4PPXA

Dna polymerase beta e295k with spiroiminodihydantoin in templating position
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
314
Chain Sequence
ETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of DNA Polymerase beta with DNA Containing the Base Lesion Spiroiminodihydantoin in a Templating Position.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 314
sequence length 327
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ppxA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ppxA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ppxA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ppxA03
2HHUA 4X4NA 5J0OA 4RQ7A 1BPZA 4DO9A 1S0VA 4DL7A 1TFRA 4X5VA 1ZQTA 2ZH2A 2BQ3A 2DR5A 3JPTA 4TURA 3RH5A 3FYHA 3EW9A 3QZ7A 3M9NB 4RQ8A 4C8LA 4KMUA 2F1JA 5F9LA 3RAXA 1T3NA 3AU6A 4UQGA 3GV8B 4UAYA 1U47A 4ED1A 4X4TA 3SI8A 4QWBA 8ICFA 2FMSA 2A1JB 4NLGA 9ICMA 3OV7A 1UEVA 5HHIA 3UPQA 1ZJNA 4YCXA 5HRLA 4DFKA 4ECWA 3T5JA 3N97B 4JWMA 8ICVA 3OVSA 5HRKA 1ZQRA 1S0NA 1NKBA 3GILA 2AGOA 3RJIA 5KFMA 1CEZA 4ECTA 4XQ7A 4UB5A 1BNPA 2MAXA 4IQTA 4KLFA 3MBYA 2BPGA 5DGAA 4R8UA 1T8EA 4DQRA 1TK8A 2PFQA 2BCUA 4RWOA 4F5NA 9ICBA 3UPSA 5HC9A 4PHEA 1MIYA 3AU2A 9ICPA 4TQRA 4M9NA 5KT5A 3SV4A 1IXRA 3Q8QB 3G6VA 3V6KA 1ZQDA 3SZ2A 4K4HA 2AGPA 1S76D 1BPYA 1VFGA 1ZQKA 3G6XA 3RJHA 1TAQA 4TUPA 2M2VA 3PMNA 4J9OA 1BPBA 2ALZA 2FMPA 4JWNA 4O5EA 1A77A 4QZBA 2W8LA 3KHRA 4ECZA 8ICCA 3OVBA 4IQWA 2DVIA 4UAWA 3AQMA 1ZQMA 4P4PA 7ICTA 8ICRA 5BPCA 5KFZA 8ICHA 5DBCA 3C2LA 2BCSA 2J6TA 3OUYA 5KT4A 1EXNA 4O3OA 2W9BB 1NO5A 4FHYA 3RJFA 4KN4A 2W9CB 2ASDA 3PW7A 2PI5A 1JXEA 1UA1A 2UVWA 4TUQA 2C28A 4FHXA 4O3RA 4KN7A 1ZQPA 1NK0A 4KLOA 1T7PA 5KFPA 3V7JA 1JX4A 3HT3A 4C8OA 3H37A 5J2BA 5J0XA 7ICSA 5IIIA 1ZQEA 4FHVA 4KLDA 4Z6CA 3T5HA 1WCLA 9ICWA 4I2IA 1NJWA 2XGPA 4J9LA 2DPIA 4AT9B 3Q8KA 3ZDAA 2DRAA 4DOBA 3RB3A 2DFLA 2J6SA 3KTQA 4IR9A 5DKWA 9ICHA 5DQGA 5KT7A 3OJUA 4EZ6A 4F5QA 4IRDA 1MIVA 4PHDA 3GV7B 4ED0A 5DLFA 2NRZA 4NLNA 4WC4A 5J0UA 1KDHA 7ICJA 4FH5A 4RPZA 4YD2A 1K1QA 3TANA 1ZQIA 1ZQOA 1UT5A 3ISDA 1BNOA 1S0OA 5HRGA 2M9NA 4RPXA 7ICEA 3GQCA 1XO1A 1CUKA 5DQHA 2BPFA 1TAUA 2C22A 4XQ8A 5CWRA 1S0MA 4YQWA 4B9TA 5F9NA 4RQ2A 9ICFA 4EYIB 1BPXA 1KFTA 4EZ9A 4KLMA 4QZEA 3MR3A 3JPRA 4NXZA 3KHLA 2AGQA 2KTQA 3ETLA 1PZNA 2DR9A 3SYZA 5KFWA 3NYBA 4WBYA 5HRIA 3UXPA 4F4KA 9ICGA 1DGSA 5KG4A 2IA6A 4WC6A 3GIIA 3WFOA 2M2UA 4Q43A 2HHXA 3BQ1A 4R63A 1RXVA 5DB6A 1XSLA 4DSJA 4UBBA 4DOAA 4EBKA 3BQ0A 1S9FA 4CCHA 4F4YA 4MF2A 1NZPA 4X4VA 1D8LA 2IMWP 1XU4A 5DDMA 2ZJ5A 4PHPA 5DLGA 4ECVA 1HJPA 1X9SA 3MGHA 2PBEA 1ZQHA 3EPIA 3Q8MA 2KN7A 4DQQA 1UEUA 5J2FA 2HHSA 3EYZA 3MFHA 4QW9A 1ZQGA 5KFKA 1LB2B 4Z6DA 2I9GA 3T5KA 4E7XA 1NOMA 4M6WB 2Y1JA 1XC9A 2P6UA 4I2BA 1QSLA 3ZD8A 1DK2A 3GDXA 4GXIA 1KFDA 4RUCA 4F4ZA 3PY8A 4QZDA 4K4GA 9ICAA 7ICVA 5HRFA 4AT7B 5KFLA 4F91B 4I2CA 4BXOB 4PPXA 4ED8A 5HRDA 1XSNA 1V9PA 4YD1A 3OHAA 2PXIA 4F4XA 8ICXA 4QZ8A 1NKEA 3GV5B 5CJ7A 4I2HA 4O9MA 4ATBB 5CP2A 1BVSA 1N48A 4R66A 8ICQA 1PX5A 3BJYA 3C18A 5J0WA 4GC6A 2ZHBA 9ICNA 3PR4A 5J0YA 1TKDA 4YR0A 2NRTA 3Q8RB 2XY5A 3PV8A 3H7IA 3UXNA 3JPSA 3MR6A 5JUMA 2AQ0A 2Q0ZX 2V4QA 1F5AA 5BOLA 4DL6A 1XS9D 5HRBA 4NKTA 4Q44A 4RQ4A 4MF8A 4B9UA 9ICVA 4AT8A 1L3UA 4NY8A 4RNMA 3PW5A 2ZUBA 4B9NA 3LQCB 3RR8A 4ECUA 4DF4A 4GXKA 1ZQZA 3ZDCA 5L1IA 8ICYA 5DEDA 4YMNA 4YMOA 5KFQA 4ELVA 8ICGA 2UVRA 4DOCA 2XCAA 3G6YA 3H3AA 2GWSA 5C5JA 4DSFA 3TFSA 4UB2A 2P66A 1R8AA 5KG1A 3OUYB 2BQUA 1JQRA 1JIHA 1ZQCA 4X4PA 4RZRA 4F2RA 4ECYA 4RT2A 5L1KA 3PX4A 3AUOA 1JMSA 4F5RA 5DDYA 3H8SA 1D9FA 2BE3A 3C23A 4E0DA 3MR2A 3JYYA 2XC9A 5CA7A 5DB8A 4UB3A 1R89A 4I2AA 2R8HA 4X0AA 4RWNA 5CHGA 3RH4A 1KRPA 4KLJA 4X4SA 4KLGA 5KTQA 3JPPA 4ED6A 4B9LA 3JPNA 4WC7A 4PH5A 5DECA 2HHPA 1NK5A 4DS5A 1NK7A 3RJEA 2ZH7A 1K1SA 2FLNA 2PFOA 2IHMA 2JZBA 4F92B 3OSNA 1D9DA 2DRBA 4M04A 4DL2A 4X0BA 4ECRA 7ICKA 2NRWA 3B0YA 1ZQVA 4P4MA 4YR2A 1ZYQA 5EWEA 5L9XA 4DFJA 4YG2A 5J2AA 5HMLA 4I2DA 3KHHA 2PFPA 4F3OA 2KFZA 4WC2A 2KZMA 5KFTA 4Z6EA 7ICPA 4KLIA 2Q66A 3H40A 1SKWA 3GFKB 4I29A 1RXWA 4KLQA 4YN4A 4NM1A 4WC0A 2ZHAA 4F5PA 2F1IA 2C2DA 4I2GA 1BPDA 5KFSA 4FBTA 1UA0A 4TQSA 2FMQA 4DSKA 1HUZA 2BCVA 4DWIA 3AQNA 4M9JA 1ZQSA 1Z3EB 4LZDA 3ZDEA 4HYKA 3H4BA 3RTVA 2M2TA 1SKRA 7ICFA 1LV5A 3HJ4A 9ICXA 4NM2A 4YVZA 4J9MA 1NJYA 3BQTA 4PGQA 4E8FA 4I27A 1ZQXA 2C2EA 2C2RA 2UVVA 2P6RA 2HVIA 8ICTA 1X9MA 1TK0A 2F1HA 1ZQNA 4KITB 2XO7A 4ED7A 4QZAA 1WOTA 3H8JA 1TVAA 2ZH1A 4IQUA 4M9LA 1S77D 5L1LA 3IM1A 5J2EA 5DBBA 1ZETA 5KFFA 2BQRA 1KFSA 4YMMA 3QEBZ 2HHVA 4M6WA 2ASJA 2ZTCA 2XY6A 1R8CA 2JEGA 3EPGA 1MQ3A 4WBZA 3C5GA 2FLPA 1MSWD 3JPOA 3M9MB 3MFIA 1SKSA 9ICEA 5HREA 2LYHA 4GC7A 4K4IA 2RFFA 2JEJA 1BPEA 8ICNA 3RJGA 4F4WA 1BGXT 1Z00A 3ISCA 2NRXA 2MUTA 4DS4A 1XSPA 3LK9A 1NK6A 4JV1A 2BCRA 4ATBA 1B43A 5KFAA 7ICUA 3BQ2A 1IM4A 1KEJA 3M8SA 5KT2A 4I28A 5DG8A 3WFSC 4ZH4A 5IIJA 4UB1A 4F50A 5CR0A 4EBEA 1COOA 4XUSA 4ECSA 4DSEA 3PVXA 3RH6A 5HR9A 1Q79A 3ZDDA 5J2JA 4M5DA 1MIWA 1AROP 4YP3A 3B0XA 3RAQA 9ICOA 1OU5A 1RYSA 5KFBA 1Q78A 3HW8A 3H4DA 2IBKA 4M47A 4IRKA 1MQ2A 4C8NA 3PW2A 1NJXA 4RT3A 2FLLA 4EBJA 1NK8A 5J2IA 4C8KA 4KLSA 4KLTA 4X4QA 2ZH9A 1S10A 1MC8A 1T4GA 4KTQA 4EBCA 8ICMA 4YXMA 4S3NA 4KLLA 5J0RA 4BWMA 3WFRE 3V72A 4QZFA 3QE9Y 8ICBA 1NK4A 3NGDA 4MEYA 5HMMA 4Z6FA 4MEXA 3HX0A 2ISOA 3RJJA 4DSLA 2JEIA 4WC5A 4O3PA 5HNKA 2XGQA 4GXJA 4RQ1A 4O3QA 4DLEA 5KFRA 4YR3A 3T5LA 4DF8A 4DFMA 2R8KA 2R8JA 1N56A 4IQVA 2V9WA 3TARA 4KLHA 4J9RA 1UT8A 4QWAA 7ICGA 4DL5A 1U49A 4F2SA 2VA8A 2Y1IA 3L9DA 4R64A 4ED2A 3RBDA 4IR1A 4AT9A 4RWPA 4QWDA 4WC3A 4QZCA 5IILA 1NKCA 1H38A 1RPLA 4I2EA 3HJ1A 4XA5A 4PGYA 5J0SA 1RYRA 2R8GA 2BCQA 4P2HA 3IHQB 2W8KA 2ID1A 3H39A 1D8YA 1S97A 3C2KA 2RDIA 4FO6A 2PFNA 3KHGA 5KFEA 2ZTDA 9ICUA 4J9PA 1JAJA 1U45A 1L3VA 3PO4A 4O3SA 1V4AA 4FS1A 5IIMA 3QZ8A 4FBUA 4RQ5A 1VJ7A 3UQ2A 8ICZA 4WC1A 3ORYA 4RQ6A 3V7LA 3V6JA 3NTUA 2KZ3A 3H38A 3THVA 5KG3A 5KFHA 5KT6A 3V7KA 5J29A 4YFKA 5KFOA 4UD5A 3UXOA 1DOQA 3H8WA 4DEZA 4QW8A 2AU0A 4DFPA 2PI4A 2DR7A 3RBEA 3ZDBA 4UD4A 2BPCA 2JEFA 7ICIA 3OHBA 4JV2A 9ICLA 4MFFA 2O5AA 5KG7A 4PHAA 4KLUA 4R65A 3TQ1A 2V4RA 4WCWA 4BGDA 5KFJA 4TUSA 2DPJA 4NKUA 8ICAA 4X4OA 1KTQA 4E80A 2O1PA 2ZUCA 3OSPA 4EP7A 1L3SA 5EWGA 9ICIA 1QTMA 1SL0A 4DQPA 4DLGA 5KFUA 5DB9A 3V6HA 4LZGA 5KFCA 8ICUA 1YLQA 4RWQA 4J9SA 3Q8PB 7ICRA 5DBAA 3T3FA 3TAQA 4QZGA 5D49A 4QZHA 3EZ5A 1JN3A 3SV3A 7ICMA 1SZPA 3TFRA 4LVSA 2AJQA 7ICNA 5DG7A 1TFYA 3PX0A 2VA2A 1FA0A 4UBCA 2HHTA 4O5CA 1WCNA 3OGUA 1TK5A 1NJZA 5EOZA 5CB1A 1B22A 4ECQA 2ASLA 3E2EA 3PX6A 2IHNA 4RPYA 2I1QA 1QSSA 3GIKA 4PGXA 1KSPA 2KFNA 1NK9A 2KP7A 1L3TA 2W9AA 1ZQWA 5J0QA 2B21A 4GLXA 4JK1A 2MUTB 3OJSA 4I2FA 1KLNA 3ZD9A 3RB6A 9ICRA 2ZH6A 3PW4A 4J9QA 3N4MB 1U9LA 4XRHA 1U48A 4G3IA 9ICKA 4RNNA 1ZQLA 2FPLA 4BDPA 4Q45A 1DK3A 2KZZA 2NRVA 4FHPA 7ICHA 5DB7A 2ZTEA 2RDJA 2OWOA 3K75D 3TAPA 3MDCA 1JXLA 3HIYA 2HVHA 9ICTA 3PW0A 4O0IA 5KG6A 2A1JA 3C2MA 3BDPA 3C1ZA 5KFGA 3OVAA 5HP4A 1RZTA 4ELTA 4QZIA 2BKEA 5F2VO 5KFIA 4UB4A 5DQIA 3C1YA 2WTFA 3GIJA 4FH3A 4RUAA 3LWMA 3M8RA 2FPKA 5J2HA 4ECXA 3RB4A 4DQIA 3Q8LA 4AT7A 4BXOA 5TZVA 4RNOA 4DL4A 2NRKA 1TFWA 4F93B 5EWFA 1U4BA 4R8UB 5KFXA 1SL1A 2ZH8A 4RQ3A 4QZ9A 3UQ0A 4BWJA 1ZQQA 4ED3A 1ZQBA 1ZQUA 3MR5A 1ZQJA 4AT8B 2AQ4A 5IIKA 2H5XA 2ZH4A 5J0PA 2DR8A 9ICJA 3PR5B 2XY7A 4JUZA 4C8MA 9ICSA 4DQSA 1C7YA 3AQKA 2ZH5A 4P4OA 5DG9A 3RB0A 2BR0A 3LDAA 1ZQYA 3K4GA 7ICLA 2VANA 1R8BA 5IINA 4MFAA 2ZUDA 5J2DA 4RU9A 8ICKA 1UETA 4JV0A 4YXJA 3HWTA 3M9OB 5BOMA 4DL3A 3EWAA 3MABA 4I2JA 3RR7A 4QWCA 2HW3A 8ICIA 1TV9A 4FHWA 1XWLA 2BHNA 3RJKA 4O3NA 4M9HA 3HPOA 2HHWA 3WFQE 1L5UA 5J2CA 2HHQA 2ZJ8A 4IG8A 3AQLA 3MDAA 2W9BA 1ZQFA 3MGIA 5KFDA 2XCPA 5D4BA 3RRGA 3LWLA 4F8RA 2W9CA 1ZJMA 4RQ0A 4DSIA 1A76A 1KNYA 5J0TA 1ZQAA 4LT6A 4Q8FA 5HHHA 5J2GA 4NLKA 5KFVA 4Q8EA 5KG2A 3GIMA 1X2IA 5D46A 5KFYA 3QEAZ 4EBDA 2BGWA 4B9SA 3PNCA 5J2KA 4B9MA 3C21A 4UAZA 4QWEA 2W9MA 3ISBA 2M2WA 8ICJA 3HP6A 9ICQA 5KFNA 2ZH3A 2ZJAA 3C66A 2VA3A 9ICCA 3JZ0A 2ISPA 5KT3A 2JZBB 1X9WA 4B9VA 8ICEA 4M0AA 5DGBA 1SL2A 3PO5A 8ICWA 4EYHB 5HRHA 5IIOA 7ICQA 2BDPA 4J9KA 5KG5A 2ATLA 4EEYA 8ICSA 3RRHA 8ICOA 1Y88A 2UVUA 4FS2A 3PMLA 3JPQA 3WFPA 2FPMA 3TI0A 3FDSA 5KG0A 1HUOA 4IRCA 4X4RA 4X4UA 4MFCA 4ELUA 8ICLA 2J6UA 4NLZA 4O5KA 4F5OA 4M9GA 1QLNA 4J9NA 8ICPA 2R8IA 1QSYA 5L1JA 1Z00B 4M2YA 4KLEA 7ICOA 3Q8SB 3C5FA
chains in the Genus database with same CATH superfamily
5J0OA 5EE0A 1BPZA 2ZIXB 1DGJA 3RH5A 3QZ7A 1N63A 2F1JA 3SMVA 5F9LA 2IUBA 3GV8B 3LVVA 2IOHA 4QNLA 1X6JA 3OV7A 2KE7A 2OYYA 3UPQA 4DFKA 2WF6A 3A0BU 3T5JA 8ICVA 1YZ7A 1ZQRA 1O08A 4IS7A 2AGOA 5KFMA 1CEZA 4ECTA 4EENA 4IQTA 3KZXA 3HRDD 2BPGA 4R8UA 2BBJA 2AHOB 5CFTA 5AIBA 4TQRA 2DUYA 4WH5A 2N1RA 3SZ2A 4K4HA 2EAPA 1BPYA 3RJHA 4KB6A 1TAQA 3DV9A 3QX7A 4QZBA 2W8LA 1COKA 3OVBA 2W03A 3M6ZA 7ICTA 2F8KA 8ICRA 5KFZA 3UM9A 4KX5A 4O3OA 1NO5A 5L1MA 2W9CB 2ASDA 1F5SA 2PI5A 2UVWA 2C28A 4O3RA 4KLOA 1T7PA 2G09A 4FHVA 5J2BA 5J0XA 7ICSA 1ZQEA 1JROA 4Z6CA 1WCLA 4I2IA 2DPIA 3ZDAA 2J6SA 3RB3A 2DFLA 2VJ4A 3HKZC 3UMBA 5DKWA 5DQGA 5AK6A 4EZ6A 3GV7B 4ED0A 2QB1A 1X9XA 4NLNA 7ICJA 3T79A 2I5HA 1BNOA 5HRGA 2WF9A 3C28A 3GQCA 4XQ8A 9ICFA 1S0MA 2Y0SF 3IP4B 4EYIB 4EZ9A 2CN1A 4JB3A 1PZNA 4PL1A 2IA6A 2FI1A 2W54A 4UBBA 3BQ0A 4F4YA 4X4VA 1N5XA 5DDMA 2WF8A 2ZJ5A 4ECVA 2PBEA 2KN7A 2HHSA 2Y9UA 3I76A 4LEZA 3CRXA 4Z6DA 4K9BA 2LYAA 3T5KA 4O69A 1LKYA 1Q46A 1QSLA 3GDXA 1KFDA 4QZDA 3BQ7A 4I2CA 5HRDA 3KKAC 4YD1A 5CFSA 2PXIA 3GV5B 4I2HA 1N48A 3C18A 5J0WA 4GC6A 2KJ9A 9ICNA 4NXWA 2KMDA 5ALJA 2XY5A 4UB6U 3UXNA 3JPSA 1RG6A 2V4QA 1QQ5A 4DL6A 4RQ4A 4MF8A 4B9UA 9ICVA 1L3UA 2ZUBA 4DF4A 2E8NA 4PZNA 2YX8A 5KFQA 2HBLA 2XCAA 1KN5A 5C5JA 4UB2A 1R8AA 3AL0B 4X4PA 1ZQCA 4ECYA 3PX4A 5DDYA 1D9FA 2WFAA 4E0DA 2XC9A 4NLCA 1R89A 4X0AA 4RWNA 1PK1A 1WUDA 5KTQA 3JCFA 5DECA 2HHPA 3RJEA 2W3SA 3E0FA 1FO4A 2DRBA 2EZZA 4DL2A 4ECRA 2G07A 2GAFD 4FZLA 2W04A 3B0YA 3BS7A 4P4MA 4F3OA 2YMQA 4I2DA 4Z6EA 3H40A 3GFKB 4FO1A 4KLQA 4YN4A 4QIWF 2C2DA 5KFSA 1VJ5A 4DWIA 1Z3EB 4LZDA 3H4BA 1B4FA 1SKRA 3HJ4A 4NM2A 4PGQA 4E8FA 2C2RA 2UVVA 2P6RA 2HVIA 8ICTA 3NVOA 1URJA 3H8JA 3KOOA 4IQUA 3PSIA 4PZOA 1S77D 3IM1A 5J2EA 2MSNA 2YTUA 2HHVA 2ASJA 3EPGA 4WBZA 2FDRA 4NV0A 3KKAA 4OAHA 5T14A 3MGVA 2JEJA 1BPEA 5CEHA 3CW2C 1NZBA 2NRXA 2BCRA 5KFAA 2KHQA 4UW9A 2HOFA 3N7PD 5KT2A 5IIJA 5CR0A 3RH6A 1WYGA 1Q79A 5K4LA 4YP3A 1OU5A 9ICOA 1RDFA 1RYSA 2IBKA 4IRKA 1MQ2A 4C8NA 1NJXA 1N62A 3NVWA 4EBJA 4X4QA 4KLSA 4KTQA 3QUBA 4KLLA 5AKHA 4BWMA 1NK4A 4MEYA 3HX0A 2JH1A 3DEEA 4CNQA 5AKLA 3QYPA 1N56A 3TARA 4KLHA 7ICGA 1U49A 4F2SA 5CRXA 2VA8A 3QUTA 3L9DA 4WC3A 4IR1A 3F2BA 4QWDA 4QZCA 1RPLA 3HJ1A 4XA5A 2R8GA 2BCQA 2KJ5A 3C2KA 5KFEA 2OCEA 3PO4A 4O3SA 4CF5A 3PZPA 4RQ5A 4RQ6A 2HBJA 3NTUA 5KT6A 5AKZA 5J29A 4YFKA 4UD5A 1DOQA 4QW8A 1X66A 3ZDBA 2O5AA 4JV2A 4KLUA 4BGDA 4TUSA 2DPJA 5CHEA 4UB8U 8ICAA 3OSPA 1SL0A 3V6HA 3SR6A 3K7DA 5AM2A 4J9SA 7ICRA 2K4HA 3T3FA 1CRXA 4QZHA 1JN3A 7ICMA 1SZPA 1TFYA 5DG7A 1WG8A 3I1YA 1B22A 1UHUA 2ASLA 3PX6A 4RPYA 1QSSA 2KP7A 1NK9A 1L3TA 2W9AA 1ZQWA 5J0QA 5AI0A 2CXYA 3WK8A 4I2FA 4ICAA 3RB6A 2ZH6A 5AK5A 1U9LA 3FC4A 2NRVA 4K99A 2ZXHA 3K75D 1JXLA 2A1JA 3BDPA 3C1ZA 5KFGA 2JHDA 3AMZA 3OVAA 3NS1A 5B66U 1RZTA 1F0MA 2BKEA 5KFIA 3C1YA 4FH3A 5J2HA 3Q8LA 5AKJA 5TZVA 4KMOB 1PVQA 1TFWA 4OJOA 3ER8C 4RQ3A 1C20A 3UQ0A 5JU5A 4BWJA 2AH5A 5ALEA 1ZQUA 2AQ4A 2H5XA 4GFJA 5J0PA 9ICJA 3PR5B 4C8MA 4U6PA 2E8PA 1C7YA 4LEWA 5DG9A 1ZQYA 4NXUA 5IINA 5ALQA 1UETA 3RR7A 1QCKA 3MABA 2HW3A 1XWLA 1D8BA 3K1RB 2HHQA 4WOYA 2BBHA 2ZJ8A 2W9BA 3RRGA 3LWLA 4UARA 5J8YC 2E8OA 1A76A 1Q3UA 1X42A 1ZQAA 1B0XA 4Q8FA 5AI8A 4Q8EA 3QEAZ 4EBDA 5AI6A 4B9SA 4B9MA 5J2KA 4ZOHC 4QWEA 2RQ5A 3HP6A 9ICQA 2ZH3A 2XICA 3C66A 2I6XA 9ICCA 5KT3A 8ICEA 2YMLA 8ICSA 8ICOA 2MRLA 3PMLA 2YY6A 5KG0A 1HUOA 4MFCA 1MA7A 1KKXA 1OUQA 8ICPA 4M2YA 1OXJA 2YN4A 5H2FU 2F3NA 4X4NA 4RQ7A 3HILA 3NWIA 1JALA 4NXVA 3FYHA 3EW9A 3D2SA 3M9NB 1T3NA 3F53A 1U47A 4EX6A 3M1YA 4U7CA 5ALZA 4O6AA 1UEVA 4YCXA 5HRLA 2OM6A 4AYBC 3RJIA 3QU2A 3OPXA 4KLFA 1IG6A 3MBYA 5HC9A 2G5IB 3UPSA 4PHEA 1MIYA 5KT5A 3Q8QB 3V6KA 2AGPA 1N61A 2M2VA 3PMNA 4J9OA 4Y2JA 3KHRA 4IQWA 4UAWA 4P4PA 2FE9A 3C2LA 2BCSA 2J6TA 2G06A 4FZNA 3ETRA 1LVHA 4KN7A 1UQVA 1NK0A 4C8OA 2JV3A 3HT3A 2QB0A 1L7MA 4KX3A 4JLXA 3T5HA 1OW5A 9ICWA 3QU4A 4DOBA 2KNJA 3B9JA 3FM9A 1L6NA 4J03A 1N2XA 1YZ6A 5J0UA 4YD2A 3ISDA 1S0OA 7ICEA 1XO1A 2WAQC 4A8EA 2C22A 3QXGA 4B9TA 1BPXA 4IC9A 3ETLA 1SGGA 2DR9A 2EZXA 3SYZA 5KFWA 3NYBA 3IRUA 3UXPA 4F4KA 9ICGA 4IL6U 2M2UA 1RXVA 5DB6A 4DSJA 4EBKA 5AKXA 1NZPA 4O68A 4WJ3B 2RRDA 2IMWP 5E79U 1JI7A 4PHPA 4C80A 1X9SA 3MGHA 3Q8MA 5J2FA 1ZQGA 5KFKA 2I9GA 1NOMA 1XC9A 1A6SA 2P6UA 1DK2A 3ZD8A 1KW4A 4GXIA 2HBMA 3PY8A 9ICAA 7ICVA 1L8OA 3MC1A 4ED8A 1XSNA 4F4XA 8ICXA 3U26A 4ATBB 5CP2A 4CF3A 2B6GA 3BJYA 5J0YA 1TKDA 3QNMA 3Q8RB 2DWQA 3PV8A 3H7IA 4OJ5A 4PL2A 2AQ0A 1F5AA 1XS9D 3H8MA 1V38A 1Z19A 1Z4NA 3FAHA 3RR8A 3NRWA 3ZDCA 2XVTA 5DEDA 4ELVA 4YMOA 8ICGA 2ZIWB 3H3AA 3G6YA 3I28A 2P66A 4PJ0U 5KG1A 3OUYB 2BQUA 1JQRA 1JIHA 2E1FA 3EF2A 4RZRA 3AUOA 2WB1F 2BE3A 3MR2A 4UAUA 4UB3A 1QH9A 2R8HA 5CHGA 3RH4A 2GA9D 1QQ6A 4JLZA 5ALXA 4DS5A 2PMZF 2EZYA 2FLNA 2ZIUB 1ZRNA 1D9DA 4X0BA 7ICKA 1ZQVA 4YR2A 1RYUA 5EWEA 4DFJA 5CFUA 3KHHA 3N28A 2QARB 5KFTA 2F44A 2HSZA 4P0PA 1BPDA 4M9JA 4HYKA 3RTVA 4K96A 4BJQA 9ICXA 5ALPA 4J9MA 4YVZA 3BQTA 3R9KA 2C2EA 3ZI4A 3C29A 2F1HA 1ZQNA 4KITB 1L7PA 2DBYA 1WOTA 3NVYA 4CRXA 4M9LA 2Y0SC 3RFAA 5DBBA 1ZETA 5KFFA 2BQRA 4YMMA 3QEBZ 4M6WA 2F76X 3SENA 2LI6A 1R8CA 1ED1A 9ICEA 5B3QA 3MFIA 4K4IA 4GC7A 2RFFA 3RJGA 4DS4A 4JV1A 1NK6A 2JH7A 1B43A 1IM4A 3M8SA 2JRZA 3WFSC 4ECSA 4XUSA 5ALMA 4FE3A 4AT8B 5KFBA 3PW2A 4RT3A 2FLLA 3KZIU 3WKAA 1J2MA 2IOFK 3WFRE 2B0CA 1O03A 4Z6FA 5HMMA 4EEKA 4MEXA 1RQNA 2ZIVB 4DSLA 5HNKA 4RQ1A 5KFRA 4NWIA 2WHEA 3ED5A 4AT9A 3RBDA 5EE9A 5D61A 2HBKA 4EV6A 5IILA 1NKCA 2ESEA 4I2EA 4MHVA 2LKYA 4OJPA 1MN8A 2LHTA 2W8KA 4LJXA 2ZTDA 9ICUA 1U45A 1L3VA 4FS1A 4C4TA 3V7LA 5ALTA 3V7KA 5KFOA 3UXOA 1ZOLA 4DEZA 3QU9A 2GOLA 3RBEA 2JR5A 4MFFA 2QB0B 2V4RA 2K60A 2A1AA 5KFJA 1KTQA 2O1PA 9ICIA 4DQPA 2DGZA 4RWQA 3TAQA 4QZGA 5D49A 1L8LA 2VA2A 4UBCA 3IN5A 2HHTA 1WCNA 1ZD5A 2R18A 2KFNA 4JK1A 2MUTB 3OJSA 2AXTU 3PW4A 9ICKA 1DK3A 2FPLA 5ALNA 5KL8B 4Q45A 2KZZA 4FHPA 5DB7A 3QU5A 2Z7JA 2DQNB 3MDCA 3TACB 9ICTA 4O0IA 4ELTA 4QZIA 5F2VO 2W3RA 2WTFA 3LWMA 4ECXA 3D2QA 4RNOA 2VIXA 1IIPA 5EWFA 1U4BA 3ERCC 4R8UB 5KFXA 1JRPA 3IDWA 1ZQQA 1XO0A 4JUZA 2W43A 2ZH5A 3RB0A 5AK3A 2BR0A 2ZUDA 2EDUA 4DL3A 4CE6A 4YXJA 3M9OB 4FHWA 4OD0A 2ZH1A 3WFQE 2HOQA 5J2CA 3MGIA 2W9CA 4DSIA 2XI9A 1KNYA 1M6YA 2H3FA 5HHHA 5J2GA 3L3FX 1X2IA 5D46A 2BGWA 3C21A 4O3MA 4P0QB 3IG5A 8ICJA 5KFNA 3KFUF 4K98A 3QUQA 4BX9C 4M0AA 5DGBA 1SB3C 1SL2A 4EYHB 5IIOA 4J9KA 2ATLA 1Q3VA 1Y88A 3WKBA 2QARA 4X4UA 3CYMA 5AK4A 1FIQA 2J6UA 4Y2RA 4O5KA 2IHOA 3KD3A 4J9NA 2R8IA 2ZXIA 1SIJA 1IV8A 5ALRA 4UASA 2HHUA 4QIWC 4DL7A 4X5VA 2KK0A 4TURA 2A3VA 4K8VA 3AU6A 3AN1A 4QWBA 8ICFA 9ICMA 3PSTA 4Y2TA 2YMMA 1ZJNA 2F77X 5AI5A 3N97B 3GILA 5AI4A 4XQ7A 5TISU 2MAXA 5DGAA 1TK8A 4DQRA 2PFQA 2BCUA 4RWOA 1SXDA 2L5YA 4F5NA 3AU2A 9ICPA 4M9NA 3SV4A 1ZQDA 4CGZA 1ZQKA 2GO7A 2OHFA 1BPBA 2ALZA 2FMPA 4JWNA 8ICCA 3AQMA 2YB1A 1ZQMA 5BPCA 2DF4B 5DBCA 2K8AA 2WF5A 1Q8KA 4C4RA 4KN4A 4Y2YA 3AQFA 3PW7A 3UMGA 4TUQA 4FHXA 2KSOB 5KFPA 3V7JA 3H37A 1PK1B 1QQ7A 4KLDA 4AT9B 3WK4A 3F5EA 4MKPA 2KIWA 5F3XB 5KT7A 3OJUA 5AM0A 1KDHA 2CRXA 4FH5A 2OH2A 2CPRA 4RPXA 1ZD4A 5GTHU 4OAGA 5ALVA 5DQHA 5CWRA 2NO5A 5F9NA 2MU2A 4KLMA 4QZEA 2IOFA 3KHLA 4NXZA 4OJLA 2KTQA 1N60A 5HRIA 5ALOA 5KG4A 2ODGA 3GIIA 1AQ6A 3WFOA 4Q43A 4R63A 1XSLA 4DOAA 4MF2A 1S9FA 3SQIA 1D8LA 1XU4A 1YT3A 5DLGA 1PUZA 5AKGA 1KQQA 4ACOA 4EGWA 1UEUA 1PVPA 3MFHA 2Y1JA 4I2BA 2NV3A 4K4GA 1K5OA 2B56A 4F91B 4PPXA 4BXOB 2W55A 4QZ8A 1V85A 4C7ZA 5CJ7A 1NKEA 8ICQA 5AIAA 2ZHBA 3GZFA 3PR4A 1S5LU 5JUMA 2Q0ZX 5BOLA 5HRBA 4Q44A 4NY8A 3LQCB 5KAFU 4ECUA 3QU7A 4UAVA 1WWVA 4YMNA 2UVRA 5AHXA 4DOCA 3CK6A 4DSFA 3TFSA 3N7SC 4F2RA 5L1KA 2YB4A 1J2NA 3H8SA 3TADA 3WU2U 5KAIU 3C23A 2E5SA 3JYYA 4I2AA 4X4SA 4KLGA 4ED6A 4OAFA 4WC7A 4PH5A 1NK7A 2ZH7A 2PFOA 1ZD2P 2IHMA 4F92B 4EEDA 4X4OA 4YG2A 4RQNA 2KZMA 3BZKA 4KLIA 4I29A 1RXWA 4DFDA 5B3PA 4F5PA 2F1IA 4USAA 4I2GA 2K4PA 1UA0A 4DSKA 1ZQSA 3ZDEA 5ALHA 2M2TA 1ZXIA 4P0QA 2KG5A 2JGAA 1ZQXA 1N5WA 2XO7A 5ALKA 2LBOA 1DXSA 5KL1B 5L1LA 3KBBA 2HMXA 1KFSA 2ZTCA 2XY6A 3RF9A 2JEGA 4WC4A 3M9MB 5HREA 2LYHA 3SAHA 2JXJA 8ICNA 4F4WA 3ISCA 1XSPA 3PHZA 5EE1A 2H3ZA 1KEJA 4ZH4A 4F50A 2ZH4A 4EBEA 3PVXA 1COOA 4DSEA 2VJ5A 5J2JA 5AKYA 1MIWA 1AROP 2DL0A 5ALIA 3RAQA 1Q78A 3HW8A 3H4DA 4M47A 1PVRA 5A0LA 1NK8A 1V97A 2W11A 1S10A 8ICMA 4YXMA 4KM5A 5J0RA 3V72A 3QE9Y 2ISOA 4WC5A 2JEIA 3T5LA 4DF8A 2A19A 1ZQ1C 4YR3A 4DFMA 4BUGA 2KKPA 4IQVA 2V9WA 4QWAA 2Q4TA 2G0AA 5C0YA 4PGYA 2HN1A 2YQEA 4QJFB 2ID1A 2HN2A 1D8YA 4FO6A 2RDIA 5AM5A 1SV4A 3WK5A 3QZ8A 4FBUA 1VJ7A 8ICZA 2KVSA 3ORYA 3THVA 5KG3A 5KFHA 2EQYA 3WK6A 2DR7A 4DFPA 2KSOA 4UD4A 2BPCA 2JEFA 4PHAA 3MCRA 3TQ1A 4WCWA 4EELA 4E80A 2ZUCA 1L3SA 4DLGA 5KFUA 3H0LB 4LZGA 5KFCA 1UCVA 5DBAA 5JTGA 4LVSA 3TFRA 2LMRA 2AJQA 7ICNA 4O5CA 3OGUA 1NJZA 3BS5A 5EOZA 4Y2SA 3E2EA 2EWRA 2I1QA 5J8YA 1X6IA 1KLNA 3NVZA 3UMCA 4XRHA 4G3IA 1Z1VA 4BDPA 5HR7A 2ZG6A 7ICHA 1J97A 4NJ8A 1KBUA 2HVHA 5AKEA 2DKZA 4FFDA 4RUAA 3RB4A 5FP0A 2RLTA 5AKIA 4BXOA 4JMUA 2K89A 4DL4A 2NRKA 3WKDA 2LPEA 4F93B 1SL1A 4OAIZ 2BDUA 1ZQJA 3MR5A 5IIKA 2DR8A 9ICSA 4DQSA 2LM1A 3LDAA 3K4GA 7ICLA 1VLBA 5HR6A 4RU9A 2DKXA 3SAFA 4I2JA 8ICIA 1TV9A 3RJKA 4M9HA 2K8BB 4IG8A 3AQLA 3MDAA 2XCPA 4US8A 1ZJMA 4RQ0A 5J0TA 4LT6A 2EH9A 3ER9B 4FZMA 5KFYA 3PNCA 2W9MA 3ISBA 2M2WA 1XNSA 3F2CA 2EAMA 2FCLA 5AM3A 2NO4A 2VA3A 2E8MA 2ISPA 1X9WA 3NASA 3PO5A 2H3VA 2VKQA 4F72A 7ICQA 1RQLA 4EEYA 2UVUA 4FS2A 2KHVA 2P35A 4Y2PA 3HKZF 3SD7A 4X4RA 4ELUA 4NLZA 3BZCA 4F71A 5L1JA 1SWVA 1Z00B 7ICOA 3Q8SB 4C8KA 1FFUA 2W7PA 4DO9A 1S0VA 4C4SA 1TFRA 1ZQTA 2ZH2A 2DR5A 2BQ3A 3EUB2 3JPTA 4O9MA 5AICA 4RQ8A 4C8LA 4KMUA 4WQKA 3RAXA 4UQGA 4UAYA 4G9BA 4ED1A 4X4TA 1S8OA 5AKKA 3SI8A 2KV2A 1GO3F 2FMSA 2A1JB 2ES6A 4NLGA 5HHIA 4ECWA 4JWMA 3OVSA 2Y9TA 5HRKA 2WAQF 1NKBA 1S0NA 2G5HB 4UB5A 1BNPA 2KJ8A 1VDVA 1T8EA 9ICBA 3N7RC 3LYSA 1GPJA 1P7DA 1IXRA 4RQMA 3G6VA 1S76D 1VFGA 3G6XA 4TUPA 4O5EA 2PKEA 2K8CB 4CDGA 1A77A 4ECZA 2DVIA 4NLBA 2ZIWA 2HOIA 8ICHA 3OUYA 5KT4A 1EXNA 4XJEA 5ALUA 2W9BB 1DRGA 4FHYA 3RJFA 2GH1A 1KL9A 1JXEA 1UA1A 3IV6A 1ZQPA 3OTQA 5IIIA 1NJWA 2XGPA 4J9LA 4I0UA 5AM4A 4Y2XA 3Q8KA 2ZIUA 2DRAA 3KTQA 4IR9A 4HAIA 9ICHA 4IRDA 1MIVA 4F5QA 2KVCA 4PHDA 5DLFA 2NRZA 1WWUA 4RPZA 1K1QA 3TANA 1ZQIA 1ZQOA 1T3QA 1UT5A 2M9NA 2F8LA 3AQEA 1CUKA 1X40A 2BPFA 1TAUA 1F44A 4YQWA 4RQ2A 1KFTA 1TE2A 2AGQA 3MR3A 3JPRA 4C0ZA 4WBYA 2JMGA 3IG8A 1DGSA 4WC6A 2HHXA 3BQ1A 3A0HU 4CCHA 5AM1A 2EANA 1HJPA 2E3TA 2D3DA 1ZQHA 3EPIA 4DQQA 3HJEA 4Y2VA 3EYZA 4QW9A 1LB2B 4E7XA 4M6WB 5ALFA 3BS5B 4RUCA 4F4ZA 5HRFA 4AT7B 5KFLA 1V9PA 3OHAA 2E1EA 1BVSA 4R66A 2K4IA 4NL9C 1PX5A 1T94A 2K4EA 4YR0A 2NRTA 2H3IA 3VC8A 3MR6A 4AT8A 4NKTA 4RNMA 3PW5A 1Z4OA 4B9NA 4GXKA 1ZQZA 8ICYA 5L1IA 2H3QA 3AM9A 3NUQA 4NXTA 5ALGA 5G5HA 4WQLA 2GWSA 2D8CA 5ALLA 4RT2A 1JMSA 4F5RA 2ZIVA 3D6JA 4EX7A 1SXEA 2B4VA 5CA7A 5DB8A 4O67A 1KRPA 4KLJA 3GU3A 2HCFA 2D6FC 3CNHA 3JPPA 5EE3A 4B9LA 3JPNA 2QKQA 1NK5A 1K1SA 4OO1J 2JZBA 3OSNA 4M04A 1HEKA 2NRWA 3J81j 4C7YA 1ZYQA 5L9XA 2PFPA 5HMLA 5J2AA 2KFZA 3F5AA 2YMPA 4WC2A 7ICPA 3D2NA 2Q66A 1SKWA 3PSFA 2ZHAA 4NM1A 4WC0A 5KNIA 4NL9A 1TAMA 4FBTA 4TQSA 4LEVA 2FMQA 1HUZA 2BCVA 3AQNA 7ICFA 1LV5A 4EEBA 1ZD3A 2ZIXA 1NJYA 1FEZA 4I27A 3LVWA 5G5GA 1X9MA 1TK0A 4ED7A 4B6JA 3OWGA 4QZAA 4Y2QA 3PSPA 1TVAA 2KKVA 2KIVA 4NXXA 1MQ3A 4AYBF 5JRTA 3C5GA 2GLEA 1Z1BA 3JPOA 3SEIA 1SKSA 2FLPA 1MSWD 1SZHA 1JX4A 1BGXT 1Z00A 4ATBA 2MUTA 3LK9A 3E58A 7ICUA 4OCZA 3BQ2A 2O6KA 5ALWA 4I28A 5DG8A 5ALYA 3K1ZA 2PMZC 3TKAA 4UB1A 3AEVA 5HR9A 4M5DA 5JTIA 3NRZA 3H0RB 3ZDDA 3B0XA 1SV0C 2KOBA 5J2IA 4KLTA 2ZH9A 1MC8A 1T4GA 4EBCA 4S3NA 1JUDA 2EAOA 1L7NA 4QZFA 8ICBA 1CI4A 3NGDA 3RJJA 4LEYA 4O3PA 2XGQA 4DLEA 4GXJA 2R8KA 1NNLA 4O3QA 2R8JA 4J9RA 1UT8A 4DL5A 3S6JA 2Y1IA 4R64A 4ED2A 1FFVA 4RWPA 2MA1A 2NYVA 1H38A 1RYRA 5J0SA 4P2HA 3IHQB 3M7DA 5D63A 4AP9A 3H39A 1SWWA 4GIBA 3ICXA 1S97A 2PFNA 3KHGA 2FJ6A 4J9PA 1JAJA 1V4AA 2OEHA 2M0NA 5IIMA 3WK9A 3UQ2A 4WC1A 3V6JA 3H38A 2KZ3A 5GTIU 4K9AA 4HX0A 4P0PB 2AU0A 3H8WA 2PI4A 2KD1A 7ICIA 9ICLA 3OHBA 3NKUA 5KG7A 4R65A 4NKUA 3L5KA 4EP7A 5EWGA 2WF7A 2KEYA 1QTMA 3QUCA 5DB9A 8ICUA 1YLQA 1L7OA 3Q8PB 3NVVA 3EZ5A 3SV3A 3PX0A 1FA0A 1UPHA 1LKYB 2KICA 1TK5A 5CB1A 4ECQA 5ALSA 2IHNA 3GIKA 4PGXA 1KSPA 3F2DA 2B21A 4GLXA 4Y2UA 3ZD9A 9ICRA 1ECWA 4J9QA 3N4MB 1U48A 3WK7A 3ONNA 5ALDA 4RNNA 1ZQLA 5D62A 2F2AB 4DCCA 2ZTEA 2RDJA 2OWOA 2BZFA 3TAPA 1SV0A 3HIYA 2W7OA 3PW0A 5KG6A 2RHFA 3C2MA 3VCBA 5HP4A 2OXOA 3WKCA 1A0PA 4UB4A 5DQIA 4N7RA 3GIJA 4DQIA 3M8RA 2FPKA 3H0MB 4AT7A 3O0FA 2LYBA 2QLTA 2ZH8A 4QZ9A 3TADC 4ED3A 1ZQBA 4US9A 2XY7A 3M6KA 1ZRMA 3AQKA 4P4OA 1NI3A 2VANA 1R8BA 2HDOA 4MFAA 5J2DA 8ICKA 3HWTA 4JV0A 5BOMA 3L4PA 3EWAA 4QWCA 4K97A 2BHNA 2HHWA 4O3NA 3HPOA 1L5UA 5AI9A 1ZQFA 3SAGA 5KFDA 5D4BA 4F8RA 2LM4A 3ALRA 1RM6C 3CP8A 4NLKA 5KFVA 5KG2A 3GIMA 4UAZA 2RP5A 2ZJAA 4B9VA 2JZBB 2HI0A 8ICWA 5HRHA 2BDPA 4OJ6A 2XIDA 1HIWA 5KG5A 2B51A 3RRHA 2WB1C 3JPQA 3WFPA 2FPMA 3TI0A 3FDSA 3DDHA 3WKEA 4IRCA 5B5EU 1PK3A 4CF4A 4UATA 8ICLA 3JZ0A 4F5OA 4M9GA 1QLNA 1QSYA 4KLEA 2G08A 3C5FA
chains in the Genus database with same CATH topology
2HHUA 4X4NA 5J0OA 4RQ7A 1BPZA 4DO9A 1S0VA 4DL7A 1TFRA 4X5VA 1ZQTA 2ZH2A 2BQ3A 2DR5A 3JPTA 4TURA 3RH5A 3FYHA 3EW9A 3QZ7A 3M9NB 4RQ8A 4C8LA 4KMUA 2F1JA 5F9LA 3RAXA 1T3NA 3AU6A 4UQGA 3GV8B 4UAYA 1U47A 4ED1A 4X4TA 3SI8A 4QWBA 8ICFA 2FMSA 2A1JB 4NLGA 9ICMA 3OV7A 1UEVA 5HHIA 3UPQA 1ZJNA 4YCXA 5HRLA 4DFKA 4ECWA 3T5JA 3N97B 4JWMA 8ICVA 3OVSA 5HRKA 1ZQRA 1S0NA 1NKBA 3GILA 2AGOA 3RJIA 5KFMA 1CEZA 4ECTA 4XQ7A 4UB5A 1BNPA 2MAXA 4IQTA 4KLFA 3MBYA 2BPGA 5DGAA 4R8UA 1T8EA 4DQRA 1TK8A 2PFQA 2BCUA 4RWOA 4F5NA 9ICBA 3UPSA 5HC9A 4PHEA 1MIYA 3AU2A 9ICPA 4TQRA 4M9NA 5KT5A 3SV4A 1IXRA 3Q8QB 3G6VA 3V6KA 1ZQDA 3SZ2A 4K4HA 2AGPA 1S76D 1BPYA 1VFGA 1ZQKA 3G6XA 3RJHA 1TAQA 4TUPA 2M2VA 3PMNA 4J9OA 1BPBA 2ALZA 2FMPA 4JWNA 4O5EA 1A77A 4QZBA 2W8LA 3KHRA 4ECZA 8ICCA 3OVBA 4IQWA 2DVIA 4UAWA 3AQMA 1ZQMA 4P4PA 7ICTA 8ICRA 5BPCA 5KFZA 8ICHA 5DBCA 3C2LA 2BCSA 2J6TA 3OUYA 5KT4A 1EXNA 4O3OA 2W9BB 1NO5A 4FHYA 3RJFA 4KN4A 2W9CB 2ASDA 3PW7A 2PI5A 1JXEA 1UA1A 2UVWA 4TUQA 2C28A 4FHXA 4O3RA 4KN7A 1ZQPA 1NK0A 4KLOA 1T7PA 5KFPA 3V7JA 1JX4A 3HT3A 4C8OA 3H37A 5J2BA 5J0XA 7ICSA 5IIIA 1ZQEA 4FHVA 4KLDA 4Z6CA 3T5HA 1WCLA 9ICWA 4I2IA 1NJWA 2XGPA 4J9LA 2DPIA 4AT9B 3Q8KA 3ZDAA 2DRAA 4DOBA 3RB3A 2DFLA 2J6SA 3KTQA 4IR9A 5DKWA 9ICHA 5DQGA 5KT7A 3OJUA 4EZ6A 4F5QA 4IRDA 1MIVA 4PHDA 3GV7B 4ED0A 5DLFA 2NRZA 4NLNA 4WC4A 5J0UA 1KDHA 7ICJA 4FH5A 4RPZA 4YD2A 1K1QA 3TANA 1ZQIA 1ZQOA 1UT5A 3ISDA 1BNOA 1S0OA 5HRGA 2M9NA 4RPXA 7ICEA 3GQCA 1XO1A 1CUKA 5DQHA 2BPFA 1TAUA 2C22A 4XQ8A 5CWRA 1S0MA 4YQWA 4B9TA 5F9NA 4RQ2A 9ICFA 4EYIB 1BPXA 1KFTA 4EZ9A 4KLMA 4QZEA 3MR3A 3JPRA 4NXZA 3KHLA 2AGQA 2KTQA 3ETLA 1PZNA 2DR9A 3SYZA 5KFWA 3NYBA 4WBYA 5HRIA 3UXPA 4F4KA 9ICGA 1DGSA 5KG4A 2IA6A 4WC6A 3GIIA 3WFOA 2M2UA 4Q43A 2HHXA 3BQ1A 4R63A 1RXVA 5DB6A 1XSLA 4DSJA 4UBBA 4DOAA 4EBKA 3BQ0A 1S9FA 4CCHA 4F4YA 4MF2A 1NZPA 4X4VA 1D8LA 2IMWP 1XU4A 5DDMA 2ZJ5A 4PHPA 5DLGA 4ECVA 1HJPA 1X9SA 3MGHA 2PBEA 1ZQHA 3EPIA 3Q8MA 2KN7A 4DQQA 1UEUA 5J2FA 2HHSA 3EYZA 3MFHA 4QW9A 1ZQGA 5KFKA 1LB2B 4Z6DA 2I9GA 3T5KA 4E7XA 1NOMA 4M6WB 2Y1JA 1XC9A 2P6UA 4I2BA 1QSLA 3ZD8A 1DK2A 3GDXA 4GXIA 1KFDA 4RUCA 4F4ZA 3PY8A 4QZDA 4K4GA 9ICAA 7ICVA 5HRFA 4AT7B 5KFLA 4F91B 4I2CA 4BXOB 4PPXA 4ED8A 5HRDA 1XSNA 1V9PA 4YD1A 3OHAA 2PXIA 4F4XA 8ICXA 4QZ8A 1NKEA 3GV5B 5CJ7A 4I2HA 4O9MA 4ATBB 5CP2A 1BVSA 1N48A 4R66A 8ICQA 1PX5A 3BJYA 3C18A 5J0WA 4GC6A 2ZHBA 9ICNA 3PR4A 5J0YA 1TKDA 4YR0A 2NRTA 3Q8RB 2XY5A 3PV8A 3H7IA 3UXNA 3JPSA 3MR6A 5JUMA 2AQ0A 2Q0ZX 2V4QA 1F5AA 5BOLA 4DL6A 1XS9D 5HRBA 4NKTA 4Q44A 4RQ4A 4MF8A 4B9UA 9ICVA 4AT8A 1L3UA 4NY8A 4RNMA 3PW5A 2ZUBA 4B9NA 3LQCB 3RR8A 4ECUA 4DF4A 4GXKA 1ZQZA 3ZDCA 5L1IA 8ICYA 5DEDA 4YMNA 4YMOA 5KFQA 4ELVA 8ICGA 2UVRA 4DOCA 2XCAA 3G6YA 3H3AA 2GWSA 5C5JA 4DSFA 3TFSA 4UB2A 2P66A 1R8AA 5KG1A 3OUYB 2BQUA 1JQRA 1JIHA 1ZQCA 4X4PA 4RZRA 4F2RA 4ECYA 4RT2A 5L1KA 3PX4A 3AUOA 1JMSA 4F5RA 5DDYA 3H8SA 1D9FA 2BE3A 3C23A 4E0DA 3MR2A 3JYYA 2XC9A 5CA7A 5DB8A 4UB3A 1R89A 4I2AA 2R8HA 4X0AA 4RWNA 5CHGA 3RH4A 1KRPA 4KLJA 4X4SA 4KLGA 5KTQA 3JPPA 4ED6A 4B9LA 3JPNA 4WC7A 4PH5A 5DECA 2HHPA 1NK5A 4DS5A 1NK7A 3RJEA 2ZH7A 1K1SA 2FLNA 2PFOA 2IHMA 2JZBA 4F92B 3OSNA 1D9DA 2DRBA 4M04A 4DL2A 4X0BA 4ECRA 7ICKA 2NRWA 3B0YA 1ZQVA 4P4MA 4YR2A 1ZYQA 5EWEA 5L9XA 4DFJA 4YG2A 5J2AA 5HMLA 4I2DA 3KHHA 2PFPA 4F3OA 2KFZA 4WC2A 2KZMA 5KFTA 4Z6EA 7ICPA 4KLIA 2Q66A 3H40A 1SKWA 3GFKB 4I29A 1RXWA 4KLQA 4YN4A 4NM1A 4WC0A 2ZHAA 4F5PA 2F1IA 2C2DA 4I2GA 1BPDA 5KFSA 4FBTA 1UA0A 4TQSA 2FMQA 4DSKA 1HUZA 2BCVA 4DWIA 3AQNA 4M9JA 1ZQSA 1Z3EB 4LZDA 3ZDEA 4HYKA 3H4BA 3RTVA 2M2TA 1SKRA 7ICFA 1LV5A 3HJ4A 9ICXA 4NM2A 4YVZA 4J9MA 1NJYA 3BQTA 4PGQA 4E8FA 4I27A 1ZQXA 2C2EA 2C2RA 2UVVA 2P6RA 2HVIA 8ICTA 1X9MA 1TK0A 2F1HA 1ZQNA 4KITB 2XO7A 4ED7A 4QZAA 1WOTA 3H8JA 1TVAA 2ZH1A 4IQUA 4M9LA 1S77D 5L1LA 3IM1A 5J2EA 5DBBA 1ZETA 5KFFA 2BQRA 1KFSA 4YMMA 3QEBZ 2HHVA 4M6WA 2ASJA 2ZTCA 2XY6A 1R8CA 2JEGA 3EPGA 1MQ3A 4WBZA 3C5GA 2FLPA 1MSWD 3JPOA 3M9MB 3MFIA 1SKSA 9ICEA 5HREA 2LYHA 4GC7A 4K4IA 2RFFA 2JEJA 1BPEA 8ICNA 3RJGA 4F4WA 1BGXT 1Z00A 3ISCA 2NRXA 2MUTA 4DS4A 1XSPA 3LK9A 1NK6A 4JV1A 2BCRA 4ATBA 1B43A 5KFAA 7ICUA 3BQ2A 1IM4A 1KEJA 3M8SA 5KT2A 4I28A 5DG8A 3WFSC 4ZH4A 5IIJA 4UB1A 4F50A 5CR0A 4EBEA 1COOA 4XUSA 4ECSA 4DSEA 3PVXA 3RH6A 5HR9A 1Q79A 3ZDDA 5J2JA 4M5DA 1MIWA 1AROP 4YP3A 3B0XA 3RAQA 9ICOA 1OU5A 1RYSA 5KFBA 1Q78A 3HW8A 3H4DA 2IBKA 4M47A 4IRKA 1MQ2A 4C8NA 3PW2A 1NJXA 4RT3A 2FLLA 4EBJA 1NK8A 5J2IA 4C8KA 4KLSA 4KLTA 4X4QA 2ZH9A 1S10A 1MC8A 1T4GA 4KTQA 4EBCA 8ICMA 4YXMA 4S3NA 4KLLA 5J0RA 4BWMA 3WFRE 3V72A 4QZFA 3QE9Y 8ICBA 1NK4A 3NGDA 4MEYA 5HMMA 4Z6FA 4MEXA 3HX0A 2ISOA 3RJJA 4DSLA 2JEIA 4WC5A 4O3PA 5HNKA 2XGQA 4GXJA 4RQ1A 4O3QA 4DLEA 5KFRA 4YR3A 3T5LA 4DF8A 4DFMA 2R8KA 2R8JA 1N56A 4IQVA 2V9WA 3TARA 4KLHA 4J9RA 1UT8A 4QWAA 7ICGA 4DL5A 1U49A 4F2SA 2VA8A 2Y1IA 3L9DA 4R64A 4ED2A 3RBDA 4IR1A 4AT9A 4RWPA 4QWDA 4WC3A 4QZCA 5IILA 1NKCA 1H38A 1RPLA 4I2EA 3HJ1A 4XA5A 4PGYA 5J0SA 1RYRA 2R8GA 2BCQA 4P2HA 3IHQB 2W8KA 2ID1A 3H39A 1D8YA 1S97A 3C2KA 2RDIA 4FO6A 2PFNA 3KHGA 5KFEA 2ZTDA 9ICUA 4J9PA 1JAJA 1U45A 1L3VA 3PO4A 4O3SA 1V4AA 4FS1A 5IIMA 3QZ8A 4FBUA 4RQ5A 1VJ7A 3UQ2A 8ICZA 4WC1A 3ORYA 4RQ6A 3V7LA 3V6JA 3NTUA 2KZ3A 3H38A 3THVA 5KG3A 5KFHA 5KT6A 3V7KA 5J29A 4YFKA 5KFOA 4UD5A 3UXOA 1DOQA 3H8WA 4DEZA 4QW8A 2AU0A 4DFPA 2PI4A 2DR7A 3RBEA 3ZDBA 4UD4A 2BPCA 2JEFA 7ICIA 3OHBA 4JV2A 9ICLA 4MFFA 2O5AA 5KG7A 4PHAA 4KLUA 4R65A 3TQ1A 2V4RA 4WCWA 4BGDA 5KFJA 4TUSA 2DPJA 4NKUA 8ICAA 4X4OA 1KTQA 4E80A 2O1PA 2ZUCA 3OSPA 4EP7A 1L3SA 5EWGA 9ICIA 1QTMA 1SL0A 4DQPA 4DLGA 5KFUA 5DB9A 3V6HA 4LZGA 5KFCA 8ICUA 1YLQA 4RWQA 4J9SA 3Q8PB 7ICRA 5DBAA 3T3FA 3TAQA 4QZGA 5D49A 4QZHA 3EZ5A 1JN3A 3SV3A 7ICMA 1SZPA 3TFRA 4LVSA 2AJQA 7ICNA 5DG7A 1TFYA 3PX0A 2VA2A 1FA0A 4UBCA 2HHTA 4O5CA 1WCNA 3OGUA 1TK5A 1NJZA 5EOZA 5CB1A 1B22A 4ECQA 2ASLA 3E2EA 3PX6A 2IHNA 4RPYA 2I1QA 1QSSA 3GIKA 4PGXA 1KSPA 2KFNA 1NK9A 2KP7A 1L3TA 2W9AA 1ZQWA 5J0QA 2B21A 4GLXA 4JK1A 2MUTB 3OJSA 4I2FA 1KLNA 3ZD9A 3RB6A 9ICRA 2ZH6A 3PW4A 4J9QA 3N4MB 1U9LA 4XRHA 1U48A 4G3IA 9ICKA 4RNNA 1ZQLA 2FPLA 4BDPA 4Q45A 1DK3A 2KZZA 2NRVA 4FHPA 7ICHA 5DB7A 2ZTEA 2RDJA 2OWOA 3K75D 3TAPA 3MDCA 1JXLA 3HIYA 2HVHA 9ICTA 3PW0A 4O0IA 5KG6A 2A1JA 3C2MA 3BDPA 3C1ZA 5KFGA 3OVAA 5HP4A 1RZTA 4ELTA 4QZIA 2BKEA 5F2VO 5KFIA 4UB4A 5DQIA 3C1YA 2WTFA 3GIJA 4FH3A 4RUAA 3LWMA 3M8RA 2FPKA 5J2HA 4ECXA 3RB4A 4DQIA 3Q8LA 4AT7A 4BXOA 5TZVA 4RNOA 4DL4A 2NRKA 1TFWA 4F93B 5EWFA 1U4BA 4R8UB 5KFXA 1SL1A 2ZH8A 4RQ3A 4QZ9A 3UQ0A 4BWJA 1ZQQA 4ED3A 1ZQBA 1ZQUA 3MR5A 1ZQJA 4AT8B 2AQ4A 5IIKA 2H5XA 2ZH4A 5J0PA 2DR8A 9ICJA 3PR5B 2XY7A 4JUZA 4C8MA 9ICSA 4DQSA 1C7YA 3AQKA 2ZH5A 4P4OA 5DG9A 3RB0A 2BR0A 3LDAA 1ZQYA 3K4GA 7ICLA 2VANA 1R8BA 5IINA 4MFAA 2ZUDA 5J2DA 4RU9A 8ICKA 1UETA 4JV0A 4YXJA 3HWTA 3M9OB 5BOMA 4DL3A 3EWAA 3MABA 4I2JA 3RR7A 4QWCA 2HW3A 8ICIA 1TV9A 4FHWA 1XWLA 2BHNA 3RJKA 4O3NA 4M9HA 3HPOA 2HHWA 3WFQE 1L5UA 5J2CA 2HHQA 2ZJ8A 4IG8A 3AQLA 3MDAA 2W9BA 1ZQFA 3MGIA 5KFDA 2XCPA 5D4BA 3RRGA 3LWLA 4F8RA 2W9CA 1ZJMA 4RQ0A 4DSIA 1A76A 1KNYA 5J0TA 1ZQAA 4LT6A 4Q8FA 5HHHA 5J2GA 4NLKA 5KFVA 4Q8EA 5KG2A 3GIMA 1X2IA 5D46A 5KFYA 3QEAZ 4EBDA 2BGWA 4B9SA 3PNCA 5J2KA 4B9MA 3C21A 4UAZA 4QWEA 2W9MA 3ISBA 2M2WA 8ICJA 3HP6A 9ICQA 5KFNA 2ZH3A 2ZJAA 3C66A 2VA3A 9ICCA 3JZ0A 2ISPA 5KT3A 2JZBB 1X9WA 4B9VA 8ICEA 4M0AA 5DGBA 1SL2A 3PO5A 8ICWA 4EYHB 5HRHA 5IIOA 7ICQA 2BDPA 4J9KA 5KG5A 2ATLA 4EEYA 8ICSA 3RRHA 8ICOA 1Y88A 2UVUA 4FS2A 3PMLA 3JPQA 3WFPA 2FPMA 3TI0A 3FDSA 5KG0A 1HUOA 4IRCA 4X4RA 4X4UA 4MFCA 4ELUA 8ICLA 2J6UA 4NLZA 4O5KA 4F5OA 4M9GA 1QLNA 4J9NA 8ICPA 2R8IA 1QSYA 5L1JA 1Z00B 4M2YA 4KLEA 7ICOA 3Q8SB 3C5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHU A;  4X4N A;  5J0O A;  4RQ7 A;  1BPZ A;  4DO9 A;  1S0V A;  4DL7 A;  1TFR A;  4X5V A;  1ZQT A;  2ZH2 A;  2BQ3 A;  2DR5 A;  3JPT A;  4TUR A;  3RH5 A;  3FYH A;  3EW9 A;  3QZ7 A;  3M9N B;  4RQ8 A;  4C8L A;  4KMU A;  2F1J A;  5F9L A;  3RAX A;  1T3N A;  3AU6 A;  4UQG A;  3GV8 B;  4UAY A;  1U47 A;  4ED1 A;  4X4T A;  3SI8 A;  4QWB A;  8ICF A;  2FMS A;  2A1J B;  4NLG A;  9ICM A;  3OV7 A;  1UEV A;  5HHI A;  3UPQ A;  1ZJN A;  4YCX A;  5HRL A;  4DFK A;  4ECW A;  3T5J A;  3N97 B;  4JWM A;  8ICV A;  3OVS A;  5HRK A;  1ZQR A;  1S0N A;  1NKB A;  3GIL A;  2AGO A;  3RJI A;  5KFM A;  1CEZ A;  4ECT A;  4XQ7 A;  4UB5 A;  1BNP A;  2MAX A;  4IQT A;  4KLF A;  3MBY A;  2BPG A;  5DGA A;  4R8U A;  1T8E A;  4DQR A;  1TK8 A;  2PFQ A;  2BCU A;  4RWO A;  4F5N A;  9ICB A;  3UPS A;  5HC9 A;  4PHE A;  1MIY A;  3AU2 A;  9ICP A;  4TQR A;  4M9N A;  5KT5 A;  3SV4 A;  1IXR A;  3Q8Q B;  3G6V A;  3V6K A;  1ZQD A;  3SZ2 A;  4K4H A;  2AGP A;  1S76 D;  1BPY A;  1VFG A;  1ZQK A;  3G6X A;  3RJH A;  1TAQ A;  4TUP A;  2M2V A;  3PMN A;  4J9O A;  1BPB A;  2ALZ A;  2FMP A;  4JWN A;  4O5E A;  1A77 A;  4QZB A;  2W8L A;  3KHR A;  4ECZ A;  8ICC A;  3OVB A;  4IQW A;  2DVI A;  4UAW A;  3AQM A;  1ZQM A;  4P4P A;  7ICT A;  8ICR A;  5BPC A;  5KFZ A;  8ICH A;  5DBC A;  3C2L A;  2BCS A;  2J6T A;  3OUY A;  5KT4 A;  1EXN A;  4O3O A;  2W9B B;  1NO5 A;  4FHY A;  3RJF A;  4KN4 A;  2W9C B;  2ASD A;  3PW7 A;  2PI5 A;  1JXE A;  1UA1 A;  2UVW A;  4TUQ A;  2C28 A;  4FHX A;  4O3R A;  4KN7 A;  1ZQP A;  1NK0 A;  4KLO A;  1T7P A;  5KFP A;  3V7J A;  1JX4 A;  3HT3 A;  4C8O A;  3H37 A;  5J2B A;  5J0X A;  7ICS A;  5III A;  1ZQE A;  4FHV A;  4KLD A;  4Z6C A;  3T5H A;  1WCL A;  9ICW A;  4I2I A;  1NJW A;  2XGP A;  4J9L A;  2DPI A;  4AT9 B;  3Q8K A;  3ZDA A;  2DRA A;  4DOB A;  3RB3 A;  2DFL A;  2J6S A;  3KTQ A;  4IR9 A;  5DKW A;  9ICH A;  5DQG A;  5KT7 A;  3OJU A;  4EZ6 A;  4F5Q A;  4IRD A;  1MIV A;  4PHD A;  3GV7 B;  4ED0 A;  5DLF A;  2NRZ A;  4NLN A;  4WC4 A;  5J0U A;  1KDH A;  7ICJ A;  4FH5 A;  4RPZ A;  4YD2 A;  1K1Q A;  3TAN A;  1ZQI A;  1ZQO A;  1UT5 A;  3ISD A;  1BNO A;  1S0O A;  5HRG A;  2M9N A;  4RPX A;  7ICE A;  3GQC A;  1XO1 A;  1CUK A;  5DQH A;  2BPF A;  1TAU A;  2C22 A;  4XQ8 A;  5CWR A;  1S0M A;  4YQW A;  4B9T A;  5F9N A;  4RQ2 A;  9ICF A;  4EYI B;  1BPX A;  1KFT A;  4EZ9 A;  4KLM A;  4QZE A;  3MR3 A;  3JPR A;  4NXZ A;  3KHL A;  2AGQ A;  2KTQ A;  3ETL A;  1PZN A;  2DR9 A;  3SYZ A;  5KFW A;  3NYB A;  4WBY A;  5HRI A;  3UXP A;  4F4K A;  9ICG A;  1DGS A;  5KG4 A;  2IA6 A;  4WC6 A;  3GII A;  3WFO A;  2M2U A;  4Q43 A;  2HHX A;  3BQ1 A;  4R63 A;  1RXV A;  5DB6 A;  1XSL A;  4DSJ A;  4UBB A;  4DOA A;  4EBK A;  3BQ0 A;  1S9F A;  4CCH A;  4F4Y A;  4MF2 A;  1NZP A;  4X4V A;  1D8L A;  2IMW P;  1XU4 A;  5DDM A;  2ZJ5 A;  4PHP A;  5DLG A;  4ECV A;  1HJP A;  1X9S A;  3MGH A;  2PBE A;  1ZQH A;  3EPI A;  3Q8M A;  2KN7 A;  4DQQ A;  1UEU A;  5J2F A;  2HHS A;  3EYZ A;  3MFH A;  4QW9 A;  1ZQG A;  5KFK A;  1LB2 B;  4Z6D A;  2I9G A;  3T5K A;  4E7X A;  1NOM A;  4M6W B;  2Y1J A;  1XC9 A;  2P6U A;  4I2B A;  1QSL A;  3ZD8 A;  1DK2 A;  3GDX A;  4GXI A;  1KFD A;  4RUC A;  4F4Z A;  3PY8 A;  4QZD A;  4K4G A;  9ICA A;  7ICV A;  5HRF A;  4AT7 B;  5KFL A;  4F91 B;  4I2C A;  4BXO B;  4PPX A;  4ED8 A;  5HRD A;  1XSN A;  1V9P A;  4YD1 A;  3OHA A;  2PXI A;  4F4X A;  8ICX A;  4QZ8 A;  1NKE A;  3GV5 B;  5CJ7 A;  4I2H A;  4O9M A;  4ATB B;  5CP2 A;  1BVS A;  1N48 A;  4R66 A;  8ICQ A;  1PX5 A;  3BJY A;  3C18 A;  5J0W A;  4GC6 A;  2ZHB A;  9ICN A;  3PR4 A;  5J0Y A;  1TKD A;  4YR0 A;  2NRT A;  3Q8R B;  2XY5 A;  3PV8 A;  3H7I A;  3UXN A;  3JPS A;  3MR6 A;  5JUM A;  2AQ0 A;  2Q0Z X;  2V4Q A;  1F5A A;  5BOL A;  4DL6 A;  1XS9 D;  5HRB A;  4NKT A;  4Q44 A;  4RQ4 A;  4MF8 A;  4B9U A;  9ICV A;  4AT8 A;  1L3U A;  4NY8 A;  4RNM A;  3PW5 A;  2ZUB A;  4B9N A;  3LQC B;  3RR8 A;  4ECU A;  4DF4 A;  4GXK A;  1ZQZ A;  3ZDC A;  5L1I A;  8ICY A;  5DED A;  4YMN A;  4YMO A;  5KFQ A;  4ELV A;  8ICG A;  2UVR A;  4DOC A;  2XCA A;  3G6Y A;  3H3A A;  2GWS A;  5C5J A;  4DSF A;  3TFS A;  4UB2 A;  2P66 A;  1R8A A;  5KG1 A;  3OUY B;  2BQU A;  1JQR A;  1JIH A;  1ZQC A;  4X4P A;  4RZR A;  4F2R A;  4ECY A;  4RT2 A;  5L1K A;  3PX4 A;  3AUO A;  1JMS A;  4F5R A;  5DDY A;  3H8S A;  1D9F A;  2BE3 A;  3C23 A;  4E0D A;  3MR2 A;  3JYY A;  2XC9 A;  5CA7 A;  5DB8 A;  4UB3 A;  1R89 A;  4I2A A;  2R8H A;  4X0A A;  4RWN A;  5CHG A;  3RH4 A;  1KRP A;  4KLJ A;  4X4S A;  4KLG A;  5KTQ A;  3JPP A;  4ED6 A;  4B9L A;  3JPN A;  4WC7 A;  4PH5 A;  5DEC A;  2HHP A;  1NK5 A;  4DS5 A;  1NK7 A;  3RJE A;  2ZH7 A;  1K1S A;  2FLN A;  2PFO A;  2IHM A;  2JZB A;  4F92 B;  3OSN A;  1D9D A;  2DRB A;  4M04 A;  4DL2 A;  4X0B A;  4ECR A;  7ICK A;  2NRW A;  3B0Y A;  1ZQV A;  4P4M A;  4YR2 A;  1ZYQ A;  5EWE A;  5L9X A;  4DFJ A;  4YG2 A;  5J2A A;  5HML A;  4I2D A;  3KHH A;  2PFP A;  4F3O A;  2KFZ A;  4WC2 A;  2KZM A;  5KFT A;  4Z6E A;  7ICP A;  4KLI A;  2Q66 A;  3H40 A;  1SKW A;  3GFK B;  4I29 A;  1RXW A;  4KLQ A;  4YN4 A;  4NM1 A;  4WC0 A;  2ZHA A;  4F5P A;  2F1I A;  2C2D A;  4I2G A;  1BPD A;  5KFS A;  4FBT A;  1UA0 A;  4TQS A;  2FMQ A;  4DSK A;  1HUZ A;  2BCV A;  4DWI A;  3AQN A;  4M9J A;  1ZQS A;  1Z3E B;  4LZD A;  3ZDE A;  4HYK A;  3H4B A;  3RTV A;  2M2T A;  1SKR A;  7ICF A;  1LV5 A;  3HJ4 A;  9ICX A;  4NM2 A;  4YVZ A;  4J9M A;  1NJY A;  3BQT A;  4PGQ A;  4E8F A;  4I27 A;  1ZQX A;  2C2E A;  2C2R A;  2UVV A;  2P6R A;  2HVI A;  8ICT A;  1X9M A;  1TK0 A;  2F1H A;  1ZQN A;  4KIT B;  2XO7 A;  4ED7 A;  4QZA A;  1WOT A;  3H8J A;  1TVA A;  2ZH1 A;  4IQU A;  4M9L A;  1S77 D;  5L1L A;  3IM1 A;  5J2E A;  5DBB A;  1ZET A;  5KFF A;  2BQR A;  1KFS A;  4YMM A;  3QEB Z;  2HHV A;  4M6W A;  2ASJ A;  2ZTC A;  2XY6 A;  1R8C A;  2JEG A;  3EPG A;  1MQ3 A;  4WBZ A;  3C5G A;  2FLP A;  1MSW D;  3JPO A;  3M9M B;  3MFI A;  1SKS A;  9ICE A;  5HRE A;  2LYH A;  4GC7 A;  4K4I A;  2RFF A;  2JEJ A;  1BPE A;  8ICN A;  3RJG A;  4F4W A;  1BGX T;  1Z00 A;  3ISC A;  2NRX A;  2MUT A;  4DS4 A;  1XSP A;  3LK9 A;  1NK6 A;  4JV1 A;  2BCR A;  4ATB A;  1B43 A;  5KFA A;  7ICU A;  3BQ2 A;  1IM4 A;  1KEJ A;  3M8S A;  5KT2 A;  4I28 A;  5DG8 A;  3WFS C;  4ZH4 A;  5IIJ A;  4UB1 A;  4F50 A;  5CR0 A;  4EBE A;  1COO A;  4XUS A;  4ECS A;  4DSE A;  3PVX A;  3RH6 A;  5HR9 A;  1Q79 A;  3ZDD A;  5J2J A;  4M5D A;  1MIW A;  1ARO P;  4YP3 A;  3B0X A;  3RAQ A;  9ICO A;  1OU5 A;  1RYS A;  5KFB A;  1Q78 A;  3HW8 A;  3H4D A;  2IBK A;  4M47 A;  4IRK A;  1MQ2 A;  4C8N A;  3PW2 A;  1NJX A;  4RT3 A;  2FLL A;  4EBJ A;  1NK8 A;  5J2I A;  4C8K A;  4KLS A;  4KLT A;  4X4Q A;  2ZH9 A;  1S10 A;  1MC8 A;  1T4G A;  4KTQ A;  4EBC A;  8ICM A;  4YXM A;  4S3N A;  4KLL A;  5J0R A;  4BWM A;  3WFR E;  3V72 A;  4QZF A;  3QE9 Y;  8ICB A;  1NK4 A;  3NGD A;  4MEY A;  5HMM A;  4Z6F A;  4MEX A;  3HX0 A;  2ISO A;  3RJJ A;  4DSL A;  2JEI A;  4WC5 A;  4O3P A;  5HNK A;  2XGQ A;  4GXJ A;  4RQ1 A;  4O3Q A;  4DLE A;  5KFR A;  4YR3 A;  3T5L A;  4DF8 A;  4DFM A;  2R8K A;  2R8J A;  1N56 A;  4IQV A;  2V9W A;  3TAR A;  4KLH A;  4J9R A;  1UT8 A;  4QWA A;  7ICG A;  4DL5 A;  1U49 A;  4F2S A;  2VA8 A;  2Y1I A;  3L9D A;  4R64 A;  4ED2 A;  3RBD A;  4IR1 A;  4AT9 A;  4RWP A;  4QWD A;  4WC3 A;  4QZC A;  5IIL A;  1NKC A;  1H38 A;  1RPL A;  4I2E A;  3HJ1 A;  4XA5 A;  4PGY A;  5J0S A;  1RYR A;  2R8G A;  2BCQ A;  4P2H A;  3IHQ B;  2W8K A;  2ID1 A;  3H39 A;  1D8Y A;  1S97 A;  3C2K A;  2RDI A;  4FO6 A;  2PFN A;  3KHG A;  5KFE A;  2ZTD A;  9ICU A;  4J9P A;  1JAJ A;  1U45 A;  1L3V A;  3PO4 A;  4O3S A;  1V4A A;  4FS1 A;  5IIM A;  3QZ8 A;  4FBU A;  4RQ5 A;  1VJ7 A;  3UQ2 A;  8ICZ A;  4WC1 A;  3ORY A;  4RQ6 A;  3V7L A;  3V6J A;  3NTU A;  2KZ3 A;  3H38 A;  3THV A;  5KG3 A;  5KFH A;  5KT6 A;  3V7K A;  5J29 A;  4YFK A;  5KFO A;  4UD5 A;  3UXO A;  1DOQ A;  3H8W A;  4DEZ A;  4QW8 A;  2AU0 A;  4DFP A;  2PI4 A;  2DR7 A;  3RBE A;  3ZDB A;  4UD4 A;  2BPC A;  2JEF A;  7ICI A;  3OHB A;  4JV2 A;  9ICL A;  4MFF A;  2O5A A;  5KG7 A;  4PHA A;  4KLU A;  4R65 A;  3TQ1 A;  2V4R A;  4WCW A;  4BGD A;  5KFJ A;  4TUS A;  2DPJ A;  4NKU A;  8ICA A;  4X4O A;  1KTQ A;  4E80 A;  2O1P A;  2ZUC A;  3OSP A;  4EP7 A;  1L3S A;  5EWG A;  9ICI A;  1QTM A;  1SL0 A;  4DQP A;  4DLG A;  5KFU A;  5DB9 A;  3V6H A;  4LZG A;  5KFC A;  8ICU A;  1YLQ A;  4RWQ A;  4J9S A;  3Q8P B;  7ICR A;  5DBA A;  3T3F A;  3TAQ A;  4QZG A;  5D49 A;  4QZH A;  3EZ5 A;  1JN3 A;  3SV3 A;  7ICM A;  1SZP A;  3TFR A;  4LVS A;  2AJQ A;  7ICN A;  5DG7 A;  1TFY A;  3PX0 A;  2VA2 A;  1FA0 A;  4UBC A;  2HHT A;  4O5C A;  1WCN A;  3OGU A;  1TK5 A;  1NJZ A;  5EOZ A;  5CB1 A;  1B22 A;  4ECQ A;  2ASL A;  3E2E A;  3PX6 A;  2IHN A;  4RPY A;  2I1Q A;  1QSS A;  3GIK A;  4PGX A;  1KSP A;  2KFN A;  1NK9 A;  2KP7 A;  1L3T A;  2W9A A;  1ZQW A;  5J0Q A;  2B21 A;  4GLX A;  4JK1 A;  2MUT B;  3OJS A;  4I2F A;  1KLN A;  3ZD9 A;  3RB6 A;  9ICR A;  2ZH6 A;  3PW4 A;  4J9Q A;  3N4M B;  1U9L A;  4XRH A;  1U48 A;  4G3I A;  9ICK A;  4RNN A;  1ZQL A;  2FPL A;  4BDP A;  4Q45 A;  1DK3 A;  2KZZ A;  2NRV A;  4FHP A;  7ICH A;  5DB7 A;  2ZTE A;  2RDJ A;  2OWO A;  3K75 D;  3TAP A;  3MDC A;  1JXL A;  3HIY A;  2HVH A;  9ICT A;  3PW0 A;  4O0I A;  5KG6 A;  2A1J A;  3C2M A;  3BDP A;  3C1Z A;  5KFG A;  3OVA A;  5HP4 A;  1RZT A;  4ELT A;  4QZI A;  2BKE A;  5F2V O;  5KFI A;  4UB4 A;  5DQI A;  3C1Y A;  2WTF A;  3GIJ A;  4FH3 A;  4RUA A;  3LWM A;  3M8R A;  2FPK A;  5J2H A;  4ECX A;  3RB4 A;  4DQI A;  3Q8L A;  4AT7 A;  4BXO A;  5TZV A;  4RNO A;  4DL4 A;  2NRK A;  1TFW A;  4F93 B;  5EWF A;  1U4B A;  4R8U B;  5KFX A;  1SL1 A;  2ZH8 A;  4RQ3 A;  4QZ9 A;  3UQ0 A;  4BWJ A;  1ZQQ A;  4ED3 A;  1ZQB A;  1ZQU A;  3MR5 A;  1ZQJ A;  4AT8 B;  2AQ4 A;  5IIK A;  2H5X A;  2ZH4 A;  5J0P A;  2DR8 A;  9ICJ A;  3PR5 B;  2XY7 A;  4JUZ A;  4C8M A;  9ICS A;  4DQS A;  1C7Y A;  3AQK A;  2ZH5 A;  4P4O A;  5DG9 A;  3RB0 A;  2BR0 A;  3LDA A;  1ZQY A;  3K4G A;  7ICL A;  2VAN A;  1R8B A;  5IIN A;  4MFA A;  2ZUD A;  5J2D A;  4RU9 A;  8ICK A;  1UET A;  4JV0 A;  4YXJ A;  3HWT A;  3M9O B;  5BOM A;  4DL3 A;  3EWA A;  3MAB A;  4I2J A;  3RR7 A;  4QWC A;  2HW3 A;  8ICI A;  1TV9 A;  4FHW A;  1XWL A;  2BHN A;  3RJK A;  4O3N A;  4M9H A;  3HPO A;  2HHW A;  3WFQ E;  1L5U A;  5J2C A;  2HHQ A;  2ZJ8 A;  4IG8 A;  3AQL A;  3MDA A;  2W9B A;  1ZQF A;  3MGI A;  5KFD A;  2XCP A;  5D4B A;  3RRG A;  3LWL A;  4F8R A;  2W9C A;  1ZJM A;  4RQ0 A;  4DSI A;  1A76 A;  1KNY A;  5J0T A;  1ZQA A;  4LT6 A;  4Q8F A;  5HHH A;  5J2G A;  4NLK A;  5KFV A;  4Q8E A;  5KG2 A;  3GIM A;  1X2I A;  5D46 A;  5KFY A;  3QEA Z;  4EBD A;  2BGW A;  4B9S A;  3PNC A;  5J2K A;  4B9M A;  3C21 A;  4UAZ A;  4QWE A;  2W9M A;  3ISB A;  2M2W A;  8ICJ A;  3HP6 A;  9ICQ A;  5KFN A;  2ZH3 A;  2ZJA A;  3C66 A;  2VA3 A;  9ICC A;  3JZ0 A;  2ISP A;  5KT3 A;  2JZB B;  1X9W A;  4B9V A;  8ICE A;  4M0A A;  5DGB A;  1SL2 A;  3PO5 A;  8ICW A;  4EYH B;  5HRH A;  5IIO A;  7ICQ A;  2BDP A;  4J9K A;  5KG5 A;  2ATL A;  4EEY A;  8ICS A;  3RRH A;  8ICO A;  1Y88 A;  2UVU A;  4FS2 A;  3PML A;  3JPQ A;  3WFP A;  2FPM A;  3TI0 A;  3FDS A;  5KG0 A;  1HUO A;  4IRC A;  4X4R A;  4X4U A;  4MFC A;  4ELU A;  8ICL A;  2J6U A;  4NLZ A;  4O5K A;  4F5O A;  4M9G A;  1QLN A;  4J9N A;  8ICP A;  2R8I A;  1QSY A;  5L1J A;  1Z00 B;  4M2Y A;  4KLE A;  7ICO A;  3Q8S B;  3C5F A; 
#chains in the Genus database with same CATH topology
 5J0O A;  5EE0 A;  1BPZ A;  2ZIX B;  1DGJ A;  3RH5 A;  3QZ7 A;  1N63 A;  2F1J A;  3SMV A;  5F9L A;  2IUB A;  3GV8 B;  3LVV A;  2IOH A;  4QNL A;  1X6J A;  3OV7 A;  2KE7 A;  2OYY A;  3UPQ A;  4DFK A;  2WF6 A;  3A0B U;  3T5J A;  8ICV A;  1YZ7 A;  1ZQR A;  1O08 A;  4IS7 A;  2AGO A;  5KFM A;  1CEZ A;  4ECT A;  4EEN A;  4IQT A;  3KZX A;  3HRD D;  2BPG A;  4R8U A;  2BBJ A;  2AHO B;  5CFT A;  5AIB A;  4TQR A;  2DUY A;  4WH5 A;  2N1R A;  3SZ2 A;  4K4H A;  2EAP A;  1BPY A;  3RJH A;  4KB6 A;  1TAQ A;  3DV9 A;  3QX7 A;  4QZB A;  2W8L A;  1COK A;  3OVB A;  2W03 A;  3M6Z A;  7ICT A;  2F8K A;  8ICR A;  5KFZ A;  3UM9 A;  4KX5 A;  4O3O A;  1NO5 A;  5L1M A;  2W9C B;  2ASD A;  1F5S A;  2PI5 A;  2UVW A;  2C28 A;  4O3R A;  4KLO A;  1T7P A;  2G09 A;  4FHV A;  5J2B A;  5J0X A;  7ICS A;  1ZQE A;  1JRO A;  4Z6C A;  1WCL A;  4I2I A;  2DPI A;  3ZDA A;  2J6S A;  3RB3 A;  2DFL A;  2VJ4 A;  3HKZ C;  3UMB A;  5DKW A;  5DQG A;  5AK6 A;  4EZ6 A;  3GV7 B;  4ED0 A;  2QB1 A;  1X9X A;  4NLN A;  7ICJ A;  3T79 A;  2I5H A;  1BNO A;  5HRG A;  2WF9 A;  3C28 A;  3GQC A;  4XQ8 A;  9ICF A;  1S0M A;  2Y0S F;  3IP4 B;  4EYI B;  4EZ9 A;  2CN1 A;  4JB3 A;  1PZN A;  4PL1 A;  2IA6 A;  2FI1 A;  2W54 A;  4UBB A;  3BQ0 A;  4F4Y A;  4X4V A;  1N5X A;  5DDM A;  2WF8 A;  2ZJ5 A;  4ECV A;  2PBE A;  2KN7 A;  2HHS A;  2Y9U A;  3I76 A;  4LEZ A;  3CRX A;  4Z6D A;  4K9B A;  2LYA A;  3T5K A;  4O69 A;  1LKY A;  1Q46 A;  1QSL A;  3GDX A;  1KFD A;  4QZD A;  3BQ7 A;  4I2C A;  5HRD A;  3KKA C;  4YD1 A;  5CFS A;  2PXI A;  3GV5 B;  4I2H A;  1N48 A;  3C18 A;  5J0W A;  4GC6 A;  2KJ9 A;  9ICN A;  4NXW A;  2KMD A;  5ALJ A;  2XY5 A;  4UB6 U;  3UXN A;  3JPS A;  1RG6 A;  2V4Q A;  1QQ5 A;  4DL6 A;  4RQ4 A;  4MF8 A;  4B9U A;  9ICV A;  1L3U A;  2ZUB A;  4DF4 A;  2E8N A;  4PZN A;  2YX8 A;  5KFQ A;  2HBL A;  2XCA A;  1KN5 A;  5C5J A;  4UB2 A;  1R8A A;  3AL0 B;  4X4P A;  1ZQC A;  4ECY A;  3PX4 A;  5DDY A;  1D9F A;  2WFA A;  4E0D A;  2XC9 A;  4NLC A;  1R89 A;  4X0A A;  4RWN A;  1PK1 A;  1WUD A;  5KTQ A;  3JCF A;  5DEC A;  2HHP A;  3RJE A;  2W3S A;  3E0F A;  1FO4 A;  2DRB A;  2EZZ A;  4DL2 A;  4ECR A;  2G07 A;  2GAF D;  4FZL A;  2W04 A;  3B0Y A;  3BS7 A;  4P4M A;  4F3O A;  2YMQ A;  4I2D A;  4Z6E A;  3H40 A;  3GFK B;  4FO1 A;  4KLQ A;  4YN4 A;  4QIW F;  2C2D A;  5KFS A;  1VJ5 A;  4DWI A;  1Z3E B;  4LZD A;  3H4B A;  1B4F A;  1SKR A;  3HJ4 A;  4NM2 A;  4PGQ A;  4E8F A;  2C2R A;  2UVV A;  2P6R A;  2HVI A;  8ICT A;  3NVO A;  1URJ A;  3H8J A;  3KOO A;  4IQU A;  3PSI A;  4PZO A;  1S77 D;  3IM1 A;  5J2E A;  2MSN A;  2YTU A;  2HHV A;  2ASJ A;  3EPG A;  4WBZ A;  2FDR A;  4NV0 A;  3KKA A;  4OAH A;  5T14 A;  3MGV A;  2JEJ A;  1BPE A;  5CEH A;  3CW2 C;  1NZB A;  2NRX A;  2BCR A;  5KFA A;  2KHQ A;  4UW9 A;  2HOF A;  3N7P D;  5KT2 A;  5IIJ A;  5CR0 A;  3RH6 A;  1WYG A;  1Q79 A;  5K4L A;  4YP3 A;  1OU5 A;  9ICO A;  1RDF A;  1RYS A;  2IBK A;  4IRK A;  1MQ2 A;  4C8N A;  1NJX A;  1N62 A;  3NVW A;  4EBJ A;  4X4Q A;  4KLS A;  4KTQ A;  3QUB A;  4KLL A;  5AKH A;  4BWM A;  1NK4 A;  4MEY A;  3HX0 A;  2JH1 A;  3DEE A;  4CNQ A;  5AKL A;  3QYP A;  1N56 A;  3TAR A;  4KLH A;  7ICG A;  1U49 A;  4F2S A;  5CRX A;  2VA8 A;  3QUT A;  3L9D A;  4WC3 A;  4IR1 A;  3F2B A;  4QWD A;  4QZC A;  1RPL A;  3HJ1 A;  4XA5 A;  2R8G A;  2BCQ A;  2KJ5 A;  3C2K A;  5KFE A;  2OCE A;  3PO4 A;  4O3S A;  4CF5 A;  3PZP A;  4RQ5 A;  4RQ6 A;  2HBJ A;  3NTU A;  5KT6 A;  5AKZ A;  5J29 A;  4YFK A;  4UD5 A;  1DOQ A;  4QW8 A;  1X66 A;  3ZDB A;  2O5A A;  4JV2 A;  4KLU A;  4BGD A;  4TUS A;  2DPJ A;  5CHE A;  4UB8 U;  8ICA A;  3OSP A;  1SL0 A;  3V6H A;  3SR6 A;  3K7D A;  5AM2 A;  4J9S A;  7ICR A;  2K4H A;  3T3F A;  1CRX A;  4QZH A;  1JN3 A;  7ICM A;  1SZP A;  1TFY A;  5DG7 A;  1WG8 A;  3I1Y A;  1B22 A;  1UHU A;  2ASL A;  3PX6 A;  4RPY A;  1QSS A;  2KP7 A;  1NK9 A;  1L3T A;  2W9A A;  1ZQW A;  5J0Q A;  5AI0 A;  2CXY A;  3WK8 A;  4I2F A;  4ICA A;  3RB6 A;  2ZH6 A;  5AK5 A;  1U9L A;  3FC4 A;  2NRV A;  4K99 A;  2ZXH A;  3K75 D;  1JXL A;  2A1J A;  3BDP A;  3C1Z A;  5KFG A;  2JHD A;  3AMZ A;  3OVA A;  3NS1 A;  5B66 U;  1RZT A;  1F0M A;  2BKE A;  5KFI A;  3C1Y A;  4FH3 A;  5J2H A;  3Q8L A;  5AKJ A;  5TZV A;  4KMO B;  1PVQ A;  1TFW A;  4OJO A;  3ER8 C;  4RQ3 A;  1C20 A;  3UQ0 A;  5JU5 A;  4BWJ A;  2AH5 A;  5ALE A;  1ZQU A;  2AQ4 A;  2H5X A;  4GFJ A;  5J0P A;  9ICJ A;  3PR5 B;  4C8M A;  4U6P A;  2E8P A;  1C7Y A;  4LEW A;  5DG9 A;  1ZQY A;  4NXU A;  5IIN A;  5ALQ A;  1UET A;  3RR7 A;  1QCK A;  3MAB A;  2HW3 A;  1XWL A;  1D8B A;  3K1R B;  2HHQ A;  4WOY A;  2BBH A;  2ZJ8 A;  2W9B A;  3RRG A;  3LWL A;  4UAR A;  5J8Y C;  2E8O A;  1A76 A;  1Q3U A;  1X42 A;  1ZQA A;  1B0X A;  4Q8F A;  5AI8 A;  4Q8E A;  3QEA Z;  4EBD A;  5AI6 A;  4B9S A;  4B9M A;  5J2K A;  4ZOH C;  4QWE A;  2RQ5 A;  3HP6 A;  9ICQ A;  2ZH3 A;  2XIC A;  3C66 A;  2I6X A;  9ICC A;  5KT3 A;  8ICE A;  2YML A;  8ICS A;  8ICO A;  2MRL A;  3PML A;  2YY6 A;  5KG0 A;  1HUO A;  4MFC A;  1MA7 A;  1KKX A;  1OUQ A;  8ICP A;  4M2Y A;  1OXJ A;  2YN4 A;  5H2F U;  2F3N A;  4X4N A;  4RQ7 A;  3HIL A;  3NWI A;  1JAL A;  4NXV A;  3FYH A;  3EW9 A;  3D2S A;  3M9N B;  1T3N A;  3F53 A;  1U47 A;  4EX6 A;  3M1Y A;  4U7C A;  5ALZ A;  4O6A A;  1UEV A;  4YCX A;  5HRL A;  2OM6 A;  4AYB C;  3RJI A;  3QU2 A;  3OPX A;  4KLF A;  1IG6 A;  3MBY A;  5HC9 A;  2G5I B;  3UPS A;  4PHE A;  1MIY A;  5KT5 A;  3Q8Q B;  3V6K A;  2AGP A;  1N61 A;  2M2V A;  3PMN A;  4J9O A;  4Y2J A;  3KHR A;  4IQW A;  4UAW A;  4P4P A;  2FE9 A;  3C2L A;  2BCS A;  2J6T A;  2G06 A;  4FZN A;  3ETR A;  1LVH A;  4KN7 A;  1UQV A;  1NK0 A;  4C8O A;  2JV3 A;  3HT3 A;  2QB0 A;  1L7M A;  4KX3 A;  4JLX A;  3T5H A;  1OW5 A;  9ICW A;  3QU4 A;  4DOB A;  2KNJ A;  3B9J A;  3FM9 A;  1L6N A;  4J03 A;  1N2X A;  1YZ6 A;  5J0U A;  4YD2 A;  3ISD A;  1S0O A;  7ICE A;  1XO1 A;  2WAQ C;  4A8E A;  2C22 A;  3QXG A;  4B9T A;  1BPX A;  4IC9 A;  3ETL A;  1SGG A;  2DR9 A;  2EZX A;  3SYZ A;  5KFW A;  3NYB A;  3IRU A;  3UXP A;  4F4K A;  9ICG A;  4IL6 U;  2M2U A;  1RXV A;  5DB6 A;  4DSJ A;  4EBK A;  5AKX A;  1NZP A;  4O68 A;  4WJ3 B;  2RRD A;  2IMW P;  5E79 U;  1JI7 A;  4PHP A;  4C80 A;  1X9S A;  3MGH A;  3Q8M A;  5J2F A;  1ZQG A;  5KFK A;  2I9G A;  1NOM A;  1XC9 A;  1A6S A;  2P6U A;  1DK2 A;  3ZD8 A;  1KW4 A;  4GXI A;  2HBM A;  3PY8 A;  9ICA A;  7ICV A;  1L8O A;  3MC1 A;  4ED8 A;  1XSN A;  4F4X A;  8ICX A;  3U26 A;  4ATB B;  5CP2 A;  4CF3 A;  2B6G A;  3BJY A;  5J0Y A;  1TKD A;  3QNM A;  3Q8R B;  2DWQ A;  3PV8 A;  3H7I A;  4OJ5 A;  4PL2 A;  2AQ0 A;  1F5A A;  1XS9 D;  3H8M A;  1V38 A;  1Z19 A;  1Z4N A;  3FAH A;  3RR8 A;  3NRW A;  3ZDC A;  2XVT A;  5DED A;  4ELV A;  4YMO A;  8ICG A;  2ZIW B;  3H3A A;  3G6Y A;  3I28 A;  2P66 A;  4PJ0 U;  5KG1 A;  3OUY B;  2BQU A;  1JQR A;  1JIH A;  2E1F A;  3EF2 A;  4RZR A;  3AUO A;  2WB1 F;  2BE3 A;  3MR2 A;  4UAU A;  4UB3 A;  1QH9 A;  2R8H A;  5CHG A;  3RH4 A;  2GA9 D;  1QQ6 A;  4JLZ A;  5ALX A;  4DS5 A;  2PMZ F;  2EZY A;  2FLN A;  2ZIU B;  1ZRN A;  1D9D A;  4X0B A;  7ICK A;  1ZQV A;  4YR2 A;  1RYU A;  5EWE A;  4DFJ A;  5CFU A;  3KHH A;  3N28 A;  2QAR B;  5KFT A;  2F44 A;  2HSZ A;  4P0P A;  1BPD A;  4M9J A;  4HYK A;  3RTV A;  4K96 A;  4BJQ A;  9ICX A;  5ALP A;  4J9M A;  4YVZ A;  3BQT A;  3R9K A;  2C2E A;  3ZI4 A;  3C29 A;  2F1H A;  1ZQN A;  4KIT B;  1L7P A;  2DBY A;  1WOT A;  3NVY A;  4CRX A;  4M9L A;  2Y0S C;  3RFA A;  5DBB A;  1ZET A;  5KFF A;  2BQR A;  4YMM A;  3QEB Z;  4M6W A;  2F76 X;  3SEN A;  2LI6 A;  1R8C A;  1ED1 A;  9ICE A;  5B3Q A;  3MFI A;  4K4I A;  4GC7 A;  2RFF A;  3RJG A;  4DS4 A;  4JV1 A;  1NK6 A;  2JH7 A;  1B43 A;  1IM4 A;  3M8S A;  2JRZ A;  3WFS C;  4ECS A;  4XUS A;  5ALM A;  4FE3 A;  4AT8 B;  5KFB A;  3PW2 A;  4RT3 A;  2FLL A;  3KZI U;  3WKA A;  1J2M A;  2IOF K;  3WFR E;  2B0C A;  1O03 A;  4Z6F A;  5HMM A;  4EEK A;  4MEX A;  1RQN A;  2ZIV B;  4DSL A;  5HNK A;  4RQ1 A;  5KFR A;  4NWI A;  2WHE A;  3ED5 A;  4AT9 A;  3RBD A;  5EE9 A;  5D61 A;  2HBK A;  4EV6 A;  5IIL A;  1NKC A;  2ESE A;  4I2E A;  4MHV A;  2LKY A;  4OJP A;  1MN8 A;  2LHT A;  2W8K A;  4LJX A;  2ZTD A;  9ICU A;  1U45 A;  1L3V A;  4FS1 A;  4C4T A;  3V7L A;  5ALT A;  3V7K A;  5KFO A;  3UXO A;  1ZOL A;  4DEZ A;  3QU9 A;  2GOL A;  3RBE A;  2JR5 A;  4MFF A;  2QB0 B;  2V4R A;  2K60 A;  2A1A A;  5KFJ A;  1KTQ A;  2O1P A;  9ICI A;  4DQP A;  2DGZ A;  4RWQ A;  3TAQ A;  4QZG A;  5D49 A;  1L8L A;  2VA2 A;  4UBC A;  3IN5 A;  2HHT A;  1WCN A;  1ZD5 A;  2R18 A;  2KFN A;  4JK1 A;  2MUT B;  3OJS A;  2AXT U;  3PW4 A;  9ICK A;  1DK3 A;  2FPL A;  5ALN A;  5KL8 B;  4Q45 A;  2KZZ A;  4FHP A;  5DB7 A;  3QU5 A;  2Z7J A;  2DQN B;  3MDC A;  3TAC B;  9ICT A;  4O0I A;  4ELT A;  4QZI A;  5F2V O;  2W3R A;  2WTF A;  3LWM A;  4ECX A;  3D2Q A;  4RNO A;  2VIX A;  1IIP A;  5EWF A;  1U4B A;  3ERC C;  4R8U B;  5KFX A;  1JRP A;  3IDW A;  1ZQQ A;  1XO0 A;  4JUZ A;  2W43 A;  2ZH5 A;  3RB0 A;  5AK3 A;  2BR0 A;  2ZUD A;  2EDU A;  4DL3 A;  4CE6 A;  4YXJ A;  3M9O B;  4FHW A;  4OD0 A;  2ZH1 A;  3WFQ E;  2HOQ A;  5J2C A;  3MGI A;  2W9C A;  4DSI A;  2XI9 A;  1KNY A;  1M6Y A;  2H3F A;  5HHH A;  5J2G A;  3L3F X;  1X2I A;  5D46 A;  2BGW A;  3C21 A;  4O3M A;  4P0Q B;  3IG5 A;  8ICJ A;  5KFN A;  3KFU F;  4K98 A;  3QUQ A;  4BX9 C;  4M0A A;  5DGB A;  1SB3 C;  1SL2 A;  4EYH B;  5IIO A;  4J9K A;  2ATL A;  1Q3V A;  1Y88 A;  3WKB A;  2QAR A;  4X4U A;  3CYM A;  5AK4 A;  1FIQ A;  2J6U A;  4Y2R A;  4O5K A;  2IHO A;  3KD3 A;  4J9N A;  2R8I A;  2ZXI A;  1SIJ A;  1IV8 A;  5ALR A;  4UAS A;  2HHU A;  4QIW C;  4DL7 A;  4X5V A;  2KK0 A;  4TUR A;  2A3V A;  4K8V A;  3AU6 A;  3AN1 A;  4QWB A;  8ICF A;  9ICM A;  3PST A;  4Y2T A;  2YMM A;  1ZJN A;  2F77 X;  5AI5 A;  3N97 B;  3GIL A;  5AI4 A;  4XQ7 A;  5TIS U;  2MAX A;  5DGA A;  1TK8 A;  4DQR A;  2PFQ A;  2BCU A;  4RWO A;  1SXD A;  2L5Y A;  4F5N A;  3AU2 A;  9ICP A;  4M9N A;  3SV4 A;  1ZQD A;  4CGZ A;  1ZQK A;  2GO7 A;  2OHF A;  1BPB A;  2ALZ A;  2FMP A;  4JWN A;  8ICC A;  3AQM A;  2YB1 A;  1ZQM A;  5BPC A;  2DF4 B;  5DBC A;  2K8A A;  2WF5 A;  1Q8K A;  4C4R A;  4KN4 A;  4Y2Y A;  3AQF A;  3PW7 A;  3UMG A;  4TUQ A;  4FHX A;  2KSO B;  5KFP A;  3V7J A;  3H37 A;  1PK1 B;  1QQ7 A;  4KLD A;  4AT9 B;  3WK4 A;  3F5E A;  4MKP A;  2KIW A;  5F3X B;  5KT7 A;  3OJU A;  5AM0 A;  1KDH A;  2CRX A;  4FH5 A;  2OH2 A;  2CPR A;  4RPX A;  1ZD4 A;  5GTH U;  4OAG A;  5ALV A;  5DQH A;  5CWR A;  2NO5 A;  5F9N A;  2MU2 A;  4KLM A;  4QZE A;  2IOF A;  3KHL A;  4NXZ A;  4OJL A;  2KTQ A;  1N60 A;  5HRI A;  5ALO A;  5KG4 A;  2ODG A;  3GII A;  1AQ6 A;  3WFO A;  4Q43 A;  4R63 A;  1XSL A;  4DOA A;  4MF2 A;  1S9F A;  3SQI A;  1D8L A;  1XU4 A;  1YT3 A;  5DLG A;  1PUZ A;  5AKG A;  1KQQ A;  4ACO A;  4EGW A;  1UEU A;  1PVP A;  3MFH A;  2Y1J A;  4I2B A;  2NV3 A;  4K4G A;  1K5O A;  2B56 A;  4F91 B;  4PPX A;  4BXO B;  2W55 A;  4QZ8 A;  1V85 A;  4C7Z A;  5CJ7 A;  1NKE A;  8ICQ A;  5AIA A;  2ZHB A;  3GZF A;  3PR4 A;  1S5L U;  5JUM A;  2Q0Z X;  5BOL A;  5HRB A;  4Q44 A;  4NY8 A;  3LQC B;  5KAF U;  4ECU A;  3QU7 A;  4UAV A;  1WWV A;  4YMN A;  2UVR A;  5AHX A;  4DOC A;  3CK6 A;  4DSF A;  3TFS A;  3N7S C;  4F2R A;  5L1K A;  2YB4 A;  1J2N A;  3H8S A;  3TAD A;  3WU2 U;  5KAI U;  3C23 A;  2E5S A;  3JYY A;  4I2A A;  4X4S A;  4KLG A;  4ED6 A;  4OAF A;  4WC7 A;  4PH5 A;  1NK7 A;  2ZH7 A;  2PFO A;  1ZD2 P;  2IHM A;  4F92 B;  4EED A;  4X4O A;  4YG2 A;  4RQN A;  2KZM A;  3BZK A;  4KLI A;  4I29 A;  1RXW A;  4DFD A;  5B3P A;  4F5P A;  2F1I A;  4USA A;  4I2G A;  2K4P A;  1UA0 A;  4DSK A;  1ZQS A;  3ZDE A;  5ALH A;  2M2T A;  1ZXI A;  4P0Q A;  2KG5 A;  2JGA A;  1ZQX A;  1N5W A;  2XO7 A;  5ALK A;  2LBO A;  1DXS A;  5KL1 B;  5L1L A;  3KBB A;  2HMX A;  1KFS A;  2ZTC A;  2XY6 A;  3RF9 A;  2JEG A;  4WC4 A;  3M9M B;  5HRE A;  2LYH A;  3SAH A;  2JXJ A;  8ICN A;  4F4W A;  3ISC A;  1XSP A;  3PHZ A;  5EE1 A;  2H3Z A;  1KEJ A;  4ZH4 A;  4F50 A;  2ZH4 A;  4EBE A;  3PVX A;  1COO A;  4DSE A;  2VJ5 A;  5J2J A;  5AKY A;  1MIW A;  1ARO P;  2DL0 A;  5ALI A;  3RAQ A;  1Q78 A;  3HW8 A;  3H4D A;  4M47 A;  1PVR A;  5A0L A;  1NK8 A;  1V97 A;  2W11 A;  1S10 A;  8ICM A;  4YXM A;  4KM5 A;  5J0R A;  3V72 A;  3QE9 Y;  2ISO A;  4WC5 A;  2JEI A;  3T5L A;  4DF8 A;  2A19 A;  1ZQ1 C;  4YR3 A;  4DFM A;  4BUG A;  2KKP A;  4IQV A;  2V9W A;  4QWA A;  2Q4T A;  2G0A A;  5C0Y A;  4PGY A;  2HN1 A;  2YQE A;  4QJF B;  2ID1 A;  2HN2 A;  1D8Y A;  4FO6 A;  2RDI A;  5AM5 A;  1SV4 A;  3WK5 A;  3QZ8 A;  4FBU A;  1VJ7 A;  8ICZ A;  2KVS A;  3ORY A;  3THV A;  5KG3 A;  5KFH A;  2EQY A;  3WK6 A;  2DR7 A;  4DFP A;  2KSO A;  4UD4 A;  2BPC A;  2JEF A;  4PHA A;  3MCR A;  3TQ1 A;  4WCW A;  4EEL A;  4E80 A;  2ZUC A;  1L3S A;  4DLG A;  5KFU A;  3H0L B;  4LZG A;  5KFC A;  1UCV A;  5DBA A;  5JTG A;  4LVS A;  3TFR A;  2LMR A;  2AJQ A;  7ICN A;  4O5C A;  3OGU A;  1NJZ A;  3BS5 A;  5EOZ A;  4Y2S A;  3E2E A;  2EWR A;  2I1Q A;  5J8Y A;  1X6I A;  1KLN A;  3NVZ A;  3UMC A;  4XRH A;  4G3I A;  1Z1V A;  4BDP A;  5HR7 A;  2ZG6 A;  7ICH A;  1J97 A;  4NJ8 A;  1KBU A;  2HVH A;  5AKE A;  2DKZ A;  4FFD A;  4RUA A;  3RB4 A;  5FP0 A;  2RLT A;  5AKI A;  4BXO A;  4JMU A;  2K89 A;  4DL4 A;  2NRK A;  3WKD A;  2LPE A;  4F93 B;  1SL1 A;  4OAI Z;  2BDU A;  1ZQJ A;  3MR5 A;  5IIK A;  2DR8 A;  9ICS A;  4DQS A;  2LM1 A;  3LDA A;  3K4G A;  7ICL A;  1VLB A;  5HR6 A;  4RU9 A;  2DKX A;  3SAF A;  4I2J A;  8ICI A;  1TV9 A;  3RJK A;  4M9H A;  2K8B B;  4IG8 A;  3AQL A;  3MDA A;  2XCP A;  4US8 A;  1ZJM A;  4RQ0 A;  5J0T A;  4LT6 A;  2EH9 A;  3ER9 B;  4FZM A;  5KFY A;  3PNC A;  2W9M A;  3ISB A;  2M2W A;  1XNS A;  3F2C A;  2EAM A;  2FCL A;  5AM3 A;  2NO4 A;  2VA3 A;  2E8M A;  2ISP A;  1X9W A;  3NAS A;  3PO5 A;  2H3V A;  2VKQ A;  4F72 A;  7ICQ A;  1RQL A;  4EEY A;  2UVU A;  4FS2 A;  2KHV A;  2P35 A;  4Y2P A;  3HKZ F;  3SD7 A;  4X4R A;  4ELU A;  4NLZ A;  3BZC A;  4F71 A;  5L1J A;  1SWV A;  1Z00 B;  7ICO A;  3Q8S B;  4C8K A;  1FFU A;  2W7P A;  4DO9 A;  1S0V A;  4C4S A;  1TFR A;  1ZQT A;  2ZH2 A;  2DR5 A;  2BQ3 A;  3EUB 2;  3JPT A;  4O9M A;  5AIC A;  4RQ8 A;  4C8L A;  4KMU A;  4WQK A;  3RAX A;  4UQG A;  4UAY A;  4G9B A;  4ED1 A;  4X4T A;  1S8O A;  5AKK A;  3SI8 A;  2KV2 A;  1GO3 F;  2FMS A;  2A1J B;  2ES6 A;  4NLG A;  5HHI A;  4ECW A;  4JWM A;  3OVS A;  2Y9T A;  5HRK A;  2WAQ F;  1NKB A;  1S0N A;  2G5H B;  4UB5 A;  1BNP A;  2KJ8 A;  1VDV A;  1T8E A;  9ICB A;  3N7R C;  3LYS A;  1GPJ A;  1P7D A;  1IXR A;  4RQM A;  3G6V A;  1S76 D;  1VFG A;  3G6X A;  4TUP A;  4O5E A;  2PKE A;  2K8C B;  4CDG A;  1A77 A;  4ECZ A;  2DVI A;  4NLB A;  2ZIW A;  2HOI A;  8ICH A;  3OUY A;  5KT4 A;  1EXN A;  4XJE A;  5ALU A;  2W9B B;  1DRG A;  4FHY A;  3RJF A;  2GH1 A;  1KL9 A;  1JXE A;  1UA1 A;  3IV6 A;  1ZQP A;  3OTQ A;  5III A;  1NJW A;  2XGP A;  4J9L A;  4I0U A;  5AM4 A;  4Y2X A;  3Q8K A;  2ZIU A;  2DRA A;  3KTQ A;  4IR9 A;  4HAI A;  9ICH A;  4IRD A;  1MIV A;  4F5Q A;  2KVC A;  4PHD A;  5DLF A;  2NRZ A;  1WWU A;  4RPZ A;  1K1Q A;  3TAN A;  1ZQI A;  1ZQO A;  1T3Q A;  1UT5 A;  2M9N A;  2F8L A;  3AQE A;  1CUK A;  1X40 A;  2BPF A;  1TAU A;  1F44 A;  4YQW A;  4RQ2 A;  1KFT A;  1TE2 A;  2AGQ A;  3MR3 A;  3JPR A;  4C0Z A;  4WBY A;  2JMG A;  3IG8 A;  1DGS A;  4WC6 A;  2HHX A;  3BQ1 A;  3A0H U;  4CCH A;  5AM1 A;  2EAN A;  1HJP A;  2E3T A;  2D3D A;  1ZQH A;  3EPI A;  4DQQ A;  3HJE A;  4Y2V A;  3EYZ A;  4QW9 A;  1LB2 B;  4E7X A;  4M6W B;  5ALF A;  3BS5 B;  4RUC A;  4F4Z A;  5HRF A;  4AT7 B;  5KFL A;  1V9P A;  3OHA A;  2E1E A;  1BVS A;  4R66 A;  2K4I A;  4NL9 C;  1PX5 A;  1T94 A;  2K4E A;  4YR0 A;  2NRT A;  2H3I A;  3VC8 A;  3MR6 A;  4AT8 A;  4NKT A;  4RNM A;  3PW5 A;  1Z4O A;  4B9N A;  4GXK A;  1ZQZ A;  8ICY A;  5L1I A;  2H3Q A;  3AM9 A;  3NUQ A;  4NXT A;  5ALG A;  5G5H A;  4WQL A;  2GWS A;  2D8C A;  5ALL A;  4RT2 A;  1JMS A;  4F5R A;  2ZIV A;  3D6J A;  4EX7 A;  1SXE A;  2B4V A;  5CA7 A;  5DB8 A;  4O67 A;  1KRP A;  4KLJ A;  3GU3 A;  2HCF A;  2D6F C;  3CNH A;  3JPP A;  5EE3 A;  4B9L A;  3JPN A;  2QKQ A;  1NK5 A;  1K1S A;  4OO1 J;  2JZB A;  3OSN A;  4M04 A;  1HEK A;  2NRW A;  3J81 j;  4C7Y A;  1ZYQ A;  5L9X A;  2PFP A;  5HML A;  5J2A A;  2KFZ A;  3F5A A;  2YMP A;  4WC2 A;  7ICP A;  3D2N A;  2Q66 A;  1SKW A;  3PSF A;  2ZHA A;  4NM1 A;  4WC0 A;  5KNI A;  4NL9 A;  1TAM A;  4FBT A;  4TQS A;  4LEV A;  2FMQ A;  1HUZ A;  2BCV A;  3AQN A;  7ICF A;  1LV5 A;  4EEB A;  1ZD3 A;  2ZIX A;  1NJY A;  1FEZ A;  4I27 A;  3LVW A;  5G5G A;  1X9M A;  1TK0 A;  4ED7 A;  4B6J A;  3OWG A;  4QZA A;  4Y2Q A;  3PSP A;  1TVA A;  2KKV A;  2KIV A;  4NXX A;  1MQ3 A;  4AYB F;  5JRT A;  3C5G A;  2GLE A;  1Z1B A;  3JPO A;  3SEI A;  1SKS A;  2FLP A;  1MSW D;  1SZH A;  1JX4 A;  1BGX T;  1Z00 A;  4ATB A;  2MUT A;  3LK9 A;  3E58 A;  7ICU A;  4OCZ A;  3BQ2 A;  2O6K A;  5ALW A;  4I28 A;  5DG8 A;  5ALY A;  3K1Z A;  2PMZ C;  3TKA A;  4UB1 A;  3AEV A;  5HR9 A;  4M5D A;  5JTI A;  3NRZ A;  3H0R B;  3ZDD A;  3B0X A;  1SV0 C;  2KOB A;  5J2I A;  4KLT A;  2ZH9 A;  1MC8 A;  1T4G A;  4EBC A;  4S3N A;  1JUD A;  2EAO A;  1L7N A;  4QZF A;  8ICB A;  1CI4 A;  3NGD A;  3RJJ A;  4LEY A;  4O3P A;  2XGQ A;  4DLE A;  4GXJ A;  2R8K A;  1NNL A;  4O3Q A;  2R8J A;  4J9R A;  1UT8 A;  4DL5 A;  3S6J A;  2Y1I A;  4R64 A;  4ED2 A;  1FFV A;  4RWP A;  2MA1 A;  2NYV A;  1H38 A;  1RYR A;  5J0S A;  4P2H A;  3IHQ B;  3M7D A;  5D63 A;  4AP9 A;  3H39 A;  1SWW A;  4GIB A;  3ICX A;  1S97 A;  2PFN A;  3KHG A;  2FJ6 A;  4J9P A;  1JAJ A;  1V4A A;  2OEH A;  2M0N A;  5IIM A;  3WK9 A;  3UQ2 A;  4WC1 A;  3V6J A;  3H38 A;  2KZ3 A;  5GTI U;  4K9A A;  4HX0 A;  4P0P B;  2AU0 A;  3H8W A;  2PI4 A;  2KD1 A;  7ICI A;  9ICL A;  3OHB A;  3NKU A;  5KG7 A;  4R65 A;  4NKU A;  3L5K A;  4EP7 A;  5EWG A;  2WF7 A;  2KEY A;  1QTM A;  3QUC A;  5DB9 A;  8ICU A;  1YLQ A;  1L7O A;  3Q8P B;  3NVV A;  3EZ5 A;  3SV3 A;  3PX0 A;  1FA0 A;  1UPH A;  1LKY B;  2KIC A;  1TK5 A;  5CB1 A;  4ECQ A;  5ALS A;  2IHN A;  3GIK A;  4PGX A;  1KSP A;  3F2D A;  2B21 A;  4GLX A;  4Y2U A;  3ZD9 A;  9ICR A;  1ECW A;  4J9Q A;  3N4M B;  1U48 A;  3WK7 A;  3ONN A;  5ALD A;  4RNN A;  1ZQL A;  5D62 A;  2F2A B;  4DCC A;  2ZTE A;  2RDJ A;  2OWO A;  2BZF A;  3TAP A;  1SV0 A;  3HIY A;  2W7O A;  3PW0 A;  5KG6 A;  2RHF A;  3C2M A;  3VCB A;  5HP4 A;  2OXO A;  3WKC A;  1A0P A;  4UB4 A;  5DQI A;  4N7R A;  3GIJ A;  4DQI A;  3M8R A;  2FPK A;  3H0M B;  4AT7 A;  3O0F A;  2LYB A;  2QLT A;  2ZH8 A;  4QZ9 A;  3TAD C;  4ED3 A;  1ZQB A;  4US9 A;  2XY7 A;  3M6K A;  1ZRM A;  3AQK A;  4P4O A;  1NI3 A;  2VAN A;  1R8B A;  2HDO A;  4MFA A;  5J2D A;  8ICK A;  3HWT A;  4JV0 A;  5BOM A;  3L4P A;  3EWA A;  4QWC A;  4K97 A;  2BHN A;  2HHW A;  4O3N A;  3HPO A;  1L5U A;  5AI9 A;  1ZQF A;  3SAG A;  5KFD A;  5D4B A;  4F8R A;  2LM4 A;  3ALR A;  1RM6 C;  3CP8 A;  4NLK A;  5KFV A;  5KG2 A;  3GIM A;  4UAZ A;  2RP5 A;  2ZJA A;  4B9V A;  2JZB B;  2HI0 A;  8ICW A;  5HRH A;  2BDP A;  4OJ6 A;  2XID A;  1HIW A;  5KG5 A;  2B51 A;  3RRH A;  2WB1 C;  3JPQ A;  3WFP A;  2FPM A;  3TI0 A;  3FDS A;  3DDH A;  3WKE A;  4IRC A;  5B5E U;  1PK3 A;  4CF4 A;  4UAT A;  8ICL A;  3JZ0 A;  4F5O A;  4M9G A;  1QLN A;  1QSY A;  4KLE A;  2G08 A;  3C5F A; 
#chains in the Genus database with same CATH homology
 2HHU A;  4X4N A;  5J0O A;  4RQ7 A;  1BPZ A;  4DO9 A;  1S0V A;  4DL7 A;  1TFR A;  4X5V A;  1ZQT A;  2ZH2 A;  2BQ3 A;  2DR5 A;  3JPT A;  4TUR A;  3RH5 A;  3FYH A;  3EW9 A;  3QZ7 A;  3M9N B;  4RQ8 A;  4C8L A;  4KMU A;  2F1J A;  5F9L A;  3RAX A;  1T3N A;  3AU6 A;  4UQG A;  3GV8 B;  4UAY A;  1U47 A;  4ED1 A;  4X4T A;  3SI8 A;  4QWB A;  8ICF A;  2FMS A;  2A1J B;  4NLG A;  9ICM A;  3OV7 A;  1UEV A;  5HHI A;  3UPQ A;  1ZJN A;  4YCX A;  5HRL A;  4DFK A;  4ECW A;  3T5J A;  3N97 B;  4JWM A;  8ICV A;  3OVS A;  5HRK A;  1ZQR A;  1S0N A;  1NKB A;  3GIL A;  2AGO A;  3RJI A;  5KFM A;  1CEZ A;  4ECT A;  4XQ7 A;  4UB5 A;  1BNP A;  2MAX A;  4IQT A;  4KLF A;  3MBY A;  2BPG A;  5DGA A;  4R8U A;  1T8E A;  4DQR A;  1TK8 A;  2PFQ A;  2BCU A;  4RWO A;  4F5N A;  9ICB A;  3UPS A;  5HC9 A;  4PHE A;  1MIY A;  3AU2 A;  9ICP A;  4TQR A;  4M9N A;  5KT5 A;  3SV4 A;  1IXR A;  3Q8Q B;  3G6V A;  3V6K A;  1ZQD A;  3SZ2 A;  4K4H A;  2AGP A;  1S76 D;  1BPY A;  1VFG A;  1ZQK A;  3G6X A;  3RJH A;  1TAQ A;  4TUP A;  2M2V A;  3PMN A;  4J9O A;  1BPB A;  2ALZ A;  2FMP A;  4JWN A;  4O5E A;  1A77 A;  4QZB A;  2W8L A;  3KHR A;  4ECZ A;  8ICC A;  3OVB A;  4IQW A;  2DVI A;  4UAW A;  3AQM A;  1ZQM A;  4P4P A;  7ICT A;  8ICR A;  5BPC A;  5KFZ A;  8ICH A;  5DBC A;  3C2L A;  2BCS A;  2J6T A;  3OUY A;  5KT4 A;  1EXN A;  4O3O A;  2W9B B;  1NO5 A;  4FHY A;  3RJF A;  4KN4 A;  2W9C B;  2ASD A;  3PW7 A;  2PI5 A;  1JXE A;  1UA1 A;  2UVW A;  4TUQ A;  2C28 A;  4FHX A;  4O3R A;  4KN7 A;  1ZQP A;  1NK0 A;  4KLO A;  1T7P A;  5KFP A;  3V7J A;  1JX4 A;  3HT3 A;  4C8O A;  3H37 A;  5J2B A;  5J0X A;  7ICS A;  5III A;  1ZQE A;  4FHV A;  4KLD A;  4Z6C A;  3T5H A;  1WCL A;  9ICW A;  4I2I A;  1NJW A;  2XGP A;  4J9L A;  2DPI A;  4AT9 B;  3Q8K A;  3ZDA A;  2DRA A;  4DOB A;  3RB3 A;  2DFL A;  2J6S A;  3KTQ A;  4IR9 A;  5DKW A;  9ICH A;  5DQG A;  5KT7 A;  3OJU A;  4EZ6 A;  4F5Q A;  4IRD A;  1MIV A;  4PHD A;  3GV7 B;  4ED0 A;  5DLF A;  2NRZ A;  4NLN A;  4WC4 A;  5J0U A;  1KDH A;  7ICJ A;  4FH5 A;  4RPZ A;  4YD2 A;  1K1Q A;  3TAN A;  1ZQI A;  1ZQO A;  1UT5 A;  3ISD A;  1BNO A;  1S0O A;  5HRG A;  2M9N A;  4RPX A;  7ICE A;  3GQC A;  1XO1 A;  1CUK A;  5DQH A;  2BPF A;  1TAU A;  2C22 A;  4XQ8 A;  5CWR A;  1S0M A;  4YQW A;  4B9T A;  5F9N A;  4RQ2 A;  9ICF A;  4EYI B;  1BPX A;  1KFT A;  4EZ9 A;  4KLM A;  4QZE A;  3MR3 A;  3JPR A;  4NXZ A;  3KHL A;  2AGQ A;  2KTQ A;  3ETL A;  1PZN A;  2DR9 A;  3SYZ A;  5KFW A;  3NYB A;  4WBY A;  5HRI A;  3UXP A;  4F4K A;  9ICG A;  1DGS A;  5KG4 A;  2IA6 A;  4WC6 A;  3GII A;  3WFO A;  2M2U A;  4Q43 A;  2HHX A;  3BQ1 A;  4R63 A;  1RXV A;  5DB6 A;  1XSL A;  4DSJ A;  4UBB A;  4DOA A;  4EBK A;  3BQ0 A;  1S9F A;  4CCH A;  4F4Y A;  4MF2 A;  1NZP A;  4X4V A;  1D8L A;  2IMW P;  1XU4 A;  5DDM A;  2ZJ5 A;  4PHP A;  5DLG A;  4ECV A;  1HJP A;  1X9S A;  3MGH A;  2PBE A;  1ZQH A;  3EPI A;  3Q8M A;  2KN7 A;  4DQQ A;  1UEU A;  5J2F A;  2HHS A;  3EYZ A;  3MFH A;  4QW9 A;  1ZQG A;  5KFK A;  1LB2 B;  4Z6D A;  2I9G A;  3T5K A;  4E7X A;  1NOM A;  4M6W B;  2Y1J A;  1XC9 A;  2P6U A;  4I2B A;  1QSL A;  3ZD8 A;  1DK2 A;  3GDX A;  4GXI A;  1KFD A;  4RUC A;  4F4Z A;  3PY8 A;  4QZD A;  4K4G A;  9ICA A;  7ICV A;  5HRF A;  4AT7 B;  5KFL A;  4F91 B;  4I2C A;  4BXO B;  4PPX A;  4ED8 A;  5HRD A;  1XSN A;  1V9P A;  4YD1 A;  3OHA A;  2PXI A;  4F4X A;  8ICX A;  4QZ8 A;  1NKE A;  3GV5 B;  5CJ7 A;  4I2H A;  4O9M A;  4ATB B;  5CP2 A;  1BVS A;  1N48 A;  4R66 A;  8ICQ A;  1PX5 A;  3BJY A;  3C18 A;  5J0W A;  4GC6 A;  2ZHB A;  9ICN A;  3PR4 A;  5J0Y A;  1TKD A;  4YR0 A;  2NRT A;  3Q8R B;  2XY5 A;  3PV8 A;  3H7I A;  3UXN A;  3JPS A;  3MR6 A;  5JUM A;  2AQ0 A;  2Q0Z X;  2V4Q A;  1F5A A;  5BOL A;  4DL6 A;  1XS9 D;  5HRB A;  4NKT A;  4Q44 A;  4RQ4 A;  4MF8 A;  4B9U A;  9ICV A;  4AT8 A;  1L3U A;  4NY8 A;  4RNM A;  3PW5 A;  2ZUB A;  4B9N A;  3LQC B;  3RR8 A;  4ECU A;  4DF4 A;  4GXK A;  1ZQZ A;  3ZDC A;  5L1I A;  8ICY A;  5DED A;  4YMN A;  4YMO A;  5KFQ A;  4ELV A;  8ICG A;  2UVR A;  4DOC A;  2XCA A;  3G6Y A;  3H3A A;  2GWS A;  5C5J A;  4DSF A;  3TFS A;  4UB2 A;  2P66 A;  1R8A A;  5KG1 A;  3OUY B;  2BQU A;  1JQR A;  1JIH A;  1ZQC A;  4X4P A;  4RZR A;  4F2R A;  4ECY A;  4RT2 A;  5L1K A;  3PX4 A;  3AUO A;  1JMS A;  4F5R A;  5DDY A;  3H8S A;  1D9F A;  2BE3 A;  3C23 A;  4E0D A;  3MR2 A;  3JYY A;  2XC9 A;  5CA7 A;  5DB8 A;  4UB3 A;  1R89 A;  4I2A A;  2R8H A;  4X0A A;  4RWN A;  5CHG A;  3RH4 A;  1KRP A;  4KLJ A;  4X4S A;  4KLG A;  5KTQ A;  3JPP A;  4ED6 A;  4B9L A;  3JPN A;  4WC7 A;  4PH5 A;  5DEC A;  2HHP A;  1NK5 A;  4DS5 A;  1NK7 A;  3RJE A;  2ZH7 A;  1K1S A;  2FLN A;  2PFO A;  2IHM A;  2JZB A;  4F92 B;  3OSN A;  1D9D A;  2DRB A;  4M04 A;  4DL2 A;  4X0B A;  4ECR A;  7ICK A;  2NRW A;  3B0Y A;  1ZQV A;  4P4M A;  4YR2 A;  1ZYQ A;  5EWE A;  5L9X A;  4DFJ A;  4YG2 A;  5J2A A;  5HML A;  4I2D A;  3KHH A;  2PFP A;  4F3O A;  2KFZ A;  4WC2 A;  2KZM A;  5KFT A;  4Z6E A;  7ICP A;  4KLI A;  2Q66 A;  3H40 A;  1SKW A;  3GFK B;  4I29 A;  1RXW A;  4KLQ A;  4YN4 A;  4NM1 A;  4WC0 A;  2ZHA A;  4F5P A;  2F1I A;  2C2D A;  4I2G A;  1BPD A;  5KFS A;  4FBT A;  1UA0 A;  4TQS A;  2FMQ A;  4DSK A;  1HUZ A;  2BCV A;  4DWI A;  3AQN A;  4M9J A;  1ZQS A;  1Z3E B;  4LZD A;  3ZDE A;  4HYK A;  3H4B A;  3RTV A;  2M2T A;  1SKR A;  7ICF A;  1LV5 A;  3HJ4 A;  9ICX A;  4NM2 A;  4YVZ A;  4J9M A;  1NJY A;  3BQT A;  4PGQ A;  4E8F A;  4I27 A;  1ZQX A;  2C2E A;  2C2R A;  2UVV A;  2P6R A;  2HVI A;  8ICT A;  1X9M A;  1TK0 A;  2F1H A;  1ZQN A;  4KIT B;  2XO7 A;  4ED7 A;  4QZA A;  1WOT A;  3H8J A;  1TVA A;  2ZH1 A;  4IQU A;  4M9L A;  1S77 D;  5L1L A;  3IM1 A;  5J2E A;  5DBB A;  1ZET A;  5KFF A;  2BQR A;  1KFS A;  4YMM A;  3QEB Z;  2HHV A;  4M6W A;  2ASJ A;  2ZTC A;  2XY6 A;  1R8C A;  2JEG A;  3EPG A;  1MQ3 A;  4WBZ A;  3C5G A;  2FLP A;  1MSW D;  3JPO A;  3M9M B;  3MFI A;  1SKS A;  9ICE A;  5HRE A;  2LYH A;  4GC7 A;  4K4I A;  2RFF A;  2JEJ A;  1BPE A;  8ICN A;  3RJG A;  4F4W A;  1BGX T;  1Z00 A;  3ISC A;  2NRX A;  2MUT A;  4DS4 A;  1XSP A;  3LK9 A;  1NK6 A;  4JV1 A;  2BCR A;  4ATB A;  1B43 A;  5KFA A;  7ICU A;  3BQ2 A;  1IM4 A;  1KEJ A;  3M8S A;  5KT2 A;  4I28 A;  5DG8 A;  3WFS C;  4ZH4 A;  5IIJ A;  4UB1 A;  4F50 A;  5CR0 A;  4EBE A;  1COO A;  4XUS A;  4ECS A;  4DSE A;  3PVX A;  3RH6 A;  5HR9 A;  1Q79 A;  3ZDD A;  5J2J A;  4M5D A;  1MIW A;  1ARO P;  4YP3 A;  3B0X A;  3RAQ A;  9ICO A;  1OU5 A;  1RYS A;  5KFB A;  1Q78 A;  3HW8 A;  3H4D A;  2IBK A;  4M47 A;  4IRK A;  1MQ2 A;  4C8N A;  3PW2 A;  1NJX A;  4RT3 A;  2FLL A;  4EBJ A;  1NK8 A;  5J2I A;  4C8K A;  4KLS A;  4KLT A;  4X4Q A;  2ZH9 A;  1S10 A;  1MC8 A;  1T4G A;  4KTQ A;  4EBC A;  8ICM A;  4YXM A;  4S3N A;  4KLL A;  5J0R A;  4BWM A;  3WFR E;  3V72 A;  4QZF A;  3QE9 Y;  8ICB A;  1NK4 A;  3NGD A;  4MEY A;  5HMM A;  4Z6F A;  4MEX A;  3HX0 A;  2ISO A;  3RJJ A;  4DSL A;  2JEI A;  4WC5 A;  4O3P A;  5HNK A;  2XGQ A;  4GXJ A;  4RQ1 A;  4O3Q A;  4DLE A;  5KFR A;  4YR3 A;  3T5L A;  4DF8 A;  4DFM A;  2R8K A;  2R8J A;  1N56 A;  4IQV A;  2V9W A;  3TAR A;  4KLH A;  4J9R A;  1UT8 A;  4QWA A;  7ICG A;  4DL5 A;  1U49 A;  4F2S A;  2VA8 A;  2Y1I A;  3L9D A;  4R64 A;  4ED2 A;  3RBD A;  4IR1 A;  4AT9 A;  4RWP A;  4QWD A;  4WC3 A;  4QZC A;  5IIL A;  1NKC A;  1H38 A;  1RPL A;  4I2E A;  3HJ1 A;  4XA5 A;  4PGY A;  5J0S A;  1RYR A;  2R8G A;  2BCQ A;  4P2H A;  3IHQ B;  2W8K A;  2ID1 A;  3H39 A;  1D8Y A;  1S97 A;  3C2K A;  2RDI A;  4FO6 A;  2PFN A;  3KHG A;  5KFE A;  2ZTD A;  9ICU A;  4J9P A;  1JAJ A;  1U45 A;  1L3V A;  3PO4 A;  4O3S A;  1V4A A;  4FS1 A;  5IIM A;  3QZ8 A;  4FBU A;  4RQ5 A;  1VJ7 A;  3UQ2 A;  8ICZ A;  4WC1 A;  3ORY A;  4RQ6 A;  3V7L A;  3V6J A;  3NTU A;  2KZ3 A;  3H38 A;  3THV A;  5KG3 A;  5KFH A;  5KT6 A;  3V7K A;  5J29 A;  4YFK A;  5KFO A;  4UD5 A;  3UXO A;  1DOQ A;  3H8W A;  4DEZ A;  4QW8 A;  2AU0 A;  4DFP A;  2PI4 A;  2DR7 A;  3RBE A;  3ZDB A;  4UD4 A;  2BPC A;  2JEF A;  7ICI A;  3OHB A;  4JV2 A;  9ICL A;  4MFF A;  2O5A A;  5KG7 A;  4PHA A;  4KLU A;  4R65 A;  3TQ1 A;  2V4R A;  4WCW A;  4BGD A;  5KFJ A;  4TUS A;  2DPJ A;  4NKU A;  8ICA A;  4X4O A;  1KTQ A;  4E80 A;  2O1P A;  2ZUC A;  3OSP A;  4EP7 A;  1L3S A;  5EWG A;  9ICI A;  1QTM A;  1SL0 A;  4DQP A;  4DLG A;  5KFU A;  5DB9 A;  3V6H A;  4LZG A;  5KFC A;  8ICU A;  1YLQ A;  4RWQ A;  4J9S A;  3Q8P B;  7ICR A;  5DBA A;  3T3F A;  3TAQ A;  4QZG A;  5D49 A;  4QZH A;  3EZ5 A;  1JN3 A;  3SV3 A;  7ICM A;  1SZP A;  3TFR A;  4LVS A;  2AJQ A;  7ICN A;  5DG7 A;  1TFY A;  3PX0 A;  2VA2 A;  1FA0 A;  4UBC A;  2HHT A;  4O5C A;  1WCN A;  3OGU A;  1TK5 A;  1NJZ A;  5EOZ A;  5CB1 A;  1B22 A;  4ECQ A;  2ASL A;  3E2E A;  3PX6 A;  2IHN A;  4RPY A;  2I1Q A;  1QSS A;  3GIK A;  4PGX A;  1KSP A;  2KFN A;  1NK9 A;  2KP7 A;  1L3T A;  2W9A A;  1ZQW A;  5J0Q A;  2B21 A;  4GLX A;  4JK1 A;  2MUT B;  3OJS A;  4I2F A;  1KLN A;  3ZD9 A;  3RB6 A;  9ICR A;  2ZH6 A;  3PW4 A;  4J9Q A;  3N4M B;  1U9L A;  4XRH A;  1U48 A;  4G3I A;  9ICK A;  4RNN A;  1ZQL A;  2FPL A;  4BDP A;  4Q45 A;  1DK3 A;  2KZZ A;  2NRV A;  4FHP A;  7ICH A;  5DB7 A;  2ZTE A;  2RDJ A;  2OWO A;  3K75 D;  3TAP A;  3MDC A;  1JXL A;  3HIY A;  2HVH A;  9ICT A;  3PW0 A;  4O0I A;  5KG6 A;  2A1J A;  3C2M A;  3BDP A;  3C1Z A;  5KFG A;  3OVA A;  5HP4 A;  1RZT A;  4ELT A;  4QZI A;  2BKE A;  5F2V O;  5KFI A;  4UB4 A;  5DQI A;  3C1Y A;  2WTF A;  3GIJ A;  4FH3 A;  4RUA A;  3LWM A;  3M8R A;  2FPK A;  5J2H A;  4ECX A;  3RB4 A;  4DQI A;  3Q8L A;  4AT7 A;  4BXO A;  5TZV A;  4RNO A;  4DL4 A;  2NRK A;  1TFW A;  4F93 B;  5EWF A;  1U4B A;  4R8U B;  5KFX A;  1SL1 A;  2ZH8 A;  4RQ3 A;  4QZ9 A;  3UQ0 A;  4BWJ A;  1ZQQ A;  4ED3 A;  1ZQB A;  1ZQU A;  3MR5 A;  1ZQJ A;  4AT8 B;  2AQ4 A;  5IIK A;  2H5X A;  2ZH4 A;  5J0P A;  2DR8 A;  9ICJ A;  3PR5 B;  2XY7 A;  4JUZ A;  4C8M A;  9ICS A;  4DQS A;  1C7Y A;  3AQK A;  2ZH5 A;  4P4O A;  5DG9 A;  3RB0 A;  2BR0 A;  3LDA A;  1ZQY A;  3K4G A;  7ICL A;  2VAN A;  1R8B A;  5IIN A;  4MFA A;  2ZUD A;  5J2D A;  4RU9 A;  8ICK A;  1UET A;  4JV0 A;  4YXJ A;  3HWT A;  3M9O B;  5BOM A;  4DL3 A;  3EWA A;  3MAB A;  4I2J A;  3RR7 A;  4QWC A;  2HW3 A;  8ICI A;  1TV9 A;  4FHW A;  1XWL A;  2BHN A;  3RJK A;  4O3N A;  4M9H A;  3HPO A;  2HHW A;  3WFQ E;  1L5U A;  5J2C A;  2HHQ A;  2ZJ8 A;  4IG8 A;  3AQL A;  3MDA A;  2W9B A;  1ZQF A;  3MGI A;  5KFD A;  2XCP A;  5D4B A;  3RRG A;  3LWL A;  4F8R A;  2W9C A;  1ZJM A;  4RQ0 A;  4DSI A;  1A76 A;  1KNY A;  5J0T A;  1ZQA A;  4LT6 A;  4Q8F A;  5HHH A;  5J2G A;  4NLK A;  5KFV A;  4Q8E A;  5KG2 A;  3GIM A;  1X2I A;  5D46 A;  5KFY A;  3QEA Z;  4EBD A;  2BGW A;  4B9S A;  3PNC A;  5J2K A;  4B9M A;  3C21 A;  4UAZ A;  4QWE A;  2W9M A;  3ISB A;  2M2W A;  8ICJ A;  3HP6 A;  9ICQ A;  5KFN A;  2ZH3 A;  2ZJA A;  3C66 A;  2VA3 A;  9ICC A;  3JZ0 A;  2ISP A;  5KT3 A;  2JZB B;  1X9W A;  4B9V A;  8ICE A;  4M0A A;  5DGB A;  1SL2 A;  3PO5 A;  8ICW A;  4EYH B;  5HRH A;  5IIO A;  7ICQ A;  2BDP A;  4J9K A;  5KG5 A;  2ATL A;  4EEY A;  8ICS A;  3RRH A;  8ICO A;  1Y88 A;  2UVU A;  4FS2 A;  3PML A;  3JPQ A;  3WFP A;  2FPM A;  3TI0 A;  3FDS A;  5KG0 A;  1HUO A;  4IRC A;  4X4R A;  4X4U A;  4MFC A;  4ELU A;  8ICL A;  2J6U A;  4NLZ A;  4O5K A;  4F5O A;  4M9G A;  1QLN A;  4J9N A;  8ICP A;  2R8I A;  1QSY A;  5L1J A;  1Z00 B;  4M2Y A;  4KLE A;  7ICO A;  3Q8S B;  3C5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...