4WC6A

Structure of trna-processing enzyme complex 4
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc6A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc6A01
4AT8B 1ZQFA 4KLEA 5BOLA 3MGIA 2BCQA 5J2AA 1JMSA 1ZQOA 4ATBA 4IG8A 8ICBA 4X5VA 8ICVA 5J2HA 5J0QA 4WC1A 3RH5A 7ICRA 9ICFA 4WC6A 7ICUA 4RPXA 5DB6A 8ICAA 7ICIA 1RPLA 4I29A 3H39A 1ZQUA 1TFWA 9ICLA 7ICGA 3MGHA 3V7JA 3UQ0A 4WC7A 9ICJA 9ICTA 4JWNA 2GWSA 4NLZA 1ZQBA 4NXZA 8ICUA 5HC9A 8ICTA 5J2IA 1ZQGA 4MF2A 1UEVA 8ICMA 1PX5A 2ZH5A 2HHPA 4KLFA 4UB1A 3ISCA 4NKUA 2DRAA 4GXIA 4KLTA 1ZQCA 4Z6DA 4RQ0A 3LK9A 5IIIA 4UB3A 3OUYA 3TFSA 8ICIA 5DBCA 3JPPA 4TUSA 5F2VO 4QZHA 2FMQA 5CA7A 8ICGA 1VFGA 3JYYA 3H37A 1R8CA 2IHMA 5IIKA 4F5PA 4PGQA 4I2EA 8ICEA 2DRBA 4KLQA 4EP7A 1F5AA 4PPXA 4I2BA 4RQ4A 2BCSA 4K4GA 1KDHA 3C5GA 3RJIA 5HRDA 4X4QA 4GXJA 3AU2A 1OU5A 3UXOA 4PGYA 2ID1A 5CHGA 3RH6A 3RJFA 4I2AA 4M9GA 4YMNA 2DR9A 1HUOA 5J2JA 4FHVA 4YD1A 2DR5A 1BPXA 3JPTA 1TV9A 4WBYA 4F5OA 9ICHA 1ZQEA 1BPYA 2O1PA 5EOZA 5DKWA 5J2FA 4YCXA 3H3AA 8ICNA 1ZQAA 5HHHA 4FO6A 4AT9B 8ICLA 4AT9A 5HR9A 1MIYA 4MF8A 4F5QA 7ICNA 5J0SA 5J0YA 4IQWA 3OVSA 5DB7A 4UD4A 4DOAA 5DBAA 2ZH7A 4QZ8A 1ZQJA 1VJ7A 4I2DA 2BPGA 4WC4A 9ICQA 9ICMA 7ICMA 5BOMA 4KLMA 3AQLA 3JPSA 2O5AA 4I2FA 3OVAA 5HHIA 3UXPA 4TURA 4R63A 4O5CA 2ZH8A 3V72A 4UAYA 8ICYA 3TFRA 4RQ6A 9ICVA 4AT8A 4RQ2A 4KLLA 2ZH6A 2FMSA 4RWPA 4WC3A 9ICBA 2ZHBA 4LVSA 2DR8A 3C2LA 2BCRA 5TZVA 1ZQWA 9ICRA 4X4RA 9ICSA 2PFPA 4P4MA 5HREA 5IIJA 1ZQKA 7ICVA 4RT3A 5IINA 2PFNA 5D49A 1JQRA 4YD2A 4TUQA 4QZ9A 3RJGA 8ICFA 2ZHAA 1BPEA 2NRKA 5CP2A 4UB4A 4KLIA 9ICCA 4EBJA 8ICCA 1JN3A 3RJEA 2BPFA 3B0XA 1MQ3A 1KNYA 4M2YA 4X4OA 3UQ2A 4QZCA 4M47A 4UB2A 4QZAA 3OGUA 3RJHA 4X0AA 4RQ3A 4DOCA 4WC0A 2PFQA 9ICWA 4MFAA 3C2MA 4MFCA 4MFFA 1MIVA 3JPOA 4XRHA 5J2BA 3JPRA 4Z6FA 5HRGA 9ICPA 4PHPA 3OV7A 3RJJA 5D4BA 4YMMA 3V7LA 4RPYA 4UAZA 9ICEA 1TVAA 4M9JA 1ZQZA 1FA0A 4NM2A 4KLDA 3WFSC 2Q66A 2ZH9A 1Q79A 3HW8A 3C2KA 3RH4A 3AQKA 3C66A 5J29A 5J0PA 1ZQRA 4UBBA 9ICUA 4PH5A 4QZFA 8ICJA 5DDYA 4K4HA 4KLHA 7ICTA 4FHPA 5J2EA 2P66A 4XQ8A 2ZH4A 4RWOA 8ICXA 1XSNA 1R89A 1R8BA 4YN4A 3PNCA 2PXIA 3ISDA 4QZBA 4P4PA 4RQ7A 3UXNA 4K4IA 4M9LA 4LZDA 4I28A 4NLKA 9ICXA 8ICSA 3HIYA 1BPDA 4I27A 4O9MA 1ZJNA 4Z6CA 5J2GA 4WC5A 1ZQMA 4KLSA 8ICHA 3L9DA 1BPZA 1ZQQA 5DB9A 4FHXA 7ICLA 4F5NA 3AUOA 1BPBA 4XQ7A 8ICKA 4FH3A 1RZTA 4X4PA 5J2CA 4M0AA 4IQTA 2M2WA 4QZGA 3HWTA 4AT7B 4UAWA 2ISOA 9ICAA 4S3NA 8ICPA 4E7XA 3AQNA 4NM1A 7ICEA 4PHEA 3C5FA 2I9GA 3JPQA 3LQCB 1ZQHA 3OVBA 3GDXA 7ICHA 1NO5A 4XA5A 4PHDA 3V7KA 1ZQSA 4QZDA 4Z6EA 4DOBA 3C18A 2M2TA 4IQVA 3JPNA 1HUZA 4QZEA 4WC2A 2W9MA 5CWRA 7ICPA 2ZH2A 7ICJA 1V4AA 4ATBB 4I2JA 2M2UA 1ZQLA 9ICKA 4XUSA 3HJ1A 4E8FA 1YLQA 2BCVA 4RQ8A 5J0WA 5HRHA 8ICOA 1UETA 5CJ7A 4X4VA 5HRLA 9ICOA 4RT2A 1XSPA 4RWQA 4KLOA 4R66A 2DVIA 4P4OA 3NYBA 3MDAA 8ICWA 5DDMA 4NLNA 4TUPA 5DECA 4RQ5A 4LZGA 4M5DA 5IIOA 5HRBA 4RWNA 1ZQXA 3UPQA 2FMPA 1ZQNA 5DBBA 4KLJA 4GXKA 4QZIA 2M2VA 3B0YA 4X4TA 4LT6A 1NOMA 9ICIA 4M9NA 9ICNA 4O5EA 1ZQIA 3WFQE 4UD5A 2BPCA 3OUYB 4F5RA 4IQUA 7ICKA 3RJKA 4KLGA 4JWMA 2VANA 3WFOA 4UBCA 3PMLA 2PFOA 7ICSA 4NY8A 3H38A 3JZ0A 3MBYA 1ZJMA 4KLUA 8ICQA 5D46A 1WOTA 2DR7A 7ICQA 1TFYA 5DB8A 1UEUA 1MIWA 4PGXA 3K75D 4I2CA 4E80A 1KEJA 4I2HA 1ZQVA 4R65A 3WFPA 4RPZA 1XSLA 5J0OA 4NKTA 2ZH1A 4PHAA 5J2KA 2ISPA 5IIMA 4DO9A 4I2GA 8ICZA 3UPSA 2BE3A 5J0UA 1ZQTA 3AU6A 1MQ2A 1ZQDA 4M04A 3PMNA 4X4UA 5J0RA 3MDCA 1JAJA 4RQ1A 4O5KA 1ZQYA 5HRFA 5J0TA 4M9HA 3HX0A 4X4NA 1ZQPA 5BPCA 1R8AA 4R64A 4AT7A 5J0XA 7ICFA 2RFFA 7ICOA 3HJ4A 3AQMA 4FH5A 4P2HA 5CR0A 5HRKA 4YMOA 5CB1A 4UB5A 4WBZA 5HRIA 1Q78A 4X4SA 4FHYA 4WCWA 8ICRA 5DEDA 4EBKA 9ICGA 3ISBA 4FHWA 2PBEA 4I2IA 5IILA 5J2DA 2BCUA 4X0BA 2ZH3A 3WFRE
chains in the Genus database with same CATH superfamily
4AT8B 1ZQFA 4KLEA 5BOLA 3MGIA 2BCQA 5J2AA 1JMSA 1ZQOA 4ATBA 4K99A 4IG8A 8ICBA 4X5VA 8ICVA 5J2HA 5J0QA 4WC1A 3RH5A 7ICRA 9ICFA 4WC6A 7ICUA 4RPXA 5DB6A 8ICAA 7ICIA 1RPLA 4I29A 3H39A 1ZQUA 1TFWA 9ICLA 7ICGA 3MGHA 3V7JA 3UQ0A 4WC7A 9ICJA 9ICTA 4O67A 4JWNA 2GWSA 4HX0A 4NLZA 1ZQBA 4NXZA 8ICUA 5HC9A 8ICTA 5J2IA 1ZQGA 4MF2A 1UEVA 8ICMA 1PX5A 2ZH5A 2HHPA 3K7DA 4KLFA 4UB1A 3ISCA 4NKUA 2DRAA 4GXIA 4KLTA 1ZQCA 4OAFA 4Z6DA 4RQ0A 3LK9A 5JTGA 5IIIA 4UB3A 3OUYA 3TFSA 8ICIA 5DBCA 3JPPA 4TUSA 5F2VO 4QZHA 2FMQA 5CA7A 4K97A 8ICGA 3ER9B 1VFGA 3JYYA 3H37A 1R8CA 2IHMA 4JLZA 5IIKA 4F5PA 4PGQA 4I2EA 8ICEA 2DRBA 4KLQA 4EP7A 1F5AA 4PPXA 4I2BA 4RQ4A 2BCSA 4K4GA 1KDHA 3C5GA 3RJIA 5HRDA 2HN1A 4X4QA 4GXJA 3AU2A 1OU5A 3UXOA 4PGYA 2ID1A 5CHGA 3RH6A 5CFTA 3RJFA 4I2AA 4M9GA 4YMNA 2DR9A 4O69A 1HUOA 5J2JA 4FHVA 4YD1A 2DR5A 1BPXA 3JPTA 3PHZA 1TV9A 4WBYA 4F5OA 9ICHA 4LEZA 1ZQEA 1BPYA 2O1PA 5EOZA 5DKWA 1GPJA 5J2FA 4YCXA 3H3AA 5CHEA 8ICNA 1ZQAA 5D63A 5HHHA 4FO6A 2B4VA 4AT9B 8ICLA 4AT9A 5HR9A 1MIYA 4MF8A 4F5QA 7ICNA 5J0SA 5J0YA 4IQWA 3OVSA 5DB7A 4UD4A 4DOAA 5DBAA 2ZH7A 4QZ8A 1ZQJA 1VJ7A 4I2DA 2BPGA 4WC4A 4WH5A 9ICQA 9ICMA 4NXVA 7ICMA 5BOMA 4KLMA 3AQLA 3JPSA 2O5AA 4I2FA 3OVAA 5HHIA 5CFSA 3UXPA 4TURA 4NXTA 4R63A 4O5CA 4OAHA 2ZH8A 3V72A 4UAYA 8ICYA 3EF2A 3TFRA 4RQ6A 9ICVA 4AT8A 4RQ2A 4KLLA 2ZH6A 2FMSA 4RWPA 4WC3A 4OAIZ 9ICBA 2ZHBA 4LVSA 3OWGA 2DR8A 3C2LA 2BCRA 4EGWA 5TZVA 1ZQWA 9ICRA 4X4RA 9ICSA 2PFPA 4P4MA 5HREA 5IIJA 1ZQKA 7ICVA 4RT3A 5IINA 2PFNA 5D49A 1JQRA 4YD2A 4TUQA 4QZ9A 3RJGA 8ICFA 2ZHAA 1BPEA 2NRKA 5CP2A 4UB4A 4KLIA 9ICCA 4NXUA 4EBJA 1JN3A 3RJEA 8ICCA 2BPFA 4K96A 3B0XA 1MQ3A 1KNYA 4NXXA 4M2YA 4X4OA 3UQ2A 4QZCA 4M47A 4EV6A 4UB2A 4QZAA 3OGUA 3RJHA 4X0AA 4RQ3A 4DOCA 4WC0A 2PFQA 9ICWA 4MFAA 3C2MA 4MFCA 4O68A 4MFFA 2BBJA 1MIVA 3JPOA 4XRHA 5J2BA 3JPRA 4Z6FA 5HRGA 4K9AA 9ICPA 4PHPA 3OV7A 3RJJA 3JCFA 5D4BA 4YMMA 3V7LA 4RPYA 4UAZA 4OAGA 9ICEA 1TVAA 4M9JA 1ZQZA 1FA0A 4NM2A 4KLDA 3WFSC 2Q66A 2ZH9A 1Q79A 3HW8A 3C2KA 3RH4A 3AQKA 3C66A 5J29A 5D61A 5J0PA 1ZQRA 4UBBA 4XJEA 5B3PA 9ICUA 4PH5A 4QZFA 8ICJA 5DDYA 4K4HA 4KLHA 5B3QA 7ICTA 4FHPA 4N7RA 5J2EA 4WQLA 2P66A 4XQ8A 2ZH4A 4RWOA 8ICXA 1XSNA 1R89A 1R8BA 4YN4A 3PNCA 2PXIA 3ISDA 4QZBA 4P4PA 4RQ7A 3UXNA 4K4IA 4M9LA 4LZDA 4I28A 4NLKA 4I0UA 9ICXA 8ICSA 4KM5A 2BBHA 3HIYA 4MKPA 1BPDA 4I27A 4O9MA 1ZJNA 4Z6CA 5J2GA 4WC5A 1ZQMA 4KLSA 8ICHA 3L9DA 1BPZA 1ZQQA 5DB9A 4FHXA 7ICLA 4F5NA 3AUOA 1BPBA 4XQ7A 8ICKA 4FH3A 1RZTA 4X4PA 5J2CA 4M0AA 4IQTA 2M2WA 4QZGA 3HWTA 4AT7B 4UAWA 2ISOA 3CK6A 9ICAA 4S3NA 8ICPA 4E7XA 3AQNA 4NM1A 7ICEA 4PHEA 2HN2A 3NWIA 3C5FA 4LEYA 2I9GA 2B56A 3JPQA 3LQCB 1ZQHA 3OVBA 5D62A 3GDXA 7ICHA 1NO5A 4XA5A 4PHDA 3V7KA 1ZQSA 4QZDA 4Z6EA 2B51A 4DOBA 3C18A 2M2TA 4IQVA 3JPNA 1HUZA 4QZEA 4WC2A 2W9MA 3ER8C 5CWRA 7ICPA 2ZH2A 7ICJA 1V4AA 4ATBB 4I2JA 5CFUA 2M2UA 1ZQLA 9ICKA 4XUSA 3HJ1A 4E8FA 1YLQA 2BCVA 4RQ8A 5J0WA 5HRHA 8ICOA 1UETA 5CJ7A 4X4VA 5HRLA 9ICOA 4RT2A 1XSPA 4RWQA 4KLOA 4R66A 2DVIA 4P4OA 3NYBA 3MDAA 4EEBA 8ICWA 5DDMA 4NLNA 4TUPA 4NXWA 5DECA 4RQ5A 4LZGA 4M5DA 5IIOA 5HRBA 4RWNA 1ZQXA 4FO1A 3UPQA 2FMPA 1ZQNA 5DBBA 4KLJA 4GXKA 2EWRA 4QZIA 2M2VA 2FCLA 3B0YA 3NKUA 4LT6A 1NOMA 3NVOA 4X4TA 9ICIA 4M9NA 9ICNA 4LEVA 4O5EA 1ZQIA 3WFQE 4UD5A 2BPCA 3OUYB 4F5RA 4IQUA 7ICKA 3RJKA 4KLGA 3MCRA 4JWMA 2VANA 3WFOA 4UBCA 4O6AA 3PMLA 2PFOA 7ICSA 4NY8A 3H38A 3JZ0A 3MBYA 1ZJMA 4KLUA 8ICQA 5D46A 1WOTA 2DR7A 7ICQA 1TFYA 5DB8A 1UEUA 1MIWA 4PGXA 3K75D 4I2CA 4E80A 1KEJA 4I2HA 2GA9D 1ZQVA 4R65A 3WFPA 4RPZA 1XSLA 5J0OA 4NKTA 2ZH1A 4PHAA 5J2KA 4JLXA 2ISPA 5IIMA 4DO9A 4I2GA 8ICZA 3UPSA 2BE3A 4WOYA 5J0UA 1ZQTA 3AU6A 1MQ2A 1ZQDA 4M04A 3PMNA 4X4UA 5J0RA 2GAFD 4LEWA 3ERCC 3MDCA 2IUBA 1JAJA 4RQ1A 4O5KA 1ZQYA 5HRFA 5J0TA 4M9HA 3HX0A 4X4NA 4K9BA 4EEDA 1ZQPA 5BPCA 4KB6A 1R8AA 4R64A 4AT7A 5J0XA 7ICFA 2RFFA 7ICOA 3HJ4A 3AQMA 4FH5A 4P2HA 4K8VA 5CR0A 5HRKA 4YMOA 4K98A 5CB1A 4UB5A 4WBZA 5HRIA 1Q78A 4X4SA 4FHYA 4WCWA 2IHOA 8ICRA 5DEDA 4EBKA 9ICGA 3ISBA 4FHWA 4WQKA 2PBEA 4I2IA 5IILA 5J2DA 2BCUA 4X0BA 2ZH3A 3WFRE
chains in the Genus database with same CATH topology
4AT8B 1ZQFA 4KLEA 5BOLA 3MGIA 2BCQA 5J2AA 1JMSA 1ZQOA 4ATBA 4IG8A 8ICBA 4X5VA 8ICVA 5J2HA 5J0QA 4WC1A 3RH5A 7ICRA 9ICFA 4WC6A 7ICUA 4RPXA 5DB6A 8ICAA 7ICIA 1RPLA 4I29A 3H39A 1ZQUA 1TFWA 9ICLA 7ICGA 3MGHA 3V7JA 3UQ0A 4WC7A 9ICJA 9ICTA 4JWNA 2GWSA 4NLZA 1ZQBA 4NXZA 8ICUA 5HC9A 8ICTA 5J2IA 1ZQGA 4MF2A 1UEVA 8ICMA 1PX5A 2ZH5A 2HHPA 4KLFA 4UB1A 3ISCA 4NKUA 2DRAA 4GXIA 4KLTA 1ZQCA 4Z6DA 4RQ0A 3LK9A 5IIIA 4UB3A 3OUYA 3TFSA 8ICIA 5DBCA 3JPPA 4TUSA 5F2VO 4QZHA 2FMQA 5CA7A 8ICGA 1VFGA 3JYYA 3H37A 1R8CA 2IHMA 5IIKA 4F5PA 4PGQA 4I2EA 8ICEA 2DRBA 4KLQA 4EP7A 1F5AA 4PPXA 4I2BA 4RQ4A 2BCSA 4K4GA 1KDHA 3C5GA 3RJIA 5HRDA 4X4QA 4GXJA 3AU2A 1OU5A 3UXOA 4PGYA 2ID1A 5CHGA 3RH6A 3RJFA 4I2AA 4M9GA 4YMNA 2DR9A 1HUOA 5J2JA 4FHVA 4YD1A 2DR5A 1BPXA 3JPTA 1TV9A 4WBYA 4F5OA 9ICHA 1ZQEA 1BPYA 2O1PA 5EOZA 5DKWA 5J2FA 4YCXA 3H3AA 8ICNA 1ZQAA 5HHHA 4FO6A 4AT9B 8ICLA 4AT9A 5HR9A 1MIYA 4MF8A 4F5QA 7ICNA 5J0SA 5J0YA 4IQWA 3OVSA 5DB7A 4UD4A 4DOAA 5DBAA 2ZH7A 4QZ8A 1ZQJA 1VJ7A 4I2DA 2BPGA 4WC4A 9ICQA 9ICMA 7ICMA 5BOMA 4KLMA 3AQLA 3JPSA 2O5AA 4I2FA 3OVAA 5HHIA 3UXPA 4TURA 4R63A 4O5CA 2ZH8A 3V72A 4UAYA 8ICYA 3TFRA 4RQ6A 9ICVA 4AT8A 4RQ2A 4KLLA 2ZH6A 2FMSA 4RWPA 4WC3A 9ICBA 2ZHBA 4LVSA 2DR8A 3C2LA 2BCRA 5TZVA 1ZQWA 9ICRA 4X4RA 9ICSA 2PFPA 4P4MA 5HREA 5IIJA 1ZQKA 7ICVA 4RT3A 5IINA 2PFNA 5D49A 1JQRA 4YD2A 4TUQA 4QZ9A 3RJGA 8ICFA 2ZHAA 1BPEA 2NRKA 5CP2A 4UB4A 4KLIA 9ICCA 4EBJA 8ICCA 1JN3A 3RJEA 2BPFA 3B0XA 1MQ3A 1KNYA 4M2YA 4X4OA 3UQ2A 4QZCA 4M47A 4UB2A 4QZAA 3OGUA 3RJHA 4X0AA 4RQ3A 4DOCA 4WC0A 2PFQA 9ICWA 4MFAA 3C2MA 4MFCA 4MFFA 1MIVA 3JPOA 4XRHA 5J2BA 3JPRA 4Z6FA 5HRGA 9ICPA 4PHPA 3OV7A 3RJJA 5D4BA 4YMMA 3V7LA 4RPYA 4UAZA 9ICEA 1TVAA 4M9JA 1ZQZA 1FA0A 4NM2A 4KLDA 3WFSC 2Q66A 2ZH9A 1Q79A 3HW8A 3C2KA 3RH4A 3AQKA 3C66A 5J29A 5J0PA 1ZQRA 4UBBA 9ICUA 4PH5A 4QZFA 8ICJA 5DDYA 4K4HA 4KLHA 7ICTA 4FHPA 5J2EA 2P66A 4XQ8A 2ZH4A 4RWOA 8ICXA 1XSNA 1R89A 1R8BA 4YN4A 3PNCA 2PXIA 3ISDA 4QZBA 4P4PA 4RQ7A 3UXNA 4K4IA 4M9LA 4LZDA 4I28A 4NLKA 9ICXA 8ICSA 3HIYA 1BPDA 4I27A 4O9MA 1ZJNA 4Z6CA 5J2GA 4WC5A 1ZQMA 4KLSA 8ICHA 3L9DA 1BPZA 1ZQQA 5DB9A 4FHXA 7ICLA 4F5NA 3AUOA 1BPBA 4XQ7A 8ICKA 4FH3A 1RZTA 4X4PA 5J2CA 4M0AA 4IQTA 2M2WA 4QZGA 3HWTA 4AT7B 4UAWA 2ISOA 9ICAA 4S3NA 8ICPA 4E7XA 3AQNA 4NM1A 7ICEA 4PHEA 3C5FA 2I9GA 3JPQA 3LQCB 1ZQHA 3OVBA 3GDXA 7ICHA 1NO5A 4XA5A 4PHDA 3V7KA 1ZQSA 4QZDA 4Z6EA 4DOBA 3C18A 2M2TA 4IQVA 3JPNA 1HUZA 4QZEA 4WC2A 2W9MA 5CWRA 7ICPA 2ZH2A 7ICJA 1V4AA 4ATBB 4I2JA 2M2UA 1ZQLA 9ICKA 4XUSA 3HJ1A 4E8FA 1YLQA 2BCVA 4RQ8A 5J0WA 5HRHA 8ICOA 1UETA 5CJ7A 4X4VA 5HRLA 9ICOA 4RT2A 1XSPA 4RWQA 4KLOA 4R66A 2DVIA 4P4OA 3NYBA 3MDAA 8ICWA 5DDMA 4NLNA 4TUPA 5DECA 4RQ5A 4LZGA 4M5DA 5IIOA 5HRBA 4RWNA 1ZQXA 3UPQA 2FMPA 1ZQNA 5DBBA 4KLJA 4GXKA 4QZIA 2M2VA 3B0YA 4X4TA 4LT6A 1NOMA 9ICIA 4M9NA 9ICNA 4O5EA 1ZQIA 3WFQE 4UD5A 2BPCA 3OUYB 4F5RA 4IQUA 7ICKA 3RJKA 4KLGA 4JWMA 2VANA 3WFOA 4UBCA 3PMLA 2PFOA 7ICSA 4NY8A 3H38A 3JZ0A 3MBYA 1ZJMA 4KLUA 8ICQA 5D46A 1WOTA 2DR7A 7ICQA 1TFYA 5DB8A 1UEUA 1MIWA 4PGXA 3K75D 4I2CA 4E80A 1KEJA 4I2HA 1ZQVA 4R65A 3WFPA 4RPZA 1XSLA 5J0OA 4NKTA 2ZH1A 4PHAA 5J2KA 2ISPA 5IIMA 4DO9A 4I2GA 8ICZA 3UPSA 2BE3A 5J0UA 1ZQTA 3AU6A 1MQ2A 1ZQDA 4M04A 3PMNA 4X4UA 5J0RA 3MDCA 1JAJA 4RQ1A 4O5KA 1ZQYA 5HRFA 5J0TA 4M9HA 3HX0A 4X4NA 1ZQPA 5BPCA 1R8AA 4R64A 4AT7A 5J0XA 7ICFA 2RFFA 7ICOA 3HJ4A 3AQMA 4FH5A 4P2HA 5CR0A 5HRKA 4YMOA 5CB1A 4UB5A 4WBZA 5HRIA 1Q78A 4X4SA 4FHYA 4WCWA 8ICRA 5DEDA 4EBKA 9ICGA 3ISBA 4FHWA 2PBEA 4I2IA 5IILA 5J2DA 2BCUA 4X0BA 2ZH3A 3WFRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT8 B;  1ZQF A;  4KLE A;  5BOL A;  3MGI A;  2BCQ A;  5J2A A;  1JMS A;  1ZQO A;  4ATB A;  4IG8 A;  8ICB A;  4X5V A;  8ICV A;  5J2H A;  5J0Q A;  4WC1 A;  3RH5 A;  7ICR A;  9ICF A;  4WC6 A;  7ICU A;  4RPX A;  5DB6 A;  8ICA A;  7ICI A;  1RPL A;  4I29 A;  3H39 A;  1ZQU A;  1TFW A;  9ICL A;  7ICG A;  3MGH A;  3V7J A;  3UQ0 A;  4WC7 A;  9ICJ A;  9ICT A;  4JWN A;  2GWS A;  4NLZ A;  1ZQB A;  4NXZ A;  8ICU A;  5HC9 A;  8ICT A;  5J2I A;  1ZQG A;  4MF2 A;  1UEV A;  8ICM A;  1PX5 A;  2ZH5 A;  2HHP A;  4KLF A;  4UB1 A;  3ISC A;  4NKU A;  2DRA A;  4GXI A;  4KLT A;  1ZQC A;  4Z6D A;  4RQ0 A;  3LK9 A;  5III A;  4UB3 A;  3OUY A;  3TFS A;  8ICI A;  5DBC A;  3JPP A;  4TUS A;  5F2V O;  4QZH A;  2FMQ A;  5CA7 A;  8ICG A;  1VFG A;  3JYY A;  3H37 A;  1R8C A;  2IHM A;  5IIK A;  4F5P A;  4PGQ A;  4I2E A;  8ICE A;  2DRB A;  4KLQ A;  4EP7 A;  1F5A A;  4PPX A;  4I2B A;  4RQ4 A;  2BCS A;  4K4G A;  1KDH A;  3C5G A;  3RJI A;  5HRD A;  4X4Q A;  4GXJ A;  3AU2 A;  1OU5 A;  3UXO A;  4PGY A;  2ID1 A;  5CHG A;  3RH6 A;  3RJF A;  4I2A A;  4M9G A;  4YMN A;  2DR9 A;  1HUO A;  5J2J A;  4FHV A;  4YD1 A;  2DR5 A;  1BPX A;  3JPT A;  1TV9 A;  4WBY A;  4F5O A;  9ICH A;  1ZQE A;  1BPY A;  2O1P A;  5EOZ A;  5DKW A;  5J2F A;  4YCX A;  3H3A A;  8ICN A;  1ZQA A;  5HHH A;  4FO6 A;  4AT9 B;  8ICL A;  4AT9 A;  5HR9 A;  1MIY A;  4MF8 A;  4F5Q A;  7ICN A;  5J0S A;  5J0Y A;  4IQW A;  3OVS A;  5DB7 A;  4UD4 A;  4DOA A;  5DBA A;  2ZH7 A;  4QZ8 A;  1ZQJ A;  1VJ7 A;  4I2D A;  2BPG A;  4WC4 A;  9ICQ A;  9ICM A;  7ICM A;  5BOM A;  4KLM A;  3AQL A;  3JPS A;  2O5A A;  4I2F A;  3OVA A;  5HHI A;  3UXP A;  4TUR A;  4R63 A;  4O5C A;  2ZH8 A;  3V72 A;  4UAY A;  8ICY A;  3TFR A;  4RQ6 A;  9ICV A;  4AT8 A;  4RQ2 A;  4KLL A;  2ZH6 A;  2FMS A;  4RWP A;  4WC3 A;  9ICB A;  2ZHB A;  4LVS A;  2DR8 A;  3C2L A;  2BCR A;  5TZV A;  1ZQW A;  9ICR A;  4X4R A;  9ICS A;  2PFP A;  4P4M A;  5HRE A;  5IIJ A;  1ZQK A;  7ICV A;  4RT3 A;  5IIN A;  2PFN A;  5D49 A;  1JQR A;  4YD2 A;  4TUQ A;  4QZ9 A;  3RJG A;  8ICF A;  2ZHA A;  1BPE A;  2NRK A;  5CP2 A;  4UB4 A;  4KLI A;  9ICC A;  4EBJ A;  8ICC A;  1JN3 A;  3RJE A;  2BPF A;  3B0X A;  1MQ3 A;  1KNY A;  4M2Y A;  4X4O A;  3UQ2 A;  4QZC A;  4M47 A;  4UB2 A;  4QZA A;  3OGU A;  3RJH A;  4X0A A;  4RQ3 A;  4DOC A;  4WC0 A;  2PFQ A;  9ICW A;  4MFA A;  3C2M A;  4MFC A;  4MFF A;  1MIV A;  3JPO A;  4XRH A;  5J2B A;  3JPR A;  4Z6F A;  5HRG A;  9ICP A;  4PHP A;  3OV7 A;  3RJJ A;  5D4B A;  4YMM A;  3V7L A;  4RPY A;  4UAZ A;  9ICE A;  1TVA A;  4M9J A;  1ZQZ A;  1FA0 A;  4NM2 A;  4KLD A;  3WFS C;  2Q66 A;  2ZH9 A;  1Q79 A;  3HW8 A;  3C2K A;  3RH4 A;  3AQK A;  3C66 A;  5J29 A;  5J0P A;  1ZQR A;  4UBB A;  9ICU A;  4PH5 A;  4QZF A;  8ICJ A;  5DDY A;  4K4H A;  4KLH A;  7ICT A;  4FHP A;  5J2E A;  2P66 A;  4XQ8 A;  2ZH4 A;  4RWO A;  8ICX A;  1XSN A;  1R89 A;  1R8B A;  4YN4 A;  3PNC A;  2PXI A;  3ISD A;  4QZB A;  4P4P A;  4RQ7 A;  3UXN A;  4K4I A;  4M9L A;  4LZD A;  4I28 A;  4NLK A;  9ICX A;  8ICS A;  3HIY A;  1BPD A;  4I27 A;  4O9M A;  1ZJN A;  4Z6C A;  5J2G A;  4WC5 A;  1ZQM A;  4KLS A;  8ICH A;  3L9D A;  1BPZ A;  1ZQQ A;  5DB9 A;  4FHX A;  7ICL A;  4F5N A;  3AUO A;  1BPB A;  4XQ7 A;  8ICK A;  4FH3 A;  1RZT A;  4X4P A;  5J2C A;  4M0A A;  4IQT A;  2M2W A;  4QZG A;  3HWT A;  4AT7 B;  4UAW A;  2ISO A;  9ICA A;  4S3N A;  8ICP A;  4E7X A;  3AQN A;  4NM1 A;  7ICE A;  4PHE A;  3C5F A;  2I9G A;  3JPQ A;  3LQC B;  1ZQH A;  3OVB A;  3GDX A;  7ICH A;  1NO5 A;  4XA5 A;  4PHD A;  3V7K A;  1ZQS A;  4QZD A;  4Z6E A;  4DOB A;  3C18 A;  2M2T A;  4IQV A;  3JPN A;  1HUZ A;  4QZE A;  4WC2 A;  2W9M A;  5CWR A;  7ICP A;  2ZH2 A;  7ICJ A;  1V4A A;  4ATB B;  4I2J A;  2M2U A;  1ZQL A;  9ICK A;  4XUS A;  3HJ1 A;  4E8F A;  1YLQ A;  2BCV A;  4RQ8 A;  5J0W A;  5HRH A;  8ICO A;  1UET A;  5CJ7 A;  4X4V A;  5HRL A;  9ICO A;  4RT2 A;  1XSP A;  4RWQ A;  4KLO A;  4R66 A;  2DVI A;  4P4O A;  3NYB A;  3MDA A;  8ICW A;  5DDM A;  4NLN A;  4TUP A;  5DEC A;  4RQ5 A;  4LZG A;  4M5D A;  5IIO A;  5HRB A;  4RWN A;  1ZQX A;  3UPQ A;  2FMP A;  1ZQN A;  5DBB A;  4KLJ A;  4GXK A;  4QZI A;  2M2V A;  3B0Y A;  4X4T A;  4LT6 A;  1NOM A;  9ICI A;  4M9N A;  9ICN A;  4O5E A;  1ZQI A;  3WFQ E;  4UD5 A;  2BPC A;  3OUY B;  4F5R A;  4IQU A;  7ICK A;  3RJK A;  4KLG A;  4JWM A;  2VAN A;  3WFO A;  4UBC A;  3PML A;  2PFO A;  7ICS A;  4NY8 A;  3H38 A;  3JZ0 A;  3MBY A;  1ZJM A;  4KLU A;  8ICQ A;  5D46 A;  1WOT A;  2DR7 A;  7ICQ A;  1TFY A;  5DB8 A;  1UEU A;  1MIW A;  4PGX A;  3K75 D;  4I2C A;  4E80 A;  1KEJ A;  4I2H A;  1ZQV A;  4R65 A;  3WFP A;  4RPZ A;  1XSL A;  5J0O A;  4NKT A;  2ZH1 A;  4PHA A;  5J2K A;  2ISP A;  5IIM A;  4DO9 A;  4I2G A;  8ICZ A;  3UPS A;  2BE3 A;  5J0U A;  1ZQT A;  3AU6 A;  1MQ2 A;  1ZQD A;  4M04 A;  3PMN A;  4X4U A;  5J0R A;  3MDC A;  1JAJ A;  4RQ1 A;  4O5K A;  1ZQY A;  5HRF A;  5J0T A;  4M9H A;  3HX0 A;  4X4N A;  1ZQP A;  5BPC A;  1R8A A;  4R64 A;  4AT7 A;  5J0X A;  7ICF A;  2RFF A;  7ICO A;  3HJ4 A;  3AQM A;  4FH5 A;  4P2H A;  5CR0 A;  5HRK A;  4YMO A;  5CB1 A;  4UB5 A;  4WBZ A;  5HRI A;  1Q78 A;  4X4S A;  4FHY A;  4WCW A;  8ICR A;  5DED A;  4EBK A;  9ICG A;  3ISB A;  4FHW A;  2PBE A;  4I2I A;  5IIL A;  5J2D A;  2BCU A;  4X0B A;  2ZH3 A;  3WFR E; 
#chains in the Genus database with same CATH topology
 4AT8 B;  1ZQF A;  4KLE A;  5BOL A;  3MGI A;  2BCQ A;  5J2A A;  1JMS A;  1ZQO A;  4ATB A;  4K99 A;  4IG8 A;  8ICB A;  4X5V A;  8ICV A;  5J2H A;  5J0Q A;  4WC1 A;  3RH5 A;  7ICR A;  9ICF A;  4WC6 A;  7ICU A;  4RPX A;  5DB6 A;  8ICA A;  7ICI A;  1RPL A;  4I29 A;  3H39 A;  1ZQU A;  1TFW A;  9ICL A;  7ICG A;  3MGH A;  3V7J A;  3UQ0 A;  4WC7 A;  9ICJ A;  9ICT A;  4O67 A;  4JWN A;  2GWS A;  4HX0 A;  4NLZ A;  1ZQB A;  4NXZ A;  8ICU A;  5HC9 A;  8ICT A;  5J2I A;  1ZQG A;  4MF2 A;  1UEV A;  8ICM A;  1PX5 A;  2ZH5 A;  2HHP A;  3K7D A;  4KLF A;  4UB1 A;  3ISC A;  4NKU A;  2DRA A;  4GXI A;  4KLT A;  1ZQC A;  4OAF A;  4Z6D A;  4RQ0 A;  3LK9 A;  5JTG A;  5III A;  4UB3 A;  3OUY A;  3TFS A;  8ICI A;  5DBC A;  3JPP A;  4TUS A;  5F2V O;  4QZH A;  2FMQ A;  5CA7 A;  4K97 A;  8ICG A;  3ER9 B;  1VFG A;  3JYY A;  3H37 A;  1R8C A;  2IHM A;  4JLZ A;  5IIK A;  4F5P A;  4PGQ A;  4I2E A;  8ICE A;  2DRB A;  4KLQ A;  4EP7 A;  1F5A A;  4PPX A;  4I2B A;  4RQ4 A;  2BCS A;  4K4G A;  1KDH A;  3C5G A;  3RJI A;  5HRD A;  2HN1 A;  4X4Q A;  4GXJ A;  3AU2 A;  1OU5 A;  3UXO A;  4PGY A;  2ID1 A;  5CHG A;  3RH6 A;  5CFT A;  3RJF A;  4I2A A;  4M9G A;  4YMN A;  2DR9 A;  4O69 A;  1HUO A;  5J2J A;  4FHV A;  4YD1 A;  2DR5 A;  1BPX A;  3JPT A;  3PHZ A;  1TV9 A;  4WBY A;  4F5O A;  9ICH A;  4LEZ A;  1ZQE A;  1BPY A;  2O1P A;  5EOZ A;  5DKW A;  1GPJ A;  5J2F A;  4YCX A;  3H3A A;  5CHE A;  8ICN A;  1ZQA A;  5D63 A;  5HHH A;  4FO6 A;  2B4V A;  4AT9 B;  8ICL A;  4AT9 A;  5HR9 A;  1MIY A;  4MF8 A;  4F5Q A;  7ICN A;  5J0S A;  5J0Y A;  4IQW A;  3OVS A;  5DB7 A;  4UD4 A;  4DOA A;  5DBA A;  2ZH7 A;  4QZ8 A;  1ZQJ A;  1VJ7 A;  4I2D A;  2BPG A;  4WC4 A;  4WH5 A;  9ICQ A;  9ICM A;  4NXV A;  7ICM A;  5BOM A;  4KLM A;  3AQL A;  3JPS A;  2O5A A;  4I2F A;  3OVA A;  5HHI A;  5CFS A;  3UXP A;  4TUR A;  4NXT A;  4R63 A;  4O5C A;  4OAH A;  2ZH8 A;  3V72 A;  4UAY A;  8ICY A;  3EF2 A;  3TFR A;  4RQ6 A;  9ICV A;  4AT8 A;  4RQ2 A;  4KLL A;  2ZH6 A;  2FMS A;  4RWP A;  4WC3 A;  4OAI Z;  9ICB A;  2ZHB A;  4LVS A;  3OWG A;  2DR8 A;  3C2L A;  2BCR A;  4EGW A;  5TZV A;  1ZQW A;  9ICR A;  4X4R A;  9ICS A;  2PFP A;  4P4M A;  5HRE A;  5IIJ A;  1ZQK A;  7ICV A;  4RT3 A;  5IIN A;  2PFN A;  5D49 A;  1JQR A;  4YD2 A;  4TUQ A;  4QZ9 A;  3RJG A;  8ICF A;  2ZHA A;  1BPE A;  2NRK A;  5CP2 A;  4UB4 A;  4KLI A;  9ICC A;  4NXU A;  4EBJ A;  1JN3 A;  3RJE A;  8ICC A;  2BPF A;  4K96 A;  3B0X A;  1MQ3 A;  1KNY A;  4NXX A;  4M2Y A;  4X4O A;  3UQ2 A;  4QZC A;  4M47 A;  4EV6 A;  4UB2 A;  4QZA A;  3OGU A;  3RJH A;  4X0A A;  4RQ3 A;  4DOC A;  4WC0 A;  2PFQ A;  9ICW A;  4MFA A;  3C2M A;  4MFC A;  4O68 A;  4MFF A;  2BBJ A;  1MIV A;  3JPO A;  4XRH A;  5J2B A;  3JPR A;  4Z6F A;  5HRG A;  4K9A A;  9ICP A;  4PHP A;  3OV7 A;  3RJJ A;  3JCF A;  5D4B A;  4YMM A;  3V7L A;  4RPY A;  4UAZ A;  4OAG A;  9ICE A;  1TVA A;  4M9J A;  1ZQZ A;  1FA0 A;  4NM2 A;  4KLD A;  3WFS C;  2Q66 A;  2ZH9 A;  1Q79 A;  3HW8 A;  3C2K A;  3RH4 A;  3AQK A;  3C66 A;  5J29 A;  5D61 A;  5J0P A;  1ZQR A;  4UBB A;  4XJE A;  5B3P A;  9ICU A;  4PH5 A;  4QZF A;  8ICJ A;  5DDY A;  4K4H A;  4KLH A;  5B3Q A;  7ICT A;  4FHP A;  4N7R A;  5J2E A;  4WQL A;  2P66 A;  4XQ8 A;  2ZH4 A;  4RWO A;  8ICX A;  1XSN A;  1R89 A;  1R8B A;  4YN4 A;  3PNC A;  2PXI A;  3ISD A;  4QZB A;  4P4P A;  4RQ7 A;  3UXN A;  4K4I A;  4M9L A;  4LZD A;  4I28 A;  4NLK A;  4I0U A;  9ICX A;  8ICS A;  4KM5 A;  2BBH A;  3HIY A;  4MKP A;  1BPD A;  4I27 A;  4O9M A;  1ZJN A;  4Z6C A;  5J2G A;  4WC5 A;  1ZQM A;  4KLS A;  8ICH A;  3L9D A;  1BPZ A;  1ZQQ A;  5DB9 A;  4FHX A;  7ICL A;  4F5N A;  3AUO A;  1BPB A;  4XQ7 A;  8ICK A;  4FH3 A;  1RZT A;  4X4P A;  5J2C A;  4M0A A;  4IQT A;  2M2W A;  4QZG A;  3HWT A;  4AT7 B;  4UAW A;  2ISO A;  3CK6 A;  9ICA A;  4S3N A;  8ICP A;  4E7X A;  3AQN A;  4NM1 A;  7ICE A;  4PHE A;  2HN2 A;  3NWI A;  3C5F A;  4LEY A;  2I9G A;  2B56 A;  3JPQ A;  3LQC B;  1ZQH A;  3OVB A;  5D62 A;  3GDX A;  7ICH A;  1NO5 A;  4XA5 A;  4PHD A;  3V7K A;  1ZQS A;  4QZD A;  4Z6E A;  2B51 A;  4DOB A;  3C18 A;  2M2T A;  4IQV A;  3JPN A;  1HUZ A;  4QZE A;  4WC2 A;  2W9M A;  3ER8 C;  5CWR A;  7ICP A;  2ZH2 A;  7ICJ A;  1V4A A;  4ATB B;  4I2J A;  5CFU A;  2M2U A;  1ZQL A;  9ICK A;  4XUS A;  3HJ1 A;  4E8F A;  1YLQ A;  2BCV A;  4RQ8 A;  5J0W A;  5HRH A;  8ICO A;  1UET A;  5CJ7 A;  4X4V A;  5HRL A;  9ICO A;  4RT2 A;  1XSP A;  4RWQ A;  4KLO A;  4R66 A;  2DVI A;  4P4O A;  3NYB A;  3MDA A;  4EEB A;  8ICW A;  5DDM A;  4NLN A;  4TUP A;  4NXW A;  5DEC A;  4RQ5 A;  4LZG A;  4M5D A;  5IIO A;  5HRB A;  4RWN A;  1ZQX A;  4FO1 A;  3UPQ A;  2FMP A;  1ZQN A;  5DBB A;  4KLJ A;  4GXK A;  2EWR A;  4QZI A;  2M2V A;  2FCL A;  3B0Y A;  3NKU A;  4LT6 A;  1NOM A;  3NVO A;  4X4T A;  9ICI A;  4M9N A;  9ICN A;  4LEV A;  4O5E A;  1ZQI A;  3WFQ E;  4UD5 A;  2BPC A;  3OUY B;  4F5R A;  4IQU A;  7ICK A;  3RJK A;  4KLG A;  3MCR A;  4JWM A;  2VAN A;  3WFO A;  4UBC A;  4O6A A;  3PML A;  2PFO A;  7ICS A;  4NY8 A;  3H38 A;  3JZ0 A;  3MBY A;  1ZJM A;  4KLU A;  8ICQ A;  5D46 A;  1WOT A;  2DR7 A;  7ICQ A;  1TFY A;  5DB8 A;  1UEU A;  1MIW A;  4PGX A;  3K75 D;  4I2C A;  4E80 A;  1KEJ A;  4I2H A;  2GA9 D;  1ZQV A;  4R65 A;  3WFP A;  4RPZ A;  1XSL A;  5J0O A;  4NKT A;  2ZH1 A;  4PHA A;  5J2K A;  4JLX A;  2ISP A;  5IIM A;  4DO9 A;  4I2G A;  8ICZ A;  3UPS A;  2BE3 A;  4WOY A;  5J0U A;  1ZQT A;  3AU6 A;  1MQ2 A;  1ZQD A;  4M04 A;  3PMN A;  4X4U A;  5J0R A;  2GAF D;  4LEW A;  3ERC C;  3MDC A;  2IUB A;  1JAJ A;  4RQ1 A;  4O5K A;  1ZQY A;  5HRF A;  5J0T A;  4M9H A;  3HX0 A;  4X4N A;  4K9B A;  4EED A;  1ZQP A;  5BPC A;  4KB6 A;  1R8A A;  4R64 A;  4AT7 A;  5J0X A;  7ICF A;  2RFF A;  7ICO A;  3HJ4 A;  3AQM A;  4FH5 A;  4P2H A;  4K8V A;  5CR0 A;  5HRK A;  4YMO A;  4K98 A;  5CB1 A;  4UB5 A;  4WBZ A;  5HRI A;  1Q78 A;  4X4S A;  4FHY A;  4WCW A;  2IHO A;  8ICR A;  5DED A;  4EBK A;  9ICG A;  3ISB A;  4FHW A;  4WQK A;  2PBE A;  4I2I A;  5IIL A;  5J2D A;  2BCU A;  4X0B A;  2ZH3 A;  3WFR E; 
#chains in the Genus database with same CATH homology
 4AT8 B;  1ZQF A;  4KLE A;  5BOL A;  3MGI A;  2BCQ A;  5J2A A;  1JMS A;  1ZQO A;  4ATB A;  4IG8 A;  8ICB A;  4X5V A;  8ICV A;  5J2H A;  5J0Q A;  4WC1 A;  3RH5 A;  7ICR A;  9ICF A;  4WC6 A;  7ICU A;  4RPX A;  5DB6 A;  8ICA A;  7ICI A;  1RPL A;  4I29 A;  3H39 A;  1ZQU A;  1TFW A;  9ICL A;  7ICG A;  3MGH A;  3V7J A;  3UQ0 A;  4WC7 A;  9ICJ A;  9ICT A;  4JWN A;  2GWS A;  4NLZ A;  1ZQB A;  4NXZ A;  8ICU A;  5HC9 A;  8ICT A;  5J2I A;  1ZQG A;  4MF2 A;  1UEV A;  8ICM A;  1PX5 A;  2ZH5 A;  2HHP A;  4KLF A;  4UB1 A;  3ISC A;  4NKU A;  2DRA A;  4GXI A;  4KLT A;  1ZQC A;  4Z6D A;  4RQ0 A;  3LK9 A;  5III A;  4UB3 A;  3OUY A;  3TFS A;  8ICI A;  5DBC A;  3JPP A;  4TUS A;  5F2V O;  4QZH A;  2FMQ A;  5CA7 A;  8ICG A;  1VFG A;  3JYY A;  3H37 A;  1R8C A;  2IHM A;  5IIK A;  4F5P A;  4PGQ A;  4I2E A;  8ICE A;  2DRB A;  4KLQ A;  4EP7 A;  1F5A A;  4PPX A;  4I2B A;  4RQ4 A;  2BCS A;  4K4G A;  1KDH A;  3C5G A;  3RJI A;  5HRD A;  4X4Q A;  4GXJ A;  3AU2 A;  1OU5 A;  3UXO A;  4PGY A;  2ID1 A;  5CHG A;  3RH6 A;  3RJF A;  4I2A A;  4M9G A;  4YMN A;  2DR9 A;  1HUO A;  5J2J A;  4FHV A;  4YD1 A;  2DR5 A;  1BPX A;  3JPT A;  1TV9 A;  4WBY A;  4F5O A;  9ICH A;  1ZQE A;  1BPY A;  2O1P A;  5EOZ A;  5DKW A;  5J2F A;  4YCX A;  3H3A A;  8ICN A;  1ZQA A;  5HHH A;  4FO6 A;  4AT9 B;  8ICL A;  4AT9 A;  5HR9 A;  1MIY A;  4MF8 A;  4F5Q A;  7ICN A;  5J0S A;  5J0Y A;  4IQW A;  3OVS A;  5DB7 A;  4UD4 A;  4DOA A;  5DBA A;  2ZH7 A;  4QZ8 A;  1ZQJ A;  1VJ7 A;  4I2D A;  2BPG A;  4WC4 A;  9ICQ A;  9ICM A;  7ICM A;  5BOM A;  4KLM A;  3AQL A;  3JPS A;  2O5A A;  4I2F A;  3OVA A;  5HHI A;  3UXP A;  4TUR A;  4R63 A;  4O5C A;  2ZH8 A;  3V72 A;  4UAY A;  8ICY A;  3TFR A;  4RQ6 A;  9ICV A;  4AT8 A;  4RQ2 A;  4KLL A;  2ZH6 A;  2FMS A;  4RWP A;  4WC3 A;  9ICB A;  2ZHB A;  4LVS A;  2DR8 A;  3C2L A;  2BCR A;  5TZV A;  1ZQW A;  9ICR A;  4X4R A;  9ICS A;  2PFP A;  4P4M A;  5HRE A;  5IIJ A;  1ZQK A;  7ICV A;  4RT3 A;  5IIN A;  2PFN A;  5D49 A;  1JQR A;  4YD2 A;  4TUQ A;  4QZ9 A;  3RJG A;  8ICF A;  2ZHA A;  1BPE A;  2NRK A;  5CP2 A;  4UB4 A;  4KLI A;  9ICC A;  4EBJ A;  8ICC A;  1JN3 A;  3RJE A;  2BPF A;  3B0X A;  1MQ3 A;  1KNY A;  4M2Y A;  4X4O A;  3UQ2 A;  4QZC A;  4M47 A;  4UB2 A;  4QZA A;  3OGU A;  3RJH A;  4X0A A;  4RQ3 A;  4DOC A;  4WC0 A;  2PFQ A;  9ICW A;  4MFA A;  3C2M A;  4MFC A;  4MFF A;  1MIV A;  3JPO A;  4XRH A;  5J2B A;  3JPR A;  4Z6F A;  5HRG A;  9ICP A;  4PHP A;  3OV7 A;  3RJJ A;  5D4B A;  4YMM A;  3V7L A;  4RPY A;  4UAZ A;  9ICE A;  1TVA A;  4M9J A;  1ZQZ A;  1FA0 A;  4NM2 A;  4KLD A;  3WFS C;  2Q66 A;  2ZH9 A;  1Q79 A;  3HW8 A;  3C2K A;  3RH4 A;  3AQK A;  3C66 A;  5J29 A;  5J0P A;  1ZQR A;  4UBB A;  9ICU A;  4PH5 A;  4QZF A;  8ICJ A;  5DDY A;  4K4H A;  4KLH A;  7ICT A;  4FHP A;  5J2E A;  2P66 A;  4XQ8 A;  2ZH4 A;  4RWO A;  8ICX A;  1XSN A;  1R89 A;  1R8B A;  4YN4 A;  3PNC A;  2PXI A;  3ISD A;  4QZB A;  4P4P A;  4RQ7 A;  3UXN A;  4K4I A;  4M9L A;  4LZD A;  4I28 A;  4NLK A;  9ICX A;  8ICS A;  3HIY A;  1BPD A;  4I27 A;  4O9M A;  1ZJN A;  4Z6C A;  5J2G A;  4WC5 A;  1ZQM A;  4KLS A;  8ICH A;  3L9D A;  1BPZ A;  1ZQQ A;  5DB9 A;  4FHX A;  7ICL A;  4F5N A;  3AUO A;  1BPB A;  4XQ7 A;  8ICK A;  4FH3 A;  1RZT A;  4X4P A;  5J2C A;  4M0A A;  4IQT A;  2M2W A;  4QZG A;  3HWT A;  4AT7 B;  4UAW A;  2ISO A;  9ICA A;  4S3N A;  8ICP A;  4E7X A;  3AQN A;  4NM1 A;  7ICE A;  4PHE A;  3C5F A;  2I9G A;  3JPQ A;  3LQC B;  1ZQH A;  3OVB A;  3GDX A;  7ICH A;  1NO5 A;  4XA5 A;  4PHD A;  3V7K A;  1ZQS A;  4QZD A;  4Z6E A;  4DOB A;  3C18 A;  2M2T A;  4IQV A;  3JPN A;  1HUZ A;  4QZE A;  4WC2 A;  2W9M A;  5CWR A;  7ICP A;  2ZH2 A;  7ICJ A;  1V4A A;  4ATB B;  4I2J A;  2M2U A;  1ZQL A;  9ICK A;  4XUS A;  3HJ1 A;  4E8F A;  1YLQ A;  2BCV A;  4RQ8 A;  5J0W A;  5HRH A;  8ICO A;  1UET A;  5CJ7 A;  4X4V A;  5HRL A;  9ICO A;  4RT2 A;  1XSP A;  4RWQ A;  4KLO A;  4R66 A;  2DVI A;  4P4O A;  3NYB A;  3MDA A;  8ICW A;  5DDM A;  4NLN A;  4TUP A;  5DEC A;  4RQ5 A;  4LZG A;  4M5D A;  5IIO A;  5HRB A;  4RWN A;  1ZQX A;  3UPQ A;  2FMP A;  1ZQN A;  5DBB A;  4KLJ A;  4GXK A;  4QZI A;  2M2V A;  3B0Y A;  4X4T A;  4LT6 A;  1NOM A;  9ICI A;  4M9N A;  9ICN A;  4O5E A;  1ZQI A;  3WFQ E;  4UD5 A;  2BPC A;  3OUY B;  4F5R A;  4IQU A;  7ICK A;  3RJK A;  4KLG A;  4JWM A;  2VAN A;  3WFO A;  4UBC A;  3PML A;  2PFO A;  7ICS A;  4NY8 A;  3H38 A;  3JZ0 A;  3MBY A;  1ZJM A;  4KLU A;  8ICQ A;  5D46 A;  1WOT A;  2DR7 A;  7ICQ A;  1TFY A;  5DB8 A;  1UEU A;  1MIW A;  4PGX A;  3K75 D;  4I2C A;  4E80 A;  1KEJ A;  4I2H A;  1ZQV A;  4R65 A;  3WFP A;  4RPZ A;  1XSL A;  5J0O A;  4NKT A;  2ZH1 A;  4PHA A;  5J2K A;  2ISP A;  5IIM A;  4DO9 A;  4I2G A;  8ICZ A;  3UPS A;  2BE3 A;  5J0U A;  1ZQT A;  3AU6 A;  1MQ2 A;  1ZQD A;  4M04 A;  3PMN A;  4X4U A;  5J0R A;  3MDC A;  1JAJ A;  4RQ1 A;  4O5K A;  1ZQY A;  5HRF A;  5J0T A;  4M9H A;  3HX0 A;  4X4N A;  1ZQP A;  5BPC A;  1R8A A;  4R64 A;  4AT7 A;  5J0X A;  7ICF A;  2RFF A;  7ICO A;  3HJ4 A;  3AQM A;  4FH5 A;  4P2H A;  5CR0 A;  5HRK A;  4YMO A;  5CB1 A;  4UB5 A;  4WBZ A;  5HRI A;  1Q78 A;  4X4S A;  4FHY A;  4WCW A;  8ICR A;  5DED A;  4EBK A;  9ICG A;  3ISB A;  4FHW A;  2PBE A;  4I2I A;  5IIL A;  5J2D A;  2BCU A;  4X0B A;  2ZH3 A;  3WFR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...