4WC6A

Structure of trna-processing enzyme complex 4
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc6A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc6A01
5HRLA 4JWMA 4FO6A 7ICUA 5CHGA 2M2VA 4FHYA 5J0TA 4KLJA 5DB8A 2ZH4A 3H38A 5BOLA 1ZQNA 2BCVA 3UPQA 3C2MA 2VANA 9ICKA 7ICNA 1YLQA 5DECA 5DKWA 2M2UA 3MGHA 3UQ2A 3HX0A 2M2WA 4I2EA 1ZQQA 1ZQFA 1ZQHA 4JWNA 3UXOA 8ICMA 1JAJA 4PGXA 2FMQA 9ICQA 2FMSA 5J2FA 4QZIA 1ZQSA 1ZQCA 4TURA 3V7LA 4KLGA 9ICMA 3UXPA 3RJGA 3B0YA 4PGYA 4RWPA 3C5FA 8ICVA 1V4AA 5J2KA 4RQ7A 4NLNA 4UAWA 2ID1A 5HRIA 8ICHA 4M5DA 4MFAA 1ZQDA 9ICNA 5J0SA 4X4RA 4KLIA 4PH5A 3JPRA 4RT3A 1ZQMA 4DOCA 2I9GA 4WBZA 4I2JA 1ZJNA 2O1PA 4AT9A 3UPSA 8ICZA 5DB7A 5BOMA 4O5EA 4Z6FA 4K4HA 4YD1A 2PFPA 4M9GA 2Q66A 4LZDA 4RWOA 4IG8A 8ICSA 1ZQRA 3WFOA 1F5AA 3AQLA 4M9LA 4NKUA 3JYYA 4WC7A 8ICNA 3WFPA 1Q79A 4DOBA 4NKTA 2GWSA 1MIWA 4K4IA 5HRKA 3HIYA 4E8FA 4RPYA 1NO5A 2DR5A 2FMPA 4KLDA 5D49A 7ICMA 4PHDA 4R66A 9ICXA 1HUZA 2ZH1A 2PBEA 5J2IA 4MF8A 7ICSA 3UQ0A 3OGUA 9ICCA 1UEVA 5HR9A 4IQUA 4GXKA 1XSLA 4FHVA 4RWQA 4LZGA 2BCRA 4X0AA 4RWNA 5EOZA 3AQMA 9ICTA 4F5PA 4YCXA 1ZQAA 2ISPA 2BCSA 5IIJA 4KLEA 2ZH2A 5J0PA 4UB5A 3V7KA 1RZTA 2IHMA 5J0QA 4QZFA 5J2DA 8ICLA 2P66A 2BPFA 5IIMA 8ICOA 1UETA 4I2AA 3OUYA 4PHAA 2BE3A 2ZH5A 4WCWA 3B0XA 8ICCA 4KLTA 7ICPA 8ICQA 7ICGA 5J2AA 4ATBA 4AT7A 1ZQKA 1ZQZA 9ICIA 4RQ3A 1KEJA 4P4OA 5IILA 7ICRA 1BPDA 5J2HA 4XRHA 5HHHA 4R63A 5IIOA 7ICIA 3JPTA 4NY8A 4RQ4A 1ZQBA 5HRDA 4RQ8A 1JQRA 1XSPA 4RQ5A 3RJJA 8ICRA 2RFFA 1ZQVA 9ICJA 1MIYA 1ZQUA 3HJ4A 4YMMA 5J0OA 5J0YA 3RJFA 4K4GA 3C2LA 3RJIA 3TFRA 1ZQLA 4DOAA 4FH3A 8ICKA 7ICLA 4KLUA 4AT9B 2M2TA 3C18A 5J0UA 8ICYA 5D4BA 4Z6CA 4QZGA 4PHEA 3OV7A 4I2IA 4QZ8A 3AU2A 1MQ3A 1ZQJA 2PFNA 4FHWA 1ZQGA 1BPZA 4UB2A 3L9DA 8ICFA 4QZBA 4R65A 5DDYA 3RJEA 4NM1A 5HRBA 4LT6A 3UXNA 3RH4A 3AU6A 4KLSA 4MFCA 4EBKA 4KLLA 3MGIA 5DDMA 2DRAA 1ZQEA 4PGQA 4F5NA 4XA5A 4IQTA 4M04A 4WC1A 4M9NA 9ICRA 5HRHA 1R8CA 3OVAA 9ICLA 1KNYA 4UB1A 2DR9A 9ICUA 5DEDA 1ZQWA 5BPCA 4RPZA 4O5CA 4I2DA 4WBYA 3RH6A 4WC3A 3K75D 5HHIA 9ICHA 3H39A 4O9MA 3LQCB 3OUYB 5HRFA 4NXZA 8ICAA 2ZH7A 5DBCA 9ICAA 4ATBB 4AT7B 7ICHA 1BPXA 4QZAA 7ICEA 4UBCA 4QZCA 1ZQYA 4X4OA 4X4VA 8ICEA 8ICGA 1ZQPA 4I28A 5J2BA 1ZQXA 1XSNA 3C66A 4X4QA 2ZH9A 4I2CA 4F5OA 1BPBA 5J2CA 4UAZA 3AUOA 4WC4A 4TUPA 4RPXA 4I2HA 2ZHBA 1HUOA 4YMOA 4UBBA 1ZQIA 3HJ1A 4GXJA 4UAYA 1R8BA 3JPPA 1OU5A 9ICSA 5DBBA 4TUSA 3JPNA 4XQ8A 1PX5A 3ISBA 3PMNA 3WFRE 5J0WA 2O5AA 3NYBA 3C2KA 4NLKA 2BCQA 4P4MA 3OVSA 9ICWA 4M9JA 2DR8A 5DB9A 7ICOA 4KLQA 3TFSA 1BPEA 4IQWA 4I2GA 4P4PA 1VFGA 1UEUA 2BPCA 4M9HA 5J29A 4AT8A 3ISDA 3V7JA 4FHXA 8ICJA 4UB3A 3AQNA 1R89A 4RQ1A 4WC5A 3ISCA 1VJ7A 2PFOA 3HWTA 3GDXA 4M0AA 8ICIA 4QZHA 4YD2A 1BPYA 3OVBA 5CWRA 4FH5A 9ICFA 9ICVA 7ICKA 4MF2A 4KLHA 4PPXA 8ICXA 7ICVA 8ICUA 3JZ0A 4P2HA 4X4NA 3PMLA 3LK9A 4X4UA 5DBAA 7ICFA 1FA0A 4X4TA 8ICPA 4F5RA 4QZ9A 2ZHAA 5CP2A 4RQ2A 2DRBA 5J0RA 4GXIA 3WFSC 3H3AA 4Z6DA 4F5QA 4Z6EA 1TFWA 5CA7A 4M2YA 3PNCA 5F2VO 3JPOA 7ICQA 1NOMA 5CR0A 4KLFA 9ICGA 1Q78A 1TVAA 3HW8A 4RT2A 4I2FA 1ZQOA 4O5KA 7ICJA 1R8AA 1ZQTA 2DVIA 4X5VA 1JMSA 2ZH3A 3AQKA 2W9MA 5J2GA 3V72A 4KLMA 4E7XA 9ICOA 1MIVA 4WC6A 3JPQA 4UD4A 4X4PA 4YMNA 4M47A 9ICPA 4R64A 5HREA 4KLOA 5CJ7A 3RH5A 5CB1A 1JN3A 4TUQA 2ZH6A 3RJHA 4LVSA 3JPSA 5J0XA 2PXIA 2BCUA 7ICTA 4QZDA 1WOTA 8ICTA 8ICWA 4WC0A 2DR7A 4XUSA 4RQ6A 4YN4A 1MQ2A 9ICEA 9ICBA 1ZJMA 4I29A 2ZH8A 4I2BA 3C5GA 1TFYA 1RPLA 5J2JA 4NM2A 4IQVA 4X0BA 4QZEA 4FHPA 4RQ0A 2PFQA 4X4SA 2BPGA 5IIKA 3MDCA 3RJKA 4UB4A 3MBYA 5HC9A 5TZVA 4NLZA 5J2EA 4DO9A 4AT8B 5DB6A 3H37A 5IIIA 5IINA 4EBJA 2NRKA 4E80A 3MDAA 2HHPA 5HRGA 8ICBA 4EP7A 4I27A 4S3NA 4PHPA 5D46A 2ISOA 3WFQE 4MFFA 4XQ7A 4UD5A 4WC2A 1KDHA 1TV9A
chains in the Genus database with same CATH superfamily
5HRLA 4JWMA 5JTGA 4FO6A 2EWRA 7ICUA 5CHGA 2M2VA 5B3QA 4FHYA 5J0TA 4KLJA 5DB8A 2ZH4A 3H38A 5BOLA 4K9AA 1ZQNA 2BCVA 3UPQA 3C2MA 2VANA 4OAGA 4NXTA 9ICKA 7ICNA 1YLQA 5DECA 5DKWA 2M2UA 3MGHA 3UQ2A 4LEWA 3HX0A 2M2WA 4I2EA 1ZQQA 1ZQFA 1ZQHA 4JWNA 3UXOA 4NXXA 8ICMA 1JAJA 4PGXA 2FMQA 9ICQA 2FMSA 5J2FA 4O6AA 4QZIA 1ZQCA 1ZQSA 4TURA 3V7LA 4KLGA 9ICMA 3UXPA 3RJGA 3B0YA 4PGYA 4RWPA 3C5FA 8ICVA 1V4AA 5J2KA 4K98A 4RQ7A 4K96A 4NLNA 4UAWA 2ID1A 5HRIA 8ICHA 4M5DA 2GAFD 4MFAA 1ZQDA 9ICNA 5D63A 5J0SA 4X4RA 4KLIA 4PH5A 3JPRA 4OAHA 4JLXA 4RT3A 1ZQMA 2HN1A 4DOCA 2I9GA 4WBZA 4I2JA 1ZJNA 2O1PA 4JLZA 4AT9A 3UPSA 8ICZA 5BOMA 5DB7A 4O5EA 4Z6FA 4K4HA 4YD1A 2PFPA 4M9GA 2Q66A 4LZDA 4RWOA 4IG8A 8ICSA 1ZQRA 3WFOA 4NXVA 1F5AA 3AQLA 2GA9D 4M9LA 4NKUA 3JYYA 4WC7A 8ICNA 3WFPA 1Q79A 4DOBA 4NKTA 2GWSA 1MIWA 4K4IA 5HRKA 3HIYA 3NWIA 4E8FA 4O68A 4RPYA 1NO5A 2BBHA 2DR5A 2FMPA 5D49A 4KLDA 7ICMA 4PHDA 3ER9B 4R66A 9ICXA 1HUZA 2ZH1A 2PBEA 5J2IA 4MF8A 7ICSA 3UQ0A 3OGUA 2HN2A 9ICCA 1UEVA 4WQKA 5HR9A 4IQUA 4GXKA 1XSLA 4KB6A 4FHVA 4RWQA 4LZGA 2BCRA 4X0AA 4RWNA 5EOZA 3AQMA 9ICTA 4F5PA 4YCXA 1ZQAA 2ISPA 2BCSA 5IIJA 2B56A 4KLEA 2ZH2A 4LEVA 5J0PA 4UB5A 3V7KA 1RZTA 2IHMA 5J0QA 4QZFA 5J2DA 8ICLA 2P66A 4N7RA 5IIMA 2BPFA 8ICOA 1UETA 4I2AA 3NKUA 4PHAA 2BE3A 3OUYA 4NXWA 4WCWA 3B0XA 2ZH5A 8ICCA 4KLTA 7ICPA 8ICQA 7ICGA 5J2AA 4ATBA 4AT7A 1ZQKA 1ZQZA 9ICIA 4RQ3A 1KEJA 4P4OA 5IILA 7ICRA 1BPDA 5J2HA 4XRHA 5HHHA 4R63A 5IIOA 7ICIA 3JPTA 4NY8A 4RQ4A 1ZQBA 5HRDA 4RQ8A 1JQRA 1XSPA 4RQ5A 3RJJA 8ICRA 2RFFA 1ZQVA 9ICJA 1MIYA 4EEDA 1ZQUA 3HJ4A 4YMMA 5J0OA 5J0YA 3RJFA 4K4GA 3C2LA 3RJIA 3TFRA 1ZQLA 4DOAA 4FH3A 8ICKA 7ICLA 4KLUA 4AT9B 2M2TA 3C18A 5J0UA 8ICYA 5D4BA 4Z6CA 4QZGA 4PHEA 4I2IA 4QZ8A 3OV7A 3AU2A 1MQ3A 4WH5A 1ZQJA 2PFNA 4FHWA 1ZQGA 1BPZA 4UB2A 3L9DA 8ICFA 4QZBA 4R65A 1GPJA 5DDYA 3RJEA 4NM1A 5HRBA 4LT6A 3UXNA 4FO1A 3JCFA 3RH4A 3AU6A 4KLSA 4MFCA 4EBKA 4KLLA 3MGIA 5DDMA 2DRAA 1ZQEA 4PGQA 4F5NA 4XA5A 4IQTA 4M04A 4WC1A 4M9NA 9ICRA 5HRHA 1R8CA 4LEZA 3OVAA 9ICLA 4O69A 4LEYA 1KNYA 4UB1A 2DR9A 9ICUA 5DEDA 1ZQWA 5BPCA 4RPZA 4O5CA 4I2DA 2B51A 3ERCC 4K97A 4WBYA 3RH6A 4WC3A 3K75D 5HHIA 9ICHA 3H39A 4O9MA 3LQCB 3OUYB 5HRFA 3K7DA 4NXZA 8ICAA 2ZH7A 5DBCA 9ICAA 4ATBB 4AT7B 7ICHA 1BPXA 4QZAA 2FCLA 7ICEA 4UBCA 4QZCA 1ZQYA 4X4OA 4X4VA 8ICEA 8ICGA 1ZQPA 4I28A 5J2BA 1ZQXA 1XSNA 5CHEA 3C66A 4XJEA 4X4QA 2ZH9A 4I2CA 4F5OA 1BPBA 5J2CA 4UAZA 3AUOA 4WC4A 4TUPA 4RPXA 4I2HA 3ER8C 2ZHBA 1HUOA 4YMOA 4UBBA 4WQLA 1ZQIA 3HJ1A 3MCRA 4GXJA 4UAYA 1R8BA 3JPPA 1OU5A 9ICSA 5DBBA 4TUSA 3JPNA 4XQ8A 4HX0A 5CFSA 1PX5A 3ISBA 3PMNA 3WFRE 5J0WA 2O5AA 3NYBA 3C2KA 4NLKA 2BCQA 4P4MA 4OAIZ 3OVSA 9ICWA 4M9JA 2DR8A 5DB9A 7ICOA 4KLQA 3TFSA 1BPEA 5CFTA 4I2GA 4IQWA 4P4PA 1VFGA 1UEUA 2BPCA 4M9HA 5J29A 4AT8A 3ISDA 3V7JA 4FHXA 8ICJA 4UB3A 3AQNA 1R89A 5D62A 4EV6A 4RQ1A 4WOYA 4WC5A 3ISCA 1VJ7A 2PFOA 3HWTA 3GDXA 4M0AA 8ICIA 4QZHA 4YD2A 1BPYA 3OVBA 5CWRA 4FH5A 9ICFA 9ICVA 7ICKA 4MF2A 4KLHA 4PPXA 8ICXA 7ICVA 8ICUA 3JZ0A 4P2HA 4X4NA 3PMLA 3LK9A 4X4UA 5DBAA 7ICFA 1FA0A 2IHOA 4X4TA 8ICPA 4F5RA 4QZ9A 2ZHAA 5CP2A 2IUBA 4RQ2A 2DRBA 5J0RA 4GXIA 3WFSC 3H3AA 4Z6DA 4F5QA 4Z6EA 4MKPA 1TFWA 5CA7A 4M2YA 3PNCA 5F2VO 3JPOA 7ICQA 1NOMA 5CR0A 4KLFA 9ICGA 1Q78A 1TVAA 3HW8A 4RT2A 4I2FA 1ZQOA 4O5KA 7ICJA 1R8AA 1ZQTA 4NXUA 4OAFA 2DVIA 4X5VA 1JMSA 2ZH3A 2BBJA 3AQKA 2W9MA 5J2GA 3V72A 4KLMA 4E7XA 9ICOA 1MIVA 4WC6A 3JPQA 3PHZA 4UD4A 4X4PA 4YMNA 4M47A 3OWGA 9ICPA 4R64A 5HREA 4I0UA 4KLOA 5CJ7A 3RH5A 5CB1A 1JN3A 2B4VA 4TUQA 2ZH6A 3RJHA 4LVSA 3EF2A 3JPSA 5J0XA 2PXIA 2BCUA 7ICTA 4QZDA 1WOTA 8ICTA 8ICWA 4O67A 4K99A 4WC0A 4K9BA 2DR7A 4XUSA 4RQ6A 4YN4A 1MQ2A 9ICEA 9ICBA 5CFUA 1ZJMA 4I29A 2ZH8A 4I2BA 3C5GA 1TFYA 1RPLA 5J2JA 4NM2A 4IQVA 4EEBA 4EGWA 4X0BA 4QZEA 4FHPA 4RQ0A 2PFQA 4X4SA 2BPGA 5IIKA 3MDCA 3RJKA 4UB4A 3MBYA 5HC9A 5TZVA 4NLZA 5J2EA 4DO9A 5DB6A 4AT8B 5B3PA 3H37A 5IIIA 4KM5A 5IINA 4EBJA 2NRKA 4E80A 3NVOA 3MDAA 2HHPA 5HRGA 8ICBA 4EP7A 4I27A 4K8VA 4S3NA 4PHPA 3CK6A 5D46A 2ISOA 3WFQE 4MFFA 5D61A 4XQ7A 4UD5A 4WC2A 1KDHA 1TV9A
chains in the Genus database with same CATH topology
5HRLA 4JWMA 4FO6A 7ICUA 5CHGA 2M2VA 4FHYA 5J0TA 4KLJA 5DB8A 2ZH4A 3H38A 5BOLA 1ZQNA 2BCVA 3UPQA 3C2MA 2VANA 9ICKA 7ICNA 1YLQA 5DECA 5DKWA 2M2UA 3MGHA 3UQ2A 3HX0A 2M2WA 4I2EA 1ZQQA 1ZQFA 1ZQHA 4JWNA 3UXOA 8ICMA 1JAJA 4PGXA 2FMQA 9ICQA 2FMSA 5J2FA 4QZIA 1ZQSA 1ZQCA 4TURA 3V7LA 4KLGA 9ICMA 3UXPA 3RJGA 3B0YA 4PGYA 4RWPA 3C5FA 8ICVA 1V4AA 5J2KA 4RQ7A 4NLNA 4UAWA 2ID1A 5HRIA 8ICHA 4M5DA 4MFAA 1ZQDA 9ICNA 5J0SA 4X4RA 4KLIA 4PH5A 3JPRA 4RT3A 1ZQMA 4DOCA 2I9GA 4WBZA 4I2JA 1ZJNA 2O1PA 4AT9A 3UPSA 8ICZA 5DB7A 5BOMA 4O5EA 4Z6FA 4K4HA 4YD1A 2PFPA 4M9GA 2Q66A 4LZDA 4RWOA 4IG8A 8ICSA 1ZQRA 3WFOA 1F5AA 3AQLA 4M9LA 4NKUA 3JYYA 4WC7A 8ICNA 3WFPA 1Q79A 4DOBA 4NKTA 2GWSA 1MIWA 4K4IA 5HRKA 3HIYA 4E8FA 4RPYA 1NO5A 2DR5A 2FMPA 4KLDA 5D49A 7ICMA 4PHDA 4R66A 9ICXA 1HUZA 2ZH1A 2PBEA 5J2IA 4MF8A 7ICSA 3UQ0A 3OGUA 9ICCA 1UEVA 5HR9A 4IQUA 4GXKA 1XSLA 4FHVA 4RWQA 4LZGA 2BCRA 4X0AA 4RWNA 5EOZA 3AQMA 9ICTA 4F5PA 4YCXA 1ZQAA 2ISPA 2BCSA 5IIJA 4KLEA 2ZH2A 5J0PA 4UB5A 3V7KA 1RZTA 2IHMA 5J0QA 4QZFA 5J2DA 8ICLA 2P66A 2BPFA 5IIMA 8ICOA 1UETA 4I2AA 3OUYA 4PHAA 2BE3A 2ZH5A 4WCWA 3B0XA 8ICCA 4KLTA 7ICPA 8ICQA 7ICGA 5J2AA 4ATBA 4AT7A 1ZQKA 1ZQZA 9ICIA 4RQ3A 1KEJA 4P4OA 5IILA 7ICRA 1BPDA 5J2HA 4XRHA 5HHHA 4R63A 5IIOA 7ICIA 3JPTA 4NY8A 4RQ4A 1ZQBA 5HRDA 4RQ8A 1JQRA 1XSPA 4RQ5A 3RJJA 8ICRA 2RFFA 1ZQVA 9ICJA 1MIYA 1ZQUA 3HJ4A 4YMMA 5J0OA 5J0YA 3RJFA 4K4GA 3C2LA 3RJIA 3TFRA 1ZQLA 4DOAA 4FH3A 8ICKA 7ICLA 4KLUA 4AT9B 2M2TA 3C18A 5J0UA 8ICYA 5D4BA 4Z6CA 4QZGA 4PHEA 3OV7A 4I2IA 4QZ8A 3AU2A 1MQ3A 1ZQJA 2PFNA 4FHWA 1ZQGA 1BPZA 4UB2A 3L9DA 8ICFA 4QZBA 4R65A 5DDYA 3RJEA 4NM1A 5HRBA 4LT6A 3UXNA 3RH4A 3AU6A 4KLSA 4MFCA 4EBKA 4KLLA 3MGIA 5DDMA 2DRAA 1ZQEA 4PGQA 4F5NA 4XA5A 4IQTA 4M04A 4WC1A 4M9NA 9ICRA 5HRHA 1R8CA 3OVAA 9ICLA 1KNYA 4UB1A 2DR9A 9ICUA 5DEDA 1ZQWA 5BPCA 4RPZA 4O5CA 4I2DA 4WBYA 3RH6A 4WC3A 3K75D 5HHIA 9ICHA 3H39A 4O9MA 3LQCB 3OUYB 5HRFA 4NXZA 8ICAA 2ZH7A 5DBCA 9ICAA 4ATBB 4AT7B 7ICHA 1BPXA 4QZAA 7ICEA 4UBCA 4QZCA 1ZQYA 4X4OA 4X4VA 8ICEA 8ICGA 1ZQPA 4I28A 5J2BA 1ZQXA 1XSNA 3C66A 4X4QA 2ZH9A 4I2CA 4F5OA 1BPBA 5J2CA 4UAZA 3AUOA 4WC4A 4TUPA 4RPXA 4I2HA 2ZHBA 1HUOA 4YMOA 4UBBA 1ZQIA 3HJ1A 4GXJA 4UAYA 1R8BA 3JPPA 1OU5A 9ICSA 5DBBA 4TUSA 3JPNA 4XQ8A 1PX5A 3ISBA 3PMNA 3WFRE 5J0WA 2O5AA 3NYBA 3C2KA 4NLKA 2BCQA 4P4MA 3OVSA 9ICWA 4M9JA 2DR8A 5DB9A 7ICOA 4KLQA 3TFSA 1BPEA 4IQWA 4I2GA 4P4PA 1VFGA 1UEUA 2BPCA 4M9HA 5J29A 4AT8A 3ISDA 3V7JA 4FHXA 8ICJA 4UB3A 3AQNA 1R89A 4RQ1A 4WC5A 3ISCA 1VJ7A 2PFOA 3HWTA 3GDXA 4M0AA 8ICIA 4QZHA 4YD2A 1BPYA 3OVBA 5CWRA 4FH5A 9ICFA 9ICVA 7ICKA 4MF2A 4KLHA 4PPXA 8ICXA 7ICVA 8ICUA 3JZ0A 4P2HA 4X4NA 3PMLA 3LK9A 4X4UA 5DBAA 7ICFA 1FA0A 4X4TA 8ICPA 4F5RA 4QZ9A 2ZHAA 5CP2A 4RQ2A 2DRBA 5J0RA 4GXIA 3WFSC 3H3AA 4Z6DA 4F5QA 4Z6EA 1TFWA 5CA7A 4M2YA 3PNCA 5F2VO 3JPOA 7ICQA 1NOMA 5CR0A 4KLFA 9ICGA 1Q78A 1TVAA 3HW8A 4RT2A 4I2FA 1ZQOA 4O5KA 7ICJA 1R8AA 1ZQTA 2DVIA 4X5VA 1JMSA 2ZH3A 3AQKA 2W9MA 5J2GA 3V72A 4KLMA 4E7XA 9ICOA 1MIVA 4WC6A 3JPQA 4UD4A 4X4PA 4YMNA 4M47A 9ICPA 4R64A 5HREA 4KLOA 5CJ7A 3RH5A 5CB1A 1JN3A 4TUQA 2ZH6A 3RJHA 4LVSA 3JPSA 5J0XA 2PXIA 2BCUA 7ICTA 4QZDA 1WOTA 8ICTA 8ICWA 4WC0A 2DR7A 4XUSA 4RQ6A 4YN4A 1MQ2A 9ICEA 9ICBA 1ZJMA 4I29A 2ZH8A 4I2BA 3C5GA 1TFYA 1RPLA 5J2JA 4NM2A 4IQVA 4X0BA 4QZEA 4FHPA 4RQ0A 2PFQA 4X4SA 2BPGA 5IIKA 3MDCA 3RJKA 4UB4A 3MBYA 5HC9A 5TZVA 4NLZA 5J2EA 4DO9A 4AT8B 5DB6A 3H37A 5IIIA 5IINA 4EBJA 2NRKA 4E80A 3MDAA 2HHPA 5HRGA 8ICBA 4EP7A 4I27A 4S3NA 4PHPA 5D46A 2ISOA 3WFQE 4MFFA 4XQ7A 4UD5A 4WC2A 1KDHA 1TV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRL A;  4JWM A;  4FO6 A;  7ICU A;  5CHG A;  2M2V A;  4FHY A;  5J0T A;  4KLJ A;  5DB8 A;  2ZH4 A;  3H38 A;  5BOL A;  1ZQN A;  2BCV A;  3UPQ A;  3C2M A;  2VAN A;  9ICK A;  7ICN A;  1YLQ A;  5DEC A;  5DKW A;  2M2U A;  3MGH A;  3UQ2 A;  3HX0 A;  2M2W A;  4I2E A;  1ZQQ A;  1ZQF A;  1ZQH A;  4JWN A;  3UXO A;  8ICM A;  1JAJ A;  4PGX A;  2FMQ A;  9ICQ A;  2FMS A;  5J2F A;  4QZI A;  1ZQS A;  1ZQC A;  4TUR A;  3V7L A;  4KLG A;  9ICM A;  3UXP A;  3RJG A;  3B0Y A;  4PGY A;  4RWP A;  3C5F A;  8ICV A;  1V4A A;  5J2K A;  4RQ7 A;  4NLN A;  4UAW A;  2ID1 A;  5HRI A;  8ICH A;  4M5D A;  4MFA A;  1ZQD A;  9ICN A;  5J0S A;  4X4R A;  4KLI A;  4PH5 A;  3JPR A;  4RT3 A;  1ZQM A;  4DOC A;  2I9G A;  4WBZ A;  4I2J A;  1ZJN A;  2O1P A;  4AT9 A;  3UPS A;  8ICZ A;  5DB7 A;  5BOM A;  4O5E A;  4Z6F A;  4K4H A;  4YD1 A;  2PFP A;  4M9G A;  2Q66 A;  4LZD A;  4RWO A;  4IG8 A;  8ICS A;  1ZQR A;  3WFO A;  1F5A A;  3AQL A;  4M9L A;  4NKU A;  3JYY A;  4WC7 A;  8ICN A;  3WFP A;  1Q79 A;  4DOB A;  4NKT A;  2GWS A;  1MIW A;  4K4I A;  5HRK A;  3HIY A;  4E8F A;  4RPY A;  1NO5 A;  2DR5 A;  2FMP A;  4KLD A;  5D49 A;  7ICM A;  4PHD A;  4R66 A;  9ICX A;  1HUZ A;  2ZH1 A;  2PBE A;  5J2I A;  4MF8 A;  7ICS A;  3UQ0 A;  3OGU A;  9ICC A;  1UEV A;  5HR9 A;  4IQU A;  4GXK A;  1XSL A;  4FHV A;  4RWQ A;  4LZG A;  2BCR A;  4X0A A;  4RWN A;  5EOZ A;  3AQM A;  9ICT A;  4F5P A;  4YCX A;  1ZQA A;  2ISP A;  2BCS A;  5IIJ A;  4KLE A;  2ZH2 A;  5J0P A;  4UB5 A;  3V7K A;  1RZT A;  2IHM A;  5J0Q A;  4QZF A;  5J2D A;  8ICL A;  2P66 A;  2BPF A;  5IIM A;  8ICO A;  1UET A;  4I2A A;  3OUY A;  4PHA A;  2BE3 A;  2ZH5 A;  4WCW A;  3B0X A;  8ICC A;  4KLT A;  7ICP A;  8ICQ A;  7ICG A;  5J2A A;  4ATB A;  4AT7 A;  1ZQK A;  1ZQZ A;  9ICI A;  4RQ3 A;  1KEJ A;  4P4O A;  5IIL A;  7ICR A;  1BPD A;  5J2H A;  4XRH A;  5HHH A;  4R63 A;  5IIO A;  7ICI A;  3JPT A;  4NY8 A;  4RQ4 A;  1ZQB A;  5HRD A;  4RQ8 A;  1JQR A;  1XSP A;  4RQ5 A;  3RJJ A;  8ICR A;  2RFF A;  1ZQV A;  9ICJ A;  1MIY A;  1ZQU A;  3HJ4 A;  4YMM A;  5J0O A;  5J0Y A;  3RJF A;  4K4G A;  3C2L A;  3RJI A;  3TFR A;  1ZQL A;  4DOA A;  4FH3 A;  8ICK A;  7ICL A;  4KLU A;  4AT9 B;  2M2T A;  3C18 A;  5J0U A;  8ICY A;  5D4B A;  4Z6C A;  4QZG A;  4PHE A;  3OV7 A;  4I2I A;  4QZ8 A;  3AU2 A;  1MQ3 A;  1ZQJ A;  2PFN A;  4FHW A;  1ZQG A;  1BPZ A;  4UB2 A;  3L9D A;  8ICF A;  4QZB A;  4R65 A;  5DDY A;  3RJE A;  4NM1 A;  5HRB A;  4LT6 A;  3UXN A;  3RH4 A;  3AU6 A;  4KLS A;  4MFC A;  4EBK A;  4KLL A;  3MGI A;  5DDM A;  2DRA A;  1ZQE A;  4PGQ A;  4F5N A;  4XA5 A;  4IQT A;  4M04 A;  4WC1 A;  4M9N A;  9ICR A;  5HRH A;  1R8C A;  3OVA A;  9ICL A;  1KNY A;  4UB1 A;  2DR9 A;  9ICU A;  5DED A;  1ZQW A;  5BPC A;  4RPZ A;  4O5C A;  4I2D A;  4WBY A;  3RH6 A;  4WC3 A;  3K75 D;  5HHI A;  9ICH A;  3H39 A;  4O9M A;  3LQC B;  3OUY B;  5HRF A;  4NXZ A;  8ICA A;  2ZH7 A;  5DBC A;  9ICA A;  4ATB B;  4AT7 B;  7ICH A;  1BPX A;  4QZA A;  7ICE A;  4UBC A;  4QZC A;  1ZQY A;  4X4O A;  4X4V A;  8ICE A;  8ICG A;  1ZQP A;  4I28 A;  5J2B A;  1ZQX A;  1XSN A;  3C66 A;  4X4Q A;  2ZH9 A;  4I2C A;  4F5O A;  1BPB A;  5J2C A;  4UAZ A;  3AUO A;  4WC4 A;  4TUP A;  4RPX A;  4I2H A;  2ZHB A;  1HUO A;  4YMO A;  4UBB A;  1ZQI A;  3HJ1 A;  4GXJ A;  4UAY A;  1R8B A;  3JPP A;  1OU5 A;  9ICS A;  5DBB A;  4TUS A;  3JPN A;  4XQ8 A;  1PX5 A;  3ISB A;  3PMN A;  3WFR E;  5J0W A;  2O5A A;  3NYB A;  3C2K A;  4NLK A;  2BCQ A;  4P4M A;  3OVS A;  9ICW A;  4M9J A;  2DR8 A;  5DB9 A;  7ICO A;  4KLQ A;  3TFS A;  1BPE A;  4IQW A;  4I2G A;  4P4P A;  1VFG A;  1UEU A;  2BPC A;  4M9H A;  5J29 A;  4AT8 A;  3ISD A;  3V7J A;  4FHX A;  8ICJ A;  4UB3 A;  3AQN A;  1R89 A;  4RQ1 A;  4WC5 A;  3ISC A;  1VJ7 A;  2PFO A;  3HWT A;  3GDX A;  4M0A A;  8ICI A;  4QZH A;  4YD2 A;  1BPY A;  3OVB A;  5CWR A;  4FH5 A;  9ICF A;  9ICV A;  7ICK A;  4MF2 A;  4KLH A;  4PPX A;  8ICX A;  7ICV A;  8ICU A;  3JZ0 A;  4P2H A;  4X4N A;  3PML A;  3LK9 A;  4X4U A;  5DBA A;  7ICF A;  1FA0 A;  4X4T A;  8ICP A;  4F5R A;  4QZ9 A;  2ZHA A;  5CP2 A;  4RQ2 A;  2DRB A;  5J0R A;  4GXI A;  3WFS C;  3H3A A;  4Z6D A;  4F5Q A;  4Z6E A;  1TFW A;  5CA7 A;  4M2Y A;  3PNC A;  5F2V O;  3JPO A;  7ICQ A;  1NOM A;  5CR0 A;  4KLF A;  9ICG A;  1Q78 A;  1TVA A;  3HW8 A;  4RT2 A;  4I2F A;  1ZQO A;  4O5K A;  7ICJ A;  1R8A A;  1ZQT A;  2DVI A;  4X5V A;  1JMS A;  2ZH3 A;  3AQK A;  2W9M A;  5J2G A;  3V72 A;  4KLM A;  4E7X A;  9ICO A;  1MIV A;  4WC6 A;  3JPQ A;  4UD4 A;  4X4P A;  4YMN A;  4M47 A;  9ICP A;  4R64 A;  5HRE A;  4KLO A;  5CJ7 A;  3RH5 A;  5CB1 A;  1JN3 A;  4TUQ A;  2ZH6 A;  3RJH A;  4LVS A;  3JPS A;  5J0X A;  2PXI A;  2BCU A;  7ICT A;  4QZD A;  1WOT A;  8ICT A;  8ICW A;  4WC0 A;  2DR7 A;  4XUS A;  4RQ6 A;  4YN4 A;  1MQ2 A;  9ICE A;  9ICB A;  1ZJM A;  4I29 A;  2ZH8 A;  4I2B A;  3C5G A;  1TFY A;  1RPL A;  5J2J A;  4NM2 A;  4IQV A;  4X0B A;  4QZE A;  4FHP A;  4RQ0 A;  2PFQ A;  4X4S A;  2BPG A;  5IIK A;  3MDC A;  3RJK A;  4UB4 A;  3MBY A;  5HC9 A;  5TZV A;  4NLZ A;  5J2E A;  4DO9 A;  4AT8 B;  5DB6 A;  3H37 A;  5III A;  5IIN A;  4EBJ A;  2NRK A;  4E80 A;  3MDA A;  2HHP A;  5HRG A;  8ICB A;  4EP7 A;  4I27 A;  4S3N A;  4PHP A;  5D46 A;  2ISO A;  3WFQ E;  4MFF A;  4XQ7 A;  4UD5 A;  4WC2 A;  1KDH A;  1TV9 A; 
#chains in the Genus database with same CATH topology
 5HRL A;  4JWM A;  5JTG A;  4FO6 A;  2EWR A;  7ICU A;  5CHG A;  2M2V A;  5B3Q A;  4FHY A;  5J0T A;  4KLJ A;  5DB8 A;  2ZH4 A;  3H38 A;  5BOL A;  4K9A A;  1ZQN A;  2BCV A;  3UPQ A;  3C2M A;  2VAN A;  4OAG A;  4NXT A;  9ICK A;  7ICN A;  1YLQ A;  5DEC A;  5DKW A;  2M2U A;  3MGH A;  3UQ2 A;  4LEW A;  3HX0 A;  2M2W A;  4I2E A;  1ZQQ A;  1ZQF A;  1ZQH A;  4JWN A;  3UXO A;  4NXX A;  8ICM A;  1JAJ A;  4PGX A;  2FMQ A;  9ICQ A;  2FMS A;  5J2F A;  4O6A A;  4QZI A;  1ZQC A;  1ZQS A;  4TUR A;  3V7L A;  4KLG A;  9ICM A;  3UXP A;  3RJG A;  3B0Y A;  4PGY A;  4RWP A;  3C5F A;  8ICV A;  1V4A A;  5J2K A;  4K98 A;  4RQ7 A;  4K96 A;  4NLN A;  4UAW A;  2ID1 A;  5HRI A;  8ICH A;  4M5D A;  2GAF D;  4MFA A;  1ZQD A;  9ICN A;  5D63 A;  5J0S A;  4X4R A;  4KLI A;  4PH5 A;  3JPR A;  4OAH A;  4JLX A;  4RT3 A;  1ZQM A;  2HN1 A;  4DOC A;  2I9G A;  4WBZ A;  4I2J A;  1ZJN A;  2O1P A;  4JLZ A;  4AT9 A;  3UPS A;  8ICZ A;  5BOM A;  5DB7 A;  4O5E A;  4Z6F A;  4K4H A;  4YD1 A;  2PFP A;  4M9G A;  2Q66 A;  4LZD A;  4RWO A;  4IG8 A;  8ICS A;  1ZQR A;  3WFO A;  4NXV A;  1F5A A;  3AQL A;  2GA9 D;  4M9L A;  4NKU A;  3JYY A;  4WC7 A;  8ICN A;  3WFP A;  1Q79 A;  4DOB A;  4NKT A;  2GWS A;  1MIW A;  4K4I A;  5HRK A;  3HIY A;  3NWI A;  4E8F A;  4O68 A;  4RPY A;  1NO5 A;  2BBH A;  2DR5 A;  2FMP A;  5D49 A;  4KLD A;  7ICM A;  4PHD A;  3ER9 B;  4R66 A;  9ICX A;  1HUZ A;  2ZH1 A;  2PBE A;  5J2I A;  4MF8 A;  7ICS A;  3UQ0 A;  3OGU A;  2HN2 A;  9ICC A;  1UEV A;  4WQK A;  5HR9 A;  4IQU A;  4GXK A;  1XSL A;  4KB6 A;  4FHV A;  4RWQ A;  4LZG A;  2BCR A;  4X0A A;  4RWN A;  5EOZ A;  3AQM A;  9ICT A;  4F5P A;  4YCX A;  1ZQA A;  2ISP A;  2BCS A;  5IIJ A;  2B56 A;  4KLE A;  2ZH2 A;  4LEV A;  5J0P A;  4UB5 A;  3V7K A;  1RZT A;  2IHM A;  5J0Q A;  4QZF A;  5J2D A;  8ICL A;  2P66 A;  4N7R A;  5IIM A;  2BPF A;  8ICO A;  1UET A;  4I2A A;  3NKU A;  4PHA A;  2BE3 A;  3OUY A;  4NXW A;  4WCW A;  3B0X A;  2ZH5 A;  8ICC A;  4KLT A;  7ICP A;  8ICQ A;  7ICG A;  5J2A A;  4ATB A;  4AT7 A;  1ZQK A;  1ZQZ A;  9ICI A;  4RQ3 A;  1KEJ A;  4P4O A;  5IIL A;  7ICR A;  1BPD A;  5J2H A;  4XRH A;  5HHH A;  4R63 A;  5IIO A;  7ICI A;  3JPT A;  4NY8 A;  4RQ4 A;  1ZQB A;  5HRD A;  4RQ8 A;  1JQR A;  1XSP A;  4RQ5 A;  3RJJ A;  8ICR A;  2RFF A;  1ZQV A;  9ICJ A;  1MIY A;  4EED A;  1ZQU A;  3HJ4 A;  4YMM A;  5J0O A;  5J0Y A;  3RJF A;  4K4G A;  3C2L A;  3RJI A;  3TFR A;  1ZQL A;  4DOA A;  4FH3 A;  8ICK A;  7ICL A;  4KLU A;  4AT9 B;  2M2T A;  3C18 A;  5J0U A;  8ICY A;  5D4B A;  4Z6C A;  4QZG A;  4PHE A;  4I2I A;  4QZ8 A;  3OV7 A;  3AU2 A;  1MQ3 A;  4WH5 A;  1ZQJ A;  2PFN A;  4FHW A;  1ZQG A;  1BPZ A;  4UB2 A;  3L9D A;  8ICF A;  4QZB A;  4R65 A;  1GPJ A;  5DDY A;  3RJE A;  4NM1 A;  5HRB A;  4LT6 A;  3UXN A;  4FO1 A;  3JCF A;  3RH4 A;  3AU6 A;  4KLS A;  4MFC A;  4EBK A;  4KLL A;  3MGI A;  5DDM A;  2DRA A;  1ZQE A;  4PGQ A;  4F5N A;  4XA5 A;  4IQT A;  4M04 A;  4WC1 A;  4M9N A;  9ICR A;  5HRH A;  1R8C A;  4LEZ A;  3OVA A;  9ICL A;  4O69 A;  4LEY A;  1KNY A;  4UB1 A;  2DR9 A;  9ICU A;  5DED A;  1ZQW A;  5BPC A;  4RPZ A;  4O5C A;  4I2D A;  2B51 A;  3ERC C;  4K97 A;  4WBY A;  3RH6 A;  4WC3 A;  3K75 D;  5HHI A;  9ICH A;  3H39 A;  4O9M A;  3LQC B;  3OUY B;  5HRF A;  3K7D A;  4NXZ A;  8ICA A;  2ZH7 A;  5DBC A;  9ICA A;  4ATB B;  4AT7 B;  7ICH A;  1BPX A;  4QZA A;  2FCL A;  7ICE A;  4UBC A;  4QZC A;  1ZQY A;  4X4O A;  4X4V A;  8ICE A;  8ICG A;  1ZQP A;  4I28 A;  5J2B A;  1ZQX A;  1XSN A;  5CHE A;  3C66 A;  4XJE A;  4X4Q A;  2ZH9 A;  4I2C A;  4F5O A;  1BPB A;  5J2C A;  4UAZ A;  3AUO A;  4WC4 A;  4TUP A;  4RPX A;  4I2H A;  3ER8 C;  2ZHB A;  1HUO A;  4YMO A;  4UBB A;  4WQL A;  1ZQI A;  3HJ1 A;  3MCR A;  4GXJ A;  4UAY A;  1R8B A;  3JPP A;  1OU5 A;  9ICS A;  5DBB A;  4TUS A;  3JPN A;  4XQ8 A;  4HX0 A;  5CFS A;  1PX5 A;  3ISB A;  3PMN A;  3WFR E;  5J0W A;  2O5A A;  3NYB A;  3C2K A;  4NLK A;  2BCQ A;  4P4M A;  4OAI Z;  3OVS A;  9ICW A;  4M9J A;  2DR8 A;  5DB9 A;  7ICO A;  4KLQ A;  3TFS A;  1BPE A;  5CFT A;  4I2G A;  4IQW A;  4P4P A;  1VFG A;  1UEU A;  2BPC A;  4M9H A;  5J29 A;  4AT8 A;  3ISD A;  3V7J A;  4FHX A;  8ICJ A;  4UB3 A;  3AQN A;  1R89 A;  5D62 A;  4EV6 A;  4RQ1 A;  4WOY A;  4WC5 A;  3ISC A;  1VJ7 A;  2PFO A;  3HWT A;  3GDX A;  4M0A A;  8ICI A;  4QZH A;  4YD2 A;  1BPY A;  3OVB A;  5CWR A;  4FH5 A;  9ICF A;  9ICV A;  7ICK A;  4MF2 A;  4KLH A;  4PPX A;  8ICX A;  7ICV A;  8ICU A;  3JZ0 A;  4P2H A;  4X4N A;  3PML A;  3LK9 A;  4X4U A;  5DBA A;  7ICF A;  1FA0 A;  2IHO A;  4X4T A;  8ICP A;  4F5R A;  4QZ9 A;  2ZHA A;  5CP2 A;  2IUB A;  4RQ2 A;  2DRB A;  5J0R A;  4GXI A;  3WFS C;  3H3A A;  4Z6D A;  4F5Q A;  4Z6E A;  4MKP A;  1TFW A;  5CA7 A;  4M2Y A;  3PNC A;  5F2V O;  3JPO A;  7ICQ A;  1NOM A;  5CR0 A;  4KLF A;  9ICG A;  1Q78 A;  1TVA A;  3HW8 A;  4RT2 A;  4I2F A;  1ZQO A;  4O5K A;  7ICJ A;  1R8A A;  1ZQT A;  4NXU A;  4OAF A;  2DVI A;  4X5V A;  1JMS A;  2ZH3 A;  2BBJ A;  3AQK A;  2W9M A;  5J2G A;  3V72 A;  4KLM A;  4E7X A;  9ICO A;  1MIV A;  4WC6 A;  3JPQ A;  3PHZ A;  4UD4 A;  4X4P A;  4YMN A;  4M47 A;  3OWG A;  9ICP A;  4R64 A;  5HRE A;  4I0U A;  4KLO A;  5CJ7 A;  3RH5 A;  5CB1 A;  1JN3 A;  2B4V A;  4TUQ A;  2ZH6 A;  3RJH A;  4LVS A;  3EF2 A;  3JPS A;  5J0X A;  2PXI A;  2BCU A;  7ICT A;  4QZD A;  1WOT A;  8ICT A;  8ICW A;  4O67 A;  4K99 A;  4WC0 A;  4K9B A;  2DR7 A;  4XUS A;  4RQ6 A;  4YN4 A;  1MQ2 A;  9ICE A;  9ICB A;  5CFU A;  1ZJM A;  4I29 A;  2ZH8 A;  4I2B A;  3C5G A;  1TFY A;  1RPL A;  5J2J A;  4NM2 A;  4IQV A;  4EEB A;  4EGW A;  4X0B A;  4QZE A;  4FHP A;  4RQ0 A;  2PFQ A;  4X4S A;  2BPG A;  5IIK A;  3MDC A;  3RJK A;  4UB4 A;  3MBY A;  5HC9 A;  5TZV A;  4NLZ A;  5J2E A;  4DO9 A;  5DB6 A;  4AT8 B;  5B3P A;  3H37 A;  5III A;  4KM5 A;  5IIN A;  4EBJ A;  2NRK A;  4E80 A;  3NVO A;  3MDA A;  2HHP A;  5HRG A;  8ICB A;  4EP7 A;  4I27 A;  4K8V A;  4S3N A;  4PHP A;  3CK6 A;  5D46 A;  2ISO A;  3WFQ E;  4MFF A;  5D61 A;  4XQ7 A;  4UD5 A;  4WC2 A;  1KDH A;  1TV9 A; 
#chains in the Genus database with same CATH homology
 5HRL A;  4JWM A;  4FO6 A;  7ICU A;  5CHG A;  2M2V A;  4FHY A;  5J0T A;  4KLJ A;  5DB8 A;  2ZH4 A;  3H38 A;  5BOL A;  1ZQN A;  2BCV A;  3UPQ A;  3C2M A;  2VAN A;  9ICK A;  7ICN A;  1YLQ A;  5DEC A;  5DKW A;  2M2U A;  3MGH A;  3UQ2 A;  3HX0 A;  2M2W A;  4I2E A;  1ZQQ A;  1ZQF A;  1ZQH A;  4JWN A;  3UXO A;  8ICM A;  1JAJ A;  4PGX A;  2FMQ A;  9ICQ A;  2FMS A;  5J2F A;  4QZI A;  1ZQS A;  1ZQC A;  4TUR A;  3V7L A;  4KLG A;  9ICM A;  3UXP A;  3RJG A;  3B0Y A;  4PGY A;  4RWP A;  3C5F A;  8ICV A;  1V4A A;  5J2K A;  4RQ7 A;  4NLN A;  4UAW A;  2ID1 A;  5HRI A;  8ICH A;  4M5D A;  4MFA A;  1ZQD A;  9ICN A;  5J0S A;  4X4R A;  4KLI A;  4PH5 A;  3JPR A;  4RT3 A;  1ZQM A;  4DOC A;  2I9G A;  4WBZ A;  4I2J A;  1ZJN A;  2O1P A;  4AT9 A;  3UPS A;  8ICZ A;  5DB7 A;  5BOM A;  4O5E A;  4Z6F A;  4K4H A;  4YD1 A;  2PFP A;  4M9G A;  2Q66 A;  4LZD A;  4RWO A;  4IG8 A;  8ICS A;  1ZQR A;  3WFO A;  1F5A A;  3AQL A;  4M9L A;  4NKU A;  3JYY A;  4WC7 A;  8ICN A;  3WFP A;  1Q79 A;  4DOB A;  4NKT A;  2GWS A;  1MIW A;  4K4I A;  5HRK A;  3HIY A;  4E8F A;  4RPY A;  1NO5 A;  2DR5 A;  2FMP A;  4KLD A;  5D49 A;  7ICM A;  4PHD A;  4R66 A;  9ICX A;  1HUZ A;  2ZH1 A;  2PBE A;  5J2I A;  4MF8 A;  7ICS A;  3UQ0 A;  3OGU A;  9ICC A;  1UEV A;  5HR9 A;  4IQU A;  4GXK A;  1XSL A;  4FHV A;  4RWQ A;  4LZG A;  2BCR A;  4X0A A;  4RWN A;  5EOZ A;  3AQM A;  9ICT A;  4F5P A;  4YCX A;  1ZQA A;  2ISP A;  2BCS A;  5IIJ A;  4KLE A;  2ZH2 A;  5J0P A;  4UB5 A;  3V7K A;  1RZT A;  2IHM A;  5J0Q A;  4QZF A;  5J2D A;  8ICL A;  2P66 A;  2BPF A;  5IIM A;  8ICO A;  1UET A;  4I2A A;  3OUY A;  4PHA A;  2BE3 A;  2ZH5 A;  4WCW A;  3B0X A;  8ICC A;  4KLT A;  7ICP A;  8ICQ A;  7ICG A;  5J2A A;  4ATB A;  4AT7 A;  1ZQK A;  1ZQZ A;  9ICI A;  4RQ3 A;  1KEJ A;  4P4O A;  5IIL A;  7ICR A;  1BPD A;  5J2H A;  4XRH A;  5HHH A;  4R63 A;  5IIO A;  7ICI A;  3JPT A;  4NY8 A;  4RQ4 A;  1ZQB A;  5HRD A;  4RQ8 A;  1JQR A;  1XSP A;  4RQ5 A;  3RJJ A;  8ICR A;  2RFF A;  1ZQV A;  9ICJ A;  1MIY A;  1ZQU A;  3HJ4 A;  4YMM A;  5J0O A;  5J0Y A;  3RJF A;  4K4G A;  3C2L A;  3RJI A;  3TFR A;  1ZQL A;  4DOA A;  4FH3 A;  8ICK A;  7ICL A;  4KLU A;  4AT9 B;  2M2T A;  3C18 A;  5J0U A;  8ICY A;  5D4B A;  4Z6C A;  4QZG A;  4PHE A;  3OV7 A;  4I2I A;  4QZ8 A;  3AU2 A;  1MQ3 A;  1ZQJ A;  2PFN A;  4FHW A;  1ZQG A;  1BPZ A;  4UB2 A;  3L9D A;  8ICF A;  4QZB A;  4R65 A;  5DDY A;  3RJE A;  4NM1 A;  5HRB A;  4LT6 A;  3UXN A;  3RH4 A;  3AU6 A;  4KLS A;  4MFC A;  4EBK A;  4KLL A;  3MGI A;  5DDM A;  2DRA A;  1ZQE A;  4PGQ A;  4F5N A;  4XA5 A;  4IQT A;  4M04 A;  4WC1 A;  4M9N A;  9ICR A;  5HRH A;  1R8C A;  3OVA A;  9ICL A;  1KNY A;  4UB1 A;  2DR9 A;  9ICU A;  5DED A;  1ZQW A;  5BPC A;  4RPZ A;  4O5C A;  4I2D A;  4WBY A;  3RH6 A;  4WC3 A;  3K75 D;  5HHI A;  9ICH A;  3H39 A;  4O9M A;  3LQC B;  3OUY B;  5HRF A;  4NXZ A;  8ICA A;  2ZH7 A;  5DBC A;  9ICA A;  4ATB B;  4AT7 B;  7ICH A;  1BPX A;  4QZA A;  7ICE A;  4UBC A;  4QZC A;  1ZQY A;  4X4O A;  4X4V A;  8ICE A;  8ICG A;  1ZQP A;  4I28 A;  5J2B A;  1ZQX A;  1XSN A;  3C66 A;  4X4Q A;  2ZH9 A;  4I2C A;  4F5O A;  1BPB A;  5J2C A;  4UAZ A;  3AUO A;  4WC4 A;  4TUP A;  4RPX A;  4I2H A;  2ZHB A;  1HUO A;  4YMO A;  4UBB A;  1ZQI A;  3HJ1 A;  4GXJ A;  4UAY A;  1R8B A;  3JPP A;  1OU5 A;  9ICS A;  5DBB A;  4TUS A;  3JPN A;  4XQ8 A;  1PX5 A;  3ISB A;  3PMN A;  3WFR E;  5J0W A;  2O5A A;  3NYB A;  3C2K A;  4NLK A;  2BCQ A;  4P4M A;  3OVS A;  9ICW A;  4M9J A;  2DR8 A;  5DB9 A;  7ICO A;  4KLQ A;  3TFS A;  1BPE A;  4IQW A;  4I2G A;  4P4P A;  1VFG A;  1UEU A;  2BPC A;  4M9H A;  5J29 A;  4AT8 A;  3ISD A;  3V7J A;  4FHX A;  8ICJ A;  4UB3 A;  3AQN A;  1R89 A;  4RQ1 A;  4WC5 A;  3ISC A;  1VJ7 A;  2PFO A;  3HWT A;  3GDX A;  4M0A A;  8ICI A;  4QZH A;  4YD2 A;  1BPY A;  3OVB A;  5CWR A;  4FH5 A;  9ICF A;  9ICV A;  7ICK A;  4MF2 A;  4KLH A;  4PPX A;  8ICX A;  7ICV A;  8ICU A;  3JZ0 A;  4P2H A;  4X4N A;  3PML A;  3LK9 A;  4X4U A;  5DBA A;  7ICF A;  1FA0 A;  4X4T A;  8ICP A;  4F5R A;  4QZ9 A;  2ZHA A;  5CP2 A;  4RQ2 A;  2DRB A;  5J0R A;  4GXI A;  3WFS C;  3H3A A;  4Z6D A;  4F5Q A;  4Z6E A;  1TFW A;  5CA7 A;  4M2Y A;  3PNC A;  5F2V O;  3JPO A;  7ICQ A;  1NOM A;  5CR0 A;  4KLF A;  9ICG A;  1Q78 A;  1TVA A;  3HW8 A;  4RT2 A;  4I2F A;  1ZQO A;  4O5K A;  7ICJ A;  1R8A A;  1ZQT A;  2DVI A;  4X5V A;  1JMS A;  2ZH3 A;  3AQK A;  2W9M A;  5J2G A;  3V72 A;  4KLM A;  4E7X A;  9ICO A;  1MIV A;  4WC6 A;  3JPQ A;  4UD4 A;  4X4P A;  4YMN A;  4M47 A;  9ICP A;  4R64 A;  5HRE A;  4KLO A;  5CJ7 A;  3RH5 A;  5CB1 A;  1JN3 A;  4TUQ A;  2ZH6 A;  3RJH A;  4LVS A;  3JPS A;  5J0X A;  2PXI A;  2BCU A;  7ICT A;  4QZD A;  1WOT A;  8ICT A;  8ICW A;  4WC0 A;  2DR7 A;  4XUS A;  4RQ6 A;  4YN4 A;  1MQ2 A;  9ICE A;  9ICB A;  1ZJM A;  4I29 A;  2ZH8 A;  4I2B A;  3C5G A;  1TFY A;  1RPL A;  5J2J A;  4NM2 A;  4IQV A;  4X0B A;  4QZE A;  4FHP A;  4RQ0 A;  2PFQ A;  4X4S A;  2BPG A;  5IIK A;  3MDC A;  3RJK A;  4UB4 A;  3MBY A;  5HC9 A;  5TZV A;  4NLZ A;  5J2E A;  4DO9 A;  4AT8 B;  5DB6 A;  3H37 A;  5III A;  5IIN A;  4EBJ A;  2NRK A;  4E80 A;  3MDA A;  2HHP A;  5HRG A;  8ICB A;  4EP7 A;  4I27 A;  4S3N A;  4PHP A;  5D46 A;  2ISO A;  3WFQ E;  4MFF A;  4XQ7 A;  4UD5 A;  4WC2 A;  1KDH A;  1TV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...