5HRKA

The crystal structure of asfvpolx(h115f mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 35
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrkA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrkA01
3LK9A 1V4AA 1ZQJA 3B0YA 5CB1A 4RQ3A 5J0PA 4P2HA 4PGXA 5J2GA 7ICTA 3JPOA 4WC1A 4R66A 1MIVA 5CP2A 1VJ7A 1HUZA 3OVAA 8ICXA 3WFRE 1BPZA 3JPRA 1KDHA 4I2FA 3RH5A 4E8FA 2ZH7A 1R8BA 7ICPA 4I2BA 4WC0A 3HIYA 2DR5A 3MGIA 4YMMA 4O5KA 4WCWA 4TUSA 2ZHAA 2BCVA 1KEJA 4M2YA 4KLLA 5DBCA 4IQWA 4AT8B 8ICGA 5J2EA 5J2AA 9ICAA 4RQ7A 1MIWA 4PHEA 3WFPA 4DOCA 2O1PA 5DBAA 2P66A 4LVSA 5DBBA 5J0WA 1BPDA 4NXZA 1BPYA 1JMSA 1MIYA 1ZQFA 5CJ7A 2ISOA 4Z6CA 8ICEA 2W9MA 5HREA 4RWQA 5DKWA 1RPLA 4RWOA 2ZH5A 4X4NA 3JPQA 4X4RA 4KLMA 4IQTA 4QZCA 4M9HA 8ICAA 2RFFA 4PH5A 3OGUA 3C5FA 3C5GA 4IQVA 4PHPA 4QZAA 4FHVA 8ICMA 7ICNA 4GXKA 3UXNA 3PMLA 4AT7A 4M5DA 2VANA 2M2WA 3JPNA 1TV9A 1ZQSA 3JPTA 4NLZA 4I2HA 1UETA 1ZQVA 4X4UA 4F5NA 7ICEA 3RJHA 1ZJNA 3AQLA 4YD1A 4X4SA 4ATBA 4LT6A 4UB4A 3RH6A 9ICVA 3WFQE 1VFGA 3UXPA 2ZH4A 5J2IA 4FHYA 5J2CA 2BPCA 5IIKA 9ICTA 3MDCA 5CR0A 5J0YA 4Z6EA 7ICKA 4PPXA 4M9JA 4MF2A 7ICLA 9ICIA 5HRLA 4DO9A 4RQ8A 1ZQRA 3WFSC 4NKTA 4XRHA 8ICOA 3C66A 4I28A 9ICXA 9ICFA 4F5RA 4NLNA 1Q78A 4P4OA 2FMQA 2FMSA 3V7LA 3WFOA 5HRBA 1ZQDA 4KLOA 7ICOA 4XQ8A 3AQNA 1ZQHA 4X4PA 2BPGA 5F2VO 2Q66A 4IG8A 3RJEA 3AU2A 1ZQYA 4UBBA 5HRDA 5IIOA 1ZQGA 5HHIA 4F5QA 1ZQBA 4QZHA 4I27A 7ICUA 5J2BA 4I2JA 4RPZA 1KNYA 4YMOA 3TFRA 4M9LA 5J2DA 5IINA 4I2IA 4MFAA 2PFQA 5BOMA 2I9GA 7ICGA 4K4IA 4DOBA 4K4GA 4KLTA 4KLFA 8ICRA 4M47A 4RQ6A 1NOMA 4I2EA 2BCUA 4E7XA 5DB7A 4LZDA 4AT7B 3MBYA 4WBZA 4UD4A 4I29A 3RJIA 4M9GA 3RJJA 2DRBA 5IIJA 4X5VA 4DOAA 4RWNA 2IHMA 9ICUA 7ICRA 3PMNA 4WC2A 5J29A 4UB2A 1HUOA 3L9DA 4ATBB 5DB6A 5J0UA 3HJ4A 4R65A 1ZQXA 5DEDA 4NM2A 3JZ0A 4S3NA 1F5AA 4WC5A 9ICCA 3TFSA 7ICJA 3JYYA 5J0XA 4PGQA 4IQUA 8ICNA 4RQ5A 3GDXA 3NYBA 4X4TA 8ICPA 2HHPA 1ZQQA 1ZQMA 1PX5A 4FHPA 4QZBA 4EBKA 3AQKA 1BPEA 2PXIA 7ICHA 8ICBA 4WC3A 9ICBA 4KLJA 4UAWA 1XSLA 4R64A 4P4PA 1ZQWA 4RPYA 1WOTA 7ICIA 9ICRA 5HR9A 1ZQLA 4KLQA 4TURA 5CHGA 1R89A 1ZQUA 5DB9A 2BE3A 2ZH9A 3HW8A 1UEUA 9ICGA 4MFFA 4UBCA 4TUQA 9ICSA 1ZJMA 9ICPA 8ICCA 5IIIA 4PGYA 4TUPA 4GXIA 2PFPA 4O5CA 4FHWA 7ICMA 2DR8A 5HRGA 4QZ8A 4RT3A 3RJFA 5BOLA 2ZH3A 2BPFA 1ZQNA 4RQ2A 1JQRA 4GXJA 3H37A 2M2TA 9ICWA 3RJKA 2DVIA 4WC6A 2DRAA 5D46A 3PNCA 3C2LA 4PHAA 7ICFA 9ICKA 4UB5A 4NLKA 1OU5A 3V72A 3C2MA 2O5AA 4YD2A 5J2JA 5IILA 3HJ1A 2GWSA 3RH4A 4QZ9A 4KLSA 4O5EA 5CA7A 1XSPA 1BPXA 3K75D 4M9NA 4I2GA 8ICJA 1JN3A 5DB8A 2PFOA 5HRKA 3ISCA 4KLGA 8ICZA 2BCQA 4FO6A 4AT9B 5EOZA 1MQ2A 4RQ4A 9ICNA 2BCSA 9ICHA 2M2VA 5HRHA 1XSNA 4FHXA 9ICMA 4E80A 1TVAA 3C2KA 3LQCB 4X0AA 8ICQA 2NRKA 1R8AA 1UEVA 5DDYA 1MQ3A 3H38A 4QZDA 5D4BA 3UPSA 5HC9A 1TFYA 3B0XA 4NM1A 3OUYB 4KLDA 3HX0A 3H39A 8ICFA 2DR7A 3MGHA 5J0SA 3AUOA 8ICVA 4MFCA 4LZGA 4RQ0A 3UXOA 8ICHA 4UB3A 8ICSA 1ZQEA 4XUSA 4AT9A 4M0AA 4I2DA 3OVSA 2ZH6A 3V7KA 5J2FA 9ICLA 4RT2A 4QZIA 4M04A 4F5OA 4UAYA 3ISDA 9ICOA 5J2KA 3HWTA 5J0QA 4JWMA 8ICWA 4KLEA 4QZGA 4KLUA 4F5PA 3AQMA 2ID1A 4WBYA 2ISPA 1JAJA 8ICKA 4P4MA 4UD5A 2ZHBA 4X4VA 2DR9A 3JPSA 1TFWA 3OUYA 3JPPA 4NKUA 9ICQA 4R63A 1ZQTA 4JWNA 5J0OA 3H3AA 3UPQA 4XA5A 3OVBA 4Z6DA 5HHHA 8ICUA 5BPCA 4PHDA 1ZQZA 1ZQCA 3OV7A 5HRIA 4KLHA 7ICQA 2ZH8A 3RJGA 1NO5A 4AT8A 3UQ2A 4WC7A 4FH3A 3V7JA 4WC4A 4YCXA 4K4HA 1RZTA 4EBJA 3UQ0A 1Q79A 4QZEA 2ZH2A 4X0BA 3C18A 5J2HA 1ZQKA 5TZVA 4FH5A 3ISBA 4X4QA 5HRFA 9ICJA 4MF8A 4RWPA 4RPXA 1YLQA 4YN4A 5DECA 1ZQIA 4Z6FA 7ICVA 1FA0A 4QZFA 4KLIA 4NY8A 2PFNA 2M2UA 1BPBA 8ICIA 2PBEA 4I2AA 8ICLA 5J0TA 7ICSA 4RQ1A 9ICEA 5D49A 8ICYA 1ZQAA 1R8CA 4UB1A 2ZH1A 5DDMA 3AU6A 4XQ7A 5CWRA 8ICTA 2FMPA 4EP7A 4X4OA 3MDAA 5J0RA 5IIMA 2BCRA 4I2CA 4UAZA 1ZQPA 1ZQOA 4YMNA 4O9MA
chains in the Genus database with same CATH superfamily
3LK9A 1V4AA 1ZQJA 3B0YA 5CB1A 4RQ3A 5J0PA 4P2HA 5CHEA 4K96A 4PGXA 5J2GA 3OWGA 7ICTA 3JPOA 4WC1A 4R66A 1MIVA 5CP2A 1VJ7A 1HUZA 3OVAA 8ICXA 3WFRE 1BPZA 4O68A 4WQKA 3JPRA 1KDHA 4I2FA 3RH5A 4E8FA 2ZH7A 1R8BA 7ICPA 3NWIA 4I2BA 4WC0A 3HIYA 2DR5A 3MGIA 4YMMA 4O5KA 4WCWA 4TUSA 2ZHAA 2BCVA 1KEJA 4M2YA 4KLLA 4NXUA 5DBCA 4IQWA 3EF2A 4AT8B 8ICGA 5J2EA 5J2AA 9ICAA 4RQ7A 1MIWA 4PHEA 4OAFA 3WFPA 4DOCA 2O1PA 4NXXA 5DBAA 4OAGA 2P66A 3JCFA 4LVSA 5DBBA 5J0WA 1BPDA 4NXZA 1BPYA 1JMSA 2FCLA 1MIYA 4EV6A 1ZQFA 5CJ7A 2ISOA 4Z6CA 8ICEA 2W9MA 4JLXA 5HREA 4RWQA 5DKWA 1RPLA 4LEVA 4RWOA 2ZH5A 4K9BA 4X4NA 3JPQA 4X4RA 4KLMA 4O6AA 4IQTA 4QZCA 4M9HA 8ICAA 2RFFA 4PH5A 1GPJA 3OGUA 3C5FA 3C5GA 4LEWA 4IQVA 4PHPA 4QZAA 3ERCC 4FHVA 4K97A 8ICMA 7ICNA 4GXKA 3UXNA 3PMLA 4AT7A 4M5DA 2BBHA 3K7DA 2VANA 2M2WA 3JPNA 1TV9A 1ZQSA 3JPTA 4NLZA 4I2HA 1UETA 1ZQVA 4X4UA 4F5NA 7ICEA 3RJHA 1ZJNA 3AQLA 4YD1A 4X4SA 4ATBA 4LT6A 4UB4A 3RH6A 9ICVA 3WFQE 1VFGA 3UXPA 2ZH4A 5J2IA 4FHYA 5J2CA 2BPCA 5IIKA 4LEZA 9ICTA 3MDCA 5CR0A 5J0YA 4Z6EA 7ICKA 4OAIZ 4PPXA 4M9JA 4MF2A 7ICLA 9ICIA 5HRLA 4DO9A 4RQ8A 1ZQRA 3WFSC 4NKTA 4XRHA 8ICOA 3C66A 4I28A 9ICXA 9ICFA 4F5RA 4NLNA 1Q78A 4P4OA 2FMQA 2FMSA 3V7LA 2HN2A 3WFOA 5HRBA 1ZQDA 4KLOA 5D61A 4N7RA 7ICOA 4XQ8A 3AQNA 1ZQHA 4EEBA 4X4PA 2BPGA 4K99A 5F2VO 2Q66A 4WOYA 4IG8A 3RJEA 3NVOA 3AU2A 1ZQYA 4UBBA 5HRDA 5IIOA 1ZQGA 5HHIA 4F5QA 1ZQBA 4QZHA 4I27A 7ICUA 5J2BA 4I2JA 4RPZA 1KNYA 4YMOA 3TFRA 4M9LA 5J2DA 5IINA 3PHZA 4K8VA 4I2IA 4MFAA 2PFQA 3ER8C 5BOMA 2B4VA 2I9GA 7ICGA 4K4IA 4DOBA 4K4GA 4KLTA 4KLFA 8ICRA 3MCRA 4M47A 4RQ6A 1NOMA 4I2EA 2BCUA 4E7XA 5DB7A 4LZDA 4AT7B 3MBYA 4WBZA 4UD4A 4I29A 3RJIA 4M9GA 3RJJA 2DRBA 5IIJA 4X5VA 4DOAA 4RWNA 5D63A 2IHMA 5B3PA 9ICUA 7ICRA 3PMNA 4WC2A 5J29A 4UB2A 1HUOA 3L9DA 4ATBB 5DB6A 5J0UA 3HJ4A 4R65A 1ZQXA 5DEDA 4NM2A 3JZ0A 4S3NA 1F5AA 4WC5A 9ICCA 3TFSA 7ICJA 3JYYA 5J0XA 4PGQA 4IQUA 8ICNA 4RQ5A 3GDXA 3NYBA 4X4TA 8ICPA 2HHPA 1ZQQA 1ZQMA 1PX5A 4FHPA 4QZBA 4EBKA 5CFUA 3AQKA 1BPEA 2PXIA 7ICHA 8ICBA 5B3QA 4WC3A 9ICBA 4KLJA 4UAWA 1XSLA 4R64A 4P4PA 4WQLA 1ZQWA 4RPYA 1WOTA 7ICIA 9ICRA 4NXTA 5HR9A 1ZQLA 4KLQA 4TURA 5CHGA 1R89A 1ZQUA 5DB9A 2BE3A 3CK6A 3HW8A 2ZH9A 1UEUA 9ICGA 4MFFA 4UBCA 4TUQA 9ICSA 4MKPA 2BBJA 1ZJMA 9ICPA 8ICCA 5IIIA 4PGYA 4TUPA 4GXIA 2PFPA 4O5CA 4FHWA 2HN1A 4I0UA 2IHOA 7ICMA 2DR8A 5HRGA 4QZ8A 4RT3A 3RJFA 5BOLA 2ZH3A 2BPFA 1ZQNA 4RQ2A 1JQRA 4GXJA 3H37A 2M2TA 9ICWA 3RJKA 2DVIA 4WC6A 2DRAA 5D46A 3PNCA 3C2LA 4PHAA 7ICFA 9ICKA 4UB5A 4NLKA 1OU5A 3V72A 3C2MA 2O5AA 4YD2A 5J2JA 5IILA 3HJ1A 2GWSA 3RH4A 4QZ9A 4KLSA 4WH5A 4O5EA 5CA7A 1XSPA 1BPXA 4HX0A 4K98A 3K75D 4M9NA 4I2GA 8ICJA 2GAFD 4EGWA 1JN3A 5DB8A 2PFOA 4JLZA 5HRKA 3ISCA 4KLGA 8ICZA 2BCQA 4FO6A 4AT9B 2B51A 5EOZA 1MQ2A 4RQ4A 9ICNA 2BCSA 9ICHA 2M2VA 5HRHA 1XSNA 4FHXA 9ICMA 4E80A 1TVAA 3C2KA 3LQCB 4X0AA 8ICQA 2NRKA 1R8AA 1UEVA 5DDYA 4NXWA 1MQ3A 4EEDA 3H38A 5CFTA 4QZDA 5JTGA 5D4BA 3UPSA 5HC9A 1TFYA 3B0XA 4NM1A 3OUYB 4KLDA 3HX0A 3H39A 8ICFA 2DR7A 3MGHA 5J0SA 3AUOA 8ICVA 4MFCA 4LZGA 4RQ0A 3UXOA 8ICHA 4UB3A 5D62A 8ICSA 1ZQEA 4XUSA 4AT9A 4M0AA 4I2DA 3OVSA 2ZH6A 3V7KA 4KB6A 5J2FA 9ICLA 4RT2A 4QZIA 4M04A 4F5OA 4UAYA 3ISDA 9ICOA 5J2KA 4LEYA 4OAHA 3HWTA 5J0QA 4KM5A 4JWMA 8ICWA 2B56A 4KLEA 4QZGA 4KLUA 4F5PA 3AQMA 2ID1A 4K9AA 4WBYA 2ISPA 1JAJA 8ICKA 4P4MA 2EWRA 4UD5A 2ZHBA 2GA9D 4X4VA 2DR9A 3JPSA 1TFWA 3OUYA 3JPPA 4NKUA 9ICQA 4R63A 1ZQTA 4JWNA 5J0OA 2IUBA 3H3AA 3UPQA 4XA5A 3OVBA 4Z6DA 5HHHA 8ICUA 5BPCA 4PHDA 1ZQZA 1ZQCA 3OV7A 5HRIA 4KLHA 7ICQA 2ZH8A 3RJGA 4NXVA 1NO5A 4AT8A 3UQ2A 4WC7A 4FH3A 4O69A 4XJEA 3V7JA 4WC4A 4YCXA 4K4HA 1RZTA 4EBJA 3UQ0A 1Q79A 4QZEA 2ZH2A 4X0BA 3C18A 5J2HA 1ZQKA 5TZVA 4FH5A 3ISBA 4X4QA 5HRFA 9ICJA 4MF8A 4RWPA 4RPXA 1YLQA 4YN4A 5DECA 1ZQIA 4Z6FA 7ICVA 1FA0A 5CFSA 4QZFA 4KLIA 4NY8A 2PFNA 2M2UA 1BPBA 8ICIA 2PBEA 4I2AA 8ICLA 5J0TA 7ICSA 4RQ1A 9ICEA 3ER9B 5D49A 8ICYA 4FO1A 1ZQAA 1R8CA 4UB1A 2ZH1A 5DDMA 3AU6A 4XQ7A 4O67A 5CWRA 8ICTA 2FMPA 4EP7A 3NKUA 4X4OA 3MDAA 5J0RA 5IIMA 2BCRA 4I2CA 4UAZA 1ZQPA 1ZQOA 4YMNA 4O9MA
chains in the Genus database with same CATH topology
3LK9A 1V4AA 1ZQJA 3B0YA 5CB1A 4RQ3A 5J0PA 4P2HA 4PGXA 5J2GA 7ICTA 3JPOA 4WC1A 4R66A 1MIVA 5CP2A 1VJ7A 1HUZA 3OVAA 8ICXA 3WFRE 1BPZA 3JPRA 1KDHA 4I2FA 3RH5A 4E8FA 2ZH7A 1R8BA 7ICPA 4I2BA 4WC0A 3HIYA 2DR5A 3MGIA 4YMMA 4O5KA 4WCWA 4TUSA 2ZHAA 2BCVA 1KEJA 4M2YA 4KLLA 5DBCA 4IQWA 4AT8B 8ICGA 5J2EA 5J2AA 9ICAA 4RQ7A 1MIWA 4PHEA 3WFPA 4DOCA 2O1PA 5DBAA 2P66A 4LVSA 5DBBA 5J0WA 1BPDA 4NXZA 1BPYA 1JMSA 1MIYA 1ZQFA 5CJ7A 2ISOA 4Z6CA 8ICEA 2W9MA 5HREA 4RWQA 5DKWA 1RPLA 4RWOA 2ZH5A 4X4NA 3JPQA 4X4RA 4KLMA 4IQTA 4QZCA 4M9HA 8ICAA 2RFFA 4PH5A 3OGUA 3C5FA 3C5GA 4IQVA 4PHPA 4QZAA 4FHVA 8ICMA 7ICNA 4GXKA 3UXNA 3PMLA 4AT7A 4M5DA 2VANA 2M2WA 3JPNA 1TV9A 1ZQSA 3JPTA 4NLZA 4I2HA 1UETA 1ZQVA 4X4UA 4F5NA 7ICEA 3RJHA 1ZJNA 3AQLA 4YD1A 4X4SA 4ATBA 4LT6A 4UB4A 3RH6A 9ICVA 3WFQE 1VFGA 3UXPA 2ZH4A 5J2IA 4FHYA 5J2CA 2BPCA 5IIKA 9ICTA 3MDCA 5CR0A 5J0YA 4Z6EA 7ICKA 4PPXA 4M9JA 4MF2A 7ICLA 9ICIA 5HRLA 4DO9A 4RQ8A 1ZQRA 3WFSC 4NKTA 4XRHA 8ICOA 3C66A 4I28A 9ICXA 9ICFA 4F5RA 4NLNA 1Q78A 4P4OA 2FMQA 2FMSA 3V7LA 3WFOA 5HRBA 1ZQDA 4KLOA 7ICOA 4XQ8A 3AQNA 1ZQHA 4X4PA 2BPGA 5F2VO 2Q66A 4IG8A 3RJEA 3AU2A 1ZQYA 4UBBA 5HRDA 5IIOA 1ZQGA 5HHIA 4F5QA 1ZQBA 4QZHA 4I27A 7ICUA 5J2BA 4I2JA 4RPZA 1KNYA 4YMOA 3TFRA 4M9LA 5J2DA 5IINA 4I2IA 4MFAA 2PFQA 5BOMA 2I9GA 7ICGA 4K4IA 4DOBA 4K4GA 4KLTA 4KLFA 8ICRA 4M47A 4RQ6A 1NOMA 4I2EA 2BCUA 4E7XA 5DB7A 4LZDA 4AT7B 3MBYA 4WBZA 4UD4A 4I29A 3RJIA 4M9GA 3RJJA 2DRBA 5IIJA 4X5VA 4DOAA 4RWNA 2IHMA 9ICUA 7ICRA 3PMNA 4WC2A 5J29A 4UB2A 1HUOA 3L9DA 4ATBB 5DB6A 5J0UA 3HJ4A 4R65A 1ZQXA 5DEDA 4NM2A 3JZ0A 4S3NA 1F5AA 4WC5A 9ICCA 3TFSA 7ICJA 3JYYA 5J0XA 4PGQA 4IQUA 8ICNA 4RQ5A 3GDXA 3NYBA 4X4TA 8ICPA 2HHPA 1ZQQA 1ZQMA 1PX5A 4FHPA 4QZBA 4EBKA 3AQKA 1BPEA 2PXIA 7ICHA 8ICBA 4WC3A 9ICBA 4KLJA 4UAWA 1XSLA 4R64A 4P4PA 1ZQWA 4RPYA 1WOTA 7ICIA 9ICRA 5HR9A 1ZQLA 4KLQA 4TURA 5CHGA 1R89A 1ZQUA 5DB9A 2BE3A 2ZH9A 3HW8A 1UEUA 9ICGA 4MFFA 4UBCA 4TUQA 9ICSA 1ZJMA 9ICPA 8ICCA 5IIIA 4PGYA 4TUPA 4GXIA 2PFPA 4O5CA 4FHWA 7ICMA 2DR8A 5HRGA 4QZ8A 4RT3A 3RJFA 5BOLA 2ZH3A 2BPFA 1ZQNA 4RQ2A 1JQRA 4GXJA 3H37A 2M2TA 9ICWA 3RJKA 2DVIA 4WC6A 2DRAA 5D46A 3PNCA 3C2LA 4PHAA 7ICFA 9ICKA 4UB5A 4NLKA 1OU5A 3V72A 3C2MA 2O5AA 4YD2A 5J2JA 5IILA 3HJ1A 2GWSA 3RH4A 4QZ9A 4KLSA 4O5EA 5CA7A 1XSPA 1BPXA 3K75D 4M9NA 4I2GA 8ICJA 1JN3A 5DB8A 2PFOA 5HRKA 3ISCA 4KLGA 8ICZA 2BCQA 4FO6A 4AT9B 5EOZA 1MQ2A 4RQ4A 9ICNA 2BCSA 9ICHA 2M2VA 5HRHA 1XSNA 4FHXA 9ICMA 4E80A 1TVAA 3C2KA 3LQCB 4X0AA 8ICQA 2NRKA 1R8AA 1UEVA 5DDYA 1MQ3A 3H38A 4QZDA 5D4BA 3UPSA 5HC9A 1TFYA 3B0XA 4NM1A 3OUYB 4KLDA 3HX0A 3H39A 8ICFA 2DR7A 3MGHA 5J0SA 3AUOA 8ICVA 4MFCA 4LZGA 4RQ0A 3UXOA 8ICHA 4UB3A 8ICSA 1ZQEA 4XUSA 4AT9A 4M0AA 4I2DA 3OVSA 2ZH6A 3V7KA 5J2FA 9ICLA 4RT2A 4QZIA 4M04A 4F5OA 4UAYA 3ISDA 9ICOA 5J2KA 3HWTA 5J0QA 4JWMA 8ICWA 4KLEA 4QZGA 4KLUA 4F5PA 3AQMA 2ID1A 4WBYA 2ISPA 1JAJA 8ICKA 4P4MA 4UD5A 2ZHBA 4X4VA 2DR9A 3JPSA 1TFWA 3OUYA 3JPPA 4NKUA 9ICQA 4R63A 1ZQTA 4JWNA 5J0OA 3H3AA 3UPQA 4XA5A 3OVBA 4Z6DA 5HHHA 8ICUA 5BPCA 4PHDA 1ZQZA 1ZQCA 3OV7A 5HRIA 4KLHA 7ICQA 2ZH8A 3RJGA 1NO5A 4AT8A 3UQ2A 4WC7A 4FH3A 3V7JA 4WC4A 4YCXA 4K4HA 1RZTA 4EBJA 3UQ0A 1Q79A 4QZEA 2ZH2A 4X0BA 3C18A 5J2HA 1ZQKA 5TZVA 4FH5A 3ISBA 4X4QA 5HRFA 9ICJA 4MF8A 4RWPA 4RPXA 1YLQA 4YN4A 5DECA 1ZQIA 4Z6FA 7ICVA 1FA0A 4QZFA 4KLIA 4NY8A 2PFNA 2M2UA 1BPBA 8ICIA 2PBEA 4I2AA 8ICLA 5J0TA 7ICSA 4RQ1A 9ICEA 5D49A 8ICYA 1ZQAA 1R8CA 4UB1A 2ZH1A 5DDMA 3AU6A 4XQ7A 5CWRA 8ICTA 2FMPA 4EP7A 4X4OA 3MDAA 5J0RA 5IIMA 2BCRA 4I2CA 4UAZA 1ZQPA 1ZQOA 4YMNA 4O9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK9 A;  1V4A A;  1ZQJ A;  3B0Y A;  5CB1 A;  4RQ3 A;  5J0P A;  4P2H A;  4PGX A;  5J2G A;  7ICT A;  3JPO A;  4WC1 A;  4R66 A;  1MIV A;  5CP2 A;  1VJ7 A;  1HUZ A;  3OVA A;  8ICX A;  3WFR E;  1BPZ A;  3JPR A;  1KDH A;  4I2F A;  3RH5 A;  4E8F A;  2ZH7 A;  1R8B A;  7ICP A;  4I2B A;  4WC0 A;  3HIY A;  2DR5 A;  3MGI A;  4YMM A;  4O5K A;  4WCW A;  4TUS A;  2ZHA A;  2BCV A;  1KEJ A;  4M2Y A;  4KLL A;  5DBC A;  4IQW A;  4AT8 B;  8ICG A;  5J2E A;  5J2A A;  9ICA A;  4RQ7 A;  1MIW A;  4PHE A;  3WFP A;  4DOC A;  2O1P A;  5DBA A;  2P66 A;  4LVS A;  5DBB A;  5J0W A;  1BPD A;  4NXZ A;  1BPY A;  1JMS A;  1MIY A;  1ZQF A;  5CJ7 A;  2ISO A;  4Z6C A;  8ICE A;  2W9M A;  5HRE A;  4RWQ A;  5DKW A;  1RPL A;  4RWO A;  2ZH5 A;  4X4N A;  3JPQ A;  4X4R A;  4KLM A;  4IQT A;  4QZC A;  4M9H A;  8ICA A;  2RFF A;  4PH5 A;  3OGU A;  3C5F A;  3C5G A;  4IQV A;  4PHP A;  4QZA A;  4FHV A;  8ICM A;  7ICN A;  4GXK A;  3UXN A;  3PML A;  4AT7 A;  4M5D A;  2VAN A;  2M2W A;  3JPN A;  1TV9 A;  1ZQS A;  3JPT A;  4NLZ A;  4I2H A;  1UET A;  1ZQV A;  4X4U A;  4F5N A;  7ICE A;  3RJH A;  1ZJN A;  3AQL A;  4YD1 A;  4X4S A;  4ATB A;  4LT6 A;  4UB4 A;  3RH6 A;  9ICV A;  3WFQ E;  1VFG A;  3UXP A;  2ZH4 A;  5J2I A;  4FHY A;  5J2C A;  2BPC A;  5IIK A;  9ICT A;  3MDC A;  5CR0 A;  5J0Y A;  4Z6E A;  7ICK A;  4PPX A;  4M9J A;  4MF2 A;  7ICL A;  9ICI A;  5HRL A;  4DO9 A;  4RQ8 A;  1ZQR A;  3WFS C;  4NKT A;  4XRH A;  8ICO A;  3C66 A;  4I28 A;  9ICX A;  9ICF A;  4F5R A;  4NLN A;  1Q78 A;  4P4O A;  2FMQ A;  2FMS A;  3V7L A;  3WFO A;  5HRB A;  1ZQD A;  4KLO A;  7ICO A;  4XQ8 A;  3AQN A;  1ZQH A;  4X4P A;  2BPG A;  5F2V O;  2Q66 A;  4IG8 A;  3RJE A;  3AU2 A;  1ZQY A;  4UBB A;  5HRD A;  5IIO A;  1ZQG A;  5HHI A;  4F5Q A;  1ZQB A;  4QZH A;  4I27 A;  7ICU A;  5J2B A;  4I2J A;  4RPZ A;  1KNY A;  4YMO A;  3TFR A;  4M9L A;  5J2D A;  5IIN A;  4I2I A;  4MFA A;  2PFQ A;  5BOM A;  2I9G A;  7ICG A;  4K4I A;  4DOB A;  4K4G A;  4KLT A;  4KLF A;  8ICR A;  4M47 A;  4RQ6 A;  1NOM A;  4I2E A;  2BCU A;  4E7X A;  5DB7 A;  4LZD A;  4AT7 B;  3MBY A;  4WBZ A;  4UD4 A;  4I29 A;  3RJI A;  4M9G A;  3RJJ A;  2DRB A;  5IIJ A;  4X5V A;  4DOA A;  4RWN A;  2IHM A;  9ICU A;  7ICR A;  3PMN A;  4WC2 A;  5J29 A;  4UB2 A;  1HUO A;  3L9D A;  4ATB B;  5DB6 A;  5J0U A;  3HJ4 A;  4R65 A;  1ZQX A;  5DED A;  4NM2 A;  3JZ0 A;  4S3N A;  1F5A A;  4WC5 A;  9ICC A;  3TFS A;  7ICJ A;  3JYY A;  5J0X A;  4PGQ A;  4IQU A;  8ICN A;  4RQ5 A;  3GDX A;  3NYB A;  4X4T A;  8ICP A;  2HHP A;  1ZQQ A;  1ZQM A;  1PX5 A;  4FHP A;  4QZB A;  4EBK A;  3AQK A;  1BPE A;  2PXI A;  7ICH A;  8ICB A;  4WC3 A;  9ICB A;  4KLJ A;  4UAW A;  1XSL A;  4R64 A;  4P4P A;  1ZQW A;  4RPY A;  1WOT A;  7ICI A;  9ICR A;  5HR9 A;  1ZQL A;  4KLQ A;  4TUR A;  5CHG A;  1R89 A;  1ZQU A;  5DB9 A;  2BE3 A;  2ZH9 A;  3HW8 A;  1UEU A;  9ICG A;  4MFF A;  4UBC A;  4TUQ A;  9ICS A;  1ZJM A;  9ICP A;  8ICC A;  5III A;  4PGY A;  4TUP A;  4GXI A;  2PFP A;  4O5C A;  4FHW A;  7ICM A;  2DR8 A;  5HRG A;  4QZ8 A;  4RT3 A;  3RJF A;  5BOL A;  2ZH3 A;  2BPF A;  1ZQN A;  4RQ2 A;  1JQR A;  4GXJ A;  3H37 A;  2M2T A;  9ICW A;  3RJK A;  2DVI A;  4WC6 A;  2DRA A;  5D46 A;  3PNC A;  3C2L A;  4PHA A;  7ICF A;  9ICK A;  4UB5 A;  4NLK A;  1OU5 A;  3V72 A;  3C2M A;  2O5A A;  4YD2 A;  5J2J A;  5IIL A;  3HJ1 A;  2GWS A;  3RH4 A;  4QZ9 A;  4KLS A;  4O5E A;  5CA7 A;  1XSP A;  1BPX A;  3K75 D;  4M9N A;  4I2G A;  8ICJ A;  1JN3 A;  5DB8 A;  2PFO A;  5HRK A;  3ISC A;  4KLG A;  8ICZ A;  2BCQ A;  4FO6 A;  4AT9 B;  5EOZ A;  1MQ2 A;  4RQ4 A;  9ICN A;  2BCS A;  9ICH A;  2M2V A;  5HRH A;  1XSN A;  4FHX A;  9ICM A;  4E80 A;  1TVA A;  3C2K A;  3LQC B;  4X0A A;  8ICQ A;  2NRK A;  1R8A A;  1UEV A;  5DDY A;  1MQ3 A;  3H38 A;  4QZD A;  5D4B A;  3UPS A;  5HC9 A;  1TFY A;  3B0X A;  4NM1 A;  3OUY B;  4KLD A;  3HX0 A;  3H39 A;  8ICF A;  2DR7 A;  3MGH A;  5J0S A;  3AUO A;  8ICV A;  4MFC A;  4LZG A;  4RQ0 A;  3UXO A;  8ICH A;  4UB3 A;  8ICS A;  1ZQE A;  4XUS A;  4AT9 A;  4M0A A;  4I2D A;  3OVS A;  2ZH6 A;  3V7K A;  5J2F A;  9ICL A;  4RT2 A;  4QZI A;  4M04 A;  4F5O A;  4UAY A;  3ISD A;  9ICO A;  5J2K A;  3HWT A;  5J0Q A;  4JWM A;  8ICW A;  4KLE A;  4QZG A;  4KLU A;  4F5P A;  3AQM A;  2ID1 A;  4WBY A;  2ISP A;  1JAJ A;  8ICK A;  4P4M A;  4UD5 A;  2ZHB A;  4X4V A;  2DR9 A;  3JPS A;  1TFW A;  3OUY A;  3JPP A;  4NKU A;  9ICQ A;  4R63 A;  1ZQT A;  4JWN A;  5J0O A;  3H3A A;  3UPQ A;  4XA5 A;  3OVB A;  4Z6D A;  5HHH A;  8ICU A;  5BPC A;  4PHD A;  1ZQZ A;  1ZQC A;  3OV7 A;  5HRI A;  4KLH A;  7ICQ A;  2ZH8 A;  3RJG A;  1NO5 A;  4AT8 A;  3UQ2 A;  4WC7 A;  4FH3 A;  3V7J A;  4WC4 A;  4YCX A;  4K4H A;  1RZT A;  4EBJ A;  3UQ0 A;  1Q79 A;  4QZE A;  2ZH2 A;  4X0B A;  3C18 A;  5J2H A;  1ZQK A;  5TZV A;  4FH5 A;  3ISB A;  4X4Q A;  5HRF A;  9ICJ A;  4MF8 A;  4RWP A;  4RPX A;  1YLQ A;  4YN4 A;  5DEC A;  1ZQI A;  4Z6F A;  7ICV A;  1FA0 A;  4QZF A;  4KLI A;  4NY8 A;  2PFN A;  2M2U A;  1BPB A;  8ICI A;  2PBE A;  4I2A A;  8ICL A;  5J0T A;  7ICS A;  4RQ1 A;  9ICE A;  5D49 A;  8ICY A;  1ZQA A;  1R8C A;  4UB1 A;  2ZH1 A;  5DDM A;  3AU6 A;  4XQ7 A;  5CWR A;  8ICT A;  2FMP A;  4EP7 A;  4X4O A;  3MDA A;  5J0R A;  5IIM A;  2BCR A;  4I2C A;  4UAZ A;  1ZQP A;  1ZQO A;  4YMN A;  4O9M A; 
#chains in the Genus database with same CATH topology
 3LK9 A;  1V4A A;  1ZQJ A;  3B0Y A;  5CB1 A;  4RQ3 A;  5J0P A;  4P2H A;  5CHE A;  4K96 A;  4PGX A;  5J2G A;  3OWG A;  7ICT A;  3JPO A;  4WC1 A;  4R66 A;  1MIV A;  5CP2 A;  1VJ7 A;  1HUZ A;  3OVA A;  8ICX A;  3WFR E;  1BPZ A;  4O68 A;  4WQK A;  3JPR A;  1KDH A;  4I2F A;  3RH5 A;  4E8F A;  2ZH7 A;  1R8B A;  7ICP A;  3NWI A;  4I2B A;  4WC0 A;  3HIY A;  2DR5 A;  3MGI A;  4YMM A;  4O5K A;  4WCW A;  4TUS A;  2ZHA A;  2BCV A;  1KEJ A;  4M2Y A;  4KLL A;  4NXU A;  5DBC A;  4IQW A;  3EF2 A;  4AT8 B;  8ICG A;  5J2E A;  5J2A A;  9ICA A;  4RQ7 A;  1MIW A;  4PHE A;  4OAF A;  3WFP A;  4DOC A;  2O1P A;  4NXX A;  5DBA A;  4OAG A;  2P66 A;  3JCF A;  4LVS A;  5DBB A;  5J0W A;  1BPD A;  4NXZ A;  1BPY A;  1JMS A;  2FCL A;  1MIY A;  4EV6 A;  1ZQF A;  5CJ7 A;  2ISO A;  4Z6C A;  8ICE A;  2W9M A;  4JLX A;  5HRE A;  4RWQ A;  5DKW A;  1RPL A;  4LEV A;  4RWO A;  2ZH5 A;  4K9B A;  4X4N A;  3JPQ A;  4X4R A;  4KLM A;  4O6A A;  4IQT A;  4QZC A;  4M9H A;  8ICA A;  2RFF A;  4PH5 A;  1GPJ A;  3OGU A;  3C5F A;  3C5G A;  4LEW A;  4IQV A;  4PHP A;  4QZA A;  3ERC C;  4FHV A;  4K97 A;  8ICM A;  7ICN A;  4GXK A;  3UXN A;  3PML A;  4AT7 A;  4M5D A;  2BBH A;  3K7D A;  2VAN A;  2M2W A;  3JPN A;  1TV9 A;  1ZQS A;  3JPT A;  4NLZ A;  4I2H A;  1UET A;  1ZQV A;  4X4U A;  4F5N A;  7ICE A;  3RJH A;  1ZJN A;  3AQL A;  4YD1 A;  4X4S A;  4ATB A;  4LT6 A;  4UB4 A;  3RH6 A;  9ICV A;  3WFQ E;  1VFG A;  3UXP A;  2ZH4 A;  5J2I A;  4FHY A;  5J2C A;  2BPC A;  5IIK A;  4LEZ A;  9ICT A;  3MDC A;  5CR0 A;  5J0Y A;  4Z6E A;  7ICK A;  4OAI Z;  4PPX A;  4M9J A;  4MF2 A;  7ICL A;  9ICI A;  5HRL A;  4DO9 A;  4RQ8 A;  1ZQR A;  3WFS C;  4NKT A;  4XRH A;  8ICO A;  3C66 A;  4I28 A;  9ICX A;  9ICF A;  4F5R A;  4NLN A;  1Q78 A;  4P4O A;  2FMQ A;  2FMS A;  3V7L A;  2HN2 A;  3WFO A;  5HRB A;  1ZQD A;  4KLO A;  5D61 A;  4N7R A;  7ICO A;  4XQ8 A;  3AQN A;  1ZQH A;  4EEB A;  4X4P A;  2BPG A;  4K99 A;  5F2V O;  2Q66 A;  4WOY A;  4IG8 A;  3RJE A;  3NVO A;  3AU2 A;  1ZQY A;  4UBB A;  5HRD A;  5IIO A;  1ZQG A;  5HHI A;  4F5Q A;  1ZQB A;  4QZH A;  4I27 A;  7ICU A;  5J2B A;  4I2J A;  4RPZ A;  1KNY A;  4YMO A;  3TFR A;  4M9L A;  5J2D A;  5IIN A;  3PHZ A;  4K8V A;  4I2I A;  4MFA A;  2PFQ A;  3ER8 C;  5BOM A;  2B4V A;  2I9G A;  7ICG A;  4K4I A;  4DOB A;  4K4G A;  4KLT A;  4KLF A;  8ICR A;  3MCR A;  4M47 A;  4RQ6 A;  1NOM A;  4I2E A;  2BCU A;  4E7X A;  5DB7 A;  4LZD A;  4AT7 B;  3MBY A;  4WBZ A;  4UD4 A;  4I29 A;  3RJI A;  4M9G A;  3RJJ A;  2DRB A;  5IIJ A;  4X5V A;  4DOA A;  4RWN A;  5D63 A;  2IHM A;  5B3P A;  9ICU A;  7ICR A;  3PMN A;  4WC2 A;  5J29 A;  4UB2 A;  1HUO A;  3L9D A;  4ATB B;  5DB6 A;  5J0U A;  3HJ4 A;  4R65 A;  1ZQX A;  5DED A;  4NM2 A;  3JZ0 A;  4S3N A;  1F5A A;  4WC5 A;  9ICC A;  3TFS A;  7ICJ A;  3JYY A;  5J0X A;  4PGQ A;  4IQU A;  8ICN A;  4RQ5 A;  3GDX A;  3NYB A;  4X4T A;  8ICP A;  2HHP A;  1ZQQ A;  1ZQM A;  1PX5 A;  4FHP A;  4QZB A;  4EBK A;  5CFU A;  3AQK A;  1BPE A;  2PXI A;  7ICH A;  8ICB A;  5B3Q A;  4WC3 A;  9ICB A;  4KLJ A;  4UAW A;  1XSL A;  4R64 A;  4P4P A;  4WQL A;  1ZQW A;  4RPY A;  1WOT A;  7ICI A;  9ICR A;  4NXT A;  5HR9 A;  1ZQL A;  4KLQ A;  4TUR A;  5CHG A;  1R89 A;  1ZQU A;  5DB9 A;  2BE3 A;  3CK6 A;  3HW8 A;  2ZH9 A;  1UEU A;  9ICG A;  4MFF A;  4UBC A;  4TUQ A;  9ICS A;  4MKP A;  2BBJ A;  1ZJM A;  9ICP A;  8ICC A;  5III A;  4PGY A;  4TUP A;  4GXI A;  2PFP A;  4O5C A;  4FHW A;  2HN1 A;  4I0U A;  2IHO A;  7ICM A;  2DR8 A;  5HRG A;  4QZ8 A;  4RT3 A;  3RJF A;  5BOL A;  2ZH3 A;  2BPF A;  1ZQN A;  4RQ2 A;  1JQR A;  4GXJ A;  3H37 A;  2M2T A;  9ICW A;  3RJK A;  2DVI A;  4WC6 A;  2DRA A;  5D46 A;  3PNC A;  3C2L A;  4PHA A;  7ICF A;  9ICK A;  4UB5 A;  4NLK A;  1OU5 A;  3V72 A;  3C2M A;  2O5A A;  4YD2 A;  5J2J A;  5IIL A;  3HJ1 A;  2GWS A;  3RH4 A;  4QZ9 A;  4KLS A;  4WH5 A;  4O5E A;  5CA7 A;  1XSP A;  1BPX A;  4HX0 A;  4K98 A;  3K75 D;  4M9N A;  4I2G A;  8ICJ A;  2GAF D;  4EGW A;  1JN3 A;  5DB8 A;  2PFO A;  4JLZ A;  5HRK A;  3ISC A;  4KLG A;  8ICZ A;  2BCQ A;  4FO6 A;  4AT9 B;  2B51 A;  5EOZ A;  1MQ2 A;  4RQ4 A;  9ICN A;  2BCS A;  9ICH A;  2M2V A;  5HRH A;  1XSN A;  4FHX A;  9ICM A;  4E80 A;  1TVA A;  3C2K A;  3LQC B;  4X0A A;  8ICQ A;  2NRK A;  1R8A A;  1UEV A;  5DDY A;  4NXW A;  1MQ3 A;  4EED A;  3H38 A;  5CFT A;  4QZD A;  5JTG A;  5D4B A;  3UPS A;  5HC9 A;  1TFY A;  3B0X A;  4NM1 A;  3OUY B;  4KLD A;  3HX0 A;  3H39 A;  8ICF A;  2DR7 A;  3MGH A;  5J0S A;  3AUO A;  8ICV A;  4MFC A;  4LZG A;  4RQ0 A;  3UXO A;  8ICH A;  4UB3 A;  5D62 A;  8ICS A;  1ZQE A;  4XUS A;  4AT9 A;  4M0A A;  4I2D A;  3OVS A;  2ZH6 A;  3V7K A;  4KB6 A;  5J2F A;  9ICL A;  4RT2 A;  4QZI A;  4M04 A;  4F5O A;  4UAY A;  3ISD A;  9ICO A;  5J2K A;  4LEY A;  4OAH A;  3HWT A;  5J0Q A;  4KM5 A;  4JWM A;  8ICW A;  2B56 A;  4KLE A;  4QZG A;  4KLU A;  4F5P A;  3AQM A;  2ID1 A;  4K9A A;  4WBY A;  2ISP A;  1JAJ A;  8ICK A;  4P4M A;  2EWR A;  4UD5 A;  2ZHB A;  2GA9 D;  4X4V A;  2DR9 A;  3JPS A;  1TFW A;  3OUY A;  3JPP A;  4NKU A;  9ICQ A;  4R63 A;  1ZQT A;  4JWN A;  5J0O A;  2IUB A;  3H3A A;  3UPQ A;  4XA5 A;  3OVB A;  4Z6D A;  5HHH A;  8ICU A;  5BPC A;  4PHD A;  1ZQZ A;  1ZQC A;  3OV7 A;  5HRI A;  4KLH A;  7ICQ A;  2ZH8 A;  3RJG A;  4NXV A;  1NO5 A;  4AT8 A;  3UQ2 A;  4WC7 A;  4FH3 A;  4O69 A;  4XJE A;  3V7J A;  4WC4 A;  4YCX A;  4K4H A;  1RZT A;  4EBJ A;  3UQ0 A;  1Q79 A;  4QZE A;  2ZH2 A;  4X0B A;  3C18 A;  5J2H A;  1ZQK A;  5TZV A;  4FH5 A;  3ISB A;  4X4Q A;  5HRF A;  9ICJ A;  4MF8 A;  4RWP A;  4RPX A;  1YLQ A;  4YN4 A;  5DEC A;  1ZQI A;  4Z6F A;  7ICV A;  1FA0 A;  5CFS A;  4QZF A;  4KLI A;  4NY8 A;  2PFN A;  2M2U A;  1BPB A;  8ICI A;  2PBE A;  4I2A A;  8ICL A;  5J0T A;  7ICS A;  4RQ1 A;  9ICE A;  3ER9 B;  5D49 A;  8ICY A;  4FO1 A;  1ZQA A;  1R8C A;  4UB1 A;  2ZH1 A;  5DDM A;  3AU6 A;  4XQ7 A;  4O67 A;  5CWR A;  8ICT A;  2FMP A;  4EP7 A;  3NKU A;  4X4O A;  3MDA A;  5J0R A;  5IIM A;  2BCR A;  4I2C A;  4UAZ A;  1ZQP A;  1ZQO A;  4YMN A;  4O9M A; 
#chains in the Genus database with same CATH homology
 3LK9 A;  1V4A A;  1ZQJ A;  3B0Y A;  5CB1 A;  4RQ3 A;  5J0P A;  4P2H A;  4PGX A;  5J2G A;  7ICT A;  3JPO A;  4WC1 A;  4R66 A;  1MIV A;  5CP2 A;  1VJ7 A;  1HUZ A;  3OVA A;  8ICX A;  3WFR E;  1BPZ A;  3JPR A;  1KDH A;  4I2F A;  3RH5 A;  4E8F A;  2ZH7 A;  1R8B A;  7ICP A;  4I2B A;  4WC0 A;  3HIY A;  2DR5 A;  3MGI A;  4YMM A;  4O5K A;  4WCW A;  4TUS A;  2ZHA A;  2BCV A;  1KEJ A;  4M2Y A;  4KLL A;  5DBC A;  4IQW A;  4AT8 B;  8ICG A;  5J2E A;  5J2A A;  9ICA A;  4RQ7 A;  1MIW A;  4PHE A;  3WFP A;  4DOC A;  2O1P A;  5DBA A;  2P66 A;  4LVS A;  5DBB A;  5J0W A;  1BPD A;  4NXZ A;  1BPY A;  1JMS A;  1MIY A;  1ZQF A;  5CJ7 A;  2ISO A;  4Z6C A;  8ICE A;  2W9M A;  5HRE A;  4RWQ A;  5DKW A;  1RPL A;  4RWO A;  2ZH5 A;  4X4N A;  3JPQ A;  4X4R A;  4KLM A;  4IQT A;  4QZC A;  4M9H A;  8ICA A;  2RFF A;  4PH5 A;  3OGU A;  3C5F A;  3C5G A;  4IQV A;  4PHP A;  4QZA A;  4FHV A;  8ICM A;  7ICN A;  4GXK A;  3UXN A;  3PML A;  4AT7 A;  4M5D A;  2VAN A;  2M2W A;  3JPN A;  1TV9 A;  1ZQS A;  3JPT A;  4NLZ A;  4I2H A;  1UET A;  1ZQV A;  4X4U A;  4F5N A;  7ICE A;  3RJH A;  1ZJN A;  3AQL A;  4YD1 A;  4X4S A;  4ATB A;  4LT6 A;  4UB4 A;  3RH6 A;  9ICV A;  3WFQ E;  1VFG A;  3UXP A;  2ZH4 A;  5J2I A;  4FHY A;  5J2C A;  2BPC A;  5IIK A;  9ICT A;  3MDC A;  5CR0 A;  5J0Y A;  4Z6E A;  7ICK A;  4PPX A;  4M9J A;  4MF2 A;  7ICL A;  9ICI A;  5HRL A;  4DO9 A;  4RQ8 A;  1ZQR A;  3WFS C;  4NKT A;  4XRH A;  8ICO A;  3C66 A;  4I28 A;  9ICX A;  9ICF A;  4F5R A;  4NLN A;  1Q78 A;  4P4O A;  2FMQ A;  2FMS A;  3V7L A;  3WFO A;  5HRB A;  1ZQD A;  4KLO A;  7ICO A;  4XQ8 A;  3AQN A;  1ZQH A;  4X4P A;  2BPG A;  5F2V O;  2Q66 A;  4IG8 A;  3RJE A;  3AU2 A;  1ZQY A;  4UBB A;  5HRD A;  5IIO A;  1ZQG A;  5HHI A;  4F5Q A;  1ZQB A;  4QZH A;  4I27 A;  7ICU A;  5J2B A;  4I2J A;  4RPZ A;  1KNY A;  4YMO A;  3TFR A;  4M9L A;  5J2D A;  5IIN A;  4I2I A;  4MFA A;  2PFQ A;  5BOM A;  2I9G A;  7ICG A;  4K4I A;  4DOB A;  4K4G A;  4KLT A;  4KLF A;  8ICR A;  4M47 A;  4RQ6 A;  1NOM A;  4I2E A;  2BCU A;  4E7X A;  5DB7 A;  4LZD A;  4AT7 B;  3MBY A;  4WBZ A;  4UD4 A;  4I29 A;  3RJI A;  4M9G A;  3RJJ A;  2DRB A;  5IIJ A;  4X5V A;  4DOA A;  4RWN A;  2IHM A;  9ICU A;  7ICR A;  3PMN A;  4WC2 A;  5J29 A;  4UB2 A;  1HUO A;  3L9D A;  4ATB B;  5DB6 A;  5J0U A;  3HJ4 A;  4R65 A;  1ZQX A;  5DED A;  4NM2 A;  3JZ0 A;  4S3N A;  1F5A A;  4WC5 A;  9ICC A;  3TFS A;  7ICJ A;  3JYY A;  5J0X A;  4PGQ A;  4IQU A;  8ICN A;  4RQ5 A;  3GDX A;  3NYB A;  4X4T A;  8ICP A;  2HHP A;  1ZQQ A;  1ZQM A;  1PX5 A;  4FHP A;  4QZB A;  4EBK A;  3AQK A;  1BPE A;  2PXI A;  7ICH A;  8ICB A;  4WC3 A;  9ICB A;  4KLJ A;  4UAW A;  1XSL A;  4R64 A;  4P4P A;  1ZQW A;  4RPY A;  1WOT A;  7ICI A;  9ICR A;  5HR9 A;  1ZQL A;  4KLQ A;  4TUR A;  5CHG A;  1R89 A;  1ZQU A;  5DB9 A;  2BE3 A;  2ZH9 A;  3HW8 A;  1UEU A;  9ICG A;  4MFF A;  4UBC A;  4TUQ A;  9ICS A;  1ZJM A;  9ICP A;  8ICC A;  5III A;  4PGY A;  4TUP A;  4GXI A;  2PFP A;  4O5C A;  4FHW A;  7ICM A;  2DR8 A;  5HRG A;  4QZ8 A;  4RT3 A;  3RJF A;  5BOL A;  2ZH3 A;  2BPF A;  1ZQN A;  4RQ2 A;  1JQR A;  4GXJ A;  3H37 A;  2M2T A;  9ICW A;  3RJK A;  2DVI A;  4WC6 A;  2DRA A;  5D46 A;  3PNC A;  3C2L A;  4PHA A;  7ICF A;  9ICK A;  4UB5 A;  4NLK A;  1OU5 A;  3V72 A;  3C2M A;  2O5A A;  4YD2 A;  5J2J A;  5IIL A;  3HJ1 A;  2GWS A;  3RH4 A;  4QZ9 A;  4KLS A;  4O5E A;  5CA7 A;  1XSP A;  1BPX A;  3K75 D;  4M9N A;  4I2G A;  8ICJ A;  1JN3 A;  5DB8 A;  2PFO A;  5HRK A;  3ISC A;  4KLG A;  8ICZ A;  2BCQ A;  4FO6 A;  4AT9 B;  5EOZ A;  1MQ2 A;  4RQ4 A;  9ICN A;  2BCS A;  9ICH A;  2M2V A;  5HRH A;  1XSN A;  4FHX A;  9ICM A;  4E80 A;  1TVA A;  3C2K A;  3LQC B;  4X0A A;  8ICQ A;  2NRK A;  1R8A A;  1UEV A;  5DDY A;  1MQ3 A;  3H38 A;  4QZD A;  5D4B A;  3UPS A;  5HC9 A;  1TFY A;  3B0X A;  4NM1 A;  3OUY B;  4KLD A;  3HX0 A;  3H39 A;  8ICF A;  2DR7 A;  3MGH A;  5J0S A;  3AUO A;  8ICV A;  4MFC A;  4LZG A;  4RQ0 A;  3UXO A;  8ICH A;  4UB3 A;  8ICS A;  1ZQE A;  4XUS A;  4AT9 A;  4M0A A;  4I2D A;  3OVS A;  2ZH6 A;  3V7K A;  5J2F A;  9ICL A;  4RT2 A;  4QZI A;  4M04 A;  4F5O A;  4UAY A;  3ISD A;  9ICO A;  5J2K A;  3HWT A;  5J0Q A;  4JWM A;  8ICW A;  4KLE A;  4QZG A;  4KLU A;  4F5P A;  3AQM A;  2ID1 A;  4WBY A;  2ISP A;  1JAJ A;  8ICK A;  4P4M A;  4UD5 A;  2ZHB A;  4X4V A;  2DR9 A;  3JPS A;  1TFW A;  3OUY A;  3JPP A;  4NKU A;  9ICQ A;  4R63 A;  1ZQT A;  4JWN A;  5J0O A;  3H3A A;  3UPQ A;  4XA5 A;  3OVB A;  4Z6D A;  5HHH A;  8ICU A;  5BPC A;  4PHD A;  1ZQZ A;  1ZQC A;  3OV7 A;  5HRI A;  4KLH A;  7ICQ A;  2ZH8 A;  3RJG A;  1NO5 A;  4AT8 A;  3UQ2 A;  4WC7 A;  4FH3 A;  3V7J A;  4WC4 A;  4YCX A;  4K4H A;  1RZT A;  4EBJ A;  3UQ0 A;  1Q79 A;  4QZE A;  2ZH2 A;  4X0B A;  3C18 A;  5J2H A;  1ZQK A;  5TZV A;  4FH5 A;  3ISB A;  4X4Q A;  5HRF A;  9ICJ A;  4MF8 A;  4RWP A;  4RPX A;  1YLQ A;  4YN4 A;  5DEC A;  1ZQI A;  4Z6F A;  7ICV A;  1FA0 A;  4QZF A;  4KLI A;  4NY8 A;  2PFN A;  2M2U A;  1BPB A;  8ICI A;  2PBE A;  4I2A A;  8ICL A;  5J0T A;  7ICS A;  4RQ1 A;  9ICE A;  5D49 A;  8ICY A;  1ZQA A;  1R8C A;  4UB1 A;  2ZH1 A;  5DDM A;  3AU6 A;  4XQ7 A;  5CWR A;  8ICT A;  2FMP A;  4EP7 A;  4X4O A;  3MDA A;  5J0R A;  5IIM A;  2BCR A;  4I2C A;  4UAZ A;  1ZQP A;  1ZQO A;  4YMN A;  4O9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...