4PPXA

Dna polymerase beta e295k with spiroiminodihydantoin in templating position
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
314
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Crystal Structure of DNA Polymerase beta with DNA Containing the Base Lesion Spiroiminodihydantoin in a Templating Position.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 314
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ppxA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ppxA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ppxA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ppxA03
8ICFA 1F5AA 5KFGA 3IM1A 1MQ3A 4AT7B 4KLOA 7ICEA 4PH5A 4DOCA 4KN4A 1NKCA 9ICCA 1CUKA 2BQRA 5DDMA 1L3VA 1MC8A 3ZDCA 9ICHA 1PX5A 3C5GA 4YMNA 1VJ7A 4QZEA 5KFMA 1RXVA 4KLGA 4X4TA 4YD1A 3Q8LA 1B22A 5J0OA 3BJYA 1ZQJA 2ZH1A 3LK9A 3H37A 2AGPA 2FMSA 4F2RA 3AU6A 3Q8SB 4KLJA 3PX0A 1ZQEA 4ELUA 1TK8A 4IRKA 8ICSA 3PW4A 1L3TA 5HC9A 1ZQPA 4I2HA 4FBTA 1Z00A 2W9CA 8ICIA 2XGPA 2HHPA 1XC9A 3H40A 1JAJA 5KT7A 2FPMA 4X4VA 4ED7A 4UAWA 1T3NA 1D9DA 3AU2A 1KDHA 3V7LA 4QZBA 3G6VA 3PO4A 2M2UA 1UETA 2V9WA 5HRGA 2ZH8A 4QW8A 3JPPA 2B21A 3UXNA 3RH6A 4X4QA 2M9NA 3MFIA 5J0RA 5DLFA 2M2TA 4NLKA 1DGSA 2J6SA 3JPSA 1ZQSA 3NTUA 1MIVA 3PMNA 4DL2A 2WTFA 1SZPA 3NYBA 4NLNA 4MF8A 1NKEA 2F1HA 3PW7A 4WC2A 1TV9A 5KFTA 4GC6A 4RPXA 4ATBA 4J9LA 4KITB 4RQ4A 1ZQYA 7ICTA 3NGDA 3MGHA 2BGWA 2HW3A 1Q79A 3C2MA 4YFKA 3GIMA 4RWNA 4NY8A 3RB4A 4RQ6A 8ICPA 4DL5A 4RQ2A 3N97B 4O3NA 4FO6A 2HHQA 3V7JA 5HRIA 1BPZA 4X4PA 4M6WB 4RNOA 1ZQXA 2P66A 1BPEA 1LV5A 4YR3A 2V4RA 3RJJA 4C8MA 2DR8A 5KG6A 1MQ2A 8ICBA 5JUMA 4F5NA 1SKSA 4RNNA 4F3OA 4GXIA 1MIWA 5KFKA 3Q8PB 1NO5A 4R63A 1BPBA 2RDIA 5DDYA 2ZTDA 3HX0A 5DBBA 1UT5A 1BVSA 3MR2A 1T7PA 7ICIA 9ICGA 5HREA 1S77D 1KNYA 4AT9B 4JK1A 1UA1A 2FLLA 4QWCA 7ICQA 4B9LA 2JEJA 4Q45A 3QEAZ 4DL4A 5KTQA 2PFPA 4TQSA 4UAZA 3JPRA 1JXLA 3MGIA 4MEXA 4PHAA 2BQUA 4XA5A 2BPCA 5KFXA 4JV0A 2FMQA 2MAXA 3ZDEA 3EPIA 5DKWA 4CCHA 4MFAA 8ICWA 9ICIA 5CHGA 3PO5A 4JUZA 4TQRA 4JWMA 3V6JA 4DO9A 1L5UA 4K4IA 1ZQQA 4QZGA 3IHQB 4QZAA 2R8KA 3RR8A 1ZQIA 4O5KA 4KLMA 4F92B 5KFZA 1HJPA 3ORYA 2OWOA 1U49A 4ECRA 4O9MA 5IIIA 5C5JA 4TUQA 3C2KA 2VA2A 4M2YA 8ICMA 4DFMA 4RWQA 3RAXA 3RAQA 3GV8B 3BQ0A 1DK3A 2NRVA 1WCNA 5HMLA 5J0WA 5EWFA 4J9KA 3H7IA 3H39A 3BQ1A 1JX4A 4AT8A 4O3SA 3MR5A 4EYIB 2PI4A 4YCXA 4FBUA 1NJWA 1U48A 3JZ0A 3RR7A 2P6UA 5IIOA 5KFLA 3SV3A 1L3UA 2DPIA 4UB4A 7ICFA 1TFYA 2ZJ8A 1ZQUA 4O3QA 3ZD8A 3JPNA 4PGYA 4M9JA 7ICVA 5EWEA 1ZQOA 1KLNA 2NRWA 4TUSA 3K75D 3TFSA 2AU0A 3H8WA 4BWJA 3EZ5A 4JV1A 4M6WA 1A76A 1NK7A 4R66A 2J6UA 2C22A 3C66A 4XQ8A 1ZQGA 2KZ3A 3M9OB 4YD2A 1S76D 5CWRA 5IINA 5KG3A 5J0PA 4UBCA 4J9OA 4UAYA 2F1JA 2VA3A 4B9NA 4FHXA 3PVXA 1R89A 9ICFA 3GV7B 5D4BA 4DQIA 2KP7A 4UD4A 4X4NA 1CEZA 2ZJAA 5CB1A 3KHGA 2W8KA 1X9MA 2BR0A 4G3IA 9ICNA 1SL2A 3PX6A 4KLTA 9ICWA 4P4MA 1BNOA 1ZYQA 4PPXA 5J2HA 1COOA 4YXJA 4WC7A 4Z6FA 1S0VA 5J0XA 4FHPA 4DSFA 3EYZA 5DGAA 5KT6A 5HNKA 2W9BA 4F5OA 3TFRA 1AROP 2IA6A 3UQ0A 4YMOA 1IXRA 5J2CA 4DSEA 2W8LA 5D46A 4WC6A 3GIKA 1Q78A 3RJEA 4XQ7A 2ZH9A 1KFDA 4NKTA 3ETLA 4YVZA 3MFHA 4IQTA 2PXIA 5J2AA 5L1KA 1ZQNA 1KTQA 2BCQA 2GWSA 3Q8RB 2PI5A 4F4KA 4KLDA 2BCUA 4ECTA 3MABA 4YXMA 3TAQA 2UVUA 4LVSA 5IIMA 1BPXA 2ZUCA 5J2GA 4I2GA 4F91B 5J0TA 1TAUA 3OVAA 2R8IA 5DBAA 3HPOA 4QWEA 4RNMA 3UPQA 1TVAA 4M9LA 1NK8A 3AQLA 3WFOA 2XGQA 4RQ8A 1KRPA 4KMUA 3H3AA 7ICOA 4RUAA 5DEDA 4R8UA 2Y1JA 2LYHA 8ICZA 3EWAA 4X0AA 4IRDA 1IM4A 5J2BA 3ISDA 4DSJA 2HHVA 4E7XA 1KFSA 5KFOA 2IBKA 4O5CA 3RRHA 4DFPA 2XY6A 4DQSA 8ICNA 4M5DA 4WC5A 5HRBA 4F4ZA 1WCLA 5BOMA 1A77A 5KG7A 3SYZA 1JIHA 2BCSA 3H4DA 7ICLA 3SV4A 4IQWA 4QZDA 3HIYA 5DB9A 2BDPA 1JMSA 4ZH4A 5DG7A 4I2FA 4FH5A 1RZTA 2I1QA 3JYYA 1QSYA 4RWPA 2ZHAA 3G6XA 2NRZA 5L1IA 4KLQA 3C18A 1XSLA 3LDAA 3T5HA 2ASLA 5EWGA 2JZBA 1NJXA 3HJ1A 4I2JA 5BOLA 5L1LA 4ED8A 3BQTA 4M47A 4WCWA 1OU5A 4RWOA 5HRKA 4QZIA 2ZUBA 7ICKA 4DFKA 4E80A 1NK9A 4GXJA 2XCAA 4IG8A 1N48A 4WBZA 9ICAA 3FDSA 4Q8FA 1MSWD 4RPYA 5HHHA 2O5AA 3GV5B 4X5VA 2FMPA 1S10A 3WFQE 1EXNA 4P4OA 3KHLA 1VFGA 1ZQBA 4F5RA 4DSKA 4YP3A 4AT7A 4WC4A 4NXZA 2ZJ5A 5DLGA 4MEYA 5KFCA 3QE9Y 4RUCA 1ZQVA 4Z6DA 2UVVA 1SKWA 4EZ6A 3PNCA 1K1SA 4PHDA 4KLFA 2ZH3A 4DL6A 1K1QA 2DFLA 5DQIA 4RU9A 4EBCA 2XY5A 4DSIA 7ICUA 9ICOA 2P6RA 4XUSA 5KFYA 4NM2A 5DB7A 2XO7A 4EEYA 2UVWA 3G6YA 2NRKA 7ICSA 2MUTB 4RQ5A 4KLUA 1FA0A 2PFOA 4I27A 7ICRA 3HW8A 9ICKA 5KFQA 4YMMA 4NLZA 4B9UA 3THVA 3C23A 3T5LA 4FS2A 2Q66A 3UXPA 5HRFA 4X4UA 4RT2A 1MIYA 1ZQLA 5DB8A 2BQ3A 1XU4A 5KFWA 4WC1A 1NJZA 1L3SA 3OV7A 4NLGA 5J2DA 2AJQA 2ZH6A 4UQGA 3MR3A 3OSPA 1RXWA 2NRXA 4DL7A 4TUPA 4KLIA 1XSPA 5IILA 1TK0A 3ISCA 2JEFA 2IHNA 2KTQA 3RB6A 5EOZA 1NK5A 5CP2A 1X9WA 2PBEA 4YQWA 4ECZA 3QEBZ 1QTMA 4ELVA 1UEVA 4EYHB 3MBYA 1U4BA 5BPCA 5J2JA 3TQ1A 3PW0A 4KLEA 8ICJA 5HRLA 3HT3A 1DOQA 4QWDA 1TK5A 3L9DA 1HUZA 1BPDA 3H8JA 4C8KA 9ICUA 1TFWA 2R8JA 4EBJA 4F5QA 4B9MA 1BNPA 1JXEA 4O5EA 7ICMA 3OVBA 4FS1A 3GIIA 3HP6A 2KZZA 3RJIA 2UVRA 4MFCA 2DR7A 4ECSA 3AUOA 5J2EA 3ZDAA 3MDCA 1ZJMA 4ED3A 3RH4A 4EP7A 4WC3A 2Y1IA 1S0NA 4K4GA 1KEJA 5CJ7A 8ICYA 1R8AA 5KFRA 5DG9A 3EPGA 2ZUDA 4YR2A 1X2IA 4UB2A 4PGXA 1XSNA 4ECXA 9ICTA 2M2VA 9ICMA 5KFHA 1RPLA 2XCPA 2JEIA 4FHYA 5J2KA 4F4YA 3RJHA 2IHMA 4ED0A 3Q8KA 8ICOA 4DLGA 3KHRA 1QSSA 4X4RA 5KG2A 2H5XA 3M9NB 1S97A 4AT9A 2DR9A 1Z3EB 3T5JA 1ZQMA 4I2DA 9ICEA 3V7KA 5KT2A 8ICVA 3FYHA 3MR6A 2BE3A 3H8SA 4RQ0A 3OJUA 7ICNA 4ECUA 2FLNA 1PZNA 5L1JA 4F50A 1KSPA 1UT8A 4M9NA 5KFUA 5J0UA 5DQHA 1ZQDA 3LQCB 2KZMA 1N56A 3RJGA 1T8EA 1YLQA 2R8GA 3PMLA 4WC0A 3WFRE 4F4WA 4DQQA 4Z6EA 3LWMA 2JEGA 9ICLA 3KTQA 4DWIA 5HRDA 4IR1A 2C2RA 2ZH4A 3LWLA 3KHHA 2Q0ZX 3OJSA 1NK4A 8ICHA 1V9PA 1ZQWA 1ZQHA 4ATBB 4C8NA 4RQ1A 4BXOB 5KG5A 1Y88A 3GQCA 4DQPA 2HHTA 2ZH7A 1BPYA 2M2WA 3V6KA 8ICGA 1ZETA 5D49A 4RQ3A 4QZ9A 4B9VA 5HR9A 4B9SA 4E0DA 4IQUA 5L9XA 4J9QA 3PR4A 5DB6A 1ZQTA 4PGQA 4Q8EA 1S9FA 4KLSA 2ZH5A 5KFJA 5IIJA 4ED2A 3RBEA 1ZQAA 8ICKA 3UPSA 5KG1A 5IIKA 3RH5A 4YN4A 2ALZA 3GIJA 1XWLA 1S0OA 4I29A 4GLXA 4C8LA 4M0AA 5DG8A 4F5PA 4GC7A 1SL1A 8ICRA 2O1PA 4BWMA 4FH3A 5F2VO 2AGQA 4JWNA 5J29A 2W9AA 1ZQRA 3ZDBA 2DPJA 2BCRA 1RYSA 4NM1A 1WOTA 3OHBA 3RB0A 4KN7A 4M04A 3TARA 1UEUA 5J0SA 4YG2A 4RZRA 3QZ7A 1D8LA 1ZQKA 1QLNA 1R8CA 5KG4A 2ASDA 8ICTA 9ICRA 1R8BA 2ZH2A 2HHSA 2IMWP 3OUYB 4R65A 4J9NA 4DOAA 3SZ2A 3RJKA 2J6TA 4Z6CA 4F8RA 2HVHA 4I28A 1JN3A 2ID1A 3UQ2A 1C7YA 5J2IA 4X4SA 3WFSC 4RT3A 5KFIA 2FPKA 2XC9A 4IRCA 2XY7A 4NKUA 1LB2B 7ICHA 2DRAA 1TFRA 4Q43A 1U47A 1T4GA 4GXKA 2HHWA 4DF4A 2HHUA 4EBEA 4F2SA 1ZQFA 3M9MB 9ICJA 3UXOA 4TURA 5HRHA 3AQKA 3JPOA 5F9NA 4B9TA 4P2HA 9ICVA 2NRTA 1NOMA 4PHEA 4AT8B 2AQ0A 5J2FA 8ICLA 2KN7A 4BXOA 2A1JB 4I2AA 3QZ8A 1H38A 1TKDA 2HVIA 2KFNA 2ZHBA 5KT5A 4QZFA 4LZGA 4F4XA 4RQ7A 9ICSA 5F9LA 4J9MA 4UB3A 3EW9A 3RJFA 4FHVA 4BGDA 2R8HA 5TZVA 3HWTA 3GILA 1BGXT 9ICPA 3C2LA 4J9SA 4MFFA 4X4OA 3H4BA 4O3PA 1B43A 3BQ2A 4ECWA 3SI8A 3C21A 4DFJA 2C2EA 1D9FA 4EZ9A 4K4HA 9ICXA 4QWAA 4KLHA 8ICEA 2VA8A 4UD5A 2BPFA 5KFPA 5CR0A 4MF2A 8ICUA 3B0XA 3MDAA 3PV8A 1NZPA 3BDPA 5KFEA 1X9SA 2DRBA 2ASJA 1ZJNA 3TANA 9ICBA 3JPTA 4KLLA 9ICQA 1TAQA 4QZCA 3C1YA 5J0QA 5DQGA 3OGUA 3ZDDA 4O3RA 1KFTA 3Q8QB 3B0YA 5KFNA 3M8RA 1SKRA 4QZ8A 4DQRA 2AQ4A 4LZDA 5HHIA 3H38A 4RPZA 4HYKA 4O0IA 1NKBA 3AQNA 1U9LA 2VANA 5KFSA 4UB5A 2FLPA 8ICCA 2DVIA 4P4PA 1QSLA 1XO1A 1UA0A 3PW5A 2W9BB 1D8YA 2ZTCA 4YR0A 4ECQA 4IR9A 3OUYA 3RBDA 2FPLA 4DEZA 3OSNA 2ISOA 4BDPA 4EBDA 2W9MA 3PY8A 7ICPA 5KT3A 4E8FA 2PFNA 4J9RA 2C2DA 2ZTEA 5DGBA 4ED6A 4UBBA 4X0BA 4JV2A 3E2EA 2HHXA 4I2CA 4DS5A 3TAPA 4KTQA 3OHAA 3M8SA 4O3OA 5KT4A 2RDJA 3T3FA 4I2IA 4M9HA 2I9GA 7ICGA 2C28A 5HMMA 3PW2A 2F1IA 4XRHA 2BCVA 1JQRA 3AQMA 1NK6A 3TI0A 3PX4A 1XS9D 5KFVA 3RB3A 1Z00B 4R8UB 2W9CB 1NJYA 3ZD9A 4PHPA 3GDXA 3Q8MA 4UB1A 4M9GA 2A1JA 5KFDA 2PFQA 4ECVA 4DLEA 1DK2A 2MUTA 2DR5A 4DL3A 4ECYA 4ED1A 3RTVA 2BKEA 4IQVA 3V6HA 5KFBA 1V4AA 1NK0A 3JPQA 4DF8A 4QZHA 4I2EA 2AGOA 3T5KA 4EBKA 5DBCA 1RYRA 8ICAA 4C8OA 4R64A 1ZQZA 2ISPA 8ICXA 5HP4A 5KFFA 3PR5B 1U45A 3K4GA 2V4QA 4DSLA 4S3NA 3V72A 4F93B 3RRGA 4DOBA 2JZBB 4QWBA 2ATLA 1ZQCA 4Q44A 1SL0A 4DS4A 8ICQA 5DECA 3WFPA 3GFKB 4J9PA 3C1ZA 4LT6A 4WBYA 4ELTA 3N4MB 3HJ4A 4I2BA 5KFAA 1HUOA 2BHNA 3C5FA 2BPGA 3ISBA 1S0MA 3OVSA 7ICJA 2RFFA 5J0YA 4FHWA 2KFZA 5KG0A 4QW9A 5CA7A
chains in the Genus database with same CATH superfamily
8ICFA 4AT7B 3IM1A 4PH5A 2A1AA 9ICHA 3C5GA 4YMNA 4QZEA 1B22A 2DF4B 3AU6A 2XI9A 3Q8SB 2WB1C 3PX0A 4UASA 1ZQEA 4IRKA 1L3TA 3C28A 2G5HB 4FBTA 2GLEA 1T3QA 1DXSA 5G5HA 2E8MA 1QQ6A 3AU2A 1WWUA 3G6VA 3PO4A 5HRGA 2ZH8A 4QW8A 3UXNA 2ZIUA 1IIPA 4X4QA 2M9NA 4BX9C 3MFIA 1VDVA 2J6SA 3JPSA 3WK5A 5B66U 1SZPA 3F53A 5KFTA 4RPXA 4J9LA 4KITB 1ZQYA 3MGHA 2HW3A 3GIMA 4RWNA 2H3ZA 4FO6A 5HRIA 4X4PA 3CRXA 2KVCA 3IV6A 1ZQXA 5TISU 2DR8A 4C80A 3Q8PB 5EE1A 4B6JA 5ALVA 2BZFA 1A6SA 1BPBA 2RDIA 5DDYA 2Y0SF 5DBBA 1A0PA 2KK0A 3MR2A 9ICGA 1KNYA 4JMUA 1S77D 1FFVA 2H3FA 4QWCA 7ICQA 2ES6A 3OWGA 5D63A 2DUYA 3JPRA 4MEXA 2BPCA 3ZDEA 5CHGA 2PKEA 3NVVA 4K4IA 2IOFK 1N5XA 4PZNA 3EF2A 1HJPA 3ORYA 8ICMA 4DFMA 5J0WA 5HMLA 3BQ1A 1JX4A 4O3SA 1SXEA 3MR5A 4EYIB 2PI4A 4NLCA 1NJWA 1U48A 2DPIA 4PGYA 2M0NA 7ICVA 1KLNA 4UB8U 3K75D 2AU0A 4JV1A 3H8WA 3DV9A 4XQ8A 5AKXA 3WK7A 5AI6A 1S76D 5IINA 1RM6C 3LVVA 5J0PA 4UBCA 4J9OA 4B9NA 2W7PA 3PVXA 1D8BA 4UD4A 9ICWA 4J03A 2JR5A 2G08A 5J0XA 4FHPA 4OJPA 1MA7A 5GTIU 5HR7A 2YMQA 5D46A 2K4PA 4CDGA 4WC6A 2ZH9A 3MFHA 4ELUA 4US8A 4F4KA 2PI5A 2E8NA 4ECTA 3MABA 2UVUA 5IIMA 3OVAA 4M9LA 2CRXA 4NWIA 5DEDA 8ICZA 2WAQF 1IM4A 3ISDA 5AI4A 2HHVA 2IBKA 8ICNA 4M5DA 3WK8A 1ZD2P 4F4ZA 3SYZA 1JIHA 1PVPA 1UQVA 3SV4A 4IQWA 4FH5A 2I1QA 2NRZA 2K4IA 1NI3A 3LVWA 5HRKA 3ZI4A 1TE2A 2XCAA 4IG8A 1SGGA 9ICAA 3TKAA 4Q8FA 1MSWD 4RPYA 1SV0A 3GV5B 4X5VA 1T94A 2B51A 2F8KA 5DLGA 4OJ6A 1SKWA 4NL9A 4PHDA 3KKAC 3PSIA 4DL6A 4RU9A 4XUSA 5KFYA 2UVWA 5CEHA 3G6YA 2NRKA 1Q46A 1QQ7A 1ZOLA 4RQ5A 4KLUA 1FA0A 4I27A 9ICKA 4YMMA 3J81j 3T5LA 4FS2A 2Q66A 2IOFA 5HRFA 1SWVA 1ZQLA 1XU4A 5KFWA 4WC1A 1NJZA 1L3SA 4WQKA 4UQGA 1WG8A 4FZLA 1XSPA 2D8CA 1PK1A 2EWRA 4Y2RA 5EOZA 1X9WA 4MKPA 4YQWA 1GO3F 3UM9A 4I0UA 3NRWA 3FM9A 3N28A 3OVBA 1BNPA 1JXEA 4O5EA 2A3VA 1VJ5A 7ICMA 5JTIA 3GIIA 2EH9A 4NXTA 4C7ZA 4ECSA 3WK9A 4ED3A 1N62A 2VKQA 3RH4A 4WC3A 1S0NA 2ZUDA 4ECXA 4LT6A 3TADA 5KFHA 3Q8KA 3KHRA 1Z3EB 3TACB 4HX0A 2QARA 3HRDD 3OJUA 5FP0A 1PZNA 5L1JA 1KSPA 2Y0SC 2HOIA 5DQHA 1ZQDA 2Q4TA 3LQCB 2KZMA 1N56A 3RJGA 1LVHA 1T8EA 4WC0A 4F4WA 2JEGA 3LWLA 3GQCA 2LYBA 3D2SA 2ZH7A 1BPYA 1KL9A 3QNMA 4J9QA 1COKA 5DB6A 2Y9TA 4PGQA 3CYMA 5JRTA 4U7CA 1X42A 2NYVA 4M0AA 2O1PA 1SL1A 3PSPA 4EEDA 3KOOA 2XICA 4O68A 3ZDBA 2F3NA 1WOTA 3OHBA 4M04A 2E1FA 1QLNA 1R8CA 1R8BA 4QIWF 2JH1A 5KG4A 2ASDA 5CFTA 5JTGA 4OD0A 4R65A 4I28A 1UHUA 5ALUA 4UARA 1C7YA 2ID1A 3SAFA 7ICHA 2HHWA 1ZQFA 3JPOA 5F9NA 4P2HA 3CK6A 1NOMA 4AT8B 2AQ0A 1ECWA 2A1JB 3QZ8A 4QZFA 4LZGA 9ICSA 4J9MA 1FEZA 2R8HA 3HWTA 3WKBA 4PL2A 2C2EA 3PHZA 4U6PA 5CR0A 4MF2A 3PV8A 1X9SA 2WAQC 3GZFA 1KN5A 5J0QA 1KFTA 1Q8KA 3Q8QB 3M8RA 4DQRA 4LZDA 2KE7A 1ZD4A 3AQNA 4UB5A 2FLPA 4P4PA 2W9BB 3I76A 4RQMA 2RP5A 2KSOB 4KMOB 2C2DA 2ZTEA 2WHEA 4X0BA 3UMCA 5GTHU 4JV2A 4KTQA 3M8SA 3T3FA 3AQMA 2L5YA 2QKQA 4G9BA 3F2BA 2BCVA 1JQRA 3GDXA 2A1JA 4ECVA 2MUTA 4ECYA 2BKEA 3V6HA 5KFBA 2DBYA 2W11A 1V4AA 4PZOA 4ICAA 4LEWA 2AGOA 4R64A 4EX7A 5HP4A 2AHOB 2MSNA 2A19A 3V72A 4F93B 3HILA 3HJ4A 1NZBA 5ALEA 3WKAA 3NVZA 2KJ5A 5J0YA 1Z1BA 2KFZA 1F5AA 3RFAA 1MQ3A 1PVRA 1NKCA 1X6IA 3NRZA 1L3VA 3ZDCA 1MC8A 1PX5A 3PSFA 4X4TA 2NV3A 4F2RA 5AKIA 3QUBA 3PZPA 8ICSA 3SAGA 3FAHA 2PMZC 4MHVA 4I2HA 2HHPA 1XC9A 5ALLA 3H40A 4C4SA 1JAJA 5KT7A 2FPMA 4IS7A 4WQLA 1KDHA 4EGWA 4QZBA 1WYGA 1OXJA 2M2UA 2V9WA 2B21A 5J0RA 1NNLA 2KIVA 4NLKA 3ER9B 1ZQSA 4OJLA 5CRXA 1NKEA 4NXWA 2E8OA 2F1HA 4WC2A 1WWVA 1Z19A 4ATBA 4CE6A 4K9BA 7ICTA 2ZXHA 1M6YA 1Q79A 1DGJA 3RB4A 4RQ6A 4DL5A 4RQ2A 3M6ZA 3N97B 2W03A 2HHQA 4US9A 4JLZA 4RNOA 2G5IB 1BPEA 4NXXA 1MQ2A 2IA6A 4K96A 2ZTDA 1S5LU 4AT9B 4Y2TA 2GH1A 4JK1A 3SENA 1UA1A 2FLLA 1Q3VA 4N7RA 4B9LA 5CFSA 2ZIWA 1PVQA 4Q45A 3DDHA 2PFPA 4UAZA 4PHAA 5D62A 8ICWA 2MAXA 3TADC 9ICIA 2BBJA 4DO9A 2JXJA 4QZAA 3RR8A 3WK4A 2OHFA 4F92B 5KFZA 3D2QA 3H0LB 5C5JA 1DK3A 2LM1A 5KAFU 2NRVA 3IP4B 3BQ0A 3H39A 3D2NA 1ZRMA 4YCXA 3RR7A 5IIOA 5ALKA 3NKUA 3KBBA 3QU2A 1ZQUA 1B0XA 4TUSA 1A76A 3M9OB 5KG3A 1RDFA 4FHXA 4JLXA 9ICFA 4BJQA 3GV7B 1CEZA 4PPXA 5J2HA 4YXJA 4DSFA 3EYZA 4F5OA 3TFRA 3UQ0A 2YMLA 5AM1A 2W8LA 3GIKA 5K4LA 3RJEA 1V85A 1KFDA 4YVZA 4JWMA 4IQTA 2BCQA 9ICBA 4LVSA 4AYBF 4P0PB 4YXMA 3TAQA 5ALQA 5J2GA 4Y2VA 1CI4A 4I2GA 4QWEA 3WFOA 1NK8A 4RQ8A 2Y1JA 1ZRNA 2KG5A 4DSJA 5KFOA 1QQ5A 5AKYA 4DQSA 5HRBA 1WCLA 3NASA 5BOMA 5KG7A 3H4DA 4FE3A 3H0MB 4QNLA 5DB9A 2BDPA 4I2FA 1QSYA 2ZHAA 5L1IA 3C18A 3LDAA 5EWGA 1QH9A 2DKZA 4I2JA 5BOLA 5L1LA 4M47A 4WCWA 1N63A 1OU5A 4QZIA 4E80A 1NK9A 4GXJA 3FDSA 3QU7A 5HHHA 5E79U 3IDWA 1JROA 3KHLA 1ZQBA 2DWQA 3S6JA 4AT7A 4NXZA 2ZJ5A 4MEYA 4EZ6A 1ZQVA 2GOLA 1K1SA 2OM6A 3PNCA 4K99A 4DSIA 1K1QA 5DQIA 2KMDA 2XY5A 9ICOA 7ICUA 4EEYA 5ALPA 3AN1A 1J2NA 7ICSA 2PFOA 2F44A 7ICRA 4OAHA 5KFQA 2KIWA 4XJEA 3THVA 2KJ8A 4X4UA 1MIYA 5AIBA 4NLGA 2ESEA 2QB0B 2W54A 4DL7A 3T79A 3MCRA 2IHNA 5B3QA 3NWIA 5CP2A 2PBEA 1RG6A 4EYHB 5BPCA 5ALFA 3K7DA 2HBKA 3HT3A 1BPDA 3BZCA 4EBJA 2LBOA 2HDOA 3D6JA 2LM4A 4FS1A 3HP6A 4MFCA 2G07A 1KEJA 5KFRA 3EPGA 1X2IA 2K8AA 9ICMA 2JEIA 1C20A 1JUDA 2IHMA 5AM3A 4DLGA 3M9NB 3E58A 3BS5B 3T5JA 3GU3A 3V7KA 5KT2A 4OAGA 1F0MA 5AKGA 3MR6A 3H8SA 4RQ0A 5AKJA 1JALA 4ECUA 3R9KA 2FLNA 2P35A 4F50A 1IG6A 5D61A 3HJEA 5KFUA 1YLQA 3LWMA 3ONNA 4IR1A 2ZH4A 4OAIZ 3KHHA 2WF6A 1ZQHA 4BXOB 5KG5A 4IC9A 3LYSA 3K1RB 5D49A 4B9SA 4IQUA 5CFUA 2AXTU 1O03A 2VJ5A 4C4RA 4LEZA 2ZH5A 5KFJA 3RBEA 4ED2A 1ZQAA 4K9AA 3QYPA 5EE0A 1Z4NA 4YN4A 2ALZA 1CRXA 4C8LA 5DG8A 5F2VO 4BWMA 2W9AA 1X40A 2BCRA 1RYSA 4NM1A 1D8LA 2ZH2A 8ICTA 9ICRA 3OUYB 5AK4A 3SZ2A 2J6TA 4F8RA 3UQ2A 3CNHA 5KFIA 2FPKA 5KAIU 4NKUA 2G0AA 5H2FU 2DRAA 5AM2A 1YT3A 2ZIXB 2F77X 3N7RC 9ICJA 2AH5A 5HRHA 9ICVA 2NRTA 3QUTA 4PHEA 2KN7A 4BXOA 4I2AA 1H38A 2KFNA 4F4XA 3EW9A 4BGDA 5TZVA 3GILA 4OJOA 4AYBC 3C2LA 4O3PA 3SI8A 4K4HA 2F2AB 4K8VA 8ICEA 3B0XA 1NZPA 3MDAA 2IHOA 1FFUA 5ALNA 3TANA 4KLLA 2W43A 3DEEA 3ZDDA 5DQGA 3AQFA 5KFNA 2AQ4A 2K89A 4HYKA 1NKBA 1U9LA 2VANA 2FE9A 5KFSA 8ICCA 1GPJA 3PW5A 4FFDA 4YR0A 4ECQA 3OUYA 2FPLA 3PY8A 4E8FA 2OCEA 2PFNA 4J9RA 5DGBA 4UBBA 3E2EA 5ALTA 4I2CA 5ALIA 1SWWA 3TAPA 4MFFA 1RYUA 5KT4A 2RDJA 4I2IA 4KM5A 2C28A 3PW2A 3PX4A 5KFVA 4CF5A 1Z00B 4R8UB 2W9CB 1NJYA 4PHPA 9ICCA 2G06A 5KFDA 1DK2A 4DLEA 5J8YA 4IQVA 2RQ5A 4Y2XA 3JPQA 4DF8A 4I2EA 8ICAA 1RYRA 2H3QA 2ZG6A 8ICXA 1U45A 5L1MA 3K4GA 4DOBA 2JZBB 2ATLA 5DECA 2OYYA 8ICQA 3WFPA 4J9PA 3C1ZA 4ELTA 3N4MB 2BHNA 3C5FA 3ISBA 1S0MA 3OVSA 7ICJA 4FHWA 3L3FX 5KG0A 5CA7A 2OH2A 5KFGA 4KN4A 1CUKA 2BQRA 3I28A 1VJ7A 1RXVA 5KFMA 4KLGA 4YD1A 3Q8LA 2EDUA 5J0OA 1ZQJA 2AGPA 2FMSA 4KLJA 5AM5A 2HOFA 1KQQA 3QUQA 5HC9A 2VJ4A 1UCVA 3SQIA 1Z00A 2W9CA 8ICIA 5KL1B 1YZ6A 4X4VA 4ED7A 3SD7A 3V7LA 2YX8A 3JPPA 1SZHA 2KICA 4KX5A 5DLFA 2M2TA 1DGSA 3NTUA 2KEYA 2KV2A 5ALMA 1ZXIA 4DL2A 2WTFA 5B5EU 3NYBA 4NLNA 5EE9A 4MF8A 3PW7A 1TV9A 4C7YA 3AEVA 2BGWA 2E5SA 3C2MA 3V7JA 2R18A 4M6WB 1KKXA 4YR3A 2V4RA 2FI1A 2YN4A 2HN2A 5KG6A 3SMVA 4F5NA 1MIWA 4RNNA 5EE3A 1J2MA 1MN8A 5ALSA 1T7PA 1BVSA 2H3IA 4O69A 5KTQA 4Y2JA 3MGIA 2BQUA 4XA5A 2FMQA 5KFXA 4JV0A 4CCHA 3EPIA 1X66A 5DKWA 4MFAA 4JUZA 4TQRA 3V6JA 1L5UA 1ZQQA 4O5KA 4KLMA 4ECRA 4RWQA 2YY6A 3GV8B 3BS7A 5EWFA 1Z1VA 1L7NA 4AT8A 4JB3A 2W3SA 2WB1F 5KFLA 4UB4A 7ICFA 1TFYA 2ZJ8A 3ZD8A 3JPNA 4M9JA 4UAVA 5EWEA 1ZQOA 2NRWA 5AI0A 2B4VA 3EZ5A 4M6WA 4R66A 5HR6A 2G09A 4FZNA 5CWRA 2VA3A 1DRGA 2D6FC 3EUB2 4DQIA 1N5WA 2ZJAA 2E3TA 3KHGA 4G3IA 9ICNA 2B6GA 3PX6A 4KLTA 3QU9A 1COOA 4WC7A 4NXVA 4Z6FA 1S0VA 5AKEA 4FZMA 5DGAA 5KT6A 5HNKA 2W9BA 1AROP 1IXRA 4DSEA 3B9JA 1Q78A 2GO7A 4O67A 2YB1A 2KSOA 3ETLA 5L1KA 5J2AA 4KLDA 2VIXA 3Q8RB 5AI8A 2JRZA 2RHFA 3AM9A 2BCUA 2HMXA 1SV0C 4F91B 5J0TA 1LKYB 3UPQA 1TVAA 3AQLA 4F71A 3N7PD 1KRPA 2RRDA 3H3AA 7ICOA 4RUAA 2EAPA 4X0AA 3H0RB 4NL9C 5AHXA 1KFSA 3RRHA 1A77A 3HIYA 1JMSA 4ZH4A 1RZTA 3ALRA 3JYYA 4OAFA 4RWPA 3G6XA 1XSLA 1NJXA 3HJ1A 4ED8A 2EZXA 3BQTA 2ZUBA 4C0ZA 4WBZA 3F5EA 1SV4A 2FMPA 2YB4A 1S10A 3WFQE 1EXNA 4P4OA 1VFGA 4F5RA 4DSKA 5ALYA 4EELA 5KFCA 4KLFA 4NXUA 2E1EA 2YMPA 2P6RA 4NM2A 1LKYA 1ED1A 2LHTA 3HW8A 4C4TA 4B9UA 3UXPA 5AKKA 5DB8A 2BQ3A 5J2DA 2AJQA 3MR3A 4LJXA 5IILA 1TK0A 4PJ0U 4QIWC 2JEFA 4ECZA 3QEBZ 3FC4A 1QTMA 1U4BA 5CHEA 5J2JA 3PW0A 5HRLA 3L9DA 1TK5A 9ICUA 1TFWA 4C8KA 2KHVA 4F5QA 4B9MA 2EAOA 4EV6A 2KZZA 3RJIA 2DR7A 3L5KA 3BQ7A 5ALGA 1J97A 1RQNA 2Y1IA 4K4GA 1R8AA 3NS1A 4YR2A 4UB2A 4K98A 4FHYA 1RPLA 4OJ5A 5J2KA 4F4YA 3RJHA 2WFAA 4ED0A 1QSSA 2Z7JA 5KG2A 2H5XA 1S97A 4AT9A 3K1ZA 4I2DA 4DCCA 8ICVA 3FYHA 2BE3A 1Q3UA 2KKVA 3BZKA 4M9NA 3NVOA 4NLBA 3M7DA 1P7DA 3RF9A 3PMLA 4Z6EA 5HRDA 4DWIA 2WF8A 3OTQA 1NK4A 8ICHA 1V9PA 2FDRA 1ZQWA 4C8NA 1Y88A 4DQPA 1YZ7A 2M2WA 3IG8A 8ICGA 4RQ3A 4QZ9A 4B9VA 4E0DA 5ALWA 3PR4A 1ZQTA 1B4FA 5IIJA 3QU5A 5IIKA 3RH5A 3GIJA 1S0OA 4GLXA 4F5PA 4FH3A 3KZIU 2AGQA 1Z4OA 1ZQRA 2DPJA 4KN7A 2CN1A 3TARA 1X6JA 5J0SA 3QZ7A 1K5OA 1ZQKA 2IMWP 4J9NA 4DOAA 3RJKA 2HVHA 1JN3A 2DL0A 4X4SA 4RT3A 4CRXA 2XC9A 1LB2B 2YMMA 1ZD5A 4Q43A 1T4GA 2JGAA 1JI7A 4DF4A 4EBEA 4F2SA 2W3RA 3M9MB 4P0PA 4UAUA 3AQKA 2BDUA 4B9TA 3JCFA 4P0QB 5J2FA 2K8BB 1L7MA 2HVIA 2ZHBA 4RQ7A 4UB3A 3RJFA 3SAHA 1N2XA 2F76X 3H4BA 4ECWA 3A0HU 1D9FA 9ICXA 4DFJA 4KLHA 2K8CB 3F5AA 4UD5A 2VA8A 1O08A 2KVSA 5KFEA 4NJ8A 3NVYA 2DRBA 1ZJNA 4F72A 5AK6A 3KD3A 4NV0A 5HHIA 4O0IA 4EENA 1WUDA 5ALRA 2DVIA 3AQEA 2ZTCA 4DEZA 4BDPA 3OSNA 2ISOA 2B56A 4Y2QA 4ED6A 4DS5A 3U26A 3OHAA 4O3OA 1F44A 4M9HA 2I9GA 4LEVA 5HMMA 4OCZA 2F1IA 4XRHA 3SEIA 1NK6A 3TI0A 3RB3A 4P0QA 3ZD9A 2PFQA 2DR5A 4DL3A 4ED1A 4O6AA 2HBMA 1NK0A 2K60A 2MRLA 4QZHA 4EBKA 3ERCC 4C8OA 2KJ9A 2ISPA 5KFFA 3PR5B 3M6KA 2QB0A 3ER8C 4QWBA 1ZQCA 4Q44A 1SL0A 2ZIVB 5T14A 2I5HA 5KFAA 1HUOA 4EEKA 3WU2U 2GAFD 3RRGA 4QW9A 2GA9D 5ALXA 7ICEA 4CGZA 4DOCA 5DDMA 2FJ6A 2XIDA 3BJYA 2ZH1A 3LK9A 3H37A 2HN1A 1TK8A 4EX6A 3PW4A 2ZXIA 3C29A 1ZQPA 2LYAA 2W55A 2XGPA 3QXGA 4Y2YA 3VCBA 2CXYA 2LI6A 3BS5A 3HKZF 5AK5A 4UAWA 1T3NA 3SR6A 1D9DA 4WJ3B 1UETA 1L7PA 3RH6A 5F3XB 1PK1B 2LPEA 1MIVA 3PMNA 2ZIVA 4UATA 4GC6A 3WKEA 2JMGA 4RQ4A 3NGDA 4YFKA 5AM0A 5AKLA 4NY8A 8ICPA 4O3NA 1BPZA 2ODGA 2P66A 1LV5A 3RJJA 4C8MA 4FO1A 1XO0A 8ICBA 5JUMA 4F3OA 1SKSA 3CP8A 4GXIA 5KFKA 5ALOA 1NO5A 5AKHA 3HX0A 5JU5A 4R63A 7ICIA 5HREA 1UT5A 2KHQA 2JEJA 2QARB 3QEAZ 4DL4A 2HI0A 4TQSA 1JXLA 4KLOA 2EAMA 2EZZA 3PO5A 1IV8A 4QZGA 3QUCA 3IHQB 2YQEA 2R8KA 1ZQIA 5ALDA 2OWOA 3NUQA 1U49A 4O9MA 3WKCA 5IIIA 4TUQA 3C2KA 2VA2A 4M2YA 3RAXA 3RAQA 5AIAA 4WOYA 1WCNA 2ZIXA 4J9KA 5AK3A 3H7IA 3PSTA 3M1YA 4FBUA 3JZ0A 2P6UA 3SV3A 1L3UA 3MGVA 2PMZF 3IG5A 4O3QA 2WF7A 2EZYA 3TFSA 4BWJA 4QJFB 1NK7A 1UPHA 4CF3A 2J6UA 4PL1A 2C22A 3C66A 1ZQGA 2D3DA 2KZ3A 4YD2A 2DQNB 3O0FA 4UAYA 2F1JA 1R89A 4EEBA 4LEYA 5D4BA 2KP7A 4HAIA 4X4NA 1VLBA 1SB3C 5CB1A 2W8KA 1X9MA 2BR0A 1SL2A 3IRUA 1BNOA 2H3VA 4P4MA 1ZYQA 1XNSA 1FIQA 2E8PA 4YMOA 3ICXA 5J2CA 4OO1J 4XQ7A 4NKTA 2PXIA 2GWSA 1ZQNA 1KTQA 9ICLA 4ACOA 2LKYA 1SXDA 2KKPA 2ZUCA 1BPXA 2LMRA 3F2DA 1TAUA 2R8IA 5DBAA 3HPOA 4RNMA 1KW4A 2W04A 2HSZA 1FO4A 2EANA 2XGQA 4KMUA 2DGZA 2IOHA 4R8UA 2LYHA 5ALJA 3EWAA 4CF4A 4IRDA 5J2BA 4E7XA 4O5CA 4DFPA 2XY6A 4WC5A 2B0CA 3MC1A 2BCSA 7ICLA 4QZDA 1N61A 5DG7A 1OUQA 4K97A 2XVTA 4KLQA 3T5HA 2ASLA 2JZBA 4KB6A 5AI9A 4RWOA 5G5GA 7ICKA 4DFKA 2RLTA 3QX7A 1N48A 2O5AA 1PK3A 3KZXA 2MU2A 4YP3A 4WC4A 3QE9Y 4RUCA 4Z6DA 2UVVA 4UW9A 2ZH3A 2DFLA 3UMBA 4EBCA 4A8EA 5DB7A 1QCKA 2XO7A 3OPXA 3CW2C 2MUTB 1KBUA 4NLZA 3C23A 1V97A 4USAA 1ZQ1C 4BUGA 4RT2A 3OV7A 2ZH6A 3OSPA 1RXWA 2NRXA 1L6NA 4TUPA 4KLIA 3WK6A 3HKZC 3ISCA 2KTQA 3RB6A 1NK5A 1UEVA 4ELVA 3MBYA 4Y2SA 1HEKA 4WH5A 3TQ1A 4KLEA 8ICJA 1PUZA 2Y9UA 1DOQA 4QWDA 1HUZA 3H8JA 2R8JA 2I6XA 1ZD3A 2WF5A 2EQYA 3E0FA 2HBLA 3NVWA 3I1YA 5J2EA 4AP9A 4KX3A 3MDCA 2JV3A 3AUOA 1ZJMA 3ZDAA 4EP7A 8ICYA 5CJ7A 5DG9A 9ICTA 2M2VA 4PGXA 1XSNA 2XCPA 2N1RA 4X4RA 8ICOA 2DR9A 9ICEA 2QB1A 1OW5A 1ZQMA 4RQNA 7ICNA 1URJA 5B3PA 3N7SC 1UT8A 1V38A 2KNJA 5J0UA 3H8MA 2R8GA 4DFDA 3WFRE 2JHDA 4DQQA 3WKDA 3KTQA 2C2RA 2Q0ZX 3OJSA 1L8LA 5AKZA 4ATBB 4RQ1A 3AL0B 4Y2PA 1L7OA 2HHTA 2DKXA 1HIWA 3V6KA 1ZETA 5HR9A 1SIJA 5L9XA 4Q8EA 1S9FA 4KLSA 4O3MA 8ICKA 3UPSA 5KG1A 4IL6U 2MA1A 1XWLA 4I29A 5ALZA 5AM4A 4GIBA 4Y2UA 4GC7A 8ICRA 4JWNA 5J29A 2ZIWB 3IN5A 3RB0A 2NO5A 2YTUA 1UEUA 4YG2A 4RZRA 2HHSA 1F5SA 4Z6CA 2BBHA 5J2IA 2JH7A 3WFSC 2W7OA 4IRCA 2XY7A 2NO4A 1TFRA 1U47A 3A0BU 4GXKA 2HHUA 3UXOA 4TURA 2OEHA 4GFJA 3L4PA 5C0YA 8ICLA 2OXOA 4CNQA 2CPRA 1TKDA 5KT5A 2QLTA 5F9LA 5AICA 4FHVA 1BGXT 9ICPA 4J9SA 5KL8B 4X4OA 4EZ9A 1B43A 3BQ2A 3C21A 1N60A 4QWAA 1X9XA 4ZOHC 3VC8A 2BPFA 1L8OA 1S8OA 5KFPA 8ICUA 1AQ6A 3BDPA 5J8YC 2ASJA 2HBJA 5AI5A 3JPTA 2HCFA 1TAQA 4QZCA 9ICQA 3C1YA 4O3RA 3OGUA 3B0YA 1SKRA 4QZ8A 5ALHA 3KFUF 3H38A 4RPZA 3QU4A 4UB6U 2FCLA 2K4HA 2HOQA 1QSLA 1XO1A 1UA0A 1D8YA 3KKAA 3F2CA 4IR9A 3RBDA 1TAMA 4EBDA 2W9MA 3UMGA 7ICPA 5KT3A 3ED5A 1RQLA 2KOBA 2F8LA 2HHXA 5A0LA 7ICGA 2O6KA 1XS9D 2UVRA 3Q8MA 4M9GA 4UB1A 3RTVA 2ZIUB 3T5KA 5DBCA 1JRPA 1ZQZA 2V4QA 4DSLA 4S3NA 3AMZA 2KD1A 4DS4A 3ETRA 3GFKB 4WBYA 4I2BA 2IUBA 2BPGA 2WF9A 2K4EA 2RFFA 5KNIA
chains in the Genus database with same CATH topology
8ICFA 1F5AA 5KFGA 3IM1A 1MQ3A 4AT7B 4KLOA 7ICEA 4PH5A 4DOCA 4KN4A 1NKCA 9ICCA 1CUKA 2BQRA 5DDMA 1L3VA 1MC8A 3ZDCA 9ICHA 1PX5A 3C5GA 4YMNA 1VJ7A 4QZEA 5KFMA 1RXVA 4KLGA 4X4TA 4YD1A 3Q8LA 1B22A 5J0OA 3BJYA 1ZQJA 2ZH1A 3LK9A 3H37A 2AGPA 2FMSA 4F2RA 3AU6A 3Q8SB 4KLJA 3PX0A 1ZQEA 4ELUA 1TK8A 4IRKA 8ICSA 3PW4A 1L3TA 5HC9A 1ZQPA 4I2HA 4FBTA 1Z00A 2W9CA 8ICIA 2XGPA 2HHPA 1XC9A 3H40A 1JAJA 5KT7A 2FPMA 4X4VA 4ED7A 4UAWA 1T3NA 1D9DA 3AU2A 1KDHA 3V7LA 4QZBA 3G6VA 3PO4A 2M2UA 1UETA 2V9WA 5HRGA 2ZH8A 4QW8A 3JPPA 2B21A 3UXNA 3RH6A 4X4QA 2M9NA 3MFIA 5J0RA 5DLFA 2M2TA 4NLKA 1DGSA 2J6SA 3JPSA 1ZQSA 3NTUA 1MIVA 3PMNA 4DL2A 2WTFA 1SZPA 3NYBA 4NLNA 4MF8A 1NKEA 2F1HA 3PW7A 4WC2A 1TV9A 5KFTA 4GC6A 4RPXA 4ATBA 4J9LA 4KITB 4RQ4A 1ZQYA 7ICTA 3NGDA 3MGHA 2BGWA 2HW3A 1Q79A 3C2MA 4YFKA 3GIMA 4RWNA 4NY8A 3RB4A 4RQ6A 8ICPA 4DL5A 4RQ2A 3N97B 4O3NA 4FO6A 2HHQA 3V7JA 5HRIA 1BPZA 4X4PA 4M6WB 4RNOA 1ZQXA 2P66A 1BPEA 1LV5A 4YR3A 2V4RA 3RJJA 4C8MA 2DR8A 5KG6A 1MQ2A 8ICBA 5JUMA 4F5NA 1SKSA 4RNNA 4F3OA 4GXIA 1MIWA 5KFKA 3Q8PB 1NO5A 4R63A 1BPBA 2RDIA 5DDYA 2ZTDA 3HX0A 5DBBA 1UT5A 1BVSA 3MR2A 1T7PA 7ICIA 9ICGA 5HREA 1S77D 1KNYA 4AT9B 4JK1A 1UA1A 2FLLA 4QWCA 7ICQA 4B9LA 2JEJA 4Q45A 3QEAZ 4DL4A 5KTQA 2PFPA 4TQSA 4UAZA 3JPRA 1JXLA 3MGIA 4MEXA 4PHAA 2BQUA 4XA5A 2BPCA 5KFXA 4JV0A 2FMQA 2MAXA 3ZDEA 3EPIA 5DKWA 4CCHA 4MFAA 8ICWA 9ICIA 5CHGA 3PO5A 4JUZA 4TQRA 4JWMA 3V6JA 4DO9A 1L5UA 4K4IA 1ZQQA 4QZGA 3IHQB 4QZAA 2R8KA 3RR8A 1ZQIA 4O5KA 4KLMA 4F92B 5KFZA 1HJPA 3ORYA 2OWOA 1U49A 4ECRA 4O9MA 5IIIA 5C5JA 4TUQA 3C2KA 2VA2A 4M2YA 8ICMA 4DFMA 4RWQA 3RAXA 3RAQA 3GV8B 3BQ0A 1DK3A 2NRVA 1WCNA 5HMLA 5J0WA 5EWFA 4J9KA 3H7IA 3H39A 3BQ1A 1JX4A 4AT8A 4O3SA 3MR5A 4EYIB 2PI4A 4YCXA 4FBUA 1NJWA 1U48A 3JZ0A 3RR7A 2P6UA 5IIOA 5KFLA 3SV3A 1L3UA 2DPIA 4UB4A 7ICFA 1TFYA 2ZJ8A 1ZQUA 4O3QA 3ZD8A 3JPNA 4PGYA 4M9JA 7ICVA 5EWEA 1ZQOA 1KLNA 2NRWA 4TUSA 3K75D 3TFSA 2AU0A 3H8WA 4BWJA 3EZ5A 4JV1A 4M6WA 1A76A 1NK7A 4R66A 2J6UA 2C22A 3C66A 4XQ8A 1ZQGA 2KZ3A 3M9OB 4YD2A 1S76D 5CWRA 5IINA 5KG3A 5J0PA 4UBCA 4J9OA 4UAYA 2F1JA 2VA3A 4B9NA 4FHXA 3PVXA 1R89A 9ICFA 3GV7B 5D4BA 4DQIA 2KP7A 4UD4A 4X4NA 1CEZA 2ZJAA 5CB1A 3KHGA 2W8KA 1X9MA 2BR0A 4G3IA 9ICNA 1SL2A 3PX6A 4KLTA 9ICWA 4P4MA 1BNOA 1ZYQA 4PPXA 5J2HA 1COOA 4YXJA 4WC7A 4Z6FA 1S0VA 5J0XA 4FHPA 4DSFA 3EYZA 5DGAA 5KT6A 5HNKA 2W9BA 4F5OA 3TFRA 1AROP 2IA6A 3UQ0A 4YMOA 1IXRA 5J2CA 4DSEA 2W8LA 5D46A 4WC6A 3GIKA 1Q78A 3RJEA 4XQ7A 2ZH9A 1KFDA 4NKTA 3ETLA 4YVZA 3MFHA 4IQTA 2PXIA 5J2AA 5L1KA 1ZQNA 1KTQA 2BCQA 2GWSA 3Q8RB 2PI5A 4F4KA 4KLDA 2BCUA 4ECTA 3MABA 4YXMA 3TAQA 2UVUA 4LVSA 5IIMA 1BPXA 2ZUCA 5J2GA 4I2GA 4F91B 5J0TA 1TAUA 3OVAA 2R8IA 5DBAA 3HPOA 4QWEA 4RNMA 3UPQA 1TVAA 4M9LA 1NK8A 3AQLA 3WFOA 2XGQA 4RQ8A 1KRPA 4KMUA 3H3AA 7ICOA 4RUAA 5DEDA 4R8UA 2Y1JA 2LYHA 8ICZA 3EWAA 4X0AA 4IRDA 1IM4A 5J2BA 3ISDA 4DSJA 2HHVA 4E7XA 1KFSA 5KFOA 2IBKA 4O5CA 3RRHA 4DFPA 2XY6A 4DQSA 8ICNA 4M5DA 4WC5A 5HRBA 4F4ZA 1WCLA 5BOMA 1A77A 5KG7A 3SYZA 1JIHA 2BCSA 3H4DA 7ICLA 3SV4A 4IQWA 4QZDA 3HIYA 5DB9A 2BDPA 1JMSA 4ZH4A 5DG7A 4I2FA 4FH5A 1RZTA 2I1QA 3JYYA 1QSYA 4RWPA 2ZHAA 3G6XA 2NRZA 5L1IA 4KLQA 3C18A 1XSLA 3LDAA 3T5HA 2ASLA 5EWGA 2JZBA 1NJXA 3HJ1A 4I2JA 5BOLA 5L1LA 4ED8A 3BQTA 4M47A 4WCWA 1OU5A 4RWOA 5HRKA 4QZIA 2ZUBA 7ICKA 4DFKA 4E80A 1NK9A 4GXJA 2XCAA 4IG8A 1N48A 4WBZA 9ICAA 3FDSA 4Q8FA 1MSWD 4RPYA 5HHHA 2O5AA 3GV5B 4X5VA 2FMPA 1S10A 3WFQE 1EXNA 4P4OA 3KHLA 1VFGA 1ZQBA 4F5RA 4DSKA 4YP3A 4AT7A 4WC4A 4NXZA 2ZJ5A 5DLGA 4MEYA 5KFCA 3QE9Y 4RUCA 1ZQVA 4Z6DA 2UVVA 1SKWA 4EZ6A 3PNCA 1K1SA 4PHDA 4KLFA 2ZH3A 4DL6A 1K1QA 2DFLA 5DQIA 4RU9A 4EBCA 2XY5A 4DSIA 7ICUA 9ICOA 2P6RA 4XUSA 5KFYA 4NM2A 5DB7A 2XO7A 4EEYA 2UVWA 3G6YA 2NRKA 7ICSA 2MUTB 4RQ5A 4KLUA 1FA0A 2PFOA 4I27A 7ICRA 3HW8A 9ICKA 5KFQA 4YMMA 4NLZA 4B9UA 3THVA 3C23A 3T5LA 4FS2A 2Q66A 3UXPA 5HRFA 4X4UA 4RT2A 1MIYA 1ZQLA 5DB8A 2BQ3A 1XU4A 5KFWA 4WC1A 1NJZA 1L3SA 3OV7A 4NLGA 5J2DA 2AJQA 2ZH6A 4UQGA 3MR3A 3OSPA 1RXWA 2NRXA 4DL7A 4TUPA 4KLIA 1XSPA 5IILA 1TK0A 3ISCA 2JEFA 2IHNA 2KTQA 3RB6A 5EOZA 1NK5A 5CP2A 1X9WA 2PBEA 4YQWA 4ECZA 3QEBZ 1QTMA 4ELVA 1UEVA 4EYHB 3MBYA 1U4BA 5BPCA 5J2JA 3TQ1A 3PW0A 4KLEA 8ICJA 5HRLA 3HT3A 1DOQA 4QWDA 1TK5A 3L9DA 1HUZA 1BPDA 3H8JA 4C8KA 9ICUA 1TFWA 2R8JA 4EBJA 4F5QA 4B9MA 1BNPA 1JXEA 4O5EA 7ICMA 3OVBA 4FS1A 3GIIA 3HP6A 2KZZA 3RJIA 2UVRA 4MFCA 2DR7A 4ECSA 3AUOA 5J2EA 3ZDAA 3MDCA 1ZJMA 4ED3A 3RH4A 4EP7A 4WC3A 2Y1IA 1S0NA 4K4GA 1KEJA 5CJ7A 8ICYA 1R8AA 5KFRA 5DG9A 3EPGA 2ZUDA 4YR2A 1X2IA 4UB2A 4PGXA 1XSNA 4ECXA 9ICTA 2M2VA 9ICMA 5KFHA 1RPLA 2XCPA 2JEIA 4FHYA 5J2KA 4F4YA 3RJHA 2IHMA 4ED0A 3Q8KA 8ICOA 4DLGA 3KHRA 1QSSA 4X4RA 5KG2A 2H5XA 3M9NB 1S97A 4AT9A 2DR9A 1Z3EB 3T5JA 1ZQMA 4I2DA 9ICEA 3V7KA 5KT2A 8ICVA 3FYHA 3MR6A 2BE3A 3H8SA 4RQ0A 3OJUA 7ICNA 4ECUA 2FLNA 1PZNA 5L1JA 4F50A 1KSPA 1UT8A 4M9NA 5KFUA 5J0UA 5DQHA 1ZQDA 3LQCB 2KZMA 1N56A 3RJGA 1T8EA 1YLQA 2R8GA 3PMLA 4WC0A 3WFRE 4F4WA 4DQQA 4Z6EA 3LWMA 2JEGA 9ICLA 3KTQA 4DWIA 5HRDA 4IR1A 2C2RA 2ZH4A 3LWLA 3KHHA 2Q0ZX 3OJSA 1NK4A 8ICHA 1V9PA 1ZQWA 1ZQHA 4ATBB 4C8NA 4RQ1A 4BXOB 5KG5A 1Y88A 3GQCA 4DQPA 2HHTA 2ZH7A 1BPYA 2M2WA 3V6KA 8ICGA 1ZETA 5D49A 4RQ3A 4QZ9A 4B9VA 5HR9A 4B9SA 4E0DA 4IQUA 5L9XA 4J9QA 3PR4A 5DB6A 1ZQTA 4PGQA 4Q8EA 1S9FA 4KLSA 2ZH5A 5KFJA 5IIJA 4ED2A 3RBEA 1ZQAA 8ICKA 3UPSA 5KG1A 5IIKA 3RH5A 4YN4A 2ALZA 3GIJA 1XWLA 1S0OA 4I29A 4GLXA 4C8LA 4M0AA 5DG8A 4F5PA 4GC7A 1SL1A 8ICRA 2O1PA 4BWMA 4FH3A 5F2VO 2AGQA 4JWNA 5J29A 2W9AA 1ZQRA 3ZDBA 2DPJA 2BCRA 1RYSA 4NM1A 1WOTA 3OHBA 3RB0A 4KN7A 4M04A 3TARA 1UEUA 5J0SA 4YG2A 4RZRA 3QZ7A 1D8LA 1ZQKA 1QLNA 1R8CA 5KG4A 2ASDA 8ICTA 9ICRA 1R8BA 2ZH2A 2HHSA 2IMWP 3OUYB 4R65A 4J9NA 4DOAA 3SZ2A 3RJKA 2J6TA 4Z6CA 4F8RA 2HVHA 4I28A 1JN3A 2ID1A 3UQ2A 1C7YA 5J2IA 4X4SA 3WFSC 4RT3A 5KFIA 2FPKA 2XC9A 4IRCA 2XY7A 4NKUA 1LB2B 7ICHA 2DRAA 1TFRA 4Q43A 1U47A 1T4GA 4GXKA 2HHWA 4DF4A 2HHUA 4EBEA 4F2SA 1ZQFA 3M9MB 9ICJA 3UXOA 4TURA 5HRHA 3AQKA 3JPOA 5F9NA 4B9TA 4P2HA 9ICVA 2NRTA 1NOMA 4PHEA 4AT8B 2AQ0A 5J2FA 8ICLA 2KN7A 4BXOA 2A1JB 4I2AA 3QZ8A 1H38A 1TKDA 2HVIA 2KFNA 2ZHBA 5KT5A 4QZFA 4LZGA 4F4XA 4RQ7A 9ICSA 5F9LA 4J9MA 4UB3A 3EW9A 3RJFA 4FHVA 4BGDA 2R8HA 5TZVA 3HWTA 3GILA 1BGXT 9ICPA 3C2LA 4J9SA 4MFFA 4X4OA 3H4BA 4O3PA 1B43A 3BQ2A 4ECWA 3SI8A 3C21A 4DFJA 2C2EA 1D9FA 4EZ9A 4K4HA 9ICXA 4QWAA 4KLHA 8ICEA 2VA8A 4UD5A 2BPFA 5KFPA 5CR0A 4MF2A 8ICUA 3B0XA 3MDAA 3PV8A 1NZPA 3BDPA 5KFEA 1X9SA 2DRBA 2ASJA 1ZJNA 3TANA 9ICBA 3JPTA 4KLLA 9ICQA 1TAQA 4QZCA 3C1YA 5J0QA 5DQGA 3OGUA 3ZDDA 4O3RA 1KFTA 3Q8QB 3B0YA 5KFNA 3M8RA 1SKRA 4QZ8A 4DQRA 2AQ4A 4LZDA 5HHIA 3H38A 4RPZA 4HYKA 4O0IA 1NKBA 3AQNA 1U9LA 2VANA 5KFSA 4UB5A 2FLPA 8ICCA 2DVIA 4P4PA 1QSLA 1XO1A 1UA0A 3PW5A 2W9BB 1D8YA 2ZTCA 4YR0A 4ECQA 4IR9A 3OUYA 3RBDA 2FPLA 4DEZA 3OSNA 2ISOA 4BDPA 4EBDA 2W9MA 3PY8A 7ICPA 5KT3A 4E8FA 2PFNA 4J9RA 2C2DA 2ZTEA 5DGBA 4ED6A 4UBBA 4X0BA 4JV2A 3E2EA 2HHXA 4I2CA 4DS5A 3TAPA 4KTQA 3OHAA 3M8SA 4O3OA 5KT4A 2RDJA 3T3FA 4I2IA 4M9HA 2I9GA 7ICGA 2C28A 5HMMA 3PW2A 2F1IA 4XRHA 2BCVA 1JQRA 3AQMA 1NK6A 3TI0A 3PX4A 1XS9D 5KFVA 3RB3A 1Z00B 4R8UB 2W9CB 1NJYA 3ZD9A 4PHPA 3GDXA 3Q8MA 4UB1A 4M9GA 2A1JA 5KFDA 2PFQA 4ECVA 4DLEA 1DK2A 2MUTA 2DR5A 4DL3A 4ECYA 4ED1A 3RTVA 2BKEA 4IQVA 3V6HA 5KFBA 1V4AA 1NK0A 3JPQA 4DF8A 4QZHA 4I2EA 2AGOA 3T5KA 4EBKA 5DBCA 1RYRA 8ICAA 4C8OA 4R64A 1ZQZA 2ISPA 8ICXA 5HP4A 5KFFA 3PR5B 1U45A 3K4GA 2V4QA 4DSLA 4S3NA 3V72A 4F93B 3RRGA 4DOBA 2JZBB 4QWBA 2ATLA 1ZQCA 4Q44A 1SL0A 4DS4A 8ICQA 5DECA 3WFPA 3GFKB 4J9PA 3C1ZA 4LT6A 4WBYA 4ELTA 3N4MB 3HJ4A 4I2BA 5KFAA 1HUOA 2BHNA 3C5FA 2BPGA 3ISBA 1S0MA 3OVSA 7ICJA 2RFFA 5J0YA 4FHWA 2KFZA 5KG0A 4QW9A 5CA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8ICF A;  1F5A A;  5KFG A;  3IM1 A;  1MQ3 A;  4AT7 B;  4KLO A;  7ICE A;  4PH5 A;  4DOC A;  4KN4 A;  1NKC A;  9ICC A;  1CUK A;  2BQR A;  5DDM A;  1L3V A;  1MC8 A;  3ZDC A;  9ICH A;  1PX5 A;  3C5G A;  4YMN A;  1VJ7 A;  4QZE A;  5KFM A;  1RXV A;  4KLG A;  4X4T A;  4YD1 A;  3Q8L A;  1B22 A;  5J0O A;  3BJY A;  1ZQJ A;  2ZH1 A;  3LK9 A;  3H37 A;  2AGP A;  2FMS A;  4F2R A;  3AU6 A;  3Q8S B;  4KLJ A;  3PX0 A;  1ZQE A;  4ELU A;  1TK8 A;  4IRK A;  8ICS A;  3PW4 A;  1L3T A;  5HC9 A;  1ZQP A;  4I2H A;  4FBT A;  1Z00 A;  2W9C A;  8ICI A;  2XGP A;  2HHP A;  1XC9 A;  3H40 A;  1JAJ A;  5KT7 A;  2FPM A;  4X4V A;  4ED7 A;  4UAW A;  1T3N A;  1D9D A;  3AU2 A;  1KDH A;  3V7L A;  4QZB A;  3G6V A;  3PO4 A;  2M2U A;  1UET A;  2V9W A;  5HRG A;  2ZH8 A;  4QW8 A;  3JPP A;  2B21 A;  3UXN A;  3RH6 A;  4X4Q A;  2M9N A;  3MFI A;  5J0R A;  5DLF A;  2M2T A;  4NLK A;  1DGS A;  2J6S A;  3JPS A;  1ZQS A;  3NTU A;  1MIV A;  3PMN A;  4DL2 A;  2WTF A;  1SZP A;  3NYB A;  4NLN A;  4MF8 A;  1NKE A;  2F1H A;  3PW7 A;  4WC2 A;  1TV9 A;  5KFT A;  4GC6 A;  4RPX A;  4ATB A;  4J9L A;  4KIT B;  4RQ4 A;  1ZQY A;  7ICT A;  3NGD A;  3MGH A;  2BGW A;  2HW3 A;  1Q79 A;  3C2M A;  4YFK A;  3GIM A;  4RWN A;  4NY8 A;  3RB4 A;  4RQ6 A;  8ICP A;  4DL5 A;  4RQ2 A;  3N97 B;  4O3N A;  4FO6 A;  2HHQ A;  3V7J A;  5HRI A;  1BPZ A;  4X4P A;  4M6W B;  4RNO A;  1ZQX A;  2P66 A;  1BPE A;  1LV5 A;  4YR3 A;  2V4R A;  3RJJ A;  4C8M A;  2DR8 A;  5KG6 A;  1MQ2 A;  8ICB A;  5JUM A;  4F5N A;  1SKS A;  4RNN A;  4F3O A;  4GXI A;  1MIW A;  5KFK A;  3Q8P B;  1NO5 A;  4R63 A;  1BPB A;  2RDI A;  5DDY A;  2ZTD A;  3HX0 A;  5DBB A;  1UT5 A;  1BVS A;  3MR2 A;  1T7P A;  7ICI A;  9ICG A;  5HRE A;  1S77 D;  1KNY A;  4AT9 B;  4JK1 A;  1UA1 A;  2FLL A;  4QWC A;  7ICQ A;  4B9L A;  2JEJ A;  4Q45 A;  3QEA Z;  4DL4 A;  5KTQ A;  2PFP A;  4TQS A;  4UAZ A;  3JPR A;  1JXL A;  3MGI A;  4MEX A;  4PHA A;  2BQU A;  4XA5 A;  2BPC A;  5KFX A;  4JV0 A;  2FMQ A;  2MAX A;  3ZDE A;  3EPI A;  5DKW A;  4CCH A;  4MFA A;  8ICW A;  9ICI A;  5CHG A;  3PO5 A;  4JUZ A;  4TQR A;  4JWM A;  3V6J A;  4DO9 A;  1L5U A;  4K4I A;  1ZQQ A;  4QZG A;  3IHQ B;  4QZA A;  2R8K A;  3RR8 A;  1ZQI A;  4O5K A;  4KLM A;  4F92 B;  5KFZ A;  1HJP A;  3ORY A;  2OWO A;  1U49 A;  4ECR A;  4O9M A;  5III A;  5C5J A;  4TUQ A;  3C2K A;  2VA2 A;  4M2Y A;  8ICM A;  4DFM A;  4RWQ A;  3RAX A;  3RAQ A;  3GV8 B;  3BQ0 A;  1DK3 A;  2NRV A;  1WCN A;  5HML A;  5J0W A;  5EWF A;  4J9K A;  3H7I A;  3H39 A;  3BQ1 A;  1JX4 A;  4AT8 A;  4O3S A;  3MR5 A;  4EYI B;  2PI4 A;  4YCX A;  4FBU A;  1NJW A;  1U48 A;  3JZ0 A;  3RR7 A;  2P6U A;  5IIO A;  5KFL A;  3SV3 A;  1L3U A;  2DPI A;  4UB4 A;  7ICF A;  1TFY A;  2ZJ8 A;  1ZQU A;  4O3Q A;  3ZD8 A;  3JPN A;  4PGY A;  4M9J A;  7ICV A;  5EWE A;  1ZQO A;  1KLN A;  2NRW A;  4TUS A;  3K75 D;  3TFS A;  2AU0 A;  3H8W A;  4BWJ A;  3EZ5 A;  4JV1 A;  4M6W A;  1A76 A;  1NK7 A;  4R66 A;  2J6U A;  2C22 A;  3C66 A;  4XQ8 A;  1ZQG A;  2KZ3 A;  3M9O B;  4YD2 A;  1S76 D;  5CWR A;  5IIN A;  5KG3 A;  5J0P A;  4UBC A;  4J9O A;  4UAY A;  2F1J A;  2VA3 A;  4B9N A;  4FHX A;  3PVX A;  1R89 A;  9ICF A;  3GV7 B;  5D4B A;  4DQI A;  2KP7 A;  4UD4 A;  4X4N A;  1CEZ A;  2ZJA A;  5CB1 A;  3KHG A;  2W8K A;  1X9M A;  2BR0 A;  4G3I A;  9ICN A;  1SL2 A;  3PX6 A;  4KLT A;  9ICW A;  4P4M A;  1BNO A;  1ZYQ A;  4PPX A;  5J2H A;  1COO A;  4YXJ A;  4WC7 A;  4Z6F A;  1S0V A;  5J0X A;  4FHP A;  4DSF A;  3EYZ A;  5DGA A;  5KT6 A;  5HNK A;  2W9B A;  4F5O A;  3TFR A;  1ARO P;  2IA6 A;  3UQ0 A;  4YMO A;  1IXR A;  5J2C A;  4DSE A;  2W8L A;  5D46 A;  4WC6 A;  3GIK A;  1Q78 A;  3RJE A;  4XQ7 A;  2ZH9 A;  1KFD A;  4NKT A;  3ETL A;  4YVZ A;  3MFH A;  4IQT A;  2PXI A;  5J2A A;  5L1K A;  1ZQN A;  1KTQ A;  2BCQ A;  2GWS A;  3Q8R B;  2PI5 A;  4F4K A;  4KLD A;  2BCU A;  4ECT A;  3MAB A;  4YXM A;  3TAQ A;  2UVU A;  4LVS A;  5IIM A;  1BPX A;  2ZUC A;  5J2G A;  4I2G A;  4F91 B;  5J0T A;  1TAU A;  3OVA A;  2R8I A;  5DBA A;  3HPO A;  4QWE A;  4RNM A;  3UPQ A;  1TVA A;  4M9L A;  1NK8 A;  3AQL A;  3WFO A;  2XGQ A;  4RQ8 A;  1KRP A;  4KMU A;  3H3A A;  7ICO A;  4RUA A;  5DED A;  4R8U A;  2Y1J A;  2LYH A;  8ICZ A;  3EWA A;  4X0A A;  4IRD A;  1IM4 A;  5J2B A;  3ISD A;  4DSJ A;  2HHV A;  4E7X A;  1KFS A;  5KFO A;  2IBK A;  4O5C A;  3RRH A;  4DFP A;  2XY6 A;  4DQS A;  8ICN A;  4M5D A;  4WC5 A;  5HRB A;  4F4Z A;  1WCL A;  5BOM A;  1A77 A;  5KG7 A;  3SYZ A;  1JIH A;  2BCS A;  3H4D A;  7ICL A;  3SV4 A;  4IQW A;  4QZD A;  3HIY A;  5DB9 A;  2BDP A;  1JMS A;  4ZH4 A;  5DG7 A;  4I2F A;  4FH5 A;  1RZT A;  2I1Q A;  3JYY A;  1QSY A;  4RWP A;  2ZHA A;  3G6X A;  2NRZ A;  5L1I A;  4KLQ A;  3C18 A;  1XSL A;  3LDA A;  3T5H A;  2ASL A;  5EWG A;  2JZB A;  1NJX A;  3HJ1 A;  4I2J A;  5BOL A;  5L1L A;  4ED8 A;  3BQT A;  4M47 A;  4WCW A;  1OU5 A;  4RWO A;  5HRK A;  4QZI A;  2ZUB A;  7ICK A;  4DFK A;  4E80 A;  1NK9 A;  4GXJ A;  2XCA A;  4IG8 A;  1N48 A;  4WBZ A;  9ICA A;  3FDS A;  4Q8F A;  1MSW D;  4RPY A;  5HHH A;  2O5A A;  3GV5 B;  4X5V A;  2FMP A;  1S10 A;  3WFQ E;  1EXN A;  4P4O A;  3KHL A;  1VFG A;  1ZQB A;  4F5R A;  4DSK A;  4YP3 A;  4AT7 A;  4WC4 A;  4NXZ A;  2ZJ5 A;  5DLG A;  4MEY A;  5KFC A;  3QE9 Y;  4RUC A;  1ZQV A;  4Z6D A;  2UVV A;  1SKW A;  4EZ6 A;  3PNC A;  1K1S A;  4PHD A;  4KLF A;  2ZH3 A;  4DL6 A;  1K1Q A;  2DFL A;  5DQI A;  4RU9 A;  4EBC A;  2XY5 A;  4DSI A;  7ICU A;  9ICO A;  2P6R A;  4XUS A;  5KFY A;  4NM2 A;  5DB7 A;  2XO7 A;  4EEY A;  2UVW A;  3G6Y A;  2NRK A;  7ICS A;  2MUT B;  4RQ5 A;  4KLU A;  1FA0 A;  2PFO A;  4I27 A;  7ICR A;  3HW8 A;  9ICK A;  5KFQ A;  4YMM A;  4NLZ A;  4B9U A;  3THV A;  3C23 A;  3T5L A;  4FS2 A;  2Q66 A;  3UXP A;  5HRF A;  4X4U A;  4RT2 A;  1MIY A;  1ZQL A;  5DB8 A;  2BQ3 A;  1XU4 A;  5KFW A;  4WC1 A;  1NJZ A;  1L3S A;  3OV7 A;  4NLG A;  5J2D A;  2AJQ A;  2ZH6 A;  4UQG A;  3MR3 A;  3OSP A;  1RXW A;  2NRX A;  4DL7 A;  4TUP A;  4KLI A;  1XSP A;  5IIL A;  1TK0 A;  3ISC A;  2JEF A;  2IHN A;  2KTQ A;  3RB6 A;  5EOZ A;  1NK5 A;  5CP2 A;  1X9W A;  2PBE A;  4YQW A;  4ECZ A;  3QEB Z;  1QTM A;  4ELV A;  1UEV A;  4EYH B;  3MBY A;  1U4B A;  5BPC A;  5J2J A;  3TQ1 A;  3PW0 A;  4KLE A;  8ICJ A;  5HRL A;  3HT3 A;  1DOQ A;  4QWD A;  1TK5 A;  3L9D A;  1HUZ A;  1BPD A;  3H8J A;  4C8K A;  9ICU A;  1TFW A;  2R8J A;  4EBJ A;  4F5Q A;  4B9M A;  1BNP A;  1JXE A;  4O5E A;  7ICM A;  3OVB A;  4FS1 A;  3GII A;  3HP6 A;  2KZZ A;  3RJI A;  2UVR A;  4MFC A;  2DR7 A;  4ECS A;  3AUO A;  5J2E A;  3ZDA A;  3MDC A;  1ZJM A;  4ED3 A;  3RH4 A;  4EP7 A;  4WC3 A;  2Y1I A;  1S0N A;  4K4G A;  1KEJ A;  5CJ7 A;  8ICY A;  1R8A A;  5KFR A;  5DG9 A;  3EPG A;  2ZUD A;  4YR2 A;  1X2I A;  4UB2 A;  4PGX A;  1XSN A;  4ECX A;  9ICT A;  2M2V A;  9ICM A;  5KFH A;  1RPL A;  2XCP A;  2JEI A;  4FHY A;  5J2K A;  4F4Y A;  3RJH A;  2IHM A;  4ED0 A;  3Q8K A;  8ICO A;  4DLG A;  3KHR A;  1QSS A;  4X4R A;  5KG2 A;  2H5X A;  3M9N B;  1S97 A;  4AT9 A;  2DR9 A;  1Z3E B;  3T5J A;  1ZQM A;  4I2D A;  9ICE A;  3V7K A;  5KT2 A;  8ICV A;  3FYH A;  3MR6 A;  2BE3 A;  3H8S A;  4RQ0 A;  3OJU A;  7ICN A;  4ECU A;  2FLN A;  1PZN A;  5L1J A;  4F50 A;  1KSP A;  1UT8 A;  4M9N A;  5KFU A;  5J0U A;  5DQH A;  1ZQD A;  3LQC B;  2KZM A;  1N56 A;  3RJG A;  1T8E A;  1YLQ A;  2R8G A;  3PML A;  4WC0 A;  3WFR E;  4F4W A;  4DQQ A;  4Z6E A;  3LWM A;  2JEG A;  9ICL A;  3KTQ A;  4DWI A;  5HRD A;  4IR1 A;  2C2R A;  2ZH4 A;  3LWL A;  3KHH A;  2Q0Z X;  3OJS A;  1NK4 A;  8ICH A;  1V9P A;  1ZQW A;  1ZQH A;  4ATB B;  4C8N A;  4RQ1 A;  4BXO B;  5KG5 A;  1Y88 A;  3GQC A;  4DQP A;  2HHT A;  2ZH7 A;  1BPY A;  2M2W A;  3V6K A;  8ICG A;  1ZET A;  5D49 A;  4RQ3 A;  4QZ9 A;  4B9V A;  5HR9 A;  4B9S A;  4E0D A;  4IQU A;  5L9X A;  4J9Q A;  3PR4 A;  5DB6 A;  1ZQT A;  4PGQ A;  4Q8E A;  1S9F A;  4KLS A;  2ZH5 A;  5KFJ A;  5IIJ A;  4ED2 A;  3RBE A;  1ZQA A;  8ICK A;  3UPS A;  5KG1 A;  5IIK A;  3RH5 A;  4YN4 A;  2ALZ A;  3GIJ A;  1XWL A;  1S0O A;  4I29 A;  4GLX A;  4C8L A;  4M0A A;  5DG8 A;  4F5P A;  4GC7 A;  1SL1 A;  8ICR A;  2O1P A;  4BWM A;  4FH3 A;  5F2V O;  2AGQ A;  4JWN A;  5J29 A;  2W9A A;  1ZQR A;  3ZDB A;  2DPJ A;  2BCR A;  1RYS A;  4NM1 A;  1WOT A;  3OHB A;  3RB0 A;  4KN7 A;  4M04 A;  3TAR A;  1UEU A;  5J0S A;  4YG2 A;  4RZR A;  3QZ7 A;  1D8L A;  1ZQK A;  1QLN A;  1R8C A;  5KG4 A;  2ASD A;  8ICT A;  9ICR A;  1R8B A;  2ZH2 A;  2HHS A;  2IMW P;  3OUY B;  4R65 A;  4J9N A;  4DOA A;  3SZ2 A;  3RJK A;  2J6T A;  4Z6C A;  4F8R A;  2HVH A;  4I28 A;  1JN3 A;  2ID1 A;  3UQ2 A;  1C7Y A;  5J2I A;  4X4S A;  3WFS C;  4RT3 A;  5KFI A;  2FPK A;  2XC9 A;  4IRC A;  2XY7 A;  4NKU A;  1LB2 B;  7ICH A;  2DRA A;  1TFR A;  4Q43 A;  1U47 A;  1T4G A;  4GXK A;  2HHW A;  4DF4 A;  2HHU A;  4EBE A;  4F2S A;  1ZQF A;  3M9M B;  9ICJ A;  3UXO A;  4TUR A;  5HRH A;  3AQK A;  3JPO A;  5F9N A;  4B9T A;  4P2H A;  9ICV A;  2NRT A;  1NOM A;  4PHE A;  4AT8 B;  2AQ0 A;  5J2F A;  8ICL A;  2KN7 A;  4BXO A;  2A1J B;  4I2A A;  3QZ8 A;  1H38 A;  1TKD A;  2HVI A;  2KFN A;  2ZHB A;  5KT5 A;  4QZF A;  4LZG A;  4F4X A;  4RQ7 A;  9ICS A;  5F9L A;  4J9M A;  4UB3 A;  3EW9 A;  3RJF A;  4FHV A;  4BGD A;  2R8H A;  5TZV A;  3HWT A;  3GIL A;  1BGX T;  9ICP A;  3C2L A;  4J9S A;  4MFF A;  4X4O A;  3H4B A;  4O3P A;  1B43 A;  3BQ2 A;  4ECW A;  3SI8 A;  3C21 A;  4DFJ A;  2C2E A;  1D9F A;  4EZ9 A;  4K4H A;  9ICX A;  4QWA A;  4KLH A;  8ICE A;  2VA8 A;  4UD5 A;  2BPF A;  5KFP A;  5CR0 A;  4MF2 A;  8ICU A;  3B0X A;  3MDA A;  3PV8 A;  1NZP A;  3BDP A;  5KFE A;  1X9S A;  2DRB A;  2ASJ A;  1ZJN A;  3TAN A;  9ICB A;  3JPT A;  4KLL A;  9ICQ A;  1TAQ A;  4QZC A;  3C1Y A;  5J0Q A;  5DQG A;  3OGU A;  3ZDD A;  4O3R A;  1KFT A;  3Q8Q B;  3B0Y A;  5KFN A;  3M8R A;  1SKR A;  4QZ8 A;  4DQR A;  2AQ4 A;  4LZD A;  5HHI A;  3H38 A;  4RPZ A;  4HYK A;  4O0I A;  1NKB A;  3AQN A;  1U9L A;  2VAN A;  5KFS A;  4UB5 A;  2FLP A;  8ICC A;  2DVI A;  4P4P A;  1QSL A;  1XO1 A;  1UA0 A;  3PW5 A;  2W9B B;  1D8Y A;  2ZTC A;  4YR0 A;  4ECQ A;  4IR9 A;  3OUY A;  3RBD A;  2FPL A;  4DEZ A;  3OSN A;  2ISO A;  4BDP A;  4EBD A;  2W9M A;  3PY8 A;  7ICP A;  5KT3 A;  4E8F A;  2PFN A;  4J9R A;  2C2D A;  2ZTE A;  5DGB A;  4ED6 A;  4UBB A;  4X0B A;  4JV2 A;  3E2E A;  2HHX A;  4I2C A;  4DS5 A;  3TAP A;  4KTQ A;  3OHA A;  3M8S A;  4O3O A;  5KT4 A;  2RDJ A;  3T3F A;  4I2I A;  4M9H A;  2I9G A;  7ICG A;  2C28 A;  5HMM A;  3PW2 A;  2F1I A;  4XRH A;  2BCV A;  1JQR A;  3AQM A;  1NK6 A;  3TI0 A;  3PX4 A;  1XS9 D;  5KFV A;  3RB3 A;  1Z00 B;  4R8U B;  2W9C B;  1NJY A;  3ZD9 A;  4PHP A;  3GDX A;  3Q8M A;  4UB1 A;  4M9G A;  2A1J A;  5KFD A;  2PFQ A;  4ECV A;  4DLE A;  1DK2 A;  2MUT A;  2DR5 A;  4DL3 A;  4ECY A;  4ED1 A;  3RTV A;  2BKE A;  4IQV A;  3V6H A;  5KFB A;  1V4A A;  1NK0 A;  3JPQ A;  4DF8 A;  4QZH A;  4I2E A;  2AGO A;  3T5K A;  4EBK A;  5DBC A;  1RYR A;  8ICA A;  4C8O A;  4R64 A;  1ZQZ A;  2ISP A;  8ICX A;  5HP4 A;  5KFF A;  3PR5 B;  1U45 A;  3K4G A;  2V4Q A;  4DSL A;  4S3N A;  3V72 A;  4F93 B;  3RRG A;  4DOB A;  2JZB B;  4QWB A;  2ATL A;  1ZQC A;  4Q44 A;  1SL0 A;  4DS4 A;  8ICQ A;  5DEC A;  3WFP A;  3GFK B;  4J9P A;  3C1Z A;  4LT6 A;  4WBY A;  4ELT A;  3N4M B;  3HJ4 A;  4I2B A;  5KFA A;  1HUO A;  2BHN A;  3C5F A;  2BPG A;  3ISB A;  1S0M A;  3OVS A;  7ICJ A;  2RFF A;  5J0Y A;  4FHW A;  2KFZ A;  5KG0 A;  4QW9 A;  5CA7 A; 
#chains in the Genus database with same CATH topology
 8ICF A;  4AT7 B;  3IM1 A;  4PH5 A;  2A1A A;  9ICH A;  3C5G A;  4YMN A;  4QZE A;  1B22 A;  2DF4 B;  3AU6 A;  2XI9 A;  3Q8S B;  2WB1 C;  3PX0 A;  4UAS A;  1ZQE A;  4IRK A;  1L3T A;  3C28 A;  2G5H B;  4FBT A;  2GLE A;  1T3Q A;  1DXS A;  5G5H A;  2E8M A;  1QQ6 A;  3AU2 A;  1WWU A;  3G6V A;  3PO4 A;  5HRG A;  2ZH8 A;  4QW8 A;  3UXN A;  2ZIU A;  1IIP A;  4X4Q A;  2M9N A;  4BX9 C;  3MFI A;  1VDV A;  2J6S A;  3JPS A;  3WK5 A;  5B66 U;  1SZP A;  3F53 A;  5KFT A;  4RPX A;  4J9L A;  4KIT B;  1ZQY A;  3MGH A;  2HW3 A;  3GIM A;  4RWN A;  2H3Z A;  4FO6 A;  5HRI A;  4X4P A;  3CRX A;  2KVC A;  3IV6 A;  1ZQX A;  5TIS U;  2DR8 A;  4C80 A;  3Q8P B;  5EE1 A;  4B6J A;  5ALV A;  2BZF A;  1A6S A;  1BPB A;  2RDI A;  5DDY A;  2Y0S F;  5DBB A;  1A0P A;  2KK0 A;  3MR2 A;  9ICG A;  1KNY A;  4JMU A;  1S77 D;  1FFV A;  2H3F A;  4QWC A;  7ICQ A;  2ES6 A;  3OWG A;  5D63 A;  2DUY A;  3JPR A;  4MEX A;  2BPC A;  3ZDE A;  5CHG A;  2PKE A;  3NVV A;  4K4I A;  2IOF K;  1N5X A;  4PZN A;  3EF2 A;  1HJP A;  3ORY A;  8ICM A;  4DFM A;  5J0W A;  5HML A;  3BQ1 A;  1JX4 A;  4O3S A;  1SXE A;  3MR5 A;  4EYI B;  2PI4 A;  4NLC A;  1NJW A;  1U48 A;  2DPI A;  4PGY A;  2M0N A;  7ICV A;  1KLN A;  4UB8 U;  3K75 D;  2AU0 A;  4JV1 A;  3H8W A;  3DV9 A;  4XQ8 A;  5AKX A;  3WK7 A;  5AI6 A;  1S76 D;  5IIN A;  1RM6 C;  3LVV A;  5J0P A;  4UBC A;  4J9O A;  4B9N A;  2W7P A;  3PVX A;  1D8B A;  4UD4 A;  9ICW A;  4J03 A;  2JR5 A;  2G08 A;  5J0X A;  4FHP A;  4OJP A;  1MA7 A;  5GTI U;  5HR7 A;  2YMQ A;  5D46 A;  2K4P A;  4CDG A;  4WC6 A;  2ZH9 A;  3MFH A;  4ELU A;  4US8 A;  4F4K A;  2PI5 A;  2E8N A;  4ECT A;  3MAB A;  2UVU A;  5IIM A;  3OVA A;  4M9L A;  2CRX A;  4NWI A;  5DED A;  8ICZ A;  2WAQ F;  1IM4 A;  3ISD A;  5AI4 A;  2HHV A;  2IBK A;  8ICN A;  4M5D A;  3WK8 A;  1ZD2 P;  4F4Z A;  3SYZ A;  1JIH A;  1PVP A;  1UQV A;  3SV4 A;  4IQW A;  4FH5 A;  2I1Q A;  2NRZ A;  2K4I A;  1NI3 A;  3LVW A;  5HRK A;  3ZI4 A;  1TE2 A;  2XCA A;  4IG8 A;  1SGG A;  9ICA A;  3TKA A;  4Q8F A;  1MSW D;  4RPY A;  1SV0 A;  3GV5 B;  4X5V A;  1T94 A;  2B51 A;  2F8K A;  5DLG A;  4OJ6 A;  1SKW A;  4NL9 A;  4PHD A;  3KKA C;  3PSI A;  4DL6 A;  4RU9 A;  4XUS A;  5KFY A;  2UVW A;  5CEH A;  3G6Y A;  2NRK A;  1Q46 A;  1QQ7 A;  1ZOL A;  4RQ5 A;  4KLU A;  1FA0 A;  4I27 A;  9ICK A;  4YMM A;  3J81 j;  3T5L A;  4FS2 A;  2Q66 A;  2IOF A;  5HRF A;  1SWV A;  1ZQL A;  1XU4 A;  5KFW A;  4WC1 A;  1NJZ A;  1L3S A;  4WQK A;  4UQG A;  1WG8 A;  4FZL A;  1XSP A;  2D8C A;  1PK1 A;  2EWR A;  4Y2R A;  5EOZ A;  1X9W A;  4MKP A;  4YQW A;  1GO3 F;  3UM9 A;  4I0U A;  3NRW A;  3FM9 A;  3N28 A;  3OVB A;  1BNP A;  1JXE A;  4O5E A;  2A3V A;  1VJ5 A;  7ICM A;  5JTI A;  3GII A;  2EH9 A;  4NXT A;  4C7Z A;  4ECS A;  3WK9 A;  4ED3 A;  1N62 A;  2VKQ A;  3RH4 A;  4WC3 A;  1S0N A;  2ZUD A;  4ECX A;  4LT6 A;  3TAD A;  5KFH A;  3Q8K A;  3KHR A;  1Z3E B;  3TAC B;  4HX0 A;  2QAR A;  3HRD D;  3OJU A;  5FP0 A;  1PZN A;  5L1J A;  1KSP A;  2Y0S C;  2HOI A;  5DQH A;  1ZQD A;  2Q4T A;  3LQC B;  2KZM A;  1N56 A;  3RJG A;  1LVH A;  1T8E A;  4WC0 A;  4F4W A;  2JEG A;  3LWL A;  3GQC A;  2LYB A;  3D2S A;  2ZH7 A;  1BPY A;  1KL9 A;  3QNM A;  4J9Q A;  1COK A;  5DB6 A;  2Y9T A;  4PGQ A;  3CYM A;  5JRT A;  4U7C A;  1X42 A;  2NYV A;  4M0A A;  2O1P A;  1SL1 A;  3PSP A;  4EED A;  3KOO A;  2XIC A;  4O68 A;  3ZDB A;  2F3N A;  1WOT A;  3OHB A;  4M04 A;  2E1F A;  1QLN A;  1R8C A;  1R8B A;  4QIW F;  2JH1 A;  5KG4 A;  2ASD A;  5CFT A;  5JTG A;  4OD0 A;  4R65 A;  4I28 A;  1UHU A;  5ALU A;  4UAR A;  1C7Y A;  2ID1 A;  3SAF A;  7ICH A;  2HHW A;  1ZQF A;  3JPO A;  5F9N A;  4P2H A;  3CK6 A;  1NOM A;  4AT8 B;  2AQ0 A;  1ECW A;  2A1J B;  3QZ8 A;  4QZF A;  4LZG A;  9ICS A;  4J9M A;  1FEZ A;  2R8H A;  3HWT A;  3WKB A;  4PL2 A;  2C2E A;  3PHZ A;  4U6P A;  5CR0 A;  4MF2 A;  3PV8 A;  1X9S A;  2WAQ C;  3GZF A;  1KN5 A;  5J0Q A;  1KFT A;  1Q8K A;  3Q8Q B;  3M8R A;  4DQR A;  4LZD A;  2KE7 A;  1ZD4 A;  3AQN A;  4UB5 A;  2FLP A;  4P4P A;  2W9B B;  3I76 A;  4RQM A;  2RP5 A;  2KSO B;  4KMO B;  2C2D A;  2ZTE A;  2WHE A;  4X0B A;  3UMC A;  5GTH U;  4JV2 A;  4KTQ A;  3M8S A;  3T3F A;  3AQM A;  2L5Y A;  2QKQ A;  4G9B A;  3F2B A;  2BCV A;  1JQR A;  3GDX A;  2A1J A;  4ECV A;  2MUT A;  4ECY A;  2BKE A;  3V6H A;  5KFB A;  2DBY A;  2W11 A;  1V4A A;  4PZO A;  4ICA A;  4LEW A;  2AGO A;  4R64 A;  4EX7 A;  5HP4 A;  2AHO B;  2MSN A;  2A19 A;  3V72 A;  4F93 B;  3HIL A;  3HJ4 A;  1NZB A;  5ALE A;  3WKA A;  3NVZ A;  2KJ5 A;  5J0Y A;  1Z1B A;  2KFZ A;  1F5A A;  3RFA A;  1MQ3 A;  1PVR A;  1NKC A;  1X6I A;  3NRZ A;  1L3V A;  3ZDC A;  1MC8 A;  1PX5 A;  3PSF A;  4X4T A;  2NV3 A;  4F2R A;  5AKI A;  3QUB A;  3PZP A;  8ICS A;  3SAG A;  3FAH A;  2PMZ C;  4MHV A;  4I2H A;  2HHP A;  1XC9 A;  5ALL A;  3H40 A;  4C4S A;  1JAJ A;  5KT7 A;  2FPM A;  4IS7 A;  4WQL A;  1KDH A;  4EGW A;  4QZB A;  1WYG A;  1OXJ A;  2M2U A;  2V9W A;  2B21 A;  5J0R A;  1NNL A;  2KIV A;  4NLK A;  3ER9 B;  1ZQS A;  4OJL A;  5CRX A;  1NKE A;  4NXW A;  2E8O A;  2F1H A;  4WC2 A;  1WWV A;  1Z19 A;  4ATB A;  4CE6 A;  4K9B A;  7ICT A;  2ZXH A;  1M6Y A;  1Q79 A;  1DGJ A;  3RB4 A;  4RQ6 A;  4DL5 A;  4RQ2 A;  3M6Z A;  3N97 B;  2W03 A;  2HHQ A;  4US9 A;  4JLZ A;  4RNO A;  2G5I B;  1BPE A;  4NXX A;  1MQ2 A;  2IA6 A;  4K96 A;  2ZTD A;  1S5L U;  4AT9 B;  4Y2T A;  2GH1 A;  4JK1 A;  3SEN A;  1UA1 A;  2FLL A;  1Q3V A;  4N7R A;  4B9L A;  5CFS A;  2ZIW A;  1PVQ A;  4Q45 A;  3DDH A;  2PFP A;  4UAZ A;  4PHA A;  5D62 A;  8ICW A;  2MAX A;  3TAD C;  9ICI A;  2BBJ A;  4DO9 A;  2JXJ A;  4QZA A;  3RR8 A;  3WK4 A;  2OHF A;  4F92 B;  5KFZ A;  3D2Q A;  3H0L B;  5C5J A;  1DK3 A;  2LM1 A;  5KAF U;  2NRV A;  3IP4 B;  3BQ0 A;  3H39 A;  3D2N A;  1ZRM A;  4YCX A;  3RR7 A;  5IIO A;  5ALK A;  3NKU A;  3KBB A;  3QU2 A;  1ZQU A;  1B0X A;  4TUS A;  1A76 A;  3M9O B;  5KG3 A;  1RDF A;  4FHX A;  4JLX A;  9ICF A;  4BJQ A;  3GV7 B;  1CEZ A;  4PPX A;  5J2H A;  4YXJ A;  4DSF A;  3EYZ A;  4F5O A;  3TFR A;  3UQ0 A;  2YML A;  5AM1 A;  2W8L A;  3GIK A;  5K4L A;  3RJE A;  1V85 A;  1KFD A;  4YVZ A;  4JWM A;  4IQT A;  2BCQ A;  9ICB A;  4LVS A;  4AYB F;  4P0P B;  4YXM A;  3TAQ A;  5ALQ A;  5J2G A;  4Y2V A;  1CI4 A;  4I2G A;  4QWE A;  3WFO A;  1NK8 A;  4RQ8 A;  2Y1J A;  1ZRN A;  2KG5 A;  4DSJ A;  5KFO A;  1QQ5 A;  5AKY A;  4DQS A;  5HRB A;  1WCL A;  3NAS A;  5BOM A;  5KG7 A;  3H4D A;  4FE3 A;  3H0M B;  4QNL A;  5DB9 A;  2BDP A;  4I2F A;  1QSY A;  2ZHA A;  5L1I A;  3C18 A;  3LDA A;  5EWG A;  1QH9 A;  2DKZ A;  4I2J A;  5BOL A;  5L1L A;  4M47 A;  4WCW A;  1N63 A;  1OU5 A;  4QZI A;  4E80 A;  1NK9 A;  4GXJ A;  3FDS A;  3QU7 A;  5HHH A;  5E79 U;  3IDW A;  1JRO A;  3KHL A;  1ZQB A;  2DWQ A;  3S6J A;  4AT7 A;  4NXZ A;  2ZJ5 A;  4MEY A;  4EZ6 A;  1ZQV A;  2GOL A;  1K1S A;  2OM6 A;  3PNC A;  4K99 A;  4DSI A;  1K1Q A;  5DQI A;  2KMD A;  2XY5 A;  9ICO A;  7ICU A;  4EEY A;  5ALP A;  3AN1 A;  1J2N A;  7ICS A;  2PFO A;  2F44 A;  7ICR A;  4OAH A;  5KFQ A;  2KIW A;  4XJE A;  3THV A;  2KJ8 A;  4X4U A;  1MIY A;  5AIB A;  4NLG A;  2ESE A;  2QB0 B;  2W54 A;  4DL7 A;  3T79 A;  3MCR A;  2IHN A;  5B3Q A;  3NWI A;  5CP2 A;  2PBE A;  1RG6 A;  4EYH B;  5BPC A;  5ALF A;  3K7D A;  2HBK A;  3HT3 A;  1BPD A;  3BZC A;  4EBJ A;  2LBO A;  2HDO A;  3D6J A;  2LM4 A;  4FS1 A;  3HP6 A;  4MFC A;  2G07 A;  1KEJ A;  5KFR A;  3EPG A;  1X2I A;  2K8A A;  9ICM A;  2JEI A;  1C20 A;  1JUD A;  2IHM A;  5AM3 A;  4DLG A;  3M9N B;  3E58 A;  3BS5 B;  3T5J A;  3GU3 A;  3V7K A;  5KT2 A;  4OAG A;  1F0M A;  5AKG A;  3MR6 A;  3H8S A;  4RQ0 A;  5AKJ A;  1JAL A;  4ECU A;  3R9K A;  2FLN A;  2P35 A;  4F50 A;  1IG6 A;  5D61 A;  3HJE A;  5KFU A;  1YLQ A;  3LWM A;  3ONN A;  4IR1 A;  2ZH4 A;  4OAI Z;  3KHH A;  2WF6 A;  1ZQH A;  4BXO B;  5KG5 A;  4IC9 A;  3LYS A;  3K1R B;  5D49 A;  4B9S A;  4IQU A;  5CFU A;  2AXT U;  1O03 A;  2VJ5 A;  4C4R A;  4LEZ A;  2ZH5 A;  5KFJ A;  3RBE A;  4ED2 A;  1ZQA A;  4K9A A;  3QYP A;  5EE0 A;  1Z4N A;  4YN4 A;  2ALZ A;  1CRX A;  4C8L A;  5DG8 A;  5F2V O;  4BWM A;  2W9A A;  1X40 A;  2BCR A;  1RYS A;  4NM1 A;  1D8L A;  2ZH2 A;  8ICT A;  9ICR A;  3OUY B;  5AK4 A;  3SZ2 A;  2J6T A;  4F8R A;  3UQ2 A;  3CNH A;  5KFI A;  2FPK A;  5KAI U;  4NKU A;  2G0A A;  5H2F U;  2DRA A;  5AM2 A;  1YT3 A;  2ZIX B;  2F77 X;  3N7R C;  9ICJ A;  2AH5 A;  5HRH A;  9ICV A;  2NRT A;  3QUT A;  4PHE A;  2KN7 A;  4BXO A;  4I2A A;  1H38 A;  2KFN A;  4F4X A;  3EW9 A;  4BGD A;  5TZV A;  3GIL A;  4OJO A;  4AYB C;  3C2L A;  4O3P A;  3SI8 A;  4K4H A;  2F2A B;  4K8V A;  8ICE A;  3B0X A;  1NZP A;  3MDA A;  2IHO A;  1FFU A;  5ALN A;  3TAN A;  4KLL A;  2W43 A;  3DEE A;  3ZDD A;  5DQG A;  3AQF A;  5KFN A;  2AQ4 A;  2K89 A;  4HYK A;  1NKB A;  1U9L A;  2VAN A;  2FE9 A;  5KFS A;  8ICC A;  1GPJ A;  3PW5 A;  4FFD A;  4YR0 A;  4ECQ A;  3OUY A;  2FPL A;  3PY8 A;  4E8F A;  2OCE A;  2PFN A;  4J9R A;  5DGB A;  4UBB A;  3E2E A;  5ALT A;  4I2C A;  5ALI A;  1SWW A;  3TAP A;  4MFF A;  1RYU A;  5KT4 A;  2RDJ A;  4I2I A;  4KM5 A;  2C28 A;  3PW2 A;  3PX4 A;  5KFV A;  4CF5 A;  1Z00 B;  4R8U B;  2W9C B;  1NJY A;  4PHP A;  9ICC A;  2G06 A;  5KFD A;  1DK2 A;  4DLE A;  5J8Y A;  4IQV A;  2RQ5 A;  4Y2X A;  3JPQ A;  4DF8 A;  4I2E A;  8ICA A;  1RYR A;  2H3Q A;  2ZG6 A;  8ICX A;  1U45 A;  5L1M A;  3K4G A;  4DOB A;  2JZB B;  2ATL A;  5DEC A;  2OYY A;  8ICQ A;  3WFP A;  4J9P A;  3C1Z A;  4ELT A;  3N4M B;  2BHN A;  3C5F A;  3ISB A;  1S0M A;  3OVS A;  7ICJ A;  4FHW A;  3L3F X;  5KG0 A;  5CA7 A;  2OH2 A;  5KFG A;  4KN4 A;  1CUK A;  2BQR A;  3I28 A;  1VJ7 A;  1RXV A;  5KFM A;  4KLG A;  4YD1 A;  3Q8L A;  2EDU A;  5J0O A;  1ZQJ A;  2AGP A;  2FMS A;  4KLJ A;  5AM5 A;  2HOF A;  1KQQ A;  3QUQ A;  5HC9 A;  2VJ4 A;  1UCV A;  3SQI A;  1Z00 A;  2W9C A;  8ICI A;  5KL1 B;  1YZ6 A;  4X4V A;  4ED7 A;  3SD7 A;  3V7L A;  2YX8 A;  3JPP A;  1SZH A;  2KIC A;  4KX5 A;  5DLF A;  2M2T A;  1DGS A;  3NTU A;  2KEY A;  2KV2 A;  5ALM A;  1ZXI A;  4DL2 A;  2WTF A;  5B5E U;  3NYB A;  4NLN A;  5EE9 A;  4MF8 A;  3PW7 A;  1TV9 A;  4C7Y A;  3AEV A;  2BGW A;  2E5S A;  3C2M A;  3V7J A;  2R18 A;  4M6W B;  1KKX A;  4YR3 A;  2V4R A;  2FI1 A;  2YN4 A;  2HN2 A;  5KG6 A;  3SMV A;  4F5N A;  1MIW A;  4RNN A;  5EE3 A;  1J2M A;  1MN8 A;  5ALS A;  1T7P A;  1BVS A;  2H3I A;  4O69 A;  5KTQ A;  4Y2J A;  3MGI A;  2BQU A;  4XA5 A;  2FMQ A;  5KFX A;  4JV0 A;  4CCH A;  3EPI A;  1X66 A;  5DKW A;  4MFA A;  4JUZ A;  4TQR A;  3V6J A;  1L5U A;  1ZQQ A;  4O5K A;  4KLM A;  4ECR A;  4RWQ A;  2YY6 A;  3GV8 B;  3BS7 A;  5EWF A;  1Z1V A;  1L7N A;  4AT8 A;  4JB3 A;  2W3S A;  2WB1 F;  5KFL A;  4UB4 A;  7ICF A;  1TFY A;  2ZJ8 A;  3ZD8 A;  3JPN A;  4M9J A;  4UAV A;  5EWE A;  1ZQO A;  2NRW A;  5AI0 A;  2B4V A;  3EZ5 A;  4M6W A;  4R66 A;  5HR6 A;  2G09 A;  4FZN A;  5CWR A;  2VA3 A;  1DRG A;  2D6F C;  3EUB 2;  4DQI A;  1N5W A;  2ZJA A;  2E3T A;  3KHG A;  4G3I A;  9ICN A;  2B6G A;  3PX6 A;  4KLT A;  3QU9 A;  1COO A;  4WC7 A;  4NXV A;  4Z6F A;  1S0V A;  5AKE A;  4FZM A;  5DGA A;  5KT6 A;  5HNK A;  2W9B A;  1ARO P;  1IXR A;  4DSE A;  3B9J A;  1Q78 A;  2GO7 A;  4O67 A;  2YB1 A;  2KSO A;  3ETL A;  5L1K A;  5J2A A;  4KLD A;  2VIX A;  3Q8R B;  5AI8 A;  2JRZ A;  2RHF A;  3AM9 A;  2BCU A;  2HMX A;  1SV0 C;  4F91 B;  5J0T A;  1LKY B;  3UPQ A;  1TVA A;  3AQL A;  4F71 A;  3N7P D;  1KRP A;  2RRD A;  3H3A A;  7ICO A;  4RUA A;  2EAP A;  4X0A A;  3H0R B;  4NL9 C;  5AHX A;  1KFS A;  3RRH A;  1A77 A;  3HIY A;  1JMS A;  4ZH4 A;  1RZT A;  3ALR A;  3JYY A;  4OAF A;  4RWP A;  3G6X A;  1XSL A;  1NJX A;  3HJ1 A;  4ED8 A;  2EZX A;  3BQT A;  2ZUB A;  4C0Z A;  4WBZ A;  3F5E A;  1SV4 A;  2FMP A;  2YB4 A;  1S10 A;  3WFQ E;  1EXN A;  4P4O A;  1VFG A;  4F5R A;  4DSK A;  5ALY A;  4EEL A;  5KFC A;  4KLF A;  4NXU A;  2E1E A;  2YMP A;  2P6R A;  4NM2 A;  1LKY A;  1ED1 A;  2LHT A;  3HW8 A;  4C4T A;  4B9U A;  3UXP A;  5AKK A;  5DB8 A;  2BQ3 A;  5J2D A;  2AJQ A;  3MR3 A;  4LJX A;  5IIL A;  1TK0 A;  4PJ0 U;  4QIW C;  2JEF A;  4ECZ A;  3QEB Z;  3FC4 A;  1QTM A;  1U4B A;  5CHE A;  5J2J A;  3PW0 A;  5HRL A;  3L9D A;  1TK5 A;  9ICU A;  1TFW A;  4C8K A;  2KHV A;  4F5Q A;  4B9M A;  2EAO A;  4EV6 A;  2KZZ A;  3RJI A;  2DR7 A;  3L5K A;  3BQ7 A;  5ALG A;  1J97 A;  1RQN A;  2Y1I A;  4K4G A;  1R8A A;  3NS1 A;  4YR2 A;  4UB2 A;  4K98 A;  4FHY A;  1RPL A;  4OJ5 A;  5J2K A;  4F4Y A;  3RJH A;  2WFA A;  4ED0 A;  1QSS A;  2Z7J A;  5KG2 A;  2H5X A;  1S97 A;  4AT9 A;  3K1Z A;  4I2D A;  4DCC A;  8ICV A;  3FYH A;  2BE3 A;  1Q3U A;  2KKV A;  3BZK A;  4M9N A;  3NVO A;  4NLB A;  3M7D A;  1P7D A;  3RF9 A;  3PML A;  4Z6E A;  5HRD A;  4DWI A;  2WF8 A;  3OTQ A;  1NK4 A;  8ICH A;  1V9P A;  2FDR A;  1ZQW A;  4C8N A;  1Y88 A;  4DQP A;  1YZ7 A;  2M2W A;  3IG8 A;  8ICG A;  4RQ3 A;  4QZ9 A;  4B9V A;  4E0D A;  5ALW A;  3PR4 A;  1ZQT A;  1B4F A;  5IIJ A;  3QU5 A;  5IIK A;  3RH5 A;  3GIJ A;  1S0O A;  4GLX A;  4F5P A;  4FH3 A;  3KZI U;  2AGQ A;  1Z4O A;  1ZQR A;  2DPJ A;  4KN7 A;  2CN1 A;  3TAR A;  1X6J A;  5J0S A;  3QZ7 A;  1K5O A;  1ZQK A;  2IMW P;  4J9N A;  4DOA A;  3RJK A;  2HVH A;  1JN3 A;  2DL0 A;  4X4S A;  4RT3 A;  4CRX A;  2XC9 A;  1LB2 B;  2YMM A;  1ZD5 A;  4Q43 A;  1T4G A;  2JGA A;  1JI7 A;  4DF4 A;  4EBE A;  4F2S A;  2W3R A;  3M9M B;  4P0P A;  4UAU A;  3AQK A;  2BDU A;  4B9T A;  3JCF A;  4P0Q B;  5J2F A;  2K8B B;  1L7M A;  2HVI A;  2ZHB A;  4RQ7 A;  4UB3 A;  3RJF A;  3SAH A;  1N2X A;  2F76 X;  3H4B A;  4ECW A;  3A0H U;  1D9F A;  9ICX A;  4DFJ A;  4KLH A;  2K8C B;  3F5A A;  4UD5 A;  2VA8 A;  1O08 A;  2KVS A;  5KFE A;  4NJ8 A;  3NVY A;  2DRB A;  1ZJN A;  4F72 A;  5AK6 A;  3KD3 A;  4NV0 A;  5HHI A;  4O0I A;  4EEN A;  1WUD A;  5ALR A;  2DVI A;  3AQE A;  2ZTC A;  4DEZ A;  4BDP A;  3OSN A;  2ISO A;  2B56 A;  4Y2Q A;  4ED6 A;  4DS5 A;  3U26 A;  3OHA A;  4O3O A;  1F44 A;  4M9H A;  2I9G A;  4LEV A;  5HMM A;  4OCZ A;  2F1I A;  4XRH A;  3SEI A;  1NK6 A;  3TI0 A;  3RB3 A;  4P0Q A;  3ZD9 A;  2PFQ A;  2DR5 A;  4DL3 A;  4ED1 A;  4O6A A;  2HBM A;  1NK0 A;  2K60 A;  2MRL A;  4QZH A;  4EBK A;  3ERC C;  4C8O A;  2KJ9 A;  2ISP A;  5KFF A;  3PR5 B;  3M6K A;  2QB0 A;  3ER8 C;  4QWB A;  1ZQC A;  4Q44 A;  1SL0 A;  2ZIV B;  5T14 A;  2I5H A;  5KFA A;  1HUO A;  4EEK A;  3WU2 U;  2GAF D;  3RRG A;  4QW9 A;  2GA9 D;  5ALX A;  7ICE A;  4CGZ A;  4DOC A;  5DDM A;  2FJ6 A;  2XID A;  3BJY A;  2ZH1 A;  3LK9 A;  3H37 A;  2HN1 A;  1TK8 A;  4EX6 A;  3PW4 A;  2ZXI A;  3C29 A;  1ZQP A;  2LYA A;  2W55 A;  2XGP A;  3QXG A;  4Y2Y A;  3VCB A;  2CXY A;  2LI6 A;  3BS5 A;  3HKZ F;  5AK5 A;  4UAW A;  1T3N A;  3SR6 A;  1D9D A;  4WJ3 B;  1UET A;  1L7P A;  3RH6 A;  5F3X B;  1PK1 B;  2LPE A;  1MIV A;  3PMN A;  2ZIV A;  4UAT A;  4GC6 A;  3WKE A;  2JMG A;  4RQ4 A;  3NGD A;  4YFK A;  5AM0 A;  5AKL A;  4NY8 A;  8ICP A;  4O3N A;  1BPZ A;  2ODG A;  2P66 A;  1LV5 A;  3RJJ A;  4C8M A;  4FO1 A;  1XO0 A;  8ICB A;  5JUM A;  4F3O A;  1SKS A;  3CP8 A;  4GXI A;  5KFK A;  5ALO A;  1NO5 A;  5AKH A;  3HX0 A;  5JU5 A;  4R63 A;  7ICI A;  5HRE A;  1UT5 A;  2KHQ A;  2JEJ A;  2QAR B;  3QEA Z;  4DL4 A;  2HI0 A;  4TQS A;  1JXL A;  4KLO A;  2EAM A;  2EZZ A;  3PO5 A;  1IV8 A;  4QZG A;  3QUC A;  3IHQ B;  2YQE A;  2R8K A;  1ZQI A;  5ALD A;  2OWO A;  3NUQ A;  1U49 A;  4O9M A;  3WKC A;  5III A;  4TUQ A;  3C2K A;  2VA2 A;  4M2Y A;  3RAX A;  3RAQ A;  5AIA A;  4WOY A;  1WCN A;  2ZIX A;  4J9K A;  5AK3 A;  3H7I A;  3PST A;  3M1Y A;  4FBU A;  3JZ0 A;  2P6U A;  3SV3 A;  1L3U A;  3MGV A;  2PMZ F;  3IG5 A;  4O3Q A;  2WF7 A;  2EZY A;  3TFS A;  4BWJ A;  4QJF B;  1NK7 A;  1UPH A;  4CF3 A;  2J6U A;  4PL1 A;  2C22 A;  3C66 A;  1ZQG A;  2D3D A;  2KZ3 A;  4YD2 A;  2DQN B;  3O0F A;  4UAY A;  2F1J A;  1R89 A;  4EEB A;  4LEY A;  5D4B A;  2KP7 A;  4HAI A;  4X4N A;  1VLB A;  1SB3 C;  5CB1 A;  2W8K A;  1X9M A;  2BR0 A;  1SL2 A;  3IRU A;  1BNO A;  2H3V A;  4P4M A;  1ZYQ A;  1XNS A;  1FIQ A;  2E8P A;  4YMO A;  3ICX A;  5J2C A;  4OO1 J;  4XQ7 A;  4NKT A;  2PXI A;  2GWS A;  1ZQN A;  1KTQ A;  9ICL A;  4ACO A;  2LKY A;  1SXD A;  2KKP A;  2ZUC A;  1BPX A;  2LMR A;  3F2D A;  1TAU A;  2R8I A;  5DBA A;  3HPO A;  4RNM A;  1KW4 A;  2W04 A;  2HSZ A;  1FO4 A;  2EAN A;  2XGQ A;  4KMU A;  2DGZ A;  2IOH A;  4R8U A;  2LYH A;  5ALJ A;  3EWA A;  4CF4 A;  4IRD A;  5J2B A;  4E7X A;  4O5C A;  4DFP A;  2XY6 A;  4WC5 A;  2B0C A;  3MC1 A;  2BCS A;  7ICL A;  4QZD A;  1N61 A;  5DG7 A;  1OUQ A;  4K97 A;  2XVT A;  4KLQ A;  3T5H A;  2ASL A;  2JZB A;  4KB6 A;  5AI9 A;  4RWO A;  5G5G A;  7ICK A;  4DFK A;  2RLT A;  3QX7 A;  1N48 A;  2O5A A;  1PK3 A;  3KZX A;  2MU2 A;  4YP3 A;  4WC4 A;  3QE9 Y;  4RUC A;  4Z6D A;  2UVV A;  4UW9 A;  2ZH3 A;  2DFL A;  3UMB A;  4EBC A;  4A8E A;  5DB7 A;  1QCK A;  2XO7 A;  3OPX A;  3CW2 C;  2MUT B;  1KBU A;  4NLZ A;  3C23 A;  1V97 A;  4USA A;  1ZQ1 C;  4BUG A;  4RT2 A;  3OV7 A;  2ZH6 A;  3OSP A;  1RXW A;  2NRX A;  1L6N A;  4TUP A;  4KLI A;  3WK6 A;  3HKZ C;  3ISC A;  2KTQ A;  3RB6 A;  1NK5 A;  1UEV A;  4ELV A;  3MBY A;  4Y2S A;  1HEK A;  4WH5 A;  3TQ1 A;  4KLE A;  8ICJ A;  1PUZ A;  2Y9U A;  1DOQ A;  4QWD A;  1HUZ A;  3H8J A;  2R8J A;  2I6X A;  1ZD3 A;  2WF5 A;  2EQY A;  3E0F A;  2HBL A;  3NVW A;  3I1Y A;  5J2E A;  4AP9 A;  4KX3 A;  3MDC A;  2JV3 A;  3AUO A;  1ZJM A;  3ZDA A;  4EP7 A;  8ICY A;  5CJ7 A;  5DG9 A;  9ICT A;  2M2V A;  4PGX A;  1XSN A;  2XCP A;  2N1R A;  4X4R A;  8ICO A;  2DR9 A;  9ICE A;  2QB1 A;  1OW5 A;  1ZQM A;  4RQN A;  7ICN A;  1URJ A;  5B3P A;  3N7S C;  1UT8 A;  1V38 A;  2KNJ A;  5J0U A;  3H8M A;  2R8G A;  4DFD A;  3WFR E;  2JHD A;  4DQQ A;  3WKD A;  3KTQ A;  2C2R A;  2Q0Z X;  3OJS A;  1L8L A;  5AKZ A;  4ATB B;  4RQ1 A;  3AL0 B;  4Y2P A;  1L7O A;  2HHT A;  2DKX A;  1HIW A;  3V6K A;  1ZET A;  5HR9 A;  1SIJ A;  5L9X A;  4Q8E A;  1S9F A;  4KLS A;  4O3M A;  8ICK A;  3UPS A;  5KG1 A;  4IL6 U;  2MA1 A;  1XWL A;  4I29 A;  5ALZ A;  5AM4 A;  4GIB A;  4Y2U A;  4GC7 A;  8ICR A;  4JWN A;  5J29 A;  2ZIW B;  3IN5 A;  3RB0 A;  2NO5 A;  2YTU A;  1UEU A;  4YG2 A;  4RZR A;  2HHS A;  1F5S A;  4Z6C A;  2BBH A;  5J2I A;  2JH7 A;  3WFS C;  2W7O A;  4IRC A;  2XY7 A;  2NO4 A;  1TFR A;  1U47 A;  3A0B U;  4GXK A;  2HHU A;  3UXO A;  4TUR A;  2OEH A;  4GFJ A;  3L4P A;  5C0Y A;  8ICL A;  2OXO A;  4CNQ A;  2CPR A;  1TKD A;  5KT5 A;  2QLT A;  5F9L A;  5AIC A;  4FHV A;  1BGX T;  9ICP A;  4J9S A;  5KL8 B;  4X4O A;  4EZ9 A;  1B43 A;  3BQ2 A;  3C21 A;  1N60 A;  4QWA A;  1X9X A;  4ZOH C;  3VC8 A;  2BPF A;  1L8O A;  1S8O A;  5KFP A;  8ICU A;  1AQ6 A;  3BDP A;  5J8Y C;  2ASJ A;  2HBJ A;  5AI5 A;  3JPT A;  2HCF A;  1TAQ A;  4QZC A;  9ICQ A;  3C1Y A;  4O3R A;  3OGU A;  3B0Y A;  1SKR A;  4QZ8 A;  5ALH A;  3KFU F;  3H38 A;  4RPZ A;  3QU4 A;  4UB6 U;  2FCL A;  2K4H A;  2HOQ A;  1QSL A;  1XO1 A;  1UA0 A;  1D8Y A;  3KKA A;  3F2C A;  4IR9 A;  3RBD A;  1TAM A;  4EBD A;  2W9M A;  3UMG A;  7ICP A;  5KT3 A;  3ED5 A;  1RQL A;  2KOB A;  2F8L A;  2HHX A;  5A0L A;  7ICG A;  2O6K A;  1XS9 D;  2UVR A;  3Q8M A;  4M9G A;  4UB1 A;  3RTV A;  2ZIU B;  3T5K A;  5DBC A;  1JRP A;  1ZQZ A;  2V4Q A;  4DSL A;  4S3N A;  3AMZ A;  2KD1 A;  4DS4 A;  3ETR A;  3GFK B;  4WBY A;  4I2B A;  2IUB A;  2BPG A;  2WF9 A;  2K4E A;  2RFF A;  5KNI A; 
#chains in the Genus database with same CATH homology
 8ICF A;  1F5A A;  5KFG A;  3IM1 A;  1MQ3 A;  4AT7 B;  4KLO A;  7ICE A;  4PH5 A;  4DOC A;  4KN4 A;  1NKC A;  9ICC A;  1CUK A;  2BQR A;  5DDM A;  1L3V A;  1MC8 A;  3ZDC A;  9ICH A;  1PX5 A;  3C5G A;  4YMN A;  1VJ7 A;  4QZE A;  5KFM A;  1RXV A;  4KLG A;  4X4T A;  4YD1 A;  3Q8L A;  1B22 A;  5J0O A;  3BJY A;  1ZQJ A;  2ZH1 A;  3LK9 A;  3H37 A;  2AGP A;  2FMS A;  4F2R A;  3AU6 A;  3Q8S B;  4KLJ A;  3PX0 A;  1ZQE A;  4ELU A;  1TK8 A;  4IRK A;  8ICS A;  3PW4 A;  1L3T A;  5HC9 A;  1ZQP A;  4I2H A;  4FBT A;  1Z00 A;  2W9C A;  8ICI A;  2XGP A;  2HHP A;  1XC9 A;  3H40 A;  1JAJ A;  5KT7 A;  2FPM A;  4X4V A;  4ED7 A;  4UAW A;  1T3N A;  1D9D A;  3AU2 A;  1KDH A;  3V7L A;  4QZB A;  3G6V A;  3PO4 A;  2M2U A;  1UET A;  2V9W A;  5HRG A;  2ZH8 A;  4QW8 A;  3JPP A;  2B21 A;  3UXN A;  3RH6 A;  4X4Q A;  2M9N A;  3MFI A;  5J0R A;  5DLF A;  2M2T A;  4NLK A;  1DGS A;  2J6S A;  3JPS A;  1ZQS A;  3NTU A;  1MIV A;  3PMN A;  4DL2 A;  2WTF A;  1SZP A;  3NYB A;  4NLN A;  4MF8 A;  1NKE A;  2F1H A;  3PW7 A;  4WC2 A;  1TV9 A;  5KFT A;  4GC6 A;  4RPX A;  4ATB A;  4J9L A;  4KIT B;  4RQ4 A;  1ZQY A;  7ICT A;  3NGD A;  3MGH A;  2BGW A;  2HW3 A;  1Q79 A;  3C2M A;  4YFK A;  3GIM A;  4RWN A;  4NY8 A;  3RB4 A;  4RQ6 A;  8ICP A;  4DL5 A;  4RQ2 A;  3N97 B;  4O3N A;  4FO6 A;  2HHQ A;  3V7J A;  5HRI A;  1BPZ A;  4X4P A;  4M6W B;  4RNO A;  1ZQX A;  2P66 A;  1BPE A;  1LV5 A;  4YR3 A;  2V4R A;  3RJJ A;  4C8M A;  2DR8 A;  5KG6 A;  1MQ2 A;  8ICB A;  5JUM A;  4F5N A;  1SKS A;  4RNN A;  4F3O A;  4GXI A;  1MIW A;  5KFK A;  3Q8P B;  1NO5 A;  4R63 A;  1BPB A;  2RDI A;  5DDY A;  2ZTD A;  3HX0 A;  5DBB A;  1UT5 A;  1BVS A;  3MR2 A;  1T7P A;  7ICI A;  9ICG A;  5HRE A;  1S77 D;  1KNY A;  4AT9 B;  4JK1 A;  1UA1 A;  2FLL A;  4QWC A;  7ICQ A;  4B9L A;  2JEJ A;  4Q45 A;  3QEA Z;  4DL4 A;  5KTQ A;  2PFP A;  4TQS A;  4UAZ A;  3JPR A;  1JXL A;  3MGI A;  4MEX A;  4PHA A;  2BQU A;  4XA5 A;  2BPC A;  5KFX A;  4JV0 A;  2FMQ A;  2MAX A;  3ZDE A;  3EPI A;  5DKW A;  4CCH A;  4MFA A;  8ICW A;  9ICI A;  5CHG A;  3PO5 A;  4JUZ A;  4TQR A;  4JWM A;  3V6J A;  4DO9 A;  1L5U A;  4K4I A;  1ZQQ A;  4QZG A;  3IHQ B;  4QZA A;  2R8K A;  3RR8 A;  1ZQI A;  4O5K A;  4KLM A;  4F92 B;  5KFZ A;  1HJP A;  3ORY A;  2OWO A;  1U49 A;  4ECR A;  4O9M A;  5III A;  5C5J A;  4TUQ A;  3C2K A;  2VA2 A;  4M2Y A;  8ICM A;  4DFM A;  4RWQ A;  3RAX A;  3RAQ A;  3GV8 B;  3BQ0 A;  1DK3 A;  2NRV A;  1WCN A;  5HML A;  5J0W A;  5EWF A;  4J9K A;  3H7I A;  3H39 A;  3BQ1 A;  1JX4 A;  4AT8 A;  4O3S A;  3MR5 A;  4EYI B;  2PI4 A;  4YCX A;  4FBU A;  1NJW A;  1U48 A;  3JZ0 A;  3RR7 A;  2P6U A;  5IIO A;  5KFL A;  3SV3 A;  1L3U A;  2DPI A;  4UB4 A;  7ICF A;  1TFY A;  2ZJ8 A;  1ZQU A;  4O3Q A;  3ZD8 A;  3JPN A;  4PGY A;  4M9J A;  7ICV A;  5EWE A;  1ZQO A;  1KLN A;  2NRW A;  4TUS A;  3K75 D;  3TFS A;  2AU0 A;  3H8W A;  4BWJ A;  3EZ5 A;  4JV1 A;  4M6W A;  1A76 A;  1NK7 A;  4R66 A;  2J6U A;  2C22 A;  3C66 A;  4XQ8 A;  1ZQG A;  2KZ3 A;  3M9O B;  4YD2 A;  1S76 D;  5CWR A;  5IIN A;  5KG3 A;  5J0P A;  4UBC A;  4J9O A;  4UAY A;  2F1J A;  2VA3 A;  4B9N A;  4FHX A;  3PVX A;  1R89 A;  9ICF A;  3GV7 B;  5D4B A;  4DQI A;  2KP7 A;  4UD4 A;  4X4N A;  1CEZ A;  2ZJA A;  5CB1 A;  3KHG A;  2W8K A;  1X9M A;  2BR0 A;  4G3I A;  9ICN A;  1SL2 A;  3PX6 A;  4KLT A;  9ICW A;  4P4M A;  1BNO A;  1ZYQ A;  4PPX A;  5J2H A;  1COO A;  4YXJ A;  4WC7 A;  4Z6F A;  1S0V A;  5J0X A;  4FHP A;  4DSF A;  3EYZ A;  5DGA A;  5KT6 A;  5HNK A;  2W9B A;  4F5O A;  3TFR A;  1ARO P;  2IA6 A;  3UQ0 A;  4YMO A;  1IXR A;  5J2C A;  4DSE A;  2W8L A;  5D46 A;  4WC6 A;  3GIK A;  1Q78 A;  3RJE A;  4XQ7 A;  2ZH9 A;  1KFD A;  4NKT A;  3ETL A;  4YVZ A;  3MFH A;  4IQT A;  2PXI A;  5J2A A;  5L1K A;  1ZQN A;  1KTQ A;  2BCQ A;  2GWS A;  3Q8R B;  2PI5 A;  4F4K A;  4KLD A;  2BCU A;  4ECT A;  3MAB A;  4YXM A;  3TAQ A;  2UVU A;  4LVS A;  5IIM A;  1BPX A;  2ZUC A;  5J2G A;  4I2G A;  4F91 B;  5J0T A;  1TAU A;  3OVA A;  2R8I A;  5DBA A;  3HPO A;  4QWE A;  4RNM A;  3UPQ A;  1TVA A;  4M9L A;  1NK8 A;  3AQL A;  3WFO A;  2XGQ A;  4RQ8 A;  1KRP A;  4KMU A;  3H3A A;  7ICO A;  4RUA A;  5DED A;  4R8U A;  2Y1J A;  2LYH A;  8ICZ A;  3EWA A;  4X0A A;  4IRD A;  1IM4 A;  5J2B A;  3ISD A;  4DSJ A;  2HHV A;  4E7X A;  1KFS A;  5KFO A;  2IBK A;  4O5C A;  3RRH A;  4DFP A;  2XY6 A;  4DQS A;  8ICN A;  4M5D A;  4WC5 A;  5HRB A;  4F4Z A;  1WCL A;  5BOM A;  1A77 A;  5KG7 A;  3SYZ A;  1JIH A;  2BCS A;  3H4D A;  7ICL A;  3SV4 A;  4IQW A;  4QZD A;  3HIY A;  5DB9 A;  2BDP A;  1JMS A;  4ZH4 A;  5DG7 A;  4I2F A;  4FH5 A;  1RZT A;  2I1Q A;  3JYY A;  1QSY A;  4RWP A;  2ZHA A;  3G6X A;  2NRZ A;  5L1I A;  4KLQ A;  3C18 A;  1XSL A;  3LDA A;  3T5H A;  2ASL A;  5EWG A;  2JZB A;  1NJX A;  3HJ1 A;  4I2J A;  5BOL A;  5L1L A;  4ED8 A;  3BQT A;  4M47 A;  4WCW A;  1OU5 A;  4RWO A;  5HRK A;  4QZI A;  2ZUB A;  7ICK A;  4DFK A;  4E80 A;  1NK9 A;  4GXJ A;  2XCA A;  4IG8 A;  1N48 A;  4WBZ A;  9ICA A;  3FDS A;  4Q8F A;  1MSW D;  4RPY A;  5HHH A;  2O5A A;  3GV5 B;  4X5V A;  2FMP A;  1S10 A;  3WFQ E;  1EXN A;  4P4O A;  3KHL A;  1VFG A;  1ZQB A;  4F5R A;  4DSK A;  4YP3 A;  4AT7 A;  4WC4 A;  4NXZ A;  2ZJ5 A;  5DLG A;  4MEY A;  5KFC A;  3QE9 Y;  4RUC A;  1ZQV A;  4Z6D A;  2UVV A;  1SKW A;  4EZ6 A;  3PNC A;  1K1S A;  4PHD A;  4KLF A;  2ZH3 A;  4DL6 A;  1K1Q A;  2DFL A;  5DQI A;  4RU9 A;  4EBC A;  2XY5 A;  4DSI A;  7ICU A;  9ICO A;  2P6R A;  4XUS A;  5KFY A;  4NM2 A;  5DB7 A;  2XO7 A;  4EEY A;  2UVW A;  3G6Y A;  2NRK A;  7ICS A;  2MUT B;  4RQ5 A;  4KLU A;  1FA0 A;  2PFO A;  4I27 A;  7ICR A;  3HW8 A;  9ICK A;  5KFQ A;  4YMM A;  4NLZ A;  4B9U A;  3THV A;  3C23 A;  3T5L A;  4FS2 A;  2Q66 A;  3UXP A;  5HRF A;  4X4U A;  4RT2 A;  1MIY A;  1ZQL A;  5DB8 A;  2BQ3 A;  1XU4 A;  5KFW A;  4WC1 A;  1NJZ A;  1L3S A;  3OV7 A;  4NLG A;  5J2D A;  2AJQ A;  2ZH6 A;  4UQG A;  3MR3 A;  3OSP A;  1RXW A;  2NRX A;  4DL7 A;  4TUP A;  4KLI A;  1XSP A;  5IIL A;  1TK0 A;  3ISC A;  2JEF A;  2IHN A;  2KTQ A;  3RB6 A;  5EOZ A;  1NK5 A;  5CP2 A;  1X9W A;  2PBE A;  4YQW A;  4ECZ A;  3QEB Z;  1QTM A;  4ELV A;  1UEV A;  4EYH B;  3MBY A;  1U4B A;  5BPC A;  5J2J A;  3TQ1 A;  3PW0 A;  4KLE A;  8ICJ A;  5HRL A;  3HT3 A;  1DOQ A;  4QWD A;  1TK5 A;  3L9D A;  1HUZ A;  1BPD A;  3H8J A;  4C8K A;  9ICU A;  1TFW A;  2R8J A;  4EBJ A;  4F5Q A;  4B9M A;  1BNP A;  1JXE A;  4O5E A;  7ICM A;  3OVB A;  4FS1 A;  3GII A;  3HP6 A;  2KZZ A;  3RJI A;  2UVR A;  4MFC A;  2DR7 A;  4ECS A;  3AUO A;  5J2E A;  3ZDA A;  3MDC A;  1ZJM A;  4ED3 A;  3RH4 A;  4EP7 A;  4WC3 A;  2Y1I A;  1S0N A;  4K4G A;  1KEJ A;  5CJ7 A;  8ICY A;  1R8A A;  5KFR A;  5DG9 A;  3EPG A;  2ZUD A;  4YR2 A;  1X2I A;  4UB2 A;  4PGX A;  1XSN A;  4ECX A;  9ICT A;  2M2V A;  9ICM A;  5KFH A;  1RPL A;  2XCP A;  2JEI A;  4FHY A;  5J2K A;  4F4Y A;  3RJH A;  2IHM A;  4ED0 A;  3Q8K A;  8ICO A;  4DLG A;  3KHR A;  1QSS A;  4X4R A;  5KG2 A;  2H5X A;  3M9N B;  1S97 A;  4AT9 A;  2DR9 A;  1Z3E B;  3T5J A;  1ZQM A;  4I2D A;  9ICE A;  3V7K A;  5KT2 A;  8ICV A;  3FYH A;  3MR6 A;  2BE3 A;  3H8S A;  4RQ0 A;  3OJU A;  7ICN A;  4ECU A;  2FLN A;  1PZN A;  5L1J A;  4F50 A;  1KSP A;  1UT8 A;  4M9N A;  5KFU A;  5J0U A;  5DQH A;  1ZQD A;  3LQC B;  2KZM A;  1N56 A;  3RJG A;  1T8E A;  1YLQ A;  2R8G A;  3PML A;  4WC0 A;  3WFR E;  4F4W A;  4DQQ A;  4Z6E A;  3LWM A;  2JEG A;  9ICL A;  3KTQ A;  4DWI A;  5HRD A;  4IR1 A;  2C2R A;  2ZH4 A;  3LWL A;  3KHH A;  2Q0Z X;  3OJS A;  1NK4 A;  8ICH A;  1V9P A;  1ZQW A;  1ZQH A;  4ATB B;  4C8N A;  4RQ1 A;  4BXO B;  5KG5 A;  1Y88 A;  3GQC A;  4DQP A;  2HHT A;  2ZH7 A;  1BPY A;  2M2W A;  3V6K A;  8ICG A;  1ZET A;  5D49 A;  4RQ3 A;  4QZ9 A;  4B9V A;  5HR9 A;  4B9S A;  4E0D A;  4IQU A;  5L9X A;  4J9Q A;  3PR4 A;  5DB6 A;  1ZQT A;  4PGQ A;  4Q8E A;  1S9F A;  4KLS A;  2ZH5 A;  5KFJ A;  5IIJ A;  4ED2 A;  3RBE A;  1ZQA A;  8ICK A;  3UPS A;  5KG1 A;  5IIK A;  3RH5 A;  4YN4 A;  2ALZ A;  3GIJ A;  1XWL A;  1S0O A;  4I29 A;  4GLX A;  4C8L A;  4M0A A;  5DG8 A;  4F5P A;  4GC7 A;  1SL1 A;  8ICR A;  2O1P A;  4BWM A;  4FH3 A;  5F2V O;  2AGQ A;  4JWN A;  5J29 A;  2W9A A;  1ZQR A;  3ZDB A;  2DPJ A;  2BCR A;  1RYS A;  4NM1 A;  1WOT A;  3OHB A;  3RB0 A;  4KN7 A;  4M04 A;  3TAR A;  1UEU A;  5J0S A;  4YG2 A;  4RZR A;  3QZ7 A;  1D8L A;  1ZQK A;  1QLN A;  1R8C A;  5KG4 A;  2ASD A;  8ICT A;  9ICR A;  1R8B A;  2ZH2 A;  2HHS A;  2IMW P;  3OUY B;  4R65 A;  4J9N A;  4DOA A;  3SZ2 A;  3RJK A;  2J6T A;  4Z6C A;  4F8R A;  2HVH A;  4I28 A;  1JN3 A;  2ID1 A;  3UQ2 A;  1C7Y A;  5J2I A;  4X4S A;  3WFS C;  4RT3 A;  5KFI A;  2FPK A;  2XC9 A;  4IRC A;  2XY7 A;  4NKU A;  1LB2 B;  7ICH A;  2DRA A;  1TFR A;  4Q43 A;  1U47 A;  1T4G A;  4GXK A;  2HHW A;  4DF4 A;  2HHU A;  4EBE A;  4F2S A;  1ZQF A;  3M9M B;  9ICJ A;  3UXO A;  4TUR A;  5HRH A;  3AQK A;  3JPO A;  5F9N A;  4B9T A;  4P2H A;  9ICV A;  2NRT A;  1NOM A;  4PHE A;  4AT8 B;  2AQ0 A;  5J2F A;  8ICL A;  2KN7 A;  4BXO A;  2A1J B;  4I2A A;  3QZ8 A;  1H38 A;  1TKD A;  2HVI A;  2KFN A;  2ZHB A;  5KT5 A;  4QZF A;  4LZG A;  4F4X A;  4RQ7 A;  9ICS A;  5F9L A;  4J9M A;  4UB3 A;  3EW9 A;  3RJF A;  4FHV A;  4BGD A;  2R8H A;  5TZV A;  3HWT A;  3GIL A;  1BGX T;  9ICP A;  3C2L A;  4J9S A;  4MFF A;  4X4O A;  3H4B A;  4O3P A;  1B43 A;  3BQ2 A;  4ECW A;  3SI8 A;  3C21 A;  4DFJ A;  2C2E A;  1D9F A;  4EZ9 A;  4K4H A;  9ICX A;  4QWA A;  4KLH A;  8ICE A;  2VA8 A;  4UD5 A;  2BPF A;  5KFP A;  5CR0 A;  4MF2 A;  8ICU A;  3B0X A;  3MDA A;  3PV8 A;  1NZP A;  3BDP A;  5KFE A;  1X9S A;  2DRB A;  2ASJ A;  1ZJN A;  3TAN A;  9ICB A;  3JPT A;  4KLL A;  9ICQ A;  1TAQ A;  4QZC A;  3C1Y A;  5J0Q A;  5DQG A;  3OGU A;  3ZDD A;  4O3R A;  1KFT A;  3Q8Q B;  3B0Y A;  5KFN A;  3M8R A;  1SKR A;  4QZ8 A;  4DQR A;  2AQ4 A;  4LZD A;  5HHI A;  3H38 A;  4RPZ A;  4HYK A;  4O0I A;  1NKB A;  3AQN A;  1U9L A;  2VAN A;  5KFS A;  4UB5 A;  2FLP A;  8ICC A;  2DVI A;  4P4P A;  1QSL A;  1XO1 A;  1UA0 A;  3PW5 A;  2W9B B;  1D8Y A;  2ZTC A;  4YR0 A;  4ECQ A;  4IR9 A;  3OUY A;  3RBD A;  2FPL A;  4DEZ A;  3OSN A;  2ISO A;  4BDP A;  4EBD A;  2W9M A;  3PY8 A;  7ICP A;  5KT3 A;  4E8F A;  2PFN A;  4J9R A;  2C2D A;  2ZTE A;  5DGB A;  4ED6 A;  4UBB A;  4X0B A;  4JV2 A;  3E2E A;  2HHX A;  4I2C A;  4DS5 A;  3TAP A;  4KTQ A;  3OHA A;  3M8S A;  4O3O A;  5KT4 A;  2RDJ A;  3T3F A;  4I2I A;  4M9H A;  2I9G A;  7ICG A;  2C28 A;  5HMM A;  3PW2 A;  2F1I A;  4XRH A;  2BCV A;  1JQR A;  3AQM A;  1NK6 A;  3TI0 A;  3PX4 A;  1XS9 D;  5KFV A;  3RB3 A;  1Z00 B;  4R8U B;  2W9C B;  1NJY A;  3ZD9 A;  4PHP A;  3GDX A;  3Q8M A;  4UB1 A;  4M9G A;  2A1J A;  5KFD A;  2PFQ A;  4ECV A;  4DLE A;  1DK2 A;  2MUT A;  2DR5 A;  4DL3 A;  4ECY A;  4ED1 A;  3RTV A;  2BKE A;  4IQV A;  3V6H A;  5KFB A;  1V4A A;  1NK0 A;  3JPQ A;  4DF8 A;  4QZH A;  4I2E A;  2AGO A;  3T5K A;  4EBK A;  5DBC A;  1RYR A;  8ICA A;  4C8O A;  4R64 A;  1ZQZ A;  2ISP A;  8ICX A;  5HP4 A;  5KFF A;  3PR5 B;  1U45 A;  3K4G A;  2V4Q A;  4DSL A;  4S3N A;  3V72 A;  4F93 B;  3RRG A;  4DOB A;  2JZB B;  4QWB A;  2ATL A;  1ZQC A;  4Q44 A;  1SL0 A;  4DS4 A;  8ICQ A;  5DEC A;  3WFP A;  3GFK B;  4J9P A;  3C1Z A;  4LT6 A;  4WBY A;  4ELT A;  3N4M B;  3HJ4 A;  4I2B A;  5KFA A;  1HUO A;  2BHN A;  3C5F A;  2BPG A;  3ISB A;  1S0M A;  3OVS A;  7ICJ A;  2RFF A;  5J0Y A;  4FHW A;  2KFZ A;  5KG0 A;  4QW9 A;  5CA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...