4PPXA

Dna polymerase beta e295k with spiroiminodihydantoin in templating position
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
314
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of DNA Polymerase beta with DNA Containing the Base Lesion Spiroiminodihydantoin in a Templating Position.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 314
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ppxA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ppxA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ppxA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ppxA03
5HRFA 3RRGA 5KFVA 3MR5A 5KFGA 4IR1A 4FHWA 1U49A 4X4NA 3MABA 5DBCA 4ED1A 2BQUA 2HHPA 1BVSA 4LZDA 1ZQYA 2HHXA 9ICJA 5IIJA 8ICCA 9ICGA 5TZVA 4ED2A 3WFQE 7ICRA 4YD2A 3MGIA 3GIJA 4O3NA 4KLLA 9ICBA 3IHQB 2AJQA 2HHTA 3ETLA 4J9MA 4JWNA 3JPPA 2AGQA 2BPGA 3OUYA 5KG7A 4ECTA 5KFTA 2IA6A 4ECYA 1U45A 2W9BA 4I2DA 2C22A 4WBZA 4I2BA 3RB4A 1MQ2A 3JPSA 1S0OA 1D9FA 1SL0A 4KLDA 3K75D 3HW8A 4ECSA 3V6KA 3H40A 2ASDA 2BHNA 2BGWA 5DQHA 2M2UA 1QSSA 3JPOA 1RPLA 4EBJA 3PVXA 3PW5A 3NTUA 4RPYA 3TARA 1U4BA 1NJXA 8ICXA 5HRHA 3AQKA 4ATBA 5HRDA 4J9QA 3LWMA 3GV8B 2W8KA 4RT2A 4RQ4A 1RXVA 3M8RA 4DQIA 4ED3A 8ICGA 1D8LA 7ICVA 3NYBA 2GWSA 5L1IA 5HREA 4TUSA 2ZHAA 2A1JB 4C8OA 1DGSA 3GILA 4I2AA 4BWMA 5KFQA 4I2FA 2ASJA 1RZTA 3C2KA 3H8JA 3OUYB 3TANA 4EBDA 4UB1A 3PV8A 5KG6A 4PHEA 3SI8A 8ICBA 3JYYA 3C5GA 4J9KA 4DQPA 2ZH6A 4KLHA 4UBCA 1S10A 1NK4A 5CP2A 4J9NA 3KHLA 4NLZA 5IIOA 5J2FA 1R89A 1ZQAA 4QWBA 4DS4A 8ICWA 2BCRA 4ECZA 4KN4A 3OVAA 9ICEA 4X4OA 4YR2A 1DK3A 3UXOA 2BR0A 4B9NA 4FBUA 2HHVA 5DEDA 4MEYA 5KFSA 1S0VA 7ICSA 4NM1A 4F50A 8ICQA 3V7KA 3H3AA 2ZH4A 2DRAA 4AT9B 5IIKA 1TK8A 5J0WA 5J29A 4O5EA 4ZH4A 2W9MA 3RRHA 3RBEA 3ORYA 2UVVA 1ZQBA 1S76D 4LVSA 4TQSA 4WC6A 4XA5A 4O3QA 1KTQA 5D49A 4J9OA 2NRTA 3N4MB 5DGBA 2ATLA 1UEVA 3GIKA 4JV0A 3T5LA 5J2IA 4BDPA 1QTMA 1JX4A 4J9PA 1TAUA 3JPQA 4P2HA 4RQ8A 3PX4A 5IILA 3RJIA 2MUTB 4O5KA 3PMNA 1OU5A 4FHPA 3GV5B 5J2BA 5BOLA 2IMWP 2BDPA 2VA3A 1Q79A 5KT4A 5EWFA 2Q0ZX 3RJGA 3H39A 1TFYA 2W9CB 4F4KA 4NM2A 4Z6DA 3RB0A 1ZQWA 1UEUA 1T3NA 5HC9A 5EWEA 1XSNA 1JXLA 3MFHA 5HNKA 3ZDDA 1R8BA 3THVA 2BQRA 4AT9A 4Z6FA 1F5AA 5DG9A 3C21A 3GIMA 5DB6A 1DOQA 2KTQA 7ICHA 2NRWA 4TQRA 5HHHA 1RYRA 4DSKA 4ED0A 3OJSA 4K4IA 3GQCA 2XCPA 4Q8FA 3M9OB 2C2DA 4LT6A 4Q8EA 5DB9A 3QE9Y 1JIHA 1BGXT 1NO5A 4EBCA 4C8NA 5IIMA 4DOBA 4RQ1A 4TUPA 2Y1JA 1TK5A 1COOA 1JMSA 4PGYA 3PO5A 7ICQA 4UAZA 3C23A 5KFNA 4O0IA 4P4MA 3OGUA 1D9DA 4M9GA 5HRLA 4X4PA 3HP6A 3G6YA 8ICUA 4R63A 1PX5A 1S0MA 5KFEA 4YN4A 4AT8B 1A77A 5DLFA 4PPXA 4DSFA 3MFIA 4UAYA 8ICRA 3BQ1A 2V4QA 2FLPA 2HHSA 5J2DA 7ICOA 4MFFA 2ZH7A 3WFRE 2R8HA 8ICJA 5KFFA 1NKCA 5KFMA 3H4DA 5F9NA 1L3VA 3G6XA 4WC0A 4E80A 1JN3A 2I1QA 4YXMA 4R66A 2V4RA 3QEBZ 1D8YA 1XO1A 4X0BA 2B21A 4FO6A 2F1IA 5J2AA 5KG4A 2KZMA 4WC4A 2OWOA 5J0RA 3OVBA 5KFWA 4R64A 2W9AA 1V9PA 5KFRA 1L3TA 1KSPA 2ZJ8A 2PFNA 9ICPA 1HJPA 2BCUA 2J6SA 2KZ3A 4PHAA 5HRKA 3Q8LA 1A76A 4QZDA 1K1SA 1EXNA 1BPDA 4MFCA 2PXIA 3T5KA 2NRKA 5KFDA 1ZQNA 2HVHA 4RWNA 3Q8SB 3TAPA 7ICLA 3LDAA 5HMLA 1U9LA 5KFJA 4PHPA 4FH3A 7ICNA 1JAJA 5EWGA 2XGPA 3V6HA 3QZ8A 1U48A 4YXJA 4YMMA 3SV4A 3AQMA 4YR0A 4FBTA 3B0XA 2BQ3A 2ZUCA 3UXNA 3JPNA 2JZBA 4NLNA 4O5CA 4DFMA 4JUZA 3M8SA 3PNCA 4F5RA 3K4GA 4JV1A 2M9NA 2VA2A 4NXZA 4ECXA 5KFXA 2HW3A 1KDHA 4B9SA 7ICFA 7ICTA 3RH5A 2ID1A 4IQTA 3LK9A 3Q8KA 1B43A 2JEIA 4F2SA 5HRBA 3OSNA 1ZQLA 2ALZA 1NKBA 2HHUA 4QZHA 3MGHA 4X4VA 2F1JA 4GXJA 4QWCA 1QSLA 5C5JA 3ZDCA 2LYHA 4QWAA 4DL7A 4ATBB 2ZH3A 3UXPA 2C2RA 5L1JA 3EPGA 4RQ7A 4RUCA 4DFPA 4EYIB 4WC5A 1NOMA 4NKTA 4RWQA 2ZTCA 4MF8A 5J0SA 4I2HA 4GC6A 4DFJA 4YCXA 4GLXA 8ICSA 4FS1A 4CCHA 4RQ0A 2F1HA 4MFAA 7ICGA 4UB2A 4EEYA 1ZQQA 1NK7A 5KT7A 1TFWA 4YG2A 5L1LA 4FS2A 3BQTA 1X2IA 1KLNA 1SKSA 1S77D 5KG1A 2ZUBA 3HWTA 1Z00A 3SZ2A 4F91B 2NRVA 1ZQGA 4JWMA 2O1PA 2FPLA 3C66A 5KG3A 5F9LA 2C2EA 9ICRA 4IQWA 4UB4A 3H8SA 3JPRA 4X4QA 3ZDBA 1IXRA 4J9LA 2P66A 4M5DA 1DK2A 3UPSA 1ZQPA 5J0QA 5CR0A 4DQRA 2MAXA 5L9XA 2PI5A 9ICNA 4QZFA 3PW2A 4EYHB 4X4RA 5CA7A 4X4TA 3RJJA 1NZPA 4Z6CA 5KFHA 4Q44A 4DLEA 4DQSA 2Y1IA 4FHVA 1ZJNA 1ZQHA 4ECRA 2VA8A 5DDYA 2VANA 2C28A 1LB2B 4ELVA 4RT3A 1UA0A 5KFYA 8ICAA 1ZQOA 1ZQKA 4NLKA 5KTQA 2KFNA 5J0TA 4WC2A 4O3RA 4C8LA 5DG7A 1U47A 1XS9D 2PFOA 1BPYA 2KFZA 4AT8A 3MR6A 9ICMA 2AGOA 2DFLA 1XSLA 2R8GA 5DG8A 4DSIA 4IRDA 2V9WA 4BGDA 1JXEA 2W8LA 4O3PA 4UQGA 4FHXA 3WFOA 1RYSA 2FMSA 4GC7A 7ICEA 4FH5A 4X4SA 5J2CA 4XRHA 5J2EA 3PW4A 4DSLA 3QZ7A 5KT2A 2ZH5A 4UBBA 4DEZA 3NGDA 2WTFA 4ED8A 3OSPA 2AGPA 1S0NA 4R8UB 4KLIA 8ICPA 2RDJA 3PO4A 5DDMA 7ICPA 1BPZA 4R8UA 1L5UA 3RJFA 9ICHA 2DR7A 4F5PA 4DSEA 8ICYA 2DR9A 3BJYA 2FPKA 5KFOA 2XC9A 3TQ1A 2J6TA 2R8JA 4I2EA 4NY8A 4G3IA 4RQ3A 4E0DA 1NK0A 4C8MA 2DPJA 7ICIA 4DL2A 1LV5A 2FLLA 2DVIA 2W9BB 4KITB 4RWPA 1WCLA 3TFSA 2JEJA 3HX0A 3GIIA 2W9CA 4AT7B 4O3SA 8ICOA 2AU0A 4M9JA 2XCAA 1L3UA 2ISPA 3LQCB 5J2HA 3RB6A 2BCVA 1SZPA 8ICEA 1TAQA 4KLQA 2BCQA 4RUAA 2DR8A 2ZJ5A 1NJYA 2RFFA 3FDSA 2MUTA 5KFKA 1ZQMA 3GFKB 5DBBA 1B22A 4XUSA 3V72A 4KN7A 4F5NA 4NKUA 4RZRA 4M9HA 2UVRA 4UB3A 1BPEA 4YVZA 8ICNA 2BKEA 2DR5A 4R65A 4AT7A 8ICLA 2PFQA 4M04A 2ZJAA 3RR7A 5KT5A 1MC8A 5HRIA 4DWIA 1HUZA 4KLMA 3G6VA 8ICZA 1AROP 4KMUA 8ICKA 9ICLA 5KFZA 4M0AA 4MF2A 1KRPA 3AU6A 4X4UA 1X9SA 1NJWA 3H38A 4RQ5A 2HVIA 8ICTA 4QW9A 3OHAA 4ED6A 4PGXA 9ICTA 5DBAA 3MDCA 5KG2A 2XGQA 3C1YA 1TKDA 4DF4A 2KZZA 4E8FA 3RH6A 5EOZA 1MIYA 1ZQJA 4DF8A 4IG8A 1TV9A 2Q66A 3RTVA 3H37A 1KEJA 9ICFA 9ICQA 5HRGA 3HT3A 4IRKA 3EZ5A 2AQ4A 1XSPA 4DO9A 4TURA 2BCSA 3EPIA 3KTQA 5D4BA 2I9GA 2PI4A 5IINA 4RNOA 5BPCA 3KHRA 4MEXA 4DL3A 4J9SA 5KFIA 5KFLA 3TAQA 1UETA 3GV7B 3OHBA 4YR3A 5DQIA 3C2LA 2NRXA 3OVSA 5J0UA 4O3OA 4I2IA 5J2KA 3PR4A 3V7JA 4DL5A 2XY6A 4KLTA 3PW0A 3L9DA 4QW8A 2IBKA 4F4WA 2ZTEA 3Q8RB 1SKRA 8ICFA 4IQUA 3PX6A 5KFBA 9ICKA 4M9LA 5HMMA 4YP3A 4BXOA 3KHGA 4KLSA 4F4ZA 1ZQTA 3M9NB 3MBYA 3C5FA 4B9MA 4JV2A 2XY5A 1RXWA 1ZQCA 2KN7A 3ZD9A 3T5JA 1X9WA 3C1ZA 4I2GA 4QZBA 1NKEA 5CB1A 1S9FA 4IRCA 4UB5A 5KG5A 3KHHA 3RH4A 5KG0A 4F93B 2M2VA 4WBYA 4I2JA 1VFGA 3TI0A 1V4AA 1ZQVA 1KFDA 4KLUA 4O9MA 5J0OA 4KTQA 2DRBA 5HHIA 2ZHBA 4WC7A 4ELUA 2ZUDA 1ZJMA 4RQ2A 3Q8PB 4QZAA 3UPQA 4X0AA 4F5OA 1NK8A 3H7IA 4RPZA 3ISBA 5DGAA 4ECUA 1XU4A 4ELTA 4I28A 4P4PA 2FPMA 3MR2A 3HJ1A 3T5HA 2M2TA 5KFPA 1KFSA 2ASLA 3SV3A 1NK6A 4FHYA 3JPTA 5J0YA 4KLEA 2J6UA 4DL4A 4BXOB 5CJ7A 3EYZA 4IR9A 5HR9A 3RAQA 1UT5A 1KNYA 3C2MA 3HIYA 2R8KA 4EBKA 4GXIA 5F2VO 2NRZA 1QLNA 8ICMA 4F92B 5J0XA 4RWOA 4Q43A 1X9MA 3QEAZ 1SL2A 2ISOA 3RJKA 4K4GA 3B0YA 4RQ6A 2M2WA 1ZQZA 9ICIA 1SKWA 9ICVA 4B9TA 1HUOA 3MDAA 3OV7A 2FMQA 4M9NA 3PX0A 2ZH2A 2XO7A 2JEGA 1ZQEA 1L3SA 5IIIA 2FMPA 4EZ9A 3Q8QB 1BPBA 3HJ4A 3H4BA 3IM1A 5DQGA 3H8WA 2AQ0A 4QZ9A 4EP7A 4ECWA 4KLGA 4YFKA 3RB3A 1ZQUA 4Q45A 4X5VA 2ZH9A 1IM4A 3BQ2A 4GXKA 3HPOA 3UQ0A 4F3OA 5KFAA 2P6UA 4UAWA 4DLGA 1ZQSA 2PFPA 4DOAA 1S97A 1JQRA 3Q8MA 2KP7A 1H38A 5DLGA 5CHGA 1ZQXA 2P6RA 7ICUA 3PMLA 1Q78A 3RJEA 5J2GA 4RPXA 2H5XA 2UVWA 3PY8A 1UT8A 4M47A 9ICUA 1ZQDA 3AQLA 3RBDA 2ZH1A 4M2YA 1CEZA 9ICWA 2R8IA 1SL1A 2JZBB 5DB8A 1R8AA 3FYHA 1KFTA 9ICAA 8ICHA 5BOMA 1YLQA 4P4OA 5J2JA 3T3FA 2DPIA 3E2EA 3M9MB 1ZETA 5DB7A 4ECVA 2IHMA 4EBEA 4XQ7A 3ISCA 4ED7A 3JZ0A 4YQWA 4B9UA 3EWAA 3BQ0A 4DSJA 3TFRA 9ICCA 4F8RA 4F4YA 3OJUA 4PH5A 1K1QA 4F5QA 4DOCA 2UVUA 4F2RA 1Z00B 4I2CA 4ECQA 4TUQA 4B9VA 1BNPA 3C18A 1WOTA 4EZ6A 1WCNA 4M6WB 3AUOA 4Z6EA 4KLFA 3ZD8A 4QZEA 2HHQA 5KT3A 1Y88A 2A1JA 4J9RA 3ZDEA 5DKWA 2ZTDA 1BPXA 4UD5A 4WC3A 3SYZA 1MIVA 2O5AA 1ZYQA 3PR5B 1XC9A 1NK9A 1QSYA 1T4GA 3GDXA 2PBEA 1TK0A 5HP4A 9ICSA 8ICIA 4YMNA 3AQNA 5KFUA 4XQ8A 3V7LA 1ZQRA 5D46A 5J0PA 1MSWD 4QZIA 4IQVA 2JEFA 1T7PA 4QWEA 4WCWA 2BPFA 4K4HA 4RNMA 4I29A 2BE3A 4C8KA 1N56A 1XWLA 1NJZA 1PZNA 1T8EA 4I27A 1BNOA 4HYKA 2BPCA 4QZGA 5L1KA 1ZQIA 2FLNA 4LZGA 2HHWA 3WFSC 1VJ7A 3N97B 3BDPA 4WC1A 2RDIA 4QZ8A 4M6WA 4PHDA 4DQQA 3RJHA 3ZDAA 7ICMA 1MQ3A 4F4XA 2XY7A 5CWRA 4PGQA 1C7YA 4E7XA 1TFRA 7ICJA 4KLOA 4BWJA 1CUKA 3V6JA 4QZCA 5KFCA 2IHNA 5DECA 2ZH8A 3EW9A 5KT6A 3UQ2A 8ICVA 4RU9A 4RNNA 5JUMA 1TVAA 1NK5A 4KLJA 3AU2A 7ICKA 4YMOA 4S3NA 4UD4A 3RR8A 3PW7A 4DL6A 4DS5A 3LWLA 9ICXA 1R8CA 1FA0A 9ICOA 3ISDA 4YD1A 4NLGA 4B9LA 3WFPA 3RAXA 3MR3A 4JK1A 4DFKA 1UA1A 1ZQFA 1MIWA 1N48A 4QWDA 1Z3EB
chains in the Genus database with same CATH superfamily
3RRGA 5KFGA 3BQ7A 3AMZA 3K1RB 3QUBA 5DBCA 4K98A 4WJ3B 4LZDA 4ED2A 7ICRA 1FIQA 2ZIVB 4J9MA 3JPPA 4NL9A 2LM4A 4I2DA 2C22A 5AM4A 2ESEA 2XICA 1MQ2A 3JPSA 4KLDA 1SL0A 2ASDA 5DQHA 3JPOA 4EBJA 3PVXA 1NJXA 8ICXA 4ATBA 2RP5A 5HRDA 2K8AA 4QIWC 1D8LA 5CEHA 3KKAA 2K60A 3H8JA 3OUYB 2G5HB 3JYYA 4DQPA 3M1YA 4KLHA 5ALSA 1S10A 1NK4A 5CP2A 1L7PA 4DS4A 8ICWA 2BCRA 9ICEA 4X4OA 1DK3A 4YR2A 3UXOA 4B9NA 5AK5A 3PSPA 3D2SA 7ICSA 3HRDD 4JB3A 3V7KA 2DKZA 2ZH4A 5IIKA 4O5EA 5CRXA 2W9MA 3ORYA 3D6JA 4C80A 3N4MB 4WH5A 3GIKA 5J2IA 1QTMA 4O5KA 3PMNA 2G07A 1TAMA 2BDPA 5AK3A 2W9CB 4F4KA 4NM2A 1UEUA 1T3NA 2WF6A 4O68A 5EWEA 3WK6A 4AT9A 3PZPA 1F5AA 4Y2VA 5DB6A 5AKKA 1QQ6A 1NO5A 4EBCA 1S8OA 3TKAA 3LVVA 4C8NA 5IIMA 2Y1JA 3PO5A 4OJ6A 4PGYA 2B6GA 3PSIA 3GZFA 7ICQA 4UAZA 5AI6A 4X4PA 4P4MA 1D9DA 3TADC 4M9GA 2K4PA 3KD3A 1A77A 4DSFA 3MFIA 8ICRA 3BQ1A 2HHSA 2KJ5A 1L3VA 3G6XA 2KNJA 4E80A 3NVZA 3SR6A 1D8YA 4X0BA 2F1IA 3H0MB 4WC4A 5KFWA 2VKQA 2J6SA 1BPDA 4MFCA 1X6IA 3LYSA 1CRXA 4RWNA 2H3QA 5EWGA 3V6HA 5AKJA 4J03A 4YXJA 2LM1A 2QB0A 4FBTA 3B0XA 2ZUCA 4O5CA 5E79U 3PNCA 4F5RA 5AKZA 2M9NA 2VA2A 4US9A 2ID1A 4K96A 1Q46A 1MN8A 2JEIA 2ALZA 2HHUA 1DRGA 3QU7A 2F1JA 4QWCA 3ZDCA 2GLEA 2ZH3A 3MC1A 2C2RA 5ALTA 2IUBA 4WC5A 4EYIB 1NOMA 3E0FA 2MA1A 4GC6A 1ZD2P 5AICA 2FDRA 3KZXA 3H8MA 4Y2QA 5FP0A 1TFWA 4FS2A 1SKSA 3HWTA 3IRUA 3SZ2A 4F91B 4JWMA 3D2NA 5TISU 2LBOA 2G06A 2KVCA 5CR0A 2PI5A 9ICNA 3RJJA 4Q44A 1ED1A 3IDWA 1ZQHA 5DDYA 2VANA 2WAQC 1ZQKA 2K8BB 2KFNA 2OCEA 2GO7A 4NWIA 3MR6A 1XSLA 2R8GA 1N60A 4O6AA 1L8LA 2FMSA 7ICEA 2EANA 1J2NA 1Z4OA 4KLIA 1S0NA 7ICPA 4R8UA 9ICHA 2FPKA 2XC9A 4G3IA 4U7CA 5ALWA 2W9BB 4KITB 1V97A 2JEJA 1PUZA 2W9CA 2WF5A 2ISPA 3RB6A 3NVYA 4RUAA 2P35A 3FDSA 1ZQMA 4JLZA 1B22A 2GOLA 4KN7A 2UVRA 8ICNA 1QCKA 4R65A 3KFUF 8ICLA 2ZJAA 2HOIA 3RR7A 2N1RA 3ALRA 2QLTA 2WFAA 5KFZA 4M0AA 4MF2A 4X4UA 4C4SA 1SV0A 4UAUA 4ED6A 3C1YA 2YMQA 4DF4A 2G09A 2KZZA 2AXTU 4E8FA 2F8KA 1A0PA 1ZQJA 1TV9A 2F77X 3H37A 9ICFA 2VJ4A 5HRGA 2ZG6A 1XSPA 4DO9A 5D4BA 1SWVA 4MEXA 4DL3A 5KFLA 3BS5B 5DQIA 5JTGA 2E3TA 3V7JA 4DL5A 2XY6A 4KLTA 9ICKA 2ZTEA 1TE2A 4OJOA 3J81j 3KOOA 5GTIU 4BXOA 3KHGA 4KLSA 4F4ZA 1ZQTA 3M9NB 4RQNA 2YQEA 1JROA 2KN7A 2BZFA 1X9WA 3C1ZA 1NKEA 4IRCA 2JGAA 5ALFA 3O0FA 5KG5A 3PSFA 5KG0A 2M2VA 1V4AA 4KLUA 4O9MA 5J0OA 2DRBA 4EX6A 2ZUDA 5C0YA 4QZAA 4F5OA 2ZIXB 1NK8A 3FM9A 4KM5A 3MR2A 2KOBA 1B0XA 2M2TA 2ASLA 4CF4A 3HIYA 1KNYA 3RAQA 1UT5A 3C2MA 2R8KA 4F92B 3K7DA 1ZQZA 1WWVA 3PX0A 2XO7A 1ZQEA 4EZ9A 2FMPA 1RQLA 5AIAA 4ECWA 3QUTA 4YFKA 1ZQUA 4Q45A 4X5VA 2DUYA 2WAQF 4DLGA 2PFPA 4JLXA 2Z7JA 1LKYB 3HILA 1ZQXA 3PMLA 1Z19A 1V38A 2H5XA 2UVWA 1UT8A 1ZOLA 3TADA 9ICUA 1ZQDA 2ZH1A 9ICWA 2OHFA 3FYHA 1X42A 1YLQA 5ALLA 4UB8U 3M9MB 2IHMA 2ZIXA 4ECVA 3JZ0A 3EWAA 9ICCA 4DSJA 3TFRA 3OJUA 4DOCA 1BNPA 1Z00B 4ECQA 4TUQA 2JR5A 3AUOA 5KAFU 4KLFA 2KSOB 4J9RA 3WK7A 3FAHA 1ZYQA 3GDXA 1TK0A 2EWRA 3AQNA 1OW5A 5ALPA 5D46A 4LEZA 4QWEA 3R9KA 4OO1J 1BNOA 1N2XA 4LZGA 1ZQIA 5L1KA 4WC1A 2F2AB 3HKZC 4M6WA 3RJHA 7ICMA 1MQ3A 4F4XA 5CWRA 1TFRA 1ZD4A 7ICJA 4BWJA 1JRPA 5KFCA 2G0AA 4Y2RA 2Q4TA 1GPJA 3WU2U 1L7NA 4KLJA 4YMOA 1IV8A 2EAOA 3LWLA 4B9LA 1UA1A 1N48A 4CCHA 5HRFA 2H3IA 1U49A 2HHPA 9ICJA 9ICGA 4UB6U 3IHQB 2AJQA 3ETLA 2AGQA 3OUYA 4I2BA 2W54A 3RB4A 2B4VA 2PMZF 3V6KA 3BZCA 2BHNA 1QSSA 1RPLA 3PW5A 3NTUA 2E8NA 5HRHA 4AYBF 4DQIA 4RT2A 2PMZC 2RLTA 7ICVA 5L1IA 2MSNA 4TUSA 2A1JB 2MRLA 4C8OA 1DGSA 3HJEA 2EZZA 4BX9C 3NVWA 2YTUA 2YY6A 4DFDA 4EBDA 3PV8A 5KG6A 2EZXA 2W03A 4J9NA 4NLZA 5IIOA 5J2FA 4NJ8A 1R89A 4KN4A 3OVAA 2BR0A 2YX8A 3H3AA 4NM1A 4F50A 1PVQA 4AT9B 2OEHA 3SEIA 1TK8A 2HHTA 1S76D 4RWPA 3RRHA 4WC6A 2IOFA 4O3QA 1KTQA 4J9OA 5KAIU 2OXOA 3T5LA 4BDPA 1TAUA 4RQ8A 3PX4A 3LVWA 2K89A 1C20A 1Q79A 1GO3F 5KT4A 2Q0ZX 1X66A 3MFHA 5HNKA 3THVA 2DKXA 1SV0C 4Z6FA 5DG9A 5AI8A 1DOQA 2NRWA 4X4NA 4Q8FA 4ED0A 4K4IA 3GQCA 2QARA 4LT6A 3QE9Y 5A0LA 1BGXT 2M0NA 1PK3A 4DOBA 1JMSA 5KFNA 2B0CA 3HP6A 2KHQA 2WF9A 5KFEA 5DLFA 4NXWA 4UAYA 2FLPA 5J2DA 5ALGA 2R8HA 2E8PA 2ZIUB 1NKCA 5KFMA 1X6JA 5F9NA 1FFVA 4YXMA 3QEBZ 3NRWA 4WQKA 2A1AA 1NZBA 5J0RA 2AHOB 3OVBA 1L8OA 2F44A 4EEBA 1KBUA 4HAIA 2KZ3A 1VLBA 1EXNA 2PXIA 3T5KA 2NRKA 5KFDA 2HVHA 3Q8SB 3F2DA 4CF5A 5KFJA 1AQ6A 1JAJA 3QZ8A 4UW9A 4NXUA 2WF7A 2W04A 2JZBA 3F5EA 1ECWA 1COKA 1KDHA 3NWIA 2W55A 3LK9A 5CFTA 2DWQA 2GA9D 4QZHA 4QIWF 4X4VA 4QWAA 3AM9A 5L1JA 4RQ7A 5ALIA 4NKTA 4RWQA 4I2HA 4DFJA 4CE6A 4YCXA 8ICSA 3UMGA 4RQ0A 4MFAA 2QB0B 1ZRMA 3BQTA 1S77D 1Z00A 1ZQGA 2FPLA 3RF9A 4PZNA 5KG3A 4NXVA 4IQWA 3JPRA 5ALEA 4J9LA 2P66A 4IL6U 2E1FA 3UPSA 4OD0A 5J0QA 2MAXA 5L9XA 4QZFA 5ALYA 1NZPA 4Z6CA 5ALVA 2W7PA 1QQ5A 1N62A 2KICA 4C7ZA 4ELVA 1Z4NA 4NLKA 4WC2A 1XS9D 3ONNA 1BPYA 2AGOA 2LYAA 4DSIA 2YN4A 3SAFA 1SGGA 2V9WA 5D61A 4O3PA 5AKYA 4DSLA 3PW4A 3QZ7A 3K1ZA 3OSPA 3CP8A 4NLBA 4UBBA 4ED8A 4R8UB 9ICBA 2RDJA 5DDMA 1BPZA 2DR7A 1ZD5A 1L5UA 2DR9A 4F5PA 3BJYA 5AM1A 2R8JA 2J6TA 7ICIA 2DVIA 4E0DA 4C8MA 1CI4A 5ALKA 1RQNA 1WCLA 3B9JA 3TFSA 3HX0A 5EE1A 4O3SA 3QXGA 2AU0A 8ICOA 3ERCC 4EEKA 1SZPA 8ICEA 1LVHA 4UARA 2FJ6A 4F5NA 4Y2TA 4M9HA 4YVZA 2PFQA 5KT5A 2LKYA 4DWIA 4OCZA 3G6VA 9ICLA 4IC9A 3T79A 3AU6A 2YMLA 2HVIA 8ICTA 4QW9A 1VJ5A 3RH6A 5EOZA 1SXEA 4DF8A 4NLCA 3HT3A 2KZMA 1B4FA 3KTQA 3EPIA 2BBHA 4FFDA 5IINA 4RNOA 5BPCA 3KHRA 5KFIA 3TAQA 2JH7A 2NRXA 4O3OA 4I2IA 3PR4A 2YMPA 3UMCA 4QW8A 2IBKA 4F4WA 5KFBA 2GAFD 4M9LA 5EE3A 2KSOA 4YP3A 3C5FA 4JV2A 3VCBA 1RXWA 1ZQCA 3T5JA 3GU3A 1QQ7A 4EX7A 5CB1A 4QZBA 4WBYA 5ALRA 1KFDA 4KTQA 3ED5A 2ZHBA 4WC7A 4ELUA 4NXXA 5KL1B 4ELTA 1FO4A 1KFSA 3DDHA 3E58A 2EQYA 5KL8B 4DL4A 4OJ5A 5F2VO 2HBJA 5HR7A 4GXIA 1QLNA 3WKDA 4Q43A 2H3ZA 3QEAZ 4K4GA 5J8YC 2M2WA 5B3PA 2KIWA 4FE3A 4UASA 1SKWA 1HUOA 4EV6A 1L3SA 2HMXA 2AQ0A 4EP7A 4KLGA 1QH9A 3HPOA 4F3OA 2D6FC 4UAWA 4US8A 1ZQSA 3Q8MA 4P0QB 1H38A 2XI9A 1Q78A 4USAA 2KKVA 4NV0A 3QX7A 4M47A 4M2YA 1CEZA 2JZBB 5BOMA 4P4OA 2DPIA 1ZETA 2Y9TA 4YQWA 5B66U 3BQ0A 4F2RA 3L3FX 4B9VA 5AKXA 1L7OA 2L5YA 1FFUA 4EZ6A 1WCNA 1HEKA 3CK6A 5EE9A 4PL1A 2JRZA 4ICAA 3ZDEA 1BPXA 2WF8A 1QSYA 2EAPA 4K97A 2PBEA 3ER9B 5HP4A 2EAMA 2JEFA 1DGJA 4WCWA 4RNMA 2DQNB 4I27A 4XJEA 5D63A 2FLNA 4KX3A 2O6KA 3BDPA 3IG8A 1UPHA 2RDIA 2Y0SF 1SWWA 2ES6A 1O03A 2IHNA 2ZH8A 3EW9A 4RU9A 1NK5A 7ICKA 4PZOA 4UD4A 4B6JA 4DS5A 9ICOA 4NLGA 1MIWA 4DFKA 3N7SC 3I76A 5KFVA 3MR5A 3N7RC 4ACOA 4IR1A 4FHWA 4ED1A 1F44A 1ZQYA 2HHXA 5IIJA 8ICCA 3VC8A 4YD2A 3GIJA 3F2CA 3DV9A 3H0RB 2BPGA 4ECTA 5KFTA 4ECYA 2W9BA 1D9FA 2M2UA 3TARA 1U4BA 2QB1A 4J9QA 3DEEA 3GV8B 2W8KA 1RXVA 3NYBA 3M8RA 3PHZA 4LEYA 2FCLA 4PJ0U 4I2AA 3GILA 5KFQA 2ASJA 2D8CA 3OPXA 3S6JA 4FZLA 3SI8A 3C5GA 2ZH6A 5ALOA 3KHLA 1RYUA 1ZQAA 4QWBA 5CFUA 4ECZA 2HBLA 1JI7A 4FBUA 2HHVA 4MEYA 2DRAA 5AI9A 1KL9A 2HHWA 4ZH4A 2UVVA 5JU5A 4TQSA 3NS1A 2NRTA 3CRXA 5DGBA 3JPQA 1OU5A 4FHPA 5J2BA 2IMWP 2VA3A 3HJ1A 5EWFA 3H39A 2KHVA 3HKZF 3RB0A 1ZQWA 4OAIZ 1XSNA 1JXLA 3NUQA 2ZIWB 4MHVA 3ZDDA 2CRXA 1RYRA 5HHHA 4DSKA 1IG6A 3OJSA 2C2DA 4Q8EA 5AHXA 3KBBA 4RQ1A 4TUPA 1TK5A 1COOA 3C23A 3OGUA 2RRDA 1N61A 5HRLA 8ICUA 4R63A 4AT8B 4PPXA 2V4QA 2OM6A 2ZH7A 4MFFA 3WFRE 5H2FU 4DCCA 3H4DA 2WHEA 4CDGA 1JN3A 2V4RA 1OUQA 2B56A 1XO1A 2K4IA 2OWOA 2GH1A 4R64A 2W9AA 5KFRA 1L3TA 2BCUA 3SAHA 3Q8LA 1A76A 4QZDA 1K1SA 4EEDA 1N63A 1ZQNA 3TAPA 7ICLA 4UATA 3LDAA 4FH3A 7ICNA 3AQMA 4YMMA 3SV4A 2IHOA 2KVSA 3JPNA 4BUGA 4KX5A 4NLNA 4ZOHC 3EF2A 1F0MA 2VIXA 3K4GA 4NXZA 4FH5A 5J8YA 7ICTA 3ETRA 3Q8KA 5HRBA 3OSNA 3MGHA 4FO1A 4GXJA 1L6NA 3A0HU 4DL7A 3UXPA 5B5EU 4K99A 2ZTCA 5J0SA 4Y2UA 2F1HA 7ICGA 4UB2A 4EEYA 1ZQQA 4G9BA 5KT7A 2OH2A 4YG2A 3IG5A 1X2IA 1KLNA 5AKLA 4P0PB 2NRVA 2BBJA 4UB4A 4X4QA 1IXRA 3WK5A 4M5DA 2PKEA 4DQRA 4EYHB 5KFHA 4GIBA 4DLEA 2Y1IA 4FHVA 1ZJNA 3FC4A 3NVVA 2VA8A 3TACB 4RT3A 5KFYA 2KK0A 4KB6A 4F72A 2K4EA 1SZHA 4O3RA 4C8LA 2IOFK 1U47A 4AT8A 2KFZA 4JMUA 5ALMA 2Y9UA 4BGDA 2W8LA 4MKPA 4UQGA 4BJQA 2EDUA 2ZH2A 1K5OA 2AGPA 9ICPA 1SV4A 3PO4A 8ICYA 3IV6A 2G08A 5KFOA 4XQ7A 3TQ1A 1PX5A 1XNSA 4RQ3A 1WWUA 2DPJA 1LV5A 2FLLA 4AT7B 5AK4A 4M9JA 1L3UA 2ZIVA 5AKIA 3LQCB 5J2HA 3WKEA 2BCVA 4KLQA 2ZIUA 2ZJ5A 1NJYA 2CPRA 2D3DA 2DGZA 2I5HA 2MUTA 5KFKA 3GFKB 5DBBA 1JUDA 3V72A 5AM0A 4HX0A 4PL2A 4NKUA 1Q8KA 4Y2YA 4RZRA 4UB3A 1BPEA 2BKEA 4AT7A 4M04A 1MC8A 5HRIA 3QUQA 2W3RA 8ICZA 1KRPA 1X9SA 2Y0SC 1NJWA 3H38A 4K9AA 5DBAA 3MDCA 1TKDA 1M6YA 2EH9A 1MIYA 2CN1A 2Q66A 9ICQA 2AQ4A 2BCSA 2KP7A 2I9GA 1Z1VA 2RHFA 4J9SA 1RG6A 2NYVA 1UETA 3GV7B 3OVSA 2W7OA 3PW0A 3L9DA 3NKUA 1UQVA 3Q8RB 3NASA 4IQUA 3PX6A 5HMMA 4LJXA 3F53A 3MBYA 4B9MA 3MGVA 2XY5A 3ZD9A 3CNHA 2DF4B 1Z1BA 1S9FA 3KHHA 3SMVA 1VFGA 1S5LU 1ZQVA 5AI4A 4FZNA 5HHIA 1ZJMA 4K8VA 3Q8PB 3UPQA 4X0AA 2KV2A 3H7IA 4RPZA 3ISBA 4I28A 3UMBA 3IN5A 5KFPA 3SV3A 1NNLA 4BXOB 5HR9A 4RQMA 4EBKA 8ICMA 1UCVA 2KD1A 1SL2A 2ISOA 3RJKA 4RQ6A 5AKHA 2XIDA 2HN2A 3OV7A 4C4RA 3AEVA 3HJ4A 3Q8QB 1BPBA 3UM9A 3H4BA 1VDVA 3IM1A 2ZH9A 3BQ2A 2E5SA 2YMMA 3UQ0A 3WKBA 4CF3A 2DL0A 1JQRA 4I0UA 1O08A 5CHGA 1ZQ1C 3RJEA 5J2GA 1FEZA 4RPXA 4OAGA 5GTHU 2KJ8A 3AQLA 3AQEA 1SL1A 1R8AA 9ICAA 8ICHA 3E2EA 1YZ6A 4OAFA 5DB7A 4ED7A 5AM2A 3AL0B 4F4YA 1K1QA 4F5QA 4I2CA 4CNQA 4M6WB 4Y2PA 3A0BU 4QNLA 4GFJA 1YZ7A 2F76X 3ICXA 4QZEA 2HHQA 4WC3A 2E8MA 3KZIU 1MIVA 2O5AA 1NK9A 2JH1A 8ICIA 1Q3VA 4YMNA 4XQ8A 3V7LA 3BS5A 5J0PA 4IQVA 1T7PA 2BPFA 3N7PD 4C8KA 3L5KA 1N56A 4P0PA 1XWLA 1NJZA 1PZNA 2LPEA 2BPCA 4QZGA 1RM6C 3WFSC 2XVTA 1VJ7A 1DXSA 4PHDA 3QU2A 1PVPA 2I6XA 2XY7A 1Q3UA 4E7XA 5K4LA 3V6JA 1CUKA 1HIWA 5DECA 2FE9A 4IS7A 5KT6A 4RNNA 5JUMA 1TVAA 3AU2A 2KE7A 2YB4A 9ICXA 1FA0A 3ISDA 3WFPA 2W3SA 1ZQFA 4QWDA 3CYMA 2KEYA 2JXJA 3MABA 2BQUA 2JHDA 2KIVA 1BVSA 3WFQE 5TZVA 2HOQA 3I1YA 3MGIA 5ALXA 4O3NA 4Y2XA 1V85A 4KLLA 2BDUA 4JWNA 5KG7A 2IA6A 1U45A 4WBZA 2KKPA 1S0OA 1WG8A 3K75D 3WK8A 3HW8A 4ECSA 3H40A 2BGWA 5EE0A 4RPYA 4CRXA 4QJFB 3AQKA 4P0QA 3LWMA 3C28A 4RQ4A 8ICGA 4ED3A 5D62A 2K8CB 2GWSA 5HREA 2ZHAA 2QKQA 4OJLA 2A3VA 1PVRA 4BWMA 4I2FA 1RZTA 3C2KA 4A8EA 3TANA 4UB1A 4PHEA 8ICBA 4J9KA 5ALUA 4UBCA 3WK4A 2A19A 1T94A 1Z3EB 1X9XA 3PSTA 5DEDA 5KFSA 1S0VA 8ICQA 2HDOA 5J0WA 5J29A 3RBEA 1ZQBA 4LVSA 1N5WA 4XA5A 1D8BA 5D49A 2ATLA 2R18A 1UEVA 4JV0A 1JX4A 5CHEA 4J9PA 4P2HA 5IILA 3RJIA 2MUTB 2JMGA 3KKAC 5AKGA 3RFAA 3GV5B 3ZI4A 5BOLA 3RJGA 1TFYA 4Z6DA 5AIBA 5HC9A 4AP9A 1R8BA 2BQRA 1UHUA 3BS7A 3C21A 3GIMA 2KTQA 7ICHA 2ODGA 4KMOB 4TQRA 2ZXHA 2XCPA 2FI1A 3M9OB 5DB9A 1XO0A 1JIHA 3M7DA 5AI5A 4O0IA 3U26A 2HN1A 3G6YA 5ALDA 1S0MA 4YN4A 1N5XA 7ICOA 8ICJA 5KFFA 4WC0A 4R66A 2I1QA 3F5AA 4K9BA 1YT3A 2B21A 4FO6A 5J2AA 5KG4A 3M6ZA 2KMDA 1V9PA 2PFNA 1KSPA 2ZJ8A 4FHXA 1HJPA 5HRKA 4PHAA 4C0ZA 1J2MA 5HMLA 1U9LA 4PHPA 1RDFA 2XGPA 1U48A 4YR0A 5L1MA 2BQ3A 3UXNA 4EELA 4DFMA 4JUZA 3M8SA 1WUDA 4JV1A 2HW3A 4ECXA 5KFXA 4B9SA 7ICFA 3RH5A 4IQTA 4WQLA 1B43A 4F2SA 1ZQLA 1NKBA 2QARB 1QSLA 2WB1C 5C5JA 3D2QA 2LYHA 4ATBB 3EPGA 4RUCA 4DFPA 5AK6A 4MF8A 2ZIWA 4GLXA 4FS1A 3SQIA 1NK7A 5L1LA 2F3NA 5KG1A 2ZUBA 2O1PA 3C66A 2HBKA 2NO4A 5F9LA 2C2EA 9ICRA 3H8SA 1SB3C 5AM3A 5F3XB 2VJ5A 3ZDBA 1DK2A 1PK1A 1ZQPA 3PW2A 1OXJA 4X4RA 5CA7A 4X4TA 4DQSA 2EZYA 1T3QA 3IP4B 3SAGA 4ECRA 2C28A 1LB2B 3I28A 1UA0A 8ICAA 1ZQOA 5KTQA 5J0TA 1MA7A 3AQFA 5DG7A 4OAHA 2NO5A 3QU5A 4O3MA 4C4TA 5KNIA 2PFOA 9ICMA 2DFLA 5DG8A 4IRDA 2RQ5A 1JXEA 4AYBC 3WFOA 1RYSA 4GC7A 4X4SA 5J2CA 4XRHA 1IIPA 5J2EA 5G5GA 3H0LB 5KT2A 2ZH5A 2G5IB 4DEZA 3NGDA 2WTFA 8ICPA 3RJFA 4DSEA 1LKYA 4NY8A 3JCFA 2F8LA 4I2EA 3QU9A 1NK0A 2DBYA 4DL2A 5JTIA 1KN5A 3GIIA 1SIJA 2XCAA 2LMRA 2HI0A 2H3VA 2KJ9A 1TAQA 2BCQA 2YB1A 2DR8A 3OTQA 3QYPA 2RFFA 1KW4A 1ZXIA 4XUSA 4EENA 2DR5A 5CFSA 3WKCA 5AI0A 1HUZA 4KLMA 1AROP 1PK1B 2JV3A 4KMUA 4Y2SA 8ICKA 1KQQA 4RQ5A 3OHAA 1P7DA 4PGXA 9ICTA 5KG2A 2WB1F 2XGQA 3OWGA 5G5HA 4IG8A 3RTVA 1KEJA 2AH5A 2LYBA 4IRKA 3EZ5A 4TURA 2PI4A 4CGZA 3M6KA 3OHBA 4YR3A 3C2LA 5J0UA 5J2KA 4WOYA 1X40A 1SKRA 8ICFA 1A6SA 5AKEA 4O67A 3C29A 4I2GA 4UB5A 1SXDA 3RH4A 1WYGA 4F93B 3SENA 3NVOA 4I2JA 4OJPA 3AN1A 3TI0A 1F5SA 4NL9C 1ZD3A 2OYYA 3L4PA 4RQ2A 2ZXIA 3WK9A 2MU2A 4F71A 5DGAA 4ECUA 1XU4A 2LHTA 4P4PA 1J97A 2FPMA 3T5HA 1NK6A 4FHYA 3JPTA 5J0YA 4KLEA 2J6UA 4IR9A 3EUB2 5CJ7A 3EYZA 2NV3A 3QUCA 2NRZA 5J0XA 4FZMA 4RWOA 1L7MA 1X9MA 3B0YA 4NXTA 9ICIA 4N7RA 9ICVA 4B9TA 3MDAA 2FMQA 4M9NA 2JEGA 5IIIA 5DQGA 3H8WA 4QZ9A 3RB3A 5AM5A 1IM4A 2K4HA 1JALA 4GXKA 3SD7A 5KFAA 2P6UA 2HOFA 4DOAA 1S97A 3ER8C 2HBMA 5ALZA 5DLGA 2P6RA 7ICUA 5ALJA 3PY8A 5JRTA 3QU4A 3RBDA 5B3QA 3WKAA 2R8IA 3MCRA 5DB8A 1KFTA 2LI6A 3T3FA 5J2JA 2W43A 4EBEA 3ISCA 4B9UA 4F8RA 2W11A 2UVUA 4PH5A 4C7YA 3C18A 3QNMA 1WOTA 4EGWA 4UAVA 2IOHA 4Z6EA 1KKXA 4LEWA 2HCFA 3ZD8A 5ALHA 5KT3A 1Y88A 2A1JA 5DKWA 2ZTDA 4UD5A 3SYZA 3PR5B 1XC9A 1T4GA 2H3FA 9ICSA 5KFUA 1ZQRA 2B51A 2KG5A 1MSWD 3CW2C 4QZIA 3F2BA 4K4HA 4I29A 2BE3A 3N28A 1T8EA 4LEVA 4HYKA 4Y2JA 5HR6A 3N97B 1ZRNA 4QZ8A 4DQQA 3ZDAA 4PGQA 1C7YA 2HSZA 4KLOA 4O69A 4QZCA 3UQ2A 8ICVA 2E1EA 4S3NA 5T14A 1URJA 2CXYA 3RR8A 3PW7A 4DL6A 1R8CA 4U6PA 2E8OA 5ALNA 4YD1A 3BZKA 3RAXA 3MR3A 4JK1A 5ALQA 3NRZA 1NI3A
chains in the Genus database with same CATH topology
5HRFA 3RRGA 5KFVA 3MR5A 5KFGA 4IR1A 4FHWA 1U49A 4X4NA 3MABA 5DBCA 4ED1A 2BQUA 2HHPA 1BVSA 4LZDA 1ZQYA 2HHXA 9ICJA 5IIJA 8ICCA 9ICGA 5TZVA 4ED2A 3WFQE 7ICRA 4YD2A 3MGIA 3GIJA 4O3NA 4KLLA 9ICBA 3IHQB 2AJQA 2HHTA 3ETLA 4J9MA 4JWNA 3JPPA 2AGQA 2BPGA 3OUYA 5KG7A 4ECTA 5KFTA 2IA6A 4ECYA 1U45A 2W9BA 4I2DA 2C22A 4WBZA 4I2BA 3RB4A 1MQ2A 3JPSA 1S0OA 1D9FA 1SL0A 4KLDA 3K75D 3HW8A 4ECSA 3V6KA 3H40A 2ASDA 2BHNA 2BGWA 5DQHA 2M2UA 1QSSA 3JPOA 1RPLA 4EBJA 3PVXA 3PW5A 3NTUA 4RPYA 3TARA 1U4BA 1NJXA 8ICXA 5HRHA 3AQKA 4ATBA 5HRDA 4J9QA 3LWMA 3GV8B 2W8KA 4RT2A 4RQ4A 1RXVA 3M8RA 4DQIA 4ED3A 8ICGA 1D8LA 7ICVA 3NYBA 2GWSA 5L1IA 5HREA 4TUSA 2ZHAA 2A1JB 4C8OA 1DGSA 3GILA 4I2AA 4BWMA 5KFQA 4I2FA 2ASJA 1RZTA 3C2KA 3H8JA 3OUYB 3TANA 4EBDA 4UB1A 3PV8A 5KG6A 4PHEA 3SI8A 8ICBA 3JYYA 3C5GA 4J9KA 4DQPA 2ZH6A 4KLHA 4UBCA 1S10A 1NK4A 5CP2A 4J9NA 3KHLA 4NLZA 5IIOA 5J2FA 1R89A 1ZQAA 4QWBA 4DS4A 8ICWA 2BCRA 4ECZA 4KN4A 3OVAA 9ICEA 4X4OA 4YR2A 1DK3A 3UXOA 2BR0A 4B9NA 4FBUA 2HHVA 5DEDA 4MEYA 5KFSA 1S0VA 7ICSA 4NM1A 4F50A 8ICQA 3V7KA 3H3AA 2ZH4A 2DRAA 4AT9B 5IIKA 1TK8A 5J0WA 5J29A 4O5EA 4ZH4A 2W9MA 3RRHA 3RBEA 3ORYA 2UVVA 1ZQBA 1S76D 4LVSA 4TQSA 4WC6A 4XA5A 4O3QA 1KTQA 5D49A 4J9OA 2NRTA 3N4MB 5DGBA 2ATLA 1UEVA 3GIKA 4JV0A 3T5LA 5J2IA 4BDPA 1QTMA 1JX4A 4J9PA 1TAUA 3JPQA 4P2HA 4RQ8A 3PX4A 5IILA 3RJIA 2MUTB 4O5KA 3PMNA 1OU5A 4FHPA 3GV5B 5J2BA 5BOLA 2IMWP 2BDPA 2VA3A 1Q79A 5KT4A 5EWFA 2Q0ZX 3RJGA 3H39A 1TFYA 2W9CB 4F4KA 4NM2A 4Z6DA 3RB0A 1ZQWA 1UEUA 1T3NA 5HC9A 5EWEA 1XSNA 1JXLA 3MFHA 5HNKA 3ZDDA 1R8BA 3THVA 2BQRA 4AT9A 4Z6FA 1F5AA 5DG9A 3C21A 3GIMA 5DB6A 1DOQA 2KTQA 7ICHA 2NRWA 4TQRA 5HHHA 1RYRA 4DSKA 4ED0A 3OJSA 4K4IA 3GQCA 2XCPA 4Q8FA 3M9OB 2C2DA 4LT6A 4Q8EA 5DB9A 3QE9Y 1JIHA 1BGXT 1NO5A 4EBCA 4C8NA 5IIMA 4DOBA 4RQ1A 4TUPA 2Y1JA 1TK5A 1COOA 1JMSA 4PGYA 3PO5A 7ICQA 4UAZA 3C23A 5KFNA 4O0IA 4P4MA 3OGUA 1D9DA 4M9GA 5HRLA 4X4PA 3HP6A 3G6YA 8ICUA 4R63A 1PX5A 1S0MA 5KFEA 4YN4A 4AT8B 1A77A 5DLFA 4PPXA 4DSFA 3MFIA 4UAYA 8ICRA 3BQ1A 2V4QA 2FLPA 2HHSA 5J2DA 7ICOA 4MFFA 2ZH7A 3WFRE 2R8HA 8ICJA 5KFFA 1NKCA 5KFMA 3H4DA 5F9NA 1L3VA 3G6XA 4WC0A 4E80A 1JN3A 2I1QA 4YXMA 4R66A 2V4RA 3QEBZ 1D8YA 1XO1A 4X0BA 2B21A 4FO6A 2F1IA 5J2AA 5KG4A 2KZMA 4WC4A 2OWOA 5J0RA 3OVBA 5KFWA 4R64A 2W9AA 1V9PA 5KFRA 1L3TA 1KSPA 2ZJ8A 2PFNA 9ICPA 1HJPA 2BCUA 2J6SA 2KZ3A 4PHAA 5HRKA 3Q8LA 1A76A 4QZDA 1K1SA 1EXNA 1BPDA 4MFCA 2PXIA 3T5KA 2NRKA 5KFDA 1ZQNA 2HVHA 4RWNA 3Q8SB 3TAPA 7ICLA 3LDAA 5HMLA 1U9LA 5KFJA 4PHPA 4FH3A 7ICNA 1JAJA 5EWGA 2XGPA 3V6HA 3QZ8A 1U48A 4YXJA 4YMMA 3SV4A 3AQMA 4YR0A 4FBTA 3B0XA 2BQ3A 2ZUCA 3UXNA 3JPNA 2JZBA 4NLNA 4O5CA 4DFMA 4JUZA 3M8SA 3PNCA 4F5RA 3K4GA 4JV1A 2M9NA 2VA2A 4NXZA 4ECXA 5KFXA 2HW3A 1KDHA 4B9SA 7ICFA 7ICTA 3RH5A 2ID1A 4IQTA 3LK9A 3Q8KA 1B43A 2JEIA 4F2SA 5HRBA 3OSNA 1ZQLA 2ALZA 1NKBA 2HHUA 4QZHA 3MGHA 4X4VA 2F1JA 4GXJA 4QWCA 1QSLA 5C5JA 3ZDCA 2LYHA 4QWAA 4DL7A 4ATBB 2ZH3A 3UXPA 2C2RA 5L1JA 3EPGA 4RQ7A 4RUCA 4DFPA 4EYIB 4WC5A 1NOMA 4NKTA 4RWQA 2ZTCA 4MF8A 5J0SA 4I2HA 4GC6A 4DFJA 4YCXA 4GLXA 8ICSA 4FS1A 4CCHA 4RQ0A 2F1HA 4MFAA 7ICGA 4UB2A 4EEYA 1ZQQA 1NK7A 5KT7A 1TFWA 4YG2A 5L1LA 4FS2A 3BQTA 1X2IA 1KLNA 1SKSA 1S77D 5KG1A 2ZUBA 3HWTA 1Z00A 3SZ2A 4F91B 2NRVA 1ZQGA 4JWMA 2O1PA 2FPLA 3C66A 5KG3A 5F9LA 2C2EA 9ICRA 4IQWA 4UB4A 3H8SA 3JPRA 4X4QA 3ZDBA 1IXRA 4J9LA 2P66A 4M5DA 1DK2A 3UPSA 1ZQPA 5J0QA 5CR0A 4DQRA 2MAXA 5L9XA 2PI5A 9ICNA 4QZFA 3PW2A 4EYHB 4X4RA 5CA7A 4X4TA 3RJJA 1NZPA 4Z6CA 5KFHA 4Q44A 4DLEA 4DQSA 2Y1IA 4FHVA 1ZJNA 1ZQHA 4ECRA 2VA8A 5DDYA 2VANA 2C28A 1LB2B 4ELVA 4RT3A 1UA0A 5KFYA 8ICAA 1ZQOA 1ZQKA 4NLKA 5KTQA 2KFNA 5J0TA 4WC2A 4O3RA 4C8LA 5DG7A 1U47A 1XS9D 2PFOA 1BPYA 2KFZA 4AT8A 3MR6A 9ICMA 2AGOA 2DFLA 1XSLA 2R8GA 5DG8A 4DSIA 4IRDA 2V9WA 4BGDA 1JXEA 2W8LA 4O3PA 4UQGA 4FHXA 3WFOA 1RYSA 2FMSA 4GC7A 7ICEA 4FH5A 4X4SA 5J2CA 4XRHA 5J2EA 3PW4A 4DSLA 3QZ7A 5KT2A 2ZH5A 4UBBA 4DEZA 3NGDA 2WTFA 4ED8A 3OSPA 2AGPA 1S0NA 4R8UB 4KLIA 8ICPA 2RDJA 3PO4A 5DDMA 7ICPA 1BPZA 4R8UA 1L5UA 3RJFA 9ICHA 2DR7A 4F5PA 4DSEA 8ICYA 2DR9A 3BJYA 2FPKA 5KFOA 2XC9A 3TQ1A 2J6TA 2R8JA 4I2EA 4NY8A 4G3IA 4RQ3A 4E0DA 1NK0A 4C8MA 2DPJA 7ICIA 4DL2A 1LV5A 2FLLA 2DVIA 2W9BB 4KITB 4RWPA 1WCLA 3TFSA 2JEJA 3HX0A 3GIIA 2W9CA 4AT7B 4O3SA 8ICOA 2AU0A 4M9JA 2XCAA 1L3UA 2ISPA 3LQCB 5J2HA 3RB6A 2BCVA 1SZPA 8ICEA 1TAQA 4KLQA 2BCQA 4RUAA 2DR8A 2ZJ5A 1NJYA 2RFFA 3FDSA 2MUTA 5KFKA 1ZQMA 3GFKB 5DBBA 1B22A 4XUSA 3V72A 4KN7A 4F5NA 4NKUA 4RZRA 4M9HA 2UVRA 4UB3A 1BPEA 4YVZA 8ICNA 2BKEA 2DR5A 4R65A 4AT7A 8ICLA 2PFQA 4M04A 2ZJAA 3RR7A 5KT5A 1MC8A 5HRIA 4DWIA 1HUZA 4KLMA 3G6VA 8ICZA 1AROP 4KMUA 8ICKA 9ICLA 5KFZA 4M0AA 4MF2A 1KRPA 3AU6A 4X4UA 1X9SA 1NJWA 3H38A 4RQ5A 2HVIA 8ICTA 4QW9A 3OHAA 4ED6A 4PGXA 9ICTA 5DBAA 3MDCA 5KG2A 2XGQA 3C1YA 1TKDA 4DF4A 2KZZA 4E8FA 3RH6A 5EOZA 1MIYA 1ZQJA 4DF8A 4IG8A 1TV9A 2Q66A 3RTVA 3H37A 1KEJA 9ICFA 9ICQA 5HRGA 3HT3A 4IRKA 3EZ5A 2AQ4A 1XSPA 4DO9A 4TURA 2BCSA 3EPIA 3KTQA 5D4BA 2I9GA 2PI4A 5IINA 4RNOA 5BPCA 3KHRA 4MEXA 4DL3A 4J9SA 5KFIA 5KFLA 3TAQA 1UETA 3GV7B 3OHBA 4YR3A 5DQIA 3C2LA 2NRXA 3OVSA 5J0UA 4O3OA 4I2IA 5J2KA 3PR4A 3V7JA 4DL5A 2XY6A 4KLTA 3PW0A 3L9DA 4QW8A 2IBKA 4F4WA 2ZTEA 3Q8RB 1SKRA 8ICFA 4IQUA 3PX6A 5KFBA 9ICKA 4M9LA 5HMMA 4YP3A 4BXOA 3KHGA 4KLSA 4F4ZA 1ZQTA 3M9NB 3MBYA 3C5FA 4B9MA 4JV2A 2XY5A 1RXWA 1ZQCA 2KN7A 3ZD9A 3T5JA 1X9WA 3C1ZA 4I2GA 4QZBA 1NKEA 5CB1A 1S9FA 4IRCA 4UB5A 5KG5A 3KHHA 3RH4A 5KG0A 4F93B 2M2VA 4WBYA 4I2JA 1VFGA 3TI0A 1V4AA 1ZQVA 1KFDA 4KLUA 4O9MA 5J0OA 4KTQA 2DRBA 5HHIA 2ZHBA 4WC7A 4ELUA 2ZUDA 1ZJMA 4RQ2A 3Q8PB 4QZAA 3UPQA 4X0AA 4F5OA 1NK8A 3H7IA 4RPZA 3ISBA 5DGAA 4ECUA 1XU4A 4ELTA 4I28A 4P4PA 2FPMA 3MR2A 3HJ1A 3T5HA 2M2TA 5KFPA 1KFSA 2ASLA 3SV3A 1NK6A 4FHYA 3JPTA 5J0YA 4KLEA 2J6UA 4DL4A 4BXOB 5CJ7A 3EYZA 4IR9A 5HR9A 3RAQA 1UT5A 1KNYA 3C2MA 3HIYA 2R8KA 4EBKA 4GXIA 5F2VO 2NRZA 1QLNA 8ICMA 4F92B 5J0XA 4RWOA 4Q43A 1X9MA 3QEAZ 1SL2A 2ISOA 3RJKA 4K4GA 3B0YA 4RQ6A 2M2WA 1ZQZA 9ICIA 1SKWA 9ICVA 4B9TA 1HUOA 3MDAA 3OV7A 2FMQA 4M9NA 3PX0A 2ZH2A 2XO7A 2JEGA 1ZQEA 1L3SA 5IIIA 2FMPA 4EZ9A 3Q8QB 1BPBA 3HJ4A 3H4BA 3IM1A 5DQGA 3H8WA 2AQ0A 4QZ9A 4EP7A 4ECWA 4KLGA 4YFKA 3RB3A 1ZQUA 4Q45A 4X5VA 2ZH9A 1IM4A 3BQ2A 4GXKA 3HPOA 3UQ0A 4F3OA 5KFAA 2P6UA 4UAWA 4DLGA 1ZQSA 2PFPA 4DOAA 1S97A 1JQRA 3Q8MA 2KP7A 1H38A 5DLGA 5CHGA 1ZQXA 2P6RA 7ICUA 3PMLA 1Q78A 3RJEA 5J2GA 4RPXA 2H5XA 2UVWA 3PY8A 1UT8A 4M47A 9ICUA 1ZQDA 3AQLA 3RBDA 2ZH1A 4M2YA 1CEZA 9ICWA 2R8IA 1SL1A 2JZBB 5DB8A 1R8AA 3FYHA 1KFTA 9ICAA 8ICHA 5BOMA 1YLQA 4P4OA 5J2JA 3T3FA 2DPIA 3E2EA 3M9MB 1ZETA 5DB7A 4ECVA 2IHMA 4EBEA 4XQ7A 3ISCA 4ED7A 3JZ0A 4YQWA 4B9UA 3EWAA 3BQ0A 4DSJA 3TFRA 9ICCA 4F8RA 4F4YA 3OJUA 4PH5A 1K1QA 4F5QA 4DOCA 2UVUA 4F2RA 1Z00B 4I2CA 4ECQA 4TUQA 4B9VA 1BNPA 3C18A 1WOTA 4EZ6A 1WCNA 4M6WB 3AUOA 4Z6EA 4KLFA 3ZD8A 4QZEA 2HHQA 5KT3A 1Y88A 2A1JA 4J9RA 3ZDEA 5DKWA 2ZTDA 1BPXA 4UD5A 4WC3A 3SYZA 1MIVA 2O5AA 1ZYQA 3PR5B 1XC9A 1NK9A 1QSYA 1T4GA 3GDXA 2PBEA 1TK0A 5HP4A 9ICSA 8ICIA 4YMNA 3AQNA 5KFUA 4XQ8A 3V7LA 1ZQRA 5D46A 5J0PA 1MSWD 4QZIA 4IQVA 2JEFA 1T7PA 4QWEA 4WCWA 2BPFA 4K4HA 4RNMA 4I29A 2BE3A 4C8KA 1N56A 1XWLA 1NJZA 1PZNA 1T8EA 4I27A 1BNOA 4HYKA 2BPCA 4QZGA 5L1KA 1ZQIA 2FLNA 4LZGA 2HHWA 3WFSC 1VJ7A 3N97B 3BDPA 4WC1A 2RDIA 4QZ8A 4M6WA 4PHDA 4DQQA 3RJHA 3ZDAA 7ICMA 1MQ3A 4F4XA 2XY7A 5CWRA 4PGQA 1C7YA 4E7XA 1TFRA 7ICJA 4KLOA 4BWJA 1CUKA 3V6JA 4QZCA 5KFCA 2IHNA 5DECA 2ZH8A 3EW9A 5KT6A 3UQ2A 8ICVA 4RU9A 4RNNA 5JUMA 1TVAA 1NK5A 4KLJA 3AU2A 7ICKA 4YMOA 4S3NA 4UD4A 3RR8A 3PW7A 4DL6A 4DS5A 3LWLA 9ICXA 1R8CA 1FA0A 9ICOA 3ISDA 4YD1A 4NLGA 4B9LA 3WFPA 3RAXA 3MR3A 4JK1A 4DFKA 1UA1A 1ZQFA 1MIWA 1N48A 4QWDA 1Z3EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRF A;  3RRG A;  5KFV A;  3MR5 A;  5KFG A;  4IR1 A;  4FHW A;  1U49 A;  4X4N A;  3MAB A;  5DBC A;  4ED1 A;  2BQU A;  2HHP A;  1BVS A;  4LZD A;  1ZQY A;  2HHX A;  9ICJ A;  5IIJ A;  8ICC A;  9ICG A;  5TZV A;  4ED2 A;  3WFQ E;  7ICR A;  4YD2 A;  3MGI A;  3GIJ A;  4O3N A;  4KLL A;  9ICB A;  3IHQ B;  2AJQ A;  2HHT A;  3ETL A;  4J9M A;  4JWN A;  3JPP A;  2AGQ A;  2BPG A;  3OUY A;  5KG7 A;  4ECT A;  5KFT A;  2IA6 A;  4ECY A;  1U45 A;  2W9B A;  4I2D A;  2C22 A;  4WBZ A;  4I2B A;  3RB4 A;  1MQ2 A;  3JPS A;  1S0O A;  1D9F A;  1SL0 A;  4KLD A;  3K75 D;  3HW8 A;  4ECS A;  3V6K A;  3H40 A;  2ASD A;  2BHN A;  2BGW A;  5DQH A;  2M2U A;  1QSS A;  3JPO A;  1RPL A;  4EBJ A;  3PVX A;  3PW5 A;  3NTU A;  4RPY A;  3TAR A;  1U4B A;  1NJX A;  8ICX A;  5HRH A;  3AQK A;  4ATB A;  5HRD A;  4J9Q A;  3LWM A;  3GV8 B;  2W8K A;  4RT2 A;  4RQ4 A;  1RXV A;  3M8R A;  4DQI A;  4ED3 A;  8ICG A;  1D8L A;  7ICV A;  3NYB A;  2GWS A;  5L1I A;  5HRE A;  4TUS A;  2ZHA A;  2A1J B;  4C8O A;  1DGS A;  3GIL A;  4I2A A;  4BWM A;  5KFQ A;  4I2F A;  2ASJ A;  1RZT A;  3C2K A;  3H8J A;  3OUY B;  3TAN A;  4EBD A;  4UB1 A;  3PV8 A;  5KG6 A;  4PHE A;  3SI8 A;  8ICB A;  3JYY A;  3C5G A;  4J9K A;  4DQP A;  2ZH6 A;  4KLH A;  4UBC A;  1S10 A;  1NK4 A;  5CP2 A;  4J9N A;  3KHL A;  4NLZ A;  5IIO A;  5J2F A;  1R89 A;  1ZQA A;  4QWB A;  4DS4 A;  8ICW A;  2BCR A;  4ECZ A;  4KN4 A;  3OVA A;  9ICE A;  4X4O A;  4YR2 A;  1DK3 A;  3UXO A;  2BR0 A;  4B9N A;  4FBU A;  2HHV A;  5DED A;  4MEY A;  5KFS A;  1S0V A;  7ICS A;  4NM1 A;  4F50 A;  8ICQ A;  3V7K A;  3H3A A;  2ZH4 A;  2DRA A;  4AT9 B;  5IIK A;  1TK8 A;  5J0W A;  5J29 A;  4O5E A;  4ZH4 A;  2W9M A;  3RRH A;  3RBE A;  3ORY A;  2UVV A;  1ZQB A;  1S76 D;  4LVS A;  4TQS A;  4WC6 A;  4XA5 A;  4O3Q A;  1KTQ A;  5D49 A;  4J9O A;  2NRT A;  3N4M B;  5DGB A;  2ATL A;  1UEV A;  3GIK A;  4JV0 A;  3T5L A;  5J2I A;  4BDP A;  1QTM A;  1JX4 A;  4J9P A;  1TAU A;  3JPQ A;  4P2H A;  4RQ8 A;  3PX4 A;  5IIL A;  3RJI A;  2MUT B;  4O5K A;  3PMN A;  1OU5 A;  4FHP A;  3GV5 B;  5J2B A;  5BOL A;  2IMW P;  2BDP A;  2VA3 A;  1Q79 A;  5KT4 A;  5EWF A;  2Q0Z X;  3RJG A;  3H39 A;  1TFY A;  2W9C B;  4F4K A;  4NM2 A;  4Z6D A;  3RB0 A;  1ZQW A;  1UEU A;  1T3N A;  5HC9 A;  5EWE A;  1XSN A;  1JXL A;  3MFH A;  5HNK A;  3ZDD A;  1R8B A;  3THV A;  2BQR A;  4AT9 A;  4Z6F A;  1F5A A;  5DG9 A;  3C21 A;  3GIM A;  5DB6 A;  1DOQ A;  2KTQ A;  7ICH A;  2NRW A;  4TQR A;  5HHH A;  1RYR A;  4DSK A;  4ED0 A;  3OJS A;  4K4I A;  3GQC A;  2XCP A;  4Q8F A;  3M9O B;  2C2D A;  4LT6 A;  4Q8E A;  5DB9 A;  3QE9 Y;  1JIH A;  1BGX T;  1NO5 A;  4EBC A;  4C8N A;  5IIM A;  4DOB A;  4RQ1 A;  4TUP A;  2Y1J A;  1TK5 A;  1COO A;  1JMS A;  4PGY A;  3PO5 A;  7ICQ A;  4UAZ A;  3C23 A;  5KFN A;  4O0I A;  4P4M A;  3OGU A;  1D9D A;  4M9G A;  5HRL A;  4X4P A;  3HP6 A;  3G6Y A;  8ICU A;  4R63 A;  1PX5 A;  1S0M A;  5KFE A;  4YN4 A;  4AT8 B;  1A77 A;  5DLF A;  4PPX A;  4DSF A;  3MFI A;  4UAY A;  8ICR A;  3BQ1 A;  2V4Q A;  2FLP A;  2HHS A;  5J2D A;  7ICO A;  4MFF A;  2ZH7 A;  3WFR E;  2R8H A;  8ICJ A;  5KFF A;  1NKC A;  5KFM A;  3H4D A;  5F9N A;  1L3V A;  3G6X A;  4WC0 A;  4E80 A;  1JN3 A;  2I1Q A;  4YXM A;  4R66 A;  2V4R A;  3QEB Z;  1D8Y A;  1XO1 A;  4X0B A;  2B21 A;  4FO6 A;  2F1I A;  5J2A A;  5KG4 A;  2KZM A;  4WC4 A;  2OWO A;  5J0R A;  3OVB A;  5KFW A;  4R64 A;  2W9A A;  1V9P A;  5KFR A;  1L3T A;  1KSP A;  2ZJ8 A;  2PFN A;  9ICP A;  1HJP A;  2BCU A;  2J6S A;  2KZ3 A;  4PHA A;  5HRK A;  3Q8L A;  1A76 A;  4QZD A;  1K1S A;  1EXN A;  1BPD A;  4MFC A;  2PXI A;  3T5K A;  2NRK A;  5KFD A;  1ZQN A;  2HVH A;  4RWN A;  3Q8S B;  3TAP A;  7ICL A;  3LDA A;  5HML A;  1U9L A;  5KFJ A;  4PHP A;  4FH3 A;  7ICN A;  1JAJ A;  5EWG A;  2XGP A;  3V6H A;  3QZ8 A;  1U48 A;  4YXJ A;  4YMM A;  3SV4 A;  3AQM A;  4YR0 A;  4FBT A;  3B0X A;  2BQ3 A;  2ZUC A;  3UXN A;  3JPN A;  2JZB A;  4NLN A;  4O5C A;  4DFM A;  4JUZ A;  3M8S A;  3PNC A;  4F5R A;  3K4G A;  4JV1 A;  2M9N A;  2VA2 A;  4NXZ A;  4ECX A;  5KFX A;  2HW3 A;  1KDH A;  4B9S A;  7ICF A;  7ICT A;  3RH5 A;  2ID1 A;  4IQT A;  3LK9 A;  3Q8K A;  1B43 A;  2JEI A;  4F2S A;  5HRB A;  3OSN A;  1ZQL A;  2ALZ A;  1NKB A;  2HHU A;  4QZH A;  3MGH A;  4X4V A;  2F1J A;  4GXJ A;  4QWC A;  1QSL A;  5C5J A;  3ZDC A;  2LYH A;  4QWA A;  4DL7 A;  4ATB B;  2ZH3 A;  3UXP A;  2C2R A;  5L1J A;  3EPG A;  4RQ7 A;  4RUC A;  4DFP A;  4EYI B;  4WC5 A;  1NOM A;  4NKT A;  4RWQ A;  2ZTC A;  4MF8 A;  5J0S A;  4I2H A;  4GC6 A;  4DFJ A;  4YCX A;  4GLX A;  8ICS A;  4FS1 A;  4CCH A;  4RQ0 A;  2F1H A;  4MFA A;  7ICG A;  4UB2 A;  4EEY A;  1ZQQ A;  1NK7 A;  5KT7 A;  1TFW A;  4YG2 A;  5L1L A;  4FS2 A;  3BQT A;  1X2I A;  1KLN A;  1SKS A;  1S77 D;  5KG1 A;  2ZUB A;  3HWT A;  1Z00 A;  3SZ2 A;  4F91 B;  2NRV A;  1ZQG A;  4JWM A;  2O1P A;  2FPL A;  3C66 A;  5KG3 A;  5F9L A;  2C2E A;  9ICR A;  4IQW A;  4UB4 A;  3H8S A;  3JPR A;  4X4Q A;  3ZDB A;  1IXR A;  4J9L A;  2P66 A;  4M5D A;  1DK2 A;  3UPS A;  1ZQP A;  5J0Q A;  5CR0 A;  4DQR A;  2MAX A;  5L9X A;  2PI5 A;  9ICN A;  4QZF A;  3PW2 A;  4EYH B;  4X4R A;  5CA7 A;  4X4T A;  3RJJ A;  1NZP A;  4Z6C A;  5KFH A;  4Q44 A;  4DLE A;  4DQS A;  2Y1I A;  4FHV A;  1ZJN A;  1ZQH A;  4ECR A;  2VA8 A;  5DDY A;  2VAN A;  2C28 A;  1LB2 B;  4ELV A;  4RT3 A;  1UA0 A;  5KFY A;  8ICA A;  1ZQO A;  1ZQK A;  4NLK A;  5KTQ A;  2KFN A;  5J0T A;  4WC2 A;  4O3R A;  4C8L A;  5DG7 A;  1U47 A;  1XS9 D;  2PFO A;  1BPY A;  2KFZ A;  4AT8 A;  3MR6 A;  9ICM A;  2AGO A;  2DFL A;  1XSL A;  2R8G A;  5DG8 A;  4DSI A;  4IRD A;  2V9W A;  4BGD A;  1JXE A;  2W8L A;  4O3P A;  4UQG A;  4FHX A;  3WFO A;  1RYS A;  2FMS A;  4GC7 A;  7ICE A;  4FH5 A;  4X4S A;  5J2C A;  4XRH A;  5J2E A;  3PW4 A;  4DSL A;  3QZ7 A;  5KT2 A;  2ZH5 A;  4UBB A;  4DEZ A;  3NGD A;  2WTF A;  4ED8 A;  3OSP A;  2AGP A;  1S0N A;  4R8U B;  4KLI A;  8ICP A;  2RDJ A;  3PO4 A;  5DDM A;  7ICP A;  1BPZ A;  4R8U A;  1L5U A;  3RJF A;  9ICH A;  2DR7 A;  4F5P A;  4DSE A;  8ICY A;  2DR9 A;  3BJY A;  2FPK A;  5KFO A;  2XC9 A;  3TQ1 A;  2J6T A;  2R8J A;  4I2E A;  4NY8 A;  4G3I A;  4RQ3 A;  4E0D A;  1NK0 A;  4C8M A;  2DPJ A;  7ICI A;  4DL2 A;  1LV5 A;  2FLL A;  2DVI A;  2W9B B;  4KIT B;  4RWP A;  1WCL A;  3TFS A;  2JEJ A;  3HX0 A;  3GII A;  2W9C A;  4AT7 B;  4O3S A;  8ICO A;  2AU0 A;  4M9J A;  2XCA A;  1L3U A;  2ISP A;  3LQC B;  5J2H A;  3RB6 A;  2BCV A;  1SZP A;  8ICE A;  1TAQ A;  4KLQ A;  2BCQ A;  4RUA A;  2DR8 A;  2ZJ5 A;  1NJY A;  2RFF A;  3FDS A;  2MUT A;  5KFK A;  1ZQM A;  3GFK B;  5DBB A;  1B22 A;  4XUS A;  3V72 A;  4KN7 A;  4F5N A;  4NKU A;  4RZR A;  4M9H A;  2UVR A;  4UB3 A;  1BPE A;  4YVZ A;  8ICN A;  2BKE A;  2DR5 A;  4R65 A;  4AT7 A;  8ICL A;  2PFQ A;  4M04 A;  2ZJA A;  3RR7 A;  5KT5 A;  1MC8 A;  5HRI A;  4DWI A;  1HUZ A;  4KLM A;  3G6V A;  8ICZ A;  1ARO P;  4KMU A;  8ICK A;  9ICL A;  5KFZ A;  4M0A A;  4MF2 A;  1KRP A;  3AU6 A;  4X4U A;  1X9S A;  1NJW A;  3H38 A;  4RQ5 A;  2HVI A;  8ICT A;  4QW9 A;  3OHA A;  4ED6 A;  4PGX A;  9ICT A;  5DBA A;  3MDC A;  5KG2 A;  2XGQ A;  3C1Y A;  1TKD A;  4DF4 A;  2KZZ A;  4E8F A;  3RH6 A;  5EOZ A;  1MIY A;  1ZQJ A;  4DF8 A;  4IG8 A;  1TV9 A;  2Q66 A;  3RTV A;  3H37 A;  1KEJ A;  9ICF A;  9ICQ A;  5HRG A;  3HT3 A;  4IRK A;  3EZ5 A;  2AQ4 A;  1XSP A;  4DO9 A;  4TUR A;  2BCS A;  3EPI A;  3KTQ A;  5D4B A;  2I9G A;  2PI4 A;  5IIN A;  4RNO A;  5BPC A;  3KHR A;  4MEX A;  4DL3 A;  4J9S A;  5KFI A;  5KFL A;  3TAQ A;  1UET A;  3GV7 B;  3OHB A;  4YR3 A;  5DQI A;  3C2L A;  2NRX A;  3OVS A;  5J0U A;  4O3O A;  4I2I A;  5J2K A;  3PR4 A;  3V7J A;  4DL5 A;  2XY6 A;  4KLT A;  3PW0 A;  3L9D A;  4QW8 A;  2IBK A;  4F4W A;  2ZTE A;  3Q8R B;  1SKR A;  8ICF A;  4IQU A;  3PX6 A;  5KFB A;  9ICK A;  4M9L A;  5HMM A;  4YP3 A;  4BXO A;  3KHG A;  4KLS A;  4F4Z A;  1ZQT A;  3M9N B;  3MBY A;  3C5F A;  4B9M A;  4JV2 A;  2XY5 A;  1RXW A;  1ZQC A;  2KN7 A;  3ZD9 A;  3T5J A;  1X9W A;  3C1Z A;  4I2G A;  4QZB A;  1NKE A;  5CB1 A;  1S9F A;  4IRC A;  4UB5 A;  5KG5 A;  3KHH A;  3RH4 A;  5KG0 A;  4F93 B;  2M2V A;  4WBY A;  4I2J A;  1VFG A;  3TI0 A;  1V4A A;  1ZQV A;  1KFD A;  4KLU A;  4O9M A;  5J0O A;  4KTQ A;  2DRB A;  5HHI A;  2ZHB A;  4WC7 A;  4ELU A;  2ZUD A;  1ZJM A;  4RQ2 A;  3Q8P B;  4QZA A;  3UPQ A;  4X0A A;  4F5O A;  1NK8 A;  3H7I A;  4RPZ A;  3ISB A;  5DGA A;  4ECU A;  1XU4 A;  4ELT A;  4I28 A;  4P4P A;  2FPM A;  3MR2 A;  3HJ1 A;  3T5H A;  2M2T A;  5KFP A;  1KFS A;  2ASL A;  3SV3 A;  1NK6 A;  4FHY A;  3JPT A;  5J0Y A;  4KLE A;  2J6U A;  4DL4 A;  4BXO B;  5CJ7 A;  3EYZ A;  4IR9 A;  5HR9 A;  3RAQ A;  1UT5 A;  1KNY A;  3C2M A;  3HIY A;  2R8K A;  4EBK A;  4GXI A;  5F2V O;  2NRZ A;  1QLN A;  8ICM A;  4F92 B;  5J0X A;  4RWO A;  4Q43 A;  1X9M A;  3QEA Z;  1SL2 A;  2ISO A;  3RJK A;  4K4G A;  3B0Y A;  4RQ6 A;  2M2W A;  1ZQZ A;  9ICI A;  1SKW A;  9ICV A;  4B9T A;  1HUO A;  3MDA A;  3OV7 A;  2FMQ A;  4M9N A;  3PX0 A;  2ZH2 A;  2XO7 A;  2JEG A;  1ZQE A;  1L3S A;  5III A;  2FMP A;  4EZ9 A;  3Q8Q B;  1BPB A;  3HJ4 A;  3H4B A;  3IM1 A;  5DQG A;  3H8W A;  2AQ0 A;  4QZ9 A;  4EP7 A;  4ECW A;  4KLG A;  4YFK A;  3RB3 A;  1ZQU A;  4Q45 A;  4X5V A;  2ZH9 A;  1IM4 A;  3BQ2 A;  4GXK A;  3HPO A;  3UQ0 A;  4F3O A;  5KFA A;  2P6U A;  4UAW A;  4DLG A;  1ZQS A;  2PFP A;  4DOA A;  1S97 A;  1JQR A;  3Q8M A;  2KP7 A;  1H38 A;  5DLG A;  5CHG A;  1ZQX A;  2P6R A;  7ICU A;  3PML A;  1Q78 A;  3RJE A;  5J2G A;  4RPX A;  2H5X A;  2UVW A;  3PY8 A;  1UT8 A;  4M47 A;  9ICU A;  1ZQD A;  3AQL A;  3RBD A;  2ZH1 A;  4M2Y A;  1CEZ A;  9ICW A;  2R8I A;  1SL1 A;  2JZB B;  5DB8 A;  1R8A A;  3FYH A;  1KFT A;  9ICA A;  8ICH A;  5BOM A;  1YLQ A;  4P4O A;  5J2J A;  3T3F A;  2DPI A;  3E2E A;  3M9M B;  1ZET A;  5DB7 A;  4ECV A;  2IHM A;  4EBE A;  4XQ7 A;  3ISC A;  4ED7 A;  3JZ0 A;  4YQW A;  4B9U A;  3EWA A;  3BQ0 A;  4DSJ A;  3TFR A;  9ICC A;  4F8R A;  4F4Y A;  3OJU A;  4PH5 A;  1K1Q A;  4F5Q A;  4DOC A;  2UVU A;  4F2R A;  1Z00 B;  4I2C A;  4ECQ A;  4TUQ A;  4B9V A;  1BNP A;  3C18 A;  1WOT A;  4EZ6 A;  1WCN A;  4M6W B;  3AUO A;  4Z6E A;  4KLF A;  3ZD8 A;  4QZE A;  2HHQ A;  5KT3 A;  1Y88 A;  2A1J A;  4J9R A;  3ZDE A;  5DKW A;  2ZTD A;  1BPX A;  4UD5 A;  4WC3 A;  3SYZ A;  1MIV A;  2O5A A;  1ZYQ A;  3PR5 B;  1XC9 A;  1NK9 A;  1QSY A;  1T4G A;  3GDX A;  2PBE A;  1TK0 A;  5HP4 A;  9ICS A;  8ICI A;  4YMN A;  3AQN A;  5KFU A;  4XQ8 A;  3V7L A;  1ZQR A;  5D46 A;  5J0P A;  1MSW D;  4QZI A;  4IQV A;  2JEF A;  1T7P A;  4QWE A;  4WCW A;  2BPF A;  4K4H A;  4RNM A;  4I29 A;  2BE3 A;  4C8K A;  1N56 A;  1XWL A;  1NJZ A;  1PZN A;  1T8E A;  4I27 A;  1BNO A;  4HYK A;  2BPC A;  4QZG A;  5L1K A;  1ZQI A;  2FLN A;  4LZG A;  2HHW A;  3WFS C;  1VJ7 A;  3N97 B;  3BDP A;  4WC1 A;  2RDI A;  4QZ8 A;  4M6W A;  4PHD A;  4DQQ A;  3RJH A;  3ZDA A;  7ICM A;  1MQ3 A;  4F4X A;  2XY7 A;  5CWR A;  4PGQ A;  1C7Y A;  4E7X A;  1TFR A;  7ICJ A;  4KLO A;  4BWJ A;  1CUK A;  3V6J A;  4QZC A;  5KFC A;  2IHN A;  5DEC A;  2ZH8 A;  3EW9 A;  5KT6 A;  3UQ2 A;  8ICV A;  4RU9 A;  4RNN A;  5JUM A;  1TVA A;  1NK5 A;  4KLJ A;  3AU2 A;  7ICK A;  4YMO A;  4S3N A;  4UD4 A;  3RR8 A;  3PW7 A;  4DL6 A;  4DS5 A;  3LWL A;  9ICX A;  1R8C A;  1FA0 A;  9ICO A;  3ISD A;  4YD1 A;  4NLG A;  4B9L A;  3WFP A;  3RAX A;  3MR3 A;  4JK1 A;  4DFK A;  1UA1 A;  1ZQF A;  1MIW A;  1N48 A;  4QWD A;  1Z3E B; 
#chains in the Genus database with same CATH topology
 3RRG A;  5KFG A;  3BQ7 A;  3AMZ A;  3K1R B;  3QUB A;  5DBC A;  4K98 A;  4WJ3 B;  4LZD A;  4ED2 A;  7ICR A;  1FIQ A;  2ZIV B;  4J9M A;  3JPP A;  4NL9 A;  2LM4 A;  4I2D A;  2C22 A;  5AM4 A;  2ESE A;  2XIC A;  1MQ2 A;  3JPS A;  4KLD A;  1SL0 A;  2ASD A;  5DQH A;  3JPO A;  4EBJ A;  3PVX A;  1NJX A;  8ICX A;  4ATB A;  2RP5 A;  5HRD A;  2K8A A;  4QIW C;  1D8L A;  5CEH A;  3KKA A;  2K60 A;  3H8J A;  3OUY B;  2G5H B;  3JYY A;  4DQP A;  3M1Y A;  4KLH A;  5ALS A;  1S10 A;  1NK4 A;  5CP2 A;  1L7P A;  4DS4 A;  8ICW A;  2BCR A;  9ICE A;  4X4O A;  1DK3 A;  4YR2 A;  3UXO A;  4B9N A;  5AK5 A;  3PSP A;  3D2S A;  7ICS A;  3HRD D;  4JB3 A;  3V7K A;  2DKZ A;  2ZH4 A;  5IIK A;  4O5E A;  5CRX A;  2W9M A;  3ORY A;  3D6J A;  4C80 A;  3N4M B;  4WH5 A;  3GIK A;  5J2I A;  1QTM A;  4O5K A;  3PMN A;  2G07 A;  1TAM A;  2BDP A;  5AK3 A;  2W9C B;  4F4K A;  4NM2 A;  1UEU A;  1T3N A;  2WF6 A;  4O68 A;  5EWE A;  3WK6 A;  4AT9 A;  3PZP A;  1F5A A;  4Y2V A;  5DB6 A;  5AKK A;  1QQ6 A;  1NO5 A;  4EBC A;  1S8O A;  3TKA A;  3LVV A;  4C8N A;  5IIM A;  2Y1J A;  3PO5 A;  4OJ6 A;  4PGY A;  2B6G A;  3PSI A;  3GZF A;  7ICQ A;  4UAZ A;  5AI6 A;  4X4P A;  4P4M A;  1D9D A;  3TAD C;  4M9G A;  2K4P A;  3KD3 A;  1A77 A;  4DSF A;  3MFI A;  8ICR A;  3BQ1 A;  2HHS A;  2KJ5 A;  1L3V A;  3G6X A;  2KNJ A;  4E80 A;  3NVZ A;  3SR6 A;  1D8Y A;  4X0B A;  2F1I A;  3H0M B;  4WC4 A;  5KFW A;  2VKQ A;  2J6S A;  1BPD A;  4MFC A;  1X6I A;  3LYS A;  1CRX A;  4RWN A;  2H3Q A;  5EWG A;  3V6H A;  5AKJ A;  4J03 A;  4YXJ A;  2LM1 A;  2QB0 A;  4FBT A;  3B0X A;  2ZUC A;  4O5C A;  5E79 U;  3PNC A;  4F5R A;  5AKZ A;  2M9N A;  2VA2 A;  4US9 A;  2ID1 A;  4K96 A;  1Q46 A;  1MN8 A;  2JEI A;  2ALZ A;  2HHU A;  1DRG A;  3QU7 A;  2F1J A;  4QWC A;  3ZDC A;  2GLE A;  2ZH3 A;  3MC1 A;  2C2R A;  5ALT A;  2IUB A;  4WC5 A;  4EYI B;  1NOM A;  3E0F A;  2MA1 A;  4GC6 A;  1ZD2 P;  5AIC A;  2FDR A;  3KZX A;  3H8M A;  4Y2Q A;  5FP0 A;  1TFW A;  4FS2 A;  1SKS A;  3HWT A;  3IRU A;  3SZ2 A;  4F91 B;  4JWM A;  3D2N A;  5TIS U;  2LBO A;  2G06 A;  2KVC A;  5CR0 A;  2PI5 A;  9ICN A;  3RJJ A;  4Q44 A;  1ED1 A;  3IDW A;  1ZQH A;  5DDY A;  2VAN A;  2WAQ C;  1ZQK A;  2K8B B;  2KFN A;  2OCE A;  2GO7 A;  4NWI A;  3MR6 A;  1XSL A;  2R8G A;  1N60 A;  4O6A A;  1L8L A;  2FMS A;  7ICE A;  2EAN A;  1J2N A;  1Z4O A;  4KLI A;  1S0N A;  7ICP A;  4R8U A;  9ICH A;  2FPK A;  2XC9 A;  4G3I A;  4U7C A;  5ALW A;  2W9B B;  4KIT B;  1V97 A;  2JEJ A;  1PUZ A;  2W9C A;  2WF5 A;  2ISP A;  3RB6 A;  3NVY A;  4RUA A;  2P35 A;  3FDS A;  1ZQM A;  4JLZ A;  1B22 A;  2GOL A;  4KN7 A;  2UVR A;  8ICN A;  1QCK A;  4R65 A;  3KFU F;  8ICL A;  2ZJA A;  2HOI A;  3RR7 A;  2N1R A;  3ALR A;  2QLT A;  2WFA A;  5KFZ A;  4M0A A;  4MF2 A;  4X4U A;  4C4S A;  1SV0 A;  4UAU A;  4ED6 A;  3C1Y A;  2YMQ A;  4DF4 A;  2G09 A;  2KZZ A;  2AXT U;  4E8F A;  2F8K A;  1A0P A;  1ZQJ A;  1TV9 A;  2F77 X;  3H37 A;  9ICF A;  2VJ4 A;  5HRG A;  2ZG6 A;  1XSP A;  4DO9 A;  5D4B A;  1SWV A;  4MEX A;  4DL3 A;  5KFL A;  3BS5 B;  5DQI A;  5JTG A;  2E3T A;  3V7J A;  4DL5 A;  2XY6 A;  4KLT A;  9ICK A;  2ZTE A;  1TE2 A;  4OJO A;  3J81 j;  3KOO A;  5GTI U;  4BXO A;  3KHG A;  4KLS A;  4F4Z A;  1ZQT A;  3M9N B;  4RQN A;  2YQE A;  1JRO A;  2KN7 A;  2BZF A;  1X9W A;  3C1Z A;  1NKE A;  4IRC A;  2JGA A;  5ALF A;  3O0F A;  5KG5 A;  3PSF A;  5KG0 A;  2M2V A;  1V4A A;  4KLU A;  4O9M A;  5J0O A;  2DRB A;  4EX6 A;  2ZUD A;  5C0Y A;  4QZA A;  4F5O A;  2ZIX B;  1NK8 A;  3FM9 A;  4KM5 A;  3MR2 A;  2KOB A;  1B0X A;  2M2T A;  2ASL A;  4CF4 A;  3HIY A;  1KNY A;  3RAQ A;  1UT5 A;  3C2M A;  2R8K A;  4F92 B;  3K7D A;  1ZQZ A;  1WWV A;  3PX0 A;  2XO7 A;  1ZQE A;  4EZ9 A;  2FMP A;  1RQL A;  5AIA A;  4ECW A;  3QUT A;  4YFK A;  1ZQU A;  4Q45 A;  4X5V A;  2DUY A;  2WAQ F;  4DLG A;  2PFP A;  4JLX A;  2Z7J A;  1LKY B;  3HIL A;  1ZQX A;  3PML A;  1Z19 A;  1V38 A;  2H5X A;  2UVW A;  1UT8 A;  1ZOL A;  3TAD A;  9ICU A;  1ZQD A;  2ZH1 A;  9ICW A;  2OHF A;  3FYH A;  1X42 A;  1YLQ A;  5ALL A;  4UB8 U;  3M9M B;  2IHM A;  2ZIX A;  4ECV A;  3JZ0 A;  3EWA A;  9ICC A;  4DSJ A;  3TFR A;  3OJU A;  4DOC A;  1BNP A;  1Z00 B;  4ECQ A;  4TUQ A;  2JR5 A;  3AUO A;  5KAF U;  4KLF A;  2KSO B;  4J9R A;  3WK7 A;  3FAH A;  1ZYQ A;  3GDX A;  1TK0 A;  2EWR A;  3AQN A;  1OW5 A;  5ALP A;  5D46 A;  4LEZ A;  4QWE A;  3R9K A;  4OO1 J;  1BNO A;  1N2X A;  4LZG A;  1ZQI A;  5L1K A;  4WC1 A;  2F2A B;  3HKZ C;  4M6W A;  3RJH A;  7ICM A;  1MQ3 A;  4F4X A;  5CWR A;  1TFR A;  1ZD4 A;  7ICJ A;  4BWJ A;  1JRP A;  5KFC A;  2G0A A;  4Y2R A;  2Q4T A;  1GPJ A;  3WU2 U;  1L7N A;  4KLJ A;  4YMO A;  1IV8 A;  2EAO A;  3LWL A;  4B9L A;  1UA1 A;  1N48 A;  4CCH A;  5HRF A;  2H3I A;  1U49 A;  2HHP A;  9ICJ A;  9ICG A;  4UB6 U;  3IHQ B;  2AJQ A;  3ETL A;  2AGQ A;  3OUY A;  4I2B A;  2W54 A;  3RB4 A;  2B4V A;  2PMZ F;  3V6K A;  3BZC A;  2BHN A;  1QSS A;  1RPL A;  3PW5 A;  3NTU A;  2E8N A;  5HRH A;  4AYB F;  4DQI A;  4RT2 A;  2PMZ C;  2RLT A;  7ICV A;  5L1I A;  2MSN A;  4TUS A;  2A1J B;  2MRL A;  4C8O A;  1DGS A;  3HJE A;  2EZZ A;  4BX9 C;  3NVW A;  2YTU A;  2YY6 A;  4DFD A;  4EBD A;  3PV8 A;  5KG6 A;  2EZX A;  2W03 A;  4J9N A;  4NLZ A;  5IIO A;  5J2F A;  4NJ8 A;  1R89 A;  4KN4 A;  3OVA A;  2BR0 A;  2YX8 A;  3H3A A;  4NM1 A;  4F50 A;  1PVQ A;  4AT9 B;  2OEH A;  3SEI A;  1TK8 A;  2HHT A;  1S76 D;  4RWP A;  3RRH A;  4WC6 A;  2IOF A;  4O3Q A;  1KTQ A;  4J9O A;  5KAI U;  2OXO A;  3T5L A;  4BDP A;  1TAU A;  4RQ8 A;  3PX4 A;  3LVW A;  2K89 A;  1C20 A;  1Q79 A;  1GO3 F;  5KT4 A;  2Q0Z X;  1X66 A;  3MFH A;  5HNK A;  3THV A;  2DKX A;  1SV0 C;  4Z6F A;  5DG9 A;  5AI8 A;  1DOQ A;  2NRW A;  4X4N A;  4Q8F A;  4ED0 A;  4K4I A;  3GQC A;  2QAR A;  4LT6 A;  3QE9 Y;  5A0L A;  1BGX T;  2M0N A;  1PK3 A;  4DOB A;  1JMS A;  5KFN A;  2B0C A;  3HP6 A;  2KHQ A;  2WF9 A;  5KFE A;  5DLF A;  4NXW A;  4UAY A;  2FLP A;  5J2D A;  5ALG A;  2R8H A;  2E8P A;  2ZIU B;  1NKC A;  5KFM A;  1X6J A;  5F9N A;  1FFV A;  4YXM A;  3QEB Z;  3NRW A;  4WQK A;  2A1A A;  1NZB A;  5J0R A;  2AHO B;  3OVB A;  1L8O A;  2F44 A;  4EEB A;  1KBU A;  4HAI A;  2KZ3 A;  1VLB A;  1EXN A;  2PXI A;  3T5K A;  2NRK A;  5KFD A;  2HVH A;  3Q8S B;  3F2D A;  4CF5 A;  5KFJ A;  1AQ6 A;  1JAJ A;  3QZ8 A;  4UW9 A;  4NXU A;  2WF7 A;  2W04 A;  2JZB A;  3F5E A;  1ECW A;  1COK A;  1KDH A;  3NWI A;  2W55 A;  3LK9 A;  5CFT A;  2DWQ A;  2GA9 D;  4QZH A;  4QIW F;  4X4V A;  4QWA A;  3AM9 A;  5L1J A;  4RQ7 A;  5ALI A;  4NKT A;  4RWQ A;  4I2H A;  4DFJ A;  4CE6 A;  4YCX A;  8ICS A;  3UMG A;  4RQ0 A;  4MFA A;  2QB0 B;  1ZRM A;  3BQT A;  1S77 D;  1Z00 A;  1ZQG A;  2FPL A;  3RF9 A;  4PZN A;  5KG3 A;  4NXV A;  4IQW A;  3JPR A;  5ALE A;  4J9L A;  2P66 A;  4IL6 U;  2E1F A;  3UPS A;  4OD0 A;  5J0Q A;  2MAX A;  5L9X A;  4QZF A;  5ALY A;  1NZP A;  4Z6C A;  5ALV A;  2W7P A;  1QQ5 A;  1N62 A;  2KIC A;  4C7Z A;  4ELV A;  1Z4N A;  4NLK A;  4WC2 A;  1XS9 D;  3ONN A;  1BPY A;  2AGO A;  2LYA A;  4DSI A;  2YN4 A;  3SAF A;  1SGG A;  2V9W A;  5D61 A;  4O3P A;  5AKY A;  4DSL A;  3PW4 A;  3QZ7 A;  3K1Z A;  3OSP A;  3CP8 A;  4NLB A;  4UBB A;  4ED8 A;  4R8U B;  9ICB A;  2RDJ A;  5DDM A;  1BPZ A;  2DR7 A;  1ZD5 A;  1L5U A;  2DR9 A;  4F5P A;  3BJY A;  5AM1 A;  2R8J A;  2J6T A;  7ICI A;  2DVI A;  4E0D A;  4C8M A;  1CI4 A;  5ALK A;  1RQN A;  1WCL A;  3B9J A;  3TFS A;  3HX0 A;  5EE1 A;  4O3S A;  3QXG A;  2AU0 A;  8ICO A;  3ERC C;  4EEK A;  1SZP A;  8ICE A;  1LVH A;  4UAR A;  2FJ6 A;  4F5N A;  4Y2T A;  4M9H A;  4YVZ A;  2PFQ A;  5KT5 A;  2LKY A;  4DWI A;  4OCZ A;  3G6V A;  9ICL A;  4IC9 A;  3T79 A;  3AU6 A;  2YML A;  2HVI A;  8ICT A;  4QW9 A;  1VJ5 A;  3RH6 A;  5EOZ A;  1SXE A;  4DF8 A;  4NLC A;  3HT3 A;  2KZM A;  1B4F A;  3KTQ A;  3EPI A;  2BBH A;  4FFD A;  5IIN A;  4RNO A;  5BPC A;  3KHR A;  5KFI A;  3TAQ A;  2JH7 A;  2NRX A;  4O3O A;  4I2I A;  3PR4 A;  2YMP A;  3UMC A;  4QW8 A;  2IBK A;  4F4W A;  5KFB A;  2GAF D;  4M9L A;  5EE3 A;  2KSO A;  4YP3 A;  3C5F A;  4JV2 A;  3VCB A;  1RXW A;  1ZQC A;  3T5J A;  3GU3 A;  1QQ7 A;  4EX7 A;  5CB1 A;  4QZB A;  4WBY A;  5ALR A;  1KFD A;  4KTQ A;  3ED5 A;  2ZHB A;  4WC7 A;  4ELU A;  4NXX A;  5KL1 B;  4ELT A;  1FO4 A;  1KFS A;  3DDH A;  3E58 A;  2EQY A;  5KL8 B;  4DL4 A;  4OJ5 A;  5F2V O;  2HBJ A;  5HR7 A;  4GXI A;  1QLN A;  3WKD A;  4Q43 A;  2H3Z A;  3QEA Z;  4K4G A;  5J8Y C;  2M2W A;  5B3P A;  2KIW A;  4FE3 A;  4UAS A;  1SKW A;  1HUO A;  4EV6 A;  1L3S A;  2HMX A;  2AQ0 A;  4EP7 A;  4KLG A;  1QH9 A;  3HPO A;  4F3O A;  2D6F C;  4UAW A;  4US8 A;  1ZQS A;  3Q8M A;  4P0Q B;  1H38 A;  2XI9 A;  1Q78 A;  4USA A;  2KKV A;  4NV0 A;  3QX7 A;  4M47 A;  4M2Y A;  1CEZ A;  2JZB B;  5BOM A;  4P4O A;  2DPI A;  1ZET A;  2Y9T A;  4YQW A;  5B66 U;  3BQ0 A;  4F2R A;  3L3F X;  4B9V A;  5AKX A;  1L7O A;  2L5Y A;  1FFU A;  4EZ6 A;  1WCN A;  1HEK A;  3CK6 A;  5EE9 A;  4PL1 A;  2JRZ A;  4ICA A;  3ZDE A;  1BPX A;  2WF8 A;  1QSY A;  2EAP A;  4K97 A;  2PBE A;  3ER9 B;  5HP4 A;  2EAM A;  2JEF A;  1DGJ A;  4WCW A;  4RNM A;  2DQN B;  4I27 A;  4XJE A;  5D63 A;  2FLN A;  4KX3 A;  2O6K A;  3BDP A;  3IG8 A;  1UPH A;  2RDI A;  2Y0S F;  1SWW A;  2ES6 A;  1O03 A;  2IHN A;  2ZH8 A;  3EW9 A;  4RU9 A;  1NK5 A;  7ICK A;  4PZO A;  4UD4 A;  4B6J A;  4DS5 A;  9ICO A;  4NLG A;  1MIW A;  4DFK A;  3N7S C;  3I76 A;  5KFV A;  3MR5 A;  3N7R C;  4ACO A;  4IR1 A;  4FHW A;  4ED1 A;  1F44 A;  1ZQY A;  2HHX A;  5IIJ A;  8ICC A;  3VC8 A;  4YD2 A;  3GIJ A;  3F2C A;  3DV9 A;  3H0R B;  2BPG A;  4ECT A;  5KFT A;  4ECY A;  2W9B A;  1D9F A;  2M2U A;  3TAR A;  1U4B A;  2QB1 A;  4J9Q A;  3DEE A;  3GV8 B;  2W8K A;  1RXV A;  3NYB A;  3M8R A;  3PHZ A;  4LEY A;  2FCL A;  4PJ0 U;  4I2A A;  3GIL A;  5KFQ A;  2ASJ A;  2D8C A;  3OPX A;  3S6J A;  4FZL A;  3SI8 A;  3C5G A;  2ZH6 A;  5ALO A;  3KHL A;  1RYU A;  1ZQA A;  4QWB A;  5CFU A;  4ECZ A;  2HBL A;  1JI7 A;  4FBU A;  2HHV A;  4MEY A;  2DRA A;  5AI9 A;  1KL9 A;  2HHW A;  4ZH4 A;  2UVV A;  5JU5 A;  4TQS A;  3NS1 A;  2NRT A;  3CRX A;  5DGB A;  3JPQ A;  1OU5 A;  4FHP A;  5J2B A;  2IMW P;  2VA3 A;  3HJ1 A;  5EWF A;  3H39 A;  2KHV A;  3HKZ F;  3RB0 A;  1ZQW A;  4OAI Z;  1XSN A;  1JXL A;  3NUQ A;  2ZIW B;  4MHV A;  3ZDD A;  2CRX A;  1RYR A;  5HHH A;  4DSK A;  1IG6 A;  3OJS A;  2C2D A;  4Q8E A;  5AHX A;  3KBB A;  4RQ1 A;  4TUP A;  1TK5 A;  1COO A;  3C23 A;  3OGU A;  2RRD A;  1N61 A;  5HRL A;  8ICU A;  4R63 A;  4AT8 B;  4PPX A;  2V4Q A;  2OM6 A;  2ZH7 A;  4MFF A;  3WFR E;  5H2F U;  4DCC A;  3H4D A;  2WHE A;  4CDG A;  1JN3 A;  2V4R A;  1OUQ A;  2B56 A;  1XO1 A;  2K4I A;  2OWO A;  2GH1 A;  4R64 A;  2W9A A;  5KFR A;  1L3T A;  2BCU A;  3SAH A;  3Q8L A;  1A76 A;  4QZD A;  1K1S A;  4EED A;  1N63 A;  1ZQN A;  3TAP A;  7ICL A;  4UAT A;  3LDA A;  4FH3 A;  7ICN A;  3AQM A;  4YMM A;  3SV4 A;  2IHO A;  2KVS A;  3JPN A;  4BUG A;  4KX5 A;  4NLN A;  4ZOH C;  3EF2 A;  1F0M A;  2VIX A;  3K4G A;  4NXZ A;  4FH5 A;  5J8Y A;  7ICT A;  3ETR A;  3Q8K A;  5HRB A;  3OSN A;  3MGH A;  4FO1 A;  4GXJ A;  1L6N A;  3A0H U;  4DL7 A;  3UXP A;  5B5E U;  4K99 A;  2ZTC A;  5J0S A;  4Y2U A;  2F1H A;  7ICG A;  4UB2 A;  4EEY A;  1ZQQ A;  4G9B A;  5KT7 A;  2OH2 A;  4YG2 A;  3IG5 A;  1X2I A;  1KLN A;  5AKL A;  4P0P B;  2NRV A;  2BBJ A;  4UB4 A;  4X4Q A;  1IXR A;  3WK5 A;  4M5D A;  2PKE A;  4DQR A;  4EYH B;  5KFH A;  4GIB A;  4DLE A;  2Y1I A;  4FHV A;  1ZJN A;  3FC4 A;  3NVV A;  2VA8 A;  3TAC B;  4RT3 A;  5KFY A;  2KK0 A;  4KB6 A;  4F72 A;  2K4E A;  1SZH A;  4O3R A;  4C8L A;  2IOF K;  1U47 A;  4AT8 A;  2KFZ A;  4JMU A;  5ALM A;  2Y9U A;  4BGD A;  2W8L A;  4MKP A;  4UQG A;  4BJQ A;  2EDU A;  2ZH2 A;  1K5O A;  2AGP A;  9ICP A;  1SV4 A;  3PO4 A;  8ICY A;  3IV6 A;  2G08 A;  5KFO A;  4XQ7 A;  3TQ1 A;  1PX5 A;  1XNS A;  4RQ3 A;  1WWU A;  2DPJ A;  1LV5 A;  2FLL A;  4AT7 B;  5AK4 A;  4M9J A;  1L3U A;  2ZIV A;  5AKI A;  3LQC B;  5J2H A;  3WKE A;  2BCV A;  4KLQ A;  2ZIU A;  2ZJ5 A;  1NJY A;  2CPR A;  2D3D A;  2DGZ A;  2I5H A;  2MUT A;  5KFK A;  3GFK B;  5DBB A;  1JUD A;  3V72 A;  5AM0 A;  4HX0 A;  4PL2 A;  4NKU A;  1Q8K A;  4Y2Y A;  4RZR A;  4UB3 A;  1BPE A;  2BKE A;  4AT7 A;  4M04 A;  1MC8 A;  5HRI A;  3QUQ A;  2W3R A;  8ICZ A;  1KRP A;  1X9S A;  2Y0S C;  1NJW A;  3H38 A;  4K9A A;  5DBA A;  3MDC A;  1TKD A;  1M6Y A;  2EH9 A;  1MIY A;  2CN1 A;  2Q66 A;  9ICQ A;  2AQ4 A;  2BCS A;  2KP7 A;  2I9G A;  1Z1V A;  2RHF A;  4J9S A;  1RG6 A;  2NYV A;  1UET A;  3GV7 B;  3OVS A;  2W7O A;  3PW0 A;  3L9D A;  3NKU A;  1UQV A;  3Q8R B;  3NAS A;  4IQU A;  3PX6 A;  5HMM A;  4LJX A;  3F53 A;  3MBY A;  4B9M A;  3MGV A;  2XY5 A;  3ZD9 A;  3CNH A;  2DF4 B;  1Z1B A;  1S9F A;  3KHH A;  3SMV A;  1VFG A;  1S5L U;  1ZQV A;  5AI4 A;  4FZN A;  5HHI A;  1ZJM A;  4K8V A;  3Q8P B;  3UPQ A;  4X0A A;  2KV2 A;  3H7I A;  4RPZ A;  3ISB A;  4I28 A;  3UMB A;  3IN5 A;  5KFP A;  3SV3 A;  1NNL A;  4BXO B;  5HR9 A;  4RQM A;  4EBK A;  8ICM A;  1UCV A;  2KD1 A;  1SL2 A;  2ISO A;  3RJK A;  4RQ6 A;  5AKH A;  2XID A;  2HN2 A;  3OV7 A;  4C4R A;  3AEV A;  3HJ4 A;  3Q8Q B;  1BPB A;  3UM9 A;  3H4B A;  1VDV A;  3IM1 A;  2ZH9 A;  3BQ2 A;  2E5S A;  2YMM A;  3UQ0 A;  3WKB A;  4CF3 A;  2DL0 A;  1JQR A;  4I0U A;  1O08 A;  5CHG A;  1ZQ1 C;  3RJE A;  5J2G A;  1FEZ A;  4RPX A;  4OAG A;  5GTH U;  2KJ8 A;  3AQL A;  3AQE A;  1SL1 A;  1R8A A;  9ICA A;  8ICH A;  3E2E A;  1YZ6 A;  4OAF A;  5DB7 A;  4ED7 A;  5AM2 A;  3AL0 B;  4F4Y A;  1K1Q A;  4F5Q A;  4I2C A;  4CNQ A;  4M6W B;  4Y2P A;  3A0B U;  4QNL A;  4GFJ A;  1YZ7 A;  2F76 X;  3ICX A;  4QZE A;  2HHQ A;  4WC3 A;  2E8M A;  3KZI U;  1MIV A;  2O5A A;  1NK9 A;  2JH1 A;  8ICI A;  1Q3V A;  4YMN A;  4XQ8 A;  3V7L A;  3BS5 A;  5J0P A;  4IQV A;  1T7P A;  2BPF A;  3N7P D;  4C8K A;  3L5K A;  1N56 A;  4P0P A;  1XWL A;  1NJZ A;  1PZN A;  2LPE A;  2BPC A;  4QZG A;  1RM6 C;  3WFS C;  2XVT A;  1VJ7 A;  1DXS A;  4PHD A;  3QU2 A;  1PVP A;  2I6X A;  2XY7 A;  1Q3U A;  4E7X A;  5K4L A;  3V6J A;  1CUK A;  1HIW A;  5DEC A;  2FE9 A;  4IS7 A;  5KT6 A;  4RNN A;  5JUM A;  1TVA A;  3AU2 A;  2KE7 A;  2YB4 A;  9ICX A;  1FA0 A;  3ISD A;  3WFP A;  2W3S A;  1ZQF A;  4QWD A;  3CYM A;  2KEY A;  2JXJ A;  3MAB A;  2BQU A;  2JHD A;  2KIV A;  1BVS A;  3WFQ E;  5TZV A;  2HOQ A;  3I1Y A;  3MGI A;  5ALX A;  4O3N A;  4Y2X A;  1V85 A;  4KLL A;  2BDU A;  4JWN A;  5KG7 A;  2IA6 A;  1U45 A;  4WBZ A;  2KKP A;  1S0O A;  1WG8 A;  3K75 D;  3WK8 A;  3HW8 A;  4ECS A;  3H40 A;  2BGW A;  5EE0 A;  4RPY A;  4CRX A;  4QJF B;  3AQK A;  4P0Q A;  3LWM A;  3C28 A;  4RQ4 A;  8ICG A;  4ED3 A;  5D62 A;  2K8C B;  2GWS A;  5HRE A;  2ZHA A;  2QKQ A;  4OJL A;  2A3V A;  1PVR A;  4BWM A;  4I2F A;  1RZT A;  3C2K A;  4A8E A;  3TAN A;  4UB1 A;  4PHE A;  8ICB A;  4J9K A;  5ALU A;  4UBC A;  3WK4 A;  2A19 A;  1T94 A;  1Z3E B;  1X9X A;  3PST A;  5DED A;  5KFS A;  1S0V A;  8ICQ A;  2HDO A;  5J0W A;  5J29 A;  3RBE A;  1ZQB A;  4LVS A;  1N5W A;  4XA5 A;  1D8B A;  5D49 A;  2ATL A;  2R18 A;  1UEV A;  4JV0 A;  1JX4 A;  5CHE A;  4J9P A;  4P2H A;  5IIL A;  3RJI A;  2MUT B;  2JMG A;  3KKA C;  5AKG A;  3RFA A;  3GV5 B;  3ZI4 A;  5BOL A;  3RJG A;  1TFY A;  4Z6D A;  5AIB A;  5HC9 A;  4AP9 A;  1R8B A;  2BQR A;  1UHU A;  3BS7 A;  3C21 A;  3GIM A;  2KTQ A;  7ICH A;  2ODG A;  4KMO B;  4TQR A;  2ZXH A;  2XCP A;  2FI1 A;  3M9O B;  5DB9 A;  1XO0 A;  1JIH A;  3M7D A;  5AI5 A;  4O0I A;  3U26 A;  2HN1 A;  3G6Y A;  5ALD A;  1S0M A;  4YN4 A;  1N5X A;  7ICO A;  8ICJ A;  5KFF A;  4WC0 A;  4R66 A;  2I1Q A;  3F5A A;  4K9B A;  1YT3 A;  2B21 A;  4FO6 A;  5J2A A;  5KG4 A;  3M6Z A;  2KMD A;  1V9P A;  2PFN A;  1KSP A;  2ZJ8 A;  4FHX A;  1HJP A;  5HRK A;  4PHA A;  4C0Z A;  1J2M A;  5HML A;  1U9L A;  4PHP A;  1RDF A;  2XGP A;  1U48 A;  4YR0 A;  5L1M A;  2BQ3 A;  3UXN A;  4EEL A;  4DFM A;  4JUZ A;  3M8S A;  1WUD A;  4JV1 A;  2HW3 A;  4ECX A;  5KFX A;  4B9S A;  7ICF A;  3RH5 A;  4IQT A;  4WQL A;  1B43 A;  4F2S A;  1ZQL A;  1NKB A;  2QAR B;  1QSL A;  2WB1 C;  5C5J A;  3D2Q A;  2LYH A;  4ATB B;  3EPG A;  4RUC A;  4DFP A;  5AK6 A;  4MF8 A;  2ZIW A;  4GLX A;  4FS1 A;  3SQI A;  1NK7 A;  5L1L A;  2F3N A;  5KG1 A;  2ZUB A;  2O1P A;  3C66 A;  2HBK A;  2NO4 A;  5F9L A;  2C2E A;  9ICR A;  3H8S A;  1SB3 C;  5AM3 A;  5F3X B;  2VJ5 A;  3ZDB A;  1DK2 A;  1PK1 A;  1ZQP A;  3PW2 A;  1OXJ A;  4X4R A;  5CA7 A;  4X4T A;  4DQS A;  2EZY A;  1T3Q A;  3IP4 B;  3SAG A;  4ECR A;  2C28 A;  1LB2 B;  3I28 A;  1UA0 A;  8ICA A;  1ZQO A;  5KTQ A;  5J0T A;  1MA7 A;  3AQF A;  5DG7 A;  4OAH A;  2NO5 A;  3QU5 A;  4O3M A;  4C4T A;  5KNI A;  2PFO A;  9ICM A;  2DFL A;  5DG8 A;  4IRD A;  2RQ5 A;  1JXE A;  4AYB C;  3WFO A;  1RYS A;  4GC7 A;  4X4S A;  5J2C A;  4XRH A;  1IIP A;  5J2E A;  5G5G A;  3H0L B;  5KT2 A;  2ZH5 A;  2G5I B;  4DEZ A;  3NGD A;  2WTF A;  8ICP A;  3RJF A;  4DSE A;  1LKY A;  4NY8 A;  3JCF A;  2F8L A;  4I2E A;  3QU9 A;  1NK0 A;  2DBY A;  4DL2 A;  5JTI A;  1KN5 A;  3GII A;  1SIJ A;  2XCA A;  2LMR A;  2HI0 A;  2H3V A;  2KJ9 A;  1TAQ A;  2BCQ A;  2YB1 A;  2DR8 A;  3OTQ A;  3QYP A;  2RFF A;  1KW4 A;  1ZXI A;  4XUS A;  4EEN A;  2DR5 A;  5CFS A;  3WKC A;  5AI0 A;  1HUZ A;  4KLM A;  1ARO P;  1PK1 B;  2JV3 A;  4KMU A;  4Y2S A;  8ICK A;  1KQQ A;  4RQ5 A;  3OHA A;  1P7D A;  4PGX A;  9ICT A;  5KG2 A;  2WB1 F;  2XGQ A;  3OWG A;  5G5H A;  4IG8 A;  3RTV A;  1KEJ A;  2AH5 A;  2LYB A;  4IRK A;  3EZ5 A;  4TUR A;  2PI4 A;  4CGZ A;  3M6K A;  3OHB A;  4YR3 A;  3C2L A;  5J0U A;  5J2K A;  4WOY A;  1X40 A;  1SKR A;  8ICF A;  1A6S A;  5AKE A;  4O67 A;  3C29 A;  4I2G A;  4UB5 A;  1SXD A;  3RH4 A;  1WYG A;  4F93 B;  3SEN A;  3NVO A;  4I2J A;  4OJP A;  3AN1 A;  3TI0 A;  1F5S A;  4NL9 C;  1ZD3 A;  2OYY A;  3L4P A;  4RQ2 A;  2ZXI A;  3WK9 A;  2MU2 A;  4F71 A;  5DGA A;  4ECU A;  1XU4 A;  2LHT A;  4P4P A;  1J97 A;  2FPM A;  3T5H A;  1NK6 A;  4FHY A;  3JPT A;  5J0Y A;  4KLE A;  2J6U A;  4IR9 A;  3EUB 2;  5CJ7 A;  3EYZ A;  2NV3 A;  3QUC A;  2NRZ A;  5J0X A;  4FZM A;  4RWO A;  1L7M A;  1X9M A;  3B0Y A;  4NXT A;  9ICI A;  4N7R A;  9ICV A;  4B9T A;  3MDA A;  2FMQ A;  4M9N A;  2JEG A;  5III A;  5DQG A;  3H8W A;  4QZ9 A;  3RB3 A;  5AM5 A;  1IM4 A;  2K4H A;  1JAL A;  4GXK A;  3SD7 A;  5KFA A;  2P6U A;  2HOF A;  4DOA A;  1S97 A;  3ER8 C;  2HBM A;  5ALZ A;  5DLG A;  2P6R A;  7ICU A;  5ALJ A;  3PY8 A;  5JRT A;  3QU4 A;  3RBD A;  5B3Q A;  3WKA A;  2R8I A;  3MCR A;  5DB8 A;  1KFT A;  2LI6 A;  3T3F A;  5J2J A;  2W43 A;  4EBE A;  3ISC A;  4B9U A;  4F8R A;  2W11 A;  2UVU A;  4PH5 A;  4C7Y A;  3C18 A;  3QNM A;  1WOT A;  4EGW A;  4UAV A;  2IOH A;  4Z6E A;  1KKX A;  4LEW A;  2HCF A;  3ZD8 A;  5ALH A;  5KT3 A;  1Y88 A;  2A1J A;  5DKW A;  2ZTD A;  4UD5 A;  3SYZ A;  3PR5 B;  1XC9 A;  1T4G A;  2H3F A;  9ICS A;  5KFU A;  1ZQR A;  2B51 A;  2KG5 A;  1MSW D;  3CW2 C;  4QZI A;  3F2B A;  4K4H A;  4I29 A;  2BE3 A;  3N28 A;  1T8E A;  4LEV A;  4HYK A;  4Y2J A;  5HR6 A;  3N97 B;  1ZRN A;  4QZ8 A;  4DQQ A;  3ZDA A;  4PGQ A;  1C7Y A;  2HSZ A;  4KLO A;  4O69 A;  4QZC A;  3UQ2 A;  8ICV A;  2E1E A;  4S3N A;  5T14 A;  1URJ A;  2CXY A;  3RR8 A;  3PW7 A;  4DL6 A;  1R8C A;  4U6P A;  2E8O A;  5ALN A;  4YD1 A;  3BZK A;  3RAX A;  3MR3 A;  4JK1 A;  5ALQ A;  3NRZ A;  1NI3 A; 
#chains in the Genus database with same CATH homology
 5HRF A;  3RRG A;  5KFV A;  3MR5 A;  5KFG A;  4IR1 A;  4FHW A;  1U49 A;  4X4N A;  3MAB A;  5DBC A;  4ED1 A;  2BQU A;  2HHP A;  1BVS A;  4LZD A;  1ZQY A;  2HHX A;  9ICJ A;  5IIJ A;  8ICC A;  9ICG A;  5TZV A;  4ED2 A;  3WFQ E;  7ICR A;  4YD2 A;  3MGI A;  3GIJ A;  4O3N A;  4KLL A;  9ICB A;  3IHQ B;  2AJQ A;  2HHT A;  3ETL A;  4J9M A;  4JWN A;  3JPP A;  2AGQ A;  2BPG A;  3OUY A;  5KG7 A;  4ECT A;  5KFT A;  2IA6 A;  4ECY A;  1U45 A;  2W9B A;  4I2D A;  2C22 A;  4WBZ A;  4I2B A;  3RB4 A;  1MQ2 A;  3JPS A;  1S0O A;  1D9F A;  1SL0 A;  4KLD A;  3K75 D;  3HW8 A;  4ECS A;  3V6K A;  3H40 A;  2ASD A;  2BHN A;  2BGW A;  5DQH A;  2M2U A;  1QSS A;  3JPO A;  1RPL A;  4EBJ A;  3PVX A;  3PW5 A;  3NTU A;  4RPY A;  3TAR A;  1U4B A;  1NJX A;  8ICX A;  5HRH A;  3AQK A;  4ATB A;  5HRD A;  4J9Q A;  3LWM A;  3GV8 B;  2W8K A;  4RT2 A;  4RQ4 A;  1RXV A;  3M8R A;  4DQI A;  4ED3 A;  8ICG A;  1D8L A;  7ICV A;  3NYB A;  2GWS A;  5L1I A;  5HRE A;  4TUS A;  2ZHA A;  2A1J B;  4C8O A;  1DGS A;  3GIL A;  4I2A A;  4BWM A;  5KFQ A;  4I2F A;  2ASJ A;  1RZT A;  3C2K A;  3H8J A;  3OUY B;  3TAN A;  4EBD A;  4UB1 A;  3PV8 A;  5KG6 A;  4PHE A;  3SI8 A;  8ICB A;  3JYY A;  3C5G A;  4J9K A;  4DQP A;  2ZH6 A;  4KLH A;  4UBC A;  1S10 A;  1NK4 A;  5CP2 A;  4J9N A;  3KHL A;  4NLZ A;  5IIO A;  5J2F A;  1R89 A;  1ZQA A;  4QWB A;  4DS4 A;  8ICW A;  2BCR A;  4ECZ A;  4KN4 A;  3OVA A;  9ICE A;  4X4O A;  4YR2 A;  1DK3 A;  3UXO A;  2BR0 A;  4B9N A;  4FBU A;  2HHV A;  5DED A;  4MEY A;  5KFS A;  1S0V A;  7ICS A;  4NM1 A;  4F50 A;  8ICQ A;  3V7K A;  3H3A A;  2ZH4 A;  2DRA A;  4AT9 B;  5IIK A;  1TK8 A;  5J0W A;  5J29 A;  4O5E A;  4ZH4 A;  2W9M A;  3RRH A;  3RBE A;  3ORY A;  2UVV A;  1ZQB A;  1S76 D;  4LVS A;  4TQS A;  4WC6 A;  4XA5 A;  4O3Q A;  1KTQ A;  5D49 A;  4J9O A;  2NRT A;  3N4M B;  5DGB A;  2ATL A;  1UEV A;  3GIK A;  4JV0 A;  3T5L A;  5J2I A;  4BDP A;  1QTM A;  1JX4 A;  4J9P A;  1TAU A;  3JPQ A;  4P2H A;  4RQ8 A;  3PX4 A;  5IIL A;  3RJI A;  2MUT B;  4O5K A;  3PMN A;  1OU5 A;  4FHP A;  3GV5 B;  5J2B A;  5BOL A;  2IMW P;  2BDP A;  2VA3 A;  1Q79 A;  5KT4 A;  5EWF A;  2Q0Z X;  3RJG A;  3H39 A;  1TFY A;  2W9C B;  4F4K A;  4NM2 A;  4Z6D A;  3RB0 A;  1ZQW A;  1UEU A;  1T3N A;  5HC9 A;  5EWE A;  1XSN A;  1JXL A;  3MFH A;  5HNK A;  3ZDD A;  1R8B A;  3THV A;  2BQR A;  4AT9 A;  4Z6F A;  1F5A A;  5DG9 A;  3C21 A;  3GIM A;  5DB6 A;  1DOQ A;  2KTQ A;  7ICH A;  2NRW A;  4TQR A;  5HHH A;  1RYR A;  4DSK A;  4ED0 A;  3OJS A;  4K4I A;  3GQC A;  2XCP A;  4Q8F A;  3M9O B;  2C2D A;  4LT6 A;  4Q8E A;  5DB9 A;  3QE9 Y;  1JIH A;  1BGX T;  1NO5 A;  4EBC A;  4C8N A;  5IIM A;  4DOB A;  4RQ1 A;  4TUP A;  2Y1J A;  1TK5 A;  1COO A;  1JMS A;  4PGY A;  3PO5 A;  7ICQ A;  4UAZ A;  3C23 A;  5KFN A;  4O0I A;  4P4M A;  3OGU A;  1D9D A;  4M9G A;  5HRL A;  4X4P A;  3HP6 A;  3G6Y A;  8ICU A;  4R63 A;  1PX5 A;  1S0M A;  5KFE A;  4YN4 A;  4AT8 B;  1A77 A;  5DLF A;  4PPX A;  4DSF A;  3MFI A;  4UAY A;  8ICR A;  3BQ1 A;  2V4Q A;  2FLP A;  2HHS A;  5J2D A;  7ICO A;  4MFF A;  2ZH7 A;  3WFR E;  2R8H A;  8ICJ A;  5KFF A;  1NKC A;  5KFM A;  3H4D A;  5F9N A;  1L3V A;  3G6X A;  4WC0 A;  4E80 A;  1JN3 A;  2I1Q A;  4YXM A;  4R66 A;  2V4R A;  3QEB Z;  1D8Y A;  1XO1 A;  4X0B A;  2B21 A;  4FO6 A;  2F1I A;  5J2A A;  5KG4 A;  2KZM A;  4WC4 A;  2OWO A;  5J0R A;  3OVB A;  5KFW A;  4R64 A;  2W9A A;  1V9P A;  5KFR A;  1L3T A;  1KSP A;  2ZJ8 A;  2PFN A;  9ICP A;  1HJP A;  2BCU A;  2J6S A;  2KZ3 A;  4PHA A;  5HRK A;  3Q8L A;  1A76 A;  4QZD A;  1K1S A;  1EXN A;  1BPD A;  4MFC A;  2PXI A;  3T5K A;  2NRK A;  5KFD A;  1ZQN A;  2HVH A;  4RWN A;  3Q8S B;  3TAP A;  7ICL A;  3LDA A;  5HML A;  1U9L A;  5KFJ A;  4PHP A;  4FH3 A;  7ICN A;  1JAJ A;  5EWG A;  2XGP A;  3V6H A;  3QZ8 A;  1U48 A;  4YXJ A;  4YMM A;  3SV4 A;  3AQM A;  4YR0 A;  4FBT A;  3B0X A;  2BQ3 A;  2ZUC A;  3UXN A;  3JPN A;  2JZB A;  4NLN A;  4O5C A;  4DFM A;  4JUZ A;  3M8S A;  3PNC A;  4F5R A;  3K4G A;  4JV1 A;  2M9N A;  2VA2 A;  4NXZ A;  4ECX A;  5KFX A;  2HW3 A;  1KDH A;  4B9S A;  7ICF A;  7ICT A;  3RH5 A;  2ID1 A;  4IQT A;  3LK9 A;  3Q8K A;  1B43 A;  2JEI A;  4F2S A;  5HRB A;  3OSN A;  1ZQL A;  2ALZ A;  1NKB A;  2HHU A;  4QZH A;  3MGH A;  4X4V A;  2F1J A;  4GXJ A;  4QWC A;  1QSL A;  5C5J A;  3ZDC A;  2LYH A;  4QWA A;  4DL7 A;  4ATB B;  2ZH3 A;  3UXP A;  2C2R A;  5L1J A;  3EPG A;  4RQ7 A;  4RUC A;  4DFP A;  4EYI B;  4WC5 A;  1NOM A;  4NKT A;  4RWQ A;  2ZTC A;  4MF8 A;  5J0S A;  4I2H A;  4GC6 A;  4DFJ A;  4YCX A;  4GLX A;  8ICS A;  4FS1 A;  4CCH A;  4RQ0 A;  2F1H A;  4MFA A;  7ICG A;  4UB2 A;  4EEY A;  1ZQQ A;  1NK7 A;  5KT7 A;  1TFW A;  4YG2 A;  5L1L A;  4FS2 A;  3BQT A;  1X2I A;  1KLN A;  1SKS A;  1S77 D;  5KG1 A;  2ZUB A;  3HWT A;  1Z00 A;  3SZ2 A;  4F91 B;  2NRV A;  1ZQG A;  4JWM A;  2O1P A;  2FPL A;  3C66 A;  5KG3 A;  5F9L A;  2C2E A;  9ICR A;  4IQW A;  4UB4 A;  3H8S A;  3JPR A;  4X4Q A;  3ZDB A;  1IXR A;  4J9L A;  2P66 A;  4M5D A;  1DK2 A;  3UPS A;  1ZQP A;  5J0Q A;  5CR0 A;  4DQR A;  2MAX A;  5L9X A;  2PI5 A;  9ICN A;  4QZF A;  3PW2 A;  4EYH B;  4X4R A;  5CA7 A;  4X4T A;  3RJJ A;  1NZP A;  4Z6C A;  5KFH A;  4Q44 A;  4DLE A;  4DQS A;  2Y1I A;  4FHV A;  1ZJN A;  1ZQH A;  4ECR A;  2VA8 A;  5DDY A;  2VAN A;  2C28 A;  1LB2 B;  4ELV A;  4RT3 A;  1UA0 A;  5KFY A;  8ICA A;  1ZQO A;  1ZQK A;  4NLK A;  5KTQ A;  2KFN A;  5J0T A;  4WC2 A;  4O3R A;  4C8L A;  5DG7 A;  1U47 A;  1XS9 D;  2PFO A;  1BPY A;  2KFZ A;  4AT8 A;  3MR6 A;  9ICM A;  2AGO A;  2DFL A;  1XSL A;  2R8G A;  5DG8 A;  4DSI A;  4IRD A;  2V9W A;  4BGD A;  1JXE A;  2W8L A;  4O3P A;  4UQG A;  4FHX A;  3WFO A;  1RYS A;  2FMS A;  4GC7 A;  7ICE A;  4FH5 A;  4X4S A;  5J2C A;  4XRH A;  5J2E A;  3PW4 A;  4DSL A;  3QZ7 A;  5KT2 A;  2ZH5 A;  4UBB A;  4DEZ A;  3NGD A;  2WTF A;  4ED8 A;  3OSP A;  2AGP A;  1S0N A;  4R8U B;  4KLI A;  8ICP A;  2RDJ A;  3PO4 A;  5DDM A;  7ICP A;  1BPZ A;  4R8U A;  1L5U A;  3RJF A;  9ICH A;  2DR7 A;  4F5P A;  4DSE A;  8ICY A;  2DR9 A;  3BJY A;  2FPK A;  5KFO A;  2XC9 A;  3TQ1 A;  2J6T A;  2R8J A;  4I2E A;  4NY8 A;  4G3I A;  4RQ3 A;  4E0D A;  1NK0 A;  4C8M A;  2DPJ A;  7ICI A;  4DL2 A;  1LV5 A;  2FLL A;  2DVI A;  2W9B B;  4KIT B;  4RWP A;  1WCL A;  3TFS A;  2JEJ A;  3HX0 A;  3GII A;  2W9C A;  4AT7 B;  4O3S A;  8ICO A;  2AU0 A;  4M9J A;  2XCA A;  1L3U A;  2ISP A;  3LQC B;  5J2H A;  3RB6 A;  2BCV A;  1SZP A;  8ICE A;  1TAQ A;  4KLQ A;  2BCQ A;  4RUA A;  2DR8 A;  2ZJ5 A;  1NJY A;  2RFF A;  3FDS A;  2MUT A;  5KFK A;  1ZQM A;  3GFK B;  5DBB A;  1B22 A;  4XUS A;  3V72 A;  4KN7 A;  4F5N A;  4NKU A;  4RZR A;  4M9H A;  2UVR A;  4UB3 A;  1BPE A;  4YVZ A;  8ICN A;  2BKE A;  2DR5 A;  4R65 A;  4AT7 A;  8ICL A;  2PFQ A;  4M04 A;  2ZJA A;  3RR7 A;  5KT5 A;  1MC8 A;  5HRI A;  4DWI A;  1HUZ A;  4KLM A;  3G6V A;  8ICZ A;  1ARO P;  4KMU A;  8ICK A;  9ICL A;  5KFZ A;  4M0A A;  4MF2 A;  1KRP A;  3AU6 A;  4X4U A;  1X9S A;  1NJW A;  3H38 A;  4RQ5 A;  2HVI A;  8ICT A;  4QW9 A;  3OHA A;  4ED6 A;  4PGX A;  9ICT A;  5DBA A;  3MDC A;  5KG2 A;  2XGQ A;  3C1Y A;  1TKD A;  4DF4 A;  2KZZ A;  4E8F A;  3RH6 A;  5EOZ A;  1MIY A;  1ZQJ A;  4DF8 A;  4IG8 A;  1TV9 A;  2Q66 A;  3RTV A;  3H37 A;  1KEJ A;  9ICF A;  9ICQ A;  5HRG A;  3HT3 A;  4IRK A;  3EZ5 A;  2AQ4 A;  1XSP A;  4DO9 A;  4TUR A;  2BCS A;  3EPI A;  3KTQ A;  5D4B A;  2I9G A;  2PI4 A;  5IIN A;  4RNO A;  5BPC A;  3KHR A;  4MEX A;  4DL3 A;  4J9S A;  5KFI A;  5KFL A;  3TAQ A;  1UET A;  3GV7 B;  3OHB A;  4YR3 A;  5DQI A;  3C2L A;  2NRX A;  3OVS A;  5J0U A;  4O3O A;  4I2I A;  5J2K A;  3PR4 A;  3V7J A;  4DL5 A;  2XY6 A;  4KLT A;  3PW0 A;  3L9D A;  4QW8 A;  2IBK A;  4F4W A;  2ZTE A;  3Q8R B;  1SKR A;  8ICF A;  4IQU A;  3PX6 A;  5KFB A;  9ICK A;  4M9L A;  5HMM A;  4YP3 A;  4BXO A;  3KHG A;  4KLS A;  4F4Z A;  1ZQT A;  3M9N B;  3MBY A;  3C5F A;  4B9M A;  4JV2 A;  2XY5 A;  1RXW A;  1ZQC A;  2KN7 A;  3ZD9 A;  3T5J A;  1X9W A;  3C1Z A;  4I2G A;  4QZB A;  1NKE A;  5CB1 A;  1S9F A;  4IRC A;  4UB5 A;  5KG5 A;  3KHH A;  3RH4 A;  5KG0 A;  4F93 B;  2M2V A;  4WBY A;  4I2J A;  1VFG A;  3TI0 A;  1V4A A;  1ZQV A;  1KFD A;  4KLU A;  4O9M A;  5J0O A;  4KTQ A;  2DRB A;  5HHI A;  2ZHB A;  4WC7 A;  4ELU A;  2ZUD A;  1ZJM A;  4RQ2 A;  3Q8P B;  4QZA A;  3UPQ A;  4X0A A;  4F5O A;  1NK8 A;  3H7I A;  4RPZ A;  3ISB A;  5DGA A;  4ECU A;  1XU4 A;  4ELT A;  4I28 A;  4P4P A;  2FPM A;  3MR2 A;  3HJ1 A;  3T5H A;  2M2T A;  5KFP A;  1KFS A;  2ASL A;  3SV3 A;  1NK6 A;  4FHY A;  3JPT A;  5J0Y A;  4KLE A;  2J6U A;  4DL4 A;  4BXO B;  5CJ7 A;  3EYZ A;  4IR9 A;  5HR9 A;  3RAQ A;  1UT5 A;  1KNY A;  3C2M A;  3HIY A;  2R8K A;  4EBK A;  4GXI A;  5F2V O;  2NRZ A;  1QLN A;  8ICM A;  4F92 B;  5J0X A;  4RWO A;  4Q43 A;  1X9M A;  3QEA Z;  1SL2 A;  2ISO A;  3RJK A;  4K4G A;  3B0Y A;  4RQ6 A;  2M2W A;  1ZQZ A;  9ICI A;  1SKW A;  9ICV A;  4B9T A;  1HUO A;  3MDA A;  3OV7 A;  2FMQ A;  4M9N A;  3PX0 A;  2ZH2 A;  2XO7 A;  2JEG A;  1ZQE A;  1L3S A;  5III A;  2FMP A;  4EZ9 A;  3Q8Q B;  1BPB A;  3HJ4 A;  3H4B A;  3IM1 A;  5DQG A;  3H8W A;  2AQ0 A;  4QZ9 A;  4EP7 A;  4ECW A;  4KLG A;  4YFK A;  3RB3 A;  1ZQU A;  4Q45 A;  4X5V A;  2ZH9 A;  1IM4 A;  3BQ2 A;  4GXK A;  3HPO A;  3UQ0 A;  4F3O A;  5KFA A;  2P6U A;  4UAW A;  4DLG A;  1ZQS A;  2PFP A;  4DOA A;  1S97 A;  1JQR A;  3Q8M A;  2KP7 A;  1H38 A;  5DLG A;  5CHG A;  1ZQX A;  2P6R A;  7ICU A;  3PML A;  1Q78 A;  3RJE A;  5J2G A;  4RPX A;  2H5X A;  2UVW A;  3PY8 A;  1UT8 A;  4M47 A;  9ICU A;  1ZQD A;  3AQL A;  3RBD A;  2ZH1 A;  4M2Y A;  1CEZ A;  9ICW A;  2R8I A;  1SL1 A;  2JZB B;  5DB8 A;  1R8A A;  3FYH A;  1KFT A;  9ICA A;  8ICH A;  5BOM A;  1YLQ A;  4P4O A;  5J2J A;  3T3F A;  2DPI A;  3E2E A;  3M9M B;  1ZET A;  5DB7 A;  4ECV A;  2IHM A;  4EBE A;  4XQ7 A;  3ISC A;  4ED7 A;  3JZ0 A;  4YQW A;  4B9U A;  3EWA A;  3BQ0 A;  4DSJ A;  3TFR A;  9ICC A;  4F8R A;  4F4Y A;  3OJU A;  4PH5 A;  1K1Q A;  4F5Q A;  4DOC A;  2UVU A;  4F2R A;  1Z00 B;  4I2C A;  4ECQ A;  4TUQ A;  4B9V A;  1BNP A;  3C18 A;  1WOT A;  4EZ6 A;  1WCN A;  4M6W B;  3AUO A;  4Z6E A;  4KLF A;  3ZD8 A;  4QZE A;  2HHQ A;  5KT3 A;  1Y88 A;  2A1J A;  4J9R A;  3ZDE A;  5DKW A;  2ZTD A;  1BPX A;  4UD5 A;  4WC3 A;  3SYZ A;  1MIV A;  2O5A A;  1ZYQ A;  3PR5 B;  1XC9 A;  1NK9 A;  1QSY A;  1T4G A;  3GDX A;  2PBE A;  1TK0 A;  5HP4 A;  9ICS A;  8ICI A;  4YMN A;  3AQN A;  5KFU A;  4XQ8 A;  3V7L A;  1ZQR A;  5D46 A;  5J0P A;  1MSW D;  4QZI A;  4IQV A;  2JEF A;  1T7P A;  4QWE A;  4WCW A;  2BPF A;  4K4H A;  4RNM A;  4I29 A;  2BE3 A;  4C8K A;  1N56 A;  1XWL A;  1NJZ A;  1PZN A;  1T8E A;  4I27 A;  1BNO A;  4HYK A;  2BPC A;  4QZG A;  5L1K A;  1ZQI A;  2FLN A;  4LZG A;  2HHW A;  3WFS C;  1VJ7 A;  3N97 B;  3BDP A;  4WC1 A;  2RDI A;  4QZ8 A;  4M6W A;  4PHD A;  4DQQ A;  3RJH A;  3ZDA A;  7ICM A;  1MQ3 A;  4F4X A;  2XY7 A;  5CWR A;  4PGQ A;  1C7Y A;  4E7X A;  1TFR A;  7ICJ A;  4KLO A;  4BWJ A;  1CUK A;  3V6J A;  4QZC A;  5KFC A;  2IHN A;  5DEC A;  2ZH8 A;  3EW9 A;  5KT6 A;  3UQ2 A;  8ICV A;  4RU9 A;  4RNN A;  5JUM A;  1TVA A;  1NK5 A;  4KLJ A;  3AU2 A;  7ICK A;  4YMO A;  4S3N A;  4UD4 A;  3RR8 A;  3PW7 A;  4DL6 A;  4DS5 A;  3LWL A;  9ICX A;  1R8C A;  1FA0 A;  9ICO A;  3ISD A;  4YD1 A;  4NLG A;  4B9L A;  3WFP A;  3RAX A;  3MR3 A;  4JK1 A;  4DFK A;  1UA1 A;  1ZQF A;  1MIW A;  1N48 A;  4QWD A;  1Z3E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...