4WC0A

Trna-processing enzyme with atp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Poly A polymerase
total genus 104
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc0A01
4NLNA 2O1PA 5BOMA 3HX0A 4XQ7A 2M2WA 7ICUA 3UQ2A 3JYYA 5J0OA 9ICEA 1TFWA 4AT8B 2PBEA 7ICNA 4X4NA 4NLZA 4WC1A 5DB6A 4X0AA 4R63A 2P66A 3MDCA 3UXNA 5DECA 3C2LA 4X5VA 5IIKA 1ZQVA 5BPCA 4MFAA 3AU2A 7ICGA 2ZH7A 1ZQUA 2PFOA 4Z6CA 4KLJA 3OVAA 2ZH5A 1ZQLA 4R64A 4KLMA 1V4AA 5IILA 4RWQA 4NM1A 5D4BA 5J2EA 4MF2A 3HWTA 5J0PA 3RJFA 7ICQA 5IINA 4KLEA 3MGIA 2FMQA 3V72A 2ZH4A 1ZQJA 2O5AA 4F5QA 5J2CA 1R8BA 4I2AA 3RJEA 1R8CA 2ZHBA 1HUOA 4I2GA 3PNCA 3H37A 1XSLA 4RT2A 4O5CA 5HRKA 3AU6A 3B0YA 3ISBA 4FH5A 3NYBA 5IIIA 2DRBA 7ICTA 9ICJA 1ZQBA 9ICFA 9ICWA 4UD5A 4X4UA 8ICIA 1ZJMA 1NOMA 3RJJA 2BCVA 7ICEA 3OVBA 8ICQA 2BPCA 5J2GA 1KEJA 9ICXA 5HR9A 4LZGA 5J0YA 5J0QA 5HHHA 9ICCA 5J2FA 3H3AA 4M5DA 1ZQAA 5D49A 4P4PA 4YMOA 4S3NA 2FMSA 4WBZA 1BPBA 5CHGA 1UEUA 3HJ4A 1XSPA 4PGXA 4KLQA 3C2KA 3HW8A 4WC7A 4LVSA 1ZQHA 3RH4A 1ZQGA 4QZFA 4QZDA 4M9NA 4WC0A 9ICLA 4AT8A 5HRGA 4M47A 4KLDA 4AT7B 4QZEA 3RJHA 3MGHA 1F5AA 4M9JA 1VFGA 1BPDA 3JPNA 3WFRE 4EP7A 4UB1A 4E7XA 4PH5A 8ICUA 9ICUA 8ICMA 7ICJA 5HRLA 3UQ0A 3H39A 4WCWA 1JN3A 3OV7A 4GXIA 1ZQRA 4P2HA 2BCRA 4M04A 5DB7A 3JPQA 3K75D 3AUOA 5CR0A 1ZQOA 4EBKA 3ISCA 5J2JA 1RPLA 8ICTA 4WBYA 1ZJNA 4M0AA 3JPOA 4O5EA 3AQLA 3RJKA 4Z6FA 1R89A 4M9HA 4WC4A 1ZQDA 1BPZA 2ZH8A 4YD1A 8ICZA 3L9DA 1FA0A 5CJ7A 4RQ6A 2BCSA 2ISPA 9ICRA 5DB8A 4QZCA 3JPSA 2PFNA 3TFRA 4O9MA 8ICYA 4UB4A 4KLHA 1Q78A 4M9LA 4KLGA 4X4SA 4NLKA 9ICKA 5CP2A 4RWOA 1TV9A 4RQ4A 7ICIA 1YLQA 9ICPA 4I2HA 4AT7A 4X4VA 5J0RA 1MQ3A 1ZQKA 5J0XA 4K4IA 4TUQA 4KLFA 3MDAA 1ZQMA 3AQNA 4LT6A 1JMSA 2IHMA 5D46A 7ICLA 1ZQWA 3WFOA 5J29A 4FHXA 5HRIA 4UBCA 2BCQA 8ICJA 4RQ8A 4DOAA 4PHDA 2RFFA 3C5FA 9ICVA 1BPEA 3V7KA 8ICHA 4RQ0A 1XSNA 4UB5A 8ICNA 4I27A 4QZHA 4XQ8A 4TURA 5J2BA 3LK9A 4NKTA 3V7LA 9ICIA 4I29A 4KLTA 4RWNA 4E80A 1ZQNA 3RH6A 4M9GA 2FMPA 5HC9A 7ICPA 2ISOA 1ZQXA 4I2JA 4NM2A 3UPQA 4PHAA 5HRFA 3WFQE 5DBAA 4ATBB 4I2EA 3JPPA 7ICSA 4Z6EA 3RJGA 2NRKA 2PFPA 2M2TA 4JWNA 1R8AA 3UXPA 2M2UA 4QZ9A 8ICLA 4X4RA 4RQ1A 4RPZA 1PX5A 9ICOA 2DR8A 2DR9A 8ICVA 4FH3A 2VANA 4RQ3A 4UAWA 2GWSA 4GXJA 4F5RA 4WC3A 9ICGA 9ICMA 2Q66A 2ZH9A 4X4OA 5IIJA 4X4TA 1RZTA 4UAYA 4YMMA 3WFPA 5BOLA 2BPGA 9ICNA 1KNYA 4UAZA 2ZH1A 4WC2A 2ID1A 5J0WA 8ICKA 3H38A 1ZQQA 3OUYA 5EOZA 3C66A 5IIOA 4KLOA 4E8FA 5F2VO 8ICSA 1UEVA 8ICAA 5J0SA 3UXOA 3AQKA 2W9MA 3B0XA 4IQVA 1ZQTA 4MFFA 4YCXA 3PMNA 3WFSC 4DOCA 3JZ0A 4I28A 3C5GA 3AQMA 5TZVA 8ICPA 8ICXA 5HRBA 4QZBA 8ICOA 2BE3A 2ZH2A 1BPXA 4TUPA 9ICBA 4UB2A 4FHPA 5DKWA 4X0BA 4YMNA 5J2KA 4XRHA 4IQTA 4I2BA 5DB9A 8ICRA 2PXIA 4K4GA 4R66A 1ZQEA 5J2HA 4KLLA 3ISDA 7ICOA 4RQ7A 3C2MA 1JQRA 2ZH6A 4DO9A 3UPSA 2ZH3A 4F5OA 1OU5A 4FHWA 4IQUA 4UB3A 5CB1A 3C18A 4DOBA 4PHEA 4P4OA 4YD2A 4O5KA 7ICKA 1TVAA 4KLSA 2BPFA 4PGQA 4NKUA 4QZ8A 3OUYB 5DDYA 2HHPA 4FHVA 8ICGA 4K4HA 4RT3A 4TUSA 8ICCA 4KLUA 5DEDA 5DBBA 1ZQIA 2I9GA 3JPTA 4RPYA 3V7JA 3HJ1A 7ICFA 3LQCB 3TFSA 7ICVA 4FO6A 4UBBA 1MIWA 3RJIA 4F5PA 2DR5A 1ZQCA 5CA7A 1VJ7A 4LZDA 4MF8A 3RH5A 9ICQA 4AT9A 2DR7A 1ZQPA 3OVSA 1MQ2A 4PHPA 5HRHA 4EBJA 5HRDA 4PGYA 5J0TA 4FHYA 1BPYA 1ZQFA 4YN4A 2ZHAA 2DVIA 9ICHA 1ZQZA 3JPRA 2M2VA 4WC5A 1ZQSA 4JWMA 5J2DA 4QZIA 7ICHA 1UETA 4GXKA 4NXZA 4I2DA 9ICAA 4QZGA 3GDXA 1MIYA 4RQ2A 5DDMA 4MFCA 5CWRA 4RWPA 4I2CA 4RQ5A 1HUZA 4I2IA 4R65A 1MIVA 8ICBA 5J0UA 9ICTA 4AT9B 4P4MA 7ICRA 4ATBA 9ICSA 1JAJA 1Q79A 4X4PA 8ICWA 1ZQYA 4XA5A 5IIMA 7ICMA 5J2IA 5HREA 4M2YA 2DRAA 3OGUA 4IG8A 4KLIA 1WOTA 5DBCA 1TFYA 1NO5A 4QZAA 1KDHA 4NY8A 4UD4A 3HIYA 2PFQA 3PMLA 4I2FA 4IQWA 3MBYA 4F5NA 4PPXA 8ICFA 4WC6A 4X4QA 4RPXA 4Z6DA 5J2AA 4XUSA 2BCUA 8ICEA 5HHIA
chains in the Genus database with same CATH superfamily
4NLNA 2O1PA 5BOMA 3HX0A 4XQ7A 4NXTA 2M2WA 7ICUA 3UQ2A 3JYYA 5J0OA 9ICEA 1TFWA 4AT8B 2PBEA 7ICNA 4X4NA 4NLZA 4WC1A 5DB6A 4X0AA 4R63A 2P66A 3MDCA 3UXNA 5DECA 3C2LA 4X5VA 5IIKA 1ZQVA 5BPCA 4MFAA 3AU2A 3NVOA 5CHEA 7ICGA 2ZH7A 1ZQUA 2PFOA 4Z6CA 4KLJA 3OVAA 2ZH5A 1ZQLA 4R64A 4KLMA 1V4AA 5IILA 4RWQA 4NM1A 5D4BA 5J2EA 4MF2A 3HWTA 5J0PA 3RJFA 2IHOA 7ICQA 4NXVA 5IINA 4KLEA 3MGIA 4O68A 2FMQA 3V72A 2ZH4A 1ZQJA 2O5AA 4F5QA 5J2CA 5CFUA 1R8BA 4I2AA 2GA9D 3RJEA 1R8CA 2ZHBA 1HUOA 4I2GA 3PNCA 3H37A 2B51A 1XSLA 4RT2A 4O5CA 5HRKA 3AU6A 3B0YA 3ISBA 4FH5A 3NYBA 5IIIA 2DRBA 7ICTA 9ICJA 1ZQBA 9ICFA 9ICWA 4UD5A 4X4UA 8ICIA 1ZJMA 1NOMA 2EWRA 5JTGA 3RJJA 4K96A 2BCVA 7ICEA 3OVBA 8ICQA 2BPCA 3OWGA 4I0UA 5J2GA 2BBHA 1KEJA 4LEYA 9ICXA 5HR9A 4LZGA 2IUBA 5J0YA 5J0QA 5HHHA 4XJEA 9ICCA 2HN1A 3H3AA 5J2FA 4M5DA 1ZQAA 5D49A 4P4PA 4YMOA 4S3NA 2FMSA 4WBZA 1BPBA 5CHGA 1UEUA 3HJ4A 1XSPA 4PGXA 4KLQA 4NXWA 3C2KA 4OAIZ 3HW8A 4WC7A 4LVSA 1ZQHA 3RH4A 1ZQGA 4QZFA 4QZDA 4M9NA 4WH5A 4WC0A 9ICLA 4AT8A 3PHZA 5HRGA 4M47A 4EEDA 3EF2A 4AT7B 4QZEA 4KLDA 2B4VA 3MGHA 3RJHA 1F5AA 3CK6A 3MCRA 1VFGA 1BPDA 3JPNA 3WFRE 4M9JA 4NXXA 4EP7A 4UB1A 4E7XA 4PH5A 8ICUA 9ICUA 5D62A 8ICMA 7ICJA 5HRLA 3UQ0A 3H39A 4WCWA 1JN3A 3OV7A 4GXIA 1ZQRA 4P2HA 3K7DA 2BCRA 4M04A 5DB7A 3JPQA 3K75D 3AUOA 5CR0A 1ZQOA 4EBKA 3ISCA 5J2JA 1RPLA 8ICTA 4WQLA 4WBYA 4N7RA 1ZJNA 4K9BA 4M0AA 3JPOA 4JLXA 4O5EA 3AQLA 3RJKA 4Z6FA 1R89A 4M9HA 4WC4A 1ZQDA 1BPZA 2ZH8A 4YD1A 8ICZA 3L9DA 1FA0A 5CJ7A 4RQ6A 2BCSA 2ISPA 9ICRA 5DB8A 4QZCA 3JPSA 2PFNA 3TFRA 4O9MA 8ICYA 4UB4A 4KLHA 1Q78A 4M9LA 4KLGA 4X4SA 4NLKA 9ICKA 5CP2A 4RWOA 4JLZA 1TV9A 4RQ4A 7ICIA 1YLQA 9ICPA 4I2HA 4AT7A 4X4VA 5J0RA 1MQ3A 1ZQKA 5J0XA 4K4IA 4TUQA 4KLFA 3MDAA 1ZQMA 3AQNA 4LT6A 1JMSA 2IHMA 5D46A 7ICLA 1ZQWA 5J29A 4FO1A 3WFOA 4FHXA 5HRIA 4UBCA 2BCQA 8ICJA 4RQ8A 2BBJA 4DOAA 4PHDA 2RFFA 3C5FA 9ICVA 1BPEA 3V7KA 4K9AA 8ICHA 4RQ0A 1XSNA 4UB5A 8ICNA 4I27A 4QZHA 4XQ8A 4OAHA 4TURA 5J2BA 2GAFD 3LK9A 4NKTA 3V7LA 5B3QA 9ICIA 4I29A 4KLTA 4RWNA 4E80A 1ZQNA 3RH6A 4M9GA 2FMPA 5HC9A 7ICPA 2ISOA 1ZQXA 4I2JA 4NM2A 3UPQA 4O67A 4PHAA 5HRFA 3WFQE 5DBAA 4ATBB 4I2EA 3JPPA 4LEWA 3JCFA 7ICSA 4Z6EA 3RJGA 2NRKA 2PFPA 2M2TA 4JWNA 1R8AA 3UXPA 2M2UA 4QZ9A 8ICLA 4X4RA 4RQ1A 4RPZA 1PX5A 4EV6A 9ICOA 2DR8A 2DR9A 8ICVA 4FH3A 2VANA 4RQ3A 1GPJA 4UAWA 2GWSA 4KM5A 4GXJA 4F5RA 4WC3A 4K97A 9ICMA 9ICGA 2Q66A 2ZH9A 4X4OA 5IIJA 4X4TA 1RZTA 3NKUA 4UAYA 4YMMA 3WFPA 5BOLA 2BPGA 9ICNA 1KNYA 4UAZA 2ZH1A 4WC2A 2ID1A 5J0WA 8ICKA 3H38A 1ZQQA 3OUYA 5EOZA 3C66A 4NXUA 5IIOA 4KLOA 4E8FA 5F2VO 8ICSA 1UEVA 8ICAA 5J0SA 3UXOA 3AQKA 2W9MA 3B0XA 4IQVA 1ZQTA 4MFFA 4YCXA 3PMNA 3WFSC 4DOCA 3JZ0A 4I28A 3C5GA 3AQMA 5TZVA 8ICPA 8ICXA 5HRBA 4O6AA 4QZBA 8ICOA 2BE3A 2ZH2A 1BPXA 4TUPA 9ICBA 4UB2A 4FHPA 4MKPA 5DKWA 4X0BA 4YMNA 5J2KA 4XRHA 4IQTA 4I2BA 5DB9A 8ICRA 2PXIA 4K4GA 4R66A 1ZQEA 5J2HA 4KLLA 3ISDA 7ICOA 4RQ7A 3C2MA 1JQRA 5D63A 3NWIA 2ZH6A 4DO9A 3UPSA 2ZH3A 4F5OA 1OU5A 4FHWA 4IQUA 4UB3A 5CB1A 3C18A 4DOBA 4PHEA 4P4OA 4YD2A 4O5KA 7ICKA 1TVAA 4KLSA 2BPFA 4PGQA 4NKUA 4QZ8A 3OUYB 5DDYA 2HHPA 4FHVA 8ICGA 4K4HA 4RT3A 4TUSA 8ICCA 4KLUA 5DEDA 5DBBA 1ZQIA 4O69A 2I9GA 3JPTA 4RPYA 3V7JA 3HJ1A 7ICFA 3LQCB 3TFSA 7ICVA 2B56A 4FO6A 4UBBA 1MIWA 3RJIA 4F5PA 2DR5A 4EGWA 1ZQCA 5CA7A 1VJ7A 4LZDA 3ER9B 4MF8A 3RH5A 9ICQA 5B3PA 4AT9A 2DR7A 1ZQPA 3OVSA 1MQ2A 3ERCC 4PHPA 5HRHA 4EBJA 4HX0A 4EEBA 4PGYA 5HRDA 5J0TA 4FHYA 1BPYA 1ZQFA 4YN4A 2ZHAA 2DVIA 9ICHA 1ZQZA 3JPRA 2M2VA 4WC5A 4K8VA 1ZQSA 4JWMA 5J2DA 4QZIA 7ICHA 1UETA 4GXKA 4NXZA 4I2DA 9ICAA 5CFTA 4QZGA 3GDXA 1MIYA 4RQ2A 5DDMA 4MFCA 4LEVA 5CWRA 4RWPA 4I2CA 4RQ5A 1HUZA 2FCLA 4I2IA 4R65A 1MIVA 8ICBA 5J0UA 9ICTA 4AT9B 4P4MA 7ICRA 4K98A 4ATBA 9ICSA 1JAJA 1Q79A 4KB6A 4X4PA 4WQKA 8ICWA 1ZQYA 5D61A 4XA5A 5IIMA 7ICMA 4OAGA 5J2IA 5HREA 4M2YA 2DRAA 3OGUA 4IG8A 4KLIA 1WOTA 5DBCA 1TFYA 1NO5A 4QZAA 1KDHA 4NY8A 4UD4A 3HIYA 2PFQA 3PMLA 2HN2A 4K99A 4I2FA 4IQWA 3MBYA 5CFSA 4F5NA 4LEZA 4PPXA 4WOYA 8ICFA 4WC6A 4OAFA 3ER8C 4X4QA 4RPXA 4Z6DA 5J2AA 4XUSA 2BCUA 8ICEA 5HHIA
chains in the Genus database with same CATH topology
4NLNA 2O1PA 5BOMA 3HX0A 4XQ7A 2M2WA 7ICUA 3UQ2A 3JYYA 5J0OA 9ICEA 1TFWA 4AT8B 2PBEA 7ICNA 4X4NA 4NLZA 4WC1A 5DB6A 4X0AA 4R63A 2P66A 3MDCA 3UXNA 5DECA 3C2LA 4X5VA 5IIKA 1ZQVA 5BPCA 4MFAA 3AU2A 7ICGA 2ZH7A 1ZQUA 2PFOA 4Z6CA 4KLJA 3OVAA 2ZH5A 1ZQLA 4R64A 4KLMA 1V4AA 5IILA 4RWQA 4NM1A 5D4BA 5J2EA 4MF2A 3HWTA 5J0PA 3RJFA 7ICQA 5IINA 4KLEA 3MGIA 2FMQA 3V72A 2ZH4A 1ZQJA 2O5AA 4F5QA 5J2CA 1R8BA 4I2AA 3RJEA 1R8CA 2ZHBA 1HUOA 4I2GA 3PNCA 3H37A 1XSLA 4RT2A 4O5CA 5HRKA 3AU6A 3B0YA 3ISBA 4FH5A 3NYBA 5IIIA 2DRBA 7ICTA 9ICJA 1ZQBA 9ICFA 9ICWA 4UD5A 4X4UA 8ICIA 1ZJMA 1NOMA 3RJJA 2BCVA 7ICEA 3OVBA 8ICQA 2BPCA 5J2GA 1KEJA 9ICXA 5HR9A 4LZGA 5J0YA 5J0QA 5HHHA 9ICCA 5J2FA 3H3AA 4M5DA 1ZQAA 5D49A 4P4PA 4YMOA 4S3NA 2FMSA 4WBZA 1BPBA 5CHGA 1UEUA 3HJ4A 1XSPA 4PGXA 4KLQA 3C2KA 3HW8A 4WC7A 4LVSA 1ZQHA 3RH4A 1ZQGA 4QZFA 4QZDA 4M9NA 4WC0A 9ICLA 4AT8A 5HRGA 4M47A 4KLDA 4AT7B 4QZEA 3RJHA 3MGHA 1F5AA 4M9JA 1VFGA 1BPDA 3JPNA 3WFRE 4EP7A 4UB1A 4E7XA 4PH5A 8ICUA 9ICUA 8ICMA 7ICJA 5HRLA 3UQ0A 3H39A 4WCWA 1JN3A 3OV7A 4GXIA 1ZQRA 4P2HA 2BCRA 4M04A 5DB7A 3JPQA 3K75D 3AUOA 5CR0A 1ZQOA 4EBKA 3ISCA 5J2JA 1RPLA 8ICTA 4WBYA 1ZJNA 4M0AA 3JPOA 4O5EA 3AQLA 3RJKA 4Z6FA 1R89A 4M9HA 4WC4A 1ZQDA 1BPZA 2ZH8A 4YD1A 8ICZA 3L9DA 1FA0A 5CJ7A 4RQ6A 2BCSA 2ISPA 9ICRA 5DB8A 4QZCA 3JPSA 2PFNA 3TFRA 4O9MA 8ICYA 4UB4A 4KLHA 1Q78A 4M9LA 4KLGA 4X4SA 4NLKA 9ICKA 5CP2A 4RWOA 1TV9A 4RQ4A 7ICIA 1YLQA 9ICPA 4I2HA 4AT7A 4X4VA 5J0RA 1MQ3A 1ZQKA 5J0XA 4K4IA 4TUQA 4KLFA 3MDAA 1ZQMA 3AQNA 4LT6A 1JMSA 2IHMA 5D46A 7ICLA 1ZQWA 3WFOA 5J29A 4FHXA 5HRIA 4UBCA 2BCQA 8ICJA 4RQ8A 4DOAA 4PHDA 2RFFA 3C5FA 9ICVA 1BPEA 3V7KA 8ICHA 4RQ0A 1XSNA 4UB5A 8ICNA 4I27A 4QZHA 4XQ8A 4TURA 5J2BA 3LK9A 4NKTA 3V7LA 9ICIA 4I29A 4KLTA 4RWNA 4E80A 1ZQNA 3RH6A 4M9GA 2FMPA 5HC9A 7ICPA 2ISOA 1ZQXA 4I2JA 4NM2A 3UPQA 4PHAA 5HRFA 3WFQE 5DBAA 4ATBB 4I2EA 3JPPA 7ICSA 4Z6EA 3RJGA 2NRKA 2PFPA 2M2TA 4JWNA 1R8AA 3UXPA 2M2UA 4QZ9A 8ICLA 4X4RA 4RQ1A 4RPZA 1PX5A 9ICOA 2DR8A 2DR9A 8ICVA 4FH3A 2VANA 4RQ3A 4UAWA 2GWSA 4GXJA 4F5RA 4WC3A 9ICGA 9ICMA 2Q66A 2ZH9A 4X4OA 5IIJA 4X4TA 1RZTA 4UAYA 4YMMA 3WFPA 5BOLA 2BPGA 9ICNA 1KNYA 4UAZA 2ZH1A 4WC2A 2ID1A 5J0WA 8ICKA 3H38A 1ZQQA 3OUYA 5EOZA 3C66A 5IIOA 4KLOA 4E8FA 5F2VO 8ICSA 1UEVA 8ICAA 5J0SA 3UXOA 3AQKA 2W9MA 3B0XA 4IQVA 1ZQTA 4MFFA 4YCXA 3PMNA 3WFSC 4DOCA 3JZ0A 4I28A 3C5GA 3AQMA 5TZVA 8ICPA 8ICXA 5HRBA 4QZBA 8ICOA 2BE3A 2ZH2A 1BPXA 4TUPA 9ICBA 4UB2A 4FHPA 5DKWA 4X0BA 4YMNA 5J2KA 4XRHA 4IQTA 4I2BA 5DB9A 8ICRA 2PXIA 4K4GA 4R66A 1ZQEA 5J2HA 4KLLA 3ISDA 7ICOA 4RQ7A 3C2MA 1JQRA 2ZH6A 4DO9A 3UPSA 2ZH3A 4F5OA 1OU5A 4FHWA 4IQUA 4UB3A 5CB1A 3C18A 4DOBA 4PHEA 4P4OA 4YD2A 4O5KA 7ICKA 1TVAA 4KLSA 2BPFA 4PGQA 4NKUA 4QZ8A 3OUYB 5DDYA 2HHPA 4FHVA 8ICGA 4K4HA 4RT3A 4TUSA 8ICCA 4KLUA 5DEDA 5DBBA 1ZQIA 2I9GA 3JPTA 4RPYA 3V7JA 3HJ1A 7ICFA 3LQCB 3TFSA 7ICVA 4FO6A 4UBBA 1MIWA 3RJIA 4F5PA 2DR5A 1ZQCA 5CA7A 1VJ7A 4LZDA 4MF8A 3RH5A 9ICQA 4AT9A 2DR7A 1ZQPA 3OVSA 1MQ2A 4PHPA 5HRHA 4EBJA 5HRDA 4PGYA 5J0TA 4FHYA 1BPYA 1ZQFA 4YN4A 2ZHAA 2DVIA 9ICHA 1ZQZA 3JPRA 2M2VA 4WC5A 1ZQSA 4JWMA 5J2DA 4QZIA 7ICHA 1UETA 4GXKA 4NXZA 4I2DA 9ICAA 4QZGA 3GDXA 1MIYA 4RQ2A 5DDMA 4MFCA 5CWRA 4RWPA 4I2CA 4RQ5A 1HUZA 4I2IA 4R65A 1MIVA 8ICBA 5J0UA 9ICTA 4AT9B 4P4MA 7ICRA 4ATBA 9ICSA 1JAJA 1Q79A 4X4PA 8ICWA 1ZQYA 4XA5A 5IIMA 7ICMA 5J2IA 5HREA 4M2YA 2DRAA 3OGUA 4IG8A 4KLIA 1WOTA 5DBCA 1TFYA 1NO5A 4QZAA 1KDHA 4NY8A 4UD4A 3HIYA 2PFQA 3PMLA 4I2FA 4IQWA 3MBYA 4F5NA 4PPXA 8ICFA 4WC6A 4X4QA 4RPXA 4Z6DA 5J2AA 4XUSA 2BCUA 8ICEA 5HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLN A;  2O1P A;  5BOM A;  3HX0 A;  4XQ7 A;  2M2W A;  7ICU A;  3UQ2 A;  3JYY A;  5J0O A;  9ICE A;  1TFW A;  4AT8 B;  2PBE A;  7ICN A;  4X4N A;  4NLZ A;  4WC1 A;  5DB6 A;  4X0A A;  4R63 A;  2P66 A;  3MDC A;  3UXN A;  5DEC A;  3C2L A;  4X5V A;  5IIK A;  1ZQV A;  5BPC A;  4MFA A;  3AU2 A;  7ICG A;  2ZH7 A;  1ZQU A;  2PFO A;  4Z6C A;  4KLJ A;  3OVA A;  2ZH5 A;  1ZQL A;  4R64 A;  4KLM A;  1V4A A;  5IIL A;  4RWQ A;  4NM1 A;  5D4B A;  5J2E A;  4MF2 A;  3HWT A;  5J0P A;  3RJF A;  7ICQ A;  5IIN A;  4KLE A;  3MGI A;  2FMQ A;  3V72 A;  2ZH4 A;  1ZQJ A;  2O5A A;  4F5Q A;  5J2C A;  1R8B A;  4I2A A;  3RJE A;  1R8C A;  2ZHB A;  1HUO A;  4I2G A;  3PNC A;  3H37 A;  1XSL A;  4RT2 A;  4O5C A;  5HRK A;  3AU6 A;  3B0Y A;  3ISB A;  4FH5 A;  3NYB A;  5III A;  2DRB A;  7ICT A;  9ICJ A;  1ZQB A;  9ICF A;  9ICW A;  4UD5 A;  4X4U A;  8ICI A;  1ZJM A;  1NOM A;  3RJJ A;  2BCV A;  7ICE A;  3OVB A;  8ICQ A;  2BPC A;  5J2G A;  1KEJ A;  9ICX A;  5HR9 A;  4LZG A;  5J0Y A;  5J0Q A;  5HHH A;  9ICC A;  5J2F A;  3H3A A;  4M5D A;  1ZQA A;  5D49 A;  4P4P A;  4YMO A;  4S3N A;  2FMS A;  4WBZ A;  1BPB A;  5CHG A;  1UEU A;  3HJ4 A;  1XSP A;  4PGX A;  4KLQ A;  3C2K A;  3HW8 A;  4WC7 A;  4LVS A;  1ZQH A;  3RH4 A;  1ZQG A;  4QZF A;  4QZD A;  4M9N A;  4WC0 A;  9ICL A;  4AT8 A;  5HRG A;  4M47 A;  4KLD A;  4AT7 B;  4QZE A;  3RJH A;  3MGH A;  1F5A A;  4M9J A;  1VFG A;  1BPD A;  3JPN A;  3WFR E;  4EP7 A;  4UB1 A;  4E7X A;  4PH5 A;  8ICU A;  9ICU A;  8ICM A;  7ICJ A;  5HRL A;  3UQ0 A;  3H39 A;  4WCW A;  1JN3 A;  3OV7 A;  4GXI A;  1ZQR A;  4P2H A;  2BCR A;  4M04 A;  5DB7 A;  3JPQ A;  3K75 D;  3AUO A;  5CR0 A;  1ZQO A;  4EBK A;  3ISC A;  5J2J A;  1RPL A;  8ICT A;  4WBY A;  1ZJN A;  4M0A A;  3JPO A;  4O5E A;  3AQL A;  3RJK A;  4Z6F A;  1R89 A;  4M9H A;  4WC4 A;  1ZQD A;  1BPZ A;  2ZH8 A;  4YD1 A;  8ICZ A;  3L9D A;  1FA0 A;  5CJ7 A;  4RQ6 A;  2BCS A;  2ISP A;  9ICR A;  5DB8 A;  4QZC A;  3JPS A;  2PFN A;  3TFR A;  4O9M A;  8ICY A;  4UB4 A;  4KLH A;  1Q78 A;  4M9L A;  4KLG A;  4X4S A;  4NLK A;  9ICK A;  5CP2 A;  4RWO A;  1TV9 A;  4RQ4 A;  7ICI A;  1YLQ A;  9ICP A;  4I2H A;  4AT7 A;  4X4V A;  5J0R A;  1MQ3 A;  1ZQK A;  5J0X A;  4K4I A;  4TUQ A;  4KLF A;  3MDA A;  1ZQM A;  3AQN A;  4LT6 A;  1JMS A;  2IHM A;  5D46 A;  7ICL A;  1ZQW A;  3WFO A;  5J29 A;  4FHX A;  5HRI A;  4UBC A;  2BCQ A;  8ICJ A;  4RQ8 A;  4DOA A;  4PHD A;  2RFF A;  3C5F A;  9ICV A;  1BPE A;  3V7K A;  8ICH A;  4RQ0 A;  1XSN A;  4UB5 A;  8ICN A;  4I27 A;  4QZH A;  4XQ8 A;  4TUR A;  5J2B A;  3LK9 A;  4NKT A;  3V7L A;  9ICI A;  4I29 A;  4KLT A;  4RWN A;  4E80 A;  1ZQN A;  3RH6 A;  4M9G A;  2FMP A;  5HC9 A;  7ICP A;  2ISO A;  1ZQX A;  4I2J A;  4NM2 A;  3UPQ A;  4PHA A;  5HRF A;  3WFQ E;  5DBA A;  4ATB B;  4I2E A;  3JPP A;  7ICS A;  4Z6E A;  3RJG A;  2NRK A;  2PFP A;  2M2T A;  4JWN A;  1R8A A;  3UXP A;  2M2U A;  4QZ9 A;  8ICL A;  4X4R A;  4RQ1 A;  4RPZ A;  1PX5 A;  9ICO A;  2DR8 A;  2DR9 A;  8ICV A;  4FH3 A;  2VAN A;  4RQ3 A;  4UAW A;  2GWS A;  4GXJ A;  4F5R A;  4WC3 A;  9ICG A;  9ICM A;  2Q66 A;  2ZH9 A;  4X4O A;  5IIJ A;  4X4T A;  1RZT A;  4UAY A;  4YMM A;  3WFP A;  5BOL A;  2BPG A;  9ICN A;  1KNY A;  4UAZ A;  2ZH1 A;  4WC2 A;  2ID1 A;  5J0W A;  8ICK A;  3H38 A;  1ZQQ A;  3OUY A;  5EOZ A;  3C66 A;  5IIO A;  4KLO A;  4E8F A;  5F2V O;  8ICS A;  1UEV A;  8ICA A;  5J0S A;  3UXO A;  3AQK A;  2W9M A;  3B0X A;  4IQV A;  1ZQT A;  4MFF A;  4YCX A;  3PMN A;  3WFS C;  4DOC A;  3JZ0 A;  4I28 A;  3C5G A;  3AQM A;  5TZV A;  8ICP A;  8ICX A;  5HRB A;  4QZB A;  8ICO A;  2BE3 A;  2ZH2 A;  1BPX A;  4TUP A;  9ICB A;  4UB2 A;  4FHP A;  5DKW A;  4X0B A;  4YMN A;  5J2K A;  4XRH A;  4IQT A;  4I2B A;  5DB9 A;  8ICR A;  2PXI A;  4K4G A;  4R66 A;  1ZQE A;  5J2H A;  4KLL A;  3ISD A;  7ICO A;  4RQ7 A;  3C2M A;  1JQR A;  2ZH6 A;  4DO9 A;  3UPS A;  2ZH3 A;  4F5O A;  1OU5 A;  4FHW A;  4IQU A;  4UB3 A;  5CB1 A;  3C18 A;  4DOB A;  4PHE A;  4P4O A;  4YD2 A;  4O5K A;  7ICK A;  1TVA A;  4KLS A;  2BPF A;  4PGQ A;  4NKU A;  4QZ8 A;  3OUY B;  5DDY A;  2HHP A;  4FHV A;  8ICG A;  4K4H A;  4RT3 A;  4TUS A;  8ICC A;  4KLU A;  5DED A;  5DBB A;  1ZQI A;  2I9G A;  3JPT A;  4RPY A;  3V7J A;  3HJ1 A;  7ICF A;  3LQC B;  3TFS A;  7ICV A;  4FO6 A;  4UBB A;  1MIW A;  3RJI A;  4F5P A;  2DR5 A;  1ZQC A;  5CA7 A;  1VJ7 A;  4LZD A;  4MF8 A;  3RH5 A;  9ICQ A;  4AT9 A;  2DR7 A;  1ZQP A;  3OVS A;  1MQ2 A;  4PHP A;  5HRH A;  4EBJ A;  5HRD A;  4PGY A;  5J0T A;  4FHY A;  1BPY A;  1ZQF A;  4YN4 A;  2ZHA A;  2DVI A;  9ICH A;  1ZQZ A;  3JPR A;  2M2V A;  4WC5 A;  1ZQS A;  4JWM A;  5J2D A;  4QZI A;  7ICH A;  1UET A;  4GXK A;  4NXZ A;  4I2D A;  9ICA A;  4QZG A;  3GDX A;  1MIY A;  4RQ2 A;  5DDM A;  4MFC A;  5CWR A;  4RWP A;  4I2C A;  4RQ5 A;  1HUZ A;  4I2I A;  4R65 A;  1MIV A;  8ICB A;  5J0U A;  9ICT A;  4AT9 B;  4P4M A;  7ICR A;  4ATB A;  9ICS A;  1JAJ A;  1Q79 A;  4X4P A;  8ICW A;  1ZQY A;  4XA5 A;  5IIM A;  7ICM A;  5J2I A;  5HRE A;  4M2Y A;  2DRA A;  3OGU A;  4IG8 A;  4KLI A;  1WOT A;  5DBC A;  1TFY A;  1NO5 A;  4QZA A;  1KDH A;  4NY8 A;  4UD4 A;  3HIY A;  2PFQ A;  3PML A;  4I2F A;  4IQW A;  3MBY A;  4F5N A;  4PPX A;  8ICF A;  4WC6 A;  4X4Q A;  4RPX A;  4Z6D A;  5J2A A;  4XUS A;  2BCU A;  8ICE A;  5HHI A; 
#chains in the Genus database with same CATH topology
 4NLN A;  2O1P A;  5BOM A;  3HX0 A;  4XQ7 A;  4NXT A;  2M2W A;  7ICU A;  3UQ2 A;  3JYY A;  5J0O A;  9ICE A;  1TFW A;  4AT8 B;  2PBE A;  7ICN A;  4X4N A;  4NLZ A;  4WC1 A;  5DB6 A;  4X0A A;  4R63 A;  2P66 A;  3MDC A;  3UXN A;  5DEC A;  3C2L A;  4X5V A;  5IIK A;  1ZQV A;  5BPC A;  4MFA A;  3AU2 A;  3NVO A;  5CHE A;  7ICG A;  2ZH7 A;  1ZQU A;  2PFO A;  4Z6C A;  4KLJ A;  3OVA A;  2ZH5 A;  1ZQL A;  4R64 A;  4KLM A;  1V4A A;  5IIL A;  4RWQ A;  4NM1 A;  5D4B A;  5J2E A;  4MF2 A;  3HWT A;  5J0P A;  3RJF A;  2IHO A;  7ICQ A;  4NXV A;  5IIN A;  4KLE A;  3MGI A;  4O68 A;  2FMQ A;  3V72 A;  2ZH4 A;  1ZQJ A;  2O5A A;  4F5Q A;  5J2C A;  5CFU A;  1R8B A;  4I2A A;  2GA9 D;  3RJE A;  1R8C A;  2ZHB A;  1HUO A;  4I2G A;  3PNC A;  3H37 A;  2B51 A;  1XSL A;  4RT2 A;  4O5C A;  5HRK A;  3AU6 A;  3B0Y A;  3ISB A;  4FH5 A;  3NYB A;  5III A;  2DRB A;  7ICT A;  9ICJ A;  1ZQB A;  9ICF A;  9ICW A;  4UD5 A;  4X4U A;  8ICI A;  1ZJM A;  1NOM A;  2EWR A;  5JTG A;  3RJJ A;  4K96 A;  2BCV A;  7ICE A;  3OVB A;  8ICQ A;  2BPC A;  3OWG A;  4I0U A;  5J2G A;  2BBH A;  1KEJ A;  4LEY A;  9ICX A;  5HR9 A;  4LZG A;  2IUB A;  5J0Y A;  5J0Q A;  5HHH A;  4XJE A;  9ICC A;  2HN1 A;  3H3A A;  5J2F A;  4M5D A;  1ZQA A;  5D49 A;  4P4P A;  4YMO A;  4S3N A;  2FMS A;  4WBZ A;  1BPB A;  5CHG A;  1UEU A;  3HJ4 A;  1XSP A;  4PGX A;  4KLQ A;  4NXW A;  3C2K A;  4OAI Z;  3HW8 A;  4WC7 A;  4LVS A;  1ZQH A;  3RH4 A;  1ZQG A;  4QZF A;  4QZD A;  4M9N A;  4WH5 A;  4WC0 A;  9ICL A;  4AT8 A;  3PHZ A;  5HRG A;  4M47 A;  4EED A;  3EF2 A;  4AT7 B;  4QZE A;  4KLD A;  2B4V A;  3MGH A;  3RJH A;  1F5A A;  3CK6 A;  3MCR A;  1VFG A;  1BPD A;  3JPN A;  3WFR E;  4M9J A;  4NXX A;  4EP7 A;  4UB1 A;  4E7X A;  4PH5 A;  8ICU A;  9ICU A;  5D62 A;  8ICM A;  7ICJ A;  5HRL A;  3UQ0 A;  3H39 A;  4WCW A;  1JN3 A;  3OV7 A;  4GXI A;  1ZQR A;  4P2H A;  3K7D A;  2BCR A;  4M04 A;  5DB7 A;  3JPQ A;  3K75 D;  3AUO A;  5CR0 A;  1ZQO A;  4EBK A;  3ISC A;  5J2J A;  1RPL A;  8ICT A;  4WQL A;  4WBY A;  4N7R A;  1ZJN A;  4K9B A;  4M0A A;  3JPO A;  4JLX A;  4O5E A;  3AQL A;  3RJK A;  4Z6F A;  1R89 A;  4M9H A;  4WC4 A;  1ZQD A;  1BPZ A;  2ZH8 A;  4YD1 A;  8ICZ A;  3L9D A;  1FA0 A;  5CJ7 A;  4RQ6 A;  2BCS A;  2ISP A;  9ICR A;  5DB8 A;  4QZC A;  3JPS A;  2PFN A;  3TFR A;  4O9M A;  8ICY A;  4UB4 A;  4KLH A;  1Q78 A;  4M9L A;  4KLG A;  4X4S A;  4NLK A;  9ICK A;  5CP2 A;  4RWO A;  4JLZ A;  1TV9 A;  4RQ4 A;  7ICI A;  1YLQ A;  9ICP A;  4I2H A;  4AT7 A;  4X4V A;  5J0R A;  1MQ3 A;  1ZQK A;  5J0X A;  4K4I A;  4TUQ A;  4KLF A;  3MDA A;  1ZQM A;  3AQN A;  4LT6 A;  1JMS A;  2IHM A;  5D46 A;  7ICL A;  1ZQW A;  5J29 A;  4FO1 A;  3WFO A;  4FHX A;  5HRI A;  4UBC A;  2BCQ A;  8ICJ A;  4RQ8 A;  2BBJ A;  4DOA A;  4PHD A;  2RFF A;  3C5F A;  9ICV A;  1BPE A;  3V7K A;  4K9A A;  8ICH A;  4RQ0 A;  1XSN A;  4UB5 A;  8ICN A;  4I27 A;  4QZH A;  4XQ8 A;  4OAH A;  4TUR A;  5J2B A;  2GAF D;  3LK9 A;  4NKT A;  3V7L A;  5B3Q A;  9ICI A;  4I29 A;  4KLT A;  4RWN A;  4E80 A;  1ZQN A;  3RH6 A;  4M9G A;  2FMP A;  5HC9 A;  7ICP A;  2ISO A;  1ZQX A;  4I2J A;  4NM2 A;  3UPQ A;  4O67 A;  4PHA A;  5HRF A;  3WFQ E;  5DBA A;  4ATB B;  4I2E A;  3JPP A;  4LEW A;  3JCF A;  7ICS A;  4Z6E A;  3RJG A;  2NRK A;  2PFP A;  2M2T A;  4JWN A;  1R8A A;  3UXP A;  2M2U A;  4QZ9 A;  8ICL A;  4X4R A;  4RQ1 A;  4RPZ A;  1PX5 A;  4EV6 A;  9ICO A;  2DR8 A;  2DR9 A;  8ICV A;  4FH3 A;  2VAN A;  4RQ3 A;  1GPJ A;  4UAW A;  2GWS A;  4KM5 A;  4GXJ A;  4F5R A;  4WC3 A;  4K97 A;  9ICM A;  9ICG A;  2Q66 A;  2ZH9 A;  4X4O A;  5IIJ A;  4X4T A;  1RZT A;  3NKU A;  4UAY A;  4YMM A;  3WFP A;  5BOL A;  2BPG A;  9ICN A;  1KNY A;  4UAZ A;  2ZH1 A;  4WC2 A;  2ID1 A;  5J0W A;  8ICK A;  3H38 A;  1ZQQ A;  3OUY A;  5EOZ A;  3C66 A;  4NXU A;  5IIO A;  4KLO A;  4E8F A;  5F2V O;  8ICS A;  1UEV A;  8ICA A;  5J0S A;  3UXO A;  3AQK A;  2W9M A;  3B0X A;  4IQV A;  1ZQT A;  4MFF A;  4YCX A;  3PMN A;  3WFS C;  4DOC A;  3JZ0 A;  4I28 A;  3C5G A;  3AQM A;  5TZV A;  8ICP A;  8ICX A;  5HRB A;  4O6A A;  4QZB A;  8ICO A;  2BE3 A;  2ZH2 A;  1BPX A;  4TUP A;  9ICB A;  4UB2 A;  4FHP A;  4MKP A;  5DKW A;  4X0B A;  4YMN A;  5J2K A;  4XRH A;  4IQT A;  4I2B A;  5DB9 A;  8ICR A;  2PXI A;  4K4G A;  4R66 A;  1ZQE A;  5J2H A;  4KLL A;  3ISD A;  7ICO A;  4RQ7 A;  3C2M A;  1JQR A;  5D63 A;  3NWI A;  2ZH6 A;  4DO9 A;  3UPS A;  2ZH3 A;  4F5O A;  1OU5 A;  4FHW A;  4IQU A;  4UB3 A;  5CB1 A;  3C18 A;  4DOB A;  4PHE A;  4P4O A;  4YD2 A;  4O5K A;  7ICK A;  1TVA A;  4KLS A;  2BPF A;  4PGQ A;  4NKU A;  4QZ8 A;  3OUY B;  5DDY A;  2HHP A;  4FHV A;  8ICG A;  4K4H A;  4RT3 A;  4TUS A;  8ICC A;  4KLU A;  5DED A;  5DBB A;  1ZQI A;  4O69 A;  2I9G A;  3JPT A;  4RPY A;  3V7J A;  3HJ1 A;  7ICF A;  3LQC B;  3TFS A;  7ICV A;  2B56 A;  4FO6 A;  4UBB A;  1MIW A;  3RJI A;  4F5P A;  2DR5 A;  4EGW A;  1ZQC A;  5CA7 A;  1VJ7 A;  4LZD A;  3ER9 B;  4MF8 A;  3RH5 A;  9ICQ A;  5B3P A;  4AT9 A;  2DR7 A;  1ZQP A;  3OVS A;  1MQ2 A;  3ERC C;  4PHP A;  5HRH A;  4EBJ A;  4HX0 A;  4EEB A;  4PGY A;  5HRD A;  5J0T A;  4FHY A;  1BPY A;  1ZQF A;  4YN4 A;  2ZHA A;  2DVI A;  9ICH A;  1ZQZ A;  3JPR A;  2M2V A;  4WC5 A;  4K8V A;  1ZQS A;  4JWM A;  5J2D A;  4QZI A;  7ICH A;  1UET A;  4GXK A;  4NXZ A;  4I2D A;  9ICA A;  5CFT A;  4QZG A;  3GDX A;  1MIY A;  4RQ2 A;  5DDM A;  4MFC A;  4LEV A;  5CWR A;  4RWP A;  4I2C A;  4RQ5 A;  1HUZ A;  2FCL A;  4I2I A;  4R65 A;  1MIV A;  8ICB A;  5J0U A;  9ICT A;  4AT9 B;  4P4M A;  7ICR A;  4K98 A;  4ATB A;  9ICS A;  1JAJ A;  1Q79 A;  4KB6 A;  4X4P A;  4WQK A;  8ICW A;  1ZQY A;  5D61 A;  4XA5 A;  5IIM A;  7ICM A;  4OAG A;  5J2I A;  5HRE A;  4M2Y A;  2DRA A;  3OGU A;  4IG8 A;  4KLI A;  1WOT A;  5DBC A;  1TFY A;  1NO5 A;  4QZA A;  1KDH A;  4NY8 A;  4UD4 A;  3HIY A;  2PFQ A;  3PML A;  2HN2 A;  4K99 A;  4I2F A;  4IQW A;  3MBY A;  5CFS A;  4F5N A;  4LEZ A;  4PPX A;  4WOY A;  8ICF A;  4WC6 A;  4OAF A;  3ER8 C;  4X4Q A;  4RPX A;  4Z6D A;  5J2A A;  4XUS A;  2BCU A;  8ICE A;  5HHI A; 
#chains in the Genus database with same CATH homology
 4NLN A;  2O1P A;  5BOM A;  3HX0 A;  4XQ7 A;  2M2W A;  7ICU A;  3UQ2 A;  3JYY A;  5J0O A;  9ICE A;  1TFW A;  4AT8 B;  2PBE A;  7ICN A;  4X4N A;  4NLZ A;  4WC1 A;  5DB6 A;  4X0A A;  4R63 A;  2P66 A;  3MDC A;  3UXN A;  5DEC A;  3C2L A;  4X5V A;  5IIK A;  1ZQV A;  5BPC A;  4MFA A;  3AU2 A;  7ICG A;  2ZH7 A;  1ZQU A;  2PFO A;  4Z6C A;  4KLJ A;  3OVA A;  2ZH5 A;  1ZQL A;  4R64 A;  4KLM A;  1V4A A;  5IIL A;  4RWQ A;  4NM1 A;  5D4B A;  5J2E A;  4MF2 A;  3HWT A;  5J0P A;  3RJF A;  7ICQ A;  5IIN A;  4KLE A;  3MGI A;  2FMQ A;  3V72 A;  2ZH4 A;  1ZQJ A;  2O5A A;  4F5Q A;  5J2C A;  1R8B A;  4I2A A;  3RJE A;  1R8C A;  2ZHB A;  1HUO A;  4I2G A;  3PNC A;  3H37 A;  1XSL A;  4RT2 A;  4O5C A;  5HRK A;  3AU6 A;  3B0Y A;  3ISB A;  4FH5 A;  3NYB A;  5III A;  2DRB A;  7ICT A;  9ICJ A;  1ZQB A;  9ICF A;  9ICW A;  4UD5 A;  4X4U A;  8ICI A;  1ZJM A;  1NOM A;  3RJJ A;  2BCV A;  7ICE A;  3OVB A;  8ICQ A;  2BPC A;  5J2G A;  1KEJ A;  9ICX A;  5HR9 A;  4LZG A;  5J0Y A;  5J0Q A;  5HHH A;  9ICC A;  5J2F A;  3H3A A;  4M5D A;  1ZQA A;  5D49 A;  4P4P A;  4YMO A;  4S3N A;  2FMS A;  4WBZ A;  1BPB A;  5CHG A;  1UEU A;  3HJ4 A;  1XSP A;  4PGX A;  4KLQ A;  3C2K A;  3HW8 A;  4WC7 A;  4LVS A;  1ZQH A;  3RH4 A;  1ZQG A;  4QZF A;  4QZD A;  4M9N A;  4WC0 A;  9ICL A;  4AT8 A;  5HRG A;  4M47 A;  4KLD A;  4AT7 B;  4QZE A;  3RJH A;  3MGH A;  1F5A A;  4M9J A;  1VFG A;  1BPD A;  3JPN A;  3WFR E;  4EP7 A;  4UB1 A;  4E7X A;  4PH5 A;  8ICU A;  9ICU A;  8ICM A;  7ICJ A;  5HRL A;  3UQ0 A;  3H39 A;  4WCW A;  1JN3 A;  3OV7 A;  4GXI A;  1ZQR A;  4P2H A;  2BCR A;  4M04 A;  5DB7 A;  3JPQ A;  3K75 D;  3AUO A;  5CR0 A;  1ZQO A;  4EBK A;  3ISC A;  5J2J A;  1RPL A;  8ICT A;  4WBY A;  1ZJN A;  4M0A A;  3JPO A;  4O5E A;  3AQL A;  3RJK A;  4Z6F A;  1R89 A;  4M9H A;  4WC4 A;  1ZQD A;  1BPZ A;  2ZH8 A;  4YD1 A;  8ICZ A;  3L9D A;  1FA0 A;  5CJ7 A;  4RQ6 A;  2BCS A;  2ISP A;  9ICR A;  5DB8 A;  4QZC A;  3JPS A;  2PFN A;  3TFR A;  4O9M A;  8ICY A;  4UB4 A;  4KLH A;  1Q78 A;  4M9L A;  4KLG A;  4X4S A;  4NLK A;  9ICK A;  5CP2 A;  4RWO A;  1TV9 A;  4RQ4 A;  7ICI A;  1YLQ A;  9ICP A;  4I2H A;  4AT7 A;  4X4V A;  5J0R A;  1MQ3 A;  1ZQK A;  5J0X A;  4K4I A;  4TUQ A;  4KLF A;  3MDA A;  1ZQM A;  3AQN A;  4LT6 A;  1JMS A;  2IHM A;  5D46 A;  7ICL A;  1ZQW A;  3WFO A;  5J29 A;  4FHX A;  5HRI A;  4UBC A;  2BCQ A;  8ICJ A;  4RQ8 A;  4DOA A;  4PHD A;  2RFF A;  3C5F A;  9ICV A;  1BPE A;  3V7K A;  8ICH A;  4RQ0 A;  1XSN A;  4UB5 A;  8ICN A;  4I27 A;  4QZH A;  4XQ8 A;  4TUR A;  5J2B A;  3LK9 A;  4NKT A;  3V7L A;  9ICI A;  4I29 A;  4KLT A;  4RWN A;  4E80 A;  1ZQN A;  3RH6 A;  4M9G A;  2FMP A;  5HC9 A;  7ICP A;  2ISO A;  1ZQX A;  4I2J A;  4NM2 A;  3UPQ A;  4PHA A;  5HRF A;  3WFQ E;  5DBA A;  4ATB B;  4I2E A;  3JPP A;  7ICS A;  4Z6E A;  3RJG A;  2NRK A;  2PFP A;  2M2T A;  4JWN A;  1R8A A;  3UXP A;  2M2U A;  4QZ9 A;  8ICL A;  4X4R A;  4RQ1 A;  4RPZ A;  1PX5 A;  9ICO A;  2DR8 A;  2DR9 A;  8ICV A;  4FH3 A;  2VAN A;  4RQ3 A;  4UAW A;  2GWS A;  4GXJ A;  4F5R A;  4WC3 A;  9ICG A;  9ICM A;  2Q66 A;  2ZH9 A;  4X4O A;  5IIJ A;  4X4T A;  1RZT A;  4UAY A;  4YMM A;  3WFP A;  5BOL A;  2BPG A;  9ICN A;  1KNY A;  4UAZ A;  2ZH1 A;  4WC2 A;  2ID1 A;  5J0W A;  8ICK A;  3H38 A;  1ZQQ A;  3OUY A;  5EOZ A;  3C66 A;  5IIO A;  4KLO A;  4E8F A;  5F2V O;  8ICS A;  1UEV A;  8ICA A;  5J0S A;  3UXO A;  3AQK A;  2W9M A;  3B0X A;  4IQV A;  1ZQT A;  4MFF A;  4YCX A;  3PMN A;  3WFS C;  4DOC A;  3JZ0 A;  4I28 A;  3C5G A;  3AQM A;  5TZV A;  8ICP A;  8ICX A;  5HRB A;  4QZB A;  8ICO A;  2BE3 A;  2ZH2 A;  1BPX A;  4TUP A;  9ICB A;  4UB2 A;  4FHP A;  5DKW A;  4X0B A;  4YMN A;  5J2K A;  4XRH A;  4IQT A;  4I2B A;  5DB9 A;  8ICR A;  2PXI A;  4K4G A;  4R66 A;  1ZQE A;  5J2H A;  4KLL A;  3ISD A;  7ICO A;  4RQ7 A;  3C2M A;  1JQR A;  2ZH6 A;  4DO9 A;  3UPS A;  2ZH3 A;  4F5O A;  1OU5 A;  4FHW A;  4IQU A;  4UB3 A;  5CB1 A;  3C18 A;  4DOB A;  4PHE A;  4P4O A;  4YD2 A;  4O5K A;  7ICK A;  1TVA A;  4KLS A;  2BPF A;  4PGQ A;  4NKU A;  4QZ8 A;  3OUY B;  5DDY A;  2HHP A;  4FHV A;  8ICG A;  4K4H A;  4RT3 A;  4TUS A;  8ICC A;  4KLU A;  5DED A;  5DBB A;  1ZQI A;  2I9G A;  3JPT A;  4RPY A;  3V7J A;  3HJ1 A;  7ICF A;  3LQC B;  3TFS A;  7ICV A;  4FO6 A;  4UBB A;  1MIW A;  3RJI A;  4F5P A;  2DR5 A;  1ZQC A;  5CA7 A;  1VJ7 A;  4LZD A;  4MF8 A;  3RH5 A;  9ICQ A;  4AT9 A;  2DR7 A;  1ZQP A;  3OVS A;  1MQ2 A;  4PHP A;  5HRH A;  4EBJ A;  5HRD A;  4PGY A;  5J0T A;  4FHY A;  1BPY A;  1ZQF A;  4YN4 A;  2ZHA A;  2DVI A;  9ICH A;  1ZQZ A;  3JPR A;  2M2V A;  4WC5 A;  1ZQS A;  4JWM A;  5J2D A;  4QZI A;  7ICH A;  1UET A;  4GXK A;  4NXZ A;  4I2D A;  9ICA A;  4QZG A;  3GDX A;  1MIY A;  4RQ2 A;  5DDM A;  4MFC A;  5CWR A;  4RWP A;  4I2C A;  4RQ5 A;  1HUZ A;  4I2I A;  4R65 A;  1MIV A;  8ICB A;  5J0U A;  9ICT A;  4AT9 B;  4P4M A;  7ICR A;  4ATB A;  9ICS A;  1JAJ A;  1Q79 A;  4X4P A;  8ICW A;  1ZQY A;  4XA5 A;  5IIM A;  7ICM A;  5J2I A;  5HRE A;  4M2Y A;  2DRA A;  3OGU A;  4IG8 A;  4KLI A;  1WOT A;  5DBC A;  1TFY A;  1NO5 A;  4QZA A;  1KDH A;  4NY8 A;  4UD4 A;  3HIY A;  2PFQ A;  3PML A;  4I2F A;  4IQW A;  3MBY A;  4F5N A;  4PPX A;  8ICF A;  4WC6 A;  4X4Q A;  4RPX A;  4Z6D A;  5J2A A;  4XUS A;  2BCU A;  8ICE A;  5HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...