4PPXA

Dna polymerase beta e295k with spiroiminodihydantoin in templating position
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
314
Chain Sequence
b'ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Crystal Structure of DNA Polymerase beta with DNA Containing the Base Lesion Spiroiminodihydantoin in a Templating Position.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 107
structure length 314
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ppxA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ppxA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ppxA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ppxA03
4F50A 5J2KA 4DF8A 5HC9A 5HRIA 3SI8A 1NK8A 3BDPA 1FA0A 5L1IA 4UAYA 2DR7A 1EXNA 2RDIA 3Q8PB 5EWFA 3UQ0A 4K4GA 4WC6A 4TUQA 4KLGA 4R8UB 5CA7A 1Z3EB 4YD2A 3AUOA 4NLKA 3H4BA 4EZ6A 4RQ0A 2Q0ZX 1KRPA 3ZDDA 2LYHA 5KTQA 3QEBZ 1DK3A 2M2WA 4RPXA 4F5NA 4UAWA 1HUOA 4B9LA 2HHXA 3BQ2A 2ASLA 5BPCA 1RXVA 4WBZA 4KLSA 1DOQA 1XSPA 4JV0A 3JPNA 4LZGA 7ICOA 3C1ZA 4DO9A 1A77A 3HX0A 3Q8MA 4PGYA 4QZIA 1ZJNA 4YD1A 3JPTA 2ZH7A 4DL4A 3KHRA 4X0BA 3MBYA 8ICMA 1ZQNA 1XWLA 1KLNA 4K4IA 7ICFA 2XGPA 8ICSA 1KFTA 4DF4A 4M9NA 4RQ3A 3ZD9A 4DL6A 4R65A 4B9UA 3H7IA 5BOLA 1IXRA 1V9PA 4KLLA 2ZUCA 5KT3A 2HHUA 9ICEA 4YR2A 4UB4A 5IIJA 3V6JA 3HT3A 4ECQA 9ICKA 2ZJ5A 2M2TA 1BPDA 1NJXA 3MDAA 3L9DA 3RJJA 3WFQE 2DR8A 3RB4A 4K4HA 4WC2A 4BWMA 3T3FA 5DB6A 2W8LA 1S9FA 4C8OA 4E80A 5KFUA 1JN3A 5KFQA 2W9BB 4ED7A 1B43A 5HHIA 3H40A 4RQ2A 3LQCB 4X4VA 4KLIA 1V4AA 5IIKA 4M9GA 2ZH4A 3EPIA 5J2BA 1RZTA 7ICIA 5KFEA 4C8MA 4UBBA 4E8FA 4I27A 2W8KA 5HR9A 4ED8A 3PV8A 2UVWA 1ZQUA 1ZQMA 4ED0A 3GIJA 4J9QA 4DEZA 2VA2A 8ICUA 2ZH1A 2DRBA 2GWSA 4DFMA 2AJQA 3OVAA 1NK5A 4XRHA 4NLNA 3B0XA 1TKDA 5HRFA 4O3SA 3JZ0A 4XQ7A 5J0YA 5J2DA 5D4BA 3ISCA 5HMMA 2WTFA 5KFNA 3OSNA 3BJYA 1AROP 4FS2A 3BQ1A 1MSWD 4F5QA 8ICFA 9ICNA 3OVSA 3OUYA 5DLFA 3UQ2A 4BXOA 4O3NA 4DFJA 3RB0A 1BNOA 3RRHA 4MEYA 4RQ8A 5HRDA 4J9MA 1S76D 4ELVA 4J9SA 4FHWA 4DFKA 4BGDA 3AQKA 4WC1A 2HHSA 3PY8A 2BHNA 4ECZA 1JIHA 4JK1A 9ICHA 1K1SA 2I1QA 1T4GA 3GIMA 2AGQA 4ECYA 2ZHAA 4RZRA 1ZQIA 4JV1A 1ZQAA 3RJIA 5CB1A 4R64A 1S97A 4F2SA 5J2FA 4EBDA 3V7LA 4ED1A 4QWBA 4DOAA 1UT5A 4I2DA 3HP6A 2NRVA 5KFZA 3M8RA 2W9CB 4ECRA 4EBCA 4DQSA 1RYRA 4MF2A 1ZQTA 2IBKA 4M5DA 3ZDAA 1HUZA 4UAZA 1U48A 1T7PA 4XQ8A 3V7KA 4Z6CA 1MIVA 4PHAA 4I2EA 4AT7A 2DRAA 2BCQA 3AU2A 2OWOA 3C5GA 1ZQPA 5KFAA 4O3RA 3HJ1A 4PGQA 5KFGA 3B0YA 4PHDA 5HRKA 4WC3A 5KFSA 5DBAA 8ICIA 2A1JA 5F2VO 1L3SA 1SL0A 1ZQYA 4IRKA 5KFKA 2R8GA 4Q8FA 4UB5A 7ICTA 3PX6A 2ASJA 5D46A 2R8HA 1D9DA 2PBEA 5KFOA 3HJ4A 2F1IA 5DDYA 4UB1A 3Q8QB 8ICHA 5KFPA 5KFFA 3TI0A 2BR0A 5KG5A 4S3NA 1NKCA 4ATBB 5HRHA 3PW2A 1KNYA 4F3OA 4YCXA 4CCHA 1L5UA 1U47A 2F1HA 4C8KA 4O3QA 2JEFA 5F9NA 4DSLA 2BGWA 2ZH2A 1S0OA 9ICBA 2HW3A 5KFVA 4YXMA 5DG8A 5J2JA 3H39A 7ICPA 2NRWA 1SKRA 3HIYA 3G6YA 4DL5A 5IIIA 3AU6A 3UXPA 4ED6A 4QZ9A 3OGUA 4P4OA 3NGDA 3HW8A 1NJYA 1Y88A 5DKWA 3UPQA 3M9NB 1R8AA 2ZUBA 4B9NA 4WC7A 2NRKA 7ICVA 4RUCA 3TAQA 3LWMA 1KFDA 3RH6A 3MDCA 1SKWA 4I2BA 2KFZA 1JAJA 4M6WA 9ICSA 2C2RA 1ZQHA 1KSPA 8ICJA 3JYYA 3RBDA 4AT9B 4I2CA 2IHNA 4J9NA 4IR9A 4EEYA 1SKSA 4I2JA 1BVSA 1COOA 1IM4A 4QW9A 2Y1JA 7ICKA 3V72A 5KFHA 4MFFA 1NJWA 4O5CA 2ZH9A 4FO6A 4WC5A 5CP2A 3C2MA 4F2RA 4JUZA 2XC9A 1ZQOA 1X2IA 2O5AA 5IIMA 2BPFA 4R8UA 4WC4A 3T5LA 5J0SA 4RQ5A 1Z00B 3RBEA 2ATLA 1XSNA 3C66A 4RQ6A 4ED2A 3KHLA 4F4WA 4C8LA 3PVXA 3TARA 2KZZA 3C2KA 3C18A 2BE3A 4J9RA 4QZGA 3HWTA 3N4MB 4DQIA 4DSKA 2IHMA 7ICJA 1VJ7A 3PW0A 4NM1A 4IQTA 3H3AA 4B9SA 3PMLA 3H8SA 7ICMA 4QWDA 4J9PA 3MGHA 1TFYA 5HRLA 4DS5A 4ECVA 4NKTA 2KFNA 7ICSA 3SZ2A 4YFKA 1BGXT 3MR6A 2KZ3A 4WCWA 3ISDA 2PI5A 2DPJA 3C1YA 3PR5B 4M0AA 3QE9Y 2ZH5A 1U9LA 4O3OA 5KG6A 5DLGA 4TQRA 5HMLA 3GV7B 3RJEA 4FHVA 4O5EA 3JPOA 2RFFA 2V4QA 2XY6A 1XSLA 1TV9A 1XC9A 1L3UA 5L1LA 1NKEA 3JPQA 1ZQQA 4TQSA 4MEXA 4YP3A 4AT8A 2AU0A 4EBEA 3PR4A 3MFHA 5DGAA 1NKBA 3C5FA 3T5KA 1ZQGA 9ICXA 1X9WA 5TZVA 3T5JA 1UA1A 1BPYA 3SV4A 1ZQCA 3SYZA 4DS4A 2RDJA 4DSIA 7ICQA 5KFCA 3TAPA 1SL2A 2NRXA 5KT2A 4FS1A 4I2AA 7ICUA 5KFJA 2XO7A 3PX4A 3JPPA 4X4SA 5J0QA 9ICUA 4UD5A 2JEIA 1KDHA 4IRDA 4DOBA 3EWAA 4NKUA 4DQQA 5BOMA 3GDXA 4NLGA 5DGBA 4KLQA 3WFPA 4KTQA 4I28A 4Z6FA 2M2UA 5J0OA 4P4MA 2DFLA 3QZ7A 2C28A 4DLGA 3C2LA 4E0DA 2ZTEA 4QZEA 1TVAA 4M47A 4KN7A 3GILA 5J2GA 2VA8A 5DG7A 3Q8KA 4NLZA 4Z6DA 8ICEA 5HP4A 4Q8EA 2KZMA 2M2VA 4X4OA 2PFNA 4EYIB 3PW4A 1HJPA 1RPLA 5CWRA 2IMWP 2JEJA 4KLEA 3RH5A 5EWEA 4PPXA 4JWNA 2BQ3A 7ICLA 5J2AA 4Q43A 3RB6A 8ICXA 4EP7A 1R89A 1ZQKA 2ZJAA 5J2CA 3SV3A 4MFAA 5KFWA 1ZQEA 1UA0A 5HRBA 3T5HA 2MUTA 5DB8A 1DGSA 4TUSA 2BQUA 2C2DA 2I9GA 4F8RA 3PW5A 2J6TA 4YMNA 3OUYB 2P66A 4QZAA 5J2EA 2BKEA 5DB7A 3ISBA 1R8BA 5KG7A 2BPCA 4BXOB 4QZBA 1N48A 4PHPA 4DSJA 4B9MA 1U45A 1JXEA 4O9MA 8ICCA 8ICYA 2FPMA 5KG0A 4YR3A 3G6VA 4DL3A 1UETA 5J29A 5IINA 3EW9A 4KLFA 4FH5A 3ORYA 4BWJA 3ZDCA 3H8WA 4FH3A 3C21A 8ICBA 3GIIA 4X4TA 4M2YA 3C23A 3Q8LA 1TK8A 2JEGA 8ICWA 3PO4A 1VFGA 4DQPA 4RQ4A 2AGOA 2R8KA 4EBJA 9ICLA 4RT2A 1TAQA 1CUKA 1X9SA 1OU5A 4X4RA 4DLEA 3MR5A 3H4DA 1LB2B 4RPZA 4X4NA 5DG9A 8ICLA 2ZH6A 4M04A 5HREA 4F5PA 1QSYA 5KFXA 3JPSA 3ZD8A 4JV2A 8ICAA 3FDSA 4AT7B 3UXOA 5KT7A 1S0NA 4RUAA 5KT6A 1NJZA 4NXZA 4KMUA 5J0RA 1T3NA 8ICZA 3AQLA 4UB3A 4QWCA 4MFCA 5F9LA 4F4YA 5EOZA 2A1JB 2XY7A 4PHEA 4F91B 4DL2A 1QSLA 1N56A 5KFDA 3ZDBA 9ICQA 4IQVA 4RT3A 5HNKA 9ICPA 3AQMA 4KITB 8ICQA 2M9NA 2ASDA 2ISPA 3RR7A 5C5JA 1H38A 2UVRA 2NRTA 3PO5A 2KN7A 1MC8A 3RR8A 3E2EA 2HHVA 1TAUA 4FBUA 1L3VA 8ICPA 4YQWA 4DWIA 1KFSA 4ECSA 4F5RA 5DQGA 4QZCA 2PFQA 4M9LA 1L3TA 2P6UA 4P4PA 4RNOA 4FHPA 4KLUA 1T8EA 4X4QA 5CJ7A 2W9MA 3TANA 4RQ7A 4YVZA 3QEAZ 1QSSA 8ICOA 3WFOA 8ICNA 4R66A 1D8LA 5KFRA 2DR9A 3PX0A 3EPGA 4KLJA 1BPXA 9ICCA 3RTVA 3EYZA 5J0PA 4YMOA 2VANA 4E7XA 5DEDA 4RWNA 5HHHA 4MF8A 4QWEA 1NK9A 4M9HA 3PNCA 5KT4A 9ICVA 1JXLA 4M6WB 1NK4A 4DSFA 3NTUA 3KHHA 3M9OB 5J0XA 2ZUDA 2AGPA 4G3IA 4B9VA 4I2GA 1MIYA 9ICJA 4ELTA 3WFSC 4QZHA 2FPLA 4PGXA 4ECTA 1TK0A 4P2HA 2JZBB 5DQIA 3IM1A 5IILA 7ICHA 1B22A 2VA3A 2KTQA 1C7YA 3GIKA 3OHBA 7ICNA 2KP7A 4F4ZA 1QLNA 1QTMA 4YMMA 4LZDA 4O5KA 5DECA 3PMNA 4UB2A 4EZ9A 4KLDA 4ZH4A 3KTQA 1Q78A 4UD4A 2P6RA 4I2IA 1BPZA 4I29A 4KLOA 5DDMA 2BCRA 7ICRA 1Q79A 1WCNA 4YXJA 2XGQA 5KG4A 1NK7A 2W9BA 1D8YA 4X5VA 4X4UA 4O3PA 1ZQVA 9ICTA 1TK5A 5DB9A 2J6SA 2PI4A 3GV8B 4X4PA 1BPBA 5J2HA 2XCPA 2BCVA 9ICMA 3Q8RB 8ICTA 1LV5A 5L9XA 1UEVA 4GC6A 3K4GA 4HYKA 3V7JA 2XY5A 3RH4A 2BPGA 3RB3A 1ZJMA 4Q45A 4RQ1A 4TUPA 2AQ0A 4J9LA 2PFPA 3WFRE 3RAXA 4GXJA 1NOMA 1K1QA 2FLLA 4GC7A 1S10A 4J9KA 4BDPA 1S77D 2PFOA 3NYBA 4QW8A 2NRZA 1ZQXA 3FYHA 4EYHB 5J0WA 5L1KA 1ZQWA 4RWPA 9ICIA 3BQ0A 2BCSA 4AT8B 4RNMA 3IHQB 5J0UA 3K75D 2V4RA 1KTQA 5KG3A 4WC0A 9ICAA 1ZQZA 4GLXA 3M8SA 2DR5A 2HVHA 4ECUA 3H37A 3PW7A 4FBTA 3TFRA 4KLTA 3AQNA 1S0VA 4IG8A 3OVBA 3MFIA 4NY8A 4Q44A 4FHXA 4XUSA 8ICGA 4ED3A 5J0TA 3H8JA 4YN4A 4LT6A 4QZ8A 5KG2A 3UXNA 8ICKA 4QZDA 3RJKA 4C8NA 3V6KA 5KFYA 4Z6EA 3RJHA 2Q66A 4ECWA 9ICOA 4IQWA 5KFLA 5CHGA 3KHGA 2W9CA 4DFPA 2BQRA 1ZQDA 2FMQA 1NO5A 9ICWA 1TFRA 3GV5B 4IR1A 4RNNA 4X0AA 1JMSA 5HRGA 4F92B 3M9MB 4KLHA 8ICRA 4DSEA 2C2EA 9ICRA 1U49A 2IA6A 2UVVA 1ZYQA 2BCUA 1S0MA 4UBCA 1D9FA 3TQ1A 3RRGA 3MABA 2W9AA 4XA5A 2ALZA 1F5AA 1UEUA 3H38A 2HVIA 4EBKA 3OJUA 3OJSA 3LDAA 3Q8SB 5CR0A 3EZ5A 1ZQRA 4TURA 2AQ4A 4YR0A 5KFMA 4IRCA 1KEJA 2FLPA 5KFTA 9ICGA 4ATBA 2ZTCA 2F1JA 2MUTB 5DBBA 1SZPA 4I2FA 2MAXA 3QZ8A 5DBCA 1U4BA 4YG2A 1NZPA 3THVA 4JWMA 2ZTDA 2ZJ8A 1ZQFA 2HHWA 4WBYA 4R63A 4J9OA 4UQGA 1BNPA 2HHPA 3BQTA 4F93B 4RWOA 4KLMA 5KG1A 4KN4A 1RYSA 3ZDEA 4M9JA 1NK0A 2FMSA 2ZH3A 1ZQBA 2H5XA 5KFBA 2HHTA 4F5OA 4IQUA 2R8IA 4RWQA 5KT5A 1SL1A 2ZHBA 5D49A 1NK6A 2HHQA 2UVUA 4GXKA 4RU9A 4NM2A 3HPOA 3RAQA 3OSPA 3MR2A 1BPEA 4ELUA 1DK2A 2DVIA 1XO1A 4FHYA 3G6XA 3V6HA 1YLQA 2ZH8A 2Y1IA 1JQRA 2DPIA 1CEZA 5L1JA 4AT9A 4F4KA 1ZQJA 1TFWA 4RPYA 4QWAA 4DOCA 9ICFA 5JUMA 1A76A 1JX4A 2XCAA 4F4XA 3MGIA 1WOTA 4O0IA 3RJGA 2O1PA 3RJFA 7ICGA 1XU4A 1ZETA 3N97B 1RXWA 3TFSA 1MQ2A 4DL7A 1ZQLA 1Z00A 5EWGA 5IIOA 5J2IA 2FPKA 4ECXA 4B9TA 1PX5A 3UPSA 3LK9A 1WCLA 1UT8A 2FMPA 2V9WA 3OV7A 3GFKB 7ICEA 3GQCA 2R8JA 4I2HA 1MIWA 8ICVA 2ISOA 4LVSA 3MR3A 2B21A 5KFIA 2C22A 1XS9D 3JPRA 1X9MA 1ZQSA 2ID1A 4QZFA 2J6UA 3ETLA 3OHAA 2PXIA 4DQRA 5DQHA 4GXIA 1R8CA 3LWLA 2JZBA 2FLNA 4PH5A 2BDPA 1PZNA 1MQ3A
chains in the Genus database with same CATH superfamily
5J2KA 3BDPA 3L5KA 1EXNA 3Q8PB 1PK1A 4K4GA 1VDVA 2KMDA 5CA7A 4NLKA 4RQ0A 1K5OA 5ALLA 3MGVA 5KTQA 1DK3A 3QEBZ 2M2WA 4B9LA 2HHXA 1O08A 5BPCA 3ED5A 2HN1A 1RXVA 4WBZA 4K98A 3F5EA 2NYVA 1XSPA 4JV0A 4K97A 1OXJA 3C1ZA 4FO1A 2OHFA 2NV3A 3MBYA 8ICMA 1XWLA 7ICFA 2PMZF 3H7IA 2ZUCA 3LVVA 5KT3A 2R18A 2BBHA 5IIJA 5AKEA 1BPDA 5JTIA 3T3FA 2KHQA 1S9FA 3M7DA 4C8OA 3TACB 1JN3A 1B43A 5HHIA 4X4VA 4KLIA 1RZTA 3WK9A 5J2BA 4CRXA 7ICIA 4E8FA 2IOHA 2W8KA 4ED8A 4ED0A 3GIJA 8ICUA 3ER9B 2DRBA 2AJQA 5HRFA 3BZCA 3BJYA 3OSNA 4F5QA 4BXOA 3RRHA 4RQ8A 4J9MA 1S76D 2E1FA 3AQKA 3SMVA 4JK1A 1K1SA 1Q3UA 2AGQA 5T14A 4JV1A 2K8CB 1ZQAA 5CB1A 5AK4A 4DOAA 2NRVA 4DQSA 4MF2A 5AK3A 4UAZA 2DRAA 4PHAA 4I2EA 3C5GA 1ZQPA 4O3RA 4RQNA 4PGQA 3DDHA 4UASA 2G07A 5F2VO 1SL0A 1ZQYA 4IRKA 2R8GA 2L5YA 2KNJA 2OXOA 1D9DA 2WF5A 3Q8QB 1NKCA 5HRHA 1L5UA 2F1HA 4C8KA 4O3QA 5F9NA 2BGWA 1S0OA 2E8MA 5KFVA 4YXMA 5AIAA 5DG8A 5J2JA 1WUDA 1J2MA 3UXPA 3IN5A 1DRGA 4P4OA 4O68A 3M9NB 5HR6A 2ZUBA 2H3FA 3TAQA 3RH6A 3MDCA 2KFZA 1JAJA 3JYYA 2YTUA 4AT9B 4J9NA 1SKSA 1PVRA 4MFFA 1NJWA 5JU5A 4EELA 5ALWA 3AQFA 3WKAA 2XC9A 1X2IA 2BPFA 4R8UA 2JGAA 5J0SA 3DV9A 1Z00B 3T5LA 2ATLA 3OWGA 4RQ6A 4AYBF 4F4WA 2KZZA 2BE3A 2FJ6A 4DSKA 3N4MB 4NM1A 3PMLA 2B51A 3WK8A 4J9PA 5HRLA 4F71A 4DS5A 2KFNA 4J03A 2KJ9A 1ZQ1C 2KZ3A 3ISDA 3KFUF 3QE9Y 5KG6A 5DLGA 2VKQA 3GV7B 4O5EA 1PK1B 1XC9A 1TAMA 1FFUA 3QU4A 4TQSA 4MEXA 4USAA 4DFDA 3T5KA 1X9WA 3SV4A 2KD1A 3QU2A 2RDJA 5KFCA 5KFJA 3JPPA 5J0QA 2JEIA 1KDHA 5F3XB 4NKUA 5B5EU 3GDXA 3WFPA 3PSIA 2ZIXA 5AK6A 3QZ7A 2C28A 4DLGA 3C2LA 2ZTEA 4KN7A 5J2GA 3SR6A 2OH2A 1KQQA 4X4OA 2PFNA 1V97A 5CWRA 2WB1F 2IMWP 4JWNA 3NVYA 4Q43A 5AHXA 1ZQEA 3SD7A 4Y2YA 4AYBC 3T5HA 4TUSA 4YMNA 4XJEA 4PZNA 5DB7A 4NL9A 4OAGA 4BXOB 4B9MA 4O9MA 1JXEA 8ICYA 2FPMA 5ALFA 4DL3A 1UETA 1SV4A 5IINA 3C21A 4M2YA 3C23A 3FM9A 1SB3C 4QIWF 2R8KA 5D62A 2W55A 3MR5A 2H3VA 4FZNA 4M04A 8ICAA 2EH9A 5KT7A 1S0NA 5KT6A 1NJZA 4K9BA 5J0RA 1T3NA 3AQLA 4UB3A 4MFCA 2KE7A 1QSLA 3ZDBA 5KFDA 5AIBA 9ICQA 4EEKA 4RT3A 3AQMA 2ISPA 2NRTA 1MC8A 4FFDA 1KL9A 4ECSA 5E79U 4QZCA 3LYSA 2PFQA 4CGZA 2P6UA 4OCZA 2I6XA 4RNOA 4FHPA 1T8EA 3QEAZ 4P0PA 1QSSA 1NNLA 3PHZA 1RQNA 4R66A 5KFRA 1FIQA 2DR9A 3F2DA 5KL8B 3PSFA 4YMOA 5HHHA 4B6JA 9ICVA 4DSFA 4Y2PA 5J0XA 2ZUDA 4B9VA 9ICJA 4ELTA 4QZHA 1QQ6A 4LEVA 4P2HA 3IM1A 3SENA 2KTQA 1RG6A 1B4FA 4NLBA 4LZDA 2K4IA 2QLTA 5DECA 1SGGA 4ZH4A 1BPZA 5KNIA 4YXJA 5KG4A 1NK7A 1D8YA 4X5VA 3GV8B 1FFVA 2LPEA 1BPBA 2XCPA 1Q46A 1UEVA 3ETRA 4HYKA 2BPGA 1ZJMA 5D61A 2WF7A 3RAXA 4GXJA 1NOMA 4GC7A 1S77D 4J9KA 3IRUA 3FYHA 3N7RC 1ZQWA 1FO4A 3BQ0A 2KG5A 3M8SA 3PW7A 2G06A 1WWUA 2HMXA 4LEWA 3N28A 1OW5A 4UB8U 3MFIA 4Q44A 4XUSA 4JLXA 4ED3A 5KG2A 3UXNA 4QZDA 2Y0SC 4Z6EA 4PL2A 2ZIXB 5CHGA 3NS1A 4IR1A 4X0AA 2QKQA 2W11A 3WKCA 4KLHA 2KV2A 1U49A 2IA6A 1ZYQA 1S0MA 3RRGA 1D9FA 1M6YA 2W9AA 2CXYA 2KVCA 3E58A 3EZ5A 3Q8SB 4TURA 3NUQA 5B3PA 2QARA 1KEJA 2FLPA 4ATBA 1UHUA 2ZTCA 2K89A 1SZPA 2MAXA 1NZPA 2YQEA 3THVA 2HHWA 4WBYA 3KBBA 4UQGA 1FEZA 4NWIA 4Y2JA 4NLCA 4F93B 1RYSA 4M9JA 2W3SA 2ZH3A 1NK0A 3LVWA 5AI5A 3GZFA 2ZHBA 2HHQA 4GXKA 3OSPA 3RAQA 3M6ZA 3MR2A 2DVIA 4OJ5A 2ZH8A 3UMBA 2Y1IA 1JQRA 1SV0C 4F4KA 1TFWA 4RPYA 4QWAA 9ICFA 3K1ZA 4NXWA 4OJLA 3RJGA 3CYMA 1XU4A 1KLNA 1PX5A 2FPKA 1WCLA 3OV7A 1Q8KA 3I76A 5D63A 3GQCA 4I2HA 1MIWA 3MR3A 2HBMA 4QZFA 3OHAA 4DQRA 3WK6A 3CK6A 3SI8A 4UAYA 2RDIA 2WF6A 4P0PB 4WC6A 1ZRMA 4YD2A 3H4BA 4EZ6A 2Q0ZX 1F44A 4F5NA 4UAWA 2ES6A 2IHOA 4KLSA 1DOQA 4LZGA 3Q8MA 1ZJNA 4YD1A 5ALIA 2OCEA 4WOYA 4X0BA 4K4IA 2XGPA 4M9NA 1IXRA 2F2AB 2HHUA 9ICEA 4YR2A 3V6JA 3HT3A 2RLTA 2K8BB 2W43A 3H0LB 2M2TA 3MDAA 4BWMA 5DB6A 5KFQA 2QB0A 2GA9D 3H40A 5IIKA 4M9GA 2ZH4A 3EPIA 3ICXA 2UVWA 1ZQUA 2CN1A 4J9QA 4DFMA 1NK5A 4XRHA 2JXJA 1TKDA 4XQ7A 3SAFA 2F76X 3BS7A 5HMMA 2WTFA 9ICNA 4DFJA 3RB0A 5AKXA 3FAHA 4J9SA 4O6AA 1N5WA 3QUQA 4ECZA 3RJIA 4BJQA 1KBUA 4ED1A 4QWBA 3M8RA 4ECRA 4EBCA 1RYRA 1ZQTA 4M5DA 3ZDAA 1U48A 1T7PA 3V7KA 2WHEA 3AU2A 3QUTA 5KFAA 4PHDA 3B0YA 5HRKA 5ALEA 5KFSA 4ICAA 1L3SA 1T3QA 2QB1A 2ASJA 3T79A 3AN1A 5D46A 4IC9A 3HJ4A 5DDYA 4UB1A 3TI0A 2BR0A 2QARB 2RP5A 4ATBB 3PW2A 4YCXA 4QNLA 4DSLA 1L8LA 3BZKA 1D8BA 2NRWA 3G6YA 4ED6A 3OGUA 3HW8A 1NJYA 1Y88A 5AKLA 1S5LU 3KOOA 4B9NA 2NRKA 2DWQA 1KFDA 1SKWA 1WYGA 5AM3A 9ICSA 2C2RA 1ZQHA 2MRLA 3RBDA 4I2CA 1BVSA 4QW9A 4O5CA 2ZH9A 2Z7JA 2E5SA 4FZMA 4JUZA 2O5AA 3RBEA 3D2NA 4EEBA 3KHLA 3TARA 2IOFA 3HWTA 1N5XA 4IQTA 3H8SA 7ICMA 5JTGA 3MGHA 1TFYA 4NKTA 3I1YA 1X42A 7ICSA 3NVVA 3F2BA 3C1YA 1N60A 5A0LA 2V4QA 1TV9A 5EE3A 3JPQA 1ZQQA 4EX6A 2AU0A 3VCBA 4EBEA 5DGAA 3C5FA 5B3QA 5TZVA 3T5JA 1UA1A 2ZXHA 4U7CA 2LYBA 1SL2A 2NRXA 4FS1A 4I2AA 4X4SA 4UD5A 2Y9TA 4IRDA 4KLQA 4C4SA 4Z6FA 2M2UA 4CF5A 5J0OA 2DFLA 3F2CA 2GLEA 3PSPA 4E0DA 4P0QA 1TVAA 4NLZA 3GILA 3Q8KA 4Z6DA 4GFJA 2VJ4A 3EUB2 3IG8A 2QB0B 2ZIVA 1Q3VA 1F0MA 1RPLA 3K7DA 3AMZA 1L6NA 3RH5A 4PPXA 4WQLA 2HSZA 2Q4TA 4EV6A 4EP7A 2ZJAA 3QX7A 5J2CA 5KFWA 1UA0A 5HRBA 5CHEA 4AP9A 1L7NA 2K4EA 1TE2A 2BQUA 2C2DA 2I9GA 3PW5A 2P66A 2KKPA 3S6JA 5KG7A 4KX5A 3QU9A 4YR3A 3G6VA 3CP8A 3EW9A 4FH5A 3ORYA 2PMZC 8ICBA 3IDWA 3AQEA 3Q8LA 8ICWA 4DQPA 2AGOA 3CRXA 9ICLA 1CUKA 4DLEA 2KOBA 2HOQA 1X66A 4FZLA 3ZD8A 3UXOA 4NXZA 4QWCA 5F9LA 2XY7A 3NVOA 5KAFU 4BX9C 2M9NA 3PO5A 3RR7A 3JCFA 2EANA 4FBUA 4US8A 4DWIA 4F5RA 2KJ5A 2G09A 4P4PA 2KIWA 4KLUA 2W9MA 5ALHA 4KLJA 5J0PA 4E7XA 5DEDA 4RWNA 1NK9A 4M9HA 2YMMA 3NTUA 4I2GA 3WFSC 5AI9A 2A19A 5AM2A 1TK0A 2JZBB 5DQIA 7ICHA 1JROA 4NL9C 2VA3A 2EZZA 7ICNA 2HBJA 1QLNA 4NJ8A 2H3IA 2D6FC 4NXTA 4O5KA 4UB2A 2F8KA 5ALNA 3KTQA 1Q78A 3ZI4A 4I2IA 2CRXA 2OM6A 5DDMA 3J81j 1Q79A 2XGQA 2W9BA 1X6IA 1PK3A 4ACOA 1DGJA 9ICTA 1TK5A 2PI4A 9ICMA 3Q8RB 1KKXA 4GC6A 2XY5A 2ZIUA 4RQ1A 3HKZF 4JB3A 2PFPA 2FLLA 2PFOA 4QW8A 1ZQXA 4OJ6A 5J0WA 5L1KA 2BCSA 5AKKA 1KTQA 5KG3A 4WC0A 1B0XA 4ECUA 2E3TA 4FBTA 3N7SC 4KLTA 5ALDA 8ICGA 3OTQA 4OAFA 3H8JA 3VC8A 3B9JA 3F53A 5AI8A 3V6KA 5KFYA 2KKVA 4IQWA 4DFPA 2FMQA 2OYYA 4P0QB 4RNNA 4Y2VA 3M9MB 2NO5A 4CF4A 4DSEA 2C2EA 2ZIVB 2UVVA 1UEUA 3MABA 4PZOA 1IIPA 1YZ6A 1KN5A 2RHFA 3LDAA 1X9XA 2AQ4A 4YR0A 4IRCA 1O03A 1UPHA 2F1JA 3QZ8A 3NWIA 1S8OA 4JWMA 2ZTDA 5ALKA 4R63A 4KLMA 5KG1A 3ZDEA 1ZQBA 2H5XA 2RRDA 4IQUA 1NK6A 2UVUA 4RU9A 5TISU 1BPEA 4ELUA 1A0PA 1RM6C 5AKYA 2LI6A 2VJ5A 1N62A 1JX4A 2XCAA 4O3MA 4O0IA 2O1PA 3RJFA 5ALPA 2WB1C 3N97B 1ZETA 3TFSA 1MQ2A 4EEDA 5IIOA 3UPSA 2FMPA 1SXDA 8ICVA 4LVSA 2B21A 5KFIA 1ZQSA 1X9MA 2ID1A 5AM4A 2PXIA 4GXIA 1R8CA 2LHTA 3PNCA 2BDPA 1PZNA 4O67A 4F50A 5HC9A 3QUBA 1FA0A 2IUBA 3UQ0A 1CI4A 4KLGA 1JALA 4R8UB 3AUOA 1Z3EB 1KRPA 4QIWC 3ZDDA 4Y2SA 4RPXA 2WAQF 4LEZA 2ASLA 7ICOA 4DO9A 3HX0A 2EAPA 3M6KA 4PGYA 2ZH7A 3KHRA 2F8LA 1ZQNA 3D2SA 2P35A 4RQ3A 3ZD9A 4DL6A 4R65A 5BOLA 1V9PA 2YB4A 2K8AA 5EE9A 4UB4A 1NJXA 3L9DA 2JH7A 3RJJA 3WFQE 3RB4A 4K4HA 4WC2A 1Z1VA 4E80A 5KFUA 1KW4A 2W9BB 3LQCB 4RQ2A 4NXUA 1MA7A 2EDUA 5ALSA 4UBBA 4I27A 3PV8A 1ZQMA 1LVHA 2BBJA 1JI7A 4DEZA 2VA2A 2ZH1A 2ZIUB 3B0XA 4O3SA 3ISCA 4EBKA 5KFNA 4OAIZ 3OVSA 1AROP 5DLFA 4GIBA 1CRXA 3WK4A 4O3NA 4US9A 5HRDA 3WK5A 1UQVA 5CEHA 2O6KA 4DFKA 4BGDA 2JH1A 2MU2A 1NI3A 3PY8A 1JIHA 5G5GA 5HR7A 9ICHA 1OUQA 3R9KA 4RZRA 1ZQIA 1S97A 4F2SA 5ALTA 4EBDA 3HILA 4I2DA 2IBKA 1HUZA 4XQ8A 1MIVA 1A6SA 3HJ1A 5KFGA 4WC3A 5DBAA 8ICIA 1WWVA 3ONNA 4Q8FA 3CNHA 4UB5A 7ICTA 2R8HA 2PBEA 5KFOA 5AM5A 5ALYA 2F1IA 8ICHA 5KFFA 5KG5A 5EE0A 3QU5A 4CCHA 5ALMA 2B4VA 1U47A 3EF2A 2LM1A 1QCKA 2JEFA 2DUYA 1Z4NA 9ICBA 4CDGA 2HW3A 2W04A 7ICPA 1SKRA 5IIIA 3NGDA 3IG5A 1R8AA 3UPQA 2MSNA 7ICVA 1ZRNA 4I2BA 4M6WA 4LJXA 1KSPA 8ICJA 2IHNA 4I2JA 1COOA 2Y1JA 1IM4A 5KFHA 2KSOA 3C2MA 4F2RA 1ZQOA 5FP0A 4RQ5A 3C66A 4ED2A 4C8LA 3PVXA 1RYUA 2CPRA 5KAIU 4J9RA 1VJ7A 4DQIA 4K96A 3PW0A 1UCVA 4B9SA 4FE3A 3ALRA 4QWDA 2N1RA 3KD3A 2E8NA 4F72A 4ECVA 4EENA 4C4RA 3SZ2A 4YFKA 3MR6A 4O3OA 4TQRA 3RJEA 4FHVA 2M0NA 2XY6A 2HBKA 1L3UA 5L1LA 2E8OA 2LMRA 5GTIU 2H3QA 1ZQGA 9ICXA 1BPYA 1ZQCA 4DS4A 4DSIA 2XO7A 2EZXA 3ER8C 4DOBA 3EWAA 4DQQA 4NLGA 4EX7A 1VLBA 1N63A 4PL1A 1VJ5A 4M47A 2VA8A 5DG7A 8ICEA 3IP4B 2KZMA 2M2VA 1XO0A 1GPJA 5J8YA 3PW4A 2GAFD 2JEJA 3NKUA 7ICLA 3RB6A 1R89A 1ZQKA 3SV3A 4MFAA 3AL0B 1DGSA 2GO7A 4QZAA 3OPXA 2BKEA 1R8BA 1MN8A 4QZBA 4DSJA 1U45A 8ICCA 2F44A 5KG0A 4IL6U 5J29A 1ZXIA 2YMQA 4FH3A 3H8WA 3PO4A 3C29A 1VFGA 4JLZA 4RQ4A 4WH5A 4RT2A 3MCRA 1X9SA 3UMGA 5ALUA 4RPZA 8ICLA 4ZOHC 4F5PA 1QSYA 5KFXA 3JPSA 5AKGA 4JV2A 1QQ5A 4KMUA 2KICA 5ALOA 4F4YA 1C20A 4DL2A 1Z1BA 1N56A 4IQVA 1XNSA 9ICPA 4KITB 8ICQA 1H38A 3E2EA 1TAUA 3WKDA 2KN7A 8ICPA 2HHVA 2NO4A 1L3VA 3N7PD 1KFSA 5DQGA 1SWWA 3TKAA 1L3TA 4X4QA 2FDRA 3KKAC 5CJ7A 3TANA 4YVZA 3WFOA 2K4HA 3TADA 3EYZA 2FE9A 3UM9A 3NASA 4MF8A 5ALQA 2JV3A 1JXLA 4M6WB 1NK4A 2AHOB 3KHHA 3M9OB 2AGPA 2FPLA 4PGXA 2XVTA 2HBLA 4RQMA 4F4ZA 2KSOB 4UW9A 4EGWA 1YZ7A 4EZ9A 4KLDA 2P6RA 4I29A 4KLOA 2BCRA 1WCNA 4O3PA 3NVZA 1ZQVA 4X4PA 5J2HA 2BCVA 5EE1A 5L9XA 3K4GA 3V7JA 3RB3A 2ZIWA 4TUPA 2AQ0A 4J9LA 3WFRE 4IS7A 1K1QA 5AM1A 1S10A 4BDPA 2YY6A 4EYHB 3I28A 5AK5A 4RNMA 3IHQB 2V4RA 3K75D 1ECWA 9ICAA 2DBYA 3KKAA 4GLXA 2ODGA 4CE6A 3H37A 3NRZA 2A1AA 3AQNA 1S0VA 3F5AA 4KB6A 4NY8A 2W03A 5J0TA 1Z19A 4YN4A 4LT6A 4QZ8A 2G0AA 3RJKA 3SQIA 5JRTA 2W9CA 1ZQDA 2DKZA 1NO5A 1TFRA 3GV5B 1JMSA 5HRGA 3C28A 2D8CA 1Z4OA 4UBCA 2ALZA 3SAHA 1V38A 2DGZA 5CFTA 2VIXA 5CR0A 3NVWA 1ZQRA 4NXVA 2DL0A 5KFTA 5ALJA 2EQYA 2IOFK 5DBCA 4K8VA 2JMGA 3K1RB 2ZJ8A 4HAIA 1JRPA 2HHPA 3WKEA 2GOLA 4KN4A 2FMSA 2HHTA 4F5OA 5AI0A 2ESEA 2R8IA 4RWQA 1SL1A 5D49A 4NM2A 3HPOA 1DK2A 1XO1A 3G6XA 3V6HA 1P7DA 1YLQA 2DPIA 5L1JA 3L3FX 2W7PA 2F77X 5JUMA 1WOTA 4F4XA 4OJPA 2B0CA 5ALRA 1ZQLA 5J2IA 4B9TA 1GO3F 1X6JA 1HEKA 4UARA 2YB1A 1IV8A 2EAOA 1WG8A 1XS9D 3JPRA 4WJ3B 2J6UA 2KK0A 4Y2UA 2FLNA 1MQ3A 4DF8A 3KZIU 5HRIA 2DR7A 1NK8A 5L1IA 4DCCA 5EWFA 2PKEA 4TUQA 3GU3A 1PVQA 2LYHA 2D3DA 4CF3A 1HUOA 3BQ2A 4Y2TA 2BDUA 3JPNA 1A77A 4QZIA 1PUZA 3RFAA 3JPTA 4DL4A 4HX0A 8ICSA 5ALXA 1QQ7A 1KFTA 4DF4A 4B9UA 4KLLA 4N7RA 2HN2A 3L4PA 4ECQA 9ICKA 2ZJ5A 4UAUA 4MKPA 2DR8A 3RF9A 1ED1A 1PVPA 2W8LA 4ED7A 1V4AA 4Y2XA 5KFEA 4C8MA 1L7OA 5HR9A 3MC1A 2F3NA 2GH1A 1URJA 2GWSA 3OVAA 5AM0A 4NLNA 2ZIWB 2B56A 3JZ0A 5J0YA 5J2DA 5D4BA 3HJEA 4FS2A 3BQ1A 1MSWD 8ICFA 3OUYA 4K9AA 3UQ2A 2FCLA 1BNOA 2ZG6A 4MEYA 5K4LA 3H0MB 3QXGA 4ELVA 4FHWA 2K60A 4WC1A 2K4PA 2HHSA 2BHNA 1JUDA 2I1QA 1T4GA 5L1MA 3GIMA 4ECYA 2ZHAA 3NRWA 4R64A 2AXTU 5J2FA 2G5IB 1ZD3A 3IV6A 3V7LA 1UT5A 3HP6A 5KFZA 2W9CB 3H3AA 4Z6CA 4AT7A 2BCQA 2OWOA 3D6JA 2A1JA 2KIVA 2KEYA 2LYAA 5KFKA 3PX6A 3HKZC 5KFPA 4S3NA 1NZBA 1KNYA 4F3OA 4PJ0U 3ERCC 2MA1A 2ZH2A 4I0UA 3H39A 3PSTA 3HIYA 4DL5A 3AU6A 4QZ9A 5DKWA 1LKYA 2E8PA 4WC7A 4RUCA 2EWRA 3LWMA 5AKHA 4OJOA 4NV0A 5AKZA 4IR9A 4EEYA 2JR5A 2G5HB 3V72A 5AI4A 7ICKA 2Y9UA 4FO6A 4WC5A 5CP2A 1X40A 5IIMA 4WC4A 3CW2C 1XSNA 2Y0SF 3C18A 3C2KA 4UB6U 4QZGA 7ICJA 2IHMA 2AH5A 5AKIA 2BZFA 3DEEA 5C0YA 1BGXT 2HOFA 5KL1B 2DPJA 2PI5A 3PR5B 4M0AA 2ZH5A 1U9LA 1YT3A 5HMLA 5ALZA 5AI6A 3JPOA 2RFFA 1XSLA 2YMPA 1NKEA 1ZD2P 4YP3A 4AT8A 1N61A 3PR4A 3MFHA 1NKBA 5G5HA 3M1YA 4WQKA 3SYZA 7ICQA 3TAPA 4C0ZA 1SZHA 5KT2A 7ICUA 3PX4A 4LEYA 1L8OA 9ICUA 3HRDD 5BOMA 1ZOLA 5DGBA 4KTQA 4I28A 1HIWA 4P4MA 2B6GA 2I5HA 4QZEA 4G9BA 5HP4A 4Q8EA 4U6PA 4EYIB 4KM5A 1N2XA 4UAVA 4A8EA 2ZXIA 2W7OA 2DKXA 1HJPA 1RDFA 4KLEA 5EWEA 2BQ3A 5J2AA 8ICXA 1AQ6A 2A3VA 1F5SA 2RQ5A 2MUTA 5DB8A 1COKA 2WAQC 4F8RA 2J6TA 4MHVA 3OUYB 5J2EA 4KMOB 3ISBA 4OAHA 3PZPA 3H0RB 2BPCA 1N48A 3QU7A 4PHPA 5ALVA 2JHDA 2W54A 1SXEA 2DF4B 4KLFA 4BWJA 3ZDCA 1QH9A 3GIIA 4X4TA 2H3ZA 1TK8A 3A0HU 3BS5A 2JEGA 5ALGA 3O0FA 4C80A 2HOIA 4EBJA 5H2FU 1TAQA 1OU5A 4X4RA 1LB2B 3H4DA 4X4NA 3SEIA 1J97A 2KJ8A 5DG9A 2ZH6A 5HREA 2HI0A 3FDSA 2DQNB 4AT7B 4RUAA 8ICZA 5EOZA 2A1JB 4PHEA 2FI1A 4F91B 4K99A 3AEVA 2HDOA 5HNKA 2ASDA 5C5JA 2UVRA 3RR8A 4YQWA 2EZYA 4M9LA 4KX3A 2KHVA 3H8MA 5J8YC 4BUGA 4RQ7A 8ICOA 1ZD4A 8ICNA 2JRZA 1D8LA 3PX0A 3WU2U 3QUCA 3EPGA 1BPXA 9ICCA 3RTVA 2LM4A 5AICA 3WKBA 1LKYB 2VANA 3QNMA 4QWEA 2EAMA 5KT4A 4G3IA 1MIYA 4NXXA 3BQ7A 4ECTA 1B22A 5IILA 1C7YA 3GIKA 3OHBA 2KP7A 4Y2RA 4C7YA 1QTMA 2E1EA 4YMMA 3PMNA 4O69A 5CFSA 2YN4A 4UD4A 7ICRA 4OD0A 1RQLA 4X4UA 2J6SA 5DB9A 2YMLA 2W3RA 8ICTA 2XI9A 1LV5A 3RH4A 5GTHU 2YX8A 5AKJA 4Q45A 1T94A 3UMCA 3NYBA 1SV0A 2NRZA 4C4TA 4RWPA 9ICIA 4AT8B 5J0UA 1J2NA 1ZQZA 2DR5A 2HVHA 3TFRA 4IG8A 3SAGA 3OVBA 2G08A 4FHXA 5B66U 3AM9A 1V85A 8ICKA 2WF9A 3KZXA 4C8NA 3RJHA 1IG6A 2Q66A 4ECWA 3TADC 9ICOA 5KFLA 3KHGA 2BQRA 1L7PA 9ICWA 3FC4A 4F92B 1L7MA 3A0BU 8ICRA 9ICRA 2BCUA 3TQ1A 4WCWA 3D2QA 3H38A 4XA5A 1F5AA 4UATA 4JMUA 2HVIA 3OJUA 4C7ZA 3OJSA 3QYPA 5KFMA 2LKYA 2HCFA 9ICGA 2MUTB 5DBBA 2LBOA 4I2FA 1U4BA 4YG2A 1ZQFA 4J9OA 1BNPA 1DXSA 3BQTA 4RWOA 4QJFB 5CFUA 5KFBA 1ZD5A 4Y2QA 5KT5A 3BS5B 2WFAA 4FHYA 2WF8A 3U26A 1SWVA 1CEZA 4AT9A 1ZQJA 2XICA 3WK7A 4DOCA 1A76A 3MGIA 2OEHA 3E0FA 7ICGA 1RXWA 4DL7A 1Z00A 2KVSA 5EWGA 4ECXA 3LK9A 1UT8A 2XIDA 2V9WA 3GFKB 7ICEA 5CRXA 2R8JA 2ISOA 4CNQA 2C22A 4OO1J 3ETLA 5DQHA 3LWLA 2JZBA 4PH5A 1SIJA
chains in the Genus database with same CATH topology
4F50A 5J2KA 4DF8A 5HC9A 5HRIA 3SI8A 1NK8A 3BDPA 1FA0A 5L1IA 4UAYA 2DR7A 1EXNA 2RDIA 3Q8PB 5EWFA 3UQ0A 4K4GA 4WC6A 4TUQA 4KLGA 4R8UB 5CA7A 1Z3EB 4YD2A 3AUOA 4NLKA 3H4BA 4EZ6A 4RQ0A 2Q0ZX 1KRPA 3ZDDA 2LYHA 5KTQA 3QEBZ 1DK3A 2M2WA 4RPXA 4F5NA 4UAWA 1HUOA 4B9LA 2HHXA 3BQ2A 2ASLA 5BPCA 1RXVA 4WBZA 4KLSA 1DOQA 1XSPA 4JV0A 3JPNA 4LZGA 7ICOA 3C1ZA 4DO9A 1A77A 3HX0A 3Q8MA 4PGYA 4QZIA 1ZJNA 4YD1A 3JPTA 2ZH7A 4DL4A 3KHRA 4X0BA 3MBYA 8ICMA 1ZQNA 1XWLA 1KLNA 4K4IA 7ICFA 2XGPA 8ICSA 1KFTA 4DF4A 4M9NA 4RQ3A 3ZD9A 4DL6A 4R65A 4B9UA 3H7IA 5BOLA 1IXRA 1V9PA 4KLLA 2ZUCA 5KT3A 2HHUA 9ICEA 4YR2A 4UB4A 5IIJA 3V6JA 3HT3A 4ECQA 9ICKA 2ZJ5A 2M2TA 1BPDA 1NJXA 3MDAA 3L9DA 3RJJA 3WFQE 2DR8A 3RB4A 4K4HA 4WC2A 4BWMA 3T3FA 5DB6A 2W8LA 1S9FA 4C8OA 4E80A 5KFUA 1JN3A 5KFQA 2W9BB 4ED7A 1B43A 5HHIA 3H40A 4RQ2A 3LQCB 4X4VA 4KLIA 1V4AA 5IIKA 4M9GA 2ZH4A 3EPIA 5J2BA 1RZTA 7ICIA 5KFEA 4C8MA 4UBBA 4E8FA 4I27A 2W8KA 5HR9A 4ED8A 3PV8A 2UVWA 1ZQUA 1ZQMA 4ED0A 3GIJA 4J9QA 4DEZA 2VA2A 8ICUA 2ZH1A 2DRBA 2GWSA 4DFMA 2AJQA 3OVAA 1NK5A 4XRHA 4NLNA 3B0XA 1TKDA 5HRFA 4O3SA 3JZ0A 4XQ7A 5J0YA 5J2DA 5D4BA 3ISCA 5HMMA 2WTFA 5KFNA 3OSNA 3BJYA 1AROP 4FS2A 3BQ1A 1MSWD 4F5QA 8ICFA 9ICNA 3OVSA 3OUYA 5DLFA 3UQ2A 4BXOA 4O3NA 4DFJA 3RB0A 1BNOA 3RRHA 4MEYA 4RQ8A 5HRDA 4J9MA 1S76D 4ELVA 4J9SA 4FHWA 4DFKA 4BGDA 3AQKA 4WC1A 2HHSA 3PY8A 2BHNA 4ECZA 1JIHA 4JK1A 9ICHA 1K1SA 2I1QA 1T4GA 3GIMA 2AGQA 4ECYA 2ZHAA 4RZRA 1ZQIA 4JV1A 1ZQAA 3RJIA 5CB1A 4R64A 1S97A 4F2SA 5J2FA 4EBDA 3V7LA 4ED1A 4QWBA 4DOAA 1UT5A 4I2DA 3HP6A 2NRVA 5KFZA 3M8RA 2W9CB 4ECRA 4EBCA 4DQSA 1RYRA 4MF2A 1ZQTA 2IBKA 4M5DA 3ZDAA 1HUZA 4UAZA 1U48A 1T7PA 4XQ8A 3V7KA 4Z6CA 1MIVA 4PHAA 4I2EA 4AT7A 2DRAA 2BCQA 3AU2A 2OWOA 3C5GA 1ZQPA 5KFAA 4O3RA 3HJ1A 4PGQA 5KFGA 3B0YA 4PHDA 5HRKA 4WC3A 5KFSA 5DBAA 8ICIA 2A1JA 5F2VO 1L3SA 1SL0A 1ZQYA 4IRKA 5KFKA 2R8GA 4Q8FA 4UB5A 7ICTA 3PX6A 2ASJA 5D46A 2R8HA 1D9DA 2PBEA 5KFOA 3HJ4A 2F1IA 5DDYA 4UB1A 3Q8QB 8ICHA 5KFPA 5KFFA 3TI0A 2BR0A 5KG5A 4S3NA 1NKCA 4ATBB 5HRHA 3PW2A 1KNYA 4F3OA 4YCXA 4CCHA 1L5UA 1U47A 2F1HA 4C8KA 4O3QA 2JEFA 5F9NA 4DSLA 2BGWA 2ZH2A 1S0OA 9ICBA 2HW3A 5KFVA 4YXMA 5DG8A 5J2JA 3H39A 7ICPA 2NRWA 1SKRA 3HIYA 3G6YA 4DL5A 5IIIA 3AU6A 3UXPA 4ED6A 4QZ9A 3OGUA 4P4OA 3NGDA 3HW8A 1NJYA 1Y88A 5DKWA 3UPQA 3M9NB 1R8AA 2ZUBA 4B9NA 4WC7A 2NRKA 7ICVA 4RUCA 3TAQA 3LWMA 1KFDA 3RH6A 3MDCA 1SKWA 4I2BA 2KFZA 1JAJA 4M6WA 9ICSA 2C2RA 1ZQHA 1KSPA 8ICJA 3JYYA 3RBDA 4AT9B 4I2CA 2IHNA 4J9NA 4IR9A 4EEYA 1SKSA 4I2JA 1BVSA 1COOA 1IM4A 4QW9A 2Y1JA 7ICKA 3V72A 5KFHA 4MFFA 1NJWA 4O5CA 2ZH9A 4FO6A 4WC5A 5CP2A 3C2MA 4F2RA 4JUZA 2XC9A 1ZQOA 1X2IA 2O5AA 5IIMA 2BPFA 4R8UA 4WC4A 3T5LA 5J0SA 4RQ5A 1Z00B 3RBEA 2ATLA 1XSNA 3C66A 4RQ6A 4ED2A 3KHLA 4F4WA 4C8LA 3PVXA 3TARA 2KZZA 3C2KA 3C18A 2BE3A 4J9RA 4QZGA 3HWTA 3N4MB 4DQIA 4DSKA 2IHMA 7ICJA 1VJ7A 3PW0A 4NM1A 4IQTA 3H3AA 4B9SA 3PMLA 3H8SA 7ICMA 4QWDA 4J9PA 3MGHA 1TFYA 5HRLA 4DS5A 4ECVA 4NKTA 2KFNA 7ICSA 3SZ2A 4YFKA 1BGXT 3MR6A 2KZ3A 4WCWA 3ISDA 2PI5A 2DPJA 3C1YA 3PR5B 4M0AA 3QE9Y 2ZH5A 1U9LA 4O3OA 5KG6A 5DLGA 4TQRA 5HMLA 3GV7B 3RJEA 4FHVA 4O5EA 3JPOA 2RFFA 2V4QA 2XY6A 1XSLA 1TV9A 1XC9A 1L3UA 5L1LA 1NKEA 3JPQA 1ZQQA 4TQSA 4MEXA 4YP3A 4AT8A 2AU0A 4EBEA 3PR4A 3MFHA 5DGAA 1NKBA 3C5FA 3T5KA 1ZQGA 9ICXA 1X9WA 5TZVA 3T5JA 1UA1A 1BPYA 3SV4A 1ZQCA 3SYZA 4DS4A 2RDJA 4DSIA 7ICQA 5KFCA 3TAPA 1SL2A 2NRXA 5KT2A 4FS1A 4I2AA 7ICUA 5KFJA 2XO7A 3PX4A 3JPPA 4X4SA 5J0QA 9ICUA 4UD5A 2JEIA 1KDHA 4IRDA 4DOBA 3EWAA 4NKUA 4DQQA 5BOMA 3GDXA 4NLGA 5DGBA 4KLQA 3WFPA 4KTQA 4I28A 4Z6FA 2M2UA 5J0OA 4P4MA 2DFLA 3QZ7A 2C28A 4DLGA 3C2LA 4E0DA 2ZTEA 4QZEA 1TVAA 4M47A 4KN7A 3GILA 5J2GA 2VA8A 5DG7A 3Q8KA 4NLZA 4Z6DA 8ICEA 5HP4A 4Q8EA 2KZMA 2M2VA 4X4OA 2PFNA 4EYIB 3PW4A 1HJPA 1RPLA 5CWRA 2IMWP 2JEJA 4KLEA 3RH5A 5EWEA 4PPXA 4JWNA 2BQ3A 7ICLA 5J2AA 4Q43A 3RB6A 8ICXA 4EP7A 1R89A 1ZQKA 2ZJAA 5J2CA 3SV3A 4MFAA 5KFWA 1ZQEA 1UA0A 5HRBA 3T5HA 2MUTA 5DB8A 1DGSA 4TUSA 2BQUA 2C2DA 2I9GA 4F8RA 3PW5A 2J6TA 4YMNA 3OUYB 2P66A 4QZAA 5J2EA 2BKEA 5DB7A 3ISBA 1R8BA 5KG7A 2BPCA 4BXOB 4QZBA 1N48A 4PHPA 4DSJA 4B9MA 1U45A 1JXEA 4O9MA 8ICCA 8ICYA 2FPMA 5KG0A 4YR3A 3G6VA 4DL3A 1UETA 5J29A 5IINA 3EW9A 4KLFA 4FH5A 3ORYA 4BWJA 3ZDCA 3H8WA 4FH3A 3C21A 8ICBA 3GIIA 4X4TA 4M2YA 3C23A 3Q8LA 1TK8A 2JEGA 8ICWA 3PO4A 1VFGA 4DQPA 4RQ4A 2AGOA 2R8KA 4EBJA 9ICLA 4RT2A 1TAQA 1CUKA 1X9SA 1OU5A 4X4RA 4DLEA 3MR5A 3H4DA 1LB2B 4RPZA 4X4NA 5DG9A 8ICLA 2ZH6A 4M04A 5HREA 4F5PA 1QSYA 5KFXA 3JPSA 3ZD8A 4JV2A 8ICAA 3FDSA 4AT7B 3UXOA 5KT7A 1S0NA 4RUAA 5KT6A 1NJZA 4NXZA 4KMUA 5J0RA 1T3NA 8ICZA 3AQLA 4UB3A 4QWCA 4MFCA 5F9LA 4F4YA 5EOZA 2A1JB 2XY7A 4PHEA 4F91B 4DL2A 1QSLA 1N56A 5KFDA 3ZDBA 9ICQA 4IQVA 4RT3A 5HNKA 9ICPA 3AQMA 4KITB 8ICQA 2M9NA 2ASDA 2ISPA 3RR7A 5C5JA 1H38A 2UVRA 2NRTA 3PO5A 2KN7A 1MC8A 3RR8A 3E2EA 2HHVA 1TAUA 4FBUA 1L3VA 8ICPA 4YQWA 4DWIA 1KFSA 4ECSA 4F5RA 5DQGA 4QZCA 2PFQA 4M9LA 1L3TA 2P6UA 4P4PA 4RNOA 4FHPA 4KLUA 1T8EA 4X4QA 5CJ7A 2W9MA 3TANA 4RQ7A 4YVZA 3QEAZ 1QSSA 8ICOA 3WFOA 8ICNA 4R66A 1D8LA 5KFRA 2DR9A 3PX0A 3EPGA 4KLJA 1BPXA 9ICCA 3RTVA 3EYZA 5J0PA 4YMOA 2VANA 4E7XA 5DEDA 4RWNA 5HHHA 4MF8A 4QWEA 1NK9A 4M9HA 3PNCA 5KT4A 9ICVA 1JXLA 4M6WB 1NK4A 4DSFA 3NTUA 3KHHA 3M9OB 5J0XA 2ZUDA 2AGPA 4G3IA 4B9VA 4I2GA 1MIYA 9ICJA 4ELTA 3WFSC 4QZHA 2FPLA 4PGXA 4ECTA 1TK0A 4P2HA 2JZBB 5DQIA 3IM1A 5IILA 7ICHA 1B22A 2VA3A 2KTQA 1C7YA 3GIKA 3OHBA 7ICNA 2KP7A 4F4ZA 1QLNA 1QTMA 4YMMA 4LZDA 4O5KA 5DECA 3PMNA 4UB2A 4EZ9A 4KLDA 4ZH4A 3KTQA 1Q78A 4UD4A 2P6RA 4I2IA 1BPZA 4I29A 4KLOA 5DDMA 2BCRA 7ICRA 1Q79A 1WCNA 4YXJA 2XGQA 5KG4A 1NK7A 2W9BA 1D8YA 4X5VA 4X4UA 4O3PA 1ZQVA 9ICTA 1TK5A 5DB9A 2J6SA 2PI4A 3GV8B 4X4PA 1BPBA 5J2HA 2XCPA 2BCVA 9ICMA 3Q8RB 8ICTA 1LV5A 5L9XA 1UEVA 4GC6A 3K4GA 4HYKA 3V7JA 2XY5A 3RH4A 2BPGA 3RB3A 1ZJMA 4Q45A 4RQ1A 4TUPA 2AQ0A 4J9LA 2PFPA 3WFRE 3RAXA 4GXJA 1NOMA 1K1QA 2FLLA 4GC7A 1S10A 4J9KA 4BDPA 1S77D 2PFOA 3NYBA 4QW8A 2NRZA 1ZQXA 3FYHA 4EYHB 5J0WA 5L1KA 1ZQWA 4RWPA 9ICIA 3BQ0A 2BCSA 4AT8B 4RNMA 3IHQB 5J0UA 3K75D 2V4RA 1KTQA 5KG3A 4WC0A 9ICAA 1ZQZA 4GLXA 3M8SA 2DR5A 2HVHA 4ECUA 3H37A 3PW7A 4FBTA 3TFRA 4KLTA 3AQNA 1S0VA 4IG8A 3OVBA 3MFIA 4NY8A 4Q44A 4FHXA 4XUSA 8ICGA 4ED3A 5J0TA 3H8JA 4YN4A 4LT6A 4QZ8A 5KG2A 3UXNA 8ICKA 4QZDA 3RJKA 4C8NA 3V6KA 5KFYA 4Z6EA 3RJHA 2Q66A 4ECWA 9ICOA 4IQWA 5KFLA 5CHGA 3KHGA 2W9CA 4DFPA 2BQRA 1ZQDA 2FMQA 1NO5A 9ICWA 1TFRA 3GV5B 4IR1A 4RNNA 4X0AA 1JMSA 5HRGA 4F92B 3M9MB 4KLHA 8ICRA 4DSEA 2C2EA 9ICRA 1U49A 2IA6A 2UVVA 1ZYQA 2BCUA 1S0MA 4UBCA 1D9FA 3TQ1A 3RRGA 3MABA 2W9AA 4XA5A 2ALZA 1F5AA 1UEUA 3H38A 2HVIA 4EBKA 3OJUA 3OJSA 3LDAA 3Q8SB 5CR0A 3EZ5A 1ZQRA 4TURA 2AQ4A 4YR0A 5KFMA 4IRCA 1KEJA 2FLPA 5KFTA 9ICGA 4ATBA 2ZTCA 2F1JA 2MUTB 5DBBA 1SZPA 4I2FA 2MAXA 3QZ8A 5DBCA 1U4BA 4YG2A 1NZPA 3THVA 4JWMA 2ZTDA 2ZJ8A 1ZQFA 2HHWA 4WBYA 4R63A 4J9OA 4UQGA 1BNPA 2HHPA 3BQTA 4F93B 4RWOA 4KLMA 5KG1A 4KN4A 1RYSA 3ZDEA 4M9JA 1NK0A 2FMSA 2ZH3A 1ZQBA 2H5XA 5KFBA 2HHTA 4F5OA 4IQUA 2R8IA 4RWQA 5KT5A 1SL1A 2ZHBA 5D49A 1NK6A 2HHQA 2UVUA 4GXKA 4RU9A 4NM2A 3HPOA 3RAQA 3OSPA 3MR2A 1BPEA 4ELUA 1DK2A 2DVIA 1XO1A 4FHYA 3G6XA 3V6HA 1YLQA 2ZH8A 2Y1IA 1JQRA 2DPIA 1CEZA 5L1JA 4AT9A 4F4KA 1ZQJA 1TFWA 4RPYA 4QWAA 4DOCA 9ICFA 5JUMA 1A76A 1JX4A 2XCAA 4F4XA 3MGIA 1WOTA 4O0IA 3RJGA 2O1PA 3RJFA 7ICGA 1XU4A 1ZETA 3N97B 1RXWA 3TFSA 1MQ2A 4DL7A 1ZQLA 1Z00A 5EWGA 5IIOA 5J2IA 2FPKA 4ECXA 4B9TA 1PX5A 3UPSA 3LK9A 1WCLA 1UT8A 2FMPA 2V9WA 3OV7A 3GFKB 7ICEA 3GQCA 2R8JA 4I2HA 1MIWA 8ICVA 2ISOA 4LVSA 3MR3A 2B21A 5KFIA 2C22A 1XS9D 3JPRA 1X9MA 1ZQSA 2ID1A 4QZFA 2J6UA 3ETLA 3OHAA 2PXIA 4DQRA 5DQHA 4GXIA 1R8CA 3LWLA 2JZBA 2FLNA 4PH5A 2BDPA 1PZNA 1MQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F50 A;  5J2K A;  4DF8 A;  5HC9 A;  5HRI A;  3SI8 A;  1NK8 A;  3BDP A;  1FA0 A;  5L1I A;  4UAY A;  2DR7 A;  1EXN A;  2RDI A;  3Q8P B;  5EWF A;  3UQ0 A;  4K4G A;  4WC6 A;  4TUQ A;  4KLG A;  4R8U B;  5CA7 A;  1Z3E B;  4YD2 A;  3AUO A;  4NLK A;  3H4B A;  4EZ6 A;  4RQ0 A;  2Q0Z X;  1KRP A;  3ZDD A;  2LYH A;  5KTQ A;  3QEB Z;  1DK3 A;  2M2W A;  4RPX A;  4F5N A;  4UAW A;  1HUO A;  4B9L A;  2HHX A;  3BQ2 A;  2ASL A;  5BPC A;  1RXV A;  4WBZ A;  4KLS A;  1DOQ A;  1XSP A;  4JV0 A;  3JPN A;  4LZG A;  7ICO A;  3C1Z A;  4DO9 A;  1A77 A;  3HX0 A;  3Q8M A;  4PGY A;  4QZI A;  1ZJN A;  4YD1 A;  3JPT A;  2ZH7 A;  4DL4 A;  3KHR A;  4X0B A;  3MBY A;  8ICM A;  1ZQN A;  1XWL A;  1KLN A;  4K4I A;  7ICF A;  2XGP A;  8ICS A;  1KFT A;  4DF4 A;  4M9N A;  4RQ3 A;  3ZD9 A;  4DL6 A;  4R65 A;  4B9U A;  3H7I A;  5BOL A;  1IXR A;  1V9P A;  4KLL A;  2ZUC A;  5KT3 A;  2HHU A;  9ICE A;  4YR2 A;  4UB4 A;  5IIJ A;  3V6J A;  3HT3 A;  4ECQ A;  9ICK A;  2ZJ5 A;  2M2T A;  1BPD A;  1NJX A;  3MDA A;  3L9D A;  3RJJ A;  3WFQ E;  2DR8 A;  3RB4 A;  4K4H A;  4WC2 A;  4BWM A;  3T3F A;  5DB6 A;  2W8L A;  1S9F A;  4C8O A;  4E80 A;  5KFU A;  1JN3 A;  5KFQ A;  2W9B B;  4ED7 A;  1B43 A;  5HHI A;  3H40 A;  4RQ2 A;  3LQC B;  4X4V A;  4KLI A;  1V4A A;  5IIK A;  4M9G A;  2ZH4 A;  3EPI A;  5J2B A;  1RZT A;  7ICI A;  5KFE A;  4C8M A;  4UBB A;  4E8F A;  4I27 A;  2W8K A;  5HR9 A;  4ED8 A;  3PV8 A;  2UVW A;  1ZQU A;  1ZQM A;  4ED0 A;  3GIJ A;  4J9Q A;  4DEZ A;  2VA2 A;  8ICU A;  2ZH1 A;  2DRB A;  2GWS A;  4DFM A;  2AJQ A;  3OVA A;  1NK5 A;  4XRH A;  4NLN A;  3B0X A;  1TKD A;  5HRF A;  4O3S A;  3JZ0 A;  4XQ7 A;  5J0Y A;  5J2D A;  5D4B A;  3ISC A;  5HMM A;  2WTF A;  5KFN A;  3OSN A;  3BJY A;  1ARO P;  4FS2 A;  3BQ1 A;  1MSW D;  4F5Q A;  8ICF A;  9ICN A;  3OVS A;  3OUY A;  5DLF A;  3UQ2 A;  4BXO A;  4O3N A;  4DFJ A;  3RB0 A;  1BNO A;  3RRH A;  4MEY A;  4RQ8 A;  5HRD A;  4J9M A;  1S76 D;  4ELV A;  4J9S A;  4FHW A;  4DFK A;  4BGD A;  3AQK A;  4WC1 A;  2HHS A;  3PY8 A;  2BHN A;  4ECZ A;  1JIH A;  4JK1 A;  9ICH A;  1K1S A;  2I1Q A;  1T4G A;  3GIM A;  2AGQ A;  4ECY A;  2ZHA A;  4RZR A;  1ZQI A;  4JV1 A;  1ZQA A;  3RJI A;  5CB1 A;  4R64 A;  1S97 A;  4F2S A;  5J2F A;  4EBD A;  3V7L A;  4ED1 A;  4QWB A;  4DOA A;  1UT5 A;  4I2D A;  3HP6 A;  2NRV A;  5KFZ A;  3M8R A;  2W9C B;  4ECR A;  4EBC A;  4DQS A;  1RYR A;  4MF2 A;  1ZQT A;  2IBK A;  4M5D A;  3ZDA A;  1HUZ A;  4UAZ A;  1U48 A;  1T7P A;  4XQ8 A;  3V7K A;  4Z6C A;  1MIV A;  4PHA A;  4I2E A;  4AT7 A;  2DRA A;  2BCQ A;  3AU2 A;  2OWO A;  3C5G A;  1ZQP A;  5KFA A;  4O3R A;  3HJ1 A;  4PGQ A;  5KFG A;  3B0Y A;  4PHD A;  5HRK A;  4WC3 A;  5KFS A;  5DBA A;  8ICI A;  2A1J A;  5F2V O;  1L3S A;  1SL0 A;  1ZQY A;  4IRK A;  5KFK A;  2R8G A;  4Q8F A;  4UB5 A;  7ICT A;  3PX6 A;  2ASJ A;  5D46 A;  2R8H A;  1D9D A;  2PBE A;  5KFO A;  3HJ4 A;  2F1I A;  5DDY A;  4UB1 A;  3Q8Q B;  8ICH A;  5KFP A;  5KFF A;  3TI0 A;  2BR0 A;  5KG5 A;  4S3N A;  1NKC A;  4ATB B;  5HRH A;  3PW2 A;  1KNY A;  4F3O A;  4YCX A;  4CCH A;  1L5U A;  1U47 A;  2F1H A;  4C8K A;  4O3Q A;  2JEF A;  5F9N A;  4DSL A;  2BGW A;  2ZH2 A;  1S0O A;  9ICB A;  2HW3 A;  5KFV A;  4YXM A;  5DG8 A;  5J2J A;  3H39 A;  7ICP A;  2NRW A;  1SKR A;  3HIY A;  3G6Y A;  4DL5 A;  5III A;  3AU6 A;  3UXP A;  4ED6 A;  4QZ9 A;  3OGU A;  4P4O A;  3NGD A;  3HW8 A;  1NJY A;  1Y88 A;  5DKW A;  3UPQ A;  3M9N B;  1R8A A;  2ZUB A;  4B9N A;  4WC7 A;  2NRK A;  7ICV A;  4RUC A;  3TAQ A;  3LWM A;  1KFD A;  3RH6 A;  3MDC A;  1SKW A;  4I2B A;  2KFZ A;  1JAJ A;  4M6W A;  9ICS A;  2C2R A;  1ZQH A;  1KSP A;  8ICJ A;  3JYY A;  3RBD A;  4AT9 B;  4I2C A;  2IHN A;  4J9N A;  4IR9 A;  4EEY A;  1SKS A;  4I2J A;  1BVS A;  1COO A;  1IM4 A;  4QW9 A;  2Y1J A;  7ICK A;  3V72 A;  5KFH A;  4MFF A;  1NJW A;  4O5C A;  2ZH9 A;  4FO6 A;  4WC5 A;  5CP2 A;  3C2M A;  4F2R A;  4JUZ A;  2XC9 A;  1ZQO A;  1X2I A;  2O5A A;  5IIM A;  2BPF A;  4R8U A;  4WC4 A;  3T5L A;  5J0S A;  4RQ5 A;  1Z00 B;  3RBE A;  2ATL A;  1XSN A;  3C66 A;  4RQ6 A;  4ED2 A;  3KHL A;  4F4W A;  4C8L A;  3PVX A;  3TAR A;  2KZZ A;  3C2K A;  3C18 A;  2BE3 A;  4J9R A;  4QZG A;  3HWT A;  3N4M B;  4DQI A;  4DSK A;  2IHM A;  7ICJ A;  1VJ7 A;  3PW0 A;  4NM1 A;  4IQT A;  3H3A A;  4B9S A;  3PML A;  3H8S A;  7ICM A;  4QWD A;  4J9P A;  3MGH A;  1TFY A;  5HRL A;  4DS5 A;  4ECV A;  4NKT A;  2KFN A;  7ICS A;  3SZ2 A;  4YFK A;  1BGX T;  3MR6 A;  2KZ3 A;  4WCW A;  3ISD A;  2PI5 A;  2DPJ A;  3C1Y A;  3PR5 B;  4M0A A;  3QE9 Y;  2ZH5 A;  1U9L A;  4O3O A;  5KG6 A;  5DLG A;  4TQR A;  5HML A;  3GV7 B;  3RJE A;  4FHV A;  4O5E A;  3JPO A;  2RFF A;  2V4Q A;  2XY6 A;  1XSL A;  1TV9 A;  1XC9 A;  1L3U A;  5L1L A;  1NKE A;  3JPQ A;  1ZQQ A;  4TQS A;  4MEX A;  4YP3 A;  4AT8 A;  2AU0 A;  4EBE A;  3PR4 A;  3MFH A;  5DGA A;  1NKB A;  3C5F A;  3T5K A;  1ZQG A;  9ICX A;  1X9W A;  5TZV A;  3T5J A;  1UA1 A;  1BPY A;  3SV4 A;  1ZQC A;  3SYZ A;  4DS4 A;  2RDJ A;  4DSI A;  7ICQ A;  5KFC A;  3TAP A;  1SL2 A;  2NRX A;  5KT2 A;  4FS1 A;  4I2A A;  7ICU A;  5KFJ A;  2XO7 A;  3PX4 A;  3JPP A;  4X4S A;  5J0Q A;  9ICU A;  4UD5 A;  2JEI A;  1KDH A;  4IRD A;  4DOB A;  3EWA A;  4NKU A;  4DQQ A;  5BOM A;  3GDX A;  4NLG A;  5DGB A;  4KLQ A;  3WFP A;  4KTQ A;  4I28 A;  4Z6F A;  2M2U A;  5J0O A;  4P4M A;  2DFL A;  3QZ7 A;  2C28 A;  4DLG A;  3C2L A;  4E0D A;  2ZTE A;  4QZE A;  1TVA A;  4M47 A;  4KN7 A;  3GIL A;  5J2G A;  2VA8 A;  5DG7 A;  3Q8K A;  4NLZ A;  4Z6D A;  8ICE A;  5HP4 A;  4Q8E A;  2KZM A;  2M2V A;  4X4O A;  2PFN A;  4EYI B;  3PW4 A;  1HJP A;  1RPL A;  5CWR A;  2IMW P;  2JEJ A;  4KLE A;  3RH5 A;  5EWE A;  4PPX A;  4JWN A;  2BQ3 A;  7ICL A;  5J2A A;  4Q43 A;  3RB6 A;  8ICX A;  4EP7 A;  1R89 A;  1ZQK A;  2ZJA A;  5J2C A;  3SV3 A;  4MFA A;  5KFW A;  1ZQE A;  1UA0 A;  5HRB A;  3T5H A;  2MUT A;  5DB8 A;  1DGS A;  4TUS A;  2BQU A;  2C2D A;  2I9G A;  4F8R A;  3PW5 A;  2J6T A;  4YMN A;  3OUY B;  2P66 A;  4QZA A;  5J2E A;  2BKE A;  5DB7 A;  3ISB A;  1R8B A;  5KG7 A;  2BPC A;  4BXO B;  4QZB A;  1N48 A;  4PHP A;  4DSJ A;  4B9M A;  1U45 A;  1JXE A;  4O9M A;  8ICC A;  8ICY A;  2FPM A;  5KG0 A;  4YR3 A;  3G6V A;  4DL3 A;  1UET A;  5J29 A;  5IIN A;  3EW9 A;  4KLF A;  4FH5 A;  3ORY A;  4BWJ A;  3ZDC A;  3H8W A;  4FH3 A;  3C21 A;  8ICB A;  3GII A;  4X4T A;  4M2Y A;  3C23 A;  3Q8L A;  1TK8 A;  2JEG A;  8ICW A;  3PO4 A;  1VFG A;  4DQP A;  4RQ4 A;  2AGO A;  2R8K A;  4EBJ A;  9ICL A;  4RT2 A;  1TAQ A;  1CUK A;  1X9S A;  1OU5 A;  4X4R A;  4DLE A;  3MR5 A;  3H4D A;  1LB2 B;  4RPZ A;  4X4N A;  5DG9 A;  8ICL A;  2ZH6 A;  4M04 A;  5HRE A;  4F5P A;  1QSY A;  5KFX A;  3JPS A;  3ZD8 A;  4JV2 A;  8ICA A;  3FDS A;  4AT7 B;  3UXO A;  5KT7 A;  1S0N A;  4RUA A;  5KT6 A;  1NJZ A;  4NXZ A;  4KMU A;  5J0R A;  1T3N A;  8ICZ A;  3AQL A;  4UB3 A;  4QWC A;  4MFC A;  5F9L A;  4F4Y A;  5EOZ A;  2A1J B;  2XY7 A;  4PHE A;  4F91 B;  4DL2 A;  1QSL A;  1N56 A;  5KFD A;  3ZDB A;  9ICQ A;  4IQV A;  4RT3 A;  5HNK A;  9ICP A;  3AQM A;  4KIT B;  8ICQ A;  2M9N A;  2ASD A;  2ISP A;  3RR7 A;  5C5J A;  1H38 A;  2UVR A;  2NRT A;  3PO5 A;  2KN7 A;  1MC8 A;  3RR8 A;  3E2E A;  2HHV A;  1TAU A;  4FBU A;  1L3V A;  8ICP A;  4YQW A;  4DWI A;  1KFS A;  4ECS A;  4F5R A;  5DQG A;  4QZC A;  2PFQ A;  4M9L A;  1L3T A;  2P6U A;  4P4P A;  4RNO A;  4FHP A;  4KLU A;  1T8E A;  4X4Q A;  5CJ7 A;  2W9M A;  3TAN A;  4RQ7 A;  4YVZ A;  3QEA Z;  1QSS A;  8ICO A;  3WFO A;  8ICN A;  4R66 A;  1D8L A;  5KFR A;  2DR9 A;  3PX0 A;  3EPG A;  4KLJ A;  1BPX A;  9ICC A;  3RTV A;  3EYZ A;  5J0P A;  4YMO A;  2VAN A;  4E7X A;  5DED A;  4RWN A;  5HHH A;  4MF8 A;  4QWE A;  1NK9 A;  4M9H A;  3PNC A;  5KT4 A;  9ICV A;  1JXL A;  4M6W B;  1NK4 A;  4DSF A;  3NTU A;  3KHH A;  3M9O B;  5J0X A;  2ZUD A;  2AGP A;  4G3I A;  4B9V A;  4I2G A;  1MIY A;  9ICJ A;  4ELT A;  3WFS C;  4QZH A;  2FPL A;  4PGX A;  4ECT A;  1TK0 A;  4P2H A;  2JZB B;  5DQI A;  3IM1 A;  5IIL A;  7ICH A;  1B22 A;  2VA3 A;  2KTQ A;  1C7Y A;  3GIK A;  3OHB A;  7ICN A;  2KP7 A;  4F4Z A;  1QLN A;  1QTM A;  4YMM A;  4LZD A;  4O5K A;  5DEC A;  3PMN A;  4UB2 A;  4EZ9 A;  4KLD A;  4ZH4 A;  3KTQ A;  1Q78 A;  4UD4 A;  2P6R A;  4I2I A;  1BPZ A;  4I29 A;  4KLO A;  5DDM A;  2BCR A;  7ICR A;  1Q79 A;  1WCN A;  4YXJ A;  2XGQ A;  5KG4 A;  1NK7 A;  2W9B A;  1D8Y A;  4X5V A;  4X4U A;  4O3P A;  1ZQV A;  9ICT A;  1TK5 A;  5DB9 A;  2J6S A;  2PI4 A;  3GV8 B;  4X4P A;  1BPB A;  5J2H A;  2XCP A;  2BCV A;  9ICM A;  3Q8R B;  8ICT A;  1LV5 A;  5L9X A;  1UEV A;  4GC6 A;  3K4G A;  4HYK A;  3V7J A;  2XY5 A;  3RH4 A;  2BPG A;  3RB3 A;  1ZJM A;  4Q45 A;  4RQ1 A;  4TUP A;  2AQ0 A;  4J9L A;  2PFP A;  3WFR E;  3RAX A;  4GXJ A;  1NOM A;  1K1Q A;  2FLL A;  4GC7 A;  1S10 A;  4J9K A;  4BDP A;  1S77 D;  2PFO A;  3NYB A;  4QW8 A;  2NRZ A;  1ZQX A;  3FYH A;  4EYH B;  5J0W A;  5L1K A;  1ZQW A;  4RWP A;  9ICI A;  3BQ0 A;  2BCS A;  4AT8 B;  4RNM A;  3IHQ B;  5J0U A;  3K75 D;  2V4R A;  1KTQ A;  5KG3 A;  4WC0 A;  9ICA A;  1ZQZ A;  4GLX A;  3M8S A;  2DR5 A;  2HVH A;  4ECU A;  3H37 A;  3PW7 A;  4FBT A;  3TFR A;  4KLT A;  3AQN A;  1S0V A;  4IG8 A;  3OVB A;  3MFI A;  4NY8 A;  4Q44 A;  4FHX A;  4XUS A;  8ICG A;  4ED3 A;  5J0T A;  3H8J A;  4YN4 A;  4LT6 A;  4QZ8 A;  5KG2 A;  3UXN A;  8ICK A;  4QZD A;  3RJK A;  4C8N A;  3V6K A;  5KFY A;  4Z6E A;  3RJH A;  2Q66 A;  4ECW A;  9ICO A;  4IQW A;  5KFL A;  5CHG A;  3KHG A;  2W9C A;  4DFP A;  2BQR A;  1ZQD A;  2FMQ A;  1NO5 A;  9ICW A;  1TFR A;  3GV5 B;  4IR1 A;  4RNN A;  4X0A A;  1JMS A;  5HRG A;  4F92 B;  3M9M B;  4KLH A;  8ICR A;  4DSE A;  2C2E A;  9ICR A;  1U49 A;  2IA6 A;  2UVV A;  1ZYQ A;  2BCU A;  1S0M A;  4UBC A;  1D9F A;  3TQ1 A;  3RRG A;  3MAB A;  2W9A A;  4XA5 A;  2ALZ A;  1F5A A;  1UEU A;  3H38 A;  2HVI A;  4EBK A;  3OJU A;  3OJS A;  3LDA A;  3Q8S B;  5CR0 A;  3EZ5 A;  1ZQR A;  4TUR A;  2AQ4 A;  4YR0 A;  5KFM A;  4IRC A;  1KEJ A;  2FLP A;  5KFT A;  9ICG A;  4ATB A;  2ZTC A;  2F1J A;  2MUT B;  5DBB A;  1SZP A;  4I2F A;  2MAX A;  3QZ8 A;  5DBC A;  1U4B A;  4YG2 A;  1NZP A;  3THV A;  4JWM A;  2ZTD A;  2ZJ8 A;  1ZQF A;  2HHW A;  4WBY A;  4R63 A;  4J9O A;  4UQG A;  1BNP A;  2HHP A;  3BQT A;  4F93 B;  4RWO A;  4KLM A;  5KG1 A;  4KN4 A;  1RYS A;  3ZDE A;  4M9J A;  1NK0 A;  2FMS A;  2ZH3 A;  1ZQB A;  2H5X A;  5KFB A;  2HHT A;  4F5O A;  4IQU A;  2R8I A;  4RWQ A;  5KT5 A;  1SL1 A;  2ZHB A;  5D49 A;  1NK6 A;  2HHQ A;  2UVU A;  4GXK A;  4RU9 A;  4NM2 A;  3HPO A;  3RAQ A;  3OSP A;  3MR2 A;  1BPE A;  4ELU A;  1DK2 A;  2DVI A;  1XO1 A;  4FHY A;  3G6X A;  3V6H A;  1YLQ A;  2ZH8 A;  2Y1I A;  1JQR A;  2DPI A;  1CEZ A;  5L1J A;  4AT9 A;  4F4K A;  1ZQJ A;  1TFW A;  4RPY A;  4QWA A;  4DOC A;  9ICF A;  5JUM A;  1A76 A;  1JX4 A;  2XCA A;  4F4X A;  3MGI A;  1WOT A;  4O0I A;  3RJG A;  2O1P A;  3RJF A;  7ICG A;  1XU4 A;  1ZET A;  3N97 B;  1RXW A;  3TFS A;  1MQ2 A;  4DL7 A;  1ZQL A;  1Z00 A;  5EWG A;  5IIO A;  5J2I A;  2FPK A;  4ECX A;  4B9T A;  1PX5 A;  3UPS A;  3LK9 A;  1WCL A;  1UT8 A;  2FMP A;  2V9W A;  3OV7 A;  3GFK B;  7ICE A;  3GQC A;  2R8J A;  4I2H A;  1MIW A;  8ICV A;  2ISO A;  4LVS A;  3MR3 A;  2B21 A;  5KFI A;  2C22 A;  1XS9 D;  3JPR A;  1X9M A;  1ZQS A;  2ID1 A;  4QZF A;  2J6U A;  3ETL A;  3OHA A;  2PXI A;  4DQR A;  5DQH A;  4GXI A;  1R8C A;  3LWL A;  2JZB A;  2FLN A;  4PH5 A;  2BDP A;  1PZN A;  1MQ3 A; 
#chains in the Genus database with same CATH topology
 5J2K A;  3BDP A;  3L5K A;  1EXN A;  3Q8P B;  1PK1 A;  4K4G A;  1VDV A;  2KMD A;  5CA7 A;  4NLK A;  4RQ0 A;  1K5O A;  5ALL A;  3MGV A;  5KTQ A;  1DK3 A;  3QEB Z;  2M2W A;  4B9L A;  2HHX A;  1O08 A;  5BPC A;  3ED5 A;  2HN1 A;  1RXV A;  4WBZ A;  4K98 A;  3F5E A;  2NYV A;  1XSP A;  4JV0 A;  4K97 A;  1OXJ A;  3C1Z A;  4FO1 A;  2OHF A;  2NV3 A;  3MBY A;  8ICM A;  1XWL A;  7ICF A;  2PMZ F;  3H7I A;  2ZUC A;  3LVV A;  5KT3 A;  2R18 A;  2BBH A;  5IIJ A;  5AKE A;  1BPD A;  5JTI A;  3T3F A;  2KHQ A;  1S9F A;  3M7D A;  4C8O A;  3TAC B;  1JN3 A;  1B43 A;  5HHI A;  4X4V A;  4KLI A;  1RZT A;  3WK9 A;  5J2B A;  4CRX A;  7ICI A;  4E8F A;  2IOH A;  2W8K A;  4ED8 A;  4ED0 A;  3GIJ A;  8ICU A;  3ER9 B;  2DRB A;  2AJQ A;  5HRF A;  3BZC A;  3BJY A;  3OSN A;  4F5Q A;  4BXO A;  3RRH A;  4RQ8 A;  4J9M A;  1S76 D;  2E1F A;  3AQK A;  3SMV A;  4JK1 A;  1K1S A;  1Q3U A;  2AGQ A;  5T14 A;  4JV1 A;  2K8C B;  1ZQA A;  5CB1 A;  5AK4 A;  4DOA A;  2NRV A;  4DQS A;  4MF2 A;  5AK3 A;  4UAZ A;  2DRA A;  4PHA A;  4I2E A;  3C5G A;  1ZQP A;  4O3R A;  4RQN A;  4PGQ A;  3DDH A;  4UAS A;  2G07 A;  5F2V O;  1SL0 A;  1ZQY A;  4IRK A;  2R8G A;  2L5Y A;  2KNJ A;  2OXO A;  1D9D A;  2WF5 A;  3Q8Q B;  1NKC A;  5HRH A;  1L5U A;  2F1H A;  4C8K A;  4O3Q A;  5F9N A;  2BGW A;  1S0O A;  2E8M A;  5KFV A;  4YXM A;  5AIA A;  5DG8 A;  5J2J A;  1WUD A;  1J2M A;  3UXP A;  3IN5 A;  1DRG A;  4P4O A;  4O68 A;  3M9N B;  5HR6 A;  2ZUB A;  2H3F A;  3TAQ A;  3RH6 A;  3MDC A;  2KFZ A;  1JAJ A;  3JYY A;  2YTU A;  4AT9 B;  4J9N A;  1SKS A;  1PVR A;  4MFF A;  1NJW A;  5JU5 A;  4EEL A;  5ALW A;  3AQF A;  3WKA A;  2XC9 A;  1X2I A;  2BPF A;  4R8U A;  2JGA A;  5J0S A;  3DV9 A;  1Z00 B;  3T5L A;  2ATL A;  3OWG A;  4RQ6 A;  4AYB F;  4F4W A;  2KZZ A;  2BE3 A;  2FJ6 A;  4DSK A;  3N4M B;  4NM1 A;  3PML A;  2B51 A;  3WK8 A;  4J9P A;  5HRL A;  4F71 A;  4DS5 A;  2KFN A;  4J03 A;  2KJ9 A;  1ZQ1 C;  2KZ3 A;  3ISD A;  3KFU F;  3QE9 Y;  5KG6 A;  5DLG A;  2VKQ A;  3GV7 B;  4O5E A;  1PK1 B;  1XC9 A;  1TAM A;  1FFU A;  3QU4 A;  4TQS A;  4MEX A;  4USA A;  4DFD A;  3T5K A;  1X9W A;  3SV4 A;  2KD1 A;  3QU2 A;  2RDJ A;  5KFC A;  5KFJ A;  3JPP A;  5J0Q A;  2JEI A;  1KDH A;  5F3X B;  4NKU A;  5B5E U;  3GDX A;  3WFP A;  3PSI A;  2ZIX A;  5AK6 A;  3QZ7 A;  2C28 A;  4DLG A;  3C2L A;  2ZTE A;  4KN7 A;  5J2G A;  3SR6 A;  2OH2 A;  1KQQ A;  4X4O A;  2PFN A;  1V97 A;  5CWR A;  2WB1 F;  2IMW P;  4JWN A;  3NVY A;  4Q43 A;  5AHX A;  1ZQE A;  3SD7 A;  4Y2Y A;  4AYB C;  3T5H A;  4TUS A;  4YMN A;  4XJE A;  4PZN A;  5DB7 A;  4NL9 A;  4OAG A;  4BXO B;  4B9M A;  4O9M A;  1JXE A;  8ICY A;  2FPM A;  5ALF A;  4DL3 A;  1UET A;  1SV4 A;  5IIN A;  3C21 A;  4M2Y A;  3C23 A;  3FM9 A;  1SB3 C;  4QIW F;  2R8K A;  5D62 A;  2W55 A;  3MR5 A;  2H3V A;  4FZN A;  4M04 A;  8ICA A;  2EH9 A;  5KT7 A;  1S0N A;  5KT6 A;  1NJZ A;  4K9B A;  5J0R A;  1T3N A;  3AQL A;  4UB3 A;  4MFC A;  2KE7 A;  1QSL A;  3ZDB A;  5KFD A;  5AIB A;  9ICQ A;  4EEK A;  4RT3 A;  3AQM A;  2ISP A;  2NRT A;  1MC8 A;  4FFD A;  1KL9 A;  4ECS A;  5E79 U;  4QZC A;  3LYS A;  2PFQ A;  4CGZ A;  2P6U A;  4OCZ A;  2I6X A;  4RNO A;  4FHP A;  1T8E A;  3QEA Z;  4P0P A;  1QSS A;  1NNL A;  3PHZ A;  1RQN A;  4R66 A;  5KFR A;  1FIQ A;  2DR9 A;  3F2D A;  5KL8 B;  3PSF A;  4YMO A;  5HHH A;  4B6J A;  9ICV A;  4DSF A;  4Y2P A;  5J0X A;  2ZUD A;  4B9V A;  9ICJ A;  4ELT A;  4QZH A;  1QQ6 A;  4LEV A;  4P2H A;  3IM1 A;  3SEN A;  2KTQ A;  1RG6 A;  1B4F A;  4NLB A;  4LZD A;  2K4I A;  2QLT A;  5DEC A;  1SGG A;  4ZH4 A;  1BPZ A;  5KNI A;  4YXJ A;  5KG4 A;  1NK7 A;  1D8Y A;  4X5V A;  3GV8 B;  1FFV A;  2LPE A;  1BPB A;  2XCP A;  1Q46 A;  1UEV A;  3ETR A;  4HYK A;  2BPG A;  1ZJM A;  5D61 A;  2WF7 A;  3RAX A;  4GXJ A;  1NOM A;  4GC7 A;  1S77 D;  4J9K A;  3IRU A;  3FYH A;  3N7R C;  1ZQW A;  1FO4 A;  3BQ0 A;  2KG5 A;  3M8S A;  3PW7 A;  2G06 A;  1WWU A;  2HMX A;  4LEW A;  3N28 A;  1OW5 A;  4UB8 U;  3MFI A;  4Q44 A;  4XUS A;  4JLX A;  4ED3 A;  5KG2 A;  3UXN A;  4QZD A;  2Y0S C;  4Z6E A;  4PL2 A;  2ZIX B;  5CHG A;  3NS1 A;  4IR1 A;  4X0A A;  2QKQ A;  2W11 A;  3WKC A;  4KLH A;  2KV2 A;  1U49 A;  2IA6 A;  1ZYQ A;  1S0M A;  3RRG A;  1D9F A;  1M6Y A;  2W9A A;  2CXY A;  2KVC A;  3E58 A;  3EZ5 A;  3Q8S B;  4TUR A;  3NUQ A;  5B3P A;  2QAR A;  1KEJ A;  2FLP A;  4ATB A;  1UHU A;  2ZTC A;  2K89 A;  1SZP A;  2MAX A;  1NZP A;  2YQE A;  3THV A;  2HHW A;  4WBY A;  3KBB A;  4UQG A;  1FEZ A;  4NWI A;  4Y2J A;  4NLC A;  4F93 B;  1RYS A;  4M9J A;  2W3S A;  2ZH3 A;  1NK0 A;  3LVW A;  5AI5 A;  3GZF A;  2ZHB A;  2HHQ A;  4GXK A;  3OSP A;  3RAQ A;  3M6Z A;  3MR2 A;  2DVI A;  4OJ5 A;  2ZH8 A;  3UMB A;  2Y1I A;  1JQR A;  1SV0 C;  4F4K A;  1TFW A;  4RPY A;  4QWA A;  9ICF A;  3K1Z A;  4NXW A;  4OJL A;  3RJG A;  3CYM A;  1XU4 A;  1KLN A;  1PX5 A;  2FPK A;  1WCL A;  3OV7 A;  1Q8K A;  3I76 A;  5D63 A;  3GQC A;  4I2H A;  1MIW A;  3MR3 A;  2HBM A;  4QZF A;  3OHA A;  4DQR A;  3WK6 A;  3CK6 A;  3SI8 A;  4UAY A;  2RDI A;  2WF6 A;  4P0P B;  4WC6 A;  1ZRM A;  4YD2 A;  3H4B A;  4EZ6 A;  2Q0Z X;  1F44 A;  4F5N A;  4UAW A;  2ES6 A;  2IHO A;  4KLS A;  1DOQ A;  4LZG A;  3Q8M A;  1ZJN A;  4YD1 A;  5ALI A;  2OCE A;  4WOY A;  4X0B A;  4K4I A;  2XGP A;  4M9N A;  1IXR A;  2F2A B;  2HHU A;  9ICE A;  4YR2 A;  3V6J A;  3HT3 A;  2RLT A;  2K8B B;  2W43 A;  3H0L B;  2M2T A;  3MDA A;  4BWM A;  5DB6 A;  5KFQ A;  2QB0 A;  2GA9 D;  3H40 A;  5IIK A;  4M9G A;  2ZH4 A;  3EPI A;  3ICX A;  2UVW A;  1ZQU A;  2CN1 A;  4J9Q A;  4DFM A;  1NK5 A;  4XRH A;  2JXJ A;  1TKD A;  4XQ7 A;  3SAF A;  2F76 X;  3BS7 A;  5HMM A;  2WTF A;  9ICN A;  4DFJ A;  3RB0 A;  5AKX A;  3FAH A;  4J9S A;  4O6A A;  1N5W A;  3QUQ A;  4ECZ A;  3RJI A;  4BJQ A;  1KBU A;  4ED1 A;  4QWB A;  3M8R A;  4ECR A;  4EBC A;  1RYR A;  1ZQT A;  4M5D A;  3ZDA A;  1U48 A;  1T7P A;  3V7K A;  2WHE A;  3AU2 A;  3QUT A;  5KFA A;  4PHD A;  3B0Y A;  5HRK A;  5ALE A;  5KFS A;  4ICA A;  1L3S A;  1T3Q A;  2QB1 A;  2ASJ A;  3T79 A;  3AN1 A;  5D46 A;  4IC9 A;  3HJ4 A;  5DDY A;  4UB1 A;  3TI0 A;  2BR0 A;  2QAR B;  2RP5 A;  4ATB B;  3PW2 A;  4YCX A;  4QNL A;  4DSL A;  1L8L A;  3BZK A;  1D8B A;  2NRW A;  3G6Y A;  4ED6 A;  3OGU A;  3HW8 A;  1NJY A;  1Y88 A;  5AKL A;  1S5L U;  3KOO A;  4B9N A;  2NRK A;  2DWQ A;  1KFD A;  1SKW A;  1WYG A;  5AM3 A;  9ICS A;  2C2R A;  1ZQH A;  2MRL A;  3RBD A;  4I2C A;  1BVS A;  4QW9 A;  4O5C A;  2ZH9 A;  2Z7J A;  2E5S A;  4FZM A;  4JUZ A;  2O5A A;  3RBE A;  3D2N A;  4EEB A;  3KHL A;  3TAR A;  2IOF A;  3HWT A;  1N5X A;  4IQT A;  3H8S A;  7ICM A;  5JTG A;  3MGH A;  1TFY A;  4NKT A;  3I1Y A;  1X42 A;  7ICS A;  3NVV A;  3F2B A;  3C1Y A;  1N60 A;  5A0L A;  2V4Q A;  1TV9 A;  5EE3 A;  3JPQ A;  1ZQQ A;  4EX6 A;  2AU0 A;  3VCB A;  4EBE A;  5DGA A;  3C5F A;  5B3Q A;  5TZV A;  3T5J A;  1UA1 A;  2ZXH A;  4U7C A;  2LYB A;  1SL2 A;  2NRX A;  4FS1 A;  4I2A A;  4X4S A;  4UD5 A;  2Y9T A;  4IRD A;  4KLQ A;  4C4S A;  4Z6F A;  2M2U A;  4CF5 A;  5J0O A;  2DFL A;  3F2C A;  2GLE A;  3PSP A;  4E0D A;  4P0Q A;  1TVA A;  4NLZ A;  3GIL A;  3Q8K A;  4Z6D A;  4GFJ A;  2VJ4 A;  3EUB 2;  3IG8 A;  2QB0 B;  2ZIV A;  1Q3V A;  1F0M A;  1RPL A;  3K7D A;  3AMZ A;  1L6N A;  3RH5 A;  4PPX A;  4WQL A;  2HSZ A;  2Q4T A;  4EV6 A;  4EP7 A;  2ZJA A;  3QX7 A;  5J2C A;  5KFW A;  1UA0 A;  5HRB A;  5CHE A;  4AP9 A;  1L7N A;  2K4E A;  1TE2 A;  2BQU A;  2C2D A;  2I9G A;  3PW5 A;  2P66 A;  2KKP A;  3S6J A;  5KG7 A;  4KX5 A;  3QU9 A;  4YR3 A;  3G6V A;  3CP8 A;  3EW9 A;  4FH5 A;  3ORY A;  2PMZ C;  8ICB A;  3IDW A;  3AQE A;  3Q8L A;  8ICW A;  4DQP A;  2AGO A;  3CRX A;  9ICL A;  1CUK A;  4DLE A;  2KOB A;  2HOQ A;  1X66 A;  4FZL A;  3ZD8 A;  3UXO A;  4NXZ A;  4QWC A;  5F9L A;  2XY7 A;  3NVO A;  5KAF U;  4BX9 C;  2M9N A;  3PO5 A;  3RR7 A;  3JCF A;  2EAN A;  4FBU A;  4US8 A;  4DWI A;  4F5R A;  2KJ5 A;  2G09 A;  4P4P A;  2KIW A;  4KLU A;  2W9M A;  5ALH A;  4KLJ A;  5J0P A;  4E7X A;  5DED A;  4RWN A;  1NK9 A;  4M9H A;  2YMM A;  3NTU A;  4I2G A;  3WFS C;  5AI9 A;  2A19 A;  5AM2 A;  1TK0 A;  2JZB B;  5DQI A;  7ICH A;  1JRO A;  4NL9 C;  2VA3 A;  2EZZ A;  7ICN A;  2HBJ A;  1QLN A;  4NJ8 A;  2H3I A;  2D6F C;  4NXT A;  4O5K A;  4UB2 A;  2F8K A;  5ALN A;  3KTQ A;  1Q78 A;  3ZI4 A;  4I2I A;  2CRX A;  2OM6 A;  5DDM A;  3J81 j;  1Q79 A;  2XGQ A;  2W9B A;  1X6I A;  1PK3 A;  4ACO A;  1DGJ A;  9ICT A;  1TK5 A;  2PI4 A;  9ICM A;  3Q8R B;  1KKX A;  4GC6 A;  2XY5 A;  2ZIU A;  4RQ1 A;  3HKZ F;  4JB3 A;  2PFP A;  2FLL A;  2PFO A;  4QW8 A;  1ZQX A;  4OJ6 A;  5J0W A;  5L1K A;  2BCS A;  5AKK A;  1KTQ A;  5KG3 A;  4WC0 A;  1B0X A;  4ECU A;  2E3T A;  4FBT A;  3N7S C;  4KLT A;  5ALD A;  8ICG A;  3OTQ A;  4OAF A;  3H8J A;  3VC8 A;  3B9J A;  3F53 A;  5AI8 A;  3V6K A;  5KFY A;  2KKV A;  4IQW A;  4DFP A;  2FMQ A;  2OYY A;  4P0Q B;  4RNN A;  4Y2V A;  3M9M B;  2NO5 A;  4CF4 A;  4DSE A;  2C2E A;  2ZIV B;  2UVV A;  1UEU A;  3MAB A;  4PZO A;  1IIP A;  1YZ6 A;  1KN5 A;  2RHF A;  3LDA A;  1X9X A;  2AQ4 A;  4YR0 A;  4IRC A;  1O03 A;  1UPH A;  2F1J A;  3QZ8 A;  3NWI A;  1S8O A;  4JWM A;  2ZTD A;  5ALK A;  4R63 A;  4KLM A;  5KG1 A;  3ZDE A;  1ZQB A;  2H5X A;  2RRD A;  4IQU A;  1NK6 A;  2UVU A;  4RU9 A;  5TIS U;  1BPE A;  4ELU A;  1A0P A;  1RM6 C;  5AKY A;  2LI6 A;  2VJ5 A;  1N62 A;  1JX4 A;  2XCA A;  4O3M A;  4O0I A;  2O1P A;  3RJF A;  5ALP A;  2WB1 C;  3N97 B;  1ZET A;  3TFS A;  1MQ2 A;  4EED A;  5IIO A;  3UPS A;  2FMP A;  1SXD A;  8ICV A;  4LVS A;  2B21 A;  5KFI A;  1ZQS A;  1X9M A;  2ID1 A;  5AM4 A;  2PXI A;  4GXI A;  1R8C A;  2LHT A;  3PNC A;  2BDP A;  1PZN A;  4O67 A;  4F50 A;  5HC9 A;  3QUB A;  1FA0 A;  2IUB A;  3UQ0 A;  1CI4 A;  4KLG A;  1JAL A;  4R8U B;  3AUO A;  1Z3E B;  1KRP A;  4QIW C;  3ZDD A;  4Y2S A;  4RPX A;  2WAQ F;  4LEZ A;  2ASL A;  7ICO A;  4DO9 A;  3HX0 A;  2EAP A;  3M6K A;  4PGY A;  2ZH7 A;  3KHR A;  2F8L A;  1ZQN A;  3D2S A;  2P35 A;  4RQ3 A;  3ZD9 A;  4DL6 A;  4R65 A;  5BOL A;  1V9P A;  2YB4 A;  2K8A A;  5EE9 A;  4UB4 A;  1NJX A;  3L9D A;  2JH7 A;  3RJJ A;  3WFQ E;  3RB4 A;  4K4H A;  4WC2 A;  1Z1V A;  4E80 A;  5KFU A;  1KW4 A;  2W9B B;  3LQC B;  4RQ2 A;  4NXU A;  1MA7 A;  2EDU A;  5ALS A;  4UBB A;  4I27 A;  3PV8 A;  1ZQM A;  1LVH A;  2BBJ A;  1JI7 A;  4DEZ A;  2VA2 A;  2ZH1 A;  2ZIU B;  3B0X A;  4O3S A;  3ISC A;  4EBK A;  5KFN A;  4OAI Z;  3OVS A;  1ARO P;  5DLF A;  4GIB A;  1CRX A;  3WK4 A;  4O3N A;  4US9 A;  5HRD A;  3WK5 A;  1UQV A;  5CEH A;  2O6K A;  4DFK A;  4BGD A;  2JH1 A;  2MU2 A;  1NI3 A;  3PY8 A;  1JIH A;  5G5G A;  5HR7 A;  9ICH A;  1OUQ A;  3R9K A;  4RZR A;  1ZQI A;  1S97 A;  4F2S A;  5ALT A;  4EBD A;  3HIL A;  4I2D A;  2IBK A;  1HUZ A;  4XQ8 A;  1MIV A;  1A6S A;  3HJ1 A;  5KFG A;  4WC3 A;  5DBA A;  8ICI A;  1WWV A;  3ONN A;  4Q8F A;  3CNH A;  4UB5 A;  7ICT A;  2R8H A;  2PBE A;  5KFO A;  5AM5 A;  5ALY A;  2F1I A;  8ICH A;  5KFF A;  5KG5 A;  5EE0 A;  3QU5 A;  4CCH A;  5ALM A;  2B4V A;  1U47 A;  3EF2 A;  2LM1 A;  1QCK A;  2JEF A;  2DUY A;  1Z4N A;  9ICB A;  4CDG A;  2HW3 A;  2W04 A;  7ICP A;  1SKR A;  5III A;  3NGD A;  3IG5 A;  1R8A A;  3UPQ A;  2MSN A;  7ICV A;  1ZRN A;  4I2B A;  4M6W A;  4LJX A;  1KSP A;  8ICJ A;  2IHN A;  4I2J A;  1COO A;  2Y1J A;  1IM4 A;  5KFH A;  2KSO A;  3C2M A;  4F2R A;  1ZQO A;  5FP0 A;  4RQ5 A;  3C66 A;  4ED2 A;  4C8L A;  3PVX A;  1RYU A;  2CPR A;  5KAI U;  4J9R A;  1VJ7 A;  4DQI A;  4K96 A;  3PW0 A;  1UCV A;  4B9S A;  4FE3 A;  3ALR A;  4QWD A;  2N1R A;  3KD3 A;  2E8N A;  4F72 A;  4ECV A;  4EEN A;  4C4R A;  3SZ2 A;  4YFK A;  3MR6 A;  4O3O A;  4TQR A;  3RJE A;  4FHV A;  2M0N A;  2XY6 A;  2HBK A;  1L3U A;  5L1L A;  2E8O A;  2LMR A;  5GTI U;  2H3Q A;  1ZQG A;  9ICX A;  1BPY A;  1ZQC A;  4DS4 A;  4DSI A;  2XO7 A;  2EZX A;  3ER8 C;  4DOB A;  3EWA A;  4DQQ A;  4NLG A;  4EX7 A;  1VLB A;  1N63 A;  4PL1 A;  1VJ5 A;  4M47 A;  2VA8 A;  5DG7 A;  8ICE A;  3IP4 B;  2KZM A;  2M2V A;  1XO0 A;  1GPJ A;  5J8Y A;  3PW4 A;  2GAF D;  2JEJ A;  3NKU A;  7ICL A;  3RB6 A;  1R89 A;  1ZQK A;  3SV3 A;  4MFA A;  3AL0 B;  1DGS A;  2GO7 A;  4QZA A;  3OPX A;  2BKE A;  1R8B A;  1MN8 A;  4QZB A;  4DSJ A;  1U45 A;  8ICC A;  2F44 A;  5KG0 A;  4IL6 U;  5J29 A;  1ZXI A;  2YMQ A;  4FH3 A;  3H8W A;  3PO4 A;  3C29 A;  1VFG A;  4JLZ A;  4RQ4 A;  4WH5 A;  4RT2 A;  3MCR A;  1X9S A;  3UMG A;  5ALU A;  4RPZ A;  8ICL A;  4ZOH C;  4F5P A;  1QSY A;  5KFX A;  3JPS A;  5AKG A;  4JV2 A;  1QQ5 A;  4KMU A;  2KIC A;  5ALO A;  4F4Y A;  1C20 A;  4DL2 A;  1Z1B A;  1N56 A;  4IQV A;  1XNS A;  9ICP A;  4KIT B;  8ICQ A;  1H38 A;  3E2E A;  1TAU A;  3WKD A;  2KN7 A;  8ICP A;  2HHV A;  2NO4 A;  1L3V A;  3N7P D;  1KFS A;  5DQG A;  1SWW A;  3TKA A;  1L3T A;  4X4Q A;  2FDR A;  3KKA C;  5CJ7 A;  3TAN A;  4YVZ A;  3WFO A;  2K4H A;  3TAD A;  3EYZ A;  2FE9 A;  3UM9 A;  3NAS A;  4MF8 A;  5ALQ A;  2JV3 A;  1JXL A;  4M6W B;  1NK4 A;  2AHO B;  3KHH A;  3M9O B;  2AGP A;  2FPL A;  4PGX A;  2XVT A;  2HBL A;  4RQM A;  4F4Z A;  2KSO B;  4UW9 A;  4EGW A;  1YZ7 A;  4EZ9 A;  4KLD A;  2P6R A;  4I29 A;  4KLO A;  2BCR A;  1WCN A;  4O3P A;  3NVZ A;  1ZQV A;  4X4P A;  5J2H A;  2BCV A;  5EE1 A;  5L9X A;  3K4G A;  3V7J A;  3RB3 A;  2ZIW A;  4TUP A;  2AQ0 A;  4J9L A;  3WFR E;  4IS7 A;  1K1Q A;  5AM1 A;  1S10 A;  4BDP A;  2YY6 A;  4EYH B;  3I28 A;  5AK5 A;  4RNM A;  3IHQ B;  2V4R A;  3K75 D;  1ECW A;  9ICA A;  2DBY A;  3KKA A;  4GLX A;  2ODG A;  4CE6 A;  3H37 A;  3NRZ A;  2A1A A;  3AQN A;  1S0V A;  3F5A A;  4KB6 A;  4NY8 A;  2W03 A;  5J0T A;  1Z19 A;  4YN4 A;  4LT6 A;  4QZ8 A;  2G0A A;  3RJK A;  3SQI A;  5JRT A;  2W9C A;  1ZQD A;  2DKZ A;  1NO5 A;  1TFR A;  3GV5 B;  1JMS A;  5HRG A;  3C28 A;  2D8C A;  1Z4O A;  4UBC A;  2ALZ A;  3SAH A;  1V38 A;  2DGZ A;  5CFT A;  2VIX A;  5CR0 A;  3NVW A;  1ZQR A;  4NXV A;  2DL0 A;  5KFT A;  5ALJ A;  2EQY A;  2IOF K;  5DBC A;  4K8V A;  2JMG A;  3K1R B;  2ZJ8 A;  4HAI A;  1JRP A;  2HHP A;  3WKE A;  2GOL A;  4KN4 A;  2FMS A;  2HHT A;  4F5O A;  5AI0 A;  2ESE A;  2R8I A;  4RWQ A;  1SL1 A;  5D49 A;  4NM2 A;  3HPO A;  1DK2 A;  1XO1 A;  3G6X A;  3V6H A;  1P7D A;  1YLQ A;  2DPI A;  5L1J A;  3L3F X;  2W7P A;  2F77 X;  5JUM A;  1WOT A;  4F4X A;  4OJP A;  2B0C A;  5ALR A;  1ZQL A;  5J2I A;  4B9T A;  1GO3 F;  1X6J A;  1HEK A;  4UAR A;  2YB1 A;  1IV8 A;  2EAO A;  1WG8 A;  1XS9 D;  3JPR A;  4WJ3 B;  2J6U A;  2KK0 A;  4Y2U A;  2FLN A;  1MQ3 A;  4DF8 A;  3KZI U;  5HRI A;  2DR7 A;  1NK8 A;  5L1I A;  4DCC A;  5EWF A;  2PKE A;  4TUQ A;  3GU3 A;  1PVQ A;  2LYH A;  2D3D A;  4CF3 A;  1HUO A;  3BQ2 A;  4Y2T A;  2BDU A;  3JPN A;  1A77 A;  4QZI A;  1PUZ A;  3RFA A;  3JPT A;  4DL4 A;  4HX0 A;  8ICS A;  5ALX A;  1QQ7 A;  1KFT A;  4DF4 A;  4B9U A;  4KLL A;  4N7R A;  2HN2 A;  3L4P A;  4ECQ A;  9ICK A;  2ZJ5 A;  4UAU A;  4MKP A;  2DR8 A;  3RF9 A;  1ED1 A;  1PVP A;  2W8L A;  4ED7 A;  1V4A A;  4Y2X A;  5KFE A;  4C8M A;  1L7O A;  5HR9 A;  3MC1 A;  2F3N A;  2GH1 A;  1URJ A;  2GWS A;  3OVA A;  5AM0 A;  4NLN A;  2ZIW B;  2B56 A;  3JZ0 A;  5J0Y A;  5J2D A;  5D4B A;  3HJE A;  4FS2 A;  3BQ1 A;  1MSW D;  8ICF A;  3OUY A;  4K9A A;  3UQ2 A;  2FCL A;  1BNO A;  2ZG6 A;  4MEY A;  5K4L A;  3H0M B;  3QXG A;  4ELV A;  4FHW A;  2K60 A;  4WC1 A;  2K4P A;  2HHS A;  2BHN A;  1JUD A;  2I1Q A;  1T4G A;  5L1M A;  3GIM A;  4ECY A;  2ZHA A;  3NRW A;  4R64 A;  2AXT U;  5J2F A;  2G5I B;  1ZD3 A;  3IV6 A;  3V7L A;  1UT5 A;  3HP6 A;  5KFZ A;  2W9C B;  3H3A A;  4Z6C A;  4AT7 A;  2BCQ A;  2OWO A;  3D6J A;  2A1J A;  2KIV A;  2KEY A;  2LYA A;  5KFK A;  3PX6 A;  3HKZ C;  5KFP A;  4S3N A;  1NZB A;  1KNY A;  4F3O A;  4PJ0 U;  3ERC C;  2MA1 A;  2ZH2 A;  4I0U A;  3H39 A;  3PST A;  3HIY A;  4DL5 A;  3AU6 A;  4QZ9 A;  5DKW A;  1LKY A;  2E8P A;  4WC7 A;  4RUC A;  2EWR A;  3LWM A;  5AKH A;  4OJO A;  4NV0 A;  5AKZ A;  4IR9 A;  4EEY A;  2JR5 A;  2G5H B;  3V72 A;  5AI4 A;  7ICK A;  2Y9U A;  4FO6 A;  4WC5 A;  5CP2 A;  1X40 A;  5IIM A;  4WC4 A;  3CW2 C;  1XSN A;  2Y0S F;  3C18 A;  3C2K A;  4UB6 U;  4QZG A;  7ICJ A;  2IHM A;  2AH5 A;  5AKI A;  2BZF A;  3DEE A;  5C0Y A;  1BGX T;  2HOF A;  5KL1 B;  2DPJ A;  2PI5 A;  3PR5 B;  4M0A A;  2ZH5 A;  1U9L A;  1YT3 A;  5HML A;  5ALZ A;  5AI6 A;  3JPO A;  2RFF A;  1XSL A;  2YMP A;  1NKE A;  1ZD2 P;  4YP3 A;  4AT8 A;  1N61 A;  3PR4 A;  3MFH A;  1NKB A;  5G5H A;  3M1Y A;  4WQK A;  3SYZ A;  7ICQ A;  3TAP A;  4C0Z A;  1SZH A;  5KT2 A;  7ICU A;  3PX4 A;  4LEY A;  1L8O A;  9ICU A;  3HRD D;  5BOM A;  1ZOL A;  5DGB A;  4KTQ A;  4I28 A;  1HIW A;  4P4M A;  2B6G A;  2I5H A;  4QZE A;  4G9B A;  5HP4 A;  4Q8E A;  4U6P A;  4EYI B;  4KM5 A;  1N2X A;  4UAV A;  4A8E A;  2ZXI A;  2W7O A;  2DKX A;  1HJP A;  1RDF A;  4KLE A;  5EWE A;  2BQ3 A;  5J2A A;  8ICX A;  1AQ6 A;  2A3V A;  1F5S A;  2RQ5 A;  2MUT A;  5DB8 A;  1COK A;  2WAQ C;  4F8R A;  2J6T A;  4MHV A;  3OUY B;  5J2E A;  4KMO B;  3ISB A;  4OAH A;  3PZP A;  3H0R B;  2BPC A;  1N48 A;  3QU7 A;  4PHP A;  5ALV A;  2JHD A;  2W54 A;  1SXE A;  2DF4 B;  4KLF A;  4BWJ A;  3ZDC A;  1QH9 A;  3GII A;  4X4T A;  2H3Z A;  1TK8 A;  3A0H U;  3BS5 A;  2JEG A;  5ALG A;  3O0F A;  4C80 A;  2HOI A;  4EBJ A;  5H2F U;  1TAQ A;  1OU5 A;  4X4R A;  1LB2 B;  3H4D A;  4X4N A;  3SEI A;  1J97 A;  2KJ8 A;  5DG9 A;  2ZH6 A;  5HRE A;  2HI0 A;  3FDS A;  2DQN B;  4AT7 B;  4RUA A;  8ICZ A;  5EOZ A;  2A1J B;  4PHE A;  2FI1 A;  4F91 B;  4K99 A;  3AEV A;  2HDO A;  5HNK A;  2ASD A;  5C5J A;  2UVR A;  3RR8 A;  4YQW A;  2EZY A;  4M9L A;  4KX3 A;  2KHV A;  3H8M A;  5J8Y C;  4BUG A;  4RQ7 A;  8ICO A;  1ZD4 A;  8ICN A;  2JRZ A;  1D8L A;  3PX0 A;  3WU2 U;  3QUC A;  3EPG A;  1BPX A;  9ICC A;  3RTV A;  2LM4 A;  5AIC A;  3WKB A;  1LKY B;  2VAN A;  3QNM A;  4QWE A;  2EAM A;  5KT4 A;  4G3I A;  1MIY A;  4NXX A;  3BQ7 A;  4ECT A;  1B22 A;  5IIL A;  1C7Y A;  3GIK A;  3OHB A;  2KP7 A;  4Y2R A;  4C7Y A;  1QTM A;  2E1E A;  4YMM A;  3PMN A;  4O69 A;  5CFS A;  2YN4 A;  4UD4 A;  7ICR A;  4OD0 A;  1RQL A;  4X4U A;  2J6S A;  5DB9 A;  2YML A;  2W3R A;  8ICT A;  2XI9 A;  1LV5 A;  3RH4 A;  5GTH U;  2YX8 A;  5AKJ A;  4Q45 A;  1T94 A;  3UMC A;  3NYB A;  1SV0 A;  2NRZ A;  4C4T A;  4RWP A;  9ICI A;  4AT8 B;  5J0U A;  1J2N A;  1ZQZ A;  2DR5 A;  2HVH A;  3TFR A;  4IG8 A;  3SAG A;  3OVB A;  2G08 A;  4FHX A;  5B66 U;  3AM9 A;  1V85 A;  8ICK A;  2WF9 A;  3KZX A;  4C8N A;  3RJH A;  1IG6 A;  2Q66 A;  4ECW A;  3TAD C;  9ICO A;  5KFL A;  3KHG A;  2BQR A;  1L7P A;  9ICW A;  3FC4 A;  4F92 B;  1L7M A;  3A0B U;  8ICR A;  9ICR A;  2BCU A;  3TQ1 A;  4WCW A;  3D2Q A;  3H38 A;  4XA5 A;  1F5A A;  4UAT A;  4JMU A;  2HVI A;  3OJU A;  4C7Z A;  3OJS A;  3QYP A;  5KFM A;  2LKY A;  2HCF A;  9ICG A;  2MUT B;  5DBB A;  2LBO A;  4I2F A;  1U4B A;  4YG2 A;  1ZQF A;  4J9O A;  1BNP A;  1DXS A;  3BQT A;  4RWO A;  4QJF B;  5CFU A;  5KFB A;  1ZD5 A;  4Y2Q A;  5KT5 A;  3BS5 B;  2WFA A;  4FHY A;  2WF8 A;  3U26 A;  1SWV A;  1CEZ A;  4AT9 A;  1ZQJ A;  2XIC A;  3WK7 A;  4DOC A;  1A76 A;  3MGI A;  2OEH A;  3E0F A;  7ICG A;  1RXW A;  4DL7 A;  1Z00 A;  2KVS A;  5EWG A;  4ECX A;  3LK9 A;  1UT8 A;  2XID A;  2V9W A;  3GFK B;  7ICE A;  5CRX A;  2R8J A;  2ISO A;  4CNQ A;  2C22 A;  4OO1 J;  3ETL A;  5DQH A;  3LWL A;  2JZB A;  4PH5 A;  1SIJ A; 
#chains in the Genus database with same CATH homology
 4F50 A;  5J2K A;  4DF8 A;  5HC9 A;  5HRI A;  3SI8 A;  1NK8 A;  3BDP A;  1FA0 A;  5L1I A;  4UAY A;  2DR7 A;  1EXN A;  2RDI A;  3Q8P B;  5EWF A;  3UQ0 A;  4K4G A;  4WC6 A;  4TUQ A;  4KLG A;  4R8U B;  5CA7 A;  1Z3E B;  4YD2 A;  3AUO A;  4NLK A;  3H4B A;  4EZ6 A;  4RQ0 A;  2Q0Z X;  1KRP A;  3ZDD A;  2LYH A;  5KTQ A;  3QEB Z;  1DK3 A;  2M2W A;  4RPX A;  4F5N A;  4UAW A;  1HUO A;  4B9L A;  2HHX A;  3BQ2 A;  2ASL A;  5BPC A;  1RXV A;  4WBZ A;  4KLS A;  1DOQ A;  1XSP A;  4JV0 A;  3JPN A;  4LZG A;  7ICO A;  3C1Z A;  4DO9 A;  1A77 A;  3HX0 A;  3Q8M A;  4PGY A;  4QZI A;  1ZJN A;  4YD1 A;  3JPT A;  2ZH7 A;  4DL4 A;  3KHR A;  4X0B A;  3MBY A;  8ICM A;  1ZQN A;  1XWL A;  1KLN A;  4K4I A;  7ICF A;  2XGP A;  8ICS A;  1KFT A;  4DF4 A;  4M9N A;  4RQ3 A;  3ZD9 A;  4DL6 A;  4R65 A;  4B9U A;  3H7I A;  5BOL A;  1IXR A;  1V9P A;  4KLL A;  2ZUC A;  5KT3 A;  2HHU A;  9ICE A;  4YR2 A;  4UB4 A;  5IIJ A;  3V6J A;  3HT3 A;  4ECQ A;  9ICK A;  2ZJ5 A;  2M2T A;  1BPD A;  1NJX A;  3MDA A;  3L9D A;  3RJJ A;  3WFQ E;  2DR8 A;  3RB4 A;  4K4H A;  4WC2 A;  4BWM A;  3T3F A;  5DB6 A;  2W8L A;  1S9F A;  4C8O A;  4E80 A;  5KFU A;  1JN3 A;  5KFQ A;  2W9B B;  4ED7 A;  1B43 A;  5HHI A;  3H40 A;  4RQ2 A;  3LQC B;  4X4V A;  4KLI A;  1V4A A;  5IIK A;  4M9G A;  2ZH4 A;  3EPI A;  5J2B A;  1RZT A;  7ICI A;  5KFE A;  4C8M A;  4UBB A;  4E8F A;  4I27 A;  2W8K A;  5HR9 A;  4ED8 A;  3PV8 A;  2UVW A;  1ZQU A;  1ZQM A;  4ED0 A;  3GIJ A;  4J9Q A;  4DEZ A;  2VA2 A;  8ICU A;  2ZH1 A;  2DRB A;  2GWS A;  4DFM A;  2AJQ A;  3OVA A;  1NK5 A;  4XRH A;  4NLN A;  3B0X A;  1TKD A;  5HRF A;  4O3S A;  3JZ0 A;  4XQ7 A;  5J0Y A;  5J2D A;  5D4B A;  3ISC A;  5HMM A;  2WTF A;  5KFN A;  3OSN A;  3BJY A;  1ARO P;  4FS2 A;  3BQ1 A;  1MSW D;  4F5Q A;  8ICF A;  9ICN A;  3OVS A;  3OUY A;  5DLF A;  3UQ2 A;  4BXO A;  4O3N A;  4DFJ A;  3RB0 A;  1BNO A;  3RRH A;  4MEY A;  4RQ8 A;  5HRD A;  4J9M A;  1S76 D;  4ELV A;  4J9S A;  4FHW A;  4DFK A;  4BGD A;  3AQK A;  4WC1 A;  2HHS A;  3PY8 A;  2BHN A;  4ECZ A;  1JIH A;  4JK1 A;  9ICH A;  1K1S A;  2I1Q A;  1T4G A;  3GIM A;  2AGQ A;  4ECY A;  2ZHA A;  4RZR A;  1ZQI A;  4JV1 A;  1ZQA A;  3RJI A;  5CB1 A;  4R64 A;  1S97 A;  4F2S A;  5J2F A;  4EBD A;  3V7L A;  4ED1 A;  4QWB A;  4DOA A;  1UT5 A;  4I2D A;  3HP6 A;  2NRV A;  5KFZ A;  3M8R A;  2W9C B;  4ECR A;  4EBC A;  4DQS A;  1RYR A;  4MF2 A;  1ZQT A;  2IBK A;  4M5D A;  3ZDA A;  1HUZ A;  4UAZ A;  1U48 A;  1T7P A;  4XQ8 A;  3V7K A;  4Z6C A;  1MIV A;  4PHA A;  4I2E A;  4AT7 A;  2DRA A;  2BCQ A;  3AU2 A;  2OWO A;  3C5G A;  1ZQP A;  5KFA A;  4O3R A;  3HJ1 A;  4PGQ A;  5KFG A;  3B0Y A;  4PHD A;  5HRK A;  4WC3 A;  5KFS A;  5DBA A;  8ICI A;  2A1J A;  5F2V O;  1L3S A;  1SL0 A;  1ZQY A;  4IRK A;  5KFK A;  2R8G A;  4Q8F A;  4UB5 A;  7ICT A;  3PX6 A;  2ASJ A;  5D46 A;  2R8H A;  1D9D A;  2PBE A;  5KFO A;  3HJ4 A;  2F1I A;  5DDY A;  4UB1 A;  3Q8Q B;  8ICH A;  5KFP A;  5KFF A;  3TI0 A;  2BR0 A;  5KG5 A;  4S3N A;  1NKC A;  4ATB B;  5HRH A;  3PW2 A;  1KNY A;  4F3O A;  4YCX A;  4CCH A;  1L5U A;  1U47 A;  2F1H A;  4C8K A;  4O3Q A;  2JEF A;  5F9N A;  4DSL A;  2BGW A;  2ZH2 A;  1S0O A;  9ICB A;  2HW3 A;  5KFV A;  4YXM A;  5DG8 A;  5J2J A;  3H39 A;  7ICP A;  2NRW A;  1SKR A;  3HIY A;  3G6Y A;  4DL5 A;  5III A;  3AU6 A;  3UXP A;  4ED6 A;  4QZ9 A;  3OGU A;  4P4O A;  3NGD A;  3HW8 A;  1NJY A;  1Y88 A;  5DKW A;  3UPQ A;  3M9N B;  1R8A A;  2ZUB A;  4B9N A;  4WC7 A;  2NRK A;  7ICV A;  4RUC A;  3TAQ A;  3LWM A;  1KFD A;  3RH6 A;  3MDC A;  1SKW A;  4I2B A;  2KFZ A;  1JAJ A;  4M6W A;  9ICS A;  2C2R A;  1ZQH A;  1KSP A;  8ICJ A;  3JYY A;  3RBD A;  4AT9 B;  4I2C A;  2IHN A;  4J9N A;  4IR9 A;  4EEY A;  1SKS A;  4I2J A;  1BVS A;  1COO A;  1IM4 A;  4QW9 A;  2Y1J A;  7ICK A;  3V72 A;  5KFH A;  4MFF A;  1NJW A;  4O5C A;  2ZH9 A;  4FO6 A;  4WC5 A;  5CP2 A;  3C2M A;  4F2R A;  4JUZ A;  2XC9 A;  1ZQO A;  1X2I A;  2O5A A;  5IIM A;  2BPF A;  4R8U A;  4WC4 A;  3T5L A;  5J0S A;  4RQ5 A;  1Z00 B;  3RBE A;  2ATL A;  1XSN A;  3C66 A;  4RQ6 A;  4ED2 A;  3KHL A;  4F4W A;  4C8L A;  3PVX A;  3TAR A;  2KZZ A;  3C2K A;  3C18 A;  2BE3 A;  4J9R A;  4QZG A;  3HWT A;  3N4M B;  4DQI A;  4DSK A;  2IHM A;  7ICJ A;  1VJ7 A;  3PW0 A;  4NM1 A;  4IQT A;  3H3A A;  4B9S A;  3PML A;  3H8S A;  7ICM A;  4QWD A;  4J9P A;  3MGH A;  1TFY A;  5HRL A;  4DS5 A;  4ECV A;  4NKT A;  2KFN A;  7ICS A;  3SZ2 A;  4YFK A;  1BGX T;  3MR6 A;  2KZ3 A;  4WCW A;  3ISD A;  2PI5 A;  2DPJ A;  3C1Y A;  3PR5 B;  4M0A A;  3QE9 Y;  2ZH5 A;  1U9L A;  4O3O A;  5KG6 A;  5DLG A;  4TQR A;  5HML A;  3GV7 B;  3RJE A;  4FHV A;  4O5E A;  3JPO A;  2RFF A;  2V4Q A;  2XY6 A;  1XSL A;  1TV9 A;  1XC9 A;  1L3U A;  5L1L A;  1NKE A;  3JPQ A;  1ZQQ A;  4TQS A;  4MEX A;  4YP3 A;  4AT8 A;  2AU0 A;  4EBE A;  3PR4 A;  3MFH A;  5DGA A;  1NKB A;  3C5F A;  3T5K A;  1ZQG A;  9ICX A;  1X9W A;  5TZV A;  3T5J A;  1UA1 A;  1BPY A;  3SV4 A;  1ZQC A;  3SYZ A;  4DS4 A;  2RDJ A;  4DSI A;  7ICQ A;  5KFC A;  3TAP A;  1SL2 A;  2NRX A;  5KT2 A;  4FS1 A;  4I2A A;  7ICU A;  5KFJ A;  2XO7 A;  3PX4 A;  3JPP A;  4X4S A;  5J0Q A;  9ICU A;  4UD5 A;  2JEI A;  1KDH A;  4IRD A;  4DOB A;  3EWA A;  4NKU A;  4DQQ A;  5BOM A;  3GDX A;  4NLG A;  5DGB A;  4KLQ A;  3WFP A;  4KTQ A;  4I28 A;  4Z6F A;  2M2U A;  5J0O A;  4P4M A;  2DFL A;  3QZ7 A;  2C28 A;  4DLG A;  3C2L A;  4E0D A;  2ZTE A;  4QZE A;  1TVA A;  4M47 A;  4KN7 A;  3GIL A;  5J2G A;  2VA8 A;  5DG7 A;  3Q8K A;  4NLZ A;  4Z6D A;  8ICE A;  5HP4 A;  4Q8E A;  2KZM A;  2M2V A;  4X4O A;  2PFN A;  4EYI B;  3PW4 A;  1HJP A;  1RPL A;  5CWR A;  2IMW P;  2JEJ A;  4KLE A;  3RH5 A;  5EWE A;  4PPX A;  4JWN A;  2BQ3 A;  7ICL A;  5J2A A;  4Q43 A;  3RB6 A;  8ICX A;  4EP7 A;  1R89 A;  1ZQK A;  2ZJA A;  5J2C A;  3SV3 A;  4MFA A;  5KFW A;  1ZQE A;  1UA0 A;  5HRB A;  3T5H A;  2MUT A;  5DB8 A;  1DGS A;  4TUS A;  2BQU A;  2C2D A;  2I9G A;  4F8R A;  3PW5 A;  2J6T A;  4YMN A;  3OUY B;  2P66 A;  4QZA A;  5J2E A;  2BKE A;  5DB7 A;  3ISB A;  1R8B A;  5KG7 A;  2BPC A;  4BXO B;  4QZB A;  1N48 A;  4PHP A;  4DSJ A;  4B9M A;  1U45 A;  1JXE A;  4O9M A;  8ICC A;  8ICY A;  2FPM A;  5KG0 A;  4YR3 A;  3G6V A;  4DL3 A;  1UET A;  5J29 A;  5IIN A;  3EW9 A;  4KLF A;  4FH5 A;  3ORY A;  4BWJ A;  3ZDC A;  3H8W A;  4FH3 A;  3C21 A;  8ICB A;  3GII A;  4X4T A;  4M2Y A;  3C23 A;  3Q8L A;  1TK8 A;  2JEG A;  8ICW A;  3PO4 A;  1VFG A;  4DQP A;  4RQ4 A;  2AGO A;  2R8K A;  4EBJ A;  9ICL A;  4RT2 A;  1TAQ A;  1CUK A;  1X9S A;  1OU5 A;  4X4R A;  4DLE A;  3MR5 A;  3H4D A;  1LB2 B;  4RPZ A;  4X4N A;  5DG9 A;  8ICL A;  2ZH6 A;  4M04 A;  5HRE A;  4F5P A;  1QSY A;  5KFX A;  3JPS A;  3ZD8 A;  4JV2 A;  8ICA A;  3FDS A;  4AT7 B;  3UXO A;  5KT7 A;  1S0N A;  4RUA A;  5KT6 A;  1NJZ A;  4NXZ A;  4KMU A;  5J0R A;  1T3N A;  8ICZ A;  3AQL A;  4UB3 A;  4QWC A;  4MFC A;  5F9L A;  4F4Y A;  5EOZ A;  2A1J B;  2XY7 A;  4PHE A;  4F91 B;  4DL2 A;  1QSL A;  1N56 A;  5KFD A;  3ZDB A;  9ICQ A;  4IQV A;  4RT3 A;  5HNK A;  9ICP A;  3AQM A;  4KIT B;  8ICQ A;  2M9N A;  2ASD A;  2ISP A;  3RR7 A;  5C5J A;  1H38 A;  2UVR A;  2NRT A;  3PO5 A;  2KN7 A;  1MC8 A;  3RR8 A;  3E2E A;  2HHV A;  1TAU A;  4FBU A;  1L3V A;  8ICP A;  4YQW A;  4DWI A;  1KFS A;  4ECS A;  4F5R A;  5DQG A;  4QZC A;  2PFQ A;  4M9L A;  1L3T A;  2P6U A;  4P4P A;  4RNO A;  4FHP A;  4KLU A;  1T8E A;  4X4Q A;  5CJ7 A;  2W9M A;  3TAN A;  4RQ7 A;  4YVZ A;  3QEA Z;  1QSS A;  8ICO A;  3WFO A;  8ICN A;  4R66 A;  1D8L A;  5KFR A;  2DR9 A;  3PX0 A;  3EPG A;  4KLJ A;  1BPX A;  9ICC A;  3RTV A;  3EYZ A;  5J0P A;  4YMO A;  2VAN A;  4E7X A;  5DED A;  4RWN A;  5HHH A;  4MF8 A;  4QWE A;  1NK9 A;  4M9H A;  3PNC A;  5KT4 A;  9ICV A;  1JXL A;  4M6W B;  1NK4 A;  4DSF A;  3NTU A;  3KHH A;  3M9O B;  5J0X A;  2ZUD A;  2AGP A;  4G3I A;  4B9V A;  4I2G A;  1MIY A;  9ICJ A;  4ELT A;  3WFS C;  4QZH A;  2FPL A;  4PGX A;  4ECT A;  1TK0 A;  4P2H A;  2JZB B;  5DQI A;  3IM1 A;  5IIL A;  7ICH A;  1B22 A;  2VA3 A;  2KTQ A;  1C7Y A;  3GIK A;  3OHB A;  7ICN A;  2KP7 A;  4F4Z A;  1QLN A;  1QTM A;  4YMM A;  4LZD A;  4O5K A;  5DEC A;  3PMN A;  4UB2 A;  4EZ9 A;  4KLD A;  4ZH4 A;  3KTQ A;  1Q78 A;  4UD4 A;  2P6R A;  4I2I A;  1BPZ A;  4I29 A;  4KLO A;  5DDM A;  2BCR A;  7ICR A;  1Q79 A;  1WCN A;  4YXJ A;  2XGQ A;  5KG4 A;  1NK7 A;  2W9B A;  1D8Y A;  4X5V A;  4X4U A;  4O3P A;  1ZQV A;  9ICT A;  1TK5 A;  5DB9 A;  2J6S A;  2PI4 A;  3GV8 B;  4X4P A;  1BPB A;  5J2H A;  2XCP A;  2BCV A;  9ICM A;  3Q8R B;  8ICT A;  1LV5 A;  5L9X A;  1UEV A;  4GC6 A;  3K4G A;  4HYK A;  3V7J A;  2XY5 A;  3RH4 A;  2BPG A;  3RB3 A;  1ZJM A;  4Q45 A;  4RQ1 A;  4TUP A;  2AQ0 A;  4J9L A;  2PFP A;  3WFR E;  3RAX A;  4GXJ A;  1NOM A;  1K1Q A;  2FLL A;  4GC7 A;  1S10 A;  4J9K A;  4BDP A;  1S77 D;  2PFO A;  3NYB A;  4QW8 A;  2NRZ A;  1ZQX A;  3FYH A;  4EYH B;  5J0W A;  5L1K A;  1ZQW A;  4RWP A;  9ICI A;  3BQ0 A;  2BCS A;  4AT8 B;  4RNM A;  3IHQ B;  5J0U A;  3K75 D;  2V4R A;  1KTQ A;  5KG3 A;  4WC0 A;  9ICA A;  1ZQZ A;  4GLX A;  3M8S A;  2DR5 A;  2HVH A;  4ECU A;  3H37 A;  3PW7 A;  4FBT A;  3TFR A;  4KLT A;  3AQN A;  1S0V A;  4IG8 A;  3OVB A;  3MFI A;  4NY8 A;  4Q44 A;  4FHX A;  4XUS A;  8ICG A;  4ED3 A;  5J0T A;  3H8J A;  4YN4 A;  4LT6 A;  4QZ8 A;  5KG2 A;  3UXN A;  8ICK A;  4QZD A;  3RJK A;  4C8N A;  3V6K A;  5KFY A;  4Z6E A;  3RJH A;  2Q66 A;  4ECW A;  9ICO A;  4IQW A;  5KFL A;  5CHG A;  3KHG A;  2W9C A;  4DFP A;  2BQR A;  1ZQD A;  2FMQ A;  1NO5 A;  9ICW A;  1TFR A;  3GV5 B;  4IR1 A;  4RNN A;  4X0A A;  1JMS A;  5HRG A;  4F92 B;  3M9M B;  4KLH A;  8ICR A;  4DSE A;  2C2E A;  9ICR A;  1U49 A;  2IA6 A;  2UVV A;  1ZYQ A;  2BCU A;  1S0M A;  4UBC A;  1D9F A;  3TQ1 A;  3RRG A;  3MAB A;  2W9A A;  4XA5 A;  2ALZ A;  1F5A A;  1UEU A;  3H38 A;  2HVI A;  4EBK A;  3OJU A;  3OJS A;  3LDA A;  3Q8S B;  5CR0 A;  3EZ5 A;  1ZQR A;  4TUR A;  2AQ4 A;  4YR0 A;  5KFM A;  4IRC A;  1KEJ A;  2FLP A;  5KFT A;  9ICG A;  4ATB A;  2ZTC A;  2F1J A;  2MUT B;  5DBB A;  1SZP A;  4I2F A;  2MAX A;  3QZ8 A;  5DBC A;  1U4B A;  4YG2 A;  1NZP A;  3THV A;  4JWM A;  2ZTD A;  2ZJ8 A;  1ZQF A;  2HHW A;  4WBY A;  4R63 A;  4J9O A;  4UQG A;  1BNP A;  2HHP A;  3BQT A;  4F93 B;  4RWO A;  4KLM A;  5KG1 A;  4KN4 A;  1RYS A;  3ZDE A;  4M9J A;  1NK0 A;  2FMS A;  2ZH3 A;  1ZQB A;  2H5X A;  5KFB A;  2HHT A;  4F5O A;  4IQU A;  2R8I A;  4RWQ A;  5KT5 A;  1SL1 A;  2ZHB A;  5D49 A;  1NK6 A;  2HHQ A;  2UVU A;  4GXK A;  4RU9 A;  4NM2 A;  3HPO A;  3RAQ A;  3OSP A;  3MR2 A;  1BPE A;  4ELU A;  1DK2 A;  2DVI A;  1XO1 A;  4FHY A;  3G6X A;  3V6H A;  1YLQ A;  2ZH8 A;  2Y1I A;  1JQR A;  2DPI A;  1CEZ A;  5L1J A;  4AT9 A;  4F4K A;  1ZQJ A;  1TFW A;  4RPY A;  4QWA A;  4DOC A;  9ICF A;  5JUM A;  1A76 A;  1JX4 A;  2XCA A;  4F4X A;  3MGI A;  1WOT A;  4O0I A;  3RJG A;  2O1P A;  3RJF A;  7ICG A;  1XU4 A;  1ZET A;  3N97 B;  1RXW A;  3TFS A;  1MQ2 A;  4DL7 A;  1ZQL A;  1Z00 A;  5EWG A;  5IIO A;  5J2I A;  2FPK A;  4ECX A;  4B9T A;  1PX5 A;  3UPS A;  3LK9 A;  1WCL A;  1UT8 A;  2FMP A;  2V9W A;  3OV7 A;  3GFK B;  7ICE A;  3GQC A;  2R8J A;  4I2H A;  1MIW A;  8ICV A;  2ISO A;  4LVS A;  3MR3 A;  2B21 A;  5KFI A;  2C22 A;  1XS9 D;  3JPR A;  1X9M A;  1ZQS A;  2ID1 A;  4QZF A;  2J6U A;  3ETL A;  3OHA A;  2PXI A;  4DQR A;  5DQH A;  4GXI A;  1R8C A;  3LWL A;  2JZB A;  2FLN A;  4PH5 A;  2BDP A;  1PZN A;  1MQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...