5HRKA

The crystal structure of asfvpolx(h115f mutant): 1nt-gap(p) dna2:dgtp ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFFFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
total genus 35
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrkA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrkA01
1BPXA 9ICKA 4RQ3A 9ICSA 5BOLA 5IIIA 4AT8B 8ICBA 2BCRA 8ICFA 5J0YA 1KDHA 4X4UA 4RQ7A 3OUYB 4PHEA 1XSLA 4X0BA 5HHIA 1RZTA 4AT9B 3C2KA 4UAYA 5IIMA 4RQ8A 3MDCA 4M04A 9ICIA 4LZDA 4RT3A 1ZQNA 7ICUA 5J2IA 1TFYA 5CA7A 4FHWA 3JPTA 9ICQA 4WC3A 5DBAA 5J2BA 2FMSA 4X4QA 4NLNA 1WOTA 4KLGA 4R65A 4I2FA 4DO9A 8ICYA 4UB2A 5CB1A 3HIYA 3HJ1A 4Z6EA 4M5DA 4EP7A 4MFCA 4KLOA 2Q66A 2BCQA 4M9HA 4LZGA 4R66A 9ICTA 1ZQIA 2BCUA 3HJ4A 5CJ7A 4F5NA 5CR0A 4KLLA 5J2KA 4X0AA 4UB4A 4X4OA 4KLJA 8ICLA 4YCXA 3RJEA 1ZQXA 5DDYA 4RQ4A 7ICTA 2ZH8A 4FHXA 1KNYA 2M2TA 3AQKA 1ZQFA 9ICUA 1ZQMA 7ICNA 3OVAA 4QZCA 4IQUA 4F5QA 4TUQA 4IG8A 4JWNA 1HUOA 4XQ8A 2BCVA 9ICWA 4TUPA 1MQ3A 4KLMA 2FMQA 4QZ9A 1BPYA 1TVAA 5IIJA 2ZHBA 4UAZA 8ICMA 4P4OA 2PBEA 4DOCA 4M9GA 5HHHA 3C5FA 4QZ8A 2BPCA 4F5RA 4ATBA 4E7XA 3OVSA 3UPQA 4IQWA 4K4GA 1Q79A 4M9NA 4NM1A 2O1PA 1BPBA 5HRFA 4O5KA 1ZQPA 8ICZA 4PHDA 8ICQA 4NKUA 3C66A 2ZH7A 5TZVA 5CHGA 4R63A 4MF8A 8ICWA 8ICIA 4NLZA 4WC1A 3WFQE 1JAJA 4WBZA 3HW8A 3AQLA 4QZFA 3GDXA 8ICEA 4PGQA 3WFSC 2ZH5A 4P4PA 1R8CA 4MFFA 3AU2A 4ATBB 5J29A 1UEUA 4I2HA 2NRKA 2VANA 5J2EA 3ISCA 3V7KA 4UB1A 4QZBA 4K4IA 4E8FA 1MQ2A 3C2LA 1ZQUA 4RWQA 4F5PA 4X4SA 3B0XA 7ICPA 1ZJMA 2P66A 2RFFA 7ICOA 4JWMA 9ICPA 3LQCB 4RWPA 1ZQZA 5EOZA 9ICJA 5HRGA 4M0AA 5J2FA 3OVBA 4YMOA 4UB3A 5DBCA 4UAWA 5DKWA 3RH6A 2PFNA 5DBBA 1ZQRA 5J2AA 1ZQQA 3UXPA 8ICGA 1V4AA 3L9DA 3ISDA 8ICPA 2W9MA 1ZQBA 3TFSA 2HHPA 1ZQVA 4YD1A 4RQ1A 1ZQKA 4KLQA 3TFRA 4FHYA 5D49A 3RJIA 8ICJA 4GXKA 5HRIA 3C2MA 4K4HA 5IIOA 2ID1A 1ZQCA 3RJJA 5DECA 7ICKA 4I2CA 1NOMA 1JQRA 4WC7A 3PNCA 9ICVA 4TUSA 4PGYA 1ZQDA 4WC5A 5CWRA 5IINA 2DR9A 3JPSA 4XQ7A 7ICEA 2ISPA 4P2HA 5J0TA 2BE3A 4I29A 5F2VO 3C18A 1XSNA 4FHVA 8ICVA 2DVIA 4I28A 4LVSA 4KLDA 7ICLA 3H39A 4Z6DA 3OV7A 4I2AA 4KLUA 5J0RA 3RJFA 4KLSA 3JPNA 4F5OA 9ICGA 2O5AA 1MIYA 5HRLA 4QZAA 1KEJA 4UBBA 3RH5A 1ZQJA 2DRBA 4DOAA 5IILA 4WC2A 2ZHAA 4X4NA 4S3NA 4WC0A 3AQMA 5J2HA 1RPLA 8ICHA 4NLKA 1ZQGA 4PH5A 2BPFA 3RJGA 8ICNA 8ICTA 3AU6A 4IQVA 3MDAA 3NYBA 5J2JA 5J0QA 5J2CA 5BPCA 4X5VA 4RQ2A 4Z6FA 3UQ0A 5J0XA 4RPZA 4P4MA 4UB5A 2DRAA 4NY8A 3AQNA 4RQ6A 5DB6A 4X4PA 4O5CA 5HRHA 4RPXA 3RJHA 9ICOA 3WFPA 9ICNA 3UQ2A 4EBJA 4MFAA 4O9MA 4Z6CA 1FA0A 4O5EA 1ZQHA 4NXZA 3WFOA 2ZH6A 4YD2A 9ICMA 1MIVA 4KLTA 5J0PA 5DDMA 2I9GA 5CP2A 4QZGA 1HUZA 8ICXA 3MGHA 4LT6A 4YN4A 4QZEA 3K75D 7ICMA 2DR5A 2ISOA 3UXNA 4YMNA 1Q78A 2DR8A 4NKTA 5J0SA 2ZH2A 1VFGA 5IIKA 1MIWA 4EBKA 9ICHA 1ZQTA 4XA5A 4I2GA 9ICAA 1TFWA 3OGUA 4RWNA 3C5GA 4WC4A 9ICBA 4KLFA 1VJ7A 8ICSA 1PX5A 8ICCA 4NM2A 4PGXA 4WCWA 1UEVA 5HRKA 1ZQSA 7ICIA 4WBYA 7ICFA 7ICQA 7ICHA 4X4RA 3JPQA 5J0WA 3PMLA 3WFRE 7ICJA 4KLEA 8ICAA 9ICRA 2ZH3A 3H37A 3JZ0A 3B0YA 3JYYA 2IHMA 4RT2A 4PHPA 4FH3A 2GWSA 4AT7A 1R8BA 4YMMA 3MBYA 1NO5A 5HR9A 4QZDA 1BPEA 2PFPA 4M9JA 1ZQYA 4FHPA 4PPXA 4UD5A 5J2DA 1BPZA 3PMNA 7ICVA 1JN3A 1ZQAA 2M2UA 5DEDA 4E80A 2BCSA 9ICCA 4QZHA 3RH4A 5BOMA 3JPOA 1ZQWA 1JMSA 2ZH9A 5DB9A 4PHAA 3V7JA 9ICFA 4AT7B 4XUSA 4FH5A 4RPYA 2BPGA 5DB7A 4X4TA 2ZH4A 2DR7A 1ZJNA 4GXJA 5J2GA 5HREA 4KLHA 7ICSA 3HX0A 7ICGA 5J0UA 4M9LA 5HRDA 5DB8A 8ICKA 2PFQA 3UXOA 9ICXA 4I2BA 7ICRA 4UD4A 3MGIA 5D46A 3H3AA 4RQ0A 4TURA 3JPRA 2M2VA 2FMPA 9ICLA 1XSPA 2M2WA 4M2YA 3ISBA 2PXIA 8ICOA 3V72A 3AUOA 4KLIA 1R8AA 3H38A 1ZQOA 4GXIA 5D4BA 8ICRA 4I2EA 3RJKA 4I2JA 4I27A 4AT8A 1F5AA 4IQTA 4XRHA 3LK9A 3HWTA 1ZQLA 5HC9A 1ZQEA 4M47A 3OUYA 4FO6A 3JPPA 1BPDA 8ICUA 4UBCA 4AT9A 2ZH1A 5J0OA 4WC6A 2PFOA 1YLQA 4MF2A 4I2IA 3V7LA 1TV9A 9ICEA 3UPSA 5HRBA 4RQ5A 4RWOA 4DOBA 4R64A 4X4VA 4I2DA 1R89A 4QZIA 1OU5A 1UETA
chains in the Genus database with same CATH superfamily
1BPXA 9ICKA 4RQ3A 4EV6A 9ICSA 4KM5A 5BOLA 5IIIA 4AT8B 8ICBA 2BCRA 4EEBA 8ICFA 5J0YA 1KDHA 4X4UA 4RQ7A 3OUYB 4PHEA 1XSLA 4X0BA 5HHIA 1RZTA 4WOYA 4AT9B 3C2KA 3CK6A 4UAYA 5IIMA 4RQ8A 3MDCA 4M04A 9ICIA 4WQKA 4LZDA 4RT3A 1ZQNA 7ICUA 5J2IA 1TFYA 5CA7A 4FHWA 3JPTA 9ICQA 4WC3A 5DBAA 5J2BA 2FMSA 4X4QA 4NLNA 1WOTA 4LEYA 4KLGA 4R65A 4I2FA 4DO9A 8ICYA 4UB2A 5CB1A 3HIYA 3HJ1A 4Z6EA 4M5DA 4EP7A 4MFCA 4KLOA 2Q66A 2BCQA 4M9HA 4LZGA 3EF2A 4R66A 9ICTA 1ZQIA 2BCUA 3HJ4A 5B3PA 5CJ7A 4F5NA 4K99A 5CR0A 3NVOA 4KLLA 3ER9B 5J2KA 4X0AA 4UB4A 4X4OA 4KLJA 8ICLA 4YCXA 3RJEA 1ZQXA 5DDYA 4RQ4A 7ICTA 2ZH8A 4FHXA 1KNYA 2M2TA 3AQKA 1ZQFA 9ICUA 1ZQMA 7ICNA 3OVAA 4QZCA 4IQUA 4F5QA 4TUQA 4IG8A 4JWNA 1HUOA 4XQ8A 2BCVA 9ICWA 4TUPA 1MQ3A 4KLMA 2FMQA 4QZ9A 1BPYA 5B3QA 1TVAA 5IIJA 2ZHBA 4I0UA 4UAZA 8ICMA 4P4OA 2PBEA 4DOCA 4M9GA 2HN1A 3ERCC 5HHHA 3C5FA 4QZ8A 2BPCA 4F5RA 4ATBA 4E7XA 3OVSA 3UPQA 4IQWA 4K9BA 4K4GA 1Q79A 4M9NA 4NM1A 2O1PA 1BPBA 5HRFA 4O5KA 1ZQPA 8ICZA 5D61A 4PHDA 8ICQA 4NKUA 3C66A 2ZH7A 5TZVA 5CHGA 2BBJA 4R63A 4MF8A 8ICWA 8ICIA 4NLZA 4WC1A 3WFQE 1JAJA 4WBZA 3HW8A 3AQLA 4QZFA 3GDXA 8ICEA 4O6AA 4PGQA 3WFSC 2ZH5A 4P4PA 1R8CA 4MFFA 3AU2A 4ATBB 5J29A 1UEUA 4I2HA 2NRKA 2VANA 5J2EA 3ISCA 3V7KA 4UB1A 4QZBA 4K4IA 4E8FA 1MQ2A 3C2LA 4NXVA 1ZQUA 4RWQA 4F5PA 4X4SA 3B0XA 7ICPA 1ZJMA 2P66A 2RFFA 7ICOA 4JWMA 9ICPA 3LQCB 4RWPA 2IHOA 1ZQZA 5EOZA 9ICJA 3ER8C 5HRGA 4M0AA 5J2FA 3OVBA 4YMOA 4UB3A 5DBCA 2GAFD 4OAGA 3OWGA 4UAWA 4JLZA 5DKWA 3RH6A 2PFNA 5DBBA 1ZQRA 5J2AA 1ZQQA 3UXPA 8ICGA 1V4AA 3L9DA 3NKUA 3ISDA 8ICPA 2W9MA 1ZQBA 3TFSA 2HHPA 1ZQVA 4YD1A 4RQ1A 1ZQKA 4KLQA 3TFRA 4FHYA 5D49A 3RJIA 8ICJA 4K8VA 4GXKA 5HRIA 3C2MA 4K4HA 5IIOA 2ID1A 1ZQCA 3RJJA 5DECA 4JLXA 7ICKA 4I2CA 1NOMA 1JQRA 4WC7A 3PNCA 9ICVA 4TUSA 4PGYA 1ZQDA 4WC5A 5CWRA 5IINA 2DR9A 3JPSA 3K7DA 4XQ7A 7ICEA 2ISPA 4P2HA 5J0TA 2BE3A 4I29A 3MCRA 3C18A 1XSNA 5F2VO 4FHVA 8ICVA 2DVIA 4I28A 4LVSA 4KLDA 7ICLA 3H39A 4Z6DA 3OV7A 4I2AA 4KLUA 4MKPA 5J0RA 3RJFA 4KLSA 4WQLA 3JPNA 4F5OA 9ICGA 2O5AA 1MIYA 5D62A 4LEWA 5HRLA 3PHZA 5CFTA 4QZAA 1KEJA 4UBBA 3RH5A 1ZQJA 1GPJA 2DRBA 4DOAA 5IILA 4WC2A 2GA9D 2IUBA 2ZHAA 3JCFA 4X4NA 4S3NA 4WC0A 3AQMA 5J2HA 1RPLA 8ICHA 4NLKA 1ZQGA 4PH5A 4EGWA 4O67A 2BPFA 3RJGA 4OAIZ 8ICNA 8ICTA 5CFSA 3AU6A 4IQVA 3MDAA 4OAHA 3NYBA 5J2JA 5J0QA 5J2CA 5BPCA 4X5VA 4RQ2A 4Z6FA 3UQ0A 5J0XA 4WH5A 4RPZA 4P4MA 4NXWA 4UB5A 2DRAA 4NY8A 3AQNA 5CFUA 4RQ6A 5DB6A 4X4PA 4O5CA 5HRHA 4RPXA 3RJHA 9ICOA 3WFPA 9ICNA 3UQ2A 4FO1A 4EBJA 4MFAA 4O9MA 4K9AA 4Z6CA 1FA0A 4O5EA 1ZQHA 4NXZA 3WFOA 2ZH6A 4YD2A 9ICMA 1MIVA 4KLTA 5J0PA 5DDMA 2I9GA 5CP2A 4QZGA 1HUZA 8ICXA 3MGHA 4LT6A 4YN4A 4QZEA 3K75D 7ICMA 2DR5A 2ISOA 3UXNA 4YMNA 1Q78A 2DR8A 4NKTA 5J0SA 2ZH2A 1VFGA 5IIKA 1MIWA 4XJEA 4EBKA 9ICHA 1ZQTA 4XA5A 4I2GA 9ICAA 1TFWA 4LEVA 4N7RA 3OGUA 4RWNA 3C5GA 4WC4A 9ICBA 4KLFA 2EWRA 1VJ7A 8ICSA 1PX5A 8ICCA 4NM2A 4PGXA 4WCWA 1UEVA 5HRKA 1ZQSA 7ICIA 4WBYA 5JTGA 7ICFA 7ICQA 7ICHA 4X4RA 3JPQA 5J0WA 4NXTA 3PMLA 3WFRE 7ICJA 4HX0A 4KLEA 2HN2A 8ICAA 9ICRA 3NWIA 2ZH3A 3H37A 3JZ0A 3B0YA 3JYYA 2IHMA 4RT2A 4PHPA 4FH3A 2GWSA 4AT7A 1R8BA 4YMMA 3MBYA 1NO5A 5HR9A 4QZDA 1BPEA 2PFPA 4K97A 4NXXA 4M9JA 1ZQYA 4EEDA 4FHPA 4PPXA 5D63A 2FCLA 4UD5A 5J2DA 1BPZA 3PMNA 7ICVA 1JN3A 1ZQAA 2M2UA 5DEDA 4E80A 2BCSA 9ICCA 4QZHA 3RH4A 5BOMA 3JPOA 1ZQWA 1JMSA 2ZH9A 5DB9A 4PHAA 3V7JA 9ICFA 4LEZA 4AT7B 4XUSA 4FH5A 4RPYA 2BPGA 5DB7A 4X4TA 2ZH4A 2DR7A 1ZJNA 4GXJA 5J2GA 5HREA 4NXUA 4KLHA 7ICSA 3HX0A 7ICGA 5J0UA 4M9LA 5HRDA 5DB8A 4OAFA 8ICKA 2PFQA 4O69A 3UXOA 9ICXA 4I2BA 7ICRA 5CHEA 4UD4A 3MGIA 5D46A 3H3AA 4RQ0A 4TURA 3JPRA 2M2VA 2FMPA 9ICLA 1XSPA 2M2WA 4M2YA 3ISBA 2PXIA 8ICOA 3V72A 3AUOA 4KLIA 1R8AA 3H38A 4K96A 1ZQOA 4GXIA 5D4BA 8ICRA 4I2EA 3RJKA 2B4VA 4I2JA 4KB6A 4I27A 4AT8A 1F5AA 4IQTA 4XRHA 3LK9A 3HWTA 1ZQLA 5HC9A 1ZQEA 4M47A 3OUYA 4FO6A 3JPPA 1BPDA 4O68A 8ICUA 4UBCA 4AT9A 2ZH1A 5J0OA 2B51A 4K98A 4WC6A 2PFOA 1YLQA 4MF2A 4I2IA 3V7LA 1TV9A 9ICEA 3UPSA 5HRBA 4RQ5A 2B56A 4RWOA 4DOBA 4R64A 4X4VA 2BBHA 4I2DA 1R89A 4QZIA 1OU5A 1UETA
chains in the Genus database with same CATH topology
1BPXA 9ICKA 4RQ3A 9ICSA 5BOLA 5IIIA 4AT8B 8ICBA 2BCRA 8ICFA 5J0YA 1KDHA 4X4UA 4RQ7A 3OUYB 4PHEA 1XSLA 4X0BA 5HHIA 1RZTA 4AT9B 3C2KA 4UAYA 5IIMA 4RQ8A 3MDCA 4M04A 9ICIA 4LZDA 4RT3A 1ZQNA 7ICUA 5J2IA 1TFYA 5CA7A 4FHWA 3JPTA 9ICQA 4WC3A 5DBAA 5J2BA 2FMSA 4X4QA 4NLNA 1WOTA 4KLGA 4R65A 4I2FA 4DO9A 8ICYA 4UB2A 5CB1A 3HIYA 3HJ1A 4Z6EA 4M5DA 4EP7A 4MFCA 4KLOA 2Q66A 2BCQA 4M9HA 4LZGA 4R66A 9ICTA 1ZQIA 2BCUA 3HJ4A 5CJ7A 4F5NA 5CR0A 4KLLA 5J2KA 4X0AA 4UB4A 4X4OA 4KLJA 8ICLA 4YCXA 3RJEA 1ZQXA 5DDYA 4RQ4A 7ICTA 2ZH8A 4FHXA 1KNYA 2M2TA 3AQKA 1ZQFA 9ICUA 1ZQMA 7ICNA 3OVAA 4QZCA 4IQUA 4F5QA 4TUQA 4IG8A 4JWNA 1HUOA 4XQ8A 2BCVA 9ICWA 4TUPA 1MQ3A 4KLMA 2FMQA 4QZ9A 1BPYA 1TVAA 5IIJA 2ZHBA 4UAZA 8ICMA 4P4OA 2PBEA 4DOCA 4M9GA 5HHHA 3C5FA 4QZ8A 2BPCA 4F5RA 4ATBA 4E7XA 3OVSA 3UPQA 4IQWA 4K4GA 1Q79A 4M9NA 4NM1A 2O1PA 1BPBA 5HRFA 4O5KA 1ZQPA 8ICZA 4PHDA 8ICQA 4NKUA 3C66A 2ZH7A 5TZVA 5CHGA 4R63A 4MF8A 8ICWA 8ICIA 4NLZA 4WC1A 3WFQE 1JAJA 4WBZA 3HW8A 3AQLA 4QZFA 3GDXA 8ICEA 4PGQA 3WFSC 2ZH5A 4P4PA 1R8CA 4MFFA 3AU2A 4ATBB 5J29A 1UEUA 4I2HA 2NRKA 2VANA 5J2EA 3ISCA 3V7KA 4UB1A 4QZBA 4K4IA 4E8FA 1MQ2A 3C2LA 1ZQUA 4RWQA 4F5PA 4X4SA 3B0XA 7ICPA 1ZJMA 2P66A 2RFFA 7ICOA 4JWMA 9ICPA 3LQCB 4RWPA 1ZQZA 5EOZA 9ICJA 5HRGA 4M0AA 5J2FA 3OVBA 4YMOA 4UB3A 5DBCA 4UAWA 5DKWA 3RH6A 2PFNA 5DBBA 1ZQRA 5J2AA 1ZQQA 3UXPA 8ICGA 1V4AA 3L9DA 3ISDA 8ICPA 2W9MA 1ZQBA 3TFSA 2HHPA 1ZQVA 4YD1A 4RQ1A 1ZQKA 4KLQA 3TFRA 4FHYA 5D49A 3RJIA 8ICJA 4GXKA 5HRIA 3C2MA 4K4HA 5IIOA 2ID1A 1ZQCA 3RJJA 5DECA 7ICKA 4I2CA 1NOMA 1JQRA 4WC7A 3PNCA 9ICVA 4TUSA 4PGYA 1ZQDA 4WC5A 5CWRA 5IINA 2DR9A 3JPSA 4XQ7A 7ICEA 2ISPA 4P2HA 5J0TA 2BE3A 4I29A 5F2VO 3C18A 1XSNA 4FHVA 8ICVA 2DVIA 4I28A 4LVSA 4KLDA 7ICLA 3H39A 4Z6DA 3OV7A 4I2AA 4KLUA 5J0RA 3RJFA 4KLSA 3JPNA 4F5OA 9ICGA 2O5AA 1MIYA 5HRLA 4QZAA 1KEJA 4UBBA 3RH5A 1ZQJA 2DRBA 4DOAA 5IILA 4WC2A 2ZHAA 4X4NA 4S3NA 4WC0A 3AQMA 5J2HA 1RPLA 8ICHA 4NLKA 1ZQGA 4PH5A 2BPFA 3RJGA 8ICNA 8ICTA 3AU6A 4IQVA 3MDAA 3NYBA 5J2JA 5J0QA 5J2CA 5BPCA 4X5VA 4RQ2A 4Z6FA 3UQ0A 5J0XA 4RPZA 4P4MA 4UB5A 2DRAA 4NY8A 3AQNA 4RQ6A 5DB6A 4X4PA 4O5CA 5HRHA 4RPXA 3RJHA 9ICOA 3WFPA 9ICNA 3UQ2A 4EBJA 4MFAA 4O9MA 4Z6CA 1FA0A 4O5EA 1ZQHA 4NXZA 3WFOA 2ZH6A 4YD2A 9ICMA 1MIVA 4KLTA 5J0PA 5DDMA 2I9GA 5CP2A 4QZGA 1HUZA 8ICXA 3MGHA 4LT6A 4YN4A 4QZEA 3K75D 7ICMA 2DR5A 2ISOA 3UXNA 4YMNA 1Q78A 2DR8A 4NKTA 5J0SA 2ZH2A 1VFGA 5IIKA 1MIWA 4EBKA 9ICHA 1ZQTA 4XA5A 4I2GA 9ICAA 1TFWA 3OGUA 4RWNA 3C5GA 4WC4A 9ICBA 4KLFA 1VJ7A 8ICSA 1PX5A 8ICCA 4NM2A 4PGXA 4WCWA 1UEVA 5HRKA 1ZQSA 7ICIA 4WBYA 7ICFA 7ICQA 7ICHA 4X4RA 3JPQA 5J0WA 3PMLA 3WFRE 7ICJA 4KLEA 8ICAA 9ICRA 2ZH3A 3H37A 3JZ0A 3B0YA 3JYYA 2IHMA 4RT2A 4PHPA 4FH3A 2GWSA 4AT7A 1R8BA 4YMMA 3MBYA 1NO5A 5HR9A 4QZDA 1BPEA 2PFPA 4M9JA 1ZQYA 4FHPA 4PPXA 4UD5A 5J2DA 1BPZA 3PMNA 7ICVA 1JN3A 1ZQAA 2M2UA 5DEDA 4E80A 2BCSA 9ICCA 4QZHA 3RH4A 5BOMA 3JPOA 1ZQWA 1JMSA 2ZH9A 5DB9A 4PHAA 3V7JA 9ICFA 4AT7B 4XUSA 4FH5A 4RPYA 2BPGA 5DB7A 4X4TA 2ZH4A 2DR7A 1ZJNA 4GXJA 5J2GA 5HREA 4KLHA 7ICSA 3HX0A 7ICGA 5J0UA 4M9LA 5HRDA 5DB8A 8ICKA 2PFQA 3UXOA 9ICXA 4I2BA 7ICRA 4UD4A 3MGIA 5D46A 3H3AA 4RQ0A 4TURA 3JPRA 2M2VA 2FMPA 9ICLA 1XSPA 2M2WA 4M2YA 3ISBA 2PXIA 8ICOA 3V72A 3AUOA 4KLIA 1R8AA 3H38A 1ZQOA 4GXIA 5D4BA 8ICRA 4I2EA 3RJKA 4I2JA 4I27A 4AT8A 1F5AA 4IQTA 4XRHA 3LK9A 3HWTA 1ZQLA 5HC9A 1ZQEA 4M47A 3OUYA 4FO6A 3JPPA 1BPDA 8ICUA 4UBCA 4AT9A 2ZH1A 5J0OA 4WC6A 2PFOA 1YLQA 4MF2A 4I2IA 3V7LA 1TV9A 9ICEA 3UPSA 5HRBA 4RQ5A 4RWOA 4DOBA 4R64A 4X4VA 4I2DA 1R89A 4QZIA 1OU5A 1UETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPX A;  9ICK A;  4RQ3 A;  9ICS A;  5BOL A;  5III A;  4AT8 B;  8ICB A;  2BCR A;  8ICF A;  5J0Y A;  1KDH A;  4X4U A;  4RQ7 A;  3OUY B;  4PHE A;  1XSL A;  4X0B A;  5HHI A;  1RZT A;  4AT9 B;  3C2K A;  4UAY A;  5IIM A;  4RQ8 A;  3MDC A;  4M04 A;  9ICI A;  4LZD A;  4RT3 A;  1ZQN A;  7ICU A;  5J2I A;  1TFY A;  5CA7 A;  4FHW A;  3JPT A;  9ICQ A;  4WC3 A;  5DBA A;  5J2B A;  2FMS A;  4X4Q A;  4NLN A;  1WOT A;  4KLG A;  4R65 A;  4I2F A;  4DO9 A;  8ICY A;  4UB2 A;  5CB1 A;  3HIY A;  3HJ1 A;  4Z6E A;  4M5D A;  4EP7 A;  4MFC A;  4KLO A;  2Q66 A;  2BCQ A;  4M9H A;  4LZG A;  4R66 A;  9ICT A;  1ZQI A;  2BCU A;  3HJ4 A;  5CJ7 A;  4F5N A;  5CR0 A;  4KLL A;  5J2K A;  4X0A A;  4UB4 A;  4X4O A;  4KLJ A;  8ICL A;  4YCX A;  3RJE A;  1ZQX A;  5DDY A;  4RQ4 A;  7ICT A;  2ZH8 A;  4FHX A;  1KNY A;  2M2T A;  3AQK A;  1ZQF A;  9ICU A;  1ZQM A;  7ICN A;  3OVA A;  4QZC A;  4IQU A;  4F5Q A;  4TUQ A;  4IG8 A;  4JWN A;  1HUO A;  4XQ8 A;  2BCV A;  9ICW A;  4TUP A;  1MQ3 A;  4KLM A;  2FMQ A;  4QZ9 A;  1BPY A;  1TVA A;  5IIJ A;  2ZHB A;  4UAZ A;  8ICM A;  4P4O A;  2PBE A;  4DOC A;  4M9G A;  5HHH A;  3C5F A;  4QZ8 A;  2BPC A;  4F5R A;  4ATB A;  4E7X A;  3OVS A;  3UPQ A;  4IQW A;  4K4G A;  1Q79 A;  4M9N A;  4NM1 A;  2O1P A;  1BPB A;  5HRF A;  4O5K A;  1ZQP A;  8ICZ A;  4PHD A;  8ICQ A;  4NKU A;  3C66 A;  2ZH7 A;  5TZV A;  5CHG A;  4R63 A;  4MF8 A;  8ICW A;  8ICI A;  4NLZ A;  4WC1 A;  3WFQ E;  1JAJ A;  4WBZ A;  3HW8 A;  3AQL A;  4QZF A;  3GDX A;  8ICE A;  4PGQ A;  3WFS C;  2ZH5 A;  4P4P A;  1R8C A;  4MFF A;  3AU2 A;  4ATB B;  5J29 A;  1UEU A;  4I2H A;  2NRK A;  2VAN A;  5J2E A;  3ISC A;  3V7K A;  4UB1 A;  4QZB A;  4K4I A;  4E8F A;  1MQ2 A;  3C2L A;  1ZQU A;  4RWQ A;  4F5P A;  4X4S A;  3B0X A;  7ICP A;  1ZJM A;  2P66 A;  2RFF A;  7ICO A;  4JWM A;  9ICP A;  3LQC B;  4RWP A;  1ZQZ A;  5EOZ A;  9ICJ A;  5HRG A;  4M0A A;  5J2F A;  3OVB A;  4YMO A;  4UB3 A;  5DBC A;  4UAW A;  5DKW A;  3RH6 A;  2PFN A;  5DBB A;  1ZQR A;  5J2A A;  1ZQQ A;  3UXP A;  8ICG A;  1V4A A;  3L9D A;  3ISD A;  8ICP A;  2W9M A;  1ZQB A;  3TFS A;  2HHP A;  1ZQV A;  4YD1 A;  4RQ1 A;  1ZQK A;  4KLQ A;  3TFR A;  4FHY A;  5D49 A;  3RJI A;  8ICJ A;  4GXK A;  5HRI A;  3C2M A;  4K4H A;  5IIO A;  2ID1 A;  1ZQC A;  3RJJ A;  5DEC A;  7ICK A;  4I2C A;  1NOM A;  1JQR A;  4WC7 A;  3PNC A;  9ICV A;  4TUS A;  4PGY A;  1ZQD A;  4WC5 A;  5CWR A;  5IIN A;  2DR9 A;  3JPS A;  4XQ7 A;  7ICE A;  2ISP A;  4P2H A;  5J0T A;  2BE3 A;  4I29 A;  5F2V O;  3C18 A;  1XSN A;  4FHV A;  8ICV A;  2DVI A;  4I28 A;  4LVS A;  4KLD A;  7ICL A;  3H39 A;  4Z6D A;  3OV7 A;  4I2A A;  4KLU A;  5J0R A;  3RJF A;  4KLS A;  3JPN A;  4F5O A;  9ICG A;  2O5A A;  1MIY A;  5HRL A;  4QZA A;  1KEJ A;  4UBB A;  3RH5 A;  1ZQJ A;  2DRB A;  4DOA A;  5IIL A;  4WC2 A;  2ZHA A;  4X4N A;  4S3N A;  4WC0 A;  3AQM A;  5J2H A;  1RPL A;  8ICH A;  4NLK A;  1ZQG A;  4PH5 A;  2BPF A;  3RJG A;  8ICN A;  8ICT A;  3AU6 A;  4IQV A;  3MDA A;  3NYB A;  5J2J A;  5J0Q A;  5J2C A;  5BPC A;  4X5V A;  4RQ2 A;  4Z6F A;  3UQ0 A;  5J0X A;  4RPZ A;  4P4M A;  4UB5 A;  2DRA A;  4NY8 A;  3AQN A;  4RQ6 A;  5DB6 A;  4X4P A;  4O5C A;  5HRH A;  4RPX A;  3RJH A;  9ICO A;  3WFP A;  9ICN A;  3UQ2 A;  4EBJ A;  4MFA A;  4O9M A;  4Z6C A;  1FA0 A;  4O5E A;  1ZQH A;  4NXZ A;  3WFO A;  2ZH6 A;  4YD2 A;  9ICM A;  1MIV A;  4KLT A;  5J0P A;  5DDM A;  2I9G A;  5CP2 A;  4QZG A;  1HUZ A;  8ICX A;  3MGH A;  4LT6 A;  4YN4 A;  4QZE A;  3K75 D;  7ICM A;  2DR5 A;  2ISO A;  3UXN A;  4YMN A;  1Q78 A;  2DR8 A;  4NKT A;  5J0S A;  2ZH2 A;  1VFG A;  5IIK A;  1MIW A;  4EBK A;  9ICH A;  1ZQT A;  4XA5 A;  4I2G A;  9ICA A;  1TFW A;  3OGU A;  4RWN A;  3C5G A;  4WC4 A;  9ICB A;  4KLF A;  1VJ7 A;  8ICS A;  1PX5 A;  8ICC A;  4NM2 A;  4PGX A;  4WCW A;  1UEV A;  5HRK A;  1ZQS A;  7ICI A;  4WBY A;  7ICF A;  7ICQ A;  7ICH A;  4X4R A;  3JPQ A;  5J0W A;  3PML A;  3WFR E;  7ICJ A;  4KLE A;  8ICA A;  9ICR A;  2ZH3 A;  3H37 A;  3JZ0 A;  3B0Y A;  3JYY A;  2IHM A;  4RT2 A;  4PHP A;  4FH3 A;  2GWS A;  4AT7 A;  1R8B A;  4YMM A;  3MBY A;  1NO5 A;  5HR9 A;  4QZD A;  1BPE A;  2PFP A;  4M9J A;  1ZQY A;  4FHP A;  4PPX A;  4UD5 A;  5J2D A;  1BPZ A;  3PMN A;  7ICV A;  1JN3 A;  1ZQA A;  2M2U A;  5DED A;  4E80 A;  2BCS A;  9ICC A;  4QZH A;  3RH4 A;  5BOM A;  3JPO A;  1ZQW A;  1JMS A;  2ZH9 A;  5DB9 A;  4PHA A;  3V7J A;  9ICF A;  4AT7 B;  4XUS A;  4FH5 A;  4RPY A;  2BPG A;  5DB7 A;  4X4T A;  2ZH4 A;  2DR7 A;  1ZJN A;  4GXJ A;  5J2G A;  5HRE A;  4KLH A;  7ICS A;  3HX0 A;  7ICG A;  5J0U A;  4M9L A;  5HRD A;  5DB8 A;  8ICK A;  2PFQ A;  3UXO A;  9ICX A;  4I2B A;  7ICR A;  4UD4 A;  3MGI A;  5D46 A;  3H3A A;  4RQ0 A;  4TUR A;  3JPR A;  2M2V A;  2FMP A;  9ICL A;  1XSP A;  2M2W A;  4M2Y A;  3ISB A;  2PXI A;  8ICO A;  3V72 A;  3AUO A;  4KLI A;  1R8A A;  3H38 A;  1ZQO A;  4GXI A;  5D4B A;  8ICR A;  4I2E A;  3RJK A;  4I2J A;  4I27 A;  4AT8 A;  1F5A A;  4IQT A;  4XRH A;  3LK9 A;  3HWT A;  1ZQL A;  5HC9 A;  1ZQE A;  4M47 A;  3OUY A;  4FO6 A;  3JPP A;  1BPD A;  8ICU A;  4UBC A;  4AT9 A;  2ZH1 A;  5J0O A;  4WC6 A;  2PFO A;  1YLQ A;  4MF2 A;  4I2I A;  3V7L A;  1TV9 A;  9ICE A;  3UPS A;  5HRB A;  4RQ5 A;  4RWO A;  4DOB A;  4R64 A;  4X4V A;  4I2D A;  1R89 A;  4QZI A;  1OU5 A;  1UET A; 
#chains in the Genus database with same CATH topology
 1BPX A;  9ICK A;  4RQ3 A;  4EV6 A;  9ICS A;  4KM5 A;  5BOL A;  5III A;  4AT8 B;  8ICB A;  2BCR A;  4EEB A;  8ICF A;  5J0Y A;  1KDH A;  4X4U A;  4RQ7 A;  3OUY B;  4PHE A;  1XSL A;  4X0B A;  5HHI A;  1RZT A;  4WOY A;  4AT9 B;  3C2K A;  3CK6 A;  4UAY A;  5IIM A;  4RQ8 A;  3MDC A;  4M04 A;  9ICI A;  4WQK A;  4LZD A;  4RT3 A;  1ZQN A;  7ICU A;  5J2I A;  1TFY A;  5CA7 A;  4FHW A;  3JPT A;  9ICQ A;  4WC3 A;  5DBA A;  5J2B A;  2FMS A;  4X4Q A;  4NLN A;  1WOT A;  4LEY A;  4KLG A;  4R65 A;  4I2F A;  4DO9 A;  8ICY A;  4UB2 A;  5CB1 A;  3HIY A;  3HJ1 A;  4Z6E A;  4M5D A;  4EP7 A;  4MFC A;  4KLO A;  2Q66 A;  2BCQ A;  4M9H A;  4LZG A;  3EF2 A;  4R66 A;  9ICT A;  1ZQI A;  2BCU A;  3HJ4 A;  5B3P A;  5CJ7 A;  4F5N A;  4K99 A;  5CR0 A;  3NVO A;  4KLL A;  3ER9 B;  5J2K A;  4X0A A;  4UB4 A;  4X4O A;  4KLJ A;  8ICL A;  4YCX A;  3RJE A;  1ZQX A;  5DDY A;  4RQ4 A;  7ICT A;  2ZH8 A;  4FHX A;  1KNY A;  2M2T A;  3AQK A;  1ZQF A;  9ICU A;  1ZQM A;  7ICN A;  3OVA A;  4QZC A;  4IQU A;  4F5Q A;  4TUQ A;  4IG8 A;  4JWN A;  1HUO A;  4XQ8 A;  2BCV A;  9ICW A;  4TUP A;  1MQ3 A;  4KLM A;  2FMQ A;  4QZ9 A;  1BPY A;  5B3Q A;  1TVA A;  5IIJ A;  2ZHB A;  4I0U A;  4UAZ A;  8ICM A;  4P4O A;  2PBE A;  4DOC A;  4M9G A;  2HN1 A;  3ERC C;  5HHH A;  3C5F A;  4QZ8 A;  2BPC A;  4F5R A;  4ATB A;  4E7X A;  3OVS A;  3UPQ A;  4IQW A;  4K9B A;  4K4G A;  1Q79 A;  4M9N A;  4NM1 A;  2O1P A;  1BPB A;  5HRF A;  4O5K A;  1ZQP A;  8ICZ A;  5D61 A;  4PHD A;  8ICQ A;  4NKU A;  3C66 A;  2ZH7 A;  5TZV A;  5CHG A;  2BBJ A;  4R63 A;  4MF8 A;  8ICW A;  8ICI A;  4NLZ A;  4WC1 A;  3WFQ E;  1JAJ A;  4WBZ A;  3HW8 A;  3AQL A;  4QZF A;  3GDX A;  8ICE A;  4O6A A;  4PGQ A;  3WFS C;  2ZH5 A;  4P4P A;  1R8C A;  4MFF A;  3AU2 A;  4ATB B;  5J29 A;  1UEU A;  4I2H A;  2NRK A;  2VAN A;  5J2E A;  3ISC A;  3V7K A;  4UB1 A;  4QZB A;  4K4I A;  4E8F A;  1MQ2 A;  3C2L A;  4NXV A;  1ZQU A;  4RWQ A;  4F5P A;  4X4S A;  3B0X A;  7ICP A;  1ZJM A;  2P66 A;  2RFF A;  7ICO A;  4JWM A;  9ICP A;  3LQC B;  4RWP A;  2IHO A;  1ZQZ A;  5EOZ A;  9ICJ A;  3ER8 C;  5HRG A;  4M0A A;  5J2F A;  3OVB A;  4YMO A;  4UB3 A;  5DBC A;  2GAF D;  4OAG A;  3OWG A;  4UAW A;  4JLZ A;  5DKW A;  3RH6 A;  2PFN A;  5DBB A;  1ZQR A;  5J2A A;  1ZQQ A;  3UXP A;  8ICG A;  1V4A A;  3L9D A;  3NKU A;  3ISD A;  8ICP A;  2W9M A;  1ZQB A;  3TFS A;  2HHP A;  1ZQV A;  4YD1 A;  4RQ1 A;  1ZQK A;  4KLQ A;  3TFR A;  4FHY A;  5D49 A;  3RJI A;  8ICJ A;  4K8V A;  4GXK A;  5HRI A;  3C2M A;  4K4H A;  5IIO A;  2ID1 A;  1ZQC A;  3RJJ A;  5DEC A;  4JLX A;  7ICK A;  4I2C A;  1NOM A;  1JQR A;  4WC7 A;  3PNC A;  9ICV A;  4TUS A;  4PGY A;  1ZQD A;  4WC5 A;  5CWR A;  5IIN A;  2DR9 A;  3JPS A;  3K7D A;  4XQ7 A;  7ICE A;  2ISP A;  4P2H A;  5J0T A;  2BE3 A;  4I29 A;  3MCR A;  3C18 A;  1XSN A;  5F2V O;  4FHV A;  8ICV A;  2DVI A;  4I28 A;  4LVS A;  4KLD A;  7ICL A;  3H39 A;  4Z6D A;  3OV7 A;  4I2A A;  4KLU A;  4MKP A;  5J0R A;  3RJF A;  4KLS A;  4WQL A;  3JPN A;  4F5O A;  9ICG A;  2O5A A;  1MIY A;  5D62 A;  4LEW A;  5HRL A;  3PHZ A;  5CFT A;  4QZA A;  1KEJ A;  4UBB A;  3RH5 A;  1ZQJ A;  1GPJ A;  2DRB A;  4DOA A;  5IIL A;  4WC2 A;  2GA9 D;  2IUB A;  2ZHA A;  3JCF A;  4X4N A;  4S3N A;  4WC0 A;  3AQM A;  5J2H A;  1RPL A;  8ICH A;  4NLK A;  1ZQG A;  4PH5 A;  4EGW A;  4O67 A;  2BPF A;  3RJG A;  4OAI Z;  8ICN A;  8ICT A;  5CFS A;  3AU6 A;  4IQV A;  3MDA A;  4OAH A;  3NYB A;  5J2J A;  5J0Q A;  5J2C A;  5BPC A;  4X5V A;  4RQ2 A;  4Z6F A;  3UQ0 A;  5J0X A;  4WH5 A;  4RPZ A;  4P4M A;  4NXW A;  4UB5 A;  2DRA A;  4NY8 A;  3AQN A;  5CFU A;  4RQ6 A;  5DB6 A;  4X4P A;  4O5C A;  5HRH A;  4RPX A;  3RJH A;  9ICO A;  3WFP A;  9ICN A;  3UQ2 A;  4FO1 A;  4EBJ A;  4MFA A;  4O9M A;  4K9A A;  4Z6C A;  1FA0 A;  4O5E A;  1ZQH A;  4NXZ A;  3WFO A;  2ZH6 A;  4YD2 A;  9ICM A;  1MIV A;  4KLT A;  5J0P A;  5DDM A;  2I9G A;  5CP2 A;  4QZG A;  1HUZ A;  8ICX A;  3MGH A;  4LT6 A;  4YN4 A;  4QZE A;  3K75 D;  7ICM A;  2DR5 A;  2ISO A;  3UXN A;  4YMN A;  1Q78 A;  2DR8 A;  4NKT A;  5J0S A;  2ZH2 A;  1VFG A;  5IIK A;  1MIW A;  4XJE A;  4EBK A;  9ICH A;  1ZQT A;  4XA5 A;  4I2G A;  9ICA A;  1TFW A;  4LEV A;  4N7R A;  3OGU A;  4RWN A;  3C5G A;  4WC4 A;  9ICB A;  4KLF A;  2EWR A;  1VJ7 A;  8ICS A;  1PX5 A;  8ICC A;  4NM2 A;  4PGX A;  4WCW A;  1UEV A;  5HRK A;  1ZQS A;  7ICI A;  4WBY A;  5JTG A;  7ICF A;  7ICQ A;  7ICH A;  4X4R A;  3JPQ A;  5J0W A;  4NXT A;  3PML A;  3WFR E;  7ICJ A;  4HX0 A;  4KLE A;  2HN2 A;  8ICA A;  9ICR A;  3NWI A;  2ZH3 A;  3H37 A;  3JZ0 A;  3B0Y A;  3JYY A;  2IHM A;  4RT2 A;  4PHP A;  4FH3 A;  2GWS A;  4AT7 A;  1R8B A;  4YMM A;  3MBY A;  1NO5 A;  5HR9 A;  4QZD A;  1BPE A;  2PFP A;  4K97 A;  4NXX A;  4M9J A;  1ZQY A;  4EED A;  4FHP A;  4PPX A;  5D63 A;  2FCL A;  4UD5 A;  5J2D A;  1BPZ A;  3PMN A;  7ICV A;  1JN3 A;  1ZQA A;  2M2U A;  5DED A;  4E80 A;  2BCS A;  9ICC A;  4QZH A;  3RH4 A;  5BOM A;  3JPO A;  1ZQW A;  1JMS A;  2ZH9 A;  5DB9 A;  4PHA A;  3V7J A;  9ICF A;  4LEZ A;  4AT7 B;  4XUS A;  4FH5 A;  4RPY A;  2BPG A;  5DB7 A;  4X4T A;  2ZH4 A;  2DR7 A;  1ZJN A;  4GXJ A;  5J2G A;  5HRE A;  4NXU A;  4KLH A;  7ICS A;  3HX0 A;  7ICG A;  5J0U A;  4M9L A;  5HRD A;  5DB8 A;  4OAF A;  8ICK A;  2PFQ A;  4O69 A;  3UXO A;  9ICX A;  4I2B A;  7ICR A;  5CHE A;  4UD4 A;  3MGI A;  5D46 A;  3H3A A;  4RQ0 A;  4TUR A;  3JPR A;  2M2V A;  2FMP A;  9ICL A;  1XSP A;  2M2W A;  4M2Y A;  3ISB A;  2PXI A;  8ICO A;  3V72 A;  3AUO A;  4KLI A;  1R8A A;  3H38 A;  4K96 A;  1ZQO A;  4GXI A;  5D4B A;  8ICR A;  4I2E A;  3RJK A;  2B4V A;  4I2J A;  4KB6 A;  4I27 A;  4AT8 A;  1F5A A;  4IQT A;  4XRH A;  3LK9 A;  3HWT A;  1ZQL A;  5HC9 A;  1ZQE A;  4M47 A;  3OUY A;  4FO6 A;  3JPP A;  1BPD A;  4O68 A;  8ICU A;  4UBC A;  4AT9 A;  2ZH1 A;  5J0O A;  2B51 A;  4K98 A;  4WC6 A;  2PFO A;  1YLQ A;  4MF2 A;  4I2I A;  3V7L A;  1TV9 A;  9ICE A;  3UPS A;  5HRB A;  4RQ5 A;  2B56 A;  4RWO A;  4DOB A;  4R64 A;  4X4V A;  2BBH A;  4I2D A;  1R89 A;  4QZI A;  1OU5 A;  1UET A; 
#chains in the Genus database with same CATH homology
 1BPX A;  9ICK A;  4RQ3 A;  9ICS A;  5BOL A;  5III A;  4AT8 B;  8ICB A;  2BCR A;  8ICF A;  5J0Y A;  1KDH A;  4X4U A;  4RQ7 A;  3OUY B;  4PHE A;  1XSL A;  4X0B A;  5HHI A;  1RZT A;  4AT9 B;  3C2K A;  4UAY A;  5IIM A;  4RQ8 A;  3MDC A;  4M04 A;  9ICI A;  4LZD A;  4RT3 A;  1ZQN A;  7ICU A;  5J2I A;  1TFY A;  5CA7 A;  4FHW A;  3JPT A;  9ICQ A;  4WC3 A;  5DBA A;  5J2B A;  2FMS A;  4X4Q A;  4NLN A;  1WOT A;  4KLG A;  4R65 A;  4I2F A;  4DO9 A;  8ICY A;  4UB2 A;  5CB1 A;  3HIY A;  3HJ1 A;  4Z6E A;  4M5D A;  4EP7 A;  4MFC A;  4KLO A;  2Q66 A;  2BCQ A;  4M9H A;  4LZG A;  4R66 A;  9ICT A;  1ZQI A;  2BCU A;  3HJ4 A;  5CJ7 A;  4F5N A;  5CR0 A;  4KLL A;  5J2K A;  4X0A A;  4UB4 A;  4X4O A;  4KLJ A;  8ICL A;  4YCX A;  3RJE A;  1ZQX A;  5DDY A;  4RQ4 A;  7ICT A;  2ZH8 A;  4FHX A;  1KNY A;  2M2T A;  3AQK A;  1ZQF A;  9ICU A;  1ZQM A;  7ICN A;  3OVA A;  4QZC A;  4IQU A;  4F5Q A;  4TUQ A;  4IG8 A;  4JWN A;  1HUO A;  4XQ8 A;  2BCV A;  9ICW A;  4TUP A;  1MQ3 A;  4KLM A;  2FMQ A;  4QZ9 A;  1BPY A;  1TVA A;  5IIJ A;  2ZHB A;  4UAZ A;  8ICM A;  4P4O A;  2PBE A;  4DOC A;  4M9G A;  5HHH A;  3C5F A;  4QZ8 A;  2BPC A;  4F5R A;  4ATB A;  4E7X A;  3OVS A;  3UPQ A;  4IQW A;  4K4G A;  1Q79 A;  4M9N A;  4NM1 A;  2O1P A;  1BPB A;  5HRF A;  4O5K A;  1ZQP A;  8ICZ A;  4PHD A;  8ICQ A;  4NKU A;  3C66 A;  2ZH7 A;  5TZV A;  5CHG A;  4R63 A;  4MF8 A;  8ICW A;  8ICI A;  4NLZ A;  4WC1 A;  3WFQ E;  1JAJ A;  4WBZ A;  3HW8 A;  3AQL A;  4QZF A;  3GDX A;  8ICE A;  4PGQ A;  3WFS C;  2ZH5 A;  4P4P A;  1R8C A;  4MFF A;  3AU2 A;  4ATB B;  5J29 A;  1UEU A;  4I2H A;  2NRK A;  2VAN A;  5J2E A;  3ISC A;  3V7K A;  4UB1 A;  4QZB A;  4K4I A;  4E8F A;  1MQ2 A;  3C2L A;  1ZQU A;  4RWQ A;  4F5P A;  4X4S A;  3B0X A;  7ICP A;  1ZJM A;  2P66 A;  2RFF A;  7ICO A;  4JWM A;  9ICP A;  3LQC B;  4RWP A;  1ZQZ A;  5EOZ A;  9ICJ A;  5HRG A;  4M0A A;  5J2F A;  3OVB A;  4YMO A;  4UB3 A;  5DBC A;  4UAW A;  5DKW A;  3RH6 A;  2PFN A;  5DBB A;  1ZQR A;  5J2A A;  1ZQQ A;  3UXP A;  8ICG A;  1V4A A;  3L9D A;  3ISD A;  8ICP A;  2W9M A;  1ZQB A;  3TFS A;  2HHP A;  1ZQV A;  4YD1 A;  4RQ1 A;  1ZQK A;  4KLQ A;  3TFR A;  4FHY A;  5D49 A;  3RJI A;  8ICJ A;  4GXK A;  5HRI A;  3C2M A;  4K4H A;  5IIO A;  2ID1 A;  1ZQC A;  3RJJ A;  5DEC A;  7ICK A;  4I2C A;  1NOM A;  1JQR A;  4WC7 A;  3PNC A;  9ICV A;  4TUS A;  4PGY A;  1ZQD A;  4WC5 A;  5CWR A;  5IIN A;  2DR9 A;  3JPS A;  4XQ7 A;  7ICE A;  2ISP A;  4P2H A;  5J0T A;  2BE3 A;  4I29 A;  5F2V O;  3C18 A;  1XSN A;  4FHV A;  8ICV A;  2DVI A;  4I28 A;  4LVS A;  4KLD A;  7ICL A;  3H39 A;  4Z6D A;  3OV7 A;  4I2A A;  4KLU A;  5J0R A;  3RJF A;  4KLS A;  3JPN A;  4F5O A;  9ICG A;  2O5A A;  1MIY A;  5HRL A;  4QZA A;  1KEJ A;  4UBB A;  3RH5 A;  1ZQJ A;  2DRB A;  4DOA A;  5IIL A;  4WC2 A;  2ZHA A;  4X4N A;  4S3N A;  4WC0 A;  3AQM A;  5J2H A;  1RPL A;  8ICH A;  4NLK A;  1ZQG A;  4PH5 A;  2BPF A;  3RJG A;  8ICN A;  8ICT A;  3AU6 A;  4IQV A;  3MDA A;  3NYB A;  5J2J A;  5J0Q A;  5J2C A;  5BPC A;  4X5V A;  4RQ2 A;  4Z6F A;  3UQ0 A;  5J0X A;  4RPZ A;  4P4M A;  4UB5 A;  2DRA A;  4NY8 A;  3AQN A;  4RQ6 A;  5DB6 A;  4X4P A;  4O5C A;  5HRH A;  4RPX A;  3RJH A;  9ICO A;  3WFP A;  9ICN A;  3UQ2 A;  4EBJ A;  4MFA A;  4O9M A;  4Z6C A;  1FA0 A;  4O5E A;  1ZQH A;  4NXZ A;  3WFO A;  2ZH6 A;  4YD2 A;  9ICM A;  1MIV A;  4KLT A;  5J0P A;  5DDM A;  2I9G A;  5CP2 A;  4QZG A;  1HUZ A;  8ICX A;  3MGH A;  4LT6 A;  4YN4 A;  4QZE A;  3K75 D;  7ICM A;  2DR5 A;  2ISO A;  3UXN A;  4YMN A;  1Q78 A;  2DR8 A;  4NKT A;  5J0S A;  2ZH2 A;  1VFG A;  5IIK A;  1MIW A;  4EBK A;  9ICH A;  1ZQT A;  4XA5 A;  4I2G A;  9ICA A;  1TFW A;  3OGU A;  4RWN A;  3C5G A;  4WC4 A;  9ICB A;  4KLF A;  1VJ7 A;  8ICS A;  1PX5 A;  8ICC A;  4NM2 A;  4PGX A;  4WCW A;  1UEV A;  5HRK A;  1ZQS A;  7ICI A;  4WBY A;  7ICF A;  7ICQ A;  7ICH A;  4X4R A;  3JPQ A;  5J0W A;  3PML A;  3WFR E;  7ICJ A;  4KLE A;  8ICA A;  9ICR A;  2ZH3 A;  3H37 A;  3JZ0 A;  3B0Y A;  3JYY A;  2IHM A;  4RT2 A;  4PHP A;  4FH3 A;  2GWS A;  4AT7 A;  1R8B A;  4YMM A;  3MBY A;  1NO5 A;  5HR9 A;  4QZD A;  1BPE A;  2PFP A;  4M9J A;  1ZQY A;  4FHP A;  4PPX A;  4UD5 A;  5J2D A;  1BPZ A;  3PMN A;  7ICV A;  1JN3 A;  1ZQA A;  2M2U A;  5DED A;  4E80 A;  2BCS A;  9ICC A;  4QZH A;  3RH4 A;  5BOM A;  3JPO A;  1ZQW A;  1JMS A;  2ZH9 A;  5DB9 A;  4PHA A;  3V7J A;  9ICF A;  4AT7 B;  4XUS A;  4FH5 A;  4RPY A;  2BPG A;  5DB7 A;  4X4T A;  2ZH4 A;  2DR7 A;  1ZJN A;  4GXJ A;  5J2G A;  5HRE A;  4KLH A;  7ICS A;  3HX0 A;  7ICG A;  5J0U A;  4M9L A;  5HRD A;  5DB8 A;  8ICK A;  2PFQ A;  3UXO A;  9ICX A;  4I2B A;  7ICR A;  4UD4 A;  3MGI A;  5D46 A;  3H3A A;  4RQ0 A;  4TUR A;  3JPR A;  2M2V A;  2FMP A;  9ICL A;  1XSP A;  2M2W A;  4M2Y A;  3ISB A;  2PXI A;  8ICO A;  3V72 A;  3AUO A;  4KLI A;  1R8A A;  3H38 A;  1ZQO A;  4GXI A;  5D4B A;  8ICR A;  4I2E A;  3RJK A;  4I2J A;  4I27 A;  4AT8 A;  1F5A A;  4IQT A;  4XRH A;  3LK9 A;  3HWT A;  1ZQL A;  5HC9 A;  1ZQE A;  4M47 A;  3OUY A;  4FO6 A;  3JPP A;  1BPD A;  8ICU A;  4UBC A;  4AT9 A;  2ZH1 A;  5J0O A;  4WC6 A;  2PFO A;  1YLQ A;  4MF2 A;  4I2I A;  3V7L A;  1TV9 A;  9ICE A;  3UPS A;  5HRB A;  4RQ5 A;  4RWO A;  4DOB A;  4R64 A;  4X4V A;  4I2D A;  1R89 A;  4QZI A;  1OU5 A;  1UET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...