4WC0A

Trna-processing enzyme with atp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 104
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc0A01
9ICEA 1ZQEA 2ZH3A 4X4RA 3L9DA 5J0RA 7ICJA 4RPYA 4QZHA 1ZQYA 4NXZA 4WC6A 4YD1A 3ISCA 4YMMA 1ZQSA 4I2JA 1ZQLA 4PHEA 4JWNA 3JPTA 4WC2A 3HJ1A 4M04A 5CWRA 4K4GA 7ICUA 2W9MA 4UAWA 2PBEA 4I2GA 1MIVA 4I2EA 4M9HA 3K75D 9ICOA 4KLUA 4MF2A 4WBZA 5J0TA 4RPXA 1VFGA 4RPZA 2DR7A 2HHPA 3JZ0A 2DR9A 4AT9A 3WFRE 5J0UA 5J0XA 1BPZA 2DVIA 3AU2A 4X0AA 5DB8A 5BOLA 2ZH8A 1ZQPA 4EBKA 5DB6A 4LZGA 5J0YA 5HRLA 4AT7A 3HX0A 5HRDA 5DBBA 3PMNA 3GDXA 4I2BA 4FHYA 4GXJA 4FH3A 4KLQA 4RWOA 5BPCA 3V7JA 2DRAA 5J2DA 8ICCA 1V4AA 1ZQCA 8ICAA 7ICSA 4Z6DA 8ICBA 4KLHA 7ICMA 4PH5A 4DOCA 1ZQVA 1JQRA 8ICRA 4IQUA 5J0SA 4UBCA 1WOTA 5J2AA 9ICXA 4KLTA 2FMQA 5J2EA 4PHPA 4XA5A 4QZAA 5CA7A 4P4MA 1JN3A 4P4OA 5CP2A 3OVSA 4DO9A 2BPGA 4KLDA 5CR0A 4E80A 4IQVA 1RZTA 4F5PA 4AT8A 8ICVA 3C18A 4QZEA 2O5AA 5HC9A 1R8BA 4LT6A 3WFSC 8ICPA 4I2CA 4F5NA 8ICXA 3UPSA 1Q78A 3V72A 8ICNA 4E8FA 2PFOA 9ICKA 2M2WA 4RQ5A 3MDCA 4I2AA 1ZQRA 7ICEA 4PGQA 4TURA 4M0AA 4Z6FA 4TUQA 8ICWA 4K4HA 4UD4A 5J2IA 1TVAA 4XQ7A 4R63A 1ZJMA 4PHAA 4R65A 8ICHA 3HJ4A 4PHDA 5HRHA 3ISBA 3OVBA 5IILA 5D4BA 3MDAA 4TUSA 2BCQA 4MFAA 9ICLA 5J2KA 4F5QA 4NY8A 1MQ3A 1TFYA 4PPXA 5D46A 5CJ7A 5HRFA 9ICFA 7ICRA 2I9GA 4RQ4A 4I2FA 1BPDA 5J2FA 2ISPA 3JPPA 4M9JA 2BCUA 1OU5A 4RWQA 4MF8A 1ZQMA 2DRBA 2GWSA 2IHMA 5J2JA 3C2KA 2ZH9A 1BPBA 4X4NA 3JPNA 4FHPA 5TZVA 4IQWA 4EP7A 5DDMA 2ZH7A 4RT2A 3HW8A 7ICGA 4ATBB 4PGXA 8ICEA 4EBJA 1UEVA 4UB5A 4UB1A 5HHIA 1UEUA 9ICJA 4WC1A 4F5OA 4UBBA 3AQLA 5HREA 4LVSA 2BCVA 5D49A 9ICCA 8ICMA 4FO6A 1HUOA 8ICGA 4X4UA 1ZQUA 5DECA 4KLIA 3MGHA 3JYYA 3B0YA 5IIKA 1Q79A 9ICIA 1ZQXA 2BCSA 7ICTA 2FMPA 4I2HA 3RJFA 4KLFA 1BPXA 3JPOA 4GXKA 4RWNA 5DBCA 1ZQHA 4UAZA 4QZ8A 3OGUA 4RQ0A 2BCRA 4I27A 3HIYA 9ICNA 5HRKA 4QZDA 1ZQJA 2ZH5A 4QZBA 3RH5A 3OUYB 3C5GA 4RQ3A 3MGIA 4YCXA 3NYBA 4UB3A 4GXIA 1PX5A 1VJ7A 4YMNA 3RH6A 4WC0A 3TFSA 2ZH6A 9ICQA 5J2GA 4I29A 5J29A 5HRBA 1JAJA 3H37A 5BOMA 2ZH2A 2ZHAA 3TFRA 1ZQZA 3RJGA 3C2MA 3OV7A 5J2HA 4WCWA 3LK9A 4KLJA 2PFQA 3RJJA 8ICQA 4WBYA 1ZQBA 2BE3A 1R89A 2RFFA 9ICMA 4LZDA 3UXOA 4O9MA 3ISDA 4ATBA 4YMOA 1ZQNA 7ICNA 4O5CA 8ICSA 8ICJA 1KNYA 2PFPA 3RH4A 4XUSA 2M2TA 4FH5A 1RPLA 3UXNA 3UQ2A 5IIOA 5CHGA 3H3AA 4P4PA 4P2HA 2M2UA 3PMLA 7ICLA 1MIWA 7ICPA 4I2IA 8ICUA 4QZCA 4QZ9A 3OVAA 5IIMA 4DOBA 3C2LA 1TV9A 4NKUA 1NO5A 5HR9A 4KLGA 4E7XA 2BPFA 4NM1A 4XQ8A 2ZHBA 4RQ7A 9ICAA 1HUZA 4UAYA 1ZQGA 2ISOA 5DBAA 3UPQA 2P66A 4O5EA 3AU6A 4NLKA 1R8AA 7ICVA 7ICKA 1ZQFA 3V7KA 1ZQTA 4X4OA 3OUYA 4RWPA 4UB2A 9ICBA 5HRIA 3H38A 3V7LA 5CB1A 4M2YA 1ZQAA 4TUPA 2Q66A 9ICGA 4K4IA 4M5DA 3C66A 4O5KA 3C5FA 4S3NA 9ICTA 1KEJA 5DB7A 4NKTA 3UQ0A 2VANA 3PNCA 4RQ6A 5J0PA 2PFNA 9ICWA 4R64A 4KLLA 2NRKA 4WC7A 3WFPA 1KDHA 1ZQQA 4NLNA 1ZQKA 1XSPA 4QZGA 1ZQWA 2ZH1A 1XSNA 3JPQA 3AQMA 4DOAA 5J2CA 1JMSA 4X4VA 4M9NA 4KLSA 1ZQDA 5F2VO 4MFCA 4M9GA 3JPRA 2DR5A 1ZQIA 4RQ8A 5J0OA 1TFWA 4IQTA 1BPEA 5IIIA 1MQ2A 4R66A 3RJKA 4X4TA 4FHXA 2ID1A 4X0BA 1YLQA 4NM2A 4WC4A 5DB9A 4X4SA 8ICZA 4XRHA 4X4PA 9ICHA 3LQCB 4I2DA 8ICOA 5IINA 1NOMA 4FHVA 4UB4A 8ICIA 5IIJA 4WC3A 3AQKA 9ICVA 4AT9B 1MIYA 5DEDA 4FHWA 1UETA 4KLMA 8ICTA 9ICRA 4YN4A 5J0QA 2PXIA 4Z6EA 8ICFA 4WC5A 4QZIA 9ICPA 4Z6CA 4AT7B 1R8CA 1ZQOA 2BPCA 3WFOA 4RT3A 4YD2A 3JPSA 3RJIA 7ICQA 4M47A 3AQNA 3WFQE 4M9LA 3MBYA 7ICOA 4JWMA 4QZFA 4MFFA 5HHHA 1BPYA 4KLEA 7ICFA 3UXPA 3HWTA 3B0XA 5HRGA 5EOZA 4F5RA 5DKWA 1ZJNA 3AUOA 7ICHA 2DR8A 2ZH4A 2M2VA 2FMSA 4UD5A 3RJEA 3H39A 3RJHA 2O1PA 4I28A 4X4QA 4AT8B 9ICSA 8ICKA 8ICLA 4X5VA 5J0WA 9ICUA 7ICIA 8ICYA 4RQ1A 1F5AA 4PGYA 5DDYA 4NLZA 4RQ2A 1XSLA 5J2BA 1FA0A 4KLOA 4IG8A
chains in the Genus database with same CATH superfamily
9ICEA 3PHZA 1ZQEA 2ZH3A 4X4RA 3L9DA 5J0RA 7ICJA 4RPYA 4QZHA 1ZQYA 4NXZA 4WC6A 3NVOA 4YD1A 3ISCA 4YMMA 1ZQSA 4I2JA 1ZQLA 4PHEA 4JWNA 3JPTA 4WC2A 3HJ1A 4M04A 5CWRA 4K4GA 7ICUA 2W9MA 4UAWA 2PBEA 4I2GA 1MIVA 4I2EA 4M9HA 3K75D 9ICOA 4KLUA 4MF2A 4WBZA 5J0TA 4RPXA 1VFGA 4RPZA 2DR7A 2HHPA 3JZ0A 2DR9A 5CFTA 4AT9A 3WFRE 3OWGA 5J0UA 1GPJA 5J0XA 1BPZA 4K8VA 2DVIA 3AU2A 4X0AA 5DB8A 5BOLA 2ZH8A 1ZQPA 4EBKA 5DB6A 4LZGA 4WOYA 5HRLA 4AT7A 5J0YA 3HX0A 5HRDA 5DBBA 3PMNA 3GDXA 5D63A 4I2BA 4FHYA 4GXJA 4FH3A 4KLQA 4RWOA 5BPCA 3V7JA 2DRAA 5J2DA 8ICCA 4FO1A 1V4AA 1ZQCA 8ICAA 7ICSA 4Z6DA 8ICBA 4KLHA 7ICMA 4PH5A 4DOCA 1ZQVA 1JQRA 8ICRA 4IQUA 5CHEA 5J0SA 4UBCA 1WOTA 5J2AA 9ICXA 4KLTA 2EWRA 4N7RA 2FMQA 5J2EA 4PHPA 4XA5A 4QZAA 5CA7A 4P4MA 1JN3A 4P4OA 5CP2A 3OVSA 4DO9A 2BPGA 4KLDA 4K99A 4LEWA 5CR0A 4E80A 4IQVA 1RZTA 4F5PA 4AT8A 8ICVA 3C18A 4QZEA 2O5AA 5HC9A 1R8BA 4LT6A 3WFSC 8ICPA 4I2CA 4F5NA 8ICXA 3EF2A 3UPSA 1Q78A 3V72A 8ICNA 4E8FA 2PFOA 9ICKA 2M2WA 4RQ5A 4NXWA 3MDCA 4I2AA 1ZQRA 7ICEA 4PGQA 4TURA 4M0AA 4Z6FA 4TUQA 8ICWA 4K4HA 4UD4A 5J2IA 1TVAA 4XQ7A 4R63A 1ZJMA 4PHAA 4R65A 8ICHA 3HJ4A 4PHDA 5HRHA 3ISBA 3OVBA 5IILA 5D4BA 3MDAA 4TUSA 2BCQA 4MFAA 9ICLA 5J2KA 4F5QA 4NY8A 1MQ3A 1TFYA 4PPXA 5D46A 5CJ7A 5HRFA 4LEZA 9ICFA 7ICRA 2I9GA 4RQ4A 4I2FA 1BPDA 5J2FA 2ISPA 3JPPA 4M9JA 2BCUA 4WH5A 1OU5A 4RWQA 4MF8A 1ZQMA 2DRBA 2GWSA 2IHMA 5J2JA 3C2KA 2ZH9A 1BPBA 4X4NA 3JPNA 4FHPA 2HN1A 5TZVA 4IQWA 4EP7A 5DDMA 2ZH7A 4RT2A 3HW8A 3ERCC 7ICGA 4ATBB 4PGXA 8ICEA 4EBJA 1UEVA 2HN2A 4UB5A 5CFSA 4UB1A 5HHIA 1UEUA 9ICJA 4WC1A 4F5OA 4EGWA 4UBBA 3AQLA 5CFUA 5HREA 4LVSA 5D62A 2BCVA 4O6AA 5D49A 5B3QA 9ICCA 8ICMA 4KM5A 4FO6A 1HUOA 8ICGA 4X4UA 1ZQUA 5DECA 4KLIA 3MGHA 3JYYA 3B0YA 5IIKA 1Q79A 2B4VA 9ICIA 1ZQXA 2BCSA 7ICTA 2FMPA 4I2HA 4WQLA 3RJFA 4KLFA 1BPXA 3JPOA 4GXKA 4RWNA 5DBCA 1ZQHA 4HX0A 4UAZA 4WQKA 4QZ8A 3OGUA 4RQ0A 2BCRA 4I27A 3HIYA 2GA9D 9ICNA 5HRKA 4QZDA 1ZQJA 2ZH5A 4QZBA 3RH5A 3OUYB 4NXUA 3C5GA 4RQ3A 3MGIA 4K96A 4YCXA 3NYBA 4O69A 4UB3A 4GXIA 1PX5A 1VJ7A 2IUBA 4YMNA 3RH6A 4XJEA 4WC0A 3TFSA 2ZH6A 9ICQA 5J2GA 4I29A 5J29A 4OAFA 4NXVA 5HRBA 3NWIA 1JAJA 3H37A 5BOMA 2ZH2A 2ZHAA 3TFRA 1ZQZA 3RJGA 3C2MA 3OV7A 5J2HA 4WCWA 3LK9A 4KLJA 2PFQA 3RJJA 8ICQA 2BBHA 4OAIZ 4WBYA 1ZQBA 2BE3A 1R89A 2RFFA 9ICMA 4LZDA 3UXOA 4O9MA 3ISDA 4ATBA 4YMOA 1ZQNA 7ICNA 4O5CA 8ICSA 5B3PA 8ICJA 1KNYA 3NKUA 2PFPA 3RH4A 4XUSA 2M2TA 4FH5A 1RPLA 3UXNA 3UQ2A 5IIOA 5CHGA 4K97A 3H3AA 4K98A 4P4PA 4I0UA 4P2HA 2M2UA 3PMLA 7ICLA 1MIWA 7ICPA 4I2IA 8ICUA 3ER9B 4QZCA 4QZ9A 3OVAA 5IIMA 4DOBA 3C2LA 1TV9A 4NKUA 1NO5A 5HR9A 4KLGA 4E7XA 2BPFA 4NM1A 4XQ8A 2ZHBA 4RQ7A 9ICAA 1HUZA 4UAYA 1ZQGA 2ISOA 5DBAA 3UPQA 2P66A 4O5EA 3AU6A 4NLKA 4JLZA 1R8AA 7ICVA 7ICKA 1ZQFA 3V7KA 1ZQTA 4EV6A 2B51A 4X4OA 3OUYA 4LEVA 4RWPA 4UB2A 9ICBA 5HRIA 3H38A 3V7LA 5CB1A 4M2YA 1ZQAA 4TUPA 2Q66A 9ICGA 4K4IA 4M5DA 3C66A 4O5KA 3C5FA 4S3NA 9ICTA 1KEJA 5DB7A 4NKTA 3UQ0A 2VANA 3PNCA 4RQ6A 5J0PA 2PFNA 9ICWA 4R64A 4KLLA 2NRKA 4WC7A 4JLXA 3WFPA 1KDHA 1ZQQA 4NLNA 1ZQKA 1XSPA 4O68A 4QZGA 1ZQWA 2ZH1A 1XSNA 2B56A 4OAHA 3JPQA 3ER8C 3AQMA 5D61A 4DOAA 4EEDA 5J2CA 5JTGA 1JMSA 4X4VA 4NXXA 4M9NA 4KLSA 1ZQDA 5F2VO 4MFCA 4NXTA 4M9GA 3JPRA 2DR5A 3JCFA 1ZQIA 4RQ8A 5J0OA 1TFWA 4IQTA 1BPEA 5IIIA 4LEYA 1MQ2A 4R66A 3RJKA 4X4TA 4FHXA 2ID1A 4X0BA 1YLQA 4NM2A 4WC4A 5DB9A 4X4SA 8ICZA 4XRHA 4X4PA 9ICHA 3LQCB 4I2DA 8ICOA 5IINA 1NOMA 4FHVA 4UB4A 4KB6A 2BBJA 8ICIA 5IIJA 4WC3A 3AQKA 9ICVA 4AT9B 1MIYA 5DEDA 4FHWA 1UETA 4KLMA 8ICTA 9ICRA 4EEBA 4YN4A 5J0QA 2PXIA 4Z6EA 8ICFA 4MKPA 4WC5A 4QZIA 3K7DA 9ICPA 4Z6CA 4AT7B 1R8CA 1ZQOA 3CK6A 2BPCA 3WFOA 3MCRA 4YD2A 4RT3A 3JPSA 3RJIA 7ICQA 4M47A 3AQNA 3WFQE 4M9LA 3MBYA 7ICOA 4JWMA 4QZFA 2IHOA 4MFFA 2FCLA 5HHHA 1BPYA 4KLEA 7ICFA 3UXPA 3HWTA 4K9AA 3B0XA 4O67A 5HRGA 5EOZA 4F5RA 5DKWA 1ZJNA 3AUOA 7ICHA 2DR8A 2ZH4A 2M2VA 2FMSA 4OAGA 4UD5A 3RJEA 3H39A 3RJHA 2O1PA 4I28A 4X4QA 4K9BA 4AT8B 9ICSA 8ICKA 2GAFD 8ICLA 4X5VA 5J0WA 9ICUA 7ICIA 8ICYA 4RQ1A 1F5AA 4PGYA 5DDYA 4NLZA 4RQ2A 1XSLA 5J2BA 1FA0A 4KLOA 4IG8A
chains in the Genus database with same CATH topology
9ICEA 1ZQEA 2ZH3A 4X4RA 3L9DA 5J0RA 7ICJA 4RPYA 4QZHA 1ZQYA 4NXZA 4WC6A 4YD1A 3ISCA 4YMMA 1ZQSA 4I2JA 1ZQLA 4PHEA 4JWNA 3JPTA 4WC2A 3HJ1A 4M04A 5CWRA 4K4GA 7ICUA 2W9MA 4UAWA 2PBEA 4I2GA 1MIVA 4I2EA 4M9HA 3K75D 9ICOA 4KLUA 4MF2A 4WBZA 5J0TA 4RPXA 1VFGA 4RPZA 2DR7A 2HHPA 3JZ0A 2DR9A 4AT9A 3WFRE 5J0UA 5J0XA 1BPZA 2DVIA 3AU2A 4X0AA 5DB8A 5BOLA 2ZH8A 1ZQPA 4EBKA 5DB6A 4LZGA 5J0YA 5HRLA 4AT7A 3HX0A 5HRDA 5DBBA 3PMNA 3GDXA 4I2BA 4FHYA 4GXJA 4FH3A 4KLQA 4RWOA 5BPCA 3V7JA 2DRAA 5J2DA 8ICCA 1V4AA 1ZQCA 8ICAA 7ICSA 4Z6DA 8ICBA 4KLHA 7ICMA 4PH5A 4DOCA 1ZQVA 1JQRA 8ICRA 4IQUA 5J0SA 4UBCA 1WOTA 5J2AA 9ICXA 4KLTA 2FMQA 5J2EA 4PHPA 4XA5A 4QZAA 5CA7A 4P4MA 1JN3A 4P4OA 5CP2A 3OVSA 4DO9A 2BPGA 4KLDA 5CR0A 4E80A 4IQVA 1RZTA 4F5PA 4AT8A 8ICVA 3C18A 4QZEA 2O5AA 5HC9A 1R8BA 4LT6A 3WFSC 8ICPA 4I2CA 4F5NA 8ICXA 3UPSA 1Q78A 3V72A 8ICNA 4E8FA 2PFOA 9ICKA 2M2WA 4RQ5A 3MDCA 4I2AA 1ZQRA 7ICEA 4PGQA 4TURA 4M0AA 4Z6FA 4TUQA 8ICWA 4K4HA 4UD4A 5J2IA 1TVAA 4XQ7A 4R63A 1ZJMA 4PHAA 4R65A 8ICHA 3HJ4A 4PHDA 5HRHA 3ISBA 3OVBA 5IILA 5D4BA 3MDAA 4TUSA 2BCQA 4MFAA 9ICLA 5J2KA 4F5QA 4NY8A 1MQ3A 1TFYA 4PPXA 5D46A 5CJ7A 5HRFA 9ICFA 7ICRA 2I9GA 4RQ4A 4I2FA 1BPDA 5J2FA 2ISPA 3JPPA 4M9JA 2BCUA 1OU5A 4RWQA 4MF8A 1ZQMA 2DRBA 2GWSA 2IHMA 5J2JA 3C2KA 2ZH9A 1BPBA 4X4NA 3JPNA 4FHPA 5TZVA 4IQWA 4EP7A 5DDMA 2ZH7A 4RT2A 3HW8A 7ICGA 4ATBB 4PGXA 8ICEA 4EBJA 1UEVA 4UB5A 4UB1A 5HHIA 1UEUA 9ICJA 4WC1A 4F5OA 4UBBA 3AQLA 5HREA 4LVSA 2BCVA 5D49A 9ICCA 8ICMA 4FO6A 1HUOA 8ICGA 4X4UA 1ZQUA 5DECA 4KLIA 3MGHA 3JYYA 3B0YA 5IIKA 1Q79A 9ICIA 1ZQXA 2BCSA 7ICTA 2FMPA 4I2HA 3RJFA 4KLFA 1BPXA 3JPOA 4GXKA 4RWNA 5DBCA 1ZQHA 4UAZA 4QZ8A 3OGUA 4RQ0A 2BCRA 4I27A 3HIYA 9ICNA 5HRKA 4QZDA 1ZQJA 2ZH5A 4QZBA 3RH5A 3OUYB 3C5GA 4RQ3A 3MGIA 4YCXA 3NYBA 4UB3A 4GXIA 1PX5A 1VJ7A 4YMNA 3RH6A 4WC0A 3TFSA 2ZH6A 9ICQA 5J2GA 4I29A 5J29A 5HRBA 1JAJA 3H37A 5BOMA 2ZH2A 2ZHAA 3TFRA 1ZQZA 3RJGA 3C2MA 3OV7A 5J2HA 4WCWA 3LK9A 4KLJA 2PFQA 3RJJA 8ICQA 4WBYA 1ZQBA 2BE3A 1R89A 2RFFA 9ICMA 4LZDA 3UXOA 4O9MA 3ISDA 4ATBA 4YMOA 1ZQNA 7ICNA 4O5CA 8ICSA 8ICJA 1KNYA 2PFPA 3RH4A 4XUSA 2M2TA 4FH5A 1RPLA 3UXNA 3UQ2A 5IIOA 5CHGA 3H3AA 4P4PA 4P2HA 2M2UA 3PMLA 7ICLA 1MIWA 7ICPA 4I2IA 8ICUA 4QZCA 4QZ9A 3OVAA 5IIMA 4DOBA 3C2LA 1TV9A 4NKUA 1NO5A 5HR9A 4KLGA 4E7XA 2BPFA 4NM1A 4XQ8A 2ZHBA 4RQ7A 9ICAA 1HUZA 4UAYA 1ZQGA 2ISOA 5DBAA 3UPQA 2P66A 4O5EA 3AU6A 4NLKA 1R8AA 7ICVA 7ICKA 1ZQFA 3V7KA 1ZQTA 4X4OA 3OUYA 4RWPA 4UB2A 9ICBA 5HRIA 3H38A 3V7LA 5CB1A 4M2YA 1ZQAA 4TUPA 2Q66A 9ICGA 4K4IA 4M5DA 3C66A 4O5KA 3C5FA 4S3NA 9ICTA 1KEJA 5DB7A 4NKTA 3UQ0A 2VANA 3PNCA 4RQ6A 5J0PA 2PFNA 9ICWA 4R64A 4KLLA 2NRKA 4WC7A 3WFPA 1KDHA 1ZQQA 4NLNA 1ZQKA 1XSPA 4QZGA 1ZQWA 2ZH1A 1XSNA 3JPQA 3AQMA 4DOAA 5J2CA 1JMSA 4X4VA 4M9NA 4KLSA 1ZQDA 5F2VO 4MFCA 4M9GA 3JPRA 2DR5A 1ZQIA 4RQ8A 5J0OA 1TFWA 4IQTA 1BPEA 5IIIA 1MQ2A 4R66A 3RJKA 4X4TA 4FHXA 2ID1A 4X0BA 1YLQA 4NM2A 4WC4A 5DB9A 4X4SA 8ICZA 4XRHA 4X4PA 9ICHA 3LQCB 4I2DA 8ICOA 5IINA 1NOMA 4FHVA 4UB4A 8ICIA 5IIJA 4WC3A 3AQKA 9ICVA 4AT9B 1MIYA 5DEDA 4FHWA 1UETA 4KLMA 8ICTA 9ICRA 4YN4A 5J0QA 2PXIA 4Z6EA 8ICFA 4WC5A 4QZIA 9ICPA 4Z6CA 4AT7B 1R8CA 1ZQOA 2BPCA 3WFOA 4RT3A 4YD2A 3JPSA 3RJIA 7ICQA 4M47A 3AQNA 3WFQE 4M9LA 3MBYA 7ICOA 4JWMA 4QZFA 4MFFA 5HHHA 1BPYA 4KLEA 7ICFA 3UXPA 3HWTA 3B0XA 5HRGA 5EOZA 4F5RA 5DKWA 1ZJNA 3AUOA 7ICHA 2DR8A 2ZH4A 2M2VA 2FMSA 4UD5A 3RJEA 3H39A 3RJHA 2O1PA 4I28A 4X4QA 4AT8B 9ICSA 8ICKA 8ICLA 4X5VA 5J0WA 9ICUA 7ICIA 8ICYA 4RQ1A 1F5AA 4PGYA 5DDYA 4NLZA 4RQ2A 1XSLA 5J2BA 1FA0A 4KLOA 4IG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICE A;  1ZQE A;  2ZH3 A;  4X4R A;  3L9D A;  5J0R A;  7ICJ A;  4RPY A;  4QZH A;  1ZQY A;  4NXZ A;  4WC6 A;  4YD1 A;  3ISC A;  4YMM A;  1ZQS A;  4I2J A;  1ZQL A;  4PHE A;  4JWN A;  3JPT A;  4WC2 A;  3HJ1 A;  4M04 A;  5CWR A;  4K4G A;  7ICU A;  2W9M A;  4UAW A;  2PBE A;  4I2G A;  1MIV A;  4I2E A;  4M9H A;  3K75 D;  9ICO A;  4KLU A;  4MF2 A;  4WBZ A;  5J0T A;  4RPX A;  1VFG A;  4RPZ A;  2DR7 A;  2HHP A;  3JZ0 A;  2DR9 A;  4AT9 A;  3WFR E;  5J0U A;  5J0X A;  1BPZ A;  2DVI A;  3AU2 A;  4X0A A;  5DB8 A;  5BOL A;  2ZH8 A;  1ZQP A;  4EBK A;  5DB6 A;  4LZG A;  5J0Y A;  5HRL A;  4AT7 A;  3HX0 A;  5HRD A;  5DBB A;  3PMN A;  3GDX A;  4I2B A;  4FHY A;  4GXJ A;  4FH3 A;  4KLQ A;  4RWO A;  5BPC A;  3V7J A;  2DRA A;  5J2D A;  8ICC A;  1V4A A;  1ZQC A;  8ICA A;  7ICS A;  4Z6D A;  8ICB A;  4KLH A;  7ICM A;  4PH5 A;  4DOC A;  1ZQV A;  1JQR A;  8ICR A;  4IQU A;  5J0S A;  4UBC A;  1WOT A;  5J2A A;  9ICX A;  4KLT A;  2FMQ A;  5J2E A;  4PHP A;  4XA5 A;  4QZA A;  5CA7 A;  4P4M A;  1JN3 A;  4P4O A;  5CP2 A;  3OVS A;  4DO9 A;  2BPG A;  4KLD A;  5CR0 A;  4E80 A;  4IQV A;  1RZT A;  4F5P A;  4AT8 A;  8ICV A;  3C18 A;  4QZE A;  2O5A A;  5HC9 A;  1R8B A;  4LT6 A;  3WFS C;  8ICP A;  4I2C A;  4F5N A;  8ICX A;  3UPS A;  1Q78 A;  3V72 A;  8ICN A;  4E8F A;  2PFO A;  9ICK A;  2M2W A;  4RQ5 A;  3MDC A;  4I2A A;  1ZQR A;  7ICE A;  4PGQ A;  4TUR A;  4M0A A;  4Z6F A;  4TUQ A;  8ICW A;  4K4H A;  4UD4 A;  5J2I A;  1TVA A;  4XQ7 A;  4R63 A;  1ZJM A;  4PHA A;  4R65 A;  8ICH A;  3HJ4 A;  4PHD A;  5HRH A;  3ISB A;  3OVB A;  5IIL A;  5D4B A;  3MDA A;  4TUS A;  2BCQ A;  4MFA A;  9ICL A;  5J2K A;  4F5Q A;  4NY8 A;  1MQ3 A;  1TFY A;  4PPX A;  5D46 A;  5CJ7 A;  5HRF A;  9ICF A;  7ICR A;  2I9G A;  4RQ4 A;  4I2F A;  1BPD A;  5J2F A;  2ISP A;  3JPP A;  4M9J A;  2BCU A;  1OU5 A;  4RWQ A;  4MF8 A;  1ZQM A;  2DRB A;  2GWS A;  2IHM A;  5J2J A;  3C2K A;  2ZH9 A;  1BPB A;  4X4N A;  3JPN A;  4FHP A;  5TZV A;  4IQW A;  4EP7 A;  5DDM A;  2ZH7 A;  4RT2 A;  3HW8 A;  7ICG A;  4ATB B;  4PGX A;  8ICE A;  4EBJ A;  1UEV A;  4UB5 A;  4UB1 A;  5HHI A;  1UEU A;  9ICJ A;  4WC1 A;  4F5O A;  4UBB A;  3AQL A;  5HRE A;  4LVS A;  2BCV A;  5D49 A;  9ICC A;  8ICM A;  4FO6 A;  1HUO A;  8ICG A;  4X4U A;  1ZQU A;  5DEC A;  4KLI A;  3MGH A;  3JYY A;  3B0Y A;  5IIK A;  1Q79 A;  9ICI A;  1ZQX A;  2BCS A;  7ICT A;  2FMP A;  4I2H A;  3RJF A;  4KLF A;  1BPX A;  3JPO A;  4GXK A;  4RWN A;  5DBC A;  1ZQH A;  4UAZ A;  4QZ8 A;  3OGU A;  4RQ0 A;  2BCR A;  4I27 A;  3HIY A;  9ICN A;  5HRK A;  4QZD A;  1ZQJ A;  2ZH5 A;  4QZB A;  3RH5 A;  3OUY B;  3C5G A;  4RQ3 A;  3MGI A;  4YCX A;  3NYB A;  4UB3 A;  4GXI A;  1PX5 A;  1VJ7 A;  4YMN A;  3RH6 A;  4WC0 A;  3TFS A;  2ZH6 A;  9ICQ A;  5J2G A;  4I29 A;  5J29 A;  5HRB A;  1JAJ A;  3H37 A;  5BOM A;  2ZH2 A;  2ZHA A;  3TFR A;  1ZQZ A;  3RJG A;  3C2M A;  3OV7 A;  5J2H A;  4WCW A;  3LK9 A;  4KLJ A;  2PFQ A;  3RJJ A;  8ICQ A;  4WBY A;  1ZQB A;  2BE3 A;  1R89 A;  2RFF A;  9ICM A;  4LZD A;  3UXO A;  4O9M A;  3ISD A;  4ATB A;  4YMO A;  1ZQN A;  7ICN A;  4O5C A;  8ICS A;  8ICJ A;  1KNY A;  2PFP A;  3RH4 A;  4XUS A;  2M2T A;  4FH5 A;  1RPL A;  3UXN A;  3UQ2 A;  5IIO A;  5CHG A;  3H3A A;  4P4P A;  4P2H A;  2M2U A;  3PML A;  7ICL A;  1MIW A;  7ICP A;  4I2I A;  8ICU A;  4QZC A;  4QZ9 A;  3OVA A;  5IIM A;  4DOB A;  3C2L A;  1TV9 A;  4NKU A;  1NO5 A;  5HR9 A;  4KLG A;  4E7X A;  2BPF A;  4NM1 A;  4XQ8 A;  2ZHB A;  4RQ7 A;  9ICA A;  1HUZ A;  4UAY A;  1ZQG A;  2ISO A;  5DBA A;  3UPQ A;  2P66 A;  4O5E A;  3AU6 A;  4NLK A;  1R8A A;  7ICV A;  7ICK A;  1ZQF A;  3V7K A;  1ZQT A;  4X4O A;  3OUY A;  4RWP A;  4UB2 A;  9ICB A;  5HRI A;  3H38 A;  3V7L A;  5CB1 A;  4M2Y A;  1ZQA A;  4TUP A;  2Q66 A;  9ICG A;  4K4I A;  4M5D A;  3C66 A;  4O5K A;  3C5F A;  4S3N A;  9ICT A;  1KEJ A;  5DB7 A;  4NKT A;  3UQ0 A;  2VAN A;  3PNC A;  4RQ6 A;  5J0P A;  2PFN A;  9ICW A;  4R64 A;  4KLL A;  2NRK A;  4WC7 A;  3WFP A;  1KDH A;  1ZQQ A;  4NLN A;  1ZQK A;  1XSP A;  4QZG A;  1ZQW A;  2ZH1 A;  1XSN A;  3JPQ A;  3AQM A;  4DOA A;  5J2C A;  1JMS A;  4X4V A;  4M9N A;  4KLS A;  1ZQD A;  5F2V O;  4MFC A;  4M9G A;  3JPR A;  2DR5 A;  1ZQI A;  4RQ8 A;  5J0O A;  1TFW A;  4IQT A;  1BPE A;  5III A;  1MQ2 A;  4R66 A;  3RJK A;  4X4T A;  4FHX A;  2ID1 A;  4X0B A;  1YLQ A;  4NM2 A;  4WC4 A;  5DB9 A;  4X4S A;  8ICZ A;  4XRH A;  4X4P A;  9ICH A;  3LQC B;  4I2D A;  8ICO A;  5IIN A;  1NOM A;  4FHV A;  4UB4 A;  8ICI A;  5IIJ A;  4WC3 A;  3AQK A;  9ICV A;  4AT9 B;  1MIY A;  5DED A;  4FHW A;  1UET A;  4KLM A;  8ICT A;  9ICR A;  4YN4 A;  5J0Q A;  2PXI A;  4Z6E A;  8ICF A;  4WC5 A;  4QZI A;  9ICP A;  4Z6C A;  4AT7 B;  1R8C A;  1ZQO A;  2BPC A;  3WFO A;  4RT3 A;  4YD2 A;  3JPS A;  3RJI A;  7ICQ A;  4M47 A;  3AQN A;  3WFQ E;  4M9L A;  3MBY A;  7ICO A;  4JWM A;  4QZF A;  4MFF A;  5HHH A;  1BPY A;  4KLE A;  7ICF A;  3UXP A;  3HWT A;  3B0X A;  5HRG A;  5EOZ A;  4F5R A;  5DKW A;  1ZJN A;  3AUO A;  7ICH A;  2DR8 A;  2ZH4 A;  2M2V A;  2FMS A;  4UD5 A;  3RJE A;  3H39 A;  3RJH A;  2O1P A;  4I28 A;  4X4Q A;  4AT8 B;  9ICS A;  8ICK A;  8ICL A;  4X5V A;  5J0W A;  9ICU A;  7ICI A;  8ICY A;  4RQ1 A;  1F5A A;  4PGY A;  5DDY A;  4NLZ A;  4RQ2 A;  1XSL A;  5J2B A;  1FA0 A;  4KLO A;  4IG8 A; 
#chains in the Genus database with same CATH topology
 9ICE A;  3PHZ A;  1ZQE A;  2ZH3 A;  4X4R A;  3L9D A;  5J0R A;  7ICJ A;  4RPY A;  4QZH A;  1ZQY A;  4NXZ A;  4WC6 A;  3NVO A;  4YD1 A;  3ISC A;  4YMM A;  1ZQS A;  4I2J A;  1ZQL A;  4PHE A;  4JWN A;  3JPT A;  4WC2 A;  3HJ1 A;  4M04 A;  5CWR A;  4K4G A;  7ICU A;  2W9M A;  4UAW A;  2PBE A;  4I2G A;  1MIV A;  4I2E A;  4M9H A;  3K75 D;  9ICO A;  4KLU A;  4MF2 A;  4WBZ A;  5J0T A;  4RPX A;  1VFG A;  4RPZ A;  2DR7 A;  2HHP A;  3JZ0 A;  2DR9 A;  5CFT A;  4AT9 A;  3WFR E;  3OWG A;  5J0U A;  1GPJ A;  5J0X A;  1BPZ A;  4K8V A;  2DVI A;  3AU2 A;  4X0A A;  5DB8 A;  5BOL A;  2ZH8 A;  1ZQP A;  4EBK A;  5DB6 A;  4LZG A;  4WOY A;  5HRL A;  4AT7 A;  5J0Y A;  3HX0 A;  5HRD A;  5DBB A;  3PMN A;  3GDX A;  5D63 A;  4I2B A;  4FHY A;  4GXJ A;  4FH3 A;  4KLQ A;  4RWO A;  5BPC A;  3V7J A;  2DRA A;  5J2D A;  8ICC A;  4FO1 A;  1V4A A;  1ZQC A;  8ICA A;  7ICS A;  4Z6D A;  8ICB A;  4KLH A;  7ICM A;  4PH5 A;  4DOC A;  1ZQV A;  1JQR A;  8ICR A;  4IQU A;  5CHE A;  5J0S A;  4UBC A;  1WOT A;  5J2A A;  9ICX A;  4KLT A;  2EWR A;  4N7R A;  2FMQ A;  5J2E A;  4PHP A;  4XA5 A;  4QZA A;  5CA7 A;  4P4M A;  1JN3 A;  4P4O A;  5CP2 A;  3OVS A;  4DO9 A;  2BPG A;  4KLD A;  4K99 A;  4LEW A;  5CR0 A;  4E80 A;  4IQV A;  1RZT A;  4F5P A;  4AT8 A;  8ICV A;  3C18 A;  4QZE A;  2O5A A;  5HC9 A;  1R8B A;  4LT6 A;  3WFS C;  8ICP A;  4I2C A;  4F5N A;  8ICX A;  3EF2 A;  3UPS A;  1Q78 A;  3V72 A;  8ICN A;  4E8F A;  2PFO A;  9ICK A;  2M2W A;  4RQ5 A;  4NXW A;  3MDC A;  4I2A A;  1ZQR A;  7ICE A;  4PGQ A;  4TUR A;  4M0A A;  4Z6F A;  4TUQ A;  8ICW A;  4K4H A;  4UD4 A;  5J2I A;  1TVA A;  4XQ7 A;  4R63 A;  1ZJM A;  4PHA A;  4R65 A;  8ICH A;  3HJ4 A;  4PHD A;  5HRH A;  3ISB A;  3OVB A;  5IIL A;  5D4B A;  3MDA A;  4TUS A;  2BCQ A;  4MFA A;  9ICL A;  5J2K A;  4F5Q A;  4NY8 A;  1MQ3 A;  1TFY A;  4PPX A;  5D46 A;  5CJ7 A;  5HRF A;  4LEZ A;  9ICF A;  7ICR A;  2I9G A;  4RQ4 A;  4I2F A;  1BPD A;  5J2F A;  2ISP A;  3JPP A;  4M9J A;  2BCU A;  4WH5 A;  1OU5 A;  4RWQ A;  4MF8 A;  1ZQM A;  2DRB A;  2GWS A;  2IHM A;  5J2J A;  3C2K A;  2ZH9 A;  1BPB A;  4X4N A;  3JPN A;  4FHP A;  2HN1 A;  5TZV A;  4IQW A;  4EP7 A;  5DDM A;  2ZH7 A;  4RT2 A;  3HW8 A;  3ERC C;  7ICG A;  4ATB B;  4PGX A;  8ICE A;  4EBJ A;  1UEV A;  2HN2 A;  4UB5 A;  5CFS A;  4UB1 A;  5HHI A;  1UEU A;  9ICJ A;  4WC1 A;  4F5O A;  4EGW A;  4UBB A;  3AQL A;  5CFU A;  5HRE A;  4LVS A;  5D62 A;  2BCV A;  4O6A A;  5D49 A;  5B3Q A;  9ICC A;  8ICM A;  4KM5 A;  4FO6 A;  1HUO A;  8ICG A;  4X4U A;  1ZQU A;  5DEC A;  4KLI A;  3MGH A;  3JYY A;  3B0Y A;  5IIK A;  1Q79 A;  2B4V A;  9ICI A;  1ZQX A;  2BCS A;  7ICT A;  2FMP A;  4I2H A;  4WQL A;  3RJF A;  4KLF A;  1BPX A;  3JPO A;  4GXK A;  4RWN A;  5DBC A;  1ZQH A;  4HX0 A;  4UAZ A;  4WQK A;  4QZ8 A;  3OGU A;  4RQ0 A;  2BCR A;  4I27 A;  3HIY A;  2GA9 D;  9ICN A;  5HRK A;  4QZD A;  1ZQJ A;  2ZH5 A;  4QZB A;  3RH5 A;  3OUY B;  4NXU A;  3C5G A;  4RQ3 A;  3MGI A;  4K96 A;  4YCX A;  3NYB A;  4O69 A;  4UB3 A;  4GXI A;  1PX5 A;  1VJ7 A;  2IUB A;  4YMN A;  3RH6 A;  4XJE A;  4WC0 A;  3TFS A;  2ZH6 A;  9ICQ A;  5J2G A;  4I29 A;  5J29 A;  4OAF A;  4NXV A;  5HRB A;  3NWI A;  1JAJ A;  3H37 A;  5BOM A;  2ZH2 A;  2ZHA A;  3TFR A;  1ZQZ A;  3RJG A;  3C2M A;  3OV7 A;  5J2H A;  4WCW A;  3LK9 A;  4KLJ A;  2PFQ A;  3RJJ A;  8ICQ A;  2BBH A;  4OAI Z;  4WBY A;  1ZQB A;  2BE3 A;  1R89 A;  2RFF A;  9ICM A;  4LZD A;  3UXO A;  4O9M A;  3ISD A;  4ATB A;  4YMO A;  1ZQN A;  7ICN A;  4O5C A;  8ICS A;  5B3P A;  8ICJ A;  1KNY A;  3NKU A;  2PFP A;  3RH4 A;  4XUS A;  2M2T A;  4FH5 A;  1RPL A;  3UXN A;  3UQ2 A;  5IIO A;  5CHG A;  4K97 A;  3H3A A;  4K98 A;  4P4P A;  4I0U A;  4P2H A;  2M2U A;  3PML A;  7ICL A;  1MIW A;  7ICP A;  4I2I A;  8ICU A;  3ER9 B;  4QZC A;  4QZ9 A;  3OVA A;  5IIM A;  4DOB A;  3C2L A;  1TV9 A;  4NKU A;  1NO5 A;  5HR9 A;  4KLG A;  4E7X A;  2BPF A;  4NM1 A;  4XQ8 A;  2ZHB A;  4RQ7 A;  9ICA A;  1HUZ A;  4UAY A;  1ZQG A;  2ISO A;  5DBA A;  3UPQ A;  2P66 A;  4O5E A;  3AU6 A;  4NLK A;  4JLZ A;  1R8A A;  7ICV A;  7ICK A;  1ZQF A;  3V7K A;  1ZQT A;  4EV6 A;  2B51 A;  4X4O A;  3OUY A;  4LEV A;  4RWP A;  4UB2 A;  9ICB A;  5HRI A;  3H38 A;  3V7L A;  5CB1 A;  4M2Y A;  1ZQA A;  4TUP A;  2Q66 A;  9ICG A;  4K4I A;  4M5D A;  3C66 A;  4O5K A;  3C5F A;  4S3N A;  9ICT A;  1KEJ A;  5DB7 A;  4NKT A;  3UQ0 A;  2VAN A;  3PNC A;  4RQ6 A;  5J0P A;  2PFN A;  9ICW A;  4R64 A;  4KLL A;  2NRK A;  4WC7 A;  4JLX A;  3WFP A;  1KDH A;  1ZQQ A;  4NLN A;  1ZQK A;  1XSP A;  4O68 A;  4QZG A;  1ZQW A;  2ZH1 A;  1XSN A;  2B56 A;  4OAH A;  3JPQ A;  3ER8 C;  3AQM A;  5D61 A;  4DOA A;  4EED A;  5J2C A;  5JTG A;  1JMS A;  4X4V A;  4NXX A;  4M9N A;  4KLS A;  1ZQD A;  5F2V O;  4MFC A;  4NXT A;  4M9G A;  3JPR A;  2DR5 A;  3JCF A;  1ZQI A;  4RQ8 A;  5J0O A;  1TFW A;  4IQT A;  1BPE A;  5III A;  4LEY A;  1MQ2 A;  4R66 A;  3RJK A;  4X4T A;  4FHX A;  2ID1 A;  4X0B A;  1YLQ A;  4NM2 A;  4WC4 A;  5DB9 A;  4X4S A;  8ICZ A;  4XRH A;  4X4P A;  9ICH A;  3LQC B;  4I2D A;  8ICO A;  5IIN A;  1NOM A;  4FHV A;  4UB4 A;  4KB6 A;  2BBJ A;  8ICI A;  5IIJ A;  4WC3 A;  3AQK A;  9ICV A;  4AT9 B;  1MIY A;  5DED A;  4FHW A;  1UET A;  4KLM A;  8ICT A;  9ICR A;  4EEB A;  4YN4 A;  5J0Q A;  2PXI A;  4Z6E A;  8ICF A;  4MKP A;  4WC5 A;  4QZI A;  3K7D A;  9ICP A;  4Z6C A;  4AT7 B;  1R8C A;  1ZQO A;  3CK6 A;  2BPC A;  3WFO A;  3MCR A;  4YD2 A;  4RT3 A;  3JPS A;  3RJI A;  7ICQ A;  4M47 A;  3AQN A;  3WFQ E;  4M9L A;  3MBY A;  7ICO A;  4JWM A;  4QZF A;  2IHO A;  4MFF A;  2FCL A;  5HHH A;  1BPY A;  4KLE A;  7ICF A;  3UXP A;  3HWT A;  4K9A A;  3B0X A;  4O67 A;  5HRG A;  5EOZ A;  4F5R A;  5DKW A;  1ZJN A;  3AUO A;  7ICH A;  2DR8 A;  2ZH4 A;  2M2V A;  2FMS A;  4OAG A;  4UD5 A;  3RJE A;  3H39 A;  3RJH A;  2O1P A;  4I28 A;  4X4Q A;  4K9B A;  4AT8 B;  9ICS A;  8ICK A;  2GAF D;  8ICL A;  4X5V A;  5J0W A;  9ICU A;  7ICI A;  8ICY A;  4RQ1 A;  1F5A A;  4PGY A;  5DDY A;  4NLZ A;  4RQ2 A;  1XSL A;  5J2B A;  1FA0 A;  4KLO A;  4IG8 A; 
#chains in the Genus database with same CATH homology
 9ICE A;  1ZQE A;  2ZH3 A;  4X4R A;  3L9D A;  5J0R A;  7ICJ A;  4RPY A;  4QZH A;  1ZQY A;  4NXZ A;  4WC6 A;  4YD1 A;  3ISC A;  4YMM A;  1ZQS A;  4I2J A;  1ZQL A;  4PHE A;  4JWN A;  3JPT A;  4WC2 A;  3HJ1 A;  4M04 A;  5CWR A;  4K4G A;  7ICU A;  2W9M A;  4UAW A;  2PBE A;  4I2G A;  1MIV A;  4I2E A;  4M9H A;  3K75 D;  9ICO A;  4KLU A;  4MF2 A;  4WBZ A;  5J0T A;  4RPX A;  1VFG A;  4RPZ A;  2DR7 A;  2HHP A;  3JZ0 A;  2DR9 A;  4AT9 A;  3WFR E;  5J0U A;  5J0X A;  1BPZ A;  2DVI A;  3AU2 A;  4X0A A;  5DB8 A;  5BOL A;  2ZH8 A;  1ZQP A;  4EBK A;  5DB6 A;  4LZG A;  5J0Y A;  5HRL A;  4AT7 A;  3HX0 A;  5HRD A;  5DBB A;  3PMN A;  3GDX A;  4I2B A;  4FHY A;  4GXJ A;  4FH3 A;  4KLQ A;  4RWO A;  5BPC A;  3V7J A;  2DRA A;  5J2D A;  8ICC A;  1V4A A;  1ZQC A;  8ICA A;  7ICS A;  4Z6D A;  8ICB A;  4KLH A;  7ICM A;  4PH5 A;  4DOC A;  1ZQV A;  1JQR A;  8ICR A;  4IQU A;  5J0S A;  4UBC A;  1WOT A;  5J2A A;  9ICX A;  4KLT A;  2FMQ A;  5J2E A;  4PHP A;  4XA5 A;  4QZA A;  5CA7 A;  4P4M A;  1JN3 A;  4P4O A;  5CP2 A;  3OVS A;  4DO9 A;  2BPG A;  4KLD A;  5CR0 A;  4E80 A;  4IQV A;  1RZT A;  4F5P A;  4AT8 A;  8ICV A;  3C18 A;  4QZE A;  2O5A A;  5HC9 A;  1R8B A;  4LT6 A;  3WFS C;  8ICP A;  4I2C A;  4F5N A;  8ICX A;  3UPS A;  1Q78 A;  3V72 A;  8ICN A;  4E8F A;  2PFO A;  9ICK A;  2M2W A;  4RQ5 A;  3MDC A;  4I2A A;  1ZQR A;  7ICE A;  4PGQ A;  4TUR A;  4M0A A;  4Z6F A;  4TUQ A;  8ICW A;  4K4H A;  4UD4 A;  5J2I A;  1TVA A;  4XQ7 A;  4R63 A;  1ZJM A;  4PHA A;  4R65 A;  8ICH A;  3HJ4 A;  4PHD A;  5HRH A;  3ISB A;  3OVB A;  5IIL A;  5D4B A;  3MDA A;  4TUS A;  2BCQ A;  4MFA A;  9ICL A;  5J2K A;  4F5Q A;  4NY8 A;  1MQ3 A;  1TFY A;  4PPX A;  5D46 A;  5CJ7 A;  5HRF A;  9ICF A;  7ICR A;  2I9G A;  4RQ4 A;  4I2F A;  1BPD A;  5J2F A;  2ISP A;  3JPP A;  4M9J A;  2BCU A;  1OU5 A;  4RWQ A;  4MF8 A;  1ZQM A;  2DRB A;  2GWS A;  2IHM A;  5J2J A;  3C2K A;  2ZH9 A;  1BPB A;  4X4N A;  3JPN A;  4FHP A;  5TZV A;  4IQW A;  4EP7 A;  5DDM A;  2ZH7 A;  4RT2 A;  3HW8 A;  7ICG A;  4ATB B;  4PGX A;  8ICE A;  4EBJ A;  1UEV A;  4UB5 A;  4UB1 A;  5HHI A;  1UEU A;  9ICJ A;  4WC1 A;  4F5O A;  4UBB A;  3AQL A;  5HRE A;  4LVS A;  2BCV A;  5D49 A;  9ICC A;  8ICM A;  4FO6 A;  1HUO A;  8ICG A;  4X4U A;  1ZQU A;  5DEC A;  4KLI A;  3MGH A;  3JYY A;  3B0Y A;  5IIK A;  1Q79 A;  9ICI A;  1ZQX A;  2BCS A;  7ICT A;  2FMP A;  4I2H A;  3RJF A;  4KLF A;  1BPX A;  3JPO A;  4GXK A;  4RWN A;  5DBC A;  1ZQH A;  4UAZ A;  4QZ8 A;  3OGU A;  4RQ0 A;  2BCR A;  4I27 A;  3HIY A;  9ICN A;  5HRK A;  4QZD A;  1ZQJ A;  2ZH5 A;  4QZB A;  3RH5 A;  3OUY B;  3C5G A;  4RQ3 A;  3MGI A;  4YCX A;  3NYB A;  4UB3 A;  4GXI A;  1PX5 A;  1VJ7 A;  4YMN A;  3RH6 A;  4WC0 A;  3TFS A;  2ZH6 A;  9ICQ A;  5J2G A;  4I29 A;  5J29 A;  5HRB A;  1JAJ A;  3H37 A;  5BOM A;  2ZH2 A;  2ZHA A;  3TFR A;  1ZQZ A;  3RJG A;  3C2M A;  3OV7 A;  5J2H A;  4WCW A;  3LK9 A;  4KLJ A;  2PFQ A;  3RJJ A;  8ICQ A;  4WBY A;  1ZQB A;  2BE3 A;  1R89 A;  2RFF A;  9ICM A;  4LZD A;  3UXO A;  4O9M A;  3ISD A;  4ATB A;  4YMO A;  1ZQN A;  7ICN A;  4O5C A;  8ICS A;  8ICJ A;  1KNY A;  2PFP A;  3RH4 A;  4XUS A;  2M2T A;  4FH5 A;  1RPL A;  3UXN A;  3UQ2 A;  5IIO A;  5CHG A;  3H3A A;  4P4P A;  4P2H A;  2M2U A;  3PML A;  7ICL A;  1MIW A;  7ICP A;  4I2I A;  8ICU A;  4QZC A;  4QZ9 A;  3OVA A;  5IIM A;  4DOB A;  3C2L A;  1TV9 A;  4NKU A;  1NO5 A;  5HR9 A;  4KLG A;  4E7X A;  2BPF A;  4NM1 A;  4XQ8 A;  2ZHB A;  4RQ7 A;  9ICA A;  1HUZ A;  4UAY A;  1ZQG A;  2ISO A;  5DBA A;  3UPQ A;  2P66 A;  4O5E A;  3AU6 A;  4NLK A;  1R8A A;  7ICV A;  7ICK A;  1ZQF A;  3V7K A;  1ZQT A;  4X4O A;  3OUY A;  4RWP A;  4UB2 A;  9ICB A;  5HRI A;  3H38 A;  3V7L A;  5CB1 A;  4M2Y A;  1ZQA A;  4TUP A;  2Q66 A;  9ICG A;  4K4I A;  4M5D A;  3C66 A;  4O5K A;  3C5F A;  4S3N A;  9ICT A;  1KEJ A;  5DB7 A;  4NKT A;  3UQ0 A;  2VAN A;  3PNC A;  4RQ6 A;  5J0P A;  2PFN A;  9ICW A;  4R64 A;  4KLL A;  2NRK A;  4WC7 A;  3WFP A;  1KDH A;  1ZQQ A;  4NLN A;  1ZQK A;  1XSP A;  4QZG A;  1ZQW A;  2ZH1 A;  1XSN A;  3JPQ A;  3AQM A;  4DOA A;  5J2C A;  1JMS A;  4X4V A;  4M9N A;  4KLS A;  1ZQD A;  5F2V O;  4MFC A;  4M9G A;  3JPR A;  2DR5 A;  1ZQI A;  4RQ8 A;  5J0O A;  1TFW A;  4IQT A;  1BPE A;  5III A;  1MQ2 A;  4R66 A;  3RJK A;  4X4T A;  4FHX A;  2ID1 A;  4X0B A;  1YLQ A;  4NM2 A;  4WC4 A;  5DB9 A;  4X4S A;  8ICZ A;  4XRH A;  4X4P A;  9ICH A;  3LQC B;  4I2D A;  8ICO A;  5IIN A;  1NOM A;  4FHV A;  4UB4 A;  8ICI A;  5IIJ A;  4WC3 A;  3AQK A;  9ICV A;  4AT9 B;  1MIY A;  5DED A;  4FHW A;  1UET A;  4KLM A;  8ICT A;  9ICR A;  4YN4 A;  5J0Q A;  2PXI A;  4Z6E A;  8ICF A;  4WC5 A;  4QZI A;  9ICP A;  4Z6C A;  4AT7 B;  1R8C A;  1ZQO A;  2BPC A;  3WFO A;  4RT3 A;  4YD2 A;  3JPS A;  3RJI A;  7ICQ A;  4M47 A;  3AQN A;  3WFQ E;  4M9L A;  3MBY A;  7ICO A;  4JWM A;  4QZF A;  4MFF A;  5HHH A;  1BPY A;  4KLE A;  7ICF A;  3UXP A;  3HWT A;  3B0X A;  5HRG A;  5EOZ A;  4F5R A;  5DKW A;  1ZJN A;  3AUO A;  7ICH A;  2DR8 A;  2ZH4 A;  2M2V A;  2FMS A;  4UD5 A;  3RJE A;  3H39 A;  3RJH A;  2O1P A;  4I28 A;  4X4Q A;  4AT8 B;  9ICS A;  8ICK A;  8ICL A;  4X5V A;  5J0W A;  9ICU A;  7ICI A;  8ICY A;  4RQ1 A;  1F5A A;  4PGY A;  5DDY A;  4NLZ A;  4RQ2 A;  1XSL A;  5J2B A;  1FA0 A;  4KLO A;  4IG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...