;  1NK9 A;  2ZIW A;  1RG6 A;  4KLH A;  4IR1 A;  1TV9 A;  4MEY A;  3PO4 A;  2NRW A;  4M6W B;  3AMZ A;  3WKA A;  5DG8 A;  3F2D A;  5ALF A;  4HX0 A;  2E8N A;  1N5W A;  1A76 A;  4FHV A;  2YTU A;  5K4L A;  2KJ5 A;  3ZDD A;  1Q79 A;  1PK3 A;  5EWG A;  1V97 A;  2BBJ A;  2JEG A;  1H38 A;  4DQI A;  1UCV A;  5AI0 A;  3OSP A;  5KFD A;  1COO A;  1SKW A;  4DL7 A;  2JZB A;  3WKC A;  3N97 B;  5KFE A;  9ICW A;  5L1I A;  4EEB A;  1ZD2 P;  2DQN B;  5AIA A;  2A1J A;  5CWR A;  4F2R A;  4K97 A;  2H3Q A;  2ZUB A;  5HNK A;  3E2E A;  3JPO A;  2VJ4 A;  1S76 D;  1NOM A;  5ALQ A;  1QSL A;  4FHW A;  5F9L A;  3B0X A;  3OPX A;  3N7S C;  3RJE A;  2HHP A;  2ZUD A;  1QQ5 A;  4QZC A;  3NVY A;  2HMX A;  2ODG A;  3TAD C;  1A77 A;  1SB3 C;  4FZN A;  4WC1 A;  9ICK A;  3MAB A;  4R65 A;  5AKJ A;  1TAU A;  3SEN A;  3CRX A;  3C5F A;  3SMV A;  3F2B A;  4EYH B;  1C7Y A;  3JPQ A;  1RPL A;  4J9R A;  4YD2 A;  4P0P A;  3OSN A;  2A19 A;  4QZF A;  2ZG6 A;  1MN8 A;  4DSK A;  3IP4 B;  3CP8 A;  4YR0 A;  4JV0 A;  4AYB F;  4JWM A;  3LQC B;  3IG8 A;  4ICA A;  3GII A;  1JN3 A;  3V6J A;  1BVS A;  4DL4 A;  3BDP A;  2MUT A;  4DL3 A;  5L1K A;  4RQM A;  2AHO B;  1V85 A;  2W03 A;  2E1F A;  5DQI A;  5DEC A;  4J9L A;  5B3P A;  4JMU A;  3ZI4 A;  4OO1 J;  5AK4 A;  4IQW A;  4Q8F A;  3IN5 A;  2JEF A;  3IRU A;  2L5Y A;  5ALV A;  4RT3 A;  2BPF A;  4YVZ A;  9ICJ A;  3QU4 A;  3LWM A;  3QYP A;  4ECU A;  3K1R B;  5J2J A;  1S8O A;  5KT5 A;  4UD4 A;  5KFR A;  1SV0 C;  9ICO A;  2FLP A;  1S0O A;  2UVR A;  4F4K A;  2NV3 A;  2H3F A;  3PVX A;  5AI8 A;  1NJY A;  2JEJ A;  1D8L A;  2ISP A;  4FH5 A;  2ZIU A;  1FEZ A;  2R8I A;  4TUR A;  2ZJA A;  3PZP A;  3T5J A;  1ZQO A;  5KFI A;  4O3Q A;  5AHX A;  5J8Y C;  5DQH A;  4UB2 A;  3QU7 A;  1UEU A;  4EZ6 A;  1ZQF A;  1TK8 A;  2JV3 A;  2EH9 A;  1L8O A;  2V9W A;  4KB6 A;  4R64 A;  2F3N A;  2XY7 A;  4GC6 A;  3ZD8 A;  1S97 A;  4NLC A;  2AGP A;  2E8O A;  2ZH9 A;  5TZV A;  4EX6 A;  2IHO A;  4QZI A;  4WC2 A;  2KV2 A;  3IG5 A;  1SGG A;  1MIW A;  4DF4 A;  1O08 A;  4FBU A;  3V7L A;  2DL0 A;  2QAR B;  2GOL A;  2HHQ A;  5HMM A;  3WK5 A;  1SZH A;  4Z6C A;  4YQW A;  4NXV A;  1V4A A;  3PX6 A;  1ZQQ A;  4YXM A;  2O5A A;  8ICV A;  2RP5 A;  2M0N A;  2W9C A;  3H8M A;  4KLG A;  2NRT A;  2HOQ A;  5BOL A;  3FM9 A;  4QWA A;  5KG6 A;  2O6K A;  2KVC A;  4RWN A;  2QB0 B;  4RWP A;  4GXJ A;  4DQR A;  3OJS A;  1MQ2 A;  7ICE A;  3WK9 A;  4JK1 A;  4PGQ A;  1QTM A;  3L3F X;  4PJ0 U;  4IQU A;  3MR5 A;  3PSF A;  5AKE A;  2W3S A;  2H3V A;  4NL9 A;  2LI6 A;  4P4M A;  3GDX A;  2W8K A;  1YLQ A;  5AIC A;  4KLE A;  1F5A A;  3HJ1 A;  4EED A;  2E5S A;  4XQ7 A;  4CRX A;  4I2F A;  2KTQ A;  2YB4 A;  2ISO A;  3PMN A;  3BQ1 A;  2WF5 A;  5KFM A;  1MC8 A;  3D6J A;  3GV5 B;  4FBT A;  3TQ1 A;  4BWJ A;  2VIX A;  3O0F A;  3QZ7 A;  1N56 A;  4EBK A;  5KFU A;  3HWT A;  1XSL A;  3D2N A;  9ICS A;  3WK4 A;  2I6X A;  4Y2R A;  3RJH A;  9ICM A;  1X9X A;  3GU3 A;  3PW5 A;  4NM1 A;  9ICH A;  4GFJ A;  7ICJ A;  2ESE A;  3NRW A;  1QSS A;  4NLN A;  3JYY A;  4IQV A;  3N7R C;  2G09 A;  4ACO A;  1ARO P;  2M2W A;  5KFV A;  4F4X A;  1BPX A;  3EF2 A;  4KMU A;  1K1Q A;  5DBA A;  1T7P A;  4I27 A;  3KHR A;  4WOY A;  5CFU A;  2AXT U;  4AYB C;  3SZ2 A;  2ZHB A;  4F50 A;  2DR7 A;  1UPH A;  4KLL A;  3AQL A;  5DG9 A;  3OHB A;  8ICE A;  1KW4 A;  5DDM A;  8ICX A;  5J0X A;  4OAF A;  5L1L A;  4NXU A;  2KN7 A;  4QZ8 A;  5HHI A;  3Q8Q B;  4F92 B;  1NKC A;  3L4P A;  2WTF A;  2K8B B;  3OHA A;  2K4I A;  1N62 A;  2ZXI A;  3QUQ A;  2RDJ A;  4DSE A;  1XNS A;  1L3V A;  2OHF A;  3K4G A;  4KLI A;  2Z7J A;  3H8S A;  4O5C A;  3WK8 A;  9ICP A;  4C4S A;  1NO5 A;  2ZTD A;  5DB9 A;  4Y2U A;  2KK0 A;  1HUZ A;  3WFQ E;  4TUQ A;  2E1E A;  2R8K A;  1SL2 A;  3NGD A;  2KIV A;  4Y2P A;  4GXK A;  1CRX A;  3AQM A;  3RH4 A;  2WF8 A;  1ED1 A;  1RXW A;  3TKA A;  2C22 A;  5GTH U;  1LKY A;  3Q8S B;  8ICH A;  4X4V A;  2BR0 A;  3L5K A;  4UBB A;  3ER8 C;  1DXS A;  2UVW A;  4US8 A;  3EZ5 A;  8ICZ A;  5BOM A;  5KFA A;  1ZQN A;  3MGH A;  2HVI A;  2ZH8 A;  5EWE A;  4J03 A;  4B9L A;  2BCU A;  3PST A;  2ZIW B;  5J2I A;  4C80 A;  3GV8 B;  2JRZ A;  3B0Y A;  4DO9 A;  2W9A A;  5ALI A;  2B6G A;  2JEI A;  3ED5 A;  3QUT A;  4QNL A;  3UXN A;  4KLO A;  3HKZ F;  3C66 A;  1X9W A;  2PFO A;  4NWI A;  1NK6 A;  2ZTE A;  2LM1 A;  3PNC A;  8ICS A;  7ICO A;  2K89 A;  8ICK A;  3RJJ A;  4K4G A;  4UAZ A;  5CHG A;  2W3R A;  3H4D A;  1ZQH A;  2IUB A;  1O03 A;  5IIL A;  4O0I A;  2JR5 A;  1BPE A;  5HRD A;  2ASD A;  3F5E A;  2JZB B;  4IL6 U;  3MGI A;  4ELT A;  3D2Q A;  1F0M A;  1WYG A;  1KEJ A;  3MC1 A;  2P6R A;  2HOF A;  2A1J B;  5CJ7 A;  1U45 A;  2QLT A;  1ZQM A;  1SXE A;  4RZR A;  3ERC C;  1KTQ A;  3CYM A;  4DOC A;  3LVW A;  5C5J A;  1JXE A;  2E8P A;  3NAS A;  3FDS A;  4DEZ A;  3ONN A;  2DFL A;  5AKG A;  1ZJM A;  5HRB A;  5CFT A;  4JWN A;  1TAM A;  3UMG A;  5J2E A;  5JU5 A;  4WC0 A;  4KN4 A;  2PI4 A;  2W43 A;  1PVQ A;  9ICT A;  1UA0 A;  4XJE A;  3RAX A;  4P0P B;  4LEZ A;  4EBJ A;  1J2N A;  5KG7 A;  4R66 A;  5HML A;  1JXL A;  1PK1 A;  1ZRN A;  2LYB A;  1JAJ A;  3KD3 A;  3V72 A;  1BGX T;  4QWC A;  5DB7 A;  2VJ5 A;  3BJY A;  3T5K A;  4ECX A;  4M9G A;  4NV0 A;  1RM6 C;  4NJ8 A;  5KFL A;  4U7C A;  1J2M A;  2P66 A;  1MA7 A;  4NL9 C;  2DPI A;  2BHN A;  3BQT A;  3AQK A;  5DB6 A;  3OVS A;  9ICX A;  5AI4 A;  5ALU A;  2E8M A;  2HVH A;  1ZD5 A;  1FIQ A;  3RJI A;  2AGO A;  2MUT B;  4LJX A;  3RFA A;  2AQ4 A;  5HRE A;  1ZQP A;  4NXW A;  4AT8 A;  5KG0 A;  4K96 A;  3RH6 A;  4B9U A;  3TFS A;  2BBH A;  2ALZ A;  2KVS A;  8ICQ A;  3MR6 A;  1K1S A;  5DKW A;  2CPR A;  1WOT A;  1N60 A;  5J0T A;  3C23 A;  2DGZ A;  3DV9 A;  5T14 A;  3HIL A;  3TAN A;  1JRO A;  2WF9 A;  4HYK A;  1JMS A;  4KLM A;  2BQR A;  3T79 A;  5AKX A;  1KKX A;  7ICN A;  1X42 A;  3HPO A;  2ZIU B;  1IIP A;  2IOF A;  1MSW D;  3U26 A;  2B0C A;  2Y1J A;  3I1Y A;  3RB0 A;  2BDU A;  4MFF A;  2ZH5 A;  1VLB A;  4YMO A;  4ED6 A;  3H38 A;  4RU9 A;  9ICE A;  5CB1 A;  5DGB A;  2DPJ A;  4LVS A;  1TFY A;  2G06 A;  3OVA A;  1RYS A;  2W55 A;  5HR9 A;  4KN7 A;  9ICQ A;  5EOZ A;  4FHX A;  4OJP A;  4XQ8 A;  5ALG A;  2I9G A;  4F72 A;  1SL0 A;  4UAR A;  5AK3 A;  3NVZ A;  1RXV A;  2HHX A;  4RQ6 A;  1BNO A;  5EWF A;  2HBL A;  4O3N A;  2YX8 A;  5J0R A;  4OJO A;  1ZQS A;  2VA8 A;  4DQQ A;  3F2C A;  3AQF A;  4XUS A;  2PFQ A;  1S9F A;  2KEY A;  5III A;  5KG2 A;  3BQ0 A;  3GIK A;  4F5P A;  4DFP A;  2HOI A;  4F3O A;  1Q3U A;  3PX0 A;  1WG8 A;  5KG3 A;  1ZET A;  1ZQI A;  4YR3 A;  3UMB A; 
#chains in the Genus database with same CATH homology
 3ZDB A;  2W9C B;  4I2G A;  4X4S A;  2R8I A;  1UEU A;  4TUR A;  3HW8 A;  1JIH A;  2ZJA A;  3TAP A;  1XSN A;  1DOQ A;  3T5J A;  9ICU A;  1ZQO A;  2ASL A;  5KFI A;  4UB5 A;  4TUS A;  1S77 D;  4O3Q A;  4X0A A;  1V9P A;  2V4R A;  4X5V A;  4EBC A;  2ASJ A;  3H4B A;  4DQP A;  7ICP A;  4C8K A;  4F2S A;  5DQH A;  4WCW A;  1JX4 A;  4UB2 A;  3EPI A;  3EW9 A;  4Q44 A;  4EZ6 A;  5J0O A;  4O5E A;  1ZQF A;  4K4H A;  2M2T A;  2R8G A;  2MAX A;  1TK8 A;  2ZH6 A;  3QEA Z;  3Q8M A;  2GWS A;  3NYB A;  1ZQC A;  1U49 A;  4RPZ A;  2V9W A;  2DRB A;  4R64 A;  2XY7 A;  4GC6 A;  3ZD8 A;  1S97 A;  3AUO A;  4G3I A;  9ICN A;  1R8B A;  5DB8 A;  1Z3E B;  3GIM A;  2AGP A;  1U4B A;  1NKE A;  2ZH9 A;  3UPQ A;  4Z6D A;  4DWI A;  1UET A;  4WBZ A;  3LDA A;  5KTQ A;  2V4Q A;  5TZV A;  4QZI A;  3RRH A;  2PI5 A;  4WC2 A;  1BPD A;  3HIY A;  1JQR A;  1XS9 D;  4X4U A;  2PXI A;  5IIO A;  1KNY A;  4NM2 A;  2IHM A;  4DF4 A;  4J9K A;  3LK9 A;  2LYH A;  3MFI A;  4I2H A;  1MIW A;  3ZD9 A;  4WBY A;  4JV1 A;  4F93 B;  4YN4 A;  1U47 A;  2Q66 A;  1ZQT A;  5J0Q A;  1PZN A;  4FBU A;  3V7L A;  2XGP A;  4NY8 A;  4DQS A;  4FHY A;  2FPM A;  3SYZ A;  4FS1 A;  3RB4 A;  1NK7 A;  3RR7 A;  4EP7 A;  3G6X A;  3OUY A;  1VFG A;  2BGW A;  3ZDC A;  9ICB A;  1EXN A;  3TAR A;  1L3T A;  2C2E A;  3PO5 A;  2HHQ A;  2ID1 A;  5HMM A;  4O5K A;  2F1H A;  3AU2 A;  4ED8 A;  3LWL A;  7ICL A;  4Z6C A;  4YQW A;  4ECR A;  2J6T A;  4I2C A;  1V4A A;  3PX6 A;  1ZQQ A;  4YXM A;  3OGU A;  2VAN A;  4KTQ A;  2O5A A;  2PBE A;  8ICV A;  4PGY A;  2W9C A;  5KG4 A;  4KLG A;  1CUK A;  4QZG A;  4Q45 A;  4DSI A;  1ZQA A;  2NRT A;  4MFC A;  3ETL A;  1QLN A;  2XC9 A;  1X9M A;  5J0U A;  5BOL A;  3TI0 A;  5IIK A;  4QWA A;  5KG6 A;  4DSJ A;  4KLF A;  5J0S A;  4RUC A;  4RWN A;  4RWP A;  5J2B A;  3PW4 A;  2B21 A;  5KFO A;  4GXJ A;  4X4O A;  4RQ8 A;  4DQR A;  3OJS A;  1MQ2 A;  2C2D A;  7ICK A;  8ICJ A;  3PY8 A;  7ICE A;  3OJU A;  3AQN A;  2I1Q A;  4JK1 A;  2BQ3 A;  2IMW P;  4PH5 A;  4PGQ A;  3PW0 A;  4IRD A;  2W9B B;  3IM1 A;  3PW2 A;  1QTM A;  4UBC A;  4F4Y A;  4E0D A;  4BXO B;  3M8S A;  4IQU A;  2BCR A;  2HHT A;  4TQR A;  3WFR E;  9ICL A;  3MR5 A;  4ED7 A;  4E80 A;  3KHH A;  4PHA A;  4ECY A;  4M9J A;  3SI8 A;  2IA6 A;  4KLU A;  4DSF A;  3RB6 A;  5KFP A;  8ICP A;  4DFK A;  2DR9 A;  4ELV A;  4XA5 A;  4P4M A;  1IM4 A;  3GDX A;  2W8K A;  4IRC A;  1YLQ A;  1B22 A;  4KLE A;  1F5A A;  3HJ1 A;  2ZUC A;  3RH5 A;  9ICI A;  3NTU A;  1NJW A;  4WC4 A;  3V6H A;  4XQ7 A;  2ZH1 A;  3RRG A;  5L9X A;  1TAQ A;  4C8M A;  4I2F A;  2KTQ A;  2ISO A;  5KFJ A;  1ZQI A;  2AJQ A;  3GFK B;  3PMN A;  3BQ1 A;  2HHS A;  4K4I A;  8ICR A;  1KLN A;  2BCV A;  3M9M B;  1TKD A;  4RQ5 A;  5KFM A;  1MC8 A;  5J2K A;  4ED3 A;  3GV5 B;  4FBT A;  3TQ1 A;  4BWJ A;  1KFS A;  3UQ0 A;  4WC5 A;  3THV A;  3QZ7 A;  5JUM A;  1N56 A;  4UAY A;  3V7J A;  4IR9 A;  4RUA A;  1ZQX A;  4EBK A;  5KFU A;  3HWT A;  3AU6 A;  2P6U A;  4UB1 A;  1XSL A;  2XY6 A;  4F5O A;  3Q8K A;  1TVA A;  5KFC A;  2VA2 A;  2HHV A;  3JPP A;  9ICS A;  4O3P A;  1D9D A;  3MBY A;  3C2M A;  3RJH A;  9ICM A;  4RNO A;  7ICG A;  8ICB A;  1UA1 A;  4J9M A;  4YP3 A;  3PW5 A;  1T4G A;  4NM1 A;  9ICH A;  4TUP A;  1ZQU A;  4BGD A;  1R89 A;  2HHU A;  4I2D A;  4QZE A;  3OV7 A;  4NKT A;  4GLX A;  7ICJ A;  1XU4 A;  4ZH4 A;  1SKS A;  1QSS A;  1UT8 A;  4NLN A;  9ICA A;  4P4O A;  4F4Z A;  4IQV A;  2XCA A;  2R8H A;  3JYY A;  1BNP A;  3V6K A;  4MF8 A;  4X4T A;  1DK2 A;  1KFD A;  3EYZ A;  1L3U A;  2ZH4 A;  1ARO P;  3RB3 A;  1LV5 A;  2W9B A;  2M2W A;  2ZHA A;  5KFV A;  4F4X A;  1BPX A;  4BXO A;  2IBK A;  4M5D A;  4M9H A;  5KG1 A;  4KMU A;  1ZJN A;  3HX0 A;  2NRZ A;  8ICY A;  1K1Q A;  5DBA A;  1T7P A;  4I27 A;  5KFX A;  5KT4 A;  3KHR A;  8ICT A;  2KP7 A;  3C21 A;  8ICW A;  2BPC A;  4YMN A;  3SZ2 A;  3ORY A;  1NJZ A;  3HP6 A;  4M47 A;  5DQG A;  2ZHB A;  4F50 A;  2FMP A;  2DR7 A;  3ISD A;  5KFH A;  4ECZ A;  4KLL A;  4J9N A;  1DGS A;  1WCN A;  4Z6F A;  4YCX A;  5DG9 A;  3OHB A;  3RTV A;  4DF8 A;  1T3N A;  1ZQL A;  8ICE A;  1MIV A;  4RWQ A;  3JZ0 A;  5DDM A;  4DSL A;  2R8J A;  5DGA A;  5J0X A;  1D9F A;  2FMS A;  8ICX A;  4X0B A;  5L1L A;  4F4W A;  5KFK A;  2KN7 A;  4Q43 A;  5IIN A;  5CR0 A;  4RQ7 A;  4FO6 A;  2RDI A;  2Y1I A;  1Z00 B;  4QZ8 A;  4I28 A;  5HHI A;  5D46 A;  1NKB A;  7ICR A;  1IXR A;  3Q8Q B;  4F92 B;  1NKC A;  2WTF A;  5D49 A;  1NK4 A;  1MIY A;  1U9L A;  4DL6 A;  3OHA A;  5J0W A;  2C28 A;  2BCQ A;  2RDJ A;  4DSE A;  3KHL A;  5J2G A;  1L3V A;  4UAW A;  4DS5 A;  1ZQZ A;  3G6Y A;  1SZP A;  3K4G A;  3RBD A;  1KSP A;  4ECV A;  4KLI A;  4X4N A;  3H8S A;  3ISB A;  4O5C A;  3N4M B;  4PHE A;  9ICV A;  9ICP A;  1NO5 A;  2ZTD A;  4RPY A;  7ICS A;  4E7X A;  5HRG A;  5DB9 A;  1SL1 A;  1ZQK A;  2FPL A;  4PGX A;  5HP4 A;  3JPR A;  3RBE A;  1RYR A;  1HUZ A;  3WFQ E;  4NLK A;  4TUQ A;  2R8K A;  1BPY A;  1SL2 A;  3NGD A;  1CEZ A;  5HRL A;  4GXK A;  4ED2 A;  1S0N A;  3AQM A;  5F9N A;  3GV7 B;  3RH4 A;  4O3R A;  4QW8 A;  3UXP A;  4RQ0 A;  2ATL A;  1RXW A;  2W9M A;  2OWO A;  4FH5 A;  5KG5 A;  2C22 A;  4DFM A;  2FPK A;  8ICC A;  4QZA A;  4AT9 B;  3C1Y A;  3Q8S B;  4YFK A;  4PHD A;  4F5Q A;  1UT5 A;  2BR0 A;  1TFR A;  1L5U A;  2FLN A;  4DLG A;  8ICH A;  4X4V A;  4UBB A;  2BCS A;  4NKU A;  4IG8 A;  3TFR A;  3C2K A;  4X4R A;  2PFP A;  4LZG A;  1ZQY A;  2UVW A;  4M04 A;  3H8J A;  1ZQD A;  4M9L A;  3EZ5 A;  3EPG A;  5HRH A;  3OVB A;  5J2F A;  8ICZ A;  5BOM A;  5HC9 A;  5HHH A;  4YR2 A;  1MQ3 A;  5KFA A;  4MEX A;  1ZQN A;  2ZH2 A;  4B9M A;  4C8O A;  3QE9 Y;  5HRI A;  2NRK A;  2F1J A;  3MR3 A;  3MGH A;  3V7K A;  2HVI A;  3Q8L A;  3H37 A;  5EWE A;  2ZH8 A;  3PX4 A;  5IIJ A;  1NJX A;  4B9L A;  4M9N A;  3HJ4 A;  4UD5 A;  2W8L A;  5KT7 A;  2BCU A;  4F5R A;  5KFW A;  5J0Y A;  3C2L A;  3ZDA A;  4B9N A;  5J2I A;  1S0V A;  3GV8 B;  7ICF A;  4QWD A;  1Z00 A;  3G6V A;  4YMM A;  4F91 B;  3B0Y A;  3UQ2 A;  5KFY A;  4MFA A;  2W9A A;  4DO9 A;  1NK8 A;  2XO7 A;  4ECT A;  3QEB Z;  4PHP A;  2JEI A;  5KFF A;  1R8A A;  1UEV A;  3UXN A;  1SKR A;  4QWE A;  1QSY A;  4KLO A;  2FLL A;  3JPS A;  3C66 A;  4EEY A;  1X9W A;  2PFO A;  4KLQ A;  1NK6 A;  3WFP A;  2ZTC A;  2BPG A;  3Q8R B;  2ZTE A;  2BDP A;  3PNC A;  3MDA A;  4ECQ A;  8ICS A;  4B9V A;  5HRF A;  3SV4 A;  5DG7 A;  1KRP A;  4CCH A;  7ICO A;  4P4P A;  8ICK A;  3RJJ A;  4K4G A;  2ZJ8 A;  4UAZ A;  5DBB A;  4B9T A;  5CHG A;  5J2H A;  2PFN A;  1WCL A;  7ICU A;  4Q8E A;  4RQ1 A;  3WFS C;  3H4D A;  1ZQH A;  8ICL A;  4LT6 A;  3C5G A;  4IRK A;  4LZD A;  5J2D A;  4FH3 A;  5DLG A;  4ED0 A;  5KFG A;  4FHP A;  5IIL A;  5KFQ A;  2ISP A;  4NLG A;  1B43 A;  4O0I A;  4B9S A;  5HRK A;  1BPE A;  3ZDE A;  4I2B A;  5HRD A;  2KFN A;  4WC6 A;  2ASD A;  2XCP A;  2FMQ A;  2KZ3 A;  5J0P A;  2JZB B;  8ICO A;  4AT9 A;  3MGI A;  4KIT B;  3M8R A;  1XC9 A;  4ELT A;  8ICF A;  3PR4 A;  2BQU A;  1KEJ A;  3ISC A;  4ECW A;  8ICN A;  1VJ7 A;  5F2V O;  3PW7 A;  2O1P A;  2P6R A;  2DR5 A;  2A1J B;  4RQ2 A;  4GC7 A;  3IHQ B;  4J9Q A;  5J29 A;  5CP2 A;  5CJ7 A;  3T3F A;  4KLT A;  1U45 A;  2NRX A;  3PR5 B;  3QZ8 A;  2XY5 A;  1ZQM A;  4XRH A;  3MR2 A;  4J9S A;  4RZR A;  1S0M A;  3H39 A;  4I29 A;  8ICI A;  4C8N A;  4KLJ A;  4Z6E A;  3C1Z A;  5KT2 A;  4E8F A;  1KTQ A;  4YXJ A;  2XGQ A;  4FS2 A;  4DOC A;  3RAQ A;  5C5J A;  3HT3 A;  4DOA A;  1NK9 A;  4M2Y A;  4X4P A;  1JXE A;  4P2H A;  3JPT A;  3GQC A;  4AT8 B;  4KLH A;  1ZQR A;  4IR1 A;  3FDS A;  2J6S A;  4O9M A;  2BKE A;  4DEZ A;  2DFL A;  1TV9 A;  4DOB A;  1DK3 A;  4MEY A;  4UB3 A;  4EBD A;  3PO4 A;  2M2V A;  3H7I A;  4QZD A;  5DLF A;  1ZJM A;  5HRB A;  1R8C A;  5KFZ A;  2NRW A;  4AT7 B;  4M6W B;  3SV3 A;  4JWN A;  1LB2 B;  5DG8 A;  5J2E A;  4NLZ A;  2KFZ A;  4WC0 A;  1BPZ A;  8ICU A;  4KN4 A;  4UB4 A;  2PI4 A;  1NK5 A;  1A76 A;  1ZQW A;  4ECS A;  1ZQJ A;  4FHV A;  4BDP A;  3ZDD A;  9ICT A;  9ICC A;  1UA0 A;  1Q79 A;  3M9N B;  4RQ4 A;  3RAX A;  9ICR A;  2HHW A;  3WFO A;  4WC3 A;  4DL5 A;  3UPS A;  5EWG A;  4EBJ A;  7ICM A;  3T5L A;  5KG7 A;  4R66 A;  2KZZ A;  1HUO A;  2JEG A;  5HML A;  4YG2 A;  1JXL A;  5KFS A;  7ICQ A;  1H38 A;  4DQI A;  1JAJ A;  3V72 A;  1BGX T;  2AQ0 A;  5KFN A;  4QWC A;  5DB7 A;  3OSP A;  5KFD A;  1COO A;  1U48 A;  1SKW A;  4DL7 A;  2JZB A;  3BJY A;  5KFE A;  3N97 B;  9ICW A;  4RWO A;  3T5K A;  4ECX A;  5L1I A;  4M9G A;  4J9O A;  5KFL A;  2P66 A;  2ZJ5 A;  2DPI A;  2BHN A;  3K75 D;  3BQT A;  3TAQ A;  4QZB A;  2A1J A;  4R8U B;  5CWR A;  4F2R A;  3AQK A;  5DB6 A;  3OVS A;  9ICX A;  4S3N A;  4DL2 A;  2ZUB A;  4UQG A;  4J9P A;  4GXI A;  2HVH A;  3RJI A;  2AGO A;  4TQS A;  5HNK A;  2MUT B;  3E2E A;  4JV2 A;  9ICG A;  3JPN A;  3JPO A;  1KFT A;  3L9D A;  2DR8 A;  2HW3 A;  4RT2 A;  1S76 D;  1NOM A;  3GIL A;  4ELU A;  4O3O A;  2AQ4 A;  2F1I A;  3KHG A;  1ZQP A;  1KDH A;  5HRE A;  1QSL A;  4FHW A;  4AT8 A;  3H8W A;  5F9L A;  4DLE A;  4EBE A;  1TK0 A;  4EZ9 A;  5KG0 A;  3B0X A;  8ICM A;  1NZP A;  4WC7 A;  2DVI A;  5J2A A;  3RJE A;  4M0A A;  3RH6 A;  4B9U A;  4NXZ A;  3TFS A;  2HHP A;  2ZUD A;  4QZC A;  4RNN A;  4QW9 A;  2ALZ A;  2ZH3 A;  1A77 A;  2AGQ A;  8ICQ A;  4AT7 A;  4M6W A;  4WC1 A;  9ICK A;  3MR6 A;  5KT6 A;  1K1S A;  5DKW A;  5IIM A;  3PV8 A;  2J6U A;  4YD1 A;  2UVV A;  3MAB A;  5J0T A;  1WOT A;  3H3A A;  3C23 A;  4R65 A;  1TAU A;  4I2I A;  7ICH A;  3C5F A;  4EYH B;  2NRV A;  1C7Y A;  3JPQ A;  1RPL A;  2BE3 A;  4F5N A;  3TAN A;  3RJF A;  4J9R A;  1X9S A;  4HYK A;  1T8E A;  4YD2 A;  5DBC A;  1XSP A;  3RJG A;  3OSN A;  1TFW A;  3UXO A;  1JMS A;  5DED A;  4QZF A;  4KLM A;  5CA7 A;  2BQR A;  4RNM A;  3RR8 A;  4DSK A;  7ICV A;  4ATB B;  4F8R A;  4R63 A;  4YR0 A;  2IHN A;  4JV0 A;  1S10 A;  4JWM A;  3LQC B;  4KLS A;  8ICA A;  7ICN A;  5KT3 A;  1PX5 A;  3GII A;  2Q0Z X;  3HPO A;  4I2A A;  5BPC A;  1MSW D;  8ICG A;  1JN3 A;  4R8U A;  3V6J A;  1N48 A;  1BVS A;  4DL4 A;  2AU0 A;  3BDP A;  4DS4 A;  3FYH A;  5KFB A;  2Y1J A;  1ZQE A;  3RB0 A;  4MFF A;  2ZH7 A;  1ZQV A;  2C2R A;  2MUT A;  2ZH5 A;  4DL3 A;  2RFF A;  4IQT A;  5L1K A;  3AQL A;  1RZT A;  4YMO A;  4ED1 A;  4ED6 A;  3H38 A;  4RU9 A;  9ICE A;  5CB1 A;  5DGB A;  5DQI A;  3MDC A;  2DPJ A;  3KTQ A;  5DEC A;  4LVS A;  3PML A;  4J9L A;  1TFY A;  4I2J A;  3M9O B;  4X4Q A;  1ZYQ A;  4DFJ A;  3OVA A;  2DRA A;  4JUZ A;  1RYS A;  4EYI B;  3H40 A;  5KFT A;  4QZH A;  4IQW A;  5HR9 A;  4Q8F A;  3OUY B;  4I2E A;  4KN7 A;  2KZM A;  2JEF A;  3RJK A;  4KLD A;  3EWA A;  9ICQ A;  5J2C A;  5EOZ A;  4FHX A;  4RQ3 A;  4XQ8 A;  4RT3 A;  3MFH A;  2BPF A;  1BPB A;  1HJP A;  1X2I A;  4C8L A;  4YVZ A;  9ICJ A;  2I9G A;  1D8Y A;  4BWM A;  1XO1 A;  4PPX A;  3LWM A;  2M9N A;  1SL0 A;  1RXV A;  2HHX A;  4RQ6 A;  9ICF A;  7ICT A;  1BNO A;  4RPX A;  4ECU A;  5EWF A;  5J2J A;  4O3N A;  5L1J A;  5J0R A;  5KT5 A;  1ZQS A;  4UD4 A;  2VA8 A;  5KFR A;  4DQQ A;  1ZQB A;  1L3S A;  1Y88 A;  5DDY A;  4XUS A;  1ZQG A;  1FA0 A;  2PFQ A;  2H5X A;  5D4B A;  1S9F A;  4O3S A;  1TK5 A;  1XWL A;  1S0O A;  2FLP A;  9ICO A;  3BQ2 A;  5III A;  2UVR A;  5KG2 A;  2UVU A;  4QZ9 A;  4F4K A;  7ICI A;  2M2U A;  3C18 A;  4ATB A;  3BQ0 A;  3GIK A;  4F5P A;  4DFP A;  3PVX A;  1Q78 A;  4F3O A;  3T5H A;  3Q8P B;  3GIJ A;  3PX0 A;  2VA3 A;  1NJY A;  4QWB A;  2JEJ A;  1OU5 A;  1D8L A;  1ZET A;  1NK0 A;  4YR3 A;  5KG3 A;  4MF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...