4PPXA

Dna polymerase beta e295k with spiroiminodihydantoin in templating position
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
314
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Crystal Structure of DNA Polymerase beta with DNA Containing the Base Lesion Spiroiminodihydantoin in a Templating Position.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 107
structure length 314
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ppxA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ppxA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ppxA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ppxA03
4HYKA 4J9RA 5KG4A 2AGPA 4M04A 2J6UA 1MQ3A 5J0UA 3SV3A 4FHWA 4DSFA 2O1PA 1U9LA 4QZAA 2ZH3A 1UT5A 2AQ4A 5KTQA 2DPIA 1CEZA 1YLQA 3AQNA 4RU9A 4XQ7A 1OU5A 7ICOA 5IIKA 5JUMA 2HVHA 4I2CA 4B9VA 4EEYA 4R65A 3RJIA 2XGPA 3H4BA 5HR9A 1ZQWA 4X5VA 2ZUDA 5DQIA 4I2JA 4BXOB 1BVSA 3ZDDA 1X9WA 4KN4A 1ZQBA 4YMNA 3SV4A 3RH4A 4F4KA 3MR6A 5F2VO 4DSEA 3T3FA 2GWSA 4P4MA 1ZQJA 1JN3A 3OUYB 5KG7A 4KLDA 2DR9A 5KFYA 5D4BA 1U45A 4B9SA 4X4RA 3PMLA 2P66A 9ICCA 3RH6A 2HHXA 5DDMA 4KLFA 8ICNA 1ZQCA 3EZ5A 5KG5A 3MR2A 3T5HA 4I2HA 4MFCA 2O5AA 8ICGA 4RQ2A 4EZ9A 1BNPA 4KTQA 3RJJA 4YR0A 2UVWA 2R8KA 3Q8QB 1V9PA 2IMWP 4I28A 3SYZA 4TUPA 5HRLA 5DKWA 4YR3A 4NLNA 4I2DA 4ED6A 3OJUA 1XC9A 5KFFA 4B9NA 1XSNA 3Q8LA 4PH5A 5KG3A 1L3UA 4RQ0A 2V4RA 5KT3A 1ZQLA 4TUQA 2XY6A 4X0BA 1NK4A 2ASDA 5HHIA 1L3SA 2MUTA 5KFHA 2ZTDA 3HIYA 3OJSA 1NKEA 1UT8A 1ZQUA 1BGXT 3ZDCA 4NKTA 3MABA 3Q8SB 2FMPA 4M5DA 1KFSA 2F1HA 2PFQA 4GXIA 4AT8B 3M9OB 4UB5A 2W9BB 1U48A 1JX4A 3RB0A 4F5NA 1ZQIA 4KLJA 1DK2A 8ICVA 2IBKA 3H3AA 4LT6A 5J0RA 4UB2A 3PVXA 1NJYA 4DSIA 4XUSA 4QW8A 4BGDA 4F8RA 4O5KA 1U49A 9ICBA 1NK5A 4PGYA 4M6WB 2FLLA 3TANA 4I2AA 9ICXA 4RNMA 8ICFA 4P4PA 2IHNA 4ELUA 4YR2A 3UQ2A 2PFNA 3RJFA 4X4OA 2XCPA 4Q8EA 3C23A 1IXRA 1K1SA 4GC7A 2ZUBA 2PI5A 2NRWA 1UEUA 2AQ0A 3HT3A 5DQHA 4FHVA 4UB4A 3RH5A 4FHPA 2JZBA 3RB3A 4R64A 2ASJA 5DGBA 5F9LA 3PR4A 4M2YA 8ICBA 2DR8A 5DB6A 4DOBA 2MAXA 2PFOA 5IIOA 3GILA 2BQ3A 1ZQEA 1QSYA 3PO5A 4MFFA 1MC8A 4C8NA 1UA0A 4RQ7A 1NKCA 2VA2A 3MGHA 2Y1IA 1DGSA 5J0YA 1B43A 4DFJA 3HJ1A 3MGIA 4DL4A 4WC7A 5HREA 4DQQA 3UQ0A 3C1ZA 1WCLA 2V4QA 4R8UA 5J0PA 1KRPA 1MIVA 2VANA 3FYHA 4F4XA 2HHSA 4QZBA 1NK6A 2ZH2A 2Q66A 4Q43A 4M9HA 4EBJA 2ZHBA 1T4GA 2ATLA 4YFKA 4UD5A 4TQRA 4F50A 3E2EA 4YG2A 5DDYA 5HMMA 9ICHA 5BOLA 2PFPA 2M2UA 2DR5A 1ZQPA 2V9WA 4B9UA 1Q79A 3ORYA 5L1JA 3GQCA 4RZRA 7ICKA 2RDJA 1RXVA 1T7PA 1A76A 1AROP 2KP7A 9ICJA 2F1IA 5CJ7A 2BCRA 3UXPA 1BPDA 2XO7A 4F2RA 2XC9A 5KFSA 2NRVA 4IQUA 4DQSA 5DG7A 3BDPA 1ZQVA 4WCWA 2ZH9A 1K1QA 5J2JA 3UPSA 5HC9A 1C7YA 1QSLA 1S77D 3HPOA 3G6VA 4DL5A 2ALZA 1NO5A 1RPLA 5J2KA 4IG8A 2BDPA 9ICPA 1N56A 5KFKA 2C28A 4RQ4A 1JXLA 3V6KA 2FLPA 2KZZA 3OV7A 2DRBA 3OGUA 3PX0A 4BWJA 2W9BA 3BQ2A 4K4HA 3C18A 3OSNA 2A1JB 4E80A 5DEDA 4PHAA 3ISCA 4ED3A 3ISBA 4JV1A 2M9NA 5EWFA 3QE9Y 1Y88A 4J9NA 1D8YA 3RR7A 4X0AA 1NK7A 1RYSA 5HRIA 2BCVA 7ICNA 1Z3EB 2HHTA 4MEYA 9ICIA 2HHWA 2KN7A 4YXMA 1B22A 2NRKA 4QZEA 3GIKA 3GV8B 4IQWA 2HW3A 5KG2A 4ECSA 3G6XA 4ED8A 3RJHA 4UD4A 5L1IA 5KFPA 4DLEA 4KLLA 3EYZA 5DLFA 3V6JA 3ZDBA 7ICLA 3K75D 5DG8A 4QWCA 2WTFA 3BJYA 2KFNA 4J9MA 4FH5A 3H40A 4DL6A 5HMLA 3C21A 7ICUA 8ICMA 5F9NA 2AGOA 4O5EA 3HX0A 4RQ6A 2H5XA 1ZQRA 3HJ4A 4FH3A 4DL7A 4X4PA 1R8AA 4TQSA 3TI0A 4B9TA 4YMMA 5DLGA 4QZ8A 4ECTA 3C2KA 4IQTA 1TAQA 2AU0A 5KFUA 3SI8A 3RBEA 3BQ0A 1D9DA 2ZH5A 4EYHB 4O3PA 5J0TA 4MEXA 2HHQA 1NK8A 1S10A 4JWMA 3WFQE 4QWBA 5C5JA 4YP3A 4C8LA 9ICTA 3GFKB 4RQ5A 4LZGA 8ICKA 9ICMA 8ICZA 2DPJA 5J2DA 4YCXA 1BPYA 4NM1A 4NKUA 9ICGA 1ZJNA 2BCUA 5HRFA 8ICPA 1XSLA 1S76D 9ICWA 3K4GA 4KN7A 1NJXA 3C2MA 1KTQA 4NLGA 4F5PA 3QEAZ 3EWAA 4IRDA 1R8CA 4FO6A 2RDIA 2ZJAA 4QZHA 4WC5A 5DB8A 4O3RA 4ECRA 4ECQA 1ZQAA 4RWOA 4F5QA 1Z00A 3MDAA 2BE3A 1TK5A 5HHHA 8ICUA 4Q45A 1RXWA 1NK9A 4DQIA 2HHVA 4DQRA 2AGQA 5HNKA 3PX4A 1JAJA 2W9CB 1COOA 2FMSA 4YVZA 4S3NA 2BGWA 5D49A 4J9OA 2BPCA 3N4MB 4J9SA 2FPKA 3JPRA 3ZD8A 4R63A 3Q8PB 1S97A 2M2WA 5DBBA 3RRHA 4ELTA 3PW5A 4WBYA 4DF4A 1U47A 3PO4A 4BDPA 3OSPA 4I2FA 3OHBA 3G6YA 5IIMA 4DL3A 5KFOA 1ZJMA 1TK8A 7ICJA 5KFLA 4DF8A 3MR3A 3T5KA 3PW4A 3EPGA 1RYRA 4X4NA 4O3OA 3C2LA 4DSJA 4LVSA 3M8RA 3ZDAA 2KZ3A 1KNYA 3RJKA 4XRHA 4WC2A 2ZTEA 4AT7B 1TAUA 1ZQXA 3M9MB 1T3NA 3GIMA 1F5AA 4AT9A 4WC3A 5KT6A 4I27A 2R8HA 3PX6A 2ZH1A 5HRDA 3UPQA 3RJEA 1XO1A 3AU6A 4Q44A 1TV9A 3AQMA 4RPYA 3JPSA 3OVSA 4KLGA 4F2SA 5J2AA 4QZ9A 3QZ7A 4FS1A 2M2VA 5DB7A 4RQ1A 2C22A 1HUOA 4F91B 2VA3A 4DO9A 2P6RA 2C2RA 2C2DA 2PI4A 3HP6A 5CWRA 2BHNA 4ELVA 3PNCA 4E0DA 4K4GA 3BQTA 9ICAA 1HUZA 9ICRA 3H8SA 2W8KA 4F93B 3RB4A 4BXOA 3GV5B 4KLMA 4ECUA 3JZ0A 4UQGA 4EBCA 2XCAA 1DOQA 2Q0ZX 3OUYA 3QZ8A 4P4OA 4WC4A 2ZH8A 1NOMA 4RQ3A 8ICQA 4F4YA 3SZ2A 4KLQA 7ICPA 1KDHA 3THVA 2OWOA 4UAZA 3T5JA 7ICFA 3OVBA 4I2IA 3C5FA 4O0IA 5BOMA 1ZQMA 3IHQB 1L3TA 4B9MA 5BPCA 2DFLA 5KG0A 3LK9A 1ZQDA 4MF8A 5KFCA 1NJWA 1TFRA 1WOTA 5HRHA 2UVRA 1MIYA 5KFGA 3AU2A 1ZQTA 2JEFA 4ECZA 2R8IA 4NY8A 5J2BA 4BWMA 4F5RA 4QWEA 3RRGA 1JIHA 4ED0A 5CB1A 4DQPA 4X4SA 3ETLA 8ICJA 4DS5A 4I2BA 4CCHA 9ICOA 4RT2A 1BPBA 3Q8KA 3JYYA 5HRBA 3M9NB 1XSPA 3UXOA 1SZPA 3ZD9A 2W8LA 3TFRA 1BPXA 4FBTA 8ICXA 4G3IA 3H7IA 1JMSA 2JEIA 1NZPA 5L1LA 4DL2A 2BQRA 1V4AA 4MFAA 1Q78A 4X4TA 1S0MA 5DG9A 3B0YA 5KG6A 4AT8A 4NLKA 5IINA 4O9MA 8ICAA 2FLNA 5EWEA 4FBUA 4I2EA 1IM4A 2I9GA 7ICHA 4Q8FA 5TZVA 3PV8A 2BPFA 1HJPA 2JEGA 5L9XA 4M6WA 2J6SA 5EOZA 3MFHA 3RB6A 2IHMA 4KLEA 5KFAA 1MIWA 3MR5A 3C1YA 4UBCA 4DS4A 5KT2A 3GIJA 4WBZA 2MUTB 1NKBA 4E8FA 1BPZA 4YN4A 1T8EA 4KMUA 4KLIA 1A77A 1ZETA 2HHUA 4ECYA 4UBBA 4YD1A 3OHAA 3ISDA 1SKSA 5J0WA 5KFNA 5J2GA 4GXKA 4C8OA 1WCNA 2XY5A 4F92B 3LDAA 4TURA 2UVUA 1EXNA 3V7KA 1S9FA 2LYHA 2W9MA 5J2EA 4QZFA 1TK0A 7ICIA 9ICSA 4KLSA 8ICTA 3LQCB 5IIIA 5J0OA 5J0XA 4UB3A 3M8SA 5EWGA 4DFPA 4EYIB 9ICNA 4E7XA 1UA1A 1VFGA 3JPNA 4QZGA 3JPTA 4FS2A 5KFIA 5D46A 8ICYA 3UXNA 4KLTA 4PHPA 1U4BA 8ICHA 3C5GA 3NYBA 3RBDA 5KFXA 2ISPA 3PR5B 4IRKA 4PGQA 4I29A 1S0NA 3LWLA 1ZQNA 1TFWA 4RT3A 4RQ8A 1LV5A 2M2TA 7ICMA 2JZBB 1XU4A 3EW9A 3JPPA 1ZQHA 3KHGA 1KLNA 3IM1A 4ECWA 2B21A 4I2GA 1QSSA 1N48A 3TARA 1D9FA 4ZH4A 4UAYA 1SKRA 4DWIA 1LB2B 3MDCA 4EP7A 2BR0A 5KFQA 2UVVA 9ICQA 4QW9A 3QEBZ 3AQLA 4GC6A 2W9AA 8ICRA 3L9DA 3WFOA 4R8UB 4C8MA 5KFTA 4EBEA 3KHHA 1L5UA 5J2FA 4QZIA 1TKDA 5KFEA 4DFKA 9ICLA 2ID1A 1X9MA 2C2EA 2FPLA 3KHRA 5KFDA 3RTVA 3GV7B 1PZNA 4RPXA 9ICUA 4X4VA 9ICVA 4LZDA 4YD2A 3Q8RB 2PXIA 2NRZA 4O5CA 5J0QA 1BNOA 2ZH4A 1KFTA 4Z6CA 1BPEA 2A1JA 4RUCA 4PHEA 3AUOA 4IR1A 2JEJA 3TAPA 4NXZA 5CP2A 5KT4A 1ZQQA 4F4ZA 4DFMA 2DVIA 4RWPA 4QZCA 2XGQA 2FMQA 2ZUCA 1MSWD 3H38A 2Y1JA 4ECVA 4ED7A 1S0OA 4XA5A 1RZTA 3PW7A 3N97B 4EBKA 2R8JA 5KFJA 4PGXA 3V7JA 4IRCA 4RNNA 3WFRE 3NGDA 2KTQA 3JPOA 5J2HA 3RAQA 2ASLA 4KLHA 3V6HA 5DQGA 5KT5A 1MQ2A 2ISOA 4ECXA 1TVAA 1S0VA 3RAXA 4JWNA 2F1JA 4KLOA 4KITB 3MBYA 5DGAA 2KZMA 2RFFA 1ZQSA 1ZQFA 1KFDA 1QTMA 5HRGA 3PY8A 4DSLA 5KFWA 4EBDA 2BCQA 4ED2A 5KFZA 4M0AA 2IA6A 4DOCA 5DB9A 3PMNA 3KHLA 4RPZA 1XWLA 3PW0A 3KTQA 4P2HA 1QLNA 4M9NA 3V72A 1ZYQA 4J9LA 1XS9D 4M9LA 9ICFA 4B9LA 2XY7A 5CA7A 4XQ8A 4ED1A 8ICWA 1JQRA 4FHYA 8ICCA 2DRAA 4Z6FA 4WC1A 4DLGA 1ZQZA 2ZTCA 4JUZA 8ICIA 3V7LA 1SL2A 1R89A 5KFBA 3GDXA 1DK3A 5CR0A 5J2IA 7ICGA 5CHGA 1UEVA 3C66A 5IIJA 4PHDA 5KT7A 3LWMA 4J9KA 3PW2A 4JV0A 4DEZA 1ZQKA 5KFVA 2KFZA 5KG1A 9ICEA 3H39A 3B0XA 4X4QA 4QZDA 2DR7A 5KFMA 4F4WA 4DSKA 7ICEA 3RR8A 4IR9A 4O3NA 1JXEA 5HP4A 2BQUA 4ATBA 2W9CA 2J6TA 4WC0A 4F5OA 3Q8MA 1X9SA 5HRKA 5IILA 3H4DA 3NTUA 4Z6EA 4F3OA 1CUKA 1UETA 4YMOA 4FHXA 3TQ1A 4UB1A 3GIIA 3T5LA 7ICQA 1SKWA 4QWAA 7ICSA 2BKEA 4RUAA 3WFPA 4Z6DA 4M9JA 4J9QA 4O3SA 4UAWA 1D8LA 4R66A 4TUSA 1SL0A 2BPGA 5J29A 4JV2A 4K4IA 2HVIA 4C8KA 2VA8A 1Z00B 3WFSC 2ZH7A 2NRXA 5J0SA 2I1QA 1KEJA 2AJQA 5DECA 1R8BA 3HWTA 3HW8A 4AT7A 4M9GA 1X2IA 2HHPA 3AQKA 4WC6A 7ICVA 4IQVA 4KLUA 2ZJ8A 1H38A 3FDSA 4O3QA 8ICEA 1L3VA 7ICRA 3H37A 4NM2A 1FA0A 2PBEA 2ZHAA 1ZQYA 4RWNA 4X4UA 4YXJA 3MFIA 1ZQGA 2ZJ5A 5KFRA 4PPXA 5DBAA 4EZ6A 1ZQOA 8ICSA 4YQWA 3BQ1A 4DOAA 4ATBB 2FPMA 4JK1A 4GXJA 2NRTA 4MF2A 8ICOA 1TFYA 4QWDA 4M47A 9ICKA 3OVAA 7ICTA 1NJZA 4J9PA 5J2CA 1NK0A 2ZH6A 5DBCA 3JPQA 3H8WA 1VJ7A 4GLXA 3RJGA 8ICLA 4RWQA 2R8GA 3TFSA 3H8JA 1KSPA 3EPIA 1SL1A 3ZDEA 4RNOA 5L1KA 4NLZA 2P6UA 1PX5A 4AT9B 2BCSA 3TAQA
chains in the Genus database with same CATH superfamily
2W11A 2AGPA 5J0UA 4FHWA 1U9LA 3ER8C 4RU9A 2VKQA 5IIKA 2K89A 1PVQA 2YTUA 4B9VA 3HKZC 1X9WA 4KN4A 1ZQBA 3RH4A 3MR6A 2QARA 5F2VO 2GWSA 2DR9A 1PK3A 4B9SA 4X4RA 1ZD4A 3MR2A 4RQMA 1SZHA 3UMGA 2GLEA 2UVWA 3Q8QB 4QIWC 4TUPA 4C80A 3NVVA 1QCKA 3OJUA 2OM6A 1XC9A 5ALSA 1L3UA 2KEYA 4X0BA 2DKZA 5AI5A 2MUTA 5KFHA 2ZTDA 4HX0A 1BGXT 5F3XB 4M5DA 2RQ5A 1KFSA 4AT8B 5AI6A 2W43A 3RB0A 4KLJA 1DK2A 3OPXA 4Y2PA 2A3VA 4NJ8A 5ALYA 3H0LB 4DSIA 4Y2YA 4QIWF 4O5KA 1SXDA 9ICBA 4K96A 1NK5A 3TANA 1N5XA 2IHNA 1ED1A 3UQ2A 2PFNA 2XCPA 4QJFB 3PSTA 1IXRA 2W04A 5CHEA 2PI5A 1VLBA 5KNIA 2E1EA 5DQHA 3RH5A 5DGBA 4M2YA 8ICBA 5JTGA 2QKQA 5IIOA 4MFFA 1NKCA 4RQ7A 1B43A 4DFJA 3TACB 5J0PA 1KRPA 3FYHA 4F4XA 4DCCA 1SV0C 2HHSA 2Q66A 4Q43A 2RHFA 1RG6A 4UD5A 1ZOLA 2ZIXB 4YG2A 3NVZA 2KNJA 4OAFA 2BCRA 4WH5A 5KFSA 4IQUA 4WCWA 1K1QA 2ALZA 1TAMA 4IG8A 1JXLA 2C28A 4NL9C 1PVPA 1ZQ1C 2EZYA 4OJLA 1P7DA 3BQ2A 4UB8U 3OSNA 4E80A 1RYSA 2KHVA 1UPHA 1Z3EB 1B22A 4FE3A 4NLCA 2HHWA 2NRKA 4QZEA 4IQWA 2YY6A 2HW3A 5KG2A 4ECSA 4ED8A 4UD4A 5L1IA 4DLEA 3V6JA 5DG8A 1MA7A 4QWCA 2KFNA 2CN1A 4J9MA 4JMUA 5CFTA 7ICUA 1T3QA 1N62A 1F44A 3HX0A 2H5XA 2B51A 3TI0A 3F53A 4B9TA 4IQTA 1TAQA 2AU0A 5J0TA 1F0MA 5CFSA 2FJ6A 1S10A 3M6KA 5C5JA 2F44A 5EE0A 2D6FC 2K4PA 1C20A 5J2DA 9ICGA 2BCUA 1S76D 2MU2A 4KN7A 4NLGA 5B66U 5ALQA 1R8CA 1V85A 4PJ0U 3DEEA 5HHHA 1RXWA 4DQRA 2AGQA 3PX4A 2W9CB 3PZPA 2JHDA 4S3NA 2BGWA 4J9OA 3R9KA 3N4MB 4ACOA 5DBBA 2LKYA 3RRHA 4ELTA 1S8OA 3OSPA 4EX6A 5IIMA 4DL3A 4X4NA 4O3OA 4LVSA 1L6NA 2KZ3A 4WC2A 3RJKA 2ZTEA 3NRZA 1XO1A 2JR5A 5GTHU 3JPSA 4KLGA 4QZ9A 5DB7A 4RQ1A 3SD7A 4DO9A 4ELVA 5CWRA 1HUZA 2E8OA 4BXOA 4KLMA 3JZ0A 4EBCA 1GPJA 1JRPA 3QZ8A 1NOMA 5AKZA 4RQ3A 1ZRMA 5J8YC 5ALKA 4I2IA 3C5FA 5ALPA 4NLBA 5KFGA 3AU2A 1ZQTA 2WF9A 4QWEA 4X4SA 3F2CA 5AKYA 4I2BA 2W54A 5HR7A 3NWIA 4G3IA 1UCVA 1JMSA 4AP9A 2JEIA 4K98A 4DL2A 1V4AA 4O9MA 8ICAA 5ALXA 3WKAA 4I2EA 1IM4A 5AKKA 2OCEA 3NUQA 5TZVA 4Q8FA 1HJPA 2JEGA 2KICA 5L9XA 4M6WA 2J6SA 3RB6A 4KLEA 1UQVA 5KFAA 4UBCA 3TKAA 1BPZA 3AL0B 1L7MA 2HOFA 1A77A 4OCZA 4F71A 4UBBA 3OHAA 3M1YA 4WOYA 1L7PA 1WCNA 3I28A 7ICIA 1QQ6A 2O6KA 1UA1A 3PSIA 1O08A 3UXNA 3BQ7A 4PHPA 1U4BA 3C5GA 3NYBA 2ISPA 5ALZA 4IRKA 4P0PA 4BJQA 5AI8A 1ZQNA 3JPPA 3IM1A 1N48A 3TARA 4UAYA 3MDCA 4CNQA 2D8CA 2WFAA 3QEBZ 4PL1A 8ICRA 4DFKA 5ALTA 3KHRA 4X4VA 2HBKA 1COKA 2NRZA 2IUBA 3H8MA 1YT3A 4K8VA 1BPEA 2A1JA 3TAPA 5J8YA 4DFMA 2DVIA 4NWIA 1RYUA 3SENA 1HEKA 3N97B 2R8JA 3V7JA 3NGDA 3JPOA 3RAQA 1MQ2A 5KT5A 3QU9A 3K1RB 4OAIZ 4JWNA 3D2QA 4KX5A 4LEYA 2KZMA 3NASA 1ZQFA 5ALLA 5HRGA 5KFWA 4ED2A 2IA6A 5DB9A 3PMNA 3SQIA 3V72A 2KV2A 1XS9D 5CA7A 4XQ8A 1XO0A 4KB6A 5AK5A 2F3NA 4WC1A 3AM9A 5ALVA 1SL2A 2MSNA 7ICGA 5CHGA 2KSOA 2LPEA 3JCFA 1LKYA 2G07A 5KFMA 7ICEA 2YX8A 2J6TA 4WC0A 3Q8MA 2NO4A 5IILA 2RP5A 3H4DA 4Z6EA 1UETA 2XIDA 4UB1A 2PKEA 2N1RA 3WFPA 4TUSA 4K4IA 3WFSC 1Z00B 2I1QA 2AJQA 5DECA 1X2IA 4WC6A 3FC4A 7ICVA 4IQVA 3NS1A 2EZXA 8ICEA 3FDSA 3WKBA 2HBMA 2PBEA 3KFUF 4YXJA 5KFRA 8ICSA 5EE1A 4I0UA 3IG5A 4QWDA 1CRXA 3OVAA 5J2CA 1VJ7A 4RWQA 3TFSA 2QB1A 1SL1A 3ZDEA 2H3VA 4AT9B 2A1AA 4J9RA 5KG4A 4EEKA 4QZAA 3BZKA 2DPIA 1YLQA 4EV6A 7ICOA 2HVHA 4I2CA 4R65A 4CF4A 4K97A 2XGPA 1YZ6A 5HR9A 2WB1C 1ZQWA 3CK6A 4X5VA 3E58A 5JTIA 1BVSA 3SV4A 4DSEA 3K7DA 1JN3A 5KG7A 5KFYA 1U45A 3PMLA 8ICNA 4UARA 3EZ5A 4MFCA 3T5HA 8ICGA 2BBHA 1FFUA 4EZ9A 4KTQA 3RJJA 2R8KA 5B3QA 1V9PA 2IMWP 3SYZA 5HRLA 4I2DA 1N61A 5KG3A 4RQ0A 1SWVA 4C7ZA 5KT3A 3HIYA 2ASDA 5HHIA 1L3SA 1J2NA 5AKJA 4C0ZA 3OJSA 1UT8A 5AM4A 1NKEA 4NKTA 2K8AA 3Q8SB 5ALOA 2MRLA 2PFQA 2W9BB 1U48A 1JX4A 3H3AA 2CXYA 4F5NA 8ICVA 2EZZA 4QNLA 4UB2A 3PVXA 1NJYA 4QW8A 4PGYA 2FLLA 9ICXA 2Y9UA 8ICFA 1SIJA 4CDGA 4P4PA 4X4OA 2VJ5A 4GC7A 2ZUBA 4Y2SA 2PMZC 5AM0A 3HT3A 2KVSA 2BDUA 3GILA 1ZQEA 2ESEA 1MC8A 4OD0A 1UA0A 2VA2A 1DGSA 5KL1B 3MGIA 4OO1J 3C1ZA 1WCLA 3QUQA 2V4QA 3AN1A 1ZXIA 4M9HA 2ZHBA 2HDOA 2PMZF 2ATLA 3AEVA 4F50A 1NI3A 2EAPA 3BZCA 5DDYA 5ALUA 3E2EA 1UHUA 1ZQPA 1TE2A 3ORYA 2RDJA 2F76X 1RXVA 2B6GA 3D2NA 2NRVA 5AICA 1ZQVA 5J2JA 3UPSA 5HC9A 2LYBA 3HPOA 3G6VA 3WK9A 9ICPA 3E0FA 3V6KA 2KZZA 2DRBA 5AK3A 3OGUA 5CRXA 4BWJA 2W9BA 3ISCA 5EWFA 3RR7A 4X0AA 5HRIA 2BCVA 2ODGA 7ICNA 5C0YA 1X6IA 2W03A 3L4PA 2YMMA 2WTFA 3BJYA 4BUGA 4FH5A 2ZXHA 1PK1A 3H40A 3CW2C 4DL6A 4EELA 5F9NA 3HJ4A 4RQ6A 3N7RC 1ZD3A 1R8AA 1T94A 3WK5A 2QLTA 5DLGA 4ECTA 3SAHA 2ZH5A 1RM6C 4MKPA 2HHQA 3KKAA 3WFQE 9ICTA 4LZGA 2DPJA 4NM1A 4YCXA 1BPYA 3PSPA 2YB4A 9ICWA 3K4GA 1NJXA 4IRDA 2B4VA 3HKZF 4FO6A 5DB8A 4O3RA 4CGZA 2ZIWB 4RWOA 3MDAA 1X6JA 4Q45A 2FMSA 4NXWA 3RF9A 3ZD8A 4R63A 3Q8PB 1OW5A 5A0LA 1L7NA 5B5EU 4DF4A 1U47A 3PO4A 4BDPA 1JUDA 2G5HB 3OHBA 4ATBA 4UASA 5KFOA 2W3RA 2E5SA 1RYRA 4DSJA 3ZDAA 2QB0B 4XRHA 3F2DA 3M9MB 1T3NA 4WC3A 5KT6A 3PX6A 2ZH1A 5HRDA 3UPQA 2F8KA 4N7RA 1IIPA 4NXVA 1TV9A 3AQMA 4RPYA 2K8BB 4CF5A 4F2SA 3M7DA 3QZ7A 2M2VA 2VA3A 3AQEA 2C22A 2C2RA 4C4SA 2PI4A 9ICAA 2BHNA 4FZMA 3RB4A 5L1MA 5ALDA 2E8MA 1D8BA 2Q0ZX 4WC4A 5ALNA 3DV9A 4F4YA 4KLQA 7ICPA 4ICAA 2G06A 1KDHA 1DRGA 4UAZA 2E1FA 7ICFA 3CP8A 3OVBA 3VCBA 3IHQB 2AHOB 4UB6U 3KZXA 3N28A 2DFLA 3LK9A 4MF8A 1NJWA 1TFRA 1WOTA 4NY8A 5J2BA 4F5RA 3RRGA 3UMCA 4ED0A 4DS5A 9ICOA 1QQ7A 1FO4A 1BPBA 4RT2A 3JYYA 3M9NB 3TFRA 1SZPA 4JB3A 2E3TA 2BQRA 4MFAA 4EENA 1Q78A 4X4TA 1HIWA 4LJXA 4AT8A 3LVVA 5IINA 2FLNA 4FBUA 2I9GA 3QUBA 3PV8A 1ZD5A 1YZ7A 2KOBA 3MFHA 2IHMA 2KJ9A 3CYMA 2LMRA 3MR5A 3GIJA 2EDUA 4E8FA 5AIAA 4KLIA 1SKSA 5J0WA 2KE7A 4C8OA 2KMDA 4F92B 3LDAA 2UVUA 1EXNA 9ICSA 2LYHA 5AIBA 4KLSA 5IIIA 5J0OA 2KG5A 9ICNA 4E7XA 5EWGA 4EYIB 2ES6A 4K99A 3TADC 8ICYA 4KLTA 5KFXA 4I29A 5EE3A 1TFWA 4RQ8A 2M2TA 2JZBB 2ZIXA 1ZRNA 3KHGA 2FE9A 1ZQHA 7ICLA 2B21A 4I2GA 3NVYA 4A8EA 4DWIA 3ETRA 1N63A 2OYYA 2W9AA 4R8UB 5KFTA 4EBEA 1L5UA 3GU3A 1X9MA 3RTVA 2KKVA 4RPXA 2XVTA 5KAIU 9ICVA 3H0MB 4OAGA 1NNLA 4O69A 2ZH4A 1SV0A 1KFTA 4K9AA 2YMQA 5KT4A 5ALEA 4F4ZA 5AM2A 2XGQA 2ZUCA 1S0OA 1AQ6A 1RZTA 4CE6A 4EBKA 3WKDA 4PGXA 4IRCA 2DKXA 5AM5A 5AKGA 2ASLA 3HILA 5AKXA 1S0VA 3OTQA 2F1JA 4KITB 5DGAA 4NL9A 4P0QB 2D3DA 1M6YA 3QNMA 3BS5B 4IC9A 4M0AA 2KK0A 3PW0A 3KTQA 5CFUA 4B9LA 8ICWA 3S6JA 8ICCA 2WHEA 4Z6FA 4DLGA 4JUZA 8ICIA 4C7YA 3HJEA 1SWWA 3F5AA 4PHDA 5KT7A 4CRXA 2K4IA 1Q8KA 3LWMA 4X4QA 4DEZA 1ZQKA 5KG1A 4DSKA 4IR9A 2W9CA 4F5OA 1SV4A 4YMOA 1SKWA 4QWAA 4UATA 4RUAA 4R66A 2BPGA 4JV2A 2LYAA 2K8CB 4C8KA 2HCFA 3DDHA 2OXOA 5J0SA 2ZH3A 1R8BA 4M9GA 4KLUA 1H38A 7ICRA 4O3QA 1ZQYA 4RWNA 2KIWA 1ZQGA 4PPXA 4YQWA 4GXJA 8ICOA 4EEDA 4M47A 4OJ6A 1Z4NA 1NJZA 4J9PA 1NK0A 2ZH6A 4Y2JA 3H8JA 1KSPA 4RNOA 2P6UA 2BCSA 3QU5A 1Z1BA 4DSFA 2O1PA 5ALRA 2XICA 1UT5A 2AQ4A 1CEZA 4J03A 1OU5A 5JUMA 4C4RA 3FM9A 3H4BA 2KIVA 5ALGA 4YMNA 2JRZA 3ERCC 4F4KA 3T3FA 3OUYB 2KHQA 2P66A 3D2SA 2H3QA 1ZQCA 5KG5A 4I2HA 2O5AA 1BNPA 4I28A 5D62A 4YR3A 4ED6A 5KFFA 4B9NA 4PH5A 2V4RA 3QUCA 2F2AB 4EGWA 4TUQA 2DUYA 1S5LU 2WF5A 1ZQUA 3N7SC 3ZDCA 4FFDA 3MABA 5GTIU 3IRUA 2F1HA 5FP0A 4GXIA 3M9OB 4UB5A 1ZQIA 2IBKA 4OJOA 4LT6A 5J0RA 4BGDA 1U49A 2ZIVB 4O67A 2Y0SC 4RNMA 2ZXIA 3C29A 4ELUA 4YR2A 3QX7A 4Q8EA 5AI0A 1K1SA 2NRWA 1UEUA 2A19A 4BX9C 4UB4A 3RB3A 5DB6A 4DOBA 4USAA 2PFOA 2BQ3A 3PO5A 1QSYA 4C8NA 5TISU 4DL4A 2Y0SF 4WC7A 4DQQA 3UM9A 4G9BA 1MIVA 2VANA 3WK4A 2G5IB 2ZH2A 2M0NA 5T14A 4TQRA 2M2UA 2PFPA 4B9UA 2Q4TA 7ICKA 4NV0A 1L8LA 1T7PA 4LEWA 2KP7A 9ICJA 2F1IA 5CJ7A 3UXPA 1BPDA 5DG7A 3WKCA 1Q3UA 5D61A 4DL5A 1RPLA 2KJ5A 5KFKA 3OV7A 4ED3A 3A0HU 3ISBA 3QE9Y 1Y88A 1D8YA 2HHTA 3KZIU 4MEYA 2ZIVA 2KN7A 2HI0A 1SGGA 1MN8A 3KOOA 3U26A 3GIKA 3UMBA 3G6XA 2ZIUB 5KFPA 4KLLA 5AKLA 3ZDBA 4UAVA 3K75D 2F8LA 4UAUA 4OJPA 4RQNA 2AGOA 4O5EA 2ZG6A 4Y2VA 4DL7A 4X4PA 4YMMA 3C2KA 5KFUA 3SI8A 3RBEA 4MEXA 1NK8A 3T79A 4JWMA 4QWBA 3GFKB 5KAFU 4RQ5A 8ICKA 9ICMA 2DWQA 8ICPA 1KTQA 2MA1A 2WB1F 4F5PA 3EWAA 2ZJAA 4QZHA 1Z00A 3D6JA 8ICUA 1NK9A 2H3IA 5HNKA 1WYGA 2HOIA 2GH1A 2NYVA 2FPKA 1S97A 5D63A 3PW5A 4O68A 4I2FA 7ICJA 1TK8A 5KFLA 4DF8A 2CRXA 3MR3A 3T5KA 2LI6A 3EPGA 3PW4A 3C2LA 5G5HA 3KD3A 4AT7B 1TAUA 1ZQXA 3QU7A 1F5AA 3GIMA 1J97A 2HMXA 4AT9A 4I27A 3B9JA 2R8HA 3RJEA 1KBUA 1L8OA 3AU6A 4Q44A 1K5OA 5AK4A 3OVSA 4FS1A 4F91B 3BQTA 9ICRA 3H8SA 2W8KA 4F93B 3EF2A 2NV3A 3GV5B 4FZNA 4DFDA 2XCAA 4F72A 4P4OA 5EE9A 3SZ2A 3NRWA 3AMZA 3F5EA 3H0RB 3THVA 4Y2XA 4B9MA 3L5KA 1IG6A 1ZQDA 5HRHA 2UVRA 1MIYA 2HBJA 4ECZA 1JIHA 2QARB 5CB1A 4DQPA 4Y2TA 3ETLA 8ICJA 4CCHA 1LVHA 3SR6A 1KN5A 3Q8KA 1XSPA 1BPXA 3ZD9A 2W8LA 8ICXA 3H7IA 1S0MA 5DG9A 3B0YA 4NLKA 5EWEA 4PL2A 2H3FA 3M6ZA 4LEVA 2K60A 2R18A 2WAQC 5ALMA 1CI4A 4AYBC 3C1YA 2I6XA 4U7CA 2MUTB 4HAIA 4YN4A 1T8EA 1ZETA 4ECYA 4YD1A 4GXKA 3LVWA 5HR6A 3SAFA 4TURA 2YN4A 3V7KA 1S9FA 5J2EA 2WAQF 8ICTA 3QUTA 4DFPA 4AYBF 4QZGA 5KFIA 5D46A 8ICHA 3RBDA 3WK7A 1S0NA 3IDWA 3O0FA 4RT3A 1LV5A 7ICMA 1SKRA 1WWUA 1LB2B 4EP7A 5KFQA 4KM5A 1Q3VA 2K4HA 4QW9A 3L9DA 1O03A 5J2FA 4QZIA 2ID1A 9ICLA 5ALIA 3SEIA 2FPLA 5KFDA 9ICUA 4LZDA 4YD2A 4EEBA 3Q8RB 1X40A 3PHZA 4O5CA 3MGVA 4U6PA 5ALHA 4RUCA 4PHEA 3AUOA 4IR1A 2JEJA 2EAMA 5CP2A 3HRDD 3C28A 2LM4A 2BZFA 4EX7A 1MSWD 4ECVA 3I76A 4XA5A 3F2BA 1VJ5A 3PW7A 5KFJA 5ALJA 1JALA 4KLHA 4ECXA 1TVAA 5AI4A 4IS7A 2GOLA 3RAXA 4KLOA 3MBYA 2VJ4A 1KFDA 1QTMA 3WK8A 4DSLA 4WQLA 4EBDA 4DOCA 3KHLA 1XWLA 4P2HA 1QLNA 3ICXA 4M9NA 5AKHA 3AQFA 4M9LA 2XY7A 2L5YA 4FHYA 5AK6A 2DRAA 1KW4A 3FAHA 1WUDA 3A0BU 1ZQZA 2W7OA 2JV3A 3GDXA 1DK3A 5JRTA 5J2IA 1UEVA 5IIJA 1JROA 4J9KA 4WJ3B 3PW2A 2ZIWA 5KFVA 9ICEA 3ZI4A 2DR7A 4QZDA 4F4WA 3WU2U 3RR8A 4O3NA 1JXEA 5HP4A 1NZBA 5HRKA 3NTUA 1L7OA 1PUZA 2FI1A 4FHXA 7ICSA 1SB3C 2BKEA 4M9JA 1D8LA 1SL0A 5J29A 1ECWA 2HVIA 1JI7A 2VA8A 2HSZA 2RLTA 2NRXA 2QB0A 1J2MA 3NVOA 3HWTA 1B4FA 3AQKA 3H37A 4NM2A 1FA0A 3IP4B 4X4UA 2HBLA 5DBAA 4UW9A 1ZQOA 1IV8A 2FPMA 4MF2A 2NRTA 1TFYA 5DBCA 3H8WA 3IN5A 3OWGA 4GLXA 3RJGA 1KQQA 2JMGA 4NLZA 4OJ5A 2G08A 4HYKA 1X66A 2J6UA 4M04A 1MQ3A 4FO1A 3SV3A 4C4TA 1KKXA 5KTQA 3AQNA 4XQ7A 4JLXA 4EEYA 3RJIA 2ZUDA 5DQIA 4I2JA 4BXOB 5AI9A 3ZDDA 1V97A 2G0AA 1Z1VA 4P4MA 1ZQJA 4O3MA 4KLDA 2AH5A 5D4BA 9ICCA 4Y2UA 3RH6A 2HHXA 2AXTU 5DDMA 4KLFA 1Q46A 2WF7A 4RQ2A 4YR0A 1QQ5A 2KD1A 2WF6A 5DKWA 4NLNA 2LBOA 1XSNA 3Q8LA 2KVCA 2EAOA 1ZQLA 2XY6A 1NK4A 2FMPA 2EH9A 4XUSA 4F8RA 4M6WB 1A0PA 4I2AA 3ONNA 3RJFA 2WF8A 3C23A 3WK6A 1FFVA 1A6SA 2BBJA 2AQ0A 2FCLA 4FHVA 4FHPA 2JZBA 3IV6A 2ASJA 4R64A 3PR4A 5F9LA 2DR8A 3MCRA 2MAXA 3NVWA 2IHOA 3MGHA 2Y1IA 5J0YA 3HJ1A 2CPRA 5HREA 4CF3A 3UQ0A 3KBBA 4R8UA 2HN1A 4P0PB 4QZBA 1NK6A 3VC8A 4EBJA 1T4GA 3TADA 4YFKA 9ICHA 5HMMA 5BOLA 2DR5A 2V9WA 1Q79A 5L1JA 3GQCA 4RZRA 1A76A 1AROP 2OH2A 2XO7A 4F2RA 4KX3A 2XC9A 4DQSA 1SXEA 3BDPA 2ZH9A 4NXXA 1C7YA 1QSLA 1S77D 2Y9TA 1NO5A 5J2KA 2BDPA 1N56A 4RQ4A 2FLPA 1FEZA 5H2FU 3PX0A 4K4HA 3C18A 2A1JB 5AHXA 5DEDA 4PHAA 4JV1A 2M9NA 4J9NA 4P0QA 4US8A 1NK7A 4JLZA 9ICIA 3BS5A 2H3ZA 4YXMA 2B0CA 3GV8B 2IOFA 3RJHA 4LEZA 3EYZA 5DLFA 5K4LA 3RFAA 2JGAA 5HMLA 3C21A 5B3PA 5G5GA 8ICMA 1ZQRA 4FH3A 1B0XA 4TQSA 4QZ8A 3SMVA 2JH7A 5JU5A 3BQ0A 1D9DA 4EYHB 4O3PA 4YP3A 2Z7JA 4K9BA 4C8LA 2XI9A 2P35A 8ICZA 4NKUA 1ZJNA 5HRFA 3QU4A 1XSLA 4B6JA 2KSOB 3C2MA 1QH9A 2DL0A 3QEAZ 2LM1A 2E8NA 2RDIA 4WC5A 4ECRA 4ECQA 1LKYB 1ZQAA 4F5QA 2BE3A 1TK5A 2B56A 4DQIA 2HHVA 4Y2RA 4GFJA 5AM1A 1N5WA 1JAJA 1COOA 4YVZA 5D49A 2BPCA 4J9SA 3JPRA 2M2WA 4NXTA 4WBYA 3G6YA 1ZJMA 1FIQA 4PZNA 3M8RA 1KNYA 3SAGA 3PSFA 2W7PA 1RQNA 1OXJA 5J2AA 1HUOA 2W55A 2P6RA 2RRDA 3QYPA 2C2DA 3HP6A 4E0DA 4WQKA 3PNCA 4K4GA 2GA9D 2G09A 4ECUA 4UQGA 1DOQA 1XNSA 3OUYA 2ZH8A 8ICQA 2KJ8A 2OWOA 3T5JA 4KMOB 4O0IA 5BOMA 3BS7A 1ZQMA 1L3TA 4ZOHC 5BPCA 4OAHA 5KG0A 5KFCA 4O6AA 2JEFA 2R8IA 4BWMA 4XJEA 1VDVA 5HRBA 3UXOA 4FBTA 5AKEA 1NZPA 5L1LA 2DQNB 2I5HA 1GO3F 5KG6A 2F77X 2LHTA 4US9A 5ALFA 7ICHA 3N7PD 2BPFA 1KL9A 1WWVA 5KL8B 1X42A 5EOZA 2GO7A 3CRXA 1MIWA 4DS4A 5KT2A 4WBZA 1NKBA 2EANA 4KMUA 2DF4B 3K1ZA 1N2XA 2HHUA 3ISDA 5KFNA 5E79U 5J2GA 2JH1A 2XY5A 2W9MA 4QZFA 1TK0A 2IOHA 3LQCB 5J0XA 4UB3A 3M8SA 3WKEA 1VFGA 3JPNA 1DXSA 3JPTA 4FS2A 2NO5A 3PR5B 2YMLA 1WG8A 4PGQA 3LWLA 4IL6U 2YB1A 1XU4A 3EW9A 1KLNA 4ECWA 5AM3A 1QSSA 1D9FA 4ZH4A 2BR0A 2UVVA 9ICQA 2GAFD 4GC6A 3AQLA 3J81j 2JXJA 3WFOA 4FZLA 4C8MA 5AKIA 2FDRA 3KHHA 1TKDA 5KFEA 2KKPA 2C2EA 4NXUA 3GV7B 1PZNA 1X9XA 1V38A 2PXIA 1BNOA 5J0QA 2EWRA 3MC1A 4Z6CA 4NXZA 1ZQQA 5ALWA 3I1YA 4Y2QA 4RWPA 4PZOA 4QZCA 2FMQA 3H38A 2Y1JA 3LYSA 4ED7A 2ZIUA 3QXGA 4RNNA 3WFRE 2IOFK 2KTQA 5J2HA 3V6HA 2HOQA 5DQGA 2ISOA 3L3FX 3NKUA 3ED5A 2RFFA 1ZQSA 3KKAC 3PY8A 3ER9B 1ZD2P 2BCQA 5KFZA 3EUB2 4RPZA 1URJA 2YMPA 1ZYQA 4J9LA 9ICFA 1JQRA 4ED1A 1PK1B 1PVRA 3CNHA 1Z4OA 2ZTCA 3V7LA 1R89A 5KFBA 5CR0A 2DGZA 3C66A 2DBYA 4JV0A 2W3SA 1Z19A 2KFZA 3H39A 3B0XA 2K4EA 2OHFA 1DGJA 2BQUA 3GZFA 2HN2A 3QU2A 1X9SA 3IG8A 1OUQA 4GIBA 4F3OA 1CUKA 3TQ1A 3GIIA 3T5LA 7ICQA 2EQYA 2OEHA 5CEHA 4Z6DA 4J9QA 4O3SA 4UAWA 2ZH7A 4MHVA 1KEJA 4AT7A 2VIXA 2E8PA 3HW8A 2HHPA 2YQEA 2ZJ8A 1L3VA 2ZHAA 3MFIA 2ZJ5A 4EZ6A 3BQ1A 4DOAA 4ATBB 4JK1A 1F5SA 1RDFA 3ALRA 9ICKA 7ICTA 3JPQA 1RQLA 8ICLA 2R8GA 3EPIA 1PX5A 1N60A 5L1KA 3TAQA
chains in the Genus database with same CATH topology
4HYKA 4J9RA 5KG4A 2AGPA 4M04A 2J6UA 1MQ3A 5J0UA 3SV3A 4FHWA 4DSFA 2O1PA 1U9LA 4QZAA 2ZH3A 1UT5A 2AQ4A 5KTQA 2DPIA 1CEZA 1YLQA 3AQNA 4RU9A 4XQ7A 1OU5A 7ICOA 5IIKA 5JUMA 2HVHA 4I2CA 4B9VA 4EEYA 4R65A 3RJIA 2XGPA 3H4BA 5HR9A 1ZQWA 4X5VA 2ZUDA 5DQIA 4I2JA 4BXOB 1BVSA 3ZDDA 1X9WA 4KN4A 1ZQBA 4YMNA 3SV4A 3RH4A 4F4KA 3MR6A 5F2VO 4DSEA 3T3FA 2GWSA 4P4MA 1ZQJA 1JN3A 3OUYB 5KG7A 4KLDA 2DR9A 5KFYA 5D4BA 1U45A 4B9SA 4X4RA 3PMLA 2P66A 9ICCA 3RH6A 2HHXA 5DDMA 4KLFA 8ICNA 1ZQCA 3EZ5A 5KG5A 3MR2A 3T5HA 4I2HA 4MFCA 2O5AA 8ICGA 4RQ2A 4EZ9A 1BNPA 4KTQA 3RJJA 4YR0A 2UVWA 2R8KA 3Q8QB 1V9PA 2IMWP 4I28A 3SYZA 4TUPA 5HRLA 5DKWA 4YR3A 4NLNA 4I2DA 4ED6A 3OJUA 1XC9A 5KFFA 4B9NA 1XSNA 3Q8LA 4PH5A 5KG3A 1L3UA 4RQ0A 2V4RA 5KT3A 1ZQLA 4TUQA 2XY6A 4X0BA 1NK4A 2ASDA 5HHIA 1L3SA 2MUTA 5KFHA 2ZTDA 3HIYA 3OJSA 1NKEA 1UT8A 1ZQUA 1BGXT 3ZDCA 4NKTA 3MABA 3Q8SB 2FMPA 4M5DA 1KFSA 2F1HA 2PFQA 4GXIA 4AT8B 3M9OB 4UB5A 2W9BB 1U48A 1JX4A 3RB0A 4F5NA 1ZQIA 4KLJA 1DK2A 8ICVA 2IBKA 3H3AA 4LT6A 5J0RA 4UB2A 3PVXA 1NJYA 4DSIA 4XUSA 4QW8A 4BGDA 4F8RA 4O5KA 1U49A 9ICBA 1NK5A 4PGYA 4M6WB 2FLLA 3TANA 4I2AA 9ICXA 4RNMA 8ICFA 4P4PA 2IHNA 4ELUA 4YR2A 3UQ2A 2PFNA 3RJFA 4X4OA 2XCPA 4Q8EA 3C23A 1IXRA 1K1SA 4GC7A 2ZUBA 2PI5A 2NRWA 1UEUA 2AQ0A 3HT3A 5DQHA 4FHVA 4UB4A 3RH5A 4FHPA 2JZBA 3RB3A 4R64A 2ASJA 5DGBA 5F9LA 3PR4A 4M2YA 8ICBA 2DR8A 5DB6A 4DOBA 2MAXA 2PFOA 5IIOA 3GILA 2BQ3A 1ZQEA 1QSYA 3PO5A 4MFFA 1MC8A 4C8NA 1UA0A 4RQ7A 1NKCA 2VA2A 3MGHA 2Y1IA 1DGSA 5J0YA 1B43A 4DFJA 3HJ1A 3MGIA 4DL4A 4WC7A 5HREA 4DQQA 3UQ0A 3C1ZA 1WCLA 2V4QA 4R8UA 5J0PA 1KRPA 1MIVA 2VANA 3FYHA 4F4XA 2HHSA 4QZBA 1NK6A 2ZH2A 2Q66A 4Q43A 4M9HA 4EBJA 2ZHBA 1T4GA 2ATLA 4YFKA 4UD5A 4TQRA 4F50A 3E2EA 4YG2A 5DDYA 5HMMA 9ICHA 5BOLA 2PFPA 2M2UA 2DR5A 1ZQPA 2V9WA 4B9UA 1Q79A 3ORYA 5L1JA 3GQCA 4RZRA 7ICKA 2RDJA 1RXVA 1T7PA 1A76A 1AROP 2KP7A 9ICJA 2F1IA 5CJ7A 2BCRA 3UXPA 1BPDA 2XO7A 4F2RA 2XC9A 5KFSA 2NRVA 4IQUA 4DQSA 5DG7A 3BDPA 1ZQVA 4WCWA 2ZH9A 1K1QA 5J2JA 3UPSA 5HC9A 1C7YA 1QSLA 1S77D 3HPOA 3G6VA 4DL5A 2ALZA 1NO5A 1RPLA 5J2KA 4IG8A 2BDPA 9ICPA 1N56A 5KFKA 2C28A 4RQ4A 1JXLA 3V6KA 2FLPA 2KZZA 3OV7A 2DRBA 3OGUA 3PX0A 4BWJA 2W9BA 3BQ2A 4K4HA 3C18A 3OSNA 2A1JB 4E80A 5DEDA 4PHAA 3ISCA 4ED3A 3ISBA 4JV1A 2M9NA 5EWFA 3QE9Y 1Y88A 4J9NA 1D8YA 3RR7A 4X0AA 1NK7A 1RYSA 5HRIA 2BCVA 7ICNA 1Z3EB 2HHTA 4MEYA 9ICIA 2HHWA 2KN7A 4YXMA 1B22A 2NRKA 4QZEA 3GIKA 3GV8B 4IQWA 2HW3A 5KG2A 4ECSA 3G6XA 4ED8A 3RJHA 4UD4A 5L1IA 5KFPA 4DLEA 4KLLA 3EYZA 5DLFA 3V6JA 3ZDBA 7ICLA 3K75D 5DG8A 4QWCA 2WTFA 3BJYA 2KFNA 4J9MA 4FH5A 3H40A 4DL6A 5HMLA 3C21A 7ICUA 8ICMA 5F9NA 2AGOA 4O5EA 3HX0A 4RQ6A 2H5XA 1ZQRA 3HJ4A 4FH3A 4DL7A 4X4PA 1R8AA 4TQSA 3TI0A 4B9TA 4YMMA 5DLGA 4QZ8A 4ECTA 3C2KA 4IQTA 1TAQA 2AU0A 5KFUA 3SI8A 3RBEA 3BQ0A 1D9DA 2ZH5A 4EYHB 4O3PA 5J0TA 4MEXA 2HHQA 1NK8A 1S10A 4JWMA 3WFQE 4QWBA 5C5JA 4YP3A 4C8LA 9ICTA 3GFKB 4RQ5A 4LZGA 8ICKA 9ICMA 8ICZA 2DPJA 5J2DA 4YCXA 1BPYA 4NM1A 4NKUA 9ICGA 1ZJNA 2BCUA 5HRFA 8ICPA 1XSLA 1S76D 9ICWA 3K4GA 4KN7A 1NJXA 3C2MA 1KTQA 4NLGA 4F5PA 3QEAZ 3EWAA 4IRDA 1R8CA 4FO6A 2RDIA 2ZJAA 4QZHA 4WC5A 5DB8A 4O3RA 4ECRA 4ECQA 1ZQAA 4RWOA 4F5QA 1Z00A 3MDAA 2BE3A 1TK5A 5HHHA 8ICUA 4Q45A 1RXWA 1NK9A 4DQIA 2HHVA 4DQRA 2AGQA 5HNKA 3PX4A 1JAJA 2W9CB 1COOA 2FMSA 4YVZA 4S3NA 2BGWA 5D49A 4J9OA 2BPCA 3N4MB 4J9SA 2FPKA 3JPRA 3ZD8A 4R63A 3Q8PB 1S97A 2M2WA 5DBBA 3RRHA 4ELTA 3PW5A 4WBYA 4DF4A 1U47A 3PO4A 4BDPA 3OSPA 4I2FA 3OHBA 3G6YA 5IIMA 4DL3A 5KFOA 1ZJMA 1TK8A 7ICJA 5KFLA 4DF8A 3MR3A 3T5KA 3PW4A 3EPGA 1RYRA 4X4NA 4O3OA 3C2LA 4DSJA 4LVSA 3M8RA 3ZDAA 2KZ3A 1KNYA 3RJKA 4XRHA 4WC2A 2ZTEA 4AT7B 1TAUA 1ZQXA 3M9MB 1T3NA 3GIMA 1F5AA 4AT9A 4WC3A 5KT6A 4I27A 2R8HA 3PX6A 2ZH1A 5HRDA 3UPQA 3RJEA 1XO1A 3AU6A 4Q44A 1TV9A 3AQMA 4RPYA 3JPSA 3OVSA 4KLGA 4F2SA 5J2AA 4QZ9A 3QZ7A 4FS1A 2M2VA 5DB7A 4RQ1A 2C22A 1HUOA 4F91B 2VA3A 4DO9A 2P6RA 2C2RA 2C2DA 2PI4A 3HP6A 5CWRA 2BHNA 4ELVA 3PNCA 4E0DA 4K4GA 3BQTA 9ICAA 1HUZA 9ICRA 3H8SA 2W8KA 4F93B 3RB4A 4BXOA 3GV5B 4KLMA 4ECUA 3JZ0A 4UQGA 4EBCA 2XCAA 1DOQA 2Q0ZX 3OUYA 3QZ8A 4P4OA 4WC4A 2ZH8A 1NOMA 4RQ3A 8ICQA 4F4YA 3SZ2A 4KLQA 7ICPA 1KDHA 3THVA 2OWOA 4UAZA 3T5JA 7ICFA 3OVBA 4I2IA 3C5FA 4O0IA 5BOMA 1ZQMA 3IHQB 1L3TA 4B9MA 5BPCA 2DFLA 5KG0A 3LK9A 1ZQDA 4MF8A 5KFCA 1NJWA 1TFRA 1WOTA 5HRHA 2UVRA 1MIYA 5KFGA 3AU2A 1ZQTA 2JEFA 4ECZA 2R8IA 4NY8A 5J2BA 4BWMA 4F5RA 4QWEA 3RRGA 1JIHA 4ED0A 5CB1A 4DQPA 4X4SA 3ETLA 8ICJA 4DS5A 4I2BA 4CCHA 9ICOA 4RT2A 1BPBA 3Q8KA 3JYYA 5HRBA 3M9NB 1XSPA 3UXOA 1SZPA 3ZD9A 2W8LA 3TFRA 1BPXA 4FBTA 8ICXA 4G3IA 3H7IA 1JMSA 2JEIA 1NZPA 5L1LA 4DL2A 2BQRA 1V4AA 4MFAA 1Q78A 4X4TA 1S0MA 5DG9A 3B0YA 5KG6A 4AT8A 4NLKA 5IINA 4O9MA 8ICAA 2FLNA 5EWEA 4FBUA 4I2EA 1IM4A 2I9GA 7ICHA 4Q8FA 5TZVA 3PV8A 2BPFA 1HJPA 2JEGA 5L9XA 4M6WA 2J6SA 5EOZA 3MFHA 3RB6A 2IHMA 4KLEA 5KFAA 1MIWA 3MR5A 3C1YA 4UBCA 4DS4A 5KT2A 3GIJA 4WBZA 2MUTB 1NKBA 4E8FA 1BPZA 4YN4A 1T8EA 4KMUA 4KLIA 1A77A 1ZETA 2HHUA 4ECYA 4UBBA 4YD1A 3OHAA 3ISDA 1SKSA 5J0WA 5KFNA 5J2GA 4GXKA 4C8OA 1WCNA 2XY5A 4F92B 3LDAA 4TURA 2UVUA 1EXNA 3V7KA 1S9FA 2LYHA 2W9MA 5J2EA 4QZFA 1TK0A 7ICIA 9ICSA 4KLSA 8ICTA 3LQCB 5IIIA 5J0OA 5J0XA 4UB3A 3M8SA 5EWGA 4DFPA 4EYIB 9ICNA 4E7XA 1UA1A 1VFGA 3JPNA 4QZGA 3JPTA 4FS2A 5KFIA 5D46A 8ICYA 3UXNA 4KLTA 4PHPA 1U4BA 8ICHA 3C5GA 3NYBA 3RBDA 5KFXA 2ISPA 3PR5B 4IRKA 4PGQA 4I29A 1S0NA 3LWLA 1ZQNA 1TFWA 4RT3A 4RQ8A 1LV5A 2M2TA 7ICMA 2JZBB 1XU4A 3EW9A 3JPPA 1ZQHA 3KHGA 1KLNA 3IM1A 4ECWA 2B21A 4I2GA 1QSSA 1N48A 3TARA 1D9FA 4ZH4A 4UAYA 1SKRA 4DWIA 1LB2B 3MDCA 4EP7A 2BR0A 5KFQA 2UVVA 9ICQA 4QW9A 3QEBZ 3AQLA 4GC6A 2W9AA 8ICRA 3L9DA 3WFOA 4R8UB 4C8MA 5KFTA 4EBEA 3KHHA 1L5UA 5J2FA 4QZIA 1TKDA 5KFEA 4DFKA 9ICLA 2ID1A 1X9MA 2C2EA 2FPLA 3KHRA 5KFDA 3RTVA 3GV7B 1PZNA 4RPXA 9ICUA 4X4VA 9ICVA 4LZDA 4YD2A 3Q8RB 2PXIA 2NRZA 4O5CA 5J0QA 1BNOA 2ZH4A 1KFTA 4Z6CA 1BPEA 2A1JA 4RUCA 4PHEA 3AUOA 4IR1A 2JEJA 3TAPA 4NXZA 5CP2A 5KT4A 1ZQQA 4F4ZA 4DFMA 2DVIA 4RWPA 4QZCA 2XGQA 2FMQA 2ZUCA 1MSWD 3H38A 2Y1JA 4ECVA 4ED7A 1S0OA 4XA5A 1RZTA 3PW7A 3N97B 4EBKA 2R8JA 5KFJA 4PGXA 3V7JA 4IRCA 4RNNA 3WFRE 3NGDA 2KTQA 3JPOA 5J2HA 3RAQA 2ASLA 4KLHA 3V6HA 5DQGA 5KT5A 1MQ2A 2ISOA 4ECXA 1TVAA 1S0VA 3RAXA 4JWNA 2F1JA 4KLOA 4KITB 3MBYA 5DGAA 2KZMA 2RFFA 1ZQSA 1ZQFA 1KFDA 1QTMA 5HRGA 3PY8A 4DSLA 5KFWA 4EBDA 2BCQA 4ED2A 5KFZA 4M0AA 2IA6A 4DOCA 5DB9A 3PMNA 3KHLA 4RPZA 1XWLA 3PW0A 3KTQA 4P2HA 1QLNA 4M9NA 3V72A 1ZYQA 4J9LA 1XS9D 4M9LA 9ICFA 4B9LA 2XY7A 5CA7A 4XQ8A 4ED1A 8ICWA 1JQRA 4FHYA 8ICCA 2DRAA 4Z6FA 4WC1A 4DLGA 1ZQZA 2ZTCA 4JUZA 8ICIA 3V7LA 1SL2A 1R89A 5KFBA 3GDXA 1DK3A 5CR0A 5J2IA 7ICGA 5CHGA 1UEVA 3C66A 5IIJA 4PHDA 5KT7A 3LWMA 4J9KA 3PW2A 4JV0A 4DEZA 1ZQKA 5KFVA 2KFZA 5KG1A 9ICEA 3H39A 3B0XA 4X4QA 4QZDA 2DR7A 5KFMA 4F4WA 4DSKA 7ICEA 3RR8A 4IR9A 4O3NA 1JXEA 5HP4A 2BQUA 4ATBA 2W9CA 2J6TA 4WC0A 4F5OA 3Q8MA 1X9SA 5HRKA 5IILA 3H4DA 3NTUA 4Z6EA 4F3OA 1CUKA 1UETA 4YMOA 4FHXA 3TQ1A 4UB1A 3GIIA 3T5LA 7ICQA 1SKWA 4QWAA 7ICSA 2BKEA 4RUAA 3WFPA 4Z6DA 4M9JA 4J9QA 4O3SA 4UAWA 1D8LA 4R66A 4TUSA 1SL0A 2BPGA 5J29A 4JV2A 4K4IA 2HVIA 4C8KA 2VA8A 1Z00B 3WFSC 2ZH7A 2NRXA 5J0SA 2I1QA 1KEJA 2AJQA 5DECA 1R8BA 3HWTA 3HW8A 4AT7A 4M9GA 1X2IA 2HHPA 3AQKA 4WC6A 7ICVA 4IQVA 4KLUA 2ZJ8A 1H38A 3FDSA 4O3QA 8ICEA 1L3VA 7ICRA 3H37A 4NM2A 1FA0A 2PBEA 2ZHAA 1ZQYA 4RWNA 4X4UA 4YXJA 3MFIA 1ZQGA 2ZJ5A 5KFRA 4PPXA 5DBAA 4EZ6A 1ZQOA 8ICSA 4YQWA 3BQ1A 4DOAA 4ATBB 2FPMA 4JK1A 4GXJA 2NRTA 4MF2A 8ICOA 1TFYA 4QWDA 4M47A 9ICKA 3OVAA 7ICTA 1NJZA 4J9PA 5J2CA 1NK0A 2ZH6A 5DBCA 3JPQA 3H8WA 1VJ7A 4GLXA 3RJGA 8ICLA 4RWQA 2R8GA 3TFSA 3H8JA 1KSPA 3EPIA 1SL1A 3ZDEA 4RNOA 5L1KA 4NLZA 2P6UA 1PX5A 4AT9B 2BCSA 3TAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYK A;  4J9R A;  5KG4 A;  2AGP A;  4M04 A;  2J6U A;  1MQ3 A;  5J0U A;  3SV3 A;  4FHW A;  4DSF A;  2O1P A;  1U9L A;  4QZA A;  2ZH3 A;  1UT5 A;  2AQ4 A;  5KTQ A;  2DPI A;  1CEZ A;  1YLQ A;  3AQN A;  4RU9 A;  4XQ7 A;  1OU5 A;  7ICO A;  5IIK A;  5JUM A;  2HVH A;  4I2C A;  4B9V A;  4EEY A;  4R65 A;  3RJI A;  2XGP A;  3H4B A;  5HR9 A;  1ZQW A;  4X5V A;  2ZUD A;  5DQI A;  4I2J A;  4BXO B;  1BVS A;  3ZDD A;  1X9W A;  4KN4 A;  1ZQB A;  4YMN A;  3SV4 A;  3RH4 A;  4F4K A;  3MR6 A;  5F2V O;  4DSE A;  3T3F A;  2GWS A;  4P4M A;  1ZQJ A;  1JN3 A;  3OUY B;  5KG7 A;  4KLD A;  2DR9 A;  5KFY A;  5D4B A;  1U45 A;  4B9S A;  4X4R A;  3PML A;  2P66 A;  9ICC A;  3RH6 A;  2HHX A;  5DDM A;  4KLF A;  8ICN A;  1ZQC A;  3EZ5 A;  5KG5 A;  3MR2 A;  3T5H A;  4I2H A;  4MFC A;  2O5A A;  8ICG A;  4RQ2 A;  4EZ9 A;  1BNP A;  4KTQ A;  3RJJ A;  4YR0 A;  2UVW A;  2R8K A;  3Q8Q B;  1V9P A;  2IMW P;  4I28 A;  3SYZ A;  4TUP A;  5HRL A;  5DKW A;  4YR3 A;  4NLN A;  4I2D A;  4ED6 A;  3OJU A;  1XC9 A;  5KFF A;  4B9N A;  1XSN A;  3Q8L A;  4PH5 A;  5KG3 A;  1L3U A;  4RQ0 A;  2V4R A;  5KT3 A;  1ZQL A;  4TUQ A;  2XY6 A;  4X0B A;  1NK4 A;  2ASD A;  5HHI A;  1L3S A;  2MUT A;  5KFH A;  2ZTD A;  3HIY A;  3OJS A;  1NKE A;  1UT8 A;  1ZQU A;  1BGX T;  3ZDC A;  4NKT A;  3MAB A;  3Q8S B;  2FMP A;  4M5D A;  1KFS A;  2F1H A;  2PFQ A;  4GXI A;  4AT8 B;  3M9O B;  4UB5 A;  2W9B B;  1U48 A;  1JX4 A;  3RB0 A;  4F5N A;  1ZQI A;  4KLJ A;  1DK2 A;  8ICV A;  2IBK A;  3H3A A;  4LT6 A;  5J0R A;  4UB2 A;  3PVX A;  1NJY A;  4DSI A;  4XUS A;  4QW8 A;  4BGD A;  4F8R A;  4O5K A;  1U49 A;  9ICB A;  1NK5 A;  4PGY A;  4M6W B;  2FLL A;  3TAN A;  4I2A A;  9ICX A;  4RNM A;  8ICF A;  4P4P A;  2IHN A;  4ELU A;  4YR2 A;  3UQ2 A;  2PFN A;  3RJF A;  4X4O A;  2XCP A;  4Q8E A;  3C23 A;  1IXR A;  1K1S A;  4GC7 A;  2ZUB A;  2PI5 A;  2NRW A;  1UEU A;  2AQ0 A;  3HT3 A;  5DQH A;  4FHV A;  4UB4 A;  3RH5 A;  4FHP A;  2JZB A;  3RB3 A;  4R64 A;  2ASJ A;  5DGB A;  5F9L A;  3PR4 A;  4M2Y A;  8ICB A;  2DR8 A;  5DB6 A;  4DOB A;  2MAX A;  2PFO A;  5IIO A;  3GIL A;  2BQ3 A;  1ZQE A;  1QSY A;  3PO5 A;  4MFF A;  1MC8 A;  4C8N A;  1UA0 A;  4RQ7 A;  1NKC A;  2VA2 A;  3MGH A;  2Y1I A;  1DGS A;  5J0Y A;  1B43 A;  4DFJ A;  3HJ1 A;  3MGI A;  4DL4 A;  4WC7 A;  5HRE A;  4DQQ A;  3UQ0 A;  3C1Z A;  1WCL A;  2V4Q A;  4R8U A;  5J0P A;  1KRP A;  1MIV A;  2VAN A;  3FYH A;  4F4X A;  2HHS A;  4QZB A;  1NK6 A;  2ZH2 A;  2Q66 A;  4Q43 A;  4M9H A;  4EBJ A;  2ZHB A;  1T4G A;  2ATL A;  4YFK A;  4UD5 A;  4TQR A;  4F50 A;  3E2E A;  4YG2 A;  5DDY A;  5HMM A;  9ICH A;  5BOL A;  2PFP A;  2M2U A;  2DR5 A;  1ZQP A;  2V9W A;  4B9U A;  1Q79 A;  3ORY A;  5L1J A;  3GQC A;  4RZR A;  7ICK A;  2RDJ A;  1RXV A;  1T7P A;  1A76 A;  1ARO P;  2KP7 A;  9ICJ A;  2F1I A;  5CJ7 A;  2BCR A;  3UXP A;  1BPD A;  2XO7 A;  4F2R A;  2XC9 A;  5KFS A;  2NRV A;  4IQU A;  4DQS A;  5DG7 A;  3BDP A;  1ZQV A;  4WCW A;  2ZH9 A;  1K1Q A;  5J2J A;  3UPS A;  5HC9 A;  1C7Y A;  1QSL A;  1S77 D;  3HPO A;  3G6V A;  4DL5 A;  2ALZ A;  1NO5 A;  1RPL A;  5J2K A;  4IG8 A;  2BDP A;  9ICP A;  1N56 A;  5KFK A;  2C28 A;  4RQ4 A;  1JXL A;  3V6K A;  2FLP A;  2KZZ A;  3OV7 A;  2DRB A;  3OGU A;  3PX0 A;  4BWJ A;  2W9B A;  3BQ2 A;  4K4H A;  3C18 A;  3OSN A;  2A1J B;  4E80 A;  5DED A;  4PHA A;  3ISC A;  4ED3 A;  3ISB A;  4JV1 A;  2M9N A;  5EWF A;  3QE9 Y;  1Y88 A;  4J9N A;  1D8Y A;  3RR7 A;  4X0A A;  1NK7 A;  1RYS A;  5HRI A;  2BCV A;  7ICN A;  1Z3E B;  2HHT A;  4MEY A;  9ICI A;  2HHW A;  2KN7 A;  4YXM A;  1B22 A;  2NRK A;  4QZE A;  3GIK A;  3GV8 B;  4IQW A;  2HW3 A;  5KG2 A;  4ECS A;  3G6X A;  4ED8 A;  3RJH A;  4UD4 A;  5L1I A;  5KFP A;  4DLE A;  4KLL A;  3EYZ A;  5DLF A;  3V6J A;  3ZDB A;  7ICL A;  3K75 D;  5DG8 A;  4QWC A;  2WTF A;  3BJY A;  2KFN A;  4J9M A;  4FH5 A;  3H40 A;  4DL6 A;  5HML A;  3C21 A;  7ICU A;  8ICM A;  5F9N A;  2AGO A;  4O5E A;  3HX0 A;  4RQ6 A;  2H5X A;  1ZQR A;  3HJ4 A;  4FH3 A;  4DL7 A;  4X4P A;  1R8A A;  4TQS A;  3TI0 A;  4B9T A;  4YMM A;  5DLG A;  4QZ8 A;  4ECT A;  3C2K A;  4IQT A;  1TAQ A;  2AU0 A;  5KFU A;  3SI8 A;  3RBE A;  3BQ0 A;  1D9D A;  2ZH5 A;  4EYH B;  4O3P A;  5J0T A;  4MEX A;  2HHQ A;  1NK8 A;  1S10 A;  4JWM A;  3WFQ E;  4QWB A;  5C5J A;  4YP3 A;  4C8L A;  9ICT A;  3GFK B;  4RQ5 A;  4LZG A;  8ICK A;  9ICM A;  8ICZ A;  2DPJ A;  5J2D A;  4YCX A;  1BPY A;  4NM1 A;  4NKU A;  9ICG A;  1ZJN A;  2BCU A;  5HRF A;  8ICP A;  1XSL A;  1S76 D;  9ICW A;  3K4G A;  4KN7 A;  1NJX A;  3C2M A;  1KTQ A;  4NLG A;  4F5P A;  3QEA Z;  3EWA A;  4IRD A;  1R8C A;  4FO6 A;  2RDI A;  2ZJA A;  4QZH A;  4WC5 A;  5DB8 A;  4O3R A;  4ECR A;  4ECQ A;  1ZQA A;  4RWO A;  4F5Q A;  1Z00 A;  3MDA A;  2BE3 A;  1TK5 A;  5HHH A;  8ICU A;  4Q45 A;  1RXW A;  1NK9 A;  4DQI A;  2HHV A;  4DQR A;  2AGQ A;  5HNK A;  3PX4 A;  1JAJ A;  2W9C B;  1COO A;  2FMS A;  4YVZ A;  4S3N A;  2BGW A;  5D49 A;  4J9O A;  2BPC A;  3N4M B;  4J9S A;  2FPK A;  3JPR A;  3ZD8 A;  4R63 A;  3Q8P B;  1S97 A;  2M2W A;  5DBB A;  3RRH A;  4ELT A;  3PW5 A;  4WBY A;  4DF4 A;  1U47 A;  3PO4 A;  4BDP A;  3OSP A;  4I2F A;  3OHB A;  3G6Y A;  5IIM A;  4DL3 A;  5KFO A;  1ZJM A;  1TK8 A;  7ICJ A;  5KFL A;  4DF8 A;  3MR3 A;  3T5K A;  3PW4 A;  3EPG A;  1RYR A;  4X4N A;  4O3O A;  3C2L A;  4DSJ A;  4LVS A;  3M8R A;  3ZDA A;  2KZ3 A;  1KNY A;  3RJK A;  4XRH A;  4WC2 A;  2ZTE A;  4AT7 B;  1TAU A;  1ZQX A;  3M9M B;  1T3N A;  3GIM A;  1F5A A;  4AT9 A;  4WC3 A;  5KT6 A;  4I27 A;  2R8H A;  3PX6 A;  2ZH1 A;  5HRD A;  3UPQ A;  3RJE A;  1XO1 A;  3AU6 A;  4Q44 A;  1TV9 A;  3AQM A;  4RPY A;  3JPS A;  3OVS A;  4KLG A;  4F2S A;  5J2A A;  4QZ9 A;  3QZ7 A;  4FS1 A;  2M2V A;  5DB7 A;  4RQ1 A;  2C22 A;  1HUO A;  4F91 B;  2VA3 A;  4DO9 A;  2P6R A;  2C2R A;  2C2D A;  2PI4 A;  3HP6 A;  5CWR A;  2BHN A;  4ELV A;  3PNC A;  4E0D A;  4K4G A;  3BQT A;  9ICA A;  1HUZ A;  9ICR A;  3H8S A;  2W8K A;  4F93 B;  3RB4 A;  4BXO A;  3GV5 B;  4KLM A;  4ECU A;  3JZ0 A;  4UQG A;  4EBC A;  2XCA A;  1DOQ A;  2Q0Z X;  3OUY A;  3QZ8 A;  4P4O A;  4WC4 A;  2ZH8 A;  1NOM A;  4RQ3 A;  8ICQ A;  4F4Y A;  3SZ2 A;  4KLQ A;  7ICP A;  1KDH A;  3THV A;  2OWO A;  4UAZ A;  3T5J A;  7ICF A;  3OVB A;  4I2I A;  3C5F A;  4O0I A;  5BOM A;  1ZQM A;  3IHQ B;  1L3T A;  4B9M A;  5BPC A;  2DFL A;  5KG0 A;  3LK9 A;  1ZQD A;  4MF8 A;  5KFC A;  1NJW A;  1TFR A;  1WOT A;  5HRH A;  2UVR A;  1MIY A;  5KFG A;  3AU2 A;  1ZQT A;  2JEF A;  4ECZ A;  2R8I A;  4NY8 A;  5J2B A;  4BWM A;  4F5R A;  4QWE A;  3RRG A;  1JIH A;  4ED0 A;  5CB1 A;  4DQP A;  4X4S A;  3ETL A;  8ICJ A;  4DS5 A;  4I2B A;  4CCH A;  9ICO A;  4RT2 A;  1BPB A;  3Q8K A;  3JYY A;  5HRB A;  3M9N B;  1XSP A;  3UXO A;  1SZP A;  3ZD9 A;  2W8L A;  3TFR A;  1BPX A;  4FBT A;  8ICX A;  4G3I A;  3H7I A;  1JMS A;  2JEI A;  1NZP A;  5L1L A;  4DL2 A;  2BQR A;  1V4A A;  4MFA A;  1Q78 A;  4X4T A;  1S0M A;  5DG9 A;  3B0Y A;  5KG6 A;  4AT8 A;  4NLK A;  5IIN A;  4O9M A;  8ICA A;  2FLN A;  5EWE A;  4FBU A;  4I2E A;  1IM4 A;  2I9G A;  7ICH A;  4Q8F A;  5TZV A;  3PV8 A;  2BPF A;  1HJP A;  2JEG A;  5L9X A;  4M6W A;  2J6S A;  5EOZ A;  3MFH A;  3RB6 A;  2IHM A;  4KLE A;  5KFA A;  1MIW A;  3MR5 A;  3C1Y A;  4UBC A;  4DS4 A;  5KT2 A;  3GIJ A;  4WBZ A;  2MUT B;  1NKB A;  4E8F A;  1BPZ A;  4YN4 A;  1T8E A;  4KMU A;  4KLI A;  1A77 A;  1ZET A;  2HHU A;  4ECY A;  4UBB A;  4YD1 A;  3OHA A;  3ISD A;  1SKS A;  5J0W A;  5KFN A;  5J2G A;  4GXK A;  4C8O A;  1WCN A;  2XY5 A;  4F92 B;  3LDA A;  4TUR A;  2UVU A;  1EXN A;  3V7K A;  1S9F A;  2LYH A;  2W9M A;  5J2E A;  4QZF A;  1TK0 A;  7ICI A;  9ICS A;  4KLS A;  8ICT A;  3LQC B;  5III A;  5J0O A;  5J0X A;  4UB3 A;  3M8S A;  5EWG A;  4DFP A;  4EYI B;  9ICN A;  4E7X A;  1UA1 A;  1VFG A;  3JPN A;  4QZG A;  3JPT A;  4FS2 A;  5KFI A;  5D46 A;  8ICY A;  3UXN A;  4KLT A;  4PHP A;  1U4B A;  8ICH A;  3C5G A;  3NYB A;  3RBD A;  5KFX A;  2ISP A;  3PR5 B;  4IRK A;  4PGQ A;  4I29 A;  1S0N A;  3LWL A;  1ZQN A;  1TFW A;  4RT3 A;  4RQ8 A;  1LV5 A;  2M2T A;  7ICM A;  2JZB B;  1XU4 A;  3EW9 A;  3JPP A;  1ZQH A;  3KHG A;  1KLN A;  3IM1 A;  4ECW A;  2B21 A;  4I2G A;  1QSS A;  1N48 A;  3TAR A;  1D9F A;  4ZH4 A;  4UAY A;  1SKR A;  4DWI A;  1LB2 B;  3MDC A;  4EP7 A;  2BR0 A;  5KFQ A;  2UVV A;  9ICQ A;  4QW9 A;  3QEB Z;  3AQL A;  4GC6 A;  2W9A A;  8ICR A;  3L9D A;  3WFO A;  4R8U B;  4C8M A;  5KFT A;  4EBE A;  3KHH A;  1L5U A;  5J2F A;  4QZI A;  1TKD A;  5KFE A;  4DFK A;  9ICL A;  2ID1 A;  1X9M A;  2C2E A;  2FPL A;  3KHR A;  5KFD A;  3RTV A;  3GV7 B;  1PZN A;  4RPX A;  9ICU A;  4X4V A;  9ICV A;  4LZD A;  4YD2 A;  3Q8R B;  2PXI A;  2NRZ A;  4O5C A;  5J0Q A;  1BNO A;  2ZH4 A;  1KFT A;  4Z6C A;  1BPE A;  2A1J A;  4RUC A;  4PHE A;  3AUO A;  4IR1 A;  2JEJ A;  3TAP A;  4NXZ A;  5CP2 A;  5KT4 A;  1ZQQ A;  4F4Z A;  4DFM A;  2DVI A;  4RWP A;  4QZC A;  2XGQ A;  2FMQ A;  2ZUC A;  1MSW D;  3H38 A;  2Y1J A;  4ECV A;  4ED7 A;  1S0O A;  4XA5 A;  1RZT A;  3PW7 A;  3N97 B;  4EBK A;  2R8J A;  5KFJ A;  4PGX A;  3V7J A;  4IRC A;  4RNN A;  3WFR E;  3NGD A;  2KTQ A;  3JPO A;  5J2H A;  3RAQ A;  2ASL A;  4KLH A;  3V6H A;  5DQG A;  5KT5 A;  1MQ2 A;  2ISO A;  4ECX A;  1TVA A;  1S0V A;  3RAX A;  4JWN A;  2F1J A;  4KLO A;  4KIT B;  3MBY A;  5DGA A;  2KZM A;  2RFF A;  1ZQS A;  1ZQF A;  1KFD A;  1QTM A;  5HRG A;  3PY8 A;  4DSL A;  5KFW A;  4EBD A;  2BCQ A;  4ED2 A;  5KFZ A;  4M0A A;  2IA6 A;  4DOC A;  5DB9 A;  3PMN A;  3KHL A;  4RPZ A;  1XWL A;  3PW0 A;  3KTQ A;  4P2H A;  1QLN A;  4M9N A;  3V72 A;  1ZYQ A;  4J9L A;  1XS9 D;  4M9L A;  9ICF A;  4B9L A;  2XY7 A;  5CA7 A;  4XQ8 A;  4ED1 A;  8ICW A;  1JQR A;  4FHY A;  8ICC A;  2DRA A;  4Z6F A;  4WC1 A;  4DLG A;  1ZQZ A;  2ZTC A;  4JUZ A;  8ICI A;  3V7L A;  1SL2 A;  1R89 A;  5KFB A;  3GDX A;  1DK3 A;  5CR0 A;  5J2I A;  7ICG A;  5CHG A;  1UEV A;  3C66 A;  5IIJ A;  4PHD A;  5KT7 A;  3LWM A;  4J9K A;  3PW2 A;  4JV0 A;  4DEZ A;  1ZQK A;  5KFV A;  2KFZ A;  5KG1 A;  9ICE A;  3H39 A;  3B0X A;  4X4Q A;  4QZD A;  2DR7 A;  5KFM A;  4F4W A;  4DSK A;  7ICE A;  3RR8 A;  4IR9 A;  4O3N A;  1JXE A;  5HP4 A;  2BQU A;  4ATB A;  2W9C A;  2J6T A;  4WC0 A;  4F5O A;  3Q8M A;  1X9S A;  5HRK A;  5IIL A;  3H4D A;  3NTU A;  4Z6E A;  4F3O A;  1CUK A;  1UET A;  4YMO A;  4FHX A;  3TQ1 A;  4UB1 A;  3GII A;  3T5L A;  7ICQ A;  1SKW A;  4QWA A;  7ICS A;  2BKE A;  4RUA A;  3WFP A;  4Z6D A;  4M9J A;  4J9Q A;  4O3S A;  4UAW A;  1D8L A;  4R66 A;  4TUS A;  1SL0 A;  2BPG A;  5J29 A;  4JV2 A;  4K4I A;  2HVI A;  4C8K A;  2VA8 A;  1Z00 B;  3WFS C;  2ZH7 A;  2NRX A;  5J0S A;  2I1Q A;  1KEJ A;  2AJQ A;  5DEC A;  1R8B A;  3HWT A;  3HW8 A;  4AT7 A;  4M9G A;  1X2I A;  2HHP A;  3AQK A;  4WC6 A;  7ICV A;  4IQV A;  4KLU A;  2ZJ8 A;  1H38 A;  3FDS A;  4O3Q A;  8ICE A;  1L3V A;  7ICR A;  3H37 A;  4NM2 A;  1FA0 A;  2PBE A;  2ZHA A;  1ZQY A;  4RWN A;  4X4U A;  4YXJ A;  3MFI A;  1ZQG A;  2ZJ5 A;  5KFR A;  4PPX A;  5DBA A;  4EZ6 A;  1ZQO A;  8ICS A;  4YQW A;  3BQ1 A;  4DOA A;  4ATB B;  2FPM A;  4JK1 A;  4GXJ A;  2NRT A;  4MF2 A;  8ICO A;  1TFY A;  4QWD A;  4M47 A;  9ICK A;  3OVA A;  7ICT A;  1NJZ A;  4J9P A;  5J2C A;  1NK0 A;  2ZH6 A;  5DBC A;  3JPQ A;  3H8W A;  1VJ7 A;  4GLX A;  3RJG A;  8ICL A;  4RWQ A;  2R8G A;  3TFS A;  3H8J A;  1KSP A;  3EPI A;  1SL1 A;  3ZDE A;  4RNO A;  5L1K A;  4NLZ A;  2P6U A;  1PX5 A;  4AT9 B;  2BCS A;  3TAQ A; 
#chains in the Genus database with same CATH topology
 2W11 A;  2AGP A;  5J0U A;  4FHW A;  1U9L A;  3ER8 C;  4RU9 A;  2VKQ A;  5IIK A;  2K89 A;  1PVQ A;  2YTU A;  4B9V A;  3HKZ C;  1X9W A;  4KN4 A;  1ZQB A;  3RH4 A;  3MR6 A;  2QAR A;  5F2V O;  2GWS A;  2DR9 A;  1PK3 A;  4B9S A;  4X4R A;  1ZD4 A;  3MR2 A;  4RQM A;  1SZH A;  3UMG A;  2GLE A;  2UVW A;  3Q8Q B;  4QIW C;  4TUP A;  4C80 A;  3NVV A;  1QCK A;  3OJU A;  2OM6 A;  1XC9 A;  5ALS A;  1L3U A;  2KEY A;  4X0B A;  2DKZ A;  5AI5 A;  2MUT A;  5KFH A;  2ZTD A;  4HX0 A;  1BGX T;  5F3X B;  4M5D A;  2RQ5 A;  1KFS A;  4AT8 B;  5AI6 A;  2W43 A;  3RB0 A;  4KLJ A;  1DK2 A;  3OPX A;  4Y2P A;  2A3V A;  4NJ8 A;  5ALY A;  3H0L B;  4DSI A;  4Y2Y A;  4QIW F;  4O5K A;  1SXD A;  9ICB A;  4K96 A;  1NK5 A;  3TAN A;  1N5X A;  2IHN A;  1ED1 A;  3UQ2 A;  2PFN A;  2XCP A;  4QJF B;  3PST A;  1IXR A;  2W04 A;  5CHE A;  2PI5 A;  1VLB A;  5KNI A;  2E1E A;  5DQH A;  3RH5 A;  5DGB A;  4M2Y A;  8ICB A;  5JTG A;  2QKQ A;  5IIO A;  4MFF A;  1NKC A;  4RQ7 A;  1B43 A;  4DFJ A;  3TAC B;  5J0P A;  1KRP A;  3FYH A;  4F4X A;  4DCC A;  1SV0 C;  2HHS A;  2Q66 A;  4Q43 A;  2RHF A;  1RG6 A;  4UD5 A;  1ZOL A;  2ZIX B;  4YG2 A;  3NVZ A;  2KNJ A;  4OAF A;  2BCR A;  4WH5 A;  5KFS A;  4IQU A;  4WCW A;  1K1Q A;  2ALZ A;  1TAM A;  4IG8 A;  1JXL A;  2C28 A;  4NL9 C;  1PVP A;  1ZQ1 C;  2EZY A;  4OJL A;  1P7D A;  3BQ2 A;  4UB8 U;  3OSN A;  4E80 A;  1RYS A;  2KHV A;  1UPH A;  1Z3E B;  1B22 A;  4FE3 A;  4NLC A;  2HHW A;  2NRK A;  4QZE A;  4IQW A;  2YY6 A;  2HW3 A;  5KG2 A;  4ECS A;  4ED8 A;  4UD4 A;  5L1I A;  4DLE A;  3V6J A;  5DG8 A;  1MA7 A;  4QWC A;  2KFN A;  2CN1 A;  4J9M A;  4JMU A;  5CFT A;  7ICU A;  1T3Q A;  1N62 A;  1F44 A;  3HX0 A;  2H5X A;  2B51 A;  3TI0 A;  3F53 A;  4B9T A;  4IQT A;  1TAQ A;  2AU0 A;  5J0T A;  1F0M A;  5CFS A;  2FJ6 A;  1S10 A;  3M6K A;  5C5J A;  2F44 A;  5EE0 A;  2D6F C;  2K4P A;  1C20 A;  5J2D A;  9ICG A;  2BCU A;  1S76 D;  2MU2 A;  4KN7 A;  4NLG A;  5B66 U;  5ALQ A;  1R8C A;  1V85 A;  4PJ0 U;  3DEE A;  5HHH A;  1RXW A;  4DQR A;  2AGQ A;  3PX4 A;  2W9C B;  3PZP A;  2JHD A;  4S3N A;  2BGW A;  4J9O A;  3R9K A;  3N4M B;  4ACO A;  5DBB A;  2LKY A;  3RRH A;  4ELT A;  1S8O A;  3OSP A;  4EX6 A;  5IIM A;  4DL3 A;  4X4N A;  4O3O A;  4LVS A;  1L6N A;  2KZ3 A;  4WC2 A;  3RJK A;  2ZTE A;  3NRZ A;  1XO1 A;  2JR5 A;  5GTH U;  3JPS A;  4KLG A;  4QZ9 A;  5DB7 A;  4RQ1 A;  3SD7 A;  4DO9 A;  4ELV A;  5CWR A;  1HUZ A;  2E8O A;  4BXO A;  4KLM A;  3JZ0 A;  4EBC A;  1GPJ A;  1JRP A;  3QZ8 A;  1NOM A;  5AKZ A;  4RQ3 A;  1ZRM A;  5J8Y C;  5ALK A;  4I2I A;  3C5F A;  5ALP A;  4NLB A;  5KFG A;  3AU2 A;  1ZQT A;  2WF9 A;  4QWE A;  4X4S A;  3F2C A;  5AKY A;  4I2B A;  2W54 A;  5HR7 A;  3NWI A;  4G3I A;  1UCV A;  1JMS A;  4AP9 A;  2JEI A;  4K98 A;  4DL2 A;  1V4A A;  4O9M A;  8ICA A;  5ALX A;  3WKA A;  4I2E A;  1IM4 A;  5AKK A;  2OCE A;  3NUQ A;  5TZV A;  4Q8F A;  1HJP A;  2JEG A;  2KIC A;  5L9X A;  4M6W A;  2J6S A;  3RB6 A;  4KLE A;  1UQV A;  5KFA A;  4UBC A;  3TKA A;  1BPZ A;  3AL0 B;  1L7M A;  2HOF A;  1A77 A;  4OCZ A;  4F71 A;  4UBB A;  3OHA A;  3M1Y A;  4WOY A;  1L7P A;  1WCN A;  3I28 A;  7ICI A;  1QQ6 A;  2O6K A;  1UA1 A;  3PSI A;  1O08 A;  3UXN A;  3BQ7 A;  4PHP A;  1U4B A;  3C5G A;  3NYB A;  2ISP A;  5ALZ A;  4IRK A;  4P0P A;  4BJQ A;  5AI8 A;  1ZQN A;  3JPP A;  3IM1 A;  1N48 A;  3TAR A;  4UAY A;  3MDC A;  4CNQ A;  2D8C A;  2WFA A;  3QEB Z;  4PL1 A;  8ICR A;  4DFK A;  5ALT A;  3KHR A;  4X4V A;  2HBK A;  1COK A;  2NRZ A;  2IUB A;  3H8M A;  1YT3 A;  4K8V A;  1BPE A;  2A1J A;  3TAP A;  5J8Y A;  4DFM A;  2DVI A;  4NWI A;  1RYU A;  3SEN A;  1HEK A;  3N97 B;  2R8J A;  3V7J A;  3NGD A;  3JPO A;  3RAQ A;  1MQ2 A;  5KT5 A;  3QU9 A;  3K1R B;  4OAI Z;  4JWN A;  3D2Q A;  4KX5 A;  4LEY A;  2KZM A;  3NAS A;  1ZQF A;  5ALL A;  5HRG A;  5KFW A;  4ED2 A;  2IA6 A;  5DB9 A;  3PMN A;  3SQI A;  3V72 A;  2KV2 A;  1XS9 D;  5CA7 A;  4XQ8 A;  1XO0 A;  4KB6 A;  5AK5 A;  2F3N A;  4WC1 A;  3AM9 A;  5ALV A;  1SL2 A;  2MSN A;  7ICG A;  5CHG A;  2KSO A;  2LPE A;  3JCF A;  1LKY A;  2G07 A;  5KFM A;  7ICE A;  2YX8 A;  2J6T A;  4WC0 A;  3Q8M A;  2NO4 A;  5IIL A;  2RP5 A;  3H4D A;  4Z6E A;  1UET A;  2XID A;  4UB1 A;  2PKE A;  2N1R A;  3WFP A;  4TUS A;  4K4I A;  3WFS C;  1Z00 B;  2I1Q A;  2AJQ A;  5DEC A;  1X2I A;  4WC6 A;  3FC4 A;  7ICV A;  4IQV A;  3NS1 A;  2EZX A;  8ICE A;  3FDS A;  3WKB A;  2HBM A;  2PBE A;  3KFU F;  4YXJ A;  5KFR A;  8ICS A;  5EE1 A;  4I0U A;  3IG5 A;  4QWD A;  1CRX A;  3OVA A;  5J2C A;  1VJ7 A;  4RWQ A;  3TFS A;  2QB1 A;  1SL1 A;  3ZDE A;  2H3V A;  4AT9 B;  2A1A A;  4J9R A;  5KG4 A;  4EEK A;  4QZA A;  3BZK A;  2DPI A;  1YLQ A;  4EV6 A;  7ICO A;  2HVH A;  4I2C A;  4R65 A;  4CF4 A;  4K97 A;  2XGP A;  1YZ6 A;  5HR9 A;  2WB1 C;  1ZQW A;  3CK6 A;  4X5V A;  3E58 A;  5JTI A;  1BVS A;  3SV4 A;  4DSE A;  3K7D A;  1JN3 A;  5KG7 A;  5KFY A;  1U45 A;  3PML A;  8ICN A;  4UAR A;  3EZ5 A;  4MFC A;  3T5H A;  8ICG A;  2BBH A;  1FFU A;  4EZ9 A;  4KTQ A;  3RJJ A;  2R8K A;  5B3Q A;  1V9P A;  2IMW P;  3SYZ A;  5HRL A;  4I2D A;  1N61 A;  5KG3 A;  4RQ0 A;  1SWV A;  4C7Z A;  5KT3 A;  3HIY A;  2ASD A;  5HHI A;  1L3S A;  1J2N A;  5AKJ A;  4C0Z A;  3OJS A;  1UT8 A;  5AM4 A;  1NKE A;  4NKT A;  2K8A A;  3Q8S B;  5ALO A;  2MRL A;  2PFQ A;  2W9B B;  1U48 A;  1JX4 A;  3H3A A;  2CXY A;  4F5N A;  8ICV A;  2EZZ A;  4QNL A;  4UB2 A;  3PVX A;  1NJY A;  4QW8 A;  4PGY A;  2FLL A;  9ICX A;  2Y9U A;  8ICF A;  1SIJ A;  4CDG A;  4P4P A;  4X4O A;  2VJ5 A;  4GC7 A;  2ZUB A;  4Y2S A;  2PMZ C;  5AM0 A;  3HT3 A;  2KVS A;  2BDU A;  3GIL A;  1ZQE A;  2ESE A;  1MC8 A;  4OD0 A;  1UA0 A;  2VA2 A;  1DGS A;  5KL1 B;  3MGI A;  4OO1 J;  3C1Z A;  1WCL A;  3QUQ A;  2V4Q A;  3AN1 A;  1ZXI A;  4M9H A;  2ZHB A;  2HDO A;  2PMZ F;  2ATL A;  3AEV A;  4F50 A;  1NI3 A;  2EAP A;  3BZC A;  5DDY A;  5ALU A;  3E2E A;  1UHU A;  1ZQP A;  1TE2 A;  3ORY A;  2RDJ A;  2F76 X;  1RXV A;  2B6G A;  3D2N A;  2NRV A;  5AIC A;  1ZQV A;  5J2J A;  3UPS A;  5HC9 A;  2LYB A;  3HPO A;  3G6V A;  3WK9 A;  9ICP A;  3E0F A;  3V6K A;  2KZZ A;  2DRB A;  5AK3 A;  3OGU A;  5CRX A;  4BWJ A;  2W9B A;  3ISC A;  5EWF A;  3RR7 A;  4X0A A;  5HRI A;  2BCV A;  2ODG A;  7ICN A;  5C0Y A;  1X6I A;  2W03 A;  3L4P A;  2YMM A;  2WTF A;  3BJY A;  4BUG A;  4FH5 A;  2ZXH A;  1PK1 A;  3H40 A;  3CW2 C;  4DL6 A;  4EEL A;  5F9N A;  3HJ4 A;  4RQ6 A;  3N7R C;  1ZD3 A;  1R8A A;  1T94 A;  3WK5 A;  2QLT A;  5DLG A;  4ECT A;  3SAH A;  2ZH5 A;  1RM6 C;  4MKP A;  2HHQ A;  3KKA A;  3WFQ E;  9ICT A;  4LZG A;  2DPJ A;  4NM1 A;  4YCX A;  1BPY A;  3PSP A;  2YB4 A;  9ICW A;  3K4G A;  1NJX A;  4IRD A;  2B4V A;  3HKZ F;  4FO6 A;  5DB8 A;  4O3R A;  4CGZ A;  2ZIW B;  4RWO A;  3MDA A;  1X6J A;  4Q45 A;  2FMS A;  4NXW A;  3RF9 A;  3ZD8 A;  4R63 A;  3Q8P B;  1OW5 A;  5A0L A;  1L7N A;  5B5E U;  4DF4 A;  1U47 A;  3PO4 A;  4BDP A;  1JUD A;  2G5H B;  3OHB A;  4ATB A;  4UAS A;  5KFO A;  2W3R A;  2E5S A;  1RYR A;  4DSJ A;  3ZDA A;  2QB0 B;  4XRH A;  3F2D A;  3M9M B;  1T3N A;  4WC3 A;  5KT6 A;  3PX6 A;  2ZH1 A;  5HRD A;  3UPQ A;  2F8K A;  4N7R A;  1IIP A;  4NXV A;  1TV9 A;  3AQM A;  4RPY A;  2K8B B;  4CF5 A;  4F2S A;  3M7D A;  3QZ7 A;  2M2V A;  2VA3 A;  3AQE A;  2C22 A;  2C2R A;  4C4S A;  2PI4 A;  9ICA A;  2BHN A;  4FZM A;  3RB4 A;  5L1M A;  5ALD A;  2E8M A;  1D8B A;  2Q0Z X;  4WC4 A;  5ALN A;  3DV9 A;  4F4Y A;  4KLQ A;  7ICP A;  4ICA A;  2G06 A;  1KDH A;  1DRG A;  4UAZ A;  2E1F A;  7ICF A;  3CP8 A;  3OVB A;  3VCB A;  3IHQ B;  2AHO B;  4UB6 U;  3KZX A;  3N28 A;  2DFL A;  3LK9 A;  4MF8 A;  1NJW A;  1TFR A;  1WOT A;  4NY8 A;  5J2B A;  4F5R A;  3RRG A;  3UMC A;  4ED0 A;  4DS5 A;  9ICO A;  1QQ7 A;  1FO4 A;  1BPB A;  4RT2 A;  3JYY A;  3M9N B;  3TFR A;  1SZP A;  4JB3 A;  2E3T A;  2BQR A;  4MFA A;  4EEN A;  1Q78 A;  4X4T A;  1HIW A;  4LJX A;  4AT8 A;  3LVV A;  5IIN A;  2FLN A;  4FBU A;  2I9G A;  3QUB A;  3PV8 A;  1ZD5 A;  1YZ7 A;  2KOB A;  3MFH A;  2IHM A;  2KJ9 A;  3CYM A;  2LMR A;  3MR5 A;  3GIJ A;  2EDU A;  4E8F A;  5AIA A;  4KLI A;  1SKS A;  5J0W A;  2KE7 A;  4C8O A;  2KMD A;  4F92 B;  3LDA A;  2UVU A;  1EXN A;  9ICS A;  2LYH A;  5AIB A;  4KLS A;  5III A;  5J0O A;  2KG5 A;  9ICN A;  4E7X A;  5EWG A;  4EYI B;  2ES6 A;  4K99 A;  3TAD C;  8ICY A;  4KLT A;  5KFX A;  4I29 A;  5EE3 A;  1TFW A;  4RQ8 A;  2M2T A;  2JZB B;  2ZIX A;  1ZRN A;  3KHG A;  2FE9 A;  1ZQH A;  7ICL A;  2B21 A;  4I2G A;  3NVY A;  4A8E A;  4DWI A;  3ETR A;  1N63 A;  2OYY A;  2W9A A;  4R8U B;  5KFT A;  4EBE A;  1L5U A;  3GU3 A;  1X9M A;  3RTV A;  2KKV A;  4RPX A;  2XVT A;  5KAI U;  9ICV A;  3H0M B;  4OAG A;  1NNL A;  4O69 A;  2ZH4 A;  1SV0 A;  1KFT A;  4K9A A;  2YMQ A;  5KT4 A;  5ALE A;  4F4Z A;  5AM2 A;  2XGQ A;  2ZUC A;  1S0O A;  1AQ6 A;  1RZT A;  4CE6 A;  4EBK A;  3WKD A;  4PGX A;  4IRC A;  2DKX A;  5AM5 A;  5AKG A;  2ASL A;  3HIL A;  5AKX A;  1S0V A;  3OTQ A;  2F1J A;  4KIT B;  5DGA A;  4NL9 A;  4P0Q B;  2D3D A;  1M6Y A;  3QNM A;  3BS5 B;  4IC9 A;  4M0A A;  2KK0 A;  3PW0 A;  3KTQ A;  5CFU A;  4B9L A;  8ICW A;  3S6J A;  8ICC A;  2WHE A;  4Z6F A;  4DLG A;  4JUZ A;  8ICI A;  4C7Y A;  3HJE A;  1SWW A;  3F5A A;  4PHD A;  5KT7 A;  4CRX A;  2K4I A;  1Q8K A;  3LWM A;  4X4Q A;  4DEZ A;  1ZQK A;  5KG1 A;  4DSK A;  4IR9 A;  2W9C A;  4F5O A;  1SV4 A;  4YMO A;  1SKW A;  4QWA A;  4UAT A;  4RUA A;  4R66 A;  2BPG A;  4JV2 A;  2LYA A;  2K8C B;  4C8K A;  2HCF A;  3DDH A;  2OXO A;  5J0S A;  2ZH3 A;  1R8B A;  4M9G A;  4KLU A;  1H38 A;  7ICR A;  4O3Q A;  1ZQY A;  4RWN A;  2KIW A;  1ZQG A;  4PPX A;  4YQW A;  4GXJ A;  8ICO A;  4EED A;  4M47 A;  4OJ6 A;  1Z4N A;  1NJZ A;  4J9P A;  1NK0 A;  2ZH6 A;  4Y2J A;  3H8J A;  1KSP A;  4RNO A;  2P6U A;  2BCS A;  3QU5 A;  1Z1B A;  4DSF A;  2O1P A;  5ALR A;  2XIC A;  1UT5 A;  2AQ4 A;  1CEZ A;  4J03 A;  1OU5 A;  5JUM A;  4C4R A;  3FM9 A;  3H4B A;  2KIV A;  5ALG A;  4YMN A;  2JRZ A;  3ERC C;  4F4K A;  3T3F A;  3OUY B;  2KHQ A;  2P66 A;  3D2S A;  2H3Q A;  1ZQC A;  5KG5 A;  4I2H A;  2O5A A;  1BNP A;  4I28 A;  5D62 A;  4YR3 A;  4ED6 A;  5KFF A;  4B9N A;  4PH5 A;  2V4R A;  3QUC A;  2F2A B;  4EGW A;  4TUQ A;  2DUY A;  1S5L U;  2WF5 A;  1ZQU A;  3N7S C;  3ZDC A;  4FFD A;  3MAB A;  5GTI U;  3IRU A;  2F1H A;  5FP0 A;  4GXI A;  3M9O B;  4UB5 A;  1ZQI A;  2IBK A;  4OJO A;  4LT6 A;  5J0R A;  4BGD A;  1U49 A;  2ZIV B;  4O67 A;  2Y0S C;  4RNM A;  2ZXI A;  3C29 A;  4ELU A;  4YR2 A;  3QX7 A;  4Q8E A;  5AI0 A;  1K1S A;  2NRW A;  1UEU A;  2A19 A;  4BX9 C;  4UB4 A;  3RB3 A;  5DB6 A;  4DOB A;  4USA A;  2PFO A;  2BQ3 A;  3PO5 A;  1QSY A;  4C8N A;  5TIS U;  4DL4 A;  2Y0S F;  4WC7 A;  4DQQ A;  3UM9 A;  4G9B A;  1MIV A;  2VAN A;  3WK4 A;  2G5I B;  2ZH2 A;  2M0N A;  5T14 A;  4TQR A;  2M2U A;  2PFP A;  4B9U A;  2Q4T A;  7ICK A;  4NV0 A;  1L8L A;  1T7P A;  4LEW A;  2KP7 A;  9ICJ A;  2F1I A;  5CJ7 A;  3UXP A;  1BPD A;  5DG7 A;  3WKC A;  1Q3U A;  5D61 A;  4DL5 A;  1RPL A;  2KJ5 A;  5KFK A;  3OV7 A;  4ED3 A;  3A0H U;  3ISB A;  3QE9 Y;  1Y88 A;  1D8Y A;  2HHT A;  3KZI U;  4MEY A;  2ZIV A;  2KN7 A;  2HI0 A;  1SGG A;  1MN8 A;  3KOO A;  3U26 A;  3GIK A;  3UMB A;  3G6X A;  2ZIU B;  5KFP A;  4KLL A;  5AKL A;  3ZDB A;  4UAV A;  3K75 D;  2F8L A;  4UAU A;  4OJP A;  4RQN A;  2AGO A;  4O5E A;  2ZG6 A;  4Y2V A;  4DL7 A;  4X4P A;  4YMM A;  3C2K A;  5KFU A;  3SI8 A;  3RBE A;  4MEX A;  1NK8 A;  3T79 A;  4JWM A;  4QWB A;  3GFK B;  5KAF U;  4RQ5 A;  8ICK A;  9ICM A;  2DWQ A;  8ICP A;  1KTQ A;  2MA1 A;  2WB1 F;  4F5P A;  3EWA A;  2ZJA A;  4QZH A;  1Z00 A;  3D6J A;  8ICU A;  1NK9 A;  2H3I A;  5HNK A;  1WYG A;  2HOI A;  2GH1 A;  2NYV A;  2FPK A;  1S97 A;  5D63 A;  3PW5 A;  4O68 A;  4I2F A;  7ICJ A;  1TK8 A;  5KFL A;  4DF8 A;  2CRX A;  3MR3 A;  3T5K A;  2LI6 A;  3EPG A;  3PW4 A;  3C2L A;  5G5H A;  3KD3 A;  4AT7 B;  1TAU A;  1ZQX A;  3QU7 A;  1F5A A;  3GIM A;  1J97 A;  2HMX A;  4AT9 A;  4I27 A;  3B9J A;  2R8H A;  3RJE A;  1KBU A;  1L8O A;  3AU6 A;  4Q44 A;  1K5O A;  5AK4 A;  3OVS A;  4FS1 A;  4F91 B;  3BQT A;  9ICR A;  3H8S A;  2W8K A;  4F93 B;  3EF2 A;  2NV3 A;  3GV5 B;  4FZN A;  4DFD A;  2XCA A;  4F72 A;  4P4O A;  5EE9 A;  3SZ2 A;  3NRW A;  3AMZ A;  3F5E A;  3H0R B;  3THV A;  4Y2X A;  4B9M A;  3L5K A;  1IG6 A;  1ZQD A;  5HRH A;  2UVR A;  1MIY A;  2HBJ A;  4ECZ A;  1JIH A;  2QAR B;  5CB1 A;  4DQP A;  4Y2T A;  3ETL A;  8ICJ A;  4CCH A;  1LVH A;  3SR6 A;  1KN5 A;  3Q8K A;  1XSP A;  1BPX A;  3ZD9 A;  2W8L A;  8ICX A;  3H7I A;  1S0M A;  5DG9 A;  3B0Y A;  4NLK A;  5EWE A;  4PL2 A;  2H3F A;  3M6Z A;  4LEV A;  2K60 A;  2R18 A;  2WAQ C;  5ALM A;  1CI4 A;  4AYB C;  3C1Y A;  2I6X A;  4U7C A;  2MUT B;  4HAI A;  4YN4 A;  1T8E A;  1ZET A;  4ECY A;  4YD1 A;  4GXK A;  3LVW A;  5HR6 A;  3SAF A;  4TUR A;  2YN4 A;  3V7K A;  1S9F A;  5J2E A;  2WAQ F;  8ICT A;  3QUT A;  4DFP A;  4AYB F;  4QZG A;  5KFI A;  5D46 A;  8ICH A;  3RBD A;  3WK7 A;  1S0N A;  3IDW A;  3O0F A;  4RT3 A;  1LV5 A;  7ICM A;  1SKR A;  1WWU A;  1LB2 B;  4EP7 A;  5KFQ A;  4KM5 A;  1Q3V A;  2K4H A;  4QW9 A;  3L9D A;  1O03 A;  5J2F A;  4QZI A;  2ID1 A;  9ICL A;  5ALI A;  3SEI A;  2FPL A;  5KFD A;  9ICU A;  4LZD A;  4YD2 A;  4EEB A;  3Q8R B;  1X40 A;  3PHZ A;  4O5C A;  3MGV A;  4U6P A;  5ALH A;  4RUC A;  4PHE A;  3AUO A;  4IR1 A;  2JEJ A;  2EAM A;  5CP2 A;  3HRD D;  3C28 A;  2LM4 A;  2BZF A;  4EX7 A;  1MSW D;  4ECV A;  3I76 A;  4XA5 A;  3F2B A;  1VJ5 A;  3PW7 A;  5KFJ A;  5ALJ A;  1JAL A;  4KLH A;  4ECX A;  1TVA A;  5AI4 A;  4IS7 A;  2GOL A;  3RAX A;  4KLO A;  3MBY A;  2VJ4 A;  1KFD A;  1QTM A;  3WK8 A;  4DSL A;  4WQL A;  4EBD A;  4DOC A;  3KHL A;  1XWL A;  4P2H A;  1QLN A;  3ICX A;  4M9N A;  5AKH A;  3AQF A;  4M9L A;  2XY7 A;  2L5Y A;  4FHY A;  5AK6 A;  2DRA A;  1KW4 A;  3FAH A;  1WUD A;  3A0B U;  1ZQZ A;  2W7O A;  2JV3 A;  3GDX A;  1DK3 A;  5JRT A;  5J2I A;  1UEV A;  5IIJ A;  1JRO A;  4J9K A;  4WJ3 B;  3PW2 A;  2ZIW A;  5KFV A;  9ICE A;  3ZI4 A;  2DR7 A;  4QZD A;  4F4W A;  3WU2 U;  3RR8 A;  4O3N A;  1JXE A;  5HP4 A;  1NZB A;  5HRK A;  3NTU A;  1L7O A;  1PUZ A;  2FI1 A;  4FHX A;  7ICS A;  1SB3 C;  2BKE A;  4M9J A;  1D8L A;  1SL0 A;  5J29 A;  1ECW A;  2HVI A;  1JI7 A;  2VA8 A;  2HSZ A;  2RLT A;  2NRX A;  2QB0 A;  1J2M A;  3NVO A;  3HWT A;  1B4F A;  3AQK A;  3H37 A;  4NM2 A;  1FA0 A;  3IP4 B;  4X4U A;  2HBL A;  5DBA A;  4UW9 A;  1ZQO A;  1IV8 A;  2FPM A;  4MF2 A;  2NRT A;  1TFY A;  5DBC A;  3H8W A;  3IN5 A;  3OWG A;  4GLX A;  3RJG A;  1KQQ A;  2JMG A;  4NLZ A;  4OJ5 A;  2G08 A;  4HYK A;  1X66 A;  2J6U A;  4M04 A;  1MQ3 A;  4FO1 A;  3SV3 A;  4C4T A;  1KKX A;  5KTQ A;  3AQN A;  4XQ7 A;  4JLX A;  4EEY A;  3RJI A;  2ZUD A;  5DQI A;  4I2J A;  4BXO B;  5AI9 A;  3ZDD A;  1V97 A;  2G0A A;  1Z1V A;  4P4M A;  1ZQJ A;  4O3M A;  4KLD A;  2AH5 A;  5D4B A;  9ICC A;  4Y2U A;  3RH6 A;  2HHX A;  2AXT U;  5DDM A;  4KLF A;  1Q46 A;  2WF7 A;  4RQ2 A;  4YR0 A;  1QQ5 A;  2KD1 A;  2WF6 A;  5DKW A;  4NLN A;  2LBO A;  1XSN A;  3Q8L A;  2KVC A;  2EAO A;  1ZQL A;  2XY6 A;  1NK4 A;  2FMP A;  2EH9 A;  4XUS A;  4F8R A;  4M6W B;  1A0P A;  4I2A A;  3ONN A;  3RJF A;  2WF8 A;  3C23 A;  3WK6 A;  1FFV A;  1A6S A;  2BBJ A;  2AQ0 A;  2FCL A;  4FHV A;  4FHP A;  2JZB A;  3IV6 A;  2ASJ A;  4R64 A;  3PR4 A;  5F9L A;  2DR8 A;  3MCR A;  2MAX A;  3NVW A;  2IHO A;  3MGH A;  2Y1I A;  5J0Y A;  3HJ1 A;  2CPR A;  5HRE A;  4CF3 A;  3UQ0 A;  3KBB A;  4R8U A;  2HN1 A;  4P0P B;  4QZB A;  1NK6 A;  3VC8 A;  4EBJ A;  1T4G A;  3TAD A;  4YFK A;  9ICH A;  5HMM A;  5BOL A;  2DR5 A;  2V9W A;  1Q79 A;  5L1J A;  3GQC A;  4RZR A;  1A76 A;  1ARO P;  2OH2 A;  2XO7 A;  4F2R A;  4KX3 A;  2XC9 A;  4DQS A;  1SXE A;  3BDP A;  2ZH9 A;  4NXX A;  1C7Y A;  1QSL A;  1S77 D;  2Y9T A;  1NO5 A;  5J2K A;  2BDP A;  1N56 A;  4RQ4 A;  2FLP A;  1FEZ A;  5H2F U;  3PX0 A;  4K4H A;  3C18 A;  2A1J B;  5AHX A;  5DED A;  4PHA A;  4JV1 A;  2M9N A;  4J9N A;  4P0Q A;  4US8 A;  1NK7 A;  4JLZ A;  9ICI A;  3BS5 A;  2H3Z A;  4YXM A;  2B0C A;  3GV8 B;  2IOF A;  3RJH A;  4LEZ A;  3EYZ A;  5DLF A;  5K4L A;  3RFA A;  2JGA A;  5HML A;  3C21 A;  5B3P A;  5G5G A;  8ICM A;  1ZQR A;  4FH3 A;  1B0X A;  4TQS A;  4QZ8 A;  3SMV A;  2JH7 A;  5JU5 A;  3BQ0 A;  1D9D A;  4EYH B;  4O3P A;  4YP3 A;  2Z7J A;  4K9B A;  4C8L A;  2XI9 A;  2P35 A;  8ICZ A;  4NKU A;  1ZJN A;  5HRF A;  3QU4 A;  1XSL A;  4B6J A;  2KSO B;  3C2M A;  1QH9 A;  2DL0 A;  3QEA Z;  2LM1 A;  2E8N A;  2RDI A;  4WC5 A;  4ECR A;  4ECQ A;  1LKY B;  1ZQA A;  4F5Q A;  2BE3 A;  1TK5 A;  2B56 A;  4DQI A;  2HHV A;  4Y2R A;  4GFJ A;  5AM1 A;  1N5W A;  1JAJ A;  1COO A;  4YVZ A;  5D49 A;  2BPC A;  4J9S A;  3JPR A;  2M2W A;  4NXT A;  4WBY A;  3G6Y A;  1ZJM A;  1FIQ A;  4PZN A;  3M8R A;  1KNY A;  3SAG A;  3PSF A;  2W7P A;  1RQN A;  1OXJ A;  5J2A A;  1HUO A;  2W55 A;  2P6R A;  2RRD A;  3QYP A;  2C2D A;  3HP6 A;  4E0D A;  4WQK A;  3PNC A;  4K4G A;  2GA9 D;  2G09 A;  4ECU A;  4UQG A;  1DOQ A;  1XNS A;  3OUY A;  2ZH8 A;  8ICQ A;  2KJ8 A;  2OWO A;  3T5J A;  4KMO B;  4O0I A;  5BOM A;  3BS7 A;  1ZQM A;  1L3T A;  4ZOH C;  5BPC A;  4OAH A;  5KG0 A;  5KFC A;  4O6A A;  2JEF A;  2R8I A;  4BWM A;  4XJE A;  1VDV A;  5HRB A;  3UXO A;  4FBT A;  5AKE A;  1NZP A;  5L1L A;  2DQN B;  2I5H A;  1GO3 F;  5KG6 A;  2F77 X;  2LHT A;  4US9 A;  5ALF A;  7ICH A;  3N7P D;  2BPF A;  1KL9 A;  1WWV A;  5KL8 B;  1X42 A;  5EOZ A;  2GO7 A;  3CRX A;  1MIW A;  4DS4 A;  5KT2 A;  4WBZ A;  1NKB A;  2EAN A;  4KMU A;  2DF4 B;  3K1Z A;  1N2X A;  2HHU A;  3ISD A;  5KFN A;  5E79 U;  5J2G A;  2JH1 A;  2XY5 A;  2W9M A;  4QZF A;  1TK0 A;  2IOH A;  3LQC B;  5J0X A;  4UB3 A;  3M8S A;  3WKE A;  1VFG A;  3JPN A;  1DXS A;  3JPT A;  4FS2 A;  2NO5 A;  3PR5 B;  2YML A;  1WG8 A;  4PGQ A;  3LWL A;  4IL6 U;  2YB1 A;  1XU4 A;  3EW9 A;  1KLN A;  4ECW A;  5AM3 A;  1QSS A;  1D9F A;  4ZH4 A;  2BR0 A;  2UVV A;  9ICQ A;  2GAF D;  4GC6 A;  3AQL A;  3J81 j;  2JXJ A;  3WFO A;  4FZL A;  4C8M A;  5AKI A;  2FDR A;  3KHH A;  1TKD A;  5KFE A;  2KKP A;  2C2E A;  4NXU A;  3GV7 B;  1PZN A;  1X9X A;  1V38 A;  2PXI A;  1BNO A;  5J0Q A;  2EWR A;  3MC1 A;  4Z6C A;  4NXZ A;  1ZQQ A;  5ALW A;  3I1Y A;  4Y2Q A;  4RWP A;  4PZO A;  4QZC A;  2FMQ A;  3H38 A;  2Y1J A;  3LYS A;  4ED7 A;  2ZIU A;  3QXG A;  4RNN A;  3WFR E;  2IOF K;  2KTQ A;  5J2H A;  3V6H A;  2HOQ A;  5DQG A;  2ISO A;  3L3F X;  3NKU A;  3ED5 A;  2RFF A;  1ZQS A;  3KKA C;  3PY8 A;  3ER9 B;  1ZD2 P;  2BCQ A;  5KFZ A;  3EUB 2;  4RPZ A;  1URJ A;  2YMP A;  1ZYQ A;  4J9L A;  9ICF A;  1JQR A;  4ED1 A;  1PK1 B;  1PVR A;  3CNH A;  1Z4O A;  2ZTC A;  3V7L A;  1R89 A;  5KFB A;  5CR0 A;  2DGZ A;  3C66 A;  2DBY A;  4JV0 A;  2W3S A;  1Z19 A;  2KFZ A;  3H39 A;  3B0X A;  2K4E A;  2OHF A;  1DGJ A;  2BQU A;  3GZF A;  2HN2 A;  3QU2 A;  1X9S A;  3IG8 A;  1OUQ A;  4GIB A;  4F3O A;  1CUK A;  3TQ1 A;  3GII A;  3T5L A;  7ICQ A;  2EQY A;  2OEH A;  5CEH A;  4Z6D A;  4J9Q A;  4O3S A;  4UAW A;  2ZH7 A;  4MHV A;  1KEJ A;  4AT7 A;  2VIX A;  2E8P A;  3HW8 A;  2HHP A;  2YQE A;  2ZJ8 A;  1L3V A;  2ZHA A;  3MFI A;  2ZJ5 A;  4EZ6 A;  3BQ1 A;  4DOA A;  4ATB B;  4JK1 A;  1F5S A;  1RDF A;  3ALR A;  9ICK A;  7ICT A;  3JPQ A;  1RQL A;  8ICL A;  2R8G A;  3EPI A;  1PX5 A;  1N60 A;  5L1K A;  3TAQ A; 
#chains in the Genus database with same CATH homology
 4HYK A;  4J9R A;  5KG4 A;  2AGP A;  4M04 A;  2J6U A;  1MQ3 A;  5J0U A;  3SV3 A;  4FHW A;  4DSF A;  2O1P A;  1U9L A;  4QZA A;  2ZH3 A;  1UT5 A;  2AQ4 A;  5KTQ A;  2DPI A;  1CEZ A;  1YLQ A;  3AQN A;  4RU9 A;  4XQ7 A;  1OU5 A;  7ICO A;  5IIK A;  5JUM A;  2HVH A;  4I2C A;  4B9V A;  4EEY A;  4R65 A;  3RJI A;  2XGP A;  3H4B A;  5HR9 A;  1ZQW A;  4X5V A;  2ZUD A;  5DQI A;  4I2J A;  4BXO B;  1BVS A;  3ZDD A;  1X9W A;  4KN4 A;  1ZQB A;  4YMN A;  3SV4 A;  3RH4 A;  4F4K A;  3MR6 A;  5F2V O;  4DSE A;  3T3F A;  2GWS A;  4P4M A;  1ZQJ A;  1JN3 A;  3OUY B;  5KG7 A;  4KLD A;  2DR9 A;  5KFY A;  5D4B A;  1U45 A;  4B9S A;  4X4R A;  3PML A;  2P66 A;  9ICC A;  3RH6 A;  2HHX A;  5DDM A;  4KLF A;  8ICN A;  1ZQC A;  3EZ5 A;  5KG5 A;  3MR2 A;  3T5H A;  4I2H A;  4MFC A;  2O5A A;  8ICG A;  4RQ2 A;  4EZ9 A;  1BNP A;  4KTQ A;  3RJJ A;  4YR0 A;  2UVW A;  2R8K A;  3Q8Q B;  1V9P A;  2IMW P;  4I28 A;  3SYZ A;  4TUP A;  5HRL A;  5DKW A;  4YR3 A;  4NLN A;  4I2D A;  4ED6 A;  3OJU A;  1XC9 A;  5KFF A;  4B9N A;  1XSN A;  3Q8L A;  4PH5 A;  5KG3 A;  1L3U A;  4RQ0 A;  2V4R A;  5KT3 A;  1ZQL A;  4TUQ A;  2XY6 A;  4X0B A;  1NK4 A;  2ASD A;  5HHI A;  1L3S A;  2MUT A;  5KFH A;  2ZTD A;  3HIY A;  3OJS A;  1NKE A;  1UT8 A;  1ZQU A;  1BGX T;  3ZDC A;  4NKT A;  3MAB A;  3Q8S B;  2FMP A;  4M5D A;  1KFS A;  2F1H A;  2PFQ A;  4GXI A;  4AT8 B;  3M9O B;  4UB5 A;  2W9B B;  1U48 A;  1JX4 A;  3RB0 A;  4F5N A;  1ZQI A;  4KLJ A;  1DK2 A;  8ICV A;  2IBK A;  3H3A A;  4LT6 A;  5J0R A;  4UB2 A;  3PVX A;  1NJY A;  4DSI A;  4XUS A;  4QW8 A;  4BGD A;  4F8R A;  4O5K A;  1U49 A;  9ICB A;  1NK5 A;  4PGY A;  4M6W B;  2FLL A;  3TAN A;  4I2A A;  9ICX A;  4RNM A;  8ICF A;  4P4P A;  2IHN A;  4ELU A;  4YR2 A;  3UQ2 A;  2PFN A;  3RJF A;  4X4O A;  2XCP A;  4Q8E A;  3C23 A;  1IXR A;  1K1S A;  4GC7 A;  2ZUB A;  2PI5 A;  2NRW A;  1UEU A;  2AQ0 A;  3HT3 A;  5DQH A;  4FHV A;  4UB4 A;  3RH5 A;  4FHP A;  2JZB A;  3RB3 A;  4R64 A;  2ASJ A;  5DGB A;  5F9L A;  3PR4 A;  4M2Y A;  8ICB A;  2DR8 A;  5DB6 A;  4DOB A;  2MAX A;  2PFO A;  5IIO A;  3GIL A;  2BQ3 A;  1ZQE A;  1QSY A;  3PO5 A;  4MFF A;  1MC8 A;  4C8N A;  1UA0 A;  4RQ7 A;  1NKC A;  2VA2 A;  3MGH A;  2Y1I A;  1DGS A;  5J0Y A;  1B43 A;  4DFJ A;  3HJ1 A;  3MGI A;  4DL4 A;  4WC7 A;  5HRE A;  4DQQ A;  3UQ0 A;  3C1Z A;  1WCL A;  2V4Q A;  4R8U A;  5J0P A;  1KRP A;  1MIV A;  2VAN A;  3FYH A;  4F4X A;  2HHS A;  4QZB A;  1NK6 A;  2ZH2 A;  2Q66 A;  4Q43 A;  4M9H A;  4EBJ A;  2ZHB A;  1T4G A;  2ATL A;  4YFK A;  4UD5 A;  4TQR A;  4F50 A;  3E2E A;  4YG2 A;  5DDY A;  5HMM A;  9ICH A;  5BOL A;  2PFP A;  2M2U A;  2DR5 A;  1ZQP A;  2V9W A;  4B9U A;  1Q79 A;  3ORY A;  5L1J A;  3GQC A;  4RZR A;  7ICK A;  2RDJ A;  1RXV A;  1T7P A;  1A76 A;  1ARO P;  2KP7 A;  9ICJ A;  2F1I A;  5CJ7 A;  2BCR A;  3UXP A;  1BPD A;  2XO7 A;  4F2R A;  2XC9 A;  5KFS A;  2NRV A;  4IQU A;  4DQS A;  5DG7 A;  3BDP A;  1ZQV A;  4WCW A;  2ZH9 A;  1K1Q A;  5J2J A;  3UPS A;  5HC9 A;  1C7Y A;  1QSL A;  1S77 D;  3HPO A;  3G6V A;  4DL5 A;  2ALZ A;  1NO5 A;  1RPL A;  5J2K A;  4IG8 A;  2BDP A;  9ICP A;  1N56 A;  5KFK A;  2C28 A;  4RQ4 A;  1JXL A;  3V6K A;  2FLP A;  2KZZ A;  3OV7 A;  2DRB A;  3OGU A;  3PX0 A;  4BWJ A;  2W9B A;  3BQ2 A;  4K4H A;  3C18 A;  3OSN A;  2A1J B;  4E80 A;  5DED A;  4PHA A;  3ISC A;  4ED3 A;  3ISB A;  4JV1 A;  2M9N A;  5EWF A;  3QE9 Y;  1Y88 A;  4J9N A;  1D8Y A;  3RR7 A;  4X0A A;  1NK7 A;  1RYS A;  5HRI A;  2BCV A;  7ICN A;  1Z3E B;  2HHT A;  4MEY A;  9ICI A;  2HHW A;  2KN7 A;  4YXM A;  1B22 A;  2NRK A;  4QZE A;  3GIK A;  3GV8 B;  4IQW A;  2HW3 A;  5KG2 A;  4ECS A;  3G6X A;  4ED8 A;  3RJH A;  4UD4 A;  5L1I A;  5KFP A;  4DLE A;  4KLL A;  3EYZ A;  5DLF A;  3V6J A;  3ZDB A;  7ICL A;  3K75 D;  5DG8 A;  4QWC A;  2WTF A;  3BJY A;  2KFN A;  4J9M A;  4FH5 A;  3H40 A;  4DL6 A;  5HML A;  3C21 A;  7ICU A;  8ICM A;  5F9N A;  2AGO A;  4O5E A;  3HX0 A;  4RQ6 A;  2H5X A;  1ZQR A;  3HJ4 A;  4FH3 A;  4DL7 A;  4X4P A;  1R8A A;  4TQS A;  3TI0 A;  4B9T A;  4YMM A;  5DLG A;  4QZ8 A;  4ECT A;  3C2K A;  4IQT A;  1TAQ A;  2AU0 A;  5KFU A;  3SI8 A;  3RBE A;  3BQ0 A;  1D9D A;  2ZH5 A;  4EYH B;  4O3P A;  5J0T A;  4MEX A;  2HHQ A;  1NK8 A;  1S10 A;  4JWM A;  3WFQ E;  4QWB A;  5C5J A;  4YP3 A;  4C8L A;  9ICT A;  3GFK B;  4RQ5 A;  4LZG A;  8ICK A;  9ICM A;  8ICZ A;  2DPJ A;  5J2D A;  4YCX A;  1BPY A;  4NM1 A;  4NKU A;  9ICG A;  1ZJN A;  2BCU A;  5HRF A;  8ICP A;  1XSL A;  1S76 D;  9ICW A;  3K4G A;  4KN7 A;  1NJX A;  3C2M A;  1KTQ A;  4NLG A;  4F5P A;  3QEA Z;  3EWA A;  4IRD A;  1R8C A;  4FO6 A;  2RDI A;  2ZJA A;  4QZH A;  4WC5 A;  5DB8 A;  4O3R A;  4ECR A;  4ECQ A;  1ZQA A;  4RWO A;  4F5Q A;  1Z00 A;  3MDA A;  2BE3 A;  1TK5 A;  5HHH A;  8ICU A;  4Q45 A;  1RXW A;  1NK9 A;  4DQI A;  2HHV A;  4DQR A;  2AGQ A;  5HNK A;  3PX4 A;  1JAJ A;  2W9C B;  1COO A;  2FMS A;  4YVZ A;  4S3N A;  2BGW A;  5D49 A;  4J9O A;  2BPC A;  3N4M B;  4J9S A;  2FPK A;  3JPR A;  3ZD8 A;  4R63 A;  3Q8P B;  1S97 A;  2M2W A;  5DBB A;  3RRH A;  4ELT A;  3PW5 A;  4WBY A;  4DF4 A;  1U47 A;  3PO4 A;  4BDP A;  3OSP A;  4I2F A;  3OHB A;  3G6Y A;  5IIM A;  4DL3 A;  5KFO A;  1ZJM A;  1TK8 A;  7ICJ A;  5KFL A;  4DF8 A;  3MR3 A;  3T5K A;  3PW4 A;  3EPG A;  1RYR A;  4X4N A;  4O3O A;  3C2L A;  4DSJ A;  4LVS A;  3M8R A;  3ZDA A;  2KZ3 A;  1KNY A;  3RJK A;  4XRH A;  4WC2 A;  2ZTE A;  4AT7 B;  1TAU A;  1ZQX A;  3M9M B;  1T3N A;  3GIM A;  1F5A A;  4AT9 A;  4WC3 A;  5KT6 A;  4I27 A;  2R8H A;  3PX6 A;  2ZH1 A;  5HRD A;  3UPQ A;  3RJE A;  1XO1 A;  3AU6 A;  4Q44 A;  1TV9 A;  3AQM A;  4RPY A;  3JPS A;  3OVS A;  4KLG A;  4F2S A;  5J2A A;  4QZ9 A;  3QZ7 A;  4FS1 A;  2M2V A;  5DB7 A;  4RQ1 A;  2C22 A;  1HUO A;  4F91 B;  2VA3 A;  4DO9 A;  2P6R A;  2C2R A;  2C2D A;  2PI4 A;  3HP6 A;  5CWR A;  2BHN A;  4ELV A;  3PNC A;  4E0D A;  4K4G A;  3BQT A;  9ICA A;  1HUZ A;  9ICR A;  3H8S A;  2W8K A;  4F93 B;  3RB4 A;  4BXO A;  3GV5 B;  4KLM A;  4ECU A;  3JZ0 A;  4UQG A;  4EBC A;  2XCA A;  1DOQ A;  2Q0Z X;  3OUY A;  3QZ8 A;  4P4O A;  4WC4 A;  2ZH8 A;  1NOM A;  4RQ3 A;  8ICQ A;  4F4Y A;  3SZ2 A;  4KLQ A;  7ICP A;  1KDH A;  3THV A;  2OWO A;  4UAZ A;  3T5J A;  7ICF A;  3OVB A;  4I2I A;  3C5F A;  4O0I A;  5BOM A;  1ZQM A;  3IHQ B;  1L3T A;  4B9M A;  5BPC A;  2DFL A;  5KG0 A;  3LK9 A;  1ZQD A;  4MF8 A;  5KFC A;  1NJW A;  1TFR A;  1WOT A;  5HRH A;  2UVR A;  1MIY A;  5KFG A;  3AU2 A;  1ZQT A;  2JEF A;  4ECZ A;  2R8I A;  4NY8 A;  5J2B A;  4BWM A;  4F5R A;  4QWE A;  3RRG A;  1JIH A;  4ED0 A;  5CB1 A;  4DQP A;  4X4S A;  3ETL A;  8ICJ A;  4DS5 A;  4I2B A;  4CCH A;  9ICO A;  4RT2 A;  1BPB A;  3Q8K A;  3JYY A;  5HRB A;  3M9N B;  1XSP A;  3UXO A;  1SZP A;  3ZD9 A;  2W8L A;  3TFR A;  1BPX A;  4FBT A;  8ICX A;  4G3I A;  3H7I A;  1JMS A;  2JEI A;  1NZP A;  5L1L A;  4DL2 A;  2BQR A;  1V4A A;  4MFA A;  1Q78 A;  4X4T A;  1S0M A;  5DG9 A;  3B0Y A;  5KG6 A;  4AT8 A;  4NLK A;  5IIN A;  4O9M A;  8ICA A;  2FLN A;  5EWE A;  4FBU A;  4I2E A;  1IM4 A;  2I9G A;  7ICH A;  4Q8F A;  5TZV A;  3PV8 A;  2BPF A;  1HJP A;  2JEG A;  5L9X A;  4M6W A;  2J6S A;  5EOZ A;  3MFH A;  3RB6 A;  2IHM A;  4KLE A;  5KFA A;  1MIW A;  3MR5 A;  3C1Y A;  4UBC A;  4DS4 A;  5KT2 A;  3GIJ A;  4WBZ A;  2MUT B;  1NKB A;  4E8F A;  1BPZ A;  4YN4 A;  1T8E A;  4KMU A;  4KLI A;  1A77 A;  1ZET A;  2HHU A;  4ECY A;  4UBB A;  4YD1 A;  3OHA A;  3ISD A;  1SKS A;  5J0W A;  5KFN A;  5J2G A;  4GXK A;  4C8O A;  1WCN A;  2XY5 A;  4F92 B;  3LDA A;  4TUR A;  2UVU A;  1EXN A;  3V7K A;  1S9F A;  2LYH A;  2W9M A;  5J2E A;  4QZF A;  1TK0 A;  7ICI A;  9ICS A;  4KLS A;  8ICT A;  3LQC B;  5III A;  5J0O A;  5J0X A;  4UB3 A;  3M8S A;  5EWG A;  4DFP A;  4EYI B;  9ICN A;  4E7X A;  1UA1 A;  1VFG A;  3JPN A;  4QZG A;  3JPT A;  4FS2 A;  5KFI A;  5D46 A;  8ICY A;  3UXN A;  4KLT A;  4PHP A;  1U4B A;  8ICH A;  3C5G A;  3NYB A;  3RBD A;  5KFX A;  2ISP A;  3PR5 B;  4IRK A;  4PGQ A;  4I29 A;  1S0N A;  3LWL A;  1ZQN A;  1TFW A;  4RT3 A;  4RQ8 A;  1LV5 A;  2M2T A;  7ICM A;  2JZB B;  1XU4 A;  3EW9 A;  3JPP A;  1ZQH A;  3KHG A;  1KLN A;  3IM1 A;  4ECW A;  2B21 A;  4I2G A;  1QSS A;  1N48 A;  3TAR A;  1D9F A;  4ZH4 A;  4UAY A;  1SKR A;  4DWI A;  1LB2 B;  3MDC A;  4EP7 A;  2BR0 A;  5KFQ A;  2UVV A;  9ICQ A;  4QW9 A;  3QEB Z;  3AQL A;  4GC6 A;  2W9A A;  8ICR A;  3L9D A;  3WFO A;  4R8U B;  4C8M A;  5KFT A;  4EBE A;  3KHH A;  1L5U A;  5J2F A;  4QZI A;  1TKD A;  5KFE A;  4DFK A;  9ICL A;  2ID1 A;  1X9M A;  2C2E A;  2FPL A;  3KHR A;  5KFD A;  3RTV A;  3GV7 B;  1PZN A;  4RPX A;  9ICU A;  4X4V A;  9ICV A;  4LZD A;  4YD2 A;  3Q8R B;  2PXI A;  2NRZ A;  4O5C A;  5J0Q A;  1BNO A;  2ZH4 A;  1KFT A;  4Z6C A;  1BPE A;  2A1J A;  4RUC A;  4PHE A;  3AUO A;  4IR1 A;  2JEJ A;  3TAP A;  4NXZ A;  5CP2 A;  5KT4 A;  1ZQQ A;  4F4Z A;  4DFM A;  2DVI A;  4RWP A;  4QZC A;  2XGQ A;  2FMQ A;  2ZUC A;  1MSW D;  3H38 A;  2Y1J A;  4ECV A;  4ED7 A;  1S0O A;  4XA5 A;  1RZT A;  3PW7 A;  3N97 B;  4EBK A;  2R8J A;  5KFJ A;  4PGX A;  3V7J A;  4IRC A;  4RNN A;  3WFR E;  3NGD A;  2KTQ A;  3JPO A;  5J2H A;  3RAQ A;  2ASL A;  4KLH A;  3V6H A;  5DQG A;  5KT5 A;  1MQ2 A;  2ISO A;  4ECX A;  1TVA A;  1S0V A;  3RAX A;  4JWN A;  2F1J A;  4KLO A;  4KIT B;  3MBY A;  5DGA A;  2KZM A;  2RFF A;  1ZQS A;  1ZQF A;  1KFD A;  1QTM A;  5HRG A;  3PY8 A;  4DSL A;  5KFW A;  4EBD A;  2BCQ A;  4ED2 A;  5KFZ A;  4M0A A;  2IA6 A;  4DOC A;  5DB9 A;  3PMN A;  3KHL A;  4RPZ A;  1XWL A;  3PW0 A;  3KTQ A;  4P2H A;  1QLN A;  4M9N A;  3V72 A;  1ZYQ A;  4J9L A;  1XS9 D;  4M9L A;  9ICF A;  4B9L A;  2XY7 A;  5CA7 A;  4XQ8 A;  4ED1 A;  8ICW A;  1JQR A;  4FHY A;  8ICC A;  2DRA A;  4Z6F A;  4WC1 A;  4DLG A;  1ZQZ A;  2ZTC A;  4JUZ A;  8ICI A;  3V7L A;  1SL2 A;  1R89 A;  5KFB A;  3GDX A;  1DK3 A;  5CR0 A;  5J2I A;  7ICG A;  5CHG A;  1UEV A;  3C66 A;  5IIJ A;  4PHD A;  5KT7 A;  3LWM A;  4J9K A;  3PW2 A;  4JV0 A;  4DEZ A;  1ZQK A;  5KFV A;  2KFZ A;  5KG1 A;  9ICE A;  3H39 A;  3B0X A;  4X4Q A;  4QZD A;  2DR7 A;  5KFM A;  4F4W A;  4DSK A;  7ICE A;  3RR8 A;  4IR9 A;  4O3N A;  1JXE A;  5HP4 A;  2BQU A;  4ATB A;  2W9C A;  2J6T A;  4WC0 A;  4F5O A;  3Q8M A;  1X9S A;  5HRK A;  5IIL A;  3H4D A;  3NTU A;  4Z6E A;  4F3O A;  1CUK A;  1UET A;  4YMO A;  4FHX A;  3TQ1 A;  4UB1 A;  3GII A;  3T5L A;  7ICQ A;  1SKW A;  4QWA A;  7ICS A;  2BKE A;  4RUA A;  3WFP A;  4Z6D A;  4M9J A;  4J9Q A;  4O3S A;  4UAW A;  1D8L A;  4R66 A;  4TUS A;  1SL0 A;  2BPG A;  5J29 A;  4JV2 A;  4K4I A;  2HVI A;  4C8K A;  2VA8 A;  1Z00 B;  3WFS C;  2ZH7 A;  2NRX A;  5J0S A;  2I1Q A;  1KEJ A;  2AJQ A;  5DEC A;  1R8B A;  3HWT A;  3HW8 A;  4AT7 A;  4M9G A;  1X2I A;  2HHP A;  3AQK A;  4WC6 A;  7ICV A;  4IQV A;  4KLU A;  2ZJ8 A;  1H38 A;  3FDS A;  4O3Q A;  8ICE A;  1L3V A;  7ICR A;  3H37 A;  4NM2 A;  1FA0 A;  2PBE A;  2ZHA A;  1ZQY A;  4RWN A;  4X4U A;  4YXJ A;  3MFI A;  1ZQG A;  2ZJ5 A;  5KFR A;  4PPX A;  5DBA A;  4EZ6 A;  1ZQO A;  8ICS A;  4YQW A;  3BQ1 A;  4DOA A;  4ATB B;  2FPM A;  4JK1 A;  4GXJ A;  2NRT A;  4MF2 A;  8ICO A;  1TFY A;  4QWD A;  4M47 A;  9ICK A;  3OVA A;  7ICT A;  1NJZ A;  4J9P A;  5J2C A;  1NK0 A;  2ZH6 A;  5DBC A;  3JPQ A;  3H8W A;  1VJ7 A;  4GLX A;  3RJG A;  8ICL A;  4RWQ A;  2R8G A;  3TFS A;  3H8J A;  1KSP A;  3EPI A;  1SL1 A;  3ZDE A;  4RNO A;  5L1K A;  4NLZ A;  2P6U A;  1PX5 A;  4AT9 B;  2BCS A;  3TAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...