4PPXA

Dna polymerase beta e295k with spiroiminodihydantoin in templating position
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
314
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Crystal Structure of DNA Polymerase beta with DNA Containing the Base Lesion Spiroiminodihydantoin in a Templating Position.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 107
structure length 314
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ppxA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ppxA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ppxA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ppxA03
2C28A 4PHPA 2MUTB 4PGQA 1ZJNA 2UVUA 3BQ2A 5BPCA 4QWCA 1PZNA 3Q8RB 4DL2A 3PNCA 4YD2A 1A76A 3TARA 4NM2A 3PY8A 5J0SA 4QZHA 2BCRA 4B9TA 1T3NA 4EBJA 4J9OA 4EYIB 2BPCA 3ISCA 1ZQZA 2VA8A 4DSEA 4XQ7A 5KT7A 9ICLA 2DPJA 1ZQUA 1BNOA 3RBDA 1Q79A 1KRPA 1TVAA 4RNOA 2VA2A 2M2TA 3HJ1A 4RQ0A 3ISDA 4IQWA 3RRGA 4PHEA 3LK9A 1NKCA 4MEYA 4NM1A 2HHVA 3QEBZ 4I29A 4IRKA 1EXNA 4EZ9A 3WFSC 1QSYA 1ZQNA 4MEXA 4G3IA 4F5QA 2DR5A 2HHSA 3ISBA 5DKWA 5HRHA 3H37A 5HHIA 1R8BA 4ELUA 5J2JA 4F2SA 5KFXA 4QZ9A 4B9LA 3EW9A 3TFSA 2ZTDA 3SZ2A 4DS5A 4NKUA 3M9OB 2ASDA 1S0MA 4O3PA 3TFRA 7ICHA 4PHDA 4Q8FA 5KFQA 5J2AA 8ICAA 9ICRA 9ICNA 5EOZA 3L9DA 2V4QA 2JEFA 4JV2A 1UT5A 1NKEA 4ELVA 3BQ1A 5J2IA 4O3RA 9ICCA 4LZDA 7ICLA 4DQSA 1ZQBA 5KFLA 5J0RA 4Z6EA 4RNMA 3KHGA 4EBEA 2AGQA 1NJYA 1RXVA 4M47A 4RPYA 4UB5A 4EBDA 3HW8A 2UVRA 3GV5B 5KFVA 2BQ3A 3NYBA 3TI0A 5KFSA 4M0AA 7ICJA 3PW0A 4RQ6A 1ZQDA 2OWOA 4ECVA 4B9SA 1Y88A 4C8MA 2DPIA 4FBUA 3EPGA 1JMSA 4KLOA 2KN7A 3RH5A 3JPOA 5L1LA 1TV9A 3WFOA 4EP7A 2R8GA 2AQ0A 4QWDA 3MABA 2FLNA 5DLGA 4NLZA 1B22A 5KFYA 8ICVA 5DEDA 3OVBA 5J0WA 4BXOA 5KT4A 4P4PA 4DFPA 3M8SA 4QZBA 5IIMA 5HHHA 1NK5A 4KN7A 4UB4A 4ECWA 1ZQOA 1KFSA 2I9GA 4XQ8A 2HHTA 5CJ7A 1RXWA 2O1PA 4P4OA 4R65A 3PMNA 1F5AA 4YCXA 4GXJA 1UEUA 2FPLA 2P6UA 4TURA 3GIKA 4LVSA 3C66A 3JZ0A 4E0DA 3AU2A 2C2RA 1U49A 4M9NA 4O0IA 4B9UA 4WBZA 3RAXA 1UT8A 5KFRA 4DQIA 4M9HA 3UXNA 2JEIA 4MF8A 5BOMA 3T5HA 5DBBA 4PGYA 2ISOA 2ID1A 1JN3A 3T3FA 5KFWA 8ICRA 4WC2A 4F5RA 5D46A 4I27A 2ZHAA 1ZQYA 1X2IA 9ICIA 2O5AA 3JPTA 3N4MB 2HHXA 5DGBA 1XSPA 4B9VA 3TQ1A 4MFFA 1UA1A 4ELTA 4RWQA 3EYZA 1D8LA 2KFZA 3RH6A 2ATLA 3Q8PB 3RB6A 3GDXA 4X4OA 4KLJA 1R89A 5F2VO 5KG2A 5HRGA 2ASLA 8ICUA 2ZTCA 4DQQA 3HP6A 2RFFA 4AT8A 1KEJA 5C5JA 1XSNA 2DFLA 8ICYA 8ICZA 1MIYA 5KG5A 3RB3A 1V4AA 2FPMA 5KG3A 4YQWA 3H4BA 5L1JA 7ICSA 2NRZA 4RUCA 4UB1A 3V7KA 1NK0A 4F3OA 3GV8B 4ED3A 4UQGA 2A1JB 3OJUA 3MDCA 4ED7A 3T5KA 5J2HA 1SKWA 3G6XA 3C2KA 4IRCA 9ICXA 1C7YA 4WC0A 1BPEA 1T8EA 3RB0A 3H39A 8ICQA 1LB2B 4YVZA 1R8CA 3AU6A 1N56A 1L3VA 8ICFA 4K4HA 3C2LA 4I2JA 3JPQA 5KFZA 4DO9A 3ZDAA 2F1HA 2Q66A 4UB3A 3G6YA 4IRDA 4LZGA 5HRLA 1UEVA 5HMMA 1ZQVA 8ICEA 3Q8LA 4XA5A 3MFHA 4DS4A 3H40A 3PX6A 3ZDCA 4O5KA 4Q8EA 8ICGA 4UBBA 3C21A 5DQIA 2PFQA 2JZBA 3JPSA 5J0PA 5DGAA 2BCUA 2ZUDA 4F93B 5J2EA 2RDJA 1KLNA 1H38A 2PFOA 1ZQWA 3V7LA 5JUMA 2JZBB 5KG7A 3UQ2A 1D9FA 3KTQA 3C2MA 1TK8A 4QZDA 3LWMA 1A77A 4MFCA 4I2HA 3PW7A 1FA0A 7ICVA 3C1ZA 1T7PA 1TK0A 3ORYA 2C22A 4F4KA 4JK1A 4QZ8A 4DLEA 5KFAA 4B9NA 9ICPA 9ICGA 4FHWA 4KLHA 4YP3A 3C5GA 1WCLA 1WOTA 2FLPA 3RJHA 3T5JA 4RWPA 3ZDEA 1BPXA 4QZEA 4M9JA 3H3AA 3Q8QB 1NK8A 2V9WA 9ICHA 5KFUA 4TUPA 5D49A 4M2YA 5KT2A 5KFBA 4RPXA 1U47A 4BWJA 4O3SA 4J9NA 2PI5A 3MR3A 8ICJA 4YMNA 9ICVA 1S0VA 1ZQQA 4ECTA 1WCNA 3C5FA 4J9MA 5KFIA 7ICFA 1ZQLA 1OU5A 4JV0A 1UETA 3C18A 1BGXT 4YR2A 5KFMA 5BOLA 4J9QA 4Z6CA 4ECXA 1JIHA 3RR7A 3K4GA 4PPXA 4X4SA 7ICIA 4ED1A 4YFKA 4RQ3A 4Q44A 1ZQRA 2C2DA 1NOMA 4IQVA 4UD4A 3N97B 8ICIA 2ZH3A 1TAQA 5KG4A 5CB1A 2BCSA 1JXEA 3G6VA 4RQ1A 9ICOA 4FS1A 4M9LA 4AT7B 5KFJA 4TUSA 2ZH5A 1N48A 2W9AA 1ZQIA 5KFNA 2ZH9A 4QZAA 5IIKA 4J9KA 3PX0A 2R8JA 2XY5A 1K1QA 3MBYA 2IA6A 1VFGA 4F4YA 7ICQA 4FHXA 3V72A 2NRWA 5KFCA 4TUQA 3OSNA 3KHHA 7ICKA 3OHBA 1LV5A 2W8KA 5HP4A 9ICAA 4Z6DA 5KFPA 4Q43A 2BCVA 1D8YA 8ICHA 5HRKA 2AGOA 4WCWA 1XU4A 3LDAA 4DQRA 9ICEA 7ICOA 4QZCA 1NJZA 5IINA 3HJ4A 5F9LA 3PR5B 1SL2A 2WTFA 4I2BA 3LQCB 4WC1A 1CUKA 4WC4A 1ZQXA 2LYHA 4IQUA 2BGWA 4NKTA 3GIMA 2HHPA 4FH5A 3GILA 1ZQPA 5J0OA 4RT2A 1XS9D 4DL5A 8ICLA 8ICMA 2MAXA 3GV7B 3RRHA 1V9PA 4C8NA 5J0TA 5J0QA 4RZRA 4BGDA 2R8KA 3FDSA 3LWLA 4X0AA 4DL7A 4R66A 3T5LA 2BPGA 8ICOA 5KFHA 5IILA 4X4VA 1YLQA 2W9CA 2AGPA 1BPBA 4PGXA 2Y1JA 4AT7A 3E2EA 2IHMA 4Q45A 1JX4A 4I2DA 4K4GA 2Q0ZX 7ICRA 2W9CB 2M2UA 5DQGA 1KTQA 2NRXA 2BQRA 4ECZA 3RJEA 3RJGA 3PR4A 9ICFA 5DB8A 2M2WA 1ZQCA 4C8KA 3M9NB 4ECSA 4ATBA 4FO6A 2KP7A 7ICNA 5CHGA 1U48A 4AT9A 2FPKA 1ZQEA 4NY8A 2ZJAA 2XCPA 3PV8A 1B43A 4QWAA 4F50A 3PW5A 3RJKA 1BNPA 2HVHA 4ATBB 4AT9B 7ICGA 2NRTA 1Q78A 3ZD8A 2JEGA 4B9MA 1KFDA 1BVSA 5L1KA 1JAJA 3Q8MA 4KLDA 5HREA 4RPZA 1S97A 1KDHA 4DQPA 5DG8A 3EZ5A 3H7IA 3RB4A 1XWLA 5J2FA 3RBEA 5KFFA 4X5VA 4NLGA 4F5OA 4J9PA 3ETLA 4EBKA 3UQ0A 5CP2A 4JWNA 2NRVA 3BJYA 3M8RA 1ZQSA 4M9GA 4X4QA 4I2CA 2BQUA 4X4NA 4F5PA 3OSPA 1MSWD 2DRAA 5KFGA 4DFJA 4FHVA 3PW4A 2W9BB 1ZQJA 3WFRE 4KITB 3V6HA 3HT3A 3MR2A 1S10A 2BR0A 5J2BA 3QE9Y 5J2DA 3ZDBA 3H4DA 4IR9A 8ICPA 4WC6A 3HPOA 4LT6A 2A1JA 5J0UA 1TFWA 3RAQA 3Q8KA 3BDPA 3PX4A 4NXZA 4X4PA 4KMUA 4O5EA 1Z00A 4DSFA 2FLLA 3BQTA 4R64A 3MGIA 3SI8A 1DK2A 2ZH8A 2R8HA 4TQRA 1Z00B 1ZQGA 1TAUA 3ZDDA 5HRIA 4RWOA 1IXRA 4C8LA 4FHPA 4JWMA 5IIIA 3TAQA 5HR9A 4M5DA 2BCQA 1S9FA 1BPYA 2P6RA 3NTUA 5DB9A 2XGQA 1HJPA 9ICSA 2M2VA 4O3OA 4QZGA 4F2RA 5DBAA 2ZH1A 3BQ0A 3QEAZ 4JUZA 2XC9A 4F92B 4RUAA 1HUOA 1NKBA 1U9LA 3GFKB 3GIJA 5DLFA 1MQ2A 7ICUA 3PW2A 8ICNA 5J0YA 3AQLA 4DOAA 1S76D 3Q8SB 4I28A 4GXKA 1X9MA 4I2EA 7ICMA 7ICTA 4YXMA 4O3NA 2R8IA 1L3TA 4UAYA 4IR1A 4F91B 4F4ZA 4X0BA 4Z6FA 4X4RA 2ZH4A 2HHQA 3RJFA 4M04A 1S0OA 4NLNA 8ICCA 2J6SA 1VJ7A 2DR9A 4GXIA 2ZJ5A 1ZQMA 8ICWA 4WC7A 1RYRA 1RYSA 1XO1A 2DRBA 3C23A 3AUOA 3H8JA 4X4UA 1QSSA 8ICBA 5L9XA 3JYYA 4FHYA 4DOCA 3PO5A 4KLIA 4KLGA 4I2AA 1ZYQA 3RTVA 5DDYA 1AROP 3V6JA 4BWMA 3RH4A 2KTQA 3ZD9A 3AQKA 4FH3A 1MQ3A 4F4WA 4XUSA 1JXLA 5IIOA 4PH5A 3NGDA 4UBCA 1X9SA 4C8OA 2ZH6A 1Z3EB 5L1IA 4KLUA 2VA3A 4E7XA 5KG0A 2IMWP 5DQHA 4KLQA 1SZPA 5TZVA 4O9MA 1KNYA 4RQ8A 2W9MA 4J9LA 2VANA 1ZQHA 2HVIA 2HHUA 3AQMA 4MF2A 5KFEA 5EWEA 4I2IA 5DB7A 3IM1A 4DSJA 4J9SA 1TK5A 4DWIA 4EZ6A 9ICTA 4I2GA 3TANA 5HRFA 3GQCA 4DOBA 5KG6A 2HW3A 5DECA 3OVAA 4PHAA 5CA7A 3UPQA 4K4IA 1S77D 4UB2A 2P66A 1HUZA 4RU9A 3QZ8A 4DL4A 4R63A 3HWTA 3RJIA 2XY6A 8ICKA 4E8FA 5DBCA 4QZFA 2KFNA 4R8UA 4KLMA 2BKEA 4QWBA 2JEJA 2IBKA 4ECRA 5HMLA 2H5XA 4F8RA 1QLNA 4R8UB 1ZQKA 5DG7A 1PX5A 9ICKA 3V6KA 1ZQFA 3MDAA 4DSLA 2B21A 2ZUBA 4QW8A 9ICUA 5J2GA 5J29A 4IQTA 4F4XA 4NLKA 1DGSA 1K1SA 3WFQE 2ASJA 5HC9A 4KLTA 5EWGA 2PBEA 1NK7A 9ICWA 3EPIA 2FMQA 4P2HA 1JQRA 1NZPA 3JPPA 2J6UA 2M9NA 4DLGA 5HRDA 4P4MA 1QTMA 1RPLA 5KFKA 4GC6A 1ZQAA 1NO5A 4X4TA 3H8WA 5KFTA 4KLFA 4UAZA 2PI4A 4DL3A 5EWFA 3UXPA 2Y1IA 1DOQA 2GWSA 4WC5A 2XO7A 4YXJA 4YMOA 5IIJA 2UVVA 9ICJA 5CWRA 5KG1A 3GIIA 3TAPA 4O3QA 2AU0A 1XC9A 1SL1A 4O5CA 4ECYA 2ZH7A 4DFKA 4KLEA 8ICSA 3PVXA 4WBYA 2I1QA 2C2EA 4BDPA 3OV7A 5KT3A 8ICTA 3H38A 4DFMA 3AQNA 1L3UA 1KFTA 4E80A 2ZJ8A 1MIVA 4ED0A 4ECQA 4ZH4A 5J0XA 4DSKA 4RWNA 2J6TA 2KZMA 1X9WA 4HYKA 3RJJA 2ZH2A 4ECUA 4RQ7A 2XGPA 2HHWA 5KFDA 1SKSA 7ICEA 1DK3A 5J2CA 4BXOB 2DR7A 4DEZA 5DG9A 3KHLA 4QZIA 2W9BA 2AQ4A 4RQ2A 4ED6A 4F5NA 3K75D 1NK9A 7ICPA 4ED8A 1R8AA 2NRKA 4DF4A 2BPFA 2RDIA 3OVSA 2KZZA 4DSIA 3EWAA 1RZTA 4XRHA 2DR8A 1U4BA 5KFOA 2BHNA 3B0XA 2F1IA 4UD5A 3FYHA 5F9NA 5KT5A 2BDPA 5HRBA 3C1YA 4J9RA 2ZUCA 1IM4A 1SL0A 4GLXA 9ICBA 1UA0A 3UXOA 3JPNA 4GC7A 1KSPA 1COOA 2IHNA 4YD1A 2F1JA 1QSLA 9ICQA 3PO4A 3MFIA 3M9MB 4YMMA 4YN4A 4RNNA 4QWEA 3OGUA 3KHRA 3WFPA 4WC3A 2DVIA 3SV4A 3B0YA 4DL6A 4S3NA 1MC8A 5DB6A 3OJSA 3HIYA 3SV3A 4MFAA 1ZQTA 1U45A 4QW9A 1BPZA 5HNKA 3QZ7A 4YR0A 3PMLA 4AT8B 5DDMA 2BE3A 3MGHA 4EYHB 2PXIA 1NK4A 4EEYA 2FMSA 5KTQA 2W8LA 2XY7A 5KT6A 1D9DA 4FS2A 2AJQA 3MR5A 4EBCA 4ED2A 2UVWA 4IG8A 3H8SA 1TFYA 4I2FA 4M6WA 5J2KA 1CEZA 3RR8A 3OUYA 1T4GA 2PFPA 5CR0A 4UAWA 4M6WB 5D4BA 2ALZA 4KLSA 1XSLA 1MIWA 3OUYB 2XCAA 4RQ5A 2PFNA 3THVA 1S0NA 1SKRA 1ZJMA 3MR6A 4FBTA 2ZHBA 3IHQB 4DF8A 2ISPA 1ZETA 1L5UA 4YG2A 9ICMA 1TFRA 8ICXA 2KZ3A 3HX0A 1NJWA 4KLLA 3UPSA 3OHAA 1TKDA 1L3SA 3SYZA 4CCHA 4TQSA 4JV1A 2V4RA 1NK6A 2FMPA 4KTQA 4RT3A 1BPDA 4RQ4A 4YR3A 4KN4A 1NJXA 3V7JA 2ZTEA 2MUTA 3JPRA
chains in the Genus database with same CATH superfamily
1SXDA 4PHPA 2MUTB 1ZJNA 2UVUA 3BQ2A 5BPCA 4QWCA 3BZCA 4FO1A 1WYGA 3CW2C 5J0SA 4B9TA 4EYIB 2BPCA 1RDFA 4XQ7A 5KT7A 2W7PA 1J97A 4CGZA 2DPJA 1BNOA 3RBDA 2M2TA 2VA2A 3ISDA 3LK9A 4KX5A 1PVQA 4MEYA 4NM1A 2HHVA 4I29A 4IRKA 1Q8KA 3I1YA 1EXNA 4EZ9A 5JRTA 3S6JA 2DR5A 2HHSA 2MRLA 3FAHA 4KM5A 5HRHA 4F2SA 1KBUA 3IN5A 3BS7A 1L8OA 5KAFU 4O3PA 1KQQA 5GTHU 3H0LB 8ICAA 5KFQA 4PL2A 3WKCA 3L9DA 2V4QA 4CDGA 4EBEA 2A3VA 4RPYA 4UB5A 4EBDA 3HW8A 2UVRA 3NYBA 4EX7A 4RQ6A 2OH2A 1Y88A 4FBUA 3EPGA 2HN2A 5L1LA 2FLNA 3ZI4A 1MA7A 1N61A 3RRGA 4KN7A 2I9GA 2G5HB 4R65A 1F5AA 2B4VA 4TURA 4LVSA 3C66A 4F71A 4UATA 1K5OA 3AU2A 4E0DA 4M9NA 1UT8A 5KFRA 1FFVA 2JEIA 5BOMA 3T5HA 5DBBA 4PGYA 3T3FA 2PMZC 2A19A 1ZQYA 9ICIA 4K99A 3JPTA 3N4MB 1XSPA 4CE6A 4RWQA 4WJ3B 1ZOLA 2KFZA 4P0QA 5F2VO 5T14A 1O08A 5HRGA 4USAA 4EEKA 2LPEA 2ZTCA 2EAMA 3HP6A 1XSNA 3FM9A 4EV6A 2OEHA 4RUCA 3V7KA 3GV8B 4ED3A 2KIVA 3OJUA 3MDCA 5J2HA 1SKWA 4LEWA 9ICXA 3H39A 2E5SA 4YVZA 1R8CA 2RRDA 2Q66A 1N60A 8ICEA 4Y2PA 4O5KA 4Q8EA 3C21A 3JPSA 5DGAA 5J2EA 3V7LA 3UQ2A 2JZBB 5KG7A 1D9FA 4DCCA 1Z19A 3C1ZA 4US8A 3N7RC 2JH1A 1T7PA 2JGAA 2XVTA 1PVPA 5AKLA 3NVVA 1WCLA 3RJHA 5ALKA 3T5JA 1NK8A 9ICHA 2EZXA 5KT2A 2EDUA 4ICAA 1WWUA 3WK9A 4RPXA 1U47A 4BWJA 4NXVA 2I6XA 8ICJA 4YMNA 9ICVA 1NNLA 5ALVA 4ECTA 1WCNA 3C5FA 2OXOA 5KFIA 1UETA 4JV0A 2H3ZA 3R9KA 4PPXA 1KKXA 5CB1A 2W54A 1N48A 2ZH9A 1ZD4A 1ZQIA 4QZAA 2IA6A 7ICQA 4OJPA 7ICKA 3KHHA 2H3VA 1Q3UA 9ICAA 3OPXA 4DQRA 4QZCA 5IINA 3PR5B 4I2BA 2QARB 4WC1A 3GIMA 2K89A 2E8MA 1ZQPA 1XS9D 8ICLA 4LEVA 4B6JA 2R8KA 2FE9A 4X0AA 2HOIA 5CRXA 3FC4A 5AIBA 2EWRA 4K8VA 2F76X 2OCEA 7ICRA 2W9CB 2RHFA 1VLBA 2M2WA 1TAMA 4ECSA 2KP7A 7ICNA 1U48A 4AT9A 2FPKA 2XCPA 7ICGA 4EX6A 1IG6A 3D2NA 4B9MA 3HJEA 1BVSA 5TISU 1JAJA 3Q8MA 5DG8A 3BS5B 3EZ5A 4EBKA 5J2FA 3NVZA 3UQ0A 2NRVA 3BJYA 3M8RA 4X4QA 2BQUA 3DDHA 4DFJA 2W9BB 3WFRE 4NXUA 2WAQC 3L3FX 3QE9Y 4IR9A 4HAIA 1TFWA 1RQLA 3PX4A 4C4TA 4X4PA 2VKQA 3AMZA 3SR6A 4R64A 2F77X 5HRIA 1ZQGA 4RWOA 3ZDDA 2BBHA 3TAQA 4GIBA 4M5DA 2BCQA 2P6RA 2XGQA 2LMRA 5DB9A 1HJPA 1ZD2P 5AKHA 4QZGA 4F2RA 2ZH1A 1X6JA 4JUZA 4MHVA 4NLCA 5DLFA 3PW2A 1S76D 3L4PA 2DF4B 3NRWA 5AM4A 5JTIA 2HHQA 4US9A 4UW9A 2DR9A 4WC7A 3JYYA 4FHYA 1V85A 2IUBA 4KLGA 4I2AA 3RTVA 3VCBA 2XICA 1RG6A 1MQ3A 2F44A 2ZH6A 1ZRNA 5IIOA 3WU2U 4PH5A 4UBCA 1X9SA 4C8OA 4K97A 2IMWP 1WUDA 5DQHA 5ALZA 4RQ8A 4QJFB 4J9LA 2VANA 5KFEA 4DSJA 9ICTA 3IM1A 3H0RB 5AKZA 2RP5A 4UASA 2Y9UA 4EEDA 1JUDA 1N5WA 4UB2A 1GPJA 3HWTA 8ICKA 4U6PA 5DBCA 4MKPA 3A0BU 2LHTA 4KLMA 2BKEA 4QWBA 2JEJA 3NASA 1ZQKA 3AL0B 1XO0A 3V6KA 2ZUBA 2GOLA 2Y0SC 4IQTA 1RYUA 3CNHA 1DGSA 1K1SA 3WFQE 5AM3A 5D63A 2ODGA 2RQ5A 2FMQA 3QUBA 2IOHA 4GC6A 4UAZA 2PI4A 2Y1IA 2B51A 4YXJA 4CF4A 2UVVA 3GIIA 4KLEA 4LEYA 3PVXA 3NVOA 4E80A 3N7SC 2ZJ8A 2KE7A 4ZH4A 1B4FA 2OHFA 2IHOA 2ZH2A 4ECUA 5HRBA 2XGPA 3LVVA 1SKSA 5J2CA 3O0FA 4DEZA 3PSFA 1Q46A 4RQ2A 4F5NA 1R8AA 4AYBF 3B9JA 2BPFA 2RDIA 3OVSA 2KZZA 4DSIA 1RZTA 1OUQA 1U4BA 2KSOA 3B0XA 2F1IA 3I76A 4UD5A 1WG8A 5KT5A 4Y2RA 5ALHA 1UA0A 3UXOA 1KSPA 1COOA 2F1JA 1KW4A 3PO4A 3MFIA 4NV0A 4WC3A 3SV4A 4DL6A 3SV3A 3RF9A 3PHZA 4QW9A 1BPZA 3AQEA 4YR0A 3PMLA 4AT8B 1Z4OA 1YZ7A 2JXJA 1NK4A 4EEYA 5KTQA 1LKYA 4UAUA 4FS2A 2UVWA 4IG8A 4I2FA 4M6WA 3CK6A 3OUYA 2IOFA 1GO3F 2HBJA 1L7PA 4KLLA 3UPSA 3OHAA 1L3SA 4JV1A 2WHEA 4RQNA 2V4RA 1NK6A 4YR3A 1NJXA 2MUTA 2KNJA 5ALXA 2C28A 2WB1F 1T94A 4FZLA 4PGQA 1PZNA 3Q8RB 3PNCA 1A76A 3SD7A 3TARA 1S8OA 5ALNA 4J9OA 1ZQZA 3KD3A 3PSTA 5HR6A 1Q79A 3IG8A 1KRPA 2OYYA 4JMUA 4IQWA 4PHEA 4EEBA 3WFSC 4F5QA 3BQ7A 5HHIA 4ELUA 4B9LA 3EW9A 3TFSA 2FDRA 1PK1B 2ZTDA 3M9OB 2ASDA 3KBBA 3QU9A 5J2AA 9ICNA 5EOZA 2JEFA 2A1AA 1UT5A 1NKEA 4ELVA 3BQ1A 4O3RA 9ICCA 1FFUA 3QU7A 2QB1A 7ICLA 4DQSA 3NVWA 5KFLA 4M47A 4Z6EA 3KHGA 4IL6U 3GV5B 3HKZF 2BQ3A 1WWVA 1ZQDA 2HBKA 2WF7A 1JMSA 2KN7A 1B0XA 2AQ0A 3MABA 4NLZA 8ICVA 5DEDA 4BXOA 5KT4A 3H37A 1Z1VA 4QZBA 3KOOA 3HRDD 1NK5A 4KLSA 4ECWA 2HHTA 5CJ7A 1RXWA 1RM6C 4P4OA 1UEUA 4GXJA 3GIKA 2JH7A 1HEKA 3JZ0A 3NKUA 2JRZA 4OAFA 4OJOA 3RAXA 4N7RA 4MF8A 5AK6A 1JN3A 4WC2A 4I27A 2ZHAA 1X2IA 2O5AA 3VC8A 4ELTA 3EYZA 2QKQA 2KHQA 3RH6A 3RB6A 3GDXA 5EE0A 3PZPA 2H3FA 8ICUA 4DQQA 2HCFA 1ZQ1C 5C5JA 4OD0A 2FPMA 4DFDA 5L1JA 2NRZA 4UB1A 5AK5A 4F3OA 5G5HA 2A1JB 5ALRA 8ICQA 3AU6A 2XIDA 8ICFA 1V97A 3G6YA 5HMMA 1L7NA 5AI0A 3MFHA 3H40A 5AKGA 3ZDCA 4UBBA 2JZBA 1O03A 5AKJA 5ALPA 3SAGA 5J0PA 1ZQWA 2YQEA 2LKYA 3M1YA 4I2HA 3ORYA 4F4KA 4DLEA 5KFAA 4B9NA 4FHWA 4KLHA 4YP3A 2AHOB 1X66A 5AHXA 3M6ZA 4GFJA 4TUPA 1NZBA 2PI5A 3WKBA 3SAFA 4J9MA 1ZQLA 3C18A 4PL1A 3TKAA 4ECXA 5BOLA 3RR7A 4J9QA 4ED1A 5ALUA 2L5YA 2C2DA 1NOMA 1DXSA 1TAQA 2BCSA 4FZMA 1JXEA 2ZIUB 3G6VA 2W04A 2ZIWB 5G5GA 2R8JA 1K1QA 1PK3A 4F4YA 4FHXA 3F53A 4WCWA 4Z6DA 4UARA 5HRKA 1D8YA 3QX7A 2QARA 2NYVA 3M7DA 2JHDA 2DQNB 2WTFA 1P7DA 4WC4A 2LYHA 2BGWA 5CEHA 1QQ7A 2YTUA 8ICMA 2N1RA 3RRHA 1V9PA 4RZRA 3LWLA 2B0CA 2H3IA 3T5LA 3NUQA 5KFHA 4X4VA 4NWIA 2W9CA 2AGPA 2ESEA 2PKEA 2IHMA 4Q45A 5AIAA 3CYMA 5DQGA 2NRXA 3RJGA 4K9BA 1VDVA 5AM2A 1ZQEA 3PV8A 3QUQA 4CF5A 3PW5A 1Q78A 3IV6A 1KFDA 2F8LA 3MCRA 2E3TA 2YMMA 2JV3A 1S97A 2HSZA 1KDHA 3H7IA 5KFFA 2QB0A 1MSWD 2DRAA 4FHVA 3V6HA 3CP8A 3MR2A 5J2DA 8ICPA 4WC6A 5J0UA 2B56A 4OJ6A 4NXZA 1DK2A 2ZH8A 4TQRA 5ALJA 4C7ZA 1BPYA 2ZXHA 4O3OA 1SZHA 5DBAA 2B6GA 3QEAZ 1AQ6A 7ICUA 5AI4A 3RFAA 5J0YA 3AQLA 4I28A 2BDUA 1D8BA 7ICTA 2D3DA 3SQIA 3UMCA 4X4RA 4Z6FA 4M04A 4NLNA 2J6SA 4GXIA 1ZQMA 3OWGA 2DRBA 3C23A 4X4UA 3H8JA 5C0YA 5L9XA 5AKYA 4BX9C 3V6JA 4BWMA 2KTQA 3AQKA 3ZD9A 1C20A 3WKEA 5JU5A 1JXLA 3E0FA 3WK5A 1KNYA 5TZVA 4O9MA 4OCZA 3L5KA 5EWEA 4M9JA 1N63A 4ZOHC 5ALQA 2BBJA 1X6IA 1ZD5A 2DL0A 2ZG6A 3JCFA 3GQCA 4A8EA 5CA7A 1S77D 2P66A 4RU9A 4R63A 5ALEA 2IBKA 4K98A 2GAFD 4F8RA 1QLNA 5DG7A 2LM4A 9ICKA 1L7MA 1ZQFA 3MDAA 9ICUA 2EAOA 5HC9A 2F8KA 9ICWA 3EPIA 1JQRA 4PZOA 2J6UA 3U26A 4IS7A 9ICJA 4O5CA 2ZH7A 4LEZA 4DFKA 3QNMA 3TADA 2F2AB 8ICTA 3H38A 4DFMA 1L3UA 1CRXA 4G9BA 2ZIXA 2E1FA 5J0XA 1SXEA 4RWNA 2KZMA 2PMZF 1X9WA 2HHWA 5DG9A 4QZIA 1NK9A 2G08A 2MA1A 7ICPA 3K75D 3NVYA 3ETRA 3QU5A 1VJ5A 3EWAA 1L7OA 1Z4NA 3FYHA 5A0LA 4Y2XA 2WFAA 1SL0A 4GLXA 9ICBA 4GC7A 2ZIVB 4YMMA 3WFPA 3OGUA 3KHRA 2YMLA 3GU3A 3B0YA 4S3NA 4P0QB 3DEEA 2G07A 2HN1A 4MFAA 1ZQTA 2YMQA 2KEYA 2E8NA 3QU4A 3AQFA 4O3MA 5DDMA 2BE3A 3MGHA 4EYHB 4EBCA 4ED2A 1SV4A 3H8SA 1CEZA 5D4BA 1MIWA 2PFNA 3THVA 1ZJMA 2ISPA 2KJ9A 1L5UA 9ICMA 4CCHA 3SYZA 4RT3A 2DBYA 1UQVA 4JB3A 4YD2A 3PY8A 4QZHA 2BCRA 2G09A 4EBJA 2VA8A 3M6KA 2NO5A 5AM5A 1TVAA 4RNOA 3D2QA 4RQ0A 3DV9A 1NKCA 3QEBZ 5ALTA 4G3IA 5H2FU 3ISBA 5DKWA 5F3XB 3BZKA 3J81j 1PK1A 5J2JA 4EGWA 1J2NA 3SZ2A 1S0MA 5KL8B 2HBMA 3TFRA 1QH9A 4PHDA 9ICRA 4FFDA 1N2XA 5J2IA 2W3RA 4LZDA 5J0RA 4RNMA 1RXVA 2NV3A 2D6FC 3TI0A 7ICJA 3PW0A 2OWOA 4ECVA 4C8MA 2DPIA 1PX5A 3RH5A 3F5AA 3JPOA 2R8GA 4QWDA 1B22A 5KFYA 2VJ4A 5IIMA 4UB4A 1ZQOA 1KFSA 4XQ8A 2LI6A 1UHUA 3HILA 3ONNA 2O1PA 3HKZC 2FPLA 2P6UA 1SB3C 3ERCC 4DQIA 4M9HA 3UXNA 4UB6U 2Q4TA 2O6KA 2ISOA 2ID1A 4Y2VA 4F5RA 2Y9TA 2HHXA 3ER8C 4B9VA 4MFFA 3ICXA 3Q8PB 5B5EU 4Y2UA 4KLJA 5KG2A 2HOFA 2W3SA 2WF6A 2RFFA 1X9XA 5KG5A 3RB3A 1JI7A 1V4AA 5KG3A 3H4BA 7ICSA 1NK0A 3D6JA 4UQGA 5K4LA 3T5KA 4EENA 1C7YA 1BPEA 5HR7A 1LB2B 2KJ8A 5ALOA 1N56A 4I2JA 3JPQA 4DO9A 4PJ0U 2F1HA 4UB3A 2KVSA 1UEVA 1ZQVA 4KX3A 4XA5A 3Q8LA 4DS4A 8ICGA 5ALFA 2BCUA 4F93B 2RDJA 1KLNA 2PFOA 4UAVA 2K4PA 5JUMA 3C2MA 1TK8A 1FA0A 4MFCA 2KKVA 3KFUF 7ICVA 2FCLA 5D62A 4OAGA 2C22A 4JK1A 4QZ8A 1DGJA 9ICPA 1F5SA 5ALDA 4FZNA 4NL9C 4QZEA 2V9WA 2DWQA 5D49A 4M2YA 4I0UA 4NLBA 5KFBA 4O3SA 4BJQA 3IDWA 1S0VA 1ZQQA 3D2SA 2K4IA 1COKA 7ICFA 2IOFK 5KNIA 1BGXT 3C28A 2BZFA 1IIPA 4Z6CA 5AI5A 2ZIUA 7ICIA 4RQ3A 4LJXA 4UD4A 2ZH3A 8ICIA 3QUCA 4RQ1A 5CFTA 4FS1A 4M9LA 5KFJA 4TUSA 2H3QA 2XI9A 5KFNA 2W9AA 5IIKA 3PX0A 2XY5A 3MBYA 1UCVA 2NRWA 3OSNA 4TUQA 4CRXA 3OHBA 1ECWA 5HP4A 5KFPA 4Q43A 2KMDA 1XU4A 3LDAA 3HJ4A 5F9LA 1ZQXA 5AICA 2EANA 2GO7A 5EE1A 2HHPA 3AEVA 1XNSA 3GILA 5J0OA 4DL5A 3WK8A 2KV2A 4HX0A 3ALRA 4O67A 3NRZA 4PGXA 2Y1JA 3E2EA 3F2DA 2Q0ZX 2QLTA 2M2UA 1KTQA 3RJEA 4AT7B 4ECZA 9ICFA 2G5IB 1ZQCA 4C8KA 3TADC 3PSPA 2R18A 1OW5A 3SMVA 3RJKA 1B43A 4ATBB 4F50A 2HVHA 3ZD8A 2JEGA 4WH5A 2DUYA 5L1KA 5HREA 4KLDA 1SWVA 4RPZA 3IRUA 1UPHA 3RB4A 3RBEA 4F5OA 2LBOA 3ETLA 5CP2A 4JWNA 4U7CA 4X4NA 4F5PA 1ZQJA 4Y2SA 4KITB 1S10A 2BR0A 5J2BA 3H4DA 1PVRA 3IG5A 4QNLA 4KMUA 4KB6A 4DSFA 3BQTA 3MGIA 3SI8A 4WQKA 1Z00B 1IXRA 4C8LA 1JALA 3NTUA 9ICSA 3BQ0A 2G0AA 2XC9A 4RUAA 3WK7A 3N7PD 2KKPA 2F3NA 4GXKA 1X9MA 7ICMA 4O3NA 2R8IA 4F91B 2HI0A 4X0BA 3RJFA 8ICCA 1S0OA 1VJ7A 2KIWA 2G06A 1XO1A 3QUTA 1J2MA 3ER9B 1QSSA 8ICBA 4DOCA 1ZYQA 4FH3A 1Z3EB 2LYAA 4KLQA 1SZPA 1URJA 2W9MA 4P0PB 2HVIA 2HHUA 3AQMA 4CNQA 5DB7A 1TK5A 4DWIA 1JRPA 5E79U 5DECA 5KG6A 2HW3A 3UPQA 3NS1A 3LVWA 1HUZA 1M6YA 3QZ8A 4DL4A 3RJIA 2KFNA 2LM1A 3EUB2 2H5XA 5HMLA 4R8UB 1FEZA 4QIWF 4DSLA 5J29A 4F4XA 2RLTA 2OM6A 5ALMA 4P2HA 3JPPA 2M9NA 4DLGA 1SWWA 4P4MA 1NO5A 5KFKA 1ZQAA 5KFTA 4KLFA 4DL3A 1DOQA 2GWSA 5CWRA 5KG1A 3TAPA 5J8YC 4O3QA 2AU0A 1XC9A 1SL1A 1QQ5A 4WBYA 4WOYA 2W7OA 2I1QA 2C2EA 1KFTA 4RQMA 1LVHA 3BS5A 1MIVA 4ED0A 4DSKA 2J6TA 1FO4A 4RQ7A 2DR7A 4BXOB 3KHLA 2W9BA 2AQ4A 4ED6A 5JTGA 4ED8A 4Y2YA 1YZ6A 2E1EA 4XRHA 3WK6A 3OTQA 2BHNA 5CHEA 3KKAA 5KAIU 2BDPA 3C1YA 4J9RA 2ZUCA 5ALIA 1IM4A 2JR5A 3E58A 2ZIVA 3JPNA 2IHNA 5B3QA 3MGVA 3H0MB 9ICQA 3M9MB 4YN4A 5L1MA 2NO4A 2M0NA 2DVIA 1MC8A 2DKXA 3UM9A 5ALSA 2PXIA 4K96A 5AI9A 2W8LA 5KT6A 2XY7A 3T79A 2AJQA 3MR5A 4Y2TA 3RR8A 3AM9A 1T4GA 2PFPA 5GTIU 5CR0A 4C80A 2ALZA 4RQ5A 2W55A 1S0NA 3MR6A 2HOQA 4NL9A 3IHQB 4DF8A 4FBTA 1ZETA 2ZHBA 4YG2A 1TFRA 1V38A 3HX0A 1NJWA 1Z1BA 4TQSA 4EELA 5AI6A 2FMPA 4KTQA 1BPDA 4KN4A 2EQYA 2P35A 3JPRA 2DKZA 2W03A 3WK4A 1X42A 2HDOA 4DL2A 2I5HA 2WF9A 4KMOB 4NM2A 4NXXA 1T3NA 3ISCA 1KL9A 4DSEA 1JROA 9ICLA 1ZQUA 3WKDA 3HJ1A 1SV0C 2CRXA 1QSYA 1ZQNA 4MEXA 2DGZA 2K8AA 1R8BA 1MN8A 5KFXA 4QZ9A 4F72A 4DS5A 5ALWA 4NKUA 2VJ5A 2KG5A 7ICHA 4Q8FA 2YB4A 4JV2A 1ZQBA 2AGQA 1NJYA 3K7DA 3K1ZA 2ES6A 1TE2A 5KFVA 4M0AA 2FI1A 5KFSA 4B9SA 4KLOA 2AH5A 1TV9A 3WFOA 4EP7A 3SAHA 5DLGA 3OVBA 5J0WA 2YX8A 3QYPA 4P4PA 4DFPA 3M8SA 5HHHA 3KZXA 1RQNA 3PMNA 4YCXA 2VIXA 2YN4A 2C2RA 1U49A 4WBZA 4O0IA 4B9UA 3MC1A 2GH1A 2K8CB 5KFWA 1F44A 8ICRA 5D46A 1SGGA 5DGBA 3TQ1A 1UA1A 1D8LA 2ATLA 4X4OA 4AYBC 1R89A 1A6SA 4XJEA 2ASLA 4AT8A 2QB0B 1KEJA 4AP9A 8ICYA 2DFLA 8ICZA 5AKKA 1MIYA 4YQWA 5CFUA 3LYSA 2CPRA 5EE3A 4ED7A 3G6XA 3C2KA 4IRCA 3ED5A 4WC0A 1T8EA 3RB0A 1L3VA 4K4HA 3C2LA 2KJ5A 2MSNA 1ZD3A 5KFZA 3ZDAA 4IRDA 4LZGA 2KOBA 5HRLA 3PX6A 4PZNA 2E8PA 5DQIA 2PFQA 1A0PA 2ZUDA 5AI8A 1H38A 3KTQA 4QZDA 3LWMA 1A77A 2FJ6A 2EAPA 4NJ8A 3PW7A 1TK0A 1T3QA 5KL1B 2K8BB 9ICGA 1WOTA 3C5GA 2HBLA 2FLPA 4RWPA 3ZDEA 1BPXA 3H3AA 3Q8QB 5KFUA 3UMGA 3F2CA 4NXWA 4ACOA 4J9NA 3MR3A 2WB1C 3H8MA 1OU5A 2WF5A 4C4SA 4YR2A 5KFMA 5B3PA 1JIHA 4X4SA 3K4GA 2AXTU 4UB8U 5ALGA 4YFKA 4Q44A 1ZQRA 4JLXA 4IQVA 5AKIA 3N97B 1IV8A 5KG4A 1YT3A 9ICOA 2ZH5A 2KK0A 4Y2JA 4J9KA 1VFGA 3PSIA 3V72A 2K4EA 3N28A 5KFCA 1LV5A 2W8KA 1N62A 4OAIZ 8ICHA 2BCVA 2AGOA 3KZIU 9ICEA 7ICOA 1NJZA 1SL2A 3LQCB 1CUKA 5J8YA 4OO1J 4IQUA 4NKTA 4FH5A 4RT2A 2MAXA 3SEIA 3GV7B 4C8NA 5J0TA 3SENA 4BGDA 4C0ZA 5J0QA 3FDSA 4DL7A 4R66A 2BPGA 8ICOA 1QQ6A 5IILA 1YLQA 1BPBA 4AT7A 5AKXA 1JX4A 4I2DA 4K4GA 5AKEA 2BQRA 1L6NA 3PR4A 5AM0A 5DB8A 3M9NB 4ATBA 4FO6A 3F5EA 3A0HU 5CHGA 1OXJA 4NY8A 5ALLA 2ZJAA 4QWAA 2WAQF 1BNPA 2K60A 4AT9B 2NRTA 4JLZA 4C7YA 3IP4B 4DQPA 2ZIXB 1XWLA 4X5VA 4NLGA 4J9PA 2CN1A 1ZQSA 4M9GA 2GLEA 5EE9A 4I2CA 2MU2A 3OSPA 3NWIA 5KFGA 3PW4A 3HT3A 3ZDBA 3HPOA 4LT6A 2A1JA 3KKAC 4O69A 3RAQA 3Q8KA 3BDPA 3TACB 3QXGA 1FIQA 4O5EA 1Z00A 2FLLA 2R8HA 2W11A 1TAUA 4FHPA 4JWMA 5IIIA 5AM1A 5HR9A 1S9FA 2M2VA 1NI3A 2D8CA 5D61A 4F92B 1HUOA 1NKBA 1U9LA 3GFKB 3GIJA 1MQ2A 3QU2A 2EZYA 8ICNA 4DOAA 3Q8SB 4I2EA 4YXMA 1L3TA 4UAYA 4IR1A 4F4ZA 2ZH4A 4WQLA 2ZJ5A 8ICWA 1RYRA 1RYSA 2KICA 3AUOA 3AN1A 2CXYA 3PO5A 4KLIA 5DDYA 4Y2QA 1AROP 2ZXIA 3RH4A 1SV0A 2KD1A 4F4WA 4FE3A 4XUSA 3NGDA 1SIJA 2GA9D 5L1IA 4NXTA 4P0PA 5CFSA 4KLUA 5B66U 2KHVA 5KG0A 2VA3A 4E7XA 1ZQHA 2JMGA 2K4HA 2KVCA 2ZIWA 4MF2A 4I2IA 4EZ6A 4J9SA 2YY6A 4I2GA 1S5LU 3TANA 5HRFA 2Y0SF 4DOBA 3OVAA 4PHAA 4K4IA 3EF2A 2XY6A 4E8FA 4QZFA 4R8UA 1L8LA 4ECRA 2E8OA 3CRXA 2EH9A 2B21A 4QW8A 5J2GA 4NLKA 2ASJA 4KLTA 5EWGA 2PBEA 1NK7A 1NZPA 5HRDA 1QTMA 1RPLA 4X4TA 3H8WA 5EWFA 3UXPA 4WC5A 2XO7A 4YMOA 5IIJA 4QIWC 4J03A 4O6AA 1X40A 5AK4A 4ECYA 3I28A 2YB1A 8ICSA 2Z7JA 4BDPA 1ED1A 3OV7A 4CF3A 5KT3A 3AQNA 3C29A 4K9AA 2W43A 2LYBA 4ECQA 4HYKA 3RJJA 1DRGA 7ICEA 1DK3A 5KFDA 1HIWA 2NRKA 4DF4A 1CI4A 2HMXA 3UMBA 2YMPA 2DR8A 3K1RB 1KN5A 4O68A 5KFOA 5F9NA 1ZRMA 1Q3VA 2KSOB 1ZXIA 4YD1A 1QSLA 4C4RA 4RNNA 4QWEA 5DB6A 1QCKA 3OJSA 3HIYA 4OJLA 3WKAA 1U45A 5HNKA 3QZ7A 2EZZA 1N5XA 2FMSA 3F2BA 1D9DA 5FP0A 1TFYA 1LKYB 5J2KA 4UAWA 4M6WB 4OJ5A 1XSLA 2WF8A 3OUYB 2XCAA 1SKRA 5ALYA 1PUZA 3GZFA 8ICXA 4OAHA 2KZ3A 4IC9A 1TKDA 4BUGA 1F0MA 4RQ4A 3V7JA 2ZTEA 5AK3A
chains in the Genus database with same CATH topology
2C28A 4PHPA 2MUTB 4PGQA 1ZJNA 2UVUA 3BQ2A 5BPCA 4QWCA 1PZNA 3Q8RB 4DL2A 3PNCA 4YD2A 1A76A 3TARA 4NM2A 3PY8A 5J0SA 4QZHA 2BCRA 4B9TA 1T3NA 4EBJA 4J9OA 4EYIB 2BPCA 3ISCA 1ZQZA 2VA8A 4DSEA 4XQ7A 5KT7A 9ICLA 2DPJA 1ZQUA 1BNOA 3RBDA 1Q79A 1KRPA 1TVAA 4RNOA 2VA2A 2M2TA 3HJ1A 4RQ0A 3ISDA 4IQWA 3RRGA 4PHEA 3LK9A 1NKCA 4MEYA 4NM1A 2HHVA 3QEBZ 4I29A 4IRKA 1EXNA 4EZ9A 3WFSC 1QSYA 1ZQNA 4MEXA 4G3IA 4F5QA 2DR5A 2HHSA 3ISBA 5DKWA 5HRHA 3H37A 5HHIA 1R8BA 4ELUA 5J2JA 4F2SA 5KFXA 4QZ9A 4B9LA 3EW9A 3TFSA 2ZTDA 3SZ2A 4DS5A 4NKUA 3M9OB 2ASDA 1S0MA 4O3PA 3TFRA 7ICHA 4PHDA 4Q8FA 5KFQA 5J2AA 8ICAA 9ICRA 9ICNA 5EOZA 3L9DA 2V4QA 2JEFA 4JV2A 1UT5A 1NKEA 4ELVA 3BQ1A 5J2IA 4O3RA 9ICCA 4LZDA 7ICLA 4DQSA 1ZQBA 5KFLA 5J0RA 4Z6EA 4RNMA 3KHGA 4EBEA 2AGQA 1NJYA 1RXVA 4M47A 4RPYA 4UB5A 4EBDA 3HW8A 2UVRA 3GV5B 5KFVA 2BQ3A 3NYBA 3TI0A 5KFSA 4M0AA 7ICJA 3PW0A 4RQ6A 1ZQDA 2OWOA 4ECVA 4B9SA 1Y88A 4C8MA 2DPIA 4FBUA 3EPGA 1JMSA 4KLOA 2KN7A 3RH5A 3JPOA 5L1LA 1TV9A 3WFOA 4EP7A 2R8GA 2AQ0A 4QWDA 3MABA 2FLNA 5DLGA 4NLZA 1B22A 5KFYA 8ICVA 5DEDA 3OVBA 5J0WA 4BXOA 5KT4A 4P4PA 4DFPA 3M8SA 4QZBA 5IIMA 5HHHA 1NK5A 4KN7A 4UB4A 4ECWA 1ZQOA 1KFSA 2I9GA 4XQ8A 2HHTA 5CJ7A 1RXWA 2O1PA 4P4OA 4R65A 3PMNA 1F5AA 4YCXA 4GXJA 1UEUA 2FPLA 2P6UA 4TURA 3GIKA 4LVSA 3C66A 3JZ0A 4E0DA 3AU2A 2C2RA 1U49A 4M9NA 4O0IA 4B9UA 4WBZA 3RAXA 1UT8A 5KFRA 4DQIA 4M9HA 3UXNA 2JEIA 4MF8A 5BOMA 3T5HA 5DBBA 4PGYA 2ISOA 2ID1A 1JN3A 3T3FA 5KFWA 8ICRA 4WC2A 4F5RA 5D46A 4I27A 2ZHAA 1ZQYA 1X2IA 9ICIA 2O5AA 3JPTA 3N4MB 2HHXA 5DGBA 1XSPA 4B9VA 3TQ1A 4MFFA 1UA1A 4ELTA 4RWQA 3EYZA 1D8LA 2KFZA 3RH6A 2ATLA 3Q8PB 3RB6A 3GDXA 4X4OA 4KLJA 1R89A 5F2VO 5KG2A 5HRGA 2ASLA 8ICUA 2ZTCA 4DQQA 3HP6A 2RFFA 4AT8A 1KEJA 5C5JA 1XSNA 2DFLA 8ICYA 8ICZA 1MIYA 5KG5A 3RB3A 1V4AA 2FPMA 5KG3A 4YQWA 3H4BA 5L1JA 7ICSA 2NRZA 4RUCA 4UB1A 3V7KA 1NK0A 4F3OA 3GV8B 4ED3A 4UQGA 2A1JB 3OJUA 3MDCA 4ED7A 3T5KA 5J2HA 1SKWA 3G6XA 3C2KA 4IRCA 9ICXA 1C7YA 4WC0A 1BPEA 1T8EA 3RB0A 3H39A 8ICQA 1LB2B 4YVZA 1R8CA 3AU6A 1N56A 1L3VA 8ICFA 4K4HA 3C2LA 4I2JA 3JPQA 5KFZA 4DO9A 3ZDAA 2F1HA 2Q66A 4UB3A 3G6YA 4IRDA 4LZGA 5HRLA 1UEVA 5HMMA 1ZQVA 8ICEA 3Q8LA 4XA5A 3MFHA 4DS4A 3H40A 3PX6A 3ZDCA 4O5KA 4Q8EA 8ICGA 4UBBA 3C21A 5DQIA 2PFQA 2JZBA 3JPSA 5J0PA 5DGAA 2BCUA 2ZUDA 4F93B 5J2EA 2RDJA 1KLNA 1H38A 2PFOA 1ZQWA 3V7LA 5JUMA 2JZBB 5KG7A 3UQ2A 1D9FA 3KTQA 3C2MA 1TK8A 4QZDA 3LWMA 1A77A 4MFCA 4I2HA 3PW7A 1FA0A 7ICVA 3C1ZA 1T7PA 1TK0A 3ORYA 2C22A 4F4KA 4JK1A 4QZ8A 4DLEA 5KFAA 4B9NA 9ICPA 9ICGA 4FHWA 4KLHA 4YP3A 3C5GA 1WCLA 1WOTA 2FLPA 3RJHA 3T5JA 4RWPA 3ZDEA 1BPXA 4QZEA 4M9JA 3H3AA 3Q8QB 1NK8A 2V9WA 9ICHA 5KFUA 4TUPA 5D49A 4M2YA 5KT2A 5KFBA 4RPXA 1U47A 4BWJA 4O3SA 4J9NA 2PI5A 3MR3A 8ICJA 4YMNA 9ICVA 1S0VA 1ZQQA 4ECTA 1WCNA 3C5FA 4J9MA 5KFIA 7ICFA 1ZQLA 1OU5A 4JV0A 1UETA 3C18A 1BGXT 4YR2A 5KFMA 5BOLA 4J9QA 4Z6CA 4ECXA 1JIHA 3RR7A 3K4GA 4PPXA 4X4SA 7ICIA 4ED1A 4YFKA 4RQ3A 4Q44A 1ZQRA 2C2DA 1NOMA 4IQVA 4UD4A 3N97B 8ICIA 2ZH3A 1TAQA 5KG4A 5CB1A 2BCSA 1JXEA 3G6VA 4RQ1A 9ICOA 4FS1A 4M9LA 4AT7B 5KFJA 4TUSA 2ZH5A 1N48A 2W9AA 1ZQIA 5KFNA 2ZH9A 4QZAA 5IIKA 4J9KA 3PX0A 2R8JA 2XY5A 1K1QA 3MBYA 2IA6A 1VFGA 4F4YA 7ICQA 4FHXA 3V72A 2NRWA 5KFCA 4TUQA 3OSNA 3KHHA 7ICKA 3OHBA 1LV5A 2W8KA 5HP4A 9ICAA 4Z6DA 5KFPA 4Q43A 2BCVA 1D8YA 8ICHA 5HRKA 2AGOA 4WCWA 1XU4A 3LDAA 4DQRA 9ICEA 7ICOA 4QZCA 1NJZA 5IINA 3HJ4A 5F9LA 3PR5B 1SL2A 2WTFA 4I2BA 3LQCB 4WC1A 1CUKA 4WC4A 1ZQXA 2LYHA 4IQUA 2BGWA 4NKTA 3GIMA 2HHPA 4FH5A 3GILA 1ZQPA 5J0OA 4RT2A 1XS9D 4DL5A 8ICLA 8ICMA 2MAXA 3GV7B 3RRHA 1V9PA 4C8NA 5J0TA 5J0QA 4RZRA 4BGDA 2R8KA 3FDSA 3LWLA 4X0AA 4DL7A 4R66A 3T5LA 2BPGA 8ICOA 5KFHA 5IILA 4X4VA 1YLQA 2W9CA 2AGPA 1BPBA 4PGXA 2Y1JA 4AT7A 3E2EA 2IHMA 4Q45A 1JX4A 4I2DA 4K4GA 2Q0ZX 7ICRA 2W9CB 2M2UA 5DQGA 1KTQA 2NRXA 2BQRA 4ECZA 3RJEA 3RJGA 3PR4A 9ICFA 5DB8A 2M2WA 1ZQCA 4C8KA 3M9NB 4ECSA 4ATBA 4FO6A 2KP7A 7ICNA 5CHGA 1U48A 4AT9A 2FPKA 1ZQEA 4NY8A 2ZJAA 2XCPA 3PV8A 1B43A 4QWAA 4F50A 3PW5A 3RJKA 1BNPA 2HVHA 4ATBB 4AT9B 7ICGA 2NRTA 1Q78A 3ZD8A 2JEGA 4B9MA 1KFDA 1BVSA 5L1KA 1JAJA 3Q8MA 4KLDA 5HREA 4RPZA 1S97A 1KDHA 4DQPA 5DG8A 3EZ5A 3H7IA 3RB4A 1XWLA 5J2FA 3RBEA 5KFFA 4X5VA 4NLGA 4F5OA 4J9PA 3ETLA 4EBKA 3UQ0A 5CP2A 4JWNA 2NRVA 3BJYA 3M8RA 1ZQSA 4M9GA 4X4QA 4I2CA 2BQUA 4X4NA 4F5PA 3OSPA 1MSWD 2DRAA 5KFGA 4DFJA 4FHVA 3PW4A 2W9BB 1ZQJA 3WFRE 4KITB 3V6HA 3HT3A 3MR2A 1S10A 2BR0A 5J2BA 3QE9Y 5J2DA 3ZDBA 3H4DA 4IR9A 8ICPA 4WC6A 3HPOA 4LT6A 2A1JA 5J0UA 1TFWA 3RAQA 3Q8KA 3BDPA 3PX4A 4NXZA 4X4PA 4KMUA 4O5EA 1Z00A 4DSFA 2FLLA 3BQTA 4R64A 3MGIA 3SI8A 1DK2A 2ZH8A 2R8HA 4TQRA 1Z00B 1ZQGA 1TAUA 3ZDDA 5HRIA 4RWOA 1IXRA 4C8LA 4FHPA 4JWMA 5IIIA 3TAQA 5HR9A 4M5DA 2BCQA 1S9FA 1BPYA 2P6RA 3NTUA 5DB9A 2XGQA 1HJPA 9ICSA 2M2VA 4O3OA 4QZGA 4F2RA 5DBAA 2ZH1A 3BQ0A 3QEAZ 4JUZA 2XC9A 4F92B 4RUAA 1HUOA 1NKBA 1U9LA 3GFKB 3GIJA 5DLFA 1MQ2A 7ICUA 3PW2A 8ICNA 5J0YA 3AQLA 4DOAA 1S76D 3Q8SB 4I28A 4GXKA 1X9MA 4I2EA 7ICMA 7ICTA 4YXMA 4O3NA 2R8IA 1L3TA 4UAYA 4IR1A 4F91B 4F4ZA 4X0BA 4Z6FA 4X4RA 2ZH4A 2HHQA 3RJFA 4M04A 1S0OA 4NLNA 8ICCA 2J6SA 1VJ7A 2DR9A 4GXIA 2ZJ5A 1ZQMA 8ICWA 4WC7A 1RYRA 1RYSA 1XO1A 2DRBA 3C23A 3AUOA 3H8JA 4X4UA 1QSSA 8ICBA 5L9XA 3JYYA 4FHYA 4DOCA 3PO5A 4KLIA 4KLGA 4I2AA 1ZYQA 3RTVA 5DDYA 1AROP 3V6JA 4BWMA 3RH4A 2KTQA 3ZD9A 3AQKA 4FH3A 1MQ3A 4F4WA 4XUSA 1JXLA 5IIOA 4PH5A 3NGDA 4UBCA 1X9SA 4C8OA 2ZH6A 1Z3EB 5L1IA 4KLUA 2VA3A 4E7XA 5KG0A 2IMWP 5DQHA 4KLQA 1SZPA 5TZVA 4O9MA 1KNYA 4RQ8A 2W9MA 4J9LA 2VANA 1ZQHA 2HVIA 2HHUA 3AQMA 4MF2A 5KFEA 5EWEA 4I2IA 5DB7A 3IM1A 4DSJA 4J9SA 1TK5A 4DWIA 4EZ6A 9ICTA 4I2GA 3TANA 5HRFA 3GQCA 4DOBA 5KG6A 2HW3A 5DECA 3OVAA 4PHAA 5CA7A 3UPQA 4K4IA 1S77D 4UB2A 2P66A 1HUZA 4RU9A 3QZ8A 4DL4A 4R63A 3HWTA 3RJIA 2XY6A 8ICKA 4E8FA 5DBCA 4QZFA 2KFNA 4R8UA 4KLMA 2BKEA 4QWBA 2JEJA 2IBKA 4ECRA 5HMLA 2H5XA 4F8RA 1QLNA 4R8UB 1ZQKA 5DG7A 1PX5A 9ICKA 3V6KA 1ZQFA 3MDAA 4DSLA 2B21A 2ZUBA 4QW8A 9ICUA 5J2GA 5J29A 4IQTA 4F4XA 4NLKA 1DGSA 1K1SA 3WFQE 2ASJA 5HC9A 4KLTA 5EWGA 2PBEA 1NK7A 9ICWA 3EPIA 2FMQA 4P2HA 1JQRA 1NZPA 3JPPA 2J6UA 2M9NA 4DLGA 5HRDA 4P4MA 1QTMA 1RPLA 5KFKA 4GC6A 1ZQAA 1NO5A 4X4TA 3H8WA 5KFTA 4KLFA 4UAZA 2PI4A 4DL3A 5EWFA 3UXPA 2Y1IA 1DOQA 2GWSA 4WC5A 2XO7A 4YXJA 4YMOA 5IIJA 2UVVA 9ICJA 5CWRA 5KG1A 3GIIA 3TAPA 4O3QA 2AU0A 1XC9A 1SL1A 4O5CA 4ECYA 2ZH7A 4DFKA 4KLEA 8ICSA 3PVXA 4WBYA 2I1QA 2C2EA 4BDPA 3OV7A 5KT3A 8ICTA 3H38A 4DFMA 3AQNA 1L3UA 1KFTA 4E80A 2ZJ8A 1MIVA 4ED0A 4ECQA 4ZH4A 5J0XA 4DSKA 4RWNA 2J6TA 2KZMA 1X9WA 4HYKA 3RJJA 2ZH2A 4ECUA 4RQ7A 2XGPA 2HHWA 5KFDA 1SKSA 7ICEA 1DK3A 5J2CA 4BXOB 2DR7A 4DEZA 5DG9A 3KHLA 4QZIA 2W9BA 2AQ4A 4RQ2A 4ED6A 4F5NA 3K75D 1NK9A 7ICPA 4ED8A 1R8AA 2NRKA 4DF4A 2BPFA 2RDIA 3OVSA 2KZZA 4DSIA 3EWAA 1RZTA 4XRHA 2DR8A 1U4BA 5KFOA 2BHNA 3B0XA 2F1IA 4UD5A 3FYHA 5F9NA 5KT5A 2BDPA 5HRBA 3C1YA 4J9RA 2ZUCA 1IM4A 1SL0A 4GLXA 9ICBA 1UA0A 3UXOA 3JPNA 4GC7A 1KSPA 1COOA 2IHNA 4YD1A 2F1JA 1QSLA 9ICQA 3PO4A 3MFIA 3M9MB 4YMMA 4YN4A 4RNNA 4QWEA 3OGUA 3KHRA 3WFPA 4WC3A 2DVIA 3SV4A 3B0YA 4DL6A 4S3NA 1MC8A 5DB6A 3OJSA 3HIYA 3SV3A 4MFAA 1ZQTA 1U45A 4QW9A 1BPZA 5HNKA 3QZ7A 4YR0A 3PMLA 4AT8B 5DDMA 2BE3A 3MGHA 4EYHB 2PXIA 1NK4A 4EEYA 2FMSA 5KTQA 2W8LA 2XY7A 5KT6A 1D9DA 4FS2A 2AJQA 3MR5A 4EBCA 4ED2A 2UVWA 4IG8A 3H8SA 1TFYA 4I2FA 4M6WA 5J2KA 1CEZA 3RR8A 3OUYA 1T4GA 2PFPA 5CR0A 4UAWA 4M6WB 5D4BA 2ALZA 4KLSA 1XSLA 1MIWA 3OUYB 2XCAA 4RQ5A 2PFNA 3THVA 1S0NA 1SKRA 1ZJMA 3MR6A 4FBTA 2ZHBA 3IHQB 4DF8A 2ISPA 1ZETA 1L5UA 4YG2A 9ICMA 1TFRA 8ICXA 2KZ3A 3HX0A 1NJWA 4KLLA 3UPSA 3OHAA 1TKDA 1L3SA 3SYZA 4CCHA 4TQSA 4JV1A 2V4RA 1NK6A 2FMPA 4KTQA 4RT3A 1BPDA 4RQ4A 4YR3A 4KN4A 1NJXA 3V7JA 2ZTEA 2MUTA 3JPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C28 A;  4PHP A;  2MUT B;  4PGQ A;  1ZJN A;  2UVU A;  3BQ2 A;  5BPC A;  4QWC A;  1PZN A;  3Q8R B;  4DL2 A;  3PNC A;  4YD2 A;  1A76 A;  3TAR A;  4NM2 A;  3PY8 A;  5J0S A;  4QZH A;  2BCR A;  4B9T A;  1T3N A;  4EBJ A;  4J9O A;  4EYI B;  2BPC A;  3ISC A;  1ZQZ A;  2VA8 A;  4DSE A;  4XQ7 A;  5KT7 A;  9ICL A;  2DPJ A;  1ZQU A;  1BNO A;  3RBD A;  1Q79 A;  1KRP A;  1TVA A;  4RNO A;  2VA2 A;  2M2T A;  3HJ1 A;  4RQ0 A;  3ISD A;  4IQW A;  3RRG A;  4PHE A;  3LK9 A;  1NKC A;  4MEY A;  4NM1 A;  2HHV A;  3QEB Z;  4I29 A;  4IRK A;  1EXN A;  4EZ9 A;  3WFS C;  1QSY A;  1ZQN A;  4MEX A;  4G3I A;  4F5Q A;  2DR5 A;  2HHS A;  3ISB A;  5DKW A;  5HRH A;  3H37 A;  5HHI A;  1R8B A;  4ELU A;  5J2J A;  4F2S A;  5KFX A;  4QZ9 A;  4B9L A;  3EW9 A;  3TFS A;  2ZTD A;  3SZ2 A;  4DS5 A;  4NKU A;  3M9O B;  2ASD A;  1S0M A;  4O3P A;  3TFR A;  7ICH A;  4PHD A;  4Q8F A;  5KFQ A;  5J2A A;  8ICA A;  9ICR A;  9ICN A;  5EOZ A;  3L9D A;  2V4Q A;  2JEF A;  4JV2 A;  1UT5 A;  1NKE A;  4ELV A;  3BQ1 A;  5J2I A;  4O3R A;  9ICC A;  4LZD A;  7ICL A;  4DQS A;  1ZQB A;  5KFL A;  5J0R A;  4Z6E A;  4RNM A;  3KHG A;  4EBE A;  2AGQ A;  1NJY A;  1RXV A;  4M47 A;  4RPY A;  4UB5 A;  4EBD A;  3HW8 A;  2UVR A;  3GV5 B;  5KFV A;  2BQ3 A;  3NYB A;  3TI0 A;  5KFS A;  4M0A A;  7ICJ A;  3PW0 A;  4RQ6 A;  1ZQD A;  2OWO A;  4ECV A;  4B9S A;  1Y88 A;  4C8M A;  2DPI A;  4FBU A;  3EPG A;  1JMS A;  4KLO A;  2KN7 A;  3RH5 A;  3JPO A;  5L1L A;  1TV9 A;  3WFO A;  4EP7 A;  2R8G A;  2AQ0 A;  4QWD A;  3MAB A;  2FLN A;  5DLG A;  4NLZ A;  1B22 A;  5KFY A;  8ICV A;  5DED A;  3OVB A;  5J0W A;  4BXO A;  5KT4 A;  4P4P A;  4DFP A;  3M8S A;  4QZB A;  5IIM A;  5HHH A;  1NK5 A;  4KN7 A;  4UB4 A;  4ECW A;  1ZQO A;  1KFS A;  2I9G A;  4XQ8 A;  2HHT A;  5CJ7 A;  1RXW A;  2O1P A;  4P4O A;  4R65 A;  3PMN A;  1F5A A;  4YCX A;  4GXJ A;  1UEU A;  2FPL A;  2P6U A;  4TUR A;  3GIK A;  4LVS A;  3C66 A;  3JZ0 A;  4E0D A;  3AU2 A;  2C2R A;  1U49 A;  4M9N A;  4O0I A;  4B9U A;  4WBZ A;  3RAX A;  1UT8 A;  5KFR A;  4DQI A;  4M9H A;  3UXN A;  2JEI A;  4MF8 A;  5BOM A;  3T5H A;  5DBB A;  4PGY A;  2ISO A;  2ID1 A;  1JN3 A;  3T3F A;  5KFW A;  8ICR A;  4WC2 A;  4F5R A;  5D46 A;  4I27 A;  2ZHA A;  1ZQY A;  1X2I A;  9ICI A;  2O5A A;  3JPT A;  3N4M B;  2HHX A;  5DGB A;  1XSP A;  4B9V A;  3TQ1 A;  4MFF A;  1UA1 A;  4ELT A;  4RWQ A;  3EYZ A;  1D8L A;  2KFZ A;  3RH6 A;  2ATL A;  3Q8P B;  3RB6 A;  3GDX A;  4X4O A;  4KLJ A;  1R89 A;  5F2V O;  5KG2 A;  5HRG A;  2ASL A;  8ICU A;  2ZTC A;  4DQQ A;  3HP6 A;  2RFF A;  4AT8 A;  1KEJ A;  5C5J A;  1XSN A;  2DFL A;  8ICY A;  8ICZ A;  1MIY A;  5KG5 A;  3RB3 A;  1V4A A;  2FPM A;  5KG3 A;  4YQW A;  3H4B A;  5L1J A;  7ICS A;  2NRZ A;  4RUC A;  4UB1 A;  3V7K A;  1NK0 A;  4F3O A;  3GV8 B;  4ED3 A;  4UQG A;  2A1J B;  3OJU A;  3MDC A;  4ED7 A;  3T5K A;  5J2H A;  1SKW A;  3G6X A;  3C2K A;  4IRC A;  9ICX A;  1C7Y A;  4WC0 A;  1BPE A;  1T8E A;  3RB0 A;  3H39 A;  8ICQ A;  1LB2 B;  4YVZ A;  1R8C A;  3AU6 A;  1N56 A;  1L3V A;  8ICF A;  4K4H A;  3C2L A;  4I2J A;  3JPQ A;  5KFZ A;  4DO9 A;  3ZDA A;  2F1H A;  2Q66 A;  4UB3 A;  3G6Y A;  4IRD A;  4LZG A;  5HRL A;  1UEV A;  5HMM A;  1ZQV A;  8ICE A;  3Q8L A;  4XA5 A;  3MFH A;  4DS4 A;  3H40 A;  3PX6 A;  3ZDC A;  4O5K A;  4Q8E A;  8ICG A;  4UBB A;  3C21 A;  5DQI A;  2PFQ A;  2JZB A;  3JPS A;  5J0P A;  5DGA A;  2BCU A;  2ZUD A;  4F93 B;  5J2E A;  2RDJ A;  1KLN A;  1H38 A;  2PFO A;  1ZQW A;  3V7L A;  5JUM A;  2JZB B;  5KG7 A;  3UQ2 A;  1D9F A;  3KTQ A;  3C2M A;  1TK8 A;  4QZD A;  3LWM A;  1A77 A;  4MFC A;  4I2H A;  3PW7 A;  1FA0 A;  7ICV A;  3C1Z A;  1T7P A;  1TK0 A;  3ORY A;  2C22 A;  4F4K A;  4JK1 A;  4QZ8 A;  4DLE A;  5KFA A;  4B9N A;  9ICP A;  9ICG A;  4FHW A;  4KLH A;  4YP3 A;  3C5G A;  1WCL A;  1WOT A;  2FLP A;  3RJH A;  3T5J A;  4RWP A;  3ZDE A;  1BPX A;  4QZE A;  4M9J A;  3H3A A;  3Q8Q B;  1NK8 A;  2V9W A;  9ICH A;  5KFU A;  4TUP A;  5D49 A;  4M2Y A;  5KT2 A;  5KFB A;  4RPX A;  1U47 A;  4BWJ A;  4O3S A;  4J9N A;  2PI5 A;  3MR3 A;  8ICJ A;  4YMN A;  9ICV A;  1S0V A;  1ZQQ A;  4ECT A;  1WCN A;  3C5F A;  4J9M A;  5KFI A;  7ICF A;  1ZQL A;  1OU5 A;  4JV0 A;  1UET A;  3C18 A;  1BGX T;  4YR2 A;  5KFM A;  5BOL A;  4J9Q A;  4Z6C A;  4ECX A;  1JIH A;  3RR7 A;  3K4G A;  4PPX A;  4X4S A;  7ICI A;  4ED1 A;  4YFK A;  4RQ3 A;  4Q44 A;  1ZQR A;  2C2D A;  1NOM A;  4IQV A;  4UD4 A;  3N97 B;  8ICI A;  2ZH3 A;  1TAQ A;  5KG4 A;  5CB1 A;  2BCS A;  1JXE A;  3G6V A;  4RQ1 A;  9ICO A;  4FS1 A;  4M9L A;  4AT7 B;  5KFJ A;  4TUS A;  2ZH5 A;  1N48 A;  2W9A A;  1ZQI A;  5KFN A;  2ZH9 A;  4QZA A;  5IIK A;  4J9K A;  3PX0 A;  2R8J A;  2XY5 A;  1K1Q A;  3MBY A;  2IA6 A;  1VFG A;  4F4Y A;  7ICQ A;  4FHX A;  3V72 A;  2NRW A;  5KFC A;  4TUQ A;  3OSN A;  3KHH A;  7ICK A;  3OHB A;  1LV5 A;  2W8K A;  5HP4 A;  9ICA A;  4Z6D A;  5KFP A;  4Q43 A;  2BCV A;  1D8Y A;  8ICH A;  5HRK A;  2AGO A;  4WCW A;  1XU4 A;  3LDA A;  4DQR A;  9ICE A;  7ICO A;  4QZC A;  1NJZ A;  5IIN A;  3HJ4 A;  5F9L A;  3PR5 B;  1SL2 A;  2WTF A;  4I2B A;  3LQC B;  4WC1 A;  1CUK A;  4WC4 A;  1ZQX A;  2LYH A;  4IQU A;  2BGW A;  4NKT A;  3GIM A;  2HHP A;  4FH5 A;  3GIL A;  1ZQP A;  5J0O A;  4RT2 A;  1XS9 D;  4DL5 A;  8ICL A;  8ICM A;  2MAX A;  3GV7 B;  3RRH A;  1V9P A;  4C8N A;  5J0T A;  5J0Q A;  4RZR A;  4BGD A;  2R8K A;  3FDS A;  3LWL A;  4X0A A;  4DL7 A;  4R66 A;  3T5L A;  2BPG A;  8ICO A;  5KFH A;  5IIL A;  4X4V A;  1YLQ A;  2W9C A;  2AGP A;  1BPB A;  4PGX A;  2Y1J A;  4AT7 A;  3E2E A;  2IHM A;  4Q45 A;  1JX4 A;  4I2D A;  4K4G A;  2Q0Z X;  7ICR A;  2W9C B;  2M2U A;  5DQG A;  1KTQ A;  2NRX A;  2BQR A;  4ECZ A;  3RJE A;  3RJG A;  3PR4 A;  9ICF A;  5DB8 A;  2M2W A;  1ZQC A;  4C8K A;  3M9N B;  4ECS A;  4ATB A;  4FO6 A;  2KP7 A;  7ICN A;  5CHG A;  1U48 A;  4AT9 A;  2FPK A;  1ZQE A;  4NY8 A;  2ZJA A;  2XCP A;  3PV8 A;  1B43 A;  4QWA A;  4F50 A;  3PW5 A;  3RJK A;  1BNP A;  2HVH A;  4ATB B;  4AT9 B;  7ICG A;  2NRT A;  1Q78 A;  3ZD8 A;  2JEG A;  4B9M A;  1KFD A;  1BVS A;  5L1K A;  1JAJ A;  3Q8M A;  4KLD A;  5HRE A;  4RPZ A;  1S97 A;  1KDH A;  4DQP A;  5DG8 A;  3EZ5 A;  3H7I A;  3RB4 A;  1XWL A;  5J2F A;  3RBE A;  5KFF A;  4X5V A;  4NLG A;  4F5O A;  4J9P A;  3ETL A;  4EBK A;  3UQ0 A;  5CP2 A;  4JWN A;  2NRV A;  3BJY A;  3M8R A;  1ZQS A;  4M9G A;  4X4Q A;  4I2C A;  2BQU A;  4X4N A;  4F5P A;  3OSP A;  1MSW D;  2DRA A;  5KFG A;  4DFJ A;  4FHV A;  3PW4 A;  2W9B B;  1ZQJ A;  3WFR E;  4KIT B;  3V6H A;  3HT3 A;  3MR2 A;  1S10 A;  2BR0 A;  5J2B A;  3QE9 Y;  5J2D A;  3ZDB A;  3H4D A;  4IR9 A;  8ICP A;  4WC6 A;  3HPO A;  4LT6 A;  2A1J A;  5J0U A;  1TFW A;  3RAQ A;  3Q8K A;  3BDP A;  3PX4 A;  4NXZ A;  4X4P A;  4KMU A;  4O5E A;  1Z00 A;  4DSF A;  2FLL A;  3BQT A;  4R64 A;  3MGI A;  3SI8 A;  1DK2 A;  2ZH8 A;  2R8H A;  4TQR A;  1Z00 B;  1ZQG A;  1TAU A;  3ZDD A;  5HRI A;  4RWO A;  1IXR A;  4C8L A;  4FHP A;  4JWM A;  5III A;  3TAQ A;  5HR9 A;  4M5D A;  2BCQ A;  1S9F A;  1BPY A;  2P6R A;  3NTU A;  5DB9 A;  2XGQ A;  1HJP A;  9ICS A;  2M2V A;  4O3O A;  4QZG A;  4F2R A;  5DBA A;  2ZH1 A;  3BQ0 A;  3QEA Z;  4JUZ A;  2XC9 A;  4F92 B;  4RUA A;  1HUO A;  1NKB A;  1U9L A;  3GFK B;  3GIJ A;  5DLF A;  1MQ2 A;  7ICU A;  3PW2 A;  8ICN A;  5J0Y A;  3AQL A;  4DOA A;  1S76 D;  3Q8S B;  4I28 A;  4GXK A;  1X9M A;  4I2E A;  7ICM A;  7ICT A;  4YXM A;  4O3N A;  2R8I A;  1L3T A;  4UAY A;  4IR1 A;  4F91 B;  4F4Z A;  4X0B A;  4Z6F A;  4X4R A;  2ZH4 A;  2HHQ A;  3RJF A;  4M04 A;  1S0O A;  4NLN A;  8ICC A;  2J6S A;  1VJ7 A;  2DR9 A;  4GXI A;  2ZJ5 A;  1ZQM A;  8ICW A;  4WC7 A;  1RYR A;  1RYS A;  1XO1 A;  2DRB A;  3C23 A;  3AUO A;  3H8J A;  4X4U A;  1QSS A;  8ICB A;  5L9X A;  3JYY A;  4FHY A;  4DOC A;  3PO5 A;  4KLI A;  4KLG A;  4I2A A;  1ZYQ A;  3RTV A;  5DDY A;  1ARO P;  3V6J A;  4BWM A;  3RH4 A;  2KTQ A;  3ZD9 A;  3AQK A;  4FH3 A;  1MQ3 A;  4F4W A;  4XUS A;  1JXL A;  5IIO A;  4PH5 A;  3NGD A;  4UBC A;  1X9S A;  4C8O A;  2ZH6 A;  1Z3E B;  5L1I A;  4KLU A;  2VA3 A;  4E7X A;  5KG0 A;  2IMW P;  5DQH A;  4KLQ A;  1SZP A;  5TZV A;  4O9M A;  1KNY A;  4RQ8 A;  2W9M A;  4J9L A;  2VAN A;  1ZQH A;  2HVI A;  2HHU A;  3AQM A;  4MF2 A;  5KFE A;  5EWE A;  4I2I A;  5DB7 A;  3IM1 A;  4DSJ A;  4J9S A;  1TK5 A;  4DWI A;  4EZ6 A;  9ICT A;  4I2G A;  3TAN A;  5HRF A;  3GQC A;  4DOB A;  5KG6 A;  2HW3 A;  5DEC A;  3OVA A;  4PHA A;  5CA7 A;  3UPQ A;  4K4I A;  1S77 D;  4UB2 A;  2P66 A;  1HUZ A;  4RU9 A;  3QZ8 A;  4DL4 A;  4R63 A;  3HWT A;  3RJI A;  2XY6 A;  8ICK A;  4E8F A;  5DBC A;  4QZF A;  2KFN A;  4R8U A;  4KLM A;  2BKE A;  4QWB A;  2JEJ A;  2IBK A;  4ECR A;  5HML A;  2H5X A;  4F8R A;  1QLN A;  4R8U B;  1ZQK A;  5DG7 A;  1PX5 A;  9ICK A;  3V6K A;  1ZQF A;  3MDA A;  4DSL A;  2B21 A;  2ZUB A;  4QW8 A;  9ICU A;  5J2G A;  5J29 A;  4IQT A;  4F4X A;  4NLK A;  1DGS A;  1K1S A;  3WFQ E;  2ASJ A;  5HC9 A;  4KLT A;  5EWG A;  2PBE A;  1NK7 A;  9ICW A;  3EPI A;  2FMQ A;  4P2H A;  1JQR A;  1NZP A;  3JPP A;  2J6U A;  2M9N A;  4DLG A;  5HRD A;  4P4M A;  1QTM A;  1RPL A;  5KFK A;  4GC6 A;  1ZQA A;  1NO5 A;  4X4T A;  3H8W A;  5KFT A;  4KLF A;  4UAZ A;  2PI4 A;  4DL3 A;  5EWF A;  3UXP A;  2Y1I A;  1DOQ A;  2GWS A;  4WC5 A;  2XO7 A;  4YXJ A;  4YMO A;  5IIJ A;  2UVV A;  9ICJ A;  5CWR A;  5KG1 A;  3GII A;  3TAP A;  4O3Q A;  2AU0 A;  1XC9 A;  1SL1 A;  4O5C A;  4ECY A;  2ZH7 A;  4DFK A;  4KLE A;  8ICS A;  3PVX A;  4WBY A;  2I1Q A;  2C2E A;  4BDP A;  3OV7 A;  5KT3 A;  8ICT A;  3H38 A;  4DFM A;  3AQN A;  1L3U A;  1KFT A;  4E80 A;  2ZJ8 A;  1MIV A;  4ED0 A;  4ECQ A;  4ZH4 A;  5J0X A;  4DSK A;  4RWN A;  2J6T A;  2KZM A;  1X9W A;  4HYK A;  3RJJ A;  2ZH2 A;  4ECU A;  4RQ7 A;  2XGP A;  2HHW A;  5KFD A;  1SKS A;  7ICE A;  1DK3 A;  5J2C A;  4BXO B;  2DR7 A;  4DEZ A;  5DG9 A;  3KHL A;  4QZI A;  2W9B A;  2AQ4 A;  4RQ2 A;  4ED6 A;  4F5N A;  3K75 D;  1NK9 A;  7ICP A;  4ED8 A;  1R8A A;  2NRK A;  4DF4 A;  2BPF A;  2RDI A;  3OVS A;  2KZZ A;  4DSI A;  3EWA A;  1RZT A;  4XRH A;  2DR8 A;  1U4B A;  5KFO A;  2BHN A;  3B0X A;  2F1I A;  4UD5 A;  3FYH A;  5F9N A;  5KT5 A;  2BDP A;  5HRB A;  3C1Y A;  4J9R A;  2ZUC A;  1IM4 A;  1SL0 A;  4GLX A;  9ICB A;  1UA0 A;  3UXO A;  3JPN A;  4GC7 A;  1KSP A;  1COO A;  2IHN A;  4YD1 A;  2F1J A;  1QSL A;  9ICQ A;  3PO4 A;  3MFI A;  3M9M B;  4YMM A;  4YN4 A;  4RNN A;  4QWE A;  3OGU A;  3KHR A;  3WFP A;  4WC3 A;  2DVI A;  3SV4 A;  3B0Y A;  4DL6 A;  4S3N A;  1MC8 A;  5DB6 A;  3OJS A;  3HIY A;  3SV3 A;  4MFA A;  1ZQT A;  1U45 A;  4QW9 A;  1BPZ A;  5HNK A;  3QZ7 A;  4YR0 A;  3PML A;  4AT8 B;  5DDM A;  2BE3 A;  3MGH A;  4EYH B;  2PXI A;  1NK4 A;  4EEY A;  2FMS A;  5KTQ A;  2W8L A;  2XY7 A;  5KT6 A;  1D9D A;  4FS2 A;  2AJQ A;  3MR5 A;  4EBC A;  4ED2 A;  2UVW A;  4IG8 A;  3H8S A;  1TFY A;  4I2F A;  4M6W A;  5J2K A;  1CEZ A;  3RR8 A;  3OUY A;  1T4G A;  2PFP A;  5CR0 A;  4UAW A;  4M6W B;  5D4B A;  2ALZ A;  4KLS A;  1XSL A;  1MIW A;  3OUY B;  2XCA A;  4RQ5 A;  2PFN A;  3THV A;  1S0N A;  1SKR A;  1ZJM A;  3MR6 A;  4FBT A;  2ZHB A;  3IHQ B;  4DF8 A;  2ISP A;  1ZET A;  1L5U A;  4YG2 A;  9ICM A;  1TFR A;  8ICX A;  2KZ3 A;  3HX0 A;  1NJW A;  4KLL A;  3UPS A;  3OHA A;  1TKD A;  1L3S A;  3SYZ A;  4CCH A;  4TQS A;  4JV1 A;  2V4R A;  1NK6 A;  2FMP A;  4KTQ A;  4RT3 A;  1BPD A;  4RQ4 A;  4YR3 A;  4KN4 A;  1NJX A;  3V7J A;  2ZTE A;  2MUT A;  3JPR A; 
#chains in the Genus database with same CATH topology
 1SXD A;  4PHP A;  2MUT B;  1ZJN A;  2UVU A;  3BQ2 A;  5BPC A;  4QWC A;  3BZC A;  4FO1 A;  1WYG A;  3CW2 C;  5J0S A;  4B9T A;  4EYI B;  2BPC A;  1RDF A;  4XQ7 A;  5KT7 A;  2W7P A;  1J97 A;  4CGZ A;  2DPJ A;  1BNO A;  3RBD A;  2M2T A;  2VA2 A;  3ISD A;  3LK9 A;  4KX5 A;  1PVQ A;  4MEY A;  4NM1 A;  2HHV A;  4I29 A;  4IRK A;  1Q8K A;  3I1Y A;  1EXN A;  4EZ9 A;  5JRT A;  3S6J A;  2DR5 A;  2HHS A;  2MRL A;  3FAH A;  4KM5 A;  5HRH A;  4F2S A;  1KBU A;  3IN5 A;  3BS7 A;  1L8O A;  5KAF U;  4O3P A;  1KQQ A;  5GTH U;  3H0L B;  8ICA A;  5KFQ A;  4PL2 A;  3WKC A;  3L9D A;  2V4Q A;  4CDG A;  4EBE A;  2A3V A;  4RPY A;  4UB5 A;  4EBD A;  3HW8 A;  2UVR A;  3NYB A;  4EX7 A;  4RQ6 A;  2OH2 A;  1Y88 A;  4FBU A;  3EPG A;  2HN2 A;  5L1L A;  2FLN A;  3ZI4 A;  1MA7 A;  1N61 A;  3RRG A;  4KN7 A;  2I9G A;  2G5H B;  4R65 A;  1F5A A;  2B4V A;  4TUR A;  4LVS A;  3C66 A;  4F71 A;  4UAT A;  1K5O A;  3AU2 A;  4E0D A;  4M9N A;  1UT8 A;  5KFR A;  1FFV A;  2JEI A;  5BOM A;  3T5H A;  5DBB A;  4PGY A;  3T3F A;  2PMZ C;  2A19 A;  1ZQY A;  9ICI A;  4K99 A;  3JPT A;  3N4M B;  1XSP A;  4CE6 A;  4RWQ A;  4WJ3 B;  1ZOL A;  2KFZ A;  4P0Q A;  5F2V O;  5T14 A;  1O08 A;  5HRG A;  4USA A;  4EEK A;  2LPE A;  2ZTC A;  2EAM A;  3HP6 A;  1XSN A;  3FM9 A;  4EV6 A;  2OEH A;  4RUC A;  3V7K A;  3GV8 B;  4ED3 A;  2KIV A;  3OJU A;  3MDC A;  5J2H A;  1SKW A;  4LEW A;  9ICX A;  3H39 A;  2E5S A;  4YVZ A;  1R8C A;  2RRD A;  2Q66 A;  1N60 A;  8ICE A;  4Y2P A;  4O5K A;  4Q8E A;  3C21 A;  3JPS A;  5DGA A;  5J2E A;  3V7L A;  3UQ2 A;  2JZB B;  5KG7 A;  1D9F A;  4DCC A;  1Z19 A;  3C1Z A;  4US8 A;  3N7R C;  2JH1 A;  1T7P A;  2JGA A;  2XVT A;  1PVP A;  5AKL A;  3NVV A;  1WCL A;  3RJH A;  5ALK A;  3T5J A;  1NK8 A;  9ICH A;  2EZX A;  5KT2 A;  2EDU A;  4ICA A;  1WWU A;  3WK9 A;  4RPX A;  1U47 A;  4BWJ A;  4NXV A;  2I6X A;  8ICJ A;  4YMN A;  9ICV A;  1NNL A;  5ALV A;  4ECT A;  1WCN A;  3C5F A;  2OXO A;  5KFI A;  1UET A;  4JV0 A;  2H3Z A;  3R9K A;  4PPX A;  1KKX A;  5CB1 A;  2W54 A;  1N48 A;  2ZH9 A;  1ZD4 A;  1ZQI A;  4QZA A;  2IA6 A;  7ICQ A;  4OJP A;  7ICK A;  3KHH A;  2H3V A;  1Q3U A;  9ICA A;  3OPX A;  4DQR A;  4QZC A;  5IIN A;  3PR5 B;  4I2B A;  2QAR B;  4WC1 A;  3GIM A;  2K89 A;  2E8M A;  1ZQP A;  1XS9 D;  8ICL A;  4LEV A;  4B6J A;  2R8K A;  2FE9 A;  4X0A A;  2HOI A;  5CRX A;  3FC4 A;  5AIB A;  2EWR A;  4K8V A;  2F76 X;  2OCE A;  7ICR A;  2W9C B;  2RHF A;  1VLB A;  2M2W A;  1TAM A;  4ECS A;  2KP7 A;  7ICN A;  1U48 A;  4AT9 A;  2FPK A;  2XCP A;  7ICG A;  4EX6 A;  1IG6 A;  3D2N A;  4B9M A;  3HJE A;  1BVS A;  5TIS U;  1JAJ A;  3Q8M A;  5DG8 A;  3BS5 B;  3EZ5 A;  4EBK A;  5J2F A;  3NVZ A;  3UQ0 A;  2NRV A;  3BJY A;  3M8R A;  4X4Q A;  2BQU A;  3DDH A;  4DFJ A;  2W9B B;  3WFR E;  4NXU A;  2WAQ C;  3L3F X;  3QE9 Y;  4IR9 A;  4HAI A;  1TFW A;  1RQL A;  3PX4 A;  4C4T A;  4X4P A;  2VKQ A;  3AMZ A;  3SR6 A;  4R64 A;  2F77 X;  5HRI A;  1ZQG A;  4RWO A;  3ZDD A;  2BBH A;  3TAQ A;  4GIB A;  4M5D A;  2BCQ A;  2P6R A;  2XGQ A;  2LMR A;  5DB9 A;  1HJP A;  1ZD2 P;  5AKH A;  4QZG A;  4F2R A;  2ZH1 A;  1X6J A;  4JUZ A;  4MHV A;  4NLC A;  5DLF A;  3PW2 A;  1S76 D;  3L4P A;  2DF4 B;  3NRW A;  5AM4 A;  5JTI A;  2HHQ A;  4US9 A;  4UW9 A;  2DR9 A;  4WC7 A;  3JYY A;  4FHY A;  1V85 A;  2IUB A;  4KLG A;  4I2A A;  3RTV A;  3VCB A;  2XIC A;  1RG6 A;  1MQ3 A;  2F44 A;  2ZH6 A;  1ZRN A;  5IIO A;  3WU2 U;  4PH5 A;  4UBC A;  1X9S A;  4C8O A;  4K97 A;  2IMW P;  1WUD A;  5DQH A;  5ALZ A;  4RQ8 A;  4QJF B;  4J9L A;  2VAN A;  5KFE A;  4DSJ A;  9ICT A;  3IM1 A;  3H0R B;  5AKZ A;  2RP5 A;  4UAS A;  2Y9U A;  4EED A;  1JUD A;  1N5W A;  4UB2 A;  1GPJ A;  3HWT A;  8ICK A;  4U6P A;  5DBC A;  4MKP A;  3A0B U;  2LHT A;  4KLM A;  2BKE A;  4QWB A;  2JEJ A;  3NAS A;  1ZQK A;  3AL0 B;  1XO0 A;  3V6K A;  2ZUB A;  2GOL A;  2Y0S C;  4IQT A;  1RYU A;  3CNH A;  1DGS A;  1K1S A;  3WFQ E;  5AM3 A;  5D63 A;  2ODG A;  2RQ5 A;  2FMQ A;  3QUB A;  2IOH A;  4GC6 A;  4UAZ A;  2PI4 A;  2Y1I A;  2B51 A;  4YXJ A;  4CF4 A;  2UVV A;  3GII A;  4KLE A;  4LEY A;  3PVX A;  3NVO A;  4E80 A;  3N7S C;  2ZJ8 A;  2KE7 A;  4ZH4 A;  1B4F A;  2OHF A;  2IHO A;  2ZH2 A;  4ECU A;  5HRB A;  2XGP A;  3LVV A;  1SKS A;  5J2C A;  3O0F A;  4DEZ A;  3PSF A;  1Q46 A;  4RQ2 A;  4F5N A;  1R8A A;  4AYB F;  3B9J A;  2BPF A;  2RDI A;  3OVS A;  2KZZ A;  4DSI A;  1RZT A;  1OUQ A;  1U4B A;  2KSO A;  3B0X A;  2F1I A;  3I76 A;  4UD5 A;  1WG8 A;  5KT5 A;  4Y2R A;  5ALH A;  1UA0 A;  3UXO A;  1KSP A;  1COO A;  2F1J A;  1KW4 A;  3PO4 A;  3MFI A;  4NV0 A;  4WC3 A;  3SV4 A;  4DL6 A;  3SV3 A;  3RF9 A;  3PHZ A;  4QW9 A;  1BPZ A;  3AQE A;  4YR0 A;  3PML A;  4AT8 B;  1Z4O A;  1YZ7 A;  2JXJ A;  1NK4 A;  4EEY A;  5KTQ A;  1LKY A;  4UAU A;  4FS2 A;  2UVW A;  4IG8 A;  4I2F A;  4M6W A;  3CK6 A;  3OUY A;  2IOF A;  1GO3 F;  2HBJ A;  1L7P A;  4KLL A;  3UPS A;  3OHA A;  1L3S A;  4JV1 A;  2WHE A;  4RQN A;  2V4R A;  1NK6 A;  4YR3 A;  1NJX A;  2MUT A;  2KNJ A;  5ALX A;  2C28 A;  2WB1 F;  1T94 A;  4FZL A;  4PGQ A;  1PZN A;  3Q8R B;  3PNC A;  1A76 A;  3SD7 A;  3TAR A;  1S8O A;  5ALN A;  4J9O A;  1ZQZ A;  3KD3 A;  3PST A;  5HR6 A;  1Q79 A;  3IG8 A;  1KRP A;  2OYY A;  4JMU A;  4IQW A;  4PHE A;  4EEB A;  3WFS C;  4F5Q A;  3BQ7 A;  5HHI A;  4ELU A;  4B9L A;  3EW9 A;  3TFS A;  2FDR A;  1PK1 B;  2ZTD A;  3M9O B;  2ASD A;  3KBB A;  3QU9 A;  5J2A A;  9ICN A;  5EOZ A;  2JEF A;  2A1A A;  1UT5 A;  1NKE A;  4ELV A;  3BQ1 A;  4O3R A;  9ICC A;  1FFU A;  3QU7 A;  2QB1 A;  7ICL A;  4DQS A;  3NVW A;  5KFL A;  4M47 A;  4Z6E A;  3KHG A;  4IL6 U;  3GV5 B;  3HKZ F;  2BQ3 A;  1WWV A;  1ZQD A;  2HBK A;  2WF7 A;  1JMS A;  2KN7 A;  1B0X A;  2AQ0 A;  3MAB A;  4NLZ A;  8ICV A;  5DED A;  4BXO A;  5KT4 A;  3H37 A;  1Z1V A;  4QZB A;  3KOO A;  3HRD D;  1NK5 A;  4KLS A;  4ECW A;  2HHT A;  5CJ7 A;  1RXW A;  1RM6 C;  4P4O A;  1UEU A;  4GXJ A;  3GIK A;  2JH7 A;  1HEK A;  3JZ0 A;  3NKU A;  2JRZ A;  4OAF A;  4OJO A;  3RAX A;  4N7R A;  4MF8 A;  5AK6 A;  1JN3 A;  4WC2 A;  4I27 A;  2ZHA A;  1X2I A;  2O5A A;  3VC8 A;  4ELT A;  3EYZ A;  2QKQ A;  2KHQ A;  3RH6 A;  3RB6 A;  3GDX A;  5EE0 A;  3PZP A;  2H3F A;  8ICU A;  4DQQ A;  2HCF A;  1ZQ1 C;  5C5J A;  4OD0 A;  2FPM A;  4DFD A;  5L1J A;  2NRZ A;  4UB1 A;  5AK5 A;  4F3O A;  5G5H A;  2A1J B;  5ALR A;  8ICQ A;  3AU6 A;  2XID A;  8ICF A;  1V97 A;  3G6Y A;  5HMM A;  1L7N A;  5AI0 A;  3MFH A;  3H40 A;  5AKG A;  3ZDC A;  4UBB A;  2JZB A;  1O03 A;  5AKJ A;  5ALP A;  3SAG A;  5J0P A;  1ZQW A;  2YQE A;  2LKY A;  3M1Y A;  4I2H A;  3ORY A;  4F4K A;  4DLE A;  5KFA A;  4B9N A;  4FHW A;  4KLH A;  4YP3 A;  2AHO B;  1X66 A;  5AHX A;  3M6Z A;  4GFJ A;  4TUP A;  1NZB A;  2PI5 A;  3WKB A;  3SAF A;  4J9M A;  1ZQL A;  3C18 A;  4PL1 A;  3TKA A;  4ECX A;  5BOL A;  3RR7 A;  4J9Q A;  4ED1 A;  5ALU A;  2L5Y A;  2C2D A;  1NOM A;  1DXS A;  1TAQ A;  2BCS A;  4FZM A;  1JXE A;  2ZIU B;  3G6V A;  2W04 A;  2ZIW B;  5G5G A;  2R8J A;  1K1Q A;  1PK3 A;  4F4Y A;  4FHX A;  3F53 A;  4WCW A;  4Z6D A;  4UAR A;  5HRK A;  1D8Y A;  3QX7 A;  2QAR A;  2NYV A;  3M7D A;  2JHD A;  2DQN B;  2WTF A;  1P7D A;  4WC4 A;  2LYH A;  2BGW A;  5CEH A;  1QQ7 A;  2YTU A;  8ICM A;  2N1R A;  3RRH A;  1V9P A;  4RZR A;  3LWL A;  2B0C A;  2H3I A;  3T5L A;  3NUQ A;  5KFH A;  4X4V A;  4NWI A;  2W9C A;  2AGP A;  2ESE A;  2PKE A;  2IHM A;  4Q45 A;  5AIA A;  3CYM A;  5DQG A;  2NRX A;  3RJG A;  4K9B A;  1VDV A;  5AM2 A;  1ZQE A;  3PV8 A;  3QUQ A;  4CF5 A;  3PW5 A;  1Q78 A;  3IV6 A;  1KFD A;  2F8L A;  3MCR A;  2E3T A;  2YMM A;  2JV3 A;  1S97 A;  2HSZ A;  1KDH A;  3H7I A;  5KFF A;  2QB0 A;  1MSW D;  2DRA A;  4FHV A;  3V6H A;  3CP8 A;  3MR2 A;  5J2D A;  8ICP A;  4WC6 A;  5J0U A;  2B56 A;  4OJ6 A;  4NXZ A;  1DK2 A;  2ZH8 A;  4TQR A;  5ALJ A;  4C7Z A;  1BPY A;  2ZXH A;  4O3O A;  1SZH A;  5DBA A;  2B6G A;  3QEA Z;  1AQ6 A;  7ICU A;  5AI4 A;  3RFA A;  5J0Y A;  3AQL A;  4I28 A;  2BDU A;  1D8B A;  7ICT A;  2D3D A;  3SQI A;  3UMC A;  4X4R A;  4Z6F A;  4M04 A;  4NLN A;  2J6S A;  4GXI A;  1ZQM A;  3OWG A;  2DRB A;  3C23 A;  4X4U A;  3H8J A;  5C0Y A;  5L9X A;  5AKY A;  4BX9 C;  3V6J A;  4BWM A;  2KTQ A;  3AQK A;  3ZD9 A;  1C20 A;  3WKE A;  5JU5 A;  1JXL A;  3E0F A;  3WK5 A;  1KNY A;  5TZV A;  4O9M A;  4OCZ A;  3L5K A;  5EWE A;  4M9J A;  1N63 A;  4ZOH C;  5ALQ A;  2BBJ A;  1X6I A;  1ZD5 A;  2DL0 A;  2ZG6 A;  3JCF A;  3GQC A;  4A8E A;  5CA7 A;  1S77 D;  2P66 A;  4RU9 A;  4R63 A;  5ALE A;  2IBK A;  4K98 A;  2GAF D;  4F8R A;  1QLN A;  5DG7 A;  2LM4 A;  9ICK A;  1L7M A;  1ZQF A;  3MDA A;  9ICU A;  2EAO A;  5HC9 A;  2F8K A;  9ICW A;  3EPI A;  1JQR A;  4PZO A;  2J6U A;  3U26 A;  4IS7 A;  9ICJ A;  4O5C A;  2ZH7 A;  4LEZ A;  4DFK A;  3QNM A;  3TAD A;  2F2A B;  8ICT A;  3H38 A;  4DFM A;  1L3U A;  1CRX A;  4G9B A;  2ZIX A;  2E1F A;  5J0X A;  1SXE A;  4RWN A;  2KZM A;  2PMZ F;  1X9W A;  2HHW A;  5DG9 A;  4QZI A;  1NK9 A;  2G08 A;  2MA1 A;  7ICP A;  3K75 D;  3NVY A;  3ETR A;  3QU5 A;  1VJ5 A;  3EWA A;  1L7O A;  1Z4N A;  3FYH A;  5A0L A;  4Y2X A;  2WFA A;  1SL0 A;  4GLX A;  9ICB A;  4GC7 A;  2ZIV B;  4YMM A;  3WFP A;  3OGU A;  3KHR A;  2YML A;  3GU3 A;  3B0Y A;  4S3N A;  4P0Q B;  3DEE A;  2G07 A;  2HN1 A;  4MFA A;  1ZQT A;  2YMQ A;  2KEY A;  2E8N A;  3QU4 A;  3AQF A;  4O3M A;  5DDM A;  2BE3 A;  3MGH A;  4EYH B;  4EBC A;  4ED2 A;  1SV4 A;  3H8S A;  1CEZ A;  5D4B A;  1MIW A;  2PFN A;  3THV A;  1ZJM A;  2ISP A;  2KJ9 A;  1L5U A;  9ICM A;  4CCH A;  3SYZ A;  4RT3 A;  2DBY A;  1UQV A;  4JB3 A;  4YD2 A;  3PY8 A;  4QZH A;  2BCR A;  2G09 A;  4EBJ A;  2VA8 A;  3M6K A;  2NO5 A;  5AM5 A;  1TVA A;  4RNO A;  3D2Q A;  4RQ0 A;  3DV9 A;  1NKC A;  3QEB Z;  5ALT A;  4G3I A;  5H2F U;  3ISB A;  5DKW A;  5F3X B;  3BZK A;  3J81 j;  1PK1 A;  5J2J A;  4EGW A;  1J2N A;  3SZ2 A;  1S0M A;  5KL8 B;  2HBM A;  3TFR A;  1QH9 A;  4PHD A;  9ICR A;  4FFD A;  1N2X A;  5J2I A;  2W3R A;  4LZD A;  5J0R A;  4RNM A;  1RXV A;  2NV3 A;  2D6F C;  3TI0 A;  7ICJ A;  3PW0 A;  2OWO A;  4ECV A;  4C8M A;  2DPI A;  1PX5 A;  3RH5 A;  3F5A A;  3JPO A;  2R8G A;  4QWD A;  1B22 A;  5KFY A;  2VJ4 A;  5IIM A;  4UB4 A;  1ZQO A;  1KFS A;  4XQ8 A;  2LI6 A;  1UHU A;  3HIL A;  3ONN A;  2O1P A;  3HKZ C;  2FPL A;  2P6U A;  1SB3 C;  3ERC C;  4DQI A;  4M9H A;  3UXN A;  4UB6 U;  2Q4T A;  2O6K A;  2ISO A;  2ID1 A;  4Y2V A;  4F5R A;  2Y9T A;  2HHX A;  3ER8 C;  4B9V A;  4MFF A;  3ICX A;  3Q8P B;  5B5E U;  4Y2U A;  4KLJ A;  5KG2 A;  2HOF A;  2W3S A;  2WF6 A;  2RFF A;  1X9X A;  5KG5 A;  3RB3 A;  1JI7 A;  1V4A A;  5KG3 A;  3H4B A;  7ICS A;  1NK0 A;  3D6J A;  4UQG A;  5K4L A;  3T5K A;  4EEN A;  1C7Y A;  1BPE A;  5HR7 A;  1LB2 B;  2KJ8 A;  5ALO A;  1N56 A;  4I2J A;  3JPQ A;  4DO9 A;  4PJ0 U;  2F1H A;  4UB3 A;  2KVS A;  1UEV A;  1ZQV A;  4KX3 A;  4XA5 A;  3Q8L A;  4DS4 A;  8ICG A;  5ALF A;  2BCU A;  4F93 B;  2RDJ A;  1KLN A;  2PFO A;  4UAV A;  2K4P A;  5JUM A;  3C2M A;  1TK8 A;  1FA0 A;  4MFC A;  2KKV A;  3KFU F;  7ICV A;  2FCL A;  5D62 A;  4OAG A;  2C22 A;  4JK1 A;  4QZ8 A;  1DGJ A;  9ICP A;  1F5S A;  5ALD A;  4FZN A;  4NL9 C;  4QZE A;  2V9W A;  2DWQ A;  5D49 A;  4M2Y A;  4I0U A;  4NLB A;  5KFB A;  4O3S A;  4BJQ A;  3IDW A;  1S0V A;  1ZQQ A;  3D2S A;  2K4I A;  1COK A;  7ICF A;  2IOF K;  5KNI A;  1BGX T;  3C28 A;  2BZF A;  1IIP A;  4Z6C A;  5AI5 A;  2ZIU A;  7ICI A;  4RQ3 A;  4LJX A;  4UD4 A;  2ZH3 A;  8ICI A;  3QUC A;  4RQ1 A;  5CFT A;  4FS1 A;  4M9L A;  5KFJ A;  4TUS A;  2H3Q A;  2XI9 A;  5KFN A;  2W9A A;  5IIK A;  3PX0 A;  2XY5 A;  3MBY A;  1UCV A;  2NRW A;  3OSN A;  4TUQ A;  4CRX A;  3OHB A;  1ECW A;  5HP4 A;  5KFP A;  4Q43 A;  2KMD A;  1XU4 A;  3LDA A;  3HJ4 A;  5F9L A;  1ZQX A;  5AIC A;  2EAN A;  2GO7 A;  5EE1 A;  2HHP A;  3AEV A;  1XNS A;  3GIL A;  5J0O A;  4DL5 A;  3WK8 A;  2KV2 A;  4HX0 A;  3ALR A;  4O67 A;  3NRZ A;  4PGX A;  2Y1J A;  3E2E A;  3F2D A;  2Q0Z X;  2QLT A;  2M2U A;  1KTQ A;  3RJE A;  4AT7 B;  4ECZ A;  9ICF A;  2G5I B;  1ZQC A;  4C8K A;  3TAD C;  3PSP A;  2R18 A;  1OW5 A;  3SMV A;  3RJK A;  1B43 A;  4ATB B;  4F50 A;  2HVH A;  3ZD8 A;  2JEG A;  4WH5 A;  2DUY A;  5L1K A;  5HRE A;  4KLD A;  1SWV A;  4RPZ A;  3IRU A;  1UPH A;  3RB4 A;  3RBE A;  4F5O A;  2LBO A;  3ETL A;  5CP2 A;  4JWN A;  4U7C A;  4X4N A;  4F5P A;  1ZQJ A;  4Y2S A;  4KIT B;  1S10 A;  2BR0 A;  5J2B A;  3H4D A;  1PVR A;  3IG5 A;  4QNL A;  4KMU A;  4KB6 A;  4DSF A;  3BQT A;  3MGI A;  3SI8 A;  4WQK A;  1Z00 B;  1IXR A;  4C8L A;  1JAL A;  3NTU A;  9ICS A;  3BQ0 A;  2G0A A;  2XC9 A;  4RUA A;  3WK7 A;  3N7P D;  2KKP A;  2F3N A;  4GXK A;  1X9M A;  7ICM A;  4O3N A;  2R8I A;  4F91 B;  2HI0 A;  4X0B A;  3RJF A;  8ICC A;  1S0O A;  1VJ7 A;  2KIW A;  2G06 A;  1XO1 A;  3QUT A;  1J2M A;  3ER9 B;  1QSS A;  8ICB A;  4DOC A;  1ZYQ A;  4FH3 A;  1Z3E B;  2LYA A;  4KLQ A;  1SZP A;  1URJ A;  2W9M A;  4P0P B;  2HVI A;  2HHU A;  3AQM A;  4CNQ A;  5DB7 A;  1TK5 A;  4DWI A;  1JRP A;  5E79 U;  5DEC A;  5KG6 A;  2HW3 A;  3UPQ A;  3NS1 A;  3LVW A;  1HUZ A;  1M6Y A;  3QZ8 A;  4DL4 A;  3RJI A;  2KFN A;  2LM1 A;  3EUB 2;  2H5X A;  5HML A;  4R8U B;  1FEZ A;  4QIW F;  4DSL A;  5J29 A;  4F4X A;  2RLT A;  2OM6 A;  5ALM A;  4P2H A;  3JPP A;  2M9N A;  4DLG A;  1SWW A;  4P4M A;  1NO5 A;  5KFK A;  1ZQA A;  5KFT A;  4KLF A;  4DL3 A;  1DOQ A;  2GWS A;  5CWR A;  5KG1 A;  3TAP A;  5J8Y C;  4O3Q A;  2AU0 A;  1XC9 A;  1SL1 A;  1QQ5 A;  4WBY A;  4WOY A;  2W7O A;  2I1Q A;  2C2E A;  1KFT A;  4RQM A;  1LVH A;  3BS5 A;  1MIV A;  4ED0 A;  4DSK A;  2J6T A;  1FO4 A;  4RQ7 A;  2DR7 A;  4BXO B;  3KHL A;  2W9B A;  2AQ4 A;  4ED6 A;  5JTG A;  4ED8 A;  4Y2Y A;  1YZ6 A;  2E1E A;  4XRH A;  3WK6 A;  3OTQ A;  2BHN A;  5CHE A;  3KKA A;  5KAI U;  2BDP A;  3C1Y A;  4J9R A;  2ZUC A;  5ALI A;  1IM4 A;  2JR5 A;  3E58 A;  2ZIV A;  3JPN A;  2IHN A;  5B3Q A;  3MGV A;  3H0M B;  9ICQ A;  3M9M B;  4YN4 A;  5L1M A;  2NO4 A;  2M0N A;  2DVI A;  1MC8 A;  2DKX A;  3UM9 A;  5ALS A;  2PXI A;  4K96 A;  5AI9 A;  2W8L A;  5KT6 A;  2XY7 A;  3T79 A;  2AJQ A;  3MR5 A;  4Y2T A;  3RR8 A;  3AM9 A;  1T4G A;  2PFP A;  5GTI U;  5CR0 A;  4C80 A;  2ALZ A;  4RQ5 A;  2W55 A;  1S0N A;  3MR6 A;  2HOQ A;  4NL9 A;  3IHQ B;  4DF8 A;  4FBT A;  1ZET A;  2ZHB A;  4YG2 A;  1TFR A;  1V38 A;  3HX0 A;  1NJW A;  1Z1B A;  4TQS A;  4EEL A;  5AI6 A;  2FMP A;  4KTQ A;  1BPD A;  4KN4 A;  2EQY A;  2P35 A;  3JPR A;  2DKZ A;  2W03 A;  3WK4 A;  1X42 A;  2HDO A;  4DL2 A;  2I5H A;  2WF9 A;  4KMO B;  4NM2 A;  4NXX A;  1T3N A;  3ISC A;  1KL9 A;  4DSE A;  1JRO A;  9ICL A;  1ZQU A;  3WKD A;  3HJ1 A;  1SV0 C;  2CRX A;  1QSY A;  1ZQN A;  4MEX A;  2DGZ A;  2K8A A;  1R8B A;  1MN8 A;  5KFX A;  4QZ9 A;  4F72 A;  4DS5 A;  5ALW A;  4NKU A;  2VJ5 A;  2KG5 A;  7ICH A;  4Q8F A;  2YB4 A;  4JV2 A;  1ZQB A;  2AGQ A;  1NJY A;  3K7D A;  3K1Z A;  2ES6 A;  1TE2 A;  5KFV A;  4M0A A;  2FI1 A;  5KFS A;  4B9S A;  4KLO A;  2AH5 A;  1TV9 A;  3WFO A;  4EP7 A;  3SAH A;  5DLG A;  3OVB A;  5J0W A;  2YX8 A;  3QYP A;  4P4P A;  4DFP A;  3M8S A;  5HHH A;  3KZX A;  1RQN A;  3PMN A;  4YCX A;  2VIX A;  2YN4 A;  2C2R A;  1U49 A;  4WBZ A;  4O0I A;  4B9U A;  3MC1 A;  2GH1 A;  2K8C B;  5KFW A;  1F44 A;  8ICR A;  5D46 A;  1SGG A;  5DGB A;  3TQ1 A;  1UA1 A;  1D8L A;  2ATL A;  4X4O A;  4AYB C;  1R89 A;  1A6S A;  4XJE A;  2ASL A;  4AT8 A;  2QB0 B;  1KEJ A;  4AP9 A;  8ICY A;  2DFL A;  8ICZ A;  5AKK A;  1MIY A;  4YQW A;  5CFU A;  3LYS A;  2CPR A;  5EE3 A;  4ED7 A;  3G6X A;  3C2K A;  4IRC A;  3ED5 A;  4WC0 A;  1T8E A;  3RB0 A;  1L3V A;  4K4H A;  3C2L A;  2KJ5 A;  2MSN A;  1ZD3 A;  5KFZ A;  3ZDA A;  4IRD A;  4LZG A;  2KOB A;  5HRL A;  3PX6 A;  4PZN A;  2E8P A;  5DQI A;  2PFQ A;  1A0P A;  2ZUD A;  5AI8 A;  1H38 A;  3KTQ A;  4QZD A;  3LWM A;  1A77 A;  2FJ6 A;  2EAP A;  4NJ8 A;  3PW7 A;  1TK0 A;  1T3Q A;  5KL1 B;  2K8B B;  9ICG A;  1WOT A;  3C5G A;  2HBL A;  2FLP A;  4RWP A;  3ZDE A;  1BPX A;  3H3A A;  3Q8Q B;  5KFU A;  3UMG A;  3F2C A;  4NXW A;  4ACO A;  4J9N A;  3MR3 A;  2WB1 C;  3H8M A;  1OU5 A;  2WF5 A;  4C4S A;  4YR2 A;  5KFM A;  5B3P A;  1JIH A;  4X4S A;  3K4G A;  2AXT U;  4UB8 U;  5ALG A;  4YFK A;  4Q44 A;  1ZQR A;  4JLX A;  4IQV A;  5AKI A;  3N97 B;  1IV8 A;  5KG4 A;  1YT3 A;  9ICO A;  2ZH5 A;  2KK0 A;  4Y2J A;  4J9K A;  1VFG A;  3PSI A;  3V72 A;  2K4E A;  3N28 A;  5KFC A;  1LV5 A;  2W8K A;  1N62 A;  4OAI Z;  8ICH A;  2BCV A;  2AGO A;  3KZI U;  9ICE A;  7ICO A;  1NJZ A;  1SL2 A;  3LQC B;  1CUK A;  5J8Y A;  4OO1 J;  4IQU A;  4NKT A;  4FH5 A;  4RT2 A;  2MAX A;  3SEI A;  3GV7 B;  4C8N A;  5J0T A;  3SEN A;  4BGD A;  4C0Z A;  5J0Q A;  3FDS A;  4DL7 A;  4R66 A;  2BPG A;  8ICO A;  1QQ6 A;  5IIL A;  1YLQ A;  1BPB A;  4AT7 A;  5AKX A;  1JX4 A;  4I2D A;  4K4G A;  5AKE A;  2BQR A;  1L6N A;  3PR4 A;  5AM0 A;  5DB8 A;  3M9N B;  4ATB A;  4FO6 A;  3F5E A;  3A0H U;  5CHG A;  1OXJ A;  4NY8 A;  5ALL A;  2ZJA A;  4QWA A;  2WAQ F;  1BNP A;  2K60 A;  4AT9 B;  2NRT A;  4JLZ A;  4C7Y A;  3IP4 B;  4DQP A;  2ZIX B;  1XWL A;  4X5V A;  4NLG A;  4J9P A;  2CN1 A;  1ZQS A;  4M9G A;  2GLE A;  5EE9 A;  4I2C A;  2MU2 A;  3OSP A;  3NWI A;  5KFG A;  3PW4 A;  3HT3 A;  3ZDB A;  3HPO A;  4LT6 A;  2A1J A;  3KKA C;  4O69 A;  3RAQ A;  3Q8K A;  3BDP A;  3TAC B;  3QXG A;  1FIQ A;  4O5E A;  1Z00 A;  2FLL A;  2R8H A;  2W11 A;  1TAU A;  4FHP A;  4JWM A;  5III A;  5AM1 A;  5HR9 A;  1S9F A;  2M2V A;  1NI3 A;  2D8C A;  5D61 A;  4F92 B;  1HUO A;  1NKB A;  1U9L A;  3GFK B;  3GIJ A;  1MQ2 A;  3QU2 A;  2EZY A;  8ICN A;  4DOA A;  3Q8S B;  4I2E A;  4YXM A;  1L3T A;  4UAY A;  4IR1 A;  4F4Z A;  2ZH4 A;  4WQL A;  2ZJ5 A;  8ICW A;  1RYR A;  1RYS A;  2KIC A;  3AUO A;  3AN1 A;  2CXY A;  3PO5 A;  4KLI A;  5DDY A;  4Y2Q A;  1ARO P;  2ZXI A;  3RH4 A;  1SV0 A;  2KD1 A;  4F4W A;  4FE3 A;  4XUS A;  3NGD A;  1SIJ A;  2GA9 D;  5L1I A;  4NXT A;  4P0P A;  5CFS A;  4KLU A;  5B66 U;  2KHV A;  5KG0 A;  2VA3 A;  4E7X A;  1ZQH A;  2JMG A;  2K4H A;  2KVC A;  2ZIW A;  4MF2 A;  4I2I A;  4EZ6 A;  4J9S A;  2YY6 A;  4I2G A;  1S5L U;  3TAN A;  5HRF A;  2Y0S F;  4DOB A;  3OVA A;  4PHA A;  4K4I A;  3EF2 A;  2XY6 A;  4E8F A;  4QZF A;  4R8U A;  1L8L A;  4ECR A;  2E8O A;  3CRX A;  2EH9 A;  2B21 A;  4QW8 A;  5J2G A;  4NLK A;  2ASJ A;  4KLT A;  5EWG A;  2PBE A;  1NK7 A;  1NZP A;  5HRD A;  1QTM A;  1RPL A;  4X4T A;  3H8W A;  5EWF A;  3UXP A;  4WC5 A;  2XO7 A;  4YMO A;  5IIJ A;  4QIW C;  4J03 A;  4O6A A;  1X40 A;  5AK4 A;  4ECY A;  3I28 A;  2YB1 A;  8ICS A;  2Z7J A;  4BDP A;  1ED1 A;  3OV7 A;  4CF3 A;  5KT3 A;  3AQN A;  3C29 A;  4K9A A;  2W43 A;  2LYB A;  4ECQ A;  4HYK A;  3RJJ A;  1DRG A;  7ICE A;  1DK3 A;  5KFD A;  1HIW A;  2NRK A;  4DF4 A;  1CI4 A;  2HMX A;  3UMB A;  2YMP A;  2DR8 A;  3K1R B;  1KN5 A;  4O68 A;  5KFO A;  5F9N A;  1ZRM A;  1Q3V A;  2KSO B;  1ZXI A;  4YD1 A;  1QSL A;  4C4R A;  4RNN A;  4QWE A;  5DB6 A;  1QCK A;  3OJS A;  3HIY A;  4OJL A;  3WKA A;  1U45 A;  5HNK A;  3QZ7 A;  2EZZ A;  1N5X A;  2FMS A;  3F2B A;  1D9D A;  5FP0 A;  1TFY A;  1LKY B;  5J2K A;  4UAW A;  4M6W B;  4OJ5 A;  1XSL A;  2WF8 A;  3OUY B;  2XCA A;  1SKR A;  5ALY A;  1PUZ A;  3GZF A;  8ICX A;  4OAH A;  2KZ3 A;  4IC9 A;  1TKD A;  4BUG A;  1F0M A;  4RQ4 A;  3V7J A;  2ZTE A;  5AK3 A; 
#chains in the Genus database with same CATH homology
 2C28 A;  4PHP A;  2MUT B;  4PGQ A;  1ZJN A;  2UVU A;  3BQ2 A;  5BPC A;  4QWC A;  1PZN A;  3Q8R B;  4DL2 A;  3PNC A;  4YD2 A;  1A76 A;  3TAR A;  4NM2 A;  3PY8 A;  5J0S A;  4QZH A;  2BCR A;  4B9T A;  1T3N A;  4EBJ A;  4J9O A;  4EYI B;  2BPC A;  3ISC A;  1ZQZ A;  2VA8 A;  4DSE A;  4XQ7 A;  5KT7 A;  9ICL A;  2DPJ A;  1ZQU A;  1BNO A;  3RBD A;  1Q79 A;  1KRP A;  1TVA A;  4RNO A;  2VA2 A;  2M2T A;  3HJ1 A;  4RQ0 A;  3ISD A;  4IQW A;  3RRG A;  4PHE A;  3LK9 A;  1NKC A;  4MEY A;  4NM1 A;  2HHV A;  3QEB Z;  4I29 A;  4IRK A;  1EXN A;  4EZ9 A;  3WFS C;  1QSY A;  1ZQN A;  4MEX A;  4G3I A;  4F5Q A;  2DR5 A;  2HHS A;  3ISB A;  5DKW A;  5HRH A;  3H37 A;  5HHI A;  1R8B A;  4ELU A;  5J2J A;  4F2S A;  5KFX A;  4QZ9 A;  4B9L A;  3EW9 A;  3TFS A;  2ZTD A;  3SZ2 A;  4DS5 A;  4NKU A;  3M9O B;  2ASD A;  1S0M A;  4O3P A;  3TFR A;  7ICH A;  4PHD A;  4Q8F A;  5KFQ A;  5J2A A;  8ICA A;  9ICR A;  9ICN A;  5EOZ A;  3L9D A;  2V4Q A;  2JEF A;  4JV2 A;  1UT5 A;  1NKE A;  4ELV A;  3BQ1 A;  5J2I A;  4O3R A;  9ICC A;  4LZD A;  7ICL A;  4DQS A;  1ZQB A;  5KFL A;  5J0R A;  4Z6E A;  4RNM A;  3KHG A;  4EBE A;  2AGQ A;  1NJY A;  1RXV A;  4M47 A;  4RPY A;  4UB5 A;  4EBD A;  3HW8 A;  2UVR A;  3GV5 B;  5KFV A;  2BQ3 A;  3NYB A;  3TI0 A;  5KFS A;  4M0A A;  7ICJ A;  3PW0 A;  4RQ6 A;  1ZQD A;  2OWO A;  4ECV A;  4B9S A;  1Y88 A;  4C8M A;  2DPI A;  4FBU A;  3EPG A;  1JMS A;  4KLO A;  2KN7 A;  3RH5 A;  3JPO A;  5L1L A;  1TV9 A;  3WFO A;  4EP7 A;  2R8G A;  2AQ0 A;  4QWD A;  3MAB A;  2FLN A;  5DLG A;  4NLZ A;  1B22 A;  5KFY A;  8ICV A;  5DED A;  3OVB A;  5J0W A;  4BXO A;  5KT4 A;  4P4P A;  4DFP A;  3M8S A;  4QZB A;  5IIM A;  5HHH A;  1NK5 A;  4KN7 A;  4UB4 A;  4ECW A;  1ZQO A;  1KFS A;  2I9G A;  4XQ8 A;  2HHT A;  5CJ7 A;  1RXW A;  2O1P A;  4P4O A;  4R65 A;  3PMN A;  1F5A A;  4YCX A;  4GXJ A;  1UEU A;  2FPL A;  2P6U A;  4TUR A;  3GIK A;  4LVS A;  3C66 A;  3JZ0 A;  4E0D A;  3AU2 A;  2C2R A;  1U49 A;  4M9N A;  4O0I A;  4B9U A;  4WBZ A;  3RAX A;  1UT8 A;  5KFR A;  4DQI A;  4M9H A;  3UXN A;  2JEI A;  4MF8 A;  5BOM A;  3T5H A;  5DBB A;  4PGY A;  2ISO A;  2ID1 A;  1JN3 A;  3T3F A;  5KFW A;  8ICR A;  4WC2 A;  4F5R A;  5D46 A;  4I27 A;  2ZHA A;  1ZQY A;  1X2I A;  9ICI A;  2O5A A;  3JPT A;  3N4M B;  2HHX A;  5DGB A;  1XSP A;  4B9V A;  3TQ1 A;  4MFF A;  1UA1 A;  4ELT A;  4RWQ A;  3EYZ A;  1D8L A;  2KFZ A;  3RH6 A;  2ATL A;  3Q8P B;  3RB6 A;  3GDX A;  4X4O A;  4KLJ A;  1R89 A;  5F2V O;  5KG2 A;  5HRG A;  2ASL A;  8ICU A;  2ZTC A;  4DQQ A;  3HP6 A;  2RFF A;  4AT8 A;  1KEJ A;  5C5J A;  1XSN A;  2DFL A;  8ICY A;  8ICZ A;  1MIY A;  5KG5 A;  3RB3 A;  1V4A A;  2FPM A;  5KG3 A;  4YQW A;  3H4B A;  5L1J A;  7ICS A;  2NRZ A;  4RUC A;  4UB1 A;  3V7K A;  1NK0 A;  4F3O A;  3GV8 B;  4ED3 A;  4UQG A;  2A1J B;  3OJU A;  3MDC A;  4ED7 A;  3T5K A;  5J2H A;  1SKW A;  3G6X A;  3C2K A;  4IRC A;  9ICX A;  1C7Y A;  4WC0 A;  1BPE A;  1T8E A;  3RB0 A;  3H39 A;  8ICQ A;  1LB2 B;  4YVZ A;  1R8C A;  3AU6 A;  1N56 A;  1L3V A;  8ICF A;  4K4H A;  3C2L A;  4I2J A;  3JPQ A;  5KFZ A;  4DO9 A;  3ZDA A;  2F1H A;  2Q66 A;  4UB3 A;  3G6Y A;  4IRD A;  4LZG A;  5HRL A;  1UEV A;  5HMM A;  1ZQV A;  8ICE A;  3Q8L A;  4XA5 A;  3MFH A;  4DS4 A;  3H40 A;  3PX6 A;  3ZDC A;  4O5K A;  4Q8E A;  8ICG A;  4UBB A;  3C21 A;  5DQI A;  2PFQ A;  2JZB A;  3JPS A;  5J0P A;  5DGA A;  2BCU A;  2ZUD A;  4F93 B;  5J2E A;  2RDJ A;  1KLN A;  1H38 A;  2PFO A;  1ZQW A;  3V7L A;  5JUM A;  2JZB B;  5KG7 A;  3UQ2 A;  1D9F A;  3KTQ A;  3C2M A;  1TK8 A;  4QZD A;  3LWM A;  1A77 A;  4MFC A;  4I2H A;  3PW7 A;  1FA0 A;  7ICV A;  3C1Z A;  1T7P A;  1TK0 A;  3ORY A;  2C22 A;  4F4K A;  4JK1 A;  4QZ8 A;  4DLE A;  5KFA A;  4B9N A;  9ICP A;  9ICG A;  4FHW A;  4KLH A;  4YP3 A;  3C5G A;  1WCL A;  1WOT A;  2FLP A;  3RJH A;  3T5J A;  4RWP A;  3ZDE A;  1BPX A;  4QZE A;  4M9J A;  3H3A A;  3Q8Q B;  1NK8 A;  2V9W A;  9ICH A;  5KFU A;  4TUP A;  5D49 A;  4M2Y A;  5KT2 A;  5KFB A;  4RPX A;  1U47 A;  4BWJ A;  4O3S A;  4J9N A;  2PI5 A;  3MR3 A;  8ICJ A;  4YMN A;  9ICV A;  1S0V A;  1ZQQ A;  4ECT A;  1WCN A;  3C5F A;  4J9M A;  5KFI A;  7ICF A;  1ZQL A;  1OU5 A;  4JV0 A;  1UET A;  3C18 A;  1BGX T;  4YR2 A;  5KFM A;  5BOL A;  4J9Q A;  4Z6C A;  4ECX A;  1JIH A;  3RR7 A;  3K4G A;  4PPX A;  4X4S A;  7ICI A;  4ED1 A;  4YFK A;  4RQ3 A;  4Q44 A;  1ZQR A;  2C2D A;  1NOM A;  4IQV A;  4UD4 A;  3N97 B;  8ICI A;  2ZH3 A;  1TAQ A;  5KG4 A;  5CB1 A;  2BCS A;  1JXE A;  3G6V A;  4RQ1 A;  9ICO A;  4FS1 A;  4M9L A;  4AT7 B;  5KFJ A;  4TUS A;  2ZH5 A;  1N48 A;  2W9A A;  1ZQI A;  5KFN A;  2ZH9 A;  4QZA A;  5IIK A;  4J9K A;  3PX0 A;  2R8J A;  2XY5 A;  1K1Q A;  3MBY A;  2IA6 A;  1VFG A;  4F4Y A;  7ICQ A;  4FHX A;  3V72 A;  2NRW A;  5KFC A;  4TUQ A;  3OSN A;  3KHH A;  7ICK A;  3OHB A;  1LV5 A;  2W8K A;  5HP4 A;  9ICA A;  4Z6D A;  5KFP A;  4Q43 A;  2BCV A;  1D8Y A;  8ICH A;  5HRK A;  2AGO A;  4WCW A;  1XU4 A;  3LDA A;  4DQR A;  9ICE A;  7ICO A;  4QZC A;  1NJZ A;  5IIN A;  3HJ4 A;  5F9L A;  3PR5 B;  1SL2 A;  2WTF A;  4I2B A;  3LQC B;  4WC1 A;  1CUK A;  4WC4 A;  1ZQX A;  2LYH A;  4IQU A;  2BGW A;  4NKT A;  3GIM A;  2HHP A;  4FH5 A;  3GIL A;  1ZQP A;  5J0O A;  4RT2 A;  1XS9 D;  4DL5 A;  8ICL A;  8ICM A;  2MAX A;  3GV7 B;  3RRH A;  1V9P A;  4C8N A;  5J0T A;  5J0Q A;  4RZR A;  4BGD A;  2R8K A;  3FDS A;  3LWL A;  4X0A A;  4DL7 A;  4R66 A;  3T5L A;  2BPG A;  8ICO A;  5KFH A;  5IIL A;  4X4V A;  1YLQ A;  2W9C A;  2AGP A;  1BPB A;  4PGX A;  2Y1J A;  4AT7 A;  3E2E A;  2IHM A;  4Q45 A;  1JX4 A;  4I2D A;  4K4G A;  2Q0Z X;  7ICR A;  2W9C B;  2M2U A;  5DQG A;  1KTQ A;  2NRX A;  2BQR A;  4ECZ A;  3RJE A;  3RJG A;  3PR4 A;  9ICF A;  5DB8 A;  2M2W A;  1ZQC A;  4C8K A;  3M9N B;  4ECS A;  4ATB A;  4FO6 A;  2KP7 A;  7ICN A;  5CHG A;  1U48 A;  4AT9 A;  2FPK A;  1ZQE A;  4NY8 A;  2ZJA A;  2XCP A;  3PV8 A;  1B43 A;  4QWA A;  4F50 A;  3PW5 A;  3RJK A;  1BNP A;  2HVH A;  4ATB B;  4AT9 B;  7ICG A;  2NRT A;  1Q78 A;  3ZD8 A;  2JEG A;  4B9M A;  1KFD A;  1BVS A;  5L1K A;  1JAJ A;  3Q8M A;  4KLD A;  5HRE A;  4RPZ A;  1S97 A;  1KDH A;  4DQP A;  5DG8 A;  3EZ5 A;  3H7I A;  3RB4 A;  1XWL A;  5J2F A;  3RBE A;  5KFF A;  4X5V A;  4NLG A;  4F5O A;  4J9P A;  3ETL A;  4EBK A;  3UQ0 A;  5CP2 A;  4JWN A;  2NRV A;  3BJY A;  3M8R A;  1ZQS A;  4M9G A;  4X4Q A;  4I2C A;  2BQU A;  4X4N A;  4F5P A;  3OSP A;  1MSW D;  2DRA A;  5KFG A;  4DFJ A;  4FHV A;  3PW4 A;  2W9B B;  1ZQJ A;  3WFR E;  4KIT B;  3V6H A;  3HT3 A;  3MR2 A;  1S10 A;  2BR0 A;  5J2B A;  3QE9 Y;  5J2D A;  3ZDB A;  3H4D A;  4IR9 A;  8ICP A;  4WC6 A;  3HPO A;  4LT6 A;  2A1J A;  5J0U A;  1TFW A;  3RAQ A;  3Q8K A;  3BDP A;  3PX4 A;  4NXZ A;  4X4P A;  4KMU A;  4O5E A;  1Z00 A;  4DSF A;  2FLL A;  3BQT A;  4R64 A;  3MGI A;  3SI8 A;  1DK2 A;  2ZH8 A;  2R8H A;  4TQR A;  1Z00 B;  1ZQG A;  1TAU A;  3ZDD A;  5HRI A;  4RWO A;  1IXR A;  4C8L A;  4FHP A;  4JWM A;  5III A;  3TAQ A;  5HR9 A;  4M5D A;  2BCQ A;  1S9F A;  1BPY A;  2P6R A;  3NTU A;  5DB9 A;  2XGQ A;  1HJP A;  9ICS A;  2M2V A;  4O3O A;  4QZG A;  4F2R A;  5DBA A;  2ZH1 A;  3BQ0 A;  3QEA Z;  4JUZ A;  2XC9 A;  4F92 B;  4RUA A;  1HUO A;  1NKB A;  1U9L A;  3GFK B;  3GIJ A;  5DLF A;  1MQ2 A;  7ICU A;  3PW2 A;  8ICN A;  5J0Y A;  3AQL A;  4DOA A;  1S76 D;  3Q8S B;  4I28 A;  4GXK A;  1X9M A;  4I2E A;  7ICM A;  7ICT A;  4YXM A;  4O3N A;  2R8I A;  1L3T A;  4UAY A;  4IR1 A;  4F91 B;  4F4Z A;  4X0B A;  4Z6F A;  4X4R A;  2ZH4 A;  2HHQ A;  3RJF A;  4M04 A;  1S0O A;  4NLN A;  8ICC A;  2J6S A;  1VJ7 A;  2DR9 A;  4GXI A;  2ZJ5 A;  1ZQM A;  8ICW A;  4WC7 A;  1RYR A;  1RYS A;  1XO1 A;  2DRB A;  3C23 A;  3AUO A;  3H8J A;  4X4U A;  1QSS A;  8ICB A;  5L9X A;  3JYY A;  4FHY A;  4DOC A;  3PO5 A;  4KLI A;  4KLG A;  4I2A A;  1ZYQ A;  3RTV A;  5DDY A;  1ARO P;  3V6J A;  4BWM A;  3RH4 A;  2KTQ A;  3ZD9 A;  3AQK A;  4FH3 A;  1MQ3 A;  4F4W A;  4XUS A;  1JXL A;  5IIO A;  4PH5 A;  3NGD A;  4UBC A;  1X9S A;  4C8O A;  2ZH6 A;  1Z3E B;  5L1I A;  4KLU A;  2VA3 A;  4E7X A;  5KG0 A;  2IMW P;  5DQH A;  4KLQ A;  1SZP A;  5TZV A;  4O9M A;  1KNY A;  4RQ8 A;  2W9M A;  4J9L A;  2VAN A;  1ZQH A;  2HVI A;  2HHU A;  3AQM A;  4MF2 A;  5KFE A;  5EWE A;  4I2I A;  5DB7 A;  3IM1 A;  4DSJ A;  4J9S A;  1TK5 A;  4DWI A;  4EZ6 A;  9ICT A;  4I2G A;  3TAN A;  5HRF A;  3GQC A;  4DOB A;  5KG6 A;  2HW3 A;  5DEC A;  3OVA A;  4PHA A;  5CA7 A;  3UPQ A;  4K4I A;  1S77 D;  4UB2 A;  2P66 A;  1HUZ A;  4RU9 A;  3QZ8 A;  4DL4 A;  4R63 A;  3HWT A;  3RJI A;  2XY6 A;  8ICK A;  4E8F A;  5DBC A;  4QZF A;  2KFN A;  4R8U A;  4KLM A;  2BKE A;  4QWB A;  2JEJ A;  2IBK A;  4ECR A;  5HML A;  2H5X A;  4F8R A;  1QLN A;  4R8U B;  1ZQK A;  5DG7 A;  1PX5 A;  9ICK A;  3V6K A;  1ZQF A;  3MDA A;  4DSL A;  2B21 A;  2ZUB A;  4QW8 A;  9ICU A;  5J2G A;  5J29 A;  4IQT A;  4F4X A;  4NLK A;  1DGS A;  1K1S A;  3WFQ E;  2ASJ A;  5HC9 A;  4KLT A;  5EWG A;  2PBE A;  1NK7 A;  9ICW A;  3EPI A;  2FMQ A;  4P2H A;  1JQR A;  1NZP A;  3JPP A;  2J6U A;  2M9N A;  4DLG A;  5HRD A;  4P4M A;  1QTM A;  1RPL A;  5KFK A;  4GC6 A;  1ZQA A;  1NO5 A;  4X4T A;  3H8W A;  5KFT A;  4KLF A;  4UAZ A;  2PI4 A;  4DL3 A;  5EWF A;  3UXP A;  2Y1I A;  1DOQ A;  2GWS A;  4WC5 A;  2XO7 A;  4YXJ A;  4YMO A;  5IIJ A;  2UVV A;  9ICJ A;  5CWR A;  5KG1 A;  3GII A;  3TAP A;  4O3Q A;  2AU0 A;  1XC9 A;  1SL1 A;  4O5C A;  4ECY A;  2ZH7 A;  4DFK A;  4KLE A;  8ICS A;  3PVX A;  4WBY A;  2I1Q A;  2C2E A;  4BDP A;  3OV7 A;  5KT3 A;  8ICT A;  3H38 A;  4DFM A;  3AQN A;  1L3U A;  1KFT A;  4E80 A;  2ZJ8 A;  1MIV A;  4ED0 A;  4ECQ A;  4ZH4 A;  5J0X A;  4DSK A;  4RWN A;  2J6T A;  2KZM A;  1X9W A;  4HYK A;  3RJJ A;  2ZH2 A;  4ECU A;  4RQ7 A;  2XGP A;  2HHW A;  5KFD A;  1SKS A;  7ICE A;  1DK3 A;  5J2C A;  4BXO B;  2DR7 A;  4DEZ A;  5DG9 A;  3KHL A;  4QZI A;  2W9B A;  2AQ4 A;  4RQ2 A;  4ED6 A;  4F5N A;  3K75 D;  1NK9 A;  7ICP A;  4ED8 A;  1R8A A;  2NRK A;  4DF4 A;  2BPF A;  2RDI A;  3OVS A;  2KZZ A;  4DSI A;  3EWA A;  1RZT A;  4XRH A;  2DR8 A;  1U4B A;  5KFO A;  2BHN A;  3B0X A;  2F1I A;  4UD5 A;  3FYH A;  5F9N A;  5KT5 A;  2BDP A;  5HRB A;  3C1Y A;  4J9R A;  2ZUC A;  1IM4 A;  1SL0 A;  4GLX A;  9ICB A;  1UA0 A;  3UXO A;  3JPN A;  4GC7 A;  1KSP A;  1COO A;  2IHN A;  4YD1 A;  2F1J A;  1QSL A;  9ICQ A;  3PO4 A;  3MFI A;  3M9M B;  4YMM A;  4YN4 A;  4RNN A;  4QWE A;  3OGU A;  3KHR A;  3WFP A;  4WC3 A;  2DVI A;  3SV4 A;  3B0Y A;  4DL6 A;  4S3N A;  1MC8 A;  5DB6 A;  3OJS A;  3HIY A;  3SV3 A;  4MFA A;  1ZQT A;  1U45 A;  4QW9 A;  1BPZ A;  5HNK A;  3QZ7 A;  4YR0 A;  3PML A;  4AT8 B;  5DDM A;  2BE3 A;  3MGH A;  4EYH B;  2PXI A;  1NK4 A;  4EEY A;  2FMS A;  5KTQ A;  2W8L A;  2XY7 A;  5KT6 A;  1D9D A;  4FS2 A;  2AJQ A;  3MR5 A;  4EBC A;  4ED2 A;  2UVW A;  4IG8 A;  3H8S A;  1TFY A;  4I2F A;  4M6W A;  5J2K A;  1CEZ A;  3RR8 A;  3OUY A;  1T4G A;  2PFP A;  5CR0 A;  4UAW A;  4M6W B;  5D4B A;  2ALZ A;  4KLS A;  1XSL A;  1MIW A;  3OUY B;  2XCA A;  4RQ5 A;  2PFN A;  3THV A;  1S0N A;  1SKR A;  1ZJM A;  3MR6 A;  4FBT A;  2ZHB A;  3IHQ B;  4DF8 A;  2ISP A;  1ZET A;  1L5U A;  4YG2 A;  9ICM A;  1TFR A;  8ICX A;  2KZ3 A;  3HX0 A;  1NJW A;  4KLL A;  3UPS A;  3OHA A;  1TKD A;  1L3S A;  3SYZ A;  4CCH A;  4TQS A;  4JV1 A;  2V4R A;  1NK6 A;  2FMP A;  4KTQ A;  4RT3 A;  1BPD A;  4RQ4 A;  4YR3 A;  4KN4 A;  1NJX A;  3V7J A;  2ZTE A;  2MUT A;  3JPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...