5HRKA

The crystal structure of asfvpolx(h115f mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 35
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrkA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrkA01
4KLHA 4E80A 4X4SA 2ZH5A 5CJ7A 4NLKA 4DOCA 3AQNA 4QZAA 1ZQHA 4NM2A 4YMOA 4M5DA 4F5PA 8ICCA 5IIIA 4WC3A 4X4RA 2BE3A 5DDYA 4WC0A 5J2DA 2ISPA 3ISDA 2PFPA 5IIKA 1RZTA 2ZHBA 2ZH8A 4X4OA 3OVAA 1ZQUA 4PPXA 3UXPA 1MQ3A 5J0SA 3K75D 3JPPA 5DBCA 1TFWA 4AT8B 4E8FA 4DOBA 8ICVA 4GXJA 4I2BA 5CHGA 8ICQA 3C66A 1ZQTA 1BPDA 5J2JA 7ICIA 1BPEA 4IQUA 3V7JA 1UEUA 4I2GA 4KLSA 7ICTA 5J2KA 4RT3A 1BPYA 3MBYA 3RJIA 4AT9B 9ICTA 1ZQXA 4YMMA 7ICMA 3UQ0A 1XSNA 9ICCA 2BCSA 5D46A 2BCRA 4PGQA 4RT2A 4WC7A 2GWSA 4KLMA 1TFYA 1XSPA 4AT7A 4I2EA 3UXOA 4IQWA 4FHVA 4M0AA 4M9LA 3UPSA 4UAWA 4TUSA 3ISBA 2M2TA 2ZH6A 4O5KA 1BPBA 4TURA 3RJJA 1ZQEA 1ZQAA 1ZQGA 9ICPA 4YCXA 4X0AA 5EOZA 4QZGA 2I9GA 2PFOA 9ICLA 3UPQA 4M9HA 4UD5A 4I27A 4K4IA 4I2DA 3PMLA 4Z6DA 4DOAA 2ZH3A 2DR5A 4PGXA 5DB7A 5D4BA 4M9JA 3RJKA 3H38A 1KNYA 3AU6A 1XSLA 3ISCA 1V4AA 1VFGA 5J0WA 4MF8A 1BPXA 8ICZA 4RWOA 2BCUA 3MGIA 4O5EA 8ICWA 5CR0A 5J2BA 2PBEA 7ICEA 4KLQA 2ZH9A 9ICGA 5TZVA 4RQ0A 4NLNA 1ZQPA 4F5QA 4E7XA 4KLUA 8ICJA 1WOTA 5F2VO 4X4NA 5BOMA 3JPOA 4KLLA 2ZH1A 2DR9A 5HRGA 1PX5A 4WBYA 4AT7B 9ICAA 1FA0A 3L9DA 7ICQA 8ICPA 4TUQA 9ICXA 8ICKA 1HUOA 3WFSC 7ICNA 4UBCA 3V72A 9ICBA 1JN3A 1ZQVA 4FHXA 4EBJA 4F5RA 4IQVA 5IIOA 5DBBA 3WFOA 1ZQDA 4WBZA 5HR9A 2DR7A 8ICIA 3B0YA 7ICGA 4EBKA 3HJ4A 4QZCA 2BPFA 7ICFA 2ZHAA 5DDMA 5HC9A 4X4UA 1TV9A 2DVIA 4JWMA 2Q66A 9ICMA 9ICUA 8ICLA 1Q78A 4FO6A 1ZQKA 4RPYA 4NXZA 1OU5A 1MIWA 1NO5A 7ICHA 4QZDA 1KEJA 3GDXA 1HUZA 3OGUA 1JQRA 4UAZA 2M2VA 2FMQA 3HWTA 3MDAA 7ICVA 4XQ8A 3V7KA 5J2FA 3HIYA 3OUYA 3PNCA 2FMPA 5HHIA 9ICVA 9ICSA 3MGHA 4KLGA 3TFRA 7ICOA 4QZBA 4I2CA 5J0XA 4FHPA 4MFCA 3RJEA 1ZQQA 5D49A 5HRFA 4R63A 2BPGA 4I2HA 5J2AA 9ICQA 2BCQA 4RQ3A 4M47A 2O1PA 5DBAA 4R65A 3MDCA 4X0BA 4R66A 7ICPA 4I29A 3TFSA 4UBBA 5HREA 3C2KA 4RWPA 4LT6A 8ICSA 4M2YA 4RQ1A 8ICNA 4KLJA 2PXIA 1R89A 4UD4A 3C5FA 4LZDA 4UB2A 2RFFA 3AU2A 4NM1A 4UB4A 4WCWA 5J0TA 4YMNA 5IIJA 1MIVA 4ATBA 2PFNA 3H39A 4RQ7A 4X4PA 4XRHA 1F5AA 2FMSA 9ICNA 4NKTA 4X4VA 4X4TA 5DKWA 1BPZA 4XQ7A 4P4PA 1ZQLA 4I2AA 1ZQJA 5HRKA 3JPSA 4PHDA 1ZQIA 4KLIA 4DO9A 4WC4A 3C2MA 3JPNA 8ICMA 3WFPA 1TVAA 5J29A 3OUYB 4RPZA 4KLEA 3JZ0A 3C2LA 7ICSA 4WC5A 3HJ1A 3NYBA 4QZFA 4KLTA 7ICKA 1JMSA 2IHMA 2DR8A 4RQ2A 3H37A 9ICHA 2O5AA 5J0PA 3AQKA 5J2CA 1ZQWA 2W9MA 8ICUA 3C18A 1UEVA 1VJ7A 5DEDA 3V7LA 4QZHA 9ICIA 1ZQCA 1ZQRA 9ICEA 1R8CA 5J2HA 4RWQA 1ZQSA 4RPXA 3RJHA 4QZIA 4GXIA 4O9MA 3AUOA 3OVBA 4WC1A 1ZQOA 1ZQFA 3HX0A 4EP7A 3OV7A 2BCVA 8ICTA 3OVSA 5CP2A 3RJFA 8ICXA 1NOMA 5HRDA 3LK9A 7ICRA 5DB6A 5CB1A 5J2GA 4UB5A 3JPRA 4ATBB 5HRLA 5DB8A 8ICBA 1UETA 3JPTA 4R64A 4F5NA 4PHPA 2VANA 5J0UA 3HW8A 1R8BA 1ZQZA 4XA5A 4MFFA 1RPLA 8ICHA 5IINA 4FH5A 4WC2A 7ICJA 4PHAA 1MQ2A 4WC6A 5BPCA 4P2HA 4X4QA 2BPCA 4YN4A 4MFAA 3PMNA 4YD2A 4FHWA 4I2FA 4QZ8A 1ZQYA 3WFQE 4IG8A 5DECA 1MIYA 4RQ5A 8ICOA 8ICGA 9ICFA 4KLDA 4QZEA 4X5VA 5J0YA 8ICFA 5J2EA 4TUPA 4F5OA 2ZH2A 4RWNA 4Z6CA 5J0QA 4PH5A 2ZH4A 4Z6EA 2PFQA 3RJGA 9ICRA 5J2IA 4LVSA 4UAYA 4Z6FA 4P4OA 5DB9A 4FHYA 4PGYA 4M9GA 2NRKA 1YLQA 3H3AA 4K4HA 3LQCB 5CA7A 3JYYA 9ICKA 3UQ2A 5HHHA 4NKUA 3AQMA 4NY8A 5HRHA 2DRBA 4I28A 4O5CA 7ICLA 1Q79A 1ZJNA 2HHPA 4KLFA 8ICEA 4P4MA 4XUSA 2ZH7A 4K4GA 9ICJA 4LZGA 2M2UA 5HRBA 2M2WA 5J0OA 1ZQMA 4M9NA 8ICRA 3RH4A 5CWRA 4UB3A 4AT8A 1JAJA 2ISOA 3RH6A 1ZJMA 9ICWA 3UXNA 4NLZA 4S3NA 3RH5A 4M04A 4PHEA 3B0XA 3JPQA 4QZ9A 7ICUA 2DRAA 3C5GA 4RQ6A 1ZQNA 4FH3A 9ICOA 8ICAA 2ID1A 5HRIA 4AT9A 4IQTA 2P66A 5BOLA 4UB1A 4JWNA 4I2JA 3AQLA 1KDHA 4RQ4A 4RQ8A 3WFRE 4MF2A 5IILA 5J0RA 4YD1A 4GXKA 1R8AA 4I2IA 5IIMA 1ZQBA 4KLOA 8ICYA
chains in the Genus database with same CATH superfamily
4KLHA 4O69A 3OWGA 4E80A 4X4SA 2ZH5A 5CJ7A 4NLKA 4DOCA 3AQNA 4QZAA 1ZQHA 4NM2A 4YMOA 4NXXA 4F5PA 8ICCA 4M5DA 5IIIA 4WC3A 4X4RA 2BE3A 4K97A 5DDYA 4WC0A 5J2DA 2ISPA 3ISDA 2PFPA 5IIKA 1RZTA 2ZHBA 2ZH8A 4X4OA 3OVAA 1ZQUA 4WH5A 4PPXA 2B56A 3UXPA 1MQ3A 5J0SA 3K75D 3JPPA 5DBCA 1TFWA 4AT8B 4E8FA 4DOBA 8ICVA 4GXJA 4I2BA 5CHGA 8ICQA 3C66A 4K8VA 1ZQTA 4LEVA 3MCRA 1BPDA 5J2JA 7ICIA 1BPEA 4IQUA 3V7JA 1UEUA 4I2GA 4KLSA 7ICTA 4NXTA 5J2KA 4RT3A 1BPYA 3MBYA 3RJIA 4AT9B 9ICTA 4I0UA 1ZQXA 4YMMA 7ICMA 3UQ0A 1XSNA 9ICCA 2BCSA 5D46A 2BCRA 4PGQA 4RT2A 4WC7A 4OAIZ 4HX0A 2GWSA 4KLMA 1TFYA 1XSPA 4AT7A 4I2EA 3UXOA 2B51A 4NXUA 4IQWA 4FHVA 4M0AA 4M9LA 3UPSA 4UAWA 4TUSA 3ISBA 4K99A 2M2TA 2ZH6A 4O5KA 1BPBA 4TURA 3RJJA 1ZQEA 1ZQAA 1ZQGA 9ICPA 4EV6A 4YCXA 4X0AA 5EOZA 3CK6A 4QZGA 2I9GA 2PFOA 9ICLA 3UPQA 4M9HA 4UD5A 4K96A 4I27A 4K4IA 4I2DA 5CFSA 3PMLA 4K9AA 4Z6DA 4DOAA 2ZH3A 5B3QA 2DR5A 4PGXA 5DB7A 5D4BA 4M9JA 3RJKA 3H38A 1KNYA 3AU6A 1XSLA 3ISCA 1V4AA 1VFGA 5J0WA 4MF8A 1BPXA 8ICZA 4RWOA 2BCUA 3MGIA 4O5EA 8ICWA 5CR0A 4OAFA 5J2BA 2PBEA 5CFUA 7ICEA 4KLQA 2ZH9A 9ICGA 5TZVA 4RQ0A 4NLNA 4EGWA 1ZQPA 4F5QA 4E7XA 4KLUA 8ICJA 1WOTA 5F2VO 4X4NA 5BOMA 3JPOA 3EF2A 4KLLA 3ER8C 2ZH1A 2DR9A 5HRGA 1PX5A 4WBYA 4AT7B 9ICAA 1FA0A 3L9DA 7ICQA 8ICPA 4TUQA 9ICXA 5D63A 8ICKA 1HUOA 3WFSC 7ICNA 4UBCA 3V72A 9ICBA 1JN3A 1ZQVA 4FHXA 4EBJA 4F5RA 4IQVA 5IIOA 5DBBA 3WFOA 1ZQDA 4WBZA 5HR9A 2DR7A 8ICIA 3B0YA 7ICGA 4EBKA 3HJ4A 4QZCA 2BPFA 7ICFA 2ZHAA 5DDMA 5HC9A 4X4UA 1TV9A 2DVIA 4JWMA 4O68A 2Q66A 9ICMA 9ICUA 8ICLA 1Q78A 4FO6A 2BBHA 1ZQKA 3K7DA 4RPYA 4NXZA 1OU5A 1MIWA 1NO5A 7ICHA 4QZDA 4JLXA 2HN2A 1KEJA 3GDXA 1HUZA 3OGUA 4NXVA 1JQRA 4UAZA 2M2VA 2FMQA 3HWTA 3MDAA 7ICVA 4XQ8A 2BBJA 3V7KA 5J2FA 3HIYA 3OUYA 3PNCA 2FMPA 5HHIA 9ICVA 9ICSA 3MGHA 4KLGA 3TFRA 7ICOA 4QZBA 4I2CA 5J0XA 4FHPA 4MFCA 3RJEA 1ZQQA 5D49A 5HRFA 4R63A 2BPGA 4I2HA 5J2AA 9ICQA 2BCQA 3ER9B 4RQ3A 4M47A 3PHZA 2O1PA 5DBAA 4R65A 3MDCA 2B4VA 4X0BA 4R66A 7ICPA 4OAHA 4I29A 3TFSA 4UBBA 5HREA 3C2KA 4RWPA 4LT6A 8ICSA 4M2YA 4RQ1A 8ICNA 4KLJA 2PXIA 1R89A 4UD4A 3C5FA 4LZDA 4UB2A 2RFFA 3AU2A 4NM1A 4UB4A 4WCWA 5J0TA 4YMNA 5IIJA 1MIVA 4NXWA 4ATBA 2GAFD 2PFNA 3H39A 4RQ7A 4X4PA 4XRHA 1F5AA 2FMSA 9ICNA 4NKTA 4X4VA 4X4TA 5DKWA 1BPZA 4XQ7A 4P4PA 2FCLA 1ZQLA 4OAGA 4I2AA 1ZQJA 5HRKA 3JPSA 4PHDA 1ZQIA 4KLIA 4DO9A 4WC4A 3C2MA 3JPNA 8ICMA 3WFPA 1TVAA 2HN1A 5J29A 3OUYB 5CFTA 4RPZA 4KLEA 3JZ0A 3C2LA 7ICSA 4WC5A 3HJ1A 3NYBA 4QZFA 4KLTA 7ICKA 1JMSA 2IHMA 2DR8A 4RQ2A 3H37A 4KM5A 9ICHA 2O5AA 4KB6A 5J0PA 3AQKA 5J2CA 1ZQWA 2W9MA 8ICUA 3C18A 1UEVA 4N7RA 2IUBA 3JCFA 1VJ7A 5DEDA 3V7LA 4LEYA 4QZHA 9ICIA 1ZQCA 1ZQRA 9ICEA 1R8CA 5J2HA 4RWQA 1ZQSA 4RPXA 3RJHA 4QZIA 4GXIA 4O9MA 3AUOA 5D61A 4WC1A 1ZQOA 3OVBA 4MKPA 1ZQFA 3HX0A 4EP7A 3OV7A 2BCVA 4K9BA 4JLZA 8ICTA 4FO1A 3OVSA 5CP2A 2IHOA 3RJFA 8ICXA 1NOMA 5HRDA 3LK9A 7ICRA 5DB6A 5CB1A 5J2GA 4UB5A 3JPRA 4ATBB 5HRLA 5DB8A 8ICBA 5D62A 1UETA 3JPTA 4R64A 4F5NA 4PHPA 2VANA 5J0UA 3HW8A 1R8BA 1ZQZA 4XA5A 4MFFA 1RPLA 8ICHA 5IINA 4FH5A 4WC2A 7ICJA 4PHAA 1MQ2A 4WC6A 3NVOA 5BPCA 4P2HA 4X4QA 2BPCA 4YN4A 4MFAA 2GA9D 2EWRA 3PMNA 4YD2A 4FHWA 4I2FA 4QZ8A 1ZQYA 3WFQE 4IG8A 4O6AA 5DECA 1MIYA 4EEBA 4RQ5A 8ICOA 8ICGA 9ICFA 4KLDA 4QZEA 4X5VA 5J0YA 8ICFA 5JTGA 5J2EA 4TUPA 4F5OA 2ZH2A 4RWNA 4Z6CA 5J0QA 4PH5A 4K98A 2ZH4A 4Z6EA 2PFQA 3RJGA 9ICRA 5J2IA 4LVSA 4UAYA 4Z6FA 4P4OA 5DB9A 4XJEA 4FHYA 4PGYA 4M9GA 2NRKA 4WQKA 1YLQA 3H3AA 4K4HA 3LQCB 5CA7A 3JYYA 9ICKA 3UQ2A 5CHEA 5HHHA 4NKUA 3AQMA 4NY8A 5HRHA 2DRBA 4I28A 4O5CA 7ICLA 1GPJA 1Q79A 3NKUA 1ZJNA 2HHPA 4KLFA 8ICEA 4P4MA 5B3PA 4XUSA 2ZH7A 4K4GA 9ICJA 4LZGA 2M2UA 5HRBA 2M2WA 5J0OA 1ZQMA 4M9NA 8ICRA 4LEWA 3RH4A 5CWRA 4UB3A 3NWIA 4AT8A 4O67A 1JAJA 4WOYA 2ISOA 3RH6A 4EEDA 1ZJMA 9ICWA 3UXNA 4NLZA 4S3NA 3RH5A 4M04A 4PHEA 3B0XA 3JPQA 4QZ9A 7ICUA 2DRAA 3C5GA 4RQ6A 1ZQNA 4FH3A 9ICOA 8ICAA 2ID1A 3ERCC 5HRIA 4AT9A 4IQTA 2P66A 5BOLA 4UB1A 4JWNA 4I2JA 3AQLA 1KDHA 4RQ4A 4RQ8A 3WFRE 4WQLA 4MF2A 5IILA 5J0RA 4YD1A 4GXKA 1R8AA 4LEZA 4I2IA 5IIMA 1ZQBA 4KLOA 8ICYA
chains in the Genus database with same CATH topology
4KLHA 4E80A 4X4SA 2ZH5A 5CJ7A 4NLKA 4DOCA 3AQNA 4QZAA 1ZQHA 4NM2A 4YMOA 4M5DA 4F5PA 8ICCA 5IIIA 4WC3A 4X4RA 2BE3A 5DDYA 4WC0A 5J2DA 2ISPA 3ISDA 2PFPA 5IIKA 1RZTA 2ZHBA 2ZH8A 4X4OA 3OVAA 1ZQUA 4PPXA 3UXPA 1MQ3A 5J0SA 3K75D 3JPPA 5DBCA 1TFWA 4AT8B 4E8FA 4DOBA 8ICVA 4GXJA 4I2BA 5CHGA 8ICQA 3C66A 1ZQTA 1BPDA 5J2JA 7ICIA 1BPEA 4IQUA 3V7JA 1UEUA 4I2GA 4KLSA 7ICTA 5J2KA 4RT3A 1BPYA 3MBYA 3RJIA 4AT9B 9ICTA 1ZQXA 4YMMA 7ICMA 3UQ0A 1XSNA 9ICCA 2BCSA 5D46A 2BCRA 4PGQA 4RT2A 4WC7A 2GWSA 4KLMA 1TFYA 1XSPA 4AT7A 4I2EA 3UXOA 4IQWA 4FHVA 4M0AA 4M9LA 3UPSA 4UAWA 4TUSA 3ISBA 2M2TA 2ZH6A 4O5KA 1BPBA 4TURA 3RJJA 1ZQEA 1ZQAA 1ZQGA 9ICPA 4YCXA 4X0AA 5EOZA 4QZGA 2I9GA 2PFOA 9ICLA 3UPQA 4M9HA 4UD5A 4I27A 4K4IA 4I2DA 3PMLA 4Z6DA 4DOAA 2ZH3A 2DR5A 4PGXA 5DB7A 5D4BA 4M9JA 3RJKA 3H38A 1KNYA 3AU6A 1XSLA 3ISCA 1V4AA 1VFGA 5J0WA 4MF8A 1BPXA 8ICZA 4RWOA 2BCUA 3MGIA 4O5EA 8ICWA 5CR0A 5J2BA 2PBEA 7ICEA 4KLQA 2ZH9A 9ICGA 5TZVA 4RQ0A 4NLNA 1ZQPA 4F5QA 4E7XA 4KLUA 8ICJA 1WOTA 5F2VO 4X4NA 5BOMA 3JPOA 4KLLA 2ZH1A 2DR9A 5HRGA 1PX5A 4WBYA 4AT7B 9ICAA 1FA0A 3L9DA 7ICQA 8ICPA 4TUQA 9ICXA 8ICKA 1HUOA 3WFSC 7ICNA 4UBCA 3V72A 9ICBA 1JN3A 1ZQVA 4FHXA 4EBJA 4F5RA 4IQVA 5IIOA 5DBBA 3WFOA 1ZQDA 4WBZA 5HR9A 2DR7A 8ICIA 3B0YA 7ICGA 4EBKA 3HJ4A 4QZCA 2BPFA 7ICFA 2ZHAA 5DDMA 5HC9A 4X4UA 1TV9A 2DVIA 4JWMA 2Q66A 9ICMA 9ICUA 8ICLA 1Q78A 4FO6A 1ZQKA 4RPYA 4NXZA 1OU5A 1MIWA 1NO5A 7ICHA 4QZDA 1KEJA 3GDXA 1HUZA 3OGUA 1JQRA 4UAZA 2M2VA 2FMQA 3HWTA 3MDAA 7ICVA 4XQ8A 3V7KA 5J2FA 3HIYA 3OUYA 3PNCA 2FMPA 5HHIA 9ICVA 9ICSA 3MGHA 4KLGA 3TFRA 7ICOA 4QZBA 4I2CA 5J0XA 4FHPA 4MFCA 3RJEA 1ZQQA 5D49A 5HRFA 4R63A 2BPGA 4I2HA 5J2AA 9ICQA 2BCQA 4RQ3A 4M47A 2O1PA 5DBAA 4R65A 3MDCA 4X0BA 4R66A 7ICPA 4I29A 3TFSA 4UBBA 5HREA 3C2KA 4RWPA 4LT6A 8ICSA 4M2YA 4RQ1A 8ICNA 4KLJA 2PXIA 1R89A 4UD4A 3C5FA 4LZDA 4UB2A 2RFFA 3AU2A 4NM1A 4UB4A 4WCWA 5J0TA 4YMNA 5IIJA 1MIVA 4ATBA 2PFNA 3H39A 4RQ7A 4X4PA 4XRHA 1F5AA 2FMSA 9ICNA 4NKTA 4X4VA 4X4TA 5DKWA 1BPZA 4XQ7A 4P4PA 1ZQLA 4I2AA 1ZQJA 5HRKA 3JPSA 4PHDA 1ZQIA 4KLIA 4DO9A 4WC4A 3C2MA 3JPNA 8ICMA 3WFPA 1TVAA 5J29A 3OUYB 4RPZA 4KLEA 3JZ0A 3C2LA 7ICSA 4WC5A 3HJ1A 3NYBA 4QZFA 4KLTA 7ICKA 1JMSA 2IHMA 2DR8A 4RQ2A 3H37A 9ICHA 2O5AA 5J0PA 3AQKA 5J2CA 1ZQWA 2W9MA 8ICUA 3C18A 1UEVA 1VJ7A 5DEDA 3V7LA 4QZHA 9ICIA 1ZQCA 1ZQRA 9ICEA 1R8CA 5J2HA 4RWQA 1ZQSA 4RPXA 3RJHA 4QZIA 4GXIA 4O9MA 3AUOA 3OVBA 4WC1A 1ZQOA 1ZQFA 3HX0A 4EP7A 3OV7A 2BCVA 8ICTA 3OVSA 5CP2A 3RJFA 8ICXA 1NOMA 5HRDA 3LK9A 7ICRA 5DB6A 5CB1A 5J2GA 4UB5A 3JPRA 4ATBB 5HRLA 5DB8A 8ICBA 1UETA 3JPTA 4R64A 4F5NA 4PHPA 2VANA 5J0UA 3HW8A 1R8BA 1ZQZA 4XA5A 4MFFA 1RPLA 8ICHA 5IINA 4FH5A 4WC2A 7ICJA 4PHAA 1MQ2A 4WC6A 5BPCA 4P2HA 4X4QA 2BPCA 4YN4A 4MFAA 3PMNA 4YD2A 4FHWA 4I2FA 4QZ8A 1ZQYA 3WFQE 4IG8A 5DECA 1MIYA 4RQ5A 8ICOA 8ICGA 9ICFA 4KLDA 4QZEA 4X5VA 5J0YA 8ICFA 5J2EA 4TUPA 4F5OA 2ZH2A 4RWNA 4Z6CA 5J0QA 4PH5A 2ZH4A 4Z6EA 2PFQA 3RJGA 9ICRA 5J2IA 4LVSA 4UAYA 4Z6FA 4P4OA 5DB9A 4FHYA 4PGYA 4M9GA 2NRKA 1YLQA 3H3AA 4K4HA 3LQCB 5CA7A 3JYYA 9ICKA 3UQ2A 5HHHA 4NKUA 3AQMA 4NY8A 5HRHA 2DRBA 4I28A 4O5CA 7ICLA 1Q79A 1ZJNA 2HHPA 4KLFA 8ICEA 4P4MA 4XUSA 2ZH7A 4K4GA 9ICJA 4LZGA 2M2UA 5HRBA 2M2WA 5J0OA 1ZQMA 4M9NA 8ICRA 3RH4A 5CWRA 4UB3A 4AT8A 1JAJA 2ISOA 3RH6A 1ZJMA 9ICWA 3UXNA 4NLZA 4S3NA 3RH5A 4M04A 4PHEA 3B0XA 3JPQA 4QZ9A 7ICUA 2DRAA 3C5GA 4RQ6A 1ZQNA 4FH3A 9ICOA 8ICAA 2ID1A 5HRIA 4AT9A 4IQTA 2P66A 5BOLA 4UB1A 4JWNA 4I2JA 3AQLA 1KDHA 4RQ4A 4RQ8A 3WFRE 4MF2A 5IILA 5J0RA 4YD1A 4GXKA 1R8AA 4I2IA 5IIMA 1ZQBA 4KLOA 8ICYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLH A;  4E80 A;  4X4S A;  2ZH5 A;  5CJ7 A;  4NLK A;  4DOC A;  3AQN A;  4QZA A;  1ZQH A;  4NM2 A;  4YMO A;  4M5D A;  4F5P A;  8ICC A;  5III A;  4WC3 A;  4X4R A;  2BE3 A;  5DDY A;  4WC0 A;  5J2D A;  2ISP A;  3ISD A;  2PFP A;  5IIK A;  1RZT A;  2ZHB A;  2ZH8 A;  4X4O A;  3OVA A;  1ZQU A;  4PPX A;  3UXP A;  1MQ3 A;  5J0S A;  3K75 D;  3JPP A;  5DBC A;  1TFW A;  4AT8 B;  4E8F A;  4DOB A;  8ICV A;  4GXJ A;  4I2B A;  5CHG A;  8ICQ A;  3C66 A;  1ZQT A;  1BPD A;  5J2J A;  7ICI A;  1BPE A;  4IQU A;  3V7J A;  1UEU A;  4I2G A;  4KLS A;  7ICT A;  5J2K A;  4RT3 A;  1BPY A;  3MBY A;  3RJI A;  4AT9 B;  9ICT A;  1ZQX A;  4YMM A;  7ICM A;  3UQ0 A;  1XSN A;  9ICC A;  2BCS A;  5D46 A;  2BCR A;  4PGQ A;  4RT2 A;  4WC7 A;  2GWS A;  4KLM A;  1TFY A;  1XSP A;  4AT7 A;  4I2E A;  3UXO A;  4IQW A;  4FHV A;  4M0A A;  4M9L A;  3UPS A;  4UAW A;  4TUS A;  3ISB A;  2M2T A;  2ZH6 A;  4O5K A;  1BPB A;  4TUR A;  3RJJ A;  1ZQE A;  1ZQA A;  1ZQG A;  9ICP A;  4YCX A;  4X0A A;  5EOZ A;  4QZG A;  2I9G A;  2PFO A;  9ICL A;  3UPQ A;  4M9H A;  4UD5 A;  4I27 A;  4K4I A;  4I2D A;  3PML A;  4Z6D A;  4DOA A;  2ZH3 A;  2DR5 A;  4PGX A;  5DB7 A;  5D4B A;  4M9J A;  3RJK A;  3H38 A;  1KNY A;  3AU6 A;  1XSL A;  3ISC A;  1V4A A;  1VFG A;  5J0W A;  4MF8 A;  1BPX A;  8ICZ A;  4RWO A;  2BCU A;  3MGI A;  4O5E A;  8ICW A;  5CR0 A;  5J2B A;  2PBE A;  7ICE A;  4KLQ A;  2ZH9 A;  9ICG A;  5TZV A;  4RQ0 A;  4NLN A;  1ZQP A;  4F5Q A;  4E7X A;  4KLU A;  8ICJ A;  1WOT A;  5F2V O;  4X4N A;  5BOM A;  3JPO A;  4KLL A;  2ZH1 A;  2DR9 A;  5HRG A;  1PX5 A;  4WBY A;  4AT7 B;  9ICA A;  1FA0 A;  3L9D A;  7ICQ A;  8ICP A;  4TUQ A;  9ICX A;  8ICK A;  1HUO A;  3WFS C;  7ICN A;  4UBC A;  3V72 A;  9ICB A;  1JN3 A;  1ZQV A;  4FHX A;  4EBJ A;  4F5R A;  4IQV A;  5IIO A;  5DBB A;  3WFO A;  1ZQD A;  4WBZ A;  5HR9 A;  2DR7 A;  8ICI A;  3B0Y A;  7ICG A;  4EBK A;  3HJ4 A;  4QZC A;  2BPF A;  7ICF A;  2ZHA A;  5DDM A;  5HC9 A;  4X4U A;  1TV9 A;  2DVI A;  4JWM A;  2Q66 A;  9ICM A;  9ICU A;  8ICL A;  1Q78 A;  4FO6 A;  1ZQK A;  4RPY A;  4NXZ A;  1OU5 A;  1MIW A;  1NO5 A;  7ICH A;  4QZD A;  1KEJ A;  3GDX A;  1HUZ A;  3OGU A;  1JQR A;  4UAZ A;  2M2V A;  2FMQ A;  3HWT A;  3MDA A;  7ICV A;  4XQ8 A;  3V7K A;  5J2F A;  3HIY A;  3OUY A;  3PNC A;  2FMP A;  5HHI A;  9ICV A;  9ICS A;  3MGH A;  4KLG A;  3TFR A;  7ICO A;  4QZB A;  4I2C A;  5J0X A;  4FHP A;  4MFC A;  3RJE A;  1ZQQ A;  5D49 A;  5HRF A;  4R63 A;  2BPG A;  4I2H A;  5J2A A;  9ICQ A;  2BCQ A;  4RQ3 A;  4M47 A;  2O1P A;  5DBA A;  4R65 A;  3MDC A;  4X0B A;  4R66 A;  7ICP A;  4I29 A;  3TFS A;  4UBB A;  5HRE A;  3C2K A;  4RWP A;  4LT6 A;  8ICS A;  4M2Y A;  4RQ1 A;  8ICN A;  4KLJ A;  2PXI A;  1R89 A;  4UD4 A;  3C5F A;  4LZD A;  4UB2 A;  2RFF A;  3AU2 A;  4NM1 A;  4UB4 A;  4WCW A;  5J0T A;  4YMN A;  5IIJ A;  1MIV A;  4ATB A;  2PFN A;  3H39 A;  4RQ7 A;  4X4P A;  4XRH A;  1F5A A;  2FMS A;  9ICN A;  4NKT A;  4X4V A;  4X4T A;  5DKW A;  1BPZ A;  4XQ7 A;  4P4P A;  1ZQL A;  4I2A A;  1ZQJ A;  5HRK A;  3JPS A;  4PHD A;  1ZQI A;  4KLI A;  4DO9 A;  4WC4 A;  3C2M A;  3JPN A;  8ICM A;  3WFP A;  1TVA A;  5J29 A;  3OUY B;  4RPZ A;  4KLE A;  3JZ0 A;  3C2L A;  7ICS A;  4WC5 A;  3HJ1 A;  3NYB A;  4QZF A;  4KLT A;  7ICK A;  1JMS A;  2IHM A;  2DR8 A;  4RQ2 A;  3H37 A;  9ICH A;  2O5A A;  5J0P A;  3AQK A;  5J2C A;  1ZQW A;  2W9M A;  8ICU A;  3C18 A;  1UEV A;  1VJ7 A;  5DED A;  3V7L A;  4QZH A;  9ICI A;  1ZQC A;  1ZQR A;  9ICE A;  1R8C A;  5J2H A;  4RWQ A;  1ZQS A;  4RPX A;  3RJH A;  4QZI A;  4GXI A;  4O9M A;  3AUO A;  3OVB A;  4WC1 A;  1ZQO A;  1ZQF A;  3HX0 A;  4EP7 A;  3OV7 A;  2BCV A;  8ICT A;  3OVS A;  5CP2 A;  3RJF A;  8ICX A;  1NOM A;  5HRD A;  3LK9 A;  7ICR A;  5DB6 A;  5CB1 A;  5J2G A;  4UB5 A;  3JPR A;  4ATB B;  5HRL A;  5DB8 A;  8ICB A;  1UET A;  3JPT A;  4R64 A;  4F5N A;  4PHP A;  2VAN A;  5J0U A;  3HW8 A;  1R8B A;  1ZQZ A;  4XA5 A;  4MFF A;  1RPL A;  8ICH A;  5IIN A;  4FH5 A;  4WC2 A;  7ICJ A;  4PHA A;  1MQ2 A;  4WC6 A;  5BPC A;  4P2H A;  4X4Q A;  2BPC A;  4YN4 A;  4MFA A;  3PMN A;  4YD2 A;  4FHW A;  4I2F A;  4QZ8 A;  1ZQY A;  3WFQ E;  4IG8 A;  5DEC A;  1MIY A;  4RQ5 A;  8ICO A;  8ICG A;  9ICF A;  4KLD A;  4QZE A;  4X5V A;  5J0Y A;  8ICF A;  5J2E A;  4TUP A;  4F5O A;  2ZH2 A;  4RWN A;  4Z6C A;  5J0Q A;  4PH5 A;  2ZH4 A;  4Z6E A;  2PFQ A;  3RJG A;  9ICR A;  5J2I A;  4LVS A;  4UAY A;  4Z6F A;  4P4O A;  5DB9 A;  4FHY A;  4PGY A;  4M9G A;  2NRK A;  1YLQ A;  3H3A A;  4K4H A;  3LQC B;  5CA7 A;  3JYY A;  9ICK A;  3UQ2 A;  5HHH A;  4NKU A;  3AQM A;  4NY8 A;  5HRH A;  2DRB A;  4I28 A;  4O5C A;  7ICL A;  1Q79 A;  1ZJN A;  2HHP A;  4KLF A;  8ICE A;  4P4M A;  4XUS A;  2ZH7 A;  4K4G A;  9ICJ A;  4LZG A;  2M2U A;  5HRB A;  2M2W A;  5J0O A;  1ZQM A;  4M9N A;  8ICR A;  3RH4 A;  5CWR A;  4UB3 A;  4AT8 A;  1JAJ A;  2ISO A;  3RH6 A;  1ZJM A;  9ICW A;  3UXN A;  4NLZ A;  4S3N A;  3RH5 A;  4M04 A;  4PHE A;  3B0X A;  3JPQ A;  4QZ9 A;  7ICU A;  2DRA A;  3C5G A;  4RQ6 A;  1ZQN A;  4FH3 A;  9ICO A;  8ICA A;  2ID1 A;  5HRI A;  4AT9 A;  4IQT A;  2P66 A;  5BOL A;  4UB1 A;  4JWN A;  4I2J A;  3AQL A;  1KDH A;  4RQ4 A;  4RQ8 A;  3WFR E;  4MF2 A;  5IIL A;  5J0R A;  4YD1 A;  4GXK A;  1R8A A;  4I2I A;  5IIM A;  1ZQB A;  4KLO A;  8ICY A; 
#chains in the Genus database with same CATH topology
 4KLH A;  4O69 A;  3OWG A;  4E80 A;  4X4S A;  2ZH5 A;  5CJ7 A;  4NLK A;  4DOC A;  3AQN A;  4QZA A;  1ZQH A;  4NM2 A;  4YMO A;  4NXX A;  4F5P A;  8ICC A;  4M5D A;  5III A;  4WC3 A;  4X4R A;  2BE3 A;  4K97 A;  5DDY A;  4WC0 A;  5J2D A;  2ISP A;  3ISD A;  2PFP A;  5IIK A;  1RZT A;  2ZHB A;  2ZH8 A;  4X4O A;  3OVA A;  1ZQU A;  4WH5 A;  4PPX A;  2B56 A;  3UXP A;  1MQ3 A;  5J0S A;  3K75 D;  3JPP A;  5DBC A;  1TFW A;  4AT8 B;  4E8F A;  4DOB A;  8ICV A;  4GXJ A;  4I2B A;  5CHG A;  8ICQ A;  3C66 A;  4K8V A;  1ZQT A;  4LEV A;  3MCR A;  1BPD A;  5J2J A;  7ICI A;  1BPE A;  4IQU A;  3V7J A;  1UEU A;  4I2G A;  4KLS A;  7ICT A;  4NXT A;  5J2K A;  4RT3 A;  1BPY A;  3MBY A;  3RJI A;  4AT9 B;  9ICT A;  4I0U A;  1ZQX A;  4YMM A;  7ICM A;  3UQ0 A;  1XSN A;  9ICC A;  2BCS A;  5D46 A;  2BCR A;  4PGQ A;  4RT2 A;  4WC7 A;  4OAI Z;  4HX0 A;  2GWS A;  4KLM A;  1TFY A;  1XSP A;  4AT7 A;  4I2E A;  3UXO A;  2B51 A;  4NXU A;  4IQW A;  4FHV A;  4M0A A;  4M9L A;  3UPS A;  4UAW A;  4TUS A;  3ISB A;  4K99 A;  2M2T A;  2ZH6 A;  4O5K A;  1BPB A;  4TUR A;  3RJJ A;  1ZQE A;  1ZQA A;  1ZQG A;  9ICP A;  4EV6 A;  4YCX A;  4X0A A;  5EOZ A;  3CK6 A;  4QZG A;  2I9G A;  2PFO A;  9ICL A;  3UPQ A;  4M9H A;  4UD5 A;  4K96 A;  4I27 A;  4K4I A;  4I2D A;  5CFS A;  3PML A;  4K9A A;  4Z6D A;  4DOA A;  2ZH3 A;  5B3Q A;  2DR5 A;  4PGX A;  5DB7 A;  5D4B A;  4M9J A;  3RJK A;  3H38 A;  1KNY A;  3AU6 A;  1XSL A;  3ISC A;  1V4A A;  1VFG A;  5J0W A;  4MF8 A;  1BPX A;  8ICZ A;  4RWO A;  2BCU A;  3MGI A;  4O5E A;  8ICW A;  5CR0 A;  4OAF A;  5J2B A;  2PBE A;  5CFU A;  7ICE A;  4KLQ A;  2ZH9 A;  9ICG A;  5TZV A;  4RQ0 A;  4NLN A;  4EGW A;  1ZQP A;  4F5Q A;  4E7X A;  4KLU A;  8ICJ A;  1WOT A;  5F2V O;  4X4N A;  5BOM A;  3JPO A;  3EF2 A;  4KLL A;  3ER8 C;  2ZH1 A;  2DR9 A;  5HRG A;  1PX5 A;  4WBY A;  4AT7 B;  9ICA A;  1FA0 A;  3L9D A;  7ICQ A;  8ICP A;  4TUQ A;  9ICX A;  5D63 A;  8ICK A;  1HUO A;  3WFS C;  7ICN A;  4UBC A;  3V72 A;  9ICB A;  1JN3 A;  1ZQV A;  4FHX A;  4EBJ A;  4F5R A;  4IQV A;  5IIO A;  5DBB A;  3WFO A;  1ZQD A;  4WBZ A;  5HR9 A;  2DR7 A;  8ICI A;  3B0Y A;  7ICG A;  4EBK A;  3HJ4 A;  4QZC A;  2BPF A;  7ICF A;  2ZHA A;  5DDM A;  5HC9 A;  4X4U A;  1TV9 A;  2DVI A;  4JWM A;  4O68 A;  2Q66 A;  9ICM A;  9ICU A;  8ICL A;  1Q78 A;  4FO6 A;  2BBH A;  1ZQK A;  3K7D A;  4RPY A;  4NXZ A;  1OU5 A;  1MIW A;  1NO5 A;  7ICH A;  4QZD A;  4JLX A;  2HN2 A;  1KEJ A;  3GDX A;  1HUZ A;  3OGU A;  4NXV A;  1JQR A;  4UAZ A;  2M2V A;  2FMQ A;  3HWT A;  3MDA A;  7ICV A;  4XQ8 A;  2BBJ A;  3V7K A;  5J2F A;  3HIY A;  3OUY A;  3PNC A;  2FMP A;  5HHI A;  9ICV A;  9ICS A;  3MGH A;  4KLG A;  3TFR A;  7ICO A;  4QZB A;  4I2C A;  5J0X A;  4FHP A;  4MFC A;  3RJE A;  1ZQQ A;  5D49 A;  5HRF A;  4R63 A;  2BPG A;  4I2H A;  5J2A A;  9ICQ A;  2BCQ A;  3ER9 B;  4RQ3 A;  4M47 A;  3PHZ A;  2O1P A;  5DBA A;  4R65 A;  3MDC A;  2B4V A;  4X0B A;  4R66 A;  7ICP A;  4OAH A;  4I29 A;  3TFS A;  4UBB A;  5HRE A;  3C2K A;  4RWP A;  4LT6 A;  8ICS A;  4M2Y A;  4RQ1 A;  8ICN A;  4KLJ A;  2PXI A;  1R89 A;  4UD4 A;  3C5F A;  4LZD A;  4UB2 A;  2RFF A;  3AU2 A;  4NM1 A;  4UB4 A;  4WCW A;  5J0T A;  4YMN A;  5IIJ A;  1MIV A;  4NXW A;  4ATB A;  2GAF D;  2PFN A;  3H39 A;  4RQ7 A;  4X4P A;  4XRH A;  1F5A A;  2FMS A;  9ICN A;  4NKT A;  4X4V A;  4X4T A;  5DKW A;  1BPZ A;  4XQ7 A;  4P4P A;  2FCL A;  1ZQL A;  4OAG A;  4I2A A;  1ZQJ A;  5HRK A;  3JPS A;  4PHD A;  1ZQI A;  4KLI A;  4DO9 A;  4WC4 A;  3C2M A;  3JPN A;  8ICM A;  3WFP A;  1TVA A;  2HN1 A;  5J29 A;  3OUY B;  5CFT A;  4RPZ A;  4KLE A;  3JZ0 A;  3C2L A;  7ICS A;  4WC5 A;  3HJ1 A;  3NYB A;  4QZF A;  4KLT A;  7ICK A;  1JMS A;  2IHM A;  2DR8 A;  4RQ2 A;  3H37 A;  4KM5 A;  9ICH A;  2O5A A;  4KB6 A;  5J0P A;  3AQK A;  5J2C A;  1ZQW A;  2W9M A;  8ICU A;  3C18 A;  1UEV A;  4N7R A;  2IUB A;  3JCF A;  1VJ7 A;  5DED A;  3V7L A;  4LEY A;  4QZH A;  9ICI A;  1ZQC A;  1ZQR A;  9ICE A;  1R8C A;  5J2H A;  4RWQ A;  1ZQS A;  4RPX A;  3RJH A;  4QZI A;  4GXI A;  4O9M A;  3AUO A;  5D61 A;  4WC1 A;  1ZQO A;  3OVB A;  4MKP A;  1ZQF A;  3HX0 A;  4EP7 A;  3OV7 A;  2BCV A;  4K9B A;  4JLZ A;  8ICT A;  4FO1 A;  3OVS A;  5CP2 A;  2IHO A;  3RJF A;  8ICX A;  1NOM A;  5HRD A;  3LK9 A;  7ICR A;  5DB6 A;  5CB1 A;  5J2G A;  4UB5 A;  3JPR A;  4ATB B;  5HRL A;  5DB8 A;  8ICB A;  5D62 A;  1UET A;  3JPT A;  4R64 A;  4F5N A;  4PHP A;  2VAN A;  5J0U A;  3HW8 A;  1R8B A;  1ZQZ A;  4XA5 A;  4MFF A;  1RPL A;  8ICH A;  5IIN A;  4FH5 A;  4WC2 A;  7ICJ A;  4PHA A;  1MQ2 A;  4WC6 A;  3NVO A;  5BPC A;  4P2H A;  4X4Q A;  2BPC A;  4YN4 A;  4MFA A;  2GA9 D;  2EWR A;  3PMN A;  4YD2 A;  4FHW A;  4I2F A;  4QZ8 A;  1ZQY A;  3WFQ E;  4IG8 A;  4O6A A;  5DEC A;  1MIY A;  4EEB A;  4RQ5 A;  8ICO A;  8ICG A;  9ICF A;  4KLD A;  4QZE A;  4X5V A;  5J0Y A;  8ICF A;  5JTG A;  5J2E A;  4TUP A;  4F5O A;  2ZH2 A;  4RWN A;  4Z6C A;  5J0Q A;  4PH5 A;  4K98 A;  2ZH4 A;  4Z6E A;  2PFQ A;  3RJG A;  9ICR A;  5J2I A;  4LVS A;  4UAY A;  4Z6F A;  4P4O A;  5DB9 A;  4XJE A;  4FHY A;  4PGY A;  4M9G A;  2NRK A;  4WQK A;  1YLQ A;  3H3A A;  4K4H A;  3LQC B;  5CA7 A;  3JYY A;  9ICK A;  3UQ2 A;  5CHE A;  5HHH A;  4NKU A;  3AQM A;  4NY8 A;  5HRH A;  2DRB A;  4I28 A;  4O5C A;  7ICL A;  1GPJ A;  1Q79 A;  3NKU A;  1ZJN A;  2HHP A;  4KLF A;  8ICE A;  4P4M A;  5B3P A;  4XUS A;  2ZH7 A;  4K4G A;  9ICJ A;  4LZG A;  2M2U A;  5HRB A;  2M2W A;  5J0O A;  1ZQM A;  4M9N A;  8ICR A;  4LEW A;  3RH4 A;  5CWR A;  4UB3 A;  3NWI A;  4AT8 A;  4O67 A;  1JAJ A;  4WOY A;  2ISO A;  3RH6 A;  4EED A;  1ZJM A;  9ICW A;  3UXN A;  4NLZ A;  4S3N A;  3RH5 A;  4M04 A;  4PHE A;  3B0X A;  3JPQ A;  4QZ9 A;  7ICU A;  2DRA A;  3C5G A;  4RQ6 A;  1ZQN A;  4FH3 A;  9ICO A;  8ICA A;  2ID1 A;  3ERC C;  5HRI A;  4AT9 A;  4IQT A;  2P66 A;  5BOL A;  4UB1 A;  4JWN A;  4I2J A;  3AQL A;  1KDH A;  4RQ4 A;  4RQ8 A;  3WFR E;  4WQL A;  4MF2 A;  5IIL A;  5J0R A;  4YD1 A;  4GXK A;  1R8A A;  4LEZ A;  4I2I A;  5IIM A;  1ZQB A;  4KLO A;  8ICY A; 
#chains in the Genus database with same CATH homology
 4KLH A;  4E80 A;  4X4S A;  2ZH5 A;  5CJ7 A;  4NLK A;  4DOC A;  3AQN A;  4QZA A;  1ZQH A;  4NM2 A;  4YMO A;  4M5D A;  4F5P A;  8ICC A;  5III A;  4WC3 A;  4X4R A;  2BE3 A;  5DDY A;  4WC0 A;  5J2D A;  2ISP A;  3ISD A;  2PFP A;  5IIK A;  1RZT A;  2ZHB A;  2ZH8 A;  4X4O A;  3OVA A;  1ZQU A;  4PPX A;  3UXP A;  1MQ3 A;  5J0S A;  3K75 D;  3JPP A;  5DBC A;  1TFW A;  4AT8 B;  4E8F A;  4DOB A;  8ICV A;  4GXJ A;  4I2B A;  5CHG A;  8ICQ A;  3C66 A;  1ZQT A;  1BPD A;  5J2J A;  7ICI A;  1BPE A;  4IQU A;  3V7J A;  1UEU A;  4I2G A;  4KLS A;  7ICT A;  5J2K A;  4RT3 A;  1BPY A;  3MBY A;  3RJI A;  4AT9 B;  9ICT A;  1ZQX A;  4YMM A;  7ICM A;  3UQ0 A;  1XSN A;  9ICC A;  2BCS A;  5D46 A;  2BCR A;  4PGQ A;  4RT2 A;  4WC7 A;  2GWS A;  4KLM A;  1TFY A;  1XSP A;  4AT7 A;  4I2E A;  3UXO A;  4IQW A;  4FHV A;  4M0A A;  4M9L A;  3UPS A;  4UAW A;  4TUS A;  3ISB A;  2M2T A;  2ZH6 A;  4O5K A;  1BPB A;  4TUR A;  3RJJ A;  1ZQE A;  1ZQA A;  1ZQG A;  9ICP A;  4YCX A;  4X0A A;  5EOZ A;  4QZG A;  2I9G A;  2PFO A;  9ICL A;  3UPQ A;  4M9H A;  4UD5 A;  4I27 A;  4K4I A;  4I2D A;  3PML A;  4Z6D A;  4DOA A;  2ZH3 A;  2DR5 A;  4PGX A;  5DB7 A;  5D4B A;  4M9J A;  3RJK A;  3H38 A;  1KNY A;  3AU6 A;  1XSL A;  3ISC A;  1V4A A;  1VFG A;  5J0W A;  4MF8 A;  1BPX A;  8ICZ A;  4RWO A;  2BCU A;  3MGI A;  4O5E A;  8ICW A;  5CR0 A;  5J2B A;  2PBE A;  7ICE A;  4KLQ A;  2ZH9 A;  9ICG A;  5TZV A;  4RQ0 A;  4NLN A;  1ZQP A;  4F5Q A;  4E7X A;  4KLU A;  8ICJ A;  1WOT A;  5F2V O;  4X4N A;  5BOM A;  3JPO A;  4KLL A;  2ZH1 A;  2DR9 A;  5HRG A;  1PX5 A;  4WBY A;  4AT7 B;  9ICA A;  1FA0 A;  3L9D A;  7ICQ A;  8ICP A;  4TUQ A;  9ICX A;  8ICK A;  1HUO A;  3WFS C;  7ICN A;  4UBC A;  3V72 A;  9ICB A;  1JN3 A;  1ZQV A;  4FHX A;  4EBJ A;  4F5R A;  4IQV A;  5IIO A;  5DBB A;  3WFO A;  1ZQD A;  4WBZ A;  5HR9 A;  2DR7 A;  8ICI A;  3B0Y A;  7ICG A;  4EBK A;  3HJ4 A;  4QZC A;  2BPF A;  7ICF A;  2ZHA A;  5DDM A;  5HC9 A;  4X4U A;  1TV9 A;  2DVI A;  4JWM A;  2Q66 A;  9ICM A;  9ICU A;  8ICL A;  1Q78 A;  4FO6 A;  1ZQK A;  4RPY A;  4NXZ A;  1OU5 A;  1MIW A;  1NO5 A;  7ICH A;  4QZD A;  1KEJ A;  3GDX A;  1HUZ A;  3OGU A;  1JQR A;  4UAZ A;  2M2V A;  2FMQ A;  3HWT A;  3MDA A;  7ICV A;  4XQ8 A;  3V7K A;  5J2F A;  3HIY A;  3OUY A;  3PNC A;  2FMP A;  5HHI A;  9ICV A;  9ICS A;  3MGH A;  4KLG A;  3TFR A;  7ICO A;  4QZB A;  4I2C A;  5J0X A;  4FHP A;  4MFC A;  3RJE A;  1ZQQ A;  5D49 A;  5HRF A;  4R63 A;  2BPG A;  4I2H A;  5J2A A;  9ICQ A;  2BCQ A;  4RQ3 A;  4M47 A;  2O1P A;  5DBA A;  4R65 A;  3MDC A;  4X0B A;  4R66 A;  7ICP A;  4I29 A;  3TFS A;  4UBB A;  5HRE A;  3C2K A;  4RWP A;  4LT6 A;  8ICS A;  4M2Y A;  4RQ1 A;  8ICN A;  4KLJ A;  2PXI A;  1R89 A;  4UD4 A;  3C5F A;  4LZD A;  4UB2 A;  2RFF A;  3AU2 A;  4NM1 A;  4UB4 A;  4WCW A;  5J0T A;  4YMN A;  5IIJ A;  1MIV A;  4ATB A;  2PFN A;  3H39 A;  4RQ7 A;  4X4P A;  4XRH A;  1F5A A;  2FMS A;  9ICN A;  4NKT A;  4X4V A;  4X4T A;  5DKW A;  1BPZ A;  4XQ7 A;  4P4P A;  1ZQL A;  4I2A A;  1ZQJ A;  5HRK A;  3JPS A;  4PHD A;  1ZQI A;  4KLI A;  4DO9 A;  4WC4 A;  3C2M A;  3JPN A;  8ICM A;  3WFP A;  1TVA A;  5J29 A;  3OUY B;  4RPZ A;  4KLE A;  3JZ0 A;  3C2L A;  7ICS A;  4WC5 A;  3HJ1 A;  3NYB A;  4QZF A;  4KLT A;  7ICK A;  1JMS A;  2IHM A;  2DR8 A;  4RQ2 A;  3H37 A;  9ICH A;  2O5A A;  5J0P A;  3AQK A;  5J2C A;  1ZQW A;  2W9M A;  8ICU A;  3C18 A;  1UEV A;  1VJ7 A;  5DED A;  3V7L A;  4QZH A;  9ICI A;  1ZQC A;  1ZQR A;  9ICE A;  1R8C A;  5J2H A;  4RWQ A;  1ZQS A;  4RPX A;  3RJH A;  4QZI A;  4GXI A;  4O9M A;  3AUO A;  3OVB A;  4WC1 A;  1ZQO A;  1ZQF A;  3HX0 A;  4EP7 A;  3OV7 A;  2BCV A;  8ICT A;  3OVS A;  5CP2 A;  3RJF A;  8ICX A;  1NOM A;  5HRD A;  3LK9 A;  7ICR A;  5DB6 A;  5CB1 A;  5J2G A;  4UB5 A;  3JPR A;  4ATB B;  5HRL A;  5DB8 A;  8ICB A;  1UET A;  3JPT A;  4R64 A;  4F5N A;  4PHP A;  2VAN A;  5J0U A;  3HW8 A;  1R8B A;  1ZQZ A;  4XA5 A;  4MFF A;  1RPL A;  8ICH A;  5IIN A;  4FH5 A;  4WC2 A;  7ICJ A;  4PHA A;  1MQ2 A;  4WC6 A;  5BPC A;  4P2H A;  4X4Q A;  2BPC A;  4YN4 A;  4MFA A;  3PMN A;  4YD2 A;  4FHW A;  4I2F A;  4QZ8 A;  1ZQY A;  3WFQ E;  4IG8 A;  5DEC A;  1MIY A;  4RQ5 A;  8ICO A;  8ICG A;  9ICF A;  4KLD A;  4QZE A;  4X5V A;  5J0Y A;  8ICF A;  5J2E A;  4TUP A;  4F5O A;  2ZH2 A;  4RWN A;  4Z6C A;  5J0Q A;  4PH5 A;  2ZH4 A;  4Z6E A;  2PFQ A;  3RJG A;  9ICR A;  5J2I A;  4LVS A;  4UAY A;  4Z6F A;  4P4O A;  5DB9 A;  4FHY A;  4PGY A;  4M9G A;  2NRK A;  1YLQ A;  3H3A A;  4K4H A;  3LQC B;  5CA7 A;  3JYY A;  9ICK A;  3UQ2 A;  5HHH A;  4NKU A;  3AQM A;  4NY8 A;  5HRH A;  2DRB A;  4I28 A;  4O5C A;  7ICL A;  1Q79 A;  1ZJN A;  2HHP A;  4KLF A;  8ICE A;  4P4M A;  4XUS A;  2ZH7 A;  4K4G A;  9ICJ A;  4LZG A;  2M2U A;  5HRB A;  2M2W A;  5J0O A;  1ZQM A;  4M9N A;  8ICR A;  3RH4 A;  5CWR A;  4UB3 A;  4AT8 A;  1JAJ A;  2ISO A;  3RH6 A;  1ZJM A;  9ICW A;  3UXN A;  4NLZ A;  4S3N A;  3RH5 A;  4M04 A;  4PHE A;  3B0X A;  3JPQ A;  4QZ9 A;  7ICU A;  2DRA A;  3C5G A;  4RQ6 A;  1ZQN A;  4FH3 A;  9ICO A;  8ICA A;  2ID1 A;  5HRI A;  4AT9 A;  4IQT A;  2P66 A;  5BOL A;  4UB1 A;  4JWN A;  4I2J A;  3AQL A;  1KDH A;  4RQ4 A;  4RQ8 A;  3WFR E;  4MF2 A;  5IIL A;  5J0R A;  4YD1 A;  4GXK A;  1R8A A;  4I2I A;  5IIM A;  1ZQB A;  4KLO A;  8ICY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...